2W1SA

Unique ligand binding specificity of a family 32 carbohydrate-binding module from the mu toxin produced by clostridium perfringens
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
139
structure length
139
Chain Sequence
NPSLIRSESWQVYEGNEANLLDGDDNTGVWYKTLNGDTSLAGEFIGLDLGKEIKLDGIRFVIGKNGGGSSDKWNKFKLEYSLDNESWTTIKEYDKTGAPAGKDVIEESFETPISAKYIRLTNMENINKWLTFSEFAIVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title N-Acetylglucosamine Recognition by a Family 32 Carbohydrate-Binding Module from Clostridium Perfringens Nagh.
pubmed doi rcsb
source organism Clostridium perfringens
molecule tags Hydrolase
molecule keywords HYALURONOGLUCOSAMINIDASE
total genus 35
structure length 139
sequence length 139
chains with identical sequence B
ec nomenclature ec 3.2.1.35: Hyaluronoglucosaminidase.
pdb deposition date 2008-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2w1sA00
5G05L 1GOHA 1ULPA 1PMHX 1SG3A 4CU9A 4LPLA 3VD3A 2ID4A 4ZZ5A 1JYNA 2ORXA 3MV01 2X09A 2WZ8A 1GMMA 3T08A 3WSOA 2Y6LA 5EIYB 2QQIA 4W8JA 2RJ2A 1WCQA 4GWIA 3ACGA 3A21A 2Z4FA 3A23A 4MGSA 1JHJA 2W91A 3HNYM 4DUWA 2V72A 2W92A 3NNGA 5JXIA 3ZM8A 2VCCA 3I2KA 5JXGA 5A1AA 2QBXA 1DP0A 4UAPA 3C7OA 3LEGA 3BGAA 3HJRA 1UYYA 1JZ8A 2VMEA 3T2PA 3WNLA 3DYMA 3MO4A 2W9XA 5DPNA 3W5MA 4OZOA 4JKLA 3CMGA 2BGOA 3C7HA 3THCA 3IAQA 1KEXA 2V4VA 2E26A 1GOGA 3DYPA 5HXMA 4RN5A 1NKGA 1MPXA 4A6OA 1GOFA 3HPNA 5CZKA 1UY4A 1W9TA 5LA2A 1US2A 1OT5A 3SKVA 4BXSV 1UY0A 2X10A 2QQKA 2WUHA 3OEAA 1UY2A 3K75B 1W8OA 4L0PA 1CZTA 3J7HA 5JUVA 3K46A 1RYYA 2EIDA 1UYZA 2R7EB 3HNBM 2VZRA 1HN1A 2YB7A 3OG2A 2VZOA 1O8PA 4QX2A 3I3DA 4QPWA 2VZ1A 1ULOA 5B4XA 3P1IA 1GUIA 3K4DA 2W95A 1WKYA 4OMCA 5JMOA 1NUKA 3GXUA 4E8DA 1JYWA 3FHQA 2VCBA 2VTFA 1US3A 4XURA 3LPGA 2J1VA 1JU4A 2WO3A 3LPFA 2VOTA 1CIYA 1DYOA 3I3EA 2VZPA 3DYOA 4A4AA 2C4XA 2W47A 3NJXA 2QQLA 2ZEXA 1PX3A 2JKXA 3GGLA 2VCAA 1CZSA 3VD9A 1XPWA 2WAAA 1GNYA 2WO1A 4IUGA 1TVGA 2E32A 2W5FA 4QDSA 3SEPA 2RV9A 4P02B 1W8NA 1DLCA 3WNPA 1K45A 2XHNA 4KWUA 2W46A 2W1QA 3C7GA 2VQUA 2ZEZA 1H6YA 1W99A 1UXXX 2OKXA 4XUTA 5IFTA 4A3ZA 3IIIA 3I2IA 3ECQA 3HN3A 3K77A 3LQCA 2DCKA 5HPOA 3OGRA 4QX1A 4JKMA 3HOBA 2VM9A 2CDOA 4PQQA 3EB7A 2WDBA 2QQMA 2B9VA 3T2OA 2XONA 4D0QA 4W50A 4TXWA 1R64A 2ZEWA 4DXSA 4UOJA 5B4NA 3I97A 3OBAA 3VD7A 5IHRA 3IDAA 2BERA 2WZEA 4E8CA 4BJ0A 1JZ7A 1K12A 5C71A 1XC6A 1L7QA 3OGVA 2J1AA 4DUVA 3U37A 5FUIA 2VR4A 2J1EA 3VD4A 2LS6A 5JXJA 4MGQA 3ACFA 3C8XA 3BN6A 1CZVA 4Z2AA 1TG7A 1T2XA 3WF2A 2YG0A 2JD9A 3I2JA 2BZDA 3SEEA 3NRUA 4CUAA 3AC0A 3THDA 4A41A 1O59A 3T09A 3PUHA 2YC2A 4ZY9A 1JZ3A 3UESA 2HLEA 3CZUA 5G04L 3I2FA 1W9SA 4ZXEA 2C26A 2VC9A 4QAWA 2VZVA 1XNTA 1JZ5A 2WBKA 3WNOA 2XOMA 4KMQA 2QQNA 1JZ4A 1CX1A 2J1RA 3A7QA 1UYXA 3VD5A 3K4AA 3GM8A 2VMCA 1UX7A 2QQJA 5EJ1B 4DUXA 3UETA 3OGSA 4CUCA 1GQPA 3WQBA 3D3AA 1UY1A 2WQ8A 2W3JA 4XVHA 4LHSA 3ABZA 1P8JA 5JR2A 4DEVA 2B4KA 4CU7A 1OF3A 1OF4A 2J22A 2DCJA 1J84A 1LNSA 5LA1A 4XZUG 3WF3A 2VO5A 3T0DA 4ARXA 1EUTA 4FI9A 2EIEA 2VQTA 5IJRA 3WNKA 4CVUA 2L9LA 1NX9A 4MADA 4MOAA 1OH4A 3DECA 2HYXA 2ORZA 3OEBA 2J1TA 4QB1A 4M4RA 1KGYA 2Y6JA 3VDBA 4XUNA 4OUEA 5IFPA 3C7EA 4QDRA 3LEIA 3WF1A 1K3IA 1K42A 1UXZA 3I2HA 3T0BA 1SDDB 2YC4A 3FL7A 4P5YA 4MO3M 1XNAA 4P08A 2EICA 2X05A 1UMIA 4QX0A 4YPJA 3WF0A 2WYSA 4JKKA 1YQ2A 4GWJA 4DXTA 3W5NA 4D8MA 2WABA 2JDAA 1J83A 4XUQA 1PMJX 4XUOA 1JYXA 2YFUA 2Y8KA 1O8SA 3WNMA 3UNPA 3T0AA 4DXRA 2W87A 3WF4A 1JZ6A 4QX3A 2ZEYA 4ARYA 2BBAA 1IQDC 3CKHA 4JHZA 2DDUA 1PX4A 4A45A 1BHGA 3HNMA 3EYPA 3E1F1 1D7PM 2QQOA 2JE8A 2LW8A 5CYYA 2VZUA 1UY3A 3SKJE 4OYUA 3LEKA 2E31A 3CIHA 2Y6KA 3FN9A 3I2GA 2WO2A 4LQRA 5C70A 3ACIA 4ET7A 5DMYA 5J1XA 2EIBA 2Y6GA 1OD3A 4BK4A 4KI5M 3MUY1 4TTGA 1W0NA 3HEIA 1SHWB 5LA0A 2VZ3A 1L7RA 2Y6HA 2KD7A 2VZQA 1H6XA 5F7UA 3VDCA 3NQHA 4W4ZA 2C9KA 2VMDA 2J1SA 1EUUA 2YFZA 4JX0A 2J7MA 2WAOA 1F4AA 2VMFA 5LCWL 3MUZ1 2W94A 3GDBA 2W1SA 4RYDA 3OB8A 2ZXQA 3MBWA 2PQSA 2WN3A 2CDPA 1I5PA 2WN2A 3CZJA 4HG6B 3F2ZA 4A44A 4ZZ8A 1JI6A 3A22A 3FHAA 4QB6A 4PF1A 1JZ2A 3I3BA 1UMHA 4M4PA 1JYVA 2VZTA 5JXHA 4QB2A 4XUPA 3JXSA 4LKSA 3WEZA 5DN2A 3ACHA 2VL4A 1JU3A 3VDAA 4AAXA 3MV11 1F4HA 1UWWA 4CU8A 4CUBA 3CQOA 3K4ZA 2Y64A 2W1UA 4PT6A 2VZSA 4BK5A 4QDQA 5C7GA 2J1UA 2V5DA 4OMDA 1GU3A 4AG4A 2XQXA 3IB3A 4BDVB 1W9WA 2BGPA 2VJXA 5I0DA 3NJVA 5EJZB 3IAPA 3T2QA 4UI9L 3ETPA 5DQ0A 3LE0A 4A42A 3P6BA 4P00B 1UZ0A 2W1WA 5IYYA 2RVAA 3PUIA 4CU6A 3WNNA 4GZ9A 3C7FA 1NAEA 4DEQA 2E33A 3CDZB
chains in the Genus database with same CATH superfamily
4V1PA 1LOGA 5G05L 2RHPA 4LBNA 2GC1A 2XLFA 1YHFA 3N9LA 3RPQA 3AZXA 5A7NA 2UURA 1J3RA 2B42B 3SH4A 3MV01 4XJWA 5F3GA 4CDXA 2ES3A 2PA7A 3RWNA 2PHRA 2HH9A 1LEMA 3T08A 1AYN2 3WSOA 5T5OA 4URAA 2UY8A 1J59A 1YC61 4FAGA 1WW6A 2LRPA 3S30A 1COV1 1IS3A 4FFHA 1C8M2 1QU0A 1CX4A 4YM3A 1YCIA 4XDQA 4W8JA 3CJIC 3AVRA 3GALA 5H9RA 4GWIA 4QQPA 4TSVA 2DUOA 1FT9A 2BNOA 3OTFA 2A3YA 1PZ7A 3PL0A 1EP0A 4XF1A 1DQ0A 4R9CA 5J37A 4UFJA 2GSYA 2V72A 1K5MC 1PMIA 3J7LA 1XYPA 3LB9A 4YZ5A 1CAUA 1AUYA 3FE5A 5F39A 2O14A 5C3RA 2H0VA 2R071 1LU1A 2ENRA 3HVDA 3M3CA 3ZMNA 1AXZA 4B4PA 5ACA2 2XQRA 1SFNA 4LBQB 3U78A 4AEDA 5FDBA 4UAPA 5FJKA 1AR93 4XF9A 2VMIA 1W2NA 1XNBA 2X53S 1LEDA 1Q8QA 4QM9A 5FZAA 2VMEA 2YPJA 4NIGA 3CLPA 1Y43B 3T2PA 5EZWA 5JPNB 3UGGA 1DGLA 2P6CA 1DU3D 2G9GA 2W9XA 3VBHB 2IUWA 4Q1PA 4CZSA 4JKLA 1HXS1 3CMGA 4N43C 3TWIA 4AQ6A 5L9RA 2UYAA 4Y1XA 2K46A 3THCA 2V4VA 1GWLA 5FXWA 2P2KA 2WS91 3CU7A 3JZVA 1X8EA 3QH6A 4FPGA 4K1ZA 3KZ4C 2C24A 2YMZA 1PM7A 3BODA 4Z1VA 1R1A2 1DFQA 2RR12 4RN5A 3CJIA 1JUIA 1BXHA 1NQJA 2FHRA 2X29A 5FZGA 4E2SA 3AFKA 4XJAA 1C1LA 1VP6A 1W6MA 3J4UH 3Q9OA 5J7MA 1SLCA 3IIAA 4JGZC 4YFZA 3WQ0A 1CPMA 1V6MA 2X8KA 5LA2A 4PBPA 4ZU7A 1FNZA 3KS7A 1VRH3 4Q0UA 4XCBA 5FWEA 3KV6A 2XWJB 1AR63 4UFIA 1RUH3 2EIDA 3OUHA 4ORFA 2R7EB 5IVCA 1BYHA 2J42A 2EVXA 1WUVA 3ME2A 1O8PA 4MXVA 5A3TA 1VALA 4NHMA 4Y1UA 5D8AB 1YQ5A 4NE9A 4QX2A 1GWMA 1Q56A 1W03A 3P1IA 4G4FA 1N1YA 4NMIA 4QQOA 5JSOA 1WLCA 1GUIA 4HPKB 3ZIXA 1RUF1 2GP5A 3O0WA 1AXYA 3ZIWA 1AR91 3FMGA 3IKWA 2E7AA 3RQ0A 1BK0A 3THTA 5GZCA 1L7LA 2VTFA 2VCBA 3IMMA 1N1VA 1AYM3 4Q0VA 4XURA 1RUOA 3ELNA 4BYYA 4IW3A 3H42B 4YM0A 1RJ8A 3O1MA 2B8MA 3AX4A 1TMF1 4DZGA 2RS31 2D6OX 1DGRA 2W68A 4Q4Y1 1IPJA 2F17A 2YPDA 2ZGTA 2JB4A 2RS53 2JE7A 2GH8A 3I3EA 4NUBA 2VUCA 1C1FA 2ZACA 1UW8A 2W47A 2WNVA 3USSA 1POV0 3D5OA 2QTWB 4FPKA 5SV8A 4Q26A 1ZZ9A 3AK0A 1QQP3 3H0OA 5FZMA 1RUJ2 4Y4YA 1SLIA 3ORJA 4P9WA 4WVZA 2VH9A 1VB2A 5EXOA 3FX3A 5FPAA 4BIFA 1GNYA 2VECA 4IEPA 1TVGA 1VBB3 2W5FA 4WM8A 1S0CA 2CYFA 2ET7A 2RV9A 3LIHA 4K8RB 4RR3C 4Y5Z0 3E6BA 3RSJA 3MIEA 1HRI3 4XDOA 3EMRA 3IPVA 2QQUA 2ETEA 5B2GB 1ZBE3 4J1XA 1KFXL 3C7GA 4G3YC 3VBHA 4CA9A 2ZEZA 3Q8BA 4I02A 1H6YA 2G1MA 1W99A 3BU7A 5GLWA 4PDWB 2OKXA 2HWC1 4A3ZA 1DZRA 3IIIA 4IESA 1STMA 2Y34A 2DCKA 4GALA 4IQPA 4FPJA 2VUDA 2QQPA 4JKMA 1WMXA 1IG3A 2VM9A 3ZXGA 2Z5WA 1UU5A 3ZYJB 5FZOA 2QQMA 2B9VA 3NNFA 2XONA 2MNGA 4WVWA 4Y5SA 1QJU3 4Y22B 2IXHA 4UFLA 4BPZA 4E4ZA 1RB8G 4GWNA 4TXWA 1R64A 5FY0A 1SACA 3DPRC 4EV0A 1NCQA 1XYOA 4IXLA 4PIXA 4GB31 2ZS6B 1HN0A 3ILNA 2R042 1O7FA 1RXFA 1CAWB 4AFMA 4FPOB 3LGRA 1U5YA 5FZ3A 4FXGB 4YVSB 4AQ2A 1ZNPA 3ITQA 2HWD1 1D4M3 1YNAA 4AHWA 1DQ5A 1K5JA 5C71A 4JDNA 2J1AA 3RFRA 4DUVA 4DOUA 5FUIA 2WZR2 1RIRA 3ZDSA 5F8PA 1BZWA 1FV2A 4H14A 2FZ1A 3ZN6A 2RR13 4LXLA 4N90A 4AE2A 4FCAA 3WT3A 4A2UA 4YVWA 5FAXA 4DQAA 4Z2AA 5FYBA 3WDTA 1RUE3 1AL23 3PUAA 4Q4W1 5A7WA 5A7PA 1XRUA 1VAMA 2RS32 2XWBB 1QXJA 4Q4Y2 1W90A 1LJ7A 4LE4A 2E53A 2JD9A 2JICA 1D2SA 1GZTA 4Q4V1 4YVSC 1RMU3 4R9DA 3ZR5A 5C9AA 1Q3EA 2A1XA 3THDA 2EIGA 4A41A 4EN9B 4NRQA 2ZA9A 1KQRA 1SZBA 4AW7A 2Y60A 4AVVA 1RUC3 4LITA 4Z82A 1JZ3A 2ZAHA 3UESA 3CZUA 3I2FA 1W9SA 3U11A 1UPSA 3P3PA 3VKLA 1Y9GA 5DDJ2 2D93A 5CIRA 3SLIA 3BPZA 2WBKA 3AKRA 4WM8B 1AR82 2PAKA 4XCAA 5IVEA 5FZHA 1XNCA 1TEIA 2QQNA 2XJSA 1JZ4A 1APNA 4AEKA 1Z78A 2H6CA 4K1YA 4RR3A 2OX0A 1QQP2 3PMSA 3M7AA 5T5JA 2VMCA 5HBAA 5F3IA 4CCJA 4C91A 5JOYA 1SPPA 2VMHA 4N8MA 4LHNA 5ACA1 2AZ5A 2VUJA 3U14A 4PLNA 1QIQA 2VOVA 2BFUL 1JMUB 4HK8A 1VPHA 3TNPB 2O1QA 2HWD3 2Q4SA 5FZEA 3KV4A 4L9BA 3WQBA 3D3AA 1TNFA 5DZFA 1R091 4CE8A 4HSLA 1RXGA 2WQ8A 1KD7A 3VZMA 1HDKA 4LHSA 4HONA 1VRBA 4NPMA 4YW5A 5FZDA 3I4IA 2WO7A 2BUKA 1FOD2 2XJTA 4V2VA 2ZMLA 5FP4A 3Q8CA 5H9QA 4XIOA 1P8JA 5JR2A 1WW4A 1W8WA 1WA4A 4HVRA 2DVAA 4QMAA 3VZKA 3WW3A 2B4KA 1DG6A 5I0TA 3WZ1A 1OF4A 2K0GA 3FWEA 4BB3A 1ODMA 3R4DB 3M8LA 5JSPA 3OD4A 1PGW2 4DRRA 2JEMA 2VTXJ 1J84A 3AMPA 5F2WA 4CDXB 2XVKA 4XZUG 1N3QA 4RA0A 4Q0QA 5FYMA 4CYDA 2WT0A 3O1UA 1C8M1 5IJRA 1G8WA 3CNAA 3W20A 2UWBA 3LSDA 3PDQA 3OEBA 5ACA3 4RR3B 2J1TA 2PFWA 5F6KA 3VBRC 4RQPB 4ZS2A 4AHXA 4L2NA 2XJUA 2WSUA 3I59B 3UGHA 4RGAA 1TE1B 1UU6A 2YU1A 2Q5TA 3C7EA 2DVGA 1YFWA 1G9FA 3DL3A 1LTEA 1YIPA 4CDUA 3ZYHA 4KH9A 2DU0A 4RGKA 4UYBA 1O4YA 2A3WA 1JODA 1FNYA 3FL7A 3THPA 1OSGA 1ZZ8A 1LGBA 5F1RA 1ENXA 1XNAA 1WCSA 4JQTA 3LDKA 3FZ3A 2JDMA 4QX0A 2WYSA 4BH9A 2NLRA 4UBGA 5GJ6A 1BK1A 1AYM2 3W5NA 4FOWA 2A71A 2WNVC 4IEQA 1G6NA 5JZGA 1R1ZA 1PMJX 1JYXA 1QJX2 4YLZA 1LECA 1V6OA 4OI1A 5E89A 3RMXA 4Y33A 3WNMA 3IN9A 4SLIA 4E4SA 1ZZ6A 1ENSA 1NE6A 4XAAA 2YU2A 3UNPA 3S5QA 2W87A 3MIDA 1QDCA 1GKBA 4M3CA 5DDJ3 5F9TA 3POBA 5C33A 4JGYC 4BM8A 1XE0A 4A7YA 1A8MA 1GYKA 1IQDC 3WOGA 1V0AA 1WMEA 1VBB1 4DY5A 3ZYGA 4COYA 5C5UA 3H8RA 1CPNA 4LBQA 4AEDB 4BQ4A 1GR3A 1IZ3A 1N47A 3ZFFA 3ZXLA 2JB8A 4JGYA 1REDA 4A45A 4D7SA 4JVAA 3HNMA 3L9JT 1OMIA 1QOTA 1YEWA 1DQ4A 2YY1A 1ENRA 2B7YA 2XB6C 1UOFA 3EYPA 3B9CA 5FZCA 5LY1A 2C1FA 1O3TA 3WR0A 5J48A 2FDIA 1D7PM 2RDRA 3ZFFC 1M06G 2JDPA 1JOJA 1H1IA 4NRMA 3MFAA 3ZMOA 5EPAA 3PVOA 1AR83 1QJZA 1POQA 2WFF3 2Y6FA 4OYUA 1XB9A 1GANA 3B94A 3EHKA 3O7OA 4IV1B 2OQ7A 1JTZX 3I2GA 4WM7A 3AB0A 1YI9A 2WO2A 5F2SA 2AACA 1YLLA 2XHKA 1MS4A 2JWPA 4MVTA 4U2AA 5DMYA 1NE4A 2PHFA 3FBYA 1KJRA 4YG0A 3I3MA 2FZ2A 3O0VA 4MXWB 5K4LA 3TN91 3AXDA 3CL1A 2RDSA 1IKPA 1VBE1 4DXZA 1RUD1 1JHNA 1CJPA 1FI2A 1H6XA 1LHVA 3Q8AA 1NOVA 2Z2SB 4ATFA 1NY72 4YWAA 1VBA3 3GZUC 1V00A 1W3VA 1RUE2 3BIEA 1UMZA 1DQ2A 4J6GA 5F3CA 2W94A 3MUZ1 1W6OB 4LMFA 3T1MA 4NROA 4ZU4A 3AMQA 4KWLA 3FLPA 4LLOA 3OB8A 5CA6A 3ZPYA 1PNGA 1C3HA 4G9SB 1O3SA 3RI9A 1IOAA 4EROA 3WW1A 2Q8OA 1GV9A 4XAEA 1IGOA 2XDVA 1UCXA 1ND3C 1QJU1 1HXS2 3F2ZA 3KT1A 4W6WA 5A6YA 4FT8A 4XQWA 1DGWA 5LRRA 2Q1MA 3PIGA 1FOD1 2RJLA 2WYFA 4QPGA 1CGPA 2ZX1A 3A22A 3FHAA 1W39A 3D6EA 3MW2A 4QB6A 3POWA 4LUKA 4WVVA 1JYVA 1VBD3 4I09A 5FPZA 1BEV1 3POGA 2VZTA 1ACCA 2NMOA 1IS6A 1D2QA 2KXLA 2XVLA 1IG0A 4XILA 4QU1A 4KBBA 1NQDA 3JXSA 3ES1A 1E5RA 2LROA 3M4FA 4QGLA 4PDWA 2A70A 3AP9A 5FP8A 4AAXA 1PNFA 4PI2A 1ASJ3 1D4M2 1UWWA 1VMJA 2KM2A 4AVCA 4L11A 3VL8A 3K4ZA 2Y64A 2W1UA 4RD7A 4RFT0 3R6SA 4BA6A 3BTYA 5C3SA 2FD8A 3KGZA 4BK5A 4H7LA 2ARCA 4R9BA 3ASIA 4K6BA 1RUH1 4KBZA 5LBEA 3SMHA 4CDQB 2D44A 2V5DA 4IEOA 2XQXA 3B9IA 4AVBA 4BDVB 5CKQA 4M0NA 1W9WA 1JYTA 4R8HA 5FK7A 2VJXA 4XJZA 3CJXA 4CCEA 1HRV2 1FATA 2TUNA 1LHWA 2RS33 4Q4Y3 4I0AA 1Q8PA 5DQ0A 1UOJA 4H55A 3T30A 1FOD3 1PZ8A 4XPVA 4EWEA 4MG2A 1BBT2 4LO4B 1Y3TA 3A0KA 3LFMA 4B3NA 4XYXA 3VZLA 3C7FA 4R9AA 5TSWA 3TBDA 2WA3A 2GC2A 2A75A 2E33A 4PF5A 1R082 2ZGKA 3CDZB 4E4DX 3RI8A 5CB7A 1JW6A 1RUG3 3QD6A 1W0OA 4WV8A 1ZZBA 2VVEA 4R52A 1KDKA 1PMHX 3PJQA 1YFYA 1HQLA 4OHZA 1XBFA 1ENQA 2YBSA 3ZOIA 2PMWB 3WUCA 2R063 3JB8A 5D8AC 2R32A 3SNMA 2X09A 3HT2A 3ZPOA 2WZ8A 4CXWA 2QVSB 4AFBA 4AI3A 1ZRCA 4PLOA 4K8FA 3UGFA 1IKQA 3R05A 5AVPA 4UFMA 2NP0A 4BCUA 5T3NA 2QQIA 2RG4A 1S4CA 5HV4A 2OA2A 3NAPB 3WG4A 2BOIA 3VDDA 3LSEA 4Y1YA 3PNAA 2NZ9A 1O91A 3FFQA 2ADEA 4LBMA 4MGSA 2W91A 3HNYM 1MS1A 2W92A 3CBNA 5C8CA 2CV6A 1COV3 1X33A 2RS12 3ZM8A 4B29A 3AL6A 4AI0A 5FPUA 2RE9A 2VCCA 1XOYA 4TZDA 5JXGA 1SPPB 4LIVA 3I2OA 1DP0A 2WZR1 5A7QA 5E1RA 1PM4A 3UKVA 1AR71 4AHYA 1UYYA 2MEV3 1ZRDA 5FV3A 1YRZA 1JZ8A 4JDOA 3H50A 2CGNA 3WNLA 1PGW1 4OLLA 4GB33 3DPRA 1ZM1A 1YWKA 3W58A 5C3OA 3OY8B 1WD3A 1W9FA 2JIJA 4Q1RA 1Y9MA 1FPN3 3RZMA 3PUQA 2FCTA 2ZJCA 1FYUA 2EALA 4JRAA 3DV8A 3AFGA 4RHV1 2PLV1 1GOGA 1W9YA 1XE7A 2P3JA 2FDJA 3AYEA 3DYPA 3M2MA 3ZN4A 4EWDA 1HXS3 3NJZA 4CUGA 4Q5OA 3S6PA 2W0XA 5KXEA 4IV3B 4EQVA 1DLLA 1UKRA 3HPNA 4KWJA 4B4QA 5A33A 4LTAA 1DBNA 1OVPA 5CZKA 4YW7A 2CGPA 1UY4A 1W9TA 2OXBA 5CAZA 2IFWA 3JD71 4QWNA 3USUB 4FPCA 3VUOA 4GA9A 4WM8C 1NCRA 3OPTA 2VULA 2WFF2 5A3MA 2O8QA 2DVBA 2WUHA 3SHRA 4OFGA 4PIZA 1W8OA 4L0PA 4QXKA 1CZTA 1H2NA 3B3QE 1XE8A 1AHSA 3J7HA 4N7IA 3RG0A 3HNBM 4K7JA 3SH5A 2VZOA 3FC0A 1URXA 2CWSA 2VQAA 4I3PA 3I59A 1J3QA 1YJLA 5L36A 4X8NA 5B4XA 4AVSA 4LR4A 5JIUA 1F9KA 1JS9A 5LBCA 1QJEA 1SLLA 2K2SA 3WDXA 3K3OA 3B02A 4Z8BA 2YC0A 5BNNC 3V0BB 5DXDA 4I2OA 2IXLA 2K9ZA 4IE7A 5CEHA 1EV13 5JMOA 1UF2C 4Z07A 1AR73 1AJKA 1O6UA 3GXUA 4E8DA 3PURA 3ZSKA 4FTSA 4C1XA 2VNOA 4CCLA 3DF0A 5FMDA 1JU4A 2FDFA 3N9OA 2NPIA 2WO3A 3KCXA 4ASKA 4AL9A 1N3PA 2DV9A 2XLAA 4B1MA 1CIYA 4FFIA 2ZGUA 3AMMA 3G7DA 4HMZA 1C8NA 5DUXA 4A4AA 2C4XA 4CDXC 3RRDA 3BALA 1H9PA 1F31A 1DQ6A 1OHFA 1RHI2 3TEWA 2UY9A 2P1BA 2JKXA 4UFHA 3GGLA 3ILFA 1H8TB 2Q8DA 4NIDA 1CZSA 4P9GA 4OZXA 1W06A 2WAAA 2WO1A 1PIV1 2E32A 4CPBA 4QDSA 1S0GA 3O1PA 1CJDA 2BFUS 3H3LA 1W8NA 1DLCA 2ILMA 4QHBA 3RWKX 3VBRB 4AK3A 2WS92 1V6IA 1HV1A 1BEV3 1IS5A 4NOTA 1K45A 5E6HA 3VBSB 3VHOA 4AGGA 1H1AA 1MS9A 2W46A 3AJZA 5EWSA 2VQUA 1JOBA 3NVCA 3O5SA 3EBRA 3RZLA 4YW1A 4BLIA 3B01A 1UO9A 4AGRA 3PTRB 2A3XA 4QX8A 4I0WB 3K77A 3LQCA 2JE9A 2R0FA 3LA2A 3RNSA 3ZO0B 4XQDA 1ASJ2 1U5IA 1V6KA 2UWCA 2VOXA 1GFF2 4IV1A 4MGKE 4Y5TA 5LY2A 1C5HA 1V70A 3KMHA 1IQAA 1VBE2 4UOJA 1CR7A 4YW6A 3MW4A 3VD7A 5B4NA 5IHRA 1GWKA 2BERA 2FMYA 2WZEA 3BYWA 3AKSA 4E8CA 5DABA 3D0JA 4AHZA 4W6XA 1QNYA 4BJ0A 4F83A 1K12A 2Z69A 4JGYB 1D0GA 5IVFA 1XC6A 1L7QA 1ASJ1 1W8FA 3OGVA 4MHUA 4QGMA 1PO21 1NG0A 2VR4A 2AC1A 5H9SA 2ERFA 2J1EA 3VD4A 4FO9A 1OBNA 1YYNA 3OF1A 3HR9A 3LF7A 5FYHA 4QQHA 4UF0B 1R1A3 3C8XA 1RUG2 3LA3A 3BN6A 1G7YA 4H2AA 3EJKA 4BLJA 5DUUA 1SFPA 4COUA 4IEXA 1BLZA 1TMF2 5IW0A 5CFCB 3URFA 2R062 4L99A 2EXJA 1POV3 1LOFC 1VBC1 2XBO2 2A6VA 3I2JA 3GZAA 3PJYA 3SEEA 1BJQA 3ZFEC 5JAXA 1W6NA 2GU9A 4A6SA 5BNOC 3T4VA 4UT5A 1DDLA 3PUHA 1WWYA 3AXEA 4YM2A 5FZKA 4BXFA 3MFCA 4QHZA 1QNWA 1S2BA 5A6XA 2AREA 3WG3A 4E4HA 4Q4V3 1MVEA 4QAWA 2VU9A 4C1WA 1W2TA 2VZVA 1PVC1 1W6PA 1JZ5A 2C0ZA 2GNBA 3CJIB 4HKOA 1MZ5A 2RS13 3U1XA 1Z7S1 1X7NA 4UW5A 2V09A 4GD4A 3VHRA 4CCMA 5FO9B 4KMQA 5JVVA 5FYCA 3VBSA 5KHKA 4HXCA 3VLBB 4GULA 2VBPA 1K5MB 3O1RA 1RHI3 1QJY3 3HD8B 4FVVA 1UX7A 2QQJA 2HWE2 2R1BA 5EJ1B 1HB3A 1GQGA 1NXD1 4D69A 2ET1A 2JKBA 2D6NA 2VOKA 3D0SA 3BB6A 4BOWA 1OPOA 3A0NA 4IL7A 4F8AA 1R093 5T52A 1UAIA 5BNNB 1GQPA 1YIFA 3GJBA 3VN4A 2PN5A 2PHXA 4YGEA 5BNPC 4BQ3A 4IEVA 3RZKA 2W3JA 3GF6A 3SH3A 5IT6A 1G9DA 4LKDA 1UL9A 5H9PA 4O9GA 5BUVA 5FK8A 2E7TA 3FUQA 4LO8A 1I1EA 1TME2 1NA1C 1O4ZA 4AWDA 4DEVA 1ALYA 4YNIA 2HWB3 1MZEA 3TYJA 4FAHA 1F8VA 4CU7A 3CHXA 2OT7A 2BP6A 1PO13 1H2KA 3VZJA 2DCJA 5IK5A 1MS0A 2WNEA 4JC1A 5GLZA 5LA1A 2P6HA 5IVVA 2EAAA 4FPEA 2RM22 4CEWA 1WBLA 2P4EA 1IS4A 3N7JA 1CD3G 4X8PA 1UNBA 2LTNA 4UF0A 3RYRA 1G9AA 5BNPB 1BMV1 1KS4A 1LHUA 2AUYA 2HYXA 5T55A 1MEC3 4Y24A 1OD5A 1ULGA 5FLHA 4BIOA 1Z7S3 1RUI1 2Y6JA 1W8TA 4XUNA 4OUEA 1ND3A 1NA1B 3WDVA 3HQRA 4JTOA 3LEIA 5JZGB 1K3IA 3KLSA 4BE3A 1UXZA 2PELA 4NAOA 1SDDB 1QQP1 2HWF3 3AM2A 4HT1T 2V73A 4Q2FA 5FFOC 3PLQA 1DZQA 1FX5A 2ZMKA 2MHFA 2R043 4MO3M 4I30A 1AR72 3KWVA 4BQ1A 1PK6C 2FCVA 4LULA 2EICA 1HLCA 2ARXA 4NHLA 3WF0A 5KHJA 1W6NB 2HEVF 5A6ZA 3G6JB 1UPIA 1YQ2A 3SCGA 1RUNA 1ZBA3 2XH6A 3PVNA 4QQLA 4OHVA 2XR4A 3DXUA 4N53A 5GM0A 4XUQA 2WT1A 1ULDA 3IDEA 3R4UA 4XQ4A 4BQ5A 5CADA 4YYOA 3N9QA 5I0SA 2HWC3 3VHPA 3GZEA 5A32A 1J3PA 2P5BA 4IEWA 1PO22 5C8WA 2VBDA 2QZ2A 4Q4V2 5FUNA 5HCAA 5FZ4A 3F95A 4E2QA 1CESA 4QX3A 4LKEA 2ZEYA 3HN1A 4BWOA 1MQTA 4AVTA 4LBQD 5ERLA 5K0UA 1AX0A 2GN3A 3OUIA 2IXIA 5ISLA 1HQNA 1UZWA 3MW3A 1V6JA 5D2AA 3EQEA 4YW3A 3MIGA 4FOYA 1PX4A 1U5ZA 2VG9A 3ZXDA 1S2KA 4W6YA 5HCFA 1S2EA 4LO7A 1BHGA 5FO7B 1GP5A 4LKFA 1AVBA 1RINA 1C5IA 3UV9A 2XPJA 1GNZA 3WINE 3W9AA 1W05A 3ZFGB 3VBSC 2QQOA 2YUEA 2LW8A 4UFKA 4YRDA 2VZUA 3ON7A 5C4WA 3LEKA 3DCQA 1NCRB 2E31A 4Y22A 2YHJA 2EA7A 2GP3A 4KU8A 1G9BA 1VR3A 4ZXKA 4CP9A 5EV7A 3BTAA 3J8F2 1BMV2 2RMU1 3ZKUA 4ZS3A 5IAVA 3MPBA 4P9JA 5KWRA 3VKMA 5ANNA 2R0HA 2Y6GA 4KI5M 4Q4W3 4CCCA 1J1TA 1R092 1ND2C 3WV6A 3ILRA 1SHWB 2BDRA 2PLV2 3FFZA 3K48A 4RS5B 2HEWF 1C28A 5F5CA 4B7EA 5LZ6A 1SBDA 1HX6A 3HQXA 3VBUB 5E16A 5KHIA 1PHMA 1RMU1 2WNUA 4N7UA 2KD7A 3WDUA 2CGOA 2AEYA 2VZQA 3H3ZA 2IXCA 5F7UA 2BNMA 3ZDVA 5FYZA 4W4ZA 4L97A 2NM1A 2J1SA 2VMDA 3NV2A 1TME3 3NV1A 2R30A 5FZBA 5FXZA 2HBUA 3OGGA 1OA2A 3DKWA 2FQPA 2ZZQA 3N36A 2WS93 4JX0A 2YBKA 1XNDA 2WSVA 3M70A 1PIV2 5JI9A 2UU8A 5LCWL 3GDBA 1V9U3 1G86A 2ZHLA 4LBKA 4RYDA 4NPRA 4TWTA 5FP3A 5C9AB 3H3UA 3QH7A 4AXOA 2ZXQA 4XW3A 3MBWA 5FY7A 5GALA 3O0XA 3B5LB 2ARAA 2WN2A 1EAH3 3ZXEA 2VQ0A 4URTA 1JI6A 3INAA 3JBG3 3O12A 5FOBB 1LENA 5DZEA 5SV5A 4OQ9A 5CU1A 1ZBA2 3VKNA 1NZIA 1SLAA 3E6CC 3AP6A 3ZR6A 3AYAA 5E8AA 1RUE1 4HVOA 4LNVA 1GZ9A 1OUSA 4QB2A 4LBJA 5FP7A 4NHKA 1AL0G 1S0BA 4XEZA 5DAVA 1PGSA 5LK5A 1JU3A 4RS5A 1FXZA 2WINB 1ODNA 3GBFA 3BKZA 3D4KA 2DUQA 1H8TA 1XYNA 2WNUB 3CQOA 1KS5A 1NZCA 1OQEA 2E9QA 1YFUA 3S7EA 5A7OA 2DWRA 5L9BA 1EV11 1LKNA 4QDQA 1E5HA 3NV3A 3WCRA 4XIKA 3TEXA 5L19A 5FZ1A 5C4WB 3IDCB 2TBVA 5EYYA 1GU3A 3RZJA 5CKMA 4YGCA 5FXXA 5LRSA 1HRI1 2WA4A 2P3IA 1QOSA 3MZHA 5FR3A 2HWC2 3ZFGA 5I0DA 5FZLA 4COZA 5L73A 1TMF3 3T2QA 1AF9A 5C5TA 3AYDA 4XFCA 2FBEA 1DIWA 2ZX3A 1J1LA 3LE0A 4BMEA 2VMGA 4IGQA 3P6BA 4DINB 2JD4A 1UZ0A 3OYWB 5IYYA 5AFBA 2RVAA 4XFAA 4GZ9A 5A3NA 1QEXA 3RVHA 3DEMA 5EQUA 4DEQA 3MIHA 2WC2A 3ZYBA 2RDNA 1U0AA 3V64A 4WZCA 1RJ7A 4CU9A 5FREA 5GLTA 4LPLA 4MH0E 3UKNA 3DUIA 1GZWA 1JYNA 4LA3A 2ORXA 3AKPA 2ZKLA 4FSJA 2P37A 1QMJA 4P9IA 4XBNA 1GMMA 2CNAA 1S1AA 1FAYA 1LAJA 2XMLA 4HBNA 2FDKA 4S2FA 2R16A 3BTXA 1Y9QA 2RS52 4M3CB 5AFEA 1MR5A 2YXSA 5EIYB 4XHXA 2RJ2A 3BIWE 1WW7A 4UWDA 2HWE3 3SITA 2VW2A 5C8CC 1H8VA 5ABJA 4OHWA 2W52A 1OLQA 3KM5A 3A23A 2Z4FA 2X5IC 4JGZA 4Y20B 1JHJA 4OUSA 2C6SA 4B1LA 1GP4A 4PCRA 5K0UC 4P9LA 5CFCA 1NCRC 3NO8A 3OY8A 1F15A 2Q1ZB 5A1AA 3QLQA 1LOAA 2JG8A 2QBXA 5JIAA 4D6RA 1ZBE2 2XLGA 5LB6A 5KBFA 4CXYA 3MF6A 5FYIA 3BPSA 4CP0A 3U4XA 3BGAA 2OPKA 2P17A 1WW5A 2HYKA 2VCMA 1A78A 5D1IA 2OW4A 1REFA 5LEJA 1XU1A 2WQ4A 5FQ0B 3AP7A 5KXDA 2IZWA 3NWKA 3MO4A 2D5HA 4LOTA 3POJA 2R061 4OZOA 1QJFA 5T50A 3C7HA 3QBQA 4F7ZA 2C5DA 1KEXA 3KV9A 1PK6A 2LALA 2OZJA 2E26A 5EFUA 3VKOA 2DCZA 3MICA 5GKAC 1SBEA 4QGNA 1KJLA 1W6PB 5HXMA 1PGL2 2ZGNA 2PQQA 1QXRA 2B5HA 1GOFA 2H6BA 1XQNA 2JG9C 5FY4A 3TEZA 1Z7S2 2XJPA 2Q1FA 2ZGMA 5C3QA 4X6RB 5JOWA 5CG9A 3LWCA 2JECA 1KDMA 4HANA 4IERA 1UY0A 4BXSV 1OA3A 5I91A 1NLQA 2F4LA 2HWE1 2QQKA 3OEAA 4DRVA 4AFCA 2JDYA 4L8QA 2Y33A 2BV4A 1QH6A 4QXHA 5JUVA 2GC0A 3K46A 1O4TA 3A4UA 1N3OA 5F37A 1HN1A 3KV5A 3ZYIB 4JAAA 1PGL1 1GZWB 1VBC2 2XBO1 1FV3A 3ZN6B 3HIFA 4Q27A 4QPWA 4BISA 5FQ0A 5T54A 1I6XA 1AR62 2EXKA 4YFWA 4L92A 2PLV3 2W95A 4LBOA 2B9UA 3OD0A 1Q5OA 1X82A 1OXCA 3AJYA 3AZVA 2XL9A 2XL7A 3E97A 2VUAA 3J9SA 1VAVA 3EXUA 1ND2B 3L2YA 1KFUL 4HFSA 1W04A 2WWUA 3NL1A 4C0BA 1SEFA 5JSRA 1US3A 3FHQA 2JJ6A 3GZTB 2J1VA 5FP9A 4LO6B 1F5JA 1QOOA 5GLUA 2VOTA 1QH7A 3B69A 5JOXA 2VZPA 3DYOA 1MVQA 1LU2A 2ZGRA 3IM0A 4LBLA 4F3JA 3NJXA 1R083 4XHBA 4XABA 4AQTA 2QQLA 3APBA 1E57A 4WVMB 5E88A 4M3CE 2EF6A 1I9RA 4JHTA 4K40A 4MGYE 1PX3A 2AH2A 3AVSA 1LHOA 4RL7A 5JDBA 1EAH2 3MF9A 1XPWA 5FY9A 5CISA 4IUGA 2DVDA 4XZPA 4FQ4A 5D21A 3ZSEA 3WD5A 3N7LA 4QPIA 1HQWA 4RHV2 3NSTA 2XHNA 3E6DA 3WUDA 4ZONA 4KWUA 2FDGA 2SBAA 2W1QA 5JZGC 3N7MA 1BKZA 2BYVE 5BNOA 1FMD3 2D3SA 2BBVA 3ECQA 2ZX0A 4GMP0 4KG8A 4FTEA 1PO11 2ZCWA 1JYIA 3KVBA 2IXJA 4ZHNA 2WZPP 1I3HA 3LA7A 4E2GA 2XJVA 4PQQA 3SQOA 4CTEA 2I2SA 2WDBA 3MYXA 3PTYA 3UYJA 3HBKA 1EAH1 5K8SA 1YO8A 4FXKB 1XU2A 2AGSA 2QFEA 4UW3A 1MEC1 3HWJA 4W50A 1W6MB 1AYN1 4LIUA 4DXSA 3GNEA 3OBAA 2X5IB 3ETQA 2CWMA 4MSVA 4XTMA 4D7YA 1DF0A 2QE3A 1VBB2 1OFNA 2Y38A 1DYKA 4P9XA 4R4XA 1B35B 4JDMA 3VHNA 3WP6A 4CEYA 3VGIA 3BOWA 3QCWA 4JRLA 3NNMA 2ZGQA 1HRI2 4PIYA 3NNLA 4MZUA 4OHYA 1QF3A 2ZHMA 5GZGA 4DIQA 4YGDA 2OIIA 5A7SA 5IK8A 1ZBA1 2WWSA 4RQPA 4UW6A 4MGQA 3KCYA 4CCKA 1LOCA 1NYWA 2R6QA 1LOFA 1POV1 3OUJA 5BY5A 1TG7A 1T2XA 1UOGA 4EN6B 4ES9A 4CRQA 3KHBA 4YZ3A 3ZFGC 5FLJA 3FLRA 4CSWA 2QNKA 4CP9B 5FMOL 4Q4X1 1DYPA 3KGLA 2BZDA 5LBBA 1UN1A 3POYA 4CUAA 2QCSB 3AC0A 1PZ9A 4QX7A 2BJSA 2BOJA 5FYVA 1HB4A 4EN7B 1WMFA 4XBLA 3NAPA 1OH3A 2XG3A 5DAPA 5FZ9A 3T09A 3N3HA 2D6PA 4JTNA 4QKBA 5IAXA 2VXJA 2WFF1 3ZXFA 1LGNA 2C26A 2BVBA 5HCBA 1OOPC 1RUG1 2VC9A 1MS8A 3VBFC 2BTVC 1X9PA 3C3VA 4LO5B 1GP6A 1HRV1 1RMU2 3VB9A 1H2LA 1W2AX 3NAPC 3AMNA 4JV4A 5JOZA 4OULA 1YXWA 1RUC1 4FPYA 5AVAA 1A34A 1ULCA 1YQ8A 3P5BA 4IGOA 1IHMA 3SISA 1F5FA 1R1A1 1AR81 3O14A 2J1RA 3A7QA 2G4IA 4HETA 3LOIA 4EYUA 3VD5A 1ZVFA 3K4AA 3GM8A 1QXPA 1QY4A 1XJAA 3T2TA 4CPBD 4GXLA 1RUJ3 4TN7A 4P14A 3UETA 1W28A 2KA3A 4Q0PA 3OGSA 3R0RA 4HN1A 2XKOA 3PU3A 5IVYA 1MZ6A 2ZZJA 3MHZA 5K9YA 1LOEA 4XACA 2D98A 3OPZA 1EY2A 3POIA 4GJZA 2EAKA 2RMU3 4GQ7A 2WNOA 3J7MA 3JB4C 4GKXA 2A6ZA 1RUC2 1UY1A 5C9AC 2PHTA 5JI7A 4E27A 4XVHA 5IK7A 1FMD2 1CAWA 5FZOB 4TLFA 1UZZA 5DUVA 1OUXA 3ABZA 4JQRA 5FPBA 3TOJA 3AZWA 2LUWA 4BU2A 1RUD2 3P3NA 4NIHA 1TNRA 5EHDA 1NCQB 4XF3A 4D6SA 2IC1A 1TME1 2IFRA 2XJRA 3RZGA 2E63A 4XFFA 4OI4A 2SLIA 2FDHA 4O65A 4IE6A 1D0HA 2IVIB 5HCHA 4Y1ZA 4QU2A 3T0DA 1QDOA 2VY0A 1UKGA 3GBGA 3VZNA 1EUTA 1TZOA 5FBJA 2EIEA 2VXRA 2JG8C 2L9LA 2O8OA 4MADA 1UIKA 3ZXKA 1OH4A 4Q8LA 5FZ6A 2XGXA 1S55A 4RS5C 4XJUA 1KGYA 1ZRIA 2RS11 3AP5A 2PAMA 2OZ6A 3ES4A 3V0AB 3VDBA 4GWMA 3VBUC 3NJYA 3BUCA 1DZTA 5APAA 1IPSA 4IEUA 5FMCA 4IETA 3WF1A 5C4WC 1Q8SA 1K42A 5EYXA 4FBFA 1Z0HA 2Q30A 3OYWA 1QKQA 4P5YA 1CIWA 2RM21 3S7IA 4NPLA 3WVJA 2VNGA 3V65A 4HVQA 1OLMA 2VVDA 4P08A 2X05A 1RUJ1 5HI0A 4YPJA 3U10A 4GWJA 1VBD2 2GNDA 3HAGA 4O9EA 3ZSMA 1HV0A 4D8MA 2F6BA 2EXIA 3BU0A 5FY8A 2ZTNA 2JDAA 3VBHC 4XETA 3OBRA 1WGPA 1WCDJ 1H0BA 2XJQA 2Y26A 4XUOA 2QQWA 2Y8KA 3MI8A 4LHKA 2ATFA 1O8SA 4I3GA 4AI2A 3LD8A 2VVFA 5FMBA 5I0RA 5I0UA 2WLQA 5ABJB 1S0EA 3T0AA 3IT8A 2CL2A 1T6BX 3WF4A 1JZ6A 1NLSA 1DQ1A 2PHDA 3PUSA 3TAYA 3J26N 5C3PA 2BBAA 3M3IA 1W6QB 2WFPA 4J1WA 2C9AA 4QX5A 1QJX3 2XBO3 3WG2A 2DDUA 4JGZB 1H8TC 1SCRA 3CF6E 4Y20A 3O1TA 2ZPXA 5A70A 2D6MA 3DXTA 3CO2A 4MV2A 1HB2A 2GC3A 4COWA 2GNTA 2PYTA 2OS2A 5FCCA 3E1F1 2VAUA 1ULFA 5AC93 4XFBA 3KT7A 1RVF1 2JE8A 5ABJC 5CYYA 1AX1A 2QKDA 3WP3A 1UY3A 1WCKA 3H1YA 3SKJE 3KF3A 3WCSA 4CDQC 4YZ2A 4LE3A 4YARA 4ZKTB 2BVVA 3CIHA 2Y6KA 1ULEA 3FN9A 3NNJA 4XOGA 1AR61 3O1OA 4QQ2A 1YUDA 2DVFA 3ZSJA 5CFDB 4RGGA 4LQRA 5FIXA 1SCSA 2D3PA 2GMMA 3RJ2X 3ENRA 4EJRA 3VBFB 4LOSA 3N9MA 5J1XA 2EIBA 2JDZA 4BK4A 3MUY1 4TTGA 1W0NA 2JDKA 5KC6A 1SMVA 1X9TA 4NHYA 1GZCA 2VZ3A 1L7RA 2BWAA 2D7FA 4BQXA 2NQYA 4IDZA 5J98B 1DGRN 3WHUA 4COVA 4FPLA 1UZVA 4ONUA 4XXPA 4OVEA 2BNNA 1O3RA 2N7GA 4ASMB 5FWJA 4K9SA 4QHOA 3VDCA 3WY6A 3WX5A 3NQHA 2C9KA 3UJOA 1GLHA 1ZRRA 1GICA 1EUUA 2UWAA 2JG9B 1RUD3 5J3UA 4CDWB 2D43A 2YFZA 4RHV3 4WVMA 5D8AA 2J7MA 3KQ4B 5ANQA 3WW4A 3T3YA 4QXCA 3ZYPA 3VDDC 3PVEA 3IBMA 2W1SA 3E5XA 4LK6A 4BQWA 5C8CB 4GMP1 2WNVB 3ZYFA 3ZKYA 4AI9A 3IMNA 4KGQA 1GBGA 2PQSA 4XXAA 1RTVA 2WN3A 2CDPA 5CFCC 1CAVB 5BNQA 1X36A 1GSLA 3AP4A 1QJY1 1VBA2 4A44A 3I54A 4ZZ8A 5LWBA 4MGTA 1N1SA 1T6GC 1NCQC 4FTBA 4KG0A 2JDNA 2ZAAA 3U0ZA 3I3BA 3PMEA 2CAUA 4M4PA 5BNOB 1I5ZA 3HMYA 3JCIA 5JXHA 3TEYA 4XFIA 3I8TA 4XUPA 1ZZ7A 2FMDA 4A3XA 1SFYA 1XXNA 2DBIA 2Y0IA 3JD73 3ACHA 1OOPB 4K3UA 4LKSA 4MGZE 4YW4A 4AEDC 2VL4A 4OCTA 1AX2A 5BPXA 1W6QA 1WA6X 3LFIA 1OI6A 3MV11 3CEWA 1F4HA 4ISQA 4Y1VA 4PT6A 1S0DA 2VZSA 4Y4RA 1QWRA 2Z79A 2VE1A 4ISRA 4TLGA 1BBT3 4DB5A 5C7GA 4AG4A 5A80A 2BGPA 2YV8A 1RL3A 2RMU2 3UK9A 3ZLIA 2ZGOA 4IV3C 1O5LA 4XJ8A 2A7AA 1NA1A 5EJZB 4ES8A 4B8EA 1RUF2 5BNNA 5BV6A 3ETPA 5A33B 3IPVB 4A42A 1C4RA 4MYEA 3U75A 5FTTC 1U12A 4EE2A 3AL5A 3M3OA 4RSUA 2PHLA 4WBBA 3PUIA 4CU6A 4BHPA 5LK7B 4GH4A 2WNUC 2FCUA 4NVPA 4X6QB 1H9WA 2R073 4JCKA 4C90A 3VBFA 4B4RA 1YI7A 4GMP3 2BU9A 3WQ7A 3FUOA 3POEA 2BPA2 1GOHA 1S0JA 1ULPA 1OA4A 1SG3A 1Y4WA 4YVWB 4E9KA 4BZ4A 1YFXA 2BEOA 2GAUA 3JUUA 4N9IA 4K21A 1MZFA 2ID4A 4QKDA 1Q43A 2ZMNA 1GNHA 4QM8A 3VD3A 3ZXAC 4ZZ5A 4WZFA 3D82A 3C2UA 2LM3A 2V4AA 4PBOA 4XMAA 4CEYB 5GLVA 4CEWB 2QDRA 2DFBA 5K7PA 2Y6LA 1H2MA 3OSDA 1UD1A 2JG8B 4KNCA 3RMYA 5CKNA 2DUPA 4HK9A 4YG3A 1WCQA 1HJGA 2IVJA 5A32B 1VIWB 1YJKA 3ACGA 3J8F3 3A21A 2WQZC 2EXHA 1M4WA 1JUHA 1UX6A 4DUWA 4AEMA 4LLFA 3NNGA 5A1FA 5JXIA 1B35C 1BCXA 3TNQA 4GB32 5HV0A 5FZIA 3I2KA 5I8YA 2G19A 5T5LA 3U4SA 5BYNA 4XE9A 2WLPA 3O1SA 4AVAA 4CEYC 3C7OA 3LEGA 3SXWA 3UT0A 3H8UA 3KCCA 3HJRA 5FYUA 2W08A 3RYKA 2D40A 5FXVA 3S57A 2O0OA 1COV2 3DYMA 2PXJA 2OVUA 2YGLA 2MEV1 2CTVA 2IXKA 3KF5A 1KITA 5DPNA 3KVAA 3W5MA 3V0BA 2GNMA 2D5FA 1OOPA 2R041 4CCOA 1YQCA 2BGOA 4H3WA 1PVXA 5FY1A 3IAQA 3VBOC 3ST7A 2CU5A 4UXAA 2GH2A 2D6LX 1NLRA 4LK7A 1W0PA 2DU1A 1EYBA 1Q8OA 3FLTA 1RGSA 4MUVA 4PQ9A 5LBFA 1FPN1 4N9HA 3MLLA 3PHMA 2WR9A 2ARBA 1NKGA 1VRH1 1MPXA 3ZVXA 1JN2P 3AZZA 4A6OA 1SDWA 2W2IA 4CDWC 4CCDA 3B00A 2PHUA 1EPWA 3VDDB 3BI3A 4OUMA 5AC92 3D8CA 1RVF3 3OBZA 2CHHA 4EN8B 1US2A 1OT5A 2ZX4A 4HSJA 3SKVA 5GZDA 5M0TA 1LRHA 2ZX2A 2MEV2 5LATA 5J96B 2X10A 4DMIA 4OI0A 3JD72 4FPFA 1UY2A 1VBD1 1A3KA 2GDFA 2KR2A 3K75B 3LAGA 4IE4A 3UL2A 4C0HA 2QQVA 4O61A 1RYYA 1HRV3 2VGDA 1UYZA 1RUF3 3MEPA 2VZRA 2YB7A 1CWPA 3OG2A 4CP1A 4EN0A 5DG2A 2DTYA 4XFGA 1E5SA 2I07B 1FPN2 1MACA 1WMDA 2OUJA 4FP2A 4S2DA 5L7OB 5FKCA 3I3DA 3TN93 2VZ1A 3FBMA 1ULOA 3FJSA 3MLKA 4INDA 2A6WA 3BCWA 1L3JA 3DKQA 1OKQA 1V9U1 2PAEA 3K4DA 5A3PA 4NIAA 5LEKA 1BVVA 3AYCA 1LOBA 1WKYA 4OMCA 4CDUC 5AC91 4Q4X3 3IWZA 4LORA 3WNXA 1NUKA 3DGTA 3WG1A 2WIIB 4M00A 1SQ4A 4FOQA 3POFA 4MGIE 1JYWA 3K2OA 2QJVA 2VW0A 4XF4A 4HKWA 1AJOA 2JIGA 4AOCA 1CVNA 3JQXA 3LPGA 4NRPA 1N1TA 1UIJA 2NYYA 3JBG1 4KL1A 2H0BA 4XFHA 2Q0AA 3H1MA 5CVRA 3LPFA 2HWD2 5IUQA 1EPZA 1W8UA 2F4PA 3SC7X 4FOVA 5CNAA 4IV3A 3ZFEB 1DYOA 3VKFC 2AYHA 5J09A 5FYYA 3GYDA 2ZEXA 3LZZA 1MS5A 3PVBB 1WCUA 4NWVA 4CXXA 2VCAA 1WZXA 1OVSA 2V5YA 2VNVA 4P5HA 3VD9A 4J25A 4CDUB 1HW5A 4DS0A 4SBVA 1WD4A 5T5PA 3FHIB 2GZWA 1HIXA 3HBZA 3AKTA 1UZYA 4P02B 5LA9A 3SEPA 2UYBA 3WNPA 2ZHKA 3H8OA 3K51A 4KWKA 5FMOS 1BBT1 4HOOA 2NMNA 5L7OA 3ALQA 4AFDA 4QKFA 4YVWC 5KC5A 3Q8EA 2D3RA 1OLME 1UXXX 4XUTA 4IV1C 3GJAA 3R4SA 5IFTA 3I2IA 4XF0A 3HN3A 4PJYA 1G9CA 5HPOA 4I0BA 4NR1A 5F6LB 3OGRA 4QX1A 1HB1A 1BEV2 2DF7A 2VPVA 2CDOA 2GMPA 3GBWA 3EB7A 3HOBA 2QDNA 5FUPA 5FZ8A 4D3WA 1PO12 3T2OA 3PU8A 3VV1A 2JX9A 5FPLA 4D0QA 1ZZCA 4QKNA 1VJ2A 4HKLA 1WLWA 2IWGB 3O1VA 1W2OA 1XNKA 2ZEWA 4ATEA 1OLRA 3NV4A 4HL0A 1RUI2 2JDUA 3I97A 3WXPA 3ZXJA 3IDAA 3VBOA 4CCNA 5FLIA 4AYUA 4LUMA 2ZKNA 4OHXA 4EWAA 1A8DA 4GIQA 4BQ2A 1JZ7A 3GCWA 4MXWA 2I74A 1RVF2 3GCXA 2WKKA 3KQRA 3TB0A 4V2WA 5KXCA 5FJHA 3H7YA 2I45A 5BNPA 3U37A 2JG9A 3RYPA 1VBE3 1Y7BA 5KXBA 2VNRA 2RS51 2E51A 2LS6A 2R072 5JXJA 4A7ZA 3OBTA 2X5IA 3QACA 1HKDA 3T4HB 3ACFA 4XC9A 3VBRA 4WM7C 5FZ7A 1CZVA 2OQ6A 2YROA 1QJY2 1VBA1 1B35A 1H1MA 4BMBA 3WF2A 2YG0A 2HWF1 3KSCA 1CAUB 1REEA 5FBZA 3TN92 4EZHA 3I7DA 4ZU5A 4IEZA 1CONA 5A3LA 3LDBA 4ITCA 5KHHA 5CFDA 3IZOA 2QUOA 5DAQA 3NRUA 4QPGB 3LIGA 4S2HA 5HXVA 2B39A 1NT0A 1ONAA 2XXZA 1UU4A 1O59A 2VOWA 4Q0SA 4PHZA 4Q4X2 4UW4A 2YC2A 3LDRA 4H7MA 3E5UA 4ZY9A 2Q8CA 3LOBA 1NY71 1O5UA 1PK6B 1WLTA 2GMEA 2HLEA 5G04L 4ZXEA 5A7WB 1UYPA 1OKOA 1ZX5A 4MHRA 2WRAA 4YGBA 3KB5A 4OQ8A 3N35A 1LB2A 1XNTA 1DGWX 3WNOA 3E5QA 4ZPIA 3OGJA 4AZZA 2XOMA 4FQZA 2D97A 1AYN3 2ADDA 4QD2A 5I93A 5DAXA 4Z92B 2D6KA 2DTWA 1CX1A 2XVGA 5F5IA 1UYXA 5K0UB 1C8M3 2HBTA 3MGUA 1QJX1 1JYCA 1BVP1 2ZHNA 4GH4C 4QPGC 5EJ3A 4D6QA 4DUXA 4IGPA 1VE0A 5L7OC 2B46X 4FPHA 4YZ4A 3ZX7A 4DY3A 3I2DA 4ASLA 2A6YA 3JU9A 2HKXA 4NJ4A 1DCSA 3OJBA 4CUCA 4IE0A 3M3EA 4Y26A 3LCPA 5IATA 1CAVA 5FO8B 1MEC2 2A6XA 1V6NA 5A6QA 5LW9A 2AEZA 2DFCA 2P3KA 5JPMB 1ST8A 2HWB1 3OPWA 3SCFA 1ZA7A 1F2NA 3H7JA 4HN0A 1AR92 2GALA 2ZGSA 3M3QA 2Q8EA 5CG8A 2ZABA 3HQUA 5BXXA 4OI2A 5FOJB 2PTMA 2WWJA 4M01A 3RJRA 3TRSB 3W59A 3NKGA 1X8MA 3W21A 2TEPA 2YYOA 1OF3A 5FYSA 2DURA 3KD4A 1ZYBA 2J22A 1LR5A 1S0FA 4HPKA 2ZBJA 1H30A 4KGGA 5F32A 3UKTA 4AI8A 5A3WA 4CDQA 1LNSA 2HEYF 1AXKA 1TQ5A 1ZA4A 2NN8A 2R49A 2VO5A 2WJSA 2Z42A 1X50A 5LASA 3WF3A 5KR7A 3H8XA 5JCTA 1NXMA 4S2GA 4AAPA 4FI9A 3VBUA 2VQTA 3OCPA 3WNKA 4ARXA 4CVUA 1NX9A 1H4HA 1ZBE1 2HWB2 1C57A 2HWF2 2DBNA 2VTXA 1JXNA 3AKQA 4MLOA 4MOAA 1PO23 1XSRA 3DECA 2ORZA 1PVC2 1W2UA 2RDQA 3H1WA 4M4RA 4QB1A 3KT4A 1V6LA 3RZZA 4IEYA 5J36A 2OPWA 1H4GA 3T1LA 5IFPA 4QDRA 3S0MA 3GHMA 4XTPA 1LULA 3I2HA 4YM1A 3T0BA 3BTZA 2DCYA 1RUI3 2YC4A 5FRAA 5IVJA 4GJYA 1XSQA 1OURA 4AGVA 5A1LA 3ROUA 3U07A 1VB4A 5GZEA 1CQ9A 1WBFA 1RUH2 2VD7A 1UMIA 5DUWA 1OQ1A 4JKKA 3V56A 1VMFA 4DXTA 4EZ4A 1VMHA 4AEJA 4LT5A 1J58A 1LGCA 2WABA 3KHCA 5CBLA 1JBCA 2QZ3A 3NMBA 1JH5A 1ND2A 2Y0OA 3J7NA 1J83A 1HJFA 1W8HA 2RM23 3DPRB 4NAMA 4XMIA 2YFUA 4A7KA 4FFGA 2TNFA 3ZFFB 3RS6A 1FMD1 3Q8FA 1LODA 4AF9A 4RFRB 1S0IA 4DXRA 4PLMA 2DCTA 5JLVA 4MX3A 4U36A 3I49A 2WL1A 4KQ7A 2ZGLA 3WQ1A 1LCLA 3WP4A 4ARYA 1UOBA 3AMHA 3MIBA 3CKHA 4LEJA 4C8DA 1K5MA 5DDJ1 3IDBB 4JHZA 1CAXA 3L2HA 4QPIB 2P34A 3MPPG 4YSFA 2JDHA 3RZHA 1BQPA 3ACLA 4XJ9A 1AYM1 4QPYA 4WM7B 5JR7B 2OUHA 3WP5A 3S5AA 4DO0A 1O3QA 1VAKA 2G9FA 2CSGA 4LA2A 5FKBA 3RGBA 1R081 1D4VB 2BGCA 3GHNA 1W3XA 1OC1A 4NO4A 4JZRA 2AR6A 4XDPA 4YVSA 2DYCA 5FPVA 2GN7A 5FYTA 4YW2A 1RC6A 1MS3A 2YBPA 5I8SA 4Z2WA 5DG1A 4Q4W2 5L9VA 3HT1A 3J8F1 1V9U2 2E6VA 2WT2A 4PI0A 1E5IA 1AZDA 1OFSA 3DN7A 4FFFA 3SCHA 1QGLA 4P9YA 1IPKA 4FP3A 4QPIC 2JXAA 2A5ZA 3EO6A 5C70A 3UJQA 2BQPA 3ACIA 3BOPA 4K20A 4UBHA 3M1HA 4DPNA 4NIIA 4ET7A 1OD3A 4CUBA 1LHNA 3NKTA 2ZOEB 3JBG2 2JENA 4CDWA 3HEIA 3POSA 5JWPA 4QXBA 5LA0A 2YZ4A 4N43B 4HZFA 4TYSA 1ND3B 2XKPA 2Y6HA 2E7QA 2YGMA 4AQSA 1QJU2 3ZYRA 1MQTB 5EP9A 2CAVA 2R1DA 4META 4O7XA 4LHLA 3USUA 2HJIA 1YQ6A 5C6CA 3VL9A 2W39A 1PVC3 4Q29A 3N4MA 2RJKA 4AR2A 4CEWC 2G9ZA 3WDYA 5CFDC 2XUMA 2VBBA 2WAOA 5A3UA 1VLNA 1F4AA 2VMFA 3ZFEA 5DAWA 1RITA 1B09A 1U5XA 2BWCA 2P3YA 3MIFA 4GAZA 4NN0A 4N53B 4DNYA 3MLJA 3RDIA 3OOXA 5IK4A 3K3NA 2XUEA 3WHTA 1SLBA 3PIJA 1I5PA 3CZJA 1D4M1 4HG6B 2OYZA 5FY5A 1ZREA 4KU7A 3WDWA 4CP2A 3N9PA 1MQTC 4AFAA 3VZOA 4PF1A 1JZ2A 4PDWC 1AL22 1UMHA 1W6OA 4XBQA 2CY6A 3ZN5A 4QT6A 1KRIA 5IWFA 2MPFA 1WLDA 2PHWA 5DZGA 4YZ1A 1ZRFA 1JOPA 4D7TA 3ZSLA 1VRH2 3B7MA 1SLTA 4GKYA 4IE5A 3WEZA 4NWWA 5DN2A 1RHI1 1UQXA 2A73B 4BQYA 3I3QA 3VDAA 2BW8A 3H9AA 3LEMA 4N43A 5I8TA 3N7KA 2YDEA 2ZGPA 4N53C 4Y3OA 5IVBA 5F5AA 4YG6A 4NHXA 1CAXB 4CU8A 1SBFA 4DFSA 1PIV3 2B45X 4RQPC 1GQHA 1W8ZA 5GZFA 3NW4A 2BRTA 4M3CF 4B7KA 5JMCA 3VBOB 3WW2A 4W65A 4LJHA 1QHDA 2J1UA 4GH4B 4OMDA 2AENA 3IB3A 1EV12 2VW1A 1AL21 3MDPA 4I01A 3BVCA 5A3OA 1DHKB 1F35A 4AI1A 5KHGA 4R4ZA 3NJVA 5FZ0A 3X29B 4Q8KA 3IAPA 5F5QA 4M0HA 3JQWA 4UI9L 3B93A 3N9NA 1LESA 1VBC3 1Q8VA 5F3EA 4D94A 4P00B 3V0AA 2W1WA 3QOPA 5FZFA 3ATGA 1OPMA 3AZYA 3WLUA 3WNNA 3LKJA 2WZR3 5FPXA 1CN1A 1KXGA 1NAEA 4HLTA 1A6CA 1OQDA 2RR11
chains in the Genus database with same CATH topology
5G05L 1GOHA 1ULPA 1PMHX 1SG3A 4CU9A 4LPLA 3VD3A 2ID4A 4ZZ5A 1JYNA 2ORXA 3MV01 2X09A 2WZ8A 1GMMA 3T08A 3WSOA 2Y6LA 5EIYB 2QQIA 4W8JA 2RJ2A 1WCQA 4GWIA 3ACGA 3A21A 2Z4FA 3A23A 4MGSA 1JHJA 2W91A 3HNYM 4DUWA 2V72A 2W92A 3NNGA 5JXIA 3ZM8A 2VCCA 3I2KA 5JXGA 5A1AA 2QBXA 1DP0A 4UAPA 3C7OA 3LEGA 3BGAA 3HJRA 1UYYA 1JZ8A 2VMEA 3T2PA 3WNLA 3DYMA 3MO4A 2W9XA 5DPNA 3W5MA 4OZOA 4JKLA 3CMGA 2BGOA 3C7HA 3THCA 3IAQA 1KEXA 2V4VA 2E26A 1GOGA 3DYPA 5HXMA 4RN5A 1NKGA 1MPXA 4A6OA 1GOFA 3HPNA 5CZKA 1UY4A 1W9TA 5LA2A 1US2A 1OT5A 3SKVA 4BXSV 1UY0A 2X10A 2QQKA 2WUHA 3OEAA 1UY2A 3K75B 1W8OA 4L0PA 1CZTA 3J7HA 5JUVA 3K46A 1RYYA 2EIDA 1UYZA 2R7EB 3HNBM 2VZRA 1HN1A 2YB7A 3OG2A 2VZOA 1O8PA 4QX2A 3I3DA 4QPWA 2VZ1A 1ULOA 5B4XA 3P1IA 1GUIA 3K4DA 2W95A 1WKYA 4OMCA 5JMOA 1NUKA 3GXUA 4E8DA 1JYWA 3FHQA 2VCBA 2VTFA 1US3A 4XURA 3LPGA 2J1VA 1JU4A 2WO3A 3LPFA 2VOTA 1CIYA 1DYOA 3I3EA 2VZPA 3DYOA 4A4AA 2C4XA 2W47A 3NJXA 2QQLA 2ZEXA 1PX3A 2JKXA 3GGLA 2VCAA 1CZSA 3VD9A 1XPWA 2WAAA 1GNYA 2WO1A 4IUGA 1TVGA 2E32A 2W5FA 4QDSA 3SEPA 2RV9A 4P02B 1W8NA 1DLCA 3WNPA 1K45A 2XHNA 4KWUA 2W46A 2W1QA 3C7GA 2VQUA 2ZEZA 1H6YA 1W99A 1UXXX 2OKXA 4XUTA 5IFTA 4A3ZA 3IIIA 3I2IA 3ECQA 3HN3A 3K77A 3LQCA 2DCKA 5HPOA 3OGRA 4QX1A 4JKMA 3HOBA 2VM9A 2CDOA 4PQQA 3EB7A 2WDBA 2QQMA 2B9VA 3T2OA 2XONA 4D0QA 4W50A 4TXWA 1R64A 2ZEWA 4DXSA 4UOJA 5B4NA 3I97A 3OBAA 3VD7A 5IHRA 3IDAA 2BERA 2WZEA 4E8CA 4BJ0A 1JZ7A 1K12A 5C71A 1XC6A 1L7QA 3OGVA 2J1AA 4DUVA 3U37A 5FUIA 2VR4A 2J1EA 3VD4A 2LS6A 5JXJA 4MGQA 3ACFA 3C8XA 3BN6A 1CZVA 4Z2AA 1TG7A 1T2XA 3WF2A 2YG0A 2JD9A 3I2JA 2BZDA 3SEEA 3NRUA 4CUAA 3AC0A 3THDA 4A41A 1O59A 3T09A 3PUHA 2YC2A 4ZY9A 1JZ3A 3UESA 2HLEA 3CZUA 5G04L 3I2FA 1W9SA 4ZXEA 2C26A 2VC9A 4QAWA 2VZVA 1XNTA 1JZ5A 2WBKA 3WNOA 2XOMA 4KMQA 2QQNA 1JZ4A 1CX1A 2J1RA 3A7QA 1UYXA 3VD5A 3K4AA 3GM8A 2VMCA 1UX7A 2QQJA 5EJ1B 4DUXA 3UETA 3OGSA 4CUCA 1GQPA 3WQBA 3D3AA 1UY1A 2WQ8A 2W3JA 4XVHA 4LHSA 3ABZA 1P8JA 5JR2A 4DEVA 2B4KA 4CU7A 1OF3A 1OF4A 2J22A 2DCJA 1J84A 1LNSA 5LA1A 4XZUG 3WF3A 2VO5A 3T0DA 4ARXA 1EUTA 4FI9A 2EIEA 2VQTA 5IJRA 3WNKA 4CVUA 2L9LA 1NX9A 4MADA 4MOAA 1OH4A 3DECA 2HYXA 2ORZA 3OEBA 2J1TA 4QB1A 4M4RA 1KGYA 2Y6JA 3VDBA 4XUNA 4OUEA 5IFPA 3C7EA 4QDRA 3LEIA 3WF1A 1K3IA 1K42A 1UXZA 3I2HA 3T0BA 1SDDB 2YC4A 3FL7A 4P5YA 4MO3M 1XNAA 4P08A 2EICA 2X05A 1UMIA 4QX0A 4YPJA 3WF0A 2WYSA 4JKKA 1YQ2A 4GWJA 4DXTA 3W5NA 4D8MA 2WABA 2JDAA 1J83A 4XUQA 1PMJX 4XUOA 1JYXA 2YFUA 2Y8KA 1O8SA 3WNMA 3UNPA 3T0AA 4DXRA 2W87A 3WF4A 1JZ6A 4QX3A 2ZEYA 4ARYA 2BBAA 1IQDC 3CKHA 4JHZA 2DDUA 1PX4A 4A45A 1BHGA 3HNMA 3EYPA 3E1F1 1D7PM 2QQOA 2JE8A 2LW8A 5CYYA 2VZUA 1UY3A 3SKJE 4OYUA 3LEKA 2E31A 3CIHA 2Y6KA 3FN9A 3I2GA 2WO2A 4LQRA 5C70A 3ACIA 4ET7A 5DMYA 5J1XA 2EIBA 2Y6GA 1OD3A 4BK4A 4KI5M 3MUY1 4TTGA 1W0NA 3HEIA 1SHWB 5LA0A 2VZ3A 1L7RA 2Y6HA 2KD7A 2VZQA 1H6XA 5F7UA 3VDCA 3NQHA 4W4ZA 2C9KA 2VMDA 2J1SA 1EUUA 2YFZA 4JX0A 2J7MA 2WAOA 1F4AA 2VMFA 5LCWL 3MUZ1 2W94A 3GDBA 2W1SA 4RYDA 3OB8A 2ZXQA 3MBWA 2PQSA 2WN3A 2CDPA 1I5PA 2WN2A 3CZJA 4HG6B 3F2ZA 4A44A 4ZZ8A 1JI6A 3A22A 3FHAA 4QB6A 4PF1A 1JZ2A 3I3BA 1UMHA 4M4PA 1JYVA 2VZTA 5JXHA 4QB2A 4XUPA 3JXSA 4LKSA 3WEZA 5DN2A 3ACHA 2VL4A 1JU3A 3VDAA 4AAXA 3MV11 1F4HA 1UWWA 4CU8A 4CUBA 3CQOA 3K4ZA 2Y64A 2W1UA 4PT6A 2VZSA 4BK5A 4QDQA 5C7GA 2J1UA 2V5DA 4OMDA 1GU3A 4AG4A 2XQXA 3IB3A 4BDVB 1W9WA 2BGPA 2VJXA 5I0DA 3NJVA 5EJZB 3IAPA 3T2QA 4UI9L 3ETPA 5DQ0A 3LE0A 4A42A 3P6BA 4P00B 1UZ0A 2W1WA 5IYYA 2RVAA 3PUIA 4CU6A 3WNNA 4GZ9A 3C7FA 1NAEA 4DEQA 2E33A 3CDZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5G05 L;  1GOH A;  1ULP A;  1PMH X;  1SG3 A;  4CU9 A;  4LPL A;  3VD3 A;  2ID4 A;  4ZZ5 A;  1JYN A;  2ORX A;  3MV0 1;  2X09 A;  2WZ8 A;  1GMM A;  3T08 A;  3WSO A;  2Y6L A;  5EIY B;  2QQI A;  4W8J A;  2RJ2 A;  1WCQ A;  4GWI A;  3ACG A;  3A21 A;  2Z4F A;  3A23 A;  4MGS A;  1JHJ A;  2W91 A;  3HNY M;  4DUW A;  2V72 A;  2W92 A;  3NNG A;  5JXI A;  3ZM8 A;  2VCC A;  3I2K A;  5JXG A;  5A1A A;  2QBX A;  1DP0 A;  4UAP A;  3C7O A;  3LEG A;  3BGA A;  3HJR A;  1UYY A;  1JZ8 A;  2VME A;  3T2P A;  3WNL A;  3DYM A;  3MO4 A;  2W9X A;  5DPN A;  3W5M A;  4OZO A;  4JKL A;  3CMG A;  2BGO A;  3C7H A;  3THC A;  3IAQ A;  1KEX A;  2V4V A;  2E26 A;  1GOG A;  3DYP A;  5HXM A;  4RN5 A;  1NKG A;  1MPX A;  4A6O A;  1GOF A;  3HPN A;  5CZK A;  1UY4 A;  1W9T A;  5LA2 A;  1US2 A;  1OT5 A;  3SKV A;  4BXS V;  1UY0 A;  2X10 A;  2QQK A;  2WUH A;  3OEA A;  1UY2 A;  3K75 B;  1W8O A;  4L0P A;  1CZT A;  3J7H A;  5JUV A;  3K46 A;  1RYY A;  2EID A;  1UYZ A;  2R7E B;  3HNB M;  2VZR A;  1HN1 A;  2YB7 A;  3OG2 A;  2VZO A;  1O8P A;  4QX2 A;  3I3D A;  4QPW A;  2VZ1 A;  1ULO A;  5B4X A;  3P1I A;  1GUI A;  3K4D A;  2W95 A;  1WKY A;  4OMC A;  5JMO A;  1NUK A;  3GXU A;  4E8D A;  1JYW A;  3FHQ A;  2VCB A;  2VTF A;  1US3 A;  4XUR A;  3LPG A;  2J1V A;  1JU4 A;  2WO3 A;  3LPF A;  2VOT A;  1CIY A;  1DYO A;  3I3E A;  2VZP A;  3DYO A;  4A4A A;  2C4X A;  2W47 A;  3NJX A;  2QQL A;  2ZEX A;  1PX3 A;  2JKX A;  3GGL A;  2VCA A;  1CZS A;  3VD9 A;  1XPW A;  2WAA A;  1GNY A;  2WO1 A;  4IUG A;  1TVG A;  2E32 A;  2W5F A;  4QDS A;  3SEP A;  2RV9 A;  4P02 B;  1W8N A;  1DLC A;  3WNP A;  1K45 A;  2XHN A;  4KWU A;  2W46 A;  2W1Q A;  3C7G A;  2VQU A;  2ZEZ A;  1H6Y A;  1W99 A;  1UXX X;  2OKX A;  4XUT A;  5IFT A;  4A3Z A;  3III A;  3I2I A;  3ECQ A;  3HN3 A;  3K77 A;  3LQC A;  2DCK A;  5HPO A;  3OGR A;  4QX1 A;  4JKM A;  3HOB A;  2VM9 A;  2CDO A;  4PQQ A;  3EB7 A;  2WDB A;  2QQM A;  2B9V A;  3T2O A;  2XON A;  4D0Q A;  4W50 A;  4TXW A;  1R64 A;  2ZEW A;  4DXS A;  4UOJ A;  5B4N A;  3I97 A;  3OBA A;  3VD7 A;  5IHR A;  3IDA A;  2BER A;  2WZE A;  4E8C A;  4BJ0 A;  1JZ7 A;  1K12 A;  5C71 A;  1XC6 A;  1L7Q A;  3OGV A;  2J1A A;  4DUV A;  3U37 A;  5FUI A;  2VR4 A;  2J1E A;  3VD4 A;  2LS6 A;  5JXJ A;  4MGQ A;  3ACF A;  3C8X A;  3BN6 A;  1CZV A;  4Z2A A;  1TG7 A;  1T2X A;  3WF2 A;  2YG0 A;  2JD9 A;  3I2J A;  2BZD A;  3SEE A;  3NRU A;  4CUA A;  3AC0 A;  3THD A;  4A41 A;  1O59 A;  3T09 A;  3PUH A;  2YC2 A;  4ZY9 A;  1JZ3 A;  3UES A;  2HLE A;  3CZU A;  5G04 L;  3I2F A;  1W9S A;  4ZXE A;  2C26 A;  2VC9 A;  4QAW A;  2VZV A;  1XNT A;  1JZ5 A;  2WBK A;  3WNO A;  2XOM A;  4KMQ A;  2QQN A;  1JZ4 A;  1CX1 A;  2J1R A;  3A7Q A;  1UYX A;  3VD5 A;  3K4A A;  3GM8 A;  2VMC A;  1UX7 A;  2QQJ A;  5EJ1 B;  4DUX A;  3UET A;  3OGS A;  4CUC A;  1GQP A;  3WQB A;  3D3A A;  1UY1 A;  2WQ8 A;  2W3J A;  4XVH A;  4LHS A;  3ABZ A;  1P8J A;  5JR2 A;  4DEV A;  2B4K A;  4CU7 A;  1OF3 A;  1OF4 A;  2J22 A;  2DCJ A;  1J84 A;  1LNS A;  5LA1 A;  4XZU G;  3WF3 A;  2VO5 A;  3T0D A;  4ARX A;  1EUT A;  4FI9 A;  2EIE A;  2VQT A;  5IJR A;  3WNK A;  4CVU A;  2L9L A;  1NX9 A;  4MAD A;  4MOA A;  1OH4 A;  3DEC A;  2HYX A;  2ORZ A;  3OEB A;  2J1T A;  4QB1 A;  4M4R A;  1KGY A;  2Y6J A;  3VDB A;  4XUN A;  4OUE A;  5IFP A;  3C7E A;  4QDR A;  3LEI A;  3WF1 A;  1K3I A;  1K42 A;  1UXZ A;  3I2H A;  3T0B A;  1SDD B;  2YC4 A;  3FL7 A;  4P5Y A;  4MO3 M;  1XNA A;  4P08 A;  2EIC A;  2X05 A;  1UMI A;  4QX0 A;  4YPJ A;  3WF0 A;  2WYS A;  4JKK A;  1YQ2 A;  4GWJ A;  4DXT A;  3W5N A;  4D8M A;  2WAB A;  2JDA A;  1J83 A;  4XUQ A;  1PMJ X;  4XUO A;  1JYX A;  2YFU A;  2Y8K A;  1O8S A;  3WNM A;  3UNP A;  3T0A A;  4DXR A;  2W87 A;  3WF4 A;  1JZ6 A;  4QX3 A;  2ZEY A;  4ARY A;  2BBA A;  1IQD C;  3CKH A;  4JHZ A;  2DDU A;  1PX4 A;  4A45 A;  1BHG A;  3HNM A;  3EYP A;  3E1F 1;  1D7P M;  2QQO A;  2JE8 A;  2LW8 A;  5CYY A;  2VZU A;  1UY3 A;  3SKJ E;  4OYU A;  3LEK A;  2E31 A;  3CIH A;  2Y6K A;  3FN9 A;  3I2G A;  2WO2 A;  4LQR A;  5C70 A;  3ACI A;  4ET7 A;  5DMY A;  5J1X A;  2EIB A;  2Y6G A;  1OD3 A;  4BK4 A;  4KI5 M;  3MUY 1;  4TTG A;  1W0N A;  3HEI A;  1SHW B;  5LA0 A;  2VZ3 A;  1L7R A;  2Y6H A;  2KD7 A;  2VZQ A;  1H6X A;  5F7U A;  3VDC A;  3NQH A;  4W4Z A;  2C9K A;  2VMD A;  2J1S A;  1EUU A;  2YFZ A;  4JX0 A;  2J7M A;  2WAO A;  1F4A A;  2VMF A;  5LCW L;  3MUZ 1;  2W94 A;  3GDB A;  2W1S A;  4RYD A;  3OB8 A;  2ZXQ A;  3MBW A;  2PQS A;  2WN3 A;  2CDP A;  1I5P A;  2WN2 A;  3CZJ A;  4HG6 B;  3F2Z A;  4A44 A;  4ZZ8 A;  1JI6 A;  3A22 A;  3FHA A;  4QB6 A;  4PF1 A;  1JZ2 A;  3I3B A;  1UMH A;  4M4P A;  1JYV A;  2VZT A;  5JXH A;  4QB2 A;  4XUP A;  3JXS A;  4LKS A;  3WEZ A;  5DN2 A;  3ACH A;  2VL4 A;  1JU3 A;  3VDA A;  4AAX A;  3MV1 1;  1F4H A;  1UWW A;  4CU8 A;  4CUB A;  3CQO A;  3K4Z A;  2Y64 A;  2W1U A;  4PT6 A;  2VZS A;  4BK5 A;  4QDQ A;  5C7G A;  2J1U A;  2V5D A;  4OMD A;  1GU3 A;  4AG4 A;  2XQX A;  3IB3 A;  4BDV B;  1W9W A;  2BGP A;  2VJX A;  5I0D A;  3NJV A;  5EJZ B;  3IAP A;  3T2Q A;  4UI9 L;  3ETP A;  5DQ0 A;  3LE0 A;  4A42 A;  3P6B A;  4P00 B;  1UZ0 A;  2W1W A;  5IYY A;  2RVA A;  3PUI A;  4CU6 A;  3WNN A;  4GZ9 A;  3C7F A;  1NAE A;  4DEQ A;  2E33 A;  3CDZ B; 
#chains in the Genus database with same CATH topology
 4V1P A;  1LOG A;  5G05 L;  2RHP A;  4LBN A;  2GC1 A;  2XLF A;  1YHF A;  3N9L A;  3RPQ A;  3AZX A;  5A7N A;  2UUR A;  1J3R A;  2B42 B;  3SH4 A;  3MV0 1;  4XJW A;  5F3G A;  4CDX A;  2ES3 A;  2PA7 A;  3RWN A;  2PHR A;  2HH9 A;  1LEM A;  3T08 A;  1AYN 2;  3WSO A;  5T5O A;  4URA A;  2UY8 A;  1J59 A;  1YC6 1;  4FAG A;  1WW6 A;  2LRP A;  3S30 A;  1COV 1;  1IS3 A;  4FFH A;  1C8M 2;  1QU0 A;  1CX4 A;  4YM3 A;  1YCI A;  4XDQ A;  4W8J A;  3CJI C;  3AVR A;  3GAL A;  5H9R A;  4GWI A;  4QQP A;  4TSV A;  2DUO A;  1FT9 A;  2BNO A;  3OTF A;  2A3Y A;  1PZ7 A;  3PL0 A;  1EP0 A;  4XF1 A;  1DQ0 A;  4R9C A;  5J37 A;  4UFJ A;  2GSY A;  2V72 A;  1K5M C;  1PMI A;  3J7L A;  1XYP A;  3LB9 A;  4YZ5 A;  1CAU A;  1AUY A;  3FE5 A;  5F39 A;  2O14 A;  5C3R A;  2H0V A;  2R07 1;  1LU1 A;  2ENR A;  3HVD A;  3M3C A;  3ZMN A;  1AXZ A;  4B4P A;  5ACA 2;  2XQR A;  1SFN A;  4LBQ B;  3U78 A;  4AED A;  5FDB A;  4UAP A;  5FJK A;  1AR9 3;  4XF9 A;  2VMI A;  1W2N A;  1XNB A;  2X53 S;  1LED A;  1Q8Q A;  4QM9 A;  5FZA A;  2VME A;  2YPJ A;  4NIG A;  3CLP A;  1Y43 B;  3T2P A;  5EZW A;  5JPN B;  3UGG A;  1DGL A;  2P6C A;  1DU3 D;  2G9G A;  2W9X A;  3VBH B;  2IUW A;  4Q1P A;  4CZS A;  4JKL A;  1HXS 1;  3CMG A;  4N43 C;  3TWI A;  4AQ6 A;  5L9R A;  2UYA A;  4Y1X A;  2K46 A;  3THC A;  2V4V A;  1GWL A;  5FXW A;  2P2K A;  2WS9 1;  3CU7 A;  3JZV A;  1X8E A;  3QH6 A;  4FPG A;  4K1Z A;  3KZ4 C;  2C24 A;  2YMZ A;  1PM7 A;  3BOD A;  4Z1V A;  1R1A 2;  1DFQ A;  2RR1 2;  4RN5 A;  3CJI A;  1JUI A;  1BXH A;  1NQJ A;  2FHR A;  2X29 A;  5FZG A;  4E2S A;  3AFK A;  4XJA A;  1C1L A;  1VP6 A;  1W6M A;  3J4U H;  3Q9O A;  5J7M A;  1SLC A;  3IIA A;  4JGZ C;  4YFZ A;  3WQ0 A;  1CPM A;  1V6M A;  2X8K A;  5LA2 A;  4PBP A;  4ZU7 A;  1FNZ A;  3KS7 A;  1VRH 3;  4Q0U A;  4XCB A;  5FWE A;  3KV6 A;  2XWJ B;  1AR6 3;  4UFI A;  1RUH 3;  2EID A;  3OUH A;  4ORF A;  2R7E B;  5IVC A;  1BYH A;  2J42 A;  2EVX A;  1WUV A;  3ME2 A;  1O8P A;  4MXV A;  5A3T A;  1VAL A;  4NHM A;  4Y1U A;  5D8A B;  1YQ5 A;  4NE9 A;  4QX2 A;  1GWM A;  1Q56 A;  1W03 A;  3P1I A;  4G4F A;  1N1Y A;  4NMI A;  4QQO A;  5JSO A;  1WLC A;  1GUI A;  4HPK B;  3ZIX A;  1RUF 1;  2GP5 A;  3O0W A;  1AXY A;  3ZIW A;  1AR9 1;  3FMG A;  3IKW A;  2E7A A;  3RQ0 A;  1BK0 A;  3THT A;  5GZC A;  1L7L A;  2VTF A;  2VCB A;  3IMM A;  1N1V A;  1AYM 3;  4Q0V A;  4XUR A;  1RUO A;  3ELN A;  4BYY A;  4IW3 A;  3H42 B;  4YM0 A;  1RJ8 A;  3O1M A;  2B8M A;  3AX4 A;  1TMF 1;  4DZG A;  2RS3 1;  2D6O X;  1DGR A;  2W68 A;  4Q4Y 1;  1IPJ A;  2F17 A;  2YPD A;  2ZGT A;  2JB4 A;  2RS5 3;  2JE7 A;  2GH8 A;  3I3E A;  4NUB A;  2VUC A;  1C1F A;  2ZAC A;  1UW8 A;  2W47 A;  2WNV A;  3USS A;  1POV 0;  3D5O A;  2QTW B;  4FPK A;  5SV8 A;  4Q26 A;  1ZZ9 A;  3AK0 A;  1QQP 3;  3H0O A;  5FZM A;  1RUJ 2;  4Y4Y A;  1SLI A;  3ORJ A;  4P9W A;  4WVZ A;  2VH9 A;  1VB2 A;  5EXO A;  3FX3 A;  5FPA A;  4BIF A;  1GNY A;  2VEC A;  4IEP A;  1TVG A;  1VBB 3;  2W5F A;  4WM8 A;  1S0C A;  2CYF A;  2ET7 A;  2RV9 A;  3LIH A;  4K8R B;  4RR3 C;  4Y5Z 0;  3E6B A;  3RSJ A;  3MIE A;  1HRI 3;  4XDO A;  3EMR A;  3IPV A;  2QQU A;  2ETE A;  5B2G B;  1ZBE 3;  4J1X A;  1KFX L;  3C7G A;  4G3Y C;  3VBH A;  4CA9 A;  2ZEZ A;  3Q8B A;  4I02 A;  1H6Y A;  2G1M A;  1W99 A;  3BU7 A;  5GLW A;  4PDW B;  2OKX A;  2HWC 1;  4A3Z A;  1DZR A;  3III A;  4IES A;  1STM A;  2Y34 A;  2DCK A;  4GAL A;  4IQP A;  4FPJ A;  2VUD A;  2QQP A;  4JKM A;  1WMX A;  1IG3 A;  2VM9 A;  3ZXG A;  2Z5W A;  1UU5 A;  3ZYJ B;  5FZO A;  2QQM A;  2B9V A;  3NNF A;  2XON A;  2MNG A;  4WVW A;  4Y5S A;  1QJU 3;  4Y22 B;  2IXH A;  4UFL A;  4BPZ A;  4E4Z A;  1RB8 G;  4GWN A;  4TXW A;  1R64 A;  5FY0 A;  1SAC A;  3DPR C;  4EV0 A;  1NCQ A;  1XYO A;  4IXL A;  4PIX A;  4GB3 1;  2ZS6 B;  1HN0 A;  3ILN A;  2R04 2;  1O7F A;  1RXF A;  1CAW B;  4AFM A;  4FPO B;  3LGR A;  1U5Y A;  5FZ3 A;  4FXG B;  4YVS B;  4AQ2 A;  1ZNP A;  3ITQ A;  2HWD 1;  1D4M 3;  1YNA A;  4AHW A;  1DQ5 A;  1K5J A;  5C71 A;  4JDN A;  2J1A A;  3RFR A;  4DUV A;  4DOU A;  5FUI A;  2WZR 2;  1RIR A;  3ZDS A;  5F8P A;  1BZW A;  1FV2 A;  4H14 A;  2FZ1 A;  3ZN6 A;  2RR1 3;  4LXL A;  4N90 A;  4AE2 A;  4FCA A;  3WT3 A;  4A2U A;  4YVW A;  5FAX A;  4DQA A;  4Z2A A;  5FYB A;  3WDT A;  1RUE 3;  1AL2 3;  3PUA A;  4Q4W 1;  5A7W A;  5A7P A;  1XRU A;  1VAM A;  2RS3 2;  2XWB B;  1QXJ A;  4Q4Y 2;  1W90 A;  1LJ7 A;  4LE4 A;  2E53 A;  2JD9 A;  2JIC A;  1D2S A;  1GZT A;  4Q4V 1;  4YVS C;  1RMU 3;  4R9D A;  3ZR5 A;  5C9A A;  1Q3E A;  2A1X A;  3THD A;  2EIG A;  4A41 A;  4EN9 B;  4NRQ A;  2ZA9 A;  1KQR A;  1SZB A;  4AW7 A;  2Y60 A;  4AVV A;  1RUC 3;  4LIT A;  4Z82 A;  1JZ3 A;  2ZAH A;  3UES A;  3CZU A;  3I2F A;  1W9S A;  3U11 A;  1UPS A;  3P3P A;  3VKL A;  1Y9G A;  5DDJ 2;  2D93 A;  5CIR A;  3SLI A;  3BPZ A;  2WBK A;  3AKR A;  4WM8 B;  1AR8 2;  2PAK A;  4XCA A;  5IVE A;  5FZH A;  1XNC A;  1TEI A;  2QQN A;  2XJS A;  1JZ4 A;  1APN A;  4AEK A;  1Z78 A;  2H6C A;  4K1Y A;  4RR3 A;  2OX0 A;  1QQP 2;  3PMS A;  3M7A A;  5T5J A;  2VMC A;  5HBA A;  5F3I A;  4CCJ A;  4C91 A;  5JOY A;  1SPP A;  2VMH A;  4N8M A;  4LHN A;  5ACA 1;  2AZ5 A;  2VUJ A;  3U14 A;  4PLN A;  1QIQ A;  2VOV A;  2BFU L;  1JMU B;  4HK8 A;  1VPH A;  3TNP B;  2O1Q A;  2HWD 3;  2Q4S A;  5FZE A;  3KV4 A;  4L9B A;  3WQB A;  3D3A A;  1TNF A;  5DZF A;  1R09 1;  4CE8 A;  4HSL A;  1RXG A;  2WQ8 A;  1KD7 A;  3VZM A;  1HDK A;  4LHS A;  4HON A;  1VRB A;  4NPM A;  4YW5 A;  5FZD A;  3I4I A;  2WO7 A;  2BUK A;  1FOD 2;  2XJT A;  4V2V A;  2ZML A;  5FP4 A;  3Q8C A;  5H9Q A;  4XIO A;  1P8J A;  5JR2 A;  1WW4 A;  1W8W A;  1WA4 A;  4HVR A;  2DVA A;  4QMA A;  3VZK A;  3WW3 A;  2B4K A;  1DG6 A;  5I0T A;  3WZ1 A;  1OF4 A;  2K0G A;  3FWE A;  4BB3 A;  1ODM A;  3R4D B;  3M8L A;  5JSP A;  3OD4 A;  1PGW 2;  4DRR A;  2JEM A;  2VTX J;  1J84 A;  3AMP A;  5F2W A;  4CDX B;  2XVK A;  4XZU G;  1N3Q A;  4RA0 A;  4Q0Q A;  5FYM A;  4CYD A;  2WT0 A;  3O1U A;  1C8M 1;  5IJR A;  1G8W A;  3CNA A;  3W20 A;  2UWB A;  3LSD A;  3PDQ A;  3OEB A;  5ACA 3;  4RR3 B;  2J1T A;  2PFW A;  5F6K A;  3VBR C;  4RQP B;  4ZS2 A;  4AHX A;  4L2N A;  2XJU A;  2WSU A;  3I59 B;  3UGH A;  4RGA A;  1TE1 B;  1UU6 A;  2YU1 A;  2Q5T A;  3C7E A;  2DVG A;  1YFW A;  1G9F A;  3DL3 A;  1LTE A;  1YIP A;  4CDU A;  3ZYH A;  4KH9 A;  2DU0 A;  4RGK A;  4UYB A;  1O4Y A;  2A3W A;  1JOD A;  1FNY A;  3FL7 A;  3THP A;  1OSG A;  1ZZ8 A;  1LGB A;  5F1R A;  1ENX A;  1XNA A;  1WCS A;  4JQT A;  3LDK A;  3FZ3 A;  2JDM A;  4QX0 A;  2WYS A;  4BH9 A;  2NLR A;  4UBG A;  5GJ6 A;  1BK1 A;  1AYM 2;  3W5N A;  4FOW A;  2A71 A;  2WNV C;  4IEQ A;  1G6N A;  5JZG A;  1R1Z A;  1PMJ X;  1JYX A;  1QJX 2;  4YLZ A;  1LEC A;  1V6O A;  4OI1 A;  5E89 A;  3RMX A;  4Y33 A;  3WNM A;  3IN9 A;  4SLI A;  4E4S A;  1ZZ6 A;  1ENS A;  1NE6 A;  4XAA A;  2YU2 A;  3UNP A;  3S5Q A;  2W87 A;  3MID A;  1QDC A;  1GKB A;  4M3C A;  5DDJ 3;  5F9T A;  3POB A;  5C33 A;  4JGY C;  4BM8 A;  1XE0 A;  4A7Y A;  1A8M A;  1GYK A;  1IQD C;  3WOG A;  1V0A A;  1WME A;  1VBB 1;  4DY5 A;  3ZYG A;  4COY A;  5C5U A;  3H8R A;  1CPN A;  4LBQ A;  4AED B;  4BQ4 A;  1GR3 A;  1IZ3 A;  1N47 A;  3ZFF A;  3ZXL A;  2JB8 A;  4JGY A;  1RED A;  4A45 A;  4D7S A;  4JVA A;  3HNM A;  3L9J T;  1OMI A;  1QOT A;  1YEW A;  1DQ4 A;  2YY1 A;  1ENR A;  2B7Y A;  2XB6 C;  1UOF A;  3EYP A;  3B9C A;  5FZC A;  5LY1 A;  2C1F A;  1O3T A;  3WR0 A;  5J48 A;  2FDI A;  1D7P M;  2RDR A;  3ZFF C;  1M06 G;  2JDP A;  1JOJ A;  1H1I A;  4NRM A;  3MFA A;  3ZMO A;  5EPA A;  3PVO A;  1AR8 3;  1QJZ A;  1POQ A;  2WFF 3;  2Y6F A;  4OYU A;  1XB9 A;  1GAN A;  3B94 A;  3EHK A;  3O7O A;  4IV1 B;  2OQ7 A;  1JTZ X;  3I2G A;  4WM7 A;  3AB0 A;  1YI9 A;  2WO2 A;  5F2S A;  2AAC A;  1YLL A;  2XHK A;  1MS4 A;  2JWP A;  4MVT A;  4U2A A;  5DMY A;  1NE4 A;  2PHF A;  3FBY A;  1KJR A;  4YG0 A;  3I3M A;  2FZ2 A;  3O0V A;  4MXW B;  5K4L A;  3TN9 1;  3AXD A;  3CL1 A;  2RDS A;  1IKP A;  1VBE 1;  4DXZ A;  1RUD 1;  1JHN A;  1CJP A;  1FI2 A;  1H6X A;  1LHV A;  3Q8A A;  1NOV A;  2Z2S B;  4ATF A;  1NY7 2;  4YWA A;  1VBA 3;  3GZU C;  1V00 A;  1W3V A;  1RUE 2;  3BIE A;  1UMZ A;  1DQ2 A;  4J6G A;  5F3C A;  2W94 A;  3MUZ 1;  1W6O B;  4LMF A;  3T1M A;  4NRO A;  4ZU4 A;  3AMQ A;  4KWL A;  3FLP A;  4LLO A;  3OB8 A;  5CA6 A;  3ZPY A;  1PNG A;  1C3H A;  4G9S B;  1O3S A;  3RI9 A;  1IOA A;  4ERO A;  3WW1 A;  2Q8O A;  1GV9 A;  4XAE A;  1IGO A;  2XDV A;  1UCX A;  1ND3 C;  1QJU 1;  1HXS 2;  3F2Z A;  3KT1 A;  4W6W A;  5A6Y A;  4FT8 A;  4XQW A;  1DGW A;  5LRR A;  2Q1M A;  3PIG A;  1FOD 1;  2RJL A;  2WYF A;  4QPG A;  1CGP A;  2ZX1 A;  3A22 A;  3FHA A;  1W39 A;  3D6E A;  3MW2 A;  4QB6 A;  3POW A;  4LUK A;  4WVV A;  1JYV A;  1VBD 3;  4I09 A;  5FPZ A;  1BEV 1;  3POG A;  2VZT A;  1ACC A;  2NMO A;  1IS6 A;  1D2Q A;  2KXL A;  2XVL A;  1IG0 A;  4XIL A;  4QU1 A;  4KBB A;  1NQD A;  3JXS A;  3ES1 A;  1E5R A;  2LRO A;  3M4F A;  4QGL A;  4PDW A;  2A70 A;  3AP9 A;  5FP8 A;  4AAX A;  1PNF A;  4PI2 A;  1ASJ 3;  1D4M 2;  1UWW A;  1VMJ A;  2KM2 A;  4AVC A;  4L11 A;  3VL8 A;  3K4Z A;  2Y64 A;  2W1U A;  4RD7 A;  4RFT 0;  3R6S A;  4BA6 A;  3BTY A;  5C3S A;  2FD8 A;  3KGZ A;  4BK5 A;  4H7L A;  2ARC A;  4R9B A;  3ASI A;  4K6B A;  1RUH 1;  4KBZ A;  5LBE A;  3SMH A;  4CDQ B;  2D44 A;  2V5D A;  4IEO A;  2XQX A;  3B9I A;  4AVB A;  4BDV B;  5CKQ A;  4M0N A;  1W9W A;  1JYT A;  4R8H A;  5FK7 A;  2VJX A;  4XJZ A;  3CJX A;  4CCE A;  1HRV 2;  1FAT A;  2TUN A;  1LHW A;  2RS3 3;  4Q4Y 3;  4I0A A;  1Q8P A;  5DQ0 A;  1UOJ A;  4H55 A;  3T30 A;  1FOD 3;  1PZ8 A;  4XPV A;  4EWE A;  4MG2 A;  1BBT 2;  4LO4 B;  1Y3T A;  3A0K A;  3LFM A;  4B3N A;  4XYX A;  3VZL A;  3C7F A;  4R9A A;  5TSW A;  3TBD A;  2WA3 A;  2GC2 A;  2A75 A;  2E33 A;  4PF5 A;  1R08 2;  2ZGK A;  3CDZ B;  4E4D X;  3RI8 A;  5CB7 A;  1JW6 A;  1RUG 3;  3QD6 A;  1W0O A;  4WV8 A;  1ZZB A;  2VVE A;  4R52 A;  1KDK A;  1PMH X;  3PJQ A;  1YFY A;  1HQL A;  4OHZ A;  1XBF A;  1ENQ A;  2YBS A;  3ZOI A;  2PMW B;  3WUC A;  2R06 3;  3JB8 A;  5D8A C;  2R32 A;  3SNM A;  2X09 A;  3HT2 A;  3ZPO A;  2WZ8 A;  4CXW A;  2QVS B;  4AFB A;  4AI3 A;  1ZRC A;  4PLO A;  4K8F A;  3UGF A;  1IKQ A;  3R05 A;  5AVP A;  4UFM A;  2NP0 A;  4BCU A;  5T3N A;  2QQI A;  2RG4 A;  1S4C A;  5HV4 A;  2OA2 A;  3NAP B;  3WG4 A;  2BOI A;  3VDD A;  3LSE A;  4Y1Y A;  3PNA A;  2NZ9 A;  1O91 A;  3FFQ A;  2ADE A;  4LBM A;  4MGS A;  2W91 A;  3HNY M;  1MS1 A;  2W92 A;  3CBN A;  5C8C A;  2CV6 A;  1COV 3;  1X33 A;  2RS1 2;  3ZM8 A;  4B29 A;  3AL6 A;  4AI0 A;  5FPU A;  2RE9 A;  2VCC A;  1XOY A;  4TZD A;  5JXG A;  1SPP B;  4LIV A;  3I2O A;  1DP0 A;  2WZR 1;  5A7Q A;  5E1R A;  1PM4 A;  3UKV A;  1AR7 1;  4AHY A;  1UYY A;  2MEV 3;  1ZRD A;  5FV3 A;  1YRZ A;  1JZ8 A;  4JDO A;  3H50 A;  2CGN A;  3WNL A;  1PGW 1;  4OLL A;  4GB3 3;  3DPR A;  1ZM1 A;  1YWK A;  3W58 A;  5C3O A;  3OY8 B;  1WD3 A;  1W9F A;  2JIJ A;  4Q1R A;  1Y9M A;  1FPN 3;  3RZM A;  3PUQ A;  2FCT A;  2ZJC A;  1FYU A;  2EAL A;  4JRA A;  3DV8 A;  3AFG A;  4RHV 1;  2PLV 1;  1GOG A;  1W9Y A;  1XE7 A;  2P3J A;  2FDJ A;  3AYE A;  3DYP A;  3M2M A;  3ZN4 A;  4EWD A;  1HXS 3;  3NJZ A;  4CUG A;  4Q5O A;  3S6P A;  2W0X A;  5KXE A;  4IV3 B;  4EQV A;  1DLL A;  1UKR A;  3HPN A;  4KWJ A;  4B4Q A;  5A33 A;  4LTA A;  1DBN A;  1OVP A;  5CZK A;  4YW7 A;  2CGP A;  1UY4 A;  1W9T A;  2OXB A;  5CAZ A;  2IFW A;  3JD7 1;  4QWN A;  3USU B;  4FPC A;  3VUO A;  4GA9 A;  4WM8 C;  1NCR A;  3OPT A;  2VUL A;  2WFF 2;  5A3M A;  2O8Q A;  2DVB A;  2WUH A;  3SHR A;  4OFG A;  4PIZ A;  1W8O A;  4L0P A;  4QXK A;  1CZT A;  1H2N A;  3B3Q E;  1XE8 A;  1AHS A;  3J7H A;  4N7I A;  3RG0 A;  3HNB M;  4K7J A;  3SH5 A;  2VZO A;  3FC0 A;  1URX A;  2CWS A;  2VQA A;  4I3P A;  3I59 A;  1J3Q A;  1YJL A;  5L36 A;  4X8N A;  5B4X A;  4AVS A;  4LR4 A;  5JIU A;  1F9K A;  1JS9 A;  5LBC A;  1QJE A;  1SLL A;  2K2S A;  3WDX A;  3K3O A;  3B02 A;  4Z8B A;  2YC0 A;  5BNN C;  3V0B B;  5DXD A;  4I2O A;  2IXL A;  2K9Z A;  4IE7 A;  5CEH A;  1EV1 3;  5JMO A;  1UF2 C;  4Z07 A;  1AR7 3;  1AJK A;  1O6U A;  3GXU A;  4E8D A;  3PUR A;  3ZSK A;  4FTS A;  4C1X A;  2VNO A;  4CCL A;  3DF0 A;  5FMD A;  1JU4 A;  2FDF A;  3N9O A;  2NPI A;  2WO3 A;  3KCX A;  4ASK A;  4AL9 A;  1N3P A;  2DV9 A;  2XLA A;  4B1M A;  1CIY A;  4FFI A;  2ZGU A;  3AMM A;  3G7D A;  4HMZ A;  1C8N A;  5DUX A;  4A4A A;  2C4X A;  4CDX C;  3RRD A;  3BAL A;  1H9P A;  1F31 A;  1DQ6 A;  1OHF A;  1RHI 2;  3TEW A;  2UY9 A;  2P1B A;  2JKX A;  4UFH A;  3GGL A;  3ILF A;  1H8T B;  2Q8D A;  4NID A;  1CZS A;  4P9G A;  4OZX A;  1W06 A;  2WAA A;  2WO1 A;  1PIV 1;  2E32 A;  4CPB A;  4QDS A;  1S0G A;  3O1P A;  1CJD A;  2BFU S;  3H3L A;  1W8N A;  1DLC A;  2ILM A;  4QHB A;  3RWK X;  3VBR B;  4AK3 A;  2WS9 2;  1V6I A;  1HV1 A;  1BEV 3;  1IS5 A;  4NOT A;  1K45 A;  5E6H A;  3VBS B;  3VHO A;  4AGG A;  1H1A A;  1MS9 A;  2W46 A;  3AJZ A;  5EWS A;  2VQU A;  1JOB A;  3NVC A;  3O5S A;  3EBR A;  3RZL A;  4YW1 A;  4BLI A;  3B01 A;  1UO9 A;  4AGR A;  3PTR B;  2A3X A;  4QX8 A;  4I0W B;  3K77 A;  3LQC A;  2JE9 A;  2R0F A;  3LA2 A;  3RNS A;  3ZO0 B;  4XQD A;  1ASJ 2;  1U5I A;  1V6K A;  2UWC A;  2VOX A;  1GFF 2;  4IV1 A;  4MGK E;  4Y5T A;  5LY2 A;  1C5H A;  1V70 A;  3KMH A;  1IQA A;  1VBE 2;  4UOJ A;  1CR7 A;  4YW6 A;  3MW4 A;  3VD7 A;  5B4N A;  5IHR A;  1GWK A;  2BER A;  2FMY A;  2WZE A;  3BYW A;  3AKS A;  4E8C A;  5DAB A;  3D0J A;  4AHZ A;  4W6X A;  1QNY A;  4BJ0 A;  4F83 A;  1K12 A;  2Z69 A;  4JGY B;  1D0G A;  5IVF A;  1XC6 A;  1L7Q A;  1ASJ 1;  1W8F A;  3OGV A;  4MHU A;  4QGM A;  1PO2 1;  1NG0 A;  2VR4 A;  2AC1 A;  5H9S A;  2ERF A;  2J1E A;  3VD4 A;  4FO9 A;  1OBN A;  1YYN A;  3OF1 A;  3HR9 A;  3LF7 A;  5FYH A;  4QQH A;  4UF0 B;  1R1A 3;  3C8X A;  1RUG 2;  3LA3 A;  3BN6 A;  1G7Y A;  4H2A A;  3EJK A;  4BLJ A;  5DUU A;  1SFP A;  4COU A;  4IEX A;  1BLZ A;  1TMF 2;  5IW0 A;  5CFC B;  3URF A;  2R06 2;  4L99 A;  2EXJ A;  1POV 3;  1LOF C;  1VBC 1;  2XBO 2;  2A6V A;  3I2J A;  3GZA A;  3PJY A;  3SEE A;  1BJQ A;  3ZFE C;  5JAX A;  1W6N A;  2GU9 A;  4A6S A;  5BNO C;  3T4V A;  4UT5 A;  1DDL A;  3PUH A;  1WWY A;  3AXE A;  4YM2 A;  5FZK A;  4BXF A;  3MFC A;  4QHZ A;  1QNW A;  1S2B A;  5A6X A;  2ARE A;  3WG3 A;  4E4H A;  4Q4V 3;  1MVE A;  4QAW A;  2VU9 A;  4C1W A;  1W2T A;  2VZV A;  1PVC 1;  1W6P A;  1JZ5 A;  2C0Z A;  2GNB A;  3CJI B;  4HKO A;  1MZ5 A;  2RS1 3;  3U1X A;  1Z7S 1;  1X7N A;  4UW5 A;  2V09 A;  4GD4 A;  3VHR A;  4CCM A;  5FO9 B;  4KMQ A;  5JVV A;  5FYC A;  3VBS A;  5KHK A;  4HXC A;  3VLB B;  4GUL A;  2VBP A;  1K5M B;  3O1R A;  1RHI 3;  1QJY 3;  3HD8 B;  4FVV A;  1UX7 A;  2QQJ A;  2HWE 2;  2R1B A;  5EJ1 B;  1HB3 A;  1GQG A;  1NXD 1;  4D69 A;  2ET1 A;  2JKB A;  2D6N A;  2VOK A;  3D0S A;  3BB6 A;  4BOW A;  1OPO A;  3A0N A;  4IL7 A;  4F8A A;  1R09 3;  5T52 A;  1UAI A;  5BNN B;  1GQP A;  1YIF A;  3GJB A;  3VN4 A;  2PN5 A;  2PHX A;  4YGE A;  5BNP C;  4BQ3 A;  4IEV A;  3RZK A;  2W3J A;  3GF6 A;  3SH3 A;  5IT6 A;  1G9D A;  4LKD A;  1UL9 A;  5H9P A;  4O9G A;  5BUV A;  5FK8 A;  2E7T A;  3FUQ A;  4LO8 A;  1I1E A;  1TME 2;  1NA1 C;  1O4Z A;  4AWD A;  4DEV A;  1ALY A;  4YNI A;  2HWB 3;  1MZE A;  3TYJ A;  4FAH A;  1F8V A;  4CU7 A;  3CHX A;  2OT7 A;  2BP6 A;  1PO1 3;  1H2K A;  3VZJ A;  2DCJ A;  5IK5 A;  1MS0 A;  2WNE A;  4JC1 A;  5GLZ A;  5LA1 A;  2P6H A;  5IVV A;  2EAA A;  4FPE A;  2RM2 2;  4CEW A;  1WBL A;  2P4E A;  1IS4 A;  3N7J A;  1CD3 G;  4X8P A;  1UNB A;  2LTN A;  4UF0 A;  3RYR A;  1G9A A;  5BNP B;  1BMV 1;  1KS4 A;  1LHU A;  2AUY A;  2HYX A;  5T55 A;  1MEC 3;  4Y24 A;  1OD5 A;  1ULG A;  5FLH A;  4BIO A;  1Z7S 3;  1RUI 1;  2Y6J A;  1W8T A;  4XUN A;  4OUE A;  1ND3 A;  1NA1 B;  3WDV A;  3HQR A;  4JTO A;  3LEI A;  5JZG B;  1K3I A;  3KLS A;  4BE3 A;  1UXZ A;  2PEL A;  4NAO A;  1SDD B;  1QQP 1;  2HWF 3;  3AM2 A;  4HT1 T;  2V73 A;  4Q2F A;  5FFO C;  3PLQ A;  1DZQ A;  1FX5 A;  2ZMK A;  2MHF A;  2R04 3;  4MO3 M;  4I30 A;  1AR7 2;  3KWV A;  4BQ1 A;  1PK6 C;  2FCV A;  4LUL A;  2EIC A;  1HLC A;  2ARX A;  4NHL A;  3WF0 A;  5KHJ A;  1W6N B;  2HEV F;  5A6Z A;  3G6J B;  1UPI A;  1YQ2 A;  3SCG A;  1RUN A;  1ZBA 3;  2XH6 A;  3PVN A;  4QQL A;  4OHV A;  2XR4 A;  3DXU A;  4N53 A;  5GM0 A;  4XUQ A;  2WT1 A;  1ULD A;  3IDE A;  3R4U A;  4XQ4 A;  4BQ5 A;  5CAD A;  4YYO A;  3N9Q A;  5I0S A;  2HWC 3;  3VHP A;  3GZE A;  5A32 A;  1J3P A;  2P5B A;  4IEW A;  1PO2 2;  5C8W A;  2VBD A;  2QZ2 A;  4Q4V 2;  5FUN A;  5HCA A;  5FZ4 A;  3F95 A;  4E2Q A;  1CES A;  4QX3 A;  4LKE A;  2ZEY A;  3HN1 A;  4BWO A;  1MQT A;  4AVT A;  4LBQ D;  5ERL A;  5K0U A;  1AX0 A;  2GN3 A;  3OUI A;  2IXI A;  5ISL A;  1HQN A;  1UZW A;  3MW3 A;  1V6J A;  5D2A A;  3EQE A;  4YW3 A;  3MIG A;  4FOY A;  1PX4 A;  1U5Z A;  2VG9 A;  3ZXD A;  1S2K A;  4W6Y A;  5HCF A;  1S2E A;  4LO7 A;  1BHG A;  5FO7 B;  1GP5 A;  4LKF A;  1AVB A;  1RIN A;  1C5I A;  3UV9 A;  2XPJ A;  1GNZ A;  3WIN E;  3W9A A;  1W05 A;  3ZFG B;  3VBS C;  2QQO A;  2YUE A;  2LW8 A;  4UFK A;  4YRD A;  2VZU A;  3ON7 A;  5C4W A;  3LEK A;  3DCQ A;  1NCR B;  2E31 A;  4Y22 A;  2YHJ A;  2EA7 A;  2GP3 A;  4KU8 A;  1G9B A;  1VR3 A;  4ZXK A;  4CP9 A;  5EV7 A;  3BTA A;  3J8F 2;  1BMV 2;  2RMU 1;  3ZKU A;  4ZS3 A;  5IAV A;  3MPB A;  4P9J A;  5KWR A;  3VKM A;  5ANN A;  2R0H A;  2Y6G A;  4KI5 M;  4Q4W 3;  4CCC A;  1J1T A;  1R09 2;  1ND2 C;  3WV6 A;  3ILR A;  1SHW B;  2BDR A;  2PLV 2;  3FFZ A;  3K48 A;  4RS5 B;  2HEW F;  1C28 A;  5F5C A;  4B7E A;  5LZ6 A;  1SBD A;  1HX6 A;  3HQX A;  3VBU B;  5E16 A;  5KHI A;  1PHM A;  1RMU 1;  2WNU A;  4N7U A;  2KD7 A;  3WDU A;  2CGO A;  2AEY A;  2VZQ A;  3H3Z A;  2IXC A;  5F7U A;  2BNM A;  3ZDV A;  5FYZ A;  4W4Z A;  4L97 A;  2NM1 A;  2J1S A;  2VMD A;  3NV2 A;  1TME 3;  3NV1 A;  2R30 A;  5FZB A;  5FXZ A;  2HBU A;  3OGG A;  1OA2 A;  3DKW A;  2FQP A;  2ZZQ A;  3N36 A;  2WS9 3;  4JX0 A;  2YBK A;  1XND A;  2WSV A;  3M70 A;  1PIV 2;  5JI9 A;  2UU8 A;  5LCW L;  3GDB A;  1V9U 3;  1G86 A;  2ZHL A;  4LBK A;  4RYD A;  4NPR A;  4TWT A;  5FP3 A;  5C9A B;  3H3U A;  3QH7 A;  4AXO A;  2ZXQ A;  4XW3 A;  3MBW A;  5FY7 A;  5GAL A;  3O0X A;  3B5L B;  2ARA A;  2WN2 A;  1EAH 3;  3ZXE A;  2VQ0 A;  4URT A;  1JI6 A;  3INA A;  3JBG 3;  3O12 A;  5FOB B;  1LEN A;  5DZE A;  5SV5 A;  4OQ9 A;  5CU1 A;  1ZBA 2;  3VKN A;  1NZI A;  1SLA A;  3E6C C;  3AP6 A;  3ZR6 A;  3AYA A;  5E8A A;  1RUE 1;  4HVO A;  4LNV A;  1GZ9 A;  1OUS A;  4QB2 A;  4LBJ A;  5FP7 A;  4NHK A;  1AL0 G;  1S0B A;  4XEZ A;  5DAV A;  1PGS A;  5LK5 A;  1JU3 A;  4RS5 A;  1FXZ A;  2WIN B;  1ODN A;  3GBF A;  3BKZ A;  3D4K A;  2DUQ A;  1H8T A;  1XYN A;  2WNU B;  3CQO A;  1KS5 A;  1NZC A;  1OQE A;  2E9Q A;  1YFU A;  3S7E A;  5A7O A;  2DWR A;  5L9B A;  1EV1 1;  1LKN A;  4QDQ A;  1E5H A;  3NV3 A;  3WCR A;  4XIK A;  3TEX A;  5L19 A;  5FZ1 A;  5C4W B;  3IDC B;  2TBV A;  5EYY A;  1GU3 A;  3RZJ A;  5CKM A;  4YGC A;  5FXX A;  5LRS A;  1HRI 1;  2WA4 A;  2P3I A;  1QOS A;  3MZH A;  5FR3 A;  2HWC 2;  3ZFG A;  5I0D A;  5FZL A;  4COZ A;  5L73 A;  1TMF 3;  3T2Q A;  1AF9 A;  5C5T A;  3AYD A;  4XFC A;  2FBE A;  1DIW A;  2ZX3 A;  1J1L A;  3LE0 A;  4BME A;  2VMG A;  4IGQ A;  3P6B A;  4DIN B;  2JD4 A;  1UZ0 A;  3OYW B;  5IYY A;  5AFB A;  2RVA A;  4XFA A;  4GZ9 A;  5A3N A;  1QEX A;  3RVH A;  3DEM A;  5EQU A;  4DEQ A;  3MIH A;  2WC2 A;  3ZYB A;  2RDN A;  1U0A A;  3V64 A;  4WZC A;  1RJ7 A;  4CU9 A;  5FRE A;  5GLT A;  4LPL A;  4MH0 E;  3UKN A;  3DUI A;  1GZW A;  1JYN A;  4LA3 A;  2ORX A;  3AKP A;  2ZKL A;  4FSJ A;  2P37 A;  1QMJ A;  4P9I A;  4XBN A;  1GMM A;  2CNA A;  1S1A A;  1FAY A;  1LAJ A;  2XML A;  4HBN A;  2FDK A;  4S2F A;  2R16 A;  3BTX A;  1Y9Q A;  2RS5 2;  4M3C B;  5AFE A;  1MR5 A;  2YXS A;  5EIY B;  4XHX A;  2RJ2 A;  3BIW E;  1WW7 A;  4UWD A;  2HWE 3;  3SIT A;  2VW2 A;  5C8C C;  1H8V A;  5ABJ A;  4OHW A;  2W52 A;  1OLQ A;  3KM5 A;  3A23 A;  2Z4F A;  2X5I C;  4JGZ A;  4Y20 B;  1JHJ A;  4OUS A;  2C6S A;  4B1L A;  1GP4 A;  4PCR A;  5K0U C;  4P9L A;  5CFC A;  1NCR C;  3NO8 A;  3OY8 A;  1F15 A;  2Q1Z B;  5A1A A;  3QLQ A;  1LOA A;  2JG8 A;  2QBX A;  5JIA A;  4D6R A;  1ZBE 2;  2XLG A;  5LB6 A;  5KBF A;  4CXY A;  3MF6 A;  5FYI A;  3BPS A;  4CP0 A;  3U4X A;  3BGA A;  2OPK A;  2P17 A;  1WW5 A;  2HYK A;  2VCM A;  1A78 A;  5D1I A;  2OW4 A;  1REF A;  5LEJ A;  1XU1 A;  2WQ4 A;  5FQ0 B;  3AP7 A;  5KXD A;  2IZW A;  3NWK A;  3MO4 A;  2D5H A;  4LOT A;  3POJ A;  2R06 1;  4OZO A;  1QJF A;  5T50 A;  3C7H A;  3QBQ A;  4F7Z A;  2C5D A;  1KEX A;  3KV9 A;  1PK6 A;  2LAL A;  2OZJ A;  2E26 A;  5EFU A;  3VKO A;  2DCZ A;  3MIC A;  5GKA C;  1SBE A;  4QGN A;  1KJL A;  1W6P B;  5HXM A;  1PGL 2;  2ZGN A;  2PQQ A;  1QXR A;  2B5H A;  1GOF A;  2H6B A;  1XQN A;  2JG9 C;  5FY4 A;  3TEZ A;  1Z7S 2;  2XJP A;  2Q1F A;  2ZGM A;  5C3Q A;  4X6R B;  5JOW A;  5CG9 A;  3LWC A;  2JEC A;  1KDM A;  4HAN A;  4IER A;  1UY0 A;  4BXS V;  1OA3 A;  5I91 A;  1NLQ A;  2F4L A;  2HWE 1;  2QQK A;  3OEA A;  4DRV A;  4AFC A;  2JDY A;  4L8Q A;  2Y33 A;  2BV4 A;  1QH6 A;  4QXH A;  5JUV A;  2GC0 A;  3K46 A;  1O4T A;  3A4U A;  1N3O A;  5F37 A;  1HN1 A;  3KV5 A;  3ZYI B;  4JAA A;  1PGL 1;  1GZW B;  1VBC 2;  2XBO 1;  1FV3 A;  3ZN6 B;  3HIF A;  4Q27 A;  4QPW A;  4BIS A;  5FQ0 A;  5T54 A;  1I6X A;  1AR6 2;  2EXK A;  4YFW A;  4L92 A;  2PLV 3;  2W95 A;  4LBO A;  2B9U A;  3OD0 A;  1Q5O A;  1X82 A;  1OXC A;  3AJY A;  3AZV A;  2XL9 A;  2XL7 A;  3E97 A;  2VUA A;  3J9S A;  1VAV A;  3EXU A;  1ND2 B;  3L2Y A;  1KFU L;  4HFS A;  1W04 A;  2WWU A;  3NL1 A;  4C0B A;  1SEF A;  5JSR A;  1US3 A;  3FHQ A;  2JJ6 A;  3GZT B;  2J1V A;  5FP9 A;  4LO6 B;  1F5J A;  1QOO A;  5GLU A;  2VOT A;  1QH7 A;  3B69 A;  5JOX A;  2VZP A;  3DYO A;  1MVQ A;  1LU2 A;  2ZGR A;  3IM0 A;  4LBL A;  4F3J A;  3NJX A;  1R08 3;  4XHB A;  4XAB A;  4AQT A;  2QQL A;  3APB A;  1E57 A;  4WVM B;  5E88 A;  4M3C E;  2EF6 A;  1I9R A;  4JHT A;  4K40 A;  4MGY E;  1PX3 A;  2AH2 A;  3AVS A;  1LHO A;  4RL7 A;  5JDB A;  1EAH 2;  3MF9 A;  1XPW A;  5FY9 A;  5CIS A;  4IUG A;  2DVD A;  4XZP A;  4FQ4 A;  5D21 A;  3ZSE A;  3WD5 A;  3N7L A;  4QPI A;  1HQW A;  4RHV 2;  3NST A;  2XHN A;  3E6D A;  3WUD A;  4ZON A;  4KWU A;  2FDG A;  2SBA A;  2W1Q A;  5JZG C;  3N7M A;  1BKZ A;  2BYV E;  5BNO A;  1FMD 3;  2D3S A;  2BBV A;  3ECQ A;  2ZX0 A;  4GMP 0;  4KG8 A;  4FTE A;  1PO1 1;  2ZCW A;  1JYI A;  3KVB A;  2IXJ A;  4ZHN A;  2WZP P;  1I3H A;  3LA7 A;  4E2G A;  2XJV A;  4PQQ A;  3SQO A;  4CTE A;  2I2S A;  2WDB A;  3MYX A;  3PTY A;  3UYJ A;  3HBK A;  1EAH 1;  5K8S A;  1YO8 A;  4FXK B;  1XU2 A;  2AGS A;  2QFE A;  4UW3 A;  1MEC 1;  3HWJ A;  4W50 A;  1W6M B;  1AYN 1;  4LIU A;  4DXS A;  3GNE A;  3OBA A;  2X5I B;  3ETQ A;  2CWM A;  4MSV A;  4XTM A;  4D7Y A;  1DF0 A;  2QE3 A;  1VBB 2;  1OFN A;  2Y38 A;  1DYK A;  4P9X A;  4R4X A;  1B35 B;  4JDM A;  3VHN A;  3WP6 A;  4CEY A;  3VGI A;  3BOW A;  3QCW A;  4JRL A;  3NNM A;  2ZGQ A;  1HRI 2;  4PIY A;  3NNL A;  4MZU A;  4OHY A;  1QF3 A;  2ZHM A;  5GZG A;  4DIQ A;  4YGD A;  2OII A;  5A7S A;  5IK8 A;  1ZBA 1;  2WWS A;  4RQP A;  4UW6 A;  4MGQ A;  3KCY A;  4CCK A;  1LOC A;  1NYW A;  2R6Q A;  1LOF A;  1POV 1;  3OUJ A;  5BY5 A;  1TG7 A;  1T2X A;  1UOG A;  4EN6 B;  4ES9 A;  4CRQ A;  3KHB A;  4YZ3 A;  3ZFG C;  5FLJ A;  3FLR A;  4CSW A;  2QNK A;  4CP9 B;  5FMO L;  4Q4X 1;  1DYP A;  3KGL A;  2BZD A;  5LBB A;  1UN1 A;  3POY A;  4CUA A;  2QCS B;  3AC0 A;  1PZ9 A;  4QX7 A;  2BJS A;  2BOJ A;  5FYV A;  1HB4 A;  4EN7 B;  1WMF A;  4XBL A;  3NAP A;  1OH3 A;  2XG3 A;  5DAP A;  5FZ9 A;  3T09 A;  3N3H A;  2D6P A;  4JTN A;  4QKB A;  5IAX A;  2VXJ A;  2WFF 1;  3ZXF A;  1LGN A;  2C26 A;  2BVB A;  5HCB A;  1OOP C;  1RUG 1;  2VC9 A;  1MS8 A;  3VBF C;  2BTV C;  1X9P A;  3C3V A;  4LO5 B;  1GP6 A;  1HRV 1;  1RMU 2;  3VB9 A;  1H2L A;  1W2A X;  3NAP C;  3AMN A;  4JV4 A;  5JOZ A;  4OUL A;  1YXW A;  1RUC 1;  4FPY A;  5AVA A;  1A34 A;  1ULC A;  1YQ8 A;  3P5B A;  4IGO A;  1IHM A;  3SIS A;  1F5F A;  1R1A 1;  1AR8 1;  3O14 A;  2J1R A;  3A7Q A;  2G4I A;  4HET A;  3LOI A;  4EYU A;  3VD5 A;  1ZVF A;  3K4A A;  3GM8 A;  1QXP A;  1QY4 A;  1XJA A;  3T2T A;  4CPB D;  4GXL A;  1RUJ 3;  4TN7 A;  4P14 A;  3UET A;  1W28 A;  2KA3 A;  4Q0P A;  3OGS A;  3R0R A;  4HN1 A;  2XKO A;  3PU3 A;  5IVY A;  1MZ6 A;  2ZZJ A;  3MHZ A;  5K9Y A;  1LOE A;  4XAC A;  2D98 A;  3OPZ A;  1EY2 A;  3POI A;  4GJZ A;  2EAK A;  2RMU 3;  4GQ7 A;  2WNO A;  3J7M A;  3JB4 C;  4GKX A;  2A6Z A;  1RUC 2;  1UY1 A;  5C9A C;  2PHT A;  5JI7 A;  4E27 A;  4XVH A;  5IK7 A;  1FMD 2;  1CAW A;  5FZO B;  4TLF A;  1UZZ A;  5DUV A;  1OUX A;  3ABZ A;  4JQR A;  5FPB A;  3TOJ A;  3AZW A;  2LUW A;  4BU2 A;  1RUD 2;  3P3N A;  4NIH A;  1TNR A;  5EHD A;  1NCQ B;  4XF3 A;  4D6S A;  2IC1 A;  1TME 1;  2IFR A;  2XJR A;  3RZG A;  2E63 A;  4XFF A;  4OI4 A;  2SLI A;  2FDH A;  4O65 A;  4IE6 A;  1D0H A;  2IVI B;  5HCH A;  4Y1Z A;  4QU2 A;  3T0D A;  1QDO A;  2VY0 A;  1UKG A;  3GBG A;  3VZN A;  1EUT A;  1TZO A;  5FBJ A;  2EIE A;  2VXR A;  2JG8 C;  2L9L A;  2O8O A;  4MAD A;  1UIK A;  3ZXK A;  1OH4 A;  4Q8L A;  5FZ6 A;  2XGX A;  1S55 A;  4RS5 C;  4XJU A;  1KGY A;  1ZRI A;  2RS1 1;  3AP5 A;  2PAM A;  2OZ6 A;  3ES4 A;  3V0A B;  3VDB A;  4GWM A;  3VBU C;  3NJY A;  3BUC A;  1DZT A;  5APA A;  1IPS A;  4IEU A;  5FMC A;  4IET A;  3WF1 A;  5C4W C;  1Q8S A;  1K42 A;  5EYX A;  4FBF A;  1Z0H A;  2Q30 A;  3OYW A;  1QKQ A;  4P5Y A;  1CIW A;  2RM2 1;  3S7I A;  4NPL A;  3WVJ A;  2VNG A;  3V65 A;  4HVQ A;  1OLM A;  2VVD A;  4P08 A;  2X05 A;  1RUJ 1;  5HI0 A;  4YPJ A;  3U10 A;  4GWJ A;  1VBD 2;  2GND A;  3HAG A;  4O9E A;  3ZSM A;  1HV0 A;  4D8M A;  2F6B A;  2EXI A;  3BU0 A;  5FY8 A;  2ZTN A;  2JDA A;  3VBH C;  4XET A;  3OBR A;  1WGP A;  1WCD J;  1H0B A;  2XJQ A;  2Y26 A;  4XUO A;  2QQW A;  2Y8K A;  3MI8 A;  4LHK A;  2ATF A;  1O8S A;  4I3G A;  4AI2 A;  3LD8 A;  2VVF A;  5FMB A;  5I0R A;  5I0U A;  2WLQ A;  5ABJ B;  1S0E A;  3T0A A;  3IT8 A;  2CL2 A;  1T6B X;  3WF4 A;  1JZ6 A;  1NLS A;  1DQ1 A;  2PHD A;  3PUS A;  3TAY A;  3J26 N;  5C3P A;  2BBA A;  3M3I A;  1W6Q B;  2WFP A;  4J1W A;  2C9A A;  4QX5 A;  1QJX 3;  2XBO 3;  3WG2 A;  2DDU A;  4JGZ B;  1H8T C;  1SCR A;  3CF6 E;  4Y20 A;  3O1T A;  2ZPX A;  5A70 A;  2D6M A;  3DXT A;  3CO2 A;  4MV2 A;  1HB2 A;  2GC3 A;  4COW A;  2GNT A;  2PYT A;  2OS2 A;  5FCC A;  3E1F 1;  2VAU A;  1ULF A;  5AC9 3;  4XFB A;  3KT7 A;  1RVF 1;  2JE8 A;  5ABJ C;  5CYY A;  1AX1 A;  2QKD A;  3WP3 A;  1UY3 A;  1WCK A;  3H1Y A;  3SKJ E;  3KF3 A;  3WCS A;  4CDQ C;  4YZ2 A;  4LE3 A;  4YAR A;  4ZKT B;  2BVV A;  3CIH A;  2Y6K A;  1ULE A;  3FN9 A;  3NNJ A;  4XOG A;  1AR6 1;  3O1O A;  4QQ2 A;  1YUD A;  2DVF A;  3ZSJ A;  5CFD B;  4RGG A;  4LQR A;  5FIX A;  1SCS A;  2D3P A;  2GMM A;  3RJ2 X;  3ENR A;  4EJR A;  3VBF B;  4LOS A;  3N9M A;  5J1X A;  2EIB A;  2JDZ A;  4BK4 A;  3MUY 1;  4TTG A;  1W0N A;  2JDK A;  5KC6 A;  1SMV A;  1X9T A;  4NHY A;  1GZC A;  2VZ3 A;  1L7R A;  2BWA A;  2D7F A;  4BQX A;  2NQY A;  4IDZ A;  5J98 B;  1DGR N;  3WHU A;  4COV A;  4FPL A;  1UZV A;  4ONU A;  4XXP A;  4OVE A;  2BNN A;  1O3R A;  2N7G A;  4ASM B;  5FWJ A;  4K9S A;  4QHO A;  3VDC A;  3WY6 A;  3WX5 A;  3NQH A;  2C9K A;  3UJO A;  1GLH A;  1ZRR A;  1GIC A;  1EUU A;  2UWA A;  2JG9 B;  1RUD 3;  5J3U A;  4CDW B;  2D43 A;  2YFZ A;  4RHV 3;  4WVM A;  5D8A A;  2J7M A;  3KQ4 B;  5ANQ A;  3WW4 A;  3T3Y A;  4QXC A;  3ZYP A;  3VDD C;  3PVE A;  3IBM A;  2W1S A;  3E5X A;  4LK6 A;  4BQW A;  5C8C B;  4GMP 1;  2WNV B;  3ZYF A;  3ZKY A;  4AI9 A;  3IMN A;  4KGQ A;  1GBG A;  2PQS A;  4XXA A;  1RTV A;  2WN3 A;  2CDP A;  5CFC C;  1CAV B;  5BNQ A;  1X36 A;  1GSL A;  3AP4 A;  1QJY 1;  1VBA 2;  4A44 A;  3I54 A;  4ZZ8 A;  5LWB A;  4MGT A;  1N1S A;  1T6G C;  1NCQ C;  4FTB A;  4KG0 A;  2JDN A;  2ZAA A;  3U0Z A;  3I3B A;  3PME A;  2CAU A;  4M4P A;  5BNO B;  1I5Z A;  3HMY A;  3JCI A;  5JXH A;  3TEY A;  4XFI A;  3I8T A;  4XUP A;  1ZZ7 A;  2FMD A;  4A3X A;  1SFY A;  1XXN A;  2DBI A;  2Y0I A;  3JD7 3;  3ACH A;  1OOP B;  4K3U A;  4LKS A;  4MGZ E;  4YW4 A;  4AED C;  2VL4 A;  4OCT A;  1AX2 A;  5BPX A;  1W6Q A;  1WA6 X;  3LFI A;  1OI6 A;  3MV1 1;  3CEW A;  1F4H A;  4ISQ A;  4Y1V A;  4PT6 A;  1S0D A;  2VZS A;  4Y4R A;  1QWR A;  2Z79 A;  2VE1 A;  4ISR A;  4TLG A;  1BBT 3;  4DB5 A;  5C7G A;  4AG4 A;  5A80 A;  2BGP A;  2YV8 A;  1RL3 A;  2RMU 2;  3UK9 A;  3ZLI A;  2ZGO A;  4IV3 C;  1O5L A;  4XJ8 A;  2A7A A;  1NA1 A;  5EJZ B;  4ES8 A;  4B8E A;  1RUF 2;  5BNN A;  5BV6 A;  3ETP A;  5A33 B;  3IPV B;  4A42 A;  1C4R A;  4MYE A;  3U75 A;  5FTT C;  1U12 A;  4EE2 A;  3AL5 A;  3M3O A;  4RSU A;  2PHL A;  4WBB A;  3PUI A;  4CU6 A;  4BHP A;  5LK7 B;  4GH4 A;  2WNU C;  2FCU A;  4NVP A;  4X6Q B;  1H9W A;  2R07 3;  4JCK A;  4C90 A;  3VBF A;  4B4R A;  1YI7 A;  4GMP 3;  2BU9 A;  3WQ7 A;  3FUO A;  3POE A;  2BPA 2;  1GOH A;  1S0J A;  1ULP A;  1OA4 A;  1SG3 A;  1Y4W A;  4YVW B;  4E9K A;  4BZ4 A;  1YFX A;  2BEO A;  2GAU A;  3JUU A;  4N9I A;  4K21 A;  1MZF A;  2ID4 A;  4QKD A;  1Q43 A;  2ZMN A;  1GNH A;  4QM8 A;  3VD3 A;  3ZXA C;  4ZZ5 A;  4WZF A;  3D82 A;  3C2U A;  2LM3 A;  2V4A A;  4PBO A;  4XMA A;  4CEY B;  5GLV A;  4CEW B;  2QDR A;  2DFB A;  5K7P A;  2Y6L A;  1H2M A;  3OSD A;  1UD1 A;  2JG8 B;  4KNC A;  3RMY A;  5CKN A;  2DUP A;  4HK9 A;  4YG3 A;  1WCQ A;  1HJG A;  2IVJ A;  5A32 B;  1VIW B;  1YJK A;  3ACG A;  3J8F 3;  3A21 A;  2WQZ C;  2EXH A;  1M4W A;  1JUH A;  1UX6 A;  4DUW A;  4AEM A;  4LLF A;  3NNG A;  5A1F A;  5JXI A;  1B35 C;  1BCX A;  3TNQ A;  4GB3 2;  5HV0 A;  5FZI A;  3I2K A;  5I8Y A;  2G19 A;  5T5L A;  3U4S A;  5BYN A;  4XE9 A;  2WLP A;  3O1S A;  4AVA A;  4CEY C;  3C7O A;  3LEG A;  3SXW A;  3UT0 A;  3H8U A;  3KCC A;  3HJR A;  5FYU A;  2W08 A;  3RYK A;  2D40 A;  5FXV A;  3S57 A;  2O0O A;  1COV 2;  3DYM A;  2PXJ A;  2OVU A;  2YGL A;  2MEV 1;  2CTV A;  2IXK A;  3KF5 A;  1KIT A;  5DPN A;  3KVA A;  3W5M A;  3V0B A;  2GNM A;  2D5F A;  1OOP A;  2R04 1;  4CCO A;  1YQC A;  2BGO A;  4H3W A;  1PVX A;  5FY1 A;  3IAQ A;  3VBO C;  3ST7 A;  2CU5 A;  4UXA A;  2GH2 A;  2D6L X;  1NLR A;  4LK7 A;  1W0P A;  2DU1 A;  1EYB A;  1Q8O A;  3FLT A;  1RGS A;  4MUV A;  4PQ9 A;  5LBF A;  1FPN 1;  4N9H A;  3MLL A;  3PHM A;  2WR9 A;  2ARB A;  1NKG A;  1VRH 1;  1MPX A;  3ZVX A;  1JN2 P;  3AZZ A;  4A6O A;  1SDW A;  2W2I A;  4CDW C;  4CCD A;  3B00 A;  2PHU A;  1EPW A;  3VDD B;  3BI3 A;  4OUM A;  5AC9 2;  3D8C A;  1RVF 3;  3OBZ A;  2CHH A;  4EN8 B;  1US2 A;  1OT5 A;  2ZX4 A;  4HSJ A;  3SKV A;  5GZD A;  5M0T A;  1LRH A;  2ZX2 A;  2MEV 2;  5LAT A;  5J96 B;  2X10 A;  4DMI A;  4OI0 A;  3JD7 2;  4FPF A;  1UY2 A;  1VBD 1;  1A3K A;  2GDF A;  2KR2 A;  3K75 B;  3LAG A;  4IE4 A;  3UL2 A;  4C0H A;  2QQV A;  4O61 A;  1RYY A;  1HRV 3;  2VGD A;  1UYZ A;  1RUF 3;  3MEP A;  2VZR A;  2YB7 A;  1CWP A;  3OG2 A;  4CP1 A;  4EN0 A;  5DG2 A;  2DTY A;  4XFG A;  1E5S A;  2I07 B;  1FPN 2;  1MAC A;  1WMD A;  2OUJ A;  4FP2 A;  4S2D A;  5L7O B;  5FKC A;  3I3D A;  3TN9 3;  2VZ1 A;  3FBM A;  1ULO A;  3FJS A;  3MLK A;  4IND A;  2A6W A;  3BCW A;  1L3J A;  3DKQ A;  1OKQ A;  1V9U 1;  2PAE A;  3K4D A;  5A3P A;  4NIA A;  5LEK A;  1BVV A;  3AYC A;  1LOB A;  1WKY A;  4OMC A;  4CDU C;  5AC9 1;  4Q4X 3;  3IWZ A;  4LOR A;  3WNX A;  1NUK A;  3DGT A;  3WG1 A;  2WII B;  4M00 A;  1SQ4 A;  4FOQ A;  3POF A;  4MGI E;  1JYW A;  3K2O A;  2QJV A;  2VW0 A;  4XF4 A;  4HKW A;  1AJO A;  2JIG A;  4AOC A;  1CVN A;  3JQX A;  3LPG A;  4NRP A;  1N1T A;  1UIJ A;  2NYY A;  3JBG 1;  4KL1 A;  2H0B A;  4XFH A;  2Q0A A;  3H1M A;  5CVR A;  3LPF A;  2HWD 2;  5IUQ A;  1EPZ A;  1W8U A;  2F4P A;  3SC7 X;  4FOV A;  5CNA A;  4IV3 A;  3ZFE B;  1DYO A;  3VKF C;  2AYH A;  5J09 A;  5FYY A;  3GYD A;  2ZEX A;  3LZZ A;  1MS5 A;  3PVB B;  1WCU A;  4NWV A;  4CXX A;  2VCA A;  1WZX A;  1OVS A;  2V5Y A;  2VNV A;  4P5H A;  3VD9 A;  4J25 A;  4CDU B;  1HW5 A;  4DS0 A;  4SBV A;  1WD4 A;  5T5P A;  3FHI B;  2GZW A;  1HIX A;  3HBZ A;  3AKT A;  1UZY A;  4P02 B;  5LA9 A;  3SEP A;  2UYB A;  3WNP A;  2ZHK A;  3H8O A;  3K51 A;  4KWK A;  5FMO S;  1BBT 1;  4HOO A;  2NMN A;  5L7O A;  3ALQ A;  4AFD A;  4QKF A;  4YVW C;  5KC5 A;  3Q8E A;  2D3R A;  1OLM E;  1UXX X;  4XUT A;  4IV1 C;  3GJA A;  3R4S A;  5IFT A;  3I2I A;  4XF0 A;  3HN3 A;  4PJY A;  1G9C A;  5HPO A;  4I0B A;  4NR1 A;  5F6L B;  3OGR A;  4QX1 A;  1HB1 A;  1BEV 2;  2DF7 A;  2VPV A;  2CDO A;  2GMP A;  3GBW A;  3EB7 A;  3HOB A;  2QDN A;  5FUP A;  5FZ8 A;  4D3W A;  1PO1 2;  3T2O A;  3PU8 A;  3VV1 A;  2JX9 A;  5FPL A;  4D0Q A;  1ZZC A;  4QKN A;  1VJ2 A;  4HKL A;  1WLW A;  2IWG B;  3O1V A;  1W2O A;  1XNK A;  2ZEW A;  4ATE A;  1OLR A;  3NV4 A;  4HL0 A;  1RUI 2;  2JDU A;  3I97 A;  3WXP A;  3ZXJ A;  3IDA A;  3VBO A;  4CCN A;  5FLI A;  4AYU A;  4LUM A;  2ZKN A;  4OHX A;  4EWA A;  1A8D A;  4GIQ A;  4BQ2 A;  1JZ7 A;  3GCW A;  4MXW A;  2I74 A;  1RVF 2;  3GCX A;  2WKK A;  3KQR A;  3TB0 A;  4V2W A;  5KXC A;  5FJH A;  3H7Y A;  2I45 A;  5BNP A;  3U37 A;  2JG9 A;  3RYP A;  1VBE 3;  1Y7B A;  5KXB A;  2VNR A;  2RS5 1;  2E51 A;  2LS6 A;  2R07 2;  5JXJ A;  4A7Z A;  3OBT A;  2X5I A;  3QAC A;  1HKD A;  3T4H B;  3ACF A;  4XC9 A;  3VBR A;  4WM7 C;  5FZ7 A;  1CZV A;  2OQ6 A;  2YRO A;  1QJY 2;  1VBA 1;  1B35 A;  1H1M A;  4BMB A;  3WF2 A;  2YG0 A;  2HWF 1;  3KSC A;  1CAU B;  1REE A;  5FBZ A;  3TN9 2;  4EZH A;  3I7D A;  4ZU5 A;  4IEZ A;  1CON A;  5A3L A;  3LDB A;  4ITC A;  5KHH A;  5CFD A;  3IZO A;  2QUO A;  5DAQ A;  3NRU A;  4QPG B;  3LIG A;  4S2H A;  5HXV A;  2B39 A;  1NT0 A;  1ONA A;  2XXZ A;  1UU4 A;  1O59 A;  2VOW A;  4Q0S A;  4PHZ A;  4Q4X 2;  4UW4 A;  2YC2 A;  3LDR A;  4H7M A;  3E5U A;  4ZY9 A;  2Q8C A;  3LOB A;  1NY7 1;  1O5U A;  1PK6 B;  1WLT A;  2GME A;  2HLE A;  5G04 L;  4ZXE A;  5A7W B;  1UYP A;  1OKO A;  1ZX5 A;  4MHR A;  2WRA A;  4YGB A;  3KB5 A;  4OQ8 A;  3N35 A;  1LB2 A;  1XNT A;  1DGW X;  3WNO A;  3E5Q A;  4ZPI A;  3OGJ A;  4AZZ A;  2XOM A;  4FQZ A;  2D97 A;  1AYN 3;  2ADD A;  4QD2 A;  5I93 A;  5DAX A;  4Z92 B;  2D6K A;  2DTW A;  1CX1 A;  2XVG A;  5F5I A;  1UYX A;  5K0U B;  1C8M 3;  2HBT A;  3MGU A;  1QJX 1;  1JYC A;  1BVP 1;  2ZHN A;  4GH4 C;  4QPG C;  5EJ3 A;  4D6Q A;  4DUX A;  4IGP A;  1VE0 A;  5L7O C;  2B46 X;  4FPH A;  4YZ4 A;  3ZX7 A;  4DY3 A;  3I2D A;  4ASL A;  2A6Y A;  3JU9 A;  2HKX A;  4NJ4 A;  1DCS A;  3OJB A;  4CUC A;  4IE0 A;  3M3E A;  4Y26 A;  3LCP A;  5IAT A;  1CAV A;  5FO8 B;  1MEC 2;  2A6X A;  1V6N A;  5A6Q A;  5LW9 A;  2AEZ A;  2DFC A;  2P3K A;  5JPM B;  1ST8 A;  2HWB 1;  3OPW A;  3SCF A;  1ZA7 A;  1F2N A;  3H7J A;  4HN0 A;  1AR9 2;  2GAL A;  2ZGS A;  3M3Q A;  2Q8E A;  5CG8 A;  2ZAB A;  3HQU A;  5BXX A;  4OI2 A;  5FOJ B;  2PTM A;  2WWJ A;  4M01 A;  3RJR A;  3TRS B;  3W59 A;  3NKG A;  1X8M A;  3W21 A;  2TEP A;  2YYO A;  1OF3 A;  5FYS A;  2DUR A;  3KD4 A;  1ZYB A;  2J22 A;  1LR5 A;  1S0F A;  4HPK A;  2ZBJ A;  1H30 A;  4KGG A;  5F32 A;  3UKT A;  4AI8 A;  5A3W A;  4CDQ A;  1LNS A;  2HEY F;  1AXK A;  1TQ5 A;  1ZA4 A;  2NN8 A;  2R49 A;  2VO5 A;  2WJS A;  2Z42 A;  1X50 A;  5LAS A;  3WF3 A;  5KR7 A;  3H8X A;  5JCT A;  1NXM A;  4S2G A;  4AAP A;  4FI9 A;  3VBU A;  2VQT A;  3OCP A;  3WNK A;  4ARX A;  4CVU A;  1NX9 A;  1H4H A;  1ZBE 1;  2HWB 2;  1C57 A;  2HWF 2;  2DBN A;  2VTX A;  1JXN A;  3AKQ A;  4MLO A;  4MOA A;  1PO2 3;  1XSR A;  3DEC A;  2ORZ A;  1PVC 2;  1W2U A;  2RDQ A;  3H1W A;  4M4R A;  4QB1 A;  3KT4 A;  1V6L A;  3RZZ A;  4IEY A;  5J36 A;  2OPW A;  1H4G A;  3T1L A;  5IFP A;  4QDR A;  3S0M A;  3GHM A;  4XTP A;  1LUL A;  3I2H A;  4YM1 A;  3T0B A;  3BTZ A;  2DCY A;  1RUI 3;  2YC4 A;  5FRA A;  5IVJ A;  4GJY A;  1XSQ A;  1OUR A;  4AGV A;  5A1L A;  3ROU A;  3U07 A;  1VB4 A;  5GZE A;  1CQ9 A;  1WBF A;  1RUH 2;  2VD7 A;  1UMI A;  5DUW A;  1OQ1 A;  4JKK A;  3V56 A;  1VMF A;  4DXT A;  4EZ4 A;  1VMH A;  4AEJ A;  4LT5 A;  1J58 A;  1LGC A;  2WAB A;  3KHC A;  5CBL A;  1JBC A;  2QZ3 A;  3NMB A;  1JH5 A;  1ND2 A;  2Y0O A;  3J7N A;  1J83 A;  1HJF A;  1W8H A;  2RM2 3;  3DPR B;  4NAM A;  4XMI A;  2YFU A;  4A7K A;  4FFG A;  2TNF A;  3ZFF B;  3RS6 A;  1FMD 1;  3Q8F A;  1LOD A;  4AF9 A;  4RFR B;  1S0I A;  4DXR A;  4PLM A;  2DCT A;  5JLV A;  4MX3 A;  4U36 A;  3I49 A;  2WL1 A;  4KQ7 A;  2ZGL A;  3WQ1 A;  1LCL A;  3WP4 A;  4ARY A;  1UOB A;  3AMH A;  3MIB A;  3CKH A;  4LEJ A;  4C8D A;  1K5M A;  5DDJ 1;  3IDB B;  4JHZ A;  1CAX A;  3L2H A;  4QPI B;  2P34 A;  3MPP G;  4YSF A;  2JDH A;  3RZH A;  1BQP A;  3ACL A;  4XJ9 A;  1AYM 1;  4QPY A;  4WM7 B;  5JR7 B;  2OUH A;  3WP5 A;  3S5A A;  4DO0 A;  1O3Q A;  1VAK A;  2G9F A;  2CSG A;  4LA2 A;  5FKB A;  3RGB A;  1R08 1;  1D4V B;  2BGC A;  3GHN A;  1W3X A;  1OC1 A;  4NO4 A;  4JZR A;  2AR6 A;  4XDP A;  4YVS A;  2DYC A;  5FPV A;  2GN7 A;  5FYT A;  4YW2 A;  1RC6 A;  1MS3 A;  2YBP A;  5I8S A;  4Z2W A;  5DG1 A;  4Q4W 2;  5L9V A;  3HT1 A;  3J8F 1;  1V9U 2;  2E6V A;  2WT2 A;  4PI0 A;  1E5I A;  1AZD A;  1OFS A;  3DN7 A;  4FFF A;  3SCH A;  1QGL A;  4P9Y A;  1IPK A;  4FP3 A;  4QPI C;  2JXA A;  2A5Z A;  3EO6 A;  5C70 A;  3UJQ A;  2BQP A;  3ACI A;  3BOP A;  4K20 A;  4UBH A;  3M1H A;  4DPN A;  4NII A;  4ET7 A;  1OD3 A;  4CUB A;  1LHN A;  3NKT A;  2ZOE B;  3JBG 2;  2JEN A;  4CDW A;  3HEI A;  3POS A;  5JWP A;  4QXB A;  5LA0 A;  2YZ4 A;  4N43 B;  4HZF A;  4TYS A;  1ND3 B;  2XKP A;  2Y6H A;  2E7Q A;  2YGM A;  4AQS A;  1QJU 2;  3ZYR A;  1MQT B;  5EP9 A;  2CAV A;  2R1D A;  4MET A;  4O7X A;  4LHL A;  3USU A;  2HJI A;  1YQ6 A;  5C6C A;  3VL9 A;  2W39 A;  1PVC 3;  4Q29 A;  3N4M A;  2RJK A;  4AR2 A;  4CEW C;  2G9Z A;  3WDY A;  5CFD C;  2XUM A;  2VBB A;  2WAO A;  5A3U A;  1VLN A;  1F4A A;  2VMF A;  3ZFE A;  5DAW A;  1RIT A;  1B09 A;  1U5X A;  2BWC A;  2P3Y A;  3MIF A;  4GAZ A;  4NN0 A;  4N53 B;  4DNY A;  3MLJ A;  3RDI A;  3OOX A;  5IK4 A;  3K3N A;  2XUE A;  3WHT A;  1SLB A;  3PIJ A;  1I5P A;  3CZJ A;  1D4M 1;  4HG6 B;  2OYZ A;  5FY5 A;  1ZRE A;  4KU7 A;  3WDW A;  4CP2 A;  3N9P A;  1MQT C;  4AFA A;  3VZO A;  4PF1 A;  1JZ2 A;  4PDW C;  1AL2 2;  1UMH A;  1W6O A;  4XBQ A;  2CY6 A;  3ZN5 A;  4QT6 A;  1KRI A;  5IWF A;  2MPF A;  1WLD A;  2PHW A;  5DZG A;  4YZ1 A;  1ZRF A;  1JOP A;  4D7T A;  3ZSL A;  1VRH 2;  3B7M A;  1SLT A;  4GKY A;  4IE5 A;  3WEZ A;  4NWW A;  5DN2 A;  1RHI 1;  1UQX A;  2A73 B;  4BQY A;  3I3Q A;  3VDA A;  2BW8 A;  3H9A A;  3LEM A;  4N43 A;  5I8T A;  3N7K A;  2YDE A;  2ZGP A;  4N53 C;  4Y3O A;  5IVB A;  5F5A A;  4YG6 A;  4NHX A;  1CAX B;  4CU8 A;  1SBF A;  4DFS A;  1PIV 3;  2B45 X;  4RQP C;  1GQH A;  1W8Z A;  5GZF A;  3NW4 A;  2BRT A;  4M3C F;  4B7K A;  5JMC A;  3VBO B;  3WW2 A;  4W65 A;  4LJH A;  1QHD A;  2J1U A;  4GH4 B;  4OMD A;  2AEN A;  3IB3 A;  1EV1 2;  2VW1 A;  1AL2 1;  3MDP A;  4I01 A;  3BVC A;  5A3O A;  1DHK B;  1F35 A;  4AI1 A;  5KHG A;  4R4Z A;  3NJV A;  5FZ0 A;  3X29 B;  4Q8K A;  3IAP A;  5F5Q A;  4M0H A;  3JQW A;  4UI9 L;  3B93 A;  3N9N A;  1LES A;  1VBC 3;  1Q8V A;  5F3E A;  4D94 A;  4P00 B;  3V0A A;  2W1W A;  3QOP A;  5FZF A;  3ATG A;  1OPM A;  3AZY A;  3WLU A;  3WNN A;  3LKJ A;  2WZR 3;  5FPX A;  1CN1 A;  1KXG A;  1NAE A;  4HLT A;  1A6C A;  1OQD A;  2RR1 1; 
#chains in the Genus database with same CATH homology
 5G05 L;  1GOH A;  1ULP A;  1PMH X;  1SG3 A;  4CU9 A;  4LPL A;  3VD3 A;  2ID4 A;  4ZZ5 A;  1JYN A;  2ORX A;  3MV0 1;  2X09 A;  2WZ8 A;  1GMM A;  3T08 A;  3WSO A;  2Y6L A;  5EIY B;  2QQI A;  4W8J A;  2RJ2 A;  1WCQ A;  4GWI A;  3ACG A;  3A21 A;  2Z4F A;  3A23 A;  4MGS A;  1JHJ A;  2W91 A;  3HNY M;  4DUW A;  2V72 A;  2W92 A;  3NNG A;  5JXI A;  3ZM8 A;  2VCC A;  3I2K A;  5JXG A;  5A1A A;  2QBX A;  1DP0 A;  4UAP A;  3C7O A;  3LEG A;  3BGA A;  3HJR A;  1UYY A;  1JZ8 A;  2VME A;  3T2P A;  3WNL A;  3DYM A;  3MO4 A;  2W9X A;  5DPN A;  3W5M A;  4OZO A;  4JKL A;  3CMG A;  2BGO A;  3C7H A;  3THC A;  3IAQ A;  1KEX A;  2V4V A;  2E26 A;  1GOG A;  3DYP A;  5HXM A;  4RN5 A;  1NKG A;  1MPX A;  4A6O A;  1GOF A;  3HPN A;  5CZK A;  1UY4 A;  1W9T A;  5LA2 A;  1US2 A;  1OT5 A;  3SKV A;  4BXS V;  1UY0 A;  2X10 A;  2QQK A;  2WUH A;  3OEA A;  1UY2 A;  3K75 B;  1W8O A;  4L0P A;  1CZT A;  3J7H A;  5JUV A;  3K46 A;  1RYY A;  2EID A;  1UYZ A;  2R7E B;  3HNB M;  2VZR A;  1HN1 A;  2YB7 A;  3OG2 A;  2VZO A;  1O8P A;  4QX2 A;  3I3D A;  4QPW A;  2VZ1 A;  1ULO A;  5B4X A;  3P1I A;  1GUI A;  3K4D A;  2W95 A;  1WKY A;  4OMC A;  5JMO A;  1NUK A;  3GXU A;  4E8D A;  1JYW A;  3FHQ A;  2VCB A;  2VTF A;  1US3 A;  4XUR A;  3LPG A;  2J1V A;  1JU4 A;  2WO3 A;  3LPF A;  2VOT A;  1CIY A;  1DYO A;  3I3E A;  2VZP A;  3DYO A;  4A4A A;  2C4X A;  2W47 A;  3NJX A;  2QQL A;  2ZEX A;  1PX3 A;  2JKX A;  3GGL A;  2VCA A;  1CZS A;  3VD9 A;  1XPW A;  2WAA A;  1GNY A;  2WO1 A;  4IUG A;  1TVG A;  2E32 A;  2W5F A;  4QDS A;  3SEP A;  2RV9 A;  4P02 B;  1W8N A;  1DLC A;  3WNP A;  1K45 A;  2XHN A;  4KWU A;  2W46 A;  2W1Q A;  3C7G A;  2VQU A;  2ZEZ A;  1H6Y A;  1W99 A;  1UXX X;  2OKX A;  4XUT A;  5IFT A;  4A3Z A;  3III A;  3I2I A;  3ECQ A;  3HN3 A;  3K77 A;  3LQC A;  2DCK A;  5HPO A;  3OGR A;  4QX1 A;  4JKM A;  3HOB A;  2VM9 A;  2CDO A;  4PQQ A;  3EB7 A;  2WDB A;  2QQM A;  2B9V A;  3T2O A;  2XON A;  4D0Q A;  4W50 A;  4TXW A;  1R64 A;  2ZEW A;  4DXS A;  4UOJ A;  5B4N A;  3I97 A;  3OBA A;  3VD7 A;  5IHR A;  3IDA A;  2BER A;  2WZE A;  4E8C A;  4BJ0 A;  1JZ7 A;  1K12 A;  5C71 A;  1XC6 A;  1L7Q A;  3OGV A;  2J1A A;  4DUV A;  3U37 A;  5FUI A;  2VR4 A;  2J1E A;  3VD4 A;  2LS6 A;  5JXJ A;  4MGQ A;  3ACF A;  3C8X A;  3BN6 A;  1CZV A;  4Z2A A;  1TG7 A;  1T2X A;  3WF2 A;  2YG0 A;  2JD9 A;  3I2J A;  2BZD A;  3SEE A;  3NRU A;  4CUA A;  3AC0 A;  3THD A;  4A41 A;  1O59 A;  3T09 A;  3PUH A;  2YC2 A;  4ZY9 A;  1JZ3 A;  3UES A;  2HLE A;  3CZU A;  5G04 L;  3I2F A;  1W9S A;  4ZXE A;  2C26 A;  2VC9 A;  4QAW A;  2VZV A;  1XNT A;  1JZ5 A;  2WBK A;  3WNO A;  2XOM A;  4KMQ A;  2QQN A;  1JZ4 A;  1CX1 A;  2J1R A;  3A7Q A;  1UYX A;  3VD5 A;  3K4A A;  3GM8 A;  2VMC A;  1UX7 A;  2QQJ A;  5EJ1 B;  4DUX A;  3UET A;  3OGS A;  4CUC A;  1GQP A;  3WQB A;  3D3A A;  1UY1 A;  2WQ8 A;  2W3J A;  4XVH A;  4LHS A;  3ABZ A;  1P8J A;  5JR2 A;  4DEV A;  2B4K A;  4CU7 A;  1OF3 A;  1OF4 A;  2J22 A;  2DCJ A;  1J84 A;  1LNS A;  5LA1 A;  4XZU G;  3WF3 A;  2VO5 A;  3T0D A;  4ARX A;  1EUT A;  4FI9 A;  2EIE A;  2VQT A;  5IJR A;  3WNK A;  4CVU A;  2L9L A;  1NX9 A;  4MAD A;  4MOA A;  1OH4 A;  3DEC A;  2HYX A;  2ORZ A;  3OEB A;  2J1T A;  4QB1 A;  4M4R A;  1KGY A;  2Y6J A;  3VDB A;  4XUN A;  4OUE A;  5IFP A;  3C7E A;  4QDR A;  3LEI A;  3WF1 A;  1K3I A;  1K42 A;  1UXZ A;  3I2H A;  3T0B A;  1SDD B;  2YC4 A;  3FL7 A;  4P5Y A;  4MO3 M;  1XNA A;  4P08 A;  2EIC A;  2X05 A;  1UMI A;  4QX0 A;  4YPJ A;  3WF0 A;  2WYS A;  4JKK A;  1YQ2 A;  4GWJ A;  4DXT A;  3W5N A;  4D8M A;  2WAB A;  2JDA A;  1J83 A;  4XUQ A;  1PMJ X;  4XUO A;  1JYX A;  2YFU A;  2Y8K A;  1O8S A;  3WNM A;  3UNP A;  3T0A A;  4DXR A;  2W87 A;  3WF4 A;  1JZ6 A;  4QX3 A;  2ZEY A;  4ARY A;  2BBA A;  1IQD C;  3CKH A;  4JHZ A;  2DDU A;  1PX4 A;  4A45 A;  1BHG A;  3HNM A;  3EYP A;  3E1F 1;  1D7P M;  2QQO A;  2JE8 A;  2LW8 A;  5CYY A;  2VZU A;  1UY3 A;  3SKJ E;  4OYU A;  3LEK A;  2E31 A;  3CIH A;  2Y6K A;  3FN9 A;  3I2G A;  2WO2 A;  4LQR A;  5C70 A;  3ACI A;  4ET7 A;  5DMY A;  5J1X A;  2EIB A;  2Y6G A;  1OD3 A;  4BK4 A;  4KI5 M;  3MUY 1;  4TTG A;  1W0N A;  3HEI A;  1SHW B;  5LA0 A;  2VZ3 A;  1L7R A;  2Y6H A;  2KD7 A;  2VZQ A;  1H6X A;  5F7U A;  3VDC A;  3NQH A;  4W4Z A;  2C9K A;  2VMD A;  2J1S A;  1EUU A;  2YFZ A;  4JX0 A;  2J7M A;  2WAO A;  1F4A A;  2VMF A;  5LCW L;  3MUZ 1;  2W94 A;  3GDB A;  2W1S A;  4RYD A;  3OB8 A;  2ZXQ A;  3MBW A;  2PQS A;  2WN3 A;  2CDP A;  1I5P A;  2WN2 A;  3CZJ A;  4HG6 B;  3F2Z A;  4A44 A;  4ZZ8 A;  1JI6 A;  3A22 A;  3FHA A;  4QB6 A;  4PF1 A;  1JZ2 A;  3I3B A;  1UMH A;  4M4P A;  1JYV A;  2VZT A;  5JXH A;  4QB2 A;  4XUP A;  3JXS A;  4LKS A;  3WEZ A;  5DN2 A;  3ACH A;  2VL4 A;  1JU3 A;  3VDA A;  4AAX A;  3MV1 1;  1F4H A;  1UWW A;  4CU8 A;  4CUB A;  3CQO A;  3K4Z A;  2Y64 A;  2W1U A;  4PT6 A;  2VZS A;  4BK5 A;  4QDQ A;  5C7G A;  2J1U A;  2V5D A;  4OMD A;  1GU3 A;  4AG4 A;  2XQX A;  3IB3 A;  4BDV B;  1W9W A;  2BGP A;  2VJX A;  5I0D A;  3NJV A;  5EJZ B;  3IAP A;  3T2Q A;  4UI9 L;  3ETP A;  5DQ0 A;  3LE0 A;  4A42 A;  3P6B A;  4P00 B;  1UZ0 A;  2W1W A;  5IYY A;  2RVA A;  3PUI A;  4CU6 A;  3WNN A;  4GZ9 A;  3C7F A;  1NAE A;  4DEQ A;  2E33 A;  3CDZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...