1QMJA

Cg-16, a homodimeric agglutinin from chicken liver
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
132
structure length
132
Chain Sequence
b'QGLVVTQLDVQPGECVKVKGKILSDAKGFSVNVGKDSSTLMLHFNPRFDCHGDVNTVVCNSKEDGTWGEEDRKADFPFQQGDKVEICISFDAAEVKVKVPEVEFEFPNRLGMEKIQYLAVEGDFKVKAIKFS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-GALACTOSIDE-BINDING LECTIN
publication title The 2.15 A Crystal Structure of Cg-16, the Developmentally Regulated Homodimeric Chicken Galectin
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 28
structure length 132
sequence length 132
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1qmjA00
4XJWA 2W52A 1VLNA 2GNMA 2ZAAA 1FATA 1S0CA 3UK9A 2Q5TA 1WW7A 4FPOB 2JKBA 3N7KA 1GSLA 4KBBA 4FPEA 5JDBA 1W6MB 4LBKA 4RL7A 1DQ0A 1V6NA 1BQPA 4FPFA 3AX4A 1LHVA 2NP0A 1LU1A 4TYSA 2ZHNA 2R16A 1GKBA 4XYXA 1N3QA 2SLIA 2R0FA 3VKLA 4ASMB 4ITCA 1WLWA 3C2UA 2A6VA 5LK5A 2ERFA 1Y7BA 1O4ZA 1C57A 1DQ5A 2DUPA 3M3EA 4UW4A 4CZSA 4YW4A 3N35A 2P37A 2ZGLA 3D6EA 3SISA 5IK4A 5IK8A 4Q26A 3RMYA 3HR9A 3T2TA 1Q8QA 1LHUA 3FBYA 5JOZA 4FOYA 1CONA 1WLDA 1G9DA 2GDFA 4XMIA 2C9AA 1MVQA 1BXHA 1IKQA 1BZWA 2CYFA 1ENRA 2GNDA 2JDZA 4Y22B 3AP6A 5H9QA 2GALA 1KRIA 1Q8VA 2D44A 2ZGSA 4GALA 1FNYA 2DYCA 4XXPA 4Y1XA 5GZEA 4YZ1A 4ZKTB 4Y26A 1X50A 1LOFC 1MS0A 2TEPA 1LENA 1QOOA 3A0NA 1FYUA 4P9WA 1UZYA 3M1HA 2VH9A 4P14A 2NZ9A 2WSVA 3R4UA 1QGLA 3RMXA 2A6ZA 1Q56A 2DV9A 1DQ1A 2NM1A 4XTMA 1TEIA 2KM2A 3PVNA 1Q8SA 1S0JA 2WT1A 4FP2A 4Q2FA 1A8DA 1JHNA 1CVNA 3ZVXA 2PHUA 1AJOA 2UWAA 4BLJA 2WKKA 5EWSA 3ASIA 4M3CE 3W59A 4XIKA 1WUVA 1V6LA 2PELA 1JYCA 2E51A 4YW2A 5GZGA 2JJ6A 3WV6A 1VAVA 3AXDA 5T5LA 3W58A 1G9AA 4JCKA 1N1SA 4BMEA 3WDTA 2CWSA 3AZXA 4CRQA 2CTVA 1LU2A 3FUQA 1SBDA 2VXRA 5KXEA 2VU9A 3M3OA 3OYWA 1O4YA 2AREA 4PBPA 4Q27A 4XHXA 1AXKA 1S1AA 1S0IA 4HANA 4C1XA 2DWRA 2YMZA 1CQ9A 3ENRA 3WNXA 3WVJA 2EXIA 4XDQA 4AYUA 2GNBA 2GN3A 3AK0A 2D6OX 1MACA 5CA6A 3I8TA 1DYPA 4OZXA 1N3OA 4XBQA 5JLVA 3R05A 4YW5A 2VW1A 2P3KA 4ISQA 3V0AA 4GXLA 3O0WA 3WG4A 4YZ3A 1W6PB 1GANA 1UX6A 1G7YA 2DVAA 4FOQA 3RG0A 2WJSA 3SH3A 5GZFA 2DVDA 1OFSA 1LOBA 3WCRA 3WOGA 3ZSMA 4GA9A 1AXYA 2PHTA 5T52A 3RSJA 2Z42A 4Y20B 4YM3A 4TZDA 1ULFA 1A3KA 4UW5A 1HLCA 1WBLA 3WG2A 3LCPA 5JOYA 4WVVA 1MZ6A 4YG3A 2WLQA 1G9CA 1SLBA 2A70A 3ZXFA 3LSEA 5FRAA 3N36A 5HCFA 3M3CA 5IT6A 3V64A 4Y24A 3ZSKA 1GNHA 1QF3A 4ATEA 1QOSA 1SLLA 3ILRA 4BOWA 2PHFA 5GLZA 1QNWA 3PJQA 3IM0A 4BPZA 2D3PA 3QCWA 3HMYA 3TAYA 2C5DA 5H9RA 3B9CA 3UL2A 2FHRA 1S0GA 2D6NA 4L8QA 4BLIA 5H9SA 3SITA 5EYXA 4LBOA 3ZXEA 2WT2A 2OUJA 3AJZA 3IPVA 4YGBA 5T50A 1D0HA 5GM0A 1SCSA 3I4IA 4WV8A 3B00A 3FFZA 1I1EA 3IPVB 4LBMA 3M2MA 1KDKA 1AJKA 4K1YA 1V6KA 3VKNA 3UJOA 2W08A 5DUXA 5CB7A 3ZXJA 1W6MA 4DPNA 1MR5A 3VUOA 1WW5A 3BOPA 5KXCA 3WZ1A 4UW3A 2D7FA 2VY0A 4CTEA 1R1ZA 4C1WA 1V00A 1QKQA 4YLZA 1WCSA 1QDCA 5DUUA 1D2SA 2WT0A 3BIWE 3OY8B 2CNAA 1UN1A 3SH5A 2W39A 2YXSA 1DQ2A 2ZACA 1QNYA 4IQPA 4PQ9A 1LTEA 3V65A 5GZCA 1GZ9A 1LOFA 1MS1A 2AR6A 1VAMA 5GJ6A 1S0FA 1V6OA 3RQ0A 3GALA 3IKWA 3WG3A 1W0PA 3AP5A 4YW1A 1IS5A 1DGLA 2OVUA 3WHTA 1LESA 5E88A 1AXZA 1IS4A 3SLIA 1BJQA 1FNZA 2UURA 4XILA 5JOWA 2PHXA 3OBRA 3WCSA 2W68A 1C4RA 4YZ4A 1GYKA 1G86A 1SLCA 3T1LA 4Y22A 3WLUA 4P9YA 2D6LX 1FAYA 1UL9A 3N3HA 3PVOA 4XE9A 3OBTA 5DZFA 1W6NB 2EAKA 4YW3A 1LOGA 2VUAA 2XB6C 2R1BA 1ULEA 2A6XA 3POYA 1MZ5A 2D6MA 1SLAA 5DG2A 3OGGA 2ZGPA 3HN1A 1HQLA 1G9FA 2CWMA 4Y1UA 3WHUA 4BMBA 3ZPYA 2DU0A 1JYIA 5GZDA 3APBA 1AZDA 4FPLA 3WUDA 1DQ6A 2DVFA 5GLVA 5GALA 2GMPA 3NV4A 4FOVA 5IK5A 5HCAA 1IS3A 1IS6A 2A5ZA 1VIWB 2JE9A 2VW0A 3BTAA 1ZA4A 4RA0A 2D6KA 4YM0A 4GWMA 3V0BB 1SCRA 3VKFC 2PHWA 5GLTA 3FLTA 1H9WA 2JE7A 4AGVA 3AZWA 2JD4A 2A3WA 4XMAA 5E89A 2A71A 4WZFA 2FMDA 2WNEA 1GLHA 4JC1A 1OKQA 3WDVA 4GKXA 1KQRA 3KM5A 5IK7A 2B7YA 3VKMA 4FPCA 3QLQA 4PF5A 1LHOA 2XG3A 3AYAA 1N1VA 4FQZA 4GWNA 3FUOA 2ZHMA 3SNMA 1WD3A 4XHBA 1YXWA 2DU1A 2V73A 4PCRA 1ONAA 2UWBA 5EXOA 3N7JA 1ULGA 1XQNA 5JVVA 2DTWA 3AYCA 3DUIA 2NMNA 3RS6A 5CAZA 1W6PA 3WDUA 3AZZA 4DRVA 3WDXA 1LEDA 2ZZJA 1V6IA 2GMMA 1GZCA 1JBCA 2ZMNA 3D5OA 5T5OA 4FPHA 3MEPA 1DFQA 4LBNA 3AFKA 1V6JA 1SLIA 4Y20A 2D3RA 2EXHA 4FPKA 4M3CB 1LECA 3Q9OA 3UJQA 1G8WA 2R49A 2DVBA 2D3SA 2RHPA 5T5JA 1UMZA 2YROA 1KJRA 4XJ8A 4YFWA 1SFYA 2P3JA 1LOAA 4LBQB 3O0VA 4NO4A 5T55A 2DUOA 3AZYA 5HCBA 3KQRA 3MW4A 4XJAA 1HKDA 2ZMLA 1WBFA 4Y1YA 3AP4A 4H55A 1MS5A 1I3HA 2ZGRA 4Q1PA 1LCLA 5JMCA 1W6QB 5GLUA 1LHNA 1MS3A 4U2AA 4XJ9A 2ZABA 3TB0A 1H30A 1KJLA 4XJUA 2ZGMA 2EALA 2DVGA 1KITA 3RRDA 3AYEA 1YO8A 2E7TA 2ARXA 5EYYA 4XOGA 2AH2A 3VKOA 1UPSA 4YG0A 2CY6A 1H9PA 2LALA 4LBLA 1CPMA 1MVEA 2NMOA 2NN8A 1IOAA 3N7LA 2CL2A 1W6OB 5F5QA 3ZYRA 2D43A 3JUUA 3NV2A 4XZPA 4YZ2A 1ENSA 3OJBA 4FQ4A 2A6WA 2ZGTA 2EF6A 4FP3A 2GMEA 1WW4A 2P3IA 1N3PA 2GN7A 3OY8A 1SLTA 4XBLA 1DYKA 4AGGA 4M3CF 3FLRA 3OPZA 5DZEA 1HDKA 3L2YA 4R9DA 4YGCA 1ULDA 3A0KA 2V5YA 4JRAA 3USUB 4BQ1A 2EXKA 1JW6A 4R9AA 3FLPA 1GZWB 1N1TA 1ZM1A 2P2KA 4NOTA 3AP7A 4PBOA 4YM1A 2NYYA 5T5PA 2PHRA 3JU9A 1DBNA 1APNA 1VALA 3NV1A 3WG1A 4DRRA 5DZGA 1C1FA 3GNEA 4I30A 4DFSA 1F31A 5H9PA 1AX1A 2EXJA 5DXDA 4AVVA 1GICA 1W6NA 1QMJA 4W65A 1CJPA 1V6MA 1J1TA 1WW6A 2OUHA 2ZBJA 5L73A 4K1ZA 4M00A 3T1MA 3AYDA 2SBAA 5T54A 3WDWA 3M3QA 2ARBA 5DG1A 1LULA 4YGEA 1PZ7A 3ZSJA 4YZ5A 4BM8A 1SACA 1SBEA 1NLSA 1AF9A 3O5SA 4FOWA 4U36A 2A3XA 3POWA 4AGRA 4XTPA 1F9KA 1LOEA 2UU8A 1YIFA 4ISRA 1URXA 1AVBA 3AXEA 4K21A 4MYEA 2OW4A 4HL0A 1DLLA 3R4SA 3V0BA 4XIOA 3O0XA 2ZGQA 2D6PA 1MS4A 1U0AA 1LODA 1PZ9A 3PMEA 5FREA 4D69A 4LBJA 1Q8PA 4LBQD 1RINA 3MW3A 1GBGA 2GNTA 2HYKA 1LOCA 2EIGA 2ZGUA 2ZHKA 4AVSA 4XJZA 5CBLA 2BQPA 4AVTA 3B3QE 2DURA 4SLIA 1RITA 5IUQA 1Q8OA 1S0DA 1OQ1A 4FVVA 5KXBA 2R0HA 2ZHLA 3DGTA 1QU0A 2H0BA 3VV1A 3NV3A 3LSDA 1GNZA 4AWDA 3AJYA 1ENQA 2E53A 1CN1A 1JUIA 4GKYA 3WUCA 2YV8A 1RIRA 3WDYA 2E7QA 1IKPA 5AVAA 1JOJA 2AUYA 1CPNA 2AENA 2ZA9A 1DZQA 4M3CA 3ZXKA 5CNAA 2JECA 1CESA 1FX5A 1LGNA 5DUVA 1AX2A 1LGBA 1AX0A 1JXNA 1UAIA 2ZKNA 5BYNA 5JOXA 2E6VA 3AP9A 4YFZA 4FPGA 5E8AA 1NXD1 4Q8LA 3B69A 2A75A 3OYWB 4LBQA 4R9CA 4DS0A 4Q1RA 1ULCA 2AYHA 1SBFA 3U4XA 1MS9A 4DQAA 1EPWA 1N1YA 2A3YA 2ENRA 1W6QA 1GV9A 2VW2A 3B01A 1YYNA 2WSUA 1S0BA 2UWCA 3A4UA 3MW2A 5SV8A 4Z8BA 2AGSA 4UW6A 5KXDA 3V0AB 4Q8KA 1N47A 3ZYPA 1S0EA 2ES3A 3ZXLA 1CIWA 3PVEA 2I2SA 4YGDA 4YG6A 1A78A 5GLWA 1WLCA 1QDOA 1WD4A 3NWKA 4XBNA 1KDMA 1W6OA 1DQ4A 1UZZA 1F5FA 4WVWA 1BYHA 3MPPG 1BKZA 1LGCA 1YRZA 2WQZC 4K20A 2P34A 3ILNA 1JN2P 1Z78A 4YM2A 3ZSLA 4R9BA 1DIWA 3H0OA 1MS8A 2G4IA 3D4KA 1QOTA 1Z0HA 3POSA 4FPJA 4Y1VA 4M01A 3O12A 1G9BA 1C1LA 1LJ7A 3AZVA 1HQWA 3IMNA 2A7AA 3IN9A 3INAA 1UKGA 4P9XA 1B09A 1LEMA 3ATGA 2ZMKA 3N7MA 3SH4A 2A6YA 1FV3A 2LTNA 3USUA 1CR7A 1W0OA 2ZGOA 1GZWA 1DHKB 1FV2A 3CNAA 5F9TA 2R1DA 1YI7A 4Y1ZA 1LHWA 2YZ4A 4F83A 2YY1A 2DTYA 4ZXKA 2DUQA 1PZ8A 4FPYA 5DUWA 4ATFA 2ZGKA 2ZGNA 4XXAA 3ILFA 3BODA
chains in the Genus database with same CATH superfamily
2RS52 2ZXQA 2W52A 1JUHA 2GNMA 4RS5C 4X8PA 4XJWA 3U07A 1CZSA 1OD3A 1H0BA 4FPOB 1J83A 4BIFA 4FPEA 3C7EA 1UU6A 1X7NA 1DQ0A 3LEMA 1LHVA 1YC61 1LU1A 4UFMA 2WIIB 1W06A 1J84A 1N3QA 2VTFA 4OULA 3BTZA 3JXSA 2BRTA 3VKLA 4L2NA 4QKFA 4CU6A 5CEHA 1OI6A 2VVDA 4HOOA 4IW3A 5FCCA 4CP1A 1Y7BA 2VZRA 1C57A 1DQ5A 5BUVA 3M3EA 4AEJA 5LA0A 4YW4A 2P37A 2Y60A 2ZGLA 1EV12 1OA3A 4AGVA 3FBYA 1QQP2 3VBOA 1COV3 1UX7A 1WLDA 4LK6A 2C9AA 1MVQA 4JGZC 5C8CB 3U37A 4AG4A 1JZ7A 2JDZA 3JQWA 4A45A 1GNYA 2EIDA 4OHXA 1LNSA 1UXXX 5A1LA 1Q8VA 1DDLA 4XXPA 3EXUA 3R0RA 3ZN4A 3ZDVA 2HKXA 1QJU3 3OB8A 4PDWB 2JDPA 1MS0A 1UYYA 5B2GB 3OUJA 5FPLA 3A0NA 3TYJA 3Q8FA 1OQEA 2NZ9A 4QKNA 1MEC2 4IEQA 3LKJA 2NM1A 1DQ1A 1TEIA 1KXGA 2RDNA 2I07B 1A8DA 1JHNA 2VOXA 3KCYA 1HJFA 4EN8B 4QHOA 5C8CC 5FZCA 4QD2A 3PHMA 4B29A 4OZOA 1W3VA 1JYCA 4WVZA 1QY4A 1R092 1VMJA 4JRLA 2BZDA 3D3AA 3PNAA 4ZONA 4YW2A 5FPBA 3OCPA 5T5LA 4DNYA 1NY72 3W9AA 1N1SA 4PDWC 4BMEA 2Z2SB 3K77A 3UESA 3OD4A 2CTVA 4XUTA 4CRQA 1SBDA 1NXMA 2VXRA 4LLFA 4ZU4A 2Y0OA 1UU5A 3M3OA 3PVBB 4DUXA 1NE6A 1YI9A 1S1AA 1XNBA 1PGSA 4JZRA 3H42B 2DWRA 2W46A 4C1XA 2YMZA 5CADA 4CSWA 2G9ZA 1BBT1 3WNXA 4XDQA 4HT1T 3AKTA 1ENXA 5HXVA 5IFPA 3WW3A 2RR11 4G4FA 4IEOA 3VBUB 3VZMA 1FMD3 2KD7A 2DCJA 3ZPOA 5HPOA 1RUJ3 4HVOA 1XSQA 4YW5A 4ZS3A 1O3TA 4ET7A 2CDOA 3GBGA 5C5TA 1O8SA 2XXZA 3DCQA 1FXZA 3KV6A 3ZIWA 3WG4A 4YZ3A 3V0AA 1GANA 1OKOA 1VBA1 3ECQA 1G7YA 1WGPA 2XONA 4FOQA 4Q29A 5FMOS 3SH3A 4XZUG 2Q30A 3KSCA 1H1MA 1ODMA 3LIHA 3OD0A 3WCRA 1AXYA 2XWJB 3VBHB 1RUD2 3PTYA 3KQ4B 3KT1A 5D8AB 4FT8A 2JD9A 1QJFA 3LOBA 2Y6KA 2WLQA 3K2OA 2A70A 4BQ3A 2J22A 4QPGB 2V09A 2CHHA 3N36A 2FDKA 2BW8A 2J1RA 3ZSKA 3E5QA 1GNHA 1QF3A 2RJLA 3W21A 2DBNA 2PHFA 3LEGA 3AKPA 4NWWA 3IM0A 3THDA 1RL3A 4N7IA 4TSVA 3UV9A 5AC93 4HZFA 1FPN3 2HJIA 4Y5SA 5LRSA 3VBHC 1QJY1 3B9CA 2FHRA 4P9JA 3J7NA 3GHMA 5H9SA 5D8AC 3ZX7A 4AI1A 2VJXA 1WWYA 2VMHA 2N7GA 5EV7A 3ZXEA 2OUJA 2QDNA 4QPGC 4UWDA 5ABJB 4JTOA 4AXOA 5JPMB 5BXXA 4FI9A 3FFZA 4EV0A 1RUF3 4LBMA 2DFBA 3ACGA 3P3NA 1KDKA 2RE9A 1Q3EA 2WZ8A 3A23A 4R8HA 5IFTA 1ZRDA 2WO3A 2D93A 4IEZA 3BOPA 3ZR5A 5KXCA 1W39A 1OLMA 2VCMA 4CTEA 4EN6B 1R1ZA 1QKQA 3BCWA 2HWF1 1LKNA 5I0RA 3OY8B 2JDKA 3LE0A 1C5IA 2K46A 4M4RA 3HAGA 4MGYE 3ZFGB 5GZCA 1DQ2A 1AR82 2L9LA 3TEWA 1LTEA 5C70A 4N53B 4JKKA 4R4ZA 3K75B 1GZ9A 4NPLA 2OZ6A 5FZ6A 1LOFA 1MS1A 3RYRA 1ZNPA 1ZBE3 5C6CA 1HRI3 1V6OA 3LF7A 2BGOA 3GALA 4KH9A 3WG3A 4LHSA 4OI2A 3AVSA 3WF0A 1VE0A 2XQXA 4V1PA 1AYN1 1WCUA 3HOBA 2ZEYA 3M70A 5FLIA 3WHTA 1LESA 4ZU5A 4MZUA 3RDIA 4FFHA 3SLIA 4BU2A 5JOWA 2BERA 3OBRA 4B4QA 2W68A 2RS31 5L9BA 1UOGA 1RMU1 4YZ4A 4J1XA 3T1LA 3ZFGC 5F7UA 2Z79A 4QX0A 4Y22A 4MOAA 4P9YA 1WMFA 3N3HA 4N53C 5DZFA 1CAUB 1W6NB 2E9QA 3MIGA 4QB6A 3M4FA 2O1QA 2P6CA 4A7ZA 4QXKA 4AEDA 2KA3A 2X09A 2A6XA 1K5MA 1US2A 2D6MA 3CIHA 4ZY9A 5CFDB 1SLAA 1ZZBA 4JQTA 3VDBA 3I49A 1RVF1 3KB5A 3HN1A 4AI9A 1BMV2 1JYIA 4Y33A 1E5SA 4FPLA 5GLVA 2DVFA 4EE2A 3I2IA 5IK5A 4L11A 1ZA4A 4RA0A 2W91A 5FLHA 1RHI1 4LULA 3V0BB 2VO5A 5SV5A 3VKFC 4OI0A 5GLTA 5EPAA 3AZWA 1XE0A 4XMAA 2VZVA 5E89A 2A71A 2DCYA 4JC1A 1EAH1 2WNEA 3FN9A 3H8UA 3WDVA 5CFDC 3NRUA 1U12A 4AHWA 5FZOB 4BLIA 3FZ3A 4COVA 4F8AA 4K6BA 3PUAA 1ZYBA 3AYAA 2X8KA 5FZIA 5DAWA 1OH3A 5CISA 2LM3A 3Q8EA 5FPVA 3SNMA 1WD3A 2WNVB 4XHBA 4NROA 5FJKA 1OUSA 5IVEA 2O0OA 3Q8CA 5EXOA 2UWBA 4CA9A 4HMZA 3MFCA 1ULGA 3WF1A 3RS6A 1RTVA 2DTWA 2VR4A 2NMNA 4QPYA 2PAMA 1W8OA 3WDXA 1ZRCA 2XH6A 2ZZJA 1V6IA 3POJA 1J58A 4QU2A 2GMMA 3D5OA 1UY4A 4CE8A 3H7JA 3N4MA 2D40A 1DFQA 1XE8A 1B35B 3AFKA 1VP6A 1RUC2 5G05L 3URFA 1AL22 4FPKA 2OX0A 2BP6A 1UPIA 2WNVC 4NHKA 3E5XA 1DCSA 3NVCA 4WVMA 1BBT3 4W8JA 2B46X 2RR13 1W9FA 4LHNA 5I93A 5DQ0A 3JBG1 2JXAA 1GQGA 3MW4A 2XHKA 5C7GA 3KVAA 5FYUA 3BU0A 4XFFA 4CDWA 1VBE2 1MS5A 2GP3A 1B35C 1SEFA 4B1MA 1JOBA 1YHFA 4U2AA 4Q0PA 3SEPA 1XB9A 2RS12 5DAPA 2WRAA 2YBKA 1S2EA 3TB0A 1H30A 1KJLA 1JTZX 2BBAA 4JQRA 3T0DA 2DVGA 3PUQA 1VPHA 2E7TA 4PI2A 5B4NA 2AH2A 4KWLA 1UNBA 4YG0A 4NJ4A 3JD72 1JZ6A 4EROA 4LBLA 2WWJA 1CPMA 2O14A 2NMOA 1NZCA 1WKYA 2NN8A 2CL2A 1W6OB 5F5QA 1JI6A 4IV3B 1RUI2 2A6WA 4X6RB 2EF6A 5LBFA 5C71A 1N3PA 2GN7A 3AMMA 1R082 5BV6A 1SLTA 1OMIA 1U5IA 3VBRB 3D0JA 2YPJA 4HKLA 3O14A 4M3CF 3LWCA 5FZEA 4AGGA 1TZOA 4QQOA 1STMA 2B39A 3ZYBA 2VC9A 4BDVB 2V5YA 4A41A 3USUB 2EXKA 2XKOA 2HBUA 1XNKA 3LA2A 4NOTA 4PIYA 4BIOA 4IV3C 1ALYA 1QIQA 1LB2A 5A33A 3UKVA 2NYYA 1POV1 4OLLA 3ZN6A 4A7YA 1RJ7A 1VALA 3J8F2 3GNEA 4CU7A 3VBRC 1QXRA 4DFSA 4J6GA 3NNFA 4OVEA 2HWF3 2WWSA 1DGRA 1CIYA 5DXDA 2XVKA 5CFCA 3I59B 3LA3A 4WBBA 3WNOA 1XC6A 3UYJA 2OUHA 4D6QA 5HXMA 1COV2 3PDQA 2ZBJA 5L73A 3OBAA 3SC7X 2SBAA 1V0AA 3WDWA 1OPOA 4YGEA 1PZ7A 1RJ8A 4H2AA 5TSWA 1SBEA 2BUKA 5JXIA 2XQRA 5FP4A 1NLSA 2C26A 2D5FA 4Q0UA 3KVBA 1QJU2 1AYN3 2IC1A 2A3XA 4FOWA 4XTPA 1LOEA 3O1RA 1URXA 4QGMA 3AXEA 4K21A 4LO6B 4JHTA 5FK7A 4HL0A 1GP5A 1TG7A 4IE5A 3R4SA 2RS33 4BHPA 1RMU3 5L36A 2ZGQA 2ZJCA 1MS4A 1GFF2 3ZSEA 1DGRN 1PZ9A 2QQOA 1WLTA 2ZPXA 1UOBA 4BISA 4FTEA 5FREA 3I2OA 4N9HA 1GBGA 3DV8A 5KC6A 4YNIA 4XJZA 4JKMA 1MQTA 4HN1A 1JYNA 4UFJA 2BQPA 4SBVA 4S2FA 2DURA 2JIGA 4SLIA 4LE4A 1RVF3 3HIFA 3N9OA 2OS2A 3MF9A 3CKHA 3ZYFA 2C24A 1QU0A 3C8XA 2CGOA 3LSDA 1YJLA 3AJYA 3OGJA 2WYFA 3NSTA 4GKYA 2YV8A 1XJAA 4CVUA 5C3PA 1AR71 2YU1A 3MGUA 1FMD2 2E7QA 1O59A 4YARA 1RUJ2 5A7WB 1BEV1 5LRRA 2HWD1 1ZZCA 4UFHA 4K7JA 1NAEA 5AVAA 5IAVA 1EAH3 2AUYA 5C3OA 3AMNA 2CV6A 2VZSA 2Y64A 4M3CA 3ZXKA 5CNAA 5FMDA 2IVJA 1CESA 2XUEA 1LGNA 5DUVA 5FYVA 2BOJA 4LHKA 5FZLA 4FBFA 3WEZA 5A3UA 5FPUA 1JYVA 2JG9A 5EP9A 3E97A 2ZX3A 3DXUA 2BNOA 1NXD1 4W6YA 1RUH1 2WAOA 5F5IA 3VBFA 4BQWA 1W9WA 3B69A 2A75A 2BDRA 4GH4B 4LBQA 5A7SA 2C6SA 3OOXA 3S5QA 3AKSA 4FTBA 2VMFA 1W2TA 1S2KA 2XGXA 1SBFA 4UYBA 4YVSA 2ENRA 2VW2A 1YQCA 5L7OA 2A73B 1JU4A 3SCFA 1H8TC 4RFT0 4CPBA 4NIHA 1ZVFA 4I3PA 4RFRB 2VNOA 1SDDB 4AFCA 3E6CC 1EYBA 3TOJA 5LY1A 1YFUA 2AGSA 3CZUA 2W9XA 2Y8KA 1IHMA 4QX5A 4A7KA 2GC0A 1VR3A 2Q4SA 3BOWA 5AC92 5D2AA 5J09A 1FPN2 1D7PM 2VZ1A 3PVEA 2HEYF 2I2SA 1PM7A 2OQ7A 2EA7A 4GH4C 3F95A 3LZZA 3GBWA 2XBO3 4LIUA 4E2SA 3CJXA 2W2IA 3NNGA 2OPWA 4KMQA 1KDMA 3LDBA 3JBG3 1UZZA 3AVRA 3KWVA 5APAA 1YCIA 3L9JT 3MPPG 1TVGA 1W9YA 2B9VA 3ILNA 1RUF2 3J7MA 4P00B 4BQYA 3S57A 4R9BA 4DXTA 3H0OA 2F4LA 4OUMA 3D8CA 2XR4A 4QDQA 1OFNA 4XETA 4Y1VA 5A3MA 4M01A 4DUVA 2XMLA 4YVWB 1LJ7A 3AZVA 3WUCA 2WZR1 2YC4A 2LROA 2ZMKA 3N7MA 2A6YA 1FV3A 3NNMA 3B93A 1JH5A 1GZWA 3E6BA 4HONA 1SFNA 3VL8A 3SKVA 3MIFA 5F9TA 1YI7A 2QFEA 5A7PA 2YZ4A 3VLBB 2DTYA 1YFYA 2IXCA 3ZYIB 5HV0A 5FDBA 5DUWA 4QX7A 1ZBE2 5G04L 2ZGKA 2ZGNA 4HBNA 1HRI2 3EHKA 3ILFA 4H7LA 2VQTA 4NRQA 1TNFA 3BODA 5FY5A 3SCHA 4AFDA 4D7YA 4QX8A 5BY5A 1Q5OA 1AR91 4YVWC 1S0CA 1S4CA 2Q5TA 1VBB3 4KBBA 4KQ7A 2TBVA 4RL7A 3TEXA 3LOIA 1WZXA 5EFUA 4FPFA 5F39A 4CP9A 1M06G 1F5JA 4HK9A 4Y4RA 3BYWA 2W94A 3ES4A 4TYSA 3RWNA 4B4PA 4BK5A 2WS91 2ZHNA 4DXSA 2D98A 1GKBA 4XYXA 5IATA 3K48A 1RUE1 1O6UA 2WFF1 2R0FA 3DF0A 1WA4A 4UFIA 1WLWA 3WW2A 3ZKUA 3C2UA 2FMYA 2A6VA 3GF6A 4LKDA 3ROUA 3WNMA 4BXSV 2IXIA 5JSPA 1RC6A 1S55A 4MG2A 2JDHA 2DUPA 4HFSA 2VECA 3CU7A 1HRV3 2GZWA 4CZSA 5IK8A 2HWE3 3D6EA 3HT2A 2EVXA 3UETA 1H1AA 4ARYA 2BFUL 1UMIA 3H9AA 1CZTA 2IXJA 4N43A 3T2TA 3ZFEB 2PHDA 1LHUA 1JS9A 1PMJX 3MLKA 4X8NA 4JX0A 5FYSA 1SG3A 2VZ3A 2GDFA 4NN0A 3MICA 4GD4A 4IE4A 1ENRA 2GNDA 2UY9A 3OEBA 4E27A 3ORJA 1POQA 3AP6A 2GALA 2D44A 4HKWA 4GALA 1FNYA 2DYCA 4AVCA 4ZKTB 3WQBA 1OHFA 1ZZ9A 2VG9A 2FDFA 2OXBA 2YC2A 4BWOA 5EWSA 5FZ0A 1NG0A 1W8TA 2XLGA 4UF0B 5LEJA 1H4GA 1FYUA 1H6YA 4P9WA 1L7RA 4P14A 3VHNA 4NAOA 3R4UA 2ZEZA 2QQWA 3CMGA 2A6ZA 1Q56A 2DV9A 3P3PA 3RMXA 2OPKA 3ZFEC 2HWC1 4UT5A 4AHXA 1Q8SA 1S0JA 1NQDA 4BH9A 4COWA 2UYAA 2UWAA 4NVPA 1X8MA 2CU5A 4BLJA 4UBGA 3VB9A 3ASIA 4L99A 4GWIA 1V6LA 2PELA 2E51A 3ME2A 4IE7A 4XQWA 1O3QA 5GZGA 3W58A 1G9AA 1UD1A 3EB7A 1BCXA 3S5AA 1LR5A 2CWSA 2PAKA 3S6PA 3AZXA 2VUDA 2V5DA 3CJIB 4D7SA 3LAGA 4E8CA 3O1UA 2VU9A 4XHXA 3OYWA 1K42A 1PK6B 4TN7A 1AXKA 3ACFA 4HANA 5FMBA 3VBUA 1D0GA 3WVJA 2IFRA 4AYUA 2EXIA 2VZUA 1YFXA 1BBT2 2J7MA 1AR73 4JGYA 1UQXA 2RDQA 2FZ2A 1GWKA 5J48A 2RR12 1VRBA 5JLVA 4XBQA 1N3OA 4XCAA 3R05A 4KWJA 1BEV3 3AKRA 4LE3A 2HWD3 2FCUA 4QQLA 3ZDSA 1PX3A 3FJSA 3O0WA 3N9LA 1AHSA 5FWJA 3H8OA 2CDPA 3CJIC 2DVAA 2GC3A 4MUVA 3DPRA 1LOBA 3WOGA 2ZS6B 3AL5A 4AEKA 4GA9A 5D8AA 4XFBA 4AE2A 3MUY1 4E4HA 5I0SA 1HW5A 1RUH3 4AVSA 2FDJA 1ULFA 5L9VA 4RR3A 4UW5A 5FZAA 1HLCA 2WA3A 4GAZA 4WVVA 1MZ6A 4XURA 5FXZA 3I3EA 4MXWA 4C91A 3ZXFA 3TRSB 5C3RA 3IAPA 3EBRA 5IT6A 3M3CA 2FCVA 5I91A 1U5XA 3V64A 5BNNA 4Y24A 1QOSA 1SLLA 3ILRA 4I2OA 3I3BA 2WABA 2ZX2A 2P17A 2D3PA 3E1F1 4IGOA 3H8XA 2Y6LA 3HMYA 2C5DA 5F32A 2WNOA 2PLV3 5F37A 5ABJA 1FOD1 1XBFA 2W5FA 4XDOA 5A6QA 4P5YA 2FCTA 4LBOA 3C7HA 5JIAA 3I54A 5J36A 4IV1A 1W03A 2WT2A 2BU9A 3AJZA 4YGBA 3RJ2X 1YQ6A 2V72A 5GM0A 1WMDA 4B8EA 5IWFA 1SCSA 1IQDC 5FFOC 3VHOA 2XLFA 3UKTA 4MSVA 4GB31 3KCXA 1JZ3A 1AJKA 3OF1A 1VRH1 4JDMA 3BKZA 1V6KA 2R041 4QGNA 3VKNA 4LOSA 4CCLA 5HV4A 2W08A 3ZXJA 1W6MA 3BTXA 1MR5A 4HSLA 3ZN5A 1WW5A 4LIVA 2VQ0A 5A7QA 4K40A 3TNPB 1U5ZA 5A3NA 1V00A 2CAVA 4YLZA 5KHJA 1QDCA 4R52A 2W95A 2WZR3 3KGZA 2WT0A 2HWF2 4XF3A 2CNAA 1BLZA 1UN1A 2BV4A 2WWUA 3VHPA 2W39A 1QNYA 4IQPA 3V65A 4JGZB 1ND3B 4CXWA 1IPJA 2QQPA 2RG4A 5JSRA 4CDUB 1VAMA 1OBNA 2J1EA 1OPMA 1S0FA 4CU8A 2E32A 1W0PA 2XKPA 3AP5A 2R071 1DGLA 3LDKA 1AYN2 1AR93 4QHBA 3BTYA 2E26A 3KGLA 3JZVA 1FNZA 2UURA 2ARCA 2PHXA 5DPNA 2LRPA 5JWPA 4QB1A 2Y6HA 2KXLA 1GYKA 1G86A 2RS32 5B4XA 4CUAA 1RMU2 2D6LX 4PLOA 1FAYA 1UL9A 1POV0 2WS93 1Y4WA 1ND3C 2WL1A 2W3JA 5FYYA 1RUE3 3OPTA 3RPQA 2WFF3 2VUAA 2XJUA 4QX1A 4CDUC 2XB6C 3S0MA 3POYA 1MZ5A 3ZYGA 2OA2A 2I74A 4EYUA 2JG8B 4QKBA 1RVF2 2VPVA 2FDGA 4Y1UA 4BMBA 3J26N 3APBA 4NE9A 4Q4X3 4I3GA 3NL1A 1X82A 2GMPA 3NV4A 1Y9QA 1IS3A 1IS6A 1SMVA 2A5ZA 3BTAA 3S7EA 5F3EA 1J1LA 2D6KA 4QXBA 3POEA 3OPWA 4O7XA 1W8FA 1D2QA 3LD8A 1H9WA 2BGPA 1DGWA 3HNBM 4H3WA 2W1UA 3UT0A 3ZXDA 4LA2A 3K4DA 4LOTA 1F15A 4IEWA 5CKNA 2FMDA 1GLHA 5KC5A 4GKXA 1KQRA 1IG0A 2Q1MA 1EAH2 2VCCA 4QPIB 3SEEA 5IK7A 3ZM8A 4FPCA 2JG8C 4PF5A 4WM7B 5A32B 2Q1ZB 4B7EA 2WC2A 4A2UA 2QZ3A 2HWC3 1NOVA 2V4AA 4CDQA 1IZ3A 2XWBB 2B8MA 4PCRA 1NYWA 1ONAA 2VOTA 4XFGA 2IXKA 3N7JA 3ZXAC 5JVVA 3AYCA 5CAZA 5JZGB 1W6PA 5FZFA 1YNAA 3AKQA 1LEDA 4DMIA 4FFFA 4WM8B 1GU3A 4NHLA 5BNOB 3IB3A 1O3SA 2YGMA 4QPIC 3O1TA 1PO21 3LIGA 4FPHA 5FYBA 2YC0A 4WM7C 1RUG1 2VXJA 4D69A 5JUVA 2JEMA 4Y20A 2D3RA 2YG0A 4N8MA 2EAAA 1LECA 3LB9A 5A3TA 3Q9OA 3THCA 3UJQA 1QXPA 4HG6B 2Q1FA 3VD7A 1SFPA 4M0NA 2CSGA 4YW7A 2AEYA 5EIYB 3P1IA 3WX5A 3N9QA 5T5JA 1PO11 3ZFFA 5K0UB 3TEYA 4LTAA 2XBO2 2YROA 4XJ8A 4GJZA 5JZGC 1QEXA 1K3IA 2LUWA 1UIKA 3JBG2 2VM9A 2ZEXA 5IHRA 2VTXJ 1UYXA 3AZYA 2B45X 4IEUA 4Q0QA 4RHV1 4WM8C 5BNOC 2ZMLA 5LEKA 5FZ1A 5FPXA 4H55A 1UKRA 3POIA 4AQSA 4Q1PA 5JMCA 3WP3A 4QT6A 1LHNA 1MS3A 3BI3A 1L7QA 4Q4V1 4X6QB 4CCKA 4XJUA 1PIV1 5DDJ1 4BA6A 3LA7A 3NJVA 4DINB 5K0UC 5BNPA 3AYEA 3HJRA 2PYTA 3CZJA 4DB5A 2QUOA 4LJHA 4XOGA 5EYYA 2BOIA 4M0HA 1UPSA 1UYZA 3LFMA 2CY6A 3MIBA 5KHHA 1X9TA 2LALA 3ZR6A 5FZDA 1IOAA 5C8WA 1PMHX 4JTNA 5A3OA 1OLME 3OJBA 4FP3A 3ST7A 2GC2A 3D82A 2GMEA 1WW4A 3DL3A 1HB4A 4BQ2A 4NHYA 2J1TA 1GQPA 5EHDA 4A44A 1OD5A 1RGSA 3WQ1A 1VBB2 1FOD3 2AEZA 1GWMA 3ZMOA 1W90A 4YYOA 4AZZA 2X5IA 3UGHA 3L2YA 1V9U1 4R9DA 1O91A 1ULDA 3A0KA 4RQPA 2WNUA 1CJDA 4JRAA 3RZHA 4I01A 3T4HB 1GP4A 4AFMA 4R9AA 2YFZA 4GB33 4XAEA 5FQ0A 2VAUA 4LEJA 3AP7A 1T6GC 1NE4A 2R043 1E5IA 3KZ4C 2BVBA 2OYZA 5LASA 1NT0A 5EJZB 3FMGA 3RYPA 3VZJA 3NV1A 3WG1A 4AHZA 1JHJA 1HRV2 3VZOA 2BTVC 2QE3A 5FKBA 2HWE2 4D7TA 2JE8A 4LKEA 5DAQA 1D4VB 2EXJA 4AVVA 1ACCA 1H2LA 4FAGA 2D97A 1V6MA 1TQ5A 2WR9A 4M00A 4K3UA 1WMXA 1QWRA 2RJKA 4OQ9A 5CU1A 1TMF1 3W5NA 3DKQA 4AEMA 3DXTA 5DAXA 3ZKYA 2JWPA 4YZ5A 4JV4A 3HQUA 1JOPA 3BGAA 2RDSA 3O5SA 4MX3A 5J7MA 4Q0VA 2R073 2CGNA 3E5UA 3AB0A 4U36A 5IAXA 2MPFA 2UU8A 4E4DX 4LO4B 1AVBA 3Q8AA 3VN4A 4MYEA 2F17A 5IVJA 2D6PA 1U0AA 4LITA 4LO7A 3MYXA 1ZRIA 1YQ2A 3VD5A 3KD4A 4O9EA 3VBOB 5C4WB 3HD8B 2EIGA 2ZGUA 5CBLA 1ST8A 1L7LA 3GGLA 3HVDA 4FAHA 3IAQA 1OQ1A 1UY2A 4OI1A 2ZHLA 3SXWA 1WA6X 2W1WA 3VV1A 4S2HA 3NV3A 4COUA 1CAXA 2E53A 4CCMA 2XDVA 1ASJ1 5C3QA 3FHIB 5FO7B 1AR72 3E6DA 3VBOC 5C4WC 2BBVA 2TNFA 1CZVA 4NPMA 2JDUA 5FTTC 2WO2A 3POBA 2BPA2 3CDZB 3VDDA 5F6LB 2GAUA 2HLEA 2JECA 5K4LA 4NMIA 3WNLA 1AX2A 3ETPA 3R6SA 1UAIA 4HPKA 1IG3A 1UY0A 3DECA 1KS5A 2E6VA 3AP9A 4PT6A 4FPGA 4YFZA 3W59A 2MHFA 4QU1A 3MIDA 1AR61 1RUH2 4QWNA 3CF6E 1ULCA 2J1AA 4MADA 2AYHA 1QH7A 3AFGA 1MS9A 4QM8A 1EPWA 1TME1 5IJRA 1NLRA 1W6QA 1X36A 2RV9A 4TLGA 5FP7A 4RSUA 2WSUA 1PO23 1VBA3 5LBEA 2UWCA 4RGAA 1KEXA 3V0AB 4DEQA 4NIGA 2VMIA 1N47A 1S0EA 4IE6A 1RUD1 2QVSB 2WYSA 5K8SA 4QX2A 1X33A 3RWKX 5GLWA 1QDOA 2PLV2 4MGQA 1PO13 3J7HA 3NWKA 4J1WA 2QBXA 1JZ8A 5ACA1 1W28A 3CLPA 1DGWX 4QQ2A 4AQ2A 1LGCA 1OUXA 3I2JA 4RHV3 1H6XA 4CXYA 1Z78A 4UFKA 5D21A 4LQRA 3WNKA 1MS8A 4YVWA 2G4IA 3T30A 4B1LA 1W8HA 3B9IA 3POSA 2Q8EA 4Q4V3 3KV4A 5DABA 4C0HA 4NRPA 2YBPA 3IMNA 3INAA 2A7AA 1QJY3 3IN9A 1UKGA 2QQIA 5DDJ3 2XHNA 2J1VA 3NKGA 4MHRA 3ATGA 1GWLA 2VNVA 3GBFA 2WZR2 4CCOA 4LORA 4Z1VA 4QDSA 4KNCA 2QNKA 3C3VA 3NNLA 1W9SA 4D94A 5FY8A 5DMYA 1FV2A 4Y1ZA 3FL7A 2GH2A 3VBSA 4ZXKA 4NIDA 2DUQA 1PZ8A 4FPYA 5JSOA 2J1UA 4E4SA 2XPJA 4KWUA 5JCTA 1CAWA 4URTA 1VLNA 2ZAAA 1QJZA 1OA2A 4HSJA 1ZRFA 1FATA 4FFGA 1WW7A 5CKQA 2JKBA 3N7KA 1GSLA 3ALQA 4GZ9A 3EQEA 4META 5FKCA 2RVAA 3FHAA 3MIEA 4LBKA 3WP4A 4A42A 1BQPA 4ZXEA 3AX4A 3H1WA 2NP0A 2FDHA 4HN0A 1V9U3 1H2KA 1IPSA 2WS92 1W99A 4ONUA 1RUE2 2WFF2 4ITCA 3KV5A 1P8JA 2ERFA 1O4ZA 1YEWA 5I0TA 4EZ4A 1CWPA 3CL1A 5IK4A 2VZQA 1OF4A 3H7YA 3O7OA 5FZ7A 2Q8CA 4V2WA 4Q4X2 4NIIA 3H50A 3WW4A 4CXXA 1NCQA 1O8PA 1SDWA 4XMIA 1G9DA 1W3XA 1BZWA 2CYFA 3JB4C 5C9AA 1GOGA 4NIAA 1TMF3 4Y22B 3TEZA 1GP6A 3NAPA 1KRIA 4YZ1A 2ZGSA 4K9SA 4Y1XA 5D1IA 5GZEA 2EIEA 1XXNA 3M7AA 1LOFC 3J4UH 3VZLA 4AEDB 2OIIA 2TEPA 3B02A 2Y33A 3N9PA 1K5MB 1UZYA 2GC1A 2VH9A 3H8RA 3OG2A 1PNGA 4OYUA 4XFAA 4S2GA 5FBZA 5IVCA 4P02B 3T3YA 3PVNA 1UXZA 4AVAA 4LMFA 2HWC2 4MGZE 1CVNA 3G7DA 3NJXA 1AJOA 3C7GA 4YWAA 5EQUA 3GYDA 1O5UA 1RHI3 2WKKA 3A21A 3FE5A 3JQXA 3MO4A 4M3CE 4XIKA 5DAVA 5LBCA 4KI5M 3UGGA 1LAJA 3WV6A 3N9MA 2P1BA 2F4PA 1H8TB 4HXCA 5ERLA 5LBBA 3PUIA 5M0TA 5FJHA 1PK6A 4AEDC 2WFPA 2DCKA 3H1YA 3BALA 1LU2A 1K5MC 4FO9A 2ORXA 4Z07A 4PBPA 1O4YA 2ADEA 2AREA 4Q27A 3MBWA 1S0IA 3I2HA 2PQSA 4D8MA 2R6QA 5FO8B 1CQ9A 1VMFA 1ASJ3 4UBHA 2GN3A 2IVIB 4AQTA 1MACA 4XQ4A 4OZXA 2B9UA 3MV11 5FY0A 5I8YA 2VW1A 1VBC1 5FR3A 4ISQA 3H3LA 4A6OA 3UNPA 4DEVA 3CBNA 4NWVA 2BGCA 5FZ8A 2ZAHA 3RG0A 5IW0A 4NRMA 2DVDA 1OFSA 3ZOIA 3WNPA 4A3XA 3IMMA 2PHTA 1OF3A 3BU7A 5I0DA 3RSJA 1AR63 2Z42A 5JI7A 4TZDA 4MGIE 2Y26A 1WBLA 2PA7A 4QX3A 3WG2A 4C90A 5JOYA 2XL7A 4QMAA 4W4ZA 1NA1A 4YG3A 1G9CA 1IGOA 4O65A 4M4PA 4WVMB 2WO7A 1BK0A 1VAKA 1DZRA 1OOPA 4RGKA 5FRAA 1OH4A 2XL9A 4EN7B 1TME3 2QQNA 4BB3A 3U0ZA 2Z4FA 4AF9A 4ATEA 5BNQA 1CD3G 4RS5A 4ARXA 5F5AA 3PJQA 4LXLA 4HETA 4CDWB 1SZBA 4O61A 4BXFA 1ZX5A 3LQCA 5H9RA 4E4ZA 2BFUS 4DUWA 2AC1A 4Y3OA 1VBD1 5I8TA 3KHCA 5A70A 5JR2A 4IXLA 2Z69A 4MLOA 3SCGA 1W2AX 5EYXA 3SITA 1FOD2 3ZXGA 2QQJA 5T50A 5ACA3 2RMU1 3BIEA 4OI4A 1ZRRA 1O4TA 4KWKA 4WV8A 2QDRA 3B00A 4Q4W1 1I1EA 3IPVB 1RUI1 3M2MA 4NHMA 4NR1A 1CGPA 4GB32 3ACHA 4IL7A 4XEZA 3VD9A 3OGRA 5J3UA 2QKDA 2R042 3UJOA 2PMWB 5CB7A 4DPNA 3VUOA 4CDWC 2WQ4A 4DY3A 1FT9A 1XYOA 4E2GA 5K9YA 2D7FA 1GOHA 2VY0A 1DG6A 1WCSA 4W6XA 1W05A 5DUUA 3WF2A 4JGZA 2QCSB 5J37A 2C0ZA 3QACA 1F4AA 1DP0A 3CO2A 3WXPA 4L97A 1JZ5A 1S2BA 5FP8A 2AR6A 3J9SA 4EN9B 4XF0A 3CQOA 3WSOA 3ZMNA 1KD7A 1RXGA 3IKWA 4PJYA 1POV3 4ZU7A 1ZZ7A 4CEYB 4LUKA 2OVUA 3J8F1 2R072 4EN0A 5E88A 3LDRA 5A33B 4XFHA 1XU2A 3ZN6B 1BJQA 2JDAA 2R061 4XILA 4LNVA 3WCSA 5C8CA 1MPXA 4GULA 1C4RA 3KF3A 3WLUA 1MZFA 1YQ8A 1COV1 3RFRA 2PQQA 1OC1A 3PVOA 1FI2A 4Q4Y1 3DEMA 2PAEA 4XE9A 5CFCB 1JZ2A 2VOWA 4PDWA 3ELNA 5FUNA 2WZPP 3PU3A 4LT5A 4NPRA 1ULEA 3BUCA 1W2OA 3WF3A 3PUSA 2VCBA 4XW3A 4CEYC 1E57A 2HWB1 2WN2A 4XUQA 4B4RA 3THTA 2GP5A 5BPXA 3WINE 2CWMA 2QQUA 4MHUA 3WHUA 3I2FA 2DU0A 3ZPYA 2XJRA 1AZDA 3QH6A 3WUDA 1DQ6A 4XCBA 5FZGA 1HB2A 5GALA 5JIUA 2CGPA 1I9RA 2JKXA 1A8MA 5HCAA 4L0PA 5F3IA 1D4M1 2XUMA 1VIWB 3U1XA 2ID4A 2WLPA 4BQXA 5LA9A 4CP0A 5IVYA 4GWMA 5CFCC 4W6WA 4PF1A 2PXJA 1IPKA 3FLTA 1UZ0A 2WQ8A 4WZFA 1YFWA 3SMHA 2NPIA 3S7IA 4JHZA 3KM5A 3GDBA 4B7KA 2B7YA 2WZEA 5F5CA 3IDAA 4EWAA 3VKMA 1E5HA 3NW4A 3QLQA 1LHOA 1QJX1 4AI8A 5FUIA 5E16A 1US3A 1DLCA 3ZYHA 2WBKA 1KS4A 5L9RA 1N1VA 3BPZA 4FQZA 3U4SA 4GWNA 3FUOA 2HBTA 5JZGA 3MUZ1 4TLFA 2K2SA 2IXLA 4BQ5A 5IYYA 3PLQA 1CX1A 1GUIA 4F3JA 1MZEA 2ZKLA 1DF0A 4DRVA 5FYCA 2VUCA 4ZPIA 3TN91 3I3MA 3O1SA 4N90A 4IERA 5T3NA 3FBMA 2VZOA 2VQAA 4LBNA 1K5JA 1PO22 1MQTC 4XUPA 1SLIA 1VBA2 2ADDA 2JB8A 2P3YA 3VBHA 2EXHA 4M3CB 1C8NA 5I8SA 1G8WA 2Q0AA 2R49A 2DVBA 4BE3A 1W8UA 1REFA 4QPGA 2D3SA 2JG9B 2RHPA 4AI2A 1K12A 1PO12 3VBFB 5HCHA 2Y6FA 1CAVB 1SFYA 2P3JA 1LOAA 1NCRB 4LBQB 4AFAA 5HBAA 5T55A 5KHIA 1VBC3 4ES9A 3KQRA 4XJAA 4CCEA 3O1PA 1HKDA 3RYKA 3AP4A 4RHV2 5I0UA 5JPNB 2XVGA 1I3HA 2ZGRA 1PVXA 4YVSB 4D3WA 2AZ5A 1LCLA 3DYPA 2FQPA 3C7FA 3RJRA 3PIGA 5CG8A 4HK8A 3GCWA 1SPPB 4Q4V2 2EICA 4AI0A 1HX6A 2RDRA 4KG0A 1GR3A 2JG9C 1QJY2 1UOFA 2XJPA 2ZGMA 4QPWA 5DDJ2 3DYOA 3RRDA 4HKOA 1YO8A 1HXS1 2ARXA 2PFWA 2IZWA 3VBFC 5JI9A 1M4WA 3WF4A 1NCRC 4CEWB 3H1MA 3LFIA 1MVEA 2G19A 3N7LA 3ZYRA 3IDCB 5F2WA 2XJSA 3Q8BA 1HB1A 2D43A 2YUEA 3JUUA 1Z7S1 2MEV1 4XUNA 1ENSA 4FQ4A 4YVSC 4YZ2A 2OKXA 1RXFA 5J96B 5A7NA 2P3IA 3VZKA 1G6NA 1W2UA 3OY8A 4BCUA 1ULPA 1E5RA 2IXHA 3ZFGA 1DYKA 1VBD3 4AOCA 3EYPA 1WCQA 4N53A 1J59A 2BWCA 1XNTA 3OSDA 2QQVA 3KLSA 4KG8A 2ZZQA 4CEWC 2RMU3 3PL0A 3ZLIA 1V9U2 5FYTA 1KGYA 4KU7A 3NMBA 4IGPA 4Q4W3 3WP6A 1F2NA 5IVVA 1GZWB 1ZBE1 1ZM1A 2P2KA 4E8DA 2K0GA 5T5PA 4GIQA 5A7OA 5JXHA 1ZBA1 3JU9A 2ZEWA 1PGW1 1DBNA 3RNSA 4OMCA 3I2GA 1UF2C 2V4VA 5DZGA 4TXWA 1C1FA 4I30A 3J7LA 5J98B 1F31A 5H9PA 1Y3TA 1AX1A 4P9LA 3IDBB 1CAUA 1GICA 1BK1A 1J3QA 1W6NA 1GQHA 1CJPA 4W65A 2E31A 2GH8A 5KBFA 2FD8A 4K8RB 4XVHA 5CFDA 3AYDA 3MLLA 4CP9B 3IBMA 5T54A 3M3QA 2ARBA 5DG1A 1TMF2 3B7MA 4BM8A 1SACA 3MHZA 1JMUB 1O3RA 3POWA 4Q5OA 2IFWA 3J8F3 1F9KA 3O1OA 5FXXA 2ZOEB 1YIFA 1AUYA 4A6SA 2R063 4CDXB 4OHVA 2WN3A 1ND2B 4C0BA 3V0BA 2DCTA 2GU9A 5C4WA 2BYVE 3PJYA 2R32A 4EZHA 1Q43A 4N43B 3PMEA 5FAXA 2OQ6A 4XACA 4LBJA 3T2PA 1Q8PA 1YWKA 1RINA 2X10A 3MW3A 1AYM1 4LBQD 1RHI2 2GNTA 3I97A 3MIHA 3QOPA 3RZKA 4UOJA 4S2DA 5FZOA 1TNRA 3OBZA 4AW7A 3HBKA 1UCXA 3NO8A 3B3QE 4AVTA 1RITA 4OUEA 2HWB3 4CPBD 4DOUA 1Q8OA 4ORFA 3U10A 3DYMA 5KXBA 2WNVA 3GCXA 4A4AA 4CDXC 4AWDA 1XNAA 1ND2C 2Y0IA 1ENQA 1PVC1 1CN1A 3K3OA 1D4M3 3TWIA 1RIRA 1PM4A 3LEIA 4N43C 5FZMA 4FXKB 1ASJ2 1W8ZA 1YJKA 3GHNA 3VHRA 1W9TA 4D6SA 1PMIA 5ANNA 4HVQA 2J1SA 1B35A 2YGLA 2ZA9A 5JR7B 4FTSA 2VMEA 5CKMA 4FSJA 1R1A1 4QDRA 4I09A 1EPZA 5CG9A 1QJX3 3NJZA 1LGBA 4PQQA 3DN7A 2W1QA 4RGGA 5BYNA 5JOXA 2E33A 2RM21 4A3ZA 2B5HA 2VL4A 2ILMA 4Q8LA 3L2HA 3OYWB 1T6BX 1AR62 1NX9A 4K8FA 2DF7A 1QH6A 1YLLA 2BNMA 4DS0A 4GQ7A 4URAA 4COYA 3LPFA 4OFGA 4JGYB 4P5HA 2A3YA 1N1YA 3B01A 4DQAA 3U4XA 1GV9A 3NJYA 3TN93 1TME2 3I3QA 1YYNA 4NHXA 4B3NA 5LZ6A 1S0BA 3ACLA 2ZX4A 2H0VA 3MPBA 5SV8A 1L3JA 4KGQA 2YB7A 1Y43B 2F6BA 4Q8KA 3RZLA 3VGIA 2YBSA 3ZYPA 1OXCA 2JENA 2HEWF 5FYMA 1CIWA 3DPRB 4IEXA 2ZTNA 3OGSA 4YG6A 1A78A 1WLCA 4MVTA 4XBNA 3VBUC 1HN1A 4LR4A 4NAMA 1W6OA 1DQ4A 4OCTA 3VDCA 3MI8A 1F5FA 4RR3B 4IV3A 4G3YC 1ZZ8A 2XOMA 4JGYC 1BYHA 4WVWA 5ACA2 1NZIA 2WQZC 2XLAA 2P34A 4MXWB 1JN2P 3ZSLA 5LA1A 4GMP0 1DU3D 3D4KA 5LW9A 3VBRA 1QOTA 1Z0HA 5BNNB 1ZREA 1W0NA 1KFXL 2DDUA 4FPJA 3NNJA 4RN5A 5FP9A 3EJKA 1C1LA 3DPRC 1HQWA 4P9XA 3HN3A 1REDA 2NQYA 3A7QA 4AL9A 1LEMA 4TWTA 5K7PA 4P08A 3SH4A 5AFBA 3MFAA 2LTNA 3USUA 4QGLA 1A34A 1HXS3 1CR7A 1W0OA 2ZGOA 3M8LA 3ZYJB 4RR3C 1DHKB 2XJQA 3PUHA 5KHKA 4XQDA 1LHWA 4IV1B 4F83A 2YY1A 2ARAA 3QH7A 3T08A 1PGL1 4XAAA 3IZOA 1C8M1 1U5YA 1VRH3 1Z7S3 1H4HA 2MEV3 1NQJA 4XXAA 3RI9A 4ATFA 5F6KA 3WT3A 2RS51 4QXHA 5BNNC 1BVVA 4ASLA 1OA4A 5FMOL 1VB4A 4XUOA 4NUBA 3I59A 3LPGA 3UK9A 5JDBA 1H8VA 1T2XA 2JB4A 1W6MB 4CCJA 1V6NA 1XYPA 1H2NA 5ABJC 2R16A 5FBJA 2SLIA 3CEWA 4MXVA 4IV1C 4BJ0A 4CU9A 4ASMB 5FY7A 5FYZA 3K4AA 5LY2A 5LK5A 4DZGA 2Y38A 1ZBA3 1XPWA 3BPSA 5E6HA 4DO0A 4UW4A 1XNDA 3MV01 4JKLA 3N35A 1XSRA 1EV11 5FP3A 3SISA 4Q26A 1YIPA 4LUMA 3RMYA 3ZO0B 2FZ1A 2VMCA 1QQP1 3HR9A 3VD3A 1Q8QA 4Y4YA 5EJ3A 5JOZA 1ZA7A 4LKSA 5JXJA 4FOYA 4CUBA 1CONA 1BXHA 1IKQA 1EY2A 3RVHA 4CYDA 4F7ZA 2UYBA 5AVPA 1OT5A 4EWEA 4BK4A 1HJGA 4JDNA 5H9QA 2MNGA 5FOJB 2CAUA 1OLRA 3HNYM 4Y26A 5CYYA 1X50A 2W92A 5FXVA 5KR7A 1X8EA 2DBIA 5EJ1B 1LENA 1QOOA 4CUCA 1MEC1 3H3ZA 3M1HA 5JAXA 2WSVA 1O7FA 1QGLA 1UIJA 4XTMA 3IIIA 3WP5A 4UI9L 1UZWA 2KM2A 1GOFA 3P6BA 2WT1A 4FP2A 4Q2FA 4ASKA 2FDIA 3ZVXA 4XC9A 2PHUA 1UYPA 4PLMA 5A7WA 3ZIXA 3FC0A 3WQ7A 5HI0A 3T0BA 4QQHA 1H8TA 1R091 1AYM3 1WUVA 3T0AA 2IWGB 1EUUA 1HV0A 2JJ6A 1NY71 2WUHA 1OSGA 1VAVA 3AXDA 1BEV2 3M3IA 2FBEA 2HWD2 4XF1A 5A3PA 4JCKA 1PX4A 4P9GA 3WDTA 3AM2A 1JU3A 1XOYA 4KL1A 3FUQA 4IEPA 4OUSA 5A80A 2X05A 4AK3A 5KXEA 4GH4A 1F4HA 1PVC3 4DY5A 4LKFA 3ENRA 3LGRA 4HLTA 2GNBA 3AK0A 4QAWA 3OUIA 5KWRA 2D6OX 5CA6A 2W47A 2Y34A 3I8TA 4CDQB 1HQNA 1DYPA 3C7OA 3W20A 3AC0A 3AL6A 2A1XA 2P3KA 1RYYA 1VMHA 3HEIA 1VBC2 4GXLA 5FZHA 2BEOA 1DZTA 1W6PB 1EP0A 1UX6A 3P5BA 3EMRA 1R1A3 1RUG3 5FZKA 2WJSA 3MF6A 5GZFA 3VDAA 1UWWA 3ZSMA 2RM23 2VTXA 5T52A 1UOJA 4Y20B 4YM3A 1A3KA 2XBO1 3FFQA 3IIAA 4C8DA 3LCPA 1UZVA 1SLBA 2B4KA 4CDQC 1JYWA 2P6HA 3LSEA 2Z5WA 3ZFFB 1EUTA 5HCFA 2XJVA 1R64A 3NQHA 4AAXA 3HQRA 4BOWA 2VE1A 5GLZA 1QNWA 2YYOA 4IGQA 4BPZA 3QCWA 3GZAA 3G6JB 4AQ6A 1BHGA 3JB8A 3PURA 2XVLA 3I2DA 3TAYA 2ZCWA 3S30A 4AFBA 3UL2A 1PIV3 1S0GA 1QJEA 5KHGA 2D6NA 1VBD2 1SQ4A 2VBPA 4L8QA 4CCDA 4I02A 5ANQA 3SHRA 3ON7A 3IPVA 3I2KA 4I0AA 1D0HA 3GZTB 4ZHNA 3B5LB 3ZFFC 2RMU2 4QM9A 3X29B 5BNPB 3I4IA 1YUDA 4MGKE 1I5ZA 1NLQA 5FY9A 4Q4W2 5F3GA 4Y5TA 4K1YA 2VGDA 5FUPA 4XF4A 2VVFA 4XPVA 1UY3A 3K4ZA 5DUXA 1PNFA 3WZ1A 4UW3A 1JODA 2QQLA 1AR92 3PMSA 1VBB1 1H1IA 4C1WA 1D2SA 5A3WA 3BIWE 3FWEA 4IDZA 3T4VA 5A1FA 5J1XA 2D5HA 4Q0SA 2ETEA 1AR81 3ACIA 3SH5A 2YXSA 2ZACA 1UW8A 4PQ9A 4H14A 4BZ4A 4CP2A 4E2QA 5BNPC 2JICA 2G9GA 4L9BA 5AFEA 4MGSA 2X5IB 5LA2A 4RQPB 4CEYA 2R30A 5FZBA 1WCDJ 1XE7A 5GJ6A 2WNUB 1C8M3 3DKWA 3R4DB 3RQ0A 2WDBA 5LCWL 2VZPA 5GKAC 2O8QA 3HBZA 2RS53 1W2NA 2ZX0A 1IS5A 4YW1A 5FQ0B 3ZFEA 3HNMA 5JXGA 1HRV1 4R4XA 3WQ0A 1AXZA 2HWE1 1IS4A 4HVRA 4G9SB 4P9IA 1GZTA 2R062 3HWJA 4PI0A 2C9KA 1SLCA 1HIXA 2RJ2A 3SQOA 1W04A 3HT1A 3OBTA 2YDEA 4QKDA 1W8WA 2EAKA 2X5IC 3HQXA 1LOGA 4Q4Y2 4RQPC 4YW3A 4UF0A 2E7AA 2R1BA 2WNUC 4XABA 4Q4Y3 1OLQA 5DG2A 3WR0A 4EJRA 3OGGA 1NKGA 5FYIA 4QXCA 2ZGPA 1BMV1 4CCCA 1NUKA 2HWB2 1HQLA 3POGA 1G9FA 1EV13 3RZGA 5GZDA 1PHMA 1QQP3 3LEKA 3PIJA 4FOVA 2K9ZA 3MZHA 3GXUA 1JYXA 2VW0A 2JE9A 1I6XA 2O8OA 1D4M2 4ZZ5A 4YM0A 3THPA 1SCRA 2PHWA 2NLRA 1QXJA 2R7EB 5CVRA 5C3SA 2JE7A 2BWAA 2C4XA 2GSYA 2JD4A 1Y9GA 2A3WA 4IE0A 4AR2A 3CJIA 1UY1A 2QTWB 1OKQA 3GJBA 1OVSA 4QPIA 4AVBA 3QD6A 4Z92B 2W0XA 3RZZA 1MEC3 4IESA 2XG3A 1QJX2 4WZCA 1REEA 3K46A 4KBZA 5IVBA 3GM8A 3JCIA 2ZHMA 4LPLA 1YXWA 3N9NA 2DU1A 2V73A 1O5LA 4V2VA 5FY4A 1CAXB 4PIXA 2DFCA 2VD7A 1XQNA 2E63A 3DUIA 1R093 4XFIA 3WDUA 2YFUA 3A22A 3AZZA 1C3HA 3QBQA 3U75A 5C5UA 1RB8G 5C33A 3TN92 1GZCA 4YRDA 1JBCA 2ZMNA 5T5OA 4DXZA 1RUC1 3MEPA 1V6JA 1AL21 3VDDB 1SHWB 2I45A 2WA4A 2BJSA 1GMMA 3IT8A 4LLOA 4LO5B 5F2SA 5FY1A 5FO9B 4FXGB 4GMP1 4OMDA 5FWEA 1CAVA 1NCRA 4HPKB 2X53S 4I0BA 4INDA 1UMZA 1IQAA 1KJRA 4YFWA 4YSFA 1F35A 1OVPA 3KCCA 3O0VA 5FZ4A 4NO4A 3BB6A 2DUOA 5HCBA 4FFIA 3KHBA 1TE1B 1RUOA 4O9GA 5A3LA 1VBE1 1WBFA 4Y1YA 4BQ4A 4ZS2A 5A6ZA 3SKJE 1SPPA 1W6QB 5GLUA 3VDDC 1XNCA 3F2ZA 2RS11 3KF5A 3I3DA 4LO8A 4XJ9A 2ZABA 4ES8A 1RUD3 3HPNA 2PLV1 4CEWA 1YQ5A 4FCAA 2EALA 1KITA 3KT4A 2VZTA 3IWZA 3WD5A 2HEVF 4COZA 1HXS2 4E9KA 3JD71 3VKOA 4LK7A 1HV1A 5FMCA 3TNQA 1H9PA 5A1AA 5FV3A 2TUNA 3OEAA 2JIJA 3BVCA 2LS6A 2VUJA 4XZPA 3NV2A 3KT7A 1AL0G 3OGVA 1Y9MA 3O1MA 5ISLA 2ZGTA 1VRH2 1Z7S2 2MEV2 4YPJA 3USSA 1R081 4CCNA 1ZZ6A 3WW1A 4LA3A 3ES1A 4XBLA 4N9IA 3FLRA 3OPZA 1ND3A 2G1MA 3EO6A 1HB3A 2HH9A 3RGBA 5DZEA 1HDKA 4KU8A 3WY6A 5L19A 4AAPA 4YGCA 2VOVA 4CDUA 1A6CA 3ABZA 4IEVA 4BQ1A 4W50A 1JW6A 4OHWA 4PHZA 3FLPA 4UFLA 4EQVA 2OZJA 1N1TA 3ETQA 2HYXA 5FPZA 3FHQA 2JDMA 4PBOA 4YM1A 2QZ2A 2PHRA 1K45A 2OT7A 5CIRA 5JMOA 3D0SA 2JDYA 4GWJA 1APNA 1ZBA2 2P4EA 4PIZA 1PGW2 3VBSB 4DRRA 2ET7A 2J42A 1QHDA 4JDOA 1J3RA 4OHZA 4IETA 3KMHA 3V56A 2P5BA 4D6RA 5IVFA 3CHXA 1CAWB 3U78A 4YW6A 2Y6GA 1QMJA 1AR83 3RZMA 1WW6A 1J1TA 3VD4A 5A6XA 4K1ZA 3T1MA 5FPAA 4J25A 4BYYA 2ATFA 2Y6JA 4N7UA 4ZZ8A 1LULA 2JG8A 3ZSJA 2AACA 4QHZA 2VCAA 4I0WB 3PTRB 1QJU1 1AF9A 4CDXA 4XDPA 3VBSC 2IUWA 4AGRA 1C5HA 1ND2A 4ISRA 3K3NA 3AMHA 2VQUA 5CZKA 5LB6A 3VL9A 2OW4A 1C28A 1DLLA 4Q4X1 4EWDA 4XIOA 3T09A 3O0XA 1BVP1 2PTMA 1LODA 2LW8A 4JVAA 3WNNA 1VB2A 4DXRA 3GZUC 1X9PA 4Y5Z0 5EZWA 3OTFA 2VNRA 2HYKA 2H6BA 2QQKA 4QB2A 1AYM2 1LOCA 1LRHA 1NCQB 2ZHKA 2X29A 3IDEA 4MO3M 2PN5A 4WM7A 4XFCA 5E1RA 5A32A 2VBDA 3AMQA 3KS7A 2YHJA 2W1SA 3U11A 3T2QA 5C9AB 3O1VA 5IUQA 2VMGA 3AMPA 3NAPB 2C1FA 5LK7B 1S0DA 1MQTB 4FVVA 5DN2A 2R0HA 1UO9A 3ITQA 3DGTA 2H0BA 2VNGA 2EIBA 2JDNA 1GNZA 4JAAA 1RUNA 1JUIA 4D0QA 1XRUA 1PVC2 3B94A 4Z82A 3W5MA 2VOKA 3KV9A 2VVEA 3WDYA 1FMD1 2KR2A 4RYDA 4WM8A 5BNOA 2W87A 1RUJ1 2PHLA 3FX3A 4GJYA 1H2MA 1NCQC 5FOBB 1IKPA 1DYOA 3UGFA 1JOJA 5FXWA 3RZJA 1CPNA 2AENA 5C9AC 1DZQA 3GZEA 1V70A 3NAPC 1F8VA 5FYHA 1FX5A 1R1A2 1RUG2 1AX0A 1JXNA 2ZKNA 1CX4A 5LWBA 5K0UA 1ULOA 4TTGA 5E8AA 4OQ8A 3VZNA 2RM22 3H3UA 4MH0E 2ET1A 4R9CA 1XYNA 3POFA 2XJTA 4AI3A 2JX9A 2QJVA 3RI8A 2WAAA 2VBBA 3U14A 2ZX1A 4Q1RA 1WMEA 5FZ9A 4PLNA 5F1RA 4XF9A 5A6YA 3I7DA 3GJAA 2WO1A 1RUC3 4L92A 5L7OB 1OURA 3BN6A 3A4UA 3MW2A 1AL23 2UY8A 2VULA 4Z8BA 4UW6A 1KFUL 5AC91 1UMHA 5F3CA 5FLJA 5KXDA 1PK6C 2G9FA 1FPN1 1I5PA 1ODNA 4AHYA 2ES3A 3ZXLA 1JYTA 1XU1A 4GMP3 2BVVA 2YU2A 5FZ3A 4YGDA 1JZ4A 2B42B 1PIV2 4RD7A 4UXAA 2Q8DA 2DCZA 1WD4A 1OQDA 2VMDA 1WCKA 3T2OA 2ORZA 5FK8A 1BKZA 1RUF1 1NA1B 1YRZA 4K20A 1VBE3 4YM2A 1VJ2A 1DIWA 1OOPB 2WINB 4OHYA 3MDPA 5L7OC 4QQPA 5F8PA 4IEYA 4UAPA 3K51A 4Z2AA 4LHLA 4MV2A 2RS13 4RS5B 2YPDA 3O12A 5LATA 1G9BA 3OUHA 1UU4A 1B09A 2Q8OA 3TBDA 4DIQA 4IUGA 1J3PA 3NKTA 3UKNA 1W8NA 4KGGA 1HN0A 4Z2WA 3JD73 3PU8A 2H6CA 3CNAA 2BNNA 2R1DA 4CUGA 1NA1C 3MLJA 1RUI3 5FIXA 4MGTA 1HRI1 1OOPC 1PGL2 2QQMA 1C8M2 4H7MA 1R083
chains in the Genus database with same CATH topology
2RS52 4X8PA 2W52A 1JUHA 2GNMA 4RS5C 4XJWA 3U07A 1H0BA 4FPOB 4BIFA 4FPEA 1UU6A 1X7NA 1DQ0A 1LHVA 1LU1A 2WIIB 1N3QA 4OULA 3VKLA 4L2NA 1OI6A 2VVDA 5FCCA 4CP1A 1Y7BA 1C57A 1DQ5A 5BUVA 3M3EA 4AEJA 4YW4A 2P37A 2ZGLA 1EV12 1OA3A 3FBYA 1QQP2 3VBOA 1COV3 1WLDA 2C9AA 1MVQA 4JGZC 5C8CB 4AG4A 2JDZA 3JQWA 4OHXA 1Q8VA 1DDLA 4XXPA 3EXUA 3R0RA 3ZN4A 2HKXA 1QJU3 4PDWB 1MS0A 5B2GB 3A0NA 3TYJA 1OQEA 2NZ9A 1MEC2 4IEQA 3LKJA 2NM1A 1DQ1A 1TEIA 1KXGA 2I07B 1A8DA 1JHNA 2VOXA 3KCYA 4EN8B 5C8CC 4QD2A 3PHMA 4B29A 4WVZA 1JYCA 1QY4A 1R092 4YW2A 4JRLA 3PNAA 4D7TA 4DNYA 3OCPA 5T5LA 1NY72 3W9AA 1N1SA 4PDWC 4BMEA 2Z2SB 3OD4A 2CTVA 4CRQA 1SBDA 1NXMA 2VXRA 4LLFA 4ZU4A 2Y0OA 1UU5A 3M3OA 3PVBB 1NE6A 1YI9A 1S1AA 1XNBA 1PGSA 4C1XA 2DWRA 2YMZA 5CADA 3WNXA 1BBT1 4XDQA 4HT1T 3AKTA 1ENXA 5HXVA 3WW3A 2RR11 4G4FA 4IEOA 3VBUB 3VZMA 1FMD3 2DCJA 1RUJ3 4HVOA 4YW5A 1O3TA 3GBGA 3V0AA 1FXZA 3ZIWA 3WG4A 4YZ3A 1GANA 3ECQA 1VBA1 1G7YA 1WGPA 4FOQA 4Q29A 5FMOS 3SH3A 2Q30A 3KSCA 1H1MA 3OD0A 3WCRA 1AXYA 2XWJB 3VBHB 1RUD2 3PTYA 3KT1A 5D8AB 4FT8A 3LOBA 2WLQA 2A70A 4QPGB 2V09A 3N36A 2BW8A 3ZSKA 3E5QA 1GNHA 1QF3A 2RJLA 2PHFA 3AKPA 4NWWA 3IM0A 1RL3A 4N7IA 4TSVA 3UV9A 5AC93 4HZFA 1FPN3 2HJIA 5LRSA 3VBHC 1QJY1 3B9CA 2FHRA 4P9JA 3GHMA 5H9SA 5D8AC 3ZX7A 4AI1A 2VMHA 2N7GA 5EV7A 3ZXEA 2OUJA 2QDNA 4QPGC 5ABJB 4JTOA 4AXOA 5JPMB 5BXXA 3FFZA 4EV0A 1RUF3 4LBMA 2DFBA 3P3NA 1KDKA 2RE9A 1Q3EA 4R8HA 1ZRDA 2D93A 4IEZA 3BOPA 5KXCA 1W39A 4EN6B 4CTEA 1R1ZA 1QKQA 3BCWA 2HWF1 1LKNA 5I0RA 3OY8B 1C5IA 4MGYE 3ZFGB 3HAGA 5GZCA 1DQ2A 1AR82 1LTEA 4N53B 4R4ZA 1GZ9A 2OZ6A 1LOFA 1MS1A 3RYRA 1ZNPA 1ZBE3 5C6CA 1HRI3 1V6OA 4KH9A 3GALA 3WG3A 4OI2A 4V1PA 1AYN1 3M70A 5FLIA 3WHTA 1LESA 4ZU5A 4MZUA 3RDIA 3SLIA 5JOWA 3OBRA 4B4QA 2W68A 2RS31 1RMU1 4YZ4A 4J1XA 3T1LA 3ZFGC 2Z79A 4Y22A 4P9YA 1WMFA 3N3HA 4N53C 5DZFA 1CAUB 1W6NB 2E9QA 3MIGA 3M4FA 2O1QA 4A7ZA 4QXKA 4AEDA 2KA3A 2A6XA 1K5MA 2D6MA 5CFDB 1SLAA 1ZZBA 1RVF1 3KB5A 3HN1A 1BMV2 1JYIA 4FPLA 5GLVA 2DVFA 5IK5A 4L11A 1ZA4A 4RA0A 5FLHA 1RHI1 4LULA 3V0BB 3VKFC 5SV5A 4OI0A 5GLTA 3AZWA 4XMAA 5E89A 2A71A 2DCYA 4JC1A 1EAH1 2WNEA 3H8UA 5CFDC 3WDVA 1U12A 4AHWA 3FZ3A 4COVA 4F8AA 4K6BA 1ZYBA 3AYAA 2X8KA 2LM3A 3SNMA 1WD3A 2WNVB 4XHBA 2O0OA 5EXOA 2UWBA 4HMZA 3MFCA 1ULGA 3RS6A 1RTVA 2DTWA 4QPYA 2NMNA 2PAMA 3WDXA 1ZRCA 2XH6A 2ZZJA 1V6IA 1J58A 4QU2A 2GMMA 3D5OA 3N4MA 3H7JA 2D40A 1DFQA 1XE8A 1B35B 3AFKA 1VP6A 1RUC2 3URFA 1AL22 4FPKA 1UPIA 2WNVC 4NHKA 3E5XA 3NVCA 4WVMA 1BBT3 2B46X 2RR13 4LHNA 5I93A 3JBG1 2JXAA 1GQGA 3MW4A 2XHKA 4XFFA 4CDWA 1VBE2 1MS5A 1B35C 1SEFA 1YHFA 4U2AA 4Q0PA 2RS12 3TB0A 1H30A 1KJLA 1JTZX 4JQRA 2DVGA 2E7TA 2AH2A 4KWLA 4YG0A 3JD72 4EROA 4LBLA 1CPMA 5F5QA 2NMOA 1NZCA 2NN8A 2CL2A 1W6OB 4IV3B 1RUI2 2A6WA 4X6RB 2EF6A 1N3PA 2GN7A 3AMMA 1R082 5BV6A 1SLTA 1OMIA 1U5IA 3VBRB 3D0JA 2YPJA 4HKLA 3O14A 4M3CF 3LWCA 4AGGA 4QQOA 2B39A 2V5YA 3USUB 2EXKA 2XKOA 1XNKA 3LA2A 4NOTA 4PIYA 4BIOA 4IV3C 1ALYA 1LB2A 5A33A 3UKVA 2NYYA 1POV1 4OLLA 3ZN6A 4A7YA 1RJ7A 1VALA 3J8F2 3GNEA 3VBRC 1QXRA 4DFSA 4J6GA 4OVEA 2HWF3 2WWSA 1DGRA 5DXDA 2XVKA 5CFCA 3I59B 3LA3A 4WBBA 2OUHA 1COV2 2ZBJA 5L73A 2SBAA 3WDWA 1OPOA 4YGEA 1PZ7A 1RJ8A 5TSWA 1SBEA 2BUKA 1NLSA 2D5FA 4Q0UA 1QJU2 1AYN3 2IC1A 2A3XA 4FOWA 4XTPA 1LOEA 1URXA 4QGMA 3AXEA 4K21A 4LO6B 4HL0A 3R4SA 2RS33 4BHPA 1RMU3 5L36A 2ZGQA 2ZJCA 1MS4A 1GFF2 3ZSEA 1DGRN 1PZ9A 2ZPXA 1WLTA 4FTEA 5FREA 4N9HA 1GBGA 3DV8A 5KC6A 4YNIA 4XJZA 1MQTA 4HN1A 2BQPA 4SBVA 4S2FA 2DURA 4SLIA 4LE4A 1RVF3 3HIFA 3MF9A 1QU0A 2CGOA 3LSDA 1YJLA 3AJYA 3OGJA 3NSTA 4GKYA 2YV8A 1AR71 3MGUA 1FMD2 2E7QA 4YARA 1RUJ2 1BEV1 5LRRA 2HWD1 1ZZCA 5AVAA 4K7JA 1EAH3 2AUYA 3AMNA 2CV6A 4M3CA 3ZXKA 5CNAA 1CESA 1LGNA 5DUVA 4LHKA 4FBFA 2JG9A 3E97A 2ZX3A 2BNOA 1NXD1 4W6YA 1RUH1 3VBFA 5LEKA 3B69A 2A75A 4GH4B 4LBQA 3AKSA 4FTBA 1S2KA 2XGXA 1SBFA 4YVSA 2ENRA 2VW2A 5L7OA 2A73B 3SCFA 1H8TC 4RFT0 1ZVFA 4I3PA 2VNOA 4AFCA 3E6CC 1EYBA 3TOJA 1YFUA 2AGSA 1IHMA 4QX5A 4A7KA 2GC0A 2Q4SA 1VR3A 3BOWA 5AC92 5J09A 1FPN2 3PVEA 2HEYF 2I2SA 1PM7A 4GH4C 2EA7A 3LZZA 3GBWA 2XBO3 4E2SA 3CJXA 1KDMA 3JBG3 1UZZA 1YCIA 3L9JT 3MPPG 3ILNA 1RUF2 4R9BA 3H0OA 4OUMA 3D8CA 4XETA 1OFNA 4Y1VA 5A3MA 4M01A 4YVWB 1LJ7A 3AZVA 3WUCA 2WZR1 2ZMKA 3N7MA 2A6YA 1FV3A 3B93A 1JH5A 1GZWA 3E6BA 1SFNA 3VL8A 3MIFA 5F9TA 1YI7A 2QFEA 2YZ4A 3VLBB 2DTYA 1YFYA 2IXCA 3ZYIB 5FDBA 5DUWA 1ZBE2 2ZGKA 2ZGNA 4HBNA 1HRI2 3EHKA 3ILFA 4H7LA 4AFDA 4D7YA 1TNFA 3BODA 3SCHA 5BY5A 1Q5OA 1AR91 4YVWC 1S0CA 2Q5TA 1VBB3 4KBBA 4KQ7A 2TBVA 4RL7A 3LOIA 5EFUA 4FPFA 1M06G 1F5JA 4HK9A 3RWNA 3ES4A 4TYSA 4B4PA 2WS91 2ZHNA 2D98A 1GKBA 4XYXA 3K48A 1RUE1 2WFF1 2R0FA 3DF0A 1WA4A 1WLWA 3C2UA 2FMYA 2A6VA 3GF6A 5JSPA 3ROUA 2IXIA 1RC6A 1S55A 2DUPA 4HFSA 2VECA 3CU7A 1HRV3 2GZWA 4CZSA 5IK8A 2HWE3 3D6EA 3HT2A 2EVXA 1H1AA 2BFUL 3H9AA 4N43A 2IXJA 3T2TA 3ZFEB 2PHDA 1LHUA 3MLKA 4X8NA 2GDFA 4NN0A 3MICA 1ENRA 2GNDA 2UY9A 4E27A 3AP6A 2GALA 2D44A 4HKWA 4GALA 1FNYA 2DYCA 4AVCA 4ZKTB 1OHFA 1ZZ9A 2VG9A 4BWOA 1NG0A 5LEJA 2XLGA 1H4GA 1FYUA 4P9WA 3VHNA 4P14A 3R4UA 3RMXA 2A6ZA 1Q56A 2DV9A 3P3PA 2OPKA 3ZFEC 2HWC1 4AHXA 1Q8SA 1S0JA 1NQDA 4BH9A 4COWA 2UYAA 2UWAA 4NVPA 1X8MA 4BLJA 4UBGA 3ASIA 4L99A 1V6LA 2PELA 2E51A 3ME2A 4XQWA 1O3QA 5GZGA 3W58A 1G9AA 1UD1A 1BCXA 1LR5A 2CWSA 2PAKA 3S6PA 3AZXA 3CJIB 4D7SA 3LAGA 2VU9A 4XHXA 3OYWA 1PK6B 1AXKA 4HANA 3VBUA 1D0GA 3WVJA 2IFRA 4AYUA 2EXIA 1YFXA 1BBT2 4JGYA 1AR73 2FZ2A 5J48A 2RR12 5JLVA 4XBQA 1N3OA 3R05A 4KWJA 1BEV3 3AKRA 4LE3A 2HWD3 4QQLA 3ZDSA 3FJSA 3O0WA 1AHSA 3CJIC 2DVAA 2GC3A 4MUVA 3DPRA 1LOBA 3WOGA 2ZS6B 4AEKA 5I0SA 4GA9A 5D8AA 4XFBA 4AE2A 1HW5A 1RUH3 4AVSA 1ULFA 4RR3A 4UW5A 1HLCA 2WA3A 4WVVA 1MZ6A 4MXWA 4C91A 3ZXFA 3TRSB 3EBRA 5IT6A 3M3CA 5I91A 1U5XA 3V64A 5BNNA 4Y24A 1QOSA 1SLLA 3ILRA 4I2OA 2ZX2A 2P17A 2D3PA 3HMYA 2C5DA 2PLV3 5ABJA 1FOD1 5JIAA 4LBOA 3I54A 5J36A 4IV1A 2WT2A 3AJZA 4YGBA 3RJ2X 4B8EA 5GM0A 1WMDA 1SCSA 5FFOC 3VHOA 2XLFA 3UKTA 4MSVA 4GB31 3KCXA 1AJKA 3OF1A 1VRH1 4JDMA 1V6KA 2R041 4QGNA 3VKNA 2W08A 3ZXJA 1W6MA 1MR5A 4HSLA 3ZN5A 1WW5A 2VQ0A 4K40A 3TNPB 1U5ZA 1V00A 2CAVA 4YLZA 5KHJA 1QDCA 4R52A 2WZR3 3KGZA 2WT0A 2HWF2 4XF3A 2CNAA 1UN1A 2W39A 1QNYA 4IQPA 3V65A 4JGZB 1ND3B 1IPJA 2QQPA 5JSRA 4CDUB 1VAMA 1OPMA 1S0FA 1W0PA 2XKPA 3AP5A 2R071 1DGLA 1AYN2 1AR93 4QHBA 3KGLA 3JZVA 1FNZA 2UURA 2PHXA 5JWPA 2KXLA 1GYKA 1G86A 2RS32 1RMU2 2D6LX 4PLOA 1FAYA 1UL9A 1POV0 2WS93 1ND3C 2WL1A 1RUE3 3RPQA 2WFF3 2VUAA 2XJUA 4CDUC 2XB6C 3S0MA 3POYA 1MZ5A 3ZYGA 2OA2A 2I74A 2JG8B 1RVF2 2VPVA 4Y1UA 4BMBA 3J26N 3APBA 4Q4X3 4I3GA 3NL1A 1X82A 2GMPA 3NV4A 1Y9QA 1IS3A 1IS6A 1SMVA 2A5ZA 3BTAA 3S7EA 1J1LA 2D6KA 1D2QA 4H3WA 1H9WA 4AGVA 1DGWA 3ZXDA 4LA2A 4IEWA 2FMDA 1GLHA 5KC5A 4GKXA 1KQRA 5IK7A 2Q1MA 1EAH2 4QPIB 4FPCA 2JG8C 4PF5A 4WM7B 5A32B 2Q1ZB 4B7EA 2WC2A 4A2UA 2QZ3A 2HWC3 1NOVA 4CDQA 1IZ3A 2XWBB 2B8MA 4PCRA 1NYWA 1ONAA 4XFGA 3ZXAC 2IXKA 3N7JA 5JVVA 3AYCA 5CAZA 5JZGB 1W6PA 1YNAA 3AKQA 1LEDA 4DMIA 4WM8B 4NHLA 5BNOB 1O3SA 2YGMA 4QPIC 1PO21 4FPHA 2YC0A 4WM7C 1RUG1 2JEMA 4Y20A 2D3RA 2EAAA 1LECA 3LB9A 3Q9OA 3UJQA 1QXPA 4M0NA 3WX5A 5T5JA 3ZFFA 1PO11 5K0UB 4LTAA 2XBO2 2YROA 4XJ8A 5JZGC 2LUWA 1UIKA 3JBG2 3AZYA 4IEUA 2B45X 4Q0QA 4RHV1 4WM8C 5BNOC 2ZMLA 5FPXA 4H55A 1UKRA 4AQSA 4Q1PA 5JMCA 3WP3A 4QT6A 1LHNA 1MS3A 4Q4V1 4X6QB 4XJUA 1PIV1 5DDJ1 4BA6A 3LA7A 4DINB 5K0UC 5BNPA 3AYEA 2PYTA 4DB5A 2QUOA 5EYYA 4XOGA 4M0HA 1UPSA 3MIBA 2CY6A 5KHHA 2LALA 1IOAA 5C8WA 4JTNA 3OJBA 4FP3A 3ST7A 2GC2A 3D82A 2GMEA 1WW4A 3DL3A 1OD5A 1RGSA 3WQ1A 1VBB2 1FOD3 3ZMOA 4YYOA 2X5IA 3L2YA 1V9U1 4R9DA 1O91A 1ULDA 3A0KA 4RQPA 2WNUA 1CJDA 4JRAA 4I01A 4AFMA 4R9AA 4GB33 5FQ0A 4LEJA 3AP7A 1T6GC 1NE4A 2R043 3KZ4C 2BVBA 2OYZA 3FMGA 3RYPA 3VZJA 3NV1A 3WG1A 4AHZA 1HRV2 3VZOA 2BTVC 2QE3A 2HWE2 1D4VB 2EXJA 4AVVA