2W1SA

Unique ligand binding specificity of a family 32 carbohydrate-binding module from the mu toxin produced by clostridium perfringens
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
139
structure length
139
Chain Sequence
b'NPSLIRSESWQVYEGNEANLLDGDDNTGVWYKTLNGDTSLAGEFIGLDLGKEIKLDGIRFVIGKNGGGSSDKWNKFKLEYSLDNESWTTIKEYDKTGAPAGKDVIEESFETPISAKYIRLTNMENINKWLTFSEFAIVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HYALURONOGLUCOSAMINIDASE
publication title N-Acetylglucosamine Recognition by a Family 32 Carbohydrate-Binding Module from Clostridium Perfringens Nagh.
pubmed doi rcsb
source organism Clostridium perfringens
molecule tags Hydrolase
total genus 35
structure length 139
sequence length 139
chains with identical sequence B
ec nomenclature ec 3.2.1.35: Hyaluronoglucosaminidase.
pdb deposition date 2008-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2w1sA00
5C71A 4E8DA 1F4AA 2ZEWA 3NQHA 3IB3A 1JZ2A 4BK4A 3K46A 2E33A 4AAXA 5JMOA 4IUGA 1W9SA 3LPFA 2CDOA 4CU9A 3LEGA 1UXXX 2W3JA 4QX1A 1JZ6A 2W92A 1JYVA 5JXGA 1JZ7A 1IQDC 4RN5A 2Z4FA 3HNBM 4DUVA 1NAEA 3C7EA 4AG4A 2VZRA 3THCA 2BZDA 3ACGA 2VCAA 5EJZB 5LCWL 2RVAA 3OEBA 3NNGA 1OT5A 3I2GA 3P6BA 1O8PA 3WNPA 4PT6A 5LA0A 2VJXA 4KWUA 1TVGA 2J1VA 2ZEZA 2VZSA 4XUTA 5J1XA 2RV9A 3I3BA 3DYMA 2VZQA 4YPJA 1UYZA 3WNOA 1GQPA 2DCKA 3GDBA 2CDPA 5LA1A 2Y6GA 4OZOA 3I3DA 2W94A 2VZPA 1P8JA 2Y6JA 3A7QA 3K75B 1F4HA 2QQMA 4OYUA 4XUNA 3C8XA 3WF1A 2VTFA 2VCCA 2E32A 1YQ2A 2VMEA 1CX1A 2RJ2A 2J1AA 2VCBA 3DYOA 1O59A 3EB7A 3MBWA 3T09A 3SKVA 5DN2A 2X09A 5IHRA 4W50A 2WAOA 3ACHA 3IIIA 4LQRA 4CU6A 4A4AA 2KD7A 4ARYA 2YC2A 4P02B 3A23A 3CDZB 3FL7A 3LE0A 2QQOA 4A6OA 3SEPA 5EIYB 1T2XA 3I2JA 3IDAA 2V4VA 5HPOA 2J7MA 3C7FA 3NJVA 1NX9A 2WO2A 3CMGA 1PX4A 3K4AA 2VMDA 1UY1A 3SKJE 4A3ZA 4OUEA 3DYPA 1GUIA 2WABA 1MPXA 2BGPA 1GOFA 4DEVA 1OD3A 2C9KA 1I5PA 5F7UA 3THDA 2YFZA 4JKMA 4MADA 5JR2A 2WN2A 4A42A 4M4RA 3SEEA 2V5DA 1UY2A 1K12A 2W9XA 2XHNA 3VDBA 1HN1A 2ZEXA 3W5NA 2EICA 1OF4A 1XC6A 5JUVA 4KMQA 1K3IA 4MGQA 3HEIA 5JXIA 2WO1A 2WBKA 1JZ8A 1WCQA 4GZ9A 2J1EA 3K4ZA 4TTGA 4FI9A 1J84A 2V72A 2QQLA 4DUWA 4ZZ8A 2W47A 3VDAA 3T0BA 3VDCA 1LNSA 1UY0A 3WF2A 1PMHX 1GMMA 2PQSA 5IFPA 3WNKA 1XPWA 1SDDB 2VZUA 2QQJA 2YB7A 1R64A 3OGVA 2W1WA 4GWJA 1TG7A 3OGRA 4CU8A 2VMFA 1KEXA 2VO5A 2XONA 1DLCA 4W8JA 4QDQA 4BDVB 3ZM8A 2XQXA 1CZSA 2QQKA 4JKLA 5DPNA 1JYNA 1KGYA 3DECA 4DUXA 3LQCA 4MOAA 2BGOA 2L9LA 1JHJA 4UI9L 3NRUA 5C70A 2W1QA 2Y8KA 3C7OA 4A44A 2QQIA 3LEKA 4QDSA 5CZKA 2VC9A 3T2OA 5JXHA 4W4ZA 1H6XA 5JXJA 2EIEA 4UAPA 1UXZA 3HOBA 1O8SA 2BBAA 3WF3A 1ULPA 2HYXA 4LHSA 1ULOA 4HG6B 1GOHA 2QBXA 3P1IA 1EUTA 4QX0A 3VD7A 4QX3A 3W5MA 3ABZA 3CZJA 1W8NA 3J7HA 3WNNA 3E1F1 4ARXA 3PUHA 4PF1A 2YFUA 2E26A 2J1UA 2VMCA 3OBAA 4DXRA 4BXSV 4BJ0A 1UYYA 1BHGA 3I2HA 3ACFA 4BK5A 4DEQA 4CU7A 3CQOA 4XVHA 4XUOA 1SHWB 3U37A 2Y64A 3UETA 3T08A 2ZEYA 2X05A 4PQQA 5FUIA 2W87A 1J83A 4TXWA 3FHQA 5G04L 4L0PA 5I0DA 2XOMA 2VZ3A 3UESA 3VD9A 3LPGA 1D7PM 1SG3A 2W1SA 4UOJA 2EIBA 4A45A 1WKYA 4D0QA 1W9TA 1XNAA 1UWWA 3JXSA 3AC0A 2C26A 4ZXEA 2VL4A 3IAPA 4ET7A 2R7EB 3MO4A 4QDRA 1CIYA 4ZZ5A 2JD9A 5IYYA 2VQTA 3HPNA 3VD3A 1RYYA 2WYSA 2JE8A 2W46A 4MO3M 3GGLA 1OF3A 3OG2A 3T0DA 1NUKA 3MUZ1 3GM8A 3D3AA 4JX0A 3ECQA 4P08A 5LA2A 1UZ0A 2E31A 2W5FA 4CUCA 1GOGA 2W95A 1XNTA 3BN6A 1JZ5A 5B4XA 5A1AA 2ORXA 4RYDA 2BERA 3FN9A 1CZVA 2C4XA 2W1UA 1UMHA 3K77A 3UNPA 2B9VA 2J22A 3C7GA 3WSOA 1NKGA 3HNYM 4JKKA 1JZ4A 2Y6KA 3OGSA 5IJRA 4KI5M 3BGAA 3ACIA 2WN3A 3I2IA 2VZTA 3WF4A 4CUBA 1OH4A 3WEZA 1L7QA 5HXMA 2WQ8A 1JU4A 1US3A 1CZTA 1GU3A 2WDBA 3WNLA 3I2KA 5CYYA 4QAWA 2WUHA 1EUUA 4XURA 2J1RA 2EIDA 3VD4A 1H6YA 4ZY9A 4QB6A 1W99A 4XZUG 4CVUA 1UY3A 2DCJA 3GXUA 2LS6A 5DMYA 2Y6HA 2WZ8A 4XUQA 1GNYA 1DYOA 2JKXA 3CIHA 5DQ0A 4LKSA 3A21A 1L7RA 1K42A 3T2PA 3A22A 3HJRA 2VZ1A 2LW8A 4DXTA 2W91A 3OB8A 3WQBA 4Z2AA 3EYPA 2OKXA 3WNMA 1JYXA 3MV01 2VZOA 1W0NA 4MGSA 2VQUA 3CKHA 1DP0A 4QX2A 3ETPA 4GWIA 1UY4A 1W9WA 2YG0A 3T0AA 2X10A 4QB1A 2VR4A 1PX3A 5G05L 5IFTA 4E8CA 2ZXQA 4D8MA 1JZ3A 3PUIA 1US2A 2VOTA 4XUPA 1W8OA 2VZVA 1JYWA 3K4DA 4CUAA 2ID4A 2WZEA 1UMIA 2HLEA 3FHAA 2VM9A 3IAQA 2WAAA 2YC4A 1JU3A 3LEIA 4P00B 5EJ1B 1K45A 3HN3A 1UX7A 2QQNA 1JI6A 4QB2A 2J1TA 4A41A 4OMCA 3F2ZA 4QPWA 3VD5A 2JDAA 2Y6LA 3OEAA 2WO3A 1PMJX 2ORZA 3HNMA 3MUY1 2DDUA 5B4NA 3MV11 2B4KA 4LPLA 1UYXA 5C7GA 3I2FA 4P5YA 3WF0A 3T2QA 3CZUA 4JHZA 4OMDA 3NJXA 3I97A 4M4PA 2J1SA 4DXSA 3C7HA 3I3EA
chains in the Genus database with same CATH superfamily
1RUJ3 3AYAA 1QJX3 5FPLA 1BEV2 2JD4A 4QPGB 5FYUA 1FATA 3LWCA 3U0ZA 1F4AA 2ZEWA 3KT4A 1YCIA 1ZZBA 3S7IA 3M4FA 3T4HB 1JZ2A 1EYBA 1UKRA 4BK4A 4AE2A 2D97A 2XBO2 4NE9A 4R8HA 3ZX7A 2WNEA 2HWF3 5T52A 5FFOC 5CFDB 1X8MA 2I2SA 4CEYC 3H50A 2OUHA 5LBCA 4XJUA 1VRH2 5JR7B 3PURA 3LCPA 2CGPA 1UIJA 1WUVA 1QQP1 4LBQA 4FQZA 3LPFA 4CU9A 1OMIA 4IXLA 4S2GA 2ZZJA 3JBG2 1G9CA 4RHV2 1R1ZA 4FOWA 4CP1A 2JG9A 3FHIB 1JZ6A 2W92A 3ZFFA 5GLVA 4UW3A 1IQDC 4YFWA 4RN5A 2A70A 2WSUA 3GZAA 3HNBM 5FZAA 5IK7A 2VZRA 4FO9A 1NXD1 5FJHA 5JWPA 4DNYA 3ACGA 3N7MA 2VCAA 3KCCA 1WCDJ 5EJZB 4HANA 3OEBA 3NNGA 1OT5A 5ACA1 1BK0A 2GC3A 4O61A 4Y5TA 5HXVA 4LHKA 5FZ1A 2RJLA 3ZIWA 3S0MA 1AR73 3E5QA 3NO8A 1TVGA 1SLLA 5F32A 2ZEZA 4XILA 4XUTA 3VBOC 4NIHA 3GCXA 2GSYA 3DYMA 5F3GA 1CWPA 3PUSA 3AKRA 5JMCA 4SBVA 1QWRA 3FE5A 4XFBA 5FCCA 5FMOL 1HX6A 3WNOA 2FMYA 2JDUA 3UT0A 1VBA2 1GQPA 3DF0A 3RMYA 2DCKA 2HWD2 5FMOS 2X29A 4URAA 1Y7BA 4CYDA 2JIGA 3FBYA 4RQPB 1SACA 3K3NA 5LA1A 1O4TA 1VBC3 4AL9A 1AR92 2EAAA 5BPXA 4B29A 5A7WA 2XPJA 4Q27A 1FMD2 2W94A 3RWNA 3DPRA 5HCAA 2FDGA 3TOJA 1YJKA 3WG1A 2PXJA 2ZGSA 4GQ7A 4Q4V3 4EYUA 2R042 4IL7A 4FOYA 3OD0A 4FPCA 2HJIA 4XUNA 1H8VA 2DWRA 2NQYA 4LLFA 3KGZA 4N90A 2HBUA 1YQ2A 3UGHA 4DZGA 4L8QA 4CDQC 4JRAA 5C4WA 2J1AA 2ENRA 1LHWA 1H1AA 4XQDA 3T09A 5F3CA 1SLAA 3SKVA 2ZA9A 2X09A 3THTA 1HXS3 3O1UA 1YWKA 5DG2A 5F1RA 1QIQA 3POEA 5C5UA 4ZS3A 4IE6A 3UYJA 4ARYA 1OA3A 2YC2A 1FAYA 2JDHA 2R0FA 1EY2A 4L9BA 4IE0A 4LBOA 4Y4YA 1ZX5A 3I49A 2Q30A 2VAUA 3LE0A 4NWVA 4A6OA 1LOFC 3BODA 1W8UA 4XACA 5DAQA 5K4LA 3UJOA 5EIYB 1T2XA 1UPIA 1VE0A 1XYOA 2PHLA 4P9IA 4P9LA 1BCXA 1IQAA 1NYWA 2JDKA 2V4VA 3NW4A 5GLZA 4DRRA 1WMXA 4RS5B 1XXNA 5LB6A 1W6MA 2UWCA 4LMFA 3C7FA 4IV1C 4BIFA 2WO2A 1GNZA 3K4AA 1UY1A 4BM8A 1Q43A 1OVSA 5JOZA 1LCLA 5F39A 4OUEA 2XLAA 1FXZA 5FZCA 3DYPA 1YFWA 1GUIA 3SH4A 5J48A 2BGPA 5CIRA 3O1OA 1AR83 4OQ9A 4EZ4A 1VAKA 1DYPA 1NCRC 1VBE1 1Y9MA 3MICA 1MS8A 4YVWB 5FK8A 3ZKYA 4PLMA 3GHMA 2D7FA 5FMDA 1CAUB 5F7UA 1FV2A 2YFZA 3B9IA 2ZACA 5BXXA 3VHNA 5C3OA 1BEV1 1EP0A 2B8MA 2AREA 5T5PA 1IGOA 4EN7B 2V5DA 2N7GA 3WOGA 2GAUA 4PI0A 2W9XA 3VDBA 2W68A 4L92A 1LTEA 1ACCA 3RG0A 4LO5B 4EWAA 2WS93 1DGRA 2XBO1 2WZR2 3ZPOA 2XJUA 4C1WA 1UZVA 1E5HA 3NJYA 3NAPC 1U5YA 5A3UA 1NCQC 4EV0A 4KG8A 5FZ8A 3WT3A 5HCBA 5IVVA 4IEUA 1VRH1 2WO1A 4NROA 2WBKA 1F8VA 4NRPA 5EJ3A 2D98A 5FPZA 5JZGC 3K4ZA 1TE1B 3JD73 2X5IA 3JQWA 1W6NB 3KLSA 3UGGA 4AFCA 2RS12 4RHV1 5E89A 4C91A 4HL0A 3UK9A 1PVC2 1LHNA 5KHKA 2ES3A 4MZUA 1AX1A 4CCNA 1PMHX 4B8EA 2PQSA 2YHJA 3RZKA 3VBUC 2D3SA 3OCPA 2R30A 5SV5A 4HK9A 1H8TC 5A80A 1XQNA 1SDDB 4GMP1 5FY4A 4JDOA 4PLOA 2IXJA 4NN0A 2H0VA 2NZ9A 2DVFA 2GH2A 2CSGA 4OFGA 4PCRA 3D5OA 4IV3C 4Z07A 2YB7A 3PL0A 5KXCA 3IBMA 2NN8A 5F3EA 4AFAA 2BTVC 2W1WA 4GWJA 3MW3A 4NPMA 1ZZ9A 1H1IA 4COWA 3OOXA 2VMFA 1ZRCA 3PUQA 3NNMA 4JDMA 2HEVF 1DLCA 1X50A 2ZAAA 2D44A 2JG8A 4WBBA 5FYIA 1OXCA 5DAWA 5JVVA 5JLVA 1CZSA 4KBZA 4WVWA 3ZMOA 4GWMA 4B4PA 3BI3A 1VBA1 2HWD1 1W2TA 1CAVA 1SFYA 4LBKA 4MOAA 4DUXA 4JGYC 5C8CC 1CD3G 2WWJA 5FY1A 3VBSC 2CL2A 1JHNA 2D6NA 2TEPA 1PO13 4NHMA 3LB9A 3WD5A 1AR91 3NRUA 3M70A 5EPAA 4DY3A 3LDBA 4FPOB 5C70A 4LJHA 5FUNA 4FFHA 1FMD1 4GB32 1GNHA 3W21A 2R041 3ZFGA 1JMUB 4PJYA 1I3HA 4GKYA 5JXJA 2CV6A 2PAMA 3DCQA 3WG2A 4YZ2A 3VBFB 1AR63 1YNAA 1ULPA 2RJKA 3KV5A 4HG6B 4Y4RA 5J7MA 5FO7B 1V6KA 2VH9A 2VMIA 2ARCA 3VD7A 4UFIA 4I2OA 3O1VA 4BQYA 2F4PA 2YFUA 1C4RA 3ELNA 2ZPXA 4MSVA 4AHYA 2G19A 4DXRA 3KHCA 1V0AA 4BJ0A 1BHGA 4MXVA 3AJZA 1ENSA 3F95A 3RYRA 3PHMA 4W6YA 4CU7A 4AFDA 2EIGA 5A33A 3M8LA 4NPLA 5FXVA 2WWSA 5A6XA 1F2NA 2PLV3 2GALA 2GN3A 2Y64A 4PDWB 1UD1A 3BTAA 3KV6A 3UETA 3OD4A 3DV8A 2FDKA 4YZ4A 3GBGA 4DO0A 4ISRA 5BNPA 4JHTA 2D6OX 4K7JA 2RM22 4WVMB 5FUIA 3SH5A 1HV1A 1SBFA 5JAXA 2W87A 5A6ZA 5CKNA 4RR3C 2VTXJ 3ZYIB 5FQ0A 1T6GC 4L0PA 2IC1A 2UWAA 4MXWA 4OUMA 4QPIB 2FCTA 2DVBA 3KSCA 3VD9A 2EVXA 2GMPA 4HXCA 2QQPA 2FQPA 2EIBA 2D6LX 1AZDA 1PM7A 1ZBE2 1XNCA 1ND2B 3QLQA 5GZFA 1W39A 1EV13 1WKYA 3AKSA 2QUOA 4I30A 3HMYA 2Z5WA 3LF7A 4ZU4A 3PU3A 3WR0A 1A8DA 1O4ZA 2D40A 1SQ4A 1UO9A 4QU1A 1O5UA 4M3CE 5FZ4A 1VLNA 3PVNA 4YM0A 5DZFA 2WLQA 3IAPA 5FP7A 3SXWA 4ET7A 2R7EB 2WIIB 5FZFA 4QDRA 1DG6A 1CIYA 2WZR1 4QPGC 4XCAA 4ZZ5A 5FLHA 1QXRA 4PBPA 1WCKA 4QHBA 3VB9A 3VDDB 2PAKA 2WYSA 2ZMNA 5F6LB 2DVGA 4IESA 1SBDA 4AGRA 5C6CA 3I59A 3OG2A 1MZ6A 4QMAA 1QJZA 2AZ5A 4B7KA 4BMBA 5C9AA 3T1MA 3DKQA 5FZ9A 5J3UA 1YI7A 2RS11 1TME3 1PVC1 4Y1XA 1R092 4Z2WA 1RUC2 1WZXA 5LW9A 4KGGA 4P08A 2VVDA 1UZ0A 3E5XA 4LIUA 4OCTA 4CDUB 2W5FA 2ZZQA 2BVVA 4LE3A 4Q0QA 4QGNA 3KT7A 5I0RA 4FAGA 4LO4B 1GOGA 1S0GA 5FREA 2BFUL 2Y6FA 4C8DA 3FFQA 3P3PA 1YUDA 1VRBA 2BFUS 4XXAA 1JZ5A 2BWAA 4MLOA 1Y9QA 1WLTA 1DGLA 1JOPA 5EP9A 5IK8A 2DFBA 3AL5A 3FFZA 1RUF3 5FZKA 2Q8CA 4N43C 3FLTA 2BW8A 5KHHA 1OOPB 2PFWA 2R0HA 3C7GA 1GBGA 4LTAA 5IVJA 2WT2A 5JI9A 5IVBA 4JKKA 4NHLA 3TWIA 1CIWA 4CCKA 3N9NA 4MVTA 2Z2SB 5IJRA 2XGXA 5C33A 2DTWA 3WW4A 4D6SA 2DTYA 3TEXA 4BCUA 3DXTA 3CJIC 3HN1A 4LITA 3GBFA 3BGAA 3ACIA 1X36A 5DABA 2ADDA 5IUQA 1VBB1 1LOBA 1MS4A 2VZTA 3KQ4B 2RG4A 1O3TA 4IEYA 1AF9A 2XQRA 3J9SA 4MYEA 3WEZA 1KDKA 3KQRA 1RHI2 1RGSA 1VB2A 5FZMA 1US3A 4GB31 4YW7A 1AXZA 3IIAA 3SHRA 1H2NA 1QQP3 4MX3A 4XAAA 3I2KA 1QGLA 4QD2A 5CVRA 1RB8G 4XURA 1ZZ7A 3MLKA 3O1RA 2EIDA 2YGMA 2WFF2 1W3VA 1ASJ3 3AVRA 2VW0A 5FRAA 2JENA 2A75A 1KFUL 4CVUA 4PBOA 1UY3A 1W2UA 3WHTA 1G6NA 3OTFA 5DMYA 1A34A 2OXBA 1GNYA 4O9GA 1N1TA 4IERA 4CTEA 2VGDA 4XDPA 1K42A 1YRZA 3A22A 3MLLA 2JJ6A 5C3PA 4MG2A 3IPVB 4R9CA 2KA3A 5ACA3 4BIOA 5C5TA 3VZNA 1Q5OA 1VBD2 1GFF2 1SMVA 3OB8A 5FK7A 1BLZA 5L7OB 1HW5A 3WQBA 1UOBA 3EYPA 2OKXA 4IDZA 4BXFA 2VOWA 5FWEA 5KR7A 1LESA 1ENRA 2Q4SA 1CONA 4GD4A 1LEMA 1D0HA 4RGAA 3HR9A 2W0XA 2VQUA 3IDBB 2ZTNA 5FYTA 4AEDB 4QX8A 4M3CA 4GWIA 4HVQA 1UY4A 1CGPA 1W9WA 3T0AA 3ZFEB 4NIGA 5T3NA 4YZ5A 5C3RA 2JXAA 2RM21 5FBZA 2X10A 5EHDA 4GXLA 4H3WA 3QACA 4MGKE 4GIQA 4P9WA 5EWSA 4M3CF 1PO22 3ZXGA 5IFTA 1V6JA 3VGIA 4TLGA 1UF2C 2GH8A 1QU0A 1DF0A 4D8MA 4LUKA 3O1TA 4UW5A 1W8OA 4D7YA 5I91A 4CUAA 5D8AB 2QE3A 4YGDA 4AR2A 4HMZA 3E97A 1O7FA 1ZBE1 2Q1MA 5T55A 2HLEA 3WDYA 3RZJA 1PGW2 4YVWC 2VM9A 1HB2A 4KQ7A 5H9RA 4NVPA 4O9EA 3RS6A 3S57A 1M4WA 2JICA 2WNUB 4JTNA 5IATA 4ZKTB 5ABJC 3WHUA 1YHFA 4ASMB 4ZHNA 2XL7A 4KWJA 2WNVC 4CEYA 4E4DX 2XWJB 4FFGA 3RI8A 2QQNA 3AFGA 1C5IA 2J1TA 3Q8CA 2AC1A 4Y33A 3FC0A 1DBNA 3NKGA 4BLIA 3D0SA 2PTMA 5CEHA 4L99A 4OMCA 4CEWB 4LE4A 1LGBA 1RXGA 3CL1A 4TYSA 3F2ZA 1L7LA 5EZWA 1NG0A 3HAGA 2Y6LA 2A73B 4UBGA 1AYM3 4NIIA 4WV8A 4CPBA 1LAJA 5GZDA 2WC2A 1V6OA 3V64A 2OZ6A 3WUCA 1J3QA 3B3QE 3RJRA 2Q5TA 1GZ9A 4YG0A 1UYXA 1W8ZA 3FZ3A 1AXYA 1DGWX 5C7GA 1GR3A 1R091 1RUC1 4WVZA 1MEC2 3I2FA 2VG9A 5KXEA 1Q3EA 4TWTA 1L3JA 3NMBA 4JRLA 1OVPA 5FZDA 3IDEA 4YG6A 4Z1VA 1AUYA 4HOOA 4OMDA 2FCUA 4M4PA 4COVA 5E88A 1HB3A 2WRAA 3U14A 1YIPA 1ST8A 3R4SA 4DS0A 5C71A 3LOBA 1YQ6A 5LY1A 2YBKA 4CDXB 1VBE3 4LKFA 2IWGB 3NQHA 4F83A 4OULA 1NZCA 3VBOA 4UFLA 1UMZA 4LBNA 3M3CA 3PIGA 4YRDA 4QX5A 4CRQA 1DFQA 2PQQA 1JS9A 3AFKA 1X9PA 3Q9OA 4K1ZA 5IWFA 2WZPP 5BNNB 2X8KA 3LZZA 5FLIA 1BEV3 3OPWA 1SPPB 3ST7A 3WY6A 3V0AA 2RDNA 5JMOA 1CPNA 3KGLA 4IUGA 1SLCA 1W9SA 3JU9A 1S4CA 1NXMA 3TNQA 2P3JA 4E4HA 1FNZA 2QDNA 2XBO3 3H3LA 4AQ6A 5B2GB 4QQ2A 2D6PA 1W6PA 4AK3A 3ZOIA 4CE8A 1Z0HA 1FOD2 4E4ZA 1DQ4A 1O4YA 1VRH3 1RHI1 3BALA 1V9U1 1WW5A 3ACLA 1GZCA 4WM8B 3NV2A 3THPA 1V00A 1MS3A 1C1FA 1IOAA 4CP9B 2ZCWA 1JW6A 4FPFA 1REDA 2MPFA 4CDQA 2R49A 4RHV3 5LATA 5LCWL 2P1BA 1K5MB 2RVAA 1KXGA 2WFF1 3H1MA 1MS1A 1G7YA 1ZZ8A 2I45A 4N53B 2RDRA 4UFMA 4E27A 3BU0A 2VMHA 1GLHA 3FLRA 3TNPB 5JOWA 3B69A 1WLCA 5EYXA 1O8PA 1HN0A 1QJU2 4PT6A 4HONA 4OHZA 5LA0A 3KT1A 4GMP0 1YC61 2J1VA 4KWUA 4GMP3 3VBFC 5I8TA 4UF0A 3RWKX 4I0WB 3HBZA 5J1XA 2D5HA 4LBMA 5LASA 1JOJA 2BOIA 1LOFA 1NA1B 3P3NA 4G3YC 3VL9A 4LULA 4FPLA 4CCMA 3DGTA 1UYZA 1VBD1 5I0SA 1S2KA 2VW1A 3POWA 3FJSA 1JYIA 1Q8VA 2XJSA 4ES9A 4IEXA 5FYZA 4IV1A 2CYFA 2BJSA 4KGQA 3FWEA 3LKJA 4NRQA 2BWCA 3RJ2X 5FPXA 4IE5A 1YXWA 2VZPA 1VBA3 2HWD3 4HPKB 2P34A 4PIZA 1MACA 2QQMA 4KU7A 4OYUA 4PDWC 1MS9A 2DFCA 3KV4A 4K9SA 1H2LA 4XBNA 3H7YA 1AR93 3R4UA 3BTZA 1NCRA 1PO21 2CAUA 1E5RA 1OQEA 3O7OA 1OA2A 1FMD3 2AGSA 2RJ2A 2VECA 1SLBA 3V0BA 1PK6C 1O59A 5L36A 1XSRA 2BEOA 2R043 3ZDVA 1DZTA 1Y43B 3WW2A 5IHRA 4AI1A 3IIIA 3HQRA 4FTSA 4K20A 4LBQB 4CU6A 2RR12 3A23A 1J1TA 2B39A 4OQ8A 1PGW1 2ZMKA 3H8OA 2K2SA 3NWKA 3FL7A 2EALA 4Z82A 3I2DA 1LECA 2JG9B 2LALA 1ND2C 3X29B 3NAPA 2BOJA 2DUQA 1NCQA 1QDCA 1REFA 3ZFFB 1S1AA 5FZ0A 1WBLA 1SEFA 4QT6A 5FPVA 1GQGA 5FXWA 5HPOA 3OUHA 2BBVA 4NHKA 3KZ4C 5FLJA 1N1SA 4UXAA 3WDWA 3VKNA 3ZYFA 5JZGA 1YQ5A 4CZSA 4NHXA 1PX4A 1GP5A 3SKJE 1CAWA 3MF9A 1MS5A 4XOGA 4A3ZA 3O0WA 2RDSA 4B1MA 3J8F2 5EXOA 1LKNA 2WABA 2WT1A 3S30A 4JVAA 3RFRA 3IMNA 4MGIE 3VBUA 5A3LA 1ENQA 1FYUA 1MEC1 3ME2A 4R9DA 4I02A 1OA4A 2G9GA 2C9KA 2VMGA 2XKPA 1GZTA 5K9YA 3U07A 4IV3A 3THDA 2CY6A 4A42A 4CDUC 3M3EA 3J7LA 3AB0A 4Y26A 3R6SA 3KVAA 4URTA 1NOVA 1UY2A 2WINB 1JUHA 2XHNA 2ZX1A 5A7WB 2ZEXA 3WCSA 1LENA 1WGPA 5DZEA 3W5NA 3DPRB 1WD3A 2Q0AA 4ONUA 1COV2 2WL1A 2ET7A 4AFBA 4G9SB 1K3IA 3HEIA 5DAVA 1U12A 5JXIA 4M00A 3RI9A 1STMA 4TSVA 1VAMA 1AVBA 4JGYA 5C8CA 4GZ9A 3VBSA 2ZX0A 4LK6A 5FZOA 1WW7A 4TTGA 2WZR3 3AP6A 1FT9A 3ATGA 3JUUA 2V72A 4GH4C 4FSJA 1QOSA 2BNNA 2RS32 1HQNA 2OT7A 4XFHA 5D1IA 4NWWA 1FOD1 3BPZA 3KD4A 4META 1CVNA 3ZYPA 1IPSA 4RSUA 2VUDA 2BNMA 4LKDA 4YVSB 1XPWA 5FP4A 3NKTA 1ALYA 2G4IA 5CG9A 3ZSKA 3Q8AA 2RS13 4K40A 5A3WA 2QQJA 4ATEA 4DIQA 1PVC3 4ASKA 3SMHA 4Q8KA 4XFIA 3VBRC 1R64A 4JGZC 5JPNB 2UU8A 4P14A 4XTMA 1FPN2 3HT1A 5KHJA 1UW8A 2ARBA 1QJU1 1CQ9A 2R1BA 4EROA 3AXEA 1J3RA 3VL8A 4CU8A 2VO5A 3B94A 5JPMB 3LIHA 3IDCB 4K1YA 3KMHA 4QDQA 3DXUA 4BDVB 3RZMA 4ZS2A 2XQXA 3H3ZA 1KFXL 4YGCA 3UKVA 3ZN6A 5DPNA 1LULA 4R52A 3V65A 2D5FA 5T5OA 3DECA 5J37A 3NJZA 4U36A 1OBNA 3SITA 1B35C 3O0XA 4S2HA 1G9DA 1Z7S2 2JB8A 3C7OA 4A44A 2OUJA 1HJFA 2VCMA 3MPPG 2QQIA 3LEKA 5CZKA 4RR3A 1YYNA 4D7TA 1V6NA 1VBB3 2B46X 5JXHA 2GDFA 1H6XA 4W4ZA 3EQEA 1W03A 3RGBA 1FV3A 4UAPA 2P5BA 3K3OA 1Y4WA 2BBAA 3VKLA 1BMV2 3OSDA 4GB33 3H42B 1ULOA 1GP6A 2P2KA 3CU7A 4ORFA 2CTVA 3P1IA 4V2WA 4QX3A 4F8AA 5IVCA 2O1QA 1MS0A 3ABZA 4XJZA 3LAGA 3J7HA 1KJRA 3PUHA 1YLLA 2RR11 4PF1A 2LRPA 2E26A 2X5IB 1IS4A 1GV9A 1TQ5A 5CB7A 3VLBB 3OUJA 3H1YA 5D8AC 3OBAA 1REEA 4QPGA 1UYYA 1NQDA 2VBBA 1N3OA 2Y0IA 4FQ4A 3JB4C 4BK5A 4BHPA 2WWUA 3TEYA 1KD7A 1VIWB 1HRV1 2WNUC 4YSFA 5F37A 2CAVA 4BU2A 5IVEA 3K48A 3U37A 4LBQD 2PAEA 4CA9A 1J3PA 2XKOA 4GJYA 1VAVA 1OD5A 2ZEYA 1RVF2 4CP2A 4AEMA 2BP6A 1C57A 3DUIA 1QEXA 3J8F1 3WW1A 5E6HA 4CEWC 1UYPA 1J83A 4LK7A 4INDA 3FHQA 4S2FA 2BU9A 2P3IA 5FUPA 5I0DA 1VMFA 2PHTA 3DN7A 4F7ZA 5CISA 1MQTC 2JG8B 1W05A 2K46A 3N9OA 5FZIA 1JYTA 3LPGA 3ZXKA 2B45X 2RM23 5FPUA 4PI2A 4QQPA 2HEWF 2ET1A 1PNFA 2R072 2ZX4A 3OYWB 5J09A 1IKPA 2UWBA 3E5UA 1W9TA 1XNAA 1BVVA 5C3SA 1UWWA 1UCXA 2EXKA 1A3KA 1UN1A 2ZGPA 1HRI2 3JXSA 5A3OA 4OZXA 4N43A 5F9TA 4ZXEA 2VL4A 3EHKA 1COV1 1ZBE3 5CKMA 2JD9A 1DQ2A 2WT0A 2Y34A 4XIOA 5AFBA 3NNFA 4D6RA 1RYYA 1XNBA 2O8OA 2OW4A 3CJIA 3RVHA 2AR6A 2IFWA 2AENA 2R1DA 1YJLA 4JCKA 2VW2A 5CNAA 3T0DA 2Z42A 5H9QA 1NUKA 4I0BA 4ES8A 4K6BA 2ZMLA 3MUZ1 2RS31 4YYOA 2XH6A 5DDJ2 4W65A 4YZ1A 3WVJA 2IXKA 2VQ0A 3Q8EA 3AP5A 1DDLA 3ECQA 3ZXEA 4HKLA 3JBG1 1OLRA 4BQ1A 2PYTA 3CHXA 2E31A 2A1XA 1X7NA 2E7QA 2VTXA 4IEWA 3RDIA 1UNBA 4XFCA 4CUCA 1N1VA 3ALQA 3Q8FA 4YW6A 3B7MA 4IEOA 2IXCA 4U2AA 3I8TA 2XLGA 3BN6A 4L11A 4YGBA 4CCCA 5ANNA 4HT1T 3ZSMA 1R093 4IGQA 1RUC3 5A33B 3ITQA 4FCAA 5FV3A 2ZKLA 5DUVA 3NNJA 3VN4A 4Y22A 1FPN1 1RUD2 5A1AA 2GP3A 4M0NA 3AYDA 1W90A 4AHWA 1UMHA 3UNPA 3M3QA 2J22A 4CDWC 3KF5A 5BNPB 2C1FA 2QZ2A 1YQCA 4IGPA 4Q26A 1NKGA 2H6BA 3G6JB 1PZ7A 4JV4A 2ZBJA 4UWDA 3S6PA 2XHKA 4EN8B 3OGSA 5FQ0B 1JZ4A 1I1EA 4ATFA 4KI5M 3GF6A 5EFUA 3RZZA 4CCLA 3D0JA 3VBHB 1LOEA 3KWVA 1VR3A 5FKCA 1NA1C 5FYMA 1VALA 3A4UA 5FWJA 1BXHA 3VHOA 3USSA 1OLMA 3WF4A 4BQXA 1XE8A 1OH4A 3L2HA 4Y1YA 1KITA 5JIAA 3ZYHA 4AOCA 1L7QA 1Z7S1 5HXMA 3OBRA 4AI9A 4OHWA 4XF1A 5BNOB 4QAWA 3ORJA 2WLPA 3L2YA 4ISQA 5JI7A 4RGGA 3ROUA 1H6YA 1LODA 4GULA 3R05A 3AYEA 4QB6A 4ZY9A 2E7AA 5A7OA 1PHMA 1RHI3 2NP0A 1V9U3 1BMV1 2MEV2 1MVQA 2IZWA 2LS6A 5T50A 5BUVA 3ZIXA 2Y6HA 2WZ8A 4AI8A 2JKXA 4JTOA 1DU3D 3WV6A 2OA2A 2I74A 4Q0SA 3VZKA 1URXA 1EAH2 1L7RA 3I59B 2WFF3 3T2PA 5C9AB 1PZ8A 2AACA 4LOSA 4AF9A 5ABJA 1ND3C 4J1WA 2WNVA 4AZZA 4Y1ZA 4E2QA 4BWOA 2W91A 3OBZA 4XZPA 5K0UC 4AWDA 4AVBA 5KC5A 2ZGKA 1JYXA 3MV01 4LHLA 2VZOA 3D82A 1Q8PA 3GCWA 4IEQA 5LEKA 1I5ZA 5FO8B 3HVDA 3B02A 3CKHA 1DP0A 1S0IA 4FPGA 1VBD3 4HBNA 1QMJA 2NM1A 3AMHA 3K2OA 4YARA 2EXJA 4EQVA 1MZ5A 1RVF1 1BZWA 2LM3A 1UPSA 2JE7A 5HV4A 4YM1A 2VNGA 5F5AA 2IUWA 4Q2FA 4QB1A 4JDNA 1J59A 3AKQA 3PMSA 1QHDA 4I09A 1LU2A 3PDQA 3A0KA 2HWE2 2IXIA 4AXOA 2GC1A 4WM7B 5FP9A 1US2A 2F4LA 2YY1A 3ILFA 3KVBA 3R4DB 4XUPA 5FY0A 3T2TA 4ZU5A 3POFA 1XNDA 1W2OA 1M06G 1N3QA 2R071 2PN5A 1PO23 4XPVA 2Z69A 4KWLA 3V56A 5I0TA 4P9GA 2ZGTA 3WG4A 2FD8A 2PMWB 3C3VA 4QKFA 5I8SA 4P00B 2XJQA 2WR9A 3RNSA 4MGTA 3O12A 1TZOA 3HN3A 1AR82 1UX7A 5LK5A 4COUA 2Y0OA 4OHVA 5LBEA 4WZFA 5LZ6A 3WXPA 4H2AA 2EF6A 4YW5A 1QOTA 4NAOA 4YM2A 1XU2A 3RMXA 3DPRC 1ODNA 4OLLA 2JDAA 1RTVA 2XL9A 3OEAA 2WO3A 3CLPA 3D8CA 3SCFA 4FAHA 5CFDC 2DU0A 5F2SA 4LXLA 4FPKA 5DDJ1 2OPWA 1AJKA 3MV11 3OGGA 5A3PA 1S2EA 4LBLA 1GWMA 2VBDA 3ZYGA 2A5ZA 2CGOA 3N9QA 2VY0A 2H6CA 1RITA 4XJWA 4AEJA 3UJQA 2BDRA 3IT8A 2P17A 1CAXA 2UY9A 3USUA 5CFCB 4FOVA 4JHZA 4HKWA 3LIGA 2J1SA 5DAXA 1SFNA 3I3EA 4QHOA 4M01A 4FFFA 2C0ZA 4O65A 4YVSC 3W58A 3TBDA 4ASLA 5F5IA 2XJPA 2ZOEB 1PM4A 4QHZA 1RUD1 2ZHKA 4XYXA 4F3JA 5GZCA 2XDVA 5J36A 4N9HA 1NY72 2Y26A 4M3CB 1OQ1A 5D2AA 2QNKA 3I54A 4JZRA 3GHNA 2GNBA 4AAXA 4CP0A 1ZYBA 4FT8A 1RUE2 1RUH2 4XQWA 1PGSA 1OFNA 2FHRA 4W6WA 3AK0A 4Q4Y2 4FVVA 4DQAA 3N35A 4C90A 2ZGRA 3LEGA 5FY5A 3FX3A 2OX0A 4H14A 1UXXX 4FXKB 4XDQA 3JQXA 4YGEA 1Y3TA 4JQTA 1KRIA 4XJ8A 2YDEA 1W2NA 2VBPA 1LRHA 1LOAA 1DQ1A 3AMQA 2Q8OA 2O0OA 5JXGA 1JZ7A 2VU9A 1JYVA 4PDWA 2O14A 4ZU7A 3LFMA 3J26N 3LSDA 5FZBA 1ULGA 1NAEA 4E4SA 4DUVA 1S0FA 4AG4A 3MIDA 2Q8DA 3THCA 1G9AA 5IVYA 1VB4A 4RQPC 4CXXA 4CEYB 1FOD3 1RINA 3T30A 1WMEA 3GYDA 1PK6A 3KF3A 5AFEA 2IVIB 2IXHA 2A6YA 3I2GA 2MEV1 1W6OB 3P6BA 4TN7A 1BBT2 4FOQA 2CWMA 1NQJA 5KC6A 2D6MA 1DQ5A 1IS6A 2VJXA 4I3PA 5JSPA 2P3YA 1IPJA 3BU7A 5LK7B 1EAH1 4XCBA 1ZZCA 4XF9A 3ZN4A 3I3BA 2FDJA 3AZWA 4DPNA 3HQXA 1ND2A 2QJVA 4Y24A 2BVBA 4BQ3A 3ZXDA 1QJU3 3ZXJA 5IVFA 2QCSB 4AQ2A 2NMNA 2G9ZA 1H1MA 2CDPA 3GZEA 1W8FA 1AR62 1W04A 1DGRN 1W2AX 2Y6GA 2WA4A 3RRDA 4D69A 3QH7A 1DZQA 1F5JA 2VULA 3I3DA 4J1XA 1F31A 2VD7A 3PVOA 5J98B 1KS4A 3B5LB 4Z92B 3RZHA 1H2MA 1J1LA 4R9BA 2GZWA 3TB0A 4B1LA 4IE7A 2E7TA 3C8XA 3FLPA 2OIIA 1OPOA 4PF5A 2VCCA 3WF1A 3VBOB 5GZEA 4BQ4A 1H4HA 4RS5C 5H9PA 2VMEA 1OKQA 1YIFA 2G1MA 3B00A 3MW4A 1CX1A 3BOPA 2VNOA 2JEMA 2HWE1 3RYPA 3EB7A 5FMCA 3V0AB 4W50A 3ACHA 5FJKA 4CDUA 4D3WA 3ZR5A 2JG8C 2AH2A 3AZZA 4Y1UA 3BTYA 2A3YA 3UV9A 1W6PB 3N9PA 3BKZA 5GJ6A 1SLTA 5JOXA 4Q4W2 2DUOA 1RUI2 2XG3A 3BIWE 3KM5A 4BE3A 5LBFA 4B4QA 2NLRA 3ES1A 1AR81 1D2SA 4YM3A 3I2JA 2Q1ZB 1UKGA 3IDAA 2RR13 3IMMA 2D93A 1RUG2 2WFPA 3L9JT 5SV8A 4CDQB 3NJVA 1NX9A 3CMGA 4GH4A 2VMDA 2BGCA 3BPSA 2HYKA 1UIKA 1XBFA 1MR5A 1HRV3 3M2MA 1MPXA 2UYBA 2ZGNA 3U10A 5IW0A 4C1XA 1S0DA 1ODMA 4LIVA 2C6SA 3WP3A 3W59A 3ILNA 3M3OA 2FZ2A 3I3QA 3TYJA 3J8F3 3I2OA 1VMHA 1H0BA 1GQHA 1I5PA 3VBRA 1LB2A 5EQUA 4JKMA 4JGZA 3ENRA 5DG1A 2WN2A 5IT6A 1FNYA 2H0BA 4M4RA 4IV1B 4Y20A 4YW2A 1QKQA 3SEEA 4W6XA 2VOKA 1K12A 1KQRA 1HN1A 2OVUA 1F5FA 5FKBA 2P6CA 1NY71 3MW2A 1TME2 2EICA 3EBRA 4BA6A 1WWYA 1S0CA 3VKMA 3SNMA 1GZWB 4NIDA 4KMQA 4MGQA 4ZONA 1RUE1 1O3SA 1RUH1 4GA9A 4L2NA 3VKFC 4LR4A 4NHYA 3VV1A 2FDHA 1W6QA 5LRRA 1TMF2 4YW3A 4Q4Y1 1AL22 3JB8A 1B35A 1BVP1 5CG8A 1RMU2 4QGLA 4QQHA 1COV3 4LT5A 3WG3A 2PHUA 5IK4A 2XXZA 1OSGA 2W47A 3VDAA 1R082 1ZZ6A 4MV2A 1ZRRA 3T0BA 3VBHC 4R9AA 3TAYA 3WF2A 3ZSJA 4G4FA 1D4M2 4BLJA 2B7YA 2YZ4A 3RZLA 5BY5A 4Y5Z0 1R1A2 1BKZA 2RS33 1AL0G 5E1RA 2VZUA 3NAPB 1C28A 2C9AA 5C3QA 1NCQB 3BVCA 5BNOC 1IKQA 3JBG3 1U5IA 5LA9A 4TLFA 4BZ4A 1BBT1 5JCTA 3C2UA 3OGJA 3QH6A 3OGRA 5C8WA 5F3IA 5JZGB 4BISA 2EXIA 1CAWB 1QXPA 2WYFA 1YFYA 2MNGA 2ZX3A 5FYSA 2ILMA 4HN0A 5D8AA 1UU5A 5L73A 5T5LA 3MIFA 1V6LA 3LSEA 3ZM8A 5FZGA 3ZVXA 4IEZA 1LOCA 1CX4A 1FPN3 2QQKA 2ZGQA 4JKLA 2E53A 4N8MA 3SISA 3VBUB 1JYNA 3AM2A 1ASJ2 4FFIA 1O3QA 3H8UA 4BPZA 3LQCA 4C0HA 2BGOA 2L9LA 1JHJA 4GWNA 1HJGA 5F5QA 2PHRA 1AR61 1G8WA 1PGL2 4IV3B 2Y38A 2W1QA 2R6QA 3GBWA 3ILRA 4HN1A 4CPBD 1U0AA 1AX0A 1C8M2 5AC92 4QDSA 1NLQA 5DZGA 3OJBA 4YNIA 1BJQA 2VC9A 2ZABA 5IK5A 1POV1 5I93A 1DYKA 1GANA 2EIEA 1UXZA 4AAPA 1MQTA 2R16A 3HOBA 1Z7S3 3WF3A 1ULEA 4QXHA 3WP5A 4MUVA 2HYXA 2XJRA 1XE0A 3RZGA 1GOHA 1XNKA 3MIBA 1EUTA 3W5MA 4Z8BA 1YFXA 2BQPA 5C8CB 3CZJA 1W8NA 1BYHA 3E1F1 4ARXA 2B5HA 5FZOB 1X8EA 3SCHA 4ZXKA 4WM7C 1APNA 1PZ9A 3PJQA 2DF7A 2J1UA 3HQUA 1ZA7A 4HFSA 3U75A 4QPIC 3WUDA 1NZIA 2DU1A 5GKAC 4S2DA 4Q4W1 4DFSA 1RUI1 3I2HA 1D2QA 2DVDA 5HCFA 1W8WA 2JDYA 2FZ1A 4DEQA 4DINB 1SZBA 1ZRIA 2PHFA 4XVHA 1D0GA 4XUOA 1RUG1 3T08A 4V2VA 3AKTA 3GZTB 4QM9A 3ON7A 4LKEA 2HWB2 3WDXA 2K0GA 2XR4A 1U5XA 4XMIA 5FY8A 2X05A 1E5IA 3MYXA 2VUCA 4TXWA 3B9CA 5HBAA 3VDDC 2A7AA 3PIJA 5F6KA 3NL1A 3AZVA 2JB4A 2XOMA 1ZBA2 2VZ3A 3UESA 1RVF3 1JH5A 1D7PM 3LA3A 4AQSA 1SG3A 4CSWA 3S5AA 3ZN6B 2W1SA 4AVVA 3WLUA 1H8TA 1POQA 4Q8LA 1UOFA 5EV7A 1N1YA 1AYM2 5CFCC 4GALA 2P37A 5FP8A 2C26A 4CDWA 3N36A 1A78A 5KBFA 1UU4A 3MO4A 3WP6A 3LDRA 4MH0E 1TME1 4Q1RA 2R073 1XOYA 2TNFA 2DCYA 4I3GA 3APBA 1JTZX 2W46A 4LNVA 4MO3M 4FPHA 2VE1A 4AW7A 1OC1A 3T4VA 3GGLA 1TMF1 4Q4X2 4UYBA 3HT2A 1GYKA 1AL21 1UZZA 1BQPA 1RMU1 4FPJA 2AYHA 3ZPYA 1O6UA 4CCOA 2RHPA 1ZNPA 1H30A 2R062 1OOPC 1R081 5C4WB 1OFSA 3D3AA 2A6WA 2HWC2 4JX0A 3ZO0B 4AI2A 4EJRA 3CJXA 2QQUA 2VQAA 2FCVA 3QBQA 1D4M1 4D7SA 2K9ZA 1NLRA 1XRUA 1WA4A 2P4EA 4RD7A 1KS5A 1R1A1 2A6VA 3EO6A 4HPKA 3LGRA 1XNTA 5DDJ3 3TRSB 5DAPA 1AHSA 3LDKA 5ANQA 2YUEA 1OLQA 5FMBA 5T54A 1ZVFA 3J7MA 4XFAA 1VPHA 4SLIA 1J58A 2RS52 2WKKA 1WLDA 2ORXA 3MI8A 4RYDA 2BERA 2NMOA 1WMDA 2OZJA 4NR1A 2C4XA 4LA3A 4RA0A 1Z78A 3OY8A 2W1UA 1CJDA 3S7EA 5A32A 1ND3A 1QH7A 4QQOA 3AYCA 3VZMA 1W6MB 1I6XA 4GAZA 3ZYRA 4K3UA 4NOTA 5K0UA 4DMIA 1QF3A 3WSOA 3HNYM 2GP5A 1RUD3 1MZEA 3SQOA 5HV0A 4V1PA 4XJAA 1HV0A 1ASJ1 2QKDA 2RMU2 3INAA 3U11A 2WN3A 2VOVA 3FUOA 4LO6B 3I2IA 4FTEA 1PGL1 3NV1A 4CUBA 5CAZA 3H9AA 3GJAA 2CWSA 2TBVA 4XQ4A 4XXPA 1I9RA 3MIEA 1OURA 3AP7A 1NLSA 2WQ8A 5ISLA 1HDKA 2VUAA 1JBCA 5AC91 3WX5A 1C8M1 1RJ7A 5GLWA 4UFKA 5CYYA 3WNLA 4AFMA 2WUHA 5L7OC 2PELA 1EUUA 2J1RA 4N43B 1JODA 4X8NA 2JDNA 3H0OA 2DVAA 4K8FA 2GNMA 1OH3A 1QJY2 1UQXA 4AEDC 5FYVA 4BQWA 2DCJA 3GXUA 3N3HA 4XUQA 3ZFEC 1DYOA 4UFJA 3CJIB 1DGWA 1ULCA 1PIV2 1W28A 3R0RA 2PA7A 4QX7A 3VUOA 5KXDA 4NJ4A 4WZCA 3HJRA 4XC9A 4H7MA 2MEV3 2YYOA 3PVEA 2LTNA 1OLME 2CGNA 4I01A 1W8HA 3KS7A 5L9RA 3BB6A 3PTYA 3ZKUA 2A6XA 1VMJA 1EAH3 3DKWA 4AYUA 1W0NA 4NPRA 2VUJA 4XFFA 5TSWA 4MGSA 2XB6C 5AVPA 2R32A 2CNAA 2UURA 3DEMA 5FPBA 4QXBA 1HQLA 3ETPA 5CFDA 2D6KA 1XJAA 3ZLIA 4UW6A 4AI0A 2HWB1 2YG0A 3MFCA 5KHIA 3E6DA 3FUQA 3LEMA 1RXFA 4XF3A 2XMLA 4Y22B 1AYN2 3WQ0A 1PX3A 4XBLA 3LD8A 4WVVA 5FR3A 4LUMA 5JSOA 3POYA 3SC7X 4BB3A 1ZBA1 4E8CA 1JOBA 2ARXA 3WCRA 1JZ3A 3H1WA 3PUIA 2B42B 3CBNA 5K8SA 4CCDA 1JYWA 1C5HA 3K4DA 4YVSA 2YPDA 3PLQA 3SH3A 2WSVA 3TN92 3FHAA 3ZXFA 3D6EA 1AYM1 3IAQA 2HWE3 2WAAA 1CAVB 3HWJA 3LEIA 3K51A 4PLNA 1K45A 1S55A 2LROA 2XJTA 1O5LA 2OPKA 2VVFA 4LOTA 3MIGA 4XJ9A 4YW4A 4P9JA 1UZWA 3Q8BA 2WQZC 4UBHA 5IAXA 4QPWA 4FPEA 3VD5A 4L97A 3ZFGB 4CDXC 4Q4X1 4E9KA 1PMJX 5A6QA 4HVRA 5FOBB 1GSLA 2ORZA 3IWZA 4I0AA 5E8AA 4N9IA 2OQ7A 2VXJA 3SLIA 2TUNA 3EMRA 2R061 2PHWA 5B4NA 5BNNC 4ZPIA 1RUJ2 4LPLA 4A2UA 5JDBA 1QJX2 4P9YA 2BPA2 2HWC1 3J7NA 1UZYA 4GJZA 3RPQA 1F15A 1XU1A 2Y60A 1X9TA 1YI9A 4D6QA 4RQPA 5ABJB 3OF1A 2WNVB 2DCZA 5L9VA 5FPAA 3UKNA 2C24A 2HWF2 3NJXA 3I97A 2E9QA 4DXSA 2GN7A 1WCSA 2DBIA 4LORA 5FXZA 3KV9A 4MHRA 4QKBA 3NSTA 4E8DA 4K8RB 2JDZA 4RFRB 1WW4A 4WM8C 2D43A 2RS51 3IB3A 2DCTA 3K46A 3BIEA 3U4SA 1IG0A 1W0PA 2E33A 4RFT0 1K5MC 3VKOA 4FP2A 2W52A 4CCJA 4MGYE 4N53C 1LR5A 4XAEA 2WA3A 2YV8A 1ZREA 3I4IA 1IS3A 4R4XA 5DUXA 2XVGA 3N7JA 1EPWA 5FAXA 2CDOA 2RMU1 3I3MA 1X33A 5JSRA 5CU1A 2GC2A 2GC0A 1X82A 2W3JA 2XVKA 5GZGA 2YC0A 2QZ3A 4MXWB 1RUE3 1HKDA 2JIJA 3GNEA 1RUH3 2B9UA 4QX1A 5ERLA 1W3XA 4AEKA 1W0OA 5L9BA 4AHXA 3GZUC 3AKPA 3N7KA 4Q4Y3 4R4ZA 5FBJA 2Z4FA 1OUXA 3FMGA 3URFA 4YFZA 1QNYA 3C7EA 4DXZA 4RS5A 1AR72 3ZSEA 5J96B 2YU2A 2BZDA 2MHFA 4NUBA 5LRSA 1LEDA 4HVOA 5AVAA 1UX6A 1MZFA 3LA2A 1QJY1 1LOGA 3JZVA 1ULFA 4OHYA 1CESA 1TEIA 5BYNA 3QD6A 3WNPA 4KH9A 4PHZA 1SFPA 2CHHA 4AVAA 4LO8A 2FDFA 1PIV1 4FBFA 1A6CA 1PNGA 2ZAHA 1GICA 2VZSA 3T3YA 4EZHA 1CPMA 3POJA 2RV9A 5T5JA 3WDTA 1VBC2 5FTTC 3AZYA 4YVWA 2VZQA 3OYWA 3CF6E 4YPJA 3RYKA 1VBB2 1BBT3 1CAUA 1SCRA 3AJYA 4KBBA 1PVXA 5JIUA 3POIA 4Q4V2 4EE2A 1CN1A 2P3KA 3GDBA 1XSQA 1CAXB 1Q8OA 1QJEA 3USUB 1N47A 4OZOA 1YO8A 3FBMA 3KHBA 3KCXA 3MEPA 2UYAA 1HIXA 1LGCA 3O14A 2V4AA 2ZX2A 5GLUA 1W06A 3O1MA 1P8JA 2JG9C 2YPJA 2Y6JA 2YBSA 2XUMA 3A7QA 3KCYA 4PIYA 4Y1VA 3K75B 3ZFFC 1F4HA 3IZOA 1JYCA 1HXS2 5M0TA 4BH9A 1UU6A 2VTFA 1AYN1 3MLJA 4IETA 1H9WA 2WQ4A 3M1HA 2E32A 2DV9A 1IZ3A 4A7ZA 2EA7A 5I0UA 3G7DA 2VCBA 3DYOA 1W6NA 1OUSA 3MBWA 5DN2A 4AGVA 4B3NA 4HLTA 2PHXA 1POV0 2WAOA 1POV3 4QXKA 4LQRA 5CA6A 1NT0A 4A4AA 2KD7A 1H2KA 4P02B 3TN91 3CDZB 1U5ZA 1WLWA 2HEYF 3PJYA 2VNVA 2QQWA 2VXRA 1QNWA 2NYYA 1DHKB 2Q1FA 4NAMA 4QKDA 5APAA 2QQOA 5LBBA 3U78A 1H4GA 3SEPA 2D3PA 4NIAA 3MFAA 3LFIA 5A7QA 1ONAA 1HRI1 3P5BA 4XDOA 1V6IA 2A71A 4FP3A 5FXXA 3WINE 1TNRA 4A7KA 5LEJA 2J7MA 1UOGA 4JQRA 1SDWA 3J4UH 4Q4W3 1PK6B 1RUI3 1ZRFA 1RUOA 1DIWA 4KNCA 1ENXA 3WW3A 4CXWA 4NMIA 1S0BA 4IQPA 2YGLA 1G9FA 2O8QA 2UY8A 1HQWA 4E2GA 3VBHA 1RJ8A 5FDBA 2GU9A 1RUG3 3AMNA 4OI0A 5BV6A 4YW1A 3UGFA 1GOFA 1QH6A 1RUJ1 1QJX1 4XFGA 4DEVA 3PNAA 3MHZA 2GNDA 2E63A 1OD3A 3AXDA 4JC1A 2F17A 5C4WC 2DURA 3PMEA 2W2IA 5BNOA 2WS92 2HWF1 3ZN5A 5HI0A 4MADA 5JR2A 2JX9A 4KL1A 1SCSA 1SBEA 4Q0UA 4RL7A 1QOOA 3UL2A 1DLLA 5CBLA 3MIHA 1LU1A 2DYCA 1MEC3 1GWLA 3JD72 5GLTA 3MGUA 4DRVA 1OF4A 3MPBA 5F5CA 1XC6A 2QTWB 3VBFA 5JUVA 2EXHA 2BYVE 2JWPA 2OS2A 4QU2A 4NO4A 1S0JA 1OQDA 2GMEA 4H7LA 4ITCA 2J42A 4LLOA 1JZ8A 1WCQA 4BQ2A 1AJOA 1XE7A 2J1EA 4FI9A 4AQTA 1C1LA 1J84A 2BUKA 3EJKA 1NE6A 1V6MA 2QQLA 4B4RA 4DUWA 4ZZ8A 3PTRB 2DUPA 2HKXA 2KXLA 1AXKA 1YFUA 3VDCA 3ZYJB 5JOYA 1LNSA 1GKBA 1O3RA 1UY0A 1TMF3 2P6HA 4X6RB 5BNQA 4XETA 1GMMA 1AL23 3CO2A 4OI1A 3WNKA 2ADEA 1QY4A 5IFPA 1RMU3 1AR71 2GMMA 5A70A 1R083 4AVTA 4OUSA 2W08A 2G9FA 2CU5A 4IE4A 4P9XA 5FYYA 4RGKA 4WVMA 1D4M3 3OGVA 5GM0A 1GP4A 1T6BX 1TG7A 4OVEA 4COYA 5K7PA 1R1A3 4AHZA 1N3PA 4FXGB 4GH4B 4J6GA 4WM7A 5L19A 3B93A 1GWKA 4FTBA 1KEXA 2XONA 1G86A 4MHUA 4QPIA 2ERFA 4W8JA 1PO12 3VZOA 1VBC1 4N7UA 5IAVA 3M7AA 5A3NA 4XHBA 3B01A 1KGYA 2YU1A 4Q4V1 5LY2A 1TNFA 4HSJA 4UI9L 1Q56A 4FPYA 5FZ6A 1V9U2 3ZSLA 5DUWA 3WDVA 1DQ6A 2X5IC 3N9LA 3VBRB 1LHUA 1LGNA 2Y8KA 4KG0A 4JGZB 3IKWA 3IM0A 3O1SA 5H9SA 4XF0A 4A6SA 3H8XA 4QXCA 4Y20B 2ZJCA 1WA6X 1HXS1 3VDDA 3T2OA 1OHFA 3CEWA 5FP3A 5FY7A 1OKOA 5GALA 2XLFA 1O8SA 4Q29A 5CADA 3ZYBA 1JN2P 1A8MA 1NE4A 4LHSA 5AC93 1C8M3 1IPKA 2X53S 2QBXA 4HZFA 4HKOA 4QX0A 2IFRA 5A7NA 4EWEA 1W6QB 2WJSA 3NV3A 2FDIA 4LEJA 2EAKA 3RQ0A 3WNNA 5CFCA 1B35B 5FYCA 3ES4A 2FBEA 2PLV2 2WO7A 5KWRA 2XWBB 2ATFA 4LO7A 4LHNA 2VMCA 1HB4A 3AMPA 4XHXA 2BV4A 4BXSV 4QWNA 3W9AA 4YZ3A 4OI4A 3ACFA 3OPZA 1XB9A 3N9MA 5FYHA 4C0BA 4CCEA 3CQOA 2BRTA 1C8NA 1Y9GA 4HK8A 1SHWB 3IN9A 4BQ5A 1UOJA 1UL9A 4XEZA 4IW3A 3E6BA 3ZMNA 1MVEA 2JECA 4AVCA 1LJ7A 1OOPA 4PQQA 2HBTA 4DY5A 3ASIA 2JKBA 2JDPA 3POGA 5G04L 4CUGA 3QCWA 3ZFGC 1EV12 3WNXA 2A3XA 5I8YA 3A0NA 3AP4A 2HWB3 1VP6A 2BNOA 3N7LA 3NV4A 3LOIA 3QOPA 4IEVA 5HCHA 1ZM1A 4UF0B 2A3WA 4UOJA 2WS91 4P5HA 5A3TA 3WQ1A 4A45A 4IGOA 4AVSA 4D0QA 2GNTA 2DBNA 1ZBA3 4YWAA 5FOJB 4XTPA 1F35A 5FO9B 3AC0A 1WBFA 2A6ZA 4QGMA 1JUIA 4X8PA 5DUUA 4NRMA 3PU8A 3PVBB 2I07B 3PUAA 1W6OA 1G9BA 3DL3A 3JD71 2ZGOA 1E5SA 3BOWA 3JCIA 4TZDA 5IYYA 1CR7A 2VQTA 3HPNA 2AEYA 3VD3A 1DCSA 4BYYA 4EN9B 2JE8A 4EWDA 1MQTB 1W9YA 1OF3A 5FZ7A 5E16A 2ZKNA 3MDPA 2NPIA 3AP9A 2FMDA 2KM2A 3IPVA 1NCRB 5BNPC 3O1PA 3GM8A 3LA7A 4Q0PA 3V0BB 5L7OA 2LUWA 3OUIA 5LA2A 1AX2A 2ZHNA 2JDMA 1D4VB 4Q4X3 1QDOA 1QXJA 4XABA 1RUF2 2V73A 3S5QA 3VZLA 4CXYA 1BK1A 5FYBA 2W95A 4DOUA 1H9PA 4AEDA 2R063 4BMEA 1B09A 3NNLA 3E6CC 2AUYA 2HWC3 2RE9A 2XVLA 3ZFEA 2QVSB 1O91A 3AL6A 2ZS6B 4Q0VA 5FZEA 5B4XA 5EYYA 3H3UA 1C3HA 1S2BA 3FN9A 1CZVA 4IEPA 2IXLA 2ZHMA 3K77A 2VVEA 3U4XA 2QQVA 3EXUA 2ZHLA 2B9VA 1KJLA 1VJ2A 3ETQA 3N4MA 1PO11 4YG3A 5A1LA 3HBKA 2VNRA 3U1XA 5CKQA 2E6VA 4XMAA 1RIRA 2Y6KA 4Q1PA 2RS53 1F9KA 3MZHA 3NVCA 3POBA 1QQP2 1WCUA 1Q8SA 3TEZA 3VHPA 1JXNA 4XIKA 4UT5A 3O0VA 2IVJA 2V5YA 2F6BA 2WNUA 4J25A 5C9AC 4PQ9A 2ARAA 1H8TB 3AVSA 5FZ3A 1JU4A 5A1FA 2JE9A 1CZTA 1GU3A 1UAIA 2WDBA 4HSLA 4A3XA 3BCWA 2WNOA 4X6QB 2RMU3 4YLZA 4XBQA 4CEWA 4CDWB 3VD4A 2V09A 4QQLA 1W99A 4XZUG 4E2SA 5FZLA 1OI6A 3WDUA 5ACA2 5FIXA 5KHGA 4KWKA 1ZRDA 4XW3A 3T1LA 3TEWA 1DZRA 5DQ0A 1WD4A 3CIHA 3VZJA 4LKSA 2Z79A 5F8PA 3A21A 4KU8A 5A7SA 1RUNA 1YEWA 3AMMA 3W20A 3I7DA 4DB5A 1PMIA 1CJPA 2ETEA 2VZ1A 2PLV1 1QJY3 1LHOA 2LW8A 4JGYB 2Q8EA 4DXTA 1HB1A 4OI2A 1V70A 3VBSB 1HLCA 3ZR6A 1WMFA 4JAAA 3SCGA 3VHRA 4QPYA 3UKTA 1EPZA 4Z2AA 2VOXA 1PIV3 3WNMA 5A6YA 4Q5OA 5FZHA 1QJFA 4M0HA 1DQ0A 4CDXA 4AGGA 3BTXA 3OPTA 1GZWA 4GKXA 2AEZA 2W39A 3HIFA 4QX2A 2QFEA 4Y5SA 1E57A 1SLIA 1Q8QA 2SLIA 4XE9A 4A7YA 1IS5A 3O5SA 4D94A 5BNNA 3ZDSA 2QDRA 1IHMA 1SPPA 2VR4A 4QM8A 4UW4A 1WW6A 4K21A 4PIXA 5G05L 3ZXAC 5A32B 1EV11 3OY8B 3BYWA 2ZGUA 1ND3B 3AX4A 5D21A 3WP4A 2Y33A 2C5DA 1W8TA 3ZXLA 2ZXQA 3HD8B 5K0UB 2YMZA 1ULDA 2ZGMA 2VOTA 1OPMA 2VZVA 1W9FA 4COZA 2ID4A 1XYPA 1AYN3 3RSJA 4EN6B 1KDMA 1LHVA 2WZEA 3WZ1A 1UMIA 1XYNA 3M3IA 2OYZA 4WM8A 4LBJA 5F2WA 3CNAA 4CP9A 3H8RA 2YC4A 1JU3A 1HRV2 3WQ7A 4MGZE 4QKNA 5EJ1B 4UFHA 1K5MA 2XUEA 4N53A 1JI6A 4N7IA 5A3MA 4QB2A 4A41A 3TN93 5A7PA 2PHDA 3GALA 4Y3OA 4EN0A 1FI2A 4H55A 4HETA 4B7EA 2HH9A 5KXBA 4RR3B 3D4KA 1K5JA 3OBTA 2VPVA 2XJVA 2YXSA 3MF6A 4O7XA 2SBAA 2YBPA 3KB5A 1HRI3 2D3RA 3HNMA 1NA1A 4AI3A 5FY9A 1IG3A 2ZGLA 4LA2A 3MUY1 2DDUA 4OHXA 1RC6A 1FX5A 2B4KA 1S0EA 2RDQA 3BUCA 2E51A 4P5YA 3WF0A 1VBE2 1YQ8A 3GJBA 3T2QA 4BOWA 5LWBA 3CZUA 1RUF1 4XF4A 3H7JA 3AZXA 2OQ6A 2KR2A 3POSA 2YROA 5DXDA 3C7HA 1RL3A 1ZA4A
chains in the Genus database with same CATH topology
5C71A 4E8DA 1F4AA 2ZEWA 3NQHA 3IB3A 1JZ2A 4BK4A 3K46A 2E33A 4AAXA 5JMOA 4IUGA 1W9SA 3LPFA 2CDOA 4CU9A 3LEGA 1UXXX 2W3JA 4QX1A 1JZ6A 2W92A 1JYVA 5JXGA 1JZ7A 1IQDC 4RN5A 2Z4FA 3HNBM 4DUVA 1NAEA 3C7EA 4AG4A 2VZRA 3THCA 2BZDA 3ACGA 2VCAA 5EJZB 5LCWL 2RVAA 3OEBA 3NNGA 1OT5A 3I2GA 3P6BA 1O8PA 3WNPA 4PT6A 5LA0A 2VJXA 4KWUA 1TVGA 2J1VA 2ZEZA 2VZSA 4XUTA 5J1XA 2RV9A 3I3BA 3DYMA 2VZQA 4YPJA 1UYZA 3WNOA 1GQPA 2DCKA 3GDBA 2CDPA 5LA1A 2Y6GA 4OZOA 3I3DA 2W94A 2VZPA 1P8JA 2Y6JA 3A7QA 3K75B 1F4HA 2QQMA 4OYUA 4XUNA 3C8XA 3WF1A 2VTFA 2VCCA 2E32A 1YQ2A 2VMEA 1CX1A 2RJ2A 2J1AA 2VCBA 3DYOA 1O59A 3EB7A 3MBWA 3T09A 3SKVA 5DN2A 2X09A 5IHRA 4W50A 2WAOA 3ACHA 3IIIA 4LQRA 4CU6A 4A4AA 2KD7A 4ARYA 2YC2A 4P02B 3A23A 3CDZB 3FL7A 3LE0A 2QQOA 4A6OA 3SEPA 5EIYB 1T2XA 3I2JA 3IDAA 2V4VA 5HPOA 2J7MA 3C7FA 3NJVA 1NX9A 2WO2A 3CMGA 1PX4A 3K4AA 2VMDA 1UY1A 3SKJE 4A3ZA 4OUEA 3DYPA 1GUIA 2WABA 1MPXA 2BGPA 1GOFA 4DEVA 1OD3A 2C9KA 1I5PA 5F7UA 3THDA 2YFZA 4JKMA 4MADA 5JR2A 2WN2A 4A42A 4M4RA 3SEEA 2V5DA 1UY2A 1K12A 2W9XA 2XHNA 3VDBA 1HN1A 2ZEXA 3W5NA 2EICA 1OF4A 1XC6A 5JUVA 4KMQA 1K3IA 4MGQA 3HEIA 5JXIA 2WO1A 2WBKA 1JZ8A 1WCQA 4GZ9A 2J1EA 3K4ZA 4TTGA 4FI9A 1J84A 2V72A 2QQLA 4DUWA 4ZZ8A 2W47A 3VDAA 3T0BA 3VDCA 1LNSA 1UY0A 3WF2A 1PMHX 1GMMA 2PQSA 5IFPA 3WNKA 1XPWA 1SDDB 2VZUA 2QQJA 2YB7A 1R64A 3OGVA 2W1WA 4GWJA 1TG7A 3OGRA 4CU8A 2VMFA 1KEXA 2VO5A 2XONA 1DLCA 4W8JA 4QDQA 4BDVB 3ZM8A 2XQXA 1CZSA 2QQKA 4JKLA 5DPNA 1JYNA 1KGYA 3DECA 4DUXA 3LQCA 4MOAA 2BGOA 2L9LA 1JHJA 4UI9L 3NRUA 5C70A 2W1QA 2Y8KA 3C7OA 4A44A 2QQIA 3LEKA 4QDSA 5CZKA 2VC9A 3T2OA 5JXHA 4W4ZA 1H6XA 5JXJA 2EIEA 4UAPA 1UXZA 3HOBA 1O8SA 2BBAA 3WF3A 1ULPA 2HYXA 4LHSA 1ULOA 4HG6B 1GOHA 2QBXA 3P1IA 1EUTA 4QX0A 3VD7A 4QX3A 3W5MA 3ABZA 3CZJA 1W8NA 3J7HA 3WNNA 3E1F1 4ARXA 3PUHA 4PF1A 2YFUA 2E26A 2J1UA 2VMCA 3OBAA 4DXRA 4BXSV 4BJ0A 1UYYA 1BHGA 3I2HA 3ACFA 4BK5A 4DEQA 4CU7A 3CQOA 4XVHA 4XUOA 1SHWB 3U37A 2Y64A 3UETA 3T08A 2ZEYA 2X05A 4PQQA 5FUIA 2W87A 1J83A 4TXWA 3FHQA 5G04L 4L0PA 5I0DA 2XOMA 2VZ3A 3UESA 3VD9A 3LPGA 1D7PM 1SG3A 2W1SA 4UOJA 2EIBA 4A45A 1WKYA 4D0QA 1W9TA 1XNAA 1UWWA 3JXSA 3AC0A 2C26A 4ZXEA 2VL4A 3IAPA 4ET7A 2R7EB 3MO4A 4QDRA 1CIYA 4ZZ5A 2JD9A 5IYYA 2VQTA 3HPNA 3VD3A 1RYYA 2WYSA 2JE8A 2W46A 4MO3M 3GGLA 1OF3A 3OG2A 3T0DA 1NUKA 3MUZ1 3GM8A 3D3AA 4JX0A 3ECQA 4P08A 5LA2A 1UZ0A 2E31A 2W5FA 4CUCA 1GOGA 2W95A 1XNTA 3BN6A 1JZ5A 5B4XA 5A1AA 2ORXA 4RYDA 2BERA 3FN9A 1CZVA 2C4XA 2W1UA 1UMHA 3K77A 3UNPA 2B9VA 2J22A 3C7GA 3WSOA 1NKGA 3HNYM 4JKKA 1JZ4A 2Y6KA 3OGSA 5IJRA 4KI5M 3BGAA 3ACIA 2WN3A 3I2IA 2VZTA 3WF4A 4CUBA 1OH4A 3WEZA 1L7QA 5HXMA 2WQ8A 1JU4A 1US3A 1CZTA 1GU3A 2WDBA 3WNLA 3I2KA 5CYYA 4QAWA 2WUHA 1EUUA 4XURA 2J1RA 2EIDA 3VD4A 1H6YA 4ZY9A 4QB6A 1W99A 4XZUG 4CVUA 1UY3A 2DCJA 3GXUA 2LS6A 5DMYA 2Y6HA 2WZ8A 4XUQA 1GNYA 1DYOA 2JKXA 3CIHA 5DQ0A 4LKSA 3A21A 1L7RA 1K42A 3T2PA 3A22A 3HJRA 2VZ1A 2LW8A 4DXTA 2W91A 3OB8A 3WQBA 4Z2AA 3EYPA 2OKXA 3WNMA 1JYXA 3MV01 2VZOA 1W0NA 4MGSA 2VQUA 3CKHA 1DP0A 4QX2A 3ETPA 4GWIA 1UY4A 1W9WA 2YG0A 3T0AA 2X10A 4QB1A 2VR4A 1PX3A 5G05L 5IFTA 4E8CA 2ZXQA 4D8MA 1JZ3A 3PUIA 1US2A 2VOTA 4XUPA 1W8OA 2VZVA 1JYWA 3K4DA 4CUAA 2ID4A 2WZEA 1UMIA 2HLEA 3FHAA 2VM9A 3IAQA 2WAAA 2YC4A 1JU3A 3LEIA 4P00B 5EJ1B 1K45A 3HN3A 1UX7A 2QQNA 1JI6A 4QB2A 2J1TA 4A41A 4OMCA 3F2ZA 4QPWA 3VD5A 2JDAA 2Y6LA 3OEAA 2WO3A 1PMJX 2ORZA 3HNMA 3MUY1 2DDUA 5B4NA 3MV11 2B4KA 4LPLA 1UYXA 5C7GA 3I2FA 4P5YA 3WF0A 3T2QA 3CZUA 4JHZA 4OMDA 3NJXA 3I97A 4M4PA 2J1SA 4DXSA 3C7HA 3I3EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C71 A;  4E8D A;  1F4A A;  2ZEW A;  3NQH A;  3IB3 A;  1JZ2 A;  4BK4 A;  3K46 A;  2E33 A;  4AAX A;  5JMO A;  4IUG A;  1W9S A;  3LPF A;  2CDO A;  4CU9 A;  3LEG A;  1UXX X;  2W3J A;  4QX1 A;  1JZ6 A;  2W92 A;  1JYV A;  5JXG A;  1JZ7 A;  1IQD C;  4RN5 A;  2Z4F A;  3HNB M;  4DUV A;  1NAE A;  3C7E A;  4AG4 A;  2VZR A;  3THC A;  2BZD A;  3ACG A;  2VCA A;  5EJZ B;  5LCW L;  2RVA A;  3OEB A;  3NNG A;  1OT5 A;  3I2G A;  3P6B A;  1O8P A;  3WNP A;  4PT6 A;  5LA0 A;  2VJX A;  4KWU A;  1TVG A;  2J1V A;  2ZEZ A;  2VZS A;  4XUT A;  5J1X A;  2RV9 A;  3I3B A;  3DYM A;  2VZQ A;  4YPJ A;  1UYZ A;  3WNO A;  1GQP A;  2DCK A;  3GDB A;  2CDP A;  5LA1 A;  2Y6G A;  4OZO A;  3I3D A;  2W94 A;  2VZP A;  1P8J A;  2Y6J A;  3A7Q A;  3K75 B;  1F4H A;  2QQM A;  4OYU A;  4XUN A;  3C8X A;  3WF1 A;  2VTF A;  2VCC A;  2E32 A;  1YQ2 A;  2VME A;  1CX1 A;  2RJ2 A;  2J1A A;  2VCB A;  3DYO A;  1O59 A;  3EB7 A;  3MBW A;  3T09 A;  3SKV A;  5DN2 A;  2X09 A;  5IHR A;  4W50 A;  2WAO A;  3ACH A;  3III A;  4LQR A;  4CU6 A;  4A4A A;  2KD7 A;  4ARY A;  2YC2 A;  4P02 B;  3A23 A;  3CDZ B;  3FL7 A;  3LE0 A;  2QQO A;  4A6O A;  3SEP A;  5EIY B;  1T2X A;  3I2J A;  3IDA A;  2V4V A;  5HPO A;  2J7M A;  3C7F A;  3NJV A;  1NX9 A;  2WO2 A;  3CMG A;  1PX4 A;  3K4A A;  2VMD A;  1UY1 A;  3SKJ E;  4A3Z A;  4OUE A;  3DYP A;  1GUI A;  2WAB A;  1MPX A;  2BGP A;  1GOF A;  4DEV A;  1OD3 A;  2C9K A;  1I5P A;  5F7U A;  3THD A;  2YFZ A;  4JKM A;  4MAD A;  5JR2 A;  2WN2 A;  4A42 A;  4M4R A;  3SEE A;  2V5D A;  1UY2 A;  1K12 A;  2W9X A;  2XHN A;  3VDB A;  1HN1 A;  2ZEX A;  3W5N A;  2EIC A;  1OF4 A;  1XC6 A;  5JUV A;  4KMQ A;  1K3I A;  4MGQ A;  3HEI A;  5JXI A;  2WO1 A;  2WBK A;  1JZ8 A;  1WCQ A;  4GZ9 A;  2J1E A;  3K4Z A;  4TTG A;  4FI9 A;  1J84 A;  2V72 A;  2QQL A;  4DUW A;  4ZZ8 A;  2W47 A;  3VDA A;  3T0B A;  3VDC A;  1LNS A;  1UY0 A;  3WF2 A;  1PMH X;  1GMM A;  2PQS A;  5IFP A;  3WNK A;  1XPW A;  1SDD B;  2VZU A;  2QQJ A;  2YB7 A;  1R64 A;  3OGV A;  2W1W A;  4GWJ A;  1TG7 A;  3OGR A;  4CU8 A;  2VMF A;  1KEX A;  2VO5 A;  2XON A;  1DLC A;  4W8J A;  4QDQ A;  4BDV B;  3ZM8 A;  2XQX A;  1CZS A;  2QQK A;  4JKL A;  5DPN A;  1JYN A;  1KGY A;  3DEC A;  4DUX A;  3LQC A;  4MOA A;  2BGO A;  2L9L A;  1JHJ A;  4UI9 L;  3NRU A;  5C70 A;  2W1Q A;  2Y8K A;  3C7O A;  4A44 A;  2QQI A;  3LEK A;  4QDS A;  5CZK A;  2VC9 A;  3T2O A;  5JXH A;  4W4Z A;  1H6X A;  5JXJ A;  2EIE A;  4UAP A;  1UXZ A;  3HOB A;  1O8S A;  2BBA A;  3WF3 A;  1ULP A;  2HYX A;  4LHS A;  1ULO A;  4HG6 B;  1GOH A;  2QBX A;  3P1I A;  1EUT A;  4QX0 A;  3VD7 A;  4QX3 A;  3W5M A;  3ABZ A;  3CZJ A;  1W8N A;  3J7H A;  3WNN A;  3E1F 1;  4ARX A;  3PUH A;  4PF1 A;  2YFU A;  2E26 A;  2J1U A;  2VMC A;  3OBA A;  4DXR A;  4BXS V;  4BJ0 A;  1UYY A;  1BHG A;  3I2H A;  3ACF A;  4BK5 A;  4DEQ A;  4CU7 A;  3CQO A;  4XVH A;  4XUO A;  1SHW B;  3U37 A;  2Y64 A;  3UET A;  3T08 A;  2ZEY A;  2X05 A;  4PQQ A;  5FUI A;  2W87 A;  1J83 A;  4TXW A;  3FHQ A;  5G04 L;  4L0P A;  5I0D A;  2XOM A;  2VZ3 A;  3UES A;  3VD9 A;  3LPG A;  1D7P M;  1SG3 A;  2W1S A;  4UOJ A;  2EIB A;  4A45 A;  1WKY A;  4D0Q A;  1W9T A;  1XNA A;  1UWW A;  3JXS A;  3AC0 A;  2C26 A;  4ZXE A;  2VL4 A;  3IAP A;  4ET7 A;  2R7E B;  3MO4 A;  4QDR A;  1CIY A;  4ZZ5 A;  2JD9 A;  5IYY A;  2VQT A;  3HPN A;  3VD3 A;  1RYY A;  2WYS A;  2JE8 A;  2W46 A;  4MO3 M;  3GGL A;  1OF3 A;  3OG2 A;  3T0D A;  1NUK A;  3MUZ 1;  3GM8 A;  3D3A A;  4JX0 A;  3ECQ A;  4P08 A;  5LA2 A;  1UZ0 A;  2E31 A;  2W5F A;  4CUC A;  1GOG A;  2W95 A;  1XNT A;  3BN6 A;  1JZ5 A;  5B4X A;  5A1A A;  2ORX A;  4RYD A;  2BER A;  3FN9 A;  1CZV A;  2C4X A;  2W1U A;  1UMH A;  3K77 A;  3UNP A;  2B9V A;  2J22 A;  3C7G A;  3WSO A;  1NKG A;  3HNY M;  4JKK A;  1JZ4 A;  2Y6K A;  3OGS A;  5IJR A;  4KI5 M;  3BGA A;  3ACI A;  2WN3 A;  3I2I A;  2VZT A;  3WF4 A;  4CUB A;  1OH4 A;  3WEZ A;  1L7Q A;  5HXM A;  2WQ8 A;  1JU4 A;  1US3 A;  1CZT A;  1GU3 A;  2WDB A;  3WNL A;  3I2K A;  5CYY A;  4QAW A;  2WUH A;  1EUU A;  4XUR A;  2J1R A;  2EID A;  3VD4 A;  1H6Y A;  4ZY9 A;  4QB6 A;  1W99 A;  4XZU G;  4CVU A;  1UY3 A;  2DCJ A;  3GXU A;  2LS6 A;  5DMY A;  2Y6H A;  2WZ8 A;  4XUQ A;  1GNY A;  1DYO A;  2JKX A;  3CIH A;  5DQ0 A;  4LKS A;  3A21 A;  1L7R A;  1K42 A;  3T2P A;  3A22 A;  3HJR A;  2VZ1 A;  2LW8 A;  4DXT A;  2W91 A;  3OB8 A;  3WQB A;  4Z2A A;  3EYP A;  2OKX A;  3WNM A;  1JYX A;  3MV0 1;  2VZO A;  1W0N A;  4MGS A;  2VQU A;  3CKH A;  1DP0 A;  4QX2 A;  3ETP A;  4GWI A;  1UY4 A;  1W9W A;  2YG0 A;  3T0A A;  2X10 A;  4QB1 A;  2VR4 A;  1PX3 A;  5G05 L;  5IFT A;  4E8C A;  2ZXQ A;  4D8M A;  1JZ3 A;  3PUI A;  1US2 A;  2VOT A;  4XUP A;  1W8O A;  2VZV A;  1JYW A;  3K4D A;  4CUA A;  2ID4 A;  2WZE A;  1UMI A;  2HLE A;  3FHA A;  2VM9 A;  3IAQ A;  2WAA A;  2YC4 A;  1JU3 A;  3LEI A;  4P00 B;  5EJ1 B;  1K45 A;  3HN3 A;  1UX7 A;  2QQN A;  1JI6 A;  4QB2 A;  2J1T A;  4A41 A;  4OMC A;  3F2Z A;  4QPW A;  3VD5 A;  2JDA A;  2Y6L A;  3OEA A;  2WO3 A;  1PMJ X;  2ORZ A;  3HNM A;  3MUY 1;  2DDU A;  5B4N A;  3MV1 1;  2B4K A;  4LPL A;  1UYX A;  5C7G A;  3I2F A;  4P5Y A;  3WF0 A;  3T2Q A;  3CZU A;  4JHZ A;  4OMD A;  3NJX A;  3I97 A;  4M4P A;  2J1S A;  4DXS A;  3C7H A;  3I3E A; 
#chains in the Genus database with same CATH topology
 1RUJ 3;  3AYA A;  1QJX 3;  5FPL A;  1BEV 2;  2JD4 A;  4QPG B;  5FYU A;  1FAT A;  3LWC A;  3U0Z A;  1F4A A;  2ZEW A;  3KT4 A;  1YCI A;  1ZZB A;  3S7I A;  3M4F A;  3T4H B;  1JZ2 A;  1EYB A;  1UKR A;  4BK4 A;  4AE2 A;  2D97 A;  2XBO 2;  4NE9 A;  4R8H A;  3ZX7 A;  2WNE A;  2HWF 3;  5T52 A;  5FFO C;  5CFD B;  1X8M A;  2I2S A;  4CEY C;  3H50 A;  2OUH A;  5LBC A;  4XJU A;  1VRH 2;  5JR7 B;  3PUR A;  3LCP A;  2CGP A;  1UIJ A;  1WUV A;  1QQP 1;  4LBQ A;  4FQZ A;  3LPF A;  4CU9 A;  1OMI A;  4IXL A;  4S2G A;  2ZZJ A;  3JBG 2;  1G9C A;  4RHV 2;  1R1Z A;  4FOW A;  4CP1 A;  2JG9 A;  3FHI B;  1JZ6 A;  2W92 A;  3ZFF A;  5GLV A;  4UW3 A;  1IQD C;  4YFW A;  4RN5 A;  2A70 A;  2WSU A;  3GZA A;  3HNB M;  5FZA A;  5IK7 A;  2VZR A;  4FO9 A;  1NXD 1;  5FJH A;  5JWP A;  4DNY A;  3ACG A;  3N7M A;  2VCA A;  3KCC A;  1WCD J;  5EJZ B;  4HAN A;  3OEB A;  3NNG A;  1OT5 A;  5ACA 1;  1BK0 A;  2GC3 A;  4O61 A;  4Y5T A;  5HXV A;  4LHK A;  5FZ1 A;  2RJL A;  3ZIW A;  3S0M A;  1AR7 3;  3E5Q A;  3NO8 A;  1TVG A;  1SLL A;  5F32 A;  2ZEZ A;  4XIL A;  4XUT A;  3VBO C;  4NIH A;  3GCX A;  2GSY A;  3DYM A;  5F3G A;  1CWP A;  3PUS A;  3AKR A;  5JMC A;  4SBV A;  1QWR A;  3FE5 A;  4XFB A;  5FCC A;  5FMO L;  1HX6 A;  3WNO A;  2FMY A;  2JDU A;  3UT0 A;  1VBA 2;  1GQP A;  3DF0 A;  3RMY A;  2DCK A;  2HWD 2;  5FMO S;  2X29 A;  4URA A;  1Y7B A;  4CYD A;  2JIG A;  3FBY A;  4RQP B;  1SAC A;  3K3N A;  5LA1 A;  1O4T A;  1VBC 3;  4AL9 A;  1AR9 2;  2EAA A;  5BPX A;  4B29 A;  5A7W A;  2XPJ A;  4Q27 A;  1FMD 2;  2W94 A;  3RWN A;  3DPR A;  5HCA A;  2FDG A;  3TOJ A;  1YJK A;  3WG1 A;  2PXJ A;  2ZGS A;  4GQ7 A;  4Q4V 3;  4EYU A;  2R04 2;  4IL7 A;  4FOY A;  3OD0 A;  4FPC A;  2HJI A;  4XUN A;  1H8V A;  2DWR A;  2NQY A;  4LLF A;  3KGZ A;  4N90 A;  2HBU A;  1YQ2 A;  3UGH A;  4DZG A;  4L8Q A;  4CDQ C;  4JRA A;  5C4W A;  2J1A A;  2ENR A;  1LHW A;  1H1A A;  4XQD A;  3T09 A;  5F3C A;  1SLA A;  3SKV A;  2ZA9 A;  2X09 A;  3THT A;  1HXS 3;  3O1U A;  1YWK A;  5DG2 A;  5F1R A;  1QIQ A;  3POE A;  5C5U A;  4ZS3 A;  4IE6 A;  3UYJ A;  4ARY A;  1OA3 A;  2YC2 A;  1FAY A;  2JDH A;  2R0F A;  1EY2 A;  4L9B A;  4IE0 A;  4LBO A;  4Y4Y A;  1ZX5 A;  3I49 A;  2Q30 A;  2VAU A;  3LE0 A;  4NWV A;  4A6O A;  1LOF C;  3BOD A;  1W8U A;  4XAC A;  5DAQ A;  5K4L A;  3UJO A;  5EIY B;  1T2X A;  1UPI A;  1VE0 A;  1XYO A;  2PHL A;  4P9I A;  4P9L A;  1BCX A;  1IQA A;  1NYW A;  2JDK A;  2V4V A;  3NW4 A;  5GLZ A;  4DRR A;  1WMX A;  4RS5 B;  1XXN A;  5LB6 A;  1W6M A;  2UWC A;  4LMF A;  3C7F A;  4IV1 C;  4BIF A;  2WO2 A;  1GNZ A;  3K4A A;  1UY1 A;  4BM8 A;  1Q43 A;  1OVS A;  5JOZ A;  1LCL A;  5F39 A;  4OUE A;  2XLA A;  1FXZ A;  5FZC A;  3DYP A;  1YFW A;  1GUI A;  3SH4 A;  5J48 A;  2BGP A;  5CIR A;  3O1O A;  1AR8 3;  4OQ9 A;  4EZ4 A;  1VAK A;  1DYP A;  1NCR C;  1VBE 1;  1Y9M A;  3MIC A;  1MS8 A;  4YVW B;  5FK8 A;  3ZKY A;  4PLM A;  3GHM A;  2D7F A;  5FMD A;  1CAU B;  5F7U A;  1FV2 A;  2YFZ A;  3B9I A;  2ZAC A;  5BXX A;  3VHN A;  5C3O A;  1BEV 1;  1EP0 A;  2B8M A;  2ARE A;  5T5P A;  1IGO A;  4EN7 B;  2V5D A;  2N7G A;  3WOG A;  2GAU A;  4PI0 A;  2W9X A;  3VDB A;  2W68 A;  4L92 A;  1LTE A;  1ACC A;  3RG0 A;  4LO5 B;  4EWA A;  2WS9 3;  1DGR A;  2XBO 1;  2WZR 2;  3ZPO A;  2XJU A;  4C1W A;  1UZV A;  1E5H A;  3NJY A;  3NAP C;  1U5Y A;  5A3U A;  1NCQ C;  4EV0 A;  4KG8 A;  5FZ8 A;  3WT3 A;  5HCB A;  5IVV A;  4IEU A;  1VRH 1;  2WO1 A;  4NRO A;  2WBK A;  1F8V A;  4NRP A;  5EJ3 A;  2D98 A;  5FPZ A;  5JZG C;  3K4Z A;  1TE1 B;  3JD7 3;  2X5I A;  3JQW A;  1W6N B;  3KLS A;  3UGG A;  4AFC A;  2RS1 2;  4RHV 1;  5E89 A;  4C91 A;  4HL0 A;  3UK9 A;  1PVC 2;  1LHN A;  5KHK A;  2ES3 A;  4MZU A;  1AX1 A;  4CCN A;  1PMH X;  4B8E A;  2PQS A;  2YHJ A;  3RZK A;  3VBU C;  2D3S A;  3OCP A;  2R30 A;  5SV5 A;  4HK9 A;  1H8T C;  5A80 A;  1XQN A;  1SDD B;  4GMP 1;  5FY4 A;  4JDO A;  4PLO A;  2IXJ A;  4NN0 A;  2H0V A;  2NZ9 A;  2DVF A;  2GH2 A;  2CSG A;  4OFG A;  4PCR A;  3D5O A;  4IV3 C;  4Z07 A;  2YB7 A;  3PL0 A;  5KXC A;  3IBM A;  2NN8 A;  5F3E A;  4AFA A;  2BTV C;  2W1W A;  4GWJ A;  3MW3 A;  4NPM A;  1ZZ9 A;  1H1I A;  4COW A;  3OOX A;  2VMF A;  1ZRC A;  3PUQ A;  3NNM A;  4JDM A;  2HEV F;  1DLC A;  1X50 A;  2ZAA A;  2D44 A;  2JG8 A;  4WBB A;  5FYI A;  1OXC A;  5DAW A;  5JVV A;  5JLV A;  1CZS A;  4KBZ A;  4WVW A;  3ZMO A;  4GWM A;  4B4P A;  3BI3 A;  1VBA 1;  2HWD 1;  1W2T A;  1CAV A;  1SFY A;  4LBK A;  4MOA A;  4DUX A;  4JGY C;  5C8C C;  1CD3 G;  2WWJ A;  5FY1 A;  3VBS C;  2CL2 A;  1JHN A;  2D6N A;  2TEP A;  1PO1 3;  4NHM A;  3LB9 A;  3WD5 A;  1AR9 1;  3NRU A;  3M70 A;  5EPA A;  4DY3 A;  3LDB A;  4FPO B;  5C70 A;  4LJH A;  5FUN A;  4FFH A;  1FMD 1;  4GB3 2;  1GNH A;  3W21 A;  2R04 1;  3ZFG A;  1JMU B;  4PJY A;  1I3H A;  4GKY A;  5JXJ A;  2CV6 A;  2PAM A;  3DCQ A;  3WG2 A;  4YZ2 A;  3VBF B;  1AR6 3;  1YNA A;  1ULP A;  2RJK A;  3KV5 A;  4HG6 B;  4Y4R A;  5J7M A;  5FO7 B;  1V6K A;  2VH9 A;  2VMI A;  2ARC A;  3VD7 A;  4UFI A;  4I2O A;  3O1V A;  4BQY A;  2F4P A;  2YFU A;  1C4R A;  3ELN A;  2ZPX A;  4MSV A;  4AHY A;  2G19 A;  4DXR A;  3KHC A;  1V0A A;  4BJ0 A;  1BHG A;  4MXV A;  3AJZ A;  1ENS A;  3F95 A;  3RYR A;  3PHM A;  4W6Y A;  4CU7 A;  4AFD A;  2EIG A;  5A33 A;  3M8L A;  4NPL A;  5FXV A;  2WWS A;  5A6X A;  1F2N A;  2PLV 3;  2GAL A;  2GN3 A;  2Y64 A;  4PDW B;  1UD1 A;  3BTA A;  3KV6 A;  3UET A;  3OD4 A;  3DV8 A;  2FDK A;  4YZ4 A;  3GBG A;  4DO0 A;  4ISR A;  5BNP A;  4JHT A;  2D6O X;  4K7J A;  2RM2 2;  4WVM B;  5FUI A;  3SH5 A;  1HV1 A;  1SBF A;  5JAX A;  2W87 A;  5A6Z A;  5CKN A;  4RR3 C;  2VTX J;  3ZYI B;  5FQ0 A;  1T6G C;  4L0P A;  2IC1 A;  2UWA A;  4MXW A;  4OUM A;  4QPI B;  2FCT A;  2DVB A;  3KSC A;  3VD9 A;  2EVX A;  2GMP A;  4HXC A;  2QQP A;  2FQP A;  2EIB A;  2D6L X;  1AZD A;  1PM7 A;  1ZBE 2;  1XNC A;  1ND2 B;  3QLQ A;  5GZF A;  1W39 A;  1EV1 3;  1WKY A;  3AKS A;  2QUO A;  4I30 A;  3HMY A;  2Z5W A;  3LF7 A;  4ZU4 A;  3PU3 A;  3WR0 A;  1A8D A;  1O4Z A;  2D40 A;  1SQ4 A;  1UO9 A;  4QU1 A;  1O5U A;  4M3C E;  5FZ4 A;  1VLN A;  3PVN A;  4YM0 A;  5DZF A;  2WLQ A;  3IAP A;  5FP7 A;  3SXW A;  4ET7 A;  2R7E B;  2WII B;  5FZF A;  4QDR A;  1DG6 A;  1CIY A;  2WZR 1;  4QPG C;  4XCA A;  4ZZ5 A;  5FLH A;  1QXR A;  4PBP A;  1WCK A;  4QHB A;  3VB9 A;  3VDD B;  2PAK A;  2WYS A;  2ZMN A;  5F6L B;  2DVG A;  4IES A;  1SBD A;  4AGR A;  5C6C A;  3I59 A;  3OG2 A;  1MZ6 A;  4QMA A;  1QJZ A;  2AZ5 A;  4B7K A;  4BMB A;  5C9A A;  3T1M A;  3DKQ A;  5FZ9 A;  5J3U A;  1YI7 A;  2RS1 1;  1TME 3;  1PVC 1;  4Y1X A;  1R09 2;  4Z2W A;  1RUC 2;  1WZX A;  5LW9 A;  4KGG A;  4P08 A;  2VVD A;  1UZ0 A;  3E5X A;  4LIU A;  4OCT A;  4CDU B;  2W5F A;  2ZZQ A;  2BVV A;  4LE3 A;  4Q0Q A;  4QGN A;  3KT7 A;  5I0R A;  4FAG A;  4LO4 B;  1GOG A;  1S0G A;  5FRE A;  2BFU L;  2Y6F A;  4C8D A;  3FFQ A;  3P3P A;  1YUD A;  1VRB A;  2BFU S;  4XXA A;  1JZ5 A;  2BWA A;  4MLO A;  1Y9Q A;  1WLT A;  1DGL A;  1JOP A;  5EP9 A;  5IK8 A;  2DFB A;  3AL5 A;  3FFZ A;  1RUF 3;  5FZK A;  2Q8C A;  4N43 C;  3FLT A;  2BW8 A;  5KHH A;  1OOP B;  2PFW A;  2R0H A;  3C7G A;  1GBG A;  4LTA A;  5IVJ A;  2WT2 A;  5JI9 A;  5IVB A;  4JKK A;  4NHL A;  3TWI A;  1CIW A;  4CCK A;  3N9N A;  4MVT A;  2Z2S B;  5IJR A;  2XGX A;  5C33 A;  2DTW A;  3WW4 A;  4D6S A;  2DTY A;  3TEX A;  4BCU A;  3DXT A;  3CJI C;  3HN1 A;  4LIT A;  3GBF A;  3BGA A;  3ACI A;  1X36 A;  5DAB A;  2ADD A;  5IUQ A;  1VBB 1;  1LOB A;  1MS4 A;  2VZT A;  3KQ4 B;  2RG4 A;  1O3T A;  4IEY A;  1AF9 A;  2XQR A;  3J9S A;  4MYE A;  3WEZ A;  1KDK A;  3KQR A;  1RHI 2;  1RGS A;  1VB2 A;  5FZM A;  1US3 A;  4GB3 1;  4YW7 A;  1AXZ A;  3IIA A;  3SHR A;  1H2N A;  1QQP 3;  4MX3 A;  4XAA A;  3I2K A;  1QGL A;  4QD2 A;  5CVR A;  1RB8 G;  4XUR A;  1ZZ7 A;  3MLK A;  3O1R A;  2EID A;  2YGM A;  2WFF 2;  1W3V A;  1ASJ 3;  3AVR A;  2VW0 A;  5FRA A;  2JEN A;  2A75 A;  1KFU L;  4CVU A;  4PBO A;  1UY3 A;  1W2U A;  3WHT A;  1G6N A;  3OTF A;  5DMY A;  1A34 A;  2OXB A;  1GNY A;  4O9G A;  1N1T A;  4IER A;  4CTE A;  2VGD A;  4XDP A;  1K42 A;  1YRZ A;  3A22 A;  3MLL A;  2JJ6 A;  5C3P A;  4MG2 A;  3IPV B;  4R9C A;  2KA3 A;  5ACA 3;  4BIO A;  5C5T A;  3VZN A;  1Q5O A;  1VBD 2;  1GFF 2;  1SMV A;  3OB8 A;  5FK7 A;  1BLZ A;  5L7O B;  1HW5 A;  3WQB A;  1UOB A;  3EYP A;  2OKX A;  4IDZ A;  4BXF A;  2VOW A;  5FWE A;  5KR7 A;  1LES A;  1ENR A;  2Q4S A;  1CON A;  4GD4 A;  1LEM A;  1D0H A;  4RGA A;  3HR9 A;  2W0X A;  2VQU A;  3IDB B;  2ZTN A;  5FYT A;  4AED B;  4QX8 A;  4M3C A;  4GWI A;  4HVQ A;  1UY4 A;  1CGP A;  1W9W A;  3T0A A;  3ZFE B;  4NIG A;  5T3N A;  4YZ5 A;  5C3R A;  2JXA A;  2RM2 1;  5FBZ A;  2X10 A;  5EHD A;  4GXL A;  4H3W A;  3QAC A;  4MGK E;  4GIQ A;  4P9W A;  5EWS A;  4M3C F;  1PO2 2;  3ZXG A;  5IFT A;  1V6J A;  3VGI A;  4TLG A;  1UF2 C;  2GH8 A;  1QU0 A;  1DF0 A;  4D8M A;  4LUK A;  3O1T A;  4UW5 A;  1W8O A;  4D7Y A;  5I91 A;  4CUA A;  5D8A B;  2QE3 A;  4YGD A;  4AR2 A;  4HMZ A;  3E97 A;  1O7F A;  1ZBE 1;  2Q1M A;  5T55 A;  2HLE A;  3WDY A;  3RZJ A;  1PGW 2;  4YVW C;  2VM9 A;  1HB2 A;  4KQ7 A;  5H9R A;  4NVP A;  4O9E A;  3RS6 A;  3S57 A;  1M4W A;  2JIC A;  2WNU B;  4JTN A;  5IAT A;  4ZKT B;  5ABJ C;  3WHU A;  1YHF A;  4ASM B;  4ZHN A;  2XL7 A;  4KWJ A;  2WNV C;  4CEY A;  4E4D X;  2XWJ B;  4FFG A;  3RI8 A;  2QQN A;  3AFG A;  1C5I A;  2J1T A;  3Q8C A;  2AC1 A;  4Y33 A;  3FC0 A;  1DBN A;  3NKG A;  4BLI A;  3D0S A;  2PTM A;  5CEH A;  4L99 A;  4OMC A;  4CEW B;  4LE4 A;  1LGB A;  1RXG A;  3CL1 A;  4TYS A;  3F2Z A;  1L7L A;  5EZW A;  1NG0 A;  3HAG A;  2Y6L A;  2A73 B;  4UBG A;  1AYM 3;  4NII A;  4WV8 A;  4CPB A;  1LAJ A;  5GZD A;  2WC2 A;  1V6O A;  3V64 A;  2OZ6 A;  3WUC A;  1J3Q A;  3B3Q E;  3RJR A;  2Q5T A;  1GZ9 A;  4YG0 A;  1UYX A;  1W8Z A;  3FZ3 A;  1AXY A;  1DGW X;  5C7G A;  1GR3 A;  1R09 1;  1RUC 1;  4WVZ A;  1MEC 2;  3I2F A;  2VG9 A;  5KXE A;  1Q3E A;  4TWT A;  1L3J A;  3NMB A;  4JRL A;  1OVP A;  5FZD A;  3IDE A;  4YG6 A;  4Z1V A;  1AUY A;  4HOO A;  4OMD A;  2FCU A;  4M4P A;  4COV A;  5E88 A;  1HB3 A;  2WRA A;  3U14 A;  1YIP A;  1ST8 A;  3R4S A;  4DS0 A;  5C71 A;  3LOB A;  1YQ6 A;  5LY1 A;  2YBK A;  4CDX B;  1VBE 3;  4LKF A;  2IWG B;  3NQH A;  4F83 A;  4OUL A;  1NZC A;  3VBO A;  4UFL A;  1UMZ A;  4LBN A;  3M3C A;  3PIG A;  4YRD A;  4QX5 A;  4CRQ A;  1DFQ A;  2PQQ A;  1JS9 A;  3AFK A;  1X9P A;  3Q9O A;  4K1Z A;  5IWF A;  2WZP P;  5BNN B;  2X8K A;  3LZZ A;  5FLI A;  1BEV 3;  3OPW A;  1SPP B;  3ST7 A;  3WY6 A;  3V0A A;  2RDN A;  5JMO A;  1CPN A;  3KGL A;  4IUG A;  1SLC A;  1W9S A;  3JU9 A;  1S4C A;  1NXM A;  3TNQ A;  2P3J A;  4E4H A;  1FNZ A;  2QDN A;  2XBO 3;  3H3L A;  4AQ6 A;  5B2G B;  4QQ2 A;  2D6P A;  1W6P A;  4AK3 A;  3ZOI A;  4CE8 A;  1Z0H A;  1FOD 2;  4E4Z A;  1DQ4 A;  1O4Y A;  1VRH 3;  1RHI 1;  3BAL A;  1V9U 1;  1WW5 A;  3ACL A;  1GZC A;  4WM8 B;  3NV2 A;  3THP A;  1V00 A;  1MS3 A;  1C1F A;  1IOA A;  4CP9 B;  2ZCW A;  1JW6 A;  4FPF A;  1RED A;  2MPF A;  4CDQ A;  2R49 A;  4RHV 3;  5LAT A;  5LCW L;  2P1B A;  1K5M B;  2RVA A;  1KXG A;  2WFF 1;  3H1M A;  1MS1 A;  1G7Y A;  1ZZ8 A;  2I45 A;  4N53 B;  2RDR A;  4UFM A;  4E27 A;  3BU0 A;  2VMH A;  1GLH A;  3FLR A;  3TNP B;  5JOW A;  3B69 A;  1WLC A;  5EYX A;  1O8P A;  1HN0 A;  1QJU 2;  4PT6 A;  4HON A;  4OHZ A;  5LA0 A;  3KT1 A;  4GMP 0;  1YC6 1;  2J1V A;  4KWU A;  4GMP 3;  3VBF C;  5I8T A;  4UF0 A;  3RWK X;  4I0W B;  3HBZ A;  5J1X A;  2D5H A;  4LBM A;  5LAS A;  1JOJ A;  2BOI A;  1LOF A;  1NA1 B;  3P3N A;  4G3Y C;  3VL9 A;  4LUL A;  4FPL A;  4CCM A;  3DGT A;  1UYZ A;  1VBD 1;  5I0S A;  1S2K A;  2VW1 A;  3POW A;  3FJS A;  1JYI A;  1Q8V A;  2XJS A;  4ES9 A;  4IEX A;  5FYZ A;  4IV1 A;  2CYF A;  2BJS A;  4KGQ A;  3FWE A;  3LKJ A;  4NRQ A;  2BWC A;  3RJ2 X;  5FPX A;  4IE5 A;  1YXW A;  2VZP A;  1VBA 3;  2HWD 3;  4HPK B;  2P34 A;  4PIZ A;  1MAC A;  2QQM A;  4KU7 A;  4OYU A;  4PDW C;  1MS9 A;  2DFC A;  3KV4 A;  4K9S A;  1H2L A;  4XBN A;  3H7Y A;  1AR9 3;  3R4U A;  3BTZ A;  1NCR A;  1PO2 1;  2CAU A;  1E5R A;  1OQE A;  3O7O A;  1OA2 A;  1FMD 3;  2AGS A;  2RJ2 A;  2VEC A;  1SLB A;  3V0B A;  1PK6 C;  1O59 A;  5L36 A;  1XSR A;  2BEO A;  2R04 3;  3ZDV A;  1DZT A;  1Y43 B;  3WW2 A;  5IHR A;  4AI1 A;  3III A;  3HQR A;  4FTS A;  4K20 A;  4LBQ B;  4CU6 A;  2RR1 2;  3A23 A;  1J1T A;  2B39 A;  4OQ8 A;  1PGW 1;  2ZMK A;  3H8O A;  2K2S A;  3NWK A;  3FL7 A;  2EAL A;  4Z82 A;  3I2D A;  1LEC A;  2JG9 B;  2LAL A;  1ND2 C;  3X29 B;  3NAP A;  2BOJ A;  2DUQ A;  1NCQ A;  1QDC A;  1REF A;  3ZFF B;  1S1A A;  5FZ0 A;  1WBL A;  1SEF A;  4QT6 A;  5FPV A;  1GQG A;  5FXW A;  5HPO A;  3OUH A;  2BBV A;  4NHK A;  3KZ4 C;  5FLJ A;  1N1S A;  4UXA A;  3WDW A;  3VKN A;  3ZYF A;  5JZG A;  1YQ5 A;  4CZS A;  4NHX A;  1PX4 A;  1GP5 A;  3SKJ E;  1CAW A;  3MF9 A;  1MS5 A;  4XOG A;  4A3Z A;  3O0W A;  2RDS A;  4B1M A;  3J8F 2;  5EXO A;  1LKN A;  2WAB A;  2WT1 A;  3S30 A;  4JVA A;  3RFR A;  3IMN A;  4MGI E;  3VBU A;  5A3L A;  1ENQ A;  1FYU A;  1MEC 1;  3ME2 A;  4R9D A;  4I02 A;  1OA4 A;  2G9G A;  2C9K A;  2VMG A;  2XKP A;  1GZT A;  5K9Y A;  3U07 A;  4IV3 A;  3THD A;  2CY6 A;  4A42 A;  4CDU C;  3M3E A;  3J7L A;  3AB0 A;  4Y26 A;  3R6S A;  3KVA A;  4URT A;  1NOV A;  1UY2 A;  2WIN B;  1JUH A;  2XHN A;  2ZX1 A;  5A7W B;  2ZEX A;  3WCS A;  1LEN A;  1WGP A;  5DZE A;  3W5N A;  3DPR B;  1WD3 A;  2Q0A A;  4ONU A;  1COV 2;  2WL1 A;  2ET7 A;  4AFB A;  4G9S B;  1K3I A;  3HEI A;  5DAV A;  1U12 A;  5JXI A;  4M00 A;  3RI9 A;  1STM A;  4TSV A;  1VAM A;  1AVB A;  4JGY A;  5C8C A;  4GZ9 A;  3VBS A;  2ZX0 A;  4LK6 A;  5FZO A;  1WW7 A;  4TTG A;  2WZR 3;  3AP6 A;  1FT9 A;  3ATG A;  3JUU A;  2V72 A;  4GH4 C;  4FSJ A;  1QOS A;  2BNN A;  2RS3 2;  1HQN A;  2OT7 A;  4XFH A;  5D1I A;  4NWW A;  1FOD 1;  3BPZ A;  3KD4 A;  4MET A;  1CVN A;  3ZYP A;  1IPS A;  4RSU A;  2VUD A;  2BNM A;  4LKD A;  4YVS B;  1XPW A;  5FP4 A;  3NKT A;  1ALY A;  2G4I A;  5CG9 A;  3ZSK A;  3Q8A A;  2RS1 3;  4K40 A;  5A3W A;  2QQJ A;  4ATE A;  4DIQ A;  1PVC 3;  4ASK A;  3SMH A;  4Q8K A;  4XFI A;  3VBR C;  1R64 A;  4JGZ C;  5JPN B;  2UU8 A;  4P14 A;  4XTM A;  1FPN 2;  3HT1 A;  5KHJ A;  1UW8 A;  2ARB A;  1QJU 1;  1CQ9 A;  2R1B A;  4ERO A;  3AXE A;  1J3R A;  3VL8 A;  4CU8 A;  2VO5 A;  3B94 A;  5JPM B;  3LIH A;  3IDC B;  4K1Y A;  3KMH A;  4QDQ A;  3DXU A;  4BDV B;  3RZM A;  4ZS2 A;  2XQX A;  3H3Z A;  1KFX L;  4YGC A;  3UKV A;  3ZN6 A;  5DPN A;  1LUL A;  4R52 A;  3V65 A;  2D5F A;  5T5O A;  3DEC A;  5J37 A;  3NJZ A;  4U36 A;  1OBN A;  3SIT A;  1B35 C;  3O0X A;  4S2H A;  1G9D A;  1Z7S 2;  2JB8 A;  3C7O A;  4A44 A;  2OUJ A;  1HJF A;  2VCM A;  3MPP G;  2QQI A;  3LEK A;  5CZK A;  4RR3 A;  1YYN A;  4D7T A;  1V6N A;  1VBB 3;  2B46 X;  5JXH A;  2GDF A;  1H6X A;  4W4Z A;  3EQE A;  1W03 A;  3RGB A;  1FV3 A;  4UAP A;  2P5B A;  3K3O A;  1Y4W A;  2BBA A;  3VKL A;  1BMV 2;  3OSD A;  4GB3 3;  3H42 B;  1ULO A;  1GP6 A;  2P2K A;  3CU7 A;  4ORF A;  2CTV A;  3P1I A;  4V2W A;  4QX3 A;  4F8A A;  5IVC A;  2O1Q A;  1MS0 A;  3ABZ A;  4XJZ A;  3LAG A;  3J7H A;  1KJR A;  3PUH A;  1YLL A;  2RR1 1;  4PF1 A;  2LRP A;  2E26 A;  2X5I B;  1IS4 A;  1GV9 A;  1TQ5 A;  5CB7 A;  3VLB B;  3OUJ A;  3H1Y A;  5D8A C;  3OBA A;  1REE A;  4QPG A;  1UYY A;  1NQD A;  2VBB A;  1N3O A;  2Y0I A;  4FQ4 A;  3JB4 C;  4BK5 A;  4BHP A;  2WWU A;  3TEY A;  1KD7 A;  1VIW B;  1HRV 1;  2WNU C;  4YSF A;  5F37 A;  2CAV A;  4BU2 A;  5IVE A;  3K48 A;  3U37 A;  4LBQ D;  2PAE A;  4CA9 A;  1J3P A;  2XKO A;  4GJY A;  1VAV A;  1OD5 A;  2ZEY A;  1RVF 2;  4CP2 A;  4AEM A;  2BP6 A;  1C57 A;  3DUI A;  1QEX A;  3J8F 1;  3WW1 A;  5E6H A;  4CEW C;  1UYP A;  1J83 A;  4LK7 A;  4IND A;  3FHQ A;  4S2F A;  2BU9 A;  2P3I A;  5FUP A;  5I0D A;  1VMF A;  2PHT A;  3DN7 A;  4F7Z A;  5CIS A;  1MQT C;  2JG8 B;  1W05 A;  2K46 A;  3N9O A;  5FZI A;  1JYT A;  3LPG A;  3ZXK A;  2B45 X;  2RM2 3;  5FPU A;  4PI2 A;  4QQP A;  2HEW F;  2ET1 A;  1PNF A;  2R07 2;  2ZX4 A;  3OYW B;  5J09 A;  1IKP A;  2UWB A;  3E5U A;  1W9T A;  1XNA A;  1BVV A;  5C3S A;  1UWW A;  1UCX A;  2EXK A;  1A3K A;  1UN1 A;  2ZGP A;  1HRI 2;  3JXS A;  5A3O A;  4OZX A;  4N43 A;  5F9T A;  4ZXE A;  2VL4 A;  3EHK A;  1COV 1;  1ZBE 3;  5CKM A;  2JD9 A;  1DQ2 A;  2WT0 A;  2Y34 A;  4XIO A;  5AFB A;  3NNF A;  4D6R A;  1RYY A;  1XNB A;  2O8O A;  2OW4 A;  3CJI A;  3RVH A;  2AR6 A;  2IFW A;  2AEN A;  2R1D A;  1YJL A;  4JCK A;  2VW2 A;  5CNA A;  3T0D A;  2Z42 A;  5H9Q A;  1NUK A;  4I0B A;  4ES8 A;  4K6B A;  2ZML A;  3MUZ 1;  2RS3 1;  4YYO A;  2XH6 A;  5DDJ 2;  4W65 A;  4YZ1 A;  3WVJ A;  2IXK A;  2VQ0 A;  3Q8E A;  3AP5 A;  1DDL A;  3ECQ A;  3ZXE A;  4HKL A;  3JBG 1;  1OLR A;  4BQ1 A;  2PYT A;  3CHX A;  2E31 A;  2A1X A;  1X7N A;  2E7Q A;  2VTX A;  4IEW A;  3RDI A;  1UNB A;  4XFC A;  4CUC A;  1N1V A;  3ALQ A;  3Q8F A;  4YW6 A;  3B7M A;  4IEO A;  2IXC A;  4U2A A;  3I8T A;  2XLG A;  3BN6 A;  4L11 A;  4YGB A;  4CCC A;  5ANN A;  4HT1 T;  3ZSM A;  1R09 3;  4IGQ A;  1RUC 3;  5A33 B;  3ITQ A;  4FCA A;  5FV3 A;  2ZKL A;  5DUV A;  3NNJ A;  3VN4 A;  4Y22 A;  1FPN 1;  1RUD 2;  5A1A A;  2GP3 A;  4M0N A;  3AYD A;  1W90 A;  4AHW A;  1UMH A;  3UNP A;  3M3Q A;  2J22 A;  4CDW C;  3KF5 A;  5BNP B;  2C1F A;  2QZ2 A;  1YQC A;  4IGP A;  4Q26 A;  1NKG A;  2H6B A;  3G6J B;  1PZ7 A;  4JV4 A;  2ZBJ A;  4UWD A;  3S6P A;  2XHK A;  4EN8 B;  3OGS A;  5FQ0 B;  1JZ4 A;  1I1E A;  4ATF A;  4KI5 M;  3GF6 A;  5EFU A;  3RZZ A;  4CCL A;  3D0J A;  3VBH B;  1LOE A;  3KWV A;  1VR3 A;  5FKC A;  1NA1 C;  5FYM A;  1VAL A;  3A4U A;  5FWJ A;  1BXH A;  3VHO A;  3USS A;  1OLM A;  3WF4 A;  4BQX A;  1XE8 A;  1OH4 A;  3L2H A;  4Y1Y A;  1KIT A;  5JIA A;  3ZYH A;  4AOC A;  1L7Q A;  1Z7S 1;  5HXM A;  3OBR A;  4AI9 A;  4OHW A;  4XF1 A;  5BNO B;  4QAW A;  3ORJ A;  2WLP A;  3L2Y A;  4ISQ A;  5JI7 A;  4RGG A;  3ROU A;  1H6Y A;  1LOD A;  4GUL A;  3R05 A;  3AYE A;  4QB6 A;  4ZY9 A;  2E7A A;  5A7O A;  1PHM A;  1RHI 3;  2NP0 A;  1V9U 3;  1BMV 1;  2MEV 2;  1MVQ A;  2IZW A;  2LS6 A;  5T50 A;  5BUV A;  3ZIX A;  2Y6H A;  2WZ8 A;  4AI8 A;  2JKX A;  4JTO A;  1DU3 D;  3WV6 A;  2OA2 A;  2I74 A;  4Q0S A;  3VZK A;  1URX A;  1EAH 2;  1L7R A;  3I59 B;  2WFF 3;  3T2P A;  5C9A B;  1PZ8 A;  2AAC A;  4LOS A;  4AF9 A;  5ABJ A;  1ND3 C;  4J1W A;  2WNV A;  4AZZ A;  4Y1Z A;  4E2Q A;  4BWO A;  2W91 A;  3OBZ A;  4XZP A;  5K0U C;  4AWD A;  4AVB A;  5KC5 A;  2ZGK A;  1JYX A;  3MV0 1;  4LHL A;  2VZO A;  3D82 A;  1Q8P A;  3GCW A;  4IEQ A;  5LEK A;  1I5Z A;  5FO8 B;  3HVD A;  3B02 A;  3CKH A;  1DP0 A;  1S0I A;  4FPG A;  1VBD 3;  4HBN A;  1QMJ A;  2NM1 A;  3AMH A;  3K2O A;  4YAR A;  2EXJ A;  4EQV A;  1MZ5 A;  1RVF 1;  1BZW A;  2LM3 A;  1UPS A;  2JE7 A;  5HV4 A;  4YM1 A;  2VNG A;  5F5A A;  2IUW A;  4Q2F A;  4QB1 A;  4JDN A;  1J59 A;  3AKQ A;  3PMS A;  1QHD A;  4I09 A;  1LU2 A;  3PDQ A;  3A0K A;  2HWE 2;  2IXI A;  4AXO A;  2GC1 A;  4WM7 B;  5FP9 A;  1US2 A;  2F4L A;  2YY1 A;  3ILF A;  3KVB A;  3R4D B;  4XUP A;  5FY0 A;  3T2T A;  4ZU5 A;  3POF A;  1XND A;  1W2O A;  1M06 G;  1N3Q A;  2R07 1;  2PN5 A;  1PO2 3;  4XPV A;  2Z69 A;  4KWL A;  3V56 A;  5I0T A;  4P9G A;  2ZGT A;  3WG4 A;  2FD8 A;  2PMW B;  3C3V A;  4QKF A;  5I8S A;  4P00 B;  2XJQ A;  2WR9 A;  3RNS A;  4MGT A;  3O12 A;  1TZO A;  3HN3 A;  1AR8 2;  1UX7 A;  5LK5 A;  4COU A;  2Y0O A;  4OHV A;  5LBE A;  4WZF A;  5LZ6 A;  3WXP A;  4H2A A;  2EF6 A;  4YW5 A;  1QOT A;  4NAO A;  4YM2 A;  1XU2 A;  3RMX A;  3DPR C;  1ODN A;  4OLL A;  2JDA A;  1RTV A;  2XL9 A;  3OEA A;  2WO3 A;  3CLP A;  3D8C A;  3SCF A;  4FAH A;  5CFD C;  2DU0 A;  5F2S A;  4LXL A;  4FPK A;  5DDJ 1;  2OPW A;  1AJK A;  3MV1 1;  3OGG A;  5A3P A;  1S2E A;  4LBL A;  1GWM A;  2VBD A;  3ZYG A;  2A5Z A;  2CGO A;  3N9Q A;  2VY0 A;  2H6C A;  1RIT A;  4XJW A;  4AEJ A;  3UJQ A;  2BDR A;  3IT8 A;  2P17 A;  1CAX A;  2UY9 A;  3USU A;  5CFC B;  4FOV A;  4JHZ A;  4HKW A;  3LIG A;  2J1S A;  5DAX A;  1SFN A;  3I3E A;  4QHO A;  4M01 A;  4FFF A;  2C0Z A;  4O65 A;  4YVS C;  3W58 A;  3TBD A;  4ASL A;  5F5I A;  2XJP A;  2ZOE B;  1PM4 A;  4QHZ A;  1RUD 1;  2ZHK A;  4XYX A;  4F3J A;  5GZC A;  2XDV A;  5J36 A;  4N9H A;  1NY7 2;  2Y26 A;  4M3C B;  1OQ1 A;  5D2A A;  2QNK A;  3I54 A;  4JZR A;  3GHN A;  2GNB A;  4AAX A;  4CP0 A;  1ZYB A;  4FT8 A;  1RUE 2;  1RUH 2;  4XQW A;  1PGS A;  1OFN A;  2FHR A;  4W6W A;  3AK0 A;  4Q4Y 2;  4FVV A;  4DQA A;  3N35 A;  4C90 A;  2ZGR A;  3LEG A;  5FY5 A;  3FX3 A;  2OX0 A;  4H14 A;  1UXX X;  4FXK B;  4XDQ A;  3JQX A;  4YGE A;  1Y3T A;  4JQT A;  1KRI A;  4XJ8 A;  2YDE A;  1W2N A;  2VBP A;  1LRH A;  1LOA A;  1DQ1 A;  3AMQ A;  2Q8O A;  2O0O A;  5JXG A;  1JZ7 A;  2VU9 A;  1JYV A;  4PDW A;  2O14 A;  4ZU7 A;  3LFM A;  3J26 N;  3LSD A;  5FZB A;  1ULG A;  1NAE A;  4E4S A;  4DUV A;  1S0F A;  4AG4 A;  3MID A;  2Q8D A;  3THC A;  1G9A A;  5IVY A;  1VB4 A;  4RQP C;  4CXX A;  4CEY B;  1FOD 3;  1RIN A;  3T30 A;  1WME A;  3GYD A;  1PK6 A;  3KF3 A;  5AFE A;  2IVI B;  2IXH A;  2A6Y A;  3I2G A;  2MEV 1;  1W6O B;  3P6B A;  4TN7 A;  1BBT 2;  4FOQ A;  2CWM A;  1NQJ A;  5KC6 A;  2D6M A;  1DQ5 A;  1IS6 A;  2VJX A;  4I3P A;  5JSP A;  2P3Y A;  1IPJ A;  3BU7 A;  5LK7 B;  1EAH 1;  4XCB A;  1ZZC A;  4XF9 A;  3ZN4 A;  3I3B A;  2FDJ A;  3AZW A;  4DPN A;  3HQX A;  1ND2 A;  2QJV A;  4Y24 A;  2BVB A;  4BQ3 A;  3ZXD A;  1QJU 3;  3ZXJ A;  5IVF A;  2QCS B;  4AQ2 A;  2NMN A;  2G9Z A;  1H1M A;  2CDP A;  3GZE A;  1W8F A;  1AR6 2;  1W04 A;  1DGR N;  1W2A X;  2Y6G A;  2WA4 A;  3RRD A;  4D69 A;  3QH7 A;  1DZQ A;  1F5J A;  2VUL A;  3I3D A;  4J1X A;  1F31 A;  2VD7 A;  3PVO A;  5J98 B;  1KS4 A;  3B5L B;  4Z92 B;  3RZH A;  1H2M A;  1J1L A;  4R9B A;  2GZW A;  3TB0 A;  4B1L A;  4IE7 A;  2E7T A;  3C8X A;  3FLP A;  2OII A;  1OPO A;  4PF5 A;  2VCC A;  3WF1 A;  3VBO B;  5GZE A;  4BQ4 A;  1H4H A;  4RS5 C;  5H9P A;  2VME A;  1OKQ A;  1YIF A;  2G1M A;  3B00 A;  3MW4 A;  1CX1 A;  3BOP A;  2VNO A;  2JEM A;  2HWE 1;  3RYP A;  3EB7 A;  5FMC A;  3V0A B;  4W50 A;  3ACH A;  5FJK A;  4CDU A;  4D3W A;  3ZR5 A;  2JG8 C;  2AH2 A;  3AZZ A;  4Y1U A;  3BTY A;  2A3Y A;  3UV9 A;  1W6P B;  3N9P A;  3BKZ A;  5GJ6 A;  1SLT A;  5JOX A;  4Q4W 2;  2DUO A;  1RUI 2;  2XG3 A;  3BIW E;  3KM5 A;  4BE3 A;  5LBF A;  4B4Q A;  2NLR A;  3ES1 A;  1AR8 1;  1D2S A;  4YM3 A;  3I2J A;  2Q1Z B;  1UKG A;  3IDA A;  2RR1 3;  3IMM A;  2D93 A;  1RUG 2;  2WFP A;  3L9J T;  5SV8 A;  4CDQ B;  3NJV A;  1NX9 A;  3CMG A;  4GH4 A;  2VMD A;  2BGC A;  3BPS A;  2HYK A;  1UIK A;  1XBF A;  1MR5 A;  1HRV 3;  3M2M A;  1MPX A;  2UYB A;  2ZGN A;  3U10 A;  5IW0 A;  4C1X A;  1S0D A;  1ODM A;  4LIV A;  2C6S A;  3WP3 A;  3W59 A;  3ILN A;  3M3O A;  2FZ2 A;  3I3Q A;  3TYJ A;  3J8F 3;  3I2O A;  1VMH A;  1H0B A;  1GQH A;  1I5P A;  3VBR A;  1LB2 A;  5EQU A;  4JKM A;  4JGZ A;  3ENR A;  5DG1 A;  2WN2 A;  5IT6 A;  1FNY A;  2H0B A;  4M4R A;  4IV1 B;  4Y20 A;  4YW2 A;  1QKQ A;  3SEE A;  4W6X A;  2VOK A;  1K12 A;  1KQR A;  1HN1 A;  2OVU A;  1F5F A;  5FKB A;  2P6C A;  1NY7 1;  3MW2 A;  1TME 2;  2EIC A;  3EBR A;  4BA6 A;  1WWY A;  1S0C A;  3VKM A;  3SNM A;  1GZW B;  4NID A;  4KMQ A;  4MGQ A;  4ZON A;  1RUE 1;  1O3S A;  1RUH 1;  4GA9 A;  4L2N A;  3VKF C;  4LR4 A;  4NHY A;  3VV1 A;  2FDH A;  1W6Q A;  5LRR A;  1TMF 2;  4YW3 A;  4Q4Y 1;  1AL2 2;  3JB8 A;  1B35 A;  1BVP 1;  5CG8 A;  1RMU 2;  4QGL A;  4QQH A;  1COV 3;  4LT5 A;  3WG3 A;  2PHU A;  5IK4 A;  2XXZ A;  1OSG A;  2W47 A;  3VDA A;  1R08 2;  1ZZ6 A;  4MV2 A;  1ZRR A;  3T0B A;  3VBH C;  4R9A A;  3TAY A;  3WF2 A;  3ZSJ A;  4G4F A;  1D4M 2;  4BLJ A;  2B7Y A;  2YZ4 A;  3RZL A;  5BY5 A;  4Y5Z 0;  1R1A 2;  1BKZ A;  2RS3 3;  1AL0 G;  5E1R A;  2VZU A;  3NAP B;  1C28 A;  2C9A A;  5C3Q A;  1NCQ B;  3BVC A;  5BNO C;  1IKQ A;  3JBG 3;  1U5I A;  5LA9 A;  4TLF A;  4BZ4 A;  1BBT 1;  5JCT A;  3C2U A;  3OGJ A;  3QH6 A;  3OGR A;  5C8W A;  5F3I A;  5JZG B;  4BIS A;  2EXI A;  1CAW B;  1QXP A;  2WYF A;  1YFY A;  2MNG A;  2ZX3 A;  5FYS A;  2ILM A;  4HN0 A;  5D8A A;  1UU5 A;  5L73 A;  5T5L A;  3MIF A;  1V6L A;  3LSE A;  3ZM8 A;  5FZG A;  3ZVX A;  4IEZ A;  1LOC A;  1CX4 A;  1FPN 3;  2QQK A;  2ZGQ A;  4JKL A;  2E53 A;  4N8M A;  3SIS A;  3VBU B;  1JYN A;  3AM2 A;  1ASJ 2;  4FFI A;  1O3Q A;  3H8U A;  4BPZ A;  3LQC A;  4C0H A;  2BGO A;  2L9L A;  1JHJ A;  4GWN A;  1HJG A;  5F5Q A;  2PHR A;  1AR6 1;  1G8W A;  1PGL 2;  4IV3 B;  2Y38 A;  2W1Q A;  2R6Q A;  3GBW A;  3ILR A;  4HN1 A;  4CPB D;  1U0A A;  1AX0 A;  1C8M 2;  5AC9 2;  4QDS A;  1NLQ A;  5DZG A;  3OJB A;  4YNI A;  1BJQ A;  2VC9 A;  2ZAB A;  5IK5 A;  1POV 1;  5I93 A;  1DYK A;  1GAN A;  2EIE A;  1UXZ A;  4AAP A;  1MQT A;  2R16 A;  3HOB A;  1Z7S 3;  3WF3 A;  1ULE A;  4QXH A;  3WP5 A;  4MUV A;  2HYX A;  2XJR A;  1XE0 A;  3RZG A;  1GOH A;  1XNK A;  3MIB A;  1EUT A;  3W5M A;  4Z8B A;  1YFX A;  2BQP A;  5C8C B;  3CZJ A;  1W8N A;  1BYH A;  3E1F 1;  4ARX A;  2B5H A;  5FZO B;  1X8E A;  3SCH A;  4ZXK A;  4WM7 C;  1APN A;  1PZ9 A;  3PJQ A;  2DF7 A;  2J1U A;  3HQU A;  1ZA7 A;  4HFS A;  3U75 A;  4QPI C;  3WUD A;  1NZI A;  2DU1 A;  5GKA C;  4S2D A;  4Q4W 1;  4DFS A;  1RUI 1;  3I2H A;  1D2Q A;  2DVD A;  5HCF A;  1W8W A;  2JDY A;  2FZ1 A;  4DEQ A;  4DIN B;  1SZB A;  1ZRI A;  2PHF A;  4XVH A;  1D0G A;  4XUO A;  1RUG 1;  3T08 A;  4V2V A;  3AKT A;  3GZT B;  4QM9 A;  3ON7 A;  4LKE A;  2HWB 2;  3WDX A;  2K0G A;  2XR4 A;  1U5X A;  4XMI A;  5FY8 A;  2X05 A;  1E5I A;  3MYX A;  2VUC A;  4TXW A;  3B9C A;  5HBA A;  3VDD C;  2A7A A;  3PIJ A;  5F6K A;  3NL1 A;  3AZV A;  2JB4 A;  2XOM A;  1ZBA 2;  2VZ3 A;  3UES A;  1RVF 3;  1JH5 A;  1D7P M;  3LA3 A;  4AQS A;  1SG3 A;  4CSW A;  3S5A A;  3ZN6 B;  2W1S A;  4AVV A;  3WLU A;  1H8T A;  1POQ A;  4Q8L A;  1UOF A;  5EV7 A;  1N1Y A;  1AYM 2;  5CFC C;  4GAL A;  2P37 A;  5FP8 A;  2C26 A;  4CDW A;  3N36 A;  1A78 A;  5KBF A;  1UU4 A;  3MO4 A;  3WP6 A;  3LDR A;  4MH0 E;  1TME 1;  4Q1R A;  2R07 3;  1XOY A;  2TNF A;  2DCY A;  4I3G A;  3APB A;  1JTZ X;  2W46 A;  4LNV A;  4MO3 M;  4FPH A;  2VE1 A;  4AW7 A;  1OC1 A;  3T4V A;  3GGL A;  1TMF 1;  4Q4X 2;  4UYB A;  3HT2 A;  1GYK A;  1AL2 1;  1UZZ A;  1BQP A;  1RMU 1;  4FPJ A;  2AYH A;  3ZPY A;  1O6U A;  4CCO A;  2RHP A;  1ZNP A;  1H30 A;  2R06 2;  1OOP C;  1R08 1;  5C4W B;  1OFS A;  3D3A A;  2A6W A;  2HWC 2;  4JX0 A;  3ZO0 B;  4AI2 A;  4EJR A;  3CJX A;  2QQU A;  2VQA A;  2FCV A;  3QBQ A;  1D4M 1;  4D7S A;  2K9Z A;  1NLR A;  1XRU A;  1WA4 A;  2P4E A;  4RD7 A;  1KS5 A;  1R1A 1;  2A6V A;  3EO6 A;  4HPK A;  3LGR A;  1XNT A;  5DDJ 3;  3TRS B;  5DAP A;  1AHS A;  3LDK A;  5ANQ A;  2YUE A;  1OLQ A;  5FMB A;  5T54 A;  1ZVF A;  3J7M A;  4XFA A;  1VPH A;  4SLI A;  1J58 A;  2RS5 2;  2WKK A;  1WLD A;  2ORX A;  3MI8 A;  4RYD A;  2BER A;  2NMO A;  1WMD A;  2OZJ A;  4NR1 A;  2C4X A;  4LA3 A;  4RA0 A;  1Z78 A;  3OY8 A;  2W1U A;  1CJD A;  3S7E A;  5A32 A;  1ND3 A;  1QH7 A;  4QQO A;  3AYC A;  3VZM A;  1W6M B;  1I6X A;  4GAZ A;  3ZYR A;  4K3U A;  4NOT A;  5K0U A;  4DMI A;  1QF3 A;  3WSO A;  3HNY M;  2GP5 A;  1RUD 3;  1MZE A;  3SQO A;  5HV0 A;  4V1P A;  4XJA A;  1HV0 A;  1ASJ 1;  2QKD A;  2RMU 2;  3INA A;  3U11 A;  2WN3 A;  2VOV A;  3FUO A;  4LO6 B;  3I2I A;  4FTE A;  1PGL 1;  3NV1 A;  4CUB A;  5CAZ A;  3H9A A;  3GJA A;  2CWS A;  2TBV A;  4XQ4 A;  4XXP A;  1I9R A;  3MIE A;  1OUR A;  3AP7 A;  1NLS A;  2WQ8 A;  5ISL A;  1HDK A;  2VUA A;  1JBC A;  5AC9 1;  3WX5 A;  1C8M 1;  1RJ7 A;  5GLW A;  4UFK A;  5CYY A;  3WNL A;  4AFM A;  2WUH A;  5L7O C;  2PEL A;  1EUU A;  2J1R A;  4N43 B;  1JOD A;  4X8N A;  2JDN A;  3H0O A;  2DVA A;  4K8F A;  2GNM A;  1OH3 A;  1QJY 2;  1UQX A;  4AED C;  5FYV A;  4BQW A;  2DCJ A;  3GXU A;  3N3H A;  4XUQ A;  3ZFE C;  1DYO A;  4UFJ A;  3CJI B;  1DGW A;  1ULC A;  1PIV 2;  1W28 A;  3R0R A;  2PA7 A;  4QX7 A;  3VUO A;  5KXD A;  4NJ4 A;  4WZC A;  3HJR A;  4XC9 A;  4H7M A;  2MEV 3;  2YYO A;  3PVE A;  2LTN A;  1OLM E;  2CGN A;  4I01 A;  1W8H A;  3KS7 A;  5L9R A;  3BB6 A;  3PTY A;  3ZKU A;  2A6X A;  1VMJ A;  1EAH 3;  3DKW A;  4AYU A;  1W0N A;  4NPR A;  2VUJ A;  4XFF A;  5TSW A;  4MGS A;  2XB6 C;  5AVP A;  2R32 A;  2CNA A;  2UUR A;  3DEM A;  5FPB A;  4QXB A;  1HQL A;  3ETP A;  5CFD A;  2D6K A;  1XJA A;  3ZLI A;  4UW6 A;  4AI0 A;  2HWB 1;  2YG0 A;  3MFC A;  5KHI A;  3E6D A;  3FUQ A;  3LEM A;  1RXF A;  4XF3 A;  2XML A;  4Y22 B;  1AYN 2;  3WQ0 A;  1PX3 A;  4XBL A;  3LD8 A;  4WVV A;  5FR3 A;  4LUM A;  5JSO A;  3POY A;  3SC7 X;  4BB3 A;  1ZBA 1;  4E8C A;  1JOB A;  2ARX A;  3WCR A;  1JZ3 A;  3H1W A;  3PUI A;  2B42 B;  3CBN A;  5K8S A;  4CCD A;  1JYW A;  1C5H A;  3K4D A;  4YVS A;  2YPD A;  3PLQ A;  3SH3 A;  2WSV A;  3TN9 2;  3FHA A;  3ZXF A;  3D6E A;  1AYM 1;  3IAQ A;  2HWE 3;  2WAA A;  1CAV B;  3HWJ A;  3LEI A;  3K51 A;  4PLN A;  1K45 A;  1S55 A;  2LRO A;  2XJT A;  1O5L A;  2OPK A;  2VVF A;  4LOT A;  3MIG A;  4XJ9 A;  4YW4 A;  4P9J A;  1UZW A;  3Q8B A;  2WQZ C;  4UBH A;  5IAX A;  4QPW A;  4FPE A;  3VD5 A;  4L97 A;  3ZFG B;  4CDX C;  4Q4X 1;  4E9K A;  1PMJ X;  5A6Q A;  4HVR A;  5FOB B;  1GSL A;  2ORZ A;  3IWZ A;  4I0A A;  5E8A A;  4N9I A;  2OQ7 A;  2VXJ A;  3SLI A;  2TUN A;  3EMR A;  2R06 1;  2PHW A;  5B4N A;  5BNN C;  4ZPI A;  1RUJ 2;  4LPL A;  4A2U A;  5JDB A;  1QJX 2;  4P9Y A;  2BPA 2;  2HWC 1;  3J7N A;  1UZY A;  4GJZ A;  3RPQ A;  1F15 A;  1XU1 A;  2Y60 A;  1X9T A;  1YI9 A;  4D6Q A;  4RQP A;  5ABJ B;  3OF1 A;  2WNV B;  2DCZ A;  5L9V A;  5FPA A;  3UKN A;  2C24 A;  2HWF 2;  3NJX A;  3I97 A;  2E9Q A;  4DXS A;  2GN7 A;  1WCS A;  2DBI A;  4LOR A;  5FXZ A;  3KV9 A;  4MHR A;  4QKB A;  3NST A;  4E8D A;  4K8R B;  2JDZ A;  4RFR B;  1WW4 A;  4WM8 C;  2D43 A;  2RS5 1;  3IB3 A;  2DCT A;  3K46 A;  3BIE A;  3U4S A;  1IG0 A;  1W0P A;  2E33 A;  4RFT 0;  1K5M C;  3VKO A;  4FP2 A;  2W52 A;  4CCJ A;  4MGY E;  4N53 C;  1LR5 A;  4XAE A;  2WA3 A;  2YV8 A;  1ZRE A;  3I4I A;  1IS3 A;  4R4X A;  5DUX A;  2XVG A;  3N7J A;  1EPW A;  5FAX A;  2CDO A;  2RMU 1;  3I3M A;  1X33 A;  5JSR A;  5CU1 A;  2GC2 A;  2GC0 A;  1X82 A;  2W3J A;  2XVK A;  5GZG A;  2YC0 A;  2QZ3 A;  4MXW B;  1RUE 3;  1HKD A;  2JIJ A;  3GNE A;  1RUH 3;  2B9U A;  4QX1 A;  5ERL A;  1W3X A;  4AEK A;  1W0O A;  5L9B A;  4AHX A;  3GZU C;  3AKP A;  3N7K A;  4Q4Y 3;  4R4Z A;  5FBJ A;  2Z4F A;  1OUX A;  3FMG A;  3URF A;  4YFZ A;  1QNY A;  3C7E A;  4DXZ A;  4RS5 A;  1AR7 2;  3ZSE A;  5J96 B;  2YU2 A;  2BZD A;  2MHF A;  4NUB A;  5LRS A;  1LED A;  4HVO A;  5AVA A;  1UX6 A;  1MZF A;  3LA2 A;  1QJY 1;  1LOG A;  3JZV A;  1ULF A;  4OHY A;  1CES A;  1TEI A;  5BYN A;  3QD6 A;  3WNP A;  4KH9 A;  4PHZ A;  1SFP A;  2CHH A;  4AVA A;  4LO8 A;  2FDF A;  1PIV 1;  4FBF A;  1A6C A;  1PNG A;  2ZAH A;  1GIC A;  2VZS A;  3T3Y A;  4EZH A;  1CPM A;  3POJ A;  2RV9 A;  5T5J A;  3WDT A;  1VBC 2;  5FTT C;  3AZY A;  4YVW A;  2VZQ A;  3OYW A;  3CF6 E;  4YPJ A;  3RYK A;  1VBB 2;  1BBT 3;  1CAU A;  1SCR A;  3AJY A;  4KBB A;  1PVX A;  5JIU A;  3POI A;  4Q4V 2;  4EE2 A;  1CN1 A;  2P3K A;  3GDB A;  1XSQ A;  1CAX B;  1Q8O A;  1QJE A;  3USU B;  1N47 A;  4OZO A;  1YO8 A;  3FBM A;  3KHB A;  3KCX A;  3MEP A;  2UYA A;  1HIX A;  1LGC A;  3O14 A;  2V4A A;  2ZX2 A;  5GLU A;  1W06 A;  3O1M A;  1P8J A;  2JG9 C;  2YPJ A;  2Y6J A;  2YBS A;  2XUM A;  3A7Q A;  3KCY A;  4PIY A;  4Y1V A;  3K75 B;  3ZFF C;  1F4H A;  3IZO A;  1JYC A;  1HXS 2;  5M0T A;  4BH9 A;  1UU6 A;  2VTF A;  1AYN 1;  3MLJ A;  4IET A;  1H9W A;  2WQ4 A;  3M1H A;  2E32 A;  2DV9 A;  1IZ3 A;  4A7Z A;  2EA7 A;  5I0U A;  3G7D A;  2VCB A;  3DYO A;  1W6N A;  1OUS A;  3MBW A;  5DN2 A;  4AGV A;  4B3N A;  4HLT A;  2PHX A;  1POV 0;  2WAO A;  1POV 3;  4QXK A;  4LQR A;  5CA6 A;  1NT0 A;  4A4A A;  2KD7 A;  1H2K A;  4P02 B;  3TN9 1;  3CDZ B;  1U5Z A;  1WLW A;  2HEY F;  3PJY A;  2VNV A;  2QQW A;  2VXR A;  1QNW A;  2NYY A;  1DHK B;  2Q1F A;  4NAM A;  4QKD A;  5APA A;  2QQO A;  5LBB A;  3U78 A;  1H4G A;  3SEP A;  2D3P A;  4NIA A;  3MFA A;  3LFI A;  5A7Q A;  1ONA A;  1HRI 1;  3P5B A;  4XDO A;  1V6I A;  2A71 A;  4FP3 A;  5FXX A;  3WIN E;  1TNR A;  4A7K A;  5LEJ A;  2J7M A;  1UOG A;  4JQR A;  1SDW A;  3J4U H;  4Q4W 3;  1PK6 B;  1RUI 3;  1ZRF A;  1RUO A;  1DIW A;  4KNC A;  1ENX A;  3WW3 A;  4CXW A;  4NMI A;  1S0B A;  4IQP A;  2YGL A;  1G9F A;  2O8Q A;  2UY8 A;  1HQW A;  4E2G A;  3VBH A;  1RJ8 A;  5FDB A;  2GU9 A;  1RUG 3;  3AMN A;  4OI0 A;  5BV6 A;  4YW1 A;  3UGF A;  1GOF A;  1QH6 A;  1RUJ 1;  1QJX 1;  4XFG A;  4DEV A;  3PNA A;  3MHZ A;  2GND A;  2E63 A;  1OD3 A;  3AXD A;  4JC1 A;  2F17 A;  5C4W C;  2DUR A;  3PME A;  2W2I A;  5BNO A;  2WS9 2;  2HWF 1;  3ZN5 A;  5HI0 A;  4MAD A;  5JR2 A;  2JX9 A;  4KL1 A;  1SCS A;  1SBE A;  4Q0U A;  4RL7 A;  1QOO A;  3UL2 A;  1DLL A;  5CBL A;  3MIH A;  1LU1 A;  2DYC A;  1MEC 3;  1GWL A;  3JD7 2;  5GLT A;  3MGU A;  4DRV A;  1OF4 A;  3MPB A;  5F5C A;  1XC6 A;  2QTW B;  3VBF A;  5JUV A;  2EXH A;  2BYV E;  2JWP A;  2OS2 A;  4QU2 A;  4NO4 A;  1S0J A;  1OQD A;  2GME A;  4H7L A;  4ITC A;  2J42 A;  4LLO A;  1JZ8 A;  1WCQ A;  4BQ2 A;  1AJO A;  1XE7 A;  2J1E A;  4FI9 A;  4AQT A;  1C1L A;  1J84 A;  2BUK A;  3EJK A;  1NE6 A;  1V6M A;  2QQL A;  4B4R A;  4DUW A;  4ZZ8 A;  3PTR B;  2DUP A;  2HKX A;  2KXL A;  1AXK A;  1YFU A;  3VDC A;  3ZYJ B;  5JOY A;  1LNS A;  1GKB A;  1O3R A;  1UY0 A;  1TMF 3;  2P6H A;  4X6R B;  5BNQ A;  4XET A;  1GMM A;  1AL2 3;  3CO2 A;  4OI1 A;  3WNK A;  2ADE A;  1QY4 A;  5IFP A;  1RMU 3;  1AR7 1;  2GMM A;  5A70 A;  1R08 3;  4AVT A;  4OUS A;  2W08 A;  2G9F A;  2CU5 A;  4IE4 A;  4P9X A;  5FYY A;  4RGK A;  4WVM A;  1D4M 3;  3OGV A;  5GM0 A;  1GP4 A;  1T6B X;  1TG7 A;  4OVE A;  4COY A;  5K7P A;  1R1A 3;  4AHZ A;  1N3P A;  4FXG B;  4GH4 B;  4J6G A;  4WM7 A;  5L19 A;  3B93 A;  1GWK A;  4FTB A;  1KEX A;  2XON A;  1G86 A;  4MHU A;  4QPI A;  2ERF A;  4W8J A;  1PO1 2;  3VZO A;  1VBC 1;  4N7U A;  5IAV A;  3M7A A;  5A3N A;  4XHB A;  3B01 A;  1KGY A;  2YU1 A;  4Q4V 1;  5LY2 A;  1TNF A;  4HSJ A;  4UI9 L;  1Q56 A;  4FPY A;  5FZ6 A;  1V9U 2;  3ZSL A;  5DUW A;  3WDV A;  1DQ6 A;  2X5I C;  3N9L A;  3VBR B;  1LHU A;  1LGN A;  2Y8K A;  4KG0 A;  4JGZ B;  3IKW A;  3IM0 A;  3O1S A;  5H9S A;  4XF0 A;  4A6S A;  3H8X A;  4QXC A;  4Y20 B;  2ZJC A;  1WA6 X;  1HXS 1;  3VDD A;  3T2O A;  1OHF A;  3CEW A;  5FP3 A;  5FY7 A;  1OKO A;  5GAL A;  2XLF A;  1O8S A;  4Q29 A;  5CAD A;  3ZYB A;  1JN2 P;  1A8M A;  1NE4 A;  4LHS A;  5AC9 3;  1C8M 3;  1IPK A;  2X53 S;  2QBX A;  4HZF A;  4HKO A;  4QX0 A;  2IFR A;  5A7N A;  4EWE A;  1W6Q B;  2WJS A;  3NV3 A;  2FDI A;  4LEJ A;  2EAK A;  3RQ0 A;  3WNN A;  5CFC A;  1B35 B;  5FYC A;  3ES4 A;  2FBE A;  2PLV 2;  2WO7 A;  5KWR A;  2XWB B;  2ATF A;  4LO7 A;  4LHN A;  2VMC A;  1HB4 A;  3AMP A;  4XHX A;  2BV4 A;  4BXS V;  4QWN A;  3W9A A;  4YZ3 A;  4OI4 A;  3ACF A;  3OPZ A;  1XB9 A;  3N9M A;  5FYH A;  4C0B A;  4CCE A;  3CQO A;  2BRT A;  1C8N A;  1Y9G A;  4HK8 A;  1SHW B;  3IN9 A;  4BQ5 A;  1UOJ A;  1UL9 A;  4XEZ A;  4IW3 A;  3E6B A;  3ZMN A;  1MVE A;  2JEC A;  4AVC A;  1LJ7 A;  1OOP A;  4PQQ A;  2HBT A;  4DY5 A;  3ASI A;  2JKB A;  2JDP A;  3POG A;  5G04 L;  4CUG A;  3QCW A;  3ZFG C;  1EV1 2;  3WNX A;  2A3X A;  5I8Y A;  3A0N A;  3AP4 A;  2HWB 3;  1VP6 A;  2BNO A;  3N7L A;  3NV4 A;  3LOI A;  3QOP A;  4IEV A;  5HCH A;  1ZM1 A;  4UF0 B;  2A3W A;  4UOJ A;  2WS9 1;  4P5H A;  5A3T A;  3WQ1 A;  4A45 A;  4IGO A;  4AVS A;  4D0Q A;  2GNT A;  2DBN A;  1ZBA 3;  4YWA A;  5FOJ B;  4XTP A;  1F35 A;  5FO9 B;  3AC0 A;  1WBF A;  2A6Z A;  4QGM A;  1JUI A;  4X8P A;  5DUU A;  4NRM A;  3PU8 A;  3PVB B;  2I07 B;  3PUA A;  1W6O A;  1G9B A;  3DL3 A;  3JD7 1;  2ZGO A;  1E5S A;  3BOW A;  3JCI A;  4TZD A;  5IYY A;  1CR7 A;  2VQT A;  3HPN A;  2AEY A;  3VD3 A;  1DCS A;  4BYY A;  4EN9 B;  2JE8 A;  4EWD A;  1MQT B;  1W9Y A;  1OF3 A;  5FZ7 A;  5E16 A;  2ZKN A;  3MDP A;  2NPI A;  3AP9 A;  2FMD A;  2KM2 A;  3IPV A;  1NCR B;  5BNP C;  3O1P A;  3GM8 A;  3LA7 A;  4Q0P A;  3V0B B;  5L7O A;  2LUW A;  3OUI A;  5LA2 A;  1AX2 A;  2ZHN A;  2JDM A;  1D4V B;  4Q4X 3;  1QDO A;  1QXJ A;  4XAB A;  1RUF 2;  2V73 A;  3S5Q A;  3VZL A;  4CXY A;  1BK1 A;  5FYB A;  2W95 A;  4DOU A;  1H9P A;  4AED A;  2R06 3;  4BME A;  1B09 A;  3NNL A;  3E6C C;  2AUY A;  2HWC 3;  2RE9 A;  2XVL A;  3ZFE A;  2QVS B;  1O91 A;  3AL6 A;  2ZS6 B;  4Q0V A;  5FZE A;  5B4X A;  5EYY A;  3H3U A;  1C3H A;  1S2B A;  3FN9 A;  1CZV A;  4IEP A;  2IXL A;  2ZHM A;  3K77 A;  2VVE A;  3U4X A;  2QQV A;  3EXU A;  2ZHL A;  2B9V A;  1KJL A;  1VJ2 A;  3ETQ A;  3N4M A;  1PO1 1;  4YG3 A;  5A1L A;  3HBK A;  2VNR A;  3U1X A;  5CKQ A;  2E6V A;  4XMA A;  1RIR A;  2Y6K A;  4Q1P A;  2RS5 3;  1F9K A;  3MZH A;  3NVC A;  3POB A;  1QQP 2;  1WCU A;  1Q8S A;  3TEZ A;  3VHP A;  1JXN A;  4XIK A;  4UT5 A;  3O0V A;  2IVJ A;  2V5Y A;  2F6B A;  2WNU A;  4J25 A;  5C9A C;  4PQ9 A;  2ARA A;  1H8T B;  3AVS A;  5FZ3 A;  1JU4 A;  5A1F A;  2JE9 A;  1CZT A;  1GU3 A;  1UAI A;  2WDB A;  4HSL A;  4A3X A;  3BCW A;  2WNO A;  4X6Q B;  2RMU 3;  4YLZ A;  4XBQ A;  4CEW A;  4CDW B;  3VD4 A;  2V09 A;  4QQL A;  1W99 A;  4XZU G;  4E2S A;  5FZL A;  1OI6 A;  3WDU A;  5ACA 2;  5FIX A;  5KHG A;  4KWK A;  1ZRD A;  4XW3 A;  3T1L A;  3TEW A;  1DZR A;  5DQ0 A;  1WD4 A;  3CIH A;  3VZJ A;  4LKS A;  2Z79 A;  5F8P A;  3A21 A;  4KU8 A;  5A7S A;  1RUN A;  1YEW A;  3AMM A;  3W20 A;  3I7D A;  4DB5 A;  1PMI A;  1CJP A;  2ETE A;  2VZ1 A;  2PLV 1;  1QJY 3;  1LHO A;  2LW8 A;  4JGY B;  2Q8E A;  4DXT A;  1HB1 A;  4OI2 A;  1V70 A;  3VBS B;  1HLC A;  3ZR6 A;  1WMF A;  4JAA A;  3SCG A;  3VHR A;  4QPY A;  3UKT A;  1EPZ A;  4Z2A A;  2VOX A;  1PIV 3;  3WNM A;  5A6Y A;  4Q5O A;  5FZH A;  1QJF A;  4M0H A;  1DQ0 A;  4CDX A;  4AGG A;  3BTX A;  3OPT A;  1GZW A;  4GKX A;  2AEZ A;  2W39 A;  3HIF A;  4QX2 A;  2QFE A;  4Y5S A;  1E57 A;  1SLI A;  1Q8Q A;  2SLI A;  4XE9 A;  4A7Y A;  1IS5 A;  3O5S A;  4D94 A;  5BNN A;  3ZDS A;  2QDR A;  1IHM A;  1SPP A;  2VR4 A;  4QM8 A;  4UW4 A;  1WW6 A;  4K21 A;  4PIX A;  5G05 L;  3ZXA C;  5A32 B;  1EV1 1;  3OY8 B;  3BYW A;  2ZGU A;  1ND3 B;  3AX4 A;  5D21 A;  3WP4 A;  2Y33 A;  2C5D A;  1W8T A;  3ZXL A;  2ZXQ A;  3HD8 B;  5K0U B;  2YMZ A;  1ULD A;  2ZGM A;  2VOT A;  1OPM A;  2VZV A;  1W9F A;  4COZ A;  2ID4 A;  1XYP A;  1AYN 3;  3RSJ A;  4EN6 B;  1KDM A;  1LHV A;  2WZE A;  3WZ1 A;  1UMI A;  1XYN A;  3M3I A;  2OYZ A;  4WM8 A;  4LBJ A;  5F2W A;  3CNA A;  4CP9 A;  3H8R A;  2YC4 A;  1JU3 A;  1HRV 2;  3WQ7 A;  4MGZ E;  4QKN A;  5EJ1 B;  4UFH A;  1K5M A;  2XUE A;  4N53 A;  1JI6 A;  4N7I A;  5A3M A;  4QB2 A;  4A41 A;  3TN9 3;  5A7P A;  2PHD A;  3GAL A;  4Y3O A;  4EN0 A;  1FI2 A;  4H55 A;  4HET A;  4B7E A;  2HH9 A;  5KXB A;  4RR3 B;  3D4K A;  1K5J A;  3OBT A;  2VPV A;  2XJV A;  2YXS A;  3MF6 A;  4O7X A;  2SBA A;  2YBP A;  3KB5 A;  1HRI 3;  2D3R A;  3HNM A;  1NA1 A;  4AI3 A;  5FY9 A;  1IG3 A;  2ZGL A;  4LA2 A;  3MUY 1;  2DDU A;  4OHX A;  1RC6 A;  1FX5 A;  2B4K A;  1S0E A;  2RDQ A;  3BUC A;  2E51 A;  4P5Y A;  3WF0 A;  1VBE 2;  1YQ8 A;  3GJB A;  3T2Q A;  4BOW A;  5LWB A;  3CZU A;  1RUF 1;  4XF4 A;  3H7J A;  3AZX A;  2OQ6 A;  2KR2 A;  3POS A;  2YRO A;  5DXD A;  3C7H A;  1RL3 A;  1ZA4 A; 
#chains in the Genus database with same CATH homology
 5C71 A;  4E8D A;  1F4A A;  2ZEW A;  3NQH A;  3IB3 A;  1JZ2 A;  4BK4 A;  3K46 A;  2E33 A;  4AAX A;  5JMO A;  4IUG A;  1W9S A;  3LPF A;  2CDO A;  4CU9 A;  3LEG A;  1UXX X;  2W3J A;  4QX1 A;  1JZ6 A;  2W92 A;  1JYV A;  5JXG A;  1JZ7 A;  1IQD C;  4RN5 A;  2Z4F A;  3HNB M;  4DUV A;  1NAE A;  3C7E A;  4AG4 A;  2VZR A;  3THC A;  2BZD A;  3ACG A;  2VCA A;  5EJZ B;  5LCW L;  2RVA A;  3OEB A;  3NNG A;  1OT5 A;  3I2G A;  3P6B A;  1O8P A;  3WNP A;  4PT6 A;  5LA0 A;  2VJX A;  4KWU A;  1TVG A;  2J1V A;  2ZEZ A;  2VZS A;  4XUT A;  5J1X A;  2RV9 A;  3I3B A;  3DYM A;  2VZQ A;  4YPJ A;  1UYZ A;  3WNO A;  1GQP A;  2DCK A;  3GDB A;  2CDP A;  5LA1 A;  2Y6G A;  4OZO A;  3I3D A;  2W94 A;  2VZP A;  1P8J A;  2Y6J A;  3A7Q A;  3K75 B;  1F4H A;  2QQM A;  4OYU A;  4XUN A;  3C8X A;  3WF1 A;  2VTF A;  2VCC A;  2E32 A;  1YQ2 A;  2VME A;  1CX1 A;  2RJ2 A;  2J1A A;  2VCB A;  3DYO A;  1O59 A;  3EB7 A;  3MBW A;  3T09 A;  3SKV A;  5DN2 A;  2X09 A;  5IHR A;  4W50 A;  2WAO A;  3ACH A;  3III A;  4LQR A;  4CU6 A;  4A4A A;  2KD7 A;  4ARY A;  2YC2 A;  4P02 B;  3A23 A;  3CDZ B;  3FL7 A;  3LE0 A;  2QQO A;  4A6O A;  3SEP A;  5EIY B;  1T2X A;  3I2J A;  3IDA A;  2V4V A;  5HPO A;  2J7M A;  3C7F A;  3NJV A;  1NX9 A;  2WO2 A;  3CMG A;  1PX4 A;  3K4A A;  2VMD A;  1UY1 A;  3SKJ E;  4A3Z A;  4OUE A;  3DYP A;  1GUI A;  2WAB A;  1MPX A;  2BGP A;  1GOF A;  4DEV A;  1OD3 A;  2C9K A;  1I5P A;  5F7U A;  3THD A;  2YFZ A;  4JKM A;  4MAD A;  5JR2 A;  2WN2 A;  4A42 A;  4M4R A;  3SEE A;  2V5D A;  1UY2 A;  1K12 A;  2W9X A;  2XHN A;  3VDB A;  1HN1 A;  2ZEX A;  3W5N A;  2EIC A;  1OF4 A;  1XC6 A;  5JUV A;  4KMQ A;  1K3I A;  4MGQ A;  3HEI A;  5JXI A;  2WO1 A;  2WBK A;  1JZ8 A;  1WCQ A;  4GZ9 A;  2J1E A;  3K4Z A;  4TTG A;  4FI9 A;  1J84 A;  2V72 A;  2QQL A;  4DUW A;  4ZZ8 A;  2W47 A;  3VDA A;  3T0B A;  3VDC A;  1LNS A;  1UY0 A;  3WF2 A;  1PMH X;  1GMM A;  2PQS A;  5IFP A;  3WNK A;  1XPW A;  1SDD B;  2VZU A;  2QQJ A;  2YB7 A;  1R64 A;  3OGV A;  2W1W A;  4GWJ A;  1TG7 A;  3OGR A;  4CU8 A;  2VMF A;  1KEX A;  2VO5 A;  2XON A;  1DLC A;  4W8J A;  4QDQ A;  4BDV B;  3ZM8 A;  2XQX A;  1CZS A;  2QQK A;  4JKL A;  5DPN A;  1JYN A;  1KGY A;  3DEC A;  4DUX A;  3LQC A;  4MOA A;  2BGO A;  2L9L A;  1JHJ A;  4UI9 L;  3NRU A;  5C70 A;  2W1Q A;  2Y8K A;  3C7O A;  4A44 A;  2QQI A;  3LEK A;  4QDS A;  5CZK A;  2VC9 A;  3T2O A;  5JXH A;  4W4Z A;  1H6X A;  5JXJ A;  2EIE A;  4UAP A;  1UXZ A;  3HOB A;  1O8S A;  2BBA A;  3WF3 A;  1ULP A;  2HYX A;  4LHS A;  1ULO A;  4HG6 B;  1GOH A;  2QBX A;  3P1I A;  1EUT A;  4QX0 A;  3VD7 A;  4QX3 A;  3W5M A;  3ABZ A;  3CZJ A;  1W8N A;  3J7H A;  3WNN A;  3E1F 1;  4ARX A;  3PUH A;  4PF1 A;  2YFU A;  2E26 A;  2J1U A;  2VMC A;  3OBA A;  4DXR A;  4BXS V;  4BJ0 A;  1UYY A;  1BHG A;  3I2H A;  3ACF A;  4BK5 A;  4DEQ A;  4CU7 A;  3CQO A;  4XVH A;  4XUO A;  1SHW B;  3U37 A;  2Y64 A;  3UET A;  3T08 A;  2ZEY A;  2X05 A;  4PQQ A;  5FUI A;  2W87 A;  1J83 A;  4TXW A;  3FHQ A;  5G04 L;  4L0P A;  5I0D A;  2XOM A;  2VZ3 A;  3UES A;  3VD9 A;  3LPG A;  1D7P M;  1SG3 A;  2W1S A;  4UOJ A;  2EIB A;  4A45 A;  1WKY A;  4D0Q A;  1W9T A;  1XNA A;  1UWW A;  3JXS A;  3AC0 A;  2C26 A;  4ZXE A;  2VL4 A;  3IAP A;  4ET7 A;  2R7E B;  3MO4 A;  4QDR A;  1CIY A;  4ZZ5 A;  2JD9 A;  5IYY A;  2VQT A;  3HPN A;  3VD3 A;  1RYY A;  2WYS A;  2JE8 A;  2W46 A;  4MO3 M;  3GGL A;  1OF3 A;  3OG2 A;  3T0D A;  1NUK A;  3MUZ 1;  3GM8 A;  3D3A A;  4JX0 A;  3ECQ A;  4P08 A;  5LA2 A;  1UZ0 A;  2E31 A;  2W5F A;  4CUC A;  1GOG A;  2W95 A;  1XNT A;  3BN6 A;  1JZ5 A;  5B4X A;  5A1A A;  2ORX A;  4RYD A;  2BER A;  3FN9 A;  1CZV A;  2C4X A;  2W1U A;  1UMH A;  3K77 A;  3UNP A;  2B9V A;  2J22 A;  3C7G A;  3WSO A;  1NKG A;  3HNY M;  4JKK A;  1JZ4 A;  2Y6K A;  3OGS A;  5IJR A;  4KI5 M;  3BGA A;  3ACI A;  2WN3 A;  3I2I A;  2VZT A;  3WF4 A;  4CUB A;  1OH4 A;  3WEZ A;  1L7Q A;  5HXM A;  2WQ8 A;  1JU4 A;  1US3 A;  1CZT A;  1GU3 A;  2WDB A;  3WNL A;  3I2K A;  5CYY A;  4QAW A;  2WUH A;  1EUU A;  4XUR A;  2J1R A;  2EID A;  3VD4 A;  1H6Y A;  4ZY9 A;  4QB6 A;  1W99 A;  4XZU G;  4CVU A;  1UY3 A;  2DCJ A;  3GXU A;  2LS6 A;  5DMY A;  2Y6H A;  2WZ8 A;  4XUQ A;  1GNY A;  1DYO A;  2JKX A;  3CIH A;  5DQ0 A;  4LKS A;  3A21 A;  1L7R A;  1K42 A;  3T2P A;  3A22 A;  3HJR A;  2VZ1 A;  2LW8 A;  4DXT A;  2W91 A;  3OB8 A;  3WQB A;  4Z2A A;  3EYP A;  2OKX A;  3WNM A;  1JYX A;  3MV0 1;  2VZO A;  1W0N A;  4MGS A;  2VQU A;  3CKH A;  1DP0 A;  4QX2 A;  3ETP A;  4GWI A;  1UY4 A;  1W9W A;  2YG0 A;  3T0A A;  2X10 A;  4QB1 A;  2VR4 A;  1PX3 A;  5G05 L;  5IFT A;  4E8C A;  2ZXQ A;  4D8M A;  1JZ3 A;  3PUI A;  1US2 A;  2VOT A;  4XUP A;  1W8O A;  2VZV A;  1JYW A;  3K4D A;  4CUA A;  2ID4 A;  2WZE A;  1UMI A;  2HLE A;  3FHA A;  2VM9 A;  3IAQ A;  2WAA A;  2YC4 A;  1JU3 A;  3LEI A;  4P00 B;  5EJ1 B;  1K45 A;  3HN3 A;  1UX7 A;  2QQN A;  1JI6 A;  4QB2 A;  2J1T A;  4A41 A;  4OMC A;  3F2Z A;  4QPW A;  3VD5 A;  2JDA A;  2Y6L A;  3OEA A;  2WO3 A;  1PMJ X;  2ORZ A;  3HNM A;  3MUY 1;  2DDU A;  5B4N A;  3MV1 1;  2B4K A;  4LPL A;  1UYX A;  5C7G A;  3I2F A;  4P5Y A;  3WF0 A;  3T2Q A;  3CZU A;  4JHZ A;  4OMD A;  3NJX A;  3I97 A;  4M4P A;  2J1S A;  4DXS A;  3C7H A;  3I3E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...