2W1SA

Unique ligand binding specificity of a family 32 carbohydrate-binding module from the mu toxin produced by clostridium perfringens
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
139
structure length
139
Chain Sequence
NPSLIRSESWQVYEGNEANLLDGDDNTGVWYKTLNGDTSLAGEFIGLDLGKEIKLDGIRFVIGKNGGGSSDKWNKFKLEYSLDNESWTTIKEYDKTGAPAGKDVIEESFETPISAKYIRLTNMENINKWLTFSEFAIVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title N-Acetylglucosamine Recognition by a Family 32 Carbohydrate-Binding Module from Clostridium Perfringens Nagh.
pubmed doi rcsb
source organism Clostridium perfringens
molecule tags Hydrolase
molecule keywords HYALURONOGLUCOSAMINIDASE
total genus 35
structure length 139
sequence length 139
chains with identical sequence B
ec nomenclature ec 3.2.1.35: Hyaluronoglucosaminidase.
pdb deposition date 2008-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2w1sA00
1EUTA 3CKHA 2KD7A 3I3DA 3NQHA 3CIHA 4OZOA 1O59A 2VMDA 4XUQA 3VD3A 2Y6HA 3HEIA 2OKXA 1UY2A 4MGSA 1XNTA 5DN2A 4XVHA 3P1IA 2WZEA 3ECQA 1UY3A 2DDUA 2QQMA 1DLCA 1H6XA 3WSOA 3C8XA 2W94A 2Y8KA 4MOAA 4Z2AA 4L0PA 5IJRA 4UOJA 3I3EA 5I0DA 1GUIA 4BK5A 1SG3A 5F7UA 3MUZ1 2J1VA 3T2OA 5LA1A 1YQ2A 3IAPA 3OBAA 3HNMA 4JKLA 1H6YA 3I3BA 4JKKA 2E31A 2YC4A 1I5PA 4UI9L 4JHZA 2Y6GA 4CVUA 4P5YA 1RYYA 4JKMA 1W8NA 3K75B 3CZJA 2L9LA 1DP0A 4XUOA 4QB2A 4QDRA 1IQDC 2W5FA 3WEZA 1GQPA 3WNMA 4YPJA 1JZ8A 3NRUA 3UNPA 2VZQA 3PUHA 4QDSA 4D8MA 2VZRA 5IFTA 5LCWL 2VOTA 3HNYM 1JI6A 5EJZB 3BN6A 2C26A 3GM8A 3LPFA 4AAXA 1SDDB 1JZ4A 1GOFA 3UESA 1KGYA 3SEEA 3IB3A 1F4AA 5JMOA 1CZVA 4XUPA 4E8CA 1GU3A 2CDPA 3J7HA 2EIBA 3MV11 1JYVA 5JXHA 3I2IA 4RYDA 3W5MA 3WF3A 4OYUA 2YB7A 3T08A 2DCKA 2VZTA 2ORZA 3ETPA 1UZ0A 2E32A 2YFZA 1US2A 4UAPA 2QQJA 2J1TA 4BXSV 3OEAA 1UY4A 3DYOA 1D7PM 2C9KA 2VQUA 3DYPA 3K46A 4HG6B 3WNNA 2WAAA 5B4NA 1UXZA 5C7GA 4XURA 3VD5A 2ORXA 2WQ8A 2Y6LA 3GDBA 4M4PA 5A1AA 2HYXA 1UX7A 2W91A 3I97A 5IFPA 1GNYA 4MGQA 3WNOA 4QB6A 1UYYA 3ABZA 2J1RA 4LKSA 1US3A 1J84A 4KI5M 2J22A 1P8JA 4KWUA 3THCA 3IDAA 4TTGA 3HJRA 1WKYA 2JDAA 3I2KA 1UXXX 3A22A 2ZEWA 5LA0A 2ZEYA 4DEVA 2WBKA 5HXMA 5DMYA 3ACGA 2ZXQA 3BGAA 1UY1A 3I2JA 2QQOA 4ZY9A 2J1AA 4BJ0A 2VZUA 2VCBA 2WO3A 1W0NA 1PMJX 1OH4A 1CIYA 2QQIA 1W9TA 3F2ZA 4E8DA 4BK4A 1W99A 5EJ1B 4QX3A 4CUBA 3MUY1 4QAWA 4CU6A 4ZZ8A 3T0AA 2J1EA 3T0BA 3WF4A 3GXUA 5JXJA 2YC2A 4AG4A 1ULPA 2XOMA 3I2GA 3SKJE 4DXSA 1NX9A 2BGOA 5IHRA 2LW8A 2LS6A 2W1UA 4XUTA 3I2HA 5CZKA 2WO2A 3HN3A 3P6BA 3WNLA 4GWIA 1SHWB 2V4VA 3EYPA 1JYWA 3NJXA 1NAEA 3LEGA 2XQXA 3OGVA 5C71A 2X09A 1EUUA 4DUVA 3HOBA 2W47A 3C7FA 4P02B 1JU3A 4IUGA 2YG0A 2J7MA 2VCCA 4A41A 2X05A 5HPOA 1KEXA 3K4AA 2EIEA 1TVGA 4MADA 1JU4A 1OD3A 1JZ6A 5JR2A 4GZ9A 3A7QA 3VD9A 3WF2A 2Y64A 2ZEXA 4FI9A 3C7OA 1F4HA 3CZUA 1K42A 2EICA 2WABA 1HN1A 4P08A 3PUIA 1CZTA 3THDA 4A3ZA 2QQLA 2W92A 1LNSA 1PX4A 3OEBA 1JHJA 3VDBA 2VZ3A 3VD4A 3MV01 5G04L 3D3AA 3K77A 2JKXA 2W46A 2W3JA 3FL7A 1XC6A 1W9SA 3SEPA 3K4DA 4TXWA 1PMHX 2XONA 1W8OA 3DECA 4A45A 2VMCA 2QQKA 1W9WA 5B4XA 4ZZ5A 1JZ3A 3MO4A 4CU7A 2ZEZA 4LPLA 2CDOA 1UMHA 5DPNA 1UY0A 3HPNA 2W95A 1NUKA 4M4RA 5C70A 1BHGA 2YFUA 4PQQA 4ET7A 4DUXA 1JYNA 3VDAA 2JE8A 1GOHA 3C7GA 2W1SA 1XPWA 1UYXA 4LQRA 3AC0A 2V72A 2VTFA 3I2FA 3NNGA 4QDQA 4QPWA 3ACFA 1UWWA 5CYYA 4DUWA 1JZ5A 2VZOA 2B4KA 3K4ZA 2VO5A 3NJVA 5G05L 2W1WA 2Y6JA 4LHSA 5JUVA 2J1SA 3LEIA 3HNBM 4XZUG 1ULOA 2BGPA 3WF0A 1CX1A 2R7EB 5LA2A 1O8PA 3W5NA 1UMIA 1GMMA 4OMCA 4QX0A 4QB1A 2RV9A 2B9VA 3CMGA 3C7EA 4A42A 2VJXA 2VZSA 4A4AA 1PX3A 2WAOA 1DYOA 3IAQA 1OF3A 2RJ2A 2JD9A 1NKGA 2W87A 3VD7A 2VZ1A 1GOGA 2VZVA 2VZPA 4ARYA 2J1UA 4QX1A 4XUNA 3U37A 2DCJA 2BZDA 3ACHA 4OMDA 1WCQA 2W9XA 4MO3M 4W50A 3LEKA 1UYZA 2BBAA 5J1XA 4CU8A 2Z4FA 3T09A 5DQ0A 3A23A 5EIYB 3T2QA 1K12A 2EIDA 5IYYA 3IIIA 3LE0A 2ID4A 3VDCA 2HLEA 4ARXA 3GGLA 3LPGA 1JYXA 2VMEA 3EB7A 4DEQA 4RN5A 1JZ2A 3WQBA 2E33A 1XNAA 3OGRA 2VCAA 3E1F1 3UETA 2QQNA 3LQCA 3OB8A 3T0DA 3WNPA 4W8JA 2E26A 2WYSA 1OT5A 2WDBA 3A21A 4CUCA 3ACIA 4GWJA 1J83A 3WNKA 2PQSA 4ZXEA 3DYMA 2WN2A 3FHAA 1CZSA 1K45A 2RVAA 4PT6A 2BERA 5JXGA 4CU9A 1OF4A 3SKVA 4D0QA 2V5DA 2WZ8A 2Y6KA 1TG7A 4A44A 2WN3A 3WF1A 1O8SA 5FUIA 4BDVB 1L7QA 2VL4A 2WUHA 3CDZB 3OGSA 4DXRA 2VQTA 3CQOA 4KMQA 3FHQA 1JZ7A 4CUAA 4OUEA 2W1QA 1MPXA 3FN9A 3OG2A 4QX2A 1L7RA 2C4XA 3T2PA 3ZM8A 2X10A 4PF1A 2XHNA 1R64A 1T2XA 2VMFA 2VR4A 3MBWA 1K3IA 2WO1A 3C7HA 2QBXA 4JX0A 2VC9A 4A6OA 4W4ZA 4DXTA 3JXSA 5JXIA 4P00B 2VM9A
chains in the Genus database with same CATH superfamily
1QXPA 2GNBA 2K9ZA 4AW7A 4BLIA 1PGL1 1ODMA 4RGKA 2XJPA 3CKHA 4OFGA 3I3DA 4FPHA 4OZOA 4BXFA 2VMDA 4XUQA 2FDFA 4XDPA 1Q5OA 2WZR1 5IW0A 5KBFA 3VZNA 4KNCA 1OURA 5FPLA 4CDUC 4OVEA 1COV1 5IAXA 1DU3D 2WZEA 1UY3A 2DDUA 1BCXA 4ATEA 4JTOA 1BEV2 1PGSA 3C8XA 3PIJA 4MOAA 4MXVA 2RJLA 1NCRB 4Z2WA 3H50A 3KV6A 5FLJA 3JUUA 5IJRA 3KQRA 2MEV3 4OHWA 1Q8VA 5IK8A 1ZBA2 4WVMB 1W6OB 4NIIA 1GUIA 1C5IA 4Q1PA 3AMQA 4XIOA 5ABJB 3VKFC 2G19A 1RIRA 3KVAA 4K6BA 1GSLA 2K46A 1JW6A 1G9CA 5DAVA 4RS5A 4XF3A 3NAPC 5CKMA 4DY5A 1NOVA 4AFMA 3GBWA 3HNMA 4N90A 4XFAA 4BQXA 4UFHA 4YW4A 3W20A 4UI9L 3T1MA 4JHZA 5I91A 4QPYA 2G9FA 2ILMA 2PLV1 4D6QA 2HJIA 3ZIXA 2QFEA 4QB2A 5LRRA 1X7NA 2HEVF 2ENRA 1LOGA 2A75A 2WNEA 3E5XA 2Q8OA 3BU0A 4G3YC 1HXS3 4NVPA 1MS4A 4AVBA 4QM8A 5FAXA 1GQPA 1B09A 1F8VA 4JGYA 1IGOA 4FFHA 4AYUA 4KH9A 5ANNA 3NRUA 3WG3A 1JZ8A 2NYYA 4XDQA 3LSEA 5DUVA 4CUGA 5GLWA 2VZRA 1MVQA 2G9ZA 2ZTNA 3ELNA 3MYXA 4D8MA 4KWJA 4RR3A 1BEV3 2PTMA 2AEYA 1JI6A 5A32B 3BN6A 3H8XA 1ENXA 4EWEA 3LPFA 4AAXA 4E4ZA 4EZ4A 3JBG3 3DKWA 2ZGSA 1JODA 4LNVA 5FKCA 4HXCA 1AJOA 2ZGLA 4Q5OA 4YW2A 1UU6A 5IVBA 3MF6A 3SEEA 5FK8A 5H9QA 3CJIC 1CZVA 4LK6A 3TAYA 3VBUB 2XPJA 3WDXA 4WBBA 1YXWA 2EIBA 1JYVA 4NRQA 2HWC1 4YM1A 5FZ7A 2Q0AA 3ZKUA 3W5MA 5FZ4A 2VXJA 2YB7A 1R1ZA 4IDZA 5J96B 5GZCA 3AMHA 3BKZA 1US2A 2QQJA 4XDOA 4FOWA 3O1SA 3ZR6A 3JU9A 2YUEA 5BNOA 1CAWA 2CSGA 4CPBD 4CCDA 5LY1A 1D2SA 5FTTC 3LGRA 3M3EA 2GAUA 5TSWA 4Y5SA 3NV1A 2NQYA 1SFYA 2ZCWA 3DYPA 5FP3A 1PVC3 5L36A 1ZZ6A 4KGQA 3UGFA 5L9BA 3FZ3A 3GZAA 2RDNA 3KT7A 1S0FA 2WT1A 2OUJA 3G6JB 1UXZA 4L97A 3QH7A 3TEXA 1OVSA 5C7GA 3NMBA 4S2FA 2VECA 2VTXA 3VD5A 2DBNA 3AK0A 4Q0QA 1S0DA 3MGUA 4AEDB 1S0JA 4AL9A 5A1AA 5BNQA 2G4IA 5C3QA 3B02A 4XZPA 4CP0A 4BPZA 1WLWA 4MGKE 5IFPA 4WM8B 5EP9A 2RS12 4BA6A 1QWRA 2RMU1 1R082 1YQ6A 1UKRA 2EXJA 3KT1A 4QB6A 4JGYC 4QX7A 5IK5A 3WHUA 5J36A 1FI2A 2WNUA 4KI5M 1X36A 3LDKA 2WNVA 3THCA 4RHV2 4IERA 4D7TA 2VAUA 1WMDA 4HBNA 4E9KA 3O7OA 4RGGA 1YEWA 1LOFA 5LA0A 4O65A 1N3OA 3CF6E 4DEVA 5HXMA 1B35C 1I1EA 1MQTC 2RM21 1FMD3 1QNYA 1RUE2 3ACGA 4INDA 4OZXA 3KLSA 4K21A 4NIAA 2VG9A 4HL0A 1UU4A 3I2JA 3INAA 3RDIA 2VZUA 3PURA 1YFXA 1W0NA 1AHSA 5FO7B 4LEJA 1XNBA 2CU5A 1OH4A 4G4FA 4E2GA 1N3PA 1QH7A 2QQIA 1G9BA 2ZGPA 3LCPA 2XL9A 1OXCA 1S0BA 3DCQA 4E8DA 4HKOA 4N9HA 1DG6A 3D0JA 1PK6C 1AR83 4QX3A 1MR5A 2PXJA 3AKRA 1NCQB 1FPN2 1GZ9A 2J42A 3LFIA 4LHLA 4XJZA 4LK7A 5FZ0A 1ENSA 1SLTA 4C91A 4LORA 5JI7A 3WDWA 1W6OA 5FP9A 4CU6A 4EN7B 3WXPA 2JXAA 3FJSA 5C4WB 2A1XA 1UU5A 3GXUA 3D8CA 5L19A 1UOGA 1ZBE1 1AR71 3B93A 2YC2A 2CGPA 3PUSA 3POGA 4QPGC 3S30A 3WZ1A 1ULPA 3GZUC 3VBRA 3BTYA 2ZHMA 2BGOA 2ATFA 2R30A 4DXZA 2A6ZA 2LW8A 2YPDA 2DCYA 3FHIB 3NNMA 4XBNA 2A5ZA 2ZOEB 1ASJ3 2W1UA 5L9VA 4NIGA 4GALA 1RUF3 1J58A 3E6CC 3CNAA 1VRH1 2YMZA 4ZONA 1OLQA 2XBO1 4UBHA 5L7OB 2WO2A 1EV13 4YW5A 3O1OA 5F37A 3MZHA 5B2GB 4WZCA 1J3QA 2V4VA 2WA4A 4NUBA 1DGWA 4XEZA 3UT0A 5K8SA 1UF2C 2XKPA 4LXLA 4PLOA 5FLHA 1Z78A 4XQWA 4FPLA 3VB9A 3OGVA 4IGPA 1HRV3 4L2NA 3JD72 1WLTA 2WFF1 4R9CA 1SBDA 1W3VA 2EAKA 4DIQA 5FZ6A 3AFKA 4MX3A 3C7FA 1ZA4A 4CE8A 1QJY2 3I59B 5L7OC 3WW1A 1DBNA 5FJKA 4IUGA 2J7MA 1TMF3 3USUA 1BK1A 1WMFA 3K3OA 4I3PA 1JYIA 5BYNA 3POYA 1XE8A 3AMPA 1ZBE3 1TVGA 1FPN3 3ITQA 5FYIA 1JU4A 5KHJA 1N3QA 3H1WA 4GH4A 4IETA 4EN9B 3M3QA 1NA1A 1UPIA 1MZEA 2HWE2 3A7QA 3QH6A 4NRMA 1YQ8A 2VUDA 3ROUA 5C5TA 4LUMA 5CADA 3RYPA 1GWLA 1VJ2A 2E63A 1MVEA 1LHOA 2VUJA 3C7OA 4TLGA 2OZ6A 2HBUA 5FUNA 4HFSA 5BNNA 1YO8A 1NXMA 2CHHA 4C1XA 2D97A 4UW6A 4UF0B 3THDA 2QQLA 1W6MA 1KFXL 2IFWA 3AP4A 4QX5A 4AVTA 3HBZA 4YZ4A 1IS6A 1N1SA 1RUJ2 2JG9A 2R0FA 2WNOA 3N9QA 3JQWA 4K3UA 3M1HA 3CHXA 3GBFA 2XR4A 3AZYA 3VD4A 1ND2C 4Q26A 4Q4Y1 1OUSA 2ZGRA 2A73B 1Q8SA 3SEPA 4FO9A 4X6RB 1PMHX 3NL1A 2XWBB 2E7TA 2EXKA 4LO6B 1VAMA 4A45A 1AR61 1WZXA 4Q4X2 2JIGA 4UFKA 3IWZA 5FZFA 4GMP3 3HN1A 1X9PA 4LPLA 1RHI1 1UMHA 4PF5A 4XXAA 3OD4A 4JGZB 2VUAA 3U78A 1MS8A 2AGSA 1ZYBA 1AX1A 4LO8A 3FFZA 4Q0PA 4M4RA 5D21A 4YFWA 3ZFFA 4DUXA 3VDAA 3MLJA 4NHKA 4IGOA 1W6PA 2AC1A 2R042 2YC0A 3AZXA 1FNZA 2W52A 4D6RA 3ENRA 2BUKA 4QHBA 1VB2A 3ST7A 1YUDA 4ZU5A 1HQWA 5A7OA 2XWJB 2Z5WA 2O0OA 2WS93 4LKDA 4V2WA 5FZ1A 2D6NA 2JDHA 3UV9A 1FX5A 3NNGA 2FZ1A 4EN0A 5LBCA 2DYCA 1UWWA 3LDBA 4K1YA 1ZVFA 1SFPA 1OOPC 3MPPG 4KG0A 4PIXA 4K8FA 5C6CA 4YW7A 4NHMA 2B4KA 4FXKB 4Q0VA 1VBB3 5LK5A 3VBFB 1D2QA 2Y6JA 3KF5A 2J1SA 4EN8B 1YQCA 1UOJA 1W2NA 2JG8A 1XNCA 4F3JA 5CKNA 4LKEA 3N7KA 5A33B 1WMXA 2GC0A 5F2SA 4FPOB 1AR81 1W2AX 3PTRB 2F4PA 4Q4V2 5I0RA 3ZXGA 1Q43A 1HQNA 1YJLA 1AL23 2X29A 1LOBA 3VZJA 3ZSKA 4EV0A 5K0UA 5LZ6A 1R083 4ORFA 2GP3A 3DXUA 3PIGA 4HMZA 4I01A 4OMCA 4OHZA 2CWMA 4EWDA 2ZA9A 3B01A 2RV9A 3CMGA 3BUCA 2SBAA 4CCEA 3PJQA 4GA9A 5KHIA 4Q0SA 3VDDA 4H2AA 4XJ9A 1OOPB 2RJ2A 4LE3A 1Q8QA 4HANA 1PK6A 4S2HA 4CDQA 4RGAA 2VZ1A 4BQYA 1GOGA 2WA3A 1E5SA 1AYM3 5A7SA 2EAAA 1JOJA 3ZXKA 1VMFA 2J1UA 3M70A 4JC1A 1TNRA 4XUNA 1VBC2 2DCJA 2RJKA 3ZVXA 4YZ2A 2BZDA 2Z42A 2LM3A 2RDRA 3ACHA 3RFRA 3WW3A 1WCQA 4IL7A 4Z8BA 5KXEA 5KXBA 4M3CE 4S2GA 1PNGA 5HCHA 3LEKA 1U0AA 1ODNA 5A6QA 4JV4A 1GZCA 4YGCA 5DQ0A 4M0NA 2R1DA 1APNA 2JDNA 1GP5A 3AMMA 1PO11 2VVFA 3TNPB 3T2QA 4IESA 4AQTA 5EIYB 4RL7A 1SQ4A 3IIIA 3LE0A 3BTAA 2H6CA 1S55A 1CAVB 2PAKA 1H2KA 1MEC1 4EYUA 5FZEA 2C0ZA 3EB7A 2Y33A 4ZU7A 3WD5A 3WQBA 4PDWB 2E33A 1E5HA 2VD7A 3V0BA 2WLQA 3PU3A 3OGRA 1XU1A 4J6GA 4COWA 1ND3C 3WNPA 1PHMA 3TN92 4IV3C 1GYKA 1PNFA 3E97A 1OKQA 1CD3G 3A21A 5DUUA 2VPVA 3SCFA 4FT8A 3O12A 2ZX2A 2CY6A 4CUCA 4OI0A 1RGSA 5A7WB 2ZAHA 3ACIA 4XTPA 5T50A 1J83A 3TNQA 5BNNB 2RS52 2HWC3 1S2KA 1WW6A 2WN2A 1VBD2 5IVFA 2YU1A 1CZSA 1VALA 2GMPA 2DVAA 2BNMA 1UZVA 1BVP1 2D43A 3JCIA 3NWKA 4GQ7A 4PT6A 4META 1KQRA 2BERA 2XBO2 2YDEA 3H3ZA 2ZGTA 1RVF2 3GZTB 3JD73 4CU9A 4D0QA 2ZX3A 4QU2A 2WZ8A 3RNSA 1BJQA 4K9SA 5FZGA 3NAPB 2XL7A 1HIXA 1OA4A 1NY72 2HBTA 3THTA 4JCKA 4AHZA 4ASMB 1H8TA 3POEA 4QXCA 3CDZB 4M3CB 4LTAA 3VHRA 2RR12 4QX8A 4RQPC 2D5FA 1ULGA 3CQOA 3FHQA 2QQUA 4D7SA 4QT6A 1ZREA 2JJ6A 2UURA 1WBFA 2WYFA 1GNHA 4XFGA 1BMV2 5EV7A 3W59A 4YRDA 1G9DA 4JDOA 4LOSA 1F35A 2WR9A 3NNFA 4QX2A 4YM0A 4FAHA 1EAH3 1CONA 3IM0A 3T2PA 2YV8A 3T1LA 1DYKA 1X82A 2AREA 2X10A 1U5ZA 2MPFA 4UFMA 5FPXA 1PVC1 1R64A 3CJIB 2JDZA 1PM7A 2VR4A 1NLSA 3TN91 3UJQA 4XBLA 1BKZA 1QXJA 2QBXA 2ZACA 2GC3A 5FIXA 4Y3OA 5F5QA 3SISA 5F9TA 4HN1A 1GFF2 4W4ZA 1IKPA 1MS1A 4Y33A 2UWAA 3POBA 4ASLA 4DQAA 1UKGA 4LBNA 4N43C 3HAGA 1AXKA 3GJBA 5FCCA 1LOEA 5CB7A 5FWJA 1VRH3 2AR6A 4Q4X3 3DUIA 2XBO3 2DF7A 5FDBA 1O59A 1IPJA 3VD3A 2Y6HA 2OKXA 5FXVA 5F3GA 5KHGA 1UY2A 2FQPA 1XNTA 1LTEA 4XVHA 3IDEA 3P1IA 2VH9A 5C4WC 2IXIA 5C8CB 4P9LA 3WSOA 3O1RA 4UW5A 1TME2 3R05A 1WLCA 1ULFA 2B39A 2W94A 2Y8KA 4XACA 3ZSJA 5FP8A 1AL21 1GICA 4WVMA 2R061 3VBFC 4JVAA 4GB33 2QCSB 4AHWA 1JYTA 3LEMA 4XFBA 4UOJA 4XCBA 2Q8DA 5I0DA 4PI2A 1H30A 2R043 5FO9B 5KC5A 1MACA 2X53S 2Q1ZB 1TMF2 1SG3A 5F7UA 1REEA 2IFRA 2OQ6A 1SDWA 2NLRA 4JHTA 3T2OA 3WCRA 2ZKLA 2P37A 3BPZA 5AC92 3A0NA 5D8AC 3LZZA 2BFUL 2HWE3 1NCQA 2RR11 3J7LA 4H7MA 4ISQA 2YHJA 3I3BA 3OPZA 4XF1A 4Y1ZA 1HW5A 2E31A 2YC4A 4HT1T 4NHLA 1GP4A 4P9JA 3DEMA 1CQ9A 1H2NA 3VBRC 4W6YA 2UYAA 1F5JA 4IE0A 3CZJA 3K75B 4XUOA 1PO22 2VOVA 4GXLA 1W2OA 1HRV1 1AR62 4AQ2A 1N1VA 4JGYB 2WWJA 3WLUA 1NQDA 2WLPA 3WW2A 2A6YA 1QIQA 1VBD1 2WNVB 3POSA 3I3MA 4YW1A 5A1FA 4BE3A 1OA2A 4Q4Y3 4AE2A 3GHMA 4UFJA 3VGIA 5IFTA 4XFFA 1Q56A 2OX0A 3DGTA 5A33A 5LCWL 3HNYM 1POQA 5CFDC 3EMRA 2SLIA 4LHNA 4COYA 4LR4A 1W2UA 4PDWA 2C26A 4AGGA 4Y1XA 5DAPA 5JSPA 1IKQA 1ST8A 4GB32 4Q29A 4YNIA 2V5YA 2BFUS 3UESA 2XJVA 5FZKA 1POV1 1SEFA 2O1QA 2BRTA 3ZN4A 2EXIA 3KSCA 2FDIA 1OSGA 1FXZA 2BOIA 2JDKA 5CISA 1RJ7A 4B8EA 1F4AA 4I3GA 5JMOA 1W05A 1K5JA 4IE6A 4PQ9A 3RMYA 1ZZ7A 3KGZA 2V73A 3IPVB 2C6SA 4FPJA 4RYDA 4X8NA 4AI0A 4R9BA 4OYUA 2DCKA 3DPRB 4ZXKA 1D4VB 2FCVA 3ZFEC 5FMCA 2GC2A 4OQ8A 2WNUC 2E32A 1OH3A 2YFZA 2D98A 3MIGA 4UAPA 4IEXA 4XQ4A 5C3PA 2ETEA 5JWPA 4AGRA 4TZDA 5A7PA 5E6HA 1FMD2 2HWB1 4XJAA 4PLNA 2RMU2 3HQXA 2A3YA 1UY4A 2LUWA 3BTZA 1D7PM 2WWUA 4XOGA 2BBVA 1BXHA 1WW7A 1KFUL 3OOXA 3K46A 3WNNA 1A8DA 2P17A 2PHFA 5FK7A 5FBZA 2WAAA 3FLRA 1G9AA 1XXNA 2Q5TA 3KV5A 5B4NA 3THPA 3PJYA 2W39A 3KB5A 3M7AA 1ZRCA 4FPYA 4Q4Y2 1EY2A 3F95A 2Y6LA 1XBFA 4GWNA 4XBQA 4OHXA 1V6IA 5F39A 4ZS3A 2HYXA 4ASKA 5JLVA 1O3RA 2VBBA 4A7YA 3WNXA 1C57A 4G9SB 1O3QA 4XF0A 5A1LA 4MUVA 1I6XA 1WGPA 1XNKA 4GD4A 3J7NA 1V6KA 4CCOA 2HWD1 2RS53 3VBSA 5FZ9A 1AR72 1UYYA 3GHNA 4Z1VA 2FCUA 1G6NA 1WCDJ 4LKSA 3RZMA 2GNTA 4YM2A 2WZR2 2DTYA 2XJSA 1PM4A 2BPA2 4NO4A 3LIHA 1HRI2 4X8PA 1OUXA 1QJU1 5F8PA 1RVF3 1OPOA 3HJRA 1WKYA 5DUWA 2K2SA 1UXXX 2OPKA 5J98B 5A6XA 2QDRA 2ZEYA 2WBKA 2I2SA 2RS51 1O6UA 3B7MA 5FY9A 1JOBA 3ZXDA 2BWAA 2MEV1 2ZXQA 3HMYA 3BGAA 2R072 4K8RB 1VBE3 5FYMA 4BJ0A 4ZY9A 2VCBA 2XVLA 3O0VA 1ND2B 3NAPA 4XAEA 4YW6A 5I93A 4HK8A 4RS5C 2ZGOA 1W9TA 5DZFA 2RE9A 4BQ2A 1JH5A 4JGZC 2NMNA 2VOWA 5EJ1B 2Y6FA 3Q8EA 1FOD2 5F6KA 5DAXA 4M3CA 2XLFA 3RVHA 1R1A2 4IEWA 5JCTA 2JDMA 1OA3A 3MUY1 1NQJA 1F15A 1DZRA 4QAWA 4H55A 4CDWA 4XILA 4CDXA 5BNPC 3RYRA 1EP0A 1SPPB 1XNDA 1MEC3 5EJ3A 1W6NB 1VRBA 2WFPA 4WM7B 4AG4A 5JR7B 2Y38A 3NNLA 3OY8B 4MHRA 3TEYA 2XOMA 4DXSA 3SKJE 1DQ5A 4U36A 3AP9A 1M06G 3LA7A 5GM0A 4AEKA 1MS3A 3BYWA 3H7JA 4CEYA 2LS6A 1UW8A 4JRLA 4SLIA 5FZMA 2QJVA 2Q30A 3CU7A 2A7AA 3H7YA 4NMIA 5BY5A 3TOJA 3FWEA 1YJKA 5JZGA 4RS5B 5A70A 4TN7A 5CFCC 1AYM1 3WNLA 4XYXA 1STMA 1H8TC 4M00A 4N9IA 5CNAA 2OIIA 1Q3EA 1W6PB 2BGCA 3EYPA 5GLVA 3ZPYA 5CA6A 1JYWA 1VR3A 4MV2A 3NJXA 3BI3A 1WUVA 3V0AA 1NAEA 3LEGA 2XQXA 3AL5A 2X09A 3FUQA 1EUUA 4GH4C 1CVNA 4NWVA 3ZSMA 4DB5A 3HOBA 3K3NA 3ALQA 1V70A 2A71A 3S57A 3USUB 2XKOA 3GBGA 1OLMA 3UYJA 3AZWA 4Q4W2 5FMOL 4J1WA 1JU3A 3RYKA 4A41A 1BK0A 1AR82 3K4AA 3LD8A 3OUHA 1S0CA 1R1A3 1QJX2 5FQ0A 2XJTA 4MADA 4D7YA 1OD3A 1ZZ8A 2BP6A 3HQRA 2JENA 1JZ6A 5GZGA 2ZGNA 3BTXA 4GZ9A 3MIFA 4H7LA 3OCPA 4RR3B 5FYVA 3TRSB 3CJXA 4B1LA 4W65A 1GZTA 2GNDA 4XAAA 1LJ7A 4P9YA 3B3QE 3OPTA 4YGEA 3CZUA 3PVOA 1UAIA 1W6MB 3QACA 2GMMA 4LBQA 4BWOA 2X5IA 4CPBA 1S2EA 4A2UA 1O5UA 3H8OA 3ACLA 4KL1A 1ASJ2 2P6CA 3KT4A 1RUF2 4L11A 4AXOA 1UO9A 1LNSA 1VP6A 1PX4A 2HEWF 1JHJA 3OEBA 1YNAA 4FPFA 3MV01 5DABA 3ZN5A 2GC1A 5J09A 5JOZA 2C5DA 1V6OA 2JKXA 2W46A 3FL7A 3I54A 1CPMA 5EYXA 4PIYA 1RUC3 2WL1A 2R041 2Z79A 2DURA 3KQ4B 4OI2A 4CDQB 3KCXA 4BIOA 4KU7A 2ZMNA 2VMCA 2W0XA 1VRH2 4TWTA 1PIV2 1CAWB 4EJRA 2QQKA 5CG9A 1KITA 3M3OA 4Q4V3 4XIKA 1JZ3A 2FDKA 1PZ8A 4YGBA 3DF0A 2WNVC 3IDBB 3BCWA 1V9U3 2IVJA 4WVZA 5GKAC 1FATA 5HV0A 1RHI2 2K0GA 3HPNA 3AP5A 4MSVA 2W95A 1TME3 2B45X 5LA9A 3RMXA 2P3YA 4MG2A 1NUKA 5C70A 4DO0A 3WW4A 1I9RA 3JZVA 4HETA 3Q8AA 1O91A 5FPZA 1ZBA3 3ZYHA 5FPVA 1GOHA 1V6LA 1X8EA 1JHNA 2E53A 2PMWB 1XPWA 4YVSA 3VKLA 1LOCA 4LQRA 2VVDA 4XFCA 2BYVE 3LDRA 2VOXA 2XUEA 4K1ZA 4Q4W1 3M8LA 3GZEA 4O9GA 3ZSEA 5ACA2 5ACA1 3ETQA 3ZFGB 3S5QA 2D40A 3L2YA 3Q8CA 5I0SA 5CYYA 1NG0A 5D1IA 4DUWA 2VZOA 1JZ5A 3R4DB 3VBSC 1DHKB 2GNMA 2PAEA 3BOPA 4ES9A 2JKBA 3IN9A 2P4EA 4NHXA 3N4MA 2IXKA 2UY9A 2VO5A 3ZXEA 3NJVA 2RS31 3BPSA 4Y4YA 1C3HA 3LEIA 4LO7A 2ARXA 3SLIA 1DZQA 3E5QA 2GZWA 1H1MA 5BNOB 1PIV3 4HZFA 5K0UB 1T6GC 5F5AA 3WF0A 5A7NA 4XQDA 1QNWA 4C1WA 3P3PA 5BPXA 5F5CA 3UJOA 1W8FA 3MEPA 5LA2A 4W6WA 2XQRA 5D8AB 1X8MA 2IZWA 4CP9A 2PLV2 2XG3A 4GKYA 4QX0A 4XMIA 4QB1A 3VBUC 3NV4A 5A3WA 3GCWA 4PJYA 1RUG2 4A42A 3OY8A 2NZ9A 5FREA 2VZSA 3NV3A 4A4AA 1PX3A 3KGLA 1RC6A 1DYOA 3IAQA 1VB4A 3J8F1 5FUPA 1ENRA 1OF3A 4YZ1A 2E7AA 2PHXA 1YHFA 2QZ2A 2JD9A 2DBIA 1YIPA 2ZJCA 2CAVA 3VD7A 1IS4A 4WZFA 1UN1A 2VZVA 1XRUA 1RUH3 5H9PA 1A6CA 5HBAA 4LKFA 2DU1A 5IUQA 2NM1A 4QX1A 4AQ6A 1GANA 4BLJA 1TEIA 5J3UA 1VBA1 1RUF1 3CL1A 2DCZA 3ZYFA 1LHUA 1AR91 2W9XA 4MO3M 4YLZA 3T2TA 3ZYRA 2VE1A 4CXWA 1UYZA 5FZ3A 4PCRA 4YGDA 1OQEA 3WUDA 3A23A 2JB4A 3RGBA 1W28A 4GWMA 1RJ8A 4UWDA 4N7UA 1FOD3 3AVRA 1K12A 2EIDA 1H1IA 4KU8A 1IZ3A 3Q8BA 1LHNA 2HLEA 3PNAA 3SNMA 2KXLA 1TE1B 3FE5A 3RRDA 4URTA 4BYYA 3EBRA 2QE3A 2VMEA 3IIAA 3WG4A 1QJX1 1JZ2A 4J25A 2JEMA 2KM2A 1RMU1 1XNAA 2XMLA 1SLBA 4AHXA 1H2LA 4Y26A 5LBFA 5C3SA 1OFSA 2AENA 3AZZA 3LQCA 4OHVA 1JYCA 4A7ZA 1W6NA 1IOAA 4W8JA 3S6PA 2VNGA 3SH5A 5KR7A 3WUCA 2PELA 4QKNA 1ZNPA 2FDHA 1PGW2 4GWJA 2RS13 4IV1B 1DCSA 3WNKA 1RUH1 2BOJA 5IVEA 1I5ZA 4QQHA 4FPGA 5DG1A 2D5HA 4LO4B 3DYMA 3S0MA 3FHAA 4Y5TA 2ET7A 1RUI1 3EHKA 3DL3A 4RFT0 4AR2A 1QU0A 3ZYGA 3B94A 5A80A 4PBOA 4MLOA 1S4CA 5JXGA 3VBRB 1WW5A 3SKVA 3LAGA 1LU1A 3DXTA 2Y6KA 4UF0A 5CG8A 4R9DA 4AFCA 1W04A 1H8TB 1RITA 4FOQA 1R081 4R4ZA 1POV3 1HV0A 1SLIA 4JDMA 2JDUA 4LMFA 4RA0A 4YZ3A 3ZXAC 2WS91 3OYWB 3CBNA 2HWB2 2WJSA 5FRAA 4I2OA 1L7QA 4HKWA 3BODA 5ERLA 2WUHA 1VBA2 3N35A 1QJX3 5FXWA 1JUIA 3RWKX 3AKTA 1C8M2 3VV1A 3OGSA 4BZ4A 4DXRA 2VQTA 1FV3A 5DDJ3 2W68A 5FZHA 2ZMLA 4LUKA 5K4LA 1L7LA 4Y5Z0 1W06A 1DGRA 3EQEA 1KRIA 2DVDA 3H3LA 4AFBA 5E16A 3FN9A 5GZFA 4YVWA 5T5LA 3OG2A 4XTMA 2YPJA 3WG1A 3WT3A 5AC93 4K40A 3I59A 4EWAA 2C4XA 1A34A 3AJZA 4PF1A 5AFEA 3T4HB 2X8KA 2ZAAA 3FFQA 3PMSA 1T2XA 4P5HA 4GJYA 2VW1A 4Y4RA 4C0HA 4CCCA 5C5UA 5C8WA 1AX2A 2ZABA 5IVCA 1BEV1 1BLZA 3C7HA 4JX0A 1TQ5A 1UIKA 5EZWA 5FV3A 2VC9A 2WT2A 1TZOA 5FZ8A 4DXTA 3GALA 2KR2A 1FT9A 1E57A 1EUTA 1GLHA 2VBPA 4Y1UA 3FBYA 4F83A 4AGVA 2Z2SB 3HR9A 4HVOA 2UWBA 3PUAA 1HRI1 2KD7A 3RS6A 3NQHA 1JMUB 1EV12 1RUD1 3HT1A 1F9KA 1R092 4HVQA 5C8CA 4R52A 4HPKB 4R9AA 3ZX7A 3ZMNA 2DFBA 3MIEA 2GN3A 1EPZA 2XUMA 2P6HA 4WV8A 1H9WA 2Q8CA 3S7EA 2D44A 2YZ4A 3PTYA 3POJA 4JQRA 4AFAA 5CEHA 5D8AA 1ACCA 1H4HA 4L0PA 3ES4A 3I2DA 1LENA 5JMCA 3ZFFC 4Q2FA 1W6QA 1S0IA 1D4M3 3VBOB 1HQLA 1N1TA 4I09A 4BH9A 4BK5A 5AC91 2D6PA 5LY2A 1ND3A 3MUZ1 1H8VA 1ZRRA 4V1PA 3RWNA 1YQ2A 3PHMA 5IVYA 1QHDA 1LEMA 4XW3A 5GLUA 2BV4A 2H0BA 4Y20A 1C8M1 1NYWA 1O7FA 2ADDA 2GN7A 2HH9A 4JKLA 4JKKA 4FQZA 4AI8A 3WR0A 1PO13 5CAZA 4LJHA 3LB9A 4M01A 1ASJ1 2D3PA 2IXHA 5L9RA 4BM8A 3KMHA 2VULA 5JIAA 2ZGMA 3ME2A 3I4IA 2FDGA 1IS5A 1LEDA 2L9LA 1DP0A 1VIWB 1WCKA 4QDRA 2A6XA 2P34A 2PHUA 2W5FA 3ZKYA 4ZU4A 3VBSB 4MZUA 1OVPA 2Y60A 3AYAA 1W9YA 3LSDA 4JQTA 4CDWC 1QOOA 1MZFA 2VOKA 3N9OA 4CDXC 5BNNC 1GR3A 1V00A 4JRAA 3RI9A 3AYCA 3N36A 4QPGB 1GZWA 5K9YA 5JZGB 3OJBA 4NHYA 1ZBA1 3MPBA 4IV3B 4QKFA 2VOTA 5LATA 5EJZB 3UKNA 4HVRA 4UW4A 4Y24A 3V0AB 4L9BA 5FPAA 4A7KA 1SDDB 3VBFA 4YVWC 1GOFA 5JOXA 2MEV2 1KGYA 1GQGA 4RD7A 4YVSC 1G9FA 1YQ5A 4AEJA 4LOTA 4D6SA 5A6YA 4XUPA 2YYOA 3MLLA 1GU3A 2WZR3 1NLQA 4E8CA 4E4HA 3DPRA 3VBHB 3VHOA 5FP7A 4YFZA 3I2IA 4P9IA 2V09A 4MGIE 5DXDA 4JAAA 1HB3A 3H1MA 5FYBA 4HLTA 3T4VA 3T08A 1OI6A 2W08A 2R6QA 4L8QA 1H0BA 4LBMA 4QHOA 1LESA 3R0RA 1AF9A 3N9NA 1MS5A 4IEQA 3POWA 5GZDA 1SPPA 2J1TA 3OF1A 2NN8A 2HWD2 4IEPA 2IWGB 3OEAA 4N53A 2Y34A 3V64A 1RXGA 1A78A 1YWKA 3E6DA 5JPNB 3DYOA 3H0OA 3HIFA 4ONUA 2OW4A 2C9KA 2VNOA 1PK6B 2R16A 4PI0A 2YGLA 4HG6B 4LBKA 4YWAA 4LULA 2ZGQA 2EF6A 3MIBA 2F6BA 1U5IA 1CESA 5C4WA 4KG8A 1BBT1 1Y9QA 4IE7A 1JN2P 4Q27A 2ORXA 2Y0IA 3OBTA 3AKQA 3SH3A 3RZHA 4P9GA 4WM8C 3GDBA 3SCHA 4M4PA 2WZPP 3TN93 3MW2A 2LRPA 4N7IA 2W91A 1DGLA 1MZ6A 4N43A 4RR3C 5BNPA 3WNOA 2IVIB 1LHWA 3JBG2 2WRAA 1VBE1 3LOBA 1ZRIA 1YFUA 3VKNA 1YIFA 3H42B 3O0XA 3VZKA 4GIQA 4XPVA 2PLV3 3WP3A 4EQVA 1CX4A 3RJRA 5JI9A 5T5JA 3SC7X 4CCLA 1J84A 1JUHA 1JBCA 1OQ1A 2J22A 3B5LB 2FCTA 3K48A 1P8JA 4KWUA 5IAVA 2HKXA 3RPQA 3V0BB 1QJFA 2VBDA 1NA1C 2PHTA 3M2MA 4X6QB 1QJU2 4TTGA 3B69A 3I2KA 2JDAA 5FMDA 2AEZA 3ZN6B 1H4GA 3A22A 2ZEWA 4OULA 5E1RA 2DUQA 3DV8A 4RSUA 1RUH2 3FLPA 5A7WA 5C8CC 2PHWA 3OPWA 4IXLA 2H0VA 1UY1A 5C9AA 2OXBA 3UL2A 1RXFA 1JOPA 3WCSA 2NP0A 1VBC3 2QQOA 2J1AA 5FZOB 2JDPA 1VBA3 1ZZBA 3N7MA 1PMJX 4HPKA 4AQSA 2QZ3A 3LIGA 1QH6A 5LK7B 2FD8A 1QJY3 3CEWA 2P1BA 2JE9A 2DFCA 5J37A 2VTXJ 4IE5A 3D4KA 4BK4A 3RZLA 1X9TA 4L92A 1RUC1 4XE9A 1DLLA 1LGCA 2OYZA 3QLQA 2ZX4A 1YCIA 2BQPA 5FPBA 5JSOA 4ZZ8A 1IPKA 1Y7BA 4R8HA 5E88A 3VBOA 4TYSA 3KD4A 2GP5A 4CRQA 1UPSA 5AVAA 1RUI3 3RSJA 1SACA 2A6WA 5FXZA 1SBFA 3AFGA 1J1LA 4YYOA 4QWNA 3I2GA 5KHKA 5LEKA 1HB2A 1NX9A 1W8ZA 3AKSA 3WP5A 3ZLIA 2OQ7A 1O5LA 3H1YA 4AFDA 4NAOA 4YG6A 4CP9B 2XJQA 4XXPA 4XUTA 2BVBA 1QY4A 2D6MA 2FBEA 2VGDA 3I2HA 2RM23 2XJRA 2VY0A 3HN3A 2P5BA 1QOTA 3HBKA 3P6BA 5FY5A 4L99A 4DFSA 3K2OA 3LA3A 1X50A 4CCJA 2JICA 1I3HA 4KWLA 1F2NA 2XDVA 1OHFA 3KHBA 1O4YA 4IW3A 3ZYPA 3KV9A 3BU7A 3KV4A 4B29A 1XYOA 2KA3A 2R063 4NJ4A 2W47A 1Y4WA 2XGXA 4KGGA 4NR1A 4P02B 1RUOA 2R0HA 1W39A 4CZSA 5CFCB 4F7ZA 3ZMOA 1EPWA 3G7DA 5FWEA 1O3SA 1XSRA 1ZZ9A 5FZIA 5FQ0B 2EXHA 1PZ9A 2TNFA 5HPOA 2RG4A 4ITCA 4KBBA 1NCRC 5CVRA 5FYHA 1W3XA 1C8M3 1K5MC 4B4QA 3VHNA 1MEC2 2RS32 1ND3B 5JIUA 2B5HA 1LR5A 3VKOA 3ZSLA 3ZXJA 3WF2A 4FP2A 3H8RA 2Y0OA 1KS5A 4LBQB 5AVPA 4FI9A 5FP4A 5F3EA 2IXJA 4BHPA 1F4HA 4GB31 4MYEA 2WSUA 1K42A 2EICA 1EAH2 5EQUA 4BQ3A 5A3MA 3PUIA 1YFWA 2DWRA 3I7DA 3H8UA 3M3CA 2W92A 2WQZC 5FY1A 1GKBA 1U12A 3ILRA 5IWFA 4BU2A 4CXXA 5C33A 4FTSA 2VZ3A 5AFBA 4Y22B 1NCRA 5JDBA 1AL0G 3KCCA 2FMDA 3N9LA 3OSDA 2W3JA 3HWJA 5A3OA 1BMV1 1WD3A 1XC6A 2RDSA 2OUHA 1GWKA 4TXWA 1ALYA 5SV5A 2UYBA 4EE2A 2XH6A 2JG9C 1W8OA 3DECA 2MNGA 1J3PA 4FTEA 4EN6B 3ZDSA 4FSJA 3C2UA 2DUPA 1PO21 2EIGA 2O8QA 5E89A 4PHZA 1W9WA 1E5RA 4ZPIA 2R062 1LRHA 3MO4A 1AL22 2VMIA 3ORJA 4IGQA 5B4XA 5LASA 2VMHA 3E5UA 4I0WB 2CDOA 2CYFA 1G8WA 2CWSA 5DPNA 4DINB 3VUOA 4RQPB 4Q4W3 4AVVA 1NY71 1VLNA 1D0GA 4KWKA 3J9SA 4QGMA 3TEWA 2CTVA 1DDLA 1GBGA 2PHLA 4A6SA 1GNZA 3HVDA 4QU1A 5BNPB 1MZ5A 1RUG3 5FY4A 4BQ1A 1W0PA 1BHGA 2YFUA 4PQQA 2XJUA 3K51A 5FMBA 3VDDC 4ET7A 1JYNA 1CR7A 4FQ4A 5EPAA 2AACA 5I0UA 2JE8A 1Z7S3 1MS9A 4V2VA 4E2SA 1D4M2 2ZGUA 2RS33 1W90A 3FBMA 4C0BA 1HXS1 2W1SA 4HK9A 1OBNA 1GV9A 4QMAA 4CXYA 1UYXA 1G7YA 2WINB 2D6LX 2V72A 4DOUA 1YYNA 5DDJ1 4UYBA 3WDTA 5DUXA 4AEDC 5GZEA 4E4SA 3OUIA 3RI8A 5IK7A 2QDNA 4FBFA 1B35B 4QPWA 1UYPA 4XABA 2WFF3 1TME1 1PVC2 5ANQA 2JG8C 4OUSA 4PBPA 3ACFA 4FTBA 5I8TA 3I8TA 1ZM1A 2WQ4A 1WA4A 1LHVA 1XE7A 4AI9A 4IQPA 5T5OA 3KS7A 1J59A 3K4ZA 2VNVA 1LAJA 2DCTA 1PO23 1WCSA 2W1WA 4IV1C 5G05L 4OQ9A 3UKTA 1RUD3 5FZLA 1IS3A 3M4FA 3VZOA 2ZHKA 2ZX1A 4XZUG 5CIRA 2PAMA 1QQP2 5FZAA 5C3RA 4LT5A 4BISA 2R7EB 4HONA 1CN1A 5F32A 4LE4A 1O3TA 4QGNA 3R4UA 4GAZA 1UMIA 4FP3A 4A3XA 5I8YA 3I2OA 4XJ8A 1U5YA 4BMEA 4COZA 4QKDA 3C7EA 2RHPA 4O61A 4UT5A 4NE9A 2E7QA 3FLTA 4ZKTB 2JDYA 2ZHLA 3U0ZA 2B8MA 5KHHA 5CFDA 4FVVA 5FYTA 1NKGA 2W87A 4N53C 3OD0A 2RDQA 2TBVA 3GJAA 4DRRA 3OTFA 1ZZCA 2UWCA 1XB9A 2BNOA 2OT7A 3ZN6A 2D3RA 5JZGC 4ZS2A 4OMDA 1Y3TA 3DPRC 1W03A 1LGBA 4LBLA 3ZFEB 5A3UA 3PVEA 1LB2A 4CCMA 5J1XA 5A32A 4WVVA 4CU8A 1EYBA 2Z4FA 3MLKA 4XF9A 1JTZX 3T09A 4WM8A 4XC9A 5FZOA 3W58A 1FYUA 2JWPA 3H3UA 4CEWA 3KVBA 4NPRA 3ZIWA 5I8SA 3URFA 1RVF1 1ULDA 3IMNA 4NN0A 1HB1A 2ZGKA 4YG0A 2ARAA 3UGHA 3PUQA 3NNJA 3SCGA 4FPEA 3GGLA 4U2AA 1LECA 3LPGA 4XF4A 4K20A 1JYXA 1PZ7A 1DFQA 1R1A1 4XETA 1A8MA 2QQWA 1QQP3 3WQ0A 4DEQA 3N7JA 5FMOS 2ADEA 4DY3A 3JB8A 3TBDA 4CYDA 1XSQA 2NPIA 2VCAA 4S2DA 2DVGA 2JIJA 2QQNA 1REDA 4LA3A 3WDUA 3WX5A 2E26A 2N7GA 1OT5A 1Q8PA 2WDBA 4QD2A 5FBJA 4LBQD 3WV6A 5IK4A 4FPCA 3MDPA 2PFWA 3JD71 3WDVA 4CEYC 5M0TA 2V4AA 3HD8B 4OLLA 4ZXEA 2BU9A 2Q4SA 1LU2A 3AM2A 2DTWA 1KJLA 2ZZQA 5KWRA 1K45A 4LITA 1IHMA 4WM7A 1HJGA 4Q8LA 1LOFC 3ILFA 2G9GA 2EA7A 4MGZE 4OHYA 4B3NA 1JS9A 1HRV2 1OF4A 1ZA7A 1V0AA 2MHFA 2VQ0A 2WC2A 2R1BA 2V5DA 5CKQA 3RZJA 4URAA 1H9PA 1NLRA 1TG7A 3AXEA 1CAXA 4QPIA 3D82A 4A44A 3POIA 3WF1A 4QPIC 1RUE3 2FHRA 3NKGA 2B42B 2VL4A 4GJZA 4UFLA 4RFRB 1ZBE2 4H14A 1VBC1 2QUOA 5FZCA 2VVEA 1S1AA 5BUVA 5GLZA 4KMQA 3WDYA 1JZ7A 2A6VA 4BIFA 4CUAA 5ISLA 4B1MA 3LFMA 1RINA 4D69A 4BQ4A 4FCAA 4WM7C 1VMHA 5LWBA 2AZ5A 2ZX0A 2W1QA 1MPXA 2BWCA 3BB6A 1AUYA 3IMMA 3R6SA 3O0WA 5F2WA 1H2MA 5A6ZA 1L7RA 4QPGA 4I0AA 3KHCA 1UD1A 3VLBB 4PDWC 5T54A 4XHXA 1OLRA 3BVCA 2XHNA 2VMFA 4IV3A 4AZZA 1RUJ3 2YY1A 1QXRA 1REFA 1XE0A 2X5IC 4FFFA 2FMYA 4LLFA 3W21A 2FZ2A 1O4TA 4HSJA 4N43B 2WO1A 1Q8OA 3EJKA 3DN7A 4A6OA 1Y9GA 3I49A 1HKDA 3JXSA 2XHKA 4DZGA 1YRZA 1QQP1 3USSA 3VN4A 2VM9A 1AR63 3RZZA 1HXS2 1HLCA 3GNEA 2YBSA 4YVSB 5L73A 1BZWA 5DAWA 2PA7A 3CIHA 4RHV1 1FNYA 2GSYA 3HEIA 2X5IB 4MGSA 5DN2A 4IEOA 2BW8A 3MI8A 2AYHA 5HXVA 1M4WA 1NA1B 2DV9A 5A3LA 3ECQA 2QQMA 3ZFGA 1DLCA 3ILNA 4Q0UA 1H6XA 4Y1VA 2YXSA 2BJSA 1GP6A 1QJY1 1DZTA 1SCSA 3ON7A 1J1TA 4GMP1 3PDQA 4DS0A 5HI0A 4Q1RA 5FPUA 5F5IA 1XYPA 4B4RA 4AVSA 3ZYBA 4Z07A 1W6QB 1UIJA 3KM5A 4DRVA 1OC1A 3I3QA 1DYPA 1C8NA 4UFIA 3I3EA 1LULA 5FYZA 2ZBJA 1LOAA 1QDCA 3AYEA 4AAPA 1O4ZA 1POV0 3AKPA 4BCUA 3NVCA 1QGLA 2XLAA 2C24A 2J1VA 5FYYA 5LA1A 5F3CA 1CJPA 1CPNA 3KCYA 4DMIA 4Q8KA 2C1FA 4NPLA 4CCNA 3IAPA 1OQDA 3OBAA 3KWVA 2IXCA 1H6YA 4R4XA 4SBVA 1TNFA 5ACA3 1I5PA 1S0GA 3D0SA 3T3YA 2Y6GA 2HEYF 4QQPA 4CVUA 2HWD3 2XVGA 4COUA 4P5YA 1RYYA 4JKMA 1W8NA 3BALA 4CP1A 5LB6A 4FFIA 1C28A 1IQDC 3J26N 2VCMA 3M3IA 3WEZA 1WLDA 4LO5B 2B9UA 1N47A 5A7QA 3SHRA 4BQWA 3WQ1A 4HOOA 5FJHA 1PGL2 3WNMA 4O9EA 4YPJA 1AX0A 3ZXFA 1TMF1 4GH4B 3UNPA 3Q9OA 4ZHNA 3VL8A 1NXD1 2VZQA 3PUHA 4E27A 5HCBA 4QDSA 4YM3A 2LROA 3WY6A 2OA2A 3D5OA 4K7JA 1N1YA 4YG3A 3WHTA 4FAGA 1AYN2 2HWF2 4Z82A 5T55A 4P14A 5T5PA 3P3NA 4CDQC 2OVUA 4QXKA 4CDUB 3JB4C 3APBA 3GM8A 4B4PA 1HN0A 2BNNA 2D3SA 5SV8A 5T52A 1SLAA 1JZ4A 5A3TA 2Y26A 1RHI3 3A0KA 4O7XA 3VBHC 1CGPA 3IB3A 1OLME 3VBHA 3ZDVA 5FLIA 1URXA 1AZDA 3ES1A 3B00A 1QEXA 2CDPA 3J7HA 3TEZA 3MV11 5JXHA 3VHPA 4B7EA 1W8UA 3WINE 3WF3A 3MFCA 1XJAA 1A3KA 3ZXLA 4CP2A 1S0EA 2VZTA 3S7IA 5KXDA 4DPNA 3O1VA 2ORZA 3ETPA 1UZ0A 2I74A 5JPMB 3RQ0A 1PO12 1KJRA 4B7KA 2IXLA 3MHZA 4LLOA 2D7FA 3ASIA 3VL9A 4BXSV 4MH0E 4IV1A 2WS92 4CA9A 1VBE2 2BVVA 3OGJA 1YI9A 3L2HA 5E8AA 2F4LA 1IPSA 3ZFEA 1ZX5A 3P5BA 4YZ5A 3ZPOA 2VQUA 1F31A 3O1TA 2PN5A 4FOVA 4CDWB 4CDXB 1IQAA 4FXGB 2BEOA 4E2QA 5GJ6A 2XXZA 4XURA 2R32A 1BBT2 4MHUA 2WQ8A 4FFGA 1NE4A 1SFNA 1WCUA 1XOYA 4XFIA 1AYN3 1UX7A 2HWF3 4AWDA 1DGRN 1W2TA 4QQ2A 3OUJA 4XJWA 3I97A 3OYWA 3SITA 4AI3A 1GNYA 5FR3A 2WWSA 1IG3A 2E6VA 3SXWA 4MGQA 4UW3A 3UK9A 4LHKA 1VMJA 5HCAA 3WP4A 1CIWA 1K5MB 2JB8A 4JTNA 5ABJC 4IEYA 3MF9A 4AVCA 1S2BA 3DKQA 2ZKNA 3ABZA 2J1RA 5JOWA 1US3A 1VBD3 1RMU2 1UNBA 2WT0A 1BQPA 5F6LB 1WD4A 3IDAA 1VAKA 2FDJA 2OPWA 5CU1A 4F8AA 3WVJA 1L3JA 3HT2A 3T30A 2O14A 4FPKA 5IATA 2A3XA 1CAVA 4XFHA 1W8HA 1XQNA 1WBLA 4QHZA 5DMYA 1GWMA 1GQHA 3IPVA 4CTEA 3NO8A 3O1UA 1OKOA 2RMU3 2VW0A 3KF3A 3NV2A 5IVJA 5BV6A 2WO3A 3WQ7A 2CAUA 3LOIA 3WG2A 5FKBA 1CIYA 2A3WA 1KDKA 5H9RA 3F2ZA 1UOBA 5DDJ2 1NE6A 3L9JT 3RZGA 1W99A 2BDRA 2WIIB 4GMP0 5APAA 4AF9A 4Z2AA 4CUBA 3GF6A 1ONAA 1ENQA 3NSTA 4Y1YA 1D4M1 4WVWA 4Y22A 4BB3A 5KXCA 3AMNA 3T0AA 3IKWA 5LBEA 3ZYIB 2J1EA 3T0BA 1HJFA 3WF4A 4QQLA 4AEMA 1IG0A 5JXJA 1DQ2A 3QD6A 5DG2A 1QJZA 1CJDA 1YLLA 3CLPA 3X29B 1SMVA 4ATFA 1SZBA 3MW3A 2RS11 3O1MA 1KS4A 5IHRA 5IVVA 1CAUB 1HV1A 5J7MA 4YARA 1UX6A 3GYDA 5FYCA 3ZO0B 4Q4X1 4RHV3 1SLLA 2Q1FA 2D93A 1HRI3 3NKTA 5CZKA 1WMEA 1LCLA 1WA6X 2VW2A 3FC0A 4YVWB 5KC6A 4GWIA 2HWC2 1SHWB 2UU8A 1FPN1 2PHRA 4IEZA 1RUC2 5A3NA 3VZLA 2E51A 2ZS6B 4AI2A 1Y43B 5JAXA 3PLQA 2R073 4TLFA 1V6MA 4M3CF 5C71A 5CFCA 3GCXA 4DUVA 1LKNA 1PGW1 1YFYA 5IT6A 5J48A 1NT0A 2XB6C 4XJUA 4W6XA 1EAH1 3Q8FA 4HSLA 3TWIA 4QM9A 2YGMA 1UQXA 3VBUA 2JE7A 1B35A 1RUE1 1COV2 2CGNA 2VCCA 2YG0A 1MQTA 4CDUA 1RB8G 1UZZA 3CJIA 4Q4V1 2X05A 1YI7A 1R091 1KEXA 1XYNA 3OBRA 4GULA 1ND2A 3JQXA 2EIEA 4BQ5A 4I30A 1VE0A 5FO8B 1V6JA 2HWE1 2RR13 5LW9A 4CEWB 1W8TA 2D6OX 4MXWB 5JR2A 1H1AA 2P3IA 4P9XA 3VD9A 2I45A 4I02A 2DU0A 2ERFA 1LODA 1QF3A 2Y64A 2ZEXA 3N7LA 4AK3A 2PQQA 5C3OA 4IE4A 3QBQA 1OD5A 3UGGA 2YBKA 2WABA 1BYHA 1HN1A 2EALA 4P08A 1CZTA 2XLGA 5EXOA 2JX9A 4A3ZA 1HDKA 2I07B 2WFF2 5FFOC 4M0HA 5BXXA 2XVKA 1DGWX 3POFA 3VDBA 1WW4A 4XCAA 2Q1MA 2QKDA 5JVVA 3D6EA 5G04L 2Q8EA 3U1XA 5JSRA 3D3AA 3K77A 4AEDA 2VUCA 1VBB2 4CEYB 4Y20B 5F1RA 1W9SA 1X33A 5FOBB 3K4DA 5JOYA 5DZGA 5GLTA 3IBMA 5T3NA 2QQVA 2XONA 5CFDB 3UKVA 4J1XA 2C9AA 4N53B 4IEVA 1E5IA 4NIHA 1NCQC 4RQPA 5EHDA 4ZZ5A 1MS0A 1R093 4CU7A 2W2IA 2ZEZA 3AL6A 1CWPA 4NAMA 2A70A 4CCKA 1F5FA 1LGNA 4OI1A 1D0HA 5FZBA 1UY0A 3V65A 3TYJA 1COV3 2ARBA 1AR93 5ABJA 3MIHA 4JGZA 3U4SA 4PLMA 1RUNA 2QQPA 2VQAA 1OPMA 1UCXA 2AH2A 1GZWB 1YC61 2ES3A 1K5MA 3AP7A 3PVNA 5FXXA 1U5XA 4C90A 1OFNA 1UL9A 4AHYA 2UY8A 1W0OA 5EWSA 3ZOIA 1KD7A 3C7GA 3LF7A 4QGLA 3U10A 1SLCA 1DIWA 1DQ1A 3AC0A 4UXAA 1J3RA 4COVA 1T6BX 3J8F3 4UBGA 3N9MA 3BOWA 3SMHA 1RUJ1 2VTFA 3I2FA 2QTWB 4QXHA 5K0UC 4OI4A 2WO7A 3LA2A 4I0BA 2CV6A 4QDQA 3VZMA 1PVXA 3MIDA 2JECA 3O1PA 3AP6A 3R4SA 1KDMA 2O8OA 1G86A 1ULCA 4LIUA 1Z0HA 5HCFA 3LKJA 3VBOC 3EXUA 4NPMA 4ES8A 2YU2A 3WP6A 2YROA 5GALA 2P2KA 2ZPXA 4QKBA 4JZRA 3U75A 1XU2A 4P9WA 1JXNA 3CO2A 4LHSA 5JUVA 3EO6A 5D2AA 1FV2A 3A4UA 1QJEA 3HNBM 4DNYA 1ULOA 3PU8A 1RL3A 2BGPA 2JG8B 2B46X 2VMGA 3AYDA 3HQUA 4FOYA 1CX1A 3AB0A 4IEUA 3J7MA 5LBBA 4XMAA 1O8PA 3W5NA 1V9U2 4GKXA 1QOSA 1GMMA 2LTNA 3N9PA 3JBG1 1AR73 5LRSA 1ULEA 3N3HA 2B9VA 5F3IA 3SQOA 1AR92 5K7PA 1RMU3 5L7OA 1UZYA 1AVBA 2VJXA 5FZDA 2GU9A 2TUNA 1PIV1 2WAOA 3S5AA 1Z7S2 2R49A 2ZZJA 1AJKA 1CAUA 3NW4A 4LBJA 1SBEA 3AX4A 1OOPA 2VZPA 4NOTA 1FOD1 2OS2A 3TB0A 2P3KA 1C5HA 1UMZA 3AZVA 3AVSA 3J8F2 5FYSA 4ARYA 1V6NA 3U37A 4YW3A 5EFUA 3IDCB 4ARXA 5C9AC 1QMJA 4W50A 4YSFA 1C1LA 1C4RA 1ZRFA 2BBAA 4C8DA 5H9SA 5EYYA 5DZEA 4BMBA 1W8WA 3FX3A 1V9U1 2R071 2OZJA 2PHDA 2HWB3 3IT8A 4LBOA 5FY0A 3H9AA 2PYTA 3SH4A 2ZMKA 2G1MA 2ET1A 4JDNA 2TEPA 5IYYA 1RUD2 3VDCA 2ID4A 1DF0A 1OMIA 3AXDA 3MICA 1RTVA 1DQ6A 4MVTA 1SCRA 2CGOA 2E9QA 1MQTB 4N8MA 2H6BA 5FY7A 1RUI2 2QVSB 5HV4A 3MFAA 3W9AA 3FUOA 4RN5A 5C9AB 1KXGA 3WOGA 2JD4A 3E6BA 2WKKA 4AVAA 4KBZA 2BTVC 3PVBB 1BBT3 4QXBA 3E1F1 3UETA 3O5SA 3OB8A 5LEJA 1NZIA 1DQ0A 4OUMA 5BNOC 3T0DA 1FAYA 2JG9B 1AXYA 1C1FA 2GH8A 2WYSA 2B7YA 4ISRA 2WSVA 4D94A 3B9IA 2IUWA 5I0TA 2VXRA 3IZOA 3PL0A 4QQOA 3U14A 2RM22 4MGYE 2PQSA 5A3PA 4CEWC 1NZCA 4BOWA 2YBPA 3ZR5A 2DVBA 3PMEA 2DUOA 2QNKA 3J4UH 3RG0A 2GDFA 4OCTA 1QDOA 3B9CA 3QCWA 3ZFGC 5FOJB 1AYM2 4KQ7A 4NWWA 2DVFA 2RVAA 2CL2A 1Z7S1 3ATGA 1QJU3 1CAXB 4QPIB 4LA2A 5CBLA 2GMEA 1RUG1 1WWYA 3ZYJB 4EROA 1AXZA 4HN0A 2WN3A 4AI1A 3BIWE 1O8SA 2ARCA 3FMGA 3KZ4C 3QOPA 4H3WA 5FUIA 3ZFFB 4BDVB 1FMD1 2ZHNA 3NJYA 3VDDB 1W9FA 4HKLA 4NRPA 4Z92B 3BIEA 3NJZA 4AOCA 3U4XA 1HB4A 2VU9A 5FY8A 2VNRA 2P3JA 3U11A 2Z69A 1HX6A 4NROA 2CNAA 3VKMA 4CSWA 1BVVA 2HYKA 4LIVA 1VBB1 1UZWA 4OUEA 1ZRDA 1DQ4A 3RJ2X 1Y9MA 3RZKA 4MXWA 3V56A 3AJYA 3O14A 3OBZA 1PMIA 3MW4A 3ZM8A 4NIDA 4MGTA 2LALA 3OGGA 1QKQA 4E4DX 2IC1A 5FYUA 2WNUB 3MBWA 1VAVA 3LWCA 2NMOA 4D3WA 2AUYA 1K3IA 1VPHA 2EVXA 1AYN1 2HWF1 4TSVA 4EZHA 2F17A 5DAQA 2GALA 1UOFA 2GH2A 3C3VA 4PIZA 2D6KA 4XHBA 5JXIA 3U07A 4P00B 1EV11
chains in the Genus database with same CATH topology
1EUTA 3CKHA 2KD7A 3I3DA 3NQHA 3CIHA 4OZOA 1O59A 2VMDA 4XUQA 3VD3A 2Y6HA 3HEIA 2OKXA 1UY2A 4MGSA 1XNTA 5DN2A 4XVHA 3P1IA 2WZEA 3ECQA 1UY3A 2DDUA 2QQMA 1DLCA 1H6XA 3WSOA 3C8XA 2W94A 2Y8KA 4MOAA 4Z2AA 4L0PA 5IJRA 4UOJA 3I3EA 5I0DA 1GUIA 4BK5A 1SG3A 5F7UA 3MUZ1 2J1VA 3T2OA 5LA1A 1YQ2A 3IAPA 3OBAA 3HNMA 4JKLA 1H6YA 3I3BA 4JKKA 2E31A 2YC4A 1I5PA 4UI9L 4JHZA 2Y6GA 4CVUA 4P5YA 1RYYA 4JKMA 1W8NA 3K75B 3CZJA 2L9LA 1DP0A 4XUOA 4QB2A 4QDRA 1IQDC 2W5FA 3WEZA 1GQPA 3WNMA 4YPJA 1JZ8A 3NRUA 3UNPA 2VZQA 3PUHA 4QDSA 4D8MA 2VZRA 5IFTA 5LCWL 2VOTA 3HNYM 1JI6A 5EJZB 3BN6A 2C26A 3GM8A 3LPFA 4AAXA 1SDDB 1JZ4A 1GOFA 3UESA 1KGYA 3SEEA 3IB3A 1F4AA 5JMOA 1CZVA 4XUPA 4E8CA 1GU3A 2CDPA 3J7HA 2EIBA 3MV11 1JYVA 5JXHA 3I2IA 4RYDA 3W5MA 3WF3A 4OYUA 2YB7A 3T08A 2DCKA 2VZTA 2ORZA 3ETPA 1UZ0A 2E32A 2YFZA 1US2A 4UAPA 2QQJA 2J1TA 4BXSV 3OEAA 1UY4A 3DYOA 1D7PM 2C9KA 2VQUA 3DYPA 3K46A 4HG6B 3WNNA 2WAAA 5B4NA 1UXZA 5C7GA 4XURA 3VD5A 2ORXA 2WQ8A 2Y6LA 3GDBA 4M4PA 5A1AA 2HYXA 1UX7A 2W91A 3I97A 5IFPA 1GNYA 4MGQA 3WNOA 4QB6A 1UYYA 3ABZA 2J1RA 4LKSA 1US3A 1J84A 4KI5M 2J22A 1P8JA 4KWUA 3THCA 3IDAA 4TTGA 3HJRA 1WKYA 2JDAA 3I2KA 1UXXX 3A22A 2ZEWA 5LA0A 2ZEYA 4DEVA 2WBKA 5HXMA 5DMYA 3ACGA 2ZXQA 3BGAA 1UY1A 3I2JA 2QQOA 4ZY9A 2J1AA 4BJ0A 2VZUA 2VCBA 2WO3A 1W0NA 1PMJX 1OH4A 1CIYA 2QQIA 1W9TA 3F2ZA 4E8DA 4BK4A 1W99A 5EJ1B 4QX3A 4CUBA 3MUY1 4QAWA 4CU6A 4ZZ8A 3T0AA 2J1EA 3T0BA 3WF4A 3GXUA 5JXJA 2YC2A 4AG4A 1ULPA 2XOMA 3I2GA 3SKJE 4DXSA 1NX9A 2BGOA 5IHRA 2LW8A 2LS6A 2W1UA 4XUTA 3I2HA 5CZKA 2WO2A 3HN3A 3P6BA 3WNLA 4GWIA 1SHWB 2V4VA 3EYPA 1JYWA 3NJXA 1NAEA 3LEGA 2XQXA 3OGVA 5C71A 2X09A 1EUUA 4DUVA 3HOBA 2W47A 3C7FA 4P02B 1JU3A 4IUGA 2YG0A 2J7MA 2VCCA 4A41A 2X05A 5HPOA 1KEXA 3K4AA 2EIEA 1TVGA 4MADA 1JU4A 1OD3A 1JZ6A 5JR2A 4GZ9A 3A7QA 3VD9A 3WF2A 2Y64A 2ZEXA 4FI9A 3C7OA 1F4HA 3CZUA 1K42A 2EICA 2WABA 1HN1A 4P08A 3PUIA 1CZTA 3THDA 4A3ZA 2QQLA 2W92A 1LNSA 1PX4A 3OEBA 1JHJA 3VDBA 2VZ3A 3VD4A 3MV01 5G04L 3D3AA 3K77A 2JKXA 2W46A 2W3JA 3FL7A 1XC6A 1W9SA 3SEPA 3K4DA 4TXWA 1PMHX 2XONA 1W8OA 3DECA 4A45A 2VMCA 2QQKA 1W9WA 5B4XA 4ZZ5A 1JZ3A 3MO4A 4CU7A 2ZEZA 4LPLA 2CDOA 1UMHA 5DPNA 1UY0A 3HPNA 2W95A 1NUKA 4M4RA 5C70A 1BHGA 2YFUA 4PQQA 4ET7A 4DUXA 1JYNA 3VDAA 2JE8A 1GOHA 3C7GA 2W1SA 1XPWA 1UYXA 4LQRA 3AC0A 2V72A 2VTFA 3I2FA 3NNGA 4QDQA 4QPWA 3ACFA 1UWWA 5CYYA 4DUWA 1JZ5A 2VZOA 2B4KA 3K4ZA 2VO5A 3NJVA 5G05L 2W1WA 2Y6JA 4LHSA 5JUVA 2J1SA 3LEIA 3HNBM 4XZUG 1ULOA 2BGPA 3WF0A 1CX1A 2R7EB 5LA2A 1O8PA 3W5NA 1UMIA 1GMMA 4OMCA 4QX0A 4QB1A 2RV9A 2B9VA 3CMGA 3C7EA 4A42A 2VJXA 2VZSA 4A4AA 1PX3A 2WAOA 1DYOA 3IAQA 1OF3A 2RJ2A 2JD9A 1NKGA 2W87A 3VD7A 2VZ1A 1GOGA 2VZVA 2VZPA 4ARYA 2J1UA 4QX1A 4XUNA 3U37A 2DCJA 2BZDA 3ACHA 4OMDA 1WCQA 2W9XA 4MO3M 4W50A 3LEKA 1UYZA 2BBAA 5J1XA 4CU8A 2Z4FA 3T09A 5DQ0A 3A23A 5EIYB 3T2QA 1K12A 2EIDA 5IYYA 3IIIA 3LE0A 2ID4A 3VDCA 2HLEA 4ARXA 3GGLA 3LPGA 1JYXA 2VMEA 3EB7A 4DEQA 4RN5A 1JZ2A 3WQBA 2E33A 1XNAA 3OGRA 2VCAA 3E1F1 3UETA 2QQNA 3LQCA 3OB8A 3T0DA 3WNPA 4W8JA 2E26A 2WYSA 1OT5A 2WDBA 3A21A 4CUCA 3ACIA 4GWJA 1J83A 3WNKA 2PQSA 4ZXEA 3DYMA 2WN2A 3FHAA 1CZSA 1K45A 2RVAA 4PT6A 2BERA 5JXGA 4CU9A 1OF4A 3SKVA 4D0QA 2V5DA 2WZ8A 2Y6KA 1TG7A 4A44A 2WN3A 3WF1A 1O8SA 5FUIA 4BDVB 1L7QA 2VL4A 2WUHA 3CDZB 3OGSA 4DXRA 2VQTA 3CQOA 4KMQA 3FHQA 1JZ7A 4CUAA 4OUEA 2W1QA 1MPXA 3FN9A 3OG2A 4QX2A 1L7RA 2C4XA 3T2PA 3ZM8A 2X10A 4PF1A 2XHNA 1R64A 1T2XA 2VMFA 2VR4A 3MBWA 1K3IA 2WO1A 3C7HA 2QBXA 4JX0A 2VC9A 4A6OA 4W4ZA 4DXTA 3JXSA 5JXIA 4P00B 2VM9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EUT A;  3CKH A;  2KD7 A;  3I3D A;  3NQH A;  3CIH A;  4OZO A;  1O59 A;  2VMD A;  4XUQ A;  3VD3 A;  2Y6H A;  3HEI A;  2OKX A;  1UY2 A;  4MGS A;  1XNT A;  5DN2 A;  4XVH A;  3P1I A;  2WZE A;  3ECQ A;  1UY3 A;  2DDU A;  2QQM A;  1DLC A;  1H6X A;  3WSO A;  3C8X A;  2W94 A;  2Y8K A;  4MOA A;  4Z2A A;  4L0P A;  5IJR A;  4UOJ A;  3I3E A;  5I0D A;  1GUI A;  4BK5 A;  1SG3 A;  5F7U A;  3MUZ 1;  2J1V A;  3T2O A;  5LA1 A;  1YQ2 A;  3IAP A;  3OBA A;  3HNM A;  4JKL A;  1H6Y A;  3I3B A;  4JKK A;  2E31 A;  2YC4 A;  1I5P A;  4UI9 L;  4JHZ A;  2Y6G A;  4CVU A;  4P5Y A;  1RYY A;  4JKM A;  1W8N A;  3K75 B;  3CZJ A;  2L9L A;  1DP0 A;  4XUO A;  4QB2 A;  4QDR A;  1IQD C;  2W5F A;  3WEZ A;  1GQP A;  3WNM A;  4YPJ A;  1JZ8 A;  3NRU A;  3UNP A;  2VZQ A;  3PUH A;  4QDS A;  4D8M A;  2VZR A;  5IFT A;  5LCW L;  2VOT A;  3HNY M;  1JI6 A;  5EJZ B;  3BN6 A;  2C26 A;  3GM8 A;  3LPF A;  4AAX A;  1SDD B;  1JZ4 A;  1GOF A;  3UES A;  1KGY A;  3SEE A;  3IB3 A;  1F4A A;  5JMO A;  1CZV A;  4XUP A;  4E8C A;  1GU3 A;  2CDP A;  3J7H A;  2EIB A;  3MV1 1;  1JYV A;  5JXH A;  3I2I A;  4RYD A;  3W5M A;  3WF3 A;  4OYU A;  2YB7 A;  3T08 A;  2DCK A;  2VZT A;  2ORZ A;  3ETP A;  1UZ0 A;  2E32 A;  2YFZ A;  1US2 A;  4UAP A;  2QQJ A;  2J1T A;  4BXS V;  3OEA A;  1UY4 A;  3DYO A;  1D7P M;  2C9K A;  2VQU A;  3DYP A;  3K46 A;  4HG6 B;  3WNN A;  2WAA A;  5B4N A;  1UXZ A;  5C7G A;  4XUR A;  3VD5 A;  2ORX A;  2WQ8 A;  2Y6L A;  3GDB A;  4M4P A;  5A1A A;  2HYX A;  1UX7 A;  2W91 A;  3I97 A;  5IFP A;  1GNY A;  4MGQ A;  3WNO A;  4QB6 A;  1UYY A;  3ABZ A;  2J1R A;  4LKS A;  1US3 A;  1J84 A;  4KI5 M;  2J22 A;  1P8J A;  4KWU A;  3THC A;  3IDA A;  4TTG A;  3HJR A;  1WKY A;  2JDA A;  3I2K A;  1UXX X;  3A22 A;  2ZEW A;  5LA0 A;  2ZEY A;  4DEV A;  2WBK A;  5HXM A;  5DMY A;  3ACG A;  2ZXQ A;  3BGA A;  1UY1 A;  3I2J A;  2QQO A;  4ZY9 A;  2J1A A;  4BJ0 A;  2VZU A;  2VCB A;  2WO3 A;  1W0N A;  1PMJ X;  1OH4 A;  1CIY A;  2QQI A;  1W9T A;  3F2Z A;  4E8D A;  4BK4 A;  1W99 A;  5EJ1 B;  4QX3 A;  4CUB A;  3MUY 1;  4QAW A;  4CU6 A;  4ZZ8 A;  3T0A A;  2J1E A;  3T0B A;  3WF4 A;  3GXU A;  5JXJ A;  2YC2 A;  4AG4 A;  1ULP A;  2XOM A;  3I2G A;  3SKJ E;  4DXS A;  1NX9 A;  2BGO A;  5IHR A;  2LW8 A;  2LS6 A;  2W1U A;  4XUT A;  3I2H A;  5CZK A;  2WO2 A;  3HN3 A;  3P6B A;  3WNL A;  4GWI A;  1SHW B;  2V4V A;  3EYP A;  1JYW A;  3NJX A;  1NAE A;  3LEG A;  2XQX A;  3OGV A;  5C71 A;  2X09 A;  1EUU A;  4DUV A;  3HOB A;  2W47 A;  3C7F A;  4P02 B;  1JU3 A;  4IUG A;  2YG0 A;  2J7M A;  2VCC A;  4A41 A;  2X05 A;  5HPO A;  1KEX A;  3K4A A;  2EIE A;  1TVG A;  4MAD A;  1JU4 A;  1OD3 A;  1JZ6 A;  5JR2 A;  4GZ9 A;  3A7Q A;  3VD9 A;  3WF2 A;  2Y64 A;  2ZEX A;  4FI9 A;  3C7O A;  1F4H A;  3CZU A;  1K42 A;  2EIC A;  2WAB A;  1HN1 A;  4P08 A;  3PUI A;  1CZT A;  3THD A;  4A3Z A;  2QQL A;  2W92 A;  1LNS A;  1PX4 A;  3OEB A;  1JHJ A;  3VDB A;  2VZ3 A;  3VD4 A;  3MV0 1;  5G04 L;  3D3A A;  3K77 A;  2JKX A;  2W46 A;  2W3J A;  3FL7 A;  1XC6 A;  1W9S A;  3SEP A;  3K4D A;  4TXW A;  1PMH X;  2XON A;  1W8O A;  3DEC A;  4A45 A;  2VMC A;  2QQK A;  1W9W A;  5B4X A;  4ZZ5 A;  1JZ3 A;  3MO4 A;  4CU7 A;  2ZEZ A;  4LPL A;  2CDO A;  1UMH A;  5DPN A;  1UY0 A;  3HPN A;  2W95 A;  1NUK A;  4M4R A;  5C70 A;  1BHG A;  2YFU A;  4PQQ A;  4ET7 A;  4DUX A;  1JYN A;  3VDA A;  2JE8 A;  1GOH A;  3C7G A;  2W1S A;  1XPW A;  1UYX A;  4LQR A;  3AC0 A;  2V72 A;  2VTF A;  3I2F A;  3NNG A;  4QDQ A;  4QPW A;  3ACF A;  1UWW A;  5CYY A;  4DUW A;  1JZ5 A;  2VZO A;  2B4K A;  3K4Z A;  2VO5 A;  3NJV A;  5G05 L;  2W1W A;  2Y6J A;  4LHS A;  5JUV A;  2J1S A;  3LEI A;  3HNB M;  4XZU G;  1ULO A;  2BGP A;  3WF0 A;  1CX1 A;  2R7E B;  5LA2 A;  1O8P A;  3W5N A;  1UMI A;  1GMM A;  4OMC A;  4QX0 A;  4QB1 A;  2RV9 A;  2B9V A;  3CMG A;  3C7E A;  4A42 A;  2VJX A;  2VZS A;  4A4A A;  1PX3 A;  2WAO A;  1DYO A;  3IAQ A;  1OF3 A;  2RJ2 A;  2JD9 A;  1NKG A;  2W87 A;  3VD7 A;  2VZ1 A;  1GOG A;  2VZV A;  2VZP A;  4ARY A;  2J1U A;  4QX1 A;  4XUN A;  3U37 A;  2DCJ A;  2BZD A;  3ACH A;  4OMD A;  1WCQ A;  2W9X A;  4MO3 M;  4W50 A;  3LEK A;  1UYZ A;  2BBA A;  5J1X A;  4CU8 A;  2Z4F A;  3T09 A;  5DQ0 A;  3A23 A;  5EIY B;  3T2Q A;  1K12 A;  2EID A;  5IYY A;  3III A;  3LE0 A;  2ID4 A;  3VDC A;  2HLE A;  4ARX A;  3GGL A;  3LPG A;  1JYX A;  2VME A;  3EB7 A;  4DEQ A;  4RN5 A;  1JZ2 A;  3WQB A;  2E33 A;  1XNA A;  3OGR A;  2VCA A;  3E1F 1;  3UET A;  2QQN A;  3LQC A;  3OB8 A;  3T0D A;  3WNP A;  4W8J A;  2E26 A;  2WYS A;  1OT5 A;  2WDB A;  3A21 A;  4CUC A;  3ACI A;  4GWJ A;  1J83 A;  3WNK A;  2PQS A;  4ZXE A;  3DYM A;  2WN2 A;  3FHA A;  1CZS A;  1K45 A;  2RVA A;  4PT6 A;  2BER A;  5JXG A;  4CU9 A;  1OF4 A;  3SKV A;  4D0Q A;  2V5D A;  2WZ8 A;  2Y6K A;  1TG7 A;  4A44 A;  2WN3 A;  3WF1 A;  1O8S A;  5FUI A;  4BDV B;  1L7Q A;  2VL4 A;  2WUH A;  3CDZ B;  3OGS A;  4DXR A;  2VQT A;  3CQO A;  4KMQ A;  3FHQ A;  1JZ7 A;  4CUA A;  4OUE A;  2W1Q A;  1MPX A;  3FN9 A;  3OG2 A;  4QX2 A;  1L7R A;  2C4X A;  3T2P A;  3ZM8 A;  2X10 A;  4PF1 A;  2XHN A;  1R64 A;  1T2X A;  2VMF A;  2VR4 A;  3MBW A;  1K3I A;  2WO1 A;  3C7H A;  2QBX A;  4JX0 A;  2VC9 A;  4A6O A;  4W4Z A;  4DXT A;  3JXS A;  5JXI A;  4P00 B;  2VM9 A; 
#chains in the Genus database with same CATH topology
 1QXP A;  2GNB A;  2K9Z A;  4AW7 A;  4BLI A;  1PGL 1;  1ODM A;  4RGK A;  2XJP A;  3CKH A;  4OFG A;  3I3D A;  4FPH A;  4OZO A;  4BXF A;  2VMD A;  4XUQ A;  2FDF A;  4XDP A;  1Q5O A;  2WZR 1;  5IW0 A;  5KBF A;  3VZN A;  4KNC A;  1OUR A;  5FPL A;  4CDU C;  4OVE A;  1COV 1;  5IAX A;  1DU3 D;  2WZE A;  1UY3 A;  2DDU A;  1BCX A;  4ATE A;  4JTO A;  1BEV 2;  1PGS A;  3C8X A;  3PIJ A;  4MOA A;  4MXV A;  2RJL A;  1NCR B;  4Z2W A;  3H50 A;  3KV6 A;  5FLJ A;  3JUU A;  5IJR A;  3KQR A;  2MEV 3;  4OHW A;  1Q8V A;  5IK8 A;  1ZBA 2;  4WVM B;  1W6O B;  4NII A;  1GUI A;  1C5I A;  4Q1P A;  3AMQ A;  4XIO A;  5ABJ B;  3VKF C;  2G19 A;  1RIR A;  3KVA A;  4K6B A;  1GSL A;  2K46 A;  1JW6 A;  1G9C A;  5DAV A;  4RS5 A;  4XF3 A;  3NAP C;  5CKM A;  4DY5 A;  1NOV A;  4AFM A;  3GBW A;  3HNM A;  4N90 A;  4XFA A;  4BQX A;  4UFH A;  4YW4 A;  3W20 A;  4UI9 L;  3T1M A;  4JHZ A;  5I91 A;  4QPY A;  2G9F A;  2ILM A;  2PLV 1;  4D6Q A;  2HJI A;  3ZIX A;  2QFE A;  4QB2 A;  5LRR A;  1X7N A;  2HEV F;  2ENR A;  1LOG A;  2A75 A;  2WNE A;  3E5X A;  2Q8O A;  3BU0 A;  4G3Y C;  1HXS 3;  4NVP A;  1MS4 A;  4AVB A;  4QM8 A;  5FAX A;  1GQP A;  1B09 A;  1F8V A;  4JGY A;  1IGO A;  4FFH A;  4AYU A;  4KH9 A;  5ANN A;  3NRU A;  3WG3 A;  1JZ8 A;  2NYY A;  4XDQ A;  3LSE A;  5DUV A;  4CUG A;  5GLW A;  2VZR A;  1MVQ A;  2G9Z A;  2ZTN A;  3ELN A;  3MYX A;  4D8M A;  4KWJ A;  4RR3 A;  1BEV 3;  2PTM A;  2AEY A;  1JI6 A;  5A32 B;  3BN6 A;  3H8X A;  1ENX A;  4EWE A;  3LPF A;  4AAX A;  4E4Z A;  4EZ4 A;  3JBG 3;  3DKW A;  2ZGS A;  1JOD A;  4LNV A;  5FKC A;  4HXC A;  1AJO A;  2ZGL A;  4Q5O A;  4YW2 A;  1UU6 A;  5IVB A;  3MF6 A;  3SEE A;  5FK8 A;  5H9Q A;  3CJI C;  1CZV A;  4LK6 A;  3TAY A;  3VBU B;  2XPJ A;  3WDX A;  4WBB A;  1YXW A;  2EIB A;  1JYV A;  4NRQ A;  2HWC 1;  4YM1 A;  5FZ7 A;  2Q0A A;  3ZKU A;  3W5M A;  5FZ4 A;  2VXJ A;  2YB7 A;  1R1Z A;  4IDZ A;  5J96 B;  5GZC A;  3AMH A;  3BKZ A;  1US2 A;  2QQJ A;  4XDO A;  4FOW A;  3O1S A;  3ZR6 A;  3JU9 A;  2YUE A;  5BNO A;  1CAW A;  2CSG A;  4CPB D;  4CCD A;  5LY1 A;  1D2S A;  5FTT C;  3LGR A;  3M3E A;  2GAU A;  5TSW A;  4Y5S A;  3NV1 A;  2NQY A;  1SFY A;  2ZCW A;  3DYP A;  5FP3 A;  1PVC 3;  5L36 A;  1ZZ6 A;  4KGQ A;  3UGF A;  5L9B A;  3FZ3 A;  3GZA A;  2RDN A;  3KT7 A;  1S0F A;  2WT1 A;  2OUJ A;  3G6J B;  1UXZ A;  4L97 A;  3QH7 A;  3TEX A;  1OVS A;  5C7G A;  3NMB A;  4S2F A;  2VEC A;  2VTX A;  3VD5 A;  2DBN A;  3AK0 A;  4Q0Q A;  1S0D A;  3MGU A;  4AED B;  1S0J A;  4AL9 A;  5A1A A;  5BNQ A;  2G4I A;  5C3Q A;  3B02 A;  4XZP A;  4CP0 A;  4BPZ A;  1WLW A;  4MGK E;  5IFP A;  4WM8 B;  5EP9 A;  2RS1 2;  4BA6 A;  1QWR A;  2RMU 1;  1R08 2;  1YQ6 A;  1UKR A;  2EXJ A;  3KT1 A;  4QB6 A;  4JGY C;  4QX7 A;  5IK5 A;  3WHU A;  5J36 A;  1FI2 A;  2WNU A;  4KI5 M;  1X36 A;  3LDK A;  2WNV A;  3THC A;  4RHV 2;  4IER A;  4D7T A;  2VAU A;  1WMD A;  4HBN A;  4E9K A;  3O7O A;  4RGG A;  1YEW A;  1LOF A;  5LA0 A;  4O65 A;  1N3O A;  3CF6 E;  4DEV A;  5HXM A;  1B35 C;  1I1E A;  1MQT C;  2RM2 1;  1FMD 3;  1QNY A;  1RUE 2;  3ACG A;  4IND A;  4OZX A;  3KLS A;  4K21 A;  4NIA A;  2VG9 A;  4HL0 A;  1UU4 A;  3I2J A;  3INA A;  3RDI A;  2VZU A;  3PUR A;  1YFX A;  1W0N A;  1AHS A;  5FO7 B;  4LEJ A;  1XNB A;  2CU5 A;  1OH4 A;  4G4F A;  4E2G A;  1N3P A;  1QH7 A;  2QQI A;  1G9B A;  2ZGP A;  3LCP A;  2XL9 A;  1OXC A;  1S0B A;  3DCQ A;  4E8D A;  4HKO A;  4N9H A;  1DG6 A;  3D0J A;  1PK6 C;  1AR8 3;  4QX3 A;  1MR5 A;  2PXJ A;  3AKR A;  1NCQ B;  1FPN 2;  1GZ9 A;  2J42 A;  3LFI A;  4LHL A;  4XJZ A;  4LK7 A;  5FZ0 A;  1ENS A;  1SLT A;  4C91 A;  4LOR A;  5JI7 A;  3WDW A;  1W6O A;  5FP9 A;  4CU6 A;  4EN7 B;  3WXP A;  2JXA A;  3FJS A;  5C4W B;  2A1X A;  1UU5 A;  3GXU A;  3D8C A;  5L19 A;  1UOG A;  1ZBE 1;  1AR7 1;  3B93 A;  2YC2 A;  2CGP A;  3PUS A;  3POG A;  4QPG C;  3S30 A;  3WZ1 A;  1ULP A;  3GZU C;  3VBR A;  3BTY A;  2ZHM A;  2BGO A;  2ATF A;  2R30 A;  4DXZ A;  2A6Z A;  2LW8 A;  2YPD A;  2DCY A;  3FHI B;  3NNM A;  4XBN A;  2A5Z A;  2ZOE B;  1ASJ 3;  2W1U A;  5L9V A;  4NIG A;  4GAL A;  1RUF 3;  1J58 A;  3E6C C;  3CNA A;  1VRH 1;  2YMZ A;  4ZON A;  1OLQ A;  2XBO 1;  4UBH A;  5L7O B;  2WO2 A;  1EV1 3;  4YW5 A;  3O1O A;  5F37 A;  3MZH A;  5B2G B;  4WZC A;  1J3Q A;  2V4V A;  2WA4 A;  4NUB A;  1DGW A;  4XEZ A;  3UT0 A;  5K8S A;  1UF2 C;  2XKP A;  4LXL A;  4PLO A;  5FLH A;  1Z78 A;  4XQW A;  4FPL A;  3VB9 A;  3OGV A;  4IGP A;  1HRV 3;  4L2N A;  3JD7 2;  1WLT A;  2WFF 1;  4R9C A;  1SBD A;  1W3V A;  2EAK A;  4DIQ A;  5FZ6 A;  3AFK A;  4MX3 A;  3C7F A;  1ZA4 A;  4CE8 A;  1QJY 2;  3I59 B;  5L7O C;  3WW1 A;  1DBN A;  5FJK A;  4IUG A;  2J7M A;  1TMF 3;  3USU A;  1BK1 A;  1WMF A;  3K3O A;  4I3P A;  1JYI A;  5BYN A;  3POY A;  1XE8 A;  3AMP A;  1ZBE 3;  1TVG A;  1FPN 3;  3ITQ A;  5FYI A;  1JU4 A;  5KHJ A;  1N3Q A;  3H1W A;  4GH4 A;  4IET A;  4EN9 B;  3M3Q A;  1NA1 A;  1UPI A;  1MZE A;  2HWE 2;  3A7Q A;  3QH6 A;  4NRM A;  1YQ8 A;  2VUD A;  3ROU A;  5C5T A;  4LUM A;  5CAD A;  3RYP A;  1GWL A;  1VJ2 A;  2E63 A;  1MVE A;  1LHO A;  2VUJ A;  3C7O A;  4TLG A;  2OZ6 A;  2HBU A;  5FUN A;  4HFS A;  5BNN A;  1YO8 A;  1NXM A;  2CHH A;  4C1X A;  2D97 A;  4UW6 A;  4UF0 B;  3THD A;  2QQL A;  1W6M A;  1KFX L;  2IFW A;  3AP4 A;  4QX5 A;  4AVT A;  3HBZ A;  4YZ4 A;  1IS6 A;  1N1S A;  1RUJ 2;  2JG9 A;  2R0F A;  2WNO A;  3N9Q A;  3JQW A;  4K3U A;  3M1H A;  3CHX A;  3GBF A;  2XR4 A;  3AZY A;  3VD4 A;  1ND2 C;  4Q26 A;  4Q4Y 1;  1OUS A;  2ZGR A;  2A73 B;  1Q8S A;  3SEP A;  4FO9 A;  4X6R B;  1PMH X;  3NL1 A;  2XWB B;  2E7T A;  2EXK A;  4LO6 B;  1VAM A;  4A45 A;  1AR6 1;  1WZX A;  4Q4X 2;  2JIG A;  4UFK A;  3IWZ A;  5FZF A;  4GMP 3;  3HN1 A;  1X9P A;  4LPL A;  1RHI 1;  1UMH A;  4PF5 A;  4XXA A;  3OD4 A;  4JGZ B;  2VUA A;  3U78 A;  1MS8 A;  2AGS A;  1ZYB A;  1AX1 A;  4LO8 A;  3FFZ A;  4Q0P A;  4M4R A;  5D21 A;  4YFW A;  3ZFF A;  4DUX A;  3VDA A;  3MLJ A;  4NHK A;  4IGO A;  1W6P A;  2AC1 A;  2R04 2;  2YC0 A;  3AZX A;  1FNZ A;  2W52 A;  4D6R A;  3ENR A;  2BUK A;  4QHB A;  1VB2 A;  3ST7 A;  1YUD A;  4ZU5 A;  1HQW A;  5A7O A;  2XWJ B;  2Z5W A;  2O0O A;  2WS9 3;  4LKD A;  4V2W A;  5FZ1 A;  2D6N A;  2JDH A;  3UV9 A;  1FX5 A;  3NNG A;  2FZ1 A;  4EN0 A;  5LBC A;  2DYC A;  1UWW A;  3LDB A;  4K1Y A;  1ZVF A;  1SFP A;  1OOP C;  3MPP G;  4KG0 A;  4PIX A;  4K8F A;  5C6C A;  4YW7 A;  4NHM A;  2B4K A;  4FXK B;  4Q0V A;  1VBB 3;  5LK5 A;  3VBF B;  1D2Q A;  2Y6J A;  3KF5 A;  2J1S A;  4EN8 B;  1YQC A;  1UOJ A;  1W2N A;  2JG8 A;  1XNC A;  4F3J A;  5CKN A;  4LKE A;  3N7K A;  5A33 B;  1WMX A;  2GC0 A;  5F2S A;  4FPO B;  1AR8 1;  1W2A X;  3PTR B;  2F4P A;  4Q4V 2;  5I0R A;  3ZXG A;  1Q43 A;  1HQN A;  1YJL A;  1AL2 3;  2X29 A;  1LOB A;  3VZJ A;  3ZSK A;  4EV0 A;  5K0U A;  5LZ6 A;  1R08 3;  4ORF A;  2GP3 A;  3DXU A;  3PIG A;  4HMZ A;  4I01 A;  4OMC A;  4OHZ A;  2CWM A;  4EWD A;  2ZA9 A;  3B01 A;  2RV9 A;  3CMG A;  3BUC A;  2SBA A;  4CCE A;  3PJQ A;  4GA9 A;  5KHI A;  4Q0S A;  3VDD A;  4H2A A;  4XJ9 A;  1OOP B;  2RJ2 A;  4LE3 A;  1Q8Q A;  4HAN A;  1PK6 A;  4S2H A;  4CDQ A;  4RGA A;  2VZ1 A;  4BQY A;  1GOG A;  2WA3 A;  1E5S A;  1AYM 3;  5A7S A;  2EAA A;  1JOJ A;  3ZXK A;  1VMF A;  2J1U A;  3M70 A;  4JC1 A;  1TNR A;  4XUN A;  1VBC 2;  2DCJ A;  2RJK A;  3ZVX A;  4YZ2 A;  2BZD A;  2Z42 A;  2LM3 A;  2RDR A;  3ACH A;  3RFR A;  3WW3 A;  1WCQ A;  4IL7 A;  4Z8B A;  5KXE A;  5KXB A;  4M3C E;  4S2G A;  1PNG A;  5HCH A;  3LEK A;  1U0A A;  1ODN A;  5A6Q A;  4JV4 A;  1GZC A;  4YGC A;  5DQ0 A;  4M0N A;  2R1D A;  1APN A;  2JDN A;  1GP5 A;  3AMM A;  1PO1 1;  2VVF A;  3TNP B;  3T2Q A;  4IES A;  4AQT A;  5EIY B;  4RL7 A;  1SQ4 A;  3III A;  3LE0 A;  3BTA A;  2H6C A;  1S55 A;  1CAV B;  2PAK A;  1H2K A;  1MEC 1;  4EYU A;  5FZE A;  2C0Z A;  3EB7 A;  2Y33 A;  4ZU7 A;  3WD5 A;  3WQB A;  4PDW B;  2E33 A;  1E5H A;  2VD7 A;  3V0B A;  2WLQ A;  3PU3 A;  3OGR A;  1XU1 A;  4J6G A;  4COW A;  1ND3 C;  3WNP A;  1PHM A;  3TN9 2;  4IV3 C;  1GYK A;  1PNF A;  3E97 A;  1OKQ A;  1CD3 G;  3A21 A;  5DUU A;  2VPV A;  3SCF A;  4FT8 A;  3O12 A;  2ZX2 A;  2CY6 A;  4CUC A;  4OI0 A;  1RGS A;  5A7W B;  2ZAH A;  3ACI A;  4XTP A;  5T50 A;  1J83 A;  3TNQ A;  5BNN B;  2RS5 2;  2HWC 3;  1S2K A;  1WW6 A;  2WN2 A;  1VBD 2;  5IVF A;  2YU1 A;  1CZS A;  1VAL A;  2GMP A;  2DVA A;  2BNM A;  1UZV A;  1BVP 1;  2D43 A;  3JCI A;  3NWK A;  4GQ7 A;  4PT6 A;  4MET A;  1KQR A;  2BER A;  2XBO 2;  2YDE A;  3H3Z A;  2ZGT A;  1RVF 2;  3GZT B;  3JD7 3;  4CU9 A;  4D0Q A;  2ZX3 A;  4QU2 A;  2WZ8 A;  3RNS A;  1BJQ A;  4K9S A;  5FZG A;  3NAP B;  2XL7 A;  1HIX A;  1OA4 A;  1NY7 2;  2HBT A;  3THT A;  4JCK A;  4AHZ A;  4ASM B;  1H8T A;  3POE A;  4QXC A;  3CDZ B;  4M3C B;  4LTA A;  3VHR A;  2RR1 2;  4QX8 A;  4RQP C;  2D5F A;  1ULG A;  3CQO A;  3FHQ A;  2QQU A;  4D7S A;  4QT6 A;  1ZRE A;  2JJ6 A;  2UUR A;  1WBF A;  2WYF A;  1GNH A;  4XFG A;  1BMV 2;  5EV7 A;  3W59 A;  4YRD A;  1G9D A;  4JDO A;  4LOS A;  1F35 A;  2WR9 A;  3NNF A;  4QX2 A;  4YM0 A;  4FAH A;  1EAH 3;  1CON A;  3IM0 A;  3T2P A;  2YV8 A;  3T1L A;  1DYK A;  1X82 A;  2ARE A;  2X10 A;  1U5Z A;  2MPF A;  4UFM A;  5FPX A;  1PVC 1;  1R64 A;  3CJI B;  2JDZ A;  1PM7 A;  2VR4 A;  1NLS A;  3TN9 1;  3UJQ A;  4XBL A;  1BKZ A;  1QXJ A;  2QBX A;  2ZAC A;  2GC3 A;  5FIX A;  4Y3O A;  5F5Q A;  3SIS A;  5F9T A;  4HN1 A;  1GFF 2;  4W4Z A;  1IKP A;  1MS1 A;  4Y33 A;  2UWA A;  3POB A;  4ASL A;  4DQA A;  1UKG A;  4LBN A;  4N43 C;  3HAG A;  1AXK A;  3GJB A;  5FCC A;  1LOE A;  5CB7 A;  5FWJ A;  1VRH 3;  2AR6 A;  4Q4X 3;  3DUI A;  2XBO 3;  2DF7 A;  5FDB A;  1O59 A;  1IPJ A;  3VD3 A;  2Y6H A;  2OKX A;  5FXV A;  5F3G A;  5KHG A;  1UY2 A;  2FQP A;  1XNT A;  1LTE A;  4XVH A;  3IDE A;  3P1I A;  2VH9 A;  5C4W C;  2IXI A;  5C8C B;  4P9L A;  3WSO A;  3O1R A;  4UW5 A;  1TME 2;  3R05 A;  1WLC A;  1ULF A;  2B39 A;  2W94 A;  2Y8K A;  4XAC A;  3ZSJ A;  5FP8 A;  1AL2 1;  1GIC A;  4WVM A;  2R06 1;  3VBF C;  4JVA A;  4GB3 3;  2QCS B;  4AHW A;  1JYT A;  3LEM A;  4XFB A;  4UOJ A;  4XCB A;  2Q8D A;  5I0D A;  4PI2 A;  1H30 A;  2R04 3;  5FO9 B;  5KC5 A;  1MAC A;  2X53 S;  2Q1Z B;  1TMF 2;  1SG3 A;  5F7U A;  1REE A;  2IFR A;  2OQ6 A;  1SDW A;  2NLR A;  4JHT A;  3T2O A;  3WCR A;  2ZKL A;  2P37 A;  3BPZ A;  5AC9 2;  3A0N A;  5D8A C;  3LZZ A;  2BFU L;  2HWE 3;  1NCQ A;  2RR1 1;  3J7L A;  4H7M A;  4ISQ A;  2YHJ A;  3I3B A;  3OPZ A;  4XF1 A;  4Y1Z A;  1HW5 A;  2E31 A;  2YC4 A;  4HT1 T;  4NHL A;  1GP4 A;  4P9J A;  3DEM A;  1CQ9 A;  1H2N A;  3VBR C;  4W6Y A;  2UYA A;  1F5J A;  4IE0 A;  3CZJ A;  3K75 B;  4XUO A;  1PO2 2;  2VOV A;  4GXL A;  1W2O A;  1HRV 1;  1AR6 2;  4AQ2 A;  1N1V A;  4JGY B;  2WWJ A;  3WLU A;  1NQD A;  2WLP A;  3WW2 A;  2A6Y A;  1QIQ A;  1VBD 1;  2WNV B;  3POS A;  3I3M A;  4YW1 A;  5A1F A;  4BE3 A;  1OA2 A;  4Q4Y 3;  4AE2 A;  3GHM A;  4UFJ A;  3VGI A;  5IFT A;  4XFF A;  1Q56 A;  2OX0 A;  3DGT A;  5A33 A;  5LCW L;  3HNY M;  1POQ A;  5CFD C;  3EMR A;  2SLI A;  4LHN A;  4COY A;  4LR4 A;  1W2U A;  4PDW A;  2C26 A;  4AGG A;  4Y1X A;  5DAP A;  5JSP A;  1IKQ A;  1ST8 A;  4GB3 2;  4Q29 A;  4YNI A;  2V5Y A;  2BFU S;  3UES A;  2XJV A;  5FZK A;  1POV 1;  1SEF A;  2O1Q A;  2BRT A;  3ZN4 A;  2EXI A;  3KSC A;  2FDI A;  1OSG A;  1FXZ A;  2BOI A;  2JDK A;  5CIS A;  1RJ7 A;  4B8E A;  1F4A A;  4I3G A;  5JMO A;  1W05 A;  1K5J A;  4IE6 A;  4PQ9 A;  3RMY A;  1ZZ7 A;  3KGZ A;  2V73 A;  3IPV B;  2C6S A;  4FPJ A;  4RYD A;  4X8N A;  4AI0 A;  4R9B A;  4OYU A;  2DCK A;  3DPR B;  4ZXK A;  1D4V B;  2FCV A;  3ZFE C;  5FMC A;  2GC2 A;  4OQ8 A;  2WNU C;  2E32 A;  1OH3 A;  2YFZ A;  2D98 A;  3MIG A;  4UAP A;  4IEX A;  4XQ4 A;  5C3P A;  2ETE A;  5JWP A;  4AGR A;  4TZD A;  5A7P A;  5E6H A;  1FMD 2;  2HWB 1;  4XJA A;  4PLN A;  2RMU 2;  3HQX A;  2A3Y A;  1UY4 A;  2LUW A;  3BTZ A;  1D7P M;  2WWU A;  4XOG A;  2BBV A;  1BXH A;  1WW7 A;  1KFU L;  3OOX A;  3K46 A;  3WNN A;  1A8D A;  2P17 A;  2PHF A;  5FK7 A;  5FBZ A;  2WAA A;  3FLR A;  1G9A A;  1XXN A;  2Q5T A;  3KV5 A;  5B4N A;  3THP A;  3PJY A;  2W39 A;  3KB5 A;  3M7A A;  1ZRC A;  4FPY A;  4Q4Y 2;  1EY2 A;  3F95 A;  2Y6L A;  1XBF A;  4GWN A;  4XBQ A;  4OHX A;  1V6I A;  5F39 A;  4ZS3 A;  2HYX A;  4ASK A;  5JLV A;  1O3R A;  2VBB A;  4A7Y A;  3WNX A;  1C57 A;  4G9S B;  1O3Q A;  4XF0 A;  5A1L A;  4MUV A;  1I6X A;  1WGP A;  1XNK A;  4GD4 A;  3J7N A;  1V6K A;  4CCO A;  2HWD 1;  2RS5 3;  3VBS A;  5FZ9 A;  1AR7 2;  1UYY A;  3GHN A;  4Z1V A;  2FCU A;  1G6N A;  1WCD J;  4LKS A;  3RZM A;  2GNT A;  4YM2 A;  2WZR 2;  2DTY A;  2XJS A;  1PM4 A;  2BPA 2;  4NO4 A;  3LIH A;  1HRI 2;  4X8P A;  1OUX A;  1QJU 1;  5F8P A;  1RVF 3;  1OPO A;  3HJR A;  1WKY A;  5DUW A;  2K2S A;  1UXX X;  2OPK A;  5J98 B;  5A6X A;  2QDR A;  2ZEY A;  2WBK A;  2I2S A;  2RS5 1;  1O6U A;  3B7M A;  5FY9 A;  1JOB A;  3ZXD A;  2BWA A;  2MEV 1;  2ZXQ A;  3HMY A;  3BGA A;  2R07 2;  4K8R B;  1VBE 3;  5FYM A;  4BJ0 A;  4ZY9 A;  2VCB A;  2XVL A;  3O0V A;  1ND2 B;  3NAP A;  4XAE A;  4YW6 A;  5I93 A;  4HK8 A;  4RS5 C;  2ZGO A;  1W9T A;  5DZF A;  2RE9 A;  4BQ2 A;  1JH5 A;  4JGZ C;  2NMN A;  2VOW A;  5EJ1 B;  2Y6F A;  3Q8E A;  1FOD 2;  5F6K A;  5DAX A;  4M3C A;  2XLF A;  3RVH A;  1R1A 2;  4IEW A;  5JCT A;  2JDM A;  1OA3 A;  3MUY 1;  1NQJ A;  1F15 A;  1DZR A;  4QAW A;  4H55 A;  4CDW A;  4XIL A;  4CDX A;  5BNP C;  3RYR A;  1EP0 A;  1SPP B;  1XND A;  1MEC 3;  5EJ3 A;  1W6N B;  1VRB A;  2WFP A;  4WM7 B;  4AG4 A;  5JR7 B;  2Y38 A;  3NNL A;  3OY8 B;  4MHR A;  3TEY A;  2XOM A;  4DXS A;  3SKJ E;  1DQ5 A;  4U36 A;  3AP9 A;  1M06 G;  3LA7 A;  5GM0 A;  4AEK A;  1MS3 A;  3BYW A;  3H7J A;  4CEY A;  2LS6 A;  1UW8 A;  4JRL A;  4SLI A;  5FZM A;  2QJV A;  2Q30 A;  3CU7 A;  2A7A A;  3H7Y A;  4NMI A;  5BY5 A;  3TOJ A;  3FWE A;  1YJK A;  5JZG A;  4RS5 B;  5A70 A;  4TN7 A;  5CFC C;  1AYM 1;  3WNL A;  4XYX A;  1STM A;  1H8T C;  4M00 A;  4N9I A;  5CNA A;  2OII A;  1Q3E A;  1W6P B;  2BGC A;  3EYP A;  5GLV A;  3ZPY A;  5CA6 A;  1JYW A;  1VR3 A;  4MV2 A;  3NJX A;  3BI3 A;  1WUV A;  3V0A A;  1NAE A;  3LEG A;  2XQX A;  3AL5 A;  2X09 A;  3FUQ A;  1EUU A;  4GH4 C;  1CVN A;  4NWV A;  3ZSM A;  4DB5 A;  3HOB A;  3K3N A;  3ALQ A;  1V70 A;  2A71 A;  3S57 A;  3USU B;  2XKO A;  3GBG A;  1OLM A;  3UYJ A;  3AZW A;  4Q4W 2;  5FMO L;  4J1W A;  1JU3 A;  3RYK A;  4A41 A;  1BK0 A;  1AR8 2;  3K4A A;  3LD8 A;  3OUH A;  1S0C A;  1R1A 3;  1QJX 2;  5FQ0 A;  2XJT A;  4MAD A;  4D7Y A;  1OD3 A;  1ZZ8 A;  2BP6 A;  3HQR A;  2JEN A;  1JZ6 A;  5GZG A;  2ZGN A;  3BTX A;  4GZ9 A;  3MIF A;  4H7L A;  3OCP A;  4RR3 B;  5FYV A;  3TRS B;  3CJX A;  4B1L A;  4W65 A;  1GZT A;  2GND A;  4XAA A;  1LJ7 A;  4P9Y A;  3B3Q E;  3OPT A;  4YGE A;  3CZU A;  3PVO A;  1UAI A;  1W6M B;  3QAC A;  2GMM A;  4LBQ A;  4BWO A;  2X5I A;  4CPB A;  1S2E A;  4A2U A;  1O5U A;  3H8O A;  3ACL A;  4KL1 A;  1ASJ 2;  2P6C A;  3KT4 A;  1RUF 2;  4L11 A;  4AXO A;  1UO9 A;  1LNS A;  1VP6 A;  1PX4 A;  2HEW F;  1JHJ A;  3OEB A;  1YNA A;  4FPF A;  3MV0 1;  5DAB A;  3ZN5 A;  2GC1 A;  5J09 A;  5JOZ A;  2C5D A;  1V6O A;  2JKX A;  2W46 A;  3FL7 A;  3I54 A;  1CPM A;  5EYX A;  4PIY A;  1RUC 3;  2WL1 A;  2R04 1;  2Z79 A;  2DUR A;  3KQ4 B;  4OI2 A;  4CDQ B;  3KCX A;  4BIO A;  4KU7 A;  2ZMN A;  2VMC A;  2W0X A;  1VRH 2;  4TWT A;  1PIV 2;  1CAW B;  4EJR A;  2QQK A;  5CG9 A;  1KIT A;  3M3O A;  4Q4V 3;  4XIK A;  1JZ3 A;  2FDK A;  1PZ8 A;  4YGB A;  3DF0 A;  2WNV C;  3IDB B;  3BCW A;  1V9U 3;  2IVJ A;  4WVZ A;  5GKA C;  1FAT A;  5HV0 A;  1RHI 2;  2K0G A;  3HPN A;  3AP5 A;  4MSV A;  2W95 A;  1TME 3;  2B45 X;  5LA9 A;  3RMX A;  2P3Y A;  4MG2 A;  1NUK A;  5C70 A;  4DO0 A;  3WW4 A;  1I9R A;  3JZV A;  4HET A;  3Q8A A;  1O91 A;  5FPZ A;  1ZBA 3;  3ZYH A;  5FPV A;  1GOH A;  1V6L A;  1X8E A;  1JHN A;  2E53 A;  2PMW B;  1XPW A;  4YVS A;  3VKL A;  1LOC A;  4LQR A;  2VVD A;  4XFC A;  2BYV E;  3LDR A;  2VOX A;  2XUE A;  4K1Z A;  4Q4W 1;  3M8L A;  3GZE A;  4O9G A;  3ZSE A;  5ACA 2;  5ACA 1;  3ETQ A;  3ZFG B;  3S5Q A;  2D40 A;  3L2Y A;  3Q8C A;  5I0S A;  5CYY A;  1NG0 A;  5D1I A;  4DUW A;  2VZO A;  1JZ5 A;  3R4D B;  3VBS C;  1DHK B;  2GNM A;  2PAE A;  3BOP A;  4ES9 A;  2JKB A;  3IN9 A;  2P4E A;  4NHX A;  3N4M A;  2IXK A;  2UY9 A;  2VO5 A;  3ZXE A;  3NJV A;  2RS3 1;  3BPS A;  4Y4Y A;  1C3H A;  3LEI A;  4LO7 A;  2ARX A;  3SLI A;  1DZQ A;  3E5Q A;  2GZW A;  1H1M A;  5BNO B;  1PIV 3;  4HZF A;  5K0U B;  1T6G C;  5F5A A;  3WF0 A;  5A7N A;  4XQD A;  1QNW A;  4C1W A;  3P3P A;  5BPX A;  5F5C A;  3UJO A;  1W8F A;  3MEP A;  5LA2 A;  4W6W A;  2XQR A;  5D8A B;  1X8M A;  2IZW A;  4CP9 A;  2PLV 2;  2XG3 A;  4GKY A;  4QX0 A;  4XMI A;  4QB1 A;  3VBU C;  3NV4 A;  5A3W A;  3GCW A;  4PJY A;  1RUG 2;  4A42 A;  3OY8 A;  2NZ9 A;  5FRE A;  2VZS A;  3NV3 A;  4A4A A;  1PX3 A;  3KGL A;  1RC6 A;  1DYO A;  3IAQ A;  1VB4 A;  3J8F 1;  5FUP A;  1ENR A;  1OF3 A;  4YZ1 A;  2E7A A;  2PHX A;  1YHF A;  2QZ2 A;  2JD9 A;  2DBI A;  1YIP A;  2ZJC A;  2CAV A;  3VD7 A;  1IS4 A;  4WZF A;  1UN1 A;  2VZV A;  1XRU A;  1RUH 3;  5H9P A;  1A6C A;  5HBA A;  4LKF A;  2DU1 A;  5IUQ A;  2NM1 A;  4QX1 A;  4AQ6 A;  1GAN A;  4BLJ A;  1TEI A;  5J3U A;  1VBA 1;  1RUF 1;  3CL1 A;  2DCZ A;  3ZYF A;  1LHU A;  1AR9 1;  2W9X A;  4MO3 M;  4YLZ A;  3T2T A;  3ZYR A;  2VE1 A;  4CXW A;  1UYZ A;  5FZ3 A;  4PCR A;  4YGD A;  1OQE A;  3WUD A;  3A23 A;  2JB4 A;  3RGB A;  1W28 A;  4GWM A;  1RJ8 A;  4UWD A;  4N7U A;  1FOD 3;  3AVR A;  1K12 A;  2EID A;  1H1I A;  4KU8 A;  1IZ3 A;  3Q8B A;  1LHN A;  2HLE A;  3PNA A;  3SNM A;  2KXL A;  1TE1 B;  3FE5 A;  3RRD A;  4URT A;  4BYY A;  3EBR A;  2QE3 A;  2VME A;  3IIA A;  3WG4 A;  1QJX 1;  1JZ2 A;  4J25 A;  2JEM A;  2KM2 A;  1RMU 1;  1XNA A;  2XML A;  1SLB A;  4AHX A;  1H2L A;  4Y26 A;  5LBF A;  5C3S A;  1OFS A;  2AEN A;  3AZZ A;  3LQC A;  4OHV A;  1JYC A;  4A7Z A;  1W6N A;  1IOA A;  4W8J A;  3S6P A;  2VNG A;  3SH5 A;  5KR7 A;  3WUC A;  2PEL A;  4QKN A;  1ZNP A;  2FDH A;  1PGW 2;  4GWJ A;  2RS1 3;  4IV1 B;  1DCS A;  3WNK A;  1RUH 1;  2BOJ A;  5IVE A;  1I5Z A;  4QQH A;  4FPG A;  5DG1 A;  2D5H A;  4LO4 B;  3DYM A;  3S0M A;  3FHA A;  4Y5T A;  2ET7 A;  1RUI 1;  3EHK A;  3DL3 A;  4RFT 0;  4AR2 A;  1QU0 A;  3ZYG A;  3B94 A;  5A80 A;  4PBO A;  4MLO A;  1S4C A;  5JXG A;  3VBR B;  1WW5 A;  3SKV A;  3LAG A;  1LU1 A;  3DXT A;  2Y6K A;  4UF0 A;  5CG8 A;  4R9D A;  4AFC A;  1W04 A;  1H8T B;  1RIT A;  4FOQ A;  1R08 1;  4R4Z A;  1POV 3;  1HV0 A;  1SLI A;  4JDM A;  2JDU A;  4LMF A;  4RA0 A;  4YZ3 A;  3ZXA C;  2WS9 1;  3OYW B;  3CBN A;  2HWB 2;  2WJS A;  5FRA A;  4I2O A;  1L7Q A;  4HKW A;  3BOD A;  5ERL A;  2WUH A;  1VBA 2;  3N35 A;  1QJX 3;  5FXW A;  1JUI A;  3RWK X;  3AKT A;  1C8M 2;  3VV1 A;  3OGS A;  4BZ4 A;  4DXR A;  2VQT A;  1FV3 A;  5DDJ 3;  2W68 A;  5FZH A;  2ZML A;  4LUK A;  5K4L A;  1L7L A;  4Y5Z 0;  1W06 A;  1DGR A;  3EQE A;  1KRI A;  2DVD A;  3H3L A;  4AFB A;  5E16 A;  3FN9 A;  5GZF A;  4YVW A;  5T5L A;  3OG2 A;  4XTM A;  2YPJ A;  3WG1 A;  3WT3 A;  5AC9 3;  4K40 A;  3I59 A;  4EWA A;  2C4X A;  1A34 A;  3AJZ A;  4PF1 A;  5AFE A;  3T4H B;  2X8K A;  2ZAA A;  3FFQ A;  3PMS A;  1T2X A;  4P5H A;  4GJY A;  2VW1 A;  4Y4R A;  4C0H A;  4CCC A;  5C5U A;  5C8W A;  1AX2 A;  2ZAB A;  5IVC A;  1BEV 1;  1BLZ A;  3C7H A;  4JX0 A;  1TQ5 A;  1UIK A;  5EZW A;  5FV3 A;  2VC9 A;  2WT2 A;  1TZO A;  5FZ8 A;  4DXT A;  3GAL A;  2KR2 A;  1FT9 A;  1E57 A;  1EUT A;  1GLH A;  2VBP A;  4Y1U A;  3FBY A;  4F83 A;  4AGV A;  2Z2S B;  3HR9 A;  4HVO A;  2UWB A;  3PUA A;  1HRI 1;  2KD7 A;  3RS6 A;  3NQH A;  1JMU B;  1EV1 2;  1RUD 1;  3HT1 A;  1F9K A;  1R09 2;  4HVQ A;  5C8C A;  4R52 A;  4HPK B;  4R9A A;  3ZX7 A;  3ZMN A;  2DFB A;  3MIE A;  2GN3 A;  1EPZ A;  2XUM A;  2P6H A;  4WV8 A;  1H9W A;  2Q8C A;  3S7E A;  2D44 A;  2YZ4 A;  3PTY A;  3POJ A;  4JQR A;  4AFA A;  5CEH A;  5D8A A;  1ACC A;  1H4H A;  4L0P A;  3ES4 A;  3I2D A;  1LEN A;  5JMC A;  3ZFF C;  4Q2F A;  1W6Q A;  1S0I A;  1D4M 3;  3VBO B;  1HQL A;  1N1T A;  4I09 A;  4BH9 A;  4BK5 A;  5AC9 1;  2D6P A;  5LY2 A;  1ND3 A;  3MUZ 1;  1H8V A;  1ZRR A;  4V1P A;  3RWN A;  1YQ2 A;  3PHM A;  5IVY A;  1QHD A;  1LEM A;  4XW3 A;  5GLU A;  2BV4 A;  2H0B A;  4Y20 A;  1C8M 1;  1NYW A;  1O7F A;  2ADD A;  2GN7 A;  2HH9 A;  4JKL A;  4JKK A;  4FQZ A;  4AI8 A;  3WR0 A;  1PO1 3;  5CAZ A;  4LJH A;  3LB9 A;  4M01 A;  1ASJ 1;  2D3P A;  2IXH A;  5L9R A;  4BM8 A;  3KMH A;  2VUL A;  5JIA A;  2ZGM A;  3ME2 A;  3I4I A;  2FDG A;  1IS5 A;  1LED A;  2L9L A;  1DP0 A;  1VIW B;  1WCK A;  4QDR A;  2A6X A;  2P34 A;  2PHU A;  2W5F A;  3ZKY A;  4ZU4 A;  3VBS B;  4MZU A;  1OVP A;  2Y60 A;  3AYA A;  1W9Y A;  3LSD A;  4JQT A;  4CDW C;  1QOO A;  1MZF A;  2VOK A;  3N9O A;  4CDX C;  5BNN C;  1GR3 A;  1V00 A;  4JRA A;  3RI9 A;  3AYC A;  3N36 A;  4QPG B;  1GZW A;  5K9Y A;  5JZG B;  3OJB A;  4NHY A;  1ZBA 1;  3MPB A;  4IV3 B;  4QKF A;  2VOT A;  5LAT A;  5EJZ B;  3UKN A;  4HVR A;  4UW4 A;  4Y24 A;  3V0A B;  4L9B A;  5FPA A;  4A7K A;  1SDD B;  3VBF A;  4YVW C;  1GOF A;  5JOX A;  2MEV 2;  1KGY A;  1GQG A;  4RD7 A;  4YVS C;  1G9F A;  1YQ5 A;  4AEJ A;  4LOT A;  4D6S A;  5A6Y A;  4XUP A;  2YYO A;  3MLL A;  1GU3 A;  2WZR 3;  1NLQ A;  4E8C A;  4E4H A;  3DPR A;  3VBH B;  3VHO A;  5FP7 A;  4YFZ A;  3I2I A;  4P9I A;  2V09 A;  4MGI E;  5DXD A;  4JAA A;  1HB3 A;  3H1M A;  5FYB A;  4HLT A;  3T4V A;  3T08 A;  1OI6 A;  2W08 A;  2R6Q A;  4L8Q A;  1H0B A;  4LBM A;  4QHO A;  1LES A;  3R0R A;  1AF9 A;  3N9N A;  1MS5 A;  4IEQ A;  3POW A;  5GZD A;  1SPP A;  2J1T A;  3OF1 A;  2NN8 A;  2HWD 2;  4IEP A;  2IWG B;  3OEA A;  4N53 A;  2Y34 A;  3V64 A;  1RXG A;  1A78 A;  1YWK A;  3E6D A;  5JPN B;  3DYO A;  3H0O A;  3HIF A;  4ONU A;  2OW4 A;  2C9K A;  2VNO A;  1PK6 B;  2R16 A;  4PI0 A;  2YGL A;  4HG6 B;  4LBK A;  4YWA A;  4LUL A;  2ZGQ A;  2EF6 A;  3MIB A;  2F6B A;  1U5I A;  1CES A;  5C4W A;  4KG8 A;  1BBT 1;  1Y9Q A;  4IE7 A;  1JN2 P;  4Q27 A;  2ORX A;  2Y0I A;  3OBT A;  3AKQ A;  3SH3 A;  3RZH A;  4P9G A;  4WM8 C;  3GDB A;  3SCH A;  4M4P A;  2WZP P;  3TN9 3;  3MW2 A;  2LRP A;  4N7I A;  2W91 A;  1DGL A;  1MZ6 A;  4N43 A;  4RR3 C;  5BNP A;  3WNO A;  2IVI B;  1LHW A;  3JBG 2;  2WRA A;  1VBE 1;  3LOB A;  1ZRI A;  1YFU A;  3VKN A;  1YIF A;  3H42 B;  3O0X A;  3VZK A;  4GIQ A;  4XPV A;  2PLV 3;  3WP3 A;  4EQV A;  1CX4 A;  3RJR A;  5JI9 A;  5T5J A;  3SC7 X;  4CCL A;  1J84 A;  1JUH A;  1JBC A;  1OQ1 A;  2J22 A;  3B5L B;  2FCT A;  3K48 A;  1P8J A;  4KWU A;  5IAV A;  2HKX A;  3RPQ A;  3V0B B;  1QJF A;  2VBD A;  1NA1 C;  2PHT A;  3M2M A;  4X6Q B;  1QJU 2;  4TTG A;  3B69 A;  3I2K A;  2JDA A;  5FMD A;  2AEZ A;  3ZN6 B;  1H4G A;  3A22 A;  2ZEW A;  4OUL A;  5E1R A;  2DUQ A;  3DV8 A;  4RSU A;  1RUH 2;  3FLP A;  5A7W A;  5C8C C;  2PHW A;  3OPW A;  4IXL A;  2H0V A;  1UY1 A;  5C9A A;  2OXB A;  3UL2 A;  1RXF A;  1JOP A;  3WCS A;  2NP0 A;  1VBC 3;  2QQO A;  2J1A A;  5FZO B;  2JDP A;  1VBA 3;  1ZZB A;  3N7M A;  1PMJ X;  4HPK A;  4AQS A;  2QZ3 A;  3LIG A;  1QH6 A;  5LK7 B;  2FD8 A;  1QJY 3;  3CEW A;  2P1B A;  2JE9 A;  2DFC A;  5J37 A;  2VTX J;  4IE5 A;  3D4K A;  4BK4 A;  3RZL A;  1X9T A;  4L92 A;  1RUC 1;  4XE9 A;  1DLL A;  1LGC A;  2OYZ A;  3QLQ A;  2ZX4 A;  1YCI A;  2BQP A;  5FPB A;  5JSO A;  4ZZ8 A;  1IPK A;  1Y7B A;  4R8H A;  5E88 A;  3VBO A;  4TYS A;  3KD4 A;  2GP5 A;  4CRQ A;  1UPS A;  5AVA A;  1RUI 3;  3RSJ A;  1SAC A;  2A6W A;  5FXZ A;  1SBF A;  3AFG A;  1J1L A;  4YYO A;  4QWN A;  3I2G A;  5KHK A;  5LEK A;  1HB2 A;  1NX9 A;  1W8Z A;  3AKS A;  3WP5 A;  3ZLI A;  2OQ7 A;  1O5L A;  3H1Y A;  4AFD A;  4NAO A;  4YG6 A;  4CP9 B;  2XJQ A;  4XXP A;  4XUT A;  2BVB A;  1QY4 A;  2D6M A;  2FBE A;  2VGD A;  3I2H A;  2RM2 3;  2XJR A;  2VY0 A;  3HN3 A;  2P5B A;  1QOT A;  3HBK A;  3P6B A;  5FY5 A;  4L99 A;  4DFS A;  3K2O A;  3LA3 A;  1X50 A;  4CCJ A;  2JIC A;  1I3H A;  4KWL A;  1F2N A;  2XDV A;  1OHF A;  3KHB A;  1O4Y A;  4IW3 A;  3ZYP A;  3KV9 A;  3BU7 A;  3KV4 A;  4B29 A;  1XYO A;  2KA3 A;  2R06 3;  4NJ4 A;  2W47 A;  1Y4W A;  2XGX A;  4KGG A;  4NR1 A;  4P02 B;  1RUO A;  2R0H A;  1W39 A;  4CZS A;  5CFC B;  4F7Z A;  3ZMO A;  1EPW A;  3G7D A;  5FWE A;  1O3S A;  1XSR A;  1ZZ9 A;  5FZI A;  5FQ0 B;  2EXH A;  1PZ9 A;  2TNF A;  5HPO A;  2RG4 A;  4ITC A;  4KBB A;  1NCR C;  5CVR A;  5FYH A;  1W3X A;  1C8M 3;  1K5M C;  4B4Q A;  3VHN A;  1MEC 2;  2RS3 2;  1ND3 B;  5JIU A;  2B5H A;  1LR5 A;  3VKO A;  3ZSL A;  3ZXJ A;  3WF2 A;  4FP2 A;  3H8R A;  2Y0O A;  1KS5 A;  4LBQ B;  5AVP A;  4FI9 A;  5FP4 A;  5F3E A;  2IXJ A;  4BHP A;  1F4H A;  4GB3 1;  4MYE A;  2WSU A;  1K42 A;  2EIC A;  1EAH 2;  5EQU A;  4BQ3 A;  5A3M A;  3PUI A;  1YFW A;  2DWR A;  3I7D A;  3H8U A;  3M3C A;  2W92 A;  2WQZ C;  5FY1 A;  1GKB A;  1U12 A;  3ILR A;  5IWF A;  4BU2 A;  4CXX A;  5C33 A;  4FTS A;  2VZ3 A;  5AFB A;  4Y22 B;  1NCR A;  5JDB A;  1AL0 G;  3KCC A;  2FMD A;  3N9L A;  3OSD A;  2W3J A;  3HWJ A;  5A3O A;  1BMV 1;  1WD3 A;  1XC6 A;  2RDS A;  2OUH A;  1GWK A;  4TXW A;  1ALY A;  5SV5 A;  2UYB A;  4EE2 A;  2XH6 A;  2JG9 C;  1W8O A;  3DEC A;  2MNG A;  1J3P A;  4FTE A;  4EN6 B;  3ZDS A;  4FSJ A;  3C2U A;  2DUP A;  1PO2 1;  2EIG A;  2O8Q A;  5E89 A;  4PHZ A;  1W9W A;  1E5R A;  4ZPI A;  2R06 2;  1LRH A;  3MO4 A;  1AL2 2;  2VMI A;  3ORJ A;  4IGQ A;  5B4X A;  5LAS A;  2VMH A;  3E5U A;  4I0W B;  2CDO A;  2CYF A;  1G8W A;  2CWS A;  5DPN A;  4DIN B;  3VUO A;  4RQP B;  4Q4W 3;  4AVV A;  1NY7 1;  1VLN A;  1D0G A;  4KWK A;  3J9S A;  4QGM A;  3TEW A;  2CTV A;  1DDL A;  1GBG A;  2PHL A;  4A6S A;  1GNZ A;  3HVD A;  4QU1 A;  5BNP B;  1MZ5 A;  1RUG 3;  5FY4 A;  4BQ1 A;  1W0P A;  1BHG A;  2YFU A;  4PQQ A;  2XJU A;  3K51 A;  5FMB A;  3VDD C;  4ET7 A;  1JYN A;  1CR7 A;  4FQ4 A;  5EPA A;  2AAC A;  5I0U A;  2JE8 A;  1Z7S 3;  1MS9 A;  4V2V A;  4E2S A;  1D4M 2;  2ZGU A;  2RS3 3;  1W90 A;  3FBM A;  4C0B A;  1HXS 1;  2W1S A;  4HK9 A;  1OBN A;  1GV9 A;  4QMA A;  4CXY A;  1UYX A;  1G7Y A;  2WIN B;  2D6L X;  2V72 A;  4DOU A;  1YYN A;  5DDJ 1;  4UYB A;  3WDT A;  5DUX A;  4AED C;  5GZE A;  4E4S A;  3OUI A;  3RI8 A;  5IK7 A;  2QDN A;  4FBF A;  1B35 B;  4QPW A;  1UYP A;  4XAB A;  2WFF 3;  1TME 1;  1PVC 2;  5ANQ A;  2JG8 C;  4OUS A;  4PBP A;  3ACF A;  4FTB A;  5I8T A;  3I8T A;  1ZM1 A;  2WQ4 A;  1WA4 A;  1LHV A;  1XE7 A;  4AI9 A;  4IQP A;  5T5O A;  3KS7 A;  1J59 A;  3K4Z A;  2VNV A;  1LAJ A;  2DCT A;  1PO2 3;  1WCS A;  2W1W A;  4IV1 C;  5G05 L;  4OQ9 A;  3UKT A;  1RUD 3;  5FZL A;  1IS3 A;  3M4F A;  3VZO A;  2ZHK A;  2ZX1 A;  4XZU G;  5CIR A;  2PAM A;  1QQP 2;  5FZA A;  5C3R A;  4LT5 A;  4BIS A;  2R7E B;  4HON A;  1CN1 A;  5F32 A;  4LE4 A;  1O3T A;  4QGN A;  3R4U A;  4GAZ A;  1UMI A;  4FP3 A;  4A3X A;  5I8Y A;  3I2O A;  4XJ8 A;  1U5Y A;  4BME A;  4COZ A;  4QKD A;  3C7E A;  2RHP A;  4O61 A;  4UT5 A;  4NE9 A;  2E7Q A;  3FLT A;  4ZKT B;  2JDY A;  2ZHL A;  3U0Z A;  2B8M A;  5KHH A;  5CFD A;  4FVV A;  5FYT A;  1NKG A;  2W87 A;  4N53 C;  3OD0 A;  2RDQ A;  2TBV A;  3GJA A;  4DRR A;  3OTF A;  1ZZC A;  2UWC A;  1XB9 A;  2BNO A;  2OT7 A;  3ZN6 A;  2D3R A;  5JZG C;  4ZS2 A;  4OMD A;  1Y3T A;  3DPR C;  1W03 A;  1LGB A;  4LBL A;  3ZFE B;  5A3U A;  3PVE A;  1LB2 A;  4CCM A;  5J1X A;  5A32 A;  4WVV A;  4CU8 A;  1EYB A;  2Z4F A;  3MLK A;  4XF9 A;  1JTZ X;  3T09 A;  4WM8 A;  4XC9 A;  5FZO A;  3W58 A;  1FYU A;  2JWP A;  3H3U A;  4CEW A;  3KVB A;  4NPR A;  3ZIW A;  5I8S A;  3URF A;  1RVF 1;  1ULD A;  3IMN A;  4NN0 A;  1HB1 A;  2ZGK A;  4YG0 A;  2ARA A;  3UGH A;  3PUQ A;  3NNJ A;  3SCG A;  4FPE A;  3GGL A;  4U2A A;  1LEC A;  3LPG A;  4XF4 A;  4K20 A;  1JYX A;  1PZ7 A;  1DFQ A;  1R1A 1;  4XET A;  1A8M A;  2QQW A;  1QQP 3;  3WQ0 A;  4DEQ A;  3N7J A;  5FMO S;  2ADE A;  4DY3 A;  3JB8 A;  3TBD A;  4CYD A;  1XSQ A;  2NPI A;  2VCA A;  4S2D A;  2DVG A;  2JIJ A;  2QQN A;  1RED A;  4LA3 A;  3WDU A;  3WX5 A;  2E26 A;  2N7G A;  1OT5 A;  1Q8P A;  2WDB A;  4QD2 A;  5FBJ A;  4LBQ D;  3WV6 A;  5IK4 A;  4FPC A;  3MDP A;  2PFW A;  3JD7 1;  3WDV A;  4CEY C;  5M0T A;  2V4A A;  3HD8 B;  4OLL A;  4ZXE A;  2BU9 A;  2Q4S A;  1LU2 A;  3AM2 A;  2DTW A;  1KJL A;  2ZZQ A;  5KWR A;  1K45 A;  4LIT A;  1IHM A;  4WM7 A;  1HJG A;  4Q8L A;  1LOF C;  3ILF A;  2G9G A;  2EA7 A;  4MGZ E;  4OHY A;  4B3N A;  1JS9 A;  1HRV 2;  1OF4 A;  1ZA7 A;  1V0A A;  2MHF A;  2VQ0 A;  2WC2 A;  2R1B A;  2V5D A;  5CKQ A;  3RZJ A;  4URA A;  1H9P A;  1NLR A;  1TG7 A;  3AXE A;  1CAX A;  4QPI A;  3D82 A;  4A44 A;  3POI A;  3WF1 A;  4QPI C;  1RUE 3;  2FHR A;  3NKG A;  2B42 B;  2VL4 A;  4GJZ A;  4UFL A;  4RFR B;  1ZBE 2;  4H14 A;  1VBC 1;  2QUO A;  5FZC A;  2VVE A;  1S1A A;  5BUV A;  5GLZ A;  4KMQ A;  3WDY A;  1JZ7 A;  2A6V A;  4BIF A;  4CUA A;  5ISL A;  4B1M A;  3LFM A;  1RIN A;  4D69 A;  4BQ4 A;  4FCA A;  4WM7 C;  1VMH A;  5LWB A;  2AZ5 A;  2ZX0 A;  2W1Q A;  1MPX A;  2BWC A;  3BB6 A;  1AUY A;  3IMM A;  3R6S A;  3O0W A;  5F2W A;  1H2M A;  5A6Z A;  1L7R A;  4QPG A;  4I0A A;  3KHC A;  1UD1 A;  3VLB B;  4PDW C;  5T54 A;  4XHX A;  1OLR A;  3BVC A;  2XHN A;  2VMF A;  4IV3 A;  4AZZ A;  1RUJ 3;  2YY1 A;  1QXR A;  1REF A;  1XE0 A;  2X5I C;  4FFF A;  2FMY A;  4LLF A;  3W21 A;  2FZ2 A;  1O4T A;  4HSJ A;  4N43 B;  2WO1 A;  1Q8O A;  3EJK A;  3DN7 A;  4A6O A;  1Y9G A;  3I49 A;  1HKD A;  3JXS A;  2XHK A;  4DZG A;  1YRZ A;  1QQP 1;  3USS A;  3VN4 A;  2VM9 A;  1AR6 3;  3RZZ A;  1HXS 2;  1HLC A;  3GNE A;  2YBS A;  4YVS B;  5L73 A;  1BZW A;  5DAW A;  2PA7 A;  3CIH A;  4RHV 1;  1FNY A;  2GSY A;  3HEI A;  2X5I B;  4MGS A;  5DN2 A;  4IEO A;  2BW8 A;  3MI8 A;  2AYH A;  5HXV A;  1M4W A;  1NA1 B;  2DV9 A;  5A3L A;  3ECQ A;  2QQM A;  3ZFG A;  1DLC A;  3ILN A;  4Q0U A;  1H6X A;  4Y1V A;  2YXS A;  2BJS A;  1GP6 A;  1QJY 1;  1DZT A;  1SCS A;  3ON7 A;  1J1T A;  4GMP 1;  3PDQ A;  4DS0 A;  5HI0 A;  4Q1R A;  5FPU A;  5F5I A;  1XYP A;  4B4R A;  4AVS A;  3ZYB A;  4Z07 A;  1W6Q B;  1UIJ A;  3KM5 A;  4DRV A;  1OC1 A;  3I3Q A;  1DYP A;  1C8N A;  4UFI A;  3I3E A;  1LUL A;  5FYZ A;  2ZBJ A;  1LOA A;  1QDC A;  3AYE A;  4AAP A;  1O4Z A;  1POV 0;  3AKP A;  4BCU A;  3NVC A;  1QGL A;  2XLA A;  2C24 A;  2J1V A;  5FYY A;  5LA1 A;  5F3C A;  1CJP A;  1CPN A;  3KCY A;  4DMI A;  4Q8K A;  2C1F A;  4NPL A;  4CCN A;  3IAP A;  1OQD A;  3OBA A;  3KWV A;  2IXC A;  1H6Y A;  4R4X A;  4SBV A;  1TNF A;  5ACA 3;  1I5P A;  1S0G A;  3D0S A;  3T3Y A;  2Y6G A;  2HEY F;  4QQP A;  4CVU A;  2HWD 3;  2XVG A;  4COU A;  4P5Y A;  1RYY A;  4JKM A;  1W8N A;  3BAL A;  4CP1 A;  5LB6 A;  4FFI A;  1C28 A;  1IQD C;  3J26 N;  2VCM A;  3M3I A;  3WEZ A;  1WLD A;  4LO5 B;  2B9U A;  1N47 A;  5A7Q A;  3SHR A;  4BQW A;  3WQ1 A;  4HOO A;  5FJH A;  1PGL 2;  3WNM A;  4O9E A;  4YPJ A;  1AX0 A;  3ZXF A;  1TMF 1;  4GH4 B;  3UNP A;  3Q9O A;  4ZHN A;  3VL8 A;  1NXD 1;  2VZQ A;  3PUH A;  4E27 A;  5HCB A;  4QDS A;  4YM3 A;  2LRO A;  3WY6 A;  2OA2 A;  3D5O A;  4K7J A;  1N1Y A;  4YG3 A;  3WHT A;  4FAG A;  1AYN 2;  2HWF 2;  4Z82 A;  5T55 A;  4P14 A;  5T5P A;  3P3N A;  4CDQ C;  2OVU A;  4QXK A;  4CDU B;  3JB4 C;  3APB A;  3GM8 A;  4B4P A;  1HN0 A;  2BNN A;  2D3S A;  5SV8 A;  5T52 A;  1SLA A;  1JZ4 A;  5A3T A;  2Y26 A;  1RHI 3;  3A0K A;  4O7X A;  3VBH C;  1CGP A;  3IB3 A;  1OLM E;  3VBH A;  3ZDV A;  5FLI A;  1URX A;  1AZD A;  3ES1 A;  3B00 A;  1QEX A;  2CDP A;  3J7H A;  3TEZ A;  3MV1 1;  5JXH A;  3VHP A;  4B7E A;  1W8U A;  3WIN E;  3WF3 A;  3MFC A;  1XJA A;  1A3K A;  3ZXL A;  4CP2 A;  1S0E A;  2VZT A;  3S7I A;  5KXD A;  4DPN A;  3O1V A;  2ORZ A;  3ETP A;  1UZ0 A;  2I74 A;  5JPM B;  3RQ0 A;  1PO1 2;  1KJR A;  4B7K A;  2IXL A;  3MHZ A;  4LLO A;  2D7F A;  3ASI A;  3VL9 A;  4BXS V;  4MH0 E;  4IV1 A;  2WS9 2;  4CA9 A;  1VBE 2;  2BVV A;  3OGJ A;  1YI9 A;  3L2H A;  5E8A A;  2F4L A;  1IPS A;  3ZFE A;  1ZX5 A;  3P5B A;  4YZ5 A;  3ZPO A;  2VQU A;  1F31 A;  3O1T A;  2PN5 A;  4FOV A;  4CDW B;  4CDX B;  1IQA A;  4FXG B;  2BEO A;  4E2Q A;  5GJ6 A;  2XXZ A;  4XUR A;  2R32 A;  1BBT 2;  4MHU A;  2WQ8 A;  4FFG A;  1NE4 A;  1SFN A;  1WCU A;  1XOY A;  4XFI A;  1AYN 3;  1UX7 A;  2HWF 3;  4AWD A;  1DGR N;  1W2T A;  4QQ2 A;  3OUJ A;  4XJW A;  3I97 A;  3OYW A;  3SIT A;  4AI3 A;  1GNY A;  5FR3 A;  2WWS A;  1IG3 A;  2E6V A;  3SXW A;  4MGQ A;  4UW3 A;  3UK9 A;  4LHK A;  1VMJ A;  5HCA A;  3WP4 A;  1CIW A;  1K5M B;  2JB8 A;  4JTN A;  5ABJ C;  4IEY A;  3MF9 A;  4AVC A;  1S2B A;  3DKQ A;  2ZKN A;  3ABZ A;  2J1R A;  5JOW A;  1US3 A;  1VBD 3;  1RMU 2;  1UNB A;  2WT0 A;  1BQP A;  5F6L B;  1WD4 A;  3IDA A;  1VAK A;  2FDJ A;  2OPW A;  5CU1 A;  4F8A A;  3WVJ A;  1L3J A;  3HT2 A;  3T30 A;  2O14 A;  4FPK A;  5IAT A;  2A3X A;  1CAV A;  4XFH A;  1W8H A;  1XQN A;  1WBL A;  4QHZ A;  5DMY A;  1GWM A;  1GQH A;  3IPV A;  4CTE A;  3NO8 A;  3O1U A;  1OKO A;  2RMU 3;  2VW0 A;  3KF3 A;  3NV2 A;  5IVJ A;  5BV6 A;  2WO3 A;  3WQ7 A;  2CAU A;  3LOI A;  3WG2 A;  5FKB A;  1CIY A;  2A3W A;  1KDK A;  5H9R A;  3F2Z A;  1UOB A;  5DDJ 2;  1NE6 A;  3L9J T;  3RZG A;  1W99 A;  2BDR A;  2WII B;  4GMP 0;  5APA A;  4AF9 A;  4Z2A A;  4CUB A;  3GF6 A;  1ONA A;  1ENQ A;  3NST A;  4Y1Y A;  1D4M 1;  4WVW A;  4Y22 A;  4BB3 A;  5KXC A;  3AMN A;  3T0A A;  3IKW A;  5LBE A;  3ZYI B;  2J1E A;  3T0B A;  1HJF A;  3WF4 A;  4QQL A;  4AEM A;  1IG0 A;  5JXJ A;  1DQ2 A;  3QD6 A;  5DG2 A;  1QJZ A;  1CJD A;  1YLL A;  3CLP A;  3X29 B;  1SMV A;  4ATF A;  1SZB A;  3MW3 A;  2RS1 1;  3O1M A;  1KS4 A;  5IHR A;  5IVV A;  1CAU B;  1HV1 A;  5J7M A;  4YAR A;  1UX6 A;  3GYD A;  5FYC A;  3ZO0 B;  4Q4X 1;  4RHV 3;  1SLL A;  2Q1F A;  2D93 A;  1HRI 3;  3NKT A;  5CZK A;  1WME A;  1LCL A;  1WA6 X;  2VW2 A;  3FC0 A;  4YVW B;  5KC6 A;  4GWI A;  2HWC 2;  1SHW B;  2UU8 A;  1FPN 1;  2PHR A;  4IEZ A;  1RUC 2;  5A3N A;  3VZL A;  2E51 A;  2ZS6 B;  4AI2 A;  1Y43 B;  5JAX A;  3PLQ A;  2R07 3;  4TLF A;  1V6M A;  4M3C F;  5C71 A;  5CFC A;  3GCX A;  4DUV A;  1LKN A;  1PGW 1;  1YFY A;  5IT6 A;  5J48 A;  1NT0 A;  2XB6 C;  4XJU A;  4W6X A;  1EAH 1;  3Q8F A;  4HSL A;  3TWI A;  4QM9 A;  2YGM A;  1UQX A;  3VBU A;  2JE7 A;  1B35 A;  1RUE 1;  1COV 2;  2CGN A;  2VCC A;  2YG0 A;  1MQT A;  4CDU A;  1RB8 G;  1UZZ A;  3CJI A;  4Q4V 1;  2X05 A;  1YI7 A;  1R09 1;  1KEX A;  1XYN A;  3OBR A;  4GUL A;  1ND2 A;  3JQX A;  2EIE A;  4BQ5 A;  4I30 A;  1VE0 A;  5FO8 B;  1V6J A;  2HWE 1;  2RR1 3;  5LW9 A;  4CEW B;  1W8T A;  2D6O X;  4MXW B;  5JR2 A;  1H1A A;  2P3I A;  4P9X A;  3VD9 A;  2I45 A;  4I02 A;  2DU0 A;  2ERF A;  1LOD A;  1QF3 A;  2Y64 A;  2ZEX A;  3N7L A;  4AK3 A;  2PQQ A;  5C3O A;  4IE4 A;  3QBQ A;  1OD5 A;  3UGG A;  2YBK A;  2WAB A;  1BYH A;  1HN1 A;  2EAL A;  4P08 A;  1CZT A;  2XLG A;  5EXO A;  2JX9 A;  4A3Z A;  1HDK A;  2I07 B;  2WFF 2;  5FFO C;  4M0H A;  5BXX A;  2XVK A;  1DGW X;  3POF A;  3VDB A;  1WW4 A;  4XCA A;  2Q1M A;  2QKD A;  5JVV A;  3D6E A;  5G04 L;  2Q8E A;  3U1X A;  5JSR A;  3D3A A;  3K77 A;  4AED A;  2VUC A;  1VBB 2;  4CEY B;  4Y20 B;  5F1R A;  1W9S A;  1X33 A;  5FOB B;  3K4D A;  5JOY A;  5DZG A;  5GLT A;  3IBM A;  5T3N A;  2QQV A;  2XON A;  5CFD B;  3UKV A;  4J1X A;  2C9A A;  4N53 B;  4IEV A;  1E5I A;  4NIH A;  1NCQ C;  4RQP A;  5EHD A;  4ZZ5 A;  1MS0 A;  1R09 3;  4CU7 A;  2W2I A;  2ZEZ A;  3AL6 A;  1CWP A;  4NAM A;  2A70 A;  4CCK A;  1F5F A;  1LGN A;  4OI1 A;  1D0H A;  5FZB A;  1UY0 A;  3V65 A;  3TYJ A;  1COV 3;  2ARB A;  1AR9 3;  5ABJ A;  3MIH A;  4JGZ A;  3U4S A;  4PLM A;  1RUN A;  2QQP A;  2VQA A;  1OPM A;  1UCX A;  2AH2 A;  1GZW B;  1YC6 1;  2ES3 A;  1K5M A;  3AP7 A;  3PVN A;  5FXX A;  1U5X A;  4C90 A;  1OFN A;  1UL9 A;  4AHY A;  2UY8 A;  1W0O A;  5EWS A;  3ZOI A;  1KD7 A;  3C7G A;  3LF7 A;  4QGL A;  3U10 A;  1SLC A;  1DIW A;  1DQ1 A;  3AC0 A;  4UXA A;  1J3R A;  4COV A;  1T6B X;  3J8F 3;  4UBG A;  3N9M A;  3BOW A;  3SMH A;  1RUJ 1;  2VTF A;  3I2F A;  2QTW B;  4QXH A;  5K0U C;  4OI4 A;  2WO7 A;  3LA2 A;  4I0B A;  2CV6 A;  4QDQ A;  3VZM A;  1PVX A;  3MID A;  2JEC A;  3O1P A;  3AP6 A;  3R4S A;  1KDM A;  2O8O A;  1G86 A;  1ULC A;  4LIU A;  1Z0H A;  5HCF A;  3LKJ A;  3VBO C;  3EXU A;  4NPM A;  4ES8 A;  2YU2 A;  3WP6 A;  2YRO A;  5GAL A;  2P2K A;  2ZPX A;  4QKB A;  4JZR A;  3U75 A;  1XU2 A;  4P9W A;  1JXN A;  3CO2 A;  4LHS A;  5JUV A;  3EO6 A;  5D2A A;  1FV2 A;  3A4U A;  1QJE A;  3HNB M;  4DNY A;  1ULO A;  3PU8 A;  1RL3 A;  2BGP A;  2JG8 B;  2B46 X;  2VMG A;  3AYD A;  3HQU A;  4FOY A;  1CX1 A;  3AB0 A;  4IEU A;  3J7M A;  5LBB A;  4XMA A;  1O8P A;  3W5N A;  1V9U 2;  4GKX A;  1QOS A;  1GMM A;  2LTN A;  3N9P A;  3JBG 1;  1AR7 3;  5LRS A;  1ULE A;  3N3H A;  2B9V A;  5F3I A;  3SQO A;  1AR9 2;  5K7P A;  1RMU 3;  5L7O A;  1UZY A;  1AVB A;  2VJX A;  5FZD A;  2GU9 A;  2TUN A;  1PIV 1;  2WAO A;  3S5A A;  1Z7S 2;  2R49 A;  2ZZJ A;  1AJK A;  1CAU A;  3NW4 A;  4LBJ A;  1SBE A;  3AX4 A;  1OOP A;  2VZP A;  4NOT A;  1FOD 1;  2OS2 A;  3TB0 A;  2P3K A;  1C5H A;  1UMZ A;  3AZV A;  3AVS A;  3J8F 2;  5FYS A;  4ARY A;  1V6N A;  3U37 A;  4YW3 A;  5EFU A;  3IDC B;  4ARX A;  5C9A C;  1QMJ A;  4W50 A;  4YSF A;  1C1L A;  1C4R A;  1ZRF A;  2BBA A;  4C8D A;  5H9S A;  5EYY A;  5DZE A;  4BMB A;  1W8W A;  3FX3 A;  1V9U 1;  2R07 1;  2OZJ A;  2PHD A;  2HWB 3;  3IT8 A;  4LBO A;  5FY0 A;  3H9A A;  2PYT A;  3SH4 A;  2ZMK A;  2G1M A;  2ET1 A;  4JDN A;  2TEP A;  5IYY A;  1RUD 2;  3VDC A;  2ID4 A;  1DF0 A;  1OMI A;  3AXD A;  3MIC A;  1RTV A;  1DQ6 A;  4MVT A;  1SCR A;  2CGO A;  2E9Q A;  1MQT B;  4N8M A;  2H6B A;  5FY7 A;  1RUI 2;  2QVS B;  5HV4 A;  3MFA A;  3W9A A;  3FUO A;  4RN5 A;  5C9A B;  1KXG A;  3WOG A;  2JD4 A;  3E6B A;  2WKK A;  4AVA A;  4KBZ A;  2BTV C;  3PVB B;  1BBT 3;  4QXB A;  3E1F 1;  3UET A;  3O5S A;  3OB8 A;  5LEJ A;  1NZI A;  1DQ0 A;  4OUM A;  5BNO C;  3T0D A;  1FAY A;  2JG9 B;  1AXY A;  1C1F A;  2GH8 A;  2WYS A;  2B7Y A;  4ISR A;  2WSV A;  4D94 A;  3B9I A;  2IUW A;  5I0T A;  2VXR A;  3IZO A;  3PL0 A;  4QQO A;  3U14 A;  2RM2 2;  4MGY E;  2PQS A;  5A3P A;  4CEW C;  1NZC A;  4BOW A;  2YBP A;  3ZR5 A;  2DVB A;  3PME A;  2DUO A;  2QNK A;  3J4U H;  3RG0 A;  2GDF A;  4OCT A;  1QDO A;  3B9C A;  3QCW A;  3ZFG C;  5FOJ B;  1AYM 2;  4KQ7 A;  4NWW A;  2DVF A;  2RVA A;  2CL2 A;  1Z7S 1;  3ATG A;  1QJU 3;  1CAX B;  4QPI B;  4LA2 A;  5CBL A;  2GME A;  1RUG 1;  1WWY A;  3ZYJ B;  4ERO A;  1AXZ A;  4HN0 A;  2WN3 A;  4AI1 A;  3BIW E;  1O8S A;  2ARC A;  3FMG A;  3KZ4 C;  3QOP A;  4H3W A;  5FUI A;  3ZFF B;  4BDV B;  1FMD 1;  2ZHN A;  3NJY A;  3VDD B;  1W9F A;  4HKL A;  4NRP A;  4Z92 B;  3BIE A;  3NJZ A;  4AOC A;  3U4X A;  1HB4 A;  2VU9 A;  5FY8 A;  2VNR A;  2P3J A;  3U11 A;  2Z69 A;  1HX6 A;  4NRO A;  2CNA A;  3VKM A;  4CSW A;  1BVV A;  2HYK A;  4LIV A;  1VBB 1;  1UZW A;  4OUE A;  1ZRD A;  1DQ4 A;  3RJ2 X;  1Y9M A;  3RZK A;  4MXW A;  3V56 A;  3AJY A;  3O14 A;  3OBZ A;  1PMI A;  3MW4 A;  3ZM8 A;  4NID A;  4MGT A;  2LAL A;  3OGG A;  1QKQ A;  4E4D X;  2IC1 A;  5FYU A;  2WNU B;  3MBW A;  1VAV A;  3LWC A;  2NMO A;  4D3W A;  2AUY A;  1K3I A;  1VPH A;  2EVX A;  1AYN 1;  2HWF 1;  4TSV A;  4EZH A;  2F17 A;  5DAQ A;  2GAL A;  1UOF A;  2GH2 A;  3C3V A;  4PIZ A;  2D6K A;  4XHB A;  5JXI A;  3U07 A;  4P00 B;  1EV1 1; 
#chains in the Genus database with same CATH homology
 1EUT A;  3CKH A;  2KD7 A;  3I3D A;  3NQH A;  3CIH A;  4OZO A;  1O59 A;  2VMD A;  4XUQ A;  3VD3 A;  2Y6H A;  3HEI A;  2OKX A;  1UY2 A;  4MGS A;  1XNT A;  5DN2 A;  4XVH A;  3P1I A;  2WZE A;  3ECQ A;  1UY3 A;  2DDU A;  2QQM A;  1DLC A;  1H6X A;  3WSO A;  3C8X A;  2W94 A;  2Y8K A;  4MOA A;  4Z2A A;  4L0P A;  5IJR A;  4UOJ A;  3I3E A;  5I0D A;  1GUI A;  4BK5 A;  1SG3 A;  5F7U A;  3MUZ 1;  2J1V A;  3T2O A;  5LA1 A;  1YQ2 A;  3IAP A;  3OBA A;  3HNM A;  4JKL A;  1H6Y A;  3I3B A;  4JKK A;  2E31 A;  2YC4 A;  1I5P A;  4UI9 L;  4JHZ A;  2Y6G A;  4CVU A;  4P5Y A;  1RYY A;  4JKM A;  1W8N A;  3K75 B;  3CZJ A;  2L9L A;  1DP0 A;  4XUO A;  4QB2 A;  4QDR A;  1IQD C;  2W5F A;  3WEZ A;  1GQP A;  3WNM A;  4YPJ A;  1JZ8 A;  3NRU A;  3UNP A;  2VZQ A;  3PUH A;  4QDS A;  4D8M A;  2VZR A;  5IFT A;  5LCW L;  2VOT A;  3HNY M;  1JI6 A;  5EJZ B;  3BN6 A;  2C26 A;  3GM8 A;  3LPF A;  4AAX A;  1SDD B;  1JZ4 A;  1GOF A;  3UES A;  1KGY A;  3SEE A;  3IB3 A;  1F4A A;  5JMO A;  1CZV A;  4XUP A;  4E8C A;  1GU3 A;  2CDP A;  3J7H A;  2EIB A;  3MV1 1;  1JYV A;  5JXH A;  3I2I A;  4RYD A;  3W5M A;  3WF3 A;  4OYU A;  2YB7 A;  3T08 A;  2DCK A;  2VZT A;  2ORZ A;  3ETP A;  1UZ0 A;  2E32 A;  2YFZ A;  1US2 A;  4UAP A;  2QQJ A;  2J1T A;  4BXS V;  3OEA A;  1UY4 A;  3DYO A;  1D7P M;  2C9K A;  2VQU A;  3DYP A;  3K46 A;  4HG6 B;  3WNN A;  2WAA A;  5B4N A;  1UXZ A;  5C7G A;  4XUR A;  3VD5 A;  2ORX A;  2WQ8 A;  2Y6L A;  3GDB A;  4M4P A;  5A1A A;  2HYX A;  1UX7 A;  2W91 A;  3I97 A;  5IFP A;  1GNY A;  4MGQ A;  3WNO A;  4QB6 A;  1UYY A;  3ABZ A;  2J1R A;  4LKS A;  1US3 A;  1J84 A;  4KI5 M;  2J22 A;  1P8J A;  4KWU A;  3THC A;  3IDA A;  4TTG A;  3HJR A;  1WKY A;  2JDA A;  3I2K A;  1UXX X;  3A22 A;  2ZEW A;  5LA0 A;  2ZEY A;  4DEV A;  2WBK A;  5HXM A;  5DMY A;  3ACG A;  2ZXQ A;  3BGA A;  1UY1 A;  3I2J A;  2QQO A;  4ZY9 A;  2J1A A;  4BJ0 A;  2VZU A;  2VCB A;  2WO3 A;  1W0N A;  1PMJ X;  1OH4 A;  1CIY A;  2QQI A;  1W9T A;  3F2Z A;  4E8D A;  4BK4 A;  1W99 A;  5EJ1 B;  4QX3 A;  4CUB A;  3MUY 1;  4QAW A;  4CU6 A;  4ZZ8 A;  3T0A A;  2J1E A;  3T0B A;  3WF4 A;  3GXU A;  5JXJ A;  2YC2 A;  4AG4 A;  1ULP A;  2XOM A;  3I2G A;  3SKJ E;  4DXS A;  1NX9 A;  2BGO A;  5IHR A;  2LW8 A;  2LS6 A;  2W1U A;  4XUT A;  3I2H A;  5CZK A;  2WO2 A;  3HN3 A;  3P6B A;  3WNL A;  4GWI A;  1SHW B;  2V4V A;  3EYP A;  1JYW A;  3NJX A;  1NAE A;  3LEG A;  2XQX A;  3OGV A;  5C71 A;  2X09 A;  1EUU A;  4DUV A;  3HOB A;  2W47 A;  3C7F A;  4P02 B;  1JU3 A;  4IUG A;  2YG0 A;  2J7M A;  2VCC A;  4A41 A;  2X05 A;  5HPO A;  1KEX A;  3K4A A;  2EIE A;  1TVG A;  4MAD A;  1JU4 A;  1OD3 A;  1JZ6 A;  5JR2 A;  4GZ9 A;  3A7Q A;  3VD9 A;  3WF2 A;  2Y64 A;  2ZEX A;  4FI9 A;  3C7O A;  1F4H A;  3CZU A;  1K42 A;  2EIC A;  2WAB A;  1HN1 A;  4P08 A;  3PUI A;  1CZT A;  3THD A;  4A3Z A;  2QQL A;  2W92 A;  1LNS A;  1PX4 A;  3OEB A;  1JHJ A;  3VDB A;  2VZ3 A;  3VD4 A;  3MV0 1;  5G04 L;  3D3A A;  3K77 A;  2JKX A;  2W46 A;  2W3J A;  3FL7 A;  1XC6 A;  1W9S A;  3SEP A;  3K4D A;  4TXW A;  1PMH X;  2XON A;  1W8O A;  3DEC A;  4A45 A;  2VMC A;  2QQK A;  1W9W A;  5B4X A;  4ZZ5 A;  1JZ3 A;  3MO4 A;  4CU7 A;  2ZEZ A;  4LPL A;  2CDO A;  1UMH A;  5DPN A;  1UY0 A;  3HPN A;  2W95 A;  1NUK A;  4M4R A;  5C70 A;  1BHG A;  2YFU A;  4PQQ A;  4ET7 A;  4DUX A;  1JYN A;  3VDA A;  2JE8 A;  1GOH A;  3C7G A;  2W1S A;  1XPW A;  1UYX A;  4LQR A;  3AC0 A;  2V72 A;  2VTF A;  3I2F A;  3NNG A;  4QDQ A;  4QPW A;  3ACF A;  1UWW A;  5CYY A;  4DUW A;  1JZ5 A;  2VZO A;  2B4K A;  3K4Z A;  2VO5 A;  3NJV A;  5G05 L;  2W1W A;  2Y6J A;  4LHS A;  5JUV A;  2J1S A;  3LEI A;  3HNB M;  4XZU G;  1ULO A;  2BGP A;  3WF0 A;  1CX1 A;  2R7E B;  5LA2 A;  1O8P A;  3W5N A;  1UMI A;  1GMM A;  4OMC A;  4QX0 A;  4QB1 A;  2RV9 A;  2B9V A;  3CMG A;  3C7E A;  4A42 A;  2VJX A;  2VZS A;  4A4A A;  1PX3 A;  2WAO A;  1DYO A;  3IAQ A;  1OF3 A;  2RJ2 A;  2JD9 A;  1NKG A;  2W87 A;  3VD7 A;  2VZ1 A;  1GOG A;  2VZV A;  2VZP A;  4ARY A;  2J1U A;  4QX1 A;  4XUN A;  3U37 A;  2DCJ A;  2BZD A;  3ACH A;  4OMD A;  1WCQ A;  2W9X A;  4MO3 M;  4W50 A;  3LEK A;  1UYZ A;  2BBA A;  5J1X A;  4CU8 A;  2Z4F A;  3T09 A;  5DQ0 A;  3A23 A;  5EIY B;  3T2Q A;  1K12 A;  2EID A;  5IYY A;  3III A;  3LE0 A;  2ID4 A;  3VDC A;  2HLE A;  4ARX A;  3GGL A;  3LPG A;  1JYX A;  2VME A;  3EB7 A;  4DEQ A;  4RN5 A;  1JZ2 A;  3WQB A;  2E33 A;  1XNA A;  3OGR A;  2VCA A;  3E1F 1;  3UET A;  2QQN A;  3LQC A;  3OB8 A;  3T0D A;  3WNP A;  4W8J A;  2E26 A;  2WYS A;  1OT5 A;  2WDB A;  3A21 A;  4CUC A;  3ACI A;  4GWJ A;  1J83 A;  3WNK A;  2PQS A;  4ZXE A;  3DYM A;  2WN2 A;  3FHA A;  1CZS A;  1K45 A;  2RVA A;  4PT6 A;  2BER A;  5JXG A;  4CU9 A;  1OF4 A;  3SKV A;  4D0Q A;  2V5D A;  2WZ8 A;  2Y6K A;  1TG7 A;  4A44 A;  2WN3 A;  3WF1 A;  1O8S A;  5FUI A;  4BDV B;  1L7Q A;  2VL4 A;  2WUH A;  3CDZ B;  3OGS A;  4DXR A;  2VQT A;  3CQO A;  4KMQ A;  3FHQ A;  1JZ7 A;  4CUA A;  4OUE A;  2W1Q A;  1MPX A;  3FN9 A;  3OG2 A;  4QX2 A;  1L7R A;  2C4X A;  3T2P A;  3ZM8 A;  2X10 A;  4PF1 A;  2XHN A;  1R64 A;  1T2X A;  2VMF A;  2VR4 A;  3MBW A;  1K3I A;  2WO1 A;  3C7H A;  2QBX A;  4JX0 A;  2VC9 A;  4A6O A;  4W4Z A;  4DXT A;  3JXS A;  5JXI A;  4P00 B;  2VM9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...