1QJU2

Human rhinovirus 16 coat protein in complex with antiviral compound vp61209
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
252
structure length
252
Chain Sequence
SDRIIQITRGDSTITSQDVANAVVGYGVWPHYLTPQDATAIDKPTQPDTSSNRFYTLDSKMWNSTSKGWWWKLPDALKDMGIFGENMFYHFLGRSGYTVHVQCNASKFHQGTLLVVMIPEHQLATVNKGNVNAGYKYTHPGEAGREVGTQVENEKQPSDDNWLNFDGTLLGNLLIFPHQFINLRSNNSATLIVPYVNAVPMDSMVRHNNWSLVIIPVCQLQSNNISNIVPITVSISPMCAEFSGARAKTVVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords PROTEIN VP1
publication title Analysis of Three Structurally Related Antiviral Compounds in Complex with Human Rhinovirus 16
pubmed doi rcsb
total genus 60
structure length 252
sequence length 252
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1999-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1qju200
5BNOC 1AYN1 4SBVA 1VBD2 4N53C 1RUD1 1RUF3 4Y4YA 3JD73 4CDXC 1PIV3 1AR71 2HWC3 4QPGC 1VB2A 2PLV1 1RUG2 2RMU3 1BMV1 2BPA2 2R062 1HRI1 2HWF2 5C4WC 3JD72 4IV1A 1BBT1 4RQPA 3LOBA 1AL22 2RS33 5K0UC 4RQPB 1H8TA 1QJY3 3HAGA 3ZFGA 4IV3B 2HWE3 1RUF1 1PGW2 3JBG2 1RUH1 1NA1C 1ASJ3 1H8TB 3ZFGB 2RS13 3JD71 3DPRC 5AC93 2WWSA 4YVWA 2FZ1A 2R073 5JZGC 1PIV1 1R1A3 2HWC1 1AR63 1D4M2 1RUC3 1VBA2 3IDEA 1HRV2 4YVWB 1RUJ3 2HWB3 2RMU1 5CFDA 1TMF2 3TN93 1SMVA 1Z7S2 1ASJ2 1OPOA 5D8AC 5BNNC 2WLPA 1FMD2 1PO23 5CFDB 2BFUL 3VBFC 1AR62 1ND3A 2RS31 4WM8C 4CDWC 5C8CC 1M06G 5A33A 2HWB2 4JGZC 1EAH3 1QJY1 2BBVA 2HWE1 1ND3B 1AYM3 1V9U2 2RM22 1NY72 4JGYA 5A33B 2XPJA 2WFF3 4RFT0 2RS11 5AC91 2R071 2MEV2 4JGYB 1R1A1 3J8F3 5BNPA 1AR92 5FMOL 1RUC1 1ZBE3 1RUJ1 2HWB1 1WCDJ 1AYM2 5BNPB 1VRH3 1HQNA 4QPIB 3TN91 1MQTA 4WM7A 1PO21 1RB8G 1COV2 1R093 1MQTB 1ND2A 2WS93 4WM7B 1ZBE2 1RHI3 1HX6A 4IV1C 4RQPC 1EAH1 1ND2B 2WFF1 3ZFEB 5FOJB 1H8TC 3ZFGC 4CEWC 2WS92 4Q4V3 3J8F1 5CFCA 1HXS3 1AYN2 1VBE3 1POV3 1ZBE1 4YVWC 1VRH1 1HRI3 5CFCB 2VQ0A 1BEV3 3S6PA 5CFDC 3M8LA 1R091 1A6CA 3VBSA 2Y26A 1VBE2 1RHI1 1BMV2 1HRI2 4RHV3 3VBSB 1ND3C 1RUH3 1F2NA 1VBC3 1BBT2 4CDUA 4Q4V1 5FMOS 4JGYC 1HXS1 1MEC1 1OHFA 2RR13 3VBUA 1VBE1 1POV1 4CDUB 3VBHA 1RUF2 4RHV2 1NCRB 5BNPC 1RUH2 1IHMA 1BEV1 3VBUB 1RMU3 3VBHB 2HWD1 1PIV2 2HWC2 4IV3A 4AEDA 1C8NA 1MQTC 4RR3B 4WM7C 4RS5C 2RMU2 4AEDB 4RHV1 1ND2C 4Q4W3 4Y5Z0 1FPN3 4NWWA 1VBC1 3ZXAC 2RS32 2BUKA 2RR11 1QJY2 4Z92B 2HWE2 3JB4C 1RVF3 2WZR3 2ZZQA 5CFCC 1RMU1 1ZBA3 2RS12 5AC92 2R072 1PO13 1R1A2 3VDDA 1RUC2 1RUJ2 1EV13 4CDQC 1QJZA 1RVF2 3VDDB 3TN92 3VBSC 1OOPA 4GH4B 4Q4W1 1FPN1 1RUI3 1PGL1 1PO22 5ABJA 1OOPB 2TBVA 1K5MA 4QPIA 5ABJB 4FSJA 1EAH2 4N53A 4CDUC 4GB33 2XBO3 1K5MB 1RUE3 1RVF1 2WZR1 1QJX3 2WFF2 2QQPA 3FBMA 1ZBA1 4YVSA 4N53B 3VBUC 3VBHC 1C8M3 1PO11 1AR83 3J8F2 2X5IA 4YVSB 1EV11 4QPGB 1VBB3 1VRH2 3ZFEA 4IV3C 2X5IB 4N43A 4AEDC 5L7OA 1PVC3 1RUI1 2FZ2A 1C8M2 5C9AA 1W39A 1AR82 2GSYA 4N43B 1FOD3 3JB8A 4Q4Y3 1R092 2GH8A 5L7OB 5K0UA 1RHI2 1MEC3 5C9AB 5GKAC 1VBB2 4GB31 2XBO1 1NCQA 5K0UB 1RUE1 1TME3 1PVC2 1QJX1 1B35A 2HWD3 1NCQB 1C8M1 4Q4V2 1AR81 1HXS2 1MEC2 3ZFFA 1B35B 3VBRA 5JZGB 4GMP3 1VBB1 1R083 1BEV2 3ZFFB 1E57A 2RS53 3VBRB 1PVC1 2HWD2 1VBD3 1FOD1 1QQP3 4Q4Y1 5BNNB 1OOPC 1NCRA 4EJRA 1DDLA 1AUYA 4JGZA 5ABJC 1F8VA 1NOVA 2RS52 1K5MC 1TME1 4JGZB 4QPIC 1VBC2 1RUG3 4Q4X3 1NG0A 4RR3A 1QQP2 2R063 2R043 2HWF3 2RR12 4YVSC 2ZAHA 4GMP1 1AL23 1R081 2X5IC 2RS51 1RMU2 4Q4X2 2R042 3ZFEC 1VBD1 5J96B 1QQP1 4N43C 3JBG3 5L7OC 1QJU3 1AL0G 1X36A 5C9AC 3VBOA 3CJIA 4FTEA 1VAKA 4Q4W2 1D4M3 4IV1B 1FPN2 1PGL2 1VBA3 1HRV3 1RUG1 4PDWA 4Q4X1 3VBOB 3CJIB 4CEYA 4CEWA 2R061 2R041 1NCQC 1CJDA 1TMF3 3NAPA 1CD3G 1QJU2 1Z7S3 4PDWB 2HWF1 1FMD3 1GFF2 1B35C 4GH4A 4CEWB 4CEYB 1POV0 3NAPB 1AL21 2WZR2 3ZFFC 1ZBA2 4NWVA 3VBRC 1PO12 1PGW1 1V9U3 2RM23 3JBG1 5DDJ3 1QJU1 5BNOA 1EV12 5J98B 1X33A 2MEV3 4GMP0 1AR93 1NCRC 1D4M1 5BNOB 1RUI2 2DF7A 1VBA1 1HRV1 4CDXA 5DDJ2 1TMF1 4QPGA 1Z7S1 1ASJ1 4CDXB 1FMD1 4RR3C 1COV3 4GB32 2XBO2 1AR61 1RUE2 1QJX2 5LK7B 5C4WA 5C4WB 1V9U1 2RM21 5DDJ1 1NY71 4RS5A 2MEV1 2IZWA 4LLFA 5ACA3 1AR91 1NA1A 4FTBA 4RS5B 1AYN3 3DPRA 3VBOC 1RUD3 3CJIC 1AYM1 1FOD2 4Q4Y2 5JZGA 1NA1B 4PDWC 3DPRB 4CEYC 1COV1 1AR73 5ACA2 3NAPC 2ZTNA 1TME2 5D8AA 2PLV3 3VDDC 5BNNA 4FTSA 4GH4C 1RUD2 3VBFA 5A32A 5D8AB 4BCUA 4WM8A 4CDWA 5C8CA 1VB4A 1BBT3 4CDQA 2BFUS 3VBFB 5A32B 1AR72 2WS91 1R082 4WM8B 2PLV2 4CDWB 5ACA1 5C8CB 4CDQB
chains in the Genus database with same CATH superfamily
4LITA 5IW0A 1I5ZA 5FUIA 1AX0A 2OPKA 1VBD2 2WA3A 3CHXA 1RUD1 3ZKYA 1F5JA 3R0RA 1E5HA 1L3JA 3CJXA 1KGYA 1Q5OA 2JDPA 3T0BA 4XF4A 4C0HA 1GR3A 3KHBA 4DEQA 1VAMA 2L9LA 3P1IA 1DGRN 3WP3A 2HWC3 3OD0A 4MGIE 2LROA 4OHYA 1UOBA 2CGNA 3FUQA 4LKFA 1K12A 2GNMA 1OA3A 1VB2A 1I5PA 1W3XA 2IFWA 1R64A 3SLIA 1AXYA 1LEMA 3K75B 3ZN4A 4BIFA 2MPFA 3INAA 1BJQA 1EUTA 2R062 1KDMA 2VCCA 3LEGA 4A41A 2BPA2 1QJEA 4FCAA 5FXWA 5JCTA 1JYNA 5CG9A 5C4WC 4L99A 1XOYA 1QOTA 2V5DA 3VZNA 4RQPA 1Y7BA 1CAWA 1AL22 1G6NA 3N7JA 1DQ2A 2IXCA 1DQ4A 1JODA 3H0OA 4FVVA 4Q1RA 4W6YA 4CUAA 1S0IA 2VZOA 4RQPB 3RQ0A 3WF2A 1H6YA 1UZWA 1CAWB 1QJY3 1V6IA 3ZFGA 4AGRA 1CX1A 4N7UA 1KD7A 1UPIA 4CUGA 3ROUA 3WHTA 4PQQA 1ASJ3 1WBLA 3ZFGB 4IERA 3JD71 4I0AA 4A3ZA 1UKRA 1ODNA 1Y3TA 1R1A3 2WA4A 2XJVA 3T08A 1E5RA 1AR63 4UW4A 1D4M2 2XL7A 1RUC3 2QVSB 1HRV2 3LCPA 4XAEA 1W2OA 1N3QA 5CFDA 4B4RA 1U5IA 3TN93 4XFHA 1Z7S2 1ASJ2 4X8PA 5FZMA 2C4XA 2WZ8A 2YFUA 4XFCA 5CFDB 4DUXA 1K42A 2BFUL 3AJYA 1CPNA 4Q2FA 1ULDA 5FLJA 2WKKA 3R4DB 1YHFA 3O5SA 4BQ1A 1AR62 1UY0A 4KI5M 3AVSA 4NHKA 1M06G 2B45X 1HKDA 2E63A 3AYAA 3LGRA 5HXMA 3GHMA 4KGGA 1EAH3 1OT5A 1ZZ8A 2I2SA 2Y64A 4NIIA 2BBVA 2JICA 4JKMA 3KF5A 4IGQA 3SKVA 1NE4A 1V9U2 2ZGNA 2JIJA 3OBTA 3T0DA 1ONAA 4PI0A 1A34A 1Q56A 2WZPP 3B94A 4RFT0 3WNKA 3A4UA 4H14A 5AC91 1JHNA 1NX9A 4LKEA 2HBTA 1OUXA 4HG6B 1CZSA 4EZ4A 4Z1VA 5IVVA 4M4PA 1OLRA 1OH4A 3H3LA 1XYOA 5LRRA 1RUJ1 3KV6A 4LO5B 5GLTA 1V00A 2HYXA 3IN9A 3J7MA 1WGPA 4PIYA 4XBLA 3VLBB 4NPMA 1W8TA 5EXOA 1YFYA 1MQTA 2Y6GA 3RJRA 4WM7A 4AAPA 2BEOA 3GZAA 2E31A 5J1XA 2YC0A 1COV2 4HVOA 3UGHA 5K8SA 2RDQA 4E27A 2MNGA 3BYWA 1MQTB 4BM8A 4WM7B 3VGIA 5T52A 4R4XA 2WQ8A 1HX6A 3LDRA 4HETA 1CVNA 3KD4A 4IV1C 5T5LA 2JKXA 4O65A 1YJKA 4AF9A 1ST8A 3BVCA 3ZXDA 5DUUA 2P2KA 2WFF1 3NW4A 4GJZA 3U10A 1H8TC 4Z07A 5B4XA 4A42A 3WP4A 3MIGA 1DIWA 3BU7A 4WVVA 2XJUA 4LO4B 3GBFA 3U37A 1LU1A 4M4RA 1VALA 2GAUA 2XJQA 4UFIA 2WO2A 4YNIA 4S2FA 3WQ7A 5C70A 1S4CA 4LO7A 1YFWA 2JG8C 5L9BA 5FY1A 3O1RA 4LA3A 1LJ7A 3HN3A 5JXJA 1O3SA 4MYEA 5FUNA 4NIDA 3RI9A 2I45A 3M8LA 3VBSA 1XPWA 1C3HA 2BNOA 4LHNA 1RHI1 4XEZA 2D6LX 4M0HA 1LB2A 1BMV2 3KM5A 3NNMA 4QQHA 5FMCA 3B5LB 3VBSB 4G3YC 1RYYA 1A3KA 1RUH3 2PHLA 1W2NA 2VAUA 1CZVA 1ZM1A 1VBC3 1YQ5A 3AP4A 4MGZE 3U75A 1BBT2 2VUJA 1CX4A 4FPYA 5FZ9A 1XJAA 4CDUA 1O8SA 1UMIA 1G9CA 3PIJA 4B7EA 5FY9A 3ZN5A 2D3SA 4AFCA 1POV1 2VW1A 4CDUB 4HFSA 3KHCA 4F8AA 1RUF2 2VZRA 2UY9A 1AXZA 3I3QA 4FOQA 5FRAA 1RUH2 4ZXKA 4YPJA 3RI8A 1DZRA 4IEXA 5C3PA 1J58A 4KNCA 2XVLA 2Q8DA 4M3CB 4K20A 1YJLA 3HQUA 4IV3A 4AEDA 3M1HA 1MS9A 3SH3A 4P9WA 3LOIA 3KZ4C 5I0UA 3CZJA 4HONA 1BYHA 4LBLA 1A8DA 2RMU2 3BB6A 1OC1A 1YIPA 5FLHA 4YW2A 4AEDB 4RHV1 5JOXA 3WP6A 4JV4A 4UAPA 4HANA 2W47A 3EO6A 4NWWA 4DO0A 5FZ7A 3ZXAC 2Y60A 3I3BA 2D97A 5EYYA 4C0BA 3LD8A 2JD4A 2OUJA 2QQIA 3AZZA 2RS32 3NL1A 4AW7A 1O3QA 3D8CA 4BMEA 1DU3D 2YV8A 3OOXA 4N7IA 2Z69A 2RR11 2HEVF 2WO3A 4FPKA 4MUVA 2HWE2 2IXJA 3BPZA 3ZYJB 1RVF3 1H6XA 3DL3A 2DVFA 4OUEA 2UWBA 4LA2A 1IPSA 3ZN6A 2V73A 4LKDA 1WW5A 1RJ7A 2R072 5GZGA 1PO13 4ATEA 3VB9A 2B42B 3D3AA 2ZX1A 3T3YA 4MG2A 3ZN6B 1O4TA 2CDOA 1GZTA 1J3RA 4LHSA 4TZDA 3CKHA 2PQQA 4A44A 4NRQA 5GZCA 4DQAA 1EV13 3VKNA 1ACCA 1TNFA 2FMDA 1RVF2 3ZYBA 3M70A 4IE4A 4JKKA 4XF9A 4TYSA 1RUI3 3BIWE 2BQPA 1PO22 3LPGA 4XURA 4ZU4A 5KXEA 4I02A 4W8JA 4P9GA 4BU2A 1MVEA 5BYNA 1KQRA 1PMJX 4GZ9A 5F1RA 4NAMA 4XJ8A 5FYIA 3N4MA 1SLLA 1K5MA 4QX7A 2CWSA 5D21A 3CZUA 2VTFA 1W8HA 3VZLA 3L2HA 4ASMB 3PMSA 4M00A 1K5MB 1RUE3 2WZR1 1MS0A 2W1SA 4MLOA 1GQGA 3RWNA 1ZBA1 1UN1A 2DVBA 4K8RB 1PK6C 3KVBA 5FAXA 5LA9A 3VBHC 1Q8VA 4HK9A 4BMBA 1AR83 4FQ4A 1LGBA 3UT0A 3W9AA 3VDCA 1US2A 3PUAA 4K3UA 2X5IA 2D7FA 3WW3A 5FP8A 3N7KA 4MXWA 4YRDA 1Z0HA 4D94A 2A7AA 1XNCA 5GM0A 4GA9A 1Z78A 5LA0A 1ENRA 4IEYA 1XSRA 4KG0A 2X5IB 1YO8A 4N43A 3VZOA 5L36A 2HH9A 2G1MA 4MXWB 1PVC3 4JQTA 4QHZA 1OKQA 2TNFA 2W91A 5C9AA 3PTRB 1AR82 4QX8A 2SLIA 1L7QA 3NO8A 4N43B 4Q4Y3 1R092 2AUYA 2ZEXA 4QDRA 5GJ6A 5K0UA 4XUTA 1QY4A 2OVUA 5L9RA 2YUEA 5C9AB 1RUOA 5FUPA 3HR9A 4IGPA 3AZVA 3W5NA 4QB2A 3PIGA 5F7UA 3ZYHA 5K0UB 1VRBA 1JMUB 2VBBA 1PVC2 1ZZ7A 2ZX2A 1OI6A 4L11A 2HWD3 1ENQA 1Q3EA 2R30A 1W8OA 5LBBA 5A7PA 3VUOA 4Q4V2 2D5HA 5EQUA 3LFMA 4XVHA 3ZFFA 5ISLA 5HCHA 5KHGA 3WDYA 2ZX4A 2J1SA 1UO9A 5JZGB 1SEFA 3VDAA 1GQPA 4RGAA 1VBB1 4IQPA 3LAGA 4PJYA 2XVKA 3VZMA 4ZZ5A 1R083 5A6QA 3WLUA 3ZFFB 1W9WA 3QD6A 4Q0PA 4XDOA 1CGPA 2HWD2 3AJZA 2QQOA 1V0AA 2LW8A 3DXUA 1T6BX 2UWCA 3O1PA 1OA4A 1W2AX 2YB7A 1FOD1 4XFBA 4E8CA 1OOPC 5J3UA 5J36A 1NKGA 5GZDA 5FWJA 2VMEA 1F31A 2A6XA 3VKLA 5JXHA 4QKNA 3AMNA 2QTWB 4CXXA 1EPWA 1VIWB 4V2VA 4AVAA 1XRUA 1LOFC 2O1QA 5I8SA 4MH0E 1H9PA 4EN6B 1QNYA 3LA3A 1UD1A 4IEQA 1GANA 4QPIC 1OQDA 4DEVA 1NG0A 2A73B 3F95A 4RR3A 1QWRA 4META 2FQPA 1UU5A 2D98A 2ZABA 1UQXA 1DGWA 3NQHA 1X7NA 4ZXEA 5IYYA 3HBKA 4DXTA 3OYWA 4M01A 2DWRA 1S0EA 1W3VA 1KS5A 3ORJA 1OD5A 3VDBA 2RDSA 2QFEA 3THDA 1Q8PA 5FYVA 4UFHA 2FDFA 2QQUA 2CU5A 4LBQA 3M3IA 4UT5A 2YROA 1QOOA 1QQP1 2JX9A 5FZFA 4PT6A 5L7OC 5KBFA 1H0BA 2OXBA 4HSJA 4LBQB 2W92A 4JZRA 1OVPA 3VBOA 3VD3A 4PCRA 1GZCA 3LA7A 1FPN2 3ACGA 1PGL2 2XJPA 4PDWA 2ZGKA 4QM9A 5FY5A 3VBOB 5LY2A 3ZVXA 3H7YA 3LEMA 4CEWA 4P9XA 4QX1A 1CD3G 3ZX7A 2WNUC 3NRUA 2HWF1 2QQNA 3K51A 4PDWB 1WMEA 1GFF2 1APNA 1B35C 2JENA 4CEWB 2C6SA 2DYCA 2Q1ZB 3VHRA 5CBLA 1RC6A 4YGCA 4UW3A 4W50A 4LUMA 1UXXX 4NWVA 4LORA 3MUY1 4PIXA 5FYBA 3VBRC 3IPVA 4QU2A 1YQ2A 5HCAA 2KM2A 5G04L 1PGW1 1FAYA 3U1XA 3JBG1 2WC2A 5FP4A 1OF3A 4AQ2A 4BLIA 3UKTA 1QJU1 1SZBA 5FXVA 2FCTA 2VNOA 5CU1A 5FZIA 4IE7A 1NCRC 2ZGTA 1JXNA 1QHDA 2QZ3A 1OFSA 4YW4A 5L73A 3WQ1A 1BXHA 4NOTA 3WP5A 4DOUA 2BZDA 2WT1A 1TMF1 1XB9A 2AZ5A 3MIDA 4QPGA 4DRRA 2BERA 4COZA 2XJSA 5AVAA 5HCFA 3T2QA 3UK9A 2HEYF 5IK5A 4HN0A 3C7GA 4GB32 3KGZA 3WW4A 2XBO2 3O1OA 1IPKA 4SLIA 1OQ1A 5TSWA 1LOGA 2OA2A 4XF0A 5IAXA 2ZEYA 3W20A 4A7YA 1GP5A 2EIBA 2YC4A 1QF3A 2D5FA 1UY3A 2LTNA 3ES1A 4AEJA 1L7LA 4AXOA 1WMDA 3MF9A 1V6OA 2D3RA 2GN7A 3KQRA 4HMZA 5A7OA 2MEV1 3HQXA 5I0DA 1QNWA 1AR91 2HLEA 4D7YA 3POYA 4RL7A 4BXFA 2A6YA 1KXGA 1MZEA 3I3MA 3DPRA 1RUD3 1H2LA 2D44A 4YFWA 4LE3A 1SFYA 1CPMA 3AMQA 4MADA 5E89A 1UZVA 2Y6KA 1D2SA 1XNAA 4H2AA 2QE3A 4Z2AA 3DPRB 4S2HA 1XQNA 2LM3A 1BLZA 4UW5A 4IUGA 2XOMA 1Q8QA 4DINB 4QD2A 3K48A 4BE3A 4P5YA 5D8AA 3BGAA 5BNNA 1MR5A 4B1MA 3A21A 2VMGA 3B7MA 4DRVA 4AI3A 3LZZA 3W5MA 1RUD2 1SFPA 2W1UA 3WF1A 3RYKA 5JI9A 5D8AB 3UKVA 1QH6A 4BCUA 1JYWA 4EN9B 1UMZA 2EVXA 4WM8A 2XLGA 4CDWA 1DF0A 1W6PB 2H0BA 4A3XA 3F2ZA 4BQYA 3H1WA 4CDQA 2BFUS 4QKDA 3E5UA 3SQOA 5A3MA 2R7EB 4CU8A 3S5AA 1XBFA 4WM8B 1ZNPA 1ZRRA 4CDWB 1YEWA 3LDBA 2VQTA 1HV0A 3Q8EA 3WDXA 4XYXA 1EPZA 2GC0A 4SBVA 4BQXA 4CDQB 2JB8A 4U2AA 3KVAA 5JOZA 4N53C 2JE8A 1UL9A 4XUOA 4DY3A 3S5QA 4XOGA 4QT6A 2CTVA 3IDCB 2Z4FA 3MIHA 3AKPA 3SH5A 3JD73 3RNSA 4OI0A 4AFAA 5FY8A 3WD5A 5APAA 1S0GA 1WKYA 1JZ3A 1GWLA 1KJLA 5JR2A 1UU6A 2PLV1 3S57A 1RUG2 2W52A 3KLSA 2W9XA 3DKWA 4Y4RA 1QIQA 1VE0A 3SITA 3QCWA 4B7KA 1RITA 1LTEA 1YQCA 1HRI1 2GNDA 3HNYM 4N8MA 5AVPA 4IXLA 4MGKE 3ZR5A 4A7KA 1OKOA 2PHFA 2XL9A 4CCKA 4D6QA 3H1YA 1UYZA 2O8OA 3JD72 5IVYA 3WW2A 4LBMA 2DDUA 3ALQA 3I7DA 4I01A 1C5HA 3VL8A 2WAOA 2VZPA 4AZZA 1WMXA 2XHKA 5FP9A 2WWJA 4XIOA 1IPJA 4EWEA 3M3CA 4B8EA 1X82A 3V64A 4LO8A 4TSVA 2F4PA 3MIBA 2EA7A 1NZIA 1YI9A 1OLMA 4XMIA 2B8MA 3HAGA 1GQHA 5JPMB 4TWTA 1FNYA 1O4ZA 5H9SA 3KQ4B 5FPVA 1Y43B 1UMHA 5LBFA 4MGTA 5FZLA 4XUQA 5AC93 4XUPA 4YVWA 1TG7A 4CCCA 4CU9A 1F5FA 1PIV1 5FO8B 5DABA 2AACA 2UU8A 3LEIA 4XBNA 2Y6LA 4C1WA 4CCDA 1PHMA 3IDEA 1S1AA 1VBA2 4XZPA 4YVWB 1RUJ3 5LEJA 1IQDC 4BWOA 1D7PM 2WDBA 3C2UA 4QAWA 3HQRA 3SNMA 1XE7A 4CCLA 2ARXA 4BZ4A 1X8EA 1JU3A 3ILNA 3SCFA 5LA1A 4LBOA 3IM0A 2WLPA 1D2QA 1FMD2 3NNGA 5CVRA 5FLIA 3DF0A 1I6XA 4DMIA 4QXHA 1UZ0A 4AQSA 2WNVC 2P4EA 2W95A 2QQWA 1ND3A 1TEIA 2LS6A 3Q8CA 4FOYA 3HD8B 5A33A 2ILMA 4Q27A 1QEXA 2ZKLA 3D4KA 1J1TA 4XJWA 4JRAA 1ND3B 3NJVA 1LR5A 2AR6A 2RM22 4GQ7A 1NY72 2VY0A 2ZCWA 3P3PA 4JGYA 3U07A 3UL2A 5A33B 4Q1PA 1ULPA 2WFF3 2RS11 2CV6A 2WNEA 3AL6A 3DN7A 4QKFA 4FXGB 1AX1A 4JGYB 1DQ0A 3OJBA 4AAXA 2PTMA 4BA6A 3R4SA 3NMBA 4RFRB 2C1FA 1WZXA 4ZU5A 1C4RA 2HWB1 3GM8A 1REDA 2D3PA 2KXLA 3TEYA 1WD3A 3PLQA 1HQNA 2VNVA 3WX5A 1ZZ6A 2VBDA 4Y1ZA 4YG6A 5DUWA 3P3NA 1HJFA 3E5XA 3ZXKA 2BOIA 4YYOA 5C5TA 3IKWA 1G8WA 2YGMA 4XDPA 3D0JA 1G86A 5FZ0A 5L19A 5HXVA 2WS93 4QU1A 2WYSA 2ZPXA 1RHI3 1RXGA 3O1TA 4RQPC 1WLDA 3AMHA 4HL0A 1POQA 4IGOA 2NP0A 2IXLA 1X8MA 5FYUA 1UIKA 3ZFEB 5FOJB 2DCTA 1LGNA 3ZFGC 1YC61 2WS92 5C33A 5FMBA 3CNAA 3J8F1 1O59A 1OD3A 1VMJA 2E9QA 2FHRA 3N7MA 4XXPA 5I0TA 5CFCA 4K8FA 1AYN2 1ZBE1 1POV3 5HCBA 2C26A 3VN4A 2YBSA 2XLAA 1VRH1 5F5CA 4Y24A 2A6ZA 2VQ0A 3DYPA 2IUWA 5CFCB 4AE2A 3DV8A 1Q8SA 5IVJA 3TBDA 4CE8A 3PL0A 5I0SA 4I3PA 3WCSA 5FPUA 5CFDC 4YLZA 3B3QE 3RYPA 5FO9B 4ATFA 4NRMA 1J59A 2ARCA 2Y26A 1N1SA 4UW6A 3RZZA 4LJHA 4D7SA 5FFOC 1NE6A 5M0TA 1LOAA 1W03A 3T30A 3OF1A 4RHV3 4Z8BA 1LHNA 4FQZA 1ZRCA 2PMWB 3BN6A 5FZKA 3I2OA 4FPLA 2ZGSA 3BTXA 4F7ZA 3WINE 4MGQA 3ITQA 1W05A 5FMOS 5IWFA 2K0GA 3GF6A 2ZX0A 4KBBA 2J7MA 1HXS1 1MEC1 2I74A 2R32A 2RR13 3N35A 4JX0A 3VBUA 5JPNB 3OUIA 2JE9A 3POJA 1JZ6A 2CNAA 4RHV2 4KWLA 3WNPA 5FXXA 5JUVA 1BEV1 3VBUB 2WQZC 4R9CA 1GOHA 4AFMA 4URAA 1ULCA 4AHXA 3C7FA 4UWDA 1XXNA 2HWC2 1ZX5A 2VMIA 3ZXFA 2WN2A 1C8NA 1MQTC 4WM7C 4XJAA 5I0RA 4RS5C 1UIJA 3GGLA 4P08A 2RV9A 3O1UA 2UY8A 2ADEA 3ME2A 2A1XA 3PJQA 3I97A 3LKJA 5F3GA 3KCYA 2A6WA 3J9SA 4XACA 4IEWA 1FYUA 4HKLA 1WA6X 3AZWA 3ZXJA 2H6CA 3QOPA 3KB5A 1YLLA 4LULA 4BPZA 4DY5A 1PMIA 2CHHA 2RJ2A 4XFFA 2BUKA 3NJYA 5HI0A 3AZXA 4RGKA 2WSVA 5FP7A 1QJY2 2BWCA 2WWUA 4Y1XA 4Z92B 4PLMA 3M3OA 4GWIA 1BK0A 1JI6A 2WZR3 4LBJA 5E1RA 3AP7A 3SKJE 3U11A 4YW5A 2VXJA 1V6LA 1RMU1 1Y9QA 1ZBA3 2A70A 4CP0A 4EWAA 3RZGA 2KA3A 2ZGPA 1WLTA 3GXUA 2Q1MA 1DP0A 1TVGA 1R1A2 1YYNA 3A0NA 5FPLA 4JTNA 2DCKA 2YFZA 1GMMA 1XNKA 1RUC2 3K4DA 1GU3A 1CQ9A 3RS6A 1XNTA 1H1AA 4LE4A 5FYZA 3TN92 3VBSC 4ZKTB 4Q4W1 2FBEA 4GH4B 2JXAA 5IFTA 3SCHA 1GNZA 1WW7A 3H50A 2ORXA 1LESA 3T2PA 4AI1A 2JB4A 5FXZA 4EZHA 3WDVA 4YZ2A 2TBVA 1RGSA 4I3GA 2CYFA 3RJ2X 2G19A 3AKQA 1EAH2 2YGLA 2ZGQA 1V6KA 2P3KA 2ZS6B 4CDUC 3JQWA 4Q26A 3T2OA 3Q8FA 1JUIA 5CAZA 2VVDA 4YVSA 1V6JA 3IAPA 5K7PA 2OZJA 2UURA 3SEEA 4YVSB 3J26N 4O9GA 2VM9A 1YRZA 4Y22A 3SC7X 1RJ8A 3I2HA 1VR3A 1XU2A 1BK1A 4J6GA 1UU4A 1VBB3 5CB7A 1WBFA 2DUOA 2W08A 2KD7A 5FCCA 1ULOA 3PNAA 4IV3C 4AEDC 5FZ1A 4W4ZA 4Y22B 3ON7A 2O8QA 4LO6B 2YBKA 2GMPA 1S2KA 2GSYA 3RG0A 1FOD3 2OZ6A 3JB8A 4XMAA 2PFWA 2CAVA 3IWZA 5FMDA 3IDAA 5C6CA 4IEOA 1RTVA 1VBB2 1YFXA 3PJYA 3OY8A 5F32A 2ZAAA 3AYEA 1NCQA 2WBKA 2OQ7A 3AKSA 1QJX1 4L8QA 4QB1A 4NE9A 2XKOA 3ZXLA 3OY8B 5DXDA 2GU9A 3UYJA 1NCQB 1C8M1 2Y34A 4PBOA 5FKBA 2EXJA 1K3IA 2YY1A 1AXKA 4MOAA 4QX0A 3RZKA 3GJBA 4LTAA 4FFIA 4QQ2A 4E2SA 4GWNA 2J1EA 3H7JA 1W6QA 2J1VA 4E4ZA 2VMFA 1IKPA 4HXCA 4YZ4A 3RVHA 3T4VA 5BV6A 4N9HA 2PHTA 4CP9A 4L0PA 3HN1A 1NQJA 2DV9A 2X29A 4ZONA 1BVVA 1W6QB 2OQ6A 3V56A 3ZMNA 1QDCA 1QQP3 2XQRA 4CP9B 4WBBA 4EJRA 2JG9A 3LSEA 1DDLA 1ZYBA 1LEDA 2YC2A 3ACLA 1ZA4A 3HVDA 1W8FA 2ZBJA 4YSFA 4EYUA 2VQUA 3MV11 5GZFA 3SEPA 1F8VA 2P34A 1NOVA 3DUIA 2JG9B 5FPZA 4CYDA 1K5MC 1TME1 3N36A 4H7LA 2C0ZA 4M3CA 1VBC2 3AKTA 1NQDA 1UAIA 2LRPA 2ZEWA 3ELNA 1FI2A 2C9AA 4XFGA 4YG0A 3OGJA 1QQP2 4HBNA 1Y9MA 2VR4A 3CEWA 3TOJA 5FZ4A 4CU6A 3J7HA 5F3IA 3ZLIA 2HWF3 3MZHA 5FZ3A 4DXZA 1GSLA 3BTYA 3NV1A 3PTYA 4XHBA 2J1TA 5CNAA 2X8KA 2ZHNA 1OBNA 5F6KA 3VKOA 5KXBA 4CPBA 2X5IC 4AFBA 2ARBA 2RS51 2HJIA 2N7GA 1QH7A 1X50A 2YYOA 4ARYA 5LWBA 1JBCA 4D69A 4MGYE 2R16A 1S2BA 2VMHA 1VBD1 2NYYA 4N43C 3JBG3 1LULA 1BQPA 3BCWA 5JOYA 1QJU3 3WNMA 2XJRA 1E5SA 1R1ZA 1X36A 1XSQA 1QXJA 2F6BA 1JYCA 2J22A 5C9AC 3FMGA 4TTGA 4FTEA 5FYSA 1VAKA 2BDRA 1N1VA 3U4SA 1J3QA 4IV1B 2ET7A 3VKMA 3W58A 4Q4X1 1U0AA 5FJHA 2IVJA 3KMHA 5HV0A 1PVXA 1W9FA 4OUMA 4CEYA 5KC6A 2R061 2R041 1TMF3 3THTA 3BI3A 1QJU2 1HW5A 3I54A 1ZRDA 4OHXA 4HPKA 1GOFA 2DCJA 4CEYB 2I07B 1G9AA 2ZGMA 4ARXA 4KBZA 4HN1A 1AL21 1W90A 1JYVA 2XDVA 3WG4A 2O0OA 4HPKB 3ZFFC 5FKCA 4E2QA 2Y6JA 3JU9A 4G9SB 2VZSA 2JG8B 4A6SA 1PO12 1HIXA 4GJYA 5DQ0A 5F9TA 5DAQA 2CGPA 2DVDA 2WN3A 2W94A 4K21A 1QKQA 1JOBA 2W68A 3KCCA 4AEMA 1HLCA 2IFRA 4CXWA 1SFNA 5I8TA 1EV12 1DFQA 3H8XA 2EAKA 5GALA 2MEV3 1ZVFA 3RWKX 2ZGUA 1AR93 3I3DA 2TEPA 1D4M1 3OPZA 2CAUA 4KWUA 1RUI2 1HRV1 1MZ6A 1MS8A 2WUHA 4CDXA 1UX6A 3HT1A 2RJKA 3DCQA 5FOBB 1UWWA 4GWMA 1ZZ9A 3BPSA 4LIUA 4NHXA 4AI9A 3AL5A 3ZDSA 5C3SA 1Z7S1 1ASJ1 3WW1A 1IZ3A 2WT2A 3MLJA 3G6JB 4LHLA 5FTTC 4RR3C 2B9VA 4CDXB 1JYIA 4QB6A 2VL4A 2VMCA 2VOXA 2XGXA 4JQRA 4PIZA 2IVIB 1AR61 1RUE2 4YM0A 3S30A 3SHRA 2W1WA 3VHNA 2IXIA 2QNKA 4BISA 1YUDA 2RG4A 3BOPA 3DYMA 4GWJA 4JDOA 4OZXA 4QX5A 1HDKA 1H2NA 1H8VA 2YZ4A 2A5ZA 1W2TA 3IB3A 1V9U1 3B01A 1XYPA 5DDJ1 5ERLA 4YW3A 4Q0VA 4GD4A 1DQ6A 4JC1A 5FBZA 4YGEA 4XETA 4Y26A 2ZHKA 3MO4A 3OUJA 5H9RA 4Y1VA 1WLCA 2KR2A 4AVBA 1PMHX 4RA0A 1H2MA 2LALA 4ZZ8A 1SLIA 1W6NA 1NA1A 2FCUA 3I2GA 1X9TA 4R4ZA 3RFRA 3ZKUA 4BIOA 5JXIA 2PXJA 4FTBA 1W9TA 2QDRA 3VBOC 5F3EA 4Q4Y2 5JZGA 1W6NB 4AL9A 1NA1B 3K2OA 3WG2A 2XUMA 4O61A 2QKDA 3SH4A 3MUZ1 4PDWC 3VL9A 1CIYA 4AHWA 5JXGA 1COV1 1PZ9A 1CAUA 1JUHA 4A7ZA 5CADA 4C90A 4YG3A 2ZTNA 4A6OA 1N3PA 1SBDA 3VDDC 2PLV3 2DU0A 3EYPA 4FTSA 4QQOA 3RMYA 1GICA 3EJKA 4I2OA 1CAUB 2P5BA 3AFGA 1SCSA 3BU0A 3NV3A 3VBFA 5A32A 5CA6A 3CF6E 1LCLA 1N1YA 5DAXA 5IATA 2IWGB 3SXWA 5C8CA 3ZO0B 3KV4A 2GC2A 4FPJA 5JMOA 1JN2P 3IDBB 5A32B 3VBFB 4BDVB 2GMEA 1JW6A 3POFA 4W6XA 3B9CA 5FY4A 5A7NA 1R082 4UBHA 4EN7B 2PLV2 5C8CB 1URXA 3WSOA 2P17A 1HB1A 3ASIA 3WF0A 4BHPA 3IAQA 2J1RA 1STMA 3AYCA 3GDBA 4YM2A 3PMEA 4LBNA 3FLTA 4OHZA 2ERFA 1UZZA 3P6BA 5JOWA 4OI1A 2BNNA 3T1MA 1U5ZA 5F6LB 5FK8A 2O14A 1LECA 1PIV3 1AR71 3UNPA 1DGRA 4FPEA 4QPGC 2XKPA 3I2FA 3AM2A 3V0AA 4BB3A 4BK5A 1QXPA 1BMV1 3O12A 4LQRA 1NXMA 5F2WA 3H3ZA 1PK6B 4N9IA 5FY7A 3WV6A 2E7AA 1BBT1 4URTA 4COVA 3FJSA 5DG1A 5F5AA 4FFHA 3LOBA 1QGLA 2WIIB 2QQMA 3FZ3A 2ORZA 2ZACA 4JVAA 2XQXA 1KITA 4E2GA 3M7AA 3H9AA 5G05L 3IMNA 2DUPA 2K2SA 2QUOA 1MVQA 1RUF1 4Y1UA 4YARA 2A75A 3POIA 3A7QA 1RUH1 2BGCA 2FMYA 2LUWA 1ZRFA 4PHZA 3LIGA 4LEJA 1NLQA 1W8NA 1PNFA 2RS13 3DPRC 5FV3A 2WWSA 4HLTA 2FZ1A 4UF0A 3CDZB 5FZBA 4BXSV 5BNQA 1JYTA 3FFZA 3CIHA 1T2XA 4GKXA 2HWB3 2RMU1 4UF0B 3BUCA 1HN0A 1H2KA 1PZ8A 5D8AC 1OPOA 3FHQA 5BNNC 2PELA 1UY1A 4IEPA 2AENA 5SV8A 1XYNA 1HB2A 4YW6A 5FZ8A 2J1AA 3URFA 3I59A 2BP6A 1S0BA 2RS31 2W39A 3HNMA 4WM8C 3N9MA 5FYHA 3WQ0A 4BH9A 4CDWC 3OBAA 1J3PA 2HWB2 4JGZC 3I59B 4NIHA 3N9PA 3A22A 3GALA 2JECA 4HVRA 2HWE1 5EJZB 5A80A 5EZWA 1AYM3 3IZOA 4OFGA 5C3QA 2NMOA 2VE1A 3MEPA 5FO7B 4DXRA 4ZU7A 3OGSA 3WZ1A 3N7LA 2ZZJA 4NHYA 4XW3A 1D4VB 3KF3A 4UOJA 5IK8A 2VOVA 4C91A 4XUNA 2R071 1DCSA 1NZCA 5DMYA 1ULGA 3J8F3 5BNPA 3LSDA 1ZBE3 5JIAA 1YQ8A 2P6CA 2ZJCA 3I2DA 3DKQA 3CLPA 1WCDJ 3MLLA 1AYM2 5BNPB 5C71A 1VRH3 4I0BA 4YZ3A 5KXDA 3KCXA 4QPIB 3C7EA 4K40A 5H9QA 4HSLA 4ZS2A 3RPQA 4ET7A 3A0KA 5DUXA 4IDZA 1PO21 1RB8G 3S0MA 1KS4A 3WQBA 3L9JT 4DXSA 1XNDA 3K4ZA 2UWAA 1ND2A 4AK3A 1ZBE2 2W46A 4FXKB 2EF6A 2PAMA 1MS4A 4RN5A 4AGGA 4FAHA 4WV8A 4IETA 1BZWA 1ND2B 1AZDA 2DUQA 2PAEA 2ZA9A 3N9OA 5BY5A 3M3QA 3O0XA 4XIKA 5KXCA 2NZ9A 2WAAA 3C3VA 4KGQA 4XZUG 4EN0A 4K1YA 2CGOA 4P5HA 3D0SA 4G4FA 3MICA 4NVPA 5J09A 4OZOA 1HXS3 3LF7A 4LKSA 1NAEA 4MZUA 3VD9A 3KS7A 1WW6A 3LE0A 3OB8A 4RYDA 4YVWC 2WFPA 1W6PA 3RDIA 1F4AA 1GNHA 2ZKNA 3U4XA 3O1MA 1BEV3 3OD4A 3VHPA 5LK5A 2R1DA 1O7FA 1HV1A 2OT7A 1WD4A 3EHKA 1CAVA 1H9WA 1GYKA 3S6PA 4KU7A 4S2DA 2AH2A 2WNUB 1B09A 2Y8KA 1R091 1A6CA 2VQAA 2WINB 3O14A 4Z82A 2V09A 3R4UA 5EJ1B 5F39A 3WNXA 2VNGA 4AHZA 4Z2WA 5IVEA 1CAVB 1OURA 4I0WB 2FDHA 5FZHA 3E6CC 2Y6HA 4KWJA 3J7NA 4ONUA 5A3LA 1ND3C 4M3CF 3FLPA 1F2NA 5KHKA 2EIDA 4BLJA 2WL1A 2VH9A 2R0FA 1KFUL 4Q4V1 5LBEA 4JGYC 2WLQA 4PF1A 3DECA 1WA4A 3ST7A 4Y33A 2JDHA 1VBE1 4CPBD 5FPBA 1ODMA 4A2UA 4XHXA 3GJAA 4KQ7A 1NCRB 2VOWA 3PU8A 4QPYA 1DHKB 4BOWA 2VMDA 1DZQA 4Y20A 2VG9A 5KHJA 1RMU3 1YNAA 2HWD1 5CEHA 4AGVA 4YGDA 4YW1A 1ZA7A 3PUSA 5ANQA 1DBNA 2ZHMA 4Y20B 2D93A 3LDKA 5JAXA 2DBNA 1WCSA 2V5YA 4OQ8A 4DB5A 4D3WA 2GDFA 5E88A 1GBGA 1SBEA 1GP4A 5FYTA 4OMCA 4Y5SA 1DG6A 1EUUA 2HKXA 4R9AA 4TN7A 5FY0A 1EP0A 1IGOA 3Q8BA 1SQ4A 4Q4W3 4X6RB 4FO9A 2C5DA 1W04A 1UYXA 4XFAA 3AP6A 3FBYA 4ASLA 4CCOA 2Z5WA 1RINA 1LNSA 1S2EA 3E6BA 3PDQA 2VULA 4IEUA 2VVFA 4FP3A 4LUKA 4QWNA 3R6SA 4Y3OA 1W0OA 3K77A 3GHNA 2W3JA 3I49A 3JB4C 3D82A 3NV4A 1GWKA 3OGVA 2UYAA 2PAKA 4LBKA 2ZZQA 3GNEA 4WVMA 3HJRA 4QM8A 4F83A 5CFCC 4L2NA 1W9SA 5AC92 5LY1A 3WDUA 4H3WA 4XBQA 5EPAA 2DFBA 3FN9A 5BXXA 4WVMB 1TZOA 4XCBA 5D1IA 1GZ9A 3B9IA 1RUJ2 5EV7A 4ISRA 2B46X 1W6MA 2AGSA 2R49A 4OLLA 1VAVA 1S55A 3ZXEA 3VD4A 4L9BA 3MIFA 3BODA 1O6UA 2VCAA 2ATFA 3KGLA 4QHBA 1FPN1 3TNQA 1PGL1 1YQ6A 1OLME 2JIGA 4AVVA 2VUAA 1W6MB 2OS2A 2WQ4A 5ABJA 2V4AA 2BYVE 4MGSA 3CU7A 1LHVA 1LOEA 2Q30A 1LHWA 3X29B 3O1VA 5FK7A 4EQVA 2PHDA 3PURA 5DZEA 1GOGA 5DZGA 1K45A 1UPSA 4YW7A 4ZS3A 5ABJB 5FZ6A 4FSJA 3HT2A 3H42B 4N53A 4NR1A 3PU3A 3CQOA 3NJZA 5FBJA 2EAAA 2PA7A 1XC6A 1QJX3 1WMFA 2WFF2 3FBMA 3VBUC 4N53B 1T6GC 1UX7A 1C8M3 1NUKA 1CWPA 3LEKA 4FI9A 4V1PA 2P3YA 1JOJA 1UCXA 4BYYA 4LNVA 1UF2C 2QQLA 4Q8LA 4P02B 1CZTA 1US3A 1OH3A 3OBRA 5LEKA 3ZFEA 1UW8A 1U5YA 3UGFA 1I3HA 3SCGA 3BTAA 2WJSA 4XE9A 3AKRA 5J37A 1O3TA 1G9FA 3AZYA 1C8M2 4CZSA 3TYJA 4PLOA 1QDOA 3UESA 3ACHA 4CXYA 1DYKA 1Q43A 1RHI2 1CAXA 2BV4A 4MHRA 2Y6FA 2R1BA 3THCA 2AC1A 2VOKA 4GB31 2VZQA 2XBO1 4D6SA 5IVFA 1CAXB 1TME3 2GC3A 2GP3A 2AREA 3ZMOA 1W9YA 1F35A 2WO7A 1J84A 2Y0OA 4QXKA 1RIRA 3AXDA 4XXAA 3WHUA 4CCNA 4IE0A 2Z79A 3LQCA 2VD7A 1FV2A 1N1TA 1H4HA 1AHSA 3PUIA 4YZ5A 2RS53 5H9PA 2B9UA 5GZEA 2XG3A 2FDGA 1REEA 1YCIA 3AP9A 4YZ1A 1VBD3 4E8DA 2WNVA 1FX5A 4Q29A 1DGLA 5AFBA 4AQTA 1UOFA 4IEZA 3E1F1 3J4UH 3ACFA 3WUCA 1XNBA 2ET1A 2YPDA 4GALA 4J25A 5T50A 2WNVB 3ZPOA 2EXHA 2RS52 3M4FA 1DGWX 3NNFA 2G9ZA 4Q4X3 3TB0A 2YU2A 1W8WA 2Z2SB 2R063 1PNGA 1UYYA 2R043 3MV01 4AVCA 1OF4A 5F8PA 5A3NA 3BIEA 1KRIA 1DQ5A 4NUBA 4P9YA 1LAJA 1OVSA 4AHYA 2PN5A 2RR12 2YHJA 2QJVA 4YVSC 4E4HA 1LGCA 2EALA 1WCUA 2E53A 3B02A 4GMP1 1VPHA 4PLNA 3POGA 4QX3A 1AL23 5FZDA 3AK0A 5LZ6A 1SLCA 3MHZA 4Q4X2 4XJ9A 1QMJA 2R042 3EXUA 2GZWA 2ZGRA 4RD7A 5J96B 2EXIA 4IL7A 2PHXA 1P8JA 4IE5A 2X10A 1N47A 3ABZA 4LLOA 2D40A 4PI2A 4AI0A 4AVSA 5JLVA 1D0GA 3H8OA 5KR7A 2CL2A 4CP2A 4WZCA 1JZ2A 4WVWA 3EMRA 2X53S 3CJIA 1S0CA 1X9PA 2DTYA 3LA2A 2W87A 1GNYA 1D4M3 4QHOA 3WEZA 2W1QA 3CBNA 3WNLA 3POSA 3ZM8A 5JSRA 1HRV3 1RUG1 3OPTA 4LHKA 2DCYA 2ZXQA 3EQEA 4UFMA 3CJIB 5JIUA 3RZHA 1C1LA 3ZSKA 1JHJA 5JSOA 1ENXA 1NCQC 1F15A 1CJDA 2A3WA 3AYDA 3WNOA 3NAPA 1JYXA 5T5PA 1Z7S3 3V0AB 2JJ6A 5B4NA 2PHRA 2DBIA 4GH4A 4KU8A 3NV2A 4OYUA 1UKGA 2A71A 1CR7A 3DEMA 1POV0 1IS5A 1VMFA 2VUCA 3NAPB 3OTFA 1PGSA 1VMHA 2WZR2 4XF3A 5FYCA 3VZJA 3OUHA 4AOCA 5A6ZA 4L97A 4ZPIA 1RL3A 1ZBA2 2D6NA 5IHRA 4UYBA 2V4VA 4P9JA 4PBPA 1IG0A 1OQEA 4R9BA 3T1LA 1YWKA 1V9U3 5DDJ3 4XPVA 2ZHLA 4QGMA 5FYMA 1IS4A 4AVTA 1UNBA 2J1UA 1X33A 3WT3A 5HPOA 4I09A 5ANNA 5K9YA 3MI8A 2Q5TA 2JG9C 5A1FA 3I2KA 2DF7A 1VBA1 3WXPA 2IC1A 5T54A 4AI2A 1Y4WA 2BRTA 2W5FA 1MS5A 3H8UA 4QPWA 5DDJ2 5FDBA 1OUSA 2WZEA 2XJTA 5AFEA 2XWBB 4CUBA 5EHDA 1FMD1 5CG8A 3JZVA 1COV3 3I4IA 3H8RA 2EIEA 2YMZA 3ZOIA 2P6HA 2Z42A 1C57A 5LK7B 5C4WA 4CCEA 2D6OX 2QBXA 3IMMA 3KWVA 4NHMA 4QQPA 3ZYIB 3B00A 4QQLA 4NROA 4ES9A 4XQ4A 5C4WB 2RM21 1WLWA 1NY71 3ATGA 1A8MA 3J7LA 3W21A 4D8MA 1OXCA 4INDA 4RS5A 2E7QA 1YIFA 2FCVA 3S7IA 3ZYFA 2XHNA 1FT9A 4CP1A 1GUIA 2B39A 2IZWA 2DCZA 4P9LA 3CO2A 2DVGA 5IJRA 1KJRA 2VW2A 3MPPG 4RS5B 5CZKA 4C1XA 1TNRA 1FOD2 2HYKA 5F2SA 4COUA 1AJOA 4DIQA 4BQ5A 2ARAA 3OBZA 5CKMA 4BK4A 2XLFA 1DZTA 1SLBA 5JR7B 4CEYC 1W6OA 2JDUA 2WT0A 5IVCA 1AR73 4FOVA 5DZFA 5HBAA 2D6PA 2OPWA 3HPNA 4DFSA 2JWPA 1PZ7A 1DLLA 1W6OB 2Q8CA 2XWJB 3W59A 3RZLA 2EICA 4HOOA 4MX3A 3ZSMA 2MHFA 3WF4A 4JDNA 4ES8A 2ES3A 4YGBA 5DAWA 3TWIA 1O3RA 3KV9A 1AF9A 1BBT3 3K3NA 1AR72 3IBMA 3P5BA 4ITCA 5D2AA 4XTPA 1AVBA 2WS91 5LA2A 5A6YA 5ACA1 1WWYA 4Q8KA 4QXCA 2BWAA 5A1AA 1AYN1 5F3CA 4XCAA 4PQ9A 3KT1A 4LBQD 1RUF3 5FPXA 2VOTA 4XTMA 3H1MA 3IIAA 3O0WA 3HEIA 4P9IA 2YXSA 3E6DA 4Y4YA 2W0XA 4CDXC 1LHOA 4YM1A 2W2IA 1UZYA 1SACA 3U0ZA 1YFUA 2B4KA 3OSDA 1L7RA 1LHUA 3C7HA 1LOBA 1CN1A 5BNOC 4QMAA 1TQ5A 5A1LA 3SISA 3WR0A 2RMU3 2G9GA 3E97A 2E51A 3N9NA 4FP2A 5A3OA 4HKWA 5EIYB 1O5UA 4K7JA 3WDWA 2OW4A 2TUNA 3MPBA 2HWF2 4J1XA 4XC9A 3ZXGA 1C5IA 4IV1A 4FPCA 5FZCA 1LRHA 2QDNA 5EYXA 2VZ1A 2D43A 3UETA 2RS33 2VUDA 2C24A 4AI8A 4E4SA 3FFQA 4L92A 2VJXA 5K0UC 2VECA 3MW4A 2WABA 2CWMA 1H8TA 4IE6A 2HWE3 4IV3B 1PGW2 1ULFA 3JQXA 3ETPA 3JBG2 3PVEA 4M3CE 3QLQA 1SDDB 1NA1C 3PVOA 4S2GA 4XABA 1H8TB 5A3UA 4CUCA 2GC1A 1G9BA 5IK7A 4CCMA 1QJFA 2NMNA 2R073 5FIXA 5T5JA 3TEXA 5A3TA 5JZGC 2HWC1 2JG8A 5KHIA 5IAVA 1WCKA 2XVGA 1JZ8A 3WCRA 3KT7A 4GKYA 4OCTA 4KH9A 2VCBA 2JD9A 3MF6A 1SLAA 1TMF2 1JU4A 1SMVA 3NVCA 4Y5TA 3AC0A 4FOWA 3O1SA 5I8YA 4H7MA 4H55A 1S0FA 1S0DA 1MPXA 1LENA 1PO23 3RMXA 1O4YA 4JHZA 3RSJA 4FPGA 3USUA 3WG1A 4CSWA 5LW9A 3VBFC 3KV5A 1UXZA 1GZWA 4XILA 4K9SA 2IXKA 1QOSA 5C8CC 1EYBA 5C3RA 3FHIB 3USUB 1ZREA 5IFPA 4O7XA 1QJY1 2G4IA 2XUEA 1GZWB 2DU1A 3CL1A 2B5HA 3OGGA 3GZEA 1F9KA 5I91A 2XPJA 4AYUA 4IW3A 4CVUA 2Y0IA 4FBFA 1J1LA 2JDNA 5IT6A 2BGOA 4NIGA 4XQWA 1OLQA 2MEV2 1R1A1 5JSPA 1AR92 5FMOL 5E16A 2VPVA 5KHHA 3ACIA 1RUC1 2WO1A 4R8HA 3T09A 2GNBA 1OFNA 3NNJA 2X05A 3V0BA 1OMIA 1TE1B 1JZ5A 3GBWA 3GBGA 4Q0SA 3TN91 3MIEA 3WG3A 1HQWA 3SMHA 3T4HB 5CKQA 3UV9A 5FQ0A 3V0BB 3Q8AA 2ZEZA 2VTXJ 2E33A 2ZOEB 4YFZA 3PUQA 1O91A 4Q5OA 4O9EA 1D0HA 1R093 2Q1FA 3S7EA 2QCSB 5FQ0B 4EV0A 1G7YA 1DYOA 5A3PA 5FP3A 2H0VA 1EAH1 3AFKA 1UYPA 1BVP1 3ZIWA 4JCKA 3A23A 3NNLA 2J42A 4OUSA 4RSUA 3ZYPA 2JE7A 2YBPA 1YI7A 2VZUA 5CKNA 4NPLA 3MFCA 4P00B 2XXZA 4BJ0A 3FLRA 1CONA 4ISQA 2AEZA 4CEWC 4JAAA 4Q4V3 3UJOA 4YWAA 4TLFA 3QH7A 4ASKA 1H1MA 2Y33A 1VBE3 3K4AA 2VZTA 2GMMA 1C28A 1PM7A 3HNBM 1HRI3 4KG8A 3K46A 4XAAA 4OHWA 2QQKA 3MBWA 3N9QA 5CIRA 5CISA 1ALYA 3NSTA 3OEBA 3PVNA 5EWSA 4B3NA 3VKFC 2BNMA 3RGBA 4JTOA 5IUQA 4BQ2A 1VBE2 4ZY9A 1C1FA 4LMFA 5T3NA 2IXHA 1ZZBA 1XU1A 1HB4A 1HRI2 5J48A 4OMDA 5EP9A 2Y38A 4FFGA 2VZVA 3AX4A 1H30A 4LK6A 1V6MA 3VD7A 4HZFA 4OHVA 4MO3M 4BQ3A 4NJ4A 1JTZX 2DFCA 3AVRA 3FE5A 2YDEA 2NLRA 3GYDA 3POBA 5FZEA 5LCWL 1FV3A 2CSGA 1W8UA 4QDSA 5A7QA 4EE2A 3MDPA 2FDKA 1W2UA 1OHFA 2EIGA 3M2MA 4JDMA 4UBGA 4W6WA 5LB6A 1U12A 1PK6A 3VBHA 1F4HA 2Q0AA 4K1ZA 4LPLA 5BNPC 3THPA 3MFAA 2VW0A 4OULA 1IHMA 1OSGA 2JDAA 2E7TA 1XE8A 5A7WA 3VBHB 1GKBA 4B29A 4LK7A 4LOTA 4NIAA 5DUVA 1PIV2 4FPFA 2NM1A 2PHWA 1SG3A 1LKNA 2BGPA 4F3JA 4GULA 4RR3B 4WZFA 1SLTA 5A7WB 5FR3A 1V70A 2E26A 4CU7A 4HVQA 2AEYA 5EFUA 4CTEA 2ZMLA 3RZJA 1ND2C 2K46A 4Y5Z0 2JDMA 2FDJA 1FPN3 4HT1T 1IOAA 1VBC1 4P14A 3LPFA 3OYWB 1KFXL 3RYRA 3LWCA 3MLKA 1N3OA 1W06A 3MW2A 4FT8A 5KC5A 5JMCA 5KWRA 1OA2A 3O7OA 4GAZA 5JWPA 3D6EA 3IIIA 4A45A 1GV9A 4LIVA 5DAVA 5A3WA 4QGLA 4E4DX 1OPMA 3AB0A 3D5OA 3ZIXA 2Q4SA 1FATA 1O8PA 3EB7A 4GIQA 2PHUA 1VLNA 2RS12 3TAYA 2AYHA 2R0HA 2RDRA 3B93A 1M4WA 3BOWA 5A6XA 1IS6A 1WCQA 5FZAA 4LOSA 5SV5A 4JKLA 3VDDA 4YM3A 2WRAA 4LR4A 3USSA 4BQWA 1KDKA 3N9LA 4Q0QA 4CDQC 1H4GA 4TLGA 1YXWA 1QJZA 1ENSA 3VDDB 3OPWA 5E6HA 1OOPA 4Y1YA 3ZDVA 1UOJA 3DXTA 4AR2A 4DNYA 4QX2A 1UY2A 3LFIA 4XDQA 5F5IA 1LOFA 1HN1A 1LOCA 1OOPB 3BALA 3E5QA 4IESA 4R52A 4XFIA 2NQYA 3IPVB 1FXZA 4QPIA 2BTVC 4MXVA 3UGGA 4AG4A 4XJZA 1PX4A 2VZ3A 4GB33 4PF5A 4KL1A 2XBO3 3UJQA 4W65A 2WYFA 4UFKA 1RVF1 1QXRA 2F17A 2QQPA 3O0VA 2HEWF 1ZRIA 5JDBA 2VXRA 1KEXA 1DYPA 2JDKA 3AP5A 1PO11 4Q0UA 1SDWA 3J8F2 1W0NA 2DTWA 2JEMA 2H6BA 1JS9A 1MS1A 1NYWA 5GLVA 2OKXA 1I1EA 2YPJA 2OYZA 2P3IA 4V2WA 4K6BA 5T55A 1EV11 3NJXA 4QKBA 2R6QA 3FUOA 4B4QA 4QPGB 1VRH2 5BUVA 2RHPA 2C9KA 1BCXA 2QZ2A 2K9ZA 3WVJA 4NPRA 5BPXA 3K3OA 5L7OA 1RUI1 2VU9A 4C8DA 4DS0A 3FL7A 2JDZA 2P37A 4OI2A 4EROA 4FFFA 1JZ7A 1W39A 2FZ2A 3NWKA 3AMMA 3GCWA 4ORFA 1DQ1A 5JI7A 5HV4A 2GH8A 3HWJA 1HQLA 3VV1A 1DLCA 5L7OB 3MYXA 1MEC3 2P3JA 2YU1A 3PVBB 4FPHA 5GKAC 3WUDA 3ZYRA 4KWKA 4XF1A 5DN2A 3VZKA 1FNZA 5GLWA 3DYOA 5T5OA 2V72A 1RUE1 2RE9A 2WNUA 5C7GA 2BBAA 4NAOA 4COWA 3G7DA 3LIHA 1B35A 3T0AA 2HBUA 2FD8A 4KMQA 3QBQA 3UKNA 1JOPA 1AR81 3KT4A 2BVVA 3WOGA 1IG3A 1IS3A 1MACA 2OUHA 5F5QA 1RXFA 1HXS2 1MEC2 1HB3A 5FPAA 1B35B 2GALA 1E5IA 3VBRA 1EY2A 4AFDA 4NN0A 4GMP3 1BKZA 4R9DA 1VJ2A 1BHGA 1BEV2 5FREA 4ZHNA 1E57A 4NO4A 3ETQA 3VBRB 1CJPA 2NPIA 3ZPYA 1PVC1 3KSCA 2P1BA 4D7TA 5FJKA 2VNRA 4AWDA 5BNNB 4Q4Y1 1V6NA 3NKGA 3PUHA 3U14A 1NCRA 1IKQA 5I93A 3MW3A 5B2GB 5C5UA 3BKZA 5DAPA 1AJKA 1AUYA 1CESA 4JGZA 5CYYA 1SBFA 2VTXA 5ABJC 2ETEA 4TXWA 4XQDA 1MS3A 1SHWB 3HOBA 3RZMA 1WW4A 5GLZA 4JRLA 3POWA 1SCRA 2BOJA 4DPNA 3WY6A 5LBCA 4JGZB 3C8XA 3GCXA 2E6VA 1K5JA 1RUG3 1GLHA 2GH2A 2PYTA 2SBAA 4GXLA 4NHLA 2ZMNA 3H3UA 1UY4A 3GZUC 3ILRA 2WNOA 4FPOB 4MV2A 1Y9GA 4CRQA 1J83A 4NMIA 3ZYGA 2ZAHA 1S0JA 2Q8OA 3L2YA 3MGUA 4BQ4A 1R081 2XR4A 5DPNA 1RUNA 1RMU2 4MSVA 2ADDA 3TEWA 3LB9A 3M3EA 3ZFEC 4B1LA 4UFJA 2XH6A 3GZTB 5A70A 2CY6A 3OCPA 4FAGA 2RVAA 5J7MA 2OIIA 3TNPB 1AL0G 1I9RA 3VD5A 2BU9A 2GP5A 3FHAA 1CIWA 1NLSA 2VO5A 3CMGA 4UI9L 5LASA 4HKOA 4Q4W2 3FX3A 3ECQA 1NT0A 3DGTA 5FYYA 5JVVA 1VBA3 4M0NA 5K4LA 5LRSA 3BTZA 1UOGA 1VP6A 1HJGA 5F37A 4XJUA 2ZGLA 2VBPA 5A7SA 2VCMA 3ZR6A 4CCJA 3AXEA 2UYBA 4B4PA 2ENRA 2WR9A 2ZMKA 1FMD3 4X6QB 2NN8A 2DVAA 1WUVA 4JHTA 2D6MA 5E8AA 1PX3A 3APBA 3ENRA 4LXLA 5L9VA 4U36A 3C7OA 5FZOA 2XB6C 5FWEA 1A78A 3ILFA 2RM23 2XONA 3FC0A 4X8NA 3HIFA 3JXSA 5BNOA 5FZOB 5J98B 3OGRA 3I2IA 2G9FA 4N90A 1IQAA 2WSUA 1W28A 4GMP0 2VGDA 1G9DA 3HMYA 5BNOB 1SPPA 4UFLA 4J1WA 1REFA 2GN3A 3HBZA 1H1IA 2GNTA 1MZ5A 1MZFA 4UXAA 3AMPA 3OG2A 1SPPB 3ZSLA 1NLRA 5FZGA 3T2TA 1PM4A 2RJLA 2B7YA 2A3YA 4EWDA 1Q8OA 3I3EA 1GWMA 3RRDA 3ES4A 3ZSJA 4EN8B 5GLUA 1QJX2 3I8TA 2ID4A 4A4AA 5IVBA 1QU0A 2JKBA 3FWEA 1NXD1 1ULEA 2X09A 5DG2A 1ZZCA 2PQSA 4DUVA 1O5LA 3Q9OA 1XE0A 1LODA 4I30A 4RGGA 5EJ3A 4OVEA 3VHOA 1JH5A 4OQ9A 5C3OA 3JCIA 1U5XA 4MHUA 5C8WA 3PHMA 4LLFA 5ACA3 2BVBA 3N3HA 4MVTA 3V65A 4D6RA 1AYN3 2BW8A 4QXBA 3POEA 3CJIC 4QGNA 1AYM1 2JDYA 2A3XA 2E32A 2QQVA 4AQ6A 5IK4A 4HK8A 1W8ZA 1W0PA 2CDPA 3JUUA 4IEVA 3WDTA 2OX0A 2QQJA 2VVEA 4E9KA 3IT8A 4DZGA 2ZX3A 4QDQA 5ACA2 3TRSB 3NAPC 2ZGOA 1TME2 3OEAA 4LT5A 4AEKA 1GP6A 4GH4C 2DURA 3QACA 3B69A 2VC9A 2A6VA 1JZ4A 4OI4A 2D6KA 3EBRA 4WVZA 3U78A 2FDIA 2RDNA 2Q8EA 3WF3A 3I2JA 2XMLA 4DUWA 4COYA 3TEZA 4CA9A 1AX2A 3WNNA 1VB4A 4NRPA 3NKTA 3ZSEA 4D0QA 3R05A 2BJSA 5LATA 2YG0A 3QH6A 2F4LA 2EXKA 1LU2A 1W99A
chains in the Genus database with same CATH topology
1I5ZA 1AX0A 2OPKA 1VBD2 2WA3A 1RUD1 1F5JA 3R0RA 1L3JA 3CJXA 1Q5OA 4C0HA 4XF4A 1GR3A 1VAMA 1DGRN 3WP3A 2HWC3 3OD0A 4MGIE 4OHYA 2CGNA 3FUQA 2GNMA 1OA3A 1VB2A 2IFWA 3SLIA 1AXYA 1LEMA 4BIFA 3ZN4A 2MPFA 3INAA 1BJQA 2R062 2BPA2 1KDMA 4FCAA 5JCTA 5CG9A 5C4WC 4L99A 1QOTA 3VZNA 4RQPA 1Y7BA 1CAWA 1AL22 1G6NA 3N7JA 1DQ2A 2IXCA 1DQ4A 3H0OA 4FVVA 4Q1RA 4W6YA 1S0IA 4RQPB 3RQ0A 1V6IA 1CAWB 1QJY3 3ZFGA 4AGRA 4N7UA 1KD7A 1UPIA 3ROUA 3WHTA 1ASJ3 1WBLA 3ZFGB 4IERA 3JD71 4I0AA 1UKRA 2WA4A 1Y3TA 1R1A3 2XJVA 1AR63 4UW4A 1D4M2 2XL7A 1RUC3 2QVSB 1HRV2 3LCPA 1N3QA 5CFDA 4B4RA 1U5IA 3TN93 4XFHA 1Z7S2 1ASJ2 4X8PA 4XFCA 5CFDB 2BFUL 3AJYA 1CPNA 4Q2FA 1ULDA 5FLJA 2WKKA 3R4DB 1YHFA 3O5SA 4BQ1A 1AR62 4NHKA 1M06G 2B45X 1HKDA 2E63A 3AYAA 3LGRA 3GHMA 4KGGA 1EAH3 1ZZ8A 2I2SA 2BBVA 2JICA 1NE4A 1V9U2 2ZGNA 3OBTA 1ONAA 1Q56A 2WZPP 3B94A 4RFT0 3A4UA 4H14A 5AC91 1JHNA 4Z1VA 1OLRA 1XYOA 5LRRA 1RUJ1 4LO5B 5GLTA 1V00A 3IN9A 1WGPA 4PIYA 4XBLA 3VLBB 5EXOA 1YFYA 1MQTA 3RJRA 4WM7A 2BEOA 3GZAA 2YC0A 1COV2 4HVOA 5K8SA 4E27A 2MNGA 1MQTB 4BM8A 4WM7B 3VGIA 5T52A 4R4XA 1HX6A 4HETA 1CVNA 3KD4A 4IV1C 5T5LA 1YJKA 4AF9A 3ZXDA 5DUUA 2P2KA 2WFF1 3NW4A 3U10A 1H8TC 4Z07A 3WP4A 3MIGA 1DIWA 3BU7A 4WVVA 2XJUA 4LO4B 3GBFA 1LU1A 1VALA 2GAUA 2XJQA 4YNIA 3WQ7A 4S2FA 4LO7A 1YFWA 2JG8C 4LA3A 1LJ7A 1O3SA 4MYEA 3RI9A 2I45A 3M8LA 3VBSA 1C3HA 2BNOA 4LHNA 1RHI1 4XEZA 2D6LX 4M0HA 1LB2A 1BMV2 3KM5A 4QQHA 3B5LB 3VBSB 4G3YC 1A3KA 1RUH3 2PHLA 1ZM1A 1VBC3 4MGZE 3AP4A 1BBT2 2VUJA 1CX4A 4FPYA 4CDUA 1G9CA 4B7EA 3ZN5A 2D3SA 4AFCA 1POV1 2VW1A 4CDUB 4HFSA 4F8AA 1RUF2 4AVTA 2UY9A 1AXZA 4FOQA 5FRAA 1RUH2 4ZXKA 3RI8A 1DZRA 4IEXA 1J58A 4KNCA 2XVLA 4M3CB 4K20A 1YJLA 4IV3A 4AEDA 3M1HA 1MS9A 3SH3A 4P9WA 3LOIA 3KZ4C 5I0UA 1BYHA 4LBLA 1A8DA 2RMU2 3BB6A 1YIPA 5FLHA 4YW2A 4AEDB 4RHV1 5JOXA 3WP6A 4JV4A 4HANA 3EO6A 4NWWA 3ZXAC 2D97A 5EYYA 4C0BA 2JD4A 2OUJA 3AZZA 2RS32 3NL1A 4AW7A 1O3QA 3D8CA 4BMEA 1DU3D 2YV8A 4N7IA 2Z69A 2RR11 2HEVF 4FPKA 4MUVA 2HWE2 2IXJA 3BPZA 3ZYJB 1RVF3 3DL3A 2DVFA 2UWBA 4LA2A 3ZN6A 2V73A 1WW5A 1RJ7A 2R072 5GZGA 1PO13 4ATEA 2B42B 2ZX1A 3ZN6B 1O4TA 4TZDA 1J3RA 5GZCA 2PQQA 4DQAA 1EV13 3VKNA 1TNFA 2FMDA 1RVF2 3M70A 4XF9A 4TYSA 1RUI3 3BIWE 2BQPA 1PO22 4ZU4A 5KXEA 4I02A 4P9GA 1MVEA 5BYNA 1KQRA 5F1RA 3N4MA 4XJ8A 1SLLA 1K5MA 2CWSA 3VZLA 3L2HA 4ASMB 3PMSA 4M00A 1K5MB 1RUE3 2WZR1 1MS0A 4MLOA 1GQGA 3RWNA 1ZBA1 1UN1A 2DVBA 1PK6C 5FAXA 3VBHC 1Q8VA 4HK9A 4BMBA 1AR83 4FQ4A 1LGBA 3W9AA 4K3UA 2X5IA 2D7FA 3WW3A 3N7KA 4MXWA 4YRDA 1Z0HA 4D94A 2A7AA 1XNCA 5GM0A 4GA9A 1Z78A 1ENRA 4IEYA 4KG0A 2X5IB 1YO8A 4N43A 3VZOA 5L36A 4MXWB 1PVC3 1OKQA 2TNFA 5C9AA 1AR82 2SLIA 4N43B 3NO8A 4Q4Y3 1R092 2AUYA 5GJ6A 5K0UA 1QY4A 2OVUA 2YUEA 5C9AB 1RUOA 3HR9A 3AZVA 5K0UB 1PVC2 1ZZ7A 2ZX2A 1OI6A 4L11A 2HWD3 1ENQA 1Q3EA 2R30A 3VUOA 4Q4V2 2D5HA 3ZFFA 5KHGA 3WDYA 2ZX4A 5JZGB 1SEFA 4RGAA 1VBB1 4IQPA 3LAGA 4PJYA 2XVKA 3VZMA 1R083 3WLUA 3ZFFB 3QD6A 4Q0PA 1CGPA 2HWD2 3AJZA 2UWCA 1OA4A 1FOD1 4XFBA 1OOPC 5J3UA 5J36A 5GZDA 1F31A 2A6XA 3VKLA 3AMNA 1EPWA 1VIWB 4AVAA 1XRUA 1LOFC 2O1QA 5I8SA 4MH0E 1H9PA 4EN6B 1QNYA 3LA3A 1UD1A 4IEQA 1GANA 4QPIC 1OQDA 1NG0A 2A73B 4RR3A 1QWRA 4META 2FQPA 1UU5A 2D98A 2ZABA 1DGWA 1X7NA 3OYWA 4M01A 2DWRA 1S0EA 1KS5A 1OD5A 2QFEA 1Q8PA 4LBQA 3M3IA 2YROA 1QOOA 1QQP1 2JX9A 5L7OC 5KBFA 1H0BA 4HSJA 4LBQB 3VBOA 4PCRA 1GZCA 3LA7A 1FPN2 1PGL2 2XJPA 4PDWA 2ZGKA 4QM9A 3VBOB 3ZVXA 3H7YA 4CEWA 4P9XA 1CD3G 3ZX7A 2WNUC 4PDWB 2HWF1 3K51A 1WMEA 1GFF2 2JENA 1APNA 1B35C 4CEWB 2DYCA 2Q1ZB 3VHRA 5CBLA 1RC6A 4YGCA 4UW3A 4LUMA 4NWVA 4PIXA 3VBRC 3IPVA 4QU2A 5HCAA 2KM2A 1PGW1 1FAYA 4AQ2A 3JBG1 2WC2A 4BLIA 3UKTA 1QJU1 2VNOA 5CU1A 1NCRC 2ZGTA 1JXNA 1QHDA 2QZ3A 1OFSA 4YW4A 5L73A 3WQ1A 1BXHA 4NOTA 3WP5A 4DOUA 2WT1A 1TMF1 2AZ5A 3MIDA 4QPGA 4DRRA 4COZA 2XJSA 5AVAA 5HCFA 3UK9A 2HEYF 5IK5A 4HN0A 4GB32 3KGZA 3WW4A 2XBO2 1IPKA 4SLIA 1OQ1A 5TSWA 1LOGA 2OA2A 4XF0A 4A7YA 1QF3A 2D5FA 2LTNA 3ES1A 4AEJA 4AXOA 1WMDA 3MF9A 1V6OA 2D3RA 2GN7A 3KQRA 4HMZA 2MEV1 3HQXA 1QNWA 1AR91 4D7YA 3POYA 4RL7A 2A6YA 1KXGA 1MZEA 3DPRA 1RUD3 1H2LA 2D44A 4YFWA 4LE3A 1SFYA 1CPMA 3AMQA 5E89A 1D2SA 2QE3A 3DPRB 4S2HA 1XQNA 2LM3A 4UW5A 1Q8QA 4DINB 4QD2A 3K48A 4BE3A 5D8AA 5BNNA 1MR5A 2VMGA 3B7MA 4DRVA 4AI3A 3LZZA 1RUD2 3RYKA 5JI9A 5D8AB 3UKVA 1QH6A 4BCUA 4EN9B 1UMZA 2EVXA 4WM8A 2XLGA 4CDWA 1DF0A 1W6PB 2H0BA 4A3XA 3H1WA 4CDQA 2BFUS 3E5UA 5A3MA 4WM8B 4CDWB 1ZNPA 1ZRRA 4CDQB 1HV0A 3WDXA 4XYXA 1EPZA 2GC0A 4SBVA 5BNOC 4U2AA 5JOZA 4N53C 1UL9A 4DY3A 4XOGA 4QT6A 2CTVA 3IDCB 3MIHA 3AKPA 3SH5A 3JD73 3RNSA 4OI0A 4AFAA 3WD5A 1S0GA 1KJLA 1UU6A 2PLV1 1RUG2 2W52A 3KLSA 3DKWA 3SITA 4B7KA 3QCWA 1RITA 1LTEA 1HRI1 2GNDA 5AVPA 4A7KA 4IXLA 4MGKE 2PHFA 2XL9A 3H1YA 2O8OA 3JD72 3WW2A 4LBMA 3VL8A 3ALQA 3I7DA 4I01A 1C5HA 2XHKA 4EWEA 4XIOA 1IPJA 3M3CA 4B8EA 1X82A 3V64A 4LO8A 4TSVA 2F4PA 3MIBA 2EA7A 4XMIA 1YI9A 2B8MA 3HAGA 1GQHA 5JPMB 4TWTA 1FNYA 1O4ZA 5H9SA 1Y43B 5AC93 4YVWA 1F5FA 1PIV1 5FO8B 4XBNA 2UU8A 4C1WA 1PHMA 3IDEA 1S1AA 1VBA2 4XZPA 4YVWB 1RUJ3 5LEJA 4BWOA 3C2UA 3SNMA 1XE7A 2ARXA 4BZ4A 1X8EA 3ILNA 3SCFA 4LBOA 3IM0A 2WLPA 1D2QA 1FMD2 5CVRA 5FLIA 3DF0A 1I6XA 4DMIA 4AQSA 2WNVC 1ND3A 1TEIA 4FOYA 3HD8B 5A33A 2ILMA 4Q27A 2ZKLA 3D4KA 1J1TA 4XJWA 4JRAA 1ND3B 1LR5A 2AR6A 2RM22 4GQ7A 1NY72 2VY0A 2ZCWA 3P3PA 4JGYA 3U07A 3UL2A 5A33B 4Q1PA 2WFF3 2RS11 2CV6A 2WNEA 3DN7A 4FXGB 1AX1A 4JGYB 1DQ0A 3OJBA 2PTMA 4BA6A 3R4SA 4ZU5A 2C1FA 1C4RA 2HWB1 1REDA 2D3PA 2KXLA 1WD3A 3PLQA 1HQNA 3WX5A 1ZZ6A 4Y1ZA 4YG6A 5DUWA 3P3NA 3E5XA 3ZXKA 4YYOA 3IKWA 1G8WA 2YGMA 3D0JA 1G86A 5L19A 5HXVA 2WS93 2ZPXA 1RHI3 4RQPC 1WLDA 3AMHA 4HL0A 2NP0A 2IXLA 1X8MA 1UIKA 3ZFEB 5FOJB 2DCTA 1LGNA 3ZFGC 2WS92 5C33A 3CNAA 3J8F1 2E9QA 3N7MA 2FHRA 4XXPA 5I0TA 5CFCA 4K8FA 1AYN2 1ZBE1 1POV3 5HCBA 3VN4A 2XLAA 1VRH1 4Y24A 2A6ZA 2VQ0A 5CFCB 4AE2A 3DV8A 1Q8SA 3TBDA 5I0SA 4I3PA 3WCSA 5CFDC 4YLZA 3B3QE 3RYPA 5FO9B 4ATFA 1J59A 2Y26A 1N1SA 4UW6A 3RZZA 4D7SA 5FFOC 1NE6A 1LOAA 3OF1A 4RHV3 4Z8BA 1LHNA 4FQZA 1ZRCA 4FPLA 2ZGSA 4F7ZA 3WINE 5FMOS 2K0GA 3GF6A 2ZX0A 4KBBA 1HXS1 1MEC1 2I74A 2R32A 2RR13 3N35A 3VBUA 5JPNB 2JE9A 2CNAA 4RHV2 4KWLA 1BEV1 3VBUB 2WQZC 4R9CA 4AFMA 1ULCA 4AHXA 1XXNA 2HWC2 1ZX5A 2VMIA 3ZXFA 1C8NA 1MQTC 4WM7C 4XJAA 5I0RA 4RS5C 1UIJA 2UY8A 3ME2A 3PJQA 3LKJA 3KCYA 2A6WA 3J9SA 4IEWA 1FYUA 4HKLA 3ZXJA 3AZWA 2H6CA 3QOPA 3KB5A 1YLLA 4LULA 4BPZA 4DY5A 1PMIA 2BUKA 5HI0A 3AZXA 2WSVA 1QJY2 2BWCA 4Y1XA 4Z92B 4PLMA 3M3OA 4LBJA 2WZR3 3U11A 5E1RA 3AP7A 4YW5A 1V6LA 1RMU1 1Y9QA 1ZBA3 2A70A 4CP0A 4EWAA 2KA3A 2ZGPA 1WLTA 2Q1MA 1YYNA 1R1A2 3A0NA 4JTNA 2DCKA 1XNKA 1RUC2 1CQ9A 3RS6A 3TN92 1H1AA 4LE4A 4ZKTB 3VBSC 4Q4W1 2FBEA 4GH4B 2JXAA 3SCHA 1GNZA 1WW7A 3H50A 1LESA 4AI1A 3WDVA 4YZ2A 2TBVA 1RGSA 4I3GA 2CYFA 3RJ2X 3AKQA 1EAH2 2YGLA 2ZGQA 1V6KA 2P3KA 2ZS6B 4CDUC 3JQWA 4Q26A 1JUIA 5CAZA 2VVDA 4YVSA 1V6JA 5K7PA 2OZJA 2UURA 4YVSB 3J26N 4O9GA 1YRZA 4Y22A 1RJ8A 1VR3A 1XU2A 1BK1A 4J6GA 1UU4A 1VBB3 5CB7A 1WBFA 2DUOA 2W08A 5FCCA 3PNAA 4IV3C 4AEDC 4Y22B 2O8QA 4LO6B 2GMPA 1S2KA 2GSYA 3RG0A 1FOD3 2OZ6A 3JB8A 4XMAA 2PFWA 2CAVA 3IWZA 5C6CA 4IEOA 1RTVA 1VBB2 1YFXA 3PJYA 3OY8A 2ZAAA 3AYEA 1NCQA 3AKSA 1QJX1 4L8QA 2XKOA 3ZXLA 3OY8B 5DXDA 2GU9A 1NCQB 1C8M1 4PBOA 2EXJA 2YY1A 1AXKA 4LTAA 4QQ2A 4E2SA 4GWNA 3H7JA 1W6QA 4E4ZA 1IKPA 4YZ4A 5BV6A 4N9HA 2PHTA 3HN1A 1NQJA 2DV9A 2X29A 3V56A 1BVVA 1W6QB 3ZMNA 1QDCA 1QQP3 4WBBA 4EJRA 2JG9A 3LSEA 1DDLA 1ZYBA 1LEDA 3ACLA 1ZA4A 2ZBJA 4YSFA 5GZFA 1F8VA 2P34A 1NOVA 3DUIA 2JG9B 5FPZA 4CYDA 1K5MC 1TME1 3N36A 4H7LA 2C0ZA 4M3CA 1VBC2 3AKTA 1NQDA 1UAIA 3ELNA 1FI2A 2C9AA 4XFGA 4YG0A 3OGJA 1QQP2 4HBNA 3CEWA 3TOJA 2HWF3 3MZHA 4DXZA 1GSLA 3NV1A 3PTYA 4XHBA 5CNAA 2X8KA 2ZHNA 5F6KA 3VKOA 5KXBA 2X5IC 4AFBA 2ARBA 2RS51 2HJIA 2N7GA 1QH7A 1X50A 2YYOA 1JBCA 4D69A 4MGYE 2R16A 1S2BA 2VMHA 1VBD1 2NYYA 4N43C 3JBG3 1LULA 1BQPA 3BCWA 5JOYA 1QJU3 2XJRA 1R1ZA 1X36A 2F6BA 1QXJA 5C9AC 1JYCA 3FMGA 4FTEA 1VAKA 1N1VA 1J3QA 4IV1B 2ET7A 3VKMA 3W58A 4Q4X1 1U0AA 3KMHA 1PVXA 5KC6A 4OUMA 4CEYA 2R061 2R041 1TMF3 3THTA 1QJU2 1HW5A 3I54A 1ZRDA 4OHXA 4HPKA 2DCJA 4CEYB 2I07B 1G9AA 2ZGMA 4HN1A 1AL21 3WG4A 2O0OA 4HPKB 3ZFFC 4E2QA 3JU9A 4G9SB 2JG8B 1PO12 1HIXA 5F9TA 2CGPA 2DVDA 4K21A 1QKQA 3KCCA 2W68A 4AEMA 1HLCA 2IFRA 1SFNA 5I8TA 1EV12 1DFQA 2EAKA 5GALA 2MEV3 1ZVFA 2ZGUA 1AR93 2TEPA 1D4M1 3OPZA 2CAUA 1RUI2 1HRV1 1MZ6A 1MS8A 4CDXA 1UX6A 3HT1A 2RJKA 5FOBB 4GWMA 1ZZ9A 3ZDSA 1Z7S1 1ASJ1 3WW1A 1IZ3A 2WT2A 3MLJA 3G6JB 4LHLA 5FTTC 4RR3C 4CDXB 1JYIA 2VOXA 2XGXA 4JQRA 4PIZA 3SHRA 1AR61 1RUE2 4YM0A 3S30A 3VHNA 2IXIA 2QNKA 1YUDA 3BOPA 4JDOA 4QX5A 4OZXA 1HDKA 1H2NA 1H8VA 2YZ4A 2A5ZA 1V9U1 3B01A 1XYPA 5DDJ1 4YW3A 4Q0VA 1DQ6A 4JC1A 5FBZA 4YGEA 4XETA 4Y26A 2ZHKA 5H9RA 4Y1VA 1WLCA 4AVBA 4RA0A 1H2MA 2LALA 1SLIA 1W6NA 1NA1A 4FTBA 4BIOA 4R4ZA 2QDRA 3VBOC 5JZGA 4Q4Y2 1W6NB 1NA1B 3WG2A 2XUMA 2QKDA 3SH4A 4PDWC 3VL9A 4AHWA 1COV1 1PZ9A 1CAUA 1JUHA 4A7ZA 5CADA 4C90A 4YG3A 2ZTNA 1N3PA 1SBDA 3VDDC 2PLV3 2DU0A 4FTSA 4QQOA 3RMYA 1GICA 3EJKA 4I2OA 1CAUB 3AFGA 1SCSA 3NV3A 3VBFA 5A32A 5CA6A 3CF6E 1LCLA 1N1YA 2IWGB 3SXWA 5C8CA 3ZO0B 2GC2A 4FPJA 1JN2P 3IDBB 5A32B 3VBFB 2GMEA 1JW6A 4W6XA 4EN7B 3B9CA 1R082 4UBHA 5C8CB 2PLV2 1URXA 2P17A 3ASIA 4BHPA 3AYCA 4YM2A 3PMEA 4LBNA 3FLTA 4OHZA 2ERFA 1UZZA 5JOWA 4OI1A 2BNNA 3T1MA 1U5ZA 5F6LB 1LECA 1PIV3 1AR71 1DGRA 4FPEA 4QPGC 2XKPA 3AM2A 1QXPA 1BMV1 3O12A 1NXMA 3H3ZA 1PK6B 4N9IA 3WV6A 2E7AA 1BBT1 4URTA 4COVA 3FJSA 5DG1A 3LOBA 1QGLA 2WIIB 3FZ3A 2ZACA 4JVAA 1KITA 4E2GA 3M7AA 3H9AA 3IMNA 2DUPA 2K2SA 2QUOA 1MVQA 1RUF1 4Y1UA 4YARA 2A75A 1RUH1 2BGCA 2FMYA 2LUWA 1ZRFA 4LEJA 1PNFA 2RS13 3DPRC 2WWSA 4HLTA 2FZ1A 5BNQA 3FFZA 4GKXA 2HWB3 2RMU1 1H2KA 1PZ8A 5D8AC 1OPOA 5BNNC 2PELA 5SV8A 4IEPA 2AENA 1XYNA 3URFA 3I59A 1S0BA 2RS31 2W39A 4BH9A 4WM8C 3WQ0A 4CDWC 1J3PA 2HWB2 4JGZC 3I59B 3GALA 4HVRA 2JECA 2HWE1 5EZWA 1AYM3 4OFGA 2NMOA 3MEPA 5FO7B 4ZU7A 3WZ1A 3N7LA 2ZZJA 4XW3A 1D4VB 5IK8A 2VOVA 4C91A 2R071 1NZCA 1ULGA 3J8F3 5BNPA 3LSDA 1ZBE3 5JIAA 2ZJCA 3I2DA 3CLPA 1WCDJ 3MLLA 1AYM2 5BNPB 1VRH3 4I0BA 4YZ3A 5KXDA 3KCXA 4QPIB 4K40A 5H9QA 4HSLA 3RPQA 3A0KA 5DUXA 1PO21 1RB8G 3S0MA 1KS4A 3L9JT 1XNDA 2UWAA 1ND2A 4AK3A 1ZBE2 4FXKB 2EF6A 2PAMA 1MS4A 4AGGA 4FAHA 4WV8A 4IETA 1BZWA 1ND2B 1AZDA 2DUQA 2PAEA 2ZA9A 5BY5A 3M3QA 3O0XA 4XIKA 5KXCA 2NZ9A 3C3VA 4KGQA 4EN0A 4K1YA 2CGOA 4P5HA 3D0SA 4G4FA 3MICA 4NVPA 5J09A 1HXS3 4MZUA 3KS7A 1WW6A 4YVWC 2WFPA 1W6PA 3RDIA 1GNHA 2ZKNA 3U4XA 1BEV3 3OD4A 3VHPA