4L11A

Structure of the c-linker/cnbhd of agerg channels
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
198
structure length
198
Chain Sequence
TARYHTQMLRVREFIRFHQIPNPLRQRLEEYFQHAWTYTNGIDMNSVLKGFPECLQADICLHLNRNLLNNCSAFEAASPGCLRALSLKFKTTHAPPGDILVHKGDVLTYLYFIARGSIEILKDDVVMAILGKDDIFGENPCIHSTLGKSNSNVKALTYCDLHKIHRDDLLDVLDLFPEFYDSFVNSLEITYNMRDEEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords AGAP007709-PA
publication title Structure of the C-terminal region of an ERG channel and functional implications.
pubmed doi rcsb
source organism Anopheles gambiae
molecule tags Metal transport
total genus 48
structure length 198
sequence length 198
ec nomenclature
pdb deposition date 2013-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4l11A02
3ROUA 4HLTA 3FHIB 1ZZ7A 2FQPA 5JSRA 5I0RA 1Q43A 4L2NA 1CGPA 4QMAA 2BNMA 3HIFA 4QGNA 5J48A 3FE5A 3I54A 2PQQA 2ET1A 3EBRA 1O3RA 2QJVA 5LEKA 3TNQA 4R52A 4ONUA 4HVQA 4MV2A 3NW4A 5FLHA 4LA3A 1ZZ8A 4Q0SA 1Q3EA 3BU7A 4LLOA 5I8YA 1CAVB 3IDCB 4MGYE 2Q1ZB 2UYBA 5AVPA 2GC3A 3PVBB 3M3IA 4HSLA 2D40A 1Y9QA 3HT2A 2GU9A 1LRHA 3DN7A 3E5UA 4XFIA 2ET7A 2Q4SA 5KHKA 3QACA 1J58A 4I02A 2QVSB 1OI6A 4A2UA 3TNPB 1ZRCA 2UYAA 3E6BA 1UIKA 3CEWA 2O8QA 2OYZA 1VP6A 1ZX5A 3UKVA 1HW5A 3MZHA 1O5LA 2QDRA 4X6QB 1CAUB 3LA3A 4Q0QA 5LEJA 2XKPA 1LB2A 3OGJA 4QX5A 4F7ZA 5K8SA 3D82A 2CAUA 4AVBA 3GYDA 2OZ6A 3I59A 3PNAA 5I8SA 1SQ4A 4EWAA 3H1MA 3ETQA 3IIAA 2UY9A 1GQGA 1RUNA 4EV0A 1O3TA 4IEXA 2XLAA 2DCTA 4AQ2A 4XF0A 4P9GA 3MPBA 5FDBA 4HBNA 5C8WA 5FQ0A 4XFGA 1YFUA 4E2SA 3H1YA 4XF9A 4FAHA 3UKTA 2BYVE 2MPFA 1DGRA 1OMIA 4I0BA 3UKNA 1DGWA 1OFNA 1QXRA 2B5HA 1RTVA 4EWEA 2XGXA 1PMIA 3KGZA 3CO2A 1G6NA 3RNSA 1Y3TA 4I09A 1WLTA 1J3QA 4MUVA 5I0UA 3EJKA 4I2OA 4JVAA 3BALA 3C3VA 4QM9A 1L3JA 4LTAA 1X8EA 1I5ZA 1YFWA 3I7DA 1I6XA 5EFUA 4Q0VA 4HVOA 3SCFA 3OCPA 5F1RA 2GC1A 2VPVA 2HKXA 1O3SA 4IESA 4EWDA 3MYXA 4YRDA 3CF6E 4XFAA 2EA7A 1FI2A 2N7GA 2PA7A 2GAUA 1ZZ9A 3RZZA 4YYOA 4KWKA 3ELNA 2BEOA 4LUKA 3FZ3A 4IEYA 3H3UA 1V70A 3LOIA 2Z2SB 3EQEA 1CX4A 3EHKA 1UW8A 4KWJA 3ACLA 4IEZA 4X6RB 5T3NA 1J1LA 4ZU7A 4J1XA 1DZRA 1NE6A 2IXLA 2MHFA 4FT8A 3S7EA 4K8FA 5KHGA 3NJZA 5E16A 1GQHA 3LWCA 1QWRA 2IXHA 3RDIA 3IBMA 2D5FA 2IXJA 3DKWA 3R6SA 4Q0PA 4QM8A 1WGPA 5CU1A 4B29A 3WW1A 3KSCA 3RPQA 1LKNA 2EVXA 2BGCA 4YSFA 2V09A 4JTOA 4QXKA 2PHDA 1QY4A 2PAMA 3LZZA 5D1IA 5EZWA 3RYPA 4EROA 4H7LA 3JZVA 3SCHA 3CL1A 2VECA 2Q0AA 5KHIA 1NYWA 2PAKA 3DV8A 4YNIA 2OA2A 2H0VA 1H1MA 3I59B 5BV6A 2CGPA 1ZRDA 1FT9A 4D7TA 5HI0A 5KBFA 4PJYA 5J7MA 5I93A 3ST7A 2MNGA 1VR3A 3KMHA 5FLIA 1H1IA 1RC6A 2XHKA 3USSA 5J3UA 2BNNA 2CV6A 2P17A 3D0JA 4AXOA 4OLLA 3EO6A 4XFHA 1ZZBA 5JAXA 3H7JA 4XEZA 3WW3A 4WVZA 4GULA 2H6CA 4DINB 3ES1A 1J3PA 5JCTA 3QOPA 4LULA 4O9EA 4KU7A 1JUHA 1O5UA 2Q30A 3CJXA 4KU8A 1UCXA 3E6DA 3H1WA 3NVCA 5JSOA 3U11A 4NVPA 2OZJA 2EAAA 1QXJA 4UXAA 1YFXA 1YFYA 2HJIA 1UIJA 3NKTA 4MGZE 4MGKE 1RUOA 2XKOA 2B8MA 3S0MA 2CAVA 2IC1A 2GH2A 1LR5A 5FCCA 4AQ6A 5BPXA 1ZREA 4IEQA 2GZWA 1NXMA 1ZRFA 4N9IA 4IEOA 4XF3A 2KXLA 1RGSA 3LA7A 1XE7A 3MDPA 1Q5OA 3E5XA 4HN1A 1CAXA 1NZCA 1XE8A 2QNKA 4J1WA 2Y0OA 4HVRA 4PIZA 5LRSA 2ZKLA 4HSJA 2K9ZA 3OD0A 2PAEA 4I0AA 3RYKA 1SFNA 3HT1A 4XFFA 1YWKA 2D5HA 3IWZA 1IPJA 1EY2A 1ZRRA 2Z69A 4E2GA 4FBFA 4IEVA 1O7FA 3OF1A 2XLFA 4UBHA 4WZCA 3U10A 4R8HA 3D0SA 1ZZCA 2ETEA 1X82A 3GBFA 4FAGA 1U12A 1YUDA 4D7SA 2XLGA 4BYYA 1CAWA 4YARA 3G7DA 1FXZA 5BXXA 1VJ2A 1X7NA 4O9GA 2OPKA 4PIYA 2XL9A 3O14A 4I3PA 4Z82A 3SXWA 3H7YA 5FPXA 4WBBA 1ZNPA 4UBGA 4PIXA 4Q0UA 2ZCWA 3BCWA 3FWEA 3BB6A 1RL3A 3OTFA 4MX3A 5LRRA 5I0SA 2I45A 5CVRA 4ORFA 3ES4A 5I8TA 1EPZA 4IEUA 2QCSB 3L2HA 1EP0A 1IPKA 1O4TA 2F4PA 1J3RA 1UD1A 3LA2A 5E1RA 3SHRA 3BPZA 4KWLA 1OD5A 4IEPA 2K0GA 3E5QA 1CAVA 4XF4A 3H9AA 5FQ0B 3FX3A 3PLQA 4MGIE 4N9HA 4AVCA 3DL3A 2BNOA 3SMHA 2PTMA 1PM7A 2GC0A 2IXKA 4HN0A 4TLFA 2UY8A 5KHHA 2D93A 4BIFA 4L11A 5CADA 3M70A 1ZVFA 3KGLA 4JTNA 4BHPA 2IXIA 2ATFA 3B02A 4OFGA 1WA4A 1SEFA 4LEJA 1XRUA 4META 5I0TA 3E97A 3N4MA 5FPZA 5KHJA 1UPIA 3ZDSA 5C6CA 1O3QA 1J59A 4E2QA 1NE4A 3FJSA 1YLLA 1CAUA 2E9QA 3S7IA 2PFWA 2C0ZA 2XL7A 3SCGA 1CAXB 4IERA 4RD7A 5I91A 2WC2A 3HQXA 4QGMA 4LUMA 2GC2A 2FMYA 4MH0E 2H6BA 4ZU4A 5JR7B 5BUVA 3WW4A 2PYTA 3U0ZA 5FLJA 4Q29A 3CLPA 3NSTA 4XFBA 4KL1A 3IDBB 5JSPA 3FFQA 4AVAA 4XF1A 4ZU5A 4XETA 4IEWA 3KCCA 3H50A 4LA2A 3NL1A 2VQAA 4JV4A 3RYRA 1EYBA 3VHRA 4F8AA 4HZFA 4IETA 3E6CC 5BY5A 1YHFA 4QGLA 3H3ZA 3H8UA 2PHLA 4Z07A 1CAWB 1ZZ6A 2O1QA 4CYDA 3LAGA 4BH9A 4MZUA 1DZTA 1TQ5A 3WW2A 2WFPA 2B9UA 1X8MA 2IXCA 4I01A 4HMZA 4XFCA
chains in the Genus database with same CATH superfamily
2G4IA 3NQHA 2OUHA 4LBKA 4BB3A 5FXWA 2VTXA 4QB2A 2SBAA 4R9BA 2BNMA 1F8VA 2ZXQA 1D7PM 4GH4C 2XONA 1ZYBA 4CEWA 1M4WA 2ZX2A 2Q8DA 4DUWA 3KLSA 5KXDA 3N9MA 4IDZA 1VRH2 1HB4A 2AACA 3JB8A 4HVQA 5HBAA 4I30A 3K75B 4UW3A 3J7HA 4E27A 3A4UA 4EN0A 3BTXA 2BERA 3I2DA 2WN3A 2HWB1 4OMCA 1M06G 2Y6GA 1D4M1 2YMZA 4JZRA 3KT4A 5FYZA 1VRH3 3DKQA 5FZDA 5GZDA 4DB5A 3ZKYA 5AC91 2UYBA 4NWWA 1BEV1 5JXGA 3VBFA 1UAIA 3U78A 1NLSA 4P9XA 5EQUA 4TYSA 1CN1A 4E9KA 4IE0A 2DF7A 4AHWA 2ILMA 3OEBA 2XR4A 3PTYA 1JU4A 2WNVA 3Q8EA 4UFMA 3HT2A 1PX4A 1UX6A 3DN7A 2JICA 5GZEA 2JIJA 1EUUA 5HCBA 2UU8A 5HV4A 1MEC3 2ET7A 4QXHA 1TMF1 4KG8A 2VZVA 1PGW1 2OS2A 2WS93 3HWJA 2GNMA 1RUH1 3OGGA 4FPKA 4I02A 3N3HA 5FY7A 1E57A 4OZOA 3GHMA 3OOXA 1QJEA 2UYAA 3I8TA 4GWIA 4TLGA 4YFZA 2DVGA 3B3QE 5C4WA 3WXPA 4XBLA 5FP8A 5FZFA 1HW5A 4BE3A 3MZHA 3LA3A 4K40A 2WO1A 1AR61 5FUIA 2YZ4A 1QH7A 1BXHA 1CESA 1W9FA 2P3YA 1AL21 2YYOA 3ILRA 4Q4X1 3NNJA 4QX5A 4QX0A 3BN6A 3R4UA 2JDZA 5K8SA 2ZEZA 1GZTA 5AFEA 3GYDA 3C8XA 5FRAA 4AI3A 3PNAA 4C0BA 2VMGA 3GJAA 3KV6A 4EYUA 2XWBB 2XUEA 1JYCA 3ETQA 1GQGA 1N3OA 3HAGA 3IMMA 5H9QA 3V0BA 1O3TA 4K8RB 1GP6A 2VE1A 3BVCA 2YUEA 3JBG3 2BTVC 1QQP2 4CA9A 4CZSA 4QKFA 4I3GA 4CDXC 1NG0A 3MHZA 1W6QB 4Q4Y2 3MPBA 5FBJA 2E33A 4MADA 3OPWA 3POBA 1FV2A 2XHNA 1YFUA 2X05A 4NPRA 4E2SA 3LD8A 1GSLA 2BYVE 4YW5A 2ZX1A 5JIAA 1OMIA 2HH9A 4I0BA 4S2DA 1W6NA 5LZ6A 3BKZA 3KF3A 4YGEA 1XSRA 2R0HA 2WZEA 1G9FA 2Q8CA 4AFCA 1IS3A 5AFBA 4I0WB 4Q4Y3 1C1LA 4LBMA 1UY0A 2B5HA 1NCRB 4WVMA 1BQPA 4EWEA 1GFF2 3MW4A 3LIGA 1PMIA 3CO2A 2Y26A 4GALA 3PIJA 4Z1VA 1EUTA 4BPZA 1CIYA 1Y3TA 1LOFC 4JKLA 5A1FA 4XHBA 1UPSA 1OQDA 1WCKA 2AENA 3C3VA 2AC1A 4QHZA 2WWUA 4FTSA 4OQ9A 4YVSB 1HB2A 1I5ZA 1YFWA 4LBQA 2RDQA 2D6NA 4M0NA 3WVJA 3VL9A 2G1MA 2YG0A 1YJLA 1VBA1 2JXAA 4XBQA 4YM0A 2IFRA 1BCXA 1S1AA 3C7EA 3SCFA 1RUC1 4D3WA 2RM21 4RS5B 4UFKA 3MIFA 5EYXA 1FMD1 3WDXA 2DU0A 3AYAA 3NNMA 4AQSA 4IESA 5FO8B 5JZGC 3MYXA 4Q4W2 4YRDA 1KEXA 2YXSA 1H6XA 2WDBA 4RYDA 3PUIA 1H0BA 2NMOA 5FY1A 4XFAA 2JKBA 2DURA 1HLCA 2WQ8A 1FI2A 5FO9B 2LRPA 2GAUA 1ODMA 1SFYA 1ZZ9A 4XUNA 3DYMA 4YYOA 2AREA 2WAAA 1RIRA 4Q4W3 3ZYGA 4CU6A 2XH6A 1HN0A 3VBOB 2WZPP 3FZ3A 3H3UA 3NV3A 2Z2SB 3V0AB 3EQEA 2V4AA 1UL9A 3EHKA 4KWJA 4ZHNA 4LMFA 2YPJA 3ACLA 4IEZA 4X6RB 5C8CB 4FTBA 1G9BA 1XE0A 4J1XA 3KF5A 3CJIC 4FT8A 4LE4A 5AVAA 4XJZA 4K8FA 4GWMA 3NJZA 5A3PA 4LBOA 1BEV2 3TWIA 1QWRA 2IXHA 2YBPA 1E5HA 2WIIB 3JXSA 4FOVA 1OUXA 1DHKB 4PI0A 4Y5Z0 1H6YA 1KGYA 3JD71 3PU3A 4Q0PA 1W6OB 3HJRA 1HRV1 3KZ4C 5CU1A 5JOWA 5F2SA 3WW1A 1PZ7A 2BOIA 3GJBA 1FAYA 2W9XA 4H2AA 2ADEA 1LKNA 5HXMA 3F2ZA 2BGCA 3RZMA 2W08A 1Y43B 1PGW2 2ZX0A 1QY4A 4P5HA 3O0VA 3LZZA 1DQ6A 3RYPA 2GNTA 1AYN3 2GNDA 1R093 1RXFA 2Q0AA 2HEWF 4F83A 2PAKA 1VIWB 1LEMA 1OQ1A 1QEXA 1UY1A 2YU2A 3LFIA 4A7KA 4EN7B 1HKDA 3MLJA 2P6CA 1LHUA 5FZLA 2RV9A 1AR62 3DPRC 1FT9A 3KT7A 4XUQA 4AGRA 5A6XA 2VOVA 4D7TA 1AL22 5KBFA 5I93A 3D4KA 4JX0A 1NKGA 4FSJA 4CDQC 2J1RA 4G3YC 3WD5A 3X29B 2MNGA 4GMP0 3OBZA 4IE7A 5DQ0A 1W8TA 1F35A 4XQ4A 1H1IA 2VMDA 3USSA 2X5IC 5FPVA 5H9RA 2PLV3 1NX9A 4XHXA 1JBCA 2P17A 5FXZA 3THPA 4AXOA 4OLLA 4XFHA 1JZ7A 1H2KA 3RG0A 4AHYA 4Y20A 1ZZBA 1XNTA 1NCRC 2VY0A 5M0TA 4AGGA 5A33B 1IG3A 3WW3A 4IV3B 1BMV2 2H6CA 1SG3A 4DINB 3ES1A 1J3PA 2DVBA 3QOPA 3HEIA 1OLRA 3P6BA 4LKSA 2AGSA 3ZN5A 5IAXA 4L99A 3T4HB 1L7LA 1XYNA 1MZFA 4FI9A 5LBBA 4BISA 2AZ5A 5GLUA 2Y6JA 4P9WA 3CJXA 4RR3B 4IQPA 1PO12 4YVSC 4FQ4A 1AZDA 1XYPA 2PHFA 4A41A 1PMHX 2ZGTA 3VD9A 1X36A 1TME3 1YNAA 2R0FA 5F3CA 5KXBA 5GLWA 4QHBA 3RZLA 1YFYA 2HJIA 1LECA 1UIJA 3NKTA 3ZFEB 2ZJCA 4A7ZA 4B1MA 1POV3 4ES8A 1RUOA 2B8MA 2E32A 1QH6A 2ARAA 5T54A 1Z7S1 2R16A 1PO13 1QXPA 2KR2A 1NAEA 1W2TA 4DY5A 2A5ZA 1H8TC 2PHRA 1QJX1 1W2AX 3CKHA 4XQDA 1RVF2 4ATEA 3PMEA 4FFHA 2EXHA 1W3XA 3VBUA 1AXZA 2V5DA 3CNAA 4KNCA 4R4ZA 1K3IA 1RGSA 2VNRA 2RM22 5DUUA 3RZJA 4TTGA 1WCSA 1AR71 1XE7A 4IGQA 1N3PA 3MFAA 4GMP1 1CAXA 1RVF3 4DMIA 1HRI1 4IV1B 5A7WA 2C24A 3LPFA 2QE3A 3NAPB 1W6QA 5G04L 3MIHA 3LIHA 3K48A 3BIWE 3WNPA 1NXD1 5LRSA 1UZZA 1GQPA 2WNUA 3OD0A 4WZFA 4YW4A 2PAEA 1OPOA 4INDA 5C3SA 2W1WA 5FBZA 1ONAA 4XFFA 5FZ8A 1JU3A 1US2A 1JN2P 1TZOA 1AX2A 5IVYA 3H3LA 3WY6A 3W59A 2HWD3 2P37A 5DPNA 2GMEA 4E2GA 3WF1A 2XUMA 2BZDA 4IEVA 2H0BA 1EPWA 1GZCA 2XXZA 4XC9A 5E6HA 4JHZA 4UBHA 3THCA 3WP6A 1XJAA 3GZAA 3LDRA 3D0SA 2D98A 2JECA 3N9LA 4QPGA 4E8CA 5CFCA 5CG8A 2BW8A 1U12A 4D7SA 1UY3A 4N53B 4EZ4A 5CBLA 4W65A 1GANA 4BYYA 1C8M1 1MS4A 4RQPC 2JB4A 4YARA 4NOTA 3QH7A 3TBDA 3WR0A 4A7YA 1MS5A 3G7DA 5C3PA 5FAXA 1ST8A 1DQ2A 5CKQA 1X7NA 3O1MA 5SV8A 1VBB1 3OGSA 4DIQA 4RS5A 3I2HA 1RUF1 1W05A 4I3PA 1ALYA 4Y24A 5IFPA 1W04A 5DDJ1 3V65A 4RGKA 4WBBA 2OIIA 1VBE3 1W0NA 4UW5A 4M3CB 4UBGA 1W39A 4Q0UA 4PLNA 5FWEA 2IXCA 1W8HA 2CGNA 3FWEA 3FFZA 4B1LA 5HCFA 4FFIA 4CDUA 2ZOEB 3OUHA 1CJDA 2VBBA 5FY9A 3T2TA 2Y38A 5JI7A 3WCRA 1GOGA 5C33A 4CXWA 5L9VA 4MOAA 2GDFA 2I45A 3AYDA 4ORFA 3ES4A 1EPZA 3ZPYA 1RHI2 2J1AA 3VBOA 3A23A 3ASIA 4IEUA 5A32B 5A7OA 5LBEA 4CDWB 4ASMB 3IZOA 3SQOA 2RR11 5FZCA 4DZGA 3AMHA 2C9AA 2O14A 1MS1A 5FMBA 2ADDA 3RQ0A 3AM2A 4AVVA 2JDNA 3PUHA 4NPMA 5CISA 4QXCA 1OVPA 1RHI3 4BZ4A 4KWLA 5A6YA 1J1TA 1LHNA 1S0BA 1K5MA 2W92A 1ULFA 4M01A 4BA6A 4UF0B 1DYKA 1EV13 1YI9A 2AR6A 1PX3A 1W6OA 3AMNA 3H9AA 4RR3C 5FQ0B 3RMXA 5JIUA 3AP5A 1SBFA 4QDSA 4AVCA 3DL3A 3PJQA 3ZFFB 2OXBA 1XSQA 3R4DB 1W9YA 5E8AA 2R062 3T0AA 4ZKTB 1W2OA 4D0QA 4OQ8A 3VHOA 2HWC2 4HK9A 4O65A 4DXZA 3AB0A 1PM7A 1T6GC 3KVAA 1HIXA 3B7MA 2P4EA 3I2GA 3MUZ1 2Y60A 2D93A 5DUVA 4IE4A 4OHXA 4YW2A 5K0UA 1ZBA1 2BWAA 1C8NA 3ZYHA 4HOOA 2HBUA 2VMEA 5D8AA 3TYJA 2R063 2UWCA 2Y34A 3DECA 3KM5A 4LK7A 4E4DX 1W9TA 2HWC3 3N9NA 2VXRA 4QQLA 3NV1A 2Y6KA 4LEJA 2CYFA 4CRQA 3O12A 3MUY1 2JX9A 1GR3A 1NA1A 1TVGA 5KHJA 1UPIA 4QPIA 3ZDSA 4E2QA 4MHRA 1NE4A 3FJSA 1YLLA 2CWSA 4CXYA 2ZAAA 1VB4A 2RS51 3S7IA 1VBC1 4LHNA 3SKVA 3VKOA 3POSA 2XL7A 2VR4A 1X9PA 5DZFA 4FP2A 4IERA 5EJ3A 2JDKA 4XW3A 3I3DA 1KRIA 3WZ1A 2FZ2A 2WZR1 1S0CA 3N7LA 1UMIA 3VDBA 4QX3A 1LOBA 2QQNA 1A3KA 5FFOC 2Z4FA 4YZ3A 4XUPA 4LO4B 4W6WA 5EJ1B 3AKQA 3WW4A 2PYTA 1DZQA 1KDKA 1H4GA 3ORJA 4MHUA 3ZFGA 4Q29A 4CUBA 5A33A 1JYVA 3NSTA 4IXLA 3AX4A 4AYUA 2XMLA 1JYWA 2D7FA 4ARYA 4ZS3A 3G6JB 2OQ7A 4Q4V1 2R49A 2Y8KA 1A8MA 5F6LB 4K6BA 4AVAA 2IFWA 2LALA 1KFUL 4XETA 4M00A 2LTNA 3AP4A 3PUAA 1UKGA 2PHWA 1EYBA 4XE9A 2VL4A 2WAOA 4IETA 1ACCA 3E6CC 2A3WA 3PMSA 4XILA 1W8WA 5BY5A 3POIA 3VL8A 4AHXA 3OUJA 1WLCA 3H8UA 4Z07A 2RS12 4OMDA 1AR81 1RUD3 1RITA 2O1QA 2J7MA 2QBXA 1W8UA 4QXBA 5FMDA 4MGSA 4Q27A 3ZMOA 1RYYA 3OY8B 1FPN1 1TQ5A 1DDLA 2D43A 5HXVA 4XIOA 2F17A 1C8M2 3WW2A 4YZ2A 2JG9B 2RS13 4Y22B 3AZZA 4MGQA 4WM8C 4HMZA 5FK8A 2WRAA 1G7YA 3ZSKA 3ZXFA 3OEAA 1XNCA 1VBB2 4HLTA 3WNOA 3FHIB 4AEDC 2XPJA 3FC0A 1RUF2 1ZZ7A 4JDMA 4C1XA 5T5JA 2WYSA 2D97A 5SV5A 1WBFA 4IV1A 5C3RA 3NAPA 1JYIA 4CDWC 3HIFA 5J48A 1V00A 3GZEA 3I54A 1VBB3 1QJY2 1PMJX 1R081 1RUJ1 2ZHKA 4H14A 1LAJA 4MSVA 4O7XA 3ABZA 4QQ2A 4HT1T 5GKAC 4B4QA 4XJ8A 4MV2A 1QJY3 4EZHA 1HV0A 3ZPOA 2VTXJ 3NW4A 2G19A 4YGCA 1OH3A 4DNYA 4DQAA 1Q3EA 4TWTA 2RR12 3AL6A 4DO0A 3BU7A 2AUYA 1CAVB 2QQLA 3I2JA 1AXYA 3IT8A 3U4SA 3NWKA 1OUSA 4LKEA 2EXKA 5FZ4A 5FV3A 2VUDA 2VULA 1UQXA 4GH4B 3HBKA 2VM9A 3PVBB 2FHRA 3M3IA 4N53A 1EAH3 1CWPA 5FZ7A 2VVEA 4XQWA 4XURA 2FCVA 4LKDA 5E88A 1Y9QA 3SEPA 1LODA 1LRHA 4XFIA 3MF9A 3MIGA 3O5SA 3UJOA 5C3QA 1SDDB 1JZ4A 3VBSC 2BPA2 3UGGA 3JQWA 2Q4SA 4Y4YA 3QACA 2E7TA 4YVWC 3UJQA 3VBRA 3OG2A 4N43A 5A7NA 2DVDA 1NY72 4Q8LA 1URXA 2FCUA 1LHOA 2VMFA 3QD6A 4Y3OA 4BXSV 1SMVA 4SLIA 5IK7A 1ZBA2 3J8F2 2D6KA 5F37A 4LO5B 4QQHA 1ZX5A 2HWF3 2YHJA 1IPSA 3BODA 3UKVA 4CSWA 1O5LA 2QDRA 4MGTA 5JMOA 1IHMA 1YC61 3HN1A 1RUI1 3MV11 5L7OC 1DQ5A 5IWFA 1IS6A 2JG8C 2DCZA 1UOJA 1ZBA3 1JOPA 3J8F3 3D82A 3WG4A 4F7ZA 2CAUA 3NKGA 3KQ4B 1YI7A 1W9SA 4AVBA 3VDCA 2B39A 1QOTA 2OZ6A 3I59A 4CUCA 5I0DA 4V1PA 1LGBA 1XU2A 2RS52 1D2QA 1VBC2 3NNGA 3V56A 2ZHLA 3HR9A 1KXGA 4EWAA 1ZBE2 4AI8A 2ERFA 1APNA 4K21A 3IIAA 3A0KA 2ARBA 4XBNA 1RUNA 5ANNA 4FPGA 4Y5SA 5DUXA 4YW6A 5FP9A 1ND2C 2WZR2 3K46A 4AQ2A 1O59A 5IYYA 2UURA 2A6WA 1VBC3 4XF0A 4P9GA 2D6MA 4KG0A 1XNBA 4NRPA 1ZBE3 4GAZA 5FDBA 4KGQA 3N9QA 5FQ0A 1OA3A 5DAVA 1WD4A 1F4HA 3H1YA 2P2KA 2MPFA 2Z79A 2ZGSA 4M0HA 1S0IA 1PNFA 2V72A 3J7MA 4GQ7A 3UKNA 2R041 4Q4V2 4JGZC 3WHTA 1SLLA 2XJUA 5FYSA 3SITA 2CY6A 1S4CA 4RSUA 3OJBA 1XBFA 5B4XA 3K2OA 1C28A 1SLBA 1T2XA 4M4PA 1V6NA 5FJKA 4GIQA 2UWAA 2GSYA 1WW7A 5KC6A 3ON7A 1PK6A 3ZX7A 2D3PA 2B45X 2VZPA 4I09A 4YM2A 4XXPA 4E4HA 4WVVA 1VAVA 4MUVA 1ENXA 3AZWA 4FPEA 1Q8SA 5IATA 3VZJA 4AZZA 3T1LA 4CCDA 1JHJA 2IUWA 1HXS1 1X8EA 4B7KA 4BWOA 3I7DA 3VKMA 2NQYA 1UWWA 2YB7A 1FPN2 1XNKA 3MPPG 4NN0A 5FP3A 2E51A 3SNMA 4CEYA 1LGNA 2NM1A 5FYBA 3WF0A 1V6KA 3LQCA 1UKRA 1UN1A 5BNPB 1UO9A 1MR5A 4X8PA 5T55A 3VD3A 5KXCA 3N9OA 1OOPA 3UV9A 2BBVA 2C9KA 5FP4A 4PDWC 1QMJA 5JUVA 1AJOA 1JOJA 3VZNA 3ZSJA 3KS7A 1CQ9A 1C3HA 1C57A 3CF6E 3GCWA 2WNVC 3POGA 2WO7A 1V9U3 1OF4A 1VMHA 5FYTA 3D8CA 2N7GA 3F95A 1R082 1GWLA 2JE9A 4C8DA 5BNNB 1HV1A 4DUVA 3EB7A 4KWKA 3ELNA 5JWPA 4FXKB 1HN1A 1V70A 3ZIWA 1DLLA 5ISLA 1UW8A 2J1UA 3BPSA 4ZS2A 2QDNA 5T3NA 5JZGB 1HX6A 1XU1A 1PVXA 4NRMA 2A6YA 4FPLA 4ZU7A 1NE6A 1UMHA 2MHFA 3WG1A 2WL1A 1W6PB 3U37A 1BVP1 1GQHA 2WT2A 3I2IA 2JB8A 3OY8A 4P9YA 3KCXA 4BQ4A 1WGPA 2ZGPA 3LGRA 1BBT1 3POJA 1CPNA 2JG9A 4CCLA 2EIGA 5C9AA 4Y22A 3SEEA 3RPQA 2ZX3A 4RHV1 2Q5TA 4JC1A 3M8LA 1WZXA 3TAYA 3WNXA 1OD3A 2V09A 4QXKA 1OXCA 2V73A 5FKBA 4WV8A 5JXJA 5EZWA 2CTVA 1ENSA 3CJIB 5FPUA 5A80A 1DCSA 3ILFA 1B35C 5LK5A 2CNAA 5FIXA 1BYHA 5J37A 1NYWA 3I3QA 5FOBB 2VW2A 2RS32 2BVVA 1DGWX 3ZSMA 4E4ZA 5EJZB 2P3IA 5A6QA 2JE7A 1A78A 1ZRDA 4LO8A 4FOWA 3D5OA 1RUI2 4XUOA 5HI0A 4PJYA 4IGPA 1N3QA 1O4ZA 1U5IA 2W1UA 5J7MA 3O1VA 2RS33 4AFAA 2CHHA 1JI6A 1POV0 3AFKA 3VZOA 1SCRA 1SDWA 1UOGA 4LO7A 5ABJA 1QNYA 3RS6A 3KMHA 4HPKB 1UU4A 5FLIA 4CP9A 1QNWA 2DVAA 1F4AA 1RC6A 2XHKA 1BK1A 2A6ZA 1NT0A 2R072 3T2PA 4AI1A 4AHZA 1L7RA 2BNNA 4GH4A 1SPPB 2R7EB 2CV6A 4ZXKA 1PIV2 2QKDA 3D0JA 4XTMA 1MS0A 5BNQA 1BLZA 4DRRA 2NYYA 3LDBA 3DPRB 3RJ2X 3IPVB 5APAA 3WQBA 2R073 1POQA 4BCUA 4P9JA 1WLDA 1H30A 2DCKA 3AMMA 1PIV3 3NMBA 4AEMA 4CDQB 2EAKA 2JDMA 1S0EA 4ES9A 4COZA 4AR2A 1UYPA 2VXJA 1U5XA 1W3VA 1LB2A 4MXVA 1LOGA 2G9FA 1RUG1 2Q30A 2X53S 2X5IB 3VN4A 3OPTA 1H4HA 1UCXA 1QQP3 3E6DA 3MI8A 3NVCA 3WNMA 3U11A 4EJRA 4NVPA 4XIKA 5GALA 5JSOA 4NR1A 2EAAA 1MQTC 2OUJA 3FBYA 3WINE 4B7EA 1TNRA 4UXAA 4Y1VA 4MGZE 4AG4A 4Z8BA 3U1XA 5FZ3A 2D44A 4QB6A 2XKOA 2VO5A 3VBHB 5BNPC 3LSDA 3O1TA 3R4SA 1YEWA 2RMU1 2HYKA 1QGLA 4H7MA 1JZ3A 2W95A 3RSJA 3N9PA 5FYVA 3ZO0B 3QH6A 4N8MA 4XMAA 4OI4A 3ENRA 2GH2A 5DAWA 1LR5A 3WDTA 3C7GA 4MVTA 3ZXLA 4AGVA 3AZVA 4QDRA 4QX1A 4XJAA 2FD8A 1U0AA 5IK4A 4CU8A 2XJRA 1AUYA 1ZREA 3AJYA 1GV9A 4N9IA 4NHYA 4XAAA 3SLIA 1AYM2 2PHUA 3INAA 3OBRA 4BK5A 5BNNC 2R1DA 5H9PA 4A45A 3I3EA 4S2FA 2W1SA 4K1YA 1QDOA 1Q8OA 2DUQA 4L0PA 4A6OA 1NCQC 2Y0OA 5F2WA 4HVRA 2ZKLA 1WW6A 2A6XA 2K9ZA 4HSJA 2YBSA 1AYM3 1H8TB 3GZTB 1CJPA 3JU9A 1MPXA 4YGBA 4JQRA 4KMQA 3BTYA 3H0OA 1HJGA 1EY2A 1ZRRA 5IT6A 2JDAA 3DCQA 1WMFA 1DIWA 2VNGA 3FHAA 1FYUA 3LF7A 4XUTA 3ZXDA 2Z69A 2C6SA 4FBFA 3WP3A 1OQEA 1AR91 2Y33A 3SC7X 2ES3A 4CDXA 3B01A 1BHGA 5CIRA 3AZYA 5GJ6A 2JD9A 3IDEA 2VW1A 2P3JA 3KVBA 1ZZCA 4R8HA 4WM7C 4YG3A 2ETEA 1X82A 5J96B 5F3IA 3J7NA 1YUDA 3AVSA 1CZSA 3EYPA 3CU7A 1QKQA 1F9KA 1MVEA 2HWB2 2RVAA 1OC1A 1D4M2 1GBGA 1YJKA 3WDVA 5A6ZA 1CAWA 3C7OA 2QQVA 1O91A 5AC92 3I4IA 1LU1A 1VJ2A 4L92A 3P3PA 4O9GA 3T09A 3ZSLA 4AOCA 1K12A 2OPKA 5LA2A 1LGCA 1R1A1 3J9SA 4BQWA 3WLUA 5FWJA 2HWB3 1LOFA 3RWNA 1D4M3 3RVHA 3ZXEA 2WFF1 4GB31 3CMGA 3POEA 4KWUA 5FPXA 5FR3A 5IW0A 1NOVA 5AC93 1BEV3 3WUCA 4PIXA 5IK5A 1TMF2 4JQTA 1MZ6A 1AX0A 2YPDA 3M3EA 1RUH2 5IVFA 1KJLA 3DXUA 3OTFA 4RQPB 5LB6A 3K4DA 5LRRA 1D0HA 4UT5A 1JS9A 1ZA4A 4GWJA 4RGAA 2ZGOA 5GZGA 2K2SA 4PF1A 1YQ8A 5A3WA 1G9DA 1OA2A 4KQ7A 4JGYC 1TMF3 1GWMA 1S0GA 3B5LB 4XDQA 2QCSB 4CU7A 1RUH3 2I07B 4HANA 4YW3A 3CZJA 1HQWA 1IPKA 1UU6A 2PELA 1A8DA 4U36A 2QQWA 4N7UA 4Q4X2 3S6PA 5JZGA 2BRTA 3VDAA 5E1RA 4AI9A 1JYTA 4HXCA 4MXWB 1OD5A 1W6PA 2ZA9A 4NJ4A 3E5QA 1P8JA 1JZ2A 1SBDA 4XF4A 1AR63 4AVTA 1UZ0A 4OI2A 5EWSA 4Q4X3 3HOBA 5DUWA 1AL23 2I2SA 2LW8A 1DYPA 4NROA 4OHYA 4KGGA 3FX3A 2HWE1 4Q1PA 2ARCA 3JCIA 4XPVA 3LE0A 4ZONA 2BNOA 3APBA 1CZTA 1WMXA 4JDNA 5IVEA 3VBUC 3CQOA 2BQPA 2VJXA 2GC0A 3AZXA 4TLFA 3LCPA 3VBHC 5KHHA 1W8OA 2PN5A 3OGRA 1OSGA 4L11A 3CJIA 3KGLA 4L9BA 2NP0A 4JTNA 2IXIA 3B02A 2VNVA 2BWCA 3SH5A 1CONA 1WW4A 4FPHA 3PUQA 5JOXA 1Z78A 5FY4A 1YIPA 2PHXA 3N4MA 2JJ6A 5CZKA 3BOWA 3W5NA 4KI5M 3BIEA 2QQOA 5C7GA 1O3QA 1BZWA 2XBO1 2AH2A 3FL7A 1F15A 4ZY9A 1S2KA 4ASLA 4AW7A 3GDBA 2RMU2 4XVHA 1O4YA 2PFWA 3JQXA 4AE2A 3AP7A 5LBCA 3SCGA 4CP0A 3VGIA 5B4NA 2BGOA 2JDUA 2GN3A 2AYHA 5I91A 5CNAA 4CCEA 4GA9A 2RMU3 2VTFA 4TSVA 4AK3A 4FPOB 2GC2A 2YC2A 4EN9B 2FMYA 4YPJA 4MH0E 2DYCA 3RZKA 1VBA2 4XDOA 5BUVA 3U0ZA 1XQNA 5FLJA 1FNZA 1RUC2 3DPRA 1GLHA 3ZMNA 3IPVA 4LOSA 4YM3A 1FMD2 1GNZA 1UYYA 4D94A 1S0FA 1DU3D 1Y9MA 3N36A 2JKXA 3JB4C 3FFQA 2EF6A 3ZR5A 2VUJA 1VBA3 1W2UA 2WQ4A 4YFWA 3QCWA 1W8NA 3NJVA 4YG6A 1OT5A 1XB9A 1RUC3 2WO3A 2BJSA 2J1EA 2RM23 2WINB 4DXTA 2X5IA 1FMD3 4NUBA 1BKZA 3Q8FA 1OURA 3RYRA 4BM8A 5FZIA 1ND3B 4HZFA 1AR92 3UK9A 4A4AA 4Z92B 4GJYA 1YHFA 5ACA1 5JPNB 1NCRA 4QGLA 3ZLIA 1W6MB 2YFUA 1JUIA 4QKBA 3GXUA 1ZZ6A 2VCBA 5ANQA 4CYDA 3AYEA 3MLLA 4GXLA 3DYPA 4RN5A 4QU1A 4LO6B 2WUHA 5GZFA 2B9UA 3WHUA 5CFDC 1PZ8A 2MEV1 4YVSA 5F5AA 1OLQA 4XTPA 3M3OA 1Y4WA 1DF0A 5EHDA 3JD72 1AHSA 3KHCA 1HRV2 3PVEA 1RUE1 1CIWA 2TUNA 1Q43A 2WFF2 4FXGB 4GB32 4L2NA 5D2AA 4CU9A 2LUWA 1CGPA 2DCJA 5FY0A 4BQ3A 1Q8VA 2W52A 3PURA 1I3HA 4GZ9A 2PQQA 2X09A 2QZ3A 4G4FA 1H8TA 3JD73 4P00B 4YM1A 1HRV3 1O3RA 2VUCA 2DUPA 4BQYA 5GM0A 4GB33 2Z5WA 4R52A 4WM8B 5C5UA 1H2NA 2BUKA 2EICA 4ONUA 4XOGA 4K3UA 5A1AA 2G9GA 1WBLA 4UW6A 2VZ1A 4AFDA 4PQ9A 4URAA 4AEDB 5HV0A 2FDIA 4A6SA 2W68A 3T08A 1R64A 1ZZ8A 2HBTA 4OCTA 4M3CE 4Q0SA 5FXXA 4LLOA 5I8YA 4LQRA 3MBWA 4MGYE 2Q1ZB 5F6KA 3VD7A 3V0AA 1JZ6A 1FATA 2ARXA 4BQXA 3A7QA 3IIIA 3Q8CA 2GC3A 4W6YA 3WEZA 5FREA 3WQ7A 3R05A 2JENA 4PBOA 4HSLA 5C8CA 3TEYA 4AL9A 2KA3A 1G86A 2EXJA 2WA3A 1D2SA 3PU8A 3WP5A 1XOYA 2ZGKA 1S55A 1LENA 3W9AA 3E5UA 4YGDA 2FDKA 1JODA 2PHTA 5IFTA 5F3GA 1DFQA 5A3MA 2B46X 5KHKA 1CPMA 3ACIA 1OI6A 1IKPA 4P9IA 1ZRCA 2F4LA 3SH4A 3O1OA 3PTRB 4R4XA 2X8KA 3E6BA 5FZOB 1UIKA 4GD4A 3T2OA 2QQIA 1W03A 3CEWA 3ZFGC 2O8QA 3LSEA 1VP6A 2RJKA 2OYZA 3PHMA 4X8NA 4OHVA 4X6QB 3I97A 1CAUB 4Q0QA 2TNFA 4CCCA 2OKXA 1V0AA 1F5JA 2Y0IA 3OGJA 3VBSB 2GH8A 2ZGRA 2W87A 4YVWB 3WDYA 2B42B 1SQ4A 4YG0A 3OYWB 3LPGA 3AFGA 1Z7S2 1GICA 1XYOA 5J98B 3LB9A 5LWBA 3T3YA 5DMYA 4BK4A 4IEXA 3ZYIB 1QJX2 3MF6A 2DCTA 1JOBA 2OQ6A 4CPBD 1OPMA 3B9IA 3USUB 5L7OB 3U4XA 1B09A 4G9SB 2JG8B 1Z7S3 2DUOA 4FAHA 1VBD1 1ND3C 2VZSA 1AJKA 1AR72 4HKOA 1DGRA 4Y1UA 1QJX3 1DGWA 4Y33A 1HRI2 4Z2AA 3KV4A 1S2BA 3S5AA 1OFNA 3NJXA 3NNFA 2QQJA 2W46A 2A1XA 1QXRA 2VVDA 4IV3A 3PIGA 4IL7A 1MZEA 1RTVA 3AVRA 1JYXA 4BQ5A 1ND2B 4C91A 1AR73 3KGZA 3O7OA 3Q8BA 5F5CA 2JWPA 4GMP3 3RNSA 1PO21 3CHXA 1HRI3 1VLNA 1BK0A 1ENQA 1J3QA 1N1YA 1QJFA 2VZOA 2YC4A 4PI2A 4UWDA 5I0UA 4XYXA 1O6UA 4PT6A 1SLCA 3AXDA 4RR3A 5FZ0A 5ACA2 4I2OA 5A3NA 3BALA 5A70A 1BJQA 1L3JA 1UYXA 1SHWB 1HQLA 3WG2A 2OT7A 2J22A 1I6XA 5EFUA 3A22A 4JGZB 2AEYA 1LHVA 4Q0VA 3ZFEA 2W47A 3JUUA 1VPHA 1IG0A 4IE6A 4IE5A 4Y1XA 3DYOA 2IVIB 5FZKA 5FMOL 3ZYBA 4HVOA 5LY1A 4D7YA 1COV1 1WMEA 3RRDA 1Y7BA 1K45A 2DTYA 4NHKA 3OCPA 1W0PA 3LDKA 3GZUC 3TEZA 2VPVA 2HKXA 2MEV2 4M3CF 3VKLA 3I3BA 4FPJA 1GZWB 1ZA7A 2ZGUA 3ZXJA 5FOJB 3N7MA 3ACGA 3BU0A 1RUE2 2VBPA 1SCSA 3PJYA 1S0JA 1AXKA 1C5IA 1FOD1 4BLIA 4QKDA 1H8VA 5DDJ2 1C8M3 1REEA 2BDRA 2Q1MA 2PA7A 2VBDA 2CSGA 2WT1A 3RZZA 1UMZA 3NNLA 4PCRA 1RUE3 4JHTA 1ULCA 2VCMA 3MIDA 4N43C 1IZ3A 4COWA 4LE3A 1G9AA 1J83A 1CX1A 5JI9A 1RUF3 3LOIA 1Z0HA 1PVC1 1CX4A 3VBFB 5DDJ3 2WZ8A 3J4UH 4P14A 4UFHA 3T30A 1OBNA 4PDWB 5LBFA 3EMRA 3R0RA 5L19A 2YGMA 1DZRA 1W6MA 2KD7A 5K4LA 4E4SA 1W99A 3CDZB 4Y1ZA 2VVFA 5DZGA 4CCKA 2WNVB 3MIEA 3M4FA 5E16A 5C71A 3LWCA 2L9LA 3B69A 3IBMA 2D5FA 4N7IA 4LT5A 4TN7A 1LTEA 4W8JA 3R6SA 4NAMA 5K9YA 1DBNA 3THTA 4B29A 2QFEA 3Q8AA 3WNNA 1LOAA 4AWDA 3KSCA 3LEGA 2D6PA 2TEPA 3IN9A 2RR13 4OYUA 4L8QA 5FZGA 4JTOA 5C4WB 1IS5A 1GP5A 3M3CA 4FPYA 1RJ7A 1NUKA 4EROA 3JZVA 3BGAA 1VRH1 5E89A 3TN91 1WCQA 3DV8A 1NLRA 4NIDA 4YNIA 3P5BA 1MVQA 1VMFA 3POFA 2OA2A 3PUSA 4K7JA 1H1MA 4QQOA 5IVCA 2CGPA 4M3CA 2E7AA 4C1WA 3LEIA 2YGLA 3AL5A 1H2MA 1PZ9A 1WD3A 2XVLA 4AEKA 4DRVA 5J1XA 5FK7A 1MEC1 4AEDA 2P1BA 2BFUL 3WG3A 2Y6LA 2WS91 5GLZA 5A7QA 4KBZA 1PK6C 3TEXA 3WOGA 2CU5A 3VKNA 1B35B 5A32A 4CDWA 2FDHA 2XJQA 3MFCA 2VCCA 5J3UA 2A70A 2CWMA 3UT0A 2RJLA 5CKNA 2P5BA 3PL0A 3EO6A 4NPLA 1GKBA 5F5QA 2VOTA 3I2KA 2VGDA 2V4VA 5JAXA 1E5IA 4BDVB 4FP3A 5KC5A 2DDUA 2R32A 3H7JA 2XJPA 4WVWA 4Y5TA 2A71A 4ARXA 4WVMB 5DG1A 3ZYFA 3UNPA 1VBD2 4UF0A 1ASJ1 5JCTA 2E53A 2RS53 1V6JA 4JKKA 4O9EA 2K46A 3BUCA 1MACA 4AFBA 2DCYA 2E7QA 5BNOC 4FFFA 5LW9A 3ZFFA 1VRBA 2XWJB 2WZR3 2ZZJA 3E1F1 3VDDC 4XCAA 5T5PA 4CPBA 3H1WA 1SZBA 2W94A 2W3JA 3ZXAC 1VAKA 1ULGA 1AX1A 4XJ9A 1RMU1 5FPBA 1PO22 1QXJA 5IVJA 1YFXA 3JBG1 5F32A 4MGKE 2CDPA 3IM0A 4K20A 2Y6HA 2AEZA 2ZGMA 3VBSA 4Q4V3 3WUDA 4XJWA 5FYMA 3ZIXA 2CAVA 2NN8A 4YVWA 5FY8A 1V6MA 4CEWC 2ZHNA 3GM8A 4GWNA 4OI1A 3VHNA 4Z2WA 1G9CA 1C5HA 1AR82 3O0XA 3OYWA 2ZACA 4Q4Y1 5BPXA 1MS3A 2GZWA 1XXNA 1NXMA 2A3XA 2ZGNA 4ITCA 2DU1A 1WMDA 5TSWA 3OSDA 4IEOA 2P3KA 1V6LA 2KXLA 4XF3A 3ZN4A 4BIOA 1MQTB 5GZCA 3MDPA 4XZUG 1Q5OA 2J42A 4OUSA 2BGPA 2Z42A 3NV4A 2YROA 1KDMA 2XJVA 1AR83 2QNKA 3USUA 3H8RA 3ZM8A 1GUIA 5IHRA 4EQVA 2JG8A 4CUGA 4XJUA 1JZ8A 3MIBA 4LBQD 3VBFC 4D8MA 1FPN3 4H55A 4I0AA 1O8PA 5T52A 3O1RA 4UFJA 1SLAA 4C0HA 3HT1A 4P9LA 1JTZX 5LY2A 4DS0A 1H9PA 2D5HA 4TXWA 1OKOA 4U2AA 2ZGQA 4OZXA 3MICA 4OUMA 3OB8A 4QD2A 3ZN6B 4QHOA 2Y6FA 5LA1A 4MLOA 1RUJ2 1PVC2 5FZBA 2WYFA 1UY4A 3DXTA 5DAXA 3OF1A 4P02B 5B2GB 2XLFA 2P6HA 3WNLA 5JMCA 1DQ1A 2VZTA 4COUA 1NCQB 3ZYJB 2FDJA 2XOMA 1UY2A 4Q26A 4D6QA 3GBFA 1R083 4FAGA 4LPLA 1YYNA 5C4WC 1MS9A 3DUIA 1RUJ3 2RE9A 3W5MA 4H3WA 4COYA 5DABA 2XLGA 4FVVA 1H2LA 1UX7A 4UFLA 1R1ZA 3I49A 5BXXA 2RDRA 4Q4W1 5ABJC 4DOUA 3PVOA 4BQ1A 3TEWA 2B4KA 3O1PA 1LULA 2QUOA 3O14A 2ZEYA 1GZWA 5T5OA 3B93A 2WBKA 3WF4A 4WM7B 1ZNPA 4AI0A 4AVSA 3FUOA 3ZVXA 1UXXX 4B8EA 3UETA 2J1VA 2ZCWA 2GP5A 2VQTA 4I01A 3N7JA 1LJ7A 4Y26A 3BCWA 3TN92 2IVJA 1RL3A 3ZXKA 4MX3A 2DV9A 1LHWA 1JMUB 4Q2FA 4YWAA 4AAXA 3AP6A 3T4VA 3TN93 4NHLA 1EP0A 2FZ1A 1KD7A 1MEC2 2XQXA 5HPOA 2A6VA 2UWBA 1O4TA 1J3RA 4JCKA 2WS92 4NAOA 4PDWA 4Y20B 4OI0A 5C3OA 2VUAA 2VMHA 1QU0A 4P5YA 4DXSA 3LA2A 2I74A 1AYN1 5CAZA 4IEPA 1R091 3OBAA 4QX7A 4UI9L 3WX5A 2A75A 3GGLA 4FOYA 5DAPA 1CAVA 3FLTA 3I2OA 4FCAA 2V5YA 3M2MA 1RUI3 2J1TA 2YU1A 1XNDA 1W8ZA 4W6XA 4BMBA 4F3JA 5CA6A 5F9TA 4RFRB 2DWRA 4JGYB 1QDCA 4LORA 3PLQA 2VQUA 4N9HA 2WLPA 2PQSA 3ACHA 1N1TA 3SMHA 2PTMA 3FN9A 5IVBA 4AF9A 1ASJ2 1F2NA 4IW3A 3RZHA 5A7PA 2CL2A 4HN0A 5FZMA 3UL2A 5L36A 1YQ2A 4RFT0 5CG9A 1YO8A 4NIGA 2VAUA 3M70A 5CADA 1ZVFA 2JDPA 4QX2A 4BHPA 2ATFA 2C5DA 5JXHA 3VKFC 4RL7A 5L73A 4FTEA 2PLV1 2R042 5FMOS 4D69A 1E5SA 1ASJ3 1WA4A 1YQ5A 1WW5A 2OW4A 3WQ1A 1XRUA 5I0TA 1REFA 1RMU2 3ACFA 1OHFA 3JBG2 1RINA 5FO7B 4QDQA 1REDA 1RJ8A 3SKJE 4ZXEA 5C6CA 1J59A 2VD7A 2O0OA 2ZABA 3VBUB 4DEVA 2R043 4LBJA 4NE9A 2BV4A 1G8WA 1FX5A 1GWKA 1SLTA 1O8SA 1RMU3 1US3A 2C0ZA 3ZOIA 2Q1FA 1CAXB 3ZYPA 3UYJA 1VALA 4MYEA 2XQRA 2VQ0A 5A7WB 4RD7A 3W21A 1B35A 1GOHA 1HXS2 3BI3A 1LOEA 4PF5A 1UZYA 2WC2A 2WQZC 5FKCA 3WQ0A 1BMV1 1J84A 3HQXA 4QGMA 3H8XA 1QJZA 5BYNA 3AK0A 3MLKA 2WNUB 2YY1A 2H6BA 4ZU4A 3IMNA 5JLVA 3HNMA 1TME1 1DG6A 3FHQA 4BXFA 3GHNA 1HXS3 1POV1 2HEYF 2B9VA 4XFBA 4KL1A 1PO11 2EXIA 3IDBB 4QB1A 3LEMA 2RDNA 2Q8OA 4JAAA 5FZ6A 3HQRA 2YC0A 3KCCA 3H50A 1LCLA 1W8FA 3I2FA 2P34A 4IEWA 1YIFA 1IS4A 1OA4A 4L97A 4QT6A 3RJRA 3T1MA 1SLIA 1WWYA 4JV4A 3RZGA 1YCIA 5FZ9A 5CFCB 4QPGB 4F8AA 3AXEA 4PLOA 4R9AA 4BU2A 5IVVA 4HKLA 1PM4A 1AVBA 5L9BA 2D3SA 1RVF1 3H3ZA 4HFSA 2PHLA 4NIIA 2GMPA 4QU2A 5L9RA 5FYUA 2QQPA 2FDFA 1NQDA 1QJU1 2OX0A 4LHSA 5CKMA 3TOJA 4MZUA 4BQ2A 3KCYA 4GKXA 3O0WA 3VV1A 3MW3A 3VDDA 1PNGA 4LOTA 2WFPA 2GP3A 3AMPA 3LKJA 3WNKA 4ZZ8A 1X8MA 3ALQA 4XFCA 5C70A 2BU9A 4XABA 3ROUA 2HWD1 4R9CA 2EALA 1OLMA 3GNEA 1HDKA 1MQTA 3AKRA 4QPWA 1JW6A 3S30A 4EN6B 2FQPA 5JSRA 3HMYA 5KWRA 3OBTA 5I0RA 1BBT2 4CDUB 1KS4A 1W0OA 4LKFA 2IWGB 4QMAA 2C4XA 5FYYA 5BNPA 2BFUS 3KD4A 4QGNA 4RHV2 1AF9A 3FE5A 2RG4A 2D3RA 3KT1A 4UW4A 4V2WA 2ET1A 2ZEXA 1W90A 3EBRA 2QJVA 1ODNA 5LEKA 1BBT3 3AYCA 3RFRA 1N47A 1PGL1 5CFDB 3IKWA 4QQPA 3TNQA 2QQUA 1V6IA 4LXLA 2JIGA 5FZHA 4RHV3 3L2YA 5FZEA 5J09A 4UYBA 3ZN6A 5FUNA 1DQ4A 1UZWA 2CGOA 2D6OX 1GYKA 2E26A 2IZWA 2QTWB 1UF2C 3EXUA 1K5MB 4LA3A 2SLIA 5FLHA 4ET7A 3WSOA 2E31A 3AKTA 3POWA 4YZ4A 3WT3A 1S2EA 2EIDA 3IDCB 1NCQA 1VBE1 3DEMA 4LHLA 3W20A 3WP4A 5AVPA 3AP9A 3KV5A 1AYN2 3VD4A 1ULDA 1R092 3NRUA 3K4AA 5FY5A 2D40A 4ZZ5A 1OVSA 5EP9A 2GU9A 5CYYA 5K0UB 2BVBA 5HCHA 2JE8A 3ITQA 1J58A 5D8AB 2QVSB 2WABA 3FMGA 3D3AA 3TNPB 4A2UA 3I3MA 4GKYA 4Y4RA 4AAPA 3RI9A 1W2NA 3P1IA 4WM7A 1KFXL 4QKNA 4S2GA 3RWKX 4YZ5A 1NA1B 3KV9A 4QPIB 3WCSA 1RHI1 2ZEWA 4UAPA 2GALA 2C1FA 3C2UA 2PLV2 2E63A 3HD8B 1HJFA 4OHZA 5EYYA 1F31A 3U75A 3ZDVA 1QIQA 5LEJA 5FYIA 1EV11 1OKQA 1RUG2 1CD3G 2XKPA 3ME2A 4J25A 3WDUA 1S0DA 1MS8A 2XDVA 3LEKA 2DBIA 4LNVA 1D0GA 2DFBA 2DVFA 1RB8G 5FPAA 3VZKA 2WNUC 2B7YA 4O61A 3CZUA 2VC9A 5LCWL 1TNFA 5I8SA 3T2QA 2FMDA 3H42B 1RUG3 3H1MA 1IGOA 1JXNA 1SFPA 2ENRA 3N7KA 4CCJA 1X50A 1K5JA 1U5YA 2F6BA 2UY9A 1WCDJ 3ZFGB 1X9TA 3OD4A 2ZAHA 1YQ6A 5T5LA 4EV0A 5A3TA 5JOZA 3V64A 2XLAA 5JR2A 2R061 3DF0A 4E8DA 2TBVA 4HPKA 2HWC1 2OPWA 3POYA 3KB5A 4YLZA 3WF3A 1TME2 3HQUA 4FO9A 4HBNA 3GF6A 2ID4A 4XFGA 4JGYA 5C8WA 1SPPA 4XF9A 5CFCC 1JYNA 1QF3A 4QPGC 2ORZA 3UKTA 5LA0A 1SACA 4JDOA 3PVNA 3S5QA 2J1SA 3NJYA 1Q8QA 3B9CA 2LM3A 4BJ0A 2OVUA 2XJTA 3SH3A 2Q8EA 3C7FA 2R30A 3QLQA 4CDQA 2XGXA 1IQDC 1G6NA 2FCTA 4RS5C 4C90A 4EE2A 1GOFA 3QBQA 5EIYB 3O1SA 2W0XA 3VLBB 1WLTA 2XJSA 2QQKA 2W39A 5DG2A 3WDWA 2E6VA 4RA0A 3EJKA 2NMNA 1RXGA 1N1VA 3IDAA 3A21A 4JVAA 1DGRN 4QX8A 4QM9A 4LTAA 3VZMA 1I1EA 1JZ5A 3MGUA 1QJU2 3U07A 1WUVA 3NO8A 4CDUC 1TEIA 4NHXA 2D6LX 1FV3A 3VBHA 4DUXA 1H1AA 3AKPA 4YW1A 1JHNA 3U14A 1HB3A 1AR93 2GC1A 5F1RA 2VW0A 3VBOC 3ZYRA 3KWVA 1O3SA 2XG3A 1QJU3 1TE1B 1I5PA 2HWD2 2HEVF 3HBZA 4SBVA 3S57A 3T0BA 2VZ3A 5C8CC 4EWDA 3H8OA 5C5TA 1Y9GA 4HG6B 4CXXA 2R6QA 3VHPA 1R1A2 1RUD1 2WSUA 1WCUA 4ZPIA 4CVUA 1DP0A 2ZPXA 3FBMA 2EA7A 1K5MC 5DXDA 2O8OA 1QOSA 2QQMA 4XCBA 4QAWA 4XMIA 5LA9A 3RI8A 5FYCA 4AQTA 3O1UA 5JVVA 1PGL2 1W06A 2BEOA 1CVNA 2RS11 4LUKA 5T50A 1R1A3 4IEYA 1ENRA 3T0DA 4PLMA 3K4ZA 2WNOA 2ZKNA 2WFF3 3J7LA 3C7HA 3HPNA 4LBNA 3M7AA 4LBLA 3MV01 1J1LA 1H9WA 4NIHA 3ATGA 5K0UC 1KQRA 2IXLA 2EIEA 3S7EA 1LU2A 5KHGA 1VBE2 4NIAA 1YQCA 5D8AC 1XC6A 1Q8PA 4HKWA 3RDIA 2WA4A 2IXJA 3DKWA 2C26A 2HLEA 5LK7B 4QM8A 1UOFA 3VBRB 4N43B 4LR4A 1NA1C 5DZEA 4QPIC 4OUEA 1DQ0A 4ISQA 2EVXA 4LHKA 4YSFA 1QJY1 2PHDA 2PAMA 1AL0G 4J6GA 4D6SA 4COVA 5D1IA 2HWE2 5GLVA 4H7LA 4GJZA 3SCHA 3CL1A 1KJRA 1UNBA 2DBNA 2XB6C 2VECA 5KHIA 2HYXA 4B4RA 3URFA 1KS5A 1EAH1 2H0VA 3I59B 4CP2A 5BV6A 1V6OA 2ZMLA 1HB1A 2ZX4A 3HNYM 2HWE3 1EV12 2WLQA 5CFDA 4LIUA 4CCNA 2ZS6B 1ULPA 4IV3C 4N90A 5IUQA 2W2IA 4RQPA 3HNBM 4OHWA 3CIHA 3RMYA 2NZ9A 2VMCA 1D4VB 1PHMA 3B94A 3ST7A 4EN8B 1GU3A 1VR3A 3ILNA 4NRQA 4CUAA 3K3OA 2XBO2 1UOBA 3P3NA 2XVKA 4FPCA 3A0NA 3Q9OA 4LK6A 3WF2A 2HWF1 3LFMA 3M3QA 4ISRA 3OUIA 4XAEA 5FZ1A 1UU5A 1NY71 1NZIA 2NPIA 4MXWA 2XBO3 4XEZA 3ZFEC 4URTA 1GP4A 4WVZA 4GULA 1LEDA 1GNHA 3J8F1 1E5RA 4LULA 3ZKUA 5BNNA 3HN3A 1U5ZA 1PK6B 4DFSA 3B00A 5A1LA 4KU7A 1JUHA 1WLWA 1O5UA 2A73B 4DEQA 4KU8A 2W91A 2YFZA 4FFGA 4W50A 2WT0A 3GBWA 2OZJA 4AFMA 3GALA 5DN2A 4A44A 5FMCA 4MO3M 3KQRA 5EV7A 1CR7A 3NV2A 4IV1C 4A42A 3NAPC 3GCXA 1UXZA 1ZBE1 3VZLA 1DYOA 2ZGLA 4UOJA 4CEYB 3S0MA 3AJZA 5F8PA 2IC1A 4PHZA 2JEMA 4BMEA 4IGOA 2WSVA 5FCCA 1DLCA 5BNOB 4AQ6A 1OOPB 5FYHA 2FBEA 4IEQA 4Q5OA 3VDDB 4FOQA 1ZRFA 3VUOA 3KHBA 5JPMB 2VMIA 3MW2A 2R1BA 4NO4A 5K7PA 2WR9A 1XPWA 3LA7A 4TZDA 3E5XA 3OPZA 3FLPA 5ACA3 4HN1A 4V2VA 5F5IA 1NQJA 1NZCA 1XE8A 5FZAA 3UGHA 5KR7A 5FXVA 4J1WA 5HCAA 1CZVA 1N1SA 1VE0A 2VOKA 2NLRA 4PIZA 5CB7A 4DY3A 3K3NA 3IAPA 4CEWB 1RUD2 4PQQA 5EXOA 3HVDA 4N53C 3RYKA 1SFNA 1YWKA 3IWZA 2MEV3 1IPJA 5JDBA 3D6EA 2KM2A 4HETA 4AI2A 4K1ZA 2RHPA 4BLJA 1GZ9A 5H9SA 2PXJA 1O7FA 2ZBJA 3VBRC 2WKKA 2A3YA 4NWVA 4WZCA 1IKQA 3U10A 1LOCA 2WWSA 5IJRA 4PBPA 4B3NA 5JOYA 2VNOA 1ND3A 1YRZA 5C9AB 4NHMA 2VU9A 3ECQA 4BOWA 2Y64A 1V9U1 4Q8KA 5A3LA 1IQAA 1YXWA 2BBAA 2WNEA 4IUGA 1ULOA 4DPNA 1SBEA 1FXZA 4FPFA 1JH5A 1W28A 2BOJA 1MZ5A 2RDSA 2ZHMA 4PIYA 2CDOA 2XL9A 4YW7A 5ERLA 3THDA 4HONA 2A7AA 1IOAA 4Z82A 3SXWA 5F3EA 3H7YA 4KH9A 2ZMKA 1UZVA 2VZUA 4FQZA 1OFSA 2ORXA 3BTAA 4D6RA 5G05L 4CCOA 1VB2A 4QWNA 1BVVA 1VAMA 3FLRA 3BB6A 3BYWA 1DGLA 1HQNA 1OH4A 4B4PA 5I0SA 1EAH2 1L7QA 4S2HA 1Q56A 3W58A 1F5FA 3M1HA 3TB0A 5CVRA 5ABJB 2JDHA 2DTWA 3AKSA 3K51A 3IB3A 5I8TA 1WA6X 4CP9B 3MO4A 1A6CA 4NMIA 3ZFFC 2YDEA 3L2HA 1WKYA 5FP7A 4HL0A 3WV6A 3RGBA 4P08A 2F4PA 4WM8A 4OVEA 3SISA 1QOOA 2VH9A 3VD5A 5FUPA 1UD1A 3SHRA 3BPZA 2WWJA 3V0BB 1PGSA 4OULA 1A34A 2X10A 4R9DA 1XNAA 2K0GA 3J26N 1C1FA 4Q1RA 1KITA 5FTTC 5A7SA 3AMQA 2HWF2 1K42A 2BP6A 3L9JT 1GMMA 2LS6A 4LITA 5F39A 4MGIE 5LASA 1W6NB 4CTEA 5F7UA 4YZ1A 3LOBA 2YBKA 2RS31 4CE8A 2IXKA 2EIBA 2UY8A 3AC0A 1LESA 2WN2A 2XVGA 4BIFA 4CEYC 4Y1YA 2WO2A 1C4RA 2LROA 2VZQA 3K77A 2GMMA 2QZ2A 4RGGA 4OFGA 2DFCA 2GNBA 1SEFA 2WJSA 4META 1OOPC 3VB9A 3E97A 5FPZA 4UFIA 1X33A 3GBGA 1VBD3 5FZOA 4XXAA 5GLTA 3TRSB 3MEPA 2R071 5FPLA 4XDPA 2W1QA 3DGTA 4MG2A 4LBQB 1CAUA 2E9QA 4A3XA 1PIV1 4CCMA 3UGFA 4W4ZA 4JRLA 4LIVA 4DXRA 1PO23 1GNYA 1VMJA 2VCAA 1I9RA 1QQP1 4JRAA 2VOWA 4LUMA 3IAQA 4LLFA 3CBNA 4CP1A 5DAQA 5JR7B 4HK8A 1COV2 4LJHA 2GN7A 3OGVA 4QPYA 3CLPA 3ZR6A 1UYZA 2YV8A 5CEHA 2VZRA 1TG7A 2VOXA 5JSPA 2PMWB 5L7OA 2W5FA 5JXIA 1COV3 4XF1A 4ZU5A 1ULEA 3ZSEA 4CDXB 1QHDA 4LA2A 1OLME 3NL1A 1FOD2 1LNSA 2JG9C 3ETPA 1W9WA 2VQAA 3ZXGA 5C9AC 2VG9A 2JD4A 5KXEA 1ZM1A 1NLQA 3VHRA 4ASKA 3PDQA 4A3ZA 4XACA 1FNYA 5EPAA 5A3UA 1T6BX 2RJ2A 1OF3A 5D21A 2ZTNA 3FUQA 5LATA 4JKMA 1CAWB 1FOD3 1ND2A 2X29A 1ZRIA 4K9SA 2ZZQA 2JDYA 5IAVA 4ATFA 3LAGA 4BH9A 1STMA 2ZMNA 2G9ZA 3BOPA 5FJHA 5A3OA 5J36A 5IK8A 1AYM1 4KBBA 4AEJA 3UESA 1V9U2 4XZPA 5BNOA 2FDGA 3BTZA 1DZTA 1PVC3 3N35A 4M4RA 4JGZA
chains in the Genus database with same CATH topology
2G4IA 2OUHA 4LBKA 2SBAA 4R9BA 2BNMA 1F8VA 4GH4C 1ZYBA 4CEWA 1M4WA 2ZX2A 3KLSA 5KXDA 1VRH2 3JB8A 4HVQA 5HBAA 4I30A 4UW3A 4E27A 4EN0A 3A4UA 3I2DA 2HWB1 1M06G 1D4M1 2YMZA 3KT4A 1VRH3 5GZDA 4DB5A 5AC91 2UYBA 4NWWA 1BEV1 3VBFA 1UAIA 1NLSA 4P9XA 4TYSA 1CN1A 4E9KA 2DF7A 4AHWA 2ILMA 3PTYA 2WNVA 3HT2A 3DN7A 1UX6A 2JICA 5GZEA 5HCBA 2UU8A 1MEC3 2ET7A 1TMF1 4KG8A 1PGW1 2WS93 3HWJA 2GNMA 1RUH1 3OGGA 4FPKA 4I02A 3N3HA 1E57A 3GHMA 2UYAA 3I8TA 4YFZA 2DVGA 3B3QE 5C4WA 3WXPA 4XBLA 1HW5A 4BE3A 3MZHA 3LA3A 4K40A 1AR61 2YZ4A 1QH7A 1BXHA 1CESA 2YYOA 4Q4X1 1AL21 1LB2A 3ILRA 4QX5A 5K8SA 3R4UA 2JDZA 5AFEA 3GYDA 5FRAA 4AI3A 3PNAA 4C0BA 2VMGA 2XWBB 1JYCA 3ETQA 1GQGA 1N3OA 3HAGA 5H9QA 3V0BA 1O3TA 2YUEA 3JBG3 2BTVC 1QQP2 4CZSA 4I3GA 4CDXC 1NG0A 4Q4Y2 1W6QB 3MPBA 1FV2A 1YFUA 4E2SA 4NPRA 1GSLA 2BYVE 4YW5A 2ZX1A 5JIAA 1OMIA 4I0BA 4S2DA 1W6NA 4YGEA 2R0HA 5AFBA 1G9FA 4AFCA 1IS3A 4I0WB 4Q4Y3 1C1LA 4LBMA 2B5HA 4WVMA 1NCRB 1BQPA 4EWEA 1GFF2 3MW4A 1PMIA 3CO2A 2Y26A 4GALA 4Z1VA 4BPZA 1Y3TA 1LOFC 4XHBA 1UPSA 1OQDA 1WCKA 2AENA 3C3VA 4FTSA 4YVSB 1I5ZA 1YFWA 4LBQA 3WVJA 2D6NA 4M0NA 3VL9A 1YJLA 1VBA1 2JXAA 4XBQA 4YM0A 2IFRA 1BCXA 1S1AA 3SCFA 1RUC1 4D3WA 2RM21 4RS5B 3MIFA 5EYXA 1FMD1 3WDXA 2DU0A 3AYAA 4AQSA 4IESA 5FO8B 5JZGC 3MYXA 4Q4W2 4YRDA 2YXSA 1H0BA 2NMOA 4XFAA 2JKBA 2DURA 1HLCA 1FI2A 5FO9B 2GAUA 1SFYA 1ZZ9A 4YYOA 2AREA 1RIRA 4Q4W3 3ZYGA 2XH6A 3VBOB 2WZPP 3FZ3A 3H3UA 3NV3A 2Z2SB 3V0AB 3EQEA 1UL9A 3EHKA 4KWJA 2YPJA 3ACLA 4IEZA 4X6RB 5C8CB 4FTBA 1G9BA 4J1XA 3CJIC 4FT8A 4LE4A 5AVAA 4XJZA 4K8FA 4GWMA 3NJZA 4LBOA 1BEV2 3TWIA 1QWRA 2IXHA 4FOVA 2WIIB 1DHKB 4Y5Z0 3JD71 4Q0PA 1W6OB 1HRV1 3KZ4C 5CU1A 5JOWA 3WW1A 1PZ7A 1FAYA 1LKNA 2BGCA 2W08A 1Y43B 1PGW2 2ZX0A 1QY4A 4P5HA 3O0VA 3LZZA 1DQ6A 3RYPA 2GNTA 1AYN3 2GNDA 1R093 2Q0AA 2HEWF 4F83A 2PAKA 1VIWB 1LEMA 1OQ1A 5KXEA 4A7KA 4EN7B 1HKDA 3MLJA 1LHUA 1AR62 3DPRC 1FT9A 3KT7A 4AGRA 2VOVA 4D7TA 1AL22 5KBFA 5I93A 3D4KA 4FSJA 4CDQC 4G3YC 3WD5A 3X29B 2MNGA 4GMP0 4XQ4A 1H1IA 3USSA 2X5IC 5H9RA 2PLV3 4XHXA 1JBCA 2P17A 3THPA 4AXOA 4OLLA 4XFHA 1H2KA 3RG0A 4AHYA 4Y20A 1ZZBA 1NCRC 2VY0A 4AGGA 5A33B 3WW3A 4IV3B 1BMV2 2H6CA 4DINB 3ES1A 1J3PA 2DVBA 3QOPA 1OLRA 2AGSA 3ZN5A 4L99A 1XYNA 1MZFA 2AZ5A 5GLUA 4P9WA 3CJXA 4RR3B 4IQPA 1PO12 4YVSC 4FQ4A 1AZDA 1XYPA 2PHFA 2ZGTA 1X36A 1TME3 1YNAA 2R0FA 5KXBA 5GLWA 4QHBA 1YFYA 2HJIA 1LECA 1UIJA 3NKTA 3ZFEB 2ZJCA 4A7ZA 4ES8A 1POV3 1RUOA 2B8MA 5T54A 1QH6A 1Z7S1 2R16A 1PO13 1QXPA 4DY5A 2A5ZA 1H8TC 2PHRA 1QJX1 4XQDA 4ATEA 1RVF2 3PMEA 2EXHA 3VBUA 1AXZA 3CNAA 4KNCA 4R4ZA 1RGSA 2VNRA 2RM22 5DUUA 1WCSA 1AR71 1XE7A 1N3PA 3MFAA 4GMP1 1CAXA 1RVF3 4DMIA 1HRI1 4IV1B 2QE3A 3NAPB 1W6QA 3MIHA 3K48A 3BIWE 1NXD1 5LRSA 1UZZA 2WNUA 4WZFA 3OD0A 4YW4A 2PAEA 1OPOA 4INDA 5FBZA 1ONAA 4XFFA 1JN2P 1AX2A 3WY6A 3W59A 2HWD3 2P37A 2GMEA 4E2GA 2XUMA 4IEVA 2H0BA 1EPWA 1GZCA 4UBHA 3WP6A 3GZAA 3D0SA 2D98A 2JECA 5CFCA 4QPGA 5CG8A 2BW8A 1U12A 4D7SA 4N53B 5CBLA 4W65A 1GANA 4BYYA 1C8M1 1MS4A 4RQPC 4YARA 4NOTA 3QH7A 3TBDA 3WR0A 4A7YA 1MS5A 3G7DA 5FAXA 1DQ2A 1X7NA 5SV8A 1VBB1 4RS5A 1RUF1 4I3PA 1ALYA 4Y24A 5DDJ1 3V65A 4WBBA 2OIIA 1VBE3 4UW5A 4M3CB 4UBGA 1W39A 4Q0UA 4PLNA 2CGNA 3FWEA 3FFZA 5HCFA 4CDUA 2ZOEB 3T2TA 1CJDA 2Y38A 5JI7A 3WCRA 5C33A 2GDFA 2I45A 3AYDA 4ORFA 3ES4A 1EPZA 3ZPYA 1RHI2 3VBOA 3ASIA 4IEUA 5A32B 4CDWB 4ASMB 2RR11 4DZGA 3AMHA 2C9AA 1MS1A 3RQ0A 3AM2A 4AVVA 1RHI3 4BZ4A 4KWLA 1J1TA 1LHNA 1S0BA 1K5MA 4BA6A 1ULFA 4M01A 1DYKA 1EV13 1YI9A 2AR6A 1W6OA 3AMNA 3H9AA 4RR3C 5FQ0B 3RMXA 5JIUA 3AP5A 1SBFA 4AVCA 3DL3A 3PJQA 3ZFFB 3R4DB 5E8AA 2R062 4ZKTB 3VHOA 2HWC2 4HK9A 4DXZA 3AB0A 1PM7A 1T6GC 1HIXA 3B7MA 5DUVA 5K0UA 2D93A 4OHXA 4YW2A 1ZBA1 2BWAA 1C8NA 5D8AA 3TYJA 2R063 2UWCA 3KM5A 4E4DX 2HWC3 2VXRA 4QQLA 3NV1A 4LEJA 2CYFA 3O12A 2JX9A 1GR3A 1NA1A 5KHJA 1UPIA 4QPIA 3ZDSA 4E2QA 1NE4A 3FJSA 1YLLA 2CWSA 2ZAAA 1VB4A 2RS51 3S7IA 1VBC1 4LHNA 3VKOA 3POSA 2XL7A 5DZFA 4FP2A 4IERA 5EJ3A 4XW3A 1KRIA 3WZ1A 2FZ2A 2WZR1 1S0CA 3N7LA 1LOBA 1A3KA 5FFOC 4YZ3A 4LO4B 4W6WA 3AKQA 3WW4A 2PYTA 1DZQA 1KDKA 1H4GA 3ZFGA 4Q29A 5A33A 3NSTA 4IXLA 3AX4A 4AYUA 2D7FA 3G6JB 4Q4V1 2R49A 1A8MA 5F6LB 4K6BA 4AVAA 2IFWA 2LALA 1KFUL 4XETA 4M00A 2LTNA 3AP4A 1UKGA 2PHWA 1EYBA 4XE9A 4IETA 3E6CC 2A3WA 3PMSA 4XILA 5BY5A 3VL8A 4AHXA 1WLCA 3H8UA 4Z07A 2RS12 1AR81 1RUD3 1RITA 2O1QA 3ZMOA 4Q27A 3OY8B 1FPN1 1TQ5A 1DDLA 2D43A 5HXVA 4XIOA 1C8M2 3WW2A 4YZ2A 2JG9B 2RS13 4Y22B 3AZZA 4WM8C 4HMZA 3ZSKA 3ZXFA 1G7YA 1XNCA 1VBB2 4HLTA 3FHIB 4AEDC 2XPJA 3FC0A 1RUF2 1ZZ7A 4JDMA 4C1XA 5T5JA 2D97A 5SV5A 1WBFA 4IV1A 3NAPA 1JYIA 4CDWC 3HIFA 5J48A 1V00A 3I54A 1VBB3 1QJY2 1R081 1RUJ1 2ZHKA 4H14A 4MSVA 4QQ2A 4HT1T 5GKAC 4B4QA 4XJ8A 4MV2A 1QJY3 1HV0A 3NW4A 4YGCA 4DNYA 4DQAA 1Q3EA 4TWTA 2RR12 3BU7A 2AUYA 1CAVB 1AXYA 3IT8A 3NWKA 2EXKA 2VULA 4GH4B 3PVBB 2FHRA 3M3IA 4N53A 1EAH3 2VVEA 4XQWA 5E88A 1Y9QA 1LODA 1LRHA 4XFIA 3MF9A 3MIGA 3O5SA 3UJOA 3VBSC 2BPA2 3JQWA 2Q4SA 4Y4YA 3QACA 2E7TA 4YVWC 3UJQA 3VBRA 4N43A 2DVDA 1NY72 4Q8LA 1URXA 1LHOA 3QD6A 1SMVA 4SLIA 5IK7A 1ZBA2 3J8F2 2D6KA 4LO5B 4QQHA 1ZX5A 2HWF3 2YHJA 3UKVA 3BODA 1O5LA 2QDRA 1IHMA 3HN1A 1RUI1 5L7OC 1DQ5A 1IS6A 2JG8C 2DCZA 1ZBA3 3J8F3 4F7ZA 3D82A 3WG4A 2CAUA 3NKGA 1YI7A 4AVBA 2B39A 1QOTA 2OZ6A 3I59A 4V1PA 1LGBA 1XU2A 2RS52 1D2QA 1VBC2 3V56A 4EWAA 2ZHLA 3HR9A 1KXGA 1ZBE2 4AI8A 2ERFA 1APNA 4K21A 3IIAA 3A0KA 2ARBA 4XBNA 1RUNA 4FPGA 5DUXA 1ND2C 2WZR2 4AQ2A 2UURA 2A6WA 1VBC3 4XF0A 4P9GA 2D6MA 4KG0A 1XNBA 5FDBA 1ZBE3 4KGQA 5FQ0A 1OA3A 1WD4A 3H1YA 2P2KA 2MPFA 2Z79A 2ZGSA 4M0HA 1S0IA 1PNFA 4GQ7A 3UKNA 2R041 4Q4V2 4JGZC 3WHTA 1SLLA 2XJUA 3SITA 2CY6A 4RSUA 3OJBA 1C28A 1SLBA 1V6NA 4GIQA 2UWAA 2GSYA 1WW7A 5KC6A 1PK6A 3ZX7A 2D3PA 2B45X 4I09A 4YM2A 4XXPA 4WVVA 1VAVA 4MUVA 1ENXA 3AZWA 4FPEA 1Q8SA 3VZJA 3T1LA 4B7KA 1HXS1 1X8EA 4BWOA 3I7DA 3VKMA 2NQYA 1FPN2 1XNKA 3MPPG 4NN0A 2E51A 3SNMA 4CEYA 1LGNA 2NM1A 1V6KA 5BNPB 1UKRA 1UN1A 1MR5A 4X8PA 5T55A 1OOPA 3UV9A 2BBVA 4PDWC 1QMJA 1AJOA 1JOJA 3VZNA 3ZSJA 3KS7A 1CQ9A 1C3HA 1C57A 3CF6E 2WNVC 1V9U3 3D8CA 2N7GA 1R082 2JE9A 5BNNB 1HV1A 4KWKA 3ELNA 5JWPA 4FXKB 1V70A 3ZIWA 1DLLA 1UW8A 2QDNA 5T3NA 5JZGB 1HX6A 1XU1A 1PVXA 2A6YA 4FPLA 4ZU7A 1NE6A 2MHFA 3WG1A 2WL1A 1W6PB 1BVP1 1GQHA 2WT2A 3OY8A 4P9YA 3KCXA 1WGPA 2ZGPA 3LGRA 1BBT1 1CPNA 2JG9A 2EIGA 5C9AA 4Y22A 3RPQA 2ZX3A 4RHV1 2Q5TA 4JC1A 3M8LA 3TAYA 3WNXA 2V09A 4QXKA 2V73A 4WV8A 5EZWA 2CTVA 1ENSA 3CJIB 3ILFA 1B35C 5LK5A 2CNAA 1BYHA 5J37A 1NYWA 5FOBB 2VW2A 2RS32 2BVVA 1DGWX 3ZSMA 4E4ZA 2P3IA 2JE7A 1A78A 1ZRDA 4LO8A 4FOWA 3D5OA 1RUI2 5HI0A 4PJYA 1N3QA 1O4ZA 1U5IA 5J7MA 2RS33 4AFAA 1POV0 3AFKA 3VZOA 1SCRA 1SDWA 4LO7A 5ABJA 1QNYA 3RS6A 3KMHA 4HPKB 1UU4A 5FLIA 5KXCA 1QNWA 2DVAA 1RC6A 2XHKA 1BK1A 2A6ZA 2R072 4AI1A 4AHZA 2BNNA 4GH4A 4ZXKA 2CV6A 1PIV2 2QKDA 3D0JA 4XTMA 1MS0A 5BNQA 4DRRA 2NYYA 3DPRB 3RJ2X 3IPVB 2R073 4BCUA 4P9JA 1WLDA 1H30A 2DCKA 3AMMA 1PIV3 4AEMA 4CDQB 2EAKA 1S0EA 4ES9A 4COZA 1U5XA 4MXVA 1LOGA 2G9FA 1RUG1 2Q30A 2X5IB 2X53S 3VN4A 1H4HA 1UCXA 1QQP3 3E6DA 3MI8A 3NVCA 4EJRA 3U11A 5JSOA 4NVPA 4XIKA 5GALA 4NR1A 2EAAA 1MQTC 2OUJA 3FBYA 3WINE 4B7EA 1TNRA 4UXAA 4Y1VA 4MGZE 4AG4A 4Z8BA 2D44A 2XKOA 3VBHB 5BNPC 3LSDA 3R4SA 2RMU1 2HYKA 1QGLA 4H7MA 3RSJA 3ZO0B 3QH6A 4XMAA 4OI4A 3ENRA 2GH2A 3ZXLA 1LR5A 3WDTA 4MVTA 4AGVA 3AZVA 4XJAA 1U0AA 5IK4A 2XJRA 1AUYA 1ZREA 3AJYA 1GV9A 4N9IA 3SLIA 1AYM2 2PHUA 3INAA 3OBRA 5BNNC 2R1DA 5H9PA 4S2FA 4K1YA 1QDOA 1Q8OA 2DUQA 1NCQC 2Y0OA 4HVRA 2ZKLA 1WW6A 2A6XA 2K9ZA 4HSJA 1AYM3 1H8TB 3GZTB 1CJPA 3JU9A 4YGBA 4JQRA 3H0OA 1EY2A 1ZRRA 5IT6A 1WMFA 1DIWA 2VNGA 3ZXDA 1FYUA 2Z69A 4FBFA 3WP3A 1OQEA 1AR91 2ES3A 4CDXA 3B01A 5CIRA 3AZYA 5GJ6A 3IDEA 2VW1A 2P3JA 4R8HA 1ZZCA 4WM7C 4YG3A 2ETEA 1X82A 5J96B 1YUDA 3CU7A 1QKQA 1F9KA 1MVEA 2HWB2 1D4M2 1GBGA 1YJKA 3WDVA 1CAWA 1O91A 5AC92 3I4IA 1LU1A 1VJ2A 4L92A 3P3PA 4O9GA 3ZSLA 2OPKA 1LGCA 1R1A1 3J9SA 3WLUA 2HWB3 1LOFA 3RWNA 1D4M3 3ZXEA 2WFF1 4GB31 5FPXA 1NOVA 5AC93 1BEV3 3WUCA 4PIXA 5IK5A 1TMF2 1MZ6A 1AX0A 3M3EA 1RUH2 1KJLA 3OTFA 4RQPB 5LRRA 1D0HA 1ZA4A 4RGAA 2ZGOA 5GZGA 2K2SA 1G9DA 1OA2A 4KQ7A 4JGYC 1TMF3 1S0GA 3B5LB 4XDQA 2QCSB 1RUH3 2I07B 4HANA 4YW3A 1HQWA 1IPKA 1UU6A 2PELA 1A8DA 4U36A 4N7UA 3S6PA 4Q4X2 5JZGA 5E1RA 4MXWB 1OD5A 1W6PA 2ZA9A 3E5QA 1SBDA 4XF4A 1AR63 4AVTA 4OI2A 5EWSA 4Q4X3 5DUWA 1AL23 2I2SA 1DYPA 4OHYA 4KGGA 3FX3A 2HWE1 4Q1PA 3JCIA 4XPVA 2BNOA 3APBA 4JDNA 3VBUC 2BQPA 2GC0A 3AZXA 4TLFA 3LCPA 3VBHC 5KHHA 2PN5A 1OSGA 4L11A 3CJIA 3KGLA 4L9BA 2NP0A 4JTNA 2IXIA 3B02A 2BWCA 3SH5A 1CONA 1WW4A 4FPHA 5JOXA 1Z78A 1YIPA 2PHXA 3N4MA 2JJ6A 3BOWA 1O3QA 1BZWA 2XBO1 2AH2A 4ASLA 1S2KA 4AW7A 2RMU2 1O4YA 2PFWA 3JQXA 4AE2A 3AP7A 3SCGA 4CP0A 3VGIA 5I91A 2GN3A 2AYHA 5CNAA 4GA9A 2RMU3 4TSVA 4FPOB 2GC2A 4EN9B 2FMYA 4MH0E 2DYCA 1VBA2 5BUVA 3U0ZA 1XQNA 5FLJA 1FNZA 1RUC2 3DPRA 1GLHA 3ZMNA 3IPVA 4YM3A 1FMD2 1GNZA 4D94A 1S0FA 1DU3D 3N36A 3JB4C 3FFQA 2EF6A 2VUJA 1VBA3 1W2UA 2WQ4A 4YFWA 3QCWA 4YG6A 2WINB 1RUC3 2RM23 2X5IA 1FMD3 1BKZA 3RYRA 4BM8A 1ND3B 4HZFA 1AR92 3UK9A 4Z92B 1YHFA 5ACA1 5JPNB 1NCRA 4QGLA 1W6MB 1JUIA 1ZZ6A 4CYDA 3AYEA 3MLLA 4GXLA 4LO6B 5GZFA 2B9UA 3WHUA 5CFDC 1PZ8A 2MEV1 4YVSA 1OLQA 4XTPA 3M3OA 1DF0A 3JD72 1AHSA 1HRV2 3PVEA 1RUE1 1CIWA 2TUNA 1Q43A 2WFF2 4FXGB 4GB32 4L2NA 1CGPA 2LUWA 2DCJA 1Q8VA 2W52A 1I3HA 2PQQA 2QZ3A 4G4FA 1H8TA 3JD73 4YM1A 1HRV3 1O3RA 2DUPA 5GM0A 4GB33 2Z5WA 4R52A 4WM8B 1H2NA 2BUKA 4ONUA 4XOGA 4K3UA 2G9GA 1WBLA 4UW6A 4AFDA 4PQ9A 4AEDB 2W68A 1ZZ8A 4Q0SA 4M3CE 4LLOA 5I8YA 4MGYE 2Q1ZB 5F6KA 3V0AA 1FATA 2ARXA 2GC3A 4W6YA 5FREA 3WQ7A 3R05A 2JENA 4PBOA 4HSLA 5C8CA 2KA3A 1G86A 2EXJA 2WA3A 1D2SA 3WP5A 2ZGKA 1S55A 1LENA 3W9AA 3E5UA 4YGDA 2PHTA 1DFQA 5A3MA 2B46X 5KHKA 1CPMA 1OI6A 1IKPA 4P9IA 1ZRCA 3SH4A 4R4XA 2X8KA 3E6BA 1UIKA 3CEWA 3ZFGC 2O8QA 3LSEA 1VP6A 2RJKA 2OYZA 3PHMA 4X8NA 4OHVA 4X6QB 1CAUB 4Q0QA 2TNFA 1F5JA 2Y0IA 3OGJA 3VBSB 2GH8A 2ZGRA 4YVWB 3WDYA 2B42B 1SQ4A 4YG0A 3OYWB 3AFGA 1Z7S2 1GICA 1XYOA 5J98B 3LB9A 4IEXA 3ZYIB 1QJX2 3MF6A 2DCTA 1OPMA 3B9IA 3USUB 5L7OB 3U4XA 1B09A 4G9SB 2JG8B 1Z7S3 2DUOA 4FAHA 1VBD1 1ND3C 1AJKA 1AR72 4HKOA 1DGRA 4Y1UA 1QJX3 1DGWA 1HRI2 1S2BA 1OFNA 2VVDA 1QXRA 4IV3A 4IL7A 1MZEA 1RTVA 1ND2B 4C91A 1AR73 3KGZA 3O7OA 4GMP3 3RNSA 1PO21 1HRI3 1VLNA 1ENQA 1N1YA 1J3QA 5I0UA 4XYXA 5ACA2