1QMJA

Cg-16, a homodimeric agglutinin from chicken liver
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
132
structure length
132
Chain Sequence
QGLVVTQLDVQPGECVKVKGKILSDAKGFSVNVGKDSSTLMLHFNPRFDCHGDVNTVVCNSKEDGTWGEEDRKADFPFQQGDKVEICISFDAAEVKVKVPEVEFEFPNRLGMEKIQYLAVEGDFKVKAIKFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The 2.15 A Crystal Structure of Cg-16, the Developmentally Regulated Homodimeric Chicken Galectin
pubmed doi rcsb
molecule tags Sugar binding protein
molecule keywords BETA-GALACTOSIDE-BINDING LECTIN
total genus 28
structure length 132
sequence length 132
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1qmjA00
1GZWB 2WT2A 4FOWA 1C4RA 4KBBA 3WG2A 2D6MA 3FUOA 3NV2A 1V6IA 4DRVA 1O4ZA 4YFZA 3Q9OA 2A3YA 4P9XA 2VUAA 3N36A 4GWMA 3RG0A 1N3OA 3DGTA 2BQPA 4YLZA 4I30A 5F5QA 1FAYA 1LOFA 3AYEA 1UPSA 4AVTA 2ZGLA 1WW7A 2GALA 3ILRA 4PCRA 1DQ2A 5E89A 4DQAA 5IK8A 4ATFA 2ZGOA 1ULFA 2EAKA 4K1YA 4D69A 4Q1RA 1UN1A 1LU1A 2ZHLA 3M3QA 1CONA 2D7FA 5T55A 1S1AA 1ULGA 3V64A 2EF6A 1MZ6A 1ULDA 1VLNA 1JW6A 1IS3A 1IS6A 1PZ8A 1GBGA 1JUIA 1WBFA 4C1XA 5GZCA 1HKDA 2EIGA 1LOCA 2VU9A 4XBNA 3WDVA 4P9YA 3T1MA 2JJ6A 1G9FA 4M01A 1BKZA 3ZYRA 4FP3A 3T2TA 1MS1A 3IKWA 1O4YA 1AZDA 2JECA 3R4SA 4PBPA 4F83A 1LEMA 1UX6A 3W59A 3IPVB 5IK7A 2ZGKA 2PHXA 3JUUA 2GDFA 1AF9A 4RL7A 2NZ9A 4FPGA 2VY0A 4NO4A 4AGRA 2WLQA 1QKQA 3N7KA 1GZCA 4LBLA 5DUVA 4Q8KA 2WQZC 2YZ4A 4FPLA 4BPZA 2P34A 1SLCA 2ZABA 2AH2A 3HMYA 4R9BA 4UW4A 5T5OA 5KXEA 3ZXFA 2ZBJA 3UJOA 2GNTA 3V0AA 4Y26A 1MS3A 4ATEA 5GZFA 3FLTA 4Q2FA 2PHFA 2DUPA 1W6QB 1AJOA 2FHRA 1GICA 5FRAA 1AX0A 1Q8PA 1V6JA 2A6YA 4JCKA 1CJPA 3AZXA 3AFKA 3MW3A 3I4IA 4DS0A 1W6PA 4WVWA 3AYCA 2UWBA 1DQ0A 2DTWA 5H9RA 4RA0A 1LEDA 2Q5TA 5DXDA 4ZXKA 3WNXA 3RQ0A 2P3KA 1C1LA 1LESA 4BOWA 4DRRA 1OQ1A 5H9SA 2E6VA 4XHBA 3ZSLA 4GXLA 3NV3A 4JC1A 2Z42A 5E8AA 3GNEA 1QMJA 4FPFA 3RMYA 3NV4A 3CNAA 1UL9A 1V6NA 3LSDA 2ZGRA 3VKMA 1AXKA 2PHUA 2WSVA 4FPEA 1OFSA 3AK0A 1ONAA 1LOFC 3WDTA 2D3PA 2JE7A 1G7YA 1MVQA 1JYIA 1MR5A 4XE9A 1BYHA 5GZGA 3OYWB 2NP0A 1QDCA 2B7YA 2W08A 3D6EA 1N47A 1ULEA 1DLLA 1ULCA 1QDOA 3AP6A 1S0BA 1SLBA 2DTYA 4FQZA 3V0BB 4ASMB 1N1YA 3M2MA 5EXOA 1G9DA 2RHPA 5T5LA 2H0BA 3OY8B 5FREA 3WLUA 2ARBA 3B01A 3UL2A 3JU9A 1DQ5A 5GLTA 3WG3A 3WHTA 2A71A 1MS9A 4P14A 5CNAA 1S0EA 5KXBA 3AJYA 3SLIA 3AX4A 3R05A 1HDKA 3AP9A 4GALA 3WDWA 1Q8SA 3PVNA 1FNYA 4XJZA 5DUXA 1A3KA 1UKGA 3VKLA 3USUA 2JE9A 1IKQA 1QOSA 1YRZA 5CAZA 3ZXJA 1GSLA 1SLAA 1F5FA 2A6XA 1SACA 1WUVA 2D6KA 2PELA 1JBCA 3O0VA 2A70A 4XYXA 2JKBA 2OW4A 3T1LA 1KITA 1CPMA 1SLTA 1FV2A 2ES3A 4FPOB 4YM0A 3W58A 4W65A 4PF5A 2ZMKA 4PBOA 4K21A 2WSUA 1C57A 5DZEA 1H9PA 3WUDA 3FUQA 4WZFA 4LBOA 3ZSMA 3B00A 2W52A 3UK9A 4BMBA 4XXAA 2UURA 3NWKA 5JVVA 5IK4A 1JHNA 4K1ZA 3N7MA 4Y1ZA 2W39A 4XTPA 2GN7A 2DVDA 2AR6A 4R9CA 4Y1YA 1LGCA 2G4IA 4P9WA 4YM2A 3WVJA 1CQ9A 3KQRA 4DPNA 1QNWA 2ZGPA 1GANA 2A3XA 1AJKA 2WT1A 5GZEA 1LU2A 3A0NA 4Q26A 4XTMA 4YG3A 5HCFA 3WHUA 3D4KA 1MZ5A 2D3RA 1LHVA 4XHXA 3FLPA 3ZYPA 1BXHA 2NMOA 3OBRA 2ZKNA 3POSA 3WDUA 1U0AA 2D3SA 1LTEA 2UWAA 4YW3A 4AVVA 3AP5A 1SCRA 5DUUA 2P37A 3B69A 3SH3A 3SISA 1ENRA 1JYCA 1V00A 3BTAA 4YM3A 4ISRA 2GN3A 1QU0A 2PHRA 2VXRA 1IS5A 1W6NA 1G9BA 1FNZA 5JLVA 3AXEA 2WT0A 3ZSKA 1WBLA 5HCAA 4GWNA 2VH9A 4UW6A 3B3QE 4YGEA 1CN1A 4UW3A 3AJZA 1DYPA 1DBNA 3AP7A 1AX2A 3MPPG 3R4UA 4HL0A 1SCSA 1W0OA 1YYNA 2DVGA 4YW1A 3A4UA 5GLVA 1UAIA 1RINA 2ZHMA 4Q8LA 1Z78A 4LBQB 4BQ1A 1F31A 2ZGMA 4CRQA 3M3EA 1DIWA 4XMAA 2CY6A 4PQ9A 1LHWA 2SBAA 4R9AA 4BM8A 3WCSA 2P3JA 3UJQA 1GNHA 2DUQA 2C5DA 2UWCA 4Y20B 3PVEA 4JRAA 1KQRA 5GLUA 3FFZA 1J1TA 1G86A 1WLWA 2TEPA 3L2YA 1AX1A 2C9AA 1MS5A 4FOQA 3SITA 4M00A 3V0AB 1YIFA 1CVNA 1GZWA 3PJQA 2DVBA 1OKQA 4FPJA 4MYEA 1SBDA 1MS8A 2YMZA 4CZSA 1KJLA 4YZ5A 1IOAA 3ZVXA 2DWRA 1AVBA 1LODA 2DYCA 3WG4A 3MEPA 2XG3A 4XJAA 2A6ZA 1N1SA 3WOGA 2AREA 2NYYA 1UZZA 2SLIA 1I3HA 3FLRA 3O0XA 3USUB 4FQ4A 1DQ1A 3WCRA 4AGVA 1S0IA 1WLDA 2CWSA 2R1DA 2GNMA 1FATA 4LBNA 1QOOA 3IMNA 2ZGNA 1GZ9A 5JOYA 1G9AA 2ARXA 1RITA 3VKFC 1LGNA 4XJUA 1W6QA 4BLJA 1MVEA 5DZGA 3VUOA 3ZXLA 3IM0A 2GMMA 1N3QA 4XXPA 3VKOA 1GYKA 2NM1A 4YG0A 5AVAA 3MW2A 1DYKA 4GKXA 1WD3A 3GALA 4XBLA 1W6MA 2JD4A 1V6MA 4ITCA 2ZGSA 1YO8A 3PMEA 1BQPA 1CESA 4Z8BA 3QLQA 3VKNA 4C1WA 2GNBA 2D6LX 2GMEA 3M1HA 4XBQA 4Y22B 1LOBA 4UW5A 4YZ1A 1JXNA 3M3OA 5EYYA 1F9KA 1PZ7A 2YROA 2ZGQA 1GV9A 4XILA 4U36A 2DU1A 2DURA 2DVAA 2XB6C 5IUQA 3WDYA 4XOGA 5CBLA 1LHUA 1A78A 1SFYA 2DU0A 1APNA 2I2SA 1G9CA 3OBTA 5EYXA 4YZ4A 3AXDA 3OYWA 3SNMA 2OUHA 3ZSJA 1IKPA 1LGBA 3I8TA 3INAA 1R1ZA 3AZVA 1H30A 3O12A 4FPKA 3N7LA 1LOGA 2CL2A 1LULA 3H0OA 3WZ1A 4Y1UA 1LHNA 2CWMA 3BIWE 3SH5A 1WW4A 1ENSA 5CB7A 4M3CA 1W6PB 1W6OA 2A5ZA 2EXHA 4IQPA 4CTEA 4XMIA 5JOXA 3N3HA 5KXCA 1V6KA 5GLZA 1ZA4A 3U4XA 4YGDA 3POWA 2ENRA 2NN8A 2R0FA 4YZ2A 2ZGTA 4M3CB 4Y1VA 1RIRA 5DUWA 1IS4A 1S0DA 2NMNA 3AZZA 2D6NA 3AZWA 3WG1A 2EXIA 1GLHA 4FVVA 3FBYA 3LSEA 1N3PA 2GMPA 4YW2A 5L73A 3POYA 1Q8VA 4YW5A 1D2SA 3HR9A 3M3CA 4Y1XA 5JOZA 3AYDA 1V6OA 2CTVA 4XZPA 1B09A 1VAVA 1LECA 4YW4A 2EXKA 4LBQA 2E53A 3ILNA 1X50A 5IK5A 1QGLA 3N7JA 1URXA 2LALA 2R49A 1LJ7A 1GNZA 1QOTA 3ZXEA 3MW4A 1KDKA 1W0PA 4XDQA 4LBKA 2A3WA 5F9TA 2A6WA 4LBMA 1DQ6A 1AXZA 3ASIA 5T5PA 3BOPA 2A7AA 1GKBA 3AYAA 3SH4A 1S0JA 1HQWA 3IPVA 2ZA9A 1S0FA 4NOTA 1H9WA 4U2AA 2R1BA 3D5OA 4TYSA 5T54A 1MS0A 1Q8QA 4H55A 1W6NB 2A6VA 2ZMLA 4FOVA 1JOJA 4K20A 4LBQD 2ZGUA 4YGBA 1LOEA 2EALA 4L8QA 5H9QA 2VW2A 4AWDA 2WKKA 1AXYA 3N35A 1VIWB 3OJBA 4XJ9A 3AP4A 4GA9A 3RS6A 3V65A 1MS4A 3ZXKA 1JN2P 1BZWA 5IT6A 3AZYA 5DG2A 2WJSA 1WLCA 1WW5A 2ZMNA 4YG6A 2ERFA 1DGLA 3O5SA 1Z0HA 1Q56A 5BYNA 1CR7A 1Q8OA 2D43A 2YV8A 3TAYA 3OPZA 3LCPA 1Y7BA 4YZ3A 4BLIA 5GM0A 2ZAAA 1HQLA 2PHWA 3RMXA 2D44A 5GALA 1SLLA 1ZM1A 2E51A 5H9PA 5SV8A 1I1EA 4AGGA 5E88A 4FPHA 4R9DA 4FPYA 1HLCA 3ATGA 3TB0A 1SBFA 2AENA 5LK5A 3WV6A 1NXD1 4M3CF 4XJ8A 4FOYA 1TEIA 1FX5A 1YXWA 2DVFA 2HYKA 1CIWA 1DZQA 3DUIA 5T52A 3VV1A 2D6OX 1C1FA 1LCLA 4FPCA 4YM1A 4ZKTB 3NV1A 3PVOA 2CNAA 5T50A 4WVVA 1A8DA 1MACA 4HANA 4AYUA 4SLIA 3WDXA 5KXDA 3OY8A 4XIKA 1ENQA 3HN1A 4WV8A 5GJ6A 3O0WA 1EPWA 2DV9A 2YXSA 2D6PA 2AYHA 5CA6A 1D0HA 2V73A 4AVSA 3BODA 2VW0A 2R16A 1KDMA 1S0CA 1BJQA 3C2UA 4LBJA 2VW1A 1UMZA 3IN9A 4OZXA 1WCSA 1PZ9A 2ZZJA 2WNEA 4Y24A 2GNDA 4GKYA 1G8WA 5T5JA 1DQ4A 1W6MB 2FMDA 2ZACA 2ZHKA 1QNYA 1UZYA 1FYUA 3WUCA 1KJRA 4M3CE 1QF3A 3QCWA 1NLSA 5JDBA 4TZDA 1DFQA 5EWSA 1N1VA 2JDZA 3ENRA 1XQNA 4Y22A 3RSJA 4DFSA 4FP2A 4XIOA 3KM5A 1LOAA 1N1TA 2CYFA 1V6LA 2P2KA 2W68A 5DZFA 5GLWA 3B9CA 5JOWA 2KM2A 1SLIA 4Q1PA 4Q27A 2OUJA 2AUYA 1WW6A 5HCBA 2DUOA 1FV3A 3V0BA 1LHOA 3APBA 5DG1A 2OVUA 2EXJA 2ZHNA 3OGGA 1VALA 4XJWA 5JMCA 2PHTA 1KRIA 2YY1A 1WD4A 2LTNA 3ILFA 2E7QA 4Y20A 5GZDA 4BMEA 4YGCA 4YFWA 1S0GA 2R0HA 1VAMA 3ZPYA 2P3IA 3RRDA 1LENA 1YI7A 1DHKB 2UU8A 2V5YA 1CPNA 2AGSA 2A75A 3A0KA 4ISQA 1SBEA 2E7TA 1W6OB
chains in the Genus database with same CATH superfamily
3DYOA 2WT2A 2F4LA 1IHMA 4FOWA 3H9AA 4QPGA 1GOGA 2D6MA 4W8JA 3NV2A 5A80A 1O4ZA 2NPIA 1HRV3 1W2NA 3RZMA 2VUAA 3HWJA 5C33A 2TBVA 3DGTA 2PLV3 5FJHA 2FDFA 3TNQA 4CCCA 3P3NA 2RMU2 5T3NA 4FFGA 5I91A 1X8EA 2WWUA 1WW7A 5EIYB 3O1TA 4CCMA 1FMD2 1KS5A 1DQ2A 5E89A 4ZZ8A 2WAAA 4XFAA 2CGPA 4JV4A 4K1YA 4META 4CUBA 1UN1A 3HT2A 4PT6A 3V64A 2EF6A 4P08A 4W50A 1VLNA 1JW6A 1PK6C 5IVFA 4C1XA 2XJVA 1JZ8A 2E33A 3U10A 1HKDA 3P5BA 3PTRB 4UYBA 4XBNA 4EJRA 4MGTA 2HBUA 5C8CC 1EP0A 1IG0A 1EY2A 2GH2A 4M01A 2VNVA 1BKZA 2ADEA 3PU3A 3U37A 3DPRC 3CZUA 5FPBA 3ZYRA 5ACA3 3O1RA 4QM9A 3HBKA 2Y34A 3NL1A 3POIA 1S4CA 5IK7A 4XQDA 5JIAA 3UT0A 3LEMA 4YPJA 2GDFA 4RL7A 4AGRA 3ZFEB 5HI0A 1XB9A 4AFDA 5LY2A 1QIQA 4TLGA 3OUHA 5FZOA 4RFT0 5T5OA 5HV0A 2Q30A 2GAUA 3UJOA 5FYHA 3O7OA 3UV9A 3ZN5A 4Y26A 2DCZA 3WNNA 5IVCA 4ATEA 4AEDA 1CZVA 4XUQA 5CFDA 1OKOA 4ARXA 2ZEZA 1AYN1 1SPPA 5DAPA 1AJOA 2DDUA 4Q4V1 4XUTA 2A6YA 4KG8A 4YVWC 3AZXA 1HRI2 1PO22 1POV0 3AFKA 3MW3A 5EFUA 1XXNA 3LD8A 3T3YA 3VZNA 2UWBA 2J1AA 4XDOA 4XAEA 1LEDA 2Q5TA 3KMHA 2JDPA 2XOMA 5FP3A 4EZHA 4ZXEA 3RQ0A 3I3MA 4CP9A 4DEVA 1IQDC 4BOWA 4DRRA 2YYOA 2R043 2PLV1 4HPKA 4XCAA 3SEPA 4CXXA 4GJYA 2V4AA 3T2PA 2XXZA 5FYUA 1NLRA 5D2AA 1U5YA 5AVPA 3NKGA 1W8UA 2WC2A 3NV4A 1RL3A 1V6NA 5C4WB 5FDBA 3TEWA 2PHUA 1OFSA 3KCYA 3JD73 4COUA 4CEWA 1LOFC 4QGLA 4JRLA 4NHYA 1PO11 1G7YA 2QCSB 1JYIA 4HETA 4XE9A 1BYHA 3VBRB 3OYWB 4LO8A 3VBHA 1QDCA 2B7YA 2RVAA 5CKQA 5ABJB 1COV3 1ULEA 1S55A 3UGFA 2ORZA 5F5IA 2DTYA 1OSGA 5FZOB 1RJ7A 1LRHA 2GZWA 4FCAA 2C26A 1UQXA 3KVBA 4O61A 5FREA 1UOBA 3UL2A 2G1MA 1YI9A 2J1UA 1DQ5A 2WO7A 3CBNA 3WG3A 2VZ1A 1MPXA 4ES8A 1MS9A 5HPOA 2FDKA 4CE8A 5KXBA 3QH6A 4NJ4A 2XL9A 5EZWA 5C8CA 3RVHA 2VAUA 4M0HA 4E4HA 4J1XA 4RR3B 3SEEA 3AP9A 3WDWA 3LIGA 2O8OA 3SXWA 5FO7B 1ZZCA 5I8TA 2YBSA 2JICA 2XLAA 4N43A 2ET7A 1IKQA 2JE9A 3USUA 1V0AA 4AVCA 1OQEA 1VBB1 4XFCA 5FY7A 1W8WA 1ND3C 2A6XA 2BRTA 1F5FA 2D6KA 3GF6A 1K42A 3O0VA 1G9CA 4L99A 1FPN1 3T1LA 1SLTA 2X8KA 4QHZA 5AC92 4W65A 4N90A 1PMHX 3B94A 5E16A 5JXHA 1FOD2 3TRSB 4BIFA 1ZZ8A 2HWB2 3U78A 2VOXA 5DZEA 3P3PA 4CXYA 3FMGA 2WZR1 3FUQA 3LZZA 5K7PA 4LBOA 3B00A 1GZTA 2AACA 3UK9A 4CDWC 4BMBA 1VRBA 5FCCA 2G9GA 2UURA 4XXAA 2IZWA 4Y4RA 4YARA 3LDKA 4M4RA 2RS31 4QXBA 4K1ZA 3LOIA 3N7MA 4OZOA 4CCDA 3LFIA 2RJ2A 5C4WC 3E1F1 1RUI2 4JDOA 1PX3A 3M70A 4LOSA 4MGYE 4Y1YA 4TLFA 1QNWA 1RUJ2 5FYSA 1CAWA 2ZKLA 5JSRA 4N53C 3BU0A 3ELNA 3JD72 3VBRC 2D3RA 5BNOA 1BXHA 3OBRA 2Y6FA 3RZLA 1Y3TA 3RWNA 2P37A 5CFCA 1MQTC 1JYCA 3BTAA 4CCJA 4LO5B 4YM3A 3E6BA 3J7HA 4V1PA 1G9BA 1FNZA 2JG8A 2RS53 4JKMA 3LE0A 5FZ0A 2D98A 2ATFA 1U5IA 2VD7A 3DKWA 2JEMA 2B5HA 4LIVA 2E63A 5HCAA 1AYN2 1Y43B 3VB9A 4UW6A 2VUCA 2WS91 3ZFGC 3FHQA 5FZKA 1XNAA 1X82A 3AJZA 1DYPA 1I9RA 1WMFA 1HJGA 3FHIB 3R4UA 2RS33 5FK8A 3VDAA 1AR61 3POFA 3VZJA 4GZ9A 4Q29A 1RUF2 1YLLA 2WZ8A 4Q5OA 2CDPA 3A4UA 4NVPA 4A2UA 5LY1A 2Q1ZB 5E6HA 1RINA 2ZHMA 1GWLA 1RUD3 2Q1MA 5L7OA 4LOTA 3MIDA 1EUTA 4EROA 1W8OA 5LASA 1DIWA 2Q8EA 1ND3A 2VZOA 3EQEA 1RUH1 3I97A 1ACCA 2KXLA 2O14A 2SBAA 3FZ3A 2DUQA 3PVEA 3H3ZA 1AR92 1KQRA 1EAH3 1GP6A 1UO9A 1J1TA 3J4UH 4P9LA 1AX1A 2RS13 1MS5A 2VZRA 4PI2A 3VD5A 4BXFA 3NNLA 5KBFA 1CVNA 4CU8A 2EAAA 2DVBA 2VJXA 4INDA 4FPJA 4B1LA 4QPIA 1WCDJ 2FCTA 2PAEA 2YMZA 3KGZA 4CZSA 1KJLA 1IOAA 4OHYA 1UY2A 4LPLA 1AVBA 2DYCA 4TN7A 5CKNA 3MEPA 2XG3A 1MEC3 1W2TA 1ZBE3 3BU7A 5K0UA 2CAUA 1I3HA 2SLIA 4PLNA 4N53B 3FLRA 1ND2A 3RYRA 3WCRA 1HRV1 4GAZA 1WLDA 3WP5A 2CWSA 1QJU3 2R1DA 2ZEXA 5ANNA 3EHKA 3GGLA 4LBNA 3U1XA 3I59A 4MV2A 1CJDA 3GHNA 4HLTA 1RITA 3VKFC 1LGNA 2PN5A 3IIIA 4LK6A 1OOPA 1W6QA 4IEXA 4XJUA 3M4FA 1J83A 1UXZA 3VBUA 3A22A 3BCWA 4EN9B 4RYDA 3IM0A 3I3DA 2GMMA 1S2EA 4MGIE 1N3QA 5FQ0A 3VKOA 3O1VA 1DP0A 1OHFA 3KCCA 1VBB3 3R0RA 5CFDC 1DYKA 1UU4A 1XOYA 1AR83 4GKXA 1UIJA 3ORJA 3JD71 4BE3A 1EV12 2PAMA 3A23A 4YVWA 4D3WA 3ZFGB 1YO8A 4Q4W3 1TME1 3VKNA 1J3QA 4CSWA 2CV6A 3WF1A 4DXRA 4P9JA 4GB31 4Z07A 5BXXA 5FZEA 5C71A 1T2XA 1ZBE1 4UW5A 4YZ1A 3GXUA 1KEXA 3M3OA 5F7UA 2YROA 3NNFA 4LORA 1GV9A 1ASJ1 3MF6A 1LNSA 3C3VA 2DU1A 2DURA 3GZEA 3IIAA 4U36A 5FWJA 2WN2A 1LHUA 1A78A 1XE7A 2DU0A 2MPFA 4AI1A 2GC3A 4FO9A 1EV11 4CCEA 3AXDA 4LKDA 1JYTA 2OUHA 2D93A 2VBDA 4W6WA 3I8TA 3INAA 3WQ0A 5L9BA 3WF3A 1H30A 4FPKA 2ID4A 4NIGA 2CL2A 2RS11 1LULA 1RUC3 1XNDA 1Z7S1 2CWMA 3H0OA 4P9IA 4XVHA 3SMHA 4FI9A 4Q4X1 3PTYA 4RGKA 2FZ1A 4JAAA 1HN0A 3SH5A 3VBOC 5A6XA 5F5AA 1QJX1 2UYBA 3KV6A 4IE4A 4KG0A 4IQPA 5JOXA 5JPNB 3E6CC 5GLZA 2HBTA 4PIYA 1GOHA 1H4HA 2H6CA 3NAPC 2ZGTA 1UY3A 1Q43A 1E5SA 5FOBB 5JZGC 5DDJ2 3H8RA 2FZ2A 1S0DA 3B5LB 1AR93 2EXIA 3GCXA 4AL9A 2W94A 3LSEA 1N3PA 4Q4Y2 4YW2A 5FP8A 1K5MC 3CJIA 1D2SA 2WQ4A 3AYDA 3OPWA 3I54A 1RUJ1 2W2IA 2CTVA 5FR3A 2BWCA 2JDNA 4BJ0A 4QHOA 1T6BX 2LRPA 1O7FA 1VMFA 3AMQA 1J58A 3GJBA 4LBQA 4QXKA 4Y33A 4DUXA 1RMU2 3WP3A 2OIIA 2LALA 2R061 1PGW1 2R49A 3POGA 1GNZA 2PFWA 1QOTA 2Y6JA 2ZCWA 1DF0A 3MW4A 1W0PA 3ZXEA 3ZR5A 5FO8B 2ZZQA 5HV4A 4LBKA 1HRV2 2A3WA 1WLTA 2WUHA 2HWC1 4HKOA 1PIV2 1DQ6A 1AXZA 1NE4A 1H2KA 3AYAA 3GDBA 3SH4A 4UI9L 5I0SA 1JHJA 1S0JA 3HQRA 4XFBA 1YFUA 1GMMA 1CD3G 3IPVA 2ZA9A 1O8SA 1S0FA 1GUIA 2WZEA 1H9WA 1OLME 3ACFA 2Y6KA 4TYSA 4EN8B 1UZWA 4H55A 3Q8EA 4HBNA 2VCCA 5FZGA 2BYVE 4AWDA 3N9OA 1PMIA 2MEV1 1AXYA 5F6KA 4E8CA 3O1PA 1R091 3OJBA 4AI2A 4ZHNA 5FYVA 3JQXA 3LAGA 4GA9A 3RS6A 3ZXKA 5IT6A 4WM7C 2VE1A 4CUCA 1WLCA 3VBUB 3O5SA 1DZRA 1Q8OA 2J7MA 2YV8A 3SC7X 5J48A 2RDNA 2BJSA 3VZOA 4XW3A 4BLIA 2J1RA 2PHWA 2R6QA 1X9PA 3NVCA 1ZM1A 2E51A 5SV8A 1QJY1 4HOOA 3OF1A 3PUIA 5E1RA 5JZGB 1HLCA 4Q0UA 3N9NA 3TB0A 3WSOA 3ZDSA 1QQP2 2CGOA 1UYPA 1EYBA 3IZOA 4PHZA 5T52A 3ZXGA 1RUG1 1CIWA 1NYWA 2EVXA 4YM1A 4IEYA 2VMGA 2XVKA 2EIBA 4OULA 2FDGA 2V5DA 3IDAA 3THPA 2Q8CA 1TE1B 1SPPB 5J09A 1IPJA 1K5MA 1VMJA 3ACIA 2I74A 3HN3A 2XHNA 4OUSA 3WDXA 5BV6A 5KXDA 4WV8A 4IDZA 2W91A 1O8PA 2J42A 3KLSA 3MIBA 1W28A 1BVVA 5A32A 4EYUA 4CU6A 5L7OC 1D0HA 1PGL2 3J8F1 4CP1A 2QQOA 2W92A 1KDMA 2XMLA 4Y4YA 2XDVA 2IFWA 3CLPA 1UMZA 4XFHA 2A73B 4XFIA 3AKTA 2B39A 1WCSA 2ZZJA 3SKVA 1HB3A 1G6NA 4N43B 2WNVC 3VBFA 4B29A 1G8WA 1STMA 2ZHKA 5IWFA 1OD3A 2E32A 2Y6HA 1QF3A 1C8M3 3QCWA 5FXVA 5JDBA 1GR3A 4FXKB 5EWSA 2VOVA 5JPMB 1QEXA 2JDZA 2WFF1 1JZ4A 3CDZB 4AAXA 2JIGA 4Y22A 3KQ4B 1GQHA 3LPFA 1YIPA 2DFCA 1PIV1 5LRSA 1OA3A 2RE9A 1LOAA 3OPTA 4XC9A 2A1XA 3K77A 1V6LA 2BGOA 5FY9A 3THDA 2KM2A 3VZKA 4Q1PA 3N9QA 3PUSA 4WM7B 5LK7B 4LE3A 3JBG2 4QQ2A 3TN91 2BU9A 2PQSA 3APBA 5C6CA 4PLMA 2PHLA 4LQRA 4K40A 4AOCA 2R063 5FPLA 2E7AA 5ABJA 1H6YA 1AYM3 2LTNA 4AI8A 4YFWA 1HX6A 2R0HA 1QHDA 5LWBA 1LENA 1DHKB 2AEZA 2UU8A 1OPMA 2RR12 3A0KA 1CAUA 1RUJ3 3E5QA 1GZWB 5BPXA 3WG2A 4E9KA 1BVP1 2WO1A 3IWZA 3NJZA 4Y5SA 2NLRA 1AR62 4O7XA 5BNOB 1D0GA 3N36A 1S2KA 4YLZA 5LW9A 4I30A 1COV2 4BXSV 1AUYA 1FAYA 5EJZB 1LOFA 4Z1VA 1UPSA 4JGZA 5LEKA 2ZGLA 4LEJA 2Y26A 4LHLA 1D4M3 4A7KA 2GP3A 3LWCA 4LXLA 2RV9A 3KZ4C 3I2KA 1WMXA 2WYFA 4ATFA 4YRDA 2EAKA 2OA2A 5L7OB 4D6SA 1L7LA 4Q4X3 2Z4FA 1LU1A 4RD7A 4AR2A 1CONA 2RS52 2YBKA 1ULGA 4X6RB 5A7OA 1MZ6A 3RJRA 5J3UA 1W9WA 1H8TA 1IGOA 1K45A 1JUIA 3IAPA 3GZUC 2WNUC 1XYPA 5F3GA 1LOCA 3WDVA 4UT5A 1AR71 2HWF1 2VMEA 4AQ2A 2JJ6A 1YJKA 4FP3A 4L97A 2RM23 1O4YA 4E27A 3EYPA 4F3JA 1AYM2 1U12A 5F37A 1UMHA 1O3SA 2JWPA 1UX6A 5FUPA 2PHXA 1XSRA 3JUUA 3ZM8A 4ARYA 1JZ2A 4FPGA 2VY0A 4NO4A 3GZAA 1ULOA 5C3SA 5A7SA 3N7KA 1GZCA 4LBLA 4X6QB 2ZABA 3CEWA 3HMYA 2ZBJA 3PIJA 2Y38A 3V0AA 1YQ5A 4P9GA 4Q0SA 4QGMA 3T4HB 1RGSA 5LRRA 3FLTA 4Q2FA 4RSUA 4ZZ5A 2EICA 1RMU3 4QQPA 5I0DA 3BTXA 1J1LA 2B9UA 4BWOA 2ZS6B 1CJPA 3I4IA 4DS0A 4BCUA 3W21A 1F8VA 2E9QA 1QJU1 2ZPXA 4QWNA 5DXDA 5B4XA 4PF1A 2HLEA 4GQ7A 4I3GA 3ZYJB 1LESA 2QDNA 5FPZA 2ZXQA 2E6VA 2Q8OA 3HQXA 4QPGC 5EP9A 4CU9A 1OH3A 5B4NA 5A3PA 4Z2WA 3RMYA 1OH4A 3RZHA 3DYPA 1UL9A 4AHWA 3CU7A 2WSVA 4FPEA 3SCHA 2XKOA 2VBPA 4R4XA 5KHJA 3WDTA 3T0DA 2G19A 3PL0A 1MVQA 4AHXA 3OUJA 1PNFA 4D7TA 4NIAA 5GZGA 3NNMA 2AZ5A 4QB2A 1GOFA 4L11A 4CPBD 5AC91 2W46A 4FFIA 4LUKA 4ZU7A 4EWAA 2HYXA 1N47A 4NPMA 2B9VA 4M0NA 3AP6A 1S0BA 3W9AA 4FQZA 2RS32 4V2VA 3KHCA 3VD3A 4CDUC 1NAEA 1P8JA 3LF7A 3V0BB 3S5AA 5EXOA 4D7YA 3GBWA 1O4TA 2FBEA 3WLUA 3B01A 4Q0PA 4FAHA 1REFA 1AL23 3WHTA 2A71A 4HN0A 4AI0A 2VTFA 4DNYA 2O1QA 1MZFA 1NCQA 3JZVA 2W1UA 3AX4A 3FE5A 3S0MA 3R05A 5ACA2 4CPBA 5JI7A 5KR7A 2WBKA 5FP4A 1O3TA 5J37A 3T09A 4XFGA 3WXPA 4D6RA 1QOSA 1DDLA 1JZ7A 4GULA 2PELA 1SACA 1WUVA 2D40A 3NQHA 1JBCA 2VUDA 5A7PA 2JKBA 1KITA 4CEYB 1JH5A 4FPOB 4N8MA 3JQWA 4PF5A 5LA1A 4PJYA 3MV11 1LR5A 4A6OA 4K21A 2XUMA 3THCA 2G9ZA 4TXWA 1H9PA 2Q4SA 2XJUA 5I0RA 3T30A 4WZFA 1EAH1 3I2FA 4OYUA 4S2GA 5F3IA 2GC1A 4RR3C 2VCMA 2ILMA 3HBZA 3NNGA 3RNSA 2HWB3 3UGGA 1NA1C 4QPGB 3NWKA 3NNJA 2XQRA 1A8MA 4Y1ZA 4E2GA 1SFNA 2W39A 1JS9A 4XTPA 3S6PA 2R32A 4AFBA 2HWF2 3DCQA 2G4IA 4JGYA 4YM2A 3WVJA 2PHDA 4QHBA 2ZGPA 1AJKA 1LU2A 2BNNA 4XTMA 3WHUA 3RPQA 4ES9A 4UBHA 3EMRA 5F1RA 3MIGA 4A4AA 4IV1B 2OXBA 3GBGA 3AM2A 3CQOA 1EV13 3POSA 3WDUA 5FAXA 4AVVA 4YW3A 5FWEA 2OQ6A 3QOPA 3ZYGA 1W03A 3C7FA 3QD6A 4YWAA 4PDWB 3MI8A 1JU3A 4CDUB 4CDWB 2GN3A 2MHFA 4CCOA 1UIKA 2PHRA 1IS5A 5FYCA 3WX5A 5F8PA 1LAJA 1W8TA 3HOBA 1RUF3 2PAKA 3BI3A 2BVBA 3O1UA 4XF3A 1XNTA 3B3QE 4A45A 2CGNA 1PVC1 1H8TB 3AP7A 1AX2A 2XWJB 3S5QA 4HL0A 4AVAA 2DVGA 2HJIA 4QQHA 5JWPA 5FYBA 4AEKA 1IG3A 3K3NA 3KT1A 5G05L 5J96B 4AQTA 4MZUA 4LJHA 2PXJA 4Q8LA 2K46A 2IFRA 1OQDA 2VM9A 3AC0A 3D82A 3NMBA 1W39A 3BOWA 1F31A 2ZGMA 4CRQA 2X5IA 3LIHA 4CEYA 2OYZA 5TSWA 4N9HA 1SG3A 3OSDA 4KI5M 3H7JA 4XF9A 4R9AA 4BM8A 3IDBB 5C70A 5IVJA 1CAXA 1RXGA 4OI4A 5BNPA 5HXMA 2TUNA 3FFZA 3HVDA 1G86A 3B93A 3C8XA 3L2YA 3SITA 2WZR3 1YIFA 1GZWA 4CDQA 1VBD1 4KNCA 4MYEA 3R4DB 1XU2A 4RHV1 1TNRA 1RUD2 3KF5A 4CCLA 3K48A 4YZ5A 2XUEA 5EJ3A 1UZ0A 5C8WA 3K4ZA 2A6ZA 3WOGA 2QBXA 2NYYA 1YEWA 3O0XA 1O3QA 3C7OA 3GM8A 1S0IA 4GJZA 3RZZA 2GNMA 1IZ3A 4H7LA 5D21A 5K8SA 4OQ8A 1L7RA 1QOOA 1ZA7A 5JOYA 3DECA 3OB8A 5A32B 2XBO1 4EQVA 1C5HA 3Q8FA 1WMEA 4GWIA 4I3PA 4ZONA 4BLJA 1MVEA 4PDWC 3MZHA 3VBRA 2W0XA 1SFPA 3WY6A 4AEDC 4CP0A 4YW6A 1W9TA 4HXCA 3HD8B 2NM1A 2QQUA 5AVAA 3MW2A 2XH6A 1YHFA 4DINB 1WD3A 4MHRA 1RUE1 1RHI2 1W6MA 4L92A 4NHKA 4OMCA 4X8NA 2WS93 1H1MA 5FQ0B 2RR13 3PMEA 3PHMA 4IERA 3WNLA 2E31A 4LE4A 4Z8BA 2VTXA 3HNYM 4G9SB 1CIYA 3JBG3 3TBDA 2ZX4A 4E4ZA 3VN4A 3M1HA 4Y22B 1JXNA 2HWD2 2GC0A 2VNRA 1NCRA 3MIEA 3I3BA 1RUI3 5FY4A 1F9KA 3ZFFA 2ZGQA 2F17A 2WN3A 5J1XA 2XB6C 3WDYA 4KWUA 1OA2A 4ZY9A 4NMIA 4ASKA 3I2GA 3LA3A 1ZZ9A 4CUGA 1RUF1 4IV1A 5DDJ1 1UCXA 5FPXA 2J22A 5CFDB 1LOGA 4CEWC 3K4DA 4J25A 4MOAA 4XPVA 3WZ1A 5F3CA 1VMHA 3DXTA 1QJZA 1WW4A 2KD7A 5EJ1B 3VHPA 3WEZA 2ZAHA 4CDXB 1AL0G 4M3CA 2Y0OA 3FN9A 4KU8A 5FYIA 4CTEA 1CZTA 4FXGB 1V6KA 2QQIA 3ZXDA 2OS2A 4UFIA 2FDHA 3TWIA 5C3QA 1EAH2 5BNNC 4LR4A 2NN8A 4KQ7A 2RM22 3Q8AA 4BQXA 3QH7A 1IS4A 5D8AB 4XQWA 3AZZA 4LA2A 3AZWA 4H3WA 1YFXA 5J98B 3QACA 3FBYA 1Z7S2 2V4VA 3ME2A 5L73A 4YSFA 5BNQA 1W06A 3HR9A 3ST7A 4JDNA 2WA3A 3J7LA 3C7GA 2YU2A 2EA7A 1K3IA 5F5CA 2YC2A 2IC1A 2EXKA 1X50A 2V09A 1QGLA 1RUC1 3GBFA 3IB3A 3NKTA 5KC5A 1POV3 3OEAA 4AEDB 1LJ7A 3RWKX 5FYZA 3D0JA 5FMCA 3THTA 4QX8A 1OURA 3IT8A 3LOBA 5F9TA 5C3RA 3I49A 3NAPB 2A6WA 2BGCA 3AMMA 2JDAA 2WR9A 4QDQA 2J1EA 5T5PA 1JYNA 1QH6A 3BOPA 4IEUA 2A7AA 2DCTA 5ANQA 4C90A 1C5IA 1DGWX 2WZR2 1W2AX 2WYSA 4KBZA 3U4SA 4QM8A 1K5MB 2JDUA 4U2AA 4LKEA 2XLFA 1Q8QA 4E2QA 1Y4WA 1IPSA 1GP4A 2Y64A 3O14A 4FOVA 4M4PA 4LBQD 1LOEA 1RHI3 4JGZB 2VW2A 4NE9A 1J3RA 2WKKA 3HJRA 2VG9A 4ASLA 3N35A 2JDMA 2DCKA 1AL21 1VIWB 3VBHC 4FAGA 4NRPA 4DUWA 5FZ4A 1MS4A 4A42A 4CEWB 2BW8A 2C9KA 3AZYA 4OI2A 1WW5A 3ITQA 4CDUA 1DGLA 4RQPC 4JVAA 1CR7A 4Q4V2 4WVMB 1T6GC 4A7YA 5C9AB 2FMYA 4Z92B 1OUXA 5GM0A 2ZJCA 2XBO2 1F15A 5H9PA 4AZZA 4OQ9A 1I1EA 2B42B 4AGGA 3P1IA 2MEV2 2WIIB 1W3VA 4FPYA 1XNCA 2PLV2 2HWE2 5LK5A 5FZ9A 4BQ4A 2XR4A 3I3QA 2GSYA 3U75A 1FX5A 5JR2A 2HYKA 4JKLA 3VV1A 2QZ3A 2JG9A 1BCXA 2VPVA 2VZ3A 2D6OX 1LCLA 3QBQA 4I01A 1FT9A 4R52A 1UYYA 4Q4V3 2YBPA 3GJAA 4JTNA 4WVVA 1ZZBA 3ZDVA 4AYUA 4AK3A 2RS51 1QJY2 4XIKA 1C8NA 1ENQA 5DDJ3 3HN1A 3J7MA 3SKJE 3GHMA 4RS5C 3WQBA 5K9YA 1EPWA 3OCPA 2D6PA 4RN5A 4MXWB 3IDEA 3BODA 1CX1A 2QQKA 1Q5OA 2R16A 4BZ4A 1S0CA 4C8DA 4CDXA 1K12A 1BJQA 1QQP3 1RMU1 2W3JA 4LBJA 4RR3A 1XSQA 2XKPA 2CU5A 5A70A 4QX1A 3IN9A 1VBE3 2YGMA 5KHIA 3OOXA 3JBG1 5IAVA 4OHZA 1ZRDA 1I5ZA 1ZYBA 3DYMA 4BQWA 2FMDA 1Q3EA 2BFUL 5A1LA 3WUCA 4M3CE 4ZS2A 1DFQA 1VBA3 4K7JA 2HH9A 1BBT2 2JD9A 3ENRA 4L9BA 2WDBA 4OMDA 4AQSA 4I0AA 3H1WA 3CO2A 2RM21 2IVJA 3VBHB 2BP6A 2VULA 1WKYA 2W68A 1FOD3 5LBCA 1SLIA 4LLFA 5CFCC 2AUYA 3V0BA 1YUDA 4FTSA 4MLOA 2MNGA 3WT3A 2QNKA 2JG8C 2XQXA 2W9XA 4XJWA 1XC6A 4BHPA 3OGJA 1WD4A 2W95A 4Y20A 2E7QA 5GZDA 4AI3A 4BMEA 4YGCA 1BLZA 1VAMA 4AHZA 4ISQA 5C3PA 1CPNA 2AGSA 4BYYA 1GWKA 3FJSA 3KT7A 2WINB 3KCXA 4QX0A 4KBBA 3FUOA 1B35B 3PU8A 5KC6A 2CHHA 1HW5A 3IBMA 4WVZA 4XQ4A 4YFZA 1ZRFA 4GH4B 3M8LA 4TSVA 4MSVA 5IVYA 4YW7A 2PA7A 3JXSA 1N3OA 3EXUA 4GWMA 5A3OA 3RG0A 3WCSA 1RUI1 5LEJA 1PIV3 1YFWA 1OXCA 4QAWA 4AVTA 5DQ0A 2QQMA 4D8MA 2GALA 3ILRA 4PCRA 5FBZA 4LO6B 1HXS1 4DQAA 5IK8A 2HWE1 4G3YC 1WGPA 1BEV3 2ZGOA 5FYTA 3TNPB 1ULFA 4URAA 1BHGA 4D69A 1W2UA 5FFOC 2DBIA 4B8EA 1QXPA 2D7FA 1UMIA 1S1AA 2HEVF 3PUQA 4LO4B 1SQ4A 4RS5A 1IS3A 2RS12 3DV8A 1GBGA 2VMDA 5GZCA 4DXSA 4HKWA 2EIGA 5DAQA 3VBOA 1XE8A 4EN6B 4CA9A 2O8QA 2XWBB 3T1MA 3WF4A 1G9FA 3T4VA 2WS92 4CVUA 3U11A 5FY8A 5A1FA 3H8XA 3MIFA 4K6BA 3VGIA 3S30A 3RYKA 2C0ZA 4QKNA 2JECA 1E5IA 1UU5A 3W59A 2ZGKA 3NAPA 3PJYA 2WFF3 1W90A 3N9LA 5LZ6A 2ARCA 5A3UA 2NZ9A 3ZYFA 3T2QA 3SCGA 1IPKA 5DUVA 2JKXA 4XF0A 2YZ4A 3LGRA 4FPLA 4BPZA 3D0SA 3NJVA 1R1A2 1SLCA 2AH2A 2UY9A 4NROA 4UW4A 2BTVC 2WWSA 3ZXFA 5CFCB 1XNKA 1U5ZA 1U5XA 1VBD3 4IEWA 5ISLA 2H6BA 5GZFA 2JG8B 2WNUB 1VRH2 1V9U2 5I0UA 4BQYA 2LW8A 2XJSA 2DUPA 3MO4A 4ZS3A 4K9SA 3KHBA 5FRAA 4CP9B 1AX0A 1KFXL 1Q8PA 2YDEA 4JCKA 3N9PA 4CDWA 4COYA 1PGW2 1W8FA 3WP4A 1W8HA 4WVWA 4YVSB 1X33A 3WNPA 2VMIA 1DQ0A 1JYWA 3DKQA 4RA0A 5L9VA 1I6XA 1H4GA 1KS4A 4ZXKA 5CG9A 1WZXA 1VBE2 5FPUA 2P3KA 1ZRCA 1C1LA 3NJXA 5H9SA 5HXVA 1MZEA 4MGQA 4XHBA 3ZSLA 1W8ZA 1UYXA 2I45A 1ZBA1 2IUWA 1EPZA 2Z42A 4HKLA 3OBAA 1QMJA 4FPFA 3SHRA 3S57A 3CNAA 3LSDA 3CJIB 3MGUA 5FMBA 3Q8CA 1ONAA 4UOJA 2JE7A 3AMPA 1MR5A 1YCIA 4RFRB 1XJAA 2VOWA 1C28A 1Y9GA 2Q8DA 2Y0IA 3VDDC 2P1BA 1OLQA 4RGAA 4E4SA 3PURA 2W08A 5JI9A 2W47A 1OFNA 3PIGA 3FHAA 4PLOA 3UKVA 3BPSA 1ULCA 4LHKA 4DIQA 2VQ0A 5FZIA 5BNNA 4ASMB 1N1YA 1R082 4XURA 2RHPA 5T5LA 1E57A 3OY8B 3ZFGA 1BMV2 4XAAA 3EB7A 3O1SA 1MEC2 3AKRA 3EJKA 3S7IA 2ARBA 3JU9A 4O9GA 3ETPA 1S0EA 2ZX2A 4ORFA 4E4DX 4NRMA 2VO5A 4R4ZA 4WBBA 1SEFA 5FZBA 4UXAA 3SLIA 1OC1A 2VOTA 1UPIA 1HDKA 3FL7A 5FK7A 3PVNA 1FNYA 2P6CA 5EQUA 3VBSA 3OG2A 1RUG2 4I2OA 3VBFB 1D2QA 1UXXX 5EPAA 1YRZA 5F32A 3RI8A 3ZXJA 5FXXA 1GSLA 1SLAA 5FZFA 4KGGA 1HIXA 3N9MA 4IEQA 2ES3A 3W58A 1W99A 4Q4X2 4HG6B 4O65A 4PBOA 2VZVA 1UF2C 3H1MA 1C57A 2R073 5FY0A 1JU4A 4JQTA 1D4M2 3DF0A 3WUDA 4IETA 1HB2A 3BGAA 5A1AA 3OTFA 4XACA 3MHZA 3M3IA 1NG0A 5EHDA 1JMUB 4OHXA 1ASJ2 1PGSA 1R083 4NRQA 4Y5Z0 5IK4A 2RJKA 1JHNA 1H1AA 3VHRA 3ZKYA 5DABA 4A3ZA 1XPWA 3GZTB 2GN7A 3LDBA 1YQ8A 2X10A 3L9JT 4IV3C 4R9CA 1HRI1 1PO21 2B4KA 1W0NA 3KB5A 4P9WA 3ZO0B 2BWAA 3KQRA 5FTTC 3WW3A 4LTAA 2WT1A 4OCTA 4GB33 2HEWF 4YG3A 3ZLIA 1LHVA 5DAXA 3AMHA 4ONUA 3ZYPA 3ZFEA 1VJ2A 4EN7B 2UWAA 2BBVA 2X09A 5F2SA 3B69A 4OI1A 1ENRA 2IXHA 1V00A 4GB32 3UGHA 1VBC2 4ISRA 1CAVA 2HWC2 2G9FA 2VXRA 5HBAA 3TEYA 1NA1B 2XONA 3WD5A 1WMDA 4EE2A 2H0VA 1RVF3 2WT0A 2XJRA 4B7EA 1WBLA 1PX4A 3MPBA 1ZRRA 3ZSEA 1BEV1 1CAVB 2JG9C 4GWNA 4QB6A 5SV5A 1HRI3 1PO23 4OUMA 2OKXA 4YGEA 1HXS3 1XNBA 1XYOA 1DGRN 2VMHA 1JUHA 2R072 3E97A 3RI9A 3CHXA 4R8HA 3MPPG 1SCSA 1YYNA 4JKKA 3POEA 4PI0A 1R081 2IWGB 4AHYA 3RGBA 4IV1C 4BISA 5GLVA 5I8YA 4Y3OA 2OPKA 3UKNA 1MEC1 4B3NA 1TME3 1JZ6A 2WLPA 4HK8A 1R1A1 4BQ5A 1WCKA 1REDA 2VXJA 5CEHA 1Z78A 4GMP1 1OPOA 4LBQB 4NAOA 3HPNA 5AFBA 4ZU4A 1UYZA 4XMAA 3UKTA 2WRAA 2WQ8A 4ET7A 4AFMA 2YGLA 1E5HA 4KWKA 2YG0A 1PM4A 1OD5A 4MHUA 5FZMA 5KHHA 2DF7A 4JRAA 5GLUA 1RXFA 1WLWA 2TEPA 4FOQA 1F5JA 2X5IB 4S2FA 3D8CA 1UNBA 1PHMA 2W1QA 2WNOA 4M00A 4AF9A 4A3XA 1H8TC 1W9YA 2VECA 1B35A 3PJQA 2PYTA 4NAMA 3U07A 2WO3A 2RJLA 3J9SA 3MLLA 1MS8A 3AKSA 3VDCA 4KGQA 5CVRA 1RTVA 3ZVXA 4IV3B 1FOD1 2DWRA 4QMAA 4BU2A 4QQLA 2NQYA 1ZBA2 4XJAA 2D5FA 1FMD3 1VB4A 5JXJA 2AREA 1XE0A 5CYYA 3WW2A 4FFHA 1UZZA 1XU1A 1AYM1 3USUB 2VGDA 1JOBA 3WNOA 3KWVA 2YC0A 3OGVA 3WNKA 1RUC2 1ZRIA 5LCWL 4KU7A 4LMFA 3BB6A 5F39A 3R6SA 3IMNA 3K4AA 4JGYC 3FBMA 1TZOA 2BZDA 1OF4A 2XGXA 5ERLA 4QKFA 3FC0A 5FLJA 2WABA 2QFEA 3OUIA 1ZREA 4H14A 4GIQA 2Q1FA 4COZA 4QB1A 4EV0A 2X05A 3VL9A 3ZXLA 4BDVB 3VUOA 4JHTA 1H2MA 5DAWA 2AEYA 3BVCA 4YG0A 3SQOA 3KV5A 3I2HA 4HSJA 5JSPA 1CX4A 3WF2A 3NO8A 1FPN2 3GALA 1D4VB 4I0WB 4BK5A 4LKFA 1Y9MA 2JD4A 1V6MA 3AKPA 1NT0A 2ZGSA 1BQPA 4AG4A 4B4RA 5I93A 3T08A 5FYYA 2QZ2A 2VR4A 1A6CA 2GNBA 4IGOA 5A6ZA 4V2WA 2D6LX 4DO0A 5CG8A 4XBQA 1UKRA 1VBC1 4K8FA 1LOBA 5FY1A 1VP6A 4AW7A 4IGQA 5EYYA 1PZ7A 4Q0VA 1PMJX 2KA3A 5IYYA 5IUQA 5FZ7A 3WP6A 2DVAA 4RHV2 3J8F2 4UFHA 4XOGA 1SFYA 5CBLA 4UF0B 2I2SA 1RC6A 5G04L 1RJ8A 3OBTA 2ZX1A 4CUAA 4E2SA 5A6YA 5AFEA 4YZ4A 4MGSA 3LA2A 3ZSJA 1LGBA 1UOGA 1R1ZA 3AZVA 3MUY1 4KWJA 1QH7A 1SDDB 1WA4A 3W5MA 4HK9A 4IEVA 1LHNA 1TMF3 4Y1UA 4AVBA 1GU3A 1ZBE2 5FMOL 5JCTA 3D3AA 2BEOA 2X5IC 4CEYC 4C91A 5LBEA 2A5ZA 4K3UA 3ROUA 2EXHA 4XMIA 3N3HA 2HWD3 3U4XA 4HSLA 4YGDA 4GMP3 4URTA 5BNPC 1H6XA 1H1IA 4EWDA 3MBWA 2ENRA 3POWA 4P02B 1DGRA 1FPN3 1CZSA 3BALA 4M3CB 4MGKE 4Y1VA 3ZYHA 1RIRA 5DUWA 1QJY3 4IE7A 5DAVA 2NMNA 3WG1A 3WQ7A 2VMFA 4OI0A 1GLHA 1YC61 4FVVA 2JB4A 4MADA 4HMZA 4XETA 4H2AA 3POYA 1Q8VA 1QY4A 4WVMA 3M3CA 5C9AA 4Y1XA 3ZN6A 4XF1A 1BEV2 1V6OA 5BUVA 4KWLA 3LEIA 3FFQA 1VAVA 1UWWA 4DXZA 3TEXA 1LECA 4UFLA 3TOJA 2JE8A 3ILNA 1GFF2 4CDXC 4QX2A 4NIIA 3WW4A 4E8DA 4WM8C 1R093 1URXA 2IVIB 2B45X 1O91A 3C7HA 3U14A 3ZN4A 1HV0A 3DN7A 3BKZA 5BNNB 3CZJA 3BYWA 1UY4A 2HWE3 3BN6A 2ZEYA 1WCUA 4LBMA 4BQ2A 3MV01 1AR81 1COV1 1W3XA 3ASIA 4F7ZA 5D8AC 4LHSA 5JIUA 3ABZA 2QQPA 1H8VA 3ZMOA 1X7NA 2XJQA 4NOTA 2F6BA 2R1BA 1HJFA 3ZMNA 3B9IA 1MS0A 4MXVA 5FXWA 5CIRA 1QJFA 3CKHA 2ZMLA 3AKQA 4EN0A 1JOJA 1RUG3 4YGBA 2ZGUA 2EALA 3KD4A 4L8QA 1RUOA 1O5LA 2BNMA 3AVRA 3HQUA 3S7EA 3TYJA 2VCBA 4GD4A 1NCRC 4XJ9A 3AP4A 1UX7A 3EO6A 5GKAC 4CU7A 1JN2P 4OHWA 1BZWA 5K0UB 1JOPA 3OEBA 2WJSA 1TQ5A 2Z69A 2ZMNA 3LB9A 4YG6A 5BYNA 3WNMA 3J7NA 3ZOIA 2QQLA 3ZN6B 2RDQA 1OMIA 3BPZA 2ZAAA 3WF0A 4JX0A 1AR91 1VE0A 3K75B 3KVAA 1H2LA 3PLQA 1BBT1 1AYN3 5GALA 5BNPB 1DYOA 5FZ1A 1PO13 3VD7A 5DMYA 1UZVA 4R9DA 2W87A 2P6HA 2B8MA 1FI2A 3ATGA 3I2OA 5LBFA 1SBFA 2AENA 2Y8KA 3WV6A 3ZR6A 1NXD1 3VL8A 1SZBA 4JGZC 4AAPA 4XJ8A 4FOYA 4QDRA 1DZQA 1WA6X 3EBRA 2IXLA 5JZGA 4AXOA 3NV1A 3PVOA 4QGNA 4ZKTB 4PIZA 2CNAA 1F4AA 5LB6A 3IAQA 1Z7S3 1A8DA 2YPJA 4HANA 4RQPB 3X29B 1NZCA 5C9AC 3H8OA 2ETEA 1WCQA 3UESA 3UETA 3KV9A 4WM8B 5GJ6A 5A3MA 2YXSA 5CA6A 4OFGA 2ZX0A 2VW0A 5L9RA 1AL22 4Q0QA 3AFGA 4UWDA 2VW1A 5F6LB 5FMOS 5KHGA 3A7QA 3G6JB 5FYMA 1OI6A 1PZ9A 3V56A 1O5UA 3I2DA 5FZCA 2BNOA 2GNDA 4GKYA 4QKBA 5FUIA 4XABA 5T5JA 1W6MB 2XBO3 1BK1A 4A7ZA 1QJX2 2ZACA 4QX5A 1NOVA 1QNYA 1UZYA 4F8AA 4TZDA 2J1SA 1UOFA 2XL7A 4N7UA 1VBD2 2UYAA 4EWEA 1PGL1 1A34A 1EUUA 1XQNA 3POJA 4QPWA 2BVVA 3RSJA 4FP2A 3KM5A 5A33A 5D1IA 4LNVA 4RS5B 1N1TA 3Q8BA 4MG2A 2CAVA 3NW4A 5GLWA 5JOWA 5K0UC 4NHMA 5FY5A 4Q27A 5CADA 1ND2C 2OUJA 1FV3A 2VL4A 2WO2A 5DG1A 3LDRA 5F3EA 3HT1A 5C3OA 3MIHA 2EXJA 3OGGA 4PIXA 1VALA 4DY3A 5KHKA 1KRIA 3AL5A 2OZJA 2YY1A 3LPGA 2V72A 4IESA 2J1TA 1OOPC 1S0GA 5A3NA 4B4PA 4NWVA 1VAKA 3RRDA 1YI7A 2CDOA 1X8MA 3P6BA 4QX7A 1ZNPA 1SBEA 4O9EA 2R042 2OZ6A 3CL1A 5J36A 4DUVA 1GQGA 1C4RA 1PK6B 4CCNA 1VB2A 1V6IA 4DRVA 1NUKA 3K51A 2YHJA 1YWKA 2C24A 3Q9OA 2A3YA 4P9XA 5C8CB 1BK0A 3ZFFB 2VVEA 2BQPA 2YC4A 4NHLA 2JENA 5F5QA 2QDRA 3AYEA 1X9TA 1JZ3A 3PUAA 4YYOA 1LB2A 4J1WA 1US2A 3ZYBA 3USSA 1TG7A 1RUH3 3VDDA 1VRH3 1C8M2 1UY1A 2HWD1 2VTXJ 5FZ8A 4RHV3 2VOKA 4YVSA 1OA4A 4Q4W1 4IEOA 5A3LA 1J59A 1NY71 1F35A 3G7DA 4IXLA 3VZMA 2K0GA 3KS7A 3SCFA 4Q1RA 2ZHLA 1NKGA 3M3QA 5LBBA 5HCHA 5T55A 4KMQA 1RB8G 1ULDA 2VVFA 1PZ8A 1IS6A 2IXKA 2F4PA 2X53S 1B35C 1WBFA 2YUEA 4NPLA 5IJRA 3RZKA 3ETQA 3NJYA 2VU9A 5A6QA 4GH4C 4IUGA 1AR82 1NCQC 4P9YA 4Q4W2 4YVWB 1REEA 1UY0A 1JYXA 4UFJA 1NY72 4UFKA 1VPHA 3T2TA 1MS1A 3IKWA 1AZDA 3R4SA 4PBPA 2I07B 4A44A 4NN0A 1LEMA 4F83A 2BBAA 3IPVB 1SDWA 3RYPA 5C7GA 1V9U3 1SMVA 1AF9A 5I0TA 1PVC3 2WLQA 2GH8A 1QKQA 4Q8KA 5JXIA 4UF0A 2WQZC 2OQ7A 2P34A 5L36A 1I5PA 1ND2B 4R9BA 4AE2A 5KXEA 3MDPA 1YQ2A 3C7EA 2GNTA 3GYDA 1MS3A 5KWRA 4BA6A 5A7WB 4D7SA 5JSOA 2QQNA 2HEYF 2PHFA 4NUBA 3VDBA 1L7QA 1OOPB 1W6QB 3H1YA 2FHRA 1GICA 1V6JA 2YB7A 4NR1A 4XCBA 3WQ1A 3W5NA 4QXCA 5CKMA 1W6PA 5ABJC 1W8NA 2QKDA 2Y33A 1ODMA 3AYCA 1M06G 1W9FA 2DTWA 3LKJA 5FIXA 5H9RA 5JXGA 2KR2A 3WNXA 3MF9A 2BPA2 1GP5A 1OVPA 3A21A 5FOJB 2XVGA 3IMMA 5I8SA 1OQ1A 3HNBM 1PM7A 1RUD1 3L2HA 3MICA 3ZFFC 1S2BA 4DEQA 5IAXA 4QXHA 2ZTNA 4GXLA 3NV3A 4JC1A 2QQVA 5E8AA 3GNEA 5IHRA 5DN2A 2WFPA 4COVA 1BMV1 2ZGRA 3VKMA 1AXKA 3OBZA 3OD4A 2VCAA 3AK0A 1RUE3 2HWB1 2K9ZA 2D3PA 2RMU1 5FJKA 5APAA 1VBE1 2NP0A 1JODA 3FWEA 3W20A 3H7YA 3D6EA 4IEPA 4YVSC 1ND3B 1HXS2 5IFTA 5ACA1 4FTBA 1DLLA 1QDOA 5FLIA 1SLBA 4MVTA 1LKNA 2C1FA 5FZLA 4W6XA 4DB5A 2XJPA 4HVRA 1W9SA 4CP2A 3BUCA 4AFAA 3M2MA 1G9DA 1NCQB 3TN92 4L0PA 2H0BA 3T2OA 2YPDA 4NWWA 4DY5A 2GC2A 3PUHA 1VRH1 3URFA 1DZTA 3MYXA 1NXMA 2ZEWA 3WR0A 2WNUA 5GLTA 2BOJA 4P14A 5CNAA 4LITA 3AJYA 3CJIC 1M4WA 1H2NA 2R30A 3VHOA 5FXZA 2VVDA 4QD2A 2RR11 5FLHA 4GALA 3OD0A 1Q8SA 1XRUA 2YU1A 2BOIA 4XJZA 5DUXA 1A3KA 4GWJA 4QPYA 4QT6A 3F2ZA 5LA0A 1UKGA 3VKLA 1YNAA 3VDDB 1DG6A 4NIHA 4WM8A 5CAZA 3K2OA 4XYXA 5FP9A 4CCKA 2A70A 2OW4A 2RDRA 1CPMA 1HB4A 2JDKA 3N4MA 1FV2A 1NZIA 1HV1A 4YM0A 4FTEA 4P00B 2WZPP 2ZMKA 3OGRA 4BH9A 1V70A 2TNFA 2WSUA 2FDJA 5D8AA 4W6YA 2CSGA 3KV4A 5FZAA 5FPAA 4DMIA 5L19A 1KFUL 1ST8A 1VR3A 3ZIWA 3ZSMA 3ZXAC 1MQTB 1JZ5A 1UD1A 2W52A 4DXTA 2Y6GA 2R041 2QTWB 2IXIA 2VZPA 1OT5A 1D7PM 1O6UA 3RDIA 2BFUS 1O59A 3I2IA 5JVVA 1JI6A 2DFBA 3ES1A 2C6SA 4AEMA 4NHXA 3VBFC 3VLBB 4JHZA 1UOJA 1PVXA 4A6SA 3B02A 5FKBA 1AR72 2DVDA 2AR6A 5IFPA 3HNMA 1LGCA 5IATA 2IXCA 1CQ9A 4DPNA 4HVQA 2BUKA 1Y9QA 1GANA 2A3XA 3CIHA 5GZEA 3A0NA 4WM7A 4Q26A 5FUNA 4XZUG 2QQJA 5HCFA 3POBA 1TNFA 3D4KA 4B7KA 1MZ5A 3BIEA 1RUE2 1W04A 2ET1A 1XBFA 4XHXA 2O0OA 3FLPA 2R071 2NMOA 2FDIA 2ZKNA 5FP7A 4AQ6A 1U0AA 2D3SA 4B1MA 1HQNA 1LTEA 2HWF3 2C4XA 3KF3A 3AP5A 1SCRA 3K3OA 1ENXA 4IL7A 2JDYA 3KGLA 5DUUA 3SH3A 3SISA 4TTGA 1DGWA 4Y5TA 1VBB2 5K4LA 1QU0A 1ZZ7A 4S2HA 1RVF1 5CZKA 1W6NA 1POV1 1TME2 5IVEA 2L9LA 5F2WA 3AXEA 3WW1A 5JLVA 1X36A 2MEV3 2Z2SB 4IE6A 4MGZE 3WINE 1OLRA 5C5TA 3ZSKA 5FO9B 2PQQA 4W4ZA 2VH9A 1ZVFA 1UW8A 1VBA2 1CN1A 4UW3A 4DZGA 3JB4C 1DBNA 4MUVA 1J84A 1TMF2 1W0OA 4FSJA 2JXAA 4K8RB 4I09A 5FV3A 4XUOA 4QKDA 1TVGA 4YW1A 3VD4A 3ACLA 3O1MA 1UAIA 2FCUA 4PQQA 1AHSA 1OBNA 4IE0A 3H50A 2RDSA 1HN1A 2HWC3 4XDPA 3RZJA 2YFUA 3ES4A 4N7IA 4BQ1A 4LKSA 1OF3A 4XF4A 4KL1A 4N9IA 3M3EA 4OVEA 4UAPA 4XEZA 5LA2A 2CY6A 3VHNA 3ZPOA 4OLLA 4OHVA 1XYNA 4H7MA 4PQ9A 1LHWA 2D97A 5FZHA 2VZUA 1UU6A 2P3JA 5A7QA 3UJQA 2VNOA 1GNHA 1KD7A 2C5DA 2UWCA 4Y20B 2WAOA 2GP5A 1WWYA 2VQUA 2JG9B 2LROA 5CISA 4HN1A 2C9AA 2P4EA 5IW0A 3V0AB 2IXJA 4AEJA 1ULPA 2JDHA 5A7WA 3KT4A 1D4M1 1OKQA 2JIJA 2W1WA 1SBDA 3AMNA 4FFFA 2XHKA 1F4HA 5LATA 3H3LA 1LODA 2QVSB 3WG4A 2WWJA 4Z2AA 1QXRA 1ALYA 4HPKB 1N1SA 3PMSA 3UNPA 1RUH2 1BBT3 4FQ4A 1DQ1A 2QJVA 2VNGA 4AGVA 4FBFA 1HB1A 5FPVA 4RGGA 1FATA 3HIFA 4B4QA 2ZGNA 2VUJA 4I02A 2W5FA 1GZ9A 1G9AA 2ARXA 2VC9A 5JR7B 2VZQA 1R1A3 2N7GA 1NQJA 4BIOA 2X29A 5AC93 4LT5A 5DZGA 3ALQA 4XXPA 1YQ6A 1GYKA 1OLMA 5FZDA 2ARAA 2DCYA 3E6DA 4XBLA 3O1OA 2RG4A 1PNGA 5FKCA 3MFAA 3VBOB 4ITCA 3F95A 5FMDA 2XJTA 3PNAA 2OPWA 2XLGA 1CESA 2WL1A 3QLQA 5A7NA 3NSTA 4C1WA 3KSCA 5B2GB 4D94A 2GMEA 5CU1A 3ZYIB 5J7MA 2HKXA 4JGYB 2PMWB 2EIEA 3ON7A 1NQDA 1DU3D 1CAWB 4XILA 4ZPIA 4FT8A 4MXWA 1APNA 2VBBA 1ZX5A 2FCVA 5EYXA 4RQPA 3OYWA 3SNMA 4LIUA 1CAUB 5JUVA 1IKPA 1E5RA 4LHNA 5BY5A 1IQAA 3JB8A 1PVC2 3O12A 1PK6A 1ZBA3 3N7LA 2LUWA 3I7DA 4XUPA 5LA9A 1TMF1 2YFZA 2FD8A 3BIWE 4G4FA 4GH4A 4QX3A 4LLOA 3BTYA 2ORXA 1ENSA 4IEZA 5CB7A 3ZX7A 5A3TA 1W6PB 1W6OA 3RZGA 3DPRA 5KXCA 1O3RA 1ZA4A 4SBVA 1US3A 2VQAA 1KGYA 2Y60A 4UFMA 1GQPA 2R0FA 3OGSA 2VZSA 4YZ2A 4J6GA 4P5YA 1VBC3 1K5JA 1YFYA 4CDQC 1RUNA 2D6NA 1L3JA 5FZ6A 1NLQA 4QPIC 1J3PA 4C0BA 2GMPA 4EZ4A 3ZKUA 3JCIA 4YW5A 5JOZA 3AVSA 1ZZ6A 3MLKA 1W05A 2B46X 2LS6A 4XFFA 4XZPA 1B09A 4HT1T 3TEZA 1AR73 3DL3A 4IE5A 4JZRA 4YW4A 3VBSC 2E53A 4HZFA 5IK5A 3N7JA 4LO7A 5EV7A 4BB3A 1QJEA 2EIDA 3LEKA 1KDKA 2E26A 2OX0A 4XDQA 1QJU2 2VQTA 3E5XA 3ACHA 1POQA 3AB0A 2AC1A 3ECQA 3IDCB 2WNVA 4PDWA 2QQWA 1RVF2 4Z82A 3VBUC 1H0BA 4Q4Y1 2PTMA 1OVSA 3U0ZA 1GKBA 2WFF2 1AR63 1HQWA 5FZ3A 4IGPA 4D6QA 3NRUA 1VBA1 2J1VA 3D5OA 5T54A 4NIDA 1W6NB 2A6VA 1YQCA 2R062 3I2JA 4HVOA 4AI9A 1DLCA 4K20A 1W2OA 3LFMA 1YJLA 5H9QA 4A41A 2XPJA 5C4WA 2P17A 4LK7A 2P3YA 3V65A 1QQP1 5DG2A 4N53A 4QQOA 3VD9A 2Z79A 4YNIA 2ERFA 1Z0HA 1Q56A 2BERA 2Q0AA 2D43A 1QXJA 5JMOA 3TAYA 3OPZA 3I59B 1F2NA 3LCPA 4IW3A 3E5UA 1Y7BA 2JB8A 4YZ3A 3RFRA 3TN93 4BK4A 1HQLA 4CXWA 2LM3A 1QJX3 5IVVA 2P5BA 3RMXA 2D44A 3B7MA 1SLLA 1MQTA 3M7AA 2RMU3 3CJXA 4WZCA 4S2DA 5A33B 4QU1A 1FMD1 4FPHA 1R092 4MX3A 3UYJA 4LUMA 3DXUA 4CDQB 4M3CF 2ZX3A 4I0BA 4LULA 3MLJA 4OUEA 4JQRA 4N43C 4QPIB 1TEIA 1C8M1 1YXWA 2DVFA 2WNVB 3DUIA 4JDMA 4JTOA 2DCJA 1NCRB 1C1FA 4FPCA 1NE6A 2WA4A 4MO3M 1JTZX 4P5HA 4L2NA 5T50A 1CWPA 2ADDA 1GWMA 1MACA 1QWRA 3MUZ1 2QUOA 3VBSB 3MFCA 4DOUA 2DBNA 3PDQA 1FXZA 4SLIA 4HONA 4MH0E 3PVBB 5IVBA 3OY8A 3CMGA 4XUNA 4ZU5A 3HAGA 3ZIXA 2FQPA 4X8PA 3O0WA 2DV9A 3HEIA 4Q4Y3 2BV4A 1NX9A 2AYHA 3T0BA 2V73A 1RYYA 4AVSA 3BTZA 4HFSA 3LA7A 1JYVA 3C2UA 4D0QA 2QE3A 2W1SA 5M0TA 4QU2A 2K2SA 1NA1A 4OZXA 1KXGA 3CF6E 4NPRA 2Y6LA 2WNEA 1RHI1 4Y24A 1GNYA 1ODNA 4COWA 4IV3A 1DQ4A 2VZTA 3LEGA 1FYUA 4BQ3A 1KJRA 3DPRB 1ASJ3 2D5HA 1NLSA 1C3HA 2UY8A 1PO12 2Z5WA 4LA3A 2XVLA 1N1VA 1V9U1 3GCWA 5A3WA 1DCSA 4TWTA 4AFCA 2GU9A 2JX9A 4DFSA 5BNOC 4XIOA 1CGPA 2CYFA 3VZLA 3ZFEC 2P2KA 5FBJA 4KH9A 5DZFA 3B9CA 2VMCA 3DEMA 3RJ2X 3H8UA 2BGPA 3J8F3 2OT7A 3K46A 1WW6A 4GMP0 3ACGA 2DUOA 5HCBA 5C5UA 2R7EB 1LHOA 5JAXA 1R64A 2OVUA 2ZHNA 2ZOEB 5JMCA 3H3UA 2PHTA 5DPNA 1OUSA 4CYDA 3I3EA 1SHWB 1CAXB 3ILFA 4QDSA 2BDRA 3T0AA 3ZPYA 4UBGA 3LQCA 3FX3A 2P3IA 3H42B 5E88A 2V5YA 4C0HA 2A75A 3J26N 3AL6A 2E7TA 1W6OB
chains in the Genus database with same CATH topology
2WT2A 4FOWA 1IHMA 3H9AA 4QPGA 2D6MA 3NV2A 1O4ZA 2NPIA 1HRV3 2VUAA 3HWJA 5C33A 2TBVA 3DGTA 2PLV3 3TNQA 3P3NA 2RMU2 5T3NA 5I91A 1X8EA 1WW7A 1FMD2 1KS5A 1DQ2A 5E89A 4XFAA 2CGPA 4JV4A 4K1YA 4META 1UN1A 3HT2A 3V64A 2EF6A 1VLNA 1JW6A 1PK6C 4C1XA 2XJVA 3U10A 1HKDA 4XBNA 4EJRA 5C8CC 1EP0A 1EY2A 2GH2A 4M01A 1BKZA 3ZYRA 3DPRC 5ACA3 4QM9A 3NL1A 5IK7A 4XQDA 5JIAA 2GDFA 4RL7A 4AGRA 3ZFEB 5HI0A 4AFDA 4RFT0 5T5OA 2Q30A 2GAUA 3UJOA 3O7OA 3UV9A 3ZN5A 4Y26A 2DCZA 4ATEA 4AEDA 5CFDA 1AYN1 1AJOA 4Q4V1 2A6YA 4KG8A 4YVWC 3AZXA 1HRI2 1PO22 1POV0 3AFKA 3MW3A 5EFUA 1XXNA 3VZNA 2UWBA 1LEDA 2Q5TA 3KMHA 3RQ0A 4BOWA 4DRRA 2YYOA 2R043 2PLV1 4HPKA 1NLRA 1U5YA 5AVPA 3NKGA 5FDBA 2WC2A 3NV4A 1RL3A 1V6NA 5C4WB 2PHUA 1OFSA 3KCYA 3JD73 4COUA 4CEWA 1LOFC 4QGLA 4JRLA 1PO11 1G7YA 2QCSB 1JYIA 4HETA 4XE9A 1BYHA 3VBRB 3OYWB 4LO8A 3VBHA 1QDCA 2B7YA 5ABJB 1COV3 1ULEA 1S55A 2DTYA 1OSGA 1RJ7A 1LRHA 2GZWA 4FCAA 5FREA 3UL2A 5LEJA 1YI9A 1DQ5A 3WG3A 4ES8A 1MS9A 5KXBA 3QH6A 5C8CA 2XL9A 5EZWA 4M0HA 4J1XA 4RR3B 3AP9A 3WDWA 2O8OA 3SXWA 5FO7B 1ZZCA 5I8TA 3USUA 2JICA 2XLAA 4N43A 2ET7A 1IKQA 2JE9A 4AVCA 1OQEA 1VBB1 4XFCA 1ND3C 2A6XA 1F5FA 2D6KA 3GF6A 3O0VA 1G9CA 4L99A 1FPN1 3T1LA 1SLTA 2X8KA 5AC92 4W65A 4N90A 3B94A 5E16A 1FOD2 3TRSB 4BIFA 1ZZ8A 2HWB2 2VOXA 5DZEA 3P3PA 3FMGA 2WZR1 3FUQA 3LZZA 5K7PA 4LBOA 3B00A 3UK9A 4CDWC 4BMBA 5FCCA 2G9GA 2UURA 4XXAA 2IZWA 4YARA 2RS31 4K1ZA 3LOIA 3N7MA 5C4WC 1RUI2 4JDOA 3M70A 4Y1YA 4MGYE 4TLFA 1QNWA 1RUJ2 1CAWA 2ZKLA 5JSRA 4N53C 3ELNA 3JD72 3VBRC 2D3RA 5BNOA 1BXHA 3OBRA 1Y3TA 3RWNA 2P37A 5CFCA 1MQTC 1JYCA 3BTAA 4LO5B 4YM3A 3E6BA 4V1PA 1G9BA 1FNZA 2JG8A 2RS53 2D98A 2ATFA 1U5IA 3DKWA 2JEMA 2B5HA 2E63A 5HCAA 1AYN2 1Y43B 4UW6A 2WS91 3ZFGC 1X82A 3AJZA 1DYPA 1I9RA 1WMFA 3FHIB 3R4UA 2RS33 1AR61 3VZJA 4Q29A 1RUF2 1YLLA 4A2UA 3A4UA 4NVPA 2Q1ZB 1RINA 2ZHMA 1RUD3 2Q1MA 5L7OA 3MIDA 4EROA 1DIWA 1ND3A 3EQEA 1RUH1 2KXLA 2SBAA 3FZ3A 2DUQA 3PVEA 3H3ZA 1AR92 1KQRA 1EAH3 4P9LA 1J1TA 3J4UH 1AX1A 2RS13 1MS5A 5KBFA 1CVNA 2EAAA 2DVBA 4INDA 4FPJA 4QPIA 1WCDJ 2PAEA 2YMZA 3KGZA 4CZSA 1KJLA 1IOAA 4OHYA 1AVBA 2DYCA 3MEPA 2XG3A 1MEC3 1ZBE3 3BU7A 5K0UA 2CAUA 1I3HA 2SLIA 4PLNA 4N53B 3FLRA 1ND2A 3RYRA 3WCRA 1HRV1 1WLDA 3WP5A 2CWSA 1QJU3 2R1DA 3EHKA 4LBNA 3I59A 4MV2A 1CJDA 3GHNA 4HLTA 1RITA 3VKFC 1LGNA 2PN5A 4XJUA 1OOPA 1W6QA 4IEXA 3M4FA 3VBUA 3BCWA 4EN9B 3IM0A 2GMMA 4MGIE 1N3QA 5FQ0A 3VKOA 1OHFA 3KCCA 1VBB3 3R0RA 5CFDC 1DYKA 1UU4A 1AR83 4GKXA 1UIJA 4BE3A 3JD71 1EV12 2PAMA 4YVWA 4D3WA 3ZFGB 1YO8A 4Q4W3 1TME1 3VKNA 1J3QA 2CV6A 4P9JA 4GB31 4Z07A 5BXXA 1ZBE1 4UW5A 4YZ1A 3M3OA 2YROA 1GV9A 1ASJ1 3MF6A 3C3VA 2DU1A 2DURA 4U36A 3IIAA 1LHUA 1A78A 1XE7A 2DU0A 2MPFA 4AI1A 2GC3A 4FO9A 1EV11 3AXDA 2OUHA 2D93A 4W6WA 3I8TA 3INAA 3WQ0A 1H30A 4FPKA 2RS11 2CL2A 1LULA 1RUC3 1XNDA 1Z7S1 2CWMA 3H0OA 4P9IA 3SMHA 4AF9A 4Q4X1 3PTYA 2FZ1A 4JAAA 3SH5A 3VBOC 1QJX1 2UYBA 4KG0A 4IQPA 5JOXA 5JPNB 3E6CC 5GLZA 4PIYA 1H4HA 2H6CA 3NAPC 2ZGTA 1Q43A 5FOBB 5JZGC 5DDJ2 2FZ2A 1S0DA 3B5LB 1AR93 2EXIA 3LSEA 1N3PA 4Q4Y2 4YW2A 1K5MC 3CJIA 1D2SA 2WQ4A 3AYDA 3I54A 1RUJ1 2CTVA 2BWCA 1O7FA 3AMQA 4LBQA 1J58A 4QXKA 1RMU2 3WP3A 2OIIA 2LALA 2R061 1PGW1 2R49A 1GNZA 1QOTA 2PFWA 2ZCWA 3MW4A 1DF0A 3ZXEA 1W0PA 5FO8B 2ZZQA 4LBKA 1HRV2 2A3WA 1WLTA 2HWC1 4HKOA 1PIV2 1DQ6A 1AXZA 1NE4A 1H2KA 3AYAA 3SH4A 5I0SA 1S0JA 4XFBA 1YFUA 1CD3G 3IPVA 2ZA9A 1S0FA 1H9WA 4TYSA 4EN8B 4H55A 4HBNA 2BYVE 4AWDA 1PMIA 2MEV1 1AXYA 5F6KA 1R091 3OJBA 4AI2A 3JQXA 3LAGA 4GA9A 3RS6A 3ZXKA 5IT6A 4WM7C 1WLCA 3VBUB 3O5SA 1DZRA 1Q8OA 2YV8A 5J48A 3VZOA 4XW3A 4BLIA 2PHWA 2R6QA 3NVCA 1ZM1A 2E51A 5SV8A 1QJY1 3OF1A 5E1RA 5JZGB 1HLCA 4Q0UA 3TB0A 3ZDSA 1QQP2 2CGOA 1EYBA 5T52A 3ZXGA 1RUG1 1CIWA 1NYWA 2EVXA 4YM1A 4IEYA 2VMGA 2XVKA 4OULA 3THPA 1TE1B 5J09A 1IPJA 1K5MA 3WDXA 4OUSA 2I74A 5BV6A 5KXDA 4WV8A 3KLSA 3MIBA 1BVVA 5A32A 5L7OC 1D0HA 1PGL2 3J8F1 4CP1A 1KDMA 4Y4YA 2IFWA 3CLPA 1UMZA 4XFHA 2A73B 4XFIA 3AKTA 2B39A 1WCSA 2ZZJA 4N43B 1G6NA 2WNVC 3VBFA 4B29A 1G8WA 2ZHKA 1QF3A 1C8M3 3QCWA 5JDBA 1GR3A 4FXKB 5EWSA 2VOVA 2JDZA 2WFF1 4Y22A 1GQHA 5LRSA 1YIPA 2DFCA 1PIV1 1OA3A 2RE9A 1LOAA 1V6LA 2KM2A 3VZKA 4Q1PA 4WM7B 5LK7B 4LE3A 3JBG2 4QQ2A 3TN91 3APBA 5C6CA 4PLMA 2PHLA 4K40A 2R063 2E7AA 5ABJA 1AYM3 2LTNA 4AI8A 4YFWA 1HX6A 2R0HA 1QHDA 1LENA 1DHKB 3A0KA 2UU8A 1OPMA 2RR12 1CAUA 1RUJ3 3E5QA 1GZWB 5BPXA 3WG2A 4E9KA 1BVP1 3NJZA 3IWZA 2NLRA 1AR62 5BNOB 1D0GA 3N36A 1S2KA 4YLZA 4I30A 1COV2 1AUYA 1FAYA 4Z1VA 1LOFA 1UPSA 4JGZA 5LEKA 2ZGLA 4LEJA 2Y26A 4LHLA 1D4M3 4A7KA 3LWCA 3KZ4C 4ATFA 4YRDA 2EAKA 2OA2A 5L7OB 4Q4X3 1LU1A 4RD7A 1CONA 2RS52 1ULGA 4X6RB 1MZ6A 3RJRA 5J3UA 1H8TA 1IGOA 1JUIA 3GZUC 2WNUC 1XYPA 1LOCA 3WDVA 1AR71 2HWF1 4AQ2A 2JJ6A 1YJKA 4FP3A 4L97A 2RM23 1O4YA 4E27A 4F3JA 1AYM2 1U12A 1O3SA 1UX6A 2PHXA 3JUUA 4FPGA 2VY0A 4NO4A 3GZAA 3N7KA 1GZCA 4LBLA 4X6QB 2ZABA 3CEWA 3HMYA 2ZBJA 2Y38A 3V0AA 4P9GA 4QGMA 4Q0SA 1RGSA 5LRRA 3FLTA 4Q2FA 4RSUA 1RMU3 4QQPA 1J1LA 2B9UA 4BWOA 2ZS6B 1CJPA 3I4IA 4DS0A 4BCUA 1F8VA 2E9QA 1QJU1 2ZPXA 5DXDA 4GQ7A 4I3GA 3ZYJB 1LESA 2QDNA 5FPZA 2E6VA 2Q8OA 3HQXA 4QPGC 4Z2WA 3RMYA 1UL9A 4AHWA 3CU7A 2WSVA 4FPEA 3SCHA 2XKOA 4R4XA 3WDTA 1MVQA 4AHXA 1PNFA 4D7TA 5GZGA 5K9YA 2AZ5A 4L11A 5AC91 4LUKA 4ZU7A 4EWAA 1N47A 4M0NA 3AP6A 1S0BA 3W9AA 4FQZA 2RS32 4CDUC 3V0BB 5EXOA 4D7YA 3GBWA 1O4TA 2FBEA 3WLUA 3B01A 4Q0PA 4FAHA 1REFA 1AL23 3WHTA 2A71A 4HN0A 4AI0A 4DNYA 2O1QA 1MZFA 1NCQA 3JZVA 3AX4A 3FE5A 3S0MA 3R05A 5ACA2 5JI7A 1O3TA 5J37A 4XFGA 3WXPA 1QOSA 1DDLA 4GULA 2PELA 1SACA 1WUVA 2D40A 1JBCA 2JKBA 1KITA 1JH5A 4FPOB 3JQWA 4PF5A 4PJYA 1LR5A 4K21A 2XUMA 1H9PA 2Q4SA 2XJUA 5I0RA 4WZFA 1EAH1 4S2GA 2GC1A 4RR3C 2ILMA 3HBZA 3RNSA 2HWB3 1NA1C 4QPGB 3NWKA 1A8MA 4Y1ZA 4E2GA 1SFNA 2W39A 4XTPA 3S6PA 2R32A 4AFBA 2HWF2 2G4IA 4JGYA 4YM2A 3WVJA 2PHDA 4QHBA 2ZGPA 1AJKA 1LU2A 2BNNA 4XTMA 3WHUA 3RPQA 4ES9A 4UBHA 5F1RA 3MIGA 4IV1B 3GBGA 3AM2A 1EV13 3POSA 3WDUA 5FAXA 4AVVA 4YW3A 3QOPA 3ZYGA 3QD6A 4PDWB 3MI8A 4CDUB 4CDWB 2GN3A 2MHFA 1UIKA 2PHRA 1IS5A 3WX5A 1RUF3 2PAKA 2BVBA 4XF3A 3B3QE 2CGNA 1PVC1 1H8TB 3AP7A 1AX2A 2XWJB 4HL0A 4AVAA 2DVGA 2HJIA 4QQHA 5JWPA 4AEKA 5J96B 3KT1A 4AQTA 4MZUA 4Q8LA 2IFRA 1OQDA 3D82A 1W39A 3BOWA 1F31A 2ZGMA 4CRQA 2X5IA 4CEYA 2OYZA 5TSWA 4N9HA 4XF9A 3H7JA 4BM8A 4R9AA 3IDBB 1CAXA 4OI4A 5BNPA 2TUNA 3FFZA 1G86A 3B93A 3L2YA 3SITA 2WZR3 1YIFA 1GZWA 4CDQA 1VBD1 4KNCA 4MYEA 3R4DB 1XU2A 4RHV1 1TNRA 1RUD2 3K48A 4YZ5A 5EJ3A 5C8WA 2A6ZA 3WOGA 2NYYA 3O0XA 1O3QA 1S0IA 3RZZA 2GNMA 1IZ3A 4H7LA 5K8SA 1QOOA 5JOYA 5A32B 2XBO1 1C5HA 1WMEA 4I3PA 4BLJA 1MVEA 4PDWC 3MZHA 3VBRA 2W0XA 3WY6A 4AEDC 4CP0A 3HD8B 2NM1A 5AVAA 3MW2A 2XH6A 1YHFA 4DINB 1WD3A 1RUE1 1RHI2 1W6MA 4L92A 4NHKA 4X8NA 2WS93 1H1MA 5FQ0B 2RR13 3PMEA 3PHMA 4IERA 4LE4A 4Z8BA 4G9SB 3JBG3 3TBDA 2ZX4A 4E4ZA 3VN4A 3M1HA 4Y22B 1JXNA 2HWD2 2GC0A 2VNRA 1NCRA 3MIEA 3ZFFA 1RUI3 1F9KA 2ZGQA 2XB6C 3WDYA 1OA2A 3LA3A 1ZZ9A 1RUF1 4IV1A 5DDJ1 1UCXA 5FPXA 5CFDB 1LOGA 4CEWC 3WZ1A 4XPVA 1QJZA 1WW4A 3VHPA 2ZAHA 4CDXB 1AL0G 4M3CA 2Y0OA 4KU8A 4CTEA 4FXGB 1V6KA 3ZXDA 3TWIA 1EAH2 5BNNC 4LR4A 2NN8A 4KQ7A 2RM22 3QH7A 1IS4A 5D8AB 4XQWA 3AZZA 4LA2A 3AZWA 4H3WA 1YFXA 5J98B 3QACA 3FBYA 1Z7S2 3ME2A 5L73A 4YSFA 5BNQA 3HR9A 3ST7A 4JDNA 2WA3A 2EA7A 2IC1A 2EXKA 1X50A 2V09A 1QGLA 1RUC1 3GBFA 3NKTA 5KC5A 1POV3 4AEDB 1LJ7A 3D0JA 3THTA 3IT8A 3LOBA 5F9TA 3NAPB 2A6WA 2BGCA 3AMMA 5T5PA 1QH6A 3BOPA 4IEUA 2A7AA 2DCTA 4C90A 1C5IA 1DGWX 2WZR2 4QM8A 1K5MB 4U2AA 2XLFA 1Q8QA 4E2QA 3O14A 4FOVA 4LBQD 1LOEA 1RHI3 4JGZB 2VW2A 1J3RA 2WKKA 2VG9A 4ASLA 3N35A 3VBHC 2DCKA 1AL21 1VIWB 4FAGA 1MS4A 4CEWB 2BW8A 3AZYA 4OI2A 1WW5A 4CDUA 1DGLA 4RQPC 4JVAA 1CR7A 4Q4V2 4WVMB 1T6GC 4A7YA 5C9AB 2FMYA 4Z92B 5GM0A 2ZJCA 2XBO2 5H9PA 1I1EA 2B42B 4AGGA 2MEV2 2WIIB 4FPYA 1XNCA