1QMJA

Cg-16, a homodimeric agglutinin from chicken liver
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
132
structure length
132
Chain Sequence
QGLVVTQLDVQPGECVKVKGKILSDAKGFSVNVGKDSSTLMLHFNPRFDCHGDVNTVVCNSKEDGTWGEEDRKADFPFQQGDKVEICISFDAAEVKVKVPEVEFEFPNRLGMEKIQYLAVEGDFKVKAIKFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords BETA-GALACTOSIDE-BINDING LECTIN
publication title The 2.15 A Crystal Structure of Cg-16, the Developmentally Regulated Homodimeric Chicken Galectin
pubmed doi rcsb
total genus 28
structure length 132
sequence length 132
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1qmjA00
2DVDA 3AXDA 3SH3A 3ZYRA 1SLBA 1ULFA 2ARBA 3IMNA 1SCRA 3AP7A 3M3CA 5GZEA 4FP2A 3UJOA 3FUOA 4YGDA 2P2KA 4AGRA 2DUQA 4UW5A 5KXDA 4U36A 4I30A 1LOAA 3AX4A 4R9CA 2LTNA 1BYHA 3N36A 2ZGRA 1W6MB 2CNAA 3VKLA 3ZSLA 3OBRA 3RG0A 3V64A 3IKWA 3FUQA 2ZGQA 4YFZA 1W6PA 2V73A 1QDOA 3WDYA 4AVSA 2ZACA 3T1LA 5DUWA 5DUUA 4C1WA 1JN2P 1GLHA 5GLUA 2ZBJA 2PHWA 1V6IA 2CTVA 4FPJA 5H9QA 5IK7A 4WVVA 2A6VA 3NWKA 5KXCA 2R49A 2ZMLA 4Y1YA 3WG3A 1DLLA 3FLTA 4XMAA 5FREA 1IS6A 1WBLA 2AUYA 4MYEA 4WVWA 1F31A 1JYIA 3B00A 1LHVA 1S0GA 1LJ7A 3CNAA 1B09A 2OUJA 3IPVA 4C1XA 4UW3A 2DWRA 2XG3A 2Q5TA 4KBBA 2VW0A 1IOAA 2VW2A 1LEDA 3KQRA 4HANA 4LBOA 2GMMA 1WCSA 4ZKTB 2A70A 4YZ1A 4K1YA 3L2YA 4GA9A 2A5ZA 5CNAA 5EXOA 1G9BA 1SACA 3N3HA 2DTYA 2DUPA 1MZ6A 3WLUA 2A3YA 3SLIA 1JUIA 1PZ8A 2E53A 1QGLA 4XJWA 3AYAA 2UWAA 1N47A 5T52A 1A8DA 1ULGA 3B69A 3ILRA 4CRQA 1G9DA 2FMDA 3AYDA 5CAZA 4XXAA 3AZYA 4Y22A 2A6XA 1V6JA 2CWSA 1KJLA 3WHUA 4XHXA 5GZCA 3RMYA 1DQ1A 2P34A 2YMZA 4FPOB 2JECA 1LGBA 3LSEA 2D44A 1FV3A 2WJSA 3ZVXA 3ZYPA 2GNMA 5F5QA 3WVJA 2GNBA 3N35A 1I3HA 4Q2FA 5T54A 3ZXKA 2AR6A 1V6KA 4XYXA 5T5PA 2ARXA 5CBLA 1S0EA 2R0FA 3ZSMA 4CTEA 2ZHKA 4YGBA 1YIFA 2E6VA 1EPWA 3NV1A 1DQ6A 2VH9A 3M3OA 1W6NA 1OFSA 5H9RA 1C4RA 1FYUA 3AP5A 2EXHA 2VXRA 1AZDA 1DQ2A 2OVUA 1N3OA 2SBAA 2CL2A 3AJYA 1H9PA 4GKYA 4P9YA 3MW2A 1LGCA 4M3CF 1S1AA 1PZ9A 3OPZA 1W6NB 4DRVA 1XQNA 3RRDA 4DQAA 1URXA 4UW4A 2DU0A 3HMYA 4Y24A 3TAYA 1IS5A 4P14A 4R9AA 3WDTA 5DZFA 3ZXEA 2ZGOA 1MVEA 1RITA 5GZFA 5IUQA 1LGNA 4FP3A 2P3IA 4XBQA 3RSJA 5JDBA 1WW4A 2E7TA 2ZGKA 3H0OA 4Y1UA 4ISQA 1WBFA 3AFKA 4NOTA 2ZHMA 1Z0HA 3PVEA 4AVVA 3GNEA 3ILNA 5H9SA 2YY1A 4GXLA 2GNTA 4XMIA 5DUXA 3HN1A 4Y1XA 2XB6C 1GSLA 1CPMA 4W65A 1ENQA 4ATFA 1QOOA 2ES3A 2AH2A 3T2TA 1AXKA 4XJ9A 2GALA 2ZZJA 5IT6A 1V6LA 1ZA4A 1WW5A 2AGSA 2P37A 2VU9A 3WNXA 2NYYA 3MEPA 1GZ9A 3ASIA 1N1SA 1UX6A 3WDWA 1YRZA 1KJRA 1W6MA 2D6KA 4BOWA 4BMEA 1LOBA 1YXWA 2FHRA 1UAIA 4GWMA 2WNEA 2UWCA 2D7FA 1F5FA 1TEIA 3QCWA 4FPYA 5AVAA 1SLCA 1GANA 1KDMA 1FATA 1FNYA 2GN7A 3N7JA 1VIWB 2CYFA 1MS5A 3N7MA 4TYSA 4YFWA 1LHOA 3RMXA 5HCFA 5T5LA 2C5DA 4XJ8A 1DBNA 4TZDA 2UU8A 3VV1A 2TEPA 5DG2A 4WZFA 5IK4A 3UJQA 1QU0A 3WOGA 3HR9A 5DUVA 2D6PA 1LOFC 4LBJA 1G86A 1LOFA 1IS3A 1MS9A 1LOEA 4FPGA 1LHNA 2EIGA 4ASMB 4CZSA 2WSUA 2YROA 4PBPA 3AYEA 5JOZA 2A6YA 3WDXA 4FOQA 2GMPA 1DQ4A 3AP9A 4YLZA 1DZQA 3AZXA 2WT2A 3I4IA 3OY8A 4SLIA 1MS1A 1GZWA 2JKBA 4FOYA 3M2MA 3N7LA 1VAMA 2ZGPA 2PHUA 4HL0A 5JVVA 5JOWA 1LOCA 4K20A 1I1EA 1W0OA 5JLVA 3OBTA 4YG0A 3IN9A 4LBMA 4FPLA 3OY8B 5L73A 2JDZA 1ULEA 1QF3A 1V00A 1GZWB 2I2SA 1V6NA 1CR7A 1LU1A 5IK5A 1MR5A 2BQPA 1A3KA 2EXIA 2A71A 1WLCA 4XJAA 1CESA 1GICA 4YZ3A 2ZAAA 5DZEA 1JBCA 3SISA 4Q27A 1C1FA 2PELA 4JCKA 1AJOA 1H9WA 2ZGUA 4IQPA 2WT1A 4L8QA 3PJQA 2Z42A 3VKMA 3WUCA 3O5SA 4K1ZA 3WG1A 3WZ1A 2GN3A 2DVGA 3KM5A 3M3QA 4GWNA 5E89A 1UPSA 1NXD1 1C1LA 2ZMNA 4XILA 1JOJA 2ZGSA 4FPEA 5DXDA 2PHTA 4LBLA 1QNWA 4YM3A 1WLDA 2DVBA 3MW4A 3RQ0A 1S0DA 4FQZA 1UN1A 1CQ9A 1O4YA 5F9TA 3ATGA 2VY0A 3VKOA 3LCPA 2JE7A 1YYNA 5GLWA 2E7QA 1MS0A 1S0FA 3R4UA 1HDKA 3APBA 4XZPA 2A6WA 1LOGA 5DG1A 3WDUA 2DURA 3WG2A 3WUDA 4YGEA 1S0CA 3JU9A 3ZPYA 5JOYA 3QLQA 2W39A 2NMOA 4ATEA 1UL9A 1MS8A 1UMZA 2WT0A 5E8AA 3NV4A 1N1YA 2JJ6A 3WCSA 2ZABA 3DGTA 2DV9A 2RHPA 2W68A 1W6QA 3M3EA 2PHFA 2KM2A 1DYPA 2VW1A 3AZWA 1ONAA 3FLPA 2WSVA 3POSA 4YGCA 3VKFC 2OW4A 2DU1A 1SBDA 1N1VA 5EYYA 1LESA 4Q8LA 4FPCA 4LBKA 1SLLA 2DTWA 2EF6A 3O0VA 2CWMA 5GALA 3NV3A 1IS4A 1ENSA 4K21A 2WQZC 2A7AA 3FBYA 4YW4A 1SLIA 4AVTA 1YO8A 1QNYA 1W6QB 2W08A 3B3QE 1QOTA 1W6OA 5T55A 3VKNA 4D69A 4BPZA 1AX0A 1FAYA 2ZHLA 4R9DA 1LHWA 5JMCA 3WG4A 3WHTA 2WLQA 1CONA 4LBNA 2R16A 2NN8A 4JRAA 4XBLA 3UK9A 3PVNA 5KXBA 2D3PA 1Q56A 5CB7A 4YW2A 1S0IA 5IK8A 1APNA 4FPFA 4AWDA 2EXJA 1SLTA 2EAKA 3B9CA 3OGGA 4XHBA 2AREA 1W6OB 4YZ4A 2ERFA 4AGGA 4YZ5A 1VAVA 1SBFA 4RL7A 3USUA 3POWA 4XJUA 4DS0A 2ZGTA 4XJZA 3A0NA 5E88A 1HQWA 3FLRA 1DQ0A 1W0PA 3RS6A 3AZVA 3T1MA 1BKZA 4OZXA 1IKPA 4FPHA 3Q9OA 1AJKA 2NZ9A 3USUB 1CPNA 1AF9A 5LK5A 3ZXFA 1GYKA 2PHXA 2AENA 3LSDA 4BQ1A 1RIRA 4Y26A 2YV8A 3PVOA 1Q8SA 4PF5A 2JD4A 3O12A 2NMNA 5H9PA 5GLVA 2GNDA 4XBNA 3AZZA 3B01A 2YZ4A 3ILFA 4BMBA 2ZMKA 3R05A 4XTMA 2A3WA 3TB0A 4YZ2A 2DUOA 1DGLA 1U0AA 4M3CE 4UW6A 1HQLA 1GKBA 4GALA 4XDQA 5DZGA 1JXNA 4Y20A 1KITA 2CY6A 1AVBA 1KRIA 1SLAA 3IM0A 3O0XA 1FNZA 3SH5A 3OJBA 1S0BA 2JE9A 3BTAA 2R1DA 1G7YA 1Q8OA 3A4UA 5SV8A 1GV9A 3V0AA 3C2UA 3R4SA 2YXSA 1NLSA 1X50A 2C9AA 4Y20B 3D6EA 2D3SA 2A3XA 1WLWA 3WV6A 1HKDA 1Z78A 2E51A 3MW3A 5JOXA 1WD4A 1JHNA 4Q8KA 2OUHA 1GNZA 3A0KA 1JW6A 1LODA 2LALA 3M1HA 3V0AB 4Z8BA 4YM2A 2P3KA 1W6PB 4FVVA 3GALA 1BJQA 2AYHA 3AP6A 4WV8A 4XOGA 3VUOA 1LECA 1D0HA 3OYWA 4FOVA 2ZGLA 4FOWA 1N3QA 2R0HA 4XIKA 2SLIA 1CVNA 1DHKB 4BM8A 5HCBA 3JUUA 3I8TA 2A6ZA 1A78A 3FFZA 4ZXKA 3ZXJA 1LCLA 1G8WA 1S0JA 1QMJA 1AXZA 1SFYA 2A75A 1AXYA 4AYUA 4DFSA 5BYNA 3AP4A 1J1TA 1G9FA 1BXHA 1Q8PA 3IPVB 2B7YA 4P9WA 2D6LX 3OYWB 4JC1A 1LULA 1LHUA 3ZXLA 1GNHA 1C57A 2NM1A 2ZHNA 5GLZA 1MS3A 2D6NA 2UWBA 1Y7BA 1PZ7A 1V6OA 4Q1RA 2VUAA 3SNMA 3UL2A 1N1TA 1SBEA 1BZWA 1AX1A 1OKQA 1LU2A 3DUIA 4XXPA 4U2AA 4RA0A 2ZA9A 5GZDA 3W58A 1KQRA 1VALA 2ZGMA 2GMEA 1LENA 1OQ1A 4NO4A 1QOSA 1MS4A 2WKKA 4ISRA 3V0BA 3NV2A 1ZM1A 4XTPA 4LBQD 2NP0A 5GZGA 1H30A 4YG6A 1UZYA 2DVFA 1WW6A 3W59A 5T5OA 4XE9A 3POYA 4YG3A 4Y22B 5EYXA 5FRAA 5CA6A 1DIWA 4H55A 1Q8VA 4PQ9A 2P3JA 1CN1A 3O0WA 2D6MA 1FX5A 2H0BA 2G4IA 3AYCA 5GM0A 5T5JA 3D5OA 4LBQA 1SCSA 1WUVA 3ZSKA 1FV2A 1GZCA 1CJPA 3V0BB 1JYCA 4YM1A 1LEMA 2PHRA 1UZZA 4ITCA 5GJ6A 1V6MA 3BOPA 3AK0A 1ENRA 2D6OX 1G9AA 1GBGA 1IKQA 1ULDA 2GDFA 3AJZA 4DPNA 3WCRA 2D43A 2ZKNA 1WW7A 2ZGNA 1WD3A 1DFQA 5HCAA 1G9CA 3BIWE 4LBQB 4YW1A 1Q8QA 1LTEA 1YI7A 2HYKA 1MVQA 3SITA 3ENRA 2DYCA 2EALA 1UKGA 5EWSA 3SH4A 2EXKA 2V5YA 1RINA 1AX2A 4Y1ZA 3N7KA 4R9BA 5GLTA 4M01A 5T50A 1ULCA 1DYKA 1O4ZA 3BODA 3D4KA 1HLCA 1QKQA 4FPKA 3WDVA 4PBOA 1R1ZA 2UURA 1MZ5A 1MACA 4XIOA 4YW5A 5KXEA 4YW3A 3INAA 4M3CA 4Y1VA 4Q1PA 1KDKA 4YM0A 2W52A 1F9KA 3AXEA 1D2SA 2DVAA 1CIWA 3ZSJA 2R1BA 2ENRA 1BQPA 4FQ4A 4PCRA 4M00A 3U4XA 3V65A 1N3PA 3PMEA 2D3RA 4BLIA 4Q26A 1DQ5A 4BLJA 4AGVA 4GKXA 4DRRA 1QDCA 4F83A 4M3CB 4P9XA 1VLNA 3MPPG
chains in the Genus database with same CATH superfamily
3ZYRA 4AEMA 2C4XA 3H1YA 4MXWB 4OFGA 5JZGB 3WSOA 3NL1A 2RR11 1REFA 1O3QA 3MUY1 4FP2A 3Q8AA 1COV2 4ARXA 4CU8A 4QX3A 1OD3A 3K4ZA 1CX1A 2IVIB 2VZSA 3K3OA 3OD0A 1YQ6A 1LOAA 4K9SA 5FXWA 4R9CA 2HWB1 3OF1A 3O1TA 1IQDC 4UFIA 3ZSLA 5IVJA 4BYYA 1JZ8A 1ZREA 3V64A 1ST8A 1RUNA 2ZGQA 4LORA 1QDOA 1ZRRA 2BOJA 4RSUA 1QJEA 2W95A 5D8AC 5DUUA 3T4VA 2ZBJA 2PHWA 3T2QA 2W9XA 3EBRA 3DF0A 3SEEA 1Y4WA 4OMCA 5IK7A 3NJXA 4WVVA 1YNAA 3VDCA 4CCOA 5BUVA 3S6PA 2ET1A 3KF5A 3WG3A 1DLLA 1H2NA 4O9GA 1WBLA 5C5UA 3CBNA 5DQ0A 2HWD2 3JB4C 1LHVA 3USSA 3H8XA 1LJ7A 3TRSB 3PHMA 5LEJA 3IPVA 4JKKA 4Q4X1 5LY2A 1HX6A 4KBBA 5FPZA 1PIV2 2PLV3 2VW0A 2VW2A 3L2HA 1WGPA 3KQRA 4BXFA 2GMMA 1WCSA 1AR62 2X5IB 1I9RA 4Q4W3 4YZ1A 2D5FA 3L2YA 4I2OA 4GA9A 1Y3TA 3IDAA 4B1LA 3DPRC 1PO22 5EXOA 4CCKA 1CGPA 1J59A 1PHMA 3MIDA 2JDKA 4NJ4A 4A6SA 4I0BA 4CEYC 1B35A 4UBHA 4IE6A 3SLIA 1W03A 1PZ8A 5C6CA 1QGLA 3KMHA 4KQ7A 1X8MA 1N47A 1V9U3 5A3LA 5K0UB 4CRQA 1G9DA 2FMDA 3AYDA 2ZAHA 1PVXA 2YPDA 3NJZA 4RQPC 1CAWA 2CWSA 1COV3 4XHXA 4FPOB 2YMZA 3SKVA 3ZVXA 1EP0A 2GNMA 1J3QA 4AFDA 3CZUA 3JD71 4RHV2 4WM7A 5T54A 2Y6GA 4OUEA 5T5PA 1XYNA 1RL3A 1S0EA 2Y64A 4LMFA 4XFFA 3U14A 4QXBA 1IGOA 1YIFA 1I5ZA 2BGCA 4AXOA 2E6VA 4ASKA 5C4WA 3VBOA 4CUAA 3NNLA 1H1MA 3AP5A 1FYUA 4RR3B 5IFPA 4CCDA 2IVJA 4A45A 5LB6A 2OVUA 2SBAA 1DGRN 2ZX4A 3VGIA 3H7YA 2OYZA 3T0AA 5FXVA 3PMSA 1JOBA 1PZ9A 4L2NA 4QHZA 2HEVF 3LPGA 5C8CA 4MGTA 2HWD3 1XQNA 1NOVA 2XGXA 4DQAA 1URXA 3OEBA 1BEV2 3NAPC 1NUKA 2B8MA 4WVMB 2DU0A 1HRV1 2CAUA 1PIV3 1QXPA 1W9TA 2C24A 3HMYA 2QE3A 3S7IA 5DZFA 2P1BA 2QQJA 1AR63 1RITA 2P4EA 3GBFA 2WZ8A 3RJ2X 5FXZA 2W1QA 4FI9A 5A32A 3AFKA 1PO23 5FP3A 1UU6A 4FFGA 5FO7B 3ILNA 5FYHA 5H9SA 4AOCA 3ZYHA 4I0WB 2GNTA 4QXCA 4XMIA 3U07A 5JZGC 5LRSA 5FPUA 4G9SB 1CPMA 1ENQA 3HNBM 1AXKA 2WNOA 3T2OA 3O1RA 2ZZJA 1RMU1 2E32A 2JX9A 4HOOA 4ZONA 3ZDVA 4XVHA 4QKNA 3K4DA 3WNXA 1WW5A 2AGSA 2VU9A 4DNYA 5CFDA 1TVGA 3MEPA 5A33B 4FAHA 3WDWA 2XMLA 1D2QA 2BGOA 1W6MA 4RHV3 4KWUA 2ZEYA 4BMEA 4GWMA 1UAIA 1FMD1 2UWCA 3I3BA 2D7FA 3C3VA 1TEIA 4B3NA 4XFAA 3VZMA 3U78A 3I3QA 3BPSA 4K8FA 2RS11 1FATA 2FD8A 2FCTA 1NCQB 1D4M1 2GN7A 4BB3A 2LS6A 1LHOA 2QQPA 3BKZA 5T5LA 1VBE1 1NQDA 2XR4A 4NMIA 1YJKA 2Y38A 4CSWA 2C1FA 2KR2A 4EWAA 5BNNB 5I8YA 1RUI2 3UJQA 3D82A 3WOGA 3HR9A 1QJX2 2J1VA 4LBJA 1OURA 4GMP1 1VBD1 4QX1A 4MVTA 3TEXA 4YVWA 4FPGA 5FMDA 3TN91 3VLBB 4L11A 5JSRA 1BEV3 4BIOA 4CZSA 1K45A 2X5IC 1U12A 2PXJA 3AYEA 5EJ3A 5JIUA 2A6YA 4FOQA 4YLZA 4OI4A 3I4IA 4C0HA 1RUF1 1YFUA 2JKBA 4FOYA 3S5QA 1RHI3 5LA9A 1M06G 2JDUA 3H42B 3W5NA 1PK6A 4LHLA 5JVVA 1PO11 4CP2A 3LA2A 3OBTA 5JLVA 2XBO1 5K0UC 4W6XA 5FR3A 3RVHA 2RS52 4LBMA 1OOPA 3BTYA 1CJDA 2AZ5A 1UY1A 4LK7A 1QJU1 3IAPA 4V2WA 4ZU7A 1NYWA 1V6NA 3U4SA 4AQ2A 5F37A 5IK5A 3N9OA 1MR5A 2VD7A 3AM2A 2ARCA 1A3KA 4Z2AA 1EYBA 1ND3B 1E5IA 2W46A 4LQRA 2B46X 4Q27A 4BE3A 4JCKA 1H9WA 4IQPA 3PJQA 3WG1A 4DXZA 2GN3A 1MEC2 2YC2A 1R091 4NWVA 5E89A 5C5TA 4RR3C 1YJLA 4IETA 1JOJA 2QNKA 1PMHX 3K51A 4PLMA 2J1TA 4ONUA 1M4WA 1UMHA 2P5BA 2VVDA 1WA6X 1AR92 2IFWA 4GULA 2VZOA 4Z1VA 4BDVB 4BQ3A 3H1WA 3MIFA 3PUSA 4NIIA 2RR12 2XVKA 3VBSA 4AR2A 4UFMA 2XDVA 1XNDA 3EYPA 1HDKA 1IG3A 2A6WA 1LOGA 1QY4A 5FV3A 3WG2A 3H8OA 5BXXA 1PGSA 2JIGA 1MS8A 5E8AA 5CISA 5HXVA 1ZNPA 4HVOA 2HWB2 1N1YA 3WCSA 3RZGA 2DV9A 2VBBA 2XKPA 4Q4Y1 1E57A 3SQOA 3RYPA 3IB3A 4DEVA 1DYPA 3VKFC 3ACFA 2WSVA 4L99A 5FPAA 2OW4A 1K5MB 4DZGA 1XOYA 2H0VA 2BBVA 1SBDA 1N1VA 4IDZA 2ZOEB 4GH4B 2F4PA 3U0ZA 2CWMA 4CEWA 4FTEA 5FO8B 1SQ4A 1ENSA 1W8OA 3K77A 1CAXB 2R042 4K21A 1W8UA 3LEIA 4AVTA 2Y6LA 2RS53 2WFF1 4IE7A 1W3XA 4LHKA 4ES8A 5APAA 1OVPA 1OLQA 2W08A 3B3QE 1QOTA 3ZKYA 3WP4A 1FAYA 4R9DA 3POFA 4XDPA 3WG4A 5FYTA 3ZSEA 3S30A 3UK9A 1IPJA 5KXBA 5ABJA 3LPFA 4Q4X2 1Q56A 1VMJA 4HXCA 1S0IA 3UKNA 3I97A 1ZBA1 2IFRA 4E2QA 2EXJA 4CVUA 5CKNA 4YZ5A 1RUJ1 2ERFA 1XNCA 1SBFA 3USUA 1NCQC 2ZEZA 4IE4A 4A2UA 3UNPA 2WA3A 2WR9A 1POQA 5E88A 4MHRA 1HQWA 2OXBA 3FLRA 3JXSA 1WWYA 1DQ0A 1RUE1 2IZWA 3H7JA 1AR93 2WNUB 4W8JA 1QIQA 4BISA 1IKPA 4Q0SA 4UF0B 4FPHA 1UIJA 3Q9OA 2ZEWA 4XFBA 4ZY9A 3SKJE 5BNNC 2RR13 2NZ9A 3RYKA 4D0QA 1CPNA 4NPRA 1AF9A 4BK5A 5LK5A 2PHXA 1GQHA 4BQ1A 4IV1A 4Y26A 3B02A 3CEWA 4RN5A 3GBGA 2JB4A 2DCZA 3O12A 3I7DA 3KV5A 1J3RA 2GNDA 5FZAA 4XBNA 3AZZA 3KT4A 4MZUA 2XPJA 2HWB3 2HBUA 2XXZA 1RGSA 3NSTA 4BMBA 3MLJA 3R05A 1WLTA 2EIDA 3BOWA 4AQSA 1SPPA 2JG8B 3OGSA 2C26A 1DGLA 2DUOA 5I0UA 4CXWA 4RGKA 2G1MA 5FY9A 3HNMA 2MHFA 1UOFA 1WCKA 1JXNA 4IUGA 2VMHA 4EN9B 2I74A 5C71A 4MXVA 3ZKUA 3O0XA 1OUSA 2R043 2G9GA 4PI0A 4Z07A 3OJBA 4S2DA 4H7LA 3OSDA 1WMFA 1G7YA 2R1DA 2WO3A 5A7QA 3KVAA 4A6OA 5CG8A 2ZTNA 2RDSA 3GJAA 3RYRA 3ZO0B 4QX2A 1ND3C 1US3A 1NLSA 3GGLA 4FO9A 1X50A 4TXWA 5D8AA 2VOTA 2UYAA 1OQEA 4HN0A 4Y20B 2D3SA 2WFPA 2FQPA 4LO5B 1ZZCA 1K12A 2JG9B 3WV6A 2X05A 1D4VB 2QUOA 3EO6A 1HRV2 3NKTA 2EIBA 4Q8KA 1UYPA 1NLQA 2VJXA 3SCFA 1JZ4A 2W94A 1ULOA 3H50A 3LOIA 4YM2A 1OSGA 3LWCA 1W6PB 2VQ0A 4FVVA 3SCGA 3U1XA 3MYXA 3GALA 2D97A 3B7MA 4PT6A 2B4KA 4WV8A 5FUIA 4URAA 3KB5A 5A3PA 2KXLA 2JXAA 3WD5A 4F8AA 4FXGB 5JXIA 1FI2A 2SLIA 4XQ4A 3VZOA 4AEDB 2Q8EA 4QDQA 1POV1 3IZOA 4XFGA 3FFZA 4N9IA 2ZZQA 3ZXJA 1G8WA 4JGYB 3GCXA 1RMU2 5FZEA 3DPRA 1S2EA 2J1RA 1NCRB 3M3IA 2XJSA 1WCDJ 1W04A 3EQEA 3MFAA 4NHXA 2JKXA 2FBEA 4NAOA 5A1LA 4CEYA 4AL9A 5JI9A 2B7YA 1RUG1 3OYWB 4QT6A 1GNHA 2RS33 1C57A 2NM1A 3BALA 2D6NA 5A7NA 1RC6A 5LA1A 1AR72 3SNMA 1K5MC 1N1TA 3RZKA 1BZWA 1LRHA 1J58A 1LU2A 2WZR1 5C3OA 2O14A 4GH4C 1KQRA 4LPLA 2RS12 4RQPA 1OQ1A 4HPKB 4Q29A 5FZ4A 1D4M2 3NNJA 4P9IA 2WKKA 3OPTA 4CDUB 1CZSA 4ISRA 5JMOA 4RFT0 3NV2A 1VBE2 4E4SA 2XLFA 4LBQD 5GZGA 1H30A 1OLMA 1WW6A 3KQ4B 5T5OA 5FP8A 4AFAA 3POYA 4YG3A 5FYMA 5DN2A 5FRAA 4KG8A 4Z82A 4FSJA 4GD4A 2HEWF 5KHJA 1CN1A 1FX5A 4KMQA 4HKOA 1VBD2 4IEOA 4QD2A 5T5JA 3D5OA 3TN92 1Z7S3 3OPWA 3LEMA 1GZCA 4OQ8A 4DUXA 2YBPA 1CJPA 1DYOA 4FXKB 4QWNA 2VGDA 2PHRA 4YM1A 1RUH1 2YBKA 4UOJA 3VB9A 4H7MA 4L92A 2PTMA 2D6OX 2WAAA 2V4VA 1GBGA 1ULDA 2GDFA 4DPNA 5A3UA 3WCRA 2D43A 2ZKNA 2B5HA 4P02B 5FY1A 2WS91 4LO4B 5LY1A 2X10A 1OKOA 2WNUC 1PO12 4IEZA 4AI9A 1AYN2 1LTEA 2ADDA 1MVQA 2WC2A 2XBO2 3NAPA 2JICA 4JGZC 1UKGA 3WNOA 2K2SA 3WW2A 4D6RA 1RINA 2FDJA 3E5XA 4EQVA 4EWDA 1QJU2 1HQNA 1QJY1 2ARAA 2XVGA 1ULCA 2VOKA 1OPMA 3G7DA 1HLCA 5HXMA 2N7GA 5C70A 2UURA 4YW5A 4DUWA 4OUSA 1H8TB 3WF2A 3WP5A 1XC6A 5FZOB 3Q8CA 1Q3EA 4QMAA 3BIEA 4MXWA 5JZGA 1UPIA 4NHYA 4P00B 3ZSJA 1AR81 1BQPA 1ZZ7A 2JG8C 1VMHA 5EV7A 3PNAA 4XC9A 1W8NA 1AR73 5FIXA 2AEZA 1N3PA 3PMEA 1R092 3IIIA 1GWKA 4LITA 3UGHA 2D3RA 2WWUA 4BLIA 3BUCA 4OVEA 2RS13 1HB2A 3B94A 4F83A 4M3CB 4FTSA 1O4TA 3RPQA 4Y1UA 1D4M3 2WWJA 3HD8B 1ULFA 4FFHA 1SCRA 1VBE3 2NLRA 1HRI1 2VOXA 3AP7A 3UJOA 1A6CA 3FUOA 4ORFA 4QPYA 3GBWA 4QPGC 5J1XA 4ZHNA 1BK0A 1W3VA 2DUQA 2OX0A 3EB7A 2JG9C 3TYJA 3WQ1A 5LCWL 4GMP3 1VBD3 2XJQA 4LHNA 4LO6B 3TN93 4HMZA 5C9AB 2CNAA 2Q1ZB 3Q8FA 3VKLA 3OBRA 3RG0A 4XF0A 5IVYA 3FUQA 3J8F1 4Q4Y2 2V73A 4D6SA 2R061 2XHNA 1R64A 2ZACA 4N43B 4IEWA 5L7OC 5I0RA 5FUPA 1FT9A 3AMNA 1V6IA 2Q4SA 4LNVA 1AYM1 1PNGA 2CTVA 2RDNA 4CUGA 5H9QA 4AEDC 1PO13 4A44A 1PMIA 2A6VA 1AYN3 4QU2A 4BK4A 3NWKA 4QXHA 1XPWA 4AI1A 2WQ8A 5KXCA 4PI2A 2ZMLA 3OG2A 4Y1YA 5DDJ1 1ZRCA 4CCMA 4JGYC 1IS6A 4IL7A 2XWJB 1NCRC 5FYZA 1QJU3 4BQ4A 4I3PA 1UYXA 2HWF2 5JUVA 4HONA 1UOJA 1BBT1 3GHNA 3NRUA 4JAAA 5FAXA 5IJRA 2OUJA 3HWJA 2Y60A 2CGNA 3BPZA 1VPHA 3I2IA 4UW3A 4E2GA 2Q5TA 1QH7A 3R4DB 5AFEA 1KEXA 2P6CA 3QACA 4CP9B 1IOAA 5K0UA 3TWIA 1VJ2A 2WO1A 3HQUA 5LBFA 1QJZA 1ZBA2 2ET7A 2RE9A 1H1AA 1RUJ2 3ES1A 2W0XA 4WZCA 5FZ9A 5IVCA 2FMYA 1R093 2ZXQA 2EVXA 1MZ6A 1T6GC 3KHBA 5KWRA 3WF1A 4WBBA 1JUIA 4URTA 4CDUC 2QBXA 2E53A 2RV9A 4OI2A 4XJWA 3AYAA 1H2LA 1HV0A 2YFUA 1RUE2 4I02A 4GJZA 4J1WA 2IXLA 1W06A 4Y22A 1W8FA 2YUEA 1KJLA 4BH9A 4E8CA 4LUKA 1PM4A 1DQ1A 2J1EA 4J1XA 1D7PM 1OHFA 1VBB3 2D44A 1FV3A 2WJSA 4KGQA 1FXZA 4IV3B 3ZYPA 4AI3A 4CPBA 3I3MA 2GNBA 3N35A 1I3HA 3ZXKA 2AR6A 5IHRA 1ZYBA 2R30A 3LD8A 2VQTA 3ZSMA 4FBFA 5CBLA 1EAH1 4YGBA 4EZHA 4Q4Y3 3PTYA 1X8EA 3VDDB 5LW9A 1W2OA 3M3OA 5EQUA 1JYVA 5H9RA 1C4RA 3LE0A 5EHDA 4K7JA 2EXHA 1DQ2A 3JQWA 1HB4A 1UOGA 2G9ZA 1N3OA 4WVMA 2RMU3 2ZX0A 3VZKA 4E9KA 4MV2A 1H9PA 3IWZA 1GQPA 4DIQA 2EIEA 3MW2A 1LGCA 4CCNA 4M3CF 1S1AA 1QQP1 3PJYA 3ABZA 1W6NB 2QQVA 1W28A 3RRDA 1ZVFA 2HWF3 3MLLA 4QDSA 1H8TC 3RGBA 4KWLA 1A8MA 5A6XA 3WW1A 1IPKA 1J3PA 4AEJA 4I01A 1DGRA 5FZBA 1YEWA 4R9AA 2W1WA 1BK1A 4PF1A 1MVEA 4DB5A 3AL5A 3CMGA 4QAWA 4XBQA 5JDBA 2VCBA 3F2ZA 1NE4A 3K3NA 1JZ2A 1ZBA3 2ZGKA 4NIGA 2ADEA 1RUJ3 1O5UA 1DZTA 4IEYA 5FZ3A 4D7YA 2BWCA 2K46A 2DBNA 1EUUA 3OGVA 3PUIA 1VBA1 4UAPA 2H6CA 4QPIB 5ANQA 5A33A 5DUXA 3HN1A 5FYVA 3S57A 2XB6C 3AC0A 3M4FA 4WM8A 1RUE3 1ZBE3 4ATFA 2ES3A 2AH2A 3ITQA 3T2TA 3WW3A 3OOXA 2UY9A 2GALA 2V09A 2GH8A 3FMGA 4AHYA 4E2SA 1V6LA 2Q0AA 4GB32 4JDMA 1XE0A 2PA7A 2W47A 3AKRA 4EN0A 3I2FA 3H3UA 1NCQA 4CXXA 2NYYA 3ETPA 1MQTA 3WQBA 1UX6A 5C9AC 1S2BA 1RUG2 1XBFA 5FZ0A 4AZZA 3ECQA 3CIHA 3T09A 3WF0A 4YW6A 1F5FA 3D8CA 3D3AA 5AVAA 1XU2A 3UKTA 1ZRIA 4N43C 5I8TA 3ACLA 3HBKA 1GWLA 2VNRA 2WZR2 2VZQA 4QM8A 5B4XA 3ZYGA 2W2IA 1FNYA 5F6LB 2RDRA 4Y5SA 1GUIA 5IW0A 4BOWA 1VIWB 1NY71 2CYFA 2J7MA 4TYSA 4YFWA 2VMGA 5D2AA 1NZIA 4NRPA 4OULA 4KG0A 5LBBA 3D0SA 2C5DA 4CE8A 3E97A 4EV0A 3WNLA 2BEOA 5IK4A 5FP7A 1QU0A 5CKMA 2D6PA 1LOFC 2Y6KA 5FY7A 4AHZA 3HOBA 4QU1A 1LHNA 1UOBA 2EIGA 3C7EA 4ASMB 5C7GA 3ZOIA 3VL9A 1CAUB 2Y33A 4RGGA 1W2NA 3WDXA 4RFRB 4CCCA 1OLRA 5KHHA 1DZQA 3AZXA 4SLIA 1RUH2 4F3JA 2YC0A 2WRAA 3N7LA 3FJSA 5DAWA 1VAMA 2ZGPA 4INDA 5JOWA 4IEPA 1I1EA 3OEAA 5KBFA 1ND3A 1OH3A 1JODA 3MIGA 5BNPB 5JPMB 5KR7A 3Q8EA 2PHDA 3ACGA 1GU3A 4KBZA 1R081 4NR1A 3DEMA 5A3MA 2Q30A 1YFYA 3OY8B 5ISLA 2JDZA 4N53C 1ULEA 1E5SA 1V00A 1QH6A 2WDBA 5FJHA 4N9HA 1CR7A 1LU1A 2WUHA 4AVCA 4O65A 3HT2A 1W99A 2BQPA 4IV3C 5FLHA 5I0DA 2EXIA 4GB33 1GICA 4YZ3A 2XL7A 3JCIA 2JWPA 4IE0A 3SISA 4D6QA 3PIGA 1AJOA 4IGPA 5D21A 2WT1A 4LIVA 3QH6A 2Z42A 3WUCA 2HWC1 4E8DA 1PGW2 3VZNA 4K1ZA 1TME1 4LA2A 3VDDC 3ZFEB 1WKYA 5B4NA 1AR82 2VE1A 3M3QA 5JR7B 3M7AA 5HI0A 3ZMOA 1C1LA 2OQ7A 3ZXDA 1JU4A 4XILA 4FPEA 3RI8A 2WZR3 4DY5A 1QNWA 1JYTA 3MW4A 4R4XA 3MICA 3QH7A 5I8SA 2ZX2A 2YDEA 1CQ9A 4LXLA 3B5LB 4BCUA 1FOD1 5F9TA 3VKOA 2JE7A 1HRI2 1R1A1 2P3YA 3CZJA 3SCHA 1XNBA 4NIAA 4LLOA 2OT7A 1K5MA 1JOPA 5DG1A 2DURA 3TNQA 3WDUA 3WUDA 3KLSA 3O1SA 5JOYA 4GH4A 2WNVB 4QGNA 5LBCA 5F1RA 2NMOA 2BGPA 3LGRA 4YPJA 4ATEA 1ODMA 1UL9A 1UMZA 1CAXA 2WT0A 3MF6A 3VBHB 3NJYA 4JKMA 4NHKA 4XF3A 2QTWB 3ETQA 2YGLA 3E5QA 2ZABA 1OXCA 1YQ2A 3OTFA 1ZX5A 2RHPA 4QB6A 2WO2A 2BRTA 4IGQA 4QHBA 4X6RB 3I2HA 2YPJA 4XCAA 5K8SA 1RUH3 4GAZA 3J8F2 5FK7A 1LKNA 1UD1A 1YLLA 1Y43B 3C8XA 5EYYA 3ZXAC 4Q8LA 1KFXL 4QPIC 5LASA 1SLLA 2DTWA 2EF6A 3FC0A 5A7OA 3RZJA 2Z69A 2JENA 1AYM2 1XU1A 5FMOS 5DMYA 4YW4A 3FFQA 3O1OA 5BNOC 4W4ZA 1PNFA 4COYA 1QNYA 2BWAA 1GP6A 1W6QB 1RJ7A 5DDJ2 5FZIA 1UIKA 4J6GA 5T55A 1UWWA 1AX0A 1UZ0A 3PUHA 1IG0A 3O1PA 1HXS1 2BNMA 2WLQA 3LQCA 5FZGA 4COUA 2NN8A 2D3PA 1OLME 2WNUA 5FYIA 1HN0A 3KT1A 2HWE1 4JGZA 5KC6A 1UQXA 3B9CA 3OGGA 2AREA 4YZ4A 3CJIA 2HJIA 3DV8A 1AR83 4BQXA 4RL7A 4LE4A 5B2GB 3ACIA 4XJUA 1CAVB 2QQLA 2ZGTA 3HAGA 1JHJA 3IDBB 3IAQA 4PIZA 4P9GA 3AZVA 3RFRA 1UY2A 2B9UA 3H3LA 4PHZA 2LM3A 4BJ0A 5FOJB 2VZTA 4LE3A 3AMMA 2JG8A 4LO8A 1O59A 3OBAA 2BDRA 3ZXFA 4B4RA 4GJYA 2AENA 3E6BA 3LSDA 3OUHA 1V70A 3PVOA 2YHJA 1I6XA 1W05A 3OB8A 1Q8SA 4META 4CUBA 5GLVA 5F3EA 1JYWA 1ODNA 2FDGA 2BOIA 3UV9A 5BNQA 1ZZ9A 5CADA 5LBEA 2ZMKA 1W9WA 3I2DA 4HSJA 5CVRA 4Z92B 5GKAC 1L3JA 3J8F3 4YZ2A 2CGPA 4QPGA 4BA6A 4XDQA 4UW6A 4OHWA 4GALA 3KSCA 1AL21 4KH9A 5BNPC 1WMXA 4Y20A 4AW7A 2CY6A 1O3TA 3DXTA 2ZKLA 3K46A 2JG9A 2RG4A 4PIYA 1AYM3 4BQYA 4NE9A 3SH5A 2GZWA 3U10A 3NJVA 2JE9A 5IVVA 4LK6A 5LZ6A 3PUQA 1DF0A 3KVBA 5DDJ3 1Q8OA 3KGLA 3A4UA 4HKLA 2VZUA 4XUQA 2QZ3A 3ZM8A 4XEZA 3R6SA 5L7OA 4UFKA 5CG9A 5EP9A 3B9IA 3OGJA 1WLWA 2VL4A 2E51A 4GZ9A 4UFLA 3ZFEC 3GJBA 2WN2A 2RM21 4A4AA 1GNZA 3A0KA 2LALA 3M1HA 4X6QB 3I49A 4Z8BA 4CU7A 3MPBA 4JGYA 1W9SA 4RS5B 4BIFA 5IVBA 3NNGA 1BJQA 3LA7A 4BHPA 3AP6A 5F7UA 4IEXA 3WF4A 3VD7A 1VBA2 3OYWA 3VHPA 4FOWA 1C5HA 1N3QA 1YHFA 4FCAA 5HCBA 2Z79A 3JUUA 4LUMA 3I8TA 5A7PA 1A78A 3WNPA 1L7RA 3GXUA 5A7WB 1S0JA 1QMJA 1QXRA 3WF3A 1AXZA 2A75A 1AXYA 5BYNA 2WNVC 3CQOA 1J1TA 4XFIA 1DDLA 1NLRA 3I54A 1TG7A 4X8NA 3VBHC 3IPVB 3WP6A 2QKDA 3NW4A 3FWEA 4JC1A 4MGIE 1LULA 1LHUA 4CDUA 2Z5WA 1F5JA 2ZHNA 3NNFA 3T08A 3W21A 2BNOA 5A1FA 4NROA 1V6OA 4Q1RA 3E6DA 1RUI3 1QXJA 4NAMA 3RDIA 5F32A 5FBZA 1AX1A 3DUIA 5FWJA 1QJX3 3FHQA 4U2AA 2IXCA 5FQ0B 2B45X 2GMEA 1B35B 1DZRA 3JBG1 4MHUA 4BXSV 1MS4A 1NY72 2VMDA 2O0OA 1XNAA 3AMHA 4O7XA 5A70A 1ZM1A 3ZN6B 3HN3A 1UZYA 2JDNA 4XE9A 4Y4RA 5CA6A 1CAWB 1SFPA 5FYCA 4H55A 4DINB 1Q8VA 1JZ5A 4AAXA 2DDUA 2H0BA 4MOAA 2YB7A 1X82A 3I2KA 5GM0A 3SEPA 4TLFA 5DAQA 1WUVA 3E1F1 1FV2A 5FYUA 1XNKA 3V0BB 4WM7B 4JRLA 1HJFA 3KCYA 4KWJA 5FLJA 1CWPA 5A7SA 4IEUA 3AK0A 5JCTA 1G9AA 4R8HA 3IDEA 4JVAA 3AJZA 3LEGA 5ANNA 3VN4A 2ZGNA 3VBOB 3HJRA 3VZJA 3LFMA 3BU0A 1DFQA 2Q8OA 1C8NA 2QQUA 4MADA 4P08A 1H8TA 2GU9A 4AAPA 1VB2A 1X7NA 1VBA3 3ENRA 1UYYA 1RUD1 2EXKA 1AX2A 1MEC3 1UY3A 4QQOA 2VOVA 1X9TA 1VRBA 5GLTA 2OIIA 2DCKA 2D93A 1O4ZA 3AMPA 3BODA 3D4KA 1QKQA 3WDVA 5C8CB 4PBOA 1R1ZA 5JSOA 1KS4A 1MACA 1H1IA 4TN7A 4M3CA 4AFBA 1ALYA 1KDKA 3AXEA 5JAXA 1CIWA 3HVDA 3WX5A 2HEYF 2R1BA 1SZBA 2HWC2 4XDOA 5FO9B 3T0BA 1TME2 3E6CC 1DQ5A 1XJAA 4CYDA 4GKXA 4C91A 4K40A 3JD72 4UXAA 1IZ3A 3BIWE 2BUKA 1SMVA 2VTXJ 3DECA 3M3EA 3MPPG 2K0GA 3AXDA 3SH3A 1SLBA 5C9AA 1DP0A 4IEQA 5GZEA 3AL6A 3WP3A 1FOD2 3QOPA 4YGDA 4M4RA 3W9AA 1R1A2 3MDPA 3ZLIA 3IT8A 4UW5A 4N43A 2R071 4CDWB 1KS5A 4BU2A 4B4PA 4XQDA 3HT1A 4I30A 3THDA 3AX4A 2HYXA 3I3DA 1BYHA 4M0HA 2ZGRA 5FZLA 1W6MB 1H2KA 1W2AX 3DKQA 1EY2A 3IKWA 4RS5C 1ENXA 1UU5A 1CD3G 1Q5OA 3GYDA 3VD3A 3W20A 5KHGA 4AVSA 1C3HA 4SBVA 4E27A 4Q4V1 5L36A 2WN3A 1JN2P 2J1UA 2VAUA 3OUIA 4UI9L 4Q4X3 2QFEA 3ORJA 3HBZA 1W0NA 1RUC1 4AFMA 4XFHA 4CP9A 4AG4A 3G6JB 1S4CA 2R49A 4QM9A 4XMAA 5JWPA 3A23A 4MYEA 2VZ3A 1F31A 1JYIA 5HV0A 1O5LA 2BYVE 5J37A 3JQXA 1AUYA 1S0GA 2CU5A 2Y6HA 3CNAA 4Y33A 1HXS2 4XUTA 5CEHA 2DWRA 2XG3A 3J7LA 1KGYA 4LKFA 3ZYFA 4LBOA 4IESA 1OT5A 2VTXA 3O14A 4K1YA 4COVA 2A5ZA 1ZZ6A 5CNAA 1U5ZA 2ORZA 2HWC3 3WEZA 4N90A 4A41A 1G9BA 4N53A 1SACA 1TME3 3N3HA 2DUPA 1B35C 1TMF1 3WXPA 2BU9A 4IV3A 2PLV1 2VZ1A 3JD73 1K3IA 2VZRA 4W6YA 1VB4A 2YU1A 5T52A 3B69A 1SHWB 1FMD2 3EHKA 2Q8DA 4CPBD 1T6BX 1H6XA 4Q0UA 5CYYA 5A6QA 2A6XA 5FPLA 1FOD3 1V6JA 3VL8A 2Y8KA 3VDDA 3WHUA 1R1A3 2OKXA 5GZCA 2P34A 2JECA 2ORXA 5F5QA 3WVJA 5A3NA 1ASJ1 4WM7C 4Y5TA 1V9U1 4Q2FA 1V6KA 3NMBA 1C5IA 1OD5A 2GSYA 2R0FA 4AFCA 1JZ7A 2XONA 4Q0VA 5J98B 1DQ6A 1VMFA 2Y0IA 1W6NA 4MX3A 2JEMA 4H14A 2ETEA 2VXRA 1AZDA 3WNNA 1AL22 5A3OA 4COWA 2GC3A 5FKCA 3LDRA 1T2XA 1HRV3 5F39A 4DMIA 3AJYA 4V1PA 2WBKA 4MG2A 4AK3A 2NQYA 2GP3A 4P9YA 4DY3A 1RUF2 3OPZA 2VBDA 4Y5Z0 4JX0A 3LAGA 5BPXA 3LF7A 4AHXA 5C8CC 4DRVA 1UX7A 1BHGA 3JB8A 3BI3A 4AEKA 3UYJA 3C7HA 2LUWA 3NKGA 1HXS3 3PIJA 1NA1B 1GP5A 1GFF2 4QPIA 2RJKA 4Y24A 4JZRA 2VECA 3ZXEA 1GP4A 2ZGOA 5GZFA 2QDNA 5BNOA 4FP3A 2P3IA 1WW4A 4NIHA 4UFHA 1RMU3 1WBFA 1F35A 4NOTA 5F3CA 1Z0HA 2YFZA 2VG9A 3PVEA 2O1QA 5FP4A 5F2SA 4LEJA 5I0TA 3PTRB 4PQQA 2R32A 4CEWB 1W2UA 1PIV1 5FCCA 4QQPA 4W65A 4CXYA 2YU2A 5CFCB 1FMD3 3LKJA 3ZFGB 4CP1A 3BTXA 2GC1A 1CIYA 2Y26A 3FX3A 3EXUA 4CDWC 3ZYJB 5IT6A 2VQAA 2J22A 1PGL1 1S55A 2XHKA 2B39A 1GZ9A 3ASIA 4S2FA 3DCQA 2JDMA 1YRZA 1O6UA 2RVAA 2J1SA 3VBFB 2PQQA 5L9VA 1LOBA 1VE0A 2WNEA 3POIA 1OUXA 1NAEA 1GANA 3MV01 5A6YA 1UXZA 4YYOA 5IVFA 1KDMA 1J1LA 4A7ZA 4JQRA 2XQRA 1Y9QA 1MS5A 3JBG2 3FE5A 5HCFA 2O8OA 3VZLA 4FTBA 1OA4A 5DAXA 2W92A 4XJ8A 4X8PA 2UU8A 1X9PA 2WAOA 5LK7B 5J36A 1RUF3 1UY4A 4OLLA 5DABA 3POGA 2GH2A 4D8MA 1MZFA 4NUBA 3A21A 4NPMA 5DUVA 3ZXGA 1G86A 2FDIA 1P8JA 4N8MA 4O61A 3RZHA 1LOEA 1CX4A 1NG0A 1YFXA 4C90A 2B42B 3TEZA 2XBO3 1C8M1 4YSFA 2FZ2A 2YROA 1RYYA 2WFF2 2X5IA 3P5BA 4PBPA 2PQSA 5JOZA 2GMPA 1DQ4A 4K8RB 3OY8A 3POBA 3ZYBA 2VCMA 3I2JA 3QD6A 3H8RA 3MI8A 1ND2B 5FY0A 1O3SA 3O1MA 2QQKA 1SPPB 2VM9A 2K9ZA 4K20A 4QPWA 3CL1A 1RUOA 1BEV1 4PJYA 2I45A 3RJRA 4MSVA 4OHZA 3T3YA 3BN6A 2P17A 3AMQA 4W6WA 4XABA 1O91A 1YI9A 2BPA2 5L73A 4EN6B 5EJ1B 1QF3A 3KZ4C 1GZWB 1RHI1 4FFIA 4FFFA 2A71A 2E9QA 1CESA 2QQNA 1RB8G 4LKDA 2YYOA 4P9LA 3NVCA 1XRUA 2ZGUA 3J7HA 1K42A 3VKMA 3WZ1A 5EPAA 4BQWA 3KM5A 4OMDA 3HQRA 1S2KA 4DOUA 1OPOA 1UPSA 1NXD1 2VVFA 2ZMNA 4RR3A 3GCWA 4LBLA 1TNFA 4QQLA 4XPVA 4A3ZA 4C8DA 3AVRA 1WLDA 2DVBA 3FBMA 4L97A 2WNVA 5FZCA 1S0DA 5F3IA 3VBHA 3ELNA 3JBG3 1GQGA 1G6NA 1UN1A 5FLIA 3T4HB 1W2TA 1WCUA 3ATGA 4K6BA 1YYNA 2XJVA 2PMWB 5AVPA 1HJGA 5GLWA 4DXRA 3R4UA 4XZPA 3APBA 4QHOA 1NA1C 4EN7B 4YGEA 3JU9A 4ET7A 2W39A 4CEYB 5HCHA 4CDQB 3NV4A 4Q5OA 2WFF3 1UKRA 2JJ6A 3K2OA 5FMOL 2W68A 3LB9A 2XLGA 1W6QA 2FDHA 2PHFA 3JZVA 2VW1A 3FLPA 1WMDA 4O9EA 3POSA 3LDKA 5FYBA 1YCIA 2X09A 2DFCA 2DU1A 2F6BA 4PLOA 4I0AA 1OMIA 4NPLA 2GP5A 2YGMA 4FPCA 4LBKA 3PDQA 4Q4V2 4CEWC 4RGAA 5GALA 3UESA 3NV3A 1IS4A 5IAVA 2JDAA 1IQAA 2A7AA 1W39A 2WQZC 4H2AA 1RUC2 2BP6A 3ZFGC 5CFCC 4CCLA 3T2PA 2QQMA 2QJVA 1YQ8A 3VKNA 4D69A 4BPZA 4C0BA 4CDXB 1W8TA 2ZHLA 4OI1A 1LHWA 4LKEA 4XZUG 3WHTA 1CONA 3VBUB 4JRAA 4XBLA 3PVNA 2BFUS 4CUCA 3VBFC 1UMIA 3H8UA 3KD4A 3MIHA 4YW2A 5CB7A 1EV11 3MV11 5IK8A 2V5DA 1APNA 3N9QA 4QQHA 4AWDA 5CZKA 1SLTA 2EAKA 4XHBA 4HSLA 1W6OB 4EROA 2GC2A 2JIJA 2EAAA 1WMEA 1YQCA 5DAPA 4A7YA 2JDYA 4XJZA 4JDOA 1TMF2 4YVSB 3ZDSA 4CU9A 2FDKA 1QEXA 2IXKA 3FHIB 5CIRA 2HLEA 2KA3A 3RS6A 2PLV2 4B7KA 3H3ZA 4LKSA 3MLKA 4I09A 5FXXA 3T1MA 2LROA 4OZXA 2F17A 4B29A 5BNNA 1RVF1 1UO9A 4ES9A 1H0BA 4JHZA 4S2GA 3MHZA 4AVAA 2VUCA 3T30A 4HN1A 4W50A 4OZOA 1YIPA 2E7AA 4EWEA 3H1MA 1RIRA 5IYYA 2YV8A 4NIDA 4PF5A 2JD4A 4GWIA 1AR91 5H9PA 1ASJ2 5IATA 1BMV1 3AFGA 1V9U2 2DBIA 1ND2C 3CLPA 1XSRA 1ACCA 4XTMA 3TB0A 2F4LA 1ZA7A 4XUNA 5E1RA 4IW3A 4AI8A 1JZ6A 1U0AA 3P1IA 1OH4A 1OFNA 4M3CE 1HQLA 3LFIA 1WA4A 4Q4V3 1FPN1 1KITA 2BZDA 1AVBA 1OC1A 1KRIA 2BTVC 2BBAA 2CHHA 5JXJA 1FNZA 1RUC3 4J25A 4EN8B 1S0BA 2IWGB 4AI2A 2A73B 3MUZ1 3UL2A 3O1UA 1XYPA 1HB1A 1SDWA 5SV8A 2VVEA 5JPNB 3CDZB 5EJZB 4RS5A 1E5HA 3PL0A 5EIYB 1IPSA 2WS92 2YXSA 2WZPP 2OPWA 1XE7A 3D6EA 2A3XA 1YWKA 2R041 1HKDA 2PHLA 2E26A 2J42A 2VQUA 3MW3A 4UYBA 1WD4A 3DKWA 1JHNA 2JDHA 5D1IA 3THCA 3MZHA 4BWOA 1JW6A 1LODA 1POV3 2VMIA 5BV6A 1QJY2 2WLPA 3V0AB 4A7KA 2P3KA 5A7WA 4CA9A 1JMUB 4XUOA 5F6KA 3M70A 4Q0QA 1JZ3A 2OZJA 2VOWA 2VCAA 3IBMA 3URFA 1CZVA 4XOGA 1TMF3 3LZZA 2ILMA 2LW8A 1RUG3 5FTTC 3VUOA 1D0HA 1NE6A 4FOVA 2ZGLA 1H4GA 1CZTA 1K5JA 4XIKA 1CVNA 1DHKB 4GMP0 3C7OA 4MGZE 5FZ6A 3UETA 4BM8A 3W5MA 3LOBA 2A6ZA 2XJTA 2Q8CA 4ZXKA 1LCLA 4L0PA 3S7EA 2J1AA 4DFSA 3AP4A 4ZZ8A 1PGL2 5FQ0A 5J09A 1G9FA 1BXHA 1Q8PA 4P9WA 2D6LX 4MH0E 4CDQC 3ZXLA 4QX0A 1C28A 5LRRA 1ASJ3 1NQJA 3NQHA 1MS3A 2IXIA 4QB2A 2UWBA 3THPA 5A3WA 3AKSA 2X8KA 5FPVA 3ZN6A 1JYXA 1PZ7A 1VP6A 4QB1A 5C3QA 1SBEA 2ID4A 3VD5A 3W58A 1VALA 3FN9A 3KS7A 2ZEXA 5F5AA 4OHYA 1LENA 3WQ7A 5I0SA 1UZVA 5EZWA 2VO5A 4P9JA 2VC9A 1XNTA 4LOTA 2RS31 1GOGA 3LDBA 3V0BA 3KT7A 3VHNA 3UT0A 2NP0A 2P6HA 2DVFA 4CDXC 4ZS2A 1AHSA 2VNVA 2R062 4Y22B 2W5FA 5FFOC 3VBUC 4LR4A 2P3JA 2XL9A 2WS93 5FWEA 3AYCA 2Q1MA 1SCSA 3ZSKA 1C8M2 1J83A 2BV4A 1RXGA 2KD7A 3ST7A 1U5XA 4AI0A 4ITCA 3OBZA 5AFBA 3CF6E 1V6MA 5GJ6A 2BERA 4PDWB 1QJY3 4ZXEA 3N4MA 1BBT2 4MO3M 4YVSC 1OQDA 1WD3A 2MEV1 5HCAA 1VBC1 1G9CA 4QXKA 4LBQB 4D3WA 1Z7S1 4LO7A 5F5IA 4YW1A 1PX4A 1YI7A 2HYKA 3OUJA 1ULPA 3SITA 2DYCA 2EALA 4XETA 4GIQA 2R6QA 2V5YA 4UF0A 4WVZA 1GMMA 4Y1ZA 4P5YA 3N7KA 2QQIA 1UY0A 4R9BA 2XJRA 3KWVA 1O3RA 5SV5A 1ZRFA 5AC91 1DYKA 1RHI2 3C7FA 3PVBB 2D40A 1REDA 1MZ5A 4XIOA 5BY5A 3INAA 4Y1VA 4YM0A 3T0DA 3ZFFB 4E4ZA 1ZZ8A 2OZ6A 1TNRA 2W1UA 5FUNA 3AKQA 1XSQA 1HRI3 2ENRA 1I5PA 4FAGA 3U4XA 5FKBA 4LIUA 4DXSA 3WT3A 4ASLA 3WQ0A 3U75A 4Q26A 4CDWA 1QWRA 2PFWA 4LA3A 4BLJA 3ACHA 3DYPA 1RXFA 1LR5A 2DVDA 2ATFA 2PN5A 2G9FA 2ARBA 4AHWA 4ZU5A 2C9KA 3IMNA 1UU4A 3M3CA 4WM8B 4D7TA 1EAH2 1NZCA 1X36A 4ZPIA 5K9YA 2QVSB 1AR71 1UCXA 2DF7A 2P2KA 3I3EA 4M0NA 3ZR5A 4AGRA 2R063 3I59B 1L7LA 4KNCA 4TSVA 4AE2A 3VBRB 5KXDA 2XJPA 4U36A 2B9VA 3P3NA 1MQTB 5C3RA 2LTNA 3N36A 2CGOA 1PVC1 1C8M3 4B8EA 3GM8A 4XFCA 3BU7A 4YFZA 1IHMA 5C33A 1W6PA 1QQP2 4E4HA 5FY5A 3WDYA 3T1LA 5DUWA 1BBT3 4C1WA 4JTNA 1GLHA 5GLUA 1OF4A 5T3NA 4FPJA 5J7MA 4Y4YA 4AEDA 5EFUA 5JIAA 2Y34A 4QGLA 2VMCA 3FLTA 3GDBA 4YNIA 5FREA 2R7EB 1F8VA 1GZTA 2AUYA 2ZX1A 3KCCA 4WVWA 5HBAA 5FZDA 4L9BA 1NCRA 2PYTA 3B00A 2VZPA 3ZIXA 1H2MA 4R4ZA 5FY8A 1B09A 4C1XA 5FZMA 5IFTA 1DG6A 1AYN1 5E16A 1LEDA 4HANA 4XF1A 4ZKTB 1EV12 4B7EA 2A70A 2NPIA 3A22A 1F4HA 2XVLA 3SXWA 5LWBA 3SHRA 4XCBA 2HBTA 4QDRA 2DTYA 4HPKA 3WLUA 1US2A 2A3YA 1TQ5A 3DYMA 1OI6A 1PM7A 3QBQA 4ZU4A 2UWAA 1ZRDA 1A8DA 1ULGA 3ILRA 4NN0A 3J26N 5CAZA 1REEA 4XXAA 1EAH3 3LIHA 3AZYA 1SDDB 4FT8A 4R52A 1RVF2 1OA3A 1O8PA 1XYOA 2XLAA 4QX8A 3BB6A 3A7QA 3RMYA 4RD7A 5TSWA 4DO0A 4IERA 1LGBA 3LSEA 5KHIA 3S5AA 3GHMA 3KCXA 4K3UA 3UGGA 1DCSA 4LT5A 3S0MA 2XUEA 4XYXA 1JTZX 1EPZA 1BMV2 2ARXA 4PDWC 2FDFA 4CTEA 3R0RA 3HQXA 2ZHKA 2BVBA 3HEIA 4N7IA 2O8QA 1EPWA 1QQP3 3NV1A 2VH9A 1OFSA 2VNGA 1VBB1 3DXUA 3UKVA 2VTFA 1XB9A 4AVBA 1POV0 5ACA1 1Q43A 2XWBB 5IWFA 1NA1A 1KXGA 5KC5A 1FPN2 2VUDA 4OQ9A 2CL2A 3ZX7A 2ZCWA 4QX7A 4BZ4A 1NX9A 4GKYA 4IE5A 1E5RA 2V72A 4HVRA 4TWTA 4D7SA 1GOHA 5G04L 3IMMA 5C4WB 4NRMA 3J9SA 4COZA 4NHLA 5FZOA 3ZFFC 4UW4A 4NHMA 4HFSA 2RMU1 3TAYA 4H3WA 1KFUL 2FCVA 1IS5A 1YQ5A 2WIIB 1R082 4P14A 3WDTA 1V0AA 1EV13 5IUQA 5CFCA 4OCTA 3ZFGA 1LGNA 4ARYA 3RSJA 2E7TA 3H0OA 4EYUA 1HW5A 4ISQA 2DCJA 4XF9A 2V4AA 2ZHMA 2HWF1 4HLTA 4AVVA 3GNEA 2MNGA 2RJ2A 2ZX3A 2YY1A 3CHXA 4GXLA 4PLNA 4QKBA 4QKFA 3ZMNA 4GWJA 1F2NA 1UZWA 1H8VA 4Y1XA 5K4LA 4JKLA 1GSLA 4WM8C 3VBFA 3RZZA 3ZN5A 1AL0G 2WO7A 1QOOA 4EJRA 1F4AA 4HVQA 4XJ9A 5A32B 4TTGA 3RZMA 3VBRC 4XW3A 1RVF3 3N9NA 1YUDA 1ZA4A 2P37A 3MBWA 2I07B 1MQTC 3MFCA 4G4FA 1N1SA 4V2VA 3VHRA 4Z2WA 1KJRA 2D6KA 1LNSA 1HIXA 5FZHA 5FZ8A 1YXWA 1ZBE1 2FHRA 5G05L 1VRH1 4RYDA 1RTVA 5FZFA 3WNKA 4CP0A 3EJKA 4JGZB 4OYUA 5DAVA 5ERLA 3QCWA 4FPYA 3K48A 4B4QA 1SLCA 3OGRA 3CJIB 1BLZA 3I2OA 4CCJA 1HN1A 5CFDB 2HKXA 3N7JA 1ZZBA 2H6BA 3N7MA 1TZOA 4HG6B 5CU1A 3RMXA 4LLFA 4HT1T 1FPN3 5F3GA 3X29B 2RS32 3PU8A 3MIBA 1DBNA 4TZDA 3VV1A 2TEPA 5DG2A 3OD4A 4WZFA 2XKOA 3B93A 3RWNA 1ND2A 4HKWA 4E4DX 1LOFA 1IS3A 4GQ7A 1MS9A 3PUAA 4KWKA 2DCYA 1H6YA 1OA2A 2WSUA 3ES4A 2PAMA 3O7OA 3UGFA 3KF3A 3K75B 2Q1FA 2X53S 5LA2A 1R083 2G19A 4DUVA 3POEA 3AP9A 2IC1A 3RI9A 3O1VA 2WT2A 4UBGA 3E5UA 1MS1A 1GZWA 5FDBA 2OQ6A 3M2MA 2PHUA 4HL0A 4YVWB 1LOCA 4QPGB 1W0OA 2MEV2 4MGKE 1VBC2 2AC1A 4D94A 3HPNA 4YG0A 1Z7S2 1OBNA 3IN9A 5A1AA 4OHXA 2HWE2 4FPLA 1O8SA 4XACA 2TBVA 3N9PA 4I3GA 2I2SA 5IVEA 3RZLA 1SG3A 1PK6B 1JU3A 3KV4A 4MLOA 1JS9A 4XAAA 4BQ2A 3C7GA 5AC92 1WLCA 4XJAA 2BVVA 2ZAAA 1JI6A 3N9MA 4UWDA 3MO4A 1JBCA 2QDRA 5DZEA 5L7OB 1QHDA 1C1FA 1OOPB 2PELA 4Q4W1 1VR3A 3P6BA 3BCWA 4L8QA 4LOSA 4TLGA 3O5SA 3AKTA 3BYWA 4HZFA 2DVGA 3NNMA 4GWNA 1U5YA 2WYFA 3BGAA 2ZGSA 2VMFA 4GB31 5DXDA 2PHTA 2IUWA 3VHOA 4YM3A 2XOMA 3RQ0A 1OVSA 1MPXA 5I91A 4JQTA 4JTOA 4FQZA 2W3JA 4CDQA 4AQTA 5FMBA 1O4YA 2VY0A 1COV1 3LCPA 4KU7A 3VBOC 3ZR6A 1QJFA 5C4WC 2E7QA 1MS0A 1S0FA 2WABA 5C3PA 1KD7A 2CDPA 1GNYA 2UYBA 4OUMA 2L9LA 1S0CA 3U11A 4KI5M 1BVP1 3ZPYA 3QLQA 3SMHA 3IIAA 2HH9A 2C0ZA 3LEKA 2VR4A 2IXJA 3U37A 3TOJA 1PVC2 3DGTA 2Z4FA 3VBSB 5JXGA 2A1XA 2KM2A 3AZWA 3DYOA 1ONAA 4XURA 4YGCA 3HNYM 4CDXA 2UY8A 4LULA 3TNPB 4YWAA 2VXJA 1LESA 3GZTB 5HPOA 3OCPA 3VBUA 1WCQA 2XQXA 3O0VA 4YARA 3VDAA 4B1MA 2MEV3 1VBC3 2BFUL 2OS2A 3FBYA 3CKHA 1SLIA 2EA7A 2D5HA 1YO8A 2XUMA 3ON7A 5FK8A 2RM22 3I2GA 4HETA 2HWE3 1W6OA 2HWD1 5L9RA 5JMCA 5L19A 2DFBA 2WQ4A 3CJXA 4LBNA 2PAEA 1J84A 2R16A 3EMRA 4XAEA 3WINE 2TNFA 4YVSA 5AC93 2VCCA 4MUVA 5F5CA 5KHKA 3BTZA 3PLQA 1AR61 4FPFA 5A3TA 3GZEA 4PIXA 3ME2A 3M8LA 4BQ5A 4ZZ5A 1PO21 1RJ8A 3CJIC 4AGGA 4DEQA 2FCUA 1VAVA 2XH6A 3POJA 5FZ7A 4IGOA 3DL3A 2ZS6B 3POWA 4S2HA 2YC4A 4DXTA 5CFDC 4XUPA 2RJLA 4DS0A 4XQWA 2LRPA 3A0NA 3P3PA 5ABJB 5JR2A 3L9JT 5J96B 1W0PA 2OA2A 2ZPXA 5FZ1A 1BKZA 4KU8A 4QX5A 1PGW1 1AJKA 4MGYE 3Q8BA 1F15A 4QGMA 2WWSA 3USUB 1GWMA 5C8WA 3LA3A 1XXNA 1GYKA 2D98A 2WA4A 1AL23 1SEFA 4RHV1 5HV4A 5FY4A 5K7PA 4IXLA 2NMNA 1CAUA 2CV6A 2RDQA 3B01A 4JDNA 2YZ4A 3J7NA 3TEYA 3ZPOA 5J3UA 3RWKX 1PVC3 3ILFA 4HBNA 1XE8A 1W8ZA 2ZJCA 2A3WA 1UNBA 2IXHA 4NVPA 2AEYA 1NT0A 2YBSA 3GF6A 4YVWC 5C3SA 5FMCA 5M0TA 3KHCA 1GKBA 4JHTA 4IV1B 5DZGA 3IDCB 1VBB2 5ACA2 2JDPA 5BNPA 4A42A 3AVSA 4YW7A 1SLAA 3IM0A 3PU3A 3PURA 3THTA 4KGGA 2CAVA 3KV9A 3KGZA 1NKGA 3FL7A 2RM23 2Y6JA 3BTAA 4YRDA 1PMJX 1DGWA 4CCEA 1H4HA 1PK6C 1DLCA 1GV9A 3FZ3A 3V0AA 3C2UA 1W9YA 2Y0OA 3R4SA 5FOBB 1BVVA 3H9AA 5JSPA 3ZYIB 2C9AA 2XJUA 3AKPA 4N7UA 4LHSA 3AB0A 1OOPC 4NWWA 1Z78A 2E63A 2VMEA 4UT5A 1NXMA 2RMU2 4LJHA 1RUD2 3WY6A 5FYSA 5JOXA 1HV1A 3ALQA 3ROUA 5CKQA 3HIFA 3ZFEA 2VNOA 2OUHA 2AACA 1OF3A 2QCSB 4MGSA 5JXHA 1O7FA 2JD9A 1W90A 4NRQA 5D8AB 2AYHA 4A3XA 4KL1A 1LECA 2E33A 1U5IA 2CDOA 3CU7A 2R0HA 4XF4A 5FPXA 1A34A 2TUNA 1L7QA 4P5HA 1Y9GA 3J4UH 3K4AA 1LB2A 5F2WA 4OI0A 1Y9MA 1W8HA 4ZS3A 3WW4A 4EE2A 1SFYA 4EZ4A 4AYUA 4AQ6A 2EICA 2OPKA 4QQ2A 4Q0PA 4UFJA 4AF9A 4MGQA 5GLZA 2VPVA 5LEKA 3VBSC 1ZBE2 3KV6A 5I93A 5FBJA 1VRH2 1Y7BA 1W8WA 5J48A 5FPBA 2QQOA 2VUAA 1OKQA 4XXPA 4Y3OA 3DPRB 5GZDA 3MGUA 1UF2C 2ZA9A 2BJSA 4N53B 2R072 4RA0A 5L9BA 2ZGMA 2VULA 1UW8A 3NO8A 4NO4A 2GC0A 3F95A 1QOSA 2C6SA 5ACA3 2JB8A 5DPNA 3GZUC 1SFNA 1W9FA 1HB3A 1MZEA 1JYNA 4QKDA 4XTPA 2VBPA 5JI7A 4HK9A 4YG6A 3SC7X 1EUTA 3WNMA 1RUI1 3W59A 1UXXX 2Y6FA 1VAKA 1WZXA 4PDWA 1QJX1 5EYXA 1D0GA 1DIWA 4RQPB 2BW8A 2QZ2A 4PQ9A 5LA0A 3O0WA 2W87A 2D6MA 3WR0A 2G4IA 2WYSA 4LBQA 2GAUA 1YFWA 1JH5A 2W1SA 1JYCA 5E6HA 1LEMA 1RUD3 1UZZA 2PAKA 2Z2SB 1DGWX 1X33A 3BOPA 3VDBA 1ENRA 3RNSA 5FP9A 1TE1B 4JV4A 3CO2A 1IKQA 1DU3D 1CAVA 2VUJA 4G3YC 3V56A 5ABJC 1WW7A 3ZIWA 4CU6A 2QQWA 1PX3A 2FZ1A 2RS51 1Q8QA 3ZFFA 2JE8A 2X29A 3MF9A 5IAXA 5EWSA 3SH4A 3LIGA 3N9LA 2CSGA 2W91A 2WZEA 3VD4A 1JUHA 3J7MA 5LATA 4M01A 3TBDA 5T50A 1STMA 1YC61 2WINB 2VZVA 4FPKA 2E31A 4IEVA 5FYYA 5FZKA 4LTAA 5FJKA 5A80A 5KXEA 1GOFA 4YW3A 5F8PA 4Q1PA 4F7ZA 3NAPB 2W52A 3BVCA 1F9KA 4OHVA 1D2SA 2DVAA 4Q4W2 3VD9A 2MPFA 2WL1A 1MEC1 3TEWA 4FQ4A 4PCRA 1VRH3 4M00A 5A6ZA 5BNOB 3V65A 3I59A 4HK8A 1BCXA 2YG0A 3MIEA 3D0JA 2BNNA 4IV1C 3VBRA 2R073 3DN7A 1UYZA 4AGVA 1LAJA 3FHAA 4DRRA 1QDCA 1GR3A 2DCTA 3ZN4A 4M4PA 3GZAA 4P9XA 1VLNA
chains in the Genus database with same CATH topology
3ZYRA 4AEMA 4MXWB 3H1YA 4OFGA 5JZGB 3NL1A 2RR11 1REFA 1O3QA 4FP2A 1COV2 3OD0A 1LOAA 4K9SA 4R9CA 2HWB1 3OF1A 1ZREA 3ZSLA 4BYYA 3V64A 1RUNA 2ZGQA 1QDOA 1ZRRA 4RSUA 5D8AC 5DUUA 2ZBJA 2PHWA 3EBRA 3DF0A 5IK7A 4WVVA 1YNAA 5BUVA 3S6PA 2ET1A 3WG3A 1DLLA 1H2NA 4O9GA 1WBLA 2HWD2 3JB4C 1LHVA 3USSA 1LJ7A 3TRSB 3PHMA 5LEJA 3IPVA 4Q4X1 1HX6A 4KBBA 5FPZA 1PIV2 2PLV3 2VW0A 2VW2A 3L2HA 1WGPA 3KQRA 2GMMA 1WCSA 1AR62 2X5IB 1I9RA 4Q4W3 4YZ1A 2D5FA 3L2YA 4I2OA 4GA9A 1Y3TA 3DPRC 1PO22 5EXOA 1CGPA 1J59A 1PHMA 3MIDA 4CEYC 4I0BA 1B35A 4UBHA 3SLIA 1PZ8A 5C6CA 1QGLA 3KMHA 4KQ7A 1X8MA 1N47A 1V9U3 5A3LA 5K0UB 4CRQA 1G9DA 2FMDA 3AYDA 2ZAHA 1PVXA 3NJZA 4RQPC 1CAWA 2CWSA 1COV3 4XHXA 4FPOB 2YMZA 3ZVXA 1EP0A 2GNMA 1J3QA 4AFDA 3JD71 4RHV2 4WM7A 5T54A 5T5PA 1XYNA 1RL3A 1S0EA 4XFFA 1IGOA 1YIFA 1I5ZA 2BGCA 4AXOA 2E6VA 5C4WA 3VBOA 1H1MA 3AP5A 1FYUA 4RR3B 2OVUA 2SBAA 1DGRN 2ZX4A 3VGIA 3H7YA 2OYZA 3PMSA 1PZ9A 4L2NA 2HEVF 5C8CA 2HWD3 1XQNA 1NOVA 2XGXA 4DQAA 1URXA 1BEV2 3NAPC 2B8MA 4WVMB 1HRV1 2CAUA 1QXPA 1PIV3 2DU0A 3HMYA 2QE3A 3S7IA 5DZFA 1AR63 1RITA 3GBFA 3RJ2X 5A32A 3AFKA 1PO23 1UU6A 5FO7B 3ILNA 5H9SA 4I0WB 2GNTA 4XMIA 3U07A 5JZGC 5LRSA 4G9SB 1CPMA 1ENQA 1AXKA 2ZZJA 1RMU1 2JX9A 3WNXA 1WW5A 2AGSA 2VU9A 4DNYA 5CFDA 3MEPA 5A33B 4FAHA 3WDWA 1D2QA 1W6MA 4RHV3 4BMEA 4GWMA 1UAIA 1FMD1 2UWCA 2D7FA 3C3VA 1TEIA 4B3NA 4XFAA 3VZMA 4K8FA 2RS11 1FATA 1NCQB 1D4M1 2GN7A 1LHOA 2QQPA 5T5LA 1VBE1 1NQDA 1YJKA 2Y38A 2C1FA 4EWAA 5I8YA 5BNNB 1RUI2 3UJQA 3D82A 3WOGA 3HR9A 1QJX2 4LBJA 4GMP1 1VBD1 3VLBB 4MVTA 4YVWA 4FPGA 3TN91 4L11A 5JSRA 1BEV3 4BIOA 4CZSA 2X5IC 1U12A 5EJ3A 3AYEA 5JIUA 2A6YA 4FOQA 4YLZA 4OI4A 3I4IA 4C0HA 1RUF1 1YFUA 2JKBA 4FOYA 1RHI3 1M06G 1PK6A 4LHLA 5JVVA 1PO11 4CP2A 3LA2A 3OBTA 5JLVA 2XBO1 5K0UC 4W6XA 2RS52 4LBMA 1OOPA 1CJDA 2AZ5A 4ZU7A 1QJU1 1NYWA 1V6NA 4AQ2A 5IK5A 1MR5A 3AM2A 1A3KA 1EYBA 1ND3B 2B46X 4Q27A 4BE3A 4JCKA 1H9WA 4IQPA 3PJQA 3WG1A 4DXZA 2GN3A 1MEC2 1R091 4NWVA 5E89A 4RR3C 1YJLA 4IETA 1JOJA 2QNKA 4PLMA 3K51A 4ONUA 1M4WA 2VVDA 1AR92 2IFWA 4GULA 4Z1VA 3H1WA 3MIFA 2RR12 2XVKA 3VBSA 1XNDA 1HDKA 2A6WA 1LOGA 1QY4A 3WG2A 5BXXA 1PGSA 1MS8A 5E8AA 5HXVA 1ZNPA 4HVOA 2HWB2 1N1YA 3WCSA 2DV9A 2XKPA 4Q4Y1 1E57A 3RYPA 1DYPA 3VKFC 2WSVA 4L99A 2OW4A 1K5MB 4DZGA 2BBVA 2H0VA 1SBDA 1N1VA 2ZOEB 4GH4B 2F4PA 3U0ZA 2CWMA 4CEWA 4FTEA 5FO8B 1SQ4A 1ENSA 1CAXB 2R042 4K21A 4AVTA 2RS53 2WFF1 4LHKA 4ES8A 1OLQA 2W08A 3B3QE 1QOTA 3WP4A 1FAYA 4R9DA 3WG4A 3ZSEA 3S30A 3UK9A 1IPJA 5KXBA 5ABJA 4Q4X2 1Q56A 1S0IA 3UKNA 1ZBA1 2IFRA 4E2QA 2EXJA 4YZ5A 1RUJ1 2ERFA 1XNCA 1SBFA 3USUA 1NCQC 4A2UA 2WA3A 5E88A 1HQWA 3FLRA 1DQ0A 1RUE1 2IZWA 3H7JA 1AR93 2WNUB 1IKPA 4Q0SA 4XFBA 4FPHA 1UIJA 3Q9OA 5BNNC 2RR13 2NZ9A 3RYKA 1CPNA 4NPRA 1AF9A 5LK5A 2PHXA 1GQHA 4BQ1A 4IV1A 4Y26A 3B02A 3CEWA 3GBGA 2DCZA 3O12A 3I7DA 1J3RA 2GNDA 4XBNA 3AZZA 3KT4A 4MZUA 2XPJA 2HWB3 1RGSA 3NSTA 4BMBA 3MLJA 3R05A 1WLTA 3BOWA 4AQSA 2JG8B 2DUOA 1DGLA 5I0UA 2MHFA 1WCKA 1JXNA 2VMHA 4EN9B 2I74A 4MXVA 3O0XA 2R043 2G9GA 4Z07A 3OJBA 4S2DA 4H7LA 1WMFA 1G7YA 2R1DA 5CG8A 2ZTNA 3RYRA 3ZO0B 1ND3C 1NLSA 4FO9A 1X50A 5D8AA 2UYAA 1OQEA 4HN0A 4Y20B 2D3SA 2WFPA 2FQPA 4LO5B 1ZZCA 2JG9B 3WV6A 1D4VB 2QUOA 3EO6A 1HRV2 3NKTA 4Q8KA 3SCFA 3H50A 3LOIA 4YM2A 1OSGA 3LWCA 1W6PB 2VQ0A 4FVVA 3SCGA 3MYXA 3GALA 2D97A 3B7MA 4WV8A 3KB5A 2KXLA 2JXAA 3WD5A 4F8AA 4FXGB 1FI2A 2SLIA 4XQ4A 3VZOA 4AEDB 1POV1 4XFGA 3FFZA 4N9IA 2ZZQA 3ZXJA 1G8WA 4JGYB 1RMU2 3DPRA 1NCRB 3M3IA 2XJSA 1WCDJ 3EQEA 3MFAA 2FBEA 4CEYA 5JI9A 2B7YA 1RUG1 3OYWB 4QT6A 1GNHA 2RS33 1C57A 2NM1A 3BALA 2D6NA 1RC6A 1AR72 3SNMA 1K5MC 1N1TA 1BZWA 1LRHA 1J58A 1LU2A 2WZR1 4GH4C 1KQRA 4RQPA 2RS12 1OQ1A 4HPKB 4Q29A 1D4M2 4P9IA 2WKKA 4CDUB 4ISRA 4RFT0 3NV2A 1VBE2 4E4SA 2XLFA 4LBQD 5GZGA 1H30A 1WW6A 4AFAA 5T5OA 3POYA 4YG3A 5FRAA 4KG8A 4Z82A 4FSJA 2HEWF 5KHJA 1CN1A 1FX5A 4HKOA 1VBD2 4IEOA 4QD2A 5T5JA 3D5OA 3TN92 1Z7S3 1GZCA 4FXKB 1CJPA 4YM1A 2VGDA 2PHRA 1RUH1 4H7MA 4L92A 2PTMA 2D6OX 1GBGA 1ULDA 2GDFA 4DPNA 3WCRA 2D43A 2ZKNA 2B5HA 2WS91 4LO4B 2WNUC 1PO12 4IEZA 1AYN2 2XBO2 1LTEA 2WC2A 1MVQA 3NAPA 4JGZC 2JICA 1UKGA 2K2SA 3WW2A 1RINA 3E5XA 4EWDA 1QJU2 1HQNA 1QJY1 2XVGA 1ULCA 2VOKA 1OPMA 3G7DA 1HLCA 2N7GA 2UURA 4YW5A 4OUSA 1H8TB 3WP5A 1Q3EA 4QMAA 4MXWA 5JZGA 1UPIA 3ZSJA 1AR81 1BQPA 1ZZ7A 2JG8C 5EV7A 3PNAA 1AR73 1N3PA 3PMEA 1R092 2D3RA 4BLIA 4OVEA 2RS13 3B94A 4F83A 4M3CB 4FTSA 1O4TA 3RPQA 4Y1UA 1D4M3 3HD8B 1ULFA 1SCRA 1VBE3 2NLRA 1HRI1 2VOXA 3AP7A 3UJOA 1A6CA 3FUOA 4ORFA 4QPYA 3GBWA 4QPGC 2DUQA 2JG9C 3TYJA 3WQ1A 4GMP3 1VBD3 2XJQA 4LHNA 4LO6B 3TN93 4HMZA 5C9AB 2CNAA 2Q1ZB 3VKLA 3OBRA 3RG0A 4XF0A 3FUQA 3J8F1 4Q4Y2 2V73A 2R061 2ZACA 4N43B 4IEWA 5L7OC 5I0RA 1FT9A 3AMNA 1V6IA 2Q4SA 4LNVA 1AYM1 1PNGA 2CTVA 5H9QA 4AEDC 1PO13 1PMIA 2A6VA 1AYN3 4QU2A 3NWKA 5KXCA 4AI1A 5DDJ1 2ZMLA 4Y1YA 1ZRCA 4JGYC 1IS6A 4IL7A 2XWJB 1NCRC 1QJU3 4I3PA 2HWF2 5FAXA 1BBT1 3GHNA 4JAAA 2OUJA 3HWJA 2CGNA 3BPZA 4UW3A 4E2GA 2Q5TA 1QH7A 3R4DB 5AFEA 3QACA 1IOAA 5K0UA 3TWIA 1VJ2A 1QJZA 1ZBA2 2ET7A 2RE9A 1H1AA 1RUJ2 3ES1A 2W0XA 4WZCA 2FMYA 1R093 2EVXA 1MZ6A 1T6GC 5KWRA 4WBBA 1JUIA 4URTA 4CDUC 2E53A 4OI2A 4XJWA 3AYAA 1H2LA 1HV0A 1RUE2 4I02A 4J1WA 2IXLA 4Y22A 2YUEA 1KJLA 4BH9A 4LUKA 1DQ1A 4J1XA 1OHFA 1VBB3 4KGQA 2D44A 1FV3A 2WJSA 3ZYPA 1FXZA 4IV3B 4AI3A 2GNBA 3N35A 1I3HA 3ZXKA 2AR6A 1ZYBA 2R30A 5CBLA 3ZSMA 4FBFA 1EAH1 4YGBA 4Q4Y3 3PTYA 1X8EA 3VDDB 3M3OA 5H9RA 1C4RA 4K7JA 2EXHA 1DQ2A 3JQWA 1N3OA 4WVMA 2RMU3 2ZX0A 3VZKA 4E9KA 4MV2A 1H9PA 3IWZA 3MW2A 1LGCA 4M3CF 1S1AA 1QQP1 3PJYA 1W6NB 3RRDA 1ZVFA 2HWF3 3MLLA 1H8TC 4KWLA 1A8MA 3WW1A 1IPKA 1J3PA 4AEJA 4I01A 1DGRA 4R9AA 1BK1A 1MVEA 4DB5A 5JDBA 4XBQA 1NE4A 1ZBA3 2ZGKA 1RUJ3 1O5UA 1DZTA 4IEYA 4D7YA 2BWCA 1VBA1 2H6CA 4QPIB 5A33A 5DUXA 3HN1A 2XB6C 3M4FA 4WM8A 1RUE3 1ZBE3 4ATFA 2ES3A 2AH2A 3T2TA 3WW3A 2UY9A 2GALA 2V09A 2GH8A 3FMGA 4AHYA 4E2SA 1V6LA 2Q0AA 4GB32 4JDMA 2PA7A 3AKRA 4EN0A 3H3UA 1NCQA 2NYYA 1MQTA 1UX6A 5C9AC 1S2BA 1RUG2 3ECQA 1F5FA 3D8CA 5AVAA 1XU2A 3UKTA 5I8TA 4N43C 3ACLA 2VNRA 2WZR2 4QM8A 3ZYGA 5F6LB 1FNYA 1VIWB 1NY71 2CYFA 4TYSA 4YFWA 2VMGA 4OULA 4KG0A 3D0SA 2C5DA 3E97A 4EV0A 2BEOA 5IK4A 1QU0A 2D6PA 1LOFC 4AHZA 1LHNA 2EIGA 4ASMB 3VL9A 1CAUB 4RGGA 3WDXA 1OLRA 5KHHA 1DZQA 3AZXA 4SLIA 1RUH2 4F3JA 2YC0A 3N7LA 3FJSA 1VAMA 2ZGPA 4INDA 5JOWA 4IEPA 1I1EA 5KBFA 1ND3A 3MIGA 5BNPB 5JPMB 4NR1A 2PHDA 1R081 5A3MA 2Q30A 1YFYA 3OY8B 2JDZA 4N53C 1ULEA 1V00A 1QH6A 4N9HA 1CR7A 1LU1A 4AVCA 3HT2A 2BQPA 4IV3C 5FLHA 2EXIA 4GB33 1GICA 4YZ3A 2XL7A 3JCIA 3SISA 1AJOA 2WT1A 3QH6A 2Z42A 3WUCA 2HWC1 1PGW2 3VZNA 4K1ZA 1TME1 4LA2A 3VDDC 3ZFEB 1AR82 3M3QA 5JR7B 3M7AA 5HI0A 3ZMOA 1C1LA 3ZXDA 4XILA 4FPEA 3RI8A 2WZR3 4DY5A 1QNWA 3MW4A 4R4XA 3MICA 3QH7A 5I8SA 2ZX2A 2YDEA 1CQ9A 3B5LB 4BCUA 1FOD1 5F9TA 3VKOA 2JE7A 1HRI2 1R1A1 3SCHA 1XNBA 4LLOA 1K5MA 5DG1A 3WDUA 2DURA 3TNQA 3WUDA 3KLSA 5JOYA 4GH4A 2WNVB 4QGNA 5F1RA 2NMOA 3LGRA 4ATEA 1UL9A 1UMZA 2WT0A 1CAXA 3MF6A 3VBHB 4NHKA 4XF3A 3ETQA 2YGLA 3E5QA 2ZABA 3OTFA 1ZX5A 2RHPA 4X6RB 4QHBA 2YPJA 5K8SA 1RUH3 3J8F2 1LKNA 1UD1A 1YLLA 1Y43B 5EYYA 3ZXAC 4Q8LA 1KFXL 4QPIC 1SLLA 2DTWA 2EF6A 3FC0A 2Z69A 2JENA 1AYM2 1XU1A 5FMOS 4YW4A 3FFQA 5BNOC 1PNFA 4COYA 1QNYA 2BWAA 1W6QB 5DDJ2 1RJ7A 1UIKA 4J6GA 5T55A 1AX0A 1HXS1 2BNMA 2WLQA 4COUA 2NN8A 2D3PA 2WNUA 3KT1A 4JGZA 2HWE1 5KC6A 3OGGA 3B9CA 2AREA 4YZ4A 3CJIA 2HJIA 3DV8A 1AR83 4RL7A 4LE4A 5B2GB 4XJUA 1CAVB 2ZGTA 3HAGA 3IDBB 4PIZA 4P9GA 3AZVA 2B9UA 2LM3A 5FOJB 4LE3A 3AMMA 2JG8A 4LO8A 3ZXFA 4B4RA 2AENA 3E6BA 3LSDA 1V70A 3PVOA 2YHJA 1I6XA 4META 1Q8SA 5GLVA 3UV9A 5BNQA 1ZZ9A 5CADA 2ZMKA 3I2DA 4HSJA 5CVRA 4Z92B 5GKAC 1L3JA 3J8F3 4YZ2A 2CGPA 4QPGA 4BA6A 4XDQA 4UW6A 4OHWA 4GALA 3KSCA 1AL21 4KH9A 5BNPC 4Y20A 4AW7A 1O3TA 2CY6A 2ZKLA 2JG9A 4PIYA