2JDHA

Lectin pa-iil of p.aeruginosa complexed with disaccharide derivative
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
114
structure length
114
Chain Sequence
b'ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNETAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILTNELNFALVGSEDGTDNDYNDAVVVINWPLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FUCOSE-BINDING LECTIN PA-IIL
publication title X-Ray Structures and Thermodynamics of the Interaction of Pa-Iil from Pseudomonas Aeruginosa with Disaccharide Derivatives.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Sugar binding protein
total genus 20
structure length 114
sequence length 114
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07472 PA-IIL Fucose-binding lectin II (PA-IIL)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.400 Mainly Beta Sandwich Jelly Rolls Calcium-mediated lectin 2jdhA00
5A6XA 4CE8A 4UT5A 5A3OA 4AOCA 1OVSA 1UQXA 1UZVA 2JDYA 1OXCA 2BOJA 1OURA 1OUSA 2JDMA 2BOIA 3ZDVA 1W8FA 2XR4A 2VNVA 2JDKA 2JDHA 5A6ZA 3DCQA 2CHHA 2JDNA 1GZTA 5HCHA 5A6QA 2BP6A 1OVPA 2VUDA 2WRAA 2BV4A 2WR9A 1OUXA 1W8HA 2JDUA 5A70A 2VUCA 5D2AA 5A6YA 2JDPA
chains in the Genus database with same CATH superfamily
4NOTA 2F6BA 2OKXA 1V70A 4J1XA 1ULCA 1UU4A 4NIDA 1DP0A 1OURA 1S2EA 1Y3TA 2BOIA 4K6BA 1PGW1 2WT1A 2B45X 4RHV2 3OSDA 4EZ4A 1W6NA 4META 3PTYA 5FYTA 4AEDC 3I2OA 4WM8C 4JGYB 1D0GA 5EYXA 5JIUA 5FZCA 2B4KA 5BNPC 3OY8A 1R1A2 5IK8A 3O12A 1AL21 3VKOA 2JJ6A 2MEV3 3WDWA 3J26N 3T0DA 2VTXA 3ES1A 1VAVA 2J1TA 3NKTA 4P9IA 4Q4X2 4JRLA 3JBG1 4IUGA 1JS9A 4L8QA 1X7NA 2UY8A 5FZOA 4FOVA 3AZVA 2P6CA 1UCXA 4OCTA 1LRHA 1UU5A 2BRTA 5ACA2 4YGBA 1F8VA 4K20A 5KHKA 1GP6A 1WBLA 4CYDA 1C8M3 4BQXA 1QJU2 4QMAA 4PBOA 3QLQA 5E89A 4C90A 1QJY1 2WFF1 1CX4A 4B7KA 4CEWC 4QXKA 5JSOA 2QNKA 4EWAA 1URXA 1XRUA 3MFCA 2AGSA 5FO9B 3WG1A 3R4SA 3AX4A 2Q1ZB 2VMCA 1AXZA 1HB4A 1QF3A 3O5SA 4UBGA 3UK9A 1RUC2 2I74A 3I7DA 1CZVA 1AR61 2GALA 3ZKYA 4AEDA 1V6JA 4WM8A 1CAXB 3RZKA 5FWJA 3AP6A 5BNPA 1JOPA 2AEYA 4P02B 5EHDA 5F5QA 3VZNA 4LE3A 4FBFA 5JMCA 2YC0A 4DB5A 1RINA 3W58A 2K2SA 1SLIA 1XNDA 4HONA 1DZQA 5C8CB 4AEJA 1BMV2 1RJ7A 2ZA9A 3ACFA 4QAWA 4AEMA 3BOPA 2OS2A 4CCNA 5H9PA 2JDKA 4PQQA 1YJKA 3RZJA 1VBB3 1XYPA 2PFWA 2C5DA 3LA7A 1A6CA 2EA7A 1POV0 1CZTA 2W39A 3WQ0A 4UW5A 1HN0A 3POIA 2JG8C 2W94A 5I91A 1K45A 4CEWA 1WMXA 3RRDA 2AACA 1ZRFA 1CAVA 3RWNA 4A7ZA 1YLLA 2DF7A 2P1BA 1NLQA 1ZZ9A 1NG0A 5DUWA 1FATA 2VTFA 4P9JA 2BQPA 4XABA 1MEC1 1BHGA 2RS11 3WF2A 5LK7B 2BNMA 2PQSA 3LZZA 1EY2A 3ENRA 4PF5A 2CHHA 4XVHA 4UYBA 3TAYA 2CGNA 5A6QA 4AL9A 1W2OA 5ISLA 2P17A 1FI2A 1DHKB 4QKNA 4X8NA 3BKZA 2VPVA 3BI3A 1JZ7A 2A3YA 1JOBA 4JQTA 2Q8DA 3MZHA 1ODMA 3WY6A 4D69A 1SFPA 3INAA 1GU3A 2XMLA 3K4ZA 2MNGA 2XG3A 1W6OA 2QKDA 4AW7A 1J58A 1AYN2 3KB5A 5K4LA 1OI6A 2JG8A 3M1HA 2WNEA 2PYTA 1DQ1A 4DUXA 1YWKA 5FY1A 2WLQA 1BK0A 4UFIA 2R32A 4YW2A 1O3RA 3PL0A 4OI2A 1YQ2A 1DGRA 2B42B 4HT1T 4U36A 1BCXA 3WNKA 4FQ4A 2Y6HA 4LBKA 2GMPA 2J1RA 2QQNA 2W3JA 4DUVA 2YHJA 5CIRA 3VD4A 5LA2A 4FPHA 1IGOA 2HYXA 4M3CA 4AI1A 2PHDA 2ZEYA 1Q8PA 1W8HA 2ZX2A 3UNPA 2VCBA 3S7EA 2YBKA 1RUH1 3W9AA 5FMBA 3POGA 2WSUA 1ST8A 3FBMA 3LWCA 4NWWA 3N9PA 4QGMA 1L7RA 2QQLA 3KVBA 5FMOS 2XBO3 4FOYA 4QM8A 3JCIA 4A45A 3OG2A 1ENXA 2EXHA 4PIZA 3MICA 4LR4A 4MLOA 3WG3A 5FY4A 4AAXA 4DIQA 2O0OA 2ZGOA 1I5PA 3J8F1 4QKDA 4YZ4A 5IAVA 1UZZA 3IAQA 1DQ5A 4B4QA 5FYBA 4JQRA 3N7MA 1SQ4A 1OVPA 3LA2A 1RUD2 1JZ5A 2C4XA 1W0NA 2Y0IA 2Z5WA 1I1EA 5A7SA 2Y6KA 1SPPA 4RS5B 3CZJA 2P2KA 5BXXA 1RUG2 4Y3OA 3WNPA 5C3SA 2WT2A 5JXGA 2AENA 4W8JA 3H3UA 3MIBA 3O1OA 4URAA 4J1WA 4LBJA 2WBKA 4YFZA 3KGLA 3GM8A 4RGAA 4EWDA 1NZCA 3I8TA 4Q29A 2A3WA 4P9XA 3NRUA 1JYVA 4FPEA 5ABJB 4TLGA 4XCAA 5FXZA 4W6XA 1H2KA 1ULGA 3Q8CA 3KMHA 2R7EB 3TOJA 3TRSB 1OQEA 4K40A 4LHNA 3WNNA 4GZ9A 4E9KA 4XHBA 1YFUA 3U4SA 4RHV1 1WA6X 4M4PA 3V64A 3RJRA 3WINE 3WQ7A 2YROA 3GZUC 3AB0A 1R082 3LQCA 1IQDC 2HLEA 5L73A 1Z7S1 1UXXX 1R1A1 2IZWA 1UXZA 2HWD2 5EP9A 4QPIB 3WF0A 4FFIA 5LA1A 3PUSA 4BB3A 3Q8BA 3C7GA 1V6LA 1AR93 1EAH2 2DCYA 1O3QA 1GANA 2ZKLA 3AYEA 1HIXA 1KJLA 1R093 3VBSC 1B35B 4OMDA 1UPSA 1OA3A 2ZBJA 2YFZA 4FI9A 1JYXA 2RM23 4MVTA 1UU6A 1GOHA 5GLWA 3CJIC 2DYCA 1YCIA 5F39A 1RL3A 1GMMA 5EPAA 3MI8A 2QUOA 4WVZA 1T6GC 4Q4W2 4PT6A 3I2GA 3MIFA 4S2HA 4TN7A 4N43B 4DQAA 3VUOA 1HB3A 2VVFA 4GKYA 2D3SA 2RMU2 4L2NA 3KGZA 1V9U2 2R1DA 3VZJA 5DABA 1AL23 1AR72 4LBQD 1YQ6A 1MS3A 4G3YC 3ZN6A 5FPLA 2GU9A 2Z2SB 5KHIA 1RUC1 1OF4A 3JXSA 2Z79A 4MZUA 3WQ1A 2R061 2WS92 2CAVA 1OT5A 2ORZA 1QNYA 2RDNA 2VMHA 3AZZA 2X8KA 4UFMA 5T5JA 3WF1A 2FDGA 3I3MA 4PI2A 2VH9A 1DFQA 2Z69A 5FZKA 3KV9A 3A0NA 3PTRB 3VBRB 1GZ9A 3GBGA 4ZU5A 3QH7A 3TN91 2VUDA 2KA3A 3IM0A 4UXAA 4E8CA 4XF3A 1JYCA 1CAWA 2WN2A 2VBPA 5BNOC 2XHNA 4NRMA 1GFF2 4QGLA 1GNHA 5DDJ1 4ES8A 2OX0A 3VBUB 3VBSA 1GR3A 1QJY3 2WFF3 3SISA 1LECA 1NXMA 2G9ZA 5DAPA 4BA6A 4IV3C 1UMZA 3CJIA 1OH3A 3LCPA 3R05A 4XOGA 3FLRA 1UQXA 1UZVA 4CCDA 5L7OB 1AJOA 2EF6A 3ZPOA 1FAYA 2F4LA 2R16A 4UF0A 1AR63 1D4M2 1PK6C 1ZZ8A 2DURA 2AH2A 2VNVA 3PUIA 2JDAA 5CNAA 3ZYJB 3WP4A 3AFKA 5HXMA 4XJUA 4XTMA 4EN0A 1ZBA2 2VC9A 5LK5A 1QXJA 3G7DA 4LULA 3ZPYA 4ATEA 2SBAA 5IYYA 2WL1A 5KXDA 1LOEA 1PIV2 1X36A 2CU5A 1FNYA 2RV9A 1V6NA 2RS52 4Q2FA 4NN0A 3QD6A 1UZYA 2W91A 4BIOA 4QXBA 4CDUB 4FFHA 2BYVE 5HPOA 1JHJA 4ISRA 4PHZA 2VZ3A 5BNOA 4KU7A 1BEV3 4B3NA 3FC0A 1BLZA 1WD3A 1H1IA 3KM5A 5FV3A 4GJZA 4IV3A 2F17A 4CCCA 1NKGA 2FQPA 2ZX1A 4G9SB 5ANQA 3ZR5A 3V0BB 4AZZA 3IKWA 3CL1A 4GB31 1AYN1 4EQVA 1PMIA 1PK6A 5IWFA 4V1PA 5LA0A 3HT1A 2C1FA 2FCUA 1GQPA 2OPWA 4E2GA 3ZXEA 2HKXA 2J1SA 4NE9A 3ZR6A 2VUCA 4AFAA 3OGGA 4HMZA 1A78A 2ZKNA 4TTGA 1V0AA 5CFDC 2W52A 1VR3A 1PVC3 1TMF3 1WMEA 1QDCA 5FBJA 1W9FA 4H3WA 3SNMA 4AHZA 2R043 4HN0A 1AYM2 2IXJA 3ZDVA 5C33A 4A44A 4LE4A 2D44A 2RVAA 3V65A 3WDYA 3ZFEB 1FPN1 2E31A 2P34A 4IEZA 5LRSA 2WO3A 2XJRA 5HXVA 4GWNA 5LEJA 4IV1B 3TEYA 2J42A 1SLBA 1DLLA 3D0SA 1CONA 1UIKA 3I3BA 1SFNA 4S2GA 2W08A 1LOAA 3VBOB 3VD3A 2D6PA 1CGPA 5FUPA 4CUAA 3OGVA 1EUTA 3USUA 4RA0A 2ERFA 4BWOA 2SLIA 2WZR1 3F2ZA 1AX1A 4AXOA 1J84A 2VD7A 3CBNA 3DYMA 4HVQA 2OQ7A 5FZLA 4LJHA 4RQPC 4OHZA 2VVDA 4NROA 1POV1 2DVDA 4TSVA 1RHI2 2WO2A 3PURA 5CFDA 4AVVA 5DPNA 3AVSA 2IXHA 3WP6A 1RMU2 1VBD1 1JN2P 2N7GA 1WW5A 1O6UA 4OFGA 3T09A 5HBAA 4YRDA 5IFTA 2FCVA 4OQ8A 4BQ2A 1YO8A 3IDEA 1N3OA 4A3XA 1C1FA 5FQ0B 1WGPA 1Y43B 2ZOEB 3AKPA 5CA6A 3C8XA 1BJQA 2VZUA 1I9RA 3GHMA 1S0JA 2OIIA 2P37A 3J8F3 4Z8BA 3MGUA 5FZIA 5FP9A 3G6JB 4RGKA 4PIXA 2A75A 4UI9L 1WCDJ 2YDEA 1CJPA 3CO2A 1WCUA 4L97A 4Y5TA 3UGFA 5I0RA 3T2QA 4AF9A 2YG0A 5JAXA 4DOUA 4M0NA 1FMD3 2BBAA 1ZBE1 4CDQB 1YFYA 1SLAA 4LIVA 1PGL2 3RI9A 2BERA 3RZMA 5A7WB 1PGL1 3PU3A 2VULA 1EUUA 1K3IA 3AP5A 3HOBA 1H4HA 2R6QA 2WR9A 1EPWA 1OD3A 2HWE2 4RQPA 4RSUA 3GZEA 4GH4B 5DG2A 4MGZE 4JDNA 2C9KA 2E63A 1EV11 4NJ4A 4CCJA 4D7YA 2QJVA 4CCMA 2QE3A 4CDXC 2VQTA 1W6QA 4S2DA 2PAKA 4CZSA 2GMEA 3VL9A 5FYSA 1JZ2A 3MUZ1 2OQ6A 3SXWA 4Z92B 1QJX1 2DWRA 2OUJA 5F3GA 4RHV3 4AGVA 2E51A 2E26A 4COWA 4GIQA 4UFKA 4A4AA 4CU8A 1VMHA 5G04L 5DAWA 2OT7A 4CEYB 2RMU1 1R1A3 2ET1A 1OOPB 1AR71 2WNUC 3LPGA 2VOVA 4I0BA 4F8AA 4ZKTB 4Q4X3 3B94A 5C6CA 5IHRA 3NNMA 4LO7A 5FAXA 4OQ9A 3K46A 3Q9OA 2B7YA 2IXLA 2WA4A 1REDA 5F5CA 5T5LA 5HV0A 3HD8B 3WR0A 1PGW2 5FP4A 1YQ5A 3SKJE 1K5MB 5DUUA 4QGNA 2XVGA 3T1MA 1GWMA 3T2OA 4FPFA 3BGAA 4SBVA 5ACA3 2NZ9A 2RDQA 2WZ8A 2D5FA 3FL7A 4WVMA 5LB6A 5HV4A 1T6BX 1AL22 1QJU3 2W68A 2IC1A 1WLWA 1SFYA 4CDXA 4DMIA 3JBG2 1WW6A 4IEXA 1TNFA 4YZ2A 1KDMA 3PHMA 3ABZA 4YVWB 4COZA 5KXEA 2EIBA 3GXUA 2WAOA 1GKBA 4PCRA 2DCJA 1GZTA 3MUY1 1VBC1 4INDA 5FTTC 3ZDSA 4BQWA 5BV6A 1SBEA 3BIEA 2WNOA 1RUC3 1Y9QA 2QDRA 3Q8EA 1D4M1 3UKVA 3POYA 3RG0A 1CVNA 1OMIA 4P08A 1RUNA 1RUF2 1SLLA 3LFMA 1RXGA 2XWJB 4UW3A 4LO5B 1PVXA 1D2SA 4N53B 4YWAA 2WNUA 1MPXA 1REEA 3DGTA 3DEMA 1O4TA 2DTWA 2WFF2 3FHAA 3M70A 4MOAA 5D1IA 4LBMA 3ZSLA 1S0DA 3MLJA 4W6WA 5FJKA 2Y34A 2LS6A 4AHYA 4BQYA 4XW3A 2EAKA 4BQ5A 1HQNA 2GNBA 2ES3A 4XQWA 3B93A 2JEMA 4OUMA 1FNZA 4IETA 3U75A 5A3TA 3TWIA 4WZFA 2J1UA 2FDFA 2WINB 5CEHA 1GWKA 2QQPA 2WABA 1Z78A 4HKWA 1JTZX 2BJSA 2XJPA 3WCSA 5CISA 5EIYB 3O1VA 1XBFA 3NV4A 4RFT0 3VHRA 3ZVXA 2VOTA 3UT0A 4ZZ8A 5JI9A 5C8CC 2Y0OA 1MS5A 3LFIA 3BOWA 1HN1A 5J1XA 3U78A 1TME2 5IVYA 5JPMB 2VZTA 1BVVA 2XOMA 3N9QA 3D6EA 4JCKA 3WT3A 3U11A 5H9SA 4WV8A 5KBFA 1W0PA 1O7FA 2ZGKA 3PNAA 3TNPB 3W5NA 4WVWA 4JKMA 2ZMNA 2WKKA 3AJZA 4JTOA 4Y1UA 2HJIA 1Y7BA 4Y22A 3VKMA 3DYOA 5CBLA 2PN5A 2X5IB 4L0PA 2KXLA 4DEVA 4QB6A 5I8TA 3JUUA 1HRV1 4JTNA 2VZQA 1MEC2 3GYDA 4LHSA 2RS12 5A3WA 3WP3A 2DVAA 4I0WB 2GN7A 4BK5A 5T50A 1IS6A 1CPNA 4MXWB 1CAXA 4CP9B 1C5IA 4H7LA 1AYN3 1BXHA 4O9GA 5T3NA 3POSA 5J96B 2BNOA 2PAEA 2VOWA 4TZDA 4QM9A 1SACA 1C28A 2Q1MA 1LJ7A 4YM3A 1HV0A 5HCFA 3KS7A 3VKNA 5C8CA 4XFFA 1FOD1 4D7TA 1UZ0A 3IIIA 3VZOA 1GP4A 4Y1YA 1S0CA 4JVAA 2W1QA 3L9JT 1IS3A 3HNYM 5FP3A 5CB7A 3S5AA 2Y8KA 3O1MA 5GLZA 2BUKA 1VALA 1AX0A 1MQTC 2G19A 3GHNA 2ORXA 5A1LA 2Y6LA 5A3MA 1CIYA 4LORA 4M00A 4LMFA 2VU9A 1UPIA 2Y6FA 2ZS6B 1RMU1 1WW7A 1PX3A 2ZGLA 4LK7A 3I97A 2ZXQA 3AMHA 1WCQA 2VW1A 3QOPA 3B5LB 2UYAA 3TB0A 3GJBA 3ZN4A 4XUOA 4I30A 1XNKA 4Q4Y1 1YFWA 1F15A 1UY2A 1AXKA 1J3PA 1WLDA 2JX9A 1K42A 1VIWB 4N90A 1RUH2 3HQUA 1W06A 4YARA 1RUD3 2VXJA 3LEKA 4R4XA 3HVDA 4YVSC 1YQ8A 1LEDA 2R071 1RUG3 1LR5A 1HDKA 4NIGA 1RYYA 2VMIA 1H30A 1JYIA 2Z4FA 5FPUA 3U37A 5CAZA 1QDOA 3OBAA 4XJ9A 3VDDB 3WX5A 3BTZA 1O5UA 1US3A 3KV4A 5DAVA 1MQTA 4AOCA 1O8SA 3UETA 4AG4A 4MADA 3EYPA 3IMMA 1NCRB 4NR1A 5GLUA 4CU9A 5LWBA 3ILRA 4HL0A 5C9AB 2NPIA 4QDQA 2C26A 3I59B 3P5BA 2KR2A 1UF2C 1MZ6A 3KT1A 3B02A 2GZWA 3PDQA 2DUQA 4GWMA 4XZPA 5FY9A 3VN4A 3EJKA 2ZX3A 2BFUS 2YUEA 1SBDA 2ZX0A 4JGZB 4RS5C 3ZLIA 2HWB1 1S55A 2WLPA 5JPNB 5BNNB 2EIEA 4KWJA 4C1XA 4E4ZA 3H7JA 4E2SA 1R083 5BNQA 5I0SA 2BZDA 3RZHA 2RR11 2V4VA 2HWD3 2RJKA 1QU0A 4HXCA 2A71A 1Q56A 4NAOA 3LGRA 1S4CA 1WCSA 4OVEA 4YVSA 4NO4A 1TG7A 1J59A 3ATGA 2ZACA 4I2OA 4RFRB 1JZ4A 4N9HA 3H42B 1EAH3 3LOIA 4JDMA 4Y24A 3OYWB 1JOJA 3AKQA 1VBA1 3HNMA 1ZRRA 1VJ2A 5C71A 2DVBA 4MH0E 3BU7A 1GICA 4H7MA 4B1LA 4D6RA 1Z7S2 3N9NA 1ND2B 1XB9A 1T2XA 2ATFA 4Q4W3 4TLFA 3BYWA 1V6OA 5E6HA 3GZTB 4DO0A 5FCCA 5FBZA 2QQVA 2H0BA 1VAMA 2CYFA 2RMU3 1V9U3 3DUIA 5A3NA 4RS5A 1XU2A 1AR73 2XKPA 5FZAA 4YGEA 3KCYA 2WS93 5FKBA 3EBRA 2DFBA 1MS0A 1W2NA 3JD71 4E4HA 1W8FA 5DAXA 1RUF1 5EJ1B 4Z2AA 3U4XA 4OLLA 3H8XA 1GP5A 1HRI1 3DKQA 4OUEA 5FZ6A 1DQ6A 1ND3B 4YG0A 4CCLA 2JECA 2A6XA 1NCQC 2YFUA 4Q1RA 3N9OA 2XLGA 4N43C 4QX2A 1LHWA 2EVXA 4HVOA 4CXWA 1QEXA 4WBBA 1J1LA 1UIJA 2DTYA 2R062 4JKLA 3ZFGB 1GQGA 3UV9A 2XVKA 4D94A 1H9WA 5F2WA 5IVFA 1KS5A 2XPJA 4WZCA 5FY0A 3VKFC 2UWAA 4N9IA 1LODA 2EXJA 2MHFA 3NKGA 4I3GA 3UJQA 1VRBA 1D4M3 2WQ4A 4NVPA 5FJHA 3TN92 2XR4A 5LASA 3H8OA 5JXJA 5I0DA 4IE0A 4NMIA 3I2IA 5DDJ2 5A6ZA 1ZBA3 2W5FA 1LHVA 4ZPIA 1O4ZA 3O1SA 5AFBA 5GM0A 5B4XA 1G8WA 2V09A 5LZ6A 1TME1 3V56A 5IVBA 1PIV3 4LUKA 1PO21 1WLCA 4IEOA 5J98B 3DL3A 2RS53 3C7HA 4DRVA 5J36A 2XUEA 5T5OA 1K5JA 3H1WA 5IVVA 4GMP0 2JG9B 3DN7A 5D2AA 4AI9A 5JXHA 3OPZA 1ULDA 5EQUA 2WO1A 1NCQA 1JXNA 1VB4A 2VE1A 3DXUA 3ETPA 3IDAA 3L2HA 3OJBA 4N43A 3I4IA 2H0VA 1WA4A 3OCPA 1AF9A 2XJTA 1X9PA 4Y4RA 1RUE2 5F6LB 2PHXA 3I3QA 1MR5A 2GC3A 4A41A 3JU9A 1CX1A 2WJSA 2E9QA 3ROUA 3T2TA 3LSDA 2V5YA 2YXSA 3ZXJA 2Y26A 3AYCA 2FCTA 3HBKA 4HVRA 1RITA 1JYTA 1ZRDA 3BB6A 3RMXA 2P5BA 1YJLA 2GNTA 3ZMNA 3NO8A 3ECQA 2ZZQA 4LOTA 4CDUC 2L9LA 3K3OA 4HOOA 4Q0QA 4E8DA 5T54A 4FCAA 2TUNA 4AK3A 2EIDA 2ZPXA 3OGSA 2XQXA 5F3EA 3CLPA 1O91A 4P14A 3WW1A 1NA1B 3D0JA 2VECA 4LITA 2ZAAA 1AYM3 1PM7A 3WW3A 1UWWA 2CWMA 2VZSA 4GB32 4W50A 4Y20B 4ASLA 1LENA 1NY71 1W03A 3PVEA 1XE0A 4LKDA 5F5IA 5CADA 2VCMA 1LHNA 2XL7A 4QB2A 1V6KA 1DCSA 2AYHA 2CTVA 1UO9A 3RQ0A 4Y26A 1H6YA 3THTA 5F7UA 4K1YA 1AHSA 5JLVA 1G9CA 1GV9A 5JDBA 3RZLA 5D21A 4KU8A 1Y4WA 2NMNA 3IB3A 4K8FA 4M0HA 1ACCA 2J1VA 3WF4A 3WUCA 3FFQA 4XAEA 1S2KA 4OI1A 3C7FA 2VCAA 4YW5A 5CKNA 1FV2A 3KHCA 1FPN2 4B4PA 5C4WB 2YC4A 3ELNA 5A32A 5JSPA 4XIOA 3K51A 1AZDA 1VP6A 4HLTA 1LKNA 2BNNA 4CXXA 2PQQA 4LLFA 2ZHKA 4XQDA 2G9GA 1RHI3 1S0IA 2Q30A 3U14A 5LY1A 3IIAA 1RMU3 2RDSA 1PNGA 1MVQA 3HEIA 1FXZA 4LOSA 1SEFA 1XSRA 4YM2A 5CFCC 3B3QE 3VBOC 1S0EA 2HWC2 2ZABA 3V0AB 4PLOA 2WZR2 5AVAA 4DXTA 3J4UH 5FZDA 3ZMOA 1DQ2A 2V4AA 4NHXA 4TYSA 1Q8VA 3OEAA 3K4DA 2QQOA 4Q0PA 1LB2A 2HYKA 4NRQA 1W6NB 4HN1A 4TXWA 3B69A 3RFRA 1W05A 1KXGA 1L7QA 1VBD2 4H55A 3FJSA 4NIIA 3OY8B 1CPMA 4IEWA 4A3ZA 1EYBA 1QY4A 1QH6A 1JBCA 1NZIA 4KI5M 2HWF2 4IEQA 4QHBA 3ST7A 3ZFFC 5FREA 2ZGPA 1QQP1 3DPRC 1COV1 4OI4A 2D6KA 2Y38A 3PVOA 4QX3A 1SBFA 2XXZA 4HFSA 2HWE3 5FZOB 1ZRIA 3LB9A 1OUXA 1RXFA 2FDKA 3PMSA 4OUSA 5JVVA 5A7NA 4EZHA 4C8DA 1WW4A 2V5DA 2VUAA 3CKHA 1ZBE2 3B7MA 4AGGA 3E97A 5CFCA 5JUVA 5FR3A 2ETEA 3VBOA 4R9AA 4RGGA 4CCEA 5IK4A 1E5SA 1UY4A 2DDUA 1UMHA 2VR4A 4L11A 4XBQA 4B4RA 1H6XA 3POWA 4IEUA 4OHWA 4DXZA 5JOXA 3BTXA 1SDWA 3E5UA 4WM7C 1QJFA 4CSWA 5GLVA 4LBNA 1PO12 1JHNA 2H6CA 4CP1A 1MS4A 1POQA 2RR13 4MO3M 1D2QA 1EV12 5CZKA 3ZXAC 4GD4A 4AEDB 1D7PM 4WM8B 3VLBB 1IG3A 4LQRA 5FZBA 5BNPB 1QXRA 2A6YA 4Q0UA 1KGYA 3ON7A 4IGPA 3OF1A 1QJX2 3ZYHA 5A70A 2PHFA 2VZOA 1W6MA 1R64A 5ERLA 3I2DA 1WUVA 4C0BA 3ZFFA 3DPRA 5FQ0A 1YFXA 5KHGA 3IDBB 3A21A 1MZ5A 2ZHLA 2YU2A 4YFWA 5FLJA 4AI2A 1DYPA 2ZGRA 3KWVA 3KT7A 1S2BA 1OUSA 1ZNPA 2D7FA 4XPVA 4COYA 1DYOA 3U0ZA 2B46X 3MF9A 1OOPC 3JBG3 5HI0A 3W21A 1JYWA 3FLPA 3AL5A 4E4SA 5L9RA 3SITA 3IAPA 5FMDA 5E88A 4ZS3A 2QZ3A 3GCWA 5HCHA 2ARXA 5DZFA 4ARYA 5JSRA 4WM7A 5I0TA 1CAVB 4ASKA 5C70A 4X6RB 2W1WA 3BIWE 3POFA 5A7WA 1RUF3 1K5MC 2FZ2A 2ENRA 2BPA2 1JZ6A 1W28A 4ES9A 3DV8A 2Q5TA 3VD9A 3AMQA 4M4RA 4RR3C 4QKBA 4YNIA 3WP5A 3FX3A 1ZZ7A 1WD4A 4AHWA 5CVRA 2WIIB 3WZ1A 2VMEA 1CAUA 1VBC2 3MPBA 1O4YA 2CV6A 1J1TA 3GF6A 3MIDA 4YVWC 3ZYGA 4CRQA 3UGGA 5K0UB 2EXKA 4KBZA 5BYNA 2HBUA 1YUDA 4FPCA 5APAA 1OSGA 2NYYA 2JB8A 4MX3A 4MG2A 4NHKA 1W9WA 4GQ7A 1FV3A 2I2SA 1HXS2 1QHDA 1OOPA 4N53C 1RUE1 5I8SA 3CJXA 4D8MA 1W6OB 4P5YA 2YYOA 1ASJ2 1E57A 4EJRA 2J7MA 3I2KA 3HWJA 3M2MA 2C6SA 3GBFA 3O1TA 1PMJX 4GAZA 2XWBB 1Q5OA 3I3DA 4FXKB 5FZEA 4CPBD 1TME3 1OPMA 2GSYA 4Y5Z0 4XDQA 2AEZA 3AXDA 1XE8A 5L9BA 4UWDA 3WV6A 1DGLA 4DINB 5I8YA 1JU4A 1QOSA 2DUPA 4JDOA 4DNYA 1W9YA 3AP9A 4RR3A 4DZGA 5KC5A 2W87A 4JX0A 3KF3A 4LK6A 2RDRA 5IK7A 2BTVC 4YVWA 2RS31 3FLTA 4QQPA 1JYNA 2NP0A 5GZDA 5FP8A 3LDKA 1TNRA 1MEC3 2RS13 5FXVA 2ZTNA 1RVF1 3WVJA 1W3VA 2VQUA 3NJYA 4KG8A 3THCA 3O1UA 1H4GA 3B9IA 2EAAA 4K1ZA 3WNXA 4N53A 3R6SA 2DBIA 3FE5A 1UYPA 1BKZA 2WNVC 1GSLA 1ONAA 1XYOA 2YBSA 1VE0A 4NPLA 5F3CA 4BLIA 4XUTA 2XJVA 2JWPA 1SLCA 3POEA 4ZHNA 1HRV2 3E1F1 4L9BA 1SPPB 5T52A 2ZGQA 3GCXA 2XHKA 3R0RA 3N35A 3MO4A 2ZGTA 3RGBA 3S30A 3O0VA 1LGCA 2BGOA 2Z42A 4M3CE 4NHYA 4CPBA 4IEVA 3VGIA 3WXPA 2CY6A 2UYBA 4QHZA 2ZHMA 2XL9A 4DXSA 1KS4A 3KSCA 1UYZA 2VBBA 1FOD2 3JQWA 3IDCB 1G7YA 4GXLA 2HWC1 3HMYA 1HKDA 4GA9A 2BOJA 4QXHA 3RVHA 3MFAA 4X8PA 4XYXA 2QQWA 4XDPA 3QBQA 1PNFA 1W6PA 2OXBA 2DU0A 3RMYA 4BZ4A 2ARAA 3LEMA 3AKTA 5JI7A 5JZGB 3UYJA 5GZEA 1RUH3 5C7GA 4NRPA 5FYUA 1G9FA 4YM0A 2ILMA 2YZ4A 4A7YA 4MHRA 1RUI1 1XYNA 4GMP1 1AJKA 2WNVA 4Q1PA 1NLSA 1DDLA 2KM2A 2EXIA 1TZOA 3KT4A 2BEOA 2ZGMA 3T30A 4M01A 4BQ4A 1YRZA 3VZKA 1L3JA 2HWF1 3H1YA 1VMFA 4Q4Y2 4XF9A 4YGCA 3IPVB 5FUNA 3MPPG 4E2QA 2Y64A 2GH2A 2PHWA 4YG6A 1ENQA 4LT5A 1GZWB 4MXWA 4CXYA 3K75B 2GP5A 3OBTA 3BUCA 4CP9A 2R072 3FHQA 2CL2A 3NSTA 1WMDA 2JD4A 5A1FA 2ADDA 1DLCA 1LHOA 2R1BA 4JC1A 2PELA 4LO4B 3NNGA 4O9EA 5FIXA 1AUYA 3TBDA 4LA2A 4XHXA 3MW2A 1W2TA 3KVAA 1P8JA 1PO11 3VDDC 4CP0A 3ZN6B 4OZXA 4D3WA 4ZXEA 4A6OA 4DRRA 4PJYA 1IZ3A 1WCKA 2VOXA 4YZ3A 1OLMA 1M06G 1I6XA 5F5AA 1TEIA 3IMNA 4NIAA 5FZ3A 2HWB2 4XFBA 3HNBM 4XFAA 2GC0A 4Q4V1 3I3EA 4JGZC 4U2AA 3LDBA 3MDPA 3MBWA 1CD3G 2PXJA 1Z7S3 4C91A 3P6BA 5KC6A 5EYYA 2RR12 2VAUA 3ZN5A 1H1MA 1H8TB 4XMAA 1TQ5A 1W8WA 3PVBB 2B5HA 5D8AB 1ZRCA 4IW3A 5EFUA 4AFCA 1QH7A 2A5ZA 1VBA2 4LXLA 1CZSA 1PHMA 4PDWB 2MEV1 4UFHA 3WW2A 2ARBA 4S2FA 4ZONA 5A3PA 1B09A 3RS6A 3T0AA 4LA3A 1RTVA 1VBE2 4QU1A 3DKWA 5H9QA 3VDDA 3S57A 2PLV2 2YPDA 4JGYC 3RSJA 1NLRA 1ND2C 2HH9A 2QCSB 4FPGA 4LBQB 1RIRA 3RPQA 1LESA 2JIGA 1KFUL 5FO7B 3OPWA 4FPJA 2PAMA 4QHOA 5FPXA 5FYMA 2LW8A 4AFBA 3I59A 2BP6A 3NNLA 1C8M1 4AAPA 1DQ4A 4LO8A 2R063 4MGTA 5SV5A 1OLQA 2DU1A 3JD72 4AQ6A 1OA2A 5BNOB 1DBNA 4UW6A 4QXCA 5DQ0A 1REFA 4KWKA 4URTA 1YIPA 3RYRA 1HRI2 1OVSA 2CNAA 1HXS1 4LLOA 4IV3B 3C7OA 4YG3A 3TN93 2BW8A 3CZUA 4ET7A 1A34A 4CP2A 1ASJ1 3WDVA 1X82A 1GNZA 3L2YA 3D3AA 5DDJ3 1ND3C 2FHRA 1PK6B 4WVVA 4DFSA 2FZ1A 2ZAHA 3UJOA 4DXRA 4E27A 1ZZCA 4LHKA 3C3VA 4XURA 3VHOA 1W8UA 4YPJA 3JZVA 5F6KA 4JGYA 4XF0A 5F37A 4AFMA 1OKQA 2B39A 1ND2A 2WWSA 2A70A 3PVNA 1XNTA 2AZ5A 2QTWB 4AQ2A 3MLLA 1VBB1 4QX1A 5FZ7A 4ZZ5A 5FOJB 5CG9A 2ET7A 4AQTA 2RJLA 3KZ4C 3S5QA 2VCCA 4LNVA 3T08A 5JCTA 1W8NA 4FT8A 4PF1A 3ZYIB 4AYUA 5JWPA 1RUE3 3C2UA 3VBHB 1HX6A 5FZMA 2I45A 2QVSB 1HB2A 2DCZA 4XC9A 4F3JA 1PO22 1PZ9A 2QDNA 2WA3A 5FY5A 4BE3A 3W5MA 2D6MA 2RE9A 4XUPA 2GC2A 1F31A 1XNAA 2E7TA 3J9SA 5LA9A 2WN3A 1ND3A 3ITQA 4FFFA 3ZYRA 3ACGA 4CU7A 1LGNA 1DIWA 1JMUB 4O61A 1E5HA 5LY2A 5FPVA 3O0WA 5LW9A 4J25A 5FMOL 1MZFA 3AFGA 5JOWA 3TEZA 2CAUA 3N7LA 5CKMA 2DVGA 3I2JA 2VW2A 4GB33 2Q8CA 3OB8A 3ILFA 4XUQA 1F35A 2LALA 4IE4A 1J3RA 1JW6A 5FZ1A 5LBEA 1GNYA 1ULFA 3GALA 4QPYA 2YU1A 3H0OA 2Q1FA 3FMGA 5FPAA 4KH9A 3USSA 1RC6A 3CHXA 4NPMA 1H2NA 4AGRA 3KQ4B 2BGPA 4XJWA 5J7MA 3ZOIA 1VB2A 3PIGA 2A73B 4BJ0A 2DCKA 4IGQA 3WOGA 3NNJA 5ANNA 2PTMA 1NY72 3THPA 1NA1C 5JOZA 3LD8A 2R0HA 4FOWA 5DAQA 1FPN3 4GJYA 5F2SA 2OYZA 4AR2A 5IK5A 2CDPA 4JAAA 5DZGA 2BBVA 1F4HA 4FP2A 3T0BA 1OFSA 5DN2A 1F9KA 2X10A 3DF0A 2D43A 3J7LA 4OHXA 3OUIA 2ZJCA 1LOFC 4FVVA 5FYCA 1N1SA 3AKRA 2JE9A 3CDZB 3MHZA 4I0AA 3DCQA 1WBFA 5DUVA 4RQPB 1U12A 4EN7B 3ZYFA 4FAHA 5FZHA 1NT0A 3A22A 2HWC3 2QQKA 2WDBA 2XBO1 3NAPB 2WZR3 3N36A 2WWJA 4XXAA 1W6QB 2HEYF 2BWAA 3EQEA 4P9WA 4B7EA 2OVUA 2WFPA 1N1VA 1OPOA 1MZEA 1U5XA 2K9ZA 3W20A 4D0QA 5JR2A 1POV3 4R9CA 5C4WC 1BBT2 5IVCA 1JZ8A 4NHLA 4FOQA 3VZLA 4CE8A 5EJ3A 5LRRA 4IDZA 1VBD3 4GMP3 3WNMA 4BDVB 1X8MA 1G9BA 3ZXLA 4YW3A 2JDZA 5GKAC 4ZY9A 4IGOA 2X53S 4K3UA 4W4ZA 1NUKA 4HSLA 1NA1A 3VDCA 4MGYE 2YGMA 3HQRA 2HWF3 3NVCA 1LOCA 5FRAA 4DPNA 1V6IA 3N9LA 5IW0A 1EP0A 2JD9A 4EN9B 1LEMA 1LOFA 1W0OA 4V2VA 3HQXA 5LCWL 5DXDA 2JDUA 2NLRA 3RI8A 3D8CA 1U0AA 1ZBE3 3P3PA 2IVIB 1CQ9A 1OLME 3M4FA 2UURA 1KD7A 2BVVA 1C4RA 4AVCA 1NYWA 2WQZC 1QQP2 1SLTA 1COV2 3NNFA 5FYYA 2IXIA 3J7MA 3SLIA 5ABJC 5G05L 1PO13 3ZSMA 5C4WA 3K48A 5E8AA 1EV13 4BXSV 3IWZA 4LBLA 2PHUA 2TEPA 2VM9A 2YB7A 5HCBA 5F8PA 1DF0A 2GAUA 2QBXA 3NV1A 2ID4A 2YY1A 1D4VB 4R8HA 3WHTA 1XSQA 2P4EA 4YZ5A 1W8TA 1VBE1 1XOYA 2PLV1 5FY8A 1QJEA 2WNUB 1HQLA 1QJX3 1CR7A 1XNBA 2WAAA 1AR91 3M3EA 5E16A 3SCHA 4EN8B 2ZHNA 4FTBA 2XUMA 1DGWX 4LO6B 1R091 4QPIC 5BUVA 5FOBB 5GZGA 1X50A 1LHUA 3GNEA 1H0BA 5EXOA 4ZU4A 2YC2A 2RM21 3KQRA 4RD7A 4M3CF 2VVEA 2E7AA 3I49A 4LPLA 1AL0G 3C7EA 2VZPA 5KHHA 2FDJA 1B35C 1MVEA 1HJGA 5BY5A 2XONA 4PLMA 5FXWA 3KV6A 5FYZA 4FQZA 4QX0A 4I09A 4ARXA 5FUIA 3H9AA 1MACA 1UOFA 4LIUA 3AC0A 2LUWA 3AYDA 5ABJA 4Q26A 2RG4A 1U5ZA 4IL7A 2IXKA 1HV1A 3GGLA 5FZGA 3RNSA 5L19A 1JUHA 2AREA 2PA7A 4HPKB 4NAMA 4KQ7A 3MV01 2HEVF 3RJ2X 1BQPA 5A7PA 5A33B 1W8OA 5IFPA 3ZM8A 5B2GB 1UOGA 4MGSA 5FLHA 5J3UA 4MGIE 3VL8A 1VBC3 4KGGA 3WG4A 1U5IA 1V00A 5A80A 1DGRN 4RN5A 4XDOA 2W2IA 2W46A 4K21A 5KWRA 4YZ1A 5TSWA 1QWRA 4LBOA 1D0HA 4LKFA 4QPIA 3WD5A 4Y22B 3VBRC 1LOBA 4QDSA 2YPJA 1RUJ1 2BVBA 4RYDA 4Q8LA 2UU8A 1IG0A 2A3XA 4UOJA 3MV11 4ISQA 1MS1A 3H7YA 1VRH2 1C8NA 1HXS3 1Q43A 2XJUA 1Q8SA 4BM8A 1QOOA 3AK0A 2VTXJ 2JICA 3VBUC 2XH6A 4QPGB 1B35A 5T55A 1G9DA 1OQ1A 1ASJ3 3TEXA 5C5TA 3LAGA 4P5HA 3LIHA 4QX5A 3PU8A 4MGQA 5L7OC 3WDTA 2VO5A 1GBGA 4RL7A 4COUA 4HETA 2C0ZA 5A1AA 1MS8A 3LA3A 4Y33A 5K0UC 4XE9A 3GBWA 4CCKA 5CG8A 3PIJA 1S0FA 3ACLA 1AVBA 3FHIB 4XF1A 1SG3A 4Z1VA 2X09A 2ZGNA 3J7NA 2E7QA 4A7KA 1ZX5A 2KD7A 3U1XA 1US2A 2FBEA 3RYKA 3AP7A 1C1LA 1N3QA 1DG6A 4QKFA 2ZMLA 1BEV1 4IESA 4P9GA 3VBRA 1JI6A 5SV8A 3ZIWA 5AC91 3WG2A 4BK4A 4CDWB 1ZVFA 3E6DA 5FYHA 2NM1A 4XIKA 4HBNA 1L7LA 1NQDA 2JXAA 1W3XA 3S6PA 3AXEA 2WQ8A 3ACHA 2Q8EA 3VBUA 4AHXA 3VDBA 2W47A 5JMOA 2BGCA 2RS32 2W9XA 4CA9A 2CWSA 2FMYA 4LTAA 5FZ8A 5JIAA 2GN3A 1DYKA 2VNGA 1J83A 1HRV3 1UL9A 2XB6C 4DS0A 5A3LA 5L7OA 1NE6A 4K8RB 1W04A 3U10A 5C5UA 1RVF2 5GZCA 1PVC1 1TMF1 5K0UA 2PHRA 5C3PA 4UW4A 1UYYA 2R041 4XF4A 2C9AA 4JHZA 3AJYA 4BXFA 3R4UA 2JENA 1MQTB 2WWUA 4AVAA 3TYJA 4XETA 1H1AA 3IT8A 3KCXA 3MW3A 4JRAA 2J1EA 1FOD3 1TE1B 3CEWA 3E5QA 1U5YA 3HN3A 4PIYA 4AFDA 4XJAA 2VJXA 3PJQA 1GZCA 2DVFA 4YYOA 1LCLA 3PMEA 4DY3A 1UNBA 2CGOA 2E32A 2H6BA 4XEZA 3SCGA 3ZFEC 4CDUA 1QKQA 2E6VA 5FLIA 1EPZA 1UY1A 1BBT1 1BZWA 2OZ6A 3MLKA 3D4KA 4IV1C 4I02A 2XLFA 3HIFA 1G86A 3OUJA 3X29B 2JDNA 2WUHA 3FBYA 3FN9A 3VD5A 1KRIA 3F95A 4FPLA 4Q27A 1IOAA 4K9SA 3VBFB 3NJVA 1SCRA 3V0BA 3RYPA 2DFCA 2VNRA 3SEPA 4AI0A 3LF7A 4YVSB 1YQCA 1W9TA 4Q4Y3 4DY5A 1WKYA 4B1MA 4HK8A 2XLAA 3ZYPA 1GWLA 5IT6A 3MIEA 1DZRA 4YW6A 2VQAA 4GWJA 3EB7A 1UMIA 3I54A 3KLSA 4UBHA 4F83A 1KFXL 1OXCA 2JIJA 4QQ2A 2DUOA 3WEZA 4FAGA 3JQXA 1O5LA 1RUI2 2Q4SA 3K2OA 5JZGC 1UY0A 2LTNA 1R1ZA 2R073 2QQMA 2YMZA 3T1LA 4P9YA 4CUGA 4HSJA 3ZYBA 4AVSA 5FZ4A 1IQAA 5M0TA 4A42A 2D5HA 2LROA 2BV4A 4QDRA 3ZFEA 1LU2A 4IEYA 3AZWA 1FMD1 2NMOA 3N3HA 4IV1A 2JKBA 3ZO0B 3AMNA 5A7OA 3RWKX 4QX8A 1AR82 4FO9A 1V6MA 1YIFA 5IAXA 4I01A 2A6ZA 4LEJA 1N1YA 5L9VA 4XILA 1XC6A 3O1RA 1M4WA 2EIGA 3JB4C 5JOYA 2HWB3 3LOBA 1NE4A 4O65A 4CDQC 1F5FA 1SCSA 2XQRA 5FPZA 4O7XA 4BMEA 4Y1ZA 2A7AA 1W99A 4MHUA 3WNOA 4MV2A 4XUNA 1UKRA 1JH5A 5FFOC 3LEIA 1ALYA 4E4DX 1O8PA 1C5HA 4CU6A 3EMRA 1ULEA 2R49A 1HQWA 4MUVA 4BISA 3I2FA 1APNA 4GH4C 2J1AA 3BODA 5JZGA 2TBVA 2WYFA 4XFCA 4BPZA 5LEKA 3NQHA 1XNCA 2IWGB 1PZ8A 5DZEA 2PMWB 2FD8A 1C3HA 1VBA3 2ZEZA 2Y33A 4Q4V2 4AI3A 2CGPA 4J6GA 3Q8FA 1N1TA 5E1RA 3H1MA 2VNOA 2XGXA 4Q4X1 1VBE3 1IPSA 2VMGA 3ILNA 3M7AA 2BDRA 2PLV3 3WF3A 4FSJA 1GOFA 3CQOA 5IATA 2D93A 2MPFA 3IPVA 2XDVA 4FP3A 4CEYC 1YXWA 4KNCA 1N3PA 1HB1A 4FXGB 4D7SA 2VUJA 5GLTA 1H8TC 1NAEA 1ODNA 4FTSA 1GZWA 3JB8A 4A6SA 5ACA1 4Y4YA 5FK8A 5C3QA 4OYUA 1UOJA 5D8AC 4CDQA 2MEV2 4CEWB 1QJU1 4GULA 2YBPA 4JV4A 3JD73 4YW4A 1I5ZA 1NCQB 3SC7X 4PDWC 1LULA 4B8EA 2FDIA 4I3PA 2Y60A 3ACIA 3MYXA 4FPKA 3POBA 5KXBA 4GH4A 1ZYBA 1HRI3 1VRH1 3KHBA 5A6XA 2W95A 3BTYA 1X33A 3HJRA 5LBFA 2Y6GA 4H2AA 2G9FA 1ULPA 3APBA 1OD5A 2OPKA 2GNDA 4CUCA 1C8M2 5J48A 2JDHA 1CJDA 1LNSA 1OHFA 4UFLA 3LKJA 2QQJA 5EJZB 2WZPP 2PHTA 4SLIA 3SKVA 1STMA 1BMV1 4Y1XA 2OA2A 4CEYA 1VAKA 3VDAA 1RJ8A 3H50A 2IFWA 1S0GA 3T4HB 1H8TA 3MW4A 4EV0A 4OHYA 2WC2A 1RUJ3 2G4IA 3KD4A 4QQOA 1ENSA 4ZXKA 5D8AA 1XQNA 3WDXA 2JG8B 3NV3A 3HBZA 4BCUA 4F7ZA 1WWYA 4BU2A 4BYYA 1A8DA 3B01A 3LSEA 2JDMA 4N7IA 4AVBA 4PDWA 2UWBA 4CTEA 1WLTA 1K5MA 4CUBA 1PO23 2O8QA 4YLZA 5FZ9A 2B9VA 4N7UA 2D98A 5L36A 1LTEA 1YYNA 3VZMA 1W2UA 1VBB2 2ZGSA 1X9TA 2D97A 3W59A 4M3CB 5C3RA 2GMMA 2VBDA 4XZUG 3LEGA 3BTAA 1H9PA 4LBQA 2D6OX 1I3HA 1O3TA 3CNAA 4P9LA 5F32A 5FPBA 1C57A 5FDBA 2R30A 5A32B 2VQ0A 1SZBA 2W1UA 4P00B 4R9BA 3NJXA 1OQDA 4YM1A 3A23A 3T3YA 3I2HA 2W1SA 1OKOA 3VBHC 2V73A 1JUIA 1SHWB 3VB9A 4L92A 4BMBA 2GDFA 1Q8QA 1YI7A 3PUHA 4BIFA 3LE0A 4QQLA 2B8MA 4Z2WA 5AC93 5FXXA 1IKPA 5AVPA 4Q5OA 3OBZA 3QACA 4KWUA 1A8MA 1KQRA 2HBTA 4OMCA 1OLRA 2F4PA 2VW0A 2X5IC 2E33A 3OEBA 3ZXFA 1MS9A 1F2NA 1OF3A 4G4FA 1TVGA 5FYVA 3BPSA 1GUIA 4AWDA 3MIHA 2K0GA 1SDDB 1J3QA 2OZJA 1ZREA 5T5PA 2WYSA 1BK1A 4HKLA 2XKOA 4FTEA 3O1PA 4H14A 2A6VA 1JZ3A 3AZXA 4AEKA 3ZXDA 4ASMB 3FZ3A 4FPYA 4MGKE 2GC1A 4JKKA 4UT5A 1VPHA 2G1MA 2RJ2A 4YW1A 3RZZA 1O3SA 3CF6E 1XXNA 2VL4A 4Z82A 3N9MA 3S7IA 3O14A 2ZEWA 1ZZBA 3FWEA 1UOBA 4XMIA 4K7JA 3B9CA 1UX7A 3LIGA 1NQJA 3T4VA 4C1WA 4DEQA 5LBBA 3VBHA 2BFUL 4PBPA 2DV9A 3ZKUA 4NHMA 2IUWA 2P3YA 4X6QB 5FY7A 3PUAA 1Q8OA 1Q3EA 2VMFA 1GLHA 5FZ0A 4YSFA 4XBLA 5IVJA 3ORJA 2VMDA 4BLJA 4QU2A 5CFCB 5FO8B 4EE2A 3AZYA 3IN9A 4XXPA 3FUOA 1Z0HA 2LM3A 2P3JA 4IE6A 4COVA 2O14A 3ZIXA 1BBT3 4HZFA 4MXVA 3QH6A 4D6SA 2X5IA 2JDPA 1RUD1 1RUOA 2OW4A 3HR9A 2V72A 1KEXA 3VKLA 3M3IA 1GOGA 1RUG1 2XBO2 3FUQA 1OA4A 3NWKA 2RHPA 5IUQA 2GH8A 2IFRA 4XACA 2C24A 3VHNA 1AR81 1LU1A 2X05A 1FYUA 3IBMA 3NAPC 2AUYA 2EICA 3N4MA 4UFJA 1W6MB 3BU0A 1G6NA 2A1XA 2Q0AA 3E5XA 3ZFFB 3DPRB 1ZM1A 3H8RA 3M3QA 4EROA 1ZZ6A 3OUHA 1K12A 4LUMA 1W39A 1QJZA 2JB4A 1LAJA 1HJFA 4ORFA 1GQHA 4GKXA 3MF6A 3TNQA 3T2PA 2I07B 5EWSA 1NCRC 1H2MA 1QQP3 1COV3 4R9DA 4FPOB 4OULA 1KJRA 3R4DB 5C9AC 3HN1A 3UESA 1R081 4XAAA 2VZVA 1BYHA 4A2UA 4LKEA 1PGSA 3AL6A 1PMHX 2R0FA 3BPZA 4IE5A 4WM7B 2HWD1 2HEWF 5JR7B 3AP4A 4EWEA 3CMGA 3SQOA 3GDBA 1CAWB 5BNNC 1YHFA 4JZRA 4AE2A 1RB8G 3BN6A 2VZRA 1NOVA 2P3KA 2WZEA 3OGJA 3VD7A 1OFNA 3VBSB 5F1RA 1EAH1 5K9YA 3E6BA 3HAGA 4XFIA 1QXPA 3NAPA 3CJIB 3EXUA 3SEEA 2PHLA 1CAUB 1UAIA 4Q0SA 3A7QA 2P6HA 3WHUA 4UF0B 2D6NA 3DYPA 4KMQA 2VY0A 1N47A 3HPNA 4KG0A 2XVLA 3ES4A 4YW7A 3WLUA 4BHPA 5K7PA 3OPTA 4Q4W1 4CCOA 3H3ZA 3AM2A 1F4AA 2Q8OA 4DUWA 4V2WA 2JE8A 5HCAA 1H2LA 1H8VA 1CN1A 1ZA7A 1AR92 3AMMA 1XPWA 1V9U1 4XCBA 4Z07A 4C0HA 3PLQA 5DG1A 1O59A 1NCRA 4AI8A 1R092 1VLNA 1DZTA 4HG6B 4Q0VA 1WZXA 3ASIA 5C9AA 2FDHA 1IS4A 2WS91 2RM22 3DECA 5I0UA 2A6WA 2XJSA 3ZXGA 3OGRA 1NX9A 4LKSA 4JGZA 3SCFA 4FFGA 4GWIA 4QX7A 3PJYA 4PLNA 3WCRA 5BNNA 3FFZA 3N7KA 5A7QA 4W65A 4EYUA 5FMCA 5DUXA 3VHPA 1ULOA 5KR7A 1UYXA 1Y9GA 2ARCA 3EO6A 4RR3B 1LGBA 4BH9A 5LATA 3POJA 1IS5A 2DCTA 4BQ1A 1PM4A 2VXRA 1YC61 2O8OA 1FX5A 1JU3A 2X29A 1YNAA 5FYIA 5KHJA 5FP7A 5LBCA 1VRH3 3OYWA 4Y1VA 5C8WA 3WW4A 1VMJA 3KF5A 3M3OA 2VZ1A 2AR6A 3ZFGC 2W92A 1OH4A 3S0MA 4GALA 4MYEA 5FKCA 4R52A 1ZBA1 2VGDA 3ME2A 3AVRA 2CSGA 1QJY2 3P1IA 1RUJ2 3CIHA 2XJQA 5A6YA 4XTPA 3ZX7A 3MIGA 4HANA 1Y9MA 1PIV1 3BALA 3NW4A 4OHVA 3H8UA 2RS51 4QB1A 4IE7A 3WNLA 3DXTA 1AR62 1DQ0A 3LPFA 2ZEXA 5GZFA 1UW8A 2P3IA 4ZU7A 3UKTA 3UGHA 2OUHA 4XFGA 4QPGC 2WT0A 1ENRA 1YEWA 1IKQA 1QGLA 2YGLA 3ZXKA 1XU1A 1S0BA 3OD4A 5B4NA 2JG9C 3USUB 3SHRA 2J22A 4IERA 2D3PA 3AYAA 3MEPA 4ZS2A 1PZ7A 1IHMA 3A0KA 3NL1A 5F3IA 5I93A 1OC1A 3NMBA 4KBBA 4N8MA 1W6PB 3GJAA 1F5JA 3BVCA 4HPKA 3O7OA 5A33A 1X8EA 4UAPA 3ZFGA 1W9SA 2IVJA 2QZ2A 4D6QA 2RS33 1KITA 1UY3A 5CFDB 1XE7A 5EV7A 1BEV2 3UKNA 3OOXA 4PI0A 2WNVB 5AC92 1A3KA 1RVF3 4XFHA 4OI0A 1UKGA 1QOTA 4R4ZA 1AYM1 1W2AX 3WDUA 4CDWC 1W90A 5K8SA 4QQHA 1XJAA 2W0XA 1G9AA 3SH3A 3NJZA 4LHLA 2D40A 3B00A 3BCWA 3E6CC 4QWNA 3WQBA 1IPKA 2IXCA 5AFEA 5KXCA 4ATFA 1QNWA 4QPGA 1PX4A 2K46A 4L99A 2NN8A 2E53A 2JE7A 4NPRA 3SH5A 2VG9A 3LDRA 3P3NA 2UY9A 3PUQA 1ZA4A 5CU1A 1PVC2 1TMF2 2ZMKA 3M8LA 3A4UA 2JG9A 2D3RA 5IVEA 1HW5A 4KGQA 2EALA 3OD0A 2R042 4MSVA 2LRPA 3H3LA 5J09A 3U07A 5J37A 4OZOA 1UN1A 2GNMA 5CYYA 4BQ3A 2BWCA 1DGWA 3AKSA 1LOGA 5EZWA 4B29A 3IZOA 3K77A 2TNFA 2QQIA 4Y5SA 2JKXA 1RHI1 4NIHA 4JHTA 3KCCA 3HT2A 1GYKA 3O0XA 3URFA 4BOWA 2BU9A 3ZSEA 2WSVA 5A3OA 4CDWA 2Y6JA 2QFEA 4NWVA 1QMJA 1IPJA 2ZX4A 2D6LX 1CESA 1RUI3 4QD2A 3K4AA 3NV2A 4XQ4A 1E5IA 4YGDA 2WO7A 4W6YA 2B9UA 3K3NA 3N7JA 3OBRA 3RDIA 1E5RA 3GZAA 4IXLA 5DMYA 4HK9A 3VBFC 1DU3D 5GJ6A 2FMDA 4Y20A 1S1AA 1RGSA 5IJRA 2ADEA 3D5OA 3UL2A 5JXIA 1BVP1 2DBNA 4Q8KA 2QQUA 3ALQA 2YV8A 2UWCA 3TEWA 1FT9A 3KV5A 1SMVA 1UZWA 2NQYA 4IQPA 4ONUA 2ZGUA 4PQ9A 1AR83 3WSOA 3EHKA 4CVUA 4WVMB 1KDKA 5F9TA 4XJ8A 5C3OA 3J8F2 5FWEA 4KL1A 3ZSJA 3VV1A 2GP3A 2O1QA 1UX6A 2AC1A 2ZCWA 2HWE1 4HKOA 2JDYA 4CDXB 1AXYA 3RZGA 1OBNA 3OTFA 4KWLA 1CIWA 5CKQA 4XJZA 1JODA 3AMPA 5FK7A 5H9RA 4EN6B 1FMD2 2VOKA 1QIQA 4QPWA 2ZZJA 3WUDA 3Q8AA 1WMFA 2CDOA 3J7HA 4XBNA 3ETQA 4QT6A 3M3CA 3QCWA 4IEPA 3SMHA 2WRAA 1NXD1 4TWTA 4AVTA 4AQSA 4ITCA 3THDA 1W8ZA 4NUBA 5BPXA 1UD1A 3D82A 3SH4A 5A3UA 4Q4V3 3VBFA 1HLCA 5GALA 3ZSKA 5FZFA 1YI9A 3V0AA 3CU7A 1CWPA 1AX2A
chains in the Genus database with same CATH topology
5A6XA 4CE8A 4UT5A 5A3OA 4AOCA 1OVSA 1UQXA 1UZVA 2JDYA 1OXCA 2BOJA 1OURA 1OUSA 2JDMA 2BOIA 3ZDVA 1W8FA 2XR4A 2VNVA 2JDKA 2JDHA 5A6ZA 3DCQA 2CHHA 2JDNA 1GZTA 5HCHA 5A6QA 2BP6A 1OVPA 2VUDA 2WRAA 2BV4A 2WR9A 1OUXA 1W8HA 2JDUA 5A70A 2VUCA 5D2AA 5A6YA 2JDPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A6X A;  4CE8 A;  4UT5 A;  5A3O A;  4AOC A;  1OVS A;  1UQX A;  1UZV A;  2JDY A;  1OXC A;  2BOJ A;  1OUR A;  1OUS A;  2JDM A;  2BOI A;  3ZDV A;  1W8F A;  2XR4 A;  2VNV A;  2JDK A;  2JDH A;  5A6Z A;  3DCQ A;  2CHH A;  2JDN A;  1GZT A;  5HCH A;  5A6Q A;  2BP6 A;  1OVP A;  2VUD A;  2WRA A;  2BV4 A;  2WR9 A;  1OUX A;  1W8H A;  2JDU A;  5A70 A;  2VUC A;  5D2A A;  5A6Y A;  2JDP A; 
#chains in the Genus database with same CATH topology
 4NOT A;  2F6B A;  2OKX A;  1V70 A;  4J1X A;  1ULC A;  1UU4 A;  4NID A;  1DP0 A;  1OUR A;  1S2E A;  1Y3T A;  2BOI A;  4K6B A;  1PGW 1;  2WT1 A;  2B45 X;  4RHV 2;  3OSD A;  4EZ4 A;  1W6N A;  4MET A;  3PTY A;  5FYT A;  4AED C;  3I2O A;  4WM8 C;  4JGY B;  1D0G A;  5EYX A;  5JIU A;  5FZC A;  2B4K A;  5BNP C;  3OY8 A;  1R1A 2;  5IK8 A;  3O12 A;  1AL2 1;  3VKO A;  2JJ6 A;  2MEV 3;  3WDW A;  3J26 N;  3T0D A;  2VTX A;  3ES1 A;  1VAV A;  2J1T A;  3NKT A;  4P9I A;  4Q4X 2;  4JRL A;  3JBG 1;  4IUG A;  1JS9 A;  4L8Q A;  1X7N A;  2UY8 A;  5FZO A;  4FOV A;  3AZV A;  2P6C A;  1UCX A;  4OCT A;  1LRH A;  1UU5 A;  2BRT A;  5ACA 2;  4YGB A;  1F8V A;  4K20 A;  5KHK A;  1GP6 A;  1WBL A;  4CYD A;  1C8M 3;  4BQX A;  1QJU 2;  4QMA A;  4PBO A;  3QLQ A;  5E89 A;  4C90 A;  1QJY 1;  2WFF 1;  1CX4 A;  4B7K A;  4CEW C;  4QXK A;  5JSO A;  2QNK A;  4EWA A;  1URX A;  1XRU A;  3MFC A;  2AGS A;  5FO9 B;  3WG1 A;  3R4S A;  3AX4 A;  2Q1Z B;  2VMC A;  1AXZ A;  1HB4 A;  1QF3 A;  3O5S A;  4UBG A;  3UK9 A;  1RUC 2;  2I74 A;  3I7D A;  1CZV A;  1AR6 1;  2GAL A;  3ZKY A;  4AED A;  1V6J A;  4WM8 A;  1CAX B;  3RZK A;  5FWJ A;  3AP6 A;  5BNP A;  1JOP A;  2AEY A;  4P02 B;  5EHD A;  5F5Q A;  3VZN A;  4LE3 A;  4FBF A;  5JMC A;  2YC0 A;  4DB5 A;  1RIN A;  3W58 A;  2K2S A;  1SLI A;  1XND A;  4HON A;  1DZQ A;  5C8C B;  4AEJ A;  1BMV 2;  1RJ7 A;  2ZA9 A;  3ACF A;  4QAW A;  4AEM A;  3BOP A;  2OS2 A;  4CCN A;  5H9P A;  2JDK A;  4PQQ A;  1YJK A;  3RZJ A;  1VBB 3;  1XYP A;  2PFW A;  2C5D A;  3LA7 A;  1A6C A;  2EA7 A;  1POV 0;  1CZT A;  2W39 A;  3WQ0 A;  4UW5 A;  1HN0 A;  3POI A;  2JG8 C;  2W94 A;  5I91 A;  1K45 A;  4CEW A;  1WMX A;  3RRD A;  2AAC A;  1ZRF A;  1CAV A;  3RWN A;  4A7Z A;  1YLL A;  2DF7 A;  2P1B A;  1NLQ A;  1ZZ9 A;  1NG0 A;  5DUW A;  1FAT A;  2VTF A;  4P9J A;  2BQP A;  4XAB A;  1MEC 1;  1BHG A;  2RS1 1;  3WF2 A;  5LK7 B;  2BNM A;  2PQS A;  3LZZ A;  1EY2 A;  3ENR A;  4PF5 A;  2CHH A;  4XVH A;  4UYB A;  3TAY A;  2CGN A;  5A6Q A;  4AL9 A;  1W2O A;  5ISL A;  2P17 A;  1FI2 A;  1DHK B;  4QKN A;  4X8N A;  3BKZ A;  2VPV A;  3BI3 A;  1JZ7 A;  2A3Y A;  1JOB A;  4JQT A;  2Q8D A;  3MZH A;  1ODM A;  3WY6 A;  4D69 A;  1SFP A;  3INA A;  1GU3 A;  2XML A;  3K4Z A;  2MNG A;  2XG3 A;  1W6O A;  2QKD A;  4AW7 A;  1J58 A;  1AYN 2;  3KB5 A;  5K4L A;  1OI6 A;  2JG8 A;  3M1H A;  2WNE A;  2PYT A;  1DQ1 A;  4DUX A;  1YWK A;  5FY1 A;  2WLQ A;  1BK0 A;  4UFI A;  2R32 A;  4YW2 A;  1O3R A;  3PL0 A;  4OI2 A;  1YQ2 A;  1DGR A;  2B42 B;  4HT1 T;  4U36 A;  1BCX A;  3WNK A;  4FQ4 A;  2Y6H A;  4LBK A;  2GMP A;  2J1R A;  2QQN A;  2W3J A;  4DUV A;  2YHJ A;  5CIR A;  3VD4 A;  5LA2 A;  4FPH A;  1IGO A;  2HYX A;  4M3C A;  4AI1 A;  2PHD A;  2ZEY A;  1Q8P A;  1W8H A;  2ZX2 A;  3UNP A;  2VCB A;  3S7E A;  2YBK A;  1RUH 1;  3W9A A;  5FMB A;  3POG A;  2WSU A;  1ST8 A;  3FBM A;  3LWC A;  4NWW A;  3N9P A;  4QGM A;  1L7R A;  2QQL A;  3KVB A;  5FMO S;  2XBO 3;  4FOY A;  4QM8 A;  3JCI A;  4A45 A;  3OG2 A;  1ENX A;  2EXH A;  4PIZ A;  3MIC A;  4LR4 A;  4MLO A;  3WG3 A;  5FY4 A;  4AAX A;  4DIQ A;  2O0O A;  2ZGO A;  1I5P A;  3J8F 1;  4QKD A;  4YZ4 A;  5IAV A;  1UZZ A;  3IAQ A;  1DQ5 A;  4B4Q A;  5FYB A;  4JQR A;  3N7M A;  1SQ4 A;  1OVP A;  3LA2 A;  1RUD 2;  1JZ5 A;  2C4X A;  1W0N A;  2Y0I A;  2Z5W A;  1I1E A;  5A7S A;  2Y6K A;  1SPP A;  4RS5 B;  3CZJ A;  2P2K A;  5BXX A;  1RUG 2;  4Y3O A;  3WNP A;  5C3S A;  2WT2 A;  5JXG A;  2AEN A;  4W8J A;  3H3U A;  3MIB A;  3O1O A;  4URA A;  4J1W A;  4LBJ A;  2WBK A;  4YFZ A;  3KGL A;  3GM8 A;  4RGA A;  4EWD A;  1NZC A;  3I8T A;  4Q29 A;  2A3W A;  4P9X A;  3NRU A;  1JYV A;  4FPE A;  5ABJ B;  4TLG A;  4XCA A;  5FXZ A;  4W6X A;  1H2K A;  1ULG A;  3Q8C A;  3KMH A;  2R7E B;  3TOJ A;  3TRS B;  1OQE A;  4K40 A;  4LHN A;  3WNN A;  4GZ9 A;  4E9K A;  4XHB A;  1YFU A;  3U4S A;  4RHV 1;  1WA6 X;  4M4P A;  3V64 A;  3RJR A;  3WIN E;  3WQ7 A;  2YRO A;  3GZU C;  3AB0 A;  1R08 2;  3LQC A;  1IQD C;  2HLE A;  5L73 A;  1Z7S 1;  1UXX X;  1R1A 1;  2IZW A;  1UXZ A;  2HWD 2;  5EP9 A;  4QPI B;  3WF0 A;  4FFI A;  5LA1 A;  3PUS A;  4BB3 A;  3Q8B A;  3C7G A;  1V6L A;  1AR9 3;  1EAH 2;  2DCY A;  1O3Q A;  1GAN A;  2ZKL A;  3AYE A;  1HIX A;  1KJL A;  1R09 3;  3VBS C;  1B35 B;  4OMD A;  1UPS A;  1OA3 A;  2ZBJ A;  2YFZ A;  4FI9 A;  1JYX A;  2RM2 3;  4MVT A;  1UU6 A;  1GOH A;  5GLW A;  3CJI C;  2DYC A;  1YCI A;  5F39 A;  1RL3 A;  1GMM A;  5EPA A;  3MI8 A;  2QUO A;  4WVZ A;  1T6G C;  4Q4W 2;  4PT6 A;  3I2G A;  3MIF A;  4S2H A;  4TN7 A;  4N43 B;  4DQA A;  3VUO A;  1HB3 A;  2VVF A;  4GKY A;  2D3S A;  2RMU 2;  4L2N A;  3KGZ A;  1V9U 2;  2R1D A;  3VZJ A;  5DAB A;  1AL2 3;  1AR7 2;  4LBQ D;  1YQ6 A;  1MS3 A;  4G3Y C;  3ZN6 A;  5FPL A;  2GU9 A;  2Z2S B;  5KHI A;  1RUC 1;  1OF4 A;  3JXS A;  2Z79 A;  4MZU A;  3WQ1 A;  2R06 1;  2WS9 2;  2CAV A;  1OT5 A;  2ORZ A;  1QNY A;  2RDN A;  2VMH A;  3AZZ A;  2X8K A;  4UFM A;  5T5J A;  3WF1 A;  2FDG A;  3I3M A;  4PI2 A;  2VH9 A;  1DFQ A;  2Z69 A;  5FZK A;  3KV9 A;  3A0N A;  3PTR B;  3VBR B;  1GZ9 A;  3GBG A;  4ZU5 A;  3QH7 A;  3TN9 1;  2VUD A;  2KA3 A;  3IM0 A;  4UXA A;  4E8C A;  4XF3 A;  1JYC A;  1CAW A;  2WN2 A;  2VBP A;  5BNO C;  2XHN A;  4NRM A;  1GFF 2;  4QGL A;  1GNH A;  5DDJ 1;  4ES8 A;  2OX0 A;  3VBU B;  3VBS A;  1GR3 A;  1QJY 3;  2WFF 3;  3SIS A;  1LEC A;  1NXM A;  2G9Z A;  5DAP A;  4BA6 A;  4IV3 C;  1UMZ A;  3CJI A;  1OH3 A;  3LCP A;  3R05 A;  4XOG A;  3FLR A;  1UQX A;  1UZV A;  4CCD A;  5L7O B;  1AJO A;  2EF6 A;  3ZPO A;  1FAY A;  2F4L A;  2R16 A;  4UF0 A;  1AR6 3;  1D4M 2;  1PK6 C;  1ZZ8 A;  2DUR A;  2AH2 A;  2VNV A;  3PUI A;  2JDA A;  5CNA A;  3ZYJ B;  3WP4 A;  3AFK A;  5HXM A;  4XJU A;  4XTM A;  4EN0 A;  1ZBA 2;  2VC9 A;  5LK5 A;  1QXJ A;  3G7D A;  4LUL A;  3ZPY A;  4ATE A;  2SBA A;  5IYY A;  2WL1 A;  5KXD A;  1LOE A;  1PIV 2;  1X36 A;  2CU5 A;  1FNY A;  2RV9 A;  1V6N A;  2RS5 2;  4Q2F A;  4NN0 A;  3QD6 A;  1UZY A;  2W91 A;  4BIO A;  4QXB A;  4CDU B;  4FFH A;  2BYV E;  5HPO A;  1JHJ A;  4ISR A;  4PHZ A;  2VZ3 A;  5BNO A;  4KU7 A;  1BEV 3;  4B3N A;  3FC0 A;  1BLZ A;  1WD3 A;  1H1I A;  3KM5 A;  5FV3 A;  4GJZ A;  4IV3 A;  2F17 A;  4CCC A;  1NKG A;  2FQP A;  2ZX1 A;  4G9S B;  5ANQ A;  3ZR5 A;  3V0B B;  4AZZ A;  3IKW A;  3CL1 A;  4GB3 1;  1AYN 1;  4EQV A;  1PMI A;  1PK6 A;  5IWF A;  4V1P A;  5LA0 A;  3HT1 A;  2C1F A;  2FCU A;  1GQP A;  2OPW A;  4E2G A;  3ZXE A;  2HKX A;  2J1S A;  4NE9 A;  3ZR6 A;  2VUC A;  4AFA A;  3OGG A;  4HMZ A;  1A78 A;  2ZKN A;  4TTG A;  1V0A A;  5CFD C;  2W52 A;  1VR3 A;  1PVC 3;  1TMF 3;  1WME A;  1QDC A;  5FBJ A;  1W9F A;  4H3W A;  3SNM A;  4AHZ A;  2R04 3;  4HN0 A;  1AYM 2;  2IXJ A;  3ZDV A;  5C33 A;  4A44 A;  4LE4 A;  2D44 A;  2RVA A;  3V65 A;  3WDY A;  3ZFE B;  1FPN 1;  2E31 A;  2P34 A;  4IEZ A;  5LRS A;  2WO3 A;  2XJR A;  5HXV A;  4GWN A;  5LEJ A;  4IV1 B;  3TEY A;  2J42 A;  1SLB A;  1DLL A;  3D0S A;  1CON A;  1UIK A;  3I3B A;  1SFN A;  4S2G A;  2W08 A;  1LOA A;  3VBO B;  3VD3 A;  2D6P A;  1CGP A;  5FUP A;  4CUA A;  3OGV A;  1EUT A;  3USU A;  4RA0 A;  2ERF A;  4BWO A;  2SLI A;  2WZR 1;  3F2Z A;  1AX1 A;  4AXO A;  1J84 A;  2VD7 A;  3CBN A;  3DYM A;  4HVQ A;  2OQ7 A;  5FZL A;  4LJH A;  4RQP C;  4OHZ A;  2VVD A;  4NRO A;  1POV 1;  2DVD A;  4TSV A;  1RHI 2;  2WO2 A;  3PUR A;  5CFD A;  4AVV A;  5DPN A;  3AVS A;  2IXH A;  3WP6 A;  1RMU 2;  1VBD 1;  1JN2 P;  2N7G A;  1WW5 A;  1O6U A;  4OFG A;  3T09 A;  5HBA A;  4YRD A;  5IFT A;  2FCV A;  4OQ8 A;  4BQ2 A;  1YO8 A;  3IDE A;  1N3O A;  4A3X A;  1C1F A;  5FQ0 B;  1WGP A;  1Y43 B;  2ZOE B;  3AKP A;  5CA6 A;  3C8X A;  1BJQ A;  2VZU A;  1I9R A;  3GHM A;  1S0J A;  2OII A;  2P37 A;  3J8F 3;  4Z8B A;  3MGU A;  5FZI A;  5FP9 A;  3G6J B;  4RGK A;  4PIX A;  2A75 A;  4UI9 L;  1WCD J;  2YDE A;  1CJP A;  3CO2 A;  1WCU A;  4L97 A;  4Y5T A;  3UGF A;  5I0R A;  3T2Q A;  4AF9 A;  2YG0 A;  5JAX A;  4DOU A;  4M0N A;  1FMD 3;  2BBA A;  1ZBE 1;  4CDQ B;  1YFY A;  1SLA A;  4LIV A;  1PGL 2;  3RI9 A;  2BER A;  3RZM A;  5A7W B;  1PGL 1;  3PU3 A;  2VUL A;  1EUU A;  1K3I A;  3AP5 A;  3HOB A;  1H4H A;  2R6Q A;  2WR9 A;  1EPW A;  1OD3 A;  2HWE 2;  4RQP A;  4RSU A;  3GZE A;  4GH4 B;  5DG2 A;  4MGZ E;  4JDN A;  2C9K A;  2E63 A;  1EV1 1;  4NJ4 A;  4CCJ A;  4D7Y A;  2QJV A;  4CCM A;  2QE3 A;  4CDX C;  2VQT A;  1W6Q A;  4S2D A;  2PAK A;  4CZS A;  2GME A;  3VL9 A;  5FYS A;  1JZ2 A;  3MUZ 1;  2OQ6 A;  3SXW A;  4Z92 B;  1QJX 1;  2DWR A;  2OUJ A;  5F3G A;  4RHV 3;  4AGV A;  2E51 A;  2E26 A;  4COW A;  4GIQ A;  4UFK A;  4A4A A;  4CU8 A;  1VMH A;  5G04 L;  5DAW A;  2OT7 A;  4CEY B;  2RMU 1;  1R1A 3;  2ET1 A;  1OOP B;  1AR7 1;  2WNU C;  3LPG A;  2VOV A;  4I0B A;  4F8A A;  4ZKT B;  4Q4X 3;  3B94 A;  5C6C A;  5IHR A;  3NNM A;  4LO7 A;  5FAX A;  4OQ9 A;  3K46 A;  3Q9O A;  2B7Y A;  2IXL A;  2WA4 A;  1RED A;  5F5C A;  5T5L A;  5HV0 A;  3HD8 B;  3WR0 A;  1PGW 2;  5FP4 A;  1YQ5 A;  3SKJ E;  1K5M B;  5DUU A;  4QGN A;  2XVG A;  3T1M A;  1GWM A;  3T2O A;  4FPF A;  3BGA A;  4SBV A;  5ACA 3;  2NZ9 A;  2RDQ A;  2WZ8 A;  2D5F A;  3FL7 A;  4WVM A;  5LB6 A;  5HV4 A;  1T6B X;  1AL2 2;  1QJU 3;  2W68 A;  2IC1 A;  1WLW A;  1SFY A;  4CDX A;  4DMI A;  3JBG 2;  1WW6 A;  4IEX A;  1TNF A;  4YZ2 A;  1KDM A;  3PHM A;  3ABZ A;  4YVW B;  4COZ A;  5KXE A;  2EIB A;  3GXU A;  2WAO A;  1GKB A;  4PCR A;  2DCJ A;  1GZT A;  3MUY 1;  1VBC 1;  4IND A;  5FTT C;  3ZDS A;  4BQW A;  5BV6 A;  1SBE A;  3BIE A;  2WNO A;  1RUC 3;  1Y9Q A;  2QDR A;  3Q8E A;  1D4M 1;  3UKV A;  3POY A;  3RG0 A;  1CVN A;  1OMI A;  4P08 A;  1RUN A;  1RUF 2;  1SLL A;  3LFM A;  1RXG A;  2XWJ B;  4UW3 A;  4LO5 B;  1PVX A;  1D2S A;  4N53 B;  4YWA A;  2WNU A;  1MPX A;  1REE A;  3DGT A;  3DEM A;  1O4T A;  2DTW A;  2WFF 2;  3FHA A;  3M70 A;  4MOA A;  5D1I A;  4LBM A;  3ZSL A;  1S0D A;  3MLJ A;  4W6W A;  5FJK A;  2Y34 A;  2LS6 A;  4AHY A;  4BQY A;  4XW3 A;  2EAK A;  4BQ5 A;  1HQN A;  2GNB A;  2ES3 A;  4XQW A;  3B93 A;  2JEM A;  4OUM A;  1FNZ A;  4IET A;  3U75 A;  5A3T A;  3TWI A;  4WZF A;  2J1U A;  2FDF A;  2WIN B;  5CEH A;  1GWK A;  2QQP A;  2WAB A;  1Z78 A;  4HKW A;  1JTZ X;  2BJS A;  2XJP A;  3WCS A;  5CIS A;  5EIY B;  3O1V A;  1XBF A;  3NV4 A;  4RFT 0;  3VHR A;  3ZVX A;  2VOT A;  3UT0 A;  4ZZ8 A;  5JI9 A;  5C8C C;  2Y0O A;  1MS5 A;  3LFI A;  3BOW A;  1HN1 A;  5J1X A;  3U78 A;  1TME 2;  5IVY A;  5JPM B;  2VZT A;  1BVV A;  2XOM A;  3N9Q A;  3D6E A;  4JCK A;  3WT3 A;  3U11 A;  5H9S A;  4WV8 A;  5KBF A;  1W0P A;  1O7F A;  2ZGK A;  3PNA A;  3TNP B;  3W5N A;  4WVW A;  4JKM A;  2ZMN A;  2WKK A;  3AJZ A;  4JTO A;  4Y1U A;  2HJI A;  1Y7B A;  4Y22 A;  3VKM A;  3DYO A;  5CBL A;  2PN5 A;  2X5I B;  4L0P A;  2KXL A;  4DEV A;  4QB6 A;  5I8T A;  3JUU A;  1HRV 1;  4JTN A;  2VZQ A;  1MEC 2;  3GYD A;  4LHS A;  2RS1 2;  5A3W A;  3WP3 A;  2DVA A;  4I0W B;  2GN7 A;  4BK5 A;  5T50 A;  1IS6 A;  1CPN A;  4MXW B;  1CAX A;  4CP9 B;  1C5I A;  4H7L A;  1AYN 3;  1BXH A;  4O9G A;  5T3N A;  3POS A;  5J96 B;  2BNO A;  2PAE A;  2VOW A;  4TZD A;  4QM9 A;  1SAC A;  1C28 A;  2Q1M A;  1LJ7 A;  4YM3 A;  1HV0 A;  5HCF A;  3KS7 A;  3VKN A;  5C8C A;  4XFF A;  1FOD 1;  4D7T A;  1UZ0 A;  3III A;  3VZO A;  1GP4 A;  4Y1Y A;  1S0C A;  4JVA A;  2W1Q A;  3L9J T;  1IS3 A;  3HNY M;  5FP3 A;  5CB7 A;  3S5A A;  2Y8K A;  3O1M A;  5GLZ A;  2BUK A;  1VAL A;  1AX0 A;  1MQT C;  2G19 A;  3GHN A;  2ORX A;  5A1L A;  2Y6L A;  5A3M A;  1CIY A;  4LOR A;  4M00 A;  4LMF A;  2VU9 A;  1UPI A;  2Y6F A;  2ZS6 B;  1RMU 1;  1WW7 A;  1PX3 A;  2ZGL A;  4LK7 A;  3I97 A;  2ZXQ A;  3AMH A;  1WCQ A;  2VW1 A;  3QOP A;  3B5L B;  2UYA A;  3TB0 A;  3GJB A;  3ZN4 A;  4XUO A;  4I30 A;  1XNK A;  4Q4Y 1;  1YFW A;  1F15 A;  1UY2 A;  1AXK A;  1J3P A;  1WLD A;  2JX9 A;  1K42 A;  1VIW B;  4N90 A;  1RUH 2;  3HQU A;  1W06 A;  4YAR A;  1RUD 3;  2VXJ A;  3LEK A;  4R4X A;  3HVD A;  4YVS C;  1YQ8 A;  1LED A;  2R07 1;  1RUG 3;  1LR5 A;  1HDK A;  4NIG A;  1RYY A;  2VMI A;  1H30 A;  1JYI A;  2Z4F A;  5FPU A;  3U37 A;  5CAZ A;  1QDO A;  3OBA A;  4XJ9 A;  3VDD B;  3WX5 A;  3BTZ A;  1O5U A;  1US3 A;  3KV4 A;  5DAV A;  1MQT A;  4AOC A;  1O8S A;  3UET A;  4AG4 A;  4MAD A;  3EYP A;  3IMM A;  1NCR B;  4NR1 A;  5GLU A;  4CU9 A;  5LWB A;  3ILR A;  4HL0 A;  5C9A B;  2NPI A;  4QDQ A;  2C26 A;  3I59 B;  3P5B A;  2KR2 A;  1UF2 C;  1MZ6 A;  3KT1 A;  3B02 A;  2GZW A;  3PDQ A;  2DUQ A;  4GWM A;  4XZP A;  5FY9 A;  3VN4 A;  3EJK A;  2ZX3 A;  2BFU S;  2YUE A;  1SBD A;  2ZX0 A;  4JGZ B;  4RS5 C;  3ZLI A;  2HWB 1;  1S55 A;  2WLP A;  5JPN B;  5BNN B;  2EIE A;  4KWJ A;  4C1X A;  4E4Z A;  3H7J A;  4E2S A;  1R08 3;  5BNQ A;  5I0S A;  2BZD A;  3RZH A;  2RR1 1;  2V4V A;  2HWD 3;  2RJK A;  1QU0 A;  4HXC A;  2A71 A;  1Q56 A;  4NAO A;  3LGR A;  1S4C A;  1WCS A;  4OVE A;  4YVS A;  4NO4 A;  1TG7 A;  1J59 A;  3ATG A;  2ZAC A;  4I2O A;  4RFR B;  1JZ4 A;  4N9H A;  3H42 B;  1EAH 3;  3LOI A;  4JDM A;  4Y24 A;  3OYW B;  1JOJ A;  3AKQ A;  1VBA 1;  3HNM A;  1ZRR A;  1VJ2 A;  5C71 A;  2DVB A;  4MH0 E;  3BU7 A;  1GIC A;  4H7M A;  4B1L A;  4D6R A;  1Z7S 2;  3N9N A;  1ND2 B;  1XB9 A;  1T2X A;  2ATF A;  4Q4W 3;  4TLF A;  3BYW A;  1V6O A;  5E6H A;  3GZT B;  4DO0 A;  5FCC A;  5FBZ A;  2QQV A;  2H0B A;  1VAM A;  2CYF A;  2RMU 3;  1V9U 3;  3DUI A;  5A3N A;  4RS5 A;  1XU2 A;  1AR7 3;  2XKP A;  5FZA A;  4YGE A;  3KCY A;  2WS9 3;  5FKB A;  3EBR A;  2DFB A;  1MS0 A;  1W2N A;  3JD7 1;  4E4H A;  1W8F A;  5DAX A;  1RUF 1;  5EJ1 B;  4Z2A A;  3U4X A;  4OLL A;  3H8X A;  1GP5 A;  1HRI 1;  3DKQ A;  4OUE A;  5FZ6 A;  1DQ6 A;  1ND3 B;  4YG0 A;  4CCL A;  2JEC A;  2A6X A;  1NCQ C;  2YFU A;  4Q1R A;  3N9O A;  2XLG A;  4N43 C;  4QX2 A;  1LHW A;  2EVX A;  4HVO A;  4CXW A;  1QEX A;  4WBB A;  1J1L A;  1UIJ A;  2DTY A;  2R06 2;  4JKL A;  3ZFG B;  1GQG A;  3UV9 A;  2XVK A;  4D94 A;  1H9W A;  5F2W A;  5IVF A;  1KS5 A;  2XPJ A;  4WZC A;  5FY0 A;  3VKF C;  2UWA A;  4N9I A;  1LOD A;  2EXJ A;  2MHF A;  3NKG A;  4I3G A;  3UJQ A;  1VRB A;  1D4M 3;  2WQ4 A;  4NVP A;  5FJH A;  3TN9 2;  2XR4 A;  5LAS A;  3H8O A;  5JXJ A;  5I0D A;  4IE0 A;  4NMI A;  3I2I A;  5DDJ 2;  5A6Z A;  1ZBA 3;  2W5F A;  1LHV A;  4ZPI A;  1O4Z A;  3O1S A;  5AFB A;  5GM0 A;  5B4X A;  1G8W A;  2V09 A;  5LZ6 A;  1TME 1;  3V56 A;  5IVB A;  1PIV 3;  4LUK A;  1PO2 1;  1WLC A;  4IEO A;  5J98 B;  3DL3 A;  2RS5 3;  3C7H A;  4DRV A;  5J36 A;  2XUE A;  5T5O A;  1K5J A;  3H1W A;  5IVV A;  4GMP 0;  2JG9 B;  3DN7 A;  5D2A A;  4AI9 A;  5JXH A;  3OPZ A;  1ULD A;  5EQU A;  2WO1 A;  1NCQ A;  1JXN A;  1VB4 A;  2VE1 A;  3DXU A;  3ETP A;  3IDA A;  3L2H A;  3OJB A;  4N43 A;  3I4I A;  2H0V A;  1WA4 A;  3OCP A;  1AF9 A;  2XJT A;  1X9P A;  4Y4R A;  1RUE 2;  5F6L B;  2PHX A;  3I3Q A;  1MR5 A;  2GC3 A;  4A41 A;  3JU9 A;  1CX1 A;  2WJS A;  2E9Q A;  3ROU A;  3T2T A;  3LSD A;  2V5Y A;  2YXS A;  3ZXJ A;  2Y26 A;  3AYC A;  2FCT A;  3HBK A;  4HVR A;  1RIT A;  1JYT A;  1ZRD A;  3BB6 A;  3RMX A;  2P5B A;  1YJL A;  2GNT A;  3ZMN A;  3NO8 A;  3ECQ A;  2ZZQ A;  4LOT A;  4CDU C;  2L9L A;  3K3O A;  4HOO A;  4Q0Q A;  4E8D A;  5T54 A;  4FCA A;  2TUN A;  4AK3 A;  2EID A;  2ZPX A;  3OGS A;  2XQX A;  5F3E A;  3CLP A;  1O91 A;  4P14 A;  3WW1 A;  1NA1 B;  3D0J A;  2VEC A;  4LIT A;  2ZAA A;  1AYM 3;  1PM7 A;  3WW3 A;  1UWW A;  2CWM A;  2VZS A;  4GB3 2;  4W50 A;  4Y20 B;  4ASL A;  1LEN A;  1NY7 1;  1W03 A;  3PVE A;  1XE0 A;  4LKD A;  5F5I A;  5CAD A;  2VCM A;  1LHN A;  2XL7 A;  4QB2 A;  1V6K A;  1DCS A;  2AYH A;  2CTV A;  1UO9 A;  3RQ0 A;  4Y26 A;  1H6Y A;  3THT A;  5F7U A;  4K1Y A;  1AHS A;  5JLV A;  1G9C A;  1GV9 A;  5JDB A;  3RZL A;  5D21 A;  4KU8 A;  1Y4W A;  2NMN A;  3IB3 A;  4K8F A;  4M0H A;  1ACC A;  2J1V A;  3WF4 A;  3WUC A;  3FFQ A;  4XAE A;  1S2K A;  4OI1 A;  3C7F A;  2VCA A;  4YW5 A;  5CKN A;  1FV2 A;  3KHC A;  1FPN 2;  4B4P A;  5C4W B;  2YC4 A;  3ELN A;  5A32 A;  5JSP A;  4XIO A;  3K51 A;  1AZD A;  1VP6 A;  4HLT A;  1LKN A;  2BNN A;  4CXX A;  2PQQ A;  4LLF A;  2ZHK A;  4XQD A;  2G9G A;  1RHI 3;  1S0I A;  2Q30 A;  3U14 A;  5LY1 A;  3IIA A;  1RMU 3;  2RDS A;  1PNG A;  1MVQ A;  3HEI A;  1FXZ A;  4LOS A;  1SEF A;  1XSR A;  4YM2 A;  5CFC C;  3B3Q E;  3VBO C;  1S0E A;  2HWC 2;  2ZAB A;  3V0A B;  4PLO A;  2WZR 2;  5AVA A;  4DXT A;  3J4U H;  5FZD A;  3ZMO A;  1DQ2 A;  2V4A A;  4NHX A;  4TYS A;  1Q8V A;  3OEA A;  3K4D A;  2QQO A;  4Q0P A;  1LB2 A;  2HYK A;  4NRQ A;  1W6N B;  4HN1 A;  4TXW A;  3B69 A;  3RFR A;  1W05 A;  1KXG A;  1L7Q A;  1VBD 2;  4H55 A;  3FJS A;  4NII A;  3OY8 B;  1CPM A;  4IEW A;  4A3Z A;  1EYB A;  1QY4 A;  1QH6 A;  1JBC A;  1NZI A;  4KI5 M;  2HWF 2;  4IEQ A;  4QHB A;  3ST7 A;  3ZFF C;  5FRE A;  2ZGP A;  1QQP 1;  3DPR C;  1COV 1;  4OI4 A;  2D6K A;  2Y38 A;  3PVO A;  4QX3 A;  1SBF A;  2XXZ A;  4HFS A;  2HWE 3;  5FZO B;  1ZRI A;  3LB9 A;  1OUX A;  1RXF A;  2FDK A;  3PMS A;  4OUS A;  5JVV A;  5A7N A;  4EZH A;  4C8D A;  1WW4 A;  2V5D A;  2VUA A;  3CKH A;  1ZBE 2;  3B7M A;  4AGG A;  3E97 A;  5CFC A;  5JUV A;  5FR3 A;  2ETE A;  3VBO A;  4R9A A;  4RGG A;  4CCE A;  5IK4 A;  1E5S A;  1UY4 A;  2DDU A;  1UMH A;  2VR4 A;  4L11 A;  4XBQ A;  4B4R A;  1H6X A;  3POW A;  4IEU A;  4OHW A;  4DXZ A;  5JOX A;  3BTX A;  1SDW A;  3E5U A;  4WM7 C;  1QJF A;  4CSW A;  5GLV A;  4LBN A;  1PO1 2;  1JHN A;  2H6C A;  4CP1 A;  1MS4 A;  1POQ A;  2RR1 3;  4MO3 M;  1D2Q A;  1EV1 2;  5CZK A;  3ZXA C;  4GD4 A;  4AED B;  1D7P M;  4WM8 B;  3VLB B;  1IG3 A;  4LQR A;  5FZB A;  5BNP B;  1QXR A;  2A6Y A;  4Q0U A;  1KGY A;  3ON7 A;  4IGP A;  3OF1 A;  1QJX 2;  3ZYH A;  5A70 A;  2PHF A;  2VZO A;  1W6M A;  1R64 A;  5ERL A;  3I2D A;  1WUV A;  4C0B A;  3ZFF A;  3DPR A;  5FQ0 A;  1YFX A;  5KHG A;  3IDB B;  3A21 A;  1MZ5 A;  2ZHL A;  2YU2 A;  4YFW A;  5FLJ A;  4AI2 A;  1DYP A;  2ZGR A;  3KWV A;  3KT7 A;  1S2B A;  1OUS A;  1ZNP A;  2D7F A;  4XPV A;  4COY A;  1DYO A;  3U0Z A;  2B46 X;  3MF9 A;  1OOP C;  3JBG 3;  5HI0 A;  3W21 A;  1JYW A;  3FLP A;  3AL5 A;  4E4S A;  5L9R A;  3SIT A;  3IAP A;  5FMD A;  5E88 A;  4ZS3 A;  2QZ3 A;  3GCW A;  5HCH A;  2ARX A;  5DZF A;  4ARY A;  5JSR A;  4WM7 A;  5I0T A;  1CAV B;  4ASK A;  5C70 A;  4X6R B;  2W1W A;  3BIW E;  3POF A;  5A7W A;  1RUF 3;  1K5M C;  2FZ2 A;  2ENR A;  2BPA 2;  1JZ6 A;  1W28 A;  4ES9 A;  3DV8 A;  2Q5T A;  3VD9 A;  3AMQ A;  4M4R A;  4RR3 C;  4QKB A;  4YNI A;  3WP5 A;  3FX3 A;  1ZZ7 A;  1WD4 A;  4AHW A;  5CVR A;  2WII B;  3WZ1 A;  2VME A;  1CAU A;  1VBC 2;  3MPB A;  1O4Y A;  2CV6 A;  1J1T A;  3GF6 A;  3MID A;  4YVW C;  3ZYG A;  4CRQ A;  3UGG A;  5K0U B;  2EXK A;  4KBZ A;  5BYN A;  2HBU A;  1YUD A;  4FPC A;  5APA A;  1OSG A;  2NYY A;  2JB8 A;  4MX3 A;  4MG2 A;  4NHK A;  1W9W A;  4GQ7 A;  1FV3 A;  2I2S A;  1HXS 2;  1QHD A;  1OOP A;  4N53 C;  1RUE 1;  5I8S A;  3CJX A;  4D8M A;  1W6O B;  4P5Y A;  2YYO A;  1ASJ 2;  1E57 A;  4EJR A;  2J7M A;  3I2K A;  3HWJ A;  3M2M A;  2C6S A;  3GBF A;  3O1T A;  1PMJ X;  4GAZ A;  2XWB B;  1Q5O A;  3I3D A;  4FXK B;  5FZE A;  4CPB D;  1TME 3;  1OPM A;  2GSY A;  4Y5Z 0;  4XDQ A;  2AEZ A;  3AXD A;  1XE8 A;  5L9B A;  4UWD A;  3WV6 A;  1DGL A;  4DIN B;  5I8Y A;  1JU4 A;  1QOS A;  2DUP A;  4JDO A;  4DNY A;  1W9Y A;  3AP9 A;  4RR3 A;  4DZG A;  5KC5 A;  2W87 A;  4JX0 A;  3KF3 A;  4LK6 A;  2RDR A;  5IK7 A;  2BTV C;  4YVW A;  2RS3 1;  3FLT A;  4QQP A;  1JYN A;  2NP0 A;  5GZD A;  5FP8 A;  3LDK A;  1TNR A;  1MEC 3;  2RS1 3;  5FXV A;  2ZTN A;  1RVF 1;  3WVJ A;  1W3V A;  2VQU A;  3NJY A;  4KG8 A;  3THC A;  3O1U A;  1H4G A;  3B9I A;  2EAA A;  4K1Z A;  3WNX A;  4N53 A;  3R6S A;  2DBI A;  3FE5 A;  1UYP A;  1BKZ A;  2WNV C;  1GSL A;  1ONA A;  1XYO A;  2YBS A;  1VE0 A;  4NPL A;  5F3C A;  4BLI A;  4XUT A;  2XJV A;  2JWP A;  1SLC A;  3POE A;  4ZHN A;  1HRV 2;  3E1F 1;  4L9B A;  1SPP B;  5T52 A;  2ZGQ A;  3GCX A;  2XHK A;  3R0R A;  3N35 A;  3MO4 A;  2ZGT A;  3RGB A;  3S30 A;  3O0V A;  1LGC A;  2BGO A;  2Z42 A;  4M3C E;  4NHY A;  4CPB A;  4IEV A;  3VGI A;  3WXP A;  2CY6 A;  2UYB A;  4QHZ A;  2ZHM A;  2XL9 A;  4DXS A;  1KS4 A;  3KSC A;  1UYZ A;  2VBB A;  1FOD 2;  3JQW A;  3IDC B;  1G7Y A;  4GXL A;  2HWC 1;  3HMY A;  1HKD A;  4GA9 A;  2BOJ A;  4QXH A;  3RVH A;  3MFA A;  4X8P A;  4XYX A;  2QQW A;  4XDP A;  3QBQ A;  1PNF A;  1W6P A;  2OXB A;  2DU0 A;  3RMY A;  4BZ4 A;  2ARA A;  3LEM A;  3AKT A;  5JI7 A;  5JZG B;  3UYJ A;  5GZE A;  1RUH 3;  5C7G A;  4NRP A;  5FYU A;  1G9F A;  4YM0 A;  2ILM A;  2YZ4 A;  4A7Y A;  4MHR A;  1RUI 1;  1XYN A;  4GMP 1;  1AJK A;  2WNV A;  4Q1P A;  1NLS A;  1DDL A;  2KM2 A;  2EXI A;  1TZO A;  3KT4 A;  2BEO A;  2ZGM A;  3T30 A;  4M01 A;  4BQ4 A;  1YRZ A;  3VZK A;  1L3J A;  2HWF 1;  3H1Y A;  1VMF A;  4Q4Y 2;  4XF9 A;  4YGC A;  3IPV B;  5FUN A;  3MPP G;  4E2Q A;  2Y64 A;  2GH2 A;  2PHW A;  4YG6 A;  1ENQ A;  4LT5 A;  1GZW B;  4MXW A;  4CXY A;  3K75 B;  2GP5 A;  3OBT A;  3BUC A;  4CP9 A;  2R07 2;  3FHQ A;  2CL2 A;  3NST A;  1WMD A;  2JD4 A;  5A1F A;  2ADD A;  1DLC A;  1LHO A;  2R1B A;  4JC1 A;  2PEL A;  4LO4 B;  3NNG A;  4O9E A;  5FIX A;  1AUY A;  3TBD A;  4LA2 A;  4XHX A;  3MW2 A;  1W2T A;  3KVA A;  1P8J A;  1PO1 1;  3VDD C;  4CP0 A;  3ZN6 B;  4OZX A;  4D3W A;  4ZXE A;  4A6O A;  4DRR A;  4PJY A;  1IZ3 A;  1WCK A;  2VOX A;  4YZ3 A;  1OLM A;  1M06 G;  1I6X A;  5F5A A;  1TEI A;  3IMN A;  4NIA A;  5FZ3 A;  2HWB 2;  4XFB A;  3HNB M;  4XFA A;  2GC0 A;  4Q4V 1;  3I3E A;  4JGZ C;  4U2A A;  3LDB A;  3MDP A;  3MBW A;  1CD3 G;  2PXJ A;  1Z7S 3;  4C91 A;  3P6B A;  5KC6 A;  5EYY A;  2RR1 2;  2VAU A;  3ZN5 A;  1H1M A;  1H8T B;  4XMA A;  1TQ5 A;  1W8W A;  3PVB B;  2B5H A;  5D8A B;  1ZRC A;  4IW3 A;  5EFU A;  4AFC A;  1QH7 A;  2A5Z A;  1VBA 2;  4LXL A;  1CZS A;  1PHM A;  4PDW B;  2MEV 1;  4UFH A;  3WW2 A;  2ARB A;  4S2F A;  4ZON A;  5A3P A;  1B09 A;  3RS6 A;  3T0A A;  4LA3 A;  1RTV A;  1VBE 2;  4QU1 A;  3DKW A;  5H9Q A;  3VDD A;  3S57 A;  2PLV 2;  2YPD A;  4JGY C;  3RSJ A;  1NLR A;  1ND2 C;  2HH9 A;  2QCS B;  4FPG A;  4LBQ B;  1RIR A;  3RPQ A;  1LES A;  2JIG A;  1KFU L;  5FO7 B;  3OPW A;  4FPJ A;  2PAM A;  4QHO A;  5FPX A;  5FYM A;  2LW8 A;  4AFB A;  3I59 A;  2BP6 A;  3NNL A;  1C8M 1;  4AAP A;  1DQ4 A;  4LO8 A;  2R06 3;  4MGT A;  5SV5 A;  1OLQ A;  2DU1 A;  3JD7 2;  4AQ6 A;  1OA2 A;  5BNO B;  1DBN A;  4UW6 A;  4QXC A;  5DQ0 A;  1REF A;  4KWK A;  4URT A;  1YIP A;  3RYR A;  1HRI 2;  1OVS A;  2CNA A;  1HXS 1;  4LLO A;  4IV3 B;  3C7O A;  4YG3 A;  3TN9 3;  2BW8 A;  3CZU A;  4ET7 A;  1A34 A;  4CP2 A;  1ASJ 1;  3WDV A;  1X82 A;  1GNZ A;  3L2Y A;  3D3A A;  5DDJ 3;  1ND3 C;  2FHR A;  1PK6 B;  4WVV A;  4DFS A;  2FZ1 A;  2ZAH A;  3UJO A;  4DXR A;  4E27 A;  1ZZC A;  4LHK A;  3C3V A;  4XUR A;  3VHO A;  1W8U A;  4YPJ A;  3JZV A;  5F6K A;  4JGY A;  4XF0 A;  5F37 A;  4AFM A;  1OKQ A;  2B39 A;  1ND2 A;  2WWS A;  2A70 A;  3PVN A;  1XNT A;  2AZ5 A;  2QTW B;  4AQ2 A;  3MLL A;  1VBB 1;  4QX1 A;  5FZ7 A;  4ZZ5 A;  5FOJ B;  5CG9 A;  2ET7 A;  4AQT A;  2RJL A;  3KZ4 C;  3S5Q A;  2VCC A;  4LNV A;  3T08 A;  5JCT A;  1W8N A;  4FT8 A;  4PF1 A;  3ZYI B;  4AYU A;  5JWP A;  1RUE 3;  3C2U A;  3VBH B;  1HX6 A;  5FZM A;  2I45 A;  2QVS B;  1HB2 A;  2DCZ A;  4XC9 A;  4F3J A;  1PO2 2;  1PZ9 A;  2QDN A;  2WA3 A;  5FY5 A;  4BE3 A;  3W5M A;  2D6M A;  2RE9 A;  4XUP A;  2GC2 A;  1F31 A;  1XNA A;  2E7T A;  3J9S A;  5LA9 A;  2WN3 A;  1ND3 A;  3ITQ A;  4FFF A;  3ZYR A;  3ACG A;  4CU7 A;  1LGN A;  1DIW A;  1JMU B;  4O61 A;  1E5H A;  5LY2 A;  5FPV A;  3O0W A;  5LW9 A;  4J25 A;  5FMO L;  1MZF A;  3AFG A;  5JOW A;  3TEZ A;  2CAU A;  3N7L A;  5CKM A;  2DVG A;  3I2J A;  2VW2 A;  4GB3 3;  2Q8C A;  3OB8 A;  3ILF A;  4XUQ A;  1F35 A;  2LAL A;  4IE4 A;  1J3R A;  1JW6 A;  5FZ1 A;  5LBE A;  1GNY A;  1ULF A;  3GAL A;  4QPY A;  2YU1 A;  3H0O A;  2Q1F A;  3FMG A;  5FPA A;  4KH9 A;  3USS A;  1RC6 A;  3CHX A;  4NPM A;  1H2N A;  4AGR A;  3KQ4 B;  2BGP A;  4XJW A;  5J7M A;  3ZOI A;  1VB2 A;  3PIG A;  2A73 B;  4BJ0 A;  2DCK A;  4IGQ A;  3WOG A;  3NNJ A;  5ANN A;  2PTM A;  1NY7 2;  3THP A;  1NA1 C;  5JOZ A;  3LD8 A;  2R0H A;  4FOW A;  5DAQ A;  1FPN 3;  4GJY A;  5F2S A;  2OYZ A;  4AR2 A;  5IK5 A;  2CDP A;  4JAA A;  5DZG A;  2BBV A;  1F4H A;  4FP2 A;  3T0B A;  1OFS A;  5DN2 A;  1F9K A;  2X10 A;  3DF0 A;  2D43 A;  3J7L A;  4OHX A;  3OUI A;  2ZJC A;  1LOF C;  4FVV A;  5FYC A;  1N1S A;  3AKR A;  2JE9 A;  3CDZ B;  3MHZ A;  4I0A A;  3DCQ A;  1WBF A;  5DUV A;  4RQP B;  1U12 A;  4EN7 B;  3ZYF A;  4FAH A;  5FZH A;  1NT0 A;  3A22 A;  2HWC 3;  2QQK A;  2WDB A;  2XBO 1;  3NAP B;  2WZR 3;  3N36 A;  2WWJ A;  4XXA A;  1W6Q B;  2HEY F;  2BWA A;  3EQE A;  4P9W A;  4B7E A;  2OVU A;  2WFP A;  1N1V A;  1OPO A;  1MZE A;  1U5X A;  2K9Z A;  3W20 A;  4D0Q A;  5JR2 A;  1POV 3;  4R9C A;  5C4W C;  1BBT 2;  5IVC A;  1JZ8 A;  4NHL A;  4FOQ A;  3VZL A;  4CE8 A;  5EJ3 A;  5LRR A;  4IDZ A;  1VBD 3;  4GMP 3;  3WNM A;  4BDV B;  1X8M A;  1G9B A;  3ZXL A;  4YW3 A;  2JDZ A;  5GKA C;  4ZY9 A;  4IGO A;  2X53 S;  4K3U A;  4W4Z A;  1NUK A;  4HSL A;  1NA1 A;  3VDC A;  4MGY E;  2YGM A;  3HQR A;  2HWF 3;  3NVC A;  1LOC A;  5FRA A;  4DPN A;  1V6I A;  3N9L A;  5IW0 A;  1EP0 A;  2JD9 A;  4EN9 B;  1LEM A;  1LOF A;  1W0O A;  4V2V A;  3HQX A;  5LCW L;  5DXD A;  2JDU A;  2NLR A;  3RI8 A;  3D8C A;  1U0A A;  1ZBE 3;  3P3P A;  2IVI B;  1CQ9 A;  1OLM E;  3M4F A;  2UUR A;  1KD7 A;  2BVV A;  1C4R A;  4AVC A;  1NYW A;  2WQZ C;  1QQP 2;  1SLT A;  1COV 2;  3NNF A;  5FYY A;  2IXI A;  3J7M A;  3SLI A;  5ABJ C;  5G05 L;  1PO1 3;  3ZSM A;  5C4W A;  3K48 A;  5E8A A;  1EV1 3;  4BXS V;  3IWZ A;  4LBL A;  2PHU A;  2TEP A;  2VM9 A;  2YB7 A;  5HCB A;  5F8P A;  1DF0 A;  2GAU A;  2QBX A;  3NV1 A;  2ID4 A;  2YY1 A;  1D4V B;  4R8H A;  3WHT A;  1XSQ A;  2P4E A;  4YZ5 A;  1W8T A;  1VBE 1;  1XOY A;  2PLV 1;  5FY8 A;  1QJE A;  2WNU B;  1HQL A;  1QJX 3;  1CR7 A;  1XNB A;  2WAA A;  1AR9 1;  3M3E A;  5E16 A;  3SCH A;  4EN8 B;  2ZHN A;  4FTB A;  2XUM A;  1DGW X;  4LO6 B;  1R09 1;  4QPI C;  5BUV A;  5FOB B;  5GZG A;  1X50 A;  1LHU A;  3GNE A;  1H0B A;  5EXO A;  4ZU4 A;  2YC2 A;  2RM2 1;  3KQR A;  4RD7 A;  4M3C F;  2VVE A;  2E7A A;  3I49 A;  4LPL A;  1AL0 G;  3C7E A;  2VZP A;  5KHH A;  2FDJ A;  1B35 C;  1MVE A;  1HJG A;  5BY5 A;  2XON A;  4PLM A;  5FXW A;  3KV6 A;  5FYZ A;  4FQZ A;  4QX0 A;  4I09 A;  4ARX A;  5FUI A;  3H9A A;  1MAC A;  1UOF A;  4LIU A;  3AC0 A;  2LUW A;  3AYD A;  5ABJ A;  4Q26 A;  2RG4 A;  1U5Z A;  4IL7 A;  2IXK A;  1HV1 A;  3GGL A;  5FZG A;  3RNS A;  5L19 A;  1JUH A;  2ARE A;  2PA7 A;  4HPK B;  4NAM A;  4KQ7 A;  3MV0 1;  2HEV F;  3RJ2 X;  1BQP A;  5A7P A;  5A33 B;  1W8O A;  5IFP A;  3ZM8 A;  5B2G B;  1UOG A;  4MGS A;  5FLH A;  5J3U A;  4MGI E;  3VL8 A;  1VBC 3;  4KGG A;  3WG4 A;  1U5I A;  1V00 A;  5A80 A;  1DGR N;  4RN5 A;  4XDO A;  2W2I A;  2W46 A;  4K21 A;  5KWR A;  4YZ1 A;  5TSW A;  1QWR A;  4LBO A;  1D0H A;  4LKF A;  4QPI A;  3WD5 A;  4Y22 B;  3VBR C;  1LOB A;  4QDS A;  2YPJ A;  1RUJ 1;  2BVB A;  4RYD A;  4Q8L A;  2UU8 A;  1IG0 A;  2A3X A;  4UOJ A;  3MV1 1;  4ISQ A;  1MS1 A;  3H7Y A;  1VRH 2;  1C8N A;  1HXS 3;  1Q43 A;  2XJU A;  1Q8S A;  4BM8 A;  1QOO A;  3AK0 A;  2VTX J;  2JIC A;  3VBU C;  2XH6 A;  4QPG B;  1B35 A;  5T55 A;  1G9D A;  1OQ1 A;  1ASJ 3;  3TEX A;  5C5T A;  3LAG A;  4P5H A;  3LIH A;  4QX5 A;  3PU8 A;  4MGQ A;  5L7O C;  3WDT A;  2VO5 A;  1GBG A;  4RL7 A;  4COU A;  4HET A;  2C0Z A;  5A1A A;  1MS8 A;  3LA3 A;  4Y33 A;  5K0U C;  4XE9 A;  3GBW A;  4CCK A;  5CG8 A;  3PIJ A;  1S0F A;  3ACL A;  1AVB A;  3FHI B;  4XF1 A;  1SG3 A;  4Z1V A;  2X09 A;  2ZGN A;  3J7N A;  2E7Q A;  4A7K A;  1ZX5 A;  2KD7 A;  3U1X A;  1US2 A;  2FBE A;  3RYK A;  3AP7 A;  1C1L A;  1N3Q A;  1DG6 A;  4QKF A;  2ZML A;  1BEV 1;  4IES A;  4P9G A;  3VBR A;  1JI6 A;  5SV8 A;  3ZIW A;  5AC9 1;  3WG2 A;  4BK4 A;  4CDW B;  1ZVF A;  3E6D A;  5FYH A;  2NM1 A;  4XIK A;  4HBN A;  1L7L A;  1NQD A;  2JXA A;  1W3X A;  3S6P A;  3AXE A;  2WQ8 A;  3ACH A;  2Q8E A;  3VBU A;  4AHX A;  3VDB A;  2W47 A;  5JMO A;  2BGC A;  2RS3 2;  2W9X A;  4CA9 A;  2CWS A;  2FMY A;  4LTA A;  5FZ8 A;  5JIA A;  2GN3 A;  1DYK A;  2VNG A;  1J83 A;  1HRV 3;  1UL9 A;  2XB6 C;  4DS0 A;  5A3L A;  5L7O A;  1NE6 A;  4K8R B;  1W04 A;  3U10 A;  5C5U A;  1RVF 2;  5GZC A;  1PVC 1;  1TMF 1;  5K0U A;  2PHR A;  5C3P A;  4UW4 A;  1UYY A;  2R04 1;  4XF4 A;  2C9A A;  4JHZ A;  3AJY A;  4BXF A;  3R4U A;  2JEN A;  1MQT B;  2WWU A;  4AVA A;  3TYJ A;  4XET A;  1H1A A;  3IT8 A;  3KCX A;  3MW3 A;  4JRA A;  2J1E A;  1FOD 3;  1TE1 B;  3CEW A;  3E5Q A;  1U5Y A;  3HN3 A;  4PIY A;  4AFD A;  4XJA A;  2VJX A;  3PJQ A;  1GZC A;  2DVF A;  4YYO A;  1LCL A;  3PME A;  4DY3 A;  1UNB A;  2CGO A;  2E32 A;  2H6B A;  4XEZ A;  3SCG A;  3ZFE C;  4CDU A;  1QKQ A;  2E6V A;  5FLI A;  1EPZ A;  1UY1 A;  1BBT 1;  1BZW A;  2OZ6 A;  3MLK A;  3D4K A;  4IV1 C;  4I02 A;  2XLF A;  3HIF A;  1G86 A;  3OUJ A;  3X29 B;  2JDN A;  2WUH A;  3FBY A;  3FN9 A;  3VD5 A;  1KRI A;  3F95 A;  4FPL A;  4Q27 A;  1IOA A;  4K9S A;  3VBF B;  3NJV A;  1SCR A;  3V0B A;  3RYP A;  2DFC A;  2VNR A;  3SEP A;  4AI0 A;  3LF7 A;  4YVS B;  1YQC A;  1W9T A;  4Q4Y 3;  4DY5 A;  1WKY A;  4B1M A;  4HK8 A;  2XLA A;  3ZYP A;  1GWL A;  5IT6 A;  3MIE A;  1DZR A;  4YW6 A;  2VQA A;  4GWJ A;  3EB7 A;  1UMI A;  3I54 A;  3KLS A;  4UBH A;  4F83 A;  1KFX L;  1OXC A;  2JIJ A;  4QQ2 A;  2DUO A;  3WEZ A;  4FAG A;  3JQX A;  1O5L A;  1RUI 2;  2Q4S A;  3K2O A;  5JZG C;  1UY0 A;  2LTN A;  1R1Z A;  2R07 3;  2QQM A;  2YMZ A;  3T1L A;  4P9Y A;  4CUG A;  4HSJ A;  3ZYB A;  4AVS A;  5FZ4 A;  1IQA A;  5M0T A;  4A42 A;  2D5H A;  2LRO A;  2BV4 A;  4QDR A;  3ZFE A;  1LU2 A;  4IEY A;  3AZW A;  1FMD 1;  2NMO A;  3N3H A;  4IV1 A;  2JKB A;  3ZO0 B;  3AMN A;  5A7O A;  3RWK X;  4QX8 A;  1AR8 2;  4FO9 A;  1V6M A;  1YIF A;  5IAX A;  4I01 A;  2A6Z A;  4LEJ A;  1N1Y A;  5L9V A;  4XIL A;  1XC6 A;  3O1R A;  1M4W A;  2EIG A;  3JB4 C;  5JOY A;  2HWB 3;  3LOB A;  1NE4 A;  4O65 A;  4CDQ C;  1F5F A;  1SCS A;  2XQR A;  5FPZ A;  4O7X A;  4BME A;  4Y1Z A;  2A7A A;  1W99 A;  4MHU A;  3WNO A;  4MV2 A;  4XUN A;  1UKR A;  1JH5 A;  5FFO C;  3LEI A;  1ALY A;  4E4D X;  1O8P A;  1C5H A;  4CU6 A;  3EMR A;  1ULE A;  2R49 A;  1HQW A;  4MUV A;  4BIS A;  3I2F A;  1APN A;  4GH4 C;  2J1A A;  3BOD A;  5JZG A;  2TBV A;  2WYF A;  4XFC A;  4BPZ A;  5LEK A;  3NQH A;  1XNC A;  2IWG B;  1PZ8 A;  5DZE A;  2PMW B;  2FD8 A;  1C3H A;  1VBA 3;  2ZEZ A;  2Y33 A;  4Q4V 2;  4AI3 A;  2CGP A;  4J6G A;  3Q8F A;  1N1T A;  5E1R A;  3H1M A;  2VNO A;  2XGX A;  4Q4X 1;  1VBE 3;  1IPS A;  2VMG A;  3ILN A;  3M7A A;  2BDR A;  2PLV 3;  3WF3 A;  4FSJ A;  1GOF A;  3CQO A;  5IAT A;  2D93 A;  2MPF A;  3IPV A;  2XDV A;  4FP3 A;  4CEY C;  1YXW A;  4KNC A;  1N3P A;  1HB1 A;  4FXG B;  4D7S A;  2VUJ A;  5GLT A;  1H8T C;  1NAE A;  1ODN A;  4FTS A;  1GZW A;  3JB8 A;  4A6S A;  5ACA 1;  4Y4Y A;  5FK8 A;  5C3Q A;  4OYU A;  1UOJ A;  5D8A C;  4CDQ A;  2MEV 2;  4CEW B;  1QJU 1;  4GUL A;  2YBP A;  4JV4 A;  3JD7 3;  4YW4 A;  1I5Z A;  1NCQ B;  3SC7 X;  4PDW C;  1LUL A;  4B8E A;  2FDI A;  4I3P A;  2Y60 A;  3ACI A;  3MYX A;  4FPK A;  3POB A;  5KXB A;  4GH4 A;  1ZYB A;  1HRI 3;  1VRH 1;  3KHB A;  5A6X A;  2W95 A;  3BTY A;  1X33 A;  3HJR A;  5LBF A;  2Y6G A;  4H2A A;  2G9F A;  1ULP A;  3APB A;  1OD5 A;  2OPK A;  2GND A;  4CUC A;  1C8M 2;  5J48 A;  2JDH A;  1CJD A;  1LNS A;  1OHF A;  4UFL A;  3LKJ A;  2QQJ A;  5EJZ B;  2WZP P;  2PHT A;  4SLI A;  3SKV A;  1STM A;  1BMV 1;  4Y1X A;  2OA2 A;  4CEY A;  1VAK A;  3VDA A;  1RJ8 A;  3H50 A;  2IFW A;  1S0G A;  3T4H B;  1H8T A;  3MW4 A;  4EV0 A;  4OHY A;  2WC2 A;  1RUJ 3;  2G4I A;  3KD4 A;  4QQO A;  1ENS A;  4ZXK A;  5D8A A;  1XQN A;  3WDX A;  2JG8 B;  3NV3 A;  3HBZ A;  4BCU A;  4F7Z A;  1WWY A;  4BU2 A;  4BYY A;  1A8D A;  3B01 A;  3LSE A;  2JDM A;  4N7I A;  4AVB A;  4PDW A;  2UWB A;  4CTE A;  1WLT A;  1K5M A;  4CUB A;  1PO2 3;  2O8Q A;  4YLZ A;  5FZ9 A;  2B9V A;  4N7U A;  2D98 A;  5L36 A;  1LTE A;  1YYN A;  3VZM A;  1W2U A;  1VBB 2;  2ZGS A;  1X9T A;  2D97 A;  3W59 A;  4M3C B;  5C3R A;  2GMM A;  2VBD A;  4XZU G;  3LEG A;  3BTA A;  1H9P A;  4LBQ A;  2D6O X;  1I3H A;  1O3T A;  3CNA A;  4P9L A;  5F32 A;  5FPB A;  1C57 A;  5FDB A;  2R30 A;  5A32 B;  2VQ0 A;  1SZB A;  2W1U A;  4P00 B;  4R9B A;  3NJX A;  1OQD A;  4YM1 A;  3A23 A;  3T3Y A;  3I2H A;  2W1S A;  1OKO A;  3VBH C;  2V73 A;  1JUI A;  1SHW B;  3VB9 A;  4L92 A;  4BMB A;  2GDF A;  1Q8Q A;  1YI7 A;  3PUH A;  4BIF A;  3LE0 A;  4QQL A;  2B8M A;  4Z2W A;  5AC9 3;  5FXX A;  1IKP A;  5AVP A;  4Q5O A;  3OBZ A;  3QAC A;  4KWU A;  1A8M A;  1KQR A;  2HBT A;  4OMC A;  1OLR A;  2F4P A;  2VW0 A;  2X5I C;  2E33 A;  3OEB A;  3ZXF A;  1MS9 A;  1F2N A;  1OF3 A;  4G4F A;  1TVG A;  5FYV A;  3BPS A;  1GUI A;  4AWD A;  3MIH A;  2K0G A;  1SDD B;  1J3Q A;  2OZJ A;  1ZRE A;  5T5P A;  2WYS A;  1BK1 A;  4HKL A;  2XKO A;  4FTE A;  3O1P A;  4H14 A;  2A6V A;  1JZ3 A;  3AZX A;  4AEK A;  3ZXD A;  4ASM B;  3FZ3 A;  4FPY A;  4MGK E;  2GC1 A;  4JKK A;  4UT5 A;  1VPH A;  2G1M A;  2RJ2 A;  4YW1 A;  3RZZ A;  1O3S A;  3CF6 E;  1XXN A;  2VL4 A;  4Z82 A;  3N9M A;  3S7I A;  3O14 A;  2ZEW A;  1ZZB A;  3FWE A;  1UOB A;  4XMI A;  4K7J A;  3B9C A;  1UX7 A;  3LIG A;  1NQJ A;  3T4V A;  4C1W A;  4DEQ A;  5LBB A;  3VBH A;  2BFU L;  4PBP A;  2DV9 A;  3ZKU A;  4NHM A;  2IUW A;  2P3Y A;  4X6Q B;  5FY7 A;  3PUA A;  1Q8O A;  1Q3E A;  2VMF A;  1GLH A;  5FZ0 A;  4YSF A;  4XBL A;  5IVJ A;  3ORJ A;  2VMD A;  4BLJ A;  4QU2 A;  5CFC B;  5FO8 B;  4EE2 A;  3AZY A;  3IN9 A;  4XXP A;  3FUO A;  1Z0H A;  2LM3 A;  2P3J A;  4IE6 A;  4COV A;  2O14 A;  3ZIX A;  1BBT 3;  4HZF A;  4MXV A;  3QH6 A;  4D6S A;  2X5I A;  2JDP A;  1RUD 1;  1RUO A;  2OW4 A;  3HR9 A;  2V72 A;  1KEX A;  3VKL A;  3M3I A;  1GOG A;  1RUG 1;  2XBO 2;  3FUQ A;  1OA4 A;  3NWK A;  2RHP A;  5IUQ A;  2GH8 A;  2IFR A;  4XAC A;  2C24 A;  3VHN A;  1AR8 1;  1LU1 A;  2X05 A;  1FYU A;  3IBM A;  3NAP C;  2AUY A;  2EIC A;  3N4M A;  4UFJ A;  1W6M B;  3BU0 A;  1G6N A;  2A1X A;  2Q0A A;  3E5X A;  3ZFF B;  3DPR B;  1ZM1 A;  3H8R A;  3M3Q A;  4ERO A;  1ZZ6 A;  3OUH A;  1K12 A;  4LUM A;  1W39 A;  1QJZ A;  2JB4 A;  1LAJ A;  1HJF A;  4ORF A;  1GQH A;  4GKX A;  3MF6 A;  3TNQ A;  3T2P A;  2I07 B;  5EWS A;  1NCR C;  1H2M A;  1QQP 3;  1COV 3;  4R9D A;  4FPO B;  4OUL A;  1KJR A;  3R4D B;  5C9A C;  3HN1 A;  3UES A;  1R08 1;  4XAA A;  2VZV A;  1BYH A;  4A2U A;  4LKE A;  1PGS A;  3AL6 A;  1PMH X;  2R0F A;  3BPZ A;  4IE5 A;  4WM7 B;  2HWD 1;  2HEW F;  5JR7 B;  3AP4 A;  4EWE A;  3CMG A;  3SQO A;  3GDB A;  1CAW B;  5BNN C;  1YHF A;  4JZR A;  4AE2 A;  1RB8 G;  3BN6 A;  2VZR A;  1NOV A;  2P3K A;  2WZE A;  3OGJ A;  3VD7 A;  1OFN A;  3VBS B;  5F1R A;  1EAH 1;  5K9Y A;  3E6B A;  3HAG A;  4XFI A;  1QXP A;  3NAP A;  3CJI B;  3EXU A;  3SEE A;  2PHL A;  1CAU B;  1UAI A;  4Q0S A;  3A7Q A;  2P6H A;  3WHU A;  4UF0 B;  2D6N A;  3DYP A;  4KMQ A;  2VY0 A;  1N47 A;  3HPN A;  4KG0 A;  2XVL A;  3ES4 A;  4YW7 A;  3WLU A;  4BHP A;  5K7P A;  3OPT A;  4Q4W 1;  4CCO A;  3H3Z A;  3AM2 A;  1F4A A;  2Q8O A;  4DUW A;  4V2W A;  2JE8 A;  5HCA A;  1H2L A;  1H8V A;  1CN1 A;  1ZA7 A;  1AR9 2;  3AMM A;  1XPW A;  1V9U 1;  4XCB A;  4Z07 A;  4C0H A;  3PLQ A;  5DG1 A;  1O59 A;  1NCR A;  4AI8 A;  1R09 2;  1VLN A;  1DZT A;  4HG6 B;  4Q0V A;  1WZX A;  3ASI A;  5C9A A;  2FDH A;  1IS4 A;  2WS9 1;  2RM2 2;  3DEC A;  5I0U A;  2A6W A;  2XJS A;  3ZXG A;  3OGR A;  1NX9 A;  4LKS A;  4JGZ A;  3SCF A;  4FFG A;  4GWI A;  4QX7 A;  3PJY A;  4PLN A;  3WCR A;  5BNN A;  3FFZ A;  3N7K A;  5A7Q A;  4W65 A;  4EYU A;  5FMC A;  5DUX A;  3VHP A;  1ULO A;  5KR7 A;  1UYX A;  1Y9G A;  2ARC A;  3EO6 A;  4RR3 B;  1LGB A;  4BH9 A;  5LAT A;  3POJ A;  1IS5 A;  2DCT A;  4BQ1 A;  1PM4 A;  2VXR A;  1YC6 1;  2O8O A;  1FX5 A;  1JU3 A;  2X29 A;  1YNA A;  5FYI A;  5KHJ A;  5FP7 A;  5LBC A;  1VRH 3;  3OYW A;  4Y1V A;  5C8W A;  3WW4 A;  1VMJ A;  3KF5 A;  3M3O A;  2VZ1 A;  2AR6 A;  3ZFG C;  2W92 A;  1OH4 A;  3S0M A;  4GAL A;  4MYE A;  5FKC A;  4R52 A;  1ZBA 1;  2VGD A;  3ME2 A;  3AVR A;  2CSG A;  1QJY 2;  3P1I A;  1RUJ 2;  3CIH A;  2XJQ A;  5A6Y A;  4XTP A;  3ZX7 A;  3MIG A;  4HAN A;  1Y9M A;  1PIV 1;  3BAL A;  3NW4 A;  4OHV A;  3H8U A;  2RS5 1;  4QB1 A;  4IE7 A;  3WNL A;  3DXT A;  1AR6 2;  1DQ0 A;  3LPF A;  2ZEX A;  5GZF A;  1UW8 A;  2P3I A;  4ZU7 A;  3UKT A;  3UGH A;  2OUH A;  4XFG A;  4QPG C;  2WT0 A;  1ENR A;  1YEW A;  1IKQ A;  1QGL A;  2YGL A;  3ZXK A;  1XU1 A;  1S0B A;  3OD4 A;  5B4N A;  2JG9 C;  3USU B;  3SHR A;  2J22 A;  4IER A;  2D3P A;  3AYA A;  3MEP A;  4ZS2 A;  1PZ7 A;  1IHM A;  3A0K A;  3NL1 A;  5F3I A;  5I93 A;  1OC1 A;  3NMB A;  4KBB A;  4N8M A;  1W6P B;  3GJA A;  1F5J A;  3BVC A;  4HPK A;  3O7O A;  5A33 A;  1X8E A;  4UAP A;  3ZFG A;  1W9S A;  2IVJ A;  2QZ2 A;  4D6Q A;  2RS3 3;  1KIT A;  1UY3 A;  5CFD B;  1XE7 A;  5EV7 A;  1BEV 2;  3UKN A;  3OOX A;  4PI0 A;  2WNV B;  5AC9 2;  1A3K A;  1RVF 3;  4XFH A;  4OI0 A;  1UKG A;  1QOT A;  4R4Z A;  1AYM 1;  1W2A X;  3WDU A;  4CDW C;  1W90 A;  5K8S A;  4QQH A;  1XJA A;  2W0X A;  1G9A A;  3SH3 A;  3NJZ A;  4LHL A;  2D40 A;  3B00 A;  3BCW A;  3E6C C;  4QWN A;  3WQB A;  1IPK A;  2IXC A;  5AFE A;  5KXC A;  4ATF A;  1QNW A;  4QPG A;  1PX4 A;  2K46 A;  4L99 A;  2NN8 A;  2E53 A;  2JE7 A;  4NPR A;  3SH5 A;  2VG9 A;  3LDR A;  3P3N A;  2UY9 A;  3PUQ A;  1ZA4 A;  5CU1 A;  1PVC 2;  1TMF 2;  2ZMK A;  3M8L A;  3A4U A;  2JG9 A;  2D3R A;  5IVE A;  1HW5 A;  4KGQ A;  2EAL A;  3OD0 A;  2R04 2;  4MSV A;  2LRP A;  3H3L A;  5J09 A;  3U07 A;  5J37 A;  4OZO A;  1UN1 A;  2GNM A;  5CYY A;  4BQ3 A;  2BWC A;  1DGW A;  3AKS A;  1LOG A;  5EZW A;  4B29 A;  3IZO A;  3K77 A;  2TNF A;  2QQI A;  4Y5S A;  2JKX A;  1RHI 1;  4NIH A;  4JHT A;  3KCC A;  3HT2 A;  1GYK A;  3O0X A;  3URF A;  4BOW A;  2BU9 A;  3ZSE A;  2WSV A;  5A3O A;  4CDW A;  2Y6J A;  2QFE A;  4NWV A;  1QMJ A;  1IPJ A;  2ZX4 A;  2D6L X;  1CES A;  1RUI 3;  4QD2 A;  3K4A A;  3NV2 A;  4XQ4 A;  1E5I A;  4YGD A;  2WO7 A;  4W6Y A;  2B9U A;  3K3N A;  3N7J A;  3OBR A;  3RDI A;  1E5R A;  3GZA A;  4IXL A;  5DMY A;  4HK9 A;  3VBF C;  1DU3 D;  5GJ6 A;  2FMD A;  4Y20 A;  1S1A A;  1RGS A;  5IJR A;  2ADE A;  3D5O A;  3UL2 A;  5JXI A;  1BVP 1;  2DBN A;  4Q8K A;  2QQU A;  3ALQ A;  2YV8 A;  2UWC A;  3TEW A;  1FT9 A;  3KV5 A;  1SMV A;  1UZW A;  2NQY A;  4IQP A;  4ONU A;  2ZGU A;  4PQ9 A;  1AR8 3;  3WSO A;  3EHK A;  4CVU A;  4WVM B;  1KDK A;  5F9T A;  4XJ8 A;  5C3O A;  3J8F 2;  5FWE A;  4KL1 A;  3ZSJ A;  3VV1 A;  2GP3 A;  2O1Q A;  1UX6 A;  2AC1 A;  2ZCW A;  2HWE 1;  4HKO A;  2JDY A;  4CDX B;  1AXY A;  3RZG A;  1OBN A;  3OTF A;  4KWL A;  1CIW A;  5CKQ A;  4XJZ A;  1JOD A;  3AMP A;  5FK7 A;  5H9R A;  4EN6 B;  1FMD 2;  2VOK A;  1QIQ A;  4QPW A;  2ZZJ A;  3WUD A;  3Q8A A;  1WMF A;  2CDO A;  3J7H A;  4XBN A;  3ETQ A;  4QT6 A;  3M3C A;  3QCW A;  4IEP A;  3SMH A;  2WRA A;  1NXD 1;  4TWT A;  4AVT A;  4AQS A;  4ITC A;  3THD A;  1W8Z A;  4NUB A;  5BPX A;  1UD1 A;  3D82 A;  3SH4 A;  5A3U A;  4Q4V 3;  3VBF A;  1HLC A;  5GAL A;  3ZSK A;  5FZF A;  1YI9 A;  3V0A A;  3CU7 A;  1CWP A;  1AX2 A; 
#chains in the Genus database with same CATH homology
 5A6X A;  4CE8 A;  4UT5 A;  5A3O A;  4AOC A;  1OVS A;  1UQX A;  1UZV A;  2JDY A;  1OXC A;  2BOJ A;  1OUR A;  1OUS A;  2JDM A;  2BOI A;  3ZDV A;  1W8F A;  2XR4 A;  2VNV A;  2JDK A;  2JDH A;  5A6Z A;  3DCQ A;  2CHH A;  2JDN A;  1GZT A;  5HCH A;  5A6Q A;  2BP6 A;  1OVP A;  2VUD A;  2WRA A;  2BV4 A;  2WR9 A;  1OUX A;  1W8H A;  2JDU A;  5A70 A;  2VUC A;  5D2A A;  5A6Y A;  2JDP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...