3T3YA

Crystal structure of alkb in complex with fe(iii) and 2-(3-hydroxypicolinomido)acetic acid
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
199
structure length
199
Chain Sequence
AAGAVILRRFAFNAAEQLIRDINDVASQSPFRQMVTPGGYTMSVAMTNCGHLGWTTHRQGYLYSPIDPQTNKPWPAMPQSFHNLCQRAATAAGYPDFQPDACLINRYAPGAKLSLHQDKDEPDLRAPIVSVSLGLPAIFQFGGLKRNDPLKRLLLEHGDVVVWGGESRLFYHGIQPLKAGFHPLTIDCRYNLTFRQAGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Alpha-ketoglutarate-dependent dioxygenase AlkB
publication title Dynamic combinatorial mass spectrometry leads to inhibitors of a 2-oxoglutarate-dependent nucleic Acid demethylase.
pubmed doi rcsb
source organism Escherichia coli
total genus 47
structure length 199
sequence length 199
ec nomenclature ec 1.14.11.33: DNA oxidative demethylase.
pdb deposition date 2011-07-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.590 Mainly Beta Sandwich Jelly Rolls Alpha-ketoglutarate-dependent dioxygenase AlkB-like 3t3yA00
3I3QA 3RZMA 3H8OA 4IE4A 4CXXA 5F8PA 2FDGA 4QKFA 4JHTA 3BKZA 3S5AA 4MGTA 2FDKA 4MG2A 3BTZA 2FD8A 3BU0A 4CXYA 3BI3A 4NRPA 3T4HB 3RZKA 3H8RA 3O1TA 3RZGA 3RZLA 3BTYA 4IE0A 4QKDA 3H8XA 3O1OA 3KHBA 2FDHA 3BIEA 4IE7A 4NPLA 3RZHA 3O1SA 4QHOA 3T4VA 4NRQA 4NPMA 4NIDA 2FDJA 3BUCA 3S57A 3O1UA 4ZS3A 3RZJA 4OCTA 4O7XA 4ZS2A 3O1VA 4ZHNA 4IE6A 2FDFA 2IUWA 4CXWA 4NROA 5DABA 4RFRB 4QKNA 3O1PA 3O1RA 3I2OA 4NIGA 4NJ4A 4QKBA 4IE5A 3I49A 4NIIA 3I3MA 4NIHA 4IDZA 2FDIA 3O1MA 3T3YA 3BTXA 4NRMA 3LFMA 4O61A 3KHCA
chains in the Genus database with same CATH superfamily
3AKQA 3GHNA 2D98A 3E5UA 5DG2A 1H2MA 1D2QA 4FFFA 1PO21 2DVDA 4QPYA 4PCRA 3ILNA 4B1MA 2IXCA 2ORXA 2DCTA 2UWCA 2WUHA 4G4FA 4PBPA 3N9PA 4CXXA 3FHQA 4Y1XA 4CU8A 3UGFA 3CIHA 2CGPA 1QJY3 3WNPA 5FYIA 1O8PA 4WBBA 2VBBA 4YW6A 2P3YA 2NM1A 3IDBB 1H8TC 3WX5A 2P6CA 1BK0A 1FV3A 4JGYC 2YGLA 4XDPA 3TNPB 3RZZA 3QOPA 4HMZA 5IVJA 4LHSA 1CAUB 2XMLA 4TLFA 5FP4A 3T4HB 4KWUA 1RUH1 2ZKNA 5F32A 5C9AC 2Y38A 1ENRA 3DECA 5FY9A 5A70A 3RZGA 3JUUA 3Q8BA 2VXRA 2IVJA 4FI9A 3U0ZA 1G86A 2AGSA 3ACGA 4QU2A 1W8FA 4LOSA 1XB9A 2OZJA 3HEIA 4H3WA 3JB4C 4AVAA 4NAOA 3VDDC 3B3QE 1W8HA 4K8RB 5GLTA 4Y5Z0 3GBWA 2E53A 2VC9A 2ZEZA 3Q8EA 1DBNA 2XVGA 4LHLA 5A3TA 1XJAA 1ODMA 1H2KA 2YFUA 5FPZA 5LA9A 1CWPA 3MIEA 4JGZC 2UWBA 2OW4A 4LK6A 3K48A 4JQRA 1E57A 1OPOA 4CEWC 1FAYA 2VW1A 3D6EA 1V9U3 3FN9A 1EY2A 3E1F1 2VZOA 1GFF2 2WS93 2WO3A 3OPZA 1YCIA 5FY0A 3L9JT 4ASLA 3AFKA 3WP6A 4P9JA 1KGYA 3NAPB 1AR82 1AX1A 1PZ9A 1WGPA 3IAPA 3LPGA 1GP6A 1JBCA 3PTRB 2PLV3 4RR3A 3NV2A 1GWKA 1W99A 3VBOA 3BOPA 2PELA 3GCWA 5L19A 1IOAA 2P3IA 2VOKA 3LDBA 2YXSA 4MGQA 3S57A 4HBNA 3IMNA 1W6PA 2Q8OA 4NHLA 3EO6A 2YC0A 4JDMA 1TQ5A 2CU5A 4R4ZA 3HOBA 3AXEA 2LUWA 5G05L 2GC0A 5CADA 5AVAA 2XG3A 2EF6A 1NZIA 1SFYA 4OI1A 3M3IA 4Q4Y1 2ZXQA 3K4DA 4PQQA 3H9AA 3FBYA 1HV1A 3AYCA 3U07A 5CFDA 1ZYBA 1ND2C 1A78A 1KEXA 3PVOA 4IV3A 4QKNA 5JDBA 5IK7A 3JB8A 3NKGA 5T3NA 2DWRA 5K8SA 2YHJA 4LO6B 2A3YA 4AI1A 4CTEA 3AZZA 5I8SA 2TNFA 3J8F2 4AI0A 2WNUB 4X6QB 1WLTA 1PVC2 3GDBA 3NJVA 4MHUA 2AZ5A 3IPVA 1HRV1 4GZ9A 1UZYA 5C8CC 2BVBA 1T2XA 1NCRC 3LDKA 1NXMA 1PIV3 3W58A 5IFTA 5JOYA 2E7TA 5FXVA 3I97A 2FDIA 4P02B 1J3RA 4E8CA 1VBE1 3T0DA 1WW6A 3BTXA 2YGMA 3LAGA 2XBO3 2XVLA 2RDNA 4O61A 4NRMA 4OHZA 2NP0A 4R9DA 3SNMA 3F95A 5I8YA 2J1RA 5LBBA 3WP4A 3LEKA 4Q0PA 1HV0A 3KQ4B 3HN1A 2RVAA 4MH0E 1VLNA 5J1XA 1IHMA 2FCUA 3H8OA 1R64A 4WVVA 5GJ6A 1BYHA 3IT8A 4HONA 1C4RA 3BALA 4Y3OA 2BTVC 2EVXA 3MIHA 2FCTA 1YYNA 5FQ0A 2HWF3 3S5AA 1XNAA 3BU7A 3C2UA 2R1BA 1LESA 3NKTA 5DDJ1 5FWEA 2ARAA 1SG3A 2WQ8A 2QQPA 4GMP0 2DVBA 4YPJA 4QWNA 4I02A 3UETA 4FTBA 1SCSA 4OHYA 1TMF3 2B9UA 3X29B 1F9KA 3WQ0A 4HLTA 5FPUA 4XYXA 3CNAA 4Q4V1 4AEKA 1VP6A 4FFGA 5DQ0A 4RGGA 1RUE2 2J1TA 3P3NA 3ZSMA 3POIA 4CCJA 3BTAA 3KWVA 3VKOA 1R1A3 4HFSA 3U4SA 5IVVA 1CR7A 2WZEA 3AJZA 4RHV2 3MW3A 1LTEA 4GULA 1GSLA 5CFCA 3W59A 4K21A 3I2KA 3H8XA 1PO22 1UCXA 4AFAA 1X33A 3C7HA 1CJDA 1UL9A 5CU1A 1DQ2A 2PHFA 3ZN5A 1HB3A 4QM8A 5FDBA 4RN5A 2A73B 2EXHA 2P3KA 1UMHA 5FUIA 3W9AA 3ZDVA 3ZKUA 4AHXA 2I2SA 2IXJA 2RM23 1W8NA 1NA1C 2R0FA 3JD71 4ZPIA 1VB4A 3WT3A 3WDXA 4NPLA 5FK8A 5GLVA 2CTVA 4RSUA 4QX1A 5CKMA 5FJKA 1UMZA 3AM2A 4UAPA 5F37A 4DPNA 1DYOA 3SEPA 4BB3A 1O5UA 1BEV3 4XMIA 1RUH2 4MSVA 4HK8A 3AK0A 4CEWB 1UY2A 1PMIA 4XUNA 1W2TA 2ZCWA 2WBKA 1QDOA 5ABJC 2Y8KA 1MQTA 2YFZA 1CPMA 2XOMA 4Q27A 4UXAA 3V0BB 2JDAA 5JAXA 2ZMKA 2R063 1ZA4A 4FQ4A 4ZS2A 3ZDSA 5ISLA 1YRZA 1MR5A 4JHZA 3MZHA 4NHMA 1RVF3 3E6DA 1QDCA 1NXD1 4EROA 5AC93 5HCBA 1OPMA 3BGAA 1RYYA 5BNPA 3GJBA 3VBOC 4ZZ8A 3O1PA 2VPVA 4N7IA 1GZTA 1LJ7A 4RGAA 1GNHA 5F2SA 1ZRCA 3TEXA 3TN91 2BU9A 4LHKA 2GZWA 4N53B 4YW5A 1WCKA 4FPLA 5FBZA 4AK3A 2CWMA 3OF1A 1NG0A 3IB3A 3HD8B 3PU3A 1DF0A 5LEKA 3AVRA 4J25A 5IT6A 2DVGA 5FPXA 4IEVA 5LCWL 4IDZA 3CL1A 1C8M1 1RUD3 2VUJA 1HB4A 4W6YA 3FUQA 1M4WA 5FXZA 4BH9A 4BQ3A 1IS3A 1IPJA 2BEOA 3O12A 1H9PA 4QPIC 5E89A 5EXOA 5GLUA 4DOUA 5CFDC 2UY9A 3VD5A 4WVMA 2PAMA 4IV3C 5JR2A 2W1SA 2Y33A 3HT1A 4MXVA 4Z82A 3D0SA 3WG1A 5FO9B 5I0DA 4XF1A 4MV2A 4Y22B 5D1IA 3ILFA 3A0NA 1NCRB 4UT5A 1AUYA 4Q4Y2 4AWDA 4XF3A 1JU3A 5FZDA 2JXAA 3PUSA 2K0GA 2JDYA 5J36A 5LA0A 1MACA 4ISQA 2NLRA 2FDGA 2IXIA 3KV4A 2AEZA 3ES1A 4MGTA 1L7QA 1YJLA 5EWSA 5A3NA 1LEMA 2XONA 2ZHKA 5IAXA 3BB6A 4DB5A 2ILMA 3TEZA 1XQNA 1W9FA 3PJQA 2ZJCA 3AZYA 1DFQA 4YVWA 4MVTA 5A7OA 4XZUG 1HRV2 1VALA 1ZZ7A 1DQ4A 2LALA 2O8QA 3K46A 1QJY1 3B9CA 3ABZA 3W20A 2RS13 1VBE2 2FCVA 4XACA 1AL21 2W95A 3ATGA 2OVUA 5IYYA 4CU6A 1H4HA 1NCQA 2EICA 3LSDA 1WZXA 4JVAA 3E5XA 4MGZE 3M8LA 2HYKA 1RUJ1 2JDHA 3R4SA 4RQPB 1PX4A 1I6XA 2BV4A 4XFCA 2J1EA 1W8OA 1ENSA 1WW4A 1HXS1 3WF2A 1H1AA 2XH6A 1IGOA 4HT1T 4B7EA 5DDJ2 1Q8QA 1S0EA 2A75A 3NNLA 2OUHA 1VRH3 4XQ4A 4P5YA 2JEMA 1D4M3 1OH3A 3KGZA 1WLDA 2NMOA 3QH6A 1JYWA 1IPSA 1VBB3 2AUYA 3RZHA 3WD5A 4Q4V2 5FZFA 4NPMA 1NA1B 1YQ2A 4S2GA 1TE1B 5FKCA 2E7QA 2NN8A 3A23A 3N9MA 5KHKA 2R16A 3MLLA 3H3LA 1OFNA 1V9U1 3CDZB 1J83A 2XWBB 3USUB 2R7EB 5J48A 2WS91 5CAZA 4ZS3A 5FP7A 2Y6HA 4LBJA 1WMDA 3I3DA 3SCHA 5FZGA 4A7YA 2RJ2A 5ANQA 3O0WA 4JCKA 4CDUB 2PLV1 1YC61 4DS0A 2WL1A 2FDFA 1D4VB 3J7NA 4LORA 3RNSA 1BVP1 2CDOA 3LB9A 4P14A 3RQ0A 3M3CA 1BLZA 2D6PA 5FZ0A 1V6NA 3VZNA 5L7OA 2BBVA 4KH9A 3I2IA 3IWZA 3JD72 4J1XA 3ZXFA 4EN9B 5ABJB 1Q8SA 3UYJA 2CHHA 5IK8A 4N90A 4MGSA 3Q8CA 1WMFA 2Y0OA 4CPBD 2DF7A 2C4XA 2HWE3 4IE5A 4XW3A 1YFXA 4CCDA 5H9PA 4NIIA 3KZ4C 2JENA 4W4ZA 3RMYA 4XUPA 1XE7A 2Y60A 1MS1A 2IFWA 1YNAA 3VDBA 1UY1A 4FPYA 4YGDA 4BWOA 3I3MA 2NMNA 2UYBA 4YGCA 3DXTA 3FJSA 1S0JA 1PM7A 1GR3A 1NE6A 4MHRA 1BQPA 1R091 4JQTA 2VGDA 1BCXA 3SXWA 1JOPA 3J7LA 3PHMA 1S2BA 2CNAA 3FLTA 4HKLA 1W6QB 2B7YA 2AREA 3NRUA 2CWSA 2XR4A 2GC1A 1PIV1 1W2UA 1S0IA 2EALA 3NJYA 2ZX4A 3WDYA 4L99A 2I45A 5FPVA 4QPIB 1W6MA 1BKZA 3WDUA 3ZFEA 2D3SA 3JBG3 5BNOC 4XFHA 4JV4A 3IBMA 2WQ4A 5FMOS 1IPKA 2XBO1 1YO8A 1NLRA 2B5HA 4YNIA 5FAXA 4UW3A 2BYVE 3VKLA 2XL7A 4XMAA 3TN92 1AJOA 3HAGA 2EXIA 3MDPA 2GU9A 3FFZA 4Y5TA 4G3YC 5JXGA 1RC6A 3WVJA 2AC1A 4HANA 1WLCA 3CBNA 2HWF1 4FPCA 1OSGA 1FYUA 5FLHA 3ZYPA 4FOWA 3G6JB 2R6QA 3OUHA 4LPLA 4JRLA 2WZPP 3THCA 1POV0 2N7GA 3N35A 4CYDA 5KBFA 1JZ2A 3RZLA 2OZ6A 4LBLA 1SEFA 5JXJA 3MPBA 4JX0A 3EHKA 3IIAA 5FYZA 4EWEA 4BA6A 2F4PA 2ZBJA 2OYZA 5CKQA 2P5BA 4F83A 1N3QA 2D43A 2VVDA 5F5IA 4AEDA 1DQ5A 2VJXA 1UIJA 3BYWA 3O1OA 2NQYA 2TBVA 2LTNA 4GH4C 1QNYA 5JXIA 1ND3C 4LBNA 1UYXA 1R1A1 1Y43B 1ZBE3 5A7SA 3UESA 1VR3A 3GHMA 4NAMA 3VL9A 5KC6A 1VAVA 1I9RA 2XWJB 4Y1UA 2PHLA 4D6SA 5IJRA 3RVHA 5JMCA 2HKXA 5GZCA 1G7YA 3OY8A 2ZEXA 2HWD3 4AI3A 5A3MA 5H9SA 4L8QA 1BZWA 3SC7X 2VZSA 5HCAA 2A3XA 1SDDB 3AYDA 4FOQA 5EP9A 4CUCA 5LRSA 4GXLA 4IEYA 5DAQA 2ADDA 3POBA 5IFPA 1KS5A 1QJY2 5DZFA 1RUG1 1OBNA 2IZWA 2BFUS 2JG8A 4MGIE 1OLQA 5A7WA 2EIEA 1JZ6A 2OQ7A 5I0UA 2Q8CA 4CRQA 2XJUA 2Y26A 2ZACA 4XHXA 5CZKA 5DPNA 1RINA 2D97A 2QE3A 1DCSA 2V09A 4H7MA 1TME1 3PUIA 4O7XA 4XJUA 1RUJ2 4XILA 3T4VA 3ASIA 1ENXA 4JDNA 2H0VA 1TNFA 4WZFA 3T2PA 3GYDA 1RUI3 1SACA 3AP5A 3ITQA 1NLSA 5T50A 3MW2A 1YI7A 2P4EA 2RS51 1HXS2 4YZ3A 3VBRA 3VBFA 3VKFC 3WF4A 4OI4A 4ZONA 2VZTA 1HQWA 1KQRA 1REEA 1WA4A 1LECA 2PHWA 4GMP3 2WZ8A 5DAVA 1M06G 2JJ6A 2BWAA 1ZVFA 2R061 1EV13 4B29A 1W03A 3I49A 1P8JA 1RVF1 4EV0A 3P1IA 1MZEA 2YPJA 5AC91 3URFA 2QJVA 4F8AA 3MPPG 3RI9A 1US3A 1Y4WA 5CEHA 1WMEA 3FLRA 4AVBA 1V9U2 3B9IA 1U12A 4AR2A 2WS92 3DKQA 4PDWA 3RWKX 4PLNA 3I3BA 1XOYA 3H50A 3M3QA 2DTWA 2PLV2 4UBGA 3BCWA 1G9AA 3VBSC 5FZOB 3PUQA 4PQ9A 5CKNA 2GAUA 3RZMA 4XUQA 1RUD1 1UY0A 3N7LA 2XLFA 1OOPC 2DFCA 3SCGA 2X05A 1E5IA 2XPJA 1SLBA 2DUOA 2P6HA 5DAPA 3DF0A 1XSRA 1REDA 5FZ9A 1K12A 1K5MA 1O7FA 3UGGA 5CIRA 1AR63 1RXFA 3ZXAC 2VOWA 3KF3A 1O5LA 1DQ1A 3C7OA 1ULGA 2GC2A 4QGNA 5FPLA 1Q56A 3DYPA 1RUF3 4DXZA 2BNNA 3T1MA 3O1TA 1ZZ6A 3POFA 3RFRA 4ASMB 2DV9A 2V72A 4HPKA 1JZ5A 2W91A 1PO13 1W9TA 4UF0B 1YEWA 2YZ4A 2ZGRA 1R092 2VULA 4BMEA 4NR1A 4QB1A 4TZDA 3AL5A 1JU4A 1ENQA 2VZVA 2BPA2 1ASJ3 2XL9A 2Y64A 3VBHA 1PIV2 4W50A 1HQLA 5JIAA 3ZFFA 1UIKA 5FO7B 2G9GA 3C7GA 1RUNA 4BIOA 3LA7A 4ARYA 2ADEA 3LA3A 1VBC3 3CJIB 1UPIA 4Q0VA 1W9WA 2XBO2 3N4MA 3AXDA 1V6JA 4TLGA 4WM8C 4Y1ZA 3V56A 3V65A 1AYN3 5A32B 2RMU3 3ROUA 1JZ4A 4GH4B 5KHGA 2ZMNA 1ND3B 1QH7A 3AMPA 2YDEA 2CV6A 4FT8A 2HBUA 2QKDA 3KQRA 4YG0A 4YFWA 5A3WA 1X7NA 5FYMA 4Q4X3 2HWF2 4AEDC 1O91A 1WMXA 3RS6A 3A4UA 1H1IA 4UFJA 1OVSA 2C5DA 4YGBA 1LU1A 4Z2WA 2Y6LA 2IXLA 2WWJA 3D82A 4XFFA 5HXVA 3WOGA 2DBIA 1D4M1 1TMF2 5C71A 1OH4A 3NVCA 1MVEA 3VBUC 2RDRA 3NV1A 4I0WB 3ZXLA 4XJ9A 3HQUA 4PHZA 1LOEA 2WWUA 1J1LA 1J1TA 2E7AA 1R1A2 1JW6A 1QMJA 1W39A 1VBD3 2VBDA 4HKOA 2ZGUA 4CXWA 1ULCA 4XTPA 1C28A 1CESA 3BN6A 3J8F1 3LEGA 2JG8C 4LLFA 2BGPA 4OYUA 5LASA 1CD3G 1F15A 4IUGA 4A42A 1XNCA 1H0BA 2JIJA 4IEXA 1OLMA 2PAKA 2WSUA 1UY4A 5FIXA 4XETA 4FPKA 1CZSA 1LOAA 2QQMA 5I0SA 2OX0A 3WCSA 2D6MA 3O5SA 3OOXA 3FBMA 3AKSA 2HWE1 2Y0IA 1J84A 4ZXKA 1UPSA 4QXHA 3LQCA 4XBNA 3VBFC 1W0OA 5FY7A 3AZXA 1TME2 3DL3A 2CYFA 4IESA 3T3YA 3MICA 5FZMA 3GZAA 3VZLA 4KMQA 5K7PA 3JZVA 1A6CA 4RS5B 4A45A 1D0HA 1Q3EA 3GJAA 4CCOA 4XAAA 4B7KA 5FMOL 3LFIA 2JICA 4LO8A 4D7YA 5C5TA 3BPZA 1RMU3 2WLPA 3ON7A 3DGTA 3SLIA 5FMCA 1O4ZA 2HEYF 2R32A 5F3GA 3N7KA 1QNWA 4MGKE 4LTAA 4HG6B 1OKOA 1SLTA 1UOJA 2R062 1C1FA 4IV1C 3OBZA 3VBSB 3ZYGA 1YIFA 4K3UA 2PA7A 2Z2SB 1QEXA 1RVF2 3MO4A 1WD3A 4Y22A 5C33A 1RGSA 1YQ6A 3M1HA 2H6BA 5L9BA 5AC92 5LEJA 5JPNB 2OA2A 5A33A 2XXZA 1C57A 1XYOA 3B69A 3JBG1 4AFBA 3W5MA 1HRI3 4KBBA 5FR3A 5IVEA 1X8MA 1W8UA 1AYM3 2KA3A 4QB2A 3UNPA 1PK6B 1F4AA 2ATFA 1LULA 4RYDA 2Y6KA 5FYUA 2ZHLA 4A4AA 4JC1A 3HMYA 2ZX3A 3H7JA 5FZ8A 2JG9A 4LE3A 4PLMA 3M7AA 5DZEA 3ECQA 2VMFA 5DXDA 1RUD2 4MZUA 3LIHA 2ETEA 2FZ1A 4BQWA 5L73A 1W2NA 1DQ0A 2F6BA 4UWDA 4N43A 4YFZA 3AMNA 5BNNB 1K5JA 5IVBA 5KXBA 2HWB3 1EAH3 4YM2A 3WF3A 4XAEA 1W6OB 4GKYA 4M4PA 1YFYA 3AJYA 5CISA 4CDWA 4TYSA 1LOBA 1ZBE1 4Q0QA 5FWJA 4NIDA 3VBHC 3O7OA 1H30A 3ZYJB 3ZFFC 5A6QA 3KCCA 4BXSV 4XF9A 1RUC3 2VW0A 3WW3A 1LGCA 1XNBA 4PBOA 2W9XA 3U14A 3ZN6B 4HN0A 2YB7A 4FPOB 5A80A 2WAOA 3HBKA 3HQXA 1ZX5A 2QQOA 4OMCA 2MPFA 4CCEA 1LR5A 2IUWA 4W6WA 3ZSLA 4Q5OA 3VZMA 3VUOA 1FPN3 2HJIA 1V6LA 4GKXA 4PIYA 1W0NA 3HVDA 3CMGA 1CAXB 1UAIA 3WEZA 3ZFGB 2WSVA 3FMGA 5IVYA 4LUMA 3VBUB 3K77A 4W8JA 4XFAA 5FP3A 4RFT0 2A1XA 5JI7A 1XE8A 1KJRA 2VECA 3FLPA 4AHWA 1RUI1 4OZXA 4AF9A 2VMDA 3VKMA 3ACIA 1O4TA 1LHVA 5D8AB 4CDXA 3NNMA 1POV3 2ZAHA 2E9QA 4WM7B 2WFF3 2ZGQA 4GMP1 4QQPA 3Q8AA 4R9CA 1Z78A 2R073 4Q1PA 5LA1A 1ONAA 2A6YA 1VRH2 2D40A 2J22A 3HQRA 4Q4W3 3WSOA 4AAXA 4LO5B 2F4LA 1D4M2 2GDFA 1U5ZA 4FOVA 4KGQA 4QX2A 4EJRA 3UL2A 2Z42A 3EJKA 3N7MA 3BVCA 3OCPA 3PDQA 3KHCA 1O3SA 4HXCA 2JDKA 4E4HA 2BQPA 1WCDJ 4DUXA 1VMFA 3MEPA 4N7UA 2ZHNA 1QOTA 4D3WA 1UNBA 2GMPA 4FPGA 2C0ZA 5F8PA 5JVVA 4DY5A 5A1LA 2D6LX 1QXJA 1DU3D 5F39A 3R05A 4N9HA 1SPPB 5K0UA 5LB6A 1SDWA 1WUVA 3BTZA 4C8DA 1OD5A 1Q43A 2B8MA 3BU0A 2GNTA 2YY1A 1CAWA 3D4KA 1UU6A 1UN1A 4LT5A 3QLQA 1W6QA 5EQUA 3MF9A 4BQ1A 4XOGA 2BJSA 4ARXA 1C5HA 1RL3A 4YW3A 4ATEA 2VNVA 2HWE2 2XHNA 5E88A 3H8RA 1DQ6A 2AR6A 2FHRA 4IV1B 5FYBA 2EXKA 3CF6E 1MS3A 1YFWA 3NQHA 1U5XA 1AR61 1IZ3A 2X10A 2W92A 3LE0A 1W8TA 4NMIA 4O65A 4PI0A 1V6OA 3WV6A 5FUNA 5JCTA 2XUMA 4E4DX 1JXNA 1RUF1 2Q4SA 1QJU3 3T30A 2GN3A 4TSVA 1AR93 3PMEA 4NN0A 1N1TA 2X5IC 1PO11 3ZM8A 3BIEA 2R30A 3OBAA 4IEUA 3VDAA 1ZREA 4RL7A 3F2ZA 1C3HA 3LEMA 5HBAA 4XEZA 5F5CA 3OJBA 1ASJ1 2OS2A 4A41A 1PGSA 2XKOA 3NO8A 1JODA 3PUHA 4E2SA 1NQJA 2F17A 4XTMA 2Z79A 2H0BA 2BUKA 2PHTA 2JIGA 1CX4A 1H8TB 1DGWA 4E4ZA 1UF2C 3JBG2 3NSTA 4JGYB 1OA4A 2ZS6B 1KD7A 3N9OA 2SBAA 5FPAA 1ZRFA 4JAAA 1UKRA 2A6WA 2WKKA 4XBLA 3K4AA 2JE7A 5ERLA 1JMUB 2XJTA 4QQ2A 2RJLA 5C9AB 1ZBA3 2RMU1 3GBFA 1QJZA 2ZGTA 1W6NA 4A3ZA 4LO7A 1RHI3 4ZZ5A 1JYVA 4QGMA 1PHMA 3M70A 1KFXL 3O1VA 2OQ6A 5L36A 2HLEA 4DEVA 2HEWF 4YZ1A 4Q0UA 4IGPA 3VDDB 4FBFA 2SLIA 4CDWC 2E26A 1Z7S3 4JTNA 4LHNA 2EIDA 5I93A 2QZ2A 3T2TA 4CE8A 3LSEA 4FCAA 4NIGA 5D2AA 4A7ZA 3U75A 4QKBA 1QXPA 5EFUA 4YW1A 5GM0A 4DEQA 4JGZB 3I2DA 2FMDA 3ZXJA 4YRDA 4GJZA 3LOBA 4QDQA 3SQOA 1ZBE2 2FQPA 4UW6A 5F9TA 2W1QA 5IK5A 3N9NA 3I59B 2DU1A 4FPJA 3NNJA 4G9SB 3I54A 3AX4A 3I2FA 5C4WA 2D6KA 2D44A 1NE4A 1O59A 1CIWA 5SV5A 2LW8A 4EZHA 4AVVA 2ZGSA 1JZ8A 2BVVA 4Y20A 1F8VA 3O1MA 2HWD2 1G9CA 1XYNA 4I01A 2WT1A 4YVWC 4XQWA 1ZA7A 1ZZCA 4PF5A 4RR3C 4GALA 4B4QA 3OD0A 3I3QA 3AC0A 3IM0A 5FZ3A 3ZYBA 2RG4A 3ME2A 1V6MA 1QJX1 1ZZ8A 2LRPA 4CDXC 4OUSA 5J3UA 3RYKA 2BOJA 5H9RA 4QKFA 1VAKA 4QT6A 3I2HA 1CAVA 1GWMA 2D6NA 3H3UA 3WW4A 1RB8G 1K45A 1YI9A 1ND2B 2WNEA 1RUI2 2GMMA 2LM3A 3H8UA 5IW0A 3POJA 1MEC3 5SV8A 2MEV3 4DZGA 5DZGA 5T5LA 3N7JA 4DY3A 4KI5M 2VH9A 1DGRN 2PXJA 2GNDA 1EUTA 2BNOA 2VVEA 3RJRA 3UJOA 2QCSB 5C8CB 4SLIA 4UFIA 3MI8A 3FWEA 4XJZA 5FY4A 1FMD1 1W8WA 4YARA 5FYVA 5K0UC 4YVSA 2A5ZA 3ACHA 2DCZA 2P34A 1X50A 1HRI1 5C3OA 4W65A 4UFHA 2TEPA 1FOD3 1MS9A 1OURA 1AYM1 2PYTA 2VQ0A 3KHBA 3KT4A 3POGA 4C1XA 5CG8A 1JHJA 4Y4RA 3EBRA 4UF0A 5DUUA 4AW7A 1BBT3 3EB7A 3HPNA 3GNEA 3VHNA 3DKWA 2PAEA 4BMBA 4INDA 3CQOA 4AQSA 2VQUA 3O14A 3W21A 4CCCA 1O3TA 2CAUA 4FXKB 1NX9A 5F2WA 4IEOA 4YW4A 1Q8PA 4QQOA 4BISA 2WABA 3ZXEA 4S2FA 4HSLA 2X5IB 2AYHA 4Y1YA 1HB1A 4ZY9A 4NRQA 3O0VA 3DPRA 3SEEA 3ZLIA 3E6CC 1S0GA 2W08A 4LBMA 3NW4A 5A1AA 1G9DA 3OB8A 1EAH1 1KFUL 1AR62 5BY5A 3HN3A 4FP3A 5KXDA 3HNYM 3WLUA 1E5SA 2Z5WA 1GLHA 2XHKA 3HT2A 2VD7A 4JZRA 4V2WA 3GF6A 5HV0A 1RUF2 4AOCA 2C1FA 1S55A 4AI2A 2ET7A 1AXKA 4AZZA 1RUC1 2RR13 3BPSA 1WBLA 1PO12 5C6CA 4NWWA 2XGXA 1JYIA 3R6SA 3FHAA 1W9YA 5GZFA 1JYNA 4CEYA 1ASJ2 2BWCA 3OGRA 5T52A 5CFCC 3RDIA 3HJRA 5FK7A 5EYXA 4MYEA 5L9RA 5A3UA 3MFAA 4AG4A 3TRSB 2PHRA 4YWAA 3OEBA 4GA9A 1DZQA 5C3SA 1OC1A 1FPN1 3WNLA 4I0BA 5JWPA 1MZ6A 4PIZA 5IAVA 2VOTA 4U2AA 1MZFA 5FKBA 1NLQA 4BE3A 1XNTA 2IVIB 5DUVA 2RMU2 2Y6JA 5FY5A 2CGOA 2XUEA 1A8MA 3KVBA 4QPGA 5KWRA 1V70A 1Y9QA 1POV1 1AZDA 2R1DA 1H6XA 2WFF1 2EA7A 1OQEA 3FL7A 3K3OA 5FZ7A 5JZGA 2BRTA 5BYNA 2AH2A 2R071 4IE4A 3RPQA 1N1SA 5EPAA 1N47A 3DN7A 4Z8BA 3SKVA 3I3EA 4Q4W1 2WNVA 2MHFA 2KM2A 4M3CA 4CP2A 2HWC3 1MQTC 3SITA 3PIJA 1GZWA 1JYTA 3LEIA 2FDKA 1DZTA 4BJ0A 1O3RA 1S0DA 1XSQA 4RR3B 5M0TA 4R4XA 4L11A 1YIPA 3VBOB 3WHTA 2JE9A 1PMHX 2P1BA 4NRPA 3CHXA 3B93A 4B4RA 4C90A 3UJQA 3O0XA 5JOXA 3N3HA 3ZR6A 1W6PB 1XPWA 2W87A 3NJZA 4YG6A 3RI8A 4Y26A 2ZGOA 5BNPC 2OXBA 1QF3A 3OYWA 5E1RA 2IFRA 2QFEA 3V0AB 1YUDA 4D7SA 1UQXA 4URTA 3WHUA 2J7MA 3ELNA 3ZXDA 3N36A 5FXXA 5KXEA 3NV4A 3B7MA 3ES4A 2QTWB 3IMMA 4BQ4A 5LZ6A 1KXGA 3B94A 4CDQA 1B35A 5CFDB 1PX3A 4IQPA 2O0OA 4Q8LA 3POWA 3U1XA 4O9EA 5J98B 4IV3B 1OA2A 3KGLA 1ZRIA 1WCQA 2NYYA 2ZABA 1QJX2 4I0AA 1LHWA 1ZNPA 2V4VA 1SBFA 2WJSA 1FXZA 3PMSA 4XFIA 5FFOC 2QVSB 2D3PA 4A44A 3VL8A 1F4HA 3BODA 4AQ2A 4D6QA 1OHFA 1U0AA 3EYPA 1YLLA 3CZJA 1RTVA 3MV11 2V4AA 4IE7A 5FTTC 3WF0A 5B2GB 4XJAA 2VR4A 3PVEA 3M2MA 4FAHA 1AR73 1QJU1 1OF3A 2B42B 2G4IA 4AFMA 5L9VA 1AR91 1LHOA 3JXSA 4P9GA 4YVSC 3MV01 4FPEA 1N3OA 4TN7A 3FFQA 4LA3A 4B1LA 4RHV3 4GWJA 5FV3A 1TMF1 4D94A 1W3XA 1Y9GA 5FZHA 5BNNA 1CAUA 3IZOA 1FMD2 1PZ8A 3WINE 4QXBA 3WF1A 4CCKA 2QNKA 5FZKA 5FYSA 1KS4A 4OHVA 4CU9A 3O1UA 3RYRA 2K46A 3ZPOA 5E6HA 2C9KA 3WG3A 1W06A 1GICA 3KLSA 3U37A 2B4KA 3LIGA 1HRI2 2BDRA 1X82A 2WO2A 3AKPA 3ETQA 3FHIB 5FQ0B 3ILRA 3LZZA 2YC2A 3WDTA 1AYM2 3DYMA 4DNYA 5FZEA 2K2SA 2DTYA 4BK5A 3PIGA 1OLRA 2QQLA 3HBZA 4M0NA 4JKKA 3INAA 2PTMA 4RFRB 4AVTA 1NCQC 1RHI1 1GQPA 1PGW1 1H2LA 1VBA3 5CBLA 3WZ1A 1DGWX 1HJGA 2RM21 3AZWA 1DDLA 2W1UA 1D2SA 2FMYA 4Q2FA 2VCBA 2QUOA 2MNGA 4C91A 5A3PA 1Z7S1 1IKQA 2P17A 2WC2A 3ZXGA 1QHDA 5CG9A 1I3HA 3E6BA 4NIHA 4CA9A 4KWKA 2A70A 2I07B 1EAH2 4Q26A 1LEDA 1FNZA 1BEV1 5CFCB 2DVAA 3N9LA 3NAPA 2ZMLA 2J42A 5D21A 4BZ4A 4EWAA 3LWCA 4URAA 1FT9A 2Z4FA 5JMOA 2GALA 2EAAA 4PF1A 1F5JA 5LA2A 3MLKA 4P5HA 1KITA 5C3QA 1NZCA 1LGNA 1SZBA 1W9SA 5AVPA 4E4SA 3SH4A 3Q8FA 1Q8OA 4WM7A 4YW2A 1RUC2 1BVVA 1W28A 5HCFA 4PJYA 5IVFA 1YWKA 2QDNA 1NKGA 1CZVA 1O3QA 3AYEA 4UW5A 3M3EA 3J4UH 4JHTA 4COVA 4Q0SA 4QXKA 1QU0A 2LS6A 2WZR3 2WA3A 4PT6A 4LKEA 4KWLA 1MS8A 4OUEA 1RUOA 3BI3A 3JCIA 4HETA 5KC5A 2VUAA 4QPGC 4QX8A 4YLZA 5L7OC 1FPN2 2XQXA 4FPHA 3RJ2X 4M3CF 4QAWA 1WKYA 2VTXJ 1MQTB 3AMQA 5A7NA 1ULFA 2JKXA 4ITCA 2VMIA 4GJYA 4LULA 2VNRA 2XJRA 3TB0A 3W5NA 2WNUA 1QJEA 1SBDA 4FOYA 2WO7A 1SPPA 4M0HA 2P2KA 5FY8A 4AGVA 4HVQA 3H1WA 3BTYA 4CCMA 2QQWA 1RIRA 4IGQA 2VXJA 2HH9A 4EQVA 1XRUA 3PJYA 4AFCA 2WFF2 5BNPB 1MS4A 4MOAA 1UD1A 3MFCA 3D3AA 4QX0A 4DRRA 2C24A 2R072 2E51A 5J96B 3T0BA 2YC4A 3MW4A 3WXPA 1OF4A 1X36A 4Q4W2 1JH5A 2BNMA 4XIKA 2PQQA 3A0KA 1A8DA 5FMDA 1TZOA 3IN9A 2VOVA 5BNOB 1J3QA 2W52A 3AKRA 5E16A 1GNYA 1FOD1 4I3GA 1N1YA 2GP5A 4CDQC 1B35C 1FI2A 2ZX1A 3ZFEC 1VBE3 1VMHA 4WVMB 5CB7A 3VHRA 2BZDA 1BBT1 2FZ2A 2JDZA 4DIQA 1DZRA 2FDJA 2PN5A 1YJKA 2NPIA 2PHXA 3CU7A 2XJPA 1LENA 2ARBA 2PQSA 3VD4A 3ALQA 2DCJA 4CUGA 4E2QA 3VKNA 2RS11 3DV8A 1C5IA 2DCYA 2CL2A 3PTYA 4BQ5A 1DG6A 5GZDA 1W2AX 3CLPA 4EE2A 5CYYA 1IS4A 5FRAA 3SH3A 1S1AA 3ZSJA 4DQAA 4EYUA 4IEZA 1OQ1A 4AAPA 4DXRA 3PVNA 3NV3A 1AX0A 4NWVA 4V2VA 4A7KA 1NY71 2O14A 2KD7A 2X29A 3I2OA 4LXLA 5LK7B 1ZZBA 3OPWA 2ZTNA 1RJ7A 1YXWA 1QJU2 1ZRRA 2CSGA 4Q4V3 4M00A 4COUA 3WUCA 3RSJA 1AR92 1G9BA 2RR11 2Y6GA 3NWKA 2W3JA 2GH8A 2Q1ZB 3MUZ1 3R4DB 5LRRA 3ZIXA 1VRH1 1ULDA 2A6ZA 4K6BA 1J58A 4M4RA 1GNZA 1NCQB 2HBTA 5F6KA 4AHZA 4EZ4A 1VBB1 3NL1A 1F35A 1OA3A 2PHDA 4XC9A 5EJZB 3M4FA 3THPA 5K9YA 3AYAA 3POEA 3B5LB 2RJKA 1SFPA 5EYYA 4K8FA 3ST7A 2YBKA 4CEWA 4TTGA 1UZZA 1CZTA 2VNOA 2WNOA 3PU8A 3KB5A 2ID4A 3WCRA 1K3IA 1BK1A 1KDKA 2OPWA 2G9FA 3IIIA 3V0BA 2VMHA 3AP9A 4X8PA 3ZOIA 4BOWA 4CDQB 4XPVA 3KM5A 2VTFA 1UXXX 4HK9A 1RHI2 4NIAA 1PGW2 2J1UA 2Q30A 2WRAA 1NYWA 5F3CA 4MG2A 5JUVA 2RM22 4QPWA 2D7FA 3I2JA 2DU0A 3KT1A 3THTA 1VE0A 1SFNA 5APAA 1LAJA 2FD8A 5ACA3 2EIBA 4LEJA 2YG0A 2C6SA 4KBZA 3UKNA 1LHUA 1Z7S2 4B8EA 4BM8A 4CP1A 1QQP3 1RXGA 4ZU4A 5FUPA 4XQDA 5FZ6A 1W90A 1ST8A 3VBRC 3WW2A 2ZGNA 4P9YA 2HWC1 4QQHA 4YZ4A 4C0HA 1ZRDA 4N53A 1BEV2 5JSRA 2VMEA 2ERFA 3H42B 4XF4A 3WDVA 1LOFA 4TXWA 1F2NA 1UZWA 5BXXA 4KQ7A 1ND2A 2QQJA 3IDEA 2AEYA 2L9LA 4XJ8A 5LBEA 4AEMA 3SMHA 1K42A 2K9ZA 5CA6A 3L2YA 5EIYB 2E33A 3LPFA 1RITA 2ZHMA 2QQNA 2A71A 1S0BA 4ASKA 3KVAA 4GWMA 2WDBA 4PDWC 4LA2A 5C8CA 3UKTA 4NOTA 5LY1A 1NCRA 3HIFA 1AX2A 3ZX7A 4PLOA 4LBQB 1OOPB 1H9WA 3RG0A 3DYOA 1DLCA 3KV6A 4IW3A 3DXUA 1YQ8A 1WW7A 2IXHA 4WZCA 1DHKB 3J7HA 2QQUA 5BUVA 1C8M3 3O1SA 1LOCA 3MIBA 5CNAA 3R4UA 4UFLA 4BCUA 2VW2A 3AP7A 2YU2A 2D3RA 1K5MC 4GWNA 4BK4A 1AR71 2E31A 1NT0A 3PLQA 1W6MB 2GSYA 1HN1A 3ZFEB 1UOGA 4ZHNA 1BHGA 4NUBA 3ZVXA 2DCKA 4LMFA 4ONUA 5FZLA 2D5HA 2V73A 1GZ9A 1D0GA 5T54A 2VY0A 1GQGA 1PMJX 4RQPA 3TOJA 1AVBA 1YQCA 4NROA 3UT0A 4UBHA 2BFUL 3CEWA 1UYPA 3ZYRA 4CPBA 5KHJA 4P9IA 1GOHA 1HW5A 1UKGA 5A6XA 1S0CA 3MIFA 3CJXA 5FZAA 5DUXA 2HEVF 4GB33 4LBOA 1UWWA 5J7MA 3AP6A 4GAZA 1FOD2 1JUHA 4UFMA 4AVSA 3JU9A 4WM8B 2X53S 4LBQD 2BERA 2KR2A 1QOOA 1AL23 3MUY1 2JD4A 1BBT2 2HWD1 1UYZA 4KWJA 5J37A 4BQYA 2ZKLA 1VBA1 4QB6A 5FOJB 1LODA 2JD9A 1RUJ3 3ZN4A 4AEDB 3RRDA 1IQDC 1NA1A 2BOIA 1S2KA 2ZX0A 2RS12 3LFMA 3MBWA 1JS9A 5T5OA 5HPOA 4E8DA 4S2DA 3FC0A 3USUA 4L2NA 1HXS3 1X9PA 1HN0A 2UU8A 2CGNA 3GM8A 4OI2A 2BGCA 4R9BA 4H7LA 4Z2AA 3QACA 4XXAA 3OY8B 1NY72 4J1WA 3VLBB 4CDUA 1MVQA 3H3ZA 4CP9B 2J1SA 1JOJA 1XU2A 3MIDA 2VM9A 1HB2A 2ARCA 4FFHA 5JI9A 3VZKA 2VZQA 2RHPA 4QQLA 1OQDA 2RS33 2A6XA 2UYAA 2VCMA 4BHPA 5ABJA 2VUCA 2JG8B 2Z69A 2RR12 4K9SA 5A7WB 1LKNA 4QHBA 3GGLA 4LQRA 1EV11 3EMRA 4OHXA 4XDOA 2VZPA 4Y5SA 3S30A 3OGJA 4D7TA 1QH6A 4OZOA 1VBB2 2W39A 3NNFA 5GZGA 2ZAAA 3KCXA 2ZZJA 2WZR1 4KNCA 4XIOA 5FJHA 1IG3A 4NO4A 4DFSA 1SBEA 1T6GC 1XU1A 2R043 4LKFA 1BMV1 5C5UA 2EAKA 1TNRA 3KT7A 3ZMOA 2GN7A 3VD9A 4NE9A 3VBRB 3VBFB 4NPRA 4F3JA 3VD3A 1V0AA 4OHWA 4DXSA 3WW1A 4DRVA 5JOWA 4IETA 4OFGA 3V0AA 1KJLA 1SQ4A 3ACLA 3OD4A 5F3EA 2XLAA 2B39A 1WLWA 2OIIA 2ZOEB 4KU8A 3TBDA 4MXWB 2VTXA 3AL6A 1GP5A 2JX9A 4N53C 4LLOA 1W2OA 1LOFC 4QPIA 1LB2A 2O1QA 1OLME 1SMVA 1APNA 1SLIA 2CY6A 2VG9A 3QD6A 4NVPA 1HDKA 3QBQA 4BIFA 1EPZA 4XFGA 2UWAA 4O9GA 5F6LB 4L0PA 4QHOA 2ARXA 2WLQA 4PDWB 3I4IA 1N1VA 2Q1FA 5AFBA 2HWC2 5JXHA 5JSPA 4YGEA 1R093 1DP0A 2C9AA 2D6OX 5LWBA 5FLJA 1FNYA 3UKVA 4BYYA 3BUCA 3GCXA 4UFKA 4A6OA 4H2AA 3EXUA 4AVCA 2BP6A 4Q8KA 2KXLA 3KSCA 4PIXA 2ZA9A 4F7ZA 3IAQA 1WD4A 3RWNA 1GP4A 4X8NA 3PL0A 1ALYA 1PNGA 5FZ1A 1DGLA 1UMIA 2WT2A 3LD8A 4ZU5A 4JKLA 4BU2A 2VE1A 1CIYA 1WWYA 1QY4A 1K5MB 2DURA 2EXJA 1ODNA 2RDSA 4CVUA 3VHPA 1VAMA 5A7QA 1I1EA 3ZMNA 4AQTA 5FZ4A 4CP0A 1VJ2A 3O1RA 4COZA 2Q8DA 1T6BX 2B9VA 4YYOA 4YM3A 4D69A 1VBC1 2JG9C 2WR9A 3GZEA 1YHFA 2Q5TA 4DUVA 1OKQA 4FP2A 1JYXA 4HPKB 1GWLA 3L2HA 4QDRA 2GH2A 2XVKA 2BBAA 4Y24A 5FLIA 1AYN1 3R0RA 5GZEA 1QXRA 4IXLA 1AL0G 3TYJA 3J7MA 4N43C 2XB6C 3UGHA 3MGUA 3Q9OA 3UV9A 3WDWA 1O4YA 4IEPA 5C70A 1JZ3A 5DUWA 4RQPC 1AR72 1UOFA 4Q4X1 3VBHB 5FPBA 4Q1RA 3ZFFB 5I0TA 5T55A 1R083 2ZEYA 1H2NA 2TUNA 3AVSA 4OI0A 5FZCA 2ZGKA 4YG3A 4L97A 2B46X 3POSA 3GZUC 3RMXA 1MZ5A 2ZGLA 5BPXA 4ES8A 2VOXA 3OGVA 4OVEA 1H8VA 3OBTA 2HYXA 2C26A 4ES9A 2A3WA 4H55A 3OGGA 4RA0A 5CVRA 4AXOA 3BKZA 2GNMA 3MLJA 4OQ8A 3GBGA 1VBD1 3RGBA 4P9LA 5I8TA 1UX6A 1DIWA 2DDUA 4YM0A 3T2QA 5JLVA 4CXYA 1RUG3 1GKBA 3D8CA 2BW8A 4GD4A 5DG1A 2ZX2A 4JRAA 2EIGA 3WQBA 1GOFA 2LROA 3LGRA 3VZOA 3AP4A 1POQA 1Y3TA 1Y9MA 2JWPA 3DEMA 1TME3 1VBA2 2UURA 4AL9A 3T2OA 2VUDA 2A7AA 3WNKA 4OMDA 4CUBA 4CDUC 4QHZA 3SCFA 2WYFA 4MADA 4COWA 3WY6A 4XVHA 3S7EA 5ACA1 2VZUA 1COV3 5IATA 1QQP1 4LKDA 2RS53 1QWRA 3HNBM 1S4CA 4YM1A 1US2A 4CUAA 3HWJA 1UY3A 4AYUA 4CSWA 2WN3A 1WBFA 3WUDA 2Q0AA 5C3PA 5FZOA 1H4GA 4EWDA 4Y1VA 3H7YA 2BGOA 1A34A 1RMU1 2UY8A 4YW7A 4R52A 1SHWB 3SH5A 1DLLA 1O6UA 1BXHA 3T1LA 4YZ2A 4XABA 1E5HA 2WFPA 4LKSA 1EV12 3S5QA 1WA6X 1N3PA 4K40A 1W8ZA 3CO2A 1JN2P 1HLCA 3PURA 3ZYHA 3P5BA 2WZR2 3TEYA 4XUOA 4E27A 1BMV2 2XDVA 1BJQA 2IXKA 2RDQA 5BNOA 3RZJA 4OCTA 1MPXA 2YUEA 2IC1A 3ZR5A 5DAXA 5F5AA 4BQ2A 4ISRA 4CCNA 2V5YA 5E8AA 3A21A 4U36A 3OPTA 3UK9A 2QBXA 2PMWB 4KG8A 4XUTA 3WQ7A 4NHYA 4P9WA 1I5ZA 4RD7A 5A6YA 2WN2A 4XXPA 1S2EA 3WNMA 1Q8VA 1Z0HA 1UZVA 3AMMA 5EZWA 3ZSEA 2H6CA 5C7GA 5DABA 3I8TA 3J26N 4QMAA 2ZEWA 3E97A 4XCAA 5EJ3A 5GLWA 1VIWB 3N9QA 4FFIA 1AJKA 5JPMB 5A33B 1LU2A 1EYBA 2QQKA 4HZFA 4E9KA 2X8KA 3CJIA 4HVOA 3K3NA 2G9ZA 2I74A 1W0PA 2HWB1 4XHBA 2Y6FA 1CN1A 2CDPA 3GZTB 5A32A 1IS5A 4NHKA 2VMGA 4GH4A 4IEWA 4DUWA 2VAUA 1ND3A 2VCCA 5EV7A 2GP3A 1UU4A 3WR0A 2JG9B 1B09A 4GB31 1SCRA 1QGLA 1GYKA 4DXTA 5T5JA 3WG2A 4Y33A 5FOBB 1L7LA 2DBNA 4N43B 1UW8A 1PNFA 4IERA 4UI9L 2CAVA 1NQDA 1WCUA 2OPKA 2D93A 2XJQA 3APBA 2VQAA 1AR83 1RJ8A 1OVPA 4FPFA 4AQ6A 1NUKA 5KR7A 4XURA 4AI8A 4CDWB 3POYA 3FE5A 2OT7A 3USSA 2J1AA 1VBC2 1IS6A 1XYPA 4EN6B 4OUMA 2JB8A 3OG2A 1LHNA 3FZ3A 3K2OA 4ET7A 1AF9A 1MS0A 1F5FA 4LITA 5FYCA 1AYN2 5FZIA 3D0JA 1GMMA 4ZKTB 1JI6A 2PFWA 4L92A 2YROA 4Q4X2 4ATFA 2O8OA 2QDRA 2RS31 1VB2A 1JUIA 4LOTA 5A7PA 1UZ0A 3U11A 2VL4A 5JSOA 5A3LA 5FP9A 3VDCA 2ZGMA 4L9BA 5JIUA 4CCLA 4S2HA 4BLJA 4BQXA 5C4WC 3J8F3 4HSJA 3QCWA 3QH7A 4YVWB 1PVC3 4CZSA 2FDHA 2JDPA 1TG7A 4QXCA 2WT0A 1SLCA 2R041 5C8WA 4RS5A 3AMHA 1VBD2 4QD2A 4CDXB 4KG0A 5DN2A 2VO5A 2YYOA 3C3VA 5G04L 3LKJA 3WNNA 5HXMA 1FX5A 3OUIA 5IK4A 1IKPA 3VZJA 1ULPA 3OEAA 2JKBA 3THDA 4FTSA 1PZ7A 1HJFA 3VBSA 4A2UA 4HL0A 3OGSA 4MLOA 3TWIA 2D5FA 3G7DA 1GOGA 1HKDA 1OOPA 3NJXA 4LBQA 4K7JA 1AXZA 4LUKA 4QM9A 5LBFA 5ACA2 3H1MA 4LIVA 4IEQA 2GMEA 4SBVA 1CONA 1QQP2 1ZM1A 1DYPA 4XZPA 1PK6A 4QX7A 3VD7A 5FZBA 3RYPA 1C1LA 5K0UB 1UOBA 1O8SA 2E63A 3WP3A 3IPVB 4YSFA 3K75B 3WNXA 1I5PA 1CAWB 3OUJA 5LBCA 3LF7A 4QX3A 5ANNA 1J3PA 4J6GA 1CVNA 2XJSA 1RUE3 5IHRA 1PVXA 1RMU2 4LK7A 2NZ9A 3ACFA 3HNMA 4ZXEA 3TAYA 1PGL1 4QDSA 3LDRA 2OKXA 4I3PA 3OSDA 4MUVA 4N9IA 2W5FA 1E5RA 1HIXA 3ZKYA 1G8WA 1OXCA 1KDMA 2XQRA 4XCBA 1CGPA 1G6NA 4AEJA 1CX1A 1W6OA 4V1PA 5BNQA 1PO23 1JHNA 2WA4A 3AFGA 3S0MA 1AXYA 5LY2A 5FYYA 5JOZA 5B4XA 4NHXA 1HQNA 1C8M2 1YQ5A 4JTOA 2JDMA 4HKWA 2FBEA 4FO9A 4LR4A 5KHHA 4A3XA 1XNDA 1J59A 3C7FA 4WM8A 1ZBA1 3KS7A 4MO3M 5F5QA 4W6XA 1A3KA 3V64A 3DPRC 4LNVA 1GQHA 3CJIC 3WNOA 3ZN6A 1XBFA 4DINB 1PM4A 1UU5A 2Q1MA 2JDNA 2ZZQA 4A6SA 5LK5A 2VZ1A 1RUH3 3K4ZA 3VV1A 1R081 1FATA 2X09A 3K51A 4HN1A 1L7RA 5F3IA 4MX3A 2W46A 2QQIA 2W0XA 2ZGPA 5EJ1B 2W47A 1JYCA 3ZFGA 4HOOA 1CAXA 1LNSA 4LBKA 1UXZA 2HWB2 5FXWA 3S6PA 5FYTA 4D6RA 1GANA 3J9SA 3VBUA 1C8NA 3RZKA 1W6NB 4KU7A 4COYA 4EN8B 4KL1A 4FAGA 5DAWA 2A6VA 3VHOA 4CEYC 4CP9A 2WYSA 1HX6A 3FX3A 3T09A 5D8AA 2WWSA 5KXCA 4GB32 3SKJE 3A7QA 4DO0A 1JTZX 2J1VA 1CQ9A 3A22A 3U10A 1OMIA 4IL7A 4IE0A 4Q29A 2AACA 4I09A 1QOSA 3H0OA 1AL22 3GXUA 5KHIA 5I91A 2YU1A 3C8XA 5AFEA 3ZYIB 4BLIA 2E32A 5LATA 1GV9A 5IVCA 2XLGA 2W1WA 3MHZA 3T0AA 1UYYA 4GWIA 1R1ZA 1COV1 4XBQA 1ULEA 2WAAA 3I7DA 4KGGA 5C4WB 1U5YA 2IWGB 5JZGC 4JKMA 5A6ZA 1VRBA 3ORJA 4Y20B 3TNQA 2OUJA 2GNBA 1G9FA 3KV9A 1XC6A 3CZUA 2WNVC 1W05A 3I2GA 3LA2A 3MIGA 4M01A 4WVWA 3VB9A 1MEC1 4Q4Y3 1OD3A 5T5PA 4MXWA 1YFUA 3VGIA 2MEV1 4UOJA 4BPZA 3U4XA 2RS32 2W2IA 4LIUA 3IDAA 3KF5A 4RS5C 4WV8A 5BV6A 4C1WA 3EQEA 1D7PM 3AZVA 3KD4A 4IV1A 3AKTA 1XNKA 3C7EA 4Z07A 2JB4A 2GC3A 5FMBA 5GLZA 4IE6A 4AI9A 3WQ1A 1CAVB 1LGBA 4XJWA 5FY1A 2WQZC 4OQ9A 3U78A 5FBJA 5FCCA 2R042 1HRV3 5IUQA 1W04A 3H1YA 1ZZ9A 4M3CE 3PUAA 5J09A 2PHUA 4P08A 4QGLA 5H9QA 4CU7A 3VN4A 5HCHA 3ZO0B 4I30A 5C3RA 1STMA 1KRIA 5F7UA 2JECA 2WIIB 2XJVA 3ZPYA 1JOBA 1MS5A 1JZ7A 4TWTA 2DUPA 2G19A 4FXGB 4LJHA 1PK6C 5FO8B 2B45X 2VZ3A 4RGKA 4UW4A 2RV9A 3SHRA 3ZIWA 3KCYA 4YVSB 1OI6A 2YMZA 3KMHA 2DFBA 1H8TA 4MGYE 4EN0A 4HVRA 4JGYA 4ORFA 2DYCA 3ETPA 2QQVA 3P6BA 1Y7BA 1LCLA 5EHDA 4PI2A 5DDJ3 1NAEA 3S7IA 5GALA 5C9AA 1OUSA 4DMIA 2ENRA 1W3VA 2Y34A 1XXNA 1GUIA 4AGGA 5K4LA 5BNNC 3M3OA 3B02A 2ES3A 4ZU7A 1NOVA 2VVFA 1OFSA 4Z92B 4FTEA 3AB0A 4AGRA 3VDDA 5IWFA 5FP8A 4BXFA 1IG0A 1LOGA 1V00A 1PGL2 4OULA 5GKAC 4H14A 3DPRB 4K1YA 3B01A 5A3OA 4B3NA 4EN7B 5I0RA 3JQXA 4C0BA 2VZRA 1EUUA 1L3JA 3HR9A 3WP5A 4IGOA 3PVBB 1AR81 2P3JA 4JGZA 4N8MA 1IQAA 4AFDA 4P00B 5HV4A 1EP0A 2E6VA 1Q5OA 4I2OA 2W68A 4XFBA 1REFA 4UYBA 1F31A 2XKPA 1X9TA 2WINB 2QZ3A 2VMCA 3JD73 3I59A 3MF6A 3PNAA 1GU3A 2RE9A 1U5IA 2ZPXA 1URXA 4R8HA 3DUIA 1ZBA2 4JDOA 4QKDA 4E2GA 1SLLA 5B4NA 5DMYA 1OUXA 3IKWA 2G1MA 3ZFGC 4CEYB 5FREA 4XE9A 4Y4YA 3NAPC 4GIQA 1R082 1V6IA 3CKHA 5D8AC 3KV5A 5TSWA 1SLAA 3BIWE 1OT5A 3NMBA 4WM7C 3LCPA 2YBPA 3TEWA 1H6YA 1V6KA 4BDVB 4FVVA 3DCQA 1PVC1 4Z1VA 1QJFA 4FSJA 3OBRA 2VCAA 1ACCA 1DGRA 1TEIA 1WCSA 3D5OA 3LOIA 4D8MA 4QPGB 1VMJA 2YPDA 5F1RA 5L7OB 4XF0A 4AHYA 5HI0A 4X6RB 5JZGB 1RUG2 3BOWA 3ZYFA 1AHSA 3JQWA 4GQ7A 1QJX3 4K1ZA 4XDQA 2VU9A 2WNVB 4LE4A 4M3CB 3TN93 1CPNA 3ZSKA 1GZCA 1GZWB 1LRHA 2Q8EA 2JE8A 2R49A 2WNUC 2VNGA 3IDCB 1GBGA 2AENA 4OLLA 3GALA 3ZXKA 4P9XA 3FUOA 1UO9A 2V5DA 3E5QA 4AE2A 2YBSA 1COV2 4R9AA 4NJ4A 2RS52 4B4PA 4QX5A 4QU1A 1QKQA 1ULOA 4META 1H1MA 3OYWB 5LW9A 2W94A 3OTFA 3SISA 3P3PA 1TVGA 1MEC2 1FMD3 1XE0A 4FQZA 1UX7A 4LO4B 5FYHA 4D0QA 1FV2A 1RUE1 1VPHA 1S0FA 2MEV2 1B35B 2ET1A 1WW5A 2R0HA 2VQTA 2WO1A 2YV8A 3B00A 4WVZA 1DYKA 2DUQA 2X5IA 1EPWA 2JDUA 1QIQA 1X8EA 1CJPA 2DVFA 2ORZA 3MYXA 3NNGA 3T08A 4K20A 4RHV1 3WG4A 5A1FA 2P37A 3ENRA 4YZ5A 2VBPA 5JR7B
chains in the Genus database with same CATH topology
3I3QA 3RZMA 3H8OA 4IE4A 4CXXA 5F8PA 2FDGA 4QKFA 4JHTA 3BKZA 3S5AA 4MGTA 2FDKA 4MG2A 3BTZA 2FD8A 3BU0A 4CXYA 3BI3A 4NRPA 3T4HB 3RZKA 3H8RA 3O1TA 3RZGA 3RZLA 3BTYA 4IE0A 4QKDA 3H8XA 3O1OA 3KHBA 2FDHA 3BIEA 4IE7A 4NPLA 3RZHA 3O1SA 4QHOA 3T4VA 4NRQA 4NPMA 4NIDA 2FDJA 3BUCA 3S57A 3O1UA 4ZS3A 3RZJA 4OCTA 4O7XA 4ZS2A 3O1VA 4ZHNA 4IE6A 2FDFA 2IUWA 4CXWA 4NROA 5DABA 4RFRB 4QKNA 3O1PA 3O1RA 3I2OA 4NIGA 4NJ4A 4QKBA 4IE5A 3I49A 4NIIA 3I3MA 4NIHA 4IDZA 2FDIA 3O1MA 3T3YA 3BTXA 4NRMA 3LFMA 4O61A 3KHCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I3Q A;  3RZM A;  3H8O A;  4IE4 A;  4CXX A;  5F8P A;  2FDG A;  4QKF A;  4JHT A;  3BKZ A;  3S5A A;  4MGT A;  2FDK A;  4MG2 A;  3BTZ A;  2FD8 A;  3BU0 A;  4CXY A;  3BI3 A;  4NRP A;  3T4H B;  3RZK A;  3H8R A;  3O1T A;  3RZG A;  3RZL A;  3BTY A;  4IE0 A;  4QKD A;  3H8X A;  3O1O A;  3KHB A;  2FDH A;  3BIE A;  4IE7 A;  4NPL A;  3RZH A;  3O1S A;  4QHO A;  3T4V A;  4NRQ A;  4NPM A;  4NID A;  2FDJ A;  3BUC A;  3S57 A;  3O1U A;  4ZS3 A;  3RZJ A;  4OCT A;  4O7X A;  4ZS2 A;  3O1V A;  4ZHN A;  4IE6 A;  2FDF A;  2IUW A;  4CXW A;  4NRO A;  5DAB A;  4RFR B;  4QKN A;  3O1P A;  3O1R A;  3I2O A;  4NIG A;  4NJ4 A;  4QKB A;  4IE5 A;  3I49 A;  4NII A;  3I3M A;  4NIH A;  4IDZ A;  2FDI A;  3O1M A;  3T3Y A;  3BTX A;  4NRM A;  3LFM A;  4O61 A;  3KHC A; 
#chains in the Genus database with same CATH topology
 3AKQ A;  3GHN A;  2D98 A;  3E5U A;  5DG2 A;  1H2M A;  1D2Q A;  4FFF A;  1PO2 1;  2DVD A;  4QPY A;  4PCR A;  3ILN A;  4B1M A;  2IXC A;  2ORX A;  2DCT A;  2UWC A;  2WUH A;  4G4F A;  4PBP A;  3N9P A;  4CXX A;  3FHQ A;  4Y1X A;  4CU8 A;  3UGF A;  3CIH A;  2CGP A;  1QJY 3;  3WNP A;  5FYI A;  1O8P A;  4WBB A;  2VBB A;  4YW6 A;  2P3Y A;  2NM1 A;  3IDB B;  1H8T C;  3WX5 A;  2P6C A;  1BK0 A;  1FV3 A;  4JGY C;  2YGL A;  4XDP A;  3TNP B;  3RZZ A;  3QOP A;  4HMZ A;  5IVJ A;  4LHS A;  1CAU B;  2XML A;  4TLF A;  5FP4 A;  3T4H B;  4KWU A;  1RUH 1;  2ZKN A;  5F32 A;  5C9A C;  2Y38 A;  1ENR A;  3DEC A;  5FY9 A;  5A70 A;  3RZG A;  3JUU A;  3Q8B A;  2VXR A;  2IVJ A;  4FI9 A;  3U0Z A;  1G86 A;  2AGS A;  3ACG A;  4QU2 A;  1W8F A;  4LOS A;  1XB9 A;  2OZJ A;  3HEI A;  4H3W A;  3JB4 C;  4AVA A;  4NAO A;  3VDD C;  3B3Q E;  1W8H A;  4K8R B;  5GLT A;  4Y5Z 0;  3GBW A;  2E53 A;  2VC9 A;  2ZEZ A;  3Q8E A;  1DBN A;  2XVG A;  4LHL A;  5A3T A;  1XJA A;  1ODM A;  1H2K A;  2YFU A;  5FPZ A;  5LA9 A;  1CWP A;  3MIE A;  4JGZ C;  2UWB A;  2OW4 A;  4LK6 A;  3K48 A;  4JQR A;  1E57 A;  1OPO A;  4CEW C;  1FAY A;  2VW1 A;  3D6E A;  1V9U 3;  3FN9 A;  1EY2 A;  3E1F 1;  2VZO A;  1GFF 2;  2WS9 3;  2WO3 A;  3OPZ A;  1YCI A;  5FY0 A;  3L9J T;  4ASL A;  3AFK A;  3WP6 A;  4P9J A;  1KGY A;  3NAP B;  1AR8 2;  1AX1 A;  1PZ9 A;  1WGP A;  3IAP A;  3LPG A;  1GP6 A;  1JBC A;  3PTR B;  2PLV 3;  4RR3 A;  3NV2 A;  1GWK A;  1W99 A;  3VBO A;  3BOP A;  2PEL A;  3GCW A;  5L19 A;  1IOA A;  2P3I A;  2VOK A;  3LDB A;  2YXS A;  4MGQ A;  3S57 A;  4HBN A;  3IMN A;  1W6P A;  2Q8O A;  4NHL A;  3EO6 A;  2YC0 A;  4JDM A;  1TQ5 A;  2CU5 A;  4R4Z A;  3HOB A;  3AXE A;  2LUW A;  5G05 L;  2GC0 A;  5CAD A;  5AVA A;  2XG3 A;  2EF6 A;  1NZI A;  1SFY A;  4OI1 A;  3M3I A;  4Q4Y 1;  2ZXQ A;  3K4D A;  4PQQ A;  3H9A A;  3FBY A;  1HV1 A;  3AYC A;  3U07 A;  5CFD A;  1ZYB A;  1ND2 C;  1A78 A;  1KEX A;  3PVO A;  4IV3 A;  4QKN A;  5JDB A;  5IK7 A;  3JB8 A;  3NKG A;  5T3N A;  2DWR A;  5K8S A;  2YHJ A;  4LO6 B;  2A3Y A;  4AI1 A;  4CTE A;  3AZZ A;  5I8S A;  2TNF A;  3J8F 2;  4AI0 A;  2WNU B;  4X6Q B;  1WLT A;  1PVC 2;  3GDB A;  3NJV A;  4MHU A;  2AZ5 A;  3IPV A;  1HRV 1;  4GZ9 A;  1UZY A;  5C8C C;  2BVB A;  1T2X A;  1NCR C;  3LDK A;  1NXM A;  1PIV 3;  3W58 A;  5IFT A;  5JOY A;  2E7T A;  5FXV A;  3I97 A;  2FDI A;  4P02 B;  1J3R A;  4E8C A;  1VBE 1;  3T0D A;  1WW6 A;  3BTX A;  2YGM A;  3LAG A;  2XBO 3;  2XVL A;  2RDN A;  4O61 A;  4NRM A;  4OHZ A;  2NP0 A;  4R9D A;  3SNM A;  3F95 A;  5I8Y A;  2J1R A;  5LBB A;  3WP4 A;  3LEK A;  4Q0P A;  1HV0 A;  3KQ4 B;  3HN1 A;  2RVA A;  4MH0 E;  1VLN A;  5J1X A;  1IHM A;  2FCU A;  3H8O A;  1R64 A;  4WVV A;  5GJ6 A;  1BYH A;  3IT8 A;  4HON A;  1C4R A;  3BAL A;  4Y3O A;  2BTV C;  2EVX A;  3MIH A;  2FCT A;  1YYN A;  5FQ0 A;  2HWF 3;  3S5A A;  1XNA A;  3BU7 A;  3C2U A;  2R1B A;  1LES A;  3NKT A;  5DDJ 1;  5FWE A;  2ARA A;  1SG3 A;  2WQ8 A;  2QQP A;  4GMP 0;  2DVB A;  4YPJ A;  4QWN A;  4I02 A;  3UET A;  4FTB A;  1SCS A;  4OHY A;  1TMF 3;  2B9U A;  3X29 B;  1F9K A;  3WQ0 A;  4HLT A;  5FPU A;  4XYX A;  3CNA A;  4Q4V 1;  4AEK A;  1VP6 A;  4FFG A;  5DQ0 A;  4RGG A;  1RUE 2;  2J1T A;  3P3N A;  3ZSM A;  3POI A;  4CCJ A;  3BTA A;  3KWV A;  3VKO A;  1R1A 3;  4HFS A;  3U4S A;  5IVV A;  1CR7 A;  2WZE A;  3AJZ A;  4RHV 2;  3MW3 A;  1LTE A;  4GUL A;  1GSL A;  5CFC A;  3W59 A;  4K21 A;  3I2K A;  3H8X A;  1PO2 2;  1UCX A;  4AFA A;  1X33 A;  3C7H A;  1CJD A;  1UL9 A;  5CU1 A;  1DQ2 A;  2PHF A;  3ZN5 A;  1HB3 A;  4QM8 A;  5FDB A;  4RN5 A;  2A73 B;  2EXH A;  2P3K A;  1UMH A;  5FUI A;  3W9A A;  3ZDV A;  3ZKU A;  4AHX A;  2I2S A;  2IXJ A;  2RM2 3;  1W8N A;  1NA1 C;  2R0F A;  3JD7 1;  4ZPI A;  1VB4 A;  3WT3 A;  3WDX A;  4NPL A;  5FK8 A;  5GLV A;  2CTV A;  4RSU A;  4QX1 A;  5CKM A;  5FJK A;  1UMZ A;  3AM2 A;  4UAP A;  5F37 A;  4DPN A;  1DYO A;  3SEP A;  4BB3 A;  1O5U A;  1BEV 3;  4XMI A;  1RUH 2;  4MSV A;  4HK8 A;  3AK0 A;  4CEW B;  1UY2 A;  1PMI A;  4XUN A;  1W2T A;  2ZCW A;  2WBK A;  1QDO A;  5ABJ C;  2Y8K A;  1MQT A;  2YFZ A;  1CPM A;  2XOM A;  4Q27 A;  4UXA A;  3V0B B;  2JDA A;  5JAX A;  2ZMK A;  2R06 3;  1ZA4 A;  4FQ4 A;  4ZS2 A;  3ZDS A;  5ISL A;  1YRZ A;  1MR5 A;  4JHZ A;  3MZH A;  4NHM A;  1RVF 3;  3E6D A;  1QDC A;  1NXD 1;  4ERO A;  5AC9 3;  5HCB A;  1OPM A;  3BGA A;  1RYY A;  5BNP A;  3GJB A;  3VBO C;  4ZZ8 A;  3O1P A;  2VPV A;  4N7I A;  1GZT A;  1LJ7 A;  4RGA A;  1GNH A;  5F2S A;  1ZRC A;  3TEX A;  3TN9 1;  2BU9 A;  4LHK A;  2GZW A;  4N53 B;  4YW5 A;  1WCK A;  4FPL A;  5FBZ A;  4AK3 A;  2CWM A;  3OF1 A;  1NG0 A;  3IB3 A;  3HD8 B;  3PU3 A;  1DF0 A;  5LEK A;  3AVR A;  4J25 A;  5IT6 A;  2DVG A;  5FPX A;  4IEV A;  5LCW L;  4IDZ A;  3CL1 A;  1C8M 1;  1RUD 3;  2VUJ A;  1HB4 A;  4W6Y A;  3FUQ A;  1M4W A;  5FXZ A;  4BH9 A;  4BQ3 A;  1IS3 A;  1IPJ A;  2BEO A;  3O12 A;  1H9P A;  4QPI C;  5E89 A;  5EXO A;  5GLU A;  4DOU A;  5CFD C;  2UY9 A;  3VD5 A;  4WVM A;  2PAM A;  4IV3 C;  5JR2 A;  2W1S A;  2Y33 A;  3HT1 A;  4MXV A;  4Z82 A;  3D0S A;  3WG1 A;  5FO9 B;  5I0D A;  4XF1 A;  4MV2 A;  4Y22 B;  5D1I A;  3ILF A;  3A0N A;  1NCR B;  4UT5 A;  1AUY A;  4Q4Y 2;  4AWD A;  4XF3 A;  1JU3 A;  5FZD A;  2JXA A;  3PUS A;  2K0G A;  2JDY A;  5J36 A;  5LA0 A;  1MAC A;  4ISQ A;  2NLR A;  2FDG A;  2IXI A;  3KV4 A;  2AEZ A;  3ES1 A;  4MGT A;  1L7Q A;  1YJL A;  5EWS A;  5A3N A;  1LEM A;  2XON A;  2ZHK A;  5IAX A;  3BB6 A;  4DB5 A;  2ILM A;  3TEZ A;  1XQN A;  1W9F A;  3PJQ A;  2ZJC A;  3AZY A;  1DFQ A;  4YVW A;  4MVT A;  5A7O A;  4XZU G;  1HRV 2;  1VAL A;  1ZZ7 A;  1DQ4 A;  2LAL A;  2O8Q A;  3K46 A;  1QJY 1;  3B9C A;  3ABZ A;  3W20 A;  2RS1 3;  1VBE 2;  2FCV A;  4XAC A;  1AL2 1;  2W95 A;  3ATG A;  2OVU A;  5IYY A;  4CU6 A;  1H4H A;  1NCQ A;  2EIC A;  3LSD A;  1WZX A;  4JVA A;  3E5X A;  4MGZ E;  3M8L A;  2HYK A;  1RUJ 1;  2JDH A;  3R4S A;  4RQP B;  1PX4 A;  1I6X A;  2BV4 A;  4XFC A;  2J1E A;  1W8O A;  1ENS A;  1WW4 A;  1HXS 1;  3WF2 A;  1H1A A;  2XH6 A;  1IGO A;  4HT1 T;  4B7E A;  5DDJ 2;  1Q8Q A;  1S0E A;  2A75 A;  3NNL A;  2OUH A;  1VRH 3;  4XQ4 A;  4P5Y A;  2JEM A;  1D4M 3;  1OH3 A;  3KGZ A;  1WLD A;  2NMO A;  3QH6 A;  1JYW A;  1IPS A;  1VBB 3;  2AUY A;  3RZH A;  3WD5 A;  4Q4V 2;  5FZF A;  4NPM A;  1NA1 B;  1YQ2 A;  4S2G A;  1TE1 B;  5FKC A;  2E7Q A;  2NN8 A;  3A23 A;  3N9M A;  5KHK A;  2R16 A;  3MLL A;  3H3L A;  1OFN A;  1V9U 1;  3CDZ B;  1J83 A;  2XWB B;  3USU B;  2R7E B;  5J48 A;  2WS9 1;  5CAZ A;  4ZS3 A;  5FP7 A;  2Y6H A;  4LBJ A;  1WMD A;  3I3D A;  3SCH A;  5FZG A;  4A7Y A;  2RJ2 A;  5ANQ A;  3O0W A;  4JCK A;  4CDU B;  2PLV 1;  1YC6 1;  4DS0 A;  2WL1 A;  2FDF A;  1D4V B;  3J7N A;  4LOR A;  3RNS A;  1BVP 1;  2CDO A;  3LB9 A;  4P14 A;  3RQ0 A;  3M3C A;  1BLZ A;  2D6P A;  5FZ0 A;  1V6N A;  3VZN A;  5L7O A;  2BBV A;  4KH9 A;  3I2I A;  3IWZ A;  3JD7 2;  4J1X A;  3ZXF A;  4EN9 B;  5ABJ B;  1Q8S A;  3UYJ A;  2CHH A;  5IK8 A;  4N90 A;  4MGS A;  3Q8C A;  1WMF A;  2Y0O A;  4CPB D;  2DF7 A;  2C4X A;  2HWE 3;  4IE5 A;  4XW3 A;  1YFX A;  4CCD A;  5H9P A;  4NII A;  3KZ4 C;  2JEN A;  4W4Z A;  3RMY A;  4XUP A;  1XE7 A;  2Y60 A;  1MS1 A;  2IFW A;  1YNA A;  3VDB A;  1UY1 A;  4FPY A;  4YGD A;  4BWO A;  3I3M A;  2NMN A;  2UYB A;  4YGC A;  3DXT A;  3FJS A;  1S0J A;  1PM7 A;  1GR3 A;  1NE6 A;  4MHR A;  1BQP A;  1R09 1;  4JQT A;  2VGD A;  1BCX A;  3SXW A;  1JOP A;  3J7L A;  3PHM A;  1S2B A;  2CNA A;  3FLT A;  4HKL A;  1W6Q B;  2B7Y A;  2ARE A;  3NRU A;  2CWS A;  2XR4 A;  2GC1 A;  1PIV 1;  1W2U A;  1S0I A;  2EAL A;  3NJY A;  2ZX4 A;  3WDY A;  4L99 A;  2I45 A;  5FPV A;  4QPI B;  1W6M A;  1BKZ A;  3WDU A;  3ZFE A;  2D3S A;  3JBG 3;  5BNO C;  4XFH A;  4JV4 A;  3IBM A;  2WQ4 A;  5FMO S;  1IPK A;  2XBO 1;  1YO8 A;  1NLR A;  2B5H A;  4YNI A;  5FAX A;  4UW3 A;  2BYV E;  3VKL A;  2XL7 A;  4XMA A;  3TN9 2;  1AJO A;  3HAG A;  2EXI A;  3MDP A;  2GU9 A;  3FFZ A;  4Y5T A;  4G3Y C;  5JXG A;  1RC6 A;  3WVJ A;  2AC1 A;  4HAN A;  1WLC A;  3CBN A;  2HWF 1;  4FPC A;  1OSG A;  1FYU A;  5FLH A;  3ZYP A;  4FOW A;  3G6J B;  2R6Q A;  3OUH A;  4LPL A;  4JRL A;  2WZP P;  3THC A;  1POV 0;  2N7G A;  3N35 A;  4CYD A;  5KBF A;  1JZ2 A;  3RZL A;  2OZ6 A;  4LBL A;  1SEF A;  5JXJ A;  3MPB A;  4JX0 A;  3EHK A;  3IIA A;  5FYZ A;  4EWE A;  4BA6 A;  2F4P A;  2ZBJ A;  2OYZ A;  5CKQ A;  2P5B A;  4F83 A;  1N3Q A;  2D43 A;  2VVD A;  5F5I A;  4AED A;  1DQ5 A;  2VJX A;  1UIJ A;  3BYW A;  3O1O A;  2NQY A;  2TBV A;  2LTN A;  4GH4 C;  1QNY A;  5JXI A;  1ND3 C;  4LBN A;  1UYX A;  1R1A 1;  1Y43 B;  1ZBE 3;  5A7S A;  3UES A;  1VR3 A;  3GHM A;  4NAM A;  3VL9 A;  5KC6 A;  1VAV A;  1I9R A;  2XWJ B;  4Y1U A;  2PHL A;  4D6S A;  5IJR A;  3RVH A;  5JMC A;  2HKX A;  5GZC A;  1G7Y A;  3OY8 A;  2ZEX A;  2HWD 3;  4AI3 A;  5A3M A;  5H9S A;  4L8Q A;  1BZW A;  3SC7 X;  2VZS A;  5HCA A;  2A3X A;  1SDD B;  3AYD A;  4FOQ A;  5EP9 A;  4CUC A;  5LRS A;  4GXL A;  4IEY A;  5DAQ A;  2ADD A;  3POB A;  5IFP A;  1KS5 A;  1QJY 2;  5DZF A;  1RUG 1;  1OBN A;  2IZW A;  2BFU S;  2JG8 A;  4MGI E;  1OLQ A;  5A7W A;  2EIE A;  1JZ6 A;  2OQ7 A;  5I0U A;  2Q8C A;  4CRQ A;  2XJU A;  2Y26 A;  2ZAC A;  4XHX A;  5CZK A;  5DPN A;  1RIN A;  2D97 A;  2QE3 A;  1DCS A;  2V09 A;  4H7M A;  1TME 1;  3PUI A;  4O7X A;  4XJU A;  1RUJ 2;  4XIL A;  3T4V A;  3ASI A;  1ENX A;  4JDN A;  2H0V A;  1TNF A;  4WZF A;  3T2P A;  3GYD A;  1RUI 3;  1SAC A;  3AP5 A;  3ITQ A;  1NLS A;  5T50 A;  3MW2 A;  1YI7 A;  2P4E A;  2RS5 1;  1HXS 2;  4YZ3 A;  3VBR A;  3VBF A;  3VKF C;  3WF4 A;  4OI4 A;  4ZON A;  2VZT A;  1HQW A;  1KQR A;  1REE A;  1WA4 A;  1LEC A;  2PHW A;  4GMP 3;  2WZ8 A;  5DAV A;  1M06 G;  2JJ6 A;  2BWA A;  1ZVF A;  2R06 1;  1EV1 3;  4B29 A;  1W03 A;  3I49 A;  1P8J A;  1RVF 1;  4EV0 A;  3P1I A;  1MZE A;  2YPJ A;  5AC9 1;  3URF A;  2QJV A;  4F8A A;  3MPP G;  3RI9 A;  1US3 A;  1Y4W A;  5CEH A;  1WME A;  3FLR A;  4AVB A;  1V9U 2;  3B9I A;  1U12 A;  4AR2 A;  2WS9 2;  3DKQ A;  4PDW A;  3RWK X;  4PLN A;  3I3B A;  1XOY A;  3H50 A;  3M3Q A;  2DTW A;  2PLV 2;  4UBG A;  3BCW A;  1G9A A;  3VBS C;  5FZO B;  3PUQ A;  4PQ9 A;  5CKN A;  2GAU A;  3RZM A;  4XUQ A;  1RUD 1;  1UY0 A;  3N7L A;  2XLF A;  1OOP C;  2DFC A;  3SCG A;  2X05 A;  1E5I A;  2XPJ A;  1SLB A;  2DUO A;  2P6H A;  5DAP A;  3DF0 A;  1XSR A;  1RED A;  5FZ9 A;  1K12 A;  1K5M A;  1O7F A;  3UGG A;  5CIR A;  1AR6 3;  1RXF A;  3ZXA C;  2VOW A;  3KF3 A;  1O5L A;  1DQ1 A;  3C7O A;  1ULG A;  2GC2 A;  4QGN A;  5FPL A;  1Q56 A;  3DYP A;  1RUF 3;  4DXZ A;  2BNN A;  3T1M A;  3O1T A;  1ZZ6 A;  3POF A;  3RFR A;  4ASM B;  2DV9 A;  2V72 A;  4HPK A;  1JZ5 A;  2W91 A;  1PO1 3;  1W9T A;  4UF0 B;  1YEW A;  2YZ4 A;  2ZGR A;  1R09 2;  2VUL A;  4BME A;  4NR1 A;  4QB1 A;  4TZD A;  3AL5 A;  1JU4 A;  1ENQ A;  2VZV A;  2BPA 2;  1ASJ 3;  2XL9 A;  2Y64 A;  3VBH A;  1PIV 2;  4W50 A;  1HQL A;  5JIA A;  3ZFF A;  1UIK A;  5FO7 B;  2G9G A;  3C7G A;  1RUN A;  4BIO A;  3LA7 A;  4ARY A;  2ADE A;  3LA3 A;  1VBC 3;  3CJI B;  1UPI A;  4Q0V A;  1W9W A;  2XBO 2;  3N4M A;  3AXD A;  1V6J A;  4TLG A;  4WM8 C;  4Y1Z A;  3V56 A;  3V65 A;  1AYN 3;  5A32 B;  2RMU 3;  3ROU A;  1JZ4 A;  4GH4 B;  5KHG A;  2ZMN A;  1ND3 B;  1QH7 A;  3AMP A;  2YDE A;  2CV6 A;  4FT8 A;  2HBU A;  2QKD A;  3KQR A;  4YG0 A;  4YFW A;  5A3W A;  1X7N A;  5FYM A;  4Q4X 3;  2HWF 2;  4AED C;  1O91 A;  1WMX A;  3RS6 A;  3A4U A;  1H1I A;  4UFJ A;  1OVS A;  2C5D A;  4YGB A;  1LU1 A;  4Z2W A;  2Y6L A;  2IXL A;  2WWJ A;  3D82 A;  4XFF A;  5HXV A;  3WOG A;  2DBI A;  1D4M 1;  1TMF 2;  5C71 A;  1OH4 A;  3NVC A;  1MVE A;  3VBU C;  2RDR A;  3NV1 A;  4I0W B;  3ZXL A;  4XJ9 A;  3HQU A;  4PHZ A;  1LOE A;  2WWU A;  1J1L A;  1J1T A;  2E7A A;  1R1A 2;  1JW6 A;  1QMJ A;  1W39 A;  1VBD 3;  2VBD A;  4HKO A;  2ZGU A;  4CXW A;  1ULC A;  4XTP A;  1C28 A;  1CES A;  3BN6 A;  3J8F 1;  3LEG A;  2JG8 C;  4LLF A;  2BGP A;  4OYU A;  5LAS A;  1CD3 G;  1F15 A;  4IUG A;  4A42 A;  1XNC A;  1H0B A;  2JIJ A;  4IEX A;  1OLM A;  2PAK A;  2WSU A;  1UY4 A;  5FIX A;  4XET A;  4FPK A;  1CZS A;  1LOA A;  2QQM A;  5I0S A;  2OX0 A;  3WCS A;  2D6M A;  3O5S A;  3OOX A;  3FBM A;  3AKS A;  2HWE 1;  2Y0I A;  1J84 A;  4ZXK A;  1UPS A;  4QXH A;  3LQC A;  4XBN A;  3VBF C;  1W0O A;  5FY7 A;  3AZX A;  1TME 2;  3DL3 A;  2CYF A;  4IES A;  3T3Y A;  3MIC A;  5FZM A;  3GZA A;  3VZL A;  4KMQ A;  5K7P A;  3JZV A;  1A6C A;  4RS5 B;  4A45 A;  1D0H A;  1Q3E A;  3GJA A;  4CCO A;  4XAA A;  4B7K A;  5FMO L;  3LFI A;  2JIC A;  4LO8 A;  4D7Y A;  5C5T A;  3BPZ A;  1RMU 3;  2WLP A;  3ON7 A;  3DGT A;  3SLI A;  5FMC A;  1O4Z A;  2HEY F;  2R32 A;  5F3G A;  3N7K A;  1QNW A;  4MGK E;  4LTA A;  4HG6 B;  1OKO A;  1SLT A;  1UOJ A;  2R06 2;  1C1F A;  4IV1 C;  3OBZ A;  3VBS B;  3ZYG A;  1YIF A;  4K3U A;  2PA7 A;  2Z2S B;  1QEX A;  1RVF 2;  3MO4 A;  1WD3 A;  4Y22 A;  5C33 A;  1RGS A;  1YQ6 A;  3M1H A;  2H6B A;  5L9B A;  5AC9 2;  5LEJ A;  5JPN B;  2OA2 A;  5A33 A;  2XXZ A;  1C57 A;  1XYO A;  3B69 A;  3JBG 1;  4AFB A;  3W5M A;  1HRI 3;  4KBB A;  5FR3 A;  5IVE A;  1X8M A;  1W8U A;  1AYM 3;  2KA3 A;  4QB2 A;  3UNP A;  1PK6 B;  1F4A A;  2ATF A;  1LUL A;  4RYD A;  2Y6K A;  5FYU A;  2ZHL A;  4A4A A;  4JC1 A;  3HMY A;  2ZX3 A;  3H7J A;  5FZ8 A;  2JG9 A;  4LE3 A;  4PLM A;  3M7A A;  5DZE A;  3ECQ A;  2VMF A;  5DXD A;  1RUD 2;  4MZU A;  3LIH A;  2ETE A;  2FZ1 A;  4BQW A;  5L73 A;  1W2N A;  1DQ0 A;  2F6B A;  4UWD A;  4N43 A;  4YFZ A;  3AMN A;  5BNN B;  1K5J A;  5IVB A;  5KXB A;  2HWB 3;  1EAH 3;  4YM2 A;  3WF3 A;  4XAE A;  1W6O B;  4GKY A;  4M4P A;  1YFY A;  3AJY A;  5CIS A;  4CDW A;  4TYS A;  1LOB A;  1ZBE 1;  4Q0Q A;  5FWJ A;  4NID A;  3VBH C;  3O7O A;  1H30 A;  3ZYJ B;  3ZFF C;  5A6Q A;  3KCC A;  4BXS V;  4XF9 A;  1RUC 3;  2VW0 A;  3WW3 A;  1LGC A;  1XNB A;  4PBO A;  2W9X A;  3U14 A;  3ZN6 B;  4HN0 A;  2YB7 A;  4FPO B;  5A80 A;  2WAO A;  3HBK A;  3HQX A;  1ZX5 A;  2QQO A;  4OMC A;  2MPF A;  4CCE A;  1LR5 A;  2IUW A;  4W6W A;  3ZSL A;  4Q5O A;  3VZM A;  3VUO A;  1FPN 3;  2HJI A;  1V6L A;  4GKX A;  4PIY A;  1W0N A;  3HVD A;  3CMG A;  1CAX B;  1UAI A;  3WEZ A;  3ZFG B;  2WSV A;  3FMG A;  5IVY A;  4LUM A;  3VBU B;  3K77 A;  4W8J A;  4XFA A;  5FP3 A;  4RFT 0;  2A1X A;  5JI7 A;  1XE8 A;  1KJR A;  2VEC A;  3FLP A;  4AHW A;  1RUI 1;  4OZX A;  4AF9 A;  2VMD A;  3VKM A;  3ACI A;  1O4T A;  1LHV A;  5D8A B;  4CDX A;  3NNM A;  1POV 3;  2ZAH A;  2E9Q A;  4WM7 B;  2WFF 3;  2ZGQ A;  4GMP 1;  4QQP A;  3Q8A A;  4R9C A;  1Z78 A;  2R07 3;  4Q1P A;  5LA1 A;  1ONA A;  2A6Y A;  1VRH 2;  2D40 A;  2J22 A;  3HQR A;  4Q4W 3;  3WSO A;  4AAX A;  4LO5 B;  2F4L A;  1D4M 2;  2GDF A;  1U5Z A;  4FOV A;  4KGQ A;  4QX2 A;  4EJR A;  3UL2 A;  2Z42 A;  3EJK A;  3N7M A;  3BVC A;  3OCP A;  3PDQ A;  3KHC A;  1O3S A;  4HXC A;  2JDK A;  4E4H A;  2BQP A;  1WCD J;  4DUX A;  1VMF A;  3MEP A;  4N7U A;  2ZHN A;  1QOT A;  4D3W A;  1UNB A;  2GMP A;  4FPG A;  2C0Z A;  5F8P A;  5JVV A;  4DY5 A;  5A1L A;  2D6L X;  1QXJ A;  1DU3 D;  5F39 A;  3R05 A;  4N9H A;  1SPP B;  5K0U A;  5LB6 A;  1SDW A;  1WUV A;  3BTZ A;  4C8D A;  1OD5 A;  1Q43 A;  2B8M A;  3BU0 A;  2GNT A;  2YY1 A;  1CAW A;  3D4K A;  1UU6 A;  1UN1 A;  4LT5 A;  3QLQ A;  1W6Q A;  5EQU A;  3MF9 A;  4BQ1 A;  4XOG A;  2BJS A;  4ARX A;  1C5H A;  1RL3 A;  4YW3 A;  4ATE A;  2VNV A;  2HWE 2;  2XHN A;  5E88 A;  3H8R A;  1DQ6 A;  2AR6 A;  2FHR A;  4IV1 B;  5FYB A;  2EXK A;  3CF6 E;  1MS3 A;  1YFW A;  3NQH A;  1U5X A;  1AR6 1;  1IZ3 A;  2X10 A;  2W92 A;  3LE0 A;  1W8T A;  4NMI A;  4O65 A;  4PI0 A;  1V6O A;  3WV6 A;  5FUN A;  5JCT A;  2XUM A;  4E4D X;  1JXN A;  1RUF 1;  2Q4S A;  1QJU 3;  3T30 A;  2GN3 A;  4TSV A;  1AR9 3;  3PME A;  4NN0 A;  1N1T A;  2X5I C;  1PO1 1;  3ZM8 A;  3BIE A;  2R30 A;  3OBA A;  4IEU A;  3VDA A;  1ZRE A;  4RL7 A;  3F2Z A;  1C3H A;  3LEM A;  5HBA A;  4XEZ A;  5F5C A;  3OJB A;  1ASJ 1;  2OS2 A;  4A41 A;  1PGS A;  2XKO A;  3NO8 A;  1JOD A;  3PUH A;  4E2S A;  1NQJ A;  2F17 A;  4XTM A;  2Z79 A;  2H0B A;  2BUK A;  2PHT A;  2JIG A;  1CX4 A;  1H8T B;  1DGW A;  4E4Z A;  1UF2 C;  3JBG 2;  3NST A;  4JGY B;  1OA4 A;  2ZS6 B;  1KD7 A;  3N9O A;  2SBA A;  5FPA A;  1ZRF A;  4JAA A;  1UKR A;  2A6W A;  2WKK A;  4XBL A;  3K4A A;  2JE7 A;  5ERL A;  1JMU B;  2XJT A;  4QQ2 A;  2RJL A;  5C9A B;  1ZBA 3;  2RMU 1;  3GBF A;  1QJZ A;  2ZGT A;  1W6N A;  4A3Z A;  4LO7 A;  1RHI 3;  4ZZ5 A;  1JYV A;  4QGM A;  1PHM A;  3M70 A;  1KFX L;  3O1V A;  2OQ6 A;  5L36 A;  2HLE A;  4DEV A;  2HEW F;  4YZ1 A;  4Q0U A;  4IGP A;  3VDD B;  4FBF A;  2SLI A;  4CDW C;  2E26 A;  1Z7S 3;  4JTN A;  4LHN A;  2EID A;  5I93 A;  2QZ2 A;  3T2T A;  4CE8 A;  3LSE A;  4FCA A;  4NIG A;  5D2A A;  4A7Z A;  3U75 A;  4QKB A;  1QXP A;  5EFU A;  4YW1 A;  5GM0 A;  4DEQ A;  4JGZ B;  3I2D A;  2FMD A;  3ZXJ A;  4YRD A;  4GJZ A;  3LOB A;  4QDQ A;  3SQO A;  1ZBE 2;  2FQP A;  4UW6 A;  5F9T A;  2W1Q A;  5IK5 A;  3N9N A;  3I59 B;  2DU1 A;  4FPJ A;  3NNJ A;  4G9S B;  3I54 A;  3AX4 A;  3I2F A;  5C4W A;  2D6K A;  2D44 A;  1NE4 A;  1O59 A;  1CIW A;  5SV5 A;  2LW8 A;  4EZH A;  4AVV A;  2ZGS A;  1JZ8 A;  2BVV A;  4Y20 A;  1F8V A;  3O1M A;  2HWD 2;  1G9C A;  1XYN A;  4I01 A;  2WT1 A;  4YVW C;  4XQW A;  1ZA7 A;  1ZZC A;  4PF5 A;  4RR3 C;  4GAL A;  4B4Q A;  3OD0 A;  3I3Q A;  3AC0 A;  3IM0 A;  5FZ3 A;  3ZYB A;  2RG4 A;  3ME2 A;  1V6M A;  1QJX 1;  1ZZ8 A;  2LRP A;  4CDX C;  4OUS A;  5J3U A;  3RYK A;  2BOJ A;  5H9R A;  4QKF A;  1VAK A;  4QT6 A;  3I2H A;  1CAV A;  1GWM A;  2D6N A;  3H3U A;  3WW4 A;  1RB8 G;  1K45 A;  1YI9 A;  1ND2 B;  2WNE A;  1RUI 2;  2GMM A;  2LM3 A;  3H8U A;  5IW0 A;  3POJ A;  1MEC 3;  5SV8 A;  2MEV 3;  4DZG A;  5DZG A;  5T5L A;  3N7J A;  4DY3 A;  4KI5 M;  2VH9 A;  1DGR N;  2PXJ A;  2GND A;  1EUT A;  2BNO A;  2VVE A;  3RJR A;  3UJO A;  2QCS B;  5C8C B;  4SLI A;  4UFI A;  3MI8 A;  3FWE A;  4XJZ A;  5FY4 A;  1FMD 1;  1W8W A;  4YAR A;  5FYV A;  5K0U C;  4YVS A;  2A5Z A;  3ACH A;  2DCZ A;  2P34 A;  1X50 A;  1HRI 1;  5C3O A;  4W65 A;  4UFH A;  2TEP A;  1FOD 3;  1MS9 A;  1OUR A;  1AYM 1;  2PYT A;  2VQ0 A;  3KHB A;  3KT4 A;  3POG A;  4C1X A;  5CG8 A;  1JHJ A;  4Y4R A;  3EBR A;  4UF0 A;  5DUU A;  4AW7 A;  1BBT 3;  3EB7 A;  3HPN A;  3GNE A;  3VHN A;  3DKW A;  2PAE A;  4BMB A;  4IND A;  3CQO A;  4AQS A;  2VQU A;  3O14 A;  3W21 A;  4CCC A;  1O3T A;  2CAU A;  4FXK B;  1NX9 A;  5F2W A;  4IEO A;  4YW4 A;  1Q8P A;  4QQO A;  4BIS A;  2WAB A;  3ZXE A;  4S2F A;  4HSL A;  2X5I B;  2AYH A;  4Y1Y A;  1HB1 A;  4ZY9 A;  4NRQ A;  3O0V A;  3DPR A;  3SEE A;  3ZLI A;  3E6C C;  1S0G A;  2W08 A;  4LBM A;  3NW4 A;  5A1A A;  1G9D A;  3OB8 A;  1EAH 1;  1KFU L;  1AR6 2;  5BY5 A;  3HN3 A;  4FP3 A;  5KXD A;  3HNY M;  3WLU A;  1E5S A;  2Z5W A;  1GLH A;  2XHK A;  3HT2 A;  2VD7 A;  4JZR A;  4V2W A;  3GF6 A;  5HV0 A;  1RUF 2;  4AOC A;  2C1F A;  1S55 A;  4AI2 A;  2ET7 A;  1AXK A;  4AZZ A;  1RUC 1;  2RR1 3;  3BPS A;  1WBL A;  1PO1 2;  5C6C A;  4NWW A;  2XGX A;  1JYI A;  3R6S A;  3FHA A;  1W9Y A;  5GZF A;  1JYN A;  4CEY A;  1ASJ 2;  2BWC A;  3OGR A;  5T52 A;  5CFC C;  3RDI A;  3HJR A;  5FK7 A;  5EYX A;  4MYE A;  5L9R A;  5A3U A;  3MFA A;  4AG4 A;  3TRS B;  2PHR A;  4YWA A;  3OEB A;  4GA9 A;  1DZQ A;  5C3S A;  1OC1 A;  1FPN 1;  3WNL A;  4I0B A;  5JWP A;  1MZ6 A;  4PIZ A;  5IAV A;  2VOT A;  4U2A A;  1MZF A;  5FKB A;  1NLQ A;  4BE3 A;  1XNT A;  2IVI B;  5DUV A;  2RMU 2;  2Y6J A;  5FY5 A;  2CGO A;  2XUE A;  1A8M A;  3KVB A;  4QPG A;  5KWR A;  1V70 A;  1Y9Q A;  1POV 1;  1AZD A;  2R1D A;  1H6X A;  2WFF 1;  2EA7 A;  1OQE A;  3FL7 A;  3K3O A;  5FZ7 A;  5JZG A;  2BRT A;  5BYN A;  2AH2 A;  2R07 1;  4IE4 A;  3RPQ A;  1N1S A;  5EPA A;  1N47 A;  3DN7 A;  4Z8B A;  3SKV A;  3I3E A;  4Q4W 1;  2WNV A;  2MHF A;  2KM2 A;  4M3C A;  4CP2 A;  2HWC 3;  1MQT C;  3SIT A;  3PIJ A;  1GZW A;  1JYT A;  3LEI A;  2FDK A;  1DZT A;  4BJ0 A;  1O3R A;  1S0D A;  1XSQ A;  4RR3 B;  5M0T A;  4R4X A;  4L11 A;  1YIP A;  3VBO B;  3WHT A;  2JE9 A;  1PMH X;  2P1B A;  4NRP A;  3CHX A;  3B93 A;  4B4R A;  4C90 A;  3UJQ A;  3O0X A;  5JOX A;  3N3H A;  3ZR6 A;  1W6P B;  1XPW A;  2W87 A;  3NJZ A;  4YG6 A;  3RI8 A;  4Y26 A;  2ZGO A;  5BNP C;  2OXB A;  1QF3 A;  3OYW A;  5E1R A;  2IFR A;  2QFE A;  3V0A B;  1YUD A;  4D7S A;  1UQX A;  4URT A;  3WHU A;  2J7M A;  3ELN A;  3ZXD A;  3N36 A;  5FXX A;  5KXE A;  3NV4 A;  3B7M A;  3ES4 A;  2QTW B;  3IMM A;  4BQ4 A;  5LZ6 A;  1KXG A;  3B94 A;  4CDQ A;  1B35 A;  5CFD B;  1PX3 A;  4IQP A;  2O0O A;  4Q8L A;  3POW A;  3U1X A;  4O9E A;  5J98 B;  4IV3 B;  1OA2 A;  3KGL A;  1ZRI A;  1WCQ A;  2NYY A;  2ZAB A;  1QJX 2;  4I0A A;  1LHW A;  1ZNP A;  2V4V A;  1SBF A;  2WJS A;  1FXZ A;  3PMS A;  4XFI A;  5FFO C;  2QVS B;  2D3P A;  4A44 A;  3VL8 A;  1F4H A;  3BOD A;  4AQ2 A;  4D6Q A;  1OHF A;  1U0A A;  3EYP A;  1YLL A;  3CZJ A;  1RTV A;  3MV1 1;  2V4A A;  4IE7 A;  5FTT C;  3WF0 A;  5B2G B;  4XJA A;  2VR4 A;  3PVE A;  3M2M A;  4FAH A;  1AR7 3;  1QJU 1;  1OF3 A;  2B42 B;  2G4I A;  4AFM A;  5L9V A;  1AR9 1;  1LHO A;  3JXS A;  4P9G A;  4YVS C;  3MV0 1;  4FPE A;  1N3O A;  4TN7 A;  3FFQ A;  4LA3 A;  4B1L A;  4RHV 3;  4GWJ A;  5FV3 A;  1TMF 1;  4D94 A;  1W3X A;  1Y9G A;  5FZH A;  5BNN A;  1CAU A;  3IZO A;  1FMD 2;  1PZ8 A;  3WIN E;  4QXB A;  3WF1 A;  4CCK A;  2QNK A;  5FZK A;  5FYS A;  1KS4 A;  4OHV A;  4CU9 A;  3O1U A;  3RYR A;  2K46 A;  3ZPO A;  5E6H A;  2C9K A;  3WG3 A;  1W06 A;  1GIC A;  3KLS A;  3U37 A;  2B4K A;  3LIG A;  1HRI 2;  2BDR A;  1X82 A;  2WO2 A;  3AKP A;  3ETQ A;  3FHI B;  5FQ0 B;  3ILR A;  3LZZ A;  2YC2 A;  3WDT A;  1AYM 2;  3DYM A;  4DNY A;  5FZE A;  2K2S A;  2DTY A;  4BK5 A;  3PIG A;  1OLR A;  2QQL A;  3HBZ A;  4M0N A;  4JKK A;  3INA A;  2PTM A;  4RFR B;  4AVT A;  1NCQ C;  1RHI 1;  1GQP A;  1PGW 1;  1H2L A;  1VBA 3;  5CBL A;  3WZ1 A;  1DGW X;  1HJG A;  2RM2 1;  3AZW A;  1DDL A;  2W1U A;  1D2S A;  2FMY A;  4Q2F A;  2VCB A;  2QUO A;  2MNG A;  4C91 A;  5A3P A;  1Z7S 1;  1IKQ A;  2P17 A;  2WC2 A;  3ZXG A;  1QHD A;  5CG9 A;  1I3H A;  3E6B A;  4NIH A;  4CA9 A;  4KWK A;  2A70 A;  2I07 B;  1EAH 2;  4Q26 A;  1LED A;  1FNZ A;  1BEV 1;  5CFC B;  2DVA A;  3N9L A;  3NAP A;  2ZML A;  2J42 A;  5D21 A;  4BZ4 A;  4EWA A;  3LWC A;  4URA A;  1FT9 A;  2Z4F A;  5JMO A;  2GAL A;  2EAA A;  4PF1 A;  1F5J A;  5LA2 A;  3MLK A;  4P5H A;  1KIT A;  5C3Q A;  1NZC A;  1LGN A;  1SZB A;  1W9S A;  5AVP A;  4E4S A;  3SH4 A;  3Q8F A;  1Q8O A;  4WM7 A;  4YW2 A;  1RUC 2;  1BVV A;  1W28 A;  5HCF A;  4PJY A;  5IVF A;  1YWK A;  2QDN A;  1NKG A;  1CZV A;  1O3Q A;  3AYE A;  4UW5 A;  3M3E A;  3J4U H;  4JHT A;  4COV A;  4Q0S A;  4QXK A;  1QU0 A;  2LS6 A;  2WZR 3;  2WA3 A;  4PT6 A;  4LKE A;  4KWL A;  1MS8 A;  4OUE A;  1RUO A;  3BI3 A;  3JCI A;  4HET A;  5KC5 A;  2VUA A;  4QPG C;  4QX8 A;  4YLZ A;  5L7O C;  1FPN 2;  2XQX A;  4FPH A;  3RJ2 X;  4M3C F;  4QAW A;  1WKY A;  2VTX J;  1MQT B;  3AMQ A;  5A7N A;  1ULF A;  2JKX A;  4ITC A;  2VMI A;  4GJY A;  4LUL A;  2VNR A;  2XJR A;  3TB0 A;  3W5N A;  2WNU A;  1QJE A;  1SBD A;  4FOY A;  2WO7 A;  1SPP A;  4M0H A;  2P2K A;  5FY8 A;  4AGV A;  4HVQ A;  3H1W A;  3BTY A;  4CCM A;  2QQW A;  1RIR A;  4IGQ A;  2VXJ A;  2HH9 A;  4EQV A;  1XRU A;  3PJY A;  4AFC A;  2WFF 2;  5BNP B;  1MS4 A;  4MOA A;  1UD1 A;  3MFC A;  3D3A A;  4QX0 A;  4DRR A;  2C24 A;  2R07 2;  2E51 A;  5J96 B;  3T0B A;  2YC4 A;  3MW4 A;  3WXP A;  1OF4 A;  1X36 A;  4Q4W 2;  1JH5 A;  2BNM A;  4XIK A;  2PQQ A;  3A0K A;  1A8D A;  5FMD A;  1TZO A;  3IN9 A;  2VOV A;  5BNO B;  1J3Q A;  2W52 A;  3AKR A;  5E16 A;  1GNY A;  1FOD 1;  4I3G A;  1N1Y A;  2GP5 A;  4CDQ C;  1B35 C;  1FI2 A;  2ZX1 A;  3ZFE C;  1VBE 3;  1VMH A;  4WVM B;  5CB7 A;  3VHR A;  2BZD A;  1BBT 1;  2FZ2 A;  2JDZ A;  4DIQ A;  1DZR A;  2FDJ A;  2PN5 A;  1YJK A;  2NPI A;  2PHX A;  3CU7 A;  2XJP A;  1LEN A;  2ARB A;  2PQS A;  3VD4 A;  3ALQ A;  2DCJ A;  4CUG A;  4E2Q A;  3VKN A;  2RS1 1;  3DV8 A;  1C5I A;  2DCY A;  2CL2 A;  3PTY A;  4BQ5 A;  1DG6 A;  5GZD A;  1W2A X;  3CLP A;  4EE2 A;  5CYY A;  1IS4 A;  5FRA A;  3SH3 A;  1S1A A;  3ZSJ A;  4DQA A;  4EYU A;  4IEZ A;  1OQ1 A;  4AAP A;  4DXR A;  3PVN A;  3NV3 A;  1AX0 A;  4NWV A;  4V2V A;  4A7K A;  1NY7 1;  2O14 A;  2KD7 A;  2X29 A;  3I2O A;  4LXL A;  5LK7 B;  1ZZB A;  3OPW A;  2ZTN A;  1RJ7 A;  1YXW A;  1QJU 2;  1ZRR A;  2CSG A;  4Q4V 3;  4M00 A;  4COU A;  3WUC A;  3RSJ A;  1AR9 2;  1G9B A;  2RR1 1;  2Y6G A;  3NWK A;  2W3J A;  2GH8 A;  2Q1Z B;  3MUZ 1;  3R4D B;  5LRR A;  3ZIX A;  1VRH 1;  1ULD A;  2A6Z A;  4K6B A;  1J58 A;  4M4R A;  1GNZ A;  1NCQ B;  2HBT A;  5F6K A;  4AHZ A;  4EZ4 A;  1VBB 1;  3NL1 A;  1F35 A;  1OA3 A;  2PHD A;  4XC9 A;  5EJZ B;  3M4F A;  3THP A;  5K9Y A;  3AYA A;  3POE A;  3B5L B;  2RJK A;  1SFP A;  5EYY A;  4K8F A;  3ST7 A;  2YBK A;  4CEW A;  4TTG A;  1UZZ A;  1CZT A;  2VNO A;  2WNO A;  3PU8 A;  3KB5 A;  2ID4 A;  3WCR A;  1K3I A;  1BK1 A;  1KDK A;  2OPW A;  2G9F A;  3III A;  3V0B A;  2VMH A;  3AP9 A;  4X8P A;  3ZOI A;  4BOW A;  4CDQ B;  4XPV A;  3KM5 A;  2VTF A;  1UXX X;  4HK9 A;  1RHI 2;  4NIA A;  1PGW 2;  2J1U A;  2Q30 A;  2WRA A;  1NYW A;  5F3C A;  4MG2 A;  5JUV A;  2RM2 2;  4QPW A;  2D7F A;  3I2J A;  2DU0 A;  3KT1 A;  3THT A;  1VE0 A;  1SFN A;  5APA A;  1LAJ A;  2FD8 A;  5ACA 3;  2EIB A;  4LEJ A;  2YG0 A;  2C6S A;  4KBZ A;  3UKN A;  1LHU A;  1Z7S 2;  4B8E A;  4BM8 A;  4CP1 A;  1QQP 3;  1RXG A;  4ZU4 A;  5FUP A;  4XQD A;  5FZ6 A;  1W90 A;  1ST8 A;  3VBR C;  3WW2 A;  2ZGN A;  4P9Y A;  2HWC 1;  4QQH A;  4YZ4 A;  4C0H A;  1ZRD A;  4N53 A;  1BEV 2;  5JSR A;  2VME A;  2ERF A;  3H42 B;  4XF4 A;  3WDV A;  1LOF A;  4TXW A;  1F2N A;  1UZW A;  5BXX A;  4KQ7 A;  1ND2 A;  2QQJ A;  3IDE A;  2AEY A;  2L9L A;  4XJ8 A;  5LBE A;  4AEM A;  3SMH A;  1K42 A;  2K9Z A;  5CA6 A;  3L2Y A;  5EIY B;  2E33 A;  3LPF A;  1RIT A;  2ZHM A;  2QQN A;  2A71 A;  1S0B A;  4ASK A;  3KVA A;  4GWM A;  2WDB A;  4PDW C;  4LA2 A;  5C8C A;  3UKT A;  4NOT A;  5LY1 A;  1NCR A;  3HIF A;  1AX2 A;  3ZX7 A;  4PLO A;  4LBQ B;  1OOP B;  1H9W A;  3RG0 A;  3DYO A;  1DLC A;  3KV6 A;  4IW3 A;  3DXU A;  1YQ8 A;  1WW7 A;  2IXH A;  4WZC A;  1DHK B;  3J7H A;  2QQU A;  5BUV A;  1C8M 3;  3O1S A;  1LOC A;  3MIB A;  5CNA A;  3R4U A;  4UFL A;  4BCU A;  2VW2 A;  3AP7 A;  2YU2 A;  2D3R A;  1K5M C;  4GWN A;  4BK4 A;  1AR7 1;  2E31 A;  1NT0 A;  3PLQ A;  1W6M B;  2GSY A;  1HN1 A;  3ZFE B;  1UOG A;  4ZHN A;  1BHG A;  4NUB A;  3ZVX A;  2DCK A;  4LMF A;  4ONU A;  5FZL A;  2D5H A;  2V73 A;  1GZ9 A;  1D0G A;  5T54 A;  2VY0 A;  1GQG A;  1PMJ X;  4RQP A;  3TOJ A;  1AVB A;  1YQC A;  4NRO A;  3UT0 A;  4UBH A;  2BFU L;  3CEW A;  1UYP A;  3ZYR A;  4CPB A;  5KHJ A;  4P9I A;  1GOH A;  1HW5 A;  1UKG A;  5A6X A;  1S0C A;  3MIF A;  3CJX A;  5FZA A;  5DUX A;  2HEV F;  4GB3 3;  4LBO A;  1UWW A;  5J7M A;  3AP6 A;  4GAZ A;  1FOD 2;  1JUH A;  4UFM A;  4AVS A;  3JU9 A;  4WM8 B;  2X53 S;  4LBQ D;  2BER A;  2KR2 A;  1QOO A;  1AL2 3;  3MUY 1;  2JD4 A;  1BBT 2;  2HWD 1;  1UYZ A;  4KWJ A;  5J37 A;  4BQY A;  2ZKL A;  1VBA 1;  4QB6 A;  5FOJ B;  1LOD A;  2JD9 A;  1RUJ 3;  3ZN4 A;  4AED B;  3RRD A;  1IQD C;  1NA1 A;  2BOI A;  1S2K A;  2ZX0 A;  2RS1 2;  3LFM A;  3MBW A;  1JS9 A;  5T5O A;  5HPO A;  4E8D A;  4S2D A;  3FC0 A;  3USU A;  4L2N A;  1HXS 3;  1X9P A;  1HN0 A;  2UU8 A;  2CGN A;  3GM8 A;  4OI2 A;  2BGC A;  4R9B A;  4H7L A;  4Z2A A;  3QAC A;  4XXA A;  3OY8 B;  1NY7 2;  4J1W A;  3VLB B;  4CDU A;  1MVQ A;  3H3Z A;  4CP9 B;  2J1S A;  1JOJ A;  1XU2 A;  3MID A;  2VM9 A;  1HB2 A;  2ARC A;  4FFH A;  5JI9 A;  3VZK A;  2VZQ A;  2RHP A;  4QQL A;  1OQD A;  2RS3 3;  2A6X A;  2UYA A;  2VCM A;  4BHP A;  5ABJ A;  2VUC A;  2JG8 B;  2Z69 A;  2RR1 2;  4K9S A;  5A7W B;  1LKN A;  4QHB A;  3GGL A;  4LQR A;  1EV1 1;  3EMR A;  4OHX A;  4XDO A;  2VZP A;  4Y5S A;  3S30 A;  3OGJ A;  4D7T A;  1QH6 A;  4OZO A;  1VBB 2;  2W39 A;  3NNF A;  5GZG A;  2ZAA A;  3KCX A;  2ZZJ A;  2WZR 1;  4KNC A;  4XIO A;  5FJH A;  1IG3 A;  4NO4 A;  4DFS A;  1SBE A;  1T6G C;  1XU1 A;  2R04 3;  4LKF A;  1BMV 1;  5C5U A;  2EAK A;  1TNR A;  3KT7 A;  3ZMO A;  2GN7 A;  3VD9 A;  4NE9 A;  3VBR B;  3VBF B;  4NPR A;  4F3J A;  3VD3 A;  1V0A A;  4OHW A;  4DXS A;  3WW1 A;  4DRV A;  5JOW A;  4IET A;  4OFG A;  3V0A A;  1KJL A;  1SQ4 A;  3ACL A;  3OD4 A;  5F3E A;  2XLA A;  2B39 A;  1WLW A;  2OII A;  2ZOE B;  4KU8 A;  3TBD A;  4MXW B;  2VTX A;  3AL6 A;  1GP5 A;  2JX9 A;  4N53 C;  4LLO A;  1W2O A;  1LOF C;  4QPI A;  1LB2 A;  2O1Q A;  1OLM E;  1SMV A;  1APN A;  1SLI A;  2CY6 A;  2VG9 A;  3QD6 A;  4NVP A;  1HDK A;  3QBQ A;  4BIF A;  1EPZ A;  4XFG A;  2UWA A;  4O9G A;  5F6L B;  4L0P A;  4QHO A;  2ARX A;  2WLQ A;  4PDW B;  3I4I A;  1N1V A;  2Q1F A;  5AFB A;  2HWC 2;  5JXH A;  5JSP A;  4YGE A;  1R09 3;  1DP0 A;  2C9A A;  2D6O X;  5LWB A;  5FLJ A;  1FNY A;  3UKV A;  4BYY A;  3BUC A;  3GCX A;  4UFK A;  4A6O A;  4H2A A;  3EXU A;  4AVC A;  2BP6 A;  4Q8K A;  2KXL A;  3KSC A;  4PIX A;  2ZA9 A;  4F7Z A;  3IAQ A;  1WD4 A;  3RWN A;  1GP4 A;  4X8N A;  3PL0 A;  1ALY A;  1PNG A;  5FZ1 A;  1DGL A;  1UMI A;  2WT2 A;  3LD8 A;  4ZU5 A;  4JKL A;  4BU2 A;  2VE1 A;  1CIY A;  1WWY A;  1QY4 A;  1K5M B;  2DUR A;  2EXJ A;  1ODN A;  2RDS A;  4CVU A;  3VHP A;  1VAM A;  5A7Q A;  1I1E A;  3ZMN A;  4AQT A;  5FZ4 A;  4CP0 A;  1VJ2 A;  3O1R A;  4COZ A;  2Q8D A;  1T6B X;  2B9V A;  4YYO A;  4YM3 A;  4D69 A;  1VBC 1;  2JG9 C;  2WR9 A;  3GZE A;  1YHF A;  2Q5T A;  4DUV A;  1OKQ A;  4FP2 A;  1JYX A;  4HPK B;  1GWL A;  3L2H A;  4QDR A;  2GH2 A;  2XVK A;  2BBA A;  4Y24 A;  5FLI A;  1AYN 1;  3R0R A;  5GZE A;  1QXR A;  4IXL A;  1AL0 G;  3TYJ A;  3J7M A;  4N43 C;  2XB6 C;  3UGH A;  3MGU A;  3Q9O A;  3UV9 A;  3WDW A;  1O4Y A;  4IEP A;  5C70 A;  1JZ3 A;  5DUW A;  4RQP C;  1AR7 2;  1UOF A;  4Q4X 1;  3VBH B;  5FPB A;  4Q1R A;  3ZFF B;  5I0T A;  5T55 A;  1R08 3;  2ZEY A;  1H2N A;  2TUN A;  3AVS A;  4OI0 A;  5FZC A;  2ZGK A;  4YG3 A;  4L97 A;  2B46 X;  3POS A;  3GZU C;  3RMX A;  1MZ5 A;  2ZGL A;  5BPX A;  4ES8 A;  2VOX A;  3OGV A;  4OVE A;  1H8V A;  3OBT A;  2HYX A;  2C26 A;  4ES9 A;  2A3W A;  4H55 A;  3OGG A;  4RA0 A;  5CVR A;  4AXO A;  3BKZ A;  2GNM A;  3MLJ A;  4OQ8 A;  3GBG A;  1VBD 1;  3RGB A;  4P9L A;  5I8T A;  1UX6 A;  1DIW A;  2DDU A;  4YM0 A;  3T2Q A;  5JLV A;  4CXY A;  1RUG 3;  1GKB A;  3D8C A;  2BW8 A;  4GD4 A;  5DG1 A;  2ZX2 A;  4JRA A;  2EIG A;  3WQB A;  1GOF A;  2LRO A;  3LGR A;  3VZO A;  3AP4 A;  1POQ A;  1Y3T A;  1Y9M A;  2JWP A;  3DEM A;  1TME 3;  1VBA 2;  2UUR A;  4AL9 A;  3T2O A;  2VUD A;  2A7A A;  3WNK A;  4OMD A;  4CUB A;  4CDU C;  4QHZ A;  3SCF A;  2WYF A;  4MAD A;  4COW A;  3WY6 A;  4XVH A;  3S7E A;  5ACA 1;  2VZU A;  1COV 3;  5IAT A;  1QQP 1;  4LKD A;  2RS5 3;  1QWR A;  3HNB M;  1S4C A;  4YM1 A;  1US2 A;  4CUA A;  3HWJ A;  1UY3 A;  4AYU A;  4CSW A;  2WN3 A;  1WBF A;  3WUD A;  2Q0A A;  5C3P A;  5FZO A;  1H4G A;  4EWD A;  4Y1V A;  3H7Y A;  2BGO A;  1A34 A;  1RMU 1;  2UY8 A;  4YW7 A;  4R52 A;  1SHW B;  3SH5 A;  1DLL A;  1O6U A;  1BXH A;  3T1L A;  4YZ2 A;  4XAB A;  1E5H A;  2WFP A;  4LKS A;  1EV1 2;  3S5Q A;  1WA6 X;  1N3P A;  4K40 A;  1W8Z A;  3CO2 A;  1JN2 P;  1HLC A;  3PUR A;  3ZYH A;  3P5B A;  2WZR 2;  3TEY A;  4XUO A;  4E27 A;  1BMV 2;  2XDV A;  1BJQ A;  2IXK A;  2RDQ A;  5BNO A;  3RZJ A;  4OCT A;  1MPX A;  2YUE A;  2IC1 A;  3ZR5 A;  5DAX A;  5F5A A;  4BQ2 A;  4ISR A;  4CCN A;  2V5Y A;  5E8A A;  3A21 A;  4U36 A;  3OPT A;  3UK9 A;  2QBX A;  2PMW B;  4KG8 A;  4XUT A;  3WQ7 A;  4NHY A;  4P9W A;  1I5Z A;  4RD7 A;  5A6Y A;  2WN2 A;  4XXP A;  1S2E A;  3WNM A;  1Q8V A;  1Z0H A;  1UZV A;  3AMM A;  5EZW A;  3ZSE A;  2H6C A;  5C7G A;  5DAB A;  3I8T A;  3J26 N;  4QMA A;  2ZEW A;  3E97 A;  4XCA A;  5EJ3 A;  5GLW A;  1VIW B;  3N9Q A;  4FFI A;  1AJK A;  5JPM B;  5A33 B;  1LU2 A;  1EYB A;  2QQK A;  4HZF A;  4E9K A;  2X8K A;  3CJI A;  4HVO A;  3K3N A;  2G9Z A;  2I74 A;  1W0P A;  2HWB 1;  4XHB A;  2Y6F A;  1CN1 A;  2CDP A;  3GZT B;  5A32 A;  1IS5 A;  4NHK A;  2VMG A;  4GH4 A;  4IEW A;  4DUW A;  2VAU A;  1ND3 A;  2VCC A;  5EV7 A;  2GP3 A;  1UU4 A;  3WR0 A;  2JG9 B;  1B09 A;  4GB3 1;  1SCR A;  1QGL A;  1GYK A;  4DXT A;  5T5J A;  3WG2 A;  4Y33 A;  5FOB B;  1L7L A;  2DBN A;  4N43 B;  1UW8 A;  1PNF A;  4IER A;  4UI9 L;  2CAV A;  1NQD A;  1WCU A;  2OPK A;  2D93 A;  2XJQ A;  3APB A;  2VQA A;  1AR8 3;  1RJ8 A;  1OVP A;  4FPF A;  4AQ6 A;  1NUK A;  5KR7 A;  4XUR A;  4AI8 A;  4CDW B;  3POY A;  3FE5 A;  2OT7 A;  3USS A;  2J1A A;  1VBC 2;  1IS6 A;  1XYP A;  4EN6 B;  4OUM A;  2JB8 A;  3OG2 A;  1LHN A;  3FZ3 A;  3K2O A;  4ET7 A;  1AF9 A;  1MS0 A;  1F5F A;  4LIT A;  5FYC A;  1AYN 2;  5FZI A;  3D0J A;  1GMM A;  4ZKT B;  1JI6 A;  2PFW A;  4L92 A;  2YRO A;  4Q4X 2;  4ATF A;  2O8O A;  2QDR A;  2RS3 1;  1VB2 A;  1JUI A;  4LOT A;  5A7P A;  1UZ0 A;  3U11 A;  2VL4 A;  5JSO A;  5A3L A;  5FP9 A;  3VDC A;  2ZGM A;  4L9B A;  5JIU A;  4CCL A;  4S2H A;  4BLJ A;  4BQX A;  5C4W C;  3J8F 3;  4HSJ A;  3QCW A;  3QH7 A;  4YVW B;  1PVC 3;  4CZS A;  2FDH A;  2JDP A;  1TG7 A;  4QXC A;  2WT0 A;  1SLC A;  2R04 1;  5C8W A;  4RS5 A;  3AMH A;  1VBD 2;  4QD2 A;  4CDX B;  4KG0 A;  5DN2 A;  2VO5 A;  2YYO A;  3C3V A;  5G04 L;  3LKJ A;  3WNN A;  5HXM A;  1FX5 A;  3OUI A;  5IK4 A;  1IKP A;  3VZJ A;  1ULP A;  3OEA A;  2JKB A;  3THD A;  4FTS A;  1PZ7 A;  1HJF A;  3VBS A;  4A2U A;  4HL0 A;  3OGS A;  4MLO A;  3TWI A;  2D5F A;  3G7D A;  1GOG A;  1HKD A;  1OOP A;  3NJX A;  4LBQ A;  4K7J A;  1AXZ A;  4LUK A;  4QM9 A;  5LBF A;  5ACA 2;  3H1M A;  4LIV A;  4IEQ A;  2GME A;  4SBV A;  1CON A;  1QQP 2;  1ZM1 A;  1DYP A;  4XZP A;  1PK6 A;  4QX7 A;  3VD7 A;  5FZB A;  3RYP A;  1C1L A;  5K0U B;  1UOB A;  1O8S A;  2E63 A;  3WP3 A;  3IPV B;  4YSF A;  3K75 B;  3WNX A;  1I5P A;  1CAW B;  3OUJ A;  5LBC A;  3LF7 A;  4QX3 A;  5ANN A;  1J3P A;  4J6G A;  1CVN A;  2XJS A;  1RUE 3;  5IHR A;  1PVX A;  1RMU 2;  4LK7 A;  2NZ9 A;  3ACF A;  3HNM A;  4ZXE A;  3TAY A;  1PGL 1;  4QDS A;  3LDR A;  2OKX A;  4I3P A;  3OSD A;  4MUV A;  4N9I A;  2W5F A;  1E5R A;  1HIX A;  3ZKY A;  1G8W A;  1OXC A;  1KDM A;  2XQR A;  4XCB A;  1CGP A;  1G6N A;  4AEJ A;  1CX1 A;  1W6O A;  4V1P A;  5BNQ A;  1PO2 3;  1JHN A;  2WA4 A;  3AFG A;  3S0M A;  1AXY A;  5LY2 A;  5FYY A;  5JOZ A;  5B4X A;  4NHX A;  1HQN A;  1C8M 2;  1YQ5 A;  4JTO A;  2JDM A;  4HKW A;  2FBE A;  4FO9 A;  4LR4 A;  5KHH A;  4A3X A;  1XND A;  1J59 A;  3C7F A;  4WM8 A;  1ZBA 1;  3KS7 A;  4MO3 M;  5F5Q A;  4W6X A;  1A3K A;  3V64 A;  3DPR C;  4LNV A;  1GQH A;  3CJI C;  3WNO A;  3ZN6 A;  1XBF A;  4DIN B;  1PM4 A;  1UU5 A;  2Q1M A;  2JDN A;  2ZZQ A;  4A6S A;  5LK5 A;  2VZ1 A;  1RUH 3;  3K4Z A;  3VV1 A;  1R08 1;  1FAT A;  2X09 A;  3K51 A;  4HN1 A;  1L7R A;  5F3I A;  4MX3 A;  2W46 A;  2QQI A;  2W0X A;  2ZGP A;  5EJ1 B;  2W47 A;  1JYC A;  3ZFG A;  4HOO A;  1CAX A;  1LNS A;  4LBK A;  1UXZ A;  2HWB 2;  5FXW A;  3S6P A;  5FYT A;  4D6R A;  1GAN A;  3J9S A;  3VBU A;  1C8N A;  3RZK A;  1W6N B;  4KU7 A;  4COY A;  4EN8 B;  4KL1 A;  4FAG A;  5DAW A;  2A6V A;  3VHO A;  4CEY C;  4CP9 A;  2WYS A;  1HX6 A;  3FX3 A;  3T09 A;  5D8A A;  2WWS A;  5KXC A;  4GB3 2;  3SKJ E;  3A7Q A;  4DO0 A;  1JTZ X;  2J1V A;  1CQ9 A;  3A22 A;  3U10 A;  1OMI A;  4IL7 A;  4IE0 A;  4Q29 A;  2AAC A;  4I09 A;  1QOS A;  3H0O A;  1AL2 2;  3GXU A;  5KHI A;  5I91 A;  2YU1 A;  3C8X A;  5AFE A;  3ZYI B;  4BLI A;  2E32 A;  5LAT A;  1GV9 A;  5IVC A;  2XLG A;  2W1W A;  3MHZ A;  3T0A A;  1UYY A;  4GWI A;  1R1Z A;  1COV 1;  4XBQ A;  1ULE A;  2WAA A;  3I7D A;  4KGG A;  5C4W B;  1U5Y A;  2IWG B;  5JZG C;  4JKM A;  5A6Z A;  1VRB A;  3ORJ A;  4Y20 B;  3TNQ A;  2OUJ A;  2GNB A;  1G9F A;  3KV9 A;  1XC6 A;  3CZU A;  2WNV C;  1W05 A;  3I2G A;  3LA2 A;  3MIG A;  4M01 A;  4WVW A;  3VB9 A;  1MEC 1;  4Q4Y 3;  1OD3 A;  5T5P A;  4MXW A;  1YFU A;  3VGI A;  2MEV 1;  4UOJ A;  4BPZ A;  3U4X A;  2RS3 2;  2W2I A;  4LIU A;  3IDA A;  3KF5 A;  4RS5 C;  4WV8 A;  5BV6 A;  4C1W A;  3EQE A;  1D7P M;  3AZV A;  3KD4 A;  4IV1 A;  3AKT A;  1XNK A;  3C7E A;  4Z07 A;  2JB4 A;  2GC3 A;  5FMB A;  5GLZ A;  4IE6 A;  4AI9 A;  3WQ1 A;  1CAV B;  1LGB A;  4XJW A;  5FY1 A;  2WQZ C;  4OQ9 A;  3U78 A;  5FBJ A;  5FCC A;  2R04 2;  1HRV 3;  5IUQ A;  1W04 A;  3H1Y A;  1ZZ9 A;  4M3C E;  3PUA A;  5J09 A;  2PHU A;  4P08 A;  4QGL A;  5H9Q A;  4CU7 A;  3VN4 A;  5HCH A;  3ZO0 B;  4I30 A;  5C3R A;  1STM A;  1KRI A;  5F7U A;  2JEC A;  2WII B;  2XJV A;  3ZPY A;  1JOB A;  1MS5 A;  1JZ7 A;  4TWT A;  2DUP A;  2G19 A;  4FXG B;  4LJH A;  1PK6 C;  5FO8 B;  2B45 X;  2VZ3 A;  4RGK A;  4UW4 A;  2RV9 A;  3SHR A;  3ZIW A;  3KCY A;  4YVS B;  1OI6 A;  2YMZ A;  3KMH A;  2DFB A;  1H8T A;  4MGY E;  4EN0 A;  4HVR A;  4JGY A;  4ORF A;  2DYC A;  3ETP A;  2QQV A;  3P6B A;  1Y7B A;  1LCL A;  5EHD A;  4PI2 A;  5DDJ 3;  1NAE A;  3S7I A;  5GAL A;  5C9A A;  1OUS A;  4DMI A;  2ENR A;  1W3V A;  2Y34 A;  1XXN A;  1GUI A;  4AGG A;  5K4L A;  5BNN C;  3M3O A;  3B02 A;  2ES3 A;  4ZU7 A;  1NOV A;  2VVF A;  1OFS A;  4Z92 B;  4FTE A;  3AB0 A;  4AGR A;  3VDD A;  5IWF A;  5FP8 A;  4BXF A;  1IG0 A;  1LOG A;  1V00 A;  1PGL 2;  4OUL A;  5GKA C;  4H14 A;  3DPR B;  4K1Y A;  3B01 A;  5A3O A;  4B3N A;  4EN7 B;  5I0R A;  3JQX A;  4C0B A;  2VZR A;  1EUU A;  1L3J A;  3HR9 A;  3WP5 A;  4IGO A;  3PVB B;  1AR8 1;  2P3J A;  4JGZ A;  4N8M A;  1IQA A;  4AFD A;  4P00 B;  5HV4 A;  1EP0 A;  2E6V A;  1Q5O A;  4I2O A;  2W68 A;  4XFB A;  1REF A;  4UYB A;  1F31 A;  2XKP A;  1X9T A;  2WIN B;  2QZ3 A;  2VMC A;  3JD7 3;  3I59 A;  3MF6 A;  3PNA A;  1GU3 A;  2RE9 A;  1U5I A;  2ZPX A;  1URX A;  4R8H A;  3DUI A;  1ZBA 2;  4JDO A;  4QKD A;  4E2G A;  1SLL A;  5B4N A;  5DMY A;  1OUX A;  3IKW A;  2G1M A;  3ZFG C;  4CEY B;  5FRE A;  4XE9 A;  4Y4Y A;  3NAP C;  4GIQ A;  1R08 2;  1V6I A;  3CKH A;  5D8A C;  3KV5 A;  5TSW A;  1SLA A;  3BIW E;  1OT5 A;  3NMB A;  4WM7 C;  3LCP A;  2YBP A;  3TEW A;  1H6Y A;  1V6K A;  4BDV B;  4FVV A;  3DCQ A;  1PVC 1;  4Z1V A;  1QJF A;  4FSJ A;  3OBR A;  2VCA A;  1ACC A;  1DGR A;  1TEI A;  1WCS A;  3D5O A;  3LOI A;  4D8M A;  4QPG B;  1VMJ A;  2YPD A;  5F1R A;  5L7O B;  4XF0 A;  4AHY A;  5HI0 A;  4X6R B;  5JZG B;  1RUG 2;  3BOW A;  3ZYF A;  1AHS A;  3JQW A;  4GQ7 A;  1QJX 3;  4K1Z A;  4XDQ A;  2VU9 A;  2WNV B;  4LE4 A;  4M3C B;  3TN9 3;  1CPN A;  3ZSK A;  1GZC A;  1GZW B;  1LRH A;  2Q8E A;  2JE8 A;  2R49 A;  2WNU C;  2VNG A;  3IDC B;  1GBG A;  2AEN A;  4OLL A;  3GAL A;  3ZXK A;  4P9X A;  3FUO A;  1UO9 A;  2V5D A;  3E5Q A;  4AE2 A;  2YBS A;  1COV 2;  4R9A A;  4NJ4 A;  2RS5 2;  4B4P A;  4QX5 A;  4QU1 A;  1QKQ A;  1ULO A;  4MET A;  1H1M A;  3OYW B;  5LW9 A;  2W94 A;  3OTF A;  3SIS A;  3P3P A;  1TVG A;  1MEC 2;  1FMD 3;  1XE0 A;  4FQZ A;  1UX7 A;  4LO4 B;  5FYH A;  4D0Q A;  1FV2 A;  1RUE 1;  1VPH A;  1S0F A;  2MEV 2;  1B35 B;  2ET1 A;  1WW5 A;  2R0H A;  2VQT A;  2WO1 A;  2YV8 A;  3B00 A;  4WVZ A;  1DYK A;  2DUQ A;  2X5I A;  1EPW A;  2JDU A;  1QIQ A;  1X8E A;  1CJP A;  2DVF A;  2ORZ A;  3MYX A;  3NNG A;  3T08 A;  4K20 A;  4RHV 1;  3WG4 A;  5A1F A;  2P37 A;  3ENR A;  4YZ5 A;  2VBP A;  5JR7 B; 
#chains in the Genus database with same CATH homology
 3I3Q A;  3RZM A;  3H8O A;  4IE4 A;  4CXX A;  5F8P A;  2FDG A;  4QKF A;  4JHT A;  3BKZ A;  3S5A A;  4MGT A;  2FDK A;  4MG2 A;  3BTZ A;  2FD8 A;  3BU0 A;  4CXY A;  3BI3 A;  4NRP A;  3T4H B;  3RZK A;  3H8R A;  3O1T A;  3RZG A;  3RZL A;  3BTY A;  4IE0 A;  4QKD A;  3H8X A;  3O1O A;  3KHB A;  2FDH A;  3BIE A;  4IE7 A;  4NPL A;  3RZH A;  3O1S A;  4QHO A;  3T4V A;  4NRQ A;  4NPM A;  4NID A;  2FDJ A;  3BUC A;  3S57 A;  3O1U A;  4ZS3 A;  3RZJ A;  4OCT A;  4O7X A;  4ZS2 A;  3O1V A;  4ZHN A;  4IE6 A;  2FDF A;  2IUW A;  4CXW A;  4NRO A;  5DAB A;  4RFR B;  4QKN A;  3O1P A;  3O1R A;  3I2O A;  4NIG A;  4NJ4 A;  4QKB A;  4IE5 A;  3I49 A;  4NII A;  3I3M A;  4NIH A;  4IDZ A;  2FDI A;  3O1M A;  3T3Y A;  3BTX A;  4NRM A;  3LFM A;  4O61 A;  3KHC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...