2JDHA

Lectin pa-iil of p.aeruginosa complexed with disaccharide derivative
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
114
structure length
114
Chain Sequence
ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNETAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILTNELNFALVGSEDGTDNDYNDAVVVINWPLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords FUCOSE-BINDING LECTIN PA-IIL
publication title X-Ray Structures and Thermodynamics of the Interaction of Pa-Iil from Pseudomonas Aeruginosa with Disaccharide Derivatives.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 20
structure length 114
sequence length 114
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07472 PA-IIL Fucose-binding lectin II (PA-IIL)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.400 Mainly Beta Sandwich Jelly Rolls Calcium-mediated lectin 2jdhA00
5A70A 2BOIA 2JDMA 1GZTA 2JDUA 5A6QA 2XR4A 2JDKA 2BV4A 2WRAA 1OVSA 5A6ZA 3DCQA 1W8FA 1OXCA 2VNVA 4CE8A 1OUXA 1UZVA 5A3OA 2CHHA 5A6XA 2BP6A 2BOJA 5HCHA 2VUDA 2JDPA 1OVPA 2WR9A 4AOCA 2JDNA 1OURA 1W8HA 5A6YA 1UQXA 5D2AA 2VUCA 3ZDVA 1OUSA 4UT5A 2JDHA 2JDYA
chains in the Genus database with same CATH superfamily
2JE7A 1JHNA 3LPGA 5A7NA 2O0OA 2WDBA 1VBE1 3VBRB 2QE3A 4A7ZA 1Q5OA 4W65A 1QDOA 5K0UC 2ZTNA 1C3HA 4BMEA 4LO8A 1DBNA 4YZ5A 4AG4A 3PUIA 2XQXA 4AGVA 1W9FA 2ZOEB 1YQ6A 1W8UA 2ORXA 2VQAA 1DHKB 3T1MA 2JDPA 4E27A 4DUVA 5F5CA 1AJOA 1WMDA 1TMF1 2PTMA 3J7NA 1SMVA 2C1FA 3WD5A 4GWMA 1LULA 4PLNA 3E5QA 4UFMA 1AXZA 1PNGA 4FI9A 4AGRA 2MEV3 3I2DA 5DZGA 5CG8A 1YNAA 3JCIA 3J4UH 2PN5A 4RN5A 4Y4YA 2RS52 3FLRA 2GNBA 4I0WB 1H6XA 3LGRA 2WWUA 1C8M1 3ZIXA 3VB9A 3VD3A 1W2AX 3NJZA 2XR4A 3FFQA 2Y6LA 3M1HA 2EALA 2TEPA 3B5LB 3HNBM 4QHZA 4BIOA 3BI3A 1DIWA 3I7DA 4P14A 3S0MA 1F35A 5KWRA 3TAYA 1V00A 2QQLA 1Y9GA 1MEC2 1VB4A 4QDQA 4BQ4A 4BA6A 4Q4Y1 1W6OA 4FFHA 3WNKA 3LFIA 5LBFA 3RWNA 2YC0A 1RVF3 3PIJA 5C3SA 4H7MA 5C3RA 2PXJA 4R8HA 5JXIA 4FPOB 3GJAA 5J1XA 5JXHA 2WNOA 1K5MB 2YU1A 1YQ2A 3KS7A 4GALA 2VR4A 1F4AA 4QPGA 4UBHA 3T2TA 3BPSA 1RUI2 2JKXA 2CDPA 2VTFA 3HMYA 1Q8OA 3DCQA 3LD8A 4XHBA 4F83A 5CG9A 4AFAA 1VMHA 2NZ9A 1W8OA 4JDMA 2CHHA 4CUCA 4QX5A 3C7FA 2B8MA 3RJRA 1OT5A 3FMGA 5CKNA 5LK7B 2UU8A 1MZFA 4QKBA 3AMQA 4O9GA 5C4WC 1RHI1 3AYAA 4U2AA 3T09A 1NLRA 3POJA 2XLGA 3B94A 1J83A 4HOOA 4X8NA 1WGPA 4J25A 3ZYRA 4AEMA 1NCQC 3EQEA 3JUUA 3RZJA 4PT6A 4R9CA 4IQPA 2RG4A 4Y22A 5FZAA 2A7AA 2VZPA 4AHYA 5C5UA 3LIGA 1AL0G 1GWMA 1RUC3 4CCJA 1P8JA 4YWAA 3RDIA 2WUHA 3POFA 4QB1A 4ISQA 4QB6A 2E53A 3KM5A 4XF1A 1HRV2 4FPKA 4ONUA 5LA9A 1W6PB 2K46A 3ACFA 5IVEA 4PQQA 5EYYA 4IL7A 5FXWA 5FO9B 4DQAA 1PO12 5JI9A 1D0GA 4NWWA 4NIAA 4NRQA 4BMBA 4OHYA 2P37A 2HWB3 1ODMA 3OGGA 5JIUA 3CLPA 2RJKA 1YIPA 1AR73 1XC6A 4XABA 4XF3A 5J48A 4MG2A 1HXS2 1EPZA 1N47A 2WSUA 4F3JA 2XPJA 3VBRC 2HWC2 2NLRA 3ACIA 1C57A 5LA0A 1XNBA 3N9MA 5BNOA 4D7SA 2RDSA 3INAA 3OSDA 2VOVA 4NJ4A 4JGYB 2VNVA 4CDWB 3KVAA 4YRDA 3H8OA 1XB9A 3VKMA 2K2SA 3VHNA 3ZYIB 4BU2A 1DYKA 4AHXA 1T6BX 5AVPA 1VBD3 5AVAA 1GP5A 5F3EA 5F3CA 1G86A 1LNSA 3H3ZA 3WQ7A 4YVWC 4WVZA 3HOBA 1AYN1 5FLHA 1PK6C 2Y0IA 1TE1B 3AZWA 1W2TA 2QCSB 1RUOA 1QQP3 3LA2A 4XQDA 2RR12 3ILNA 1MS5A 2VCAA 4WM7B 2R072 4LKFA 1QJEA 5FYBA 3DKWA 2X29A 4FAHA 1HRI1 5I0SA 2QQNA 2ZAAA 1VBB2 1UAIA 1C5IA 4D0QA 3IAPA 4YVSC 4AFCA 3QBQA 1UXXX 1QDCA 3QOPA 5FZ9A 3GDBA 2VCCA 3VKFC 1OFSA 1PVC3 1GSLA 4IGPA 2EVXA 1NZIA 2IWGB 2VZTA 1QEXA 2ZHMA 5GLTA 5HI0A 3NAPA 1KS5A 4QX7A 4XURA 3M70A 2Q4SA 1J58A 4W50A 2A6XA 3S5QA 2FCVA 2GU9A 2XQRA 3NL1A 4PIXA 2VBDA 4AK3A 5JOZA 1ZM1A 1A34A 5BNNA 1RUJ1 4YZ1A 3FJSA 4LULA 3H0OA 2VXJA 1U0AA 1XYPA 3JD71 4CSWA 4AI3A 1ZRIA 1ZBA3 4LBMA 2ZXQA 3OTFA 3AZZA 1YJLA 4LTAA 2Q8OA 2P6CA 3WV6A 3H8RA 1JYTA 5FBJA 3ZFEB 4HKWA 3MFCA 4XJZA 4W6XA 1RXFA 3V56A 3HBKA 1U5XA 1JW6A 3B69A 1PNFA 1NQDA 2VW0A 5D2AA 2W68A 4I2OA 4A44A 1UX6A 1Z78A 3FWEA 3MLKA 2YPJA 1VE0A 2BGCA 5FZKA 4UFLA 4Q4W3 1PO23 4XQ4A 4CP0A 4LBQA 1AJKA 4XQWA 5FZ1A 2JB8A 5T55A 4EROA 4Q4V2 5F39A 1BCXA 4GXLA 4RR3A 4YVWA 1K42A 3CHXA 3THDA 4BK4A 1IG0A 1PK6A 2DUPA 4LMFA 5LWBA 1OI6A 2O14A 3IPVA 5FPAA 4V1PA 1I6XA 2R1DA 1ZNPA 3KGZA 2WFPA 5DDJ2 4LORA 3VHPA 1GU3A 1BBT2 2B9VA 3ZFFC 2HWD3 4QT6A 5F37A 5FP4A 3W5MA 4W8JA 1XE0A 3I3DA 1VBC2 2BEOA 3VBUC 1R082 1EPWA 1NY71 3OG2A 1VALA 2R062 3JB4C 3CJXA 1K3IA 4YVSA 2EXHA 3WSOA 4GH4C 4XUQA 3M8LA 4BQYA 2AZ5A 5HBAA 4FTSA 5DMYA 3KCYA 4LLFA 4BK5A 3JBG3 4XETA 2W2IA 4K7JA 5FOJB 4MGQA 3ZYBA 2D98A 3GCXA 3TEXA 3WG4A 1GOFA 4GMP3 5C33A 4KBZA 3UKTA 4XZUG 3BKZA 1O4YA 3FHAA 4CDWC 4PLMA 1RGSA 2QQKA 5FZ0A 1QJFA 1WD3A 3DEMA 3LSDA 3VBSB 4BISA 4XXPA 5FYZA 4EQVA 1MPXA 3C8XA 2P5BA 1AR63 4LLOA 1ZZ9A 4OHXA 4Q8KA 2WNUC 3K46A 1VAVA 4RFRB 4GULA 1HB2A 1PMJX 2D5FA 2X5IB 2C9AA 1S0GA 1WMEA 2GP5A 4WM7C 1UY2A 2BNNA 1Q8VA 2WZ8A 5IK4A 2V72A 2LW8A 3SXWA 1F8VA 4HT1T 3P3PA 2A6VA 1MZEA 4MZUA 1PMIA 3M7AA 1RIRA 4NUBA 2OS2A 2RE9A 4Q0QA 5IFPA 5KHJA 3BU7A 3ZXAC 5H9SA 3ZX7A 1C4RA 4AAXA 1DCSA 1W90A 4OUEA 4IERA 3RMXA 2G9GA 2NN8A 4TLGA 4XC9A 3VL9A 1UKGA 4Q4Y2 1CR7A 2PHFA 1C8NA 1YFWA 5A32B 5IK8A 3UGGA 5FYSA 4HK8A 4NMIA 1KFUL 2GC0A 5F3GA 3ZFFA 3AK0A 3FC0A 1V6JA 3T2QA 2A1XA 1WW5A 1LOEA 4NPMA 4XFIA 3SHRA 5JOXA 3VBUA 1O3SA 4H2AA 5T5OA 4F8AA 1PMHX 3HD8B 2WS91 4XFCA 5FO7B 4PDWC 4AXOA 1OH3A 4YW6A 4ZS2A 4I3PA 5CEHA 2BBVA 4YG3A 3J8F1 3ZFEC 4AL9A 4ZZ5A 2ET7A 2VH9A 1WLCA 5FCCA 3POYA 3AP7A 4M4PA 4MGTA 3A7QA 1W3XA 1KRIA 3MDPA 5FTTC 1MQTB 4OULA 1MS1A 3E97A 3P5BA 1A3KA 3UGHA 2VY0A 3E1F1 3E6BA 4R52A 3N7LA 1DQ0A 4YPJA 3PL0A 2G19A 4JDOA 1F9KA 1N1TA 4A45A 5GM0A 3MLJA 2X53S 5FJHA 5DXDA 5ABJC 1ALYA 3LZZA 4P08A 1TQ5A 2D3PA 4BPZA 2BRTA 2DU0A 1IS3A 2P6HA 4DXZA 1JZ2A 2XUMA 2BNOA 1QJU1 2R043 4Q1PA 2OA2A 2OIIA 2WNUA 4Q4X3 3PUQA 1WCKA 2VU9A 4CTEA 4NE9A 3CQOA 1UYXA 1Z7S3 5A6ZA 1LGCA 5A7WA 4NWVA 2OX0A 5IFTA 1NXD1 1QXRA 4IGOA 4LPLA 1LOFC 5CFDB 1OQEA 3NQHA 1Q56A 3ZFGC 2R49A 3GALA 4P9WA 1UY1A 4HN1A 4M0NA 3CJIA 3F95A 4YW4A 3ASIA 2E7QA 2X10A 2PLV3 2ZX3A 2VZUA 1UZWA 1W2NA 1W8TA 3F2ZA 3AFGA 3PVOA 2EA7A 2DTYA 2MEV2 3FBMA 4IETA 1UOGA 3K4DA 3RSJA 2JDHA 2YMZA 5JOWA 1IS6A 3FZ3A 2GMEA 4XCAA 5FY9A 3OUIA 2EXIA 1DG6A 2FDKA 4NHXA 5LBBA 4FOQA 5FZ4A 5C6CA 4O65A 4N53C 4RSUA 2VE1A 3EJKA 3SC7X 4AEDB 2LALA 1XNTA 2ZGSA 1S0EA 1YRZA 3L2YA 3KSCA 5FYVA 4GQ7A 4HN0A 4N9HA 1GP4A 1UU6A 3AKSA 4P9JA 4CA9A 3A21A 4MXVA 5IATA 4M3CA 1H30A 1CQ9A 2ERFA 4HKLA 1ZRFA 1XNKA 5FP9A 1W39A 2VZ1A 4IV3C 4NO4A 1BEV3 2RVAA 3AL6A 3GBFA 3H7JA 3LQCA 5FQ0B 2X5IC 4XDPA 1O5UA 1WCDJ 2KM2A 5IVBA 2JX9A 1ZX5A 2HH9A 2DYCA 3KZ4C 1SFYA 4RGGA 3T0DA 5HV0A 5FPLA 4Z07A 4CXYA 2AGSA 1C5HA 2JD4A 4MXWB 4RGKA 4YZ3A 2WWSA 3VGIA 3OPWA 4UYBA 1KDMA 2WA3A 5BYNA 2IVJA 3MBWA 2W92A 2VZSA 1LHWA 3R0RA 4DUXA 3DV8A 3IN9A 5KHGA 4OQ9A 2DBNA 3VZMA 2RS13 1VMJA 5JWPA 3VUOA 2VBPA 4BXFA 3APBA 1HB3A 3AKTA 1LOFA 4L2NA 1VB2A 2ZEZA 1FI2A 1L7QA 1UYYA 2ZGRA 1RUJ2 1UF2C 2XJUA 3EXUA 1RC6A 3ZFGA 4Q1RA 4B1LA 5F1RA 5JXGA 1YYNA 1PGL2 1S0FA 1AR93 1ULPA 3VBFC 1F2NA 2RS51 3IDEA 2W47A 3VBHC 1LHOA 3GBWA 4WM8A 1LR5A 3TEZA 4E8CA 2IXKA 3IZOA 1W3VA 3AYCA 3RZLA 2HEYF 3ZSJA 4LO5B 2B5HA 3FHQA 2VVDA 1HLCA 1MQTC 5L9BA 1QNYA 5LW9A 5EV7A 3V64A 4AF9A 4N53A 3O7OA 2W52A 3WP5A 1LECA 1QHDA 4LIVA 1GWLA 1UKRA 3VN4A 3HJRA 1K5JA 1H0BA 3FN9A 1W6MB 3PIGA 5JLVA 1YQ5A 5FLJA 4BQ5A 1FMD3 3ETQA 3AP6A 2YFUA 2VPVA 4BQ1A 4UW4A 4UAPA 1OLMA 4NAOA 1LOGA 1LENA 1H8TB 1LHUA 4YZ4A 1GMMA 1H2NA 3UJQA 4CDXB 3NV3A 2WRAA 3TOJA 1LOBA 3SH4A 3ETPA 3I2IA 5DUXA 1MACA 1COV2 1RUI1 1K12A 2W1UA 5FY0A 2VJXA 3ZLIA 5CFDC 3OEBA 3M4FA 3WQ1A 4OHVA 1RB8G 2FZ2A 1LTEA 4UI9L 2BNMA 4YM2A 1WLWA 5L36A 1KJRA 3AFKA 2B45X 1Y43B 4LK6A 2VBBA 1NY72 4BQWA 4YGCA 5FMOS 2VGDA 4XPVA 3WDTA 1XJAA 4I3GA 4A6SA 2A6YA 4KH9A 4ZXKA 4N43A 3A4UA 1WA4A 3KMHA 3ILFA 2V5YA 5CKQA 1E57A 2Z69A 5G04L 4AVAA 3C7GA 2H6CA 4RQPC 2ZX4A 3G6JB 1FPN3 1WA6X 4XFHA 1ZZ6A 5T5LA 1CAVA 3BYWA 3PVBB 5B4NA 2Y0OA 3PTRB 2HWE3 1SBDA 3I59A 3OEAA 1CIYA 2WQZC 4CEYC 2IFRA 3WZ1A 4XAEA 2XGXA 4IEWA 3AMMA 2XOMA 1XSQA 4XFGA 3RMYA 3VBHA 1HRV1 1WW7A 2A71A 2J1RA 3MGUA 2F6BA 1NYWA 1PVC2 3C7EA 1PO11 4QDRA 2GMPA 1NX9A 3TRSB 1AX2A 1J3RA 4QWNA 3AC0A 1W8ZA 4FXGB 1HXS1 3I54A 4MOAA 4IV1B 2VVEA 4WVMA 3V0AB 1AR82 1JYVA 3M3CA 2BGPA 2AACA 4LIUA 4OI2A 4UF0A 5FUPA 3L2HA 1ASJ3 3PURA 3NNFA 5IT6A 2XUEA 4JGZB 1BLZA 4QPIB 5J09A 1QXJA 4C0BA 4CEWA 4CE8A 4BQ3A 1VMFA 3MUZ1 4E9KA 2BVBA 2ZEWA 3VDDB 4LITA 3W59A 5LCWL 5IAXA 2HWF2 3LKJA 1ENXA 4KG8A 5EWSA 2XH6A 1YQCA 4GZ9A 5E1RA 4WZFA 4PI0A 2XWBB 5FUIA 3WNLA 4BLJA 3USSA 4QPGB 3WNPA 4FXKB 3TN93 2C26A 1ND2C 1MZ6A 2WT0A 4A3ZA 1S0CA 3KHCA 1GANA 3ZPOA 1CONA 1V9U3 1ZBE2 3A23A 2ILMA 4Q4W2 4P5YA 5L19A 3OF1A 3N9OA 2JE8A 2DVFA 2OQ6A 1GZCA 2VQUA 4OVEA 4QU2A 2GNTA 2I07B 2DF7A 3K4AA 2R071 2WJSA 3R05A 4ATFA 2RM23 2C5DA 2OVUA 3POWA 3NV4A 4LBQD 3ZPYA 4M3CE 3BUCA 4E2SA 1NKGA 3VKNA 1I9RA 4IE0A 4RQPA 1YIFA 1R1A3 3S7IA 2VUAA 2JG8B 4WVVA 3LOIA 3RYKA 1GZWB 1J3PA 2OW4A 3PVNA 5FYMA 2WWJA 1RUG2 1AYM1 4CDUC 1LODA 3ZIWA 1CESA 4CEYA 3MICA 4TWTA 5DAPA 4Q26A 2XG3A 1HQLA 3N7MA 4AWDA 3ALQA 4Q0SA 4AQ6A 3MV01 3JBG2 1OBNA 1H8TC 3WXPA 3WNOA 1QJU2 1A6CA 1GZTA 1CGPA 1W04A 3WDVA 3I2GA 2JB4A 4NVPA 4QKDA 1D2QA 3UL2A 5FZMA 4FPLA 1JOJA 3ELNA 4JKLA 4NPRA 3V0BA 2OKXA 1TMF3 3I3QA 1UU4A 1MS4A 2YBKA 1RUH3 4DRVA 1RUD3 2DURA 2JDNA 3Q8CA 4UBGA 5KBFA 2WZEA 2EXJA 1HJGA 5FYTA 2FBEA 3ZDVA 1E5RA 2PHRA 3CEWA 3HAGA 4I09A 4LJHA 1S55A 4HONA 4B4RA 4D6SA 2D5HA 2CGPA 1C8M3 4XE9A 1EUUA 1NCRB 3N9LA 4IEXA 3WW3A 5C3QA 3ENRA 1FT9A 1HDKA 4P00B 1HV1A 5E16A 3IDCB 1JZ5A 1ND2A 4Q4V1 2JDKA 4Y1UA 2XVGA 1BQPA 2OZJA 1KJLA 1NE4A 1BJQA 3KQ4B 4KWLA 4NRPA 4BH9A 2JDAA 4ORFA 5K8SA 2NM1A 4Y5Z0 2ZX2A 4YW3A 5L7OB 4RHV3 2OPKA 2XJVA 3USUA 4JAAA 5DDJ1 1XU2A 1BBT1 2B4KA 2DCTA 1OLME 1ZA7A 3B01A 1HB1A 4OZOA 4AGGA 1R092 3BPZA 4CP2A 5BNPB 1R081 2FDIA 3JZVA 2R061 3HQXA 4P5HA 4Y20B 5FZHA 4B7EA 4NROA 2WNVB 3GNEA 3HR9A 4ITCA 5A33A 4IV1C 4PJYA 2LS6A 4QXHA 1UN1A 1KEXA 2AH2A 3MV11 4YSFA 4NHLA 2YC2A 1VAMA 1G9FA 1ULFA 4HSJA 2IVIB 4JGZC 1LRHA 4QPIC 3R6SA 1LJ7A 2YV8A 2R0HA 1IS5A 2BDRA 1JODA 3RS6A 2WBKA 2JIJA 5BNQA 4H14A 3VDDC 4XCBA 3O14A 3ZN6A 5IW0A 5BNNB 1RHI3 1UMZA 1WCSA 1KS4A 1X9PA 4YARA 1CAUB 2LUWA 1B35B 1N3OA 1XNCA 3DPRC 2ETEA 2CWSA 2W46A 1OD3A 3K3OA 5BUVA 1ZREA 2BZDA 1ND3B 4TXWA 2QBXA 3M3EA 1X7NA 1QOOA 1BVP1 4NRMA 1NA1C 4QD2A 2PA7A 2WIIB 4IEUA 1W03A 1CZTA 1VRH1 3T1LA 5GJ6A 4DEVA 4ZXEA 1S0DA 4B8EA 2CL2A 1X8EA 3WCSA 1CAXB 1JZ6A 1ULDA 1YJKA 3PU8A 4C1WA 4KI5M 3LEIA 2YU2A 4XF0A 3HN1A 4XDOA 1EAH2 4LBQB 1UMIA 3U14A 2J1EA 3KV4A 3CBNA 1BYHA 4NHMA 2GDFA 2Q1FA 4RR3B 5F32A 3OD4A 4X6RB 4IXLA 5FIXA 2P2KA 2CNAA 5J98B 3SMHA 3IPVB 3O1RA 2Z5WA 1KDKA 1TVGA 3WLUA 2ZHKA 1AX1A 3KVBA 4XILA 3VHRA 5A3UA 5IVVA 5CISA 1RUNA 4OFGA 3H8XA 2IXLA 3LEGA 3PUSA 1S2EA 3J9SA 1F5FA 3H1YA 3AXDA 4I30A 2BTVC 1E5IA 2W91A 2D6PA 1OOPC 1D4M3 1SZBA 3HEIA 4YLZA 4E4SA 1DFQA 2VTXJ 5C70A 3OGSA 2N7GA 5IHRA 2CU5A 5L73A 1AYN3 4MADA 1V70A 4MGIE 5K0UA 5LK5A 5FK8A 4OHZA 3ZSMA 4EWDA 2RS33 2XVKA 3UKNA 1UD1A 4B29A 3RVHA 4M3CF 5JZGB 1L7RA 3EB7A 5A7OA 1JN2P 4O61A 1HRI3 2CSGA 4TLFA 2CDOA 3W9AA 3BU0A 3SH5A 3DPRA 1Q3EA 5I0RA 2VMEA 2VQTA 4XOGA 5FZIA 1JBCA 4N8MA 4COVA 1H6YA 1OVSA 2GN3A 5EXOA 1VAKA 3C2UA 1IHMA 2DTWA 3B02A 2BGOA 1W0NA 2CGNA 1W9SA 5L7OC 3T08A 2BFUS 3N7JA 5FP3A 2DVAA 3SCFA 4QX0A 3WP6A 1RMU2 3AXEA 4C1XA 2DV9A 4CUGA 2QTWB 1OVPA 3WHTA 4EN8B 5AFEA 2EIBA 5KC5A 4NPLA 2RS12 4FFFA 3UV9A 4QX3A 5GZEA 3H8UA 2X05A 2WNVC 1YFXA 1U5YA 1N3QA 2XWJB 3LOBA 2YXSA 2MEV1 4D6QA 4IEVA 1REFA 4MO3M 1W28A 4EYUA 2HBTA 1YI9A 2VOTA 5D8AB 3U75A 2VUJA 3WW2A 2D7FA 4HG6B 1UNBA 1WCQA 1GWKA 1IG3A 2VCBA 4IDZA 4UWDA 4K9SA 3OPZA 4P9XA 5A1AA 4HKOA 2Y38A 4DZGA 4R4ZA 3M2MA 1EV12 1SLAA 1G6NA 1FNZA 2ARCA 2BOJA 3LAGA 4OCTA 3RJ2X 1H9WA 5IYYA 5AFBA 1O8PA 1B35C 2J1AA 1TME2 1Y3TA 1DQ4A 1XE8A 2XJTA 3OOXA 3LIHA 3AYEA 5KHIA 3RZMA 2J7MA 1ND3C 3O1MA 4QQ2A 2B39A 1OOPA 1QOSA 2J1TA 4IUGA 3HQUA 3S57A 1C28A 2I74A 5C4WA 1H9PA 2GMMA 5ANQA 3CL1A 2NYYA 2D40A 3N7KA 4E4HA 5HPOA 3N3HA 5J7MA 5JPMB 1BXHA 1HV0A 5BY5A 3ZXFA 5ACA3 3DYOA 3MEPA 1NCQA 4WV8A 1QJY2 3UGFA 3S30A 3LA7A 4E4DX 3T30A 4HETA 5HCAA 3DYPA 4DRRA 2VUDA 1A78A 4E2QA 1AYM2 3KV9A 4YZ2A 3BN6A 4HPKB 4YNIA 2IXCA 1TNRA 4XZPA 5LEKA 4TN7A 3I2FA 2WO1A 2VQ0A 3ACGA 4LOSA 1NG0A 1ODNA 2UWCA 4W4ZA 5A7WB 4HANA 4D3WA 4G3YC 4Y1XA 1SPPB 4DPNA 3MYXA 4DEQA 1RINA 5CNAA 1K5MC 1PGL1 2R30A 1FPN2 1HB4A 3Q8AA 5CU1A 4OQ8A 5FYHA 1V6NA 3AX4A 2VZOA 3H7YA 4URTA 3OY8A 1HKDA 4YG0A 4JHZA 1CAWB 5TSWA 4AVBA 3E6CC 1YHFA 1SLLA 4QU1A 3SCHA 4LO4B 3O1SA 2JIGA 4RGAA 4XUOA 1S1AA 2Q5TA 1LOCA 2Q0AA 3VBRA 5LB6A 4RS5B 5DQ0A 5DZFA 2ZGNA 3AP4A 4ZU5A 5FY1A 1UY4A 4IE7A 5J96B 1UYPA 1ZZCA 2WO7A 2VW1A 2WO2A 3ZMNA 5IK7A 3MFAA 1UQXA 3BCWA 4LKDA 4RFT0 4LNVA 5C8CB 3BTAA 1BVVA 2VMCA 1XNAA 3ZYHA 4BZ4A 5B2GB 5JZGC 2ZEYA 4BB3A 1M06G 1Z0HA 1NE6A 2G9ZA 2RDRA 1AR71 1S4CA 5A7SA 5JSRA 3GYDA 5CVRA 1UCXA 4LUKA 1DQ5A 2WA4A 4OMDA 1GQGA 2ZGQA 4IGQA 3GZUC 4FOWA 5FZEA 3UYJA 2EF6A 5LY1A 3OGRA 1RL3A 1RUE2 4M3CB 2BWCA 4GB33 2OZ6A 1W6NB 3PU3A 1DGWX 2ARAA 1QJX2 3SISA 1YWKA 2GP3A 1ENQA 1COV1 1D4VB 2SLIA 5DPNA 1UOFA 3SQOA 2YFZA 4UFIA 3VBOB 2ARBA 1QGLA 1VR3A 5FY8A 5JMOA 2WLQA 2VCMA 2Y34A 5LY2A 1HJFA 3IBMA 4LEJA 3I49A 3WINE 4OYUA 3U1XA 4BE3A 3O1VA 1DGWA 3VZOA 4XVHA 3CKHA 5IWFA 1GR3A 5E89A 5DUWA 1VBA2 1FOD3 2UY9A 3QACA 4JQTA 1MZ5A 1VJ2A 3WG2A 4QKNA 3DL3A 5I0UA 4BDVB 3X29B 2RM22 3NWKA 2XJRA 5FPBA 4QM8A 3POGA 4QM9A 2F4LA 4JGYC 5I0DA 4XJWA 1GOGA 1VLNA 1R1A2 3HN3A 2WNEA 3MIEA 1AX0A 5JI7A 3H42B 3SKVA 3VV1A 1SQ4A 1RUF3 2JG9B 3HNMA 2VXRA 3SKJE 3T4HB 2XBO2 1US3A 1PVC1 3A0KA 3AJZA 4WM8B 3LCPA 1QMJA 3I2OA 3VD7A 1RJ8A 4K1ZA 3G7DA 2GC2A 3U4XA 4NOTA 4JRLA 1YI7A 1VRH2 2PQQA 2YY1A 4K1YA 2RMU3 2EAKA 3WY6A 2VULA 1AR81 2ZGUA 5GLVA 2R16A 3RYPA 5AC92 3ZMOA 4JHTA 3VLBB 4Z1VA 3AZXA 3C7HA 1UU5A 2BWAA 2MPFA 3HNYM 4CU8A 4EWAA 2BERA 1SBEA 1FATA 2VC9A 3KT4A 3ROUA 2VNRA 2HWF1 1L7LA 4XJAA 5EHDA 2Y6JA 5FLIA 4A6OA 1H1MA 3WT3A 1W6PA 5F6LB 3AMNA 4Q27A 3BTXA 3ZOIA 5GZCA 1ZBE1 2WFF3 4XUTA 4LXLA 1SHWB 2VO5A 4Q4W1 4ZHNA 5LASA 3O0WA 4QAWA 4FO9A 1YO8A 1UY3A 2RHPA 4DFSA 1NQJA 2PHTA 3D8CA 4GH4A 4CDQB 5C9AB 3OCPA 5LZ6A 2TBVA 3ZYGA 4AI8A 2D6KA 3ZN4A 5IK5A 2ATFA 4RS5C 4FCAA 3VDBA 1G9BA 2UYBA 3MIHA 1UIKA 4A3XA 4ASKA 2Z42A 4OMCA 5JIAA 2WQ4A 1JMUB 2D6LX 2HWD1 2CWMA 2G1MA 5C8CC 1AL23 1UZ0A 2W1QA 1RUG1 4JGYA 3WP3A 2ZAHA 4PLOA 4AEKA 4CDWA 1JZ7A 2A6ZA 3MLLA 3SEPA 2ZS6B 1W6QB 4CU9A 3GZEA 3I59B 3UESA 5H9PA 4CCKA 2AENA 3JB8A 3D6EA 2NMNA 3ZYPA 1ULEA 3JBG1 2PHLA 3L9JT 5CFCB 1PZ8A 5EYXA 1JZ4A 4NAMA 3FFZA 4AFBA 2RV9A 4I01A 1REEA 1H4GA 1V6IA 4QQHA 4WM7A 5A3OA 1JZ8A 4Z8BA 4IEYA 1KFXL 4QPWA 3ZSKA 1OLRA 2W1WA 5FZOB 1V6LA 1DP0A 3IT8A 2FDGA 1IKPA 1DGRA 5A3WA 1LESA 4DXSA 1V6OA 1QF3A 4CP9B 3WDXA 1NLQA 1NXMA 1HQNA 1HX6A 2E26A 2VOKA 3MW4A 5L9RA 4R9BA 3NNJA 5EFUA 1L3JA 3N35A 5FY4A 1OC1A 4FPYA 4CEWB 2RS53 2ZGTA 1FAYA 2R6QA 5A3LA 1VP6A 1WZXA 5GZFA 4CP1A 5FZBA 4QB2A 4TZDA 1W8NA 3BTYA 4QHOA 5CBLA 1H8VA 3T0BA 4BIFA 1CD3G 3D4KA 5T5JA 1XPWA 1JYXA 3A0NA 1SBFA 4XEZA 4LA2A 3JU9A 3ZKYA 3TEWA 3TYJA 3VBSC 1IQDC 2Q8EA 1I5ZA 2FZ1A 2PELA 1MEC3 1OD5A 4PDWA 4XBQA 1UMHA 4LA3A 1UZYA 4DNYA 3ZFEA 4BM8A 4XMIA 4YGBA 5FAXA 3HPNA 4ES9A 1XSRA 2VUCA 3K75B 1OQ1A 1SEFA 1R091 4D6RA 1N1VA 4LE3A 4Q0UA 1PIV3 3ZSEA 3U37A 4OI4A 1JS9A 4BCUA 1RVF2 3E5XA 4GWJA 1OKOA 2GC1A 1N3PA 4L99A 3SLIA 3LA3A 2JDMA 2V09A 3KT1A 3MIDA 3PHMA 3WVJA 2VM9A 4BLIA 2ES3A 1TNFA 2ENRA 3D0JA 1GNHA 3WF4A 5F6KA 5ABJA 5FDBA 1W9TA 3EHKA 4P9GA 5EJZB 2WKKA 4LBKA 4AI2A 1EY2A 5A1LA 1Q43A 4HSLA 4YW7A 3ZO0B 3VD5A 5K7PA 1POV1 1QXPA 1UY0A 4XTMA 3RI8A 5DG2A 5JAXA 4MHUA 2IFWA 3B9IA 1D0HA 2Q1MA 2ZPXA 5GLUA 5CAZA 2R1BA 2RS32 4LHLA 5J3UA 4O7XA 5FZ6A 1OPOA 2OYZA 1DZTA 5EJ3A 4ZS3A 5T5PA 1O3QA 2FCTA 3ZN5A 2P3KA 3NNLA 2VZRA 4L0PA 1OA2A 1YEWA 4CDQC 5C9AC 2KXLA 1RUC2 2BBAA 3HT1A 3WW1A 3AP5A 5FZ7A 4WBBA 3I4IA 2C0ZA 1O4TA 3BODA 2D6OX 5FXZA 3CF6E 1PO13 1Y7BA 1CJDA 3TEYA 1EAH1 3U11A 1XQNA 2P1BA 2W5FA 1F31A 1TG7A 2PLV1 1YUDA 2HWB2 3VBSA 1GP6A 3AMHA 2CAVA 1AR72 5F5IA 2HWC3 1OH4A 2ZEXA 3N9PA 4OUMA 4CPBA 3R4UA 3WEZA 3IM0A 2PFWA 2JDUA 2QQVA 4I0BA 4R4XA 1J59A 4IV3A 1Q8SA 3BB6A 1BK1A 3Q9OA 2X5IA 1BKZA 1V0AA 2JXAA 5HCBA 2AC1A 2H0BA 3LDBA 3OYWB 1OUXA 4G4FA 3DF0A 2DCYA 4QMAA 4RD7A 4LO6B 3WOGA 1X82A 1O3TA 4SBVA 4R9AA 1JXNA 1SDWA 1QU0A 3QCWA 5GKAC 1VBD2 4M0HA 1OSGA 1G8WA 2ZABA 2HJIA 2DVGA 5CB7A 3RNSA 4C91A 4SLIA 5JR2A 2E51A 4AHZA 5LA1A 5LBCA 2RR13 3POBA 2WABA 2X8KA 2VOXA 4S2HA 2GH8A 4S2FA 2VOWA 5FZ8A 2YZ4A 1QQP2 2WZR3 4OZXA 4ARXA 2RJLA 4H3WA 2WSVA 4JVAA 4D69A 1DQ1A 2PQSA 4C90A 5A32A 4FSJA 1VBB3 5SV8A 3UKVA 5ACA2 4QKFA 4AEDC 3MW2A 4L97A 4QX1A 4Q0PA 2ZGKA 4ZY9A 4YM1A 4K40A 2W9XA 3ZDSA 1LHVA 2JENA 4EN6B 1POQA 4AZZA 3VBFA 1GQPA 3AVRA 2B46X 2VZQA 1RMU1 2HEVF 5DAXA 5EPAA 2LROA 2Y6KA 5DUUA 2RS11 2VNGA 2AEYA 2TNFA 1MVEA 3MPBA 3URFA 3IDAA 4PI2A 4AVVA 2WT2A 1MQTA 1YC61 2P3JA 4JRAA 5KHHA 1S2BA 1JYCA 4DY3A 1X8MA 4PF5A 1DQ2A 2WN3A 3NNGA 5C71A 2E9QA 1GQHA 2Q8CA 1DGRN 4QXCA 2H6BA 3R4SA 4K3UA 5GLZA 4AW7A 1AR91 1MS0A 1OF4A 3PJYA 1ZBA2 4A42A 2ADDA 4KBBA 1QH7A 3WNMA 1AF9A 2YUEA 3KQRA 4LOTA 3GJBA 4ATEA 2WINB 1W6OB 5D1IA 2XMLA 3ILRA 5FZGA 1OFNA 1EV11 1WBFA 3NV1A 5FK7A 3J26N 1N1YA 3LDRA 1QNWA 4DO0A 3O1PA 4B3NA 1G9AA 3OBRA 1TME1 4ET7A 4UFJA 2ZGOA 4UW6A 2VVFA 5I91A 2D6NA 4N7UA 5CFDA 3BTZA 4BHPA 4Z82A 3PMSA 1QKQA 4CUAA 3Q8FA 1FMD1 4Q4V3 1PO22 3ES4A 4Y26A 2WYSA 4J1XA 2QVSB 3MI8A 4FOYA 3T3YA 4LO7A 4YGEA 5FXXA 3WF1A 3VD4A 4XBLA 3IWZA 1NAEA 5JXJA 4JC1A 3VZLA 3IIAA 5JSPA 1QY4A 5DDJ3 1QJY1 1BBT3 1FV3A 1YLLA 1LGBA 2YG0A 1D2SA 1VBC3 2QKDA 3CNAA 4X8PA 2HWD2 1ZRDA 2FMYA 3NJYA 5BXXA 2EXKA 2R063 2CYFA 2QQMA 1S2KA 4Y22B 2FDJA 3N9NA 3WW4A 2FMDA 3B93A 4QDSA 2DFCA 3T4VA 2F17A 2NP0A 3J7HA 3H50A 4E4ZA 1KITA 1ULGA 2DFBA 1VBE3 4PBOA 1RYYA 3P1IA 3M3IA 4QX2A 3CMGA 4QXKA 4ASLA 2XL7A 1A8DA 1O7FA 1FOD2 2OPWA 4C8DA 5F9TA 4S2DA 4CDXC 2XVLA 2QZ3A 1FPN1 1XXNA 1AXKA 4CRQA 4EZHA 4KMQA 4GD4A 4LBOA 2G9FA 3BIWE 3P3NA 1YFUA 4MXWA 5EJ1B 3WQ0A 1K45A 2QQIA 1DQ6A 1POV0 4FPHA 4KWUA 1LAJA 2E33A 3NMBA 1I1EA 1AR62 4HVRA 1GOHA 1G9DA 2KD7A 5BNOB 2QFEA 4YGDA 4LT5A 4L8QA 3AKPA 2Z4FA 5T50A 4V2VA 4W6YA 1OUSA 4FQZA 2LM3A 2Q1ZB 5KXBA 1W06A 1PZ7A 4NIIA 3AYDA 4LE4A 2WT1A 1W05A 2VZ3A 1VPHA 3VZKA 3WDUA 1OA4A 3M3QA 4COUA 2RMU2 4ARYA 4WVWA 5FY5A 3E5UA 5F5AA 4QGLA 4CXXA 1RUE1 1AZDA 1KXGA 1SCRA 1QH6A 4K6BA 1MVQA 4A7YA 1I5PA 1PHMA 1QJX1 2JE9A 2QQJA 3K4ZA 4QX8A 1WMXA 5FOBB 4Q4Y3 3EO6A 5C4WB 3ACLA 3D3AA 4MGYE 4Q2FA 5L9VA 2FDHA 4GJZA 3K3NA 1LGNA 4XFFA 3OGVA 5DAVA 3RZKA 5C5TA 1RXGA 3W21A 5F2WA 1AXYA 4MVTA 4AAPA 5LRSA 2B9UA 4CDUA 1W6MA 2P17A 3MUY1 4E8DA 4Y5SA 1OQDA 1UO9A 3RQ0A 1VBA1 2RDQA 5FPUA 3ABZA 2PMWB 1WUVA 3NNMA 4QQOA 2RM21 1OXCA 3FUQA 3NAPB 4MH0E 3J7MA 5FUNA 1OLQA 2VL4A 1JH5A 1H8TA 1S0JA 3H9AA 2JD9A 3I2JA 4HK9A 2ID4A 2ZGPA 1LHNA 1R1A1 1NT0A 1JOBA 4CDXA 1SLCA 3IIIA 1PGSA 1SLIA 1CN1A 5I93A 1EUTA 2E31A 5EP9A 3TNPB 2A75A 5FPXA 3U4SA 4J6GA 1HQWA 4QPGC 5M0TA 4EN9B 3U78A 2XBO1 2DVBA 2Q30A 3OPTA 5FYUA 4UXAA 5JOYA 4UFHA 3WX5A 2K0GA 4FTBA 2EIGA 4MYEA 1PGW2 1R64A 3SNMA 4A41A 2J22A 5A6QA 1OHFA 2R042 3VHOA 4ASMB 4Q4X2 5IVJA 3OB8A 1ST8A 5AC91 4KL1A 5FYYA 5FZDA 1Z7S2 3ZXJA 2JDZA 3WNNA 5LBEA 3LEMA 4EN0A 3VKOA 1FV2A 3WF2A 2JG8C 1GUIA 2R0FA 4YM3A 3B00A 3NRUA 3BOPA 1WD4A 2GC3A 2YHJA 1RUH1 2XKOA 3OJBA 1LCLA 1RUD1 4KWJA 3ZYFA 4JTOA 4CCNA 1G7YA 4CVUA 2QQOA 1PM4A 2PLV2 3O0VA 4YVWB 3U07A 1Q8QA 2ARXA 1LOAA 4Q8LA 1PK6B 1GKBA 2GH2A 3ZR6A 5T3NA 1OKQA 5DG1A 4CCCA 1H2MA 2JDYA 3N4MA 2Y6HA 4D7TA 5J37A 3DUIA 2Z2SB 4KU8A 4QQPA 3HQRA 4BWOA 1LKNA 3EMRA 2FDFA 2DBIA 1GV9A 4EWEA 4Y1YA 1W8FA 2ZKNA 4GAZA 4IV1A 3V0AA 4YVSB 2A3XA 2XJPA 5F2SA 5T52A 4MHRA 3RI9A 1FXZA 2ZCWA 3N36A 5JVVA 1LB2A 2UY8A 2MNGA 3CU7A 2D93A 4JGZA 4QPIA 4RHV1 4A4AA 2BVVA 4YM0A 5BNOC 4CU6A 2BFUL 1GFF2 1BEV2 3RWKX 4H7LA 1IPJA 1PIV2 3H1WA 3OD0A 3VDDA 1ULOA 2FHRA 1BZWA 3O12A 3PJQA 3TB0A 5F7UA 4W6WA 1NCRC 2XB6C 4FP3A 5DAWA 2V4AA 5BPXA 4BYYA 5JSOA 3MO4A 3ZR5A 3IB3A 5FMDA 3AKRA 1UWWA 3I8TA 4LBNA 5KC6A 3ZXKA 2V73A 1CPNA 1APNA 3SH3A 1GICA 1NA1A 1OPMA 1X33A 3B7MA 5K9YA 5GZGA 4XFAA 1X50A 2OT7A 2HBUA 3ZXGA 4LUMA 3O1TA 2P3YA 5BNPC 5FZLA 4WZCA 5B4XA 3KWVA 3Q8EA 4R9DA 3VL8A 2XONA 4N7IA 4PBPA 1RUJ3 3OBZA 2JG8A 1XRUA 1M4WA 4U36A 1GZWA 3JD73 4HXCA 3T0AA 4IEZA 3WUDA 3WQBA 2GAUA 1BHGA 4FVVA 4ISRA 2BQPA 1F15A 1AR92 1YFYA 4XJUA 1EP0A 3FL7A 3W20A 3RZHA 4Z92B 1W8WA 2CTVA 3B9CA 3NKTA 5FFOC 5FMBA 2D3SA 1XYNA 4RYDA 5FYCA 5IVFA 4N9IA 3NAPC 4AR2A 1WCUA 5C3PA 4EE2A 3UK9A 3KF5A 5DN2A 3ZFFB 4AI0A 5BNNC 2CV6A 5HCHA 5CYYA 2WN2A 1SG3A 2SBAA 4AOCA 4AEJA 2VW2A 1BMV1 4X6QB 1O59A 1KQRA 5EZWA 3VBUB 1J84A 2DDUA 4GJYA 1EYBA 3EBRA 4UFKA 1XNDA 2A3WA 1UYZA 2D6MA 4LHKA 4GH4B 4EZ4A 2W1SA 4ZU4A 4LHNA 1FMD2 1QOTA 3RZGA 1SLBA 4NN0A 5A80A 5A70A 3KT7A 1RVF1 3MIBA 4IE4A 4FT8A 4L11A 1CPMA 2BV4A 2O1QA 4CCOA 1STMA 5KXEA 1COV3 2QQUA 4CPBD 2WQ8A 4E2GA 2JWPA 2PHUA 1NCRA 1IPKA 2R32A 4XYXA 1ZRCA 3ATGA 1DDLA 3O0XA 3IDBB 3UNPA 4MUVA 4NIDA 1VIWB 3M3OA 4HFSA 1H2KA 2JICA 1C1LA 3MIGA 1D4M1 3D0SA 3WP4A 3PDQA 5FZ3A 1JYWA 4JCKA 4JKKA 4RR3C 3ON7A 3PTYA 2VD7A 2E7TA 2WNUB 3WUCA 4AQSA 3H3UA 3S5AA 2DCKA 2ZMNA 3RFRA 3TNQA 1GZ9A 2RS31 1TZOA 5L7OA 3W5NA 5FV3A 2QQPA 2XHNA 4L92A 2Z79A 3PMEA 4XBNA 2WZR2 2Y8KA 3FE5A 5BNPA 1C1FA 5A3NA 2OQ7A 3LWCA 4XXAA 4Y20A 1U5ZA 4ZPIA 1PM7A 1YQ8A 2WO3A 2WNVA 3CJIB 4PIYA 3ZXLA 4YFWA 1WKYA 3GM8A 1R1ZA 1RUC1 1CIWA 2HWE2 3BOWA 4C0HA 1UZVA 1XBFA 2W0XA 2XHKA 3TWIA 5I8YA 4COYA 2W3JA 4AQ2A 2WL1A 1MS3A 4EV0A 2JEMA 5FPZA 1J1TA 3POIA 2TUNA 4JX0A 2FD8A 2RJ2A 2H0VA 5CKMA 3VD9A 2HWB1 1PVXA 4AVSA 4Y5TA 3RGBA 1H4HA 1CAUA 3AL5A 3GZTB 1B35A 1AR83 3LE0A 4MLOA 3MZHA 4FFGA 5C8WA 4YG6A 3WDYA 4PDWB 3ECQA 5FR3A 1IZ3A 2ZMKA 5I8SA 2OXBA 1ND3A 1OMIA 1ASJ2 2KR2A 1UPSA 5JMCA 2NMOA 3RG0A 2HWF3 1NLSA 3Q8BA 4M00A 3I2HA 1O91A 2CY6A 3RPQA 4JDNA 1JU4A 2I45A 4FFIA 1J3QA 4I0AA 4FPFA 1CAXA 4DINB 2AEZA 2GN7A 1ZBE3 1VBD1 5LATA 3TN92 5ABJB 4YW5A 1W0PA 2KA3A 4XUNA 1V9U2 1OA3A 4AFMA 3GBGA 4BJ0A 2WS93 1O5LA 2ZX0A 3I3EA 5JPNB 2BOIA 2AYHA 2YGLA 5D8AC 3J8F3 1QQP1 3R4DB 1ONAA 3CDZB 1W9WA 2ZHNA 3E6DA 5E88A 2UYAA 3WCRA 3WG3A 3KCCA 3S7EA 3FBYA 5ACA1 3IKWA 2ADEA 5FYIA 4M01A 4Q29A 5CZKA 1K5MA 1GYKA 3ZFGB 2UWBA 4JKMA 3ZSLA 1HN1A 1RUG3 2BPA2 2OUHA 4UW5A 4RA0A 3GGLA 5FBZA 3OUHA 4L9BA 2VMFA 4FTEA 1V6KA 3HT2A 2EAAA 4GA9A 4XW3A 5FP8A 3EYPA 4NHYA 2ZACA 2PAKA 3PLQA 2GNDA 3KV6A 3K77A 3T2PA 1JYIA 2F4PA 5A3MA 3K2OA 2XLAA 4A2UA 1QJU3 1SFNA 2YB7A 3AB0A 1VBE2 4PCRA 2CAUA 2WAAA 3RRDA 2G4IA 2Q8DA 2FCUA 4N53B 3WG1A 2K9ZA 3HVDA 1ZBA1 2UWAA 4XACA 3S6PA 5JZGA 1IQAA 3FUOA 3LDKA 4MGZE 4XFBA 3I3BA 4QHBA 2GZWA 1SFPA 4HLTA 3JXSA 1TMF2 1UXZA 4DB5A 2EIEA 1RUH2 4AVCA 1RUD2 1E5HA 1JU3A 1ZZ8A 5IUQA 3ST7A 3MIFA 4TTGA 4S2GA 3B3QE 3KHBA 4XHXA 4INDA 4IV3B 1ZA4A 1XOYA 1UOBA 3GF6A 4HVOA 4M4RA 3POSA 1MS9A 3WDWA 4Q0VA 3SEEA 1JUIA 2PAEA 4K8RB 4LQRA 5A1FA 4TYSA 4F7ZA 2JKBA 1C8M2 1AVBA 1IOAA 3I97A 1OF3A 3KLSA 4B1MA 2BYVE 1PO21 1IS4A 1ZYBA 5APAA 5JR7B 2JJ6A 4FPEA 3CJIC 3HWJA 3O1OA 1IKQA 1W2UA 3WHUA 3FHIB 5FJKA 2HEWF 1SDDB 2LTNA 4GB31 4N43B 4LHSA 5SV5A 5D8AA 3MF6A 5FZFA 2IZWA 2Y26A 3MPPG 3RYRA 4RHV2 4G9SB 5EIYB 2ZMLA 4XDQA 1R093 4FAGA 3MF9A 3C3VA 2YYOA 5FMCA 3FLTA 1DGLA 4K8FA 4FP2A 5IJRA 1J1LA 1CAVB 1PX4A 3BVCA 5JUVA 2GNMA 3NJXA 4AE2A 3DECA 4XF9A 4XJ9A 1BK0A 2XLFA 5GZDA 2D44A 5CIRA 1TEIA 1ENSA 2ZBJA 1SCSA 2VECA 1AUYA 3GHNA 5F3IA 5FO8B 2YROA 3VBFB 5CADA 3VBHB 1KGYA 5FZCA 1FOD1 2B7YA 2VMIA 1POV3 1Y4WA 3IMMA 4IW3A 3POEA 4CCDA 3OUJA 4GMP1 3I2KA 1WLDA 1SLTA 4B7KA 3LSEA 2PYTA 3H3LA 1NZCA 4ES8A 1UX7A 4EN7B 3VBOC 2HYXA 1RHI2 4KQ7A 1SACA 1REDA 3PUHA 2A3YA 4WVMB 5GALA 1QIQA 1RUF1 1G9CA 4O9EA 4UF0B 1CZSA 4AFDA 1AR61 4BQXA 3GZAA 3ZKUA 2ZJCA 5H9QA 3C7OA 3AVSA 3H1MA 4HPKA 2WLPA 1LEMA 3ZXDA 3RZZA 4FBFA 4JV4A 5IVCA 1A8MA 1W99A 5G05L 4XTPA 2C24A 3NW4A 1RJ7A 1DYPA 4XIKA 2RMU1 5ERLA 3PNAA 1SPPA 5FP7A 1H1IA 4COWA 3NKGA 5LEJA 4J1WA 4DY5A 1EAH3 1GLHA 1BMV2 2ZGMA 1ZRRA 2WR9A 2JG9C 2HYKA 1CAWA 4D8MA 2W39A 4MX3A 3LFMA 2QZ2A 4XF4A 4AVTA 4HBNA 2AUYA 5FRAA 5BV6A 2XKPA 4WM8C 4BXSV 1UL9A 4RS5A 3ZM8A 1PX3A 2VAUA 5GLWA 2WC2A 2AREA 4MV2A 4RQPB 4XJ8A 2IXJA 4OI0A 2WFF1 2ZA9A 3WNXA 5C8CA 3JQXA 3DYMA 4OLLA 4MGSA 2DUQA 4I02A 3AJYA 3PUAA 1RUI3 1DLLA 4V2WA 2E32A 2HKXA 3GHMA 4DOUA 4IE6A 2QQWA 1JHJA 4GKYA 4NR1A 4CEYB 4P9LA 2NPIA 1O8SA 3KD4A 2Y6GA 4CCLA 4OUSA 3IAQA 3VKLA 3NV2A 1D4M2 2A5ZA 4BQ2A 3T2OA 1OURA 4CCMA 3LB9A 1QJZA 4PQ9A 1W6NA 4CZSA 4GWIA 1AYN2 5HV4A 4CCEA 2YBPA 2V4VA 1ULCA 1WW6A 4FPJA 1UZZA 1X9TA 1AL21 2R7EB 5T54A 4Z2WA 1VRBA 4P02B 5F5QA 3UETA 4A7KA 4COZA 2HLEA 3CIHA 5FPVA 3VBOA 1DZRA 2O8QA 1JTZX 1JI6A 1HRI2 3ZVXA 3V0BB 1WWYA 3CZJA 3KB5A 5FKBA 5LA2A 1WBLA 4QGNA 4ZZ8A 3O1UA 3I3MA 1PGW1 2QNKA 5J36A 4TSVA 2R041 1ENRA 3CZUA 4Q4X1 1Q8PA 2B42B 4CXWA 4DS0A 4N43C 3U0ZA 1HRV3 5A3PA 3SCGA 2D43A 1RMU3 1Z7S1 2BP6A 4Z2AA 2DUOA 1ACCA 4KG0A 5HXVA 1MS8A 4PIZA 1KD7A 1XE7A 3OBTA 2C9KA 4MSVA 4JQRA 5KR7A 3BGAA 4XAAA 4YFZA 4Y1VA 2A70A 5IVYA 2BJSA 5DABA 1W9YA 5ANNA 1ND2B 3TBDA 2J1SA 4RL7A 2VG9A 5JCTA 1HXS3 2EIDA 2J1UA 4UOJA 1GNZA 4H55A 4AI1A 2XJSA 3JD72 2JG9A 4JZRA 1YCIA 2QDRA 3VDAA 4DXRA 5FMOL 2YDEA 2W08A 4IE5A 5CFCC 3USUB 1Y9MA 2AR6A 2YGMA 4IESA 4Y4RA 1EV13 4KU7A 1V6MA 1DF0A 3VZNA 5KXCA 5A33B 1TME3 2IXIA 2VZVA 3DXTA 3GCWA 3WF0A 4XIOA 1DU3D 3UT0A 1MEC1 2NQYA 3THCA 4CDUB 3J7LA 3MW3A 4LBLA 4CU7A 2UURA 1NUKA 5KHKA 2BW8A 3DKQA 3NSTA 1HW5A 3OBAA 1O6UA 4PHZA 2ZGLA 1B09A 1UW8A 2ZX1A 4CEWC 1BEV1 1PIV1 4ZU7A 1ZZ7A 1WLTA 2R073 3LPFA 3AZYA 3ZN6B 4OI1A 3AKQA 1QWRA 1QJY3 1DYOA 2IXHA 1WMFA 2E7AA 2DU1A 4LBJA 3QLQA 1RITA 1S0BA 1URXA 1UPIA 1I3HA 2W87A 1LU1A 2P4EA 2E63A 1AYM3 2VMHA 3NVCA 1E5SA 4EJRA 2YPDA 5K4LA 2J42A 4CDQA 1FNYA 2WYFA 3DN7A 5C9AA 2I2SA 3NO8A 4LR4A 4QPYA 5E6HA 4B4QA 4P9IA 2E6VA 1T2XA 3MHZA 4LKSA 2VTXA 1U12A 4MGKE 5A7PA 2GALA 1D7PM 2EICA 1F5JA 1GNYA 2YBSA 2Y6FA 3ORJA 1W6QA 4YW1A 4FPCA 1H1AA 3KV5A 3D5OA 2IC1A 4ZKTB 5CA6A 4HMZA 2YC4A 2IUWA 1U5IA 1O4ZA 2VMGA 1IGOA 3IMNA 3LEKA 2J1VA 3UJOA 3BIEA 5CFCA 1FYUA 4GMP0 5F8PA 4IEQA 4PF1A 1T6GC 2ZKLA 3KF3A 4HVQA 1JUHA 3THPA 5A6YA 2QDNA 1UIJA 4FPGA 1X36A 2A73B 2X09A 1RTVA 3ES1A 1AHSA 4ZONA 5FZOA 3OGJA 4JTNA 4CP9A 2PAMA 1JZ3A 2LRPA 2HWC1 1JOPA 3JQWA 1RUE3 4CUBA 4K21A 1CJPA 4B4PA 4DIQA 5HXMA 5JDBA 3FX3A 1QJX3 5K0UB 4Y1ZA 2CGOA 3ME2A 4GB32 5E8AA 4BOWA 2VNOA 4URAA 1H2LA 1HIXA 2ZHLA 4GKXA 4DXTA 3HBZA 1NOVA 4GIQA 2PHDA 1JYNA 3W58A 2O8OA 1CX4A 3K48A 1LEDA 2P3IA 2QUOA 1R083 3AMPA 4AI9A 2FQPA 2ORZA 2QJVA 3DPRB 2PHXA 4AEDA 4UW3A 4DUWA 5C7GA 4NIHA 1PZ9A 3A22A 3BALA 5FWEA 2W94A 4KWKA 1F4HA 4HZFA 3ZYJB 4XMAA 2RR11 2WS92 3AP9A 1NA1B 1VBA3 4QQLA 2D3RA 5FREA 1XU1A 3J8F2 2WZR1 1YXWA 4META 5FQ0A 2GSYA 3SITA 1VBB1 1WW4A 3KGLA 3ACHA 4FQ4A 4KGGA 2A6WA 4Q5OA 2XXZA 4GWNA 3DXUA 2HWE1 1CWPA 5I0TA 4QXBA 3HIFA 2BUKA 4Y24A 2ZZJA 2C6SA 4LKEA 3QH6A 4KGQA 2XBO3 4OHWA 5KXDA 5FXVA 1RUF2 3WF3A 2WAOA 3D82A 5A7QA 5IAVA 3QH7A 2XJQA 2XL9A 4QGMA 2WZPP 2BU9A 1GBGA 4NIGA 2ZZQA 4AQTA 1VRH3 3ITQA 3ZXEA 2DVDA 2L9LA 4Y33A 4IEPA 1XYOA 5AC93 2DWRA 3WR0A 4DMIA 4YYOA 2DCJA 2JECA 2V5DA 3FLPA 4N90A 3N9QA 4XUPA 3THTA 1ASJ1 3P6BA 5DZEA 5A3TA 2OUJA 1S0IA 1CZVA 4NHKA 3LF7A 5DUVA 1OOPB 1HN0A 5HCFA 1CVNA 2DCZA 5ISLA 1DZQA 2VMDA 4AHWA 3VDCA 1IPSA 1W8HA 2PHWA 4IEOA 3DGTA 4UT5A 1NCQB 3TN91 1US2A 2MHFA 3V65A 3AZVA 1V9U1 5DAQA 2WFF2 5H9RA 3U10A 1N1SA 5EQUA 3NJVA 1UOJA 4P9YA 4KNCA 4D94A 4K20A 5C3OA 1CX1A 2P34A 1MR5A 1W0OA 1O3RA 3K51A 2C4XA 1LU2A 5FKCA 5D21A 5A6XA 1DLCA 2Y64A 3GXUA 1ZZBA 4AYUA 2Y60A 3QD6A 2W95A 5LRRA 1FX5A 2RDNA 3O5SA 4CYDA 1VBC1 1Y9QA 4Y3OA 5FY7A 5I8TA 3OYWA 1AL22 4HL0A 3CO2A 1W2OA 2Y33A 4D7YA 1ZVFA 2D97A 2XDVA 3AM2A 3OY8B 4FOVA 5FWJA 3KCXA 4YW2A 2ET1A 4LK7A 3VZJA 3PVEA
chains in the Genus database with same CATH topology
5A70A 2BOIA 2JDMA 1GZTA 2JDUA 5A6QA 2XR4A 2JDKA 2BV4A 2WRAA 1OVSA 5A6ZA 3DCQA 1W8FA 1OXCA 2VNVA 4CE8A 1OUXA 1UZVA 5A3OA 2CHHA 5A6XA 2BP6A 2BOJA 5HCHA 2VUDA 2JDPA 1OVPA 2WR9A 4AOCA 2JDNA 1OURA 1W8HA 5A6YA 1UQXA 5D2AA 2VUCA 3ZDVA 1OUSA 4UT5A 2JDHA 2JDYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A70 A;  2BOI A;  2JDM A;  1GZT A;  2JDU A;  5A6Q A;  2XR4 A;  2JDK A;  2BV4 A;  2WRA A;  1OVS A;  5A6Z A;  3DCQ A;  1W8F A;  1OXC A;  2VNV A;  4CE8 A;  1OUX A;  1UZV A;  5A3O A;  2CHH A;  5A6X A;  2BP6 A;  2BOJ A;  5HCH A;  2VUD A;  2JDP A;  1OVP A;  2WR9 A;  4AOC A;  2JDN A;  1OUR A;  1W8H A;  5A6Y A;  1UQX A;  5D2A A;  2VUC A;  3ZDV A;  1OUS A;  4UT5 A;  2JDH A;  2JDY A; 
#chains in the Genus database with same CATH topology
 2JE7 A;  1JHN A;  3LPG A;  5A7N A;  2O0O A;  2WDB A;  1VBE 1;  3VBR B;  2QE3 A;  4A7Z A;  1Q5O A;  4W65 A;  1QDO A;  5K0U C;  2ZTN A;  1C3H A;  4BME A;  4LO8 A;  1DBN A;  4YZ5 A;  4AG4 A;  3PUI A;  2XQX A;  4AGV A;  1W9F A;  2ZOE B;  1YQ6 A;  1W8U A;  2ORX A;  2VQA A;  1DHK B;  3T1M A;  2JDP A;  4E27 A;  4DUV A;  5F5C A;  1AJO A;  1WMD A;  1TMF 1;  2PTM A;  3J7N A;  1SMV A;  2C1F A;  3WD5 A;  4GWM A;  1LUL A;  4PLN A;  3E5Q A;  4UFM A;  1AXZ A;  1PNG A;  4FI9 A;  4AGR A;  2MEV 3;  3I2D A;  5DZG A;  5CG8 A;  1YNA A;  3JCI A;  3J4U H;  2PN5 A;  4RN5 A;  4Y4Y A;  2RS5 2;  3FLR A;  2GNB A;  4I0W B;  1H6X A;  3LGR A;  2WWU A;  1C8M 1;  3ZIX A;  3VB9 A;  3VD3 A;  1W2A X;  3NJZ A;  2XR4 A;  3FFQ A;  2Y6L A;  3M1H A;  2EAL A;  2TEP A;  3B5L B;  3HNB M;  4QHZ A;  4BIO A;  3BI3 A;  1DIW A;  3I7D A;  4P14 A;  3S0M A;  1F35 A;  5KWR A;  3TAY A;  1V00 A;  2QQL A;  1Y9G A;  1MEC 2;  1VB4 A;  4QDQ A;  4BQ4 A;  4BA6 A;  4Q4Y 1;  1W6O A;  4FFH A;  3WNK A;  3LFI A;  5LBF A;  3RWN A;  2YC0 A;  1RVF 3;  3PIJ A;  5C3S A;  4H7M A;  5C3R A;  2PXJ A;  4R8H A;  5JXI A;  4FPO B;  3GJA A;  5J1X A;  5JXH A;  2WNO A;  1K5M B;  2YU1 A;  1YQ2 A;  3KS7 A;  4GAL A;  2VR4 A;  1F4A A;  4QPG A;  4UBH A;  3T2T A;  3BPS A;  1RUI 2;  2JKX A;  2CDP A;  2VTF A;  3HMY A;  1Q8O A;  3DCQ A;  3LD8 A;  4XHB A;  4F83 A;  5CG9 A;  4AFA A;  1VMH A;  2NZ9 A;  1W8O A;  4JDM A;  2CHH A;  4CUC A;  4QX5 A;  3C7F A;  2B8M A;  3RJR A;  1OT5 A;  3FMG A;  5CKN A;  5LK7 B;  2UU8 A;  1MZF A;  4QKB A;  3AMQ A;  4O9G A;  5C4W C;  1RHI 1;  3AYA A;  4U2A A;  3T09 A;  1NLR A;  3POJ A;  2XLG A;  3B94 A;  1J83 A;  4HOO A;  4X8N A;  1WGP A;  4J25 A;  3ZYR A;  4AEM A;  1NCQ C;  3EQE A;  3JUU A;  3RZJ A;  4PT6 A;  4R9C A;  4IQP A;  2RG4 A;  4Y22 A;  5FZA A;  2A7A A;  2VZP A;  4AHY A;  5C5U A;  3LIG A;  1AL0 G;  1GWM A;  1RUC 3;  4CCJ A;  1P8J A;  4YWA A;  3RDI A;  2WUH A;  3POF A;  4QB1 A;  4ISQ A;  4QB6 A;  2E53 A;  3KM5 A;  4XF1 A;  1HRV 2;  4FPK A;  4ONU A;  5LA9 A;  1W6P B;  2K46 A;  3ACF A;  5IVE A;  4PQQ A;  5EYY A;  4IL7 A;  5FXW A;  5FO9 B;  4DQA A;  1PO1 2;  5JI9 A;  1D0G A;  4NWW A;  4NIA A;  4NRQ A;  4BMB A;  4OHY A;  2P37 A;  2HWB 3;  1ODM A;  3OGG A;  5JIU A;  3CLP A;  2RJK A;  1YIP A;  1AR7 3;  1XC6 A;  4XAB A;  4XF3 A;  5J48 A;  4MG2 A;  1HXS 2;  1EPZ A;  1N47 A;  2WSU A;  4F3J A;  2XPJ A;  3VBR C;  2HWC 2;  2NLR A;  3ACI A;  1C57 A;  5LA0 A;  1XNB A;  3N9M A;  5BNO A;  4D7S A;  2RDS A;  3INA A;  3OSD A;  2VOV A;  4NJ4 A;  4JGY B;  2VNV A;  4CDW B;  3KVA A;  4YRD A;  3H8O A;  1XB9 A;  3VKM A;  2K2S A;  3VHN A;  3ZYI B;  4BU2 A;  1DYK A;  4AHX A;  1T6B X;  5AVP A;  1VBD 3;  5AVA A;  1GP5 A;  5F3E A;  5F3C A;  1G86 A;  1LNS A;  3H3Z A;  3WQ7 A;  4YVW C;  4WVZ A;  3HOB A;  1AYN 1;  5FLH A;  1PK6 C;  2Y0I A;  1TE1 B;  3AZW A;  1W2T A;  2QCS B;  1RUO A;  1QQP 3;  3LA2 A;  4XQD A;  2RR1 2;  3ILN A;  1MS5 A;  2VCA A;  4WM7 B;  2R07 2;  4LKF A;  1QJE A;  5FYB A;  3DKW A;  2X29 A;  4FAH A;  1HRI 1;  5I0S A;  2QQN A;  2ZAA A;  1VBB 2;  1UAI A;  1C5I A;  4D0Q A;  3IAP A;  4YVS C;  4AFC A;  3QBQ A;  1UXX X;  1QDC A;  3QOP A;  5FZ9 A;  3GDB A;  2VCC A;  3VKF C;  1OFS A;  1PVC 3;  1GSL A;  4IGP A;  2EVX A;  1NZI A;  2IWG B;  2VZT A;  1QEX A;  2ZHM A;  5GLT A;  5HI0 A;  3NAP A;  1KS5 A;  4QX7 A;  4XUR A;  3M70 A;  2Q4S A;  1J58 A;  4W50 A;  2A6X A;  3S5Q A;  2FCV A;  2GU9 A;  2XQR A;  3NL1 A;  4PIX A;  2VBD A;  4AK3 A;  5JOZ A;  1ZM1 A;  1A34 A;  5BNN A;  1RUJ 1;  4YZ1 A;  3FJS A;  4LUL A;  3H0O A;  2VXJ A;  1U0A A;  1XYP A;  3JD7 1;  4CSW A;  4AI3 A;  1ZRI A;  1ZBA 3;  4LBM A;  2ZXQ A;  3OTF A;  3AZZ A;  1YJL A;  4LTA A;  2Q8O A;  2P6C A;  3WV6 A;  3H8R A;  1JYT A;  5FBJ A;  3ZFE B;  4HKW A;  3MFC A;  4XJZ A;  4W6X A;  1RXF A;  3V56 A;  3HBK A;  1U5X A;  1JW6 A;  3B69 A;  1PNF A;  1NQD A;  2VW0 A;  5D2A A;  2W68 A;  4I2O A;  4A44 A;  1UX6 A;  1Z78 A;  3FWE A;  3MLK A;  2YPJ A;  1VE0 A;  2BGC A;  5FZK A;  4UFL A;  4Q4W 3;  1PO2 3;  4XQ4 A;  4CP0 A;  4LBQ A;  1AJK A;  4XQW A;  5FZ1 A;  2JB8 A;  5T55 A;  4ERO A;  4Q4V 2;  5F39 A;  1BCX A;  4GXL A;  4RR3 A;  4YVW A;  1K42 A;  3CHX A;  3THD A;  4BK4 A;  1IG0 A;  1PK6 A;  2DUP A;  4LMF A;  5LWB A;  1OI6 A;  2O14 A;  3IPV A;  5FPA A;  4V1P A;  1I6X A;  2R1D A;  1ZNP A;  3KGZ A;  2WFP A;  5DDJ 2;  4LOR A;  3VHP A;  1GU3 A;  1BBT 2;  2B9V A;  3ZFF C;  2HWD 3;  4QT6 A;  5F37 A;  5FP4 A;  3W5M A;  4W8J A;  1XE0 A;  3I3D A;  1VBC 2;  2BEO A;  3VBU C;  1R08 2;  1EPW A;  1NY7 1;  3OG2 A;  1VAL A;  2R06 2;  3JB4 C;  3CJX A;  1K3I A;  4YVS A;  2EXH A;  3WSO A;  4GH4 C;  4XUQ A;  3M8L A;  4BQY A;  2AZ5 A;  5HBA A;  4FTS A;  5DMY A;  3KCY A;  4LLF A;  4BK5 A;  3JBG 3;  4XET A;  2W2I A;  4K7J A;  5FOJ B;  4MGQ A;  3ZYB A;  2D98 A;  3GCX A;  3TEX A;  3WG4 A;  1GOF A;  4GMP 3;  5C33 A;  4KBZ A;  3UKT A;  4XZU G;  3BKZ A;  1O4Y A;  3FHA A;  4CDW C;  4PLM A;  1RGS A;  2QQK A;  5FZ0 A;  1QJF A;  1WD3 A;  3DEM A;  3LSD A;  3VBS B;  4BIS A;  4XXP A;  5FYZ A;  4EQV A;  1MPX A;  3C8X A;  2P5B A;  1AR6 3;  4LLO A;  1ZZ9 A;  4OHX A;  4Q8K A;  2WNU C;  3K46 A;  1VAV A;  4RFR B;  4GUL A;  1HB2 A;  1PMJ X;  2D5F A;  2X5I B;  2C9A A;  1S0G A;  1WME A;  2GP5 A;  4WM7 C;  1UY2 A;  2BNN A;  1Q8V A;  2WZ8 A;  5IK4 A;  2V72 A;  2LW8 A;  3SXW A;  1F8V A;  4HT1 T;  3P3P A;  2A6V A;  1MZE A;  4MZU A;  1PMI A;  3M7A A;  1RIR A;  4NUB A;  2OS2 A;  2RE9 A;  4Q0Q A;  5IFP A;  5KHJ A;  3BU7 A;  3ZXA C;  5H9S A;  3ZX7 A;  1C4R A;  4AAX A;  1DCS A;  1W90 A;  4OUE A;  4IER A;  3RMX A;  2G9G A;  2NN8 A;  4TLG A;  4XC9 A;  3VL9 A;  1UKG A;  4Q4Y 2;  1CR7 A;  2PHF A;  1C8N A;  1YFW A;  5A32 B;  5IK8 A;  3UGG A;  5FYS A;  4HK8 A;  4NMI A;  1KFU L;  2GC0 A;  5F3G A;  3ZFF A;  3AK0 A;  3FC0 A;  1V6J A;  3T2Q A;  2A1X A;  1WW5 A;  1LOE A;  4NPM A;  4XFI A;  3SHR A;  5JOX A;  3VBU A;  1O3S A;  4H2A A;  5T5O A;  4F8A A;  1PMH X;  3HD8 B;  2WS9 1;  4XFC A;  5FO7 B;  4PDW C;  4AXO A;  1OH3 A;  4YW6 A;  4ZS2 A;  4I3P A;  5CEH A;  2BBV A;  4YG3 A;  3J8F 1;  3ZFE C;  4AL9 A;  4ZZ5 A;  2ET7 A;  2VH9 A;  1WLC A;  5FCC A;  3POY A;  3AP7 A;  4M4P A;  4MGT A;  3A7Q A;  1W3X A;  1KRI A;  3MDP A;  5FTT C;  1MQT B;  4OUL A;  1MS1 A;  3E97 A;  3P5B A;  1A3K A;  3UGH A;  2VY0 A;  3E1F 1;  3E6B A;  4R52 A;  3N7L A;  1DQ0 A;  4YPJ A;  3PL0 A;  2G19 A;  4JDO A;  1F9K A;  1N1T A;  4A45 A;  5GM0 A;  3MLJ A;  2X53 S;  5FJH A;  5DXD A;  5ABJ C;  1ALY A;  3LZZ A;  4P08 A;  1TQ5 A;  2D3P A;  4BPZ A;  2BRT A;  2DU0 A;  1IS3 A;  2P6H A;  4DXZ A;  1JZ2 A;  2XUM A;  2BNO A;  1QJU 1;  2R04 3;  4Q1P A;  2OA2 A;  2OII A;  2WNU A;  4Q4X 3;  3PUQ A;  1WCK A;  2VU9 A;  4CTE A;  4NE9 A;  3CQO A;  1UYX A;  1Z7S 3;  5A6Z A;  1LGC A;  5A7W A;  4NWV A;  2OX0 A;  5IFT A;  1NXD 1;  1QXR A;  4IGO A;  4LPL A;  1LOF C;  5CFD B;  1OQE A;  3NQH A;  1Q56 A;  3ZFG C;  2R49 A;  3GAL A;  4P9W A;  1UY1 A;  4HN1 A;  4M0N A;  3CJI A;  3F95 A;  4YW4 A;  3ASI A;  2E7Q A;  2X10 A;  2PLV 3;  2ZX3 A;  2VZU A;  1UZW A;  1W2N A;  1W8T A;  3F2Z A;  3AFG A;  3PVO A;  2EA7 A;  2DTY A;  2MEV 2;  3FBM A;  4IET A;  1UOG A;  3K4D A;  3RSJ A;  2JDH A;  2YMZ A;  5JOW A;  1IS6 A;  3FZ3 A;  2GME A;  4XCA A;  5FY9 A;  3OUI A;  2EXI A;  1DG6 A;  2FDK A;  4NHX A;  5LBB A;  4FOQ A;  5FZ4 A;  5C6C A;  4O65 A;  4N53 C;  4RSU A;  2VE1 A;  3EJK A;  3SC7 X;  4AED B;  2LAL A;  1XNT A;  2ZGS A;  1S0E A;  1YRZ A;  3L2Y A;  3KSC A;  5FYV A;  4GQ7 A;  4HN0 A;  4N9H A;  1GP4 A;  1UU6 A;  3AKS A;  4P9J A;  4CA9 A;  3A21 A;  4MXV A;  5IAT A;  4M3C A;  1H30 A;  1CQ9 A;  2ERF A;  4HKL A;  1ZRF A;  1XNK A;  5FP9 A;  1W39 A;  2VZ1 A;  4IV3 C;  4NO4 A;  1BEV 3;  2RVA A;  3AL6 A;  3GBF A;  3H7J A;  3LQC A;  5FQ0 B;  2X5I C;  4XDP A;  1O5U A;  1WCD J;  2KM2 A;  5IVB A;  2JX9 A;  1ZX5 A;  2HH9 A;  2DYC A;  3KZ4 C;  1SFY A;  4RGG A;  3T0D A;  5HV0 A;  5FPL A;  4Z07 A;  4CXY A;  2AGS A;  1C5H A;  2JD4 A;  4MXW B;  4RGK A;  4YZ3 A;  2WWS A;  3VGI A;  3OPW A;  4UYB A;  1KDM A;  2WA3 A;  5BYN A;  2IVJ A;  3MBW A;  2W92 A;  2VZS A;  1LHW A;  3R0R A;  4DUX A;  3DV8 A;  3IN9 A;  5KHG A;  4OQ9 A;  2DBN A;  3VZM A;  2RS1 3;  1VMJ A;  5JWP A;  3VUO A;  2VBP A;  4BXF A;  3APB A;  1HB3 A;  3AKT A;  1LOF A;  4L2N A;  1VB2 A;  2ZEZ A;  1FI2 A;  1L7Q A;  1UYY A;  2ZGR A;  1RUJ 2;  1UF2 C;  2XJU A;  3EXU A;  1RC6 A;  3ZFG A;  4Q1R A;  4B1L A;  5F1R A;  5JXG A;  1YYN A;  1PGL 2;  1S0F A;  1AR9 3;  1ULP A;  3VBF C;  1F2N A;  2RS5 1;  3IDE A;  2W47 A;  3VBH C;  1LHO A;  3GBW A;  4WM8 A;  1LR5 A;  3TEZ A;  4E8C A;  2IXK A;  3IZO A;  1W3V A;  3AYC A;  3RZL A;  2HEY F;  3ZSJ A;  4LO5 B;  2B5H A;  3FHQ A;  2VVD A;  1HLC A;  1MQT C;  5L9B A;  1QNY A;  5LW9 A;  5EV7 A;  3V64 A;  4AF9 A;  4N53 A;  3O7O A;  2W52 A;  3WP5 A;  1LEC A;  1QHD A;  4LIV A;  1GWL A;  1UKR A;  3VN4 A;  3HJR A;  1K5J A;  1H0B A;  3FN9 A;  1W6M B;  3PIG A;  5JLV A;  1YQ5 A;  5FLJ A;  4BQ5 A;  1FMD 3;  3ETQ A;  3AP6 A;  2YFU A;  2VPV A;  4BQ1 A;  4UW4 A;  4UAP A;  1OLM A;  4NAO A;  1LOG A;  1LEN A;  1H8T B;  1LHU A;  4YZ4 A;  1GMM A;  1H2N A;  3UJQ A;  4CDX B;  3NV3 A;  2WRA A;  3TOJ A;  1LOB A;  3SH4 A;  3ETP A;  3I2I A;  5DUX A;  1MAC A;  1COV 2;  1RUI 1;  1K12 A;  2W1U A;  5FY0 A;  2VJX A;  3ZLI A;  5CFD C;  3OEB A;  3M4F A;  3WQ1 A;  4OHV A;  1RB8 G;  2FZ2 A;  1LTE A;  4UI9 L;  2BNM A;  4YM2 A;  1WLW A;  5L36 A;  1KJR A;  3AFK A;  2B45 X;  1Y43 B;  4LK6 A;  2VBB A;  1NY7 2;  4BQW A;  4YGC A;  5FMO S;  2VGD A;  4XPV A;  3WDT A;  1XJA A;  4I3G A;  4A6S A;  2A6Y A;  4KH9 A;  4ZXK A;  4N43 A;  3A4U A;  1WA4 A;  3KMH A;  3ILF A;  2V5Y A;  5CKQ A;  1E57 A;  2Z69 A;  5G04 L;  4AVA A;  3C7G A;  2H6C A;  4RQP C;  2ZX4 A;  3G6J B;  1FPN 3;  1WA6 X;  4XFH A;  1ZZ6 A;  5T5L A;  1CAV A;  3BYW A;  3PVB B;  5B4N A;  2Y0O A;  3PTR B;  2HWE 3;  1SBD A;  3I59 A;  3OEA A;  1CIY A;  2WQZ C;  4CEY C;  2IFR A;  3WZ1 A;  4XAE A;  2XGX A;  4IEW A;  3AMM A;  2XOM A;  1XSQ A;  4XFG A;  3RMY A;  3VBH A;  1HRV 1;  1WW7 A;  2A71 A;  2J1R A;  3MGU A;  2F6B A;  1NYW A;  1PVC 2;  3C7E A;  1PO1 1;  4QDR A;  2GMP A;  1NX9 A;  3TRS B;  1AX2 A;  1J3R A;  4QWN A;  3AC0 A;  1W8Z A;  4FXG B;  1HXS 1;  3I54 A;  4MOA A;  4IV1 B;  2VVE A;  4WVM A;  3V0A B;  1AR8 2;  1JYV A;  3M3C A;  2BGP A;  2AAC A;  4LIU A;  4OI2 A;  4UF0 A;  5FUP A;  3L2H A;  1ASJ 3;  3PUR A;  3NNF A;  5IT6 A;  2XUE A;  4JGZ B;  1BLZ A;  4QPI B;  5J09 A;  1QXJ A;  4C0B A;  4CEW A;  4CE8 A;  4BQ3 A;  1VMF A;  3MUZ 1;  4E9K A;  2BVB A;  2ZEW A;  3VDD B;  4LIT A;  3W59 A;  5LCW L;  5IAX A;  2HWF 2;  3LKJ A;  1ENX A;  4KG8 A;  5EWS A;  2XH6 A;  1YQC A;  4GZ9 A;  5E1R A;  4WZF A;  4PI0 A;  2XWB B;  5FUI A;  3WNL A;  4BLJ A;  3USS A;  4QPG B;  3WNP A;  4FXK B;  3TN9 3;  2C26 A;  1ND2 C;  1MZ6 A;  2WT0 A;  4A3Z A;  1S0C A;  3KHC A;  1GAN A;  3ZPO A;  1CON A;  1V9U 3;  1ZBE 2;  3A23 A;  2ILM A;  4Q4W 2;  4P5Y A;  5L19 A;  3OF1 A;  3N9O A;  2JE8 A;  2DVF A;  2OQ6 A;  1GZC A;  2VQU A;  4OVE A;  4QU2 A;  2GNT A;  2I07 B;  2DF7 A;  3K4A A;  2R07 1;  2WJS A;  3R05 A;  4ATF A;  2RM2 3;  2C5D A;  2OVU A;  3POW A;  3NV4 A;  4LBQ D;  3ZPY A;  4M3C E;  3BUC A;  4E2S A;  1NKG A;  3VKN A;  1I9R A;  4IE0 A;  4RQP A;  1YIF A;  1R1A 3;  3S7I A;  2VUA A;  2JG8 B;  4WVV A;  3LOI A;  3RYK A;  1GZW B;  1J3P A;  2OW4 A;  3PVN A;  5FYM A;  2WWJ A;  1RUG 2;  1AYM 1;  4CDU C;  1LOD A;  3ZIW A;  1CES A;  4CEY A;  3MIC A;  4TWT A;  5DAP A;  4Q26 A;  2XG3 A;  1HQL A;  3N7M A;  4AWD A;  3ALQ A;  4Q0S A;  4AQ6 A;  3MV0 1;  3JBG 2;  1OBN A;  1H8T C;  3WXP A;  3WNO A;  1QJU 2;  1A6C A;  1GZT A;  1CGP A;  1W04 A;  3WDV A;  3I2G A;  2JB4 A;  4NVP A;  4QKD A;  1D2Q A;  3UL2 A;  5FZM A;  4FPL A;  1JOJ A;  3ELN A;  4JKL A;  4NPR A;  3V0B A;  2OKX A;  1TMF 3;  3I3Q A;  1UU4 A;  1MS4 A;  2YBK A;  1RUH 3;  4DRV A;  1RUD 3;  2DUR A;  2JDN A;  3Q8C A;  4UBG A;  5KBF A;  2WZE A;  2EXJ A;  1HJG A;  5FYT A;  2FBE A;  3ZDV A;  1E5R A;  2PHR A;  3CEW A;  3HAG A;  4I09 A;  4LJH A;  1S55 A;  4HON A;  4B4R A;  4D6S A;  2D5H A;  2CGP A;  1C8M 3;  4XE9 A;  1EUU A;  1NCR B;  3N9L A;  4IEX A;  3WW3 A;  5C3Q A;  3ENR A;  1FT9 A;  1HDK A;  4P00 B;  1HV1 A;  5E16 A;  3IDC B;  1JZ5 A;  1ND2 A;  4Q4V 1;  2JDK A;  4Y1U A;  2XVG A;  1BQP A;  2OZJ A;  1KJL A;  1NE4 A;  1BJQ A;  3KQ4 B;  4KWL A;  4NRP A;  4BH9 A;  2JDA A;  4ORF A;  5K8S A;  2NM1 A;  4Y5Z 0;  2ZX2 A;  4YW3 A;  5L7O B;  4RHV 3;  2OPK A;  2XJV A;  3USU A;  4JAA A;  5DDJ 1;  1XU2 A;  1BBT 1;  2B4K A;  2DCT A;  1OLM E;  1ZA7 A;  3B01 A;  1HB1 A;  4OZO A;  4AGG A;  1R09 2;  3BPZ A;  4CP2 A;  5BNP B;  1R08 1;  2FDI A;  3JZV A;  2R06 1;  3HQX A;  4P5H A;  4Y20 B;  5FZH A;  4B7E A;  4NRO A;  2WNV B;  3GNE A;  3HR9 A;  4ITC A;  5A33 A;  4IV1 C;  4PJY A;  2LS6 A;  4QXH A;  1UN1 A;  1KEX A;  2AH2 A;  3MV1 1;  4YSF A;  4NHL A;  2YC2 A;  1VAM A;  1G9F A;  1ULF A;  4HSJ A;  2IVI B;  4JGZ C;  1LRH A;  4QPI C;  3R6S A;  1LJ7 A;  2YV8 A;  2R0H A;  1IS5 A;  2BDR A;  1JOD A;  3RS6 A;  2WBK A;  2JIJ A;  5BNQ A;  4H14 A;  3VDD C;  4XCB A;  3O14 A;  3ZN6 A;  5IW0 A;  5BNN B;  1RHI 3;  1UMZ A;  1WCS A;  1KS4 A;  1X9P A;  4YAR A;  1CAU B;  2LUW A;  1B35 B;  1N3O A;  1XNC A;  3DPR C;  2ETE A;  2CWS A;  2W46 A;  1OD3 A;  3K3O A;  5BUV A;  1ZRE A;  2BZD A;  1ND3 B;  4TXW A;  2QBX A;  3M3E A;  1X7N A;  1QOO A;  1BVP 1;  4NRM A;  1NA1 C;  4QD2 A;  2PA7 A;  2WII B;  4IEU A;  1W03 A;  1CZT A;  1VRH 1;  3T1L A;  5GJ6 A;  4DEV A;  4ZXE A;  1S0D A;  4B8E A;  2CL2 A;  1X8E A;  3WCS A;  1CAX B;  1JZ6 A;  1ULD A;  1YJK A;  3PU8 A;  4C1W A;  4KI5 M;  3LEI A;  2YU2 A;  4XF0 A;  3HN1 A;  4XDO A;  1EAH 2;  4LBQ B;  1UMI A;  3U14 A;  2J1E A;  3KV4 A;  3CBN A;  1BYH A;  4NHM A;  2GDF A;  2Q1F A;  4RR3 B;  5F32 A;  3OD4 A;  4X6R B;  4IXL A;  5FIX A;  2P2K A;  2CNA A;  5J98 B;  3SMH A;  3IPV B;  3O1R A;  2Z5W A;  1KDK A;  1TVG A;  3WLU A;  2ZHK A;  1AX1 A;  3KVB A;  4XIL A;  3VHR A;  5A3U A;  5IVV A;  5CIS A;  1RUN A;  4OFG A;  3H8X A;  2IXL A;  3LEG A;  3PUS A;  1S2E A;  3J9S A;  1F5F A;  3H1Y A;  3AXD A;  4I30 A;  2BTV C;  1E5I A;  2W91 A;  2D6P A;  1OOP C;  1D4M 3;  1SZB A;  3HEI A;  4YLZ A;  4E4S A;  1DFQ A;  2VTX J;  5C70 A;  3OGS A;  2N7G A;  5IHR A;  2CU5 A;  5L73 A;  1AYN 3;  4MAD A;  1V70 A;  4MGI E;  5K0U A;  5LK5 A;  5FK8 A;  4OHZ A;  3ZSM A;  4EWD A;  2RS3 3;  2XVK A;  3UKN A;  1UD1 A;  4B29 A;  3RVH A;  4M3C F;  5JZG B;  1L7R A;  3EB7 A;  5A7O A;  1JN2 P;  4O61 A;  1HRI 3;  2CSG A;  4TLF A;  2CDO A;  3W9A A;  3BU0 A;  3SH5 A;  3DPR A;  1Q3E A;  5I0R A;  2VME A;  2VQT A;  4XOG A;  5FZI A;  1JBC A;  4N8M A;  4COV A;  1H6Y A;  1OVS A;  2GN3 A;  5EXO A;  1VAK A;  3C2U A;  1IHM A;  2DTW A;  3B02 A;  2BGO A;  1W0N A;  2CGN A;  1W9S A;  5L7O C;  3T08 A;  2BFU S;  3N7J A;  5FP3 A;  2DVA A;  3SCF A;  4QX0 A;  3WP6 A;  1RMU 2;  3AXE A;  4C1X A;  2DV9 A;  4CUG A;  2QTW B;  1OVP A;  3WHT A;  4EN8 B;  5AFE A;  2EIB A;  5KC5 A;  4NPL A;  2RS1 2;  4FFF A;  3UV9 A;  4QX3 A;  5GZE A;  3H8U A;  2X05 A;  2WNV C;  1YFX A;  1U5Y A;  1N3Q A;  2XWJ B;  3LOB A;  2YXS A;  2MEV 1;  4D6Q A;  4IEV A;  1REF A;  4MO3 M;  1W28 A;  4EYU A;  2HBT A;  1YI9 A;  2VOT A;  5D8A B;  3U75 A;  2VUJ A;  3WW2 A;  2D7F A;  4HG6 B;  1UNB A;  1WCQ A;  1GWK A;  1IG3 A;  2VCB A;  4IDZ A;  4UWD A;  4K9S A;  3OPZ A;  4P9X A;  5A1A A;  4HKO A;  2Y38 A;  4DZG A;  4R4Z A;  3M2M A;  1EV1 2;  1SLA A;  1G6N A;  1FNZ A;  2ARC A;  2BOJ A;  3LAG A;  4OCT A;  3RJ2 X;  1H9W A;  5IYY A;  5AFB A;  1O8P A;  1B35 C;  2J1A A;  1TME 2;  1Y3T A;  1DQ4 A;  1XE8 A;  2XJT A;  3OOX A;  3LIH A;  3AYE A;  5KHI A;  3RZM A;  2J7M A;  1ND3 C;  3O1M A;  4QQ2 A;  2B39 A;  1OOP A;  1QOS A;  2J1T A;  4IUG A;  3HQU A;  3S57 A;  1C28 A;  2I74 A;  5C4W A;  1H9P A;  2GMM A;  5ANQ A;  3CL1 A;  2NYY A;  2D40 A;  3N7K A;  4E4H A;  5HPO A;  3N3H A;  5J7M A;  5JPM B;  1BXH A;  1HV0 A;  5BY5 A;  3ZXF A;  5ACA 3;  3DYO A;  3MEP A;  1NCQ A;  4WV8 A;  1QJY 2;  3UGF A;  3S30 A;  3LA7 A;  4E4D X;  3T30 A;  4HET A;  5HCA A;  3DYP A;  4DRR A;  2VUD A;  1A78 A;  4E2Q A;  1AYM 2;  3KV9 A;  4YZ2 A;  3BN6 A;  4HPK B;  4YNI A;  2IXC A;  1TNR A;  4XZP A;  5LEK A;  4TN7 A;  3I2F A;  2WO1 A;  2VQ0 A;  3ACG A;  4LOS A;  1NG0 A;  1ODN A;  2UWC A;  4W4Z A;  5A7W B;  4HAN A;  4D3W A;  4G3Y C;  4Y1X A;  1SPP B;  4DPN A;  3MYX A;  4DEQ A;  1RIN A;  5CNA A;  1K5M C;  1PGL 1;  2R30 A;  1FPN 2;  1HB4 A;  3Q8A A;  5CU1 A;  4OQ8 A;  5FYH A;  1V6N A;  3AX4 A;  2VZO A;  3H7Y A;  4URT A;  3OY8 A;  1HKD A;  4YG0 A;  4JHZ A;  1CAW B;  5TSW A;  4AVB A;  3E6C C;  1YHF A;  1SLL A;  4QU1 A;  3SCH A;  4LO4 B;  3O1S A;  2JIG A;  4RGA A;  4XUO A;  1S1A A;  2Q5T A;  1LOC A;  2Q0A A;  3VBR A;  5LB6 A;  4RS5 B;  5DQ0 A;  5DZF A;  2ZGN A;  3AP4 A;  4ZU5 A;  5FY1 A;  1UY4 A;  4IE7 A;  5J96 B;  1UYP A;  1ZZC A;  2WO7 A;  2VW1 A;  2WO2 A;  3ZMN A;  5IK7 A;  3MFA A;  1UQX A;  3BCW A;  4LKD A;  4RFT 0;  4LNV A;  5C8C B;  3BTA A;  1BVV A;  2VMC A;  1XNA A;  3ZYH A;  4BZ4 A;  5B2G B;  5JZG C;  2ZEY A;  4BB3 A;  1M06 G;  1Z0H A;  1NE6 A;  2G9Z A;  2RDR A;  1AR7 1;  1S4C A;  5A7S A;  5JSR A;  3GYD A;  5CVR A;  1UCX A;  4LUK A;  1DQ5 A;  2WA4 A;  4OMD A;  1GQG A;  2ZGQ A;  4IGQ A;  3GZU C;  4FOW A;  5FZE A;  3UYJ A;  2EF6 A;  5LY1 A;  3OGR A;  1RL3 A;  1RUE 2;  4M3C B;  2BWC A;  4GB3 3;  2OZ6 A;  1W6N B;  3PU3 A;  1DGW X;  2ARA A;  1QJX 2;  3SIS A;  1YWK A;  2GP3 A;  1ENQ A;  1COV 1;  1D4V B;  2SLI A;  5DPN A;  1UOF A;  3SQO A;  2YFZ A;  4UFI A;  3VBO B;  2ARB A;  1QGL A;  1VR3 A;  5FY8 A;  5JMO A;  2WLQ A;  2VCM A;  2Y34 A;  5LY2 A;  1HJF A;  3IBM A;  4LEJ A;  3I49 A;  3WIN E;  4OYU A;  3U1X A;  4BE3 A;  3O1V A;  1DGW A;  3VZO A;  4XVH A;  3CKH A;  5IWF A;  1GR3 A;  5E89 A;  5DUW A;  1VBA 2;  1FOD 3;  2UY9 A;  3QAC A;  4JQT A;  1MZ5 A;  1VJ2 A;  3WG2 A;  4QKN A;  3DL3 A;  5I0U A;  4BDV B;  3X29 B;  2RM2 2;  3NWK A;  2XJR A;  5FPB A;  4QM8 A;  3POG A;  4QM9 A;  2F4L A;  4JGY C;  5I0D A;  4XJW A;  1GOG A;  1VLN A;  1R1A 2;  3HN3 A;  2WNE A;  3MIE A;  1AX0 A;  5JI7 A;  3H42 B;  3SKV A;  3VV1 A;  1SQ4 A;  1RUF 3;  2JG9 B;  3HNM A;  2VXR A;  3SKJ E;  3T4H B;  2XBO 2;  1US3 A;  1PVC 1;  3A0K A;  3AJZ A;  4WM8 B;  3LCP A;  1QMJ A;  3I2O A;  3VD7 A;  1RJ8 A;  4K1Z A;  3G7D A;  2GC2 A;  3U4X A;  4NOT A;  4JRL A;  1YI7 A;  1VRH 2;  2PQQ A;  2YY1 A;  4K1Y A;  2RMU 3;  2EAK A;  3WY6 A;  2VUL A;  1AR8 1;  2ZGU A;  5GLV A;  2R16 A;  3RYP A;  5AC9 2;  3ZMO A;  4JHT A;  3VLB B;  4Z1V A;  3AZX A;  3C7H A;  1UU5 A;  2BWA A;  2MPF A;  3HNY M;  4CU8 A;  4EWA A;  2BER A;  1SBE A;  1FAT A;  2VC9 A;  3KT4 A;  3ROU A;  2VNR A;  2HWF 1;  1L7L A;  4XJA A;  5EHD A;  2Y6J A;  5FLI A;  4A6O A;  1H1M A;  3WT3 A;  1W6P A;  5F6L B;  3AMN A;  4Q27 A;  3BTX A;  3ZOI A;  5GZC A;  1ZBE 1;  2WFF 3;  4XUT A;  4LXL A;  1SHW B;  2VO5 A;  4Q4W 1;  4ZHN A;  5LAS A;  3O0W A;  4QAW A;  4FO9 A;  1YO8 A;  1UY3 A;  2RHP A;  4DFS A;  1NQJ A;  2PHT A;  3D8C A;  4GH4 A;  4CDQ B;  5C9A B;  3OCP A;  5LZ6 A;  2TBV A;  3ZYG A;  4AI8 A;  2D6K A;  3ZN4 A;  5IK5 A;  2ATF A;  4RS5 C;  4FCA A;  3VDB A;  1G9B A;  2UYB A;  3MIH A;  1UIK A;  4A3X A;  4ASK A;  2Z42 A;  4OMC A;  5JIA A;  2WQ4 A;  1JMU B;  2D6L X;  2HWD 1;  2CWM A;  2G1M A;  5C8C C;  1AL2 3;  1UZ0 A;  2W1Q A;  1RUG 1;  4JGY A;  3WP3 A;  2ZAH A;  4PLO A;  4AEK A;  4CDW A;  1JZ7 A;  2A6Z A;  3MLL A;  3SEP A;  2ZS6 B;  1W6Q B;  4CU9 A;  3GZE A;  3I59 B;  3UES A;  5H9P A;  4CCK A;  2AEN A;  3JB8 A;  3D6E A;  2NMN A;  3ZYP A;  1ULE A;  3JBG 1;  2PHL A;  3L9J T;  5CFC B;  1PZ8 A;  5EYX A;  1JZ4 A;  4NAM A;  3FFZ A;  4AFB A;  2RV9 A;  4I01 A;  1REE A;  1H4G A;  1V6I A;  4QQH A;  4WM7 A;  5A3O A;  1JZ8 A;  4Z8B A;  4IEY A;  1KFX L;  4QPW A;  3ZSK A;  1OLR A;  2W1W A;  5FZO B;  1V6L A;  1DP0 A;  3IT8 A;  2FDG A;  1IKP A;  1DGR A;  5A3W A;  1LES A;  4DXS A;  1V6O A;  1QF3 A;  4CP9 B;  3WDX A;  1NLQ A;  1NXM A;  1HQN A;  1HX6 A;  2E26 A;  2VOK A;  3MW4 A;  5L9R A;  4R9B A;  3NNJ A;  5EFU A;  1L3J A;  3N35 A;  5FY4 A;  1OC1 A;  4FPY A;  4CEW B;  2RS5 3;  2ZGT A;  1FAY A;  2R6Q A;  5A3L A;  1VP6 A;  1WZX A;  5GZF A;  4CP1 A;  5FZB A;  4QB2 A;  4TZD A;  1W8N A;  3BTY A;  4QHO A;  5CBL A;  1H8V A;  3T0B A;  4BIF A;  1CD3 G;  3D4K A;  5T5J A;  1XPW A;  1JYX A;  3A0N A;  1SBF A;  4XEZ A;  4LA2 A;  3JU9 A;  3ZKY A;  3TEW A;  3TYJ A;  3VBS C;  1IQD C;  2Q8E A;  1I5Z A;  2FZ1 A;  2PEL A;  1MEC 3;  1OD5 A;  4PDW A;  4XBQ A;  1UMH A;  4LA3 A;  1UZY A;  4DNY A;  3ZFE A;  4BM8 A;  4XMI A;  4YGB A;  5FAX A;  3HPN A;  4ES9 A;  1XSR A;  2VUC A;  3K75 B;  1OQ1 A;  1SEF A;  1R09 1;  4D6R A;  1N1V A;  4LE3 A;  4Q0U A;  1PIV 3;  3ZSE A;  3U37 A;  4OI4 A;  1JS9 A;  4BCU A;  1RVF 2;  3E5X A;  4GWJ A;  1OKO A;  2GC1 A;  1N3P A;  4L99 A;  3SLI A;  3LA3 A;  2JDM A;  2V09 A;  3KT1 A;  3MID A;  3PHM A;  3WVJ A;  2VM9 A;  4BLI A;  2ES3 A;  1TNF A;  2ENR A;  3D0J A;  1GNH A;  3WF4 A;  5F6K A;  5ABJ A;  5FDB A;  1W9T A;  3EHK A;  4P9G A;  5EJZ B;  2WKK A;  4LBK A;  4AI2 A;  1EY2 A;  5A1L A;  1Q43 A;  4HSL A;  4YW7 A;  3ZO0 B;  3VD5 A;  5K7P A;  1POV 1;  1QXP A;  1UY0 A;  4XTM A;  3RI8 A;  5DG2 A;  5JAX A;  4MHU A;  2IFW A;  3B9I A;  1D0H A;  2Q1M A;  2ZPX A;  5GLU A;  5CAZ A;  2R1B A;  2RS3 2;  4LHL A;  5J3U A;  4O7X A;  5FZ6 A;  1OPO A;  2OYZ A;  1DZT A;  5EJ3 A;  4ZS3 A;  5T5P A;  1O3Q A;  2FCT A;  3ZN5 A;  2P3K A;  3NNL A;  2VZR A;  4L0P A;  1OA2 A;  1YEW A;  4CDQ C;  5C9A C;  2KXL A;  1RUC 2;  2BBA A;  3HT1 A;  3WW1 A;  3AP5 A;  5FZ7 A;  4WBB A;  3I4I A;  2C0Z A;  1O4T A;  3BOD A;  2D6O X;  5FXZ A;  3CF6 E;  1PO1 3;  1Y7B A;  1CJD A;  3TEY A;  1EAH 1;  3U11 A;  1XQN A;  2P1B A;  2W5F A;  1F31 A;  1TG7 A;  2PLV 1;  1YUD A;  2HWB 2;  3VBS A;  1GP6 A;  3AMH A;  2CAV A;  1AR7 2;  5F5I A;  2HWC 3;  1OH4 A;  2ZEX A;  3N9P A;  4OUM A;  4CPB A;  3R4U A;  3WEZ A;  3IM0 A;  2PFW A;  2JDU A;  2QQV A;  4I0B A;  4R4X A;  1J59 A;  4IV3 A;  1Q8S A;  3BB6 A;  1BK1 A;  3Q9O A;  2X5I A;  1BKZ A;  1V0A A;  2JXA A;  5HCB A;  2AC1 A;  2H0B A;  3LDB A;  3OYW B;  1OUX A;  4G4F A;  3DF0 A;  2DCY A;  4QMA A;  4RD7 A;  4LO6 B;  3WOG A;  1X82 A;  1O3T A;  4SBV A;  4R9A A;  1JXN A;  1SDW A;  1QU0 A;  3QCW A;  5GKA C;  1VBD 2;  4M0H A;  1OSG A;  1G8W A;  2ZAB A;  2HJI A;  2DVG A;  5CB7 A;  3RNS A;  4C91 A;  4SLI A;  5JR2 A;  2E51 A;  4AHZ A;  5LA1 A;  5LBC A;  2RR1 3;  3POB A;  2WAB A;  2X8K A;  2VOX A;  4S2H A;  2GH8 A;  4S2F A;  2VOW A;  5FZ8 A;  2YZ4 A;  1QQP 2;  2WZR 3;  4OZX A;  4ARX A;  2RJL A;  4H3W A;  2WSV A;  4JVA A;  4D69 A;  1DQ1 A;  2PQS A;  4C90 A;  5A32 A;  4FSJ A;  1VBB 3;  5SV8 A;  3UKV A;  5ACA 2;  4QKF A;  4AED C;  3MW2 A;  4L97 A;  4QX1 A;  4Q0P A;  2ZGK A;  4ZY9 A;  4YM1 A;  4K40 A;  2W9X A;  3ZDS A;  1LHV A;  2JEN A;  4EN6 B;  1POQ A;  4AZZ A;  3VBF A;  1GQP A;  3AVR A;  2B46 X;  2VZQ A;  1RMU 1;  2HEV F;  5DAX A;  5EPA A;  2LRO A;  2Y6K A;  5DUU A;  2RS1 1;  2VNG A;  2AEY A;  2TNF A;  1MVE A;  3MPB A;  3URF A;  3IDA A;  4PI2 A;  4AVV A;  2WT2 A;  1MQT A;  1YC6 1;  2P3J A;  4JRA A;  5KHH A;  1S2B A;  1JYC A;  4DY3 A;  1X8M A;  4PF5 A;  1DQ2 A;  2WN3 A;  3NNG A;  5C71 A;  2E9Q A;  1GQH A;  2Q8C A;  1DGR N;  4QXC A;  2H6B A;  3R4S A;  4K3U A;  5GLZ A;  4AW7 A;  1AR9 1;  1MS0 A;  1OF4 A;  3PJY A;  1ZBA 2;  4A42 A;  2ADD A;  4KBB A;  1QH7 A;  3WNM A;  1AF9 A;  2YUE A;  3KQR A;  4LOT A;  3GJB A;  4ATE A;  2WIN B;  1W6O B;  5D1I A;  2XML A;  3ILR A;  5FZG A;  1OFN A;  1EV1 1;  1WBF A;  3NV1 A;  5FK7 A;  3J26 N;  1N1Y A;  3LDR A;  1QNW A;  4DO0 A;  3O1P A;  4B3N A;  1G9A A;  3OBR A;  1TME 1;  4ET7 A;  4UFJ A;  2ZGO A;  4UW6 A;  2VVF A;  5I91 A;  2D6N A;  4N7U A;  5CFD A;  3BTZ A;  4BHP A;  4Z82 A;  3PMS A;  1QKQ A;  4CUA A;  3Q8F A;  1FMD 1;  4Q4V 3;  1PO2 2;  3ES4 A;  4Y26 A;  2WYS A;  4J1X A;  2QVS B;  3MI8 A;  4FOY A;  3T3Y A;  4LO7 A;  4YGE A;  5FXX A;  3WF1 A;  3VD4 A;  4XBL A;  3IWZ A;  1NAE A;  5JXJ A;  4JC1 A;  3VZL A;  3IIA A;  5JSP A;  1QY4 A;  5DDJ 3;  1QJY 1;  1BBT 3;  1FV3 A;  1YLL A;  1LGB A;  2YG0 A;  1D2S A;  1VBC 3;  2QKD A;  3CNA A;  4X8P A;  2HWD 2;  1ZRD A;  2FMY A;  3NJY A;  5BXX A;  2EXK A;  2R06 3;  2CYF A;  2QQM A;  1S2K A;  4Y22 B;  2FDJ A;  3N9N A;  3WW4 A;  2FMD A;  3B93 A;  4QDS A;  2DFC A;  3T4V A;  2F17 A;  2NP0 A;  3J7H A;  3H50 A;  4E4Z A;  1KIT A;  1ULG A;  2DFB A;  1VBE 3;  4PBO A;  1RYY A;  3P1I A;  3M3I A;  4QX2 A;  3CMG A;  4QXK A;  4ASL A;  2XL7 A;  1A8D A;  1O7F A;  1FOD 2;  2OPW A;  4C8D A;  5F9T A;  4S2D A;  4CDX C;  2XVL A;  2QZ3 A;  1FPN 1;  1XXN A;  1AXK A;  4CRQ A;  4EZH A;  4KMQ A;  4GD4 A;  4LBO A;  2G9F A;  3BIW E;  3P3N A;  1YFU A;  4MXW A;  5EJ1 B;  3WQ0 A;  1K45 A;  2QQI A;  1DQ6 A;  1POV 0;  4FPH A;  4KWU A;  1LAJ A;  2E33 A;  3NMB A;  1I1E A;  1AR6 2;  4HVR A;  1GOH A;  1G9D A;  2KD7 A;  5BNO B;  2QFE A;  4YGD A;  4LT5 A;  4L8Q A;  3AKP A;  2Z4F A;  5T50 A;  4V2V A;  4W6Y A;  1OUS A;  4FQZ A;  2LM3 A;  2Q1Z B;  5KXB A;  1W06 A;  1PZ7 A;  4NII A;  3AYD A;  4LE4 A;  2WT1 A;  1W05 A;  2VZ3 A;  1VPH A;  3VZK A;  3WDU A;  1OA4 A;  3M3Q A;  4COU A;  2RMU 2;  4ARY A;  4WVW A;  5FY5 A;  3E5U A;  5F5A A;  4QGL A;  4CXX A;  1RUE 1;  1AZD A;  1KXG A;  1SCR A;  1QH6 A;  4K6B A;  1MVQ A;  4A7Y A;  1I5P A;  1PHM A;  1QJX 1;  2JE9 A;  2QQJ A;  3K4Z A;  4QX8 A;  1WMX A;  5FOB B;  4Q4Y 3;  3EO6 A;  5C4W B;  3ACL A;  3D3A A;  4MGY E;  4Q2F A;  5L9V A;  2FDH A;  4GJZ A;  3K3N A;  1LGN A;  4XFF A;  3OGV A;  5DAV A;  3RZK A;  5C5T A;  1RXG A;  3W21 A;  5F2W A;  1AXY A;  4MVT A;  4AAP A;  5LRS A;  2B9U A;  4CDU A;  1W6M A;  2P17 A;  3MUY 1;  4E8D A;  4Y5S A;  1OQD A;  1UO9 A;  3RQ0 A;  1VBA 1;  2RDQ A;  5FPU A;  3ABZ A;  2PMW B;  1WUV A;  3NNM A;  4QQO A;  2RM2 1;  1OXC A;  3FUQ A;  3NAP B;  4MH0 E;  3J7M A;  5FUN A;  1OLQ A;  2VL4 A;  1JH5 A;  1H8T A;  1S0J A;  3H9A A;  2JD9 A;  3I2J A;  4HK9 A;  2ID4 A;  2ZGP A;  1LHN A;  1R1A 1;  1NT0 A;  1JOB A;  4CDX A;  1SLC A;  3III A;  1PGS A;  1SLI A;  1CN1 A;  5I93 A;  1EUT A;  2E31 A;  5EP9 A;  3TNP B;  2A75 A;  5FPX A;  3U4S A;  4J6G A;  1HQW A;  4QPG C;  5M0T A;  4EN9 B;  3U78 A;  2XBO 1;  2DVB A;  2Q30 A;  3OPT A;  5FYU A;  4UXA A;  5JOY A;  4UFH A;  3WX5 A;  2K0G A;  4FTB A;  2EIG A;  4MYE A;  1PGW 2;  1R64 A;  3SNM A;  4A41 A;  2J22 A;  5A6Q A;  1OHF A;  2R04 2;  3VHO A;  4ASM B;  4Q4X 2;  5IVJ A;  3OB8 A;  1ST8 A;  5AC9 1;  4KL1 A;  5FYY A;  5FZD A;  1Z7S 2;  3ZXJ A;  2JDZ A;  3WNN A;  5LBE A;  3LEM A;  4EN0 A;  3VKO A;  1FV2 A;  3WF2 A;  2JG8 C;  1GUI A;  2R0F A;  4YM3 A;  3B00 A;  3NRU A;  3BOP A;  1WD4 A;  2GC3 A;  2YHJ A;  1RUH 1;  2XKO A;  3OJB A;  1LCL A;  1RUD 1;  4KWJ A;  3ZYF A;  4JTO A;  4CCN A;  1G7Y A;  4CVU A;  2QQO A;  1PM4 A;  2PLV 2;  3O0V A;  4YVW B;  3U07 A;  1Q8Q A;  2ARX A;  1LOA A;  4Q8L A;  1PK6 B;  1GKB A;  2GH2 A;  3ZR6 A;  5T3N A;  1OKQ A;  5DG1 A;  4CCC A;  1H2M A;  2JDY A;  3N4M A;  2Y6H A;  4D7T A;  5J37 A;  3DUI A;  2Z2S B;  4KU8 A;  4QQP A;  3HQR A;  4BWO A;  1LKN A;  3EMR A;  2FDF A;  2DBI A;  1GV9 A;  4EWE A;  4Y1Y A;  1W8F A;  2ZKN A;  4GAZ A;  4IV1 A;  3V0A A;  4YVS B;  2A3X A;  2XJP A;  5F2S A;  5T52 A;  4MHR A;  3RI9 A;  1FXZ A;  2ZCW A;  3N36 A;  5JVV A;  1LB2 A;  2UY8 A;  2MNG A;  3CU7 A;  2D93 A;  4JGZ A;  4QPI A;  4RHV 1;  4A4A A;  2BVV A;  4YM0 A;  5BNO C;  4CU6 A;  2BFU L;  1GFF 2;  1BEV 2;  3RWK X;  4H7L A;  1IPJ A;  1PIV 2;  3H1W A;  3OD0 A;  3VDD A;  1ULO A;  2FHR A;  1BZW A;  3O12 A;  3PJQ A;  3TB0 A;  5F7U A;  4W6W A;  1NCR C;  2XB6 C;  4FP3 A;  5DAW A;  2V4A A;  5BPX A;  4BYY A;  5JSO A;  3MO4 A;  3ZR5 A;  3IB3 A;  5FMD A;  3AKR A;  1UWW A;  3I8T A;  4LBN A;  5KC6 A;  3ZXK A;  2V73 A;  1CPN A;  1APN A;  3SH3 A;  1GIC A;  1NA1 A;  1OPM A;  1X33 A;  3B7M A;  5K9Y A;  5GZG A;  4XFA A;  1X50 A;  2OT7 A;  2HBU A;  3ZXG A;  4LUM A;  3O1T A;  2P3Y A;  5BNP C;  5FZL A;  4WZC A;  5B4X A;  3KWV A;  3Q8E A;  4R9D A;  3VL8 A;  2XON A;  4N7I A;  4PBP A;  1RUJ 3;  3OBZ A;  2JG8 A;  1XRU A;  1M4W A;  4U36 A;  1GZW A;  3JD7 3;  4HXC A;  3T0A A;  4IEZ A;  3WUD A;  3WQB A;  2GAU A;  1BHG A;  4FVV A;  4ISR A;  2BQP A;  1F15 A;  1AR9 2;  1YFY A;  4XJU A;  1EP0 A;  3FL7 A;  3W20 A;  3RZH A;  4Z92 B;  1W8W A;  2CTV A;  3B9C A;  3NKT A;  5FFO C;  5FMB A;  2D3S A;  1XYN A;  4RYD A;  5FYC A;  5IVF A;  4N9I A;  3NAP C;  4AR2 A;  1WCU A;  5C3P A;  4EE2 A;  3UK9 A;  3KF5 A;  5DN2 A;  3ZFF B;  4AI0 A;  5BNN C;  2CV6 A;  5HCH A;  5CYY A;  2WN2 A;  1SG3 A;  2SBA A;  4AOC A;  4AEJ A;  2VW2 A;  1BMV 1;  4X6Q B;  1O59 A;  1KQR A;  5EZW A;  3VBU B;  1J84 A;  2DDU A;  4GJY A;  1EYB A;  3EBR A;  4UFK A;  1XND A;  2A3W A;  1UYZ A;  2D6M A;  4LHK A;  4GH4 B;  4EZ4 A;  2W1S A;  4ZU4 A;  4LHN A;  1FMD 2;  1QOT A;  3RZG A;  1SLB A;  4NN0 A;  5A80 A;  5A70 A;  3KT7 A;  1RVF 1;  3MIB A;  4IE4 A;  4FT8 A;  4L11 A;  1CPM A;  2BV4 A;  2O1Q A;  4CCO A;  1STM A;  5KXE A;  1COV 3;  2QQU A;  4CPB D;  2WQ8 A;  4E2G A;  2JWP A;  2PHU A;  1NCR A;  1IPK A;  2R32 A;  4XYX A;  1ZRC A;  3ATG A;  1DDL A;  3O0X A;  3IDB B;  3UNP A;  4MUV A;  4NID A;  1VIW B;  3M3O A;  4HFS A;  1H2K A;  2JIC A;  1C1L A;  3MIG A;  1D4M 1;  3D0S A;  3WP4 A;  3PDQ A;  5FZ3 A;  1JYW A;  4JCK A;  4JKK A;  4RR3 C;  3ON7 A;  3PTY A;  2VD7 A;  2E7T A;  2WNU B;  3WUC A;  4AQS A;  3H3U A;  3S5A A;  2DCK A;  2ZMN A;  3RFR A;  3TNQ A;  1GZ9 A;  2RS3 1;  1TZO A;  5L7O A;  3W5N A;  5FV3 A;  2QQP A;  2XHN A;  4L92 A;  2Z79 A;  3PME A;  4XBN A;  2WZR 2;  2Y8K A;  3FE5 A;  5BNP A;  1C1F A;  5A3N A;  2OQ7 A;  3LWC A;  4XXA A;  4Y20 A;  1U5Z A;  4ZPI A;  1PM7 A;  1YQ8 A;  2WO3 A;  2WNV A;  3CJI B;  4PIY A;  3ZXL A;  4YFW A;  1WKY A;  3GM8 A;  1R1Z A;  1RUC 1;  1CIW A;  2HWE 2;  3BOW A;  4C0H A;  1UZV A;  1XBF A;  2W0X A;  2XHK A;  3TWI A;  5I8Y A;  4COY A;  2W3J A;  4AQ2 A;  2WL1 A;  1MS3 A;  4EV0 A;  2JEM A;  5FPZ A;  1J1T A;  3POI A;  2TUN A;  4JX0 A;  2FD8 A;  2RJ2 A;  2H0V A;  5CKM A;  3VD9 A;  2HWB 1;  1PVX A;  4AVS A;  4Y5T A;  3RGB A;  1H4H A;  1CAU A;  3AL5 A;  3GZT B;  1B35 A;  1AR8 3;  3LE0 A;  4MLO A;  3MZH A;  4FFG A;  5C8W A;  4YG6 A;  3WDY A;  4PDW B;  3ECQ A;  5FR3 A;  1IZ3 A;  2ZMK A;  5I8S A;  2OXB A;  1ND3 A;  1OMI A;  1ASJ 2;  2KR2 A;  1UPS A;  5JMC A;  2NMO A;  3RG0 A;  2HWF 3;  1NLS A;  3Q8B A;  4M00 A;  3I2H A;  1O91 A;  2CY6 A;  3RPQ A;  4JDN A;  1JU4 A;  2I45 A;  4FFI A;  1J3Q A;  4I0A A;  4FPF A;  1CAX A;  4DIN B;  2AEZ A;  2GN7 A;  1ZBE 3;  1VBD 1;  5LAT A;  3TN9 2;  5ABJ B;  4YW5 A;  1W0P A;  2KA3 A;  4XUN A;  1V9U 2;  1OA3 A;  4AFM A;  3GBG A;  4BJ0 A;  2WS9 3;  1O5L A;  2ZX0 A;  3I3E A;  5JPN B;  2BOI A;  2AYH A;  2YGL A;  5D8A C;  3J8F 3;  1QQP 1;  3R4D B;  1ONA A;  3CDZ B;  1W9W A;  2ZHN A;  3E6D A;  5E88 A;  2UYA A;  3WCR A;  3WG3 A;  3KCC A;  3S7E A;  3FBY A;  5ACA 1;  3IKW A;  2ADE A;  5FYI A;  4M01 A;  4Q29 A;  5CZK A;  1K5M A;  1GYK A;  3ZFG B;  2UWB A;  4JKM A;  3ZSL A;  1HN1 A;  1RUG 3;  2BPA 2;  2OUH A;  4UW5 A;  4RA0 A;  3GGL A;  5FBZ A;  3OUH A;  4L9B A;  2VMF A;  4FTE A;  1V6K A;  3HT2 A;  2EAA A;  4GA9 A;  4XW3 A;  5FP8 A;  3EYP A;  4NHY A;  2ZAC A;  2PAK A;  3PLQ A;  2GND A;  3KV6 A;  3K77 A;  3T2P A;  1JYI A;  2F4P A;  5A3M A;  3K2O A;  2XLA A;  4A2U A;  1QJU 3;  1SFN A;  2YB7 A;  3AB0 A;  1VBE 2;  4PCR A;  2CAU A;  2WAA A;  3RRD A;  2G4I A;  2Q8D A;  2FCU A;  4N53 B;  3WG1 A;  2K9Z A;  3HVD A;  1ZBA 1;  2UWA A;  4XAC A;  3S6P A;  5JZG A;  1IQA A;  3FUO A;  3LDK A;  4MGZ E;  4XFB A;  3I3B A;  4QHB A;  2GZW A;  1SFP A;  4HLT A;  3JXS A;  1TMF 2;  1UXZ A;  4DB5 A;  2EIE A;  1RUH 2;  4AVC A;  1RUD 2;  1E5H A;  1JU3 A;  1ZZ8 A;  5IUQ A;  3ST7 A;  3MIF A;  4TTG A;  4S2G A;  3B3Q E;  3KHB A;  4XHX A;  4IND A;  4IV3 B;  1ZA4 A;  1XOY A;  1UOB A;  3GF6 A;  4HVO A;  4M4R A;  3POS A;  1MS9 A;  3WDW A;  4Q0V A;  3SEE A;  1JUI A;  2PAE A;  4K8R B;  4LQR A;  5A1F A;  4TYS A;  4F7Z A;  2JKB A;  1C8M 2;  1AVB A;  1IOA A;  3I97 A;  1OF3 A;  3KLS A;  4B1M A;  2BYV E;  1PO2 1;  1IS4 A;  1ZYB A;  5APA A;  5JR7 B;  2JJ6 A;  4FPE A;  3CJI C;  3HWJ A;  3O1O A;  1IKQ A;  1W2U A;  3WHU A;  3FHI B;  5FJK A;  2HEW F;  1SDD B;  2LTN A;  4GB3 1;  4N43 B;  4LHS A;  5SV5 A;  5D8A A;  3MF6 A;  5FZF A;  2IZW A;  2Y26 A;  3MPP G;  3RYR A;  4RHV 2;  4G9S B;  5EIY B;  2ZML A;  4XDQ A;  1R09 3;  4FAG A;  3MF9 A;  3C3V A;  2YYO A;  5FMC A;  3FLT A;  1DGL A;  4K8F A;  4FP2 A;  5IJR A;  1J1L A;  1CAV B;  1PX4 A;  3BVC A;  5JUV A;  2GNM A;  3NJX A;  4AE2 A;  3DEC A;  4XF9 A;  4XJ9 A;  1BK0 A;  2XLF A;  5GZD A;  2D44 A;  5CIR A;  1TEI A;  1ENS A;  2ZBJ A;  1SCS A;  2VEC A;  1AUY A;  3GHN A;  5F3I A;  5FO8 B;  2YRO A;  3VBF B;  5CAD A;  3VBH B;  1KGY A;  5FZC A;  1FOD 1;  2B7Y A;  2VMI A;  1POV 3;  1Y4W A;  3IMM A;  4IW3 A;  3POE A;  4CCD A;  3OUJ A;  4GMP 1;  3I2K A;  1WLD A;  1SLT A;  4B7K A;  3LSE A;  2PYT A;  3H3L A;  1NZC A;  4ES8 A;  1UX7 A;  4EN7 B;  3VBO C;  2HYX A;  1RHI 2;  4KQ7 A;  1SAC A;  1RED A;  3PUH A;  2A3Y A;  4WVM B;  5GAL A;  1QIQ A;  1RUF 1;  1G9C A;  4O9E A;  4UF0 B;  1CZS A;  4AFD A;  1AR6 1;  4BQX A;  3GZA A;  3ZKU A;  2ZJC A;  5H9Q A;  3C7O A;  3AVS A;  3H1M A;  4HPK A;  2WLP A;  1LEM A;  3ZXD A;  3RZZ A;  4FBF A;  4JV4 A;  5IVC A;  1A8M A;  1W99 A;  5G05 L;  4XTP A;  2C24 A;  3NW4 A;  1RJ7 A;  1DYP A;  4XIK A;  2RMU 1;  5ERL A;  3PNA A;  1SPP A;  5FP7 A;  1H1I A;  4COW A;  3NKG A;  5LEJ A;  4J1W A;  4DY5 A;  1EAH 3;  1GLH A;  1BMV 2;  2ZGM A;  1ZRR A;  2WR9 A;  2JG9 C;  2HYK A;  1CAW A;  4D8M A;  2W39 A;  4MX3 A;  3LFM A;  2QZ2 A;  4XF4 A;  4AVT A;  4HBN A;  2AUY A;  5FRA A;  5BV6 A;  2XKP A;  4WM8 C;  4BXS V;  1UL9 A;  4RS5 A;  3ZM8 A;  1PX3 A;  2VAU A;  5GLW A;  2WC2 A;  2ARE A;  4MV2 A;  4RQP B;  4XJ8 A;  2IXJ A;  4OI0 A;  2WFF 1;  2ZA9 A;  3WNX A;  5C8C A;  3JQX A;  3DYM A;  4OLL A;  4MGS A;  2DUQ A;  4I02 A;  3AJY A;  3PUA A;  1RUI 3;  1DLL A;  4V2W A;  2E32 A;  2HKX A;  3GHM A;  4DOU A;  4IE6 A;  2QQW A;  1JHJ A;  4GKY A;  4NR1 A;  4CEY B;  4P9L A;  2NPI A;  1O8S A;  3KD4 A;  2Y6G A;  4CCL A;  4OUS A;  3IAQ A;  3VKL A;  3NV2 A;  1D4M 2;  2A5Z A;  4BQ2 A;  3T2O A;  1OUR A;  4CCM A;  3LB9 A;  1QJZ A;  4PQ9 A;  1W6N A;  4CZS A;  4GWI A;  1AYN 2;  5HV4 A;  4CCE A;  2YBP A;  2V4V A;  1ULC A;  1WW6 A;  4FPJ A;  1UZZ A;  1X9T A;  1AL2 1;  2R7E B;  5T54 A;  4Z2W A;  1VRB A;  4P02 B;  5F5Q A;  3UET A;  4A7K A;  4COZ A;  2HLE A;  3CIH A;  5FPV A;  3VBO A;  1DZR A;  2O8Q A;  1JTZ X;  1JI6 A;  1HRI 2;  3ZVX A;  3V0B B;  1WWY A;  3CZJ A;  3KB5 A;  5FKB A;  5LA2 A;  1WBL A;  4QGN A;  4ZZ8 A;  3O1U A;  3I3M A;  1PGW 1;  2QNK A;  5J36 A;  4TSV A;  2R04 1;  1ENR A;  3CZU A;  4Q4X 1;  1Q8P A;  2B42 B;  4CXW A;  4DS0 A;  4N43 C;  3U0Z A;  1HRV 3;  5A3P A;  3SCG A;  2D43 A;  1RMU 3;  1Z7S 1;  2BP6 A;  4Z2A A;  2DUO A;  1ACC A;  4KG0 A;  5HXV A;  1MS8 A;  4PIZ A;  1KD7 A;  1XE7 A;  3OBT A;  2C9K A;  4MSV A;  4JQR A;  5KR7 A;  3BGA A;  4XAA A;  4YFZ A;  4Y1V A;  2A70 A;  5IVY A;  2BJS A;  5DAB A;  1W9Y A;  5ANN A;  1ND2 B;  3TBD A;  2J1S A;  4RL7 A;  2VG9 A;  5JCT A;  1HXS 3;  2EID A;  2J1U A;  4UOJ A;  1GNZ A;  4H55 A;  4AI1 A;  2XJS A;  3JD7 2;  2JG9 A;  4JZR A;  1YCI A;  2QDR A;  3VDA A;  4DXR A;  5FMO L;  2YDE A;  2W08 A;  4IE5 A;  5CFC C;  3USU B;  1Y9M A;  2AR6 A;  2YGM A;  4IES A;  4Y4R A;  1EV1 3;  4KU7 A;  1V6M A;  1DF0 A;  3VZN A;  5KXC A;  5A33 B;  1TME 3;  2IXI A;  2VZV A;  3DXT A;  3GCW A;  3WF0 A;  4XIO A;  1DU3 D;  3UT0 A;  1MEC 1;  2NQY A;  3THC A;  4CDU B;  3J7L A;  3MW3 A;  4LBL A;  4CU7 A;  2UUR A;  1NUK A;  5KHK A;  2BW8 A;  3DKQ A;  3NST A;  1HW5 A;  3OBA A;  1O6U A;  4PHZ A;  2ZGL A;  1B09 A;  1UW8 A;  2ZX1 A;  4CEW C;  1BEV 1;  1PIV 1;  4ZU7 A;  1ZZ7 A;  1WLT A;  2R07 3;  3LPF A;  3AZY A;  3ZN6 B;  4OI1 A;  3AKQ A;  1QWR A;  1QJY 3;  1DYO A;  2IXH A;  1WMF A;  2E7A A;  2DU1 A;  4LBJ A;  3QLQ A;  1RIT A;  1S0B A;  1URX A;  1UPI A;  1I3H A;  2W87 A;  1LU1 A;  2P4E A;  2E63 A;  1AYM 3;  2VMH A;  3NVC A;  1E5S A;  4EJR A;  2YPD A;  5K4L A;  2J42 A;  4CDQ A;  1FNY A;  2WYF A;  3DN7 A;  5C9A A;  2I2S A;  3NO8 A;  4LR4 A;  4QPY A;  5E6H A;  4B4Q A;  4P9I A;  2E6V A;  1T2X A;  3MHZ A;  4LKS A;  2VTX A;  1U12 A;  4MGK E;  5A7P A;  2GAL A;  1D7P M;  2EIC A;  1F5J A;  1GNY A;  2YBS A;  2Y6F A;  3ORJ A;  1W6Q A;  4YW1 A;  4FPC A;  1H1A A;  3KV5 A;  3D5O A;  2IC1 A;  4ZKT B;  5CA6 A;  4HMZ A;  2YC4 A;  2IUW A;  1U5I A;  1O4Z A;  2VMG A;  1IGO A;  3IMN A;  3LEK A;  2J1V A;  3UJO A;  3BIE A;  5CFC A;  1FYU A;  4GMP 0;  5F8P A;  4IEQ A;  4PF1 A;  1T6G C;  2ZKL A;  3KF3 A;  4HVQ A;  1JUH A;  3THP A;  5A6Y A;  2QDN A;  1UIJ A;  4FPG A;  1X36 A;  2A73 B;  2X09 A;  1RTV A;  3ES1 A;  1AHS A;  4ZON A;  5FZO A;  3OGJ A;  4JTN A;  4CP9 A;  2PAM A;  1JZ3 A;  2LRP A;  2HWC 1;  1JOP A;  3JQW A;  1RUE 3;  4CUB A;  4K21 A;  1CJP A;  4B4P A;  4DIQ A;  5HXM A;  5JDB A;  3FX3 A;  1QJX 3;  5K0U B;  4Y1Z A;  2CGO A;  3ME2 A;  4GB3 2;  5E8A A;  4BOW A;  2VNO A;  4URA A;  1H2L A;  1HIX A;  2ZHL A;  4GKX A;  4DXT A;  3HBZ A;  1NOV A;  4GIQ A;  2PHD A;  1JYN A;  3W58 A;  2O8O A;  1CX4 A;  3K48 A;  1LED A;  2P3I A;  2QUO A;  1R08 3;  3AMP A;  4AI9 A;  2FQP A;  2ORZ A;  2QJV A;  3DPR B;  2PHX A;  4AED A;  4UW3 A;  4DUW A;  5C7G A;  4NIH A;  1PZ9 A;  3A22 A;  3BAL A;  5FWE A;  2W94 A;  4KWK A;  1F4H A;  4HZF A;  3ZYJ B;  4XMA A;  2RR1 1;  2WS9 2;  3AP9 A;  1NA1 B;  1VBA 3;  4QQL A;  2D3R A;  5FRE A;  1XU1 A;  3J8F 2;  2WZR 1;  1YXW A;  4MET A;  5FQ0 A;  2GSY A;  3SIT A;  1VBB 1;  1WW4 A;  3KGL A;  3ACH A;  4FQ4 A;  4KGG A;  2A6W A;  4Q5O A;  2XXZ A;  4GWN A;  3DXU A;  2HWE 1;  1CWP A;  5I0T A;  4QXB A;  3HIF A;  2BUK A;  4Y24 A;  2ZZJ A;  2C6S A;  4LKE A;  3QH6 A;  4KGQ A;  2XBO 3;  4OHW A;  5KXD A;  5FXV A;  1RUF 2;  3WF3 A;  2WAO A;  3D82 A;  5A7Q A;  5IAV A;  3QH7 A;  2XJQ A;  2XL9 A;  4QGM A;  2WZP P;  2BU9 A;  1GBG A;  4NIG A;  2ZZQ A;  4AQT A;  1VRH 3;  3ITQ A;  3ZXE A;  2DVD A;  2L9L A;  4Y33 A;  4IEP A;  1XYO A;  5AC9 3;  2DWR A;  3WR0 A;  4DMI A;  4YYO A;  2DCJ A;  2JEC A;  2V5D A;  3FLP A;  4N90 A;  3N9Q A;  4XUP A;  3THT A;  1ASJ 1;  3P6B A;  5DZE A;  5A3T A;  2OUJ A;  1S0I A;  1CZV A;  4NHK A;  3LF7 A;  5DUV A;  1OOP B;  1HN0 A;  5HCF A;  1CVN A;  2DCZ A;  5ISL A;  1DZQ A;  2VMD A;  4AHW A;  3VDC A;  1IPS A;  1W8H A;  2PHW A;  4IEO A;  3DGT A;  4UT5 A;  1NCQ B;  3TN9 1;  1US2 A;  2MHF A;  3V65 A;  3AZV A;  1V9U 1;  5DAQ A;  2WFF 2;  5H9R A;  3U10 A;  1N1S A;  5EQU A;  3NJV A;  1UOJ A;  4P9Y A;  4KNC A;  4D94 A;  4K20 A;  5C3O A;  1CX1 A;  2P34 A;  1MR5 A;  1W0O A;  1O3R A;  3K51 A;  2C4X A;  1LU2 A;  5FKC A;  5D21 A;  5A6X A;  1DLC A;  2Y64 A;  3GXU A;  1ZZB A;  4AYU A;  2Y60 A;  3QD6 A;  2W95 A;  5LRR A;  1FX5 A;  2RDN A;  3O5S A;  4CYD A;  1VBC 1;  1Y9Q A;  4Y3O A;  5FY7 A;  5I8T A;  3OYW A;  1AL2 2;  4HL0 A;  3CO2 A;  1W2O A;  2Y33 A;  4D7Y A;  1ZVF A;  2D97 A;  2XDV A;  3AM2 A;  3OY8 B;  4FOV A;  5FWJ A;  3KCX A;  4YW2 A;  2ET1 A;  4LK7 A;  3VZJ A;  3PVE A; 
#chains in the Genus database with same CATH homology
 5A70 A;  2BOI A;  2JDM A;  1GZT A;  2JDU A;  5A6Q A;  2XR4 A;  2JDK A;  2BV4 A;  2WRA A;  1OVS A;  5A6Z A;  3DCQ A;  1W8F A;  1OXC A;  2VNV A;  4CE8 A;  1OUX A;  1UZV A;  5A3O A;  2CHH A;  5A6X A;  2BP6 A;  2BOJ A;  5HCH A;  2VUD A;  2JDP A;  1OVP A;  2WR9 A;  4AOC A;  2JDN A;  1OUR A;  1W8H A;  5A6Y A;  1UQX A;  5D2A A;  2VUC A;  3ZDV A;  1OUS A;  4UT5 A;  2JDH A;  2JDY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...