2W1SA

Unique ligand binding specificity of a family 32 carbohydrate-binding module from the mu toxin produced by clostridium perfringens
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
139
structure length
139
Chain Sequence
NPSLIRSESWQVYEGNEANLLDGDDNTGVWYKTLNGDTSLAGEFIGLDLGKEIKLDGIRFVIGKNGGGSSDKWNKFKLEYSLDNESWTTIKEYDKTGAPAGKDVIEESFETPISAKYIRLTNMENINKWLTFSEFAIVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords HYALURONOGLUCOSAMINIDASE
publication title N-Acetylglucosamine Recognition by a Family 32 Carbohydrate-Binding Module from Clostridium Perfringens Nagh.
pubmed doi rcsb
source organism Clostridium perfringens
total genus 35
structure length 139
sequence length 139
chains with identical sequence B
ec nomenclature ec 3.2.1.35: Hyaluronoglucosaminidase.
pdb deposition date 2008-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2w1sA00
3T2PA 1H6XA 2VZSA 4E8CA 1H6YA 5B4XA 2W1QA 5A1AA 2ZEXA 5LA0A 1GOGA 2LS6A 2Y6JA 3ETPA 3NNGA 2W46A 1HN1A 3JXSA 4CUAA 4KMQA 2VMCA 2YG0A 4KWUA 4ET7A 5DN2A 3I3EA 1OF3A 5C71A 3SKJE 2YFUA 4XVHA 3K75B 3MUZ1 2QQJA 1EUUA 4ZZ5A 2CDOA 1K42A 3OG2A 2VZTA 1SHWB 1CZSA 2XHNA 3WQBA 3WNLA 4JKKA 1SG3A 1K45A 3PUHA 4XUPA 2QQIA 1DYOA 3CIHA 4L0PA 5CYYA 3UETA 2E33A 1NUKA 2VZ3A 2VOTA 1OD3A 4QDRA 3T08A 3SEPA 2V72A 1W9TA 3FL7A 2X05A 1WKYA 2ZXQA 2VL4A 3CDZB 2QBXA 2VQTA 4PT6A 3A21A 2VTFA 1JU3A 4BK4A 3K46A 4TTGA 4ARXA 3T0AA 2WO3A 1XC6A 2ZEZA 5C70A 2VZVA 1UMHA 4JKMA 4OMDA 2BERA 3C7HA 2JE8A 4GWIA 1JHJA 1K3IA 2Y8KA 1IQDC 3T0BA 4LKSA 2BZDA 5JUVA 1GMMA 4D8MA 4DEVA 2E31A 1JYWA 1GOHA 1LNSA 3C8XA 1UX7A 3T0DA 2WAOA 2W9XA 3CZUA 2WYSA 2XQXA 1OH4A 1UXXX 3ACGA 1UZ0A 1MPXA 4OZOA 4FI9A 5F7UA 1OT5A 2R7EB 3K4AA 3UESA 4A42A 3HPNA 4CU9A 1W9WA 3WEZA 2J1EA 3VD3A 3EYPA 1UY4A 3HNYM 4CU8A 1DLCA 4JKLA 4M4RA 1GNYA 3SKVA 3W5NA 3A7QA 4HG6B 2QQKA 3HEIA 3CZJA 3I3BA 4BJ0A 2WO2A 3MUY1 3I2JA 2Y6LA 3WNOA 4PF1A 4RN5A 4QX3A 3LE0A 4P08A 5LA2A 2C4XA 4DUXA 1L7RA 3C7OA 4MOAA 1JI6A 2XONA 5IFPA 2ID4A 3IAPA 2J1VA 2PQSA 3GGLA 2HLEA 2WDBA 3NQHA 1SDDB 2W95A 4DXSA 4UI9L 2ORZA 4CUCA 1CZVA 1JZ6A 2B9VA 4LHSA 2JKXA 2QQLA 3IDAA 4BK5A 4QDSA 3THCA 4QB2A 2LW8A 3GXUA 2DCKA 3WF0A 3WNNA 2Y64A 3FN9A 4UAPA 2W5FA 4QX2A 2WQ8A 3CKHA 1KGYA 1O8SA 3VD7A 4D0QA 1W8NA 1NKGA 5DPNA 1L7QA 1J83A 3MV01 3BN6A 3NRUA 2Y6KA 2ZEWA 1PMHX 2VZ1A 3HOBA 1DP0A 4LPLA 2C26A 2ZEYA 1XNTA 4XZUG 5G04L 4UOJA 5EIYB 3I2HA 4XUTA 4CUBA 2VCAA 4XUQA 1ULOA 2VR4A 3IB3A 4W4ZA 4DEQA 4P5YA 3T2QA 3WNKA 3F2ZA 3I97A 3J7HA 1ULPA 1TG7A 2WABA 2WBKA 2W1SA 4IUGA 3C7FA 3I3DA 3T2OA 5DQ0A 1UY1A 3OGSA 1W9SA 4A44A 4W8JA 2VMDA 2Y6GA 5EJ1B 4ZZ8A 4GZ9A 5C7GA 3ACHA 1JU4A 2VM9A 2ORXA 1US3A 1JZ3A 2W1WA 2J1SA 3OGRA 1UY3A 1PX4A 2WO1A 2W87A 1CIYA 2WUHA 5JR2A 3U37A 1I5PA 4QDQA 3DYPA 1UYXA 3UNPA 3ECQA 1EUTA 1YQ2A 2VJXA 2CDPA 2KD7A 3VD4A 3GDBA 3FHQA 4MADA 4PQQA 4CU7A 4GWJA 2VZRA 4QB1A 3MBWA 3MO4A 4BDVB 2W91A 1JZ5A 2E26A 1O8PA 2VQUA 1P8JA 4A45A 3OGVA 1JZ4A 3P6BA 2JD9A 1NAEA 3I2IA 4DUWA 1XPWA 3ABZA 2X09A 1GUIA 4W50A 3WNMA 1W0NA 3T09A 5IYYA 3ACFA 1UY0A 1T2XA 2WAAA 1PX3A 2VZPA 3E1F1 1JYXA 1UMIA 3K4DA 4A3ZA 4DXRA 3CQOA 3PUIA 5FUIA 3DYMA 1JZ7A 2HYXA 5IFTA 4P00B 4QX0A 2RVAA 4QPWA 2W3JA 2Y6HA 4CVUA 2BGOA 5HPOA 3NJXA 4P02B 2VO5A 4RYDA 2J1UA 4JHZA 5JXGA 3IIIA 2QQNA 3VDCA 3HN3A 3LPGA 1W99A 1TVGA 2X10A 3VD5A 4QB6A 3LPFA 2OKXA 4XUOA 1GQPA 3ACIA 3VD9A 2B4KA 3MV11 2VMEA 1NX9A 2VMFA 2J1AA 4YPJA 4ZY9A 3HJRA 1JYVA 3DECA 3VDBA 3W5MA 5IHRA 3OEBA 2E32A 4A6OA 1UYYA 3HNMA 3LEKA 4ARYA 5HXMA 2Z4FA 2YC4A 4Z2AA 4BXSV 2EICA 1F4AA 2DDUA 3LQCA 1JZ8A 2JDAA 5LCWL 1O59A 2L9LA 4OUEA 1UYZA 3WSOA 3LEGA 3ZM8A 2W94A 1UWWA 2VZOA 1D7PM 2EIBA 3I2KA 2J1TA 2YB7A 1GU3A 3WF3A 5JXJA 2VZUA 2V5DA 2WZEA 4DUVA 4M4PA 1JYNA 2DCJA 5JXIA 3I2FA 1KEXA 5EJZB 5G05L 2VCBA 2W92A 3OEAA 3WF1A 5DMYA 2BGPA 1CZTA 3C7GA 1K12A 1UXZA 4OMCA 2J1RA 4CU6A 3WNPA 3P1IA 4KI5M 3OBAA 1UY2A 4MGQA 2EIEA 2C9KA 1R64A 2J7MA 3WF2A 3K77A 5B4NA 1RYYA 4LQRA 2J22A 4XURA 2RV9A 3LEIA 1BHGA 4ZXEA 3BGAA 3C7EA 3FHAA 1J84A 1WCQA 3VDAA 4AG4A 2YC2A 4MO3M 2QQOA 3A23A 3THDA 3AC0A 1XNAA 4TXWA 1GOFA 5CZKA 1CX1A 3HNBM 4OYUA 4MGSA 1JZ2A 5JMOA 3SEEA 2WN2A 3NJVA 3CMGA 3IAQA 2BBAA 3EB7A 2VZQA 2VC9A 2XOMA 3GM8A 1W8OA 3DYOA 2W1UA 4XUNA 1PMJX 4DXTA 2RJ2A 5I0DA 2W47A 2WZ8A 3OB8A 4E8DA 3I2GA 4A41A 2V4VA 4QAWA 3K4ZA 4A4AA 2YFZA 5IJRA 2VCCA 5J1XA 5LA1A 4AAXA 3D3AA 2QQMA 4QX1A 3WF4A 3A22A 1US2A 1F4HA 2WN3A 1OF4A 4JX0A 5JXHA 2EIDA
chains in the Genus database with same CATH superfamily
3T2PA 4I0BA 1VP6A 2KXLA 2W1QA 5T5JA 2ZTNA 1RUNA 5LWBA 3ON7A 1KITA 4GH4B 1WZXA 2VUDA 1VB4A 2W46A 4Y1YA 4CUAA 4KMQA 2VG9A 3O0VA 4L92A 4E9KA 2OZJA 2RM22 4Q4Y2 3S5AA 1N1YA 1FI2A 1WW4A 3I3EA 4W65A 1OF3A 3VBUB 3WDXA 5C71A 1GBGA 4JGZA 1YJLA 2YFUA 4M3CB 1HRV2 4LBKA 1HW5A 1ND2C 5CAZA 1DGRN 3MUZ1 2QQJA 3ZX7A 4QM8A 1J1TA 5A33B 1UL9A 1DQ1A 1EUUA 3ZXJA 1NQDA 3NAPC 2RS53 4HSLA 5A3NA 1MZFA 4Q4X3 4OQ9A 2R0FA 1PK6C 5F37A 3OG2A 3VV1A 2VZTA 4F7ZA 1OLRA 4JDOA 2YU2A 1CZSA 2ARBA 2NPIA 2XHNA 3WQBA 2CGNA 3B94A 2WNOA 5LK5A 4LNVA 3AP6A 1QOTA 4XUPA 4MG2A 4L0PA 3UETA 2E33A 1NUKA 3O14A 1LOGA 2XL7A 2HKXA 4CDQB 1BBT3 2V72A 2OZ6A 3GCWA 4QHBA 3FL7A 1OOPA 5DUUA 2UURA 2HWF1 2O14A 2ZXQA 3CDZB 3H9AA 2B46X 2VQTA 4UFIA 1BK1A 4RQPB 1BCXA 1VBA2 1T6BX 3J8F2 3A21A 4HN1A 4AEDA 5JPMB 3RS6A 2JG9C 4PDWB 4CCMA 2CWSA 3TNQA 4NR1A 4ARXA 5JZGB 1HQWA 1SFPA 3DPRC 1PVXA 3O12A 4FPHA 3DXTA 1OVPA 2ZX4A 3JD71 4HN0A 3T0AA 4PF5A 3KCXA 1AL23 5LW9A 4XIKA 1V6IA 1HDKA 1WMEA 3LIHA 5L9VA 2E6VA 3GHMA 4JKMA 4FO9A 3VBOC 4BH9A 3C7HA 5ABJC 2V4AA 3JCIA 4YGCA 4AI9A 4OCTA 4PJYA 3HAGA 4JTOA 3ZFFC 1M06G 1X82A 1EV13 2P3IA 3H1MA 1HB4A 4LKSA 4N53A 4AZZA 3AYAA 3NJZA 2D6OX 1OLME 1GMMA 1S0JA 3RVHA 5EHDA 4AI8A 4AFAA 4R9DA 4Q0PA 4QXBA 4ZS2A 1JYWA 4ITCA 1AZDA 3C8XA 1POQA 1DGRA 1JUIA 2WAOA 5SV5A 2YV8A 1A8MA 1Q8VA 3P5BA 5FPLA 4HT1T 5CB7A 3AMMA 4CEWB 5LATA 5L9BA 1T6GC 1O3RA 1UOBA 3VBSC 3DUIA 1Q8QA 2VH9A 1IKPA 2WT0A 1O4TA 2DU0A 3SH3A 4XTMA 1AR61 1HV0A 1OT5A 1W8HA 1YCIA 2R063 3OUHA 4XBQA 2XBO2 3APBA 3MFAA 1X36A 4OHVA 2R043 1VLNA 3WEZA 5APAA 1VBB2 4FAHA 5A3TA 2DU1A 1RHI2 2YY1A 2WR9A 4FOYA 3WDTA 3WQ0A 3TYJA 5A3LA 4O7XA 3HNYM 1UOFA 3ZYFA 3ZN6B 4LIVA 1RIRA 4BLIA 4AVSA 2HWD2 5EWSA 5FZDA 3KZ4C 5E6HA 4I09A 4OHWA 2SLIA 2VNOA 3SKVA 3WDUA 3TEXA 3VL9A 4HSJA 3ZIWA 5DZEA 3HEIA 3JQWA 3CZJA 2ZMLA 1HB2A 1HV1A 5A3OA 4HBNA 1NCQB 4FFIA 3AMHA 3CU7A 4FOQA 1SBDA 2UWCA 4RS5C 3PJQA 3LE0A 2HBUA 5H9SA 5IVFA 4IGQA 2BWAA 1L7RA 3T4VA 4IGPA 2WJSA 3AP5A 3VHPA 2Q1MA 3RRDA 4YARA 3IAPA 4URTA 4B29A 3R05A 5CG9A 1W8ZA 3E6CC 4JVAA 3PJYA 1GSLA 4LITA 2HWF3 4QQOA 1UU4A 2XUEA 1QEXA 1ND2B 4FTSA 5JOWA 4UW4A 4WM7C 1NT0A 2B9VA 2R30A 4LHSA 1LR5A 1QXJA 3LOIA 4RA0A 4Z1VA 4LO4B 3WY6A 1AJKA 4U2AA 1SLTA 4OZXA 1F9KA 2UY9A 1I5ZA 4E4HA 3CBNA 1ENQA 5C6CA 1NG0A 1R1A1 1XNCA 3JD73 1WLDA 2DVBA 3FN9A 1UX6A 3ME2A 4LK7A 1QMJA 2WQ8A 3KV6A 2P4EA 3CKHA 1KGYA 2GH8A 4O65A 2RDQA 4D0QA 4WVMB 2OQ7A 5FZIA 1UOGA 3ZFGA 5LK7B 4M3CE 1AYM1 4N43B 1L7QA 3POWA 5CBLA 3G6JB 1XE7A 1F15A 1IHMA 2D3RA 3BODA 2Q4SA 5E1RA 2ZGLA 5A3PA 4DS0A 2IXLA 2CL2A 3GBFA 1WLWA 2ZEWA 3MICA 4B3NA 4P9YA 2P6HA 2JG9B 4BIOA 3FBMA 4EV0A 4NRQA 4AFBA 1URXA 1IG0A 1ULFA 3DPRB 3N7JA 4I02A 1AX2A 1DP0A 3HOBA 3IMMA 3Q8FA 1AX0A 1OUSA 4IETA 4ONUA 4XZUG 1XU1A 2QVSB 1S0FA 4H7MA 1W8FA 4UOJA 5GLTA 3OD4A 2OPKA 3AXEA 5FZGA 3I2HA 2VCAA 1RUE2 1QH7A 4HONA 1ULOA 5FR3A 4A2UA 5ABJB 3CNAA 1S4CA 1QJY2 3IBMA 1H8TC 2AEZA 2EXHA 3JZVA 4HVOA 1KDMA 3T2QA 1LGBA 3L2HA 1N3OA 2BWCA 1MEC1 3AVSA 4BE3A 2DUQA 1ULPA 4C90A 3LGRA 1W2UA 3NAPA 3N9MA 4NIIA 1AL0G 4R8HA 1DU3D 4OI1A 2CYFA 3TN91 2PTMA 3I3DA 1NA1A 1PK6A 2BDRA 3OGGA 2VQ0A 3QCWA 4YZ3A 5DQ0A 5KHIA 1UY1A 3OY8A 2AR6A 2BRTA 2ZOEB 3CJIC 2RHPA 2P3JA 3PTRB 4PCRA 1QXPA 4NWWA 2E7TA 2Y6GA 4JAAA 4MHUA 3AMPA 1RUI1 2VOXA 5EJ1B 3RPQA 3VBSB 2VQAA 4NPMA 5C7GA 5A7QA 1W0PA 1BK0A 3AVRA 2WQZC 4I3PA 4D6RA 3RGBA 1DBNA 2W0XA 2J1SA 5FAXA 2C9AA 1OURA 3OGRA 4Q4V1 1LB2A 1PGL2 1PO22 4OULA 3ZFEB 3QACA 2HWB2 2WIIB 3NL1A 2OVUA 2JDMA 3POSA 5FZ3A 3DN7A 4XF9A 2VMIA 1UCXA 5FQ0B 3WNXA 1UIJA 1YI9A 1LU2A 4XIOA 2WNUA 1H4GA 3ES1A 3FE5A 5BNQA 5GZEA 1RMU3 2JG8B 1H9WA 2UY8A 4IW3A 4XQDA 1BEV3 3VZKA 1EUTA 4I0AA 3HQUA 2VJXA 2KD7A 3OUJA 3SXWA 3GDBA 3FHQA 3VBOA 2Q5TA 2NMNA 1JOBA 1XE8A 3POBA 4Q0SA 3T3YA 1RXGA 1V6JA 3ZFFA 2OYZA 3ZPOA 2IC1A 2WYFA 4QB1A 2RE9A 5A70A 4Y33A 3I3QA 4RS5B 4QQ2A 3M70A 2NLRA 5LRSA 4OI0A 2B7YA 3AL6A 5BNPA 1O8PA 2VQUA 1CAXB 3RQ0A 4A45A 1Q5OA 1R1A3 2CTVA 1OLQA 1WW6A 3I59B 4LOSA 2JD9A 1WD3A 3ILRA 2A1XA 4GIQA 1XPWA 2DF7A 2Z5WA 4K7JA 4KGQA 4Q0UA 5DZFA 3NKTA 4CPBA 3GZEA 3H3ZA 3J26N 3I2OA 3WNMA 1AYM3 2A6WA 1J59A 3T09A 2P34A 5FZMA 2YPDA 4S2HA 2HWE1 1CQ9A 4V2WA 1ULDA 5T52A 4MSVA 1HKDA 1V6LA 4NJ4A 5BUVA 2ZHKA 4WM7B 1QXRA 5F9TA 3IN9A 3VB9A 4A3ZA 2GC1A 3PDQA 3VL8A 3GJBA 4GB32 1SCRA 1YQ8A 2VMHA 4DXRA 2ZGOA 4FSJA 1CONA 2VNGA 5FZ7A 4NE9A 4N9HA 2JE7A 3DYMA 3JU9A 1WW5A 1NXMA 3KQRA 2HYXA 4OHYA 1DQ6A 1AYN1 3LD8A 3IM0A 2XJRA 3HMYA 3VZJA 4EE2A 3ZO0B 3FUQA 1IS4A 5SV8A 2Y6HA 1NZIA 4XMIA 2ZGSA 3H42B 5F3GA 2VO5A 1TME2 5FYSA 4CP1A 4LBQA 4RFRB 5JSPA 3H3UA 1FOD2 2J1UA 4JHZA 3IIIA 3MLKA 1MEC3 5JIAA 3INAA 5BNOA 3VDCA 1DGLA 3TN93 3GYDA 1W99A 2RM21 3KS7A 4Q4Y1 1H8VA 2HEYF 3BB6A 2X10A 4IQPA 5I0RA 3IPVB 1DIWA 4XABA 3RYPA 4BHPA 3VLBB 2Q30A 1HRV1 3VD5A 2O8OA 2CAUA 3NV2A 1RUH1 1ST8A 1W6MB 2K2SA 2VUAA 1RUI3 3M3CA 2OKXA 2QCSB 2XQRA 3W21A 4BMEA 2IFWA 5ACA1 3N9NA 3FBYA 4XUOA 4AVTA 2ZS6B 3ACIA 3VD9A 4AYUA 3H8OA 4GWMA 1NYWA 1RUG3 2DUOA 1GANA 4Y22A 4BZ4A 4YPJA 1H8TB 3POJA 1O91A 3HJRA 4Q4V3 3THPA 3JB8A 3W5MA 3MW4A 3ZMNA 1EAH2 1PO11 4B4RA 2VMGA 1UKGA 3HNMA 3LEKA 1SLCA 2AEYA 3AZYA 3EQEA 4H2AA 1COV3 3ZKUA 4BQ3A 4Z2AA 5AFBA 3USUA 3U10A 3NNLA 3E6BA 4AWDA 3B9IA 4HPKA 2JDAA 1O59A 1VBA1 3OBRA 1RUD3 2BEOA 3H0OA 1TNRA 2W68A 5FPUA 1CVNA 3ZPYA 3UKVA 4IGOA 2W94A 1KS5A 3KV9A 1ASJ2 5AVAA 5FTTC 1C8M2 2FZ1A 2DYCA 3B01A 4KBZA 3I2KA 2CHHA 4FPOB 5JXJA 4Y4RA 1YQCA 4ASKA 1VMHA 2DFBA 3CLPA 2BOIA 2VNVA 1LOFA 3KT7A 4YW4A 4AHYA 5BNNC 4DINB 2TEPA 2QZ2A 1W3VA 2WFF3 2XMLA 3AMNA 3RJRA 5JXIA 4LORA 5EJZB 4X8NA 2VCBA 2ERFA 3HBKA 1TQ5A 3WF1A 1MQTA 1RVF3 3A4UA 5DMYA 2DV9A 2JWPA 4XETA 3AZXA 5CA6A 1XJAA 2R072 5C5TA 1FV2A 2JE9A 3SH4A 2HWE3 1N3PA 1PZ9A 2E53A 1H1AA 4GD4A 4YVSC 5BY5A 1LULA 5A1FA 3LA3A 4BIFA 4N8MA 4RFT0 4XAEA 5FCCA 3AP9A 4NHKA 4W6XA 3LB9A 4AEMA 2ZA9A 5T5LA 1W2AX 1TNFA 3KHBA 4J25A 2BVVA 1YYNA 4Q8KA 4D6QA 5J3UA 3FFQA 4HL0A 3CJIA 2RV9A 4OI4A 1QNWA 1SBEA 1QOOA 4ZXEA 1HB3A 3PMSA 3BGAA 3FHAA 2HWC1 1J84A 4YM0A 3VDAA 2I07B 2JECA 1UD1A 3WXPA 4MO3M 4EZ4A 1RHI1 2Z79A 2OUHA 2PXJA 3IDBB 3THDA 1ZZBA 2WINB 4TXWA 2R1BA 2ZGTA 5FFOC 2ZGNA 3HNBM 5F2SA 1GQGA 1JUHA 1UZYA 3RG0A 2HWD1 5CFDA 3U14A 1PGW2 5A6XA 2XR4A 4NHMA 5FZ6A 1O3QA 2RM23 4Q4Y3 4QPGA 5FZ1A 1CAVA 2E51A 3VHNA 5F8PA 1IS3A 1O7FA 2WN2A 1UPIA 2WZPP 3ZYIB 3V0BB 3AFKA 5DAVA 1G9DA 1HRV3 5DUVA 5ACA3 4CA9A 1MS0A 1Q8PA 1Z7S1 1QF3A 2EAAA 2JDPA 1W8OA 2VXRA 1GV9A 2B5HA 3NMBA 3DYOA 5B2GB 4SLIA 2W1UA 1FAYA 4FFHA 5K7PA 1PVC2 4JGYB 5D1IA 5T55A 3AL5A 5L7OC 1AVBA 2WZ8A 3PLQA 1CAWA 2VU9A 3EMRA 4K9SA 5E16A 2JDUA 3WX5A 3KT1A 1BEV2 1YXWA 1JYCA 4QU1A 2XH6A 3ROUA 5JIUA 3USSA 4G3YC 5T54A 1FNYA 1JMUB 2AYHA 1OKOA 1R082 3WF4A 2D40A 3SCHA 3KQ4B 2OIIA 3AZWA 4G9SB 2IXKA 2WN3A 1VBA3 3CHXA 4NROA 3J8F3 5C8WA 2X29A 4LULA 1UMZA 1PNGA 4K8RB 5GLZA 3PUAA 1H6XA 1Y9QA 4C0BA 1H6YA 1XNKA 4NHXA 2AUYA 1GOGA 2R32A 3PL0A 3D8CA 4S2DA 4YFWA 3JXSA 4ET7A 2VMCA 2YG0A 4XMAA 1H1MA 5DN2A 3NO8A 3T30A 4HFSA 4UYBA 3WHUA 4AFCA 5KHKA 3B9CA 4LIUA 2FZ2A 2ETEA 4LA3A 4MX3A 4YGDA 4AEJA 4GH4C 3GZAA 4FXGB 3T4HB 3MF6A 2CDOA 2V09A 2ZAAA 1RUJ2 3NKGA 2F17A 2PHXA 1QNYA 3I2DA 3VZNA 1ULCA 3O1PA 2CWMA 1VBD2 5DUXA 1SEFA 2VBDA 2YGLA 4N9IA 1AR92 1NCRC 3AKTA 3LSDA 1REDA 2PFWA 4LBMA 1B35C 3M8LA 4ES9A 2UWBA 1DGWA 3ILNA 1W8UA 1VPHA 1SG3A 2DVGA 4MHRA 3PUHA 4ES8A 2XJQA 5CYYA 3WP5A 4DZGA 1RUE1 2OW4A 5BNNB 4QDRA 1PZ7A 4IDZA 4BQ4A 1QJY1 1RTVA 2VL4A 2XBO3 4PLOA 2WT2A 4PT6A 1SPPA 1WCDJ 1Z0HA 2VTFA 2RG4A 3KVAA 3OJBA 2Y34A 4UFMA 1VBB3 3LIGA 4XYXA 4YW1A 1RHI3 4FCAA 4EN0A 1RGSA 2D6LX 3HWJA 4Y5TA 1RITA 3ZSMA 4CDQC 3O1MA 2R0HA 4YVSB 3DL3A 4AOCA 4ZONA 3AB0A 1F35A 2HWD3 1WUVA 1N1SA 4LKDA 3SNMA 3VBRA 4WVZA 4META 4FP2A 1F8VA 4S2GA 1QJEA 4NO4A 5LBEA 3RI9A 3VZOA 4DO0A 1POV0 2PLV2 2BERA 1Y3TA 2RS13 3WP6A 1CJPA 4PDWC 3GALA 2WO7A 1OPOA 4N7UA 3S30A 3SHRA 5JZGC 3RZGA 2D44A 3M4FA 3LF7A 2Y8KA 3WG1A 3ES4A 5A7WB 1IQDC 4LHKA 3AM2A 2XJUA 5CKMA 5FV3A 5J98B 1SBFA 4Y1UA 1LHVA 3LAGA 1PGL1 1I1EA 3AZZA 4GKYA 2ZMKA 2HWB1 3LDBA 2JD4A 2E31A 3OPTA 1GOHA 4BOWA 1LNSA 5FOBB 4CSWA 4P9GA 4CCNA 1A3KA 3PUQA 4HANA 1UXXX 1XBFA 3ACGA 3BYWA 4J1XA 2FHRA 2ZGUA 4OUSA 4OZOA 4YW2A 4FI9A 4KG0A 4CCLA 4BCUA 1FYUA 3OSDA 1W6PA 2G1MA 1FPN2 4JQTA 3UV9A 4ORFA 5FY8A 4CEWC 5GLWA 1AL21 4I01A 5TSWA 2LRPA 2WZR3 4FTEA 3MW2A 2RDRA 3EO6A 4CRQA 4AE2A 1ZREA 1DLCA 5HBAA 4JKLA 1H2NA 4UFLA 4LBJA 4CYDA 4IEVA 5CG8A 1XQNA 1GNYA 4C91A 1FXZA 4AI1A 3A7QA 1HXS2 4HG6B 4L11A 4LO7A 2VXJA 3LZZA 3B02A 1IOAA 1QGLA 2TBVA 1W2OA 2FDKA 3BTXA 1OLMA 3I3BA 1OA3A 2WO2A 1D4M2 3MUY1 1W05A 3I2JA 3HN1A 5EV7A 2W52A 2DFCA 4PF1A 5FXXA 2HBTA 3O0WA 5GALA 2R49A 4GB31 4W6YA 4P08A 5LA2A 2P1BA 4TLGA 5FP7A 3HD8B 4HK8A 4LHLA 4MOAA 4NPLA 4B8EA 2H6CA 3RSJA 1BQPA 3V0AB 2ID4A 2Q0AA 2J1VA 2IXJA 4GWNA 4LKEA 1U0AA 2ZKNA 3UKTA 3PVNA 5A3MA 1RUE3 5IATA 1AR72 1CR7A 2HLEA 3NQHA 2GMPA 5CFCB 5FK8A 3QH7A 4UFJA 1QJY3 4DXSA 2ORZA 1MS1A 1TME1 2EAKA 5F6LB 3ZMOA 4AGVA 4AHZA 4QPIA 1ENRA 1X9TA 1FOD1 2JKBA 5CNAA 2UYBA 1VALA 1YI7A 3C2UA 1GZ9A 1WGPA 2QQLA 4FVVA 2ZX1A 3S7IA 3IIAA 4QDSA 4QB2A 4NIDA 2IVIB 4TYSA 1NCRB 2JXAA 3WNNA 5J37A 2TNFA 1B35B 5L7OA 1ZZ6A 4UAPA 5H9QA 2VULA 4QX2A 2WFPA 1PIV2 3HBZA 3NWKA 4KWKA 1X8MA 4ZPIA 1NKGA 5DPNA 1VAVA 2A73B 1G86A 2F6BA 1LHNA 2WNVB 3RWNA 1STMA 1VBC2 3MFCA 3BN6A 3NRUA 4I3GA 4R4ZA 2C5DA 5A32A 4TLFA 1UKRA 1PO23 1EAH1 4CE8A 2HWB3 1PMHX 2JIGA 2DTWA 2GC3A 2VZ1A 4COZA 3AP4A 1YIFA 4N43C 2XB6C 1EPWA 5FPAA 1W6NB 2YC0A 1ZZ8A 4QQPA 1BZWA 2C26A 1XNTA 4H3WA 2G9GA 5FMBA 2LROA 4EWEA 2RDSA 4V2VA 3VBHC 2B9UA 3BIEA 4XFGA 1QJZA 4XUQA 1E5RA 1UU5A 3RFRA 2FDFA 1RUOA 2A5ZA 5C4WC 4PBPA 5KC6A 3SCGA 3WCSA 4EN9B 5DABA 4UW6A 2R6QA 1ASJ1 2WWUA 3AMQA 3I97A 5CFCC 5GZFA 3E5XA 3MW3A 4QKFA 2B8MA 2PHWA 1IPSA 2YU1A 3I7DA 5G04L 4GH4A 5C3SA 1BKZA 2ZHLA 1WA4A 4B7KA 4X8PA 3C7FA 4LUKA 3AJZA 4JRAA 3I3MA 3VBUA 3KVBA 3ZR6A 3OGSA 3BTAA 4XFHA 1SZBA 2DBIA 3J4UH 3VKLA 3TAYA 4M3CA 4M0NA 3RDIA 2YUEA 5FY0A 4GULA 2ZPXA 5A33A 5DDJ2 4AHXA 1XYPA 3D0JA 3ACHA 5C3PA 1DDLA 1JU4A 2R071 2VM9A 4PI2A 3V65A 5DAQA 4UFKA 4HKWA 1JZ3A 2W1WA 2GN7A 4Q1PA 3ZXDA 2JEMA 3PURA 1FT9A 1UY3A 2JDZA 2QQVA 3JBG2 4GB33 4FPGA 1IS5A 1G9FA 1WA6X 4E2SA 3NVCA 3ZDVA 1ZA4A 4EQVA 1XXNA 2ZACA 4CDQA 3O1SA 2PQQA 1TZOA 1UQXA 3UNPA 4Z8BA 2QKDA 1W9FA 2IXCA 4XHXA 3ZFEC 3ZSJA 4RQPA 2FCTA 5IK5A 5L73A 4M00A 4YM2A 3MI8A 3MPPG 1OKQA 5LY2A 3VBFC 1REEA 3FFZA 5JDBA 5K0UB 1TME3 1APNA 1OSGA 4PDWA 1I6XA 5KXCA 4CDWC 1FOD3 2ZKLA 5JZGA 4YZ4A 5IUQA 1O5UA 2JG8C 3E5UA 1PGW1 4BDVB 2W91A 3ZYPA 4RHV2 3R6SA 2D97A 4CCCA 3H7JA 4QXHA 1NXD1 2RS12 1BMV2 4LBLA 3H1YA 3KM5A 3U11A 3N36A 1OPMA 2VVEA 3TNPB 5IVVA 2X09A 2P5BA 5IVYA 1O4YA 4N90A 5GLVA 4CXWA 2ZX2A 1KXGA 1TMF2 2EVXA 3KF3A 1PVC1 3CO2A 4MVTA 2R041 4AAPA 1UY0A 2CY6A 1DZRA 2GALA 2WAAA 4QWNA 4FQ4A 4IV3B 4CEYC 2ARCA 2NZ9A 2NQYA 2WLPA 5FREA 3SCFA 3U4SA 4DIQA 2ZBJA 1U12A 3H50A 3N7KA 1EAH3 4LXLA 3FLPA 1RMU1 4CEWA 1WBFA 1BEV1 1W28A 2H0BA 5ERLA 1CAUB 3WUCA 3OCPA 1R081 1H2LA 1SCSA 4RR3B 4P00B 2WNEA 3O1VA 3ZDSA 4I2OA 2G19A 4KGGA 2W3JA 3KGLA 5FYBA 4DNYA 3RWKX 2BGOA 2WZR2 2A6ZA 2FBEA 5EZWA 4CCKA 1ASJ3 4P02B 2O8QA 1C8M3 2QTWB 4LOTA 4RYDA 5D21A 1D2SA 2VUCA 2QQNA 2D93A 3ZN6A 1E5SA 3B5LB 2W2IA 3OBTA 4M0HA 3KCYA 3LPGA 4XJZA 3WOGA 2DUPA 4CDUC 3V56A 3KF5A 2IUWA 4HLTA 2X53S 1JXNA 5FPVA 3O1RA 5AFEA 3QOPA 3PU3A 4XQWA 3POFA 4UFHA 1NCQA 3VBHB 1Q8OA 4PI0A 3SMHA 1V00A 1NE6A 3HT1A 1G9AA 1GP6A 1RUJ1 2R073 4PQ9A 2B4KA 5C4WB 1AJOA 2VMFA 4NN0A 4XHBA 1VBD1 2VAUA 2GZWA 3NSTA 1AR91 3LWCA 1W6QB 1WLTA 3WZ1A 4CDXC 1NE4A 1MS8A 1QQP2 3GJAA 3VDBA 1UIKA 3WR0A 3WW1A 3OEBA 2E32A 2JDYA 5FYIA 5GZGA 5JI9A 4ARYA 5I8SA 2PHUA 4FAGA 2ADDA 5FXVA 1HJFA 2Q8OA 1KJRA 1ZBE2 1PM7A 4BQYA 4CP0A 5FYVA 1LJ7A 1F4AA 3Q8EA 3OPZA 1K5MC 1ND2A 4COVA 5LRRA 3D5OA 2L9LA 4XOGA 4AK3A 1A8DA 1UYZA 1C4RA 3UKNA 3K48A 3AKRA 4RSUA 3ZXLA 5F5IA 1UWWA 3AP7A 1U5YA 1D7PM 4LBNA 4QHZA 1MS9A 5IW0A 2J1TA 3PIGA 2XG3A 3WF3A 4FT8A 2H0VA 1GZWB 4A7KA 3ZYJB 4Z92B 5M0TA 2V5DA 1HRI2 3WP3A 4M4PA 4QPYA 1JYNA 2PLV1 1U5XA 4WVMA 4YFZA 1RUG1 3I2FA 2GU9A 4P5HA 3VN4A 1GZCA 3ZVXA 4N43A 5G05L 2NYYA 2D98A 3M7AA 3OEAA 4V1PA 1ZX5A 2BGPA 3KCCA 4PLMA 3TRSB 1ENSA 2N7GA 1PVC3 2OXBA 2XL9A 5FLIA 3VBFB 2J1RA 4YZ2A 4Y20B 1OA2A 2JG9A 1COV1 4QM9A 4CDWB 4PBOA 2VBPA 3P1IA 5F5QA 3DPRA 3K2OA 5EFUA 2A6XA 4Z07A 3OBAA 5CFCA 3FC0A 4DOUA 2W39A 2OUJA 3K3OA 2YDEA 1KDKA 4M3CF 3ZYHA 2J7MA 1RUD1 2O1QA 1QJFA 3U07A 1C57A 3K77A 2XLFA 3H3LA 1R083 5CKQA 1H30A 4Q2FA 1RYYA 5ANNA 3GF6A 4FPKA 3RYKA 1Q8SA 5LBFA 4XJAA 1B09A 1NOVA 1ULGA 3LEIA 4GXLA 1QJU2 4AG4A 3BTZA 5E89A 1KD7A 5FJKA 2J42A 2B42B 3WW4A 1GOFA 4UF0B 2QQWA 2WFF1 1XSRA 5CZKA 4CEYB 5JLVA 1R092 1SACA 5IVCA 3VDDC 4FTBA 1PHMA 4YVWC 1RVF1 3W59A 5JMOA 3L9JT 5IT6A 1ZZ7A 4DRVA 2R1DA 2VW1A 2WT1A 1CN1A 1HXS1 1F31A 2IWGB 3VBSA 1SFNA 4NAOA 1X7NA 5DAXA 1U5IA 1QJX2 4WVVA 2HYKA 2VZQA 2XOMA 2ZABA 1J58A 1V9U2 3GBGA 5J48A 1RUJ3 3ATGA 4HETA 5FYYA 4IE6A 4AVBA 2RJ2A 2VE1A 4KH9A 2YYOA 4UT5A 3ZFEA 5GZCA 3E6DA 2W47A 4MLOA 4XEZA 1VBD3 4P9JA 2WSUA 2IXHA 1AR93 2E7AA 1UAIA 1G7YA 4G4FA 5JI7A 1UZWA 2V4VA 3VKFC 4E4DX 1VMFA 5FQ0A 4R9CA 1WMDA 3K4ZA 1DQ5A 3RJ2X 4BISA 4C1WA 1LHOA 3VKNA 2JG8A 2JB8A 3NNJA 4CDUB 1AR71 4IXLA 3MZHA 2EXKA 1YC61 2UU8A 4JGYC 4GQ7A 3N7LA 4KU8A 4QX1A 5L36A 1US2A 3PHMA 1F4HA 1DQ0A 1NLSA 3Q9OA 2JIJA 1OF4A 2A70A 2Z2SB 1OFSA 5E88A 1RINA 5FZ9A 2E7QA 2QJVA 4TWTA 2ZCWA 1X33A 4RS5A 1JOJA 1OFNA 1H1IA 2UWAA 2ZEXA 5F5AA 5LA0A 1AHSA 2Y6JA 1CAXA 3ETPA 2FQPA 3NNGA 5E8AA 5LBBA 3I59A 4CDXB 1S2EA 1S0EA 1J3PA 1W6OB 1PIV1 1LGCA 2VOVA 3N3HA 1KFXL 1DZQA 2WLQA 2PLV3 3R4SA 1SFYA 1H4HA 5K4LA 2XKPA 4Y26A 4IE4A 3OF1A 1OMIA 2BNOA 3KV5A 3MLLA 5BYNA 3K75B 4B7EA 5F1RA 3U4XA 4YM1A 5C8CB 2PHLA 3OTFA 4ZZ5A 1K5MB 4Q8LA 4WM7A 1OA4A 3POGA 5FP9A 4HOOA 3FLTA 5I0SA 1O5LA 1K42A 3K51A 1MZEA 3ZOIA 1CPMA 3POEA 1SHWB 2WL1A 3WNLA 4YW3A 5FRAA 4CP9B 2RS32 4JKKA 3AFGA 1PMIA 1H0BA 2OT7A 2WWJA 5FZFA 5FP4A 1DYOA 1H2KA 2D6MA 3CIHA 3PU8A 3WG2A 5J09A 3KSCA 5K9YA 3J8F1 4I30A 1BJQA 2VOTA 1JYTA 1OD3A 2PELA 5DXDA 1LRHA 2ZGQA 5AVPA 2YHJA 1QH6A 5HCFA 3SEPA 3URFA 1W9TA 1JW6A 3RMYA 2X05A 5A3WA 1FPN3 4JHTA 2MHFA 1DYPA 2QBXA 3ITQA 1C1LA 4EJRA 4EROA 1LOBA 3MLJA 1ND3C 5FUPA 1ZBA2 1W2TA 5FY4A 1HQLA 2ADEA 4BK4A 2GMMA 1QWRA 1S0GA 1R1ZA 2GH2A 3K46A 4MGKE 4YG6A 4TTGA 4MGTA 3IZOA 1ZNPA 2AENA 4XCAA 1IPJA 1DGWX 4WV8A 3MHZA 1UPSA 4OHXA 3IPVA 1Q43A 1XC6A 2BW8A 5C70A 3RNSA 4OQ8A 1WMFA 2BFUL 1UMHA 1W6MA 2GP5A 1HXS3 1POV1 4C0HA 4RGKA 3ZIXA 4NRPA 3J7MA 4NRMA 1DHKB 2BJSA 3I49A 1JTZX 2JE8A 2YROA 4GWIA 1JHJA 4BQ5A 3ZSEA 4ZKTB 1DZTA 3KWVA 4O9EA 1D4M3 4GMP0 2ARAA 3T0BA 1MVQA 1H8TA 3U1XA 2CGPA 1CD3G 5FOJB 4XBNA 2BZDA 5JUVA 3PVOA 3RZZA 3CF6E 4DEVA 3GNEA 2ZAHA 3EHKA 4XTPA 5JVVA 2JDKA 2C6SA 1UX7A 3IDEA 1LHWA 3BOWA 1A34A 1CIWA 2RDNA 3OPWA 4KBBA 4YLZA 3VDDB 2F4PA 1YHFA 2XBO1 2XUMA 3HVDA 4YVWB 5C9AC 4R4XA 1OH4A 1AR73 4XAAA 3F95A 3UGHA 5HCAA 1VBB1 2PHTA 3D82A 3M3OA 3ZKYA 3JUUA 4EN8B 5F7UA 5FYUA 1XNBA 4Y1XA 2R7EB 2Y6FA 4E27A 3UESA 3HPNA 1BVVA 1W9WA 4KNCA 4XF4A 1DQ2A 4QMAA 4RHV1 1AR62 2J1EA 2OX0A 5FO9B 1UY4A 2KR2A 1CPNA 2RS11 1BMV1 1W2NA 2YBKA 3U75A 3O0XA 2F4LA 2PHDA 5JWPA 5LZ6A 2VW2A 5T50A 1ENXA 1PIV3 4FPEA 3AYDA 3DV8A 5I91A 1NZCA 3W5NA 1UOJA 1C28A 3MIFA 4CXXA 1OXCA 3N9PA 1NY72 3K3NA 3KV4A 1A78A 3MIHA 4J6GA 4Y4YA 3T1MA 3FUOA 5FMOL 4BJ0A 1VBC3 5D8AC 1VE0A 4X6QB 1C1FA 1SQ4A 2Y6LA 1KS4A 2JJ6A 3PNAA 4IV1C 4Q0VA 5FMDA 3EBRA 3W9AA 1ALYA 1VIWB 4QX3A 2YMZA 3AYCA 3P3NA 1ZRRA 4EWDA 1YIPA 2C4XA 1XB9A 4LO5B 4TZDA 2VPVA 4M01A 4MXVA 1AXZA 2X5IB 5JSOA 1UN1A 5IFPA 5JOZA 3FX3A 5FZBA 4YSFA 1W3XA 4JGZC 1XE0A 5I93A 2WDBA 4CP2A 5D2AA 2PAKA 4QX5A 3QBQA 5FUNA 1SDDB 5IK8A 1LCLA 1WWYA 2WZR1 1G9BA 5CKNA 3NNMA 2DURA 4UI9L 3D6EA 4CUCA 1JZ6A 1HIXA 2MPFA 2JKXA 4WM8B 3O1TA 2A7AA 3IDAA 1JH5A 5FP3A 4Y1ZA 4BMBA 3KD4A 3THCA 3QD6A 2LW8A 2WA4A 2DCKA 3WF0A 3N9QA 3DEMA 1GZTA 4XF0A 1FMD2 4XQ4A 5HXVA 2CNAA 3SITA 3V0BA 3BTYA 2Y64A 2X8KA 3KB5A 2W5FA 4BPZA 5CEHA 5A3UA 4JDMA 3VD7A 1O8SA 1S1AA 1W8NA 3DKWA 1POV3 1HLCA 5DDJ3 5T5OA 3B69A 1YWKA 4UXAA 2GAUA 1F2NA 1OOPC 1IGOA 2RMU2 4LE4A 2WS92 3MV01 2MEV2 4AI2A 4JGYA 4NMIA 3SLIA 1Y9GA 1UNBA 2Y6KA 1ND3B 3JBG3 1RXFA 4UBHA 2VUJA 1S2KA 4BWOA 4IE7A 3NV4A 3JB4C 2FD8A 1WMXA 3ACLA 2WNVC 3BKZA 2FCVA 2W08A 4GAZA 4LPLA 1ZBE1 2VTXA 5EIYB 2JB4A 4XUTA 4CUBA 3LCPA 4RL7A 1W8TA 3IMNA 4XF1A 5H9PA 2FCUA 5JSRA 4A7ZA 4AW7A 4DRRA 4JQRA 3BUCA 4MXWB 5FLHA 3WNKA 1VRH2 3F2ZA 1DYKA 2NM1A 2QQUA 2WSVA 1W9YA 2GDFA 4EN6B 1YFXA 5J96B 1CWPA 5FIXA 1E57A 5FBJA 4NIHA 2C24A 2BU9A 5FZOB 3HQRA 3BPSA 3ALQA 1GWKA 2W1SA 4YNIA 4RHV3 4PIXA 3RMXA 1ZRFA 1J3QA 4QGLA 2FDJA 3T2OA 4C1XA 2ZZQA 4FFGA 1HB1A 1VBE2 4W8JA 1RUC2 2VD7A 1O6UA 2GC2A 3WDYA 5IK7A 2ZHMA 2EIGA 4JRLA 2VMDA 1E5IA 3FWEA 5GM0A 5C9AB 5FYMA 4GZ9A 5FZKA 2WWSA 1PO21 3ZXEA 4LLOA 4QGMA 4YGBA 1RJ8A 4B4QA 2QDNA 1TMF3 1PNFA 1JN2P 2ATFA 1AX1A 4OHZA 5A6QA 1PX4A 2A71A 4HVRA 2WO1A 4H55A 3OYWB 1LKNA 3WDWA 1NLQA 1CIYA 2W87A 5FO8B 5JR2A 3U37A 4AR2A 1DF0A 1I5PA 2A6VA 4D7SA 4QDQA 5BNNA 4PLNA 2IXIA 2EALA 1LOCA 1QU0A 4CZSA 4F83A 3MEPA 4IEZA 4K6BA 4NUBA 4XE9A 1YFYA 3D0SA 4XFBA 4ASMB 2CDPA 4UWDA 3VD4A 4MADA 1A6CA 1K5JA 2EF6A 4KWJA 4PQQA 5D8AB 4XFAA 1X9PA 2VBBA 2BP6A 4IV1B 4YVSA 1R091 3POIA 2VVFA 1MS5A 2IZWA 2OPWA 2ZMNA 1Y43B 2E63A 5LY1A 2ZZJA 4Z2WA 5BXXA 5K0UC 3OGVA 1JZ4A 3P6BA 1M4WA 3UGGA 4DUWA 5FY1A 3LDRA 4YZ1A 2ZX3A 1QJX1 1DCSA 2GN3A 2GNMA 1ULEA 5ANQA 3MIGA 1GUIA 4ISRA 5A7WA 1V9U1 3U78A 2BNNA 4HVQA 4JGZB 1W0NA 5IYYA 1S55A 2Y0OA 2D6NA 2ENRA 1GKBA 4ASLA 2XHKA 4MGIE 2VZPA 3E1F1 3GHNA 3T2TA 3WDVA 1JYXA 5F3CA 3S0MA 1QQP3 1JBCA 3SC7X 2V5YA 4BM8A 4D94A 2ZJCA 3CQOA 3PUIA 2JENA 1O4ZA 4LO8A 3ASIA 2D3PA 5LBCA 3M1HA 5FUIA 4P9XA 1ZBE3 4AVAA 4KL1A 5L9RA 1JZ7A 4IV3C 3VGIA 2GP3A 3AKPA 4IEWA 1MZ6A 2NMOA 5ABJA 3ZFGC 3CL1A 4E4ZA 3RZJA 3BOPA 4F3JA 2RVAA 4QPWA 3UK9A 2XDVA 1MZ5A 2DVDA 3BCWA 4LUMA 4CVUA 5FWJA 5HPOA 3NJXA 1OOPB 3BVCA 2P37A 1AYN2 3W58A 3R0RA 2AREA 4OLLA 5JXGA 1FX5A 4AEDB 5CISA 1AR82 3EXUA 4KU7A 4RR3C 1J3RA 1YUDA 4J1WA 4Q29A 2BVBA 1HRI3 1S0DA 3ORJA 1I9RA 1TVGA 1WLCA 4XPVA 1VR3A 1ZYBA 5FPZA 4LT5A 4NAMA 5FYTA 4NIGA 1V6MA 4QB6A 4QT6A 3LPFA 5ISLA 2O0OA 4WZCA 3CJXA 1GQPA 4INDA 1W8WA 5A6YA 1IZ3A 1SDWA 2VMEA 5ACA2 2Y26A 3MF9A 4WBBA 2Q8DA 3HQXA 4AXOA 1RUH2 4N53B 4IV1A 2Z69A 1C8NA 1JYVA 3DECA 3TEWA 5FZ8A 3ETQA 4CTEA 2RS31 3V0AA 3BU0A 1NA1C 4A6OA 5FZLA 3RZKA 2BGCA 2OQ6A 3O5SA 2XVLA 5FP8A 1JHNA 5I0TA 4FP3A 4QHOA 5FZEA 4BXSV 4AI0A 1W06A 1C8M1 2EICA 1PO12 1G6NA 2DDUA 1AUYA 4K3UA 1N3QA 4OVEA 4OUEA 1ZBA1 3WSOA 1QJU3 3UGFA 3WUDA 4XDQA 3N9OA 2K46A 2ZGPA 5C3QA 3JQXA 2CAVA 2EIBA 1EP0A 3TBDA 4EWAA 3S6PA 4JCKA 1W90A 1R093 1CJDA 1GU3A 1NCRA 1YQ6A 4FPLA 1QOSA 5HV0A 1B35A 1ZRCA 2VZUA 3DXUA 2HEWF 3SISA 1O3TA 2Q8CA 4Y5SA 2PHRA 1KQRA 4MYEA 3FLRA 1IQAA 2DCJA 2AZ5A 2WNUC 1LU1A 2G4IA 4Q4W2 1KEXA 4UBGA 2WNVA 1QJX3 2W92A 2NN8A 1L3JA 4XFIA 1XU2A 1V9U3 4IESA 3C7GA 5CADA 1K12A 1RC6A 2LTNA 2XVGA 2D6PA 1SMVA 1Q56A 3GZTB 2BPA2 1GYKA 1VRBA 3WNPA 1J1LA 2RR12 3H1WA 4L2NA 2K0GA 4KI5M 4RD7A 1W6NA 5H9RA 3SQOA 1UY2A 2K9ZA 4MGQA 5AC92 2EIEA 5A7OA 5BNPC 2C9KA 2A75A 5EPAA 4ZU4A 2DCZA 4CPBD 1KRIA 1S0IA 5IK4A 1W0OA 3LA7A 4YZ5A 2R16A 5HI0A 4LQRA 4XURA 5I8YA 1WBLA 5EYXA 5IVBA 2Q1FA 3FMGA 1NLRA 2AH2A 5BPXA 1N1VA 2I2SA 2YC2A 1FATA 4JZRA 2QQOA 3OGJA 3A23A 5EXOA 2GC0A 3AC0A 2WC2A 3H8UA 1XNAA 5LEKA 1HQNA 3WCRA 4CXYA 1CX1A 5FY7A 4AEKA 4JC1A 1ZZ9A 3PMEA 3Q8BA 3MIEA 3VZLA 1H9PA 2HWC2 3ELNA 5FYZA 4XBLA 1JZ2A 4AGRA 1ZRDA 4HKLA 3C3VA 4HKOA 3WHTA 2Z42A 3CMGA 1KJLA 1RUF2 1Y7BA 1NY71 2BBAA 4YW7A 3EB7A 3WG3A 5C33A 3KMHA 4EYUA 4GKXA 3THTA 4LBQD 3ZFGB 3ZXFA 2VGDA 3HT2A 4QXCA 2EA7A 4AQSA 1PMJX 1AXYA 5I0DA 2LM3A 4QX7A 1H2MA 2CU5A 4IEUA 1D2QA 5BNOC 1Z7S2 1LODA 5EYYA 4E8DA 4A41A 1MR5A 2RS33 4QAWA 4ZXKA 4MGZE 2XJSA 3OBZA 2H6BA 1IG3A 1F5JA 2B39A 2YFZA 2CV6A 3NV3A 5IJRA 5J1XA 5LA1A 1C3HA 3O1UA 1S0BA 4AAXA 4LMFA 1PZ8A 3DCQA 2C0ZA 4F8AA 4H7LA 5C3OA 1JYIA 1ZA7A 2ARXA 5K0UA 1GNHA 3R4DB 4TN7A 4XC9A 3RZLA 4Y5Z0 1WCSA 4COWA 1ZBA3 5JXHA 3T1LA 1VJ2A 3ZSKA 1AXKA 5A80A 2VZSA 4E8CA 5B4XA 5A1AA 4HK9A 5KBFA 4IEPA 2LS6A 1V0AA 1OC1A 3QH6A 4K8FA 1FMD1 1HN1A 3NAPB 5FLJA 5EQUA 4KWUA 5JCTA 2HEVF 1CGPA 2YBPA 1NA1B 1PK6B 1LAJA 3OY8B 2D5FA 5EP9A 1EPZA 1X50A 4IE0A 3RYRA 4HMZA 4YW6A 5FYHA 3SKJE 3WV6A 3KT4A 2RMU1 4KG8A 4XVHA 4LE3A 2G9ZA 2WS91 3S57A 1WCUA 2MEV1 1C5IA 1ACCA 1YNAA 4IV3A 1YJKA 2KA3A 2ZGKA 3I4IA 4URAA 1UO9A 2XXZA 4A7YA 1UZZA 3FJSA 3NV1A 3PUSA 3GBWA 1UYPA 3RZMA 1ZZCA 2GNDA 4P9LA 1EY2A 2ZGRA 1ZVFA 2AACA 5LB6A 4DPNA 1GR3A 2QNKA 4QKDA 5C8CC 4XZPA 1CAUA 5FZCA 3ZXAC 4L99A 3KHCA 1LOFC 5FPXA 1K45A 2BOJA 1ZRIA 1GNZA 2QQIA 4RR3A 2PN5A 3W20A 4LKFA 4MUVA 1S0CA 1D0HA 3X29B 2QZ3A 2VZ3A 3T08A 1YFUA 4O61A 3LOBA 2WNUB 1MQTC 3AKSA 4YW5A 3WW3A 2VNRA 2YXSA 1WKYA 1VRH1 3OOXA 5IVJA 5JOYA 4GJZA 1JU3A 1PGSA 3VBOB 2Y33A 3AKQA 1AR63 1GWLA 1OD5A 3ZFFB 5C3RA 3J7LA 5CIRA 2GNTA 1LGNA 1VBE1 5C5UA 1RUC1 1TE1B 2WO3A 2ZEZA 1FNZA 5BNPB 2JDNA 2VECA 2VZVA 3AX4A 3GZUC 4OMDA 3VBHA 3TEYA 4KQ7A 3DF0A 3M2MA 4IEYA 4IEQA 5DAPA 1OVSA 3L2YA 2ZGMA 4AFMA 2DVAA 5C4WA 5KR7A 2ET1A 1N47A 1K3IA 4AVVA 1BLZA 4GMP1 2RS52 2BUKA 4Q4X2 4CUGA 1W6QA 5FZHA 4D8MA 5LASA 5GKAC 4OFGA 4W6WA 4ATFA 4QQHA 4O9GA 3M3IA 4E2GA 1WW7A 1REFA 2YGMA 5CFDC 1I3HA 2EXIA 2PA7A 3H7YA 1LOAA 3KLSA 4L97A 2W9XA 5IAVA 4XJ9A 3CZUA 2WYSA 4QPGC 1N1TA 4D7TA 3S5QA 1FPN1 2OA2A 2XQXA 1W03A 2YPJA 5FXZA 1YEWA 1UZ0A 1MPXA 2BQPA 4K21A 4AI3A 4IEOA 1BBT2 4Q27A 5JMCA 5FYCA 4NHLA 3K4AA 4IE5A 2CGOA 4A42A 4AQ6A 1QIQA 2P3YA 3LSEA 4BB3A 2PAEA 5CU1A 2PYTA 4CU9A 2NP0A 1GZWA 4FQZA 4QGNA 4LBQB 4NPRA 4C8DA 4RGAA 5FY9A 2I45A 2I74A 1Q3EA 3VD3A 3EYPA 3MPBA 1QDCA 3B93A 4CU8A 3UT0A 5BNOB 4M4RA 1FMD3 1EYBA 2AGSA 1D4M1 1AL22 3BU7A 1BXHA 4Q1RA 3P3PA 3LEMA 5FJHA 1JOPA 2YZ4A 4XILA 3O7OA 1MS4A 4XFFA 4NOTA 2DBNA 3WINE 3ZXGA 2QQKA 1XYNA 2YBSA 2LALA 2RMU3 5FXWA 3B7MA 4AGGA 2RJKA 2ILMA 2WS93 1RL3A 2MEV3 2BV4A 3VBFA 1EV12 3LA2A 4Y20A 3ENRA 4CCJA 5F3IA 5I0UA 3WNOA 4FPJA 5IAXA 4CDWA 4CCOA 4X6RB 4RN5A 4Y22B 4ATEA 2Y38A 1LEDA 3UYJA 4DUXA 4NWVA 1C5HA 3C7OA 3AZVA 1JI6A 2XONA 1JODA 2B45X 3VHOA 1HN0A 5IVEA 2WA3A 3WLUA 3LFIA 2XLGA 2PQSA 2ZX0A 3GGLA 1IKQA 4XFCA 3USUB 3E97A 5FWEA 1VAKA 2ET7A 2W95A 4JDNA 2D7FA 1VRH3 2R062 4HPKB 3H8XA 4BQ2A 2X5IC 4DMIA 1CZVA 3NNFA 1G9CA 4K1YA 3PVEA 4OI2A 4R9AA 4UF0A 4CEYA 2R042 1AR81 2PAMA 1YFWA 2MNGA 4FXKB 4BK5A 2D3SA 3GXUA 4JV4A 3ZN5A 4LBOA 3O1OA 1VBE3 3IWZA 1RUC3 1NQJA 3S7EA 2BBVA 4DY5A 4AQTA 1VBC1 2XWBB 4XXAA 4ZU7A 1IS6A 4LTAA 2DVFA 5GZDA 2A3XA 4WM8C 1CESA 2DCYA 3Q8AA 2BNMA 3HIFA 1RJ7A 1J83A 1MQTB 4QKNA 4GMP3 1V6KA 3MYXA 5F39A 4MZUA 1ONAA 2PMWB 3PTYA 4FFFA 2A6YA 4BU2A 2FMDA 1HJGA 2FDIA 1XNDA 1FV3A 3BPZA 3VBRC 4CDUA 2IFRA 4DQAA 4K40A 2ZEYA 1YQ5A 5KXDA 2GSYA 2QQPA 1UW8A 1LTEA 1V6OA 2HJIA 3M3EA 3POYA 1OQ1A 2WQ4A 3MIDA 1GWMA 2VR4A 3IB3A 4MGYE 5KWRA 1AF9A 1VMJA 2IVJA 4W4ZA 4DEQA 2GMEA 4RGGA 1QDOA 4NHYA 4P5YA 2HWF2 4K1ZA 3CJIB 2XGXA 5LA9A 5GLUA 1YRZA 4P9IA 3J7HA 4LA2A 1TG7A 2AC1A 2WABA 5T3NA 4CDXA 2WBKA 4IUGA 5DDJ1 1W6OA 4PIYA 2QUOA 3OD0A 5JOXA 2P6CA 3OUIA 5FKBA 1W9SA 4A44A 5CFDB 4U36A 3JD72 2XJTA 2XJVA 2P3KA 4Q4W1 4QPGB 1OBNA 1CAVB 3UL2A 3RI8A 5C8CA 4CCEA 4ZZ8A 4JTNA 2XKOA 5F32A 3JBG1 4R52A 1K5MA 1UU6A 1JS9A 3G7DA 2ORXA 2QE3A 2ZHNA 1US3A 4XXPA 3WT3A 4D69A 3N9LA 5K8SA 3B00A 1OHFA 2RR11 3QLQA 3PIJA 4WZFA 3VKMA 1HX6A 3CEWA 4FOWA 4CP9A 2WUHA 5AC91 4IL7A 1Z78A 3ZLIA 2BFUS 1CAWB 2G9FA 3FHIB 3NJYA 1GQHA 3A0NA 3VZMA 5A1LA 1VAMA 4XDOA 3DYPA 4YWAA 1UYXA 1U5ZA 1RB8G 2WRAA 5HCHA 3ECQA 4TSVA 2Y60A 4D6SA 1YQ2A 1KFUL 4LK6A 4XW3A 4AHWA 4NVPA 3IT8A 4QD2A 1SLAA 5LEJA 4XACA 1AYN3 4CU7A 4GWJA 3IKWA 2VZRA 4AFDA 1CX4A 1W39A 1AR83 2VW0A 2Q8EA 4B4PA 3MBWA 4DFSA 3MO4A 1GP5A 2XLAA 5KHHA 4YM3A 1JZ5A 3UJQA 2BTVC 2E9QA 4IEXA 2E26A 2EXJA 2RJLA 1P8JA 1GP4A 4L8QA 4XJUA 5BV6A 4MV2A 1RUF1 1TMF1 3MGUA 4GA9A 3R4UA 3I2IA 1NAEA 3LDKA 2XJPA 2A3WA 3ABZA 5EJ3A 4QKBA 1V70A 2DCTA 3I8TA 4PIZA 5CVRA 5FK7A 3N7MA 3VKOA 2FDHA 4W50A 4XCBA 1GICA 1MVEA 3ZYBA 1F5FA 1ODNA 2HH9A 4YRDA 4CCDA 5F2WA 4BA6A 3ACFA 1T2XA 2DWRA 4QPIC 4YG3A 1OQEA 1RUH3 1PX3A 3NW4A 5FBZA 1LENA 1UMIA 3K4DA 4YGEA 5T5PA 5FMCA 3FZ3A 4H14A 3VDDA 2V73A 4QQLA 4YVWA 3HR9A 3MIBA 3AXDA 5DG2A 4AVCA 4AF9A 5DZGA 4DY3A 3AJYA 3IDCB 5HCBA 1BYHA 3J7NA 5IFTA 5J36A 5FMOS 1PO13 3E5QA 1RMU2 4KWLA 4QX0A 2QDRA 5F6KA 3ZR5A 1VB2A 3H8RA 4L9BA 3EJKA 4EZHA 2VTXJ 2FDGA 4R9BA 1YLLA 4MH0E 2DTYA 2ES3A 1SPPB 5F5CA 5FZAA 1DLLA 2VY0A 5IWFA 2P17A 2UYAA 1GFF2 1MS3A 3HN3A 3Q8CA 4E4SA 4P9WA 4B1LA 2LUWA 3AYEA 5GJ6A 3WP4A 4Z82A 4B1MA 3AK0A 5J7MA 3TWIA 4WVWA 1R1A2 3VBRB 4LLFA 4Q4W3 4BQWA 2D43A 4AEDC 2D5HA 3ZYGA 2WKKA 4FBFA 3UJOA 3PVBB 4P14A 4UW5A 1QQP1 1AYM2 2BYVE 3MV11 1NX9A 5FPBA 1XRUA 2J1AA 4LJHA 3LKJA 4ZY9A 4XDPA 1QKQA 2RR13 2Y0IA 3LFMA 5I8TA 2VOWA 1OH3A 2X5IA 2TUNA 5IHRA 5AC93 2FMYA 5DG1A 1UYYA 3U0ZA 2VVDA 3VBUC 3ZSLA 2C1FA 2QFEA 4Q5OA 5HXMA 2Z4FA 2YC4A 1ODMA 5FY5A 3WG4A 4A3XA 5JPNB 1X8EA 4YYOA 5HV4A 4N53C 2D6KA 5JAXA 1BVP1 3LQCA 2VOKA 1V6NA 5LCWL 1SLLA 4NIAA 4BYYA 1JZ8A 3TOJA 3BI3A 1O3SA 5A7NA 3A0KA 3TEZA 1WD4A 3LEGA 4WM8A 4Y24A 1W6PB 3ZM8A 1HRI1 2VZOA 5KC5A 4Q26A 2PHFA 4BQXA 4A6SA 3WD5A 1MEC2 2YB7A 1YO8A 4BQ1A 1Y4WA 1L7LA 4BXFA 1DQ4A 1Y9MA 2HWC3 3TN92 4ISQA 4FPCA 4LEJA 2WZEA 4DUVA 1LESA 1E5HA 4D3WA 4E2QA 1DG6A 4UW3A 1RUF3 4IERA 3I54A 3DKQA 2VCMA 4QXKA 3DGTA 3WW2A 4Q0QA 3ZYRA 4RQPC 1RUI2 1CZTA 4ZS3A 5DAWA 2RS51 1UZVA 5A7SA 1UXZA 4Q4X1 4DXZA 1ND3A 4OMCA 3KGZA 4PHZA 5FZ4A 1RUG2 3M3QA 4EN7B 5A7PA 4CU6A 3GCXA 1MACA 4Q4V2 4GALA 1Z7S3 5F3EA 4COUA 4DB5A 4FOVA 1R64A 1LOEA 4QX8A 1COV2 3WF2A 5KXBA 1QJU1 5FZ0A 1LEMA 3WQ1A 2JICA 1BBT1 4XJ8A 2JX9A 3RZHA 4SBVA 5B4NA 1XYOA 2J22A 1LECA 2XWJB 4MXWA 5FKCA 1PM4A 3N35A 4COYA 2CSGA 3J9SA 5JR7B 3VHRA 3T0DA 1BHGA 1DFQA 1RUD2 3MDPA 3C7EA 4FPFA 1WCQA 4ZU5A 5FZOA 1QHDA 3WVJA 4QPIB 5FO7B 1UF2C 2SBAA 4OYUA 4MGSA 3VUOA 3ILFA 5DUWA 4BLJA 2XPJA 1OUXA 3SEEA 5C9AA 3N4MA 3NJVA 2OS2A 5KHJA 5L7OB 2WFF2 4LR4A 4Y1VA 3IAQA 3D4KA 1G8WA 4FPYA 2Q1ZB 2VC9A 4S2FA 1EV11 1RVF2 2GNBA 4K20A 1LHUA 1WCKA 1TEIA 1D4VB 3ZXKA 4XUNA 2A3YA 4QU2A 4DXTA 2HWE2 3OYWA 3B3QE 3GM8A 4HZFA 1QY4A 4OUMA 5A32B 4XF3A 2KM2A 3OB8A 1GLHA 4N7IA 1IPKA 5FDBA 3I2GA 4AL9A 5KXEA 2JDHA 3TB0A 4ZHNA 4I0WB 4A4AA 4AQ2A 4HXCA 2VCCA 3ST7A 4LHNA 1SLBA 4D7YA 5A6ZA 1S2BA 1SLIA 3D3AA 5KHGA 1OQDA 3BIWE 2QQMA 3SH5A 4YG0A 1W04A 4LO6B 5L19A 1NCQC 2XVKA 3A22A 1D0GA 4GJYA 2R061 4Y3OA 3V64A 3BALA 3ZN4A 5D8AA 4XJWA 4JX0A 3WQ7A 1ZM1A 1OI6A 2P2KA 1XSQA 2EIDA 1XOYA
chains in the Genus database with same CATH topology
3T2PA 1H6XA 2VZSA 4E8CA 1H6YA 5B4XA 2W1QA 5A1AA 2ZEXA 5LA0A 1GOGA 2LS6A 2Y6JA 3ETPA 3NNGA 2W46A 1HN1A 3JXSA 4CUAA 4KMQA 2VMCA 2YG0A 4KWUA 4ET7A 5DN2A 3I3EA 1OF3A 5C71A 3SKJE 2YFUA 4XVHA 3K75B 3MUZ1 2QQJA 1EUUA 4ZZ5A 2CDOA 1K42A 3OG2A 2VZTA 1SHWB 1CZSA 2XHNA 3WQBA 3WNLA 4JKKA 1SG3A 1K45A 3PUHA 4XUPA 2QQIA 1DYOA 3CIHA 4L0PA 5CYYA 3UETA 2E33A 1NUKA 2VZ3A 2VOTA 1OD3A 4QDRA 3T08A 3SEPA 2V72A 1W9TA 3FL7A 2X05A 1WKYA 2ZXQA 2VL4A 3CDZB 2QBXA 2VQTA 4PT6A 3A21A 2VTFA 1JU3A 4BK4A 3K46A 4TTGA 4ARXA 3T0AA 2WO3A 1XC6A 2ZEZA 5C70A 2VZVA 1UMHA 4JKMA 4OMDA 2BERA 3C7HA 2JE8A 4GWIA 1JHJA 1K3IA 2Y8KA 1IQDC 3T0BA 4LKSA 2BZDA 5JUVA 1GMMA 4D8MA 4DEVA 2E31A 1JYWA 1GOHA 1LNSA 3C8XA 1UX7A 3T0DA 2WAOA 2W9XA 3CZUA 2WYSA 2XQXA 1OH4A 1UXXX 3ACGA 1UZ0A 1MPXA 4OZOA 4FI9A 5F7UA 1OT5A 2R7EB 3K4AA 3UESA 4A42A 3HPNA 4CU9A 1W9WA 3WEZA 2J1EA 3VD3A 3EYPA 1UY4A 3HNYM 4CU8A 1DLCA 4JKLA 4M4RA 1GNYA 3SKVA 3W5NA 3A7QA 4HG6B 2QQKA 3HEIA 3CZJA 3I3BA 4BJ0A 2WO2A 3MUY1 3I2JA 2Y6LA 3WNOA 4PF1A 4RN5A 4QX3A 3LE0A 4P08A 5LA2A 2C4XA 4DUXA 1L7RA 3C7OA 4MOAA 1JI6A 2XONA 5IFPA 2ID4A 3IAPA 2J1VA 2PQSA 3GGLA 2HLEA 2WDBA 3NQHA 1SDDB 2W95A 4DXSA 4UI9L 2ORZA 4CUCA 1CZVA 1JZ6A 2B9VA 4LHSA 2JKXA 2QQLA 3IDAA 4BK5A 4QDSA 3THCA 4QB2A 2LW8A 3GXUA 2DCKA 3WF0A 3WNNA 2Y64A 3FN9A 4UAPA 2W5FA 4QX2A 2WQ8A 3CKHA 1KGYA 1O8SA 3VD7A 4D0QA 1W8NA 1NKGA 5DPNA 1L7QA 1J83A 3MV01 3BN6A 3NRUA 2Y6KA 2ZEWA 1PMHX 2VZ1A 3HOBA 1DP0A 4LPLA 2C26A 2ZEYA 1XNTA 4XZUG 5G04L 4UOJA 5EIYB 3I2HA 4XUTA 4CUBA 2VCAA 4XUQA 1ULOA 2VR4A 3IB3A 4W4ZA 4DEQA 4P5YA 3T2QA 3WNKA 3F2ZA 3I97A 3J7HA 1ULPA 1TG7A 2WABA 2WBKA 2W1SA 4IUGA 3C7FA 3I3DA 3T2OA 5DQ0A 1UY1A 3OGSA 1W9SA 4A44A 4W8JA 2VMDA 2Y6GA 5EJ1B 4ZZ8A 4GZ9A 5C7GA 3ACHA 1JU4A 2VM9A 2ORXA 1US3A 1JZ3A 2W1WA 2J1SA 3OGRA 1UY3A 1PX4A 2WO1A 2W87A 1CIYA 2WUHA 5JR2A 3U37A 1I5PA 4QDQA 3DYPA 1UYXA 3UNPA 3ECQA 1EUTA 1YQ2A 2VJXA 2CDPA 2KD7A 3VD4A 3GDBA 3FHQA 4MADA 4PQQA 4CU7A 4GWJA 2VZRA 4QB1A 3MBWA 3MO4A 4BDVB 2W91A 1JZ5A 2E26A 1O8PA 2VQUA 1P8JA 4A45A 3OGVA 1JZ4A 3P6BA 2JD9A 1NAEA 3I2IA 4DUWA 1XPWA 3ABZA 2X09A 1GUIA 4W50A 3WNMA 1W0NA 3T09A 5IYYA 3ACFA 1UY0A 1T2XA 2WAAA 1PX3A 2VZPA 3E1F1 1JYXA 1UMIA 3K4DA 4A3ZA 4DXRA 3CQOA 3PUIA 5FUIA 3DYMA 1JZ7A 2HYXA 5IFTA 4P00B 4QX0A 2RVAA 4QPWA 2W3JA 2Y6HA 4CVUA 2BGOA 5HPOA 3NJXA 4P02B 2VO5A 4RYDA 2J1UA 4JHZA 5JXGA 3IIIA 2QQNA 3VDCA 3HN3A 3LPGA 1W99A 1TVGA 2X10A 3VD5A 4QB6A 3LPFA 2OKXA 4XUOA 1GQPA 3ACIA 3VD9A 2B4KA 3MV11 2VMEA 1NX9A 2VMFA 2J1AA 4YPJA 4ZY9A 3HJRA 1JYVA 3DECA 3VDBA 3W5MA 5IHRA 3OEBA 2E32A 4A6OA 1UYYA 3HNMA 3LEKA 4ARYA 5HXMA 2Z4FA 2YC4A 4Z2AA 4BXSV 2EICA 1F4AA 2DDUA 3LQCA 1JZ8A 2JDAA 5LCWL 1O59A 2L9LA 4OUEA 1UYZA 3WSOA 3LEGA 3ZM8A 2W94A 1UWWA 2VZOA 1D7PM 2EIBA 3I2KA 2J1TA 2YB7A 1GU3A 3WF3A 5JXJA 2VZUA 2V5DA 2WZEA 4DUVA 4M4PA 1JYNA 2DCJA 5JXIA 3I2FA 1KEXA 5EJZB 5G05L 2VCBA 2W92A 3OEAA 3WF1A 5DMYA 2BGPA 1CZTA 3C7GA 1K12A 1UXZA 4OMCA 2J1RA 4CU6A 3WNPA 3P1IA 4KI5M 3OBAA 1UY2A 4MGQA 2EIEA 2C9KA 1R64A 2J7MA 3WF2A 3K77A 5B4NA 1RYYA 4LQRA 2J22A 4XURA 2RV9A 3LEIA 1BHGA 4ZXEA 3BGAA 3C7EA 3FHAA 1J84A 1WCQA 3VDAA 4AG4A 2YC2A 4MO3M 2QQOA 3A23A 3THDA 3AC0A 1XNAA 4TXWA 1GOFA 5CZKA 1CX1A 3HNBM 4OYUA 4MGSA 1JZ2A 5JMOA 3SEEA 2WN2A 3NJVA 3CMGA 3IAQA 2BBAA 3EB7A 2VZQA 2VC9A 2XOMA 3GM8A 1W8OA 3DYOA 2W1UA 4XUNA 1PMJX 4DXTA 2RJ2A 5I0DA 2W47A 2WZ8A 3OB8A 4E8DA 3I2GA 4A41A 2V4VA 4QAWA 3K4ZA 4A4AA 2YFZA 5IJRA 2VCCA 5J1XA 5LA1A 4AAXA 3D3AA 2QQMA 4QX1A 3WF4A 3A22A 1US2A 1F4HA 2WN3A 1OF4A 4JX0A 5JXHA 2EIDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T2P A;  1H6X A;  2VZS A;  4E8C A;  1H6Y A;  5B4X A;  2W1Q A;  5A1A A;  2ZEX A;  5LA0 A;  1GOG A;  2LS6 A;  2Y6J A;  3ETP A;  3NNG A;  2W46 A;  1HN1 A;  3JXS A;  4CUA A;  4KMQ A;  2VMC A;  2YG0 A;  4KWU A;  4ET7 A;  5DN2 A;  3I3E A;  1OF3 A;  5C71 A;  3SKJ E;  2YFU A;  4XVH A;  3K75 B;  3MUZ 1;  2QQJ A;  1EUU A;  4ZZ5 A;  2CDO A;  1K42 A;  3OG2 A;  2VZT A;  1SHW B;  1CZS A;  2XHN A;  3WQB A;  3WNL A;  4JKK A;  1SG3 A;  1K45 A;  3PUH A;  4XUP A;  2QQI A;  1DYO A;  3CIH A;  4L0P A;  5CYY A;  3UET A;  2E33 A;  1NUK A;  2VZ3 A;  2VOT A;  1OD3 A;  4QDR A;  3T08 A;  3SEP A;  2V72 A;  1W9T A;  3FL7 A;  2X05 A;  1WKY A;  2ZXQ A;  2VL4 A;  3CDZ B;  2QBX A;  2VQT A;  4PT6 A;  3A21 A;  2VTF A;  1JU3 A;  4BK4 A;  3K46 A;  4TTG A;  4ARX A;  3T0A A;  2WO3 A;  1XC6 A;  2ZEZ A;  5C70 A;  2VZV A;  1UMH A;  4JKM A;  4OMD A;  2BER A;  3C7H A;  2JE8 A;  4GWI A;  1JHJ A;  1K3I A;  2Y8K A;  1IQD C;  3T0B A;  4LKS A;  2BZD A;  5JUV A;  1GMM A;  4D8M A;  4DEV A;  2E31 A;  1JYW A;  1GOH A;  1LNS A;  3C8X A;  1UX7 A;  3T0D A;  2WAO A;  2W9X A;  3CZU A;  2WYS A;  2XQX A;  1OH4 A;  1UXX X;  3ACG A;  1UZ0 A;  1MPX A;  4OZO A;  4FI9 A;  5F7U A;  1OT5 A;  2R7E B;  3K4A A;  3UES A;  4A42 A;  3HPN A;  4CU9 A;  1W9W A;  3WEZ A;  2J1E A;  3VD3 A;  3EYP A;  1UY4 A;  3HNY M;  4CU8 A;  1DLC A;  4JKL A;  4M4R A;  1GNY A;  3SKV A;  3W5N A;  3A7Q A;  4HG6 B;  2QQK A;  3HEI A;  3CZJ A;  3I3B A;  4BJ0 A;  2WO2 A;  3MUY 1;  3I2J A;  2Y6L A;  3WNO A;  4PF1 A;  4RN5 A;  4QX3 A;  3LE0 A;  4P08 A;  5LA2 A;  2C4X A;  4DUX A;  1L7R A;  3C7O A;  4MOA A;  1JI6 A;  2XON A;  5IFP A;  2ID4 A;  3IAP A;  2J1V A;  2PQS A;  3GGL A;  2HLE A;  2WDB A;  3NQH A;  1SDD B;  2W95 A;  4DXS A;  4UI9 L;  2ORZ A;  4CUC A;  1CZV A;  1JZ6 A;  2B9V A;  4LHS A;  2JKX A;  2QQL A;  3IDA A;  4BK5 A;  4QDS A;  3THC A;  4QB2 A;  2LW8 A;  3GXU A;  2DCK A;  3WF0 A;  3WNN A;  2Y64 A;  3FN9 A;  4UAP A;  2W5F A;  4QX2 A;  2WQ8 A;  3CKH A;  1KGY A;  1O8S A;  3VD7 A;  4D0Q A;  1W8N A;  1NKG A;  5DPN A;  1L7Q A;  1J83 A;  3MV0 1;  3BN6 A;  3NRU A;  2Y6K A;  2ZEW A;  1PMH X;  2VZ1 A;  3HOB A;  1DP0 A;  4LPL A;  2C26 A;  2ZEY A;  1XNT A;  4XZU G;  5G04 L;  4UOJ A;  5EIY B;  3I2H A;  4XUT A;  4CUB A;  2VCA A;  4XUQ A;  1ULO A;  2VR4 A;  3IB3 A;  4W4Z A;  4DEQ A;  4P5Y A;  3T2Q A;  3WNK A;  3F2Z A;  3I97 A;  3J7H A;  1ULP A;  1TG7 A;  2WAB A;  2WBK A;  2W1S A;  4IUG A;  3C7F A;  3I3D A;  3T2O A;  5DQ0 A;  1UY1 A;  3OGS A;  1W9S A;  4A44 A;  4W8J A;  2VMD A;  2Y6G A;  5EJ1 B;  4ZZ8 A;  4GZ9 A;  5C7G A;  3ACH A;  1JU4 A;  2VM9 A;  2ORX A;  1US3 A;  1JZ3 A;  2W1W A;  2J1S A;  3OGR A;  1UY3 A;  1PX4 A;  2WO1 A;  2W87 A;  1CIY A;  2WUH A;  5JR2 A;  3U37 A;  1I5P A;  4QDQ A;  3DYP A;  1UYX A;  3UNP A;  3ECQ A;  1EUT A;  1YQ2 A;  2VJX A;  2CDP A;  2KD7 A;  3VD4 A;  3GDB A;  3FHQ A;  4MAD A;  4PQQ A;  4CU7 A;  4GWJ A;  2VZR A;  4QB1 A;  3MBW A;  3MO4 A;  4BDV B;  2W91 A;  1JZ5 A;  2E26 A;  1O8P A;  2VQU A;  1P8J A;  4A45 A;  3OGV A;  1JZ4 A;  3P6B A;  2JD9 A;  1NAE A;  3I2I A;  4DUW A;  1XPW A;  3ABZ A;  2X09 A;  1GUI A;  4W50 A;  3WNM A;  1W0N A;  3T09 A;  5IYY A;  3ACF A;  1UY0 A;  1T2X A;  2WAA A;  1PX3 A;  2VZP A;  3E1F 1;  1JYX A;  1UMI A;  3K4D A;  4A3Z A;  4DXR A;  3CQO A;  3PUI A;  5FUI A;  3DYM A;  1JZ7 A;  2HYX A;  5IFT A;  4P00 B;  4QX0 A;  2RVA A;  4QPW A;  2W3J A;  2Y6H A;  4CVU A;  2BGO A;  5HPO A;  3NJX A;  4P02 B;  2VO5 A;  4RYD A;  2J1U A;  4JHZ A;  5JXG A;  3III A;  2QQN A;  3VDC A;  3HN3 A;  3LPG A;  1W99 A;  1TVG A;  2X10 A;  3VD5 A;  4QB6 A;  3LPF A;  2OKX A;  4XUO A;  1GQP A;  3ACI A;  3VD9 A;  2B4K A;  3MV1 1;  2VME A;  1NX9 A;  2VMF A;  2J1A A;  4YPJ A;  4ZY9 A;  3HJR A;  1JYV A;  3DEC A;  3VDB A;  3W5M A;  5IHR A;  3OEB A;  2E32 A;  4A6O A;  1UYY A;  3HNM A;  3LEK A;  4ARY A;  5HXM A;  2Z4F A;  2YC4 A;  4Z2A A;  4BXS V;  2EIC A;  1F4A A;  2DDU A;  3LQC A;  1JZ8 A;  2JDA A;  5LCW L;  1O59 A;  2L9L A;  4OUE A;  1UYZ A;  3WSO A;  3LEG A;  3ZM8 A;  2W94 A;  1UWW A;  2VZO A;  1D7P M;  2EIB A;  3I2K A;  2J1T A;  2YB7 A;  1GU3 A;  3WF3 A;  5JXJ A;  2VZU A;  2V5D A;  2WZE A;  4DUV A;  4M4P A;  1JYN A;  2DCJ A;  5JXI A;  3I2F A;  1KEX A;  5EJZ B;  5G05 L;  2VCB A;  2W92 A;  3OEA A;  3WF1 A;  5DMY A;  2BGP A;  1CZT A;  3C7G A;  1K12 A;  1UXZ A;  4OMC A;  2J1R A;  4CU6 A;  3WNP A;  3P1I A;  4KI5 M;  3OBA A;  1UY2 A;  4MGQ A;  2EIE A;  2C9K A;  1R64 A;  2J7M A;  3WF2 A;  3K77 A;  5B4N A;  1RYY A;  4LQR A;  2J22 A;  4XUR A;  2RV9 A;  3LEI A;  1BHG A;  4ZXE A;  3BGA A;  3C7E A;  3FHA A;  1J84 A;  1WCQ A;  3VDA A;  4AG4 A;  2YC2 A;  4MO3 M;  2QQO A;  3A23 A;  3THD A;  3AC0 A;  1XNA A;  4TXW A;  1GOF A;  5CZK A;  1CX1 A;  3HNB M;  4OYU A;  4MGS A;  1JZ2 A;  5JMO A;  3SEE A;  2WN2 A;  3NJV A;  3CMG A;  3IAQ A;  2BBA A;  3EB7 A;  2VZQ A;  2VC9 A;  2XOM A;  3GM8 A;  1W8O A;  3DYO A;  2W1U A;  4XUN A;  1PMJ X;  4DXT A;  2RJ2 A;  5I0D A;  2W47 A;  2WZ8 A;  3OB8 A;  4E8D A;  3I2G A;  4A41 A;  2V4V A;  4QAW A;  3K4Z A;  4A4A A;  2YFZ A;  5IJR A;  2VCC A;  5J1X A;  5LA1 A;  4AAX A;  3D3A A;  2QQM A;  4QX1 A;  3WF4 A;  3A22 A;  1US2 A;  1F4H A;  2WN3 A;  1OF4 A;  4JX0 A;  5JXH A;  2EID A; 
#chains in the Genus database with same CATH topology
 3T2P A;  4I0B A;  1VP6 A;  2KXL A;  2W1Q A;  5T5J A;  2ZTN A;  1RUN A;  5LWB A;  3ON7 A;  1KIT A;  4GH4 B;  1WZX A;  2VUD A;  1VB4 A;  2W46 A;  4Y1Y A;  4CUA A;  4KMQ A;  2VG9 A;  3O0V A;  4L92 A;  4E9K A;  2OZJ A;  2RM2 2;  4Q4Y 2;  3S5A A;  1N1Y A;  1FI2 A;  1WW4 A;  3I3E A;  4W65 A;  1OF3 A;  3VBU B;  3WDX A;  5C71 A;  1GBG A;  4JGZ A;  1YJL A;  2YFU A;  4M3C B;  1HRV 2;  4LBK A;  1HW5 A;  1ND2 C;  5CAZ A;  1DGR N;  3MUZ 1;  2QQJ A;  3ZX7 A;  4QM8 A;  1J1T A;  5A33 B;  1UL9 A;  1DQ1 A;  1EUU A;  3ZXJ A;  1NQD A;  3NAP C;  2RS5 3;  4HSL A;  5A3N A;  1MZF A;  4Q4X 3;  4OQ9 A;  2R0F A;  1PK6 C;  5F37 A;  3OG2 A;  3VV1 A;  2VZT A;  4F7Z A;  1OLR A;  4JDO A;  2YU2 A;  1CZS A;  2ARB A;  2NPI A;  2XHN A;  3WQB A;  2CGN A;  3B94 A;  2WNO A;  5LK5 A;  4LNV A;  3AP6 A;  1QOT A;  4XUP A;  4MG2 A;  4L0P A;  3UET A;  2E33 A;  1NUK A;  3O14 A;  1LOG A;  2XL7 A;  2HKX A;  4CDQ B;  1BBT 3;  2V72 A;  2OZ6 A;  3GCW A;  4QHB A;  3FL7 A;  1OOP A;  5DUU A;  2UUR A;  2HWF 1;  2O14 A;  2ZXQ A;  3CDZ B;  3H9A A;  2B46 X;  2VQT A;  4UFI A;  1BK1 A;  4RQP B;  1BCX A;  1VBA 2;  1T6B X;  3J8F 2;  3A21 A;  4HN1 A;  4AED A;  5JPM B;  3RS6 A;  2JG9 C;  4PDW B;  4CCM A;  2CWS A;  3TNQ A;  4NR1 A;  4ARX A;  5JZG B;  1HQW A;  1SFP A;  3DPR C;  1PVX A;  3O12 A;  4FPH A;  3DXT A;  1OVP A;  2ZX4 A;  3JD7 1;  4HN0 A;  3T0A A;  4PF5 A;  3KCX A;  1AL2 3;  5LW9 A;  4XIK A;  1V6I A;  1HDK A;  1WME A;  3LIH A;  5L9V A;  2E6V A;  3GHM A;  4JKM A;  4FO9 A;  3VBO C;  4BH9 A;  3C7H A;  5ABJ C;  2V4A A;  3JCI A;  4YGC A;  4AI9 A;  4OCT A;  4PJY A;  3HAG A;  4JTO A;  3ZFF C;  1M06 G;  1X82 A;  1EV1 3;  2P3I A;  3H1M A;  1HB4 A;  4LKS A;  4N53 A;  4AZZ A;  3AYA A;  3NJZ A;  2D6O X;  1OLM E;  1GMM A;  1S0J A;  3RVH A;  5EHD A;  4AI8 A;  4AFA A;  4R9D A;  4Q0P A;  4QXB A;  4ZS2 A;  1JYW A;  4ITC A;  1AZD A;  3C8X A;  1POQ A;  1DGR A;  1JUI A;  2WAO A;  5SV5 A;  2YV8 A;  1A8M A;  1Q8V A;  3P5B A;  5FPL A;  4HT1 T;  5CB7 A;  3AMM A;  4CEW B;  5LAT A;  5L9B A;  1T6G C;  1O3R A;  1UOB A;  3VBS C;  3DUI A;  1Q8Q A;  2VH9 A;  1IKP A;  2WT0 A;  1O4T A;  2DU0 A;  3SH3 A;  4XTM A;  1AR6 1;  1HV0 A;  1OT5 A;  1W8H A;  1YCI A;  2R06 3;  3OUH A;  4XBQ A;  2XBO 2;  3APB A;  3MFA A;  1X36 A;  4OHV A;  2R04 3;  1VLN A;  3WEZ A;  5APA A;  1VBB 2;  4FAH A;  5A3T A;  2DU1 A;  1RHI 2;  2YY1 A;  2WR9 A;  4FOY A;  3WDT A;  3WQ0 A;  3TYJ A;  5A3L A;  4O7X A;  3HNY M;  1UOF A;  3ZYF A;  3ZN6 B;  4LIV A;  1RIR A;  4BLI A;  4AVS A;  2HWD 2;  5EWS A;  5FZD A;  3KZ4 C;  5E6H A;  4I09 A;  4OHW A;  2SLI A;  2VNO A;  3SKV A;  3WDU A;  3TEX A;  3VL9 A;  4HSJ A;  3ZIW A;  5DZE A;  3HEI A;  3JQW A;  3CZJ A;  2ZML A;  1HB2 A;  1HV1 A;  5A3O A;  4HBN A;  1NCQ B;  4FFI A;  3AMH A;  3CU7 A;  4FOQ A;  1SBD A;  2UWC A;  4RS5 C;  3PJQ A;  3LE0 A;  2HBU A;  5H9S A;  5IVF A;  4IGQ A;  2BWA A;  1L7R A;  3T4V A;  4IGP A;  2WJS A;  3AP5 A;  3VHP A;  2Q1M A;  3RRD A;  4YAR A;  3IAP A;  4URT A;  4B29 A;  3R05 A;  5CG9 A;  1W8Z A;  3E6C C;  4JVA A;  3PJY A;  1GSL A;  4LIT A;  2HWF 3;  4QQO A;  1UU4 A;  2XUE A;  1QEX A;  1ND2 B;  4FTS A;  5JOW A;  4UW4 A;  4WM7 C;  1NT0 A;  2B9V A;  2R30 A;  4LHS A;  1LR5 A;  1QXJ A;  3LOI A;  4RA0 A;  4Z1V A;  4LO4 B;  3WY6 A;  1AJK A;  4U2A A;  1SLT A;  4OZX A;  1F9K A;  2UY9 A;  1I5Z A;  4E4H A;  3CBN A;  1ENQ A;  5C6C A;  1NG0 A;  1R1A 1;  1XNC A;  3JD7 3;  1WLD A;  2DVB A;  3FN9 A;  1UX6 A;  3ME2 A;  4LK7 A;  1QMJ A;  2WQ8 A;  3KV6 A;  2P4E A;  3CKH A;  1KGY A;  2GH8 A;  4O65 A;  2RDQ A;  4D0Q A;  4WVM B;  2OQ7 A;  5FZI A;  1UOG A;  3ZFG A;  5LK7 B;  4M3C E;  1AYM 1;  4N43 B;  1L7Q A;  3POW A;  5CBL A;  3G6J B;  1XE7 A;  1F15 A;  1IHM A;  2D3R A;  3BOD A;  2Q4S A;  5E1R A;  2ZGL A;  5A3P A;  4DS0 A;  2IXL A;  2CL2 A;  3GBF A;  1WLW A;  2ZEW A;  3MIC A;  4B3N A;  4P9Y A;  2P6H A;  2JG9 B;  4BIO A;  3FBM A;  4EV0 A;  4NRQ A;  4AFB A;  1URX A;  1IG0 A;  1ULF A;  3DPR B;  3N7J A;  4I02 A;  1AX2 A;  1DP0 A;  3HOB A;  3IMM A;  3Q8F A;  1AX0 A;  1OUS A;  4IET A;  4ONU A;  4XZU G;  1XU1 A;  2QVS B;  1S0F A;  4H7M A;  1W8F A;  4UOJ A;  5GLT A;  3OD4 A;  2OPK A;  3AXE A;  5FZG A;  3I2H A;  2VCA A;  1RUE 2;  1QH7 A;  4HON A;  1ULO A;  5FR3 A;  4A2U A;  5ABJ B;  3CNA A;  1S4C A;  1QJY 2;  3IBM A;  1H8T C;  2AEZ A;  2EXH A;  3JZV A;  4HVO A;  1KDM A;  3T2Q A;  1LGB A;  3L2H A;  1N3O A;  2BWC A;  1MEC 1;  3AVS A;  4BE3 A;  2DUQ A;  1ULP A;  4C90 A;  3LGR A;  1W2U A;  3NAP A;  3N9M A;  4NII A;  1AL0 G;  4R8H A;  1DU3 D;  4OI1 A;  2CYF A;  3TN9 1;  2PTM A;  3I3D A;  1NA1 A;  1PK6 A;  2BDR A;  3OGG A;  2VQ0 A;  3QCW A;  4YZ3 A;  5DQ0 A;  5KHI A;  1UY1 A;  3OY8 A;  2AR6 A;  2BRT A;  2ZOE B;  3CJI C;  2RHP A;  2P3J A;  3PTR B;  4PCR A;  1QXP A;  4NWW A;  2E7T A;  2Y6G A;  4JAA A;  4MHU A;  3AMP A;  1RUI 1;  2VOX A;  5EJ1 B;  3RPQ A;  3VBS B;  2VQA A;  4NPM A;  5C7G A;  5A7Q A;  1W0P A;  1BK0 A;  3AVR A;  2WQZ C;  4I3P A;  4D6R A;  3RGB A;  1DBN A;  2W0X A;  2J1S A;  5FAX A;  2C9A A;  1OUR A;  3OGR A;  4Q4V 1;  1LB2 A;  1PGL 2;  1PO2 2;  4OUL A;  3ZFE B;  3QAC A;  2HWB 2;  2WII B;  3NL1 A;  2OVU A;  2JDM A;  3POS A;  5FZ3 A;  3DN7 A;  4XF9 A;  2VMI A;  1UCX A;  5FQ0 B;  3WNX A;  1UIJ A;  1YI9 A;  1LU2 A;  4XIO A;  2WNU A;  1H4G A;  3ES1 A;  3FE5 A;  5BNQ A;  5GZE A;  1RMU 3;  2JG8 B;  1H9W A;  2UY8 A;  4IW3 A;  4XQD A;  1BEV 3;  3VZK A;  1EUT A;  4I0A A;  3HQU A;  2VJX A;  2KD7 A;  3OUJ A;  3SXW A;  3GDB A;  3FHQ A;  3VBO A;  2Q5T A;  2NMN A;  1JOB A;  1XE8 A;  3POB A;  4Q0S A;  3T3Y A;  1RXG A;  1V6J A;  3ZFF A;  2OYZ A;  3ZPO A;  2IC1 A;  2WYF A;  4QB1 A;  2RE9 A;  5A70 A;  4Y33 A;  3I3Q A;  4RS5 B;  4QQ2 A;  3M70 A;  2NLR A;  5LRS A;  4OI0 A;  2B7Y A;  3AL6 A;  5BNP A;  1O8P A;  2VQU A;  1CAX B;  3RQ0 A;  4A45 A;  1Q5O A;  1R1A 3;  2CTV A;  1OLQ A;  1WW6 A;  3I59 B;  4LOS A;  2JD9 A;  1WD3 A;  3ILR A;  2A1X A;  4GIQ A;  1XPW A;  2DF7 A;  2Z5W A;  4K7J A;  4KGQ A;  4Q0U A;  5DZF A;  3NKT A;  4CPB A;  3GZE A;  3H3Z A;  3J26 N;  3I2O A;  3WNM A;  1AYM 3;  2A6W A;  1J59 A;  3T09 A;  2P34 A;  5FZM A;  2YPD A;  4S2H A;  2HWE 1;  1CQ9 A;  4V2W A;  1ULD A;  5T52 A;  4MSV A;  1HKD A;  1V6L A;  4NJ4 A;  5BUV A;  2ZHK A;  4WM7 B;  1QXR A;  5F9T A;  3IN9 A;  3VB9 A;  4A3Z A;  2GC1 A;  3PDQ A;  3VL8 A;  3GJB A;  4GB3 2;  1SCR A;  1YQ8 A;  2VMH A;  4DXR A;  2ZGO A;  4FSJ A;  1CON A;  2VNG A;  5FZ7 A;  4NE9 A;  4N9H A;  2JE7 A;  3DYM A;  3JU9 A;  1WW5 A;  1NXM A;  3KQR A;  2HYX A;  4OHY A;  1DQ6 A;  1AYN 1;  3LD8 A;  3IM0 A;  2XJR A;  3HMY A;  3VZJ A;  4EE2 A;  3ZO0 B;  3FUQ A;  1IS4 A;  5SV8 A;  2Y6H A;  1NZI A;  4XMI A;  2ZGS A;  3H42 B;  5F3G A;  2VO5 A;  1TME 2;  5FYS A;  4CP1 A;  4LBQ A;  4RFR B;  5JSP A;  3H3U A;  1FOD 2;  2J1U A;  4JHZ A;  3III A;  3MLK A;  1MEC 3;  5JIA A;  3INA A;  5BNO A;  3VDC A;  1DGL A;  3TN9 3;  3GYD A;  1W99 A;  2RM2 1;  3KS7 A;  4Q4Y 1;  1H8V A;  2HEY F;  3BB6 A;  2X10 A;  4IQP A;  5I0R A;  3IPV B;  1DIW A;  4XAB A;  3RYP A;  4BHP A;  3VLB B;  2Q30 A;  1HRV 1;  3VD5 A;  2O8O A;  2CAU A;  3NV2 A;  1RUH 1;  1ST8 A;  1W6M B;  2K2S A;  2VUA A;  1RUI 3;  3M3C A;  2OKX A;  2QCS B;  2XQR A;  3W21 A;  4BME A;  2IFW A;  5ACA 1;  3N9N A;  3FBY A;  4XUO A;  4AVT A;  2ZS6 B;  3ACI A;  3VD9 A;  4AYU A;  3H8O A;  4GWM A;  1NYW A;  1RUG 3;  2DUO A;  1GAN A;  4Y22 A;  4BZ4 A;  4YPJ A;  1H8T B;  3POJ A;  1O91 A;  3HJR A;  4Q4V 3;  3THP A;  3JB8 A;  3W5M A;  3MW4 A;  3ZMN A;  1EAH 2;  1PO1 1;  4B4R A;  2VMG A;  1UKG A;  3HNM A;  3LEK A;  1SLC A;  2AEY A;  3AZY A;  3EQE A;  4H2A A;  1COV 3;  3ZKU A;  4BQ3 A;  4Z2A A;  5AFB A;  3USU A;  3U10 A;  3NNL A;  3E6B A;  4AWD A;  3B9I A;  4HPK A;  2JDA A;  1O59 A;  1VBA 1;  3OBR A;  1RUD 3;  2BEO A;  3H0O A;  1TNR A;  2W68 A;  5FPU A;  1CVN A;  3ZPY A;  3UKV A;  4IGO A;  2W94 A;  1KS5 A;  3KV9 A;  1ASJ 2;  5AVA A;  5FTT C;  1C8M 2;  2FZ1 A;  2DYC A;  3B01 A;  4KBZ A;  3I2K A;  2CHH A;  4FPO B;  5JXJ A;  4Y4R A;  1YQC A;  4ASK A;  1VMH A;  2DFB A;  3CLP A;  2BOI A;  2VNV A;  1LOF A;  3KT7 A;  4YW4 A;  4AHY A;  5BNN C;  4DIN B;  2TEP A;  2QZ2 A;  1W3V A;  2WFF 3;  2XML A;  3AMN A;  3RJR A;  5JXI A;  4LOR A;  5EJZ B;  4X8N A;  2VCB A;  2ERF A;  3HBK A;  1TQ5 A;  3WF1 A;  1MQT A;  1RVF 3;  3A4U A;  5DMY A;  2DV9 A;  2JWP A;  4XET A;  3AZX A;  5CA6 A;  1XJA A;  2R07 2;  5C5T A;  1FV2 A;  2JE9 A;  3SH4 A;  2HWE 3;  1N3P A;  1PZ9 A;  2E53 A;  1H1A A;  4GD4 A;  4YVS C;  5BY5 A;  1LUL A;  5A1F A;  3LA3 A;  4BIF A;  4N8M A;  4RFT 0;  4XAE A;  5FCC A;  3AP9 A;  4NHK A;  4W6X A;  3LB9 A;  4AEM A;  2ZA9 A;  5T5L A;  1W2A X;  1TNF A;  3KHB A;  4J25 A;  2BVV A;  1YYN A;  4Q8K A;  4D6Q A;  5J3U A;  3FFQ A;  4HL0 A;  3CJI A;  2RV9 A;  4OI4 A;  1QNW A;  1SBE A;  1QOO A;  4ZXE A;  1HB3 A;  3PMS A;  3BGA A;  3FHA A;  2HWC 1;  1J84 A;  4YM0 A;  3VDA A;  2I07 B;  2JEC A;  1UD1 A;  3WXP A;  4MO3 M;  4EZ4 A;  1RHI 1;  2Z79 A;  2OUH A;  2PXJ A;  3IDB B;  3THD A;  1ZZB A;  2WIN B;  4TXW A;  2R1B A;  2ZGT A;  5FFO C;  2ZGN A;  3HNB M;  5F2S A;  1GQG A;  1JUH A;  1UZY A;  3RG0 A;  2HWD 1;  5CFD A;  3U14 A;  1PGW 2;  5A6X A;  2XR4 A;  4NHM A;  5FZ6 A;  1O3Q A;  2RM2 3;  4Q4Y 3;  4QPG A;  5FZ1 A;  1CAV A;  2E51 A;  3VHN A;  5F8P A;  1IS3 A;  1O7F A;  2WN2 A;  1UPI A;  2WZP P;  3ZYI B;  3V0B B;  3AFK A;  5DAV A;  1G9D A;  1HRV 3;  5DUV A;  5ACA 3;  4CA9 A;  1MS0 A;  1Q8P A;  1Z7S 1;  1QF3 A;  2EAA A;  2JDP A;  1W8O A;  2VXR A;  1GV9 A;  2B5H A;  3NMB A;  3DYO A;  5B2G B;  4SLI A;  2W1U A;  1FAY A;  4FFH A;  5K7P A;  1PVC 2;  4JGY B;  5D1I A;  5T55 A;  3AL5 A;  5L7O C;  1AVB A;  2WZ8 A;  3PLQ A;  1CAW A;  2VU9 A;  3EMR A;  4K9S A;  5E16 A;  2JDU A;  3WX5 A;  3KT1 A;  1BEV 2;  1YXW A;  1JYC A;  4QU1 A;  2XH6 A;  3ROU A;  5JIU A;  3USS A;  4G3Y C;  5T54 A;  1FNY A;  1JMU B;  2AYH A;  1OKO A;  1R08 2;  3WF4 A;  2D40 A;  3SCH A;  3KQ4 B;  2OII A;  3AZW A;  4G9S B;  2IXK A;  2WN3 A;  1VBA 3;  3CHX A;  4NRO A;  3J8F 3;  5C8W A;  2X29 A;  4LUL A;  1UMZ A;  1PNG A;  4K8R B;  5GLZ A;  3PUA A;  1H6X A;  1Y9Q A;  4C0B A;  1H6Y A;  1XNK A;  4NHX A;  2AUY A;  1GOG A;  2R32 A;  3PL0 A;  3D8C A;  4S2D A;  4YFW A;  3JXS A;  4ET7 A;  2VMC A;  2YG0 A;  4XMA A;  1H1M A;  5DN2 A;  3NO8 A;  3T30 A;  4HFS A;  4UYB A;  3WHU A;  4AFC A;  5KHK A;  3B9C A;  4LIU A;  2FZ2 A;  2ETE A;  4LA3 A;  4MX3 A;  4YGD A;  4AEJ A;  4GH4 C;  3GZA A;  4FXG B;  3T4H B;  3MF6 A;  2CDO A;  2V09 A;  2ZAA A;  1RUJ 2;  3NKG A;  2F17 A;  2PHX A;  1QNY A;  3I2D A;  3VZN A;  1ULC A;  3O1P A;  2CWM A;  1VBD 2;  5DUX A;  1SEF A;  2VBD A;  2YGL A;  4N9I A;  1AR9 2;  1NCR C;  3AKT A;  3LSD A;  1RED A;  2PFW A;  4LBM A;  1B35 C;  3M8L A;  4ES9 A;  2UWB A;  1DGW A;  3ILN A;  1W8U A;  1VPH A;  1SG3 A;  2DVG A;  4MHR A;  3PUH A;  4ES8 A;  2XJQ A;  5CYY A;  3WP5 A;  4DZG A;  1RUE 1;  2OW4 A;  5BNN B;  4QDR A;  1PZ7 A;  4IDZ A;  4BQ4 A;  1QJY 1;  1RTV A;  2VL4 A;  2XBO 3;  4PLO A;  2WT2 A;  4PT6 A;  1SPP A;  1WCD J;  1Z0H A;  2VTF A;  2RG4 A;  3KVA A;  3OJB A;  2Y34 A;  4UFM A;  1VBB 3;  3LIG A;  4XYX A;  4YW1 A;  1RHI 3;  4FCA A;  4EN0 A;  1RGS A;  2D6L X;  3HWJ A;  4Y5T A;  1RIT A;  3ZSM A;  4CDQ C;  3O1M A;  2R0H A;  4YVS B;  3DL3 A;  4AOC A;  4ZON A;  3AB0 A;  1F35 A;  2HWD 3;  1WUV A;  1N1S A;  4LKD A;  3SNM A;  3VBR A;  4WVZ A;  4MET A;  4FP2 A;  1F8V A;  4S2G A;  1QJE A;  4NO4 A;  5LBE A;  3RI9 A;  3VZO A;  4DO0 A;  1POV 0;  2PLV 2;  2BER A;  1Y3T A;  2RS1 3;  3WP6 A;  1CJP A;  4PDW C;  3GAL A;  2WO7 A;  1OPO A;  4N7U A;  3S30 A;  3SHR A;  5JZG C;  3RZG A;  2D44 A;  3M4F A;  3LF7 A;  2Y8K A;  3WG1 A;  3ES4 A;  5A7W B;  1IQD C;  4LHK A;  3AM2 A;  2XJU A;  5CKM A;  5FV3 A;  5J98 B;  1SBF A;  4Y1U A;  1LHV A;  3LAG A;  1PGL 1;  1I1E A;  3AZZ A;  4GKY A;  2ZMK A;  2HWB 1;  3LDB A;  2JD4 A;  2E31 A;  3OPT A;  1GOH A;  4BOW A;  1LNS A;  5FOB B;  4CSW A;  4P9G A;  4CCN A;  1A3K A;  3PUQ A;  4HAN A;  1UXX X;  1XBF A;  3ACG A;  3BYW A;  4J1X A;  2FHR A;  2ZGU A;  4OUS A;  4OZO A;  4YW2 A;  4FI9 A;  4KG0 A;  4CCL A;  4BCU A;  1FYU A;  3OSD A;  1W6P A;  2G1M A;  1FPN 2;  4JQT A;  3UV9 A;  4ORF A;  5FY8 A;  4CEW C;  5GLW A;  1AL2 1;  4I01 A;  5TSW A;  2LRP A;  2WZR 3;  4FTE A;  3MW2 A;  2RDR A;  3EO6 A;  4CRQ A;  4AE2 A;  1ZRE A;  1DLC A;  5HBA A;  4JKL A;  1H2N A;  4UFL A;  4LBJ A;  4CYD A;  4IEV A;  5CG8 A;  1XQN A;  1GNY A;  4C91 A;  1FXZ A;  4AI1 A;  3A7Q A;  1HXS 2;  4HG6 B;  4L11 A;  4LO7 A;  2VXJ A;  3LZZ A;  3B02 A;  1IOA A;  1QGL A;  2TBV A;  1W2O A;  2FDK A;  3BTX A;  1OLM A;  3I3B A;  1OA3 A;  2WO2 A;  1D4M 2;  3MUY 1;  1W05 A;  3I2J A;  3HN1 A;  5EV7 A;  2W52 A;  2DFC A;  4PF1 A;  5FXX A;  2HBT A;  3O0W A;  5GAL A;  2R49 A;  4GB3 1;  4W6Y A;  4P08 A;  5LA2 A;  2P1B A;  4TLG A;  5FP7 A;  3HD8 B;  4HK8 A;  4LHL A;  4MOA A;  4NPL A;  4B8E A;  2H6C A;  3RSJ A;  1BQP A;  3V0A B;  2ID4 A;  2Q0A A;  2J1V A;  2IXJ A;  4GWN A;  4LKE A;  1U0A A;  2ZKN A;  3UKT A;  3PVN A;  5A3M A;  1RUE 3;  5IAT A;  1AR7 2;  1CR7 A;  2HLE A;  3NQH A;  2GMP A;  5CFC B;  5FK8 A;  3QH7 A;  4UFJ A;  1QJY 3;  4DXS A;  2ORZ A;  1MS1 A;  1TME 1;  2EAK A;  5F6L B;  3ZMO A;  4AGV A;  4AHZ A;  4QPI A;  1ENR A;  1X9T A;  1FOD 1;  2JKB A;  5CNA A;  2UYB A;  1VAL A;  1YI7 A;  3C2U A;  1GZ9 A;  1WGP A;  2QQL A;  4FVV A;  2ZX1 A;  3S7I A;  3IIA A;  4QDS A;  4QB2 A;  4NID A;  2IVI B;  4TYS A;  1NCR B;  2JXA A;  3WNN A;  5J37 A;  2TNF A;  1B35 B;  5L7O A;  1ZZ6 A;  4UAP A;  5H9Q A;  2VUL A;  4QX2 A;  2WFP A;  1PIV 2;  3HBZ A;  3NWK A;  4KWK A;  1X8M A;  4ZPI A;  1NKG A;  5DPN A;  1VAV A;  2A73 B;  1G86 A;  2F6B A;  1LHN A;  2WNV B;  3RWN A;  1STM A;  1VBC 2;  3MFC A;  3BN6 A;  3NRU A;  4I3G A;  4R4Z A;  2C5D A;  5A32 A;  4TLF A;  1UKR A;  1PO2 3;  1EAH 1;  4CE8 A;  2HWB 3;  1PMH X;  2JIG A;  2DTW A;  2GC3 A;  2VZ1 A;  4COZ A;  3AP4 A;  1YIF A;  4N43 C;  2XB6 C;  1EPW A;  5FPA A;  1W6N B;  2YC0 A;  1ZZ8 A;  4QQP A;  1BZW A;  2C26 A;  1XNT A;  4H3W A;  2G9G A;  5FMB A;  2LRO A;  4EWE A;  2RDS A;  4V2V A;  3VBH C;  2B9U A;  3BIE A;  4XFG A;  1QJZ A;  4XUQ A;  1E5R A;  1UU5 A;  3RFR A;  2FDF A;  1RUO A;  2A5Z A;  5C4W C;  4PBP A;  5KC6 A;  3SCG A;  3WCS A;  4EN9 B;  5DAB A;  4UW6 A;  2R6Q A;  1ASJ 1;  2WWU A;  3AMQ A;  3I97 A;  5CFC C;  5GZF A;  3E5X A;  3MW3 A;  4QKF A;  2B8M A;  2PHW A;  1IPS A;  2YU1 A;  3I7D A;  5G04 L;  4GH4 A;  5C3S A;  1BKZ A;  2ZHL A;  1WA4 A;  4B7K A;  4X8P A;  3C7F A;  4LUK A;  3AJZ A;  4JRA A;  3I3M A;  3VBU A;  3KVB A;  3ZR6 A;  3OGS A;  3BTA A;  4XFH A;  1SZB A;  2DBI A;  3J4U H;  3VKL A;  3TAY A;  4M3C A;  4M0N A;  3RDI A;  2YUE A;  5FY0 A;  4GUL A;  2ZPX A;  5A33 A;  5DDJ 2;  4AHX A;  1XYP A;  3D0J A;  3ACH A;  5C3P A;  1DDL A;  1JU4 A;  2R07 1;  2VM9 A;  4PI2 A;  3V65 A;  5DAQ A;  4UFK A;  4HKW A;  1JZ3 A;  2W1W A;  2GN7 A;  4Q1P A;  3ZXD A;  2JEM A;  3PUR A;  1FT9 A;  1UY3 A;  2JDZ A;  2QQV A;  3JBG 2;  4GB3 3;  4FPG A;  1IS5 A;  1G9F A;  1WA6 X;  4E2S A;  3NVC A;  3ZDV A;  1ZA4 A;  4EQV A;  1XXN A;  2ZAC A;  4CDQ A;  3O1S A;  2PQQ A;  1TZO A;  1UQX A;  3UNP A;  4Z8B A;  2QKD A;  1W9F A;  2IXC A;  4XHX A;  3ZFE C;  3ZSJ A;  4RQP A;  2FCT A;  5IK5 A;  5L73 A;  4M00 A;  4YM2 A;  3MI8 A;  3MPP G;  1OKQ A;  5LY2 A;  3VBF C;  1REE A;  3FFZ A;  5JDB A;  5K0U B;  1TME 3;  1APN A;  1OSG A;  4PDW A;  1I6X A;  5KXC A;  4CDW C;  1FOD 3;  2ZKL A;  5JZG A;  4YZ4 A;  5IUQ A;  1O5U A;  2JG8 C;  3E5U A;  1PGW 1;  4BDV B;  2W91 A;  3ZYP A;  4RHV 2;  3R6S A;  2D97 A;  4CCC A;  3H7J A;  4QXH A;  1NXD 1;  2RS1 2;  1BMV 2;  4LBL A;  3H1Y A;  3KM5 A;  3U11 A;  3N36 A;  1OPM A;  2VVE A;  3TNP B;  5IVV A;  2X09 A;  2P5B A;  5IVY A;  1O4Y A;  4N90 A;  5GLV A;  4CXW A;  2ZX2 A;  1KXG A;  1TMF 2;  2EVX A;  3KF3 A;  1PVC 1;  3CO2 A;  4MVT A;  2R04 1;  4AAP A;  1UY0 A;  2CY6 A;  1DZR A;  2GAL A;  2WAA A;  4QWN A;  4FQ4 A;  4IV3 B;  4CEY C;  2ARC A;  2NZ9 A;  2NQY A;  2WLP A;  5FRE A;  3SCF A;  3U4S A;  4DIQ A;  2ZBJ A;  1U12 A;  3H50 A;  3N7K A;  1EAH 3;  4LXL A;  3FLP A;  1RMU 1;  4CEW A;  1WBF A;  1BEV 1;  1W28 A;  2H0B A;  5ERL A;  1CAU B;  3WUC A;  3OCP A;  1R08 1;  1H2L A;  1SCS A;  4RR3 B;  4P00 B;  2WNE A;  3O1V A;  3ZDS A;  4I2O A;  2G19 A;  4KGG A;  2W3J A;  3KGL A;  5FYB A;  4DNY A;  3RWK X;  2BGO A;  2WZR 2;  2A6Z A;  2FBE A;  5EZW A;  4CCK A;  1ASJ 3;  4P02 B;  2O8Q A;  1C8M 3;  2QTW B;  4LOT A;  4RYD A;  5D21 A;  1D2S A;  2VUC A;  2QQN A;  2D93 A;  3ZN6 A;  1E5S A;  3B5L B;  2W2I A;  3OBT A;  4M0H A;  3KCY A;  3LPG A;  4XJZ A;  3WOG A;  2DUP A;  4CDU C;  3V56 A;  3KF5 A;  2IUW A;  4HLT A;  2X53 S;  1JXN A;  5FPV A;  3O1R A;  5AFE A;  3QOP A;  3PU3 A;  4XQW A;  3POF A;  4UFH A;  1NCQ A;  3VBH B;  1Q8O A;  4PI0 A;  3SMH A;  1V00 A;  1NE6 A;  3HT1 A;  1G9A A;  1GP6 A;  1RUJ 1;  2R07 3;  4PQ9 A;  2B4K A;  5C4W B;  1AJO A;  2VMF A;  4NN0 A;  4XHB A;  1VBD 1;  2VAU A;  2GZW A;  3NST A;  1AR9 1;  3LWC A;  1W6Q B;  1WLT A;  3WZ1 A;  4CDX C;  1NE4 A;  1MS8 A;  1QQP 2;  3GJA A;  3VDB A;  1UIK A;  3WR0 A;  3WW1 A;  3OEB A;  2E32 A;  2JDY A;  5FYI A;  5GZG A;  5JI9 A;  4ARY A;  5I8S A;  2PHU A;  4FAG A;  2ADD A;  5FXV A;  1HJF A;  2Q8O A;  1KJR A;  1ZBE 2;  1PM7 A;  4BQY A;  4CP0 A;  5FYV A;  1LJ7 A;  1F4A A;  3Q8E A;  3OPZ A;  1K5M C;  1ND2 A;  4COV A;  5LRR A;  3D5O A;  2L9L A;  4XOG A;  4AK3 A;  1A8D A;  1UYZ A;  1C4R A;  3UKN A;  3K48 A;  3AKR A;  4RSU A;  3ZXL A;  5F5I A;  1UWW A;  3AP7 A;  1U5Y A;  1D7P M;  4LBN A;  4QHZ A;  1MS9 A;  5IW0 A;  2J1T A;  3PIG A;  2XG3 A;  3WF3 A;  4FT8 A;  2H0V A;  1GZW B;  4A7K A;  3ZYJ B;  4Z92 B;  5M0T A;  2V5D A;  1HRI 2;  3WP3 A;  4M4P A;  4QPY A;  1JYN A;  2PLV 1;  1U5X A;  4WVM A;  4YFZ A;  1RUG 1;  3I2F A;  2GU9 A;  4P5H A;  3VN4 A;  1GZC A;  3ZVX A;  4N43 A;  5G05 L;  2NYY A;  2D98 A;  3M7A A;  3OEA A;  4V1P A;  1ZX5 A;  2BGP A;  3KCC A;  4PLM A;  3TRS B;  1ENS A;  2N7G A;  1PVC 3;  2OXB A;  2XL9 A;  5FLI A;  3VBF B;  2J1R A;  4YZ2 A;  4Y20 B;  1OA2 A;  2JG9 A;  1COV 1;  4QM9 A;  4CDW B;  4PBO A;  2VBP A;  3P1I A;  5F5Q A;  3DPR A;  3K2O A;  5EFU A;  2A6X A;  4Z07 A;  3OBA A;  5CFC A;  3FC0 A;  4DOU A;  2W39 A;  2OUJ A;  3K3O A;  2YDE A;  1KDK A;  4M3C F;  3ZYH A;  2J7M A;  1RUD 1;  2O1Q A;  1QJF A;  3U07 A;  1C57 A;  3K77 A;  2XLF A;  3H3L A;  1R08 3;  5CKQ A;  1H30 A;  4Q2F A;  1RYY A;  5ANN A;  3GF6 A;  4FPK A;  3RYK A;  1Q8S A;  5LBF A;  4XJA A;  1B09 A;  1NOV A;  1ULG A;  3LEI A;  4GXL A;  1QJU 2;  4AG4 A;  3BTZ A;  5E89 A;  1KD7 A;  5FJK A;  2J42 A;  2B42 B;  3WW4 A;  1GOF A;  4UF0 B;  2QQW A;  2WFF 1;  1XSR A;  5CZK A;  4CEY B;  5JLV A;  1R09 2;  1SAC A;  5IVC A;  3VDD C;  4FTB A;  1PHM A;  4YVW C;  1RVF 1;  3W59 A;  5JMO A;  3L9J T;  5IT6 A;  1ZZ7 A;  4DRV A;  2R1D A;  2VW1 A;  2WT1 A;  1CN1 A;  1HXS 1;  1F31 A;  2IWG B;  3VBS A;  1SFN A;  4NAO A;  1X7N A;  5DAX A;  1U5I A;  1QJX 2;  4WVV A;  2HYK A;  2VZQ A;  2XOM A;  2ZAB A;  1J58 A;  1V9U 2;  3GBG A;  5J48 A;  1RUJ 3;  3ATG A;  4HET A;  5FYY A;  4IE6 A;  4AVB A;  2RJ2 A;  2VE1 A;  4KH9 A;  2YYO A;  4UT5 A;  3ZFE A;  5GZC A;  3E6D A;  2W47 A;  4MLO A;  4XEZ A;  1VBD 3;  4P9J A;  2WSU A;  2IXH A;  1AR9 3;  2E7A A;  1UAI A;  1G7Y A;  4G4F A;  5JI7 A;  1UZW A;  2V4V A;  3VKF C;  4E4D X;  1VMF A;  5FQ0 A;  4R9C A;  1WMD A;  3K4Z A;  1DQ5 A;  3RJ2 X;  4BIS A;  4C1W A;  1LHO A;  3VKN A;  2JG8 A;  2JB8 A;  3NNJ A;  4CDU B;  1AR7 1;  4IXL A;  3MZH A;  2EXK A;  1YC6 1;  2UU8 A;  4JGY C;  4GQ7 A;  3N7L A;  4KU8 A;  4QX1 A;  5L36 A;  1US2 A;  3PHM A;  1F4H A;  1DQ0 A;  1NLS A;  3Q9O A;  2JIJ A;  1OF4 A;  2A70 A;  2Z2S B;  1OFS A;  5E88 A;  1RIN A;  5FZ9 A;  2E7Q A;  2QJV A;  4TWT A;  2ZCW A;  1X33 A;  4RS5 A;  1JOJ A;  1OFN A;  1H1I A;  2UWA A;  2ZEX A;  5F5A A;  5LA0 A;  1AHS A;  2Y6J A;  1CAX A;  3ETP A;  2FQP A;  3NNG A;  5E8A A;  5LBB A;  3I59 A;  4CDX B;  1S2E A;  1S0E A;  1J3P A;  1W6O B;  1PIV 1;  1LGC A;  2VOV A;  3N3H A;  1KFX L;  1DZQ A;  2WLQ A;  2PLV 3;  3R4S A;  1SFY A;  1H4H A;  5K4L A;  2XKP A;  4Y26 A;  4IE4 A;  3OF1 A;  1OMI A;  2BNO A;  3KV5 A;  3MLL A;  5BYN A;  3K75 B;  4B7E A;  5F1R A;  3U4X A;  4YM1 A;  5C8C B;  2PHL A;  3OTF A;  4ZZ5 A;  1K5M B;  4Q8L A;  4WM7 A;  1OA4 A;  3POG A;  5FP9 A;  4HOO A;  3FLT A;  5I0S A;  1O5L A;  1K42 A;  3K51 A;  1MZE A;  3ZOI A;  1CPM A;  3POE A;  1SHW B;  2WL1 A;  3WNL A;  4YW3 A;  5FRA A;  4CP9 B;  2RS3 2;  4JKK A;  3AFG A;  1PMI A;  1H0B A;  2OT7 A;  2WWJ A;  5FZF A;  5FP4 A;  1DYO A;  1H2K A;  2D6M A;  3CIH A;  3PU8 A;  3WG2 A;  5J09 A;  3KSC A;  5K9Y A;  3J8F 1;  4I30 A;  1BJQ A;  2VOT A;  1JYT A;  1OD3 A;  2PEL A;  5DXD A;  1LRH A;  2ZGQ A;  5AVP A;  2YHJ A;  1QH6 A;  5HCF A;  3SEP A;  3URF A;  1W9T A;  1JW6 A;  3RMY A;  2X05 A;  5A3W A;  1FPN 3;  4JHT A;  2MHF A;  1DYP A;  2QBX A;  3ITQ A;  1C1L A;  4EJR A;  4ERO A;  1LOB A;  3MLJ A;  1ND3 C;  5FUP A;  1ZBA 2;  1W2T A;  5FY4 A;  1HQL A;  2ADE A;  4BK4 A;  2GMM A;  1QWR A;  1S0G A;  1R1Z A;  2GH2 A;  3K46 A;  4MGK E;  4YG6 A;  4TTG A;  4MGT A;  3IZO A;  1ZNP A;  2AEN A;  4XCA A;  1IPJ A;  1DGW X;  4WV8 A;  3MHZ A;  1UPS A;  4OHX A;  3IPV A;  1Q43 A;  1XC6 A;  2BW8 A;  5C70 A;  3RNS A;  4OQ8 A;  1WMF A;  2BFU L;  1UMH A;  1W6M A;  2GP5 A;  1HXS 3;  1POV 1;  4C0H A;  4RGK A;  3ZIX A;  4NRP A;  3J7M A;  4NRM A;  1DHK B;  2BJS A;  3I49 A;  1JTZ X;  2JE8 A;  2YRO A;  4GWI A;  1JHJ A;  4BQ5 A;  3ZSE A;  4ZKT B;  1DZT A;  3KWV A;  4O9E A;  1D4M 3;  4GMP 0;  2ARA A;  3T0B A;  1MVQ A;  1H8T A;  3U1X A;  2CGP A;  1CD3 G;  5FOJ B;  4XBN A;  2BZD A;  5JUV A;  3PVO A;  3RZZ A;  3CF6 E;  4DEV A;  3GNE A;  2ZAH A;  3EHK A;  4XTP A;  5JVV A;  2JDK A;  2C6S A;  1UX7 A;  3IDE A;  1LHW A;  3BOW A;  1A34 A;  1CIW A;  2RDN A;  3OPW A;  4KBB A;  4YLZ A;  3VDD B;  2F4P A;  1YHF A;  2XBO 1;  2XUM A;  3HVD A;  4YVW B;  5C9A C;  4R4X A;  1OH4 A;  1AR7 3;  4XAA A;  3F95 A;  3UGH A;  5HCA A;  1VBB 1;  2PHT A;  3D82 A;  3M3O A;  3ZKY A;  3JUU A;  4EN8 B;  5F7U A;  5FYU A;  1XNB A;  4Y1X A;  2R7E B;  2Y6F A;  4E27 A;  3UES A;  3HPN A;  1BVV A;  1W9W A;  4KNC A;  4XF4 A;  1DQ2 A;  4QMA A;  4RHV 1;  1AR6 2;  2J1E A;  2OX0 A;  5FO9 B;  1UY4 A;  2KR2 A;  1CPN A;  2RS1 1;  1BMV 1;  1W2N A;  2YBK A;  3U75 A;  3O0X A;  2F4L A;  2PHD A;  5JWP A;  5LZ6 A;  2VW2 A;  5T50 A;  1ENX A;  1PIV 3;  4FPE A;  3AYD A;  3DV8 A;  5I91 A;  1NZC A;  3W5N A;  1UOJ A;  1C28 A;  3MIF A;  4CXX A;  1OXC A;  3N9P A;  1NY7 2;  3K3N A;  3KV4 A;  1A78 A;  3MIH A;  4J6G A;  4Y4Y A;  3T1M A;  3FUO A;  5FMO L;  4BJ0 A;  1VBC 3;  5D8A C;  1VE0 A;  4X6Q B;  1C1F A;  1SQ4 A;  2Y6L A;  1KS4 A;  2JJ6 A;  3PNA A;  4IV1 C;  4Q0V A;  5FMD A;  3EBR A;  3W9A A;  1ALY A;  1VIW B;  4QX3 A;  2YMZ A;  3AYC A;  3P3N A;  1ZRR A;  4EWD A;  1YIP A;  2C4X A;  1XB9 A;  4LO5 B;  4TZD A;  2VPV A;  4M01 A;  4MXV A;  1AXZ A;  2X5I B;  5JSO A;  1UN1 A;  5IFP A;  5JOZ A;  3FX3 A;  5FZB A;  4YSF A;  1W3X A;  4JGZ C;  1XE0 A;  5I93 A;  2WDB A;  4CP2 A;  5D2A A;  2PAK A;  4QX5 A;  3QBQ A;  5FUN A;  1SDD B;  5IK8 A;  1LCL A;  1WWY A;  2WZR 1;  1G9B A;  5CKN A;  3NNM A;  2DUR A;  4UI9 L;  3D6E A;  4CUC A;  1JZ6 A;  1HIX A;  2MPF A;  2JKX A;  4WM8 B;  3O1T A;  2A7A A;  3IDA A;  1JH5 A;  5FP3 A;  4Y1Z A;  4BMB A;  3KD4 A;  3THC A;  3QD6 A;  2LW8 A;  2WA4 A;  2DCK A;  3WF0 A;  3N9Q A;  3DEM A;  1GZT A;  4XF0 A;  1FMD 2;  4XQ4 A;  5HXV A;  2CNA A;  3SIT A;  3V0B A;  3BTY A;  2Y64 A;  2X8K A;  3KB5 A;  2W5F A;  4BPZ A;  5CEH A;  5A3U A;  4JDM A;  3VD7 A;  1O8S A;  1S1A A;  1W8N A;  3DKW A;  1POV 3;  1HLC A;  5DDJ 3;  5T5O A;  3B69 A;  1YWK A;  4UXA A;  2GAU A;  1F2N A;  1OOP C;  1IGO A;  2RMU 2;  4LE4 A;  2WS9 2;  3MV0 1;  2MEV 2;  4AI2 A;  4JGY A;  4NMI A;  3SLI A;  1Y9G A;  1UNB A;  2Y6K A;  1ND3 B;  3JBG 3;  1RXF A;  4UBH A;  2VUJ A;  1S2K A;  4BWO A;  4IE7 A;  3NV4 A;  3JB4 C;  2FD8 A;  1WMX A;  3ACL A;  2WNV C;  3BKZ A;  2FCV A;  2W08 A;  4GAZ A;  4LPL A;  1ZBE 1;  2VTX A;  5EIY B;  2JB4 A;  4XUT A;  4CUB A;  3LCP A;  4RL7 A;  1W8T A;  3IMN A;  4XF1 A;  5H9P A;  2FCU A;  5JSR A;  4A7Z A;  4AW7 A;  4DRR A;  4JQR A;  3BUC A;  4MXW B;  5FLH A;  3WNK A;  1VRH 2;  3F2Z A;  1DYK A;  2NM1 A;  2QQU A;  2WSV A;  1W9Y A;  2GDF A;  4EN6 B;  1YFX A;  5J96 B;  1CWP A;  5FIX A;  1E57 A;  5FBJ A;  4NIH A;  2C24 A;  2BU9 A;  5FZO B;  3HQR A;  3BPS A;  3ALQ A;  1GWK A;  2W1S A;  4YNI A;  4RHV 3;  4PIX A;  3RMX A;  1ZRF A;  1J3Q A;  4QGL A;  2FDJ A;  3T2O A;  4C1X A;  2ZZQ A;  4FFG A;  1HB1 A;  1VBE 2;  4W8J A;  1RUC 2;  2VD7 A;  1O6U A;  2GC2 A;  3WDY A;  5IK7 A;  2ZHM A;  2EIG A;  4JRL A;  2VMD A;  1E5I A;  3FWE A;  5GM0 A;  5C9A B;  5FYM A;  4GZ9 A;  5FZK A;  2WWS A;  1PO2 1;  3ZXE A;  4LLO A;  4QGM A;  4YGB A;  1RJ8 A;  4B4Q A;  2QDN A;  1TMF 3;  1PNF A;  1JN2 P;  2ATF A;  1AX1 A;  4OHZ A;  5A6Q A;  1PX4 A;  2A71 A;  4HVR A;  2WO1 A;  4H55 A;  3OYW B;  1LKN A;  3WDW A;  1NLQ A;  1CIY A;  2W87 A;  5FO8 B;  5JR2 A;  3U37 A;  4AR2 A;  1DF0 A;  1I5P A;  2A6V A;  4D7S A;  4QDQ A;  5BNN A;  4PLN A;  2IXI A;  2EAL A;  1LOC A;  1QU0 A;  4CZS A;  4F83 A;  3MEP A;  4IEZ A;  4K6B A;  4NUB A;  4XE9 A;  1YFY A;  3D0S A;  4XFB A;  4ASM B;  2CDP A;  4UWD A;  3VD4 A;  4MAD A;  1A6C A;  1K5J A;  2EF6 A;  4KWJ A;  4PQQ A;  5D8A B;  4XFA A;  1X9P A;  2VBB A;  2BP6 A;  4IV1 B;  4YVS A;  1R09 1;  3POI A;  2VVF A;  1MS5 A;  2IZW A;  2OPW A;  2ZMN A;  1Y43 B;  2E63 A;  5LY1 A;  2ZZJ A;  4Z2W A;  5BXX A;  5K0U C;  3OGV A;  1JZ4 A;  3P6B A;  1M4W A;  3UGG A;  4DUW A;  5FY1 A;  3LDR A;  4YZ1 A;  2ZX3 A;  1QJX 1;  1DCS A;  2GN3 A;  2GNM A;  1ULE A;  5ANQ A;  3MIG A;  1GUI A;  4ISR A;  5A7W A;  1V9U 1;  3U78 A;  2BNN A;  4HVQ A;  4JGZ B;  1W0N A;  5IYY A;  1S55 A;  2Y0O A;  2D6N A;  2ENR A;  1GKB A;  4ASL A;  2XHK A;  4MGI E;  2VZP A;  3E1F 1;  3GHN A;  3T2T A;  3WDV A;  1JYX A;  5F3C A;  3S0M A;  1QQP 3;  1JBC A;  3SC7 X;  2V5Y A;  4BM8 A;  4D94 A;  2ZJC A;  3CQO A;  3PUI A;  2JEN A;  1O4Z A;  4LO8 A;  3ASI A;  2D3P A;  5LBC A;  3M1H A;  5FUI A;  4P9X A;  1ZBE 3;  4AVA A;  4KL1 A;  5L9R A;  1JZ7 A;  4IV3 C;  3VGI A;  2GP3 A;  3AKP A;  4IEW A;  1MZ6 A;  2NMO A;  5ABJ A;  3ZFG C;  3CL1 A;  4E4Z A;  3RZJ A;  3BOP A;  4F3J A;  2RVA A;  4QPW A;  3UK9 A;  2XDV A;  1MZ5 A;  2DVD A;  3BCW A;  4LUM A;  4CVU A;  5FWJ A;  5HPO A;  3NJX A;  1OOP B;  3BVC A;  2P37 A;  1AYN 2;  3W58 A;  3R0R A;  2ARE A;  4OLL A;  5JXG A;  1FX5 A;  4AED B;  5CIS A;  1AR8 2;  3EXU A;  4KU7 A;  4RR3 C;  1J3R A;  1YUD A;  4J1W A;  4Q29 A;  2BVB A;  1HRI 3;  1S0D A;  3ORJ A;  1I9R A;  1TVG A;  1WLC A;  4XPV A;  1VR3 A;  1ZYB A;  5FPZ A;  4LT5 A;  4NAM A;  5FYT A;  4NIG A;  1V6M A;  4QB6 A;  4QT6 A;  3LPF A;  5ISL A;  2O0O A;  4WZC A;  3CJX A;  1GQP A;  4IND A;  1W8W A;  5A6Y A;  1IZ3 A;  1SDW A;  2VME A;  5ACA 2;  2Y26 A;  3MF9 A;  4WBB A;  2Q8D A;  3HQX A;  4AXO A;  1RUH 2;  4N53 B;  4IV1 A;  2Z69 A;  1C8N A;  1JYV A;  3DEC A;  3TEW A;  5FZ8 A;  3ETQ A;  4CTE A;  2RS3 1;  3V0A A;  3BU0 A;  1NA1 C;  4A6O A;  5FZL A;  3RZK A;  2BGC A;  2OQ6 A;  3O5S A;  2XVL A;  5FP8 A;  1JHN A;  5I0T A;  4FP3 A;  4QHO A;  5FZE A;  4BXS V;  4AI0 A;  1W06 A;  1C8M 1;  2EIC A;  1PO1 2;  1G6N A;  2DDU A;  1AUY A;  4K3U A;  1N3Q A;  4OVE A;  4OUE A;  1ZBA 1;  3WSO A;  1QJU 3;  3UGF A;  3WUD A;  4XDQ A;  3N9O A;  2K46 A;  2ZGP A;  5C3Q A;  3JQX A;  2CAV A;  2EIB A;  1EP0 A;  3TBD A;  4EWA A;  3S6P A;  4JCK A;  1W90 A;  1R09 3;  1CJD A;  1GU3 A;  1NCR A;  1YQ6 A;  4FPL A;  1QOS A;  5HV0 A;  1B35 A;  1ZRC A;  2VZU A;  3DXU A;  2HEW F;  3SIS A;  1O3T A;  2Q8C A;  4Y5S A;  2PHR A;  1KQR A;  4MYE A;  3FLR A;  1IQA A;  2DCJ A;  2AZ5 A;  2WNU C;  1LU1 A;  2G4I A;  4Q4W 2;  1KEX A;  4UBG A;  2WNV A;  1QJX 3;  2W92 A;  2NN8 A;  1L3J A;  4XFI A;  1XU2 A;  1V9U 3;  4IES A;  3C7G A;  5CAD A;  1K12 A;  1RC6 A;  2LTN A;  2XVG A;  2D6P A;  1SMV A;  1Q56 A;  3GZT B;  2BPA 2;  1GYK A;  1VRB A;  3WNP A;  1J1L A;  2RR1 2;  3H1W A;  4L2N A;  2K0G A;  4KI5 M;  4RD7 A;  1W6N A;  5H9R A;  3SQO A;  1UY2 A;  2K9Z A;  4MGQ A;  5AC9 2;  2EIE A;  5A7O A;  5BNP C;  2C9K A;  2A75 A;  5EPA A;  4ZU4 A;  2DCZ A;  4CPB D;  1KRI A;  1S0I A;  5IK4 A;  1W0O A;  3LA7 A;  4YZ5 A;  2R16 A;  5HI0 A;  4LQR A;  4XUR A;  5I8Y A;  1WBL A;  5EYX A;  5IVB A;  2Q1F A;  3FMG A;  1NLR A;  2AH2 A;  5BPX A;  1N1V A;  2I2S A;  2YC2 A;  1FAT A;  4JZR A;  2QQO A;  3OGJ A;  3A23 A;  5EXO A;  2GC0 A;  3AC0 A;  2WC2 A;  3H8U A;  1XNA A;  5LEK A;  1HQN A;  3WCR A;  4CXY A;  1CX1 A;  5FY7 A;  4AEK A;  4JC1 A;  1ZZ9 A;  3PME A;  3Q8B A;  3MIE A;  3VZL A;  1H9P A;  2HWC 2;  3ELN A;  5FYZ A;  4XBL A;  1JZ2 A;  4AGR A;  1ZRD A;  4HKL A;  3C3V A;  4HKO A;  3WHT A;  2Z42 A;  3CMG A;  1KJL A;  1RUF 2;  1Y7B A;  1NY7 1;  2BBA A;  4YW7 A;  3EB7 A;  3WG3 A;  5C33 A;  3KMH A;  4EYU A;  4GKX A;  3THT A;  4LBQ D;  3ZFG B;  3ZXF A;  2VGD A;  3HT2 A;  4QXC A;  2EA7 A;  4AQS A;  1PMJ X;  1AXY A;  5I0D A;  2LM3 A;  4QX7 A;  1H2M A;  2CU5 A;  4IEU A;  1D2Q A;  5BNO C;  1Z7S 2;  1LOD A;  5EYY A;  4E8D A;  4A41 A;  1MR5 A;  2RS3 3;  4QAW A;  4ZXK A;  4MGZ E;  2XJS A;  3OBZ A;  2H6B A;  1IG3 A;  1F5J A;  2B39 A;  2YFZ A;  2CV6 A;  3NV3 A;  5IJR A;  5J1X A;  5LA1 A;  1C3H A;  3O1U A;  1S0B A;  4AAX A;  4LMF A;  1PZ8 A;  3DCQ A;  2C0Z A;  4F8A A;  4H7L A;  5C3O A;  1JYI A;  1ZA7 A;  2ARX A;  5K0U A;  1GNH A;  3R4D B;  4TN7 A;  4XC9 A;  3RZL A;  4Y5Z 0;  1WCS A;  4COW A;  1ZBA 3;  5JXH A;  3T1L A;  1VJ2 A;  3ZSK A;  1AXK A;  5A80 A;  2VZS A;  4E8C A;  5B4X A;  5A1A A;  4HK9 A;  5KBF A;  4IEP A;  2LS6 A;  1V0A A;  1OC1 A;  3QH6 A;  4K8F A;  1FMD 1;  1HN1 A;  3NAP B;  5FLJ A;  5EQU A;  4KWU A;  5JCT A;  2HEV F;  1CGP A;  2YBP A;  1NA1 B;  1PK6 B;  1LAJ A;  3OY8 B;  2D5F A;  5EP9 A;  1EPZ A;  1X50 A;  4IE0 A;  3RYR A;  4HMZ A;  4YW6 A;  5FYH A;  3SKJ E;  3WV6 A;  3KT4 A;  2RMU 1;  4KG8 A;  4XVH A;  4LE3 A;  2G9Z A;  2WS9 1;  3S57 A;  1WCU A;  2MEV 1;  1C5I A;  1ACC A;  1YNA A;  4IV3 A;  1YJK A;  2KA3 A;  2ZGK A;  3I4I A;  4URA A;  1UO9 A;  2XXZ A;  4A7Y A;  1UZZ A;  3FJS A;  3NV1 A;  3PUS A;  3GBW A;  1UYP A;  3RZM A;  1ZZC A;  2GND A;  4P9L A;  1EY2 A;  2ZGR A;  1ZVF A;  2AAC A;  5LB6 A;  4DPN A;  1GR3 A;  2QNK A;  4QKD A;  5C8C C;  4XZP A;  1CAU A;  5FZC A;  3ZXA C;  4L99 A;  3KHC A;  1LOF C;  5FPX A;  1K45 A;  2BOJ A;  1ZRI A;  1GNZ A;  2QQI A;  4RR3 A;  2PN5 A;  3W20 A;  4LKF A;  4MUV A;  1S0C A;  1D0H A;  3X29 B;  2QZ3 A;  2VZ3 A;  3T08 A;  1YFU A;  4O61 A;  3LOB A;  2WNU B;  1MQT C;  3AKS A;  4YW5 A;  3WW3 A;  2VNR A;  2YXS A;  1WKY A;  1VRH 1;  3OOX A;  5IVJ A;  5JOY A;  4GJZ A;  1JU3 A;  1PGS A;  3VBO B;  2Y33 A;  3AKQ A;  1AR6 3;  1GWL A;  1OD5 A;  3ZFF B;  5C3R A;  3J7L A;  5CIR A;  2GNT A;  1LGN A;  1VBE 1;  5C5U A;  1RUC 1;  1TE1 B;  2WO3 A;  2ZEZ A;  1FNZ A;  5BNP B;  2JDN A;  2VEC A;  2VZV A;  3AX4 A;  3GZU C;  4OMD A;  3VBH A;  3TEY A;  4KQ7 A;  3DF0 A;  3M2M A;  4IEY A;  4IEQ A;  5DAP A;  1OVS A;  3L2Y A;  2ZGM A;  4AFM A;  2DVA A;  5C4W A;  5KR7 A;  2ET1 A;  1N47 A;  1K3I A;  4AVV A;  1BLZ A;  4GMP 1;  2RS5 2;  2BUK A;  4Q4X 2;  4CUG A;  1W6Q A;  5FZH A;  4D8M A;  5LAS A;  5GKA C;  4OFG A;  4W6W A;  4ATF A;  4QQH A;  4O9G A;  3M3I A;  4E2G A;  1WW7 A;  1REF A;  2YGM A;  5CFD C;  1I3H A;  2EXI A;  2PA7 A;  3H7Y A;  1LOA A;  3KLS A;  4L97 A;  2W9X A;  5IAV A;  4XJ9 A;  3CZU A;  2WYS A;  4QPG C;  1N1T A;  4D7T A;  3S5Q A;  1FPN 1;  2OA2 A;  2XQX A;  1W03 A;  2YPJ A;  5FXZ A;  1YEW A;  1UZ0 A;  1MPX A;  2BQP A;  4K21 A;  4AI3 A;  4IEO A;  1BBT 2;  4Q27 A;  5JMC A;  5FYC A;  4NHL A;  3K4A A;  4IE5 A;  2CGO A;  4A42 A;  4AQ6 A;  1QIQ A;  2P3Y A;  3LSE A;  4BB3 A;  2PAE A;  5CU1 A;  2PYT A;  4CU9 A;  2NP0 A;  1GZW A;  4FQZ A;  4QGN A;  4LBQ B;  4NPR A;  4C8D A;  4RGA A;  5FY9 A;  2I45 A;  2I74 A;  1Q3E A;  3VD3 A;  3EYP A;  3MPB A;  1QDC A;  3B93 A;  4CU8 A;  3UT0 A;  5BNO B;  4M4R A;  1FMD 3;  1EYB A;  2AGS A;  1D4M 1;  1AL2 2;  3BU7 A;  1BXH A;  4Q1R A;  3P3P A;  3LEM A;  5FJH A;  1JOP A;  2YZ4 A;  4XIL A;  3O7O A;  1MS4 A;  4XFF A;  4NOT A;  2DBN A;  3WIN E;  3ZXG A;  2QQK A;  1XYN A;  2YBS A;  2LAL A;  2RMU 3;  5FXW A;  3B7M A;  4AGG A;  2RJK A;  2ILM A;  2WS9 3;  1RL3 A;  2MEV 3;  2BV4 A;  3VBF A;  1EV1 2;  3LA2 A;  4Y20 A;  3ENR A;  4CCJ A;  5F3I A;  5I0U A;  3WNO A;  4FPJ A;  5IAX A;  4CDW A;  4CCO A;  4X6R B;  4RN5 A;  4Y22 B;  4ATE A;  2Y38 A;  1LED A;  3UYJ A;  4DUX A;  4NWV A;  1C5H A;  3C7O A;  3AZV A;  1JI6 A;  2XON A;  1JOD A;  2B45 X;  3VHO A;  1HN0 A;  5IVE A;  2WA3 A;  3WLU A;  3LFI A;  2XLG A;  2PQS A;  2ZX0 A;  3GGL A;  1IKQ A;  4XFC A;  3USU B;  3E97 A;  5FWE A;  1VAK A;  2ET7 A;  2W95 A;  4JDN A;  2D7F A;  1VRH 3;  2R06 2;  4HPK B;  3H8X A;  4BQ2 A;  2X5I C;  4DMI A;  1CZV A;  3NNF A;  1G9C A;  4K1Y A;  3PVE A;  4OI2 A;  4R9A A;  4UF0 A;  4CEY A;  2R04 2;  1AR8 1;  2PAM A;  1YFW A;  2MNG A;  4FXK B;  4BK5 A;  2D3S A;  3GXU A;  4JV4 A;  3ZN5 A;  4LBO A;  3O1O A;  1VBE 3;  3IWZ A;  1RUC 3;  1NQJ A;  3S7E A;  2BBV A;  4DY5 A;  4AQT A;  1VBC 1;  2XWB B;  4XXA A;  4ZU7 A;  1IS6 A;  4LTA A;  2DVF A;  5GZD A;  2A3X A;  4WM8 C;  1CES A;  2DCY A;  3Q8A A;  2BNM A;  3HIF A;  1RJ7 A;  1J83 A;  1MQT B;  4QKN A;  4GMP 3;  1V6K A;  3MYX A;  5F39 A;  4MZU A;  1ONA A;  2PMW B;  3PTY A;  4FFF A;  2A6Y A;  4BU2 A;  2FMD A;  1HJG A;  2FDI A;  1XND A;  1FV3 A;  3BPZ A;  3VBR C;  4CDU A;  2IFR A;  4DQA A;  4K40 A;  2ZEY A;  1YQ5 A;  5KXD A;  2GSY A;  2QQP A;  1UW8 A;  1LTE A;  1V6O A;  2HJI A;  3M3E A;  3POY A;  1OQ1 A;  2WQ4 A;  3MID A;  1GWM A;  2VR4 A;  3IB3 A;  4MGY E;  5KWR A;  1AF9 A;  1VMJ A;  2IVJ A;  4W4Z A;  4DEQ A;  2GME A;  4RGG A;  1QDO A;  4NHY A;  4P5Y A;  2HWF 2;  4K1Z A;  3CJI B;  2XGX A;  5LA9 A;  5GLU A;  1YRZ A;  4P9I A;  3J7H A;  4LA2 A;  1TG7 A;  2AC1 A;  2WAB A;  5T3N A;  4CDX A;  2WBK A;  4IUG A;  5DDJ 1;  1W6O A;  4PIY A;  2QUO A;  3OD0 A;  5JOX A;  2P6C A;  3OUI A;  5FKB A;  1W9S A;  4A44 A;  5CFD B;  4U36 A;  3JD7 2;  2XJT A;  2XJV A;  2P3K A;  4Q4W 1;  4QPG B;  1OBN A;  1CAV B;  3UL2 A;  3RI8 A;  5C8C A;  4CCE A;  4ZZ8 A;  4JTN A;  2XKO A;  5F32 A;  3JBG 1;  4R52 A;  1K5M A;  1UU6 A;  1JS9 A;  3G7D A;  2ORX A;  2QE3 A;  2ZHN A;  1US3 A;  4XXP A;  3WT3 A;  4D69 A;  3N9L A;  5K8S A;  3B00 A;  1OHF A;  2RR1 1;  3QLQ A;  3PIJ A;  4WZF A;  3VKM A;  1HX6 A;  3CEW A;  4FOW A;  4CP9 A;  2WUH A;  5AC9 1;  4IL7 A;  1Z78 A;  3ZLI A;  2BFU S;  1CAW B;  2G9F A;  3FHI B;  3NJY A;  1GQH A;  3A0N A;  3VZM A;  5A1L A;  1VAM A;  4XDO A;  3DYP A;  4YWA A;  1UYX A;  1U5Z A;  1RB8 G;  2WRA A;  5HCH A;  3ECQ A;  4TSV A;  2Y60 A;  4D6S A;  1YQ2 A;  1KFU L;  4LK6 A;  4XW3 A;  4AHW A;  4NVP A;  3IT8 A;  4QD2 A;  1SLA A;  5LEJ A;  4XAC A;  1AYN 3;  4CU7 A;  4GWJ A;  3IKW A;  2VZR A;  4AFD A;  1CX4 A;  1W39 A;  1AR8 3;  2VW0 A;  2Q8E A;  4B4P A;  3MBW A;  4DFS A;  3MO4 A;  1GP5 A;  2XLA A;  5KHH A;  4YM3 A;  1JZ5 A;  3UJQ A;  2BTV C;  2E9Q A;  4IEX A;  2E26 A;  2EXJ A;  2RJL A;  1P8J A;  1GP4 A;  4L8Q A;  4XJU A;  5BV6 A;  4MV2 A;  1RUF 1;  1TMF 1;  3MGU A;  4GA9 A;  3R4U A;  3I2I A;  1NAE A;  3LDK A;  2XJP A;  2A3W A;  3ABZ A;  5EJ3 A;  4QKB A;  1V70 A;  2DCT A;  3I8T A;  4PIZ A;  5CVR A;  5FK7 A;  3N7M A;  3VKO A;  2FDH A;  4W50 A;  4XCB A;  1GIC A;  1MVE A;  3ZYB A;  1F5F A;  1ODN A;  2HH9 A;  4YRD A;  4CCD A;  5F2W A;  4BA6 A;  3ACF A;  1T2X A;  2DWR A;  4QPI C;  4YG3 A;  1OQE A;  1RUH 3;  1PX3 A;  3NW4 A;  5FBZ A;  1LEN A;  1UMI A;  3K4D A;  4YGE A;  5T5P A;  5FMC A;  3FZ3 A;  4H14 A;  3VDD A;  2V73 A;  4QQL A;  4YVW A;  3HR9 A;  3MIB A;  3AXD A;  5DG2 A;  4AVC A;  4AF9 A;  5DZG A;  4DY3 A;  3AJY A;  3IDC B;  5HCB A;  1BYH A;  3J7N A;  5IFT A;  5J36 A;  5FMO S;  1PO1 3;  3E5Q A;  1RMU 2;  4KWL A;  4QX0 A;  2QDR A;  5F6K A;  3ZR5 A;  1VB2 A;  3H8R A;  4L9B A;  3EJK A;  4EZH A;  2VTX J;  2FDG A;  4R9B A;  1YLL A;  4MH0 E;  2DTY A;  2ES3 A;  1SPP B;  5F5C A;  5FZA A;  1DLL A;  2VY0 A;  5IWF A;  2P17 A;  2UYA A;  1GFF 2;  1MS3 A;  3HN3 A;  3Q8C A;  4E4S A;  4P9W A;  4B1L A;  2LUW A;  3AYE A;  5GJ6 A;  3WP4 A;  4Z82 A;  4B1M A;  3AK0 A;  5J7M A;  3TWI A;  4WVW A;  1R1A 2;  3VBR B;  4LLF A;  4Q4W 3;  4BQW A;  2D43 A;  4AED C;  2D5H A;  3ZYG A;  2WKK A;  4FBF A;  3UJO A;  3PVB B;  4P14 A;  4UW5 A;  1QQP 1;  1AYM 2;  2BYV E;  3MV1 1;  1NX9 A;  5FPB A;  1XRU A;  2J1A A;  4LJH A;  3LKJ A;  4ZY9 A;  4XDP A;  1QKQ A;  2RR1 3;  2Y0I A;  3LFM A;  5I8T A;  2VOW A;  1OH3 A;  2X5I A;  2TUN A;  5IHR A;  5AC9 3;  2FMY A;  5DG1 A;  1UYY A;  3U0Z A;  2VVD A;  3VBU C;  3ZSL A;  2C1F A;  2QFE A;  4Q5O A;  5HXM A;  2Z4F A;  2YC4 A;  1ODM A;  5FY5 A;  3WG4 A;  4A3X A;  5JPN B;  1X8E A;  4YYO A;  5HV4 A;  4N53 C;  2D6K A;  5JAX A;  1BVP 1;  3LQC A;  2VOK A;  1V6N A;  5LCW L;  1SLL A;  4NIA A;  4BYY A;  1JZ8 A;  3TOJ A;  3BI3 A;  1O3S A;  5A7N A;  3A0K A;  3TEZ A;  1WD4 A;  3LEG A;  4WM8 A;  4Y24 A;  1W6P B;  3ZM8 A;  1HRI 1;  2VZO A;  5KC5 A;  4Q26 A;  2PHF A;  4BQX A;  4A6S A;  3WD5 A;  1MEC 2;  2YB7 A;  1YO8 A;  4BQ1 A;  1Y4W A;  1L7L A;  4BXF A;  1DQ4 A;  1Y9M A;  2HWC 3;  3TN9 2;  4ISQ A;  4FPC A;  4LEJ A;  2WZE A;  4DUV A;  1LES A;  1E5H A;  4D3W A;  4E2Q A;  1DG6 A;  4UW3 A;  1RUF 3;  4IER A;  3I54 A;  3DKQ A;  2VCM A;  4QXK A;  3DGT A;  3WW2 A;  4Q0Q A;  3ZYR A;  4RQP C;  1RUI 2;  1CZT A;  4ZS3 A;  5DAW A;  2RS5 1;  1UZV A;  5A7S A;  1UXZ A;  4Q4X 1;  4DXZ A;  1ND3 A;  4OMC A;  3KGZ A;  4PHZ A;  5FZ4 A;  1RUG 2;  3M3Q A;  4EN7 B;  5A7P A;  4CU6 A;  3GCX A;  1MAC A;  4Q4V 2;  4GAL A;  1Z7S 3;  5F3E A;  4COU A;  4DB5 A;  4FOV A;  1R64 A;  1LOE A;  4QX8 A;  1COV 2;  3WF2 A;  5KXB A;  1QJU 1;  5FZ0 A;  1LEM A;  3WQ1 A;  2JIC A;  1BBT 1;  4XJ8 A;  2JX9 A;  3RZH A;  4SBV A;  5B4N A;  1XYO A;  2J22 A;  1LEC A;  2XWJ B;  4MXW A;  5FKC A;  1PM4 A;  3N35 A;  4COY A;  2CSG A;  3J9S A;  5JR7 B;  3VHR A;  3T0D A;  1BHG A;  1DFQ A;  1RUD 2;  3MDP A;  3C7E A;  4FPF A;  1WCQ A;  4ZU5 A;  5FZO A;  1QHD A;  3WVJ A;  4QPI B;  5FO7 B;  1UF2 C;  2SBA A;  4OYU A;  4MGS A;  3VUO A;  3ILF A;  5DUW A;  4BLJ A;  2XPJ A;  1OUX A;  3SEE A;  5C9A A;  3N4M A;  3NJV A;  2OS2 A;  5KHJ A;  5L7O B;  2WFF 2;  4LR4 A;  4Y1V A;  3IAQ A;  3D4K A;  1G8W A;  4FPY A;  2Q1Z B;  2VC9 A;  4S2F A;  1EV1 1;  1RVF 2;  2GNB A;  4K20 A;  1LHU A;  1WCK A;  1TEI A;  1D4V B;  3ZXK A;  4XUN A;  2A3Y A;  4QU2 A;  4DXT A;  2HWE 2;  3OYW A;  3B3Q E;  3GM8 A;  4HZF A;  1QY4 A;  4OUM A;  5A32 B;  4XF3 A;  2KM2 A;  3OB8 A;  1GLH A;  4N7I A;  1IPK A;  5FDB A;  3I2G A;  4AL9 A;  5KXE A;  2JDH A;  3TB0 A;  4ZHN A;  4I0W B;  4A4A A;  4AQ2 A;  4HXC A;  2VCC A;  3ST7 A;  4LHN A;  1SLB A;  4D7Y A;  5A6Z A;  1S2B A;  1SLI A;  3D3A A;  5KHG A;  1OQD A;  3BIW E;  2QQM A;  3SH5 A;  4YG0 A;  1W04 A;  4LO6 B;  5L19 A;  1NCQ C;  2XVK A;  3A22 A;  1D0G A;  4GJY A;  2R06 1;  4Y3O A;  3V64 A;  3BAL A;  3ZN4 A;  5D8A A;  4XJW A;  4JX0 A;  3WQ7 A;  1ZM1 A;  1OI6 A;  2P2K A;  1XSQ A;  2EID A;  1XOY A; 
#chains in the Genus database with same CATH homology
 3T2P A;  1H6X A;  2VZS A;  4E8C A;  1H6Y A;  5B4X A;  2W1Q A;  5A1A A;  2ZEX A;  5LA0 A;  1GOG A;  2LS6 A;  2Y6J A;  3ETP A;  3NNG A;  2W46 A;  1HN1 A;  3JXS A;  4CUA A;  4KMQ A;  2VMC A;  2YG0 A;  4KWU A;  4ET7 A;  5DN2 A;  3I3E A;  1OF3 A;  5C71 A;  3SKJ E;  2YFU A;  4XVH A;  3K75 B;  3MUZ 1;  2QQJ A;  1EUU A;  4ZZ5 A;  2CDO A;  1K42 A;  3OG2 A;  2VZT A;  1SHW B;  1CZS A;  2XHN A;  3WQB A;  3WNL A;  4JKK A;  1SG3 A;  1K45 A;  3PUH A;  4XUP A;  2QQI A;  1DYO A;  3CIH A;  4L0P A;  5CYY A;  3UET A;  2E33 A;  1NUK A;  2VZ3 A;  2VOT A;  1OD3 A;  4QDR A;  3T08 A;  3SEP A;  2V72 A;  1W9T A;  3FL7 A;  2X05 A;  1WKY A;  2ZXQ A;  2VL4 A;  3CDZ B;  2QBX A;  2VQT A;  4PT6 A;  3A21 A;  2VTF A;  1JU3 A;  4BK4 A;  3K46 A;  4TTG A;  4ARX A;  3T0A A;  2WO3 A;  1XC6 A;  2ZEZ A;  5C70 A;  2VZV A;  1UMH A;  4JKM A;  4OMD A;  2BER A;  3C7H A;  2JE8 A;  4GWI A;  1JHJ A;  1K3I A;  2Y8K A;  1IQD C;  3T0B A;  4LKS A;  2BZD A;  5JUV A;  1GMM A;  4D8M A;  4DEV A;  2E31 A;  1JYW A;  1GOH A;  1LNS A;  3C8X A;  1UX7 A;  3T0D A;  2WAO A;  2W9X A;  3CZU A;  2WYS A;  2XQX A;  1OH4 A;  1UXX X;  3ACG A;  1UZ0 A;  1MPX A;  4OZO A;  4FI9 A;  5F7U A;  1OT5 A;  2R7E B;  3K4A A;  3UES A;  4A42 A;  3HPN A;  4CU9 A;  1W9W A;  3WEZ A;  2J1E A;  3VD3 A;  3EYP A;  1UY4 A;  3HNY M;  4CU8 A;  1DLC A;  4JKL A;  4M4R A;  1GNY A;  3SKV A;  3W5N A;  3A7Q A;  4HG6 B;  2QQK A;  3HEI A;  3CZJ A;  3I3B A;  4BJ0 A;  2WO2 A;  3MUY 1;  3I2J A;  2Y6L A;  3WNO A;  4PF1 A;  4RN5 A;  4QX3 A;  3LE0 A;  4P08 A;  5LA2 A;  2C4X A;  4DUX A;  1L7R A;  3C7O A;  4MOA A;  1JI6 A;  2XON A;  5IFP A;  2ID4 A;  3IAP A;  2J1V A;  2PQS A;  3GGL A;  2HLE A;  2WDB A;  3NQH A;  1SDD B;  2W95 A;  4DXS A;  4UI9 L;  2ORZ A;  4CUC A;  1CZV A;  1JZ6 A;  2B9V A;  4LHS A;  2JKX A;  2QQL A;  3IDA A;  4BK5 A;  4QDS A;  3THC A;  4QB2 A;  2LW8 A;  3GXU A;  2DCK A;  3WF0 A;  3WNN A;  2Y64 A;  3FN9 A;  4UAP A;  2W5F A;  4QX2 A;  2WQ8 A;  3CKH A;  1KGY A;  1O8S A;  3VD7 A;  4D0Q A;  1W8N A;  1NKG A;  5DPN A;  1L7Q A;  1J83 A;  3MV0 1;  3BN6 A;  3NRU A;  2Y6K A;  2ZEW A;  1PMH X;  2VZ1 A;  3HOB A;  1DP0 A;  4LPL A;  2C26 A;  2ZEY A;  1XNT A;  4XZU G;  5G04 L;  4UOJ A;  5EIY B;  3I2H A;  4XUT A;  4CUB A;  2VCA A;  4XUQ A;  1ULO A;  2VR4 A;  3IB3 A;  4W4Z A;  4DEQ A;  4P5Y A;  3T2Q A;  3WNK A;  3F2Z A;  3I97 A;  3J7H A;  1ULP A;  1TG7 A;  2WAB A;  2WBK A;  2W1S A;  4IUG A;  3C7F A;  3I3D A;  3T2O A;  5DQ0 A;  1UY1 A;  3OGS A;  1W9S A;  4A44 A;  4W8J A;  2VMD A;  2Y6G A;  5EJ1 B;  4ZZ8 A;  4GZ9 A;  5C7G A;  3ACH A;  1JU4 A;  2VM9 A;  2ORX A;  1US3 A;  1JZ3 A;  2W1W A;  2J1S A;  3OGR A;  1UY3 A;  1PX4 A;  2WO1 A;  2W87 A;  1CIY A;  2WUH A;  5JR2 A;  3U37 A;  1I5P A;  4QDQ A;  3DYP A;  1UYX A;  3UNP A;  3ECQ A;  1EUT A;  1YQ2 A;  2VJX A;  2CDP A;  2KD7 A;  3VD4 A;  3GDB A;  3FHQ A;  4MAD A;  4PQQ A;  4CU7 A;  4GWJ A;  2VZR A;  4QB1 A;  3MBW A;  3MO4 A;  4BDV B;  2W91 A;  1JZ5 A;  2E26 A;  1O8P A;  2VQU A;  1P8J A;  4A45 A;  3OGV A;  1JZ4 A;  3P6B A;  2JD9 A;  1NAE A;  3I2I A;  4DUW A;  1XPW A;  3ABZ A;  2X09 A;  1GUI A;  4W50 A;  3WNM A;  1W0N A;  3T09 A;  5IYY A;  3ACF A;  1UY0 A;  1T2X A;  2WAA A;  1PX3 A;  2VZP A;  3E1F 1;  1JYX A;  1UMI A;  3K4D A;  4A3Z A;  4DXR A;  3CQO A;  3PUI A;  5FUI A;  3DYM A;  1JZ7 A;  2HYX A;  5IFT A;  4P00 B;  4QX0 A;  2RVA A;  4QPW A;  2W3J A;  2Y6H A;  4CVU A;  2BGO A;  5HPO A;  3NJX A;  4P02 B;  2VO5 A;  4RYD A;  2J1U A;  4JHZ A;  5JXG A;  3III A;  2QQN A;  3VDC A;  3HN3 A;  3LPG A;  1W99 A;  1TVG A;  2X10 A;  3VD5 A;  4QB6 A;  3LPF A;  2OKX A;  4XUO A;  1GQP A;  3ACI A;  3VD9 A;  2B4K A;  3MV1 1;  2VME A;  1NX9 A;  2VMF A;  2J1A A;  4YPJ A;  4ZY9 A;  3HJR A;  1JYV A;  3DEC A;  3VDB A;  3W5M A;  5IHR A;  3OEB A;  2E32 A;  4A6O A;  1UYY A;  3HNM A;  3LEK A;  4ARY A;  5HXM A;  2Z4F A;  2YC4 A;  4Z2A A;  4BXS V;  2EIC A;  1F4A A;  2DDU A;  3LQC A;  1JZ8 A;  2JDA A;  5LCW L;  1O59 A;  2L9L A;  4OUE A;  1UYZ A;  3WSO A;  3LEG A;  3ZM8 A;  2W94 A;  1UWW A;  2VZO A;  1D7P M;  2EIB A;  3I2K A;  2J1T A;  2YB7 A;  1GU3 A;  3WF3 A;  5JXJ A;  2VZU A;  2V5D A;  2WZE A;  4DUV A;  4M4P A;  1JYN A;  2DCJ A;  5JXI A;  3I2F A;  1KEX A;  5EJZ B;  5G05 L;  2VCB A;  2W92 A;  3OEA A;  3WF1 A;  5DMY A;  2BGP A;  1CZT A;  3C7G A;  1K12 A;  1UXZ A;  4OMC A;  2J1R A;  4CU6 A;  3WNP A;  3P1I A;  4KI5 M;  3OBA A;  1UY2 A;  4MGQ A;  2EIE A;  2C9K A;  1R64 A;  2J7M A;  3WF2 A;  3K77 A;  5B4N A;  1RYY A;  4LQR A;  2J22 A;  4XUR A;  2RV9 A;  3LEI A;  1BHG A;  4ZXE A;  3BGA A;  3C7E A;  3FHA A;  1J84 A;  1WCQ A;  3VDA A;  4AG4 A;  2YC2 A;  4MO3 M;  2QQO A;  3A23 A;  3THD A;  3AC0 A;  1XNA A;  4TXW A;  1GOF A;  5CZK A;  1CX1 A;  3HNB M;  4OYU A;  4MGS A;  1JZ2 A;  5JMO A;  3SEE A;  2WN2 A;  3NJV A;  3CMG A;  3IAQ A;  2BBA A;  3EB7 A;  2VZQ A;  2VC9 A;  2XOM A;  3GM8 A;  1W8O A;  3DYO A;  2W1U A;  4XUN A;  1PMJ X;  4DXT A;  2RJ2 A;  5I0D A;  2W47 A;  2WZ8 A;  3OB8 A;  4E8D A;  3I2G A;  4A41 A;  2V4V A;  4QAW A;  3K4Z A;  4A4A A;  2YFZ A;  5IJR A;  2VCC A;  5J1X A;  5LA1 A;  4AAX A;  3D3A A;  2QQM A;  4QX1 A;  3WF4 A;  3A22 A;  1US2 A;  1F4H A;  2WN3 A;  1OF4 A;  4JX0 A;  5JXH A;  2EID A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...