4L11A

Structure of the c-linker/cnbhd of agerg channels
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
198
structure length
198
Chain Sequence
TARYHTQMLRVREFIRFHQIPNPLRQRLEEYFQHAWTYTNGIDMNSVLKGFPECLQADICLHLNRNLLNNCSAFEAASPGCLRALSLKFKTTHAPPGDILVHKGDVLTYLYFIARGSIEILKDDVVMAILGKDDIFGENPCIHSTLGKSNSNVKALTYCDLHKIHRDDLLDVLDLFPEFYDSFVNSLEITYNMRDEEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the C-terminal region of an ERG channel and functional implications.
pubmed doi rcsb
source organism Anopheles gambiae
molecule tags Metal transport
molecule keywords AGAP007709-PA
total genus 48
structure length 198
sequence length 198
ec nomenclature
pdb deposition date 2013-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4l11A02
4OLLA 3DL3A 4YARA 1O7FA 2ET1A 4MGIE 1PM7A 2IXCA 1RTVA 1SQ4A 3EQEA 2IXLA 1Q43A 1ZREA 4IEWA 4IESA 3EBRA 5LRSA 2GC3A 4XFIA 3CF6E 4Q0SA 5FLHA 3G7DA 3H3ZA 4Q29A 3HT1A 3SCFA 2UYAA 1DGRA 3OCPA 1RGSA 2OZJA 3LA7A 1CAWA 4YSFA 5EFUA 1UD1A 4META 3PVBB 3UKTA 1ZRCA 2IXJA 5KHGA 1ZZCA 3FE5A 3BCWA 2PYTA 3D82A 2K0GA 1YLLA 4HVQA 3WW2A 1ZRFA 5KHIA 4FAHA 2C0ZA 5I0UA 4HSJA 3IWZA 4XF9A 2XL9A 5I8SA 1RUNA 4I3PA 5KBFA 2ZCWA 4H7LA 3M70A 1J3QA 2HKXA 2ZKLA 5KHKA 1Q3EA 4IEQA 3MYXA 4KWJA 4QX5A 1ZZ8A 2FMYA 1ZVFA 2Q4SA 3IIAA 5FLJA 4LUMA 3E6CC 3FHIB 1VJ2A 3CJXA 2HJIA 3H8UA 3QACA 4AVBA 1IPKA 4IEXA 4MX3A 2XLGA 2PA7A 1RL3A 2BGCA 5D1IA 1H1MA 5JSPA 1QXJA 4I0AA 1OMIA 4GULA 4IEVA 4QMAA 1I5ZA 4EROA 1ZX5A 3FWEA 5BUVA 1YHFA 3UKNA 4LA2A 1XE8A 5J7MA 3PNAA 4X6QB 4HN1A 4AQ6A 2PFWA 2WC2A 3SMHA 1OI6A 3I59A 4MGYE 4MV2A 3I54A 4EWEA 5LEKA 4KWLA 2H0VA 4HVOA 2XKOA 3H7JA 3E97A 3FZ3A 4IEUA 1CAVA 3L2HA 4B29A 5EZWA 4LEJA 2QJVA 1ZRRA 1J3PA 3U11A 4JVAA 5BY5A 4LA3A 3OF1A 3ELNA 4QGLA 3N4MA 1CAVB 3BPZA 3CL1A 5FQ0A 4ZU4A 5I8YA 3WW3A 1NE6A 1X8EA 5E16A 2BYVE 4QGMA 4I01A 3ETQA 3MDPA 1X7NA 1O3QA 3H7YA 4J1XA 3UKVA 5J48A 4BHPA 2Z2SB 3GBFA 4XF3A 4WBBA 5JAXA 1VR3A 4IEOA 1X8MA 3C3VA 1O3RA 3KCCA 5JSRA 1O3SA 1UPIA 4UBHA 4EV0A 4HVRA 4FT8A 5FQ0B 3SHRA 3KSCA 1NE4A 1YFYA 1CAUB 4HN0A 5LRRA 3RYKA 3HT2A 1LR5A 4HBNA 2IXIA 1SEFA 2XL7A 3QOPA 5JCTA 4D7SA 1FI2A 2QDRA 4HSLA 2V09A 3HQXA 2GAUA 2IC1A 3OD0A 2I45A 3LZZA 2GC1A 4I0BA 3ST7A 3LOIA 2QNKA 2FQPA 5CADA 4XF1A 2GU9A 4IEYA 4K8FA 3EJKA 3IDBB 5FPXA 1U12A 1EY2A 2UY9A 4Z82A 5BPXA 4AVCA 5KHJA 1YFWA 2PAMA 3VHRA 4FAGA 4CYDA 3E5XA 2GH2A 4BYYA 4RD7A 1LRHA 4QXKA 4I2OA 3DV8A 3H1WA 1OD5A 4XFAA 1O5LA 4QM9A 3D0SA 3LA2A 4X6RB 1YFXA 4FBFA 2PAKA 1ZZ9A 1J58A 2B9UA 2VECA 4Q0UA 3RDIA 2PHDA 1UCXA 4PIXA 2QCSB 3E5UA 4IEPA 1ZRDA 5I91A 3RYPA 4BIFA 2IXKA 2BEOA 5FCCA 5AVPA 3KGZA 2XKPA 2Y0OA 1YWKA 1EP0A 2PHLA 1NZCA 2QVSB 3ROUA 2Z69A 4JTNA 4Q0VA 1DGWA 3HIFA 1CAWB 5C6CA 2H6BA 2OPKA 5I8TA 4UBGA 1SFNA 3LAGA 1J59A 4O9GA 5FLIA 4HMZA 1CAXA 1QY4A 1YFUA 5FPZA 3ACLA 2GC2A 1CAXB 1DZRA 2EAAA 3DKWA 5BXXA 2O8QA 3LWCA 4BH9A 4EWAA 2Q1ZB 3OGJA 4PIYA 3U10A 1Y3TA 3BALA 4XFHA 4LLOA 4KWKA 4MUVA 5E1RA 3RPQA 3D0JA 1Q5OA 1EYBA 2Q30A 3E6BA 1EPZA 3SXWA 1WA4A 5J3UA 1V70A 4N9IA 3RYRA 3S0MA 4MGZE 4O9EA 1PMIA 5F1RA 4LUKA 1UW8A 3H1YA 3LA3A 4N9HA 5CVRA 1LB2A 3OTFA 3KMHA 3O14A 3SCGA 4XFFA 2F4PA 4NVPA 2MHFA 4YRDA 1FT9A 2CAVA 1GQHA 2GZWA 1CAUA 1G6NA 3S7EA 3E5QA 5K8SA 2PAEA 2D40A 1CGPA 3CLPA 4AVAA 1J3RA 2CV6A 3EO6A 1WGPA 1VP6A 2N7GA 3TNPB 5CU1A 2BNNA 3R6SA 4E2GA 3RNSA 3I59B 2CAUA 4Q0PA 4R52A 1CX4A 3H9AA 2OA2A 5T3NA 3DN7A 3EHKA 2PQQA 1OFNA 1QXRA 2PTMA 4E2SA 1GQGA 3E6DA 4I09A 4KL1A 2D5HA 1RUOA 4JV4A 2MNGA 2H6CA 4QGNA 4XFBA 3NVCA 2KXLA 4P9GA 5HI0A 2EVXA 5LEJA 3SCHA 4ORFA 2D5FA 5KHHA 4XFCA 2Q0AA 1JUHA 4XFGA 2B8MA 1QWRA 2DCTA 3BU7A 3GYDA 2E9QA 2WFPA 3PLQA 3H3UA 2XHKA 4MZUA 4F8AA 2P17A 1L3JA 3FX3A 4KU8A 4F7ZA 3ES4A 4LTAA 1UIJA 4L11A 1NXMA 4ZU7A 4YNIA 2VQAA 1H1IA 1XRUA 3ZDSA 1RC6A 4PJYA 2IXHA 2O1QA 4KU7A 2MPFA 3M3IA 4J1WA 1UIKA 3KGLA 3BB6A 4Z07A 5I0SA 5BV6A 4LULA 4MGKE 1XE7A 5I93A 4Q0QA 3NKTA 2OZ6A 4ONUA 3MPBA 3CO2A 1ZZ7A 2XLFA 4HLTA 3JZVA 1WLTA 4HZFA 4AXOA 5JSOA 5C8WA 2UY8A 3WW1A 4EWDA 3FFQA 3MZHA 3U0ZA 1ZZBA 3NSTA 2K9ZA 3NL1A 4XF4A 5I0RA 3FJSA 2D93A 4WVZA 3H50A 1IPJA 4QM8A 2BNMA 5JR7B 1ZNPA 2CGPA 2ET7A 1I6XA 3NW4A 3WW4A 3IBMA 1LKNA 3NJZA 1TQ5A 1J1LA 4OFGA 4XEZA 1O4TA 2XLAA 1YUDA 2UYBA 4TLFA 4PIZA 2B5HA 3H1MA 4IETA 4UXAA 2ATFA 4A2UA 1O5UA 4YYOA 1ZZ6A 4IERA 4MH0E 2ETEA 2BNOA 3S7IA 2VPVA 2OYZA 4XETA 4R8HA 4WZCA 1FXZA 3B02A 3ES1A 2EA7A 4DINB 1Y9QA 4JTOA 3IDCB 1DZTA 4AQ2A 5FDBA 1O3TA 3USSA 4ZU5A 5I0TA 1HW5A 2GC0A 1X82A 3CEWA 4XF0A 1NYWA 4L2NA 2XGXA 3RZZA 3TNQA 4IEZA 3I7DA 4I02A 4D7TA 4E2QA
chains in the Genus database with same CATH superfamily
4CU8A 1L7RA 4M00A 1KS4A 1S0BA 1C5IA 3HQRA 4MGIE 4XPVA 5FZHA 4BA6A 2HWE2 2IXCA 3O1UA 3R05A 1DDLA 5A32B 2BPA2 5LBCA 2RR11 1AYM2 1SQ4A 1D2SA 3EQEA 2IXLA 3VBOA 5J36A 4CCMA 1Q43A 4W50A 3I2OA 4WM8C 4BM8A 2PQSA 3L2YA 3TYJA 4JRLA 4IESA 1OSGA 4S2DA 4C8DA 3JBG2 3J7LA 1OT5A 1OKQA 1VB2A 3OGRA 4FPLA 5FKCA 2DF7A 1GUIA 2OUHA 1WW5A 3FL7A 3VZLA 5A3UA 2Y64A 2P6CA 2OX0A 4IW3A 1CAWA 2VJXA 4Y5TA 4KQ7A 4META 1QOTA 4P5HA 5HCFA 2X5IB 3R4DB 2IXJA 1LGNA 4BLJA 4Y24A 1OOPA 1V6MA 1I5PA 2RE9A 2JKBA 4R9AA 3T08A 3U07A 1GZWB 2A6ZA 4K1YA 3D82A 5FPLA 3MEPA 5IJRA 1DGLA 1NT0A 3AKQA 1G9DA 5FOBB 2C0ZA 2ZX3A 4ET7A 2JX9A 3IWZA 2XL9A 5HXMA 3IT8A 5FXZA 4CDQC 1NXD1 2X29A 3K3NA 4CP9A 4H7LA 1JU4A 2CWSA 2BFUL 1OPMA 3M8LA 5GJ6A 1W9YA 3MF6A 1XSQA 5KHKA 3P5BA 4CCEA 3LB9A 4K21A 4IEQA 4NWVA 4P02B 4Y1YA 3MYXA 1ALYA 4QX5A 3AZYA 2FMYA 4K20A 3N9PA 3IIAA 4OI1A 4AEJA 3IN9A 1BZWA 3HN3A 1MS3A 1CZTA 5H9PA 1RUG2 1FOD1 2RS32 5ABJB 3RFRA 2QE3A 3FHIB 1I1EA 4Y1VA 3H8UA 1DYOA 1FOD2 2RS31 2WA4A 3AVSA 4MX3A 3WP6A 3AYDA 2XLGA 5GLWA 4DB5A 2RDNA 2PA7A 2VC9A 1LODA 1FNZA 2C24A 1G9FA 1HRI3 4AFBA 4WVWA 3USUB 1NA1C 5JOWA 2O8OA 4I0AA 1W2NA 3K46A 4COWA 4AL9A 5C3OA 2QQOA 1A6CA 4WM7A 4IEVA 3VZMA 4B7KA 4EROA 1ZX5A 1MS0A 4A4AA 1YQ2A 2ZMNA 1BXHA 5BUVA 5IK5A 2BUKA 1VMJA 3IMMA 3PUQA 2I74A 3Q8FA 4FI9A 3B94A 3UKNA 3I2KA 3WQ0A 1M06G 4JDOA 2JDHA 5A3MA 1V6JA 4HN1A 3AZVA 2E63A 4OULA 2UWAA 3TAYA 2WN3A 3ZYJB 4HVQA 3LOBA 3OG2A 4G9SB 4Z92B 4CRQA 1IS6A 1E5IA 3I2IA 1ZRFA 4QKNA 1RUD1 2RS12 4GH4A 5J96B 1MR5A 4IV3A 2DVFA 1QJX2 4OHWA 2VUJA 4HVOA 1WKYA 1ZBA3 2QQWA 1G8WA 1QQP3 2Y6JA 3E97A 1HXS2 2DBIA 3SKVA 5FY5A 4XTMA 1QNWA 3U11A 1EV13 3P3NA 1JYIA 1W0PA 2Y8KA 1O3RA 1TVGA 3MLKA 4HPKB 4QPYA 4XJUA 4L97A 4QGLA 4CPBA 3N4MA 1N1YA 4AOCA 1VBD3 1MQTB 1JMUB 4OMCA 2ZGNA 3DEMA 5FMDA 1E5RA 4BMBA 3IAQA 3I3DA 3BOWA 3CJIC 5DAXA 1X8EA 4BDVB 1GWMA 3EYPA 1FAYA 2OIIA 2WNOA 5AFBA 2JDKA 1H2LA 4LBKA 5IUQA 1V9U3 3ETQA 2NMOA 3MDPA 4GWNA 4AHXA 5BNNA 3V0AB 3AP7A 2W3JA 4MLOA 4Q4W1 5KWRA 1O3QA 3H7YA 1W3VA 5J48A 1WWYA 4BHPA 1IS5A 2C4XA 5IVJA 3M1HA 1YO8A 4WBBA 5KXCA 2UWBA 4NIGA 2VMDA 1PO23 2P34A 2YG0A 3PMSA 3VLBB 4D7YA 3ORJA 1D0HA 3K75B 4HK8A 4P08A 2HWF2 3AZZA 1VB4A 2R062 1O3SA 4ATEA 1UPIA 4UF0B 4AQSA 5IVBA 2YBKA 3AKSA 2X5IA 3KT1A 3LEGA 4HVRA 4QX8A 4FT8A 4YVWB 5A6QA 5CISA 4ZY9A 2WQ4A 4PDWC 3LDBA 2DUQA 3NV4A 4OCTA 1YFYA 4PLNA 3KWVA 2OKXA 2J1EA 5FZDA 5D8AC 4W4ZA 2EIBA 4LBMA 3M4FA 4LBQB 1D7PM 5FO7B 3MIGA 1GQPA 1SDDB 1BEV3 4ZKTB 2R0FA 4PT6A 2WQZC 3VBFA 5J09A 1AYM1 1BHGA 1RUG3 4QPGA 3AB0A 5KR7A 4XUOA 1KXGA 1MQTC 2A3YA 2CSGA 4HANA 4KWUA 3ZSKA 1FV3A 1H2KA 3NNGA 2VTXJ 4AI0A 4O61A 4HL0A 1G86A 1RMU1 1ULCA 1CPNA 5LW9A 2ZX0A 3WLUA 3LOIA 5AC91 2AYHA 1POQA 2VG9A 2WT0A 4CDUA 1SHWB 4FOWA 2ZX1A 3AZWA 4QWNA 2ZGTA 4IEYA 5E6HA 3EJKA 5F5IA 5CG9A 3FBYA 4N53B 4UYBA 4YW5A 3ZFFA 3ECQA 4Z82A 2WS93 1ULFA 2ORZA 2XJVA 4AVCA 4SBVA 1YFWA 3HNBM 3WG1A 3WDXA 4DXTA 4FAGA 3LF7A 1JZ2A 4Y4YA 2VTXA 2RS13 4RD7A 3GZEA 4QXKA 3ZN6A 1JS9A 3PHMA 4DS0A 5FYIA 3QBQA 1GOFA 5BNQA 2X53S 2HEWF 4CP2A 1GYKA 1W6OB 4MADA 1DYKA 2VQ0A 3N7MA 3V64A 1PGW1 4YGDA 1PGL1 3EMRA 1JH5A 3F2ZA 5FK7A 3TEXA 2Z5WA 3ZXDA 3ZXLA 4AF9A 4CDWA 5M0TA 1J58A 1EAH1 3T4HB 3BUCA 3CBNA 3J8F1 4PIXA 1ULGA 2EXIA 4AFCA 3SLIA 3KF5A 2E7AA 4GH4C 5DMYA 4BIFA 1X50A 1O8PA 3AL6A 4R4XA 2WFF3 4CEWB 4N90A 4FPCA 4HOOA 2WAOA 4GB33 1V9U2 2PHLA 2V4VA 4Q4X3 4PLMA 5AVAA 4OHZA 3WEZA 2Z69A 4CSWA 4Q0VA 5J37A 4D69A 4RHV1 1LULA 1VRH2 1QDOA 4ZXKA 1HXS3 1BBT3 2H6BA 4KGQA 5I8TA 4UBGA 5GZGA 5SV5A 2B42B 3OJBA 3T2TA 2W5FA 4ES9A 1NQDA 1SFNA 2XBO2 2ZAHA 2AC1A 3O12A 5A3OA 3UGFA 1X33A 1Y43B 3MIFA 1CAXA 1H2NA 2HWD2 4YGBA 4C90A 4TTGA 1YFUA 3ZX7A 3OPZA 2WYFA 5BNNC 4XABA 2GC2A 2WZEA 3PIJA 3DKWA 2CHHA 5L9BA 1W3XA 5EYXA 3LGRA 1URXA 3R4SA 1XBFA 1H6XA 4N53C 1Z7S1 2GNBA 5CFDC 2WWJA 5FZ4A 3ZFFB 3RG0A 4YW3A 2YZ4A 1JU3A 1EUUA 1PIV1 1I3HA 5FZBA 4E4DX 3D0JA 5IVVA 1Q8OA 1K5MC 1BKZA 1RUJ3 4QQPA 4H3WA 4LBJA 1Q5OA 1XB9A 3K4DA 3FLTA 4AEDB 3O5SA 5FY1A 4I30A 1EPZA 3I3MA 2GN7A 1QOSA 3R4UA 3AM2A 5T5OA 3BTYA 4NIDA 5D8AA 1XQNA 2QQMA 3AXEA 1BVVA 1LHUA 3EB7A 4FFFA 4YVSB 3S0MA 3KV6A 4O9EA 4QX7A 4AI9A 1VIWB 2WFF2 5F1RA 4N9HA 3VHNA 5KXBA 5JXGA 3ZOIA 5FJKA 1WA6X 1UU5A 4ZS3A 5CVRA 1W2TA 4Q4X2 2VULA 1LB2A 3OTFA 3SCGA 4QU2A 3GXUA 4L9BA 4M3CA 1AR81 2ENRA 5LBFA 3B5LB 4AI1A 1HV0A 1W0OA 2A7AA 3NWKA 5J1XA 5CG8A 2VCMA 2CAVA 2JG8C 1NCQC 3I2DA 4QHOA 4QU1A 4U2AA 2XJQA 2DCKA 4QD2A 5K8SA 3CJIA 3I8TA 2D40A 5CAZA 2Z79A 1LJ7A 3HPNA 4QPWA 3EO6A 3JBG3 1IS4A 2N7GA 1MEC2 4IV1C 5FFOC 1OQEA 3W58A 5JMOA 3RZJA 2WFF1 1SLCA 1FPN2 1VLNA 4Q0PA 4YVSA 1XOYA 5AFEA 5EJZB 1MVEA 1O4ZA 1ULPA 3DXTA 1DBNA 3DN7A 2B39A 1EAH3 2BZDA 5IVFA 4XOGA 5L19A 3PL0A 3PUAA 3WP3A 2D5HA 4PQQA 4L0PA 2Q8CA 3H8XA 2H6CA 2ZGLA 5JI9A 4DQAA 4CCDA 1HDKA 1ONAA 3NAPA 4XYXA 4CU6A 2BVBA 2Y0IA 4XTPA 5C3PA 3VKNA 1YQ5A 4GMP3 1OUXA 2VMCA 4AGGA 4CDWC 5LEJA 1RJ7A 4HFSA 4NPRA 5KHHA 2A6WA 2Q0AA 2W1WA 3N7JA 4XFGA 4ZXEA 3TOJA 3WP4A 3IM0A 2C9KA 2DCTA 3BU7A 2AEZA 3GYDA 4OHYA 2Q1FA 4UFMA 1LNSA 1NA1A 1XU1A 1D0GA 2XHKA 3ACGA 1FNYA 3C7FA 3C7EA 3O7OA 3FX3A 3OEBA 3PLQA 4Q1PA 2XJSA 5G05L 4HONA 4IV3B 2SLIA 5GZEA 3WNMA 3IDAA 2P4EA 4BK5A 1UIJA 3MLLA 3QCWA 4F7ZA 1TZOA 4E4HA 2G9ZA 5CB7A 5FO9B 1RUJ1 4M0HA 5ACA1 2A5ZA 3LIGA 4CUBA 1HB2A 3M3IA 4J1WA 5LBBA 3KGLA 3BB6A 1Z7S3 3PVNA 4JGYC 5I0SA 3HAGA 4PF5A 5C70A 5F5AA 4A42A 3OEAA 4K6BA 4UFLA 4Q0QA 2ADDA 2OZ6A 4LQRA 4N7UA 5C3RA 3MPBA 5IVYA 1NOVA 2ARAA 3AJZA 3OBAA 3CO2A 2E51A 2VQUA 4HLTA 3JZVA 1IKQA 2C9AA 1DQ4A 1LOFA 4GA9A 1RJ8A 4CP0A 5DZFA 4GAZA 1HXS1 1K5MA 4X8NA 3OYWA 3ZKYA 5EPAA 4EWDA 2CGNA 5JZGB 1AJKA 4FXGB 1UZWA 4O7XA 3ZDVA 3MZHA 3ACIA 1ZZBA 4Y33A 5JXJA 3TBDA 1OXCA 2K9ZA 4GB31 3WF1A 3Q8CA 4CDQB 3LEMA 4CP9B 3FJSA 1K5JA 4IE6A 5JMCA 3BKZA 4M01A 4XIKA 4YFWA 1D4VB 4JHTA 3DF0A 3H50A 4N53A 1IPJA 5JDBA 1ZNPA 1E57A 4LHLA 4P5YA 1C4RA 2YBPA 1MS8A 3GZUC 2YPJA 2QQJA 4Y5SA 3N9OA 1LKNA 1FPN1 1MEC3 2WNVA 4KG8A 4AFAA 3AP4A 1J84A 1N47A 4DMIA 2A6VA 2HBTA 2VMEA 3DCQA 2QBXA 2JD4A 2XWJB 2DCZA 3BTZA 2XLAA 1Q56A 1OA4A 1C8M2 3FUOA 3I2JA 3LFIA 4XDPA 4AGVA 3B00A 1UOJA 1UX7A 2ERFA 4URTA 1JHNA 2TEPA 2MEV3 2LM3A 2Y6KA 4TLFA 4RR3C 1KGYA 1SFPA 2B5HA 3LSEA 2DFCA 1TNFA 4MXWA 2PMWB 1ND3C 2R063 2ZJCA 3C7HA 2WS91 4Y1XA 4XJZA 5T5LA 5IFPA 3WY6A 1PNGA 1O5UA 4ZHNA 1M4WA 5GZCA 3RVHA 1PO12 2P2KA 1AR82 2WSVA 1RUH3 2ZTNA 3AKTA 4MH0E 5A7QA 3VBOB 2BNOA 1SLBA 4URAA 2V73A 4ISRA 4OZXA 5L9VA 4XETA 2JDAA 1ODNA 1FXZA 5A3TA 2EA7A 4DINB 1BK1A 2BBAA 3B3QE 5AC93 3KQ4B 3OD4A 2E7QA 2IVJA 1RMU3 2X09A 1Y9QA 1JHJA 2UU8A 1COV2 4KGGA 3RI8A 4JTOA 4ARYA 1H30A 3IDCB 3RZHA 4BWOA 4W6WA 1XU2A 3KD4A 4GXLA 4NHXA 5GKAC 1JYTA 2WAAA 4MO3M 2HWF1 1FMD2 4NN0A 1FMD1 4LIVA 3ZXEA 3NV3A 5EYYA 4JDNA 2ZEXA 3OUHA 4E2QA 2PLV2 3GBWA 5CYYA 2HWC3 1VBC1 2HWC1 1VBC3 2VUCA 2VL4A 3BOPA 2R1DA 1LENA 2QUOA 2VBPA 3DL3A 3WDVA 3DYMA 1O7FA 3WF2A 3WQBA 2ET1A 2W87A 2JECA 2BWCA 1RTVA 2VO5A 2HWF3 2V72A 4P9JA 4CPBD 1HQNA 1MZEA 4QX2A 3UESA 4EYUA 3W5MA 5K7PA 1QF3A 5F39A 1ZREA 1HRV1 4A7YA 2W0XA 4JKMA 1NX9A 3EBRA 4C0HA 4CDUC 1BK0A 2Y6LA 1RHI3 1F9KA 3ABZA 3CF6E 3M2MA 1KFXL 2MEV2 3JXSA 3PUSA 1AR73 3BVCA 2QQIA 4Y1ZA 3WX5A 1H9WA 2NZ9A 5C33A 1O6UA 4YLZA 5FAXA 3SCFA 1IG0A 2UYAA 2IFRA 2JDMA 2UWCA 3K48A 4JKLA 1RGSA 2OZJA 2VVEA 3SH5A 3ZFFC 4YSFA 1ND2C 5EFUA 1UD1A 5FYUA 5GLZA 1JYVA 1PHMA 3P6BA 1UPSA 1CWPA 4PDWB 2Q1MA 1J83A 1UYPA 1VAKA 5IK8A 2YGMA 1ZZCA 1SG3A 1ZBE2 3BCWA 4GIQA 3VDBA 2K0GA 1YLLA 3SQOA 2IFWA 3WW2A 5T5PA 2UURA 2D98A 1GOHA 2V5DA 2XQXA 3LEIA 2XJUA 3MHZA 5ANQA 5I0UA 2J1SA 2W94A 2ZZJA 1VBD1 3LIHA 4UFHA 5F9TA 3V0BA 2BOIA 4AHZA 4LIUA 4E27A 2JE9A 2ZCWA 3GZTB 1Q8PA 3DYOA 1AR91 3M70A 3POYA 5A3PA 4Q1RA 3N9QA 2W95A 1WCSA 1W8UA 4FXKB 4LNVA 4QKBA 2GP5A 1Q3EA 1QQP1 3CZJA 1ZZ8A 2W39A 3WDUA 1JBCA 4QX0A 2JICA 4YVSC 4NAMA 1VALA 3I3QA 4FP3A 3HMYA 3WNPA 2AUYA 2BGOA 2HEVF 3NNFA 4AVBA 1AR71 2W1UA 4EN8B 3SH3A 3MUZ1 2JB8A 4CDXB 1SCSA 1H6YA 5IVEA 2G19A 5EIYB 3ASIA 4QMAA 2VAUA 5LB6A 4Z8BA 3FWEA 2A70A 3KB5A 3WXPA 1OFSA 3AP6A 1UMIA 4ISQA 4XBNA 1ND3B 3K4AA 3WUDA 3T0DA 3RZKA 4RA0A 4RR3B 4X6QB 4AQ6A 5FP4A 2OQ7A 4PLOA 2WC2A 4CEYC 3KCYA 4WM8A 1IOAA 1AZDA 1UY3A 1FMD3 3VGIA 4BQ2A 3I54A 1S4CA 4XILA 1OOPB 4Y1UA 4LK7A 4LJHA 5L7OA 2R7EB 1R092 2AGSA 5JPMB 1REDA 3D4KA 1US3A 1NA1B 4JHZA 3L2HA 3ZMOA 5EZWA 2VZ1A 3MW4A 1W6MB 4EN0A 3IAPA 4NE9A 4Y3OA 4JVAA 4XZPA 4N8MA 5BNPA 2A75A 3N9LA 1XNBA 1O4YA 4LA3A 3OF1A 3ELNA 2VOWA 5KXEA 4LOSA 3CL1A 4FFGA 3VL9A 5CFCC 5I8YA 2E31A 4FVVA 3ZVXA 3O0XA 3NAPB 1UXZA 4K40A 2WBKA 2D3PA 3UK9A 1DFQA 5E16A 3VZNA 1GR3A 2WN2A 2WZR2 2ZGPA 4QGMA 1RXFA 2WUHA 1UOGA 5FYHA 1U5IA 4OUEA 3W59A 1X7NA 4DUWA 4K8RB 2XR4A 1TMF3 1Q8VA 4Q5OA 4J1XA 2VOTA 1XPWA 4GMP1 1DQ2A 1XXNA 1WLWA 5FZEA 1F5JA 1VBB2 1W03A 4XF3A 2LRPA 5A3NA 3V0AA 4LKDA 1BYHA 2XBO3 1D4M1 3C3VA 3KCCA 1WW6A 1SLLA 2HWB3 3JD72 4P14A 1ZYBA 2J7MA 3A23A 2D43A 1Y9GA 2VUDA 1AXKA 2XJTA 3I3BA 4FO9A 1PIV2 3QH6A 1FV2A 3MIHA 3U78A 1BJQA 3WDTA 3ZPOA 4CCNA 3U4XA 4N7IA 5FUNA 2NP0A 5BNPB 2AENA 4HBNA 3ZO0B 2D97A 4XW3A 2BDRA 3RI9A 1VBE2 3D3AA 2EIGA 4OI2A 4D7SA 1FI2A 2ARXA 1OD3A 1QJX1 2D3SA 4HSLA 5EHDA 2JDYA 5FZ6A 2HWD1 5B4XA 1TME1 5L73A 1UXXX 5L7OB 3JQXA 1AL23 1PK6C 3Q9OA 4LBQD 2ZMLA 3PMEA 1OHFA 2GALA 1GV9A 5FZKA 4CUAA 2YC2A 2GAUA 5SV8A 4LORA 4NWWA 1OC1A 4PBOA 1S55A 4DXZA 2I45A 1GNZA 1WLCA 1UL9A 1V6OA 1YXWA 2GC1A 2P3YA 2R042 2P6HA 2W47A 1B09A 4LKSA 2Q8DA 3ZFGB 3A21A 1RXGA 2JIGA 2XG3A 4A3XA 1POV1 4G4FA 4NOTA 1ZBE1 2DCJA 3AMNA 1UU4A 5DAWA 2C26A 1WUVA 5GZDA 4YGCA 2VW2A 3J26N 4K8FA 4NHYA 3IDBB 2VZQA 1W99A 3TRSB 1LOFC 4B3NA 1F4HA 3VD9A 3H42B 2W68A 1W6PB 1EY2A 4XUPA 5BPXA 5FWEA 4XJWA 3LQCA 4QXBA 2W91A 3IZOA 4CYDA 1SFYA 2FMDA 2WABA 2XQRA 1ZRIA 5C9AA 3QH7A 2YFZA 4I2OA 2YC4A 2WT2A 4FOQA 3NV1A 1O5LA 4QM9A 3VBOC 3ZPYA 4XQWA 4YW6A 4ES8A 4XIOA 4NROA 3M3CA 4AFDA 3M3OA 3KT4A 1ZZ9A 1VBE3 2B9UA 2VECA 3RWKX 2QCSB 4QQHA 3TWIA 4FTBA 3POJA 4FPKA 3O1TA 3RYPA 4JKKA 1NCRC 5CFCB 3RZGA 5FXWA 5AVPA 2ZS6B 1YWKA 3ROUA 1YJLA 1NZCA 3ZXAC 2WO3A 4NHMA 1BBT1 3ZKUA 1VBB1 3N3HA 5DQ0A 3VKFC 2XMLA 4FSJA 2Q8OA 1CIYA 5F7UA 4ARXA 1PGW2 2BFUS 2ZXQA 2BP6A 1PGL2 4O9GA 5FZCA 4HMZA 1NAEA 3X29B 5A7NA 2QQVA 1LEMA 1R64A 4AAPA 2R16A 2WYSA 4COYA 5DABA 1SBFA 2P1BA 4RN5A 3DPRB 2OUJA 3MV11 1QMJA 2ZKNA 2EAAA 1AX2A 2Y6FA 3BIEA 5F2SA 3VKLA 4K9SA 2ZX4A 3LWCA 4QDSA 1YYNA 4LKFA 1W6QB 3NJVA 3HBZA 3O1PA 1QJU3 5BNPC 2Q1ZB 3U10A 5LK7B 2XJPA 4AAXA 3BALA 2RS53 2JG9C 4XFHA 1X36A 4KWKA 4MUVA 4NRQA 2JDPA 1UY1A 1DQ0A 1RUC1 5DDJ3 5DUWA 3OBZA 3WV6A 5FXVA 1Y7BA 5E8AA 4WM8B 4BK4A 4KG0A 3SXWA 3B93A 3VBUC 3AMPA 1PZ9A 2E7TA 4TWTA 4AYUA 4QAWA 5A6XA 1F35A 1N3OA 1W8FA 2XH6A 3HVDA 3VZKA 5DZGA 4AHYA 2A6YA 4A44A 4MGZE 1EV12 2NQYA 3NKGA 1Z78A 3H1YA 4XMIA 1GLHA 2H0BA 4BCUA 3IPVA 1W9TA 1LOGA 1R1A2 2KM2A 3BGAA 2HYXA 4HT1T 2J1AA 4Q4V1 3OUJA 1MACA 3HOBA 4LT5A 2OPWA 2F4PA 3H0OA 2MHFA 4IV3C 2AREA 4KBZA 4YRDA 4Q4Y1 3MBWA 3BPSA 1JW6A 1AHSA 1KITA 2WS92 3GZAA 3HNMA 2RDRA 3ACHA 2JDZA 3WF4A 2CY6A 2Y60A 2FDHA 2GZWA 4Z2AA 1GWLA 3A7QA 1U5XA 4GKXA 4RS5C 1CGPA 5JLVA 2CV6A 4AVSA 1R091 1OA2A 1AUYA 1NG0A 1PO22 1VP6A 3TNPB 4UF0A 1IPSA 1K3IA 2AH2A 1H0BA 2BNNA 4HG6B 4YZ4A 1JXNA 2VGDA 3OBRA 3RJ2X 5FR3A 1UZYA 5A1AA 3POWA 4XQ4A 2RG4A 4PI0A 1AR62 1F31A 2WL1A 2JIJA 5CKNA 2PQQA 1WBFA 3AYEA 2PTMA 2GN3A 2WSUA 1GQGA 5FP8A 5IWFA 5DDJ2 4JV4A 4BMEA 1PMJX 1CR7A 1UWWA 2E6VA 4CDQA 2ID4A 4GB32 1IG3A 1BMV1 4QGNA 1BEV2 2OW4A 2DU1A 4XFBA 2KXLA 2P3KA 3NVCA 4B4QA 1Z0HA 2J42A 3WF0A 1B35B 5EP9A 4CCJA 5HI0A 2WNUC 2EVXA 3AX4A 5FZ8A 3C2UA 4IDZA 5FZ0A 4ORFA 3SCHA 1H8TC 3ME2A 3URFA 1UY4A 5FYSA 3V65A 4DXRA 4XFCA 1KJLA 1JUHA 3ZFEA 2B8MA 4MG2A 1ACCA 3FHAA 1QNYA 1AXZA 4KI5M 1LOEA 4IE0A 5ISLA 1LEDA 2E9QA 1KFUL 4MHRA 3KS7A 1WCKA 3BN6A 3D6EA 3H3UA 4DIQA 2FHRA 1PK6A 4OQ9A 1L3JA 2P17A 1IKPA 1KQRA 4Y26A 4KU8A 1VBA2 2RM21 3ES4A 3N9NA 4LTAA 2TUNA 2RS11 4GH4B 1RHI2 3CNAA 3N35A 4FPHA 4L11A 4CEYB 4DNYA 2VMIA 5L9RA 5LA1A 5DDJ1 1EV11 2VQAA 3AMMA 1S2EA 2ZX2A 3ZDSA 4R4ZA 4BXFA 3MIDA 1VBC2 4QKDA 5H9QA 1W28A 1G9CA 1UMHA 2QKDA 1JODA 1H1AA 5ACA2 5L36A 2G9GA 4Z07A 4AGRA 5BV6A 5LA9A 1QJEA 5A70A 3U1XA 4MGKE 1MS1A 4WM7B 3D8CA 3AK0A 2ZEYA 1A8MA 5FY8A 2B4KA 3AP9A 4ONUA 5LASA 2XONA 3A4UA 4TYSA 4E4ZA 3MF9A 1DU3D 4HZFA 3FHQA 3HBKA 1S0DA 3J4UH 1SCRA 4JGYB 5FP7A 5JSOA 3AYAA 3KV5A 4Q2FA 2RDSA 1RUG1 5A80A 1W8NA 1EPWA 1SLAA 2UY8A 4LE3A 3VHPA 3WW1A 3CDZB 3DPRA 4H55A 3F95A 3FFQA 1W2AX 1SPPA 5APAA 2WO2A 5F6KA 4KMQA 2WKKA 3WNNA 3U0ZA 1DCSA 2ZBJA 4Q4V2 1RUE2 2YY1A 2RR12 2VCBA 2JE7A 5A32A 4XF4A 1WCQA 5LBEA 3TEYA 2GDFA 1VAVA 1K42A 5H9RA 4LO5B 3WG3A 3S5QA 5A1FA 4UWDA 4QM8A 2BNMA 1NCRA 1XYPA 2AEYA 1XE0A 3THDA 1I6XA 2ZEZA 5FZ9A 4CU9A 1TMF1 4MOAA 4Y22B 1NLRA 2XVGA 3ILFA 3WW4A 1GP6A 2QTWB 3IBMA 5DZEA 4W8JA 3WNKA 4OQ8A 1TQ5A 4UFKA 4XQDA 2V5YA 4O65A 5C3QA 1RUI3 1W2UA 2PHWA 5D2AA 5K0UA 2E53A 4DO0A 4AFMA 4A3ZA 3AZXA 5GLUA 1S0FA 5BNOB 3VBUA 4Q4W3 2XDVA 1Z7S2 4XE9A 1GANA 2R49A 4IETA 3ZXKA 1ASJ2 3ZMNA 4A2UA 2EIEA 1N1TA 1SACA 2XUEA 4LHNA 5HPOA 2F6BA 1ZZ6A 4IERA 1YNAA 3S7IA 4IV1B 4QQLA 1F5FA 3AYCA 4LR4A 4R8HA 4WZCA 3VBSA 1ZBE3 3VL8A 1JYNA 2YPDA 2PHFA 4RS5B 4HKOA 3GJAA 2GSYA 4MHUA 1OVSA 4JGYA 3MLJA 3NNMA 4R9BA 4JC1A 1VRH1 4A41A 1DZTA 4YM2A 1QJFA 3SEEA 3WNLA 3TB0A 2J1VA 1Q8SA 3RWNA 3MICA 4XF0A 3CEWA 4LPLA 1NYWA 2DVGA 2YYOA 1R081 1ST8A 4RFT0 5DUXA 4XCBA 1AL21 1KDMA 3RZZA 4YM1A 5A7WA 3T1LA 1LHOA 3MW3A 2R041 2ZHKA 4I02A 4NRMA 4C1XA 1MS9A 4D7TA 4QQ2A 3J8F2 3NNJA 4OLLA 2R043 5HCBA 4CDWB 4YFZA 5JOYA 2RVAA 1CQ9A 1PM7A 1OF3A 2R0HA 3VBHC 1RVF1 2ZOEB 2OS2A 4NHKA 3VBFC 1DLCA 1HRI2 4JRAA 4OVEA 4QDQA 1HRI1 3G6JB 2ZPXA 3FN9A 4IEWA 3ZN6B 3ZXFA 4DEQA 4KNCA 3LD8A 4XFIA 3JCIA 4Q0SA 5FXXA 3AVRA 5FLHA 4EZHA 1F8VA 2QDNA 1D4M3 2RJ2A 2XBO1 3A0KA 4HKWA 4YG6A 3ZFEB 2FDJA 4CCCA 3CIHA 1LTEA 3OCPA 3LA7A 1AR63 4EQVA 3VDCA 5FZ1A 5CIRA 3PVBB 1MS5A 1ODMA 4DY3A 2FBEA 1DP0A 3UKTA 1OUSA 1AVBA 4YZ2A 1JZ7A 5KHGA 4FPOB 3FLRA 4XDOA 3FE5A 1O59A 1R082 4GZ9A 4XBQA 2LALA 4ASLA 5AC92 5F3CA 3ZFGA 1HB4A 2VZPA 1ZBA2 5FY7A 3VD3A 5I8SA 3DXUA 1CJDA 1LAJA 1RUI1 1TE1B 3P1IA 4I3PA 3I97A 3HQUA 5F8PA 3ZSEA 3ZR6A 5KBFA 2RHPA 3VBSB 4V2WA 2ZKLA 1IHMA 4QXHA 4MGQA 1ZA4A 2A6XA 3T4VA 4KWJA 1UYYA 4D6RA 1AX0A 5FREA 2IUWA 1LU2A 3NAPC 2VH9A 1LECA 3D5OA 1HN0A 4FP2A 4MYEA 2PHXA 4OI4A 4XHXA 2J1RA 4ZPIA 1FYUA 5JR2A 3CJXA 1MZ6A 1OLRA 2HJIA 3QACA 2WWSA 1IPKA 2YXSA 2KD7A 1LHNA 4AI3A 5C8CC 4M3CB 2BGCA 1LU1A 3FFZA 3LDKA 3VD4A 3I49A 4Y4RA 5D1IA 1H1MA 3VDAA 5JSPA 3O1SA 1QXJA 4INDA 1R1A1 4C1WA 1HN1A 4GULA 1W90A 5DN2A 1S0IA 2OQ6A 2QZ2A 3KHCA 1LHVA 4Y22A 5DAQA 2XVKA 4XBLA 4CUCA 1QJU2 1ULEA 3ZFEC 1JN2P 5J98B 2ES3A 1QOOA 4YW1A 4S2GA 5EWSA 2PFWA 5BNNB 2FDGA 1OI6A 4DUVA 1GOGA 4MXVA 1ENXA 1UZVA 4EWEA 5IHRA 4Q8LA 2HH9A 5LEKA 5FV3A 5FYZA 4ITCA 2YHJA 2XKOA 1SPPB 4IEUA 2EAKA 2VUAA 1WBLA 4B29A 5C4WB 4LEJA 2BWAA 2QJVA 4YM0A 3KT7A 1R1ZA 1ZRRA 1J3PA 4ZONA 3H8RA 3RRDA 1AR93 2FDKA 4L99A 5BY5A 3M3EA 3ZM8A 4S2HA 2WNUB 4BQYA 4AEMA 2Q5TA 2VNOA 2VCCA 4QB6A 1XYOA 3MFAA 3WDWA 3BTXA 2F4LA 1QHDA 5FQ0A 3ZIXA 4LBOA 3WW3A 1NE6A 4AW7A 2A3XA 1G9BA 1U5ZA 3UNPA 4LO6B 3UETA 4GD4A 1BVP1 4UI9L 5JI7A 2BYVE 3TN92 4CXXA 2ZEWA 3PU8A 1IGOA 1SLTA 1JOPA 4LE4A 1W0NA 3SC7X 3WG4A 4B4PA 4BQWA 2DUOA 1YEWA 3I2FA 5D8AB 1DQ6A 1VR3A 4R9CA 4HETA 4D3WA 1D2QA 1HX6A 2PXJA 1X8MA 4DUXA 4LBLA 4V1PA 5FYTA 1UQXA 4GQ7A 1RHI1 1WCDJ 4BLIA 4UBHA 2D6NA 4NPLA 1OPOA 1JTZX 2JJ6A 4B1LA 3SHRA 2VR4A 4QB1A 1NE4A 2JG9B 1CAUB 5GLVA 1NY71 4WVMB 3ZYBA 1DGRN 1UZ0A 1RYYA 3AFKA 4WV8A 1Q8QA 4H7MA 4IE5A 4QQOA 5C5TA 3VHOA 4MGSA 2EF6A 1A8DA 5CFDB 2IXIA 1JYWA 4Y5Z0 1N3PA 4XC9A 5F3GA 3QOPA 4Q27A 5JCTA 1S0EA 1YI9A 3VBSC 1UO9A 4Q26A 4UAPA 2VBDA 1QQP2 1YQCA 5IATA 4LOTA 4PCRA 5C9AB 1RUD2 2OT7A 4FPFA 1YQ6A 3HQXA 2YC0A 1GNHA 2ZGUA 5E88A 2IC1A 3NRUA 3OGGA 3ZYGA 4YZ3A 1SLIA 3KF3A 3OD0A 4W6YA 1GSLA 1ENQA 3LZZA 5K0UB 4FPYA 2VOKA 4XAAA 1J1TA 1HIXA 1VMHA 4DRRA 3T2OA 2WA3A 5CADA 4CEWA 2BOJA 2WINB 2GU9A 4IL7A 1RUH1 4CXYA 3RS6A 2D6MA 5EJ1B 4CZSA 3LDRA 2VNVA 1U12A 3K4ZA 3WOGA 5BYNA 5FPXA 2UY9A 5FKBA 1RUF2 2PAMA 3VHRA 4LO8A 1BLZA 3JQWA 5ABJA 2WWUA 2MEV1 1RUC3 5FO8B 4BYYA 1F15A 3SEPA 3S6PA 3ZYHA 1V00A 5JVVA 1H9PA 3OUIA 4WM7C 4MSVA 4A45A 5I0DA 2KA3A 1OD5A 4PHZA 4XFAA 5FYVA 4DY5A 1PMHX 3W5NA 3LA2A 2VW0A 5H9SA 4W65A 4CUGA 4X6RB 1FPN3 1W9WA 4KH9A 1YRZA 4CU7A 2VZ3A 2JDNA 4FBFA 2X8KA 2PAKA 5DXDA 4Q0UA 2PHDA 2VVDA 1GP5A 4IEPA 4ZZ5A 4JAAA 5I91A 5JOXA 1ND2A 5T52A 1KEXA 3VDDC 2IXKA 1CIWA 1GZWA 2YMZA 2XVLA 1ZA7A 2BEOA 2NMNA 4BQ1A 5FOJB 3PVEA 1LGCA 1W06A 2PELA 2WNVB 2XKPA 3H3LA 1EP0A 2C6SA 4FQ4A 5FBJA 3SNMA 3V56A 3PURA 3J9SA 1TMF2 2DCYA 3HIFA 4NRPA 1CAWB 3VKOA 4BOWA 4PF1A 2JENA 1OH4A 3TEZA 2WZR1 1J59A 1WMFA 5FLIA 3HR9A 1C57A 3QLQA 3WSOA 5FPZA 3BU0A 1PK6B 3ACLA 1PO11 3LFMA 3OYWB 2ILMA 1K5MB 3NJXA 2D6OX 4C0BA 4M4RA 1A3KA 5FK8A 3W20A 3POBA 3ZN5A 5BNOC 4BH9A 1CPMA 1RUF1 2W9XA 3U14A 4B8EA 4FPEA 3OGJA 4MVTA 4PIYA 2VQTA 3OBTA 4E9KA 1Y3TA 3SKJE 2P3IA 5EQUA 1RUH2 4LLOA 4DOUA 2BVVA 4GJZA 3AMHA 3RPQA 4A7KA 5ACA3 4BPZA 1XNAA 4NIAA 3GNEA 1BMV2 5FZFA 1TEIA 4XXAA 2NN8A 1DG6A 2Q30A 3E6BA 3NV2A 1WMXA 1WA4A 3AL5A 4NJ4A 1OURA 3ACFA 1H8VA 1PIV3 4Y20A 5CZKA 1V70A 4BXSV 1G7YA 1NUKA 4N9IA 3RYRA 3APBA 2R1BA 4AI8A 3R0RA 2RMU1 1YC61 1L7QA 2G4IA 2PHTA 1V6LA 3KM5A 1SBDA 4YG3A 5FY4A 1QJY3 2CDOA 3KMHA 2Z42A 4QPGC 2HBUA 2YB7A 2RS51 4XFFA 2PLV3 4NVPA 1C8M3 1MQTA 2RJKA 3T30A 4A6OA 2V4AA 1STMA 3AKPA 3VDDB 1POV0 4B1MA 1HV1A 2DVDA 2FD8A 2WZR3 5GZFA 1GKBA 4XAEA 1CAUA 3K2OA 1CVNA 2WRAA 3ILNA 4CCOA 1JZ6A 1UY2A 3PUHA 2PAEA 1XNTA 2XWBB 3N7KA 3JB8A 2W1QA 4OHXA 1J3RA 2L9LA 1QU0A 5C8CA 4UW6A 4ATFA 1WW4A 3O0VA 4COUA 2XPJA 1JYXA 5CU1A 1C1FA 4QHBA 4K1ZA 3R6SA 4YM3A 4E2GA 2RMU2 3J7NA 3RNSA 3THTA 2JD9A 4RQPC 3GF6A 1TNRA 2WIIB 3H9AA 3OPTA 4R52A 5IVCA 2XOMA 2OA2A 4TZDA 1U0AA 4Y20B 2GP3A 3LSDA 1CJPA 1UN1A 2YU1A 3E1F1 2LTNA 4YGEA 5KC5A 3HN1A 3E6DA 2HLEA 4KL1A 4WVVA 1RUJ2 3OY8A 2MNGA 1RUC2 1LHWA 3FUQA 1AYN1 2ZABA 4OI0A 2OXBA 4H2AA 2OVUA 3B7MA 2FCUA 4RGKA 1AR83 3MV01 2DTYA 4P9IA 3RGBA 2W2IA 1O91A 1VBE1 1GFF2 1EUTA 1OF4A 3I2GA 2K46A 1QGLA 2VVFA 1T6GC 3MW2A 5K4LA 1B35C 1QWRA 2AR6A 3MO4A 4GMP0 5C4WA 4YZ5A 3GCWA 5F3EA 4A6SA 2WFPA 2DV9A 2B45X 5FP9A 3PDQA 5B2GB 4F8AA 5T54A 2VNRA 3K3OA 2J1UA 3MPPG 5L7OC 1PNFA 4LITA 3VBRA 2NPIA 1NXMA 3GBGA 5FMBA 3EXUA 1ENSA 2BQPA 1XRUA 3W9AA 3ZN4A 3U75A 4QT6A 2W92A 3WT3A 5IK4A 4GKYA 2IXHA 2QQUA 4KU7A 2TNFA 1PVC2 4LO4B 4X8PA 2DUPA 2MPFA 3ATGA 1UIKA 1X9PA 2FZ1A 1HJFA 3BI3A 3PTRB 3W21A 4F3JA 5FMOL 2ZGQA 5CFCA 1POV3 2ZGOA 2GNTA 3MIBA 4AEDC 1AYM3 5FZAA 1VE0A 4JQRA 1XNDA 2WQ8A 1GP4A 1PO13 2IWGB 2R071 2BTVC 2YGLA 3SH4A 3ZSMA 5FRAA 3Q8BA 1A34A 4XUTA 3WCRA 1ZZ7A 4FFHA 1FX5A 1JUIA 1WLTA 2G1MA 1GICA 4F83A 5IAVA 4AXOA 1UU6A 5LA0A 5FZ7A 1MS4A 5FZ3A 3WNXA 2CL2A 3JUUA 1C8NA 4M3CE 3ZSJA 4NO4A 2I2SA 2VOXA 1JI6A 2O0OA 3VBHA 1VAMA 1F4AA 4Q4X1 1AYN2 1LGBA 1ULDA 4XVHA 4MXWB 3GHNA 1W05A 2HWE1 2WO7A 5I0RA 1HQWA 2VMFA 4BQ3A 1YI7A 2VXRA 2D93A 3LCPA 2WJSA 3RMYA 4P00B 3J8F3 2CGPA 2ET7A 4PI2A 4ASMB 5C7GA 3NW4A 1BBT2 1KD7A 2LS6A 2W1SA 2GMEA 4I3GA 5CKMA 5A7PA 4B7EA 1V9U1 2A73B 2ZAAA 3NJZA 4FOVA 5DAPA 3PU3A 2VCAA 3NJYA 5F32A 5HCAA 5JZGC 2EICA 5FUPA 1J1LA 1H8TA 4L8QA 3I2HA 4BZ4A 2QQPA 4A7ZA 4CEWC 5GLTA 1YUDA 1NCQA 1OOPC 3WZ1A 1L7LA 2UYBA 2A3WA 1PVC3 3ON7A 2X05A 4WZFA 5LK5A 5HV4A 4GALA 3RMXA 2VZRA 4R9DA 5C5UA 3H1MA 1JZ8A 1LCLA 2ATFA 3VDDA 1GU3A 2FZ2A 5FJHA 2RJLA 3NNLA 2RS52 5JUVA 3THPA 5A3WA 5IW0A 2VXJA 5FPUA 2VNGA 1P8JA 5CFDA 2VTFA 1LOAA 4BQ4A 3B02A 3ES1A 4IGOA 5IAXA 3T1MA 2KR2A 4EN9B 1HB1A 1DZQA 2QZ3A 3C8XA 1E5SA 3MGUA 4OYUA 4D6QA 4EE2A 3V0BB 1W6PA 1QJZA 4RHV2 3POIA 5FY9A 4AQ2A 1O3TA 5JWPA 4HK9A 1NCQB 1HRV3 1W04A 1WZXA 1O8SA 2SBAA 4LK6A 1HW5A 5CNAA 4JGZB 5CEHA 1VBA3 1JZ5A 2BERA 3RZLA 1X9TA 1X82A 3VZOA 4DXSA 2XGXA 3ZYRA 4NPMA 2JDUA 5E89A 1V6IA 5EJ3A 3Q8EA 5A3LA 4AQTA 2DDUA 3B9IA 4IGQA 3KQRA 2BBVA 5C4WC 4YARA 4NIHA 2VOVA 4QPIB 2RS33 3POSA 4JQTA 4E8DA 3AJYA 4RS5A 1PZ8A 3HEIA 4K7JA 4W6XA 3GALA 2I07B 2Y34A 3BTAA 3AMQA 1TME2 1MZ5A 2GH8A 1DQ1A 2XUMA 1YIFA 1QDCA 1W2OA 4AG4A 2BJSA 3NO8A 3O0WA 3AP5A 4LO7A 5LA2A 2VY0A 5LRSA 5DPNA 2GC3A 1LOBA 3S30A 1V0AA 5FP3A 2WZPP 3G7DA 4AK3A 3H3ZA 1C5HA 2TBVA 2Y6GA 4Q29A 3HT1A 1IZ3A 5FTTC 1DGRA 2Y33A 1JZ4A 5BNOA 1S0CA 1UNBA 1IQAA 1OVPA 4H14A 1RIRA 2LUWA 5F5CA 2PHUA 5A7WB 3UJQA 1ZRCA 4CDUB 2R061 4XJ8A 1UOFA 2JB4A 2PYTA 3PIGA 4XMAA 2DVBA 2HEYF 3IDEA 1MZFA 2YFUA 5KHIA 2DTWA 1H4HA 4FAHA 1GBGA 3FC0A 1DLLA 1OQ1A 1PVC1 4HSJA 3O1VA 4XF9A 3DECA 5LY2A 1RUNA 3KVAA 5KC6A 2C1FA 2D3RA 3AKRA 5C9AC 1SZBA 3JB4C 4QPGB 4Z1VA 1J3QA 1OKOA 1MEC1 2HKXA 1HQLA 1WD4A 2QQNA 4QX3A 3MUY1 4IV1A 1KDKA 1DGWX 3WCSA 1V6KA 4LLFA 2VZVA 4DRVA 1N1SA 1DHKB 1ZVFA 2Q4SA 3CJIB 4Q8KA 2K2SA 1C3HA 4RQPA 3T3YA 5FLJA 2RR13 3PTYA 4LUMA 5FIXA 1RVF3 4EN6B 3E6CC 2A71A 5FWJA 1VJ2A 2HWE3 5F3IA 3JU9A 4YVWC 4IEXA 4BJ0A 1SBEA 4P9YA 1WD3A 3O1RA 1RL3A 2VZUA 1UMZA 4PBPA 1REFA 1WCUA 1US2A 3DGTA 4UFJA 3WHTA 5KXDA 4AHWA 1XNKA 5CBLA 3VKMA 1YJKA 4HXCA 1OMIA 3OY8B 4N43C 1I5ZA 1RUI2 1U5YA 3BODA 3HJRA 1YHFA 4NHLA 4RR3A 3A0NA 4LA2A 1ND3A 1XE8A 2PHRA 3PNAA 2QQKA 5F37A 3OB8A 4IQPA 4YG0A 4Q4W2 5J7MA 1QH7A 3DPRC 5HCHA 3SMHA 3M3QA 4IXLA 4P9WA 4AEDA 3I59A 1T6BX 4K3UA 3AFGA 1G9AA 4MGYE 2G9FA 4MV2A 1ASJ3 2VZOA 1F2NA 4EZ4A 3WQ1A 3INAA 1AXYA 4QX1A 1VBA1 4KWLA 2H0VA 3WHUA 2XB6C 2R30A 3CQOA 3PVOA 3H7JA 3FZ3A 1CAVA 2JG8A 4YZ1A 3FLPA 4HPKA 4YW2A 3AXDA 1GZ9A 2XHNA 1WW7A 1DF0A 2DVAA 2F17A 1NY72 4WVMA 1CZVA 2O14A 2PN5A 2JG9A 5FPAA 3O1MA 1UAIA 3S57A 1CAVB 2JG8B 4AEKA 3BPZA 4M3CF 1B35A 5B4NA 4ZU4A 2XXZA 2Y38A 4RGGA 4D6SA 3GCXA 1RVF2 4I0WB 1ULOA 5A7SA 3T2PA 1OQDA 4I01A 4J6GA 2YBSA 1UYZA 1OLQA 4P9LA 5JOZA 1CN1A 3UKVA 2WLPA 4BIOA 2Z2SB 3GBFA 4LBNA 1JYCA 2EXKA 1AR61 1H4GA 2VD7A 3CU7A 4HKLA 4JZRA 5JAXA 1KRIA 4UW5A 4IEOA 4FPJA 4U36A 5A1LA 2ZHMA 3H8OA 4C91A 5JSRA 2VMHA 3L9JT 2JEMA 4AVTA 3WP5A 4XXPA 5HBAA 4XURA 2RM22 4COZA 1REEA 3I4IA 4XACA 4EV0A 3VV1A 3OGVA 5FQ0B 4MGTA 1XSRA 1YQ8A 3TEWA 1EAH2 2DYCA 3KSCA 1HKDA 2GMPA 4HN0A 5F5QA 2WNUA 5LRRA 3RYKA 1Y4WA 3HT2A 1LR5A 3A22A 1SEFA 3JBG1 3LKJA 5FZGA 2CYFA 1NZIA 1PX3A 1UX6A 1ZM1A 2XL7A 4ZS2A 1HRV2 5FUIA 2QDRA 2DU0A 4OUMA 3THCA 1QEXA 1NQJA 4FQZA 4TSVA 5ERLA 5F2WA 3UT0A 5JIAA 1W8OA 5FPVA 2V09A 1R083 2QFEA 2R32A 2VW1A 2D6LX 4DEVA 1E5HA 4RL7A 3ITQA 5GM0A 4EJRA 3OOXA 3PJQA 1GWKA 4XCAA 3VBUB 2EXHA 1JOJA 2HWC2 4DFSA 1C8M1 2PLV1 1VRH3 4CA9A 5JXIA 2R073 3U37A 1I9RA 3BIWE 4I0BA 3SISA 5CKQA 3ST7A 2QNKA 1W8WA 1Y9MA 2FQPA 3MIEA 3N36A 5FYCA 2ZACA 4NIIA 2Q8EA 1XC6A 2E32A 3WF3A 2RMU3 4FTSA 2ZHNA 4XF1A 4BQXA 3I3EA 2JE8A 2WNVC 1ND2B 3RZMA 1CZSA 2GMMA 5C3SA 1A78A 2WT1A 1NCRB 4IUGA 3VBRC 1VRBA 3HD8B 1COV1 1W6QA 4UOJA 4CXWA 5KHJA 3O1OA 1GMMA 3E5XA 1W8HA 2GH2A 5FZLA 3T09A 5DG2A 1OLME 5IK7A 1LRHA 3WVJA 3VBFB 3IIIA 4RQPB 4N43A 3DV8A 3BYWA 3H1WA 1RINA 2X10A 3FMGA 4CCKA 5IYYA 4N43B 3D0SA 2FDIA 2BRTA 5A6YA 5FPBA 3IMNA 3UL2A 4OUSA 3IPVB 3VZJA 3QD6A 4QHZA 1YFXA 1W9SA 3GHMA 3KV9A 4CDXC 1MPXA 4JX0A 2FCVA 4G3YC 3RDIA 1UCXA 5FY0A 3E5UA 1ZRDA 4YVWA 5LCWL 1RB8G 2A1XA 2BW8A 3POGA 4XJAA 5G04L 1HB3A 1AYN3 1LESA 1WMDA 5LWBA 1FATA 1UKRA 5FCCA 1JOBA 3KGZA 2Y0OA 4UW3A 2QVSB 1R093 4AR2A 4JTNA 4JGZA 5LZ6A 3UJOA 2ARBA 1DGWA 1CONA 5HV0A 2VU9A 4XDQA 2WDBA 5C6CA 2OPKA 4TXWA 5K0UC 2VBBA 4OHVA 5DG1A 2BU9A 4YW4A 5TSWA 3LAGA 1AX1A 4UFIA 2DBNA 2VMGA 4CP1A 5FMOS 3ZLIA 3HNYM 4CEYA 5IT6A 1C1LA 3ZXGA 2W08A 3CHXA 4M4PA 1AJOA 1QY4A 2CWMA 4S2FA 4LHKA 1CX1A 5JZGA 1W6NA 2NLRA 2Y26A 1CAXB 1DZRA 4JCKA 4Z2WA 5BXXA 5A33A 1XYNA 2O8QA 2ZGSA 4RYDA 4PQ9A 5FYMA 5F6LB 2ZA9A 4QPIA 1OH3A 4EWAA 3J7MA 3OGSA 3NQHA 4ZZ8A 3Q8AA 3VD7A 2DURA 2ZHLA 1NLSA 5CA6A 5C71A 1PM4A 2JWPA 3N7LA 4IGPA 5E1RA 1QJY1 1XNCA 1VPHA 5JXHA 3ZFGC 3RSJA 1UKGA 3JD73 2YROA 1EYBA 3IB3A 3RQ0A 3LPFA 4CCLA 2RM23 2W52A 2VZTA 1YCIA 2CGOA 3WDYA 1OBNA 3WD5A 5J3UA 5HXVA 2WZ8A 5T50A 3UYJA 3DUIA 4YWAA 1GZTA 1N3QA 1PMIA 2VZSA 4LUKA 1UW8A 3LA3A 3WUCA 4CVUA 2GNDA 1H2MA 1UY0A 4E4SA 1S1AA 4RSUA 2Z4FA 3USUA 1UOBA 2C5DA 3O14A 2BV4A 1MVQA 5FZOB 1RUE3 1CD3G 1QH6A 2YU2A 1FT9A 1SMVA 1RUF3 3PJYA 3WR0A 3VD5A 2D7FA 3TN93 1S0GA 1GQHA 4SLIA 1G6NA 3S7EA 2GNMA 1DYPA 1BCXA 3E5QA 4XUNA 1W8TA 4D0QA 2CNAA 4COVA 1VBB3 2R072 3CLPA 3FBMA 4AVAA 1HJGA 1OA3A 2X5IC 3B69A 3PUIA 1WGPA 2CDPA 1QIQA 1W9FA 4GWIA 1DQ5A 3KHBA 5ANNA 5FZMA 1AL0G 3I59B 4D8MA 2CAUA 3VB9A 2D44A 4AWDA 1RMU2 4UW4A 1CX4A 3WQ7A 1QKQA 4RHV3 3S5AA 5T3NA 3EHKA 4FPGA 5JPNB 1OFNA 4DZGA 2EIDA 4P9XA 1S0JA 1QXRA 2WR9A 4E2SA 1PZ7A 3LEKA 4LXLA 4I09A 2VM9A 2B7YA 4IE7A 1RUOA 2J22A 1S2KA 3M7AA 3TN91 4JDMA 3VBRB 4D94A 4CTEA 1PX4A 3MI8A 2J1TA 1RUE1 1K12A 4Q4Y3 1JZ3A 4NR1A 1CESA 4P9GA 3VBHB 4AI2A 2W46A 2ZGKA 4GWJA 3T2QA 2BGPA 1K45A 4Q4V3 3CZUA 4XZUG 4BU2A 3J7HA 2WLQA 4CE8A 3HWJA 1PGSA 4IE4A 1V6NA 2JXAA 3ENRA 1PVXA 3T0BA 1COV3 1GNYA 4TLGA 3K77A 5K9YA 2WNEA 4NMIA 4TN7A 4MZUA 5FZIA 5ABJC 2EXJA 5DUVA 1UF2C 3KVBA 4JGZC 3AC0A 4NUBA 3U4SA 3KV4A 4FOYA 2P3JA 3DKQA 2YUEA 3JD71 2E26A 2VE1A 2D6KA 3WNOA 1D4M2 2WO1A 1N1VA 4ZU7A 4YNIA 1ENRA 1H1IA 2DWRA 4B4RA 3OSDA 1RC6A 2QQLA 4PJYA 4XJ9A 4XUQA 5FYYA 1YIPA 2ZGRA 1ZBA1 2O1QA 4DPNA 3KLSA 1QJU1 1W39A 1LOCA 1UYXA 3VUOA 2HYKA 5FYBA 1KS5A 4RGAA 4LULA 4BISA 2E33A 1HLCA 1XE7A 2LROA 4QKFA 5I93A 3IKWA 3NKTA 1TME3 2HWD3 1TG7A 4GJYA 3POEA 2Y6HA 5C8CB 1KJRA 5GALA 5JIUA 3B9CA 4M0NA 2XLFA 5T55A 2IVIB 1IQDC 4YW7A 1AR72 3B01A 1SDWA 3ZYIB 5C8WA 4QB2A 1T2XA 4QXCA 4XHBA 4UT5A 4ASKA 3ZXJA 1W6OA 1OLMA 1W6MA 4YPJA 3WINE 1R1A3 1W6NB 2YDEA 3DYPA 3GM8A 3ILRA 1S2BA 3N9MA 3P3PA 4V2VA 1AF9A 3GJBA 5FZOA 3T0AA 4AZZA 1BQPA 5IFTA 3C7GA 1BEV1 3NSTA 3NL1A 2HWB1 2FDFA 2CTVA 1GZCA 3UV9A 5T5JA 1FOD3 1NLQA 2D6PA 1WMEA 4WVZA 3VN4A 1DIWA 3GDBA 5EXOA 2RV9A 3LE0A 5FMCA 5JR7B 2FCTA 2AZ5A 1UZZA 1H8TB 4AE2A 5DUUA 4BB3A 2NM1A 5LY1A 3SITA 4QDRA 5D21A 1VMFA 4BE3A 3LPGA 4OFGA 1PO21 2ADEA 2B9VA 1QJY2 1O4TA 4XEZA 3ALQA 4RFRB 2AACA 4CDXA 2P37A 4LHSA 2JKXA 1QXPA 3KCXA 2IZWA 2R6QA 3ZYPA 2LW8A 3UGGA 1IS3A 3MFCA 4PIZA 4OZOA 1RITA 2NYYA 5DAVA 4UXAA 5A33B 2HWB2 5EV7A 4EN7B 1WLDA 4FFIA 4FTEA 2B46X 3ZIWA 4Q4Y2 4AVVA 4YYOA 3ZSLA 3POFA 4FCAA 2YV8A 4J25A 3ETPA 3K51A 4BQ5A 2ETEA 2XJRA 3ZYFA 5FBZA 2VPVA 2OYZA 4L92A 1ASJ1 4QPIC 5A6ZA 1XJAA 2ZZQA 4LBQA 1AR92 1C28A 2CU5A 4LMFA 3C7OA 1NKGA 2ZMKA 2DFBA 2EALA 4KBBA 5LATA 4E8CA 1VBD2 4OMDA 3ZR5A 1W8ZA 3GGLA 2ORXA 5FDBA 3USSA 4GWMA 4ZU5A 2P5BA 3NMBA 2ARCA 5I0TA 3RJRA 3UGHA 4LKEA 2RDQA 1RUD3 1AL22 2GC0A 3CMGA 3OPWA 4L2NA 4NAOA 3KZ4C 2ZGMA 5A7OA 4IEZA 4PDWA 3TNQA 3WG2A 1QJX3 3I7DA 2D5FA 3CKHA 1APNA
chains in the Genus database with same CATH topology
4M00A 1KS4A 1S0BA 1C5IA 4MGIE 4XPVA 4BA6A 2HWE2 2IXCA 1DDLA 3R05A 5A32B 2BPA2 2RR11 1AYM2 1SQ4A 1D2SA 3EQEA 2IXLA 3VBOA 5J36A 1Q43A 4WM8C 4BM8A 3L2YA 3TYJA 4JRLA 4IESA 1OSGA 4S2DA 3JBG2 1OKQA 1VB2A 4FPLA 2DF7A 2OUHA 3VZLA 1WW5A 1CAWA 4KQ7A 4META 1QOTA 4P5HA 5HCFA 2X5IB 3R4DB 2IXJA 1LGNA 4BLJA 4Y24A 1OOPA 1V6MA 2RE9A 4R9AA 2JKBA 3U07A 1GZWB 2A6ZA 4K1YA 3D82A 3MEPA 1DGLA 3AKQA 1G9DA 5FOBB 2C0ZA 2ZX3A 2JX9A 3IWZA 2XL9A 3IT8A 4CDQC 1NXD1 2X29A 4H7LA 2CWSA 2BFUL 1OPMA 3M8LA 5GJ6A 3MF6A 5KHKA 3LB9A 4K21A 4IEQA 4NWVA 4Y1YA 3MYXA 1ALYA 4QX5A 3AZYA 2FMYA 4K20A 4OI1A 3IIAA 4AEJA 3IN9A 1BZWA 1MS3A 5H9PA 1RUG2 1FOD1 2RS32 5ABJB 2QE3A 3FHIB 1I1EA 4Y1VA 3H8UA 1FOD2 2RS31 2WA4A 3WP6A 4DB5A 4MX3A 3AYDA 2XLGA 5GLWA 2PA7A 1LODA 1FNZA 1G9FA 1HRI3 4AFBA 4WVWA 3USUB 1NA1C 5JOWA 2O8OA 4I0AA 4COWA 4WM7A 1A6CA 4IEVA 3VZMA 4B7KA 4EROA 1ZX5A 1MS0A 5BUVA 5IK5A 2ZMNA 1BXHA 2BUKA 3ZXFA 3WQ0A 1M06G 2I74A 3B94A 3UKNA 4JDOA 5A3MA 1V6JA 4HN1A 3AZVA 2E63A 4OULA 2UWAA 3TAYA 3ZYJB 3LOBA 4G9SB 4Z92B 4CRQA 1IS6A 1RUD1 2RS12 4GH4A 5J96B 1MR5A 4IV3A 2DVFA 1QJX2 4OHWA 2VUJA 4HVOA 1ZBA3 3E97A 1G8WA 1QQP3 1HXS2 4XTMA 1QNWA 3U11A 1EV13 3P3NA 1JYIA 1W0PA 3MLKA 4HPKB 4QPYA 4XJUA 4L97A 4QGLA 3N4MA 1N1YA 1VBD3 1MQTB 2ZGNA 4BMBA 3BOWA 3CJIC 1X8EA 1FAYA 2OIIA 5AFBA 1H2LA 4LBKA 5IUQA 1V9U3 3ETQA 2NMOA 3MDPA 4GWNA 4AHXA 5BNNA 3V0AB 3AP7A 4MLOA 4Q4W1 5KWRA 1O3QA 3H7YA 5J48A 4BHPA 1IS5A 3M1HA 1YO8A 4WBBA 5KXCA 2UWBA 1PO23 2P34A 3PMSA 3VLBB 4D7YA 1D0HA 1O3RA 4HK8A 2HWF2 3AZZA 1VB4A 2R062 1O3SA 4ATEA 1UPIA 4AQSA 3AKSA 2X5IA 3KT1A 4HVRA 4FT8A 4YVWB 2WQ4A 4PDWC 2DUQA 3NV4A 4PLNA 1YFYA 5D8AC 4LBMA 3M4FA 4LBQB 5FO7B 3MIGA 1BEV3 4ZKTB 2R0FA 2WQZC 3VBFA 5J09A 1AYM1 1RUG3 4QPGA 3AB0A 3ZSKA 1KXGA 1MQTC 2A3YA 4HANA 1FV3A 1H2KA 4AI0A 4HL0A 1G86A 1RMU1 1ULCA 1CPNA 2ZX0A 3WLUA 3LOIA 5AC91 2AYHA 2VG9A 2WT0A 4CDUA 4FOWA 2ZX1A 3AZWA 2ZGTA 4IEYA 3EJKA 5CG9A 3FBYA 4N53B 4YW5A 3ZFFA 3ECQA 4Z82A 2WS93 1ULFA 2XJVA 4AVCA 4SBVA 1YFWA 3WDXA 3WG1A 4FAGA 4Y4YA 2RS13 4RD7A 4QXKA 3ZN6A 3PHMA 4DS0A 3QBQA 5BNQA 2X53S 2HEWF 4CP2A 1GYKA 1W6OB 1DYKA 2VQ0A 3N7MA 3V64A 1PGW1 4YGDA 1PGL1 3ZXLA 1JH5A 2Z5WA 3ZXDA 4CDWA 4AF9A 1J58A 1EAH1 3J8F1 4PIXA 1ULGA 2EXIA 4AFCA 3SLIA 2E7AA 4GH4C 4BIFA 1X50A 4R4XA 2WFF3 4CEWB 4N90A 4FPCA 4GB33 1V9U2 2PHLA 4Q4X3 4OHZA 4PLMA 5AVAA 5J37A 2Z69A 4Q0VA 4D69A 4RHV1 1LULA 1VRH2 1QDOA 4ZXKA 1HXS3 1BBT3 2H6BA 4KGQA 5I8TA 4UBGA 5GZGA 5SV5A 2B42B 3OJBA 3T2TA 4ES9A 1NQDA 1SFNA 2XBO2 2ZAHA 3O12A 1X33A 1Y43B 3MIFA 1CAXA 1H2NA 2HWD2 4YGBA 4C90A 1YFUA 3ZX7A 3OPZA 5BNNC 2GC2A 3DKWA 5EYXA 3LGRA 1URXA 3R4SA 4N53C 1Z7S1 2GNBA 5CFDC 3ZFFB 3RG0A 4YW3A 2YZ4A 1PIV1 1I3HA 4E4DX 3D0JA 1Q8OA 1K5MC 1BKZA 1RUJ3 4QQPA 4H3WA 4LBJA 1Q5OA 3FLTA 4AEDB 3O5SA 4I30A 1EPZA 2GN7A 1QOSA 3R4UA 3AM2A 5T5OA 5D8AA 1XQNA 3AXEA 1BVVA 1LHUA 4YVSB 3S0MA 4O9EA 1VIWB 2WFF2 5F1RA 4N9HA 3VHNA 5KXBA 1UU5A 5CVRA 4Q4X2 2VULA 1LB2A 3OTFA 3SCGA 4QU2A 4L9BA 4M3CA 1AR81 2ENRA 3B5LB 4AI1A 1HV0A 1W0OA 2A7AA 3NWKA 5CG8A 2CAVA 2JG8C 1NCQC 3I2DA 4U2AA 2XJQA 2DCKA 4QD2A 5K8SA 3CJIA 3I8TA 2D40A 5CAZA 2Z79A 1LJ7A 3EO6A 3JBG3 1IS4A 2N7GA 1MEC2 4IV1C 5FFOC 1OQEA 3W58A 2WFF1 1SLCA 1FPN2 1VLNA 4Q0PA 4YVSA 5AFEA 1MVEA 1O4ZA 1DBNA 3DN7A 2B39A 1EAH3 4XOGA 5L19A 3WP3A 2D5HA 2H6CA 2ZGLA 5JI9A 4DQAA 1HDKA 1ONAA 3NAPA 4XYXA 2BVBA 2Y0IA 4XTPA 3VKNA 4GMP3 4AGGA 4CDWC 5LEJA 1RJ7A 4HFSA 4NPRA 5KHHA 2A6WA 2Q0AA 3N7JA 4XFGA 3TOJA 3WP4A 3IM0A 2DCTA 3BU7A 3GYDA 4OHYA 5ABJC 1NA1A 1XU1A 3O7OA 1D0GA 2XHKA 3PLQA 1FNYA 3FX3A 4Q1PA 2XJSA 5GZEA 4IV3B 2SLIA 4F7ZA 1UIJA 3MLLA 3QCWA 5CB7A 5FO9B 1RUJ1 4M0HA 5ACA1 2A5ZA 3M3IA 4J1WA 3KGLA 3BB6A 1Z7S3 3PVNA 4JGYC 5I0SA 3HAGA 4PF5A 4K6BA 4Q0QA 2OZ6A 4N7UA 3MPBA 1NOVA 3AJZA 3CO2A 2E51A 4HLTA 3JZVA 1IKQA 2C9AA 1DQ4A 1LOFA 4GA9A 1RJ8A 4CP0A 5DZFA 1HXS1 1K5MA 4X8NA 3OYWA 4EWDA 2CGNA 5JZGB 1AJKA 4FXGB 3MZHA 1ZZBA 3TBDA 2K9ZA 4GB31 4CDQB 3FJSA 5JMCA 4M01A 4XIKA 4YFWA 1D4VB 3DF0A 3H50A 4N53A 1IPJA 5JDBA 1ZNPA 1E57A 4LHLA 1C4RA 1MS8A 3GZUC 2YPJA 1LKNA 1FPN1 1MEC3 2WNVA 4KG8A 4AFAA 3AP4A 1N47A 4DMIA 2A6VA 2JD4A 2XWJB 2DCZA 2XLAA 1Q56A 1OA4A 1C8M2 3FUOA 4AGVA 3B00A 2ERFA 4URTA 1JHNA 2TEPA 2MEV3 2LM3A 4TLFA 4RR3C 2B5HA 3LSEA 2DFCA 1TNFA 4MXWA 4Y1XA 1ND3C 2R063 2ZJCA 5T5LA 2WS91 4XJZA 3WY6A 1PNGA 1O5UA 1M4WA 5GZCA 1PO12 2P2KA 1AR82 2WSVA 1RUH3 2ZTNA 3AKTA 4MH0E 3VBOB 2BNOA 1SLBA 2V73A 4ISRA 4OZXA 4XETA 1FXZA 2EA7A 4DINB 1BK1A 3B3QE 5AC93 3OD4A 2E7QA 4KGGA 1RMU3 1Y9QA 2UU8A 3RI8A 1COV2 4JTOA 1H30A 3IDCB 4BWOA 4W6WA 1XU2A 3KD4A 4GXLA 5GKAC 2HWF1 1FMD2 4NN0A 1FMD1 3ZXEA 3NV3A 5EYYA 4JDNA 4E2QA 2PLV2 3GBWA 2HWC3 1VBC1 2HWC1 1VBC3 3BOPA 2R1DA 1LENA 2QUOA 3DL3A 3WDVA 1O7FA 2ET1A 2JECA 2BWCA 1RTVA 2HWF3 4P9JA 1HQNA 1MZEA 5K7PA 1QF3A 1ZREA 1HRV1 4A7YA 2W0XA 3EBRA 4C0HA 4CDUC 1RHI3 1F9KA 3CF6E 3M2MA 1KFXL 2MEV2 3WX5A 1AR73 4Y1ZA 1H9WA 2NZ9A 5C33A 4YLZA 5FAXA 3SCFA 3K48A 2UYAA 2IFRA 3SH5A 2UWCA 3ZFFC 4YSFA 1RGSA 2OZJA 2VVEA 1ND2C 5EFUA 1UD1A 5GLZA 1PHMA 1UPSA 4PDWB 2Q1MA 1VAKA 5IK8A 2YGMA 1ZZCA 1ZBE2 4GIQA 3BCWA 2K0GA 1YLLA 4HVQA 2IFWA 3WW2A 5T5PA 2UURA 2D98A 1ZRFA 2XJUA 5I0UA 2ZZJA 1VBD1 5F9TA 3V0BA 4AHZA 2JE9A 2ZCWA 3GZTB 1Q8PA 1AR91 3M70A 3POYA 4Q1RA 1WCSA 4FXKB 4LNVA 1Q3EA 1QQP1 1ZZ8A 2W39A 3WDUA 1JBCA 2JICA 4YVSC 1VALA 4FP3A 3HMYA 2AUYA 2HEVF 4AVBA 1AR71 4EN8B 3SH3A 4CDXB 1SCSA 3ASIA 4QMAA 4Z8BA 3FWEA 2A70A 3KB5A 3WXPA 1OFSA 3AP6A 4ISQA 4XBNA 1ND3B 3WUDA 4RA0A 4RR3B 4X6QB 4AQ6A 4PLOA 2WC2A 4CEYC 3KCYA 4WM8A 1IOAA 1AZDA 1FMD3 3VGIA 3I54A 4XILA 1OOPB 4Y1UA 5L7OA 1R092 2AGSA 5JPMB 1REDA 3D4KA 1NA1B 3L2HA 3ZMOA 5EZWA 3MW4A 1W6MB 4EN0A 4JVAA 4XZPA 5BNPA 2A75A 1XNBA 1O4YA 4LA3A 3OF1A 3ELNA 2VOWA 5KXEA 3CL1A 3VL9A 5CFCC 5I8YA 4FVVA 3ZVXA 3O0XA 3NAPB 4K40A 2D3PA 3UK9A 1DFQA 5E16A 3VZNA 1GR3A 2ZGPA 2WZR2 4QGMA 1U5IA 3W59A 1X7NA 1TMF3 1Q8VA 4J1XA 4GMP1 1DQ2A 1XXNA 1WLWA 1F5JA 1VBB2 4XF3A 3V0AA 1BYHA 2XBO3 1D4M1 3C3VA 3KCCA 1WW6A 1SLLA 2HWB3 3JD72 4P14A 1ZYBA 2D43A 1AXKA 2XJTA 4FO9A 1PIV2 3QH6A 1FV2A 3MIHA 1BJQA 3WDTA 3U4XA 4N7IA 2NP0A 5BNPB 2AENA 4HBNA 3ZO0B 2D97A 4XW3A 3RI9A 1VBE2 4OI2A 2EIGA 4D7SA 1FI2A 2ARXA 1QJX1 2D3SA 4HSLA 5L73A 2HWD1 1TME1 5L7OB 3JQXA 1AL23 1PK6C 3Q9OA 4LBQD 2ZMLA 3PMEA 1OHFA 2GALA 1GV9A 2GAUA 5SV8A 4NWWA 4PBOA 1S55A 4DXZA 2I45A 1GNZA 1WLCA 1UL9A 1V6OA 1YXWA 2GC1A 2R042 4DOUA 1B09A 3ZFGB 4A3XA 2XG3A 1POV1 4G4FA 4NOTA 1ZBE1 2DCJA 3AMNA 1UU4A 1WUVA 5GZDA 4YGCA 2VW2A 3J26N 4K8FA 3IDBB 3TRSB 1LOFC 4B3NA 2W68A 1W6PB 1EY2A 5BPXA 4XJWA 4CYDA 1SFYA 2FMDA 5C9AA 3QH7A 4I2OA 2WT2A 4FOQA 3NV1A 1O5LA 4QM9A 3VBOC 3ZPYA 4XQWA 4ES8A 4XIOA 3M3CA 4AFDA 3M3OA 3KT4A 1ZZ9A 1VBE3 2B9UA 2VECA 2QCSB 4QQHA 3TWIA 4FTBA 4FPKA 3RYPA 1NCRC 5CFCB 5AVPA 2ZS6B 1YWKA 3ROUA 1YJLA 1NZCA 3ZXAC 4NHMA 1BBT1 1VBB1 3N3HA 3VKFC 4FSJA 2Q8OA 1PGW2 2BFUS 1PGL2 4O9GA 4HMZA 3X29B 1LEMA 2R16A 4COYA 1SBFA 3DPRB 2OUJA 1QMJA 2ZKNA 2EAAA 1AX2A 3VKLA 4K9SA 2ZX4A 3LWCA 1YYNA 1W6QB 3HBZA 1QJU3 5BNPC 2Q1ZB 3U10A 5LK7B 2XJPA 3BALA 2RS53 2JG9C 4XFHA 1X36A 4KWKA 4MUVA 1DQ0A 1RUC1 5DDJ3 5DUWA 3WV6A 1Y7BA 5E8AA 4WM8B 4KG0A 3SXWA 3B93A 3VBUC 3AMPA 1PZ9A 2E7TA 4TWTA 4AYUA 1N3OA 2XH6A 3VZKA 5DZGA 4AHYA 2A6YA 4MGZE 1EV12 2NQYA 3NKGA 1Z78A 3H1YA 4XMIA 1GLHA 2H0BA 4BCUA 3IPVA 1LOGA 1R1A2 2KM2A 4HT1T 4Q4V1 1MACA 4LT5A 2F4PA 3H0OA 2MHFA 4IV3C 2AREA 4YRDA 4Q4Y1 1JW6A 1AHSA 1KITA 2WS92 3GZAA 2JDZA 2CY6A 2GZWA 4GKXA 1U5XA 4RS5C 1CGPA 5JLVA 2CV6A 4AVSA 1R091 1OA2A 1AUYA 1NG0A 1PO22 1VP6A 3TNPB 2AH2A 2BNNA 1H0BA 4YZ4A 1JXNA 2VGDA 3OBRA 3RJ2X 1UZYA 3POWA 4XQ4A 1AR62 1F31A 2WL1A 2PQQA 1WBFA 3AYEA 2PTMA 2GN3A 2WSUA 1GQGA 5DDJ2 4JV4A 4BMEA 1CR7A 2E6VA 4CDQA 1BMV1 4GB32 4QGNA 1BEV2 2OW4A 2DU1A 4XFBA 2KXLA 2P3KA 3NVCA 4B4QA 1Z0HA 1B35B 5HI0A 2WNUC 2EVXA 3AX4A 3C2UA 3SCHA 4ORFA 1H8TC 3ME2A 3URFA 3V65A 4XFCA 1KJLA 1JUHA 3ZFEA 2B8MA 1QNYA 1AXZA 1LOEA 1LEDA 2E9QA 1KFUL 3KS7A 1WCKA 3D6EA 3H3UA 2FHRA 1PK6A 1L3JA 2P17A 1IKPA 1KQRA 4Y26A 4KU8A 1VBA2 2RM21 3ES4A 4LTAA 2TUNA 2RS11 4GH4B 1RHI2 3CNAA 3N35A 4FPHA 4L11A 4CEYB 4DNYA 2VMIA 5DDJ1 1EV11 2VQAA 3AMMA 2ZX2A 3ZDSA 4R4ZA 3MIDA 1VBC2 5H9QA 1G9CA 2QKDA 1H1AA 5ACA2 5L36A 2G9GA 4Z07A 4AGRA 5BV6A 4MGKE 1MS1A 4WM7B 3D8CA 3AK0A 1A8MA 3AP9A 4ONUA 3A4UA 4TYSA 4E4ZA 3MF9A 1DU3D 4HZFA 4JGYB 1S0DA 3J4UH 1SCRA 5JSOA 3AYAA 4Q2FA 1RUG1 3VHPA 1EPWA 1SLAA 2UY8A 4LE3A 3WW1A 4E27A 4H55A 3DPRA 3FFQA 5F6KA 3U0ZA 2WKKA 2ZBJA 4Q4V2 1RUE2 2YY1A 2RR12 2JE7A 5A32A 4XF4A 2GDFA 1VAVA 5H9RA 4LO5B 3WG3A 4QM8A 2BNMA 1NCRA 1XYPA 1I6XA 1TMF1 4Y22B 1NLRA 2XVGA 3ILFA 3WW4A 3IBMA 5DZEA 1TQ5A 4XQDA 2V5YA 1RUI3 1W2UA 2PHWA 5K0UA 2E53A 4AFMA 3AZXA 5GLUA 1S0FA 5BNOB 3VBUA 4Q4W3 1Z7S2 4XE9A 1GANA 2R49A 4IETA 3ZXKA 1ASJ2 3ZMNA 4A2UA 1N1TA 1SACA 4LHNA 2F6BA 1ZZ6A 4IERA 1YNAA 3S7IA 4IV1B 4QQLA 1F5FA 3AYCA 4LR4A 4R8HA 4WZCA 3VBSA 1ZBE3 3VL8A 2PHFA 4RS5B 4HKOA 2GSYA 4JGYA 3MLJA 4R9BA 4JC1A 1VRH1 1DZTA 4YM2A 3TB0A 1Q8SA 3RWNA 3MICA 4XF0A 3CEWA 1NYWA 2DVGA 2YYOA 1R081 4RFT0 5DUXA 1AL21 1KDMA 3RZZA 4YM1A 3T1LA 1LHOA 3MW3A 2R041 2ZHKA 4I02A 4C1XA 4D7TA 1MS9A 4QQ2A 3J8F2 4OLLA 2R043 5HCBA 4CDWB 4YFZA 5JOYA 1CQ9A 1PM7A 2R0HA 3VBHC 1RVF1 2ZOEB 4NHKA 3VBFC 1HRI2 4JRAA 4OVEA 1HRI1 3G6JB 2ZPXA 4IEWA 3ZN6B 4KNCA 4XFIA 3JCIA 4Q0SA 5FLHA 1F8VA 2QDNA 1D4M3 3A0KA 2XBO1 4HKWA 4YG6A 3ZFEB 1LTEA 3OCPA 3LA7A 1AR63 5CIRA 3PVBB 1MS5A 4DY3A 2FBEA 3UKTA 1AVBA 4YZ2A 5KHGA 4FPOB 3FLRA 3FE5A 1R082 4XBQA 2LALA 4ASLA 5AC92 3ZFGA 1ZBA2 5I8SA 1CJDA 1RUI1 1TE1B 4I3PA 3ZSEA 5KBFA 2RHPA 3VBSB 2ZKLA 1IHMA 1ZA4A 2A6XA 4KWJA 1AX0A 5FREA 1LU2A 3NAPC 2VH9A 1LECA 3D5OA 4FP2A 4MYEA 4OI4A 2PHXA 4XHXA 1FYUA 3CJXA 1MZ6A 1OLRA 2HJIA 3QACA 2WWSA 1IPKA 2YXSA 1LHNA 4AI3A 5C8CC 4M3CB 2BGCA 1LU1A 3FFZA 5D1IA 1H1MA 5JSPA 1QXJA 4INDA 1R1A1 4C1WA 4GULA 1S0IA 2QZ2A 1LHVA 4Y22A 2XVKA 4XBLA 1QJU2 1ULEA 3ZFEC 1JN2P 5J98B 2ES3A 1QOOA 4YW1A 4S2GA 5EWSA 2PFWA 5BNNB 1OI6A 4MXVA 1ENXA 4EWEA 4Q8LA 5LEKA 4ITCA 2YHJA 2XKOA 4IEUA 2EAKA 2VUAA 1WBLA 4B29A 5C4WB 4LEJA 2BWAA 2QJVA 4YM0A 3KT7A 1R1ZA 1ZRRA 1J3PA 3RRDA 1AR93 4L99A 5BY5A 3M3EA 4S2HA 2WNUB 4AEMA 2Q5TA 2VNOA 1XYOA 3MFAA 3WDWA 1QHDA 5FQ0A 3ZIXA 4LBOA 3WW3A 1NE6A 4AW7A 2A3XA 1G9BA 1U5ZA 4LO6B 1BVP1 5JI7A 2BYVE 3TN92 1IGOA 1SLTA 4LE4A 3WG4A 4B4PA 2DUOA 5D8AB 1DQ6A 1VR3A 4R9CA 4HETA 4D3WA 1D2QA