3T3YA

Crystal structure of alkb in complex with fe(iii) and 2-(3-hydroxypicolinomido)acetic acid
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
199
structure length
199
Chain Sequence
b'AAGAVILRRFAFNAAEQLIRDINDVASQSPFRQMVTPGGYTMSVAMTNCGHLGWTTHRQGYLYSPIDPQTNKPWPAMPQSFHNLCQRAATAAGYPDFQPDACLINRYAPGAKLSLHQDKDEPDLRAPIVSVSLGLPAIFQFGGLKRNDPLKRLLLEHGDVVVWGGESRLFYHGIQPLKAGFHPLTIDCRYNLTFRQAGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-ketoglutarate-dependent dioxygenase AlkB
publication title Dynamic combinatorial mass spectrometry leads to inhibitors of a 2-oxoglutarate-dependent nucleic Acid demethylase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 47
structure length 199
sequence length 199
ec nomenclature ec 1.14.11.33: DNA oxidative demethylase.
pdb deposition date 2011-07-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.590 Mainly Beta Sandwich Jelly Rolls Alpha-ketoglutarate-dependent dioxygenase AlkB-like 3t3yA00
2FDGA 2FD8A 3O1VA 3BTXA 4IE0A 2FDJA 4ZHNA 3O1OA 4CXYA 4IDZA 4IE7A 4NRQA 3LFMA 3RZGA 4QKFA 3O1RA 4QKBA 5F8PA 4O7XA 3O1UA 4NJ4A 3RZHA 4NPLA 2FDKA 3BUCA 3I49A 3RZKA 3BI3A 3KHCA 4QKNA 3H8RA 3O1MA 4ZS3A 4IE4A 4NROA 4NPMA 4NIIA 2IUWA 3KHBA 3BIEA 2FDIA 4CXWA 3RZLA 3T4VA 4QKDA 3S57A 4IE5A 3O1PA 3T3YA 3O1SA 4CXXA 4QHOA 4OCTA 3BKZA 3RZMA 4NIHA 4MGTA 4RFRB 3T4HB 2FDHA 4NIGA 4NRMA 3H8XA 3H8OA 3BU0A 3S5AA 2FDFA 4NIDA 4NRPA 4JHTA 3BTYA 3RZJA 3O1TA 4MG2A 3I3QA 3I3MA 3I2OA 5DABA 4ZS2A 3BTZA 4O61A 4IE6A
chains in the Genus database with same CATH superfamily
2LS6A 4Z2WA 1XYNA 4DINB 4MO3M 3GDBA 1W8NA 5LEJA 3ZFFA 3NAPC 4SBVA 4QX3A 1O8SA 5T52A 1R092 5DDJ3 1V6KA 1N3QA 5FXZA 2QBXA 1IHMA 2ERFA 1LHOA 4N53A 5DQ0A 1PZ9A 3H9AA 2FDJA 4OHVA 1PGW1 4UFHA 4YW5A 1SFPA 1ND3B 4ZU4A 2V73A 4RR3A 2P4EA 4JKKA 3KVAA 3GBWA 3EXUA 4Y1YA 4LA3A 4B4RA 4ZXEA 3W21A 3LFMA 3DGTA 3H42B 5BNNA 2J22A 3RZGA 2D44A 1GOHA 2R7EB 2BJSA 5L9RA 3AKTA 2VO5A 3E97A 4OUSA 5F8PA 3AXDA 2OYZA 3PMEA 3I97A 5C5UA 4INDA 1K12A 1F35A 3NO8A 2Z69A 3LQCA 4QM8A 3VBHB 4E9KA 4R9AA 3MGUA 2F6BA 1LU2A 5E89A 4E27A 2E26A 1IQAA 4MXWA 2Z42A 2PHUA 5EPAA 3AMHA 3UK9A 1S0CA 1RITA 2Y6HA 5C4WA 3O1MA 1Y7BA 2XJUA 1JU3A 3LEGA 1RHI3 2C0ZA 3AX4A 3RVHA 1GUIA 3MDPA 3PNAA 5FYIA 1E57A 1MS9A 1RUF2 1TG7A 3JB8A 2ADDA 4GMP1 2N7GA 4Y4YA 3TEZA 1KS4A 1CVNA 2BRTA 4S2HA 4XXPA 3EO6A 1Z7S1 2EICA 1V6OA 2RVAA 2CAUA 4QB2A 3CZJA 1TVGA 3BVCA 2CDOA 1QGLA 4CCEA 2PQQA 3N9NA 2HWD1 5FBJA 2WNUB 3T4VA 4GB33 1UZVA 3I2JA 1PX4A 4CCOA 4NMIA 2HBTA 1LRHA 5JSOA 2WT0A 2X05A 2VD7A 3WF3A 3OSDA 4V2VA 1AYN1 4AHWA 3VDCA 4NR1A 2P6HA 4QGNA 3O1PA 4RGAA 4MVTA 1YWKA 2VVDA 2NN8A 2ZZQA 3M3IA 2B45X 3Q8AA 1PGL2 1C1LA 1D2QA 3KF5A 1P8JA 2W95A 3RFRA 3FHQA 2JEMA 1PK6B 5D8AA 5FY1A 2D3SA 4IEQA 1VBA3 1QJU3 5FXWA 4YZ4A 2PHXA 4HVRA 2R073 2FZ2A 2WWSA 1HB4A 4QXHA 3V0AB 3UGHA 4L92A 5FZLA 2D3RA 1NAEA 1V9U3 1QNWA 4ARYA 2XBO3 1OLMA 3H8XA 5FYTA 4RL7A 4IEYA 1NY72 2NMNA 1NA1A 3RDIA 3NVCA 4RQPA 2OX0A 4YFZA 3Q8FA 3E5QA 1AR73 5KR7A 4E4SA 1DQ6A 4IL7A 4LPLA 2AZ5A 1W2TA 4E4ZA 1REFA 4YZ5A 5FZGA 2XQRA 4XC9A 5FK7A 4D6SA 3SXWA 5ABJB 2XJVA 4CDQB 2P3YA 3SH3A 3THCA 2JG9B 5DZFA 1NXD1 2ARXA 1UZ0A 5FMCA 3VBOA 4WVMB 1AR81 2JDZA 2ET1A 2EIGA 5E8AA 1HX6A 4Y1XA 3ZOIA 2O8OA 2V09A 3WQ0A 4P9LA 2ENRA 2BGCA 1UYPA 3L2YA 2RR12 1UZYA 1UL9A 2PHLA 4JGYA 2K0GA 4XW3A 4Q4Y1 1GMMA 5T50A 3H3LA 5IFPA 4OLLA 1AX1A 2ZOEB 2Q30A 3AP6A 1C5IA 3VBHC 3WQBA 3AKQA 4HETA 2OT7A 5G04L 1H4GA 1QJY2 3AP9A 4IEUA 5BNPB 1H9WA 3MV11 1UY0A 3ZXGA 3IKWA 3VZNA 1NCQB 2HWF2 4IV3B 5IUQA 4HMZA 4MADA 3PJYA 5K0UB 3H3UA 5C9AA 1S55A 1W6MA 2A6WA 1VAVA 1AR63 1MEC1 2LM3A 1RUC1 3I4IA 5LA2A 2DBNA 4XJ9A 2GC0A 3KV5A 3AM2A 3K46A 4MX3A 1R1A1 1ACCA 2DYCA 2H0BA 1OKQA 2JE7A 3NMBA 4HK8A 2D40A 3H1WA 4Y22B 1HJFA 5FZBA 4N8MA 5EQUA 4N7UA 4LKDA 2OIIA 4PBOA 3UV9A 1MR5A 1JXNA 3O0VA 2WNUC 1NQJA 4GWIA 5CBLA 4RHV3 5IJRA 3RGBA 1NLRA 1JODA 2FMDA 1WCDJ 1FPN2 4UW6A 4Q4V1 3DV8A 4IESA 3KT7A 3VZMA 1Q43A 1POV3 3INAA 4Q0SA 4UF0A 1UIKA 4AG4A 4M3CE 3NNFA 3B69A 2CNAA 4HG6B 3RRDA 1MVEA 2W3JA 4AVCA 3DYMA 1W3XA 4ZXKA 2IFWA 4O9GA 3OJBA 2YGMA 1FI2A 1BEV2 3WQ7A 1N1TA 1GP4A 1PK6C 1SBDA 4QKDA 2WZEA 3IWZA 1QXPA 4YRDA 1FNYA 5FMOS 1ZNPA 5JI7A 4IEXA 1MACA 2YBPA 1PVC2 5FYCA 4EYUA 2GMPA 2RM23 3O1SA 4IQPA 2R061 3A22A 3VKOA 4H14A 3OD4A 2E31A 2XH6A 3TAYA 1C5HA 1H2KA 3MIGA 3LOIA 4JQRA 2QJVA 4A3ZA 5FK8A 1JYVA 1LU1A 4JRAA 1X33A 3KV9A 5CA6A 3ZIWA 2RMU1 5EJ3A 2HWE1 2R0HA 1APNA 2ORXA 1A8DA 1FOD1 4QQHA 4CEWA 2ORZA 2VNRA 1XPWA 5ABJC 2UYAA 3H0OA 1RUH1 4RD7A 3WG2A 2VH9A 2JG9C 4CDQC 2EIDA 4GA9A 1I5ZA 1KRIA 1S0IA 1W9FA 3AVSA 2Q4SA 1AL22 4LORA 3WDUA 2VXJA 3D5OA 2XLAA 4OMDA 4PT6A 5IFTA 1VRH2 2B9VA 1RUD3 4Z82A 3WG3A 2GU9A 1CONA 3ZN6B 2VPVA 1WLDA 2ZCWA 3AFKA 4MLOA 4PBPA 5EYYA 5HCHA 4AQTA 4HSJA 3U10A 4ATFA 2EXJA 5KC6A 1J3RA 3O1VA 3P3NA 5AVAA 1WA6X 3UJQA 1S0FA 3AZYA 3IN9A 5A6QA 3DPRB 1W3VA 1NCQC 2UURA 4DXRA 2IWGB 4IV3C 1W8FA 1C1FA 3DYPA 3MI8A 4CUBA 4IDZA 1UPSA 1W9YA 3D6EA 1OVPA 4X6QB 4EROA 2HWC1 2PLV3 3OY8A 5LK7B 1QWRA 2PHTA 5J3UA 3D4KA 3WW1A 3LSEA 4ZY9A 5JIUA 2ZMKA 4PIZA 4BISA 4P9GA 4LBQA 3PUSA 3WXPA 4C91A 1BKZA 1UKRA 5F7UA 1MVQA 5JSPA 2ZKNA 1DZRA 3TNQA 1OT5A 2QE3A 4U36A 3RZHA 3SKJE 3OB8A 4BU2A 4GJYA 2DUQA 3V56A 5F5IA 2GH2A 1ZVFA 4NAOA 5FQ0B 1COV2 2W1QA 3WF4A 1QOTA 3UGFA 4AHYA 4UYBA 3TB0A 1VBB2 3JBG3 5DAVA 4RGKA 4QU2A 4AW7A 1PIV1 1UPIA 5FZHA 2YC0A 1YFWA 4EJRA 3ZSJA 3DL3A 3M3OA 4NPMA 5I8YA 1BBT1 3QD6A 5A7WA 3ENRA 4Q4W1 3T08A 1XU2A 3POGA 1VPHA 4M0NA 4WM7A 4AYUA 3GZAA 4ISRA 1F2NA 5ANQA 1N1VA 2JDAA 2WL1A 1W8HA 2XUEA 5KXCA 1YI7A 4EWAA 2AH2A 2VAUA 3PVBB 1EAH2 2IVJA 1W6NA 3D82A 3P6BA 3PDQA 4QWNA 4D8MA 1B35B 4BYYA 3LWCA 5DUXA 3HNMA 1QHDA 3ZYGA 5I0DA 3LE0A 3EYPA 3PUQA 1RTVA 5JIAA 5BXXA 5IK8A 2R16A 1PO12 4XF9A 3OGGA 3WCRA 1TME3 1YYNA 1AR91 2JDNA 5FZ9A 3D0SA 5E6HA 2ZHMA 1QEXA 3FX3A 4UFKA 1BMV1 2YY1A 1F31A 3WX5A 2W08A 4AAXA 3AVRA 4U2AA 4EN8B 5LBBA 4Y5Z0 5J1XA 4E2SA 4UFIA 1VRBA 1CAWA 4WZCA 5A7QA 3K2OA 4KWUA 3LDBA 1DBNA 5SV5A 1R091 2VMFA 3JU9A 5HCFA 4BMBA 1UY3A 1X7NA 2G9GA 5DN2A 4BZ4A 3HWJA 3AKPA 1ST8A 2VUAA 5FY5A 3RYPA 1XNBA 1NLSA 1XBFA 4CDWA 4CPBD 1RUE3 1LGBA 2JG8B 4OYUA 3KM5A 2I2SA 4AGVA 2VZPA 3MW2A 4MG2A 3AMPA 2EA7A 1LOFC 4CUGA 5DDJ2 3HN3A 2WNVB 3DPRC 1J58A 4B29A 1CAXB 1CZVA 3GZTB 4O61A 4BDVB 2VOTA 4E2GA 4WVVA 5K8SA 2FDGA 1V6LA 2W87A 3SEPA 4YGBA 1CPMA 1VB2A 3ECQA 1ENSA 1YIPA 5JOXA 4BQ5A 2ET7A 4RSUA 4LHNA 4LE4A 4FTSA 1FXZA 2YGLA 1ZRFA 4LUMA 2CGNA 3ALQA 3FBYA 1DYOA 3B93A 2ZGTA 3CQOA 4LKEA 4FPJA 4UFJA 1IKQA 5FV3A 5A7NA 1I6XA 3H7YA 4ISQA 4CXYA 2WFPA 4XF1A 4PI2A 4Q4X3 4C8DA 3FMGA 2VUDA 2QUOA 3K3OA 1DZTA 1YNAA 1GYKA 1W0NA 5FY7A 1H1AA 5J48A 2A6VA 2EXHA 3I2IA 1DQ1A 1ZBE3 3IPVA 3K75B 2W46A 5DXDA 3VKLA 2YROA 3U75A 2Q1FA 3NJYA 4NN0A 3VHOA 3KMHA 2XLFA 2VQ0A 3POWA 4NJ4A 5T5PA 2ZX3A 4C0HA 5JR2A 2EXKA 2BFUS 1TNFA 1QKQA 1CJDA 1VJ2A 4GWMA 1A3KA 4IGOA 4J25A 3KQRA 4BIOA 2JIGA 3BI3A 5F2WA 2E33A 3HIFA 5FZ6A 4QKNA 4K9SA 3OBTA 1QY4A 1W99A 5LW9A 1JYXA 5LA1A 5C3RA 3G6JB 2QQIA 5IVBA 1IKPA 2ID4A 1B35C 3B00A 4CP9B 5FP4A 4NHKA 4EN9B 3AZVA 4XMIA 3WW2A 4UT5A 1H30A 3CL1A 2FQPA 4K20A 4GB32 3T30A 5J98B 4FPHA 3T2OA 1SHWB 1GKBA 2DVFA 2P6CA 4OZOA 4R52A 1IZ3A 4COVA 5TSWA 5A1FA 2GSYA 1IOAA 2XONA 3LF7A 2JJ6A 3VBHA 4W8JA 5CG8A 1DGWA 2XVGA 3KWVA 1WBLA 2W0XA 5C70A 2ZTNA 1QJX1 3VV1A 4W6XA 3WDXA 1SFYA 4A7KA 4NAMA 1L7QA 4EZ4A 4LXLA 1NY71 1TMF3 1X50A 3IAQA 3ZSMA 2V5DA 3MIHA 1L7LA 4R9BA 2VUCA 1VBA2 1QJU2 1UY2A 2VOXA 2XG3A 4LMFA 4N7IA 1PO23 1H4HA 2PHWA 2V72A 2R072 5KXEA 2R042 1GU3A 4QX1A 3R4SA 1F5JA 5AFBA 2QNKA 4UWDA 3W58A 1V9U2 4XUPA 1WMEA 2XBO2 3RZMA 4PLMA 3URFA 3OUJA 4IEWA 1AYM3 3GCXA 5KWRA 5LA0A 2I74A 2R1BA 2RS53 2JG8C 1V6MA 5ACA3 2NZ9A 4XF3A 5FOBB 3OF1A 3T0AA 3LA7A 1WW6A 3VN4A 4IETA 1AR72 1O5LA 1JOPA 2Y38A 2Y6LA 2Y33A 1JYTA 1F4AA 1O59A 2WZR2 4GAZA 1HB1A 5FY8A 4OHZA 2HKXA 1GICA 1UU6A 4FCAA 5A32A 2RR11 5F3EA 1D0GA 2EALA 1QXRA 4YW4A 2C24A 3N7JA 5FZDA 4XEZA 3KSCA 3ZYJB 4QPIB 4QXCA 2I45A 4Y20B 1HJGA 4FAHA 1ZZ9A 2YU2A 3HAGA 1O3RA 1QJY1 4XQWA 3NNJA 1JOBA 4X8PA 1X82A 5JXJA 1CX1A 4BQ3A 3WHTA 2DUPA 4K7JA 3BTXA 5GM0A 5JUVA 5JOWA 2J1UA 1HRV3 4I0BA 3V0AA 1RUI3 1GV9A 3WP6A 4XURA 1YJKA 2P2KA 5FO7B 4QAWA 1YIFA 2E9QA 1ND2B 2BBAA 4B3NA 1VE0A 1HN0A 2GN7A 1OXCA 1UX7A 2HYXA 1AF9A 2FBEA 4LR4A 4ZZ5A 1AR62 1U12A 2XMLA 4WM8B 2GMEA 5ABJA 4WBBA 2VW1A 4CDQA 1FPN1 1SDWA 3VD4A 3ZXJA 1GWMA 1MZ6A 3POBA 5L9VA 1W39A 4QPWA 3MFCA 4XDOA 2JKBA 4NPLA 2CTVA 2LW8A 2Y26A 3Q8EA 5FZAA 1BCXA 5H9QA 5C3QA 3W5NA 3RZKA 4MGSA 4QPGB 5FJKA 2Y0IA 3AYAA 5F3IA 5HXVA 5CKNA 4FFHA 3AP7A 4RHV2 3A23A 1Z0HA 5AC92 3TEWA 1H2MA 4A44A 5GLTA 2LALA 4QXBA 2BNMA 3NV1A 3PTYA 2ARCA 4GKXA 2XXZA 1YQCA 4GZ9A 2ZS6B 3TEXA 1UQXA 2RV9A 3MF9A 1O3TA 4CXWA 4META 4DEVA 1GNYA 1W2AX 2HEWF 3SHRA 2BWAA 4OQ9A 2D6OX 3WDWA 3ZFGC 5DAPA 3PLQA 3ROUA 1YFXA 2WC2A 4XAEA 1N1SA 2GC2A 4QDRA 2RM22 1URXA 2Q1ZB 1OURA 3HBKA 5KBFA 2RS13 2QTWB 2P34A 4JQTA 1PGSA 4QDQA 4Y1UA 4AI8A 2VZOA 2XJQA 4CU6A 3A0KA 1QMJA 2WA4A 1FMD3 1D4M3 2WLQA 5F39A 4QB6A 1CGPA 2X5IC 1VRH1 4Z07A 4UAPA 1G9DA 2XB6C 3KF3A 1ZA4A 1LOAA 5I0RA 4OCTA 3SH5A 5CKMA 4A41A 2NPIA 2QDNA 2XOMA 4XACA 4BPZA 1CPNA 4QXKA 3ZXAC 4BK4A 1RC6A 2VZ1A 4QPIC 2P1BA 4DS0A 4Q2FA 1NG0A 1W6QB 4MZUA 4DUWA 2XKPA 4DFSA 4M3CA 3WSOA 1C8M1 5FREA 3C7EA 4Q8LA 1UOBA 5IVEA 1RUD2 4D7YA 3TN93 3WNOA 1LCLA 2OVUA 1C28A 4QX5A 3I59A 4MUVA 3ITQA 3OEAA 2MEV3 3KT1A 4KWLA 5T5OA 2A3YA 3AKSA 1ND2C 1QH6A 4LO4B 3LA2A 3MEPA 1RUG3 4GH4A 2E53A 3ZDSA 4B4PA 5C8CB 2VBDA 3I8TA 3ZKYA 1GOFA 4AF9A 1LEDA 2YPDA 3MHZA 3FFQA 4FP3A 3HQXA 1WUVA 1QJZA 2YXSA 1AXYA 4YGEA 1NT0A 4WM8C 2DDUA 4J6GA 1CAUA 2RJLA 5C5TA 1WGPA 3VZKA 1VBB1 5JVVA 3GZEA 4E8DA 4B7EA 1D4VB 4JGZC 1OLRA 2PN5A 4BM8A 4QPGC 4CRQA 2VZQA 1NOVA 1PHMA 4C1XA 1ULEA 4CA9A 4HT1T 5H9SA 1H6XA 4LBOA 3N9OA 2QFEA 4FOVA 4PDWB 4CCDA 3EHKA 2PAMA 4JKMA 5CFDB 4MGYE 4N43B 3X29B 4O7XA 2W1SA 1N47A 5LZ6A 3UYJA 2L9LA 1UF2C 1EAH1 2O1QA 3AP4A 2C9KA 1QOOA 1R083 1O7FA 4LUKA 3I3BA 3OTFA 1R1ZA 4DXZA 1I9RA 3WNPA 1AXKA 1CQ9A 2ATFA 2DVGA 2PHDA 5L73A 1PO11 2YBSA 4IUGA 4RS5B 4JX0A 1BVP1 3ZO0B 2HJIA 3Q8BA 2Y6FA 1MQTA 3VKMA 5BUVA 5GLUA 4JC1A 3C7OA 4DRRA 2Q8EA 5DZGA 4EWEA 4PCRA 1LHWA 5GJ6A 5F3CA 3MZHA 1V70A 3LIHA 2ZGSA 3KHBA 3OYWB 3VDDB 3WINE 3BIEA 3KCXA 1HRI2 2HWB1 2R49A 4H55A 5A7OA 2WAOA 5FR3A 2IXJA 3THPA 5IVVA 2YFUA 4GMP3 2CAVA 1S4CA 1US3A 5DUVA 1GQGA 1Z7S3 3B3QE 2Y8KA 3LEMA 1SZBA 3UT0A 3MLKA 4ASKA 5FQ0A 5I0SA 5IATA 4AHXA 5KHGA 1ZRRA 1QQP1 2WIIB 1UAIA 1QIQA 1VR3A 3O0XA 3AMQA 1YXWA 4UBHA 1YQ5A 1XSRA 2W52A 3WR0A 1PZ8A 3LPGA 4NVPA 1B09A 1W8WA 3W9AA 5DDJ1 3ORJA 4Q29A 2A73B 4YYOA 1AYN3 4BE3A 2SLIA 4FO9A 3GYDA 2JE8A 4JRLA 2VCAA 5F37A 4P00B 1DGLA 1CZTA 1H9PA 1PNFA 5D21A 4PF5A 4IEOA 1I5PA 2J1SA 3LDRA 3I2FA 3NKGA 4NOTA 4LO5B 2QKDA 1YQ2A 3VBUB 3WP4A 4AVSA 5C8CC 1LNSA 2VCCA 1XYOA 1RJ7A 3QH7A 3T1LA 2ZX1A 4HPKB 1EPZA 2IXIA 2VGDA 3OBZA 4YVWB 4CEYB 4CUAA 2UY9A 1RUJ1 4AZZA 4LA2A 3BTYA 1VIWB 1NCRB 3R05A 2RDNA 3KCYA 1W2UA 5I0TA 2P37A 3J8F3 2SBAA 3WQ1A 1VMJA 3BTZA 4IE6A 4NE9A 3LOBA 1I1EA 2FCTA 4S2DA 4FXGB 4CDUB 3LGRA 4YARA 2VUJA 4CPBA 1VBE1 3IAPA 1CX4A 1XXNA 4XF0A 4QPYA 1QNYA 1ZYBA 3PVOA 3PMSA 1XJAA 2D7FA 1OQ1A 1S0JA 1XU1A 1AR83 2ZX4A 3BCWA 3Q9OA 5FZOB 4PDWC 3L2HA 1KITA 5CFDC 1K5MB 4R4ZA 4KL1A 3TEYA 1VBD3 3CNAA 1ZBE2 4N43C 4OZXA 1UNBA 3VLBB 5CVRA 3WW3A 1MS1A 2DBIA 2EAAA 2AEZA 1AX2A 2BOJA 2GNTA 1Q8OA 2B39A 1D0HA 1IPSA 3K77A 5CIRA 4A6SA 1DDLA 1ND3C 3APBA 4I3PA 4RS5C 1XNDA 3S6PA 3USUA 4FPCA 4P08A 2VXRA 4E4DX 2YC4A 5IVYA 4DIQA 2IXKA 3I49A 3BUCA 2W94A 1TNRA 4HLTA 2VZ3A 2F4PA 2YDEA 3MIDA 2A7AA 3VDDC 3WDYA 3AB0A 4I2OA 4A7ZA 5JZGB 1W28A 3VKNA 4IW3A 3USSA 4QU1A 2Z4FA 1VBA1 4JTNA 2QQNA 1JYCA 4AHZA 3S5QA 4BLIA 4HFSA 3J7LA 2GH8A 2BW8A 2VVEA 2VCBA 2R071 1S2EA 3MLJA 4TXWA 1DP0A 2R041 5A1LA 4YZ2A 2IC1A 2IXCA 1V9U1 4GALA 3AFGA 3OBRA 1ULFA 4AE2A 2OPKA 2RDSA 2OUHA 2ZGQA 4GWJA 2G9ZA 1TMF2 2AREA 1MZ5A 1O8PA 1W8OA 2UWCA 1YO8A 3NJZA 1GZTA 5GLVA 4N9HA 5GZEA 5BNOB 5IVCA 2WZR1 1W6PB 4ORFA 4EQVA 3K48A 5IT6A 4BXSV 4QX7A 4TTGA 1U0AA 5FUIA 5A3TA 5HCAA 3E5XA 1AYM2 2A6ZA 2OZJA 1AX0A 3ZYHA 1LEMA 5B4NA 5ACA2 3WCSA 3M4FA 3VBUC 5FZ3A 5IK4A 2JB4A 3OG2A 4Q27A 4BQWA 5FPXA 5FMDA 1EY2A 1VP6A 4QM9A 4YVWC 2R063 4CEYC 4EV0A 2A5ZA 1WBFA 5DAWA 3HQRA 3LDKA 5CEHA 3THDA 1RMU1 1GP6A 1NCRC 1BK1A 2D98A 1ASJ3 4RFRB 2DFBA 3VD7A 1HV1A 2RDQA 3MV01 5GZDA 1CIYA 1JHJA 2RMU3 4EN0A 4CDUC 1G7YA 3KV6A 4YG3A 1IS6A 4I0WB 5JSRA 1ZREA 5J09A 4LO7A 4OULA 3S5AA 2W9XA 3K4AA 1SDDB 3EJKA 1IG3A 4TLFA 4HL0A 2Q8OA 3GJAA 4DXSA 2ZGMA 3ZFGA 1GR3A 2DU0A 1AR61 2PAKA 3M3EA 1VBC3 3B02A 1HRV2 5FZIA 2C6SA 2VOWA 1RUI2 2WFF1 1X8EA 2JD4A 3PU8A 1DQ5A 4S2GA 4OI1A 5M0TA 2CL2A 4B4QA 2B46X 3DECA 1CZSA 3SITA 3J7HA 2EIEA 1H8TB 3GHMA 3VZJA 2ZAAA 2ZGLA 3G7DA 1GP5A 4BQ1A 4PLOA 4QB1A 1XE0A 4DOUA 4E8CA 1W6OA 5FKBA 5FYMA 3VHPA 2X5IA 1ULDA 3N9PA 3JXSA 3SQOA 1JI6A 5D2AA 2ZX2A 4Q26A 4Q8KA 4Q1PA 4ZHNA 2CDPA 4WVZA 1N3PA 1ENRA 1OMIA 1GZCA 2RS33 2DF7A 3T09A 5AC91 2RJ2A 1W0PA 3GHNA 1POV1 2WS91 1EV13 2NQYA 3ZR5A 1C57A 4TWTA 1OOPB 4W4ZA 2ILMA 1JMUB 4XIKA 2HWC3 2VVFA 1ZBA3 2R30A 3NW4A 1W0OA 5JZGC 4ES9A 3GBFA 1WMXA 3UETA 1R64A 4IV1A 1J3QA 1SBFA 2W92A 4HBNA 2HEVF 4KG8A 1RYYA 1HDKA 4B7KA 3IMNA 5BNPC 1ND2A 1UIJA 2RM21 4AGRA 4FPFA 4HVQA 5K0UC 1SG3A 5ERLA 2JDKA 1XNAA 4GXLA 4W50A 5H9PA 2Q8DA 5I93A 5L7OA 3RS6A 4QQOA 1QF3A 3VBFA 5CKQA 4AEKA 5CNAA 5FPLA 5BNOC 5FZ4A 1PIV3 3WUCA 2IUWA 2V4VA 5HXMA 5EJ1B 2WINB 3MUY1 2QZ2A 5LRSA 2RS12 1RINA 2J1RA 4JGZA 4A45A 1GFF2 1OI6A 2W91A 3LAGA 4XIOA 1A78A 4F8AA 4L0PA 1LHVA 1RUNA 2QZ3A 5T3NA 1D4M2 1FMD2 1IG0A 1UMZA 5CADA 4RR3B 4L99A 4NHYA 3UKNA 2A1XA 1RUD1 4FOWA 5F5AA 2HLEA 1EP0A 2WQ4A 3NAPA 5FIXA 4I0AA 3WF1A 1AR93 2PA7A 4PF1A 3IDAA 4ARXA 2VULA 2DFCA 3CZUA 3EQEA 1ALYA 3N35A 3OGSA 1N1YA 3OPZA 1RXFA 3RJ2X 1AVBA 4JKLA 3NWKA 1STMA 3ACGA 3WNKA 1YJLA 1O4ZA 1UZWA 4Y5TA 3V0BA 4I3GA 4OHXA 5FZKA 1OQEA 3NJXA 3MICA 3R4UA 4DZGA 2XVLA 1KDKA 2C4XA 3TN92 5JXIA 4YM1A 2G1MA 2XJRA 2W1UA 3N3HA 4BQ2A 5T5JA 4MXWB 2PHFA 3VD9A 3N7LA 3RMYA 1R093 2E6VA 5C4WB 2BDRA 3RI9A 1DGRA 4UW4A 4FTEA 2EIBA 3PUAA 4XFHA 1H8TC 5EP9A 2ZGOA 5EWSA 1W06A 3JCIA 5FPVA 3J7MA 5JCTA 3I3MA 3I2OA 2WZ8A 2XWJB 1J1TA 2DWRA 1UN1A 5A7PA 1F9KA 2D6KA 5A3LA 4IGQA 2AEYA 4FTBA 3WF0A 3VL8A 2A3WA 5F5CA 3U11A 4LTAA 1WWYA 5JLVA 1PGW2 1OPOA 3JD73 1S2BA 1W6QA 2W2IA 2UWBA 3IBMA 1PNGA 3ZXEA 3MFAA 1OOPC 1VAKA 2WYFA 4LBJA 2JB8A 3PURA 4XJWA 3NNLA 2WO1A 2VQTA 3HN1A 4F3JA 4AAPA 2CWSA 2YHJA 4A4AA 2WN3A 3IIIA 1XSQA 2W1WA 5FZCA 1TE1B 3CEWA 1QH7A 4Y4RA 2ZACA 3DF0A 2ZEWA 5LY2A 1DHKB 3O7OA 2D5HA 2W5FA 4AFBA 1IGOA 1LOEA 3KT4A 2BEOA 2J1TA 1R082 4I01A 2ETEA 1J1LA 5D8AB 2BUKA 2TEPA 4UW5A 1O3SA 1C3HA 1JZ6A 1RIRA 3K3NA 2DCKA 2Q1MA 5FYHA 1HRI1 2ZHNA 4Y24A 4QGLA 3GXUA 1O4TA 1HQNA 5KC5A 4UFMA 4JDOA 3S30A 1T6BX 2XJSA 1W8ZA 3K4ZA 4XJAA 2HBUA 1QJFA 3LSDA 1V6IA 4DO0A 1WD4A 4YGDA 5JAXA 3HEIA 3KS7A 3GJBA 1V6JA 4RQPB 3ZPOA 2XR4A 1WCKA 4CCJA 4FPYA 1W8UA 5EHDA 2DUOA 4LO6B 1IQDC 3N9QA 4H7LA 1IPJA 2QQVA 2C5DA 1HV0A 3P5BA 2B7YA 1UYZA 3I2HA 4RR3C 3DN7A 1Z7S2 3CDZB 5J36A 5FUNA 1NE4A 3MIFA 5CFDA 3ON7A 1RUF1 2ZGRA 2DCZA 3ETQA 4DPNA 1DIWA 5C8WA 3ILNA 2FDIA 5F9TA 5I8TA 1LOCA 1KGYA 5BYNA 1HW5A 5E88A 4PI0A 2P17A 4P14A 3E5UA 1RHI2 1GWKA 1REDA 2XHNA 1H1IA 2VM9A 5A70A 1ND3A 3FJSA 3V64A 2ZX0A 1PMHX 5T54A 4NWWA 1OVSA 4RFT0 2HEYF 5BNQA 1QJX3 4LNVA 3FWEA 4GWNA 3ZR6A 1F5FA 1LULA 3I2DA 2MPFA 2D6PA 3M3QA 5KHHA 4BB3A 3MYXA 1HB3A 2FCUA 2VQUA 3B7MA 3MPBA 5FPZA 3A21A 1UMHA 5C4WC 5APAA 3OUIA 1PGL1 5DMYA 3VDDA 1ENXA 3AK0A 1XYPA 5C9AB 3WG1A 5FUPA 2D6NA 5FZ0A 4HONA 1SLCA 4MGKE 5BV6A 1ULOA 2UWAA 3OPWA 5GLWA 4OUMA 2VC9A 1LODA 3ZVXA 2XJTA 1Q8QA 2PQSA 1JZ3A 4DUVA 2UU8A 3JQWA 5JI9A 2ZJCA 3J8F2 3ILFA 3BU0A 3UESA 1BVVA 1ZBE1 4Y26A 3QOPA 4F7ZA 5A7SA 5LBEA 4J1WA 4JHTA 3RNSA 1XNCA 4AEDB 1U5XA 2LUWA 2ZBJA 1UMIA 2RR13 4JDMA 1VALA 3JUUA 4NWVA 3T2TA 2VJXA 4MGQA 3SC7X 3WV6A 3LZZA 1UY1A 3WHUA 5K7PA 3PUHA 1JZ5A 2V4AA 4UF0B 1AR82 4HKLA 1KJLA 5ANNA 3DKQA 5LY1A 2VCMA 1LGCA 1WMDA 1VBD2 2G19A 3M3CA 4TYSA 5LATA 4FFIA 1ZZBA 3OBAA 4PQQA 3W5MA 2CU5A 5JOYA 4QQLA 2WNVC 2VMEA 2WNUA 2RDRA 4XFAA 5D8AC 3VBUA 1YUDA 4AI9A 4QGMA 1C8NA 1BYHA 5A80A 3RWNA 1UD1A 4HPKA 3F2ZA 4CEYA 1UU4A 3WNLA 5FWJA 1NCRA 4OI2A 3JB4C 4LLFA 4ITCA 1WCSA 4HKOA 4QKFA 2GNMA 1WLTA 4YG6A 4LBKA 1SQ4A 1BQPA 4CDUA 4RQPC 1BHGA 1PK6A 3M7AA 2HWF1 3VD3A 3ZYFA 2JDYA 5CFCB 1OA3A 1XOYA 1H6YA 3D3AA 1TMF1 4X6RB 2ZHKA 1HKDA 2O0OA 4CEWB 5IYYA 3S0MA 3ILRA 2VG9A 4Z2AA 2D6LX 3BPSA 3VDAA 2VU9A 5HCBA 2WBKA 1S0DA 3UKVA 2XVKA 2YB7A 3AMNA 3ZN5A 2XJPA 1O91A 3U4XA 5GLZA 2ZEZA 1AYM1 3ZFEB 2VZSA 1SCSA 1UU5A 4TLGA 3NSTA 4LIUA 2AGSA 4XFIA 4DRVA 1LJ7A 3I54A 2GP3A 4FQ4A 4LULA 3RI8A 1PMJX 3F95A 2JG9A 2WYSA 3ZYRA 1DQ2A 2A6XA 3KGZA 3LIGA 4K8FA 2C1FA 1AXZA 4WVMA 1W9WA 4Y1VA 1JUIA 5FRAA 5FZ7A 2VNOA 4MXVA 2FHRA 3CO2A 4XFBA 1WCQA 4JTOA 3I3DA 2Q8CA 1G6NA 4XCBA 4OI0A 2A6YA 4HXCA 4XUQA 3MUZ1 1DCSA 1BEV1 4ASMB 1UX6A 5C9AC 1POV0 2VZVA 1KS5A 1ULGA 3WD5A 3GNEA 5JZGA 2QDRA 2R062 3B5LB 4J1XA 4YGCA 1NXMA 4W6YA 1DGRN 1PVC1 1IPKA 1ASJ2 4LBQB 4XE9A 4DY3A 3DXTA 3DEMA 1AJOA 5BNPA 1RUI1 3POEA 3QLQA 4LK7A 2QQMA 1NCQA 3CF6E 2JDUA 2RMU2 4IV3A 2JWPA 2PHRA 5K0UA 1NZCA 2X53S 1Q8PA 1JHNA 4TZDA 4AEDC 1L7RA 3RPQA 2DCTA 2P3KA 5J37A 2F4LA 2Y60A 4NIGA 1JTZX 2JDHA 1C4RA 4ZU7A 1RJ8A 2ZMNA 4C1WA 5L9BA 4COUA 1VBC2 3HBZA 1REEA 3AZWA 4Y22A 1UYXA 5AFEA 1C8M3 1AL21 2OUJA 1CJPA 4LT5A 4KNCA 4L11A 3VBSB 4KGGA 2WAAA 4WM7B 3DKWA 5DABA 5LBFA 3RMXA 4H2AA 4RGGA 2Z2SB 3CMGA 2R32A 3WZ1A 1NLQA 4XDPA 4XUNA 3VDBA 4LHLA 3FFZA 2RS32 4HK9A 4C90A 2CGOA 4NHLA 5DUUA 1J3PA 5T5LA 1XC6A 3MLLA 5FPUA 1SPPB 3Q8CA 5B2GB 2WLPA 1RVF3 1EV12 2QCSB 4GULA 4HVOA 5FMOL 4I02A 5C6CA 2ARAA 2VZTA 3WVJA 1WMFA 4I30A 1X36A 3GZUC 5CFCC 2HWC2 2KM2A 5KHKA 1UXZA 1ZBA2 4V2WA 4YG0A 2BU9A 1G8WA 3QBQA 3U78A 3VUOA 3HOBA 2R6QA 4NRQA 3C2UA 4O65A 4CEWC 4XJ8A 3OGRA 4Q0VA 5JR7B 1KEXA 2K9ZA 1SLTA 4QKBA 2GP5A 3WNXA 3U4SA 4IXLA 3ZKUA 1CAWB 4M0HA 3ZX7A 1HXS3 3PVNA 4M4RA 2DTWA 3PU3A 1F4HA 3ZFEC 1Y9QA 2RS11 2VW0A 2AENA 3FHAA 4QT6A 2RHPA 2PLV2 3LB9A 1TEIA 1WLCA 1FX5A 1FMD1 1COV1 2WR9A 3QACA 5F1RA 4Q1RA 3N36A 5FZ1A 5L19A 4FQZA 2WN2A 4MSVA 4CDWB 1PIV2 1Q56A 1XB9A 5EXOA 5I8SA 2YFZA 5A3UA 5HV0A 1UCXA 1FT9A 2XDVA 4IEPA 1JZ7A 3AZZA 5FP8A 3JZVA 4UFLA 3VKFC 4AI0A 1OOPA 5FFOC 2BPA2 5A3NA 2WO3A 3U1XA 3ZN6A 4Z92B 4PJYA 1Q8SA 1MZEA 3OCPA 1HN1A 1FATA 2BNNA 5JDBA 3POSA 3JBG2 4QHBA 2ZAHA 4CU9A 1AL0G 2JDPA 2QQLA 1KD7A 2Y6GA 1UO9A 3I2KA 3KQ4B 2HWB3 4NHXA 4XXAA 1AR92 1LOFA 5IW0A 4AR2A 2GZWA 1V0AA 2AR6A 2E7AA 5A3PA 3DPRA 3E6BA 4LE3A 5FKCA 3SMHA 4JZRA 1OC1A 2DCYA 3SCHA 1BMV2 4LBNA 1QQP3 1EUTA 1JBCA 3IPVB 3NQHA 3MF6A 5EZWA 4AVTA 4MH0E 2F17A 2WKKA 1JYNA 1L3JA 1W2NA 2FZ1A 3BKZA 3ETPA 1SBEA 4KWKA 4P9XA 5FMBA 4BCUA 5JPMB 1JW6A 3ZPYA 4XJZA 3D8CA 1TME2 4NIHA 4M3CF 4YWAA 4KU7A 5CZKA 3VBSC 2VZRA 3IB3A 1ZX5A 3CU7A 1Y9MA 2VBPA 4KU8A 4WM7C 4P5HA 3M2MA 1VMHA 4XDQA 4XAAA 1MS0A 3IZOA 4FOYA 1F15A 2ZGNA 1SLAA 5I91A 2ZGKA 2OA2A 2HWD3 4QDSA 5IAVA 4D7TA 4H7MA 2VECA 4CCNA 1WCUA 2OQ7A 3O1TA 4COWA 4XZUG 1ZM1A 1O4YA 3ES1A 5FYBA 3FLRA 4AI3A 3BU7A 3KD4A 1PVXA 3ZYPA 4ZS2A 3JD72 1OD5A 1BZWA 1RUJ3 1NX9A 1R081 3THTA 4B8EA 3B01A 4CE8A 4UBGA 3WUDA 3TRSB 1J59A 2BQPA 2VNVA 3WF2A 4HOOA 5FWEA 1ULPA 2VOKA 5GALA 3NV3A 4IE0A 2QQKA 5FO8B 2JKXA 4GD4A 1B35A 1RUE2 5LASA 1VBE3 4BQYA 4IEZA 4FBFA 5FPAA 3RZZA 4ES8A 1DF0A 5FZEA 2ZXQA 2H0VA 2Z79A 4XBNA 5LK5A 2B42B 2BOIA 2DTYA 4ZU5A 2CV6A 3DYOA 1H2LA 1JU4A 1W9SA 2O8QA 5DPNA 3RJRA 3VL9A 5FXVA 3ZYBA 4Y1ZA 4COZA 4CVUA 3H8UA 3GALA 3SCFA 3O1RA 1S2KA 2CY6A 2MHFA 2HH9A 3WDTA 5JXHA 2BV4A 4K6BA 4CDWC 1Y9GA 3ACLA 2PELA 3CJIB 5LWBA 1SLIA 2WO2A 3HD8B 4R8HA 2ZPXA 1OFNA 2BWCA 2FDKA 4YZ1A 3LEIA 4YVSB 3WEZA 5C3PA 4QMAA 4Z1VA 4FVVA 4Q4X2 4CDXB 3PVEA 1RHI1 5A32B 3ZDVA 5A3MA 2BYVE 1F8VA 5DAXA 3LFIA 1Y43B 1LENA 5F2SA 4HZFA 4ZS3A 3PIGA 1PX3A 5FJHA 4BK5A 1GZWB 3HR9A 2JG8A 2BTVC 3RG0A 5EIYB 3VGIA 1DG6A 1KDMA 5FYYA 4Q4Y3 2WNVA 2WNOA 2XGXA 4MHUA 1W2OA 1O3QA 1CAXA 5B4XA 4BXFA 1LESA 4BMEA 4XYXA 4JDNA 3SKVA 4GB31 3U37A 5C33A 5DG2A 1DLCA 2R043 2IZWA 1OH3A 4YW3A 1UXXX 4L8QA 3AL5A 5FYVA 1OKOA 4CU7A 1QJX2 1OPMA 3H1MA 2J42A 4A42A 5FTTC 1OA2A 1AZDA 1HLCA 4RYDA 5LBCA 4D0QA 1LGNA 2CSGA 1VAMA 2Y64A 1RB8G 2C9AA 2DVBA 4CP0A 1MEC3 2ZABA 1WKYA 1RUC3 2XL9A 3J8F1 4IERA 4R9DA 4XBLA 4CZSA 5LCWL 3N9LA 1BLZA 5FDBA 4Y33A 4DNYA 4LBMA 5FY9A 1NE6A 2AYHA 4YFWA 2WZR3 1R1A3 3UL2A 3WP5A 4AVAA 2D6MA 4B1LA 4AL9A 4CXXA 1QJU1 4QHOA 5LRRA 3WW4A 3ELNA 2ZGUA 1SEFA 3KVBA 4LO8A 1OQDA 1NQDA 3FHIB 2D43A 4AXOA 3N4MA 2BFUL 1ODNA 4XOGA 1HB2A 5IK7A 2XBO1 4TN7A 5HPOA 1VBD1 2WA3A 4XFCA 2D5FA 4MGTA 1A34A 4Q4V3 5JMOA 3BB6A 3ZXLA 2VMGA 3POYA 3LD8A 3WOGA 4Q0PA 3TYJA 3KLSA 3SH4A 3WG4A 1AR71 4HANA 2JECA 2CYFA 1RMU3 2W47A 3FLPA 1ZZCA 3AP5A 4G3YC 4A2UA 1PO22 1US2A 1Z78A 4PIYA 2EVXA 3VB9A 2GDFA 2CWMA 1YRZA 3SEEA 1J83A 4XQDA 1UOGA 1ZZ6A 1QJEA 5GZFA 2RS52 3TOJA 3ZSKA 4CCMA 4CP9A 4X8NA 4ASLA 4P9YA 5JPNB 1AHSA 4SLIA 5BPXA 1SCRA 3ZSEA 3FLTA 5LB6A 3CIHA 3HT1A 4P02B 1SMVA 2E7TA 5EYXA 2K2SA 2WFF3 2KR2A 1UZZA 3WNNA 3ZSLA 5F3GA 1S1AA 4LOTA 4AFCA 3BTAA 3ZMNA 2LRPA 4CTEA 4QQPA 4GQ7A 4COYA 1YHFA 3M70A 2YU1A 2HWE3 3CJIC 2H6BA 5A33B 1JYWA 3DXUA 4KI5M 1FOD3 2J1EA 4M01A 1KFXL 2D3PA 4K40A 4XFGA 5FP9A 5KHJA 1K42A 1CAVB 4YVSC 5CU1A 4AEDA 1RUH3 2Y6KA 4FP2A 1UKGA 2LTNA 4LLOA 4CDXC 5FP7A 4QX8A 1YCIA 5AC93 3BOWA 3SCGA 4AGGA 1OUSA 1K5MC 2WS93 4OHWA 3SNMA 5F6KA 5KXBA 4L97A 2E32A 4FFGA 2VE1A 1UOFA 3L9JT 3HPNA 5JMCA 3SLIA 2BGPA 2X10A 4M3CB 2WUHA 4DUXA 1JUHA 3KHCA 1KFUL 2J1AA 4F83A 4W6WA 3FE5A 2BBVA 3J26N 1GQPA 3WDVA 3BN6A 4RHV1 4W65A 3CKHA 4AI1A 3I59B 2FCVA 1K5JA 2GMMA 1V6NA 3B9IA 2VR4A 4QPIA 4NROA 3U0ZA 5C7GA 4Y20A 4NIIA 5JOZA 1T2XA 3NV4A 3N7MA 2AACA 3VBRB 3WNMA 4H3WA 4GH4B 1ASJ1 1UWWA 4NHMA 5IVFA 1ZZ7A 2TBVA 2OW4A 4YM2A 1MS5A 3T1MA 2BVBA 1YQ8A 5CFCA 5CISA 4ZKTB 3IDCB 4HKWA 4AEJA 1ZRDA 1YQ6A 1GANA 1SFNA 2JX9A 3OPTA 4B1MA 4YSFA 3A0NA 3POFA 3VZLA 4S2FA 1H0BA 2O14A 1CAUB 2A71A 1DQ0A 2RE9A 3ME2A 3O12A 5DZEA 3FL7A 3IIAA 4FPEA 5A6YA 1JN2P 2NLRA 3BGAA 3PIJA 4QQ2A 4K21A 1VBC1 1Y4WA 4TSVA 2ZA9A 4A7YA 5CB7A 1GZ9A 3ZFEA 4Q0UA 4FAGA 4A3XA 4L9BA 2TNFA 3ASIA 4CU8A 4URTA 1QOSA 4WM8A 2WNEA 3LPFA 3LCPA 2GN3A 3MBWA 4MHRA 3ZFFB 5ISLA 2PAEA 2BZDA 1MS8A 2QQUA 1BBT3 5EJZB 2A3XA 3ACHA 4Q4W3 2WZPP 3PJQA 3RYRA 2RS31 3MW4A 4MGIE 3EMRA 3NNGA 1C8M2 4N53B 4EE2A 1SACA 4N90A 4QPGA 3FZ3A 3UKTA 5FLIA 3H8OA 4FI9A 5FZ8A 1EV11 4C0BA 4Y5SA 1JYIA 5F32A 1GOGA 4LEJA 2V5YA 5K4LA 4LBLA 4QHZA 1MQTB 4XUTA 1ZBA1 4XJUA 4D69A 3S7EA 3TWIA 2W68A 4AFDA 2P3IA 2Q5TA 3I3QA 5BNNB 2VQAA 5IK5A 4ZPIA 1W05A 3ZIXA 2YPJA 3WP3A 1A6CA 2E51A 5F5QA 2FD8A 4FSJA 2QQOA 2WJSA 1QDCA 1S0GA 3ZN4A 1RVF2 2WABA 4UI9L 2P3JA 3MPPG 4NPRA 4ZZ8A 1A8MA 3HJRA 2DVDA 3OUHA 4FPKA 2X09A 2Y0OA 1FV2A 1Y3TA 1DFQA 3AC0A 3EB7A 3IT8A 4YPJA 1I3HA 1MZFA 4QD2A 5A6XA 2CHHA 1S0BA 3AYDA 2PLV1 3RYKA 2VBBA 2MEV2 2WT1A 4ET7A 3GBGA 4LJHA 4PIXA 2B4KA 1IS5A 1KQRA 3HNYM 4CSWA 1LHNA 1LECA 4BQ4A 4OFGA 1RUG2 1DYPA 3E6DA 1GBGA 1POQA 2UYBA 3BIWE 1W9TA 4AQSA 4AVVA 1HXS2 3VBSA 1E5HA 4N9IA 4FPLA 3PTRB 4CP2A 3KCCA 1FNZA 4G4FA 3I2GA 4MV2A 4DMIA 2D93A 3AJZA 2Z5WA 2WQZC 4FFFA 1GLHA 3AYCA 1ONAA 5A3WA 1IS4A 4LHKA 4YZ3A 1CIWA 1GNHA 2IXLA 3ES4A 4Y3OA 4K1ZA 2E7QA 2VMCA 3JBG1 5E1RA 3VBRC 1SPPA 4GKYA 4GH4C 1W04A 1HRI3 3H8RA 1LR5A 4WVWA 1JOJA 3RWKX 3T0DA 3MIBA 4IE4A 1DU3D 2ADEA 2WDBA 1OF4A 1W03A 3RQ0A 1RUOA 1J84A 2NP0A 2JIJA 5KXDA 2B9UA 4ONUA 2HWB2 1QDOA 5FAXA 5C8CA 5A3OA 2VMDA 3U14A 1OLQA 1OLME 2BVVA 3N9MA 3AMMA 1TME1 2C26A 1RXGA 3AJYA 5C71A 4XETA 1HIXA 4EN6B 1RUF3 2JXAA 4XVHA 3I3EA 2WT2A 4BLJA 1QQP2 4HSLA 4R4XA 3T2PA 4CCLA 4CCKA 3ZFFC 5C3SA 1NYWA 1D2SA 1NA1B 3U07A 3LA3A 3UJOA 1W90A 2VY0A 4HN0A 4WV8A 4GMP0 4AQ2A 4KQ7A 1ODMA 1VMFA 3N7KA 4N53C 3T3YA 3WLUA 4BQXA 2BERA 4D6RA 3NV2A 1YFYA 4V1PA 1OHFA 2DU1A 3A4UA 5FP3A 5FOJB 3ACFA 2QQJA 3JD71 1OFSA 1LKNA 1TZOA 3PL0A 4PDWA 4RA0A 2GALA 2XUMA 4LKFA 3T2QA 3USUB 3VBOB 3IM0A 4XABA 3C7FA 5GZGA 1EPWA 1DGWX 1MQTC 3OOXA 3AL6A 4K3UA 1X8MA 4N43A 5GKAC 5BNNC 2HWD2 4OMCA 3V65A 5LA9A 2FDHA 1XQNA 1JH5A 5EFUA 3S7IA 2OKXA 1RUE1 2TUNA 5CG9A 4JGYB 5AVPA 4DEQA 5HBAA 2FDFA 1MS4A 4RS5A 1RUJ2 5H9RA 4AEMA 1AYN2 5FO9B 2OPWA 4NIDA 2VOVA 1S0EA 1CESA 1D7PM 4MGZE 1RGSA 2GNBA 3VHRA 4CDXA 1LOGA 2OZ6A 3PUIA 4NUBA 5IWFA 4BOWA 2NM1A 4PLNA 1XRUA 1VBE2 4DQAA 1N3OA 3NNMA 1PZ7A 2YG0A 3A7QA 2YUEA 3OYWA 4ZONA 4D6QA 4D94A 5L36A 1W6MB 3NKTA 3FC0A 3W20A 3NJVA 1YFUA 1VB4A 2VMIA 3EBRA 1WA4A 1BXHA 4XQ4A 5KHIA 1T6GC 4BHPA 2LROA 1QXJA 4AK3A 3AYEA 4YW1A 5F6LB 3RSJA 1CD3G 1O6UA 1E5RA 3DUIA 4Q4X1 3QH6A 2P5BA 3KGLA 3CBNA 3BALA 2JDMA 3VD5A 3H3ZA 5I0UA 4UW3A 1LTEA 2Y34A 3O14A 4LITA 2G9FA 2ZHLA 3IMMA 3O1OA 2OS2A 3E1F1 2ZKLA 5HV4A 3QCWA 3GF6A 1MS3A 3GM8A 1M06G 4XBQA 5FY4A 4BA6A 1UOJA 2QQPA 1OBNA 5D1IA 1JS9A 5IVJA 4MOAA 4BJ0A 5IHRA 1H2NA 3OEBA 4LK6A 2HYKA 3J4UH 4KG0A 4DY5A 1WW4A 4CP1A 4GJZA 4YM0A 2JICA 3O1UA 2A70A 1QJY3 2AUYA 1DQ4A 4YNIA 4KBBA 2ES3A 4XF4A 1FYUA 2NMOA 5FXXA 1G9FA 4AVBA 4OQ8A 4JCKA 3I7DA 1AJKA 1GWLA 1WW5A 2HWF3 3ZXFA 4IGPA 4EN7B 2XWBB 4Q4Y2 1G9BA 3B94A 4YLZA 3ZYIB 3POJA 4EWDA 4FOQA 4YVWA 3ZXDA 3ZFGB 4P9WA 3B9CA 3R0RA 1LOBA 4KBZA 4XILA 1H1MA 2DURA 4YM3A 2XQXA 4XTPA 3NRUA 5J7MA 3AZXA 4CCCA 1NA1C 4LIVA 2H6CA 5FY0A 3CJIA 1MEC2 4HN1A 2PXJA 1RUC2 1UY4A 4KGQA 3RZLA 2DV9A 2XHKA 4YVSA 1W6OB 1DLLA 1YEWA 1FPN3 2E63A 2X5IB 1LB2A 2YMZA 5FYUA 1R1A2 4P9IA 5FZOA 4CYDA 4D7SA 4YW7A 3HVDA 4OUEA 1BJQA 3VBOC 1K5MA 3DCQA 3MW3A 1PO21 1LAJA 3LEKA 4UOJA 3PHMA 1ZA7A 1HQWA 2B8MA 4XPVA 1G86A 2GC1A 3IDBB 4Q5OA 5FYSA 3C7HA 3S57A 1GZWA 3P3PA 1BEV3 3SISA 3HNBM 2IVIB 1ULCA 1XNTA 2OQ6A 2VZUA 4M4PA 2RS51 1ZRIA 1V00A 1G9CA 4K1YA 4LOSA 4Q4V2 2Y6JA 5ACA1 4M00A 4JGYC 3HMYA 4AFAA 1ZRCA 4AWDA 2KD7A 2JE9A 1DZQA 1PVC3 4K8RB 2BNOA 1RMU2 2Q0AA 4GIQA 4LKSA 3ST7A 4PQ9A 5CAZA 2EXIA 1OH4A 4IV1B 4I09A 4XHBA 3OGJA 3T4HB 5JWPA 1JZ4A 1E5IA 2DCJA 2KXLA 3J7NA 4IEVA 3ZXKA 3K51A 4NRMA 4YW2A 3LKJA 4NIAA 3UNPA 2RJKA 1QU0A 2CGPA 2VTFA 3K4DA 3D0JA 2VTXJ 3T0BA 4NRPA 1UYYA 3TNPB 5L7OB 2AC1A 1PM7A 1WLWA 3OY8B 3VBFB 1E5SA 1WW7A 5T55A 3BOPA 2WFF2 1AL23 5FZFA 4E2QA 1KXGA 1OSGA 2PYTA 2WWJA 1HRV1 2ARBA 1JZ2A 5HI0A 1JZ8A 2XPJA 2J7MA 3UGGA 1YC61 2WQ8A 4RN5A 5FPBA 1VRH3 4JGZB 3TBDA 4WZFA 3W59A 2HWE2 4FPGA 2XLGA 1FOD2 4XMAA 1CN1A 3ZMOA 4D3WA 1OD3A 1GQHA 1RUH2 1YI9A 4JV4A 2GAUA 4XZPA 2YBKA 1H8VA 2ZEYA 4JVAA 5FCCA 4LBQD 5BNOA 1CWPA 1W6PA 2ZZJA 3NAPB 4IE7A 2WS92 4KWJA 4P5YA 1SLLA 1TQ5A 5CYYA 2JD9A 1U5ZA 4XHXA 4AQ6A 2MNGA 4XCAA 3KV4A 4E4HA 1YLLA 4URAA 5A7WB 1K45A 2DVAA 5G05L 1BK0A 2A75A 4YW6A 2JENA 3CHXA 3V0BB 2QQWA 5C3OA 1W8TA 3POIA 2XL7A 3AXEA 4FXKB 1ENQA 1KJRA 2VTXA 2W39A 3CLPA 2EF6A 4JHZA 5FLJA 4PHZA 1W6NB 3OD0A 1U5IA 3HT2A 4BWOA 4FPOB 3M1HA 1SLBA 2UY8A 3MIEA 4XFFA 1WZXA 3P1IA 3GCWA 4FT8A 1PM4A 5JXGA 5A33A 3CJXA 2VMHA 2YYOA 1EUUA 3ATGA 2R0FA 1M4WA 2EAKA 2WSVA 2WRAA 1GNZA 4UXAA 3ZLIA 1CAVA 1UW8A 2ZGPA 1COV3 2RG4A 3JQXA 5A6ZA 3VZOA 5J96B 3C3VA 3R4DB 2BGOA 1X9PA 1VBB3 5DAQA 1CR7A 4BH9A 2K46A 4DXTA 5IAXA 4QX2A 3C7GA 5SV8A 2NYYA 4LQRA 3R6SA 1PMIA 5LEKA 5FLHA 2FMYA 4LHSA 4AFMA 4G9SB 4XTMA 5FYZA 4R9CA 2YV8A 4ATEA 1H8TA 2R1DA 2PTMA 3H1YA 3KZ4C 2G4IA 4L2NA 4AOCA 4MYEA 1XE8A 2IXHA 3FUOA 4BIFA 1ZZ8A 5DG1A 1RL3A 4KMQA 4EZHA 2WWUA 1D4M1 2QVSB 1EAH3 2KA3A 4NO4A 1G9AA 2WO7A 1U5YA 3O0WA 3ACIA 2I07B 3H50A 2VL4A 1O5UA 2X8KA 1XNKA 3ABZA 1VLNA 3IDEA 4IV1C 4OI4A 1AUYA 4IE5A 5GZCA 1LHUA 4JAAA 2YC2A 1FAYA 1BBT2 1PO13 3KB5A 1DYKA 3H7JA 1IS3A 3BODA 2BP6A 1Q8VA 3J9SA 4Q4W2 1OUXA 4XUOA 3VBRA 2GC3A 2YZ4A 4OVEA 4Q0QA 3HQUA 3WT3A 2PMWB 1Q5OA 2ZMLA 1WD3A 1OF3A 1Q3EA 4A6OA 5L7OC 1RVF1 1OA4A 2XKOA 4O9EA 2VNGA 2D97A 3VBFC 2PFWA 2VW2A 4AI2A 5BY5A 3MO4A 5FBZA 5DUWA 4QX0A 3FUQA 5E16A 3TN91 1EYBA 2ZEXA 1NUKA 3OGVA 2GNDA 2J1VA 3M8LA 2B5HA 4CUCA 4KH9A 1NZIA 2MEV1 1MPXA 3E6CC 3FBMA 3O5SA 2IFRA 3BPZA 3NL1A 4P9JA 4Z8BA 3ZM8A 1XE7A 2X29A 5FZMA 2OXBA 4OHYA 1K3IA 1NKGA 1RUG1 5K9YA 3RZJA 1X9TA 3GGLA 2WSUA 3AKRA 1HXS1 4DB5A 5EV7A 3VHNA 1HQLA 1GSLA 3C8XA 3BYWA 3FN9A 5A1AA 1FV3A 3WY6A
chains in the Genus database with same CATH topology
2FDGA 2FD8A 3O1VA 3BTXA 4IE0A 2FDJA 4ZHNA 3O1OA 4CXYA 4IDZA 4IE7A 4NRQA 3LFMA 3RZGA 4QKFA 3O1RA 4QKBA 5F8PA 4O7XA 3O1UA 4NJ4A 3RZHA 4NPLA 2FDKA 3BUCA 3I49A 3RZKA 3BI3A 3KHCA 4QKNA 3H8RA 3O1MA 4ZS3A 4IE4A 4NROA 4NPMA 4NIIA 2IUWA 3KHBA 3BIEA 2FDIA 4CXWA 3RZLA 3T4VA 4QKDA 3S57A 4IE5A 3O1PA 3T3YA 3O1SA 4CXXA 4QHOA 4OCTA 3BKZA 3RZMA 4NIHA 4MGTA 4RFRB 3T4HB 2FDHA 4NIGA 4NRMA 3H8XA 3H8OA 3BU0A 3S5AA 2FDFA 4NIDA 4NRPA 4JHTA 3BTYA 3RZJA 3O1TA 4MG2A 3I3QA 3I3MA 3I2OA 5DABA 4ZS2A 3BTZA 4O61A 4IE6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FDG A;  2FD8 A;  3O1V A;  3BTX A;  4IE0 A;  2FDJ A;  4ZHN A;  3O1O A;  4CXY A;  4IDZ A;  4IE7 A;  4NRQ A;  3LFM A;  3RZG A;  4QKF A;  3O1R A;  4QKB A;  5F8P A;  4O7X A;  3O1U A;  4NJ4 A;  3RZH A;  4NPL A;  2FDK A;  3BUC A;  3I49 A;  3RZK A;  3BI3 A;  3KHC A;  4QKN A;  3H8R A;  3O1M A;  4ZS3 A;  4IE4 A;  4NRO A;  4NPM A;  4NII A;  2IUW A;  3KHB A;  3BIE A;  2FDI A;  4CXW A;  3RZL A;  3T4V A;  4QKD A;  3S57 A;  4IE5 A;  3O1P A;  3T3Y A;  3O1S A;  4CXX A;  4QHO A;  4OCT A;  3BKZ A;  3RZM A;  4NIH A;  4MGT A;  4RFR B;  3T4H B;  2FDH A;  4NIG A;  4NRM A;  3H8X A;  3H8O A;  3BU0 A;  3S5A A;  2FDF A;  4NID A;  4NRP A;  4JHT A;  3BTY A;  3RZJ A;  3O1T A;  4MG2 A;  3I3Q A;  3I3M A;  3I2O A;  5DAB A;  4ZS2 A;  3BTZ A;  4O61 A;  4IE6 A; 
#chains in the Genus database with same CATH topology
 2LS6 A;  4Z2W A;  1XYN A;  4DIN B;  4MO3 M;  3GDB A;  1W8N A;  5LEJ A;  3ZFF A;  3NAP C;  4SBV A;  4QX3 A;  1O8S A;  5T52 A;  1R09 2;  5DDJ 3;  1V6K A;  1N3Q A;  5FXZ A;  2QBX A;  1IHM A;  2ERF A;  1LHO A;  4N53 A;  5DQ0 A;  1PZ9 A;  3H9A A;  2FDJ A;  4OHV A;  1PGW 1;  4UFH A;  4YW5 A;  1SFP A;  1ND3 B;  4ZU4 A;  2V73 A;  4RR3 A;  2P4E A;  4JKK A;  3KVA A;  3GBW A;  3EXU A;  4Y1Y A;  4LA3 A;  4B4R A;  4ZXE A;  3W21 A;  3LFM A;  3DGT A;  3H42 B;  5BNN A;  2J22 A;  3RZG A;  2D44 A;  1GOH A;  2R7E B;  2BJS A;  5L9R A;  3AKT A;  2VO5 A;  3E97 A;  4OUS A;  5F8P A;  3AXD A;  2OYZ A;  3PME A;  3I97 A;  5C5U A;  4IND A;  1K12 A;  1F35 A;  3NO8 A;  2Z69 A;  3LQC A;  4QM8 A;  3VBH B;  4E9K A;  4R9A A;  3MGU A;  2F6B A;  1LU2 A;  5E89 A;  4E27 A;  2E26 A;  1IQA A;  4MXW A;  2Z42 A;  2PHU A;  5EPA A;  3AMH A;  3UK9 A;  1S0C A;  1RIT A;  2Y6H A;  5C4W A;  3O1M A;  1Y7B A;  2XJU A;  1JU3 A;  3LEG A;  1RHI 3;  2C0Z A;  3AX4 A;  3RVH A;  1GUI A;  3MDP A;  3PNA A;  5FYI A;  1E57 A;  1MS9 A;  1RUF 2;  1TG7 A;  3JB8 A;  2ADD A;  4GMP 1;  2N7G A;  4Y4Y A;  3TEZ A;  1KS4 A;  1CVN A;  2BRT A;  4S2H A;  4XXP A;  3EO6 A;  1Z7S 1;  2EIC A;  1V6O A;  2RVA A;  2CAU A;  4QB2 A;  3CZJ A;  1TVG A;  3BVC A;  2CDO A;  1QGL A;  4CCE A;  2PQQ A;  3N9N A;  2HWD 1;  5FBJ A;  2WNU B;  3T4V A;  4GB3 3;  1UZV A;  3I2J A;  1PX4 A;  4CCO A;  4NMI A;  2HBT A;  1LRH A;  5JSO A;  2WT0 A;  2X05 A;  2VD7 A;  3WF3 A;  3OSD A;  4V2V A;  1AYN 1;  4AHW A;  3VDC A;  4NR1 A;  2P6H A;  4QGN A;  3O1P A;  4RGA A;  4MVT A;  1YWK A;  2VVD A;  2NN8 A;  2ZZQ A;  3M3I A;  2B45 X;  3Q8A A;  1PGL 2;  1C1L A;  1D2Q A;  3KF5 A;  1P8J A;  2W95 A;  3RFR A;  3FHQ A;  2JEM A;  1PK6 B;  5D8A A;  5FY1 A;  2D3S A;  4IEQ A;  1VBA 3;  1QJU 3;  5FXW A;  4YZ4 A;  2PHX A;  4HVR A;  2R07 3;  2FZ2 A;  2WWS A;  1HB4 A;  4QXH A;  3V0A B;  3UGH A;  4L92 A;  5FZL A;  2D3R A;  1NAE A;  1V9U 3;  1QNW A;  4ARY A;  2XBO 3;  1OLM A;  3H8X A;  5FYT A;  4RL7 A;  4IEY A;  1NY7 2;  2NMN A;  1NA1 A;  3RDI A;  3NVC A;  4RQP A;  2OX0 A;  4YFZ A;  3Q8F A;  3E5Q A;  1AR7 3;  5KR7 A;  4E4S A;  1DQ6 A;  4IL7 A;  4LPL A;  2AZ5 A;  1W2T A;  4E4Z A;  1REF A;  4YZ5 A;  5FZG A;  2XQR A;  4XC9 A;  5FK7 A;  4D6S A;  3SXW A;  5ABJ B;  2XJV A;  4CDQ B;  2P3Y A;  3SH3 A;  3THC A;  2JG9 B;  5DZF A;  1NXD 1;  2ARX A;  1UZ0 A;  5FMC A;  3VBO A;  4WVM B;  1AR8 1;  2JDZ A;  2ET1 A;  2EIG A;  5E8A A;  1HX6 A;  4Y1X A;  3ZOI A;  2O8O A;  2V09 A;  3WQ0 A;  4P9L A;  2ENR A;  2BGC A;  1UYP A;  3L2Y A;  2RR1 2;  1UZY A;  1UL9 A;  2PHL A;  4JGY A;  2K0G A;  4XW3 A;  4Q4Y 1;  1GMM A;  5T50 A;  3H3L A;  5IFP A;  4OLL A;  1AX1 A;  2ZOE B;  2Q30 A;  3AP6 A;  1C5I A;  3VBH C;  3WQB A;  3AKQ A;  4HET A;  2OT7 A;  5G04 L;  1H4G A;  1QJY 2;  3AP9 A;  4IEU A;  5BNP B;  1H9W A;  3MV1 1;  1UY0 A;  3ZXG A;  3IKW A;  3VZN A;  1NCQ B;  2HWF 2;  4IV3 B;  5IUQ A;  4HMZ A;  4MAD A;  3PJY A;  5K0U B;  3H3U A;  5C9A A;  1S55 A;  1W6M A;  2A6W A;  1VAV A;  1AR6 3;  1MEC 1;  2LM3 A;  1RUC 1;  3I4I A;  5LA2 A;  2DBN A;  4XJ9 A;  2GC0 A;  3KV5 A;  3AM2 A;  3K46 A;  4MX3 A;  1R1A 1;  1ACC A;  2DYC A;  2H0B A;  1OKQ A;  2JE7 A;  3NMB A;  4HK8 A;  2D40 A;  3H1W A;  4Y22 B;  1HJF A;  5FZB A;  4N8M A;  5EQU A;  4N7U A;  4LKD A;  2OII A;  4PBO A;  3UV9 A;  1MR5 A;  1JXN A;  3O0V A;  2WNU C;  1NQJ A;  4GWI A;  5CBL A;  4RHV 3;  5IJR A;  3RGB A;  1NLR A;  1JOD A;  2FMD A;  1WCD J;  1FPN 2;  4UW6 A;  4Q4V 1;  3DV8 A;  4IES A;  3KT7 A;  3VZM A;  1Q43 A;  1POV 3;  3INA A;  4Q0S A;  4UF0 A;  1UIK A;  4AG4 A;  4M3C E;  3NNF A;  3B69 A;  2CNA A;  4HG6 B;  3RRD A;  1MVE A;  2W3J A;  4AVC A;  3DYM A;  1W3X A;  4ZXK A;  2IFW A;  4O9G A;  3OJB A;  2YGM A;  1FI2 A;  1BEV 2;  3WQ7 A;  1N1T A;  1GP4 A;  1PK6 C;  1SBD A;  4QKD A;  2WZE A;  3IWZ A;  1QXP A;  4YRD A;  1FNY A;  5FMO S;  1ZNP A;  5JI7 A;  4IEX A;  1MAC A;  2YBP A;  1PVC 2;  5FYC A;  4EYU A;  2GMP A;  2RM2 3;  3O1S A;  4IQP A;  2R06 1;  3A22 A;  3VKO A;  4H14 A;  3OD4 A;  2E31 A;  2XH6 A;  3TAY A;  1C5H A;  1H2K A;  3MIG A;  3LOI A;  4JQR A;  2QJV A;  4A3Z A;  5FK8 A;  1JYV A;  1LU1 A;  4JRA A;  1X33 A;  3KV9 A;  5CA6 A;  3ZIW A;  2RMU 1;  5EJ3 A;  2HWE 1;  2R0H A;  1APN A;  2ORX A;  1A8D A;  1FOD 1;  4QQH A;  4CEW A;  2ORZ A;  2VNR A;  1XPW A;  5ABJ C;  2UYA A;  3H0O A;  1RUH 1;  4RD7 A;  3WG2 A;  2VH9 A;  2JG9 C;  4CDQ C;  2EID A;  4GA9 A;  1I5Z A;  1KRI A;  1S0I A;  1W9F A;  3AVS A;  2Q4S A;  1AL2 2;  4LOR A;  3WDU A;  2VXJ A;  3D5O A;  2XLA A;  4OMD A;  4PT6 A;  5IFT A;  1VRH 2;  2B9V A;  1RUD 3;  4Z82 A;  3WG3 A;  2GU9 A;  1CON A;  3ZN6 B;  2VPV A;  1WLD A;  2ZCW A;  3AFK A;  4MLO A;  4PBP A;  5EYY A;  5HCH A;  4AQT A;  4HSJ A;  3U10 A;  4ATF A;  2EXJ A;  5KC6 A;  1J3R A;  3O1V A;  3P3N A;  5AVA A;  1WA6 X;  3UJQ A;  1S0F A;  3AZY A;  3IN9 A;  5A6Q A;  3DPR B;  1W3V A;  1NCQ C;  2UUR A;  4DXR A;  2IWG B;  4IV3 C;  1W8F A;  1C1F A;  3DYP A;  3MI8 A;  4CUB A;  4IDZ A;  1UPS A;  1W9Y A;  3D6E A;  1OVP A;  4X6Q B;  4ERO A;  2HWC 1;  2PLV 3;  3OY8 A;  5LK7 B;  1QWR A;  2PHT A;  5J3U A;  3D4K A;  3WW1 A;  3LSE A;  4ZY9 A;  5JIU A;  2ZMK A;  4PIZ A;  4BIS A;  4P9G A;  4LBQ A;  3PUS A;  3WXP A;  4C91 A;  1BKZ A;  1UKR A;  5F7U A;  1MVQ A;  5JSP A;  2ZKN A;  1DZR A;  3TNQ A;  1OT5 A;  2QE3 A;  4U36 A;  3RZH A;  3SKJ E;  3OB8 A;  4BU2 A;  4GJY A;  2DUQ A;  3V56 A;  5F5I A;  2GH2 A;  1ZVF A;  4NAO A;  5FQ0 B;  1COV 2;  2W1Q A;  3WF4 A;  1QOT A;  3UGF A;  4AHY A;  4UYB A;  3TB0 A;  1VBB 2;  3JBG 3;  5DAV A;  4RGK A;  4QU2 A;  4AW7 A;  1PIV 1;  1UPI A;  5FZH A;  2YC0 A;  1YFW A;  4EJR A;  3ZSJ A;  3DL3 A;  3M3O A;  4NPM A;  5I8Y A;  1BBT 1;  3QD6 A;  5A7W A;  3ENR A;  4Q4W 1;  3T08 A;  1XU2 A;  3POG A;  1VPH A;  4M0N A;  4WM7 A;  4AYU A;  3GZA A;  4ISR A;  1F2N A;  5ANQ A;  1N1V A;  2JDA A;  2WL1 A;  1W8H A;  2XUE A;  5KXC A;  1YI7 A;  4EWA A;  2AH2 A;  2VAU A;  3PVB B;  1EAH 2;  2IVJ A;  1W6N A;  3D82 A;  3P6B A;  3PDQ A;  4QWN A;  4D8M A;  1B35 B;  4BYY A;  3LWC A;  5DUX A;  3HNM A;  1QHD A;  3ZYG A;  5I0D A;  3LE0 A;  3EYP A;  3PUQ A;  1RTV A;  5JIA A;  5BXX A;  5IK8 A;  2R16 A;  1PO1 2;  4XF9 A;  3OGG A;  3WCR A;  1TME 3;  1YYN A;  1AR9 1;  2JDN A;  5FZ9 A;  3D0S A;  5E6H A;  2ZHM A;  1QEX A;  3FX3 A;  4UFK A;  1BMV 1;  2YY1 A;  1F31 A;  3WX5 A;  2W08 A;  4AAX A;  3AVR A;  4U2A A;  4EN8 B;  5LBB A;  4Y5Z 0;  5J1X A;  4E2S A;  4UFI A;  1VRB A;  1CAW A;  4WZC A;  5A7Q A;  3K2O A;  4KWU A;  3LDB A;  1DBN A;  5SV5 A;  1R09 1;  2VMF A;  3JU9 A;  5HCF A;  4BMB A;  1UY3 A;  1X7N A;  2G9G A;  5DN2 A;  4BZ4 A;  3HWJ A;  3AKP A;  1ST8 A;  2VUA A;  5FY5 A;  3RYP A;  1XNB A;  1NLS A;  1XBF A;  4CDW A;  4CPB D;  1RUE 3;  1LGB A;  2JG8 B;  4OYU A;  3KM5 A;  2I2S A;  4AGV A;  2VZP A;  3MW2 A;  4MG2 A;  3AMP A;  2EA7 A;  1LOF C;  4CUG A;  5DDJ 2;  3HN3 A;  2WNV B;  3DPR C;  1J58 A;  4B29 A;  1CAX B;  1CZV A;  3GZT B;  4O61 A;  4BDV B;  2VOT A;  4E2G A;  4WVV A;  5K8S A;  2FDG A;  1V6L A;  2W87 A;  3SEP A;  4YGB A;  1CPM A;  1VB2 A;  3ECQ A;  1ENS A;  1YIP A;  5JOX A;  4BQ5 A;  2ET7 A;  4RSU A;  4LHN A;  4LE4 A;  4FTS A;  1FXZ A;  2YGL A;  1ZRF A;  4LUM A;  2CGN A;  3ALQ A;  3FBY A;  1DYO A;  3B93 A;  2ZGT A;  3CQO A;  4LKE A;  4FPJ A;  4UFJ A;  1IKQ A;  5FV3 A;  5A7N A;  1I6X A;  3H7Y A;  4ISQ A;  4CXY A;  2WFP A;  4XF1 A;  4PI2 A;  4Q4X 3;  4C8D A;  3FMG A;  2VUD A;  2QUO A;  3K3O A;  1DZT A;  1YNA A;  1GYK A;  1W0N A;  5FY7 A;  1H1A A;  5J48 A;  2A6V A;  2EXH A;  3I2I A;  1DQ1 A;  1ZBE 3;  3IPV A;  3K75 B;  2W46 A;  5DXD A;  3VKL A;  2YRO A;  3U75 A;  2Q1F A;  3NJY A;  4NN0 A;  3VHO A;  3KMH A;  2XLF A;  2VQ0 A;  3POW A;  4NJ4 A;  5T5P A;  2ZX3 A;  4C0H A;  5JR2 A;  2EXK A;  2BFU S;  1TNF A;  1QKQ A;  1CJD A;  1VJ2 A;  4GWM A;  1A3K A;  4IGO A;  4J25 A;  3KQR A;  4BIO A;  2JIG A;  3BI3 A;  5F2W A;  2E33 A;  3HIF A;  5FZ6 A;  4QKN A;  4K9S A;  3OBT A;  1QY4 A;  1W99 A;  5LW9 A;  1JYX A;  5LA1 A;  5C3R A;  3G6J B;  2QQI A;  5IVB A;  1IKP A;  2ID4 A;  1B35 C;  3B00 A;  4CP9 B;  5FP4 A;  4NHK A;  4EN9 B;  3AZV A;  4XMI A;  3WW2 A;  4UT5 A;  1H30 A;  3CL1 A;  2FQP A;  4K20 A;  4GB3 2;  3T30 A;  5J98 B;  4FPH A;  3T2O A;  1SHW B;  1GKB A;  2DVF A;  2P6C A;  4OZO A;  4R52 A;  1IZ3 A;  4COV A;  5TSW A;  5A1F A;  2GSY A;  1IOA A;  2XON A;  3LF7 A;  2JJ6 A;  3VBH A;  4W8J A;  5CG8 A;  1DGW A;  2XVG A;  3KWV A;  1WBL A;  2W0X A;  5C70 A;  2ZTN A;  1QJX 1;  3VV1 A;  4W6X A;  3WDX A;  1SFY A;  4A7K A;  4NAM A;  1L7Q A;  4EZ4 A;  4LXL A;  1NY7 1;  1TMF 3;  1X50 A;  3IAQ A;  3ZSM A;  2V5D A;  3MIH A;  1L7L A;  4R9B A;  2VUC A;  1VBA 2;  1QJU 2;  1UY2 A;  2VOX A;  2XG3 A;  4LMF A;  4N7I A;  1PO2 3;  1H4H A;  2PHW A;  2V72 A;  2R07 2;  5KXE A;  2R04 2;  1GU3 A;  4QX1 A;  3R4S A;  1F5J A;  5AFB A;  2QNK A;  4UWD A;  3W58 A;  1V9U 2;  4XUP A;  1WME A;  2XBO 2;  3RZM A;  4PLM A;  3URF A;  3OUJ A;  4IEW A;  1AYM 3;  3GCX A;  5KWR A;  5LA0 A;  2I74 A;  2R1B A;  2RS5 3;  2JG8 C;  1V6M A;  5ACA 3;  2NZ9 A;  4XF3 A;  5FOB B;  3OF1 A;  3T0A A;  3LA7 A;  1WW6 A;  3VN4 A;  4IET A;  1AR7 2;  1O5L A;  1JOP A;  2Y38 A;  2Y6L A;  2Y33 A;  1JYT A;  1F4A A;  1O59 A;  2WZR 2;  4GAZ A;  1HB1 A;  5FY8 A;  4OHZ A;  2HKX A;  1GIC A;  1UU6 A;  4FCA A;  5A32 A;  2RR1 1;  5F3E A;  1D0G A;  2EAL A;  1QXR A;  4YW4 A;  2C24 A;  3N7J A;  5FZD A;  4XEZ A;  3KSC A;  3ZYJ B;  4QPI B;  4QXC A;  2I45 A;  4Y20 B;  1HJG A;  4FAH A;  1ZZ9 A;  2YU2 A;  3HAG A;  1O3R A;  1QJY 1;  4XQW A;  3NNJ A;  1JOB A;  4X8P A;  1X82 A;  5JXJ A;  1CX1 A;  4BQ3 A;  3WHT A;  2DUP A;  4K7J A;  3BTX A;  5GM0 A;  5JUV A;  5JOW A;  2J1U A;  1HRV 3;  4I0B A;  3V0A A;  1RUI 3;  1GV9 A;  3WP6 A;  4XUR A;  1YJK A;  2P2K A;  5FO7 B;  4QAW A;  1YIF A;  2E9Q A;  1ND2 B;  2BBA A;  4B3N A;  1VE0 A;  1HN0 A;  2GN7 A;  1OXC A;  1UX7 A;  2HYX A;  1AF9 A;  2FBE A;  4LR4 A;  4ZZ5 A;  1AR6 2;  1U12 A;  2XML A;  4WM8 B;  2GME A;  5ABJ A;  4WBB A;  2VW1 A;  4CDQ A;  1FPN 1;  1SDW A;  3VD4 A;  3ZXJ A;  1GWM A;  1MZ6 A;  3POB A;  5L9V A;  1W39 A;  4QPW A;  3MFC A;  4XDO A;  2JKB A;  4NPL A;  2CTV A;  2LW8 A;  2Y26 A;  3Q8E A;  5FZA A;  1BCX A;  5H9Q A;  5C3Q A;  3W5N A;  3RZK A;  4MGS A;  4QPG B;  5FJK A;  2Y0I A;  3AYA A;  5F3I A;  5HXV A;  5CKN A;  4FFH A;  3AP7 A;  4RHV 2;  3A23 A;  1Z0H A;  5AC9 2;  3TEW A;  1H2M A;  4A44 A;  5GLT A;  2LAL A;  4QXB A;  2BNM A;  3NV1 A;  3PTY A;  2ARC A;  4GKX A;  2XXZ A;  1YQC A;  4GZ9 A;  2ZS6 B;  3TEX A;  1UQX A;  2RV9 A;  3MF9 A;  1O3T A;  4CXW A;  4MET A;  4DEV A;  1GNY A;  1W2A X;  2HEW F;  3SHR A;  2BWA A;  4OQ9 A;  2D6O X;  3WDW A;  3ZFG C;  5DAP A;  3PLQ A;  3ROU A;  1YFX A;  2WC2 A;  4XAE A;  1N1S A;  2GC2 A;  4QDR A;  2RM2 2;  1URX A;  2Q1Z B;  1OUR A;  3HBK A;  5KBF A;  2RS1 3;  2QTW B;  2P34 A;  4JQT A;  1PGS A;  4QDQ A;  4Y1U A;  4AI8 A;  2VZO A;  2XJQ A;  4CU6 A;  3A0K A;  1QMJ A;  2WA4 A;  1FMD 3;  1D4M 3;  2WLQ A;  5F39 A;  4QB6 A;  1CGP A;  2X5I C;  1VRH 1;  4Z07 A;  4UAP A;  1G9D A;  2XB6 C;  3KF3 A;  1ZA4 A;  1LOA A;  5I0R A;  4OCT A;  3SH5 A;  5CKM A;  4A41 A;  2NPI A;  2QDN A;  2XOM A;  4XAC A;  4BPZ A;  1CPN A;  4QXK A;  3ZXA C;  4BK4 A;  1RC6 A;  2VZ1 A;  4QPI C;  2P1B A;  4DS0 A;  4Q2F A;  1NG0 A;  1W6Q B;  4MZU A;  4DUW A;  2XKP A;  4DFS A;  4M3C A;  3WSO A;  1C8M 1;  5FRE A;  3C7E A;  4Q8L A;  1UOB A;  5IVE A;  1RUD 2;  4D7Y A;  3TN9 3;  3WNO A;  1LCL A;  2OVU A;  1C28 A;  4QX5 A;  3I59 A;  4MUV A;  3ITQ A;  3OEA A;  2MEV 3;  3KT1 A;  4KWL A;  5T5O A;  2A3Y A;  3AKS A;  1ND2 C;  1QH6 A;  4LO4 B;  3LA2 A;  3MEP A;  1RUG 3;  4GH4 A;  2E53 A;  3ZDS A;  4B4P A;  5C8C B;  2VBD A;  3I8T A;  3ZKY A;  1GOF A;  4AF9 A;  1LED A;  2YPD A;  3MHZ A;  3FFQ A;  4FP3 A;  3HQX A;  1WUV A;  1QJZ A;  2YXS A;  1AXY A;  4YGE A;  1NT0 A;  4WM8 C;  2DDU A;  4J6G A;  1CAU A;  2RJL A;  5C5T A;  1WGP A;  3VZK A;  1VBB 1;  5JVV A;  3GZE A;  4E8D A;  4B7E A;  1D4V B;  4JGZ C;  1OLR A;  2PN5 A;  4BM8 A;  4QPG C;  4CRQ A;  2VZQ A;  1NOV A;  1PHM A;  4C1X A;  1ULE A;  4CA9 A;  4HT1 T;  5H9S A;  1H6X A;  4LBO A;  3N9O A;  2QFE A;  4FOV A;  4PDW B;  4CCD A;  3EHK A;  2PAM A;  4JKM A;  5CFD B;  4MGY E;  4N43 B;  3X29 B;  4O7X A;  2W1S A;  1N47 A;  5LZ6 A;  3UYJ A;  2L9L A;  1UF2 C;  1EAH 1;  2O1Q A;  3AP4 A;  2C9K A;  1QOO A;  1R08 3;  1O7F A;  4LUK A;  3I3B A;  3OTF A;  1R1Z A;  4DXZ A;  1I9R A;  3WNP A;  1AXK A;  1CQ9 A;  2ATF A;  2DVG A;  2PHD A;  5L73 A;  1PO1 1;  2YBS A;  4IUG A;  4RS5 B;  4JX0 A;  1BVP 1;  3ZO0 B;  2HJI A;  3Q8B A;  2Y6F A;  1MQT A;  3VKM A;  5BUV A;  5GLU A;  4JC1 A;  3C7O A;  4DRR A;  2Q8E A;  5DZG A;  4EWE A;  4PCR A;  1LHW A;  5GJ6 A;  5F3C A;  3MZH A;  1V70 A;  3LIH A;  2ZGS A;  3KHB A;  3OYW B;  3VDD B;  3WIN E;  3BIE A;  3KCX A;  1HRI 2;  2HWB 1;  2R49 A;  4H55 A;  5A7O A;  2WAO A;  5FR3 A;  2IXJ A;  3THP A;  5IVV A;  2YFU A;  4GMP 3;  2CAV A;  1S4C A;  1US3 A;  5DUV A;  1GQG A;  1Z7S 3;  3B3Q E;  2Y8K A;  3LEM A;  1SZB A;  3UT0 A;  3MLK A;  4ASK A;  5FQ0 A;  5I0S A;  5IAT A;  4AHX A;  5KHG A;  1ZRR A;  1QQP 1;  2WII B;  1UAI A;  1QIQ A;  1VR3 A;  3O0X A;  3AMQ A;  1YXW A;  4UBH A;  1YQ5 A;  1XSR A;  2W52 A;  3WR0 A;  1PZ8 A;  3LPG A;  4NVP A;  1B09 A;  1W8W A;  3W9A A;  5DDJ 1;  3ORJ A;  4Q29 A;  2A73 B;  4YYO A;  1AYN 3;  4BE3 A;  2SLI A;  4FO9 A;  3GYD A;  2JE8 A;  4JRL A;  2VCA A;  5F37 A;  4P00 B;  1DGL A;  1CZT A;  1H9P A;  1PNF A;  5D21 A;  4PF5 A;  4IEO A;  1I5P A;  2J1S A;  3LDR A;  3I2F A;  3NKG A;  4NOT A;  4LO5 B;  2QKD A;  1YQ2 A;  3VBU B;  3WP4 A;  4AVS A;  5C8C C;  1LNS A;  2VCC A;  1XYO A;  1RJ7 A;  3QH7 A;  3T1L A;  2ZX1 A;  4HPK B;  1EPZ A;  2IXI A;  2VGD A;  3OBZ A;  4YVW B;  4CEY B;  4CUA A;  2UY9 A;  1RUJ 1;  4AZZ A;  4LA2 A;  3BTY A;  1VIW B;  1NCR B;  3R05 A;  2RDN A;  3KCY A;  1W2U A;  5I0T A;  2P37 A;  3J8F 3;  2SBA A;  3WQ1 A;  1VMJ A;  3BTZ A;  4IE6 A;  4NE9 A;  3LOB A;  1I1E A;  2FCT A;  4S2D A;  4FXG B;  4CDU B;  3LGR A;  4YAR A;  2VUJ A;  4CPB A;  1VBE 1;  3IAP A;  1CX4 A;  1XXN A;  4XF0 A;  4QPY A;  1QNY A;  1ZYB A;  3PVO A;  3PMS A;  1XJA A;  2D7F A;  1OQ1 A;  1S0J A;  1XU1 A;  1AR8 3;  2ZX4 A;  3BCW A;  3Q9O A;  5FZO B;  4PDW C;  3L2H A;  1KIT A;  5CFD C;  1K5M B;  4R4Z A;  4KL1 A;  3TEY A;  1VBD 3;  3CNA A;  1ZBE 2;  4N43 C;  4OZX A;  1UNB A;  3VLB B;  5CVR A;  3WW3 A;  1MS1 A;  2DBI A;  2EAA A;  2AEZ A;  1AX2 A;  2BOJ A;  2GNT A;  1Q8O A;  2B39 A;  1D0H A;  1IPS A;  3K77 A;  5CIR A;  4A6S A;  1DDL A;  1ND3 C;  3APB A;  4I3P A;  4RS5 C;  1XND A;  3S6P A;  3USU A;  4FPC A;  4P08 A;  2VXR A;  4E4D X;  2YC4 A;  5IVY A;  4DIQ A;  2IXK A;  3I49 A;  3BUC A;  2W94 A;  1TNR A;  4HLT A;  2VZ3 A;  2F4P A;  2YDE A;  3MID A;  2A7A A;  3VDD C;  3WDY A;  3AB0 A;  4I2O A;  4A7Z A;  5JZG B;  1W28 A;  3VKN A;  4IW3 A;  3USS A;  4QU1 A;  2Z4F A;  1VBA 1;  4JTN A;  2QQN A;  1JYC A;  4AHZ A;  3S5Q A;  4BLI A;  4HFS A;  3J7L A;  2GH8 A;  2BW8 A;  2VVE A;  2VCB A;  2R07 1;  1S2E A;  3MLJ A;  4TXW A;  1DP0 A;  2R04 1;  5A1L A;  4YZ2 A;  2IC1 A;  2IXC A;  1V9U 1;  4GAL A;  3AFG A;  3OBR A;  1ULF A;  4AE2 A;  2OPK A;  2RDS A;  2OUH A;  2ZGQ A;  4GWJ A;  2G9Z A;  1TMF 2;  2ARE A;  1MZ5 A;  1O8P A;  1W8O A;  2UWC A;  1YO8 A;  3NJZ A;  1GZT A;  5GLV A;  4N9H A;  5GZE A;  5BNO B;  5IVC A;  2WZR 1;  1W6P B;  4ORF A;  4EQV A;  3K48 A;  5IT6 A;  4BXS V;  4QX7 A;  4TTG A;  1U0A A;  5FUI A;  5A3T A;  5HCA A;  3E5X A;  1AYM 2;  2A6Z A;  2OZJ A;  1AX0 A;  3ZYH A;  1LEM A;  5B4N A;  5ACA 2;  3WCS A;  3M4F A;  3VBU C;  5FZ3 A;  5IK4 A;  2JB4 A;  3OG2 A;  4Q27 A;  4BQW A;  5FPX A;  5FMD A;  1EY2 A;  1VP6 A;  4QM9 A;  4YVW C;  2R06 3;  4CEY C;  4EV0 A;  2A5Z A;  1WBF A;  5DAW A;  3HQR A;  3LDK A;  5CEH A;  3THD A;  1RMU 1;  1GP6 A;  1NCR C;  1BK1 A;  2D98 A;  1ASJ 3;  4RFR B;  2DFB A;  3VD7 A;  1HV1 A;  2RDQ A;  3MV0 1;  5GZD A;  1CIY A;  1JHJ A;  2RMU 3;  4EN0 A;  4CDU C;  1G7Y A;  3KV6 A;  4YG3 A;  1IS6 A;  4I0W B;  5JSR A;  1ZRE A;  5J09 A;  4LO7 A;  4OUL A;  3S5A A;  2W9X A;  3K4A A;  1SDD B;  3EJK A;  1IG3 A;  4TLF A;  4HL0 A;  2Q8O A;  3GJA A;  4DXS A;  2ZGM A;  3ZFG A;  1GR3 A;  2DU0 A;  1AR6 1;  2PAK A;  3M3E A;  1VBC 3;  3B02 A;  1HRV 2;  5FZI A;  2C6S A;  2VOW A;  1RUI 2;  2WFF 1;  1X8E A;  2JD4 A;  3PU8 A;  1DQ5 A;  4S2G A;  4OI1 A;  5M0T A;  2CL2 A;  4B4Q A;  2B46 X;  3DEC A;  1CZS A;  3SIT A;  3J7H A;  2EIE A;  1H8T B;  3GHM A;  3VZJ A;  2ZAA A;  2ZGL A;  3G7D A;  1GP5 A;  4BQ1 A;  4PLO A;  4QB1 A;  1XE0 A;  4DOU A;  4E8C A;  1W6O A;  5FKB A;  5FYM A;  3VHP A;  2X5I A;  1ULD A;  3N9P A;  3JXS A;  3SQO A;  1JI6 A;  5D2A A;  2ZX2 A;  4Q26 A;  4Q8K A;  4Q1P A;  4ZHN A;  2CDP A;  4WVZ A;  1N3P A;  1ENR A;  1OMI A;  1GZC A;  2RS3 3;  2DF7 A;  3T09 A;  5AC9 1;  2RJ2 A;  1W0P A;  3GHN A;  1POV 1;  2WS9 1;  1EV1 3;  2NQY A;  3ZR5 A;  1C57 A;  4TWT A;  1OOP B;  4W4Z A;  2ILM A;  1JMU B;  4XIK A;  2HWC 3;  2VVF A;  1ZBA 3;  2R30 A;  3NW4 A;  1W0O A;  5JZG C;  4ES9 A;  3GBF A;  1WMX A;  3UET A;  1R64 A;  4IV1 A;  1J3Q A;  1SBF A;  2W92 A;  4HBN A;  2HEV F;  4KG8 A;  1RYY A;  1HDK A;  4B7K A;  3IMN A;  5BNP C;  1ND2 A;  1UIJ A;  2RM2 1;  4AGR A;  4FPF A;  4HVQ A;  5K0U C;  1SG3 A;  5ERL A;  2JDK A;  1XNA A;  4GXL A;  4W50 A;  5H9P A;  2Q8D A;  5I93 A;  5L7O A;  3RS6 A;  4QQO A;  1QF3 A;  3VBF A;  5CKQ A;  4AEK A;  5CNA A;  5FPL A;  5BNO C;  5FZ4 A;  1PIV 3;  3WUC A;  2IUW A;  2V4V A;  5HXM A;  5EJ1 B;  2WIN B;  3MUY 1;  2QZ2 A;  5LRS A;  2RS1 2;  1RIN A;  2J1R A;  4JGZ A;  4A45 A;  1GFF 2;  1OI6 A;  2W91 A;  3LAG A;  4XIO A;  1A78 A;  4F8A A;  4L0P A;  1LHV A;  1RUN A;  2QZ3 A;  5T3N A;  1D4M 2;  1FMD 2;  1IG0 A;  1UMZ A;  5CAD A;  4RR3 B;  4L99 A;  4NHY A;  3UKN A;  2A1X A;  1RUD 1;  4FOW A;  5F5A A;  2HLE A;  1EP0 A;  2WQ4 A;  3NAP A;  5FIX A;  4I0A A;  3WF1 A;  1AR9 3;  2PA7 A;  4PF1 A;  3IDA A;  4ARX A;  2VUL A;  2DFC A;  3CZU A;  3EQE A;  1ALY A;  3N35 A;  3OGS A;  1N1Y A;  3OPZ A;  1RXF A;  3RJ2 X;  1AVB A;  4JKL A;  3NWK A;  1STM A;  3ACG A;  3WNK A;  1YJL A;  1O4Z A;  1UZW A;  4Y5T A;  3V0B A;  4I3G A;  4OHX A;  5FZK A;  1OQE A;  3NJX A;  3MIC A;  3R4U A;  4DZG A;  2XVL A;  1KDK A;  2C4X A;  3TN9 2;  5JXI A;  4YM1 A;  2G1M A;  2XJR A;  2W1U A;  3N3H A;  4BQ2 A;  5T5J A;  4MXW B;  2PHF A;  3VD9 A;  3N7L A;  3RMY A;  1R09 3;  2E6V A;  5C4W B;  2BDR A;  3RI9 A;  1DGR A;  4UW4 A;  4FTE A;  2EIB A;  3PUA A;  4XFH A;  1H8T C;  5EP9 A;  2ZGO A;  5EWS A;  1W06 A;  3JCI A;  5FPV A;  3J7M A;  5JCT A;  3I3M A;  3I2O A;  2WZ8 A;  2XWJ B;  1J1T A;  2DWR A;  1UN1 A;  5A7P A;  1F9K A;  2D6K A;  5A3L A;  4IGQ A;  2AEY A;  4FTB A;  3WF0 A;  3VL8 A;  2A3W A;  5F5C A;  3U11 A;  4LTA A;  1WWY A;  5JLV A;  1PGW 2;  1OPO A;  3JD7 3;  1S2B A;  1W6Q A;  2W2I A;  2UWB A;  3IBM A;  1PNG A;  3ZXE A;  3MFA A;  1OOP C;  1VAK A;  2WYF A;  4LBJ A;  2JB8 A;  3PUR A;  4XJW A;  3NNL A;  2WO1 A;  2VQT A;  3HN1 A;  4F3J A;  4AAP A;  2CWS A;  2YHJ A;  4A4A A;  2WN3 A;  3III A;  1XSQ A;  2W1W A;  5FZC A;  1TE1 B;  3CEW A;  1QH7 A;  4Y4R A;  2ZAC A;  3DF0 A;  2ZEW A;  5LY2 A;  1DHK B;  3O7O A;  2D5H A;  2W5F A;  4AFB A;  1IGO A;  1LOE A;  3KT4 A;  2BEO A;  2J1T A;  1R08 2;  4I01 A;  2ETE A;  1J1L A;  5D8A B;  2BUK A;  2TEP A;  4UW5 A;  1O3S A;  1C3H A;  1JZ6 A;  1RIR A;  3K3N A;  2DCK A;  2Q1M A;  5FYH A;  1HRI 1;  2ZHN A;  4Y24 A;  4QGL A;  3GXU A;  1O4T A;  1HQN A;  5KC5 A;  4UFM A;  4JDO A;  3S30 A;  1T6B X;  2XJS A;  1W8Z A;  3K4Z A;  4XJA A;  2HBU A;  1QJF A;  3LSD A;  1V6I A;  4DO0 A;  1WD4 A;  4YGD A;  5JAX A;  3HEI A;  3KS7 A;  3GJB A;  1V6J A;  4RQP B;  3ZPO A;  2XR4 A;  1WCK A;  4CCJ A;  4FPY A;  1W8U A;  5EHD A;  2DUO A;  4LO6 B;  1IQD C;  3N9Q A;  4H7L A;  1IPJ A;  2QQV A;  2C5D A;  1HV0 A;  3P5B A;  2B7Y A;  1UYZ A;  3I2H A;  4RR3 C;  3DN7 A;  1Z7S 2;  3CDZ B;  5J36 A;  5FUN A;  1NE4 A;  3MIF A;  5CFD A;  3ON7 A;  1RUF 1;  2ZGR A;  2DCZ A;  3ETQ A;  4DPN A;  1DIW A;  5C8W A;  3ILN A;  2FDI A;  5F9T A;  5I8T A;  1LOC A;  1KGY A;  5BYN A;  1HW5 A;  5E88 A;  4PI0 A;  2P17 A;  4P14 A;  3E5U A;  1RHI 2;  1GWK A;  1RED A;  2XHN A;  1H1I A;  2VM9 A;  5A70 A;  1ND3 A;  3FJS A;  3V64 A;  2ZX0 A;  1PMH X;  5T54 A;  4NWW A;  1OVS A;  4RFT 0;  2HEY F;  5BNQ A;  1QJX 3;  4LNV A;  3FWE A;  4GWN A;  3ZR6 A;  1F5F A;  1LUL A;  3I2D A;  2MPF A;  2D6P A;  3M3Q A;  5KHH A;  4BB3 A;  3MYX A;  1HB3 A;  2FCU A;  2VQU A;  3B7M A;  3MPB A;  5FPZ A;  3A21 A;  1UMH A;  5C4W C;  5APA A;  3OUI A;  1PGL 1;  5DMY A;  3VDD A;  1ENX A;  3AK0 A;  1XYP A;  5C9A B;  3WG1 A;  5FUP A;  2D6N A;  5FZ0 A;  4HON A;  1SLC A;  4MGK E;  5BV6 A;  1ULO A;  2UWA A;  3OPW A;  5GLW A;  4OUM A;  2VC9 A;  1LOD A;  3ZVX A;  2XJT A;  1Q8Q A;  2PQS A;  1JZ3 A;  4DUV A;  2UU8 A;  3JQW A;  5JI9 A;  2ZJC A;  3J8F 2;  3ILF A;  3BU0 A;  3UES A;  1BVV A;  1ZBE 1;  4Y26 A;  3QOP A;  4F7Z A;  5A7S A;  5LBE A;  4J1W A;  4JHT A;  3RNS A;  1XNC A;  4AED B;  1U5X A;  2LUW A;  2ZBJ A;  1UMI A;  2RR1 3;  4JDM A;  1VAL A;  3JUU A;  4NWV A;  3T2T A;  2VJX A;  4MGQ A;  3SC7 X;  3WV6 A;  3LZZ A;  1UY1 A;  3WHU A;  5K7P A;  3PUH A;  1JZ5 A;  2V4A A;  4UF0 B;  1AR8 2;  4HKL A;  1KJL A;  5ANN A;  3DKQ A;  5LY1 A;  2VCM A;  1LGC A;  1WMD A;  1VBD 2;  2G19 A;  3M3C A;  4TYS A;  5LAT A;  4FFI A;  1ZZB A;  3OBA A;  4PQQ A;  3W5M A;  2CU5 A;  5JOY A;  4QQL A;  2WNV C;  2VME A;  2WNU A;  2RDR A;  4XFA A;  5D8A C;  3VBU A;  1YUD A;  4AI9 A;  4QGM A;  1C8N A;  1BYH A;  5A80 A;  3RWN A;  1UD1 A;  4HPK A;  3F2Z A;  4CEY A;  1UU4 A;  3WNL A;  5FWJ A;  1NCR A;  4OI2 A;  3JB4 C;  4LLF A;  4ITC A;  1WCS A;  4HKO A;  4QKF A;  2GNM A;  1WLT A;  4YG6 A;  4LBK A;  1SQ4 A;  1BQP A;  4CDU A;  4RQP C;  1BHG A;  1PK6 A;  3M7A A;  2HWF 1;  3VD3 A;  3ZYF A;  2JDY A;  5CFC B;  1OA3 A;  1XOY A;  1H6Y A;  3D3A A;  1TMF 1;  4X6R B;  2ZHK A;  1HKD A;  2O0O A;  4CEW B;  5IYY A;  3S0M A;  3ILR A;  2VG9 A;  4Z2A A;  2D6L X;  3BPS A;  3VDA A;  2VU9 A;  5HCB A;  2WBK A;  1S0D A;  3UKV A;  2XVK A;  2YB7 A;  3AMN A;  3ZN5 A;  2XJP A;  1O91 A;  3U4X A;  5GLZ A;  2ZEZ A;  1AYM 1;  3ZFE B;  2VZS A;  1SCS A;  1UU5 A;  4TLG A;  3NST A;  4LIU A;  2AGS A;  4XFI A;  4DRV A;  1LJ7 A;  3I54 A;  2GP3 A;  4FQ4 A;  4LUL A;  3RI8 A;  1PMJ X;  3F95 A;  2JG9 A;  2WYS A;  3ZYR A;  1DQ2 A;  2A6X A;  3KGZ A;  3LIG A;  4K8F A;  2C1F A;  1AXZ A;  4WVM A;  1W9W A;  4Y1V A;  1JUI A;  5FRA A;  5FZ7 A;  2VNO A;  4MXV A;  2FHR A;  3CO2 A;  4XFB A;  1WCQ A;  4JTO A;  3I3D A;  2Q8C A;  1G6N A;  4XCB A;  4OI0 A;  2A6Y A;  4HXC A;  4XUQ A;  3MUZ 1;  1DCS A;  1BEV 1;  4ASM B;  1UX6 A;  5C9A C;  1POV 0;  2VZV A;  1KS5 A;  1ULG A;  3WD5 A;  3GNE A;  5JZG A;  2QDR A;  2R06 2;  3B5L B;  4J1X A;  4YGC A;  1NXM A;  4W6Y A;  1DGR N;  1PVC 1;  1IPK A;  1ASJ 2;  4LBQ B;  4XE9 A;  4DY3 A;  3DXT A;  3DEM A;  1AJO A;  5BNP A;  1RUI 1;  3POE A;  3QLQ A;  4LK7 A;  2QQM A;  1NCQ A;  3CF6 E;  2JDU A;  2RMU 2;  4IV3 A;  2JWP A;  2PHR A;  5K0U A;  1NZC A;  2X53 S;  1Q8P A;  1JHN A;  4TZD A;  4AED C;  1L7R A;  3RPQ A;  2DCT A;  2P3K A;  5J37 A;  2F4L A;  2Y60 A;  4NIG A;  1JTZ X;  2JDH A;  1C4R A;  4ZU7 A;  1RJ8 A;  2ZMN A;  4C1W A;  5L9B A;  4COU A;  1VBC 2;  3HBZ A;  1REE A;  3AZW A;  4Y22 A;  1UYX A;  5AFE A;  1C8M 3;  1AL2 1;  2OUJ A;  1CJP A;  4LT5 A;  4KNC A;  4L11 A;  3VBS B;  4KGG A;  2WAA A;  4WM7 B;  3DKW A;  5DAB A;  5LBF A;  3RMX A;  4H2A A;  4RGG A;  2Z2S B;  3CMG A;  2R32 A;  3WZ1 A;  1NLQ A;  4XDP A;  4XUN A;  3VDB A;  4LHL A;  3FFZ A;  2RS3 2;  4HK9 A;  4C90 A;  2CGO A;  4NHL A;  5DUU A;  1J3P A;  5T5L A;  1XC6 A;  3MLL A;  5FPU A;  1SPP B;  3Q8C A;  5B2G B;  2WLP A;  1RVF 3;  1EV1 2;  2QCS B;  4GUL A;  4HVO A;  5FMO L;  4I02 A;  5C6C A;  2ARA A;  2VZT A;  3WVJ A;  1WMF A;  4I30 A;  1X36 A;  3GZU C;  5CFC C;  2HWC 2;  2KM2 A;  5KHK A;  1UXZ A;  1ZBA 2;  4V2W A;  4YG0 A;  2BU9 A;  1G8W A;  3QBQ A;  3U78 A;  3VUO A;  3HOB A;  2R6Q A;  4NRQ A;  3C2U A;  4O65 A;  4CEW C;  4XJ8 A;  3OGR A;  4Q0V A;  5JR7 B;  1KEX A;  2K9Z A;  1SLT A;  4QKB A;  2GP5 A;  3WNX A;  3U4S A;  4IXL A;  3ZKU A;  1CAW B;  4M0H A;  3ZX7 A;  1HXS 3;  3PVN A;  4M4R A;  2DTW A;  3PU3 A;  1F4H A;  3ZFE C;  1Y9Q A;  2RS1 1;  2VW0 A;  2AEN A;  3FHA A;  4QT6 A;  2RHP A;  2PLV 2;  3LB9 A;  1TEI A;  1WLC A;  1FX5 A;  1FMD 1;  1COV 1;  2WR9 A;  3QAC A;  5F1R A;  4Q1R A;  3N36 A;  5FZ1 A;  5L19 A;  4FQZ A;  2WN2 A;  4MSV A;  4CDW B;  1PIV 2;  1Q56 A;  1XB9 A;  5EXO A;  5I8S A;  2YFZ A;  5A3U A;  5HV0 A;  1UCX A;  1FT9 A;  2XDV A;  4IEP A;  1JZ7 A;  3AZZ A;  5FP8 A;  3JZV A;  4UFL A;  3VKF C;  4AI0 A;  1OOP A;  5FFO C;  2BPA 2;  5A3N A;  2WO3 A;  3U1X A;  3ZN6 A;  4Z92 B;  4PJY A;  1Q8S A;  1MZE A;  3OCP A;  1HN1 A;  1FAT A;  2BNN A;  5JDB A;  3POS A;  3JBG 2;  4QHB A;  2ZAH A;  4CU9 A;  1AL0 G;  2JDP A;  2QQL A;  1KD7 A;  2Y6G A;  1UO9 A;  3I2K A;  3KQ4 B;  2HWB 3;  4NHX A;  4XXA A;  1AR9 2;  1LOF A;  5IW0 A;  4AR2 A;  2GZW A;  1V0A A;  2AR6 A;  2E7A A;  5A3P A;  3DPR A;  3E6B A;  4LE3 A;  5FKC A;  3SMH A;  4JZR A;  1OC1 A;  2DCY A;  3SCH A;  1BMV 2;  4LBN A;  1QQP 3;  1EUT A;  1JBC A;  3IPV B;  3NQH A;  3MF6 A;  5EZW A;  4AVT A;  4MH0 E;  2F17 A;  2WKK A;  1JYN A;  1L3J A;  1W2N A;  2FZ1 A;  3BKZ A;  3ETP A;  1SBE A;  4KWK A;  4P9X A;  5FMB A;  4BCU A;  5JPM B;  1JW6 A;  3ZPY A;  4XJZ A;  3D8C A;  1TME 2;  4NIH A;  4M3C F;  4YWA A;  4KU7 A;  5CZK A;  3VBS C;  2VZR A;  3IB3 A;  1ZX5 A;  3CU7 A;  1Y9M A;  2VBP A;  4KU8 A;  4WM7 C;  4P5H A;  3M2M A;  1VMH A;  4XDQ A;  4XAA A;  1MS0 A;  3IZO A;  4FOY A;  1F15 A;  2ZGN A;  1SLA A;  5I91 A;  2ZGK A;  2OA2 A;  2HWD 3;  4QDS A;  5IAV A;  4D7T A;  4H7M A;  2VEC A;  4CCN A;  1WCU A;  2OQ7 A;  3O1T A;  4COW A;  4XZU G;  1ZM1 A;  1O4Y A;  3ES1 A;  5FYB A;  3FLR A;  4AI3 A;  3BU7 A;  3KD4 A;  1PVX A;  3ZYP A;  4ZS2 A;  3JD7 2;  1OD5 A;  1BZW A;  1RUJ 3;  1NX9 A;  1R08 1;  3THT A;  4B8E A;  3B01 A;  4CE8 A;  4UBG A;  3WUD A;  3TRS B;  1J59 A;  2BQP A;  2VNV A;  3WF2 A;  4HOO A;  5FWE A;  1ULP A;  2VOK A;  5GAL A;  3NV3 A;  4IE0 A;  2QQK A;  5FO8 B;  2JKX A;  4GD4 A;  1B35 A;  1RUE 2;  5LAS A;  1VBE 3;  4BQY A;  4IEZ A;  4FBF A;  5FPA A;  3RZZ A;  4ES8 A;  1DF0 A;  5FZE A;  2ZXQ A;  2H0V A;  2Z79 A;  4XBN A;  5LK5 A;  2B42 B;  2BOI A;  2DTY A;  4ZU5 A;  2CV6 A;  3DYO A;  1H2L A;  1JU4 A;  1W9S A;  2O8Q A;  5DPN A;  3RJR A;  3VL9 A;  5FXV A;  3ZYB A;  4Y1Z A;  4COZ A;  4CVU A;  3H8U A;  3GAL A;  3SCF A;  3O1R A;  1S2K A;  2CY6 A;  2MHF A;  2HH9 A;  3WDT A;  5JXH A;  2BV4 A;  4K6B A;  4CDW C;  1Y9G A;  3ACL A;  2PEL A;  3CJI B;  5LWB A;  1SLI A;  2WO2 A;  3HD8 B;  4R8H A;  2ZPX A;  1OFN A;  2BWC A;  2FDK A;  4YZ1 A;  3LEI A;  4YVS B;  3WEZ A;  5C3P A;  4QMA A;  4Z1V A;  4FVV A;  4Q4X 2;  4CDX B;  3PVE A;  1RHI 1;  5A32 B;  3ZDV A;  5A3M A;  2BYV E;  1F8V A;  5DAX A;  3LFI A;  1Y43 B;  1LEN A;  5F2S A;  4HZF A;  4ZS3 A;  3PIG A;  1PX3 A;  5FJH A;  4BK5 A;  1GZW B;  3HR9 A;  2JG8 A;  2BTV C;  3RG0 A;  5EIY B;  3VGI A;  1DG6 A;  1KDM A;  5FYY A;  4Q4Y 3;  2WNV A;  2WNO A;  2XGX A;  4MHU A;  1W2O A;  1O3Q A;  1CAX A;  5B4X A;  4BXF A;  1LES A;  4BME A;  4XYX A;  4JDN A;  3SKV A;  4GB3 1;  3U37 A;  5C33 A;  5DG2 A;  1DLC A;  2R04 3;  2IZW A;  1OH3 A;  4YW3 A;  1UXX X;  4L8Q A;  3AL5 A;  5FYV A;  1OKO A;  4CU7 A;  1QJX 2;  1OPM A;  3H1M A;  2J42 A;  4A42 A;  5FTT C;  1OA2 A;  1AZD A;  1HLC A;  4RYD A;  5LBC A;  4D0Q A;  1LGN A;  2CSG A;  1VAM A;  2Y64 A;  1RB8 G;  2C9A A;  2DVB A;  4CP0 A;  1MEC 3;  2ZAB A;  1WKY A;  1RUC 3;  2XL9 A;  3J8F 1;  4IER A;  4R9D A;  4XBL A;  4CZS A;  5LCW L;  3N9L A;  1BLZ A;  5FDB A;  4Y33 A;  4DNY A;  4LBM A;  5FY9 A;  1NE6 A;  2AYH A;  4YFW A;  2WZR 3;  1R1A 3;  3UL2 A;  3WP5 A;  4AVA A;  2D6M A;  4B1L A;  4AL9 A;  4CXX A;  1QJU 1;  4QHO A;  5LRR A;  3WW4 A;  3ELN A;  2ZGU A;  1SEF A;  3KVB A;  4LO8 A;  1OQD A;  1NQD A;  3FHI B;  2D43 A;  4AXO A;  3N4M A;  2BFU L;  1ODN A;  4XOG A;  1HB2 A;  5IK7 A;  2XBO 1;  4TN7 A;  5HPO A;  1VBD 1;  2WA3 A;  4XFC A;  2D5F A;  4MGT A;  1A34 A;  4Q4V 3;  5JMO A;  3BB6 A;  3ZXL A;  2VMG A;  3POY A;  3LD8 A;  3WOG A;  4Q0P A;  3TYJ A;  3KLS A;  3SH4 A;  3WG4 A;  1AR7 1;  4HAN A;  2JEC A;  2CYF A;  1RMU 3;  2W47 A;  3FLP A;  1ZZC A;  3AP5 A;  4G3Y C;  4A2U A;  1PO2 2;  1US2 A;  1Z78 A;  4PIY A;  2EVX A;  3VB9 A;  2GDF A;  2CWM A;  1YRZ A;  3SEE A;  1J83 A;  4XQD A;  1UOG A;  1ZZ6 A;  1QJE A;  5GZF A;  2RS5 2;  3TOJ A;  3ZSK A;  4CCM A;  4CP9 A;  4X8N A;  4ASL A;  4P9Y A;  5JPN B;  1AHS A;  4SLI A;  5BPX A;  1SCR A;  3ZSE A;  3FLT A;  5LB6 A;  3CIH A;  3HT1 A;  4P02 B;  1SMV A;  2E7T A;  5EYX A;  2K2S A;  2WFF 3;  2KR2 A;  1UZZ A;  3WNN A;  3ZSL A;  5F3G A;  1S1A A;  4LOT A;  4AFC A;  3BTA A;  3ZMN A;  2LRP A;  4CTE A;  4QQP A;  4GQ7 A;  4COY A;  1YHF A;  3M70 A;  2YU1 A;  2HWE 3;  3CJI C;  2H6B A;  5A33 B;  1JYW A;  3DXU A;  4KI5 M;  1FOD 3;  2J1E A;  4M01 A;  1KFX L;  2D3P A;  4K40 A;  4XFG A;  5FP9 A;  5KHJ A;  1K42 A;  1CAV B;  4YVS C;  5CU1 A;  4AED A;  1RUH 3;  2Y6K A;  4FP2 A;  1UKG A;  2LTN A;  4LLO A;  4CDX C;  5FP7 A;  4QX8 A;  1YCI A;  5AC9 3;  3BOW A;  3SCG A;  4AGG A;  1OUS A;  1K5M C;  2WS9 3;  4OHW A;  3SNM A;  5F6K A;  5KXB A;  4L97 A;  2E32 A;  4FFG A;  2VE1 A;  1UOF A;  3L9J T;  3HPN A;  5JMC A;  3SLI A;  2BGP A;  2X10 A;  4M3C B;  2WUH A;  4DUX A;  1JUH A;  3KHC A;  1KFU L;  2J1A A;  4F83 A;  4W6W A;  3FE5 A;  2BBV A;  3J26 N;  1GQP A;  3WDV A;  3BN6 A;  4RHV 1;  4W65 A;  3CKH A;  4AI1 A;  3I59 B;  2FCV A;  1K5J A;  2GMM A;  1V6N A;  3B9I A;  2VR4 A;  4QPI A;  4NRO A;  3U0Z A;  5C7G A;  4Y20 A;  4NII A;  5JOZ A;  1T2X A;  3NV4 A;  3N7M A;  2AAC A;  3VBR B;  3WNM A;  4H3W A;  4GH4 B;  1ASJ 1;  1UWW A;  4NHM A;  5IVF A;  1ZZ7 A;  2TBV A;  2OW4 A;  4YM2 A;  1MS5 A;  3T1M A;  2BVB A;  1YQ8 A;  5CFC A;  5CIS A;  4ZKT B;  3IDC B;  4HKW A;  4AEJ A;  1ZRD A;  1YQ6 A;  1GAN A;  1SFN A;  2JX9 A;  3OPT A;  4B1M A;  4YSF A;  3A0N A;  3POF A;  3VZL A;  4S2F A;  1H0B A;  2O14 A;  1CAU B;  2A71 A;  1DQ0 A;  2RE9 A;  3ME2 A;  3O12 A;  5DZE A;  3FL7 A;  3IIA A;  4FPE A;  5A6Y A;  1JN2 P;  2NLR A;  3BGA A;  3PIJ A;  4QQ2 A;  4K21 A;  1VBC 1;  1Y4W A;  4TSV A;  2ZA9 A;  4A7Y A;  5CB7 A;  1GZ9 A;  3ZFE A;  4Q0U A;  4FAG A;  4A3X A;  4L9B A;  2TNF A;  3ASI A;  4CU8 A;  4URT A;  1QOS A;  4WM8 A;  2WNE A;  3LPF A;  3LCP A;  2GN3 A;  3MBW A;  4MHR A;  3ZFF B;  5ISL A;  2PAE A;  2BZD A;  1MS8 A;  2QQU A;  1BBT 3;  5EJZ B;  2A3X A;  3ACH A;  4Q4W 3;  2WZP P;  3PJQ A;  3RYR A;  2RS3 1;  3MW4 A;  4MGI E;  3EMR A;  3NNG A;  1C8M 2;  4N53 B;  4EE2 A;  1SAC A;  4N90 A;  4QPG A;  3FZ3 A;  3UKT A;  5FLI A;  3H8O A;  4FI9 A;  5FZ8 A;  1EV1 1;  4C0B A;  4Y5S A;  1JYI A;  5F32 A;  1GOG A;  4LEJ A;  2V5Y A;  5K4L A;  4LBL A;  4QHZ A;  1MQT B;  4XUT A;  1ZBA 1;  4XJU A;  4D69 A;  3S7E A;  3TWI A;  2W68 A;  4AFD A;  2P3I A;  2Q5T A;  3I3Q A;  5BNN B;  2VQA A;  5IK5 A;  4ZPI A;  1W05 A;  3ZIX A;  2YPJ A;  3WP3 A;  1A6C A;  2E51 A;  5F5Q A;  2FD8 A;  4FSJ A;  2QQO A;  2WJS A;  1QDC A;  1S0G A;  3ZN4 A;  1RVF 2;  2WAB A;  4UI9 L;  2P3J A;  3MPP G;  4NPR A;  4ZZ8 A;  1A8M A;  3HJR A;  2DVD A;  3OUH A;  4FPK A;  2X09 A;  2Y0O A;  1FV2 A;  1Y3T A;  1DFQ A;  3AC0 A;  3EB7 A;  3IT8 A;  4YPJ A;  1I3H A;  1MZF A;  4QD2 A;  5A6X A;  2CHH A;  1S0B A;  3AYD A;  2PLV 1;  3RYK A;  2VBB A;  2MEV 2;  2WT1 A;  4ET7 A;  3GBG A;  4LJH A;  4PIX A;  2B4K A;  1IS5 A;  1KQR A;  3HNY M;  4CSW A;  1LHN A;  1LEC A;  4BQ4 A;  4OFG A;  1RUG 2;  1DYP A;  3E6D A;  1GBG A;  1POQ A;  2UYB A;  3BIW E;  1W9T A;  4AQS A;  4AVV A;  1HXS 2;  3VBS A;  1E5H A;  4N9I A;  4FPL A;  3PTR B;  4CP2 A;  3KCC A;  1FNZ A;  4G4F A;  3I2G A;  4MV2 A;  4DMI A;  2D93 A;  3AJZ A;  2Z5W A;  2WQZ C;  4FFF A;  1GLH A;  3AYC A;  1ONA A;  5A3W A;  1IS4 A;  4LHK A;  4YZ3 A;  1CIW A;  1GNH A;  2IXL A;  3ES4 A;  4Y3O A;  4K1Z A;  2E7Q A;  2VMC A;  3JBG 1;  5E1R A;  3VBR C;  1SPP A;  4GKY A;  4GH4 C;  1W04 A;  1HRI 3;  3H8R A;  1LR5 A;  4WVW A;  1JOJ A;  3RWK X;  3T0D A;  3MIB A;  4IE4 A;  1DU3 D;  2ADE A;  2WDB A;  1OF4 A;  1W03 A;  3RQ0 A;  1RUO A;  1J84 A;  2NP0 A;  2JIJ A;  5KXD A;  2B9U A;  4ONU A;  2HWB 2;  1QDO A;  5FAX A;  5C8C A;  5A3O A;  2VMD A;  3U14 A;  1OLQ A;  1OLM E;  2BVV A;  3N9M A;  3AMM A;  1TME 1;  2C26 A;  1RXG A;  3AJY A;  5C71 A;  4XET A;  1HIX A;  4EN6 B;  1RUF 3;  2JXA A;  4XVH A;  3I3E A;  2WT2 A;  4BLJ A;  1QQP 2;  4HSL A;  4R4X A;  3T2P A;  4CCL A;  4CCK A;  3ZFF C;  5C3S A;  1NYW A;  1D2S A;  1NA1 B;  3U07 A;  3LA3 A;  3UJO A;  1W90 A;  2VY0 A;  4HN0 A;  4WV8 A;  4GMP 0;  4AQ2 A;  4KQ7 A;  1ODM A;  1VMF A;  3N7K A;  4N53 C;  3T3Y A;  3WLU A;  4BQX A;  2BER A;  4D6R A;  3NV2 A;  1YFY A;  4V1P A;  1OHF A;  2DU1 A;  3A4U A;  5FP3 A;  5FOJ B;  3ACF A;  2QQJ A;  3JD7 1;  1OFS A;  1LKN A;  1TZO A;  3PL0 A;  4PDW A;  4RA0 A;  2GAL A;  2XUM A;  4LKF A;  3T2Q A;  3USU B;  3VBO B;  3IM0 A;  4XAB A;  3C7F A;  5GZG A;  1EPW A;  1DGW X;  1MQT C;  3OOX A;  3AL6 A;  4K3U A;  1X8M A;  4N43 A;  5GKA C;  5BNN C;  2HWD 2;  4OMC A;  3V65 A;  5LA9 A;  2FDH A;  1XQN A;  1JH5 A;  5EFU A;  3S7I A;  2OKX A;  1RUE 1;  2TUN A;  5CG9 A;  4JGY B;  5AVP A;  4DEQ A;  5HBA A;  2FDF A;  1MS4 A;  4RS5 A;  1RUJ 2;  5H9R A;  4AEM A;  1AYN 2;  5FO9 B;  2OPW A;  4NID A;  2VOV A;  1S0E A;  1CES A;  1D7P M;  4MGZ E;  1RGS A;  2GNB A;  3VHR A;  4CDX A;  1LOG A;  2OZ6 A;  3PUI A;  4NUB A;  5IWF A;  4BOW A;  2NM1 A;  4PLN A;  1XRU A;  1VBE 2;  4DQA A;  1N3O A;  3NNM A;  1PZ7 A;  2YG0 A;  3A7Q A;  2YUE A;  3OYW A;  4ZON A;  4D6Q A;  4D94 A;  5L36 A;  1W6M B;  3NKT A;  3FC0 A;  3W20 A;  3NJV A;  1YFU A;  1VB4 A;  2VMI A;  3EBR A;  1WA4 A;  1BXH A;  4XQ4 A;  5KHI A;  1T6G C;  4BHP A;  2LRO A;  1QXJ A;  4AK3 A;  3AYE A;  4YW1 A;  5F6L B;  3RSJ A;  1CD3 G;  1O6U A;  1E5R A;  3DUI A;  4Q4X 1;  3QH6 A;  2P5B A;  3KGL A;  3CBN A;  3BAL A;  2JDM A;  3VD5 A;  3H3Z A;  5I0U A;  4UW3 A;  1LTE A;  2Y34 A;  3O14 A;  4LIT A;  2G9F A;  2ZHL A;  3IMM A;  3O1O A;  2OS2 A;  3E1F 1;  2ZKL A;  5HV4 A;  3QCW A;  3GF6 A;  1MS3 A;  3GM8 A;  1M06 G;  4XBQ A;  5FY4 A;  4BA6 A;  1UOJ A;  2QQP A;  1OBN A;  5D1I A;  1JS9 A;  5IVJ A;  4MOA A;  4BJ0 A;  5IHR A;  1H2N A;  3OEB A;  4LK6 A;  2HYK A;  3J4U H;  4KG0 A;  4DY5 A;  1WW4 A;  4CP1 A;  4GJZ A;  4YM0 A;  2JIC A;  3O1U A;  2A70 A;  1QJY 3;  2AUY A;  1DQ4 A;  4YNI A;  4KBB A;  2ES3 A;  4XF4 A;  1FYU A;  2NMO A;  5FXX A;  1G9F A;  4AVB A;  4OQ8 A;  4JCK A;  3I7D A;  1AJK A;  1GWL A;  1WW5 A;  2HWF 3;  3ZXF A;  4IGP A;  4EN7 B;  2XWB B;  4Q4Y 2;  1G9B A;  3B94 A;  4YLZ A;  3ZYI B;  3POJ A;  4EWD A;  4FOQ A;  4YVW A;  3ZXD A;  3ZFG B;  4P9W A;  3B9C A;  3R0R A;  1LOB A;  4KBZ A;  4XIL A;  1H1M A;  2DUR A;  4YM3 A;  2XQX A;  4XTP A;  3NRU A;  5J7M A;  3AZX A;  4CCC A;  1NA1 C;  4LIV A;  2H6C A;  5FY0 A;  3CJI A;  1MEC 2;  4HN1 A;  2PXJ A;  1RUC 2;  1UY4 A;  4KGQ A;  3RZL A;  2DV9 A;  2XHK A;  4YVS A;  1W6O B;  1DLL A;  1YEW A;  1FPN 3;  2E63 A;  2X5I B;  1LB2 A;  2YMZ A;  5FYU A;  1R1A 2;  4P9I A;  5FZO A;  4CYD A;  4D7S A;  4YW7 A;  3HVD A;  4OUE A;  1BJQ A;  3VBO C;  1K5M A;  3DCQ A;  3MW3 A;  1PO2 1;  1LAJ A;  3LEK A;  4UOJ A;  3PHM A;  1ZA7 A;  1HQW A;  2B8M A;  4XPV A;  1G86 A;  2GC1 A;  3IDB B;  4Q5O A;  5FYS A;  3C7H A;  3S57 A;  1GZW A;  3P3P A;  1BEV 3;  3SIS A;  3HNB M;  2IVI B;  1ULC A;  1XNT A;  2OQ6 A;  2VZU A;  4M4P A;  2RS5 1;  1ZRI A;  1V00 A;  1G9C A;  4K1Y A;  4LOS A;  4Q4V 2;  2Y6J A;  5ACA 1;  4M00 A;  4JGY C;  3HMY A;  4AFA A;  1ZRC A;  4AWD A;  2KD7 A;  2JE9 A;  1DZQ A;  1PVC 3;  4K8R B;  2BNO A;  1RMU 2;  2Q0A A;  4GIQ A;  4LKS A;  3ST7 A;  4PQ9 A;  5CAZ A;  2EXI A;  1OH4 A;  4IV1 B;  4I09 A;  4XHB A;  3OGJ A;  3T4H B;  5JWP A;  1JZ4 A;  1E5I A;  2DCJ A;  2KXL A;  3J7N A;  4IEV A;  3ZXK A;  3K51 A;  4NRM A;  4YW2 A;  3LKJ A;  4NIA A;  3UNP A;  2RJK A;  1QU0 A;  2CGP A;  2VTF A;  3K4D A;  3D0J A;  2VTX J;  3T0B A;  4NRP A;  1UYY A;  3TNP B;  5L7O B;  2AC1 A;  1PM7 A;  1WLW A;  3OY8 B;  3VBF B;  1E5S A;  1WW7 A;  5T55 A;  3BOP A;  2WFF 2;  1AL2 3;  5FZF A;  4E2Q A;  1KXG A;  1OSG A;  2PYT A;  2WWJ A;  1HRV 1;  2ARB A;  1JZ2 A;  5HI0 A;  1JZ8 A;  2XPJ A;  2J7M A;  3UGG A;  1YC6 1;  2WQ8 A;  4RN5 A;  5FPB A;  1VRH 3;  4JGZ B;  3TBD A;  4WZF A;  3W59 A;  2HWE 2;  4FPG A;  2XLG A;  1FOD 2;  4XMA A;  1CN1 A;  3ZMO A;  4D3W A;  1OD3 A;  1GQH A;  1RUH 2;  1YI9 A;  4JV4 A;  2GAU A;  4XZP A;  2YBK A;  1H8V A;  2ZEY A;  4JVA A;  5FCC A;  4LBQ D;  5BNO A;  1CWP A;  1W6P A;  2ZZJ A;  3NAP B;  4IE7 A;  2WS9 2;  4KWJ A;  4P5Y A;  1SLL A;  1TQ5 A;  5CYY A;  2JD9 A;  1U5Z A;  4XHX A;  4AQ6 A;  2MNG A;  4XCA A;  3KV4 A;  4E4H A;  1YLL A;  4URA A;  5A7W B;  1K45 A;  2DVA A;  5G05 L;  1BK0 A;  2A75 A;  4YW6 A;  2JEN A;  3CHX A;  3V0B B;  2QQW A;  5C3O A;  1W8T A;  3POI A;  2XL7 A;  3AXE A;  4FXK B;  1ENQ A;  1KJR A;  2VTX A;  2W39 A;  3CLP A;  2EF6 A;  4JHZ A;  5FLJ A;  4PHZ A;  1W6N B;  3OD0 A;  1U5I A;  3HT2 A;  4BWO A;  4FPO B;  3M1H A;  1SLB A;  2UY8 A;  3MIE A;  4XFF A;  1WZX A;  3P1I A;  3GCW A;  4FT8 A;  1PM4 A;  5JXG A;  5A33 A;  3CJX A;  2VMH A;  2YYO A;  1EUU A;  3ATG A;  2R0F A;  1M4W A;  2EAK A;  2WSV A;  2WRA A;  1GNZ A;  4UXA A;  3ZLI A;  1CAV A;  1UW8 A;  2ZGP A;  1COV 3;  2RG4 A;  3JQX A;  5A6Z A;  3VZO A;  5J96 B;  3C3V A;  3R4D B;  2BGO A;  1X9P A;  1VBB 3;  5DAQ A;  1CR7 A;  4BH9 A;  2K46 A;  4DXT A;  5IAX A;  4QX2 A;  3C7G A;  5SV8 A;  2NYY A;  4LQR A;  3R6S A;  1PMI A;  5LEK A;  5FLH A;  2FMY A;  4LHS A;  4AFM A;  4G9S B;  4XTM A;  5FYZ A;  4R9C A;  2YV8 A;  4ATE A;  1H8T A;  2R1D A;  2PTM A;  3H1Y A;  3KZ4 C;  2G4I A;  4L2N A;  4AOC A;  4MYE A;  1XE8 A;  2IXH A;  3FUO A;  4BIF A;  1ZZ8 A;  5DG1 A;  1RL3 A;  4KMQ A;  4EZH A;  2WWU A;  1D4M 1;  2QVS B;  1EAH 3;  2KA3 A;  4NO4 A;  1G9A A;  2WO7 A;  1U5Y A;  3O0W A;  3ACI A;  2I07 B;  3H50 A;  2VL4 A;  1O5U A;  2X8K A;  1XNK A;  3ABZ A;  1VLN A;  3IDE A;  4IV1 C;  4OI4 A;  1AUY A;  4IE5 A;  5GZC A;  1LHU A;  4JAA A;  2YC2 A;  1FAY A;  1BBT 2;  1PO1 3;  3KB5 A;  1DYK A;  3H7J A;  1IS3 A;  3BOD A;  2BP6 A;  1Q8V A;  3J9S A;  4Q4W 2;  1OUX A;  4XUO A;  3VBR A;  2GC3 A;  2YZ4 A;  4OVE A;  4Q0Q A;  3HQU A;  3WT3 A;  2PMW B;  1Q5O A;  2ZML A;  1WD3 A;  1OF3 A;  1Q3E A;  4A6O A;  5L7O C;  1RVF 1;  1OA4 A;  2XKO A;  4O9E A;  2VNG A;  2D97 A;  3VBF C;  2PFW A;  2VW2 A;  4AI2 A;  5BY5 A;  3MO4 A;  5FBZ A;  5DUW A;  4QX0 A;  3FUQ A;  5E16 A;  3TN9 1;  1EYB A;  2ZEX A;  1NUK A;  3OGV A;  2GND A;  2J1V A;  3M8L A;  2B5H A;  4CUC A;  4KH9 A;  1NZI A;  2MEV 1;  1MPX A;  3E6C C;  3FBM A;  3O5S A;  2IFR A;  3BPZ A;  3NL1 A;  4P9J A;  4Z8B A;  3ZM8 A;  1XE7 A;  2X29 A;  5FZM A;  2OXB A;  4OHY A;  1K3I A;  1NKG A;  1RUG 1;  5K9Y A;  3RZJ A;  1X9T A;  3GGL A;  2WSU A;  3AKR A;  1HXS 1;  4DB5 A;  5EV7 A;  3VHN A;  1HQL A;  1GSL A;  3C8X A;  3BYW A;  3FN9 A;  5A1A A;  1FV3 A;  3WY6 A; 
#chains in the Genus database with same CATH homology
 2FDG A;  2FD8 A;  3O1V A;  3BTX A;  4IE0 A;  2FDJ A;  4ZHN A;  3O1O A;  4CXY A;  4IDZ A;  4IE7 A;  4NRQ A;  3LFM A;  3RZG A;  4QKF A;  3O1R A;  4QKB A;  5F8P A;  4O7X A;  3O1U A;  4NJ4 A;  3RZH A;  4NPL A;  2FDK A;  3BUC A;  3I49 A;  3RZK A;  3BI3 A;  3KHC A;  4QKN A;  3H8R A;  3O1M A;  4ZS3 A;  4IE4 A;  4NRO A;  4NPM A;  4NII A;  2IUW A;  3KHB A;  3BIE A;  2FDI A;  4CXW A;  3RZL A;  3T4V A;  4QKD A;  3S57 A;  4IE5 A;  3O1P A;  3T3Y A;  3O1S A;  4CXX A;  4QHO A;  4OCT A;  3BKZ A;  3RZM A;  4NIH A;  4MGT A;  4RFR B;  3T4H B;  2FDH A;  4NIG A;  4NRM A;  3H8X A;  3H8O A;  3BU0 A;  3S5A A;  2FDF A;  4NID A;  4NRP A;  4JHT A;  3BTY A;  3RZJ A;  3O1T A;  4MG2 A;  3I3Q A;  3I3M A;  3I2O A;  5DAB A;  4ZS2 A;  3BTZ A;  4O61 A;  4IE6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...