3T3YA

Crystal structure of alkb in complex with fe(iii) and 2-(3-hydroxypicolinomido)acetic acid
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
199
structure length
199
Chain Sequence
AAGAVILRRFAFNAAEQLIRDINDVASQSPFRQMVTPGGYTMSVAMTNCGHLGWTTHRQGYLYSPIDPQTNKPWPAMPQSFHNLCQRAATAAGYPDFQPDACLINRYAPGAKLSLHQDKDEPDLRAPIVSVSLGLPAIFQFGGLKRNDPLKRLLLEHGDVVVWGGESRLFYHGIQPLKAGFHPLTIDCRYNLTFRQAGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dynamic combinatorial mass spectrometry leads to inhibitors of a 2-oxoglutarate-dependent nucleic Acid demethylase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Alpha-ketoglutarate-dependent dioxygenase AlkB
total genus 47
structure length 199
sequence length 199
ec nomenclature ec 1.14.11.33: DNA oxidative demethylase.
pdb deposition date 2011-07-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.590 Mainly Beta Sandwich Jelly Rolls Alpha-ketoglutarate-dependent dioxygenase AlkB-like 3t3yA00
4IDZA 2FDHA 3O1PA 4QKDA 4ZS3A 4CXWA 4NPMA 4IE5A 4QHOA 4RFRB 2FDIA 2IUWA 3RZMA 2FDKA 4IE6A 4NIGA 4ZHNA 3BI3A 5F8PA 3T3YA 4O7XA 3O1VA 4NIDA 3KHBA 4O61A 3S57A 5DABA 3I3MA 3H8XA 3S5AA 3O1OA 3I3QA 2FDGA 3H8OA 4OCTA 3BTYA 3RZKA 4MGTA 3H8RA 3RZGA 3RZHA 2FDJA 3O1RA 3BUCA 3O1MA 2FDFA 3I2OA 4NIHA 4IE7A 3KHCA 3O1UA 3T4VA 3BIEA 3T4HB 2FD8A 4NPLA 4JHTA 4IE0A 4NJ4A 4NRPA 4NRQA 4QKNA 3O1TA 4QKFA 4NRMA 4NROA 4NIIA 4CXXA 3LFMA 4CXYA 3I49A 3BKZA 3BTXA 3RZJA 3RZLA 4IE4A 4QKBA 3O1SA 4MG2A 3BU0A 4ZS2A 3BTZA
chains in the Genus database with same CATH superfamily
4EJRA 2KA3A 1JH5A 3VL9A 1Y4WA 2GAUA 4MHRA 4CEWB 1QGLA 1ZRIA 2XWJB 1XU1A 1F4HA 4KH9A 3OF1A 5BYNA 3AC0A 4N53C 3ILNA 1Q8OA 1GR3A 2BBAA 4RR3A 1LTEA 3VBUC 4BHPA 1W2TA 1FI2A 3ON7A 2A3YA 5FY7A 3FHIB 1UPSA 1UU4A 2N7GA 1UMZA 3O12A 5F5AA 5GZCA 1C5HA 5L7OC 4H55A 5DQ0A 4MYEA 4DXZA 3O1RA 3NV3A 3ZSKA 3B7MA 4KBZA 4QB2A 1VRH1 3ES4A 3V56A 4CUGA 1NX9A 3N7KA 5FY8A 2WWJA 1UY2A 5A7SA 5L9VA 2VMDA 4AQ2A 2A6WA 2HJIA 2ZACA 4YLZA 2WS92 1TQ5A 1RUC1 2AEYA 4LBMA 4XHBA 2A6VA 1JBCA 1ODNA 2PHLA 3RSJA 3X29B 2ZX1A 1QJEA 2RJKA 4J6GA 1YWKA 2HBTA 4FPGA 1YJKA 4Y26A 3UJQA 2AR6A 4XJ9A 3N9LA 3IN9A 5J09A 2DWRA 4R9AA 1PK6B 5E16A 4R9CA 1BVVA 1BEV3 4LIVA 5FZMA 3SKVA 4LNVA 1DBNA 3FHAA 1N3OA 4HZFA 4TSVA 4DUVA 2D5HA 4CPBA 4LEJA 3DECA 3P5BA 3FUOA 3J8F3 2W9XA 1POV1 1VMJA 1RMU1 4RQPC 4A42A 4ATEA 3MZHA 3A21A 4FP3A 2VZOA 3GXUA 4D0QA 4ZU5A 4DRRA 1HW5A 5TSWA 5DG1A 1RUF1 3I2DA 3VBHA 4QAWA 4XC9A 2CAVA 3GHNA 3AX4A 3HNYM 5DUUA 2BTVC 2VZQA 5GALA 4COZA 2FDIA 4GB31 1G9CA 2YMZA 4Y24A 5JR2A 1UOBA 4WM7C 4DMIA 2B42B 5DABA 4YARA 2E33A 5GJ6A 5A33A 4E4ZA 2WO1A 2J1TA 3I7DA 3PL0A 4JRAA 5EJ3A 4CDXB 1QJU3 1DQ1A 4XFHA 3U4SA 3E97A 2D97A 4NUBA 2MEV2 1IQDC 1XNAA 3IKWA 2WT0A 4JTNA 4Y1YA 5C71A 1W6MA 4FTEA 3ZXAC 1POQA 4W8JA 1W8NA 3RZJA 1C28A 2D3RA 1WCSA 2ZX2A 4XCAA 3A0NA 1WA4A 1V70A 2JKBA 5GLTA 3J26N 3RI9A 5FZ6A 1JYWA 4MH0E 2IXHA 4HKLA 3VDBA 3WF3A 1YQ6A 3E5UA 1FT9A 1PGW1 3VD3A 1GWMA 4XABA 5JZGA 3HNBM 3BI3A 3I2GA 2XGXA 1EUTA 4LOSA 4OI4A 3VDDB 5KBFA 2IVJA 1NKGA 4HOOA 4D3WA 1JTZX 3WNPA 4YVWA 1DQ5A 1AR82 2O14A 3MW3A 4AL9A 4Y20B 4K3UA 2D6KA 5B4NA 3O1MA 1PGL2 4XUQA 1HQLA 1CPMA 1UY0A 2YPJA 2ZHNA 2WQZC 2QZ2A 3GHMA 4MXWB 1OOPB 1MZFA 1H2LA 2XVGA 1H2MA 2PHTA 4CDQC 3TN92 5JLVA 2IXKA 3BTAA 4GALA 5FDBA 3GJAA 3KV9A 5JWPA 5FYVA 3IPVB 2C24A 4RFRB 2A5ZA 1UX6A 5CFCA 2D6PA 2XXZA 3DPRA 4BU2A 2HBUA 5BNNC 3E6CC 3TNQA 1FPN1 1YEWA 3VKNA 2YB7A 4S2FA 5FV3A 3UT0A 2BOIA 3TAYA 2VXRA 5M0TA 3WSOA 5ACA3 4E4DX 3LFIA 2Y8KA 2OA2A 3OUIA 4Y20A 1W2AX 1OQEA 3NAPA 1QDOA 1TMF1 4UT5A 4Y1XA 5CAZA 1LENA 2P4EA 2CSGA 1K5MA 1VBD2 3R4DB 1RVF3 1QMJA 2VOVA 2VVFA 1DGRA 1JODA 2WIIB 3OPZA 4JV4A 2WSUA 4PQ9A 4HETA 4FPJA 1HRI2 2ARXA 2YUEA 3HBKA 3PUAA 5FZ8A 5FZOA 4FFFA 1VBA2 3OYWB 1WW5A 3VBUB 4N8MA 5BNPB 3CHXA 4C0HA 4WM8A 5IVJA 1CAWB 4UW6A 4UBGA 2VECA 2CHHA 5I0SA 4FQ4A 2YBSA 2EIGA 3MLKA 4DIQA 2J1AA 1AUYA 4I09A 5A7OA 3HT2A 4CEYA 3GZAA 2VW1A 3AK0A 2W0XA 3MUZ1 1DYOA 1GP5A 3POFA 4Q2FA 3H8OA 3EMRA 2R32A 3CIHA 3FFZA 5GLZA 5FTTC 1NXD1 3MLJA 4Q27A 1N1TA 2JIJA 3INAA 4Z2WA 2HH9A 1QJX1 2DURA 2GC2A 5KR7A 1RUOA 2XBO2 4GJZA 3VBHC 2E31A 2XDVA 4XUOA 1OQ1A 5FZOB 4AGVA 4BQXA 5E1RA 5FUPA 5ERLA 3SEPA 2GN3A 2LW8A 4QPGA 3SC7X 2ZMKA 5KHJA 2UWCA 2Y6FA 5JSRA 5DZEA 3T0DA 2QQKA 4BK5A 3ZYJB 1XXNA 1KS5A 1W6PB 1PX3A 1GYKA 5T50A 2YFUA 3FC0A 4XILA 3ACGA 3A23A 4JQRA 4WBBA 3HT1A 5BY5A 2JWPA 2V72A 1QOOA 1WGPA 1DZRA 1X8EA 3HEIA 4YG0A 5EQUA 2Y6HA 1J83A 4IGOA 3DV8A 5D8AB 5FWJA 3LQCA 1DGWX 5C3PA 4LOTA 3KHBA 5FKBA 2Q4SA 5FXXA 5H9SA 1TME1 1XNBA 3MV01 3QCWA 3RMYA 4BQ4A 5LRSA 1WZXA 3UKTA 3AB0A 3EB7A 2Y64A 4H7MA 5LA1A 4XUTA 4AEDA 1ULOA 2WAAA 5I0UA 2DBNA 5F3CA 1R64A 4QPGC 1ND3A 1ZX5A 1MEC3 3DN7A 1VBC1 1APNA 3GBFA 4UBHA 1JYXA 1RUD1 2NYYA 2EXIA 3FBYA 2Y34A 5FZ4A 1CESA 3ENRA 3NNFA 4NO4A 3P3PA 5A7WA 3WQ7A 1X33A 4AF9A 2RDQA 4MXVA 3KV5A 5F2WA 1Y7BA 2LRPA 4CEYB 4QDSA 4DXSA 5I0TA 5LEJA 2RG4A 3Q8BA 5KC6A 3VHRA 1QJU2 1WBLA 5IUQA 3IAPA 1JZ7A 2ORZA 5J3UA 5FYBA 1RINA 2XUMA 2QDNA 3H7JA 5DDJ1 4COYA 2FDFA 2YGMA 1BYHA 1ENXA 4N43B 2ZGUA 3WDVA 5C33A 1LJ7A 2BVBA 1V9U3 4LK7A 1JU4A 3E1F1 3L2HA 5L36A 1XE0A 3ETPA 4UYBA 5FMOS 1H4GA 1FMD1 3WCSA 4WZCA 1C57A 4HXCA 3VB9A 4ZZ8A 3AJZA 1UYZA 1IS6A 4Q0VA 4DY3A 1WD4A 1ND3C 4Y22A 4XXPA 2WFPA 2FDKA 4YVSC 3CZJA 4GWJA 3I3BA 1CPNA 1VBA3 1Q8QA 1S55A 2A6ZA 5EWSA 2WS93 1UXZA 4E2GA 1C5IA 4L9BA 1PGW2 4P9GA 4PDWB 4KG0A 5FZFA 3ZXFA 4K20A 1UF2C 3RG0A 1RUNA 3M2MA 3U75A 2YU2A 4PT6A 1M06G 4XJWA 1LGBA 1PO11 2DCZA 2DUQA 4HK8A 4RHV2 1TE1B 5FZAA 1KDKA 1IGOA 4GA9A 2XPJA 1F5JA 2DVDA 1MVEA 1AJKA 3W9AA 4MLOA 1GFF2 4EQVA 1J58A 2BZDA 3LF7A 5SV5A 2X5IB 2XJVA 1XOYA 3ZYPA 3FZ3A 1LNSA 1MQTC 1RXGA 3DKQA 3B5LB 4M0NA 5AVPA 4ZHNA 3T3YA 3A7QA 1W28A 4ORFA 1COV1 2WO3A 5JXHA 3SNMA 2PTMA 2BPA2 3OJBA 4AI2A 2R30A 3ACIA 3AKSA 4AZZA 2A70A 5FCCA 2Q30A 1OOPA 5K0UB 2Z69A 2JG8A 3FLRA 3WP6A 5KXEA 3KLSA 4EN7B 1ZRFA 1LCLA 4JHZA 5FUNA 1X9TA 4AI8A 3RJ2X 3WD5A 3EYPA 2BGCA 1I3HA 3BPSA 3VL8A 3V0AB 4MGQA 2VC9A 2XONA 4CP0A 1DLCA 3AVRA 1YQ2A 3TNPB 5CFCB 3OGRA 3H9AA 4K1YA 1BKZA 5KHGA 2GP5A 1VBB3 2WSVA 4KQ7A 3UGFA 1VAMA 3EBRA 4S2DA 2FZ2A 1QKQA 4GMP3 3W59A 2WZR1 4NR1A 4XJAA 2B39A 4GKXA 4WM8C 1CJDA 1EPZA 3K46A 1IPKA 1LGNA 4LO7A 4BXSV 2X05A 4KU8A 3WLUA 4COUA 5JSOA 3MV11 1LKNA 1OA4A 4LO8A 2E26A 4XF1A 2NP0A 1D0GA 4I01A 3IBMA 2BWCA 4BB3A 3PUIA 2LUWA 3UL2A 4P02B 1ZREA 3D0JA 2KR2A 1H8VA 1WLWA 4BQYA 5I0RA 4NWWA 1JZ2A 3IB3A 1RITA 4COVA 5LA9A 1RUC2 1A78A 2QE3A 2E7TA 1AZDA 3IDBB 4JKMA 4YFWA 5A6YA 5GZGA 4HVQA 3WQBA 4DRVA 4BIOA 2ET1A 4TLFA 1B35A 1JYVA 4AVVA 1YI7A 4CP1A 4TN7A 1J84A 1U5XA 3DKWA 3S7EA 3WW1A 2B45X 2WFF2 2PN5A 2PHXA 4YG3A 5A6QA 2NPIA 4Q4X3 2YY1A 2CNAA 1CGPA 3HWJA 1SG3A 2AUYA 1RUH3 2RJLA 3H0OA 1ZBA1 4X8PA 3VBUA 3BIEA 1LHWA 1HJFA 3KV4A 4N9IA 2GALA 1F15A 4KWJA 2ZAHA 4YM2A 3RZLA 2Q8DA 5LBBA 3VBFB 3SHRA 3DYMA 1RUG2 2ZBJA 5HCBA 5K0UC 2IXJA 3EHKA 2TNFA 3K4ZA 1F4AA 1ND2C 2Z79A 3WG1A 4AHZA 4MUVA 4NIDA 3LSDA 1OI6A 1YHFA 3PLQA 4GMP0 5FPLA 4UFMA 1P8JA 1WKYA 5JI7A 1Q8VA 4QGMA 5C70A 4RL7A 5C9AB 1H1AA 3ZSEA 1K12A 2A3WA 2XH6A 1VRH2 1HRV1 3B69A 3VZKA 4DUWA 4QXBA 3RWNA 1C1LA 3WW4A 1V6KA 1ULGA 2ZEZA 4H3WA 4XTPA 3K48A 2Q8OA 1F9KA 1OD5A 1GQPA 3PVOA 2D93A 3VBFC 3KT7A 4D6QA 5F5CA 2DU0A 4QDRA 3ZR5A 1V0AA 2MEV1 4DXRA 5CFDC 5BNPA 5BNOA 1G9BA 3UNPA 2XVKA 3NJXA 1A34A 1S0GA 2VMCA 2UYBA 4QX7A 4XF3A 4D7YA 3LDBA 3VBFA 3B02A 1RUD2 3QACA 3BU7A 2ZGNA 3KCXA 4XZPA 5F39A 1S0CA 2QQLA 3CDZB 3ZO0B 4KNCA 3P1IA 2DYCA 4LO4B 2WN2A 1GANA 1JHNA 1PHMA 3T08A 3UETA 1Q8SA 1YYNA 3RZGA 1R1A1 1ZRRA 2BRTA 2XUEA 5FK7A 4XAAA 2QJVA 4K8FA 3W58A 2R6QA 4PCRA 4W50A 4X6RB 3O1TA 3LEGA 5LW9A 5LEKA 3J4UH 2G1MA 5HV0A 3BU0A 1ASJ3 2D7FA 3B00A 1G9FA 4CDWA 4QX5A 1VBE2 4PIZA 1PGSA 1ZNPA 3JD73 3T1MA 2JDKA 3VDDA 3GNEA 2ET7A 1WW6A 2VZVA 1RUI3 1W6NA 4I0AA 1LOGA 1Q3EA 3LA7A 2HWD3 2EIBA 2XJRA 2YC0A 2D6LX 1W0PA 4LE3A 4CU6A 2DDUA 4MXWA 3OSDA 1JN2P 2G4IA 2HWE2 2O0OA 4Q4W1 4WVMB 4XACA 2RR13 3VD5A 1PVC1 2FCVA 1ZZBA 2IC1A 3GM8A 3AYDA 5KC5A 2J1UA 1C8M2 3POBA 4BJ0A 1S0EA 3M7AA 4XEZA 4NRPA 3ZXDA 3TN93 2W2IA 2Y26A 1IG0A 1W06A 4XFCA 2E51A 4M01A 4XYXA 2QKDA 5FP3A 1AX2A 5KXBA 2HWB2 3WY6A 1FNZA 4Y1UA 2DU1A 5F2SA 5BUVA 3R0RA 5CVRA 2YHJA 3M3OA 3HQRA 3JB8A 1XNKA 1Q5OA 4IE6A 1RJ8A 1W0NA 1AR83 4K9SA 5FWEA 2VAUA 2ADEA 4I2OA 4LKEA 1CZTA 4JQTA 1Y3TA 4PLMA 4YW4A 2W1WA 2EAKA 1JYTA 2XLFA 1PO21 3AKRA 1QOTA 1G8WA 3WNOA 1KD7A 3N35A 1EP0A 1PZ7A 1W9TA 2ARCA 1GSLA 2D3PA 4Q0SA 4YZ2A 1XQNA 1RHI3 3D0SA 4JDNA 2WZPP 5LZ6A 2VMFA 1BZWA 4META 1D7PM 4LORA 4MV2A 3QD6A 1DGRN 2AGSA 4MGZE 4XXAA 1E5SA 4JDOA 3ZPYA 1PO12 2X10A 2X8KA 3NAPB 3T0BA 3UGHA 1Q56A 2BU9A 3VZJA 2RM23 1CIYA 4YG6A 3ZYFA 2PLV3 1OUXA 2QQUA 3K4DA 1KGYA 4O7XA 2XMLA 5ANQA 1JOJA 2VW2A 3MW2A 1YNAA 3AZVA 1OA2A 3N9NA 4DO0A 4E9KA 5C7GA 2R063 2RS32 1IQAA 2AC1A 3WP3A 2X5IA 1NOVA 4NWVA 2VNGA 3E5XA 5E8AA 2VMHA 3CJXA 2DTWA 2EXHA 1ZZCA 1FOD3 2RDSA 4FOWA 3WOGA 1WMDA 4QQPA 4Q0PA 2DV9A 3C7EA 3WNNA 3VDAA 3JBG1 1RUC3 2RS51 2K46A 2QTWB 1O4ZA 1VMHA 5FMDA 1G6NA 2JICA 3NV1A 1I9RA 1UKGA 1UY3A 1XSQA 2ZGMA 3VBSB 4AVCA 3J8F2 1GQHA 3LZZA 4B4RA 4AFDA 2BNOA 1GUIA 4FPOB 1YFWA 1OC1A 4L2NA 2ADDA 3G7DA 1BEV1 5F1RA 4M4PA 1AL22 1AL0G 4LO5B 1CJPA 1ONAA 4DB5A 1BBT3 1HX6A 2P1BA 3AP7A 2WNUA 4ASKA 1OT5A 1SFPA 3S5QA 5L19A 1HXS2 3WF4A 5LCWL 2EF6A 2W3JA 4QX3A 1WBFA 1RTVA 1QOSA 2OX0A 2BQPA 5IFTA 2ZPXA 4Y5TA 2E32A 1LOEA 3AKTA 4FPYA 5IAXA 5HXMA 2WNVC 1ULPA 4NHXA 2OQ6A 5DAQA 3NW4A 2IVIB 1YXWA 4QPIA 3PDQA 3CEWA 3LOIA 1WCUA 1DDLA 5A3LA 1PX4A 2WKKA 1ZRDA 3PTRB 3LEMA 1RUG1 2EVXA 5FBZA 1AR62 2VZUA 1ZZ9A 4LBQA 1NLSA 2RE9A 2XJTA 2XHNA 2XQXA 1RYYA 2YV8A 4ES9A 3BIWE 4WVZA 4Q1RA 2CGNA 3MIBA 4YRDA 1D0HA 1EAH3 1QQP2 2WZ8A 3ZDSA 5BNNA 4Y5Z0 4RS5B 5JOXA 3AMHA 1D4M2 1PZ9A 5LBCA 2BBVA 2CL2A 3ACHA 1SZBA 2RMU1 3ES1A 5T5OA 1MACA 4ZS2A 3ECQA 2X09A 5IW0A 4AOCA 2V4VA 3VUOA 3I2FA 1AR61 3I3EA 1IKPA 1HDKA 1K45A 3ACLA 2TBVA 3KQ4B 4M3CB 3O0XA 3VDDC 2PAEA 5FYZA 3QH7A 3AKQA 4YVSB 2UWAA 1LOFA 4GWNA 1SBDA 4IEYA 1SDWA 4RFT0 3D6EA 4J1XA 4AWDA 4QGNA 3ZYBA 4DUXA 4LBQD 5JCTA 1UMHA 3S7IA 4BLIA 2ID4A 4YZ1A 4BZ4A 3O1UA 4L92A 1HXS3 4XQDA 1UD1A 2XHKA 4B4PA 5JXIA 3VZOA 1BMV2 4RHV3 1OF3A 3VBRB 2XLGA 5DPNA 5IJRA 3VV1A 1XE8A 2E6VA 2XQRA 2KXLA 1DQ2A 1W8UA 3CF6E 5FLJA 1RUJ3 4ISRA 1SFYA 4XQWA 4ZS3A 4ARYA 1U5ZA 3WR0A 5FMOL 1LECA 4BA6A 3GDBA 1REFA 2R16A 1RUF2 4M3CF 1UIKA 1Y9GA 4HG6B 1HIXA 4M0HA 4Y4YA 1O3QA 1H2KA 1O3TA 4I0BA 3WF2A 3ZXLA 3ITQA 4N53B 4C8DA 4YSFA 3WG3A 1B35C 2BGPA 1BMV1 2ZA9A 2ZEWA 4TYSA 2ATFA 2LROA 1PVXA 3GF6A 4B1MA 1FOD2 2VXJA 2WQ8A 3F2ZA 4YVWB 1X36A 1MR5A 3WNXA 4BYYA 4XAEA 1N1VA 3T0AA 1QQP1 3IMMA 4P14A 3DYOA 1BK1A 1JHJA 4LLFA 3A4UA 3VBOB 1G9AA 3Q8CA 4XIOA 3I2KA 2VNOA 3SCFA 3NJYA 5F32A 1NCQA 2ZCWA 2J1RA 5K0UA 1W2OA 1UZYA 3M3IA 3NWKA 4D7TA 1X9PA 1Y43B 2ZAAA 3U4XA 3OYWA 4MADA 5AFBA 1GLHA 1MZEA 3H8RA 1DZQA 2X5IC 3PJQA 4YGDA 1MVQA 1S0FA 4AEMA 1E5HA 5FYTA 4DNYA 3ZN5A 2WZEA 4CXYA 2XWBB 3GBGA 3OUHA 4KWUA 5B4XA 1O8PA 4KBBA 1QHDA 1UZVA 1WMEA 1Q8PA 2WT1A 4HBNA 4LE4A 2VVDA 4Y1ZA 5DZGA 3ZKUA 4A7YA 3KMHA 1NQJA 4Z8BA 1IS5A 1QJX3 4RA0A 3LPGA 2JDAA 3PMSA 5F6KA 4PDWC 3NO8A 2XJUA 2IXCA 3JB4C 4F7ZA 2A6YA 5JIUA 1NCQB 3W20A 2VBBA 4JZRA 2ZHKA 4YM1A 3JBG2 1DHKB 4QB1A 4A44A 1HQWA 4YW6A 2YXSA 5FP9A 4AEKA 1C8M3 1EV11 1JYIA 5J96B 2R071 2XR4A 3R4SA 4EN9B 5AC91 4HANA 4HSLA 4JGYC 3SLIA 2RS31 4AVSA 4OMCA 5FRAA 2OW4A 1O4TA 3MIFA 3O1SA 5FP4A 3D5OA 3OCPA 5GLVA 3CL1A 1TNRA 3BOPA 4L97A 1ZBE1 4CA9A 4AHYA 2E7QA 3GALA 3P3NA 1OHFA 1JYCA 3POGA 1JZ5A 5LATA 2AH2A 3DXTA 1R083 1UN1A 3I59B 5EFUA 2OXBA 1PGL1 1LRHA 2ERFA 3VBOA 1W9WA 4OZOA 4CEYC 4QD2A 5BNOC 1OH3A 4PQQA 4Q4Y3 4LBJA 2HWC1 5FUIA 1MEC1 2MHFA 4YGCA 2Q8EA 1GZWB 5CYYA 3OTFA 2GMPA 3VGIA 4CVUA 2PYTA 3LD8A 3IMNA 1AX1A 5K7PA 1RUF3 3MGUA 1HRI3 5JZGB 4S2HA 3BKZA 4XTMA 2WWUA 4P5HA 4RQPB 4XF4A 3UJOA 2DCKA 1OXCA 2W92A 3KVBA 3PU8A 4FFGA 4QPGB 4BLJA 4L0PA 4BCUA 4GB33 2UY9A 4M3CE 2C9KA 4IEWA 1ZYBA 2DUPA 2AEZA 4LHNA 4MGSA 2Q1MA 4FP2A 5JOWA 4KMQA 5LWBA 1K3IA 3KF3A 2LALA 2R041 3S57A 1O7FA 4U2AA 5FZEA 2WN3A 4IV3A 5DDJ3 1UPIA 5A32B 5FO7B 1UAIA 5C6CA 2XBO1 3NNLA 3I59A 5H9PA 5E6HA 2RDRA 5LY1A 3M8LA 1S2BA 1QJY1 2JG9A 3LIHA 3QLQA 2HKXA 2LTNA 1KXGA 3ZSMA 4V1PA 3ZYIB 4HONA 4TTGA 4N43C 4RSUA 2YZ4A 4HKWA 4LBOA 4OUEA 1YC61 2XL7A 5I91A 3UKVA 3GYDA 1ZA4A 1GBGA 2VG9A 4JRLA 1VBE1 2P3IA 1AR71 4OI0A 2Q0AA 1CWPA 4P9YA 1Z78A 2YC4A 1UZ0A 3PTYA 4LBNA 5EJZB 2P3YA 3O1OA 4CEWA 5JMCA 2WR9A 4QPIB 1BHGA 4PIYA 4XFFA 3N7JA 4RS5A 2OS2A 1Z7S2 2DF7A 1LEDA 3LCPA 3N9MA 2VQUA 1OSGA 2EALA 1YJLA 3AP9A 4MGKE 5I93A 5J48A 4FBFA 5JUVA 4OHVA 4LBQB 1UQXA 1AYM1 2WFF1 3BTXA 1W6QA 4IE4A 2HWC2 4U36A 1HB1A 4FPEA 3PUQA 1LEMA 4OQ8A 4LT5A 1CAWA 4GAZA 1W2NA 3R6SA 3KQRA 4IE5A 2ZHMA 4ZZ5A 2WO2A 5I0DA 3GBWA 5FZ9A 1FPN3 4NOTA 3BN6A 2I2SA 3AFGA 2BYVE 3HR9A 3N9PA 2FCTA 1BBT2 5A3OA 3ZXKA 2GC1A 3C3VA 3KT1A 3FL7A 1FX5A 1H9WA 4CRQA 1DYKA 5C4WB 1IOAA 4LQRA 2OQ7A 1UIJA 2BUKA 3ZIWA 3WF0A 2WJSA 1SPPA 5APAA 1OLQA 1X7NA 2FQPA 5CBLA 3IIIA 2ZABA 1RVF1 5D2AA 1VJ2A 3R05A 5A32A 1U5IA 1Z0HA 3U10A 2P3KA 2VTXA 4MX3A 4O9GA 3TBDA 1PMIA 4JKLA 2DCJA 2KM2A 1S2EA 1L7RA 4FPLA 4OUSA 1E5IA 2Y0IA 2IWGB 3APBA 3RPQA 4COWA 1NLRA 4DFSA 1POV3 5FIXA 2HYKA 1PVC2 1URXA 1CAUB 1FNYA 5T3NA 4L8QA 5DAWA 4XURA 4CEWC 1I5ZA 5FJKA 1PM7A 3C7GA 1BLZA 2QQOA 4CUBA 4OFGA 2DVAA 1X8MA 2FZ1A 1AX0A 1V6OA 2W94A 3Q8FA 4EV0A 3ZSLA 5JXGA 3GZTB 3NKTA 3ZN4A 3THPA 3RGBA 4C91A 4FXGB 1MS8A 1JZ4A 1ULDA 2ES3A 2ZKNA 5FZBA 1WLDA 2VCCA 3MPBA 4NAMA 1JZ3A 4Q4V1 2R7EB 1C1FA 3DYPA 2BV4A 4R52A 2ZGPA 2VUAA 4BDVB 4DOUA 2VZ3A 1KFXL 3IZOA 1QJU1 1HN0A 1B09A 4XMAA 4DS0A 3WT3A 1H1IA 2PAMA 4LJHA 1OLRA 3H8XA 3NJVA 4LTAA 1T2XA 2GNTA 4TLGA 4DXTA 5C8CC 5FPVA 4P9WA 3U0ZA 2BGOA 1OPMA 1UYPA 1LOFC 1RUH1 1UOJA 3AZYA 3HOBA 1WA6X 4A45A 4BQ2A 1O5LA 3BTYA 2W5FA 3H3ZA 3MHZA 4LBKA 1O4YA 1W8WA 4FQZA 2PELA 3T4HB 1CAUA 2ZOEB 3RYKA 1D4M3 2KD7A 2K2SA 2ZMNA 3R4UA 1W03A 4Q5OA 1HJGA 2Y33A 4GWMA 3DL3A 4HPKA 3M4FA 1C3HA 1DQ0A 1L7QA 1V6JA 5JDBA 4QXHA 4LHKA 2W91A 3WNKA 1S0DA 4N53A 3HAGA 2GZWA 5EP9A 5T54A 3WXPA 1GOHA 4Q4Y2 1CZSA 4BMBA 1XYPA 4P00B 1R092 2V5YA 1OBNA 3DCQA 5LY2A 4CDXA 3S6PA 1LOAA 2XL9A 3O14A 4GH4C 3H7YA 3NV4A 4HKOA 2ZGKA 1Q43A 1SCRA 3WG2A 4B29A 3VBOC 5FMBA 4AEJA 5C9AA 1RGSA 2WL1A 2A3XA 3AL5A 4JDMA 4ZONA 2EIEA 1RUE3 4NRMA 1W6OB 1NCRA 3IDEA 2D6OX 5JZGC 1A3KA 5DUWA 3LOBA 3THTA 1CVNA 1ASJ2 4R4XA 5FZGA 4EWDA 5ACA2 2QUOA 1DFQA 1GMMA 1XB9A 4NMIA 5A6XA 3Q9OA 5BNOB 2R0HA 2VZRA 4XJ8A 1AL23 1VBD1 2JDPA 1BK0A 3AYCA 3ORJA 4IQPA 4OVEA 5LRRA 4QX2A 2UWBA 4UFKA 1NAEA 4XUNA 2CTVA 1H6YA 4MO3M 5CU1A 4OLLA 2UURA 3QBQA 4YGEA 5FAXA 5A3WA 3JCIA 4XMIA 5JAXA 2PHRA 5KWRA 4CDWB 4HN1A 2DCYA 3L2YA 2E63A 2JG9C 2C6SA 2H6CA 4QQLA 4RR3B 3VKOA 3ZYHA 2A1XA 1WW7A 4NHYA 1ASJ1 2BERA 2HWF3 3ASIA 1NA1C 1YQ8A 4O9EA 4W4ZA 2W68A 4JC1A 4GJYA 3WHTA 4CXWA 1NYWA 2BVVA 4EZHA 3S0MA 2JX9A 5K9YA 1R1A2 1VRBA 1VIWB 1MS3A 4XIKA 5FJHA 1VLNA 2J1EA 4Q4W3 2DVGA 5CG9A 1WD3A 4P5YA 2WWSA 5KHHA 2YDEA 4LUMA 3KF5A 1PO13 1OLME 3FUQA 3OGGA 1UXXX 3KHCA 1AR93 3UV9A 3VHOA 2VJXA 3D82A 4CDUC 1V00A 2ZX3A 1RHI2 1SHWB 3VZLA 4YZ4A 3UGGA 5KHIA 4Z2AA 3PJYA 5T5JA 4MGIE 4AAXA 4OHYA 3V0BA 3LSEA 1ZRCA 4E2SA 1AR81 1CX1A 4CP9B 4DPNA 3J7MA 3KCCA 2Z42A 5FPUA 2RS13 3IDAA 3NMBA 2JDMA 2JG8B 3ZOIA 2TEPA 3H3LA 2G9GA 3T30A 4UFJA 3EXUA 4R9DA 2DTYA 1SDDB 3BOWA 2WO7A 2E7AA 4LLOA 1A8MA 1RHI1 1T6GC 2EA7A 1QNYA 4JGYA 2WNVB 3WUDA 2HWF2 1H4HA 4EYUA 3PUHA 2P3JA 3ZFGB 2V5DA 3AZXA 2VOWA 1SACA 2PMWB 3OG2A 4AK3A 4MG2A 2RR12 4MHUA 1G9DA 1T6BX 1OD3A 2FMDA 2W1SA 3CJIC 2VUCA 4UXAA 4XF9A 1US2A 2GNBA 2IUWA 4GMP1 1HV1A 1W3VA 4A3XA 2CY6A 5C8CB 4OQ9A 4UFLA 2CWMA 5FOBB 3MLLA 1YRZA 4QHZA 1H8TB 1XNDA 1VE0A 5FLIA 5JXJA 1FOD1 1GQGA 3JD72 5FZIA 1QNWA 1C8NA 1OKOA 2BNNA 3HMYA 4XDQA 3VD7A 3KVAA 1W8ZA 5H9QA 1FMD2 1SBEA 2GDFA 2RS53 5FOJB 1ULCA 5C3OA 4G3YC 2AACA 2VQTA 4IEQA 3VHNA 2YG0A 4H14A 3EQEA 4NROA 4JGYB 4A6SA 1NZIA 3AL6A 4LHSA 4FSJA 4JGZC 4AHXA 5FYIA 4D6RA 5F37A 1S0JA 3E5QA 2YFZA 4ASMB 5A1FA 4N43A 5I8SA 3PIGA 3SITA 1QIQA 5FZHA 3GZEA 1B35B 3RZMA 1H8TC 1GOGA 1NE4A 1XRUA 2Y0OA 1OUSA 1W6MB 5T52A 3DEMA 4BK4A 1PM4A 5D21A 4AYUA 5FP7A 4Z1VA 4Q4X1 2WLQA 3HN1A 4JTOA 3WW3A 2J1VA 5A3MA 2VGDA 2XJPA 4OCTA 4ZXKA 5C8CA 2BJSA 4IV3C 4IGPA 1H8TA 2R49A 2FHRA 3AP5A 3U37A 5C8WA 3FJSA 2QNKA 4UAPA 4HK9A 1PZ8A 1YIFA 3N3HA 2RV9A 4L99A 5A7WB 1QJX2 4UW5A 4RS5C 4A6OA 3L9JT 1BXHA 1CONA 1W39A 2WNVA 3ELNA 3POEA 5IHRA 1TMF3 1I6XA 2OZ6A 2WC2A 4KI5M 3AJYA 3MIGA 3OD0A 2RVAA 4LPLA 4XJZA 2D40A 3J7NA 4IXLA 5FY4A 4BXFA 5CADA 5L9BA 1HRV3 3O7OA 1KQRA 1OLMA 1VALA 2VULA 4KU7A 1LESA 2WNUC 1NT0A 2JEMA 3M70A 1OURA 1GV9A 1ZZ8A 1XYOA 2EIDA 5IT6A 4NIHA 1F8VA 5FZ1A 3KGLA 2MEV3 4IE0A 2JDNA 3T1LA 5DG2A 3N9QA 2Z4FA 2NMOA 2VZTA 5BPXA 1VB2A 4Y22B 3WW2A 1REDA 1W04A 2HYXA 3CJIA 5EPAA 5FBJA 4DY5A 1COV3 5A70A 4TXWA 3FWEA 1LHOA 1RJ7A 3LPFA 2P5BA 1RXFA 2W1UA 2Y60A 2D5FA 2GC3A 1X82A 1E5RA 5B2GB 3VZNA 4CU9A 3I3MA 3USUB 2XKPA 3RI8A 2FDGA 2RS12 1XNCA 3AMQA 2D3SA 3PVBB 4INDA 5BXXA 1JXNA 5DXDA 3RDIA 5HCAA 5GZDA 1N1SA 2RM22 1CR7A 4GZ9A 3AMNA 1OH4A 4MSVA 4XZUG 1NCRB 5IVYA 4MVTA 4LULA 4AEDC 3VBSC 5FXZA 4ET7A 4DZGA 1GNYA 3J7HA 3WP4A 4N7IA 4CCKA 2C5DA 1A6CA 5JI9A 3E6BA 4LITA 2SBAA 4HT1T 4YM0A 1NLQA 2JG9B 4YPJA 5F3GA 5F3IA 1UX7A 2R072 5C3SA 1S1AA 1SMVA 5GKAC 3JXSA 5FZ3A 1VR3A 1W6PA 1CZVA 4ZU4A 1W8HA 3PURA 1ZA7A 4UFHA 4IEXA 4A7KA 1UNBA 4ITCA 4WVVA 5LK5A 3MW4A 4AGRA 4K21A 2GC0A 1SLCA 5IVVA 2B46X 1W8FA 4RGKA 3CBNA 3I54A 1TME2 2JD4A 2XKOA 4PIXA 2JIGA 1R1ZA 5CIRA 3ZMNA 4OUMA 4C1WA 4WVWA 5CFDB 2DCTA 1QH7A 5HCHA 1UY4A 2DFCA 2LM3A 3NJZA 3ZYRA 1GZCA 2O8QA 1NZCA 1GWLA 4QMAA 1I5PA 3ZLIA 1XU2A 4JVAA 5FQ0B 4RN5A 2OYZA 4B7KA 1VBC2 2IFWA 5A3PA 3V0AA 1RMU3 2K0GA 2OVUA 3KV6A 4Q26A 2HEYF 4N9HA 1MS5A 3CMGA 4UF0A 4FOQA 3VBRA 5ABJB 3CO2A 2J7MA 3HVDA 4LA3A 2VOKA 4XDPA 2Y6KA 4WV8A 1MS4A 3AFKA 2HWB3 4R4ZA 3H1MA 4XBNA 2RJ2A 1RMU2 2JDUA 4AFAA 1LHVA 4BE3A 4KWLA 1QJFA 4Q1PA 2VMIA 4HL0A 4Q8LA 1AYN2 5CFCC 2VUJA 5IYYA 1QY4A 2F17A 5C4WA 3OY8A 3K4AA 4NIIA 4CCLA 3I8TA 4YFZA 5GLUA 4NAOA 3BALA 1WWYA 3U14A 2HWD2 3ST7A 4C1XA 3NVCA 1TME3 4QKDA 2GN7A 3POIA 4P9IA 1MS0A 3SH5A 3FX3A 1GNZA 4FVVA 1JOPA 1H6XA 1K5MC 1FMD3 4YNIA 4I02A 2A75A 4KG8A 4O65A 2BEOA 4SBVA 2WNEA 4QX8A 3NQHA 2PQSA 3MDPA 4YYOA 4Q0QA 4LK6A 1C8M1 4FO9A 4CCMA 1RUD3 1MQTB 3NNJA 2XVLA 2P6CA 1PMHX 2R073 2ZGTA 4GB32 4GH4A 3UK9A 1YFXA 5AC93 3OUJA 5IAVA 4DEVA 2FMYA 5A80A 3D3AA 2D44A 2PFWA 2F4PA 4LO6B 1HLCA 3MO4A 2ETEA 4Y1VA 4H2AA 3WDXA 2ZGOA 2WINB 2ZTNA 3ZXEA 1KJRA 4QPYA 4UW3A 1MZ5A 1O3SA 4WM8B 1J59A 2A6XA 3AM2A 3MEPA 4AVTA 3WQ0A 4XFBA 4NIGA 1F35A 5IATA 3O1VA 1KFUL 3S5AA 1TG7A 2H6BA 4NHKA 4AQTA 5BV6A 4AAPA 3O0WA 1UOFA 2F6BA 3N4MA 4GXLA 1SBFA 2WABA 1COV2 1UZWA 3OBAA 1AR92 3KWVA 1O59A 1REEA 4XJUA 3K77A 4FOYA 5IK4A 3JD71 1HQNA 4QKNA 4XDOA 2BOJA 3MYXA 1RC6A 1UO9A 3LFMA 1GOFA 1VRH3 3ZFFB 2CYFA 4P9LA 4DQAA 4OHXA 2HWE1 4Q4W2 5LA0A 4AGGA 1KITA 3NRUA 4XFGA 4QM9A 3RQ0A 4EWEA 2VCMA 4QHBA 3MIDA 5IFPA 4HPKB 2VZPA 4GQ7A 4AVAA 1LODA 1UOGA 3RNSA 1PVC3 5H9RA 3WUCA 2ZGSA 2J42A 1QF3A 3ZMOA 4K1ZA 1TMF2 1JZ6A 3RFRA 2WYSA 1EAH1 4PI2A 4TZDA 1QJY3 2OIIA 1D4VB 4V2VA 1ZZ6A 4E4HA 3CLPA 4GIQA 2GMEA 1EYBA 2Y6LA 3LGRA 2HLEA 1ST8A 2J1SA 3J8F1 1XPWA 4Y3OA 4HMZA 3WNLA 4WM7A 3TWIA 3IM0A 4AI9A 5DMYA 4EN0A 5CG8A 3OB8A 5F5IA 3WNMA 4IEUA 3OBRA 4WZFA 4E8CA 4EN8B 1JZ8A 2XLAA 5CEHA 2JD9A 3D8CA 1PIV3 4IEOA 2VPVA 4ASLA 1JYNA 4IETA 2JDHA 2NLRA 4PI0A 1N47A 4YW7A 4DINB 5JSPA 2I74A 1CN1A 5G04L 2OPKA 5C5TA 1ND3B 5FZ0A 3T2PA 3WX5A 2B5HA 4N90A 4CCNA 1CAXA 1YFYA 3BUCA 3K75B 4IW3A 5T55A 5A33B 2MNGA 2H0BA 5D1IA 3ZKYA 3MICA 5FK8A 5I8TA 3KSCA 4E8DA 3ABZA 2VNVA 4IERA 3CQOA 1RUJ1 2B7YA 3H1YA 3W5NA 1W99A 1JMUB 3O5SA 1BJQA 4NVPA 5L9RA 1ZBA2 3LWCA 5A3UA 4OHWA 1V6LA 3CNAA 5LASA 1DGWA 5FREA 5A7NA 3H3UA 1W6QB 1Z7S3 2R061 1N3PA 5FPAA 2D6MA 2QQVA 5FY9A 1DU3D 2JDYA 3E6DA 2JE9A 3RYPA 1ENSA 1J3QA 4MOAA 2G9FA 3VBHB 3JZVA 1O5UA 4AI3A 4MZUA 2PXJA 4R8HA 1NG0A 3T09A 1YUDA 1RUJ2 1WCQA 4G4FA 2CAUA 1XJAA 1R093 1G86A 3HN3A 1LR5A 1J3PA 3A0KA 4LKSA 4QDQA 1UWWA 4D69A 4URAA 4RGGA 2Z2SB 3I97A 4YGBA 1W2UA 2V09A 5CZKA 2BFUL 2CV6A 3BTZA 5HI0A 4E2QA 1LB2A 3NL1A 2W87A 3THCA 2P6HA 1BBT1 3B9IA 2QCSB 2OPWA 3KB5A 4K7JA 4LXLA 2WQ4A 5F8PA 4FPHA 1NUKA 2PHWA 4BQ3A 4CSWA 3SCHA 3BGAA 4CP9A 1VPHA 3ZXGA 1ND2B 4BQ1A 2ZEYA 1W9YA 1YCIA 5DAXA 1YLLA 2YROA 4IEVA 5EJ1B 5J37A 4H7LA 4NPRA 4B8EA 2QZ3A 3LE0A 5HBAA 1DGLA 3AVSA 5J36A 4I3PA 1J1TA 1YO8A 3MIHA 2ZJCA 3KS7A 1L7LA 1MS9A 4Q4V3 3USUA 3JU9A 2ZX4A 2ZXQA 1RUG3 1SLLA 4IDZA 1JOBA 4IESA 1HN1A 4M00A 4UW4A 1CAVB 2RHPA 4YZ5A 1IZ3A 4XOGA 5IVBA 1NXMA 3TEYA 5AFEA 4FI9A 4LBLA 5IVCA 4CCOA 1WLTA 5KXCA 3WHUA 3U1XA 1J1LA 2VTXJ 3KD4A 3WDUA 2YBKA 2C26A 4LIUA 4CCDA 3MF6A 3NAPC 5FYUA 1TEIA 1ENRA 4HSJA 5L73A 3A22A 1XBFA 3DPRB 4CZSA 4NPLA 3M3QA 1KDMA 2GNMA 4Y33A 2IZWA 5EIYB 4ONUA 4HLTA 1AYN1 1ZVFA 2CU5A 5EYXA 4QGLA 4BM8A 5FYHA 3DPRC 1DYPA 1FXZA 1Y9QA 4C0BA 4KGGA 5LBFA 1OF4A 1UYYA 2G9ZA 3UESA 2JXAA 2ZZJA 5FYMA 4A4AA 2ZEXA 3MFAA 3TN91 1PIV2 1PNFA 4KGQA 1DG6A 3POJA 2NM1A 5BNPC 4CDQA 1K5MB 2AZ5A 3SXWA 1E57A 4IV1C 4K8RB 3V64A 1ALYA 2HWC3 4RHV1 3SQOA 4XBLA 4PHZA 3B01A 1IG3A 3JQXA 5HV4A 3ZX7A 1BVP1 2K9ZA 3NKGA 4CU8A 1FPN2 2Q1ZB 2V73A 1JW6A 4YVWC 4RGAA 3I49A 1RUE2 4QB6A 1W8OA 5EZWA 2E53A 3ZFEC 1PNGA 2VR4A 3K2OA 3ZM8A 1ACCA 2W08A 1QXJA 1RUI1 2VOTA 2DFBA 1SEFA 5ANNA 3WG4A 2FDHA 1RL3A 1QU0A 1AL21 2OT7A 2VZ1A 4GWIA 4FAHA 1JS9A 2P17A 3H1WA 2TUNA 5J1XA 4A2UA 1K42A 2A71A 4CDXC 2H0VA 4YW3A 2QQJA 2RR11 1XE7A 2Y38A 4PLNA 4KL1A 1V6NA 2W52A 2XBO3 3B3QE 4OI2A 4B3NA 4PBPA 5F3EA 1U12A 3URFA 1TVGA 4XUPA 2PLV1 4UI9L 4FTBA 2EXKA 1IS4A 4W6YA 5IWFA 3ZFFA 4FPKA 3I2HA 4LKFA 4QU2A 3WZ1A 2WZR3 4EWAA 4BIFA 5FPZA 3ZFEB 2JENA 5EYYA 3Q8AA 4QKBA 1KJLA 3KCYA 4BPZA 3TEZA 2RS52 3ILRA 2A7AA 1S2KA 4KWKA 1RB8G 2VZSA 4BQ5A 1S0BA 3B93A 4JX0A 5LK7B 5JIAA 2BDRA 3K3OA 4JCKA 5FZ7A 2Q8CA 1STMA 5F9TA 1LOBA 2QQMA 1IHMA 1PK6C 5IK8A 3I4IA 3ZVXA 2O8OA 3OD4A 3UKNA 5BNQA 3LKJA 1VAKA 4FFIA 2QQWA 4QQ2A 3RWKX 2WNOA 3OBTA 3THDA 1WW4A 5EXOA 3C7HA 1UZZA 2Y6JA 3AZZA 5FYSA 1LOCA 1DP0A 3VHPA 1S0IA 3LIGA 4ZU7A 1UMIA 4UWDA 5SV8A 1NY71 3WDYA 4FFHA 5C5UA 3ZFEA 1PMJX 1ZBA3 3POYA 2WYFA 2ZKLA 2QFEA 2DVFA 2RS11 4QX1A 2YU1A 3KGZA 1V9U2 5C9AC 3V0BB 5J7MA 1RUI2 1H1MA 4ARXA 4XQ4A 4EZ4A 3RS6A 2QQIA 5FO8B 3D4KA 3H8UA 4A3ZA 4MGYE 2WS91 1O8SA 2WT2A 1YI9A 3OGVA 3PVEA 1NY72 3AXDA 3KZ4C 3VN4A 1V6MA 3ZFFC 5FQ0A 4C90A 3T2QA 1H2NA 3TEXA 1RIRA 3HJRA 5IK5A 2R042 4XFAA 5CFDA 1FAYA 4RD7A 4CUAA 5ABJA 3ZSJA 1W3XA 5FY5A 1WUVA 1DCSA 4B4QA 2WNUB 1MZ6A 1F5FA 2ZS6B 5I8YA 3M1HA 2EXJA 5DAVA 4IV1B 5FZKA 5J98B 3W21A 5LBEA 1UCXA 5FFOC 3OPTA 4JKKA 3WDTA 1QJY2 5JOYA 1AR63 1HRI1 3QH6A 3FLPA 5HCFA 3RZKA 1W6NB 3RZZA 4FT8A 4Q29A 4D6SA 5A1LA 3T2TA 5FYCA 5IK7A 2VU9A 3U78A 4CCEA 4K6BA 2FCUA 4FCAA 5FMCA 4NRQA 5JVVA 4PLOA 5FPBA 5FPXA 3RZHA 3NSTA 5ACA1 3H42B 2ZX0A 5JPNB 2VCAA 3WVJA 1OOPC 3C7FA 3ME2A 2WA3A 5AVAA 2IFRA 2ZMLA 5FZDA 3VKFC 1SLBA 3LB9A 3M3CA 3OY8B 4AVBA 1LAJA 3MUY1 1ENQA 4NPMA 2WDBA 2VL4A 5C4WC 1UU5A 2IXLA 4J1WA 4NHMA 4FTSA 1OFSA 3NV2A 3POWA 3FFQA 4XFIA 2CWSA 2D98A 3I2IA 4XW3A 2OKXA 1MQTA 2VTFA 3ROUA 1CD3G 2IXIA 3TYJA 3AP4A 4AFCA 2W1QA 4Y5SA 2J22A 1W6OA 1GZWA 1VBB1 1GZTA 2PA7A 4FPCA 1UU6A 4P9JA 4L11A 3WQ1A 1OPOA 5A3TA 1QH6A 4IEPA 1QWRA 1D4M1 3VZMA 2ORXA 1XSRA 1W0OA 1VP6A 2RMU2 2C1FA 2W39A 2AENA 2HWD1 3WDWA 3SMHA 1ULFA 4OHZA 4OYUA 4XBQA 4AI0A 4CCCA 2VY0A 3P6BA 2XG3A 2AREA 5CKMA 5DAPA 3HD8B 2NQYA 4I3GA 5FXWA 3WF1A 1LHNA 4F8AA 4QPIC 2P37A 4Q8KA 2EICA 1GZ9A 2C0ZA 2ZGLA 5AC92 3EJKA 5E89A 1GP4A 3FLTA 3OBZA 4SLIA 3O0VA 5KHKA 5K4LA 2VMEA 3CJIB 3AZWA 4CUCA 2JE8A 2WBKA 3USSA 3BODA 2O1QA 3TEWA 2F4LA 1EPWA 4LHLA 2XJSA 5FZLA 1GWKA 2GH8A 2VO5A 1NA1B 4Q4V2 3UYJA 1KRIA 3LA3A 2PHUA 4X8NA 2ARBA 3PVNA 4ZKTB 1YQ5A 2B8MA 1VBD3 2JB4A 1LHUA 2DBIA 2VH9A 3IT8A 4CDUA 2P2KA 4YW1A 5IVFA 5HXVA 1O3RA 1OQDA 2YYOA 2B9VA 2JG8C 3CU7A 1IKQA 4QXCA 1KS4A 1TNFA 4AFMA 4AW7A 1GICA 3AP6A 5ABJC 3MPPG 1UW8A 1IPJA 1Y9MA 2E9QA 5CISA 3GZUC 1TZOA 2G19A 4IL7A 4CTEA 2C9AA 1QJZA 3N7LA 3LEIA 3IIAA 4N7UA 1BCXA 1US3A 2I45A 3IWZA 4QWNA 2WZR2 3EO6A 3WV6A 5L7OA 3I2OA 1QQP3 3RRDA 3C7OA 4CDQB 2QVSB 3RMXA 4AXOA 3CZUA 2QBXA 4F83A 3LDKA 3SKJE 3BYWA 3JUUA 3M3EA 4AEDB 1VBC3 3OGJA 4QQHA 3VLBB 1N1YA 2ZGRA 3O1PA 1VAVA 2SLIA 3CKHA 4BISA 3JBG3 1SLIA 3PU3A 1QXPA 1FYUA 4XF0A 2GU9A 3LAGA 2OUJA 3PMEA 4Y4RA 1OA3A 1SLTA 1EAH2 3HIFA 4S2GA 1DF0A 2VW0A 3DF0A 4NE9A 1LU1A 3N9OA 1F2NA 3BPZA 3ZFGA 4B1LA 1SQ4A 1AJOA 4R9BA 4D94A 1SPPB 3C2UA 4HVRA 4AQSA 4YM3A 4BMEA 1YQCA 5FZCA 4CCJA 2ILMA 5CB7A 3AMMA 1PO22 1JU3A 2EAAA 2CDPA 2OZJA 2GH2A 4JGZB 2DUOA 4A7ZA 1IPSA 4Q4Y1 3SCGA 1V9U1 2R1BA 3I3DA 2D43A 4CYDA 2BFUS 5A7QA 1AR72 1NCRC 4FXKB 2FBEA 4IEZA 2ZHLA 4CDWC 1GP6A 3KT4A 1H9PA 2W95A 4QHOA 1ZZ7A 1CIWA 5FP8A 4EE2A 1NA1A 5A3NA 2WAOA 3POSA 3ZDVA 2MPFA 1QDCA 1NCQC 2WA4A 3LEKA 1XNTA 1CQ9A 3VD9A 5D8AC 1UKRA 1VBA1 4FPFA 1LU2A 4HN0A 4W65A 3DXUA 1AXKA 4I0WB 5C3RA 3N7MA 5A7PA 4Z07A 3T4VA 4YZ3A 4NHLA 1ZBE3 4JHTA 5F6LB 2A73B 2JDZA 3T2OA 4ES8A 5CA6A 1ZBE2 1WLCA 1LGCA 4AE2A 2R062 3ZN6B 4X6QB 3RJRA 5FR3A 5HPOA 4GKYA 1SCSA 2X53S 2B4KA 4I30A 4JGZA 1JUHA 1AXYA 2BNMA 5C3QA 5A6ZA 4GH4B 5FY0A 3SH4A 1I1EA 1W05A 3W5MA 3NNGA 3HQXA 2RMU3 4IGQA 4UOJA 4O61A 3SISA 3ZPOA 2UY8A 1WMXA 4BQWA 5BNNB 4B7EA 1AVBA 4EN6B 3DUIA 1IS3A 3AXEA 3OEAA 2YPDA 1BEV2 3LA2A 5FKCA 1NE6A 4UF0B 1AR73 1U0AA 2D6NA 4P9XA 1ODMA 3MF9A 5JOZA 2P34A 1OMIA 5FYYA 4K40A 4CXXA 4M3CA 5IVEA 3MFCA 1CAVA 2BWAA 2YC2A 4UFIA 3HNMA 4D8MA 5JMOA 3ZXJA 4WVMA 1SLAA 4IV1A 1NQDA 3FE5A 4E27A 1VB4A 1QEXA 4GD4A 5CKNA 4QT6A 3OGSA 1AYM3 2WFF3 2RDNA 4NIAA 2B9UA 4HVOA 2VMGA 1HRV2 3OEBA 5DDJ2 1D2SA 2VM9A 5CKQA 2RM21 3GCWA 2VNRA 1XYNA 3H50A 4PF1A 3B94A 5DUXA 3TRSB 3VKLA 2VBDA 2QQPA 4CPBD 5JPMB 1FV3A 3S30A 1BQPA 2HWF1 1DLLA 3BCWA 4CP2A 2Q5TA 1W9SA 2Q1FA 4M4RA 3ZR6A 5A1AA 3Q8EA 4XVHA 1PK6A 1GKBA 5JR7B 1JUIA 2WUHA 3U07A 3WCRA 2HWE3 4LMFA 1O6UA 4LUKA 3VBRC 4OI1A 4AG4A 5GM0A 1AHSA 1HB4A 4W6XA 3U11A 3MBWA 2PHFA 2Y6GA 3TB0A 4P08A 2VVEA 3VKMA 4A41A 4F3JA 4QX0A 4E4SA 5FLHA 4FOVA 4BH9A 4PJYA 3FHQA 4HFSA 4YWAA 3ZN6A 1AR91 1R082 2VD7A 3I3QA 2QQNA 2XOMA 1F31A 3ACFA 1OVSA 3GGLA 3OPWA 4Q0UA 3AYAA 4MGTA 3NNMA 3IPVA 1DZTA 4Z92B 3BVCA 3FBMA 1X50A 4YW2A 3ZYGA 5E88A 4NJ4A 3ZFGC 1WCKA 4XE9A 4CE8A 3MI8A 1OKQA 2C4XA 4XPVA 5FY1A 5FXVA 1PIV1 3PIJA 4ZPIA 4LKDA 2XJQA 1AXZA 3HBZA 5T5PA 3DGTA 3V65A 1HB3A 2CGPA 2VBPA 1CAXB 2UYAA 2OUHA 1DIWA 1FV2A 1O91A 2QDRA 2ARAA 5F5QA 1V6IA 3VBSA 2VUDA 2R0FA 2PHDA 1C4RA 2VCBA 1N3QA 5LB6A 5ISLA 3WEZA 1AF9A 1W9FA 3VDCA 2I07B 5EHDA 2FDJA 1RVF2 3WP5A 1UY1A 4W6WA 3ETQA 2GSYA 1QXRA 4RQPA 4QM8A 1DQ4A 1YFUA 1MPXA 1ULEA 2NZ9A 2VE1A 1GNHA 2JB8A 2YGLA 3F95A 1FATA 3GJBA 2HEVF 4QQOA 4V2WA 4Z82A 4DEQA 4CDUB 1HKDA 4RR3C 2PQQA 1Z7S1 2R1DA 3SEEA 1EV13 4EROA 4JAAA 2HEWF 4LR4A 3TOJA 4IUGA 1M4WA 4AR2A 2AYHA 2JE7A 2LS6A 2JJ6A 3AYEA 2RS33 3I2JA 1J3RA 1AYM2 3RYRA 3MIEA 5G05L 5LA2A 1H30A 3FN9A 4YW5A 1G7YA 2W47A 4PDWA 4WM7B 1UYXA 3WINE 3QOPA 4PF5A 5FO9B 2PLV2 2ZGQA 5DUVA 2NN8A 2JECA 2WRAA 2XB6C 3C8XA 3LDRA 1R091 3RVHA 4ZY9A 2ENRA 2V4AA 2ZZQA 1W90A 4YVSA 4IE7A 3IAQA 1R081 3J9SA 1R1A3 4Q4X2 2BW8A 4OULA 4QKFA 2GP3A 1W8TA 2JKXA 4BOWA 4XCBA 3PUSA 1HXS1 3PHMA 1POV0 1XC6A 5DZFA 3IDCB 4GULA 4PBOA 4G9SB 5EV7A 2GMMA 1EV12 1KEXA 4QXKA 5F7UA 2BP6A 2VQAA 4URTA 4AQ6A 1EUUA 1RUE1 3JQWA 3HQUA 3OOXA 2HWB1 3VD4A 1RUH2 4ISQA 3ALQA 5GZFA 1H0BA 4D7SA 1GU3A 5DN2A 2DVBA 5KXDA 4AFBA 1VMFA 1HV0A 3N36A 5D8AA 3K51A 4QPWA 2R043 5T5LA 3AMPA 4NN0A 1ZM1A 2CGOA 3G6JB 5GLWA 3KM5A 1L3JA 4J25A 4XETA 3SH3A 1WMFA 3ATGA 1CX4A 2Z5WA 4RYDA 3PNAA 1MEC2 1SFNA 5CNAA 2UU8A 3HPNA 2X29A 2NMNA 4IV3B 1WCDJ 4AHWA 3FMGA 2CDOA 4CU7A 4ZXEA 1S4CA 1D2QA 5GZEA 4AI1A 3B9CA 5L7OB 2L9LA 3ZIXA 3J7LA 4FAGA 2WLPA 1EY2A 5K8SA 4OMDA 2PAKA 1HB2A 1A8DA 1MS1A 2VOXA 2W46A 4LA2A 1OVPA 1U5YA 4BWOA 1YIPA 2VQ0A 4OZXA 3GCXA 1VBE3 1LULA 1OFNA 1PO23 2YBPA 4XHXA 4ATFA 1VBB2 3AKPA 3ILFA 3K3NA 1AYN3 2FD8A 1UL9A 4QU1A 1ND2A 1JI6A 3BB6A 4TWTA 1K5JA 2GNDA 1DQ6A
chains in the Genus database with same CATH topology
4IDZA 2FDHA 3O1PA 4QKDA 4ZS3A 4CXWA 4NPMA 4IE5A 4QHOA 4RFRB 2FDIA 2IUWA 3RZMA 2FDKA 4IE6A 4NIGA 4ZHNA 3BI3A 5F8PA 3T3YA 4O7XA 3O1VA 4NIDA 3KHBA 4O61A 3S57A 5DABA 3I3MA 3H8XA 3S5AA 3O1OA 3I3QA 2FDGA 3H8OA 4OCTA 3BTYA 3RZKA 4MGTA 3H8RA 3RZGA 3RZHA 2FDJA 3O1RA 3BUCA 3O1MA 2FDFA 3I2OA 4NIHA 4IE7A 3KHCA 3O1UA 3T4VA 3BIEA 3T4HB 2FD8A 4NPLA 4JHTA 4IE0A 4NJ4A 4NRPA 4NRQA 4QKNA 3O1TA 4QKFA 4NRMA 4NROA 4NIIA 4CXXA 3LFMA 4CXYA 3I49A 3BKZA 3BTXA 3RZJA 3RZLA 4IE4A 4QKBA 3O1SA 4MG2A 3BU0A 4ZS2A 3BTZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IDZ A;  2FDH A;  3O1P A;  4QKD A;  4ZS3 A;  4CXW A;  4NPM A;  4IE5 A;  4QHO A;  4RFR B;  2FDI A;  2IUW A;  3RZM A;  2FDK A;  4IE6 A;  4NIG A;  4ZHN A;  3BI3 A;  5F8P A;  3T3Y A;  4O7X A;  3O1V A;  4NID A;  3KHB A;  4O61 A;  3S57 A;  5DAB A;  3I3M A;  3H8X A;  3S5A A;  3O1O A;  3I3Q A;  2FDG A;  3H8O A;  4OCT A;  3BTY A;  3RZK A;  4MGT A;  3H8R A;  3RZG A;  3RZH A;  2FDJ A;  3O1R A;  3BUC A;  3O1M A;  2FDF A;  3I2O A;  4NIH A;  4IE7 A;  3KHC A;  3O1U A;  3T4V A;  3BIE A;  3T4H B;  2FD8 A;  4NPL A;  4JHT A;  4IE0 A;  4NJ4 A;  4NRP A;  4NRQ A;  4QKN A;  3O1T A;  4QKF A;  4NRM A;  4NRO A;  4NII A;  4CXX A;  3LFM A;  4CXY A;  3I49 A;  3BKZ A;  3BTX A;  3RZJ A;  3RZL A;  4IE4 A;  4QKB A;  3O1S A;  4MG2 A;  3BU0 A;  4ZS2 A;  3BTZ A; 
#chains in the Genus database with same CATH topology
 4EJR A;  2KA3 A;  1JH5 A;  3VL9 A;  1Y4W A;  2GAU A;  4MHR A;  4CEW B;  1QGL A;  1ZRI A;  2XWJ B;  1XU1 A;  1F4H A;  4KH9 A;  3OF1 A;  5BYN A;  3AC0 A;  4N53 C;  3ILN A;  1Q8O A;  1GR3 A;  2BBA A;  4RR3 A;  1LTE A;  3VBU C;  4BHP A;  1W2T A;  1FI2 A;  3ON7 A;  2A3Y A;  5FY7 A;  3FHI B;  1UPS A;  1UU4 A;  2N7G A;  1UMZ A;  3O12 A;  5F5A A;  5GZC A;  1C5H A;  5L7O C;  4H55 A;  5DQ0 A;  4MYE A;  4DXZ A;  3O1R A;  3NV3 A;  3ZSK A;  3B7M A;  4KBZ A;  4QB2 A;  1VRH 1;  3ES4 A;  3V56 A;  4CUG A;  1NX9 A;  3N7K A;  5FY8 A;  2WWJ A;  1UY2 A;  5A7S A;  5L9V A;  2VMD A;  4AQ2 A;  2A6W A;  2HJI A;  2ZAC A;  4YLZ A;  2WS9 2;  1TQ5 A;  1RUC 1;  2AEY A;  4LBM A;  4XHB A;  2A6V A;  1JBC A;  1ODN A;  2PHL A;  3RSJ A;  3X29 B;  2ZX1 A;  1QJE A;  2RJK A;  4J6G A;  1YWK A;  2HBT A;  4FPG A;  1YJK A;  4Y26 A;  3UJQ A;  2AR6 A;  4XJ9 A;  3N9L A;  3IN9 A;  5J09 A;  2DWR A;  4R9A A;  1PK6 B;  5E16 A;  4R9C A;  1BVV A;  1BEV 3;  4LIV A;  5FZM A;  3SKV A;  4LNV A;  1DBN A;  3FHA A;  1N3O A;  4HZF A;  4TSV A;  4DUV A;  2D5H A;  4CPB A;  4LEJ A;  3DEC A;  3P5B A;  3FUO A;  3J8F 3;  2W9X A;  1POV 1;  1VMJ A;  1RMU 1;  4RQP C;  4A42 A;  4ATE A;  3MZH A;  3A21 A;  4FP3 A;  2VZO A;  3GXU A;  4D0Q A;  4ZU5 A;  4DRR A;  1HW5 A;  5TSW A;  5DG1 A;  1RUF 1;  3I2D A;  3VBH A;  4QAW A;  4XC9 A;  2CAV A;  3GHN A;  3AX4 A;  3HNY M;  5DUU A;  2BTV C;  2VZQ A;  5GAL A;  4COZ A;  2FDI A;  4GB3 1;  1G9C A;  2YMZ A;  4Y24 A;  5JR2 A;  1UOB A;  4WM7 C;  4DMI A;  2B42 B;  5DAB A;  4YAR A;  2E33 A;  5GJ6 A;  5A33 A;  4E4Z A;  2WO1 A;  2J1T A;  3I7D A;  3PL0 A;  4JRA A;  5EJ3 A;  4CDX B;  1QJU 3;  1DQ1 A;  4XFH A;  3U4S A;  3E97 A;  2D97 A;  4NUB A;  2MEV 2;  1IQD C;  1XNA A;  3IKW A;  2WT0 A;  4JTN A;  4Y1Y A;  5C71 A;  1W6M A;  4FTE A;  3ZXA C;  1POQ A;  4W8J A;  1W8N A;  3RZJ A;  1C28 A;  2D3R A;  1WCS A;  2ZX2 A;  4XCA A;  3A0N A;  1WA4 A;  1V70 A;  2JKB A;  5GLT A;  3J26 N;  3RI9 A;  5FZ6 A;  1JYW A;  4MH0 E;  2IXH A;  4HKL A;  3VDB A;  3WF3 A;  1YQ6 A;  3E5U A;  1FT9 A;  1PGW 1;  3VD3 A;  1GWM A;  4XAB A;  5JZG A;  3HNB M;  3BI3 A;  3I2G A;  2XGX A;  1EUT A;  4LOS A;  4OI4 A;  3VDD B;  5KBF A;  2IVJ A;  1NKG A;  4HOO A;  4D3W A;  1JTZ X;  3WNP A;  4YVW A;  1DQ5 A;  1AR8 2;  2O14 A;  3MW3 A;  4AL9 A;  4Y20 B;  4K3U A;  2D6K A;  5B4N A;  3O1M A;  1PGL 2;  4XUQ A;  1HQL A;  1CPM A;  1UY0 A;  2YPJ A;  2ZHN A;  2WQZ C;  2QZ2 A;  3GHM A;  4MXW B;  1OOP B;  1MZF A;  1H2L A;  2XVG A;  1H2M A;  2PHT A;  4CDQ C;  3TN9 2;  5JLV A;  2IXK A;  3BTA A;  4GAL A;  5FDB A;  3GJA A;  3KV9 A;  5JWP A;  5FYV A;  3IPV B;  2C24 A;  4RFR B;  2A5Z A;  1UX6 A;  5CFC A;  2D6P A;  2XXZ A;  3DPR A;  4BU2 A;  2HBU A;  5BNN C;  3E6C C;  3TNQ A;  1FPN 1;  1YEW A;  3VKN A;  2YB7 A;  4S2F A;  5FV3 A;  3UT0 A;  2BOI A;  3TAY A;  2VXR A;  5M0T A;  3WSO A;  5ACA 3;  4E4D X;  3LFI A;  2Y8K A;  2OA2 A;  3OUI A;  4Y20 A;  1W2A X;  1OQE A;  3NAP A;  1QDO A;  1TMF 1;  4UT5 A;  4Y1X A;  5CAZ A;  1LEN A;  2P4E A;  2CSG A;  1K5M A;  1VBD 2;  3R4D B;  1RVF 3;  1QMJ A;  2VOV A;  2VVF A;  1DGR A;  1JOD A;  2WII B;  3OPZ A;  4JV4 A;  2WSU A;  4PQ9 A;  4HET A;  4FPJ A;  1HRI 2;  2ARX A;  2YUE A;  3HBK A;  3PUA A;  5FZ8 A;  5FZO A;  4FFF A;  1VBA 2;  3OYW B;  1WW5 A;  3VBU B;  4N8M A;  5BNP B;  3CHX A;  4C0H A;  4WM8 A;  5IVJ A;  1CAW B;  4UW6 A;  4UBG A;  2VEC A;  2CHH A;  5I0S A;  4FQ4 A;  2YBS A;  2EIG A;  3MLK A;  4DIQ A;  2J1A A;  1AUY A;  4I09 A;  5A7O A;  3HT2 A;  4CEY A;  3GZA A;  2VW1 A;  3AK0 A;  2W0X A;  3MUZ 1;  1DYO A;  1GP5 A;  3POF A;  4Q2F A;  3H8O A;  3EMR A;  2R32 A;  3CIH A;  3FFZ A;  5GLZ A;  5FTT C;  1NXD 1;  3MLJ A;  4Q27 A;  1N1T A;  2JIJ A;  3INA A;  4Z2W A;  2HH9 A;  1QJX 1;  2DUR A;  2GC2 A;  5KR7 A;  1RUO A;  2XBO 2;  4GJZ A;  3VBH C;  2E31 A;  2XDV A;  4XUO A;  1OQ1 A;  5FZO B;  4AGV A;  4BQX A;  5E1R A;  5FUP A;  5ERL A;  3SEP A;  2GN3 A;  2LW8 A;  4QPG A;  3SC7 X;  2ZMK A;  5KHJ A;  2UWC A;  2Y6F A;  5JSR A;  5DZE A;  3T0D A;  2QQK A;  4BK5 A;  3ZYJ B;  1XXN A;  1KS5 A;  1W6P B;  1PX3 A;  1GYK A;  5T50 A;  2YFU A;  3FC0 A;  4XIL A;  3ACG A;  3A23 A;  4JQR A;  4WBB A;  3HT1 A;  5BY5 A;  2JWP A;  2V72 A;  1QOO A;  1WGP A;  1DZR A;  1X8E A;  3HEI A;  4YG0 A;  5EQU A;  2Y6H A;  1J83 A;  4IGO A;  3DV8 A;  5D8A B;  5FWJ A;  3LQC A;  1DGW X;  5C3P A;  4LOT A;  3KHB A;  5FKB A;  2Q4S A;  5FXX A;  5H9S A;  1TME 1;  1XNB A;  3MV0 1;  3QCW A;  3RMY A;  4BQ4 A;  5LRS A;  1WZX A;  3UKT A;  3AB0 A;  3EB7 A;  2Y64 A;  4H7M A;  5LA1 A;  4XUT A;  4AED A;  1ULO A;  2WAA A;  5I0U A;  2DBN A;  5F3C A;  1R64 A;  4QPG C;  1ND3 A;  1ZX5 A;  1MEC 3;  3DN7 A;  1VBC 1;  1APN A;  3GBF A;  4UBH A;  1JYX A;  1RUD 1;  2NYY A;  2EXI A;  3FBY A;  2Y34 A;  5FZ4 A;  1CES A;  3ENR A;  3NNF A;  4NO4 A;  3P3P A;  5A7W A;  3WQ7 A;  1X33 A;  4AF9 A;  2RDQ A;  4MXV A;  3KV5 A;  5F2W A;  1Y7B A;  2LRP A;  4CEY B;  4QDS A;  4DXS A;  5I0T A;  5LEJ A;  2RG4 A;  3Q8B A;  5KC6 A;  3VHR A;  1QJU 2;  1WBL A;  5IUQ A;  3IAP A;  1JZ7 A;  2ORZ A;  5J3U A;  5FYB A;  1RIN A;  2XUM A;  2QDN A;  3H7J A;  5DDJ 1;  4COY A;  2FDF A;  2YGM A;  1BYH A;  1ENX A;  4N43 B;  2ZGU A;  3WDV A;  5C33 A;  1LJ7 A;  2BVB A;  1V9U 3;  4LK7 A;  1JU4 A;  3E1F 1;  3L2H A;  5L36 A;  1XE0 A;  3ETP A;  4UYB A;  5FMO S;  1H4G A;  1FMD 1;  3WCS A;  4WZC A;  1C57 A;  4HXC A;  3VB9 A;  4ZZ8 A;  3AJZ A;  1UYZ A;  1IS6 A;  4Q0V A;  4DY3 A;  1WD4 A;  1ND3 C;  4Y22 A;  4XXP A;  2WFP A;  2FDK A;  4YVS C;  3CZJ A;  4GWJ A;  3I3B A;  1CPN A;  1VBA 3;  1Q8Q A;  1S55 A;  2A6Z A;  5EWS A;  2WS9 3;  1UXZ A;  4E2G A;  1C5I A;  4L9B A;  1PGW 2;  4P9G A;  4PDW B;  4KG0 A;  5FZF A;  3ZXF A;  4K20 A;  1UF2 C;  3RG0 A;  1RUN A;  3M2M A;  3U75 A;  2YU2 A;  4PT6 A;  1M06 G;  4XJW A;  1LGB A;  1PO1 1;  2DCZ A;  2DUQ A;  4HK8 A;  4RHV 2;  1TE1 B;  5FZA A;  1KDK A;  1IGO A;  4GA9 A;  2XPJ A;  1F5J A;  2DVD A;  1MVE A;  1AJK A;  3W9A A;  4MLO A;  1GFF 2;  4EQV A;  1J58 A;  2BZD A;  3LF7 A;  5SV5 A;  2X5I B;  2XJV A;  1XOY A;  3ZYP A;  3FZ3 A;  1LNS A;  1MQT C;  1RXG A;  3DKQ A;  3B5L B;  4M0N A;  5AVP A;  4ZHN A;  3T3Y A;  3A7Q A;  1W28 A;  4ORF A;  1COV 1;  2WO3 A;  5JXH A;  3SNM A;  2PTM A;  2BPA 2;  3OJB A;  4AI2 A;  2R30 A;  3ACI A;  3AKS A;  4AZZ A;  2A70 A;  5FCC A;  2Q30 A;  1OOP A;  5K0U B;  2Z69 A;  2JG8 A;  3FLR A;  3WP6 A;  5KXE A;  3KLS A;  4EN7 B;  1ZRF A;  1LCL A;  4JHZ A;  5FUN A;  1X9T A;  4AI8 A;  3RJ2 X;  3WD5 A;  3EYP A;  2BGC A;  1I3H A;  3BPS A;  3VL8 A;  3V0A B;  4MGQ A;  2VC9 A;  2XON A;  4CP0 A;  1DLC A;  3AVR A;  1YQ2 A;  3TNP B;  5CFC B;  3OGR A;  3H9A A;  4K1Y A;  1BKZ A;  5KHG A;  2GP5 A;  1VBB 3;  2WSV A;  4KQ7 A;  3UGF A;  1VAM A;  3EBR A;  4S2D A;  2FZ2 A;  1QKQ A;  4GMP 3;  3W59 A;  2WZR 1;  4NR1 A;  4XJA A;  2B39 A;  4GKX A;  4WM8 C;  1CJD A;  1EPZ A;  3K46 A;  1IPK A;  1LGN A;  4LO7 A;  4BXS V;  2X05 A;  4KU8 A;  3WLU A;  4COU A;  5JSO A;  3MV1 1;  1LKN A;  1OA4 A;  4LO8 A;  2E26 A;  4XF1 A;  2NP0 A;  1D0G A;  4I01 A;  3IBM A;  2BWC A;  4BB3 A;  3PUI A;  2LUW A;  3UL2 A;  4P02 B;  1ZRE A;  3D0J A;  2KR2 A;  1H8V A;  1WLW A;  4BQY A;  5I0R A;  4NWW A;  1JZ2 A;  3IB3 A;  1RIT A;  4COV A;  5LA9 A;  1RUC 2;  1A78 A;  2QE3 A;  2E7T A;  1AZD A;  3IDB B;  4JKM A;  4YFW A;  5A6Y A;  5GZG A;  4HVQ A;  3WQB A;  4DRV A;  4BIO A;  2ET1 A;  4TLF A;  1B35 A;  1JYV A;  4AVV A;  1YI7 A;  4CP1 A;  4TN7 A;  1J84 A;  1U5X A;  3DKW A;  3S7E A;  3WW1 A;  2B45 X;  2WFF 2;  2PN5 A;  2PHX A;  4YG3 A;  5A6Q A;  2NPI A;  4Q4X 3;  2YY1 A;  2CNA A;  1CGP A;  3HWJ A;  1SG3 A;  2AUY A;  1RUH 3;  2RJL A;  3H0O A;  1ZBA 1;  4X8P A;  3VBU A;  3BIE A;  1LHW A;  1HJF A;  3KV4 A;  4N9I A;  2GAL A;  1F15 A;  4KWJ A;  2ZAH A;  4YM2 A;  3RZL A;  2Q8D A;  5LBB A;  3VBF B;  3SHR A;  3DYM A;  1RUG 2;  2ZBJ A;  5HCB A;  5K0U C;  2IXJ A;  3EHK A;  2TNF A;  3K4Z A;  1F4A A;  1ND2 C;  2Z79 A;  3WG1 A;  4AHZ A;  4MUV A;  4NID A;  3LSD A;  1OI6 A;  1YHF A;  3PLQ A;  4GMP 0;  5FPL A;  4UFM A;  1P8J A;  1WKY A;  5JI7 A;  1Q8V A;  4QGM A;  5C70 A;  4RL7 A;  5C9A B;  1H1A A;  3ZSE A;  1K12 A;  2A3W A;  2XH6 A;  1VRH 2;  1HRV 1;  3B69 A;  3VZK A;  4DUW A;  4QXB A;  3RWN A;  1C1L A;  3WW4 A;  1V6K A;  1ULG A;  2ZEZ A;  4H3W A;  4XTP A;  3K48 A;  2Q8O A;  1F9K A;  1OD5 A;  1GQP A;  3PVO A;  2D93 A;  3VBF C;  3KT7 A;  4D6Q A;  5F5C A;  2DU0 A;  4QDR A;  3ZR5 A;  1V0A A;  2MEV 1;  4DXR A;  5CFD C;  5BNP A;  5BNO A;  1G9B A;  3UNP A;  2XVK A;  3NJX A;  1A34 A;  1S0G A;  2VMC A;  2UYB A;  4QX7 A;  4XF3 A;  4D7Y A;  3LDB A;  3VBF A;  3B02 A;  1RUD 2;  3QAC A;  3BU7 A;  2ZGN A;  3KCX A;  4XZP A;  5F39 A;  1S0C A;  2QQL A;  3CDZ B;  3ZO0 B;  4KNC A;  3P1I A;  2DYC A;  4LO4 B;  2WN2 A;  1GAN A;  1JHN A;  1PHM A;  3T08 A;  3UET A;  1Q8S A;  1YYN A;  3RZG A;  1R1A 1;  1ZRR A;  2BRT A;  2XUE A;  5FK7 A;  4XAA A;  2QJV A;  4K8F A;  3W58 A;  2R6Q A;  4PCR A;  4W50 A;  4X6R B;  3O1T A;  3LEG A;  5LW9 A;  5LEK A;  3J4U H;  2G1M A;  5HV0 A;  3BU0 A;  1ASJ 3;  2D7F A;  3B00 A;  1G9F A;  4CDW A;  4QX5 A;  1VBE 2;  4PIZ A;  1PGS A;  1ZNP A;  3JD7 3;  3T1M A;  2JDK A;  3VDD A;  3GNE A;  2ET7 A;  1WW6 A;  2VZV A;  1RUI 3;  1W6N A;  4I0A A;  1LOG A;  1Q3E A;  3LA7 A;  2HWD 3;  2EIB A;  2XJR A;  2YC0 A;  2D6L X;  1W0P A;  4LE3 A;  4CU6 A;  2DDU A;  4MXW A;  3OSD A;  1JN2 P;  2G4I A;  2HWE 2;  2O0O A;  4Q4W 1;  4WVM B;  4XAC A;  2RR1 3;  3VD5 A;  1PVC 1;  2FCV A;  1ZZB A;  2IC1 A;  3GM8 A;  3AYD A;  5KC5 A;  2J1U A;  1C8M 2;  3POB A;  4BJ0 A;  1S0E A;  3M7A A;  4XEZ A;  4NRP A;  3ZXD A;  3TN9 3;  2W2I A;  2Y26 A;  1IG0 A;  1W06 A;  4XFC A;  2E51 A;  4M01 A;  4XYX A;  2QKD A;  5FP3 A;  1AX2 A;  5KXB A;  2HWB 2;  3WY6 A;  1FNZ A;  4Y1U A;  2DU1 A;  5F2S A;  5BUV A;  3R0R A;  5CVR A;  2YHJ A;  3M3O A;  3HQR A;  3JB8 A;  1XNK A;  1Q5O A;  4IE6 A;  1RJ8 A;  1W0N A;  1AR8 3;  4K9S A;  5FWE A;  2VAU A;  2ADE A;  4I2O A;  4LKE A;  1CZT A;  4JQT A;  1Y3T A;  4PLM A;  4YW4 A;  2W1W A;  2EAK A;  1JYT A;  2XLF A;  1PO2 1;  3AKR A;  1QOT A;  1G8W A;  3WNO A;  1KD7 A;  3N35 A;  1EP0 A;  1PZ7 A;  1W9T A;  2ARC A;  1GSL A;  2D3P A;  4Q0S A;  4YZ2 A;  1XQN A;  1RHI 3;  3D0S A;  4JDN A;  2WZP P;  5LZ6 A;  2VMF A;  1BZW A;  4MET A;  1D7P M;  4LOR A;  4MV2 A;  3QD6 A;  1DGR N;  2AGS A;  4MGZ E;  4XXA A;  1E5S A;  4JDO A;  3ZPY A;  1PO1 2;  2X10 A;  2X8K A;  3NAP B;  3T0B A;  3UGH A;  1Q56 A;  2BU9 A;  3VZJ A;  2RM2 3;  1CIY A;  4YG6 A;  3ZYF A;  2PLV 3;  1OUX A;  2QQU A;  3K4D A;  1KGY A;  4O7X A;  2XML A;  5ANQ A;  1JOJ A;  2VW2 A;  3MW2 A;  1YNA A;  3AZV A;  1OA2 A;  3N9N A;  4DO0 A;  4E9K A;  5C7G A;  2R06 3;  2RS3 2;  1IQA A;  2AC1 A;  3WP3 A;  2X5I A;  1NOV A;  4NWV A;  2VNG A;  3E5X A;  5E8A A;  2VMH A;  3CJX A;  2DTW A;  2EXH A;  1ZZC A;  1FOD 3;  2RDS A;  4FOW A;  3WOG A;  1WMD A;  4QQP A;  4Q0P A;  2DV9 A;  3C7E A;  3WNN A;  3VDA A;  3JBG 1;  1RUC 3;  2RS5 1;  2K46 A;  2QTW B;  1O4Z A;  1VMH A;  5FMD A;  1G6N A;  2JIC A;  3NV1 A;  1I9R A;  1UKG A;  1UY3 A;  1XSQ A;  2ZGM A;  3VBS B;  4AVC A;  3J8F 2;  1GQH A;  3LZZ A;  4B4R A;  4AFD A;  2BNO A;  1GUI A;  4FPO B;  1YFW A;  1OC1 A;  4L2N A;  2ADD A;  3G7D A;  1BEV 1;  5F1R A;  4M4P A;  1AL2 2;  1AL0 G;  4LO5 B;  1CJP A;  1ONA A;  4DB5 A;  1BBT 3;  1HX6 A;  2P1B A;  3AP7 A;  2WNU A;  4ASK A;  1OT5 A;  1SFP A;  3S5Q A;  5L19 A;  1HXS 2;  3WF4 A;  5LCW L;  2EF6 A;  2W3J A;  4QX3 A;  1WBF A;  1RTV A;  1QOS A;  2OX0 A;  2BQP A;  5IFT A;  2ZPX A;  4Y5T A;  2E32 A;  1LOE A;  3AKT A;  4FPY A;  5IAX A;  5HXM A;  2WNV C;  1ULP A;  4NHX A;  2OQ6 A;  5DAQ A;  3NW4 A;  2IVI B;  1YXW A;  4QPI A;  3PDQ A;  3CEW A;  3LOI A;  1WCU A;  1DDL A;  5A3L A;  1PX4 A;  2WKK A;  1ZRD A;  3PTR B;  3LEM A;  1RUG 1;  2EVX A;  5FBZ A;  1AR6 2;  2VZU A;  1ZZ9 A;  4LBQ A;  1NLS A;  2RE9 A;  2XJT A;  2XHN A;  2XQX A;  1RYY A;  2YV8 A;  4ES9 A;  3BIW E;  4WVZ A;  4Q1R A;  2CGN A;  3MIB A;  4YRD A;  1D0H A;  1EAH 3;  1QQP 2;  2WZ8 A;  3ZDS A;  5BNN A;  4Y5Z 0;  4RS5 B;  5JOX A;  3AMH A;  1D4M 2;  1PZ9 A;  5LBC A;  2BBV A;  2CL2 A;  3ACH A;  1SZB A;  2RMU 1;  3ES1 A;  5T5O A;  1MAC A;  4ZS2 A;  3ECQ A;  2X09 A;  5IW0 A;  4AOC A;  2V4V A;  3VUO A;  3I2F A;  1AR6 1;  3I3E A;  1IKP A;  1HDK A;  1K45 A;  3ACL A;  2TBV A;  3KQ4 B;  4M3C B;  3O0X A;  3VDD C;  2PAE A;  5FYZ A;  3QH7 A;  3AKQ A;  4YVS B;  2UWA A;  1LOF A;  4GWN A;  1SBD A;  4IEY A;  1SDW A;  4RFT 0;  3D6E A;  4J1X A;  4AWD A;  4QGN A;  3ZYB A;  4DUX A;  4LBQ D;  5JCT A;  1UMH A;  3S7I A;  4BLI A;  2ID4 A;  4YZ1 A;  4BZ4 A;  3O1U A;  4L92 A;  1HXS 3;  4XQD A;  1UD1 A;  2XHK A;  4B4P A;  5JXI A;  3VZO A;  1BMV 2;  4RHV 3;  1OF3 A;  3VBR B;  2XLG A;  5DPN A;  5IJR A;  3VV1 A;  1XE8 A;  2E6V A;  2XQR A;  2KXL A;  1DQ2 A;  1W8U A;  3CF6 E;  5FLJ A;  1RUJ 3;  4ISR A;  1SFY A;  4XQW A;  4ZS3 A;  4ARY A;  1U5Z A;  3WR0 A;  5FMO L;  1LEC A;  4BA6 A;  3GDB A;  1REF A;  2R16 A;  1RUF 2;  4M3C F;  1UIK A;  1Y9G A;  4HG6 B;  1HIX A;  4M0H A;  4Y4Y A;  1O3Q A;  1H2K A;  1O3T A;  4I0B A;  3WF2 A;  3ZXL A;  3ITQ A;  4N53 B;  4C8D A;  4YSF A;  3WG3 A;  1B35 C;  2BGP A;  1BMV 1;  2ZA9 A;  2ZEW A;  4TYS A;  2ATF A;  2LRO A;  1PVX A;  3GF6 A;  4B1M A;  1FOD 2;  2VXJ A;  2WQ8 A;  3F2Z A;  4YVW B;  1X36 A;  1MR5 A;  3WNX A;  4BYY A;  4XAE A;  1N1V A;  3T0A A;  1QQP 1;  3IMM A;  4P14 A;  3DYO A;  1BK1 A;  1JHJ A;  4LLF A;  3A4U A;  3VBO B;  1G9A A;  3Q8C A;  4XIO A;  3I2K A;  2VNO A;  3SCF A;  3NJY A;  5F32 A;  1NCQ A;  2ZCW A;  2J1R A;  5K0U A;  1W2O A;  1UZY A;  3M3I A;  3NWK A;  4D7T A;  1X9P A;  1Y43 B;  2ZAA A;  3U4X A;  3OYW A;  4MAD A;  5AFB A;  1GLH A;  1MZE A;  3H8R A;  1DZQ A;  2X5I C;  3PJQ A;  4YGD A;  1MVQ A;  1S0F A;  4AEM A;  1E5H A;  5FYT A;  4DNY A;  3ZN5 A;  2WZE A;  4CXY A;  2XWB B;  3GBG A;  3OUH A;  4KWU A;  5B4X A;  1O8P A;  4KBB A;  1QHD A;  1UZV A;  1WME A;  1Q8P A;  2WT1 A;  4HBN A;  4LE4 A;  2VVD A;  4Y1Z A;  5DZG A;  3ZKU A;  4A7Y A;  3KMH A;  1NQJ A;  4Z8B A;  1IS5 A;  1QJX 3;  4RA0 A;  3LPG A;  2JDA A;  3PMS A;  5F6K A;  4PDW C;  3NO8 A;  2XJU A;  2IXC A;  3JB4 C;  4F7Z A;  2A6Y A;  5JIU A;  1NCQ B;  3W20 A;  2VBB A;  4JZR A;  2ZHK A;  4YM1 A;  3JBG 2;  1DHK B;  4QB1 A;  4A44 A;  1HQW A;  4YW6 A;  2YXS A;  5FP9 A;  4AEK A;  1C8M 3;  1EV1 1;  1JYI A;  5J96 B;  2R07 1;  2XR4 A;  3R4S A;  4EN9 B;  5AC9 1;  4HAN A;  4HSL A;  4JGY C;  3SLI A;  2RS3 1;  4AVS A;  4OMC A;  5FRA A;  2OW4 A;  1O4T A;  3MIF A;  3O1S A;  5FP4 A;  3D5O A;  3OCP A;  5GLV A;  3CL1 A;  1TNR A;  3BOP A;  4L97 A;  1ZBE 1;  4CA9 A;  4AHY A;  2E7Q A;  3GAL A;  3P3N A;  1OHF A;  1JYC A;  3POG A;  1JZ5 A;  5LAT A;  2AH2 A;  3DXT A;  1R08 3;  1UN1 A;  3I59 B;  5EFU A;  2OXB A;  1PGL 1;  1LRH A;  2ERF A;  3VBO A;  1W9W A;  4OZO A;  4CEY C;  4QD2 A;  5BNO C;  1OH3 A;  4PQQ A;  4Q4Y 3;  4LBJ A;  2HWC 1;  5FUI A;  1MEC 1;  2MHF A;  4YGC A;  2Q8E A;  1GZW B;  5CYY A;  3OTF A;  2GMP A;  3VGI A;  4CVU A;  2PYT A;  3LD8 A;  3IMN A;  1AX1 A;  5K7P A;  1RUF 3;  3MGU A;  1HRI 3;  5JZG B;  4S2H A;  3BKZ A;  4XTM A;  2WWU A;  4P5H A;  4RQP B;  4XF4 A;  3UJO A;  2DCK A;  1OXC A;  2W92 A;  3KVB A;  3PU8 A;  4FFG A;  4QPG B;  4BLJ A;  4L0P A;  4BCU A;  4GB3 3;  2UY9 A;  4M3C E;  2C9K A;  4IEW A;  1ZYB A;  2DUP A;  2AEZ A;  4LHN A;  4MGS A;  2Q1M A;  4FP2 A;  5JOW A;  4KMQ A;  5LWB A;  1K3I A;  3KF3 A;  2LAL A;  2R04 1;  3S57 A;  1O7F A;  4U2A A;  5FZE A;  2WN3 A;  4IV3 A;  5DDJ 3;  1UPI A;  5A32 B;  5FO7 B;  1UAI A;  5C6C A;  2XBO 1;  3NNL A;  3I59 A;  5H9P A;  5E6H A;  2RDR A;  5LY1 A;  3M8L A;  1S2B A;  1QJY 1;  2JG9 A;  3LIH A;  3QLQ A;  2HKX A;  2LTN A;  1KXG A;  3ZSM A;  4V1P A;  3ZYI B;  4HON A;  4TTG A;  4N43 C;  4RSU A;  2YZ4 A;  4HKW A;  4LBO A;  4OUE A;  1YC6 1;  2XL7 A;  5I91 A;  3UKV A;  3GYD A;  1ZA4 A;  1GBG A;  2VG9 A;  4JRL A;  1VBE 1;  2P3I A;  1AR7 1;  4OI0 A;  2Q0A A;  1CWP A;  4P9Y A;  1Z78 A;  2YC4 A;  1UZ0 A;  3PTY A;  4LBN A;  5EJZ B;  2P3Y A;  3O1O A;  4CEW A;  5JMC A;  2WR9 A;  4QPI B;  1BHG A;  4PIY A;  4XFF A;  3N7J A;  4RS5 A;  2OS2 A;  1Z7S 2;  2DF7 A;  1LED A;  3LCP A;  3N9M A;  2VQU A;  1OSG A;  2EAL A;  1YJL A;  3AP9 A;  4MGK E;  5I93 A;  5J48 A;  4FBF A;  5JUV A;  4OHV A;  4LBQ B;  1UQX A;  1AYM 1;  2WFF 1;  3BTX A;  1W6Q A;  4IE4 A;  2HWC 2;  4U36 A;  1HB1 A;  4FPE A;  3PUQ A;  1LEM A;  4OQ8 A;  4LT5 A;  1CAW A;  4GAZ A;  1W2N A;  3R6S A;  3KQR A;  4IE5 A;  2ZHM A;  4ZZ5 A;  2WO2 A;  5I0D A;  3GBW A;  5FZ9 A;  1FPN 3;  4NOT A;  3BN6 A;  2I2S A;  3AFG A;  2BYV E;  3HR9 A;  3N9P A;  2FCT A;  1BBT 2;  5A3O A;  3ZXK A;  2GC1 A;  3C3V A;  3KT1 A;  3FL7 A;  1FX5 A;  1H9W A;  4CRQ A;  1DYK A;  5C4W B;  1IOA A;  4LQR A;  2OQ7 A;  1UIJ A;  2BUK A;  3ZIW A;  3WF0 A;  2WJS A;  1SPP A;  5APA A;  1OLQ A;  1X7N A;  2FQP A;  5CBL A;  3III A;  2ZAB A;  1RVF 1;  5D2A A;  1VJ2 A;  3R05 A;  5A32 A;  1U5I A;  1Z0H A;  3U10 A;  2P3K A;  2VTX A;  4MX3 A;  4O9G A;  3TBD A;  1PMI A;  4JKL A;  2DCJ A;  2KM2 A;  1S2E A;  1L7R A;  4FPL A;  4OUS A;  1E5I A;  2Y0I A;  2IWG B;  3APB A;  3RPQ A;  4COW A;  1NLR A;  4DFS A;  1POV 3;  5FIX A;  2HYK A;  1PVC 2;  1URX A;  1CAU B;  1FNY A;  5T3N A;  4L8Q A;  5DAW A;  4XUR A;  4CEW C;  1I5Z A;  5FJK A;  1PM7 A;  3C7G A;  1BLZ A;  2QQO A;  4CUB A;  4OFG A;  2DVA A;  1X8M A;  2FZ1 A;  1AX0 A;  1V6O A;  2W94 A;  3Q8F A;  4EV0 A;  3ZSL A;  5JXG A;  3GZT B;  3NKT A;  3ZN4 A;  3THP A;  3RGB A;  4C91 A;  4FXG B;  1MS8 A;  1JZ4 A;  1ULD A;  2ES3 A;  2ZKN A;  5FZB A;  1WLD A;  2VCC A;  3MPB A;  4NAM A;  1JZ3 A;  4Q4V 1;  2R7E B;  1C1F A;  3DYP A;  2BV4 A;  4R52 A;  2ZGP A;  2VUA A;  4BDV B;  4DOU A;  2VZ3 A;  1KFX L;  3IZO A;  1QJU 1;  1HN0 A;  1B09 A;  4XMA A;  4DS0 A;  3WT3 A;  1H1I A;  2PAM A;  4LJH A;  1OLR A;  3H8X A;  3NJV A;  4LTA A;  1T2X A;  2GNT A;  4TLG A;  4DXT A;  5C8C C;  5FPV A;  4P9W A;  3U0Z A;  2BGO A;  1OPM A;  1UYP A;  1LOF C;  1RUH 1;  1UOJ A;  3AZY A;  3HOB A;  1WA6 X;  4A45 A;  4BQ2 A;  1O5L A;  3BTY A;  2W5F A;  3H3Z A;  3MHZ A;  4LBK A;  1O4Y A;  1W8W A;  4FQZ A;  2PEL A;  3T4H B;  1CAU A;  2ZOE B;  3RYK A;  1D4M 3;  2KD7 A;  2K2S A;  2ZMN A;  3R4U A;  1W03 A;  4Q5O A;  1HJG A;  2Y33 A;  4GWM A;  3DL3 A;  4HPK A;  3M4F A;  1C3H A;  1DQ0 A;  1L7Q A;  1V6J A;  5JDB A;  4QXH A;  4LHK A;  2W91 A;  3WNK A;  1S0D A;  4N53 A;  3HAG A;  2GZW A;  5EP9 A;  5T54 A;  3WXP A;  1GOH A;  4Q4Y 2;  1CZS A;  4BMB A;  1XYP A;  4P00 B;  1R09 2;  2V5Y A;  1OBN A;  3DCQ A;  5LY2 A;  4CDX A;  3S6P A;  1LOA A;  2XL9 A;  3O14 A;  4GH4 C;  3H7Y A;  3NV4 A;  4HKO A;  2ZGK A;  1Q43 A;  1SCR A;  3WG2 A;  4B29 A;  3VBO C;  5FMB A;  4AEJ A;  5C9A A;  1RGS A;  2WL1 A;  2A3X A;  3AL5 A;  4JDM A;  4ZON A;  2EIE A;  1RUE 3;  4NRM A;  1W6O B;  1NCR A;  3IDE A;  2D6O X;  5JZG C;  1A3K A;  5DUW A;  3LOB A;  3THT A;  1CVN A;  1ASJ 2;  4R4X A;  5FZG A;  4EWD A;  5ACA 2;  2QUO A;  1DFQ A;  1GMM A;  1XB9 A;  4NMI A;  5A6X A;  3Q9O A;  5BNO B;  2R0H A;  2VZR A;  4XJ8 A;  1AL2 3;  1VBD 1;  2JDP A;  1BK0 A;  3AYC A;  3ORJ A;  4IQP A;  4OVE A;  5LRR A;  4QX2 A;  2UWB A;  4UFK A;  1NAE A;  4XUN A;  2CTV A;  1H6Y A;  4MO3 M;  5CU1 A;  4OLL A;  2UUR A;  3QBQ A;  4YGE A;  5FAX A;  5A3W A;  3JCI A;  4XMI A;  5JAX A;  2PHR A;  5KWR A;  4CDW B;  4HN1 A;  2DCY A;  3L2Y A;  2E63 A;  2JG9 C;  2C6S A;  2H6C A;  4QQL A;  4RR3 B;  3VKO A;  3ZYH A;  2A1X A;  1WW7 A;  4NHY A;  1ASJ 1;  2BER A;  2HWF 3;  3ASI A;  1NA1 C;  1YQ8 A;  4O9E A;  4W4Z A;  2W68 A;  4JC1 A;  4GJY A;  3WHT A;  4CXW A;  1NYW A;  2BVV A;  4EZH A;  3S0M A;  2JX9 A;  5K9Y A;  1R1A 2;  1VRB A;  1VIW B;  1MS3 A;  4XIK A;  5FJH A;  1VLN A;  2J1E A;  4Q4W 3;  2DVG A;  5CG9 A;  1WD3 A;  4P5Y A;  2WWS A;  5KHH A;  2YDE A;  4LUM A;  3KF5 A;  1PO1 3;  1OLM E;  3FUQ A;  3OGG A;  1UXX X;  3KHC A;  1AR9 3;  3UV9 A;  3VHO A;  2VJX A;  3D82 A;  4CDU C;  1V00 A;  2ZX3 A;  1RHI 2;  1SHW B;  3VZL A;  4YZ4 A;  3UGG A;  5KHI A;  4Z2A A;  3PJY A;  5T5J A;  4MGI E;  4AAX A;  4OHY A;  3V0B A;  3LSE A;  1ZRC A;  4E2S A;  1AR8 1;  1CX1 A;  4CP9 B;  4DPN A;  3J7M A;  3KCC A;  2Z42 A;  5FPU A;  2RS1 3;  3IDA A;  3NMB A;  2JDM A;  2JG8 B;  3ZOI A;  2TEP A;  3H3L A;  2G9G A;  3T30 A;  4UFJ A;  3EXU A;  4R9D A;  2DTY A;  1SDD B;  3BOW A;  2WO7 A;  2E7A A;  4LLO A;  1A8M A;  1RHI 1;  1T6G C;  2EA7 A;  1QNY A;  4JGY A;  2WNV B;  3WUD A;  2HWF 2;  1H4H A;  4EYU A;  3PUH A;  2P3J A;  3ZFG B;  2V5D A;  3AZX A;  2VOW A;  1SAC A;  2PMW B;  3OG2 A;  4AK3 A;  4MG2 A;  2RR1 2;  4MHU A;  1G9D A;  1T6B X;  1OD3 A;  2FMD A;  2W1S A;  3CJI C;  2VUC A;  4UXA A;  4XF9 A;  1US2 A;  2GNB A;  2IUW A;  4GMP 1;  1HV1 A;  1W3V A;  4A3X A;  2CY6 A;  5C8C B;  4OQ9 A;  4UFL A;  2CWM A;  5FOB B;  3MLL A;  1YRZ A;  4QHZ A;  1H8T B;  1XND A;  1VE0 A;  5FLI A;  5JXJ A;  1FOD 1;  1GQG A;  3JD7 2;  5FZI A;  1QNW A;  1C8N A;  1OKO A;  2BNN A;  3HMY A;  4XDQ A;  3VD7 A;  3KVA A;  1W8Z A;  5H9Q A;  1FMD 2;  1SBE A;  2GDF A;  2RS5 3;  5FOJ B;  1ULC A;  5C3O A;  4G3Y C;  2AAC A;  2VQT A;  4IEQ A;  3VHN A;  2YG0 A;  4H14 A;  3EQE A;  4NRO A;  4JGY B;  4A6S A;  1NZI A;  3AL6 A;  4LHS A;  4FSJ A;  4JGZ C;  4AHX A;  5FYI A;  4D6R A;  5F37 A;  1S0J A;  3E5Q A;  2YFZ A;  4ASM B;  5A1F A;  4N43 A;  5I8S A;  3PIG A;  3SIT A;  1QIQ A;  5FZH A;  3GZE A;  1B35 B;  3RZM A;  1H8T C;  1GOG A;  1NE4 A;  1XRU A;  2Y0O A;  1OUS A;  1W6M B;  5T52 A;  3DEM A;  4BK4 A;  1PM4 A;  5D21 A;  4AYU A;  5FP7 A;  4Z1V A;  4Q4X 1;  2WLQ A;  3HN1 A;  4JTO A;  3WW3 A;  2J1V A;  5A3M A;  2VGD A;  2XJP A;  4OCT A;  4ZXK A;  5C8C A;  2BJS A;  4IV3 C;  4IGP A;  1H8T A;  2R49 A;  2FHR A;  3AP5 A;  3U37 A;  5C8W A;  3FJS A;  2QNK A;  4UAP A;  4HK9 A;  1PZ8 A;  1YIF A;  3N3H A;  2RV9 A;  4L99 A;  5A7W B;  1QJX 2;  4UW5 A;  4RS5 C;  4A6O A;  3L9J T;  1BXH A;  1CON A;  1W39 A;  2WNV A;  3ELN A;  3POE A;  5IHR A;  1TMF 3;  1I6X A;  2OZ6 A;  2WC2 A;  4KI5 M;  3AJY A;  3MIG A;  3OD0 A;  2RVA A;  4LPL A;  4XJZ A;  2D40 A;  3J7N A;  4IXL A;  5FY4 A;  4BXF A;  5CAD A;  5L9B A;  1HRV 3;  3O7O A;  1KQR A;  1OLM A;  1VAL A;  2VUL A;  4KU7 A;  1LES A;  2WNU C;  1NT0 A;  2JEM A;  3M70 A;  1OUR A;  1GV9 A;  1ZZ8 A;  1XYO A;  2EID A;  5IT6 A;  4NIH A;  1F8V A;  5FZ1 A;  3KGL A;  2MEV 3;  4IE0 A;  2JDN A;  3T1L A;  5DG2 A;  3N9Q A;  2Z4F A;  2NMO A;  2VZT A;  5BPX A;  1VB2 A;  4Y22 B;  3WW2 A;  1RED A;  1W04 A;  2HYX A;  3CJI A;  5EPA A;  5FBJ A;  4DY5 A;  1COV 3;  5A70 A;  4TXW A;  3FWE A;  1LHO A;  1RJ7 A;  3LPF A;  2P5B A;  1RXF A;  2W1U A;  2Y60 A;  2D5F A;  2GC3 A;  1X82 A;  1E5R A;  5B2G B;  3VZN A;  4CU9 A;  3I3M A;  3USU B;  2XKP A;  3RI8 A;  2FDG A;  2RS1 2;  1XNC A;  3AMQ A;  2D3S A;  3PVB B;  4IND A;  5BXX A;  1JXN A;  5DXD A;  3RDI A;  5HCA A;  5GZD A;  1N1S A;  2RM2 2;  1CR7 A;  4GZ9 A;  3AMN A;  1OH4 A;  4MSV A;  4XZU G;  1NCR B;  5IVY A;  4MVT A;  4LUL A;  4AED C;  3VBS C;  5FXZ A;  4ET7 A;  4DZG A;  1GNY A;  3J7H A;  3WP4 A;  4N7I A;  4CCK A;  2C5D A;  1A6C A;  5JI9 A;  3E6B A;  4LIT A;  2SBA A;  4HT1 T;  4YM0 A;  1NLQ A;  2JG9 B;  4YPJ A;  5F3G A;  5F3I A;  1UX7 A;  2R07 2;  5C3S A;  1S1A A;  1SMV A;  5GKA C;  3JXS A;  5FZ3 A;  1VR3 A;  1W6P A;  1CZV A;  4ZU4 A;  1W8H A;  3PUR A;  1ZA7 A;  4UFH A;  4IEX A;  4A7K A;  1UNB A;  4ITC A;  4WVV A;  5LK5 A;  3MW4 A;  4AGR A;  4K21 A;  2GC0 A;  1SLC A;  5IVV A;  2B46 X;  1W8F A;  4RGK A;  3CBN A;  3I54 A;  1TME 2;  2JD4 A;  2XKO A;  4PIX A;  2JIG A;  1R1Z A;  5CIR A;  3ZMN A;  4OUM A;  4C1W A;  4WVW A;  5CFD B;  2DCT A;  1QH7 A;  5HCH A;  1UY4 A;  2DFC A;  2LM3 A;  3NJZ A;  3ZYR A;  1GZC A;  2O8Q A;  1NZC A;  1GWL A;  4QMA A;  1I5P A;  3ZLI A;  1XU2 A;  4JVA A;  5FQ0 B;  4RN5 A;  2OYZ A;  4B7K A;  1VBC 2;  2IFW A;  5A3P A;  3V0A A;  1RMU 3;  2K0G A;  2OVU A;  3KV6 A;  4Q26 A;  2HEY F;  4N9H A;  1MS5 A;  3CMG A;  4UF0 A;  4FOQ A;  3VBR A;  5ABJ B;  3CO2 A;  2J7M A;  3HVD A;  4LA3 A;  2VOK A;  4XDP A;  2Y6K A;  4WV8 A;  1MS4 A;  3AFK A;  2HWB 3;  4R4Z A;  3H1M A;  4XBN A;  2RJ2 A;  1RMU 2;  2JDU A;  4AFA A;  1LHV A;  4BE3 A;  4KWL A;  1QJF A;  4Q1P A;  2VMI A;  4HL0 A;  4Q8L A;  1AYN 2;  5CFC C;  2VUJ A;  5IYY A;  1QY4 A;  2F17 A;  5C4W A;  3OY8 A;  3K4A A;  4NII A;  4CCL A;  3I8T A;  4YFZ A;  5GLU A;  4NAO A;  3BAL A;  1WWY A;  3U14 A;  2HWD 2;  3ST7 A;  4C1X A;  3NVC A;  1TME 3;  4QKD A;  2GN7 A;  3POI A;  4P9I A;  1MS0 A;  3SH5 A;  3FX3 A;  1GNZ A;  4FVV A;  1JOP A;  1H6X A;  1K5M C;  1FMD 3;  4YNI A;  4I02 A;  2A75 A;  4KG8 A;  4O65 A;  2BEO A;  4SBV A;  2WNE A;  4QX8 A;  3NQH A;  2PQS A;  3MDP A;  4YYO A;  4Q0Q A;  4LK6 A;  1C8M 1;  4FO9 A;  4CCM A;  1RUD 3;  1MQT B;  3NNJ A;  2XVL A;  2P6C A;  1PMH X;  2R07 3;  2ZGT A;  4GB3 2;  4GH4 A;  3UK9 A;  1YFX A;  5AC9 3;  3OUJ A;  5IAV A;  4DEV A;  2FMY A;  5A80 A;  3D3A A;  2D44 A;  2PFW A;  2F4P A;  4LO6 B;  1HLC A;  3MO4 A;  2ETE A;  4Y1V A;  4H2A A;  3WDX A;  2ZGO A;  2WIN B;  2ZTN A;  3ZXE A;  1KJR A;  4QPY A;  4UW3 A;  1MZ5 A;  1O3S A;  4WM8 B;  1J59 A;  2A6X A;  3AM2 A;  3MEP A;  4AVT A;  3WQ0 A;  4XFB A;  4NIG A;  1F35 A;  5IAT A;  3O1V A;  1KFU L;  3S5A A;  1TG7 A;  2H6B A;  4NHK A;  4AQT A;  5BV6 A;  4AAP A;  3O0W A;  1UOF A;  2F6B A;  3N4M A;  4GXL A;  1SBF A;  2WAB A;  1COV 2;  1UZW A;  3OBA A;  1AR9 2;  3KWV A;  1O59 A;  1REE A;  4XJU A;  3K77 A;  4FOY A;  5IK4 A;  3JD7 1;  1HQN A;  4QKN A;  4XDO A;  2BOJ A;  3MYX A;  1RC6 A;  1UO9 A;  3LFM A;  1GOF A;  1VRH 3;  3ZFF B;  2CYF A;  4P9L A;  4DQA A;  4OHX A;  2HWE 1;  4Q4W 2;  5LA0 A;  4AGG A;  1KIT A;  3NRU A;  4XFG A;  4QM9 A;  3RQ0 A;  4EWE A;  2VCM A;  4QHB A;  3MID A;  5IFP A;  4HPK B;  2VZP A;  4GQ7 A;  4AVA A;  1LOD A;  1UOG A;  3RNS A;  1PVC 3;  5H9R A;  3WUC A;  2ZGS A;  2J42 A;  1QF3 A;  3ZMO A;  4K1Z A;  1TMF 2;  1JZ6 A;  3RFR A;  2WYS A;  1EAH 1;  4PI2 A;  4TZD A;  1QJY 3;  2OII A;  1D4V B;  4V2V A;  1ZZ6 A;  4E4H A;  3CLP A;  4GIQ A;  2GME A;  1EYB A;  2Y6L A;  3LGR A;  2HLE A;  1ST8 A;  2J1S A;  3J8F 1;  1XPW A;  4Y3O A;  4HMZ A;  3WNL A;  4WM7 A;  3TWI A;  3IM0 A;  4AI9 A;  5DMY A;  4EN0 A;  5CG8 A;  3OB8 A;  5F5I A;  3WNM A;  4IEU A;  3OBR A;  4WZF A;  4E8C A;  4EN8 B;  1JZ8 A;  2XLA A;  5CEH A;  2JD9 A;  3D8C A;  1PIV 3;  4IEO A;  2VPV A;  4ASL A;  1JYN A;  4IET A;  2JDH A;  2NLR A;  4PI0 A;  1N47 A;  4YW7 A;  4DIN B;  5JSP A;  2I74 A;  1CN1 A;  5G04 L;  2OPK A;  5C5T A;  1ND3 B;  5FZ0 A;  3T2P A;  3WX5 A;  2B5H A;  4N90 A;  4CCN A;  1CAX A;  1YFY A;  3BUC A;  3K75 B;  4IW3 A;  5T55 A;  5A33 B;  2MNG A;  2H0B A;  5D1I A;  3ZKY A;  3MIC A;  5FK8 A;  5I8T A;  3KSC A;  4E8D A;  3ABZ A;  2VNV A;  4IER A;  3CQO A;  1RUJ 1;  2B7Y A;  3H1Y A;  3W5N A;  1W99 A;  1JMU B;  3O5S A;  1BJQ A;  4NVP A;  5L9R A;  1ZBA 2;  3LWC A;  5A3U A;  4OHW A;  1V6L A;  3CNA A;  5LAS A;  1DGW A;  5FRE A;  5A7N A;  3H3U A;  1W6Q B;  1Z7S 3;  2R06 1;  1N3P A;  5FPA A;  2D6M A;  2QQV A;  5FY9 A;  1DU3 D;  2JDY A;  3E6D A;  2JE9 A;  3RYP A;  1ENS A;  1J3Q A;  4MOA A;  2G9F A;  3VBH B;  3JZV A;  1O5U A;  4AI3 A;  4MZU A;  2PXJ A;  4R8H A;  1NG0 A;  3T09 A;  1YUD A;  1RUJ 2;  1WCQ A;  4G4F A;  2CAU A;  1XJA A;  1R09 3;  1G86 A;  3HN3 A;  1LR5 A;  1J3P A;  3A0K A;  4LKS A;  4QDQ A;  1UWW A;  4D69 A;  4URA A;  4RGG A;  2Z2S B;  3I97 A;  4YGB A;  1W2U A;  2V09 A;  5CZK A;  2BFU L;  2CV6 A;  3BTZ A;  5HI0 A;  4E2Q A;  1LB2 A;  3NL1 A;  2W87 A;  3THC A;  2P6H A;  1BBT 1;  3B9I A;  2QCS B;  2OPW A;  3KB5 A;  4K7J A;  4LXL A;  2WQ4 A;  5F8P A;  4FPH A;  1NUK A;  2PHW A;  4BQ3 A;  4CSW A;  3SCH A;  3BGA A;  4CP9 A;  1VPH A;  3ZXG A;  1ND2 B;  4BQ1 A;  2ZEY A;  1W9Y A;  1YCI A;  5DAX A;  1YLL A;  2YRO A;  4IEV A;  5EJ1 B;  5J37 A;  4H7L A;  4NPR A;  4B8E A;  2QZ3 A;  3LE0 A;  5HBA A;  1DGL A;  3AVS A;  5J36 A;  4I3P A;  1J1T A;  1YO8 A;  3MIH A;  2ZJC A;  3KS7 A;  1L7L A;  1MS9 A;  4Q4V 3;  3USU A;  3JU9 A;  2ZX4 A;  2ZXQ A;  1RUG 3;  1SLL A;  4IDZ A;  1JOB A;  4IES A;  1HN1 A;  4M00 A;  4UW4 A;  1CAV B;  2RHP A;  4YZ5 A;  1IZ3 A;  4XOG A;  5IVB A;  1NXM A;  3TEY A;  5AFE A;  4FI9 A;  4LBL A;  5IVC A;  4CCO A;  1WLT A;  5KXC A;  3WHU A;  3U1X A;  1J1L A;  2VTX J;  3KD4 A;  3WDU A;  2YBK A;  2C26 A;  4LIU A;  4CCD A;  3MF6 A;  3NAP C;  5FYU A;  1TEI A;  1ENR A;  4HSJ A;  5L73 A;  3A22 A;  1XBF A;  3DPR B;  4CZS A;  4NPL A;  3M3Q A;  1KDM A;  2GNM A;  4Y33 A;  2IZW A;  5EIY B;  4ONU A;  4HLT A;  1AYN 1;  1ZVF A;  2CU5 A;  5EYX A;  4QGL A;  4BM8 A;  5FYH A;  3DPR C;  1DYP A;  1FXZ A;  1Y9Q A;  4C0B A;  4KGG A;  5LBF A;  1OF4 A;  1UYY A;  2G9Z A;  3UES A;  2JXA A;  2ZZJ A;  5FYM A;  4A4A A;  2ZEX A;  3MFA A;  3TN9 1;  1PIV 2;  1PNF A;  4KGQ A;  1DG6 A;  3POJ A;  2NM1 A;  5BNP C;  4CDQ A;  1K5M B;  2AZ5 A;  3SXW A;  1E57 A;  4IV1 C;  4K8R B;  3V64 A;  1ALY A;  2HWC 3;  4RHV 1;  3SQO A;  4XBL A;  4PHZ A;  3B01 A;  1IG3 A;  3JQX A;  5HV4 A;  3ZX7 A;  1BVP 1;  2K9Z A;  3NKG A;  4CU8 A;  1FPN 2;  2Q1Z B;  2V73 A;  1JW6 A;  4YVW C;  4RGA A;  3I49 A;  1RUE 2;  4QB6 A;  1W8O A;  5EZW A;  2E53 A;  3ZFE C;  1PNG A;  2VR4 A;  3K2O A;  3ZM8 A;  1ACC A;  2W08 A;  1QXJ A;  1RUI 1;  2VOT A;  2DFB A;  1SEF A;  5ANN A;  3WG4 A;  2FDH A;  1RL3 A;  1QU0 A;  1AL2 1;  2OT7 A;  2VZ1 A;  4GWI A;  4FAH A;  1JS9 A;  2P17 A;  3H1W A;  2TUN A;  5J1X A;  4A2U A;  1K42 A;  2A71 A;  4CDX C;  2H0V A;  4YW3 A;  2QQJ A;  2RR1 1;  1XE7 A;  2Y38 A;  4PLN A;  4KL1 A;  1V6N A;  2W52 A;  2XBO 3;  3B3Q E;  4OI2 A;  4B3N A;  4PBP A;  5F3E A;  1U12 A;  3URF A;  1TVG A;  4XUP A;  2PLV 1;  4UI9 L;  4FTB A;  2EXK A;  1IS4 A;  4W6Y A;  5IWF A;  3ZFF A;  4FPK A;  3I2H A;  4LKF A;  4QU2 A;  3WZ1 A;  2WZR 3;  4EWA A;  4BIF A;  5FPZ A;  3ZFE B;  2JEN A;  5EYY A;  3Q8A A;  4QKB A;  1KJL A;  3KCY A;  4BPZ A;  3TEZ A;  2RS5 2;  3ILR A;  2A7A A;  1S2K A;  4KWK A;  1RB8 G;  2VZS A;  4BQ5 A;  1S0B A;  3B93 A;  4JX0 A;  5LK7 B;  5JIA A;  2BDR A;  3K3O A;  4JCK A;  5FZ7 A;  2Q8C A;  1STM A;  5F9T A;  1LOB A;  2QQM A;  1IHM A;  1PK6 C;  5IK8 A;  3I4I A;  3ZVX A;  2O8O A;  3OD4 A;  3UKN A;  5BNQ A;  3LKJ A;  1VAK A;  4FFI A;  2QQW A;  4QQ2 A;  3RWK X;  2WNO A;  3OBT A;  3THD A;  1WW4 A;  5EXO A;  3C7H A;  1UZZ A;  2Y6J A;  3AZZ A;  5FYS A;  1LOC A;  1DP0 A;  3VHP A;  1S0I A;  3LIG A;  4ZU7 A;  1UMI A;  4UWD A;  5SV8 A;  1NY7 1;  3WDY A;  4FFH A;  5C5U A;  3ZFE A;  1PMJ X;  1ZBA 3;  3POY A;  2WYF A;  2ZKL A;  2QFE A;  2DVF A;  2RS1 1;  4QX1 A;  2YU1 A;  3KGZ A;  1V9U 2;  5C9A C;  3V0B B;  5J7M A;  1RUI 2;  1H1M A;  4ARX A;  4XQ4 A;  4EZ4 A;  3RS6 A;  2QQI A;  5FO8 B;  3D4K A;  3H8U A;  4A3Z A;  4MGY E;  2WS9 1;  1O8S A;  2WT2 A;  1YI9 A;  3OGV A;  3PVE A;  1NY7 2;  3AXD A;  3KZ4 C;  3VN4 A;  1V6M A;  3ZFF C;  5FQ0 A;  4C90 A;  3T2Q A;  1H2N A;  3TEX A;  1RIR A;  3HJR A;  5IK5 A;  2R04 2;  4XFA A;  5CFD A;  1FAY A;  4RD7 A;  4CUA A;  5ABJ A;  3ZSJ A;  1W3X A;  5FY5 A;  1WUV A;  1DCS A;  4B4Q A;  2WNU B;  1MZ6 A;  1F5F A;  2ZS6 B;  5I8Y A;  3M1H A;  2EXJ A;  5DAV A;  4IV1 B;  5FZK A;  5J98 B;  3W21 A;  5LBE A;  1UCX A;  5FFO C;  3OPT A;  4JKK A;  3WDT A;  1QJY 2;  5JOY A;  1AR6 3;  1HRI 1;  3QH6 A;  3FLP A;  5HCF A;  3RZK A;  1W6N B;  3RZZ A;  4FT8 A;  4Q29 A;  4D6S A;  5A1L A;  3T2T A;  5FYC A;  5IK7 A;  2VU9 A;  3U78 A;  4CCE A;  4K6B A;  2FCU A;  4FCA A;  5FMC A;  4NRQ A;  5JVV A;  4PLO A;  5FPB A;  5FPX A;  3RZH A;  3NST A;  5ACA 1;  3H42 B;  2ZX0 A;  5JPN B;  2VCA A;  3WVJ A;  1OOP C;  3C7F A;  3ME2 A;  2WA3 A;  5AVA A;  2IFR A;  2ZML A;  5FZD A;  3VKF C;  1SLB A;  3LB9 A;  3M3C A;  3OY8 B;  4AVB A;  1LAJ A;  3MUY 1;  1ENQ A;  4NPM A;  2WDB A;  2VL4 A;  5C4W C;  1UU5 A;  2IXL A;  4J1W A;  4NHM A;  4FTS A;  1OFS A;  3NV2 A;  3POW A;  3FFQ A;  4XFI A;  2CWS A;  2D98 A;  3I2I A;  4XW3 A;  2OKX A;  1MQT A;  2VTF A;  3ROU A;  1CD3 G;  2IXI A;  3TYJ A;  3AP4 A;  4AFC A;  2W1Q A;  4Y5S A;  2J22 A;  1W6O A;  1GZW A;  1VBB 1;  1GZT A;  2PA7 A;  4FPC A;  1UU6 A;  4P9J A;  4L11 A;  3WQ1 A;  1OPO A;  5A3T A;  1QH6 A;  4IEP A;  1QWR A;  1D4M 1;  3VZM A;  2ORX A;  1XSR A;  1W0O A;  1VP6 A;  2RMU 2;  2C1F A;  2W39 A;  2AEN A;  2HWD 1;  3WDW A;  3SMH A;  1ULF A;  4OHZ A;  4OYU A;  4XBQ A;  4AI0 A;  4CCC A;  2VY0 A;  3P6B A;  2XG3 A;  2ARE A;  5CKM A;  5DAP A;  3HD8 B;  2NQY A;  4I3G A;  5FXW A;  3WF1 A;  1LHN A;  4F8A A;  4QPI C;  2P37 A;  4Q8K A;  2EIC A;  1GZ9 A;  2C0Z A;  2ZGL A;  5AC9 2;  3EJK A;  5E89 A;  1GP4 A;  3FLT A;  3OBZ A;  4SLI A;  3O0V A;  5KHK A;  5K4L A;  2VME A;  3CJI B;  3AZW A;  4CUC A;  2JE8 A;  2WBK A;  3USS A;  3BOD A;  2O1Q A;  3TEW A;  2F4L A;  1EPW A;  4LHL A;  2XJS A;  5FZL A;  1GWK A;  2GH8 A;  2VO5 A;  1NA1 B;  4Q4V 2;  3UYJ A;  1KRI A;  3LA3 A;  2PHU A;  4X8N A;  2ARB A;  3PVN A;  4ZKT B;  1YQ5 A;  2B8M A;  1VBD 3;  2JB4 A;  1LHU A;  2DBI A;  2VH9 A;  3IT8 A;  4CDU A;  2P2K A;  4YW1 A;  5IVF A;  5HXV A;  1O3R A;  1OQD A;  2YYO A;  2B9V A;  2JG8 C;  3CU7 A;  1IKQ A;  4QXC A;  1KS4 A;  1TNF A;  4AFM A;  4AW7 A;  1GIC A;  3AP6 A;  5ABJ C;  3MPP G;  1UW8 A;  1IPJ A;  1Y9M A;  2E9Q A;  5CIS A;  3GZU C;  1TZO A;  2G19 A;  4IL7 A;  4CTE A;  2C9A A;  1QJZ A;  3N7L A;  3LEI A;  3IIA A;  4N7U A;  1BCX A;  1US3 A;  2I45 A;  3IWZ A;  4QWN A;  2WZR 2;  3EO6 A;  3WV6 A;  5L7O A;  3I2O A;  1QQP 3;  3RRD A;  3C7O A;  4CDQ B;  2QVS B;  3RMX A;  4AXO A;  3CZU A;  2QBX A;  4F83 A;  3LDK A;  3SKJ E;  3BYW A;  3JUU A;  3M3E A;  4AED B;  1VBC 3;  3OGJ A;  4QQH A;  3VLB B;  1N1Y A;  2ZGR A;  3O1P A;  1VAV A;  2SLI A;  3CKH A;  4BIS A;  3JBG 3;  1SLI A;  3PU3 A;  1QXP A;  1FYU A;  4XF0 A;  2GU9 A;  3LAG A;  2OUJ A;  3PME A;  4Y4R A;  1OA3 A;  1SLT A;  1EAH 2;  3HIF A;  4S2G A;  1DF0 A;  2VW0 A;  3DF0 A;  4NE9 A;  1LU1 A;  3N9O A;  1F2N A;  3BPZ A;  3ZFG A;  4B1L A;  1SQ4 A;  1AJO A;  4R9B A;  4D94 A;  1SPP B;  3C2U A;  4HVR A;  4AQS A;  4YM3 A;  4BME A;  1YQC A;  5FZC A;  4CCJ A;  2ILM A;  5CB7 A;  3AMM A;  1PO2 2;  1JU3 A;  2EAA A;  2CDP A;  2OZJ A;  2GH2 A;  4JGZ B;  2DUO A;  4A7Z A;  1IPS A;  4Q4Y 1;  3SCG A;  1V9U 1;  2R1B A;  3I3D A;  2D43 A;  4CYD A;  2BFU S;  5A7Q A;  1AR7 2;  1NCR C;  4FXK B;  2FBE A;  4IEZ A;  2ZHL A;  4CDW C;  1GP6 A;  3KT4 A;  1H9P A;  2W95 A;  4QHO A;  1ZZ7 A;  1CIW A;  5FP8 A;  4EE2 A;  1NA1 A;  5A3N A;  2WAO A;  3POS A;  3ZDV A;  2MPF A;  1QDC A;  1NCQ C;  2WA4 A;  3LEK A;  1XNT A;  1CQ9 A;  3VD9 A;  5D8A C;  1UKR A;  1VBA 1;  4FPF A;  1LU2 A;  4HN0 A;  4W65 A;  3DXU A;  1AXK A;  4I0W B;  5C3R A;  3N7M A;  5A7P A;  4Z07 A;  3T4V A;  4YZ3 A;  4NHL A;  1ZBE 3;  4JHT A;  5F6L B;  2A73 B;  2JDZ A;  3T2O A;  4ES8 A;  5CA6 A;  1ZBE 2;  1WLC A;  1LGC A;  4AE2 A;  2R06 2;  3ZN6 B;  4X6Q B;  3RJR A;  5FR3 A;  5HPO A;  4GKY A;  1SCS A;  2X53 S;  2B4K A;  4I30 A;  4JGZ A;  1JUH A;  1AXY A;  2BNM A;  5C3Q A;  5A6Z A;  4GH4 B;  5FY0 A;  3SH4 A;  1I1E A;  1W05 A;  3W5M A;  3NNG A;  3HQX A;  2RMU 3;  4IGQ A;  4UOJ A;  4O61 A;  3SIS A;  3ZPO A;  2UY8 A;  1WMX A;  4BQW A;  5BNN B;  4B7E A;  1AVB A;  4EN6 B;  3DUI A;  1IS3 A;  3AXE A;  3OEA A;  2YPD A;  1BEV 2;  3LA2 A;  5FKC A;  1NE6 A;  4UF0 B;  1AR7 3;  1U0A A;  2D6N A;  4P9X A;  1ODM A;  3MF9 A;  5JOZ A;  2P34 A;  1OMI A;  5FYY A;  4K40 A;  4CXX A;  4M3C A;  5IVE A;  3MFC A;  1CAV A;  2BWA A;  2YC2 A;  4UFI A;  3HNM A;  4D8M A;  5JMO A;  3ZXJ A;  4WVM A;  1SLA A;  4IV1 A;  1NQD A;  3FE5 A;  4E27 A;  1VB4 A;  1QEX A;  4GD4 A;  5CKN A;  4QT6 A;  3OGS A;  1AYM 3;  2WFF 3;  2RDN A;  4NIA A;  2B9U A;  4HVO A;  2VMG A;  1HRV 2;  3OEB A;  5DDJ 2;  1D2S A;  2VM9 A;  5CKQ A;  2RM2 1;  3GCW A;  2VNR A;  1XYN A;  3H50 A;  4PF1 A;  3B94 A;  5DUX A;  3TRS B;  3VKL A;  2VBD A;  2QQP A;  4CPB D;  5JPM B;  1FV3 A;  3S30 A;  1BQP A;  2HWF 1;  1DLL A;  3BCW A;  4CP2 A;  2Q5T A;  1W9S A;  2Q1F A;  4M4R A;  3ZR6 A;  5A1A A;  3Q8E A;  4XVH A;  1PK6 A;  1GKB A;  5JR7 B;  1JUI A;  2WUH A;  3U07 A;  3WCR A;  2HWE 3;  4LMF A;  1O6U A;  4LUK A;  3VBR C;  4OI1 A;  4AG4 A;  5GM0 A;  1AHS A;  1HB4 A;  4W6X A;  3U11 A;  3MBW A;  2PHF A;  2Y6G A;  3TB0 A;  4P08 A;  2VVE A;  3VKM A;  4A41 A;  4F3J A;  4QX0 A;  4E4S A;  5FLH A;  4FOV A;  4BH9 A;  4PJY A;  3FHQ A;  4HFS A;  4YWA A;  3ZN6 A;  1AR9 1;  1R08 2;  2VD7 A;  3I3Q A;  2QQN A;  2XOM A;  1F31 A;  3ACF A;  1OVS A;  3GGL A;  3OPW A;  4Q0U A;  3AYA A;  4MGT A;  3NNM A;  3IPV A;  1DZT A;  4Z92 B;  3BVC A;  3FBM A;  1X50 A;  4YW2 A;  3ZYG A;  5E88 A;  4NJ4 A;  3ZFG C;  1WCK A;  4XE9 A;  4CE8 A;  3MI8 A;  1OKQ A;  2C4X A;  4XPV A;  5FY1 A;  5FXV A;  1PIV 1;  3PIJ A;  4ZPI A;  4LKD A;  2XJQ A;  1AXZ A;  3HBZ A;  5T5P A;  3DGT A;  3V65 A;  1HB3 A;  2CGP A;  2VBP A;  1CAX B;  2UYA A;  2OUH A;  1DIW A;  1FV2 A;  1O91 A;  2QDR A;  2ARA A;  5F5Q A;  1V6I A;  3VBS A;  2VUD A;  2R0F A;  2PHD A;  1C4R A;  2VCB A;  1N3Q A;  5LB6 A;  5ISL A;  3WEZ A;  1AF9 A;  1W9F A;  3VDC A;  2I07 B;  5EHD A;  2FDJ A;  1RVF 2;  3WP5 A;  1UY1 A;  4W6W A;  3ETQ A;  2GSY A;  1QXR A;  4RQP A;  4QM8 A;  1DQ4 A;  1YFU A;  1MPX A;  1ULE A;  2NZ9 A;  2VE1 A;  1GNH A;  2JB8 A;  2YGL A;  3F95 A;  1FAT A;  3GJB A;  2HEV F;  4QQO A;  4V2W A;  4Z82 A;  4DEQ A;  4CDU B;  1HKD A;  4RR3 C;  2PQQ A;  1Z7S 1;  2R1D A;  3SEE A;  1EV1 3;  4ERO A;  4JAA A;  2HEW F;  4LR4 A;  3TOJ A;  4IUG A;  1M4W A;  4AR2 A;  2AYH A;  2JE7 A;  2LS6 A;  2JJ6 A;  3AYE A;  2RS3 3;  3I2J A;  1J3R A;  1AYM 2;  3RYR A;  3MIE A;  5G05 L;  5LA2 A;  1H30 A;  3FN9 A;  4YW5 A;  1G7Y A;  2W47 A;  4PDW A;  4WM7 B;  1UYX A;  3WIN E;  3QOP A;  4PF5 A;  5FO9 B;  2PLV 2;  2ZGQ A;  5DUV A;  2NN8 A;  2JEC A;  2WRA A;  2XB6 C;  3C8X A;  3LDR A;  1R09 1;  3RVH A;  4ZY9 A;  2ENR A;  2V4A A;  2ZZQ A;  1W90 A;  4YVS A;  4IE7 A;  3IAQ A;  1R08 1;  3J9S A;  1R1A 3;  4Q4X 2;  2BW8 A;  4OUL A;  4QKF A;  2GP3 A;  1W8T A;  2JKX A;  4BOW A;  4XCB A;  3PUS A;  1HXS 1;  3PHM A;  1POV 0;  1XC6 A;  5DZF A;  3IDC B;  4GUL A;  4PBO A;  4G9S B;  5EV7 A;  2GMM A;  1EV1 2;  1KEX A;  4QXK A;  5F7U A;  2BP6 A;  2VQA A;  4URT A;  4AQ6 A;  1EUU A;  1RUE 1;  3JQW A;  3HQU A;  3OOX A;  2HWB 1;  3VD4 A;  1RUH 2;  4ISQ A;  3ALQ A;  5GZF A;  1H0B A;  4D7S A;  1GU3 A;  5DN2 A;  2DVB A;  5KXD A;  4AFB A;  1VMF A;  1HV0 A;  3N36 A;  5D8A A;  3K51 A;  4QPW A;  2R04 3;  5T5L A;  3AMP A;  4NN0 A;  1ZM1 A;  2CGO A;  3G6J B;  5GLW A;  3KM5 A;  1L3J A;  4J25 A;  4XET A;  3SH3 A;  1WMF A;  3ATG A;  1CX4 A;  2Z5W A;  4RYD A;  3PNA A;  1MEC 2;  1SFN A;  5CNA A;  2UU8 A;  3HPN A;  2X29 A;  2NMN A;  4IV3 B;  1WCD J;  4AHW A;  3FMG A;  2CDO A;  4CU7 A;  4ZXE A;  1S4C A;  1D2Q A;  5GZE A;  4AI1 A;  3B9C A;  5L7O B;  2L9L A;  3ZIX A;  3J7L A;  4FAG A;  2WLP A;  1EY2 A;  5K8S A;  4OMD A;  2PAK A;  1HB2 A;  1A8D A;  1MS1 A;  2VOX A;  2W46 A;  4LA2 A;  1OVP A;  1U5Y A;  4BWO A;  1YIP A;  2VQ0 A;  4OZX A;  3GCX A;  1VBE 3;  1LUL A;  1OFN A;  1PO2 3;  2YBP A;  4XHX A;  4ATF A;  1VBB 2;  3AKP A;  3ILF A;  3K3N A;  1AYN 3;  2FD8 A;  1UL9 A;  4QU1 A;  1ND2 A;  1JI6 A;  3BB6 A;  4TWT A;  1K5J A;  2GND A;  1DQ6 A; 
#chains in the Genus database with same CATH homology
 4IDZ A;  2FDH A;  3O1P A;  4QKD A;  4ZS3 A;  4CXW A;  4NPM A;  4IE5 A;  4QHO A;  4RFR B;  2FDI A;  2IUW A;  3RZM A;  2FDK A;  4IE6 A;  4NIG A;  4ZHN A;  3BI3 A;  5F8P A;  3T3Y A;  4O7X A;  3O1V A;  4NID A;  3KHB A;  4O61 A;  3S57 A;  5DAB A;  3I3M A;  3H8X A;  3S5A A;  3O1O A;  3I3Q A;  2FDG A;  3H8O A;  4OCT A;  3BTY A;  3RZK A;  4MGT A;  3H8R A;  3RZG A;  3RZH A;  2FDJ A;  3O1R A;  3BUC A;  3O1M A;  2FDF A;  3I2O A;  4NIH A;  4IE7 A;  3KHC A;  3O1U A;  3T4V A;  3BIE A;  3T4H B;  2FD8 A;  4NPL A;  4JHT A;  4IE0 A;  4NJ4 A;  4NRP A;  4NRQ A;  4QKN A;  3O1T A;  4QKF A;  4NRM A;  4NRO A;  4NII A;  4CXX A;  3LFM A;  4CXY A;  3I49 A;  3BKZ A;  3BTX A;  3RZJ A;  3RZL A;  4IE4 A;  4QKB A;  3O1S A;  4MG2 A;  3BU0 A;  4ZS2 A;  3BTZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...