1QMJA

Cg-16, a homodimeric agglutinin from chicken liver
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
132
structure length
132
Chain Sequence
QGLVVTQLDVQPGECVKVKGKILSDAKGFSVNVGKDSSTLMLHFNPRFDCHGDVNTVVCNSKEDGTWGEEDRKADFPFQQGDKVEICISFDAAEVKVKVPEVEFEFPNRLGMEKIQYLAVEGDFKVKAIKFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-GALACTOSIDE-BINDING LECTIN
publication title The 2.15 A Crystal Structure of Cg-16, the Developmentally Regulated Homodimeric Chicken Galectin
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 28
structure length 132
sequence length 132
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1qmjA00
1GKBA 2PHTA 4JRAA 4GKXA 4XTMA 2GNDA 4Q27A 3N36A 2WKKA 2PHFA 3Q9OA 4Q8KA 2SBAA 4YGBA 1URXA 1OFSA 2EXJA 1V6IA 3ZVXA 1GZ9A 2OUHA 1W6MB 2DV9A 2YV8A 3AZYA 2WQZC 2GDFA 2AGSA 2ZGTA 5T52A 2D3SA 1Q8VA 3OPZA 3MW2A 4ITCA 3USUA 2DTYA 2DVFA 3SH4A 1FV3A 1WUVA 1C1LA 3OJBA 4W65A 4Y1XA 4YM0A 3APBA 3WDWA 2HYKA 1MS8A 2P2KA 1GYKA 5GALA 4UW4A 4K1YA 2GNBA 3NV2A 4XHXA 3C2UA 1JXNA 3ENRA 1LEMA 1HLCA 2ZHNA 1UL9A 3VUOA 4BMBA 1IS5A 3AJZA 4GA9A 3AK0A 4XXAA 5GLVA 1IS3A 1S0JA 4D69A 1H9WA 3TAYA 3FUQA 5HCAA 1QMJA 2CWMA 4LBOA 1GNZA 4YZ5A 4YGDA 3DGTA 2D44A 2VW0A 5JMCA 1F31A 1DFQA 1N1SA 2DVGA 3RS6A 1WW4A 1LHVA 3R4SA 5DUXA 1AX0A 2P3JA 3N7LA 2BQPA 1IS4A 1W6PB 3UL2A 5JOXA 2DVAA 4H55A 2AUYA 3OYWA 4K21A 1LECA 2W52A 1FYUA 1S0EA 1Q8OA 1DHKB 4WZFA 1SCRA 1SLBA 2WT0A 1Q56A 4Y26A 1LHOA 2W08A 4DFSA 2WSVA 5IK4A 3B9CA 4NO4A 4LBQB 2LTNA 4BLJA 1JN2P 4LBKA 1KJRA 2P3KA 2JKBA 1SFYA 5L73A 2Q5TA 2YXSA 4Q2FA 4UW3A 5E8AA 3V0AB 1AJOA 1DQ2A 1N47A 2EXIA 2ZACA 1NXD1 5GLWA 3HR9A 4FPYA 1KJLA 4YW1A 5H9QA 2PELA 2EXKA 3SISA 4YW5A 5BYNA 2WT2A 1AVBA 1BZWA 3R05A 1DYPA 4K1ZA 5EXOA 2JDZA 4M00A 3IKWA 1JW6A 2ENRA 1WLDA 4OZXA 5F5QA 1LU1A 2DUOA 3BIWE 5JVVA 2UWAA 3NV3A 2ZGRA 3AXDA 2GN3A 2A6WA 3MPPG 3T2TA 4AVSA 3MW3A 2ZGQA 4TYSA 2ZGSA 3KM5A 4YM2A 2D43A 3WG1A 2VUAA 2ES3A 2ZGPA 4FP2A 4YG3A 1MVEA 2ZBJA 1OQ1A 1W0PA 5H9PA 1LU2A 4RL7A 4JCKA 1H9PA 2WT1A 5F9TA 1V6NA 5IT6A 1QKQA 5DUUA 1S0FA 4HL0A 2VY0A 2A5ZA 4YGEA 4PQ9A 3OBTA 5GZDA 4ATEA 1QU0A 4BQ1A 4FOYA 4PCRA 4Y1UA 2DU1A 3JUUA 4LBLA 4XILA 3WHTA 1W6NB 3QCWA 5JOYA 2TEPA 2WNEA 3M3EA 1KDKA 4PBOA 1V6OA 4FQ4A 3W58A 4P9XA 1WW7A 1CJPA 3PJQA 2ZGKA 1N3OA 2P34A 2DVBA 1UKGA 1HDKA 5GZCA 1WBLA 1FNYA 4GWMA 2D3RA 1FAYA 5GJ6A 5GLZA 1HQLA 1J1TA 1GSLA 1LGBA 1QOOA 3WG3A 4YM1A 3O0WA 3WG2A 2DURA 4XJZA 3AP7A 1D0HA 1S0IA 1G9DA 3FLRA 1QDOA 4AVTA 5HCBA 2A71A 2CTVA 1LTEA 2DVDA 3NWKA 4FQZA 4Y24A 2EXHA 4AGVA 5JLVA 2D6MA 3A4UA 3WVJA 1W0OA 5LK5A 3WUCA 5T54A 1RIRA 4FPLA 3VKLA 3QLQA 1R1ZA 2EF6A 2XG3A 5IK5A 1GLHA 1CPMA 4K20A 4P9WA 5E89A 2DUPA 1DQ1A 4P9YA 1LOAA 1DIWA 1LEDA 1W6MA 4FVVA 4XJ8A 2OVUA 5DUWA 4XMIA 3SLIA 1IS6A 1S0GA 1MACA 2GMEA 1MVQA 2E51A 2VU9A 2NZ9A 2A3XA 3FLPA 3V0BB 5KXEA 1LHWA 1ULFA 1ZA4A 1PZ9A 2NM1A 3AP6A 4DQAA 4XJUA 4YG6A 5KXBA 1S0DA 2ERFA 4ZXKA 5JDBA 3WDYA 1MS0A 4M3CE 5JOWA 2R49A 1A8DA 3RMXA 2JE9A 4R9AA 5JOZA 1MS9A 1WD3A 1YRZA 2JECA 3N7JA 4YLZA 5DXDA 1N1YA 2ARXA 3N35A 3RMYA 3WDUA 4CTEA 2A6VA 2CYFA 2H0BA 1AF9A 3HN1A 2AENA 2E7QA 3AP9A 5DZEA 1QOSA 3D4KA 5CBLA 2ZA9A 3AYAA 2ZZJA 1ENSA 2VW1A 1WW6A 1O4ZA 1CIWA 3WLUA 4AGRA 5GLUA 5DG1A 1UMZA 3WDXA 1KITA 3POWA 3ZXLA 4Y20B 1LOBA 2UWCA 2CY6A 4Y22B 4ZKTB 2E6VA 4XOGA 4Q26A 4YFWA 2ZHKA 1G9FA 1N1TA 3M3OA 4GXLA 1W6PA 3WNXA 1YIFA 5CAZA 2P3IA 1LGCA 2UWBA 3V65A 1MZ6A 5EWSA 4BOWA 2E7TA 1C1FA 2UU8A 3NV1A 3PMEA 1ULCA 1G8WA 3AXEA 3AJYA 3WCSA 1Q8SA 1CN1A 1BXHA 3D6EA 4CZSA 2ZKNA 1Z0HA 3OY8B 3AYDA 1MS5A 3UJOA 4P14A 4PF5A 4LBQA 5T5OA 1LHUA 2ARBA 1JHNA 3A0KA 3ZSJA 4BLIA 1GZWB 3V0AA 1PZ8A 4XBLA 1DGLA 1DZQA 2R1DA 2CL2A 4GWNA 2PHXA 4F83A 1SLTA 2D6NA 1C57A 1IKQA 3ILRA 4Z8BA 3INAA 3ILFA 1I3HA 2P37A 2W39A 3LSDA 4M01A 4YW3A 1KRIA 1O4YA 1SLCA 3HMYA 3PVOA 1SLLA 5EYXA 2V5YA 3WG4A 1JYCA 2R1BA 1AX1A 4FPGA 4YZ2A 3BOPA 1LOCA 3IPVB 4YZ4A 3IMNA 2SLIA 2B7YA 4XJWA 1UAIA 2YROA 3AFKA 3JU9A 4IQPA 4NOTA 4XYXA 5IK8A 4Y1YA 1YYNA 1LOEA 1MS1A 1AXYA 3ZSLA 4UW5A 2JD4A 3N7KA 3W59A 1SBDA 2KM2A 2YZ4A 3WV6A 4FPHA 2VW2A 1OKQA 4FPEA 3FBYA 3ASIA 1GANA 4XHBA 2A6XA 1BKZA 5T5LA 1VALA 2DYCA 1LOGA 4LBJA 4XBQA 4XJAA 1W6NA 3VKOA 1QNYA 2VH9A 1W6QB 1ONAA 4YW2A 4FPKA 1IKPA 3N3HA 4I30A 1WLCA 4SLIA 1LCLA 2YMZA 1LHNA 2NYYA 1LOFA 3T1LA 1Q8PA 4FOQA 4CRQA 1YI7A 1HKDA 3NV4A 4FP3A 3VKNA 3AZXA 5IUQA 3AZVA 5H9SA 2ZMNA 3M3CA 3DUIA 3M3QA 3VV1A 1QNWA 3CNAA 3PVNA 3UK9A 2PHRA 3VKFC 2A70A 1CESA 4C1WA 4YM3A 1TEIA 2WJSA 2ZHLA 1RINA 2CNAA 2PHWA 5CA6A 5GLTA 2UURA 1B09A 1MS4A 1LGNA 4L8QA 1QGLA 1V6KA 2EAKA 1AXZA 3ZXEA 1CVNA 3M1HA 3MEPA 3WCRA 4LBNA 3ZXKA 1UN1A 1S1AA 5DG2A 3RG0A 3AYCA 4PBPA 4KBBA 2A75A 3V0BA 1H30A 4M3CB 1G7YA 1QOTA 5T5JA 4RA0A 1A3KA 2DWRA 4R9BA 5GM0A 3SH5A 2NP0A 1GV9A 1LENA 1GBGA 1S0CA 1V6LA 2CWSA 3M2MA 3ILNA 5H9RA 3D5OA 4ISRA 1SBEA 3POSA 3FFZA 1DYKA 1Z78A 3B69A 1ULEA 1W6OB 4U36A 1BQPA 5EYYA 1LODA 5AVAA 4AYUA 1LULA 2ZGUA 2JE7A 3B00A 4FPOB 1AXKA 2AR6A 2D6KA 4UW6A 1WD4A 5CNAA 2DTWA 4Y20A 1DQ6A 2ZMLA 1N3QA 1DQ0A 4JC1A 2R0HA 3AX4A 4Y22A 1BJQA 3SNMA 2D7FA 1SACA 2ZAAA 3O5SA 1ENRA 5FREA 3U4XA 5IK7A 5GZFA 5KXDA 1XQNA 3USUB 4HANA 3IM0A 2ZGMA 4XIOA 2D6PA 2WLQA 3ZYPA 2R0FA 3AP4A 1SBFA 2GNMA 3GNEA 3LSEA 4ASMB 5GZGA 1F9KA 5GZEA 4Y1ZA 1UZZA 1SLAA 2GALA 2OW4A 1APNA 1U0AA 1S0BA 3O0VA 3OY8A 3WZ1A 3FUOA 5KXCA 3RQ0A 3FLTA 3O12A 4MYEA 2AREA 1ENQA 4C1XA 1JUIA 1MZ5A 1WCSA 3BTAA 2G4IA 3H0OA 4GALA 3WDVA 2D6OX 2A6YA 3WHUA 1MS3A 4YZ1A 2XB6C 4XMAA 1GZWA 1CR7A 5SV8A 2ZABA 3O0XA 4YGCA 1FV2A 3I4IA 3OGGA 1UZYA 1G9CA 1WW5A 2D6LX 2DU0A 2ZHMA 2V73A 1JOJA 2FHRA 5DZFA 1EPWA 4WVWA 1UPSA 3L2YA 3A0NA 2OUJA 1FATA 3VKMA 2NMNA 1HQWA 3ZPYA 1QF3A 2ZGOA 1Y7BA 2AYHA 3OYWB 1G9AA 1WBFA 5DUVA 1N3PA 3IPVA 1LESA 3AYEA 1JBCA 2ZGNA 2EALA 2LALA 4DS0A 1FNZA 4FOWA 3B01A 3BODA 4YG0A 1VLNA 4XBNA 1AX2A 4XJ9A 1YXWA 5E88A 1LOFC 1VIWB 1CQ9A 4BM8A 1QDCA 3IN9A 3OBRA 2R16A 5CB7A 3SITA 1CONA 1BYHA 3B3QE 4R9CA 4LBMA 1VAMA 3WDTA 2AH2A 3WUDA 4DRRA 3MW4A 3LCPA 1AZDA 3SH3A 2GMMA 3AZWA 1WLWA 4R9DA 3ZXJA 1RITA 5T50A 4XTPA 2Z42A 2GNTA 1GICA 4AGGA 2JJ6A 1JYIA 1W6QA 4FPFA 1DBNA 4LBQD 2VXRA 4U2AA 1V6MA 3I8TA 1KQRA 5T5PA 3GALA 3KQRA 3ZXFA 1PZ7A 1C4RA 4XDQA 4Q8LA 4ISQA 2DUQA 2A6ZA 1SCSA 2GN7A 2RHPA 2EIGA 3AZZA 4ATFA 1NLSA 2WSUA 2PHUA 4FPCA 4GKYA 2GMPA 1ULGA 2NN8A 1KDMA 1N1VA 1Q8QA 2A3YA 2NMOA 4FOVA 3RSJA 3TB0A 3ATGA 1DQ5A 1GNHA 1AJKA 1LJ7A 2A7AA 1DQ4A 2YY1A 1V00A 4YFZA 4TZDA 2ZGLA 4XZPA 3R4UA 3V64A 4WVVA 4Y1VA 3AP5A 4AWDA 3ZSKA 2D3PA 4Q1PA 3RRDA 1A78A 2C9AA 1FX5A 1VAVA 1DLLA 4M3CF 3WOGA 2FMDA 2C5DA 1ZM1A 3POYA 4FPJA 4YW4A 5HCFA 4AVVA 1IOAA 1D2SA 4YZ3A 5T55A 1G9BA 1YO8A 4XXPA 1CPNA 3UJQA 2E53A 4M3CA 4Q1RA 4WV8A 3ZSMA 4BMEA 2W68A 4XE9A 1GZCA 5DZGA 4DRVA 1ULDA 3ZYRA 1V6JA 1X50A 3N7MA 1G86A 4XIKA 2A3WA 5FRAA 3PVEA 3T1MA 1UX6A 1I1EA 1F5FA 1SLIA 1W6OA 4DPNA 2I2SA 2ZMKA 1MR5A 4BPZA
chains in the Genus database with same CATH superfamily
2PHTA 4I0WB 4AI9A 2VMDA 2QJVA 3N36A 1XNKA 1OUSA 3BOWA 3OTFA 4ZY9A 3PTRB 3ZYFA 3LAGA 2PHFA 2JE8A 3AMPA 2Q1MA 4XFCA 1V6IA 2XWBB 3AZYA 2DV9A 1NLRA 4XF0A 2JDMA 2D3SA 1DZRA 3OPZA 1MEC2 3MICA 5L7OB 3IAPA 2G9FA 2DTYA 2BGCA 1X9TA 1WUVA 2QKDA 2W0XA 4Q29A 3SKJE 3WDWA 4YM0A 1RUF2 3DYPA 3M7AA 3BTZA 3VBHB 4JKLA 1GYKA 4RR3C 1PK6B 1SQ4A 2X5IC 5DABA 3ACHA 1OBNA 3NV2A 4K1YA 4QQOA 3C2UA 4FFFA 1IG3A 1GOHA 1RYYA 2ZHNA 3AJZA 4GA9A 2WWSA 1MQTB 4OLLA 4XXAA 5A7QA 3ZFFB 1YQ6A 4IEVA 4LE3A 1S0JA 2WWUA 4K8RB 4UWDA 2WN2A 1QMJA 5F5AA 3R0RA 4AZZA 5APAA 1QQP3 5DAWA 5AFEA 2RM23 4NRQA 2FDHA 4OHWA 3H3ZA 3ZR5A 1F31A 4FXKB 2DVGA 3AL6A 1ENXA 2EICA 2B5HA 5IJRA 1OQEA 2HWC1 4BQ2A 3UL2A 5HBAA 2WNVC 2DVAA 3SQOA 1H6YA 2K0GA 3ZN6A 4D7TA 4QGMA 3HJRA 3QACA 1DHKB 4EZ4A 1REEA 2VZ1A 1J84A 3HWJA 2Y38A 1K12A 3LDKA 5A32A 4QQPA 5IK4A 3ACIA 1UQXA 3B9CA 2V09A 1CAWB 4KWJA 4CEYB 4LTAA 2QQUA 4MGKE 5LBBA 5IVBA 4BA6A 1JN2P 4NR1A 3VZNA 5FUIA 4AAXA 2Q5TA 2UY8A 5C8CA 5L19A 3ACLA 1DQ2A 2EXIA 1F2NA 1PGL1 3HR9A 2R062 3VBSC 1YEWA 5JAXA 2ZAHA 4LT5A 4D7SA 2QQLA 1X36A 4LK7A 3IZOA 3MYXA 3OGJA 2RS32 4GMP0 4MSVA 4XABA 2PLV2 4N53C 4YW5A 3SISA 5FDBA 1RGSA 2JDZA 3FC0A 3CZJA 1AR72 2DUOA 3ON7A 1KFUL 4YVSA 2UWAA 2GU9A 5JVVA 4A6OA 3T2OA 4DB5A 2VNVA 2EA7A 2BVBA 2VCAA 3MPPG 1UKRA 5LBCA 5FOJB 5F3EA 4P9GA 3UYJA 1YFUA 2VUAA 2VBBA 3GBFA 4HVRA 1MVEA 1VBD3 2ZBJA 2B46X 3LD8A 4XAEA 5H9PA 1LU2A 4EJRA 3IAQA 4YVWB 4IEXA 4BZ4A 4Q0QA 1V6NA 4RS5B 2YC0A 3ST7A 1AL0G 1S0FA 3DYOA 4IERA 2OZ6A 4CDWC 4A7ZA 1QU0A 5FXWA 4BQ1A 1AYM1 4LBLA 3WHTA 4BQXA 4A41A 4MGTA 4GB33 1KDKA 1IGOA 1I6XA 4LA2A 3NNMA 5FZ9A 2FQPA 4QHZA 2ZGKA 5C7GA 1VE0A 1CAUA 1PVXA 1DG6A 2DVBA 4I3GA 4GULA 5KHJA 4IE4A 3ES4A 3HVDA 4IV3B 5JCTA 1LGBA 2WYSA 1GNYA 1V9U3 5FYIA 3BIEA 3WG2A 1NE4A 5BNOB 3AP7A 1PGW1 1NCRC 1G9DA 3FLRA 1QDOA 3KZ4C 4JVAA 4XQDA 5E6HA 5HCBA 3WQ0A 3DF0A 4AGVA 3H3UA 1QQP2 2D6MA 1O8PA 3JD71 1CD3G 1MZEA 3PUAA 2RM22 4WVMB 3VDDB 5IFTA 2VZTA 1H1IA 4QT6A 5T54A 4LIUA 4LORA 4CCLA 1RIRA 2FCVA 3BCWA 3EB7A 4FPLA 2J1TA 2VZQA 1DIWA 1XNAA 1LEDA 4JDMA 1Y9MA 5GKAC 3IMMA 2PA7A 1QXJA 5A6QA 4NPMA 4MV2A 2W92A 2GMEA 4EN0A 3I59A 5J48A 3HQUA 1ZA4A 2Y64A 1R083 2RDRA 2P4EA 4GJYA 5ANNA 5A7PA 3VBRB 2J42A 4AQ2A 4DQAA 5KXBA 4ZXKA 5IAVA 3B9IA 4UT5A 4R9AA 3AMMA 4JV4A 4D6SA 1YRZA 3ORJA 2FMYA 3ZXKA 3PLQA 3H7YA 3K4AA 2A6VA 3WDUA 5C9AC 1NKGA 3MZHA 5A3PA 3AP9A 5CBLA 2XL7A 4W6WA 2ZZJA 1L7LA 1OKOA 5FMCA 2P6HA 4BWOA 4A6SA 1CIWA 4K7JA 3WLUA 5GLUA 5DG1A 1PHMA 3OPTA 2YGMA 4Y20B 2GP3A 5FYHA 2UY9A 4ZKTB 4FTEA 5F1RA 1LB2A 3I97A 4P9LA 1KGYA 4GH4C 3KQ4B 2VTXA 3AMQA 5C3RA 1JZ2A 1XNTA 3M3OA 1W6PA 4HETA 3WW2A 1X33A 1VBD2 4RFRB 1E5HA 1MZ6A 4JZRA 4BOWA 2XUMA 2E7TA 1E5SA 1PX4A 2UU8A 5FJKA 3PMEA 2WO1A 4L9BA 2J1EA 4JGZB 3D6EA 3HEIA 1Z0HA 2BVVA 4R8HA 1WMXA 1MPXA 4PLOA 3AYDA 2V5DA 4BJ0A 1MS5A 2VMIA 4CDXB 4LBQA 1AR81 5T5OA 4TN7A 1F4HA 4QQLA 2VMHA 4GB32 3H8XA 3NO8A 2PHLA 5C3SA 3MV01 3V0AA 4GWNA 2VZRA 1BHGA 2HYXA 1I5ZA 1SLTA 2D6NA 3N9LA 1IKQA 1XYPA 4HKWA 4A44A 5FYBA 4PDWC 1OOPB 3VZMA 4NE9A 1D4M2 4I09A 1SLCA 4UF0A 1V9U2 1SLLA 4CEWB 3WF4A 5EYXA 1O59A 3PUQA 1VAKA 5G05L 3UKNA 2VTXJ 4E4ZA 2SLIA 2B7YA 5EFUA 1UAIA 3AFKA 2XJVA 3PJYA 4JTOA 2BERA 3E6BA 1AXYA 2VECA 1BMV2 4JHZA 3VBOB 1KS5A 2HLEA 2B8MA 3VHOA 1RUC3 4ES9A 2UYBA 3WV6A 4NRPA 5J37A 4LLOA 3P3NA 1GANA 4GQ7A 2A6XA 4P08A 4GAZA 1VALA 4A7KA 3I49A 4XBQA 1LOGA 3C8XA 1W6NA 2XVLA 1VBA1 4EN7B 1QNYA 1AHSA 4YW2A 4FPKA 2WR9A 1IKPA 5CFDB 2IUWA 1WLCA 4I30A 3I3EA 4QPIB 2E9QA 2YMZA 4MZUA 5E16A 5C3PA 1LHNA 1R082 4IV1B 5I8YA 5A6ZA 5KXCA 1Q8PA 3EO6A 2X8KA 4FOQA 3ZKUA 3GF6A 3ACFA 2HWF1 3AZXA 5IUQA 3BPSA 4HVOA 3M3CA 1IPJA 5FCCA 1OLMA 1QNWA 4OI1A 3TN91 4WM8A 1L7RA 3PVNA 1UZ0A 3BPZA 5J98B 3VKFC 1ZZBA 4J1WA 5BNQA 2JDUA 2WJSA 5B4XA 5GLTA 1PM7A 1MS4A 3E6DA 4P9JA 4XFGA 5F2SA 2YBKA 4GD4A 5FXXA 2R043 3ROUA 1UZWA 1W3VA 2A1XA 1QGLA 1V6KA 4PIYA 4URTA 5A7SA 3ZX7A 1TVGA 4X6RB 2BOIA 1W8OA 3BKZA 2DF7A 1NCQA 2OYZA 3WCRA 2EAAA 1UN1A 2V72A 5B2GB 3NRUA 3RG0A 1JUHA 2BNNA 5A7WB 1PM4A 4QPGB 3WNPA 5A6YA 1UXXX 2VOWA 4KBBA 2VOXA 1H30A 3ZIXA 4M3CB 1K5MA 3IB3A 2KXLA 4D3WA 2IFRA 2NP0A 1C8M1 1GV9A 1GBGA 1S0CA 1TG7A 2CWSA 2QQKA 2WBKA 3AB0A 3KCXA 3M2MA 4N8MA 4QX5A 4BQWA 2R32A 5H9RA 4XCAA 3JZVA 3WP6A 1HRI1 4AHWA 2RDQA 1B35B 4CP0A 1BQPA 3JBG3 2OQ7A 2HBTA 1W2AX 4UFIA 1LULA 4I02A 4AVCA 3LOBA 3K3OA 4UW6A 1ULOA 1ZA7A 5A3MA 5LK7B 2DTWA 2Q8CA 4JC1A 2HEWF 1DQ0A 3J7HA 5KHGA 4WM7A 4Y22A 2ADDA 2D7FA 3U4XA 1ENRA 5GZFA 3G7DA 1XRUA 3U11A 2MPFA 1HRV3 4FI9A 2W87A 5JSPA 3IT8A 2D6PA 4OI0A 3URFA 4QDRA 3ZYPA 1L7QA 3T0AA 4LKFA 3GNEA 2WZR1 4JTNA 3NAPC 4Y1ZA 3PMSA 5C5UA 4ZZ8A 3PU3A 1YI9A 4QPWA 4DIQA 5BUVA 1RUC2 2PAMA 2G19A 2YU1A 2MHFA 2QBXA 3DEMA 3PL0A 4IGQA 3FLTA 4QAWA 3RQ0A 4ZZ5A 5FZDA 1PO23 1RTVA 1JUIA 1YQ5A 2W2IA 3H0OA 3WDVA 4BCUA 1PIV1 3WHUA 3WF2A 3WW4A 4YZ1A 2XB6C 1XB9A 4X8NA 5FZGA 4GWIA 5ACA1 1IPKA 4ARXA 1FV2A 2VBDA 1UZYA 4Q4X3 3ZYIB 2Q1FA 4RR3A 2ZHMA 3PUHA 2X5IA 3KHCA 5DZFA 1D4VB 1EPWA 4PLMA 1UPSA 2JIJA 3L2YA 3THTA 4DMIA 2UYAA 3POIA 2OUJA 3VKMA 2ZGOA 5FMOS 2V4AA 4LUKA 1G9AA 2VTFA 3KT1A 4AK3A 3WEZA 1W8HA 1LESA 3IPVA 3ZN6B 1UNBA 5FZHA 3NVCA 2LALA 3BODA 3H1WA 1VLNA 1WMEA 2XL9A 2XHNA 1YXWA 4CUGA 3AFGA 1RUJ3 1AR93 3GM8A 4XFFA 4XZUG 5KBFA 4OQ8A 3SCGA 5A32B 1LOFC 2R042 1OT5A 3I3DA 2R30A 3FN9A 5CB7A 1VBE2 2B45X 4XPVA 4HN1A 3AKPA 3BGAA 1GZTA 4W8JA 2MNGA 2X09A 2WRAA 4KI5M 1BEV1 4R9CA 5C8CB 1ZBA1 1YJKA 3IIAA 4LULA 1JH5A 4DRRA 3KVBA 3W5NA 3LA2A 1AZDA 3SH3A 2XOMA 3AZWA 3MBWA 2VZPA 3NNGA 5T50A 4QKDA 2XQRA 3RPQA 3D0JA 2ZOEB 4AGGA 1W6QA 5F5IA 1J59A 4U2AA 5F32A 1V6MA 4MX3A 1KQRA 1W9YA 3GALA 4YVSB 5T5PA 4EWAA 4CEYA 4D6RA 4C0BA 2QQJA 1RUI3 4HXCA 3N9QA 4SBVA 4UI9L 3S7EA 1CZTA 1UY3A 2GN7A 5DAXA 4G4FA 4HVQA 1U5XA 2JIGA 1R1A3 2PHUA 3JBG2 3VBSA 3J8F3 4B8EA 1FMD3 5EJZB 3THCA 2NN8A 5FP7A 1NOVA 2WYFA 4XAAA 3N9OA 3I54A 3RSJA 2HWB3 1UOBA 3ATGA 4N53A 3TB0A 1ZRDA 1GNHA 5C4WC 1VMJA 4TZDA 1VRH1 5I8SA 2VE1A 4E27A 4NIIA 1AL21 1QHDA 3ZSKA 3RVHA 4Q1PA 1SEFA 3LFIA 1HRV2 4M3CF 4I3PA 5FZ4A 3WOGA 2LW8A 2C5DA 5FK8A 3PUSA 1ZRIA 1CAUB 4NAOA 1JHJA 5D21A 4COYA 5T55A 4XFAA 4AHYA 1YO8A 2K46A 3JQWA 1DGRN 4RHV3 4XXPA 2W5FA 4QX1A 4WV8A 1YCIA 4AOCA 2LRPA 4CDWA 4L0PA 4Q0SA 4XE9A 2WAAA 1PO22 4P02B 1J3QA 2QCSB 3LWCA 2OPWA 3ZDSA 4CPBA 1W8ZA 3MLJA 1O5LA 3RWKX 1SLIA 2VNOA 1MR5A 1ZRFA 4BPZA 2Y34A 4J1XA 4AQSA 1GKBA 4E2GA 5ISLA 3BU0A 4Q4X2 4HOOA 2VG9A 4XF4A 2ZTNA 4GKXA 3WP4A 1JYTA 4Q27A 1T2XA 3P5BA 5C5TA 4LR4A 4MUVA 2FDGA 2X29A 3EXUA 4ZS3A 5C70A 1H2KA 4QMAA 4YGBA 4Q8KA 1RMU1 1OFSA 4XEZA 2YV8A 4EN6B 3KVAA 4QU1A 5JXJA 1DF0A 3WINE 4EZHA 2ZGTA 2GH8A 3NSTA 3I2JA 1GWMA 4IE6A 3MW2A 5ABJA 3I59B 3POEA 3USUA 5F7UA 2XLFA 5FPAA 3ZIWA 1RUJ2 1AR92 5FZ6A 3C7GA 3I2GA 3MIEA 4HMZA 3I3MA 2MEV3 5GALA 2FD8A 2GNBA 2CAUA 4O61A 3MIGA 3ENRA 1LEMA 4X8PA 1HLCA 5IHRA 4MGSA 4Q4Y3 1SHWB 2D98A 5CG8A 3FZ3A 3TNPB 4RD7A 5KR7A 1IS3A 3WX5A 5FBZA 3TAYA 4KL1A 2O1QA 1BBT3 4QKNA 4LBOA 4P5HA 4EYUA 1UD1A 2GZWA 5A3NA 1GOFA 5CVRA 5KHHA 1C3HA 3CJXA 1BK1A 3ME2A 1OVSA 5FZLA 5FYMA 1N1SA 3ZXDA 1WW4A 4E8CA 1PO11 5FUNA 1AX0A 4R4XA 1KFXL 2YBSA 3A7QA 4XUPA 3O1SA 1RUI2 1QJEA 3N7LA 4B29A 1W6PB 3OGVA 2QZ3A 5JOXA 1R1A2 5FZBA 4AQTA 1EUTA 1OA3A 3J8F2 1LECA 2FZ1A 1FMD2 2W52A 3BN6A 5IVFA 1LAJA 1HXS3 3V56A 1SPPA 3OGSA 1SCRA 2HWB2 2WT0A 2NQYA 4KNCA 4Y26A 3RZHA 1XBFA 1VP6A 3J7MA 1WGPA 3W5MA 2X05A 4LBQB 1W99A 5FP4A 3RGBA 1KJRA 3EHKA 1DDLA 2JKBA 4LOTA 1HN1A 1AR61 1SFYA 4UW3A 3V0AB 4QKBA 1N47A 4RGKA 2ZACA 4Y4YA 1VMHA 4P9IA 5FY8A 4AEDC 4RGGA 2PYTA 3EYPA 3KV5A 4YW1A 5H9QA 3LDBA 3H50A 2EXKA 1NG0A 3JB4C 4RHV2 3AC0A 4CDQC 1O91A 5JR2A 2BRTA 4LO4B 4K1ZA 1DYPA 1L3JA 2DCYA 4M00A 4UF0B 2BPA2 2Y0OA 4GJZA 3LA7A 4JGYC 4OCTA 2ZGRA 4AAPA 1Z7S3 1CAXA 2A6WA 2VCMA 3T2TA 4MOAA 3MW3A 5DPNA 4D8MA 1W9WA 3WG1A 4YG3A 2JWPA 1RUNA 2B9VA 2W1WA 3AKRA 1OLRA 1OQ1A 2RV9A 1Y9QA 3DYMA 1H9PA 3B7MA 3LB9A 4FFGA 2C0ZA 1F4AA 1UIKA 2OXBA 1W2UA 2VY0A 1WMDA 4KG0A 4MGYE 4XFHA 2PAKA 5KWRA 1YIPA 3OBTA 1VJ2A 1CZVA 2ARAA 2CV6A 1OLME 3CZUA 3KCYA 4FOYA 3SCFA 1AYN3 4XDOA 5JSRA 5HI0A 5BY5A 1DCSA 1W6NB 5LWBA 2WNEA 1W9SA 1Q5OA 3DXUA 3M3EA 4FQ4A 1RHI3 2XJUA 3W58A 3M8LA 2VOKA 1WW7A 3NNLA 1CJPA 1PNGA 3PJQA 3IDAA 1UU5A 3KHBA 4KWLA 3RZMA 3VD4A 2ILMA 1WBLA 2D3RA 1US3A 1POV1 2MEV2 1PVC1 1HQLA 3I2HA 1J1TA 1QXRA 4QPGA 2ET7A 3OOXA 2J1VA 2RJLA 4Q4Y2 1OF3A 3GDBA 2D93A 3O0WA 4XC9A 4OHYA 3U0ZA 5L7OC 1YLLA 4WM8B 3HNYM 2C9KA 4H7MA 2A71A 2H6CA 3EQEA 1BBT2 1LTEA 2WABA 2AC1A 5JLVA 2EXHA 3A4UA 3WVJA 2B39A 1W0OA 3J7LA 3VBHC 4Y5TA 1PK6C 1RUE3 2IC1A 4I2OA 4L92A 1R1ZA 2EF6A 2ZX2A 1JZ8A 4P9WA 5LA1A 2WL1A 2HBUA 2Y6LA 3LDRA 5F2WA 3CL1A 4BQYA 3WT3A 1HIXA 4XJ8A 1NCQB 3B93A 5K0UC 4OYUA 4TLGA 2VQAA 2VUDA 1RXGA 1YQ8A 2R071 4A3ZA 1HXS2 2VU9A 5KC6A 1F35A 2A3XA 1X8EA 2QQWA 2W95A 1K5MB 3KWVA 4NWVA 1PZ9A 1COV1 1HQNA 1TMF1 1OH4A 1VBC1 3AP6A 4YG6A 2ERFA 4TSVA 3W20A 3CJIC 5JOWA 2R49A 3RMXA 2JE9A 5JOZA 1WD3A 5HPOA 2JECA 3N7JA 4YLZA 2Y33A 3WNKA 3RMYA 4YWAA 4CTEA 1AR63 3HN1A 2H0BA 2IVIB 2E7QA 2VUJA 3N4MA 1A8MA 3D4KA 3W21A 2XBO1 4B7EA 2BU9A 5C6CA 4QHOA 3ITQA 1UYYA 3LIHA 3MF9A 3F95A 4WBBA 1KITA 3CIHA 4IE0A 4CEYC 3ZN4A 4BXSV 2UWCA 5IATA 4WM7B 4Y22B 1OA4A 4XOGA 1Z7S2 2RMU3 4Q26A 1UU4A 4HSJA 5FO9B 1G9FA 1NY71 5DAPA 3ZYHA 3DCQA 2UWBA 5FLJA 1QJX3 4Z07A 5EWSA 1J3PA 1UX7A 5FR3A 3NV1A 4XQ4A 1ULCA 2YC2A 2Y26A 1Q8SA 1REDA 3MDPA 4HG6B 4N90A 2QNKA 2WDBA 4BB3A 3ZYBA 5D8AC 4P14A 2DCJA 4OQ9A 3TWIA 1AYN2 2G9ZA 5J36A 4ASKA 5BNOA 4B3NA 1VBB3 1H0BA 3ZSJA 1PZ8A 1RHI2 2XJTA 4XBLA 3FFQA 1DZQA 4YVWC 3VDAA 2J1UA 4NIGA 2JX9A 3INAA 4RR3B 3ILFA 1I3HA 2W39A 3NAPA 3E1F1 2X5IB 4UFJA 4YW3A 4CE8A 5IVEA 1PMIA 1O4YA 1V0AA 2YPJA 5T3NA 4HK8A 1OVPA 3PVOA 5FY7A 2O14A 1OXCA 2DBIA 3J9SA 3FL7A 3WG4A 3VD7A 5FZ1A 2X10A 4FPGA 4YZ2A 1LOCA 3IPVB 3U14A 2XMLA 4FAHA 3IMNA 5EJ3A 2YROA 4Q4W1 1UW8A 5FWEA 4UOJA 1W90A 4IQPA 1VR3A 1XJAA 4LHSA 4NIDA 4GWJA 1GWKA 1RUE2 3ZSLA 5F5CA 2JD4A 1K42A 4IV3C 3MV11 3OPWA 4DZGA 5BNOC 2XKPA 2DFCA 2YZ4A 5LY2A 2VW2A 5LB6A 3BB6A 4RQPA 1PGSA 1CAVA 4K9SA 1NA1A 4XJAA 5FOBB 2R073 3ETPA 4XFBA 3VDDC 1W6QB 4AEJA 5LEJA 2IWGB 3B5LB 3GZTB 3N3HA 5CFCC 1ALYA 1LCLA 1H1AA 2PMWB 2ZEWA 5LY1A 4W50A 1JZ4A 2NYYA 1LOFA 3T1LA 5FPBA 1TMF3 1UO9A 2QQIA 3NV4A 4O9EA 3VKNA 2OQ6A 4XF3A 1S55A 3T4HB 4LE4A 4E4HA 4MXVA 5H9SA 1UYPA 2ZMNA 1NX9A 5FAXA 3SEPA 3DUIA 2BV4A 2YFZA 2RDSA 3VBSB 3S6PA 2IXHA 3MFCA 1W06A 5F3CA 4C90A 2BJSA 3GGLA 2VL4A 2A70A 4N7UA 4N53B 4C1WA 3POJA 5A3UA 2NLRA 3VBRC 3VHNA 3K46A 4S2FA 2AEZA 3JCIA 3BTXA 1XXNA 2R6QA 5FZ7A 3EBRA 4PI2A 4OI4A 2RMU2 2EAKA 4BISA 1EV11 4COUA 3VL8A 4TTGA 3W9AA 2EIBA 3LEMA 4OULA 5I93A 5K7PA 4JRLA 2E33A 2HWC3 1YQ2A 3MEPA 4K3UA 4LBNA 1QJX2 4QPYA 2JG8A 1S1AA 3AYCA 3K4ZA 1ASJ1 3UKVA 2LM3A 4OMCA 1FPN1 4ZS2A 5C4WA 5FZAA 4LK6A 4CDWB 2VGDA 1EUUA 2GAUA 2XWJB 2DWRA 4R9BA 3DPRA 5AVPA 5FY0A 5GM0A 1LENA 5LBFA 5HCHA 1RUD1 1V6LA 2Z5WA 5CIRA 3ILNA 2BOJA 1VBB2 1YQCA 1SBEA 3FFZA 2W9XA 1ND3A 1RUH1 1LODA 4Q4V1 4COWA 3PVBB 4FPOB 5JI9A 1JZ3A 1AXKA 1H8TC 4A2UA 4AG4A 4CDUA 4MVTA 1WD4A 2XHKA 1ZBE1 2RJKA 2W94A 3HIFA 2R0HA 5FLIA 5HXMA 2ZAAA 1SACA 1XYNA 5IK7A 3N9NA 1S2BA 2PXJA 2WWJA 4IW3A 4XDPA 5KXDA 5F6LB 5ABJB 3USUB 4XUOA 3Q8FA 1FI2A 2WLQA 1US2A 3S57A 3LSEA 2VNRA 4X6QB 5JZGC 2OX0A 1UZZA 2ZX1A 4NUBA 4ES8A 1R091 2XONA 4Z1VA 5FZIA 1SFPA 4CEWC 2OW4A 5FY1A 1S0BA 4K6BA 3WZ1A 4AE2A 2BBVA 3FUOA 1UMIA 4XFIA 3O12A 3Q8EA 3E6CC 1I9RA 2AEYA 4K40A 2YG0A 4C1XA 1WCSA 1ZZ7A 4GALA 2WZEA 5FUPA 2ORXA 2A6YA 2BTVC 2IXLA 2R072 3VBFC 3ZMOA 5CADA 1CR7A 2WNOA 5SV8A 1TME1 3O0XA 1AYM3 1SDDB 3WR0A 3ZLIA 1YJLA 3I4IA 4LUMA 2HH9A 4TWTA 3TEZA 3ZFEA 3VBOC 2DDUA 1GR3A 2VJXA 3LQCA 1TMF2 4HPKA 2V73A 2YBPA 1JU3A 1TNRA 3N9MA 1U5YA 3P3PA 4QDQA 4MGQA 3A0NA 2FCUA 3CLPA 1FATA 4LITA 4NVPA 4RYDA 5BNNA 5C33A 3NW4A 2AYHA 2A73B 3MF6A 1JBCA 2EALA 4DS0A 3KV4A 3T4VA 3U78A 3B01A 1SPPB 2XQXA 4QPIC 3ETQA 3VD9A 4IV1C 4N43C 3VDCA 5EZWA 3JD73 4BM8A 4A3XA 2R16A 1CJDA 1D2QA 3FHIB 2WFF1 1C8NA 1BYHA 3B3QE 1NY72 4LBMA 3ZFFA 2AH2A 4IESA 4LMFA 2WZ8A 3MW4A 4QX0A 2HWC2 3LCPA 2ZEXA 4R9DA 3ZXJA 1JYVA 1RITA 4C91A 1WMFA 4XTPA 2GNTA 1YHFA 1DGWX 4FPFA 4YW7A 4LBQD 5FK7A 2ATFA 2WZPP 3GHMA 2GP5A 3KQRA 4HKOA 3ZXFA 2WNUA 4Q0PA 1CAXB 4Q8LA 4AI3A 2DUQA 1SCSA 5F6KA 5K4LA 2EIGA 3O1VA 1EAH1 3AZZA 5ERLA 2WSUA 4DUWA 4TXWA 4E9KA 1ZNPA 4DXRA 3TRSB 1ULGA 1FOD1 1N1VA 2A3YA 2NMOA 4FOVA 3LEGA 3AVRA 5JPNB 1PGL2 3O1TA 4F8AA 5FYZA 1AJKA 3ABZA 1LJ7A 1X82A 1DQ4A 1OPOA 2L9LA 2YY1A 3FJSA 5I0TA 4JGYA 5CKMA 1Y3TA 4L99A 2F17A 3AP5A 2RS51 3RRDA 1A78A 1CX1A 2GC2A 4Z92B 2RE9A 2VO5A 2FMDA 3VBUC 3POYA 4FPJA 5HCFA 4YW4A 3U75A 1UY2A 4AVVA 1TQ5A 4IEQA 2W1QA 5HXVA 3HQRA 1CPNA 4OHZA 4HFSA 3UJQA 2PTMA 3AL5A 1Q43A 3SXWA 4BMEA 5FV3A 4CXXA 5J09A 1UY1A 1BK0A 4DRVA 4IXLA 5EP9A 1VRBA 2RS11 3VHPA 4UFKA 3CHXA 3D82A 2A3WA 5FRAA 1W9TA 1W2OA 3PVEA 3QOPA 1LKNA 1MZFA 1TNFA 1I1EA 4RN5A 3RZJA 1AR83 5FTTC 1JOPA 2ZMKA 3GZEA 1AYM2 1XU1A 3TOJA 4JDNA 2BDRA 2ZX0A 3H7JA 1S2KA 2Q0AA 4PIXA 1GP4A 2P17A 3KV9A 4DXZA 3WF3A 3K51A 5F8PA 4XQWA 1PMJX 2SBAA 1URXA 2EXJA 2VQUA 2XJQA 3ZVXA 1GZ9A 1DGRA 2BZDA 2HWE1 2OUHA 5BV6A 2JG9C 3K4DA 4FTBA 2FDIA 2OS2A 1I5PA 5JXIA 2OIIA 1A34A 4BQ3A 3NNJA 3MPBA 1POQA 4ITCA 5EHDA 5FZEA 1PGW2 5FXZA 3BALA 2O0OA 3KB5A 3SH4A 1C1LA 4BK5A 2G1MA 1X7NA 3HQXA 3APBA 3H8RA 4UBGA 1SDWA 1S2EA 4AFCA 4CP9A 2P2KA 3JD72 4KGQA 4YSFA 4OUEA 4BIFA 4UW4A 4XHXA 4IGPA 4E4SA 1UL9A 4BMBA 4UFHA 1IS5A 2TNFA 5GLVA 2GC1A 3AK0A 5K0UA 1O3TA 5JR7B 4Q0VA 2WS91 2RR11 4CCNA 5FPXA 2CWMA 4DINB 1GNZA 2XJSA 4YGDA 3GZUC 4B1MA 1R64A 3ELNA 5FY5A 2VCBA 2VW0A 5JMCA 1O3SA 1VBA3 4AI8A 1DFQA 3AKSA 3E5UA 3RS6A 4DY5A 3R4SA 2WQ4A 5JIUA 5DUXA 5JMOA 2JEMA 3CJIA 3DECA 2P3JA 4IE5A 4PIZA 1RL3A 3S30A 5C8CC 2BQPA 5FZCA 3IWZA 2HWF3 4JHTA 3L9JT 4HZFA 4AFMA 3B02A 3OYWA 3B94A 5LA0A 2IZWA 2W1UA 1FYUA 5CKQA 2Q1ZB 2HWD1 1G6NA 1SLBA 4R52A 1RUG1 1QH6A 2B4KA 3TN93 3VL9A 4H14A 4YVSC 5LA2A 1LHOA 2W08A 5DN2A 4DFSA 2WSVA 1J83A 4PT6A 1RVF1 4FFHA 5EPAA 4BLJA 1KEXA 1UY0A 2P3KA 1HB4A 1ZVFA 3CEWA 5L73A 1ZYBA 5F3GA 2OKXA 4MG2A 3VN4A 2WNVA 4FPYA 1DGWA 3LZZA 3NAPB 1ND2C 2VMEA 2XLGA 4YM3A 2WT2A 1AVBA 1BZWA 1JODA 2Y6FA 5EXOA 1JW6A 1WLDA 5D8AA 1LU1A 5DDJ1 3BIWE 1W8NA 3ZSEA 5AC91 2XKOA 3NV3A 3AXDA 2GN3A 5KHKA 5F3IA 4M4RA 2ZGQA 1C8M3 3KM5A 1LNSA 2D43A 3USSA 1AR82 2ZGPA 3M70A 1JYNA 3PTYA 1HRI3 4JCKA 1YFXA 3FE5A 2WT1A 4Z2AA 1H6XA 1TE1B 3MLLA 5IT6A 1HB3A 2C4XA 5DUUA 1W39A 4CP1A 4OI2A 2Z69A 2A5ZA 4BXFA 4QU2A 2VOTA 4KWKA 3E97A 1QJU1 1TZOA 3HBZA 5GZDA 5C3OA 4G9SB 4RQPB 3S7IA 1JZ6A 4PCRA 1H4HA 2DU1A 4LIVA 2VMGA 4M4PA 1CAVB 2VXJA 1NA1B 3JXSA 3QCWA 4KWUA 2TEPA 4PBOA 5JOYA 5FMBA 1V6OA 3KD4A 3GJBA 4EE2A 2OPKA 3BVCA 4E8DA 2GSYA 1DZTA 1HDKA 2G9GA 2QFEA 3H1YA 4XCBA 1FAYA 5GJ6A 1HV1A 2VMCA 5ABJC 3E5QA 1GSLA 1QJY1 2VM9A 1JU4A 3AVSA 1PMHX 2WZR3 3I7DA 2YPDA 4META 4QB2A 3ZFGC 1MEC1 1U5ZA 2DURA 4XJZA 5FZ8A 2JKXA 3MI8A 4AVTA 1J3RA 2YDEA 1RUF1 2CTVA 4AI0A 3S5AA 2DVDA 2D97A 2WO2A 2WIIB 3GCWA 4QDSA 3KGZA 4N9HA 3OCPA 3ZMNA 5CFCA 1PIV3 1CX4A 2W1SA 2WC2A 3WUCA 4CA9A 2RG4A 1VBA2 4LJHA 5I0SA 3VKLA 4Z82A 1JYXA 3I3BA 5ACA3 2XG3A 2QQVA 1GLHA 1CPMA 4K20A 3R6SA 2DUPA 1DQ1A 4P9YA 1LOAA 5TSWA 1WKYA 5ANQA 2TBVA 1W6MA 3RZLA 2HWF2 1IQAA 2OVUA 1C5HA 2Q30A 2QQPA 4XMIA 3SLIA 1GMMA 5A1LA 1IS6A 2JG8B 4QM8A 5BNPC 2VZ3A 2YHJA 4OUSA 5IVJA 5JWPA 1NCRA 3BTYA 4DEQA 3TN92 5C4WB 4EN9B 4S2GA 4CDXC 1OLQA 5JXGA 3DPRB 1S0DA 4N9IA 5JDBA 5LW9A 1MS0A 2WAOA 5D2AA 1A8DA 4GMP1 1MS9A 1HJGA 2VNGA 1ND3B 5DXDA 5JUVA 5FYSA 5F39A 2CYFA 1GQPA 3O14A 5FJHA 1BEV3 5EJ1B 3AYAA 1ZBA3 2VW1A 1WW6A 1OHFA 4CDUB 4HONA 1O4ZA 4JQRA 1XU2A 3CQOA 3NKGA 1UMZA 1XC6A 3WDXA 3POWA 3HNMA 3ZXLA 1LOBA 3T0BA 4CPBD 4NRMA 1XYOA 4I01A 5CU1A 2I07B 1UYXA 1YFYA 1JZ7A 4YFWA 3VZKA 2R061 1N1TA 4R4ZA 1RJ7A 1C8M2 1OMIA 2P3IA 1LGCA 2OZJA 2RS31 3AMHA 4FT8A 2PLV1 3HT2A 1H2LA 1HRI2 2Z2SB 5C9AA 1BCXA 1H8TA 2QDRA 2C26A 1AR71 4PJYA 2BW8A 2LS6A 3U4SA 4E2QA 2CGOA 4UAPA 2CSGA 3ZO0B 4DUXA 3I2IA 1JHNA 1KXGA 1VRH3 1YC61 3A0KA 4QGNA 3UESA 2J1RA 4GH4A 1D7PM 1HW5A 2VVFA 4W6XA 2CL2A 1AL23 2PHXA 4AEKA 5CEHA 1AUYA 3K77A 3OD0A 1ODMA 2YYOA 3ILRA 3ZFEB 4AF9A 4Z8BA 5JZGA 3MO4A 2P37A 3KT7A 1KRIA 3UGFA 4HPKB 5A3TA 1H2MA 1QJY3 2WZR2 3U07A 3MIDA 5BNNB 1QH7A 4F3JA 1JYCA 2Y6KA 3LA3A 4YZ4A 3J4UH 2KR2A 3VBFA 3MLKA 4XJWA 4OZOA 1CZSA 3JU9A 5AFBA 3D0SA 4NOTA 4XYXA 5IK8A 1PIV2 3U37A 1LOEA 1W04A 4NIAA 2O8QA 3C3VA 5ACA2 3OF1A 1BLZA 3LIGA 4LOSA 4PDWA 4L2NA 4CCOA 3W59A 5K9YA 5IYYA 3CF6E 4UFMA 4FPHA 1OKQA 2AACA 4FPEA 3FBYA 4I0BA 3ASIA 1UIJA 4WM8C 4XVHA 3GXUA 4XHBA 1QQP1 1BKZA 5FKBA 3MIBA 2RM21 1RMU3 4H3WA 4LBJA 2ZX3A 4LO5B 4BIOA 1UY4A 1ONAA 5FPUA 1W28A 2ET1A 4OFGA 3HD8B 4N43A 1UWWA 4ZONA 1OC1A 1ULPA 4AI1A 1WCDJ 2XJRA 4CRQA 1YI7A 2JDYA 3CBNA 1HKDA 1YNAA 2WNUB 3I2KA 3MGUA 4FP3A 2K2SA 5FYUA 1RB8G 4OHVA 5HV0A 2J1AA 4JDOA 3VV1A 1BEV2 5FKCA 1GUIA 2PHRA 1ODNA 1ZBA2 2HEYF 3C7EA 3LPGA 4IEYA 3UK9A 2WINB 4D0QA 4DY3A 1JI6A 2K9ZA 1RINA 2CNAA 2WO3A 2UURA 1B09A 4IE7A 3O1UA 5I8TA 4JGYB 4AHXA 4L8QA 2CU5A 1NLQA 1ZRCA 1AXZA 3ZXEA 2FDKA 2YC4A 1CVNA 1PO13 3M1HA 5FP9A 2J1SA 3DV8A 2Q8OA 1H1MA 1MQTC 2YGLA 4D94A 3TNQA 2IXIA 4MXWA 5FPLA 2Y60A 3IBMA 1E57A 3V0BA 4ZHNA 1G7YA 2ADEA 1QOTA 1WCQA 3FMGA 4WM7C 3GYDA 2JDHA 4RA0A 4H2AA 5FMDA 5JIAA 3NMBA 3VD3A 1OF4A 3D8CA 2BUKA 3UT0A 1VBD1 1VRH2 3D5OA 4ISRA 3WNOA 3POSA 4CUBA 2B9UA 3K2OA 4DO0A 3PIGA 5L36A 5EYYA 1ACCA 3TEXA 1AL22 3VBUA 4F7ZA 2P3YA 2ZGUA 4QX8A 2W91A 2ZS6B 2VZSA 1KS4A 5FO7B 4E4DX 2BWAA 3ZM8A 4EN8B 5FYTA 4O65A 3UNPA 4V1PA 5CNAA 3K75B 4AVAA 1QJY2 1N3QA 1Q3EA 2JDAA 1E5IA 2WFPA 3AX4A 1BJQA 1UOGA 3BU7A 1Y4WA 3DN7A 3O5SA 4GB31 4KH9A 5FREA 3RNSA 3SNMA 3VDBA 3FBMA 1RUOA 5A33A 1XQNA 1EP0A 5EIYB 4HANA 2QQOA 3IM0A 2ZGMA 4XIOA 3T2QA 3M3IA 5LBEA 1D4M1 1WA4A 2R0FA 3AP4A 1SBFA 4CP9B 5JXHA 1OFNA 2B42B 4GZ9A 1V9U1 3EJKA 4L97A 4XF9A 5FO8B 1APNA 1U0AA 2E26A 2EVXA 3O0VA 3OY8A 3P6BA 3RZZA 1IG0A 4B4PA 2JG9A 2AREA 5K0UB 1ENQA 5DQ0A 1MZ5A 3RI8A 4LPLA 4CCKA 5EQUA 1X9PA 2G4IA 3OBAA 1RMU2 1ZREA 1MS3A 3KCCA 1GZWA 1QIQA 1BMV1 4KQ7A 1WLTA 2GC0A 2VD7A 1G9CA 3OGGA 1WW5A 3IIIA 3LE0A 3ZYJB 2HJIA 3OUJA 4RS5C 5C8WA 3CJIB 2FHRA 4NPLA 2JDNA 3I2FA 4WVWA 5FFOC 4D6QA 4J6GA 1STMA 5IFPA 3WP3A 1QJZA 1W2NA 3PHMA 2JB4A 1POV3 2NMNA 1PVC3 4JAAA 1NUKA 1QF3A 2E31A 4LKSA 3ZPYA 1Y7BA 1O7FA 2VVEA 3OYWB 4HT1T 1WBFA 2Y0IA 5DUVA 5FY9A 5FZ0A 2Q8EA 4XUNA 3WP5A 1KD7A 5J1XA 2YU2A 4B1LA 1R081 4OVEA 4YG0A 5A3LA 3WQ7A 5FYCA 1AX2A 3RZKA 5E88A 4FBFA 4FSJA 3GHNA 3MFAA 1X8MA 5FZMA 3T08A 1VIWB 1CQ9A 1YFWA 1GP5A 3IN9A 3DKQA 3SITA 4KU8A 1CONA 2R7EB 1PO12 2YUEA 2BNOA 1VAMA 3WUDA 2IXKA 3LPFA 3VZJA 4OUMA 2WNVB 3T3YA 4BH9A 1WLWA 2TUNA 2KA3A 3GJAA 3IDCB 3NJXA 4NPRA 4S2HA 4AEMA 5A1AA 1JYWA 1GICA 5A3OA 4FAGA 1XNCA 2JJ6A 5FLHA 1W05A 3GZAA 4A4AA 4MGIE 1DBNA 4CUAA 2VXRA 1W03A 2ID4A 1U12A 3I8TA 5D8AB 5A80A 3ZKYA 4AFDA 4IEUA 3ZXAC 3OG2A 1IPSA 3J26N 3VZLA 1COV3 3HAGA 4ISQA 2C24A 2VZUA 1VBC3 4OMDA 5FP8A 3WSOA 4FPCA 1RXFA 2W3JA 1OURA 4EROA 2WQ8A 3WW3A 5A7NA 4PF1A 1WZXA 1AR62 1EY2A 1KDMA 1ND2A 2J7MA 3Q8AA 4URAA 3OGRA 2XBO3 5FPZA 3AMNA 1J1LA 4Y3OA 3DL3A 4C0HA 1GP6A 1XNBA 4YFZA 4QWNA 1OUXA 4IEPA 3RDIA 4RSUA 3WNNA 4MHUA 3R4UA 4XZPA 3SKVA 3V64A 4MH0E 4LHLA 2EIEA 4WVVA 3U10A 2D3PA 3CKHA 4PI0A 4IGOA 5DAQA 2C9AA 1FX5A 4JKKA 2ZEYA 4XACA 3ZR6A 5LATA 4QHBA 1UU6A 3HN3A 1ZM1A 4HBNA 3MHZA 1D4M3 4YZ3A 1G9BA 2C6SA 2E53A 3A23A 3ZSMA 1CWPA 2FDJA 3QH7A 5DZGA 4CCCA 3AKTA 4UFLA 4DOUA 3ZYRA 1V6JA 1X50A 3ALQA 3N7MA 2FDFA 1UOFA 1UX6A 3CO2A 5IAXA 1F5FA 3NKTA 4INDA 1W6OA 4LO6B 4NHMA 4DPNA 5CFCB 4XUTA 2CDPA 3PNAA 4JRAA 4ZU4A 3SCHA 5FZOA 4XTMA 1RUC1 2GNDA 5FQ0A 3N9PA 4JGZC 3NJZA 5CG9A 2WKKA 3SHRA 3WNMA 3Q9OA 1U5IA 4NMIA 3ZFGA 2XLAA 1PVC2 1W6MB 4ONUA 4S2DA 4LQRA 4QKFA 3H3LA 2WQZC 3KT4A 4W4ZA 1PNFA 2AGSA 2GDFA 2XVKA 4COVA 5T52A 2VBPA 4EWEA 1W0NA 1Q8VA 1NCRB 3M4FA 3O7OA 2P6CA 5IW0A 2F4PA 3LEKA 4QGLA 5FBJA 2DVFA 5CZKA 1FV3A 3WF0A 2P5BA 1RC6A 3OJBA 4QXHA 4W65A 4Y1XA 1ZZ6A 3ZDVA 4CVUA 4DNYA 2BWCA 2HYKA 1MS8A 4YARA 4Q4W3 4QX2A 1OOPC 4UXAA 5I0RA 3H42B 2HEVF 5G04L 4Z2WA 1JXNA 2VQTA 4RGAA 3VUOA 4CCEA 4XF1A 5BNPA 4D69A 1H9WA 3FUQA 1POV0 1HB2A 5HCAA 3H1MA 5K8SA 4EQVA 4K8FA 3DGTA 4AW7A 4PHZA 4YZ5A 2D44A 2R041 3R4DB 1NT0A 1VMFA 1VBE1 1HB1A 3RJRA 5M0TA 4YW6A 3T0DA 1LHVA 1NQJA 3Q8CA 1W8FA 3H9AA 1FT9A 4IEOA 4HSLA 3TYJA 2FZ2A 3G6JB 4QXKA 4CSWA 4O9GA 1CIYA 1COV2 1IS4A 1VBC2 2RDNA 1NXMA 3A22A 3KF5A 2W46A 4H55A 1W2TA 3T09A 2IFWA 2AUYA 1NE6A 4K21A 2XGXA 5IVYA 3JQXA 4BQ4A 5C9AB 3KGLA 3ECQA 1S0EA 1H8TB 1Q8OA 1S4CA 1GU3A 4NHLA 4QM9A 4GIQA 4WZFA 1Q56A 5CFDC 4V2VA 2XBO2 2XJPA 3UKTA 1JOBA 4MLOA 3PDQA 2D5HA 3D3AA 2VMFA 4NO4A 2BP6A 2LTNA 1WCUA 3JBG1 4LBKA 4XUQA 2ETEA 4GH4B 1ST8A 2YXSA 4Q2FA 5E8AA 5F37A 1AJOA 2D40A 1EV13 5GLWA 1NXD1 1DLCA 2F4LA 3NQHA 3BI3A 1KJLA 3ZYGA 4UBHA 2VULA 4IDZA 5JZGB 2PELA 1T6GC 4LO8A 5BYNA 4IEZA 1NAEA 3R05A 4NN0A 4OHXA 3SC7X 2O8OA 1ASJ3 2ENRA 3IKWA 4OZXA 4XW3A 5F5QA 4BK4A 1FPN3 5JPMB 1O3RA 4ZU5A 1HRV1 4QX7A 4AVSA 1ZZ8A 4KU7A 3LFMA 2PN5A 2VAUA 4TYSA 2J22A 2ZGSA 4YM2A 3VBFB 1RUD3 1QXPA 2Z79A 1Y9GA 1YWKA 2ES3A 4FP2A 2Y8KA 4M0NA 1W0PA 3C7OA 3I2OA 4CU8A 4RL7A 3F2ZA 1W8WA 1RUH3 3JB8A 4AEDA 4CUCA 5F9TA 5A3WA 4QPGC 4Q4V3 1QKQA 4HL0A 2VZOA 1NYWA 2DCZA 4MADA 1PO21 1UPIA 2WN3A 4PDWB 4CDQA 4FFIA 4KBZA 4YGEA 1JZ5A 4AI2A 4PQ9A 4ATEA 4Y1UA 5LZ6A 4BU2A 3LGRA 1ZBE3 1DYOA 3JUUA 4A45A 3PURA 4XILA 3HOBA 4Q4X1 4L11A 1ZZCA 4P9XA 4KGGA 1B35C 5I0DA 3SEEA 4N43B 1N3OA 4IUGA 2P34A 1UKGA 4NAMA 4Q4W2 4LNVA 3U1XA 2QQNA 1FNYA 1WCKA 2WLPA 4GWMA 4B4QA 5GZCA 5GLZA 5FP3A 3IDEA 3NJVA 3KS7A 4HN0A 4MGZE 1QOOA 3OEAA 3WG3A 4YM1A 3FHAA 1R093 2VUCA 4BHPA 1D0HA 1S0IA 4C8DA 1NZIA 1RUJ1 1AR91 3THPA 3NWKA 4FQZA 4Y24A 2XVGA 4LKEA 1LRHA 5LRRA 3RYRA 5LK5A 5A7OA 5J7MA 2QZ2A 4ZXEA 1VBE3 2PQQA 2VOVA 3KF3A 1TME3 3NJYA 3OB8A 3QLQA 4FCAA 4QQHA 5IK5A 1QJFA 4V2WA 5E89A 1SG3A 2XPJA 1ZX5A 5B4NA 1RJ8A 1ZRRA 4LO7A 5DMYA 2BGOA 1HN0A 4FVVA 5DUWA 4WVZA 4MHRA 2I74A 5I0UA 1BVP1 1S0GA 2OA2A 1MACA 4XURA 4MXWB 1MVQA 2E51A 5L7OA 3WQBA 2GH2A 2NZ9A 1UOJA 3FLPA 3V0BB 3OUIA 5KXEA 3VD5A 1LHWA 1ULFA 1RUI1 4QD2A 2NM1A 3VBHA 1PK6A 3VZOA 4D7YA 5CISA 3GBGA 4XJUA 5C3QA 1BVVA 4LHNA 4LEJA 3WDYA 1R1A1 1H4GA 4M3CE 2FCTA 3TBDA 2JDKA 3J8F1 1FMD1 3LF7A 1O4TA 3KV6A 1N1YA 2ARXA 2AZ5A 1MQTA 1XOYA 2Q4SA 3N35A 4HLTA 1EV12 1AF9A 2WFF3 1OA2A 2HWB1 2AENA 1JTZX 3VBUB 1F8VA 1IZ3A 2CAVA 1QOSA 5DZEA 2ZA9A 3RJ2X 1ENSA 3VB9A 3RI9A 4AGRA 2QTWB 3O1PA 3UGGA 1ASJ2 1DP0A 3RZGA 3ZN5A 1FPN2 3IDBB 2CY6A 1H8VA 1GQGA 4CCJA 4DXSA 5LCWL 2E6VA 1H2NA 2ZHKA 2GC3A 5A70A 3WNXA 4GXLA 1YIFA 3WD5A 1RUD2 4ZU7A 5A33B 5CAZA 4DEVA 3PUIA 1UZVA 4RHV1 3V65A 2XDVA 3O1MA 1W3XA 1C1FA 1EAH3 1RUH2 2V4VA 3RWNA 1JS9A 3WW1A 1G8WA 3AXEA 3AJYA 4Q4V2 3T2PA 3WCSA 1CN1A 1BXHA 4CZSA 5KHIA 2ZKNA 3OBZA 2N7GA 4HK9A 1FOD3 2E7AA 2ZZQA 3OY8B 4AQ6A 4CU6A 3CDZB 3UJOA 3DKWA 2JG9B 1CAWA 3CMGA 4PF5A 3WF1A 4ASLA 3PIJA 1GFF2 4IL7A 1LHUA 2ARBA 1ZBE2 3WY6A 4DUVA 4AL9A 4BLIA 3VGIA 2VCCA 5JSOA 1GZWB 2HKXA 4NJ4A 3ES1A 3RYPA 1DGLA 2R1DA 2RS53 4F83A 1JMUB 3H8OA 3S0MA 1C57A 5HV4A 5SV5A 5FWJA 1O3QA 3LSDA 3WNLA 4M01A 1UMHA 1HV0A 3HMYA 4RQPC 2RVAA 1ZZ9A 2F6BA 1XNDA 4LHKA 4CP2A 2Y6HA 1R092 2V5YA 2ZCWA 3ZPOA 2R1BA 1NA1C 1AX1A 2E32A 3BOPA 2CGNA 2KD7A 4W6YA 5E1RA 3EMRA 2P1BA 2RS13 4I0AA 4BQ5A 5CKNA 2MEV1 1SZBA 4Y1YA 1YYNA 1K45A 1MS1A 4EWDA 4NHYA 1UF2C 1W9FA 4YVWA 1TME2 4UW5A 1EPZA 2LROA 3N7KA 4Q4Y1 4RS5A 5FY4A 3WXPA 4BE3A 1QY4A 2QVSB 2JD9A 4Q0UA 2QE3A 4LA3A 1SBDA 2KM2A 2Q8DA 3ZOIA 1BBT1 2BBAA 2DCTA 2H0VA 3K48A 2VC9A 3O1RA 1O5UA 1WA6X 2BFUS 2XH6A 5T5LA 3TEYA 4JX0A 1WWYA 1HX6A 2DYCA 4MO3M 3UGHA 3WQ1A 3VKOA 2HWE3 1XE8A 1VB4A 2VH9A 5A1FA 2NPIA 4SLIA 2BFUL 2C1FA 5L9RA 3UV9A 2BGPA 4AVBA 1M06G 4Y4RA 5FZKA 5J96B 1O8SA 4A42A 1QEXA 4IV3A 1OD5A 3I3QA 2W47A 3AZVA 3J7NA 4WZCA 3O1OA 1HXS1 1XE0A 1IQDC 2DFBA 2IXCA 2JG8C 2Y6GA 2Z4FA 3M3QA 3CNAA 4QB6A 2WFF2 5FIXA 4QX3A 1XE7A 2H6BA 4CU7A 1ND2B 3SMHA 1XSQA 2WO7A 3L2HA 1CESA 3Q8BA 2JXAA 1VB2A 2ZPXA 3VDDA 3VLBB 1UYZA 1TEIA 2JICA 2RR13 2WS93 2ZHLA 2PHWA 3DPRC 4N7IA 4WVMA 5CA6A 1HJFA 5FXVA 3QH6A 1LGNA 5KC5A 1V70A 1PX3A 1ND3C 5FMOL 5BXXA 3RFRA 3GBWA 2YB7A 2VVDA 1F5JA 4H7LA 5FZ3A 4AXOA 4P00B 4FO9A 4CDUC 5DG2A 1EAH2 4PBPA 2A75A 2DBNA 2XXZA 1DU3D 3POFA 4M0HA 1Z7S1 2HWD3 1FOD2 5T5JA 4ZPIA 3T30A 5LA9A 3VBRA 3FX3A 1A3KA 3SH5A 4CCDA 1RUG3 4KG8A 2JENA 2PFWA 2JB8A 5I91A 4O7XA 1K3IA 1DYKA 1RVF3 1Z78A 3B69A 4G3YC 4Y5SA 1ULEA 1W6OB 4U36A 4UYBA 3OUHA 5FZFA 4HKLA 5IVCA 4NIHA 2RS52 2BNMA 5AVAA 4AYUA 4EV0A 3B00A 2JE7A 5LRSA 5FZOB 2AR6A 2D6KA 2ZJCA 5FQ0B 2VPVA 3FHQA 5IWFA 3RYKA 2CGPA 1AYN1 2VQ0A 3POGA 4Y20A 2I45A 1DQ6A 1GQHA 2ZMLA 4YPJA 3ZFGB 1NQDA 3BUCA 2QDNA 4QB1A 1QWRA 1RHI1 5IVVA 4CXYA 4CXWA 4FTSA 2QUOA 5DDJ3 3E5XA 5AC93 2PQSA 2RS12 2ZX4A 5CYYA 1LR5A 3ZFEC 3KSCA 5JI7A 1FXZA 4QQ2A 2XUEA 5GZGA 5L9VA 1VPHA 2GNMA 4ASMB 3DXTA 1F9KA 2EIDA 4JGZA 5FPVA 5GZEA 4CU9A 1SLAA 2GALA 5BNNC 2E63A 2WA3A 1CGPA 2DCKA 4XETA 4CDXA 2ZEZA 4MYEA 1E5RA 1O6UA 3BTAA 1QJU3 5BNPB 1OI6A 2D6OX 2HWE2 3A21A 1RUE1 3MUZ1 4XMAA 1GWLA 2ZABA 4JKMA 4RFT0 4B4RA 4CCMA 1GOGA 3BYWA 4YGCA 3THDA 3LKJA 2BYVE 1C5IA 4Q5OA 2D6LX 2DU0A 4KMQA 4IETA 1OOPA 2X53S 1XSRA 3ACGA 1JOJA 3NL1A 5LEKA 1A6CA 3MIFA 3ZFFC 1F15A 1HQWA 5L9BA 4CEWA 2VR4A 2LUWA 3HBKA 4NROA 5BPXA 1IHMA 1N3PA 3OSDA 3AYEA 1OH3A 1MEC3 2ZGNA 1FNZA 3H8UA 4FOWA 4TLFA 4XBNA 4XJ9A 2WS92 2RR12 1RUF3 5DAVA 3HNBM 3ZXGA 2WNUC 4Y33A 1P8JA 4BDVB 3MIHA 3UETA 4BYYA 3TEWA 1QDCA 3VBOA 3OBRA 3QBQA 3POBA 2ZKLA 1T6BX 4DXTA 5J3UA 1C28A 3KMHA 3OD4A 3LOIA 3WDTA 4YNIA 1W8TA 1K5JA 2IVJA 2GMMA 3K3NA 2WUHA 4A7YA 4LKDA 1XPWA 2JDPA 5EV7A 4AFAA 2Z42A 5A6XA 1SMVA 2CDOA 3HT1A 1JYIA 4AR2A 2ZXQA 4COZA 4IEWA 5CFDA 2YFUA 4QPIA 1REFA 2BEOA 2HWD2 2RMU1 4IV1A 5FYVA 4Y5Z0 3P1IA 4E2SA 5C71A 1M4WA 1RUG2 4NHXA 3C7HA 1PZ7A 1C4RA 4XDQA 1EYBA 2A6ZA 2ORZA 2PAEA 1QJX1 2RHPA 4B7KA 4J25A 1RVF2 1Y43B 1NLSA 1UXZA 4PQQA 1D0GA 1NCQC 4ATFA 4QXBA 1UCXA 2OT7A 4GKYA 3MUY1 4GMP3 4ET7A 2GMPA 2ARCA 2CHHA 1YUDA 4AEDB 4LXLA 2RJ2A 1Q8QA 1DQ5A 2PHDA 1OPMA 2D5FA 2A7AA 1K5MC 4CDQB 4CYDA 1NZCA 1V00A 3CU7A 1VBB1 3QD6A 5D1IA 4YYOA 2IXJA 2ZGLA 3AKQA 4QXCA 2XR4A 4AHZA 4Y1VA 4AWDA 5DDJ2 1J58A 5AC92 3KLSA 3C7FA 1VAVA 1DLLA 4LLFA 3AM2A 4ARYA 2R063 3FWEA 1IOAA 1D2SA 5A7WA 3GCXA 2Y6JA 1SFNA 2RS33 2PLV3 2WA4A 4M3CA 2VZVA 4P5YA 4NHKA 4Q1RA 4FXGB 3I2DA 3S5QA 2W68A 1AR73 4ORFA 4YRDA 1GZCA 3VHRA 3PU8A 2FBEA 1ULDA 5LASA 4PLNA 4AFBA 3OEBA 1QJU2 3X29B 3LEIA 1OD3A 1OSGA 4XIKA 3T1MA 4JQTA 4NWWA 1OQDA 3NNFA 5FYYA 2I2SA 1B35A 1G86A 3HPNA 1W8UA 2QQMA
chains in the Genus database with same CATH topology
2PHTA 4I0WB 2QJVA 3N36A 1XNKA 3BOWA 3OTFA 3LAGA 2PHFA 3AMPA 2Q1MA 4XFCA 1V6IA 2XWBB 3AZYA 2DV9A 1NLRA 4XF0A 2D3SA 1DZRA 3OPZA 1MEC2 3MICA 5L7OB 2G9FA 2DTYA 2BGCA 2W0XA 1WUVA 2QKDA 4Q29A 3WDWA 4YM0A 1RUF2 3M7AA 3VBHB 1GYKA 4RR3C 1PK6B 1SQ4A 2X5IC 4K1YA 3NV2A 4QQOA 3C2UA 2ZHNA 3AJZA 4GA9A 2WWSA 1MQTB 4OLLA 4XXAA 4IEVA 4LE3A 1S0JA 1QMJA 3R0RA 5AFEA 1QQP3 2RM23 4OHWA 3H3ZA 1F31A 4FXKB 2DVGA 1ENXA 2B5HA 1OQEA 2HWC1 3UL2A 5HBAA 2WNVC 2DVAA 2K0GA 3ZN6A 4D7TA 4QGMA 3QACA 1DHKB 1REEA 3HWJA 2Y38A 5A32A 4QQPA 5IK4A 3B9CA 4KWJA 2V09A 1CAWB 4CEYB 4LTAA 4MGKE 4BA6A 1JN2P 4NR1A 3VZNA 5L19A 2Q5TA 2UY8A 5C8CA 3ACLA 1DQ2A 2EXIA 1F2NA 1PGL1 3HR9A 2R062 3VBSC 5JAXA 2ZAHA 4LT5A 4D7SA 1X36A 3MYXA 3OGJA 2RS32 4GMP0 4MSVA 3SISA 2PLV2 4N53C 4YW5A 5FDBA 1RGSA 2JDZA 3FC0A 1AR72 2DUOA 5JVVA 1KFUL 4YVSA 2UWAA 2GU9A 4DB5A 2EA7A 2BVBA 3MPPG 1UKRA 5FOJB 4P9GA 1YFUA 2VUAA 3GBFA 4HVRA 1MVEA 1VBD3 2ZBJA 2B46X 4EJRA 5H9PA 1LU2A 4YVWB 4IEXA 4BZ4A 4Q0QA 1V6NA 4RS5B 2YC0A 3ST7A 1AL0G 1S0FA 4IERA 2OZ6A 4CDWC 4A7ZA 1QU0A 4BQ1A 1AYM1 4LBLA 3WHTA 4GB33 1KDKA 1IGOA 1I6XA 4LA2A 2FQPA 2ZGKA 1CAUA 1PVXA 1DG6A 2DVBA 4I3GA 4GULA 5KHJA 3ES4A 4IV3B 5JCTA 1LGBA 1V9U3 3WG2A 1NE4A 5BNOB 3AP7A 1PGW1 1NCRC 1G9DA 3FLRA 1QDOA 3KZ4C 4JVAA 4XQDA 5HCBA 3WQ0A 3DF0A 4AGVA 3H3UA 1QQP2 2D6MA 3JD71 5ABJC 1CD3G 1MZEA 3VDDB 2RM22 4WVMB 1H1IA 4QT6A 5T54A 1RIRA 4FPLA 3BCWA 1DIWA 1LEDA 4JDMA 5GKAC 2PA7A 1QXJA 4MV2A 2GMEA 4EN0A 3I59A 5J48A 1ZA4A 1R083 3VBRB 4AQ2A 4DQAA 5KXBA 4ZXKA 3B9IA 4R9AA 3AMMA 4JV4A 1YRZA 3ZXKA 2FMYA 3PLQA 3H7YA 3WDUA 2A6VA 5C9AC 3MZHA 3AP9A 5CBLA 2XL7A 4W6WA 2ZZJA 4BWOA 1CIWA 4K7JA 3WLUA 5GLUA 5DG1A 1PHMA 2YGMA 4Y20B 2UY9A 4ZKTB 4FTEA 5F1RA 1LB2A 4P9LA 4GH4C 3AMQA 3M3OA 1W6PA 4HETA 3WW2A 1X33A 1VBD2 1MZ6A 4BOWA 2XUMA 2E7TA 2UU8A 3PMEA 4L9BA 4JGZB 3D6EA 4R8HA 1Z0HA 2BVVA 4PLOA 3AYDA 1MS5A 2VMIA 4CDXB 4LBQA 1AR81 5T5OA 4QQLA 2VMHA 4GB32 3NO8A 2PHLA 3V0AA 4GWNA 1I5ZA 1SLTA 2D6NA 1IKQA 1XYPA 4HKWA 4PDWC 1OOPB 3VZMA 1D4M2 4I09A 1SLCA 1V9U2 1SLLA 4CEWB 5EYXA 3UKNA 1VAKA 4E4ZA 2SLIA 2B7YA 5EFUA 1UAIA 3AFKA 2XJVA 3PJYA 4JTOA 3E6BA 1AXYA 2VECA 1BMV2 3VBOB 1KS5A 2B8MA 3VHOA 1RUC3 4ES9A 2UYBA 3WV6A 5J37A 4LLOA 3P3NA 1GANA 4GQ7A 2A6XA 1VALA 4A7KA 4XBQA 1LOGA 1W6NA 2XVLA 1VBA1 4EN7B 1QNYA 1AHSA 4YW2A 4FPKA 5CFDB 1IKPA 4I30A 1WLCA 4QPIB 5E16A 5I8YA 2E9QA 2YMZA 4MZUA 1LHNA 1R082 4IV1B 1Q8PA 3EO6A 2X8KA 4FOQA 3GF6A 2HWF1 3AZXA 5IUQA 4HVOA 3M3CA 1IPJA 5FCCA 1QNWA 4OI1A 3TN91 4WM8A 3PVNA 3BPZA 5J98B 3VKFC 1ZZBA 4J1WA 5BNQA 2WJSA 5GLTA 1PM7A 1MS4A 3E6DA 4P9JA 4XFGA 2R043 3ROUA 1QGLA 1V6KA 4PIYA 4URTA 3ZX7A 4X6RB 2DF7A 1NCQA 2OYZA 3WCRA 2EAAA 1UN1A 5B2GB 3RG0A 1JUHA 2BNNA 4QPGB 2VOWA 4KBBA 2VOXA 1H30A 3ZIXA 4M3CB 1K5MA 2KXLA 4D3WA 2IFRA 2NP0A 1C8M1 1GV9A 1GBGA 1S0CA 2CWSA 3AB0A 3KCXA 3M2MA 4QX5A 2R32A 5H9RA 3JZVA 3WP6A 1HRI1 4AHWA 1B35B 4CP0A 1BQPA 3JBG3 1LULA 4I02A 4AVCA 3LOBA 4UW6A 5A3MA 5LK7B 2DTWA 4JC1A 2HEWF 1DQ0A 5KHGA 4WM7A 4Y22A 2D7FA 3U4XA 1ENRA 5GZFA 3G7DA 1XRUA 3U11A 2MPFA 1HRV3 5JSPA 3IT8A 2D6PA 4OI0A 3URFA 3ZYPA 3GNEA 2WZR1 4JTNA 3NAPC 4Y1ZA 3PMSA 1YI9A 5BUVA 1RUC2 2PAMA 2MHFA 5KXCA 3RQ0A 3FLTA 1PO23 1RTVA 1JUIA 3H0OA 3WDVA 4BCUA 1PIV1 3WHUA 4YZ1A 3WW4A 2XB6C 4X8NA 5ACA1 1IPKA 1FV2A 1UZYA 4Q4X3 3ZYIB 4RR3A 2ZHMA 2X5IA 5DZFA 1D4VB 1EPWA 4PLMA 1UPSA 3L2YA 3THTA 4DMIA 2UYAA 2OUJA 3VKMA 2ZGOA 4LUKA 1G9AA 3KT1A 4AK3A 3IPVA 1LESA 3ZN6B 3NVCA 2LALA 3BODA 3H1WA 1VLNA 1WMEA 2XL9A 1YXWA 3AFGA 1RUJ3 1AR93 4XFFA 5KBFA 3SCGA 5A32B 1LOFC 2R042 2R30A 5CB7A 1VBE2 2B45X 4XPVA 4HN1A 3AKPA 2MNGA 1BEV1 4R9CA 5C8CB 1ZBA1 1YJKA 3IIAA 4LULA 1JH5A 4DRRA 3LA2A 1AZDA 3SH3A 3AZWA 5T50A 3RPQA 3D0JA 2ZOEB 4AGGA 1W6QA 1J59A 4U2AA 1V6MA 4MX3A 1KQRA 4YVSB 3GALA 5T5PA 4EWAA 4C0BA 4SBVA 1RUI3 3S7EA 2GN7A 4G4FA 4HVQA 1U5XA 1R1A3 2PHUA 3JBG2 3VBSA 3J8F3 4B8EA 1FMD3 2NN8A 1NOVA 3I54A 3RSJA 2HWB3 4N53A 3ATGA 3TB0A 1ZRDA 1GNHA 5C4WC 4TZDA 1VRH1 5I8SA 4E27A 1AL21 1QHDA 3ZSKA 4Q1PA 1SEFA 4M3CF 1HRV2 4I3PA 3WOGA 2C5DA 1CAUB 4COYA 5T55A 4XFAA 4AHYA 1YO8A 4XXPA 3JQWA 1DGRN 4RHV3 4WV8A 1YCIA 4CDWA 4Q0SA 4XE9A 1PO22 1J3QA 2QCSB 3LWCA 3ZDSA 3MLJA 1O5LA 1SLIA 2VNOA 1MR5A 1ZRFA 4BPZA 4J1XA 4AQSA 4E2GA 1GKBA 4Q4X2 2VG9A 4XF4A 2ZTNA 4GKXA 3WP4A 4Q27A 4LR4A 4MUVA 2X29A 3EXUA 1H2KA 4QMAA 4YGBA 4Q8KA 1RMU1 1OFSA 4XEZA 2YV8A 4EN6B 1DF0A 3WINE 2ZGTA 2GH8A 3NSTA 3MW2A 5ABJA 3I59B 3USUA 2XLFA 3ZIWA 1RUJ2 1AR92 3MIEA 4HMZA 2MEV3 5GALA 2GNBA 2CAUA 3MIGA 3ENRA 1LEMA 4X8PA 1HLCA 4Q4Y3 5CG8A 2D98A 3FZ3A 3TNPB 4RD7A 1IS3A 3WX5A 5FBZA 3TAYA 4KL1A 2O1QA 1BBT3 4LBOA 4P5HA 1UD1A 2GZWA 5CVRA 5KHHA 1C3HA 3CJXA 1BK1A 3ME2A 1N1SA 3ZXDA 1WW4A 1PO11 1AX0A 4R4XA 1KFXL 1RUI2 3N7LA 4B29A 1W6PB 2QZ3A 5JOXA 1R1A2 4AQTA 3J8F2 1OA3A 1LECA 2FZ1A 1FMD2 2W52A 1HXS3 3V56A 1SCRA 2HWB2 2WT0A 2NQYA 4KNCA 4Y26A 1VP6A 1WGPA 4LBQB 1KJRA 3EHKA 1DDLA 2JKBA 1SFYA 1AR61 4UW3A 3V0AB 4Y4YA 1N47A 2ZACA 4P9IA 4AEDC 4RGGA 2PYTA 4YW1A 5H9QA 3H50A 2EXKA 1NG0A 3JB4C 4RHV2 4CDQC 1O91A 4LO4B 4K1ZA 1L3JA 1DYPA 2DCYA 4M00A 2BPA2 2Y0OA 3LA7A 4JGYC 2ZGRA 1Z7S3 1CAXA 2A6WA 3T2TA 3MW3A 3WG1A 4YG3A 1RUNA 3AKRA 1OLRA 1OQ1A 1Y9QA 1H9PA 3B7MA 3LB9A 2C0ZA 1UIKA 4MGYE 4XFHA 1W2UA 2VY0A 1WMDA 4KG0A 5KWRA 2PAKA 1YIPA 3OBTA 1VJ2A 2CV6A 3KCYA 3SCFA 4FOYA 1AYN3 5JSRA 5HI0A 5BY5A 1W6NB 2WNEA 3M3EA 1Q5OA 4FQ4A 1RHI3 2XJUA 3W58A 3M8LA 2VOKA 1WW7A 1CJPA 1PNGA 3PJQA 1UU5A 4KWLA 2ILMA 1WBLA 2D3RA 1POV1 2MEV2 1PVC1 1HQLA 1J1TA 1QXRA 4QPGA 2ET7A 2RJLA 4Q4Y2 2D93A 3O0WA 4OHYA 3U0ZA 5L7OC 1YLLA 4WM8B 4H7MA 2A71A 2H6CA 3EQEA 1BBT2 1LTEA 5JLVA 2EXHA 3A4UA 3WVJA 2B39A 1W0OA 3VBHC 1PK6C 1RUE3 2IC1A 4I2OA 4L92A 1R1ZA 2EF6A 2ZX2A 4P9WA 2WL1A 3CL1A 3WT3A 1HIXA 4XJ8A 1NCQB 3B93A 5K0UC 2VQAA 2R071 1HXS2 2VU9A 5KC6A 2A3XA 1X8EA 1K5MB 4NWVA 1PZ9A 1COV1 1HQNA 1TMF1 1VBC1 3AP6A 4YG6A 2ERFA 4TSVA 3CJIC 5JOWA 2R49A 3RMXA 2JE9A 5JOZA 1WD3A 2JECA 3N7JA 4YLZA 3RMYA 4CTEA 1AR63 3HN1A 2H0BA 2E7QA 2VUJA 3N4MA 1A8MA 3D4KA 4B7EA 2XBO1 5C6CA 3MF9A 4WBBA 1KITA 4CEYC 3ZN4A 2UWCA 4WM7B 4Y22B 1OA4A 4XOGA 1Z7S2 2RMU3 4Q26A 1UU4A 4HSJA 5FO9B 1G9FA 1NY71 2UWBA 5FLJA 1QJX3 4Z07A 5EWSA 1J3PA 3NV1A 4XQ4A 1ULCA 2Y26A 1Q8SA 1REDA 3MDPA 4N90A 2QNKA 5D8AC 4P14A 2DCJA 3TWIA 1AYN2 5J36A 4B3NA 1VBB3 1H0BA 3ZSJA 1PZ8A 1RHI2 2XJTA 4XBLA 3FFQA 1DZQA 4YVWC 2JX9A 3INAA 4RR3B 3ILFA 1I3HA 2W39A 3NAPA 4YW3A 2X5IB 1PMIA 1O4YA 2YPJA 5T3NA 4HK8A 3PVOA 3J9SA 3WG4A 4FPGA 4YZ2A 1LOCA 3IPVB 4FAHA 3IMNA 5EJ3A 2YROA 4Q4W1 1UW8A 4IQPA 1VR3A 1RUE2 3ZSLA 2JD4A 4IV3C 4DZGA 5BNOC 2XKPA 2DFCA 2YZ4A 2VW2A 3BB6A 4RQPA 1PGSA 1CAVA 4K9SA 1NA1A 4XJAA 5FOBB 2R073 3VDDC 4XFBA 1W6QB 4AEJA 5LEJA 2IWGB 3B5LB 3GZTB 3N3HA 5CFCC 1ALYA 1LCLA 1H1AA 2NYYA 1LOFA 3T1LA 1TMF3 3NV4A 4O9EA 3VKNA 4XF3A 1S55A 4LE4A 4MXVA 5H9SA 2ZMNA 5FAXA 3DUIA 3VBSB 3S6PA 2IXHA 3MFCA 4C90A 2A70A 4N7UA 4N53B 4C1WA 2NLRA 3VBRC 3VHNA 4S2FA 3JCIA 1XXNA 2R6QA 3EBRA 4OI4A 2RMU2 2EAKA 1EV11 4COUA 3VL8A 3W9AA 5K7PA 4OULA 5I93A 4JRLA 2HWC3 3MEPA 4K3UA 4QPYA 4LBNA 1QJX2 2JG8A 1S1AA 3AYCA 1ASJ1 3UKVA 2LM3A 1FPN1 5C4WA 4CDWB 2VGDA 2GAUA 2XWJB 2DWRA 4R9BA 3DPRA 5GM0A 1LENA 1RUD1 1V6LA 2Z5WA 5CIRA 3ILNA 1VBB2 1SBEA 3FFZA 1ND3A 1RUH1 1LODA 4Q4V1 4COWA 3PVBB 4FPOB 5JI9A 1AXKA 1H8TC 4A2UA 4AG4A 4CDUA 4MVTA 1WD4A 2XHKA 1ZBE1 2RJKA 3HIFA 2R0HA 5FLIA 2ZAAA 1SACA 1XYNA 5IK7A 1S2BA 5KXDA 5F6LB 5ABJB 3USUB 1FI2A 2WLQA 3LSEA 2VNRA 4X6QB 5JZGC 1UZZA 2ZX1A 4ES8A 1R091 4Z1VA 4CEWC 2OW4A 3WZ1A 1S0BA 4K6BA 4AE2A 2BBVA 3FUOA 4XFIA 3O12A 3E6CC 1I9RA 4K40A 4C1XA 1WCSA 1ZZ7A 4GALA 2A6YA 2BTVC 2IXLA 2R072 3VBFC 3ZMOA 5CADA 1CR7A 5SV8A 1TME1 3O0XA 1AYM3 3WR0A 1YJLA 3I4IA 4LUMA 4TWTA 3ZFEA 3VBOC 1GR3A 4HPKA 1TMF2 2V73A 1TNRA 1U5YA 3P3PA 3A0NA 4NVPA 3CLPA 1FATA 5C33A 5BNNA 3NW4A 2AYHA 2A73B 3MF6A 1JBCA