1W8TA

Cbm29-2 mutant k74a complexed with cellulohexaose: probing the mechanism of ligand recognition by family 29 carbohydrate binding modules
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
142
structure length
142
Chain Sequence
b'NVRATYTVIFKNASGLPNGYDNWGWGCTLSYYGGAMIINPQEGKYGAVSLKRNSGSFRGGSLRFDMKNEGKVAILVENSEADEKFEVETISPSDEYVTYILDVDFDLPFDRIDFQDAPGNGDRIWIKNLVHSTGSADDFVDP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NON CATALYTIC PROTEIN 1
molecule tags Carbohydrate-binding domain
source organism Piromyces equi
publication title Probing the Mechanism of Ligand Recognition in Family 29 Carbohydrate-Binding Modules
pubmed doi rcsb
total genus 28
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2004-09-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 1w8tA00
4BQ5A 3ZYBA 4BQ2A 1OKOA 2JWPA 1V0AA 5D21A 1W8WA 4LK6A 4YW7A 3ZYHA 4AL9A 4LKEA 2K46A 1W9FA 1HN0A 1WZXA 3ORJA 4YWAA 2VXJA 2C24A 4BQ3A 1W8TA 2KR2A 1GWLA 2LROA 1W8UA 3UT0A 1WMXA 4A6SA 4CP9B 4CPBA 1L7LA 1WCUA 4LKDA 3ZYFA 4CP9A 2LRPA 4LJHA 4YW6A 1OH3A 1GWKA 2O14A 1UOJA 4LKFA 4LK7A 2WYFA 1W90A 1W8ZA 4BQ4A 4CPBD 1GWMA 3F95A 2Q1FA
chains in the Genus database with same CATH superfamily
2ZEWA 1W2AX 3UGFA 3SCGA 4LK6A 4LTAA 4Y4RA 4GH4B 1Z7S2 1WZXA 4GH4A 1VALA 4G9SB 3PIGA 5A70A 2EVXA 1QGLA 3K46A 4P9YA 3WP5A 4LOTA 3WG4A 3DXTA 1OURA 2ZGPA 1RVF1 3Q8CA 5FUIA 1XOYA 3P1IA 2DURA 1WCUA 2JE9A 5A3TA 1LECA 3AFKA 2EIEA 4E8DA 1LODA 2OZJA 1H8TA 2B9UA 2GNTA 2RMU1 4GMP3 4L2NA 4W6XA 1LCLA 1NA1B 4AI0A 5C8CA 1GOFA 1ULCA 2IVJA 2Q8OA 1QOOA 1V6OA 2Y6JA 4MO3M 5BNOB 2VMEA 1ZX5A 1OA4A 3T2TA 4QB1A 1HN0A 4K3UA 4QX1A 2HWB2 4UFJA 3VKFC 1V6KA 1QHDA 4DOUA 1PVC2 2HLEA 2G19A 4MH0E 2VMFA 4DQAA 3KM5A 3BOPA 4M3CB 4BPZA 1I5PA 3MIHA 3ZR6A 4XILA 4AEJA 3CZJA 1TE1B 4FBFA 3AL5A 1H0BA 3FFZA 4YVWB 2Y60A 1ZA4A 1C3HA 3HAGA 1N3QA 1OPOA 4JHZA 3CJIB 3MEPA 1JOPA 2JG8B 2ZACA 1REEA 3TOJA 3WOGA 3GCXA 1FV2A 5BNPA 2XKOA 2XVKA 3J7LA 1DYPA 2WKKA 4QXKA 3C7GA 3OD0A 4LMFA 1ENQA 1DQ5A 3OGSA 4WM8B 1SDWA 1UZYA 2Y64A 5A7SA 1UU4A 4IETA 1CIYA 1Y7BA 4COYA 1COV2 1NT0A 3RYRA 3FFQA 4AFCA 5BNPC 5IVJA 3TAYA 3MW2A 1DP0A 1X33A 3HNBM 5JVVA 3OUIA 3N3HA 3AK0A 4QQOA 1ULPA 2V09A 3N9MA 4RQPC 4HT1T 3VBSB 4IEYA 1OA2A 1XNTA 2XMLA 1I6XA 4IE0A 1RJ7A 1W3XA 1UU5A 3J7MA 5F3EA 1RUH3 5JOWA 3BTZA 1MS9A 2NLRA 2X10A 4C1XA 1UY1A 2WJSA 2WWJA 3G6JB 3WX5A 3N7JA 4FTBA 1AL23 2HWC1 1O4TA 4CP9A 3H8XA 3OPTA 2FCVA 4R9AA 3V0BB 3SKJE 2I45A 3NQHA 5GJ6A 3B9CA 2CAUA 1IS6A 3L2YA 4C90A 4UFHA 5BXXA 4K7JA 1JH5A 2NMOA 5F32A 4J1XA 3RYKA 1CWPA 1LRHA 1BBT2 2DFCA 1QH7A 3GBFA 4KU7A 2OYZA 3POGA 5A7WA 2KA3A 1MZFA 3A21A 3FN9A 5JUVA 4XJ9A 1JMUB 5FZ7A 5LA1A 3JD71 1B35C 1N3OA 4PIZA 4CZSA 2UYAA 5KXCA 4B7EA 5E16A 3AMHA 4LBJA 4ET7A 2C0ZA 2JDYA 1JYXA 2YC2A 4J6GA 2XPJA 4G4FA 3VBOA 5JI7A 1HB3A 1WBFA 3ES1A 1BJQA 1D2QA 1WCQA 2RDNA 2XLAA 1CR7A 5C9AB 2QZ3A 2GC0A 1BKZA 3WHTA 1W8ZA 1TME3 3I3DA 2RMU3 2W91A 1AR63 5EXOA 1NCRC 3OGRA 1ZZ7A 4NRPA 1S0EA 4XJ8A 4K8RB 2CNAA 3WW4A 3ZN6A 1GNHA 4JDOA 3ZYRA 5DMYA 3VKLA 2R042 2AEZA 1VMJA 2FHRA 3A22A 1VRH2 4LORA 1VBC1 3BYWA 4X6QB 2RJ2A 3LOIA 1VBE1 4BHPA 3J7NA 3ZN4A 3OUJA 5LK7B 5FPXA 4HVOA 5DUVA 2DF7A 1PGSA 3INAA 2VTXJ 3PLQA 4I09A 1S0DA 3I3QA 4HVRA 2YUEA 2WNVC 1IOAA 4CE8A 2BU9A 4V2VA 2ZOEB 2EALA 4KL1A 4RS5A 4BJ0A 4COVA 1KITA 3T08A 4CP1A 2PAMA 4XZPA 1MZEA 1S4CA 2F4LA 1TEIA 5FCCA 5FMOS 3FUQA 3W59A 1OXCA 3K77A 1H8TC 1ALYA 3LDKA 4XC9A 2B9VA 1VBB2 2YGLA 2OZ6A 3GHMA 3KCYA 2ZGNA 3BIEA 1COV3 2K2SA 2FDHA 2GP3A 2ZBJA 3ZSEA 1L3JA 2HWF1 2JIJA 3AP6A 4Q4Y2 5L9RA 4W8JA 3T09A 2W52A 5I0UA 3WQ0A 2PXJA 3RG0A 4D7YA 1A34A 2D6OX 4HK9A 3BN6A 5ERLA 4QQ2A 3WG3A 5C7GA 1R1A2 1UPIA 1FNYA 4WM8A 3RWKX 4Q8KA 2FDKA 2ZGUA 3NNLA 3URFA 1QKQA 3LE0A 4GQ7A 3RYPA 2J1SA 3NRUA 4LJHA 2V5DA 4R4XA 5ANQA 2QQUA 4IEVA 2C4XA 2Y8KA 1H1MA 3I3MA 3AKRA 3HD8B 3AKQA 4SLIA 2OT7A 4FTSA 5FLHA 4BB3A 4E27A 5IK7A 5A6ZA 4SBVA 5J98B 5I8SA 5TSWA 2XLFA 2WIIB 4QU2A 4S2HA 1MVEA 2VVEA 4QM8A 5GZEA 4YZ2A 2MEV2 4IV1B 2R0FA 4CCJA 1H6XA 3ZXLA 1JU3A 1PK6C 1G9BA 4GD4A 4CP9B 2WT2A 1OUXA 1UWWA 5JMOA 3NJZA 4XIKA 5FZ8A 4Q0PA 3IDBB 3POFA 4GMP0 2WO1A 1SDDB 2HWD2 3U0ZA 1NYWA 3DCQA 4AAPA 3AJZA 3AYCA 3ZXKA 3PJQA 2XG3A 2FDIA 2JXAA 1WLDA 1ODMA 1SZBA 3LEKA 3HJRA 2GZWA 2EIBA 1R092 1ONAA 1W3VA 4IL7A 2VH9A 1NA1A 3CF6E 3N7KA 4AK3A 1QQP3 4QGLA 3JBG3 5JSOA 1DGWA 1QJX1 3VZNA 4BXSV 4LBLA 1STMA 5A7OA 1DGRN 2A6YA 1JS9A 2G4IA 1HW5A 1GWLA 4XAAA 1LHVA 2VL4A 2ENRA 1RUJ2 3POSA 1PO23 4B7KA 3ASIA 4JGYB 2W3JA 2RS53 4DB5A 2BNNA 3DKQA 1W0OA 1Q8SA 3FHQA 1W8FA 2OQ7A 3D4KA 2R043 4TSVA 1Y43B 1XYNA 3N9PA 4UW4A 2AACA 2WRAA 1VRH3 2ZGQA 1LJ7A 4AVVA 1N1YA 1NLRA 1QDOA 1SLLA 2EF6A 2HBUA 3CZUA 4M3CA 3ZFFC 4AE2A 5JZGA 1HRV2 1LGCA 5BNQA 3AKPA 1LR5A 1V6NA 4QKDA 4YLZA 5BV6A 3ILRA 4NIHA 1QJY3 1WW6A 3OCPA 1N1VA 2Z2SB 3AYAA 4RGGA 3T1LA 3R05A 1Y3TA 3MPBA 3VBFA 1VBD1 3T0DA 1W6NA 3FL7A 2NYYA 3CJIA 5C9AC 1YC61 2DCYA 4HN1A 3VN4A 3POJA 4AVTA 4RHV1 1W8UA 2WDBA 2XBO1 3VZKA 3WW3A 3IDEA 2Z79A 4AHZA 5ACA2 1DDLA 4DEQA 2XVGA 3VBHB 3OBRA 1GQGA 1LGBA 3U78A 2D3RA 3WV6A 2WUHA 3PUAA 1F15A 4Q4V2 2ZS6B 2D97A 1PMIA 4E4HA 1LOBA 4ZPIA 1IS5A 3V0AB 2TBVA 4FPCA 5A3WA 4CDUA 1RUG1 1SFPA 3RZLA 4FQ4A 3JUUA 3WT3A 2P3IA 3LDBA 4FOVA 2ZXQA 1W2NA 3VD7A 3WNPA 3IB3A 4X6RB 1DFQA 1F2NA 4JGZA 5FO8B 3R4SA 1LHNA 3TNQA 2A70A 2VO5A 4ZZ5A 4AEDB 2B45X 3B01A 3ZFGB 4KG0A 1H8VA 4XUOA 1GR3A 4KWUA 4AXOA 1JU4A 1C8M1 3KGZA 1LOEA 2BP6A 4XCAA 1H1AA 5KC6A 4MSVA 1E5HA 2VZ1A 2I2SA 5DDJ2 1X9PA 4AI2A 3WF1A 2JDZA 5CFDC 3RI9A 2V4AA 4Q0UA 1XB9A 4HOOA 2WFF2 4JRLA 1NY71 2PHTA 3Q8FA 3EHKA 4CDXA 2J1VA 4AL9A 3QD6A 4WVWA 5EYXA 1JYNA 2O8QA 1QF3A 1QJY1 3N7MA 1CX1A 5AC93 1QXJA 3ZMNA 3NW4A 2LROA 3IPVA 4I01A 4PDWA 2D5HA 2WO3A 4XDQA 5CKQA 5BNOA 1AYM1 1K5MB 4HPKB 5BY5A 1RGSA 3D5OA 4QHOA 4PIYA 1AR83 3PNAA 1UYYA 1M4WA 3FC0A 1QU0A 5D8AC 1AYN1 2JG9B 3NJXA 2YFZA 3SH4A 4CU6A 4YM3A 3EJKA 3WNNA 4J1WA 4E2QA 2AH2A 3SITA 3VBOB 4MVTA 4BIFA 1V9U2 1XBFA 5FAXA 5ACA1 3H8RA 1C1FA 1R083 3O1OA 5JMCA 1HB1A 1K45A 3W5NA 3JQWA 4A4AA 3BUCA 2C6SA 1NXMA 3A7QA 4MV2A 3JBG1 1QQP1 3ACLA 5IVVA 4HG6B 2DWRA 1XSQA 2DYCA 4AVCA 1YXWA 1R1ZA 2JB4A 2ZAAA 4N9IA 4PCRA 1H2NA 4GXLA 4NHMA 3I3EA 4Y1VA 2H0VA 2JDKA 3LQCA 1YQ8A 4HLTA 4O7XA 4EROA 5A7QA 1DLLA 1GNZA 2O1QA 4EWEA 2W9XA 4HMZA 3B9IA 4E4SA 5FTTC 3I2DA 3NV2A 1NOVA 1L7LA 4BK5A 1K3IA 4XUPA 4XF3A 3MBWA 2X53S 4GJZA 3MW4A 4XACA 5FQ0A 4RS5C 1Y9MA 3WQ1A 2ZEYA 5DABA 2F4PA 3BTYA 5D8AA 1F9KA 4UI9L 4DINB 2QQPA 1RUE3 1HV0A 5AC91 4QPIB 3UKVA 2VW0A 1HLCA 1NAEA 4IV3C 3O1PA 1W6NB 2VCMA 1UZZA 2ILMA 1EP0A 1QJEA 4Y5Z0 2PHUA 4N7UA 1JYTA 1UAIA 4META 3K75B 4CDWB 1NKGA 4Q4V3 5CNAA 2PQQA 2A6ZA 5FP7A 1S0BA 1YFXA 1GFF2 4NE9A 3IDCB 1PO12 2YYOA 4CPBA 1OVPA 5CFDA 2K9ZA 4XEZA 4RFRB 3LAGA 5EJ1B 4ZKTB 3R4UA 5FP8A 4I30A 4NOTA 1FAYA 5BPXA 1W6QB 4Z2WA 5JLVA 4CDQB 4FAHA 1JZ2A 3IIIA 1NLQA 5KBFA 5HCAA 1RUC3 3OSDA 5KXBA 5C3OA 3M3QA 4YVSB 3MGUA 3E6BA 1J3RA 1RHI1 2XHNA 3I2FA 3THDA 1C28A 2C1FA 2A6XA 1WW5A 4Y20B 1C8NA 2QBXA 5A1AA 5C4WB 4CDWA 3AL6A 4QPYA 1QXPA 4LIUA 1YJLA 2D6PA 5FJKA 5DDJ3 5GLVA 4K20A 3VDCA 2WWUA 3ZYPA 2BVVA 4PLOA 4MXWB 2ZHNA 4HKLA 4AGRA 5H9PA 1QIQA 2VMDA 5FZMA 1W6QA 2BOIA 3VBRB 4AQ6A 1OFNA 5HPOA 4BQ4A 4CDWC 3ZDVA 2JD4A 1BVP1 3HNMA 3OYWB 2WYSA 2OS2A 4Q4W2 5CA6A 2CGPA 3ELNA 3GGLA 2WAAA 4BQXA 3OYWA 4K1ZA 4CCOA 1JZ3A 3CO2A 3I59B 1LU1A 4GWMA 1GZ9A 2P3YA 1RVF3 3LB9A 4XCBA 2YMZA 4MHRA 2DUQA 1HDKA 1W6MB 4IQPA 4X8PA 5F9TA 1AJKA 5A3MA 1NQJA 2GNBA 4BXFA 4OUMA 4FXKB 3UJQA 4EWAA 2VXRA 1QH6A 1SBFA 1W8OA 1C5HA 3BB6A 4ORFA 2Q8CA 2B8MA 2GALA 1WD4A 2VCAA 3AP5A 3MO4A 4KI5M 4KNCA 4XE9A 4YGBA 3LD8A 4W4ZA 5FXVA 4ES9A 1ZRFA 2A5ZA 5FKBA 4KWKA 2Y34A 4LO5B 5IW0A 4OI4A 2YBSA 1PK6B 5H9SA 4HBNA 3RZJA 4N43B 1ENRA 3RZZA 1AZDA 2YXSA 3C7FA 5J36A 4D3WA 4YWAA 5K0UC 2LUWA 3NVCA 2ZCWA 2OW4A 3NMBA 3VBOC 1JZ4A 3VD5A 3KB5A 1TQ5A 4B4PA 3K2OA 2GNDA 1RYYA 2BW8A 3IDAA 2P1BA 1ST8A 4PQ9A 5FYYA 3U4SA 1PGW1 3RI8A 1IQDC 2FDJA 4GKXA 3M3IA 2HEWF 4L11A 5F6LB 2PHDA 2VTXA 4MYEA 5FJHA 4MADA 1APNA 1EY2A 3AFGA 4AOCA 1W0NA 4A7YA 5B4NA 4HANA 3SCHA 4AEDC 3MV11 4YM0A 1UX7A 1S0IA 2KD7A 2W47A 4ASMB 2VZSA 1VMHA 1MZ5A 2PN5A 1YIFA 3PL0A 1PIV2 5FUNA 1UIJA 1HQWA 3UESA 4XYXA 1HB2A 3WQ7A 1VRBA 5IVEA 3H1WA 5FBJA 4K21A 1DBNA 1PZ8A 2ZJCA 4UBHA 4RYDA 1RUF3 2ZGMA 2WSUA 2J42A 2VBBA 3J26N 5LK5A 2GSYA 5JXIA 4NWVA 1SBEA 1WGPA 1OMIA 1AXKA 1GYKA 3G7DA 5C70A 5FPLA 4ZS2A 4IGOA 2MHFA 1LOCA 5A3OA 5L9BA 2XWJB 3V65A 5F3IA 4Q27A 4ZXKA 5C3RA 1OVSA 2PHFA 3LSDA 2Q1FA 1OOPC 4FSJA 4CDXC 3HQUA 5E1RA 2AENA 4G3YC 4AYUA 3AP4A 2CU5A 4IUGA 3GNEA 4GWJA 4KWJA 3WDWA 4AVSA 4CP0A 2LW8A 4A41A 5B4XA 3AXEA 2RV9A 1QEXA 4CXXA 1OBNA 3C7EA 5FP9A 4R9BA 4AWDA 4KU8A 1AR62 1ND2A 3SC7X 5A32B 3A0KA 3IZOA 3I97A 5GLWA 4NJ4A 5G05L 3RNSA 3PURA 3PJYA 2QKDA 4I0AA 3T4VA 4ZONA 4P9LA 1OLRA 1OH3A 1FMD2 3ZXGA 1RUH2 4COWA 1UOJA 5J3UA 2VMCA 5JSRA 1FX5A 5CKMA 5T3NA 2ARCA 1OHFA 4ZU4A 1S0JA 3VZJA 4YM2A 2JDHA 4COZA 5A1FA 4F7ZA 1Q8OA 1ENSA 4QX5A 1W8WA 4Q1PA 2W1SA 4XFBA 2W1QA 4MLOA 4OQ9A 3V64A 2DTYA 1HJFA 2VG9A 4JTNA 4UFMA 4YVWA 4E4ZA 1V9U1 4QU1A 1U0AA 3RWNA 3BVCA 1BZWA 2Q30A 4ISQA 3HPNA 1BEV2 1Y9QA 2BRTA 3FLPA 1ZNPA 4CVUA 3GXUA 4PI0A 1UYZA 5FY8A 4YYOA 1RMU2 5FZIA 4YZ4A 2KXLA 2W1UA 2XHKA 5KWRA 3OPZA 4A3XA 2ZGSA 4Q4Y3 4QX3A 2RM21 3KT1A 5L19A 3D3AA 4YNIA 5A33A 1TNFA 4GWIA 1Q3EA 4LBMA 1OFSA 3DEMA 3I2IA 2AUYA 4WM8C 4B3NA 5T52A 1WLCA 5FFOC 4Z1VA 2RM22 2HWB1 1WMFA 1XU2A 4NAOA 4RR3A 1QWRA 4XJAA 1JYVA 3VBHA 4WZFA 3RZGA 3E5UA 1CONA 1CJDA 1OT5A 2PHRA 2QDNA 2VBPA 3ZKUA 5C3SA 1A78A 1KQRA 1OOPB 3SH3A 4DUVA 1LHUA 1AYN3 4BH9A 1Q43A 5A80A 3AB0A 1YO8A 4M0NA 1LHOA 4DFSA 2MEV3 2XB6C 3BIWE 1X8EA 4LUMA 3GALA 5FZ1A 2ZABA 2IUWA 3UYJA 5I93A 3EBRA 1SPPA 3BPZA 3THPA 1UY0A 1ZBE3 2C5DA 1QJFA 3WNKA 1YNAA 2B42B 3H9AA 3RS6A 3VLBB 5JR7B 2BUKA 4NHYA 4IEQA 4Z82A 1CN1A 3MUZ1 3LPGA 4FT8A 3DPRA 1H4GA 1JOBA 1YQCA 2CDOA 2D43A 5L73A 4WVZA 2SLIA 5JR2A 2D5FA 1OD3A 3KV6A 4UOJA 1CAWB 3HN3A 3WVJA 1F31A 4CEYA 2PFWA 2FBEA 4LKSA 2LRPA 2XBO2 4B4QA 1V6LA 1FOD2 2DVGA 3MIDA 1OQDA 2VGDA 4Y26A 4UW6A 2UU8A 3OPWA 3RMYA 3ETQA 1ASJ2 1VBD2 4BU2A 4IV3A 4XAEA 5FYUA 3POWA 2VOXA 4LR4A 1FNZA 1XNDA 1ODNA 2D40A 3MLJA 5L7OC 1O3RA 2UURA 1YLLA 3USUB 1UQXA 4NMIA 2RS11 4JKLA 1HRV3 2ZGTA 2J1UA 1CD3G 4A7ZA 2YB7A 2O0OA 1RUI2 4YG6A 2A75A 1OLME 3MLKA 1PM7A 3EO6A 3RZKA 2VUAA 2AGSA 4FFIA 1PIV1 2R6QA 4FPJA 4YZ3A 2A3WA 4RN5A 3AMPA 2XXZA 5LRSA 2WZR2 1W9SA 1MS8A 2WR9A 2XUEA 2ZGRA 2QUOA 5HBAA 4DNYA 5FZDA 1SACA 3O7OA 1R64A 4Q8LA 5FYBA 1CAVA 5FO9B 2YC0A 5FREA 3U11A 3BCWA 2PLV1 1PGL1 2X5IB 2YU1A 1VBA3 1UZ0A 1YFYA 4B29A 2WQ4A 1UOFA 1KEXA 3H0OA 2JKXA 3S5AA 2Q0AA 5CZKA 4DY5A 4KWLA 2CAVA 5CVRA 2VAUA 2HWD3 2W68A 2VY0A 3BU7A 5FXWA 1W6OB 4KH9A 4MX3A 3VBSA 1A6CA 4ZZ8A 5FZ6A 4R52A 1F5JA 4FAGA 5E6HA 2UWCA 2QDRA 2B39A 2XJTA 3OUHA 4D7TA 1ASJ1 2ZGOA 2BERA 3JBG2 4PBOA 5GM0A 2E7AA 5FLIA 1WCSA 3DYOA 3MFCA 4O65A 2JX9A 4AAXA 2UWBA 3GBGA 2B4KA 3VHNA 4D94A 5EZWA 3E1F1 2BWCA 1GOHA 2BQPA 1Y9GA 2HEYF 3S7IA 2FMYA 4QDSA 1AYN2 1JW6A 1LKNA 3ZN5A 1OLMA 4XFGA 1BQPA 4YARA 4BYYA 2BEOA 2XR4A 5EHDA 4URAA 3GZAA 3WF0A 4COUA 3N9QA 3GBWA 1ZBE2 2EIGA 1QJY2 3RVHA 2GN7A 4M4PA 1OQ1A 4W6YA 4TZDA 2YU2A 2ZMNA 1RUC1 4PDWB 4JC1A 2O14A 2BGPA 1E5SA 2WNUA 2ZMKA 3VBRA 4A44A 5FOBB 2E9QA 1JODA 2JDAA 2WAOA 1CPNA 3M3OA 4LA3A 3W9AA 3WQBA 4KMQA 1DYKA 2OIIA 3C7OA 5FK8A 1W8NA 5HCFA 4DS0A 2JG9C 3F2ZA 1JN2P 1PM4A 2CL2A 3WNOA 4FPYA 1C57A 4XZUG 2LALA 2XBO3 1R082 1HKDA 2QJVA 4QPIA 4IE4A 5IK5A 1D4VB 1IPSA 5IK8A 2JG8C 3J8F2 1YRZA 2CV6A 1ULFA 1O3TA 2G9GA 1VBD3 4KGGA 1UZVA 2X5IC 3VBUB 5A6XA 3C7HA 1BK1A 4XFAA 4R9DA 5E88A 1PHMA 2E53A 5FZ0A 5FZBA 5KHHA 4JV4A 2ZZJA 2XL7A 1JUHA 2JENA 3MPPG 1ZZ8A 1VBE2 4CTEA 3ROUA 1YYNA 4Q4X1 4DXRA 2E63A 2QVSB 1G6NA 3ZSMA 3NNMA 1REDA 1RMU1 3IAQA 4F83A 2GAUA 4P14A 3ZFFA 2K46A 1RUG3 4QKBA 1QJZA 3PIJA 1DF0A 2JDUA 4QAWA 4LNVA 4XABA 4ZY9A 1GICA 1X50A 1RUE2 1CJPA 5T55A 1BK0A 1LEMA 2AR6A 5F5QA 1RXGA 5I0DA 2A6WA 5JIUA 3V56A 4LBKA 5KC5A 3R4DB 1LB2A 2HWB3 4CCNA 3APBA 1MEC1 2XQXA 4LKDA 3UNPA 3CDZB 4LXLA 3B02A 5C71A 3I2HA 4ATEA 3WR0A 5JI9A 5J09A 1H2LA 1AUYA 2ZX3A 5FQ0B 1NZIA 3PUHA 4C8DA 3T1MA 1W6PA 3MHZA 4LEJA 5JCTA 3DL3A 2R063 5DUXA 1VBC3 2VQAA 4IEUA 5D21A 4RGKA 3ILNA 1JTZX 4LITA 5GZFA 4PT6A 2QQNA 2Q5TA 2R1DA 5DAPA 1XPWA 4J25A 2R16A 4F3JA 2WABA 2ZHLA 2AREA 2Z42A 4PQQA 3MW3A 4AFDA 3KVBA 1BVVA 2FZ2A 4NR1A 3DGTA 4WM7C 5FY1A 3O1MA 3ZXEA 3O0XA 1O6UA 1LGNA 4S2DA 1VBA1 4Y4YA 5LBBA 3GDBA 1KGYA 2ZGLA 2W2IA 4CEYB 4MUVA 1F4HA 3VBUA 3H7YA 4MHUA 1TG7A 4AEDA 2OKXA 3AZWA 3TEWA 1FOD1 3HN1A 2D6KA 4RL7A 5JZGC 1WLTA 2WO2A 5JXGA 2R30A 1QJX3 4OMCA 3I2GA 3ZXDA 5IYYA 2ZZQA 4XXPA 1C8M3 1EPZA 4IEPA 4NUBA 4CSWA 1GP5A 3WHUA 2IXJA 4BCUA 4DEVA 2CGNA 2VUJA 3B00A 2VZOA 2GMEA 4FPHA 2BJSA 4XURA 4ZS3A 3WDTA 3FBMA 4BA6A 5HV4A 3HT2A 3S0MA 4KQ7A 5K8SA 2ZHKA 4GB31 4IEWA 2YG0A 1GZTA 1XC6A 4JX0A 4N90A 1XJAA 5JZGB 5JXHA 4UW5A 3MIEA 4I3PA 4ARXA 3SH5A 1A8DA 3HEIA 1LU2A 2Q1MA 5CADA 1YQ2A 5DQ0A 4LUKA 3OBZA 4ONUA 4QPGC 5I0TA 5T50A 4YGDA 2WFF1 1VAVA 1GBGA 3BGAA 5SV5A 1GQPA 3ZLIA 4CPBD 4DIQA 1CAUA 1UOGA 2WZEA 4R4ZA 3PMSA 3R6SA 3SLIA 5CFCC 1LTEA 2WLQA 1PGW2 3J8F3 3OB8A 4JAAA 5F2SA 4AQSA 5C8CB 2B5HA 4RD7A 2XONA 4QX7A 5FMBA 1WCDJ 3KV9A 4UYBA 4GJYA 2D44A 4AFAA 3J4UH 4FFFA 1GUIA 1BMV2 1R1A1 5GLTA 3NKTA 3N9NA 2D6LX 3VD3A 1NCQA 4KBBA 3AMNA 2TNFA 5FPZA 4Z8BA 4EN9B 4AZZA 1RUC2 2OX0A 3T2PA 1RL3A 4ZHNA 2GP5A 1Q5OA 4YM1A 2ZPXA 4K8FA 3ZKYA 1RUG2 3L2HA 1W05A 1PX4A 1SHWB 4IDZA 3WY6A 2VPVA 3AX4A 2JDNA 3OD4A 3VKOA 3MYXA 1G86A 2YPDA 1UXZA 4IV1A 3AZVA 1JYWA 4CCKA 3W21A 3PU8A 3AMMA 5DPNA 1KD7A 1SLCA 4FFGA 5FKCA 1US3A 1WWYA 3QLQA 2RMU2 1J58A 2V73A 3PDQA 5JOXA 2YDEA 4H55A 5HCBA 3OGVA 4OZOA 3PMEA 1AVBA 3ZSKA 1H9PA 4E9KA 4P9XA 4IE6A 1REFA 3PUIA 1UW8A 1D0GA 2H6BA 3WG2A 4E8CA 2ZX0A 2HEVF 4OHWA 3WNLA 4EWDA 3KD4A 2WN3A 3BI3A 2A1XA 5FXXA 2IC1A 4IEOA 1ZYBA 4OI2A 3DF0A 4UF0A 2E7TA 5LASA 1Z7S1 4WM7B 1J3PA 4Q5OA 4XF9A 3O1VA 2VUDA 3HBZA 2JE8A 3KT4A 2ZA9A 1X36A 3CNAA 3Q8BA 4TWTA 2P6CA 5LEKA 2AYHA 2XJRA 2XVLA 4JDNA 2R0HA 3WDYA 3LPFA 1HJGA 1W03A 2PLV2 3AKTA 3O1TA 1PGL2 4Q0QA 3LFIA 3H3UA 1W0PA 2JKBA 3CJIC 3IM0A 1NX9A 3ZFGA 5FZOA 1GNYA 3HQXA 3I4IA 3IT8A 3Q8EA 2XJVA 5IAVA 4EZ4A 5F37A 3USSA 1VB4A 2RHPA 2QQKA 4AHWA 2WZR1 1QJX2 1OC1A 3WCRA 4XETA 4QHZA 4LA2A 4TN7A 4XJZA 2CSGA 4EQVA 1XNKA 2D3SA 5SV8A 3RMXA 1UKGA 1YUDA 4WV8A 5DG1A 3ZIWA 1GV9A 2VZRA 1O5UA 1Z78A 3KF5A 3Q9OA 1QJU1 1PMHX 3WW1A 3ZYJB 3IAPA 5EJZB 2J7MA 3E97A 2WNVB 3AZZA 4JHTA 1JI6A 4RQPA 2YPJA 2WNUB 1F8VA 2ZTNA 5CFDB 5ISLA 4XTPA 2QQOA 3VDDB 1O3QA 5A3NA 4NWWA 4OVEA 3N9OA 1UD1A 4O9GA 3WLUA 3O1SA 1CESA 5C3PA 1HQNA 3P3NA 4B1MA 2XJQA 1JZ5A 4ISRA 3IWZA 3KT7A 2ADDA 4TLFA 4YW6A 2OVUA 4CCCA 3FLRA 4CEWB 4GWNA 3UL2A 1W6MA 3OY8B 2VOKA 1UOBA 3H3ZA 2QZ2A 3H42B 5LEJA 2R32A 5FYCA 3LEMA 3WF2A 4LLFA 4FPOB 1DHKB 5A7WB 4QB2A 1I3HA 1TNRA 4O9EA 1UO9A 2WNVA 2Q1ZB 2BFUL 3USUA 1XQNA 4D6SA 3KQ4B 1HXS3 4LO4B 2VJXA 4MGKE 4YVSC 3LEGA 3FJSA 1WMXA 2BYVE 1IQAA 1QQP2 2RM23 2V72A 2ZHMA 3K3OA 3NAPA 4HKWA 3CL1A 4IV3B 4A6OA 4BIOA 3BKZA 4M4RA 1WA4A 5AVAA 2GH2A 3B7MA 1UNBA 2JB8A 4Y22B 5T5PA 3MV01 1NG0A 2GC2A 3T0AA 1SMVA 3AM2A 4L92A 1EYBA 2XL9A 3BTXA 4LO7A 3B5LB 4Y5SA 4RFT0 3T3YA 2Z69A 1RINA 1NLSA 5LBCA 2EAAA 1CQ9A 1AX2A 3HQRA 2QQVA 4AI3A 5FPBA 4O61A 5E89A 1ZA7A 4U2AA 3MICA 2WNOA 2YV8A 4K1YA 4XF1A 5LY2A 2VZQA 3JB8A 4Q1RA 1N47A 4CDQC 1US2A 4D6QA 3WF3A 4YPJA 1OPMA 3A4UA 3E6DA 1W06A 1PNFA 1W6OA 2D7FA 3WF4A 2JICA 3VDAA 4L9BA 3R0RA 3IMMA 3RJRA 3UV9A 2ARAA 3W5MA 2P5BA 5F7UA 4A42A 4XFFA 1BMV1 2E7QA 4D69A 2VNGA 5DDJ1 4LIVA 1UY4A 4TXWA 2VECA 1ND2B 1W9WA 3LDRA 1BEV3 2MNGA 4QD2A 1OOPA 2ARXA 3LA2A 1YFWA 1W04A 3I2KA 1RMU3 2VTFA 3VZMA 5CAZA 4TLGA 4XQ4A 1XXNA 5A3LA 5BNPB 1MZ6A 1XU1A 1IKPA 2H0BA 3RDIA 1MQTB 1YFUA 2HJIA 5FUPA 1W99A 4H7LA 3VDBA 1SBDA 3ES4A 1RUH1 2I07B 3EXUA 3K4DA 4OZXA 4FPGA 5JSPA 3O1UA 4QB6A 4LHSA 3VZLA 1AR73 2P3JA 2YGMA 2VVDA 2V4VA 4AHXA 2GNMA 3JZVA 4P5YA 5BNNC 4QGNA 3ZOIA 4C91A 1V6MA 1H2MA 2HKXA 1IG0A 1MS1A 4WVVA 3WCSA 3IIAA 4V1PA 1OKOA 1YI9A 2JWPA 2R072 3MFAA 5DXDA 3LOBA 2WZR3 2P3KA 4WVMA 2ET7A 3LFMA 5DZGA 3M1HA 4PLMA 4L99A 2FDGA 4XDOA 4NAMA 5GLUA 3CQOA 5FZ4A 2NM1A 4W6WA 3UGHA 3ACIA 3FX3A 3RFRA 2WA3A 2WBKA 1VBA2 1YQ6A 4M01A 1GSLA 4CCDA 5I8TA 1U5XA 2XKPA 2NMNA 4OFGA 4Q4Y1 1ZBA3 1H4HA 1RHI3 3ZR5A 4NIGA 1FPN1 4YW1A 5AC92 1QDCA 5I0RA 4HL0A 1JZ8A 3H8UA 1MS5A 2GC3A 1ND3C 4HONA 5LBFA 5J1XA 2C26A 4Y24A 5BUVA 5K7PA 2VE1A 1AR82 3RGBA 1O59A 3KV4A 3S7EA 2VW2A 4UWDA 2VM9A 5DN2A 5APAA 3WUDA 1EAH3 3ZYGA 3DPRC 4DUWA 2A73B 4YVWC 4D6RA 1GANA 5LATA 3C2UA 5A33B 3PVOA 5FP4A 1UIKA 4AHYA 5I8YA 1S1AA 2C24A 4PDWC 3N36A 1FOD3 1PK6A 1KJRA 4CXWA 3VL9A 1XE8A 3H7JA 1MEC2 2RE9A 2VZVA 3K3NA 1N1SA 1O91A 1ASJ3 1UZWA 4LOSA 1LULA 2OPWA 3AC0A 4HXCA 3RPQA 4K6BA 2ADEA 1QJU3 1RUE1 3U14A 2QQIA 5LZ6A 2PAKA 2QQJA 2W5FA 3F95A 3HOBA 4XTMA 1DZRA 1B35B 1RIRA 1K12A 2HWD1 4JCKA 1KJLA 1IZ3A 3NV4A 5FIXA 1TMF2 4YW5A 5FPAA 1M06G 2W46A 5IWFA 5CFCA 2RDSA 3DKWA 4N8MA 1Q8VA 1RUD2 5AFBA 5B2GB 2XUMA 5HXMA 3V0AA 2Y6LA 4Q4X2 1AYM2 4WBBA 3U4XA 4DZGA 4H7MA 5KXEA 2VUCA 1D2SA 5HI0A 1DQ4A 1VMFA 5K0UA 4ES8A 2HYKA 2W0XA 5CKNA 1PVC1 2QQLA 4S2FA 1S0GA 1LESA 2PMWB 2VU9A 2H6CA 3KLSA 4MGIE 3K51A 4DXZA 2P37A 2GU9A 3J8F1 3ZXAC 1SLBA 3KCCA 5FP3A 3N9LA 5JWPA 1X8MA 1Z7S3 1LEDA 1R081 2A3YA 5J37A 1P8JA 1CVNA 3P6BA 5KHKA 4QXHA 2BV4A 2WLPA 1O7FA 4JGYC 4XF4A 4ATFA 5FYZA 1IPJA 2AC1A 4W50A 4OLLA 2JDPA 1UN1A 1S0CA 3MUY1 1J1TA 2ORZA 2PHXA 4BMBA 1W8TA 4BQYA 2OQ6A 4Q4W1 2HWF2 4JVAA 4E4DX 3FLTA 2BGOA 5EV7A 1WMDA 1W2TA 5FYSA 3SEPA 1NCQB 3M8LA 5J48A 4JGYA 2WNUC 1TVGA 5CG9A 1J1LA 4Y5TA 1GP4A 1WUVA 5FPUA 2BDRA 5LY1A 1ZM1A 4LKFA 4Q0SA 3SISA 1IS4A 3MIGA 4NPLA 5IVFA 4I0BA 1RJ8A 3AVSA 4FI9A 1W9TA 4Z07A 4AEKA 4UFLA 1A3KA 1ZZCA 2W92A 3KGLA 1X82A 2Y38A 5HXVA 1JHNA 1ZBA2 4RHV2 4NRMA 3ZDSA 1F5FA 1RHI2 5C6CA 5F5AA 3LZZA 5F2WA 2LS6A 4Q4W3 1G9DA 3IBMA 4XJUA 4YFZA 1DZTA 1SLAA 2GH8A 1HRI2 2ID4A 4JDMA 3S5QA 1VBC2 5A6QA 3T2QA 4FTEA 3M70A 3GZTB 4F8AA 3ZVXA 1XNCA 2J1TA 1FATA 1AF9A 1T6GC 4YGEA 1EAH2 1E57A 1PO11 2EICA 4Q29A 2VD7A 3H3LA 3JB4C 1PO21 3LCPA 5FYIA 4OHYA 4IV1C 3JQXA 4YRDA 3ZX7A 4H3WA 2JECA 3B3QE 5FK7A 4FPFA 3O0WA 5JIAA 3U10A 3UKTA 5JPMB 1L7RA 1POV1 3SHRA 1MEC3 5JXJA 1RB8G 1VIWB 3VBUC 5LBEA 3FWEA 1UX6A 5DZEA 5C9AA 3M3EA 3NV3A 1FYUA 5K4LA 5CBLA 3JD72 2UY8A 1LOGA 1VB2A 2W94A 2VNRA 4Q0VA 1DCSA 4UBGA 3I2OA 4XFIA 2IXLA 3RQ0A 4DMIA 3D8CA 2X5IA 4NHLA 5I0SA 1MVQA 1UMZA 2G9FA 2VCBA 2G1MA 1VBE3 1XE0A 1XYOA 3DV8A 3NJVA 1CAVB 1NZCA 4K40A 3AZXA 3PVBB 3BTAA 3ZIXA 3ZSLA 1GQHA 2YFUA 4AGVA 1GWKA 1S2KA 4Q4X3 1AYM3 2RS12 1WKYA 5CIRA 3M2MA 3CBNA 3MLLA 1TME1 4QXBA 4GKYA 1X9TA 1EPWA 1LOFA 2AZ5A 3PVNA 3FZ3A 1RXFA 2IXCA 4QPGA 5GLZA 4HN0A 4LKEA 3V0BA 3VBRC 2OA2A 3I3BA 3NNGA 4LBQB 1AL22 3C3VA 2DUPA 2VXJA 1SPPB 3EQEA 5FZHA 3OY8A 2WWSA 3LIHA 5DAXA 5FYVA 4BQ3A 5AFEA 3S57A 3VL8A 1A8MA 1XRUA 3UGGA 5CFCB 1E5RA 2VOVA 2X09A 4TYSA 1G9FA 4QDQA 4XBQA 1IG3A 4IEXA 5GALA 2R062 1PIV3 4AI8A 4CA9A 1BBT3 2RR11 3U07A 3NKGA 4OULA 5T5OA 1KS4A 5C4WA 1W90A 4JKKA 1V70A 3IN9A 2J1EA 5BNNA 5FYHA 2DBIA 1AR93 3TBDA 3MIFA 2HWF3 2CY6A 5IK4A 5FWJA 2YBPA 3UETA 1HQLA 2X8KA 1LHWA 2UWAA 5FMDA 1SLTA 1QNYA 4QT6A 1JZ7A 4PHZA 4FFHA 4QKNA 1HX6A 3OF1A 1GU3A 3PTYA 4WM7A 4R8HA 1XE7A 3ECQA 3WP3A 3PUQA 4OUSA 1DQ1A 3E6CC 1TME2 2VVFA 1HV1A 3LKJA 4QPIC 3THTA 3KSCA 4I0WB 5IFTA 4QQHA 1VBB1 5A3PA 2IVIB 1GZWB 2IWGB 1C4RA 4QKFA 4AI9A 1RUF1 2BWAA 5AVPA 4FP2A 1JOJA 5FZOB 4AR2A 3KF3A 4AF9A 2MPFA 2BNOA 3GHNA 4NIAA 5FPVA 5FY7A 3M3CA 4N9HA 2RDRA 4E2GA 2VR4A 4H14A 1NXD1 3TEYA 3T2OA 4OHXA 1TZOA 2XGXA 3J9SA 4QPGB 2Y6HA 2KM2A 1RUOA 4LHKA 3B69A 2E51A 4YFWA 1UMHA 4P9IA 4JGZC 1RTVA 3JXSA 2QNKA 2FMDA 3O12A 1S0FA 2R041 4QQPA 2BPA2 3KMHA 3OJBA 5FLJA 4I2OA 1LOFC 1PZ9A 2JE7A 3M7AA 1BEV1 1O4ZA 3LWCA 2RS51 3NNFA 2Z4FA 5FO7B 2PAEA 1KDKA 4Y1YA 3AYEA 3JD73 1DQ2A 4XJWA 4TTGA 2Q8EA 4CRQA 1B09A 1VJ2A 2VMGA 1HRI1 4IGPA 2Y0OA 4YGCA 2X05A 4FO9A 2VNVA 3I2JA 4Y1XA 3U1XA 3ZYBA 5EIYB 3QCWA 2W39A 2RJLA 4YVSA 2BGCA 1S2BA 5C8WA 4FOYA 1FMD1 2OXBA 3VBSC 1HRV1 3D0SA 2RS13 3L9JT 5FMOL 4AFBA 3WUCA 5D2AA 1F35A 2W08A 1I5ZA 4UF0B 1HN1A 1BBT1 2FCTA 2QE3A 2VCCA 2YBKA 3J7HA 4NRQA 4E2SA 4LT5A 1J3QA 1U12A 5E8AA 1Q56A 5K0UB 3VUOA 2VNOA 3VV1A 3PU3A 4V2WA 1AR61 2EXJA 1Z0HA 4N7IA 4BLJA 1RUJ1 4OYUA 1AHSA 1WD3A 1YCIA 4CCMA 5FXZA 4DXTA 2D93A 4BZ4A 3ZPOA 1DLCA 2DU1A 1YQ5A 1V0AA 2A3XA 5C3QA 1CGPA 4OQ8A 2EXKA 5EP9A 2DVBA 3FHIB 2K0GA 3GYDA 3TEZA 3SNMA 5IFPA 1R091 4OHZA 3SCFA 1AXZA 2RG4A 2BZDA 2P4EA 4IGQA 3SXWA 2ZEXA 1K5MA 4HPKA 1VR3A 5CG8A 2GDFA 1G7YA 5ABJA 1AR92 1V6JA 2P6HA 5FOJB 4MGTA 3VGIA 1W8HA 5C33A 3E5QA 1V00A 2VMHA 4I02A 1DG6A 2QQWA 1O3SA 1BCXA 1XNAA 1BHGA 4LK7A 2RDQA 3LEIA 2E26A 1EV12 2MEV1 5KXDA 5A32A 1RUNA 2WS91 1COV1 2B7YA 1D0HA 3AKSA 2HWC3 3KZ4C 3PTRB 4YZ1A 3D6EA 3B94A 2PHLA 4CYDA 5FR3A 3VBFC 3WDVA 5FZ3A 2WT0A 1CZSA 1TMF1 3VD9A 4LBNA 3VHOA 3OTFA 5FDBA 2F6BA 2GN3A 1GMMA 1MACA 2I74A 4IXLA 2XJUA 3JCIA 1H9WA 1FPN3 4LBOA 5BNOC 1CAXA 2HWE1 3GJBA 5F6KA 2J1RA 4QQLA 1FXZA 3BODA 5EJ3A 1RUI3 4IESA 1ULOA 3POIA 4AQTA 5JDBA 1MQTC 4DPNA 4X8NA 5A6YA 3ATGA 4CU7A 5J96B 1FV3A 3WW2A 2PQSA 3FE5A 4BQ5A 3MI8A 4YW7A 1DYOA 4A45A 1RITA 2IXIA 1OUSA 2ORXA 3GZUC 5FZGA 3VHRA 1FI2A 3HWJA 1ND3A 1SQ4A 2QFEA 3ETPA 3OGJA 1AX1A 4BQWA 4HSLA 4NO4A 4XF0A 2KR2A 2VQTA 2VQUA 2SBAA 3VZOA 3ZN6B 1W28A 1POV0 2ES3A 2PHWA 2R1BA 1XYPA 3TN92 1XSRA 3W58A 5H9QA 2HWE3 4CU9A 4AEMA 3ZYFA 3RJ2X 1AXYA 2XJSA 4XFHA 3OEBA 4CP2A 2JEMA 4FP3A 3BPSA 4P02B 1ACCA 4WZCA 3KHCA 3K48A 1N1TA 2OUHA 4YG3A 5DUWA 1HXS2 4XUTA 5FYMA 5K9YA 1ZVFA 1AR72 3T4HB 4KG8A 3GCWA 2DVDA 5FZFA 4BM8A 4CEYC 1UXXX 5FBZA 2WS93 3QOPA 4XPVA 3ORJA 3CMGA 5GZDA 4EV0A 1CIWA 2R071 1J84A 1WW7A 4UT5A 5I91A 2ARBA 1KRIA 4CUBA 5FY5A 3C8XA 2R073 5CISA 2NZ9A 4L97A 4YZ5A 2D6NA 4LBQD 4XHBA 2PTMA 4CUGA 2RJKA 5HV0A 4L8QA 4XMAA 3D0JA 1PVC3 2BBAA 4L0PA 5A7NA 1OSGA 2WYFA 2XDVA 3EYPA 4XQWA 2OPKA 1PX3A 2DCKA 2RS32 2VULA 4PLNA 4EN8B 3FHAA 1UY2A 4HKOA 2VMIA 1K5MC 2DDUA 2WNEA 4LO6B 4Z2AA 1G9CA 2EA7A 3WP6A 5CEHA 2Q8DA 3TRSB 4IE7A 4LBQA 5A3UA 4RSUA 2WC2A 1V9U3 1T6BX 3ME2A 5L7OA 4RA0A 2L9LA 4N43C 4NIDA 1MPXA 1KXGA 4C0BA 3DUIA 3AP7A 4LPLA 5FYTA 4DY3A 4CUCA 2DCZA 1HXS1 4MXWA 2CWMA 4H2AA 5FRAA 1HIXA 1YI7A 1NUKA 5IVYA 5LRRA 3VDDC 2DTWA 4CXYA 3S30A 2EXHA 1ENXA 1POQA 5F39A 3ZFGC 5FY4A 4JZRA 3HMYA 3KV5A 2JJ6A 2FDFA 2GC1A 5FZCA 3TNPB 3K4ZA 3BU0A 4Y20A 4PI2A 5C5TA 1LAJA 1Q8PA 3AMQA 4PJYA 2CWSA 4XVHA 3HR9A 5KHIA 1TMF3 2JG8A 2WA4A 2Y26A 2ZAHA 4CU8A 2WO7A 1RUD3 1CAUB 4DRRA 1T2XA 3ACGA 4A7KA 3ZPYA 2X29A 3CJXA 1O8SA 4XBNA 3E5XA 3HIFA 3T0BA 4GIQA 2QCSB 2TUNA 3MF9A 4BMEA 1J59A 1CZVA 3WDXA 4PF1A 3AXDA 4QM9A 2HH9A 3KHBA 2XJPA 1JXNA 4C0HA 3NSTA 4UAPA 2HWE2 3CEWA 5C5UA 5IHRA 2CDPA 3H1MA 4GAZA 5FWEA 4GMP1 1NCRB 2FZ1A 4BLIA 3WXPA 3O5SA 4DO0A 1N3PA 1ND2C 4QWNA 4ARYA 5JOYA 4RR3C 1H8TB 1U5IA 2W1WA 5IVCA 2WINB 4PF5A 3AYDA 4MGQA 1KFXL 4FQZA 3QH7A 3KCXA 5D1IA 3X29B 1CAWA 1UU6A 4GH4C 4PBPA 1ZRDA 3HNYM 1JUIA 1K5JA 2WS92 2BNMA 4Q2FA 1E5IA 1OF3A 2FQPA 1QNWA 4FXGB 4XUNA 4CCLA 3K4AA 4JGZB 2JDMA 3ZXFA 3SEEA 2VBDA 3ILFA 3RSJA 1NCQC 4JKMA 1SEFA 3QBQA 1NY72 1LENA 3NAPC 4XDPA 1OQEA 1ZRIA 3LF7A 3TYJA 1QY4A 5FY0A 3I8TA 1H1IA 4GB33 4P9GA 3ENRA 1DZQA 3GM8A 4HETA 4CDXB 5HCHA 4BOWA 1ZZBA 2DBNA 3JU9A 1C8M2 3WDUA 2RS33 1NCRA 4XMIA 4A6SA 3M4FA 3VB9A 4P9WA 1MS4A 4QX0A 1QXRA 5ABJB 2BBVA 5C4WC 4AVBA 1CZTA 4YG0A 4MG2A 1RVF2 2E31A 3UK9A 3QH6A 5G04L 2OUJA 4UFKA 1HRI3 4QX8A 1ZRCA 3VD4A 1X7NA 3HBKA 3I59A 4PIXA 4W65A 2HYXA 3IPVB 4BQ2A 4ZU7A 1VE0A 2IZWA 4WVMB 5JPNB 1KFUL 1DGRA 3ALQA 2DU0A 1IKQA 4IW3A 4QGMA 4URTA 5F3GA 4OI1A 4AGGA 4BDVB 1WBLA 5IVBA 3UJOA 4Q4V1 3ZFFB 1Y4WA 4B1LA 2UYBA 2YHJA 3UT0A 1LOAA 5GZGA 3MDPA 3OGGA 1B35A 1U5YA 1QMJA 4XBLA 5LA0A 3H1YA 1CX4A 1D4M1 1VLNA 1W2UA 3CKHA 4FPKA 4FCAA 3TEXA 1EUUA 3H8OA 2O8OA 1ZZ6A 3NJYA 4FPLA 4MGYE 4DRVA 5JOZA 1S2EA 3WSOA 4EJRA 1MQTA 1R1A3 4MGZE 3ZFEC 5DAQA 4RR3B 4OHVA 5FZKA 5LA9A 1NE4A 1QOSA 2P17A 1BLZA 3IKWA 1YEWA 4AG4A 5CU1A 5A1LA 3S6PA 1UL9A 3DN7A 3PHMA 4NN0A 2BTVC 2VZTA 1HB4A 3TN91 1ND3B 1IGOA 4JTOA 1SLIA 1XNBA 5FZLA 4CDUB 2DUOA 4AVAA 2G9ZA 4P9JA 2VOTA 4NPRA 1WLWA 2Y6KA 5FY9A 1OH4A 3ZXJA 3FBYA 1SCSA 2EXIA 4UFIA 3ITQA 2D3PA 3GF6A 5IJRA 1SFYA 5H9RA 3FUOA 1MS3A 2F17A 4FPEA 4OCTA 3WP4A 1FT9A 1WMEA 2D6MA 2DCJA 3A23A 4D0QA 3BOWA 4P00B 3WG1A 4RHV3 1GP6A 2C9AA 4EYUA 4Y1UA 3POEA 2DVAA 2ZX1A 2JD9A 5LA2A 3WZ1A 3OBTA 5IT6A 3RZMA 2IXKA 1WW4A 3CU7A 4CUAA 3KQRA 4ASLA 5IAXA 3ACHA 1C1LA 2ZKNA 1RUF2 3OEAA 1H2KA 4JQRA 1L7QA 4U36A 5FZEA 3HVDA 1NA1C 3LGRA 2FD8A 2Y6FA 4A2UA 1H6YA 1R093 3AZYA 3Q8AA 4IERA 3OG2A 5T54A 2CTVA 3KS7A 3P5BA 4GA9A 1VBB3 2V5YA 2VZ3A 1GLHA 2PLV3 3LIGA 3A0NA 4LULA 4AFMA 4DUXA 4OI0A 2PYTA 2VC9A 2ZKLA 4YW2A 1RUJ3 1JYCA 2NN8A 2YC4A 1GWMA 4XXAA 4GB32 4M0HA 2WN2A 2PA7A 3KWVA 5IATA 5JAXA 1AL0G 1PZ7A 2ZEZA 4IEZA 1RC6A 2WSVA 1ZRRA 5J7MA 4Z92B 2GMPA 1MS0A 3I49A 1ULEA 3KVAA 3ACFA 1SFNA 2XWBB 3P3PA 1BXHA 2IFRA 5BNNB 3ZO0B 2WFPA 1AR91 5BYNA 2JG9A 3POYA 1FMD3 2VW1A 4QPWA 4NROA 4RGAA 4BK4A 1JZ6A 1OF4A 1VP6A 2B46X 3AP9A 4YSFA 4XIOA 3NV1A 2NP0A 2RR13 4EE2A 3LA7A 3THCA 4BWOA 1F4AA 3EMRA 1O8PA 1UY3A 3ZYIB 4IE5A 1YJKA 3I7DA 1VAMA 4UXAA 1AJOA 4NHXA 1G8WA 4NPMA 4INDA 3BALA 3D82A 4ASKA 4AI1A 2J22A 5ACA3 3DXUA 4LE3A 3VDDA 1OD5A 4QHBA 2AEYA 1LNSA 1YHFA 2Y33A 3POBA 3B93A 2QTWB 1AR81 2ETEA 5ABJC 2TEPA 3WNMA 4N43A 3OBAA 2UY9A 4M3CE 1W39A 2A6VA 2JIGA 1WCKA 2C9KA 1D7PM 1J83A 2CYFA 1PNGA 4XOGA 4HVQA 3NWKA 1S55A 2P2KA 4P08A 2A71A 2E32A 4Y22A 5DAVA 1BYHA 2YY1A 1IHMA 4KBZA 4N53C 1UYXA 3W20A 1ULDA 2BVBA 3TB0A 2VOWA 1D4M2 3ZMOA 1VRH1 4BE3A 1SCRA 5L36A 2CHHA 1PO22 2ET1A 1YWKA 4QDRA 5A7PA 2RS52 3ZYHA 2D98A 2ZMLA 3O14A 3NO8A 3WEZA 4Y33A 4Q26A 1POV3 1W9FA 2NPIA 2W87A 3SMHA 5CYYA 4FOWA 2WT1A 4OMDA 3CIHA 5EFUA 5FZAA 4XUQA 1W2OA 2WFF3 2YROA 4LO8A 4I3GA 5LWBA 1PMJX 1ZZ9A 3VKNA 5GKAC 2EIDA 3ZFEA 1W9YA 4S2GA 5F5IA 3SKVA 2CGOA 3CLPA 1AX0A 4QX2A 1GOGA 1DU3D 4YW4A 1ZBA1 3U75A 4CEWA 3ST7A 3VKMA 1Q8QA 4UW3A 4Y1ZA 2ATFA 2DCTA 4XFCA 5FZ9A 5LW9A 1UPSA 2DFBA 2ZX2A 5IUQA 3VBFB 1DQ0A 3T30A 3DYPA 5KHGA 1NQDA 4N53A 2ERFA 4ZXEA 5DZFA 1PVXA 4XQDA 1H30A 4MZUA 3WNXA 1O4YA 2Q4SA 5D8AB 4P5HA 2YZ4A 1DIWA 5DUUA 1JHJA 2VZPA 4HSJA 4EZHA 4RQPB 1O5LA 4LHNA 1UCXA 2VZUA 1QOTA 5DG2A 4CDQA 2LM3A 1YIPA 2HWC2 4KGQA 4JRAA 4QXCA 3WINE 1IS3A 1AR71 1C5IA 4AW7A 3GJAA 3OOXA 5L7OB 4LHLA 1VAKA 4Y3OA 1K42A 2HBTA 1ZBE1 1ULGA 4A3ZA 4CDUC 4NVPA 1OI6A 3H50A 1KDMA 5F5CA 5F8PA 2VQ0A 1OKQA 1EUTA 3NL1A 3QACA 1OA3A 5FV3A 4R9CA 2RR12 1U5ZA 4YW3A 5FMCA 3O1RA 5L9VA 2R061 3RRDA 1GZCA 4MGSA 2W95A 4ZU5A 5CB7A 2XQRA 4HFSA 3LA3A 4MOAA 1G9AA 1GKBA 3GZEA 4BQ1A 1DQ6A 2Y6GA 1DGWX 2N7GA 3AJYA 2E6VA 3FMGA 3PUSA 1AL21 1UYPA 2RVAA 4K9SA 2EAKA 5EWSA 2E33A 3ZSJA 1KS5A 2PELA 4LLOA 5T5LA 3N7LA 3ZM8A 2FCUA 1RUD1 3O0VA 1I1EA 4GULA 2QQMA 3MIBA 5F3CA 4LQRA 3HT1A 4MXVA 5ANNA 5GZCA 3TN93 3WD5A 4FVVA 5EQUA 2A7AA 4M00A 1PO13 2GMMA 4HZFA 1DGLA 3ABZA 3VHPA 5LCWL 2NQYA 4DXSA 2IFWA 3NNJA 3AVRA 3VBHC 3EB7A 4HK8A 5EPAA 1CAXB 2ZX4A 2WZPP 1GZWA 3IMNA 1UF2C 3LSEA 2BFUS 4D7SA 3UKNA 1MR5A 3DECA 4JQTA 2WZ8A 4XW3A 3ZFEB 1VPHA 2ZGKA 4BISA 2DV9A 4EN7B 1D4M3 4M3CF 1EV13 4B8EA 3NAPB 2DVFA 3MF6A 4GZ9A 2Y0IA 3I54A 5T5JA 1EV11 4XHXA 1UKRA 5F1RA 2Z5WA 4LE4A 1RUI1 2P34A 3DYMA 4ITCA 1I9RA 2LTNA 3RZHA 1EAH1 1WA6X 4EN6B 1CPMA 2XLGA 1FPN2 4OUEA 1QJU2 1UMIA 3CHXA 2IXHA 2WL1A 4N53B 4RS5B 1W6PB 2XH6A 4D8MA 1URXA 4CEWC 5KR7A 1SG3A 4FOQA 2XOMA 4NIIA 2BOJA 1IPKA 4QMAA 5KHJA 1ZREA 1JBCA 4GALA 5C8CC 5EYYA 1JYIA 2WQZC 4B4RA 3SQOA 3N35A 4C1WA 4AQ2A 3DPRB 1V6IA 2RS31 2R49A 3MZHA 4NHKA 5DAWA 3N4MA 5M0TA 2R7EB 3ON7A 2WQ8A 3U37A 1OLQA 4CCEA 4EN0A 5LB6A 1NE6A 2J1AA 3TWIA 3PVEA
chains in the Genus database with same CATH topology
4BQ5A 3ZYBA 4BQ2A 1OKOA 2JWPA 1V0AA 5D21A 1W8WA 4LK6A 4YW7A 3ZYHA 4AL9A 4LKEA 2K46A 1W9FA 1HN0A 1WZXA 3ORJA 4YWAA 2VXJA 2C24A 4BQ3A 1W8TA 2KR2A 1GWLA 2LROA 1W8UA 3UT0A 1WMXA 4A6SA 4CP9B 4CPBA 1L7LA 1WCUA 4LKDA 3ZYFA 4CP9A 2LRPA 4LJHA 4YW6A 1OH3A 1GWKA 2O14A 1UOJA 4LKFA 4LK7A 2WYFA 1W90A 1W8ZA 4BQ4A 4CPBD 1GWMA 3F95A 2Q1FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BQ5 A;  3ZYB A;  4BQ2 A;  1OKO A;  2JWP A;  1V0A A;  5D21 A;  1W8W A;  4LK6 A;  4YW7 A;  3ZYH A;  4AL9 A;  4LKE A;  2K46 A;  1W9F A;  1HN0 A;  1WZX A;  3ORJ A;  4YWA A;  2VXJ A;  2C24 A;  4BQ3 A;  1W8T A;  2KR2 A;  1GWL A;  2LRO A;  1W8U A;  3UT0 A;  1WMX A;  4A6S A;  4CP9 B;  4CPB A;  1L7L A;  1WCU A;  4LKD A;  3ZYF A;  4CP9 A;  2LRP A;  4LJH A;  4YW6 A;  1OH3 A;  1GWK A;  2O14 A;  1UOJ A;  4LKF A;  4LK7 A;  2WYF A;  1W90 A;  1W8Z A;  4BQ4 A;  4CPB D;  1GWM A;  3F95 A;  2Q1F A; 
#chains in the Genus database with same CATH topology
 2ZEW A;  1W2A X;  3UGF A;  3SCG A;  4LK6 A;  4LTA A;  4Y4R A;  4GH4 B;  1Z7S 2;  1WZX A;  4GH4 A;  1VAL A;  4G9S B;  3PIG A;  5A70 A;  2EVX A;  1QGL A;  3K46 A;  4P9Y A;  3WP5 A;  4LOT A;  3WG4 A;  3DXT A;  1OUR A;  2ZGP A;  1RVF 1;  3Q8C A;  5FUI A;  1XOY A;  3P1I A;  2DUR A;  1WCU A;  2JE9 A;  5A3T A;  1LEC A;  3AFK A;  2EIE A;  4E8D A;  1LOD A;  2OZJ A;  1H8T A;  2B9U A;  2GNT A;  2RMU 1;  4GMP 3;  4L2N A;  4W6X A;  1LCL A;  1NA1 B;  4AI0 A;  5C8C A;  1GOF A;  1ULC A;  2IVJ A;  2Q8O A;  1QOO A;  1V6O A;  2Y6J A;  4MO3 M;  5BNO B;  2VME A;  1ZX5 A;  1OA4 A;  3T2T A;  4QB1 A;  1HN0 A;  4K3U A;  4QX1 A;  2HWB 2;  4UFJ A;  3VKF C;  1V6K A;  1QHD A;  4DOU A;  1PVC 2;  2HLE A;  2G19 A;  4MH0 E;  2VMF A;  4DQA A;  3KM5 A;  3BOP A;  4M3C B;  4BPZ A;  1I5P A;  3MIH A;  3ZR6 A;  4XIL A;  4AEJ A;  3CZJ A;  1TE1 B;  4FBF A;  3AL5 A;  1H0B A;  3FFZ A;  4YVW B;  2Y60 A;  1ZA4 A;  1C3H A;  3HAG A;  1N3Q A;  1OPO A;  4JHZ A;  3CJI B;  3MEP A;  1JOP A;  2JG8 B;  2ZAC A;  1REE A;  3TOJ A;  3WOG A;  3GCX A;  1FV2 A;  5BNP A;  2XKO A;  2XVK A;  3J7L A;  1DYP A;  2WKK A;  4QXK A;  3C7G A;  3OD0 A;  4LMF A;  1ENQ A;  1DQ5 A;  3OGS A;  4WM8 B;  1SDW A;  1UZY A;  2Y64 A;  5A7S A;  1UU4 A;  4IET A;  1CIY A;  1Y7B A;  4COY A;  1COV 2;  1NT0 A;  3RYR A;  3FFQ A;  4AFC A;  5BNP C;  5IVJ A;  3TAY A;  3MW2 A;  1DP0 A;  1X33 A;  3HNB M;  5JVV A;  3OUI A;  3N3H A;  3AK0 A;  4QQO A;  1ULP A;  2V09 A;  3N9M A;  4RQP C;  4HT1 T;  3VBS B;  4IEY A;  1OA2 A;  1XNT A;  2XML A;  1I6X A;  4IE0 A;  1RJ7 A;  1W3X A;  1UU5 A;  3J7M A;  5F3E A;  1RUH 3;  5JOW A;  3BTZ A;  1MS9 A;  2NLR A;  2X10 A;  4C1X A;  1UY1 A;  2WJS A;  2WWJ A;  3G6J B;  3WX5 A;  3N7J A;  4FTB A;  1AL2 3;  2HWC 1;  1O4T A;  4CP9 A;  3H8X A;  3OPT A;  2FCV A;  4R9A A;  3V0B B;  3SKJ E;  2I45 A;  3NQH A;  5GJ6 A;  3B9C A;  2CAU A;  1IS6 A;  3L2Y A;  4C90 A;  4UFH A;  5BXX A;  4K7J A;  1JH5 A;  2NMO A;  5F32 A;  4J1X A;  3RYK A;  1CWP A;  1LRH A;  1BBT 2;  2DFC A;  1QH7 A;  3GBF A;  4KU7 A;  2OYZ A;  3POG A;  5A7W A;  2KA3 A;  1MZF A;  3A21 A;  3FN9 A;  5JUV A;  4XJ9 A;  1JMU B;  5FZ7 A;  5LA1 A;  3JD7 1;  1B35 C;  1N3O A;  4PIZ A;  4CZS A;  2UYA A;  5KXC A;  4B7E A;  5E16 A;  3AMH A;  4LBJ A;  4ET7 A;  2C0Z A;  2JDY A;  1JYX A;  2YC2 A;  4J6G A;  2XPJ A;  4G4F A;  3VBO A;  5JI7 A;  1HB3 A;  1WBF A;  3ES1 A;  1BJQ A;  1D2Q A;  1WCQ A;  2RDN A;  2XLA A;  1CR7 A;  5C9A B;  2QZ3 A;  2GC0 A;  1BKZ A;  3WHT A;  1W8Z A;  1TME 3;  3I3D A;  2RMU 3;  2W91 A;  1AR6 3;  5EXO A;  1NCR C;  3OGR A;  1ZZ7 A;  4NRP A;  1S0E A;  4XJ8 A;  4K8R B;  2CNA A;  3WW4 A;  3ZN6 A;  1GNH A;  4JDO A;  3ZYR A;  5DMY A;  3VKL A;  2R04 2;  2AEZ A;  1VMJ A;  2FHR A;  3A22 A;  1VRH 2;  4LOR A;  1VBC 1;  3BYW A;  4X6Q B;  2RJ2 A;  3LOI A;  1VBE 1;  4BHP A;  3J7N A;  3ZN4 A;  3OUJ A;  5LK7 B;  5FPX A;  4HVO A;  5DUV A;  2DF7 A;  1PGS A;  3INA A;  2VTX J;  3PLQ A;  4I09 A;  1S0D A;  3I3Q A;  4HVR A;  2YUE A;  2WNV C;  1IOA A;  4CE8 A;  2BU9 A;  4V2V A;  2ZOE B;  2EAL A;  4KL1 A;  4RS5 A;  4BJ0 A;  4COV A;  1KIT A;  3T08 A;  4CP1 A;  2PAM A;  4XZP A;  1MZE A;  1S4C A;  2F4L A;  1TEI A;  5FCC A;  5FMO S;  3FUQ A;  3W59 A;  1OXC A;  3K77 A;  1H8T C;  1ALY A;  3LDK A;  4XC9 A;  2B9V A;  1VBB 2;  2YGL A;  2OZ6 A;  3GHM A;  3KCY A;  2ZGN A;  3BIE A;  1COV 3;  2K2S A;  2FDH A;  2GP3 A;  2ZBJ A;  3ZSE A;  1L3J A;  2HWF 1;  2JIJ A;  3AP6 A;  4Q4Y 2;  5L9R A;  4W8J A;  3T09 A;  2W52 A;  5I0U A;  3WQ0 A;  2PXJ A;  3RG0 A;  4D7Y A;  1A34 A;  2D6O X;  4HK9 A;  3BN6 A;  5ERL A;  4QQ2 A;  3WG3 A;  5C7G A;  1R1A 2;  1UPI A;  1FNY A;  4WM8 A;  3RWK X;  4Q8K A;  2FDK A;  2ZGU A;  3NNL A;  3URF A;  1QKQ A;  3LE0 A;  4GQ7 A;  3RYP A;  2J1S A;  3NRU A;  4LJH A;  2V5D A;  4R4X A;  5ANQ A;  2QQU A;  4IEV A;  2C4X A;  2Y8K A;  1H1M A;  3I3M A;  3AKR A;  3HD8 B;  3AKQ A;  4SLI A;  2OT7 A;  4FTS A;  5FLH A;  4BB3 A;  4E27 A;  5IK7 A;  5A6Z A;  4SBV A;  5J98 B;  5I8S A;  5TSW A;  2XLF A;  2WII B;  4QU2 A;  4S2H A;  1MVE A;  2VVE A;  4QM8 A;  5GZE A;  4YZ2 A;  2MEV 2;  4IV1 B;  2R0F A;  4CCJ A;  1H6X A;  3ZXL A;  1JU3 A;  1PK6 C;  1G9B A;  4GD4 A;  4CP9 B;  2WT2 A;  1OUX A;  1UWW A;  5JMO A;  3NJZ A;  4XIK A;  5FZ8 A;  4Q0P A;  3IDB B;  3POF A;  4GMP 0;  2WO1 A;  1SDD B;  2HWD 2;  3U0Z A;  1NYW A;  3DCQ A;  4AAP A;  3AJZ A;  3AYC A;  3ZXK A;  3PJQ A;  2XG3 A;  2FDI A;  2JXA A;  1WLD A;  1ODM A;  1SZB A;  3LEK A;  3HJR A;  2GZW A;  2EIB A;  1R09 2;  1ONA A;  1W3V A;  4IL7 A;  2VH9 A;  1NA1 A;  3CF6 E;  3N7K A;  4AK3 A;  1QQP 3;  4QGL A;  3JBG 3;  5JSO A;  1DGW A;  1QJX 1;  3VZN A;  4BXS V;  4LBL A;  1STM A;  5A7O A;  1DGR N;  2A6Y A;  1JS9 A;  2G4I A;  1HW5 A;  1GWL A;  4XAA A;  1LHV A;  2VL4 A;  2ENR A;  1RUJ 2;  3POS A;  1PO2 3;  4B7K A;  3ASI A;  4JGY B;  2W3J A;  2RS5 3;  4DB5 A;  2BNN A;  3DKQ A;  1W0O A;  1Q8S A;  3FHQ A;  1W8F A;  2OQ7 A;  3D4K A;  2R04 3;  4TSV A;  1Y43 B;  1XYN A;  3N9P A;  4UW4 A;  2AAC A;  2WRA A;  1VRH 3;  2ZGQ A;  1LJ7 A;  4AVV A;  1N1Y A;  1NLR A;  1QDO A;  1SLL A;  2EF6 A;  2HBU A;  3CZU A;  4M3C A;  3ZFF C;  4AE2 A;  5JZG A;  1HRV 2;  1LGC A;  5BNQ A;  3AKP A;  1LR5 A;  1V6N A;  4QKD A;  4YLZ A;  5BV6 A;  3ILR A;  4NIH A;  1QJY 3;  1WW6 A;  3OCP A;  1N1V A;  2Z2S B;  3AYA A;  4RGG A;  3T1L A;  3R05 A;  1Y3T A;  3MPB A;  3VBF A;  1VBD 1;  3T0D A;  1W6N A;  3FL7 A;  2NYY A;  3CJI A;  5C9A C;  1YC6 1;  2DCY A;  4HN1 A;  3VN4 A;  3POJ A;  4AVT A;  4RHV 1;  1W8U A;  2WDB A;  2XBO 1;  3VZK A;  3WW3 A;  3IDE A;  2Z79 A;  4AHZ A;  5ACA 2;  1DDL A;  4DEQ A;  2XVG A;  3VBH B;  3OBR A;  1GQG A;  1LGB A;  3U78 A;  2D3R A;  3WV6 A;  2WUH A;  3PUA A;  1F15 A;  4Q4V 2;  2ZS6 B;  2D97 A;  1PMI A;  4E4H A;  1LOB A;  4ZPI A;  1IS5 A;  3V0A B;  2TBV A;  4FPC A;  5A3W A;  4CDU A;  1RUG 1;  1SFP A;  3RZL A;  4FQ4 A;  3JUU A;  3WT3 A;  2P3I A;  3LDB A;  4FOV A;  2ZXQ A;  1W2N A;  3VD7 A;  3WNP A;  3IB3 A;  4X6R B;  1DFQ A;  1F2N A;  4JGZ A;  5FO8 B;  3R4S A;  1LHN A;  3TNQ A;  2A70 A;  2VO5 A;  4ZZ5 A;  4AED B;  2B45 X;  3B01 A;  3ZFG B;  4KG0 A;  1H8V A;  4XUO A;  1GR3 A;  4KWU A;  4AXO A;  1JU4 A;  1C8M 1;  3KGZ A;  1LOE A;  2BP6 A;  4XCA A;  1H1A A;  5KC6 A;  4MSV A;  1E5H A;  2VZ1 A;  2I2S A;  5DDJ 2;  1X9P A;  4AI2 A;  3WF1 A;  2JDZ A;  5CFD C;  3RI9 A;  2V4A A;  4Q0U A;  1XB9 A;  4HOO A;  2WFF 2;  4JRL A;  1NY7 1;  2PHT A;  3Q8F A;  3EHK A;  4CDX A;  2J1V A;  4AL9 A;  3QD6 A;  4WVW A;  5EYX A;  1JYN A;  2O8Q A;  1QF3 A;  1QJY 1;  3N7M A;  1CX1 A;  5AC9 3;  1QXJ A;  3ZMN A;  3NW4 A;  2LRO A;  3IPV A;  4I01 A;  4PDW A;  2D5H A;  2WO3 A;  4XDQ A;  5CKQ A;  5BNO A;  1AYM 1;  1K5M B;  4HPK B;  5BY5 A;  1RGS A;  3D5O A;  4QHO A;  4PIY A;  1AR8 3;  3PNA A;  1UYY A;  1M4W A;  3FC0 A;  1QU0 A;  5D8A C;  1AYN 1;  2JG9 B;  3NJX A;  2YFZ A;  3SH4 A;  4CU6 A;  4YM3 A;  3EJK A;  3WNN A;  4J1W A;  4E2Q A;  2AH2 A;  3SIT A;  3VBO B;  4MVT A;  4BIF A;  1V9U 2;  1XBF A;  5FAX A;  5ACA 1;  3H8R A;  1C1F A;  1R08 3;  3O1O A;  5JMC A;  1HB1 A;  1K45 A;  3W5N A;  3JQW A;  4A4A A;  3BUC A;  2C6S A;  1NXM A;  3A7Q A;  4MV2 A;  3JBG 1;  1QQP 1;  3ACL A;  5IVV A;  4HG6 B;  2DWR A;  1XSQ A;  2DYC A;  4AVC A;  1YXW A;  1R1Z A;  2JB4 A;  2ZAA A;  4N9I A;  4PCR A;  1H2N A;  4GXL A;  4NHM A;  3I3E A;  4Y1V A;  2H0V A;  2JDK A;  3LQC A;  1YQ8 A;  4HLT A;  4O7X A;  4ERO A;  5A7Q A;  1DLL A;  1GNZ A;  2O1Q A;  4EWE A;  2W9X A;  4HMZ A;  3B9I A;  4E4S A;  5FTT C;  3I2D A;  3NV2 A;  1NOV A;  1L7L A;  4BK5 A;  1K3I A;  4XUP A;  4XF3 A;  3MBW A;  2X53 S;  4GJZ A;  3MW4 A;  4XAC A;  5FQ0 A;  4RS5 C;  1Y9M A;  3WQ1 A;  2ZEY A;  5DAB A;  2F4P A;  3BTY A;  5D8A A;  1F9K A;  4UI9 L;  4DIN B;  2QQP A;  1RUE 3;  1HV0 A;  5AC9 1;  4QPI B;  3UKV A;  2VW0 A;  1HLC A;  1NAE A;  4IV3 C;  3O1P A;  1W6N B;  2VCM A;  1UZZ A;  2ILM A;  1EP0 A;  1QJE A;  4Y5Z 0;  2PHU A;  4N7U A;  1JYT A;  1UAI A;  4MET A;  3K75 B;  4CDW B;  1NKG A;  4Q4V 3;  5CNA A;  2PQQ A;  2A6Z A;  5FP7 A;  1S0B A;  1YFX A;  1GFF 2;  4NE9 A;  3IDC B;  1PO1 2;  2YYO A;  4CPB A;  1OVP A;  5CFD A;  2K9Z A;  4XEZ A;  4RFR B;  3LAG A;  5EJ1 B;  4ZKT B;  3R4U A;  5FP8 A;  4I30 A;  4NOT A;  1FAY A;  5BPX A;  1W6Q B;  4Z2W A;  5JLV A;  4CDQ B;  4FAH A;  1JZ2 A;  3III A;  1NLQ A;  5KBF A;  5HCA A;  1RUC 3;  3OSD A;  5KXB A;  5C3O A;  3M3Q A;  4YVS B;  3MGU A;  3E6B A;  1J3R A;  1RHI 1;  2XHN A;  3I2F A;  3THD A;  1C28 A;  2C1F A;  2A6X A;  1WW5 A;  4Y20 B;  1C8N A;  2QBX A;  5A1A A;  5C4W B;  4CDW A;  3AL6 A;  4QPY A;  1QXP A;  4LIU A;  1YJL A;  2D6P A;  5FJK A;  5DDJ 3;  5GLV A;  4K20 A;  3VDC A;  2WWU A;  3ZYP A;  2BVV A;  4PLO A;  4MXW B;  2ZHN A;  4HKL A;  4AGR A;  5H9P A;  1QIQ A;  2VMD A;  5FZM A;  1W6Q A;  2BOI A;  3VBR B;  4AQ6 A;  1OFN A;  5HPO A;  4BQ4 A;  4CDW C;  3ZDV A;  2JD4 A;  1BVP 1;  3HNM A;  3OYW B;  2WYS A;  2OS2 A;  4Q4W 2;  5CA6 A;  2CGP A;  3ELN A;  3GGL A;  2WAA A;  4BQX A;  3OYW A;  4K1Z A;  4CCO A;  1JZ3 A;  3CO2 A;  3I59 B;  1LU1 A;  4GWM A;  1GZ9 A;  2P3Y A;  1RVF 3;  3LB9 A;  4XCB A;  2YMZ A;  4MHR A;  2DUQ A;  1HDK A;  1W6M B;  4IQP A;  4X8P A;  5F9T A;  1AJK A;  5A3M A;  1NQJ A;  2GNB A;  4BXF A;  4OUM A;  4FXK B;  3UJQ A;  4EWA A;  2VXR A;  1QH6 A;  1SBF A;  1W8O A;  1C5H A;  3BB6 A;  4ORF A;  2Q8C A;  2B8M A;  2GAL A;  1WD4 A;  2VCA A;  3AP5 A;  3MO4 A;  4KI5 M;  4KNC A;  4XE9 A;  4YGB A;  3LD8 A;  4W4Z A;  5FXV A;  4ES9 A;  1ZRF A;  2A5Z A;  5FKB A;  4KWK A;  2Y34 A;  4LO5 B;  5IW0 A;  4OI4 A;  2YBS A;  1PK6 B;  5H9S A;  4HBN A;  3RZJ A;  4N43 B;  1ENR A;  3RZZ A;  1AZD A;  2YXS A;  3C7F A;  5J36 A;  4D3W A;  4YWA A;  5K0U C;  2LUW A;  3NVC A;  2ZCW A;  2OW4 A;  3NMB A;  3VBO C;  1JZ4 A;  3VD5 A;  3KB5 A;  1TQ5 A;  4B4P A;  3K2O A;  2GND A;  1RYY A;  2BW8 A;  3IDA A;  2P1B A;  1ST8 A;  4PQ9 A;  5FYY A;  3U4S A;  1PGW 1;  3RI8 A;  1IQD C;  2FDJ A;  4GKX A;  3M3I A;  2HEW F;  4L11 A;  5F6L B;  2PHD A;  2VTX A;  4MYE A;  5FJH A;  4MAD A;  1APN A;  1EY2 A;  3AFG A;  4AOC A;  1W0N A;  4A7Y A;  5B4N A;  4HAN A;  3SCH A;  4AED C;  3MV1 1;  4YM0 A;  1UX7 A;  1S0I A;  2KD7 A;  2W47 A;  4ASM B;  2VZS A;  1VMH A;  1MZ5 A;  2PN5 A;  1YIF A;  3PL0 A;  1PIV 2;  5FUN A;  1UIJ A;  1HQW A;  3UES A;  4XYX A;  1HB2 A;  3WQ7 A;  1VRB A;  5IVE A;  3H1W A;  5FBJ A;  4K21 A;  1DBN A;  1PZ8 A;  2ZJC A;  4UBH A;  4RYD A;  1RUF 3;  2ZGM A;  2WSU A;  2J42 A;  2VBB A;  3J26 N;  5LK5 A;  2GSY A;  5JXI A;  4NWV A;  1SBE A;  1WGP A;  1OMI A;  1AXK A;  1GYK A;  3G7D A;  5C70 A;  5FPL A;  4ZS2 A;  4IGO A;  2MHF A;  1LOC A;  5A3O A;  5L9B A;  2XWJ B;  3V65 A;  5F3I A;  4Q27 A;  4ZXK A;  5C3R A;  1OVS A;  2PHF A;  3LSD A;  2Q1F A;  1OOP C;  4FSJ A;  4CDX C;  3HQU A;  5E1R A;  2AEN A;  4G3Y C;  4AYU A;  3AP4 A;  2CU5 A;  4IUG A;  3GNE A;  4GWJ A;  4KWJ A;  3WDW A;  4AVS A;  4CP0 A;  2LW8 A;  4A41 A;  5B4X A;  3AXE A;  2RV9 A;  1QEX A;  4CXX A;  1OBN A;  3C7E A;  5FP9 A;  4R9B A;  4AWD A;  4KU8 A;  1AR6 2;  1ND2 A;  3SC7 X;  5A32 B;  3A0K A;  3IZO A;  3I97 A;  5GLW A;  4NJ4 A;  5G05 L;  3RNS A;  3PUR A;  3PJY A;  2QKD A;  4I0A A;  3T4V A;  4ZON A;  4P9L A;  1OLR A;  1OH3 A;  1FMD 2;  3ZXG A;  1RUH 2;  4COW A;  1UOJ A;  5J3U A;  2VMC A;  5JSR A;  1FX5 A;  5CKM A;  5T3N A;  2ARC A;  1OHF A;  4ZU4 A;  1S0J A;  3VZJ A;  4YM2 A;  2JDH A;  4COZ A;  5A1F A;  4F7Z A;  1Q8O A;  1ENS A;  4QX5 A;  1W8W A;  4Q1P A;  2W1S A;  4XFB A;  2W1Q A;  4MLO A;  4OQ9 A;  3V64 A;  2DTY A;  1HJF A;  2VG9 A;  4JTN A;  4UFM A;  4YVW A;  4E4Z A;  1V9U 1;  4QU1 A;  1U0A A;  3RWN A;  3BVC A;  1BZW A;  2Q30 A;  4ISQ A;  3HPN A;  1BEV 2;  1Y9Q A;  2BRT A;  3FLP A;  1ZNP A;  4CVU A;  3GXU A;  4PI0 A;  1UYZ A;  5FY8 A;  4YYO A;  1RMU 2;  5FZI A;  4YZ4 A;  2KXL A;  2W1U A;  2XHK A;  5KWR A;  3OPZ A;  4A3X A;  2ZGS A;  4Q4Y 3;  4QX3 A;  2RM2 1;  3KT1 A;  5L19 A;  3D3A A;  4YNI A;  5A33 A;  1TNF A;  4GWI A;  1Q3E A;  4LBM A;  1OFS A;  3DEM A;  3I2I A;  2AUY A;  4WM8 C;  4B3N A;  5T52 A;  1WLC A;  5FFO C;  4Z1V A;  2RM2 2;  2HWB 1;  1WMF A;  1XU2 A;  4NAO A;  4RR3 A;  1QWR A;  4XJA A;  1JYV A;  3VBH A;  4WZF A;  3RZG A;  3E5U A;  1CON A;  1CJD A;  1OT5 A;  2PHR A;  2QDN A;  2VBP A;  3ZKU A;  5C3S A;  1A78 A;  1KQR A;  1OOP B;  3SH3 A;  4DUV A;  1LHU A;  1AYN 3;  4BH9 A;  1Q43 A;  5A80 A;  3AB0 A;  1YO8 A;  4M0N A;  1LHO A;  4DFS A;  2MEV 3;  2XB6 C;  3BIW E;  1X8E A;  4LUM A;  3GAL A;  5FZ1 A;  2ZAB A;  2IUW A;  3UYJ A;  5I93 A;  3EBR A;  1SPP A;  3BPZ A;  3THP A;  1UY0 A;  1ZBE 3;  2C5D A;  1QJF A;  3WNK A;  1YNA A;  2B42 B;  3H9A A;  3RS6 A;  3VLB B;  5JR7 B;  2BUK A;  4NHY A;  4IEQ A;  4Z82 A;  1CN1 A;  3MUZ 1;  3LPG A;  4FT8 A;  3DPR A;  1H4G A;  1JOB A;  1YQC A;  2CDO A;  2D43 A;  5L73 A;  4WVZ A;  2SLI A;  5JR2 A;  2D5F A;  1OD3 A;  3KV6 A;  4UOJ A;  1CAW B;  3HN3 A;  3WVJ A;  1F31 A;  4CEY A;  2PFW A;  2FBE A;  4LKS A;  2LRP A;  2XBO 2;  4B4Q A;  1V6L A;  1FOD 2;  2DVG A;  3MID A;  1OQD A;  2VGD A;  4Y26 A;  4UW6 A;  2UU8 A;  3OPW A;  3RMY A;  3ETQ A;  1ASJ 2;  1VBD 2;  4BU2 A;  4IV3 A;  4XAE A;  5FYU A;  3POW A;  2VOX A;  4LR4 A;  1FNZ A;  1XND A;  1ODN A;  2D40 A;  3MLJ A;  5L7O C;  1O3R A;  2UUR A;  1YLL A;  3USU B;  1UQX A;  4NMI A;  2RS1 1;  4JKL A;  1HRV 3;  2ZGT A;  2J1U A;  1CD3 G;  4A7Z A;  2YB7 A;  2O0O A;  1RUI 2;  4YG6 A;  2A75 A;  1OLM E;  3MLK A;  1PM7 A;  3EO6 A;  3RZK A;  2VUA A;  2AGS A;  4FFI A;  1PIV 1;  2R6Q A;  4FPJ A;  4YZ3 A;  2A3W A;  4RN5 A;  3AMP A;  2XXZ A;  5LRS A;  2WZR 2;  1W9S A;  1MS8 A;  2WR9 A;  2XUE A;  2ZGR A;  2QUO A;  5HBA A;  4DNY A;  5FZD A;  1SAC A;  3O7O A;  1R64 A;  4Q8L A;  5FYB A;  1CAV A;  5FO9 B;  2YC0 A;  5FRE A;  3U11 A;  3BCW A;  2PLV 1;  1PGL 1;  2X5I B;  2YU1 A;  1VBA 3;  1UZ0 A;  1YFY A;  4B29 A;  2WQ4 A;  1UOF A;  1KEX A;  3H0O A;  2JKX A;  3S5A A;  2Q0A A;  5CZK A;  4DY5 A;  4KWL A;  2CAV A;  5CVR A;  2VAU A;  2HWD 3;  2W68 A;  2VY0 A;  3BU7 A;  5FXW A;  1W6O B;  4KH9 A;  4MX3 A;  3VBS A;  1A6C A;  4ZZ8 A;  5FZ6 A;  4R52 A;  1F5J A;  4FAG A;  5E6H A;  2UWC A;  2QDR A;  2B39 A;  2XJT A;  3OUH A;  4D7T A;  1ASJ 1;  2ZGO A;  2BER A;  3JBG 2;  4PBO A;  5GM0 A;  2E7A A;  5FLI A;  1WCS A;  3DYO A;  3MFC A;  4O65 A;  2JX9 A;  4AAX A;  2UWB A;  3GBG A;  2B4K A;  3VHN A;  4D94 A;  5EZW A;  3E1F 1;  2BWC A;  1GOH A;  2BQP A;  1Y9G A;  2HEY F;  3S7I A;  2FMY A;  4QDS A;  1AYN 2;  1JW6 A;  1LKN A;  3ZN5 A;  1OLM A;  4XFG A;  1BQP A;  4YAR A;  4BYY A;  2BEO A;  2XR4 A;  5EHD A;  4URA A;  3GZA A;  3WF0 A;  4COU A;  3N9Q A;  3GBW A;  1ZBE 2;  2EIG A;  1QJY 2;  3RVH A;  2GN7 A;  4M4P A;  1OQ1 A;  4W6Y A;  4TZD A;  2YU2 A;  2ZMN A;  1RUC 1;  4PDW B;  4JC1 A;  2O14 A;  2BGP A;  1E5S A;  2WNU A;  2ZMK A;  3VBR A;  4A44 A;  5FOB B;  2E9Q A;  1JOD A;  2JDA A;  2WAO A;  1CPN A;  3M3O A;  4LA3 A;  3W9A A;  3WQB A;  4KMQ A;  1DYK A;  2OII A;  3C7O A;  5FK8 A;  1W8N A;  5HCF A;  4DS0 A;  2JG9 C;  3F2Z A;  1JN2 P;  1PM4 A;  2CL2 A;  3WNO A;  4FPY A;  1C57 A;  4XZU G;  2LAL A;  2XBO 3;  1R08 2;  1HKD A;  2QJV A;  4QPI A;  4IE4 A;  5IK5 A;  1D4V B;  1IPS A;  5IK8 A;  2JG8 C;  3J8F 2;  1YRZ A;  2CV6 A;  1ULF A;  1O3T A;  2G9G A;  1VBD 3;  4KGG A;  1UZV A;  2X5I C;  3VBU B;  5A6X A;  3C7H A;  1BK1 A;  4XFA A;  4R9D A;  5E88 A;  1PHM A;  2E53 A;  5FZ0 A;  5FZB A;  5KHH A;  4JV4 A;  2ZZJ A;  2XL7 A;  1JUH A;  2JEN A;  3MPP G;  1ZZ8 A;  1VBE 2;  4CTE A;  3ROU A;  1YYN A;  4Q4X 1;  4DXR A;  2E63 A;  2QVS B;  1G6N A;  3ZSM A;  3NNM A;  1RED A;  1RMU 1;  3IAQ A;  4F83 A;  2GAU A;  4P14 A;  3ZFF A;  2K46 A;  1RUG 3;  4QKB A;  1QJZ A;  3PIJ A;  1DF0 A;  2JDU A;  4QAW A;  4LNV A;  4XAB A;  4ZY9 A;  1GIC A;  1X50 A;  1RUE 2;  1CJP A;  5T55 A;  1BK0 A;  1LEM A;  2AR6 A;  5F5Q A;  1RXG A;  5I0D A;  2A6W A;  5JIU A;  3V56 A;  4LBK A;  5KC5 A;  3R4D B;  1LB2 A;  2HWB 3;  4CCN A;  3APB A;  1MEC 1;  2XQX A;  4LKD A;  3UNP A;  3CDZ B;  4LXL A;  3B02 A;  5C71 A;  3I2H A;  4ATE A;  3WR0 A;  5JI9 A;  5J09 A;  1H2L A;  1AUY A;  2ZX3 A;  5FQ0 B;  1NZI A;  3PUH A;  4C8D A;  3T1M A;  1W6P A;  3MHZ A;  4LEJ A;  5JCT A;  3DL3 A;  2R06 3;  5DUX A;  1VBC 3;  2VQA A;  4IEU A;  5D21 A;  4RGK A;  3ILN A;  1JTZ X;  4LIT A;  5GZF A;  4PT6 A;  2QQN A;  2Q5T A;  2R1D A;  5DAP A;  1XPW A;  4J25 A;  2R16 A;  4F3J A;  2WAB A;  2ZHL A;  2ARE A;  2Z42 A;  4PQQ A;  3MW3 A;  4AFD A;  3KVB A;  1BVV A;  2FZ2 A;  4NR1 A;  3DGT A;  4WM7 C;  5FY1 A;  3O1M A;  3ZXE A;  3O0X A;  1O6U A;  1LGN A;  4S2D A;  1VBA 1;  4Y4Y A;  5LBB A;  3GDB A;  1KGY A;  2ZGL A;  2W2I A;  4CEY B;  4MUV A;  1F4H A;  3VBU A;  3H7Y A;  4MHU A;  1TG7 A;  4AED A;  2OKX A;  3AZW A;  3TEW A;  1FOD 1;  3HN1 A;  2D6K A;  4RL7 A;  5JZG C;  1WLT A;  2WO2 A;  5JXG A;  2R30 A;  1QJX 3;  4OMC A;  3I2G A;  3ZXD A;  5IYY A;  2ZZQ A;  4XXP A;  1C8M 3;  1EPZ A;  4IEP A;  4NUB A;  4CSW A;  1GP5 A;  3WHU A;  2IXJ A;  4BCU A;  4DEV A;  2CGN A;  2VUJ A;  3B00 A;  2VZO A;  2GME A;  4FPH A;  2BJS A;  4XUR A;  4ZS3 A;  3WDT A;  3FBM A;  4BA6 A;  5HV4 A;  3HT2 A;  3S0M A;  4KQ7 A;  5K8S A;  2ZHK A;  4GB3 1;  4IEW A;  2YG0 A;  1GZT A;  1XC6 A;  4JX0 A;  4N90 A;  1XJA A;  5JZG B;  5JXH A;  4UW5 A;  3MIE A;  4I3P A;  4ARX A;  3SH5 A;  1A8D A;  3HEI A;  1LU2 A;  2Q1M A;  5CAD A;  1YQ2 A;  5DQ0 A;  4LUK A;  3OBZ A;  4ONU A;  4QPG C;  5I0T A;  5T50 A;  4YGD A;  2WFF 1;  1VAV A;  1GBG A;  3BGA A;  5SV5 A;  1GQP A;  3ZLI A;  4CPB D;  4DIQ A;  1CAU A;  1UOG A;  2WZE A;  4R4Z A;  3PMS A;  3R6S A;  3SLI A;  5CFC C;  1LTE A;  2WLQ A;  1PGW 2;  3J8F 3;  3OB8 A;  4JAA A;  5F2S A;  4AQS A;  5C8C B;  2B5H A;  4RD7 A;  2XON A;  4QX7 A;  5FMB A;  1WCD J;  3KV9 A;  4UYB A;  4GJY A;  2D44 A;  4AFA A;  3J4U H;  4FFF A;  1GUI A;  1BMV 2;  1R1A 1;  5GLT A;  3NKT A;  3N9N A;  2D6L X;  3VD3 A;  1NCQ A;  4KBB A;  3AMN A;  2TNF A;  5FPZ A;  4Z8B A;  4EN9 B;  4AZZ A;  1RUC 2;  2OX0 A;  3T2P A;  1RL3 A;  4ZHN A;  2GP5 A;  1Q5O A;  4YM1 A;  2ZPX A;  4K8F A;  3ZKY A;  1RUG 2;  3L2H A;  1W05 A;  1PX4 A;  1SHW B;  4IDZ A;  3WY6 A;  2VPV A;  3AX4 A;  2JDN A;  3OD4 A;  3VKO A;  3MYX A;  1G86 A;  2YPD A;  1UXZ A;  4IV1 A;  3AZV A;  1JYW A;  4CCK A;  3W21 A;  3PU8 A;  3AMM A;  5DPN A;  1KD7 A;  1SLC A;  4FFG A;  5FKC A;  1US3 A;  1WWY A;  3QLQ A;  2RMU 2;  1J58 A;  2V73 A;  3PDQ A;  5JOX A;  2YDE A;  4H55 A;  5HCB A;  3OGV A;  4OZO A;  3PME A;  1AVB A;  3ZSK A;  1H9P A;  4E9K A;  4P9X A;  4IE6 A;  1REF A;  3PUI A;  1UW8 A;  1D0G A;  2H6B A;  3WG2 A;  4E8C A;  2ZX0 A;  2HEV F;  4OHW A;  3WNL A;  4EWD A;  3KD4 A;  2WN3 A;  3BI3 A;  2A1X A;  5FXX A;  2IC1 A;  4IEO A;  1ZYB A;  4OI2 A;  3DF0 A;  4UF0 A;  2E7T A;  5LAS A;  1Z7S 1;  4WM7 B;  1J3P A;  4Q5O A;  4XF9 A;  3O1V A;  2VUD A;  3HBZ A;  2JE8 A;  3KT4 A;  2ZA9 A;  1X36 A;  3CNA A;  3Q8B A;  4TWT A;  2P6C A;  5LEK A;  2AYH A;  2XJR A;  2XVL A;  4JDN A;  2R0H A;  3WDY A;  3LPF A;  1HJG A;  1W03 A;  2PLV 2;  3AKT A;  3O1T A;  1PGL 2;  4Q0Q A;  3LFI A;  3H3U A;  1W0P A;  2JKB A;  3CJI C;  3IM0 A;  1NX9 A;  3ZFG A;  5FZO A;  1GNY A;  3HQX A;  3I4I A;  3IT8 A;  3Q8E A;  2XJV A;  5IAV A;  4EZ4 A;  5F37 A;  3USS A;  1VB4 A;  2RHP A;  2QQK A;  4AHW A;  2WZR 1;  1QJX 2;  1OC1 A;  3WCR A;  4XET A;  4QHZ A;  4LA2 A;  4TN7 A;  4XJZ A;  2CSG A;  4EQV A;  1XNK A;  2D3S A;  5SV8 A;  3RMX A;  1UKG A;  1YUD A;  4WV8 A;  5DG1 A;  3ZIW A;  1GV9 A;  2VZR A;  1O5U A;  1Z78 A;  3KF5 A;  3Q9O A;  1QJU 1;  1PMH X;  3WW1 A;  3ZYJ B;  3IAP A;  5EJZ B;  2J7M A;  3E97 A;  2WNV B;  3AZZ A;  4JHT A;  1JI6 A;  4RQP A;  2YPJ A;  2WNU B;  1F8V A;  2ZTN A;  5CFD B;  5ISL A;  4XTP A;  2QQO A;  3VDD B;  1O3Q A;  5A3N A;  4NWW A;  4OVE A;  3N9O A;  1UD1 A;  4O9G A;  3WLU A;  3O1S A;  1CES A;  5C3P A;  1HQN A;  3P3N A;  4B1M A;  2XJQ A;  1JZ5 A;  4ISR A;  3IWZ A;  3KT7 A;  2ADD A;  4TLF A;  4YW6 A;  2OVU A;  4CCC A;  3FLR A;  4CEW B;  4GWN A;  3UL2 A;  1W6M A;  3OY8 B;  2VOK A;  1UOB A;  3H3Z A;  2QZ2 A;  3H42 B;  5LEJ A;  2R32 A;  5FYC A;  3LEM A;  3WF2 A;  4LLF A;  4FPO B;  1DHK B;  5A7W B;  4QB2 A;  1I3H A;  1TNR A;  4O9E A;  1UO9 A;  2WNV A;  2Q1Z B;  2BFU L;  3USU A;  1XQN A;  4D6S A;  3KQ4 B;  1HXS 3;  4LO4 B;  2VJX A;  4MGK E;  4YVS C;  3LEG A;  3FJS A;  1WMX A;  2BYV E;  1IQA A;  1QQP 2;  2RM2 3;  2V72 A;  2ZHM A;  3K3O A;  3NAP A;  4HKW A;  3CL1 A;  4IV3 B;  4A6O A;  4BIO A;  3BKZ A;  4M4R A;  1WA4 A;  5AVA A;  2GH2 A;  3B7M A;  1UNB A;  2JB8 A;  4Y22 B;  5T5P A;  3MV0 1;  1NG0 A;  2GC2 A;  3T0A A;  1SMV A;  3AM2 A;  4L92 A;  1EYB A;  2XL9 A;  3BTX A;  4LO7 A;  3B5L B;  4Y5S A;  4RFT 0;  3T3Y A;  2Z69 A;  1RIN A;  1NLS A;  5LBC A;  2EAA A;  1CQ9 A;  1AX2 A;  3HQR A;  2QQV A;  4AI3 A;  5FPB A;  4O61 A;  5E89 A;  1ZA7 A;  4U2A A;  3MIC A;  2WNO A;  2YV8 A;  4K1Y A;  4XF1 A;  5LY2 A;  2VZQ A;  3JB8 A;  4Q1R A;  1N47 A;  4CDQ C;  1US2 A;  4D6Q A;  3WF3 A;  4YPJ A;  1OPM A;  3A4U A;  3E6D A;  1W06 A;  1PNF A;  1W6O A;  2D7F A;  3WF4 A;  2JIC A;  3VDA A;  4L9B A;  3R0R A;  3IMM A;  3RJR A;  3UV9 A;  2ARA A;  3W5M A;  2P5B A;  5F7U A;  4A42 A;  4XFF A;  1BMV 1;  2E7Q A;  4D69 A;  2VNG A;  5DDJ 1;  4LIV A;  1UY4 A;  4TXW A;  2VEC A;  1ND2 B;  1W9W A;  3LDR A;  1BEV 3;  2MNG A;  4QD2 A;  1OOP A;  2ARX A;  3LA2 A;  1YFW A;  1W04 A;  3I2K A;  1RMU 3;  2VTF A;  3VZM A;  5CAZ A;  4TLG A;  4XQ4 A;  1XXN A;  5A3L A;  5BNP B;  1MZ6 A;  1XU1 A;  1IKP A;  2H0B A;  3RDI A;  1MQT B;  1YFU A;  2HJI A;  5FUP A;  1W99 A;  4H7L A;  3VDB A;  1SBD A;  3ES4 A;  1RUH 1;  2I07 B;  3EXU A;  3K4D A;  4OZX A;  4FPG A;  5JSP A;  3O1U A;  4QB6 A;  4LHS A;  3VZL A;  1AR7 3;  2P3J A;  2YGM A;  2VVD A;  2V4V A;  4AHX A;  2GNM A;  3JZV A;  4P5Y A;  5BNN C;  4QGN A;  3ZOI A;  4C91 A;  1V6M A;  1H2M A;  2HKX A;  1IG0 A;  1MS1 A;  4WVV A;  3WCS A;  3IIA A;  4V1P A;  1OKO A;  1YI9 A;  2JWP A;  2R07 2;  3MFA A;  5DXD A;  3LOB A;  2WZR 3;  2P3K A;  4WVM A;  2ET7 A;  3LFM A;  5DZG A;  3M1H A;  4PLM A;  4L99 A;  2FDG A;  4XDO A;  4NAM A;  5GLU A;  3CQO A;  5FZ4 A;  2NM1 A;  4W6W A;  3UGH A;  3ACI A;  3FX3 A;  3RFR A;  2WA3 A;  2WBK A;  1VBA 2;  1YQ6 A;  4M01 A;  1GSL A;  4CCD A;  5I8T A;  1U5X A;  2XKP A;  2NMN A;  4OFG A;  4Q4Y 1;  1ZBA 3;  1H4H A;  1RHI 3;  3ZR5 A;  4NIG A;  1FPN 1;  4YW1 A;  5AC9 2;  1QDC A;  5I0R A;  4HL0 A;  1JZ8 A;  3H8U A;  1MS5 A;  2GC3 A;  1ND3 C;  4HON A;  5LBF A;  5J1X A;  2C26 A;  4Y24 A;  5BUV A;  5K7P A;  2VE1 A;  1AR8 2;  3RGB A;  1O59 A;  3KV4 A;  3S7E A;  2VW2 A;  4UWD A;  2VM9 A;  5DN2 A;  5APA A;  3WUD A;  1EAH 3;  3ZYG A;  3DPR C;  4DUW A;  2A73 B;  4YVW C;  4D6R A;  1GAN A;  5LAT A;  3C2U A;  5A33 B;  3PVO A;  5FP4 A;  1UIK A;  4AHY A;  5I8Y A;  1S1A A;  2C24 A;  4PDW C;  3N36 A;  1FOD 3;  1PK6 A;  1KJR A;  4CXW A;  3VL9 A;  1XE8 A;  3H7J A;  1MEC 2;  2RE9 A;  2VZV A;  3K3N A;  1N1S A;  1O91 A;  1ASJ 3;  1UZW A;  4LOS A;  1LUL A;  2OPW A;  3AC0 A;  4HXC A;  3RPQ A;  4K6B A;  2ADE A;  1QJU 3;  1RUE 1;  3U14 A;  2QQI A;  5LZ6 A;  2PAK A;  2QQJ A;  2W5F A;  3F95 A;  3HOB A;  4XTM A;  1DZR A;  1B35 B;  1RIR A;  1K12 A;  2HWD 1;  4JCK A;  1KJL A;  1IZ3 A;  3NV4 A;  5FIX A;  1TMF 2;  4YW5 A;  5FPA A;  1M06 G;  2W46 A;  5IWF A;  5CFC A;  2RDS A;  3DKW A;  4N8M A;  1Q8V A;  1RUD 2;  5AFB A;  5B2G B;  2XUM A;  5HXM A;  3V0A A;  2Y6L A;  4Q4X 2;  1AYM 2;  4WBB A;  3U4X A;  4DZG A;  4H7M A;  5KXE A;  2VUC A;  1D2S A;  5HI0 A;  1DQ4 A;  1VMF A;  5K0U A;  4ES8 A;  2HYK A;  2W0X A;  5CKN A;  1PVC 1;  2QQL A;  4S2F A;  1S0G A;  1LES A;  2PMW B;  2VU9 A;  2H6C A;  3KLS A;  4MGI E;  3K51 A;  4DXZ A;  2P37 A;  2GU9 A;  3J8F 1;  3ZXA C;  1SLB A;  3KCC A;  5FP3 A;  3N9L A;  5JWP A;  1X8M A;  1Z7S 3;  1LED A;  1R08 1;  2A3Y A;  5J37 A;  1P8J A;  1CVN A;  3P6B A;  5KHK A;  4QXH A;  2BV4 A;  2WLP A;  1O7F A;  4JGY C;  4XF4 A;  4ATF A;  5FYZ A;  1IPJ A;  2AC1 A;  4W50 A;  4OLL A;  2JDP A;  1UN1 A;  1S0C A;  3MUY 1;  1J1T A;  2ORZ A;  2PHX A;  4BMB A;  1W8T A;  4BQY A;  2OQ6 A;  4Q4W 1;  2HWF 2;  4JVA A;  4E4D X;  3FLT A;  2BGO A;  5EV7 A;  1WMD A;  1W2T A;  5FYS A;  3SEP A;  1NCQ B;  3M8L A;  5J48 A;  4JGY A;  2WNU C;  1TVG A;  5CG9 A;  1J1L A;  4Y5T A;  1GP4 A;  1WUV A;  5FPU A;  2BDR A;  5LY1 A;  1ZM1 A;  4LKF A;  4Q0S A;  3SIS A;  1IS4 A;  3MIG A;  4NPL A;  5IVF A;  4I0B A;  1RJ8 A;  3AVS A;  4FI9 A;  1W9T A;  4Z07 A;  4AEK A;  4UFL A;  1A3K A;  1ZZC A;  2W92 A;  3KGL A;  1X82 A;  2Y38 A;  5HXV A;  1JHN A;  1ZBA 2;  4RHV 2;  4NRM A;  3ZDS A;  1F5F A;  1RHI 2;  5C6C A;  5F5A A;  3LZZ A;  5F2W A;  2LS6 A;  4Q4W 3;  1G9D A;  3IBM A;  4XJU A;  4YFZ A;  1DZT A;  1SLA A;  2GH8 A;  1HRI 2;  2ID4 A;  4JDM A;  3S5Q A;  1VBC 2;  5A6Q A;  3T2Q A;  4FTE A;  3M70 A;  3GZT B;  4F8A A;  3ZVX A;  1XNC A;  2J1T A;  1FAT A;  1AF9 A;  1T6G C;  4YGE A;  1EAH 2;  1E57 A;  1PO1 1;  2EIC A;  4Q29 A;  2VD7 A;  3H3L A;  3JB4 C;  1PO2 1;  3LCP A;  5FYI A;  4OHY A;  4IV1 C;  3JQX A;  4YRD A;  3ZX7 A;  4H3W A;  2JEC A;  3B3Q E;  5FK7 A;  4FPF A;  3O0W A;  5JIA A;  3U10 A;  3UKT A;  5JPM B;  1L7R A;  1POV 1;  3SHR A;  1MEC 3;  5JXJ A;  1RB8 G;  1VIW B;  3VBU C;  5LBE A;  3FWE A;  1UX6 A;  5DZE A;  5C9A A;  3M3E A;  3NV3 A;  1FYU A;  5K4L A;  5CBL A;  3JD7 2;  2UY8 A;  1LOG A;  1VB2 A;  2W94 A;  2VNR A;  4Q0V A;  1DCS A;  4UBG A;  3I2O A;  4XFI A;  2IXL A;  3RQ0 A;  4DMI A;  3D8C A;  2X5I A;  4NHL A;  5I0S A;  1MVQ A;  1UMZ A;  2G9F A;  2VCB A;  2G1M A;  1VBE 3;  1XE0 A;  1XYO A;  3DV8 A;  3NJV A;  1CAV B;  1NZC A;  4K40 A;  3AZX A;  3PVB B;  3BTA A;  3ZIX A;  3ZSL A;  1GQH A;  2YFU A;  4AGV A;  1GWK A;  1S2K A;  4Q4X 3;  1AYM 3;  2RS1 2;  1WKY A;  5CIR A;  3M2M A;  3CBN A;  3MLL A;  1TME 1;  4QXB A;  4GKY A;  1X9T A;  1EPW A;  1LOF A;  2AZ5 A;  3PVN A;  3FZ3 A;  1RXF A;  2IXC A;  4QPG A;  5GLZ A;  4HN0 A;  4LKE A;  3V0B A;  3VBR C;  2OA2 A;  3I3B A;  3NNG A;  4LBQ B;  1AL2 2;  3C3V A;  2DUP A;  2VXJ A;  1SPP B;  3EQE A;  5FZH A;  3OY8 A;  2WWS A;  3LIH A;  5DAX A;  5FYV A;  4BQ3 A;  5AFE A;  3S57 A;  3VL8 A;  1A8M A;  1XRU A;  3UGG A;  5CFC B;  1E5R A;  2VOV A;  2X09 A;  4TYS A;  1G9F A;  4QDQ A;  4XBQ A;  1IG3 A;  4IEX A;  5GAL A;  2R06 2;  1PIV 3;  4AI8 A;  4CA9 A;  1BBT 3;  2RR1 1;  3U07 A;  3NKG A;  4OUL A;  5T5O A;  1KS4 A;  5C4W A;  1W90 A;  4JKK A;  1V70 A;  3IN9 A;  2J1E A;  5BNN A;  5FYH A;  2DBI A;  1AR9 3;  3TBD A;  3MIF A;  2HWF 3;  2CY6 A;  5IK4 A;  5FWJ A;  2YBP A;  3UET A;  1HQL A;  2X8K A;  1LHW A;  2UWA A;  5FMD A;  1SLT A;  1QNY A;  4QT6 A;  1JZ7 A;  4PHZ A;  4FFH A;  4QKN A;  1HX6 A;  3OF1 A;  1GU3 A;  3PTY A;  4WM7 A;  4R8H A;  1XE7 A;  3ECQ A;  3WP3 A;  3PUQ A;  4OUS A;  1DQ1 A;  3E6C C;  1TME 2;  2VVF A;  1HV1 A;  3LKJ A;  4QPI C;  3THT A;  3KSC A;  4I0W B;  5IFT A;  4QQH A;  1VBB 1;  5A3P A;  2IVI B;  1GZW B;  2IWG B;  1C4R A;  4QKF A;  4AI9 A;  1RUF 1;  2BWA A;  5AVP A;  4FP2 A;  1JOJ A;  5FZO B;  4AR2 A;  3KF3 A;  4AF9 A;  2MPF A;  2BNO A;  3GHN A;  4NIA A;  5FPV A;  5FY7 A;  3M3C A;  4N9H A;  2RDR A;  4E2G A;  2VR4 A;  4H14 A;  1NXD 1;  3TEY A;  3T2O A;  4OHX A;  1TZO A;  2XGX A;  3J9S A;  4QPG B;  2Y6H A;  2KM2 A;  1RUO A;  4LHK A;  3B69 A;  2E51 A;  4YFW A;  1UMH A;  4P9I A;  4JGZ C;  1RTV A;  3JXS A;  2QNK A;  2FMD A;  3O12 A;  1S0F A;  2R04 1;  4QQP A;  2BPA 2;  3KMH A;  3OJB A;  5FLJ A;  4I2O A;  1LOF C;  1PZ9 A;  2JE7 A;  3M7A A;  1BEV 1;  1O4Z A;  3LWC A;  2RS5 1;  3NNF A;  2Z4F A;  5FO7 B;  2PAE A;  1KDK A;  4Y1Y A;  3AYE A;  3JD7 3;  1DQ2 A;  4XJW A;  4TTG A;  2Q8E A;  4CRQ A;  1B09 A;  1VJ2 A;  2VMG A;  1HRI 1;  4IGP A;  2Y0O A;  4YGC A;  2X05 A;  4FO9 A;  2VNV A;  3I2J A;  4Y1X A;  3U1X A;  3ZYB A;  5EIY B;  3QCW A;  2W39 A;  2RJL A;  4YVS A;  2BGC A;  1S2B A;  5C8W A;  4FOY A;  1FMD 1;  2OXB A;  3VBS C;  1HRV 1;  3D0S A;  2RS1 3;  3L9J T;  5FMO L;  4AFB A;  3WUC A;  5D2A A;  1F35 A;  2W08 A;  1I5Z A;  4UF0 B;  1HN1 A;  1BBT 1;  2FCT A;  2QE3 A;  2VCC A;  2YBK A;  3J7H A;  4NRQ A;  4E2S A;  4LT5 A;  1J3Q A;  1U12 A;  5E8A A;  1Q56 A;  5K0U B;  3VUO A;  2VNO A;  3VV1 A;  3PU3 A;  4V2W A;  1AR6 1;  2EXJ A;  1Z0H A;  4N7I A;  4BLJ A;  1RUJ 1;  4OYU A;  1AHS A;  1WD3 A;  1YCI A;  4CCM A;  5FXZ A;  4DXT A;  2D93 A;  4BZ4 A;  3ZPO A;  1DLC A;  2DU1 A;  1YQ5 A;  1V0A A;  2A3X A;  5C3Q A;  1CGP A;  4OQ8 A;  2EXK A;  5EP9 A;  2DVB A;  3FHI B;  2K0G A;  3GYD A;  3TEZ A;  3SNM A;  5IFP A;  1R09 1;  4OHZ A;  3SCF A;  1AXZ A;  2RG4 A;  2BZD A;  2P4E A;  4IGQ A;  3SXW A;  2ZEX A;  1K5M A;  4HPK A;  1VR3 A;  5CG8 A;  2GDF A;  1G7Y A;  5ABJ A;  1AR9 2;  1V6J A;  2P6H A;  5FOJ B;  4MGT A;  3VGI A;  1W8H A;  5C33 A;  3E5Q A;  1V00 A;  2VMH A;  4I02 A;  1DG6 A;  2QQW A;  1O3S A;  1BCX A;  1XNA A;  1BHG A;  4LK7 A;  2RDQ A;  3LEI A;  2E26 A;  1EV1 2;  2MEV 1;  5KXD A;  5A32 A;  1RUN A;  2WS9 1;  1COV 1;  2B7Y A;  1D0H A;  3AKS A;  2HWC 3;  3KZ4 C;  3PTR B;  4YZ1 A;  3D6E A;  3B94 A;  2PHL A;  4CYD A;  5FR3 A;  3VBF C;  3WDV A;  5FZ3 A;  2WT0 A;  1CZS A;  1TMF 1;  3VD9 A;  4LBN A;  3VHO A;  3OTF A;  5FDB A;  2F6B A;  2GN3 A;  1GMM A;  1MAC A;  2I74 A;  4IXL A;  2XJU A;  3JCI A;  1H9W A;  1FPN 3;  4LBO A;  5BNO C;  1CAX A;  2HWE 1;  3GJB A;  5F6K A;  2J1R A;  4QQL A;  1FXZ A;  3BOD A;  5EJ3 A;  1RUI 3;  4IES A;  1ULO A;  3POI A;  4AQT A;  5JDB A;  1MQT C;  4DPN A;  4X8N A;  5A6Y A;  3ATG A;  4CU7 A;  5J96 B;  1FV3 A;  3WW2 A;  2PQS A;  3FE5 A;  4BQ5 A;  3MI8 A;  4YW7 A;  1DYO A;  4A45 A;  1RIT A;  2IXI A;  1OUS A;  2ORX A;  3GZU C;  5FZG A;  3VHR A;  1FI2 A;  3HWJ A;  1ND3 A;  1SQ4 A;  2QFE A;  3ETP A;  3OGJ A;  1AX1 A;  4BQW A;  4HSL A;  4NO4 A;  4XF0 A;  2KR2 A;  2VQT A;  2VQU A;  2SBA A;  3VZO A;  3ZN6 B;  1W28 A;  1POV 0;  2ES3 A;  2PHW A;  2R1B A;  1XYP A;  3TN9 2;  1XSR A;  3W58 A;  5H9Q A;  2HWE 3;  4CU9 A;  4AEM A;  3ZYF A;  3RJ2 X;  1AXY A;  2XJS A;  4XFH A;  3OEB A;  4CP2 A;  2JEM A;  4FP3 A;  3BPS A;  4P02 B;  1ACC A;  4WZC A;  3KHC A;  3K48 A;  1N1T A;  2OUH A;  4YG3 A;  5DUW A;  1HXS 2;  4XUT A;  5FYM A;  5K9Y A;  1ZVF A;  1AR7 2;  3T4H B;  4KG8 A;  3GCW A;  2DVD A;  5FZF A;  4BM8 A;  4CEY C;  1UXX X;  5FBZ A;  2WS9 3;  3QOP A;  4XPV A;  3ORJ A;  3CMG A;  5GZD A;  4EV0 A;  1CIW A;  2R07 1;  1J84 A;  1WW7 A;  4UT5 A;  5I91 A;  2ARB A;  1KRI A;  4CUB A;  5FY5 A;  3C8X A;  2R07 3;  5CIS A;  2NZ9 A;  4L97 A;  4YZ5 A;  2D6N A;  4LBQ D;  4XHB A;  2PTM A;  4CUG A;  2RJK A;  5HV0 A;  4L8Q A;  4XMA A;  3D0J A;  1PVC 3;  2BBA A;  4L0P A;  5A7N A;  1OSG A;  2WYF A;  2XDV A;  3EYP A;  4XQW A;  2OPK A;  1PX3 A;  2DCK A;  2RS3 2;  2VUL A;  4PLN A;  4EN8 B;  3FHA A;  1UY2 A;  4HKO A;  2VMI A;  1K5M C;  2DDU A;  2WNE A;  4LO6 B;  4Z2A A;  1G9C A;  2EA7 A;  3WP6 A;  5CEH A;  2Q8D A;  3TRS B;  4IE7 A;  4LBQ A;  5A3U A;  4RSU A;  2WC2 A;  1V9U 3;  1T6B X;  3ME2 A;  5L7O A;  4RA0 A;  2L9L A;  4N43 C;  4NID A;  1MPX A;  1KXG A;  4C0B A;  3DUI A;  3AP7 A;  4LPL A;  5FYT A;  4DY3 A;  4CUC A;  2DCZ A;  1HXS 1;  4MXW A;  2CWM A;  4H2A A;  5FRA A;  1HIX A;  1YI7 A;  1NUK A;  5IVY A;  5LRR A;  3VDD C;  2DTW A;  4CXY A;  3S30 A;  2EXH A;  1ENX A;  1POQ A;  5F39 A;  3ZFG C;  5FY4 A;  4JZR A;  3HMY A;  3KV5 A;  2JJ6 A;  2FDF A;  2GC1 A;  5FZC A;  3TNP B;  3K4Z A;  3BU0 A;  4Y20 A;  4PI2 A;  5C5T A;  1LAJ A;  1Q8P A;  3AMQ A;  4PJY A;  2CWS A;  4XVH A;  3HR9 A;  5KHI A;  1TMF 3;  2JG8 A;  2WA4 A;  2Y26 A;  2ZAH A;  4CU8 A;  2WO7 A;  1RUD 3;  1CAU B;  4DRR A;  1T2X A;  3ACG A;  4A7K A;  3ZPY A;  2X29 A;  3CJX A;  1O8S A;  4XBN A;  3E5X A;  3HIF A;  3T0B A;  4GIQ A;  2QCS B;  2TUN A;  3MF9 A;  4BME A;  1J59 A;  1CZV A;  3WDX A;  4PF1 A;  3AXD A;  4QM9 A;  2HH9 A;  3KHB A;  2XJP A;  1JXN A;  4C0H A;  3NST A;  4UAP A;  2HWE 2;  3CEW A;  5C5U A;  5IHR A;  2CDP A;  3H1M A;  4GAZ A;  5FWE A;  4GMP 1;  1NCR B;  2FZ1 A;  4BLI A;  3WXP A;  3O5S A;  4DO0 A;  1N3P A;  1ND2 C;  4QWN A;  4ARY A;  5JOY A;  4RR3 C;  1H8T B;  1U5I A;  2W1W A;  5IVC A;  2WIN B;  4PF5 A;  3AYD A;  4MGQ A;  1KFX L;  4FQZ A;  3QH7 A;  3KCX A;  5D1I A;  3X29 B;  1CAW A;  1UU6 A;  4GH4 C;  4PBP A;  1ZRD A;  3HNY M;  1JUI A;  1K5J A;  2WS9 2;  2BNM A;  4Q2F A;  1E5I A;  1OF3 A;  2FQP A;  1QNW A;  4FXG B;  4XUN A;  4CCL A;  3K4A A;  4JGZ B;  2JDM A;  3ZXF A;  3SEE A;  2VBD A;  3ILF A;  3RSJ A;  1NCQ C;  4JKM A;  1SEF A;  3QBQ A;  1NY7 2;  1LEN A;  3NAP C;  4XDP A;  1OQE A;  1ZRI A;  3LF7 A;  3TYJ A;  1QY4 A;  5FY0 A;  3I8T A;  1H1I A;  4GB3 3;  4P9G A;  3ENR A;  1DZQ A;  3GM8 A;  4HET A;  4CDX B;  5HCH A;  4BOW A;  1ZZB A;  2DBN A;  3JU9 A;  1C8M 2;  3WDU A;  2RS3 3;  1NCR A;  4XMI A;  4A6S A;  3M4F A;  3VB9 A;  4P9W A;  1MS4 A;  4QX0 A;  1QXR A;  5ABJ B;  2BBV A;  5C4W C;  4AVB A;  1CZT A;  4YG0 A;  4MG2 A;  1RVF 2;  2E31 A;  3UK9 A;  3QH6 A;  5G04 L;  2OUJ A;  4UFK A;  1HRI 3;  4QX8 A;  1ZRC A;  3VD4 A;  1X7N A;  3HBK A;  3I59 A;  4PIX A;  4W65 A;  2HYX A;  3IPV B;  4BQ2 A;  4ZU7 A;  1VE0 A;  2IZW A;  4WVM B;  5JPN B;  1KFU L;  1DGR A;  3ALQ A;  2DU0 A;  1IKQ A;  4IW3 A;  4QGM A;  4URT A;  5F3G A;  4OI1 A;  4AGG A;  4BDV B;  1WBL A;  5IVB A;  3UJO A;  4Q4V 1;  3ZFF B;  1Y4W A;  4B1L A;  2UYB A;  2YHJ A;  3UT0 A;  1LOA A;  5GZG A;  3MDP A;  3OGG A;  1B35 A;  1U5Y A;  1QMJ A;  4XBL A;  5LA0 A;  3H1Y A;  1CX4 A;  1D4M 1;  1VLN A;  1W2U A;  3CKH A;  4FPK A;  4FCA A;  3TEX A;  1EUU A;  3H8O A;  2O8O A;  1ZZ6 A;  3NJY A;  4FPL A;  4MGY E;  4DRV A;  5JOZ A;  1S2E A;  3WSO A;  4EJR A;  1MQT A;  1R1A 3;  4MGZ E;  3ZFE C;  5DAQ A;  4RR3 B;  4OHV A;  5FZK A;  5LA9 A;  1NE4 A;  1QOS A;  2P17 A;  1BLZ A;  3IKW A;  1YEW A;  4AG4 A;  5CU1 A;  5A1L A;  3S6P A;  1UL9 A;  3DN7 A;  3PHM A;  4NN0 A;  2BTV C;  2VZT A;  1HB4 A;  3TN9 1;  1ND3 B;  1IGO A;  4JTO A;  1SLI A;  1XNB A;  5FZL A;  4CDU B;  2DUO A;  4AVA A;  2G9Z A;  4P9J A;  2VOT A;  4NPR A;  1WLW A;  2Y6K A;  5FY9 A;  1OH4 A;  3ZXJ A;  3FBY A;  1SCS A;  2EXI A;  4UFI A;  3ITQ A;  2D3P A;  3GF6 A;  5IJR A;  1SFY A;  5H9R A;  3FUO A;  1MS3 A;  2F17 A;  4FPE A;  4OCT A;  3WP4 A;  1FT9 A;  1WME A;  2D6M A;  2DCJ A;  3A23 A;  4D0Q A;  3BOW A;  4P00 B;  3WG1 A;  4RHV 3;  1GP6 A;  2C9A A;  4EYU A;  4Y1U A;  3POE A;  2DVA A;  2ZX1 A;  2JD9 A;  5LA2 A;  3WZ1 A;  3OBT A;  5IT6 A;  3RZM A;  2IXK A;  1WW4 A;  3CU7 A;  4CUA A;  3KQR A;  4ASL A;  5IAX A;  3ACH A;  1C1L A;  2ZKN A;  1RUF 2;  3OEA A;  1H2K A;  4JQR A;  1L7Q A;  4U36 A;  5FZE A;  3HVD A;  1NA1 C;  3LGR A;  2FD8 A;  2Y6F A;  4A2U A;  1H6Y A;  1R09 3;  3AZY A;  3Q8A A;  4IER A;  3OG2 A;  5T54 A;  2CTV A;  3KS7 A;  3P5B A;  4GA9 A;  1VBB 3;  2V5Y A;  2VZ3 A;  1GLH A;  2PLV 3;  3LIG A;  3A0N A;  4LUL A;  4AFM A;  4DUX A;  4OI0 A;  2PYT A;  2VC9 A;  2ZKL A;  4YW2 A;  1RUJ 3;  1JYC A;  2NN8 A;  2YC4 A;  1GWM A;  4XXA A;  4GB3 2;  4M0H A;  2WN2 A;  2PA7 A;  3KWV A;  5IAT A;  5JAX A;  1AL0 G;  1PZ7 A;  2ZEZ A;  4IEZ A;  1RC6 A;  2WSV A;  1ZRR A;  5J7M A;  4Z92 B;  2GMP A;  1MS0 A;  3I49 A;  1ULE A;  3KVA A;  3ACF A;  1SFN A;  2XWB B;  3P3P A;  1BXH A;  2IFR A;  5BNN B;  3ZO0 B;  2WFP A;  1AR9 1;  5BYN A;  2JG9 A;  3POY A;  1FMD 3;  2VW1 A;  4QPW A;  4NRO A;  4RGA A;  4BK4 A;  1JZ6 A;  1OF4 A;  1VP6 A;  2B46 X;  3AP9 A;  4YSF A;  4XIO A;  3NV1 A;  2NP0 A;  2RR1 3;  4EE2 A;  3LA7 A;  3THC A;  4BWO A;  1F4A A;  3EMR A;  1O8P A;  1UY3 A;  3ZYI B;  4IE5 A;  1YJK A;  3I7D A;  1VAM A;  4UXA A;  1AJO A;  4NHX A;  1G8W A;  4NPM A;  4IND A;  3BAL A;  3D82 A;  4ASK A;  4AI1 A;  2J22 A;  5ACA 3;  3DXU A;  4LE3 A;  3VDD A;  1OD5 A;  4QHB A;  2AEY A;  1LNS A;  1YHF A;  2Y33 A;  3POB A;  3B93 A;  2QTW B;  1AR8 1;  2ETE A;  5ABJ C;  2TEP A;  3WNM A;  4N43 A;  3OBA A;  2UY9 A;  4M3C E;  1W39 A;  2A6V A;  2JIG A;  1WCK A;  2C9K A;  1D7P M;  1J83 A;  2CYF A;  1PNG A;  4XOG A;  4HVQ A;  3NWK A;  1S55 A;  2P2K A;  4P08 A;  2A71 A;  2E32 A;  4Y22 A;  5DAV A;  1BYH A;  2YY1 A;  1IHM A;  4KBZ A;  4N53 C;  1UYX A;  3W20 A;  1ULD A;  2BVB A;  3TB0 A;  2VOW A;  1D4M 2;  3ZMO A;  1VRH 1;  4BE3 A;  1SCR A;  5L36 A;  2CHH A;  1PO2 2;  2ET1 A;  1YWK A;  4QDR A;  5A7P A;  2RS5 2;  3ZYH A;  2D98 A;  2ZML A;  3O14 A;  3NO8 A;  3WEZ A;  4Y33 A;  4Q26 A;  1POV 3;  1W9F A;  2NPI A;  2W87 A;  3SMH A;  5CYY A;  4FOW A;  2WT1 A;  4OMD A;  3CIH A;  5EFU A;  5FZA A;  4XUQ A;  1W2O A;  2WFF 3;  2YRO A;  4LO8 A;  4I3G A;  5LWB A;  1PMJ X;  1ZZ9 A;  3VKN A;  5GKA C;  2EID A;  3ZFE A;  1W9Y A;  4S2G A;  5F5I A;  3SKV A;  2CGO A;  3CLP A;  1AX0 A;  4QX2 A;  1GOG A;  1DU3 D;  4YW4 A;  1ZBA 1;  3U75 A;  4CEW A;  3ST7 A;  3VKM A;  1Q8Q A;  4UW3 A;  4Y1Z A;  2ATF A;  2DCT A;  4XFC A;  5FZ9 A;  5LW9 A;  1UPS A;  2DFB A;  2ZX2 A;  5IUQ A;  3VBF B;  1DQ0 A;  3T30 A;  3DYP A;  5KHG A;  1NQD A;  4N53 A;  2ERF A;  4ZXE A;  5DZF A;  1PVX A;  4XQD A;  1H30 A;  4MZU A;  3WNX A;  1O4Y A;  2Q4S A;  5D8A B;  4P5H A;  2YZ4 A;  1DIW A;  5DUU A;  1JHJ A;  2VZP A;  4HSJ A;  4EZH A;  4RQP B;  1O5L A;  4LHN A;  1UCX A;  2VZU A;  1QOT A;  5DG2 A;  4CDQ A;  2LM3 A;  1YIP A;  2HWC 2;  4KGQ A;  4JRA A;  4QXC A;  3WIN E;  1IS3 A;  1AR7 1;  1C5I A;  4AW7 A;  3GJA A;  3OOX A;  5L7O B;  4LHL A;  1VAK A;  4Y3O A;  1K42 A;  2HBT A;  1ZBE 1;  1ULG A;  4A3Z A;  4CDU C;  4NVP A;  1OI6 A;  3H50 A;  1KDM A;  5F5C A;  5F8P A;  2VQ0 A;  1OKQ A;  1EUT A;  3NL1 A;  3QAC A;  1OA3 A;  5FV3 A;  4R9C A;  2RR1 2;  1U5Z A;  4YW3 A;  5FMC A;  3O1R A;  5L9V A;  2R06 1;  3RRD A;  1GZC A;  4MGS A;  2W95 A;  4ZU5 A;  5CB7 A;  2XQR A;  4HFS A;  3LA3 A;  4MOA A;  1G9A A;  1GKB A;  3GZE A;  4BQ1 A;  1DQ6 A;  2Y6G A;  1DGW X;  2N7G A;  3AJY A;  2E6V A;  3FMG A;  3PUS A;  1AL2 1;  1UYP A;  2RVA A;  4K9S A;  2EAK A;  5EWS A;  2E33 A;  3ZSJ A;  1KS5 A;  2PEL A;  4LLO A;  5T5L A;  3N7L A;  3ZM8 A;  2FCU A;  1RUD 1;  3O0V A;  1I1E A;  4GUL A;  2QQM A;  3MIB A;  5F3C A;  4LQR A;  3HT1 A;  4MXV A;  5ANN A;  5GZC A;  3TN9 3;  3WD5 A;  4FVV A;  5EQU A;  2A7A A;  4M00 A;  1PO1 3;  2GMM A;  4HZF A;  1DGL A;  3ABZ A;  3VHP A;  5LCW L;  2NQY A;  4DXS A;  2IFW A;  3NNJ A;  3AVR A;  3VBH C;  3EB7 A;  4HK8 A;  5EPA A;  1CAX B;  2ZX4 A;  2WZP P;  1GZW A;  3IMN A;  1UF2 C;  3LSE A;  2BFU S;  4D7S A;  3UKN A;  1MR5 A;  3DEC A;  4JQT A;  2WZ8 A;  4XW3 A;  3ZFE B;  1VPH A;  2ZGK A;  4BIS A;  2DV9 A;  4EN7 B;  1D4M 3;  4M3C F;  1EV1 3;  4B8E A;  3NAP B;  2DVF A;  3MF6 A;  4GZ9 A;  2Y0I A;  3I54 A;  5T5J A;  1EV1 1;  4XHX A;  1UKR A;  5F1R A;  2Z5W A;  4LE4 A;  1RUI 1;  2P34 A;  3DYM A;  4ITC A;  1I9R A;  2LTN A;  3RZH A;  1EAH 1;  1WA6 X;  4EN6 B;  1CPM A;  2XLG A;  1FPN 2;  4OUE A;  1QJU 2;  1UMI A;  3CHX A;  2IXH A;  2WL1 A;  4N53 B;  4RS5 B;  1W6P B;  2XH6 A;  4D8M A;  1URX A;  4CEW C;  5KR7 A;  1SG3 A;  4FOQ A;  2XOM A;  4NII A;  2BOJ A;  1IPK A;  4QMA A;  5KHJ A;  1ZRE A;  1JBC A;  4GAL A;  5C8C C;  5EYY A;  1JYI A;  2WQZ C;  4B4R A;  3SQO A;  3N35 A;  4C1W A;  4AQ2 A;  3DPR B;  1V6I A;  2RS3 1;  2R49 A;  3MZH A;  4NHK A;  5DAW A;  3N4M A;  5M0T A;  2R7E B;  3ON7 A;  2WQ8 A;  3U37 A;  1OLQ A;  4CCE A;  4EN0 A;  5LB6 A;  1NE6 A;  2J1A A;  3TWI A;  3PVE A; 
#chains in the Genus database with same CATH homology
 4BQ5 A;  3ZYB A;  4BQ2 A;  1OKO A;  2JWP A;  1V0A A;  5D21 A;  1W8W A;  4LK6 A;  4YW7 A;  3ZYH A;  4AL9 A;  4LKE A;  2K46 A;  1W9F A;  1HN0 A;  1WZX A;  3ORJ A;  4YWA A;  2VXJ A;  2C24 A;  4BQ3 A;  1W8T A;  2KR2 A;  1GWL A;  2LRO A;  1W8U A;  3UT0 A;  1WMX A;  4A6S A;  4CP9 B;  4CPB A;  1L7L A;  1WCU A;  4LKD A;  3ZYF A;  4CP9 A;  2LRP A;  4LJH A;  4YW6 A;  1OH3 A;  1GWK A;  2O14 A;  1UOJ A;  4LKF A;  4LK7 A;  2WYF A;  1W90 A;  1W8Z A;  4BQ4 A;  4CPB D;  1GWM A;  3F95 A;  2Q1F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...