1LGCA

Interaction of a legume lectin with the n2 fragment of human lactotransferrin or with the isolated biantennary glycopeptide: role of the fucose moiety
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
181
structure length
181
Chain Sequence
TETTSFSITKFGPDQPNLIFQGDGYTTKERLTLTKAVRNTVGRALYSSPIHIWDSKTGNVANFVTSFTFVIDAPNSYNVADGFTFFIAPVDTKPQTGGGYLGVFNSKDYDKTSQTVAVEFDTFYNTAWDPSNGDRHIGIDVNSIKSINTKSWKLQNGKEANVVIAFNGATNVLTVSLTYPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lectin
molecule keywords LEGUME ISOLECTIN II (ALPHA CHAIN)
publication title Structures of a legume lectin complexed with the human lactotransferrin N2 fragment, and with an isolated biantennary glycopeptide: role of the fucose moiety.
pubmed doi rcsb
source organism Lathyrus ochrus
total genus 24
structure length 181
sequence length 181
chains with identical sequence C, E
ec nomenclature
pdb deposition date 1994-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1lgcA00
4UW4A 5KXEA 1BZWA 4AGGA 1UN1A 1WW6A 5JOYA 1DYPA 3OJBA 1N1YA 3O0XA 4XIKA 3A0NA 5IK4A 1WW7A 4DPNA 4FPGA 4U2AA 5GLWA 1JXNA 4YZ5A 1WCSA 1FV3A 2WT0A 4FPKA 1V6JA 4TZDA 1DGLA 5CA6A 4YW3A 5IK8A 1Y7BA 1MS0A 3OBRA 1G7YA 1F31A 4IQPA 4C1XA 2P3IA 3OPZA 2D3RA 1ONAA 4DRRA 4DQAA 2AREA 2P2KA 3AJZA 2WT2A 2CWSA 1O4YA 1GZWA 3VKFC 2UWBA 1CJPA 3V0AB 1AXKA 3B00A 1VALA 2GMPA 4R9CA 1AJOA 1D0HA 3OGGA 2GN7A 1WW4A 2NN8A 4R9DA 1W6NA 1MS4A 2D6MA 1AJKA 1LGBA 1N3QA 4YW4A 2JKBA 1GZCA 2FHRA 3OYWA 3VKNA 3HMYA 1IS5A 1SBFA 4LBMA 3T1MA 1CESA 3SISA 4M3CB 1FNYA 4DFSA 2ZGUA 4XXPA 3WUCA 3SH4A 2ZHNA 2WSVA 3SLIA 1MS3A 1YI7A 2DVBA 1CVNA 1I3HA 2A6YA 2TEPA 1LOAA 4FVVA 2PHTA 3TB0A 3B9CA 1ULGA 1PZ8A 1YXWA 3ZYPA 1HLCA 1KITA 1X50A 4K21A 4MYEA 2PHXA 4FPEA 1FAYA 3FLPA 1W6PA 2D6KA 3SNMA 4Q1RA 1YYNA 3APBA 1JYCA 2NP0A 1VAMA 4PCRA 2E51A 5EXOA 3OY8A 4Y20A 5T50A 4FP2A 1JOJA 2ZGTA 2WJSA 1GKBA 1RINA 1S0IA 1G9AA 4AVVA 3ZXLA 1BXHA 3HN1A 1GICA 3I8TA 5JLVA 1AX2A 2CTVA 4ISRA 2JECA 1APNA 4NOTA 5JVVA 1CONA 4D69A 1QDCA 2LALA 2ZMKA 4XJ8A 1VLNA 1F5FA 4C1WA 1GNHA 1OFSA 2A7AA 2ZHKA 3O12A 1Z78A 1UAIA 1QNYA 2PHFA 4FOWA 5IT6A 3N7KA 1WD4A 1D2SA 4YGBA 4YM0A 4ISQA 4YM1A 1Q8OA 4XMIA 5IK7A 1JYIA 1AX0A 4WV8A 2I2SA 3A4UA 2ZGLA 3M3OA 3QLQA 1RIRA 4GKYA 4ITCA 1A8DA 1MZ6A 2YY1A 3AZXA 3N35A 4YGEA 2ZGMA 4XBNA 3ZXEA 1G9FA 3RG0A 1CPNA 2WSUA 1UPSA 4LBQB 1FYUA 1J1TA 3PVNA 3IMNA 1OQ1A 2DU1A 5JOXA 1UL9A 1LJ7A 3AP7A 1SBEA 5AVAA 1LOEA 3B69A 4Q8LA 4Y26A 1H9WA 2H0BA 2SBAA 1CPMA 5EYXA 1VAVA 1S0CA 2CWMA 3AJYA 1GBGA 2EIGA 4YM3A 3IPVB 2D7FA 4Q8KA 1SCSA 1LU2A 2D3PA 3V0BB 4WZFA 3M1HA 3N7JA 1GSLA 4HANA 1SBDA 5CAZA 4WVWA 4XILA 1QNWA 3NV2A 2DV9A 2DTYA 3JU9A 5DUXA 1NLSA 5E88A 3NV3A 4DS0A 2DVGA 3R05A 4XJAA 1LTEA 1S0GA 3WHTA 3OBTA 5KXCA 3ATGA 2D6NA 1FNZA 2AENA 4YM2A 3AP4A 2ZMLA 3JUUA 4ZKTB 1GV9A 1HQWA 1V6LA 1SLIA 3CNAA 3NWKA 3AX4A 1DLLA 1GNZA 1LESA 1R1ZA 5GZDA 1CIWA 2JDZA 3POYA 2NMOA 1GANA 1KDKA 1LGNA 2EXJA 5IUQA 4BLJA 1WW5A 5GZGA 1CR7A 5GZEA 4FOYA 1N1SA 2PELA 5KXBA 1RITA 5L73A 1W6OA 1V6OA 1LHWA 4YFZA 2D6LX 1LHUA 1GZWB 2AUYA 1U0AA 2E53A 3ZXFA 3ZXKA 4F83A 1QMJA 2A70A 3USUA 1MS8A 4FPCA 4BPZA 3ZVXA 3T2TA 5CNAA 2ZKNA 2ZAAA 4OZXA 5GLUA 2CY6A 4P9YA 1W6NB 5GZFA 2WT1A 2WLQA 1LOGA 1S0JA 3OYWB 2GNDA 2WKKA 2D43A 1HDKA 3VKMA 3ZSMA 3KQRA 4YG6A 3C2UA 1QKQA 1YO8A 2DYCA 2A6XA 3FLRA 5DUWA 4GA9A 2DVDA 1DQ6A 2C9AA 3AP5A 5EYYA 4YZ2A 5FREA 4FPFA 2EALA 2ZGKA 2JD4A 1ZM1A 5CBLA 5DG1A 4XZPA 2ZHLA 1QF3A 3AP9A 2DUQA 4RL7A 2GMMA 2D6PA 1W6PB 3DGTA 4BLIA 1WUVA 2V73A 3WCRA 3M3CA 2EXKA 3AYCA 5JDBA 1DQ2A 3PMEA 3OY8B 4M3CE 1DIWA 4Y1XA 4Y20B 5DG2A 3WV6A 3WZ1A 4Y1UA 1WBFA 4CRQA 4CZSA 4FPOB 4L8QA 5T5LA 1TEIA 1EPWA 3UJQA 3VUOA 1Q8PA 2D3SA 2HYKA 3WG4A 4GALA 4BMBA 1A3KA 3POSA 5GLZA 5JOZA 4XIOA 1ZA4A 1LU1A 3WDXA 1WLWA 3AXEA 3ZSJA 2SLIA 5DXDA 2GNMA 1N3PA 4LBNA 2R49A 2OW4A 2P34A 3IN9A 3WNXA 1ENSA 2ZGNA 1N1VA 4FPHA 4XHXA 3UL2A 3NV4A 1ENQA 4AGRA 2GALA 4XYXA 5H9QA 4XOGA 1B09A 1WBLA 2E7TA 2UWCA 1GYKA 3ASIA 3L2YA 4P9XA 1AF9A 1SACA 1IKPA 1KQRA 1S1AA 2JJ6A 5DZEA 3U4XA 5HCFA 4YW5A 1LHVA 1MZ5A 3AYAA 5GLVA 2A3XA 4XMAA 4Q26A 1PZ9A 4XJZA 3WLUA 2UURA 3PJQA 4LBOA 1N47A 4YZ4A 3NV1A 3RRDA 1WLCA 1O4ZA 1Z0HA 2KM2A 4XTMA 5BYNA 3FFZA 2E6VA 1QGLA 1VIWB 2WNEA 3WHUA 2NMNA 1Q8VA 3ZSLA 2P3KA 1IOAA 1C1LA 3M3EA 4UW6A 2YROA 2DTWA 3GNEA 2ZHMA 1BJQA 2ES3A 2OVUA 2VW1A 1JN2P 1AZDA 2ARXA 2DUOA 2NZ9A 4GWMA 5GJ6A 1DZQA 1IKQA 1G8WA 3MEPA 1DQ1A 4FQZA 3PVEA 5T5PA 4YGCA 3FUOA 1IS3A 1XQNA 3AZVA 4YG0A 4FP3A 2AYHA 2OUJA 5T55A 1AVBA 1GZ9A 1N3OA 3V65A 3Q9OA 5GM0A 1MR5A 1URXA 2P37A 4GXLA 1DQ5A 4YZ3A 3VKLA 1LULA 1PZ7A 2GN3A 2ZGSA 1DFQA 5E8AA 5FRAA 3ZSKA 4JCKA 2D44A 2DVFA 2R16A 1H9PA 4YFWA 4R9AA 4K1ZA 1G86A 1SLAA 4PQ9A 2W08A 2UU8A 4LBQD 3N36A 4BQ1A 2VY0A 3AFKA 4FPLA 4YG3A 1CN1A 1LGCA 4JC1A 4ATEA 3N3HA 5F9TA 3PVOA 3O0VA 4I30A 1H30A 2C5DA 3WG3A 4FOQA 1ULDA 1NXD1 2W52A 2PHWA 1G9DA 1W6QA 4UW3A 2CNAA 1W6OB 1S0FA 2E7QA 3AZWA 4GWNA 2A75A 1MACA 3H0OA 2ZGOA 3ZPYA 2DU0A 1V6KA 3ILRA 4AVTA 1S0EA 3IM0A 1V6IA 5T52A 5IK5A 3USUB 1SCRA 4FOVA 1UZZA 3ENRA 3N7LA 3RMYA 2XB6C 3WDTA 1A78A 1C1FA 1LECA 2ZMNA 1AXZA 5EWSA 4CTEA 3LCPA 4P9WA 2CL2A 5T5JA 1QOSA 4AWDA 2JE7A 3D4KA 1OKQA 3FLTA 3POWA 3SH3A 1G9BA 1BYHA 3FBYA 2OUHA 2EF6A 2A71A 1ENRA 2UWAA 5H9RA 3WDYA 1ULFA 4P14A 4RA0A 4AGVA 2YXSA 2AR6A 4Z8BA 5HCAA 2A5ZA 4W65A 4YLZA 5JMCA 1WLDA 4H55A 3BTAA 3VKOA 1MS1A 2R1DA 1G9CA 2JE9A 1MVEA 1LOBA 1SFYA 1Q8QA 3RQ0A 4Y1ZA 1LODA 1QDOA 1ULEA 2W39A 4XTPA 2Q5TA 3WDVA 5GALA 4BMEA 1JUIA 2ZZJA 3D5OA 1UX6A 2A6VA 5DUUA 2VH9A 3WUDA 4K1YA 5KXDA 2EAKA 1W6MB 1HQLA 2GDFA 4KBBA 1WD3A 3WDUA 3VV1A 4XJ9A 5F5QA 2ENRA 4LBLA 3T1LA 3ZXJA 4GKXA 3V0AA 1W6MA 1DYKA 2NM1A 3UJOA 1FATA 3D6EA 1LEMA 1IS4A 4FPYA 4LBJA 2YV8A 3BIWE 4DRVA 5GZCA 4U36A 3ZYRA 1I1EA 4Y1VA 1V6NA 3B01A 5H9PA 2EXIA 2NYYA 2YZ4A 1SLLA 2Z42A 1LOCA 4HL0A 1AX1A 5DUVA 3IKWA 4YW1A 3AZYA 4ASMB 4M3CA 2FMDA 3AP6A 3RMXA 1C4RA 3WG2A 5JOWA 4TYSA 4BM8A 2ZGPA 1LENA 3UK9A 3RSJA 1SLBA 1LCLA 2VXRA 1SLTA 2RHPA 3BODA 1C57A 4Q1PA 4Q2FA 5T5OA 1UMZA 2ZBJA 5DZFA 1HKDA 2B7YA 4PBOA 4XBQA 1DBNA 1JBCA 5DZGA 1IS6A 2R0HA 1DHKB 1LHOA 1QOTA 3A0KA 1DQ0A 3GALA 3WG1A 1FX5A 2YMZA 1FV2A 1Q56A 1JHNA 1YIFA 2GMEA 2WQZC 3WOGA 4NO4A 2GNBA 1N1TA 2ZA9A 3MW4A 4Y1YA 5SV8A 3BOPA 4JRAA 4M3CF 5H9SA 1MVQA 5CB7A 3WDWA 2ZACA 4M00A 2PHUA 4SLIA 3W58A 1KJRA 3LSEA 3O0WA 1SLCA 3MW3A 1V00A 2ERFA 4LBKA 3AK0A 4M01A 4XBLA 4Y22B 2BQPA 2XG3A 3ILFA 4Q27A 2G4IA 3SITA 5GLTA 1JW6A 2PHRA 1YRZA 2VW0A 3AZZA 4XJWA 1DQ4A 1BQPA 4Y22A 3AYDA 3N7MA 4XE9A 1AXYA 4XJUA 5LK5A 1UKGA 1MS5A 2VU9A 5E89A 3AYEA 1KRIA 3TAYA 2EXHA 1MS9A 2AH2A 4K20A 1V6MA 2D6OX 2A3WA 1BKZA 1W0OA 3AXDA 2A6WA 3INAA 1KJLA 2ZGQA 1KDMA 1ULCA 4LBQA 2P3JA 3HR9A 4PBPA 2DVAA 3MW2A 4PF5A 2A6ZA 3KM5A 3MPPG 1S0DA 2ARBA 3B3QE 1LOFC 4AYUA 4ATFA 4YGDA 3W59A 2CYFA 2LTNA 2W68A 5HCBA 3RS6A 1W6QB 1QU0A 2DWRA 3ILNA 3M2MA 4ZXKA 4FQ4A 3IPVA 5T54A 2VUAA 1GLHA 4XHBA 4UW5A 3SH5A 1Q8SA 2VW2A 3FUQA 3LSDA 4XDQA 3V0BA 3O5SA 2A3YA 3R4UA 2V5YA 3DUIA 2GNTA 3WVJA 1W0PA 4YW2A 3M3QA 4R9BA 1LOFA 3WCSA 4WVVA 4FPJA 1F9KA 2DUPA 4AVSA 1UZYA 2AGSA 4XXAA 4BOWA 4YZ1A 2ZABA 4Y24A 2ZGRA 1LEDA 2R1BA 3R4SA 2DURA 1CQ9A 3QCWA 1QOOA 1S0BA 3I4IA 3V64A 2R0FA 1LHNA
chains in the Genus database with same CATH superfamily
1LRHA 1P8JA 1BZWA 1UOBA 5JOYA 3J7NA 3O0XA 1FPN2 5IK4A 1JYNA 3NNLA 1JXNA 3FX3A 3NL1A 1I5ZA 3AKSA 5FDBA 5EP9A 5CU1A 3SEEA 5CA6A 4LT5A 2XXZA 1V9U1 1MS0A 3VD9A 5JPNB 1NG0A 1WCDJ 2P3IA 3ZXGA 5AC92 1ONAA 3SC7X 4DQAA 3VDCA 3K4DA 3CKHA 3LAGA 1GZWA 2LM3A 1CJPA 2P4EA 5FMOS 3B00A 2WO1A 1VALA 2VUDA 5HPOA 3J7HA 2FDGA 2QQNA 4MUVA 3Q8EA 1AJOA 3OGGA 1W8HA 2QQIA 3C3VA 3WF1A 5D2AA 1WW4A 1RUG1 2GP3A 5FMBA 5F6KA 5C71A 5LZ6A 4YW4A 2JKBA 5FXWA 1D4M3 3SMHA 2VBBA 1AR61 2ZAHA 3VKNA 1SBFA 3VBRC 3O14A 3SISA 1PK6A 4M3CB 4DFSA 2ZGUA 3VBOC 3KF3A 4MGIE 2IC1A 1PGW1 2WWSA 3KVBA 2C0ZA 4DB5A 3ZKUA 2Y60A 1J84A 2DVBA 2W46A 1TMF2 3KV4A 4JZRA 1QH6A 4FVVA 3FHIB 3B9CA 3VZOA 1ULGA 3T2PA 4XFFA 1HLCA 4K21A 5JPMB 4AI2A 3CZUA 5FZ7A 2YGMA 4MXVA 5C8CC 3S5AA 3FLPA 2E32A 4E4SA 5JUVA 2XUEA 2QQLA 4Q1RA 1JYCA 1UYZA 3BU7A 4MHUA 4NR1A 1IG0A 2E51A 3ES4A 3MV01 1T2XA 1RUG3 5EXOA 3RYPA 3OY8A 4N43A 4GMP0 2FDFA 4MGQA 3ZLIA 5J7MA 5FJKA 1US2A 3H8OA 1OHFA 3ABZA 2LUWA 4LR4A 3WNMA 1G9AA 3HN1A 1PGL1 1H8TC 1W9SA 1HN1A 2CTVA 2ZX4A 3RZJA 4BQWA 4AEKA 3K3OA 4FAHA 1QDCA 4HN1A 4AEDB 3B94A 4C1WA 4UFIA 3J7LA 3O12A 5A7QA 1NOVA 1SEFA 3KHBA 1OH4A 3GDBA 4D0QA 1QNYA 3N7KA 3RYRA 1CAWA 1W2UA 1IPKA 2VMCA 4Q4V1 4YM1A 4LLFA 2FMYA 2RS12 1JYIA 2XL7A 2DCZA 3A4UA 2WL1A 2ZGLA 1RIRA 3ZXEA 1UIJA 2HH9A 3AZXA 4URAA 1ST8A 4XBNA 5B4NA 3RFRA 4A41A 3IMMA 4IEXA 4MGTA 1HJFA 1CPNA 5J48A 4Q4X1 1RUI1 4LBQB 1UKRA 2ZEYA 5A3WA 1GR3A 1UL9A 3ZIXA 2C9KA 3AP7A 1UYPA 4DXTA 1HV1A 3AKRA 4ZS3A 3SCHA 3OPWA 4W6XA 1UYXA 2QQJA 3KWVA 3WR0A 4BXSV 4IV3A 1CPMA 5EYXA 4HG6B 1S0CA 2Q1ZB 2OA2A 5DAQA 1GBGA 4A45A 4AVCA 1POQA 2EIGA 3KHCA 1W8TA 1ZBA1 4Q4V3 4QM8A 4LPLA 1XNKA 1STMA 5A6YA 1PGSA 2D3PA 4MG2A 5BNNA 5KHHA 2X53S 1VBA1 4P9LA 3N9NA 2JXAA 5CAZA 3ZFFC 5I8TA 2DTYA 4Q4X3 1RUI3 3SXWA 1NLSA 4LUMA 4QX5A 1UX7A 2QQUA 1UD1A 3ZYBA 3MLJA 5FBZA 3ZYJB 2UYBA 3R05A 3V56A 2C1FA 1LTEA 2YFZA 1S0GA 4XJAA 3WHTA 3OBTA 2R7EB 3D8CA 3IBMA 1K5JA 5KXCA 3DL3A 3GBFA 3R4DB 3Q8BA 4MVTA 1OURA 5D1IA 5DABA 3AX4A 1QH7A 1R1ZA 1LESA 4NHYA 1PVC1 2JDZA 3U07A 3WP5A 2JDPA 2NMOA 5IVFA 1LGNA 1AR92 4BLJA 1OPOA 5GZEA 1TVGA 1VMHA 1PX3A 2PELA 2VECA 3OEBA 1XE7A 4C0BA 5KXBA 2BNMA 1V6OA 2VCBA 4Q4W3 4YFZA 3PHMA 2W9XA 2D6LX 2JENA 1GZWB 2QZ2A 2WDBA 3ALQA 4G4FA 4P9IA 1MS8A 2R042 3LD8A 4BJ0A 2LROA 3PUHA 4A42A 1JS9A 3X29B 2PLV2 4N53C 4OZXA 4XF0A 5GLUA 2CY6A 3K48A 1L7QA 4XQDA 3ZYHA 4UYBA 2YYOA 4LKEA 4AE2A 2RE9A 1LOGA 4EN0A 2D93A 3WNOA 1VBB1 2P17A 4RN5A 3ZYGA 1O3RA 2DYCA 2A6XA 4IEQA 3TEYA 2HWD1 4AI0A 4XZUG 5HCHA 2WYFA 2DVDA 2C9AA 1KS4A 4A7YA 2BZDA 2JD4A 1GOGA 2K0GA 4JAAA 5DG1A 2ZHLA 2GMMA 2D6PA 3GCXA 2R071 2BBAA 5LA1A 3IZOA 2ATFA 1AR72 2V73A 2W1SA 2WFF1 2BVBA 3AYCA 4RGAA 3WQ0A 2FDKA 1HRI2 4XW3A 3OY8B 4N43B 5FZOA 4M3CE 3LIHA 5DG2A 3WZ1A 1WBFA 3P5BA 3HNYM 4FPOB 2BFUL 1TEIA 1D4VB 1EPWA 3LEGA 4L8QA 5T5LA 4EN7B 4ZU7A 5CISA 1VBB3 1UY0A 5GLZA 5JOZA 4FTBA 5KHIA 1RMU2 2VTXJ 2Y26A 2HWD3 4K3UA 4UFMA 1AHSA 3WDXA 4CEYA 1NA1A 2XWJB 1ALYA 4LBNA 2R49A 1OOPC 3RWNA 2CGOA 3O1PA 2D5FA 3IN9A 3ZDVA 5FZ4A 1M4WA 4QX3A 4XHXA 1FT9A 2P6HA 1MQTC 4NWWA 1CAWB 2DCYA 3NV4A 5EPAA 2QE3A 2GALA 4WM8B 2WO2A 5H9QA 1QJU1 2W95A 3H8UA 4H3WA 1GYKA 4OFGA 2R073 4YWAA 2C24A 5FIXA 5CKNA 1KQRA 4TN7A 1S1AA 1ACCA 2WNOA 5DZEA 3L9JT 5FYSA 5HCFA 4AFDA 4ZZ8A 3AYAA 3KMHA 4K40A 4JGYA 5GLVA 3RYKA 2A3XA 4V2VA 2J1EA 2UURA 4LBOA 3NV1A 4C8DA 3MHZA 3Q8AA 3W5NA 1C8M3 4UFLA 3HPNA 2ARCA 4XTMA 2W1QA 4KG0A 2Q1FA 1QGLA 2RMU1 4BB3A 5LWBA 4Y5SA 3AM2A 1H2MA 1Q8VA 5FY1A 3ZSLA 3M3EA 1NX9A 1C1LA 4IV3B 1JMUB 1H1MA 4KBZA 4RGKA 3KLSA 1AZDA 2NZ9A 4PQQA 4XFBA 5FY4A 1B35C 2IXLA 5FY8A 4A3ZA 4FQZA 3ZN4A 1BVVA 2DDUA 3B7MA 4HXCA 4XCAA 4QX0A 5BNNB 3NKTA 5BNPA 1SHWB 1J3PA 1IS3A 1MZEA 1VRBA 2VG9A 1XNCA 4AQ6A 4W4ZA 4QPIA 5E16A 2E31A 3N9QA 1AVBA 2XMLA 4P5YA 4I01A 3H8XA 3WNLA 4FTEA 2TNFA 3ZN6A 3J8F3 5F8PA 4OHWA 1UU6A 5FRAA 2O14A 2RMU3 3ELNA 2VZQA 4JCKA 1VP6A 4YFWA 2WWJA 1W3XA 4K1ZA 3NRUA 2W08A 5FYHA 4LBQD 3N36A 3U78A 3AFKA 3JD73 5F2WA 2ZXQA 4YG3A 5F9TA 5JIUA 5IATA 3PVOA 1O5LA 1SDWA 5LB6A 4B29A 1OLQA 3UNPA 5FKCA 4E8DA 3O1VA 3IB3A 1C5IA 1G9DA 2YUEA 1AL21 3GZTB 1O8PA 1ZBA2 2CNAA 1ZRDA 1L3JA 3WNNA 1NQDA 4XQWA 3JCIA 1RJ8A 3PLQA 4WVMA 5F3IA 5FZ9A 1CX4A 1V6KA 4QXHA 5L36A 4PDWA 4BDVB 2WZR1 3RMYA 3WDTA 2XJVA 5FJHA 5KHGA 3TN93 1DZTA 1AXZA 2Z4FA 1TNFA 4ZS2A 1UOJA 1X33A 2R061 4ZPIA 1XYPA 4RFRB 1QOSA 5FZKA 2Y6FA 1OKQA 2CAUA 2D97A 3D4KA 2RG4A 4LNVA 4EZ4A 2OUHA 2WNVA 5IAVA 2LRPA 3HT2A 1RUJ2 1W04A 2QDNA 4RHV1 4NUBA 2YXSA 4ET7A 3AL6A 5ACA3 2ORXA 4P9GA 1H2LA 2XVGA 3C7HA 4I0BA 1ND2A 1ZBE3 2PAMA 1LOBA 1SFNA 1Q8QA 1SFYA 4Y1ZA 3ZMOA 3GM8A 5FQ0A 1RUF1 1W2TA 2XPJA 5IFPA 3GJAA 5CYYA 4QKBA 5LRSA 3D5OA 1UX6A 1SFPA 3EQEA 2QQMA 4IEPA 4IGPA 4CU9A 2WZR3 2J7MA 3C7FA 5F5QA 4LOTA 2BU9A 1W6MA 2DF7A 3H50A 1OPMA 5FZOB 2R063 4LBJA 4EV0A 4HT1T 3VHRA 4HKLA 1JODA 1JHJA 3TNPB 1I1EA 1O3QA 3GJBA 4Q4Y2 3D3AA 3MUY1 3U14A 2EIBA 3ZFEA 1Z7S1 1YUDA 2O1QA 4CEYB 5FR3A 5JXHA 4UI9L 1NA1B 5JCTA 3WW3A 1UO9A 3JBG1 3WG2A 2PHLA 2VMHA 4GQ7A 3W21A 3NMBA 5HI0A 1SLBA 2VXRA 3CDZB 2ET7A 2JDKA 1JUHA 2PHDA 2Y0IA 3HQXA 5F2SA 1COV2 4RD7A 2ZBJA 2B7YA 4R4XA 5DMYA 2E63A 1C5HA 4PBOA 4LJHA 3LB9A 3ACGA 1MEC3 3NAPB 4D7YA 3LFMA 3HBKA 1X7NA 2HWF2 5JSOA 2IXHA 1FX5A 5D8AC 2JEMA 1JHNA 1XU2A 4XVHA 2GMEA 2WQZC 2G9FA 4PT6A 5J09A 1VBE2 4B4PA 5SV8A 4JRAA 2FZ1A 4D6RA 2BGCA 4CU7A 5CB7A 3PIGA 5I8SA 3WDWA 2ZACA 4IESA 4L0PA 3W58A 5FZ6A 3JBG3 5C5TA 2B5HA 2JG9B 4LA2A 5C8CA 3PVBB 1SDDB 2BQPA 3SITA 2G4IA 2YC2A 4XJWA 1R1A2 5BPXA 5CADA 4CUBA 2B9UA 3N7MA 1Q3EA 4XJUA 4R4ZA 3VGIA 4CU8A 3K3NA 5BNPB 1MS5A 1OSGA 4AR2A 5ANNA 2RVAA 4QPIB 4AL9A 1MS9A 2VBDA 2VNRA 1RUH3 1AR82 1V6MA 1AYN3 2D6OX 2IFRA 4NROA 5AVPA 4CCMA 4DUXA 3AMQA 4IE7A 1HB3A 2Q30A 5F3EA 3VHOA 2HWB3 4IV1C 5A7PA 3DEMA 4CDXB 4IE6A 1R091 2OPKA 5FTTC 5T3NA 4FCAA 4AI3A 3BB6A 1PMHX 3MW2A 4QB6A 1S0DA 4FFFA 4E4ZA 4G9SB 1O91A 1ZVFA 1QXPA 5DAVA 2OYZA 1VRH1 1RVF2 1HXS2 1I5PA 3E5XA 2BEOA 3H3LA 4YGDA 2CYFA 2WS91 3AL5A 1CIYA 3B93A 3EJKA 4XDPA 1H8VA 5A7OA 2YBSA 5LY1A 1QU0A 4UBHA 3VZJA 3WF0A 5FZ0A 1QJY2 5T54A 2RR13 4NAMA 4UW5A 4WVMB 2B42B 1W8OA 1QJX2 3SH5A 1W9WA 2ILMA 3LSDA 4CDWB 3ETPA 4PDWB 5JXIA 1FMD3 5A3TA 2IXJA 2V5YA 5FFOC 2Y6GA 3PTYA 3M3QA 3POEA 4R9BA 4XFHA 5LY2A 2F17A 1EUUA 1HIXA 3TBDA 4I0AA 4XXAA 4NE9A 1BVP1 4P9JA 3VD3A 2OX0A 1LEDA 3E5UA 3RZGA 4PLMA 3T4VA 3DV8A 1C28A 1KS5A 1VRH3 2WNVB 5A32A 4AGGA 1DYPA 3F95A 3OJBA 2WS93 3A0NA 3N9LA 4CEWC 1WW7A 4FPGA 5GLWA 3THDA 1Y3TA 1WCSA 2WT0A 3ZFFA 4RYDA 1J1LA 1PIV2 2PTMA 4CE8A 4YZ5A 2RS33 4HN0A 5JAXA 1UWWA 5FZDA 5IK8A 1Y7BA 3WXPA 2BBVA 2PA7A 4OI1A 1QQP3 1NY71 5EQUA 1VBD3 2D3RA 4AAXA 1X36A 3AJZA 2WT2A 2XJSA 4EJRA 3BTZA 1O4YA 5F39A 4ONUA 5KR7A 3UETA 3VKFC 2UWBA 3GZEA 1AXKA 4DINB 4JKKA 5BNQA 1AYM1 1X8EA 5FPBA 2HWC2 4IDZA 3O1UA 1BBT2 4C90A 3SQOA 2GN7A 1WGPA 1BK0A 1FPN3 3LOIA 4IE0A 3A23A 1W6NA 2D6MA 3AKQA 3F2ZA 1AJKA 3I2GA 4QPGC 2VJXA 2FHRA 3OYWA 2FD8A 2XHKA 3ZFEB 3AB0A 4RQPC 3MIGA 1ULOA 3SEPA 1M06G 4E8CA 4RHV2 4A4AA 4LTAA 4XXPA 1UNBA 3SH4A 5AC93 3LA3A 4OMDA 1NE6A 2G9ZA 3KS7A 4DXRA 3SLIA 1JZ6A 4LHSA 1JOBA 1MS3A 5C3OA 1CVNA 2VULA 2QKDA 3H3ZA 4UOJA 4LHNA 2WABA 3E1F1 4A6OA 3W9AA 3VZKA 3HBZA 1RXGA 1SPPB 1YIPA 2YB7A 3EYPA 3ZYPA 2WN2A 1JYTA 4E2GA 4FPEA 5E6HA 1FAYA 3MUZ1 1VMFA 1YYNA 2NP0A 1VAMA 3QD6A 3M4FA 3CLPA 4PCRA 3VBOB 3POBA 3BTYA 4LE4A 4LKSA 4EN6B 1UXXX 2OZJA 3HVDA 1OQEA 5T50A 1RUD1 4FP2A 4HKWA 4OMCA 4XUTA 2YBKA 3IDAA 1S0IA 2Q8EA 4HOOA 3LA2A 2K2SA 3URFA 1Z7S2 1GICA 3I8TA 5JLVA 4ISRA 3ORJA 4LUKA 5C8CB 1EV11 3H7JA 2MEV1 5ABJC 2LALA 3LFIA 2ZMKA 4OZOA 4PF1A 1VLNA 5G05L 4IEVA 4WM7C 3SHRA 4E2QA 2A7AA 4JX0A 2ZHKA 3E6BA 4LMFA 4B7EA 1UAIA 5F6LB 3OGRA 4AEDA 3FZ3A 1IZ3A 4FOWA 3LOBA 1WD4A 5K8SA 4ES9A 4EWAA 1Q8OA 5IK7A 3FC0A 4K8FA 4QB1A 5I93A 2JG8C 5F3GA 2ZPXA 4E27A 4GKYA 4ITCA 1H8TB 3IIAA 4QXKA 4W8JA 1E5RA 2ZGMA 1BHGA 4YGEA 2RS51 5I91A 5IAXA 1RUD3 2MNGA 2EIEA 3VDAA 1UPSA 3KD4A 2OZ6A 2VZTA 2IZWA 4OUEA 3POIA 3NO8A 1BEV1 3ZX7A 4BQ4A 2DU1A 5C8WA 4MV2A 5LW9A 5JOXA 3H1MA 1DGRA 1MQTA 2QVSB 1SBEA 2BOIA 1VB2A 1EV13 3B69A 2MEV3 2Q8CA 1VB4A 4L97A 5FZIA 4Y26A 1NCQC 2SBAA 1W0NA 2HJIA 1RUE1 3BALA 2RM22 5EHDA 2Y64A 2YGLA 1VBC2 3ZIWA 4MGYE 1JU4A 2D7FA 2ZOEB 4FT8A 1W90A 1SCSA 5DAPA 5FCCA 5FY9A 4Q8KA 1LU2A 4FO9A 2ZX2A 1GZTA 2XGXA 3M1HA 3I2FA 3N7JA 3RI9A 3I2OA 3RJRA 2RS53 5B4XA 3BUCA 4XILA 2OQ6A 3KV6A 1HRV2 5E88A 4DZGA 4QXCA 1W99A 3NV3A 1BEV3 2DVGA 2IUWA 4JDMA 4JDOA 4CDUC 4TTGA 4AVAA 3NVCA 2AENA 3GZUC 2ZMLA 1MPXA 4ZKTB 1JZ5A 2BTVC 1GV9A 3LDKA 1SLIA 3NWKA 4K6BA 4I02A 1JYWA 1CIWA 1RUE3 1UZWA 4ORFA 4E4HA 1H4HA 2P1BA 1D4M1 5FBJA 3WW2A 3ZFFB 4CU6A 1GANA 2EXJA 4AXOA 5IUQA 1UZ0A 3BGAA 1CR7A 3ETQA 3WT3A 1N1SA 3LDBA 4LXLA 1RITA 4IEOA 5L73A 1W6OA 2R6QA 4COWA 1CJDA 1UCXA 2W1UA 3MFCA 5FZEA 5FPLA 2H6CA 3AVSA 2CV6A 3B02A 5CG9A 1OH3A 1LHUA 2VCMA 1T6GC 3ZXFA 4QX8A 4CP9A 1EAH2 5FP3A 2A70A 3USUA 3EBRA 4UBGA 1OQDA 4XEZA 3T2TA 5I0RA 1NLRA 2BGOA 3VBSC 3DPRC 2ZAAA 2LW8A 1WMXA 4P9YA 1W6NB 4RR3C 2JB4A 5GZFA 5FY5A 1OVSA 2Y8KA 1FOD1 1PHMA 3CU7A 4Q0QA 5JI7A 1AR93 1W2OA 1W8WA 1RHI1 2E33A 2VBPA 2WKKA 1QWRA 3D82A 3OYWB 4Q0VA 3OSDA 2HWE2 5KHJA 4Y5Z0 3T08A 1QKQA 2GC3A 1NUKA 5DUWA 4YARA 1ZREA 1J83A 2R32A 1VJ2A 3W5MA 4CXXA 4YZ2A 5EYYA 2R30A 2R043 4FPFA 4N53B 2EALA 1UY4A 5A6ZA 2HEYF 4OI2A 1DG6A 3VBUC 2PLV3 4RL7A 2DUQA 3CJIC 4NHKA 3UGFA 4AF9A 4BZ4A 1TME2 4BLIA 1WUVA 4DXSA 3I3BA 3LWCA 1H2KA 1XSQA 3HJRA 2E26A 4OUMA 1DQ2A 2QJVA 5JR7B 1DIWA 1FOD3 1KXGA 2W94A 1UOFA 1RHI3 5A1LA 4DY3A 5FOJB 5FMDA 3MV11 2YG0A 4BMBA 1KD7A 2WUHA 3N9MA 4JDNA 5FV3A 3K4AA 2BFUS 4DO0A 5J36A 4ZU4A 1LU1A 1GOHA 1YQ6A 5DDJ2 2GNMA 1N3PA 4GB31 1XRUA 5FO7B 3MIEA 2P34A 3WNXA 2C6SA 5GKAC 3T30A 2ZGNA 5IVYA 4E2SA 3SCGA 2WRAA 2YU1A 3KCYA 5CVRA 4NIHA 1ENQA 2WAAA 3CF6E 4AGRA 2QQOA 2XBO1 1V70A 3O7OA 3VBFA 4XC9A 1WBLA 2BGPA 1W8FA 2UWCA 3P1IA 3L2YA 3LF7A 4P9XA 1ASJ1 2E7AA 5FZ1A 3WSOA 4WM8A 3U4XA 5DAXA 5L9BA 3OG2A 3ACIA 4YW5A 3S57A 1RJ7A 3WF2A 1CAUA 4EE2A 2Y6LA 1CAXA 3PJQA 4E9KA 4YZ4A 2X09A 3ZFGC 5A3LA 3S30A 4LK6A 1GP5A 3RRDA 1WLCA 3ZO0B 4QQPA 4CCKA 5BYNA 5L7OC 4J1XA 2B39A 4OQ8A 1MQTB 1O6UA 2GU9A 2OS2A 4OVEA 2D5HA 3U75A 1PO11 4GB33 1H1IA 2P3KA 1IOAA 4DEQA 4LK7A 3WP4A 2YROA 4ASKA 3GNEA 2XONA 4YRDA 1CZVA 1BJQA 2WQ8A 3K51A 5FYMA 2VW1A 1GOFA 2WNUC 2Q8DA 1JN2P 2ARXA 3KCCA 2AEYA 2DUOA 3GGLA 4GWMA 2XBO3 3J26N 4AZZA 5D8AA 4Z92B 3MEPA 1IQDC 1DQ1A 2JDUA 4A3XA 1ASJ3 4V2WA 3VD5A 1WMFA 1XU1A 1HB4A 4IL7A 4Q0UA 4UXAA 3RWKX 3LIGA 2DFCA 3AZVA 5LEJA 4YG0A 4D94A 4Q4W1 2OUJA 5T55A 5JIAA 2XQXA 3V65A 2GC1A 3Q9OA 4NJ4A 5GM0A 5C3QA 1MR5A 1URXA 4NRMA 4YZ3A 3AKTA 3BTXA 1PZ7A 4QGNA 1W9FA 2DVFA 2R16A 1H9PA 2L9LA 3NJVA 1PO13 1B35B 4UT5A 4PQ9A 4XUNA 4CCDA 1BMV2 2VY0A 1REFA 1W03A 4QKFA 1POV1 2VXJA 5CIRA 2HEWF 4FOQA 5I0TA 1ULDA 2W52A 2PHWA 1W6QA 4UW3A 1US3A 1C3HA 5A3OA 1W6OB 4IV1A 4GWNA 1NAEA 1R081 4MGZE 1MACA 2CSGA 2ZGOA 1RB8G 2DU0A 1TZOA 4AVTA 1S0EA 5IK5A 4CP9B 4YNIA 3USUB 1SCRA 2QQPA 4KWLA 3MGUA 2VO5A 4L9BA 2BV4A 1ZA7A 5IVBA 2P5BA 3J7MA 5EV7A 3BKZA 1C1FA 4NAOA 5EWSA 4CTEA 3LCPA 4P9WA 2ZJCA 5FK8A 2Y6JA 5F7UA 1G9BA 4CSWA 1POV3 4LOSA 4L99A 1ENRA 2FCVA 2UWAA 5H9RA 1O5UA 3THTA 3N9PA 4RA0A 4OI4A 2QNKA 3ZSEA 4IEUA 5HCAA 4W65A 4Z07A 3E6CC 2ARAA 4EWDA 2R1DA 4I09A 1G9CA 2JE9A 1MVEA 1R083 3MBWA 1QDOA 4O61A 2XKOA 1V9U2 5GALA 1I9RA 4YYOA 3WUDA 2VH9A 3HAGA 4K1YA 3VDBA 1IHMA 2GDFA 3WDUA 4RGGA 1WD3A 4CP0A 3T0AA 5IVJA 4Q29A 1JTZX 1OVPA 2ZCWA 4LBLA 1XXNA 3ZXJA 4O7XA 5FLJA 4CEWA 4AQSA 1VAKA 4OUSA 5IFTA 3D6EA 4M4PA 2CDPA 4ES8A 3ZYRA 3DXTA 4JRLA 4O65A 3U11A 1RUG2 2OKXA 4Y1VA 5BXXA 5KBFA 5BNOC 2Z42A 4HL0A 1C8M1 1Y9GA 2J1VA 4QGMA 1AR62 4ASMB 4BK4A 2FMDA 3AP6A 4JKMA 1ND3C 3VHNA 3IWZA 1UPIA 3TEZA 4AFCA 1PGW2 3RSJA 1NLQA 3PURA 2QQWA 2FCTA 3ON7A 1SLTA 4ZY9A 3VLBB 4IGOA 4KI5M 5FY7A 4JVAA 3VBFB 2Z69A 4NPMA 4PIXA 4IW3A 2WINB 3T3YA 1GQHA 1DGRN 1K5MC 5KC6A 1CAUB 4FTSA 4RQPA 1DU3D 1LHOA 4Q4Y3 1PNGA 3NAPA 1CAXB 3WG1A 2O8OA 2WAOA 5FYBA 4H14A 2YMZA 1FV2A 4PIYA 3SCFA 4CDQA 3LEIA 3WOGA 3WINE 4MO3M 2GNBA 4Y1YA 4CA9A 3WNKA 1DGWX 5FPZA 3POJA 1MVQA 3J8F1 4JKLA 4M00A 4SLIA 3LSEA 3O0WA 3MW3A 2ET1A 1F5JA 1V00A 2ERFA 1PGL2 1COV3 2XUMA 3BI3A 3ILFA 3ZM8A 4YVWC 4BISA 2XVLA 3IDBB 2JG9A 3JD71 5GLTA 1DQ4A 3WP3A 3AYDA 3USSA 5D8AB 1U5XA 2WZ8A 2ZX3A 4XE9A 3ROUA 3L2HA 3CJXA 3POGA 3TWIA 3CO2A 4BYYA 3O1RA 2BW8A 1GWLA 2BNNA 2WLPA 2VC9A 2IXIA 2JKXA 2XKPA 3HNMA 1NKGA 4EYUA 2VU9A 4Q4V2 1RUOA 1JOPA 2EXHA 1VBE3 1CD3G 2AH2A 3C7OA 3OBAA 3TAYA 1PO21 4ASLA 4CCJA 4DOUA 5FP4A 4DXZA 3O1SA 4B4RA 3RVHA 2ADEA 2FBEA 1EP0A 4CCNA 2EVXA 5JZGC 4WZCA 2ZGQA 1KDMA 1ULCA 1QEXA 3PUIA 4Q4X2 2XLFA 4XF1A 1RUI2 3BN6A 3HR9A 3OD4A 3OUIA 4CDXA 5DQ0A 2A6ZA 4M0NA 3TN91 1LOFC 1WLTA 4CUGA 4KMQA 1XYNA 5A33A 3W59A 5AFEA 2LTNA 4H2AA 3NJZA 5B2GB 1W6QB 1NZIA 2DWRA 3M2MA 4IV1B 1AR83 1OLMA 2VNOA 5ACA1 1RXFA 5CFCC 3MIFA 5K7PA 1GLHA 2Q4SA 4N90A 2BWAA 3RZLA 2VW2A 1H0BA 4BXFA 4BQ5A 1ZBE1 5FZLA 1PO23 3V0BA 1ZRFA 2VQUA 5FPUA 2W2IA 2A3YA 2CAVA 2VTXA 3KSCA 4P08A 1VBA2 3R4UA 4AVBA 2GP5A 4BQXA 2WC2A 5C4WC 4QDQA 4CDWA 1NCQA 2VOKA 2JIGA 4URTA 4AVSA 1HXS3 4YZ1A 2Q0AA 3CZJA 5JSRA 2R1BA 2K46A 2DURA 2DFBA 3I4IA 5SV5A 3V64A 1XOYA 1LHNA 1I6XA 4MLOA 4NHLA 1QJY3 1N1YA 2XJRA 2VMEA 4DPNA 4QU1A 1QJX3 1PVC2 2VZVA 4D7TA 3I97A 1BCXA 4QPWA 4LKDA 1V6JA 2UY9A 2W1WA 2WN3A 3BYWA 1R64A 4YW3A 4P00B 5J1XA 3OBRA 3OEAA 1PK6C 1G7YA 1F31A 4AOCA 4C1XA 4CDUA 3OPZA 4DRRA 4PI2A 2AREA 2P2KA 2G1MA 2CWSA 4QD2A 4QT6A 2XLGA 1OUSA 4B8EA 1S2EA 2P3YA 3D0SA 2GMPA 4RS5C 4AHYA 4CEWB 4R9CA 1MEC1 1D0HA 4W6YA 3UYJA 2VZ3A 1UMHA 2NN8A 4BE3A 5LBEA 1N3QA 1GZCA 4ZU5A 3E5QA 5BY5A 3HMYA 1IS5A 5FWEA 5FYCA 3WNPA 3ZKYA 1W8NA 4IE5A 5ANQA 1IPJA 2J22A 3KZ4C 1FNYA 1VBB2 2V5DA 3AVRA 2ZHNA 5DN2A 2VL4A 5CFDC 2HWD2 5J3UA 2JDNA 5JXJA 1I3HA 2TEPA 3ST7A 1LOAA 3TB0A 2PHTA 3RZMA 3BU0A 1W28A 3S0MA 1PZ8A 1RUC1 1YI9A 5D21A 4RR3A 2YDEA 2HWC3 1KITA 1X50A 4MSVA 4CCEA 1BBT3 1NYWA 1Y43B 4LLOA 4QPGB 2EIDA 4KH9A 1SPPA 4N7IA 1W6PA 5IYYA 4RQPB 4COYA 4JHTA 3GHMA 2R072 2Y0OA 3K2OA 3VBRA 2WFF2 4CDQB 5K9YA 4GWIA 1RUH1 2FDJA 1QIQA 1AYN1 4NRQA 4HSLA 4Y20A 3VBOA 1JOJA 1NT0A 2X05A 4PJYA 5F32A 1KGYA 2HWB1 2WJSA 3TOJA 1GKBA 4QXBA 4AVVA 3ZXLA 4DUVA 1O3TA 1AX2A 3ACLA 5JVVA 1APNA 3CJIA 5FYVA 3I3DA 4XJ8A 2JICA 1F5FA 4QHOA 1CWPA 1GNHA 4CUCA 1RUC3 2DBIA 2OPWA 4FAGA 5IT6A 1D2SA 5FP8A 3MZHA 1JYXA 3OGSA 2BRTA 5FK7A 3JXSA 4HLTA 1QJU2 5IVVA 4NIGA 3T09A 3M3OA 1NXMA 2RR11 3QLQA 3PU3A 2Y33A 3N35A 2D98A 5FOBB 1RC6A 4LO5B 5ABJB 2XHNA 2VAUA 3RG0A 1H8TA 1WCQA 2WSUA 3IT8A 4LHKA 4WM7B 4LE3A 4Z2AA 4S2HA 1FMD1 3S5QA 3IMNA 1OQ1A 1E5IA 5L9VA 3MLKA 1LJ7A 1VPHA 5AVAA 5I8YA 2RMU2 4Q8LA 3I3MA 1Q43A 1H9WA 2JG8B 2VMDA 2VQTA 3VBHC 5A33B 3E97A 1VAVA 2WIIB 1K3IA 3TEXA 2VZOA 4JGZC 4YM3A 2JD9A 1CAVA 4TLGA 5FPAA 3PL0A 3UV9A 3DKQA 4BU2A 3AKPA 1YHFA 1EY2A 3K4ZA 3E6DA 4R52A 2RS31 3UKTA 5L7OA 3V0BB 4WZFA 2XLAA 4QQ2A 1GSLA 1SBDA 2QTWB 3BPSA 4WVWA 2Z5WA 5L9RA 1QQP1 3NV2A 4IXLA 2DV9A 3RI8A 1VBD1 1OF4A 4JV4A 1NCQB 4BQ2A 4QDRA 3GBWA 1UIKA 4EN8B 3IAPA 4LORA 4DNYA 4HVOA 2JE8A 3OTFA 3VL8A 2X5IC 5C3SA 5A6QA 3RDIA 3I7DA 1HQWA 1VBC3 3FWEA 3CNAA 1FPN1 3IDCB 1CZSA 2BERA 1DLLA 1GNZA 1F4HA 3FN9A 2QQKA 1OD3A 5GZDA 4C0HA 2JB8A 5A7NA 4CP1A 5JMOA 4PLOA 3POYA 1XPWA 1WW5A 1PM4A 4S2DA 2UY8A 5GZGA 5ISLA 4FOYA 2PN5A 2HKXA 2WWUA 4EZHA 1YFWA 1AL22 2ETEA 5AC91 4CDUB 2CDOA 1J3QA 3I2JA 3AMPA 4B1MA 1ZBE2 1QJEA 3DECA 3JB8A 1HB2A 5FYIA 1U0AA 2E53A 5HV0A 4F83A 1ZX5A 1Q5OA 2B8MA 3LDRA 4FPCA 3MI8A 5FXVA 4BPZA 2MHFA 1U5YA 5CNAA 2HBTA 2V4AA 2WO3A 4D3WA 2ZKNA 2WZR2 3MPBA 4HONA 1RTVA 4NIAA 2R062 2WLQA 1S0JA 3UGHA 4BQYA 2D43A 2F6BA 2VZRA 2WQ4A 2VZSA 1YNAA 3CIHA 4AFAA 5IVEA 1NCRC 4AI1A 1XJAA 3C2UA 2B45X 1VE0A 1YQ2A 2HYXA 3BOWA 1TMF1 4GA9A 1DQ6A 3LGRA 1LNSA 2BP6A 3VBSB 3DPRB 5FREA 1NE4A 1XBFA 2HBUA 4CEYC 4RR3B 1NA1C 1ZM1A 5CBLA 4A44A 4XZPA 5CEHA 1RUF2 4D6SA 1GP4A 1EYBA 4N53A 1W6PB 2CHHA 5IW0A 3DGTA 1JU3A 3OUHA 5K0UC 3M3CA 3VBRB 2BYVE 5JDBA 4COUA 4CRQA 3WV6A 4Y20B 4GH4C 1YJKA 3PIJA 4Y1UA 1A34A 4CZSA 2VPVA 3VUOA 4S2GA 1Q8PA 5C7GA 3NW4A 4JGYC 3DCQA 2HYKA 2VOVA 4D6QA 5LK7B 1JYVA 1A3KA 2AACA 2HEVF 3VBUB 1K42A 1ZA4A 2IVJA 5LA2A 1TMF3 1WLWA 3AXEA 3CJIB 2SLIA 1XNTA 5FZAA 5C6CA 2OW4A 4ZHNA 2J42A 3JBG2 3VHPA 3GYDA 1N1VA 3QH6A 2W47A 4FPHA 4CVUA 1TME3 3UL2A 3JB4C 2ZEXA 3H1WA 4XOGA 1E5HA 5APAA 3Q8CA 1AF9A 4UWDA 2JJ6A 1Y9MA 2XDVA 1QJZA 5HV4A 3QH7A 1MZ5A 4XFAA 1ZZ9A 2AEZA 1F8VA 1EPZA 3NNFA 4Q26A 4XMAA 4Y4RA 4X6RB 3MYXA 2W92A 2J1TA 2Y34A 1J58A 1ND3A 4TWTA 2WFPA 1O4ZA 1Z0HA 1GMMA 4I2OA 5DDJ3 1OOPA 3FFZA 2E6VA 3MIDA 4J6GA 5FZMA 4AEMA 2GSYA 2WNEA 3WHUA 4NN0A 4B4QA 4IERA 5A3PA 1O8SA 1A8MA 3MFAA 3WW1A 2BPA2 3OGVA 4UW6A 2X8KA 4Y3OA 2ZEZA 3W20A 2JIJA 2OXBA 3NNJA 2ES3A 4KG8A 1QJFA 2O0OA 2WA4A 3I2HA 2K9ZA 1CAVB 1BLZA 1YWKA 1ZZBA 4QU2A 5AFBA 1IKQA 2RS13 3VN4A 4AI9A 4NRPA 3FHQA 2QQVA 1XNAA 1PMJX 5L7OB 4YVSC 4YGCA 4XURA 4MADA 4PI0A 3BVCA 4HPKA 2WYSA 2RR12 2VD7A 4PHZA 1AL0G 3FL7A 3ECQA 2AYHA 5FY0A 4LO4B 2FDHA 3MO4A 5FZ3A 3VKLA 2V4VA 3ZSKA 1FMD2 3PUQA 2ZGSA 1DFQA 5LA0A 1R092 2D44A 4OHYA 1GWKA 3H7YA 4PDWC 4R9AA 2UU8A 1OLME 2VTFA 3NNGA 4BQ1A 4FPLA 3FJSA 1LGCA 4GMP3 3T4HB 1B35A 5IHRA 4K7JA 3N9OA 1AR91 1VRH2 1H30A 1K45A 1YFXA 2C5DA 3WG3A 2JDYA 2XJTA 2Y38A 3SKVA 2WS92 2WNVC 3MF9A 4QX2A 1S0FA 2E7QA 3AZWA 4XUPA 5JZGA 3QOPA 4UAPA 4JQTA 3HN3A 1YCIA 4AFMA 3IM0A 2WZPP 2R041 1ND2C 5T52A 4CUAA 3OGJA 2AC1A 1VR3A 5FYYA 3DKWA 4MHRA 4TLFA 3OF1A 4XF3A 5LBFA 4RSUA 2PLV1 4GD4A 4YPJA 1A78A 3KT4A 5A3NA 1LECA 2ZMNA 4YW7A 3ZXAC 2A1XA 2VMGA 1DDLA 1TQ5A 4AWDA 3PJYA 2JE7A 3ES1A 1YEWA 3FLTA 3LEKA 3SH3A 5CFCA 5FUNA 1XE0A 4XDOA 2A71A 3G6JB 2TBVA 4PLNA 3WDYA 3NSTA 1ULFA 1ZRIA 2ZS6B 3HWJA 3I49A 4QWNA 4Z8BA 1TNRA 1FXZA 2A5ZA 4LO7A 4ZXEA 3VD7A 5JMCA 1WLDA 2IVIB 3KGZA 1QY4A 1MS1A 3PMSA 5FLHA 1JZ2A 5C4WA 3RQ0A 3ZFEC 4IE4A 1LODA 2W39A 1C8NA 4XTPA 4AHXA 2RDQA 3RGBA 3BPZA 4BMEA 1JUIA 2ZZJA 5A3MA 1OFNA 3WF4A 2FCUA 2A73B 2BJSA 1NY72 1HQNA 4UF0A 2EAKA 3ZYFA 5KXDA 4KBBA 1D0GA 1J3RA 1AR71 1KEXA 1BK1A 4XJ9A 5A70A 5J96B 2ENRA 3T1LA 1HRI1 4CCCA 4GKXA 2QZ3A 5FO9B 5L19A 3V0AA 5J98B 4KL1A 3H8RA 1FATA 1AYM2 1LEMA 1IS4A 4LULA 4XFIA 4DRVA 3BIWE 4HETA 2OIIA 3I3QA 2QDRA 4U36A 4XAEA 2PQQA 5CG8A 5H9PA 2IWGB 5C9AC 2YZ4A 1SLLA 4HSJA 1LOCA 1RMU1 5CKMA 5DUVA 2RJLA 5FZCA 3LQCA 2PYTA 1OKOA 1V9U3 3OB8A 3RMXA 3VZMA 1C4RA 5JOWA 5LEKA 2QUOA 3GBGA 4BM8A 3R6SA 4MGSA 4O9EA 3UK9A 5A1FA 3PTRB 4RS5A 1LCLA 4UFHA 3PNAA 4X6QB 2RHPA 3BODA 3WW4A 1IG3A 1UZVA 4Q1PA 4Q2FA 5LA9A 5T5OA 1UMZA 4QMAA 3A7QA 1JZ7A 1HKDA 1AR73 4XBQA 5BNOB 1DBNA 1HRI3 1NZCA 5DZGA 1XNBA 3J4UH 1IS6A 2UYAA 1DHKB 2WZEA 4FXKB 1QOTA 1ZZ6A 3A0KA 1DQ0A 3GALA 1ND3B 3ZXDA 2W91A 1AR63 1ZZ7A 3U10A 3HD8B 4AEJA 1YLLA 2J1SA 2ZA9A 3MW4A 5CFDA 1OOPB 1RMU3 2VOWA 1JZ8A 3LKJA 1RUD2 3BOPA 4Z2WA 4XFCA 4M3CF 3KGLA 5H9SA 2VCCA 3ITQA 4AK3A 2VGDA 1KJRA 5FUIA 1SLCA 4LBKA 4M01A 4XBLA 4Y22B 3AK0A 3FBMA 3U1XA 2XG3A 4Q27A 1EV12 1K5MB 2MEV2 4Q5OA 4W6WA 5FYUA 1F35A 1JW6A 1UY1A 1YRZA 2PHRA 2VW0A 2B9VA 1BQPA 2KA3A 2ORZA 3VDDC 4AFBA 5J37A 1AXYA 4FI9A 1GNYA 5A3UA 5LK5A 4B3NA 1UKGA 4MH0E 1OF3A 3QACA 4HPKB 3CMGA 1KRIA 4N7UA 4LO6B 1SQ4A 3OUJA 1OA4A 4H7MA 3AXDA 3WF3A 2RS52 4YVWB 1DGWA 3M3IA 2P3JA 1ODNA 4PBPA 2DVAA 1ODMA 1BEV2 3KM5A 2ZX1A 3MPPG 3NKGA 3OCPA 4PF5A 2NLRA 3ACFA 5A7SA 4OCTA 4P5HA 3UKVA 4D7SA 2VOXA 3MICA 3IAQA 1H6YA 1YFYA 4ATFA 3IIIA 2Y6KA 3H3UA 4F7ZA 2DCKA 1W06A 5HCBA 1H4GA 4LITA 4CCOA 1LB2A 4TSVA 1GQGA 1RUE2 3ZMNA 2ZTNA 5JZGB 3IPVA 2VUAA 1L7RA 2I45A 1F2NA 1Q8SA 2YU2A 4R8HA 3FUQA 4B7KA 5A1AA 4XFGA 4XDQA 1OXCA 4AI8A 1WCUA 4XUQA 5FLIA 2IFWA 2XH6A 1UW8A 2YC4A 3DUIA 1JH5A 5HXMA 5EJZB 3VBHA 2IXCA 4WVVA 3LEMA 4FPJA 3ME2A 1F9KA 1PMIA 2YHJA 2AGSA 4KU7A 4NIDA 2IXKA 5JSPA 4JGZA 2KR2A 2ZGRA 4DEVA 3R4SA 5LATA 5CFCB 1HJGA 3QCWA 4NMIA 4QQLA 4Y4YA 1S0BA 1H6XA 1RUJ1 2R0FA 3WG4A 2RDSA 5FO8B 2BNOA 4GJYA 3GXUA 4UW4A 5DAWA 1UN1A 1WW6A 2G19A 4XIKA 5KXEA 1ZBA3 4U2AA 3VB9A 3S7EA 1FV3A 2RDRA 1D4M2 4FPKA 4ARXA 4TZDA 4Z82A 1UYYA 2HLEA 5C4WB 1DGLA 3C8XA 2F4LA 1VBA3 1U12A 4IQPA 2RV9A 4MX3A 3O1OA 5FMOL 4UF0B 1U5ZA 3FE5A 4DMIA 4P02B 2PMWB 2X5IA 1T6BX 3CL1A 2NQYA 3PUAA 3THPA 1W2AX 2W87A 3KV5A 1DF0A 3ZN5A 4QX7A 5C5UA 3V0AB 2GC2A 4UFKA 4QPYA 1QXJA 2EAAA 2GAUA 4R9DA 3PU8A 4Q4Y1 4CXYA 1MS4A 1RUJ3 1LGBA 1PVC3 4PIZA 3BCWA 1PK6B 4HVRA 1FOD2 3KT1A 2ZEWA 3NQHA 1PX4A 1YJLA 1RHI2 4LBMA 2MPFA 1CESA 3T1MA 1TE1B 4FBFA 4G3YC 5FPXA 4Z1VA 3WUCA 4N9IA 4OLLA 2WSVA 5F1RA 4NWVA 3CQOA 4RS5B 1A6CA 1E57A 1YI7A 2VVFA 2A6YA 2W5FA 2ZX0A 1K12A 1W9TA 3KB5A 1COV1 5IVCA 3O1MA 4XETA 4QM9A 1YXWA 3S6PA 2C26A 1RUNA 4MYEA 2P6CA 2VQ0A 4OI0A 2PHXA 4A6SA 4LKFA 3DXUA 3THCA 2D6KA 2HWF1 4HK9A 4OHVA 3APBA 3I2KA 3SKJE 3SNMA 4QPGA 4AEDC 3Q8FA 1O3SA 1NCRA 2GH2A 4CXWA 1ZZ8A 2ZZQA 4OULA 1VBE1 3H1YA 5CFDB 3EO6A 4LA3A 2ZGTA 3OOXA 2OT7A 1JZ4A 1RINA 2YPDA 1XB9A 1BXHA 3AMHA 2JECA 2WO7A 4NOTA 1CONA 4D69A 3GHNA 4ZONA 3HIFA 1R1A1 3EHKA 3MDPA 4GB32 1OFSA 1ENXA 2W3JA 5K0UA 1Z78A 4D8MA 3D0JA 4XF9A 2QBXA 2PHFA 4IGQA 5ERLA 4FFHA 4COZA 3RZKA 4YGBA 2ID4A 3P6BA 4GH4A 4ISQA 4YM0A 3T2OA 4WBBA 4XMIA 2WFF3 1D7PM 2XBO2 4O9GA 2HWF3 1MZFA 4COVA 3T0BA 1AR81 1REDA 1AX0A 1GP6A 2I2SA 4WV8A 1ASJ2 1CX1A 3HQUA 1A8DA 1MZ6A 2YY1A 5EJ3A 4RFT0 1D2QA 1POV0 4CPBA 1G9FA 2BUKA 4BIFA 3BIEA 3OBZA 1FYUA 5ABJA 3ZYIB 1J1TA 3WY6A 3PVNA 3GZAA 3O1TA 4WM7A 5JXGA 3MF6A 1F15A 4OQ9A 1RVF1 1LOEA 2JDAA 4OYUA 1HXS1 5FP9A 3GF6A 5FYTA 3S7IA 3JQWA 4Q0SA 1R1A3 4L11A 1PO12 2H0BA 1OMIA 4N9HA 2CWMA 3AJYA 1HW5A 1QJU3 2JG8A 1QJY1 3ZDSA 2XR4A 4GAZA 4DUWA 2W0XA 3IPVB 2VVDA 2PAKA 1QJX1 5JR2A 3EMRA 1UQXA 3KT7A 3KF5A 3M70A 4IUGA 5C3PA 1YFUA 4HANA 4NIIA 1QNWA 4TXWA 3JU9A 5DUXA 3RZZA 2XJQA 4Q4W2 3VBHB 4HZFA 1W2NA 4I3PA 5FZBA 4DS0A 3VL9A 4IEWA 1WWYA 1S2KA 4B1LA 4JGZB 4QDSA 3ATGA 1RVF3 1FNZA 2D6NA 4GWJA 1H2NA 2VQAA 4YM2A 3AP4A 3UESA 3JUUA 5FPVA 3RPQA 2Z79A 1V6LA 2CU5A 1DP0A 1PVXA 4YVSA 1XC6A 3U0ZA 3T2QA 3KCXA 3MIBA 1PIV1 4MGKE 4QKDA 1KDKA 1REEA 3TEWA 3ZR5A 3T0DA 1YQCA 1UU5A 1LHWA 1R082 3A21A 2X5IB 5LBCA 2AUYA 3ZXKA 1ULPA 4HKOA 1VMJA 1QMJA 4N8MA 3DYOA 1GWMA 2HWC1 1Y4WA 4F8AA 3ZVXA 1BBT1 3WX5A 3GCWA 4XAAA 2VOTA 2I74A 3AMNA 2QFEA 2WT1A 4AQ2A 4EN9B 1GUIA 2GNDA 3PDQA 1HDKA 5HXVA 2GC0A 2JDHA 3VKMA 3HOBA 3ZSMA 2VZPA 1PIV3 1AL23 3KQRA 1FI2A 1PM7A 2WA3A 1UXZA 4YG6A 3WP6A 1YO8A 5A6XA 1OA2A 3FLRA 4N43C 2B46X 4BA6A 4F3JA 3TYJA 2FZ2A 1EUTA 5FXXA 4XQ4A 1XSRA 2H0VA 3AP5A 3H9AA 4CP2A 1CGPA 3VZNA 5FWJA 4HBNA 1WMEA 2ZGKA 4MZUA 4Y33A 4A7KA 3VBSA 3DPRA 3ZPOA 2E9QA 2Q1MA 5C33A 1QF3A 3AP9A 1WA4A 2VCAA 2H6BA 3JQXA 1UOGA 3I3EA 3NJXA 5I0DA 1RGSA 5C70A 5BV6A 3WD5A 1NCRB 4M4RA 2AZ5A 3WCRA 2FDIA 2EXKA 3VBFC 1NQJA 3PMEA 4JTNA 4KNCA 4LEJA 2ADDA 4Y1XA 3LE0A 4NVPA 4HFSA 4M0HA 3I2IA 5G04L 4WM8C 5FAXA 3UJQA 1SG3A 2X10A 3EXUA 2Z2SB 2D3SA 3IDEA 3LPGA 4MOAA 2GZWA 4RHV3 4GALA 4KWUA 1YQ5A 3POSA 3HQRA 5LBBA 4BH9A 4QX1A 4XIOA 2OQ7A 2DBNA 2VZUA 1C8M2 3ZSJA 2VE1A 4GZ9A 5DXDA 3VBUA 1OT5A 4AAPA 1SZBA 1RUF3 3EB7A 2JDMA 4QGLA 4Q0PA 5K0UB 3K77A 1ENSA 5F5IA 2XJUA 5BUVA 4QB2A 4BCUA 4GH4B 3P3PA 4XYXA 1B09A 4V1PA 2E7TA 3ASIA 4JGYB 1SACA 1IKPA 4IV3C 4MXWA 4X8NA 5C9AA 4NPRA 4BIOA 4BK5A 3ZR6A 2G9GA 1LHVA 2XOMA 3WQ7A 5A7WA 1OD5A 2RDNA 1PZ9A 1WZXA 4XJZA 2V72A 5FZFA 3WLUA 1YQ8A 2XL9A 1N47A 1UMIA 3M8LA 5E1RA 1DLCA 2KM2A 1Z7S3 2TUNA 3HT1A 5CZKA 4KQ7A 4W50A 5BNNC 3CEWA 1VIWB 3NJYA 2J1UA 4FFGA 3NNMA 3ZOIA 2NMNA 3J8F2 2O8QA 4GULA 1O7FA 1OA3A 1WCKA 2VM9A 2DTWA 4AG4A 2FQPA 2RM21 2ZHMA 3B5LB 5LASA 1YC61 1QXRA 1VBC1 2OVUA 3U37A 4AQTA 5JI9A 5GJ6A 5A80A 2F4PA 1TG7A 4XCBA 3JD72 1DZQA 1G8WA 3H42B 3PVEA 5T5PA 2D40A 3ZFGA 3WQ1A 3FUOA 4L2NA 5EJ1B 1XQNA 4IETA 3K46A 4FP3A 3ZN6B 1HRV1 1JI6A 4INDA 2XWBB 3OPTA 1PO22 1RL3A 4JTOA 1GZ9A 1N3OA 4NHXA 2P37A 4GXLA 1DQ5A 1LULA 2GN3A 1ZRRA 5E8AA 2VNGA 1IPSA 1W39A 3C7EA 4L92A 4XPVA 3VDDA 4LHLA 3VZLA 2WNUA 1G86A 1SLAA 4Y5TA 2CGNA 3HEIA 3OD0A 5JWPA 4YVSB 3TN92 1CN1A 4JC1A 2RM23 4QQOA 3N3HA 4ATEA 4YSFA 3O0VA 4KU8A 4I30A 1AUYA 2RJ2A 3I2DA 1NXD1 1XYOA 4XACA 1HX6A 4XF4A 3PUSA 5I0SA 1PNFA 2A75A 4AHWA 5ACA2 3H0OA 1O4TA 3I59A 2RJKA 3QBQA 4H7LA 4YW6A 3P3NA 4QQHA 3ZPYA 3ILRA 1EAH1 1ZNPA 1HRV3 1X8MA 1V6IA 1X9PA 2QCSB 2GH8A 1R093 3ACHA 4J1WA 3LZZA 4FOVA 1UZZA 2VR4A 5FYZA 3ENRA 3KVAA 3AC0A 2JWPA 3N7LA 4K8RB 5K4LA 2XB6C 4META 3JZVA 1J59A 1RYYA 3C7GA 2CL2A 4ZZ5A 1ZYBA 5T5JA 1WA6X 4UFJA 3UT0A 3POWA 1BYHA 2HWE1 3FBYA 1G6NA 1LR5A 2EF6A 4EWEA 3DYPA 3B9IA 4IEZA 4QAWA 4P14A 1OLRA 4AGVA 4GJZA 1ND2B 2AR6A 1DZRA 3DN7A 5FP7A 3FHAA 3LA7A 4QHBA 4YLZA 2B4KA 1CZTA 4H55A 5FQ0B 3BTAA 3VKOA 4ARYA 1ULEA 4NHMA 4HVQA 2Q5TA 2Y6HA 3WDVA 3POFA 1EAH3 2KXLA 2XQRA 1DYOA 2A6VA 5DUUA 5FXZA 1TME1 1KFUL 1W6MB 1HQLA 5EFUA 4DIQA 2BOJA 3VV1A 2C4XA 2VZ1A 3I54A 5F37A 1DYKA 3AMMA 4OHXA 3K75B 2NM1A 1V0AA 1W3VA 4XUOA 1KFXL 3UJOA 4FSJA 3MLLA 1OC1A 2VNVA 2VUCA 1OBNA 2YV8A 1MEC2 1L7LA 3DF0A 4FPYA 5GZCA 5KC5A 3VD4A 1GFF2 2DCTA 2HWE3 2BWCA 1V6NA 3B01A 2PFWA 2EXIA 1F4AA 1O59A 1SMVA 2LS6A 2NYYA 3NAPC 5FZGA 5IJRA 5KWRA 1AX1A 4AW7A 1ZZCA 3G7DA 3IKWA 4QKNA 4YW1A 4CDQC 5DDJ1 3AZYA 3RNSA 4M3CA 4JHZA 3UGGA 5EIYB 4BWOA 4TYSA 3LPFA 4BHPA 1JZ3A 3AFGA 2ZGPA 2I07B 5IWFA 1LENA 2J1RA 5TSWA 2DCJA 2PXJA 4JQRA 3J9SA 5FZHA 2CGPA 2XVKA 1C57A 4DY5A 5DPNA 5DZFA 2WBKA 1RUC2 2YC0A 3U4SA 1AYM3 5CKQA 5C9AB 4MXWB 3WQBA 4FXGB 2JG9C 2KD7A 3R0RA 1IQAA 5FZ8A 1WMDA 1JBCA 1UY2A 2RS11 4A7ZA 2R0HA 5A7WB 5BNOA 1X82A 1UF2C 4EQVA 3KV9A 2VMFA 2PQSA 2N7GA 3CBNA 4IEYA 1Q56A 1YIFA 4HK8A 2EICA 4CCLA 1WKYA 4NO4A 1N1TA 1X9TA 1W8UA 2YPJA 1RUH2 4X8PA 1UY3A 1AYN2 5BNPC 5FUPA 2BDRA 4QPIC 5HBAA 2HWB2 4K9SA 2PHUA 1S55A 2PAEA 4KWKA 3M7AA 4S2FA 1ZRCA 2WR9A 5F5CA 2EA7A 4CDXC 1UU4A 2VUJA 3FMGA 4LO8A 3DYMA 4Y22A 5I0UA 3AZZA 1U5IA 1LKNA 4GMP1 2X29A 4GIQA 4LIUA 4QHZA 1K5MA 5M0TA 5FKBA 4XABA 4SBVA 1GU3A 1E5SA 1S4CA 3ZFGB 2XJPA 1S2BA 2J1AA 3A22A 5E89A 1H1AA 1QHDA 3AYEA 2VVEA 4I0WB 4K20A 5FMCA 2A3WA 3KQ4B 5C3RA 1BKZA 1W0OA 1HV0A 3MIHA 2A6WA 3INAA 1XE8A 3FFQA 4FFIA 1KJLA 5F3CA 2NPIA 4KGGA 2Q8OA 2V09A 4LBQA 1LAJA 2ZKLA 3VDDB 1DCSA 2YFUA 4LQRA 2BVVA 4YVWA 4CPBD 2WNUB 1BMV1 2VMIA 4OHZA 4CDWC 2ARBA 3B3QE 4A2UA 4AYUA 1HB1A 4I3GA 4J25A 3HNBM 3WEZA 1HN0A 2W68A 3RS6A 5KHKA 5EZWA 4NPLA 1W8ZA 3ILNA 4ZXKA 1IGOA 4FQ4A 1OUXA 4KWJA 4EROA 4XHBA 4LIVA 4WVZA 3I59B 4CYDA 5F5AA 4E4DX 4BQ3A 2RS32 3O5SA 4HMZA 5LCWL 1OI6A 3WVJA 1QQP2 2GNTA 1W0PA 4YW2A 1LOFA 1VBD2 4KGQA 3WCSA 2DUPA 1UZYA 1W9YA 1XNDA 2JX9A 4BOWA 5A32B 4AHZA 3N4MA 2YBPA 2ZABA 3RZHA 1Y9QA 4Y24A 1W05A 1GQPA 4C91A 3UKNA 3TRSB 1CQ9A 3CHXA 1QOOA 3TNQA 3RJ2X 5LRRA
chains in the Genus database with same CATH topology
1LRHA 1BZWA 5JOYA 3O0XA 1FPN2 5IK4A 1JXNA 3FX3A 3NL1A 1I5ZA 3AKSA 5FDBA 5CU1A 5CA6A 4LT5A 1V9U1 1MS0A 5JPNB 1NG0A 1WCDJ 2P3IA 3ZXGA 5AC92 1ONAA 4DQAA 3LAGA 1GZWA 2LM3A 1CJPA 5FMOS 3B00A 1VALA 4MUVA 1AJOA 3OGGA 3C3VA 1WW4A 1RUG1 5F6KA 4YW4A 2JKBA 1D4M3 3SMHA 1AR61 2ZAHA 3VKNA 1SBFA 3VBRC 3O14A 3SISA 1PK6A 4M3CB 4DFSA 2ZGUA 3VBOC 4MGIE 2IC1A 1PGW1 2WWSA 4DB5A 2C0ZA 2DVBA 1TMF2 1QH6A 4FVVA 3FHIB 3B9CA 3VZOA 1ULGA 4XFFA 1HLCA 4K21A 4AI2A 5C8CC 2YGMA 4MXVA 3FLPA 4E4SA 4Q1RA 1JYCA 3BU7A 4NR1A 2E51A 3ES4A 1RUG3 5EXOA 3RYPA 3OY8A 4N43A 4GMP0 5J7MA 1OHFA 4LR4A 2LUWA 1G9AA 3HN1A 1PGL1 1H8TC 2CTVA 2ZX4A 4AEKA 4FAHA 1QDCA 4HN1A 4AEDB 3B94A 4C1WA 3O12A 1NOVA 1SEFA 1QNYA 3N7KA 3RYRA 1CAWA 1W2UA 1IPKA 4Q4V1 4YM1A 4LLFA 2FMYA 2RS12 1JYIA 2XL7A 2DCZA 3A4UA 2WL1A 2ZGLA 1RIRA 3ZXEA 1UIJA 3AZXA 4XBNA 4IEXA 1CPNA 5J48A 4Q4X1 1RUI1 4LBQB 1UKRA 1GR3A 1UL9A 3ZIXA 3AP7A 1HV1A 3AKRA 3SCHA 4W6XA 3WR0A 4IV3A 1CPMA 5EYXA 1S0CA 2Q1ZB 2OA2A 1GBGA 4AVCA 2EIGA 1ZBA1 4Q4V3 4QM8A 1XNKA 1PGSA 2D3PA 5BNNA 5KHHA 2X53S 1VBA1 4P9LA 5CAZA 2JXAA 5I8TA 3ZFFC 2DTYA 4Q4X3 1RUI3 3SXWA 1NLSA 4LUMA 4QX5A 1UD1A 3MLJA 5FBZA 3ZYJB 2UYBA 3R05A 3V56A 2C1FA 1LTEA 4XJAA 1S0GA 3WHTA 3OBTA 3D8CA 3IBMA 5KXCA 3DL3A 3GBFA 3R4DB 4MVTA 5D1IA 3AX4A 1QH7A 1R1ZA 1LESA 1PVC1 2JDZA 3U07A 3WP5A 2NMOA 1LGNA 1AR92 4BLJA 1OPOA 5GZEA 2PELA 2VECA 4C0BA 1XE7A 5KXBA 2BNMA 1V6OA 4Q4W3 4YFZA 3PHMA 2D6LX 2JENA 1GZWB 2QZ2A 4P9IA 3ALQA 4G4FA 1MS8A 2R042 2PLV2 4N53C 4OZXA 4XF0A 5GLUA 2CY6A 3K48A 4XQDA 2YYOA 4AE2A 2RE9A 1LOGA 4EN0A 2D93A 1VBB1 2P17A 3ZYGA 1O3RA 2DYCA 2A6XA 4IEQA 2HWD1 4AI0A 2DVDA 2C9AA 1KS4A 4A7YA 2JD4A 2K0GA 4JAAA 5DG1A 2ZHLA 2GMMA 2D6PA 2R071 2ATFA 1AR72 2V73A 2WFF1 2BVBA 3AYCA 4RGAA 3WQ0A 1HRI2 4XW3A 3OY8B 4N43B 4M3CE 5DG2A 3WZ1A 1WBFA 4FPOB 4L8QA 2BFUL 1TEIA 1D4VB 1EPWA 5T5LA 4EN7B 4ZU7A 1VBB3 5GLZA 5JOZA 4FTBA 5KHIA 1RMU2 2Y26A 4K3UA 2HWD3 4CEYA 1AHSA 3WDXA 1NA1A 2XWJB 1ALYA 4LBNA 2R49A 1OOPC 3RWNA 2CGOA 2D5FA 3IN9A 1M4WA 4XHXA 1FT9A 1MQTC 4NWWA 1CAWB 2DCYA 3NV4A 2QE3A 2GALA 4WM8B 5H9QA 1QJU1 3H8UA 4H3WA 1GYKA 4OFGA 2R073 1KQRA 1S1AA 5DZEA 4AFDA 3L9JT 5HCFA 3AYAA 3KMHA 4K40A 4JGYA 5GLVA 3RYKA 2A3XA 2UURA 4LBOA 3NV1A 1C8M3 4XTMA 4KG0A 1QGLA 2RMU1 3AM2A 1H2MA 1Q8VA 3ZSLA 3M3EA 1C1LA 4IV3B 1H1MA 3KLSA 1AZDA 2NZ9A 4XFBA 1B35C 2IXLA 4FQZA 3ZN4A 1BVVA 3B7MA 5BNNB 3NKTA 5BNPA 1J3PA 1IS3A 1MZEA 2VG9A 4AQ6A 1XNCA 4QPIA 5E16A 1AVBA 4I01A 4FTEA 2TNFA 3ZN6A 3J8F3 4OHWA 1UU6A 5FRAA 2RMU3 3ELNA 4JCKA 1VP6A 4YFWA 4K1ZA 2W08A 4LBQD 3N36A 3AFKA 3JD73 4YG3A 5F9TA 5JIUA 3PVOA 1O5LA 1SDWA 4B29A 1OLQA 1C5IA 1G9DA 2YUEA 1AL21 3GZTB 1ZBA2 2CNAA 1ZRDA 1L3JA 1NQDA 4XQWA 3JCIA 1RJ8A 3PLQA 4WVMA 1CX4A 1V6KA 5L36A 4PDWA 2WZR1 3RMYA 3WDTA 2XJVA 5KHGA 3TN93 1DZTA 1AXZA 1TNFA 1X33A 2R061 1XYPA 1QOSA 3D4KA 1OKQA 2CAUA 2D97A 4LNVA 2OUHA 2WNVA 3HT2A 1RUJ2 2QDNA 4RHV1 5ACA3 2YXSA 4P9GA 1H2LA 2XVGA 4I0BA 1ND2A 1ZBE3 2PAMA 1LOBA 1SFNA 1Q8QA 1SFYA 4Y1ZA 3ZMOA 5FQ0A 1RUF1 2XPJA 5LRSA 3D5OA 1UX6A 3EQEA 4IEPA 2WZR3 5F5QA 1W6MA 2DF7A 3H50A 1OPMA 2R063 4LBJA 4EV0A 4HT1T 3VHRA 4HKLA 1I1EA 3TNPB 1O3QA 4Q4Y2 3ZFEA 1Z7S1 1YUDA 2O1QA 4CEYB 1NA1B 5JCTA 3WW3A 3JBG1 3WG2A 2PHLA 2VMHA 4GQ7A 5HI0A 1SLBA 2VXRA 2ET7A 1JUHA 2PHDA 2Y0IA 3HQXA 1COV2 4RD7A 2ZBJA 2B7YA 4R4XA 2E63A 1C5HA 4PBOA 3LB9A 1MEC3 3NAPB 4D7YA 1X7NA 2HWF2 5JSOA 2IXHA 1FX5A 5D8AC 2JEMA 1JHNA 1XU2A 2GMEA 2WQZC 2G9FA 5J09A 1VBE2 4B4PA 5SV8A 4JRAA 2FZ1A 2BGCA 5CB7A 5I8SA 3WDWA 2ZACA 4IESA 3W58A 3JBG3 2B5HA 2JG9B 4LA2A 5C8CA 3PVBB 2BQPA 3SITA 2G4IA 5BPXA 4XJWA 1R1A2 5CADA 2B9UA 3N7MA 1Q3EA 4XJUA 4R4ZA 3VGIA 5BNPB 1MS5A 1OSGA 4QPIB 1MS9A 2VNRA 1RUH3 1AR82 1V6MA 1AYN3 2D6OX 2IFRA 5AVPA 3AMQA 2Q30A 3VHOA 2HWB3 4IV1C 4CDXB 1R091 2OPKA 5FTTC 5T3NA 4FCAA 4AI3A 3BB6A 3MW2A 1S0DA 4E4ZA 4G9SB 1O91A 1ZVFA 1QXPA 2OYZA 1VRH1 1RVF2 1HXS2 3E5XA 2BEOA 4YGDA 2CYFA 2WS91 3B93A 3EJKA 1H8VA 1QU0A 4UBHA 3VZJA 1QJY2 5T54A 2RR13 4WVMB 4UW5A 2B42B 3SH5A 1QJX2 2ILMA 3LSDA 4CDWB 4PDWB 1FMD3 2IXJA 2V5YA 5FFOC 4XFHA 3PTYA 3M3QA 4R9BA 1HIXA 3TBDA 4I0AA 4XXAA 1BVP1 4P9JA 1LEDA 3E5UA 4PLMA 3DV8A 1C28A 1KS5A 1VRH3 2WNVB 5A32A 4AGGA 1DYPA 3OJBA 2WS93 3A0NA 4CEWC 1WW7A 4FPGA 5GLWA 1Y3TA 1WCSA 2WT0A 3ZFFA 4YZ5A 1J1LA 1PIV2 2PTMA 5JAXA 2RS33 4HN0A 5IK8A 1Y7BA 3WXPA 2BBVA 2PA7A 4OI1A 1QQP3 1NY71 1VBD3 2D3RA 1X36A 3AJZA 2WT2A 2XJSA 4EJRA 1O4YA 4ONUA 3VKFC 2UWBA 1AXKA 4DINB 5BNQA 1AYM1 1X8EA 2HWC2 1BBT2 4C90A 2GN7A 1WGPA 1FPN3 3LOIA 1W6NA 2D6MA 3AKQA 1AJKA 4QPGC 2FHRA 3OYWA 2XHKA 3ZFEB 3AB0A 4RQPC 3MIGA 1M06G 4RHV2 4LTAA 4XXPA 3SH4A 5AC93 3LA3A 1NE6A 3KS7A 3SLIA 1MS3A 1CVNA 2VULA 2QKDA 3H3ZA 4LHNA 3W9AA 3VZKA 3HBZA 1YIPA 3ZYPA 4E2GA 4FPEA 1FAYA 1YYNA 2NP0A 1VAMA 3QD6A 3M4FA 3CLPA 4PCRA 3VBOB 4LE4A 4EN6B 2OZJA 1OQEA 5T50A 1RUD1 4FP2A 4HKWA 1S0IA 3LA2A 2K2SA 3URFA 1Z7S2 1GICA 3I8TA 5JLVA 4ISRA 4LUKA 5C8CB 1EV11 3H7JA 2MEV1 5ABJC 2LALA 2ZMKA 1VLNA 4IEVA 4WM7C 3SHRA 4E2QA 2A7AA 2ZHKA 3E6BA 4B7EA 1UAIA 5F6LB 4AEDA 3FZ3A 1IZ3A 4FOWA 3LOBA 1WD4A 5K8SA 4ES9A 4EWAA 1Q8OA 5IK7A 3FC0A 4K8FA 5I93A 2JG8C 2ZPXA 4E27A 4GKYA 4ITCA 1H8TB 3IIAA 4QXKA 4YGEA 2ZGMA 2RS51 5I91A 1RUD3 2MNGA 1UPSA 3KD4A 2OZ6A 2IZWA 3ZX7A 3NO8A 1BEV1 5C8WA 2DU1A 4MV2A 5JOXA 3H1MA 1DGRA 1MQTA 2QVSB 1SBEA 1VB2A 1EV13 3B69A 2MEV3 1VB4A 4L97A 4Y26A 1NCQC 2SBAA 2HJIA 1RUE1 3BALA 2RM22 2YGLA 3ZIWA 1VBC2 4MGYE 2D7FA 2ZOEB 4FT8A 4Q8KA 1SCSA 5FCCA 1LU2A 4FO9A 2ZX2A 2XGXA 3M1HA 3N7JA 3RI9A 3RJRA 2RS53 4XILA 1HRV2 5E88A 4DZGA 3NV3A 1BEV3 2DVGA 4JDMA 4JDOA 4CDUC 4AVAA 3NVCA 2AENA 3GZUC 2ZMLA 4ZKTB 2BTVC 1GV9A 1SLIA 3NWKA 4K6BA 4I02A 1CIWA 1RUE3 4ORFA 1H4HA 1D4M1 3WW2A 3ZFFB 1GANA 2EXJA 4AXOA 5IUQA 3ETQA 1CR7A 3WT3A 1N1SA 1RITA 4IEOA 5L73A 1W6OA 2R6QA 4COWA 1CJDA 1UCXA 3MFCA 2H6CA 3B02A 2CV6A 5CG9A 1LHUA 1T6GC 3ZXFA 1EAH2 2A70A 3USUA 3EBRA 4UBGA 1OQDA 4XEZA 3T2TA 5I0RA 1NLRA 3VBSC 3DPRC 2ZAAA 4P9YA 4RR3C 1W6NB 5GZFA 1FOD1 1PHMA 3CU7A 4Q0QA 5JI7A 1AR93 3OYWB 1RHI1 3D82A 2WKKA 1QWRA 4Q0VA 2HWE2 5KHJA 4Y5Z0 1QKQA 2GC3A 5DUWA 1ZREA 2R32A 1VJ2A 4YZ2A 5EYYA 2R30A 2R043 4FPFA 4N53B 2EALA 2HEYF 4OI2A 1DG6A 3VBUC 2PLV3 4RL7A 2DUQA 3CJIC 4NHKA 4AF9A 4BZ4A 1TME2 4BLIA 1WUVA 3LWCA 1H2KA 4OUMA 1DQ2A 2QJVA 5JR7B 1DIWA 1FOD3 1KXGA 1RHI3 4DY3A 5FOJB 4BMBA 1KD7A 4JDNA 5J36A 2BFUS 4ZU4A 1LU1A 5DDJ2 2GNMA 1N3PA 4GB31 1XRUA 5FO7B 3MIEA 2P34A 3WNXA 5GKAC 2ZGNA 4E2SA 3SCGA 5CVRA 3KCYA 1ENQA 3CF6E 4AGRA 2XBO1 3O7OA 1V70A 3VBFA 1WBLA 2UWCA 3L2YA 4P9XA 1ASJ1 2E7AA 4WM8A 3U4XA 4YW5A 1RJ7A 1CAUA 1CAXA 3PJQA 4E9KA 4YZ4A 3ZFGC 5A3LA 3S30A 3RRDA 3ZO0B 1WLCA 4QQPA 5L7OC 5BYNA 4J1XA 2B39A 1MQTB 2GU9A 4OVEA 2D5HA 1PO11 4GB33 1H1IA 2P3KA 1IOAA 3WP4A 2YROA 3GNEA 4YRDA 1BJQA 3K51A 2VW1A 2WNUC 1JN2P 2ARXA 3KCCA 2DUOA 4GWMA 2XBO3 3J26N 5D8AA 4Z92B 3MEPA 1DQ1A 4A3XA 1ASJ3 1WMFA 1XU1A 4IL7A 4Q0UA 4UXAA 5LEJA 2DFCA 3AZVA 4YG0A 4D94A 4Q4W1 2OUJA 5T55A 5JIAA 3V65A 2GC1A 3Q9OA 5GM0A 1MR5A 1URXA 4YZ3A 3AKTA 1PZ7A 4QGNA 2DVFA 2R16A 1H9PA 1PO13 1B35B 4PQ9A 1BMV2 2VY0A 1REFA 1POV1 5CIRA 2HEWF 4FOQA 5I0TA 1ULDA 2W52A 2PHWA 1W6QA 4UW3A 1C3HA 1W6OB 4IV1A 4GWNA 1R081 4MGZE 1MACA 2ZGOA 1RB8G 2DU0A 4AVTA 1S0EA 5IK5A 4YNIA 3USUB 1SCRA 2QQPA 4KWLA 3MGUA 4L9BA 5EV7A 1C1FA 5EWSA 4CTEA 3LCPA 4P9WA 2ZJCA 1G9BA 1POV3 4L99A 1ENRA 2UWAA 5H9RA 1O5UA 3THTA 4RA0A 4OI4A 2QNKA 3ZSEA 4IEUA 5HCAA 4W65A 4Z07A 3E6CC 4EWDA 2R1DA 4I09A 1G9CA 2JE9A 1MVEA 1R083 1QDOA 2XKOA 1V9U2 5GALA 1I9RA 4YYOA 3WUDA 2VH9A 3HAGA 4K1YA 1IHMA 2GDFA 3WDUA 4RGGA 1WD3A 4CP0A 4Q29A 1JTZX 2ZCWA 4LBLA 1XXNA 3ZXJA 5FLJA 4CEWA 4AQSA 1VAKA 4OUSA 3D6EA 4ES8A 3ZYRA 4JRLA 3U11A 1RUG2 4Y1VA 5BXXA 5KBFA 5BNOC 2Z42A 4HL0A 1C8M1 4QGMA 1AR62 4ASMB 2FMDA 3AP6A 3VHNA 1ND3C 3IWZA 1UPIA 4AFCA 1PGW2 3RSJA 1SLTA