3M3QA

Crystal structure of agrocybe aegerita lectin aal complexed with ganglosides gm1 pentasaccharide
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
159
structure length
159
Chain Sequence
MQGVNIYNISAGTSVDLAAPVTTGDIVTFFSSALNLNAGAGNPNNTTLNLFAENGAYLLHIAFRLQENVIIFNSRQPDGPWLVEQRVSDVANQFAGIDGKAMVTVFDHGDKYQVVINEKTVIQYTKQISGLTSSLSYNATEETSIFSTVVEAVTYTGLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Anti-tumor lectin
publication title Structural insights into the recognition mechanism between an antitumor galectin AAL and the Thomsen-Friedenreich antigen
pubmed doi rcsb
source organism Agrocybe aegerita
total genus 42
structure length 159
sequence length 159
chains with identical sequence B
ec nomenclature ec 3.1.21.-:
pdb deposition date 2010-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3m3qA00
1SLCA 4PBOA 2ZABA 1S0GA 1Y7BA 3AXDA 4M3CA 4GWNA 4XZPA 1U0AA 2EXIA 5T55A 1LECA 3H0OA 3ZPYA 4Y1YA 1KRIA 1LENA 1ONAA 1W0PA 2BQPA 3W59A 2GMPA 3OY8A 3KM5A 1IS5A 4YGEA 3V65A 4YFZA 5GLVA 1BKZA 1HKDA 5KXDA 2WT1A 1LTEA 3INAA 5IT6A 5JOXA 3MW3A 1PZ9A 3WLUA 3WDXA 2ERFA 2UURA 2A5ZA 3POWA 2A7AA 5HCFA 3RS6A 1H30A 1UN1A 3NV3A 1SCSA 4Q1RA 4Y1UA 1WUVA 3N35A 3AJZA 1LHVA 4Q26A 1W6QA 1CPNA 1MZ5A 1OKQA 2EAKA 2HYKA 4FPYA 4K1YA 2CYFA 2UU8A 4FPHA 2YZ4A 3U4XA 5GJ6A 1JUIA 1LGNA 2UWAA 3WUDA 1CN1A 2A6VA 1LOAA 2JDZA 5JVVA 1LGCA 1SBEA 1ULFA 3SH5A 2ZHKA 2WLQA 1EPWA 4Y1XA 2P3IA 2ZACA 1VAVA 4FPGA 2ENRA 5JMCA 1YO8A 1ULDA 2CTVA 4Q8LA 1X50A 3N7JA 3T1LA 2SLIA 3DGTA 1MZ6A 4XYXA 2E7QA 4ZKTB 4YG0A 3R4UA 3NWKA 3GNEA 2JD4A 3ILRA 1DLLA 4YM1A 2W39A 1ENQA 3AYEA 2VH9A 5T50A 4FQZA 2VXRA 2AH2A 4YG6A 1F31A 1JOJA 4DS0A 2DURA 3WVJA 4FPKA 1MS0A 1JYCA 1A3KA 4AGVA 1JXNA 1Q8SA 4F83A 1PZ8A 4GKYA 1DQ1A 1LULA 2E7TA 4K20A 4YZ4A 1IS4A 1RITA 1GYKA 1AJOA 2A75A 2PHTA 1W6NA 1SBFA 2OUJA 4YM2A 4BOWA 2VW0A 2EALA 4GALA 4PBPA 1LESA 2I2SA 2SBAA 2A3XA 3OYWA 5IK4A 1UL9A 3FLPA 4Y26A 5T5OA 3JUUA 2D6OX 2ARXA 2ZAAA 4UW4A 3ZXEA 5LK5A 2ZMKA 3M2MA 1LHNA 1QGLA 3RG0A 2P2KA 5EXOA 1DQ6A 3FUOA 1WD3A 1BJQA 3WUCA 4FPLA 2R0FA 1V6OA 2OW4A 2VUAA 1S0EA 1GKBA 4FP3A 3OJBA 1DYKA 1R1ZA 4JCKA 1AX1A 2FHRA 4FP2A 4XE9A 3WCSA 3IMNA 4ITCA 3WNXA 3USUA 2DVBA 1ZM1A 3VKNA 3VKFC 1HQWA 1VAMA 3I4IA 1AXZA 3AZWA 3ZXLA 4LBNA 5CA6A 5EYYA 2NN8A 5T54A 4BPZA 4UW6A 1PZ7A 2GNTA 5GZDA 1NLSA 5GALA 5GZEA 4LBKA 3O0VA 2CNAA 4AGGA 4R9DA 4LBOA 2ZGMA 1V6IA 3PMEA 2JECA 2D6PA 4I30A 1DZQA 3R05A 1LJ7A 4XOGA 1KITA 1FYUA 1GSLA 4ZXKA 1LOEA 1AXYA 1LOCA 3PVEA 2EIGA 4YW1A 3WDUA 1FX5A 1SLTA 2ZKNA 3MW2A 1QKQA 2DTYA 4XIKA 2W68A 1J1TA 4AWDA 1GZWB 1F5FA 1SLAA 4BQ1A 1BZWA 1GICA 1XQNA 2WT0A 2NM1A 2ZGRA 2YXSA 4UW5A 3RRDA 2VW1A 1D0HA 3SH3A 2ZHNA 1AVBA 4R9AA 5DUXA 1G9DA 1BQPA 3JU9A 1SCRA 1Z0HA 4R9BA 3AXEA 2Q5TA 3LCPA 4UW3A 2NZ9A 5DXDA 1IS6A 1GANA 1NXD1 2V73A 5F5QA 1N1TA 3ILFA 1UX6A 2C9AA 3HMYA 1VLNA 1JBCA 1MS5A 3B01A 3M3QA 4M01A 1H9PA 3UL2A 2ZA9A 1LGBA 2DVGA 3D4KA 5HCAA 1QDOA 5H9PA 1ULCA 2YY1A 4WZFA 5GZGA 4U36A 4FOQA 1FNYA 5T5PA 2C5DA 2LTNA 2VU9A 1DBNA 3A0KA 1AX0A 3AX4A 4AVSA 5E88A 4XHBA 4XTMA 4BMEA 4M3CB 1QNWA 3AYCA 4XTPA 1MVEA 3ILNA 4K21A 3O0WA 3AP6A 2PHFA 2WKKA 1Q8QA 1WBLA 4YFWA 3ENRA 1S1AA 2DVDA 3OY8B 1V6KA 1VIWB 1LCLA 2VW2A 3WDYA 2GNMA 2WJSA 5JOYA 5KXCA 4GA9A 3MW4A 4YGDA 3B9CA 4DQAA 3VUOA 3M3CA 1IKQA 1MS8A 4HANA 3RMXA 5JOWA 2EXJA 2ZMLA 2AREA 1D2SA 2A3YA 2GALA 3FUQA 1N3QA 4M3CF 4Q8KA 1HQLA 4WVWA 1ENSA 4YGCA 3HN1A 1YYNA 4JRAA 1W6MA 2GN7A 1W6QB 2RHPA 5IK7A 4XILA 2GNDA 1LHOA 2D7FA 1G86A 1W6OA 4YW2A 1N1SA 2NMNA 4DPNA 1FV3A 1URXA 5GM0A 1SACA 1ULEA 2D3PA 3RQ0A 5IK8A 1UPSA 1GLHA 1UAIA 4YW3A 3WHUA 2E51A 5FRAA 1G9CA 4YW4A 5GLUA 2ZZJA 1OFSA 1SLLA 4BLJA 3IPVA 1IKPA 1APNA 3WOGA 4Y22A 1HLCA 1WW7A 3FBYA 5GLTA 2DVAA 1FATA 1FAYA 2DU1A 3AP4A 3AYDA 5L73A 4YZ1A 4RA0A 1CONA 2CWSA 3WDTA 3ZSJA 4XBQA 4W65A 3QLQA 2DVFA 5DZGA 1RINA 3ZXKA 2ZHLA 1N3PA 3WG4A 2UWCA 3UJQA 4LBJA 1QOOA 2KM2A 3ZXJA 4L8QA 4AYUA 1Q56A 3B69A 1FNZA 1BYHA 1GV9A 3LSDA 3I8TA 1WBFA 3N7MA 3LSEA 2NMOA 5EYXA 1W6NB 1DGLA 1Q8PA 4XMAA 5JOZA 2YROA 1O4YA 1QU0A 1LEMA 5JDBA 1S0CA 3T1MA 3OYWB 4R9CA 4U2AA 1AJKA 1SLBA 2W08A 4FOWA 2PHUA 1QDCA 3AP9A 4YM3A 3FLTA 3V0AA 2DWRA 4ISQA 2P3JA 2TEPA 4NO4A 1G7YA 3WZ1A 2A71A 1CJPA 1GBGA 3SITA 4AVTA 2Z42A 4FPFA 4BMBA 3BODA 1MVQA 3AZYA 1LOFA 3NV2A 4GXLA 1C4RA 4XJZA 1V00A 4MYEA 4DRVA 1LOFC 2PELA 3ZVXA 1TEIA 1QMJA 1N47A 1V6LA 4JC1A 3USUB 1G9BA 2ZBJA 1YIFA 4P14A 5DZFA 1YRZA 3FFZA 1CPMA 1MS4A 3RSJA 4OZXA 4Y20A 3SNMA 1I3HA 2DV9A 5AVAA 1KJLA 3V0BA 1DQ2A 3TB0A 4BLIA 2A6ZA 4XHXA 1DQ5A 5E8AA 5KXEA 4FOVA 1UZYA 5CNAA 2ZGNA 3UJOA 1JYIA 4LBQD 3SLIA 3AK0A 2ZGQA 2JJ6A 5GLWA 3VKOA 2W52A 1GZ9A 2R16A 2ZGOA 3VV1A 1I1EA 4XBNA 3BIWE 3BTAA 3T2TA 3WG3A 4PF5A 3IN9A 1OQ1A 2EF6A 2PHXA 1G8WA 4M3CE 1MR5A 3IM0A 4HL0A 1QOTA 1JW6A 3O5SA 1A78A 4Y1ZA 2V5YA 1AF9A 2R1BA 2D44A 1C1LA 1UKGA 5DUWA 1W6PA 4FPCA 4P9WA 4PCRA 2AR6A 4LBQA 4YM0A 2CWMA 3ATGA 3NV1A 4YW5A 1QNYA 1IS3A 5IUQA 1KJRA 3WV6A 3PJQA 1RIRA 4Z8BA 4WVVA 1WCSA 1YI7A 1Z78A 3ZSLA 3L2YA 4Y24A 2A3WA 5T52A 1MS3A 1Q8VA 4PQ9A 4DFSA 1SFYA 1WLCA 3ZSKA 4AGRA 2A6WA 4K1ZA 2ZGUA 3DUIA 2XB6C 2D3RA 5DZEA 3VKLA 4P9YA 3B3QE 1GZCA 4NOTA 1S0JA 4Q2FA 1WW5A 1QOSA 2NP0A 4FQ4A 4ATEA 2JE9A 4ATFA 1V6NA 3N7LA 4P9XA 5EWSA 2JE7A 1DYPA 5GZFA 3VKMA 3POSA 2E6VA 1ULGA 4Q27A 2ZGKA 2D6MA 1KDKA 1W6MB 2GN3A 2P37A 4LBMA 2ZGPA 1DQ0A 4KBBA 4XJUA 5DG1A 5DUVA 4XIOA 2EXKA 1W6OB 3OBRA 3APBA 5H9QA 4XJWA 4CRQA 3KQRA 3OGGA 5CAZA 2D6NA 4ISRA 3W58A 5GZCA 4YZ3A 1G9FA 4XXPA 4CZSA 1DFQA 4FOYA 4XJ9A 3IPVB 2NYYA 2DUQA 2OUHA 5F9TA 2ZHMA 4Y22B 1SLIA 5E89A 2G4IA 2D43A 2YMZA 1S0IA 4M00A 4XMIA 3SH4A 2WNEA 2LALA 3PVNA 1W0OA 2DUOA 3PVOA 1UZZA 3MPPG 4WV8A 4BM8A 4SLIA 3RMYA 1DIWA 1GNZA 3OPZA 1CIWA 3O12A 3WHTA 3ZXFA 5H9RA 4YGBA 5T5LA 4FPJA 2ARBA 3GALA 4YZ5A 4DRRA 1KQRA 3V64A 1CVNA 1F9KA 4YZ2A 3IKWA 1S0FA 1CQ9A 1WLDA 3WG2A 1S0BA 3CNAA 1BXHA 1LOGA 3AZVA 2D6KA 3SISA 3D5OA 1LHWA 1WLWA 2WSVA 4TZDA 3TAYA 1VALA 2PHRA 4Q1PA 4YLZA 5GLZA 5T5JA 4XXAA 3N36A 3Q9OA 3R4SA 2XG3A 5CBLA 1WW4A 1MS9A 3ZYRA 4C1WA 1IOAA 3V0AB 4RL7A 2YV8A 1JN2P 2DU0A 3D6EA 1G9AA 3AP5A 2DYCA 4TYSA 4Y1VA 1GNHA 4ASMB 2GMEA 2DTWA 5KXBA 2ZGSA 2E53A 3A4UA 1C57A 1LU2A 3C2UA 3QCWA 4XJAA 1A8DA 1MS1A 1SBDA 3AZZA 1DQ4A 4XJ8A 1LOBA 3AP7A 1AX2A 1ENRA 1KDMA 1B09A 2ZMNA 2AENA 1YXWA 3WDWA 3WG1A 1CESA 1AXKA 1N1YA 3M1HA 1DHKB 2AGSA 2PHWA 3HR9A 3MEPA 2DUPA 2A6YA 4Y20B 2B7YA 2ZGLA 1LEDA 3N7KA 3V0BB 1WW6A 2D6LX 2FMDA 2WQZC 1CR7A 4FVVA 1O4ZA 2P34A 5BYNA 2CL2A 1UMZA 1V6MA 4GKXA 4H55A 4XBLA 3ZYPA 4FPEA 5JLVA 3O0XA 2OVUA 3AJYA 5SV8A 2H0BA 3OBTA 2GMMA 2EXHA 1MACA 1N1VA 5H9SA 1LU1A 3FLRA 4D69A 5DUUA 1S0DA 1H9WA 2UWBA 1WD4A 2D3SA 1V6JA 3BOPA 2WT2A 3UK9A 5IK5A 3M3EA 1GZWA 5DG2A 2AYHA 2ZGTA 1C1FA 1Q8OA 2CY6A 2VY0A 2JKBA 3AZXA 4FPOB 4IQPA 1FV2A 2R49A 3A0NA 3AFKA 1AZDA 5HCBA 2R0HA 4C1XA 1LODA 1QF3A 4XDQA 3WDVA 4GWMA 2R1DA 2A6XA 1W6PB 1LHUA 2WSUA 2GNBA 4LBLA 3WCRA 3N3HA 1JHNA 4LBQB 2AUYA 1N3OA 1ZA4A 2P3KA 4AVVA 3ASIA 5FREA 2A70A 5CB7A 4CTEA 3ZSMA 3M3OA 3POYA 3AYAA 3B00A 3NV4A 4YG3A 2GDFA 1HDKA 2ES3A
chains in the Genus database with same CATH superfamily
1BVVA 3AXDA 4YVSA 1LECA 3ZPYA 3PTRB 3ZSEA 4F3JA 5FY7A 3OB8A 3E5UA 3W59A 2GC0A 4AEDA 1IS5A 1RHI1 1RVF1 4YGEA 4D7YA 2J1TA 3B02A 4YVWA 1FOD1 1NLQA 3K46A 5IT6A 3LFMA 1NQJA 1V0AA 3ZKYA 3WDXA 3MI8A 2RS33 2UURA 4RGKA 2CV6A 4LT5A 5CFDC 5A3NA 1V70A 1VBC1 1HRV2 4O7XA 1FPN1 2E31A 2VO5A 5DAXA 2PMWB 5DQ0A 3NV3A 2WLPA 4LE3A 4YNIA 1WUVA 2Y6FA 4KQ7A 3TBDA 5L7OC 2QQMA 4FPYA 2HYKA 4K1YA 5A3MA 1NG0A 1X9TA 4L9BA 5F5AA 1H6XA 2EIBA 3POBA 2P3YA 5GJ6A 3U37A 5JWPA 4UWDA 2JDZA 2J22A 3W9AA 1TVGA 1NQDA 4JGYB 5FY1A 4HFSA 1UCXA 2MEV1 5CYYA 1EPWA 3KCYA 4IV1C 2P6CA 2ZACA 5JMCA 1ULDA 3AMHA 4B1LA 3P3PA 4HMZA 3DGTA 4JZRA 5BNNC 5EIYB 1MEC3 2BOJA 1NZIA 2BYVE 3T4HB 1VBA1 4BQ4A 1LNSA 4EZHA 4Z07A 1QJEA 2E63A 1R64A 4CEYC 2Y0OA 3OPWA 1PIV3 2FZ2A 2VH9A 3RI9A 1J58A 5I8SA 3S30A 2AH2A 4CXXA 4PT6A 3GCWA 4Y5Z0 1F31A 1NY72 1YFXA 2FDIA 1RJ7A 1AUYA 2BJSA 2WNVA 3EJKA 4KWLA 5FP9A 2WC2A 5FZMA 3THTA 2Q1MA 4LULA 3ZFEC 1JYCA 5CFCB 3H8OA 5FMBA 1XPWA 3DL3A 4KWUA 4GJZA 2RS31 4EROA 1QY4A 3OGJA 4GKYA 1DQ1A 4QB2A 3VL8A 4BISA 4JDMA 1XYOA 2VUJA 4K20A 1IS4A 4PI0A 2A75A 3M8LA 5FOJB 2PLV3 4YM2A 1LRHA 1MEC2 2VZTA 3KVAA 2WAOA 3ZX7A 2KR2A 3J4UH 1FMD3 1UL9A 3QACA 2YUEA 5T5OA 3L9JT 3MLKA 1H8TC 2ARXA 2BNOA 2ZAAA 2Y6JA 4L11A 4UW4A 4YWAA 4NIDA 1MQTB 3S6PA 1D4M3 1LHNA 3PUHA 3AKSA 5FXXA 2J7MA 5EXOA 3RYRA 3WF2A 3FUOA 1WD3A 1KS5A 4LIUA 3TYJA 1RUJ3 1VBE3 3WF3A 2R0FA 3ZN5A 2OW4A 3CJIA 3O1PA 1S0EA 2XLFA 2PYTA 2JDYA 3OJBA 1DYKA 1C8M3 4JCKA 1AX1A 3PHMA 4FP2A 1W9SA 5FY9A 4AI0A 1POQA 2X5IB 3IMNA 1PIV1 3WNXA 4Y4RA 2HWB3 4HG6B 2Y6GA 2QQWA 5FZEA 1J59A 2FDJA 1D4M2 2BNMA 1WWYA 4BPZA 3CEWA 4A3ZA 3KV6A 2W95A 1AL23 4B29A 1H4GA 4ONUA 3C7OA 5ABJC 1YC61 3HD8B 3T09A 4LBKA 3K75B 4M4PA 5IW0A 4R9DA 4IV3B 3UKVA 4AGGA 1W2NA 1OD5A 2ZGMA 1BK0A 5BUVA 1C8M2 2OYZA 4NE9A 2JECA 2WRAA 2ZX1A 3MDPA 3I2HA 2B5HA 4MADA 4R4XA 3H3LA 3ECQA 4W6XA 4AVCA 1W8FA 4LOTA 4ZXKA 1LOEA 4DB5A 5LY1A 1H1AA 4NAOA 4ZZ8A 1XSQA 1QKQA 4XIKA 4CDXC 1NCRA 4QWNA 4XUTA 1TNRA 2JG8B 4HK9A 3RRDA 3SH5A 1YFUA 2YXSA 3SH3A 1AR63 4AI2A 1VBE1 4W6YA 5DUXA 1AL22 1OLMA 2Z79A 4E4HA 3FHQA 2RG4A 4UFKA 2NZ9A 3LDRA 3JB4C 2NLRA 3DV8A 1N1TA 3ILFA 1WCQA 1UX6A 1REDA 3LE0A 1ASJ3 4Y5SA 1H9PA 4A41A 2ZA9A 4PQQA 3D4KA 5FY8A 2HWB1 3ACHA 5IVBA 2XXZA 1ULCA 3KF5A 5IFPA 5FPVA 4PHZA 1VBD3 1W9WA 3VHOA 3A0KA 1AX0A 1CAWA 1RUI1 3AX4A 2YFUA 4KBZA 1QH6A 4LQRA 4EWEA 4YARA 4EN9B 5C3OA 4AFAA 3OUHA 4EQVA 3P3NA 4IE5A 4JGZC 2VTFA 2HBUA 3VBHA 2Q8CA 2XBO3 5K4LA 2XLAA 1JZ8A 2YC0A 1HJGA 4YFWA 3TNPB 3ENRA 1COV2 3VHPA 1GOHA 1VB4A 1RUG2 4GIQA 2PN5A 5D8AC 3RVHA 2JDAA 4OI4A 4YGDA 5CKMA 3B9CA 2JDMA 2J1RA 3M3CA 5FPAA 5FZCA 5J36A 2K0GA 1MS8A 1XYPA 1CAVB 4HANA 3RMXA 2EXJA 2ZMLA 5FZOB 3ZFGB 5K0UB 2A3YA 2WWUA 2VE1A 2GALA 3RZLA 1HQLA 1B35C 5JPNB 4W50A 4A44A 3RZJA 3HN1A 1YYNA 4AXOA 1AR61 3IWZA 2RHPA 5DDJ3 4XILA 4HVOA 2D7FA 1K5JA 2VMGA 2RR13 1FV3A 4RFRB 4WM7B 3VBFA 1YLLA 4A3XA 1QJX2 3M70A 1GLHA 1UAIA 3DN7A 4HXCA 2B4KA 2DF7A 4PJYA 4UFHA 5EHDA 5F3GA 4RR3C 1OUXA 2RS13 2JXAA 5GLUA 1H2LA 1GWKA 5CIRA 1LR5A 3BPSA 1PO23 1UPIA 2AEZA 3IBMA 4NHXA 1APNA 1VBB3 3HNBM 5FP8A 4Y22A 3WOGA 1KXGA 1WW7A 5C4WB 5GLTA 1JZ2A 1O91A 1X8EA 4DXZA 2DVAA 1Z7S2 1FAYA 2D5HA 5L73A 4RA0A 1O5UA 1W8NA 3OUIA 3WDTA 3ZSJA 2ZEXA 1ZX5A 2XL7A 2IVJA 4W65A 2DVFA 1WCUA 4XVHA 2X8KA 3N4MA 5LBFA 2RR12 3ZXKA 4KU8A 1N3PA 3WG4A 5FYMA 3UJQA 4XACA 1YQ5A 2JG9C 4IGQA 4UOJA 2RDNA 4PI2A 2CSGA 1Q56A 5F37A 2RS12 1ZZBA 1BYHA 4JKLA 1GV9A 1F35A 4HKWA 1OFNA 3LSDA 4CCLA 2WQ4A 4QXBA 2O14A 3C7FA 3N7MA 5C8CC 4KL1A 1YI9A 2B8MA 1W6NB 2VVFA 2VNOA 2WIIB 5DDJ1 5FZ1A 3MF9A 4P02B 3HOBA 1HXS2 4R9CA 4JTOA 1AJKA 3O1SA 1SLBA 1GNYA 3BVCA 3UGHA 1GUIA 4L99A 3VBOB 1GR3A 4DINB 4NO4A 3MF6A 3SCGA 1GP4A 1QXRA 5IAVA 3PURA 1PO21 1GBGA 1W28A 2PXJA 2Z42A 4FPFA 1HN0A 5FXVA 1A8MA 3LIHA 1NCQB 3N9PA 4DRVA 5FWJA 5KHHA 4QPGC 4Y3OA 3E6BA 2DCZA 5FZLA 1QMJA 2BVVA 3HT1A 4JC1A 4YYOA 1JYTA 3USUB 4XF4A 2ZBJA 4EV0A 4P14A 1OOPA 3LEKA 4OZXA 4Y20A 2DV9A 3AB0A 1S2KA 1KJLA 2VPVA 4OHZA 1DQ2A 2PA7A 1UU6A 2A6ZA 4MHUA 2W3JA 1U12A 2QZ3A 3LZZA 1SMVA 4I0WB 4Q4Y2 5E8AA 3W20A 3BI3A 4LBQD 3VLBB 3AK0A 2ZGQA 2W52A 4MZUA 3AMMA 2FDHA 1U5XA 5FQ0B 4CVUA 4E2GA 4TTGA 3HNYM 4N9IA 1ZREA 3IN9A 4QX8A 2EF6A 2PHXA 3GBWA 1G8WA 3OGVA 3BYWA 4PLNA 5A6XA 1E5RA 1ZRDA 1QOTA 2HWF2 3JBG3 3ZM8A 3KHCA 3ZYBA 3NKGA 4CU6A 3O5SA 4WM8A 3AM2A 4NR1A 3K2OA 4Y1ZA 1AF9A 2QUOA 1OLQA 1UOBA 2D44A 1C1LA 4MLOA 4G4FA 5DUWA 3ZXGA 4P9WA 4PCRA 4K9SA 4XUQA 2AR6A 3T2OA 2CWMA 3ATGA 1QNYA 5IUQA 4RQPB 5M0TA 3GJBA 4WVVA 1WCSA 4QKBA 1PK6B 1IGOA 5J96B 2PFWA 3S0MA 2A3WA 4GMP0 1MS3A 1Q8VA 1CIYA 3TOJA 2RMU2 3AVRA 3WSOA 3KCXA 1R091 3I2KA 5FZAA 2W1UA 4E8DA 4OZOA 2D3RA 3POFA 2J1SA 2VZUA 1TG7A 2WZ8A 1UY4A 2HEYF 2JDHA 4E9KA 1S0JA 2RV9A 2Q4SA 1ALYA 1CAXB 4CCJA 2NP0A 3PU3A 4FQ4A 1VMFA 2JE9A 4IGPA 1L3JA 1QIQA 2MHFA 3NNFA 3NNGA 5EWSA 3N7LA 1PVC3 3I59A 2JE7A 5FP3A 1CJDA 1XU1A 4CCEA 1DYPA 5GZFA 3ZFFC 5CFDA 2E6VA 3JBG1 1ULGA 4Q27A 1UKRA 4PDWB 4D7SA 2HH9A 1PNGA 4ZY9A 1KFXL 1KDKA 5L7OA 1DQ0A 4XJUA 4QM9A 5DG1A 5J98B 4XIOA 3USSA 1DCSA 3VGIA 4TLGA 3HQRA 3APBA 2Q1FA 2ADDA 4JQRA 1JOPA 3EHKA 1JZ7A 3WP4A 5CAZA 3HQUA 5LY2A 4LBJA 4BH9A 2D6NA 3MBWA 4ISRA 1UOFA 1K42A 3W58A 5GZCA 2BERA 1G9FA 1J3QA 4IV1A 4FI9A 5FO9B 2WO2A 5CKNA 2VUDA 3IPVB 3SXWA 3O14A 2VGDA 2ZHMA 1SLIA 2YMZA 3WW2A 2WS92 4FSJA 1ZYBA 5BNNA 2WNEA 2XJSA 4GMP1 1QWRA 2WBKA 2QQPA 3QD6A 4URAA 1E5SA 1PMHX 2YBKA 3MPPG 4CEYA 1PGL2 3T08A 4BM8A 3RMYA 1DIWA 1GNZA 1ZRRA 1CIWA 3O12A 4L97A 4NHMA 5HV4A 2RVAA 4YGBA 3PIJA 3E5XA 2HWD3 3GALA 4QDSA 3ZFEA 3V64A 3TNQA 3SEPA 1F9KA 2CDOA 1S0FA 2VAUA 5JR7B 2K46A 1S2EA 3AZVA 3POIA 3RYKA 1H0BA 2D6KA 1JUHA 5IJRA 1ULOA 3AKTA 4HVQA 1Y9QA 4ZU7A 4CDWB 1WMEA 1PO13 4KGGA 3TAYA 4Q1PA 4YLZA 4MXVA 3ZR6A 4XXAA 5A7NA 3CMGA 2VVDA 1TMF3 2BVBA 1H8TA 2QTWB 2XG3A 5CBLA 4CUCA 5LEKA 3V0AB 2RM22 5J7MA 4H3WA 2DU0A 3JCIA 4I09A 2Z69A 3VDBA 2BUKA 4Y1VA 3IDEA 4X6RB 4XUNA 3TWIA 5KXBA 2QQNA 2ZGSA 4A7ZA 2E53A 4XJAA 3D0SA 3OSDA 1SBDA 2QVSB 4XJ8A 3RZHA 3AP7A 5FYZA 3F95A 1ENRA 5B4XA 2X5IC 4FXKB 3EBRA 4CEWC 5I0TA 1AYM2 3I3EA 4CDQC 1TMF2 4TXWA 1WGPA 1MZFA 2ZX2A 5LA2A 1OLME 1YQ8A 2XUEA 4XPVA 5F6LB 5FO7B 2HWD1 2AC1A 5FBZA 4Z92B 1GQPA 1WW6A 2D6LX 1V9U2 2D5FA 4FVVA 3VD3A 2CL2A 1UMZA 1V6MA 1QHDA 1ACCA 3B93A 5B4NA 1GWLA 4IETA 1YJKA 5SV8A 2H0BA 3OBTA 2GMMA 3FZ3A 4P9IA 1N1VA 4AI9A 4ES8A 1IPJA 2ET1A 3WINE 3MIGA 5DUUA 1S0DA 3THCA 1WD4A 3ORJA 3BOPA 1Y9MA 5A3UA 2BW8A 2AYHA 3AZXA 2CY6A 4FPOB 2JKBA 3VZMA 1FV2A 4CDXA 2WYFA 2I74A 2ZTNA 3HBZA 2JG8C 2VMEA 5HCBA 1JZ3A 1OA2A 3S7EA 4MHRA 2VZ1A 3ZXAC 4FBFA 5A3WA 2GH2A 1WA6X 3WDVA 4BQ3A 1W6PB 3CBNA 2BBAA 4LBLA 2GNBA 5A3OA 3WCRA 3RZGA 4LBQB 1AR82 3AL6A 5A7PA 2A70A 3ZIWA 1EAH2 3KD4A 3ZSMA 1VE0A 3POYA 3POJA 1PGW1 1H2NA 1XNDA 3DCQA 2IXIA 3J7NA 3VDDC 5ACA1 1RUF1 4UBHA 1UMIA 2ZABA 1S0GA 1Y7BA 1BVP1 2KXLA 4GWNA 4H2AA 5FIXA 2WINB 4Y1YA 1CZTA 1LENA 1Q3EA 5FLIA 1KRIA 5KHJA 3VN4A 3O1TA 3DEMA 4JGZA 2GMPA 3OY8A 3V65A 4AQ6A 3VBUB 3NAPB 3FE5A 3OEAA 1JH5A 2GH8A 4IEWA 1BMV2 3INAA 2K2SA 1PZ9A 2B45X 2ERFA 2A5ZA 1O8SA 2XL9A 1US2A 3VBSA 3NJYA 3RS6A 2VMCA 2IXCA 4MSVA 3RWNA 4Q1RA 2FQPA 4Q0PA 1LHVA 1PHMA 1W6QA 1CPNA 1MZ5A 1OKQA 5FYTA 2EAKA 1W8HA 4XCAA 1IPKA 1B35A 1ODMA 1TQ5A 2E33A 2QZ2A 2VOKA 3VBRC 3O1UA 3U4XA 3LEGA 5F3IA 4C91A 2UWAA 1LGNA 4YRDA 3KV5A 1CN1A 3VZLA 1LOAA 4CU7A 5A3TA 3ZMOA 3O1RA 3QBQA 5A33B 1HV1A 1RUH2 2WLQA 4CDUC 2ET7A 4Y1XA 2Y38A 5LWBA 2R30A 2Q1ZB 4W4ZA 5FYIA 3WW3A 1ENXA 2CTVA 2IXHA 4J1XA 4Q8LA 4RS5B 5JCTA 4RR3A 1Y3TA 2SLIA 2W1SA 1D0GA 3SCFA 5LBBA 2VOVA 3S5QA 2E7QA 2FBEA 4AOCA 4KMQA 3UESA 4ZKTB 3R4UA 3WNMA 4QXCA 4AEMA 2JD4A 1KFUL 2W39A 1LAJA 1VMJA 2I07B 2OXBA 2W1QA 5T50A 3ACGA 1E57A 4DS0A 2DURA 4D8MA 4FPKA 2YBSA 5IYYA 4QXHA 1A3KA 5FPLA 1Q8SA 3FJSA 2JG9A 1LULA 2E7TA 2VUCA 2XVLA 3HN3A 4OUSA 4DNYA 2XHNA 2YHJA 1RITA 1ZZ6A 1GYKA 1NKGA 2W87A 1C5HA 2J1VA 2PHTA 5JXHA 2OUJA 1JYXA 3LB9A 1HV0A 1L7LA 1TME3 1UY1A 2VW0A 5FBJA 5C8CA 3I2IA 1DU3D 3FLPA 5C9AB 3JUUA 2D6OX 2VQTA 2ORZA 3AMQA 3H7JA 4IE6A 3DPRB 3GBFA 4Q0UA 4GH4B 1R1A2 4B7EA 2ZPXA 1POV3 3VBOC 2VC9A 4OUMA 3WD5A 2FDKA 5LRRA 1SDDB 1AR72 1XE7A 3ABZA 3WUCA 4CP9B 5BNOC 1Q5OA 5CG8A 2Y6LA 2VUAA 4EZ4A 2R041 3H9AA 4FP3A 4NIAA 4LR4A 3IB3A 4QD2A 4MGQA 2FHRA 1VRH2 3NNMA 1CX4A 3WCSA 5J09A 4CPBA 4D6QA 1KGYA 2ZZQA 1ZM1A 2VMFA 4QPGA 3FFQA 3FMGA 3VKFC 3AKQA 3I4IA 2ORXA 1AXZA 1K5MC 1QJY2 1QXPA 4LBNA 2G9GA 4N53A 2NN8A 1OMIA 3H8UA 4JX0A 1OHFA 4LHNA 5EFUA 4P9LA 5FYYA 1QXJA 2V4AA 1BCXA 4UW6A 5C8WA 1PZ7A 2VCMA 2JX9A 5JZGC 1NLSA 1IHMA 3O0VA 2E9QA 2E7AA 2GZWA 1OKOA 4R4ZA 2D6PA 4NWVA 2PAEA 4D7TA 3EQEA 3LPFA 3OPTA 3R05A 4XOGA 2WO3A 2WNUC 1AXYA 3TN92 1G6NA 2EIGA 4Y5TA 3CZJA 4CCKA 4EN7B 4NIGA 3KT4A 3MW2A 1ND3B 3VHRA 2W68A 1HB4A 1CD3G 4A6OA 3ON7A 2RE9A 1SLAA 1GICA 2FCVA 4UW5A 4TN7A 3I2GA 4R9AA 3IAQA 4HN1A 1G9DA 3JU9A 2O1QA 3AXEA 2LW8A 5DXDA 1NXD1 2JE8A 1AYN2 1S4CA 2XJVA 1EYBA 4BZ4A 1KD7A 4M01A 5AC91 1JBCA 5F7UA 4MH0E 2DCKA 1RUE1 2GC1A 2WA4A 4QX1A 1UWWA 4YPJA 2C5DA 2LTNA 4P9GA 3VZJA 4KNCA 4GB32 1RMU1 4XTMA 3LEIA 4BMEA 5FCCA 1QNWA 1UXZA 3ES1A 1RVF2 4BA6A 3ZYGA 3AYCA 4Q4X2 4YVSB 3SEEA 3ILNA 1FOD2 2R071 2VOXA 4K21A 3O0WA 3TEZA 5LRSA 1RXFA 3AP6A 4V2WA 5JSOA 1G9CA 4AEDB 5FZHA 2QQVA 4A4AA 4CP0A 4YVWB 4COUA 4NVPA 3ELNA 4NRQA 4Y33A 3VUOA 5I93A 2QJVA 3KHBA 1D2SA 4AFMA 3FUQA 4R52A 3ETPA 1ENSA 2WZR2 5AFBA 2X10A 3ZFFA 3KQ4B 1W6MA 5LA0A 2WWSA 1WMXA 2ARAA 2V09A 2MEV2 3RFRA 2NMNA 4HN0A 2IC1A 3LWCA 2CGNA 1HRV1 3A23A 4QDQA 1SACA 5APAA 1Y9GA 3R6SA 1PM7A 5I91A 3IAPA 1PX4A 1STMA 4CU8A 1ZNPA 2ZZJA 5FZGA 4QPIC 4QAWA 4AFCA 1OSGA 2RS53 2YYOA 2WFF3 1FATA 2XUMA 4AVAA 4W6WA 2DU1A 4YZ1A 1CONA 4E4ZA 2WN3A 2JB4A 4HETA 4KG0A 4XBQA 2G9FA 4XUPA 3ZDVA 2J1UA 5DZGA 1ZRCA 3H1MA 4DY5A 5BY5A 4QX0A 1PGSA 1RUD3 2FZ1A 2DCTA 2KM2A 2WNVB 3CDZB 1F15A 4HPKA 1UZVA 4X6QB 4SBVA 1DF0A 2Y0IA 5FOBB 5L9RA 5F32A 3I49A 1ND2C 4O65A 2RS52 4N43C 1O5LA 2W1WA 5FUIA 4JQTA 2WFF2 4DUXA 5JXJA 1JZ4A 1Q8PA 1U5IA 3ZKUA 4ASLA 5JDBA 1S0CA 4CDWC 4U2AA 1XBFA 3MLJA 1IG0A 3QH6A 1QDCA 1ZZ9A 2VMIA 3MFCA 4YM3A 3FLTA 2K9ZA 2DWRA 4ISQA 4ZZ5A 2P3JA 1RUD2 1NA1C 2OPWA 1MEC1 3GDBA 1W8OA 3I2FA 4LEJA 1F4HA 1G7YA 1ZZ7A 4AK3A 5LW9A 4XFIA 3WZ1A 4EN0A 4URTA 3AVSA 3CJIB 2JB8A 4KH9A 3BODA 1MPXA 3P5BA 4GXLA 4XJZA 5JI7A 3LFIA 2HEWF 1XNAA 4MYEA 5FP7A 3GGLA 1DG6A 4CUBA 1LOFC 5JXIA 1TEIA 1N47A 4TLFA 4COWA 2ZEZA 1YRZA 3FFZA 1ZZ8A 1MS4A 1UD1A 4CEWA 1H2MA 1YEWA 2XWJB 5JIUA 4CDQA 2PLV1 4LORA 4S2DA 3S57A 3LD8A 1ULPA 5KXEA 1UZYA 1FMD1 5CNAA 1JYIA 3SLIA 3K77A 3VKOA 2ZXQA 3U75A 2YC2A 3A7QA 2R16A 4XBNA 4IEVA 1O3TA 3T2TA 3WG3A 1D4M1 3I2OA 4LLFA 1GP5A 2DCJA 4LHSA 1OQ1A 4OUEA 3TEXA 1JYVA 3T0AA 1RUJ1 1A34A 4KU7A 4CXWA 3WXPA 2ZJCA 3CL1A 5EZWA 1NCRB 1C8M1 1COV3 3CLPA 2OT7A 4CE8A 1RUG3 5HV0A 3IMMA 4OHVA 1UKGA 1UNBA 4YM0A 1ZBA2 3NV1A 1TZOA 2PAKA 4P00B 2RJLA 2F17A 4JKKA 4HSJA 1AL21 2FCUA 1YI7A 5A6ZA 5I8YA 5TSWA 4Y24A 3T2QA 3VDDA 1QJX3 1CAWB 3POEA 3H1WA 3ZSKA 2A6WA 3CZUA 4K1ZA 1W0NA 3ZO0B 1OD3A 3GJAA 4A6SA 4ET7A 5K7PA 3DUIA 1PNFA 2H6BA 3VBHB 5I0UA 3VKLA 3RZKA 2B9UA 3B3QE 4OLLA 5IVJA 4NIHA 4RHV3 5BV6A 1DZTA 5BPXA 4A7KA 2XQXA 1WW5A 2BGCA 2C9KA 2F4PA 3M4FA 4IW3A 4J6GA 1Z7S3 5BXXA 4ATEA 3HIFA 4I3PA 4RFT0 1Q43A 3JD73 3WW4A 1UU5A 1JMUB 5F39A 1RYYA 2VNGA 3POSA 4BCUA 1OT5A 2YGMA 1COV1 4D94A 1EUUA 2ZGKA 3HVDA 1RUG1 3J7HA 3GM8A 1UOJA 1HRI2 1ASJ1 1NT0A 1RUC3 4KBBA 4FXGB 4OMDA 4Q4W2 4XFBA 1XOYA 3LDBA 3NJZA 3VBRA 2BDRA 3NNLA 1QJU3 3OBRA 3OOXA 4C0BA 2XQRA 3GCXA 4XJWA 3K3OA 1SFPA 4J25A 3VBFB 1VBD1 4RHV2 5LATA 4N8MA 2HBTA 4CZSA 2BV4A 1DFQA 3JD72 4CDUA 3GZAA 4IXLA 4FOYA 3GZTB 5FPXA 1HXS3 1W9TA 4IEXA 4RS5C 5DAQA 2NYYA 1XNCA 4AFDA 2OUHA 2WA3A 2XBO1 3S7IA 4Y22B 5BNPC 2G4IA 4CCDA 4XW3A 2JDPA 2UYAA 4I2OA 1RUC2 3PVOA 1UZZA 3ETQA 2QQLA 5A80A 4WV8A 3AC0A 1RB8G 3PDQA 1E5IA 1QJU2 4SLIA 1HW5A 5FLJA 3WHTA 3ZXFA 5I0SA 4Q4V2 5H9RA 1YQ2A 5FYBA 3H3UA 4YZ5A 4EN6B 1KQRA 3WNKA 1REEA 3LOIA 1VR3A 3GBGA 3IKWA 3U78A 1WLDA 3N9NA 4M0NA 3B5LB 3MHZA 4QGLA 3H8RA 3W5NA 2RR11 2QQKA 3QH7A 3OEBA 2Q8EA 3VZKA 3HJRA 2D40A 3RDIA 1WLWA 3MGUA 1YUDA 3ZYJB 4MV2A 2LM3A 5T5JA 5GLZA 2RS11 1SPPA 4OMCA 5FPZA 3X29B 3N9QA 4Q4Y3 3R4SA 5C9AC 1UO9A 1UIJA 2V72A 1JTZX 1C5IA 1VBB1 3WP3A 2BGPA 3ZYRA 3JQXA 1IOAA 4RL7A 2YV8A 4QQPA 1JN2P 4ZS3A 1G9AA 1OXCA 2XMLA 1L7QA 3VBOA 2B46X 5FTTC 4LK6A 5BNOA 1X7NA 2DTWA 3LOBA 4AQ2A 5E6HA 3QCWA 3C3VA 3UKTA 1FI2A 2HWF3 1A8DA 5SV5A 1YFWA 3AZZA 1DQ4A 5FMDA 1AX2A 1R082 2VMHA 1WLTA 1KDMA 2VOTA 3E1F1 5CZKA 2OZ6A 1UYXA 1YXWA 5EQUA 1AXKA 4CUAA 4C90A 1SDWA 1O6UA 3A21A 5KC6A 1DGRA 1DHKB 1GWMA 3DKQA 2AGSA 1OOPB 4UT5A 2DUPA 2A6YA 3LDKA 5L36A 4Y20B 4QHOA 1K5MA 2B7YA 4XFFA 3THDA 2JKXA 1JODA 3S5AA 1AR92 4COYA 4P5YA 5BYNA 2FMDA 1O4ZA 2P34A 5LK7B 4H55A 1OQEA 1OH3A 4O61A 5JZGA 4FPEA 5FZIA 5JLVA 1GMMA 5DAVA 2EXHA 3TRSB 1XXNA 5H9SA 1RUNA 2ZS6B 3VD9A 1HN1A 2C0ZA 1ZVFA 2QFEA 3FLRA 2RMU3 4QQ2A 5FYCA 5FZDA 1H9WA 2EAAA 4NN0A 5FZ4A 2ILMA 1V6JA 2WNUA 2XJQA 2WN2A 4WVMA 1T2XA 4LE4A 3UK9A 1GZWA 3URFA 2ZGTA 1C1FA 1Q8OA 2E32A 4NIIA 1EV12 2V5DA 3K4DA 3ZN6A 3A0NA 3AFKA 4WM8B 1AZDA 3FN9A 4QXKA 4B7KA 2R0HA 3WQ1A 4BK5A 4QM8A 4WBBA 4QT6A 3Q8BA 1PMJX 5J37A 4AVVA 2EVXA 1WMFA 2AUYA 2XVGA 2XJUA 1VMHA 2VL4A 4GWIA 4LTAA 2BRTA 2OX0A 1QJFA 3EMRA 4MG2A 3B00A 2TNFA 5A7SA 4GZ9A 1HDKA 3B94A 4OCTA 2FMYA 1UU4A 2ES3A 4LO6B 4BDVB 4ARXA 4PBOA 1L7RA 2C26A 4M3CA 4NRMA 4QPWA 4XZPA 5A7WA 1U0AA 2Q30A 3OG2A 3FHIB 1DGWA 1HB1A 1QQP2 2BQPA 4B4RA 3KM5A 3AKRA 4YFZA 1KS4A 4XEZA 5GLVA 1BKZA 4MGTA 4DIQA 3E97A 2WT1A 3LF7A 4OULA 4CCCA 3WLUA 5F3CA 5J48A 4NUBA 3PMSA 2RMU1 1OF4A 4X8NA 3J8F2 4FAGA 2WS93 2A7AA 2HWC2 5FK7A 3ACLA 3MIFA 3K48A 2C4XA 4NHYA 1ODNA 3BTXA 1SCSA 3N35A 1P8JA 5CFDB 2CYFA 1DYOA 1H6YA 2QDRA 1BBT3 4BWOA 4E27A 4NAMA 2UU8A 4JGYC 3UV9A 5L7OB 3KT1A 2BZDA 5JVVA 3WUDA 4LITA 3WX5A 4H7MA 5KWRA 2ZCWA 3WQ0A 2CGPA 2ZHKA 5IVYA 2R7EB 3Q8AA 5A6QA 2P3IA 2ENRA 3NW4A 3VD5A 3N7JA 4MGYE 1IQDC 4IV1B 3VHNA 1BLZA 2YC4A 4QB1A 4QPIA 4I0BA 4YG0A 3GNEA 4YM1A 4B4PA 3LPGA 1BBT2 4S2FA 1BEV2 1GQGA 2RM23 3AYEA 3EXUA 5BNNB 5C3SA 5J1XA 5CFCC 5A32A 1PVC1 1W3XA 4QX5A 4LO4B 4CEYB 2X05A 3WNLA 2C6SA 2Y6HA 1MS0A 3PNAA 3I3QA 1NYWA 2JEMA 4AGVA 3ME2A 1JXNA 1FT9A 3OBAA 2G9ZA 1PZ8A 2WS91 1J84A 4F83A 1W04A 3KVBA 3ZFEB 4YZ4A 1K45A 4LOSA 3PLQA 3O1VA 1AJOA 3OF1A 3FHAA 1PGL1 1ND2A 4D0QA 1AYM3 4CPBD 2Y6KA 4BOWA 4IEQA 3HAGA 5HI0A 4N43A 1H4HA 2I2SA 4LLOA 2SBAA 2A3XA 3OYWA 1MQTC 2BWAA 2OZJA 2IVIB 2OQ6A 1UZWA 4Y26A 2VZQA 1OURA 1V9U3 3ZXEA 5LEJA 3E5QA 5LK5A 4B3NA 4CDWA 4DEVA 2YB7A 3D3AA 3E6CC 1HJFA 1RXGA 3OD0A 3PUAA 1F5JA 2ZMKA 4NROA 3ZPOA 2EIEA 1QGLA 1H8TB 2BNNA 4BXSV 1DQ6A 1NX9A 4ORFA 4DUWA 1QH7A 1BJQA 3CIHA 2WWJA 1NA1A 4XUOA 1NLRA 5FLHA 2VULA 4NMIA 1GKBA 1UX7A 4GD4A 2VCBA 5HBAA 3CJIC 5FZ3A 4AHXA 3FX3A 2XVKA 4XE9A 5CEHA 2RM21 2DVBA 4LA2A 4GJYA 5IVFA 4G9SB 4QU2A 2VJXA 1RUOA 3AZWA 4FTSA 4OHWA 1T6BX 5CA6A 3Q8EA 1J83A 1HIXA 4DXRA 5FZBA 2ATFA 4PIXA 5ABJA 4IV3C 5FY0A 1AR83 2VBDA 3I7DA 5DAPA 5GALA 1PO11 5LBCA 1EAH3 3RYPA 1J3RA 4LBOA 4K6BA 3UETA 1AYM1 1V6IA 1TMF1 2BGOA 3MICA 4I30A 4ZS2A 3B7MA 4NPLA 4TSVA 3PTYA 3ZOIA 1LJ7A 4S2HA 1KITA 4ZONA 1LOCA 2W2IA 3RNSA 2XJTA 1V9U1 4CP2A 2CGOA 2AACA 1SLTA 2ZKNA 4JRLA 2DTYA 4P9JA 1J1TA 5A1FA 4BQ1A 2O0OA 3U07A 4GQ7A 2ZGRA 3WF1A 1NCRC 1D0HA 2VW1A 2WR9A 1UYPA 2ZHNA 4LKDA 4CDXB 1SFNA 1SCRA 4IESA 4LNVA 4R9BA 2WQ8A 5F2SA 4DOUA 1GANA 2V73A 2W92A 3KGLA 5F5QA 2GP5A 3DXTA 2EA7A 4HOOA 3O1OA 2C9AA 1VLNA 3GYDA 2W5FA 4QKFA 4DUVA 1ZRIA 5ACA2 1LGBA 2DVGA 3ZYFA 4QDRA 1W39A 4L2NA 2JDNA 4JDOA 5HCAA 5H9PA 2YY1A 4WZFA 5D1IA 3C8XA 4LJHA 4PIYA 5EV7A 2WZPP 4U36A 4FOQA 5GZGA 1FNYA 5T5PA 2P4EA 2VU9A 4C8DA 3NSTA 1JYWA 3MIEA 4AVSA 1JU4A 4XHBA 5C6CA 3BTZA 3FBMA 3T4VA 1AR81 1E5HA 1RUH3 2IXLA 4GAZA 4XTPA 4V2VA 1EAH1 1ZBE2 3Q8CA 5D8AA 4DEQA 1Q8QA 4JGZB 5T3NA 1S1AA 2DVDA 3OY8B 1VIWB 3JQWA 1LCLA 4HLTA 3NL1A 2GNMA 2WJSA 3WDYA 5JOYA 3ZFGC 5K0UC 4AAXA 4DQAA 1BHGA 3W5MA 4XETA 1GP6A 2VZOA 3K4AA 3VBSB 4M3CF 3ACFA 1N3QA 2BTVC 4COVA 5IVVA 4WVWA 1PX3A 1GFF2 1WMDA 1BMV1 3WF0A 2GN7A 1W6QB 4Q29A 4WM7C 4FCAA 2GNDA 1LHOA 1IZ3A 3PU8A 1B35B 2YFZA 2GP3A 1G86A 1W6OA 3SMHA 1ST8A 2BPA2 5KR7A 3VD7A 1URXA 4H14A 4IE7A 5GM0A 2R063 1ULEA 2D3PA 2VG9A 2WNOA 4EWAA 5IK8A 1M06G 1W99A 1NOVA 4YW3A 5FRAA 4PIZA 3NRUA 4INDA 5C4WC 1OFSA 4BLJA 2J42A 3KT7A 2QQIA 3MIHA 5C5TA 3D8CA 1IKPA 2ZEWA 4QGNA 4RR3B 4DMIA 1HLCA 3FBYA 4RSUA 3AYDA 1R1A3 1RUH1 3MUZ1 2CWSA 2ZKLA 5BNPA 5JUVA 4UXAA 1AR73 2BFUL 2R32A 2ZHLA 4IEYA 1K3IA 1YCIA 2UWCA 3CU7A 2I45A 5K9YA 2R062 1QOOA 1SEFA 2JWPA 4AYUA 1VRH3 2R6QA 1EPZA 5FZ9A 1I5ZA 2JG9B 1JZ6A 1W9FA 4AI8A 4IDZA 1XNTA 3LSEA 5EYXA 5B2GB 1DGLA 1QJY3 3WT3A 4XMAA 1UYYA 5JOZA 2YROA 1F4AA 1QU0A 2YPJA 5C8CB 5KBFA 2VR4A 1HB2A 4LO7A 4UYBA 4MXWA 2W08A 2PHUA 3Q8FA 4FTBA 4Y4YA 3T30A 3ZR5A 3KLSA 5C9AA 4LXLA 4GWJA 5HPOA 1CAUB 5FFOC 2W0XA 2ZAHA 5DN2A 1NCQC 5FZ0A 2C1FA 5A6YA 3TN93 1CJPA 2GC3A 2ZX3A 4ZXEA 4A2UA 4BMBA 4XZUG 3AZYA 3MLLA 2CDPA 3MUY1 3THPA 2WL1A 1YQCA 1R1A1 2BEOA 2RJKA 3MPBA 2ZEYA 2WABA 2UY9A 2PELA 2IFRA 5F3EA 3ZVXA 2HWE2 3WR0A 1V6LA 4ASKA 1AR71 1W03A 1G9BA 1S2BA 5DZFA 1UW8A 4QPGB 4R8HA 1CPMA 3SNMA 1W9YA 3MV11 4ZHNA 1I3HA 4N53B 1OOPC 2WDBA 5EJZB 3V0BA 3TB0A 1AYN3 1VRH1 3R0RA 4HSLA 4YSFA 1TME1 4XHXA 4OI0A 2P6HA 4FOVA 2ZGNA 2CAUA 3U10A 5FZ7A 1XNBA 2QQJA 2JJ6A 3BGAA 2LUWA 1GZ9A 2ZGOA 1O8PA 3UKNA 1I1EA 5KHIA 2Z5WA 3BIWE 1QJY1 1HQNA 5FYSA 1UF2C 5GKAC 1ZRFA 4PF5A 3MIDA 2VTXA 4GB33 1TE1B 4UF0A 5I0RA 1GZTA 4P08A 1POV1 2AZ5A 4A45A 4AQSA 1RVF3 4M3CE 5IVEA 1MR5A 2W91A 4ZU5A 4Q4X3 1SZBA 1FOD3 4HL0A 5JSPA 4OQ9A 3VD4A 4O9EA 2XHKA 1A78A 3U11A 4B8EA 4EJRA 3CQOA 4MGIE 3J9SA 1VJ2A 2R1BA 2X53S 4WM8C 1XSRA 3TN91 2VD7A 3KS7A 4FPCA 4X8PA 5EP9A 3B9IA 4RQPC 1PK6C 4YW5A 3IDAA 5DPNA 3WV6A 1T6GC 1XRUA 1M4WA 3PJQA 2WZR3 1RIRA 4BB3A 3KV9A 2XDVA 5FYHA 1RMU2 1RHI2 3MO4A 1UOGA 1PVXA 2G19A 3ZSLA 3L2YA 4BU2A 5D2AA 3TEWA 2MEV3 1SG3A 5JR2A 5EJ1B 3BN6A 2ETEA 4Q0VA 3OBZA 4KG8A 4QQLA 1VBC2 1FPN2 3WQBA 5DABA 3NJVA 5KC5A 1VBA3 2Q8OA 4NOTA 2XKPA 4MUVA 2VNVA 4Q2FA 2JIJA 3KMHA 4N9HA 1VAKA 4WZCA 4GB31 3ZDSA 4AEKA 4ES9A 5KHKA 1QOSA 3EYPA 3POGA 4ATFA 4NJ4A 1V6NA 5FP4A 4P9XA 4PDWC 4Q4X1 3DXUA 3HT2A 3SHRA 3LA7A 2RDQA 2PQSA 4XAEA 4OHYA 3T2PA 2D6MA 3ZFFB 1W6MB 4DY3A 5JI9A 1OBNA 3HBKA 2EXKA 4XQDA 3ZN4A 4AQTA 5FMOL 1HX6A 4JGYA 2VZ3A 4AAPA 1VBA2 4LKFA 2IXKA 2WAAA 3OGGA 2WZR1 4BK4A 1JYNA 1WKYA 2P17A 2VECA 3BOWA 4YZ3A 3NKTA 5EPAA 4LMFA 1AL0G 1O3RA 3K51A 4XJ9A 2F6BA 3H7YA 5ANNA 1GU3A 1C8NA 2DUQA 2YU2A 2MNGA 4BIFA 5F9TA 2DFBA 2RS32 1S0IA 2B39A 4V1PA 1WA4A 2UY8A 1YJLA 4AG4A 1W0OA 2DUOA 3H1YA 2VZSA 4XDOA 1OA4A 1JU3A 2A1XA 3ROUA 1SHWB 4CYDA 5C70A 3KGZA 3DKWA 5CFCA 3GHNA 2LROA 3IIIA 4Z2AA 1RC6A 4FPJA 2ARBA 5F6KA 4ZU4A 1NXMA 1IQAA 1NY71 3PUSA 5T5LA 2PTMA 4HPKB 4EYUA 4Z2WA 4HK8A 1A6CA 5L9BA 4E2QA 2Q8DA 2CU5A 2J1EA 4QKDA 4YZ2A 5C33A 5IAXA 3P6BA 4ZPIA 3WG2A 1WZXA 4B1MA 4XF1A 3CNAA 3RGBA 4JKMA 3SISA 2DCYA 4AFBA 2WSVA 5DMYA 2PHRA 4XURA 4DXSA 3LKJA 1J3PA 1MQTA 3ZYIB 5A1LA 4KI5M 3BU0A 3BKZA 1WW4A 2RS51 4I02A 4K3UA 1W8UA 1PIV2 2WFF1 1NUKA 1OF3A 4OHXA 3AL5A 4M4RA 2DYCA 3N9OA 1GNHA 4BE3A 2OS2A 2X09A 1W90A 3A4UA 1C57A 1LU2A 4JVAA 2X5IA 4A42A 1OVPA 3WQ7A 3KV4A 4AW7A 5G05L 1RUD1 4L0PA 2W9XA 4XFAA 4P5HA 4I0AA 2ZMNA 2P1BA 3UGFA 1CESA 1N1YA 2PLV2 1AHSA 1H2KA 2PHWA 3MEPA 4ARYA 2Y60A 1O7FA 5A1AA 1FMD2 2VZRA 2N7GA 1I5PA 3DF0A 4H7LA 1LEDA 4CEWB 1UMHA 4CDQB 1ZBA3 2IWGB 2WQZC 1CR7A 1JI6A 1HB3A 3BCWA 4IV3A 4GKXA 4D3WA 2L9LA 3WY6A 3ZYPA 3KWVA 1RUI3 1DP0A 4LK7A 4DO0A 3BUCA 3KSCA 2ID4A 3N9MA 1RUJ2 1VBE2 4WVZA 3ZYHA 1LU1A 4AE2A 4BQYA 4COZA 2VTXJ 4D69A 1SQ4A 3VDAA 5CG9A 2UWBA 2D3SA 4HZFA 1F8VA 3ZIXA 3HNMA 4LUMA 3M3IA 2JG8A 1UIKA 3GZEA 1DZRA 4Z82A 2HWB2 4AEJA 4G3YC 4LO8A 2VCAA 1LODA 2H6CA 4XDQA 2R1DA 4F8AA 1RUI2 2WSUA 3J7MA 3N3HA 1JHNA 2XLGA 2P3KA 2ARCA 3G7DA 4MO3M 4XFHA 5FREA 5CB7A 1JZ5A 5FJHA 4N7UA 3M3OA 5FWEA 4YG3A 3AYAA 3IDBB 1HRI3 3NV4A 4XFCA 3KF3A 2GDFA 2WFPA 5FXWA 4BYYA 4UBGA 2XPJA 4Q4W3 3SKJE 2WYSA 2KA3A 1SLCA 3U4SA 2VCCA 4IGOA 2JENA 3KCCA 3LA3A 1ZBA1 2W94A 2EXIA 1UYZA 3LEMA 3H0OA 4XDPA 3NAPC 5T55A 3VBUC 4IEOA 3VDDB 1ONAA 5JPMB 3OD4A 3FC0A 1W0PA 5KXDA 1HKDA 3HEIA 3NJXA 5CVRA 2A73B 3C7GA 3HQXA 1LTEA 4YW7A 2XWBB 5FUPA 4AHYA 4K40A 5JOXA 3MW3A 1AR62 1GOFA 3GF6A 1OPOA 1PMIA 3ZFGA 1CAVA 5K0UA 3SC7X 3POWA 5FZOA 5HCFA 5C5UA 1H30A 1UN1A 3HPNA 4JTNA 1MZEA 3ACIA 4QB6A 1ASJ2 5AVPA 4Y1UA 3VBSC 2VOWA 3AJZA 2PHLA 4Q26A 3BPZA 3D82A 2HLEA 5IATA 4TWTA 2Y34A 2G1MA 4Q4V3 1W8WA 4FPHA 2YZ4A 1VBD2 4WM7A 1JUIA 2A6VA 3VBRB 2TUNA 1LGCA 4PF1A 1SBEA 1ULFA 1Y4WA 4OQ8A 1W2UA 4NWWA 1EUTA 2DBNA 4L92A 5A70A 1VAVA 4FPGA 3C7HA 1QJX1 1YO8A 1W2OA 2XBO2 5LZ6A 1HRI1 4NHLA 1X50A 3T1LA 3NNJA 5F5IA 4CDUB 2PQQA 4Q4W1 4LA3A 5C4WA 3H8XA 5LB6A 1W2TA 1MZ6A 4CCOA 4XYXA 1WCDJ 3RPQA 2WUHA 3M7AA 3NWKA 4RN5A 1J1LA 2XJPA 4RHV1 5C7GA 3ILRA 1DLLA 3JB8A 3RWKX 2MPFA 1ENQA 2B42B 5FZ8A 3LAGA 1Z7S1 2WZEA 2VXRA 4FQZA 3JD71 3LA2A 4YG6A 1H8VA 1JOJA 5JSRA 3WVJA 5DDJ2 3MYXA 5HXVA 4AR2A 4A7YA 4LHKA 4IEPA 3ITQA 2BP6A 1CGPA 1R083 1RUC1 3VDCA 2Y26A 1W6NA 1SBFA 3IDCB 1QJU1 4PBPA 2EALA 4GALA 1LESA 4Q4V1 4UFIA 3DPRC 5IK4A 5IVCA 1PO22 1D2QA 2GU9A 2IFWA 3I2DA 1AR93 1VBB2 4GH4C 3RJ2X 5EJ3A 4AHWA 1SPPB 2KD7A 4Q5OA 4QHBA 2UYBA 3OGRA 4KWJA 4LIVA 1HXS1 3M2MA 2DDUA 2BOIA 3PVBB 2P2KA 3NVCA 4DXTA 1W3VA 4FPLA 2QCSB 1V6OA 3MIBA 4NPMA 4OYUA 4XQWA 2VXJA 1NCQA 3N9LA 5BNOB 4AL9A 1R1ZA 2QE3A 4E2SA 3IZOA 3J7LA 1XU2A 3DYPA 3UYJA 5F1RA 5L19A 2ZOEB 4ITCA 3USUA 1EV13 5C3QA 5J3UA 2YGLA 2DBIA 5FZFA 2ZX0A 3VKNA 4K8RB 2VQUA 3I2JA 5JIAA 1HQWA 1VAMA 3ZXLA 3PL0A 2IZWA 5EYYA 5T54A 2F4LA 1KEXA 3E6DA 4N53C 1K5MB 2GNTA 5GZDA 1CZSA 1XYNA 3KZ4C 1R081 5GZEA 2CNAA 2C24A 3H42B 3EB7A 4HKOA 4E4DX 5JZGB 1OUSA 4HT1T 4Q4Y1 5FQ0A 3PMEA 3GXUA 1R093 4W8JA 1DZQA 1ND3C 4RGGA 2VQAA 1FYUA 1GSLA 3RG0A 4Q0SA 2W46A 1AR91 3PVEA 3ST7A 2FDFA 4YW1A 3WDUA 1FX5A 3I97A 4BQ2A 3NMBA 2OQ7A 2WNUB 2ZX4A 4WVMB 4AWDA 1QQP3 1GZWB 1F5FA 2RDSA 4CA9A 5ERLA 1BZWA 4FFHA 1XQNA 2WT0A 2NM1A 4DFSA 5C71A 2HWF1 4IUGA 1AVBA 4NPRA 3ZN6B 5LCWL 3I3MA 1BQPA 2P5BA 5E16A 1Z0HA 3J8F3 2Q5TA 3LCPA 4UW3A 2IXJA 1IS6A 2HWC3 2X29A 2XGXA 5FZKA 4AF9A 4HVRA 2XOMA 5FKCA 1R092 3HMYA 3M3QA 3B01A 1MS5A 1XB9A 2GC2A 4RQPA 3UL2A 1EV11 3FWEA 3WNNA 3MV01 1PK6A 2JDUA 5HCHA 1QDOA 4QGMA 4RGAA 2QBXA 3T3YA 4M0HA 1YFYA 1DBNA 4YVSC 1W05A 4Q0QA 4FFGA 5E88A 1ZZCA 5FK8A 1OVSA 1U5ZA 4M3CB 4XF0A 5A7WB 5I0DA 5FUNA 4AEDC 4AVBA 1MVEA 2VZPA 4KGQA 1XJAA 4N90A 4YVWC 2PHFA 3JBG2 2WKKA 2VQ0A 4MGSA 1WBLA 2BWCA 3RI8A 1V6KA 2BFUS 2XH6A 1CAXA 2VW2A 5KXCA 1W8TA 1RTVA 3I59B 1IPSA 4GMP3 4GA9A 2YPDA 4UI9L 4XAAA 1OA3A 3MW4A 4OVEA 4UFLA 3SQOA 4RD7A 3CHXA 1IKQA 3BTYA 5JOWA 1BEV3 2AREA 2RJ2A 2NQYA 1QQP1 4Q8KA 4CCNA 4PDWA 1OC1A 2QQOA 4CUGA 4XABA 4FO9A 5DAWA 4YGCA 1W2AX 2O8QA 2GSYA 3H3ZA 2JDKA 4JRAA 5IK7A 5AFEA 4FTEA 3J8F1 5CKQA 1X33A 4YW2A 5FZ6A 1N1SA 4DPNA 1O3QA 2HWC1 4MGZE 1OPMA 5L9VA 2HKXA 2YG0A 3RQ0A 1UPSA 2E51A 5BNQA 4YW4A 3CKHA 4CP1A 4NRPA 1OH4A 1SLLA 2D93A 3IPVA 1D7PM 3L2HA 3ZLIA 3BU7A 2OKXA 4QPIB 4IEUA 4YW6A 3AP4A 1JOBA 1PVC2 4QPYA 2PHDA 4FFFA 2FD8A 3OGSA 2WNVC 3QLQA 4IE4A 1RINA 1UY0A 4D6RA 5A32B 2PAMA 4O9GA 4MOAA 5CU1A 4UFMA 1BK1A 2Y64A 3ZXJA 4L8QA 4BQWA 3B69A 1FNZA 1BBT1 1BEV1 4GULA 3I8TA 3RZZA 1WBFA 3AFGA 4AHZA 2NMOA 3UT0A 5F5CA 1ND2B 5FJKA 1XE0A 1O4YA 1LEMA 4N43B 1JHJA 4BQ5A 4JAAA 1X82A 3K3NA 1QEXA 3OYWB 1RGSA 3T1MA 4FOWA 4UFJA 2J1AA 5LA1A 3AP9A 5IFTA 3V0AA 2RDRA 3W21A 2TEPA 4FFIA 2A71A 1NA1B 2YU1A 3SITA 4AVTA 1MVQA 4N7IA 1LOFA 4I3GA 2HWD2 1UY3A 1C4RA 3I3DA 3NV2A 3RZMA 1V00A 5LASA 4CU9A 1RJ8A 2YBPA 3ALQA 1NAEA 5FMCA 2XJRA 1YIFA 3RJRA 3KB5A 2VNRA 4OFGA 3RSJA 1XC6A 3WW1A 1GQHA 2ADEA 1PO12 2E26A 5AVAA 2OPKA 2CAVA 3SCHA 1NE6A 1XE8A 5FPBA 1VB2A 3VL9A 2WO7A 3D0JA 4BLIA 5ABJB 3PIGA 1DQ5A 3WEZA 1X8MA 3UJOA 1VRBA 4C0HA 5ACA3 1RUF3 5GLWA 4QQHA 3VB9A 3VV1A 1WCKA 3HWJA 3NQHA 3BTAA 2XKOA 4MGKE 1IG3A 1H1MA 4XCBA 1OI6A 3WHUA 1EY2A 3MFAA 1DGRN 3CO2A 3IM0A 5FV3A 2CHHA 1ZBE3 2HYXA 3R4DB 4PLOA 5FO8B 1W8ZA 1JW6A 2EICA 5LA9A 4LHLA 3WP5A 1ZA7A 2V5YA 4IERA 4HONA 3WF4A 5HXMA 1PGW2 2QQUA 4FAHA 2W47A 3OUJA 2VVEA 4MX3A 1RUF2 1W6PA 5E1RA 1U5YA 5C3PA 4LBQA 5C3RA 5FMOS 2QNKA 2GAUA 5A7OA 1IS3A 1YNAA 1KJRA 3EO6A 1GOGA 3GHMA 1UZ0A 4Z8BA 2VBBA 2FDGA 1TNFA 1Z78A 4JV4A 1W06A 5T52A 4PQ9A 3WNOA 1SFYA 1WLCA 1PM4A 3I3BA 1EP0A 3VBHC 4XFGA 4HBNA 4AGRA 2ZGUA 3K4ZA 2XB6C 2Y8KA 3VBUA 3NAPA 5DZEA 4QKNA 3LIGA 4K8FA 4P9YA 5D8AB 1GZCA 5FAXA 1UY2A 2O8OA 4DZGA 5FPUA 2TBVA 4CSWA 5FYUA 4META 4LKEA 4QX3A 3BB6A 5JMOA 1C28A 5IHRA 4EE2A 1ZBE1 3VKMA 5CADA 1DLCA 1JS9A 4D6SA 4BIOA 1F2NA 3CJXA 4QHZA 2P37A 1O4TA 2GN3A 4LBMA 3VBFC 4Z1VA 2ZGPA 2VM9A 1RL3A 5DUVA 3U14A 1DDLA 4BQXA 3LGRA 3TEYA 1W6OB 4NHKA 5H9QA 3VZNA 1C3HA 4LUKA 1UXXX 5A33A 3BIEA 4CRQA 4F7ZA 3ZXDA 3KQRA 5K8SA 3BALA 2DFCA 2NPIA 4E4SA 4RS5A 4XXPA 5ANQA 4BXFA 1I9RA 2WO1A 1O59A 5D21A 3SKVA 2H0VA 4XQ4A 5E89A 1O3SA 3T0DA 2D43A 3SH4A 4M00A 4XMIA 1X36A 2LALA 4JDNA 3PJYA 5FY4A 3PVNA 4XF9A 4QU1A 3QOPA 1YWKA 2R043 5A3PA 5BNPB 2BBVA 3ZMNA 1CWPA 3CF6E 3OPZA 4AI3A 4XF3A 1H1IA 2V4VA 2XONA 3FL7A 3JZVA 3DECA 4QMAA 5FYVA 4DRRA 3H50A 1POV0 1CVNA 1D4VB 1NZCA 3P1IA 3U0ZA 5ISLA 4K7JA 1CQ9A 2HWE3 3JXSA 5IWFA 2FCTA 1S0BA 1REFA 1BXHA 1LOGA 2D97A 1NE4A 2OA2A 4FT8A 3PUQA 2LRPA 4IEZA 4MVTA 5FDBA 3D5OA 4IE0A 1LHWA 3C7EA 4OI1A 2QKDA 2R061 2D98A 2VBPA 1OQDA 2Q0AA 4TZDA 2Y33A 2AEYA 3LQCA 5JAXA 1VALA 3UGGA 2EIDA 2IUWA 2R042 2XR4A 3DPRA 3N36A 4MXWB 3Q9OA 2QDNA 4GH4A 3OTFA 1MS9A 1CZVA 3IT8A 4C1WA 2YDEA 3AKPA 1UQXA 4JHZA 4CP9A 1FXZA 5F2WA 3D6EA 4KWKA 4PLMA 2JIGA 3AP5A 4QX2A 4UAPA 4TYSA 1YHFA 4ASMB 2GMEA 3AMPA 1CAUA 3C2UA 2VZVA 4I01A 4E8CA 2JD9A 1S55A 3DYMA 5FR3A 2JICA 1MS1A 4LPLA 2BU9A 3A22A 1LOBA 3VZOA 4OI2A 4CCMA 5A3LA 1B09A 5F8PA 2AENA 3WDWA 1QJZA 3WG1A 2B9VA 5JXGA 5FKBA 3NO8A 5KHGA 3M1HA 1LKNA 1TME2 5AC93 3HR9A 4HKLA 2HEVF 2ZGLA 3N7KA 1RUE3 3V0BB 4QQOA 1US3A 3DYOA 3GZUC 3WNPA 3T0BA 4IL7A 2HWE1 4BJ0A 4XBLA 3O0XA 1XNKA 3F2ZA 4LKSA 1RMU3 1RHI3 2OVUA 2VMDA 3AJYA 1X9PA 1MACA 4QX7A 3WP6A 5FY5A 2R073 5CISA 5I8TA 4UF0B 1ND3A 1I6XA 2HJIA 1VBC3 5G04L 2WT2A 5FXZA 1FPN3 3V56A 3M3EA 4S2GA 4B4QA 5DG2A 5IK5A 2VY0A 5AC92 4EWDA 1DGWX 1K12A 4IQPA 1LB2A 1Y43B 2OIIA 2R49A 3UNPA 3O7OA 1YQ6A 3G6JB 4JHTA 3PUIA 1RUE2 4AZZA 3I54A 1VP6A 4J1WA 4C1XA 2LS6A 1QF3A 3IIAA 4CXYA 4GWMA 1CX1A 2A6XA 3ES4A 1LHUA 4AI1A 3AMNA 5LBEA 3U1XA 4EN8B 1YIPA 3OCPA 1N3OA 1OLRA 1ZA4A 3ASIA 2R072 2Z2SB 4CTEA 2Z4FA 4BHPA 1AYN1 3J26N 3MZHA 1VPHA 4LO5B 1HRV3 4RYDA 5A7QA 3O1MA 4XC9A
chains in the Genus database with same CATH topology
1BVVA 3AXDA 4YVSA 1LECA 3ZPYA 3ZSEA 4F3JA 3E5UA 3W59A 2GC0A 4AEDA 1IS5A 1RHI1 1RVF1 4YGEA 4D7YA 3B02A 4YVWA 1FOD1 5IT6A 1NQJA 3WDXA 3MI8A 2RS33 2UURA 4LT5A 2CV6A 5CFDC 1V70A 1VBC1 1HRV2 5FCCA 1FPN1 3NV3A 2WLPA 4LE3A 4YNIA 1WUVA 4KQ7A 3TBDA 5L7OC 4FPYA 2HYKA 4K1YA 5A3MA 1NG0A 4L9BA 5GJ6A 5JWPA 2JDZA 3W9AA 1NQDA 4JGYB 4HFSA 1UCXA 2MEV1 1EPWA 3KCYA 4IV1C 2ZACA 5JMCA 1ULDA 3AMHA 3P3PA 4HMZA 3DGTA 5BNNC 1MEC3 2BYVE 1VBA1 4Z07A 2E63A 4CEYC 2Y0OA 1PIV3 2FZ2A 2VH9A 3RI9A 1J58A 5I8SA 3S30A 2AH2A 4Y5Z0 1F31A 1NY72 1YFXA 1RJ7A 1AUYA 2WNVA 3EJKA 4KWLA 2WC2A 3THTA 3ZFEC 2Q1MA 4LULA 5CFCB 1JYCA 3DL3A 4EROA 2RS31 1QY4A 3OGJA 4GKYA 1DQ1A 3VL8A 4JDMA 1XYOA 2VUJA 4K20A 1IS4A 2A75A 3M8LA 5FOJB 2PLV3 4YM2A 1LRHA 1MEC2 3ZX7A 3J4UH 1FMD3 1UL9A 3QACA 2YUEA 5T5OA 3L9JT 3MLKA 1H8TC 2ARXA 2BNOA 2ZAAA 4L11A 4UW4A 1MQTB 3S6PA 1D4M3 1LHNA 3AKSA 5EXOA 3RYRA 3FUOA 1WD3A 1KS5A 3TYJA 1RUJ3 1VBE3 2R0FA 3ZN5A 2OW4A 3CJIA 1S0EA 2XLFA 2PYTA 3OJBA 1DYKA 1C8M3 4JCKA 1AX1A 3PHMA 4FP2A 4AI0A 2X5IB 3IMNA 1PIV1 3WNXA 2HWB3 1J59A 1D4M2 2BNMA 4BPZA 3CEWA 1AL23 4B29A 1H4GA 4ONUA 5ABJC 3UKVA 3HD8B 4LBKA 4AGGA 4R9DA 4IV3B 2ZGMA 1OD5A 5BUVA 1C8M2 2OYZA 2JECA 2ZX1A 3MDPA 5KC5A 4R4XA 2B5HA 4W6XA 3ECQA 4AVCA 4ZXKA 1LOEA 4DB5A 1H1AA 1QKQA 4XIKA 4CDXC 1NCRA 1TNRA 2JG8B 4HK9A 3RRDA 3SH5A 1YFUA 2YXSA 3SH3A 1AR63 4AI2A 1VBE1 4W6YA 5DUXA 1AL22 2Z79A 2NZ9A 3JB4C 2NLRA 3DV8A 1N1TA 3ILFA 1UX6A 1REDA 1ASJ3 1H9PA 2ZA9A 3D4KA 2HWB1 1ULCA 1VBD3 3VHOA 3A0KA 1AX0A 1CAWA 1RUI1 3AX4A 4EWEA 1QH6A 4YARA 4EN9B 4AFAA 3P3NA 4JGZC 3VBHA 2XBO3 2XLAA 2YC0A 4YFWA 3TNPB 3VHPA 3ENRA 1COV2 1VB4A 1RUG2 4GIQA 2PN5A 5D8AC 4OI4A 4YGDA 3B9CA 3M3CA 5J36A 2K0GA 1MS8A 1XYPA 1CAVB 4HANA 3RMXA 2EXJA 2ZMLA 3ZFGB 5K0UB 2A3YA 2GALA 1HQLA 1B35C 5JPNB 3HN1A 1YYNA 4AXOA 1AR61 3IWZA 2RHPA 5DDJ3 4XILA 4HVOA 2D7FA 2VMGA 2RR13 1FV3A 4WM7B 3VBFA 1YLLA 4A3XA 1QJX2 3M70A 1GLHA 1UAIA 3DN7A 3WHUA 2DF7A 4PJYA 1G9CA 4RR3C 2RS13 5GLUA 2JXAA 1H2LA 5CIRA 1LR5A 1PO23 1UPIA 3IBMA 3WOGA 1APNA 1VBB3 4Y22A 1KXGA 1WW7A 5C4WB 5GLTA 1O91A 1X8EA 4DXZA 2DVAA 1Z7S2 1FAYA 2D5HA 5L73A 4RA0A 1O5UA 3WDTA 3ZSJA 1ZX5A 2XL7A 4W65A 3N4MA 2DVFA 2X8KA 2RR12 3ZXKA 4KU8A 1N3PA 3WG4A 3UJQA 2JG9C 1Q56A 2RS12 1ZZBA 1BYHA 1GV9A 4HKWA 1OFNA 3LSDA 2WQ4A 3N7MA 5C8CC 4KL1A 1YI9A 2B8MA 1W6NB 2VVFA 2VNOA 2WIIB 5DDJ1 3MF9A 1HXS2 4R9CA 4JTOA 1AJKA 1SLBA 4L99A 3VBOB 1GR3A 4DINB 4NO4A 3MF6A 3SCGA 1QXRA 1PO21 1GBGA 2Z42A 4FPFA 1A8MA 1NCQB 4DRVA 5KHHA 4QPGC 3E6BA 2DCZA 1QMJA 2BVVA 3HT1A 4JC1A 4YYOA 3USUB 4XF4A 2ZBJA 4EV0A 4P14A 1OOPA 4OZXA 4Y20A 2DV9A 3AB0A 1S2KA 2VPVA 1KJLA 4OHZA 1DQ2A 2PA7A 1UU6A 2A6ZA 3LZZA 1U12A 2QZ3A 4I0WB 1SMVA 4Q4Y2 5E8AA 4LBQD 3VLBB 3AK0A 2ZGQA 2W52A 4MZUA 3AMMA 1U5XA 5FQ0B 4E2GA 4N9IA 1ZREA 3IN9A 2EF6A 2PHXA 3GBWA 1G8WA 4PLNA 1ZRDA 1QOTA 2HWF2 3JBG3 3NKGA 3O5SA 4WM8A 3AM2A 4NR1A 4Y1ZA 1AF9A 2QUOA 1OLQA 2D44A 1C1LA 4MLOA 4G4FA 5DUWA 3ZXGA 4P9WA 4PCRA 4K9SA 2AR6A 2CWMA 3ATGA 1QNYA 5IUQA 4RQPB 4WVVA 1WCSA 1PK6B 1IGOA 5J96B 2PFWA 3S0MA 2A3WA 4GMP0 1MS3A 1Q8VA 3TOJA 2RMU2 3KCXA 1R091 2D3RA 2HEYF 4E9KA 1S0JA 2Q4SA 1ALYA 1CAXB 2NP0A 4FQ4A 2JE9A 1L3JA 2MHFA 5EWSA 3N7LA 1PVC3 3I59A 2JE7A 1CJDA 1XU1A 1DYPA 5GZFA 3ZFFC 5CFDA 2E6VA 3JBG1 1ULGA 4Q27A 1UKRA 4PDWB 4D7SA 1PNGA 1KFXL 1KDKA 5L7OA 1DQ0A 4XJUA 4QM9A 5DG1A 5J98B 4XIOA 3USSA 3VGIA 3APBA 4JQRA 3EHKA 3WP4A 5CAZA 4BH9A 2D6NA 4ISRA 3W58A 5GZCA 1G9FA 1J3QA 4IV1A 5FO9B 3IPVB 3SXWA 3O14A 2VGDA 2ZHMA 1SLIA 2YMZA 3WW2A 2WS92 4FSJA 1ZYBA 5BNNA 2WNEA 2XJSA 4GMP1 1QWRA 2QQPA 3QD6A 3MPPG 4CEYA 1PGL2 4BM8A 3RMYA 1DIWA 1GNZA 1ZRRA 1CIWA 3O12A 4L97A 4NHMA 4YGBA 3E5XA 2HWD3 3GALA 3ZFEA 3V64A 3TNQA 1F9KA 1S0FA 5JR7B 3AZVA 3RYKA 1H0BA 2D6KA 1JUHA 3AKTA 4HVQA 1Y9QA 4ZU7A 4CDWB 1WMEA 1PO13 4KGGA 3TAYA 4Q1PA 4YLZA 4MXVA 4XXAA 2VVDA 1TMF3 2BVBA 1H8TA 2XG3A 5CBLA 5LEKA 3V0AB 2RM22 5J7MA 4H3WA 2DU0A 3JCIA 4I09A 2Z69A 2BUKA 4Y1VA 3IDEA 4X6RB 3TWIA 5KXBA 2ZGSA 4A7ZA 2E53A 4XJAA 3D0SA 1SBDA 2QVSB 4XJ8A 3AP7A 1ENRA 2X5IC 4FXKB 3EBRA 4CEWC 5I0TA 1AYM2 4CDQC 1TMF2 1WGPA 1MZFA 2ZX2A 5F6LB 5FO7B 4XPVA 2HWD1 5FBZA 4Z92B 1WW6A 2D6LX 1V9U2 2D5FA 4FVVA 2CL2A 1UMZA 1V6MA 1QHDA 3B93A 4IETA 1YJKA 5SV8A 2H0BA 3OBTA 2GMMA 3FZ3A 4P9IA 1N1VA 4ES8A 1IPJA 2ET1A 3WINE 3MIGA 5DUUA 1S0DA 1WD4A 3BOPA 2BW8A 2AYHA 3AZXA 2CY6A 4FPOB 2JKBA 3VZMA 1FV2A 4CDXA 2I74A 2ZTNA 3HBZA 2JG8C 5HCBA 1OA2A 3S7EA 3ZXAC 4FBFA 3WDVA 2GH2A 1W6PB 4LBLA 2GNBA 3WCRA 4LBQB 1AR82 2A70A 3ZIWA 1EAH2 3KD4A 3ZSMA 3POYA 1PGW1 1H2NA 1XNDA 2IXIA 3VDDC 5ACA1 1RUF1 4UBHA 2ZABA 1S0GA 1Y7BA 1BVP1 2KXLA 4GWNA 2WINB 4Y1YA 1Q3EA 1LENA 5FLIA 1KRIA 5KHJA 3VN4A 4JGZA 2GMPA 3OY8A 3V65A 4AQ6A 3VBUB 3NAPB 3FE5A 1JH5A 2GH8A 4IEWA 1BMV2 3INAA 2K2SA 1PZ9A 2B45X 2ERFA 2A5ZA 2XL9A 3VBSA 3RS6A 2IXCA 4MSVA 3RWNA 4Q1RA 2FQPA 4Q0PA 1LHVA 1PHMA 1W6QA 1CPNA 1MZ5A 1OKQA 2EAKA 1IPKA 1B35A 1TQ5A 3VBRC 2QZ2A 2VOKA 3U4XA 4C91A 2UWAA 1LGNA 4YRDA 3VZLA 1CN1A 1LOAA 3ZMOA 3QBQA 5A33B 1HV1A 1RUH2 2WLQA 4CDUC 2ET7A 4Y1XA 2Y38A 2R30A 2Q1ZB 3WW3A 1ENXA 2CTVA 2IXHA 4J1XA 4Q8LA 4RS5B 5JCTA 4RR3A 1Y3TA 2SLIA 3SCFA 1D0GA 2VOVA 2E7QA 2FBEA 4ZKTB 3R4UA 4AEMA 2JD4A 1KFUL 2W39A 2I07B 5T50A 1E57A 4DS0A 2DURA 4FPKA 1A3KA 1Q8SA 3FJSA 2JG9A 1LULA 2E7TA 4DNYA 2XVLA 4OUSA 2YHJA 1RITA 1ZZ6A 1GYKA 1C5HA 2PHTA 2OUJA 3LB9A 1HV0A 1TME3 2VW0A 5C8CA 1DU3D 3FLPA 5C9AB 3JUUA 2D6OX 3AMQA 3H7JA 3DPRB 3GBFA 4Q0UA 4GH4B 1R1A2 4B7EA 2ZPXA 1POV3 3VBOC 3WD5A 4OUMA 5LRRA 1XE7A 1AR72 5BNOC 3WUCA 1Q5OA 5CG8A 2VUAA 2R041 3H9AA 4FP3A 4LR4A 4QD2A 2FHRA 1VRH2 1CX4A 3WCSA 5J09A 2ZZQA 1ZM1A 4QPGA 3FFQA 3FMGA 3VKFC 3AKQA 3I4IA 1AXZA 1K5MC 1QJY2 1QXPA 4LBNA 2G9GA 4N53A 2NN8A 1OMIA 3H8UA 4LHNA 1OHFA 5EFUA 4P9LA 5C8WA 1QXJA 4UW6A 1BCXA 1PZ7A 2JX9A 5JZGC 1NLSA 1IHMA 3O0VA 2E9QA 2E7AA 2GZWA 4R4ZA 2D6PA 4NWVA 2PAEA 4D7TA 3EQEA 3R05A 4XOGA 2WNUC 1AXYA 3TN92 1G6NA 2EIGA 4EN7B 3KT4A 3MW2A 1ND3B 3VHRA 2W68A 1CD3G 2RE9A 1SLAA 1GICA 4UW5A 4R9AA 4HN1A 1G9DA 3JU9A 2O1QA 3AXEA 5DXDA 1NXD1 1AYN2 2XJVA 1EYBA 4BZ4A 1KD7A 4M01A 5AC91 1JBCA 4MH0E 2DCKA 1RUE1 2GC1A 2WA4A 2C5DA 2LTNA 4P9GA 3VZJA 4KNCA 4GB32 1RMU1 4XTMA 4BMEA 1QNWA 3ES1A 1RVF2 4BA6A 3ZYGA 3AYCA 4Q4X2 4YVSB 3ILNA 1FOD2 2R071 2VOXA 4K21A 3O0WA 5LRSA 3AP6A 5JSOA 4AEDB 4CP0A 4YVWB 4COUA 4NVPA 3ELNA 3VUOA 5I93A 2QJVA 4AFMA 1D2SA 3FUQA 4R52A 1ENSA 2WZR2 5AFBA 3ZFFA 1W6MA 2WWSA 2V09A 2MEV2 2NMNA 4HN0A 2IC1A 3LWCA 2CGNA 1HRV1 1SACA 3R6SA 1PM7A 5I91A 1ZNPA 2ZZJA 4AFCA 4QPIC 1OSGA 2RS53 2YYOA 2WFF3 1FATA 2XUMA 4AVAA 4W6WA 2DU1A 4YZ1A 1CONA 4E4ZA 4HETA 4KG0A 4XBQA 2G9FA 5DZGA 1ZRCA 3H1MA 4DY5A 5BY5A 1PGSA 1RUD3 2FZ1A 2DCTA 2KM2A 2WNVB 4LBJA 4HPKA 4X6QB 4SBVA 1DF0A 2Y0IA 5FOBB 1ND2C 2RS52 4N43C 1O5LA 2WFF2 1Q8PA 1U5IA 4ASLA 5JDBA 1S0CA 4CDWC 4U2AA 3MLJA 3QH6A 1QDCA 1ZZ9A 2VMIA 3MFCA 4YM3A 3FLTA 2K9ZA 2DWRA 4ISQA 2P3JA 1RUD2 1NA1C 1MEC1 4LEJA 1G7YA 1ZZ7A 4AK3A 4XFIA 3WZ1A 4EN0A 4URTA 4KH9A 3CJIB 3BODA 4GXLA 4XJZA 5JI7A 2HEWF 4MYEA 1DG6A 1LOFC 1TEIA 1N47A 4TLFA 4COWA 1YRZA 3FFZA 1ZZ8A 1MS4A 1UD1A 4CEWA 1H2MA 2XWJB 5JIUA 4CDQA 2PLV1 4S2DA 5KXEA 1UZYA 1FMD1 5CNAA 1JYIA 3SLIA 3VKOA 2R16A 4XBNA 4IEVA 1O3TA 3T2TA 3WG3A 1D4M1 4LLFA 2DCJA 1OQ1A 1RUJ1 4KU7A 3WXPA 2ZJCA 3CL1A 5EZWA 1NCRB 1C8M1 1COV3 3CLPA 1RUG3 4OHVA 1UKGA 4YM0A 1ZBA2 3NV1A 2PAKA 2RJLA 4HSJA 1AL21 1YI7A 5I8YA 5TSWA 4Y24A 3VDDA 1QJX3 1CAWB 3H1WA 3ZSKA 2A6WA 4K1ZA 3ZO0B 5K7PA 3DUIA 1PNFA 2H6BA 3VBHB 5I0UA 3VKLA 2B9UA 3B3QE 4OLLA 4RHV3 5BV6A 1DZTA 5BPXA 4A7KA 1WW5A 2BGCA 2F4PA 3M4FA 4J6GA 5BXXA 1Z7S3 4ATEA 3HIFA 4I3PA 4RFT0 1Q43A 3JD73 3WW4A 1UU5A 3POSA 2VNGA 4BCUA 2YGMA 1COV1 4D94A 2ZGKA 1RUG1 1HRI2 1ASJ1 1RUC3 4KBBA 4FXGB 4Q4W2 4XFBA 3VBRA 3NJZA 1QJU3 3OBRA 4C0BA 4XJWA 3VBFB 1VBD1 4RHV2 4CZSA 4CDUA