1W8TA

Cbm29-2 mutant k74a complexed with cellulohexaose: probing the mechanism of ligand recognition by family 29 carbohydrate binding modules
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
142
structure length
142
Chain Sequence
NVRATYTVIFKNASGLPNGYDNWGWGCTLSYYGGAMIINPQEGKYGAVSLKRNSGSFRGGSLRFDMKNEGKVAILVENSEADEKFEVETISPSDEYVTYILDVDFDLPFDRIDFQDAPGNGDRIWIKNLVHSTGSADDFVDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NON CATALYTIC PROTEIN 1
publication title Probing the Mechanism of Ligand Recognition in Family 29 Carbohydrate-Binding Modules
pubmed doi rcsb
source organism Piromyces equi
molecule tags Carbohydrate-binding domain
total genus 28
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2004-09-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 1w8tA00
1WZXA 2LRPA 2KR2A 2WYFA 2LROA 1UOJA 2Q1FA 1W8WA 2JWPA 4LJHA 1GWKA 5D21A 1W8ZA 1W90A 4YWAA 1W9FA 3UT0A 4YW6A 2K46A 4LKFA 2O14A 4BQ5A 4BQ3A 4LKDA 1HN0A 4BQ4A 3F95A 4BQ2A 2VXJA 3ZYHA 1GWMA 4AL9A 4CP9A 1L7LA 1OH3A 1V0AA 1WCUA 3ZYBA 4LK6A 3ZYFA 4LK7A 4YW7A 2C24A 1OKOA 4LKEA 1W8TA 4CPBD 1W8UA 3ORJA 4CPBA 1GWLA 4CP9B 1WMXA 4A6SA
chains in the Genus database with same CATH superfamily
2ZEXA 1SDWA 3MO4A 3CKHA 1CONA 1RB8G 3N9MA 1T6BX 3K51A 1H30A 3PVEA 4B4QA 1YFWA 3AP6A 3B00A 4JDOA 5FZDA 3USUB 2JX9A 4COVA 3OJBA 3O7OA 4Q0SA 4XUQA 3S7IA 5BNPA 1IZ3A 5DPNA 3UJQA 2R043 2J42A 4JC1A 4Q1PA 1G8WA 5CG9A 5E1RA 4Y20A 4LTAA 3JU9A 4YYOA 3H8XA 5C8CA 2XONA 4ISRA 3WNMA 3ZN4A 2A6XA 3WG2A 4DY5A 3K2OA 4PBPA 3D4KA 4HMZA 1JW6A 4DPNA 5FZ0A 3VL8A 2WNUA 1S0DA 1PIV1 1UMIA 1V9U1 4MGIE 1O3QA 3OY8A 1CESA 4RHV2 4FQZA 1S2EA 2EXIA 1CX4A 2GAUA 4XDPA 3ROUA 5I0SA 4YNIA 1YFXA 2XHNA 4Q1RA 3C7HA 3VBHA 3BN6A 3L2HA 2BNNA 2AEYA 1TME1 2ZS6B 3ZYBA 5LA0A 2E33A 4LHLA 1W6MB 4OCTA 2WKKA 4A45A 3R4UA 1MPXA 1DG6A 1CAXB 1PMIA 1W8HA 2W3JA 1W8UA 1PX3A 2QZ2A 3RJ2X 1Y9MA 3JBG3 4RGGA 3ACIA 1X7NA 2Y26A 5FY9A 4LBQB 1IOAA 1WMXA 4AI1A 3SEPA 1ONAA 2IXKA 3DXTA 2QCSB 5FZAA 1YLLA 2R0FA 5DUUA 1BBT3 3RI9A 4AVSA 1FMD3 2DVGA 1NYWA 2QQOA 1UYXA 3C7FA 1GZWB 4JVAA 1VBE3 4MVTA 1MEC3 5F3GA 3PUHA 1Z7S1 4NIDA 2ADDA 1PZ7A 5FYYA 4CP2A 2IXJA 5CEHA 2QDRA 5FMDA 4ZHNA 1CIWA 3BUCA 1VR3A 2H6CA 3MUZ1 4A42A 4AVVA 5FZ3A 4EWEA 1TNRA 1GNHA 1N1SA 2JICA 1GLHA 1S0IA 1ZRCA 3HMYA 3SCHA 4MH0E 3DV8A 4PQ9A 2YXSA 1GR3A 1JYTA 4KWLA 1SHWB 2PHTA 2PLV1 1PO23 2RR12 3W9AA 4D7TA 3MIDA 1ZZ8A 3AZVA 1JYNA 5D21A 4FVVA 1ULOA 1UU5A 5FLJA 5CFCC 1YUDA 4UFMA 3UKNA 1QQP3 2XBO1 3EYPA 3RG0A 4F8AA 2D5FA 1R082 4BMEA 4LEJA 3U75A 4QU2A 2HBTA 4E4SA 3I49A 4QKFA 3V0AB 1O7FA 1W2NA 2DYCA 4HKWA 4NHKA 5GJ6A 3H8UA 4QDSA 4XHXA 1CAWB 2YDEA 5HCHA 1ULPA 3I2JA 2Y6GA 1V00A 3BOWA 1GKBA 4XCBA 2Q30A 1FPN2 4BK4A 5KC6A 4YW2A 1ULEA 4R4XA 3PTYA 5G05L 3AK0A 4NIAA 4LO5B 1WW5A 5DMYA 3FUOA 1XQNA 2MEV3 4CP0A 1JZ4A 3QCWA 3KT4A 4DFSA 1OKQA 1RUF2 3TN93 4FFGA 3VBUB 1JZ6A 4PI0A 1HRV1 1ULCA 4LBMA 1SLLA 2BERA 4RYDA 4Q4Y2 3V56A 4C8DA 2IFWA 2OYZA 3LEKA 5L9RA 4XMIA 1APNA 1NXMA 5FJHA 1C5IA 4GB31 5T50A 4BQ1A 1ODMA 4P5YA 4QPGC 2VBBA 2B8MA 3FN9A 4LA2A 1UL9A 1AR93 3LCPA 1IPKA 5A33B 1LHNA 2C1FA 3MIFA 4YARA 3PVBB 3B94A 1OD3A 1W6QA 1AX0A 2JE7A 4MYEA 5C3RA 3VD4A 5T5PA 1NY72 1EUTA 2DTYA 2XL7A 4AEMA 3WG3A 2WS91 2CGPA 3O1OA 3ZFGA 3HEIA 2ZPXA 4WVMA 1PVC3 3X29B 1H8TC 1QJY1 1SEFA 4E2SA 4J1XA 3D8CA 4PDWC 2YV8A 3GCWA 3VLBB 2D6KA 4AI2A 5IAXA 4LORA 1GP5A 1VP6A 4Y1UA 2Y8KA 3HT2A 3IDAA 1C8M1 2RJLA 2O8QA 2OUHA 5IVVA 3J7MA 2ARCA 3MYXA 2ZX4A 2WT0A 4COYA 3P1IA 4FFHA 5FZIA 2A6YA 2NLRA 4NRPA 4W8JA 5GZGA 3S7EA 2NMOA 4HPKB 3SISA 2VUDA 3QH7A 1WWYA 4LXLA 3N9QA 4P00B 4QPGB 5DAXA 5T5LA 2X09A 3AP9A 1FOD3 2VO5A 5C8WA 1QEXA 1S0FA 3RYKA 3BPZA 2PN5A 4L9BA 2DCYA 4UF0A 1UYPA 1W8FA 2C0ZA 2RDNA 2ZZJA 3NV4A 1Q8SA 4KH9A 5A7QA 1J83A 1RUH2 2JD4A 2GN7A 1VALA 2YROA 3DYPA 2ZAAA 3MIEA 3POSA 2VZPA 3E6BA 4P9IA 4RGAA 1RMU2 3D82A 2CV6A 4YVSA 1KS5A 5FPXA 1K5MC 5FUIA 3I2FA 5EYYA 5FZOB 1OVPA 1RUI3 4PDWB 4A7YA 2VOTA 2VQTA 1IS3A 4K40A 2HWC1 4AGVA 3M70A 2DUPA 5LZ6A 1AHSA 1NLRA 1D7PM 3PUIA 5FPAA 1HQLA 2QE3A 2DBNA 1MS1A 2VW0A 3CQOA 4CCCA 1XU1A 2XKOA 2Q8CA 1C5HA 1OI6A 5JMCA 2OT7A 4S2HA 4YM1A 1UMZA 3TYJA 4IXLA 2TUNA 4Q26A 2XQXA 1VBC3 3Q8EA 2ZX1A 1W2TA 4HKOA 4XJZA 3VDDC 4A2UA 1OQ1A 3E6CC 2O1QA 4P9XA 1JBCA 3UGFA 5ANQA 4ONUA 4CDWC 2WJSA 5F39A 3WV6A 1ACCA 3FHIB 1JUHA 4FP2A 5IK5A 2GZWA 4QGNA 4CTEA 5T5JA 4WZFA 5FBZA 4LIVA 2JG9A 1UD1A 4KWUA 4CDQC 5F37A 1A8MA 1PO12 2R041 2CDOA 2XVGA 3R0RA 1Y43B 2GMMA 4KWJA 4RL7A 3VV1A 4RR3B 1ENRA 1JZ2A 2CU5A 3HVDA 1DQ6A 1W6NA 2CGNA 1GBGA 1K5MB 1V6JA 2ZEWA 4JGYA 5BNOC 4HKLA 3OPTA 5H9QA 2F6BA 2A5ZA 1CAVA 4W65A 5IW0A 2JD9A 1DYKA 5F5AA 3DN7A 5JIUA 5K0UB 4FCAA 4N43B 5JZGC 1VRH2 1JYWA 1I3HA 2BEOA 4LIUA 3N7JA 5LK7B 3PJQA 2ZXQA 4BIOA 2MPFA 2UWAA 3FLRA 1VAMA 4OI1A 4I3PA 3VBRA 2HWB2 3T0DA 3I8TA 2IXIA 3N35A 5C4WC 1ZBA2 2D5HA 4IEYA 2LTNA 5C3SA 3VZKA 2WLQA 4CCLA 1WD4A 1TEIA 5BYNA 2EF6A 3VDDB 4GH4C 4DO0A 5L73A 4AEDA 2QQPA 1K45A 1SFPA 3JBG1 1LJ7A 5ABJC 5GLTA 2QBXA 3HWJA 5F6KA 2OZJA 5FZEA 2FDIA 3KD4A 3KT1A 3L9JT 4LJHA 4Y3OA 1BBT1 2WYSA 2KR2A 3I59B 4AI8A 3C2UA 4XDQA 2R0HA 4ZU5A 1G9FA 1SPPA 1PZ8A 2JG8C 2Z69A 2ZACA 3E5UA 2VMEA 3H50A 4OHZA 2E6VA 4ZU7A 2VVDA 3MV11 1Q8OA 1R092 5BV6A 3POGA 4AR2A 4GALA 3CDZB 5GLZA 1WCUA 1POQA 1QXJA 4OMCA 5JZGB 4COZA 4G9SB 2HEWF 4EN6B 2PHUA 3NJVA 1G9BA 1OPOA 3IMMA 5DDJ3 1J3PA 5FPBA 4AGRA 2JDAA 5JSRA 4R9DA 4ASLA 5I93A 2VMIA 1VIWB 2LM3A 4QXBA 4IEWA 5C4WB 4FAGA 3F2ZA 1XE0A 4WM8A 4XJAA 1COV3 5FQ0B 1VBB2 4UFHA 1QQP1 2RS53 4V1PA 4Q0VA 1W9FA 2XWJB 1X8EA 2X5IB 2RM23 3LSDA 3PHMA 4FTEA 3KZ4C 2PA7A 3NV1A 3SH3A 2YB7A 1S0EA 4MGYE 5KXCA 1NE4A 4FSJA 3RMYA 3PUSA 2PQSA 2NPIA 1KJRA 3VZLA 2YC0A 4LK7A 4XEZA 3ZVXA 1NA1A 2A3XA 4Z2WA 2HWE3 2R30A 5J3UA 3FUQA 1QNYA 2E7TA 3ZDVA 3WZ1A 2FCTA 1ZZ7A 3E97A 4L0PA 1O6UA 5FMOS 3KS7A 2ZGMA 5DAPA 4CP9B 3VHOA 1XRUA 2BDRA 2JDUA 3NNFA 4K9SA 1W8NA 3WHUA 5IT6A 1J1TA 2KM2A 2B9UA 2VMFA 3WD5A 2WINB 5FY5A 4FTBA 4LQRA 2HYXA 1KDKA 5FZHA 5HCFA 5JXGA 1A3KA 4E27A 2A3YA 5ACA3 2PYTA 3S57A 1KXGA 1AR62 1FPN1 2UURA 3MEPA 3OGGA 2VQUA 3K46A 1RUG2 3PIJA 5I0TA 4V2VA 1QJFA 1HXS3 2G4IA 2VC9A 2P5BA 1F9KA 3NVCA 3PU8A 3OUJA 1MR5A 2GNMA 3GDBA 4AWDA 1RUF1 1QIQA 1DP0A 1MS9A 4FOWA 3MW4A 3SH4A 1AR91 2XR4A 4JQRA 3BTXA 2WNVC 5A3PA 1XU2A 1QJU2 3GJBA 4A7KA 5CU1A 3NNJA 1MS3A 1HQNA 2YGMA 3ABZA 3AMHA 4CCEA 1NQDA 3AXDA 1SZBA 3GHNA 1V70A 1VBA3 4E8CA 1YXWA 4Q4V3 1CAXA 2J1VA 4EE2A 3MGUA 1US2A 1OBNA 2NM1A 2WLPA 4LKDA 2KA3A 3BB6A 4BQ4A 1YO8A 4HL0A 4SLIA 2O0OA 1OHFA 5T3NA 3W20A 4OULA 2VNGA 3IAQA 1NX9A 1XB9A 1MZ5A 1X8MA 2PHLA 2Z42A 1NY71 2B9VA 1Q56A 3D5OA 3RWKX 3M3OA 2A1XA 1UZZA 4QX7A 5BNNC 1SBEA 4ES8A 3TEZA 2Q1MA 3NSTA 1AYM2 1CR7A 3E1F1 1R1A3 3UYJA 1GZWA 4N8MA 2BZDA 4UFLA 2ZGQA 2O8OA 3AVRA 3O0VA 1D0GA 4GD4A 2W1SA 4E4HA 3OEAA 4A41A 2GP3A 3LD8A 4N7IA 5CZKA 2HWF3 3FZ3A 4LE3A 4JZRA 2P2KA 4LMFA 2JIJA 5FMBA 2W1UA 3OD4A 5A7PA 1TME2 5IVBA 1HB2A 5IAVA 3OF1A 2XJSA 3LEGA 3O0WA 4HETA 2XPJA 2B46X 1FOD1 1FI2A 3KQRA 1QY4A 4Y5Z0 4IUGA 3EXUA 4YZ1A 5A32A 2R49A 2PHXA 2WNVB 4IL7A 4AAPA 4YGDA 2ORZA 1HJFA 3WHTA 1HJGA 1H9WA 2DU0A 1UYYA 3DUIA 3I7DA 2HH9A 3BU0A 4BJ0A 4LKEA 5CB7A 1I5ZA 4K6BA 4IV1C 4HVQA 2XUMA 2XJVA 1HLCA 3ZYGA 1MS8A 2EAAA 1AYN2 1F15A 1OUSA 2D97A 3CIHA 3KT7A 4IE7A 4XIKA 4YM0A 3IKWA 4AEKA 1RUD2 4Q4W3 1BHGA 4JV4A 2ZMNA 3RZLA 1UO9A 1AL22 1KEXA 2OQ7A 4GQ7A 1Z7S2 3SKVA 3ZYRA 4TXWA 4D7SA 5IFPA 4CZSA 4BQXA 1D0HA 2DWRA 2MNGA 4Y1VA 2CWMA 1OA4A 2DCJA 5LRRA 5BNNB 2Q4SA 1KJLA 2XHKA 3AX4A 4D8MA 3M3QA 3OTFA 1RHI2 5IYYA 2G9FA 2OA2A 3ZSJA 1PGL1 4MGZE 2W94A 5E8AA 3HQRA 5FZBA 4KG0A 3RPQA 1QJX2 2VM9A 5FZFA 2DCKA 1AJKA 1AXYA 2JJ6A 4UYBA 3ZR6A 4IESA 1TMF3 1FNZA 4OI2A 1FV3A 3U0ZA 2HYKA 5J7MA 3RZZA 1U5XA 2VAUA 3LGRA 3O5SA 2XBO2 4LUMA 5F5QA 4H7LA 4TZDA 3RYRA 4KQ7A 1W3VA 3AYDA 3O1RA 2Y33A 2G9GA 1WBLA 4I0AA 1UKRA 2A6ZA 3RZGA 1EV12 1F31A 1AR72 4IV1B 5CFCA 4XFAA 1H1IA 2VZSA 1REFA 2OUJA 3P3PA 2DTWA 4NUBA 4AAXA 4BXSV 5GLWA 3VDCA 4S2GA 3BOPA 1V6OA 1P8JA 1UCXA 4CXWA 5FUNA 3SC7X 4KGQA 3EO6A 1NKGA 2X8KA 1FV2A 4HZFA 1PHMA 2BWCA 2V5DA 4MXWA 3WQBA 4TN7A 3EJKA 3W5NA 5CFDB 2AACA 3J26N 4AVAA 1KS4A 3PMSA 1UOJA 3B3QE 3WLUA 1W2OA 3VN4A 1Q8PA 4YVWC 1VRH1 4YW5A 3THPA 5AFBA 1O3SA 4BZ4A 4IEOA 1CD3G 5FMCA 2PXJA 4CEYB 1W9YA 4N7UA 2HWB1 2QFEA 4XQDA 2Y0IA 1LU1A 1OKOA 3GGLA 1WMDA 4XJWA 3ZYJB 2GC0A 5CYYA 3WNLA 3KV6A 4UAPA 3LEMA 4ET7A 3NRUA 4UW5A 1JOJA 4QPGA 2ZCWA 3VD9A 2OW4A 3B69A 2ES3A 2E7QA 2KD7A 1W2UA 1E5SA 4OLLA 5KHHA 2WFF3 1U5YA 4XTMA 1RUJ2 2XUEA 1MS4A 1QJY2 2WAAA 3VHPA 4CU6A 5IATA 3QACA 4DIQA 4GMP3 1HN0A 3FC0A 2Y6FA 2Q8OA 3WW1A 3AKRA 2Q8DA 1H8TA 1NLSA 2Y64A 5DDJ1 3T30A 1C8M2 1T2XA 3H1YA 3MHZA 1VMHA 3J7NA 3OBTA 5FZOA 4C1WA 4OI0A 4EV0A 3THTA 2RS12 3ELNA 4AVBA 4L97A 2EAKA 1R091 2YY1A 3HN3A 4PLOA 1YWKA 4WM7B 2E9QA 2G9ZA 3KVBA 1RUE3 2CAVA 4PLNA 4D6RA 3U4SA 3ZMNA 2A73B 4AEJA 5A1FA 4UBGA 3MLLA 2RS51 4QHOA 3KHCA 2YPJA 3VHRA 3C3VA 3IMNA 3MUY1 5FYHA 3AB0A 4Q5OA 3O12A 1T6GC 4RS5C 5FZGA 3CL1A 1BJQA 3DF0A 3N7MA 4LOTA 2VZVA 5FOBB 3WDTA 4OHYA 5K8SA 2IUWA 4AI0A 4IGPA 4KI5M 3B7MA 3BTYA 2HWE1 4FPKA 1VBD3 3MIHA 5FP8A 4PIYA 1LESA 2UYBA 2ARXA 3I2KA 3NNLA 2X29A 3EB7A 2EVXA 4A4AA 1LU2A 4YZ3A 3ECQA 3AMQA 1FATA 2WO1A 5BXXA 4AZZA 5A6XA 1J3RA 1OFNA 3RZKA 2WSVA 4JGZA 2Y60A 4ISQA 3WP3A 1EPZA 1I6XA 2XLGA 4HT1T 3NWKA 3GBFA 4F83A 2W1WA 4BISA 4Q4X3 3H8RA 2OPKA 2VBPA 5T54A 3IDEA 3CZUA 5A3LA 1BVVA 5BNQA 5LA2A 3WF4A 4NIGA 2D3PA 3GHMA 1K5MA 2Z5WA 3HPNA 4I01A 3ST7A 2XMLA 1ENXA 2JENA 4M3CB 4R52A 3H1WA 1HXS1 3CMGA 5F8PA 5FLIA 4QDRA 3S0MA 4XZPA 3HN1A 4XAEA 1UIKA 1QJZA 5F2WA 5IVYA 4EWAA 3ZN6A 3JXSA 3L2YA 1UX6A 3POYA 5FO8B 1WW6A 2VY0A 4YM2A 3AXEA 3WF0A 1RUG1 4OUEA 1CVNA 1X33A 3CBNA 1GP4A 5LATA 3VZMA 3ZLIA 3AYCA 4QXHA 1ULGA 1QGLA 4U2AA 1IPJA 3WW3A 1DU3D 4R4ZA 4Q0QA 3AZXA 3ZMOA 4IV3A 5KXDA 5FZ9A 3VDDA 2R042 3A0NA 1QHDA 2Q1FA 2XJRA 3DL3A 1SMVA 4IE4A 3S30A 4XURA 4CDWA 1NXD1 3WINE 4IEPA 1QJU1 1W99A 4FPCA 5FUPA 1SLIA 2FD8A 5CAZA 2D6PA 1GSLA 1OT5A 3LSEA 5HXVA 4O61A 5A6QA 2QQIA 4V2WA 5LBFA 4AW7A 3EMRA 1MS0A 4CDQA 4OUMA 4Y5SA 2P34A 1UOFA 2BV4A 2HBUA 4ITCA 4LUKA 1URXA 4NE9A 5J36A 1JTZX 1OXCA 1R1A1 1IQAA 4XTPA 5BY5A 3BIEA 1V6MA 4EN8B 4EQVA 1AR83 5CKNA 3IDCB 3NL1A 4B1LA 2VH9A 3UKTA 1CJPA 5BNOA 5JPMB 3LIHA 4NOTA 1NQJA 4CCJA 1IHMA 3OGJA 4XMAA 4Y22B 4O7XA 3VD3A 1POV3 3AKPA 4EN9B 5FP7A 2VW1A 2NQYA 4MLOA 4O65A 4CCKA 5JZGA 3LPGA 4CXYA 4W50A 4FPHA 4YG6A 1AYM1 3CJIB 3P3NA 4NHMA 5JOYA 2F17A 1DQ2A 5FRAA 5JOXA 1GZTA 4DMIA 4FQ4A 1PM4A 4CDXB 1LODA 2DVAA 5FWJA 3JBG2 1STMA 3RI8A 5C4WA 3SQOA 3ZXFA 2ZGSA 2K9ZA 1LECA 3URFA 1RC6A 2A6VA 3ZSEA 1ZRFA 4I30A 1DGLA 2PHDA 4ATEA 1E5IA 1ND2C 3NQHA 3KM5A 4IEZA 4GH4A 4NHYA 5M0TA 4ES9A 1BBT2 2VCBA 3TRSB 2HWD3 3ZFFA 1FMD2 3MLJA 4A3ZA 4BPZA 2ZKNA 3Q8BA 4Y4RA 1IS6A 1YQ2A 2ZHMA 4Q4W1 4AVTA 5ABJA 1XNBA 3WQ7A 2B7YA 2QZ3A 5TSWA 1VBE2 2YYOA 1MEC2 1AVBA 3TWIA 2GU9A 5B2GB 2R1BA 1DQ5A 1O59A 3PJYA 1LOAA 4ZY9A 5AFEA 2BBVA 2C4XA 2R6QA 4RA0A 5F1RA 1PVXA 5GKAC 3HJRA 1AYN1 2JG8A 1WA6X 1RUD1 4YGBA 1UY2A 4BMBA 3ZYPA 1AL21 2H6BA 3NAPC 4Q0UA 3FBYA 4CP9A 5LB6A 1PO22 2VZQA 2WABA 1TMF1 1H6YA 1NE6A 3WOGA 2YUEA 2RG4A 1ZVFA 5F32A 4FFFA 4HSJA 4YRDA 1GICA 3K4ZA 5KBFA 1JZ8A 1RHI1 4JCKA 3VBSC 3IPVB 4XACA 1QQP2 1UWWA 3VBUC 4B7EA 1IKPA 3OEBA 3SXWA 1OQDA 1WLCA 1QJX1 1BVP1 1IGOA 2Q1ZB 1EAH3 2ATFA 5F7UA 3WVJA 4NRQA 4CP1A 3T08A 1BLZA 1ND2B 3S5QA 3K75B 1ZZBA 3ZFEB 2K46A 4ZPIA 2RMU3 5T52A 4AK3A 2AYHA 3NMBA 4K8RB 4CVUA 4L92A 3SKJE 4E2QA 2P6HA 1W6PB 2J1TA 4RD7A 2LW8A 2VUAA 4OI4A 4CU7A 1UXZA 3O1VA 1SFYA 2EIBA 5L9VA 1EV11 5EXOA 1AR71 4FXGB 4ZS2A 4DOUA 2P6CA 2VZ3A 5DZFA 4D94A 3ORJA 2WNEA 2MEV2 4AHXA 2P17A 4LT5A 3SITA 3TN92 4OHVA 4QX3A 4GJZA 1D2SA 1BCXA 3NAPB 5FLHA 3AP7A 3I2GA 4P9JA 3N7LA 1CZVA 1W90A 2KXLA 3MFCA 1V6KA 5H9RA 1US3A 2RS33 2TNFA 4FBFA 4NPMA 1WUVA 4BQ3A 4AI9A 4XETA 1QKQA 2CYFA 2V73A 3VBSB 1GWMA 1KD7A 2RR13 4XFBA 3LIGA 1H4GA 4Y33A 1W04A 2YC4A 3H8OA 3S6PA 1AR92 1DLLA 5JI7A 2V5YA 3WP5A 1F5JA 1LOCA 4NWVA 4NHLA 1HW5A 3FX3A 4LKSA 5HBAA 1WLDA 4Y1YA 4IQPA 1N1VA 4KL1A 3SH5A 3LA2A 3OOXA 1PVC2 2CGOA 2PTMA 2WNVA 3K4AA 3ME2A 1NLQA 4CEWB 1JYXA 2VECA 4GULA 3TEWA 2W47A 4QXKA 1AJOA 2D40A 5FFOC 3VZOA 5A1LA 1E5HA 2W91A 3ZSLA 3ZYHA 4B1MA 1RUJ1 3NJXA 4X8PA 3HOBA 1W3XA 1XJAA 3MIGA 3I3DA 4Y24A 4YZ4A 1RUE1 1WW7A 4J6GA 1H9PA 2IWGB 2CWSA 3R05A 3T0AA 1JZ5A 2WQ4A 1JZ7A 5FPVA 4G3YC 2CHHA 3HNMA 2WZR3 1UW8A 4MGTA 3NNMA 4QM9A 4OHWA 2WBKA 5KHGA 4FP3A 1OFSA 2RS11 2LRPA 4LBJA 4RQPB 4CDUC 1FOD2 1PMJX 5EV7A 5D1IA 5FXXA 1F5FA 1IQDC 3DEMA 2O14A 1H4HA 1VBD1 2C9AA 2RV9A 2VBDA 5AC93 1DQ0A 4ORFA 4CU9A 3Q8CA 4LA3A 4TWTA 5EJ3A 5C9AB 1GOGA 4Y5TA 3K4DA 4EYUA 2VOKA 3DYOA 5A7WB 4COUA 4Q27A 1RUI2 2QTWB 1G6NA 4Q29A 4WVVA 5JXIA 4MHUA 2B5HA 4Q4X1 5A3MA 3AZWA 2QQMA 4IE6A 5F3CA 5A7SA 1RUNA 3WP4A 1W9SA 4IV1A 4GKXA 1DGRA 4WVZA 2FDHA 4RR3C 3POWA 4XBNA 1BQPA 3VDAA 4LBKA 3WT3A 3LFMA 5FBJA 1RYYA 4DUWA 4TTGA 1KITA 2ENRA 3IAPA 1PGL2 2ZGKA 5JPNB 5KC5A 3ZKUA 2RDQA 3GJAA 4MGSA 3RZHA 5K0UC 4N43C 3PURA 1VBC2 2RDRA 4OZXA 4QB6A 2WZPP 3J7LA 1G9DA 1CAUA 4M4PA 4QWNA 3RYPA 2LUWA 3A4UA 3WQ0A 1XNAA 4ATFA 5CKQA 1Y3TA 1UU6A 2JDPA 4CDUB 4XJ9A 5FP9A 5GLUA 2J1SA 4DNYA 4QDQA 2VQ0A 3DPRB 4JKMA 3UGGA 4X8NA 5H9SA 3I97A 5D8AB 4A6SA 3ZR5A 5ABJB 5LWBA 1O4ZA 2WYFA 4DS0A 1JS9A 4YGCA 4H14A 1CPMA 1RUC3 1W8ZA 5FYBA 4F7ZA 3POFA 1OPMA 1RUOA 4GWNA 2WO2A 1DYPA 1UZVA 4NPLA 1OD5A 3IDBB 4AL9A 1XNDA 5JXHA 4OUSA 1NCQB 2WO3A 3KV5A 3ZXLA 1UY1A 3GYDA 2Y6JA 4OHXA 4DXZA 4AHZA 4UWDA 5FK7A 3LOBA 3OG2A 4IE0A 1EUUA 4ZS3A 4NIHA 1A8DA 5ANNA 2WIIB 4C0BA 1POV1 4QQHA 2DUQA 3A0KA 2VJXA 3VZNA 4LULA 2PHRA 4CSWA 3INAA 2YFZA 2HEYF 4WV8A 2C9KA 3PTRB 4XF4A 3VD5A 3VKFC 4E4DX 4LBLA 1PGW2 4YGEA 5L7OC 2BTVC 1V6LA 5B4NA 4AQSA 1GNZA 1GWKA 1JZ3A 2QKDA 4E4ZA 3POJA 1HV0A 2K0GA 3HQXA 3ZIXA 2GH2A 1W6OB 4YVWA 5FY0A 1NCRB 2VXJA 4XPVA 1MVQA 1X9PA 1WCSA 1YIFA 4HK9A 4OZOA 5DG2A 3V0BB 1D4M3 1A34A 3Q8FA 3NO8A 4TSVA 5LCWL 1UN1A 4I2OA 2DV9A 2X5IC 1DGRN 3DGTA 3KQ4B 3KVAA 1LHWA 1YI7A 3VD7A 5APAA 5CADA 5JMOA 3U07A 4UFKA 1WA4A 5FXZA 4AYUA 5JXJA 3OCPA 2YC2A 4HG6B 4M0HA 5FPLA 3OYWB 5HCBA 3DECA 3U11A 1FMD1 4JRAA 1WCQA 4JQTA 1YCIA 4JTOA 5FYZA 4QM8A 1ZBE3 2J7MA 1AL0G 3AJYA 4HXCA 4LE4A 4QPYA 4OQ9A 1VBE1 3WNPA 1MEC1 2EIGA 5DDJ2 4XFIA 1DGWA 1SLCA 3I3EA 1JOBA 4HANA 4LO4B 1HB4A 3B9CA 2FHRA 2NMNA 3H1MA 1O4TA 4I09A 5JVVA 4YG0A 1ST8A 2GC2A 3K3OA 3BU7A 5IVEA 3IN9A 3ZXDA 2WL1A 4IEUA 1ZRRA 1COV2 5FO9B 5L7OB 4IEXA 2XJUA 1S55A 2RS52 4N90A 2GN3A 3ZM8A 2RM22 1UYZA 2YZ4A 3AP5A 3AKTA 2VCCA 3LOIA 1XNCA 5BNPB 4NRMA 1PO21 5FZ1A 4UFIA 3MPPG 2P3YA 4Y4YA 3SEEA 4NAOA 3N9OA 1BZWA 2BRTA 2WN3A 2NZ9A 1ZRDA 1ZZ6A 2VMHA 4Y20B 5CVRA 2V4AA 5C8CB 1GZ9A 2HWE2 2BGPA 5FZMA 4RS5A 1YQCA 1SLTA 4Y1ZA 2X05A 5LY1A 3OUIA 4KU7A 1YQ6A 1RTVA 4K21A 4YW1A 1DBNA 1HQWA 3MW3A 5FYSA 4XAAA 2WNUB 2FDFA 5C5UA 2VMCA 4MHRA 3GZUC 1KFUL 3I2IA 3A22A 3OY8B 2VOXA 2BGCA 2YBPA 3MFAA 4R9CA 4BQYA 5ACA2 3ZXAC 1H2NA 4DY3A 4MADA 3USUA 3VBHB 1VMFA 1L3JA 1SDDB 2R073 1HXS2 2SLIA 1KQRA 2X53S 4LITA 1HRI3 3WF1A 4GZ9A 1V6IA 2BVBA 3BPSA 3T2QA 2YU2A 4JTNA 2MEV1 3I3BA 1YFUA 3SNMA 3TN91 1TE1B 2WWUA 2EICA 4RFT0 3THCA 5IVJA 3ZSMA 5EIYB 2IFRA 3H3LA 3N36A 4LBQD 2FDGA 2WZ8A 5FYTA 1VBB3 3NKGA 3MW2A 5E16A 1VBA2 2Q8EA 4Q4V2 3NJZA 1H6XA 5DQ0A 1S4CA 2BYVE 1LCLA 2WT2A 4OVEA 2HKXA 3SCFA 4AHYA 1XSRA 4XDOA 2P3KA 3BIWE 1DZQA 2ZGPA 4FPYA 1W6MA 4CUAA 3HT1A 4N53C 1CZSA 1PVC1 1CPNA 1QXRA 2IVIB 2YMZA 4LO6B 5JSPA 1TZOA 5FJKA 1R1A2 4MUVA 3TEXA 4AFBA 3ASIA 4P5HA 1UZYA 1ZM1A 3OGSA 4LBQA 3VKMA 1E57A 2VUCA 5JWPA 2HWF2 2WZR1 3S5AA 5I0UA 3K3NA 5J98B 2BJSA 2ETEA 3T1LA 4K7JA 2VNVA 2WT1A 4A7ZA 1DCSA 3WG4A 4CCMA 3T3YA 4R9BA 4AI3A 2ARAA 1C1LA 1PMHX 4ZKTB 1FX5A 3LEIA 3TEYA 2QJVA 2H0BA 5GALA 4XFGA 3RZMA 1B09A 5EWSA 3R6SA 1LENA 2DCTA 1N3OA 5LEKA 5FDBA 1R64A 1F2NA 2FZ2A 4C1XA 3BI3A 1E5RA 1EP0A 1OH3A 2XB6C 4Q4W2 1DZRA 3WDXA 4B3NA 5C71A 4YW3A 5JAXA 1S0CA 5SV8A 1AXZA 2ZKLA 1ND2A 1ND3C 3LF7A 3BODA 4XABA 1OMIA 4N53B 2QDNA 3ILNA 3AMNA 4JX0A 4GWIA 1DQ1A 2GDFA 4WZCA 1RUI1 1U5ZA 4I02A 3UK9A 3JCIA 2WWJA 3GCXA 2A70A 4H55A 4FAHA 1I1EA 3V0AA 5F5IA 1JXNA 1C28A 1DGWX 2NP0A 1W2AX 1PIV3 1V9U3 4QAWA 5J09A 1TMF2 3QLQA 4LO7A 1BK1A 1CAWA 3MBWA 5CFDC 2DF7A 5C3QA 2ERFA 1XPWA 2D93A 1LR5A 3OUHA 5FYIA 2UY9A 4IEVA 4YSFA 1J1LA 1UIJA 2IXCA 2VZ1A 3NAPA 1W6QB 4CCDA 4DEQA 5A3OA 5FY4A 4YW7A 1GP6A 1W9WA 3GBWA 3KF3A 4BK5A 3HD8B 1W9TA 2Y6KA 1VBC1 3A21A 4LLOA 4U36A 2JDYA 4E2GA 5FZKA 3QH6A 4WVMB 2W68A 3M8LA 1UPSA 5CG8A 1OA3A 1ZA7A 1RUC1 2VL4A 4CEYC 4QQLA 5LBBA 3VBUA 1ALYA 3AL6A 4AFAA 5A3WA 1LNSA 4CA9A 4IETA 2ZMLA 4JDNA 2ZOEB 1IPSA 4YW6A 3M3IA 3H9AA 1I5PA 4QX5A 4XQWA 1ND3B 3CO2A 1M06G 4META 3T2TA 2WO7A 3QOPA 2DFBA 3KB5A 4XBQA 2OPWA 1HDKA 1FNYA 3K48A 1JI6A 3AC0A 2XLFA 1GZCA 5A6ZA 5A33A 1L7QA 2W39A 1LGCA 5BPXA 4Q8KA 2DFCA 1RVF3 3GXUA 3OBRA 1RIRA 1GOFA 4CPBD 1AX1A 1D4VB 2EXHA 4QKDA 1MQTC 2BNOA 4QKNA 1OF4A 3N9NA 4BCUA 4QPWA 4WVWA 3KCYA 4EJRA 1OUXA 4B8EA 4XCAA 2V72A 1OF3A 4M4RA 1UQXA 3PUQA 3RVHA 2W9XA 1UY3A 5C7GA 3J8F3 2PLV3 3H3UA 2DUOA 3D0SA 4LHNA 4PLMA 4UF0B 5DAVA 3NJYA 1ZNPA 5C70A 4WM7C 1CWPA 2F4PA 2ZGTA 3JQWA 3WSOA 4O9EA 2JE9A 3WF2A 1B35C 2XJTA 5JLVA 1JH5A 1BMV2 3WNOA 1PGW1 4YVSB 3VBFC 1ODNA 1UF2C 2Z4FA 3NV2A 2JDZA 2R32A 2P4EA 3W59A 1GFF2 5DAWA 2VZOA 1LOFC 1W03A 3RS6A 2WFF2 3WDVA 1JHNA 4BXFA 2FDKA 2DBIA 1Z0HA 2VXRA 4NWWA 2JDHA 4LHKA 3JB8A 4HPKA 4QX2A 1WMFA 2CNAA 4CPBA 4PF1A 4E8DA 1VB4A 3ZPYA 3LE0A 3WCRA 2PELA 5GZFA 4XUTA 4DXSA 3USSA 5F6LB 4Q0PA 5A7WA 4KMQA 1G9AA 4LPLA 3PDQA 1LRHA 3EHKA 1F8VA 5FXWA 1XYOA 5FY7A 3PLQA 4BQ5A 2Y0OA 3ES4A 4AGGA 1RUE2 2OQ6A 4XF3A 4AG4A 2QQJA 2GNTA 2Y6HA 4DQAA 3KGLA 1MQTB 3AYAA 1Z78A 2W0XA 3WEZA 1L7LA 1GUIA 2ZHLA 3FE5A 1OOPC 3V64A 5HI0A 1CX1A 1HRV3 1KDMA 1REEA 3LB9A 4HBNA 3M7AA 4R8HA 3TNQA 3QD6A 4XHBA 1SACA 5CNAA 4PDWA 3VB9A 1AZDA 2JG9B 5GLVA 5HPOA 2P1BA 1Q8VA 3WX5A 1B35B 1HB1A 1COV1 4GB33 1JMUB 1W6NB 1PM7A 1SLAA 3VBFB 2D6NA 1VBD2 1YEWA 1M4WA 2RM21 4JGYB 3M4FA 4CDUA 1CAVB 1IKQA 1BK0A 3TBDA 1X82A 4BB3A 1O3TA 3WP6A 1JYVA 5IHRA 5B4XA 2XJPA 3AM2A 3CHXA 3FBMA 4BLJA 1BEV3 2IVJA 3R4DB 4Q4X2 2WS93 3VBOC 4C0HA 4EROA 3BCWA 4B7KA 3LDRA 5FZ6A 3RMXA 3I54A 4AQ2A 5HV0A 3VBRB 1U5IA 4LNVA 4JHZA 1X50A 2R071 2JB8A 4LHSA 2WSUA 4Z1VA 1HRI1 3WUDA 3AP4A 3DKWA 5I8TA 5L9BA 1WBFA 3TNPB 3HR9A 4P9WA 4CYDA 4CXXA 4I3GA 4RR3A 4AEDB 1OQEA 3GBGA 5ACA1 1JU4A 1QWRA 1YHFA 4P9YA 1OOPB 1SBDA 2XJQA 2JEMA 4L11A 4CUBA 1G86A 3J4UH 1TQ5A 2G19A 2ZABA 2W08A 4QX0A 3WG1A 4URTA 1DFQA 1PK6C 3MIBA 4N43A 5EP9A 1NA1C 5K0UA 3ZN5A 3RGBA 2W46A 4YM3A 3OB8A 3CJIC 1LEMA 2JDMA 4HSLA 2VGDA 4M3CF 3HAGA 3T0BA 3R4SA 3B9IA 2TEPA 3ES1A 3N9PA 2VTXJ 5IWFA 1J3QA 3U4XA 1W6OA 4CDXC 3BTZA 2HLEA 3FWEA 5FZLA 2FZ1A 4XIOA 1DQ4A 1NOVA 2B39A 2J1EA 3IBMA 3JD73 5F5CA 3VBOB 1VBA1 4QPIC 4Q4V1 3RFRA 1OLRA 2R063 5A6YA 4D3WA 1ASJ3 3WXPA 4X6QB 5DABA 4AFMA 4ZXEA 1AR82 1RXGA 1AF9A 1VPHA 2LALA 1EY2A 1SBFA 2CDPA 4KWKA 5HXMA 2GMPA 2HWC3 1FT9A 4W6YA 4WM8B 2BU9A 4BA6A 2R16A 1W8OA 1O8PA 3OYWA 3ACFA 2VW2A 4BE3A 3I59A 4OMDA 1XNTA 1A6CA 2ZGLA 2AEZA 1N3QA 1W28A 1QF3A 3GNEA 4KBZA 4HK8A 4A6OA 4DUXA 4PBOA 2VZUA 1XNKA 2JB4A 2ID4A 3FHAA 3U10A 2XGXA 3NKTA 4KBBA 3KMHA 2HWF1 1JOPA 1VLNA 2VG9A 1WZXA 1PK6B 1C8NA 1NA1B 4NAMA 5JR2A 5K7PA 5FAXA 3ZIWA 5L7OA 2YFUA 3ZXEA 5GM0A 3HNBM 4QX8A 1G7YA 2HWD2 2W92A 5CIRA 3OBZA 2LS6A 4B29A 2C26A 3J9SA 2ZZQA 4IERA 3ZKYA 1YYNA 5DZEA 2XWBB 1OSGA 4MXVA 3VKNA 2VPVA 2E31A 4OQ8A 4QPIB 3WDYA 1DHKB 1S2BA 5FQ0A 1HB3A 3ZFEC 3VZJA 5I8YA 2X5IA 2WRAA 4XE9A 2BGOA 4NR1A 3AZZA 1O3RA 2G1MA 3LFIA 2JDNA 5FV3A 3UJOA 2PAEA 2VCAA 4FOQA 1PZ9A 4GWMA 3PUAA 4XW3A 4XYXA 5IJRA 2BWAA 4KU8A 4PF5A 5A7NA 3N4MA 3D3AA 1W0NA 2ET1A 1VRBA 3CJXA 3WDUA 3CU7A 2R7EB 5J96B 5J1XA 4BIFA 2WAOA 1NZIA 3GALA 4XOGA 3KGZA 3MI8A 5D2AA 5DUXA 4UW6A 4Z8BA 1KRIA 2EIDA 2VZTA 2P3JA 2A7AA 1V0AA 3LA3A 1VJ2A 4TLFA 1K42A 4OFGA 1EAH2 1N3PA 2GALA 2GSYA 5DAQA 4RHV3 5A80A 1NZCA 1W8TA 2WFPA 3UNPA 2RMU2 4BH9A 2WN2A 5SV5A 3ZX7A 2Y38A 3DKQA 3NNGA 2FCUA 3O1PA 2UY8A 2E26A 4MGQA 4HOOA 2BOJA 4XZUG 3UT0A 5KWRA 2BFUL 5DUVA 3E5QA 4X6RB 3AKQA 1F35A 1QDOA 1GNYA 4ZU4A 1RVF1 3CZJA 3G6JB 4CEWC 2BNMA 4CU8A 1PGSA 1PX4A 4XF1A 2VMDA 2CL2A 2RS32 4GA9A 5A32B 4BQWA 5F2SA 3J8F1 2QQNA 3N3HA 2F4LA 3E6DA 1GMMA 5EQUA 5FYVA 2L9LA 3D0JA 3WF3A 1LHVA 5FYUA 1ZRIA 1WMEA 1DDLA 4YFZA 2XLAA 2YHJA 5IK8A 4EN7B 4QQOA 2BBAA 4S2DA 2UU8A 4TLGA 1SLBA 4XILA 4FPGA 4XFHA 3O0XA 2HEVF 4P9LA 4NIIA 3T2OA 2JDKA 4RQPC 4XF9A 5EJ1B 5EZWA 4I0WB 2GH8A 1RINA 4GIQA 1WD3A 4Z92B 2H0VA 1JYCA 5FP3A 5FY8A 3O1TA 3I4IA 1OVSA 1UU4A 1H2LA 2P37A 2XDVA 3AKSA 2JIGA 3ZSKA 3AFGA 3KCCA 1LEDA 4S2FA 1R083 4UT5A 5FTTC 5C9AC 1VMJA 3J7HA 2WFF1 2IXLA 4D6QA 1OLMA 3GZAA 2PFWA 2ZGRA 4GMP1 1JHJA 5EFUA 4N53A 1Q43A 1RITA 2WZR2 1FPN3 1K3IA 2E7AA 2OZ6A 2RHPA 4UXAA 3JQXA 5GZEA 4CCOA 4JHTA 3VKOA 2SBAA 4GWJA 5DN2A 5A3NA 3AYEA 3U1XA 1LGBA 2I74A 4QMAA 2AGSA 1EYBA 1DZTA 2DVFA 3NV3A 5A7OA 5LEJA 2VMGA 4XQ4A 5CFCB 1IG3A 3FHQA 1O91A 5AC92 5BNNA 1RUF3 5FPZA 4AFDA 3O1SA 1CQ9A 4QQ2A 3LKJA 5JDBA 2FMDA 4JAAA 1ZREA 4Q4Y3 1YJKA 3I2HA 3C7OA 2JWPA 4XF0A 4YWAA 5C3OA 5IK4A 4FOVA 1BEV1 4MXWB 4RN5A 3VKLA 1UPIA 2VOWA 1MS5A 4GXLA 5F3IA 3DPRC 1QXPA 5FWEA 5FY1A 4DRRA 1UKGA 3AL5A 1CGPA 5D8AC 2I45A 2ZHNA 3H7JA 3ETPA 1MZ6A 1SG3A 1GU3A 3LQCA 1WGPA 1CIYA 1F4AA 1W39A 2PHWA 1XBFA 4GJYA 3N9LA 4I0BA 1WLWA 4P9GA 1S0BA 3U78A 1ND3A 2B42B 2XVKA 3IZOA 4XJ8A 1Y7BA 3T2PA 1J59A 1JU3A 2ZHKA 5ERLA 1UY4A 3GM8A 4OYUA 1UXXX 2VR4A 2V4VA 2WZEA 1NCQC 3M1HA 4RSUA 4YW4A 2Q5TA 1JODA 4G4FA 1SCSA 2B45X 4QGMA 5LASA 4CUCA 1UMHA 4NMIA 1XYNA 4LKFA 5CKMA 5LA9A 4ASKA 4XUNA 2I07B 4L99A 5FXVA 4QHBA 2ZBJA 1K5JA 5CFDA 1OA2A 5JUVA 4CCNA 2HJIA 3MF6A 2EXJA 4QD2A 4LK6A 1YQ8A 1JYIA 2VE1A 3WR0A 3B93A 4JGZC 3AFKA 3TAYA 1RUC2 3C7GA 3OPWA 4BDVB 1HKDA 1LKNA 2Q0AA 3JD71 1DYOA 4L2NA 2ZEZA 4IGOA 2XL9A 1NCRC 2ADEA 2R061 4C90A 1ASJ1 4XXAA 2AENA 3H42B 1H8TB 4A3XA 5HV4A 4MX3A 4F3JA 4XC9A 4DRVA 2ZGUA 1JN2P 3D6EA 4CEYA 3CEWA 1GANA 2DVDA 1CJDA 2VNOA 4ARXA 4QT6A 2BVVA 4KG8A 1RUH3 2J22A 2A71A 2WDBA 2WNOA 4INDA 4XBLA 3T4VA 3UV9A 4AE2A 1LGNA 3F95A 3I3QA 2XG3A 1RMU3 3JZVA 2CTVA 2ZX3A 1NUKA 2VCMA 3ACGA 2JKBA 1S0GA 3CNAA 4FOYA 4JDMA 4Z82A 4LO8A 4YZ2A 3ZYIB 1AR81 1IG0A 3U14A 4KNCA 3SLIA 3WQ1A 4UOJA 4WBBA 3W21A 3OGVA 4YG3A 4DZGA 1N1TA 1I9RA 3FJSA 4P02B 4IV3C 1J84A 2W52A 5DG1A 4AQTA 2D98A 2EA7A 4P08A 4QU1A 1MQTA 1KGYA 2FMYA 4DXTA 5A1AA 1MZFA 1D4M2 2PHFA 4PQQA 4CRQA 1YJLA 2VUJA 4JGZB 5LK5A 3KLSA 2D3RA 2CSGA 4TYSA 2NYYA 4WM7A 5FKBA 1S2KA 3B02A 3OSDA 3PIGA 5BNPC 1UY0A 2EALA 3ILFA 1B35A 3APBA 1SFNA 3JB4C 1GOHA 4PIXA 2VTFA 3THDA 3VBFA 3WW2A 1C57A 5I91A 3ZYFA 2HWD1 2W5FA 5C8CC 4AHWA 4XUOA 1LOFA 3RNSA 2XKPA 1ZBE2 1ZZCA 5LW9A 1WLTA 4MV2A 2Z2SB 4YLZA 1PO13 2XVLA 3TOJA 3ZN6B 2QQWA 3OGRA 4Y1XA 3ZXGA 4W6WA 2WNUC 1QH6A 3TB0A 3QBQA 2W2IA 5LBCA 1JUIA 3MLKA 1XXNA 1WCDJ 1WCKA 5EYXA 2DVBA 4NROA 3VBHC 3W5MA 3ZXJA 3O1UA 1OH4A 2UWBA 1VRH3 4IV3B 3WCSA 2ZMKA 3BALA 4N9IA 4RHV1 2RE9A 3G7DA 5FREA 2IC1A 3ZFFC 3A23A 5G04L 2ET7A 2OVUA 4CDWB 1OOPA 1G9CA 4ZONA 2HWB3 2AREA 1N1YA 5EHDA 3U37A 4M3CA 4XJUA 4B4PA 2GNBA 5IVFA 1WW4A 1ZBA3 2X10A 2VNRA 3KV4A 4CDQB 4QHZA 2VTXA 4BM8A 1EAH1 5E89A 1WKYA 2WQ8A 3GF6A 3GZEA 3E5XA 1N47A 3ZPOA 1HIXA 1HX6A 3FLPA 3DCQA 5FKCA 4LR4A 5BUVA 5GZCA 2VVEA 5E6HA 2RMU1 5FZCA 3WDWA 3WUCA 5BNOB 1OLME 4HN1A 3OBAA 2VQAA 3SHRA 3AMPA 4IDZA 1VB2A 1DLCA 3LDBA 4N9HA 3IM0A 2R072 3IT8A 1O8SA 3WY6A 2D3SA 3T09A 3VBOA 2P3IA 1OC1A 1HRI2 2J1AA 1QOSA 1W0OA 3WW4A 2QNKA 1ULFA 4FI9A 3SCGA 3HIFA 3KWVA 4YZ5A 1QJEA 2JE8A 5JOZA 5FZ4A 4FPFA 2WA4A 2XOMA 5ISLA 1RJ7A 1R093 4HFSA 4MSVA 4QB2A 5JR7B 3JUUA 4J25A 2A3WA 4UW3A 4GKYA 4GH4B 1QOOA 3ZFFB 4ARYA 2RS31 3O1MA 1KFXL 3MF9A 5KR7A 3RZJA 5F9TA 1Y9QA 2TBVA 2YG0A 3W58A 2A6WA 2AUYA 2BP6A 2ILMA 1W05A 2QQVA 1XOYA 2RR11 3FLTA 4XFFA 4CE8A 5IVCA 2Z79A 1HV1A 2E32A 3Q9OA 4HN0A 5IK7A 1U12A 1NAEA 1RL3A 4BHPA 4Y22A 1PK6A 1LB2A 1W0PA 4FTSA 2JG8B 5HCAA 3CJIA 1R081 4Y26A 1Q8QA 2WC2A 2BPA2 4QXCA 2E51A 1GV9A 4CDXA 3LWCA 3N7KA 2OKXA 1OLQA 1YQ5A 4Q8LA 3M2MA 5FR3A 2NN8A 2JKXA 4QPIA 2DCZA 1YFYA 1YNAA 2C5DA 2PQQA 1C3HA 3A7QA 5FCCA 4J1WA 3M3EA 4FO9A 4L8QA 4R9AA 2CY6A 5C33A 2D44A 1MVEA 4LBNA 5J48A 4Z2AA 2D6MA 1Y4WA 2OS2A 4FPLA 2GC1A 2VVFA 2Y34A 3RSJA 4AXOA 2EIEA 1QOTA 2YBKA 5JI9A 5LRSA 2DURA 2XH6A 3ITQA 3MDPA 5FOJB 1AR63 1DF0A 1X9TA 1D2QA 2ZX0A 5AVPA 2UWCA 2W87A 1RUG3 5LBEA 1GWLA 4Q4Y1 1NG0A 2ZX2A 5FZ7A 3LDKA 5JIAA 2PAKA 4UW4A 1ENQA 2OXBA 4DEVA 5I0RA 3BKZA 3AMMA 2LROA 3RJRA 4K8FA 4FPOB 3MPBA 1PNFA 4PJYA 5AC91 2JECA 4EZ4A 2D6OX 1O5UA 3ZFGC 2DDUA 3WNNA 1LTEA 5KHJA 4H7MA 3VDBA 1QJU3 1TVGA 3DXUA 1GYKA 2WR9A 3HNYM 3ILRA 4PIZA 3IPVA 5T55A 5L36A 3IB3A 3O14A 1REDA 1XE7A 1U0AA 4FT8A 2JXAA 5K9YA 5FK8A 1ZYBA 4FPEA 4D0QA 4MG2A 1S0JA 1CZTA 3ON7A 4K1YA 1GQGA 4BOWA 1RXFA 1UOGA 4LBOA 1PIV2 1V9U2 5FIXA 4BWOA 4NN0A 3ZFEA 1YI9A 5JCTA 1UZWA 4QX1A 1SQ4A 3ZDSA 3LA7A 5FP4A 4ZXKA 4B4RA 1W6PA 4IE5A 4EWDA 5FMOL 4YPJA 3POIA 1FXZA 3IIIA 3P5BA 4ASMB 4LOSA 1AYM3 3VGIA 4A44A 1ZA4A 1SCRA 3PU3A 4RGKA 5A3TA 5EPAA 3RRDA 1C4RA 5C3PA 4M00A 2VZRA 3EBRA 5FO7B 5CA6A 2E53A 4E9KA 1TME3 4BLIA 4BU2A 1CN1A 1UOBA 1O4YA 4BYYA 3NW4A 4QKBA 1LHUA 3K77A 4YVSC 3ZFGB 2WQZC 2E63A 3VBSA 2Y6LA 3I3MA 4Q2FA 4MGKE 2ZGNA 1OURA 1RUH1 2OX0A 1FYUA 2QQUA 2ZEYA 5DXDA 5H9PA 1AX2A 4HVRA 3UKVA 2R1DA 1RMU1 1RVF2 3BVCA 1ULDA 3POBA 5LY2A 4IEQA 1AYN3 5FPUA 3FL7A 2MHFA 3M3CA 3ZXKA 1C1FA 1J58A 1RUD3 4Z07A 2FCVA 5F3EA 4FFIA 5C6CA 1H2KA 2RJKA 1AL23 5FZ8A 3KHBA 1Z7S3 2PLV2 3J8F2 3PL0A 4NVPA 3V65A 4CEWA 5CISA 1S1AA 3UGHA 4DXRA 4ZZ8A 4URAA 2J1UA 3OD0A 2BOIA 4M0NA 3PNAA 2GMEA 4M3CE 4XUPA 2D6LX 2YBSA 1RHI3 2B4KA 3ENRA 4EN0A 2ZA9A 3B5LB 3BTAA 1YIPA 4GMP0 1AXKA 3UL2A 2ORXA 2ZJCA 3MZHA 4K1ZA 1QJX3 2AC1A 1LOEA 2D43A 2EXKA 2FBEA 2JG9C 4H3WA 3AVSA 4JKLA 4DB5A 4AQ6A 4UBHA 1ZZ9A 3ACHA 3FFZA 1QU0A 4NHXA 1D4M1 5KHKA 3HQUA 1XYPA 1HN1A 4NJ4A 2BW8A 2RVAA 3HBKA 4JRLA 4UFJA 2XBO3 1O5LA 5E88A 1RJ8A 3T1MA 4FPJA 4JGYC 5FYMA 1QDCA 4RQPA 1PO11 1LULA 1UNBA 4ZZ5A 5A70A 4UI9L 4RFRB 3H0OA 1K12A 2FDJA 3KV9A 1EV13 4K20A 5IUQA 5K4LA 1AR73 1QNWA 3HBZA 4MO3M 3ZO0B 3OPZA 4K3UA 1XC6A 1CAUB 2FQPA 2DU1A 5C9AA 2QQLA 4PHZA 1LOBA 4D6SA 1ZBE1 4NPRA 3PMEA 1HRV2 3VBRC 1Y9GA 3EQEA 4PCRA 4P14A 2WA3A 3UESA 1DIWA 3RDIA 3ALQA 2I2SA 2GC3A 4HONA 1IS4A 1R1ZA 1YRZA 4GB32 1XE8A 4AEDC 5I8SA 5L19A 3CLPA 3LAGA 2C6SA 4SBVA 3BYWA 1H8VA 2V09A 3FFQA 3KSCA 4XFCA 1ZBA1 5DUWA 3CF6E 2XQRA 4GAZA 4AFCA 3VHNA 4XXPA 5C5TA 5DZGA 3KCXA 3KF5A 1F4HA 3LPFA 1ENSA 3PVOA 4JKKA 5KXBA 1BEV2 4HVOA 2PAMA 1V6NA 2WS92 2WWSA 2D7FA 4IW3A 5I0DA 2N7GA 2UYAA 1TG7A 1FAYA 2VOVA 4PI2A 1W8WA 2YGLA 1A78A 3I2DA 3MICA 3P6BA 1Q3EA 4D7YA 4MOAA 1YC61 5FYCA 4M01A 4LLFA 2K2SA 1BKZA 1H1MA 4DUVA 3DPRA 4AOCA 5D8AA 1IS5A 3T4HB 3ACLA 3I2OA 1QMJA 1RUJ3 1Q5OA 2BQPA 1QJY3 4W4ZA 3DYMA 2ZGOA 3B01A 4YFWA 4QGLA 1EPWA 2WUHA 3GZTB 4O9GA 4YVWB 4DINB 2VULA 3ZOIA 5KXEA 4XVHA 5JOWA 4WM8C 2YPDA 1C8M3 2QUOA 3H7YA 1W06A 1NCQA 4KGGA 5AVAA 2RS13 1VAVA 4NO4A 5LA1A 1BXHA 3ETQA 1LAJA 1PNGA 5GZDA 1BYHA 3IIAA 2VD7A 4QB1A 1VBB1 3PVNA 3AJZA 4H2AA 3LZZA 3SMHA 2BUKA 2IXHA 3JD72 2ZTNA 1L7RA 1LOGA 1UZ0A 3IWZA 1VAKA 2R062 2CAUA 1SPPB 1NT0A 1UAIA 1ASJ2 1GQHA 3BGAA 1X36A 3UETA 1TNFA 4CUGA 5EJZB 1POV0 4IGQA 2AR6A 1VE0A 2PMWB 3C7EA 2OIIA 3RWNA 3MV01 2QVSB 5J37A 2HWC2 2W1QA 2W95A 1NCRA 2VU9A 1MZEA 2YU1A 3AZYA 4FXKB 5T5OA 1H2MA 5KHIA 4EZHA 3VL9A 1LHOA 3V0BA 2AH2A 3C8XA 1AUYA 5CBLA 2IZWA 4AVCA 2RJ2A 1H1AA 2ARBA 2QQKA 2J1RA 1BMV1 1MACA 3ATGA 4PT6A 5IFTA 2AZ5A 4MZUA 3POEA 4W6XA 1XSQA 1GQPA 4AF9A 4BQ2A 3WNXA 2A75A 4C91A 2GNDA 1AR61 3FMGA 5A3UA 3H3ZA 1RGSA 1H0BA 4QQPA 3RQ0A 3VUOA 2C24A 4RS5B 5JSOA 2ZAHA 1ZX5A 4COWA 2RDSA 4D69A 2XXZA 3WNKA 3Q8AA 1QH7A 4HLTA 2BFUS 1UX7A 2GP5A
chains in the Genus database with same CATH topology
1WZXA 2LRPA 2KR2A 2WYFA 2LROA 1UOJA 2Q1FA 1W8WA 2JWPA 4LJHA 1GWKA 5D21A 1W8ZA 1W90A 4YWAA 1W9FA 3UT0A 4YW6A 2K46A 4LKFA 2O14A 4BQ5A 4BQ3A 4LKDA 1HN0A 4BQ4A 3F95A 4BQ2A 2VXJA 3ZYHA 1GWMA 4AL9A 4CP9A 1L7LA 1OH3A 1V0AA 1WCUA 3ZYBA 4LK6A 3ZYFA 4LK7A 4YW7A 2C24A 1OKOA 4LKEA 1W8TA 4CPBD 1W8UA 3ORJA 4CPBA 1GWLA 4CP9B 1WMXA 4A6SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WZX A;  2LRP A;  2KR2 A;  2WYF A;  2LRO A;  1UOJ A;  2Q1F A;  1W8W A;  2JWP A;  4LJH A;  1GWK A;  5D21 A;  1W8Z A;  1W90 A;  4YWA A;  1W9F A;  3UT0 A;  4YW6 A;  2K46 A;  4LKF A;  2O14 A;  4BQ5 A;  4BQ3 A;  4LKD A;  1HN0 A;  4BQ4 A;  3F95 A;  4BQ2 A;  2VXJ A;  3ZYH A;  1GWM A;  4AL9 A;  4CP9 A;  1L7L A;  1OH3 A;  1V0A A;  1WCU A;  3ZYB A;  4LK6 A;  3ZYF A;  4LK7 A;  4YW7 A;  2C24 A;  1OKO A;  4LKE A;  1W8T A;  4CPB D;  1W8U A;  3ORJ A;  4CPB A;  1GWL A;  4CP9 B;  1WMX A;  4A6S A; 
#chains in the Genus database with same CATH topology
 2ZEX A;  1SDW A;  3MO4 A;  3CKH A;  1CON A;  1RB8 G;  3N9M A;  1T6B X;  3K51 A;  1H30 A;  3PVE A;  4B4Q A;  1YFW A;  3AP6 A;  3B00 A;  4JDO A;  5FZD A;  3USU B;  2JX9 A;  4COV A;  3OJB A;  3O7O A;  4Q0S A;  4XUQ A;  3S7I A;  5BNP A;  1IZ3 A;  5DPN A;  3UJQ A;  2R04 3;  2J42 A;  4JC1 A;  4Q1P A;  1G8W A;  5CG9 A;  5E1R A;  4Y20 A;  4LTA A;  3JU9 A;  4YYO A;  3H8X A;  5C8C A;  2XON A;  4ISR A;  3WNM A;  3ZN4 A;  2A6X A;  3WG2 A;  4DY5 A;  3K2O A;  4PBP A;  3D4K A;  4HMZ A;  1JW6 A;  4DPN A;  5FZ0 A;  3VL8 A;  2WNU A;  1S0D A;  1PIV 1;  1UMI A;  1V9U 1;  4MGI E;  1O3Q A;  3OY8 A;  1CES A;  4RHV 2;  4FQZ A;  1S2E A;  2EXI A;  1CX4 A;  2GAU A;  4XDP A;  3ROU A;  5I0S A;  4YNI A;  1YFX A;  2XHN A;  4Q1R A;  3C7H A;  3VBH A;  3BN6 A;  3L2H A;  2BNN A;  2AEY A;  1TME 1;  2ZS6 B;  3ZYB A;  5LA0 A;  2E33 A;  4LHL A;  1W6M B;  4OCT A;  2WKK A;  4A45 A;  3R4U A;  1MPX A;  1DG6 A;  1CAX B;  1PMI A;  1W8H A;  2W3J A;  1W8U A;  1PX3 A;  2QZ2 A;  3RJ2 X;  1Y9M A;  3JBG 3;  4RGG A;  3ACI A;  1X7N A;  2Y26 A;  5FY9 A;  4LBQ B;  1IOA A;  1WMX A;  4AI1 A;  3SEP A;  1ONA A;  2IXK A;  3DXT A;  2QCS B;  5FZA A;  1YLL A;  2R0F A;  5DUU A;  1BBT 3;  3RI9 A;  4AVS A;  1FMD 3;  2DVG A;  1NYW A;  2QQO A;  1UYX A;  3C7F A;  1GZW B;  4JVA A;  1VBE 3;  4MVT A;  1MEC 3;  5F3G A;  3PUH A;  1Z7S 1;  4NID A;  2ADD A;  1PZ7 A;  5FYY A;  4CP2 A;  2IXJ A;  5CEH A;  2QDR A;  5FMD A;  4ZHN A;  1CIW A;  3BUC A;  1VR3 A;  2H6C A;  3MUZ 1;  4A42 A;  4AVV A;  5FZ3 A;  4EWE A;  1TNR A;  1GNH A;  1N1S A;  2JIC A;  1GLH A;  1S0I A;  1ZRC A;  3HMY A;  3SCH A;  4MH0 E;  3DV8 A;  4PQ9 A;  2YXS A;  1GR3 A;  1JYT A;  4KWL A;  1SHW B;  2PHT A;  2PLV 1;  1PO2 3;  2RR1 2;  3W9A A;  4D7T A;  3MID A;  1ZZ8 A;  3AZV A;  1JYN A;  5D21 A;  4FVV A;  1ULO A;  1UU5 A;  5FLJ A;  5CFC C;  1YUD A;  4UFM A;  3UKN A;  1QQP 3;  2XBO 1;  3EYP A;  3RG0 A;  4F8A A;  2D5F A;  1R08 2;  4BME A;  4LEJ A;  3U75 A;  4QU2 A;  2HBT A;  4E4S A;  3I49 A;  4QKF A;  3V0A B;  1O7F A;  1W2N A;  2DYC A;  4HKW A;  4NHK A;  5GJ6 A;  3H8U A;  4QDS A;  4XHX A;  1CAW B;  2YDE A;  5HCH A;  1ULP A;  3I2J A;  2Y6G A;  1V00 A;  3BOW A;  1GKB A;  4XCB A;  2Q30 A;  1FPN 2;  4BK4 A;  5KC6 A;  4YW2 A;  1ULE A;  4R4X A;  3PTY A;  5G05 L;  3AK0 A;  4NIA A;  4LO5 B;  1WW5 A;  5DMY A;  3FUO A;  1XQN A;  2MEV 3;  4CP0 A;  1JZ4 A;  3QCW A;  3KT4 A;  4DFS A;  1OKQ A;  1RUF 2;  3TN9 3;  4FFG A;  3VBU B;  1JZ6 A;  4PI0 A;  1HRV 1;  1ULC A;  4LBM A;  1SLL A;  2BER A;  4RYD A;  4Q4Y 2;  3V56 A;  4C8D A;  2IFW A;  2OYZ A;  3LEK A;  5L9R A;  4XMI A;  1APN A;  1NXM A;  5FJH A;  1C5I A;  4GB3 1;  5T50 A;  4BQ1 A;  1ODM A;  4P5Y A;  4QPG C;  2VBB A;  2B8M A;  3FN9 A;  4LA2 A;  1UL9 A;  1AR9 3;  3LCP A;  1IPK A;  5A33 B;  1LHN A;  2C1F A;  3MIF A;  4YAR A;  3PVB B;  3B94 A;  1OD3 A;  1W6Q A;  1AX0 A;  2JE7 A;  4MYE A;  5C3R A;  3VD4 A;  5T5P A;  1NY7 2;  1EUT A;  2DTY A;  2XL7 A;  4AEM A;  3WG3 A;  2WS9 1;  2CGP A;  3O1O A;  3ZFG A;  3HEI A;  2ZPX A;  4WVM A;  1PVC 3;  3X29 B;  1H8T C;  1QJY 1;  1SEF A;  4E2S A;  4J1X A;  3D8C A;  4PDW C;  2YV8 A;  3GCW A;  3VLB B;  2D6K A;  4AI2 A;  5IAX A;  4LOR A;  1GP5 A;  1VP6 A;  4Y1U A;  2Y8K A;  3HT2 A;  3IDA A;  1C8M 1;  2RJL A;  2O8Q A;  2OUH A;  5IVV A;  3J7M A;  2ARC A;  3MYX A;  2ZX4 A;  2WT0 A;  4COY A;  3P1I A;  4FFH A;  5FZI A;  2A6Y A;  2NLR A;  4NRP A;  4W8J A;  5GZG A;  3S7E A;  2NMO A;  4HPK B;  3SIS A;  2VUD A;  3QH7 A;  1WWY A;  4LXL A;  3N9Q A;  4P00 B;  4QPG B;  5DAX A;  5T5L A;  2X09 A;  3AP9 A;  1FOD 3;  2VO5 A;  5C8W A;  1QEX A;  1S0F A;  3RYK A;  3BPZ A;  2PN5 A;  4L9B A;  2DCY A;  4UF0 A;  1UYP A;  1W8F A;  2C0Z A;  2RDN A;  2ZZJ A;  3NV4 A;  1Q8S A;  4KH9 A;  5A7Q A;  1J83 A;  1RUH 2;  2JD4 A;  2GN7 A;  1VAL A;  2YRO A;  3DYP A;  2ZAA A;  3MIE A;  3POS A;  2VZP A;  3E6B A;  4P9I A;  4RGA A;  1RMU 2;  3D82 A;  2CV6 A;  4YVS A;  1KS5 A;  5FPX A;  1K5M C;  5FUI A;  3I2F A;  5EYY A;  5FZO B;  1OVP A;  1RUI 3;  4PDW B;  4A7Y A;  2VOT A;  2VQT A;  1IS3 A;  4K40 A;  2HWC 1;  4AGV A;  3M70 A;  2DUP A;  5LZ6 A;  1AHS A;  1NLR A;  1D7P M;  3PUI A;  5FPA A;  1HQL A;  2QE3 A;  2DBN A;  1MS1 A;  2VW0 A;  3CQO A;  4CCC A;  1XU1 A;  2XKO A;  2Q8C A;  1C5H A;  1OI6 A;  5JMC A;  2OT7 A;  4S2H A;  4YM1 A;  1UMZ A;  3TYJ A;  4IXL A;  2TUN A;  4Q26 A;  2XQX A;  1VBC 3;  3Q8E A;  2ZX1 A;  1W2T A;  4HKO A;  4XJZ A;  3VDD C;  4A2U A;  1OQ1 A;  3E6C C;  2O1Q A;  4P9X A;  1JBC A;  3UGF A;  5ANQ A;  4ONU A;  4CDW C;  2WJS A;  5F39 A;  3WV6 A;  1ACC A;  3FHI B;  1JUH A;  4FP2 A;  5IK5 A;  2GZW A;  4QGN A;  4CTE A;  5T5J A;  4WZF A;  5FBZ A;  4LIV A;  2JG9 A;  1UD1 A;  4KWU A;  4CDQ C;  5F37 A;  1A8M A;  1PO1 2;  2R04 1;  2CDO A;  2XVG A;  3R0R A;  1Y43 B;  2GMM A;  4KWJ A;  4RL7 A;  3VV1 A;  4RR3 B;  1ENR A;  1JZ2 A;  2CU5 A;  3HVD A;  1DQ6 A;  1W6N A;  2CGN A;  1GBG A;  1K5M B;  1V6J A;  2ZEW A;  4JGY A;  5BNO C;  4HKL A;  3OPT A;  5H9Q A;  2F6B A;  2A5Z A;  1CAV A;  4W65 A;  5IW0 A;  2JD9 A;  1DYK A;  5F5A A;  3DN7 A;  5JIU A;  5K0U B;  4FCA A;  4N43 B;  5JZG C;  1VRH 2;  1JYW A;  1I3H A;  2BEO A;  4LIU A;  3N7J A;  5LK7 B;  3PJQ A;  2ZXQ A;  4BIO A;  2MPF A;  2UWA A;  3FLR A;  1VAM A;  4OI1 A;  4I3P A;  3VBR A;  2HWB 2;  3T0D A;  3I8T A;  2IXI A;  3N35 A;  5C4W C;  1ZBA 2;  2D5H A;  4IEY A;  2LTN A;  5C3S A;  3VZK A;  2WLQ A;  4CCL A;  1WD4 A;  1TEI A;  5BYN A;  2EF6 A;  3VDD B;  4GH4 C;  4DO0 A;  5L73 A;  4AED A;  2QQP A;  1K45 A;  1SFP A;  3JBG 1;  1LJ7 A;  5ABJ C;  5GLT A;  2QBX A;  3HWJ A;  5F6K A;  2OZJ A;  5FZE A;  2FDI A;  3KD4 A;  3KT1 A;  3L9J T;  4LJH A;  4Y3O A;  1BBT 1;  2WYS A;  2KR2 A;  3I59 B;  4AI8 A;  3C2U A;  4XDQ A;  2R0H A;  4ZU5 A;  1G9F A;  1SPP A;  1PZ8 A;  2JG8 C;  2Z69 A;  2ZAC A;  3E5U A;  2VME A;  3H50 A;  4OHZ A;  2E6V A;  4ZU7 A;  2VVD A;  3MV1 1;  1Q8O A;  1R09 2;  5BV6 A;  3POG A;  4AR2 A;  4GAL A;  3CDZ B;  5GLZ A;  1WCU A;  1POQ A;  1QXJ A;  4OMC A;  5JZG B;  4COZ A;  4G9S B;  2HEW F;  4EN6 B;  2PHU A;  3NJV A;  1G9B A;  1OPO A;  3IMM A;  5DDJ 3;  1J3P A;  5FPB A;  4AGR A;  2JDA A;  5JSR A;  4R9D A;  4ASL A;  5I93 A;  2VMI A;  1VIW B;  2LM3 A;  4QXB A;  4IEW A;  5C4W B;  4FAG A;  3F2Z A;  1XE0 A;  4WM8 A;  4XJA A;  1COV 3;  5FQ0 B;  1VBB 2;  4UFH A;  1QQP 1;  2RS5 3;  4V1P A;  4Q0V A;  1W9F A;  2XWJ B;  1X8E A;  2X5I B;  2RM2 3;  3LSD A;  3PHM A;  4FTE A;  3KZ4 C;  2PA7 A;  3NV1 A;  3SH3 A;  2YB7 A;  1S0E A;  4MGY E;  5KXC A;  1NE4 A;  4FSJ A;  3RMY A;  3PUS A;  2PQS A;  2NPI A;  1KJR A;  3VZL A;  2YC0 A;  4LK7 A;  4XEZ A;  3ZVX A;  1NA1 A;  2A3X A;  4Z2W A;  2HWE 3;  2R30 A;  5J3U A;  3FUQ A;  1QNY A;  2E7T A;  3ZDV A;  3WZ1 A;  2FCT A;  1ZZ7 A;  3E97 A;  4L0P A;  1O6U A;  5FMO S;  3KS7 A;  2ZGM A;  5DAP A;  4CP9 B;  3VHO A;  1XRU A;  2BDR A;  2JDU A;  3NNF A;  4K9S A;  1W8N A;  3WHU A;  5IT6 A;  1J1T A;  2KM2 A;  2B9U A;  2VMF A;  3WD5 A;  2WIN B;  5FY5 A;  4FTB A;  4LQR A;  2HYX A;  1KDK A;  5FZH A;  5HCF A;  5JXG A;  1A3K A;  4E27 A;  2A3Y A;  5ACA 3;  2PYT A;  3S57 A;  1KXG A;  1AR6 2;  1FPN 1;  2UUR A;  3MEP A;  3OGG A;  2VQU A;  3K46 A;  1RUG 2;  3PIJ A;  5I0T A;  4V2V A;  1QJF A;  1HXS 3;  2G4I A;  2VC9 A;  2P5B A;  1F9K A;  3NVC A;  3PU8 A;  3OUJ A;  1MR5 A;  2GNM A;  3GDB A;  4AWD A;  1RUF 1;  1QIQ A;  1DP0 A;  1MS9 A;  4FOW A;  3MW4 A;  3SH4 A;  1AR9 1;  2XR4 A;  4JQR A;  3BTX A;  2WNV C;  5A3P A;  1XU2 A;  1QJU 2;  3GJB A;  4A7K A;  5CU1 A;  3NNJ A;  1MS3 A;  1HQN A;  2YGM A;  3ABZ A;  3AMH A;  4CCE A;  1NQD A;  3AXD A;  1SZB A;  3GHN A;  1V70 A;  1VBA 3;  4E8C A;  1YXW A;  4Q4V 3;  1CAX A;  2J1V A;  4EE2 A;  3MGU A;  1US2 A;  1OBN A;  2NM1 A;  2WLP A;  4LKD A;  2KA3 A;  3BB6 A;  4BQ4 A;  1YO8 A;  4HL0 A;  4SLI A;  2O0O A;  1OHF A;  5T3N A;  3W20 A;  4OUL A;  2VNG A;  3IAQ A;  1NX9 A;  1XB9 A;  1MZ5 A;  1X8M A;  2PHL A;  2Z42 A;  1NY7 1;  2B9V A;  1Q56 A;  3D5O A;  3RWK X;  3M3O A;  2A1X A;  1UZZ A;  4QX7 A;  5BNN C;  1SBE A;  4ES8 A;  3TEZ A;  2Q1M A;  3NST A;  1AYM 2;  1CR7 A;  3E1F 1;  1R1A 3;  3UYJ A;  1GZW A;  4N8M A;  2BZD A;  4UFL A;  2ZGQ A;  2O8O A;  3AVR A;  3O0V A;  1D0G A;  4GD4 A;  2W1S A;  4E4H A;  3OEA A;  4A41 A;  2GP3 A;  3LD8 A;  4N7I A;  5CZK A;  2HWF 3;  3FZ3 A;  4LE3 A;  4JZR A;  2P2K A;  4LMF A;  2JIJ A;  5FMB A;  2W1U A;  3OD4 A;  5A7P A;  1TME 2;  5IVB A;  1HB2 A;  5IAV A;  3OF1 A;  2XJS A;  3LEG A;  3O0W A;  4HET A;  2XPJ A;  2B46 X;  1FOD 1;  1FI2 A;  3KQR A;  1QY4 A;  4Y5Z 0;  4IUG A;  3EXU A;  4YZ1 A;  5A32 A;  2R49 A;  2PHX A;  2WNV B;  4IL7 A;  4AAP A;  4YGD A;  2ORZ A;  1HJF A;  3WHT A;  1HJG A;  1H9W A;  2DU0 A;  1UYY A;  3DUI A;  3I7D A;  2HH9 A;  3BU0 A;  4BJ0 A;  4LKE A;  5CB7 A;  1I5Z A;  4K6B A;  4IV1 C;  4HVQ A;  2XUM A;  2XJV A;  1HLC A;  3ZYG A;  1MS8 A;  2EAA A;  1AYN 2;  1F15 A;  1OUS A;  2D97 A;  3CIH A;  3KT7 A;  4IE7 A;  4XIK A;  4YM0 A;  3IKW A;  4AEK A;  1RUD 2;  4Q4W 3;  1BHG A;  4JV4 A;  2ZMN A;  3RZL A;  1UO9 A;  1AL2 2;  1KEX A;  2OQ7 A;  4GQ7 A;  1Z7S 2;  3SKV A;  3ZYR A;  4TXW A;  4D7S A;  5IFP A;  4CZS A;  4BQX A;  1D0H A;  2DWR A;  2MNG A;  4Y1V A;  2CWM A;  1OA4 A;  2DCJ A;  5LRR A;  5BNN B;  2Q4S A;  1KJL A;  2XHK A;  3AX4 A;  4D8M A;  3M3Q A;  3OTF A;  1RHI 2;  5IYY A;  2G9F A;  2OA2 A;  3ZSJ A;  1PGL 1;  4MGZ E;  2W94 A;  5E8A A;  3HQR A;  5FZB A;  4KG0 A;  3RPQ A;  1QJX 2;  2VM9 A;  5FZF A;  2DCK A;  1AJK A;  1AXY A;  2JJ6 A;  4UYB A;  3ZR6 A;  4IES A;  1TMF 3;  1FNZ A;  4OI2 A;  1FV3 A;  3U0Z A;  2HYK A;  5J7M A;  3RZZ A;  1U5X A;  2VAU A;  3LGR A;  3O5S A;  2XBO 2;  4LUM A;  5F5Q A;  4H7L A;  4TZD A;  3RYR A;  4KQ7 A;  1W3V A;  3AYD A;  3O1R A;  2Y33 A;  2G9G A;  1WBL A;  4I0A A;  1UKR A;  2A6Z A;  3RZG A;  1EV1 2;  1F31 A;  1AR7 2;  4IV1 B;  5CFC A;  4XFA A;  1H1I A;  2VZS A;  1REF A;  2OUJ A;  3P3P A;  2DTW A;  4NUB A;  4AAX A;  4BXS V;  5GLW A;  3VDC A;  4S2G A;  3BOP A;  1V6O A;  1P8J A;  1UCX A;  4CXW A;  5FUN A;  3SC7 X;  4KGQ A;  3EO6 A;  1NKG A;  2X8K A;  1FV2 A;  4HZF A;  1PHM A;  2BWC A;  2V5D A;  4MXW A;  3WQB A;  4TN7 A;  3EJK A;  3W5N A;  5CFD B;  2AAC A;  3J26 N;  4AVA A;  1KS4 A;  3PMS A;  1UOJ A;  3B3Q E;  3WLU A;  1W2O A;  3VN4 A;  1Q8P A;  4YVW C;  1VRH 1;  4YW5 A;  3THP A;  5AFB A;  1O3S A;  4BZ4 A;  4IEO A;  1CD3 G;  5FMC A;  2PXJ A;  4CEY B;  1W9Y A;  4N7U A;  2HWB 1;  2QFE A;  4XQD A;  2Y0I A;  1LU1 A;  1OKO A;  3GGL A;  1WMD A;  4XJW A;  3ZYJ B;  2GC0 A;  5CYY A;  3WNL A;  3KV6 A;  4UAP A;  3LEM A;  4ET7 A;  3NRU A;  4UW5 A;  1JOJ A;  4QPG A;  2ZCW A;  3VD9 A;  2OW4 A;  3B69 A;  2ES3 A;  2E7Q A;  2KD7 A;  1W2U A;  1E5S A;  4OLL A;  5KHH A;  2WFF 3;  1U5Y A;  4XTM A;  1RUJ 2;  2XUE A;  1MS4 A;  1QJY 2;  2WAA A;  3VHP A;  4CU6 A;  5IAT A;  3QAC A;  4DIQ A;  4GMP 3;  1HN0 A;  3FC0 A;  2Y6F A;  2Q8O A;  3WW1 A;  3AKR A;  2Q8D A;  1H8T A;  1NLS A;  2Y64 A;  5DDJ 1;  3T30 A;  1C8M 2;  1T2X A;  3H1Y A;  3MHZ A;  1VMH A;  3J7N A;  3OBT A;  5FZO A;  4C1W A;  4OI0 A;  4EV0 A;  3THT A;  2RS1 2;  3ELN A;  4AVB A;  4L97 A;  2EAK A;  1R09 1;  2YY1 A;  3HN3 A;  4PLO A;  1YWK A;  4WM7 B;  2E9Q A;  2G9Z A;  3KVB A;  1RUE 3;  2CAV A;  4PLN A;  4D6R A;  3U4S A;  3ZMN A;  2A73 B;  4AEJ A;  5A1F A;  4UBG A;  3MLL A;  2RS5 1;  4QHO A;  3KHC A;  2YPJ A;  3VHR A;  3C3V A;  3IMN A;  3MUY 1;  5FYH A;  3AB0 A;  4Q5O A;  3O12 A;  1T6G C;  4RS5 C;  5FZG A;  3CL1 A;  1BJQ A;  3DF0 A;  3N7M A;  4LOT A;  2VZV A;  5FOB B;  3WDT A;  4OHY A;  5K8S A;  2IUW A;  4AI0 A;  4IGP A;  4KI5 M;  3B7M A;  3BTY A;  2HWE 1;  4FPK A;  1VBD 3;  3MIH A;  5FP8 A;  4PIY A;  1LES A;  2UYB A;  2ARX A;  3I2K A;  3NNL A;  2X29 A;  3EB7 A;  2EVX A;  4A4A A;  1LU2 A;  4YZ3 A;  3ECQ A;  3AMQ A;  1FAT A;  2WO1 A;  5BXX A;  4AZZ A;  5A6X A;  1J3R A;  1OFN A;  3RZK A;  2WSV A;  4JGZ A;  2Y60 A;  4ISQ A;  3WP3 A;  1EPZ A;  1I6X A;  2XLG A;  4HT1 T;  3NWK A;  3GBF A;  4F83 A;  2W1W A;  4BIS A;  4Q4X 3;  3H8R A;  2OPK A;  2VBP A;  5T54 A;  3IDE A;  3CZU A;  5A3L A;  1BVV A;  5BNQ A;  5LA2 A;  3WF4 A;  4NIG A;  2D3P A;  3GHM A;  1K5M A;  2Z5W A;  3HPN A;  4I01 A;  3ST7 A;  2XML A;  1ENX A;  2JEN A;  4M3C B;  4R52 A;  3H1W A;  1HXS 1;  3CMG A;  5F8P A;  5FLI A;  4QDR A;  3S0M A;  4XZP A;  3HN1 A;  4XAE A;  1UIK A;  1QJZ A;  5F2W A;  5IVY A;  4EWA A;  3ZN6 A;  3JXS A;  3L2Y A;  1UX6 A;  3POY A;  5FO8 B;  1WW6 A;  2VY0 A;  4YM2 A;  3AXE A;  3WF0 A;  1RUG 1;  4OUE A;  1CVN A;  1X33 A;  3CBN A;  1GP4 A;  5LAT A;  3VZM A;  3ZLI A;  3AYC A;  4QXH A;  1ULG A;  1QGL A;  4U2A A;  1IPJ A;  3WW3 A;  1DU3 D;  4R4Z A;  4Q0Q A;  3AZX A;  3ZMO A;  4IV3 A;  5KXD A;  5FZ9 A;  3VDD A;  2R04 2;  3A0N A;  1QHD A;  2Q1F A;  2XJR A;  3DL3 A;  1SMV A;  4IE4 A;  3S30 A;  4XUR A;  4CDW A;  1NXD 1;  3WIN E;  4IEP A;  1QJU 1;  1W99 A;  4FPC A;  5FUP A;  1SLI A;  2FD8 A;  5CAZ A;  2D6P A;  1GSL A;  1OT5 A;  3LSE A;  5HXV A;  4O61 A;  5A6Q A;  2QQI A;  4V2W A;  5LBF A;  4AW7 A;  3EMR A;  1MS0 A;  4CDQ A;  4OUM A;  4Y5S A;  2P34 A;  1UOF A;  2BV4 A;  2HBU A;  4ITC A;  4LUK A;  1URX A;  4NE9 A;  5J36 A;  1JTZ X;  1OXC A;  1R1A 1;  1IQA A;  4XTP A;  5BY5 A;  3BIE A;  1V6M A;  4EN8 B;  4EQV A;  1AR8 3;  5CKN A;  3IDC B;  3NL1 A;  4B1L A;  2VH9 A;  3UKT A;  1CJP A;  5BNO A;  5JPM B;  3LIH A;  4NOT A;  1NQJ A;  4CCJ A;  1IHM A;  3OGJ A;  4XMA A;  4Y22 B;  4O7X A;  3VD3 A;  1POV 3;  3AKP A;  4EN9 B;  5FP7 A;  2VW1 A;  2NQY A;  4MLO A;  4O65 A;  4CCK A;  5JZG A;  3LPG A;  4CXY A;  4W50 A;  4FPH A;  4YG6 A;  1AYM 1;  3CJI B;  3P3N A;  4NHM A;  5JOY A;  2F17 A;  1DQ2 A;  5FRA A;  5JOX A;  1GZT A;  4DMI A;  4FQ4 A;  1PM4 A;  4CDX B;  1LOD A;  2DVA A;  5FWJ A;  3JBG 2;  1STM A;  3RI8 A;  5C4W A;  3SQO A;  3ZXF A;  2ZGS A;  2K9Z A;  1LEC A;  3URF A;  1RC6 A;  2A6V A;  3ZSE A;  1ZRF A;  4I30 A;  1DGL A;  2PHD A;  4ATE A;  1E5I A;  1ND2 C;  3NQH A;  3KM5 A;  4IEZ A;  4GH4 A;  4NHY A;  5M0T A;  4ES9 A;  1BBT 2;  2VCB A;  3TRS B;  2HWD 3;  3ZFF A;  1FMD 2;  3MLJ A;  4A3Z A;  4BPZ A;  2ZKN A;  3Q8B A;  4Y4R A;  1IS6 A;  1YQ2 A;  2ZHM A;  4Q4W 1;  4AVT A;  5ABJ A;  1XNB A;  3WQ7 A;  2B7Y A;  2QZ3 A;  5TSW A;  1VBE 2;  2YYO A;  1MEC 2;  1AVB A;  3TWI A;  2GU9 A;  5B2G B;  2R1B A;  1DQ5 A;  1O59 A;  3PJY A;  1LOA A;  4ZY9 A;  5AFE A;  2BBV A;  2C4X A;  2R6Q A;  4RA0 A;  5F1R A;  1PVX A;  5GKA C;  3HJR A;  1AYN 1;  2JG8 A;  1WA6 X;  1RUD 1;  4YGB A;  1UY2 A;  4BMB A;  3ZYP A;  1AL2 1;  2H6B A;  3NAP C;  4Q0U A;  3FBY A;  4CP9 A;  5LB6 A;  1PO2 2;  2VZQ A;  2WAB A;  1TMF 1;  1H6Y A;  1NE6 A;  3WOG A;  2YUE A;  2RG4 A;  1ZVF A;  5F32 A;  4FFF A;  4HSJ A;  4YRD A;  1GIC A;  3K4Z A;  5KBF A;  1JZ8 A;  1RHI 1;  4JCK A;  3VBS C;  3IPV B;  4XAC A;  1QQP 2;  1UWW A;  3VBU C;  4B7E A;  1IKP A;  3OEB A;  3SXW A;  1OQD A;  1WLC A;  1QJX 1;  1BVP 1;  1IGO A;  2Q1Z B;  1EAH 3;  2ATF A;  5F7U A;  3WVJ A;  4NRQ A;  4CP1 A;  3T08 A;  1BLZ A;  1ND2 B;  3S5Q A;  3K75 B;  1ZZB A;  3ZFE B;  2K46 A;  4ZPI A;  2RMU 3;  5T52 A;  4AK3 A;  2AYH A;  3NMB A;  4K8R B;  4CVU A;  4L92 A;  3SKJ E;  4E2Q A;  2P6H A;  1W6P B;  2J1T A;  4RD7 A;  2LW8 A;  2VUA A;  4OI4 A;  4CU7 A;  1UXZ A;  3O1V A;  1SFY A;  2EIB A;  5L9V A;  1EV1 1;  5EXO A;  1AR7 1;  4FXG B;  4ZS2 A;  4DOU A;  2P6C A;  2VZ3 A;  5DZF A;  4D94 A;  3ORJ A;  2WNE A;  2MEV 2;  4AHX A;  2P17 A;  4LT5 A;  3SIT A;  3TN9 2;  4OHV A;  4QX3 A;  4GJZ A;  1D2S A;  1BCX A;  3NAP B;  5FLH A;  3AP7 A;  3I2G A;  4P9J A;  3N7L A;  1CZV A;  1W90 A;  2KXL A;  3MFC A;  1V6K A;  5H9R A;  1US3 A;  2RS3 3;  2TNF A;  4FBF A;  4NPM A;  1WUV A;  4BQ3 A;  4AI9 A;  4XET A;  1QKQ A;  2CYF A;  2V73 A;  3VBS B;  1GWM A;  1KD7 A;  2RR1 3;  4XFB A;  3LIG A;  1H4G A;  4Y33 A;  1W04 A;  2YC4 A;  3H8O A;  3S6P A;  1AR9 2;  1DLL A;  5JI7 A;  2V5Y A;  3WP5 A;  1F5J A;  1LOC A;  4NWV A;  4NHL A;  1HW5 A;  3FX3 A;  4LKS A;  5HBA A;  1WLD A;  4Y1Y A;  4IQP A;  1N1V A;  4KL1 A;  3SH5 A;  3LA2 A;  3OOX A;  1PVC 2;  2CGO A;  2PTM A;  2WNV A;  3K4A A;  3ME2 A;  1NLQ A;  4CEW B;  1JYX A;  2VEC A;  4GUL A;  3TEW A;  2W47 A;  4QXK A;  1AJO A;  2D40 A;  5FFO C;  3VZO A;  5A1L A;  1E5H A;  2W91 A;  3ZSL A;  3ZYH A;  4B1M A;  1RUJ 1;  3NJX A;  4X8P A;  3HOB A;  1W3X A;  1XJA A;  3MIG A;  3I3D A;  4Y24 A;  4YZ4 A;  1RUE 1;  1WW7 A;  4J6G A;  1H9P A;  2IWG B;  2CWS A;  3R05 A;  3T0A A;  1JZ5 A;  2WQ4 A;  1JZ7 A;  5FPV A;  4G3Y C;  2CHH A;  3HNM A;  2WZR 3;  1UW8 A;  4MGT A;  3NNM A;  4QM9 A;  4OHW A;  2WBK A;  5KHG A;  4FP3 A;  1OFS A;  2RS1 1;  2LRP A;  4LBJ A;  4RQP B;  4CDU C;  1FOD 2;  1PMJ X;  5EV7 A;  5D1I A;  5FXX A;  1F5F A;  1IQD C;  3DEM A;  2O14 A;  1H4H A;  1VBD 1;  2C9A A;  2RV9 A;  2VBD A;  5AC9 3;  1DQ0 A;  4ORF A;  4CU9 A;  3Q8C A;  4LA3 A;  4TWT A;  5EJ3 A;  5C9A B;  1GOG A;  4Y5T A;  3K4D A;  4EYU A;  2VOK A;  3DYO A;  5A7W B;  4COU A;  4Q27 A;  1RUI 2;  2QTW B;  1G6N A;  4Q29 A;  4WVV A;  5JXI A;  4MHU A;  2B5H A;  4Q4X 1;  5A3M A;  3AZW A;  2QQM A;  4IE6 A;  5F3C A;  5A7S A;  1RUN A;  3WP4 A;  1W9S A;  4IV1 A;  4GKX A;  1DGR A;  4WVZ A;  2FDH A;  4RR3 C;  3POW A;  4XBN A;  1BQP A;  3VDA A;  4LBK A;  3WT3 A;  3LFM A;  5FBJ A;  1RYY A;  4DUW A;  4TTG A;  1KIT A;  2ENR A;  3IAP A;  1PGL 2;  2ZGK A;  5JPN B;  5KC5 A;  3ZKU A;  2RDQ A;  3GJA A;  4MGS A;  3RZH A;  5K0U C;  4N43 C;  3PUR A;  1VBC 2;  2RDR A;  4OZX A;  4QB6 A;  2WZP P;  3J7L A;  1G9D A;  1CAU A;  4M4P A;  4QWN A;  3RYP A;  2LUW A;  3A4U A;  3WQ0 A;  1XNA A;  4ATF A;  5CKQ A;  1Y3T A;  1UU6 A;  2JDP A;  4CDU B;  4XJ9 A;  5FP9 A;  5GLU A;  2J1S A;  4DNY A;  4QDQ A;  2VQ0 A;  3DPR B;  4JKM A;  3UGG A;  4X8N A;  5H9S A;  3I97 A;  5D8A B;  4A6S A;  3ZR5 A;  5ABJ B;  5LWB A;  1O4Z A;  2WYF A;  4DS0 A;  1JS9 A;  4YGC A;  4H14 A;  1CPM A;  1RUC 3;  1W8Z A;  5FYB A;  4F7Z A;  3POF A;  1OPM A;  1RUO A;  4GWN A;  2WO2 A;  1DYP A;  1UZV A;  4NPL A;  1OD5 A;  3IDB B;  4AL9 A;  1XND A;  5JXH A;  4OUS A;  1NCQ B;  2WO3 A;  3KV5 A;  3ZXL A;  1UY1 A;  3GYD A;  2Y6J A;  4OHX A;  4DXZ A;  4AHZ A;  4UWD A;  5FK7 A;  3LOB A;  3OG2 A;  4IE0 A;  1EUU A;  4ZS3 A;  4NIH A;  1A8D A;  5ANN A;  2WII B;  4C0B A;  1POV 1;  4QQH A;  2DUQ A;  3A0K A;  2VJX A;  3VZN A;  4LUL A;  2PHR A;  4CSW A;  3INA A;  2YFZ A;  2HEY F;  4WV8 A;  2C9K A;  3PTR B;  4XF4 A;  3VD5 A;  3VKF C;  4E4D X;  4LBL A;  1PGW 2;  4YGE A;  5L7O C;  2BTV C;  1V6L A;  5B4N A;  4AQS A;  1GNZ A;  1GWK A;  1JZ3 A;  2QKD A;  4E4Z A;  3POJ A;  1HV0 A;  2K0G A;  3HQX A;  3ZIX A;  2GH2 A;  1W6O B;  4YVW A;  5FY0 A;  1NCR B;  2VXJ A;  4XPV A;  1MVQ A;  1X9P A;  1WCS A;  1YIF A;  4HK9 A;  4OZO A;  5DG2 A;  3V0B B;  1D4M 3;  1A34 A;  3Q8F A;  3NO8 A;  4TSV A;  5LCW L;  1UN1 A;  4I2O A;  2DV9 A;  2X5I C;  1DGR N;  3DGT A;  3KQ4 B;  3KVA A;  1LHW A;  1YI7 A;  3VD7 A;  5APA A;  5CAD A;  5JMO A;  3U07 A;  4UFK A;  1WA4 A;  5FXZ A;  4AYU A;  5JXJ A;  3OCP A;  2YC2 A;  4HG6 B;  4M0H A;  5FPL A;  3OYW B;  5HCB A;  3DEC A;  3U11 A;  1FMD 1;  4JRA A;  1WCQ A;  4JQT A;  1YCI A;  4JTO A;  5FYZ A;  4QM8 A;  1ZBE 3;  2J7M A;  1AL0 G;  3AJY A;  4HXC A;  4LE4 A;  4QPY A;  4OQ9 A;  1VBE 1;  3WNP A;  1MEC 1;  2EIG A;  5DDJ 2;  4XFI A;  1DGW A;  1SLC A;  3I3E A;  1JOB A;  4HAN A;  4LO4 B;  1HB4 A;  3B9C A;  2FHR A;  2NMN A;  3H1M A;  1O4T A;  4I09 A;  5JVV A;  4YG0 A;  1ST8 A;  2GC2 A;  3K3O A;  3BU7 A;  5IVE A;  3IN9 A;  3ZXD A;  2WL1 A;  4IEU A;  1ZRR A;  1COV 2;  5FO9 B;  5L7O B;  4IEX A;  2XJU A;  1S55 A;  2RS5 2;  4N90 A;  2GN3 A;  3ZM8 A;  2RM2 2;  1UYZ A;  2YZ4 A;  3AP5 A;  3AKT A;  2VCC A;  3LOI A;  1XNC A;  5BNP B;  4NRM A;  1PO2 1;  5FZ1 A;  4UFI A;  3MPP G;  2P3Y A;  4Y4Y A;  3SEE A;  4NAO A;  3N9O A;  1BZW A;  2BRT A;  2WN3 A;  2NZ9 A;  1ZRD A;  1ZZ6 A;  2VMH A;  4Y20 B;  5CVR A;  2V4A A;  5C8C B;  1GZ9 A;  2HWE 2;  2BGP A;  5FZM A;  4RS5 A;  1YQC A;  1SLT A;  4Y1Z A;  2X05 A;  5LY1 A;  3OUI A;  4KU7 A;  1YQ6 A;  1RTV A;  4K21 A;  4YW1 A;  1DBN A;  1HQW A;  3MW3 A;  5FYS A;  4XAA A;  2WNU B;  2FDF A;  5C5U A;  2VMC A;  4MHR A;  3GZU C;  1KFU L;  3I2I A;  3A22 A;  3OY8 B;  2VOX A;  2BGC A;  2YBP A;  3MFA A;  4R9C A;  4BQY A;  5ACA 2;  3ZXA C;  1H2N A;  4DY3 A;  4MAD A;  3USU A;  3VBH B;  1VMF A;  1L3J A;  1SDD B;  2R07 3;  1HXS 2;  2SLI A;  1KQR A;  2X53 S;  4LIT A;  1HRI 3;  3WF1 A;  4GZ9 A;  1V6I A;  2BVB A;  3BPS A;  3T2Q A;  2YU2 A;  4JTN A;  2MEV 1;  3I3B A;  1YFU A;  3SNM A;  3TN9 1;  1TE1 B;  2WWU A;  2EIC A;  4RFT 0;  3THC A;  5IVJ A;  3ZSM A;  5EIY B;  2IFR A;  3H3L A;  3N36 A;  4LBQ D;  2FDG A;  2WZ8 A;  5FYT A;  1VBB 3;  3NKG A;  3MW2 A;  5E16 A;  1VBA 2;  2Q8E A;  4Q4V 2;  3NJZ A;  1H6X A;  5DQ0 A;  1S4C A;  2BYV E;  1LCL A;  2WT2 A;  4OVE A;  2HKX A;  3SCF A;  4AHY A;  1XSR A;  4XDO A;  2P3K A;  3BIW E;  1DZQ A;  2ZGP A;  4FPY A;  1W6M A;  4CUA A;  3HT1 A;  4N53 C;  1CZS A;  1PVC 1;  1CPN A;  1QXR A;  2IVI B;  2YMZ A;  4LO6 B;  5JSP A;  1TZO A;  5FJK A;  1R1A 2;  4MUV A;  3TEX A;  4AFB A;  3ASI A;  4P5H A;  1UZY A;  1ZM1 A;  3OGS A;  4LBQ A;  3VKM A;  1E57 A;  2VUC A;  5JWP A;  2HWF 2;  2WZR 1;  3S5A A;  5I0U A;  3K3N A;  5J98 B;  2BJS A;  2ETE A;  3T1L A;  4K7J A;  2VNV A;  2WT1 A;  4A7Z A;  1DCS A;  3WG4 A;  4CCM A;  3T3Y A;  4R9B A;  4AI3 A;  2ARA A;  1C1L A;  1PMH X;  4ZKT B;  1FX5 A;  3LEI A;  3TEY A;  2QJV A;  2H0B A;  5GAL A;  4XFG A;  3RZM A;  1B09 A;  5EWS A;  3R6S A;  1LEN A;  2DCT A;  1N3O A;  5LEK A;  5FDB A;  1R64 A;  1F2N A;  2FZ2 A;  4C1X A;  3BI3 A;  1E5R A;  1EP0 A;  1OH3 A;  2XB6 C;  4Q4W 2;  1DZR A;  3WDX A;  4B3N A;  5C71 A;  4YW3 A;  5JAX A;  1S0C A;  5SV8 A;  1AXZ A;  2ZKL A;  1ND2 A;  1ND3 C;  3LF7 A;  3BOD A;  4XAB A;  1OMI A;  4N53 B;  2QDN A;  3ILN A;  3AMN A;  4JX0 A;  4GWI A;  1DQ1 A;  2GDF A;  4WZC A;  1RUI 1;  1U5Z A;  4I02 A;  3UK9 A;  3JCI A;  2WWJ A;  3GCX A;  2A70 A;  4H55 A;  4FAH A;  1I1E A;  3V0A A;  5F5I A;  1JXN A;  1C28 A;  1DGW X;  2NP0 A;  1W2A X;  1PIV 3;  1V9U 3;  4QAW A;  5J09 A;  1TMF 2;  3QLQ A;  4LO7 A;  1BK1 A;  1CAW A;  3MBW A;  5CFD C;  2DF7 A;  5C3Q A;  2ERF A;  1XPW A;  2D93 A;  1LR5 A;  3OUH A;  5FYI A;  2UY9 A;  4IEV A;  4YSF A;  1J1L A;  1UIJ A;  2IXC A;  2VZ1 A;  3NAP A;  1W6Q B;  4CCD A;  4DEQ A;  5A3O A;  5FY4 A;  4YW7 A;  1GP6 A;  1W9W A;  3GBW A;  3KF3 A;  4BK5 A;  3HD8 B;  1W9T A;  2Y6K A;  1VBC 1;  3A21 A;  4LLO A;  4U36 A;  2JDY A;  4E2G A;  5FZK A;  3QH6 A;  4WVM B;  2W68 A;  3M8L A;  1UPS A;  5CG8 A;  1OA3 A;  1ZA7 A;  1RUC 1;  2VL4 A;  4CEY C;  4QQL A;  5LBB A;  3VBU A;  1ALY A;  3AL6 A;  4AFA A;  5A3W A;  1LNS A;  4CA9 A;  4IET A;  2ZML A;  4JDN A;  2ZOE B;  1IPS A;  4YW6 A;  3M3I A;  3H9A A;  1I5P A;  4QX5 A;  4XQW A;  1ND3 B;  3CO2 A;  1M06 G;  4MET A;  3T2T A;  2WO7 A;  3QOP A;  2DFB A;  3KB5 A;  4XBQ A;  2OPW A;  1HDK A;  1FNY A;  3K48 A;  1JI6 A;  3AC0 A;  2XLF A;  1GZC A;  5A6Z A;  5A33 A;  1L7Q A;  2W39 A;  1LGC A;  5BPX A;  4Q8K A;  2DFC A;  1RVF 3;  3GXU A;  3OBR A;  1RIR A;  1GOF A;  4CPB D;  1AX1 A;  1D4V B;  2EXH A;  4QKD A;  1MQT C;  2BNO A;  4QKN A;  1OF4 A;  3N9N A;  4BCU A;  4QPW A;  4WVW A;  3KCY A;  4EJR A;  1OUX A;  4B8E A;  4XCA A;  2V72 A;  1OF3 A;  4M4R A;  1UQX A;  3PUQ A;  3RVH A;  2W9X A;  1UY3 A;  5C7G A;  3J8F 3;  2PLV 3;  3H3U A;  2DUO A;  3D0S A;  4LHN A;  4PLM A;  4UF0 B;  5DAV A;  3NJY A;  1ZNP A;  5C70 A;  4WM7 C;  1CWP A;  2F4P A;  2ZGT A;  3JQW A;  3WSO A;  4O9E A;  2JE9 A;  3WF2 A;  1B35 C;  2XJT A;  5JLV A;  1JH5 A;  1BMV 2;  3WNO A;  1PGW 1;  4YVS B;  3VBF C;  1ODN A;  1UF2 C;  2Z4F A;  3NV2 A;  2JDZ A;  2R32 A;  2P4E A;  3W59 A;  1GFF 2;  5DAW A;  2VZO A;  1LOF C;  1W03 A;  3RS6 A;  2WFF 2;  3WDV A;  1JHN A;  4BXF A;  2FDK A;  2DBI A;  1Z0H A;  2VXR A;  4NWW A;  2JDH A;  4LHK A;  3JB8 A;  4HPK A;  4QX2 A;  1WMF A;  2CNA A;  4CPB A;  4PF1 A;  4E8D A;  1VB4 A;  3ZPY A;  3LE0 A;  3WCR A;  2PEL A;  5GZF A;  4XUT A;  4DXS A;  3USS A;  5F6L B;  4Q0P A;  5A7W A;  4KMQ A;  1G9A A;  4LPL A;  3PDQ A;  1LRH A;  3EHK A;  1F8V A;  5FXW A;  1XYO A;  5FY7 A;  3PLQ A;  4BQ5 A;  2Y0O A;  3ES4 A;  4AGG A;  1RUE 2;  2OQ6 A;  4XF3 A;  4AG4 A;  2QQJ A;  2GNT A;  2Y6H A;  4DQA A;  3KGL A;  1MQT B;  3AYA A;  1Z78 A;  2W0X A;  3WEZ A;  1L7L A;  1GUI A;  2ZHL A;  3FE5 A;  1OOP C;  3V64 A;  5HI0 A;  1CX1 A;  1HRV 3;  1KDM A;  1REE A;  3LB9 A;  4HBN A;  3M7A A;  4R8H A;  3TNQ A;  3QD6 A;  4XHB A;  1SAC A;  5CNA A;  4PDW A;  3VB9 A;  1AZD A;  2JG9 B;  5GLV A;  5HPO A;  2P1B A;  1Q8V A;  3WX5 A;  1B35 B;  1HB1 A;  1COV 1;  4GB3 3;  1JMU B;  1W6N B;  1PM7 A;  1SLA A;  3VBF B;  2D6N A;  1VBD 2;  1YEW A;  1M4W A;  2RM2 1;  4JGY B;  3M4F A;  4CDU A;  1CAV B;  1IKQ A;  1BK0 A;  3TBD A;  1X82 A;  4BB3 A;  1O3T A;  3WP6 A;  1JYV A;  5IHR A;  5B4X A;  2XJP A;  3AM2 A;  3CHX A;  3FBM A;  4BLJ A;  1BEV 3;  2IVJ A;  3R4D B;  4Q4X 2;  2WS9 3;  3VBO C;  4C0H A;  4ERO A;  3BCW A;  4B7K A;  3LDR A;  5FZ6 A;  3RMX A;  3I54 A;  4AQ2 A;  5HV0 A;  3VBR B;  1U5I A;  4LNV A;  4JHZ A;  1X50 A;  2R07 1;  2JB8 A;  4LHS A;  2WSU A;  4Z1V A;  1HRI 1;  3WUD A;  3AP4 A;  3DKW A;  5I8T A;  5L9B A;  1WBF A;  3TNP B;  3HR9 A;  4P9W A;  4CYD A;  4CXX A;  4I3G A;  4RR3 A;  4AED B;  1OQE A;  3GBG A;  5ACA 1;  1JU4 A;  1QWR A;  1YHF A;  4P9Y A;  1OOP B;  1SBD A;  2XJQ A;  2JEM A;  4L11 A;  4CUB A;  1G86 A;  3J4U H;  1TQ5 A;  2G19 A;  2ZAB A;  2W08 A;  4QX0 A;  3WG1 A;  4URT A;  1DFQ A;  1PK6 C;  3MIB A;  4N43 A;  5EP9 A;  1NA1 C;  5K0U A;  3ZN5 A;  3RGB A;  2W46 A;  4YM3 A;  3OB8 A;  3CJI C;  1LEM A;  2JDM A;  4HSL A;  2VGD A;  4M3C F;  3HAG A;  3T0B A;  3R4S A;  3B9I A;  2TEP A;  3ES1 A;  3N9P A;  2VTX J;  5IWF A;  1J3Q A;  3U4X A;  1W6O A;  4CDX C;  3BTZ A;  2HLE A;  3FWE A;  5FZL A;  2FZ1 A;  4XIO A;  1DQ4 A;  1NOV A;  2B39 A;  2J1E A;  3IBM A;  3JD7 3;  5F5C A;  3VBO B;  1VBA 1;  4QPI C;  4Q4V 1;  3RFR A;  1OLR A;  2R06 3;  5A6Y A;  4D3W A;  1ASJ 3;  3WXP A;  4X6Q B;  5DAB A;  4AFM A;  4ZXE A;  1AR8 2;  1RXG A;  1AF9 A;  1VPH A;  2LAL A;  1EY2 A;  1SBF A;  2CDP A;  4KWK A;  5HXM A;  2GMP A;  2HWC 3;  1FT9 A;  4W6Y A;  4WM8 B;  2BU9 A;  4BA6 A;  2R16 A;  1W8O A;  1O8P A;  3OYW A;  3ACF A;  2VW2 A;  4BE3 A;  3I59 A;  4OMD A;  1XNT A;  1A6C A;  2ZGL A;  2AEZ A;  1N3Q A;  1W28 A;  1QF3 A;  3GNE A;  4KBZ A;  4HK8 A;  4A6O A;  4DUX A;  4PBO A;  2VZU A;  1XNK A;  2JB4 A;  2ID4 A;  3FHA A;  3U10 A;  2XGX A;  3NKT A;  4KBB A;  3KMH A;  2HWF 1;  1JOP A;  1VLN A;  2VG9 A;  1WZX A;  1PK6 B;  1C8N A;  1NA1 B;  4NAM A;  5JR2 A;  5K7P A;  5FAX A;  3ZIW A;  5L7O A;  2YFU A;  3ZXE A;  5GM0 A;  3HNB M;  4QX8 A;  1G7Y A;  2HWD 2;  2W92 A;  5CIR A;  3OBZ A;  2LS6 A;  4B29 A;  2C26 A;  3J9S A;  2ZZQ A;  4IER A;  3ZKY A;  1YYN A;  5DZE A;  2XWB B;  1OSG A;  4MXV A;  3VKN A;  2VPV A;  2E31 A;  4OQ8 A;  4QPI B;  3WDY A;  1DHK B;  1S2B A;  5FQ0 A;  1HB3 A;  3ZFE C;  3VZJ A;  5I8Y A;  2X5I A;  2WRA A;  4XE9 A;  2BGO A;  4NR1 A;  3AZZ A;  1O3R A;  2G1M A;  3LFI A;  2JDN A;  5FV3 A;  3UJO A;  2PAE A;  2VCA A;  4FOQ A;  1PZ9 A;  4GWM A;  3PUA A;  4XW3 A;  4XYX A;  5IJR A;  2BWA A;  4KU8 A;  4PF5 A;  5A7N A;  3N4M A;  3D3A A;  1W0N A;  2ET1 A;  1VRB A;  3CJX A;  3WDU A;  3CU7 A;  2R7E B;  5J96 B;  5J1X A;  4BIF A;  2WAO A;  1NZI A;  3GAL A;  4XOG A;  3KGZ A;  3MI8 A;  5D2A A;  5DUX A;  4UW6 A;  4Z8B A;  1KRI A;  2EID A;  2VZT A;  2P3J A;  2A7A A;  1V0A A;  3LA3 A;  1VJ2 A;  4TLF A;  1K42 A;  4OFG A;  1EAH 2;  1N3P A;  2GAL A;  2GSY A;  5DAQ A;  4RHV 3;  5A80 A;  1NZC A;  1W8T A;  2WFP A;  3UNP A;  2RMU 2;  4BH9 A;  2WN2 A;  5SV5 A;  3ZX7 A;  2Y38 A;  3DKQ A;  3NNG A;  2FCU A;  3O1P A;  2UY8 A;  2E26 A;  4MGQ A;  4HOO A;  2BOJ A;  4XZU G;  3UT0 A;  5KWR A;  2BFU L;  5DUV A;  3E5Q A;  4X6R B;  3AKQ A;  1F35 A;  1QDO A;  1GNY A;  4ZU4 A;  1RVF 1;  3CZJ A;  3G6J B;  4CEW C;  2BNM A;  4CU8 A;  1PGS A;  1PX4 A;  4XF1 A;  2VMD A;  2CL2 A;  2RS3 2;  4GA9 A;  5A32 B;  4BQW A;  5F2S A;  3J8F 1;  2QQN A;  3N3H A;  2F4L A;  3E6D A;  1GMM A;  5EQU A;  5FYV A;  2L9L A;  3D0J A;  3WF3 A;  1LHV A;  5FYU A;  1ZRI A;  1WME A;  1DDL A;  4YFZ A;  2XLA A;  2YHJ A;  5IK8 A;  4EN7 B;  4QQO A;  2BBA A;  4S2D A;  2UU8 A;  4TLG A;  1SLB A;  4XIL A;  4FPG A;  4XFH A;  3O0X A;  2HEV F;  4P9L A;  4NII A;  3T2O A;  2JDK A;  4RQP C;  4XF9 A;  5EJ1 B;  5EZW A;  4I0W B;  2GH8 A;  1RIN A;  4GIQ A;  1WD3 A;  4Z92 B;  2H0V A;  1JYC A;  5FP3 A;  5FY8 A;  3O1T A;  3I4I A;  1OVS A;  1UU4 A;  1H2L A;  2P37 A;  2XDV A;  3AKS A;  2JIG A;  3ZSK A;  3AFG A;  3KCC A;  1LED A;  4S2F A;  1R08 3;  4UT5 A;  5FTT C;  5C9A C;  1VMJ A;  3J7H A;  2WFF 1;  2IXL A;  4D6Q A;  1OLM A;  3GZA A;  2PFW A;  2ZGR A;  4GMP 1;  1JHJ A;  5EFU A;  4N53 A;  1Q43 A;  1RIT A;  2WZR 2;  1FPN 3;  1K3I A;  2E7A A;  2OZ6 A;  2RHP A;  4UXA A;  3JQX A;  5GZE A;  4CCO A;  4JHT A;  3VKO A;  2SBA A;  4GWJ A;  5DN2 A;  5A3N A;  3AYE A;  3U1X A;  1LGB A;  2I74 A;  4QMA A;  2AGS A;  1EYB A;  1DZT A;  2DVF A;  3NV3 A;  5A7O A;  5LEJ A;  2VMG A;  4XQ4 A;  5CFC B;  1IG3 A;  3FHQ A;  1O91 A;  5AC9 2;  5BNN A;  1RUF 3;  5FPZ A;  4AFD A;  3O1S A;  1CQ9 A;  4QQ2 A;  3LKJ A;  5JDB A;  2FMD A;  4JAA A;  1ZRE A;  4Q4Y 3;  1YJK A;  3I2H A;  3C7O A;  2JWP A;  4XF0 A;  4YWA A;  5C3O A;  5IK4 A;  4FOV A;  1BEV 1;  4MXW B;  4RN5 A;  3VKL A;  1UPI A;  2VOW A;  1MS5 A;  4GXL A;  5F3I A;  3DPR C;  1QXP A;  5FWE A;  5FY1 A;  4DRR A;  1UKG A;  3AL5 A;  1CGP A;  5D8A C;  2I45 A;  2ZHN A;  3H7J A;  3ETP A;  1MZ6 A;  1SG3 A;  1GU3 A;  3LQC A;  1WGP A;  1CIY A;  1F4A A;  1W39 A;  2PHW A;  1XBF A;  4GJY A;  3N9L A;  4I0B A;  1WLW A;  4P9G A;  1S0B A;  3U78 A;  1ND3 A;  2B42 B;  2XVK A;  3IZO A;  4XJ8 A;  1Y7B A;  3T2P A;  1J59 A;  1JU3 A;  2ZHK A;  5ERL A;  1UY4 A;  3GM8 A;  4OYU A;  1UXX X;  2VR4 A;  2V4V A;  2WZE A;  1NCQ C;  3M1H A;  4RSU A;  4YW4 A;  2Q5T A;  1JOD A;  4G4F A;  1SCS A;  2B45 X;  4QGM A;  5LAS A;  4CUC A;  1UMH A;  4NMI A;  1XYN A;  4LKF A;  5CKM A;  5LA9 A;  4ASK A;  4XUN A;  2I07 B;  4L99 A;  5FXV A;  4QHB A;  2ZBJ A;  1K5J A;  5CFD A;  1OA2 A;  5JUV A;  4CCN A;  2HJI A;  3MF6 A;  2EXJ A;  4QD2 A;  4LK6 A;  1YQ8 A;  1JYI A;  2VE1 A;  3WR0 A;  3B93 A;  4JGZ C;  3AFK A;  3TAY A;  1RUC 2;  3C7G A;  3OPW A;  4BDV B;  1HKD A;  1LKN A;  2Q0A A;  3JD7 1;  1DYO A;  4L2N A;  2ZEZ A;  4IGO A;  2XL9 A;  1NCR C;  2ADE A;  2R06 1;  4C90 A;  1ASJ 1;  4XXA A;  2AEN A;  3H42 B;  1H8T B;  4A3X A;  5HV4 A;  4MX3 A;  4F3J A;  4XC9 A;  4DRV A;  2ZGU A;  1JN2 P;  3D6E A;  4CEY A;  3CEW A;  1GAN A;  2DVD A;  1CJD A;  2VNO A;  4ARX A;  4QT6 A;  2BVV A;  4KG8 A;  1RUH 3;  2J22 A;  2A71 A;  2WDB A;  2WNO A;  4IND A;  4XBL A;  3T4V A;  3UV9 A;  4AE2 A;  1LGN A;  3F95 A;  3I3Q A;  2XG3 A;  1RMU 3;  3JZV A;  2CTV A;  2ZX3 A;  1NUK A;  2VCM A;  3ACG A;  2JKB A;  1S0G A;  3CNA A;  4FOY A;  4JDM A;  4Z82 A;  4LO8 A;  4YZ2 A;  3ZYI B;  1AR8 1;  1IG0 A;  3U14 A;  4KNC A;  3SLI A;  3WQ1 A;  4UOJ A;  4WBB A;  3W21 A;  3OGV A;  4YG3 A;  4DZG A;  1N1T A;  1I9R A;  3FJS A;  4P02 B;  4IV3 C;  1J84 A;  2W52 A;  5DG1 A;  4AQT A;  2D98 A;  2EA7 A;  4P08 A;  4QU1 A;  1MQT A;  1KGY A;  2FMY A;  4DXT A;  5A1A A;  1MZF A;  1D4M 2;  2PHF A;  4PQQ A;  4CRQ A;  1YJL A;  2VUJ A;  4JGZ B;  5LK5 A;  3KLS A;  2D3R A;  2CSG A;  4TYS A;  2NYY A;  4WM7 A;  5FKB A;  1S2K A;  3B02 A;  3OSD A;  3PIG A;  5BNP C;  1UY0 A;  2EAL A;  3ILF A;  1B35 A;  3APB A;  1SFN A;  3JB4 C;  1GOH A;  4PIX A;  2VTF A;  3THD A;  3VBF A;  3WW2 A;  1C57 A;  5I91 A;  3ZYF A;  2HWD 1;  2W5F A;  5C8C C;  4AHW A;  4XUO A;  1LOF A;  3RNS A;  2XKP A;  1ZBE 2;  1ZZC A;  5LW9 A;  1WLT A;  4MV2 A;  2Z2S B;  4YLZ A;  1PO1 3;  2XVL A;  3TOJ A;  3ZN6 B;  2QQW A;  3OGR A;  4Y1X A;  3ZXG A;  4W6W A;  2WNU C;  1QH6 A;  3TB0 A;  3QBQ A;  2W2I A;  5LBC A;  1JUI A;  3MLK A;  1XXN A;  1WCD J;  1WCK A;  5EYX A;  2DVB A;  4NRO A;  3VBH C;  3W5M A;  3ZXJ A;  3O1U A;  1OH4 A;  2UWB A;  1VRH 3;  4IV3 B;  3WCS A;  2ZMK A;  3BAL A;  4N9I A;  4RHV 1;  2RE9 A;  3G7D A;  5FRE A;  2IC1 A;  3ZFF C;  3A23 A;  5G04 L;  2ET7 A;  2OVU A;  4CDW B;  1OOP A;  1G9C A;  4ZON A;  2HWB 3;  2ARE A;  1N1Y A;  5EHD A;  3U37 A;  4M3C A;  4XJU A;  4B4P A;  2GNB A;  5IVF A;  1WW4 A;  1ZBA 3;  2X10 A;  2VNR A;  3KV4 A;  4CDQ B;  4QHZ A;  2VTX A;  4BM8 A;  1EAH 1;  5E89 A;  1WKY A;  2WQ8 A;  3GF6 A;  3GZE A;  3E5X A;  1N47 A;  3ZPO A;  1HIX A;  1HX6 A;  3FLP A;  3DCQ A;  5FKC A;  4LR4 A;  5BUV A;  5GZC A;  2VVE A;  5E6H A;  2RMU 1;  5FZC A;  3WDW A;  3WUC A;  5BNO B;  1OLM E;  4HN1 A;  3OBA A;  2VQA A;  3SHR A;  3AMP A;  4IDZ A;  1VB2 A;  1DLC A;  3LDB A;  4N9H A;  3IM0 A;  2R07 2;  3IT8 A;  1O8S A;  3WY6 A;  2D3S A;  3T09 A;  3VBO A;  2P3I A;  1OC1 A;  1HRI 2;  2J1A A;  1QOS A;  1W0O A;  3WW4 A;  2QNK A;  1ULF A;  4FI9 A;  3SCG A;  3HIF A;  3KWV A;  4YZ5 A;  1QJE A;  2JE8 A;  5JOZ A;  5FZ4 A;  4FPF A;  2WA4 A;  2XOM A;  5ISL A;  1RJ7 A;  1R09 3;  4HFS A;  4MSV A;  4QB2 A;  5JR7 B;  3JUU A;  4J25 A;  2A3W A;  4UW3 A;  4GKY A;  4GH4 B;  1QOO A;  3ZFF B;  4ARY A;  2RS3 1;  3O1M A;  1KFX L;  3MF9 A;  5KR7 A;  3RZJ A;  5F9T A;  1Y9Q A;  2TBV A;  2YG0 A;  3W58 A;  2A6W A;  2AUY A;  2BP6 A;  2ILM A;  1W05 A;  2QQV A;  1XOY A;  2RR1 1;  3FLT A;  4XFF A;  4CE8 A;  5IVC A;  2Z79 A;  1HV1 A;  2E32 A;  3Q9O A;  4HN0 A;  5IK7 A;  1U12 A;  1NAE A;  1RL3 A;  4BHP A;  4Y22 A;  1PK6 A;  1LB2 A;  1W0P A;  4FTS A;  2JG8 B;  5HCA A;  3CJI A;  1R08 1;  4Y26 A;  1Q8Q A;  2WC2 A;  2BPA 2;  4QXC A;  2E51 A;  1GV9 A;  4CDX A;  3LWC A;  3N7K A;  2OKX A;  1OLQ A;  1YQ5 A;  4Q8L A;  3M2M A;  5FR3 A;  2NN8 A;  2JKX A;  4QPI A;  2DCZ A;  1YFY A;  1YNA A;  2C5D A;  2PQQ A;  1C3H A;  3A7Q A;  5FCC A;  4J1W A;  3M3E A;  4FO9 A;  4L8Q A;  4R9A A;  2CY6 A;  5C33 A;  2D44 A;  1MVE A;  4LBN A;  5J48 A;  4Z2A A;  2D6M A;  1Y4W A;  2OS2 A;  4FPL A;  2GC1 A;  2VVF A;  2Y34 A;  3RSJ A;  4AXO A;  2EIE A;  1QOT A;  2YBK A;  5JI9 A;  5LRS A;  2DUR A;  2XH6 A;  3ITQ A;  3MDP A;  5FOJ B;  1AR6 3;  1DF0 A;  1X9T A;  1D2Q A;  2ZX0 A;  5AVP A;  2UWC A;  2W87 A;  1RUG 3;  5LBE A;  1GWL A;  4Q4Y 1;  1NG0 A;  2ZX2 A;  5FZ7 A;  3LDK A;  5JIA A;  2PAK A;  4UW4 A;  1ENQ A;  2OXB A;  4DEV A;  5I0R A;  3BKZ A;  3AMM A;  2LRO A;  3RJR A;  4K8F A;  4FPO B;  3MPB A;  1PNF A;  4PJY A;  5AC9 1;  2JEC A;  4EZ4 A;  2D6O X;  1O5U A;  3ZFG C;  2DDU A;  3WNN A;  1LTE A;  5KHJ A;  4H7M A;  3VDB A;  1QJU 3;  1TVG A;  3DXU A;  1GYK A;  2WR9 A;  3HNY M;  3ILR A;  4PIZ A;  3IPV A;  5T55 A;  5L36 A;  3IB3 A;  3O14 A;  1RED A;  1XE7 A;  1U0A A;  4FT8 A;  2JXA A;  5K9Y A;  5FK8 A;  1ZYB A;  4FPE A;  4D0Q A;  4MG2 A;  1S0J A;  1CZT A;  3ON7 A;  4K1Y A;  1GQG A;  4BOW A;  1RXF A;  1UOG A;  4LBO A;  1PIV 2;  1V9U 2;  5FIX A;  4BWO A;  4NN0 A;  3ZFE A;  1YI9 A;  5JCT A;  1UZW A;  4QX1 A;  1SQ4 A;  3ZDS A;  3LA7 A;  5FP4 A;  4ZXK A;  4B4R A;  1W6P A;  4IE5 A;  4EWD A;  5FMO L;  4YPJ A;  3POI A;  1FXZ A;  3III A;  3P5B A;  4ASM B;  4LOS A;  1AYM 3;  3VGI A;  4A44 A;  1ZA4 A;  1SCR A;  3PU3 A;  4RGK A;  5A3T A;  5EPA A;  3RRD A;  1C4R A;  5C3P A;  4M00 A;  2VZR A;  3EBR A;  5FO7 B;  5CA6 A;  2E53 A;  4E9K A;  1TME 3;  4BLI A;  4BU2 A;  1CN1 A;  1UOB A;  1O4Y A;  4BYY A;  3NW4 A;  4QKB A;  1LHU A;  3K77 A;  4YVS C;  3ZFG B;  2WQZ C;  2E63 A;  3VBS A;  2Y6L A;  3I3M A;  4Q2F A;  4MGK E;  2ZGN A;  1OUR A;  1RUH 1;  2OX0 A;  1FYU A;  2QQU A;  2ZEY A;  5DXD A;  5H9P A;  1AX2 A;  4HVR A;  3UKV A;  2R1D A;  1RMU 1;  1RVF 2;  3BVC A;  1ULD A;  3POB A;  5LY2 A;  4IEQ A;  1AYN 3;  5FPU A;  3FL7 A;  2MHF A;  3M3C A;  3ZXK A;  1C1F A;  1J58 A;  1RUD 3;  4Z07 A;  2FCV A;  5F3E A;  4FFI A;  5C6C A;  1H2K A;  2RJK A;  1AL2 3;  5FZ8 A;  3KHB A;  1Z7S 3;  2PLV 2;  3J8F 2;  3PL0 A;  4NVP A;  3V65 A;  4CEW A;  5CIS A;  1S1A A;  3UGH A;  4DXR A;  4ZZ8 A;  4URA A;  2J1U A;  3OD0 A;  2BOI A;  4M0N A;  3PNA A;  2GME A;  4M3C E;  4XUP A;  2D6L X;  2YBS A;  1RHI 3;  2B4K A;  3ENR A;  4EN0 A;  2ZA9 A;  3B5L B;  3BTA A;  1YIP A;  4GMP 0;  1AXK A;  3UL2 A;  2ORX A;  2ZJC A;  3MZH A;  4K1Z A;  1QJX 3;  2AC1 A;  1LOE A;  2D43 A;  2EXK A;  2FBE A;  2JG9 C;  4H3W A;  3AVS A;  4JKL A;  4DB5 A;  4AQ6 A;  4UBH A;  1ZZ9 A;  3ACH A;  3FFZ A;  1QU0 A;  4NHX A;  1D4M 1;  5KHK A;  3HQU A;  1XYP A;  1HN1 A;  4NJ4 A;  2BW8 A;  2RVA A;  3HBK A;  4JRL A;  4UFJ A;  2XBO 3;  1O5L A;  5E88 A;  1RJ8 A;  3T1M A;  4FPJ A;  4JGY C;  5FYM A;  1QDC A;  4RQP A;  1PO1 1;  1LUL A;  1UNB A;  4ZZ5 A;  5A70 A;  4UI9 L;  4RFR B;  3H0O A;  1K12 A;  2FDJ A;  3KV9 A;  1EV1 3;  4K20 A;  5IUQ A;  5K4L A;  1AR7 3;  1QNW A;  3HBZ A;  4MO3 M;  3ZO0 B;  3OPZ A;  4K3U A;  1XC6 A;  1CAU B;  2FQP A;  2DU1 A;  5C9A A;  2QQL A;  4PHZ A;  1LOB A;  4D6S A;  1ZBE 1;  4NPR A;  3PME A;  1HRV 2;  3VBR C;  1Y9G A;  3EQE A;  4PCR A;  4P14 A;  2WA3 A;  3UES A;  1DIW A;  3RDI A;  3ALQ A;  2I2S A;  2GC3 A;  4HON A;  1IS4 A;  1R1Z A;  1YRZ A;  4GB3 2;  1XE8 A;  4AED C;  5I8S A;  5L19 A;  3CLP A;  3LAG A;  2C6S A;  4SBV A;  3BYW A;  1H8V A;  2V09 A;  3FFQ A;  3KSC A;  4XFC A;  1ZBA 1;  5DUW A;  3CF6 E;  2XQR A;  4GAZ A;  4AFC A;  3VHN A;  4XXP A;  5C5T A;  5DZG A;  3KCX A;  3KF5 A;  1F4H A;  3LPF A;  1ENS A;  3PVO A;  4JKK A;  5KXB A;  1BEV 2;  4HVO A;  2PAM A;  1V6N A;  2WS9 2;  2WWS A;  2D7F A;  4IW3 A;  5I0D A;  2N7G A;  2UYA A;  1TG7 A;  1FAY A;  2VOV A;  4PI2 A;  1W8W A;  2YGL A;  1A78 A;  3I2D A;  3MIC A;  3P6B A;  1Q3E A;  4D7Y A;  4MOA A;  1YC6 1;  5FYC A;  4M01 A;  4LLF A;  2K2S A;  1BKZ A;  1H1M A;  4DUV A;  3DPR A;  4AOC A;  5D8A A;  1IS5 A;  3T4H B;  3ACL A;  3I2O A;  1QMJ A;  1RUJ 3;  1Q5O A;  2BQP A;  1QJY 3;  4W4Z A;  3DYM A;  2ZGO A;  3B01 A;  4YFW A;  4QGL A;  1EPW A;  2WUH A;  3GZT B;  4O9G A;  4YVW B;  4DIN B;  2VUL A;  3ZOI A;  5KXE A;  4XVH A;  5JOW A;  4WM8 C;  2YPD A;  1C8M 3;  2QUO A;  3H7Y A;  1W06 A;  1NCQ A;  4KGG A;  5AVA A;  2RS1 3;  1VAV A;  4NO4 A;  5LA1 A;  1BXH A;  3ETQ A;  1LAJ A;  1PNG A;  5GZD A;  1BYH A;  3IIA A;  2VD7 A;  4QB1 A;  1VBB 1;  3PVN A;  3AJZ A;  4H2A A;  3LZZ A;  3SMH A;  2BUK A;  2IXH A;  3JD7 2;  2ZTN A;  1L7R A;  1LOG A;  1UZ0 A;  3IWZ A;  1VAK A;  2R06 2;  2CAU A;  1SPP B;  1NT0 A;  1UAI A;  1ASJ 2;  1GQH A;  3BGA A;  1X36 A;  3UET A;  1TNF A;  4CUG A;  5EJZ B;  1POV 0;  4IGQ A;  2AR6 A;  1VE0 A;  2PMW B;  3C7E A;  2OII A;  3RWN A;  3MV0 1;  2QVS B;  5J37 A;  2HWC 2;  2W1Q A;  2W95 A;  1NCR A;  2VU9 A;  1MZE A;  2YU1 A;  3AZY A;  4FXK B;  5T5O A;  1H2M A;  5KHI A;  4EZH A;  3VL9 A;  1LHO A;  3V0B A;  2AH2 A;  3C8X A;  1AUY A;  5CBL A;  2IZW A;  4AVC A;  2RJ2 A;  1H1A A;  2ARB A;  2QQK A;  2J1R A;  1BMV 1;  1MAC A;  3ATG A;  4PT6 A;  5IFT A;  2AZ5 A;  4MZU A;  3POE A;  4W6X A;  1XSQ A;  1GQP A;  4AF9 A;  4BQ2 A;  3WNX A;  2A75 A;  4C91 A;  2GND A;  1AR6 1;  3FMG A;  5A3U A;  3H3Z A;  1RGS A;  1H0B A;  4QQP A;  3RQ0 A;  3VUO A;  2C24 A;  4RS5 B;  5JSO A;  2ZAH A;  1ZX5 A;  4COW A;  2RDS A;  4D69 A;  2XXZ A;  3WNK A;  3Q8A A;  1QH7 A;  4HLT A;  2BFU S;  1UX7 A;  2GP5 A; 
#chains in the Genus database with same CATH homology
 1WZX A;  2LRP A;  2KR2 A;  2WYF A;  2LRO A;  1UOJ A;  2Q1F A;  1W8W A;  2JWP A;  4LJH A;  1GWK A;  5D21 A;  1W8Z A;  1W90 A;  4YWA A;  1W9F A;  3UT0 A;  4YW6 A;  2K46 A;  4LKF A;  2O14 A;  4BQ5 A;  4BQ3 A;  4LKD A;  1HN0 A;  4BQ4 A;  3F95 A;  4BQ2 A;  2VXJ A;  3ZYH A;  1GWM A;  4AL9 A;  4CP9 A;  1L7L A;  1OH3 A;  1V0A A;  1WCU A;  3ZYB A;  4LK6 A;  3ZYF A;  4LK7 A;  4YW7 A;  2C24 A;  1OKO A;  4LKE A;  1W8T A;  4CPB D;  1W8U A;  3ORJ A;  4CPB A;  1GWL A;  4CP9 B;  1WMX A;  4A6S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...