2JDHA

Lectin pa-iil of p.aeruginosa complexed with disaccharide derivative
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
114
structure length
114
Chain Sequence
ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNETAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILTNELNFALVGSEDGTDNDYNDAVVVINWPLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FUCOSE-BINDING LECTIN PA-IIL
publication title X-Ray Structures and Thermodynamics of the Interaction of Pa-Iil from Pseudomonas Aeruginosa with Disaccharide Derivatives.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Sugar binding protein
total genus 20
structure length 114
sequence length 114
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07472 PA-IIL Fucose-binding lectin II (PA-IIL)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.400 Mainly Beta Sandwich Jelly Rolls Calcium-mediated lectin 2jdhA00
2CHHA 2JDHA 1OXCA 5A3OA 5A6ZA 2BOJA 2JDUA 4CE8A 4UT5A 1OURA 1OUXA 1W8HA 2VUDA 3DCQA 1OVPA 5A70A 1OVSA 1W8FA 2JDKA 2WR9A 3ZDVA 2JDMA 2JDPA 5A6YA 1GZTA 2VUCA 5D2AA 2XR4A 1UQXA 2JDNA 2JDYA 2BP6A 2WRAA 2BV4A 5HCHA 2BOIA 1UZVA 1OUSA 4AOCA 5A6QA 5A6XA 2VNVA
chains in the Genus database with same CATH superfamily
1GQGA 4E4DX 5IJRA 5DDJ3 4RHV3 5IK8A 1UY3A 1Y43B 2ZGQA 2C24A 1MEC3 4QXHA 2R16A 4Y22A 1ZA7A 4CPBD 1B35A 4Z92B 3MFCA 1HX6A 2GMEA 4MGZE 4V2VA 1JOJA 4WVMA 3ZXFA 3AKRA 4R9BA 4Z2AA 2YC2A 2OXBA 3D3AA 4K1ZA 4L97A 2NZ9A 2WRAA 4NWWA 4XZPA 4QMAA 3Q8FA 4OI2A 5FYIA 2K0GA 4Y1ZA 4BB3A 4QAWA 4KWKA 3AXDA 2QJVA 3ST7A 2ZKNA 1OKQA 3OCPA 4OI0A 4W6YA 4N9HA 1CQ9A 2BNOA 5I0UA 3KT7A 4FQ4A 1SLIA 4COYA 2YFUA 2HYKA 1J58A 1VRH3 1LHUA 4NE9A 5KXCA 2BOJA 4XJUA 5I0RA 1FXZA 1GNYA 4AZZA 1H9WA 2HKXA 1I5PA 4CDWA 3FHIB 1TG7A 1X82A 5HCAA 1UOJA 3QD6A 2Y26A 3AFKA 3ES1A 1N1YA 2JDKA 5A7NA 4GJYA 4D6RA 4WM8C 2QUOA 3ASIA 3TNQA 4R4ZA 1BVP1 1V9U1 4KQ7A 1UXZA 3ZFGC 1MS3A 1A8MA 2NMOA 1YNAA 2Y6FA 4XCAA 2MHFA 1Z7S1 5C8CC 1UMZA 4LK6A 3MPBA 4QHOA 3N3HA 3LEGA 3VBOA 3N36A 3ZYRA 5GZDA 4QX7A 4FPJA 1LTEA 4AHYA 3ROUA 1OLME 3M2MA 3WDXA 4LULA 5GZGA 4B8EA 3PJYA 3D5OA 4KH9A 2VUDA 3ZN6A 5JOYA 4FFHA 1V6NA 4AI9A 2OPKA 3LAGA 4GH4C 1LAJA 4HN0A 3IT8A 5HXVA 1GMMA 1YQ2A 2X5IB 4JHZA 2DURA 2WS93 1XYNA 3U4SA 4CXYA 4XEZA 1JODA 2Q0AA 4JQTA 5FYVA 3E97A 4TLFA 3Q8AA 4GB32 2GC1A 3B94A 3HNBM 2EXJA 4E4ZA 4Q0PA 5AVAA 2Y33A 3USUB 5F2WA 4DEVA 2OUJA 4IEPA 1LGNA 1RJ8A 1QOOA 1JU4A 3CLPA 1NUKA 3QCWA 4N53C 3SCGA 3T3YA 2A3YA 4ARXA 2GC2A 2BYVE 3NKGA 3WV6A 4AAXA 1QGLA 2ZMNA 1ZBA2 4QPGC 1V6IA 3OOXA 4HPKA 1AYM3 2A3WA 4XHBA 2IVJA 1SFNA 3ZPOA 1JYCA 4AVSA 4LKDA 4WVVA 3PUIA 5GLUA 1LOBA 2DU1A 1KJLA 2QE3A 4TLGA 5GZCA 4RD7A 1GZTA 2B45X 2J42A 4LHLA 2CY6A 3CU7A 5I0DA 2VZQA 5A7SA 1ZBA1 3AP7A 3ETPA 5FY1A 5HV0A 5JSOA 2YY1A 3BYWA 4RR3C 3LA3A 1KFXL 3M1HA 2Z42A 5I93A 1YFXA 1HIXA 4FTSA 3NAPA 1JYVA 2W3JA 5C4WA 3I54A 2W2IA 3OGJA 5CNAA 3HN3A 4IUGA 4XXPA 2W5FA 3WEZA 4KI5M 4ZS3A 1ZZCA 1VBA3 1OQ1A 3AVSA 1K42A 1YXWA 3RYKA 1UU4A 4WM7A 2AC1A 2R062 1OD3A 1HB3A 2DUQA 3LDRA 4NR1A 3JD72 4JC1A 3O1RA 1O91A 1GUIA 1G9FA 2IXLA 2ZMKA 2VH9A 3I2FA 4GAZA 3WOGA 3TEZA 3RYPA 1OF4A 4XCBA 2I74A 5JLVA 2Q4SA 4BXSV 1RUF3 2R061 3NO8A 1DQ4A 5KHHA 3GZEA 2DVAA 5CZKA 5KXDA 4CEWC 2SBAA 2HWD2 1ND2C 5CEHA 1NA1A 4GMP3 3M3OA 2AR6A 3VUOA 5JZGC 4M3CA 2WC2A 5FMBA 3I3MA 2Z4FA 3W20A 4LT5A 2LTNA 3N35A 4ZXKA 3PUHA 3PJQA 5EIYB 2E26A 4Y5SA 3GZTB 3NW4A 5FY9A 1YWKA 3TEXA 4LXLA 3VKNA 4CUBA 4V2WA 3A23A 3R0RA 2RDNA 2ZHMA 2HWD1 4Q4Y2 5LBCA 1UU6A 3I7DA 4BOWA 3OBTA 4CCEA 1UOBA 2FMDA 4FXGB 4ISQA 4XTPA 1NE6A 4PJYA 4RS5A 3S30A 3SMHA 3UT0A 4ATFA 2RG4A 3MW2A 3U10A 3KLSA 2V09A 4BM8A 1K5MA 3LOIA 4FOVA 3ELNA 4K21A 3NKTA 3PMSA 4X8NA 4C91A 4KGQA 4Q4Y1 4PLMA 4R9AA 3QBQA 3WLUA 4AE2A 4EROA 2DTWA 4UFLA 3WY6A 4CYDA 4LBMA 4K3UA 1BBT3 1GOHA 3WG4A 4BMEA 4FPGA 1MS1A 2BNNA 2DVBA 1XU2A 1DZQA 3RMYA 3VBRB 1UX7A 5HBAA 4TWTA 2ARAA 3EO6A 1GZCA 1YEWA 2VC9A 5DAQA 1DLLA 2E6VA 2QQJA 2ZGRA 3BN6A 4LA2A 4LHNA 4NJ4A 3WDVA 3POEA 3MGUA 2W1QA 4XQDA 3TAYA 2HEYF 2OZJA 4GWIA 2R7EB 2K2SA 4JDOA 3VBSA 2JG8B 4INDA 4OVEA 4BISA 3A22A 3NV2A 1UZZA 4RL7A 1VBD3 4YM0A 4RHV1 2CDOA 4QPIB 4OFGA 1VE0A 3C8XA 1LHWA 1QJFA 1DQ1A 2YMZA 2Y64A 2XMLA 5LWBA 5JMOA 1NLQA 5LK5A 5FWJA 4FTEA 2XJSA 5CFDB 2GNBA 2VECA 3U07A 1Q3EA 3O7OA 2R1BA 4UXAA 4A7ZA 2HJIA 4ORFA 1PMIA 4JV4A 4YW2A 2E53A 2PHRA 5A1AA 1LENA 4A42A 4XTMA 3T0AA 4C90A 4EN7B 1NY72 5CAZA 4DUXA 4UW6A 4ZZ8A 4E8DA 1AR63 3H1YA 1AHSA 3NRUA 3MV11 1VB2A 5FO8B 3GNEA 1NZIA 2VAUA 2JEMA 2PHFA 1GQHA 3KCXA 2XGXA 5D1IA 4IV1C 5IFTA 5T50A 4NWVA 2BOIA 3PTRB 3RS6A 4AOCA 1IZ3A 1PK6C 1NY71 1YIPA 5H9RA 1REFA 1LKNA 4JQRA 3AXEA 1DHKB 1SPPA 3PMEA 4CUGA 5HV4A 1R092 3AMMA 1LOCA 4X8PA 5CG8A 5DUWA 3Q9OA 1W03A 3I3EA 2HWB2 2J1AA 1HV1A 2C0ZA 5CA6A 2YDEA 1RUG2 4S2FA 1XE8A 5C70A 3OUHA 3GM8A 1VBC3 3RWKX 5ACA2 2XBO2 3POFA 3WHTA 3T2TA 1R091 1FI2A 3QACA 4JGYC 1P8JA 1MS0A 3J26N 2GZWA 3OBRA 4N7IA 4QHBA 1NAEA 3VLBB 2GH8A 1JXNA 2CV6A 1OH3A 2OIIA 2E63A 2WT0A 4QKBA 3THTA 3ZXEA 4CCCA 2ZGLA 5FBJA 2R042 1PMJX 2XJTA 1W9FA 3GCXA 4N7UA 4ES8A 2XBO1 4JGZA 3EBRA 3MPPG 1HRI2 1LOGA 4A3ZA 1YFWA 4ASKA 4X6QB 1XE7A 5BNOA 1B35B 4LO8A 2FMYA 2VG9A 2EIEA 4YM3A 3OEAA 2X29A 4CUCA 1QNYA 2JD9A 4WVMB 1DGRA 1XNAA 1O7FA 5AFBA 3I2GA 5JPMB 1OF3A 2P3KA 2R041 2D40A 3M8LA 1REDA 1C3HA 5FAXA 4I30A 1HRI1 4UFJA 1S0FA 4Y3OA 5F5QA 5CADA 5BV6A 5JVVA 4DB5A 2ZBJA 5APAA 2WZPP 3PIGA 1AXKA 2R073 4ZU7A 1NKGA 3MZHA 3SCHA 1FMD3 3VBFB 1ZRRA 3O1MA 2G1MA 2B39A 3PTYA 3ZM8A 1ZZ6A 4XIKA 1H8TC 5DAVA 1OC1A 5GKAC 1YQ6A 3R4DB 5T3NA 3ILRA 3ZXLA 1OSGA 2CGPA 4XYXA 2AEYA 4Y1UA 5F3EA 4D7YA 3CEWA 1AL0G 4DXTA 3WR0A 1QJY1 2UWCA 3OSDA 1V00A 1A6CA 2JXAA 3AL5A 2F17A 5F1RA 3C7EA 5CVRA 3KGZA 2ZPXA 4K7JA 5FP9A 3AC0A 1F15A 4NRQA 5E1RA 5L9BA 2HWE2 3VZKA 5A3LA 3HVDA 4MLOA 5EYXA 1DQ5A 3MO4A 2CAVA 4DXZA 5B4NA 2ID4A 5HCHA 3VBOB 3NNGA 1G86A 1NT0A 2AUYA 3F2ZA 4K1YA 2VCCA 3FFZA 2JIGA 1AYN3 5FY5A 3WDTA 4HLTA 5ANQA 1RITA 1RIRA 1PVC2 1SEFA 4YVSC 4UT5A 3ZN6B 5K0UB 3U75A 5F3GA 1VBE3 2B42B 3QH6A 2XVKA 4FQZA 5EPAA 1Y9MA 4F8AA 5IW0A 3GDBA 2Y0IA 3WP5A 3VDBA 5F39A 1SG3A 4IETA 1RUF1 1U0AA 4JDMA 4MO3M 2JE9A 2W1UA 5A6YA 1VBB3 1CAVA 1PVC1 1RUC3 3LPFA 3R05A 4ZPIA 1CR7A 1Q8VA 4M3CF 4Y4RA 5FYYA 5F6KA 5FPUA 4OHXA 1MS8A 3HQUA 2WABA 1Q43A 3K77A 4QM9A 2ZX4A 1Q56A 5LEJA 1PVXA 1RUE3 4WZFA 4YZ4A 1WWYA 3WG2A 2VMHA 1FV3A 5B2GB 4Y4YA 2PHLA 1BQPA 1PIV3 5H9PA 1VR3A 2J7MA 1V6OA 1GV9A 5GZEA 1QNWA 4N9IA 5I8TA 1WMFA 4Q4X2 4Q8LA 4LKEA 1RTVA 1FATA 1COV2 4KU8A 1HXS2 4FP3A 5EYYA 4BIFA 1KXGA 1BBT1 1ZZBA 1NYWA 1LEMA 1D2QA 2BRTA 2SLIA 3AL6A 4Q4X1 1L7LA 1COV1 4W8JA 5A7OA 4TN7A 1HXS1 1UN1A 3VBUB 1BCXA 4PI0A 4QPYA 3ES4A 1FX5A 4A44A 3KZ4C 2Y6GA 3WSOA 2Y6HA 4C1XA 4HK8A 4WM7B 5E88A 3J7NA 1E5HA 1QQP3 4EWEA 4CEWB 2A6XA 2RHPA 3HT2A 3K46A 4CXXA 3NNMA 2OW4A 1PO13 4DXRA 2PMWB 5JAXA 1TNFA 3WHUA 3KGLA 1J84A 1UQXA 5EZWA 5J1XA 2WYSA 3GZAA 3WX5A 1Y9QA 5LY2A 4XABA 4YARA 4AGVA 1S0DA 5A3WA 4CPBA 2JDZA 4B1MA 5L73A 1W2UA 2DFCA 3V64A 1O3QA 5FUPA 5IVYA 4MGTA 3E6BA 2I07B 3TBDA 2PXJA 2HLEA 4YG6A 1J59A 4NPMA 4XJZA 5M0TA 2YG0A 4XFIA 2RDQA 4YW1A 3WP4A 1DYKA 5FZIA 2EIDA 2GU9A 2WT2A 5DQ0A 4YGEA 1K5MB 2WBKA 4QQPA 3I3DA 4WV8A 1O59A 3E5QA 4HVRA 2B5HA 3BU0A 2D97A 2Q30A 3N9PA 2A6VA 1FT9A 4Z8BA 5FO9B 1UW8A 3MBWA 5JSPA 2OVUA 1ZYBA 1JZ8A 2X5IC 1PX3A 2CGNA 2WFF3 5L9VA 5FBZA 1JZ4A 3CIHA 4KWLA 3UNPA 1LU2A 1X33A 3ZYBA 4ATEA 1WCSA 3ACHA 1O5UA 3P3NA 2AZ5A 2WNOA 5CISA 3AJZA 4MXWB 3LWCA 4MXVA 5ANNA 1AX2A 4QU2A 5FREA 5H9SA 3DPRA 2ZGTA 1BKZA 2BZDA 1RMU2 2IUWA 1YLLA 5FPZA 1RVF2 3I59A 1I9RA 1RUH2 4CEYA 1FOD3 1OH4A 1WW6A 3PUAA 4AYUA 1PHMA 2E7TA 1JZ7A 2VZSA 2RMU2 3RYRA 4S2GA 2AH2A 1JMUB 4JCKA 2Q1FA 4HK9A 2WZEA 3ZLIA 4AW7A 4E2SA 5BNQA 4EV0A 3WW3A 4HL0A 1RVF1 2OA2A 1LCLA 3CBNA 1I5ZA 3CMGA 1AJOA 3RJRA 3ZIWA 1OPOA 1H2LA 3K51A 3VKLA 4JRLA 4H2AA 5F3CA 2RMU1 2TNFA 2W68A 3FL7A 2HH9A 1FMD1 1MZ6A 2UY9A 1JHNA 3VL9A 1QOTA 4PLOA 4HKOA 4IV3A 4MGIE 1XYOA 4TTGA 3PVNA 4FPFA 1AXYA 2ZEXA 2OKXA 1OUSA 3A0NA 5G04L 4P14A 5IFPA 1W0NA 4LLFA 1SPPB 3VV1A 1ACCA 3I2JA 3N4MA 1ZRFA 3THCA 3NNJA 1W8ZA 1LHVA 1TME2 3P6BA 2DUOA 4NRPA 3ZFEB 4B7EA 2LM3A 3V0BA 4NIGA 4YGCA 1JZ2A 2A73B 1SLAA 3GF6A 2ZAHA 3GYDA 3ZYHA 1YRZA 5K8SA 1YIFA 3MIDA 1W6NA 2ES3A 2WINB 3KQRA 3SQOA 2VUAA 1DGWA 3BPSA 3M3IA 5GLTA 1US3A 3E6DA 3S5QA 5FYTA 1AYN1 4BQ1A 3ZFFA 1LHOA 2XR4A 3LEKA 1UAIA 4DS0A 5CFCB 3ACIA 1XNBA 1N3PA 3OPZA 5FKCA 3NJVA 5JR2A 3G7DA 3T2PA 1KDKA 5CKNA 3IDCB 1H6XA 1F4HA 4BQ5A 1XPWA 4YLZA 5FFOC 3VHRA 2CNAA 2ZGUA 5A1LA 4UW4A 1IQAA 1OMIA 4QQ2A 1OFNA 1YI7A 2PFWA 5J96B 1LHNA 2WWSA 3H7JA 4GB33 2EAAA 5BY5A 2VQ0A 1S2EA 1W3XA 1CONA 2Y6KA 1UYYA 1HN0A 2RS33 2PN5A 4XAAA 2BFUS 1UIKA 1PO23 3ZYFA 1OQDA 3CHXA 4UBGA 1CJDA 3LKJA 1WW7A 3I49A 1ULPA 4PF5A 2D6LX 2ETEA 3OF1A 3WNPA 1ENSA 3VBRC 1WCUA 1TZOA 2E7AA 2WNVA 3GBFA 3RNSA 2YGMA 1UPIA 3H3ZA 4KWUA 5D21A 2P1BA 1W28A 3FFQA 4OUMA 2BVBA 3O14A 2AENA 1QDCA 4PIZA 5LASA 1MQTB 1ST8A 4JHTA 4QPIC 1W0OA 4EN8B 1GLHA 1QJZA 2JDMA 2Q1ZB 4K40A 2ZX3A 2NP0A 3N7JA 2HBTA 4LHSA 2TEPA 1H2KA 3FC0A 3OPWA 1C28A 4JAAA 4YVSB 3OPTA 4YW4A 4AFAA 5JI9A 3MIHA 3L9JT 5LA0A 4BQ4A 3V65A 4PIXA 1BXHA 1W6PB 1RUD3 2VBBA 4ASLA 4Y1XA 3IIIA 4LQRA 1DZRA 2VO5A 3LE0A 5FJKA 1O8PA 1BEV2 4XF9A 5E6HA 3L2HA 2X10A 5CKMA 5AC93 2XH6A 3VHNA 3ZYGA 1VAKA 2YV8A 3AZXA 5HXMA 2QBXA 3LDKA 5IATA 2HWC3 1S0EA 5L7OA 1ZZ8A 1PO11 3VZNA 3E6CC 2VZPA 2ZACA 4M00A 1DLCA 2A6WA 1W8NA 2J22A 4HKWA 4QM8A 4RFT0 1S0JA 2RDSA 4PQQA 3UGGA 2ADDA 3FUOA 4LBQD 4OZXA 3H8OA 1G7YA 2DBIA 1CAVB 2HWF2 2PA7A 5FOBB 2ZZJA 3Q8EA 3I3BA 2W46A 2P37A 3TEWA 3ZMOA 5EHDA 3ENRA 4QX0A 1UZWA 2LS6A 4U2AA 5F5AA 2CSGA 5FK8A 3AK0A 4CP2A 2DDUA 2ZABA 2K9ZA 1UZYA 3J7HA 4LMFA 4O9EA 4XQWA 5IWFA 3WF4A 3ZDSA 3WNKA 3IPVB 3LF7A 4OUSA 4WVWA 5FXXA 2HWF1 1VRBA 4D3WA 4BQ3A 3N7MA 2WZR2 1HN1A 5DUUA 4JKMA 3CJXA 3RRDA 3S5AA 1W6MB 1ULFA 1HJFA 4I3GA 2N7GA 1KDMA 3VDDB 3KVBA 1V6JA 2ARXA 5LA2A 1QKQA 5I8SA 3WD5A 4FOWA 1XC6A 4L99A 1QOSA 2XHKA 4U36A 4DRRA 2IXCA 5F5CA 2WZR1 2DTYA 3AZYA 5H9QA 5LEKA 2GNTA 1CJPA 1N1VA 4A3XA 1LECA 4CRQA 2G9ZA 1UIJA 2VQUA 5FZ3A 4AFCA 1ZREA 1X8EA 3CF6E 2Y8KA 1B35C 1W8TA 1IS4A 2P17A 2HEWF 2QNKA 3ZIXA 2LALA 4OCTA 1W39A 5FLIA 4DFSA 4XVHA 5KC5A 4FFGA 4XF3A 5FY7A 5A3OA 5JXHA 3O1UA 1NCQB 3HAGA 1J1TA 2CU5A 4C0HA 3JQXA 5F37A 4LHKA 1DCSA 1V9U2 1NCRA 1UU5A 2RJ2A 2PHWA 2PHUA 3J9SA 1Z7S2 4ZHNA 5IVEA 2Z69A 3LSEA 2OZ6A 3VD5A 1B09A 1KD7A 2W87A 3BOPA 2RR13 4YW6A 1X9PA 5A33B 1HB2A 3B01A 3FBMA 3VBFC 2ZX2A 3HMYA 3GJBA 4NAOA 5I91A 3OD4A 3LEIA 3MLKA 3RI8A 4Q29A 5DG2A 5FY0A 1VJ2A 3J8F2 4E9KA 1ULEA 1OLRA 1QJU3 4J25A 4JKLA 3VZOA 4D94A 1U5XA 2XPJA 1DBNA 2P3JA 4AQ2A 1EPWA 2CTVA 2RS52 3WINE 4NPLA 1H1IA 3DGTA 4L0PA 2VNGA 2EALA 4LBJA 5LB6A 3U78A 1MS4A 3VDCA 4M4RA 3P5BA 1DQ6A 3W5MA 4HSJA 4Y1VA 4CUAA 1CAWA 3J8F1 3GALA 4X6RB 1Y3TA 2ET7A 3TN93 3VD4A 1OVPA 4CCLA 3O0XA 1UKRA 1ASJ3 1W05A 4PI2A 1AR93 2RS51 3VBOC 3VD3A 4CCDA 4YNIA 3CNAA 5FZCA 1WW4A 3WG3A 1SBDA 2BDRA 2G9FA 2VUCA 2VTFA 1XOYA 3OY8A 2L9LA 2W1WA 4Y5Z0 1N47A 2XVGA 2C9AA 4GH4A 3UGHA 1APNA 1UX6A 3LEMA 3RPQA 4XFBA 2EAKA 5K0UC 5KC6A 2VMDA 1VAMA 3GZUC 4CDUA 3I97A 1ZBE2 4NHYA 4B4RA 2XOMA 1NQDA 2FBEA 3RZGA 5SV8A 1ODMA 3ZO0B 4NHXA 1RUG3 1S0BA 3RZJA 5FCCA 1POQA 3POYA 2TBVA 4MYEA 5ACA3 2XJPA 4UI9L 3AYCA 1M06G 4P00B 3ABZA 5C3QA 1KRIA 1V6KA 4N53A 1ZBE1 1C5HA 2ILMA 4YW7A 3H8XA 1R082 4W4ZA 2YZ4A 2ZS6B 4J1WA 3RZKA 3OUJA 3U14A 1UD1A 3I59B 1DGLA 4L9BA 4QPGA 2PTMA 3IM0A 4CEYB 3ZXJA 1ZNPA 5A3TA 3VB9A 3FUQA 1D4VB 3B9IA 1GP4A 1CX1A 4YZ5A 2O14A 1Q8SA 1WLTA 5KBFA 1R081 2WNUA 4AAPA 5BNPA 4P02B 4R52A 5EJ1B 3I2KA 4TSVA 2BGOA 3GGLA 2NMNA 4RQPA 2J1UA 3UK9A 3RZHA 1JYTA 3HNMA 1PZ9A 5EFUA 4AXOA 1C8NA 2RS31 4CSWA 3IIAA 4FVVA 2QVSB 2GNMA 1XXNA 1S0IA 2VMEA 5GLZA 5IVFA 3ZN5A 4AI1A 2DF7A 3BIWE 3IBMA 2Q8EA 4N43A 2TUNA 4UYBA 1W6QA 3T4HB 1LOAA 4IV3B 3VBHA 2Y6LA 5C4WC 3WP6A 1DF0A 2OQ6A 2YFZA 3KCYA 1AR73 3VBUC 4CDQA 5L19A 3NMBA 2PELA 3UKTA 2ZGOA 1UZVA 4DY5A 4MHUA 3AMHA 2ERFA 1OI6A 3DXTA 4WM7C 4Z2WA 1H0BA 4Q8KA 1O3SA 4UOJA 5A7QA 2PHXA 3T4VA 2JDHA 3KS7A 4H7MA 1R1A2 4P9JA 4Y24A 5FXVA 3R4UA 4XFCA 3V0BB 1VMJA 1IPKA 1W99A 4HG6B 4AEKA 2WNEA 4BZ4A 2ET1A 2CWMA 4MGYE 3V0AA 1W6NB 4XURA 5FY8A 1ND2A 2MEV3 2CL2A 1VP6A 2WR9A 3AX4A 4XFAA 1AR82 1D4M2 1RUJ2 2VMGA 2ZOEB 4Z82A 5FYHA 3BALA 5CB7A 4AFDA 5FPBA 4CP9A 2IFRA 1R1A1 4B4PA 4EN6B 2D3RA 2DYCA 2RV9A 2UYAA 4YSFA 3G6JB 1H6YA 1YQCA 3M70A 3VKOA 3WF1A 3DYOA 1YC61 4MSVA 4Q4V3 4QB1A 5IK7A 1EV12 4UW3A 4A7YA 1J1LA 1RUI2 2QZ3A 3BU7A 4QD2A 1AR81 1D4M1 1RUJ1 2QTWB 2JICA 3DEMA 3DXUA 3JQWA 4I09A 1LOEA 2J1VA 1UL9A 3OBZA 4ZONA 3RZLA 1LULA 3ZSMA 1REEA 4OMDA 4URTA 4YRDA 4RS5C 4I01A 1GBGA 4IEXA 4NIAA 3WUCA 2XDVA 5K4LA 3HIFA 1EV11 1HDKA 4I0AA 4RHV2 5DDJ2 4C1WA 1K5MC 1RUI1 1MEC2 2WQ8A 2O8OA 1RUNA 4LKSA 1T6BX 1W6OB 1K5JA 2RM23 3M3CA 1GNZA 2VCAA 2WN3A 1H1MA 2YHJA 3AMNA 5FYSA 3T30A 3INAA 5FXWA 2FHRA 4AR2A 3K3NA 3MUZ1 5DDJ1 1IG0A 3SEPA 2VM9A 1MEC1 2BWAA 3J7MA 3K4ZA 4Q4W3 3VGIA 2H6BA 3OGSA 4AEDA 1O4TA 2E31A 3FLTA 3NJXA 4QQHA 3PU8A 4DPNA 5JXIA 5T54A 3UL2A 1VRH2 2JWPA 4UFIA 1OBNA 2ZHKA 4W50A 3MUY1 1PNGA 3HJRA 4KMQA 2VCMA 5CG9A 2BUKA 4I02A 2X53S 2P3IA 4H14A 2W39A 2QQKA 2VMIA 1QXRA 4UF0A 3O0VA 5C6CA 4NAMA 1JS9A 3I2HA 3FHQA 1FPN3 1VRH1 2VQTA 3S7IA 4BXFA 4AQTA 4AQ6A 3AZZA 5K7PA 3O1SA 1HJGA 2C26A 2DVGA 1V6LA 3WNLA 4FPHA 1S0GA 3WNOA 3GJAA 3BTXA 3N9MA 4FPLA 2IXKA 2X09A 4G3YC 4IV1A 5D8AA 4CE8A 2ZAAA 1C8M3 1FNZA 2R32A 1JI6A 1QDOA 1PK6A 2AGSA 4TZDA 3CO2A 2ZEWA 1W04A 5HCBA 3RWNA 3ZYIB 2QQPA 4YM1A 1OFSA 3T2QA 3UGFA 1W2TA 4IERA 5CU1A 4GIQA 1K45A 3WNXA 1DP0A 2IWGB 2WS92 4QQLA 2RS13 4BDVB 3UESA 5JCTA 3ZFEC 5JI7A 4Y26A 5DZEA 1GSLA 2H0VA 2J1SA 1UO9A 2P3YA 3LIHA 3TN91 1ASJ1 4P9WA 2R1DA 4K8FA 4Y22B 1ZZ7A 2GN3A 3FJSA 4WBBA 3TRSB 3PU3A 2WS91 3O1OA 2BTVC 4NIDA 4GMP0 4A4AA 5CFCC 2OUHA 4LLOA 5I0SA 4COUA 5FP3A 4C8DA 4LITA 5FJHA 1N1SA 1AYM2 4HOOA 4KGGA 4LKFA 5HPOA 1XE0A 5AVPA 1SLBA 5A7WA 1OD5A 5GLWA 3PL0A 3H1WA 3RFRA 1MZEA 4GULA 3IZOA 5AFEA 5BNOC 4PIYA 1GZWA 5FZOA 5E89A 1QJY2 4FPYA 4QGMA 4OHYA 4AI2A 4IEYA 1F31A 3OYWA 1F5FA 1AYM1 1QU0A 1QY4A 3M4FA 4HANA 3AP4A 4QX1A 5T55A 1W2NA 2XJVA 2IC1A 1NCRB 1PX4A 1XNKA 2VXJA 2VOKA 1QJX3 2WSVA 2XWBB 1K3IA 4BU2A 4DIQA 5A3MA 4CDWB 3VD9A 2PQQA 2D6KA 2JG9A 2VGDA 4BE3A 3HQRA 2YXSA 3WXPA 1VBA2 4IEVA 3U1XA 4CZSA 1ZA4A 1WA4A 3FN9A 4XFGA 1GP5A 4DXSA 3RMXA 2GAUA 4Q5OA 1XSRA 4YW5A 5FQ0A 5HI0A 4JTOA 3KV9A 3DYMA 2A75A 1CAUA 3MW4A 1VBA1 4J1XA 4JKKA 3ZYJB 5CBLA 3SKJE 1R1ZA 1S2KA 1RUF2 1MQTC 2A71A 2P6HA 3RI9A 2RJKA 1H4GA 4HKLA 1CZVA 2KA3A 1QH6A 2Y38A 4XJWA 2YGLA 2QQNA 5FPVA 1ALYA 1HRV3 4AHXA 5JWPA 5C5UA 4G4FA 5FLJA 3I2DA 4OI1A 1GOFA 1TMF3 4E4SA 3AB0A 3IDBB 4XC9A 1IQDC 3AZWA 5DAXA 2VZRA 5KXEA 2PYTA 1RINA 3B5LB 2IVIB 1BZWA 3PUQA 4GMP1 3ZSLA 4CDUB 4D7SA 5FMOS 1U12A 3U4XA 1WD3A 1WMDA 2BW8A 1H2MA 5A3NA 3JBG3 4OQ8A 2J1TA 1YUDA 2BJSA 2DVFA 3SLIA 3J4UH 4HPKB 5FZKA 3JU9A 4EWAA 3MLJA 2ZA9A 2A5ZA 1BBT2 1URXA 3S57A 1PMHX 1G6NA 1DG6A 2D3SA 1AJKA 1ONAA 2R0FA 3PIJA 4M3CE 5FUNA 3VN4A 5IAXA 1W3VA 3HBKA 1LEDA 4QGNA 4UW5A 5C9AA 2VMFA 3VKFC 2IXIA 2BP6A 1A8DA 3H1MA 2W92A 3TYJA 1EUTA 3B00A 1F2NA 5BNNA 2YB7A 3ATGA 2NPIA 3QOPA 2WNUB 5BNPB 3NAPB 3NV4A 5C4WB 4KG8A 2UWAA 4XF1A 1VBD2 4RQPB 3VDDC 2J1RA 4LBQA 1IPSA 4A41A 2HBUA 4BK4A 5FMOL 1HV0A 1IS6A 1EAH3 2GC3A 4M0NA 2Q8CA 2D43A 4LIUA 4GZ9A 1HB4A 1EY2A 1IOAA 3KQ4B 4Y1YA 4N43B 3A21A 3VBHB 1WD4A 2QZ2A 1Q8QA 1VBD1 5LBEA 3MIBA 4AWDA 4E2GA 1VALA 4EZ4A 1WUVA 4XJAA 4Z1VA 1RHI3 2VY0A 3E5UA 1VAVA 2XUEA 5LZ6A 4KBZA 5JMCA 4N8MA 4Q4W1 2ZEYA 3Q8CA 5FYZA 5FPAA 1NCQC 2VMCA 2Z2SB 1AR62 2OX0A 3KSCA 2PLV3 1XU1A 1TE1B 2WZ8A 1LESA 2ZGMA 2WFPA 3NNLA 1NA1B 2VZOA 3JUUA 1DIWA 3LFMA 2JKXA 1XNDA 3MEPA 4M3CB 1AR61 1EYBA 4QDRA 5C5TA 4DINB 4A2UA 4FPCA 2YPJA 3O1VA 1I3HA 1JW6A 1OVSA 2WO3A 1BHGA 1FPN1 2XJUA 3ALQA 4XBLA 5C3PA 3B02A 1AL23 1AX0A 2PAMA 5T5LA 4QXBA 1UY1A 2D5HA 4JX0A 5T5OA 4E2QA 4RS5B 1A78A 5D2AA 2JECA 4XAEA 2VTXA 5JIAA 3USSA 5BXXA 4IEUA 1VBC2 4ONUA 2ZHLA 3K4DA 4BHPA 4HXCA 3K75B 4M01A 3RZMA 4MGQA 1OOPA 3C7FA 3ZR5A 1XRUA 2CHHA 3IMNA 3SISA 5IVCA 1V0AA 4GD4A 2CAUA 3HT1A 4D7TA 5ABJA 2W0XA 1VBC1 4CU6A 3I2IA 1W8HA 5I0TA 1G8WA 1YYNA 4MZUA 1W9TA 2VVEA 4YVWA 4BQXA 3H8RA 5ABJB 5FYMA 2RS11 5IT6A 3SXWA 1E57A 4AVTA 3PVBB 3UJQA 2Q8DA 3NQHA 1RUOA 1CPMA 2ZX0A 3AVRA 3B69A 4H55A 3VBSB 3ZSEA 1SCRA 5L36A 3H50A 3VD7A 4F7ZA 1UOFA 2XJQA 3T1LA 5C3OA 4PQ9A 4XUOA 1H30A 3LQCA 4OQ9A 4AFMA 5GZFA 3WDWA 4DO0A 3AKPA 1FNYA 3HN1A 3P3PA 3U37A 1BMV2 4YG3A 3ZVXA 3C7GA 1TQ5A 2GSYA 2O0OA 5FZ8A 4QKDA 4YFWA 4XMIA 1I6XA 1WLWA 2R072 1O3RA 2ZGKA 2JE8A 1CAXA 5KWRA 2XL9A 1FMD2 3K2OA 3ZXKA 5JXGA 2FCTA 3I4IA 4LK7A 4CU7A 3LFIA 1RB8G 1O4YA 4CEYC 1BMV1 1XNTA 2OQ7A 3WW1A 3WNNA 5DMYA 3O12A 2R071 3S7EA 4LBLA 4UF0B 1Z0HA 4BIOA 4EYUA 5FOJB 5DABA 2J1EA 1M4WA 1UMHA 1YQ8A 2VU9A 4O7XA 4W6WA 1X9TA 3UV9A 1STMA 1UXXX 2W52A 4FAGA 4OHVA 1QJX1 5C3RA 1OLMA 1AVBA 1MS9A 4CA9A 1SCSA 1SBEA 3ZYPA 1WKYA 4BQYA 4MGSA 1GWLA 4I0WB 2YBSA 5J3UA 3SH5A 3H0OA 1Z7S3 2WN2A 3EB7A 3Q8BA 1G9CA 1UCXA 1T6GC 1IG3A 4MX3A 1AYN2 1YFYA 4D69A 1PZ8A 3D6EA 4IV3C 2VVDA 5LBFA 1ULOA 3OGVA 1JYWA 2LW8A 5DPNA 3VZLA 1UY2A 3C3VA 5BYNA 2XJRA 1VPHA 1D0GA 4LJHA 2RJLA 3W59A 3ZXGA 1VBE2 2GP5A 4P5YA 1LRHA 2C5DA 2BBVA 4UWDA 3JZVA 2YROA 5FZ1A 2VOWA 3DUIA 1JZ5A 4D6QA 2BPA2 4NMIA 5KHJA 1DU3D 2B7YA 1VBB2 1RUC2 1W9WA 3AP9A 3WZ1A 1HRV1 1ULGA 1VBE1 3AMPA 3B3QE 3ON7A 4KG0A 2NLRA 3MF6A 1UYPA 1CPNA 4JGZB 4Q26A 4RGGA 4ZZ5A 4AVBA 5BNOB 5J09A 3ZXAC 4CU9A 2ZEZA 2QQMA 2Z79A 4K9SA 1A3KA 3DKQA 4MUVA 2BWCA 1RUE2 2JIJA 5LRRA 1VBB1 3GHNA 4PF1A 2JB4A 1E5IA 1DGRN 4XF4A 1RUC1 1G9BA 5JOZA 2PHDA 1PIV2 3K3OA 2YUEA 3FLRA 1CN1A 3K48A 3POJA 1CD3G 2I45A 4HSLA 5EJ3A 3RZZA 4Q2FA 2WSUA 3VZJA 3U11A 1KJRA 4B7KA 5HCFA 5FZOB 2VOXA 2PHTA 3SNMA 2EXHA 1RUE1 3BTAA 1RC6A 3KF5A 2ORXA 3OYWB 5FY4A 2V5DA 3NWKA 3ECQA 4FBFA 4NN0A 2QQLA 4YG0A 4AFBA 1PIV1 2FDFA 4SLIA 4O65A 1ZBA3 3ZOIA 2HEVF 1WCKA 4CP1A 4KBBA 2WL1A 4HBNA 4NHMA 4AEJA 2VOVA 3N9OA 1GR3A 2ZKLA 4CVUA 2A1XA 5FZEA 2W94A 2JG9B 4I3PA 4NHLA 1VIWB 5T52A 5BUVA 2V5YA 5L9RA 4CU8A 4F83A 3B93A 3BTYA 2XKOA 3R4SA 2AEZA 3W9AA 3RJ2X 3EMRA 2WNVC 3W21A 1W90A 1QQP2 5J98B 1US2A 4YZ3A 2O8QA 4FAHA 3KF3A 5FQ0B 2JG8A 2BGPA 3N9NA 1MVQA 3O1PA 1PO12 1A34A 4B29A 1NX9A 2E33A 2WO2A 4QPIA 3FE5A 2VCBA 4XACA 1JYXA 2VNVA 4OHZA 1JYNA 1QQP1 3M3QA 3SITA 2XQRA 3H42B 1WCDJ 1N3OA 4BJ0A 3I2OA 1F5JA 5IK4A 3MIFA 4XMAA 4DRVA 4EE2A 2R063 3QLQA 5CFDA 2UURA 3V56A 3JD73 1G9AA 1NLRA 5FMCA 3HNYM 1LR5A 3APBA 1EP0A 3CJIA 2XHNA 1NOVA 4P9IA 4CDXA 4BMBA 2JDAA 2E9QA 1LGCA 2DCJA 4AEMA 3C2UA 5J48A 1HW5A 2P6CA 3N9QA 3KV5A 1BYHA 1ND3A 4KNCA 3N7LA 3ZR6A 4NO4A 1ULDA 1JHJA 1AZDA 2HWD3 1OA2A 4JZRA 1Q8OA 4AG4A 4AVCA 1J83A 4PDWA 4IGPA 2VNOA 4Q1RA 1D0HA 4A45A 1JZ3A 2X8KA 4TYSA 4IEWA 3ZXDA 1ZRDA 1LOFC 1NE4A 3A0KA 4ZY9A 2JX9A 4XIOA 4LO5B 2GH2A 4E8CA 5IVVA 3FMGA 1LODA 4EWDA 1ZVFA 2VPVA 4QXCA 3VKMA 4Q4Y3 5SV5A 3NNFA 2D7FA 2WFF2 5TSWA 1PZ7A 2E32A 3A7QA 3LD8A 2ATFA 1W0PA 2ENRA 4UFHA 2RE9A 2YYOA 1LGBA 4RN5A 3UJOA 3UKNA 4MHRA 1F9KA 5BNNB 2DUPA 4LA3A 3WDUA 3I3QA 2WFF1 4IGOA 4DUVA 5KHGA 2KD7A 4OLLA 5FYCA 3R6SA 2QCSB 1FOD2 2YU2A 4FPKA 4HVQA 3VDAA 1FV2A 3OB8A 3PVEA 3RDIA 5A80A 5C7GA 1QH7A 4HETA 4XUPA 5FWEA 1QMJA 4GWJA 3FX3A 1IS5A 2NM1A 4COVA 1MZ5A 1O4ZA 2DBNA 2JB8A 4P9LA 1FOD1 2WKKA 2R6QA 4QDSA 2BBAA 4ET7A 4L2NA 3NJYA 4XUQA 1POV3 1NCRC 1ULCA 3TWIA 4D0QA 1C5IA 3N9LA 1J3RA 4CDWC 1GANA 3RG0A 1O3TA 3T09A 3BODA 3VBFA 2CYFA 3RVHA 4WM8A 1UKGA 3U0ZA 4XF0A 1SQ4A 4ZU5A 1OXCA 4YFZA 3ZFGA 2R30A 1YHFA 3JB4C 5C8CA 5C8WA 4EJRA 4MGKE 4TXWA 2WWUA 4QWNA 1PNFA 4ES9A 2WO1A 3RQ0A 1WMEA 1C57A 1YCIA 2WWJA 1YJLA 2VULA 5FZ9A 2GMPA 1JH5A 5JOWA 4I2OA 1LNSA 4IGQA 5FYBA 4GJZA 1NQJA 4COWA 1UNBA 4MADA 5FLHA 2VW1A 3SH3A 4ZS2A 3BIEA 3FZ3A 1XNCA 4NIIA 1NXD1 4CCNA 5IUQA 1OOPB 3H8UA 1R093 1DGWX 4LO6B 3S0MA 4M0HA 3KWVA 2VJXA 4YYOA 1KGYA 1HQLA 2GMMA 2HWB3 4P9XA 2Y6JA 2EIGA 3BTZA 1GWMA 5K0UA 4YVWB 3T08A 2C1FA 5JDBA 3SCFA 3IN9A 3K4AA 5JOXA 2W95A 1RJ7A 2XBO3 2A6ZA 2WT1A 4CDUC 4OYUA 2DWRA 4CP0A 2FZ2A 4GALA 3P1IA 2VR4A 3DPRB 3KT4A 1XYPA 2B46X 2R0HA 1LB2A 3LZZA 1RGSA 2F4PA 3CKHA 3E5XA 4PT6A 4QX3A 4HONA 4P08A 4XDOA 3UKVA 2P4EA 3ZX7A 2R043 3MYXA 3PDQA 4B4QA 2RS32 1DYPA 3KCCA 4GQ7A 3B9CA 1PO22 1GKBA 1HRI3 2IZWA 2V73A 4OZOA 4UFKA 1J3PA 1CAXB 2E7QA 1ZRIA 3ZN4A 1DDLA 1ENQA 3MI8A 2WLPA 1IGOA 4L92A 4GB31 3SH4A 2YPDA 3HBZA 1FAYA 1PM4A 2JKBA 3L2YA 4S2HA 2ZTNA 5FO7B 1QJEA 4GXLA 4RR3A 1YFUA 1GNHA 4AHWA 1PO21 4LEJA 5IVBA 5KHKA 2OS2A 3O0WA 3VL8A 1LJ7A 5FZLA 3MLLA 4IXLA 3BUCA 4IE6A 1EUUA 2GC0A 2VW0A 1QJY3 2WNUC 3KV6A 3NAPC 3WF0A 1CZSA 5BNPC 5FPXA 3CZUA 4IW3A 4RQPC 2FCUA 1S2BA 2JE7A 3TB0A 2BQPA 5J7MA 2BEOA 1ODNA 1U5ZA 1CWPA 3MV01 4IE0A 3DN7A 3POWA 4LPLA 2WDBA 4RSUA 2VBPA 1RUD2 4N43C 1QHDA 1FYUA 2W47A 1YJKA 3MDPA 3UETA 4PLNA 3VBHC 5LA1A 4XHXA 3AKQA 4MV2A 1N3QA 5FP7A 3VBUA 2XUMA 2XWJB 3DV8A 4OI4A 2A6YA 4IL7A 5AC92 4XILA 4CDQC 2VBDA 5FUIA 1WBFA 1WCQA 1C1FA 2NQYA 5EQUA 1ZRCA 2HWC2 2HWE3 4CEWA 2D6PA 3LA2A 3IAQA 1OA4A 4Q27A 1RUD1 4QX2A 2VQAA 2VUJA 4XBNA 4BLJA 2VZTA 5JZGA 3FBYA 4FPEA 1NA1C 3J7LA 2JDYA 5AC91 2BV4A 1DFQA 1CIYA 2O1QA 5FZMA 4XDPA 1GQPA 2BERA 5FZ6A 2HWC1 1POV0 1U5IA 5C33A 3JD71 4YGBA 1PVC3 2A3XA 1QIQA 2YU1A 4IESA 3OJBA 1S1AA 1JOBA 4RYDA 4Y20A 5DZFA 3HR9A 3WQBA 1MZFA 3AMQA 3GHMA 5DZGA 3BKZA 3PVOA 4NIHA 3ETQA 3ZFFB 3WF3A 2D6NA 4SBVA 4LR4A 4CCJA 4Q0UA 3BOWA 4FCAA 4V1PA 4YZ1A 2XG3A 4URAA 3WW4A 4YM2A 3NJZA 4BCUA 4AF9A 5IHRA 5LA9A 2D93A 5JSRA 2VZ1A 2ZGSA 3AYDA 3BGAA 4GA9A 5F7UA 1RL3A 4GKYA 3URFA 4IE7A 3ME2A 2QQVA 5KHIA 2QKDA 2YC4A 4LIVA 2WNVB 1BLZA 2GN7A 2PQSA 2QDRA 1S0CA 2UU8A 1JBCA 5ABJC 3PUSA 1KQRA 3GCWA 3KHCA 2DU0A 3WCSA 5IK5A 1MR5A 1QXJA 5DUVA 5F6LB 1ENXA 1JU3A 1TEIA 1WLDA 3VBSC 4KWJA 4Q4X3 4P9YA 2W08A 1COV3 1H9PA 2G4IA 2VW2A 2V4VA 5FZ0A 1HXS3 1W9YA 4DNYA 4LOSA 4DMIA 3VZMA 1VLNA 1W8FA 5J37A 4MXWA 2V4AA 5FPLA 2EXKA 4KL1A 3CZJA 5A32A 3ZKYA 1D2SA 1CESA 4HZFA 4Q0QA 2R49A 4AEDC 2RR12 2EXIA 2X05A 3WG1A 5EWSA 3D0SA 4OULA 4RFRB 4W6XA 1PGSA 4A7KA 2P2KA 2H6CA 4LTAA 4LOTA 1HB1A 1QJU2 5ERLA 3W5NA 4GWNA 3WQ0A 5L7OB 4ARYA 2RR11 3DCQA 2Q8OA 1POV1 2D6MA 1RXFA 3CJIB 3PLQA 4PHZA 4QHZA 3RSJA 4BK5A 4CDXB 1ZZ9A 3PHMA 1NLSA 2VZVA 5E8AA 3EXUA 3IB3A 3TN92 1QJU1 2QQWA 2EICA 3OTFA 1ND3B 4GWMA 4QT6A 1ASJ2 3AKSA 5EP9A 2I2SA 4META 3LGRA 4C0BA 1AR92 1ZM1A 2XLFA 5D8AC 4YZ2A 1OKOA 4PDWB 1RXGA 1DQ0A 5EV7A 4FTBA 2E51A 1KS4A 3NV3A 1O5LA 4RGKA 1HKDA 4AHZA 5JXJA 1O6UA 3BPZA 1E5SA 2VZ3A 3IDEA 5K9YA 4FPOB 3RGBA 4JVAA 1AR91 3THDA 5A7PA 4FT8A 5FYUA 4JGYA 4WVZA 4AK3A 3ZFEA 5GLVA 4L11A 4QX8A 1IKPA 3ZSKA 5FKBA 4DZGA 2WUHA 1WGPA 3HEIA 4OUEA 4XE9A 3ZSJA 1OA3A 2F6BA 2PAEA 3UYJA 3DKWA 3F95A 5FTTC 3ZPYA 2FDIA 4LE4A 5FXZA 5FV3A 5LCWL 4JGZC 1JUHA 2FDJA 2HWB1 4FOYA 5CFCA 1H1AA 4OMCA 3N7KA 2ZCWA 2FDGA 2EVXA 1J3QA 1SZBA 1RUG1 4YWAA 2HYXA 5ACA1 4FFIA 3GXUA 4MG2A 3OUIA 2DFBA 3X29B 4IEQA 3T0BA 1OUXA 3TOJA 3BI3A 2XLAA 4XQ4A 1CIWA 4LUMA 5A3UA 1RMU3 4NROA 5FZFA 4AVAA 4RGAA 4W65A 1RVF3 1H8TA 3CQOA 5FP8A 1CZTA 1RUH3 2KXLA 1XSQA 4BQWA 2ARBA 1EPZA 3ILFA 2RMU3 1NZCA 2B4KA 4XPVA 4NRMA 3SEEA 5FK7A 3A4UA 3GBGA 5EJZB 1H4HA 1SACA 2JD4A 4WM8B 2JG9C 5FMDA 1AR72 4H7LA 4QQOA 1Y7BA 1GFF2 3NV1A 4IEOA 1OQEA 4Y5TA 3ZFGB 4AVVA 2C9KA 5CYYA 1XJAA 2PAKA 1JTZX 5C8CB 1W2AX 2DV9A 5DAWA 1CAWB 1UMIA 2VTXJ 3ACGA 3EHKA 3WCRA 4HMZA 2DCTA 4DEQA 3LOBA 3ACLA 4LO7A 1LU1A 3FWEA 1DZTA 5F2SA 5T5JA 4BA6A 5LY1A 1AR71 3PURA 4P5HA 3ZDVA 1GYKA 2BGCA 1MQTA 3AJYA 1F4AA 1OT5A 4PBOA 4PBPA 4FI9A 4EZHA 1K12A 3O5SA 3FLPA 3T1MA 4ZKTB 4WZCA 4YVSA 2MEV2 1WZXA 2JDNA 2WAAA 3OY8B 5F5IA 2XLGA 4CCOA 3S6PA 2ZZQA 3JB8A 4GH4B 4QX5A 1MVEA 4XZUG 4XUNA 3LPGA 5DG1A 1W6PA 2YC0A 2BVVA 1WW5A 1OHFA 1KS5A 2GP3A 4AI0A 2B9VA 4OHWA 1TME3 2XL7A 2WYFA 2HWE1 4QPWA 4O61A 4Q4V2 1WLCA 1T2XA 3POIA 3WDYA 3MIEA 2MEV1 4HVOA 3KHBA 2WJSA 4QGLA 3WP3A 3FHAA 1UYZA 3AP5A 5LK7B 3NVCA 5DUXA 4N53B 5I8YA 4NPRA 2FDHA 4HT1T 3POSA 2XKPA 3HD8B 4Q4V1 4IEZA 4XOGA 4NHKA 3I8TA 4AGRA 4QPGB 4CTEA 3HQXA 2BNMA 4LBKA 3IDAA 2RM22 4CCKA 3THPA 1KEXA 3IMMA 2ZHNA 4IQPA 2ZGPA 2OYZA 3SKVA 3DECA 2FCVA 3POGA 5A6QA 1F35A 2EIBA 2FZ1A 2W91A 2W9XA 3B7MA 2Q5TA 3IPVA 2A7AA 3WNMA 4EN9B 5C9AC 1W6MA 4RR3B 4Q4W2 5FZ7A 2RM21 4XW3A 1UF2C 1VMHA 2ORZA 3OGRA 4ASMB 4M4PA 4MVTA 5GJ6A 5IVJA 5BNNC 4XUTA 1HQNA 2C4XA 3OG2A 3VDDA 3LSDA 1W6QB 3OGGA 2F4LA 4L8QA 2FDKA 4QB2A 3VHPA 2ARCA 2G9GA 3IAPA 4LUKA 4CDQB 2Y0OA 4AI8A 3W58A 4UAPA 5FZHA 3OD0A 1H2NA 2UWBA 4F3JA 2IFWA 1GZ9A 4E4HA 2D6OX 3EQEA 4EN0A 2B9UA 1MS5A 1FPN2 1S55A 2Y60A 4XFHA 1YQ5A 1JZ6A 1SFPA 2WLQA 3WQ7A 1RYYA 1NCQA 3H3LA 4EQVA 4LBOA 3LIGA 1I1EA 3V0AB 3D8CA 1ND2B 4NOTA 1MPXA 1F8VA 2Q1MA 1C8M2 2H0BA 3E1F1 3MFAA 2UY8A 3WF2A 4CP9B 5JZGB 5A33A 3CDZB 5F8PA 1BJQA 2VXRA 3MIGA 4BH9A 4QDQA 4A6OA 1BEV3 3LCPA 3NL1A 2B8MA 5JIUA 4D6SA 1BVVA 1TVGA 1W2OA 1PM7A 1C8M1 4Y20B 3KVAA 1DYOA 3QH7A 2RS12 4FO9A 4NVPA 1VB4A 5FP4A 1IKQA 4ISRA 4Y33A 3VHOA 3KD4A 2JDUA 4IDZA 4K6BA 1IHMA 5IAVA 3NSTA 1WMXA 3WUDA 3H3UA 5LBBA 1IS3A 3BCWA 2HWF3 5C3SA 4LORA 2QDNA 1R64A 1WA6X 5BPXA 3EJKA 2GDFA 2FQPA 3ILNA 5GM0A 4R8HA 4XBQA 1OOPC 5F9TA 4LE3A 2X5IA 4UFMA 1GICA 2CWSA 1W9SA 1DQ2A 4G9SB 3H9AA 4AL9A 5CKQA 3POBA 2ZXQA 4COZA 2EA7A 4DUWA 2YBKA 4QKNA 5FDBA 5DN2A 2WZR3 4HFSA 4YVWC 1SFYA 4XXAA 5DXDA 1XBFA 2D98A 3ACFA 3USUA 4FOQA 1BK1A 4FSJA 3KB5A 1UY0A 4ZXEA 4AEDB 3DL3A 4YW3A 2WIIB 2GALA 3IKWA 4FXKB 3T2OA 1GWKA 3HPNA 3O1TA 1UOGA 1Q5OA 2QQIA 3DPRC 3KV4A 4UBHA 5FZ4A 2UYBA 1IPJA 4DY3A 1PGL2 3TNPB 3EYPA 3WW2A 1QJX2 4N90A 3GBWA 1GU3A 1KITA 1PGW2 5A32B 2ZJCA 3DYPA 5A1FA 3AYEA 1UZ0A 3M7AA 1C1LA 1ZX5A 4S2DA 1XQNA 2KM2A 5A3PA 1W06A 3KM5A 2QQOA 3C7HA 5LW9A 1PGL1 1W8UA 1PGW1 1CVNA 1V9U3 3KMHA 2OT7A 4QXKA 5E16A 1QXPA 4FP2A 1RMU1 2ZX1A 4O9GA 4IV1B 5D8AB 2IXJA 2ADEA 4BLIA 1SMVA 1Y9GA 1RUH1 1D7PM 1SHWB 1QWRA 2DCKA 1N1TA 4DOUA 1PK6B 4IE5A 2AYHA 1X36A 1S4CA 5KR7A 5LRSA 3D82A 3AKTA 1SLTA 4MH0E 4YGDA 4JRAA 4RA0A 5FZAA 4NUBA 1HRV2 3J8F3 2DCYA 1YO8A 1GOGA 3BB6A 3AYAA 2EF6A 2A70A 5KXBA 5DAPA 4QU1A 1TMF2 5G05L 4BWOA 2RS53 1UYXA 5FR3A 4H3WA 4I0BA 4B3NA 3JCIA 2VE1A 1GP6A 2GNDA 2WO7A 2XXZA 4GKXA 4ITCA 5A6XA 1HQWA 4KU7A 3LB9A 4AGGA 3SC7X 4JGYB 3AM2A 2NYYA 1X8MA 2ZMLA 3PNAA 1TMF1 2VVFA 2QFEA 3JBG2 1Q8PA 2WQ4A 4YPJA 5CIRA 3WT3A 2DVDA 1SLCA 2WAOA 4JTNA 4ZU4A 2VL4A 1AUYA 5LATA 1NG0A 1TNRA 4XFFA 5A7WB 2JDPA 2QQUA 2W1SA 1TME1 3H7YA 2G19A 2WA3A 3MF9A 3JBG1 4XETA 1SBFA 1GZWB 1ZBE3 1QEXA 1X7NA 2CGOA 4R9DA 4JDNA 5J36A 3ZFFC 2OPWA 3T0DA 1O8SA 4LBNA 1V70A 1AX1A 5EXOA 1XB9A 1ENRA 3D0JA 3OBAA 1SDWA 1UY4A 2P5BA 4BQ2A 1UPSA 4XJ9A 3M3EA 1R083 5F32A 1AF9A 5FZBA 5B4XA 3WQ1A 1H8TB 3VBRA 4BPZA 4BYYA 1QF3A 2JJ6A 1EAH2 3HWJA 3MW3A 1L7QA 2D44A 4XJ8A 4AQSA 1W6OA 2DCZA 4Q1PA 4R9CA 1W8WA 3IWZA 5FZGA 5T5PA 1L7RA 3LA7A 2P34A 2WQZC 3D4KA 1SDDB 5JUVA 2XVLA 4D8MA 1X50A 1RHI2 4P9GA 3C7OA 1W8OA 1CAUB 2D5FA 3JXSA 1EAH1 3SHRA 2KR2A 3AZVA 3ITQA 4HN1A 2PLV2 1OLQA 3ORJA 1L3JA 3BVCA 4J6GA 5A6ZA 1YI9A 2AACA 2K46A 1OURA 1Z78A 2JG8C 4XDQA 4LO4B 5FIXA 2IXHA 1RHI1 2LROA 4Q0VA 2VD7A 3AP6A 3AFGA 4QKFA 5A70A 1E5RA 2VNRA 2VOTA 3OEBA 2PLV1 2XONA 3ZKUA 4DQAA 4LNVA 3HOBA 3TEYA 1CGPA 1BK0A 2CDPA 1CX4A 5F3IA 5CFDC 4PCRA 1AL22 4K8RB 3LDBA 5L7OC 2FD8A 4Z07A 4A6SA 2LRPA 1R1A3 2AREA 2D3PA 2ZGNA 2V72A 1JUIA 2BFUL 2Z5WA 4IE4A 2RDRA 1HLCA 3CJIC 2RVAA 3MICA 4QB6A 4CDXC 4FFFA 1VMFA 2Y34A 1JOPA 3KT1A 4R4XA 3WVJA 5C71A 4Q0SA 4CXWA 2C6SA 1KFUL 1ND3C 3DF0A 1AL21 1AR83 1D4M3 1RUJ3 1SLLA 2MNGA 2XB6C 5GALA 2VZUA 2JENA 5JPNB 1JYIA 2YBPA 1JN2P 1BEV1 1LOFA 1NXMA 1UWWA 4MOAA 4PDWC 1H8VA 4E27A 2LUWA 1Y4WA 1WBLA 2XQXA 5ISLA 1C4RA 2NN8A 5C9AB 1AXZA 1EV13 3MHZA 1MACA 1RUI3 5FRAA 1OPMA 4CCMA 4AI3A 2MPFA 4B1LA 5IYYA 2BU9A 1G9DA 3CL1A 4K20A 5FZDA 2WA4A 1V6MA 1U5YA 5JR7B 3ZMNA 4LBQB
chains in the Genus database with same CATH topology
2CHHA 2JDHA 1OXCA 5A3OA 5A6ZA 2BOJA 2JDUA 4CE8A 4UT5A 1OURA 1OUXA 1W8HA 2VUDA 3DCQA 1OVPA 5A70A 1OVSA 1W8FA 2JDKA 2WR9A 3ZDVA 2JDMA 2JDPA 5A6YA 1GZTA 2VUCA 5D2AA 2XR4A 1UQXA 2JDNA 2JDYA 2BP6A 2WRAA 2BV4A 5HCHA 2BOIA 1UZVA 1OUSA 4AOCA 5A6QA 5A6XA 2VNVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CHH A;  2JDH A;  1OXC A;  5A3O A;  5A6Z A;  2BOJ A;  2JDU A;  4CE8 A;  4UT5 A;  1OUR A;  1OUX A;  1W8H A;  2VUD A;  3DCQ A;  1OVP A;  5A70 A;  1OVS A;  1W8F A;  2JDK A;  2WR9 A;  3ZDV A;  2JDM A;  2JDP A;  5A6Y A;  1GZT A;  2VUC A;  5D2A A;  2XR4 A;  1UQX A;  2JDN A;  2JDY A;  2BP6 A;  2WRA A;  2BV4 A;  5HCH A;  2BOI A;  1UZV A;  1OUS A;  4AOC A;  5A6Q A;  5A6X A;  2VNV A; 
#chains in the Genus database with same CATH topology
 1GQG A;  4E4D X;  5IJR A;  5DDJ 3;  4RHV 3;  5IK8 A;  1UY3 A;  1Y43 B;  2ZGQ A;  2C24 A;  1MEC 3;  4QXH A;  2R16 A;  4Y22 A;  1ZA7 A;  4CPB D;  1B35 A;  4Z92 B;  3MFC A;  1HX6 A;  2GME A;  4MGZ E;  4V2V A;  1JOJ A;  4WVM A;  3ZXF A;  3AKR A;  4R9B A;  4Z2A A;  2YC2 A;  2OXB A;  3D3A A;  4K1Z A;  4L97 A;  2NZ9 A;  2WRA A;  4NWW A;  4XZP A;  4QMA A;  3Q8F A;  4OI2 A;  5FYI A;  2K0G A;  4Y1Z A;  4BB3 A;  4QAW A;  4KWK A;  3AXD A;  2QJV A;  3ST7 A;  2ZKN A;  1OKQ A;  3OCP A;  4OI0 A;  4W6Y A;  4N9H A;  1CQ9 A;  2BNO A;  5I0U A;  3KT7 A;  4FQ4 A;  1SLI A;  4COY A;  2YFU A;  2HYK A;  1J58 A;  1VRH 3;  1LHU A;  4NE9 A;  5KXC A;  2BOJ A;  4XJU A;  5I0R A;  1FXZ A;  1GNY A;  4AZZ A;  1H9W A;  2HKX A;  1I5P A;  4CDW A;  3FHI B;  1TG7 A;  1X82 A;  5HCA A;  1UOJ A;  3QD6 A;  2Y26 A;  3AFK A;  3ES1 A;  1N1Y A;  2JDK A;  5A7N A;  4GJY A;  4D6R A;  4WM8 C;  2QUO A;  3ASI A;  3TNQ A;  4R4Z A;  1BVP 1;  1V9U 1;  4KQ7 A;  1UXZ A;  3ZFG C;  1MS3 A;  1A8M A;  2NMO A;  1YNA A;  2Y6F A;  4XCA A;  2MHF A;  1Z7S 1;  5C8C C;  1UMZ A;  4LK6 A;  3MPB A;  4QHO A;  3N3H A;  3LEG A;  3VBO A;  3N36 A;  3ZYR A;  5GZD A;  4QX7 A;  4FPJ A;  1LTE A;  4AHY A;  3ROU A;  1OLM E;  3M2M A;  3WDX A;  4LUL A;  5GZG A;  4B8E A;  3PJY A;  3D5O A;  4KH9 A;  2VUD A;  3ZN6 A;  5JOY A;  4FFH A;  1V6N A;  4AI9 A;  2OPK A;  3LAG A;  4GH4 C;  1LAJ A;  4HN0 A;  3IT8 A;  5HXV A;  1GMM A;  1YQ2 A;  2X5I B;  4JHZ A;  2DUR A;  2WS9 3;  1XYN A;  3U4S A;  4CXY A;  4XEZ A;  1JOD A;  2Q0A A;  4JQT A;  5FYV A;  3E97 A;  4TLF A;  3Q8A A;  4GB3 2;  2GC1 A;  3B94 A;  3HNB M;  2EXJ A;  4E4Z A;  4Q0P A;  5AVA A;  2Y33 A;  3USU B;  5F2W A;  4DEV A;  2OUJ A;  4IEP A;  1LGN A;  1RJ8 A;  1QOO A;  1JU4 A;  3CLP A;  1NUK A;  3QCW A;  4N53 C;  3SCG A;  3T3Y A;  2A3Y A;  4ARX A;  2GC2 A;  2BYV E;  3NKG A;  3WV6 A;  4AAX A;  1QGL A;  2ZMN A;  1ZBA 2;  4QPG C;  1V6I A;  3OOX A;  4HPK A;  1AYM 3;  2A3W A;  4XHB A;  2IVJ A;  1SFN A;  3ZPO A;  1JYC A;  4AVS A;  4LKD A;  4WVV A;  3PUI A;  5GLU A;  1LOB A;  2DU1 A;  1KJL A;  2QE3 A;  4TLG A;  5GZC A;  4RD7 A;  1GZT A;  2B45 X;  2J42 A;  4LHL A;  2CY6 A;  3CU7 A;  5I0D A;  2VZQ A;  5A7S A;  1ZBA 1;  3AP7 A;  3ETP A;  5FY1 A;  5HV0 A;  5JSO A;  2YY1 A;  3BYW A;  4RR3 C;  3LA3 A;  1KFX L;  3M1H A;  2Z42 A;  5I93 A;  1YFX A;  1HIX A;  4FTS A;  3NAP A;  1JYV A;  2W3J A;  5C4W A;  3I54 A;  2W2I A;  3OGJ A;  5CNA A;  3HN3 A;  4IUG A;  4XXP A;  2W5F A;  3WEZ A;  4KI5 M;  4ZS3 A;  1ZZC A;  1VBA 3;  1OQ1 A;  3AVS A;  1K42 A;  1YXW A;  3RYK A;  1UU4 A;  4WM7 A;  2AC1 A;  2R06 2;  1OD3 A;  1HB3 A;  2DUQ A;  3LDR A;  4NR1 A;  3JD7 2;  4JC1 A;  3O1R A;  1O91 A;  1GUI A;  1G9F A;  2IXL A;  2ZMK A;  2VH9 A;  3I2F A;  4GAZ A;  3WOG A;  3TEZ A;  3RYP A;  1OF4 A;  4XCB A;  2I74 A;  5JLV A;  2Q4S A;  4BXS V;  1RUF 3;  2R06 1;  3NO8 A;  1DQ4 A;  5KHH A;  3GZE A;  2DVA A;  5CZK A;  5KXD A;  4CEW C;  2SBA A;  2HWD 2;  1ND2 C;  5CEH A;  1NA1 A;  4GMP 3;  3M3O A;  2AR6 A;  3VUO A;  5JZG C;  4M3C A;  2WC2 A;  5FMB A;  3I3M A;  2Z4F A;  3W20 A;  4LT5 A;  2LTN A;  3N35 A;  4ZXK A;  3PUH A;  3PJQ A;  5EIY B;  2E26 A;  4Y5S A;  3GZT B;  3NW4 A;  5FY9 A;  1YWK A;  3TEX A;  4LXL A;  3VKN A;  4CUB A;  4V2W A;  3A23 A;  3R0R A;  2RDN A;  2ZHM A;  2HWD 1;  4Q4Y 2;  5LBC A;  1UU6 A;  3I7D A;  4BOW A;  3OBT A;  4CCE A;  1UOB A;  2FMD A;  4FXG B;  4ISQ A;  4XTP A;  1NE6 A;  4PJY A;  4RS5 A;  3S30 A;  3SMH A;  3UT0 A;  4ATF A;  2RG4 A;  3MW2 A;  3U10 A;  3KLS A;  2V09 A;  4BM8 A;  1K5M A;  3LOI A;  4FOV A;  3ELN A;  4K21 A;  3NKT A;  3PMS A;  4X8N A;  4C91 A;  4KGQ A;  4Q4Y 1;  4PLM A;  4R9A A;  3QBQ A;  3WLU A;  4AE2 A;  4ERO A;  2DTW A;  4UFL A;  3WY6 A;  4CYD A;  4LBM A;  4K3U A;  1BBT 3;  1GOH A;  3WG4 A;  4BME A;  4FPG A;  1MS1 A;  2BNN A;  2DVB A;  1XU2 A;  1DZQ A;  3RMY A;  3VBR B;  1UX7 A;  5HBA A;  4TWT A;  2ARA A;  3EO6 A;  1GZC A;  1YEW A;  2VC9 A;  5DAQ A;  1DLL A;  2E6V A;  2QQJ A;  2ZGR A;  3BN6 A;  4LA2 A;  4LHN A;  4NJ4 A;  3WDV A;  3POE A;  3MGU A;  2W1Q A;  4XQD A;  3TAY A;  2HEY F;  2OZJ A;  4GWI A;  2R7E B;  2K2S A;  4JDO A;  3VBS A;  2JG8 B;  4IND A;  4OVE A;  4BIS A;  3A22 A;  3NV2 A;  1UZZ A;  4RL7 A;  1VBD 3;  4YM0 A;  4RHV 1;  2CDO A;  4QPI B;  4OFG A;  1VE0 A;  3C8X A;  1LHW A;  1QJF A;  1DQ1 A;  2YMZ A;  2Y64 A;  2XML A;  5LWB A;  5JMO A;  1NLQ A;  5LK5 A;  5FWJ A;  4FTE A;  2XJS A;  5CFD B;  2GNB A;  2VEC A;  3U07 A;  1Q3E A;  3O7O A;  2R1B A;  4UXA A;  4A7Z A;  2HJI A;  4ORF A;  1PMI A;  4JV4 A;  4YW2 A;  2E53 A;  2PHR A;  5A1A A;  1LEN A;  4A42 A;  4XTM A;  3T0A A;  4C90 A;  4EN7 B;  1NY7 2;  5CAZ A;  4DUX A;  4UW6 A;  4ZZ8 A;  4E8D A;  1AR6 3;  3H1Y A;  1AHS A;  3NRU A;  3MV1 1;  1VB2 A;  5FO8 B;  3GNE A;  1NZI A;  2VAU A;  2JEM A;  2PHF A;  1GQH A;  3KCX A;  2XGX A;  5D1I A;  4IV1 C;  5IFT A;  5T50 A;  4NWV A;  2BOI A;  3PTR B;  3RS6 A;  4AOC A;  1IZ3 A;  1PK6 C;  1NY7 1;  1YIP A;  5H9R A;  1REF A;  1LKN A;  4JQR A;  3AXE A;  1DHK B;  1SPP A;  3PME A;  4CUG A;  5HV4 A;  1R09 2;  3AMM A;  1LOC A;  4X8P A;  5CG8 A;  5DUW A;  3Q9O A;  1W03 A;  3I3E A;  2HWB 2;  2J1A A;  1HV1 A;  2C0Z A;  5CA6 A;  2YDE A;  1RUG 2;  4S2F A;  1XE8 A;  5C70 A;  3OUH A;  3GM8 A;  1VBC 3;  3RWK X;  5ACA 2;  2XBO 2;  3POF A;  3WHT A;  3T2T A;  1R09 1;  1FI2 A;  3QAC A;  4JGY C;  1P8J A;  1MS0 A;  3J26 N;  2GZW A;  3OBR A;  4N7I A;  4QHB A;  1NAE A;  3VLB B;  2GH8 A;  1JXN A;  2CV6 A;  1OH3 A;  2OII A;  2E63 A;  2WT0 A;  4QKB A;  3THT A;  3ZXE A;  4CCC A;  2ZGL A;  5FBJ A;  2R04 2;  1PMJ X;  2XJT A;  1W9F A;  3GCX A;  4N7U A;  4ES8 A;  2XBO 1;  4JGZ A;  3EBR A;  3MPP G;  1HRI 2;  1LOG A;  4A3Z A;  1YFW A;  4ASK A;  4X6Q B;  1XE7 A;  5BNO A;  1B35 B;  4LO8 A;  2FMY A;  2VG9 A;  2EIE A;  4YM3 A;  3OEA A;  2X29 A;  4CUC A;  1QNY A;  2JD9 A;  4WVM B;  1DGR A;  1XNA A;  1O7F A;  5AFB A;  3I2G A;  5JPM B;  1OF3 A;  2P3K A;  2R04 1;  2D40 A;  3M8L A;  1RED A;  1C3H A;  5FAX A;  4I30 A;  1HRI 1;  4UFJ A;  1S0F A;  4Y3O A;  5F5Q A;  5CAD A;  5BV6 A;  5JVV A;  4DB5 A;  2ZBJ A;  5APA A;  2WZP P;  3PIG A;  1AXK A;  2R07 3;  4ZU7 A;  1NKG A;  3MZH A;  3SCH A;  1FMD 3;  3VBF B;  1ZRR A;  3O1M A;  2G1M A;  2B39 A;  3PTY A;  3ZM8 A;  1ZZ6 A;  4XIK A;  1H8T C;  5DAV A;  1OC1 A;  5GKA C;  1YQ6 A;  3R4D B;  5T3N A;  3ILR A;  3ZXL A;  1OSG A;  2CGP A;  4XYX A;  2AEY A;  4Y1U A;  5F3E A;  4D7Y A;  3CEW A;  1AL0 G;  4DXT A;  3WR0 A;  1QJY 1;  2UWC A;  3OSD A;  1V00 A;  1A6C A;  2JXA A;  3AL5 A;  2F17 A;  5F1R A;  3C7E A;  5CVR A;  3KGZ A;  2ZPX A;  4K7J A;  5FP9 A;  3AC0 A;  1F15 A;  4NRQ A;  5E1R A;  5L9B A;  2HWE 2;  3VZK A;  5A3L A;  3HVD A;  4MLO A;  5EYX A;  1DQ5 A;  3MO4 A;  2CAV A;  4DXZ A;  5B4N A;  2ID4 A;  5HCH A;  3VBO B;  3NNG A;  1G86 A;  1NT0 A;  2AUY A;  3F2Z A;  4K1Y A;  2VCC A;  3FFZ A;  2JIG A;  1AYN 3;  5FY5 A;  3WDT A;  4HLT A;  5ANQ A;  1RIT A;  1RIR A;  1PVC 2;  1SEF A;  4YVS C;  4UT5 A;  3ZN6 B;  5K0U B;  3U75 A;  5F3G A;  1VBE 3;  2B42 B;  3QH6 A;  2XVK A;  4FQZ A;  5EPA A;  1Y9M A;  4F8A A;  5IW0 A;  3GDB A;  2Y0I A;  3WP5 A;  3VDB A;  5F39 A;  1SG3 A;  4IET A;  1RUF 1;  1U0A A;  4JDM A;  4MO3 M;  2JE9 A;  2W1U A;  5A6Y A;  1VBB 3;  1CAV A;  1PVC 1;  1RUC 3;  3LPF A;  3R05 A;  4ZPI A;  1CR7 A;  1Q8V A;  4M3C F;  4Y4R A;  5FYY A;  5F6K A;  5FPU A;  4OHX A;  1MS8 A;  3HQU A;  2WAB A;  1Q43 A;  3K77 A;  4QM9 A;  2ZX4 A;  1Q56 A;  5LEJ A;  1PVX A;  1RUE 3;  4WZF A;  4YZ4 A;  1WWY A;  3WG2 A;  2VMH A;  1FV3 A;  5B2G B;  4Y4Y A;  2PHL A;  1BQP A;  1PIV 3;  5H9P A;  1VR3 A;  2J7M A;  1V6O A;  1GV9 A;  5GZE A;  1QNW A;  4N9I A;  5I8T A;  1WMF A;  4Q4X 2;  4Q8L A;  4LKE A;  1RTV A;  1FAT A;  1COV 2;  4KU8 A;  1HXS 2;  4FP3 A;  5EYY A;  4BIF A;  1KXG A;  1BBT 1;  1ZZB A;  1NYW A;  1LEM A;  1D2Q A;  2BRT A;  2SLI A;  3AL6 A;  4Q4X 1;  1L7L A;  1COV 1;  4W8J A;  5A7O A;  4TN7 A;  1HXS 1;  1UN1 A;  3VBU B;  1BCX A;  4PI0 A;  4QPY A;  3ES4 A;  1FX5 A;  4A44 A;  3KZ4 C;  2Y6G A;  3WSO A;  2Y6H A;  4C1X A;  4HK8 A;  4WM7 B;  5E88 A;  3J7N A;  1E5H A;  1QQP 3;  4EWE A;  4CEW B;  2A6X A;  2RHP A;  3HT2 A;  3K46 A;  4CXX A;  3NNM A;  2OW4 A;  1PO1 3;  4DXR A;  2PMW B;  5JAX A;  1TNF A;  3WHU A;  3KGL A;  1J84 A;  1UQX A;  5EZW A;  5J1X A;  2WYS A;  3GZA A;  3WX5 A;  1Y9Q A;  5LY2 A;  4XAB A;  4YAR A;  4AGV A;  1S0D A;  5A3W A;  4CPB A;  2JDZ A;  4B1M A;  5L73 A;  1W2U A;  2DFC A;  3V64 A;  1O3Q A;  5FUP A;  5IVY A;  4MGT A;  3E6B A;  2I07 B;  3TBD A;  2PXJ A;  2HLE A;  4YG6 A;  1J59 A;  4NPM A;  4XJZ A;  5M0T A;  2YG0 A;  4XFI A;  2RDQ A;  4YW1 A;  3WP4 A;  1DYK A;  5FZI A;  2EID A;  2GU9 A;  2WT2 A;  5DQ0 A;  4YGE A;  1K5M B;  2WBK A;  4QQP A;  3I3D A;  4WV8 A;  1O59 A;  3E5Q A;  4HVR A;  2B5H A;  3BU0 A;  2D97 A;  2Q30 A;  3N9P A;  2A6V A;  1FT9 A;  4Z8B A;  5FO9 B;  1UW8 A;  3MBW A;  5JSP A;  2OVU A;  1ZYB A;  1JZ8 A;  2X5I C;  1PX3 A;  2CGN A;  2WFF 3;  5L9V A;  5FBZ A;  1JZ4 A;  3CIH A;  4KWL A;  3UNP A;  1LU2 A;  1X33 A;  3ZYB A;  4ATE A;  1WCS A;  3ACH A;  1O5U A;  3P3N A;  2AZ5 A;  2WNO A;  5CIS A;  3AJZ A;  4MXW B;  3LWC A;  4MXV A;  5ANN A;  1AX2 A;  4QU2 A;  5FRE A;  5H9S A;  3DPR A;  2ZGT A;  1BKZ A;  2BZD A;  1RMU 2;  2IUW A;  1YLL A;  5FPZ A;  1RVF 2;  3I59 A;  1I9R A;  1RUH 2;  4CEY A;  1FOD 3;  1OH4 A;  1WW6 A;  3PUA A;  4AYU A;  1PHM A;  2E7T A;  1JZ7 A;  2VZS A;  2RMU 2;  3RYR A;  4S2G A;  2AH2 A;  1JMU B;  4JCK A;  2Q1F A;  4HK9 A;  2WZE A;  3ZLI A;  4AW7 A;  4E2S A;  5BNQ A;  4EV0 A;  3WW3 A;  4HL0 A;  1RVF 1;  2OA2 A;  1LCL A;  3CBN A;  1I5Z A;  3CMG A;  1AJO A;  3RJR A;  3ZIW A;  1OPO A;  1H2L A;  3K51 A;  3VKL A;  4JRL A;  4H2A A;  5F3C A;  2RMU 1;  2TNF A;  2W68 A;  3FL7 A;  2HH9 A;  1FMD 1;  1MZ6 A;  2UY9 A;  1JHN A;  3VL9 A;  1QOT A;  4PLO A;  4HKO A;  4IV3 A;  4MGI E;  1XYO A;  4TTG A;  3PVN A;  4FPF A;  1AXY A;  2ZEX A;  2OKX A;  1OUS A;  3A0N A;  5G04 L;  4P14 A;  5IFP A;  1W0N A;  4LLF A;  1SPP B;  3VV1 A;  1ACC A;  3I2J A;  3N4M A;  1ZRF A;  3THC A;  3NNJ A;  1W8Z A;  1LHV A;  1TME 2;  3P6B A;  2DUO A;  4NRP A;  3ZFE B;  4B7E A;  2LM3 A;  3V0B A;  4NIG A;  4YGC A;  1JZ2 A;  2A73 B;  1SLA A;  3GF6 A;  2ZAH A;  3GYD A;  3ZYH A;  1YRZ A;  5K8S A;  1YIF A;  3MID A;  1W6N A;  2ES3 A;  2WIN B;  3KQR A;  3SQO A;  2VUA A;  1DGW A;  3BPS A;  3M3I A;  5GLT A;  1US3 A;  3E6D A;  3S5Q A;  5FYT A;  1AYN 1;  4BQ1 A;  3ZFF A;  1LHO A;  2XR4 A;  3LEK A;  1UAI A;  4DS0 A;  5CFC B;  3ACI A;  1XNB A;  1N3P A;  3OPZ A;  5FKC A;  3NJV A;  5JR2 A;  3G7D A;  3T2P A;  1KDK A;  5CKN A;  3IDC B;  1H6X A;  1F4H A;  4BQ5 A;  1XPW A;  4YLZ A;  5FFO C;  3VHR A;  2CNA A;  2ZGU A;  5A1L A;  4UW4 A;  1IQA A;  1OMI A;  4QQ2 A;  1OFN A;  1YI7 A;  2PFW A;  5J96 B;  1LHN A;  2WWS A;  3H7J A;  4GB3 3;  2EAA A;  5BY5 A;  2VQ0 A;  1S2E A;  1W3X A;  1CON A;  2Y6K A;  1UYY A;  1HN0 A;  2RS3 3;  2PN5 A;  4XAA A;  2BFU S;  1UIK A;  1PO2 3;  3ZYF A;  1OQD A;  3CHX A;  4UBG A;  1CJD A;  3LKJ A;  1WW7 A;  3I49 A;  1ULP A;  4PF5 A;  2D6L X;  2ETE A;  3OF1 A;  3WNP A;  1ENS A;  3VBR C;  1WCU A;  1TZO A;  2E7A A;  2WNV A;  3GBF A;  3RNS A;  2YGM A;  1UPI A;  3H3Z A;  4KWU A;  5D21 A;  2P1B A;  1W28 A;  3FFQ A;  4OUM A;  2BVB A;  3O14 A;  2AEN A;  1QDC A;  4PIZ A;  5LAS A;  1MQT B;  1ST8 A;  4JHT A;  4QPI C;  1W0O A;  4EN8 B;  1GLH A;  1QJZ A;  2JDM A;  2Q1Z B;  4K40 A;  2ZX3 A;  2NP0 A;  3N7J A;  2HBT A;  4LHS A;  2TEP A;  1H2K A;  3FC0 A;  3OPW A;  1C28 A;  4JAA A;  4YVS B;  3OPT A;  4YW4 A;  4AFA A;  5JI9 A;  3MIH A;  3L9J T;  5LA0 A;  4BQ4 A;  3V65 A;  4PIX A;  1BXH A;  1W6P B;  1RUD 3;  2VBB A;  4ASL A;  4Y1X A;  3III A;  4LQR A;  1DZR A;  2VO5 A;  3LE0 A;  5FJK A;  1O8P A;  1BEV 2;  4XF9 A;  5E6H A;  3L2H A;  2X10 A;  5CKM A;  5AC9 3;  2XH6 A;  3VHN A;  3ZYG A;  1VAK A;  2YV8 A;  3AZX A;  5HXM A;  2QBX A;  3LDK A;  5IAT A;  2HWC 3;  1S0E A;  5L7O A;  1ZZ8 A;  1PO1 1;  3VZN A;  3E6C C;  2VZP A;  2ZAC A;  4M00 A;  1DLC A;  2A6W A;  1W8N A;  2J22 A;  4HKW A;  4QM8 A;  4RFT 0;  1S0J A;  2RDS A;  4PQQ A;  3UGG A;  2ADD A;  3FUO A;  4LBQ D;  4OZX A;  3H8O A;  1G7Y A;  2DBI A;  1CAV B;  2HWF 2;  2PA7 A;  5FOB B;  2ZZJ A;  3Q8E A;  3I3B A;  2W46 A;  2P37 A;  3TEW A;  3ZMO A;  5EHD A;  3ENR A;  4QX0 A;  1UZW A;  2LS6 A;  4U2A A;  5F5A A;  2CSG A;  5FK8 A;  3AK0 A;  4CP2 A;  2DDU A;  2ZAB A;  2K9Z A;  1UZY A;  3J7H A;  4LMF A;  4O9E A;  4XQW A;  5IWF A;  3WF4 A;  3ZDS A;  3WNK A;  3IPV B;  3LF7 A;  4OUS A;  4WVW A;  5FXX A;  2HWF 1;  1VRB A;  4D3W A;  4BQ3 A;  3N7M A;  2WZR 2;  1HN1 A;  5DUU A;  4JKM A;  3CJX A;  3RRD A;  3S5A A;  1W6M B;  1ULF A;  1HJF A;  4I3G A;  2N7G A;  1KDM A;  3VDD B;  3KVB A;  1V6J A;  2ARX A;  5LA2 A;  1QKQ A;  5I8S A;  3WD5 A;  4FOW A;  1XC6 A;  4L99 A;  1QOS A;  2XHK A;  4U36 A;  4DRR A;  2IXC A;  5F5C A;  2WZR 1;  2DTY A;  3AZY A;  5H9Q A;  5LEK A;  2GNT A;  1CJP A;  1N1V A;  4A3X A;  1LEC A;  4CRQ A;  2G9Z A;  1UIJ A;  2VQU A;  5FZ3 A;  4AFC A;  1ZRE A;  1X8E A;  3CF6 E;  2Y8K A;  1B35 C;  1W8T A;  1IS4 A;  2P17 A;  2HEW F;  2QNK A;  3ZIX A;  2LAL A;  4OCT A;  1W39 A;  5FLI A;  4DFS A;  4XVH A;  5KC5 A;  4FFG A;  4XF3 A;  5FY7 A;  5A3O A;  5JXH A;  3O1U A;  1NCQ B;  3HAG A;  1J1T A;  2CU5 A;  4C0H A;  3JQX A;  5F37 A;  4LHK A;  1DCS A;  1V9U 2;  1NCR A;  1UU5 A;  2RJ2 A;  2PHW A;  2PHU A;  3J9S A;  1Z7S 2;  4ZHN A;  5IVE A;  2Z69 A;  3LSE A;  2OZ6 A;  3VD5 A;  1B09 A;  1KD7 A;  2W87 A;  3BOP A;  2RR1 3;  4YW6 A;  1X9P A;  5A33 B;  1HB2 A;  3B01 A;  3FBM A;  3VBF C;  2ZX2 A;  3HMY A;  3GJB A;  4NAO A;  5I91 A;  3OD4 A;  3LEI A;  3MLK A;  3RI8 A;  4Q29 A;  5DG2 A;  5FY0 A;  1VJ2 A;  3J8F 2;  4E9K A;  1ULE A;  1OLR A;  1QJU 3;  4J25 A;  4JKL A;  3VZO A;  4D94 A;  1U5X A;  2XPJ A;  1DBN A;  2P3J A;  4AQ2 A;  1EPW A;  2CTV A;  2RS5 2;  3WIN E;  4NPL A;  1H1I A;  3DGT A;  4L0P A;  2VNG A;  2EAL A;  4LBJ A;  5LB6 A;  3U78 A;  1MS4 A;  3VDC A;  4M4R A;  3P5B A;  1DQ6 A;  3W5M A;  4HSJ A;  4Y1V A;  4CUA A;  1CAW A;  3J8F 1;  3GAL A;  4X6R B;  1Y3T A;  2ET7 A;  3TN9 3;  3VD4 A;  1OVP A;  4CCL A;  3O0X A;  1UKR A;  1ASJ 3;  1W05 A;  4PI2 A;  1AR9 3;  2RS5 1;  3VBO C;  3VD3 A;  4CCD A;  4YNI A;  3CNA A;  5FZC A;  1WW4 A;  3WG3 A;  1SBD A;  2BDR A;  2G9F A;  2VUC A;  2VTF A;  1XOY A;  3OY8 A;  2L9L A;  2W1W A;  4Y5Z 0;  1N47 A;  2XVG A;  2C9A A;  4GH4 A;  3UGH A;  1APN A;  1UX6 A;  3LEM A;  3RPQ A;  4XFB A;  2EAK A;  5K0U C;  5KC6 A;  2VMD A;  1VAM A;  3GZU C;  4CDU A;  3I97 A;  1ZBE 2;  4NHY A;  4B4R A;  2XOM A;  1NQD A;  2FBE A;  3RZG A;  5SV8 A;  1ODM A;  3ZO0 B;  4NHX A;  1RUG 3;  1S0B A;  3RZJ A;  5FCC A;  1POQ A;  3POY A;  2TBV A;  4MYE A;  5ACA 3;  2XJP A;  4UI9 L;  3AYC A;  1M06 G;  4P00 B;  3ABZ A;  5C3Q A;  1KRI A;  1V6K A;  4N53 A;  1ZBE 1;  1C5H A;  2ILM A;  4YW7 A;  3H8X A;  1R08 2;  4W4Z A;  2YZ4 A;  2ZS6 B;  4J1W A;  3RZK A;  3OUJ A;  3U14 A;  1UD1 A;  3I59 B;  1DGL A;  4L9B A;  4QPG A;  2PTM A;  3IM0 A;  4CEY B;  3ZXJ A;  1ZNP A;  5A3T A;  3VB9 A;  3FUQ A;  1D4V B;  3B9I A;  1GP4 A;  1CX1 A;  4YZ5 A;  2O14 A;  1Q8S A;  1WLT A;  5KBF A;  1R08 1;  2WNU A;  4AAP A;  5BNP A;  4P02 B;  4R52 A;  5EJ1 B;  3I2K A;  4TSV A;  2BGO A;  3GGL A;  2NMN A;  4RQP A;  2J1U A;  3UK9 A;  3RZH A;  1JYT A;  3HNM A;  1PZ9 A;  5EFU A;  4AXO A;  1C8N A;  2RS3 1;  4CSW A;  3IIA A;  4FVV A;  2QVS B;  2GNM A;  1XXN A;  1S0I A;  2VME A;  5GLZ A;  5IVF A;  3ZN5 A;  4AI1 A;  2DF7 A;  3BIW E;  3IBM A;  2Q8E A;  4N43 A;  2TUN A;  4UYB A;  1W6Q A;  3T4H B;  1LOA A;  4IV3 B;  3VBH A;  2Y6L A;  5C4W C;  3WP6 A;  1DF0 A;  2OQ6 A;  2YFZ A;  3KCY A;  1AR7 3;  3VBU C;  4CDQ A;  5L19 A;  3NMB A;  2PEL A;  3UKT A;  2ZGO A;  1UZV A;  4DY5 A;  4MHU A;  3AMH A;  2ERF A;  1OI6 A;  3DXT A;  4WM7 C;  4Z2W A;  1H0B A;  4Q8K A;  1O3S A;  4UOJ A;  5A7Q A;  2PHX A;  3T4V A;  2JDH A;  3KS7 A;  4H7M A;  1R1A 2;  4P9J A;  4Y24 A;  5FXV A;  3R4U A;  4XFC A;  3V0B B;  1VMJ A;  1IPK A;  1W99 A;  4HG6 B;  4AEK A;  2WNE A;  4BZ4 A;  2ET1 A;  2CWM A;  4MGY E;  3V0A A;  1W6N B;  4XUR A;  5FY8 A;  1ND2 A;  2MEV 3;  2CL2 A;  1VP6 A;  2WR9 A;  3AX4 A;  4XFA A;  1AR8 2;  1D4M 2;  1RUJ 2;  2VMG A;  2ZOE B;  4Z82 A;  5FYH A;  3BAL A;  5CB7 A;  4AFD A;  5FPB A;  4CP9 A;  2IFR A;  1R1A 1;  4B4P A;  4EN6 B;  2D3R A;  2DYC A;  2RV9 A;  2UYA A;  4YSF A;  3G6J B;  1H6Y A;  1YQC A;  3M70 A;  3VKO A;  3WF1 A;  3DYO A;  1YC6 1;  4MSV A;  4Q4V 3;  4QB1 A;  5IK7 A;  1EV1 2;  4UW3 A;  4A7Y A;  1J1L A;  1RUI 2;  2QZ3 A;  3BU7 A;  4QD2 A;  1AR8 1;  1D4M 1;  1RUJ 1;  2QTW B;  2JIC A;  3DEM A;  3DXU A;  3JQW A;  4I09 A;  1LOE A;  2J1V A;  1UL9 A;  3OBZ A;  4ZON A;  3RZL A;  1LUL A;  3ZSM A;  1REE A;  4OMD A;  4URT A;  4YRD A;  4RS5 C;  4I01 A;  1GBG A;  4IEX A;  4NIA A;  3WUC A;  2XDV A;  5K4L A;  3HIF A;  1EV1 1;  1HDK A;  4I0A A;  4RHV 2;  5DDJ 2;  4C1W A;  1K5M C;  1RUI 1;  1MEC 2;  2WQ8 A;  2O8O A;  1RUN A;  4LKS A;  1T6B X;  1W6O B;  1K5J A;  2RM2 3;  3M3C A;  1GNZ A;  2VCA A;  2WN3 A;  1H1M A;  2YHJ A;  3AMN A;  5FYS A;  3T30 A;  3INA A;  5FXW A;  2FHR A;  4AR2 A;  3K3N A;  3MUZ 1;  5DDJ 1;  1IG0 A;  3SEP A;  2VM9 A;  1MEC 1;  2BWA A;  3J7M A;  3K4Z A;  4Q4W 3;  3VGI A;  2H6B A;  3OGS A;  4AED A;  1O4T A;  2E31 A;  3FLT A;  3NJX A;  4QQH A;  3PU8 A;  4DPN A;  5JXI A;  5T54 A;  3UL2 A;  1VRH 2;  2JWP A;  4UFI A;  1OBN A;  2ZHK A;  4W50 A;  3MUY 1;  1PNG A;  3HJR A;  4KMQ A;  2VCM A;  5CG9 A;  2BUK A;  4I02 A;  2X53 S;  2P3I A;  4H14 A;  2W39 A;  2QQK A;  2VMI A;  1QXR A;  4UF0 A;  3O0V A;  5C6C A;  4NAM A;  1JS9 A;  3I2H A;  3FHQ A;  1FPN 3;  1VRH 1;  2VQT A;  3S7I A;  4BXF A;  4AQT A;  4AQ6 A;  3AZZ A;  5K7P A;  3O1S A;  1HJG A;  2C26 A;  2DVG A;  1V6L A;  3WNL A;  4FPH A;  1S0G A;  3WNO A;  3GJA A;  3BTX A;  3N9M A;  4FPL A;  2IXK A;  2X09 A;  4G3Y C;  4IV1 A;  5D8A A;  4CE8 A;  2ZAA A;  1C8M 3;  1FNZ A;  2R32 A;  1JI6 A;  1QDO A;  1PK6 A;  2AGS A;  4TZD A;  3CO2 A;  2ZEW A;  1W04 A;  5HCB A;  3RWN A;  3ZYI B;  2QQP A;  4YM1 A;  1OFS A;  3T2Q A;  3UGF A;  1W2T A;  4IER A;  5CU1 A;  4GIQ A;  1K45 A;  3WNX A;  1DP0 A;  2IWG B;  2WS9 2;  4QQL A;  2RS1 3;  4BDV B;  3UES A;  5JCT A;  3ZFE C;  5JI7 A;  4Y26 A;  5DZE A;  1GSL A;  2H0V A;  2J1S A;  1UO9 A;  2P3Y A;  3LIH A;  3TN9 1;  1ASJ 1;  4P9W A;  2R1D A;  4K8F A;  4Y22 B;  1ZZ7 A;  2GN3 A;  3FJS A;  4WBB A;  3TRS B;  3PU3 A;  2WS9 1;  3O1O A;  2BTV C;  4NID A;  4GMP 0;  4A4A A;  5CFC C;  2OUH A;  4LLO A;  5I0S A;  4COU A;  5FP3 A;  4C8D A;  4LIT A;  5FJH A;  1N1S A;  1AYM 2;  4HOO A;  4KGG A;  4LKF A;  5HPO A;  1XE0 A;  5AVP A;  1SLB A;  5A7W A;  1OD5 A;  5GLW A;  3PL0 A;  3H1W A;  3RFR A;  1MZE A;  4GUL A;  3IZO A;  5AFE A;  5BNO C;  4PIY A;  1GZW A;  5FZO A;  5E89 A;  1QJY 2;  4FPY A;  4QGM A;  4OHY A;  4AI2 A;  4IEY A;  1F31 A;  3OYW A;  1F5F A;  1AYM 1;  1QU0 A;  1QY4 A;  3M4F A;  4HAN A;  3AP4 A;  4QX1 A;  5T55 A;  1W2N A;  2XJV A;  2IC1 A;  1NCR B;  1PX4 A;  1XNK A;  2VXJ A;  2VOK A;  1QJX 3;  2WSV A;  2XWB B;  1K3I A;  4BU2 A;  4DIQ A;  5A3M A;  4CDW B;  3VD9 A;  2PQQ A;  2D6K A;  2JG9 A;  2VGD A;  4BE3 A;  3HQR A;  2YXS A;  3WXP A;  1VBA 2;  4IEV A;  3U1X A;  4CZS A;  1ZA4 A;  1WA4 A;  3FN9 A;  4XFG A;  1GP5 A;  4DXS A;  3RMX A;  2GAU A;  4Q5O A;  1XSR A;  4YW5 A;  5FQ0 A;  5HI0 A;  4JTO A;  3KV9 A;  3DYM A;  2A75 A;  1CAU A;  3MW4 A;  1VBA 1;  4J1X A;  4JKK A;  3ZYJ B;  5CBL A;  3SKJ E;  1R1Z A;  1S2K A;  1RUF 2;  1MQT C;  2A71 A;  2P6H A;  3RI9 A;  2RJK A;  1H4G A;  4HKL A;  1CZV A;  2KA3 A;  1QH6 A;  2Y38 A;  4XJW A;  2YGL A;  2QQN A;  5FPV A;  1ALY A;  1HRV 3;  4AHX A;  5JWP A;  5C5U A;  4G4F A;  5FLJ A;  3I2D A;  4OI1 A;  1GOF A;  1TMF 3;  4E4S A;  3AB0 A;  3IDB B;  4XC9 A;  1IQD C;  3AZW A;  5DAX A;  2VZR A;  5KXE A;  2PYT A;  1RIN A;  3B5L B;  2IVI B;  1BZW A;  3PUQ A;  4GMP 1;  3ZSL A;  4CDU B;  4D7S A;  5FMO S;  1U12 A;  3U4X A;  1WD3 A;  1WMD A;  2BW8 A;  1H2M A;  5A3N A;  3JBG 3;  4OQ8 A;  2J1T A;  1YUD A;  2BJS A;  2DVF A;  3SLI A;  3J4U H;  4HPK B;  5FZK A;  3JU9 A;  4EWA A;  3MLJ A;  2ZA9 A;  2A5Z A;  1BBT 2;  1URX A;  3S57 A;  1PMH X;  1G6N A;  1DG6 A;  2D3S A;  1AJK A;  1ONA A;  2R0F A;  3PIJ A;  4M3C E;  5FUN A;  3VN4 A;  5IAX A;  1W3V A;  3HBK A;  1LED A;  4QGN A;  4UW5 A;  5C9A A;  2VMF A;  3VKF C;  2IXI A;  2BP6 A;  1A8D A;  3H1M A;  2W92 A;  3TYJ A;  1EUT A;  3B00 A;  1F2N A;  5BNN A;  2YB7 A;  3ATG A;  2NPI A;  3QOP A;  2WNU B;  5BNP B;  3NAP B;  3NV4 A;  5C4W B;  4KG8 A;  2UWA A;  4XF1 A;  1VBD 2;  4RQP B;  3VDD C;  2J1R A;  4LBQ A;  1IPS A;  4A41 A;  2HBU A;  4BK4 A;  5FMO L;  1HV0 A;  1IS6 A;  1EAH 3;  2GC3 A;  4M0N A;  2Q8C A;  2D43 A;  4LIU A;  4GZ9 A;  1HB4 A;  1EY2 A;  1IOA A;  3KQ4 B;  4Y1Y A;  4N43 B;  3A21 A;  3VBH B;  1WD4 A;  2QZ2 A;  1Q8Q A;  1VBD 1;  5LBE A;  3MIB A;  4AWD A;  4E2G A;  1VAL A;  4EZ4 A;  1WUV A;  4XJA A;  4Z1V A;  1RHI 3;  2VY0 A;  3E5U A;  1VAV A;  2XUE A;  5LZ6 A;  4KBZ A;  5JMC A;  4N8M A;  4Q4W 1;  2ZEY A;  3Q8C A;  5FYZ A;  5FPA A;  1NCQ C;  2VMC A;  2Z2S B;  1AR6 2;  2OX0 A;  3KSC A;  2PLV 3;  1XU1 A;  1TE1 B;  2WZ8 A;  1LES A;  2ZGM A;  2WFP A;  3NNL A;  1NA1 B;  2VZO A;  3JUU A;  1DIW A;  3LFM A;  2JKX A;  1XND A;  3MEP A;  4M3C B;  1AR6 1;  1EYB A;  4QDR A;  5C5T A;  4DIN B;  4A2U A;  4FPC A;  2YPJ A;  3O1V A;  1I3H A;  1JW6 A;  1OVS A;  2WO3 A;  1BHG A;  1FPN 1;  2XJU A;  3ALQ A;  4XBL A;  5C3P A;  3B02 A;  1AL2 3;  1AX0 A;  2PAM A;  5T5L A;  4QXB A;  1UY1 A;  2D5H A;  4JX0 A;  5T5O A;  4E2Q A;  4RS5 B;  1A78 A;  5D2A A;  2JEC A;  4XAE A;  2VTX A;  5JIA A;  3USS A;  5BXX A;  4IEU A;  1VBC 2;  4ONU A;  2ZHL A;  3K4D A;  4BHP A;  4HXC A;  3K75 B;  4M01 A;  3RZM A;  4MGQ A;  1OOP A;  3C7F A;  3ZR5 A;  1XRU A;  2CHH A;  3IMN A;  3SIS A;  5IVC A;  1V0A A;  4GD4 A;  2CAU A;  3HT1 A;  4D7T A;  5ABJ A;  2W0X A;  1VBC 1;  4CU6 A;  3I2I A;  1W8H A;  5I0T A;  1G8W A;  1YYN A;  4MZU A;  1W9T A;  2VVE A;  4YVW A;  4BQX A;  3H8R A;  5ABJ B;  5FYM A;  2RS1 1;  5IT6 A;  3SXW A;  1E57 A;  4AVT A;  3PVB B;  3UJQ A;  2Q8D A;  3NQH A;  1RUO A;  1CPM A;  2ZX0 A;  3AVR A;  3B69 A;  4H55 A;  3VBS B;  3ZSE A;  1SCR A;  5L36 A;  3H50 A;  3VD7 A;  4F7Z A;  1UOF A;  2XJQ A;  3T1L A;  5C3O A;  4PQ9 A;  4XUO A;  1H30 A;  3LQC A;  4OQ9 A;  4AFM A;  5GZF A;  3WDW A;  4DO0 A;  3AKP A;  1FNY A;  3HN1 A;  3P3P A;  3U37 A;  1BMV 2;  4YG3 A;  3ZVX A;  3C7G A;  1TQ5 A;  2GSY A;  2O0O A;  5FZ8 A;  4QKD A;  4YFW A;  4XMI A;  1I6X A;  1WLW A;  2R07 2;  1O3R A;  2ZGK A;  2JE8 A;  1CAX A;  5KWR A;  2XL9 A;  1FMD 2;  3K2O A;  3ZXK A;  5JXG A;  2FCT A;  3I4I A;  4LK7 A;  4CU7 A;  3LFI A;  1RB8 G;  1O4Y A;  4CEY C;  1BMV 1;  1XNT A;  2OQ7 A;  3WW1 A;  3WNN A;  5DMY A;  3O12 A;  2R07 1;  3S7E A;  4LBL A;  4UF0 B;  1Z0H A;  4BIO A;  4EYU A;  5FOJ B;  5DAB A;  2J1E A;  1M4W A;  1UMH A;  1YQ8 A;  2VU9 A;  4O7X A;  4W6W A;  1X9T A;  3UV9 A;  1STM A;  1UXX X;  2W52 A;  4FAG A;  4OHV A;  1QJX 1;  5C3R A;  1OLM A;  1AVB A;  1MS9 A;  4CA9 A;  1SCS A;  1SBE A;  3ZYP A;  1WKY A;  4BQY A;  4MGS A;  1GWL A;  4I0W B;  2YBS A;  5J3U A;  3SH5 A;  3H0O A;  1Z7S 3;  2WN2 A;  3EB7 A;  3Q8B A;  1G9C A;  1UCX A;  1T6G C;  1IG3 A;  4MX3 A;  1AYN 2;  1YFY A;  4D69 A;  1PZ8 A;  3D6E A;  4IV3 C;  2VVD A;  5LBF A;  1ULO A;  3OGV A;  1JYW A;  2LW8 A;  5DPN A;  3VZL A;  1UY2 A;  3C3V A;  5BYN A;  2XJR A;  1VPH A;  1D0G A;  4LJH A;  2RJL A;  3W59 A;  3ZXG A;  1VBE 2;  2GP5 A;  4P5Y A;  1LRH A;  2C5D A;  2BBV A;  4UWD A;  3JZV A;  2YRO A;  5FZ1 A;  2VOW A;  3DUI A;  1JZ5 A;  4D6Q A;  2BPA 2;  4NMI A;  5KHJ A;  1DU3 D;  2B7Y A;  1VBB 2;  1RUC 2;  1W9W A;  3AP9 A;  3WZ1 A;  1HRV 1;  1ULG A;  1VBE 1;  3AMP A;  3B3Q E;  3ON7 A;  4KG0 A;  2NLR A;  3MF6 A;  1UYP A;  1CPN A;  4JGZ B;  4Q26 A;  4RGG A;  4ZZ5 A;  4AVB A;  5BNO B;  5J09 A;  3ZXA C;  4CU9 A;  2ZEZ A;  2QQM A;  2Z79 A;  4K9S A;  1A3K A;  3DKQ A;  4MUV A;  2BWC A;  1RUE 2;  2JIJ A;  5LRR A;  1VBB 1;  3GHN A;  4PF1 A;  2JB4 A;  1E5I A;  1DGR N;  4XF4 A;  1RUC 1;  1G9B A;  5JOZ A;  2PHD A;  1PIV 2;  3K3O A;  2YUE A;  3FLR A;  1CN1 A;  3K48 A;  3POJ A;  1CD3 G;  2I45 A;  4HSL A;  5EJ3 A;  3RZZ A;  4Q2F A;  2WSU A;  3VZJ A;  3U11 A;  1KJR A;  4B7K A;  5HCF A;  5FZO B;  2VOX A;  2PHT A;  3SNM A;  2EXH A;  1RUE 1;  3BTA A;  1RC6 A;  3KF5 A;  2ORX A;  3OYW B;  5FY4 A;  2V5D A;  3NWK A;  3ECQ A;  4FBF A;  4NN0 A;  2QQL A;  4YG0 A;  4AFB A;  1PIV 1;  2FDF A;  4SLI A;  4O65 A;  1ZBA 3;  3ZOI A;  2HEV F;  1WCK A;  4CP1 A;  4KBB A;  2WL1 A;  4HBN A;  4NHM A;  4AEJ A;  2VOV A;  3N9O A;  1GR3 A;  2ZKL A;  4CVU A;  2A1X A;  5FZE A;  2W94 A;  2JG9 B;  4I3P A;  4NHL A;  1VIW B;  5T52 A;  5BUV A;  2V5Y A;  5L9R A;  4CU8 A;  4F83 A;  3B93 A;  3BTY A;  2XKO A;  3R4S A;  2AEZ A;  3W9A A;  3RJ2 X;  3EMR A;  2WNV C;  3W21 A;  1W90 A;  1QQP 2;  5J98 B;  1US2 A;  4YZ3 A;  2O8Q A;  4FAH A;  3KF3 A;  5FQ0 B;  2JG8 A;  2BGP A;  3N9N A;  1MVQ A;  3O1P A;  1PO1 2;  1A34 A;  4B29 A;  1NX9 A;  2E33 A;  2WO2 A;  4QPI A;  3FE5 A;  2VCB A;  4XAC A;  1JYX A;  2VNV A;  4OHZ A;  1JYN A;  1QQP 1;  3M3Q A;  3SIT A;  2XQR A;  3H42 B;  1WCD J;  1N3O A;  4BJ0 A;  3I2O A;  1F5J A;  5IK4 A;  3MIF A;  4XMA A;  4DRV A;  4EE2 A;  2R06 3;  3QLQ A;  5CFD A;  2UUR A;  3V56 A;  3JD7 3;  1G9A A;  1NLR A;  5FMC A;  3HNY M;  1LR5 A;  3APB A;  1EP0 A;  3CJI A;  2XHN A;  1NOV A;  4P9I A;  4CDX A;  4BMB A;  2JDA A;  2E9Q A;  1LGC A;  2DCJ A;  4AEM A;  3C2U A;  5J48 A;  1HW5 A;  2P6C A;  3N9Q A;  3KV5 A;  1BYH A;  1ND3 A;  4KNC A;  3N7L A;  3ZR6 A;  4NO4 A;  1ULD A;  1JHJ A;  1AZD A;  2HWD 3;  1OA2 A;  4JZR A;  1Q8O A;  4AG4 A;  4AVC A;  1J83 A;  4PDW A;  4IGP A;  2VNO A;  4Q1R A;  1D0H A;  4A45 A;  1JZ3 A;  2X8K A;  4TYS A;  4IEW A;  3ZXD A;  1ZRD A;  1LOF C;  1NE4 A;  3A0K A;  4ZY9 A;  2JX9 A;  4XIO A;  4LO5 B;  2GH2 A;  4E8C A;  5IVV A;  3FMG A;  1LOD A;  4EWD A;  1ZVF A;  2VPV A;  4QXC A;  3VKM A;  4Q4Y 3;  5SV5 A;  3NNF A;  2D7F A;  2WFF 2;  5TSW A;  1PZ7 A;  2E32 A;  3A7Q A;  3LD8 A;  2ATF A;  1W0P A;  2ENR A;  4UFH A;  2RE9 A;  2YYO A;  1LGB A;  4RN5 A;  3UJO A;  3UKN A;  4MHR A;  1F9K A;  5BNN B;  2DUP A;  4LA3 A;  3WDU A;  3I3Q A;  2WFF 1;  4IGO A;  4DUV A;  5KHG A;  2KD7 A;  4OLL A;  5FYC A;  3R6S A;  2QCS B;  1FOD 2;  2YU2 A;  4FPK A;  4HVQ A;  3VDA A;  1FV2 A;  3OB8 A;  3PVE A;  3RDI A;  5A80 A;  5C7G A;  1QH7 A;  4HET A;  4XUP A;  5FWE A;  1QMJ A;  4GWJ A;  3FX3 A;  1IS5 A;  2NM1 A;  4COV A;  1MZ5 A;  1O4Z A;  2DBN A;  2JB8 A;  4P9L A;  1FOD 1;  2WKK A;  2R6Q A;  4QDS A;  2BBA A;  4ET7 A;  4L2N A;  3NJY A;  4XUQ A;  1POV 3;  1NCR C;  1ULC A;  3TWI A;  4D0Q A;  1C5I A;  3N9L A;  1J3R A;  4CDW C;  1GAN A;  3RG0 A;  1O3T A;  3T09 A;  3BOD A;  3VBF A;  2CYF A;  3RVH A;  4WM8 A;  1UKG A;  3U0Z A;  4XF0 A;  1SQ4 A;  4ZU5 A;  1OXC A;  4YFZ A;  3ZFG A;  2R30 A;  1YHF A;  3JB4 C;  5C8C A;  5C8W A;  4EJR A;  4MGK E;  4TXW A;  2WWU A;  4QWN A;  1PNF A;  4ES9 A;  2WO1 A;  3RQ0 A;  1WME A;  1C57 A;  1YCI A;  2WWJ A;  1YJL A;  2VUL A;  5FZ9 A;  2GMP A;  1JH5 A;  5JOW A;  4I2O A;  1LNS A;  4IGQ A;  5FYB A;  4GJZ A;  1NQJ A;  4COW A;  1UNB A;  4MAD A;  5FLH A;  2VW1 A;  3SH3 A;  4ZS2 A;  3BIE A;  3FZ3 A;  1XNC A;  4NII A;  1NXD 1;  4CCN A;  5IUQ A;  1OOP B;  3H8U A;  1R09 3;  1DGW X;  4LO6 B;  3S0M A;  4M0H A;  3KWV A;  2VJX A;  4YYO A;  1KGY A;  1HQL A;  2GMM A;  2HWB 3;  4P9X A;  2Y6J A;  2EIG A;  3BTZ A;  1GWM A;  5K0U A;  4YVW B;  3T08 A;  2C1F A;  5JDB A;  3SCF A;  3IN9 A;  3K4A A;  5JOX A;  2W95 A;  1RJ7 A;  2XBO 3;  2A6Z A;  2WT1 A;  4CDU C;  4OYU A;  2DWR A;  4CP0 A;  2FZ2 A;  4GAL A;  3P1I A;  2VR4 A;  3DPR B;  3KT4 A;  1XYP A;  2B46 X;  2R0H A;  1LB2 A;  3LZZ A;  1RGS A;  2F4P A;  3CKH A;  3E5X A;  4PT6 A;  4QX3 A;  4HON A;  4P08 A;  4XDO A;  3UKV A;  2P4E A;  3ZX7 A;  2R04 3;  3MYX A;  3PDQ A;  4B4Q A;  2RS3 2;  1DYP A;  3KCC A;  4GQ7 A;  3B9C A;  1PO2 2;  1GKB A;  1HRI 3;  2IZW A;  2V73 A;  4OZO A;  4UFK A;  1J3P A;  1CAX B;  2E7Q A;  1ZRI A;  3ZN4 A;  1DDL A;  1ENQ A;  3MI8 A;  2WLP A;  1IGO A;  4L92 A;  4GB3 1;  3SH4 A;  2YPD A;  3HBZ A;  1FAY A;  1PM4 A;  2JKB A;  3L2Y A;  4S2H A;  2ZTN A;  5FO7 B;  1QJE A;  4GXL A;  4RR3 A;  1YFU A;  1GNH A;  4AHW A;  1PO2 1;  4LEJ A;  5IVB A;  5KHK A;  2OS2 A;  3O0W A;  3VL8 A;  1LJ7 A;  5FZL A;  3MLL A;  4IXL A;  3BUC A;  4IE6 A;  1EUU A;  2GC0 A;  2VW0 A;  1QJY 3;  2WNU C;  3KV6 A;  3NAP C;  3WF0 A;  1CZS A;  5BNP C;  5FPX A;  3CZU A;  4IW3 A;  4RQP C;  2FCU A;  1S2B A;  2JE7 A;  3TB0 A;  2BQP A;  5J7M A;  2BEO A;  1ODN A;  1U5Z A;  1CWP A;  3MV0 1;  4IE0 A;  3DN7 A;  3POW A;  4LPL A;  2WDB A;  4RSU A;  2VBP A;  1RUD 2;  4N43 C;  1QHD A;  1FYU A;  2W47 A;  1YJK A;  3MDP A;  3UET A;  4PLN A;  3VBH C;  5LA1 A;  4XHX A;  3AKQ A;  4MV2 A;  1N3Q A;  5FP7 A;  3VBU A;  2XUM A;  2XWJ B;  3DV8 A;  4OI4 A;  2A6Y A;  4IL7 A;  5AC9 2;  4XIL A;  4CDQ C;  2VBD A;  5FUI A;  1WBF A;  1WCQ A;  1C1F A;  2NQY A;  5EQU A;  1ZRC A;  2HWC 2;  2HWE 3;  4CEW A;  2D6P A;  3LA2 A;  3IAQ A;  1OA4 A;  4Q27 A;  1RUD 1;  4QX2 A;  2VQA A;  2VUJ A;  4XBN A;  4BLJ A;  2VZT A;  5JZG A;  3FBY A;  4FPE A;  1NA1 C;  3J7L A;  2JDY A;  5AC9 1;  2BV4 A;  1DFQ A;  1CIY A;  2O1Q A;  5FZM A;  4XDP A;  1GQP A;  2BER A;  5FZ6 A;  2HWC 1;  1POV 0;  1U5I A;  5C33 A;  3JD7 1;  4YGB A;  1PVC 3;  2A3X A;  1QIQ A;  2YU1 A;  4IES A;  3OJB A;  1S1A A;  1JOB A;  4RYD A;  4Y20 A;  5DZF A;  3HR9 A;  3WQB A;  1MZF A;  3AMQ A;  3GHM A;  5DZG A;  3BKZ A;  3PVO A;  4NIH A;  3ETQ A;  3ZFF B;  3WF3 A;  2D6N A;  4SBV A;  4LR4 A;  4CCJ A;  4Q0U A;  3BOW A;  4FCA A;  4V1P A;  4YZ1 A;  2XG3 A;  4URA A;  3WW4 A;  4YM2 A;  3NJZ A;  4BCU A;  4AF9 A;  5IHR A;  5LA9 A;  2D93 A;  5JSR A;  2VZ1 A;  2ZGS A;  3AYD A;  3BGA A;  4GA9 A;  5F7U A;  1RL3 A;  4GKY A;  3URF A;  4IE7 A;  3ME2 A;  2QQV A;  5KHI A;  2QKD A;  2YC4 A;  4LIV A;  2WNV B;  1BLZ A;  2GN7 A;  2PQS A;  2QDR A;  1S0C A;  2UU8 A;  1JBC A;  5ABJ C;  3PUS A;  1KQR A;  3GCW A;  3KHC A;  2DU0 A;  3WCS A;  5IK5 A;  1MR5 A;  1QXJ A;  5DUV A;  5F6L B;  1ENX A;  1JU3 A;  1TEI A;  1WLD A;  3VBS C;  4KWJ A;  4Q4X 3;  4P9Y A;  2W08 A;  1COV 3;  1H9P A;  2G4I A;  2VW2 A;  2V4V A;  5FZ0 A;  1HXS 3;  1W9Y A;  4DNY A;  4LOS A;  4DMI A;  3VZM A;  1VLN A;  1W8F A;  5J37 A;  4MXW A;  2V4A A;  5FPL A;  2EXK A;  4KL1 A;  3CZJ A;  5A32 A;  3ZKY A;  1D2S A;  1CES A;  4HZF A;  4Q0Q A;  2R49 A;  4AED C;  2RR1 2;  2EXI A;  2X05 A;  3WG1 A;  5EWS A;  3D0S A;  4OUL A;  4RFR B;  4W6X A;  1PGS A;  4A7K A;  2P2K A;  2H6C A;  4LTA A;  4LOT A;  1HB1 A;  1QJU 2;  5ERL A;  3W5N A;  4GWN A;  3WQ0 A;  5L7O B;  4ARY A;  2RR1 1;  3DCQ A;  2Q8O A;  1POV 1;  2D6M A;  1RXF A;  3CJI B;  3PLQ A;  4PHZ A;  4QHZ A;  3RSJ A;  4BK5 A;  4CDX B;  1ZZ9 A;  3PHM A;  1NLS A;  2VZV A;  5E8A A;  3EXU A;  3IB3 A;  3TN9 2;  1QJU 1;  2QQW A;  2EIC A;  3OTF A;  1ND3 B;  4GWM A;  4QT6 A;  1ASJ 2;  3AKS A;  5EP9 A;  2I2S A;  4MET A;  3LGR A;  4C0B A;  1AR9 2;  1ZM1 A;  2XLF A;  5D8A C;  4YZ2 A;  1OKO A;  4PDW B;  1RXG A;  1DQ0 A;  5EV7 A;  4FTB A;  2E51 A;  1KS4 A;  3NV3 A;  1O5L A;  4RGK A;  1HKD A;  4AHZ A;  5JXJ A;  1O6U A;  3BPZ A;  1E5S A;  2VZ3 A;  3IDE A;  5K9Y A;  4FPO B;  3RGB A;  4JVA A;  1AR9 1;  3THD A;  5A7P A;  4FT8 A;  5FYU A;  4JGY A;  4WVZ A;  4AK3 A;  3ZFE A;  5GLV A;  4L11 A;  4QX8 A;  1IKP A;  3ZSK A;  5FKB A;  4DZG A;  2WUH A;  1WGP A;  3HEI A;  4OUE A;  4XE9 A;  3ZSJ A;  1OA3 A;  2F6B A;  2PAE A;  3UYJ A;  3DKW A;  3F95 A;  5FTT C;  3ZPY A;  2FDI A;  4LE4 A;  5FXZ A;  5FV3 A;  5LCW L;  4JGZ C;  1JUH A;  2FDJ A;  2HWB 1;  4FOY A;  5CFC A;  1H1A A;  4OMC A;  3N7K A;  2ZCW A;  2FDG A;  2EVX A;  1J3Q A;  1SZB A;  1RUG 1;  4YWA A;  2HYX A;  5ACA 1;  4FFI A;  3GXU A;  4MG2 A;  3OUI A;  2DFB A;  3X29 B;  4IEQ A;  3T0B A;  1OUX A;  3TOJ A;  3BI3 A;  2XLA A;  4XQ4 A;  1CIW A;  4LUM A;  5A3U A;  1RMU 3;  4NRO A;  5FZF A;  4AVA A;  4RGA A;  4W65 A;  1RVF 3;  1H8T A;  3CQO A;  5FP8 A;  1CZT A;  1RUH 3;  2KXL A;  1XSQ A;  4BQW A;  2ARB A;  1EPZ A;  3ILF A;  2RMU 3;  1NZC A;  2B4K A;  4XPV A;  4NRM A;  3SEE A;  5FK7 A;  3A4U A;  3GBG A;  5EJZ B;  1H4H A;  1SAC A;  2JD4 A;  4WM8 B;  2JG9 C;  5FMD A;  1AR7 2;  4H7L A;  4QQO A;  1Y7B A;  1GFF 2;  3NV1 A;  4IEO A;  1OQE A;  4Y5T A;  3ZFG B;  4AVV A;  2C9K A;  5CYY A;  1XJA A;  2PAK A;  1JTZ X;  5C8C B;  1W2A X;  2DV9 A;  5DAW A;  1CAW B;  1UMI A;  2VTX J;  3ACG A;  3EHK A;  3WCR A;  4HMZ A;  2DCT A;  4DEQ A;  3LOB A;  3ACL A;  4LO7 A;  1LU1 A;  3FWE A;  1DZT A;  5F2S A;  5T5J A;  4BA6 A;  5LY1 A;  1AR7 1;  3PUR A;  4P5H A;  3ZDV A;  1GYK A;  2BGC A;  1MQT A;  3AJY A;  1F4A A;  1OT5 A;  4PBO A;  4PBP A;  4FI9 A;  4EZH A;  1K12 A;  3O5S A;  3FLP A;  3T1M A;  4ZKT B;  4WZC A;  4YVS A;  2MEV 2;  1WZX A;  2JDN A;  2WAA A;  3OY8 B;  5F5I A;  2XLG A;  4CCO A;  3S6P A;  2ZZQ A;  3JB8 A;  4GH4 B;  4QX5 A;  1MVE A;  4XZU G;  4XUN A;  3LPG A;  5DG1 A;  1W6P A;  2YC0 A;  2BVV A;  1WW5 A;  1OHF A;  1KS5 A;  2GP3 A;  4AI0 A;  2B9V A;  4OHW A;  1TME 3;  2XL7 A;  2WYF A;  2HWE 1;  4QPW A;  4O61 A;  4Q4V 2;  1WLC A;  1T2X A;  3POI A;  3WDY A;  3MIE A;  2MEV 1;  4HVO A;  3KHB A;  2WJS A;  4QGL A;  3WP3 A;  3FHA A;  1UYZ A;  3AP5 A;  5LK7 B;  3NVC A;  5DUX A;  4N53 B;  5I8Y A;  4NPR A;  2FDH A;  4HT1 T;  3POS A;  2XKP A;  3HD8 B;  4Q4V 1;  4IEZ A;  4XOG A;  4NHK A;  3I8T A;  4AGR A;  4QPG B;  4CTE A;  3HQX A;  2BNM A;  4LBK A;  3IDA A;  2RM2 2;  4CCK A;  3THP A;  1KEX A;  3IMM A;  2ZHN A;  4IQP A;  2ZGP A;  2OYZ A;  3SKV A;  3DEC A;  2FCV A;  3POG A;  5A6Q A;  1F35 A;  2EIB A;  2FZ1 A;  2W91 A;  2W9X A;  3B7M A;  2Q5T A;  3IPV A;  2A7A A;  3WNM A;  4EN9 B;  5C9A C;  1W6M A;  4RR3 B;  4Q4W 2;  5FZ7 A;  2RM2 1;  4XW3 A;  1UF2 C;  1VMH A;  2ORZ A;  3OGR A;  4ASM B;  4M4P A;  4MVT A;  5GJ6 A;  5IVJ A;  5BNN C;  4XUT A;  1HQN A;  2C4X A;  3OG2 A;  3VDD A;  3LSD A;  1W6Q B;  3OGG A;  2F4L A;  4L8Q A;  2FDK A;  4QB2 A;  3VHP A;  2ARC A;  2G9G A;  3IAP A;  4LUK A;  4CDQ B;  2Y0O A;  4AI8 A;  3W58 A;  4UAP A;  5FZH A;  3OD0 A;  1H2N A;  2UWB A;  4F3J A;  2IFW A;  1GZ9 A;  4E4H A;  2D6O X;  3EQE A;  4EN0 A;  2B9U A;  1MS5 A;  1FPN 2;  1S55 A;  2Y60 A;  4XFH A;  1YQ5 A;  1JZ6 A;  1SFP A;  2WLQ A;  3WQ7 A;  1RYY A;  1NCQ A;  3H3L A;  4EQV A;  4LBO A;  3LIG A;  1I1E A;  3V0A B;  3D8C A;  1ND2 B;  4NOT A;  1MPX A;  1F8V A;  2Q1M A;  1C8M 2;  2H0B A;  3E1F 1;  3MFA A;  2UY8 A;  3WF2 A;  4CP9 B;  5JZG B;  5A33 A;  3CDZ B;  5F8P A;  1BJQ A;  2VXR A;  3MIG A;  4BH9 A;  4QDQ A;  4A6O A;  1BEV 3;  3LCP A;  3NL1 A;  2B8M A;  5JIU A;  4D6S A;  1BVV A;  1TVG A;  1W2O A;  1PM7 A;  1C8M 1;  4Y20 B;  3KVA A;  1DYO A;  3QH7 A;  2RS1 2;  4FO9 A;  4NVP A;  1VB4 A;  5FP4 A;  1IKQ A;  4ISR A;  4Y33 A;  3VHO A;  3KD4 A;  2JDU A;  4IDZ A;  4K6B A;  1IHM A;  5IAV A;  3NST A;  1WMX A;  3WUD A;  3H3U A;  5LBB A;  1IS3 A;  3BCW A;  2HWF 3;  5C3S A;  4LOR A;  2QDN A;  1R64 A;  1WA6 X;  5BPX A;  3EJK A;  2GDF A;  2FQP A;  3ILN A;  5GM0 A;  4R8H A;  4XBQ A;  1OOP C;  5F9T A;  4LE3 A;  2X5I A;  4UFM A;  1GIC A;  2CWS A;  1W9S A;  1DQ2 A;  4G9S B;  3H9A A;  4AL9 A;  5CKQ A;  3POB A;  2ZXQ A;  4COZ A;  2EA7 A;  4DUW A;  2YBK A;  4QKN A;  5FDB A;  5DN2 A;  2WZR 3;  4HFS A;  4YVW C;  1SFY A;  4XXA A;  5DXD A;  1XBF A;  2D98 A;  3ACF A;  3USU A;  4FOQ A;  1BK1 A;  4FSJ A;  3KB5 A;  1UY0 A;  4ZXE A;  4AED B;  3DL3 A;  4YW3 A;  2WII B;  2GAL A;  3IKW A;  4FXK B;  3T2O A;  1GWK A;  3HPN A;  3O1T A;  1UOG A;  1Q5O A;  2QQI A;  3DPR C;  3KV4 A;  4UBH A;  5FZ4 A;  2UYB A;  1IPJ A;  4DY3 A;  1PGL 2;  3TNP B;  3EYP A;  3WW2 A;  1QJX 2;  4N90 A;  3GBW A;  1GU3 A;  1KIT A;  1PGW 2;  5A32 B;  2ZJC A;  3DYP A;  5A1F A;  3AYE A;  1UZ0 A;  3M7A A;  1C1L A;  1ZX5 A;  4S2D A;  1XQN A;  2KM2 A;  5A3P A;  1W06 A;  3KM5 A;  2QQO A;  3C7H A;  5LW9 A;  1PGL 1;  1W8U A;  1PGW 1;  1CVN A;  1V9U 3;  3KMH A;  2OT7 A;  4QXK A;  5E16 A;  1QXP A;  4FP2 A;  1RMU 1;  2ZX1 A;  4O9G A;  4IV1 B;  5D8A B;  2IXJ A;  2ADE A;  4BLI A;  1SMV A;  1Y9G A;  1RUH 1;  1D7P M;  1SHW B;  1QWR A;  2DCK A;  1N1T A;  4DOU A;  1PK6 B;  4IE5 A;  2AYH A;  1X36 A;  1S4C A;  5KR7 A;  5LRS A;  3D82 A;  3AKT A;  1SLT A;  4MH0 E;  4YGD A;  4JRA A;  4RA0 A;  5FZA A;  4NUB A;  1HRV 2;  3J8F 3;  2DCY A;  1YO8 A;  1GOG A;  3BB6 A;  3AYA A;  2EF6 A;  2A70 A;  5KXB A;  5DAP A;  4QU1 A;  1TMF 2;  5G05 L;  4BWO A;  2RS5 3;  1UYX A;  5FR3 A;  4H3W A;  4I0B A;  4B3N A;  3JCI A;  2VE1 A;  1GP6 A;  2GND A;  2WO7 A;  2XXZ A;  4GKX A;  4ITC A;  5A6X A;  1HQW A;  4KU7 A;  3LB9 A;  4AGG A;  3SC7 X;  4JGY B;  3AM2 A;  2NYY A;  1X8M A;  2ZML A;  3PNA A;  1TMF 1;  2VVF A;  2QFE A;  3JBG 2;  1Q8P A;  2WQ4 A;  4YPJ A;  5CIR A;  3WT3 A;  2DVD A;  1SLC A;  2WAO A;  4JTN A;  4ZU4 A;  2VL4 A;  1AUY A;  5LAT A;  1NG0 A;  1TNR A;  4XFF A;  5A7W B;  2JDP A;  2QQU A;  2W1S A;  1TME 1;  3H7Y A;  2G19 A;  2WA3 A;  3MF9 A;  3JBG 1;  4XET A;  1SBF A;  1GZW B;  1ZBE 3;  1QEX A;  1X7N A;  2CGO A;  4R9D A;  4JDN A;  5J36 A;  3ZFF C;  2OPW A;  3T0D A;  1O8S A;  4LBN A;  1V70 A;  1AX1 A;  5EXO A;  1XB9 A;  1ENR A;  3D0J A;  3OBA A;  1SDW A;  1UY4 A;  2P5B A;  4BQ2 A;  1UPS A;  4XJ9 A;  3M3E A;  1R08 3;  5F32 A;  1AF9 A;  5FZB A;  5B4X A;  3WQ1 A;  1H8T B;  3VBR A;  4BPZ A;  4BYY A;  1QF3 A;  2JJ6 A;  1EAH 2;  3HWJ A;  3MW3 A;  1L7Q A;  2D44 A;  4XJ8 A;  4AQS A;  1W6O A;  2DCZ A;  4Q1P A;  4R9C A;  1W8W A;  3IWZ A;  5FZG A;  5T5P A;  1L7R A;  3LA7 A;  2P34 A;  2WQZ C;  3D4K A;  1SDD B;  5JUV A;  2XVL A;  4D8M A;  1X50 A;  1RHI 2;  4P9G A;  3C7O A;  1W8O A;  1CAU B;  2D5F A;  3JXS A;  1EAH 1;  3SHR A;  2KR2 A;  3AZV A;  3ITQ A;  4HN1 A;  2PLV 2;  1OLQ A;  3ORJ A;  1L3J A;  3BVC A;  4J6G A;  5A6Z A;  1YI9 A;  2AAC A;  2K46 A;  1OUR A;  1Z78 A;  2JG8 C;  4XDQ A;  4LO4 B;  5FIX A;  2IXH A;  1RHI 1;  2LRO A;  4Q0V A;  2VD7 A;  3AP6 A;  3AFG A;  4QKF A;  5A70 A;  1E5R A;  2VNR A;  2VOT A;  3OEB A;  2PLV 1;  2XON A;  3ZKU A;  4DQA A;  4LNV A;  3HOB A;  3TEY A;  1CGP A;  1BK0 A;  2CDP A;  1CX4 A;  5F3I A;  5CFD C;  4PCR A;  1AL2 2;  4K8R B;  3LDB A;  5L7O C;  2FD8 A;  4Z07 A;  4A6S A;  2LRP A;  1R1A 3;  2ARE A;  2D3P A;  2ZGN A;  2V72 A;  1JUI A;  2BFU L;  2Z5W A;  4IE4 A;  2RDR A;  1HLC A;  3CJI C;  2RVA A;  3MIC A;  4QB6 A;  4CDX C;  4FFF A;  1VMF A;  2Y34 A;  1JOP A;  3KT1 A;  4R4X A;  3WVJ A;  5C71 A;  4Q0S A;  4CXW A;  2C6S A;  1KFU L;  1ND3 C;  3DF0 A;  1AL2 1;  1AR8 3;  1D4M 3;  1RUJ 3;  1SLL A;  2MNG A;  2XB6 C;  5GAL A;  2VZU A;  2JEN A;  5JPN B;  1JYI A;  2YBP A;  1JN2 P;  1BEV 1;  1LOF A;  1NXM A;  1UWW A;  4MOA A;  4PDW C;  1H8V A;  4E27 A;  2LUW A;  1Y4W A;  1WBL A;  2XQX A;  5ISL A;  1C4R A;  2NN8 A;  5C9A B;  1AXZ A;  1EV1 3;  3MHZ A;  1MAC A;  1RUI 3;  5FRA A;  1OPM A;  4CCM A;  4AI3 A;  2MPF A;  4B1L A;  5IYY A;  2BU9 A;  1G9D A;  3CL1 A;  4K20 A;  5FZD A;  2WA4 A;  1V6M A;  1U5Y A;  5JR7 B;  3ZMN A;  4LBQ B; 
#chains in the Genus database with same CATH homology
 2CHH A;  2JDH A;  1OXC A;  5A3O A;  5A6Z A;  2BOJ A;  2JDU A;  4CE8 A;  4UT5 A;  1OUR A;  1OUX A;  1W8H A;  2VUD A;  3DCQ A;  1OVP A;  5A70 A;  1OVS A;  1W8F A;  2JDK A;  2WR9 A;  3ZDV A;  2JDM A;  2JDP A;  5A6Y A;  1GZT A;  2VUC A;  5D2A A;  2XR4 A;  1UQX A;  2JDN A;  2JDY A;  2BP6 A;  2WRA A;  2BV4 A;  5HCH A;  2BOI A;  1UZV A;  1OUS A;  4AOC A;  5A6Q A;  5A6X A;  2VNV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...