1LGCA

Interaction of a legume lectin with the n2 fragment of human lactotransferrin or with the isolated biantennary glycopeptide: role of the fucose moiety
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
181
structure length
181
Chain Sequence
TETTSFSITKFGPDQPNLIFQGDGYTTKERLTLTKAVRNTVGRALYSSPIHIWDSKTGNVANFVTSFTFVIDAPNSYNVADGFTFFIAPVDTKPQTGGGYLGVFNSKDYDKTSQTVAVEFDTFYNTAWDPSNGDRHIGIDVNSIKSINTKSWKLQNGKEANVVIAFNGATNVLTVSLTYPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of a legume lectin complexed with the human lactotransferrin N2 fragment, and with an isolated biantennary glycopeptide: role of the fucose moiety.
pubmed doi rcsb
source organism Lathyrus ochrus
molecule tags Lectin
molecule keywords LEGUME ISOLECTIN II (ALPHA CHAIN)
total genus 24
structure length 181
sequence length 181
chains with identical sequence C, E
ec nomenclature
pdb deposition date 1994-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1lgcA00
2R1BA 1IKPA 2BQPA 3V65A 1V6IA 1FX5A 1SCSA 2OUHA 5JOWA 2E51A 4XBQA 3NV4A 4GA9A 4FOVA 1BXHA 5CNAA 2A70A 1IOAA 4XTPA 2DUQA 4XYXA 3VKLA 1IS3A 1LOBA 4HL0A 1MS0A 4U36A 4AGRA 2JDZA 1LEDA 5T5JA 4YGEA 2W39A 2GN3A 3AP7A 3FUQA 1Q56A 1ULDA 4GKYA 1MS8A 2B7YA 1V00A 3IN9A 3RSJA 4HANA 1MVQA 4ITCA 3WZ1A 1AJOA 2WKKA 1NXD1 2R0HA 3H0OA 4BOWA 5CB7A 1X50A 1YO8A 1G7YA 1Y7BA 5E8AA 1GZWA 2ZZJA 2ZKNA 4DPNA 1V6NA 4U2AA 2OUJA 1LOCA 3OBTA 4C1XA 1Q8VA 4ATEA 4Y1ZA 4Y26A 4D69A 4XJZA 5KXCA 2AR6A 1S0EA 1JBCA 4FP2A 1SBEA 3HR9A 4AVVA 4FOYA 1N1SA 3INAA 1BZWA 1LODA 3BODA 1JHNA 4BPZA 5H9PA 1DQ1A 1AX0A 2ZGNA 3WDUA 4BQ1A 4YLZA 2E7QA 1QU0A 4M3CF 1W6MB 3ILFA 4BLJA 1W6NA 2ENRA 4Z8BA 4YZ5A 4M3CA 2UWCA 5GZFA 2W08A 2ZGTA 3OY8A 1LU1A 4WVWA 2EXJA 2GNMA 2D6MA 2GMEA 2WT1A 2AGSA 4ZXKA 4LBMA 3ZSKA 1CQ9A 3BTAA 1GLHA 1DQ0A 3V0BB 1S0IA 3OBRA 1CIWA 3T1LA 1WBFA 1GZWB 3PVOA 4XXAA 4FVVA 4Q1RA 1N1VA 4XBNA 2ZGRA 3FUOA 1N1YA 5DUWA 1QNYA 2R0FA 2DWRA 1ULCA 2P3KA 5IK7A 1GBGA 4UW6A 4H55A 2R49A 1LGBA 1RITA 1RIRA 5GZDA 1OFSA 1NLSA 2ZBJA 2VU9A 2A6XA 3OYWB 4XMAA 4YM1A 3W59A 3ZSJA 1QMJA 2D3SA 4BMBA 1RINA 1UPSA 3IPVA 3KQRA 4YGBA 4XJUA 2GNDA 1LCLA 1DQ4A 3NV1A 1O4ZA 1W6PA 2ARBA 1MZ6A 1VAMA 3T1MA 2VH9A 1CJPA 1LHNA 3D6EA 4BLIA 4DFSA 1KDMA 2NMOA 2DU1A 3C2UA 3N36A 4YW2A 5T52A 1QF3A 2R1DA 2ZMKA 3RMYA 3A4UA 4XJAA 2ZGMA 2CY6A 5DZFA 5EYYA 4CZSA 1S0JA 2YZ4A 1DBNA 1QOOA 4L8QA 1KITA 3ENRA 2XB6C 3B00A 1CPNA 3N35A 1VAVA 3HN1A 1FNYA 4SLIA 2WQZC 3WDVA 2ZGUA 5T50A 4LBQB 1D2SA 3KM5A 1SACA 1DLLA 1WCSA 3N7LA 1F9KA 3WCRA 1R1ZA 2YY1A 5CA6A 4P9YA 3IMNA 5FREA 1QOTA 1QKQA 1V6KA 2EIGA 2A3YA 1F5FA 3AXDA 2WSUA 2GN7A 3WDYA 1S0CA 2ERFA 3JUUA 2WT2A 3WCSA 1CPMA 3AP5A 4M3CE 4R9BA 3SITA 3O0WA 2CWSA 1DFQA 3WLUA 3AYCA 3AZWA 4YGCA 5T54A 1N3OA 3ZYRA 4YW1A 3WDTA 4K21A 3B9CA 4FP3A 4ZKTB 2OVUA 2KM2A 1ENSA 3LSDA 1DQ2A 2PHTA 4YG0A 3UJOA 4WV8A 3ZXKA 2D6OX 4Y20A 3SH5A 3B69A 4BM8A 3QLQA 1IS4A 2ZGOA 1WW6A 4FPOB 3RS6A 1KJLA 4Y22B 2ZMLA 4Y1YA 5KXDA 4YG6A 2JE7A 1AF9A 1G9BA 3TB0A 2DVBA 5L73A 1ONAA 2EALA 3MW4A 3LCPA 4ASMB 4XILA 4YFWA 1CESA 2GDFA 2GMPA 3WNXA 4YM3A 3WUCA 3PVNA 5GZCA 2P34A 5DUUA 2UWAA 2LTNA 1MS5A 1V6LA 3N7JA 3ZXJA 1YIFA 1TEIA 4XIKA 1G9FA 2ZHNA 1JW6A 4XZPA 2G4IA 2PHUA 1MS9A 4XJ8A 1MS4A 4PCRA 3SH4A 1ENQA 2SLIA 3MW2A 2ZGSA 1PZ8A 1APNA 2ZAAA 1HQLA 4LBOA 3O0VA 4ISQA 1PZ9A 1Q8PA 2DU0A 3NV3A 4AYUA 3V64A 4YM2A 2ZHLA 5GZGA 1AXKA 3POYA 3UJQA 4MYEA 1FNZA 3TAYA 2TEPA 1LOFA 2ZGQA 4XJWA 1MR5A 3FLTA 2XG3A 5EWSA 1LHUA 3AZZA 3JU9A 5AVAA 2ZABA 2ARXA 1UAIA 1QNWA 1GANA 3UL2A 1N3PA 4XTMA 1HQWA 1AZDA 3FLPA 3M2MA 4I30A 1MACA 2GALA 4LBJA 3I8TA 5JVVA 1DGLA 1LJ7A 4P9WA 3FFZA 3RQ0A 3MPPG 1MVEA 2C9AA 1J1TA 4DQAA 4LBNA 3PVEA 5T5PA 3GNEA 5GM0A 2ZA9A 5T5LA 5BYNA 1KJRA 3AP6A 2A75A 2D6NA 3N7MA 5IUQA 3VKOA 1U0AA 3WDWA 1G86A 1GNHA 4AVTA 1W0OA 1SBFA 2ZACA 1YYNA 3R4UA 4GWMA 4M00A 1LECA 3WHUA 1QGLA 3OYWA 4XHBA 3HMYA 1QDCA 1ULGA 1WLCA 4JC1A 4YM0A 5LK5A 3WVJA 4Y20B 1H9WA 1CONA 4OZXA 4PQ9A 2CL2A 2GNBA 3SLIA 3D4KA 3AJZA 2VY0A 1A8DA 4FPKA 4AWDA 3BIWE 1W6MA 1SBDA 3AP4A 2FMDA 1KQRA 1KDKA 3B01A 1OQ1A 1LGNA 2YV8A 3OY8B 4UW5A 1DYPA 2W52A 2ZHMA 1IS6A 3AJYA 1JXNA 1JN2P 4YW3A 2D6LX 4GXLA 4K1ZA 1V6OA 1ZA4A 2PHFA 2E7TA 1CR7A 2AH2A 3NV2A 1WLWA 4XOGA 5DZGA 3U4XA 2DV9A 3N7KA 3AX4A 1LOAA 2YROA 3WG1A 3SISA 3ZVXA 2NZ9A 5GLTA 4DS0A 2NP0A 2DVDA 2JD4A 1N3QA 2VW0A 2CYFA 5CAZA 3V0AB 1LHVA 1FV2A 1AXZA 3PMEA 1SFYA 3LSEA 1S0FA 5JDBA 4FPFA 4XBLA 1W6OB 3VKMA 4AGGA 5T55A 3DGTA 4NO4A 3ILNA 4Q1PA 4YFZA 2VUAA 2PELA 3DUIA 4RL7A 4FPEA 2D6KA 5GALA 1BJQA 1LGCA 2A6WA 3M3CA 1GYKA 5DG1A 1WD4A 1SLCA 3M3EA 1AXYA 4JCKA 4XE9A 3AZXA 1WLDA 2E53A 3MW3A 1IS5A 1GICA 2WLQA 4XIOA 4XJ9A 1WUVA 2JKBA 3W58A 1HLCA 2A6ZA 1LESA 3AYAA 4FOWA 2AENA 1URXA 3AFKA 5F5QA 2EF6A 2P3IA 5GLVA 1UKGA 5H9RA 1Q8QA 2ZHKA 2D3PA 1VALA 3R05A 4IQPA 2CNAA 2DURA 3N3HA 5KXEA 2P3JA 3ZXLA 3NWKA 4PBPA 4FOQA 1DZQA 1WD3A 3AZVA 4KBBA 3VKFC 1W6OA 1WW5A 4GALA 5DG2A 1LEMA 4FPCA 1EPWA 1S1AA 1GZCA 5T5OA 4PF5A 1JOJA 3SH3A 1ULEA 2AREA 3ATGA 2DTWA 5EYXA 1QOSA 2LALA 4Q8LA 4P9XA 3WG2A 1JYCA 3WOGA 1OKQA 2E6VA 5JLVA 1Z0HA 4K1YA 3ZPYA 1LULA 3BOPA 5JMCA 1Q8SA 4CTEA 1HDKA 3ILRA 1BKZA 3WUDA 5H9SA 5H9QA 1UN1A 2DYCA 4Q2FA 3RRDA 1C1LA 4ISRA 2A71A 4C1WA 4XDQA 2DUPA 2UU8A 2VXRA 3O0XA 3R4SA 4GWNA 1DIWA 1LOGA 1LTEA 3MEPA 2Z42A 3APBA 4LBKA 1UX6A 1YXWA 5JOZA 1C57A 3AYDA 1A78A 1W6QB 2YXSA 1SLLA 5JOXA 1C1FA 1XQNA 1WW4A 3V0AA 2PHXA 4Y22A 5F9TA 3Q9OA 2EAKA 4Y1VA 3M3QA 3ZXFA 4YW4A 1ZM1A 4UW4A 2PHRA 5DZEA 3AK0A 3AZYA 4PBOA 4YG3A 1UMZA 1UZYA 1AVBA 4JRAA 3USUB 1H30A 3POWA 2EXHA 2WJSA 1BQPA 1V6MA 2DVGA 2WSVA 1MS1A 3AP9A 3OPZA 2CTVA 4R9DA 4XXPA 3CNAA 2HYKA 1DYKA 4FPGA 2ES3A 4K20A 4UW3A 4W65A 1S0DA 5GLZA 2WT0A 3ZSMA 1V6JA 4AGVA 5IK5A 1B09A 1FV3A 2UURA 2NN8A 2RHPA 2ZGPA 2A3WA 2R16A 3AXEA 3ZSLA 1GV9A 2JECA 4FPYA 4WVVA 4P14A 2GMMA 1JUIA 1YRZA 3T2TA 1AX2A 3VV1A 3O5SA 1SLTA 4NOTA 5KXBA 1N1TA 2A6YA 4LBQA 4YZ1A 1H9PA 1MS3A 5EXOA 1LENA 4Q26A 1UZZA 2H0BA 4LBQD 3ASIA 4F83A 3B3QE 3WG4A 4YZ2A 1G9AA 1QDOA 3OGGA 1SLIA 2VW1A 2I2SA 5DXDA 4Y1UA 3OJBA 4XMIA 5GLUA 1W6PB 3PJQA 1JYIA 4FPHA 4TYSA 4DRVA 2DVFA 1C4RA 5FRAA 2JJ6A 2EXKA 1BYHA 3A0NA 1VIWB 1Z78A 5E89A 1SCRA 1I1EA 3POSA 1KRIA 4M3CB 5DUVA 1S0GA 2ZMNA 2DVAA 3QCWA 4Y24A 3VUOA 1ENRA 1WW7A 1A3KA 2C5DA 2JE9A 4AVSA 1LHOA 5SV8A 1GZ9A 1FATA 1O4YA 2FHRA 1FYUA 2EXIA 3L2YA 4Q27A 4YZ4A 2AUYA 1HKDA 1W0PA 1GNZA 2AYHA 2PHWA 4R9AA 5GZEA 1GSLA 4M01A 5IT6A 3FLRA 5JOYA 2D44A 4YZ3A 2W68A 1N47A 5HCAA 2YMZA 2A5ZA 2D3RA 3M3OA 3UK9A 1D0HA 4RA0A 4XHXA 5IK4A 1CN1A 2CWMA 2D7FA 1DHKB 2NYYA 2UWBA 2DTYA 5DUXA 5HCFA 3VKNA 1G9CA 3IKWA 3O12A 4Q8KA 3IM0A 2NM1A 1CVNA 1W6QA 1IKQA 3WV6A 1FAYA 3USUA 1F31A 4FQZA 4FPJA 4CRQA 1VLNA 3AYEA 4YW5A 1G9DA 2D43A 1Q8OA 1DQ6A 1I3HA 1LOFC 5IK8A 1GKBA 1ULFA 2A3XA 3ZXEA 2GNTA 1PZ7A 1S0BA 2ZGKA 3D5OA 4Y1XA 5CBLA 1AX1A 3WG3A 3V0BA 3M1HA 1W6NB 2NMNA 3ZYPA 4LBLA 4YGDA 3WDXA 1LHWA 1MZ5A 4TZDA 3RG0A 2WNEA 1WBLA 2SBAA 2ZGLA 4FQ4A 4DRRA 1DQ5A 1LOEA 4FPLA 2V5YA 2A6VA 1SLAA 1LU2A 3I4IA 4WZFA 3GALA 3SNMA 1YI7A 2DUOA 1UL9A 3A0KA 1G8WA 2Q5TA 3FBYA 5GJ6A 5E88A 2V73A 2D6PA 2P2KA 5GLWA 5HCBA 2OW4A 4R9CA 3IPVB 4BMEA 4ATFA 4GKXA 2VW2A 3RMXA 3WHTA 1AJKA 1SLBA 2P37A 2A7AA
chains in the Genus database with same CATH superfamily
2FQPA 2WO3A 1YQ6A 1NUKA 3V65A 2OUHA 1SCSA 3CZUA 3I2FA 2PN5A 5A32B 3WNNA 5JOWA 3O1PA 1L7RA 4GA9A 5CNAA 1AR93 4XTPA 1GQGA 4CDXA 4V2WA 1IS3A 4HETA 4U36A 4AGRA 1O3QA 1HRI1 4YGEA 2W39A 1CAXB 2YPDA 2VZ3A 3AP7A 2ZX2A 3FUQA 2Z69A 2RS51 1ASJ1 1B35B 2C1FA 4KWJA 5ANNA 4D6SA 4GWJA 2D40A 1QJY2 2HEVF 2KXLA 2IXHA 3KWVA 4HT1T 1B35A 5CISA 4DINB 3BGAA 4GULA 1AJOA 1NA1A 1NY71 1QJFA 2WKKA 2XVGA 3AMHA 4S2GA 4BOWA 4XVHA 2CGNA 4AQ2A 3MF6A 4FCAA 3O1UA 3GCWA 1CAWB 4CSWA 4CUAA 5E16A 4OHWA 1GZWA 3LA7A 2E33A 3ZIWA 4U2AA 2OUJA 1LOCA 2ETEA 4C90A 4RN5A 3ACHA 3OGVA 3KF3A 4D69A 1S0EA 1JBCA 1S2BA 4FP2A 4LUKA 3HR9A 5DAQA 1XYPA 1TMF3 4E2SA 2EIBA 5C7GA 1Z7S3 5D21A 1JHJA 3BODA 3SHRA 3KD4A 5H9PA 4CP0A 2BPA2 1AL21 1W2OA 1JODA 1NX9A 2E7QA 1AYM3 4M3CF 4BLJA 3OGRA 4SBVA 1W6NA 5CZKA 1H1MA 1ZVFA 4Z8BA 5L19A 4M3CA 1JZ6A 1IHMA 2W08A 3OY8A 3PIGA 1LU1A 4IEYA 4QGNA 5FQ0B 1JZ4A 2D6MA 5F8PA 5B2GB 5IVBA 2VCAA 2WLPA 2L9LA 4YPJA 2WT1A 3VZOA 2X10A 4ZXKA 4G9SB 3HD8B 2LW8A 2JE8A 4OUMA 1C5IA 1GLHA 1S0IA 3O1TA 3FHQA 2FCUA 2Q8CA 1PO11 1GZWB 1WBFA 2EICA 3PVOA 2W0XA 3RGBA 1HJFA 3VDCA 3ZO0B 3HBKA 1JU4A 1UNBA 3KCYA 1ND3C 1EUUA 5DUWA 4QPIA 3ELNA 3WX5A 1NCRA 4OYUA 2MEV1 2P3KA 3QOPA 4UW6A 1GZTA 2HJIA 4Q0SA 3K77A 5IFTA 3CJXA 3ZN4A 1OOPB 4LA2A 2P17A 2VOTA 2A6XA 2R073 3CQOA 1HV1A 4XMAA 4GWIA 1QMJA 3EMRA 1AYM1 4BMBA 5FBJA 4TN7A 3IPVA 4CCEA 5FMCA 3H1WA 2BJSA 3JQWA 4DXZA 3VDAA 1FT9A 1J84A 2XONA 2Z5WA 2BBAA 3D6EA 2W1SA 1KDMA 1PMJX 2BUKA 1NZIA 2IZWA 2WWUA 2VTXJ 1RMU3 4B7KA 3QD6A 2R1DA 2OZ6A 1QQP1 3NRUA 4XF3A 4M4RA 2XWBB 2ZGMA 3BALA 4JGYB 3VBSA 2CY6A 4A6SA 4CDUB 2Y26A 4XEZA 5DZFA 2YHJA 4N7UA 5A3WA 1L7QA 5EYYA 2FCVA 1QOOA 5KBFA 5DN2A 3ENRA 2XB6C 3B00A 3PU8A 5D8AA 3J7HA 5FYYA 4HKLA 2WZPP 3SKJE 3VBOC 1VAKA 4SLIA 3CHXA 3DF0A 3WDVA 2ZGUA 5DABA 4LBQB 4AK3A 1WCUA 3I7DA 3RJ2X 2XJUA 5HCHA 1SPPB 2YY1A 3ACIA 3CZJA 1WCQA 4FFHA 1K3IA 1MEC3 2A3YA 3AXDA 2HWD3 2GN7A 3E6BA 1S0CA 2ERFA 3JUUA 2WT2A 2W91A 2WUHA 4M3CE 2IVIB 3SITA 3P6BA 3WLUA 3FFQA 4O9EA 3B94A 3O1VA 4YGCA 4CEWB 3ZYRA 5D1IA 2RM21 4QX1A 4K21A 3B9CA 4GB31 1ENSA 3LSDA 3VGIA 2VNOA 4YG0A 1GQHA 2PHTA 3LA2A 1UZWA 4Y20A 2VO5A 3A22A 4IE0A 3RNSA 4K40A 5CKQA 2UYBA 5IVJA 2Q0AA 5HV4A 4Y22B 3ZYFA 2GC3A 4MXVA 4OQ8A 2X05A 2XBO1 4N53B 1GP5A 2DVBA 1ONAA 3BU7A 2HWF3 4ASMB 1ZZBA 5FOBB 2IFRA 4GH4B 1F4HA 4JV4A 3KV6A 2E7AA 3KVAA 1F4AA 3VBHB 3WUCA 4AEDC 4YM3A 4RQPA 2DFBA 3PL0A 5DUUA 3RZGA 1AR71 3OGSA 2UWAA 4Y4YA 2LTNA 1O4TA 2A73B 3ZMNA 1YIFA 1TEIA 4HN0A 3U11A 2XJQA 4EYUA 1MS9A 4XJ8A 4AI9A 4DXRA 2PTMA 3VBRA 2I45A 1R1A3 3DECA 2ZAAA 1JI6A 1HQLA 2OA2A 5LK7B 3MHZA 4CDQA 2DU0A 3NV3A 3VBRB 5DDJ2 4AYUA 4I0AA 3V64A 5F7UA 2BU9A 1HRV3 3JCIA 2BNMA 1HB1A 1FMD1 4JZRA 5C4WC 1MR5A 3POJA 3TEZA 1UAIA 3ACGA 5FIXA 3O1RA 2LUWA 1N3PA 1VBC2 1YI9A 2EIEA 4XTMA 3K4AA 1VJ2A 5FXZA 5BNPB 4XDPA 2JX9A 2PLV1 1MACA 3ZFGC 2GALA 5FYCA 1I5PA 3CJIB 1OLMA 1DGLA 3FFZA 5FBZA 1NE6A 1PIV1 4H7LA 5FY0A 5LEJA 4DQAA 2PXJA 4LBNA 4MOAA 2ZA9A 1BK0A 1CAWA 2YYOA 1KJRA 1UU5A 2RMU2 3AM2A 3AP6A 2A75A 3SCHA 2BDRA 1VBD1 1IZ3A 3N7MA 4KGGA 4OI1A 1U0AA 3VKOA 2HWE1 3FBMA 1BMV2 5A3NA 5CG9A 3POBA 1UIJA 1XJAA 3MUY1 2HWD2 4AEDA 5I8TA 2XHKA 4AW7A 4RGAA 4MGKE 1QGLA 2VL4A 3HMYA 4YRDA 1QDCA 4MADA 1E57A 4CXWA 2XGXA 2BFUL 3ACLA 4FAGA 5FLIA 4OI2A 4YW7A 2PLV2 2GNBA 3WQ1A 3FC0A 4QQ2A 2VZPA 3CEWA 1OSGA 3PUIA 1PO13 1OA3A 3HWJA 1OUSA 2IC1A 1KQRA 1KDKA 3UNPA 3CMGA 3OY8B 3WNKA 1L3JA 1GNYA 3SKVA 1IS6A 3FWEA 1K5MB 4L97A 5F6KA 1V6OA 5DZGA 2PHFA 4X8NA 1CR7A 2AH2A 3K2OA 1WLWA 4S2FA 4XFAA 4E9KA 3N7KA 2HWD1 2QFEA 3AX4A 3WG1A 1XNTA 3WF3A 4DS0A 3CIHA 5L7OC 3MZHA 2O14A 1N3QA 3UT0A 2CYFA 4BQ4A 2YDEA 5CAZA 4A41A 3V0AB 4RFT0 1GP6A 4KG8A 1AXZA 1BK1A 3B02A 3O1MA 2I74A 3K3OA 4LA3A 4NO4A 4CCJA 3RDIA 4M0NA 4Q4Y2 3WY6A 4C0HA 5I93A 4PDWB 1RUD1 3ZN5A 1ULPA 4L2NA 5FKCA 1NKGA 2VOVA 2XVKA 4XFGA 5DG1A 5F39A 3IBMA 5FPAA 1VB2A 4O65A 1DYOA 1IS5A 1JU3A 2J1UA 3WNOA 4XIOA 2R041 1WUVA 3SQOA 3K4DA 3W58A 5E6HA 1HLCA 2XMLA 2B9UA 4CPBA 4QX2A 4LKFA 2WWJA 4META 2EF6A 5CFDA 5F3IA 3BN6A 1JUHA 4MUVA 1OD3A 4PHZA 5C8WA 1YFYA 2W5FA 3POFA 1GWKA 2XKPA 3AKPA 2HBUA 4ZXEA 4ZY9A 4OHZA 4XFBA 1MZFA 4FOQA 4LXLA 3VKFC 1RUF3 5DG2A 3CL1A 3LZZA 2B45X 2XL7A 4LIUA 5FZ9A 2RMU3 4TTGA 3GGLA 1JOJA 1C28A 4ASKA 1GFF2 4D8MA 2AREA 4Q29A 1RXGA 2E9QA 5EYXA 4BHPA 2LALA 4JKMA 5FMBA 4OMCA 1DGRA 3AMMA 1OLRA 4NIIA 4QXHA 3WOGA 3I59B 2WR9A 1GWMA 2EVXA 2QKDA 4A4AA 1MZEA 4XF9A 3QH6A 4CTEA 5A7PA 1BKZA 3MICA 5FZIA 5H9QA 3IIIA 4Y33A 2WRAA 3LF7A 4J1XA 4Q2FA 5C5UA 4QPIC 2WZEA 2B9VA 1Y9MA 1LOGA 1LTEA 4Q4Y3 4PI2A 1ND2B 3H7JA 1DCSA 3WSOA 2Z42A 3APBA 4COZA 1I6XA 1UX6A 1YXWA 3WW2A 4CCCA 3VZMA 4D0QA 4YSFA 5F37A 1HJGA 1UF2C 4FTEA 5JMOA 4OHVA 1SLLA 5JOXA 1XQNA 1WW4A 3DEMA 4S2DA 4Y22A 3TWIA 3V0AA 5F9TA 5LBBA 3A23A 2WIIB 2ZEZA 1RYYA 4LLOA 1RHI3 3M3QA 4UFJA 4Y1VA 3VZKA 4UW4A 1UYPA 1R1A1 3AK0A 2Z79A 2GH2A 1UZYA 4IV1A 2C4XA 4A44A 3GZUC 2FDFA 1I5ZA 2EXHA 3OPZA 3THCA 2BNOA 1MS1A 5FY5A 2HYKA 1DYKA 3BTYA 2WA3A 4KWKA 5GLZA 2J7MA 1B09A 2UURA 4OI4A 1CZSA 1HN0A 2A3WA 2ZGPA 2ZJCA 3LQCA 3LAGA 1TVGA 4DB5A 2JECA 4XURA 1UY4A 1OFNA 3NJVA 4BISA 1VR3A 3D3AA 3NSTA 4NRMA 1QQP2 1FOD2 3GZTB 1SLTA 3ST7A 3UV9A 3VV1A 1N1TA 2A6YA 4LBQA 4YZ1A 1MS3A 5HXMA 4RGKA 4KH9A 3POGA 2J22A 4IUGA 2H0BA 4CUCA 2P4EA 2CU5A 3WG4A 1QDOA 2D98A 3HIFA 2I2SA 2J1TA 3K75B 5DXDA 3ETPA 5GLUA 2K46A 3KLSA 4FFFA 4DRVA 2DVFA 1ZYBA 2N7GA 4H7MA 2JJ6A 2G9ZA 3OD0A 2EXKA 5CADA 5I91A 5FZ3A 1QJU3 3VDDA 1VIWB 3OPTA 5E89A 3LFIA 3ZYGA 2VZSA 3POSA 4BQ3A 4IGPA 3PUSA 4Y24A 3H8XA 3QCWA 3VZJA 1ENXA 1W9YA 4Z92B 1XXNA 3OB8A 1H8TA 2K0GA 1HB4A 3RWNA 1RC6A 2HWC2 2D93A 3HEIA 1DP0A 2BBVA 2EXIA 4UOJA 4ZPIA 1HKDA 3U75A 4CDWB 1GNZA 4GB32 4N43B 3VHRA 4R9AA 3POIA 1GOFA 2OX0A 3FLRA 4HZFA 4BU2A 2WYSA 1NCRB 4YZ3A 1G6NA 1JTZX 1VBE2 2OT7A 5A7SA 5KR7A 4M4PA 3M3OA 2GC0A 1RMU2 3ZM8A 2A1XA 2O8OA 4OULA 2VNGA 4MGTA 5F3CA 3X29B 2JG9B 4EWAA 3EQEA 5KHKA 2C9KA 2HWF2 3IM0A 4R8HA 5FDBA 1BVP1 1CAVB 3THTA 4J6GA 1QXPA 4JQRA 5J1XA 3RZHA 3OUHA 3H7YA 3JBG3 1JYNA 4FQZA 4CRQA 2QQJA 1W2TA 3AYEA 4BDVB 1T6BX 3E1F1 3F2ZA 2WDBA 1PK6A 3P3PA 4JHZA 4QMAA 4E2QA 2VNVA 5HBAA 1ULFA 1VBE1 2ZGKA 4Y1XA 3GZEA 3C8XA 5CBLA 1JYXA 4HN1A 1PGL2 4N9IA 4IEUA 4DZGA 5D2AA 4JGYC 5BNNA 3M1HA 3VBHC 2NMNA 2IFWA 4UF0B 1NCQC 1LHWA 1MZ5A 5FYMA 2TBVA 2ZGLA 4FQ4A 4IE4A 2WFF1 4W6YA 1NLQA 4DRRA 4EV0A 3ZFFA 5JZGC 1XSQA 1DQ5A 1LOEA 1OBNA 4KU8A 4FPLA 2EIDA 2V5YA 4YZ5A 1PHMA 4CCNA 3SNMA 1IQAA 2Q5TA 2Z4FA 3LOBA 5GJ6A 5HCBA 2ZAHA 5GLWA 2YU1A 1JMUB 2OW4A 1Q3EA 4QGMA 3IPVB 4FFGA 2VBPA 2VW2A 4LOSA 3H8RA 2RV9A 1PGL1 5LY2A 4OQ9A 3WHTA 1EUTA 1SLBA 2P37A 3KM5A 3JQXA 4CCOA 2OIIA 2PAKA 2BQPA 1V6IA 1REDA 2RS11 4XBQA 5FYUA 4UBHA 5J48A 4E8DA 4B4QA 1F15A 3PUQA 4XYXA 3T3YA 1J59A 2QQWA 3NNMA 3DCQA 4HK8A 2FZ1A 4OUSA 5LASA 5FY7A 4LT5A 5LA9A 5KWRA 5FP4A 2VQTA 2DDUA 3BB6A 2CAUA 2AC1A 4GKYA 4L0PA 4PIYA 1MS8A 4IEXA 2B7YA 4CDXC 4ES9A 1V00A 3IN9A 2HWB1 3P1IA 2ARCA 1MVQA 1PM7A 1LKNA 3IWZA 5I8YA 1NXD1 2YPJA 4UFMA 1OI6A 2D5HA 2IWGB 1VBE3 2QCSB 5JWPA 1J83A 4A7ZA 1YO8A 1O7FA 4MGZE 1HIXA 4QHZA 2FDIA 2BTVC 2WABA 1U5IA 4GB33 1V6NA 3WW3A 5CFCC 3MF9A 2ATFA 4KG0A 4QKDA 1O8SA 2ZEWA 4Y26A 4QPIB 4CP9A 2AR6A 4LHSA 1S2KA 2WS92 3SC7X 3VB9A 4E2GA 4AVVA 1LRHA 2XKOA 3MIGA 2ZOEB 4HOOA 5A7OA 3ZSEA 2BYVE 4C0BA 2UYAA 3AVSA 3ZN6B 2OKXA 4BPZA 1IPKA 4W6WA 3WP4A 1XOYA 5JXIA 3I2GA 2WZR1 3S5AA 1ZRFA 4BQ1A 1AR81 1ND3B 4W6XA 5FZ7A 1XB9A 2Q8DA 4CCKA 2RR11 5FKBA 2ENRA 2BEOA 4XDOA 2BWAA 2UWCA 5GZFA 3ZXGA 2ZGTA 2GP3A 2GNMA 5C4WB 2AGSA 4S2HA 4EZHA 5CIRA 5LZ6A 5FP3A 4Q4W1 3M8LA 3BTAA 5CU1A 3IAQA 1DQ0A 2WS91 3OBRA 1ZX5A 2R042 1W28A 5EJZB 4XXAA 5ACA2 4WM7B 2B39A 4JRLA 4LTAA 2QDRA 2JDYA 2NQYA 1N1YA 2ZGRA 3FUOA 1QNYA 5FY4A 3ZFFC 1VBC3 4TLGA 5HPOA 4KNCA 1Y3TA 2W87A 1XC6A 1HB3A 2R49A 3ACFA 4RQPB 1LGBA 1RITA 5CFDC 4O7XA 2VMCA 3KV4A 1OFSA 1NLSA 1E5SA 2ZBJA 3OYWB 5LW9A 3V56A 4NIHA 2RS53 3VLBB 1ZBE2 4LK7A 5JAXA 4AEKA 1ZZ6A 1BBT3 4Y5Z0 4DFSA 3VD4A 1CJPA 1LHNA 1RJ8A 4IETA 1O59A 2Q1MA 3IT8A 4YVSA 5AVPA 1W2UA 1U5ZA 3GF6A 3KSCA 2DU1A 4ZS3A 4CDUA 1AR91 3N36A 1GOHA 5T52A 1QF3A 5JZGA 4ARYA 3RMYA 1W06A 3A4UA 4LEJA 4KWLA 1BEV1 2J1SA 3PLQA 4K6BA 1POV0 1OHFA 4HVQA 2QVSB 1EYBA 2YZ4A 1DBNA 4L8QA 1AR83 5IVCA 1DLCA 3VZLA 4LLFA 2X5IA 5JIUA 4NRPA 2JG9C 2WQZC 4N90A 4GJZA 1WMDA 1RUC3 5FCCA 1DLLA 5DAVA 1F9KA 4JVAA 4R4XA 4P9YA 3IMNA 5FREA 2GC2A 2H0VA 5FYZA 1V6KA 3H3UA 1F5FA 2WSUA 4AFDA 1BEV2 3LDRA 3U10A 4URAA 2JDHA 4QX7A 3O0WA 4AEJA 1LAJA 3AZWA 4MXWB 1N3OA 1T2XA 2DCTA 2WQ4A 2RS32 2J1EA 4QPGC 4FP3A 1J3PA 3BKZA 5LEKA 2FDJA 2OVUA 4UT5A 4BJ0A 4Y5SA 4AFMA 5FY9A 3UJOA 4WM8A 5IYYA 1S55A 2QQUA 5AFEA 3C7HA 4P00B 3PMSA 1IS4A 3VHPA 4FPOB 5CYYA 5JZGB 4ARXA 5FQ0A 2ZMLA 5G04L 3VL8A 3ME2A 4Y1YA 5FPVA 5CFCA 5KXDA 4AHXA 1AF9A 1FOD1 1AR73 2FCTA 5C3SA 3NQHA 1KFUL 3C7GA 4XCBA 2EALA 1YNAA 1FPN1 1PVC3 4MHUA 5J96B 3WNXA 2GDFA 3UGFA 2G9FA 3ZKYA 5GZCA 2P34A 5A80A 1EV11 2AZ5A 4RS5C 3T2PA 2EAAA 4HXCA 4IEVA 1MS5A 3N7JA 2ORZA 4G4FA 3RYKA 2FD8A 1O8PA 2WWSA 4MH0E 3GM8A 2Y0OA 2VMEA 4NWWA 2PHUA 4RGGA 4XACA 3VDBA 5EHDA 5FFOC 5C8CB 3HAGA 4AE2A 1R091 4LBOA 4UFLA 3EHKA 5IAXA 3O0VA 4MV2A 4A7KA 4AQSA 5E1RA 3POEA 4YM2A 2ZHLA 5GZGA 1QJX2 3JD73 2UY8A 1AXKA 4BB3A 3AB0A 1FNZA 4NJ4A 3TAYA 1WKYA 1LOFA 2ZGQA 3MBWA 4AVCA 3FLTA 3WEZA 4AI1A 1LHUA 2VZ1A 3KB5A 4CDQC 2F4LA 2JDPA 1FXZA 3B5LB 1HQWA 4HKOA 4QU2A 3WF0A 2B42B 2ZPXA 4I09A 4B1LA 2NPIA 5L9VA 3PTRB 3RZKA 2VVDA 3TN92 4LBJA 2XJPA 5JVVA 2OPKA 4XQWA 4ZS2A 3MPPG 3H3LA 2C9AA 2XUMA 4LE4A 4QPWA 3PVEA 5HV0A 1ZZCA 1YFWA 3ZYJB 4BQXA 2DCJA 5FUPA 3KVBA 1RUI1 4CXXA 1G86A 1QJU2 2XLGA 1SBFA 1DGWX 1YYNA 3R4UA 4M00A 2C26A 1LECA 3WHUA 3NW4A 3OYWA 1TQ5A 3VZNA 1RGSA 1KFXL 3KCXA 5SV5A 1JYVA 1NG0A 1ULGA 2ADEA 2BGOA 2YFUA 3WVJA 4ES8A 1CONA 4OZXA 4FBFA 2R062 3SLIA 1C8NA 3TN91 4FPKA 3BIWE 5FZLA 5A3MA 2O1QA 3KHCA 4N9HA 3B01A 4JKKA 1LGNA 1DYPA 2ZHMA 3AJYA 2WFF2 1AYN2 4GXLA 2VNRA 3I2JA 2WNOA 3VBHA 1W9SA 3GBFA 2HKXA 3T4VA 3VBFA 3U4XA 5DAPA 3E5QA 1CX4A 1LOAA 2YROA 3OEAA 5JR7B 5GLTA 3ALQA 2DVDA 4M0HA 3Q8AA 5FZOA 4MGSA 4OVEA 2XJVA 1UPIA 1DZRA 3ORJA 4A7YA 3LWCA 3LSEA 1S0FA 4COUA 1AL22 4XF1A 4FPFA 4XBLA 5GKAC 5JDBA 3VD7A 4NN0A 3OUIA 5FYTA 5T55A 1MQTC 5C3QA 3T30A 1PX4A 2W1UA 4NHMA 2VQ0A 3KF5A 4WM8C 1KXGA 2VZRA 1F2NA 3J7MA 4FPEA 5GALA 3WP6A 1BJQA 1LGCA 2A6WA 2JXAA 1AYN1 5FY1A 4PDWA 4B4RA 1WD4A 3FL7A 5FP7A 2JDNA 5K0UB 1UY3A 4N43C 2VG9A 1WLDA 1RVF1 2E53A 4WVMA 2WQ8A 4K9SA 5CKNA 1UYYA 1H2NA 3R0RA 4XJ9A 4AVBA 5ISLA 5FMOS 1UW8A 4EWDA 1ALYA 3Q8FA 5T3NA 1LESA 2LM3A 2R072 1W90A 2AENA 1URXA 4FOWA 1W05A 4J25A 2P3IA 1NXMA 5F5QA 3VL9A 2Y6JA 5H9RA 1LNSA 4JGZC 5LBCA 2B46X 2VOWA 1VALA 2RDQA 5IWFA 4XUOA 3NAPA 2CNAA 2XQRA 4QDQA 2JG8B 5FZOB 5A70A 3WW4A 2QZ3A 3TN93 4FAHA 3J4UH 2P3JA 2V4AA 1STMA 3I2DA 3ZXLA 3NWKA 4BQ5A 1QJZA 4EN8B 2WN3A 1AYM2 3HOBA 1RUG2 1IG0A 1JOPA 1LEMA 5F5AA 4BZ4A 5FMOL 4UFIA 3ZXDA 1UCXA 3N9NA 3NNLA 4HLTA 5EFUA 3ZR5A 1F8VA 1SMVA 2NLRA 1Z7S2 1RUE3 1ZBA1 4QQHA 4YARA 3F95A 2UY9A 2BW8A 3ZIXA 1HRV2 2R071 3FE5A 4QPYA 3WT3A 3WG2A 1UMHA 2WZR2 3GHNA 2BRTA 5JLVA 4K1YA 1LULA 3BOPA 4CP1A 3ILRA 3WUDA 1QXRA 5DAWA 5H9SA 3UYJA 1XNAA 3WD5A 3RRDA 1C1LA 4C1WA 4ORFA 4XDQA 4XILA 4JDNA 2VXRA 2WC2A 3J7LA 1QJX3 1H1IA 2OXBA 3MEPA 4ZU5A 4E27A 3S57A 4LBKA 1UX7A 4NPLA 5JOZA 2W94A 3FJSA 1ND2A 1NYWA 5KHHA 2WYFA 5FTTC 4IESA 1OVSA 5I0UA 4F7ZA 2BNNA 3J8F3 2GSYA 3MGUA 1U5YA 4KU7A 5F2SA 1ZM1A 4JGZA 1YLLA 3RVHA 3VBUC 3T0DA 1AL23 3KV5A 5ABJA 1H2LA 3TEXA 3OBAA 1H30A 4KGQA 3POWA 2VC9A 2WJSA 5C9AB 3AP9A 2DVGA 3BOWA 2RDNA 4Y5TA 2CTVA 2Q1ZB 3CNAA 5FPUA 3I2KA 4FPGA 2ES3A 4MGQA 1LB2A 1PK6B 5IK5A 1V6JA 2ZS6B 3FMGA 2VD7A 3THPA 1FV3A 1EAH1 1NLRA 3ZFFB 4LO5B 3WNMA 1ASJ3 4G3YC 3MIEA 1YJKA 1XE8A 3RI9A 2HEWF 2GMMA 1OA4A 5BYNA 4UYBA 2XBO2 1NOVA 4FI9A 3ZFGA 1RUOA 3JB8A 4LBQD 3UKNA 5FR3A 4D94A 3ASIA 4OFGA 4F83A 4HSLA 3Q8CA 4YZ2A 4AAPA 1OLME 2VW1A 3I3MA 5IVVA 4XMIA 3PUHA 4TYSA 5FO8B 5AFBA 1C4RA 5K9YA 1RUD3 2QBXA 1KGYA 1POV1 1YHFA 2DF7A 5FYVA 1AR61 3UESA 2DVAA 1CAXA 2RS13 4P5HA 4Y3OA 3VUOA 2Y6LA 2VOKA 3LEGA 5IHRA 2Q8OA 2WNVA 2R7EB 1GZ9A 1COV2 3QH7A 4Q27A 1FYUA 4YZ4A 4IV3C 2AUYA 1OD5A 1W0PA 2RS31 1QJY3 2AYHA 3J26N 2ZX0A 1H0BA 5FPBA 5A6ZA 1GSLA 2GP5A 2VE1A 5FZEA 5HCAA 2VCBA 1POQA 2A5ZA 2D3RA 4DOUA 5FUIA 4RA0A 5CFDB 1AR62 5LRSA 2BOJA 3EJKA 5DDJ3 4H2AA 2OPWA 1WA4A 5IK4A 2CWMA 5DUXA 3VKNA 3PIJA 4BK4A 1VBD2 3O12A 4Q8KA 2WNUB 1CVNA 2JG9A 4BXFA 3GXUA 3WV6A 1EV12 4CDXB 2R063 1X7NA 3NJZA 1WMXA 1VLNA 3VHOA 1NCQA 4ZZ5A 4LKEA 3LDBA 1LOFC 1GR3A 1GKBA 2VCMA 2WO1A 3CLPA 1NA1C 4Z82A 3VBUA 2GNTA 1PZ7A 1S0BA 1ZZ9A 4PLOA 1R092 3ZFEA 5IVFA 4BH9A 3EO6A 5BXXA 3H3ZA 5CFCB 2R043 1W6NB 2VMHA 3D0JA 3M7AA 4TSVA 3ZYPA 3V0BA 3LEIA 3WDXA 5FZ4A 3ZXAC 1CX1A 1JS9A 1WBLA 1VP6A 4PJYA 1BVVA 2K2SA 4Q0VA 2Z2SB 3MV11 3J8F1 1V70A 2DCYA 5K0UA 2WS93 5FJKA 1SLAA 2WNVC 4PLMA 5IJRA 5BNNC 2DUOA 4LHKA 4Y4RA 1KS4A 2W95A 1W03A 1ASJ2 2D6PA 1J1LA 2V73A 3AKSA 2HEYF 5E88A 2WNUA 4R9CA 3HQXA 2VPVA 3AMPA 4BMEA 4ATFA 1TNRA 2FDKA 2QE3A 1UXXX 3BCWA 5FP8A 3WF4A 1BEV3 2R1BA 5JCTA 3BTXA 1VRBA 1IKPA 1RUH2 4I02A 1FX5A 4MG2A 2G19A 1EPZA 4NAMA 1BXHA 5LRRA 1IOAA 2A70A 2HBTA 2PQSA 2JG8C 2RJLA 3J7NA 3NKGA 3S30A 5K8SA 1QJU1 1RXFA 1W3XA 2W9XA 1LOBA 2F4PA 1V0AA 3NJXA 4HL0A 2FDHA 2W1QA 4CEYA 1LEDA 5T5JA 4DY3A 4LO6B 2KR2A 3RZMA 2GN3A 2BGPA 2OZJA 5TSWA 1Q56A 2HWE3 3DKWA 2PA7A 1XNCA 2W47A 1KD7A 1TNFA 1VMHA 4GZ9A 5BNQA 1V9U2 5F1RA 5L36A 2R0HA 3KT7A 3H0OA 4LHNA 2O0OA 4CP2A 5CB7A 1X50A 4MZUA 1G7YA 1Y7BA 1TME3 4COVA 5EQUA 4CP9B 3KHBA 2RG4A 1GUIA 2ZKNA 2ZZJA 4DPNA 1AYN3 2JDUA 3O1OA 4ATEA 5EP9A 4Y1ZA 4OI0A 1HRI2 4R52A 4RD7A 2WZR3 1SDDB 3EBRA 1SBEA 1M4WA 1VMJA 1N1SA 2RS52 4FOYA 2ZEYA 4QAWA 1BZWA 4FXKB 1LODA 4AL9A 1JHNA 3MFAA 4WVMB 2RS33 2J42A 1DQ1A 2PFWA 5A7WB 1AX0A 2ZGNA 3AVRA 3WDUA 1V9U1 4K7JA 2WFPA 1QU0A 1SZBA 4RR3B 2VQAA 1H6XA 1EY2A 1VRH3 4UFKA 5BV6A 4GD4A 4Q4V3 1SG3A 3C7FA 3KGLA 4JDOA 4WVWA 3DXTA 4L99A 1UU4A 3ZSKA 1RVF2 4FFIA 3PTYA 2FBEA 4D7TA 3V0BB 2HWB3 1OA2A 3KV9A 4CEYC 3T1LA 1C8M1 2BV4A 1R093 4N43A 4FVVA 1W9WA 4OCTA 1N1VA 5FYSA 4XBNA 2BZDA 3HBZA 3ZYBA 3DPRC 3VDDC 4EQVA 3A21A 1ULCA 4DMIA 5BNOB 5IVEA 1GBGA 2BVBA 2IUWA 3D0SA 4PIZA 3OPWA 1OPMA 5FUNA 4QKFA 3KQ4B 5JI9A 5JPNB 3VN4A 3KQRA 1UPSA 4YGBA 2ZX4A 1CWPA 2GNDA 3NV1A 2J1AA 1MZ6A 2V72A 3T1MA 2VH9A 2CGOA 3LEMA 5EJ1B 4BCUA 1Z7S1 2NMOA 4I3GA 1UY0A 2DCZA 3C2UA 5C4WA 3TNQA 1IPSA 1XNDA 4YW2A 4IV3B 5ABJB 4QX0A 2ZMKA 2DBNA 4CDWC 2IXJA 1MEC1 2P6HA 2MEV2 2QQNA 2XPJA 4LMFA 3K51A 1PNGA 3OGJA 4CZSA 2VZVA 1OOPC 5FXWA 3I2OA 4B29A 5F32A 4JTOA 2V4VA 1A34A 4QXBA 1KITA 3ZDSA 1CPNA 4CEWC 4FO9A 3IZOA 5JSRA 3N35A 1OLQA 4AAXA 4NIDA 2YG0A 4NWVA 5FZ6A 5BNPA 3T0BA 4N53A 4DO0A 4MGIE 2HLEA 3N7LA 4P9JA 5CA6A 1R1ZA 2HYXA 3K46A 1TG7A 2IXLA 4MSVA 1QOTA 4HSJA 5B4NA 3MI8A 2EIGA 1JOBA 2X5IC 4H3WA 4AI3A 3K4ZA 4OHXA 3T4HB 5J98B 2AACA 3S7IA 3AP5A 4LJHA 3IAPA 3MUZ1 4R9BA 5F5CA 4CDQB 1OF4A 5A3UA 4CUGA 5FZGA 4NIAA 3AYCA 5BY5A 1IQDC 2ET1A 3KGZA 5I8SA 2WN2A 5FXXA 3O14A 4LKSA 1CIYA 2C0ZA 3WDTA 3T09A 2KM2A 4D3WA 2CSGA 2FDGA 1DQ2A 4WV8A 4Q0QA 2VR4A 1W8OA 4IE5A 2JB8A 4GAZA 4HK9A 4W50A 4WVZA 1H8TB 4BM8A 4CDUC 4XUQA 3S0MA 1WW6A 4PIXA 3RS6A 2X53S 2YC0A 1D2QA 3M3IA 4YG6A 5BNNB 1G9BA 4CU8A 2YFZA 4KI5M 5DDJ1 5L73A 3B93A 4QQOA 4V2VA 3LCPA 4CDWA 4EWEA 4YFWA 1NAEA 2GMPA 4IERA 2HWF1 3DV8A 1UYXA 3ZPOA 2E32A 4JHTA 4RYDA 5K4LA 1HRI3 4KMQA 3MIDA 2XJRA 4Z2WA 3ZXJA 1V6LA 1W2NA 5FPXA 4XIKA 2ZHNA 1UOBA 1ZBE3 1VBC1 4XAAA 4XZPA 2G4IA 4I0BA 4IW3A 4Q4X2 3K3NA 3N9LA 5A3PA 5BNPC 1MS4A 4PCRA 3KZ4C 2SLIA 4NR1A 2B8MA 2YBKA 3MW2A 1OMIA 1PZ8A 3C7EA 4F8AA 2QZ2A 1PIV2 5C8CA 4ISQA 1OF3A 1Q8PA 4Q4W3 1XYNA 1XYOA 1XE0A 1W3VA 5FPZA 5A7WA 3WXPA 1H8VA 1OT5A 1CAUB 5LA1A 3POYA 3UJQA 4MYEA 4EJRA 2TEPA 4LE3A 4XJWA 1SFPA 1W8ZA 5EWSA 4LQRA 3LOIA 3NAPB 4OHYA 4FT8A 2FMYA 4CVUA 2ZABA 4XF0A 5I0DA 1GANA 4QWNA 3DXUA 1FI2A 3T2QA 3RZJA 4KQ7A 4I2OA 1AZDA 2VXJA 5CVRA 3FLPA 3M2MA 2PAMA 4NE9A 4I30A 3WQ7A 3SEPA 4AQTA 2JIGA 1O3RA 1RUH3 3JBG1 5EIYB 4JGZB 3I8TA 2VZOA 2VQUA 3AKRA 3PUAA 4P9WA 5J37A 1HXS3 1S4CA 3RQ0A 4D7YA 4JAAA 1MVEA 5KHGA 4RS5B 4GMP1 4YNIA 5FZDA 1OQEA 3GNEA 3IDCB 1BCXA 3PU3A 2D6NA 1UYZA 5J36A 4AF9A 2ET7A 3I2IA 3WDWA 2QQLA 5BUVA 1PMHX 1TME1 3WP3A 4UF0A 4AVTA 5BNOA 2ZACA 3MV01 1WZXA 4RR3C 4QQPA 3CU7A 4GWMA 4IEOA 4CUBA 1XSRA 4JC1A 2RJ2A 1D4M3 4YM0A 4BQYA 3Q8EA 3KCCA 4Y20B 3JBG2 1W8FA 5CKMA 2VY0A 4AWDA 5DQ0A 1SBDA 3I97A 3W5NA 4AHWA 3DL3A 1OQ1A 2YV8A 4UW5A 2W52A 4K3UA 4YW3A 1JXNA 1JN2P 1HXS1 1X8EA 4WM7C 5HI0A 2HWE2 1YQ2A 1BMV1 2JIJA 1TME2 2E7TA 3NV2A 4XOGA 3J8F2 5F2WA 3S5QA 3RZLA 3OF1A 3SISA 2NZ9A 3BI3A 4EE2A 1D7PM 2JD4A 2VW0A 1UQXA 5FZBA 2C24A 3H1MA 1EAH3 2MHFA 1LHVA 1FV2A 1YUDA 4GJYA 1JZ5A 3PMEA 1SFYA 4E4ZA 2WO7A 3RWKX 2R32A 3W20A 2YGMA 3TNPB 1AR63 1W6OB 4YVSC 3ZR6A 4AGGA 1UMIA 1NE4A 3TEYA 1PO22 1A6CA 4BE3A 1D4M1 5JSPA 3NNGA 3OSDA 2RR12 3ZLIA 3N4MA 1RUH1 1C5HA 3FHAA 4QX3A 3H8UA 5FZKA 2VUAA 2PELA 3DUIA 3G7DA 4RL7A 1MPXA 2BERA 1S2EA 4QXCA 4E4HA 1DF0A 1NT0A 1AXYA 3PURA 3UGHA 3MW3A 2WLQA 2ZTNA 2JKBA 2VULA 2Y34A 3CF6E 4RSUA 4RR3A 4YVWC 5FLJA 3WQ0A 3IMMA 3AYAA 1R083 3LIHA 5FAXA 3AFKA 1IGOA 1NQDA 4IXLA 1ND2C 2Q1FA 5GLVA 2QQIA 5A3TA 2JD9A 4RHV3 2D3PA 3R05A 5FO7B 1WCKA 1PO21 1Y9GA 1WGPA 1D4M2 2QJVA 4XUTA 2DURA 5FYIA 1W2AX 1RUD2 5K7PA 4LO4B 4A42A 5J7MA 5A33A 1B35C 5LB6A 5KXEA 1R081 5C5TA 5FV3A 1Y9QA 4XFIA 4GALA 5EPAA 2X5IB 1EPWA 1DDLA 1GZCA 5T5OA 3U78A 1UY2A 2F17A 1MQTB 3GBWA 2Y8KA 3MDPA 1QOSA 4AR2A 1RUI3 4Q8LA 4HG6B 2VZUA 2XBO3 3I2HA 4GIQA 4NVPA 4P9XA 2Q8EA 3U1XA 1JYTA 1JYCA 1OKQA 1WLTA 2E6VA 2XHNA 3AL6A 3SXWA 1Z0HA 2VMDA 4CCDA 2TNFA 2R6QA 2QQOA 1R1A2 5JMCA 1Q8SA 1RL3A 2DYCA 2A71A 2DUPA 2UU8A 3O0XA 1UZ0A 4QHOA 2RR13 3R4SA 1YWKA 1LR5A 2Q4SA 3AFGA 4XFHA 5IW0A 3WR0A 4AZZA 1KEXA 4DEVA 4EN0A 1UXZA 4ZZ8A 1PVC1 4DXSA 3DKQA 5M0TA 5JR2A 1A78A 1C8M2 3H50A 4UXAA 2YXSA 4LHLA 4PF1A 1K42A 1ZREA 2X8KA 2VECA 2AEZA 4AFAA 5DAXA 1A8MA 3Q9OA 1BHGA 2EAKA 1DGRN 2PMWB 4ZU4A 1JH5A 2PHRA 2I07B 4A45A 4YG3A 2CV6A 4N8MA 3GCXA 1WA6X 1AVBA 5C33A 1CD3G 3USUB 3DPRA 1BQPA 3ABZA 4R9DA 4AOCA 2VUDA 1SPPA 4K20A 4UW3A 1UO9A 1OH4A 4W65A 3ZSMA 1GP4A 1PVC2 3CBNA 1UWWA 5FPLA 3SCGA 4AGVA 5JIAA 2NN8A 1K12A 1XNKA 2WAOA 2RHPA 3THDA 1QEXA 2R16A 4AFBA 2Y6HA 4FPYA 4P14A 2BVVA 3C7OA 3HN3A 1YRZA 3T2TA 1RHI1 4NOTA 1PGW1 1C3HA 1WMFA 1RUC1 2WZ8A 4LITA 1MEC2 5FZHA 3CO2A 3USSA 3BYWA 5EXOA 2ZKLA 4Q26A 1UZZA 4XC9A 2H6CA 3B3QE 4XQDA 4AHZA 2QNKA 1SLIA 1VBA2 3MO4A 3OGGA 5FXVA 2IXKA 1CGPA 1J58A 1ZA7A 3S7EA 1JYIA 1W6PB 3PJQA 4FPHA 2YC4A 4NMIA 3KMHA 5FZ1A 5FRAA 1W04A 5KC5A 4IGQA 1JZ3A 4IEQA 1NCRC 3A0NA 3AMNA 4XUPA 5C9AA 4MVTA 5FZMA 2P6CA 1R64A 4XW3A 4IV3A 1HB2A 3AKTA 3I3EA 1BLZA 2ZMNA 3ES4A 1RHI2 5DUVA 5G05L 3ZFEC 4KWUA 4LNVA 1RUC2 1AHSA 1WW7A 3W21A 4EN9B 1DZTA 2C5DA 4B1MA 4AG4A 4CU9A 1QJX1 4AVSA 1HQNA 1ZRDA 4LKDA 1FATA 1VE0A 1RUNA 1VBA1 5A1FA 2RM22 4I01A 4LPLA 1HW5A 2PHWA 4B7EA 1UU6A 5EZWA 5GZEA 3ZYIB 4M01A 2VMFA 2OQ6A 3TEWA 1EV13 5F3GA 4QHBA 4QX8A 1N47A 3PHMA 5FJHA 4O61A 3DYOA 2DBIA 2X29A 2Y60A 1D0HA 1ODMA 5F5IA 5I0SA 1O5LA 1CN1A 1F35A 5HCFA 2DTYA 4Q0UA 4HKWA 1G9CA 3TRSB 1ZRRA 3IKWA 1WCDJ 2Y6GA 1W6QA 1IKQA 1Y43B 4COWA 1AR72 2KD7A 2PLV3 3ZDVA 3USUA 4FPJA 4YW5A 3U14A 5C70A 2D43A 1RUF2 2XWJB 1Q8OA 3ZN6A 1K5JA 5A32A 3ITQA 2ORXA 4NPMA 3VBSB 1W8UA 4YW6A 3NNFA 1QWRA 5K0UC 3HNMA 5ACA3 3WG3A 4LO7A 4ZONA 4OUEA 1TE1B 1TMF1 2GH8A 3N9PA 2QTWB 1DGWA 2RS12 3RG0A 3NNJA 2XDVA 2VJXA 3JXSA 2SBAA 5FWEA 4BWOA 4E4DX 4PQQA 3TOJA 3O1SA 1FMD2 3SCFA 4HPKA 4W4ZA 1YI7A 1UL9A 4AFCA 2D5FA 2RDSA 2P2KA 1W9FA 2VZQA 5ERLA 1VBA3 5FO9B 3N9OA 3GJAA 3VDDB 5FP9A 3BU0A 1UOGA 1TZOA 4RQPC 1ZBA3 5A6XA 5A6YA 1HX6A 2E51A 4QXKA 3NV4A 4QDSA 2RMU1 4FOVA 4CEYB 1US2A 2DUQA 3VKLA 5A1AA 4ZHNA 2RE9A 4JX0A 2MEV3 3OOXA 1MS0A 5L9BA 3C3VA 2XJTA 1O91A 1K45A 2JDZA 2WBKA 5L9RA 4BQWA 2H6BA 3NL1A 4IV1B 4Z07A 1X9TA 3LPGA 3VBRC 1JZ2A 3MIBA 1ULDA 3U4SA 5A3OA 5FLHA 1W9TA 4IGOA 3VBFB 2RM23 3BVCA 2VBDA 4QQLA 3RSJA 3WINE 4HANA 4QX5A 4ITCA 4XCAA 1ODNA 3WZ1A 4ASLA 4KL1A 1DG6A 4NHXA 3P3NA 2MNGA 1W8NA 4WBBA 5E8AA 1M06G 2J1VA 2IXIA 5A1LA 3ROUA 4HVOA 2ZX1A 3AKQA 1YC61 1RUG1 1EP0A 3OBTA 1Q8VA 4C1XA 2YU2A 2JDMA 1WMEA 4Z2AA 4UAPA 5ABJC 4XJZA 1XPWA 4MHRA 3LFMA 4CA9A 3N9QA 3WNLA 1UOJA 2Y0IA 2E26A 1KS5A 2BWCA 2PHLA 4UI9L 4UFHA 3INAA 4LO8A 1E5RA 1HRV1 1OVPA 1RVF3 2HWB2 5IFPA 2ZX3A 1D4VB 4YLZA 3LIGA 1W6MB 3ILFA 5KHJA 4Q4Y1 5JXGA 1CZTA 3PDQA 5L7OB 4CU7A 2XLFA 1QY4A 1XE7A 5BNOC 1NCQB 1OH3A 2EXJA 2GMEA 3HQRA 3T08A 3OG2A 1ZBE1 3IDAA 4LBMA 3EB7A 2P5BA 2QQKA 1CQ9A 1SFNA 4JGYA 4OMDA 2OS2A 4R4ZA 4URTA 3I59A 1CIWA 1RUG3 2TUNA 4NPRA 2Y6FA 3CDZB 4Q1RA 4D6RA 2CDPA 5FZFA 4CYDA 4DNYA 2CGPA 5FK7A 3S6PA 4BIFA 4DEQA 1SDWA 5LY1A 2R0FA 2B5HA 5FK8A 2DWRA 3PVBB 2Y38A 5A6QA 4QM9A 5IK7A 4AVAA 4TLFA 4H55A 4BYYA 1REFA 1RIRA 5GZDA 2QQPA 2VU9A 4YM1A 1R082 3W59A 3ZSJA 1GU3A 2D3SA 1RINA 5C6CA 1ND3A 3H42B 3UGGA 4XJUA 1LCLA 1DQ4A 1O4ZA 1W6PA 4Q4W2 2ARBA 1VAMA 3OUJA 4DUWA 4TXWA 4BLIA 1EAH2 4ONUA 4QB6A 1SHWB 1QH7A 4NIGA 2P1BA 5C3RA 4XJAA 5CEHA 4J1WA 3W9AA 2IXCA 5FYHA 1S0JA 4CE8A 2B4KA 1NZCA 4YVWA 2G9GA 2Q30A 3BUCA 1Q43A 3E5UA 1UIKA 4QPGB 1VAVA 2QQMA 2YC2A 3HN1A 3D8CA 3MIFA 4Q5OA 1SQ4A 4QKBA 5LA2A 1FNYA 4DY5A 1X9PA 2W3JA 3DPRB 5T50A 1D2SA 1H2KA 1SACA 3L2HA 3ZX7A 2R30A 1WCSA 1VRH1 2VUJA 3WCRA 1AR92 5FOJB 2VMGA 1GQPA 3DN7A 3BIEA 1QKQA 4LULA 3JB4C 3LE0A 4XFCA 3U0ZA 4XQ4A 5D8AC 2Y33A 3VBOA 3WDYA 3GYDA 3WCSA 1CPMA 1J3RA 3M70A 5C8CC 1ST8A 2CWSA 1DFQA 5FMDA 5EV7A 3EXUA 4IE6A 1POV3 4CCLA 5T54A 2VTXA 4L92A 3O7OA 2BOIA 4YW1A 1BBT1 4ZKTB 1W8WA 5C71A 1ZZ7A 2RJKA 3FHIB 3ZXKA 2D6OX 3SH5A 2GAUA 3NKTA 5A7NA 3B69A 3RI8A 4XF4A 2O8QA 3QLQA 5FYBA 3VBUB 2ZGOA 5JI7A 4EZ4A 3WF1A 4YYOA 1KJLA 3GJBA 4RHV2 1RUJ1 2WNVB 3VD3A 5KHIA 2JE7A 5LATA 1CZVA 1PGW2 3TB0A 4FTBA 4UBGA 2DFCA 2JENA 3MW4A 1X8MA 2E31A 2V5DA 2XL9A 1CESA 1XU2A 2VZTA 1PMIA 1FPN3 1O5UA 3AC0A 3G6JB 3PVNA 4QDRA 1H4GA 3JD72 1C8M3 1UY1A 2JICA 4K8RB 1XRUA 4P5YA 2CDOA 4P9LA 5FY8A 1RJ7A 2WL1A 1YQ8A 1VBB3 3BPSA 3HNBM 4HPKB 1RUJ3 4B8EA 1YCIA 3NAPC 1BBT2 2ZCWA 1US3A 3CKHA 4A3XA 4YWAA 1G9FA 2XXZA 4XABA 1JW6A 2DCKA 4AEMA 4V1PA 5IATA 4QGLA 3SH4A 1ENQA 2WINB 4FTSA 3P5BA 1PO23 1XU1A 2ZGSA 4NAOA 1APNA 3RFRA 3VBOB 1UD1A 1OURA 1RUJ2 2WA4A 2WFF3 2XH6A 3MLKA 4RHV1 1CAUA 1PNFA 2CHHA 5KXCA 4WM8B 1PZ9A 5I0RA 2HH9A 1E5IA 4LR4A 4NROA 1FPN2 1COV3 2HWC1 1RUI2 3RYRA 3B7MA 3VBFC 4MXWA 1OPOA 3JD71 3ZKUA 4EN7B 4HONA 2YGLA 3NJYA 2XG3A 3OEBA 3IB3A 4MGYE 4D7SA 1H2MA 2XUEA 3AZZA 3JU9A 5AVAA 4BK5A 1GOGA 2ARXA 1UZVA 1QNWA 4Q4V1 4YVWB 3L9JT 4E8CA 3UL2A 3W5MA 2OYZA 3PNAA 4GH4A 2W46A 2W92A 1H6YA 1XBFA 2R061 1K5MA 1X33A 3NMBA 1RMU1 1LJ7A 1W8TA 3R6SA 1W0NA 3VD5A 4I3PA 1J1TA 5T5PA 3CJIA 5GM0A 5T5LA 4IDZA 4K8FA 1W99A 4EROA 4A2UA 5IUQA 2J1RA 2JKXA 3J9SA 3T0AA 1GNHA 3I3DA 1W0OA 5JSOA 3OCPA 3H9AA 4Q4V2 3UETA 1L7LA 2BP6A 3KT4A 4XHBA 2VUCA 1RUF1 4PLNA 1WLCA 5LK5A 4AEDB 1HV0A 1QXJA 4AI0A 1H9WA 1QJY1 4PQ9A 3WF2A 4L9BA 2CL2A 3D4KA 1JYWA 1QJEA 3AJZA 3M4FA 1A8DA 2KA3A 3LEKA 4I0WB 4YVSB 1D0GA 4N7IA 4A3ZA 1QHDA 1W6MA 1OKOA 2GU9A 1TMF2 2PYTA 3AP4A 5FZCA 2FMDA 5J09A 1JZ8A 2JDAA 3E97A 1GWLA 1VMFA 4HFSA 5LBEA 2X09A 2E63A 1T6GC 2D6LX 1OQDA 4K1ZA 1ZA4A 2QUOA 1I1EA 4UWDA 1PX3A 2DV9A 3QBQA 3ZVXA 2NP0A 2XJSA 3H8OA 4XPVA 2XLAA 1VB4A 4DUXA 4INDA 4FXGB 5JXHA 1AL0G 1PGSA 4WZCA 4WM7A 4GMP3 2RDRA 4OLLA 3VKMA 2GZWA 4RS5A 2RVAA 3DGTA 3DYPA 3DYMA 4IE7A 3A7QA 3ILNA 2AEYA 4Q1PA 3E5XA 3MLLA 1IPJA 4YFZA 1GMMA 1O3TA 4Q4X3 3SEEA 2D6KA 3CJIC 1U5XA 2PAEA 3M3CA 1GYKA 3ZMOA 1SLCA 1PK6C 3M3EA 4JCKA 4XE9A 1J3QA 3AZXA 5EJ3A 1GICA 2C6SA 4MO3M 3T2OA 4CEWA 2VBBA 1ZBA2 4TWTA 1RUE2 1PO12 2A6ZA 2Y64A 4ZU7A 5FWJA 5AC91 1F5JA 1YQ5A 1UKGA 2ID4A 4JDMA 2OQ7A 1Q8QA 3ZFGB 2ZHKA 5LBFA 3MYXA 4IQPA 1CAVA 4QU1A 3TBDA 4JTNA 3BTZA 3NO8A 1JZ7A 4QB1A 4Z1VA 3N3HA 5IAVA 2BFUS 1Q5OA 5AC93 4PBPA 4P08A 1DZQA 4XFFA 1FMD3 1WD3A 3AZVA 4IV1C 1W6OA 1WW5A 3I3BA 4KBBA 4NHKA 1UKRA 4FPCA 4F3JA 5L7OA 5D8AB 3MIHA 1S1AA 5J3UA 3UKTA 4PF5A 3SH3A 1ULEA 3HQUA 4XETA 1RTVA 3ATGA 4C91A 2DTWA 3RPQA 2VVEA 3VBSC 1RUE1 4AI8A 2JB4A 4CU6A 5AC92 5JXJA 2ZXQA 2W2IA 4LUMA 3H1YA 2EA7A 1AR82 4RFRB 1H4HA 5LCWL 1PIV3 1YJLA 3HPNA 3ZPYA 3BPZA 2D97A 4BQ2A 4QT6A 4QB2A 1E5HA 3LB9A 5JUVA 1HDKA 4P02B 3E6CC 3B9IA 5IVYA 5F3EA 1UN1A 1YFXA 2BGCA 4ISRA 3QACA 2ARAA 1VBD3 1K5MC 5A3LA 3RZZA 4GWNA 1DIWA 3I3QA 1AUYA 1ZRIA 5LA0A 4X8PA 4IEZA 4MLOA 5APAA 4PDWC 1X36A 5B4XA 1YFUA 3OTFA 1VBB2 4XUNA 1U12A 1C57A 3AYDA 5ANQA 3LKJA 1W6QB 3LGRA 1O6UA 4AXOA 3WQBA 5ACA1 1C1FA 4X6RB 4BXSV 3K48A 2PHXA 1YQCA 2JWPA 4HVRA 2ADDA 2VOXA 4DXTA 3KS7A 2ZZQA 3HJRA 1OUXA 3GHMA 3UKVA 3LA3A 2QDNA 4YW4A 3ZXFA 2WAAA 4DIQA 5DZEA 1V9U3 1H8TC 1ULOA 2WNUC 2ZEXA 3AZYA 4PBOA 4N53C 1UMZA 3LD8A 2G1MA 4L11A 3ZOIA 2JDKA 4AI2A 5CG8A 5BPXA 4JRAA 2F6BA 5A7QA 1V6MA 2WSVA 2HWC3 3HT1A 3R4DB 4XXPA 5DMYA 3N9MA 4XZUG 1S0DA 4Q0PA 2WT0A 4OZOA 1MQTA 3URFA 1VBB1 3U37A 1NA1B 2P3YA 4X6QB 4E4SA 1PVXA 3AXEA 4C8DA 3ZSLA 1GV9A 4WVVA 3WW1A 1X82A 2VTFA 3ECQA 4LIVA 1JUIA 3NVCA 1AX2A 1IG3A 3OBZA 3O5SA 1YIPA 5KXBA 2MPFA 3KT1A 1H9PA 4B4PA 1UOFA 1LENA 2ILMA 1COV1 4CCMA 2CAVA 5C9AC 3AMQA 5FZAA 4AHYA 4AQ6A 1G9AA 2VAUA 1VPHA 5F6LB 1ZZ8A 1ZNPA 5DPNA 4Y1UA 3OJBA 4GQ7A 2YBPA 1DU3D 3WNPA 1OXCA 2VM9A 4Q4X1 1FOD3 2JG8A 4DUVA 5KC6A 3HVDA 3IDEA 1BYHA 1Z78A 1VRH2 1SCRA 2JEMA 1KRIA 3ES1A 4M3CB 3GBGA 1S0GA 1W8HA 3MLJA 3OD4A 4HMZA 4LOTA 1ENRA 1H1AA 4A6OA 4P9GA 4COYA 2VGDA 1A3KA 2FZ2A 1OC1A 4KBZA 3EYPA 2JE9A 3WP5A 1YEWA 1LHOA 3IDBB 5SV8A 3ZYHA 2V09A 3ON7A 2Y6KA 1O4YA 3L2YA 2FHRA 1Y4WA 4CXYA 1W39A 4LORA 3I49A 1PM4A 3MFCA 4PI0A 1P8JA 4QD2A 3VD9A 1HN1A 4W8JA 2VCCA 5IT6A 5JOYA 3PJYA 4XAEA 2D44A 5LWBA 2W68A 5FZ8A 2XOMA 5JPMB 2YMZA 3UK9A 1O3SA 5C3OA 4FSJA 4HBNA 4D6QA 1REEA 4XHXA 3TYJA 4BIOA 3I54A 3LDKA 2IVJA 2LS6A 5I0TA 4BA6A 2D7FA 2NYYA 1DHKB 4PT6A 2UWBA 1WWYA 1XNBA 2NM1A 4JQTA 3MPBA 2QQVA 3Q8BA 2XQXA 1FAYA 4IEPA 1F31A 4QKNA 4P9IA 4NUBA 3FX3A 3FN9A 1NQJA 3VHNA 5A33B 1G9DA 3GDBA 3RYPA 1DQ6A 3ZFEB 1I3HA 1QIQA 3HT2A 2WO2A 5IK8A 2A3XA 5HXVA 4QM8A 3ZXEA 1ZRCA 3D5OA 3SMHA 3HNYM 4MX3A 4NHLA 3D82A 4H14A 4B3NA 1AX1A 1I9RA 2W1WA 4GH4C 5FZ0A 3RJRA 3AL5A 1QH6A 4LBLA 4YGDA 4TZDA 2YB7A 2YBSA 4JKLA 1ACCA 2WNEA 4QPGA 3U07A 2PHDA 3ETQA 2VVFA 3E6DA 1HXS2 4IEWA 4ET7A 2K9ZA 2LROA 1SEFA 3GZAA 3IIAA 4NHYA 2GC1A 2A6VA 2XVLA 1LU2A 3I4IA 1CJDA 3GALA 4WZFA 3A0KA 2YUEA 1QQP3 3JZVA 1G8WA 4GMP0 4EN6B 5C3PA 1RB8G 3FBYA 1OOPA 3FZ3A 4O9GA 4IL7A 4LK6A 4CPBD 3LPFA 2PQQA 4GKXA 3RMXA 2VMIA 4NRQA 1AJKA 2XR4A 2LRPA 1NY72 2A7AA
chains in the Genus database with same CATH topology
2FQPA 3V65A 2OUHA 1SCSA 5JOWA 2PN5A 5A32B 4GA9A 5CNAA 1AR93 4XTPA 1GQGA 4CDXA 1IS3A 4HETA 4U36A 4AGRA 1O3QA 1HRI1 4YGEA 2W39A 1CAXB 3AP7A 2ZX2A 3FUQA 2Z69A 2RS51 1ASJ1 1B35B 2C1FA 4KWJA 2D40A 1QJY2 2HEVF 2KXLA 2IXHA 4HT1T 1B35A 4DINB 4GULA 1AJOA 1NA1A 1NY71 2WKKA 2XVGA 3AMHA 4S2GA 4BOWA 2CGNA 4AQ2A 3MF6A 4FCAA 1CAWB 5E16A 4OHWA 1GZWA 3LA7A 3ZIWA 4U2AA 2OUJA 1LOCA 2ETEA 4C90A 4D69A 1S0EA 1JBCA 1S2BA 4FP2A 4LUKA 3HR9A 1XYPA 1TMF3 1Z7S3 3BODA 3SHRA 3KD4A 5H9PA 4CP0A 2BPA2 1AL21 2E7QA 1AYM3 4M3CF 4BLJA 4SBVA 1W6NA 1H1MA 1ZVFA 4Z8BA 5L19A 4M3CA 1IHMA 2W08A 3OY8A 4IEYA 1LU1A 4QGNA 5FQ0B 2D6MA 5B2GB 2WLPA 3VZOA 2WT1A 4ZXKA 4G9SB 3HD8B 4OUMA 1C5IA 1GLHA 1S0IA 1PO11 1GZWB 1WBFA 3PVOA 2W0XA 3ZO0B 3KCYA 1ND3C 5DUWA 4QPIA 3ELNA 3WX5A 1NCRA 2MEV1 2P3KA 3QOPA 4UW6A 2HJIA 4Q0SA 3CJXA 3ZN4A 1OOPB 4LA2A 2P17A 4XMAA 2A6XA 2R073 1HV1A 1QMJA 1AYM1 4BMBA 3IPVA 3H1WA 3JQWA 1FT9A 2Z5WA 3D6EA 1KDMA 2BUKA 2IZWA 1RMU3 4B7KA 3QD6A 2R1DA 2OZ6A 1QQP1 4XF3A 2XWBB 2ZGMA 3BALA 4JGYB 3VBSA 2CY6A 4CDUB 2Y26A 4XEZA 5DZFA 2YHJA 4N7UA 5EYYA 1QOOA 5KBFA 3ENRA 2XB6C 3B00A 5D8AA 3VBOC 4HKLA 2WZPP 1VAKA 4SLIA 3DF0A 3WDVA 2ZGUA 4LBQB 4AK3A 3I7DA 3RJ2X 2XJUA 2YY1A 1MEC3 2A3YA 3AXDA 2HWD3 2GN7A 3E6BA 1S0CA 2ERFA 3JUUA 2WT2A 4M3CE 3SITA 3WLUA 3FFQA 4O9EA 3B94A 4YGCA 4CEWB 3ZYRA 5D1IA 2RM21 4K21A 3B9CA 4GB31 1ENSA 3LSDA 3VGIA 2VNOA 4YG0A 1GQHA 2PHTA 3LA2A 4Y20A 3RNSA 4K40A 2UYBA 2Q0AA 4Y22B 2GC3A 4MXVA 2XBO1 4N53B 2DVBA 3BU7A 1ONAA 2HWF3 4ASMB 1ZZBA 5FOBB 2IFRA 4GH4B 4JV4A 3VBHB 2E7AA 4YM3A 3WUCA 4AEDC 4RQPA 2DFBA 5DUUA 1AR71 2UWAA 4Y4YA 1O4TA 2LTNA 2A73B 3ZMNA 1YIFA 1TEIA 4HN0A 3U11A 2XJQA 1MS9A 4XJ8A 2PTMA 3VBRA 2I45A 1R1A3 2ZAAA 1HQLA 2OA2A 5LK7B 4CDQA 2DU0A 3NV3A 3VBRB 5DDJ2 4AYUA 4I0AA 3V64A 1HRV3 3JCIA 2BNMA 1FMD1 5C4WC 1MR5A 1UAIA 2LUWA 1N3PA 1VBC2 1YI9A 4XTMA 1VJ2A 5BNPB 2JX9A 2PLV1 1MACA 3ZFGC 2GALA 3CJIB 1DGLA 3FFZA 5FBZA 1NE6A 1PIV1 4H7LA 5LEJA 4DQAA 4LBNA 2ZA9A 1CAWA 5BYNA 2YYOA 1KJRA 1UU5A 2RMU2 3AM2A 3AP6A 2A75A 3SCHA 4OI1A 1VBD1 1IZ3A 3N7MA 4KGGA 3VKOA 1U0AA 2HWE1 3FBMA 1BMV2 5CG9A 1UIJA 5I8TA 2HWD2 4AEDA 2XHKA 4AW7A 4RGAA 4MGKE 1QGLA 3HMYA 4YRDA 1QDCA 1E57A 2XGXA 2BFUL 3ACLA 4FAGA 5FLIA 4OI2A 2PLV2 2GNBA 3WQ1A 3FC0A 4QQ2A 3CEWA 1OSGA 1PO13 1OA3A 3HWJA 2IC1A 1KQRA 1KDKA 3OY8B 1L3JA 1IS6A 3FWEA 1K5MB 4L97A 5F6KA 1V6OA 5DZGA 2PHFA 4X8NA 1CR7A 2AH2A 4S2FA 1WLWA 4E9KA 4XFAA 3N7KA 2HWD1 2QFEA 3AX4A 3WG1A 4DS0A 5L7OC 3MZHA 1N3QA 2CYFA 2YDEA 5CAZA 3V0AB 4RFT0 4KG8A 1AXZA 1BK1A 3B02A 2I74A 4LA3A 4NO4A 3RDIA 4M0NA 4Q4Y2 3WY6A 4C0HA 5I93A 4PDWB 1RUD1 3ZN5A 4L2NA 2VOVA 2XVKA 4XFGA 5DG1A 3IBMA 1VB2A 1IS5A 4XIOA 2R041 1WUVA 3W58A 1HLCA 2B9UA 4META 5CFDA 2EF6A 1JUHA 4MUVA 5C8WA 1YFYA 2XKPA 3AKPA 4OHZA 4XFBA 1MZFA 4FOQA 3VKFC 1RUF3 5DG2A 3CL1A 3LZZA 2B45X 2XL7A 2RMU3 1JOJA 1C28A 1GFF2 2AREA 4Q29A 2E9QA 5EYXA 4BHPA 2LALA 1DGRA 3AMMA 1OLRA 3WOGA 3I59B 2EVXA 2QKDA 1MZEA 4XF9A 3QH6A 4CTEA 1BKZA 3MICA 5H9QA 4Q2FA 4J1XA 4QPIC 4Q4Y3 1LOGA 1LTEA 1ND2B 3H7JA 2Z42A 3APBA 4COZA 1I6XA 1UX6A 1YXWA 3WW2A 4YSFA 3VZMA 4FTEA 1UF2C 4OHVA 1SLLA 5JOXA 1XQNA 1WW4A 4S2DA 3TWIA 4Y22A 3V0AA 5F9TA 2WIIB 4LLOA 1RHI3 3M3QA 4Y1VA 3VZKA 4UW4A 1R1A1 3AK0A 2Z79A 2GH2A 1UZYA 4IV1A 3GZUC 1I5ZA 2EXHA 3OPZA 2BNOA 1MS1A 2HYKA 1DYKA 2WA3A 4KWKA 5GLZA 1B09A 2UURA 4OI4A 2ZGPA 2A3WA 2ZJCA 3LAGA 4DB5A 2JECA 1OFNA 1VR3A 3NSTA 1QQP2 1FOD2 3GZTB 1SLTA 3ST7A 3UV9A 3VV1A 1N1TA 2A6YA 4LBQA 4YZ1A 1MS3A 4KH9A 2H0BA 3WG4A 1QDOA 2D98A 3HIFA 2I2SA 5DXDA 5GLUA 3KLSA 4DRVA 2DVFA 1ZYBA 2N7GA 4H7MA 2JJ6A 3OD0A 2EXKA 5CADA 5I91A 3VDDA 1QJU3 1VIWB 5E89A 3ZYGA 3POSA 4Y24A 3QCWA 3VZJA 1ENXA 4Z92B 1XXNA 1H8TA 2K0GA 3RWNA 1RC6A 2HWC2 2D93A 2BBVA 2EXIA 1HKDA 4CDWB 1GNZA 4GB32 4N43B 3VHRA 4R9AA 3FLRA 4HZFA 1NCRB 4YZ3A 1G6NA 1JTZX 1VBE2 3M3OA 2GC0A 1RMU2 2O8OA 4OULA 2VNGA 3X29B 2JG9B 4EWAA 3EQEA 5KHKA 2HWF2 3IM0A 4R8HA 5FDBA 1BVP1 1CAVB 3THTA 4J6GA 1QXPA 4JQRA 3H7YA 3JBG3 4FQZA 4CRQA 3AYEA 4QMAA 1PK6A 3P3PA 4E2QA 5HBAA 1ULFA 1VBE1 2ZGKA 4Y1XA 1PGL2 5CBLA 4HN1A 4N9IA 4IEUA 4DZGA 4JGYC 5BNNA 3M1HA 3VBHC 2NMNA 2IFWA 1NCQC 1LHWA 1MZ5A 2TBVA 2ZGLA 4FQ4A 2WFF1 4W6YA 4DRRA 4EV0A 3ZFFA 5JZGC 1DQ5A 1LOEA 4KU8A 4FPLA 2V5YA 4YZ5A 1PHMA 3SNMA 1IQAA 2Q5TA 3LOBA 5GJ6A 5HCBA 2ZAHA 5GLWA 2OW4A 1Q3EA 4QGMA 3IPVB 2VW2A 1PGL1 3WHTA 1SLBA 2P37A 3KM5A 3JQXA 2OIIA 2PAKA 2BQPA 1V6IA 1REDA 2RS11 4XBQA 4UBHA 5J48A 4B4QA 4XYXA 1J59A 4HK8A 4OUSA 2FZ1A 4LT5A 5KWRA 3BB6A 2CAUA 4GKYA 4PIYA 1MS8A 4IEXA 2B7YA 4CDXC 4ES9A 1V00A 3IN9A 2HWB1 1MVQA 1PM7A 1LKNA 3IWZA 1NXD1 2YPJA 1OI6A 2D5HA 2IWGB 1VBE3 2QCSB 5JWPA 4A7ZA 1YO8A 1O7FA 4MGZE 1HIXA 2BTVC 1U5IA 4GB33 1V6NA 3WW3A 5CFCC 3MF9A 2ATFA 4KG0A 4Y26A 4QPIB 2AR6A 1S2KA 2WS92 4E2GA 4AVVA 1LRHA 2XKOA 3MIGA 2ZOEB 3ZSEA 2BYVE 4C0BA 2UYAA 3ZN6B 4BPZA 1IPKA 4W6WA 3WP4A 1ZRFA 2WZR1 4BQ1A 1AR81 1ND3B 4W6XA 2RR11 2ENRA 2BEOA 2BWAA 2UWCA 5GZFA 3ZXGA 2ZGTA 2GNMA 5C4WB 2AGSA 4S2HA 5CIRA 4Q4W1 3M8LA 3BTAA 5CU1A 1DQ0A 2WS91 3OBRA 1ZX5A 2R042 4XXAA 5ACA2 4WM7B 2B39A 4JRLA 4LTAA 2QDRA 2NQYA 2ZGRA 1N1YA 3FUOA 3ZFFC 1QNYA 1VBC3 4KNCA 1Y3TA 4RQPB 2R49A 5CFDC 1LGBA 1RITA 1OFSA 1NLSA 2ZBJA 3OYWB 3V56A 2RS53 3VLBB 1ZBE2 5JAXA 4AEKA 1ZZ6A 1BBT3 4Y5Z0 4DFSA 1CJPA 1LHNA 1RJ8A 4IETA 3IT8A 2Q1MA 4YVSA 5AVPA 1W2UA 1U5ZA 3GF6A 3KSCA 2DU1A 4CDUA 1AR91 3N36A 5T52A 1QF3A 5JZGA 3RMYA 3A4UA 4LEJA 4KWLA 1BEV1 3PLQA 4K6BA 1POV0 1OHFA 4HVQA 2QVSB 1EYBA 2YZ4A 1DBNA 4L8QA 1AR83 3VZLA 4LLFA 2X5IA 5JIUA 2JG9C 2WQZC 4N90A 1WMDA 1RUC3 5FCCA 1DLLA 1F9KA 4JVAA 4R4XA 4P9YA 3IMNA 5FREA 2GC2A 2H0VA 1V6KA 3H3UA 1F5FA 2WSUA 4AFDA 1BEV2 3U10A 3O0WA 4AEJA 3AZWA 4MXWB 1N3OA 2WQ4A 2DCTA 2RS32 4QPGC 4FP3A 1J3PA 5LEKA 2OVUA 4AFMA 3UJOA 4WM8A 1S55A 5AFEA 3PMSA 1IS4A 3VHPA 4FPOB 5JZGB 5FQ0A 2ZMLA 3VL8A 3ME2A 4Y1YA 5KXDA 5CFCA 4AHXA 1AF9A 1FOD1 1AR73 1KFUL 2EALA 1YNAA 1FPN1 1PVC3 5J96B 3WNXA 2GDFA 2G9FA 5GZCA 2P34A 1EV11 2AZ5A 4RS5C 2EAAA 4IEVA 1MS5A 3N7JA 3RYKA 4G4FA 2WWSA 4MH0E 2Y0OA 4NWWA 2PHUA 4RGGA 5FFOC 5C8CB 3HAGA 4AE2A 1R091 4LBOA 3EHKA 3O0VA 4MV2A 4A7KA 4AQSA 5E1RA 4YM2A 2ZHLA 5GZGA 1QJX2 3JD73 2UY8A 1AXKA 3AB0A 1FNZA 3TAYA 4AVCA 1LOFA 2ZGQA 3FLTA 4AI1A 1LHUA 3KB5A 4CDQC 3B5LB 1FXZA 1HQWA 4HKOA 4QU2A 2B42B 2ZPXA 4I09A 2NPIA 2VVDA 3TN92 4LBJA 2XJPA 5JVVA 2OPKA 4XQWA 3MPPG 2C9AA 2XUMA 4LE4A 3PVEA 1ZZCA 1YFWA 3ZYJB 2DCJA 1RUI1 1G86A 1QJU2 2XLGA 1SBFA 1DGWX 1YYNA 3R4UA 4M00A 3WHUA 1LECA 3NW4A 3OYWA 1TQ5A 3VZNA 1RGSA 1KFXL 3KCXA 5SV5A 1NG0A 1ULGA 3WVJA 4ES8A 1CONA 4OZXA 4FBFA 2R062 3SLIA 1C8NA 3TN91 4FPKA 3BIWE 5A3MA 2O1QA 4N9HA 3B01A 1LGNA 3AJYA 1DYPA 2ZHMA 2WFF2 1AYN2 4GXLA 2VNRA 3VBHA 3GBFA 2HKXA 3VBFA 3U4XA 3E5QA 1CX4A 1LOAA 2YROA 5JR7B 5GLTA 3ALQA 2DVDA 4M0HA 4OVEA 2XJVA 1UPIA 1DZRA 4A7YA 3LWCA 3LSEA 1S0FA 4COUA 1AL22 4XF1A 4FPFA 4XBLA 5GKAC 5JDBA 4NN0A 5T55A 1MQTC 4NHMA 2VQ0A 4WM8C 1KXGA 1F2NA 4FPEA 5GALA 3WP6A 1BJQA 1LGCA 2A6WA 2JXAA 1AYN1 4PDWA 4B4RA 1WD4A 5K0UB 4N43C 2VG9A 1WLDA 1RVF1 2E53A 4WVMA 4K9SA 1H2NA 3R0RA 4XJ9A 4AVBA 5FMOS 1UW8A 4EWDA 1ALYA 5T3NA 1LESA 2LM3A 2R072 4FOWA 2AENA 1URXA 5F5QA 3VL9A 2P3IA 1NXMA 5H9RA 4JGZC 2B46X 2VOWA 1VALA 3NAPA 2CNAA 2JG8B 3WW4A 2QZ3A 3TN93 4FAHA 3J4UH 2P3JA 3I2DA 3ZXLA 3NWKA 1QJZA 4EN8B 1AYM2 1RUG2 1LEMA 4BZ4A 5FMOL 3ZXDA 1UCXA 5EFUA 1F8VA 4HLTA 1SMVA 2NLRA 1Z7S2 1RUE3 1ZBA1 4QQHA 4YARA 2UY9A 2BW8A 3ZIXA 1HRV2 2R071 3FE5A 4QPYA 3WT3A 3WG2A 2WZR2 3GHNA 5JLVA 4K1YA 1LULA 3BOPA 4CP1A 3ILRA 3WUDA 1QXRA 5H9SA 3WD5A 3RRDA 1C1LA 4C1WA 4ORFA 4XDQA 4JDNA 2VXRA 2WC2A 1QJX3 1H1IA 3MEPA 4ZU5A 4E27A 4LBKA 5JOZA 3FJSA 1ND2A 1NYWA 5KHHA 5FTTC 4IESA 5I0UA 4F7ZA 2BNNA 3J8F3 2GSYA 3MGUA 1U5YA 4KU7A 1ZM1A 4JGZA 1YLLA 3VBUC 1AL23 5ABJA 1H2LA 1H30A 4KGQA 3POWA 5C9AB 2WJSA 3BOWA