4L11A

Structure of the c-linker/cnbhd of agerg channels
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
198
structure length
198
Chain Sequence
TARYHTQMLRVREFIRFHQIPNPLRQRLEEYFQHAWTYTNGIDMNSVLKGFPECLQADICLHLNRNLLNNCSAFEAASPGCLRALSLKFKTTHAPPGDILVHKGDVLTYLYFIARGSIEILKDDVVMAILGKDDIFGENPCIHSTLGKSNSNVKALTYCDLHKIHRDDLLDVLDLFPEFYDSFVNSLEITYNMRDEEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords AGAP007709-PA
publication title Structure of the C-terminal region of an ERG channel and functional implications.
pubmed doi rcsb
source organism Anopheles gambiae
molecule tags Metal transport
total genus 48
structure length 198
sequence length 198
ec nomenclature
pdb deposition date 2013-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4l11A02
5E16A 3LA3A 4XFHA 1CAUA 2H6BA 3MZHA 1RUOA 4KL1A 5I91A 4R52A 1ZZ8A 1RL3A 2O8QA 2Q1ZB 2WFPA 3H1YA 1O5LA 2VECA 2D5HA 3E6BA 1EP0A 4TLFA 4HBNA 4BYYA 1ZRFA 5I0SA 1VJ2A 3LA7A 5CVRA 1IPKA 1YLLA 4UBHA 1Q3EA 3LZZA 4BH9A 4NVPA 4IERA 1CAXA 3DV8A 5KBFA 5KHJA 4B29A 5JR7B 5HI0A 3LWCA 4LA3A 4LTAA 3ES1A 3LA2A 2ZKLA 1PM7A 3B02A 3EO6A 4Q0VA 2ATFA 1O4TA 2BYVE 4K8FA 4QGMA 4E2GA 1ZZ7A 1J58A 1YWKA 3ACLA 5LEKA 4XFAA 4MGIE 4Q0QA 3H9AA 2IC1A 1RC6A 4QX5A 1UW8A 4EWEA 1DZRA 4LUKA 4Q0SA 1X7NA 1SQ4A 1LKNA 1CAVA 5J7MA 3SMHA 3NL1A 1Q43A 2XL7A 5JCTA 1GQGA 4JTOA 3H1WA 2EAAA 3EBRA 3BPZA 2KXLA 2K9ZA 1ZRCA 1J3QA 3ES4A 1Y3TA 2CV6A 2ET1A 2BNNA 3UKNA 4ZU7A 3CO2A 1PMIA 2QCSB 4MUVA 5BV6A 1J59A 1X8MA 5JSPA 3OCPA 3M70A 4XFFA 4L11A 3WW3A 1XRUA 5I8YA 5KHGA 2F4PA 1WA4A 1UIKA 2Z2SB 4Z82A 3LAGA 3C3VA 3FJSA 3FE5A 4PIYA 3D82A 1O5UA 2XL9A 4R8HA 1IPJA 1OMIA 3UKTA 4AQ2A 2CAVA 4WZCA 3IIAA 4I2OA 1DGRA 2I45A 2EA7A 4E2QA 5LRRA 1Y9QA 1TQ5A 5C8WA 3E5QA 1NZCA 5EFUA 2IXIA 3QACA 3U0ZA 2XLFA 2B5HA 4IEQA 4OFGA 3PVBB 1RGSA 2H6CA 1DGWA 3ELNA 5AVPA 1CAWB 3FFQA 4JV4A 4XF1A 4X6QB 3E5UA 3EQEA 4X6RB 1YFYA 3G7DA 1U12A 3HT2A 5FQ0A 1H1IA 4IETA 1J3PA 4EV0A 2UYBA 4IESA 4LLOA 5CU1A 3SCGA 3VHRA 4YSFA 4N9IA 1NYWA 2IXLA 4HVQA 5FPZA 4BHPA 4XF3A 4QGNA 1J3RA 4XETA 3RDIA 2WC2A 2C0ZA 2IXHA 2D93A 3I59A 4I09A 5I8TA 2GH2A 3RYRA 1X82A 3IDBB 2XLGA 5KHHA 4WBBA 2E9QA 2XHKA 3S0MA 2BNOA 2MNGA 5FCCA 4HSJA 4YARA 5LEJA 2H0VA 2UYAA 1YFUA 1O3TA 2QDRA 5C6CA 1JUHA 1ZREA 2PQQA 4L2NA 4UBGA 2EVXA 3LOIA 4EROA 3FX3A 2Q4SA 2GC0A 4AXOA 4F8AA 2ET7A 3H3UA 5K8SA 4DINB 1OD5A 1OFNA 5FPXA 2IXCA 1EPZA 4O9EA 4HLTA 4FAHA 2MPFA 3E5XA 3I7DA 1SFNA 3ST7A 4MV2A 3JZVA 3E97A 2P17A 2PHLA 3FWEA 1RTVA 1UD1A 2OZJA 1ZX5A 1OI6A 2D5FA 2Z69A 4P9GA 4QM8A 1YHFA 1O3SA 3E6CC 5EZWA 3FHIB 2CAUA 3D0SA 2GC2A 4XFBA 1WGPA 5BXXA 2ZCWA 4I01A 4RD7A 4O9GA 3RYKA 1I5ZA 5I8SA 2Q30A 5E1RA 1XE7A 3CF6E 5F1RA 2N7GA 3GYDA 2FQPA 3NKTA 1YFXA 1HW5A 2DCTA 4IEZA 4CYDA 1ZRDA 3NVCA 3H8UA 5KHKA 1GQHA 1LRHA 3CLPA 1QY4A 4EWAA 5J48A 3L2HA 3OGJA 3FZ3A 4ZU4A 3U10A 4AVCA 1UCXA 2OZ6A 3EJKA 4J1WA 4LEJA 3RYPA 1YFWA 2O1QA 3S7EA 4ORFA 1V70A 3HIFA 5BY5A 4IEOA 4Z07A 5BPXA 1NE4A 3DN7A 2D40A 5J3UA 3BCWA 4LULA 3M3IA 4HN1A 1ZVFA 4XF0A 2IXJA 1I6XA 4E2SA 1LR5A 2PTMA 4KU7A 4IEUA 3MPBA 4GULA 1NXMA 2QJVA 4XFCA 4BIFA 3WW4A 4LUMA 4IEPA 1ZNPA 1RUNA 4ONUA 4JVAA 3DL3A 3H7YA 3KSCA 2BNMA 2MHFA 4AVAA 5LRSA 3KCCA 4IEYA 3QOPA 4QM9A 3BALA 4ZU5A 2PA7A 1CAUB 5I0UA 3HT1A 4Q0PA 4YRDA 3OD0A 3RZZA 3IBMA 4PIZA 3TNPB 3CEWA 2GU9A 4XF4A 2PAKA 3IDCB 5KHIA 1CAWA 2GC3A 4HVRA 3DKWA 4MX3A 5FLJA 4I02A 3TNQA 3U11A 1CAXB 3MDPA 3EHKA 2QNKA 4H7LA 1FXZA 1SEFA 1EYBA 3RPQA 2PYTA 4KWLA 4MGZE 2ETEA 2V09A 2XKPA 4IEXA 1CX4A 3SCHA 5FDBA 4I0BA 3E6DA 4WVZA 1FI2A 4I3PA 5I93A 2XGXA 4XFGA 5FLIA 2CGPA 1FT9A 1UPIA 1G6NA 3NJZA 4HN0A 5I0TA 1X8EA 3SHRA 2OA2A 4MGKE 3ROUA 1O7FA 4AVBA 1NE6A 3ETQA 1QXRA 3PLQA 3USSA 4Q29A 2QVSB 2PAMA 1O3RA 4HSLA 1CAVB 2OPKA 2VPVA 1UIJA 2GZWA 4D7TA 2BGCA 4YNIA 4EWDA 2XKOA 1QWRA 4HMZA 1VP6A 2UY9A 3UKVA 2Y0OA 3WW2A 4PJYA 4QMAA 4F7ZA 4Q0UA 4AQ6A 3O14A 3KGLA 4IEVA 5JSOA 5CADA 3HQXA 4YYOA 1ZRRA 4QXKA 1VR3A 4J1XA 5BUVA 4KU8A 4JTNA 4MZUA 5JAXA 5T3NA 2K0GA 2UY8A 3SCFA 3KMHA 4A2UA 3NSTA 1ZZBA 1WLTA 1H1MA 2B9UA 3H1MA 3MYXA 1YUDA 4IEWA 3SXWA 1XE8A 1CGPA 3OF1A 3BB6A 4XFIA 1ZZ9A 4PIXA 2GAUA 3WW1A 3GBFA 1ZZCA 1L3JA 5FQ0B 1ZZ6A 5FLHA 4HZFA 4KWKA 4OLLA 4UXAA 3R6SA 1LB2A 5I0RA 4FT8A 3D0JA 3PNAA 4LA2A 3ZDSA 2FMYA 3NW4A 2GC1A 4QGLA 5D1IA 2PAEA 4HVOA 2OYZA 4FAGA 4XEZA 4FBFA 1DZTA 3BU7A 1EY2A 4META 2B8MA 5JSRA 3N4MA 4D7SA 2BEOA 1O3QA 3OTFA 3S7IA 3I59B 3H7JA 4N9HA 4MH0E 2HKXA 4XF9A 4KWJA 3H3ZA 3CL1A 3IWZA 2PFWA 1Q5OA 4I0AA 4MGYE 2Q0AA 3KGZA 1J1LA 1QXJA 2XLAA 3CJXA 2IXKA 3I54A 2HJIA 2PHDA 2VQAA 3H50A 3RNSA
chains in the Genus database with same CATH superfamily
5M0TA 1PO23 2YU1A 4MSVA 4XFHA 4RGAA 4CP0A 4OUMA 1SHWB 4KL1A 1PIV1 2EALA 3DPRC 5F6LB 1RL3A 1YEWA 2P6CA 1WBLA 3ENRA 1W0PA 2VECA 3WNMA 4QPWA 3IB3A 1H8TC 1EP0A 4TLFA 4BYYA 4CPBD 1AXZA 5FXVA 4EN6B 1ZRFA 2NP0A 5CVRA 2XJPA 2FBEA 5HXVA 2NLRA 1RMU1 4IERA 1GZWA 1MVEA 4IDZA 5BYNA 5ABJB 3O12A 2QDNA 4B29A 1IHMA 4LKDA 3VGIA 4B4RA 4E8CA 1X36A 2CSGA 3ES1A 2ZKLA 5FYCA 1B09A 3AYCA 3ZYRA 3OBAA 2BYVE 2D7FA 2Z42A 4IGQA 4E2GA 1QOOA 1ZZ7A 2AZ5A 2OQ6A 5JIUA 1UOFA 4DFSA 2Z5WA 4WV8A 3ZFEB 4RS5A 2AC1A 3HN3A 2CU5A 3ACLA 1DQ2A 5LEKA 4XFAA 1QJX1 1QNYA 1W6NB 3M8LA 4UYBA 2BJSA 1BVVA 4Q0QA 4QKFA 4E4DX 1RC6A 3H42B 1MR5A 2RDSA 1Y7BA 4KG8A 1G9AA 2LS6A 5EIYB 1A6CA 1GR3A 4QXCA 1R1A3 2Y0IA 5IWFA 5IVYA 2CGNA 1RUE1 1DYKA 1OPMA 3RWKX 4Y24A 5F5IA 1NA1C 3IT8A 2VG9A 1H2LA 3NL1A 4AI8A 1HRV2 3E1F1 5HCFA 4LPLA 1Q43A 4ASMB 1YNAA 1AJOA 3UT0A 4XURA 4AFBA 1ND2A 5JCTA 5K0UB 1STMA 2WYSA 1ZBE2 1R092 2KXLA 2Y8KA 3N9QA 4KBZA 5C8CB 2BBVA 1LHUA 4CDQB 1YCIA 1J3QA 1JXNA 3C7OA 3T4HB 2ET1A 1WCKA 4P08A 3UKNA 3WF3A 1HB1A 5FP4A 3CO2A 4ZU7A 3NJXA 4QX1A 1VBD2 4XQ4A 4M01A 5FYHA 4CDWC 3VLBB 1J59A 3MF9A 5C3PA 1HRI1 4YGBA 5DAPA 4OQ9A 3CJIA 1B35B 2YBPA 5FZFA 4XFFA 3WW3A 1K5MB 5KXEA 1XJAA 4LHLA 3FJSA 1X9PA 5EJ1B 3ZYFA 1JYNA 1BLZA 1RUH3 4CDXB 4HOOA 4XUNA 3J7MA 2OQ7A 1GQPA 2WWSA 1KITA 2BDRA 3HBZA 4IE6A 4IQPA 5H9RA 1VBE3 3HQUA 1I1EA 2RE9A 4AQ2A 4WZCA 5EJZB 3BODA 2ILMA 5A3OA 1LHWA 3VBRB 1AR62 5JMOA 1H0BA 1RYYA 1Y9QA 3Q8BA 1UYYA 4JKKA 1XNTA 2WO1A 5CIRA 3VBSA 1GMMA 3IPVA 3M3OA 3QACA 3U0ZA 2VVEA 3W20A 3BTYA 2DUQA 5FZ3A 1RHI3 4NWWA 3TN92 1FYUA 4E8DA 3I3BA 3UL2A 2H6CA 3DYMA 3JBG2 4FPKA 3ETPA 3FFQA 4H14A 5AVPA 1GWMA 1TMF1 4X6QB 4YPJA 4COYA 4HG6B 4RHV2 4X6RB 3G7DA 5GLZA 3J8F2 2VW1A 4PLMA 3VDBA 4LHKA 3VBFC 2E51A 2Q8DA 4WZFA 1GNYA 4AI3A 4BU2A 1UOJA 2WS92 5BNNA 4FSJA 2WN3A 4FFHA 4GMP3 5C9AA 3UK9A 1H6YA 1X33A 2VMHA 4IETA 4YVWB 2X5IA 1XB9A 4D8MA 2K46A 1ND3A 3ILFA 3MIBA 4XOGA 3WF1A 1UQXA 4IESA 2DFCA 5F39A 4XUOA 2WR9A 2YC0A 3RGBA 1JZ8A 5EJ3A 5FY7A 1PO12 3M3QA 2ZMLA 5F9TA 1S2BA 5DAXA 4QQPA 5JXJA 4PF5A 2VZUA 5FZ0A 1NYWA 3U37A 3UESA 3LFMA 2BFUS 4JQTA 2C5DA 2R6QA 1FV3A 3R05A 3A0KA 4IE4A 4O65A 4Y1ZA 4YGDA 2PHWA 5FPZA 4BHPA 1RUJ1 4YFWA 3IMMA 1RITA 1GSLA 2R1DA 1ZA7A 2DWRA 3VBHA 5FUIA 3OOXA 1TEIA 2QQLA 1SDWA 3IZOA 2ZGUA 4CEWB 1DGWX 3ZFGC 4DUWA 2GH2A 1R083 3AKQA 5LA0A 2R072 1GBGA 2XLGA 5FBZA 3ZXLA 4A41A 1WLDA 3THPA 5T54A 1E5IA 2GNMA 5IVEA 4E27A 4PQQA 3JCIA 5FCCA 1IKPA 1TE1B 4YARA 3H3LA 3RQ0A 4AVTA 1SLCA 1RXGA 4DY5A 4N53A 1JHJA 2UYAA 4FFGA 4AAPA 4CEYA 4UFMA 4OHWA 1HV1A 3HPNA 3QLQA 1PGW2 2VXRA 5DG1A 3VZJA 1L7RA 1YRZA 4YW6A 1AYM3 2O14A 2B7YA 1ZREA 1AR83 2PQQA 2VU9A 2EVXA 3WQ1A 4EROA 5FKCA 4JQRA 3L2YA 2CL2A 5CNAA 3TEZA 2GC0A 4AXOA 1EAH2 1WW5A 3AX4A 4UOJA 2Y60A 4XUQA 4AEMA 4B1LA 4F8AA 1IG3A 1NX9A 3KLSA 5FPXA 4U2AA 2IXCA 1EPZA 1MS1A 3ZIWA 4OZOA 1D4M2 2E53A 2ZMKA 1ULDA 4NIIA 3ZVXA 4LO8A 3N7MA 1LGCA 4AWDA 3VKLA 5KXDA 1VAVA 3PUQA 2JDYA 2K2SA 1O59A 2PHLA 1W9SA 4COVA 1WUVA 1W6PB 2D97A 1OI6A 3BU0A 1E57A 4HL0A 1PGL2 2XR4A 5ABJA 5A6YA 1RUC2 4FPEA 3D0SA 1ZA4A 3POEA 1WGPA 4XQDA 1PMHX 3NV1A 3NV2A 5E6HA 4DRVA 1MS4A 2UWAA 1HRV1 3RYKA 4QKDA 3VL9A 4V2WA 3ZSMA 2DVGA 5GKAC 4YZ2A 5I8SA 2FMDA 3ZFEA 3M7AA 5JPNB 1C1FA 1R091 1ASJ2 1W6NA 2VNVA 4FPOB 4X8PA 5LA9A 1PO22 3SLIA 5FO9B 3GYDA 3JU9A 5CA6A 2LTNA 2DCTA 3WNNA 4JGZC 1IS3A 1UO9A 3OBZA 2J1EA 4RGKA 3ECQA 4UW3A 3OGJA 3NQHA 2DFBA 2ZHMA 3FZ3A 5JXIA 1MS9A 1UCXA 2HYKA 4LEJA 1GOHA 4B8EA 1XPWA 1OA3A 2O1QA 1V70A 3AKSA 1DCSA 4LBNA 4QQHA 3HIFA 4AI1A 2XBO2 5K0UA 3MUZ1 2JG8A 5BPXA 5C8CA 4CDQA 2VBBA 3KHCA 1AR73 4FP3A 3OUHA 4NIHA 4JDNA 2VVDA 4LE3A 1ENQA 4FFFA 3WG1A 2RS13 2WN2A 4LULA 5CAZA 3AP6A 4L92A 1DQ6A 1VBC3 3FC0A 4XF0A 5EPAA 4I30A 1UKGA 1B35A 1UU6A 4DXSA 4XAAA 4XTMA 4XTPA 1UZYA 1FOD2 1K5MA 5DG2A 3TN91 1DGLA 1UOBA 4YZ3A 3W21A 1S0JA 4OHXA 4BJ0A 4FTBA 2QKDA 2JENA 3AP7A 2EIGA 1QJX3 2VZ3A 5LBEA 4AHZA 1HXS2 5L7OC 2ENRA 1R1A2 2E7AA 2ERFA 3AXEA 3J9SA 4KGGA 4KMQA 4RHV1 1F5FA 3WW4A 3WNKA 3ZSLA 4CDXA 1RUNA 4AVVA 3K48A 4ONUA 2DYCA 3HEIA 3I97A 3ZXGA 3DL3A 3H7YA 3SNMA 2WS91 3VBRA 3KCCA 2XVGA 4XHXA 5C7GA 3N9PA 3ACHA 4GA9A 4ZU5A 1QMJA 5FMOS 3WP6A 2PHUA 1KD7A 1AX2A 4K3UA 4WVMB 3VZLA 5I0UA 3LKJA 3GCWA 2Z79A 2GU9A 3POJA 2SLIA 2CWMA 3IDCB 5KHIA 2FDIA 5CISA 2XWBB 2J1RA 2ZEWA 3BIWE 1PO11 3DKWA 5FO7B 3KHBA 1BBT3 1JH5A 2W5FA 3N9MA 5FLJA 3S5QA 2E7QA 4OI4A 2FCVA 1CAXB 4YW5A 3TNQA 3ZXAC 3ZXEA 2QNKA 4CCKA 4YVWA 5IUQA 2PYTA 4FPYA 3SITA 5CFDC 1WMXA 1RUH2 1C5HA 1G7YA 5GZFA 3TYJA 3VDAA 4ITCA 3QD6A 1PM4A 2P4EA 4BZ4A 4Q4W2 3P5BA 3NMBA 5JOYA 1BQPA 5D2AA 2R071 2EICA 2R49A 2XGXA 3V56A 2RM22 5L9BA 2QQUA 1VB4A 4OYUA 4PI2A 1G6NA 2Y6KA 2VZTA 4WM7B 4LBJA 1PK6B 4EZ4A 5I0TA 3IAQA 1WMEA 4NHKA 1SDDB 3WOGA 3SHRA 1G9DA 4TTGA 3ROUA 4QDRA 1O7FA 2WZPP 4AVBA 5J96B 1JBCA 3SKVA 4LNVA 4CUAA 5C3SA 3T0DA 1PGW1 2VCMA 1NT0A 3GGLA 2VVFA 3TBDA 5A3PA 2WZR3 4Q29A 4XW3A 1UY0A 4HSLA 2VPVA 2JG9B 2Y64A 4KGQA 4CU7A 3WQBA 2VM9A 5IATA 1ACCA 3JXSA 2XJVA 2V72A 4XJUA 3HN1A 4HMZA 1KEXA 2E63A 1EAH1 4A42A 3FHAA 5F5CA 1US3A 1W8NA 1VBB3 1XU2A 1GLHA 1EUTA 2A70A 2OUJA 2WL1A 3PTYA 4RQPC 4Y1UA 4YVSB 5JIAA 4LO5B 5L9VA 2VNOA 4Q0UA 3WQ0A 4NIAA 1VE0A 3HQXA 4YYOA 3AK0A 4LHSA 4XDOA 4AL9A 2VMDA 1AYN3 2Q1FA 1IKQA 5D8AB 4MZUA 5ACA2 3UGGA 5BUVA 2LUWA 2BGOA 5EHDA 5LA2A 3WP5A 2UY8A 5AFEA 3WF2A 3RMYA 4A2UA 1PGL1 4JKMA 2V73A 1SPPB 5FP9A 4FQ4A 1RUC1 5A1FA 2OS2A 1IZ3A 4GZ9A 1JZ3A 2RMU3 4ZY9A 1SLTA 2JIJA 2W46A 1CONA 3MYXA 3DGTA 2RHPA 2ZGMA 3K2OA 4AQTA 4J25A 5GZDA 1OC1A 2NYYA 3DUIA 1S2KA 3L9JT 1MZEA 2G9ZA 2NN8A 3PVNA 1R082 2P3YA 4W6XA 4Y1XA 4FOVA 2LM3A 4AFMA 2KD7A 2XJUA 1ASJ1 4Q27A 2W0XA 1CJDA 2GALA 1PO21 1W2UA 2IVJA 4SBVA 2ZHLA 4UFHA 3U1XA 1W6PA 1ZZ9A 3T2PA 1C3HA 2X10A 3GBFA 5FWJA 4Z1VA 3ZN4A 1UX7A 3KV5A 5DUXA 1YQCA 4LKSA 1SBDA 1YI9A 2NM1A 1HB4A 1AYM2 3PUIA 3CDZB 4ATFA 4P14A 4KWKA 4GWIA 1NZIA 4YZ4A 3R6SA 2GSYA 4M3CB 2XBO1 4CPBA 2DCKA 3N9NA 4RR3C 5FMDA 3MLKA 3T08A 2WWUA 2EXHA 1Q8QA 1VRH3 3DF0A 4OUEA 2FMYA 2VW0A 2GC1A 2RR12 1MQTB 3ASIA 2ZGQA 2FDFA 4AFDA 2WRAA 1ZYBA 1BZWA 1A3KA 3I2OA 2W3JA 4XJ8A 2VUCA 3BU7A 4QHZA 5GLTA 1SZBA 2D3SA 3FBYA 2ZEZA 3I2FA 4XACA 2ARCA 1W8WA 3MPPG 1AF9A 5FPLA 2B8MA 4DXTA 5JSRA 1W06A 3I3EA 3VHNA 4ISQA 1WD3A 5LWBA 2EIEA 4YG0A 1R1A1 3OTFA 2DF7A 2PLV3 3I59B 3H7JA 3CHXA 4S2DA 1U5IA 4Y5Z0 2HKXA 4CCNA 1RUG3 4JHZA 1REEA 4XJWA 1HRV3 2W47A 3BOPA 2C24A 2PFWA 2D6PA 3GZUC 4ARXA 2R32A 3AZXA 3PVEA 4W4ZA 1ZBE3 3T4VA 2XUEA 5SV8A 3U14A 1EUUA 3OUIA 4HFSA 4AF9A 1LHOA 1RJ8A 2W94A 1KJLA 1PNGA 1G9FA 2VCAA 1VIWB 3CJXA 3HOBA 4RYDA 4K8RB 2WA4A 3PHMA 1VBD3 2IVIB 2Y6FA 3PUSA 5BNPC 4M3CF 2VQAA 4IV1C 4RS5B 5E16A 5H9PA 1GV9A 1O8SA 4CUGA 4WVMA 4URAA 1Q8SA 1XYPA 3K3NA 4BWOA 5CBLA 1ULPA 1RUH1 1UPSA 3OEAA 3WX5A 5GZGA 3GM8A 1MS0A 2O8QA 2WFPA 1AR72 2WNOA 4COZA 4DUVA 4Q4W1 2D5HA 3F2ZA 3BIEA 5FYSA 2RS12 1JYIA 4JRLA 2JDMA 4EE2A 5I0SA 1VJ2A 1POV1 2RM21 1KGYA 1VBC2 1A78A 2WFF2 2WT0A 3LA7A 3P3NA 3LZZA 3OJBA 4NVPA 2A3YA 1AR63 1CAXA 3DV8A 2BW8A 2DCYA 2CWSA 3ILRA 4NROA 1APNA 3LDRA 1K45A 3C7HA 4OI1A 3ZYBA 5L9RA 2D6KA 1O4YA 4XXPA 1UY3A 1BKZA 1K3IA 1H9PA 1DZQA 4PLNA 3O5SA 1MS3A 1O4TA 4JHTA 4LXLA 3JBG3 1ULEA 1FMD3 1W8UA 3VBOC 1NUKA 5FMCA 4YGCA 1DQ0A 5FY8A 1J58A 1YWKA 3J8F3 5J98B 2ARBA 5K9YA 2XJRA 4GMP1 3V64A 4MGIE 2D3RA 2VZPA 1ALYA 2YY1A 2YUEA 4WM7A 1PK6A 2P2KA 2VZSA 4JRAA 5H9SA 3ZKYA 3ZFFC 3JQWA 1YIPA 4MHRA 4EWEA 3ILNA 4N7IA 3WDUA 5C3RA 3NAPC 5AC93 3DKQA 1SQ4A 5J7MA 5ACA1 3SMHA 2JG9A 3VN4A 5C3OA 1URXA 3OGVA 1C5IA 1VAKA 4GJYA 3VZOA 2FDGA 1DIWA 2E6VA 3T30A 4A3ZA 4DB5A 1VPHA 1PX4A 2XL7A 2VMGA 4JZRA 2V4VA 1PO13 1RUI3 3KS7A 3AZYA 3KVBA 2P3IA 4NRMA 2PN5A 2ZHKA 3RG0A 1VB2A 2K9ZA 1WCUA 3NV3A 3S5AA 4CEWC 4YVSA 1ZRCA 2CV6A 1NCRC 5AVAA 4Y22B 4AEDB 4BMBA 1PMIA 3V0AB 2FD8A 1R081 1AUYA 3AM2A 3OCPA 5D8AA 4LT5A 4GWNA 4CDUB 5I8YA 4YM1A 5CG9A 5JI7A 4Z82A 5HV4A 4MGSA 3C3VA 4PIYA 1SPPA 3FE5A 3JQXA 1O5UA 4N43B 3RZGA 4A6SA 2HWF3 2XL9A 3AMNA 5HCAA 4R8HA 3WR0A 1GFF2 3KF5A 4NJ4A 1AYM1 3UKTA 1NAEA 2ZHNA 4URTA 1AR81 5A7QA 5LB6A 1DGRA 4PDWB 1QXPA 2ARAA 4QB2A 2FCUA 5DPNA 5LRRA 1TQ5A 3E5QA 3PVOA 2VOVA 1K5JA 1VBB2 5JZGB 1QOSA 2B46X 3K75B 4Q4X3 3W5NA 1JHNA 1CAWB 4XF1A 3A21A 1C28A 1WLCA 3ORJA 4OZXA 3VDDA 1QH7A 3HT2A 1CZVA 3I2DA 1H1IA 1S0EA 1AYN2 1D4M3 5JVVA 2YGLA 4XBLA 3OPZA 1KRIA 4N7UA 3JUUA 2J1UA 4XC9A 4M3CA 1S2EA 2WLQA 4Q1RA 3TEYA 1LENA 4Z92B 3M3EA 1QJU2 3WNXA 3ZSJA 2C9AA 4LORA 1J84A 3SH3A 2QQWA 1S0BA 5A6QA 5IAVA 2R0HA 3AZVA 5F8PA 2RMU2 3MEPA 1VALA 1KDMA 1LAJA 1HX6A 1MQTA 1D2SA 4XJAA 1C8M3 4UW5A 1O4ZA 3UJOA 3KCYA 4Y20B 1OOPC 3UGFA 5FY0A 5T50A 4DS0A 1LOFC 3OYWB 1OKQA 4Q8LA 2IXLA 3LEGA 1SLLA 4D69A 4QGNA 4BOWA 3RDIA 3S57A 1GWKA 2JICA 3W5MA 4ASKA 5IJRA 2OKXA 4RA0A 2A6YA 3I59A 5I8TA 5FZOB 1UN1A 3UJQA 3RYRA 2R16A 3IKWA 4LBKA 4QAWA 5FR3A 1GANA 1W9YA 3OD4A 4GH4C 1PVXA 1Z7S2 3S0MA 3U78A 4HXCA 5E8AA 3QBQA 3J7NA 2YGMA 1ZBA2 5FIXA 4BK4A 4HSJA 1WD4A 5A6XA 1ENRA 1VRH2 2ZKNA 2CDPA 1AR71 2XBO3 5JR2A 1YFUA 4K6BA 1DLCA 2QDRA 2VZRA 5C6CA 1W2NA 5ERLA 2RS11 1BK1A 3O1RA 1VBC1 4F3JA 4MADA 2ZABA 2ZEYA 4UBGA 2VZVA 4H3WA 2WT1A 3LOIA 3D8CA 3K4AA 3AFGA 1OHFA 1BHGA 2LRPA 2XONA 1UYXA 1VMHA 2Q4SA 4DEQA 5A33B 1NG0A 3H3UA 4UFJA 5IVVA 3AZWA 1S1AA 3CZUA 2D6LX 3KV6A 4DINB 1FOD3 4R9AA 3RZJA 1GOFA 4O9EA 4OQ8A 1EPWA 2PLV2 1DQ4A 3DECA 1JU3A 3A22A 3KD4A 4NWVA 2GN7A 4BPZA 1HXS3 1W3XA 5LASA 2DV9A 3AFKA 3LSDA 4QPIB 1NXD1 5C4WC 3E97A 3T0BA 4NIDA 1LU1A 3NKGA 3P6BA 1RUG2 3Q8CA 5FZ4A 3FWEA 1LEDA 1RTVA 4P9GA 4IE5A 1V9U3 4IE0A 1YHFA 3WQ7A 3Q9OA 1O3SA 3HNBM 4BDVB 3FHIB 5IYYA 2EXIA 3ZDVA 1CN1A 2CHHA 2JG8B 2VZ1A 1IS6A 5GM0A 2X09A 4DMIA 5JUVA 5BXXA 2X53S 1CIYA 1N47A 3HR9A 4O9GA 2A75A 4ZS2A 1BBT1 3RZMA 1YO8A 4LBMA 1DLLA 1F9KA 2WBKA 3AYDA 2OUHA 3NNGA 3MGUA 3RSJA 4EJRA 4Y5TA 1CX1A 2GMMA 1S4CA 4XMAA 2RS52 3OBTA 1MEC3 2VQTA 5FOBB 1H2KA 2TUNA 4Q4Y2 5T55A 3SISA 2LALA 5DAQA 1HW5A 3TAYA 1ZRDA 1G8WA 4YZ5A 3H8XA 1GQHA 1LRHA 1QY4A 3CLPA 4Y3OA 2NQYA 3NV4A 4IV3C 3WINE 4CA9A 3VBUB 4EWAA 3WUCA 4V2VA 3ZKUA 1UF2C 4M3CE 4AVCA 2DCJA 2OZ6A 5FYUA 4Q4W3 4QX2A 2VD7A 3POBA 4RL7A 4M0HA 4ORFA 3S7EA 3SQOA 2R0FA 3PU3A 1W8FA 1WA6X 1POV3 2RM23 1AJKA 3AB0A 4E4HA 3BUCA 2RJLA 1ULGA 4GQ7A 3I3MA 1XE0A 1A34A 3DN7A 5FZGA 1KS4A 1VMFA 5GZEA 2D40A 2WZR1 4ZXEA 5DMYA 2V4AA 3APBA 4Y22A 4AEDA 3V0AA 2C4XA 1FMD2 3M3IA 4HN1A 3V65A 4Y1VA 3GZEA 1YQ2A 4QPGC 1I6XA 4LBOA 4CUBA 5LBCA 3WVJA 1S0DA 3CNAA 1VBB1 2J1SA 4CDUA 5DAVA 4IEUA 2Q1MA 1WBFA 3MPBA 4GULA 1NXMA 2BQPA 2ADDA 3AP9A 4N43A 4DRRA 2QJVA 2VO5A 5FRAA 1BEV2 1WKYA 5AC92 4K20A 2HYXA 3WT3A 5F6KA 1AYN1 2EIDA 3HWJA 3M1HA 5EYXA 4JVAA 3USUB 2PELA 1OF3A 1OH4A 5BNOA 2WNUC 2QUOA 4PDWA 2C1FA 4IEYA 4LBLA 3T09A 3BALA 4NRQA 4EN8B 2J1AA 3LEMA 5ACA3 1RUI2 1PNFA 1CAUB 1ONAA 3PMEA 3RZZA 4OVEA 3IBMA 4GIQA 3WG4A 4DIQA 4ZZ8A 2RMU1 5JZGA 4PIZA 5FYBA 2Y6LA 3AJYA 2VMFA 3WDWA 1CAWA 5B2GB 5JOXA 2JX9A 4INDA 3SEPA 5IT6A 2JXAA 1YYNA 1RUF3 4GALA 4DPNA 5CFCB 3ZMNA 3AP4A 5T52A 4BISA 1JZ4A 4AEJA 1SG3A 4BLJA 4HPKA 1CWPA 1MPXA 2ARXA 1OLQA 4JX0A 3U11A 3MDPA 2WLPA 1KQRA 5FMBA 4DO0A 3I2HA 2VQUA 3KV4A 2VOTA 3D5OA 1EYBA 3RPQA 2VCBA 2Y38A 1LHNA 2IFRA 2WNVB 2ETEA 2HWF2 5GZCA 2AEZA 1V0AA 4AGRA 4YW1A 3K77A 4WVZA 2XXZA 3LDBA 3VKNA 2W1WA 2GNBA 3C2UA 4MYEA 4Y20A 2HWB2 5FLIA 1Z7S1 1FT9A 1F5JA 1H2MA 3KF3A 1E5SA 1UPIA 3MI8A 4P5YA 4RFT0 1ZBA1 2JDZA 2I2SA 3KQ4B 3OYWA 5A7OA 1NQDA 1VRH1 1X8EA 2OA2A 5F37A 4ZPIA 1NE6A 3PJQA 4Q4X2 4YW2A 2AYHA 1QU0A 2BV4A 2F17A 3ETQA 3WDTA 2GH8A 3USSA 5KC5A 4YM2A 1HN1A 1S0CA 1CAVB 2EF6A 2JB8A 1C57A 2RR13 4QT6A 4XDPA 5FZOA 2LW8A 2BGCA 4PI0A 4UT5A 5F32A 3TB0A 3WF0A 4CUCA 4EWDA 1NLSA 3C7EA 4OMDA 2WAOA 1VP6A 3K3OA 3ZYHA 3HVDA 3GDBA 3O0VA 5JLVA 1ULCA 1FNYA 2PLV1 3LE0A 5CADA 4FXKB 1PVC3 5C5TA 3RS6A 2GP5A 3AP5A 2YHJA 4QXKA 1C8M2 1TNFA 4AHXA 3WF4A 1RUG1 1O8PA 3GHNA 5T3NA 2Q8OA 3T2OA 2A5ZA 3WP3A 4CSWA 4ET7A 2K0GA 4NHXA 3KM5A 1BMV2 1XNAA 2DBNA 2BFUL 1S0FA 3NSTA 1OFSA 2WUHA 3NWKA 4JGYB 5FZLA 4WM8B 1ZBE1 3OPWA 5A33A 1NCQB 1T2XA 5A3TA 1H1MA 5A6ZA 4B7KA 3H1MA 5F7UA 5FPBA 1XE8A 4FPGA 4K1ZA 1GP4A 4MGQA 3MBWA 4XXAA 4RS5C 3RZHA 4JDMA 1CGPA 1JOPA 1OH3A 1VBD1 5FWEA 1HLCA 1UU5A 4U36A 5IVBA 4QPIA 4BIOA 3MV11 5LA1A 4C90A 2RJKA 2WO7A 3BB6A 4COUA 5IVFA 2RS51 4PQ9A 3B9CA 1VLNA 4CXWA 4PIXA 1Z78A 1OVPA 1TME2 3WW1A 1NY72 4P5HA 2ZTNA 2W92A 4LOSA 5FY4A 1T6BX 4BQ2A 1L3JA 1QJEA 3FHQA 1L7QA 1OKOA 2PHFA 5IK8A 4ZKTB 4G9SB 2HEYF 5FQ0B 4GAZA 4Q4V2 2A6ZA 1W6MB 5F5QA 4CXXA 5DUVA 3NRUA 1CQ9A 1ND2C 2GMPA 3MIHA 2ZJCA 1ZM1A 5CEHA 1AR61 3WDXA 5IK5A 4FT8A 2WFF3 3LFIA 4NOTA 3G6JB 4NAOA 5A7PA 5FZAA 3U75A 3BKZA 1YC61 2W9XA 1XNBA 2VL4A 3IAPA 5L19A 2YBKA 3DPRB 4XJ9A 3WNOA 2ZGOA 4QGLA 3JBG1 2Y26A 3RRDA 3THDA 4P9YA 1FMD1 2XHNA 3CJIC 3VBUA 2AREA 4FBFA 1H8TB 2A1XA 3J8F1 5FYTA 4AK3A 3LF7A 1EY2A 3S30A 1H30A 4OCTA 4PHZA 4Q2FA 4RGGA 5FZEA 3S6PA 3LEKA 4FXGB 2A6XA 4D7SA 4CP9B 3BGAA 3WUDA 1V9U2 1H4GA 1G86A 1H2NA 1XYOA 1LOCA 4LK7A 4TXWA 2HBTA 5AC91 5FREA 3WY6A 2HBUA 5FYMA 2JE8A 3A4UA 4FFIA 5FP3A 4MH0E 2VGDA 1D4VB 3IDAA 2WDBA 2WNEA 1SACA 3J4UH 3O1SA 5FV3A 3VBSC 1Q8VA 5IW0A 3T2QA 5JI9A 2Y6JA 2ZX2A 1LJ7A 1RUI1 2WQ4A 4PBPA 2JD4A 3H3ZA 3CL1A 3IWZA 1Q5OA 3A0NA 3SEEA 1MEC2 5FP7A 3FLTA 2D6OX 1VBA3 4I0AA 4QXBA 1DYOA 1W3VA 4MGYE 5DZEA 2Q0AA 2ADEA 3ACIA 3J26N 2CDOA 1P8JA 4XABA 1QXJA 4LIVA 4AHYA 4QDSA 2WAAA 2Y6HA 1V6NA 3WLUA 4ES8A 5BNNC 4G4FA 1SBFA 1NA1B 2D3PA 4S2FA 3USUA 4LMFA 5C9AC 3ME2A 1QHDA 5BNQA 2FZ1A 5C71A 2X5IC 2PXJA 1LCLA 1ND3C 4BCUA 2VOKA 1CAUA 2H6BA 1RUOA 3WSOA 1W2TA 1POV0 3ZYPA 2HWF1 4R52A 4YG6A 3WCSA 2GP3A 4Y33A 2Q1ZB 1OXCA 3H1YA 3PUAA 1O5LA 2HWE2 2X8KA 3C7FA 4UW6A 3WHUA 5JMCA 2D43A 3N7LA 4CDWB 5CFCA 2HWB1 5LK7B 1T6GC 4YGEA 3LOBA 5F3IA 3INAA 1IPKA 4FP2A 4NN0A 4BH9A 4F83A 2RDNA 1SFPA 1TVGA 4ES9A 2UWCA 5JDBA 3PIGA 1F15A 3R4DB 1ENXA 5JR7B 5HI0A 5ISLA 4Q4X1 2BTVC 4TSVA 3VBHC 4YLZA 1PM7A 2WNVA 3B02A 1NQJA 3DYPA 4GMP0 4Q0VA 2ATFA 4Y4RA 5KXCA 3CMGA 2HWD3 4K8FA 4QGMA 1D4M1 3PJYA 4NPMA 2IZWA 2I07B 2R1BA 2R30A 3UYJA 4ZHNA 4FO9A 3FL7A 3VD3A 1U5YA 4N53C 5FMOL 2IC1A 2BVBA 4CEYC 2G9GA 2AR6A 5FXXA 4ARYA 1FAYA 1CESA 3J7HA 1QJU3 3RJ2X 2AUYA 3TWIA 5CKMA 1YXWA 3HQRA 5HBAA 1C8M1 3VD7A 4IL7A 3MIGA 1RUF2 1CAVA 3KT7A 4KI5M 3AKTA 3BI3A 4PT6A 4QD2A 5LW9A 2RS33 3ZMOA 1XSRA 1W8ZA 2RG4A 2W68A 1GZ9A 4AOCA 2VC9A 1BMV1 4LKEA 1GQGA 4JTOA 5A3MA 2J7MA 4ZZ5A 2BOJA 2RJ2A 3VV1A 4C1WA 4DXRA 3ES4A 1Y3TA 3EMRA 3WP4A 3FFZA 2VUAA 3SH5A 3VHPA 5L36A 3T1LA 3MHZA 1M06G 5BV6A 4MLOA 1W28A 1X8MA 5JXHA 1TZOA 2B39A 3A23A 4LJHA 1UZWA 5LY2A 5FKBA 3VDDB 4CCDA 3SC7X 1LHVA 4BK5A 1JZ6A 1US2A 4GWMA 1XRUA 5ABJC 3TOJA 1TME1 1UIKA 1NY71 1W9FA 2AENA 1QH6A 3LAGA 1Z7S3 3D82A 4JGYA 3T2TA 4CRQA 1W0OA 1AVBA 3AYAA 1ZBA3 4WM8A 4CXYA 1W90A 1HDKA 1NCQA 1D2QA 2ZGRA 3ZN6B 5A3UA 2J1TA 4Q4V1 4RN5A 3ITQA 3IIAA 1DBNA 2VR4A 4I2OA 3ZFEC 3ZFGB 1OBNA 2A6WA 4E2QA 1GWLA 3ZXJA 1JU4A 2A6VA 1UL9A 5C8WA 2YC2A 1GUIA 2W08A 4AZZA 5L73A 1IPSA 2HEWF 3T3YA 4GB32 2E7TA 1UMIA 5DDJ3 1W39A 2B5HA 2VOXA 1COV3 1FOD1 2B4KA 2TNFA 1GOGA 3ELNA 1DGWA 4KBBA 4LE4A 5FZIA 1HQNA 4JV4A 1V6KA 4D3WA 1Q56A 2W1SA 3E5UA 5TSWA 3O1VA 1PVC2 3ACFA 3N36A 1HXS1 2D6MA 1U12A 2VE1A 3POFA 3IN9A 4Q26A 3RI9A 5LZ6A 5FQ0A 4I0WB 1H8VA 1W6MA 2P5BA 2ZEXA 1LOBA 4KQ7A 4YW7A 5B4NA 4CU9A 1U5XA 4H2AA 5K0UC 4E4SA 2UURA 1DG6A 1V9U1 2WZ8A 2JG8C 2Y6GA 2JKXA 5C8CC 4CDQC 3QH6A 1HB3A 4EV0A 2A73B 2DVBA 1N1SA 2UYBA 1GZCA 2XVKA 1SCRA 5E88A 3SCGA 3DPRA 4GD4A 3VHRA 3UETA 4J6GA 2ZX3A 1LOEA 1B35C 1UZVA 4L99A 5HCBA 1H8TA 1OLRA 3RMXA 1K5MC 4LO6B 3WEZA 3BVCA 5DQ0A 1F8VA 1MS8A 1MEC1 3ZXFA 1JUIA 4CP9A 4XF3A 1RXFA 4PF1A 1J3RA 1AXYA 4I3GA 4CDXC 1JZ7A 2RS53 2XMLA 1D0GA 2P6HA 2ZX0A 1UXXX 1D7PM 1MZFA 5LK5A 4Q4Y3 3ZOIA 3ZYIB 1ULFA 2DTWA 2QQJA 1XQNA 1BK0A 3DEMA 3VBRC 3ZXKA 1X82A 2YDEA 4HKWA 4KH9A 3AL6A 5KHHA 3ZSKA 2BNOA 3WNPA 1U5ZA 3ZLIA 1DDLA 4BB3A 5LEJA 2WQ8A 4QXHA 4C91A 1LNSA 2E31A 2GNDA 1X50A 3VUOA 5JOWA 2C26A 2HWE1 4UW4A 4JGZB 2NPIA 3B5LB 1S55A 1V00A 3KQRA 4E9KA 1M4WA 1BCXA 1QJFA 3ATGA 4L2NA 1NA1A 2GN3A 4K7JA 3FX3A 5IVCA 4YVWC 4Y5SA 5I0DA 3VD5A 2ET7A 5K8SA 4D6QA 2I74A 1K42A 4QKBA 1OD5A 4FQZA 1OFNA 1WCQA 1UU4A 2QQIA 2ZGLA 3T1MA 2MPFA 2X29A 4CCJA 1SFNA 3N7KA 5G04L 4MV2A 1BEV3 2XJSA 4CDWA 3O7OA 2FDJA 2HEVF 2QZ2A 4OHYA 3O1OA 4O7XA 2OZJA 2D5FA 2BZDA 2YYOA 5F2WA 5FZDA 4CP2A 1GKBA 2A3WA 3IM0A 3R0RA 1IGOA 5EZWA 1AL0G 1VBA2 2GC2A 3VB9A 5L7OB 4XFBA 4QHBA 1RUF1 4I01A 3O1MA 4D6SA 1W2AX 5C3QA 2WWJA 4P02B 1I5ZA 2DU0A 1CVNA 1BYHA 3KVAA 2EIBA 1XE7A 3F95A 4EYUA 3H0OA 2XWJB 2N7GA 5T5PA 3WHTA 3X29B 5AFBA 2FQPA 4M00A 4QU1A 4CYDA 4IEZA 3ZM8A 5GLWA 3NVCA 1JS9A 1W2OA 3H8UA 3BYWA 2JDKA 2WJSA 4XPVA 5J48A 2BERA 3L2HA 5FPUA 1WCDJ 4ZU4A 1MS5A 4L0PA 3VBFA 1QOTA 2W2IA 3RYPA 4UWDA 5BNOB 4OI2A 3ZX7A 1LODA 2J1VA 2OT7A 4AAXA 3LD8A 2HWB3 4XAEA 5BY5A 4IEOA 3MIFA 3N9OA 3AJZA 5FTTC 5LATA 3TRSB 2R063 1IQAA 1C1LA 1SMVA 3MFAA 5CFDB 2AACA 2MEV3 2RR11 4B3NA 2HWD2 1MACA 3IDEA 3I2GA 1GZTA 2BU9A 4Z8BA 3O1UA 1LR5A 3LEIA 2PTMA 4NE9A 2YU2A 4XCBA 4KU7A 2OX0A 1AL23 4HPKB 5FZHA 5J37A 4N8MA 3BPSA 3GF6A 3V0BB 4QX7A 1Y9GA 3ACGA 1CJPA 4S2GA 3RWNA 1FX5A 5FXZA 4BXFA 3I8TA 1PVC1 4LBQD 4TLGA 4UFIA 1GNHA 1YI7A 2ZAHA 4LUMA 1JYXA 1ZNPA 3ZN6A 2ORZA 4C0HA 3KSCA 5CG8A 2RS32 2MHFA 4BQWA 3ZFGA 1DYPA 3QOPA 2PA7A 4L9BA 1PX3A 2P1BA 3FUOA 1OURA 4GKYA 4YRDA 5E89A 4E4ZA 2VW2A 4RQPB 3TNPB 5ANNA 3CEWA 3MLLA 4XF4A 5JOZA 4W65A 4OMCA 2JE9A 1YQ8A 1DHKB 3POIA 4HVRA 3TEXA 2J22A 4MX3A 3ZSEA 4A7YA 1IOAA 4I02A 3VKFC 3EB7A 2ZX1A 3EHKA 1JZ5A 3VD4A 4HETA 1U0AA 1REFA 3FMGA 1RUJ2 2ID4A 1FXZA 3EYPA 1NLRA 2E32A 4UF0B 3VZNA 3RVHA 2L9LA 4MGZE 5FAXA 3WG2A 5FOJB 1QJY3 4N90A 3RZKA 2V09A 2XKPA 1TME3 3NJYA 2JWPA 4FPHA 2ZGKA 4I0BA 3E6DA 3SCHA 4CTEA 2ZBJA 1FI2A 4I3PA 3MUY1 1XXNA 2VMIA 1D0HA 4XFGA 1V6OA 4ZS3A 2B45X 4R9CA 3ZPOA 4Q4V3 3H8OA 3HBKA 2WFF1 3NJZA 2VQ0A 2O8OA 4HN0A 5DDJ2 3AMMA 3WDYA 3WV6A 1COV2 2EXKA 3M4FA 1NOVA 5A1AA 4QB6A 4R4ZA 3PLQA 1R64A 4IE7A 2WQZC 4V1PA 2QVSB 2UU8A 5CYYA 2OPKA 4XBNA 5DZGA 1UIJA 2ES3A 2G4IA 4BLIA 4TN7A 3OEBA 2KR2A 4D7TA 3OB8A 3ZYJB 5IHRA 4YNIA 3WDVA 1N1TA 1OQ1A 1QDOA 2XKOA 5EV7A 1LEMA 2P34A 3VZMA 3DYOA 4O61A 2P3JA 2UY9A 1X9TA 2W39A 4QHOA 3UKVA 2Y0OA 4RR3B 4PJYA 4QMAA 2QZ3A 3JD72 4UAPA 2WT2A 4LQRA 4AQ6A 3O14A 3POWA 3KGLA 5JSOA 2GNTA 2D6NA 4XIKA 4XILA 4JGZA 1SCSA 3P3PA 4M4RA 1ENSA 1VR3A 1G9CA 2QQPA 1EV12 4P9IA 4JTNA 1ULOA 1MVQA 2JJ6A 4QQLA 3POYA 3K4ZA 1QQP3 5JPMB 3KMHA 2VCCA 1W03A 3KZ4C 3LSEA 4Z2WA 1YQ6A 1BXHA 1O91A 4B1MA 1JOJA 3MFCA 2NMNA 4XVHA 1VBA1 2JIGA 1OQDA 3OGGA 4L97A 3SXWA 4AGGA 2A3XA 4JAAA 5GLVA 3GBWA 4DZGA 5C70A 4JKLA 3WZ1A 4LKFA 2ZXQA 1UXZA 4CE8A 2YPDA 2YV8A 3ZR6A 4TYSA 5HXMA 1HN0A 2YFUA 3OF1A 1OPOA 1PK6C 1TNRA 3MW2A 4WM7C 4WVWA 4K40A 4AFAA 4XIOA 2E26A 4XFIA 2FDKA 4K21A 2XQXA 2YG0A 3I2IA 2ZMNA 1ZZCA 5FZ7A 2A7AA 1QEXA 5K7PA 5DUWA 4BM8A 2JG9C 5L7OA 1ZZ6A 3HMYA 3HD8B 5FLHA 5IVJA 3AC0A 3N9LA 4HZFA 5FYIA 1QNWA 4BQ5A 3KB5A 2HWE3 3B69A 4IGOA 4OLLA 5GLUA 4BE3A 4P9JA 1LB2A 2YZ4A 1CIWA 4LK6A 5FUPA 5FUNA 5K4LA 5BNPB 4W6WA 3D0JA 4IV1B 3LPGA 3UV9A 4YVSC 3PNAA 4YG3A 4IXLA 4LA2A 3ZDSA 3M2MA 2VNRA 1XNCA 3NW4A 3QH7A 1LGBA 3BTXA 1GNZA 1QGLA 2WA3A 2HWD1 3GXUA 3HJRA 4P9WA 2CTVA 4Q8KA 3H8RA 2PAEA 4HVOA 3OGRA 3ABZA 4FAGA 5D8AC 4CCEA 5FZBA 1DZTA 3THCA 2JDHA 3AXDA 4META 3I3QA 2JKBA 3N4MA 4A4AA 1DFQA 2BEOA 2ZX4A 1UWWA 1S0IA 2QQNA 1QJU1 2QBXA 3KWVA 5A32B 2JEMA 1O3QA 2B9VA 1A8MA 5DAWA 5C33A 3AMPA 2A71A 2PHXA 2RDRA 1XBFA 4QX8A 5CFDA 1E5RA 5KC6A 1XU1A 2CYFA 2YC4A 2WSVA 4FVVA 5FY1A 2RS31 2HWC3 2OW4A 2WIIB 1WCSA 3VBOB 4KWJA 4CP1A 1AX1A 3WNLA 5KR7A 1ODNA 1YIFA 1LOGA 3V0BA 1W99A 2VTXJ 4X8NA 4XCAA 4H7MA 4NMIA 4NHLA 2XDVA 5F5AA 4AI0A 4LR4A 3ZFFB 5FZCA 3VDDC 4CCOA 1XYNA 2XVLA 1HV0A 3NAPB 2XLAA 2XJTA 4B4QA 3GHMA 1F4HA 1XOYA 3ZPYA 2E33A 3I54A 3ALQA 1H4HA 2PHDA 2CAVA 3PTRB 5FYYA 3OPTA 3RNSA 3LA3A 3B00A 2DU1A 4AHWA 3AKRA 3ON7A 1CZTA 1N3QA 3MZHA 3DXUA 5I91A 1MQTC 3UNPA 2R062 2GDFA 1ZZ8A 1HQLA 1RVF3 2DVDA 4RQPA 1CPMA 1NCRB 1AX0A 1HIXA 2KA3A 2ZZQA 3ZN5A 2MEV2 3E6BA 5T5OA 5IK7A 4HBNA 1HB2A 4LBQB 2YPJA 4TWTA 3GZTB 3VD9A 3QCWA 1AR93 1F35A 3W9AA 3BTZA 1YLLA 2XJQA 1Q3EA 4FPCA 1DP0A 4UBHA 5D21A 5HPOA 3VZKA 1N3PA 1AL22 5DDJ1 5KBFA 5KHJA 4GXLA 1COV1 4UF0A 2FCTA 2G19A 3AVRA 3LWCA 3MF6A 1Q8OA 4LA3A 3LA2A 4GB33 4LTAA 3ZXDA 3EO6A 2TEPA 1XNDA 4PLOA 4CCCA 4EZHA 4AFCA 2YBSA 1RUD3 2YROA 3CIHA 4SLIA 1E5HA 2LROA 4XYXA 2TBVA 3WG3A 4CCMA 1G9BA 1WMDA 3RFRA 1W6QB 3GALA 4TZDA 3H9AA 4ATEA 1OA2A 4QX5A 1OF4A 2OVUA 3JD71 3OGSA 4AG4A 1WWYA 1OSGA 1SFYA 1FNZA 2VTXA 1UW8A 4MVTA 1FPN3 1FV2A 4C8DA 1DZRA 4LUKA 4Q0SA 1W8HA 1X7NA 3ZR5A 4AYUA 2DVAA 5FO8B 1TG7A 4XJZA 1EV11 3NO8A 3URFA 4DXZA 5C5UA 1LKNA 2R042 5CKNA 3KCXA 5A80A 4HT1T 1IQDC 4EQVA 2IWGB 3GJAA 3PL0A 4W50A 4LO4B 3H1WA 4W6YA 2EAAA 3EBRA 5DZFA 1RJ7A 1QKQA 1W04A 3BPZA 2XUMA 2FDHA 4ISRA 3GZAA 3PDQA 2QFEA 4RR3A 2BNNA 3AYEA 1QJY2 4Q4Y1 5FYVA 3U07A 5KWRA 2QCSB 2VMEA 1XSQA 4MUVA 3W58A 5A3WA 1J1TA 3AMHA 4MXWB 1C4RA 1V6IA 3LB9A 5JSPA 1LOAA 3JB4C 3LCPA 3FBMA 3AVSA 4AW7A 1UOGA 1HKDA 2W91A 4Q5OA 3M70A 4YWAA 4L11A 1OOPB 2JD9A 3HNMA 3N7JA 5DXDA 1OT5A 3NNLA 3VKMA 2O0OA 1KS5A 2F4PA 1WA4A 2Z2SB 2ZGSA 4Z2AA 5KHGA 2IUWA 5EP9A 4YW4A 4GWJA 4UFKA 4D94A 4MOAA 1PIV3 1IPJA 3BN6A 5ANQA 2CY6A 1H6XA 1OMIA 4MO3M 2G1MA 1OQEA 2I45A 2DDUA 2HLEA 2XG3A 2EA7A 1S0GA 5GJ6A 4CVUA 1F31A 4QWNA 5IK4A 5FZ1A 5EFUA 1NZCA 1PGSA 2AEYA 4YW3A 2IXIA 5KXBA 1RMU3 1ST8A 3GBGA 2XLFA 4GH4B 4QDQA 2JECA 2VAUA 4HONA 4OFGA 4IEQA 4BQ3A 3R4UA 5J36A 4NPRA 3PVBB 3IIIA 1RGSA 4P00B 3FN9A 5APAA 2KM2A 2VJXA 2P3KA 3Q8EA 4D0QA 3TEWA 2NMOA 3EQEA 1K12A 2C6SA 1JOBA 1YFYA 4NUBA 1BEV1 1W6OB 4OHZA 3B01A 5FFOC 3B3QE 3OY8B 2PMWB 4NPLA 2G9FA 2WSUA 1QQP2 5BNPA 3THTA 2VXJA 4IV1A 4LHNA 2BUKA 1J3PA 1W9TA 1RB8G 4DY3A 2VZQA 2HH9A 2WABA 3BOWA 3DCQA 4AEDC 2F6BA 1UYPA 4G3YC 4AQSA 1L7LA 5LY1A 1JTZX 3MW4A 1YQ5A 4LLOA 5CU1A 2DUPA 3GCXA 3Q8FA 4AI2A 1RUE3 4DNYA 4YSFA 5JWPA 1GP6A 4HANA 2F4LA 3Q8AA 1MZ6A 1QDCA 4EN0A 1JYTA 1WLWA 1F4AA 1F2NA 3N35A 1KJRA 4FI9A 4CDUC 2JB4A 3B9IA 5C4WB 4N9IA 4RFRB 2VMCA 4HVQA 4N43C 4RSUA 4D7YA 2VY0A 2XQRA 1JMUB 4XETA 3U4XA 2WC2A 2C0ZA 2IXHA 5A32A 2D93A 1IG0A 3AZZA 2VZOA 4I09A 4B7EA 3NNMA 3B94A 4PDWC 2GMEA 5BNOC 2FZ2A 4NR1A 3IDBB 1HRI3 3IMNA 3VBOA 4WBBA 2E9QA 1JI6A 2XHKA 1I9RA 2MNGA 2Q5TA 3MICA 2PHTA 4FOWA 4MHUA 5F2SA 4A45A 4XUPA 5JZGC 5EWSA 1WW4A 2H0VA 2R061 2BWAA 5A3LA 1VBE2 1UX6A 3UGHA 4FCAA 1Q8PA 3O1TA 2MEV1 1O3TA 1FATA 3ZFFA 1O6UA 2OPWA 3VDCA 2QTWB 3T0AA 4IV3B 3NAPA 1JUHA 2D98A 3CZJA 1WW7A 1RHI2 1AL21 1R1ZA 1Y4WA 4DUXA 1LTEA 1PZ8A 3MO4A 2BWCA 4FPLA 4JDOA 2IFWA 4LO7A 2BBAA 1Z0HA 1KFXL 3RJRA 1OD3A 1IS4A 1LULA 2W87A 4HLTA 4CEWA 1WMFA 4FAHA 1TMF3 1NCRA 4P9LA 3E5XA 3I7DA 3ST7A 4FOQA 5F3CA 3I2KA 4R4XA 1MZ5A 2HWC2 4LBQA 2VNGA 3JZVA 2AGSA 2P17A 5FK7A 4QPGB 1UYZA 5FBJA 1WW6A 1UD1A 3VBFB 1ZX5A 2Z69A 4QM8A 2VBPA 4XQWA 1J83A 4S2HA 1V6LA 5FK8A 2YB7A 3E6CC 1RINA 2BRTA 2CAUA 2DVFA 2WYFA 3W59A 3LIGA 3LIHA 1YJKA 1CD3G 1KFUL 1C8NA 2WKKA 2ZCWA 2R041 2J42A 4RD7A 3ZYGA 2CGOA 3C7GA 3KV9A 1HJFA 5FJKA 4NHYA 3JB8A 3WXPA 2FHRA 4YM3A 5A70A 5DUUA 4BXSV 2Q30A 2WNUB 5E1RA 4BA6A 5EQUA 4OULA 3CF6E 5F1RA 1W6QA 3O0WA 1OUXA 4XMIA 2V5DA 2ZACA 3J7LA 3NKTA 1QJY1 1YFXA 2PHRA 4K9SA 1RUJ3 4R9BA 4R9DA 3HAGA 5H9QA 1RVF2 1CPNA 5KHKA 1LU2A 1OVSA 3A7QA 3LGRA 3CBNA 2ZS6B 5EXOA 2BVVA 2EAKA 3U10A 5A7WB 1LGNA 3CU7A 1AR92 4J1WA 3EJKA 3PIJA 4IUGA 1DU3D 2V5YA 4NAMA 4ZONA 1YFWA 1AZDA 2ZPXA 4YM0A 3OUJA 1QIQA 1BVP1 4XE9A 4Z07A 1NE4A 5FZKA 2WO3A 4NRPA 4C1XA 5J3UA 1JW6A 3VKOA 4UI9L 1AR82 2Z4FA 3BCWA 4YZ1A 1UAIA 1UMZA 4QPIC 4A3XA 1RUD2 4MXWA 2WO2A 1UZZA 2W52A 2W95A 3I4IA 4PBOA 1ZVFA 4KWUA 4AEKA 2IXJA 4QQOA 4E2SA 5CB7A 4MGTA 1UY4A 1OOPA 1AHSA 5GALA 1NLQA 4NO4A 2DURA 4DQAA 2RV9A 3LQCA 1LOFA 4FPJA 4AI9A 1W0NA 2NZ9A 4NHMA 4QQ2A 4XFCA 1FPN2 4BIFA 1KXGA 4BQ1A 5IFPA 4BQXA 2JDNA 1GU3A 1Y43B 1I3HA 3JD73 4IEPA 3SH4A 4EN7B 5B4XA 4LITA 1IS5A 3KT1A 4FTEA 2AH2A 5LRSA 2BNMA 5T5JA 4AVAA 2P37A 5FZ8A 3LPFA 1QQP1 1EV13 4HKLA 4QM9A 3ZO0B 1UZ0A 2DCZA 3OSDA 3HT1A 4GH4A 1AXKA 2ZOEB 3OD0A 4Q0PA 4GKXA 4M4PA 5DABA 4QX0A 5A7NA 2PQSA 2PAKA 4OI0A 4W8JA 3K51A 3VBUC 3HNYM 3R4SA 2JDUA 3K46A 1LESA 2GC3A 1W6OA 5SV5A 2BGPA 1POQA 1PHMA 1JODA 1QF3A 4EN9B 3OY8A 4IGPA 1GZWB 4H7LA 5FPVA 1PZ7A 1R093 1SEFA 2UWBA 3CKHA 2W1UA 2EXJA 4KWLA 3MIEA 2QQKA 1UY2A 4LIUA 3LDKA 1PIV2 4IEXA 1CX4A 5FDBA 3ZIXA 5FZMA 1JYCA 4MG2A 5I93A 2ZAAA 3POSA 4Y1YA 2DUOA 2CGPA 3D6EA 1UY1A 4QKNA 5C4WA 4L8QA 2XPJA 2VOWA 1RMU2 2XB6C 4FPFA 1N1YA 4Q1PA 2QQVA 5FZ9A 4MGKE 1VBE1 2YFZA 4Y4YA 2C9KA 1VAMA 1QXRA 4CU8A 2PAMA 3WCRA 5T5LA 3RZLA 4MXVA 1O3RA 2VH9A 3MLJA 3MIDA 2GZWA 4A6OA 2VTFA 4QB1A 1JN2P 5A3NA 1RHI1 1QWRA 1ND2B 4QX3A 2BOIA 5F3GA 1PZ9A 2XH6A 2Y33A 1XNKA 1QJX2 1YJLA 2YMZA 1JYWA 3WW2A 2RVAA 4GJZA 2X05A 2D44A 3TN93 2DBIA 4C0BA 4F7ZA 1OLMA 4D6RA 3M3CA 4BMEA 4IEVA 1LECA 5FJHA 1NKGA 2YXSA 4RHV3 3RI8A 4CU6A 5CFCC 4HK9A 1RUE2 1ZRRA 2VBDA 4ASLA 5LBFA 2HWC1 3FUQA 3GJBA 3NNFA 3CJIB 3B93A 4IV3A 4J1XA 4XBQA 4KU8A 4P9XA 4JCKA 3KT4A 5HV0A 5JAXA 3D4KA 3DXTA 2WS93 1KDKA 2SBAA 2Q8CA 3SCFA 3MW3A 3GNEA 4XDQA 2BP6A 4OHVA 1VRBA 2ZGPA 1QJZA 5J09A 3AKPA 2WNVC 5FY9A 1ZZBA 1WLTA 2QQMA 3EXUA 1HQWA 2B9UA 4IEWA 5EYYA 1YUDA 3FLPA 4FTSA 1BBT2 1W8OA 2WINB 3MV01 4BQ4A 1UMHA 4AGVA 4B4PA 4XUTA 4CCLA 4DOUA 4A7KA 3PMSA 1HRI2 1SLIA 3OG2A 4XZUG 4Y26A 2Q8EA 4YFZA 1PMJX 1OA4A 1UNBA 2RDQA 2BPA2 2B42B 3IPVB 1SLAA 3VBSB 5LBBA 4QPGA 4LOTA 1DQ5A 4CZSA 2CNAA 4IW3A 2XOMA 4ZXKA 4HK8A 1N3OA 4KG0A 2GAUA 4XHBA 4OUSA 2VUDA 1DF0A 1RVF1 2QE3A 4UFLA 5A1LA 2JDAA 2OXBA 2QQOA 5DN2A 1CR7A 1DQ1A 1GP5A 5FPAA 1SLBA 4PCRA 1N1VA 3O0XA 1AR91 1W05A 5IAXA 5FP8A 3I2JA 2R073 4A7ZA 5G05L 4UXAA 5BNNB 1Y9MA 5JXGA 5I0RA 1W9WA 5C9AB 3AL5A 1CZSA 2WNUA 3AMQA 3VL8A 2X5IB 1ODMA 1V6JA 4COWA 1ZRIA 4AE2A 1UKRA 1ND3B 3PU8A 2WZR2 1VMJA 4GB31 1H1AA 5CKQA 1H9WA 1SBEA 3D3AA 1GYKA 1JZ2A 1GICA 1TMF2 5D1IA 1RUD1 2VUJA 2OYZA 4XEZA 4H55A 1REDA 2OIIA 3NJVA 2ZGTA 1A8DA 2ZZJA 4QU2A 1BJQA 5A7WA 3PURA 4HKOA 2H0BA 2DTYA 2ZA9A 1HJGA 3I3DA 1EAH3 4JGYC 5FXWA 5FY5A 4WM8C 5FYZA 3U4SA 1NCQC 3I49A 1FPN1 1DGRN 3CQOA 3VBHB 4AR2A 4DEVA 3S7IA 2JE7A 2ZGNA 4KNCA 4N9HA 1RIRA 3NNJA 3B7MA 3POGA 4XF9A 5F3EA 5LCWL 5A7SA 4JC1A 2W1QA 2R043 5FZ6A 4NIGA 4FOYA 4M0NA 4WVVA 3BTAA 4BQYA 4LLFA 1JYVA 3N3HA 1I5PA 4K1YA 5J1XA 2Y34A 2R7EB 4N53B 4XZPA 1OUSA 2WZEA 3SKJE 1RUC3 4A44A 4CEYB 5IFTA 3K4DA 3OBRA 4AVSA 1WZXA 3KGZA 1J1LA 3FLRA 1V6MA 3VHOA 3C8XA 3O1PA 1XC6A 2JDPA 4QPYA 3P1IA 1W8TA 2ORXA 2IXKA 5CZKA 5HCHA 2VULA 2HJIA 3PUHA 3H50A 3WD5A 1OLME 1ASJ3
chains in the Genus database with same CATH topology
1PO23 4MSVA 4XFHA 4RGAA 4CP0A 4OUMA 4KL1A 1PIV1 2EALA 3DPRC 5F6LB 1RL3A 1WBLA 3ENRA 1W0PA 2VECA 1H8TC 1EP0A 4TLFA 4BYYA 1ZRFA 1AXZA 4EN6B 2NP0A 5CVRA 2XJPA 2FBEA 5HXVA 2NLRA 1RMU1 4IERA 1GZWA 1MVEA 5BYNA 5ABJB 3O12A 2QDNA 4B29A 1IHMA 3VGIA 4B4RA 1X36A 3ES1A 2ZKLA 1B09A 3AYCA 3ZYRA 2BYVE 2D7FA 2Z42A 4E2GA 1QOOA 1ZZ7A 2AZ5A 5JIUA 4DFSA 2Z5WA 4WV8A 3ZFEB 4RS5A 3ACLA 1DQ2A 5LEKA 4XFAA 1QJX1 1QNYA 1W6NB 3M8LA 4E4DX 1BVVA 4Q0QA 1RC6A 1MR5A 4KG8A 1Y7BA 1G9AA 1A6CA 1GR3A 1R1A3 2Y0IA 2CGNA 1RUE1 1DYKA 1OPMA 4Y24A 1NA1C 3IT8A 2VG9A 1H2LA 3NL1A 4AI8A 1HRV2 5HCFA 1Q43A 4ASMB 1YNAA 1AJOA 4AFBA 1ND2A 5JCTA 5K0UB 1ZBE2 1R092 2KXLA 5C8CB 2BBVA 1LHUA 4CDQB 1YCIA 1J3QA 1JXNA 2ET1A 1WCKA 3UKNA 4ZU7A 3CO2A 4CDWC 4XQ4A 1VBD2 1J59A 4M01A 3VLBB 3MF9A 1HRI1 4YGBA 3CJIA 1B35B 4XFFA 3WW3A 1K5MB 5KXEA 4LHLA 3FJSA 1RUH3 4CDXB 2WWSA 1KITA 3HBZA 4IQPA 5H9RA 1VBE3 1I1EA 2RE9A 4AQ2A 4WZCA 3BODA 2ILMA 1LHWA 3VBRB 1AR62 1H0BA 1Y9QA 5CIRA 3VBSA 3IPVA 3QACA 3M3OA 3U0ZA 2VVEA 2DUQA 1RHI3 4NWWA 3TN92 1FYUA 3UL2A 2H6CA 3JBG2 4FPKA 5AVPA 3FFQA 4H14A 1TMF1 4X6QB 4COYA 4RHV2 4X6RB 3G7DA 5GLZA 3J8F2 2VW1A 4PLMA 4LHKA 3VBFC 2E51A 4WZFA 4AI3A 2WS92 5BNNA 4FSJA 4GMP3 5C9AA 3UK9A 1X33A 2VMHA 4IETA 4YVWB 2X5IA 1ND3A 3ILFA 3MIBA 4XOGA 4IESA 2DFCA 2YC0A 5EJ3A 1PO12 3M3QA 2ZMLA 5F9TA 1S2BA 4QQPA 4PF5A 1NYWA 2BFUS 2C5DA 2R6QA 1FV3A 3R05A 3A0KA 4YGDA 4Y1ZA 5FPZA 4BHPA 2PHWA 1RUJ1 4YFWA 1RITA 1GSLA 2R1DA 2DWRA 3VBHA 1TEIA 1SDWA 2ZGUA 4CEWB 1DGWX 3ZFGC 2GH2A 1R083 3AKQA 2R072 1GBGA 2XLGA 5FBZA 3ZXLA 1WLDA 3THPA 5T54A 2GNMA 4E27A 3JCIA 5FCCA 1IKPA 1TE1B 4YARA 3RQ0A 4AVTA 1SLCA 4DY5A 4N53A 2UYAA 4CEYA 4OHWA 1HV1A 3QLQA 1PGW2 2VXRA 5DG1A 3VZJA 1YRZA 1AYM3 2B7YA 1ZREA 1AR83 2PQQA 2VU9A 2EVXA 3WQ1A 4EROA 4JQRA 3L2YA 2CL2A 5CNAA 2GC0A 4AXOA 1EAH2 1WW5A 3AX4A 4AEMA 4F8AA 3KLSA 5FPXA 4U2AA 2IXCA 1EPZA 1MS1A 3ZIWA 1D4M2 2E53A 2ZMKA 1ULDA 3ZVXA 4LO8A 3N7MA 1LGCA 4AWDA 3VKLA 5KXDA 1VAVA 2K2SA 2PHLA 4COVA 1WUVA 1W6PB 2D97A 1OI6A 1E57A 4HL0A 1PGL2 5ABJA 1RUC2 4FPEA 3D0SA 1ZA4A 1WGPA 4XQDA 3NV1A 3NV2A 4DRVA 1MS4A 2UWAA 1HRV1 3RYKA 3VL9A 3ZSMA 2DVGA 5GKAC 4YZ2A 5I8SA 2FMDA 3ZFEA 3M7AA 5JPNB 1C1FA 1R091 1ASJ2 1W6NA 4FPOB 4X8PA 5FO9B 1PO22 3SLIA 3GYDA 3JU9A 5CA6A 2LTNA 2DCTA 4JGZC 1IS3A 3ECQA 4UW3A 3OGJA 2DFBA 2ZHMA 3FZ3A 1MS9A 1UCXA 2HYKA 4LEJA 4B8EA 1OA3A 2O1QA 1V70A 3AKSA 4LBNA 4AI1A 4QQHA 3HIFA 2XBO2 5K0UA 2JG8A 5BPXA 5C8CA 4CDQA 1AR73 4FP3A 4JDNA 2VVDA 4LE3A 1ENQA 3WG1A 2RS13 5CAZA 4LULA 3AP6A 4L92A 1DQ6A 1VBC3 3FC0A 4XF0A 4I30A 1UKGA 1B35A 1UU6A 4XTMA 4XTPA 1UZYA 1FOD2 1K5MA 5DG2A 3TN91 1DGLA 4YZ3A 1S0JA 4OHXA 4FTBA 2QKDA 2JENA 3AP7A 2EIGA 1QJX3 4AHZA 1HXS2 5L7OC 2ENRA 1R1A2 2E7AA 2ERFA 3AXEA 3J9SA 4KGGA 4RHV1 3WW4A 1F5FA 4CDXA 3ZSLA 1RUNA 4AVVA 3K48A 4ONUA 2DYCA 3ZXGA 3DL3A 3H7YA 3SNMA 2WS91 3VBRA 3KCCA 2XVGA 4XHXA 4GA9A 4ZU5A 1QMJA 5FMOS 3WP6A 2PHUA 1KD7A 1AX2A 4K3UA 4WVMB 3VZLA 5I0UA 3LKJA 2Z79A 2GU9A 2SLIA 2CWMA 3IDCB 5KHIA 2XWBB 3BIWE 1PO11 3DKWA 5FO7B 1BBT3 1JH5A 5FLJA 3TNQA 2E7QA 4OI4A 1CAXB 4YW5A 3ZXAC 3ZXEA 2QNKA 4YVWA 5IUQA 2PYTA 4FPYA 3SITA 5CFDC 1RUH2 1C5HA 1G7YA 5GZFA 3TYJA 4ITCA 3QD6A 4BZ4A 4Q4W2 5JOYA 1BQPA 2R071 2R49A 2XGXA 3V56A 2RM22 1VB4A 1G6NA 4WM7B 4LBJA 1PK6B 5I0TA 1WMEA 4NHKA 3WOGA 3SHRA 1G9DA 3ROUA 1O7FA 2WZPP 4AVBA 5J96B 1JBCA 4LNVA 1PGW1 3TBDA 2VVFA 2WZR3 4Q29A 4XW3A 4HSLA 2VPVA 2JG9B 4KGQA 2XJVA 4XJUA 3HN1A 4HMZA 2E63A 1EAH1 1XU2A 1VBB3 2OUJA 1GLHA 2A70A 2WL1A 3PTYA 4RQPC 5JIAA 4YVSB 4Y1UA 4LO5B 2VNOA 4Q0UA 3WQ0A 3HQXA 4YYOA 3AK0A 1AYN3 1IKQA 5D8AB 4MZUA 5ACA2 5BUVA 2LUWA 3WP5A 2UY8A 5AFEA 3RMYA 4A2UA 1PGL1 2V73A 4FQ4A 1RUC1 1IZ3A 2RMU3 1SLTA 1CONA 3MYXA 3DGTA 2RHPA 2ZGMA 4AQTA 5GZDA 2NYYA 3DUIA 1S2KA 3L9JT 1MZEA 2NN8A 3PVNA 1R082 4W6XA 4Y1XA 4FOVA 2LM3A 4AFMA 2XJUA 1ASJ1 4Q27A 2W0XA 1CJDA 2GALA 1PO21 1W2UA 4SBVA 2ZHLA 1W6PA 1ZZ9A 1C3HA 3GBFA 4Z1VA 3ZN4A 5DUXA 1SBDA 1YI9A 2NM1A 1AYM2 4ATFA 4P14A 4KWKA 4YZ4A 3R6SA 2GSYA 4M3CB 2XBO1 2DCKA 4RR3C 3MLKA 2EXHA 1Q8QA 1VRH3 3DF0A 2FMYA 2VW0A 2GC1A 2RR12 1MQTB 3ASIA 2ZGQA 4AFDA 1ZYBA 1BZWA 1A3KA 4XJ8A 3BU7A 5GLTA 2D3SA 3FBYA 3MPPG 1AF9A 2B8MA 5JSRA 3VHNA 4ISQA 1WD3A 4YG0A 1R1A1 3OTFA 2DF7A 2PLV3 3I59B 3H7JA 4S2DA 1U5IA 4Y5Z0 2HKXA 1RUG3 1REEA 4XJWA 1HRV3 3BOPA 2PFWA 2D6PA 3GZUC 2R32A 3AZXA 3PVEA 1ZBE3 5SV8A 4HFSA 4AF9A 1LHOA 1RJ8A 1KJLA 1PNGA 1G9FA 3CJXA 1VIWB 2WA4A 3PHMA 1VBD3 5BNPC 4M3CF 2VQAA 4IV1C 4RS5B 5E16A 5H9PA 1GV9A 4WVMA 1Q8SA 1XYPA 4BWOA 5CBLA 1UPSA 1RUH1 3WX5A 5GZGA 1MS0A 2O8QA 2WFPA 1AR72 4COZA 4Q4W1 2D5HA 2RS12 1JYIA 4JRLA 5I0SA 1VJ2A 1POV1 2RM21 1VBC2 2WFF2 1A78A 2WT0A 3LA7A 3P3NA 3LZZA 3OJBA 4NVPA 2A3YA 1AR63 1CAXA 3DV8A 2BW8A 2DCYA 2CWSA 3ILRA 4W6WA 1APNA 4OI1A 2D6KA 1O4YA 4XXPA 1BKZA 1H9PA 1DZQA 4PLNA 3O5SA 1MS3A 1O4TA 3JBG3 1ULEA 1FMD3 3VBOC 4YGCA 1DQ0A 1J58A 1YWKA 3J8F3 5J98B 2ARBA 5K9YA 2XJRA 4GMP1 3V64A 4MGIE 2D3RA 1ALYA 2YY1A 2YUEA 4WM7A 1PK6A 2P2KA 4JRAA 5H9SA 3ZFFC 3JQWA 1YIPA 4EWEA 3ILNA 4N7IA 3WDUA 3NAPC 5AC93 1SQ4A 5J7MA 5ACA1 3SMHA 2JG9A 3VN4A 1URXA 3VZOA 1C5IA 1VAKA 1DIWA 2E6VA 4DB5A 2XL7A 2VMGA 1PO13 1RUI3 3KS7A 3AZYA 2P3IA 2PN5A 2ZHKA 3RG0A 1VB2A 2K9ZA 3NV3A 1ZRCA 4CEWC 4YVSA 2CV6A 1NCRC 5AVAA 4Y22B 4AEDB 4BMBA 1PMIA 3V0AB 1R081 1AUYA 3AM2A 3OCPA 5D8AA 4LT5A 4GWNA 4CDUB 5I8YA 4YM1A 5CG9A 5JI7A 4Z82A 3C3VA 4PIYA 3FE5A 3JQXA 4N43B 1O5UA 2HWF3 2XL9A 3AMNA 5HCAA 4R8HA 3WR0A 1GFF2 1AYM1 3UKTA 2ZHNA 4URTA 1AR81 1DGRA 4PDWB 1QXPA 5LRRA 1TQ5A 3E5QA 3PVOA 2VOVA 1VBB2 5JZGB 1QOSA 2B46X 4Q4X3 1JHNA 1CAWB 4XF1A 1C28A 1WLCA 4OZXA 3VDDA 1QH7A 3HT2A 3I2DA 1H1IA 1S0EA 1AYN2 1D4M3 5JVVA 2YGLA 4XBLA 3OPZA 1KRIA 4N7UA 3JUUA 4Z92B 4M3CA 2WLQA 4Q1RA 1LENA 3M3EA 1QJU2 3WNXA 3ZSJA 2C9AA 3SH3A 1S0BA 2R0HA 3AZVA 2RMU2 3MEPA 1VALA 1KDMA 1HX6A 1MQTA 1D2SA 4XJAA 1C8M3 4UW5A 1O4ZA 3UJOA 3KCYA 4Y20B 1OOPC 5T50A 4DS0A 1LOFC 3OYWB 1OKQA 4Q8LA 2IXLA 1SLLA 4D69A 4QGNA 4BOWA 3RDIA 2JICA 4RA0A 2A6YA 3I59A 5I8TA 1UN1A 3UJQA 3RYRA 2R16A 3IKWA 4LBKA 1GANA 3OD4A 4GH4C 1PVXA 1Z7S2 3S0MA 5E8AA 3QBQA 2YGMA 1ZBA2 4HSJA 1WD4A 1ENRA 1VRH2 2ZKNA 1AR71 2XBO3 1YFUA 4K6BA 2QDRA 5C6CA 2RS11 1BK1A 1VBC1 4F3JA 2ZABA 4UBGA 4H3WA 2WT1A 3LOIA 3D8CA 3AFGA 1OHFA 2Q4SA 5A33B 1NG0A 3H3UA 3AZWA 1S1AA 2D6LX 4DINB 1FOD3 4R9AA 4O9EA 1EPWA 2PLV2 1DQ4A 4NWVA 4BPZA 3KD4A 2GN7A 1HXS3 2DV9A 3AFKA 3LSDA 4QPIB 1NXD1 5C4WC 3E97A 1LU1A 3NKGA 1RUG2 3FWEA 1LEDA 1RTVA 4P9GA 1V9U3 1YHFA 3WQ7A 3Q9OA 1O3SA 3FHIB 2EXIA 1CN1A 2JG8B 1IS6A 5GM0A 4DMIA 5BXXA 2X53S 1N47A 3HR9A 4O9GA 2A75A 1BBT1 1YO8A 4LBMA 1DLLA 1F9KA 3AYDA 2OUHA 3MGUA 3RSJA 4EJRA 2GMMA 4XMAA 2RS52 3OBTA 1MEC3 5FOBB 1H2KA 2TUNA 4Q4Y2 5T55A 3SISA 2LALA 1HW5A 3TAYA 1ZRDA 1G8WA 4YZ5A 1GQHA 1LRHA 1QY4A 3CLPA 2NQYA 3NV4A 4IV3C 3WINE 4EWAA 3VBUB 3WUCA 1UF2C 4M3CE 4AVCA 2DCJA 2OZ6A 4Q4W3 4RL7A 3S7EA 4M0HA 4ORFA 2R0FA 2RM23 1POV3 1AJKA 3AB0A 2RJLA 1ULGA 4GQ7A 3DN7A 1KS4A 5GZEA 2D40A 2WZR1 4Y22A 3APBA 4AEDA 3V0AA 1FMD2 3M3IA 4HN1A 3V65A 4Y1VA 4QPGC 1I6XA 4LBOA 3WVJA 1S0DA 3CNAA 1VBB1 4CDUA 4IEUA 2Q1MA 1WBFA 3MPBA 4GULA 1NXMA 2BQPA 3AP9A 4N43A 4DRRA 2QJVA 5FRAA 1BEV2 5AC92 4K20A 3WT3A 5F6KA 1AYN1 3HWJA 3M1HA 5EYXA 4JVAA 3USUB 2PELA 5BNOA 2WNUC 2QUOA 4PDWA 2C1FA 4IEYA 4LBLA 3BALA 4EN8B 5ACA3 1RUI2 1PNFA 1CAUB 1ONAA 3PMEA 3RZZA 4OVEA 3IBMA 4GIQA 3WG4A 5JZGA 2RMU1 4PIZA 3AJYA 3WDWA 1CAWA 5B2GB 5JOXA 2JX9A 4INDA 5IT6A 2JXAA 1YYNA 1RUF3 4GALA 4DPNA 5CFCB 3ZMNA 3AP4A 5T52A 4AEJA 4BLJA 4HPKA 2ARXA 3U11A 1OLQA 3MDPA 2WLPA 1KQRA 3D5OA 1EYBA 3RPQA 2Y38A 1LHNA 2IFRA 2WNVB 2ETEA 2HWF2 5GZCA 4AGRA 4YW1A 4WVZA 3VKNA 2GNBA 3C2UA 4MYEA 4Y20A 2HWB2 5FLIA 1Z7S1 1FT9A 1F5JA 1H2MA 4RFT0 1UPIA 3MI8A 1ZBA1 2JDZA 2I2SA 3OYWA 1NQDA 1VRH1 1X8EA 2OA2A 1NE6A 3PJQA 4Q4X2 4YW2A 2AYHA 1QU0A 3ETQA 3WDTA 5KC5A 2GH8A 3USSA 4YM2A 1S0CA 1CAVB 2EF6A 1C57A 2RR13 4QT6A 2BGCA 3TB0A 4EWDA 1NLSA 1VP6A 3O0VA 5JLVA 1ULCA 1FNYA 2PLV1 5CADA 4FXKB 1PVC3 3RS6A 4QXKA 3AP5A 2YHJA 1C8M2 1TNFA 4AHXA 1RUG1 3GHNA 5T3NA 2Q8OA 3WP3A 2A5ZA 2K0GA 3KM5A 1BMV2 2BFUL 1S0FA 3NSTA 1OFSA 3NWKA 4JGYB 5A33A 4WM8B 1ZBE1 1NCQB 1H1MA 4B7KA 3H1MA 1XE8A 4FPGA 4K1ZA 4XXAA 1CGPA 4RS5C 4JDMA 1VBD1 1HLCA 1UU5A 4U36A 4QPIA 4BIOA 4C90A 2RJKA 4COUA 3BB6A 2RS51 4PQ9A 3B9CA 1VLNA 4PIXA 1Z78A 1TME2 3WW1A 1NY72 4P5HA 2ZTNA 1L3JA 2PHFA 5IK8A 4ZKTB 4G9SB 2HEYF 5FQ0B 4Q4V2 2A6ZA 1W6MB 5F5QA 5DUVA 1CQ9A 1ND2C 2GMPA 3MIHA 2ZJCA 1ZM1A 1AR61 3WDXA 5IK5A 4FT8A 2WFF3 4NOTA 3G6JB 1XNBA 5L19A 4XJ9A 3DPRB 2ZGOA 4QGLA 3JBG1 2Y26A 3RRDA 4P9YA 1FMD1 3CJIC 3VBUA 2AREA 4FBFA 1H8TB 3J8F1 4AK3A 3S30A 1EY2A 1H30A 4Q2FA 3S6PA 4RGGA 4FXGB 2A6XA 4D7SA 3WUDA 1V9U2 1H4GA 1G86A 1H2NA 1XYOA 1LOCA 5AC91 5FREA 3WY6A 3A4UA 4MH0E 2VGDA 1D4VB 2WNEA 1SACA 3J4UH 3VBSC 1Q8VA 5JI9A 2ZX2A 1LJ7A 1RUI1 2WQ4A 4PBPA 2JD4A 3H3ZA 3CL1A 3IWZA 1Q5OA 3A0NA 1MEC2 3FLTA 2D6OX 1VBA3 4I0AA 5DZEA 4MGYE 2Q0AA 4AHYA 3J26N 1QXJA 1V6NA 4ES8A 5BNNC 4G4FA 1SBFA 1NA1B 2D3PA 4S2FA 3USUA 5C9AC 3ME2A 1QHDA 5BNQA 2FZ1A 2X5IC 1LCLA 1ND3C 4BCUA 2VOKA 1CAUA 2H6BA 1RUOA 3ZYPA 1POV0 2HWF1 4R52A 4YG6A 3WCSA 2Q1ZB 3H1YA 1O5LA 2HWE2 2X8KA 4UW6A 3WHUA 5JMCA 2D43A 3N7LA 4CDWB 5CFCA 2HWB1 5LK7B 1T6GC 4YGEA 3LOBA 3INAA 1IPKA 4FP2A 4NN0A 4BH9A 4F83A 4ES9A 2UWCA 5JDBA 3R4DB 5JR7B 1ENXA 5HI0A 4Q4X1 2BTVC 4TSVA 3VBHC 4YLZA 1PM7A 2WNVA 3B02A 1NQJA 4GMP0 5KXCA 4Q0VA 2ATFA 2HWD3 4K8FA 4QGMA 1D4M1 3PJYA 2IZWA 2I07B 2R1BA 2R30A 4FO9A 1U5YA 4N53C 5FMOL 2IC1A 2BVBA 4CEYC 2G9GA 2AR6A 1FAYA 1CESA 3RJ2X 1QJU3 2AUYA 3TWIA 1YXWA 5HBAA 1C8M1 4IL7A 3MIGA 1RUF2 1CAVA 3KT7A 3AKTA 4QD2A 2RS33 3ZMOA 2W68A 1GZ9A 1BMV1 1GQGA 4JTOA 5A3MA 3VV1A 4C1WA 3ES4A 1Y3TA 3WP4A 3FFZA 2VUAA 3SH5A 3VHPA 5L36A 3T1LA 1M06G 5BV6A 4MLOA 1X8MA 2B39A 3VDDB 1LHVA 4GWMA 1XRUA 5ABJC 3TOJA 1TME1 1UIKA 1NY71 2AENA 1QH6A 3LAGA 1Z7S3 3D82A 4JGYA 3T2TA 4CRQA 1W0OA 1AVBA 3AYAA 1ZBA3 4WM8A 1HDKA 1NCQA 1D2QA 2ZGRA 3ZN6B 4Q4V1 3IIAA 1DBNA 4I2OA 3ZFEC 3ZFGB 2A6WA 4E2QA 3ZXJA 2A6VA 1UL9A 5C8WA 2W08A 5L73A 2HEWF 4GB32 2E7TA 5DDJ3 1W39A 2B5HA 2VOXA 1COV3 1FOD1 2TNFA 4LE4A 3ELNA 1DGWA 4KBBA 4D3WA 1HQNA 4JV4A 1V6KA 1Q56A 3E5UA 5TSWA 1PVC2 4Q26A 3N36A 1HXS1 2D6MA 1U12A 3RI9A 3IN9A 5FQ0A 4I0WB 1H8VA 1W6MA 4KQ7A 1LOBA 1U5XA 5K0UC 4E4SA 2UURA 1DG6A 1V9U1 2JG8C 5C8CC 4CDQC 3QH6A 4EV0A 2A73B 2DVBA 1N1SA 2UYBA