1W8TA

Cbm29-2 mutant k74a complexed with cellulohexaose: probing the mechanism of ligand recognition by family 29 carbohydrate binding modules
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
142
structure length
142
Chain Sequence
b'NVRATYTVIFKNASGLPNGYDNWGWGCTLSYYGGAMIINPQEGKYGAVSLKRNSGSFRGGSLRFDMKNEGKVAILVENSEADEKFEVETISPSDEYVTYILDVDFDLPFDRIDFQDAPGNGDRIWIKNLVHSTGSADDFVDP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NON CATALYTIC PROTEIN 1
publication title Probing the Mechanism of Ligand Recognition in Family 29 Carbohydrate-Binding Modules
pubmed doi rcsb
source organism Piromyces equi
molecule tags Carbohydrate-binding domain
total genus 28
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2004-09-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 1w8tA00
2C24A 1W8ZA 4LKDA 4AL9A 4BQ2A 4LKEA 2O14A 3ZYBA 1WCUA 5D21A 4YW6A 1W90A 1W8WA 4LK7A 4CPBA 3ZYFA 4BQ3A 1W8UA 1L7LA 1GWKA 3ORJA 2KR2A 4YWAA 1WMXA 3ZYHA 1OH3A 4CPBD 2JWPA 1W9FA 1UOJA 1GWLA 3F95A 4CP9A 2LRPA 2LROA 2Q1FA 4LKFA 1W8TA 1GWMA 2K46A 4LJHA 1V0AA 1WZXA 4A6SA 4BQ5A 4CP9B 2WYFA 4LK6A 3UT0A 4BQ4A 2VXJA 1OKOA 1HN0A 4YW7A
chains in the Genus database with same CATH superfamily
3I2FA 5BV6A 1YUDA 1DQ2A 4LHLA 4PCRA 3WNMA 2ADEA 2G9ZA 3ETPA 2W46A 4PLMA 1EPWA 1CN1A 4WM8B 1JYIA 3IKWA 3NJVA 1GQGA 2FBEA 4XXAA 3O1OA 5KR7A 4EYUA 4CCJA 5DUXA 1TE1B 2R1DA 4X8NA 2BNNA 1PGW2 3H8UA 1Z7S1 2KR2A 5FKCA 5C6CA 1Y7BA 3FHQA 5FJKA 5LBFA 2A6XA 1FPN3 3FHIB 4FBFA 4DXTA 3ZR6A 3VDDC 2BWAA 3POBA 4FT8A 1W8TA 4OZOA 4Q4W3 5DUVA 4FAGA 1S2KA 3SHRA 1ND2C 2PN5A 4K7JA 4ARXA 5LBCA 2R072 1SFPA 5FXZA 3JD71 3LPFA 1EP0A 3MFAA 2AACA 3P5BA 3IIAA 4E4SA 4QGMA 2OYZA 4HSJA 3ZOIA 1RUF1 2XQRA 3NL1A 4FP2A 1RXFA 4M3CB 5I8TA 3B5LB 1CPMA 1VB4A 3AMPA 4N53B 4YGBA 1MQTA 3WT3A 1Q43A 2A75A 2SLIA 3MFCA 3I3BA 4XDQA 2VOWA 5G04L 1W2OA 3RMXA 2H6BA 4AF9A 1H6YA 1RUD1 4CP1A 3WINE 2JE8A 5A7WB 3OY8B 2ARBA 1RIRA 1W9SA 3HAGA 5F2WA 1MZEA 5A3LA 3BIWE 5FY4A 2DUOA 1YRZA 2WO1A 2C6SA 4PQQA 2UWCA 1UKGA 3ZFGC 1UF2C 4XF4A 2W9XA 4NHKA 4Q4X3 1RUJ2 1VBA1 3POGA 1EAH1 4BYYA 3UJOA 4EWDA 2VBDA 4XTPA 2WZ8A 3MW2A 4RR3C 2F4LA 1SCRA 1RUOA 1SLBA 3HT1A 4UFKA 4Y20B 4CDWA 2WIIB 1FMD1 2C0ZA 2W68A 5C8CA 2RR12 1GYKA 3QBQA 2WC2A 2XOMA 1HIXA 1CX4A 4O9EA 4TSVA 3JD72 3ES1A 5E1RA 1SLIA 2CY6A 4CPBA 2GNMA 1QKQA 2V72A 2YG0A 3I4IA 4BXFA 1QGLA 1S0FA 3NSTA 4N43A 1H6XA 5E16A 1DFQA 1W9FA 3LCPA 3LIGA 5D1IA 3VZLA 3TEYA 1CJDA 1KJRA 1OLME 2EXIA 5CA6A 1A8DA 3HQXA 3V0AA 1DLCA 3OYWA 4NUBA 3V65A 5JI9A 3ZYJB 1URXA 4P00B 4YM2A 5FY9A 4KU8A 4MH0E 4XCAA 4OHVA 4R9AA 4KWJA 3IPVA 4DRVA 5A3TA 3VHOA 2B9UA 4AI9A 2HH9A 4AZZA 1UCXA 1C28A 2DDUA 2W3JA 5FXWA 5K0UC 4A3XA 1WW6A 1VP6A 4YZ4A 2JG8A 3VBRC 2PAKA 4JQRA 3SXWA 1W8WA 4FSJA 1SDDB 2XB6C 4RYDA 1WMFA 1UXZA 1VIWB 4KBBA 1W2AX 4AEDC 1ZX5A 3R0RA 5AC91 2I74A 1XPWA 5LA9A 3AZWA 3AB0A 4MXVA 3AP5A 1FAYA 1DZTA 3WF4A 4LMFA 4OUSA 3LF7A 3JBG1 3W5NA 3VBFB 3J26N 5FZ3A 2HYXA 4UW4A 1PO11 3AYEA 1CPNA 1SZBA 4A44A 3N36A 1WCQA 3MV01 4HFSA 4KGGA 3POWA 3VBSC 1N1VA 2BGCA 4Y1VA 1HJGA 4EN0A 3TAYA 2WNEA 4Y3OA 2RDRA 5JUVA 3L2YA 3KD4A 1PGL1 1QJFA 4JV4A 1QEXA 2YC4A 4Q27A 5LK7B 1R081 3W9AA 4CEWC 5A33B 2BUKA 3NWKA 3KV9A 1FOD1 3N9MA 3ZFFC 4DS0A 1H8TB 4IEYA 2ZJCA 4MGZE 3WXPA 3W5MA 4Y1ZA 5JWPA 4J6GA 1XU1A 3ACFA 2D6PA 1O4YA 5GLVA 4NIHA 4EJRA 4OI1A 1VRH3 1ZA4A 3GALA 5F9TA 1D4M3 2PA7A 4A3ZA 3PIJA 1ZZ6A 2D40A 4YG0A 4ET7A 2EAKA 3ZXAC 4HZFA 2Z69A 5F37A 1YHFA 1TME3 5A7QA 1UMZA 1AX1A 1GUIA 1VB2A 4Q4Y1 4RFRB 1KRIA 1K3IA 3AL5A 4CYDA 1QH7A 1KFXL 3E5XA 4K8FA 4GIQA 2EIEA 5JXJA 4XEZA 2CV6A 1XJAA 3S30A 1GANA 4NHLA 1K45A 5F7UA 3HNMA 4BJ0A 2HWF2 2P2KA 5DUUA 3U4XA 2WWJA 5FYIA 5T52A 3N7JA 5A3PA 3AZVA 1WLWA 5BNQA 5IVVA 3NNLA 4LOSA 5EPAA 1OPOA 1T6GC 2PHLA 1JZ8A 3ZMNA 2EICA 1UZYA 4I02A 3NVCA 3N9QA 3VKLA 2BZDA 5F32A 2KD7A 5L9VA 2XVLA 2PAEA 4FTEA 4N9IA 3ZDVA 2JXAA 1F35A 1PK6B 5FREA 5JOXA 5C9AB 2Q8OA 2LTNA 3POFA 5BYNA 2FD8A 3RVHA 3H8RA 4B4QA 5LK5A 2QQUA 5FP9A 3MZHA 3MICA 4FFHA 2AUYA 3A21A 5IVEA 2WDBA 3NV2A 1I6XA 1AVBA 1QJY1 3FLRA 4JDMA 2DF7A 2K9ZA 3NNFA 4QX3A 4AVTA 4C0BA 4EWEA 1AZDA 3VDCA 1Q8PA 3KV6A 4UAPA 1KS5A 5CKNA 4FTBA 2K46A 5FMCA 1MVQA 1UW8A 2E31A 5ISLA 1BMV1 1HB4A 1WCDJ 3GDBA 1AYN3 1PIV1 4PBPA 3N9LA 2RM22 3KCYA 1SG3A 3H7JA 4CUCA 2VZQA 3ITQA 1UKRA 3RQ0A 4D7YA 3GHMA 3CJXA 5E89A 1KEXA 5DXDA 4DEVA 2G9FA 1QJU3 3QH7A 1MEC2 4GAZA 3AP9A 1WCUA 1AL21 4YVWB 4WBBA 2FCTA 3QOPA 1ACCA 2E51A 2VW1A 4AQSA 3V64A 4GALA 2B8MA 3ORJA 2WA4A 2VE1A 1W6PA 4NIDA 4Q1PA 2JD4A 3DXUA 4XMAA 4AHXA 5ACA1 4WVMB 3KM5A 3OD0A 3WW3A 3BIEA 5GZCA 2NN8A 4JKKA 4PDWC 4XJ9A 2GNTA 1HB3A 2V73A 2NYYA 4QKDA 1F5JA 3ZKUA 4AVVA 4F83A 2UWBA 1QJY2 4INDA 5J37A 4P9GA 3ZYBA 2NP0A 2ID4A 1BMV2 2WZR1 5HCHA 2W94A 2OX0A 1YQ5A 5FO9B 3L2HA 4IEZA 1IS5A 1J58A 3IDCB 1QJX3 1DBNA 1OH3A 2E7TA 1JYXA 3T2OA 1BYHA 2JWPA 1O7FA 1Q56A 1XYOA 3U07A 4HVOA 1LOFA 1W6OA 2VJXA 2VC9A 4IEQA 4E4HA 1AL22 5GJ6A 2VNRA 3EXUA 3WOGA 4P5YA 2W47A 5FP3A 1PVC2 2IWGB 1AYM3 3E5QA 5DAPA 3B01A 3I2OA 5ACA2 2ZGPA 4LLOA 2VUJA 5T5OA 4NPMA 3WF0A 2DVAA 4GB31 4IV1B 3CDZB 3I3DA 1QDOA 1S0GA 4KWUA 1Z78A 1WLCA 3OG2A 4LE4A 4FPJA 5F6LB 3KQ4B 4WM8C 5BNNB 1TMF3 3I59B 1UO9A 1OVSA 1OOPA 4NRMA 1GU3A 1QY4A 4LO5B 3ZKYA 1IKPA 3MLLA 5C7GA 4ZU5A 5I93A 3DCQA 1W06A 3INAA 5F3EA 4BA6A 4CDXA 3ATGA 5LZ6A 3T1LA 4KQ7A 3UKTA 3ZN6B 4KWKA 1CAWA 3B00A 3BTAA 2IC1A 1V00A 3JB8A 1W99A 4QDSA 4OLLA 2Y6FA 2R043 4SBVA 5GLWA 1HJFA 3JXSA 1VBD2 1VAKA 3ILNA 2VY0A 4YZ5A 4Q4W1 1IPSA 1JUIA 1N1YA 2X53S 4JTOA 2UYAA 1ENRA 1N3OA 4PJYA 3UGFA 4BQWA 4MHRA 5CG9A 3QH6A 4N53C 3I3EA 1EV11 5L7OA 2D6NA 4Y22B 1JYNA 2FCUA 3MO4A 3OB8A 2WS91 2P3YA 2R073 2UWAA 4RHV2 4YLZA 3BTZA 5BNPB 4QQHA 1VBB1 1F31A 2HWC3 4NRQA 3K4AA 1DU3D 4ZXKA 4H14A 4XYXA 1POQA 4BU2A 2ZEXA 1PO22 3EO6A 4W6XA 5FY0A 4I09A 3U4SA 4IE5A 3WY6A 4JGYB 1O3TA 3WDUA 1CWPA 1NUKA 4YVSB 5HPOA 1H0BA 1KGYA 5DMYA 3DECA 1RUG2 4D8MA 4MGYE 5EIYB 5LA1A 5FMDA 3DEMA 1F5FA 2HWE2 4OFGA 2DUQA 4QQPA 4XC9A 5FKBA 5FZFA 1Z7S3 1MR5A 3RNSA 3H8XA 4LOTA 5JPNB 1NQJA 4Z82A 1CAXA 2EAAA 4TWTA 3THDA 4ASMB 2B42B 5K9YA 1WKYA 3R4DB 2YBPA 1YNAA 3WDYA 4CDUA 2RR13 4HKOA 3C2UA 1OQ1A 1AXZA 2Y0IA 3D4KA 3JD73 3MF6A 3U1XA 3AXDA 3MUY1 2JB8A 1RUF3 2MPFA 1UZWA 1K5MA 1JI6A 1B35A 1RMU2 3WNXA 1H8VA 2W39A 1R1A2 3F95A 3ZSKA 1YIPA 2JX9A 4TLGA 1XBFA 5CU1A 1DIWA 2ZEZA 3CIHA 3MHZA 1UYXA 4XCBA 4YZ3A 5J36A 1QXJA 1OKQA 3WD5A 4QB2A 1UY3A 1ODMA 3BPSA 5C3RA 4CXXA 1AXYA 1OH4A 1UOGA 4XUPA 1VBA3 4U2AA 1EAH3 1KQRA 1S0CA 1LOBA 2R062 3M70A 2O14A 3MUZ1 4WM7B 2LUWA 5I0TA 3ZPOA 4LIVA 1RTVA 2Z79A 2WNUB 2WT2A 3FFQA 3PMEA 2DVFA 4JVAA 2PHWA 1WMDA 3RZZA 1NZIA 4AQ6A 2XHKA 4OMDA 2QUOA 5DAVA 2AEZA 3B94A 4BH9A 4RQPB 4CP9A 1PZ8A 1RVF2 1UU5A 2XL7A 4GWMA 4LKFA 4XDPA 5GZDA 3SCHA 3S7EA 5GLUA 3PU3A 2A73B 4COWA 2EIDA 2SBAA 5A32B 4AAPA 1V6OA 1H8TC 4BDVB 1ZZ7A 2JB4A 1XE0A 2ADDA 3KB5A 1ULPA 1BKZA 1LHWA 3ROUA 3FLPA 2ZGQA 4BMBA 5LATA 1AR72 4YW2A 2GNBA 3JQWA 4YM0A 3LAGA 3PIGA 1U5XA 3UETA 1SFNA 4IESA 1VALA 4QX8A 5FWEA 3PMSA 1W0NA 1YI9A 4ZZ5A 5I0SA 2WBKA 4FFIA 1VRH1 5I0UA 1AR82 1D4M1 2ENRA 3I2JA 3VD3A 4AI3A 2GH2A 3JCIA 3PHMA 1UWWA 2GC1A 3B9IA 4P9IA 1WZXA 4YGCA 4QXBA 5FY7A 4LR4A 5AC93 5FXVA 1C57A 5F2SA 2NMOA 3GYDA 4XDOA 5ERLA 2D6LX 1JU4A 5KC6A 2YU2A 1CZTA 3WNKA 1Q3EA 3I49A 3ZIWA 2ZACA 3CJIB 3ZX7A 4QPIA 1H2LA 1XB9A 5TSWA 4CU8A 2MNGA 4DO0A 4NROA 2K2SA 3VD4A 1MQTB 2B5HA 3VBOB 1UZZA 4YW6A 4OCTA 2DV9A 5A1LA 1SPPA 2GU9A 4L92A 4LNVA 1FNZA 4R52A 1G6NA 2Z42A 3PVEA 4BQ3A 1OSGA 1TG7A 2IVIB 3AMQA 3ACIA 2CSGA 3H1WA 2JJ6A 4LIUA 4BB3A 5C9AC 1R083 4AGVA 1JMUB 3ZYPA 1NT0A 3N7MA 2GMMA 1E5HA 4QX2A 5IFTA 1H4GA 5IYYA 3PDQA 3AXEA 2DCZA 3VV1A 4LUMA 4MOAA 3ZLIA 2YMZA 4QX0A 2Q30A 3BOPA 5J48A 5JOYA 5IFPA 2FZ1A 4GMP0 3H3UA 3HR9A 5EQUA 3MIEA 3D82A 3DYPA 4CDWB 3IDEA 2D6OX 2HLEA 5C8CB 2BGOA 1LGCA 4O61A 4Q1RA 3AVSA 4V2VA 5IHRA 3VBHA 2JDKA 2RJKA 4P14A 3VLBB 3BOWA 1N1SA 2VQ0A 2WUHA 5CZKA 4XETA 3UV9A 2Y64A 4AAXA 2QKDA 3TB0A 1DGLA 4URAA 3FBYA 4YVWC 2J1AA 2JE7A 1W6NB 3J8F2 5BNOB 2RM23 1APNA 2XH6A 2ZMLA 4KNCA 3V0AB 1R091 1BVP1 3C7FA 2X05A 5T54A 5JMOA 4FVVA 1JTZX 2B4KA 3ELNA 4TXWA 1FATA 1RUI2 2BVBA 2CL2A 2ZX0A 3FMGA 4Q4V1 4YRDA 3RZKA 2JKXA 4N7IA 3GZTB 1NXD1 1L7QA 3VKMA 1W9WA 1O3RA 1W6MB 2VMEA 4XHBA 1CAUA 2XLAA 2W08A 4OQ9A 1V6JA 2JG8B 4HOOA 4ASLA 2EALA 4EN8B 1YFXA 5F3GA 4AFCA 2CWMA 1DZQA 4CXWA 3WG2A 3LIHA 1ASJ1 1SBEA 4D0QA 1UOFA 1HQNA 4FI9A 3ZXDA 1GZTA 1CIWA 2VQUA 4IEPA 4R8HA 4FPGA 1NA1B 1E5RA 3WUDA 5CVRA 5IVBA 1QJY3 3ZSLA 1IS4A 1WW4A 3WP5A 5JSPA 5JSOA 1MACA 1XE8A 2A3WA 4L97A 1SEFA 4JX0A 5CFDA 2ET7A 3C8XA 1GBGA 3GZUC 3OBRA 1PIV3 3DPRA 2QZ3A 5EXOA 2G4IA 1GP6A 4W6YA 3GJBA 3GGLA 5ANQA 3KHBA 3IBMA 4Y33A 2E7QA 5T5PA 4G3YC 4ONUA 2BQPA 4AVCA 1RHI2 2P3KA 3OJBA 4GH4B 2B7YA 1AL23 4KH9A 5FZ1A 4CUGA 4IV1C 1QH6A 5KC5A 5KWRA 3WDXA 4J1XA 4JKMA 4N8MA 1A8MA 2VMHA 1JHJA 3VKFC 3LZZA 4GJYA 1UY0A 5FJHA 1JOPA 2ZEWA 4LO6B 5DZGA 1RYYA 5ACA3 5DPNA 5BNNC 5HCBA 1SLLA 1Y43B 4RFT0 2J1EA 4CP2A 3NRUA 2O0OA 1ULEA 2ZOEB 2FDKA 2IUWA 4QKBA 5DG2A 2G19A 5I0RA 4LBJA 2Y6KA 5A3WA 3POJA 3JQXA 2P5BA 4B3NA 3RYKA 2ZS6B 4RL7A 5KXEA 1C3HA 2VCMA 2VMDA 3RMYA 1FX5A 2DCTA 5KHGA 2PHTA 1OI6A 3VDAA 4Y24A 4I2OA 3DL3A 4NPLA 1HXS2 3M8LA 2WJSA 3ZSEA 4XFHA 4S2DA 2Z4FA 2UY9A 3AMNA 5IVFA 3U78A 2BJSA 3U10A 1OQDA 5JDBA 4Y1UA 3QACA 1PZ9A 5F3IA 3HT2A 1PGW1 2G9GA 3DGTA 3K3NA 5FYUA 5LWBA 2IVJA 2VZ1A 3WQ1A 1QIQA 3WQ7A 3ZDSA 4R4ZA 4PI2A 3LD8A 4CXYA 5BNPC 5FXXA 3PVOA 4QHBA 4CP0A 1V9U1 2J1SA 4LHSA 4XFBA 5FMOS 4Z2WA 3D6EA 3AKTA 5T55A 4BXSV 2R071 1KXGA 5GKAC 3MW3A 4AFBA 4CCEA 5FY8A 3TNPB 3ABZA 4GB33 5JXHA 5FPLA 4JGYC 3X29B 2JDYA 3FWEA 2JENA 3ETQA 4URTA 2VZRA 1BK1A 2B45X 2HWB1 4HVRA 4UFJA 4FCAA 4YVSC 1OC1A 4V1PA 2D43A 2VO5A 2WNOA 5FPZA 2AEYA 4OMCA 1OF4A 3OOXA 2A3YA 5ANNA 3TN92 4F3JA 2W95A 3ZFGA 3FHAA 1SLAA 3I2IA 2XKOA 3I8TA 5DZFA 2Y0OA 4NAOA 1POV0 1LENA 1SBDA 4Q0UA 1DCSA 2UY8A 3KV4A 1LAJA 1WA4A 2VVEA 4PIYA 1JHNA 4RA0A 1RUJ1 1CIYA 3W58A 5A6ZA 1P8JA 4K21A 4RR3A 4RS5C 4DOUA 3TWIA 1PMHX 2XJVA 3VDBA 2HWE3 2BP6A 4QXKA 1GR3A 2VW2A 1W04A 4PQ9A 4I01A 4KU7A 3LE0A 1WLTA 3RYRA 4BQ5A 1V9U2 2JE9A 4GWNA 4XJWA 3WP3A 5IVJA 3OBTA 1S0IA 1R64A 2CAVA 1U0AA 2RR11 2X5IC 1EV13 2XGXA 4WVZA 3WHTA 1UIKA 2V5DA 1COV1 1NLQA 4FO9A 1Q8VA 4IW3A 3Q8CA 2WS93 4QU2A 2E9QA 1W9YA 2PELA 4H3WA 3DUIA 1VBB3 3HEIA 1XYNA 2HWB2 4IDZA 4IV3C 3I3MA 2BNMA 2WFF1 3I2GA 4FOQA 4LO4B 2PHDA 1U5YA 4TN7A 1RMU3 4QB1A 5CYYA 1YO8A 2R0FA 2RV9A 2Y8KA 4I0WB 1ENSA 1W8UA 2Y38A 2GC0A 2VOXA 3FX3A 4QPGB 5IT6A 2HEVF 3VZKA 4WM7C 2HKXA 4J25A 1VJ2A 1I3HA 1OA2A 1DYPA 2XXZA 4AI0A 3VBRA 1YC61 1AXKA 4NVPA 1W6OB 4AQ2A 2VGDA 3NJXA 2X8KA 1SQ4A 1OLRA 2A6YA 1D2QA 3A4UA 4AEDA 2BFUS 2ZCWA 3OUJA 1GZWB 1ZM1A 3EYPA 1UZVA 4IGPA 4KMQA 5F1RA 3POYA 4IQPA 4M3CF 4NIGA 1X82A 4DXZA 4D6RA 1BEV2 1UXXX 2O1QA 3E6BA 2ZZQA 1KJLA 1C8M1 2VMIA 3AJZA 3V0BB 1COV2 3GBGA 5F5IA 4CPBD 1PNGA 1XNCA 4HPKA 3VHPA 1ENQA 3FZ3A 1ULCA 2TBVA 4E9KA 2MEV2 1UOJA 3RFRA 1IPJA 5J96B 2ZHMA 2WFF2 1HRI1 4Q8KA 4QM9A 2VXRA 2VZVA 3KVBA 4CEWA 2XR4A 4UYBA 3UT0A 3ZFFA 1HN0A 3WNOA 3NNGA 2QJVA 4QPWA 4KG8A 1JYWA 2QQLA 2DURA 5C3PA 4JGZA 1ULGA 1ULDA 1RUH2 2XJRA 3C3VA 4MYEA 4QX5A 5IVCA 2XHNA 3VBUB 4GWJA 4O7XA 1HKDA 5CKMA 1AR83 1JYCA 2OXBA 1CAVA 1ZA7A 3MI8A 4PIZA 2Y6JA 3CJIC 4P9XA 3WF2A 4META 2ZMNA 1MQTC 3VBOC 4YW3A 5L7OB 1UPSA 2DWRA 5FZBA 1C8M2 1OT5A 1LJ7A 2VTFA 2WYFA 1D0HA 1JZ4A 1JYVA 2FCVA 4OI4A 2BRTA 1C1LA 4XF1A 1D0GA 3NQHA 5J3UA 4FOWA 4QB6A 4AHZA 2HWF1 3WQBA 4DY3A 3ZXKA 3USSA 1HRI2 5D8AC 4NWWA 5FOJB 2IXCA 2JIJA 1J3PA 1GP4A 1YLLA 2D6KA 4CEYC 3ENRA 3LWCA 4ZU4A 5JSRA 1WUVA 3B02A 1JODA 4UF0B 4R9CA 1EYBA 5C8WA 1NZCA 3NKGA 1UY1A 2FMYA 2XWBB 1LR5A 2W1UA 1GOHA 4CDWC 4BM8A 4XFAA 5JVVA 2ZMKA 2R6QA 3I2HA 5C8CC 5FZAA 3T08A 3ZXEA 3HWJA 2VZOA 5B4XA 4YG3A 1SMVA 1OUSA 2XBO2 3MF9A 3O0VA 4LITA 4OI2A 1G9DA 1CAXB 1OBNA 2JDPA 4MHUA 3NMBA 1O59A 3GHNA 4Q8LA 3WCRA 2QQVA 2ATFA 2NZ9A 3B7MA 3O5SA 5BNOC 4GXLA 4W6WA 3U75A 4NO4A 5ABJA 4UI9L 1UN1A 2XMLA 4CDUB 3USUA 5JOWA 3LA3A 5JXGA 1V6MA 4QM8A 3O1MA 2WN2A 2DBIA 1GQHA 3ILFA 3ZYGA 1BBT1 2RM21 1SDWA 3S0MA 3VZNA 1NCRB 5C71A 2VG9A 1B35B 1AF9A 1D2SA 1LULA 3J8F3 3NNJA 4JAAA 4DMIA 4CZSA 4A6OA 1L7RA 5FYBA 5LA2A 4X6QB 2YUEA 1MEC1 4M0HA 3S5QA 2E53A 2OPWA 4DQAA 1RUI3 3N9OA 4ATEA 4HETA 5C5UA 2GDFA 2GN3A 2HYKA 4QU1A 4RGAA 3UJQA 4I30A 4E4ZA 1NA1C 3A22A 1JW6A 2RG4A 3C7EA 3LA2A 1S0DA 4XFFA 1V70A 5JIAA 4PDWA 5BPXA 1C8NA 4BLJA 3PUAA 4MXWB 2ZXQA 2PHXA 3ZXGA 2QQIA 5DABA 5C4WC 1LU2A 4E4DX 3MIGA 3N9PA 1VR3A 4LE3A 4QGNA 3CEWA 1JOJA 2BDRA 5KHJA 2FDGA 3PTRB 3GM8A 3FBMA 5A7PA 3SISA 1RUE2 2J1RA 3D5OA 3Q8EA 5KBFA 3BUCA 3LDKA 3H1YA 1BBT2 3KQRA 2XLGA 3LQCA 2DCKA 4GH4C 4UT5A 3FUOA 2RDNA 3I97A 3NV3A 1R093 3UKVA 1BLZA 1ND3B 1U12A 4H2AA 1V6IA 2A5ZA 5CFCB 4XUTA 5KHHA 3ZFEA 4LK7A 4Q4V3 2WQZC 2DFBA 1RHI3 2R32A 2WFPA 2ZGTA 2I45A 4H7MA 2P17A 2JDHA 2OQ7A 4COVA 5DQ0A 4CRQA 2QDNA 1I5PA 1PX4A 1LECA 2CGOA 2PMWB 3T0AA 1YQCA 1PVC1 2WWUA 3GXUA 3LGRA 3QD6A 2ILMA 3URFA 2GAUA 4FQZA 3BB6A 4AVAA 2VOVA 1RXGA 1AJKA 1LNSA 3Q8AA 3SC7X 4GD4A 1ASJ3 2KM2A 1VBC2 3K77A 1YFYA 4WM8A 1QMJA 3WDTA 4LBQA 4LBQD 3WDWA 4IEVA 1NCQB 4IE7A 2VH9A 4MGKE 2JICA 2BWCA 3OGJA 1HB2A 2HWD2 1W90A 3NKTA 4HKWA 4LO7A 4PHZA 3LEMA 1CESA 4XMIA 1SPPB 5FYTA 3B69A 5CAZA 3WNLA 4OHXA 4KI5M 1HXS3 2G1MA 4ISRA 4BK4A 2KA3A 3H1MA 4XVHA 4BWOA 4XUQA 3Q9OA 1NX9A 1KS4A 3P3PA 3T0BA 5LCWL 4C91A 1OFSA 4BIOA 3MW4A 4IGQA 1UU6A 4PBOA 4KG0A 1E5SA 4PLOA 5FCCA 2GC2A 2VXJA 5I8YA 4OQ8A 1OKOA 3LFMA 1VBD1 2ZEYA 2W1SA 4N53A 3THTA 1K42A 3O7OA 1W2UA 4HL0A 3K3OA 1WGPA 4ARYA 1KFUL 4XOGA 4IXLA 3OY8A 5LBBA 4A45A 3RPQA 2UU8A 1DG6A 2DFCA 4RHV1 5J98B 3T1MA 4TZDA 2R1BA 4FPCA 4R4XA 2E6VA 3ACHA 4FFFA 2WINB 2AENA 1GWLA 2ZX4A 3KVAA 1PO21 2BU9A 2WT0A 5EP9A 4BZ4A 4GMP1 1HV1A 1DHKB 5JR2A 4NHYA 4UFHA 3CNAA 4QX7A 3TN93 1A34A 1RUC2 1JXNA 3WLUA 4JC1A 4D69A 4Y20A 2VOTA 4X6RB 5FTTC 3WNNA 1KITA 3KCCA 4FPLA 1AR62 3AVRA 1RUG1 2YGLA 2VVFA 2LALA 2YROA 4D94A 1IQDC 2HWE1 2V4VA 4FOVA 3VKNA 2CNAA 1W0PA 3MIHA 5BUVA 2VCBA 1F4AA 1S2BA 1GWKA 2ZGMA 3WZ1A 4DY5A 1ENXA 1ZYBA 1W3VA 2VMGA 4YG6A 4COYA 4UW3A 1V9U3 2LRPA 3K46A 4YGEA 4MO3M 4XJAA 1CR7A 4EN9B 4BPZA 5FYMA 1HX6A 3RGBA 3I2DA 3TEZA 4AHWA 1AJOA 3D0SA 2F6BA 1XU2A 2YDEA 3MBWA 5FZMA 1FYUA 2VUAA 4QPGC 3S6PA 5FQ0A 2WKKA 3SLIA 3IMNA 2HEYF 2ET1A 1RMU1 3OCPA 4PT6A 2HWB3 1W8ZA 2IXHA 3GZAA 2AYHA 3RI9A 3OBAA 4ES9A 5I91A 1R1A1 5CFDB 5M0TA 4IE0A 2X29A 4O65A 3BU0A 3ZXJA 1X7NA 1W8FA 3VUOA 3DPRB 4CCCA 5FZDA 2Q8EA 1OHFA 4XUOA 1UOBA 3AKQA 5FYSA 5DDJ2 4QAWA 3SH4A 3TNQA 1CJPA 2FQPA 3SCFA 3WP4A 1AHSA 1AX0A 1G9AA 2OS2A 3GBFA 4EZHA 3AZZA 1YEWA 1S0EA 2LW8A 1RUJ3 2R061 2F4PA 5H9QA 4NWVA 1VMJA 3T2TA 2DTYA 2WRAA 1JN2P 3T09A 4CDQA 4NIIA 3BYWA 4NRPA 2RS31 5EJ3A 1Y9MA 3B9CA 2VW0A 3OGSA 3OEAA 1GOGA 4G9SB 4AGGA 1AUYA 1YJKA 5GLZA 2XVKA 2ZGOA 3THCA 4BQ2A 5CEHA 4IEUA 3HVDA 5FP8A 1RVF1 2QQPA 4XIOA 1COV3 3FL7A 4IUGA 2RDQA 3MPBA 2NQYA 1G7YA 1X36A 4HANA 2WZEA 3DYMA 2JEMA 4QQLA 1GZ9A 4UFMA 5L73A 1ZRDA 4RGKA 4XQDA 2WFF3 2P6CA 3HPNA 3T3YA 2Q1FA 1FPN2 3LSDA 4FXGB 4Y26A 1YFUA 3VBUC 3IIIA 1EUUA 4CA9A 2A7AA 3M3IA 1AR71 2NPIA 1YQ8A 2QQMA 4LT5A 1NKGA 2I07B 2CHHA 3L9JT 1M4WA 2YPJA 3NW4A 1DF0A 1VE0A 5K7PA 1YQ2A 2GP3A 4KBZA 2MHFA 3O0XA 2R0HA 1RUH3 5DUWA 5C3QA 2AR6A 5DZEA 5IK4A 5FV3A 5GZFA 1AR81 3OPTA 4K1ZA 4QHOA 1GMMA 1HLCA 1QHDA 3LEKA 1BK0A 5EJ1B 2Y34A 3VBFC 4AEMA 3QLQA 3AYCA 4XUNA 1C5HA 2ZZJA 4XF9A 3RZJA 3WF1A 2RS32 1UMHA 1XSRA 3TBDA 1SFYA 4YFWA 4BE3A 4XJZA 1M06G 2OQ6A 2VTXJ 1C8M3 1FI2A 5LY2A 4AFMA 4EV0A 2A1XA 5FY1A 2NMNA 2V4AA 3NNMA 4AGRA 2XLFA 2XUMA 3VHNA 3DXTA 4Q4X2 3UK9A 3LOIA 5FY5A 5FK7A 1SLCA 4L9BA 1IS6A 4XBQA 1HRI3 2W91A 5C9AA 4B8EA 1J3RA 2D93A 4DNYA 2QVSB 2YC0A 2VBBA 3D0JA 1QXRA 1L3JA 2CDPA 1PZ7A 2YC2A 2ZX3A 3NAPA 5FUPA 3HOBA 3J7LA 5L9RA 3AK0A 4NPRA 5FZIA 4K9SA 1B09A 3WG1A 3KGLA 3C7OA 3ZR5A 3KHCA 4RR3B 5DAQA 5FLHA 3RI8A 1UAIA 3OUHA 4Z92B 1ODNA 5CB7A 4XFIA 3W59A 1GSLA 4N7UA 3SH3A 4MADA 1MZ6A 1OMIA 3FE5A 1POV1 1H2NA 1XC6A 3MIBA 5FBJA 5FZOA 3R6SA 4DB5A 2VQTA 2XBO3 4YSFA 1JZ6A 4CUAA 5FOBB 5K8SA 1NCRC 1WW7A 1QNWA 1QNYA 3AFKA 5FK8A 4CSWA 3I54A 2TUNA 5AVPA 1CVNA 2DTWA 4YVWA 1O5LA 1UX6A 1OD5A 2JG9A 4FPOB 4IL7A 4AOCA 5D21A 2VZUA 1WMEA 2JDMA 5FYHA 4Z2AA 3J8F1 3JUUA 1C4RA 3R4UA 1L7LA 2YBKA 2ZPXA 2HWF3 1FT9A 3IDAA 5JR7B 4FP3A 1JUHA 3EHKA 3PUHA 1LHUA 4WVMA 2ES3A 1WD4A 1RUI1 4MGSA 1O5UA 1HDKA 1PK6C 2W5FA 5LASA 3HNYM 3VBRB 3KCXA 2VULA 2WN3A 2EXHA 4BQ4A 3GCWA 1SACA 4AEJA 2VMFA 2WLPA 5SV5A 5FZKA 2RMU1 5IWFA 4AEDB 3PTYA 3IMMA 1US3A 5FUNA 1X33A 5IUQA 5I0DA 5A7OA 5FZ9A 3H7YA 3ZO0B 3KWVA 3VGIA 1F4HA 1LHNA 2PQSA 3FLTA 2A71A 2GMEA 3AP6A 4MGQA 2WQ4A 3UKNA 1WCKA 2CGNA 1UL9A 3ON7A 4HONA 3BALA 1N47A 1S1AA 3A0KA 2ZTNA 3AP4A 4MUVA 1H1AA 1ND3C 3UL2A 2Q0AA 4LBOA 4N43B 1MS0A 4OZXA 1RUE3 4ZU7A 1Z0HA 3MIDA 1DQ6A 4YM3A 5CFCC 4YZ1A 4NHXA 1BBT3 4LLFA 4YNIA 1TNRA 4NJ4A 3U14A 4AG4A 5LW9A 3OYWB 4ZY9A 4CCMA 2DCJA 2WNVA 1OURA 1ZRIA 3ZFFB 1W05A 2X09A 5FLJA 1UYZA 1MEC3 2XUEA 3AYAA 3CQOA 3M3CA 1TME2 3IPVB 5FPXA 1RHI1 1XRUA 5A6QA 4JGZB 4HN0A 1ZRCA 4QWNA 3WUCA 2ZX2A 1ZNPA 2GSYA 4QDRA 2VM9A 3E97A 3ZN5A 5EWSA 3FJSA 4P5HA 2ZKLA 2RMU2 1O8SA 1CAVB 1DYOA 3VZJA 3D3AA 2ORZA 2OT7A 4BHPA 1NCQC 1XNDA 4YYOA 3RYPA 1LOCA 2D98A 1JBCA 1PGSA 2HBUA 5JZGA 5LB6A 4XABA 3UNPA 2D44A 4LK6A 1VBC3 3IZOA 4XBLA 3O1UA 4QHZA 1UMIA 5A6XA 3ZN6A 1DQ0A 2W1QA 4OVEA 1IS3A 3SITA 1KD7A 2Z5WA 3PUQA 5FPBA 4UW5A 2HWD3 1HXS1 3ECQA 2XQXA 3KF3A 1MPXA 4FAHA 5IVYA 1O3QA 4MZUA 1FNYA 1NOVA 2H0BA 1IKQA 4UXAA 4XF0A 3VD7A 1YFWA 5GZGA 2WABA 3SEEA 4ISQA 3KZ4C 2IXIA 4K8RB 5FIXA 4LA2A 1W3XA 3ZVXA 5DN2A 4QQ2A 2XL9A 5JI7A 3TEWA 1N1TA 5F6KA 3I2KA 3FFZA 4L99A 5FP4A 5FRAA 4CCOA 1PMJX 4Q26A 1I1EA 1AYN2 2DYCA 4RGGA 3HN3A 2DBNA 5CKQA 1JZ3A 1NLRA 1PVC3 2W52A 3LSEA 4X8PA 2DU1A 3R4SA 1OUXA 4LBKA 3WG3A 2Z2SB 4LXLA 1GFF2 3AM2A 2CDOA 1QJU2 3O1PA 1F2NA 1BCXA 3EMRA 2VU9A 4XILA 3NV1A 4XPVA 4FPFA 5ABJB 3USUB 4QD2A 5FZ7A 5HXMA 4KGQA 2VNVA 5AVAA 4C90A 3IM0A 1AR91 2FDHA 3N9NA 2JDUA 3TN91 3VL8A 5FYVA 2D7FA 2LROA 3RWKX 1W03A 1CD3G 4LKSA 1UD1A 1ZBE1 2VVDA 2YYOA 4FPHA 4I0AA 4YW4A 1RUC3 2ZGUA 5CISA 4NIAA 4RS5A 4MGTA 1QOOA 5C33A 4L2NA 2QQOA 5CNAA 2CAUA 3OD4A 2EXKA 4B7KA 3WW1A 4LUKA 3O14A 3VZOA 4M01A 3VDDA 1SBFA 2GALA 5IK5A 4D7SA 3AJYA 1VBD3 1XYPA 2BOJA 2OZ6A 4AVBA 3VN4A 1ND2A 2X5IA 3WVJA 4EE2A 1WA6X 1PHMA 2Y6GA 4HK8A 2P34A 1H1MA 3T4VA 5LEJA 1O4TA 4PDWB 2QCSB 3NO8A 4K3UA 4RN5A 5FPVA 1QJX2 5E6HA 3ZSMA 4QPYA 3IAPA 4XZPA 4KWLA 1HRV2 4IV3A 3WW2A 3DPRC 4RHV3 1ZBA2 3EQEA 4A42A 4DINB 2Y60A 3M3QA 4RSUA 5FWJA 4MV2A 3SKJE 4DZGA 5FZ0A 2FHRA 2V09A 2XJUA 4Y5SA 3AMMA 2JIGA 4ITCA 4PIXA 1AR92 4Y1XA 2I2SA 1O3SA 1PO23 3VZMA 2RS51 3HBZA 1C1FA 4GMP3 5HV0A 4PF1A 4AL9A 5KXBA 1AYM2 1J3QA 2D3RA 1ZBE2 3H8OA 3U0ZA 4CCDA 4FPYA 2ZGKA 2J22A 1N3QA 2PFWA 3LB9A 4L0PA 5DDJ3 3T30A 2AH2A 5LRSA 5APAA 2J42A 3RZHA 3ZFEB 5HV4A 5JOZA 1LOAA 4CCKA 3LDRA 1X9TA 1RUG3 1WW5A 1HN1A 1W6PB 2D97A 1TMF2 2FDFA 2FMDA 2H6CA 3IT8A 4Y1YA 1HV0A 3PUIA 4JQTA 1BEV1 3VL9A 4YZ2A 4NE9A 2GC3A 3S7IA 1NXMA 2VZPA 3PL0A 5CG8A 2FZ2A 1BVVA 2Q1ZB 2EVXA 5FPUA 1WBFA 5L36A 2OZJA 2B9VA 4MGIE 4LBQB 2D5HA 1QWRA 2MEV1 3PLQA 5A3NA 4ATFA 1W8OA 3I7DA 4UBHA 1R1ZA 5EZWA 3S57A 2D3SA 2R042 3VD5A 4CUBA 1OF3A 1VBE1 2Q4SA 3E6CC 1LU1A 1R1A3 2RS52 4K40A 1WCSA 3MEPA 1RITA 2VMCA 2A70A 5FZ4A 5K0UA 3AZXA 5FP7A 4P9JA 3KSCA 1RUH1 1EUTA 2WNUC 3EB7A 3M7AA 4DUXA 5EFUA 3WNPA 4B4PA 2YXSA 1G86A 3K4DA 4GZ9A 4EZ4A 4R9BA 5J1XA 4YM1A 2HWC2 3CJIA 3DF0A 1DGRN 1JU3A 3KS7A 2WR9A 4I3GA 3MIFA 4RQPC 1NY72 2R063 5A80A 4UBGA 5EJZB 3J7HA 1ULFA 3VBOA 4CCNA 4E2GA 4LORA 5LEKA 2E7AA 2PHFA 2BV4A 3UESA 4IEWA 1W6QA 4S2FA 2RS33 2DVDA 2L9LA 3O1VA 2CWSA 2OPKA 2Y6LA 1RVF3 4JCKA 3VBSA 2GN7A 2RHPA 3N35A 2B39A 5B4NA 2P6HA 1PMIA 5D8AA 4DXSA 4JHTA 3OSDA 3WV6A 5CADA 4A41A 3B93A 4IEXA 4L11A 4CEYA 3BI3A 1OOPB 3R05A 2YV8A 2ZKNA 2OA2A 2BYVE 1Z7S2 5FO8B 3AZYA 1VBE2 2ZX1A 1K5JA 2OUJA 4SLIA 3FUQA 4CU9A 4ZHNA 4CDXB 3P1IA 2YPDA 4BISA 1AR73 3DN7A 1CAWB 4Q2FA 1KDMA 1FV3A 2ZGSA 1OPMA 5F8PA 3H0OA 3K51A 1QQP1 5DG1A 1RUF2 3PNAA 5FZHA 5FR3A 4OUMA 1LOGA 2XBO1 1V6NA 1PVXA 1HW5A 1W6NA 2UYBA 3E6DA 5BNOA 3B3QE 4FPKA 3MDPA 4LJHA 1RUD2 1WLDA 5IK7A 1LHVA 2RJ2A 1DQ4A 2N7GA 3WHUA 5FYZA 5IK8A 1E57A 1HQWA 3ACLA 2WZPP 3KLSA 3MLJA 5FQ0B 3CL1A 3BPZA 2QQJA 4DPNA 1W6MA 4FTSA 2RE9A 4EROA 5KXDA 3K48A 3LFIA 5A3MA 1VBA2 3M3OA 1EAH2 1RJ8A 3EBRA 5F39A 4GJZA 5IAVA 1LEMA 4A7KA 3N7KA 2PHRA 4QDQA 3G6JB 2XKPA 3OPWA 5FDBA 2BNOA 4LBLA 1JOBA 4ZS2A 4Y4RA 1FMD2 1D4VB 2BPA2 1NA1A 5A7NA 1RB8G 3W21A 4YGDA 1A3KA 2C1FA 2QE3A 4BK5A 2VCCA 1QQP2 3BGAA 4XJ8A 5C4WA 4AE2A 3HNBM 1F9KA 3LDBA 4XQ4A 2VQAA 3V56A 3ZYRA 3PVBB 2ZHLA 1CONA 4CDQB 1J1TA 2XG3A 4N43C 4XACA 1POV3 4UFLA 2IFWA 2JDZA 5FYCA 4QXHA 4DEQA 5A1AA 3GCXA 3H50A 3H42B 5E8AA 5HXVA 1LEDA 1CZSA 2NLRA 1J83A 4JDNA 3ZYFA 4AVSA 1RUE1 2UURA 4GH4A 3LOBA 1VPHA 4JKLA 5LBEA 3H3LA 3AX4A 1PX3A 2QZ2A 2XJQA 3C7GA 4MSVA 4XHXA 1K5MB 2PHUA 5C3SA 2VUDA 4JGZC 4M4RA 3D8CA 5T5LA 1LCLA 5H9RA 1REEA 2JG8C 1W28A 4B4RA 4YW5A 4CU7A 2WQ8A 5AC92 1DQ5A 4AEKA 1UZ0A 2ARAA 2WAAA 3N7LA 4TLFA 1JZ5A 1Y9QA 2E26A 4DRRA 4BMEA 2FDIA 1LB2A 3AKSA 1PM7A 2YU1A 3JBG2 3HMYA 2QBXA 2ZA9A 3DKQA 1DP0A 2YHJA 3Q8FA 1PO12 5JPMB 2O8QA 1OXCA 1G9BA 3ST7A 1N3PA 2WLQA 2RMU3 5FBZA 4AR2A 4M4PA 4IGOA 3AL6A 3I3QA 1XQNA 2JKBA 3J7NA 2LS6A 3WCSA 3O1RA 2XJSA 3BTYA 1VBC1 3FC0A 3U11A 4A7YA 1VAVA 2VR4A 5C5TA 4IE4A 1G9CA 1PGL2 4V2WA 2P3JA 4CP9B 1R082 1UYPA 1RGSA 5F5CA 1VAMA 3WDVA 2E63A 5J7MA 1FOD2 1UX7A 4Y4YA 1XXNA 4LBNA 2HWD1 4QKNA 4MG2A 2C9KA 2AC1A 4AK3A 2ZGLA 5J09A 5KHKA 3AC0A 1LGNA 2AREA 5IW0A 4E27A 1CGPA 1O6UA 2VNGA 3PJQA 4CE8A 4QGLA 4BQ1A 2WAOA 1VMFA 4FOYA 1H2KA 3H3ZA 1LOEA 2E33A 3NAPB 4ZPIA 1DGRA 1ZZBA 1I9RA 1IG0A 1GOFA 2WSVA 4H55A 1ZRFA 4Q4Y2 3QCWA 4ZXEA 4OHZA 5A3UA 1H2MA 3JZVA 1MVEA 2VZTA 3JU9A 3ILRA 5ABJC 5F3CA 2EF6A 1ULOA 1V0AA 2JDAA 4HBNA 5EYXA 2IFRA 4U36A 2WA3A 4Q0SA 5FZOB 3TRSB 4C1WA 4B1LA 4Z07A 1H1IA 1S0JA 4JZRA 3AYDA 2IXKA 2HJIA 3M4FA 4NOTA 2ZHKA 3T2PA 4GQ7A 3PVNA 4W4ZA 5JMCA 5G05L 4LULA 1ONAA 3ZN4A 1UYYA 4EQVA 5SV8A 3KF5A 2RS11 4QPIB 5D2AA 5HI0A 2JG9B 1YIFA 5A70A 1W8NA 2DVGA 4PI0A 1WD3A 3CU7A 1YWKA 5JXIA 1RUC1 2KXLA 1W0OA 2QTWB 4K20A 1AR61 5B2GB 2HEWF 1W9TA 2J1UA 3GZEA 4YFZA 2A3XA 5C70A 3CZUA 4BIFA 1X8MA 1NLSA 1F15A 2PLV1 2XJTA 3CLPA 4B1MA 4DIQA 1YYNA 2TEPA 3K4ZA 4M3CA 3M1HA 2ETEA 4HSLA 2Q8DA 2YB7A 1XNBA 3SCGA 1AX2A 1JH5A 4LHKA 2YGMA 4IE6A 4AFAA 4OUEA 1PIV2 2GZWA 1REDA 2OW4A 2WO2A 3PUSA 4HMZA 2R7EB 4LPLA 5A7WA 3MYXA 4QPGA 4EWAA 2PAMA 3PJYA 2H0VA 4IEOA 3RJ2X 3ZYHA 2PXJA 2R30A 3AKRA 3CF6E 1GICA 3A7QA 2JDNA 1HRV3 3RSJA 3SEPA 4JHZA 3P6BA 3VBHB 4W65A 1ZBA3 3SQOA 1X9PA 4GKXA 5L9BA 3CMGA 2Y33A 2RS12 5A6YA 3A23A 3SH5A 4BQYA 2BTVC 2C5DA 3O0WA 4HLTA 4OULA 4XAAA 2BW8A 4HKLA 3ZFEC 1AR93 2AGSA 3WG4A 3AP7A 3KT1A 2VCAA 5K4LA 1GZWA 5GM0A 1LGBA 2WNVB 2ZGNA 3ES4A 1SLTA 5DDJ1 1ZBE3 3K75B 2VTXA 1ALYA 1H9PA 4HT1T 3V0BA 1NAEA 4D7TA 1E5IA 1MZ5A 1ZZCA 2RJLA 3WX5A 2PLV2 1CAUB 2BOIA 4WZFA 2BBVA 1YI7A 2OUHA 5C3OA 4I0BA 4W8JA 5FMOL 3T4HB 3MV11 1TQ5A 3DYOA 1XOYA 4NAMA 1H9WA 1QOSA 5FFOC 3ZXLA 1GP5A 2WZR2 2D3PA 4K6BA 5JAXA 3BU7A 1PNFA 1XNAA 2WO3A 1OQEA 2ARXA 1LODA 1XE7A 2YFUA 2NM1A 5JZGB 1UU4A 4JRLA 2ERFA 2IXLA 2CGPA 2QQNA 2C24A 4XFCA 1RC6A 1OLQA 3POSA 2ZBJA 4R9DA 4D3WA 4HG6B 1QU0A 3J7MA 3VBUA 3GJAA 1LOFC 3ACGA 4QMAA 3LEGA 3RZLA 3N3HA 1FPN1 1LHOA 4XE9A 4ZKTB 4D6SA 5A7SA 1X8EA 3GNEA 1EPZA 3TYJA 3A0NA 2R49A 2RS53 2ARCA 1V6LA 1YJLA 1LTEA 3E5UA 5FZ6A 3O12A 3DKWA 3WF3A 4LBMA 2VECA 4GB32 2YBSA 3EJKA 1GWMA 1ZRRA 3BVCA 3VBFA 3OGRA 1JZ7A 4AI8A 2W92A 2VD7A 4WVVA 4UW6A 3ZSJA 4TYSA 2ZAHA 3VHRA 4E2QA 1HQLA 4E8DA 5H9SA 2BEOA 2CTVA 1BZWA 2AZ5A 1QJEA 3ZXFA 4FQ4A 1H4HA 2DVBA 1BEV3 1OOPC 2X10A 1G9FA 1TEIA 1S55A 4UF0A 3FN9A 4P9WA 1LKNA 5A33A 4NN0A 1RINA 3CKHA 1Q8OA 2WL1A 1H8TA 4Q4X1 2J1VA 3ZYIB 4CDXC 4PF5A 2MEV3 1DLLA 4QXCA 1OA3A 3BN6A 4ES8A 5E88A 5T3NA 3O1SA 4Y5TA 5LA0A 3HQRA 3RJRA 4K1YA 3APBA 1VBE3 3GBWA 4Q4W2 1VLNA 2BERA 4XBNA 4P08A 5GZEA 3WQ0A 4XF3A 1G8WA 1EV12 4PLNA 4RS5B 2VPVA 1GV9A 5L7OC 2WS92 1NE4A 3HIFA 2BFUL 4LKEA 1DQ1A 1MS9A 3BODA 4ZS3A 1JZ2A 4QKFA 3VDDB 5FZGA 3OBZA 1VBB2 1LESA 2LM3A 4M0NA 5EYYA 4XTMA 5FZEA 4B7EA 2W0XA 1K12A 5T50A 3U37A 1ND2B 1NCRA 2X5IB 3NV4A 2XPJA 2ZHNA 3RRDA 4FFGA 1GZCA 4G4FA 2RVAA 5BXXA 4ZZ8A 2DUPA 4KL1A 1ST8A 1X50A 1RUD3 4J1WA 1IOAA 2WWSA 1IZ3A 1ZZ9A 4GKYA 4AWDA 4C8DA 4RD7A 4IV3B 1UPIA 4LEJA 5FAXA 1GKBA 3AKPA 1NG0A 4P9YA 5AFEA 3GF6A 5GLTA 3POEA 1VMHA 1W39A 4XQWA 4AI1A 2Q5TA 3T0DA 3CHXA 2GH8A 4HK9A 4LKDA 1PK6A 3POIA 1DGWA 4Z8BA 4W50A 3WP6A 3ZFGB 2CU5A 1XNKA 3KGZA 2A6VA 2QNKA 1UY4A 4MXWA 1STMA 3CO2A 1MS5A 2JECA 2WO7A 4HXCA 4Q29A 3SMHA 1CQ9A 4ORFA 4CDQC 2C9AA 1REFA 3LPGA 1JYTA 4LO8A 1FMD3 4XJUA 2VNOA 1OLMA 2WSUA 5FPAA 5GALA 5HCFA 3UGGA 3WSOA 4C0HA 4YARA 2W1WA 2Y6HA 2P3IA 5EV7A 1CZVA 4CDUC 2HBTA 2F17A 3IDBB 1QQP3 2OVUA 4Q5OA 1XSQA 3T2QA 4D6QA 5A1FA 2Y26A 4Y5Z0 4AQTA 4QT6A 3KMHA 2JD9A 4OI0A 1K5MC 4F8AA 1B35C 3KT7A 1ND3A 3AFGA 4FXKB 2E32A 2QDRA 1T6BX 1QF3A 4JTNA 2EIBA 5CFCA 4HN1A 4CU6A 5BY5A 2ORXA 2VZSA 4YPJA 3KT4A 3P3NA 4A7ZA 3ASIA 5HBAA 5KHIA 4C1XA 3OEBA 1A6CA 2P1BA 1KDKA 4XAEA 1IPKA 1Y4WA 1YCIA 1TME1 4COZA 3M3EA 1ZREA 4AHYA 2QQKA 2QFEA 5K0UB 2XVGA 1IGOA 3C7HA 3MGUA 4XFGA 3TOJA 1GNYA 1S0BA 5FZCA 3NJZA 1MS4A 5I8SA 2DCYA 2R16A 2XDVA 3MLKA 4IETA 3JBG3 1NCQA 5FMBA 4A4AA 4HVQA 1O8PA 1A78A 4UFIA 4LTAA 3VB9A 1PO13 1QOTA 3THPA 3ZIXA 3H9AA 1GQPA 5F5QA 3LEIA 2BVVA 4O9GA 4AYUA 1DDLA 1CX1A 5EHDA 3S5AA 1I5ZA 1SHWB 3N4MA 2VUCA 1DGWX 3VKOA 1W6QB 4NHMA 5CIRA 3LKJA 4Q0QA 4YWAA 2OKXA 3IN9A 4UOJA 1RL3A 4AI2A 4MLOA 4NMIA 4HPKB 3VBSB 4TTGA 1H30A 1OD3A 1FOD3 5D8AB 2VZ3A 4A6SA 3IAQA 3HN1A 3E1F1 3NAPC 4LHNA 4CEYB 4NR1A 2C26A 1LRHA 1J1LA 2WT1A 1VRH2 1QXPA 3SNMA 4CEWB 1D4M2 4E2SA 1Q8QA 1J84A 1D7PM 1O4ZA 4XXPA 3CBNA 1BJQA 1GNHA 2CYFA 3WW4A 2YY1A 5HCAA 2ZAAA 4IV1A 1MS8A 1XNTA 4ZONA 3PU8A 2W2IA 1V6KA 1FXZA 1NQDA 5A3OA 4Q4Y3 1RJ7A 4XURA 1F8VA 2ZABA 2BBAA 1U5ZA 1AYN1 1WWYA 2D5FA 3CZJA 3I59A 5BNNA 5H9PA 3OPZA 2OIIA 3G7DA 4DUVA 3ALQA 4QPIC 2J1TA 2JG9C 4COUA 4EN7B 1HB1A 1IG3A 3OGVA 1QJU1 1OVPA 1UIJA 4P9LA 1W2NA 3J9SA 4CVUA 1J59A 1JS9A 4L8QA 4BQXA 1Y9GA 4JDOA 2IXJA 1SCSA 1BQPA 2J7MA 3RS6A 1YQ6A 2RDSA 3TEXA 5FZ8A 3HBKA 1GNZA 3K2OA 1NE6A 3RG0A 5KXCA 4Y22A 3LA7A 1IQAA 4Q0VA 1S4CA 2PQQA 2GMPA 4OYUA 1Y3TA 3BTXA 3UYJA 4B29A 4AXOA 5CBLA 1FV2A 5BNPA 2GNDA 1UQXA 5JIUA 4CTEA 5AFBA 4LA3A 1VRBA 3WR0A 2VL4A 4S2HA 3O1TA 3F2ZA 3RWNA 3VBHC 3WEZA 2TNFA 5FO7B 5C4WB 2EXJA 4AW7A 2VBPA 1QJX1 1O91A 4M3CE 4JGYA 3PURA 1S2EA 4P02B 2A6ZA 1R092 1HRV1 2EIGA 2DU0A 2K0GA 1ZBA1 3Q8BA 4YVSA 2Q1MA 2WNVC 4FPEA 2FDJA 1BXHA 4Q4V2 2XONA 5L19A 2VOKA 3RDIA 2RS13 1PM4A 4XIKA 1QDCA 4GWIA 4N9HA 4H7LA 1WBLA 4BOWA 1W2TA 1AL0G 4DXRA 3BKZA 1AYM1 3DV8A 4LQRA 2O8OA 2BGPA 4S2GA 1T2XA 3J4UH 2B46X 4QX1A 4XZUG 4WV8A 4YW1A 1GLHA 4QQOA 1ASJ2 1AR63 1OA4A 4WVWA 3AMHA 2QQWA 5LRRA 2P4EA 3M2MA 3ME2A 5T5JA 5IJRA 2C4XA 3ZMOA 4OHYA 2WYSA 5JZGC 2PLV3 1TMF1 3NJYA 4ASKA 5DAWA 1UY2A 1YXWA 1TNFA 4CCLA 5FUIA 3KV5A 4M00A 5LY1A 5FLIA 4E8CA 1DZRA 2GP5A 3SKVA 3HJRA 3MPPG 2WZR3 4DFSA 2V5YA 4MX3A 4EN6B 5JLVA 1EY2A 1Q8SA 5CFDC 2XJPA 1TVGA 3OUIA 1Q5OA 1ZZ8A 1MZFA 1W8HA 1BHGA 1NYWA 2PYTA 4BCUA 4UWDA 3ZPYA 2YFZA 4AFDA 1IHMA 2A6WA 4YW7A 5IATA 1TZOA 2R041 2P37A 3VD9A 4JRAA 4OHWA 5IAXA 2EA7A 2ZGRA 4MVTA 1US2A 4WM7A 2W87A 1QJZA 1UNBA 4WZCA 2XWJB 5JCTA 4GULA 1MS1A 4BLIA 2WNUA 4A2UA 4F7ZA 3OF1A 3OTFA 3IB3A 3W20A 2D6MA 1WMXA 3JB4C 4RQPA 4Z1VA 3RZGA 2PTMA 2HWC1 3BCWA 2YZ4A 3HQUA 4XW3A 5FZLA 2Q8CA 1RUNA 4I3PA 1NY71 3HD8B 3UGHA 1ZVFA 4N90A 5FYYA 1OFNA 1MS3A 2IZWA 2VAUA 4Q0PA 3ZM8A 4DUWA 5A32A 3OGGA 1DYKA 3IWZA 4IERA 5DAXA 5F5AA 1C5IA 4GA9A 3RZMA 1U5IA
chains in the Genus database with same CATH topology
2C24A 1W8ZA 4LKDA 4AL9A 4BQ2A 4LKEA 2O14A 3ZYBA 1WCUA 5D21A 4YW6A 1W90A 1W8WA 4LK7A 4CPBA 3ZYFA 4BQ3A 1W8UA 1L7LA 1GWKA 3ORJA 2KR2A 4YWAA 1WMXA 3ZYHA 1OH3A 4CPBD 2JWPA 1W9FA 1UOJA 1GWLA 3F95A 4CP9A 2LRPA 2LROA 2Q1FA 4LKFA 1W8TA 1GWMA 2K46A 4LJHA 1V0AA 1WZXA 4A6SA 4BQ5A 4CP9B 2WYFA 4LK6A 3UT0A 4BQ4A 2VXJA 1OKOA 1HN0A 4YW7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C24 A;  1W8Z A;  4LKD A;  4AL9 A;  4BQ2 A;  4LKE A;  2O14 A;  3ZYB A;  1WCU A;  5D21 A;  4YW6 A;  1W90 A;  1W8W A;  4LK7 A;  4CPB A;  3ZYF A;  4BQ3 A;  1W8U A;  1L7L A;  1GWK A;  3ORJ A;  2KR2 A;  4YWA A;  1WMX A;  3ZYH A;  1OH3 A;  4CPB D;  2JWP A;  1W9F A;  1UOJ A;  1GWL A;  3F95 A;  4CP9 A;  2LRP A;  2LRO A;  2Q1F A;  4LKF A;  1W8T A;  1GWM A;  2K46 A;  4LJH A;  1V0A A;  1WZX A;  4A6S A;  4BQ5 A;  4CP9 B;  2WYF A;  4LK6 A;  3UT0 A;  4BQ4 A;  2VXJ A;  1OKO A;  1HN0 A;  4YW7 A; 
#chains in the Genus database with same CATH topology
 3I2F A;  5BV6 A;  1YUD A;  1DQ2 A;  4LHL A;  4PCR A;  3WNM A;  2ADE A;  2G9Z A;  3ETP A;  2W46 A;  4PLM A;  1EPW A;  1CN1 A;  4WM8 B;  1JYI A;  3IKW A;  3NJV A;  1GQG A;  2FBE A;  4XXA A;  3O1O A;  5KR7 A;  4EYU A;  4CCJ A;  5DUX A;  1TE1 B;  2R1D A;  4X8N A;  2BNN A;  1PGW 2;  3H8U A;  1Z7S 1;  2KR2 A;  5FKC A;  5C6C A;  1Y7B A;  3FHQ A;  5FJK A;  5LBF A;  2A6X A;  1FPN 3;  3FHI B;  4FBF A;  4DXT A;  3ZR6 A;  3VDD C;  2BWA A;  3POB A;  4FT8 A;  1W8T A;  4OZO A;  4Q4W 3;  5DUV A;  4FAG A;  1S2K A;  3SHR A;  1ND2 C;  2PN5 A;  4K7J A;  4ARX A;  5LBC A;  2R07 2;  1SFP A;  5FXZ A;  3JD7 1;  3LPF A;  1EP0 A;  3MFA A;  2AAC A;  3P5B A;  3IIA A;  4E4S A;  4QGM A;  2OYZ A;  4HSJ A;  3ZOI A;  1RUF 1;  2XQR A;  3NL1 A;  4FP2 A;  1RXF A;  4M3C B;  5I8T A;  3B5L B;  1CPM A;  1VB4 A;  3AMP A;  4N53 B;  4YGB A;  1MQT A;  3WT3 A;  1Q43 A;  2A75 A;  2SLI A;  3MFC A;  3I3B A;  4XDQ A;  2VOW A;  5G04 L;  1W2O A;  3RMX A;  2H6B A;  4AF9 A;  1H6Y A;  1RUD 1;  4CP1 A;  3WIN E;  2JE8 A;  5A7W B;  3OY8 B;  2ARB A;  1RIR A;  1W9S A;  3HAG A;  5F2W A;  1MZE A;  5A3L A;  3BIW E;  5FY4 A;  2DUO A;  1YRZ A;  2WO1 A;  2C6S A;  4PQQ A;  2UWC A;  1UKG A;  3ZFG C;  1UF2 C;  4XF4 A;  2W9X A;  4NHK A;  4Q4X 3;  1RUJ 2;  1VBA 1;  3POG A;  1EAH 1;  4BYY A;  3UJO A;  4EWD A;  2VBD A;  4XTP A;  2WZ8 A;  3MW2 A;  4RR3 C;  2F4L A;  1SCR A;  1RUO A;  1SLB A;  3HT1 A;  4UFK A;  4Y20 B;  4CDW A;  2WII B;  1FMD 1;  2C0Z A;  2W68 A;  5C8C A;  2RR1 2;  1GYK A;  3QBQ A;  2WC2 A;  2XOM A;  1HIX A;  1CX4 A;  4O9E A;  4TSV A;  3JD7 2;  3ES1 A;  5E1R A;  1SLI A;  2CY6 A;  4CPB A;  2GNM A;  1QKQ A;  2V72 A;  2YG0 A;  3I4I A;  4BXF A;  1QGL A;  1S0F A;  3NST A;  4N43 A;  1H6X A;  5E16 A;  1DFQ A;  1W9F A;  3LCP A;  3LIG A;  5D1I A;  3VZL A;  3TEY A;  1CJD A;  1KJR A;  1OLM E;  2EXI A;  5CA6 A;  1A8D A;  3HQX A;  3V0A A;  1DLC A;  3OYW A;  4NUB A;  3V65 A;  5JI9 A;  3ZYJ B;  1URX A;  4P00 B;  4YM2 A;  5FY9 A;  4KU8 A;  4MH0 E;  4XCA A;  4OHV A;  4R9A A;  4KWJ A;  3IPV A;  4DRV A;  5A3T A;  3VHO A;  2B9U A;  4AI9 A;  2HH9 A;  4AZZ A;  1UCX A;  1C28 A;  2DDU A;  2W3J A;  5FXW A;  5K0U C;  4A3X A;  1WW6 A;  1VP6 A;  4YZ4 A;  2JG8 A;  3VBR C;  2PAK A;  4JQR A;  3SXW A;  1W8W A;  4FSJ A;  1SDD B;  2XB6 C;  4RYD A;  1WMF A;  1UXZ A;  1VIW B;  4KBB A;  1W2A X;  4AED C;  1ZX5 A;  3R0R A;  5AC9 1;  2I74 A;  1XPW A;  5LA9 A;  3AZW A;  3AB0 A;  4MXV A;  3AP5 A;  1FAY A;  1DZT A;  3WF4 A;  4LMF A;  4OUS A;  3LF7 A;  3JBG 1;  3W5N A;  3VBF B;  3J26 N;  5FZ3 A;  2HYX A;  4UW4 A;  1PO1 1;  3AYE A;  1CPN A;  1SZB A;  4A44 A;  3N36 A;  1WCQ A;  3MV0 1;  4HFS A;  4KGG A;  3POW A;  3VBS C;  1N1V A;  2BGC A;  4Y1V A;  1HJG A;  4EN0 A;  3TAY A;  2WNE A;  4Y3O A;  2RDR A;  5JUV A;  3L2Y A;  3KD4 A;  1PGL 1;  1QJF A;  4JV4 A;  1QEX A;  2YC4 A;  4Q27 A;  5LK7 B;  1R08 1;  3W9A A;  4CEW C;  5A33 B;  2BUK A;  3NWK A;  3KV9 A;  1FOD 1;  3N9M A;  3ZFF C;  4DS0 A;  1H8T B;  4IEY A;  2ZJC A;  4MGZ E;  3WXP A;  3W5M A;  4Y1Z A;  5JWP A;  4J6G A;  1XU1 A;  3ACF A;  2D6P A;  1O4Y A;  5GLV A;  4NIH A;  4EJR A;  4OI1 A;  1VRH 3;  1ZA4 A;  3GAL A;  5F9T A;  1D4M 3;  2PA7 A;  4A3Z A;  3PIJ A;  1ZZ6 A;  2D40 A;  4YG0 A;  4ET7 A;  2EAK A;  3ZXA C;  4HZF A;  2Z69 A;  5F37 A;  1YHF A;  1TME 3;  5A7Q A;  1UMZ A;  1AX1 A;  1GUI A;  1VB2 A;  4Q4Y 1;  4RFR B;  1KRI A;  1K3I A;  3AL5 A;  4CYD A;  1QH7 A;  1KFX L;  3E5X A;  4K8F A;  4GIQ A;  2EIE A;  5JXJ A;  4XEZ A;  2CV6 A;  1XJA A;  3S30 A;  1GAN A;  4NHL A;  1K45 A;  5F7U A;  3HNM A;  4BJ0 A;  2HWF 2;  2P2K A;  5DUU A;  3U4X A;  2WWJ A;  5FYI A;  5T52 A;  3N7J A;  5A3P A;  3AZV A;  1WLW A;  5BNQ A;  5IVV A;  3NNL A;  4LOS A;  5EPA A;  1OPO A;  1T6G C;  2PHL A;  1JZ8 A;  3ZMN A;  2EIC A;  1UZY A;  4I02 A;  3NVC A;  3N9Q A;  3VKL A;  2BZD A;  5F32 A;  2KD7 A;  5L9V A;  2XVL A;  2PAE A;  4FTE A;  4N9I A;  3ZDV A;  2JXA A;  1F35 A;  1PK6 B;  5FRE A;  5JOX A;  5C9A B;  2Q8O A;  2LTN A;  3POF A;  5BYN A;  2FD8 A;  3RVH A;  3H8R A;  4B4Q A;  5LK5 A;  2QQU A;  5FP9 A;  3MZH A;  3MIC A;  4FFH A;  2AUY A;  3A21 A;  5IVE A;  2WDB A;  3NV2 A;  1I6X A;  1AVB A;  1QJY 1;  3FLR A;  4JDM A;  2DF7 A;  2K9Z A;  3NNF A;  4QX3 A;  4AVT A;  4C0B A;  4EWE A;  1AZD A;  3VDC A;  1Q8P A;  3KV6 A;  4UAP A;  1KS5 A;  5CKN A;  4FTB A;  2K46 A;  5FMC A;  1MVQ A;  1UW8 A;  2E31 A;  5ISL A;  1BMV 1;  1HB4 A;  1WCD J;  3GDB A;  1AYN 3;  1PIV 1;  4PBP A;  3N9L A;  2RM2 2;  3KCY A;  1SG3 A;  3H7J A;  4CUC A;  2VZQ A;  3ITQ A;  1UKR A;  3RQ0 A;  4D7Y A;  3GHM A;  3CJX A;  5E89 A;  1KEX A;  5DXD A;  4DEV A;  2G9F A;  1QJU 3;  3QH7 A;  1MEC 2;  4GAZ A;  3AP9 A;  1WCU A;  1AL2 1;  4YVW B;  4WBB A;  2FCT A;  3QOP A;  1ACC A;  2E51 A;  2VW1 A;  4AQS A;  3V64 A;  4GAL A;  2B8M A;  3ORJ A;  2WA4 A;  2VE1 A;  1W6P A;  4NID A;  4Q1P A;  2JD4 A;  3DXU A;  4XMA A;  4AHX A;  5ACA 1;  4WVM B;  3KM5 A;  3OD0 A;  3WW3 A;  3BIE A;  5GZC A;  2NN8 A;  4JKK A;  4PDW C;  4XJ9 A;  2GNT A;  1HB3 A;  2V73 A;  2NYY A;  4QKD A;  1F5J A;  3ZKU A;  4AVV A;  4F83 A;  2UWB A;  1QJY 2;  4IND A;  5J37 A;  4P9G A;  3ZYB A;  2NP0 A;  2ID4 A;  1BMV 2;  2WZR 1;  5HCH A;  2W94 A;  2OX0 A;  1YQ5 A;  5FO9 B;  3L2H A;  4IEZ A;  1IS5 A;  1J58 A;  3IDC B;  1QJX 3;  1DBN A;  1OH3 A;  2E7T A;  1JYX A;  3T2O A;  1BYH A;  2JWP A;  1O7F A;  1Q56 A;  1XYO A;  3U07 A;  4HVO A;  1LOF A;  1W6O A;  2VJX A;  2VC9 A;  4IEQ A;  4E4H A;  1AL2 2;  5GJ6 A;  2VNR A;  3EXU A;  3WOG A;  4P5Y A;  2W47 A;  5FP3 A;  1PVC 2;  2IWG B;  1AYM 3;  3E5Q A;  5DAP A;  3B01 A;  3I2O A;  5ACA 2;  2ZGP A;  4LLO A;  2VUJ A;  5T5O A;  4NPM A;  3WF0 A;  2DVA A;  4GB3 1;  4IV1 B;  3CDZ B;  3I3D A;  1QDO A;  1S0G A;  4KWU A;  1Z78 A;  1WLC A;  3OG2 A;  4LE4 A;  4FPJ A;  5F6L B;  3KQ4 B;  4WM8 C;  5BNN B;  1TMF 3;  3I59 B;  1UO9 A;  1OVS A;  1OOP A;  4NRM A;  1GU3 A;  1QY4 A;  4LO5 B;  3ZKY A;  1IKP A;  3MLL A;  5C7G A;  4ZU5 A;  5I93 A;  3DCQ A;  1W06 A;  3INA A;  5F3E A;  4BA6 A;  4CDX A;  3ATG A;  5LZ6 A;  3T1L A;  4KQ7 A;  3UKT A;  3ZN6 B;  4KWK A;  1CAW A;  3B00 A;  3BTA A;  2IC1 A;  1V00 A;  3JB8 A;  1W99 A;  4QDS A;  4OLL A;  2Y6F A;  2R04 3;  4SBV A;  5GLW A;  1HJF A;  3JXS A;  1VBD 2;  1VAK A;  3ILN A;  2VY0 A;  4YZ5 A;  4Q4W 1;  1IPS A;  1JUI A;  1N1Y A;  2X53 S;  4JTO A;  2UYA A;  1ENR A;  1N3O A;  4PJY A;  3UGF A;  4BQW A;  4MHR A;  5CG9 A;  3QH6 A;  4N53 C;  3I3E A;  1EV1 1;  5L7O A;  2D6N A;  4Y22 B;  1JYN A;  2FCU A;  3MO4 A;  3OB8 A;  2WS9 1;  2P3Y A;  2R07 3;  2UWA A;  4RHV 2;  4YLZ A;  3BTZ A;  5BNP B;  4QQH A;  1VBB 1;  1F31 A;  2HWC 3;  4NRQ A;  3K4A A;  1DU3 D;  4ZXK A;  4H14 A;  4XYX A;  1POQ A;  4BU2 A;  2ZEX A;  1PO2 2;  3EO6 A;  4W6X A;  5FY0 A;  4I09 A;  3U4S A;  4IE5 A;  3WY6 A;  4JGY B;  1O3T A;  3WDU A;  1CWP A;  1NUK A;  4YVS B;  5HPO A;  1H0B A;  1KGY A;  5DMY A;  3DEC A;  1RUG 2;  4D8M A;  4MGY E;  5EIY B;  5LA1 A;  5FMD A;  3DEM A;  1F5F A;  2HWE 2;  4OFG A;  2DUQ A;  4QQP A;  4XC9 A;  5FKB A;  5FZF A;  1Z7S 3;  1MR5 A;  3RNS A;  3H8X A;  4LOT A;  5JPN B;  1NQJ A;  4Z82 A;  1CAX A;  2EAA A;  4TWT A;  3THD A;  4ASM B;  2B42 B;  5K9Y A;  1WKY A;  3R4D B;  2YBP A;  1YNA A;  3WDY A;  4CDU A;  2RR1 3;  4HKO A;  3C2U A;  1OQ1 A;  1AXZ A;  2Y0I A;  3D4K A;  3JD7 3;  3MF6 A;  3U1X A;  3AXD A;  3MUY 1;  2JB8 A;  1RUF 3;  2MPF A;  1UZW A;  1K5M A;  1JI6 A;  1B35 A;  1RMU 2;  3WNX A;  1H8V A;  2W39 A;  1R1A 2;  3F95 A;  3ZSK A;  1YIP A;  2JX9 A;  4TLG A;  1XBF A;  5CU1 A;  1DIW A;  2ZEZ A;  3CIH A;  3MHZ A;  1UYX A;  4XCB A;  4YZ3 A;  5J36 A;  1QXJ A;  1OKQ A;  3WD5 A;  4QB2 A;  1UY3 A;  1ODM A;  3BPS A;  5C3R A;  4CXX A;  1AXY A;  1OH4 A;  1UOG A;  4XUP A;  1VBA 3;  4U2A A;  1EAH 3;  1KQR A;  1S0C A;  1LOB A;  2R06 2;  3M70 A;  2O14 A;  3MUZ 1;  4WM7 B;  2LUW A;  5I0T A;  3ZPO A;  4LIV A;  1RTV A;  2Z79 A;  2WNU B;  2WT2 A;  3FFQ A;  3PME A;  2DVF A;  4JVA A;  2PHW A;  1WMD A;  3RZZ A;  1NZI A;  4AQ6 A;  2XHK A;  4OMD A;  2QUO A;  5DAV A;  2AEZ A;  3B94 A;  4BH9 A;  4RQP B;  4CP9 A;  1PZ8 A;  1RVF 2;  1UU5 A;  2XL7 A;  4GWM A;  4LKF A;  4XDP A;  5GZD A;  3SCH A;  3S7E A;  5GLU A;  3PU3 A;  2A73 B;  4COW A;  2EID A;  2SBA A;  5A32 B;  4AAP A;  1V6O A;  1H8T C;  4BDV B;  1ZZ7 A;  2JB4 A;  1XE0 A;  2ADD A;  3KB5 A;  1ULP A;  1BKZ A;  1LHW A;  3ROU A;  3FLP A;  2ZGQ A;  4BMB A;  5LAT A;  1AR7 2;  4YW2 A;  2GNB A;  3JQW A;  4YM0 A;  3LAG A;  3PIG A;  1U5X A;  3UET A;  1SFN A;  4IES A;  1VAL A;  4QX8 A;  5FWE A;  3PMS A;  1W0N A;  1YI9 A;  4ZZ5 A;  5I0S A;  2WBK A;  4FFI A;  1VRH 1;  5I0U A;  1AR8 2;  1D4M 1;  2ENR A;  3I2J A;  3VD3 A;  4AI3 A;  2GH2 A;  3JCI A;  3PHM A;  1UWW A;  2GC1 A;  3B9I A;  4P9I A;  1WZX A;  4YGC A;  4QXB A;  5FY7 A;  4LR4 A;  5AC9 3;  5FXV A;  1C57 A;  5F2S A;  2NMO A;  3GYD A;  4XDO A;  5ERL A;  2D6L X;  1JU4 A;  5KC6 A;  2YU2 A;  1CZT A;  3WNK A;  1Q3E A;  3I49 A;  3ZIW A;  2ZAC A;  3CJI B;  3ZX7 A;  4QPI A;  1H2L A;  1XB9 A;  5TSW A;  4CU8 A;  2MNG A;  4DO0 A;  4NRO A;  2K2S A;  3VD4 A;  1MQT B;  2B5H A;  3VBO B;  1UZZ A;  4YW6 A;  4OCT A;  2DV9 A;  5A1L A;  1SPP A;  2GU9 A;  4L92 A;  4LNV A;  1FNZ A;  4R52 A;  1G6N A;  2Z42 A;  3PVE A;  4BQ3 A;  1OSG A;  1TG7 A;  2IVI B;  3AMQ A;  3ACI A;  2CSG A;  3H1W A;  2JJ6 A;  4LIU A;  4BB3 A;  5C9A C;  1R08 3;  4AGV A;  1JMU B;  3ZYP A;  1NT0 A;  3N7M A;  2GMM A;  1E5H A;  4QX2 A;  5IFT A;  1H4G A;  5IYY A;  3PDQ A;  3AXE A;  2DCZ A;  3VV1 A;  4LUM A;  4MOA A;  3ZLI A;  2YMZ A;  4QX0 A;  2Q30 A;  3BOP A;  5J48 A;  5JOY A;  5IFP A;  2FZ1 A;  4GMP 0;  3H3U A;  3HR9 A;  5EQU A;  3MIE A;  3D82 A;  3DYP A;  4CDW B;  3IDE A;  2D6O X;  2HLE A;  5C8C B;  2BGO A;  1LGC A;  4O61 A;  4Q1R A;  3AVS A;  4V2V A;  5IHR A;  3VBH A;  2JDK A;  2RJK A;  4P14 A;  3VLB B;  3BOW A;  1N1S A;  2VQ0 A;  2WUH A;  5CZK A;  4XET A;  3UV9 A;  2Y64 A;  4AAX A;  2QKD A;  3TB0 A;  1DGL A;  4URA A;  3FBY A;  4YVW C;  2J1A A;  2JE7 A;  1W6N B;  3J8F 2;  5BNO B;  2RM2 3;  1APN A;  2XH6 A;  2ZML A;  4KNC A;  3V0A B;  1R09 1;  1BVP 1;  3C7F A;  2X05 A;  5T54 A;  5JMO A;  4FVV A;  1JTZ X;  2B4K A;  3ELN A;  4TXW A;  1FAT A;  1RUI 2;  2BVB A;  2CL2 A;  2ZX0 A;  3FMG A;  4Q4V 1;  4YRD A;  3RZK A;  2JKX A;  4N7I A;  3GZT B;  1NXD 1;  1L7Q A;  3VKM A;  1W9W A;  1O3R A;  1W6M B;  2VME A;  4XHB A;  1CAU A;  2XLA A;  2W08 A;  4OQ9 A;  1V6J A;  2JG8 B;  4HOO A;  4ASL A;  2EAL A;  4EN8 B;  1YFX A;  5F3G A;  4AFC A;  2CWM A;  1DZQ A;  4CXW A;  3WG2 A;  3LIH A;  1ASJ 1;  1SBE A;  4D0Q A;  1UOF A;  1HQN A;  4FI9 A;  3ZXD A;  1GZT A;  1CIW A;  2VQU A;  4IEP A;  4R8H A;  4FPG A;  1NA1 B;  1E5R A;  3WUD A;  5CVR A;  5IVB A;  1QJY 3;  3ZSL A;  1IS4 A;  1WW4 A;  3WP5 A;  5JSP A;  5JSO A;  1MAC A;  1XE8 A;  2A3W A;  4L97 A;  1SEF A;  4JX0 A;  5CFD A;  2ET7 A;  3C8X A;  1GBG A;  3GZU C;  3OBR A;  1PIV 3;  3DPR A;  2QZ3 A;  5EXO A;  2G4I A;  1GP6 A;  4W6Y A;  3GJB A;  3GGL A;  5ANQ A;  3KHB A;  3IBM A;  4Y33 A;  2E7Q A;  5T5P A;  4G3Y C;  4ONU A;  2BQP A;  4AVC A;  1RHI 2;  2P3K A;  3OJB A;  4GH4 B;  2B7Y A;  1AL2 3;  4KH9 A;  5FZ1 A;  4CUG A;  4IV1 C;  1QH6 A;  5KC5 A;  5KWR A;  3WDX A;  4J1X A;  4JKM A;  4N8M A;  1A8M A;  2VMH A;  1JHJ A;  3VKF C;  3LZZ A;  4GJY A;  1UY0 A;  5FJH A;  1JOP A;  2ZEW A;  4LO6 B;  5DZG A;  1RYY A;  5ACA 3;  5DPN A;  5BNN C;  5HCB A;  1SLL A;  1Y43 B;  4RFT 0;  2J1E A;  4CP2 A;  3NRU A;  2O0O A;  1ULE A;  2ZOE B;  2FDK A;  2IUW A;  4QKB A;  5DG2 A;  2G19 A;  5I0R A;  4LBJ A;  2Y6K A;  5A3W A;  3POJ A;  3JQX A;  2P5B A;  4B3N A;  3RYK A;  2ZS6 B;  4RL7 A;  5KXE A;  1C3H A;  2VCM A;  2VMD A;  3RMY A;  1FX5 A;  2DCT A;  5KHG A;  2PHT A;  1OI6 A;  3VDA A;  4Y24 A;  4I2O A;  3DL3 A;  4NPL A;  1HXS 2;  3M8L A;  2WJS A;  3ZSE A;  4XFH A;  4S2D A;  2Z4F A;  2UY9 A;  3AMN A;  5IVF A;  3U78 A;  2BJS A;  3U10 A;  1OQD A;  5JDB A;  4Y1U A;  3QAC A;  1PZ9 A;  5F3I A;  3HT2 A;  1PGW 1;  2G9G A;  3DGT A;  3K3N A;  5FYU A;  5LWB A;  2IVJ A;  2VZ1 A;  3WQ1 A;  1QIQ A;  3WQ7 A;  3ZDS A;  4R4Z A;  4PI2 A;  3LD8 A;  4CXY A;  5BNP C;  5FXX A;  3PVO A;  4QHB A;  4CP0 A;  1V9U 1;  2J1S A;  4LHS A;  4XFB A;  5FMO S;  4Z2W A;  3D6E A;  3AKT A;  5T55 A;  4BXS V;  2R07 1;  1KXG A;  5GKA C;  3MW3 A;  4AFB A;  4CCE A;  5FY8 A;  3TNP B;  3ABZ A;  4GB3 3;  5JXH A;  5FPL A;  4JGY C;  3X29 B;  2JDY A;  3FWE A;  2JEN A;  3ETQ A;  4URT A;  2VZR A;  1BK1 A;  2B45 X;  2HWB 1;  4HVR A;  4UFJ A;  4FCA A;  4YVS C;  1OC1 A;  4V1P A;  2D43 A;  2VO5 A;  2WNO A;  5FPZ A;  2AEY A;  4OMC A;  1OF4 A;  3OOX A;  2A3Y A;  5ANN A;  3TN9 2;  4F3J A;  2W95 A;  3ZFG A;  3FHA A;  1SLA A;  3I2I A;  2XKO A;  3I8T A;  5DZF A;  2Y0O A;  4NAO A;  1POV 0;  1LEN A;  1SBD A;  4Q0U A;  1DCS A;  2UY8 A;  3KV4 A;  1LAJ A;  1WA4 A;  2VVE A;  4PIY A;  1JHN A;  4RA0 A;  1RUJ 1;  1CIY A;  3W58 A;  5A6Z A;  1P8J A;  4K21 A;  4RR3 A;  4RS5 C;  4DOU A;  3TWI A;  1PMH X;  2XJV A;  3VDB A;  2HWE 3;  2BP6 A;  4QXK A;  1GR3 A;  2VW2 A;  1W04 A;  4PQ9 A;  4I01 A;  4KU7 A;  3LE0 A;  1WLT A;  3RYR A;  4BQ5 A;  1V9U 2;  2JE9 A;  4GWN A;  4XJW A;  3WP3 A;  5IVJ A;  3OBT A;  1S0I A;  1R64 A;  2CAV A;  1U0A A;  2RR1 1;  2X5I C;  1EV1 3;  2XGX A;  4WVZ A;  3WHT A;  1UIK A;  2V5D A;  1COV 1;  1NLQ A;  4FO9 A;  1Q8V A;  4IW3 A;  3Q8C A;  2WS9 3;  4QU2 A;  2E9Q A;  1W9Y A;  2PEL A;  4H3W A;  3DUI A;  1VBB 3;  3HEI A;  1XYN A;  2HWB 2;  4IDZ A;  4IV3 C;  3I3M A;  2BNM A;  2WFF 1;  3I2G A;  4FOQ A;  4LO4 B;  2PHD A;  1U5Y A;  4TN7 A;  1RMU 3;  4QB1 A;  5CYY A;  1YO8 A;  2R0F A;  2RV9 A;  2Y8K A;  4I0W B;  1ENS A;  1W8U A;  2Y38 A;  2GC0 A;  2VOX A;  3FX3 A;  4QPG B;  5IT6 A;  2HEV F;  3VZK A;  4WM7 C;  2HKX A;  4J25 A;  1VJ2 A;  1I3H A;  1OA2 A;  1DYP A;  2XXZ A;  4AI0 A;  3VBR A;  1YC6 1;  1AXK A;  4NVP A;  1W6O B;  4AQ2 A;  2VGD A;  3NJX A;  2X8K A;  1SQ4 A;  1OLR A;  2A6Y A;  1D2Q A;  3A4U A;  4AED A;  2BFU S;  2ZCW A;  3OUJ A;  1GZW B;  1ZM1 A;  3EYP A;  1UZV A;  4IGP A;  4KMQ A;  5F1R A;  3POY A;  4IQP A;  4M3C F;  4NIG A;  1X82 A;  4DXZ A;  4D6R A;  1BEV 2;  1UXX X;  2O1Q A;  3E6B A;  2ZZQ A;  1KJL A;  1C8M 1;  2VMI A;  3AJZ A;  3V0B B;  1COV 2;  3GBG A;  5F5I A;  4CPB D;  1PNG A;  1XNC A;  4HPK A;  3VHP A;  1ENQ A;  3FZ3 A;  1ULC A;  2TBV A;  4E9K A;  2MEV 2;  1UOJ A;  3RFR A;  1IPJ A;  5J96 B;  2ZHM A;  2WFF 2;  1HRI 1;  4Q8K A;  4QM9 A;  2VXR A;  2VZV A;  3KVB A;  4CEW A;  2XR4 A;  4UYB A;  3UT0 A;  3ZFF A;  1HN0 A;  3WNO A;  3NNG A;  2QJV A;  4QPW A;  4KG8 A;  1JYW A;  2QQL A;  2DUR A;  5C3P A;  4JGZ A;  1ULG A;  1ULD A;  1RUH 2;  2XJR A;  3C3V A;  4MYE A;  4QX5 A;  5IVC A;  2XHN A;  3VBU B;  4GWJ A;  4O7X A;  1HKD A;  5CKM A;  1AR8 3;  1JYC A;  2OXB A;  1CAV A;  1ZA7 A;  3MI8 A;  4PIZ A;  2Y6J A;  3CJI C;  4P9X A;  3WF2 A;  4MET A;  2ZMN A;  1MQT C;  3VBO C;  4YW3 A;  5L7O B;  1UPS A;  2DWR A;  5FZB A;  1C8M 2;  1OT5 A;  1LJ7 A;  2VTF A;  2WYF A;  1D0H A;  1JZ4 A;  1JYV A;  2FCV A;  4OI4 A;  2BRT A;  1C1L A;  4XF1 A;  1D0G A;  3NQH A;  5J3U A;  4FOW A;  4QB6 A;  4AHZ A;  2HWF 1;  3WQB A;  4DY3 A;  3ZXK A;  3USS A;  1HRI 2;  5D8A C;  4NWW A;  5FOJ B;  2IXC A;  2JIJ A;  1J3P A;  1GP4 A;  1YLL A;  2D6K A;  4CEY C;  3ENR A;  3LWC A;  4ZU4 A;  5JSR A;  1WUV A;  3B02 A;  1JOD A;  4UF0 B;  4R9C A;  1EYB A;  5C8W A;  1NZC A;  3NKG A;  1UY1 A;  2FMY A;  2XWB B;  1LR5 A;  2W1U A;  1GOH A;  4CDW C;  4BM8 A;  4XFA A;  5JVV A;  2ZMK A;  2R6Q A;  3I2H A;  5C8C C;  5FZA A;  3T08 A;  3ZXE A;  3HWJ A;  2VZO A;  5B4X A;  4YG3 A;  1SMV A;  1OUS A;  2XBO 2;  3MF9 A;  3O0V A;  4LIT A;  4OI2 A;  1G9D A;  1CAX B;  1OBN A;  2JDP A;  4MHU A;  3NMB A;  1O59 A;  3GHN A;  4Q8L A;  3WCR A;  2QQV A;  2ATF A;  2NZ9 A;  3B7M A;  3O5S A;  5BNO C;  4GXL A;  4W6W A;  3U75 A;  4NO4 A;  5ABJ A;  4UI9 L;  1UN1 A;  2XML A;  4CDU B;  3USU A;  5JOW A;  3LA3 A;  5JXG A;  1V6M A;  4QM8 A;  3O1M A;  2WN2 A;  2DBI A;  1GQH A;  3ILF A;  3ZYG A;  1BBT 1;  2RM2 1;  1SDW A;  3S0M A;  3VZN A;  1NCR B;  5C71 A;  2VG9 A;  1B35 B;  1AF9 A;  1D2S A;  1LUL A;  3J8F 3;  3NNJ A;  4JAA A;  4DMI A;  4CZS A;  4A6O A;  1L7R A;  5FYB A;  5LA2 A;  4X6Q B;  2YUE A;  1MEC 1;  4M0H A;  3S5Q A;  2E53 A;  2OPW A;  4DQA A;  1RUI 3;  3N9O A;  4ATE A;  4HET A;  5C5U A;  2GDF A;  2GN3 A;  2HYK A;  4QU1 A;  4RGA A;  3UJQ A;  4I30 A;  4E4Z A;  1NA1 C;  3A22 A;  1JW6 A;  2RG4 A;  3C7E A;  3LA2 A;  1S0D A;  4XFF A;  1V70 A;  5JIA A;  4PDW A;  5BPX A;  1C8N A;  4BLJ A;  3PUA A;  4MXW B;  2ZXQ A;  2PHX A;  3ZXG A;  2QQI A;  5DAB A;  5C4W C;  1LU2 A;  4E4D X;  3MIG A;  3N9P A;  1VR3 A;  4LE3 A;  4QGN A;  3CEW A;  1JOJ A;  2BDR A;  5KHJ A;  2FDG A;  3PTR B;  3GM8 A;  3FBM A;  5A7P A;  3SIS A;  1RUE 2;  2J1R A;  3D5O A;  3Q8E A;  5KBF A;  3BUC A;  3LDK A;  3H1Y A;  1BBT 2;  3KQR A;  2XLG A;  3LQC A;  2DCK A;  4GH4 C;  4UT5 A;  3FUO A;  2RDN A;  3I97 A;  3NV3 A;  1R09 3;  3UKV A;  1BLZ A;  1ND3 B;  1U12 A;  4H2A A;  1V6I A;  2A5Z A;  5CFC B;  4XUT A;  5KHH A;  3ZFE A;  4LK7 A;  4Q4V 3;  2WQZ C;  2DFB A;  1RHI 3;  2R32 A;  2WFP A;  2ZGT A;  2I45 A;  4H7M A;  2P17 A;  2JDH A;  2OQ7 A;  4COV A;  5DQ0 A;  4CRQ A;  2QDN A;  1I5P A;  1PX4 A;  1LEC A;  2CGO A;  2PMW B;  3T0A A;  1YQC A;  1PVC 1;  2WWU A;  3GXU A;  3LGR A;  3QD6 A;  2ILM A;  3URF A;  2GAU A;  4FQZ A;  3BB6 A;  4AVA A;  2VOV A;  1RXG A;  1AJK A;  1LNS A;  3Q8A A;  3SC7 X;  4GD4 A;  1ASJ 3;  2KM2 A;  1VBC 2;  3K77 A;  1YFY A;  4WM8 A;  1QMJ A;  3WDT A;  4LBQ A;  4LBQ D;  3WDW A;  4IEV A;  1NCQ B;  4IE7 A;  2VH9 A;  4MGK E;  2JIC A;  2BWC A;  3OGJ A;  1HB2 A;  2HWD 2;  1W90 A;  3NKT A;  4HKW A;  4LO7 A;  4PHZ A;  3LEM A;  1CES A;  4XMI A;  1SPP B;  5FYT A;  3B69 A;  5CAZ A;  3WNL A;  4OHX A;  4KI5 M;  1HXS 3;  2G1M A;  4ISR A;  4BK4 A;  2KA3 A;  3H1M A;  4XVH A;  4BWO A;  4XUQ A;  3Q9O A;  1NX9 A;  1KS4 A;  3P3P A;  3T0B A;  5LCW L;  4C91 A;  1OFS A;  4BIO A;  3MW4 A;  4IGQ A;  1UU6 A;  4PBO A;  4KG0 A;  1E5S A;  4PLO A;  5FCC A;  2GC2 A;  2VXJ A;  5I8Y A;  4OQ8 A;  1OKO A;  3LFM A;  1VBD 1;  2ZEY A;  2W1S A;  4N53 A;  3THT A;  1K42 A;  3O7O A;  1W2U A;  4HL0 A;  3K3O A;  1WGP A;  4ARY A;  1KFU L;  4XOG A;  4IXL A;  3OY8 A;  5LBB A;  4A45 A;  3RPQ A;  2UU8 A;  1DG6 A;  2DFC A;  4RHV 1;  5J98 B;  3T1M A;  4TZD A;  2R1B A;  4FPC A;  4R4X A;  2E6V A;  3ACH A;  4FFF A;  2WIN B;  2AEN A;  1GWL A;  2ZX4 A;  3KVA A;  1PO2 1;  2BU9 A;  2WT0 A;  5EP9 A;  4BZ4 A;  4GMP 1;  1HV1 A;  1DHK B;  5JR2 A;  4NHY A;  4UFH A;  3CNA A;  4QX7 A;  3TN9 3;  1A34 A;  1RUC 2;  1JXN A;  3WLU A;  4JC1 A;  4D69 A;  4Y20 A;  2VOT A;  4X6R B;  5FTT C;  3WNN A;  1KIT A;  3KCC A;  4FPL A;  1AR6 2;  3AVR A;  1RUG 1;  2YGL A;  2VVF A;  2LAL A;  2YRO A;  4D94 A;  1IQD C;  2HWE 1;  2V4V A;  4FOV A;  3VKN A;  2CNA A;  1W0P A;  3MIH A;  5BUV A;  2VCB A;  1F4A A;  1S2B A;  1GWK A;  2ZGM A;  3WZ1 A;  4DY5 A;  1ENX A;  1ZYB A;  1W3V A;  2VMG A;  4YG6 A;  4COY A;  4UW3 A;  1V9U 3;  2LRP A;  3K46 A;  4YGE A;  4MO3 M;  4XJA A;  1CR7 A;  4EN9 B;  4BPZ A;  5FYM A;  1HX6 A;  3RGB A;  3I2D A;  3TEZ A;  4AHW A;  1AJO A;  3D0S A;  2F6B A;  1XU2 A;  2YDE A;  3MBW A;  5FZM A;  1FYU A;  2VUA A;  4QPG C;  3S6P A;  5FQ0 A;  2WKK A;  3SLI A;  3IMN A;  2HEY F;  2ET1 A;  1RMU 1;  3OCP A;  4PT6 A;  2HWB 3;  1W8Z A;  2IXH A;  3GZA A;  2AYH A;  3RI9 A;  3OBA A;  4ES9 A;  5I91 A;  1R1A 1;  5CFD B;  5M0T A;  4IE0 A;  2X29 A;  4O65 A;  3BU0 A;  3ZXJ A;  1X7N A;  1W8F A;  3VUO A;  3DPR B;  4CCC A;  5FZD A;  2Q8E A;  1OHF A;  4XUO A;  1UOB A;  3AKQ A;  5FYS A;  5DDJ 2;  4QAW A;  3SH4 A;  3TNQ A;  1CJP A;  2FQP A;  3SCF A;  3WP4 A;  1AHS A;  1AX0 A;  1G9A A;  2OS2 A;  3GBF A;  4EZH A;  3AZZ A;  1YEW A;  1S0E A;  2LW8 A;  1RUJ 3;  2R06 1;  2F4P A;  5H9Q A;  4NWV A;  1VMJ A;  3T2T A;  2DTY A;  2WRA A;  1JN2 P;  3T09 A;  4CDQ A;  4NII A;  3BYW A;  4NRP A;  2RS3 1;  5EJ3 A;  1Y9M A;  3B9C A;  2VW0 A;  3OGS A;  3OEA A;  1GOG A;  4G9S B;  4AGG A;  1AUY A;  1YJK A;  5GLZ A;  2XVK A;  2ZGO A;  3THC A;  4BQ2 A;  5CEH A;  4IEU A;  3HVD A;  5FP8 A;  1RVF 1;  2QQP A;  4XIO A;  1COV 3;  3FL7 A;  4IUG A;  2RDQ A;  3MPB A;  2NQY A;  1G7Y A;  1X36 A;  4HAN A;  2WZE A;  3DYM A;  2JEM A;  4QQL A;  1GZ9 A;  4UFM A;  5L73 A;  1ZRD A;  4RGK A;  4XQD A;  2WFF 3;  2P6C A;  3HPN A;  3T3Y A;  2Q1F A;  1FPN 2;  3LSD A;  4FXG B;  4Y26 A;  1YFU A;  3VBU C;  3III A;  1EUU A;  4CA9 A;  2A7A A;  3M3I A;  1AR7 1;  2NPI A;  1YQ8 A;  2QQM A;  4LT5 A;  1NKG A;  2I07 B;  2CHH A;  3L9J T;  1M4W A;  2YPJ A;  3NW4 A;  1DF0 A;  1VE0 A;  5K7P A;  1YQ2 A;  2GP3 A;  4KBZ A;  2MHF A;  3O0X A;  2R0H A;  1RUH 3;  5DUW A;  5C3Q A;  2AR6 A;  5DZE A;  5IK4 A;  5FV3 A;  5GZF A;  1AR8 1;  3OPT A;  4K1Z A;  4QHO A;  1GMM A;  1HLC A;  1QHD A;  3LEK A;  1BK0 A;  5EJ1 B;  2Y34 A;  3VBF C;  4AEM A;  3QLQ A;  3AYC A;  4XUN A;  1C5H A;  2ZZJ A;  4XF9 A;  3RZJ A;  3WF1 A;  2RS3 2;  1UMH A;  1XSR A;  3TBD A;  1SFY A;  4YFW A;  4BE3 A;  4XJZ A;  1M06 G;  2OQ6 A;  2VTX J;  1C8M 3;  1FI2 A;  5LY2 A;  4AFM A;  4EV0 A;  2A1X A;  5FY1 A;  2NMN A;  2V4A A;  3NNM A;  4AGR A;  2XLF A;  2XUM A;  3VHN A;  3DXT A;  4Q4X 2;  3UK9 A;  3LOI A;  5FY5 A;  5FK7 A;  1SLC A;  4L9B A;  1IS6 A;  4XBQ A;  1HRI 3;  2W91 A;  5C9A A;  4B8E A;  1J3R A;  2D93 A;  4DNY A;  2QVS B;  2YC0 A;  2VBB A;  3D0J A;  1QXR A;  1L3J A;  2CDP A;  1PZ7 A;  2YC2 A;  2ZX3 A;  3NAP A;  5FUP A;  3HOB A;  3J7L A;  5L9R A;  3AK0 A;  4NPR A;  5FZI A;  4K9S A;  1B09 A;  3WG1 A;  3KGL A;  3C7O A;  3ZR5 A;  3KHC A;  4RR3 B;  5DAQ A;  5FLH A;  3RI8 A;  1UAI A;  3OUH A;  4Z92 B;  1ODN A;  5CB7 A;  4XFI A;  3W59 A;  1GSL A;  4N7U A;  3SH3 A;  4MAD A;  1MZ6 A;  1OMI A;  3FE5 A;  1POV 1;  1H2N A;  1XC6 A;  3MIB A;  5FBJ A;  5FZO A;  3R6S A;  4DB5 A;  2VQT A;  2XBO 3;  4YSF A;  1JZ6 A;  4CUA A;  5FOB B;  5K8S A;  1NCR C;  1WW7 A;  1QNW A;  1QNY A;  3AFK A;  5FK8 A;  4CSW A;  3I54 A;  2TUN A;  5AVP A;  1CVN A;  2DTW A;  4YVW A;  1O5L A;  1UX6 A;  1OD5 A;  2JG9 A;  4FPO B;  4IL7 A;  4AOC A;  5D21 A;  2VZU A;  1WME A;  2JDM A;  5FYH A;  4Z2A A;  3J8F 1;  3JUU A;  1C4R A;  3R4U A;  1L7L A;  2YBK A;  2ZPX A;  2HWF 3;  1FT9 A;  3IDA A;  5JR7 B;  4FP3 A;  1JUH A;  3EHK A;  3PUH A;  1LHU A;  4WVM A;  2ES3 A;  1WD4 A;  1RUI 1;  4MGS A;  1O5U A;  1HDK A;  1PK6 C;  2W5F A;  5LAS A;  3HNY M;  3VBR B;  3KCX A;  2VUL A;  2WN3 A;  2EXH A;  4BQ4 A;  3GCW A;  1SAC A;  4AEJ A;  2VMF A;  2WLP A;  5SV5 A;  5FZK A;  2RMU 1;  5IWF A;  4AED B;  3PTY A;  3IMM A;  1US3 A;  5FUN A;  1X33 A;  5IUQ A;  5I0D A;  5A7O A;  5FZ9 A;  3H7Y A;  3ZO0 B;  3KWV A;  3VGI A;  1F4H A;  1LHN A;  2PQS A;  3FLT A;  2A71 A;  2GME A;  3AP6 A;  4MGQ A;  2WQ4 A;  3UKN A;  1WCK A;  2CGN A;  1UL9 A;  3ON7 A;  4HON A;  3BAL A;  1N47 A;  1S1A A;  3A0K A;  2ZTN A;  3AP4 A;  4MUV A;  1H1A A;  1ND3 C;  3UL2 A;  2Q0A A;  4LBO A;  4N43 B;  1MS0 A;  4OZX A;  1RUE 3;  4ZU7 A;  1Z0H A;  3MID A;  1DQ6 A;  4YM3 A;  5CFC C;  4YZ1 A;  4NHX A;  1BBT 3;  4LLF A;  4YNI A;  1TNR A;  4NJ4 A;  3U14 A;  4AG4 A;  5LW9 A;  3OYW B;  4ZY9 A;  4CCM A;  2DCJ A;  2WNV A;  1OUR A;  1ZRI A;  3ZFF B;  1W05 A;  2X09 A;  5FLJ A;  1UYZ A;  1MEC 3;  2XUE A;  3AYA A;  3CQO A;  3M3C A;  1TME 2;  3IPV B;  5FPX A;  1RHI 1;  1XRU A;  5A6Q A;  4JGZ B;  4HN0 A;  1ZRC A;  4QWN A;  3WUC A;  2ZX2 A;  1ZNP A;  2GSY A;  4QDR A;  2VM9 A;  3E97 A;  3ZN5 A;  5EWS A;  3FJS A;  4P5H A;  2ZKL A;  2RMU 2;  1O8S A;  1CAV B;  1DYO A;  3VZJ A;  3D3A A;  2ORZ A;  2OT7 A;  4BHP A;  1NCQ C;  1XND A;  4YYO A;  3RYP A;  1LOC A;  2D98 A;  1JBC A;  1PGS A;  2HBU A;  5JZG A;  5LB6 A;  4XAB A;  3UNP A;  2D44 A;  4LK6 A;  1VBC 3;  3IZO A;  4XBL A;  3O1U A;  4QHZ A;  1UMI A;  5A6X A;  3ZN6 A;  1DQ0 A;  2W1Q A;  4OVE A;  1IS3 A;  3SIT A;  1KD7 A;  2Z5W A;  3PUQ A;  5FPB A;  4UW5 A;  2HWD 3;  1HXS 1;  3ECQ A;  2XQX A;  3KF3 A;  1MPX A;  4FAH A;  5IVY A;  1O3Q A;  4MZU A;  1FNY A;  1NOV A;  2H0B A;  1IKQ A;  4UXA A;  4XF0 A;  3VD7 A;  1YFW A;  5GZG A;  2WAB A;  3SEE A;  4ISQ A;  3KZ4 C;  2IXI A;  4K8R B;  5FIX A;  4LA2 A;  1W3X A;  3ZVX A;  5DN2 A;  4QQ2 A;  2XL9 A;  5JI7 A;  3TEW A;  1N1T A;  5F6K A;  3I2K A;  3FFZ A;  4L99 A;  5FP4 A;  5FRA A;  4CCO A;  1PMJ X;  4Q26 A;  1I1E A;  1AYN 2;  2DYC A;  4RGG A;  3HN3 A;  2DBN A;  5CKQ A;  1JZ3 A;  1NLR A;  1PVC 3;  2W52 A;  3LSE A;  4X8P A;  2DU1 A;  3R4S A;  1OUX A;  4LBK A;  3WG3 A;  2Z2S B;  4LXL A;  1GFF 2;  3AM2 A;  2CDO A;  1QJU 2;  3O1P A;  1F2N A;  1BCX A;  3EMR A;  2VU9 A;  4XIL A;  3NV1 A;  4XPV A;  4FPF A;  5ABJ B;  3USU B;  4QD2 A;  5FZ7 A;  5HXM A;  4KGQ A;  2VNV A;  5AVA A;  4C90 A;  3IM0 A;  1AR9 1;  2FDH A;  3N9N A;  2JDU A;  3TN9 1;  3VL8 A;  5FYV A;  2D7F A;  2LRO A;  3RWK X;  1W03 A;  1CD3 G;  4LKS A;  1UD1 A;  1ZBE 1;  2VVD A;  2YYO A;  4FPH A;  4I0A A;  4YW4 A;  1RUC 3;  2ZGU A;  5CIS A;  4NIA A;  4RS5 A;  4MGT A;  1QOO A;  5C33 A;  4L2N A;  2QQO A;  5CNA A;  2CAU A;  3OD4 A;  2EXK A;  4B7K A;  3WW1 A;  4LUK A;  3O14 A;  3VZO A;  4M01 A;  3VDD A;  1SBF A;  2GAL A;  5IK5 A;  4D7S A;  3AJY A;  1VBD 3;  1XYP A;  2BOJ A;  2OZ6 A;  4AVB A;  3VN4 A;  1ND2 A;  2X5I A;  3WVJ A;  4EE2 A;  1WA6 X;  1PHM A;  2Y6G A;  4HK8 A;  2P34 A;  1H1M A;  3T4V A;  5LEJ A;  1O4T A;  4PDW B;  2QCS B;  3NO8 A;  4K3U A;  4RN5 A;  5FPV A;  1QJX 2;  5E6H A;  3ZSM A;  4QPY A;  3IAP A;  4XZP A;  4KWL A;  1HRV 2;  4IV3 A;  3WW2 A;  3DPR C;  4RHV 3;  1ZBA 2;  3EQE A;  4A42 A;  4DIN B;  2Y60 A;  3M3Q A;  4RSU A;  5FWJ A;  4MV2 A;  3SKJ E;  4DZG A;  5FZ0 A;  2FHR A;  2V09 A;  2XJU A;  4Y5S A;  3AMM A;  2JIG A;  4ITC A;  4PIX A;  1AR9 2;  4Y1X A;  2I2S A;  1O3S A;  1PO2 3;  3VZM A;  2RS5 1;  3HBZ A;  1C1F A;  4GMP 3;  5HV0 A;  4PF1 A;  4AL9 A;  5KXB A;  1AYM 2;  1J3Q A;  2D3R A;  1ZBE 2;  3H8O A;  3U0Z A;  4CCD A;  4FPY A;  2ZGK A;  2J22 A;  1N3Q A;  2PFW A;  3LB9 A;  4L0P A;  5DDJ 3;  3T30 A;  2AH2 A;  5LRS A;  5APA A;  2J42 A;  3RZH A;  3ZFE B;  5HV4 A;  5JOZ A;  1LOA A;  4CCK A;  3LDR A;  1X9T A;  1RUG 3;  1WW5 A;  1HN1 A;  1W6P B;  2D97 A;  1TMF 2;  2FDF A;  2FMD A;  2H6C A;  3IT8 A;  4Y1Y A;  1HV0 A;  3PUI A;  4JQT A;  1BEV 1;  3VL9 A;  4YZ2 A;  4NE9 A;  2GC3 A;  3S7I A;  1NXM A;  2VZP A;  3PL0 A;  5CG8 A;  2FZ2 A;  1BVV A;  2Q1Z B;  2EVX A;  5FPU A;  1WBF A;  5L36 A;  2OZJ A;  2B9V A;  4MGI E;  4LBQ B;  2D5H A;  1QWR A;  2MEV 1;  3PLQ A;  5A3N A;  4ATF A;  1W8O A;  3I7D A;  4UBH A;  1R1Z A;  5EZW A;  3S57 A;  2D3S A;  2R04 2;  3VD5 A;  4CUB A;  1OF3 A;  1VBE 1;  2Q4S A;  3E6C C;  1LU1 A;  1R1A 3;  2RS5 2;  4K40 A;  1WCS A;  3MEP A;  1RIT A;  2VMC A;  2A70 A;  5FZ4 A;  5K0U A;  3AZX A;  5FP7 A;  4P9J A;  3KSC A;  1RUH 1;  1EUT A;  2WNU C;  3EB7 A;  3M7A A;  4DUX A;  5EFU A;  3WNP A;  4B4P A;  2YXS A;  1G86 A;  3K4D A;  4GZ9 A;  4EZ4 A;  4R9B A;  5J1X A;  4YM1 A;  2HWC 2;  3CJI A;  3DF0 A;  1DGR N;  1JU3 A;  3KS7 A;  2WR9 A;  4I3G A;  3MIF A;  4RQP C;  1NY7 2;  2R06 3;  5A80 A;  4UBG A;  5EJZ B;  3J7H A;  1ULF A;  3VBO A;  4CCN A;  4E2G A;  4LOR A;  5LEK A;  2E7A A;  2PHF A;  2BV4 A;  3UES A;  4IEW A;  1W6Q A;  4S2F A;  2RS3 3;  2DVD A;  2L9L A;  3O1V A;  2CWS A;  2OPK A;  2Y6L A;  1RVF 3;  4JCK A;  3VBS A;  2GN7 A;  2RHP A;  3N35 A;  2B39 A;  5B4N A;  2P6H A;  1PMI A;  5D8A A;  4DXS A;  4JHT A;  3OSD A;  3WV6 A;  5CAD A;  4A41 A;  3B93 A;  4IEX A;  4L11 A;  4CEY A;  3BI3 A;  1OOP B;  3R05 A;  2YV8 A;  2ZKN A;  2OA2 A;  2BYV E;  1Z7S 2;  5FO8 B;  3AZY A;  1VBE 2;  2ZX1 A;  1K5J A;  2OUJ A;  4SLI A;  3FUQ A;  4CU9 A;  4ZHN A;  4CDX B;  3P1I A;  2YPD A;  4BIS A;  1AR7 3;  3DN7 A;  1CAW B;  4Q2F A;  1KDM A;  1FV3 A;  2ZGS A;  1OPM A;  5F8P A;  3H0O A;  3K51 A;  1QQP 1;  5DG1 A;  1RUF 2;  3PNA A;  5FZH A;  5FR3 A;  4OUM A;  1LOG A;  2XBO 1;  1V6N A;  1PVX A;  1HW5 A;  1W6N A;  2UYB A;  3E6D A;  5BNO A;  3B3Q E;  4FPK A;  3MDP A;  4LJH A;  1RUD 2;  1WLD A;  5IK7 A;  1LHV A;  2RJ2 A;  1DQ4 A;  2N7G A;  3WHU A;  5FYZ A;  5IK8 A;  1E57 A;  1HQW A;  3ACL A;  2WZP P;  3KLS A;  3MLJ A;  5FQ0 B;  3CL1 A;  3BPZ A;  2QQJ A;  4DPN A;  1W6M A;  4FTS A;  2RE9 A;  4ERO A;  5KXD A;  3K48 A;  3LFI A;  5A3M A;  1VBA 2;  3M3O A;  1EAH 2;  1RJ8 A;  3EBR A;  5F39 A;  4GJZ A;  5IAV A;  1LEM A;  4A7K A;  3N7K A;  2PHR A;  4QDQ A;  3G6J B;  2XKP A;  3OPW A;  5FDB A;  2BNO A;  4LBL A;  1JOB A;  4ZS2 A;  4Y4R A;  1FMD 2;  1D4V B;  2BPA 2;  1NA1 A;  5A7N A;  1RB8 G;  3W21 A;  4YGD A;  1A3K A;  2C1F A;  2QE3 A;  4BK5 A;  2VCC A;  1QQP 2;  3BGA A;  4XJ8 A;  5C4W A;  4AE2 A;  3HNB M;  1F9K A;  3LDB A;  4XQ4 A;  2VQA A;  3V56 A;  3ZYR A;  3PVB B;  2ZHL A;  1CON A;  4CDQ B;  1J1T A;  2XG3 A;  4N43 C;  4XAC A;  1POV 3;  4UFL A;  2IFW A;  2JDZ A;  5FYC A;  4QXH A;  4DEQ A;  5A1A A;  3GCX A;  3H50 A;  3H42 B;  5E8A A;  5HXV A;  1LED A;  1CZS A;  2NLR A;  1J83 A;  4JDN A;  3ZYF A;  4AVS A;  1RUE 1;  2UUR A;  4GH4 A;  3LOB A;  1VPH A;  4JKL A;  5LBE A;  3H3L A;  3AX4 A;  1PX3 A;  2QZ2 A;  2XJQ A;  3C7G A;  4MSV A;  4XHX A;  1K5M B;  2PHU A;  5C3S A;  2VUD A;  4JGZ C;  4M4R A;  3D8C A;  5T5L A;  1LCL A;  5H9R A;  1REE A;  2JG8 C;  1W28 A;  4B4R A;  4YW5 A;  4CU7 A;  2WQ8 A;  5AC9 2;  1DQ5 A;  4AEK A;  1UZ0 A;  2ARA A;  2WAA A;  3N7L A;  4TLF A;  1JZ5 A;  1Y9Q A;  2E26 A;  4DRR A;  4BME A;  2FDI A;  1LB2 A;  3AKS A;  1PM7 A;  2YU1 A;  3JBG 2;  3HMY A;  2QBX A;  2ZA9 A;  3DKQ A;  1DP0 A;  2YHJ A;  3Q8F A;  1PO1 2;  5JPM B;  2O8Q A;  1OXC A;  1G9B A;  3ST7 A;  1N3P A;  2WLQ A;  2RMU 3;  5FBZ A;  4AR2 A;  4M4P A;  4IGO A;  3AL6 A;  3I3Q A;  1XQN A;  2JKB A;  3J7N A;  2LS6 A;  3WCS A;  3O1R A;  2XJS A;  3BTY A;  1VBC 1;  3FC0 A;  3U11 A;  4A7Y A;  1VAV A;  2VR4 A;  5C5T A;  4IE4 A;  1G9C A;  1PGL 2;  4V2W A;  2P3J A;  4CP9 B;  1R08 2;  1UYP A;  1RGS A;  5F5C A;  1VAM A;  3WDV A;  2E63 A;  5J7M A;  1FOD 2;  1UX7 A;  4Y4Y A;  1XXN A;  4LBN A;  2HWD 1;  4QKN A;  4MG2 A;  2C9K A;  2AC1 A;  4AK3 A;  2ZGL A;  5J09 A;  5KHK A;  3AC0 A;  1LGN A;  2ARE A;  5IW0 A;  4E27 A;  1CGP A;  1O6U A;  2VNG A;  3PJQ A;  4CE8 A;  4QGL A;  4BQ1 A;  2WAO A;  1VMF A;  4FOY A;  1H2K A;  3H3Z A;  1LOE A;  2E33 A;  3NAP B;  4ZPI A;  1DGR A;  1ZZB A;  1I9R A;  1IG0 A;  1GOF A;  2WSV A;  4H55 A;  1ZRF A;  4Q4Y 2;  3QCW A;  4ZXE A;  4OHZ A;  5A3U A;  1H2M A;  3JZV A;  1MVE A;  2VZT A;  3JU9 A;  3ILR A;  5ABJ C;  5F3C A;  2EF6 A;  1ULO A;  1V0A A;  2JDA A;  4HBN A;  5EYX A;  2IFR A;  4U36 A;  2WA3 A;  4Q0S A;  5FZO B;  3TRS B;  4C1W A;  4B1L A;  4Z07 A;  1H1I A;  1S0J A;  4JZR A;  3AYD A;  2IXK A;  2HJI A;  3M4F A;  4NOT A;  2ZHK A;  3T2P A;  4GQ7 A;  3PVN A;  4W4Z A;  5JMC A;  5G05 L;  4LUL A;  1ONA A;  3ZN4 A;  1UYY A;  4EQV A;  5SV8 A;  3KF5 A;  2RS1 1;  4QPI B;  5D2A A;  5HI0 A;  2JG9 B;  1YIF A;  5A70 A;  1W8N A;  2DVG A;  4PI0 A;  1WD3 A;  3CU7 A;  1YWK A;  5JXI A;  1RUC 1;  2KXL A;  1W0O A;  2QTW B;  4K20 A;  1AR6 1;  5B2G B;  2HEW F;  1W9T A;  2J1U A;  3GZE A;  4YFZ A;  2A3X A;  5C70 A;  3CZU A;  4BIF A;  1X8M A;  1NLS A;  1F15 A;  2PLV 1;  2XJT A;  3CLP A;  4B1M A;  4DIQ A;  1YYN A;  2TEP A;  3K4Z A;  4M3C A;  3M1H A;  2ETE A;  4HSL A;  2Q8D A;  2YB7 A;  1XNB A;  3SCG A;  1AX2 A;  1JH5 A;  4LHK A;  2YGM A;  4IE6 A;  4AFA A;  4OUE A;  1PIV 2;  2GZW A;  1RED A;  2OW4 A;  2WO2 A;  3PUS A;  4HMZ A;  2R7E B;  4LPL A;  5A7W A;  3MYX A;  4QPG A;  4EWA A;  2PAM A;  3PJY A;  2H0V A;  4IEO A;  3RJ2 X;  3ZYH A;  2PXJ A;  2R30 A;  3AKR A;  3CF6 E;  1GIC A;  3A7Q A;  2JDN A;  1HRV 3;  3RSJ A;  3SEP A;  4JHZ A;  3P6B A;  3VBH B;  4W65 A;  1ZBA 3;  3SQO A;  1X9P A;  4GKX A;  5L9B A;  3CMG A;  2Y33 A;  2RS1 2;  5A6Y A;  3A23 A;  3SH5 A;  4BQY A;  2BTV C;  2C5D A;  3O0W A;  4HLT A;  4OUL A;  4XAA A;  2BW8 A;  4HKL A;  3ZFE C;  1AR9 3;  2AGS A;  3WG4 A;  3AP7 A;  3KT1 A;  2VCA A;  5K4L A;  1GZW A;  5GM0 A;  1LGB A;  2WNV B;  2ZGN A;  3ES4 A;  1SLT A;  5DDJ 1;  1ZBE 3;  3K75 B;  2VTX A;  1ALY A;  1H9P A;  4HT1 T;  3V0B A;  1NAE A;  4D7T A;  1E5I A;  1MZ5 A;  1ZZC A;  2RJL A;  3WX5 A;  2PLV 2;  1CAU B;  2BOI A;  4WZF A;  2BBV A;  1YI7 A;  2OUH A;  5C3O A;  4I0B A;  4W8J A;  5FMO L;  3T4H B;  3MV1 1;  1TQ5 A;  3DYO A;  1XOY A;  4NAM A;  1H9W A;  1QOS A;  5FFO C;  3ZXL A;  1GP5 A;  2WZR 2;  2D3P A;  4K6B A;  5JAX A;  3BU7 A;  1PNF A;  1XNA A;  2WO3 A;  1OQE A;  2ARX A;  1LOD A;  1XE7 A;  2YFU A;  2NM1 A;  5JZG B;  1UU4 A;  4JRL A;  2ERF A;  2IXL A;  2CGP A;  2QQN A;  2C24 A;  4XFC A;  1RC6 A;  1OLQ A;  3POS A;  2ZBJ A;  4R9D A;  4D3W A;  4HG6 B;  1QU0 A;  3J7M A;  3VBU A;  3GJA A;  1LOF C;  3ACG A;  4QMA A;  3LEG A;  3RZL A;  3N3H A;  1FPN 1;  1LHO A;  4XE9 A;  4ZKT B;  4D6S A;  5A7S A;  1X8E A;  3GNE A;  1EPZ A;  3TYJ A;  3A0N A;  2R49 A;  2RS5 3;  2ARC A;  1V6L A;  1YJL A;  1LTE A;  3E5U A;  5FZ6 A;  3O12 A;  3DKW A;  3WF3 A;  4LBM A;  2VEC A;  4GB3 2;  2YBS A;  3EJK A;  1GWM A;  1ZRR A;  3BVC A;  3VBF A;  3OGR A;  1JZ7 A;  4AI8 A;  2W92 A;  2VD7 A;  4WVV A;  4UW6 A;  3ZSJ A;  4TYS A;  2ZAH A;  3VHR A;  4E2Q A;  1HQL A;  4E8D A;  5H9S A;  2BEO A;  2CTV A;  1BZW A;  2AZ5 A;  1QJE A;  3ZXF A;  4FQ4 A;  1H4H A;  2DVB A;  1BEV 3;  1OOP C;  2X10 A;  1G9F A;  1TEI A;  1S55 A;  4UF0 A;  3FN9 A;  4P9W A;  1LKN A;  5A33 A;  4NN0 A;  1RIN A;  3CKH A;  1Q8O A;  2WL1 A;  1H8T A;  4Q4X 1;  2J1V A;  3ZYI B;  4CDX C;  4PF5 A;  2MEV 3;  1DLL A;  4QXC A;  1OA3 A;  3BN6 A;  4ES8 A;  5E88 A;  5T3N A;  3O1S A;  4Y5T A;  5LA0 A;  3HQR A;  3RJR A;  4K1Y A;  3APB A;  1VBE 3;  3GBW A;  4Q4W 2;  1VLN A;  2BER A;  4XBN A;  4P08 A;  5GZE A;  3WQ0 A;  4XF3 A;  1G8W A;  1EV1 2;  4PLN A;  4RS5 B;  2VPV A;  1GV9 A;  5L7O C;  2WS9 2;  1NE4 A;  3HIF A;  2BFU L;  4LKE A;  1DQ1 A;  1MS9 A;  3BOD A;  4ZS3 A;  1JZ2 A;  4QKF A;  3VDD B;  5FZG A;  3OBZ A;  1VBB 2;  1LES A;  2LM3 A;  4M0N A;  5EYY A;  4XTM A;  5FZE A;  4B7E A;  2W0X A;  1K12 A;  5T50 A;  3U37 A;  1ND2 B;  1NCR A;  2X5I B;  3NV4 A;  2XPJ A;  2ZHN A;  3RRD A;  4FFG A;  1GZC A;  4G4F A;  2RVA A;  5BXX A;  4ZZ8 A;  2DUP A;  4KL1 A;  1ST8 A;  1X50 A;  1RUD 3;  4J1W A;  1IOA A;  2WWS A;  1IZ3 A;  1ZZ9 A;  4GKY A;  4AWD A;  4C8D A;  4RD7 A;  4IV3 B;  1UPI A;  4LEJ A;  5FAX A;  1GKB A;  3AKP A;  1NG0 A;  4P9Y A;  5AFE A;  3GF6 A;  5GLT A;  3POE A;  1VMH A;  1W39 A;  4XQW A;  4AI1 A;  2Q5T A;  3T0D A;  3CHX A;  2GH8 A;  4HK9 A;  4LKD A;  1PK6 A;  3POI A;  1DGW A;  4Z8B A;  4W50 A;  3WP6 A;  3ZFG B;  2CU5 A;  1XNK A;  3KGZ A;  2A6V A;  2QNK A;  1UY4 A;  4MXW A;  1STM A;  3CO2 A;  1MS5 A;  2JEC A;  2WO7 A;  4HXC A;  4Q29 A;  3SMH A;  1CQ9 A;  4ORF A;  4CDQ C;  2C9A A;  1REF A;  3LPG A;  1JYT A;  4LO8 A;  1FMD 3;  4XJU A;  2VNO A;  1OLM A;  2WSU A;  5FPA A;  5GAL A;  5HCF A;  3UGG A;  3WSO A;  4C0H A;  4YAR A;  2W1W A;  2Y6H A;  2P3I A;  5EV7 A;  1CZV A;  4CDU C;  2HBT A;  2F17 A;  3IDB B;  1QQP 3;  2OVU A;  4Q5O A;  1XSQ A;  3T2Q A;  4D6Q A;  5A1F A;  2Y26 A;  4Y5Z 0;  4AQT A;  4QT6 A;  3KMH A;  2JD9 A;  4OI0 A;  1K5M C;  4F8A A;  1B35 C;  3KT7 A;  1ND3 A;  3AFG A;  4FXK B;  2E32 A;  2QDR A;  1T6B X;  1QF3 A;  4JTN A;  2EIB A;  5CFC A;  4HN1 A;  4CU6 A;  5BY5 A;  2ORX A;  2VZS A;  4YPJ A;  3KT4 A;  3P3N A;  4A7Z A;  3ASI A;  5HBA A;  5KHI A;  4C1X A;  3OEB A;  1A6C A;  2P1B A;  1KDK A;  4XAE A;  1IPK A;  1Y4W A;  1YCI A;  1TME 1;  4COZ A;  3M3E A;  1ZRE A;  4AHY A;  2QQK A;  2QFE A;  5K0U B;  2XVG A;  1IGO A;  3C7H A;  3MGU A;  4XFG A;  3TOJ A;  1GNY A;  1S0B A;  5FZC A;  3NJZ A;  1MS4 A;  5I8S A;  2DCY A;  2R16 A;  2XDV A;  3MLK A;  4IET A;  3JBG 3;  1NCQ A;  5FMB A;  4A4A A;  4HVQ A;  1O8P A;  1A78 A;  4UFI A;  4LTA A;  3VB9 A;  1PO1 3;  1QOT A;  3THP A;  3ZIX A;  3H9A A;  1GQP A;  5F5Q A;  3LEI A;  2BVV A;  4O9G A;  4AYU A;  1DDL A;  1CX1 A;  5EHD A;  3S5A A;  1I5Z A;  1SHW B;  3N4M A;  2VUC A;  1DGW X;  3VKO A;  1W6Q B;  4NHM A;  5CIR A;  3LKJ A;  4Q0Q A;  4YWA A;  2OKX A;  3IN9 A;  4UOJ A;  1RL3 A;  4AI2 A;  4MLO A;  4NMI A;  4HPK B;  3VBS B;  4TTG A;  1H30 A;  1OD3 A;  1FOD 3;  5D8A B;  2VZ3 A;  4A6S A;  3IAQ A;  3HN1 A;  3E1F 1;  3NAP C;  4LHN A;  4CEY B;  4NR1 A;  2C26 A;  1LRH A;  1J1L A;  2WT1 A;  1VRH 2;  1QXP A;  3SNM A;  4CEW B;  1D4M 2;  4E2S A;  1Q8Q A;  1J84 A;  1D7P M;  1O4Z A;  4XXP A;  3CBN A;  1BJQ A;  1GNH A;  2CYF A;  3WW4 A;  2YY1 A;  5HCA A;  2ZAA A;  4IV1 A;  1MS8 A;  1XNT A;  4ZON A;  3PU8 A;  2W2I A;  1V6K A;  1FXZ A;  1NQD A;  5A3O A;  4Q4Y 3;  1RJ7 A;  4XUR A;  1F8V A;  2ZAB A;  2BBA A;  1U5Z A;  1AYN 1;  1WWY A;  2D5F A;  3CZJ A;  3I59 A;  5BNN A;  5H9P A;  3OPZ A;  2OII A;  3G7D A;  4DUV A;  3ALQ A;  4QPI C;  2J1T A;  2JG9 C;  4COU A;  4EN7 B;  1HB1 A;  1IG3 A;  3OGV A;  1QJU 1;  1OVP A;  1UIJ A;  4P9L A;  1W2N A;  3J9S A;  4CVU A;  1J59 A;  1JS9 A;  4L8Q A;  4BQX A;  1Y9G A;  4JDO A;  2IXJ A;  1SCS A;  1BQP A;  2J7M A;  3RS6 A;  1YQ6 A;  2RDS A;  3TEX A;  5FZ8 A;  3HBK A;  1GNZ A;  3K2O A;  1NE6 A;  3RG0 A;  5KXC A;  4Y22 A;  3LA7 A;  1IQA A;  4Q0V A;  1S4C A;  2PQQ A;  2GMP A;  4OYU A;  1Y3T A;  3BTX A;  3UYJ A;  4B29 A;  4AXO A;  5CBL A;  1FV2 A;  5BNP A;  2GND A;  1UQX A;  5JIU A;  4CTE A;  5AFB A;  4LA3 A;  1VRB A;  3WR0 A;  2VL4 A;  4S2H A;  3O1T A;  3F2Z A;  3RWN A;  3VBH C;  3WEZ A;  2TNF A;  5FO7 B;  5C4W B;  2EXJ A;  4AW7 A;  2VBP A;  1QJX 1;  1O91 A;  4M3C E;  4JGY A;  3PUR A;  1S2E A;  4P02 B;  2A6Z A;  1R09 2;  1HRV 1;  2EIG A;  2DU0 A;  2K0G A;  1ZBA 1;  3Q8B A;  4YVS A;  2Q1M A;  2WNV C;  4FPE A;  2FDJ A;  1BXH A;  4Q4V 2;  2XON A;  5L19 A;  2VOK A;  3RDI A;  2RS1 3;  1PM4 A;  4XIK A;  1QDC A;  4GWI A;  4N9H A;  4H7L A;  1WBL A;  4BOW A;  1W2T A;  1AL0 G;  4DXR A;  3BKZ A;  1AYM 1;  3DV8 A;  4LQR A;  2O8O A;  2BGP A;  4S2G A;  1T2X A;  3J4U H;  2B46 X;  4QX1 A;  4XZU G;  4WV8 A;  4YW1 A;  1GLH A;  4QQO A;  1ASJ 2;  1AR6 3;  1OA4 A;  4WVW A;  3AMH A;  2QQW A;  5LRR A;  2P4E A;  3M2M A;  3ME2 A;  5T5J A;  5IJR A;  2C4X A;  3ZMO A;  4OHY A;  2WYS A;  5JZG C;  2PLV 3;  1TMF 1;  3NJY A;  4ASK A;  5DAW A;  1UY2 A;  1YXW A;  1TNF A;  4CCL A;  5FUI A;  3KV5 A;  4M00 A;  5LY1 A;  5FLI A;  4E8C A;  1DZR A;  2GP5 A;  3SKV A;  3HJR A;  3MPP G;  2WZR 3;  4DFS A;  2V5Y A;  4MX3 A;  4EN6 B;  5JLV A;  1EY2 A;  1Q8S A;  5CFD C;  2XJP A;  1TVG A;  3OUI A;  1Q5O A;  1ZZ8 A;  1MZF A;  1W8H A;  1BHG A;  1NYW A;  2PYT A;  4BCU A;  4UWD A;  3ZPY A;  2YFZ A;  4AFD A;  1IHM A;  2A6W A;  4YW7 A;  5IAT A;  1TZO A;  2R04 1;  2P37 A;  3VD9 A;  4JRA A;  4OHW A;  5IAX A;  2EA7 A;  2ZGR A;  4MVT A;  1US2 A;  4WM7 A;  2W87 A;  1QJZ A;  1UNB A;  4WZC A;  2XWJ B;  5JCT A;  4GUL A;  1MS1 A;  4BLI A;  2WNU A;  4A2U A;  4F7Z A;  3OF1 A;  3OTF A;  3IB3 A;  3W20 A;  2D6M A;  1WMX A;  3JB4 C;  4RQP A;  4Z1V A;  3RZG A;  2PTM A;  2HWC 1;  3BCW A;  2YZ4 A;  3HQU A;  4XW3 A;  5FZL A;  2Q8C A;  1RUN A;  4I3P A;  1NY7 1;  3HD8 B;  3UGH A;  1ZVF A;  4N90 A;  5FYY A;  1OFN A;  1MS3 A;  2IZW A;  2VAU A;  4Q0P A;  3ZM8 A;  4DUW A;  5A32 A;  3OGG A;  1DYK A;  3IWZ A;  4IER A;  5DAX A;  5F5A A;  1C5I A;  4GA9 A;  3RZM A;  1U5I A; 
#chains in the Genus database with same CATH homology
 2C24 A;  1W8Z A;  4LKD A;  4AL9 A;  4BQ2 A;  4LKE A;  2O14 A;  3ZYB A;  1WCU A;  5D21 A;  4YW6 A;  1W90 A;  1W8W A;  4LK7 A;  4CPB A;  3ZYF A;  4BQ3 A;  1W8U A;  1L7L A;  1GWK A;  3ORJ A;  2KR2 A;  4YWA A;  1WMX A;  3ZYH A;  1OH3 A;  4CPB D;  2JWP A;  1W9F A;  1UOJ A;  1GWL A;  3F95 A;  4CP9 A;  2LRP A;  2LRO A;  2Q1F A;  4LKF A;  1W8T A;  1GWM A;  2K46 A;  4LJH A;  1V0A A;  1WZX A;  4A6S A;  4BQ5 A;  4CP9 B;  2WYF A;  4LK6 A;  3UT0 A;  4BQ4 A;  2VXJ A;  1OKO A;  1HN0 A;  4YW7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...