1W8TA

Cbm29-2 mutant k74a complexed with cellulohexaose: probing the mechanism of ligand recognition by family 29 carbohydrate binding modules
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
142
structure length
142
Chain Sequence
NVRATYTVIFKNASGLPNGYDNWGWGCTLSYYGGAMIINPQEGKYGAVSLKRNSGSFRGGSLRFDMKNEGKVAILVENSEADEKFEVETISPSDEYVTYILDVDFDLPFDRIDFQDAPGNGDRIWIKNLVHSTGSADDFVDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Carbohydrate-binding domain
molecule keywords NON CATALYTIC PROTEIN 1
publication title Probing the Mechanism of Ligand Recognition in Family 29 Carbohydrate-Binding Modules
pubmed doi rcsb
source organism Piromyces equi
total genus 28
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2004-09-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 1w8tA00
1GWKA 2Q1FA 1UOJA 4LK6A 4YW7A 4YW6A 1WZXA 1V0AA 4CPBD 4BQ2A 1OKOA 1W8UA 1W8TA 4BQ4A 4A6SA 1W9FA 3ORJA 5D21A 2KR2A 1W8ZA 1WCUA 4CP9A 1HN0A 3ZYBA 1W8WA 4AL9A 3UT0A 4LJHA 2C24A 2LRPA 4YWAA 1OH3A 4BQ3A 1W90A 2JWPA 2WYFA 4CP9B 2K46A 3F95A 4LK7A 1L7LA 2O14A 2VXJA 1WMXA 3ZYFA 3ZYHA 4LKDA 1GWMA 2LROA 4CPBA 4LKFA 4BQ5A 4LKEA 1GWLA
chains in the Genus database with same CATH superfamily
2WQ4A 4QU2A 5FYZA 4MGIE 5FYTA 2EICA 3A0KA 4H3WA 1JZ3A 2WNOA 2VY0A 1QNWA 5E6HA 5J7MA 3RNSA 1O3RA 4QX2A 1RUI2 1TME1 4XIKA 1MEC2 3E5QA 2ZGSA 4KH9A 4CCDA 2XVGA 1UY2A 3M7AA 4YLZA 3H9AA 4S2GA 4CUGA 2FD8A 3T4VA 1A8DA 2NZ9A 1PX4A 3VBSA 3OOXA 3GBFA 4YG6A 3S30A 3OD4A 1IPSA 1F31A 2ARCA 4X6QB 3M3EA 1W6OA 2XKOA 4IERA 4NMIA 2G1MA 4AFCA 3S57A 1SZBA 4GJYA 4JKMA 1MVQA 4PLOA 1OLME 1CGPA 4MV2A 1ULDA 3EXUA 3I3EA 4DY3A 3AMMA 5FZOB 3UESA 4AVCA 1F15A 2XDVA 3SHRA 4B4QA 1I1EA 4JKLA 2VMFA 4WM7C 5CAZA 1HQNA 4P9YA 4UW4A 2JB8A 3MUZ1 1GLHA 1O4YA 3NQHA 4A45A 3CF6E 4DEVA 3ILRA 1AF9A 4HT1T 2B39A 3ITQA 1JUHA 2VMCA 2BQPA 1UWWA 4QKDA 4CUBA 5CZKA 2JE7A 1EUTA 3N7JA 1ND2B 4IV3A 2DU0A 4GAZA 3FHAA 1K5JA 2ZCWA 4NIGA 2KXLA 5FO7B 3OEBA 1IKQA 2DV9A 1I5PA 1RUJ3 2VQAA 2TNFA 1YEWA 1MPXA 2CSGA 3AL5A 1UOJA 2WFF1 4CEYB 3VDDA 3N35A 2WSUA 3K2OA 4N43A 1LOCA 1E5IA 1NA1C 5DAVA 1RUNA 4KGQA 2ZHLA 3I3QA 1WCUA 1AVBA 1XNDA 3I54A 4FP3A 3CJIC 4LJHA 5C8CC 4FTSA 2VVDA 3ZOIA 3DEMA 4WVZA 2VOKA 4XJZA 3P3PA 1YFWA 2OX0A 4GWNA 1H1AA 3NNFA 3ASIA 4IL7A 3T08A 2HJIA 2QQJA 1WA6X 2Y34A 3B7MA 2RS52 4Y1YA 4AOCA 3IDEA 2HBUA 5FZFA 2Z5WA 4JGZC 5JCTA 1OA2A 1RUH1 4LORA 5J98B 1GQGA 3NAPA 5FMOS 5F32A 1PGSA 3ZM8A 1CVNA 4OHYA 1VR3A 3GZUC 2ZS6B 2WA3A 1TVGA 4LULA 1BXHA 5BPXA 1XC6A 1AR81 2H0VA 1OH3A 1WBFA 3B94A 4YW4A 1ZBE2 1BJQA 3NVCA 3Q8AA 3ZR5A 5FY8A 3BIEA 3OTFA 1ZRRA 2XHKA 1OD5A 2E6VA 3AKQA 5ANQA 3ZSLA 1CAUB 1W6NA 4XXPA 4RQPB 1LOFA 5A3PA 3EHKA 3AMHA 1SACA 1PO23 5IK8A 1FNYA 5C4WB 2Y38A 4OHXA 3IBMA 1PGL2 3MFCA 4YFWA 4PF1A 1J84A 1YFUA 2BBVA 2XLAA 1GNZA 2AR6A 2C0ZA 5FYIA 3WG2A 2C6SA 2D6KA 2VGDA 1BMV2 3RJ2X 1GUIA 4P5YA 4AYUA 2PQSA 1J3PA 1N3OA 4RYDA 5GZFA 1H9WA 4UYBA 4BYYA 3LAGA 4AG4A 3WR0A 1QWRA 2W39A 1XJAA 2CTVA 4JTNA 5LY2A 4C1WA 4CDQB 5C70A 5CIRA 2NPIA 2D6PA 4JC1A 1XYPA 2HWC1 4PI0A 3VD3A 4AEKA 4A7YA 3ETPA 4BDVB 1JYVA 5LA0A 3W5MA 1O5UA 4TSVA 3T0AA 4G4FA 2FDHA 4XPVA 1JTZX 1US2A 3WNOA 5A1FA 3AZZA 3FUOA 3H7JA 3J7NA 4CU8A 4DQAA 3NW4A 3GZTB 1YQ2A 5GZDA 1ULPA 5KXCA 2P3JA 4QM9A 1CONA 1QJZA 4YYOA 3O1TA 2FZ2A 4MGKE 4JGYC 2B9UA 3D3AA 2VAUA 2NQYA 3OG2A 4OCTA 3AMPA 3P1IA 1PO11 1L3JA 3NNLA 3VD4A 3JD73 4WVMB 1GZTA 3HR9A 1OH4A 4K20A 3VZNA 4M3CA 1UIJA 2HWD3 3M3OA 4AFAA 1W2NA 5FK8A 2OZ6A 2XR4A 2Z2SB 5FZOA 3MLLA 5JWPA 3S0MA 1JYTA 1E5HA 2B7YA 3GZAA 2PAEA 4AZZA 4IEQA 1QXRA 2UYBA 3KD4A 5CKMA 5HCAA 1AL21 3LA2A 5FO8B 4AVBA 1NLQA 3NNGA 1MR5A 1PHMA 4K7JA 2B45X 3OGSA 3VUOA 5LEJA 1OVPA 4D6SA 5FLJA 4PCRA 5C8WA 4JVAA 1ND2A 4TZDA 4AEMA 1VBE3 3UK9A 3AL6A 2BZDA 1V9U1 2WZPP 1FV3A 4P9XA 5CU1A 4ARYA 2QQUA 1UX6A 2MEV1 5IVCA 4CP2A 1QU0A 4F3JA 1FAYA 2JDZA 4CEWB 2VW1A 5K8SA 5I0TA 1EYBA 4CEYA 1S0JA 4QMAA 1QJFA 2AACA 1GBGA 3SH4A 3HQRA 2UY9A 4M4PA 2W68A 2A6VA 5B4NA 2RJ2A 1O5LA 1MACA 2R063 1IG0A 2X10A 2ZKNA 3MBWA 1AZDA 4FAHA 3AFKA 1N1YA 4QHBA 2PHFA 1KRIA 1V6OA 1PX3A 3MZHA 5D2AA 1S0FA 2JEMA 3MW3A 5FP8A 5FFOC 4K9SA 2ZMLA 5APAA 1LOEA 2DVFA 1RGSA 4IEOA 4L8QA 4PLMA 5I0SA 3OPTA 4PQ9A 2PAMA 1UU5A 3E6DA 1HQLA 3ETQA 3PMSA 3ST7A 3SMHA 3AC0A 4H7MA 4K1ZA 1CAXB 1EAH3 1W6MB 3LCPA 4QB1A 5FYVA 2VZRA 1N3QA 1OF4A 1NCQC 2GNDA 4LBNA 3FFZA 2VOTA 4BK5A 5JXHA 3HBKA 1CX1A 1GFF2 2PHXA 5A7NA 3KT4A 1T2XA 4A44A 3WQ1A 1GP6A 1RUD3 1LHOA 2R6QA 2VXRA 3LE0A 1BZWA 2WLQA 4A7ZA 2LM3A 1WW7A 3J8F1 2VMDA 4AL9A 1LJ7A 1RUD1 3THDA 1CAUA 4IESA 1W9TA 1XXNA 3VV1A 1AR73 3PJYA 4D0QA 2HYKA 4LBMA 3DECA 3K51A 4NN0A 4BPZA 1DYPA 1NY71 1DIWA 5C4WA 1DP0A 3PLQA 1QJX2 4Y1XA 3A4UA 4LO6B 1C1LA 2ZPXA 2GMMA 4XFBA 3UGHA 2VE1A 3FBMA 4LHKA 4Q4W3 4UBGA 4AAXA 5K7PA 3PHMA 1ZREA 1AYN2 1UCXA 2DBNA 4WVWA 5BNQA 2JG8B 4NHKA 2Y64A 4YVWA 1SFYA 3D8CA 5L7OA 2VNOA 4CDXB 4XC9A 1G9BA 4FPFA 3FFQA 5G04L 4JQTA 2KR2A 1D4M1 4WV8A 5GZCA 5C3PA 2A70A 4XF9A 4CDQA 1VBC1 4GMP1 1W90A 1FOD2 5CEHA 1YQ5A 4K1YA 3ZVXA 4BU2A 1KS4A 1W06A 4COZA 3KQRA 3ELNA 3OEAA 1A78A 5FJKA 4Q0UA 5A7QA 5JAXA 2RR11 4Z1VA 1SBDA 1V6NA 1ZBA3 3H0OA 5A6XA 2BVVA 2A6YA 4DIQA 5FV3A 3WDYA 1OBNA 3ZYJB 4RS5C 1HV1A 4IE5A 4CU6A 3RFRA 1J59A 1W8UA 1ZRDA 2NMNA 2WO3A 4V2VA 1WD3A 2IXHA 2CGPA 1DQ2A 4HKOA 5CYYA 1VLNA 2YBSA 5GZGA 1LENA 4WVMA 4RN5A 1JU3A 4XDOA 4LTAA 1F4HA 2VQTA 3ILFA 1DZQA 5FYCA 4AEDC 3ZYPA 1POV0 2WIIB 1JXNA 4QX8A 1JOJA 3AP5A 5A3NA 1RVF1 4I3GA 2PELA 4I2OA 5GLVA 4GWMA 2YHJA 5AC93 1OVSA 4HVQA 4UF0B 1UZ0A 3KF5A 1RUJ2 4E4HA 4BQ2A 1AR91 4XF0A 3LPFA 2OQ7A 4B29A 3JQXA 4CP9A 1ZA4A 1PK6C 4PIZA 4OMCA 4XF1A 1LGNA 2IVJA 2LRPA 2YPJA 1W28A 3U0ZA 1LU2A 2E31A 3FL7A 3MPPG 4U2AA 4CEWA 1AYM2 1QOSA 3AZWA 1GZCA 2DUPA 3RRDA 3B3QE 3WT3A 4I02A 4AVVA 2XJTA 1Z7S3 2O14A 4AQSA 4QWNA 5J96B 1B35B 2PHDA 5FJHA 3JCIA 1W0NA 3M3IA 5GLUA 4W6WA 3KV4A 1WMFA 1YCIA 2VPVA 4IGPA 4QDSA 5DAWA 1C8M3 4B1LA 4RA0A 1NCRB 3IMNA 1RYYA 2JB4A 4YGBA 4O9EA 3S7EA 1XE0A 3SKJE 4HXCA 2IXLA 1UMIA 4UT5A 5CKQA 1W9YA 1VBD3 2VL4A 4M3CE 1IQAA 1HB2A 2V4AA 2VVFA 5KC6A 4NAOA 4AQTA 3WUDA 2P34A 3K48A 1MS8A 3NKGA 3AYDA 1K45A 4YARA 5FPUA 4IUGA 1CAXA 2G9FA 1W2AX 1SLCA 3HWJA 3ON7A 5CNAA 3USUB 5IVBA 3LEMA 2ES3A 3LDRA 4AFDA 4W4ZA 3ZYHA 5T5PA 1O6UA 1REEA 2ADDA 3BCWA 4HETA 4P14A 1UYXA 5FZBA 3TNQA 4UAPA 5JSPA 2AEZA 2Q1ZB 2ZEZA 5H9PA 4AQ6A 4B7EA 2D3PA 1FMD2 1ULOA 3QOPA 3HEIA 3WQ0A 4IEXA 1PO22 1G9CA 2EIBA 1F9KA 5B4XA 1YLLA 2QUOA 1H6YA 4QQPA 2RM21 3WQ7A 2E7AA 2VZTA 4K8FA 3KB5A 4LBKA 4OUMA 4LNVA 5HPOA 3FX3A 1YQ6A 4A42A 1F4AA 1PM4A 2IXCA 2MPFA 4XJWA 3JQWA 4R4ZA 5JOWA 1ONAA 3CIHA 4FTBA 2WYFA 3BVCA 3FLPA 3KGLA 4E4DX 1W0PA 2KD7A 3N9MA 2D93A 5KWRA 4XCBA 2PHLA 5ANNA 4FCAA 2WINB 5AVAA 5L9BA 5ACA1 1U5XA 2R30A 1NYWA 4GJZA 4BXFA 2F17A 2ET7A 2R041 4MH0E 2JG8A 5J48A 3BOWA 2ARAA 2OXBA 1Y9MA 2GNBA 3AYAA 3LFIA 2CV6A 1ALYA 3SCFA 1HDKA 4FSJA 4ZU5A 2H0BA 4CDXA 4YZ1A 4LUKA 1VBB3 3Q9OA 4W6YA 5FZMA 5T50A 4Q4Y3 4A7KA 2QQNA 3A22A 1UF2C 2UURA 1SDDB 3KCXA 2VM9A 4YVWC 2BV4A 4HKWA 3RMYA 5L7OC 4QB2A 4AXOA 1H30A 5FPBA 3HNMA 4HN0A 2W91A 4ZS3A 5JZGC 3S5QA 2J7MA 3GNEA 1I3HA 3CLPA 3CMGA 4HL0A 4D6QA 5BNOB 2GNTA 4EN7B 2BBAA 1IOAA 4JRLA 4NE9A 3K4AA 2YU2A 1OD3A 1CN1A 1YQ8A 2XJQA 3WVJA 1VBA1 5LRSA 2QBXA 4QXBA 2XLFA 5IW0A 3VZKA 1S2KA 4YSFA 1RTVA 3JD72 2ZHKA 4SLIA 1I5ZA 4XJ8A 4DPNA 2VTXJ 4N9HA 1MQTC 1COV3 3V0BB 2HWD2 1GWLA 3DL3A 1G6NA 4AW7A 4AHWA 1R1A3 1UY4A 4GMP0 4M4RA 2VNRA 2E53A 2ATFA 3HT1A 5FBJA 4JRAA 4R4XA 1W9FA 4XFHA 3VHPA 1BBT3 1WLDA 4ZY9A 5FZLA 3VBRC 5A6QA 4QQHA 2AC1A 1XYNA 5FR3A 4CDWB 4JQRA 4FPGA 2IC1A 1BK0A 1XE8A 1VRH3 1SCRA 4KG8A 3RWKX 4Z2AA 1VBE2 5I91A 3C7GA 2ZGNA 2RS51 4KWJA 5LK5A 3LA3A 4UF0A 3I8TA 4KG0A 4XACA 3RZGA 1CZTA 5F9TA 1AR61 2ILMA 5GALA 5A70A 2KM2A 2JG9B 2GP3A 2CU5A 1GQPA 5IFPA 2CL2A 1G9DA 2UU8A 4RR3B 2QCSB 4BMBA 1UIKA 2R062 1W8ZA 5K0UC 1N3PA 1W03A 1EPZA 2VZ1A 4FPYA 1XU2A 5T5JA 5B2GB 1LHVA 2VMEA 1IKPA 4EZ4A 2EXHA 1B35A 3H1YA 5FTTC 2Q8DA 1UU4A 2RMU1 2WUHA 5A3LA 3VKMA 1VE0A 3CEWA 1ULCA 3RVHA 4QXHA 2DF7A 2VZSA 1CZVA 5JXJA 3ZFFB 4Q4X3 4GKXA 1RUOA 1CD3G 2ZGQA 1Q5OA 2ZACA 5FZAA 1VAMA 2XGXA 5IVVA 2JD9A 2XLGA 1EAH2 5BNNA 4XW3A 3AXDA 4A41A 3TEZA 4XUPA 3SEEA 3FE5A 4YVSB 4MX3A 5F5CA 4QPGB 2Z79A 3USUA 2OZJA 5FK7A 1RUE1 3E1F1 1C28A 3TN91 2WS93 3AMNA 5F6LB 2QJVA 1ZZ8A 3CZJA 2X8KA 1AR72 3VZOA 5BY5A 1O3QA 2D7FA 3POSA 3B5LB 1GYKA 4YZ5A 4NRQA 1ACCA 2AUYA 2BWAA 2OA2A 4HN1A 5IAVA 2R16A 5F37A 2B9VA 1YHFA 5FZ0A 2HH9A 4LKFA 1W2UA 4AGGA 3ZXDA 4GH4B 1R091 2A73B 3ZSMA 4R9DA 2JDAA 4QT6A 3PVBB 4Q4W2 5FMOL 3RMXA 5HCHA 1ZNPA 3POBA 1FATA 3FUQA 5FYYA 3ENRA 3IPVB 1TMF1 2W0XA 1CJDA 4XAEA 4FFHA 2R49A 2XJVA 4XF3A 2BRTA 1ASJ3 4BQ3A 5FPVA 3OBZA 2WAAA 3O0WA 2WT1A 3BTZA 3U37A 4N7UA 5IVYA 2VTXA 3CZUA 5C5TA 1OKQA 4Y5TA 3POFA 3ZXLA 2CDOA 1GWMA 2E63A 3MIFA 1REFA 2HWE1 4I09A 4Q1RA 2WLPA 3PIGA 1VMHA 5A6ZA 1CWPA 1ZBA2 1QJY3 1J1TA 1WCQA 4OHWA 5FZ8A 1XYOA 4IV1B 3WDXA 4BQ4A 4AI0A 1NKGA 4A6SA 5BNOA 4PHZA 5JMCA 4N53B 2LTNA 1XB9A 2A3XA 2JDHA 1YO8A 4GQ7A 1GU3A 1D2QA 1GNYA 5DG2A 3WQBA 1UNBA 2ZGMA 4XF4A 2JICA 4JHTA 1JZ8A 3LKJA 1F5FA 1XE7A 4MADA 4A4AA 2VVEA 1FNZA 4RHV3 1KD7A 1PIV3 3FMGA 3KM5A 3UKTA 2C5DA 1O3SA 3Q8EA 5I93A 1AUYA 2W47A 3B9IA 4MGZE 4RHV1 4S2HA 5KBFA 2WNUB 2X5IB 3V0BA 4NVPA 2JKXA 5E1RA 4XFAA 4C0BA 4NHLA 4CCOA 1RUG3 5C9AC 4HVRA 3SNMA 2DUOA 2YPDA 1LOBA 1NQDA 4XTMA 5FXWA 3C2UA 1AXKA 4BCUA 5AC92 2GP5A 1WZXA 3BKZA 3VZMA 4EN8B 3U1XA 1RUF3 3MLKA 4FPLA 5K4LA 1YUDA 2C4XA 4DXZA 1U5YA 4HPKB 1HN0A 5LB6A 1VRBA 1RUF1 1ULEA 2YMZA 2K2SA 3I2IA 4JHZA 1XNBA 5FUIA 4ZKTB 1H8VA 1RUC2 2RS11 2XL7A 2WT0A 1SLAA 4HMZA 5LA2A 1OA4A 5EV7A 2IVIB 1Z7S2 2JG9A 3ZXEA 4NRPA 2PXJA 3MHZA 1RIRA 2PHWA 4RR3A 3HVDA 3VBOC 1YQCA 3GXUA 4B7KA 4DINB 1C8M2 2FMDA 4AI8A 1HRV2 1MZ6A 4ISQA 3U11A 4HONA 2V4VA 4M0NA 1W8TA 1WMEA 5EFUA 1FPN2 1TME3 1RINA 1DF0A 1VBD2 4LBQD 4BIOA 3ZKYA 3WXPA 1STMA 3NRUA 1X33A 1GP4A 2DDUA 2YROA 1FI2A 1JN2P 4KWLA 3ZXAC 2YDEA 3TBDA 2P6HA 1UMZA 2UWCA 2F4PA 1MS1A 1TEIA 2YGLA 2R32A 2WFPA 3JBG3 2VCMA 3TWIA 5KXEA 3QBQA 4Y4YA 3DXUA 1XQNA 3SLIA 4BOWA 1PM7A 4DFSA 5KR7A 1CAVA 2O0OA 3JBG1 5A3UA 5FZ3A 1R081 4YVSA 1UYZA 1APNA 2ZAHA 5DQ0A 2XUEA 5BNNC 2BNNA 5FZIA 2HEYF 1OXCA 1XBFA 2HEWF 1JYCA 4WBBA 3WZ1A 2VULA 2R1DA 2WNVC 2RS31 2W87A 3R4DB 4META 1N47A 3MIEA 2BU9A 3WUCA 5BYNA 1OFSA 5E89A 3TRSB 2P5BA 4LEJA 4PBPA 4D94A 4GH4A 1VALA 5BUVA 1EUUA 2VUDA 4IQPA 4AAPA 4HK8A 2QDRA 4NHYA 5BNPB 2P3IA 1AJOA 1QGLA 2YC0A 3AVRA 3LEKA 3LSDA 2WFF3 2P3KA 1O3TA 4AR2A 2UYAA 4CCCA 3IPVA 4LHSA 1JBCA 4PDWB 4XBQA 3V65A 1VBB2 2PQQA 5A32B 4EWEA 4Q4Y2 2V5YA 1IQDC 4IE6A 2SBAA 3I2DA 4KQ7A 4B8EA 1OQDA 4WM8C 4QHOA 3LOBA 2NN8A 3KHCA 2EIGA 2WO2A 5KHHA 5C71A 4PJYA 3ZDSA 3H8RA 3DYMA 4ITCA 4FVVA 3AX4A 2MNGA 4IW3A 4BZ4A 1LNSA 1OA3A 5FZ4A 1HQWA 1YI7A 1UZZA 5FLHA 2PMWB 2VJXA 1C3HA 1UY3A 3WF3A 3ZFEC 4IV1A 1RUH3 2WQZC 1ODMA 3MW2A 1H9PA 3LDBA 4N53A 2QDNA 4DUWA 3QLQA 1ZYBA 5FP7A 4RL7A 2HWB2 1COV2 4ZXEA 1KITA 1WKYA 3OPZA 2Y6JA 1ENRA 3IIIA 1S0IA 4QGMA 3ZMNA 4B4PA 3LFMA 1FYUA 1R1A2 2EAKA 1W6PB 4OZOA 4DNYA 4YGEA 1AR83 3B93A 1IHMA 3ZYBA 1TZOA 5JMOA 1ZZ6A 1DGLA 1BBT2 5FP9A 2ZGRA 1AYM1 3GM8A 2D6MA 2X5IA 3GGLA 1UXZA 3OYWB 1QH6A 1VRH2 4RGKA 1CESA 1WA4A 2QQVA 3EYPA 3Q8BA 2P2KA 2VU9A 2VUCA 3SC7X 3VDCA 3UGGA 1OHFA 2W9XA 5EXOA 5GLZA 3ZN6B 1VB4A 2V73A 3ACGA 3RGBA 2W1WA 3M3QA 3MF6A 5E8AA 4HPKA 2D6OX 3SCGA 3R4SA 4KU8A 2VC9A 2VMIA 3MW4A 4MGSA 1WCSA 1Q8VA 4MO3M 4QD2A 1W8HA 4CDUC 1LODA 5FZ1A 2OS2A 4XZUG 5H9SA 2BWCA 3IWZA 2Y8KA 4L97A 3VGIA 1DU3D 4BWOA 2GAUA 1BYHA 1PVC1 4Y20B 2HWC3 2RDSA 5FYMA 2OT7A 1OF3A 3WY6A 1LULA 4CUCA 4GIQA 2PLV3 2ZGOA 4D7TA 5L36A 3ZN5A 4Q4X2 1FMD1 5EP9A 1QJU1 2VBPA 2WO7A 2D6LX 2E33A 2WZR1 2PLV1 2A71A 5LBFA 4NAMA 5AFBA 3ZSJA 2XKPA 3PTRB 1POV1 4CVUA 4CXYA 2CAVA 2Y26A 1HXS1 4YG0A 5CFCB 1JMUB 3E6BA 2H6CA 2DCZA 5FUNA 1HB3A 3LD8A 3I97A 3SXWA 4LO4B 3WP4A 1K42A 4BHPA 2DTWA 1IG3A 2RG4A 2PAKA 1PO13 1IS4A 4Y24A 1YXWA 4IEUA 4LPLA 1UOFA 2BERA 2FCTA 2WS92 4I0AA 4RD7A 1S4CA 3ZFGB 4FXKB 1RHI2 4Q29A 3VBSC 2IXIA 1PGW1 3LEIA 3J9SA 1H4HA 3T3YA 3DPRB 3MO4A 4CXWA 1US3A 1ZZCA 2IXKA 1AL23 5CFDB 5F3IA 4YVSC 1JYIA 4Q4V1 2VG9A 3H7YA 4XAAA 1DQ1A 1C8NA 3THTA 3WDTA 3V0AB 3HNYM 1KDMA 4LBLA 5AVPA 4N90A 4P5HA 1PMIA 4PBOA 3JB4C 3POEA 3N7KA 4WZFA 2VZUA 4S2DA 1SMVA 1V9U3 2VOVA 2MEV3 1ASJ2 3AZYA 5BNPA 5J36A 2Q8OA 1ND3B 4MVTA 1O8PA 2N7GA 1J3QA 1W8FA 1QMJA 2PHRA 2QQLA 4K3UA 5D1IA 1QQP2 2RDQA 5FMDA 4IV3C 2FBEA 3NMBA 5A32A 4GWIA 2WZEA 5DG1A 4EZHA 4DB5A 3L9JT 3VHOA 1VMFA 2IXJA 4CPBD 1OKOA 2VMHA 4QDRA 4HKLA 4D3WA 3VDDC 1UD1A 4N43C 4XCAA 1MZ5A 1SBEA 3OBRA 4UFIA 1H4GA 4LE4A 2EIEA 2GC0A 4YM0A 3THCA 5BV6A 5EJ3A 1H2LA 1YFYA 2E32A 1HRI1 3GJBA 4GZ9A 4H55A 4I3PA 4OLLA 5LA9A 3A7QA 1PIV2 3FWEA 3IDAA 3W58A 3PU3A 4LITA 1XNAA 2FHRA 4ONUA 1YJLA 1CR7A 3MPBA 2HWF1 3NJYA 3T4HB 2XVLA 1UZWA 3BPZA 1NXD1 5FPZA 1RUG2 1W6PA 3I59B 4IEYA 4CTEA 3R4UA 1U12A 1HJGA 4N53C 3DKWA 1YNAA 1UZVA 2J22A 4L9BA 3WF0A 4OULA 3DYPA 1UYYA 3J8F3 4XMAA 2WA4A 3NAPC 3ES1A 4NIDA 3HBZA 1AX2A 3OYWA 4N8MA 3CU7A 3VBUB 1FT9A 4CCMA 1V00A 4JV4A 4B1MA 3W5NA 3WP5A 5A1LA 2P4EA 5CADA 1WGPA 4LIUA 1BCXA 1JU4A 3LA7A 3L2YA 3MDPA 4UW6A 3ZN6A 4WZCA 4W8JA 1SLLA 4RQPA 5FY1A 1NOVA 1ZZ7A 3NNJA 3O5SA 2RVAA 3TEWA 4YW5A 1XRUA 5FZ6A 4LBOA 1HB4A 3LQCA 4IEZA 3EBRA 1V6IA 4DO0A 4DS0A 1IGOA 4XFIA 1LOFC 1BEV1 2BP6A 2EIDA 1H0BA 4ATEA 3FLTA 4NWVA 4Y22B 4GA9A 1H8TB 3X29B 3HQUA 4NIHA 3KVAA 1D4M3 4ASKA 3D0SA 2BUKA 4XIOA 2E51A 2O8QA 1SEFA 5T3NA 3M8LA 4CYDA 1VBC3 4GMP3 1RMU3 1TME2 1HLCA 2QKDA 2ZX0A 2YB7A 4Y20A 3RYPA 2FDGA 1SPPB 2JWPA 1RMU1 3IZOA 2WN3A 4IGQA 4FOQA 4HK9A 2RR13 1XNKA 5SV8A 1OURA 2A75A 3PJQA 4NOTA 3I2KA 3LIHA 3ATGA 5C6CA 5CFCA 5FZCA 3PVOA 5FPXA 1EY2A 1RB8G 4UWDA 2A5ZA 4QHZA 2XBO1 1V0AA 4IEVA 1YRZA 4QX0A 1ST8A 4IXLA 3VBHB 3ZXKA 3ZXFA 3K3OA 5D8AB 2ZAAA 1CIYA 3A23A 5FAXA 4EN0A 3N9OA 5HV4A 4FOWA 3DXTA 1UL9A 1IPKA 3ROUA 1JZ6A 3KV6A 3F95A 5G05L 2VD7A 3CNAA 4OHVA 1L7QA 1TQ5A 1RVF3 3BTXA 3AP9A 1K5MB 1OSGA 2ZOEB 5FO9B 1S0CA 5CFDA 1JZ2A 3I7DA 1AJKA 1KXGA 2Y6HA 1EPWA 1L7RA 2G19A 5FYUA 2DVAA 3V0AA 1JYXA 3E6CC 3AXEA 1X8MA 1OMIA 4M00A 5I8TA 1J3RA 1AR93 2WFF2 4S2FA 1W2TA 1CQ9A 2GN7A 5FZEA 4KNCA 3NJXA 1OC1A 2P3YA 5I8SA 1PNFA 3OF1A 1HKDA 3ACLA 2FZ1A 2I2SA 4ZZ5A 4Y1VA 4OQ9A 1JZ5A 1GICA 3DYOA 3QH7A 1ND3A 3D4KA 3GCXA 2RJLA 1J1LA 5IWFA 3SQOA 5JOZA 3GCWA 2K9ZA 5FPAA 1EV11 1ND2C 2PTMA 3LF7A 1JZ4A 2DUQA 3IN9A 1C5IA 3UJOA 2XL9A 3S7IA 5JLVA 2BTVC 4CP9B 3I2HA 3CQOA 4OYUA 1W6QB 2LUWA 1HB1A 2CGNA 2XWJB 4CEYC 4XYXA 4AVTA 1QDCA 1LGBA 4HLTA 3M1HA 2D97A 3IDBB 3WW1A 3IMMA 3GDBA 2VW2A 2R071 3HN1A 1NUKA 2CDPA 5KXDA 4QPWA 4GB31 3QD6A 1MS4A 2OPWA 3VKOA 1YI9A 2ZX1A 1I9RA 2BNMA 3KGZA 4LLOA 5I0DA 1QIQA 5DDJ1 4AVAA 4AVSA 1REDA 1W6MA 4CCLA 2D98A 2BDRA 1JW6A 4K21A 4ZU4A 3T09A 4OI4A 3I59A 4L0PA 5T54A 1M4WA 2Q1MA 3K75B 3KF3A 3USSA 3M4FA 4XDQA 2A3YA 3VDAA 1W0OA 1OI6A 1HRV1 4I01A 2RM23 1D0GA 2XQXA 4MGTA 1LHNA 3H8UA 4OUEA 4LO5B 2GMEA 3VBUA 2VQUA 2CYFA 1DQ6A 3VZLA 2ZJCA 5HI0A 1MEC3 4W50A 1RUI1 2QTWB 4MGQA 4UOJA 3AM2A 4WM7B 2DVBA 5JOXA 1MEC1 2X53S 4FPJA 3ACFA 2BEOA 2IWGB 1U0AA 2BPA2 4J1XA 2J1SA 2R0FA 5ACA3 1TE1B 2CAUA 2VCAA 1RXGA 2R043 3WW2A 2LW8A 3OJBA 1WW5A 4L11A 5JXIA 1H1MA 4RQPC 5FKBA 4EYUA 2Z69A 4Y1ZA 5C4WC 5ABJB 5FOBB 5IYYA 4CA9A 2HWC2 3KV9A 1SLBA 1NXMA 1H8TA 1Q8SA 2XVKA 4Y22A 3ZSEA 3BODA 2B42B 2YV8A 1HX6A 3ACIA 3ILNA 5F1RA 2GU9A 5FZHA 3PNAA 3IB3A 5A3TA 2EXIA 4AHZA 2YZ4A 1SPPA 3NV1A 4TLGA 4DZGA 5CISA 1NA1B 4J1WA 3C7HA 5JPNB 3K4DA 1RL3A 2EXJA 5T52A 3UT0A 4BMEA 5C7GA 2E7TA 3CO2A 1OLQA 1AX0A 2WRAA 1C5HA 1O4ZA 2OPKA 4XXAA 4YW3A 5C8CB 1LHWA 1VBA3 1D4VB 5IVEA 1W99A 5JDBA 3GJAA 4PLNA 3BB6A 1PO12 3E5XA 1Z0HA 4CDQC 5CKNA 1LESA 1Q43A 3AYEA 1DGWA 5A33B 5LZ6A 2TBVA 1UKRA 1LRHA 3VKFC 5IVJA 2FDFA 3WEZA 5FZGA 2YGMA 2AGSA 3MF9A 4XQDA 4TLFA 3VBHA 2XXZA 2JDYA 3O14A 5A3WA 4AEJA 5CFCC 5M0TA 1DQ4A 4JGZB 2ZKLA 5D8AA 4YGDA 1CPMA 5F3CA 1AL22 3R6SA 1W9SA 2ZGUA 4Z92B 3HT2A 2JXAA 2ARXA 2QQMA 4QX3A 1F35A 1WLTA 2B5HA 4N9IA 1K5MA 1NZCA 4Q0PA 5FREA 3WNXA 2Y60A 3LIGA 5IT6A 3I49A 4HBNA 2RS53 1V9U2 1OQ1A 2PYTA 3B00A 4XZPA 3GBGA 4XMIA 1X8EA 2MEV2 3AJYA 4LLFA 5FXVA 3LGRA 4LHNA 1AR63 2F4LA 4XJ9A 2GMPA 5H9QA 1S1AA 4XFGA 3N7MA 2QVSB 4M0HA 4IEWA 3PVEA 4COYA 2HWB1 2XWBB 3PURA 4YW7A 2G9GA 3NWKA 3E97A 3N4MA 2XJPA 3GYDA 3ZR6A 1A3KA 1GR3A 2VOXA 3PTYA 2D3RA 3GZEA 4NPLA 2W1QA 4XUNA 3E5UA 1IZ3A 2HBTA 2RMU3 2J1TA 4CZSA 2C24A 3UV9A 1ZBE1 1NT0A 5JI7A 2ZEYA 4TWTA 5ERLA 4CUAA 1SQ4A 1DFQA 2QQKA 1V6MA 1UZYA 4EJRA 1W6QA 4CEWC 3O1UA 4ZZ8A 5H9RA 3EMRA 2GC1A 5T5LA 3ZXJA 1NCRA 1UXXX 4AHYA 3T1MA 4BQ5A 4LXLA 1PGL1 4Z8BA 1GKBA 4QGLA 3THPA 1GOHA 1UY1A 1CZSA 2OKXA 2O8OA 4DMIA 3ZIWA 4XJAA 4A3XA 1KEXA 1JOPA 2G4IA 1BVP1 1RUE3 3TN93 1NE4A 4LKSA 1W2OA 3J8F2 4OFGA 3JUUA 3U4SA 4DOUA 3TNPB 1BMV1 4E9KA 4XOGA 1RUD2 3S5AA 3PIJA 1K12A 1BLZA 2B8MA 4FP2A 5KHIA 3WNMA 4JGYB 2C26A 5EIYB 2OQ6A 3DUIA 1NY72 3HIFA 5LY1A 1A8MA 5CG9A 4XJUA 4R9AA 5KHKA 3U78A 1OLRA 1R093 5HCBA 3P5BA 2FDKA 4EROA 3O0VA 4P9WA 1DGRA 4Y5Z0 3INAA 3H1WA 3LWCA 3ECQA 4NO4A 4KWKA 3WG4A 4UXAA 4Q8KA 2XMLA 4FPKA 4WM7A 1Q8QA 5DZEA 1TMF3 5EPAA 2BFUS 2XJRA 1QKQA 4NR1A 2AH2A 3ZYGA 5KHGA 2NYYA 3OUJA 1T6BX 4IETA 3RZMA 4RFRB 1GZ9A 1D4M2 4LBQB 2WKKA 2XONA 3W9AA 2RE9A 4BISA 2VOWA 1VBC2 4YM2A 3I2OA 3BTYA 4DRRA 3J4UH 2X05A 3WSOA 5ABJA 3G6JB 3VD5A 4QQ2A 1RHI1 1AHSA 3C7OA 3OUHA 2EF6A 2HWE3 4JKKA 4QX5A 2RR12 4OI1A 5DMYA 4QB6A 2ZGPA 4BQ1A 5A3OA 1KFXL 5IHRA 2JG8C 5DUVA 5FP3A 3WHTA 1HW5A 4RGGA 1XNCA 4CDXC 1UKGA 4COVA 5J1XA 4ZU7A 3RQ0A 5CB7A 2YBPA 1DQ0A 2WABA 2YC4A 1RITA 5C8CA 4R9CA 3BI3A 4DXSA 1J58A 4R9BA 5GM0A 1WW4A 4YWAA 1NX9A 1G9AA 3NSTA 2Q8EA 1X7NA 1Y43B 4TN7A 5C3SA 5JPMB 3U4XA 1L7LA 4PIYA 5JVVA 4I30A 3S6PA 3VL8A 1AL0G 5JR2A 2D6NA 1QQP1 3KVBA 5FKCA 1RVF2 1VB2A 3T2OA 5CG8A 1ZZ9A 2LROA 2W3JA 4JGZA 3VB9A 2QQIA 1BQPA 3DN7A 4KI5M 3AZVA 2ZMKA 4LMFA 2JDKA 2RDRA 1XU1A 1NCQB 4V2WA 3WW4A 5DN2A 5KXBA 4QX1A 3DGTA 1Q56A 5FOJB 1CIWA 2TUNA 3WG1A 1AR92 1XSRA 4CDWA 3WF4A 1GOGA 3RZJA 1JOBA 1SFPA 3BOPA 2XQRA 1Y7BA 4E8CA 1NLRA 4ASLA 4XFFA 3AMQA 4GKYA 3WDWA 3B01A 1VAVA 2ENRA 1NAEA 4CCKA 3RSJA 3WINE 5I0RA 3K4ZA 2XB6C 2RS13 1KDKA 1MZFA 2UWBA 4URTA 5EJZB 4PF5A 3BIWE 1C1FA 4FT8A 2QQOA 2XJUA 2W1SA 3BN6A 4YZ4A 5FYSA 5HXVA 3I3BA 1KS5A 1GQHA 1DQ5A 1LR5A 1OOPB 2DCKA 4HVOA 3PUHA 4K6BA 5JSOA 1OPMA 5CA6A 1HIXA 2WAOA 4XURA 4YG3A 5F8PA 4HSJA 3MYXA 4AK3A 5E88A 5DZFA 3ZYIB 4D7YA 3P3NA 4XUTA 3MIBA 3NNMA 1Y4WA 5D21A 2JENA 5L9RA 1S0DA 3CHXA 2FMYA 3KHBA 3UKVA 1K3IA 3FBYA 1KGYA 3QCWA 4MG2A 3HMYA 2L9LA 5GKAC 2AEYA 3U75A 2Y6FA 1ENQA 3ZFFA 3TEYA 5GLTA 3M3CA 1B35C 1H2NA 1YJKA 3DF0A 3PUIA 3RI8A 2VECA 3HNBM 3IKWA 4C8DA 3MV11 1QJX1 4JDNA 1LHUA 2W5FA 3BU0A 2O1QA 3SKVA 3HQXA 1R083 1NCRC 2XJSA 1O7FA 3M70A 3VBFB 1AYN1 3WNPA 1X82A 3UKNA 4NPMA 4QPGA 1F2NA 4LO8A 2VZQA 2RS33 1ZRFA 2RM22 3ABZA 2J1UA 2JJ6A 2WL1A 4RS5B 1C57A 2JKBA 4J6GA 1IPJA 5HCFA 2JIGA 4W65A 4X6RB 4JGYA 5EYXA 1FOD3 4GD4A 3MEPA 1TG7A 1QH7A 2GDFA 4PT6A 2ADEA 4MHRA 4XQWA 2W94A 4P02B 1FOD1 2HKXA 4OHZA 4BB3A 1UPIA 4FQZA 1Z78A 2UY8A 2DFBA 2LS6A 3CKHA 4AEDB 4DUXA 1JHJA 3ZLIA 1XNTA 4IE7A 4AE2A 5ACA2 3PVNA 2R042 3TYJA 4MGYE 4V1PA 2CGOA 2JX9A 1OFNA 1OUSA 3WD5A 1XOYA 5LBCA 1ULGA 2GSYA 1GSLA 4M3CB 4H7LA 4BK4A 4LA3A 1YC61 5FY0A 2A6ZA 5FY7A 4LBQA 1PNGA 2E9QA 3BU7A 4Y3OA 2ORXA 2AZ5A 2OIIA 2QQWA 4MXWB 2A1XA 3URFA 4QXCA 4CCNA 1O4TA 4D8MA 4NROA 1W05A 2A6XA 1O8SA 3JB8A 5FY4A 4Z07A 4QXKA 1PK6B 2YFZA 4P9JA 1WCDJ 5KHJA 2P1BA 4LK7A 5A1AA 5ABJC 2B4KA 1VBA2 2DWRA 3SH5A 2ERFA 2JIJA 4SBVA 5A7PA 3ZYFA 4BE3A 1H6XA 2DTYA 4JTOA 5A7WB 3T0BA 5HXMA 3SH3A 1LTEA 1PMHX 2DYCA 5FIXA 3VD7A 4MZUA 4O7XA 2BNOA 4AF9A 1DZRA 1RUJ1 2I74A 3EO6A 4NIIA 4TTGA 4OI0A 2BGPA 4XFCA 2GH2A 3CBNA 5IVFA 3ZKUA 2ZX4A 3WDUA 3NO8A 2ZA9A 1JS9A 2Q4SA 1LB2A 5EQUA 2YBKA 5C33A 4YNIA 1DG6A 1AYM3 4FPCA 5BNOC 3IM0A 3O0XA 2ZBJA 3EB7A 2E7QA 2WNUA 4MOAA 2XG3A 3W20A 3K46A 1PZ8A 4LR4A 5E16A 1UO9A 2VO5A 1NCQA 5FYHA 1FX5A 5DXDA 3WP3A 1X9PA 4BQWA 1MS9A 5F6KA 5GLWA 1AR62 1C4RA 3CDZB 1QEXA 1W9WA 5DZGA 1ODNA 5EHDA 3RYRA 2J1VA 2WZ8A 5FQ0B 2PFWA 5DUWA 2K0GA 3ZSKA 4CDWC 1NG0A 4NPRA 4CE8A 1D7PM 2WWSA 2YU1A 4E2QA 5L19A 1YFXA 1X9TA 3KWVA 2J1EA 3IIAA 1ZRCA 1U5IA 1UOGA 4IE0A 3IT8A 4UFJA 2RMU2 1DYOA 5FWEA 2X09A 3WHUA 4A6OA 3WCRA 1PVC3 1XPWA 1W3VA 4KBBA 4XDPA 5L73A 1JODA 4AI2A 1OOPA 5IFTA 2GH8A 1A34A 4FPHA 1FMD3 1QJU3 3H1MA 3LZZA 2WZR3 1X36A 4ASMB 4QU1A 2YFUA 1YIPA 1S0BA 3OGRA 1Q8OA 1POV3 1S55A 4KGGA 2JG9C 2ZGTA 3TB0A 2GZWA 1HXS3 3KT7A 1PO21 4O9GA 3L2HA 4LK6A 4RR3C 4UBHA 3VL9A 2FDIA 4NHXA 1O59A 3RWNA 3DV8A 3ZMOA 2HYXA 4YVWB 1LOGA 5FXXA 3KT1A 2EXKA 1V6JA 4CCEA 2VNVA 5L7OB 4INDA 1UOBA 2DVGA 3AB0A 1RUE2 3TN92 5JZGB 2YUEA 1CX4A 3N36A 2LALA 1H2MA 5J09A 5IK4A 1B09A 2CWMA 4C1XA 4NUBA 5IUQA 1DYKA 5FMCA 3ZFFC 4HANA 1LEDA 1G7YA 3D82A 3PUQA 3VBFA 3PU8A 2Y6KA 4D7SA 1OQEA 2JECA 3AJZA 2A7AA 2A3WA 4LIVA 3RDIA 2ET1A 4RS5A 2YYOA 2ZHMA 1R092 4JDOA 4Q4V3 3Q8CA 1X50A 1QXJA 3GHNA 2VBDA 1MQTB 4BA6A 2DU1A 2Q30A 4NRMA 4QPGC 4BQXA 4D69A 4QQLA 1S2EA 3AVSA 1TMF2 4ET7A 5LCWL 3K3NA 4RFT0 3VBRB 4QPIB 4AEDA 1LGCA 5JIUA 3ZN4A 1ZRIA 1KFUL 2ZHNA 3OBTA 4ATFA 4P08A 4BJ0A 4HSLA 4GWJA 1H2KA 1WMXA 3KCCA 4COWA 2KA3A 3JD71 4FFFA 5FRAA 3F2ZA 4ES8A 4PDWA 4GH4C 4RSUA 2HWE2 1HJFA 2W92A 1BKZA 4MXWA 2D5FA 4L99A 2CWSA 3CJXA 1U5ZA 2HWD1 3ZX7A 2VUJA 1RJ7A 1UAIA 2BOIA 3AK0A 2WT2A 2ZXQA 3EJKA 1PK6A 1QJY2 2W52A 2D3SA 3KCYA 5HV0A 1JYWA 4TYSA 1SFNA 3SCHA 2HEVF 5K0UB 3D6EA 3I2FA 5FYBA 2D40A 1QOOA 2RV9A 4GXLA 3UL2A 1V6LA 3VKLA 1HRI3 2PHUA 3KZ4C 2WC2A 5F5QA 5A7WA 3T1LA 1IS3A 4CP0A 4ZS2A 5L9VA 3KLSA 1VBE1 2VXJA 5A6YA 2WN2A 1GOFA 4RHV2 1SDWA 2HWF3 2ZZQA 2RHPA 4Q27A 2FCVA 4XQ4A 1OPOA 2OYZA 1VJ2A 3OSDA 4FXGB 2HLEA 2EAAA 4IV1C 3SEPA 4FOYA 2W95A 3K77A 4Q0VA 3WNLA 1W39A 4CSWA 4UFKA 4X8PA 4NWWA 1N1SA 1PVXA 2R061 3JXSA 4KL1A 3N9NA 1KJRA 4G9SB 1UW8A 4QGNA 1NZIA 5LA1A 4Q26A 1LEMA 1RUF2 3ZDVA 5IJRA 5IAXA 5LEKA 2W1UA 1BK1A 3PDQA 1P8JA 4HFSA 5EJ1B 5FZDA 1MS3A 2VUAA 3AKPA 4FAGA 4Q0QA 2DURA 2WNUC 2X5IC 3GBWA 2RS12 3TEXA 2RJKA 2WQ8A 2BGCA 2VZVA 2X29A 1R64A 4COUA 2GNMA 5EYYA 2JDNA 5F7UA 3B9CA 5EZWA 3JU9A 4FI9A 4Y4RA 1WW6A 4CPBA 1BEV3 3OB8A 4EN9B 1EAH1 4PQQA 3ZXGA 5FQ0A 1UX7A 1E57A 3N9LA 1NQJA 5FY9A 4HG6B 4XUOA 2P6CA 2Y33A 4ZONA 2VMGA 5F39A 3W59A 2DCYA 4KBZA 2H6BA 1WWYA 1UN1A 4JZRA 1CAWB 4IEPA 2E26A 1E5SA 1FXZA 1UYPA 2ZGLA 1OT5A 3OPWA 4DXTA 2SLIA 3C7FA 4FPEA 3U10A 3JZVA 4EV0A 1M06G 1DZTA 4XE9A 3RPQA 1AR71 2Q5TA 3UETA 3AKSA 2OVUA 3FHIB 5DPNA 3O1VA 2WSVA 4XHXA 1OOPC 3ME2A 3MIDA 2OW4A 4TXWA 4LT5A 5F2SA 2BVBA 3UYJA 4J25A 5FZ7A 1UY0A 3JBG2 4Z2WA 2XBO3 4QKBA 3WG3A 1R082 4QQOA 4Q4W1 4LE3A 2QZ2A 2JE8A 3WW3A 1QNYA 2GALA 3O12A 3I2GA 1A6CA 4CXXA 3N3HA 4KU7A 5JZGA 4UFMA 2RS32 4EN6B 4XBNA 3T0DA 4P00B 1DCSA 1DHKB 3UJQA 4ARXA 2VCCA 2WWUA 1G86A 3VN4A 3C7EA 4P9LA 3ZFGA 5JR7B 4R52A 3WCSA 3ZO0B 4XVHA 2Q8CA 5ISLA 3O1OA 1WLCA 3Q8FA 3DPRA 5BXXA 2YG0A 3AFGA 2EA7A 1MQTA 4FBFA 2VR4A 3VBFC 4Q5OA 1GZWB 1TNFA 2ZGKA 2BGOA 4ZXKA 2JDPA 5LBEA 4UFHA 3U07A 5C9AB 1ZBA1 1QHDA 4Q0SA 4MYEA 5LK7B 4YZ2A 3VBRA 3KQ4B 4QPIA 3ZPOA 3ORJA 5J3UA 1QY4A 4JDMA 3W21A 4YRDA 4QPYA 2D44A 3MICA 4MSVA 3I4IA 4ISRA 3VD9A 4F8AA 5HBAA 1EV13 3HOBA 4LUMA 4Y33A 3QACA 4LO7A 1AX1A 2WWJA 3H3LA 4FQ4A 5FCCA 3RZLA 3AP4A 2YC2A 4W6XA 2GN3A 4JAAA 5BNPC 4DUVA 1PMJX 1ENXA 3FJSA 3NV3A 2V09A 1SG3A 5DAXA 3WV6A 4URAA 3WF2A 1BVVA 2VZOA 4PDWC 4M3CF 5GJ6A 2WDBA 5AC91 5FZ9A 3VBOB 4DY5A 3LPGA 1AXYA 1RUH2 2R073 3BTAA 3N9QA 2BFUL 3A21A 4R8HA 5DAQA 5K0UA 4GB33 4IDZA 2PA7A 3VHNA 3MV01 3RYKA 2ZEXA 3WOGA 3P6BA 4E2SA 2VZ3A 4F7ZA 2NMOA 4XHBA 1N1VA 2A6WA 2PN5A 3HN3A 4O65A 5FP4A 5DDJ3 1RUC3 4C0HA 5LW9A 1RXFA 1AR82 2YY1A 4XUQA 5C5UA 3ZPYA 3LDKA 4JX0A 1S0GA 2BW8A 1KQRA 1RUC1 1VAKA 5A7OA 5IATA 2Q0AA 3UNPA 3OGJA 1ZA7A 4EE2A 1WCKA 3FHQA 5LASA 4K8RB 1Z7S1 5IK5A 3OY8B 1G8WA 4CU7A 4ORFA 5J37A 2W46A 2VH9A 1HRV3 3T2PA 1Y9QA 1SCSA 3OUIA 1F8VA 5LBBA 1V6KA 3H3UA 1C8M1 1LOAA 3H42B 5DUXA 3WNKA 1FPN3 4GALA 4P9IA 1ZM1A 1YYNA 3A0NA 5BNNB 3D0JA 3ACHA 4K40A 3IAQA 1RUI3 1FPN1 1MS0A 3LSEA 2MHFA 4BIFA 4ES9A 3PUSA 2WNVB 3J7MA 1DLCA 1VBD1 3J7HA 1W8NA 1GANA 1Q3EA 1GNHA 5T55A 3POYA 3C8XA 1QOTA 1DGRN 4I0BA 4YM1A 2PHTA 4B4RA 3T2QA 1BHGA 3APBA 3EQEA 3OGGA 5FY5A 5FZKA 4PI2A 3BGAA 2V5DA 3SISA 3POJA 1LAJA 2Y0OA 3RJRA 4XETA 1ZX5A 2ORZA 1PVC2 2NM1A 3O1RA 3MGUA 3NV4A 3QH6A 4YFZA 2P37A 5F2WA 2V72A 3J7LA 2YXSA 3I3DA 1KJLA 1QJU2 4Q1PA 4F83A 2WZR2 2PLV2 3LB9A 4IGOA 2WBKA 5JSRA 4CCJA 2ZZJA 2Q1FA 1CAWA 4OZXA 4AWDA 4YW6A 1HXS2 3POWA 3D5OA 1UPSA 2JE9A 5JI9A 1DDLA 3LOIA 3NJZA 4ZPIA 4Z82A 3I3MA 3CL1A 3R05A 2CHHA 2WO1A 4WVVA 1S0EA 2AENA 2VW0A 2XH6A 4WM8B 3KS7A 2R7EB 3NKTA 5FLIA 3RZZA 4DXRA 1DLLA 2P17A 3CJIB 3KMHA 1JH5A 3DCQA 3MI8A 1TNRA 5FPLA 3V64A 4G3YC 2FQPA 5JUVA 3NV2A 4L2NA 2DCTA 4O61A 2B46X 4Q2FA 1PGW2 1SBFA 2DCJA 3H3ZA 4MHUA 2BJSA 1MS5A 3ZFEB 3OD0A 4AGVA 5LWBA 3C3VA 4BLIA 5I8YA 4Q4V2 1VBB1 3LEGA 5JXGA 4Q4Y1 1F5JA 3B02A 4KMQA 3O1SA 3WDVA 5EWSA 1LECA 5LATA 3T30A 2ZMNA 3AYCA 3ZIXA 1MZEA 3PMEA 4YM3A 3WNNA 2IFWA 3BUCA 4ZHNA 3ZFGC 1WD4A 1J83A 1DGWX 3B69A 2Z4FA 3MIHA 2NLRA 1GZWA 3TOJA 3KV5A 3J26N 4Q8LA 5TSWA 3WP6A 4LQRA 5C9AA 4NIAA 3H8XA 2D5HA 3AP6A 3DPRC 3MIGA 4XEZA 5F3EA 2AREA 2HWB3 2WR9A 3BPSA 4QKNA 4OI2A 5CFDC 3AKTA 3N7LA 4JCKA 1W8OA 1T6GC 2JD4A 3BALA 4Y5SA 1ULFA 1COV1 2QE3A 1VIWB 4FFIA 4YGCA 2JDMA 1R1A1 4BQYA 4QPIC 1IS6A 1QXPA 3N9PA 4AI1A 5C3RA 1ZBE3 4P9GA 1W8WA 1BBT1 2UWAA 4QAWA 1VPHA 4BM8A 2BOJA 4E4ZA 2ZTNA 4QDQA 1ND3C 3FC0A 1YWKA 4CDUB 1OLMA 1VRH1 4UW5A 3PUAA 1HRI2 5C3QA 1W04A 3FZ3A 4QKFA 2WJSA 1VP6A 1WMDA 2Z42A 3VBOA 1DBNA 4MLOA 3RG0A 2QZ3A 2QFEA 2ZABA 4QM8A 2HWF2 1FV2A 4U36A 4XTPA 2J1RA 3ES4A 4N7IA 5KC5A 2QNKA 4FPOB 1JI6A 2EALA 5FUPA 3I2JA 4MXVA 2OUJA 4QX7A 5DUUA 4YPJA 3O7OA 3MLJA 2C9KA 1XSQA 2J42A 4CRQA 5JOYA 4E4SA 4RGAA 2VTFA 3MUY1 4PIXA 4AFMA 3WLUA 3BYWA 4FOVA 2DVDA 2JDUA 4OMDA 2CNAA 3GHMA 3OY8A 5F3GA 4AGRA 4YZ3A 3ALQA 2CY6A 4BH9A 4E2GA 5CBLA 1SLTA 1JYNA 3VHRA 4AFBA 4EWAA 3RZHA 4I0WB 4BXSV 2TEPA 3MFAA 2XUMA 3HJRA 4Q4X1 3U14A 3POIA 4X8NA 5FMBA 3VBSB 2ARBA 1UQXA 1EP0A 1GV9A 1G9FA 1IS5A 3H50A 1YIFA 1BEV2 1GWKA 1V70A 1N1TA 1W6OB 2WNVA 3AKRA 3GF6A 1CAVB 1UU6A 2NP0A 3SITA 2AYHA 2DFCA 5FDBA 2QQPA 2W2IA 2VBBA 1CJPA 1D2SA 3VBUC 1I6XA 4GULA 3DKQA 3WF1A 1SHWB 3WX5A 2C1FA 4C91A 1NLSA 5SV5A 1H1IA 3PL0A 1RHI3 1RMU2 2WS91 4KWUA 3IAPA 4Y1UA 3NL1A 4LOSA 2R1BA 2VZPA 3G7DA 2ZEWA 4DRVA 1VMJA 3R0RA 5CVRA 4OQ8A 1LKNA 4LKDA 4A2UA 5F5AA 4FTEA 3OCPA 1O91A 1POQA 1Q8PA 2ETEA 2OUHA 3VKNA 5C3OA 2GC2A 4OVEA 4XABA 4FFGA 1PZ9A 1HN1A 4IV3B 4LKEA 4UFLA 3AZXA 4CP1A 1H8TC 5A3MA 5A80A 5IK7A 1AXZA 2ZX2A 2XBO2 1NA1A 4LOTA 2F6BA 3O1PA 2XOMA 2VQ0A 4WM8A 2GC3A 2Y6LA 4IE4A 1Y9GA 5T5OA 1QDOA 3CJIA 3NJVA 3HPNA 4H2AA 3VDDB 4N43B 2DBIA 2I07B 1WLWA 2FCUA 4NJ4A 5A33A 3HAGA 1ASJ1 3ZYRA 1MVEA 4AHXA 4CU9A 2K46A 1S2BA 5FBZA 1SLIA 1QQP3 1ZZBA 3POGA 3H8OA 3OGVA 3FN9A 5FXZA 5LRRA 3ZFEA 2EVXA 2R0HA 4D6RA 3VZJA 4EQVA 1ZVFA 2RDNA 4FO9A 1GMMA 4Y26A 1URXA 2ID4A 5F5IA 4HOOA 3AP7A 5A7SA 1JZ7A 1UMHA 2BYVE 4AI9A 2FDJA 4LHLA 3VBHC 5GZEA 4AI3A 1QJY1 4XILA 4E8DA 1WBLA 3O1MA 4YW1A 4LBJA 2D43A 5D8AC 3TAYA 5FWJA 2ZX3A 4YW2A 5I0UA 5DAPA 3NAPB 4AQ2A 1LCLA 3IDCB 4A3ZA 2XPJA 1QJEA 3VLBB 2WNEA 1R1ZA 2C9AA 1K5MC 2IZWA 2I45A 1EV12 1LU1A 1E5RA 1PIV1 1WUVA 4LA2A 2VNGA 2WYSA 3V56A 4M01A 4NHMA 1HV0A 2W08A 4UW3A 3M2MA 4H14A 3T2TA 4EWDA 1D0HA 1W6NB 4DEQA 3VDBA 1RUG1 4XBLA 3FLRA 2IFRA 1JUIA 3OBAA 1ENSA 4E27A 2Y6GA 2R072 1OUXA 4GB32 4CDUA 1GP5A 2VCBA 4UI9L 4BLJA 2XHNA 3KSCA 5AFEA 3HD8B 1JHNA 4OUSA 1RJ8A 1QF3A 2J1AA 4MUVA 1QJX3 5DDJ2 5DABA 3RI9A 2G9ZA 1PZ7A 1Y3TA 3RZKA 4HZFA 1NE6A 3GALA 4B3NA 4L92A 1RC6A 2IUWA 5JIAA 1CPNA 4C90A 1AYN3 1W3XA 3UGFA 5K9YA 2Y0IA 3RS6A
chains in the Genus database with same CATH topology
1GWKA 2Q1FA 1UOJA 4LK6A 4YW7A 4YW6A 1WZXA 1V0AA 4CPBD 4BQ2A 1OKOA 1W8UA 1W8TA 4BQ4A 4A6SA 1W9FA 3ORJA 5D21A 2KR2A 1W8ZA 1WCUA 4CP9A 1HN0A 3ZYBA 1W8WA 4AL9A 3UT0A 4LJHA 2C24A 2LRPA 4YWAA 1OH3A 4BQ3A 1W90A 2JWPA 2WYFA 4CP9B 2K46A 3F95A 4LK7A 1L7LA 2O14A 2VXJA 1WMXA 3ZYFA 3ZYHA 4LKDA 1GWMA 2LROA 4CPBA 4LKFA 4BQ5A 4LKEA 1GWLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GWK A;  2Q1F A;  1UOJ A;  4LK6 A;  4YW7 A;  4YW6 A;  1WZX A;  1V0A A;  4CPB D;  4BQ2 A;  1OKO A;  1W8U A;  1W8T A;  4BQ4 A;  4A6S A;  1W9F A;  3ORJ A;  5D21 A;  2KR2 A;  1W8Z A;  1WCU A;  4CP9 A;  1HN0 A;  3ZYB A;  1W8W A;  4AL9 A;  3UT0 A;  4LJH A;  2C24 A;  2LRP A;  4YWA A;  1OH3 A;  4BQ3 A;  1W90 A;  2JWP A;  2WYF A;  4CP9 B;  2K46 A;  3F95 A;  4LK7 A;  1L7L A;  2O14 A;  2VXJ A;  1WMX A;  3ZYF A;  3ZYH A;  4LKD A;  1GWM A;  2LRO A;  4CPB A;  4LKF A;  4BQ5 A;  4LKE A;  1GWL A; 
#chains in the Genus database with same CATH topology
 2WQ4 A;  4QU2 A;  5FYZ A;  4MGI E;  5FYT A;  2EIC A;  3A0K A;  4H3W A;  1JZ3 A;  2WNO A;  2VY0 A;  1QNW A;  5E6H A;  5J7M A;  3RNS A;  1O3R A;  4QX2 A;  1RUI 2;  1TME 1;  4XIK A;  1MEC 2;  3E5Q A;  2ZGS A;  4KH9 A;  4CCD A;  2XVG A;  1UY2 A;  3M7A A;  4YLZ A;  3H9A A;  4S2G A;  4CUG A;  2FD8 A;  3T4V A;  1A8D A;  2NZ9 A;  1PX4 A;  3VBS A;  3OOX A;  3GBF A;  4YG6 A;  3S30 A;  3OD4 A;  1IPS A;  1F31 A;  2ARC A;  4X6Q B;  3M3E A;  1W6O A;  2XKO A;  4IER A;  4NMI A;  2G1M A;  4AFC A;  3S57 A;  1SZB A;  4GJY A;  4JKM A;  1MVQ A;  4PLO A;  1OLM E;  1CGP A;  4MV2 A;  1ULD A;  3EXU A;  3I3E A;  4DY3 A;  3AMM A;  5FZO B;  3UES A;  4AVC A;  1F15 A;  2XDV A;  3SHR A;  4B4Q A;  1I1E A;  4JKL A;  2VMF A;  4WM7 C;  5CAZ A;  1HQN A;  4P9Y A;  4UW4 A;  2JB8 A;  3MUZ 1;  1GLH A;  1O4Y A;  3NQH A;  4A45 A;  3CF6 E;  4DEV A;  3ILR A;  1AF9 A;  4HT1 T;  2B39 A;  3ITQ A;  1JUH A;  2VMC A;  2BQP A;  1UWW A;  4QKD A;  4CUB A;  5CZK A;  2JE7 A;  1EUT A;  3N7J A;  1ND2 B;  4IV3 A;  2DU0 A;  4GAZ A;  3FHA A;  1K5J A;  2ZCW A;  4NIG A;  2KXL A;  5FO7 B;  3OEB A;  1IKQ A;  2DV9 A;  1I5P A;  1RUJ 3;  2VQA A;  2TNF A;  1YEW A;  1MPX A;  2CSG A;  3AL5 A;  1UOJ A;  2WFF 1;  4CEY B;  3VDD A;  3N35 A;  2WSU A;  3K2O A;  4N43 A;  1LOC A;  1E5I A;  1NA1 C;  5DAV A;  1RUN A;  4KGQ A;  2ZHL A;  3I3Q A;  1WCU A;  1AVB A;  1XND A;  3I54 A;  4FP3 A;  3CJI C;  4LJH A;  5C8C C;  4FTS A;  2VVD A;  3ZOI A;  3DEM A;  4WVZ A;  2VOK A;  4XJZ A;  3P3P A;  1YFW A;  2OX0 A;  4GWN A;  1H1A A;  3NNF A;  3ASI A;  4IL7 A;  3T08 A;  2HJI A;  2QQJ A;  1WA6 X;  2Y34 A;  3B7M A;  2RS5 2;  4Y1Y A;  4AOC A;  3IDE A;  2HBU A;  5FZF A;  2Z5W A;  4JGZ C;  5JCT A;  1OA2 A;  1RUH 1;  4LOR A;  5J98 B;  1GQG A;  3NAP A;  5FMO S;  5F32 A;  1PGS A;  3ZM8 A;  1CVN A;  4OHY A;  1VR3 A;  3GZU C;  2ZS6 B;  2WA3 A;  1TVG A;  4LUL A;  1BXH A;  5BPX A;  1XC6 A;  1AR8 1;  2H0V A;  1OH3 A;  1WBF A;  3B94 A;  4YW4 A;  1ZBE 2;  1BJQ A;  3NVC A;  3Q8A A;  3ZR5 A;  5FY8 A;  3BIE A;  3OTF A;  1ZRR A;  2XHK A;  1OD5 A;  2E6V A;  3AKQ A;  5ANQ A;  3ZSL A;  1CAU B;  1W6N A;  4XXP A;  4RQP B;  1LOF A;  5A3P A;  3EHK A;  3AMH A;  1SAC A;  1PO2 3;  5IK8 A;  1FNY A;  5C4W B;  2Y38 A;  4OHX A;  3IBM A;  1PGL 2;  3MFC A;  4YFW A;  4PF1 A;  1J84 A;  1YFU A;  2BBV A;  2XLA A;  1GNZ A;  2AR6 A;  2C0Z A;  5FYI A;  3WG2 A;  2C6S A;  2D6K A;  2VGD A;  1BMV 2;  3RJ2 X;  1GUI A;  4P5Y A;  4AYU A;  2PQS A;  1J3P A;  1N3O A;  4RYD A;  5GZF A;  1H9W A;  4UYB A;  4BYY A;  3LAG A;  4AG4 A;  3WR0 A;  1QWR A;  2W39 A;  1XJA A;  2CTV A;  4JTN A;  5LY2 A;  4C1W A;  4CDQ B;  5C70 A;  5CIR A;  2NPI A;  2D6P A;  4JC1 A;  1XYP A;  2HWC 1;  4PI0 A;  3VD3 A;  4AEK A;  4A7Y A;  3ETP A;  4BDV B;  1JYV A;  5LA0 A;  3W5M A;  1O5U A;  4TSV A;  3T0A A;  4G4F A;  2FDH A;  4XPV A;  1JTZ X;  1US2 A;  3WNO A;  5A1F A;  3AZZ A;  3FUO A;  3H7J A;  3J7N A;  4CU8 A;  4DQA A;  3NW4 A;  3GZT B;  1YQ2 A;  5GZD A;  1ULP A;  5KXC A;  2P3J A;  4QM9 A;  1CON A;  1QJZ A;  4YYO A;  3O1T A;  2FZ2 A;  4MGK E;  4JGY C;  2B9U A;  3D3A A;  2VAU A;  2NQY A;  3OG2 A;  4OCT A;  3AMP A;  3P1I A;  1PO1 1;  1L3J A;  3NNL A;  3VD4 A;  3JD7 3;  4WVM B;  1GZT A;  3HR9 A;  1OH4 A;  4K20 A;  3VZN A;  4M3C A;  1UIJ A;  2HWD 3;  3M3O A;  4AFA A;  1W2N A;  5FK8 A;  2OZ6 A;  2XR4 A;  2Z2S B;  5FZO A;  3MLL A;  5JWP A;  3S0M A;  1JYT A;  1E5H A;  2B7Y A;  3GZA A;  2PAE A;  4AZZ A;  4IEQ A;  1QXR A;  2UYB A;  3KD4 A;  5CKM A;  5HCA A;  1AL2 1;  3LA2 A;  5FO8 B;  4AVB A;  1NLQ A;  3NNG A;  1MR5 A;  1PHM A;  4K7J A;  2B45 X;  3OGS A;  3VUO A;  5LEJ A;  1OVP A;  4D6S A;  5FLJ A;  4PCR A;  5C8W A;  4JVA A;  1ND2 A;  4TZD A;  4AEM A;  1VBE 3;  3UK9 A;  3AL6 A;  2BZD A;  1V9U 1;  2WZP P;  1FV3 A;  4P9X A;  5CU1 A;  4ARY A;  2QQU A;  1UX6 A;  2MEV 1;  5IVC A;  4CP2 A;  1QU0 A;  4F3J A;  1FAY A;  2JDZ A;  4CEW B;  2VW1 A;  5K8S A;  5I0T A;  1EYB A;  4CEY A;  1S0J A;  4QMA A;  1QJF A;  2AAC A;  1GBG A;  3SH4 A;  3HQR A;  2UY9 A;  4M4P A;  2W68 A;  2A6V A;  5B4N A;  2RJ2 A;  1O5L A;  1MAC A;  2R06 3;  1IG0 A;  2X10 A;  2ZKN A;  3MBW A;  1AZD A;  4FAH A;  3AFK A;  1N1Y A;  4QHB A;  2PHF A;  1KRI A;  1V6O A;  1PX3 A;  3MZH A;  5D2A A;  1S0F A;  2JEM A;  3MW3 A;  5FP8 A;  5FFO C;  4K9S A;  2ZML A;  5APA A;  1LOE A;  2DVF A;  1RGS A;  4IEO A;  4L8Q A;  4PLM A;  5I0S A;  3OPT A;  4PQ9 A;  2PAM A;  1UU5 A;  3E6D A;  1HQL A;  3ETQ A;  3PMS A;  3ST7 A;  3SMH A;  3AC0 A;  4H7M A;  4K1Z A;  1CAX B;  1EAH 3;  1W6M B;  3LCP A;  4QB1 A;  5FYV A;  2VZR A;  1N3Q A;  1OF4 A;  1NCQ C;  2GND A;  4LBN A;  3FFZ A;  2VOT A;  4BK5 A;  5JXH A;  3HBK A;  1CX1 A;  1GFF 2;  2PHX A;  5A7N A;  3KT4 A;  1T2X A;  4A44 A;  3WQ1 A;  1GP6 A;  1RUD 3;  1LHO A;  2R6Q A;  2VXR A;  3LE0 A;  1BZW A;  2WLQ A;  4A7Z A;  2LM3 A;  1WW7 A;  3J8F 1;  2VMD A;  4AL9 A;  1LJ7 A;  1RUD 1;  3THD A;  1CAU A;  4IES A;  1W9T A;  1XXN A;  3VV1 A;  1AR7 3;  3PJY A;  4D0Q A;  2HYK A;  4LBM A;  3DEC A;  3K51 A;  4NN0 A;  4BPZ A;  1DYP A;  1NY7 1;  1DIW A;  5C4W A;  1DP0 A;  3PLQ A;  1QJX 2;  4Y1X A;  3A4U A;  4LO6 B;  1C1L A;  2ZPX A;  2GMM A;  4XFB A;  3UGH A;  2VE1 A;  3FBM A;  4LHK A;  4Q4W 3;  4UBG A;  4AAX A;  5K7P A;  3PHM A;  1ZRE A;  1AYN 2;  1UCX A;  2DBN A;  4WVW A;  5BNQ A;  2JG8 B;  4NHK A;  2Y64 A;  4YVW A;  1SFY A;  3D8C A;  5L7O A;  2VNO A;  4CDX B;  4XC9 A;  1G9B A;  4FPF A;  3FFQ A;  5G04 L;  4JQT A;  2KR2 A;  1D4M 1;  4WV8 A;  5GZC A;  5C3P A;  2A70 A;  4XF9 A;  4CDQ A;  1VBC 1;  4GMP 1;  1W90 A;  1FOD 2;  5CEH A;  1YQ5 A;  4K1Y A;  3ZVX A;  4BU2 A;  1KS4 A;  1W06 A;  4COZ A;  3KQR A;  3ELN A;  3OEA A;  1A78 A;  5FJK A;  4Q0U A;  5A7Q A;  5JAX A;  2RR1 1;  4Z1V A;  1SBD A;  1V6N A;  1ZBA 3;  3H0O A;  5A6X A;  2BVV A;  2A6Y A;  4DIQ A;  5FV3 A;  3WDY A;  1OBN A;  3ZYJ B;  4RS5 C;  1HV1 A;  4IE5 A;  4CU6 A;  3RFR A;  1J59 A;  1W8U A;  1ZRD A;  2NMN A;  2WO3 A;  4V2V A;  1WD3 A;  2IXH A;  2CGP A;  1DQ2 A;  4HKO A;  5CYY A;  1VLN A;  2YBS A;  5GZG A;  1LEN A;  4WVM A;  4RN5 A;  1JU3 A;  4XDO A;  4LTA A;  1F4H A;  2VQT A;  3ILF A;  1DZQ A;  5FYC A;  4AED C;  3ZYP A;  1POV 0;  2WII B;  1JXN A;  4QX8 A;  1JOJ A;  3AP5 A;  5A3N A;  1RVF 1;  4I3G A;  2PEL A;  4I2O A;  5GLV A;  4GWM A;  2YHJ A;  5AC9 3;  1OVS A;  4HVQ A;  4UF0 B;  1UZ0 A;  3KF5 A;  1RUJ 2;  4E4H A;  4BQ2 A;  1AR9 1;  4XF0 A;  3LPF A;  2OQ7 A;  4B29 A;  3JQX A;  4CP9 A;  1ZA4 A;  1PK6 C;  4PIZ A;  4OMC A;  4XF1 A;  1LGN A;  2IVJ A;  2LRP A;  2YPJ A;  1W28 A;  3U0Z A;  1LU2 A;  2E31 A;  3FL7 A;  3MPP G;  4U2A A;  4CEW A;  1AYM 2;  1QOS A;  3AZW A;  1GZC A;  2DUP A;  3RRD A;  3B3Q E;  3WT3 A;  4I02 A;  4AVV A;  2XJT A;  1Z7S 3;  2O14 A;  4AQS A;  4QWN A;  5J96 B;  1B35 B;  2PHD A;  5FJH A;  3JCI A;  1W0N A;  3M3I A;  5GLU A;  4W6W A;  3KV4 A;  1WMF A;  1YCI A;  2VPV A;  4IGP A;  4QDS A;  5DAW A;  1C8M 3;  4B1L A;  4RA0 A;  1NCR B;  3IMN A;  1RYY A;  2JB4 A;  4YGB A;  4O9E A;  3S7E A;  1XE0 A;  3SKJ E;  4HXC A;  2IXL A;  1UMI A;  4UT5 A;  5CKQ A;  1W9Y A;  1VBD 3;  2VL4 A;  4M3C E;  1IQA A;  1HB2 A;  2V4A A;  2VVF A;  5KC6 A;  4NAO A;  4AQT A;  3WUD A;  2P34 A;  3K48 A;  1MS8 A;  3NKG A;  3AYD A;  1K45 A;  4YAR A;  5FPU A;  4IUG A;  1CAX A;  2G9F A;  1W2A X;  1SLC A;  3HWJ A;  3ON7 A;  5CNA A;  3USU B;  5IVB A;  3LEM A;  2ES3 A;  3LDR A;  4AFD A;  4W4Z A;  3ZYH A;  5T5P A;  1O6U A;  1REE A;  2ADD A;  3BCW A;  4HET A;  4P14 A;  1UYX A;  5FZB A;  3TNQ A;  4UAP A;  5JSP A;  2AEZ A;  2Q1Z B;  2ZEZ A;  5H9P A;  4AQ6 A;  4B7E A;  2D3P A;  1FMD 2;  1ULO A;  3QOP A;  3HEI A;  3WQ0 A;  4IEX A;  1PO2 2;  1G9C A;  2EIB A;  1F9K A;  5B4X A;  1YLL A;  2QUO A;  1H6Y A;  4QQP A;  2RM2 1;  3WQ7 A;  2E7A A;  2VZT A;  4K8F A;  3KB5 A;  4LBK A;  4OUM A;  4LNV A;  5HPO A;  3FX3 A;  1YQ6 A;  4A42 A;  1F4A A;  1PM4 A;  2IXC A;  2MPF A;  4XJW A;  3JQW A;  4R4Z A;  5JOW A;  1ONA A;  3CIH A;  4FTB A;  2WYF A;  3BVC A;  3FLP A;  3KGL A;  4E4D X;  1W0P A;  2KD7 A;  3N9M A;  2D93 A;  5KWR A;  4XCB A;  2PHL A;  5ANN A;  4FCA A;  2WIN B;  5AVA A;  5L9B A;  5ACA 1;  1U5X A;  2R30 A;  1NYW A;  4GJZ A;  4BXF A;  2F17 A;  2ET7 A;  2R04 1;  4MH0 E;  2JG8 A;  5J48 A;  3BOW A;  2ARA A;  2OXB A;  1Y9M A;  2GNB A;  3AYA A;  3LFI A;  2CV6 A;  1ALY A;  3SCF A;  1HDK A;  4FSJ A;  4ZU5 A;  2H0B A;  4CDX A;  4YZ1 A;  4LUK A;  1VBB 3;  3Q9O A;  4W6Y A;  5FZM A;  5T50 A;  4Q4Y 3;  4A7K A;  2QQN A;  3A22 A;  1UF2 C;  2UUR A;  1SDD B;  3KCX A;  2VM9 A;  4YVW C;  2BV4 A;  4HKW A;  3RMY A;  5L7O C;  4QB2 A;  4AXO A;  1H30 A;  5FPB A;  3HNM A;  4HN0 A;  2W91 A;  4ZS3 A;  5JZG C;  3S5Q A;  2J7M A;  3GNE A;  1I3H A;  3CLP A;  3CMG A;  4HL0 A;  4D6Q A;  5BNO B;  2GNT A;  4EN7 B;  2BBA A;  1IOA A;  4JRL A;  4NE9 A;  3K4A A;  2YU2 A;  1OD3 A;  1CN1 A;  1YQ8 A;  2XJQ A;  3WVJ A;  1VBA 1;  5LRS A;  2QBX A;  4QXB A;  2XLF A;  5IW0 A;  3VZK A;  1S2K A;  4YSF A;  1RTV A;  3JD7 2;  2ZHK A;  4SLI A;  1I5Z A;  4XJ8 A;  4DPN A;  2VTX J;  4N9H A;  1MQT C;  1COV 3;  3V0B B;  2HWD 2;  1GWL A;  3DL3 A;  1G6N A;  4AW7 A;  4AHW A;  1R1A 3;  1UY4 A;  4GMP 0;  4M4R A;  2VNR A;  2E53 A;  2ATF A;  3HT1 A;  5FBJ A;  4JRA A;  4R4X A;  1W9F A;  4XFH A;  3VHP A;  1BBT 3;  1WLD A;  4ZY9 A;  5FZL A;  3VBR C;  5A6Q A;  4QQH A;  2AC1 A;  1XYN A;  5FR3 A;  4CDW B;  4JQR A;  4FPG A;  2IC1 A;  1BK0 A;  1XE8 A;  1VRH 3;  1SCR A;  4KG8 A;  3RWK X;  4Z2A A;  1VBE 2;  5I91 A;  3C7G A;  2ZGN A;  2RS5 1;  4KWJ A;  5LK5 A;  3LA3 A;  4UF0 A;  3I8T A;  4KG0 A;  4XAC A;  3RZG A;  1CZT A;  5F9T A;  1AR6 1;  2ILM A;  5GAL A;  5A70 A;  2KM2 A;  2JG9 B;  2GP3 A;  2CU5 A;  1GQP A;  5IFP A;  2CL2 A;  1G9D A;  2UU8 A;  4RR3 B;  2QCS B;  4BMB A;  1UIK A;  2R06 2;  1W8Z A;  5K0U C;  1N3P A;  1W03 A;  1EPZ A;  2VZ1 A;  4FPY A;  1XU2 A;  5T5J A;  5B2G B;  1LHV A;  2VME A;  1IKP A;  4EZ4 A;  2EXH A;  1B35 A;  3H1Y A;  5FTT C;  2Q8D A;  1UU4 A;  2RMU 1;  2WUH A;  5A3L A;  3VKM A;  1VE0 A;  3CEW A;  1ULC A;  3RVH A;  4QXH A;  2DF7 A;  2VZS A;  1CZV A;  5JXJ A;  3ZFF B;  4Q4X 3;  4GKX A;  1RUO A;  1CD3 G;  2ZGQ A;  1Q5O A;  2ZAC A;  5FZA A;  1VAM A;  2XGX A;  5IVV A;  2JD9 A;  2XLG A;  1EAH 2;  5BNN A;  4XW3 A;  3AXD A;  4A41 A;  3TEZ A;  4XUP A;  3SEE A;  3FE5 A;  4YVS B;  4MX3 A;  5F5C A;  4QPG B;  2Z79 A;  3USU A;  2OZJ A;  5FK7 A;  1RUE 1;  3E1F 1;  1C28 A;  3TN9 1;  2WS9 3;  3AMN A;  5F6L B;  2QJV A;  1ZZ8 A;  3CZJ A;  2X8K A;  1AR7 2;  3VZO A;  5BY5 A;  1O3Q A;  2D7F A;  3POS A;  3B5L B;  1GYK A;  4YZ5 A;  4NRQ A;  1ACC A;  2AUY A;  2BWA A;  2OA2 A;  4HN1 A;  5IAV A;  2R16 A;  5F37 A;  2B9V A;  1YHF A;  5FZ0 A;  2HH9 A;  4LKF A;  1W2U A;  4AGG A;  3ZXD A;  4GH4 B;  1R09 1;  2A73 B;  3ZSM A;  4R9D A;  2JDA A;  4QT6 A;  3PVB B;  4Q4W 2;  5FMO L;  3RMX A;  5HCH A;  1ZNP A;  3POB A;  1FAT A;  3FUQ A;  5FYY A;  3ENR A;  3IPV B;  1TMF 1;  2W0X A;  1CJD A;  4XAE A;  4FFH A;  2R49 A;  2XJV A;  4XF3 A;  2BRT A;  1ASJ 3;  4BQ3 A;  5FPV A;  3OBZ A;  2WAA A;  3O0W A;  2WT1 A;  3BTZ A;  3U37 A;  4N7U A;  5IVY A;  2VTX A;  3CZU A;  5C5T A;  1OKQ A;  4Y5T A;  3POF A;  3ZXL A;  2CDO A;  1GWM A;  2E63 A;  3MIF A;  1REF A;  2HWE 1;  4I09 A;  4Q1R A;  2WLP A;  3PIG A;  1VMH A;  5A6Z A;  1CWP A;  1ZBA 2;  1QJY 3;  1J1T A;  1WCQ A;  4OHW A;  5FZ8 A;  1XYO A;  4IV1 B;  3WDX A;  4BQ4 A;  4AI0 A;  1NKG A;  4A6S A;  5BNO A;  4PHZ A;  5JMC A;  4N53 B;  2LTN A;  1XB9 A;  2A3X A;  2JDH A;  1YO8 A;  4GQ7 A;  1GU3 A;  1D2Q A;  1GNY A;  5DG2 A;  3WQB A;  1UNB A;  2ZGM A;  4XF4 A;  2JIC A;  4JHT A;  1JZ8 A;  3LKJ A;  1F5F A;  1XE7 A;  4MAD A;  4A4A A;  2VVE A;  1FNZ A;  4RHV 3;  1KD7 A;  1PIV 3;  3FMG A;  3KM5 A;  3UKT A;  2C5D A;  1O3S A;  3Q8E A;  5I93 A;  1AUY A;  2W47 A;  3B9I A;  4MGZ E;  4RHV 1;  4S2H A;  5KBF A;  2WNU B;  2X5I B;  3V0B A;  4NVP A;  2JKX A;  5E1R A;  4XFA A;  4C0B A;  4NHL A;  4CCO A;  1RUG 3;  5C9A C;  4HVR A;  3SNM A;  2DUO A;  2YPD A;  1LOB A;  1NQD A;  4XTM A;  5FXW A;  3C2U A;  1AXK A;  4BCU A;  5AC9 2;  2GP5 A;  1WZX A;  3BKZ A;  3VZM A;  4EN8 B;  3U1X A;  1RUF 3;  3MLK A;  4FPL A;  5K4L A;  1YUD A;  2C4X A;  4DXZ A;  1U5Y A;  4HPK B;  1HN0 A;  5LB6 A;  1VRB A;  1RUF 1;  1ULE A;  2YMZ A;  2K2S A;  3I2I A;  4JHZ A;  1XNB A;  5FUI A;  4ZKT B;  1H8V A;  1RUC 2;  2RS1 1;  2XL7 A;  2WT0 A;  1SLA A;  4HMZ A;  5LA2 A;  1OA4 A;  5EV7 A;  2IVI B;  1Z7S 2;  2JG9 A;  3ZXE A;  4NRP A;  2PXJ A;  3MHZ A;  1RIR A;  2PHW A;  4RR3 A;  3HVD A;  3VBO C;  1YQC A;  3GXU A;  4B7K A;  4DIN B;  1C8M 2;  2FMD A;  4AI8 A;  1HRV 2;  1MZ6 A;  4ISQ A;  3U11 A;  4HON A;  2V4V A;  4M0N A;  1W8T A;  1WME A;  5EFU A;  1FPN 2;  1TME 3;  1RIN A;  1DF0 A;  1VBD 2;  4LBQ D;  4BIO A;  3ZKY A;  3WXP A;  1STM A;  3NRU A;  1X33 A;  1GP4 A;  2DDU A;  2YRO A;  1FI2 A;  1JN2 P;  4KWL A;  3ZXA C;  2YDE A;  3TBD A;  2P6H A;  1UMZ A;  2UWC A;  2F4P A;  1MS1 A;  1TEI A;  2YGL A;  2R32 A;  2WFP A;  3JBG 3;  2VCM A;  3TWI A;  5KXE A;  3QBQ A;  4Y4Y A;  3DXU A;  1XQN A;  3SLI A;  4BOW A;  1PM7 A;  4DFS A;  5KR7 A;  1CAV A;  2O0O A;  3JBG 1;  5A3U A;  5FZ3 A;  1R08 1;  4YVS A;  1UYZ A;  1APN A;  2ZAH A;  5DQ0 A;  2XUE A;  5BNN C;  2BNN A;  5FZI A;  2HEY F;  1OXC A;  1XBF A;  2HEW F;  1JYC A;  4WBB A;  3WZ1 A;  2VUL A;  2R1D A;  2WNV C;  2RS3 1;  2W87 A;  3R4D B;  4MET A;  1N47 A;  3MIE A;  2BU9 A;  3WUC A;  5BYN A;  1OFS A;  5E89 A;  3TRS B;  2P5B A;  4LEJ A;  4PBP A;  4D94 A;  4GH4 A;  1VAL A;  5BUV A;  1EUU A;  2VUD A;  4IQP A;  4AAP A;  4HK8 A;  2QDR A;  4NHY A;  5BNP B;  2P3I A;  1AJO A;  1QGL A;  2YC0 A;  3AVR A;  3LEK A;  3LSD A;  2WFF 3;  2P3K A;  1O3T A;  4AR2 A;  2UYA A;  4CCC A;  3IPV A;  4LHS A;  1JBC A;  4PDW B;  4XBQ A;  3V65 A;  1VBB 2;  2PQQ A;  5A32 B;  4EWE A;  4Q4Y 2;  2V5Y A;  1IQD C;  4IE6 A;  2SBA A;  3I2D A;  4KQ7 A;  4B8E A;  1OQD A;  4WM8 C;  4QHO A;  3LOB A;  2NN8 A;  3KHC A;  2EIG A;  2WO2 A;  5KHH A;  5C71 A;  4PJY A;  3ZDS A;  3H8R A;  3DYM A;  4ITC A;  4FVV A;  3AX4 A;  2MNG A;  4IW3 A;  4BZ4 A;  1LNS A;  1OA3 A;  5FZ4 A;  1HQW A;  1YI7 A;  1UZZ A;  5FLH A;  2PMW B;  2VJX A;  1C3H A;  1UY3 A;  3WF3 A;  3ZFE C;  4IV1 A;  1RUH 3;  2WQZ C;  1ODM A;  3MW2 A;  1H9P A;  3LDB A;  4N53 A;  2QDN A;  4DUW A;  3QLQ A;  1ZYB A;  5FP7 A;  4RL7 A;  2HWB 2;  1COV 2;  4ZXE A;  1KIT A;  1WKY A;  3OPZ A;  2Y6J A;  1ENR A;  3III A;  1S0I A;  4QGM A;  3ZMN A;  4B4P A;  3LFM A;  1FYU A;  1R1A 2;  2EAK A;  1W6P B;  4OZO A;  4DNY A;  4YGE A;  1AR8 3;  3B93 A;  1IHM A;  3ZYB A;  1TZO A;  5JMO A;  1ZZ6 A;  1DGL A;  1BBT 2;  5FP9 A;  2ZGR A;  1AYM 1;  3GM8 A;  2D6M A;  2X5I A;  3GGL A;  1UXZ A;  3OYW B;  1QH6 A;  1VRH 2;  4RGK A;  1CES A;  1WA4 A;  2QQV A;  3EYP A;  3Q8B A;  2P2K A;  2VU9 A;  2VUC A;  3SC7 X;  3VDC A;  3UGG A;  1OHF A;  2W9X A;  5EXO A;  5GLZ A;  3ZN6 B;  1VB4 A;  2V73 A;  3ACG A;  3RGB A;  2W1W A;  3M3Q A;  3MF6 A;  5E8A A;  4HPK A;  2D6O X;  3SCG A;  3R4S A;  4KU8 A;  2VC9 A;  2VMI A;  3MW4 A;  4MGS A;  1WCS A;  1Q8V A;  4MO3 M;  4QD2 A;  1W8H A;  4CDU C;  1LOD A;  5FZ1 A;  2OS2 A;  4XZU G;  5H9S A;  2BWC A;  3IWZ A;  2Y8K A;  4L97 A;  3VGI A;  1DU3 D;  4BWO A;  2GAU A;  1BYH A;  1PVC 1;  4Y20 B;  2HWC 3;  2RDS A;  5FYM A;  2OT7 A;  1OF3 A;  3WY6 A;  1LUL A;  4CUC A;  4GIQ A;  2PLV 3;  2ZGO A;  4D7T A;  5L36 A;  3ZN5 A;  4Q4X 2;  1FMD 1;  5EP9 A;  1QJU 1;  2VBP A;  2WO7 A;  2D6L X;  2E33 A;  2WZR 1;  2PLV 1;  2A71 A;  5LBF A;  4NAM A;  5AFB A;  3ZSJ A;  2XKP A;  3PTR B;  1POV 1;  4CVU A;  4CXY A;  2CAV A;  2Y26 A;  1HXS 1;  4YG0 A;  5CFC B;  1JMU B;  3E6B A;  2H6C A;  2DCZ A;  5FUN A;  1HB3 A;  3LD8 A;  3I97 A;  3SXW A;  4LO4 B;  3WP4 A;  1K42 A;  4BHP A;  2DTW A;  1IG3 A;  2RG4 A;  2PAK A;  1PO1 3;  1IS4 A;  4Y24 A;  1YXW A;  4IEU A;  4LPL A;  1UOF A;  2BER A;  2FCT A;  2WS9 2;  4I0A A;  4RD7 A;  1S4C A;  3ZFG B;  4FXK B;  1RHI 2;  4Q29 A;  3VBS C;  2IXI A;  1PGW 1;  3LEI A;  3J9S A;  1H4H A;  3T3Y A;  3DPR B;  3MO4 A;  4CXW A;  1US3 A;  1ZZC A;  2IXK A;  1AL2 3;  5CFD B;  5F3I A;  4YVS C;  1JYI A;  4Q4V 1;  2VG9 A;  3H7Y A;  4XAA A;  1DQ1 A;  1C8N A;  3THT A;  3WDT A;  3V0A B;  3HNY M;  1KDM A;  4LBL A;  5AVP A;  4N90 A;  4P5H A;  1PMI A;  4PBO A;  3JB4 C;  3POE A;  3N7K A;  4WZF A;  2VZU A;  4S2D A;  1SMV A;  1V9U 3;  2VOV A;  2MEV 3;  1ASJ 2;  3AZY A;  5BNP A;  5J36 A;  2Q8O A;  1ND3 B;  4MVT A;  1O8P A;  2N7G A;  1J3Q A;  1W8F A;  1QMJ A;  2PHR A;  2QQL A;  4K3U A;  5D1I A;  1QQP 2;  2RDQ A;  5FMD A;  4IV3 C;  2FBE A;  3NMB A;  5A32 A;  4GWI A;  2WZE A;  5DG1 A;  4EZH A;  4DB5 A;  3L9J T;  3VHO A;  1VMF A;  2IXJ A;  4CPB D;  1OKO A;  2VMH A;  4QDR A;  4HKL A;  4D3W A;  3VDD C;  1UD1 A;  4N43 C;  4XCA A;  1MZ5 A;  1SBE A;  3OBR A;  4UFI A;  1H4G A;  4LE4 A;  2EIE A;  2GC0 A;  4YM0 A;  3THC A;  5BV6 A;  5EJ3 A;  1H2L A;  1YFY A;  2E32 A;  1HRI 1;  3GJB A;  4GZ9 A;  4H55 A;  4I3P A;  4OLL A;  5LA9 A;  3A7Q A;  1PIV 2;  3FWE A;  3IDA A;  3W58 A;  3PU3 A;  4LIT A;  1XNA A;  2FHR A;  4ONU A;  1YJL A;  1CR7 A;  3MPB A;  2HWF 1;  3NJY A;  3T4H B;  2XVL A;  1UZW A;  3BPZ A;  1NXD 1;  5FPZ A;  1RUG 2;  1W6P A;  3I59 B;  4IEY A;  4CTE A;  3R4U A;  1U12 A;  1HJG A;  4N53 C;  3DKW A;  1YNA A;  1UZV A;  2J22 A;  4L9B A;  3WF0 A;  4OUL A;  3DYP A;  1UYY A;  3J8F 3;  4XMA A;  2WA4 A;  3NAP C;  3ES1 A;  4NID A;  3HBZ A;  1AX2 A;  3OYW A;  4N8M A;  3CU7 A;  3VBU B;  1FT9 A;  4CCM A;  1V00 A;  4JV4 A;  4B1M A;  3W5N A;  3WP5 A;  5A1L A;  2P4E A;  5CAD A;  1WGP A;  4LIU A;  1BCX A;  1JU4 A;  3LA7 A;  3L2Y A;  3MDP A;  4UW6 A;  3ZN6 A;  4WZC A;  4W8J A;  1SLL A;  4RQP A;  5FY1 A;  1NOV A;  1ZZ7 A;  3NNJ A;  3O5S A;  2RVA A;  3TEW A;  4YW5 A;  1XRU A;  5FZ6 A;  4LBO A;  1HB4 A;  3LQC A;  4IEZ A;  3EBR A;  1V6I A;  4DO0 A;  4DS0 A;  1IGO A;  4XFI A;  1LOF C;  1BEV 1;  2BP6 A;  2EID A;  1H0B A;  4ATE A;  3FLT A;  4NWV A;  4Y22 B;  4GA9 A;  1H8T B;  3X29 B;  3HQU A;  4NIH A;  3KVA A;  1D4M 3;  4ASK A;  3D0S A;  2BUK A;  4XIO A;  2E51 A;  2O8Q A;  1SEF A;  5T3N A;  3M8L A;  4CYD A;  1VBC 3;  4GMP 3;  1RMU 3;  1TME 2;  1HLC A;  2QKD A;  2ZX0 A;  2YB7 A;  4Y20 A;  3RYP A;  2FDG A;  1SPP B;  2JWP A;  1RMU 1;  3IZO A;  2WN3 A;  4IGQ A;  4FOQ A;  4HK9 A;  2RR1 3;  1XNK A;  5SV8 A;  1OUR A;  2A75 A;  3PJQ A;  4NOT A;  3I2K A;  3LIH A;  3ATG A;  5C6C A;  5CFC A;  5FZC A;  3PVO A;  5FPX A;  1EY2 A;  1RB8 G;  4UWD A;  2A5Z A;  4QHZ A;  2XBO 1;  1V0A A;  4IEV A;  1YRZ A;  4QX0 A;  1ST8 A;  4IXL A;  3VBH B;  3ZXK A;  3ZXF A;  3K3O A;  5D8A B;  2ZAA A;  1CIY A;  3A23 A;  5FAX A;  4EN0 A;  3N9O A;  5HV4 A;  4FOW A;  3DXT A;  1UL9 A;  1IPK A;  3ROU A;  1JZ6 A;  3KV6 A;  3F95 A;  5G05 L;  2VD7 A;  3CNA A;  4OHV A;  1L7Q A;  1TQ5 A;  1RVF 3;  3BTX A;  3AP9 A;  1K5M B;  1OSG A;  2ZOE B;  5FO9 B;  1S0C A;  5CFD A;  1JZ2 A;  3I7D A;  1AJK A;  1KXG A;  2Y6H A;  1EPW A;  1L7R A;  2G19 A;  5FYU A;  2DVA A;  3V0A A;  1JYX A;  3E6C C;  3AXE A;  1X8M A;  1OMI A;  4M00 A;  5I8T A;  1J3R A;  1AR9 3;  2WFF 2;  4S2F A;  1W2T A;  1CQ9 A;  2GN7 A;  5FZE A;  4KNC A;  3NJX A;  1OC1 A;  2P3Y A;  5I8S A;  1PNF A;  3OF1 A;  1HKD A;  3ACL A;  2FZ1 A;  2I2S A;  4ZZ5 A;  4Y1V A;  4OQ9 A;  1JZ5 A;  1GIC A;  3DYO A;  3QH7 A;  1ND3 A;  3D4K A;  3GCX A;  2RJL A;  1J1L A;  5IWF A;  3SQO A;  5JOZ A;  3GCW A;  2K9Z A;  5FPA A;  1EV1 1;  1ND2 C;  2PTM A;  3LF7 A;  1JZ4 A;  2DUQ A;  3IN9 A;  1C5I A;  3UJO A;  2XL9 A;  3S7I A;  5JLV A;  2BTV C;  4CP9 B;  3I2H A;  3CQO A;  4OYU A;  1W6Q B;  2LUW A;  1HB1 A;  2CGN A;  2XWJ B;  4CEY C;  4XYX A;  4AVT A;  1QDC A;  1LGB A;  4HLT A;  3M1H A;  2D97 A;  3IDB B;  3WW1 A;  3IMM A;  3GDB A;  2VW2 A;  2R07 1;  3HN1 A;  1NUK A;  2CDP A;  5KXD A;  4QPW A;  4GB3 1;  3QD6 A;  1MS4 A;  2OPW A;  3VKO A;  1YI9 A;  2ZX1 A;  1I9R A;  2BNM A;  3KGZ A;  4LLO A;  5I0D A;  1QIQ A;  5DDJ 1;  4AVA A;  4AVS A;  1RED A;  1W6M A;  4CCL A;  2D98 A;  2BDR A;  1JW6 A;  4K21 A;  4ZU4 A;  3T09 A;  4OI4 A;  3I59 A;  4L0P A;  5T54 A;  1M4W A;  2Q1M A;  3K75 B;  3KF3 A;  3USS A;  3M4F A;  4XDQ A;  2A3Y A;  3VDA A;  1W0O A;  1OI6 A;  1HRV 1;  4I01 A;  2RM2 3;  1D0G A;  2XQX A;  4MGT A;  1LHN A;  3H8U A;  4OUE A;  4LO5 B;  2GME A;  3VBU A;  2VQU A;  2CYF A;  1DQ6 A;  3VZL A;  2ZJC A;  5HI0 A;  1MEC 3;  4W50 A;  1RUI 1;  2QTW B;  4MGQ A;  4UOJ A;  3AM2 A;  4WM7 B;  2DVB A;  5JOX A;  1MEC 1;  2X53 S;  4FPJ A;  3ACF A;  2BEO A;  2IWG B;  1U0A A;  2BPA 2;  4J1X A;  2J1S A;  2R0F A;  5ACA 3;  1TE1 B;  2CAU A;  2VCA A;  1RXG A;  2R04 3;  3WW2 A;  2LW8 A;  3OJB A;  1WW5 A;  4L11 A;  5JXI A;  1H1M A;  4RQP C;  5FKB A;  4EYU A;  2Z69 A;  4Y1Z A;  5C4W C;  5ABJ B;  5FOB B;  5IYY A;  4CA9 A;  2HWC 2;  3KV9 A;  1SLB A;  1NXM A;  1H8T A;  1Q8S A;  2XVK A;  4Y22 A;  3ZSE A;  3BOD A;  2B42 B;  2YV8 A;  1HX6 A;  3ACI A;  3ILN A;  5F1R A;  2GU9 A;  5FZH A;  3PNA A;  3IB3 A;  5A3T A;  2EXI A;  4AHZ A;  2YZ4 A;  1SPP A;  3NV1 A;  4TLG A;  4DZG A;  5CIS A;  1NA1 B;  4J1W A;  3C7H A;  5JPN B;  3K4D A;  1RL3 A;  2EXJ A;  5T52 A;  3UT0 A;  4BME A;  5C7G A;  2E7T A;  3CO2 A;  1OLQ A;  1AX0 A;  2WRA A;  1C5H A;  1O4Z A;  2OPK A;  4XXA A;  4YW3 A;  5C8C B;  1LHW A;  1VBA 3;  1D4V B;  5IVE A;  1W99 A;  5JDB A;  3GJA A;  4PLN A;  3BB6 A;  1PO1 2;  3E5X A;  1Z0H A;  4CDQ C;  5CKN A;  1LES A;  1Q43 A;  3AYE A;  1DGW A;  5A33 B;  5LZ6 A;  2TBV A;  1UKR A;  1LRH A;  3VKF C;  5IVJ A;  2FDF A;  3WEZ A;  5FZG A;  2YGM A;  2AGS A;  3MF9 A;  4XQD A;  4TLF A;  3VBH A;  2XXZ A;  2JDY A;  3O14 A;  5A3W A;  4AEJ A;  5CFC C;  5M0T A;  1DQ4 A;  4JGZ B;  2ZKL A;  5D8A A;  4YGD A;  1CPM A;  5F3C A;  1AL2 2;  3R6S A;  1W9S A;  2ZGU A;  4Z92 B;  3HT2 A;  2JXA A;  2ARX A;  2QQM A;  4QX3 A;  1F35 A;  1WLT A;  2B5H A;  4N9I A;  1K5M A;  1NZC A;  4Q0P A;  5FRE A;  3WNX A;  2Y60 A;  3LIG A;  5IT6 A;  3I49 A;  4HBN A;  2RS5 3;  1V9U 2;  1OQ1 A;  2PYT A;  3B00 A;  4XZP A;  3GBG A;  4XMI A;  1X8E A;  2MEV 2;  3AJY A;  4LLF A;  5FXV A;  3LGR A;  4LHN A;  1AR6 3;  2F4L A;  4XJ9 A;  2GMP A;  5H9Q A;  1S1A A;  4XFG A;  3N7M A;  2QVS B;  4M0H A;  4IEW A;  3PVE A;  4COY A;  2HWB 1;  2XWB B;  3PUR A;  4YW7 A;  2G9G A;  3NWK A;  3E97 A;  3N4M A;  2XJP A;  3GYD A;  3ZR6 A;  1A3K A;  1GR3 A;  2VOX A;  3PTY A;  2D3R A;  3GZE A;  4NPL A;  2W1Q A;  4XUN A;  3E5U A;  1IZ3 A;  2HBT A;  2RMU 3;  2J1T A;  4CZS A;  2C24 A;  3UV9 A;  1ZBE 1;  1NT0 A;  5JI7 A;  2ZEY A;  4TWT A;  5ERL A;  4CUA A;  1SQ4 A;  1DFQ A;  2QQK A;  1V6M A;  1UZY A;  4EJR A;  1W6Q A;  4CEW C;  3O1U A;  4ZZ8 A;  5H9R A;  3EMR A;  2GC1 A;  5T5L A;  3ZXJ A;  1NCR A;  1UXX X;  4AHY A;  3T1M A;  4BQ5 A;  4LXL A;  1PGL 1;  4Z8B A;  1GKB A;  4QGL A;  3THP A;  1GOH A;  1UY1 A;  1CZS A;  2OKX A;  2O8O A;  4DMI A;  3ZIW A;  4XJA A;  4A3X A;  1KEX A;  1JOP A;  2G4I A;  1BVP 1;  1RUE 3;  3TN9 3;  1NE4 A;  4LKS A;  1W2O A;  3J8F 2;  4OFG A;  3JUU A;  3U4S A;  4DOU A;  3TNP B;  1BMV 1;  4E9K A;  4XOG A;  1RUD 2;  3S5A A;  3PIJ A;  1K12 A;  1BLZ A;  2B8M A;  4FP2 A;  5KHI A;  3WNM A;  4JGY B;  2C26 A;  5EIY B;  2OQ6 A;  3DUI A;  1NY7 2;  3HIF A;  5LY1 A;  1A8M A;  5CG9 A;  4XJU A;  4R9A A;  5KHK A;  3U78 A;  1OLR A;  1R09 3;  5HCB A;  3P5B A;  2FDK A;  4ERO A;  3O0V A;  4P9W A;  1DGR A;  4Y5Z 0;  3INA A;  3H1W A;  3LWC A;  3ECQ A;  4NO4 A;  4KWK A;  3WG4 A;  4UXA A;  4Q8K A;  2XML A;  4FPK A;  4WM7 A;  1Q8Q A;  5DZE A;  1TMF 3;  5EPA A;  2BFU S;  2XJR A;  1QKQ A;  4NR1 A;  2AH2 A;  3ZYG A;  5KHG A;  2NYY A;  3OUJ A;  1T6B X;  4IET A;  3RZM A;  4RFR B;  1GZ9 A;  1D4M 2;  4LBQ B;  2WKK A;  2XON A;  3W9A A;  2RE9 A;  4BIS A;  2VOW A;  1VBC 2;  4YM2 A;  3I2O A;  3BTY A;  4DRR A;  3J4U H;  2X05 A;  3WSO A;  5ABJ A;  3G6J B;  3VD5 A;  4QQ2 A;  1RHI 1;  1AHS A;  3C7O A;  3OUH A;  2EF6 A;  2HWE 3;  4JKK A;  4QX5 A;  2RR1 2;  4OI1 A;  5DMY A;  4QB6 A;  2ZGP A;  4BQ1 A;  5A3O A;  1KFX L;  5IHR A;  2JG8 C;  5DUV A;  5FP3 A;  3WHT A;  1HW5 A;  4RGG A;  1XNC A;  4CDX C;  1UKG A;  4COV A;  5J1X A;  4ZU7 A;  3RQ0 A;  5CB7 A;  2YBP A;  1DQ0 A;  2WAB A;  2YC4 A;  1RIT A;  5C8C A;  4R9C A;  3BI3 A;  4DXS A;  1J58 A;  4R9B A;  5GM0 A;  1WW4 A;  4YWA A;  1NX9 A;  1G9A A;  3NST A;  2Q8E A;  1X7N A;  1Y43 B;  4TN7 A;  5C3S A;  5JPM B;  3U4X A;  1L7L A;  4PIY A;  5JVV A;  4I30 A;  3S6P A;  3VL8 A;  1AL0 G;  5JR2 A;  2D6N A;  1QQP 1;  3KVB A;  5FKC A;  1RVF 2;  1VB2 A;  3T2O A;  5CG8 A;  1ZZ9 A;  2LRO A;  2W3J A;  4JGZ A;  3VB9 A;  2QQI A;  1BQP A;  3DN7 A;  4KI5 M;  3AZV A;  2ZMK A;  4LMF A;  2JDK A;  2RDR A;  1XU1 A;  1NCQ B;  4V2W A;  3WW4 A;  5DN2 A;  5KXB A;  4QX1 A;  3DGT A;  1Q56 A;  5FOJ B;  1CIW A;  2TUN A;  3WG1 A;  1AR9 2;  1XSR A;  4CDW A;  3WF4 A;  1GOG A;  3RZJ A;  1JOB A;  1SFP A;  3BOP A;  2XQR A;  1Y7B A;  4E8C A;  1NLR A;  4ASL A;  4XFF A;  3AMQ A;  4GKY A;  3WDW A;  3B01 A;  1VAV A;  2ENR A;  1NAE A;  4CCK A;  3RSJ A;  3WIN E;  5I0R A;  3K4Z A;  2XB6 C;  2RS1 3;  1KDK A;  1MZF A;  2UWB A;  4URT A;  5EJZ B;  4PF5 A;  3BIW E;  1C1F A;  4FT8 A;  2QQO A;  2XJU A;  2W1S A;  3BN6 A;  4YZ4 A;  5FYS A;  5HXV A;  3I3B A;  1KS5 A;  1GQH A;  1DQ5 A;  1LR5 A;  1OOP B;  2DCK A;  4HVO A;  3PUH A;  4K6B A;  5JSO A;  1OPM A;  5CA6 A;  1HIX A;  2WAO A;  4XUR A;  4YG3 A;  5F8P A;  4HSJ A;  3MYX A;  4AK3 A;  5E88 A;  5DZF A;  3ZYI B;  4D7Y A;  3P3N A;  4XUT A;  3MIB A;  3NNM A;  1Y4W A;  5D21 A;  2JEN A;  5L9R A;  1S0D A;  3CHX A;  2FMY A;  3KHB A;  3UKV A;  1K3I A;  3FBY A;  1KGY A;  3QCW A;  4MG2 A;  3HMY A;  2L9L A;  5GKA C;  2AEY A;  3U75 A;  2Y6F A;  1ENQ A;  3ZFF A;  3TEY A;  5GLT A;  3M3C A;  1B35 C;  1H2N A;  1YJK A;  3DF0 A;  3PUI A;  3RI8 A;  2VEC A;  3HNB M;  3IKW A;  4C8D A;  3MV1 1;  1QJX 1;  4JDN A;  1LHU A;  2W5F A;  3BU0 A;  2O1Q A;  3SKV A;  3HQX A;  1R08 3;  1NCR C;  2XJS A;  1O7F A;  3M70 A;  3VBF B;  1AYN 1;  3WNP A;  1X82 A;  3UKN A;  4NPM A;  4QPG A;  1F2N A;  4LO8 A;  2VZQ A;  2RS3 3;  1ZRF A;  2RM2 2;  3ABZ A;  2J1U A;  2JJ6 A;  2WL1 A;  4RS5 B;  1C57 A;  2JKB A;  4J6G A;  1IPJ A;  5HCF A;  2JIG A;  4W65 A;  4X6R B;  4JGY A;  5EYX A;  1FOD 3;  4GD4 A;  3MEP A;  1TG7 A;  1QH7 A;  2GDF A;  4PT6 A;  2ADE A;  4MHR A;  4XQW A;  2W94 A;  4P02 B;  1FOD 1;  2HKX A;  4OHZ A;  4BB3 A;  1UPI A;  4FQZ A;  1Z78 A;  2UY8 A;  2DFB A;  2LS6 A;  3CKH A;  4AED B;  4DUX A;  1JHJ A;  3ZLI A;  1XNT A;  4IE7 A;  4AE2 A;  5ACA 2;  3PVN A;  2R04 2;  3TYJ A;  4MGY E;  4V1P A;  2CGO A;  2JX9 A;  1OFN A;  1OUS A;  3WD5 A;  1XOY A;  5LBC A;  1ULG A;  2GSY A;  1GSL A;  4M3C B;  4H7L A;  4BK4 A;  4LA3 A;  1YC6 1;  5FY0 A;  2A6Z A;  5FY7 A;  4LBQ A;  1PNG A;  2E9Q A;  3BU7 A;  4Y3O A;  2ORX A;  2AZ5 A;  2OII A;  2QQW A;  4MXW B;  2A1X A;  3URF A;  4QXC A;  4CCN A;  1O4T A;  4D8M A;  4NRO A;  1W05 A;  2A6X A;  1O8S A;  3JB8 A;  5FY4 A;  4Z07 A;  4QXK A;  1PK6 B;  2YFZ A;  4P9J A;  1WCD J;  5KHJ A;  2P1B A;  4LK7 A;  5A1A A;  5ABJ C;  2B4K A;  1VBA 2;  2DWR A;  3SH5 A;  2ERF A;  2JIJ A;  4SBV A;  5A7P A;  3ZYF A;  4BE3 A;  1H6X A;  2DTY A;  4JTO A;  5A7W B;  3T0B A;  5HXM A;  3SH3 A;  1LTE A;  1PMH X;  2DYC A;  5FIX A;  3VD7 A;  4MZU A;  4O7X A;  2BNO A;  4AF9 A;  1DZR A;  1RUJ 1;  2I74 A;  3EO6 A;  4NII A;  4TTG A;  4OI0 A;  2BGP A;  4XFC A;  2GH2 A;  3CBN A;  5IVF A;  3ZKU A;  2ZX4 A;  3WDU A;  3NO8 A;  2ZA9 A;  1JS9 A;  2Q4S A;  1LB2 A;  5EQU A;  2YBK A;  5C33 A;  4YNI A;  1DG6 A;  1AYM 3;  4FPC A;  5BNO C;  3IM0 A;  3O0X A;  2ZBJ A;  3EB7 A;  2E7Q A;  2WNU A;  4MOA A;  2XG3 A;  3W20 A;  3K46 A;  1PZ8 A;  4LR4 A;  5E16 A;  1UO9 A;  2VO5 A;  1NCQ A;  5FYH A;  1FX5 A;  5DXD A;  3WP3 A;  1X9P A;  4BQW A;  1MS9 A;  5F6K A;  5GLW A;  1AR6 2;  1C4R A;  3CDZ B;  1QEX A;  1W9W A;  5DZG A;  1ODN A;  5EHD A;  3RYR A;  2J1V A;  2WZ8 A;  5FQ0 B;  2PFW A;  5DUW A;  2K0G A;  3ZSK A;  4CDW C;  1NG0 A;  4NPR A;  4CE8 A;  1D7P M;  2WWS A;  2YU1 A;  4E2Q A;  5L19 A;  1YFX A;  1X9T A;  3KWV A;  2J1E A;  3IIA A;  1ZRC A;  1U5I A;  1UOG A;  4IE0 A;  3IT8 A;  4UFJ A;  2RMU 2;  1DYO A;  5FWE A;  2X09 A;  3WHU A;  4A6O A;  3WCR A;  1PVC 3;  1XPW A;  1W3V A;  4KBB A;  4XDP A;  5L73 A;  1JOD A;  4AI2 A;  1OOP A;  5IFT A;  2GH8 A;  1A34 A;  4FPH A;  1FMD 3;  1QJU 3;  3H1M A;  3LZZ A;  2WZR 3;  1X36 A;  4ASM B;  4QU1 A;  2YFU A;  1YIP A;  1S0B A;  3OGR A;  1Q8O A;  1POV 3;  1S55 A;  4KGG A;  2JG9 C;  2ZGT A;  3TB0 A;  2GZW A;  1HXS 3;  3KT7 A;  1PO2 1;  4O9G A;  3L2H A;  4LK6 A;  4RR3 C;  4UBH A;  3VL9 A;  2FDI A;  4NHX A;  1O59 A;  3RWN A;  3DV8 A;  3ZMO A;  2HYX A;  4YVW B;  1LOG A;  5FXX A;  3KT1 A;  2EXK A;  1V6J A;  4CCE A;  2VNV A;  5L7O B;  4IND A;  1UOB A;  2DVG A;  3AB0 A;  1RUE 2;  3TN9 2;  5JZG B;  2YUE A;  1CX4 A;  3N36 A;  2LAL A;  1H2M A;  5J09 A;  5IK4 A;  1B09 A;  2CWM A;  4C1X A;  4NUB A;  5IUQ A;  1DYK A;  5FMC A;  3ZFF C;  4HAN A;  1LED A;  1G7Y A;  3D82 A;  3PUQ A;  3VBF A;  3PU8 A;  2Y6K A;  4D7S A;  1OQE A;  2JEC A;  3AJZ A;  2A7A A;  2A3W A;  4LIV A;  3RDI A;  2ET1 A;  4RS5 A;  2YYO A;  2ZHM A;  1R09 2;  4JDO A;  4Q4V 3;  3Q8C A;  1X50 A;  1QXJ A;  3GHN A;  2VBD A;  1MQT B;  4BA6 A;  2DU1 A;  2Q30 A;  4NRM A;  4QPG C;  4BQX A;  4D69 A;  4QQL A;  1S2E A;  3AVS A;  1TMF 2;  4ET7 A;  5LCW L;  3K3N A;  4RFT 0;  3VBR B;  4QPI B;  4AED A;  1LGC A;  5JIU A;  3ZN4 A;  1ZRI A;  1KFU L;  2ZHN A;  3OBT A;  4ATF A;  4P08 A;  4BJ0 A;  4HSL A;  4GWJ A;  1H2K A;  1WMX A;  3KCC A;  4COW A;  2KA3 A;  3JD7 1;  4FFF A;  5FRA A;  3F2Z A;  4ES8 A;  4PDW A;  4GH4 C;  4RSU A;  2HWE 2;  1HJF A;  2W92 A;  1BKZ A;  4MXW A;  2D5F A;  4L99 A;  2CWS A;  3CJX A;  1U5Z A;  2HWD 1;  3ZX7 A;  2VUJ A;  1RJ7 A;  1UAI A;  2BOI A;  3AK0 A;  2WT2 A;  2ZXQ A;  3EJK A;  1PK6 A;  1QJY 2;  2W52 A;  2D3S A;  3KCY A;  5HV0 A;  1JYW A;  4TYS A;  1SFN A;  3SCH A;  2HEV F;  5K0U B;  3D6E A;  3I2F A;  5FYB A;  2D40 A;  1QOO A;  2RV9 A;  4GXL A;  3UL2 A;  1V6L A;  3VKL A;  1HRI 3;  2PHU A;  3KZ4 C;  2WC2 A;  5F5Q A;  5A7W A;  3T1L A;  1IS3 A;  4CP0 A;  4ZS2 A;  5L9V A;  3KLS A;  1VBE 1;  2VXJ A;  5A6Y A;  2WN2 A;  1GOF A;  4RHV 2;  1SDW A;  2HWF 3;  2ZZQ A;  2RHP A;  4Q27 A;  2FCV A;  4XQ4 A;  1OPO A;  2OYZ A;  1VJ2 A;  3OSD A;  4FXG B;  2HLE A;  2EAA A;  4IV1 C;  3SEP A;  4FOY A;  2W95 A;  3K77 A;  4Q0V A;  3WNL A;  1W39 A;  4CSW A;  4UFK A;  4X8P A;  4NWW A;  1N1S A;  1PVX A;  2R06 1;  3JXS A;  4KL1 A;  3N9N A;  1KJR A;  4G9S B;  1UW8 A;  4QGN A;  1NZI A;  5LA1 A;  4Q26 A;  1LEM A;  1RUF 2;  3ZDV A;  5IJR A;  5IAX A;  5LEK A;  2W1U A;  1BK1 A;  3PDQ A;  1P8J A;  4HFS A;  5EJ1 B;  5FZD A;  1MS3 A;  2VUA A;  3AKP A;  4FAG A;  4Q0Q A;  2DUR A;  2WNU C;  2X5I C;  3GBW A;  2RS1 2;  3TEX A;  2RJK A;  2WQ8 A;  2BGC A;  2VZV A;  2X29 A;  1R64 A;  4COU A;  2GNM A;  5EYY A;  2JDN A;  5F7U A;  3B9C A;  5EZW A;  3JU9 A;  4FI9 A;  4Y4R A;  1WW6 A;  4CPB A;  1BEV 3;  3OB8 A;  4EN9 B;  1EAH 1;  4PQQ A;  3ZXG A;  5FQ0 A;  1UX7 A;  1E57 A;  3N9L A;  1NQJ A;  5FY9 A;  4HG6 B;  4XUO A;  2P6C A;  2Y33 A;  4ZON A;  2VMG A;  5F39 A;  3W59 A;  2DCY A;  4KBZ A;  2H6B A;  1WWY A;  1UN1 A;  4JZR A;  1CAW B;  4IEP A;  2E26 A;  1E5S A;  1FXZ A;  1UYP A;  2ZGL A;  1OT5 A;  3OPW A;  4DXT A;  2SLI A;  3C7F A;  4FPE A;  3U10 A;  3JZV A;  4EV0 A;  1M06 G;  1DZT A;  4XE9 A;  3RPQ A;  1AR7 1;  2Q5T A;  3UET A;  3AKS A;  2OVU A;  3FHI B;  5DPN A;  3O1V A;  2WSV A;  4XHX A;  1OOP C;  3ME2 A;  3MID A;  2OW4 A;  4TXW A;  4LT5 A;  5F2S A;  2BVB A;  3UYJ A;  4J25 A;  5FZ7 A;  1UY0 A;  3JBG 2;  4Z2W A;  2XBO 3;  4QKB A;  3WG3 A;  1R08 2;  4QQO A;  4Q4W 1;  4LE3 A;  2QZ2 A;  2JE8 A;  3WW3 A;  1QNY A;  2GAL A;  3O12 A;  3I2G A;  1A6C A;  4CXX A;  3N3H A;  4KU7 A;  5JZG A;  4UFM A;  2RS3 2;  4EN6 B;  4XBN A;  3T0D A;  4P00 B;  1DCS A;  1DHK B;  3UJQ A;  4ARX A;  2VCC A;  2WWU A;  1G86 A;  3VN4 A;  3C7E A;  4P9L A;  3ZFG A;  5JR7 B;  4R52 A;  3WCS A;  3ZO0 B;  4XVH A;  2Q8C A;  5ISL A;  3O1O A;  1WLC A;  3Q8F A;  3DPR A;  5BXX A;  2YG0 A;  3AFG A;  2EA7 A;  1MQT A;  4FBF A;  2VR4 A;  3VBF C;  4Q5O A;  1GZW B;  1TNF A;  2ZGK A;  2BGO A;  4ZXK A;  2JDP A;  5LBE A;  4UFH A;  3U07 A;  5C9A B;  1ZBA 1;  1QHD A;  4Q0S A;  4MYE A;  5LK7 B;  4YZ2 A;  3VBR A;  3KQ4 B;  4QPI A;  3ZPO A;  3ORJ A;  5J3U A;  1QY4 A;  4JDM A;  3W21 A;  4YRD A;  4QPY A;  2D44 A;  3MIC A;  4MSV A;  3I4I A;  4ISR A;  3VD9 A;  4F8A A;  5HBA A;  1EV1 3;  3HOB A;  4LUM A;  4Y33 A;  3QAC A;  4LO7 A;  1AX1 A;  2WWJ A;  3H3L A;  4FQ4 A;  5FCC A;  3RZL A;  3AP4 A;  2YC2 A;  4W6X A;  2GN3 A;  4JAA A;  5BNP C;  4DUV A;  1PMJ X;  1ENX A;  3FJS A;  3NV3 A;  2V09 A;  1SG3 A;  5DAX A;  3WV6 A;  4URA A;  3WF2 A;  1BVV A;  2VZO A;  4PDW C;  4M3C F;  5GJ6 A;  2WDB A;  5AC9 1;  5FZ9 A;  3VBO B;  4DY5 A;  3LPG A;  1AXY A;  1RUH 2;  2R07 3;  3BTA A;  3N9Q A;  2BFU L;  3A21 A;  4R8H A;  5DAQ A;  5K0U A;  4GB3 3;  4IDZ A;  2PA7 A;  3VHN A;  3MV0 1;  3RYK A;  2ZEX A;  3WOG A;  3P6B A;  4E2S A;  2VZ3 A;  4F7Z A;  2NMO A;  4XHB A;  1N1V A;  2A6W A;  2PN5 A;  3HN3 A;  4O65 A;  5FP4 A;  5DDJ 3;  1RUC 3;  4C0H A;  5LW9 A;  1RXF A;  1AR8 2;  2YY1 A;  4XUQ A;  5C5U A;  3ZPY A;  3LDK A;  4JX0 A;  1S0G A;  2BW8 A;  1KQR A;  1RUC 1;  1VAK A;  5A7O A;  5IAT A;  2Q0A A;  3UNP A;  3OGJ A;  1ZA7 A;  4EE2 A;  1WCK A;  3FHQ A;  5LAS A;  4K8R B;  1Z7S 1;  5IK5 A;  3OY8 B;  1G8W A;  4CU7 A;  4ORF A;  5J37 A;  2W46 A;  2VH9 A;  1HRV 3;  3T2P A;  1Y9Q A;  1SCS A;  3OUI A;  1F8V A;  5LBB A;  1V6K A;  3H3U A;  1C8M 1;  1LOA A;  3H42 B;  5DUX A;  3WNK A;  1FPN 3;  4GAL A;  4P9I A;  1ZM1 A;  1YYN A;  3A0N A;  5BNN B;  3D0J A;  3ACH A;  4K40 A;  3IAQ A;  1RUI 3;  1FPN 1;  1MS0 A;  3LSE A;  2MHF A;  4BIF A;  4ES9 A;  3PUS A;  2WNV B;  3J7M A;  1DLC A;  1VBD 1;  3J7H A;  1W8N A;  1GAN A;  1Q3E A;  1GNH A;  5T55 A;  3POY A;  3C8X A;  1QOT A;  1DGR N;  4I0B A;  4YM1 A;  2PHT A;  4B4R A;  3T2Q A;  1BHG A;  3APB A;  3EQE A;  3OGG A;  5FY5 A;  5FZK A;  4PI2 A;  3BGA A;  2V5D A;  3SIS A;  3POJ A;  1LAJ A;  2Y0O A;  3RJR A;  4XET A;  1ZX5 A;  2ORZ A;  1PVC 2;  2NM1 A;  3O1R A;  3MGU A;  3NV4 A;  3QH6 A;  4YFZ A;  2P37 A;  5F2W A;  2V72 A;  3J7L A;  2YXS A;  3I3D A;  1KJL A;  1QJU 2;  4Q1P A;  4F83 A;  2WZR 2;  2PLV 2;  3LB9 A;  4IGO A;  2WBK A;  5JSR A;  4CCJ A;  2ZZJ A;  2Q1F A;  1CAW A;  4OZX A;  4AWD A;  4YW6 A;  1HXS 2;  3POW A;  3D5O A;  1UPS A;  2JE9 A;  5JI9 A;  1DDL A;  3LOI A;  3NJZ A;  4ZPI A;  4Z82 A;  3I3M A;  3CL1 A;  3R05 A;  2CHH A;  2WO1 A;  4WVV A;  1S0E A;  2AEN A;  2VW0 A;  2XH6 A;  4WM8 B;  3KS7 A;  2R7E B;  3NKT A;  5FLI A;  3RZZ A;  4DXR A;  1DLL A;  2P17 A;  3CJI B;  3KMH A;  1JH5 A;  3DCQ A;  3MI8 A;  1TNR A;  5FPL A;  3V64 A;  4G3Y C;  2FQP A;  5JUV A;  3NV2 A;  4L2N A;  2DCT A;  4O61 A;  2B46 X;  4Q2F A;  1PGW 2;  1SBF A;  2DCJ A;  3H3Z A;  4MHU A;  2BJS A;  1MS5 A;  3ZFE B;  3OD0 A;  4AGV A;  5LWB A;  3C3V A;  4BLI A;  5I8Y A;  4Q4V 2;  1VBB 1;  3LEG A;  5JXG A;  4Q4Y 1;  1F5J A;  3B02 A;  4KMQ A;  3O1S A;  3WDV A;  5EWS A;  1LEC A;  5LAT A;  3T30 A;  2ZMN A;  3AYC A;  3ZIX A;  1MZE A;  3PME A;  4YM3 A;  3WNN A;  2IFW A;  3BUC A;  4ZHN A;  3ZFG C;  1WD4 A;  1J83 A;  1DGW X;  3B69 A;  2Z4F A;  3MIH A;  2NLR A;  1GZW A;  3TOJ A;  3KV5 A;  3J26 N;  4Q8L A;  5TSW A;  3WP6 A;  4LQR A;  5C9A A;  4NIA A;  3H8X A;  2D5H A;  3AP6 A;  3DPR C;  3MIG A;  4XEZ A;  5F3E A;  2ARE A;  2HWB 3;  2WR9 A;  3BPS A;  4QKN A;  4OI2 A;  5CFD C;  3AKT A;  3N7L A;  4JCK A;  1W8O A;  1T6G C;  2JD4 A;  3BAL A;  4Y5S A;  1ULF A;  1COV 1;  2QE3 A;  1VIW B;  4FFI A;  4YGC A;  2JDM A;  1R1A 1;  4BQY A;  4QPI C;  1IS6 A;  1QXP A;  3N9P A;  4AI1 A;  5C3R A;  1ZBE 3;  4P9G A;  1W8W A;  1BBT 1;  2UWA A;  4QAW A;  1VPH A;  4BM8 A;  2BOJ A;  4E4Z A;  2ZTN A;  4QDQ A;  1ND3 C;  3FC0 A;  1YWK A;  4CDU B;  1OLM A;  1VRH 1;  4UW5 A;  3PUA A;  1HRI 2;  5C3Q A;  1W04 A;  3FZ3 A;  4QKF A;  2WJS A;  1VP6 A;  1WMD A;  2Z42 A;  3VBO A;  1DBN A;  4MLO A;  3RG0 A;  2QZ3 A;  2QFE A;  2ZAB A;  4QM8 A;  2HWF 2;  1FV2 A;  4U36 A;  4XTP A;  2J1R A;  3ES4 A;  4N7I A;  5KC5 A;  2QNK A;  4FPO B;  1JI6 A;  2EAL A;  5FUP A;  3I2J A;  4MXV A;  2OUJ A;  4QX7 A;  5DUU A;  4YPJ A;  3O7O A;  3MLJ A;  2C9K A;  1XSQ A;  2J42 A;  4CRQ A;  5JOY A;  4E4S A;  4RGA A;  2VTF A;  3MUY 1;  4PIX A;  4AFM A;  3WLU A;  3BYW A;  4FOV A;  2DVD A;  2JDU A;  4OMD A;  2CNA A;  3GHM A;  3OY8 A;  5F3G A;  4AGR A;  4YZ3 A;  3ALQ A;  2CY6 A;  4BH9 A;  4E2G A;  5CBL A;  1SLT A;  1JYN A;  3VHR A;  4AFB A;  4EWA A;  3RZH A;  4I0W B;  4BXS V;  2TEP A;  3MFA A;  2XUM A;  3HJR A;  4Q4X 1;  3U14 A;  3POI A;  4X8N A;  5FMB A;  3VBS B;  2ARB A;  1UQX A;  1EP0 A;  1GV9 A;  1G9F A;  1IS5 A;  3H50 A;  1YIF A;  1BEV 2;  1GWK A;  1V70 A;  1N1T A;  1W6O B;  2WNV A;  3AKR A;  3GF6 A;  1CAV B;  1UU6 A;  2NP0 A;  3SIT A;  2AYH A;  2DFC A;  5FDB A;  2QQP A;  2W2I A;  2VBB A;  1CJP A;  1D2S A;  3VBU C;  1I6X A;  4GUL A;  3DKQ A;  3WF1 A;  1SHW B;  3WX5 A;  2C1F A;  4C91 A;  1NLS A;  5SV5 A;  1H1I A;  3PL0 A;  1RHI 3;  1RMU 2;  2WS9 1;  4KWU A;  3IAP A;  4Y1U A;  3NL1 A;  4LOS A;  2R1B A;  2VZP A;  3G7D A;  2ZEW A;  4DRV A;  1VMJ A;  3R0R A;  5CVR A;  4OQ8 A;  1LKN A;  4LKD A;  4A2U A;  5F5A A;  4FTE A;  3OCP A;  1O91 A;  1POQ A;  1Q8P A;  2ETE A;  2OUH A;  3VKN A;  5C3O A;  2GC2 A;  4OVE A;  4XAB A;  4FFG A;  1PZ9 A;  1HN1 A;  4IV3 B;  4LKE A;  4UFL A;  3AZX A;  4CP1 A;  1H8T C;  5A3M A;  5A80 A;  5IK7 A;  1AXZ A;  2ZX2 A;  2XBO 2;  1NA1 A;  4LOT A;  2F6B A;  3O1P A;  2XOM A;  2VQ0 A;  4WM8 A;  2GC3 A;  2Y6L A;  4IE4 A;  1Y9G A;  5T5O A;  1QDO A;  3CJI A;  3NJV A;  3HPN A;  4H2A A;  3VDD B;  4N43 B;  2DBI A;  2I07 B;  1WLW A;  2FCU A;  4NJ4 A;  5A33 A;  3HAG A;  1ASJ 1;  3ZYR A;  1MVE A;  4AHX A;  4CU9 A;  2K46 A;  1S2B A;  5FBZ A;  1SLI A;  1QQP 3;  1ZZB A;  3POG A;  3H8O A;  3OGV A;  3FN9 A;  5FXZ A;  5LRR A;  3ZFE A;  2EVX A;  2R0H A;  4D6R A;  3VZJ A;  4EQV A;  1ZVF A;  2RDN A;  4FO9 A;  1GMM A;  4Y26 A;  1URX A;  2ID4 A;  5F5I A;  4HOO A;  3AP7 A;  5A7S A;  1JZ7 A;  1UMH A;  2BYV E;  4AI9 A;  2FDJ A;  4LHL A;  3VBH C;  5GZE A;  4AI3 A;  1QJY 1;  4XIL A;  4E8D A;  1WBL A;  3O1M A;  4YW1 A;  4LBJ A;  2D43 A;  5D8A C;  3TAY A;  5FWJ A;  2ZX3 A;  4YW2 A;  5I0U A;  5DAP A;  3NAP B;  4AQ2 A;  1LCL A;  3IDC B;  4A3Z A;  2XPJ A;  1QJE A;  3VLB B;  2WNE A;  1R1Z A;  2C9A A;  1K5M C;  2IZW A;  2I45 A;  1EV1 2;  1LU1 A;  1E5R A;  1PIV 1;  1WUV A;  4LA2 A;  2VNG A;  2WYS A;  3V56 A;  4M01 A;  4NHM A;  1HV0 A;  2W08 A;  4UW3 A;  3M2M A;  4H14 A;  3T2T A;  4EWD A;  1D0H A;  1W6N B;  4DEQ A;  3VDB A;  1RUG 1;  4XBL A;  3FLR A;  2IFR A;  1JUI A;  3OBA A;  1ENS A;  4E27 A;  2Y6G A;  2R07 2;  1OUX A;  4GB3 2;  4CDU A;  1GP5 A;  2VCB A;  4UI9 L;  4BLJ A;  2XHN A;  3KSC A;  5AFE A;  3HD8 B;  1JHN A;  4OUS A;  1RJ8 A;  1QF3 A;  2J1A A;  4MUV A;  1QJX 3;  5DDJ 2;  5DAB A;  3RI9 A;  2G9Z A;  1PZ7 A;  1Y3T A;  3RZK A;  4HZF A;  1NE6 A;  3GAL A;  4B3N A;  4L92 A;  1RC6 A;  2IUW A;  5JIA A;  1CPN A;  4C90 A;  1AYN 3;  1W3X A;  3UGF A;  5K9Y A;  2Y0I A;  3RS6 A; 
#chains in the Genus database with same CATH homology
 1GWK A;  2Q1F A;  1UOJ A;  4LK6 A;  4YW7 A;  4YW6 A;  1WZX A;  1V0A A;  4CPB D;  4BQ2 A;  1OKO A;  1W8U A;  1W8T A;  4BQ4 A;  4A6S A;  1W9F A;  3ORJ A;  5D21 A;  2KR2 A;  1W8Z A;  1WCU A;  4CP9 A;  1HN0 A;  3ZYB A;  1W8W A;  4AL9 A;  3UT0 A;  4LJH A;  2C24 A;  2LRP A;  4YWA A;  1OH3 A;  4BQ3 A;  1W90 A;  2JWP A;  2WYF A;  4CP9 B;  2K46 A;  3F95 A;  4LK7 A;  1L7L A;  2O14 A;  2VXJ A;  1WMX A;  3ZYF A;  3ZYH A;  4LKD A;  1GWM A;  2LRO A;  4CPB A;  4LKF A;  4BQ5 A;  4LKE A;  1GWL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...