4XEZA

Cysteine dioxygenase variant - y157f at ph 8.0 with dithionite
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
186
structure length
186
Chain Sequence
ELLKPRTLADLIRILHELFAGDEVNVEEVQAVLEAYESNPAEWALYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTDSHCFLKLLQGNLKETLFDWPDKKSNEMIKKSERTLRENQCAYINDSIGLHRVENVSHTEPAVSLHLFSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cysteine dioxygenase type 1
publication title Structure-Based Insights into the Role of the Cys-Tyr Crosslink and Inhibitor Recognition by Mammalian Cysteine Dioxygenase.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
total genus 56
structure length 186
sequence length 186
ec nomenclature ec 1.13.11.20: Cysteine dioxygenase.
pdb deposition date 2014-12-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05995 CDO_I Cysteine dioxygenase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4xezA00
3WW4A 4LUKA 4EROA 1O3QA 3DV8A 2DCTA 3RZZA 4QGMA 1VJ2A 2Y0OA 4XFBA 4LTAA 3E6CC 2MHFA 1CAXB 2B9UA 4I09A 1WGPA 1IPJA 3ROUA 4Q0UA 3ES1A 4IETA 3WW3A 4I02A 1TQ5A 3H1YA 1PMIA 5J3UA 2PTMA 1ZRCA 3E5XA 3CL1A 5J7MA 1QXJA 2QVSB 1O3RA 3HT1A 4WVZA 3BB6A 3NL1A 5KHJA 4KWKA 1LR5A 2ETEA 3S7IA 2CGPA 4LLOA 3GYDA 3UKTA 4F7ZA 4AVCA 3CLPA 2BGCA 1ZZ8A 4BIFA 2K9ZA 4NVPA 3SCFA 1UIKA 1CAUA 2MNGA 2Q1ZB 4FAHA 5BV6A 5KBFA 4P9GA 4ZU5A 4MGKE 2I45A 5I0RA 3EHKA 1VP6A 3MZHA 4B29A 2D93A 3E6BA 1Q43A 3JZVA 1X8EA 2D40A 3NKTA 1Y9QA 4L11A 4QX5A 3OCPA 2V09A 4Z07A 2D5FA 1LKNA 4KU7A 5AVPA 4IEUA 1CAUB 1ZZCA 2QNKA 4QGNA 2XL7A 4I0BA 4IEWA 5KHIA 3HQXA 1WA4A 2ZKLA 1I6XA 4YARA 4MGIE 4X6RB 1ZZ9A 2OYZA 4Q29A 1UW8A 2E9QA 3FX3A 3E5QA 1YHFA 2BNMA 2Q4SA 4XFHA 5CADA 2XHKA 3NJZA 3FWEA 2GC3A 4JV4A 5FPXA 3H1MA 4IERA 4AQ6A 1YFUA 3QACA 1GQHA 3RYRA 3CO2A 5HI0A 4LULA 4AVAA 2VECA 3IDCB 5F1RA 5JSOA 3TNPB 1RL3A 1PM7A 1X8MA 5J48A 1IPKA 4OLLA 1J59A 3BCWA 4FBFA 4F8AA 4K8FA 1QXRA 5I0TA 3IIAA 2XLFA 3BPZA 2CAUA 3CF6E 2GH2A 3KMHA 5T3NA 1UPIA 5FLJA 3NSTA 2QJVA 2UYBA 2BNOA 3G7DA 3LA3A 2OZJA 2IXJA 4MX3A 5C6CA 4HN0A 4ONUA 2GC2A 3UKNA 4FT8A 3MDPA 1RGSA 2BNNA 4XFFA 3S7EA 1H1IA 4XFCA 4D7TA 1DGRA 3CJXA 4WZCA 5LRSA 1GQGA 2B8MA 1X7NA 1O4TA 4XF1A 2IC1A 2GZWA 2XGXA 2XKPA 3I59A 3U0ZA 4WBBA 1YFWA 3C3VA 3M70A 4ORFA 5I93A 4JVAA 1O3TA 4KL1A 3FE5A 4XFAA 2EA7A 3NW4A 3E6DA 5LEKA 2FQPA 1QWRA 2C0ZA 4ZU4A 3BALA 2KXLA 5D1IA 1XE7A 1O3SA 3DN7A 3LAGA 3FHIB 5JSRA 4EWDA 4E2SA 1ZRDA 4BHPA 3I59B 4HVOA 1J3PA 1ZRFA 3KGZA 3SHRA 3SCHA 5BY5A 2IXIA 4MZUA 5I0SA 2O1QA 1Q5OA 2PQQA 4PJYA 2VPVA 3EBRA 5KHHA 2FMYA 1H1MA 4Q0PA 1O7FA 2GU9A 4IEQA 5FLHA 2H6BA 3FFQA 4IEOA 2D5HA 4QGLA 4XFIA 3WW1A 3ELNA 1RTVA 1ZZBA 3B02A 1O5LA 5EZWA 4HLTA 5KHKA 2O8QA 4LA3A 1ZRRA 1J3RA 1NZCA 3FJSA 4UXAA 2UYAA 4O9GA 1RC6A 3H3UA 5FQ0A 1ZREA 1CAVA 1DZRA 2QDRA 3H50A 5FCCA 3H7JA 5CVRA 2HKXA 4IESA 1OFNA 2IXLA 1SQ4A 4R52A 1RUOA 3KGLA 1CAWA 1Q3EA 1VR3A 2OZ6A 2Z2SB 3IBMA 3SMHA 4YSFA 1SEFA 3LWCA 1O5UA 2ZCWA 4KWLA 3U11A 4R8HA 3PNAA 2ATFA 5I0UA 3NVCA 5FQ0B 1OMIA 3KSCA 5JCTA 1CAVB 1G6NA 1EYBA 4BH9A 2PHLA 2H0VA 4XF4A 3OF1A 3DL3A 4D7SA 5C8WA 2UY9A 1CAWB 3CEWA 2P17A 5I8TA 5JAXA 3H7YA 3RDIA 3PVBB 4JTOA 4IEZA 2F4PA 4ZU7A 2N7GA 2XLGA 4O9EA 1SFNA 3RPQA 2Q0AA 1UD1A 2WFPA 2BYVE 3D0JA 2PAEA 4QXKA 4TLFA 4BYYA 1RUNA 3O14A 3FZ3A 5LEJA 1UIJA 1J1LA 2UY8A 1YFXA 3ETQA 3PLQA 5BPXA 2B5HA 4Q0QA 3LOIA 4EV0A 1FT9A 3IWZA 4FAGA 4EWEA 3WW2A 3USSA 1NXMA 4HVRA 4CYDA 2K0GA 5E1RA 3L2HA 4N9HA 1XE8A 3OD0A 4YRDA 3SCGA 1ZZ7A 2WC2A 1X82A 4AXOA 2PFWA 5CU1A 1LRHA 4HN1A 5I91A 3S0MA 3LZZA 1FXZA 3ZDSA 5K8SA 3ACLA 4META 2EAAA 1J3QA 1NE6A 5EFUA 3DKWA 1FI2A 4QM9A 3H3ZA 5JR7B 5KHGA 3ES4A 4Q0SA 5I8YA 4Z82A 1JUHA 4KWJA 4JTNA 4DINB 2Q30A 4QMAA 1YWKA 3R6SA 4IEVA 4MH0E 2IXKA 3ST7A 1V70A 4KU8A 4L2NA 4I01A 3RYKA 4QM8A 4AVBA 2VQAA 3OGJA 1ZVFA 3SXWA 4I0AA 4Q0VA 4OFGA 5I8SA 1NE4A 5FLIA 5FPZA 4IEXA 3EQEA 4MV2A 2PAKA 4E2QA 2ET7A 4UBHA 4IEYA 4E2GA 3VHRA 2HJIA 3EJKA 4PIYA 5JSPA 3HIFA 3RYPA 2QCSB 2OPKA 4AQ2A 5FDBA 3M3IA 1J58A 3LA2A 2PAMA 1NYWA 1Y3TA 3D82A 1OI6A 5BUVA 3I54A 3U10A 2GC0A 3E5UA 4XF0A 1YUDA 3TNQA 3HT2A 1WLTA 4HBNA 4IEPA 2GAUA 2XKOA 3QOPA 1L3JA 4MUVA 4XF3A 1CX4A 3N4MA 3H9AA 4J1XA 2XLAA 4HMZA 2OA2A 4XF9A 1ZX5A 1EP0A 1ZNPA 4LA2A 2EVXA 2PYTA 4H7LA 4MGYE 3BU7A 5E16A 3LA7A 4LUMA 3GBFA 1EPZA 4MGZE 1QY4A 4HSLA 2IXCA 4HZFA 4PIXA 1UCXA 2ET1A 4RD7A 2Z69A 2H6CA 3IDBB 1DGWA 1XRUA 4YNIA 2IXHA 3RNSA 2BEOA 1OD5A 4PIZA 4HSJA 5BXXA 3KCCA 2CV6A 4GULA 3I7DA 1I5ZA 3H8UA 4XETA 5LRRA 2CAVA 4LEJA 1EY2A 2PA7A 1LB2A 1YFYA 1HW5A 4I2OA 2GC1A 3E97A 4A2UA 1ZZ6A 2XL9A 3MYXA 4YYOA 4EWAA 3EO6A 4N9IA 2PHDA 1CAXA 3UKVA 4J1WA 4HVQA 3D0SA 1CGPA 4UBGA 2MPFA 3H1WA 4XFGA 4I3PA 4XEZA 4X6QB 3OTFA 1YLLA 1DZTA 1U12A 3MPBA
chains in the Genus database with same CATH superfamily
1OLME 1H0BA 2TBVA 3O5SA 4GMP0 3SH3A 2BP6A 2EXKA 2XG3A 4FO9A 4QX3A 5GZDA 3CMGA 2FZ1A 2ZACA 1P8JA 1KDKA 3I2JA 3E6CC 1GICA 2MHFA 3VV1A 4XC9A 2B9UA 3I3MA 5JXIA 4OHVA 3VHNA 1Q8PA 3ROUA 4A7YA 1DDLA 2Q1MA 1VMFA 5A6XA 4ZXKA 2ENRA 3ACHA 4JZRA 4CEYC 5E6HA 1UZYA 3WF4A 1D2SA 1VBB2 1HXS1 4O61A 1R1A1 1VAKA 1RUC1 3UETA 1JODA 4XJAA 2PTMA 4P9IA 4NPRA 4PI2A 2JE9A 2G9FA 2WFF2 1YXWA 3ZYIB 1LOBA 5LZ6A 4K40A 3MV01 1QXJA 1XC6A 3KF3A 1O3RA 4N7UA 2ZOEB 1GMMA 1PGW2 2LW8A 2YXSA 3TBDA 4QQLA 4QPIA 3AL6A 1ULFA 1PVC2 1RUI3 1EAH2 1DYOA 4BLJA 4XUNA 1ENQA 4CU6A 3GYDA 1PIV2 3OUHA 2FHRA 5FY8A 2XMLA 3K4DA 3KD4A 2P37A 4Y1UA 4OMDA 4DFSA 1W99A 5BNQA 1OA4A 4YGCA 2ZGLA 4NVPA 5JI7A 5IAVA 3H8XA 1BBT2 3RJRA 1CAUA 1WBFA 3WNOA 2Q1ZB 3NNMA 1PO22 4O65A 4FAHA 4Q1PA 4P9GA 2VOTA 1TME2 4QPIB 4AEJA 5BNOC 4JCKA 4Q26A 3H8OA 2GMMA 2I45A 4PBPA 4Q4X1 4Y1YA 3PVNA 3ZYJB 2C26A 4WZFA 4CSWA 2J1RA 1U5XA 3RQ0A 1IS5A 4Q8KA 1JYWA 3HWJA 1OF3A 4KMQA 3WOGA 4DXSA 4YZ4A 3VZLA 4EE2A 5IVEA 3NKTA 1N1TA 3VB9A 5J09A 2QQOA 3AZXA 1UL9A 2HWF2 4QX5A 3GCXA 4BMBA 4NMIA 3IM0A 1CAUB 2QNKA 3S5QA 4QGNA 5KC5A 3VUOA 1O4ZA 5IK8A 2ORXA 1OH3A 1ZBA3 2HYKA 2RM23 2XL7A 4X8NA 1C8M2 1J84A 3HQXA 5D21A 2ZGOA 4NWVA 4AI1A 3KHCA 2OS2A 3RZMA 4Q4W2 2R32A 3F95A 1JHNA 4LORA 3Q8CA 4OQ9A 2OT7A 5A33B 3AMQA 5IAXA 5IVVA 3KQRA 2NM1A 1GP5A 4WM7A 4WVMA 1OT5A 1UW8A 2EALA 5B4XA 1YYNA 3POEA 2R061 3FX3A 3E5QA 3VBFA 2ZGSA 1AYM3 1STMA 1GZ9A 4GAZA 1QXPA 2XHKA 3B7MA 1IKPA 4K8RB 4D6QA 1H6XA 1QGLA 3MLKA 4AHWA 2EIGA 3W5MA 3IDEA 3H1MA 4TLGA 3RYRA 3CO2A 5FOJB 5HI0A 1I1EA 4I3GA 2WBKA 2WO3A 2XJPA 3IAPA 2RMU3 1TMF1 1XPWA 4LJHA 4LO5B 5JSOA 3GNEA 1PM4A 5DUUA 5A3NA 3T0AA 4A45A 1W6QA 4WM7B 2D98A 3HR9A 4WVMB 1H8TC 1RL3A 2VNGA 4BQXA 1H6YA 3LQCA 2R071 3SISA 1IPKA 1FNYA 1JUIA 3AZVA 5HCFA 1J59A 4XBLA 4FXKB 5FFOC 1KJLA 1XNKA 1QJFA 1HV1A 2P1BA 1W6PB 5FMCA 4NPLA 4BK4A 2XLFA 2ZGQA 1US2A 5M0TA 1KEXA 4H2AA 4QHBA 3NO8A 3VBSA 2Y6LA 2X53S 2BPA2 2RR13 2Y26A 1RIRA 2VCCA 4QPGA 1MS9A 5FZLA 3FLRA 1OOPC 1LOAA 2JX9A 1W6QB 3JBG3 3M3EA 4Z2WA 4GH4C 3M3OA 4E9KA 2GH8A 4BQ3A 4QXHA 1DGWX 4ONUA 2A5ZA 5CFCC 5FP7A 5FYSA 3I3DA 1XYOA 5LWBA 4OCTA 1RGSA 1OHFA 3AB0A 5FZ1A 1UKGA 2RS52 3WNKA 4E8CA 3I4IA 4D7TA 1QHDA 1DQ1A 1DGRA 3CJXA 1UPSA 4WZCA 2EXJA 3VBUC 3VBSB 5LRSA 1AR82 2B8MA 3ZN6A 2DVFA 2W52A 3HBZA 3O7OA 3SLIA 4JAAA 2WZR2 4N8MA 1QJU1 2XGXA 5L9RA 1YFWA 4QKBA 3ZFGC 3W58A 1N3OA 3I2FA 5F5CA 3M2MA 5L36A 1COV3 1LESA 3Q8AA 1RMU2 3UK9A 1OLMA 1CJPA 3VDBA 5LEKA 2TEPA 5BNNA 4COYA 2HWE3 4LLFA 4MOAA 4FTSA 2JDYA 3MIFA 2XWBB 2ZGMA 4FPEA 4CU8A 4QD2A 5F6LB 4GWJA 3FHIB 4AZZA 3ZN6B 2GALA 3ZYRA 3PTRB 5CG9A 1NX9A 4CCMA 3JXSA 5FXXA 2Y6GA 4XUOA 1ODNA 3NWKA 3SCHA 3T1LA 2E33A 1ZM1A 2D6LX 2IXIA 4UFJA 2JIGA 2FD8A 3K4AA 3WV6A 5K0UC 1SBFA 4JX0A 4OI0A 1SLLA 2A3WA 2D6KA 4TSVA 1BEV3 2F6BA 5BNNB 4ATFA 2X05A 2DDUA 5FZBA 4Q0PA 1O7FA 2WS92 2XVLA 1PNGA 5FLHA 1BMV1 2E6VA 2HH9A 4XHXA 1LHWA 4GKXA 2WNEA 3FLPA 4WV8A 1NQDA 3AX4A 5C8CA 3BI3A 2Y6JA 1RVF1 3B02A 3HNBM 4WM8A 5JI9A 4JDNA 2JD4A 3VZOA 4HLTA 2NMOA 5A6QA 4K3UA 2XQXA 3LSDA 2IFRA 4O9GA 3S6PA 1SZBA 1ND3C 3VHOA 2YZ4A 2PQSA 2OXBA 3VL9A 2K46A 3BTZA 4AI2A 1X36A 1RUI1 1CAVA 1DZRA 1UX6A 3ZR5A 1FOD3 1CX1A 2NYYA 2HKXA 3U78A 4CDWC 4IESA 1VALA 2BQPA 3A21A 4K6BA 1AYN3 1ACCA 2CNAA 3KGLA 5C8CB 1CAWA 1Z7S3 4WM8B 5FWEA 4PI0A 3C7OA 1OURA 4RR3A 2OZ6A 4IE0A 3GHMA 1XNCA 2Z2SB 1PO13 4EQVA 1H2MA 1FMD2 3WX5A 3ACFA 1W6MA 4CCLA 1E5SA 4CPBD 1JTZX 2OQ6A 1SPPA 3U11A 3WF1A 2WL1A 4CCOA 2DTWA 1IS3A 5I0UA 4XTPA 1CAVB 1I9RA 3SKVA 2VVFA 2C24A 4CXWA 4QB1A 4EZ4A 1GOFA 5FMOL 2PHLA 4D7SA 3OF1A 2E63A 3DL3A 3RZKA 3SQOA 1CAWB 1R093 2XB6C 2P17A 1OQ1A 1WD4A 5JAXA 3H7YA 3U37A 4GQ7A 4RR3B 3K51A 3PVBB 1BK0A 3HQRA 4XILA 1UU5A 2GNMA 3AKTA 3AP4A 1LECA 3ZXAC 2BERA 5KR7A 1RUD3 3KS7A 4UW3A 1BHGA 4ARYA 1W8NA 2XLGA 3ZFEC 2Q0AA 2Y64A 3THDA 4NRQA 3T30A 1SPPB 4P02B 5FBZA 3T0BA 4TLFA 1ZBA1 2RM21 3D5OA 2W47A 1LHOA 1UOBA 2QQNA 1RUNA 2NMNA 5JPNB 2RS32 3FZ3A 5CFDC 5FY1A 2VOVA 1OKOA 1UIJA 2QQLA 4QWNA 5DAQA 4XZPA 2GP3A 4EV0A 3K75B 4FAGA 1QJX3 4NPMA 2P4EA 3WNXA 3VBOA 1AYM1 3IDAA 4LITA 1SCSA 1OPMA 2DYCA 4PDWC 2XJQA 4A42A 2CL2A 2VG9A 2WN3A 3KB5A 4CYDA 2WO2A 4I0WB 3MW2A 1YIFA 2ARAA 3PHMA 5CB7A 1AJKA 3SCGA 1H1AA 1G9CA 1QDOA 2WQ8A 4FFGA 5GZCA 4B8EA 4B4PA 4QB2A 5ERLA 5C3OA 3X29B 2RMU1 2RDQA 2ZGUA 3WQBA 1Y9GA 1VAMA 2UU8A 4INDA 4R9CA 4YZ1A 1LU1A 2PFWA 2JDPA 1G9AA 3N7MA 3VBOB 2GSYA 1G8WA 4LMFA 3BYWA 4DMIA 5JOWA 2VVDA 1UOJA 1Q8QA 3GZUC 3ZDSA 2Y6KA 5JIUA 3ACLA 2EAAA 3JCIA 3IPVA 3DKWA 1UWWA 3CU7A 2Y33A 4QM9A 1AL0G 3LEKA 4R9BA 1SLBA 4R9AA 4RQPC 1GWMA 1ULDA 1OQEA 1W0PA 5BNPA 2J1SA 5K4LA 2RR11 5DAVA 2XVKA 3ZXDA 3DYOA 3JBG1 3WCRA 1QH6A 2CHHA 4AQSA 5IWFA 2W46A 1CONA 5HCHA 3AL5A 1S0JA 1ALYA 4KU8A 4L2NA 3T2QA 1UOFA 4DOUA 2VQAA 1CIYA 4ZS3A 1OVPA 4BIOA 4M4PA 4I0AA 4GA9A 3IPVB 1JU4A 1TNFA 1BXHA 1DQ2A 5AC93 5FYZA 4DZGA 5FP4A 1JZ5A 2FDKA 1IOAA 5FPZA 5EIYB 3EQEA 4MV2A 4QDSA 5BNPB 3VHRA 3S5AA 3KHBA 4AHZA 5JSPA 3RYPA 1H8VA 3OUIA 3LPGA 1COV1 1MS5A 1YRZA 4AQ2A 1V9U3 5FDBA 3V0AA 2JDUA 2J1TA 2PAMA 5CKNA 5GZGA 1JH5A 1H2NA 2YPDA 3ENRA 3CQOA 5FYBA 3D82A 1KJRA 2HWE1 3IT8A 3S30A 3UV9A 3VZMA 5HV4A 1AR73 1LULA 2Y8KA 3WXPA 3ILFA 2RJLA 1WUVA 2JDKA 2ZX2A 1QQP3 1YUDA 2DVAA 3HT2A 4HBNA 1XBFA 3D6EA 5L9BA 2VMIA 3WLUA 4FTEA 1L3JA 4FPFA 4MUVA 1CX4A 4XF3A 4YW6A 2R6QA 2VMGA 3H9AA 5FR3A 2XONA 3V0AB 4LKFA 1DHKB 1EV13 2D6PA 3VDDA 5IYYA 1BEV1 1NA1A 2NLRA 2OA2A 2AEZA 4LA2A 5F8PA 2YGLA 1ND2C 2EVXA 2MEV3 3MBWA 2DUPA 1RUJ3 2YUEA 1YEWA 3MIGA 2ZJCA 3FHAA 3DUIA 1CZSA 2VNRA 1UX7A 5CG8A 3GALA 5GJ6A 4QKNA 1IKQA 1OLRA 3GBFA 1RUE3 1UY4A 4BQ2A 4YM0A 4AI0A 2IXCA 1HRI3 2BDRA 2FBEA 2JECA 2V4VA 3J9SA 3LCPA 4LBLA 4CZSA 4PIXA 4W8JA 4RD7A 4AF9A 4D0QA 4DS0A 2D6NA 1ULCA 2H6CA 3IDBB 1JYIA 5FRAA 1DQ6A 3H42B 1YC61 3QH6A 4LHNA 4FPHA 4QXBA 1NA1B 1WMFA 3Q8FA 4QKFA 5T55A 4P00B 2JDNA 5FY7A 4CCCA 5KXBA 1HJGA 4COZA 3POIA 2RG4A 2ZX4A 4PIZA 4HSJA 1S0BA 3ILNA 4BM8A 3KCCA 1FOD1 3WUDA 1HQNA 2R7EB 3V0BA 4OHZA 1AYN1 1WCDJ 4XETA 5APAA 2WABA 1V6NA 1Z7S1 3RZLA 3O0XA 2P6CA 2CAVA 1B09A 4LO6B 3LIGA 5FXVA 5JVVA 2CSGA 1YFYA 4I2OA 5J96B 1X33A 1PO11 1RITA 2WKKA 1AX1A 1OVSA 1ZZ6A 2WR9A 3LB9A 4JHZA 4RYDA 3MYXA 3M3CA 2XJTA 4EWAA 3AYDA 3EO6A 2E31A 1CAXA 2PHDA 4IXLA 5F3GA 4J1WA 3KT4A 2W91A 2R0HA 1PX3A 2A6ZA 4HVQA 4KBZA 3NNLA 1SLCA 3NQHA 4R4XA 1QMJA 2MPFA 2XH6A 3JQXA 2WO1A 4W6YA 4XW3A 5CAZA 2VCAA 3VBHC 3OBRA 4I3PA 4ITCA 4XEZA 3V0BB 1NCQC 4X6QB 4Z92B 1LGBA 2BVVA 4URTA 1YLLA 4JVAA 3URFA 1U12A 1R091 2WA4A 2VW0A 4A3ZA 1K5MA 3WW4A 3NJYA 1PGL1 4EROA 1O3QA 1RUD1 2DCTA 5T5JA 3DYPA 4BLIA 2Y0OA 5J98B 4CCJA 4W4ZA 2D3SA 1CAXB 4I09A 2K2SA 1RXGA 1J1TA 3VKNA 2ZEXA 1UAIA 4HOOA 2YBPA 2HYXA 1VBC3 3KF5A 3ORJA 4IE4A 4UFIA 2DCYA 4PF5A 2BGOA 5HPOA 3MV11 2HEYF 1RUF3 1RYYA 4IETA 2VMFA 4HPKA 5EQUA 2DUQA 3WW3A 5C7GA 2W1WA 3KV9A 5DQ0A 2QQJA 5IFTA 1K5MB 3CKHA 1D4M3 1PMIA 3H1YA 4JGZC 4UAPA 1ZRCA 3POSA 1QJX1 1YCIA 5F7UA 1XYPA 3E5XA 1CR7A 2WSUA 2QVSB 3ZXKA 4BK5A 2E7TA 3WEZA 4TTGA 1YO8A 4YFWA 3AJYA 5FYMA 1WWYA 4N43C 3TN93 3BB6A 4WVVA 3OBAA 5KHJA 2Y38A 3WF0A 2AENA 2XOMA 3O1MA 2P3KA 1JBCA 2WN2A 5CZKA 5A1LA 3S7IA 2CGPA 4LLOA 2AC1A 4AVCA 3GBGA 4HPKB 5T5PA 1X50A 2BGCA 4R4ZA 5CA6A 4AYUA 4Y24A 5LATA 5JXJA 5FTTC 2IZWA 2W5FA 1GBGA 2BBVA 3ATGA 4AWDA 3ON7A 1F9KA 4X8PA 5DDJ3 1W03A 3SCFA 1RINA 3R4SA 2ES3A 2LS6A 3AXEA 3PMSA 4P9XA 4XUQA 5LK5A 3VKOA 3W20A 5FY0A 2ZGRA 2SBAA 5BV6A 1V6IA 1W8FA 5KBFA 2WNUA 3FLTA 5DUVA 1UU4A 4LBJA 5K0UA 2DTYA 3VBRB 3ZLIA 3MZHA 2ZEWA 4B29A 3VHPA 3B9CA 2D93A 2JWPA 3N9LA 4R9DA 1SDWA 1UO9A 1X8EA 4UFHA 2WZPP 4CDQA 1QJY2 4ISRA 2D40A 5LASA 2RS53 1HKDA 4DIQA 4L11A 1H2KA 3V64A 5LB6A 3KT1A 3ZMOA 4Z07A 4AFAA 1LKNA 4KU7A 4YWAA 4XHBA 2JDMA 1HRV3 5A3WA 3ACGA 2VE1A 2WNVA 2ZAHA 1F4AA 1ZBE3 3DF0A 3WNLA 2Y0IA 5EJ1B 2WNUB 5IUQA 3RJ2X 4EN9B 5K0UB 1OA2A 2ZKLA 2ZS6B 4L9BA 5D8AC 1I6XA 5C70A 4DXRA 1GWLA 3MUZ1 4MGIE 3O1TA 4X6RB 2Q5TA 4CDQB 5JZGA 3BKZA 3WNPA 1M4WA 4W6WA 3EXUA 4EN6B 1R082 3DGTA 1SDDB 3POYA 4M0HA 4Q29A 1F8VA 1RHI2 3A23A 4FFFA 4P9WA 4GZ9A 1VBE2 5FK7A 4Q4V3 1YHFA 4TWTA 4WM7C 2Q4SA 1KFXL 1V9U1 3WZ1A 4A4AA 5ACA2 1FYUA 1LOFC 3NJZA 1VB4A 4FTBA 3D8CA 1A3KA 3VBFC 5JOYA 3HNYM 4A7KA 2GC3A 4IGPA 1VBA3 4XIOA 4G3YC 4JV4A 5FPXA 1MZ5A 4IERA 4QXCA 4XVHA 5F39A 1AR71 3RG0A 4AL9A 4CEWA 3QACA 3RZJA 2W1QA 4NOTA 4P9JA 3OPWA 4AVAA 2XWJB 4GD4A 4DQAA 2QQKA 5F1RA 1QQP1 2JD9A 3WG1A 2CDOA 3ZSEA 4BMEA 5JZGB 2G9ZA 2BBAA 1AL22 5C4WA 3T1MA 2JICA 1H4GA 1X8MA 5ANNA 4CCEA 1MVEA 2LTNA 4NE9A 3GBWA 1WLWA 2VBPA 2B45X 4MO3M 4OLLA 1EV11 1CQ9A 1S2BA 4YW1A 5FZOA 4YGEA 3WF3A 3POWA 2D43A 2MEV1 3IIAA 3AVSA 4L99A 1UU6A 5DG1A 1U0AA 4CEWB 4E4HA 1N1VA 1RUJ1 3MW3A 1OBNA 4I30A 3L9JT 4RGAA 5FBJA 1W2UA 2Q8EA 1KGYA 3PVOA 1A6CA 4NAOA 3U14A 4AGRA 5FLJA 5FY4A 4EN7B 1RUE1 2ZZJA 3O1VA 1RUH3 1HRI1 2YFUA 2VCMA 5FPAA 5FUIA 5C4WB 4K9SA 2BNOA 4QPGC 3G7DA 2RS13 4A6OA 2IXJA 5C6CA 5CISA 2HEVF 4HN0A 1BYHA 2WT0A 5FZOB 3MDPA 3CNAA 3LF7A 3K48A 4PQ9A 1PMHX 4OHXA 1JOJA 2VNVA 2CYFA 1V6OA 4CP9A 1AZDA 5LBFA 3USUA 1LCLA 2RDSA 4IE7A 1X7NA 3T4VA 1HB2A 1JHJA 3ABZA 3I59A 5CNAA 2OUHA 5FP8A 4DEVA 5A32A 1PVXA 5IK5A 4GWNA 3WP6A 5I93A 5IVYA 5A80A 1BVP1 2P2KA 3OUJA 4E4SA 4KL1A 3NW4A 3ZN4A 3BU0A 1A78A 3WHUA 1JYVA 5DXDA 1UY1A 4XJUA 3M4FA 3WP5A 5BNNC 1LHVA 3DN7A 1AR93 3U4SA 3LAGA 2WYSA 3AMNA 4QQOA 4CP9B 3USUB 2A3XA 2W0XA 5KXDA 4RSUA 5JSRA 3M3QA 3MHZA 1AR63 3PL0A 3T2TA 4YVSC 4COUA 4E2SA 3BN6A 4EWDA 3I59B 1DFQA 5A32B 4AEDA 3KGZA 1E5IA 5BY5A 3AKRA 4TXWA 4N53C 3UNPA 2PLV2 4PJYA 1S1AA 4CP2A 2VPVA 1X9TA 5H9SA 3JD72 2HWC2 4A44A 5KHHA 2FMYA 2XBO3 4NROA 2VOWA 1LJ7A 1H1MA 1VBC1 2FCTA 3UGFA 5LA0A 1I5PA 4AFCA 3K4ZA 2WYFA 5ABJA 5B4NA 1RUF1 4TZDA 2D5HA 4OUEA 1YQ5A 5A33A 2V73A 3ELNA 3OGSA 1C3HA 3RWNA 4AHYA 1O5LA 5EZWA 5A6YA 1D4M1 2JG8A 1DCSA 4PQQA 4AEDB 3N7JA 2RVAA 3W21A 4YG0A 4Y22A 2ERFA 4WM8C 4A6SA 3AM2A 2QZ2A 3GZTB 1ZRRA 1J83A 3N9MA 3O0WA 4FPGA 2BW8A 1RC6A 2VAUA 3OBTA 3H3UA 3AZWA 1NCRC 3TN91 4FVVA 1R1A2 4YVWC 3V65A 5HV0A 1RUC2 4HETA 5FP3A 2WNOA 3ZYHA 3N36A 2QDRA 3WP3A 5ABJB 2VUDA 5DZEA 1PGSA 3TOJA 1OFNA 4G4FA 1RUOA 2Z5WA 1POQA 4D69A 3AP5A 2JG8B 1VR3A 3INAA 1QJZA 2QTWB 1DGLA 1UZZA 2QE3A 3FUOA 4Y22B 1NY71 4E4DX 3IBMA 5DDJ1 2VTXA 1VBD3 1W6OB 1OA3A 3PURA 4RR3C 3SMHA 4YSFA 5JR2A 4CE8A 4KWLA 1MZEA 2VNOA 1BCXA 3IAQA 4RHV3 4HANA 1W6PA 1D0HA 1ULOA 4K1YA 1W8ZA 2VZTA 3NVCA 3AKQA 2OQ7A 3BTAA 5JCTA 2BWCA 3OY8A 4RN5A 3UKTA 5FJKA 1EYBA 4U36A 1IG0A 2H0VA 4LNVA 3VZNA 4A7ZA 5C8WA 5GLTA 1PZ9A 3A4UA 5FZDA 1RUG3 3CEWA 4S2GA 3RDIA 2RS51 4C91A 1BKZA 2P3YA 3ZPYA 2XJRA 2DU1A 2WDBA 2FDHA 1SFNA 3F2ZA 4Q4X2 5SV5A 1HRV1 3VLBB 5FKBA 2BYVE 2KD7A 2BOIA 1ZBE1 4B3NA 3THPA 4ISQA 2JB8A 3ACIA 2KM2A 4JGYA 3O14A 2DUOA 1GP4A 3W9AA 2VZPA 3UL2A 1H30A 2Z79A 4DRRA 3OY8B 1S55A 4CDXC 5LEJA 5GZFA 4YM2A 3UGGA 2UY8A 5EJZB 5BPXA 5LCWL 3RZGA 2B5HA 2R16A 3LOIA 3LE0A 3IWZA 1XNAA 5FMDA 2EF6A 4FPKA 4NIDA 1SHWB 2R30A 4Q4V1 1JXNA 1YI9A 5AC91 1XSRA 4YGBA 3WW2A 1FNZA 5L73A 2AEYA 3THTA 2BFUS 4XOGA 2VOKA 1VBA1 1JOBA 1C5HA 1VMJA 1VPHA 2K0GA 3K2OA 1KITA 3L2HA 4RS5A 3SC7X 2ZKNA 4N9HA 1BVVA 1W06A 2QQVA 2ZHKA 2VH9A 3MIEA 4AHXA 4JGYB 2WLPA 2R062 1W8UA 2IWGB 3A0NA 5FZEA 5DAPA 3WT3A 3O1RA 4AXOA 2XVGA 2B42B 4IE6A 1UZVA 1CWPA 4Z1VA 3OG2A 4FP2A 4CTEA 4LHLA 1U5YA 4QX2A 5I91A 4XQ4A 3S0MA 2R043 3UJQA 4CU9A 1WW5A 4ZHNA 2QQWA 3J7MA 1UXXX 1K3IA 1JYNA 3OPTA 4QB6A 5FPVA 3U75A 2VU9A 1S0EA 5F3IA 5JOXA 1TMF2 1W8WA 2B46X 4RS5B 1J3QA 1NE6A 4XE9A 3LGRA 5EFUA 3WG4A 1W0OA 2YROA 3OYWA 4JKMA 5FZMA 3HOBA 1Q8SA 3MFAA 3H3ZA 1O6UA 5JR7B 2YPJA 3ES4A 1SLIA 1WZXA 2R072 1B35C 1MQTC 1HQWA 2YDEA 4FP3A 4FI9A 2XUEA 1JUHA 5JXGA 4K21A 1RUH1 2QQIA 2ARBA 2ZGPA 4JTNA 2JDHA 5BNPC 1ZA4A 2FDFA 1HJFA 2C9AA 3R6SA 3KZ4C 2RS11 2YC4A 2BWAA 2IXKA 2XHNA 2ZX0A 3M8LA 3MF6A 4EYUA 5LK7B 4CUAA 2GMPA 3RYKA 2ADDA 1NKGA 2JIJA 4GMP3 1ZVFA 5IJRA 5E88A 4Q0VA 2VL4A 4MYEA 3OYWB 2PELA 5FLIA 2VZSA 3ZPOA 4PF1A 1W05A 3RSJA 4ZKTB 2P3IA 1FX5A 4UBHA 2R49A 1ULGA 2HJIA 2PHUA 3EJKA 1NLQA 2OW4A 3AK0A 3I8TA 4QU2A 5EJ3A 2ZEYA 3L2YA 1OF4A 3CJIA 2OPKA 3KCXA 3SEEA 5A6ZA 3GZAA 2A73B 4PCRA 5EP9A 3FC0A 5IVJA 3G6JB 3ZYPA 4LIUA 2X5IC 3KVAA 4FSJA 3NV1A 1O59A 1C28A 1Y3TA 1HX6A 3ZFFC 2W08A 1OUXA 4ASKA 3NJVA 5F2WA 2VMCA 1OI6A 2FZ2A 1QJU2 2RDNA 5AVAA 1VRH3 3PJQA 1AR91 5BUVA 2GC0A 4XCBA 4FQ4A 3E5UA 2VJXA 5J1XA 4OHYA 5CBLA 1AR61 1JMUB 2F4LA 1KS4A 4IEPA 2Q8CA 1O8PA 2HLEA 1US3A 2PHRA 5L19A 3KV5A 4UT5A 3CJIB 3HMYA 3QBQA 1TVGA 5FYTA 1C5IA 5IW0A 4HMZA 1GP6A 3KM5A 3GF6A 1E5RA 4Y5SA 5EHDA 5FREA 1CPNA 1ZX5A 2C4XA 2XBO1 1EP0A 1UY0A 2ZHLA 3VDDC 5FPUA 5FOBB 2BUKA 1NA1C 1VAVA 2PYTA 3ZKYA 2UWAA 2YFZA 3ZSJA 4NUBA 3BU7A 3AP7A 4M0NA 3NRUA 2V4AA 1IQDC 1EPZA 1PZ7A 4MGZE 1QY4A 5IVFA 1H2LA 2WWSA 1XB9A 3E1F1 2WSVA 4LPLA 2Z69A 2DFBA 3P6BA 1EUTA 4MXVA 1BMV2 1XRUA 3N9OA 1YJKA 2AR6A 3RNSA 5L7OC 5C9AC 3WP4A 4RFRB 4SLIA 4YFZA 1RVF2 1OD5A 2XJUA 2ZAAA 1FPN3 1ASJ3 1DLCA 2D3RA 5H9RA 1MEC3 1PNFA 4GULA 5EYYA 2PXJA 1QU0A 3C2UA 1I5ZA 2ILMA 4AVVA 1H8TA 3T0DA 2G19A 1W2TA 4QHZA 2R1DA 2I2SA 3ETPA 4LEJA 1EY2A 2PA7A 4AI9A 1LB2A 5T5LA 1HW5A 1WLCA 1MPXA 3KWVA 5DG2A 4IV1C 5A7QA 3WQ0A 1WA6X 1F2NA 1RUI2 1VBD1 3NMBA 2TUNA 2PHXA 2ZMNA 4YYOA 1QJY3 4MHRA 4RHV1 3AZZA 3MEPA 3D0SA 3I97A 2J1AA 4GB33 1VMHA 4HKLA 4UBGA 1CGPA 2GN7A 3AFKA 5EWSA 1UY2A 4Z8BA 2GN3A 5HXVA 2JDZA 1F31A 3OTFA 2QQPA 3RS6A 4GH4A 1H8TB 2JEMA 3U07A 1S0CA 1RUG1 1AXZA 4LBQA 3MPBA 5FY5A 1UZ0A 4Q4Y3 3ZX7A 1CZVA 5FUNA 3ITQA 4FFHA 1K5MC 3RZZA 4QGMA 5C3SA 2FMDA 1WMEA 1D4VB 1L7LA 5FYUA 1JN2P 1ODMA 1WGPA 2DF7A 1IPJA 2ZMLA 3IMNA 1VBE3 3TAYA 1WKYA 3ES1A 5DABA 5ACA3 3SNMA 1CN1A 1UXZA 1WCKA 5FYIA 1CD3G 4GH4B 4I02A 1TQ5A 4LBQB 5J3UA 1LEMA 2TNFA 1ZBA2 2RM22 4D7YA 1JZ4A 3J8F3 3PUIA 3CL1A 5KXCA 2WT1A 2HWD3 1EPWA 2B7YA 4YPJA 5FXWA 1H9WA 2VGDA 5G04L 1C1LA 4WVZA 1UYPA 2QFEA 4COWA 5A3TA 3NL1A 4KWKA 5DMYA 1LR5A 3T3YA 2VOXA 1AYM2 4ARXA 2FDGA 3DPRC 2VBDA 4YZ2A 1QNYA 1OH4A 2DURA 2P6HA 4CRQA 2VULA 1SLAA 1ZZ8A 3HPNA 5LBBA 5TSWA 4OI2A 4KGQA 4BIFA 4IE5A 3MICA 3POBA 1LOEA 1VRBA 3R0RA 4LOTA 4ZPIA 2R041 2K9ZA 2Y6FA 4YG3A 3A0KA 2G1MA 2HWB3 3OJBA 5FY9A 1V6LA 3QLQA 2RMU2 5EV7A 1AXKA 1UMHA 4CPBA 4ZU5A 1R1ZA 5IHRA 2RV9A 1XQNA 4YW7A 3N9NA 3MUY1 4MGKE 4KG0A 1VP6A 2WNUC 5AFEA 1C57A 2JE8A 4LXLA 4AW7A 1ST8A 3WDWA 2O14A 2C9KA 4GXLA 3AJZA 5A7NA 1WCUA 3UT0A 4CDQC 5FZ8A 1Y9QA 1AX0A 3NJXA 1GOGA 1ONAA 5KWRA 2A3YA 4FFIA 1POV3 5A3UA 2V09A 3RI9A 3ZR6A 1VBB3 4J25A 4K20A 1QNWA 4IEUA 3VD9A 4BB3A 2WRAA 4GMP1 5GALA 2RR12 1XSQA 5IVBA 3FBMA 4CCDA 3I2GA 1A8MA 3JBG2 3K3NA 4I0BA 2WFF3 1TG7A 2JG9C 2WNVC 4XTMA 1K42A 1VB2A 3B94A 4NHKA 3A7QA 3DYMA 3OOXA 4HK9A 1KQRA 3CDZB 1ZZ9A 2D3PA 2QZ3A 2OYZA 4DXZA 1Z0HA 3OEBA 4UOJA 5JXHA 4GJYA 1PVC3 3JU9A 3J7LA 4HKWA 1EAH3 4AE2A 3O1SA 2E9QA 4AFMA 2XR4A 4ASMB 2BNMA 4N90A 4XFHA 3RZHA 1PIV3 2ZZQA 4AI3A 1BJQA 5CADA 3TWIA 4OULA 4MHUA 4BXFA 3FWEA 1OLQA 3ZOIA 4AQ6A 4M4RA 3VN4A 1A34A 1JW6A 1VRH1 4C1XA 4DB5A 3H0OA 4M3CE 5DZFA 4CXYA 1BBT3 1COV2 2G4IA 4V1PA 2VECA 4YW4A 1PO23 5HCAA 1KD7A 5FYCA 1D7PM 3RMXA 1JZ6A 2C6SA 1TME3 1N1SA 3TEYA 3VD3A 3BTXA 4XMAA 2HWE2 5DZGA 5A3OA 4JRLA 5DPNA 4K7JA 1JZ8A 1ZRIA 2G9GA 1DP0A 3RFRA 3W59A 2IUWA 2WINB 2VC9A 3VD4A 4F3JA 1OD3A 1T2XA 3BCWA 3NNFA 4F8AA 1F35A 4FBFA 1EUUA 4K8FA 1QXRA 4H55A 3ASIA 4UW6A 4DEQA 2HWF3 3HJRA 3P3NA 3FN9A 2PHFA 2CAUA 2W2IA 3CF6E 4MSVA 1ULEA 5T3NA 1HN1A 1UPIA 5FZHA 4FPJA 2VTFA 2QJVA 1BEV2 2UYBA 1DIWA 1N1YA 4LE4A 5FYVA 1C8M3 3PUQA 4XJ9A 3ZFEB 4PDWA 1W2OA 3AZYA 3LA3A 4Q4W3 1U5ZA 3KVBA 3J7HA 2FDJA 4MX3A 5LA9A 1TE1B 4XABA 4PT6A 1OXCA 2GC2A 4FT8A 5DUWA 3UKNA 2VXJA 3V56A 3WG3A 2BNNA 3C7GA 4Y1VA 1FPN1 4XFFA 3RI8A 1ASJ1 1ENXA 5I0DA 1MEC1 3O12A 1H1IA 2I74A 4L0PA 2VMDA 1N3QA 1OC1A 4Y26A 5FXZA 3WDVA 3JQWA 4LOSA 1O4TA 4XF1A 4LBMA 3U0ZA 2XKPA 1Q8OA 4BU2A 5F6KA 3M70A 4PDWB 4EJRA 4YG6A 2QQUA 1W28A 1DU3D 4JKKA 4U2AA 5F3EA 3FHQA 1FOD2 4OYUA 2UURA 5FMOS 5C3QA 1AX2A 2KA3A 1QJY1 3FE5A 4XFAA 1DF0A 2EA7A 3SKJE 3E6DA 3K77A 4W6XA 4AOCA 1AYN2 1GNYA 2VZVA 1QWRA 1Z7S2 2C0ZA 4GB31 2XJVA 2OUJA 2XDVA 4N7IA 3BALA 2KXLA 3AYCA 1XU1A 3MW4A 4ZU4A 4XDOA 5A1AA 1O3SA 3VBRA 1PO12 1QOTA 1UMIA 4RGKA 4QPIC 4E4ZA 1K45A 3K3OA 4CUCA 1KDMA 3I2OA 4P9YA 1XXNA 3AYAA 3MFCA 4NN0A 4Q4Y1 3KV4A 1W3XA 2QQMA 3HNMA 4AGVA 5JLVA 5FPLA 4MZUA 1W9TA 4AEDC 2O1QA 1UZWA 2JKBA 4DPNA 3NV3A 5FPBA 4XCAA 4PLNA 3UGHA 3ALQA 1R092 1VBE1 4AAXA 4XIKA 1PGL2 4QX1A 3IZOA 4PLMA 4CXXA 1BZWA 3WINE 5IT6A 5ACA1 5JWPA 2H6BA 4XPVA 1RUD2 2OIIA 4DRVA 1JYCA 2AH2A 3WW1A 1OUSA 4XFIA 3VD7A 4AFBA 4B1LA 5ABJC 1F5FA 5A3MA 2O8QA 4CU7A 3J8F1 4LA3A 5F3CA 1J3RA 1NZCA 1AR83 2HBUA 2B39A 2HWD1 2UYAA 2VMEA 3Q8EA 1JI6A 2WZR3 4LKDA 4Y5TA 1MS0A 2WIIB 3AXDA 3NV2A 4Y5Z0 3J4UH 3OD4A 3TYJA 1ZREA 3VDAA 3H50A 1QJX2 1JZ3A 2QUOA 1RMU3 1NOVA 3H7JA 2YGMA 4CCKA 5CVRA 2BU9A 2W87A 3BUCA 2IXLA 1SQ4A 4ASLA 2BFUL 4OUMA 1CVNA 4D3WA 1Q3EA 1F4HA 3NAPA 2VUAA 4XUTA 4QPWA 4GJZA 2HWB1 1SEFA 2CGOA 2ZCWA 3LWCA 1E5HA 2I07B 1ND2A 3PNAA 4R8HA 3ZXJA 4ATEA 5ISLA 1LTEA 5CIRA 3BPSA 3KQ4B 1JYXA 1DLLA 1O4YA 2XPJA 1OMIA 4PLOA 2PHWA 1QOSA 3KSCA 3HAGA 1XNBA 3ECQA 4K1ZA 4AVSA 4C90A 2ZBJA 4FCAA 4XF4A 1GKBA 2UY9A 4ZONA 3TEXA 3JB8A 1PK6A 5I8TA 3BODA 2WS93 3I2HA 3NAPB 1POV1 2N7GA 1VBB1 4OI4A 1QF3A 1QOOA 2A6VA 4YZ5A 1ND2B 3D0JA 2PAEA 1G9BA 4QXKA 2GMEA 5SV8A 3LEIA 2WFF1 2SLIA 1RXFA 2DVGA 2W3JA 1QEXA 2Z42A 4UW4A 5A7PA 2BGPA 4OUSA 1YNAA 1PGW1 4Y33A 4KGGA 1YQ6A 1HLCA 3VBSC 4Q5OA 1PK6B 5A1FA 1PVC1 4M3CA 5A3LA 1EAH1 2QDNA 4MADA 1DYPA 3OSDA 1PIV1 5A7SA 1S2KA 4HVRA 2CTVA 2VQUA 2BRTA 1VLNA 5E1RA 4ES8A 4NR1A 4B1MA 1MR5A 3VBHA 2ARXA 2Q8DA 3OD0A 1NCQA 4YRDA 3BGAA 1FMD3 1SBDA 1ZZ7A 3GM8A 3BOPA 4XQWA 1V6KA 3QH7A 1BBT1 2WC2A 1V9U2 4F83A 1X9PA 1PO21 1SG3A 2BJSA 3AP6A 3RWKX 3I2IA 1LOCA 1TME1 4P5YA 4CDUA 3DECA 1RB8G 3WNMA 4FOWA 4LHSA 4LO8A 4M3CB 4RGGA 1LRHA 3Q8BA 4HN1A 5CU1A 4NHYA 1WBLA 4DY5A 1AR72 3P3PA 3WF2A 5C3PA 4GKYA 4Y3OA 5FZ9A 2D44A 1FXZA 2RJ2A 3OGGA 5F2SA 2X09A 1LHUA 1QQP2 4META 2EXHA 2CY6A 2IFWA 2J42A 2O8OA 3VBHB 1JYTA 2HWF1 1GYKA 1FI2A 1NCQB 3WUCA 3C7FA 4Y20A 3WD5A 4HT1T 1RJ7A 4Q0SA 5T54A 3OEAA 2JENA 4JGZA 4RL7A 4BQ4A 4Z82A 1EV12 2VUJA 3BIWE 1BQPA 1RVF3 2AGSA 4JQRA 4CDUB 3VZJA 1C8M1 2Q30A 1YWKA 1BK1A 4YW5A 1GWKA 1AJOA 2RS33 2MEV2 3FMGA 3M1HA 4FOVA 4MH0E 4Q4W1 5ANQA 2DFCA 1V70A 2VQTA 4N43A 1RUJ2 4DNYA 1YQ2A 2W94A 4NWWA 2WAAA 2P5BA 1C4RA 3ZXFA 4AVTA 3PVEA 1IS6A 3OGJA 3SXWA 3ZSLA 1RUE2 2HEWF 3S57A 4M3CF 1FATA 2Q8OA 4NHMA 5F9TA 1HRI2 3BOWA 3LEMA 5I8SA 3ZSMA 5FO8B 5FZIA 1CJDA 4IEXA 4Y20B 4HL0A 2JXAA 2PAKA 2ZGNA 3AMHA 4OZXA 2ET7A 5F5IA 4E2QA 2YV8A 4HONA 4JGZB 3I2KA 2WQ4A 4E2GA 1I3HA 1REFA 3RRDA 3W5NA 2GNDA 3N9PA 2GP5A 3HIFA 3LKJA 3LFMA 1GSLA 2A1XA 5C8CC 3MIBA 1QIQA 1WD3A 2AZ5A 2YB7A 1ENRA 1JS9A 1W6OA 2NQYA 1VIWB 1GOHA 3ILRA 4N43B 5FV3A 3BIEA 3CJIC 3LSEA 5GM0A 1G9FA 4ES9A 1HXS2 2E51A 3HVDA 4LK7A 2FCUA 1NLSA 4UFKA 3UJOA 3EYPA 3LFIA 3KLSA 2AREA 1WCSA 2E26A 4S2DA 3I54A 4XXAA 3THCA 5HXMA 4LBOA 1YQ8A 5A7WA 4QT6A 4OMCA 3TNQA 4ZZ5A 1QDCA 1GZCA 1WLTA 1DYKA 1T6BX 4JHTA 2GAUA 2YG0A 5T50A 5JPMB 3QOPA 4LE3A 4OHWA 4SBVA 4AK3A 2YU2A 1UYZA 1S0IA 3N4MA 1NT0A 2YHJA 1UN1A 5LA2A 4J1XA 3JB4C 4AGGA 1GNZA 3VGIA 1SBEA 1W8TA 4XF9A 1LHNA 4Q8LA 4J6GA 4Y1XA 1ZNPA 5D8AA 5FZ6A 3PUAA 5FMBA 4QX7A 3T09A 3AVRA 4IV3A 4NIGA 3ZIXA 4V2WA 5E16A 4FPYA 4QQ2A 4FQZA 3ZO0B 4NRMA 5A7WB 1CPMA 4P5HA 2A7AA 1UKRA 1QH7A 1UNBA 2IVIB 4HSLA 4LK6A 4HZFA 1LOFA 1GV9A 1UCXA 1VBC2 2DCKA 2ET1A 4O7XA 4Z2AA 2LROA 4P14A 4Q27A 1AR81 1GU3A 3HN1A 3PTYA 4YNIA 2IXHA 4A41A 1RUF2 2ADEA 2WZR1 4NHLA 4PBOA 1URXA 4JDMA 2VZQA 1GZTA 4IW3A 5D8AB 1D4M2 3D3AA 4B4QA 4IV3B 5B2GB 2CV6A 1RMU1 3APBA 4FXGB 3HD8B 2DBNA 2W39A 5CKQA 3O1UA 1AUYA 5LY1A 3OB8A 5E8AA 3LPFA 4QX8A 4UF0A 5LRRA 2LUWA 5F5QA 3TN92 3ZSKA 2ZA9A 4GIQA 2GC1A 3E97A 4S2FA 1NLRA 1W04A 4A2UA 1KS5A 4MGSA 3VBFB 3DKQA 1TEIA 4LHKA 2WWJA 4W65A 3LOBA 4QU1A 3FUQA 3VBOC 1PZ8A 4KNCA 2W1SA 4CP0A 3PMEA 1HIXA 2JB4A 4MG2A 2P34A 4YZ3A 5JMCA 5D2AA 3H1WA 2RDRA 4BOWA 3P1IA 3CBNA 1NY72 4NO4A 5DDJ2 3N7KA 5LBEA 1MS8A 3B00A 5FP9A 1DZTA 3P5BA 4UF0B 3MI8A 3PUSA 4FPCA 4YW3A 1XE0A 3AC0A 2WS91 4LUKA 3ZXGA 4QQHA 2VR4A 2WLQA 4NRPA 2VUCA 3DV8A 2ZHNA 3WG2A 1VJ2A 4XFBA 1GANA 4LTAA 1YQCA 1H9PA 2LRPA 3AKSA 3U4XA 1S0DA 4FPLA 4PHZA 4CEYA 4OQ8A 1A8DA 4P9LA 4Q0UA 4NIHA 1W9FA 4EN0A 2YBSA 2ZX1A 1UF2C 3GJBA 4IGOA 5GLWA 1HRV2 1SFPA 4QPGB 2JKXA 1ZBE2 1DQ4A 2RHPA 1REDA 3C7HA 4ZZ8A 2J7MA 4KBBA 2E32A 1IPSA 4LO7A 3NV4A 5J7MA 2WZEA 1IGOA 1FAYA 1DQ5A 3HT1A 3WQ1A 5FZAA 4XACA 4NHXA 2W95A 4DXTA 4S2HA 4CEYB 4XJZA 2ETEA 1FMD1 2B9VA 4Q4V2 4QAWA 5AC92 4YVSA 4H7MA 1POV0 4HG6B 4LBQD 5FKCA 4YW2A 5FZCA 4MXWA 2P3JA 3EB7A 4F7ZA 4UWDA 3SEPA 3CLPA 3LIHA 3RMYA 3B3QE 5IFPA 2D97A 5E89A 2E53A 4N53A 4UW5A 1VBA2 1PMJX 4EN8B 5FZ7A 5IATA 4QDRA 2OPWA 2A6XA 1NXD1 1DBNA 2D6MA 1SFYA 1UIKA 4DO0A 5BNOA 2V5YA 2MNGA 4LR4A 5EYXA 3MGUA 5JIAA 4B4RA 5C5TA 1MS3A 1SLTA 2A6YA 2O0OA 4M00A 3TRSB 1MZ6A 2J22A 5H9QA 3WNNA 3QCWA 5I0RA 4XAAA 3EHKA 4YVSB 2DV9A 4MXWB 3AMMA 1Q43A 3B01A 3E6BA 3JZVA 5FJHA 3POGA 4N53B 5FZ3A 2ZMKA 2RS31 1W90A 4IGQA 1GFF2 4L92A 1C8NA 2C1FA 3OCPA 3IB3A 1NCRA 3WDYA 3ZDVA 4AEKA 2D5FA 4E8DA 4YVWA 5AVPA 4QX0A 3I3EA 3KV6A 5BNOB 3N9QA 4AFDA 4KH9A 1ZZCA 4ZS2A 1LENA 4Y4YA 4Y1ZA 5GZEA 3ZKUA 5JUVA 1HB3A 1RUH2 2CU5A 4CCNA 1W9WA 2YC2A 4IEWA 3ZMNA 5KHIA 3H8RA 3VD5A 1WA4A 3PJYA 3QD6A 1C1FA 3IN9A 5DUXA 5KC6A 4W50A 2RS12 4YARA 3GDBA 2J1EA 2ZXQA 1F5JA 3B93A 2UWBA 3J26N 3ZN5A 5JMOA 3MIDA 1HB4A 5BYNA 3IIIA 5GKAC 1G7YA 3LDBA 1K5JA 2BTVC 4BDVB 1NCRB 1WMXA 1YIPA 3RVHA 1IG3A 1HB1A 3FBYA 4UFMA 4XBNA 4YVWB 4HXCA 5KXEA 1NUKA 2PHTA 5FYHA 1OPOA 1WW7A 3PIJA 5JOZA 2VY0A 2CWMA 1YFUA 1GQHA 2JDAA 4XBQA 4LULA 2ZGKA 5A7OA 1HDKA 5EXOA 5JDBA 1SCRA 1ENSA 3IDCB 2BZDA 4BJ0A 2VZRA 4Q2FA 2PN5A 1NQJA 5LY2A 4OI1A 2EIBA 3TNPB 3LDKA 5LA1A 1JZ2A 1PM7A 2EICA 5J48A 1H4HA 4C1WA 5J37A 2JE7A 1OKQA 1S4CA 3LEGA 1AR92 1W6MB 4NIAA 4ZXEA 1G9DA 1XNDA 3CZUA 3KT7A 3WDTA 1AR62 3ZXLA 5I0TA 4CDXA 3BPZA 3I3QA 3C7EA 3IKWA 2FDIA 5C71A 3WVJA 1YI7A 5LBCA 3UESA 2GH2A 3KMHA 1OOPA 4YM1A 3WR0A 1V0AA 4H3WA 3NSTA 3CZJA 3FFZA 3GCWA 4V2VA 4CUGA 2X10A 2XBO2 5DAXA 4QPYA 4XYXA 4XXPA 5K7PA 1XJAA 5CFCA 2OZJA 4Y4RA 2WQZC 1VE0A 1R083 4IQPA 2Y34A 4A3XA 4OVEA 1LAJA 2F17A 1RHI3 4CDXB 3B5LB 2VTXJ 4MVTA 1LEDA 1KFUL 3VBUA 3S7EA 5FZKA 4XFCA 4Q1RA 4RFT0 2E7QA 2EAKA 3R4UA 1GQGA 1OOPB 2W68A 3MF9A 2VD7A 3MPPG 3ZFGA 4D6SA 3TB0A 1E57A 2IC1A 2OX0A 2UWCA 2CDPA 1LOGA 2GZWA 4TN7A 4AAPA 3T2OA 2ZPXA 4WBBA 5AFBA 4XDQA 3C3VA 4LKSA 4ORFA 1OSGA 5T5OA 5CFCB 5LW9A 4YM3A 1O3TA 2BOJA 1AL23 3PU3A 2FQPA 1M06G 3N35A 5IK7A 1W39A 4NAMA 5D1IA 3VBUB 1B35A 1XE7A 1MQTA 3ZYFA 1ZYBA 2ZGTA 3U1XA 1W8HA 3SH4A 1VBD2 1N3PA 3VBRC 4JRAA 3ZFGB 1ZRDA 4BHPA 4JC1A 5G05L 1IZ3A 4H14A 4RHV2 3HN3A 4HVOA 1J3PA 1ZRFA 3SHRA 1JOPA 4BQ1A 4P08A 5I0SA 3DCQA 5J36A 3T4HB 2XQRA 1Q5OA 1LGCA 2PQQA 4CA9A 2YU1A 1R64A 2CWSA 3EBRA 2C5DA 1RUG2 2RJKA 5CYYA 1B35B 2GDFA 1MQTB 2GU9A 4IEQA 4IL7A 2NN8A 4JQTA 3FFQA 1T6GC 2W9XA 4LBKA 4CVUA 4IEOA 1JU3A 4QGLA 3WSOA 2VMHA 4IUGA 3NKGA 1RTVA 1ZZBA 2VM9A 3FL7A 3K46A 5FUPA 3SITA 5C33A 4MGTA 5IVCA 1UY3A 5HCBA 5F37A 5KHKA 3VKFC 2V5DA 4D8MA 2X5IA 1ND3A 1UYXA 2A71A 3VKMA 1SACA 5T52A 4MLOA 3FJSA 4UXAA 2DVDA 3ZFFA 3R4DB 4EZHA 5FO9B 1APNA 2W1UA 3T2PA 3OPZA 3OGRA 2L9LA 4CUBA 1DQ0A 3ME2A 4LKEA 3NNGA 5FQ0A 4CDWA 1Y9MA 5FCCA 4XURA 1L7RA 4YLZA 1UYYA 1Y43B 2DU0A 4KWUA 4QQPA 5L9VA 4RA0A 4KQ7A 1PHMA 5C5UA 4R52A 4UFLA 4URAA 1PX4A 1KXGA 2NZ9A 1SMVA 4AQTA 2B4KA 5JZGC 3PUHA 3ZM8A 2X5IB 4YGDA 1ND3B 1OFSA 1S0FA 3ZFFB 2LALA 3TEZA 1O5UA 2VZUA 2QBXA 3NAPC 3DXUA 5DAWA 2ATFA 2WO7A 1IS4A 4AG4A 5FQ0B 2VQ0A 4CDWB 4JDOA 1ULPA 1G6NA 2PLV3 5F32A 3C8XA 1MZFA 2R042 4CEWC 3LD8A 4BH9A 3JD73 2HWC3 5FO7B 1U5IA 1REEA 2LM3A 3AKPA 3POJA 4GWMA 3EMRA 3PIGA 4D94A 4JTOA 3ZFEA 4IEZA 1YJLA 3WQ7A 2F4PA 1PK6C 2WZ8A 4ZU7A 1QJEA 5L7OA 4AR2A 3BVCA 4O9EA 3RPQA 5C4WC 5C9AA 1DZQA 1XU2A 1UD1A 4DUVA 3VDDB 1D0GA 2YC0A 2WFPA 1NZIA 3MIHA 5A3PA 4BYYA 5CFDA 1MVQA 1WMDA 2BV4A 3ZIWA 5FZ4A 1W2AX 1CZTA 2Q1FA 1J1LA 3POFA 2J1UA 2WA3A 1OQDA 1HXS3 2WAOA 4HKOA 4UI9L 1YFXA 3ETQA 1R1A3 3PLQA 4IV1A 4Q0QA 1RUC3 5H9PA 3H3LA 1FT9A 3HEIA 1HQLA 3O1OA 2VZOA 3UYJA 1AVBA 2W92A 4EWEA 2VZ1A 3SH5A 5L7OB 4HFSA 3MLJA 4B7EA 3DEMA 1Y4WA 4WVWA 3LDRA 5C9AB 3O1PA 1LNSA 4HK8A 1XYNA 3USSA 1MS1A 1NXMA 3OBZA 1AHSA 2E7AA 3AP9A 5A70A 1W3VA 4BE3A 4BPZA 5CFDB 1AXYA 1XE8A 1JZ7A 2HBTA 1O91A 2DCJA 2XUMA 2R0FA 1F15A 2RE9A 3PDQA 2VCBA 4XAEA 1X82A 4IV1B 4XJ8A 2GNBA 3HBKA 4NJ4A 3VKLA 3T08A 1MS4A 4CDUC 1LODA 4LT5A 1GNHA 1S0GA 1VRH2 1MACA 2VZ3A 1W6NA 3LZZA 4BWOA 5HBAA 1GQPA 1Q56A 1V6JA 1XOYA 2FCVA 2X8KA 3Q9OA 5K8SA 4RQPA 1LGNA 1HN0A 3AMPA 3I2DA 5GLZA 4Q4X3 5KHGA 1WLDA 5I8YA 3GJAA 1QKQA 1LU2A 3B9IA 4KWJA 4UYBA 4DINB 4QKDA 4QMAA 4QHOA 4IEVA 2DBIA 2WWUA 2Y6HA 4KG8A 4ZY9A 4LO4B 2XXZA 1N47A 4FPOB 4NIIA 3ST7A 3VL8A 2KR2A 4BA6A 2EIDA 4I01A 1W8OA 1W6NB 4QM8A 4AVBA 4DY3A 1R081 5IK4A 1FV3A 4LQRA 2AUYA 5K9YA 4BQYA 1RHI1 5FIXA 1UQXA 4RQPB 4BZ4A 4C0BA 3OGVA 4FOYA 2D7FA 1G86A 4OFGA 4AI8A 1NE4A 2VW2A 3GXUA 1IHMA 3DPRA 1ZA7A 1FV2A 2Z4FA 3M7AA 4XDPA 3PU8A 1DG6A 5GLUA 4IEYA 1WW4A 4BISA 4D6RA 4PIYA 3BTYA 2BVBA 4B7KA 4COVA 4DUWA 4XMIA 3B69A 2ORZA 2QCSB 2VW1A 1XNTA 1V00A 2R063 3O0VA 1FPN2 2JG8C 1WW6A 1ASJ2 3DXTA 3R05A 1MEC2 2DWRA 3WHTA 2NP0A 3M3IA 1J58A 2WUHA 3LA2A 2A6WA 4KI5M 3ZVXA 3TEWA 5FZGA 1AL21 1NYWA 3WDUA 3J7NA 4IDZA 4XQDA 2WJSA 3VZKA 3WDXA 3A22A 5CKMA 3I3BA 5CEHA 3DPRB 2D6OX 4LBNA 1O8SA 1GZWA 3U10A 2H0BA 3CHXA 2IVJA 2A75A 2WT2A 4XF0A 2CGNA 3IMMA 1BLZA 4GALA 1TMF3 4C8DA 2X29A 2ARCA 5FWJA 2R1BA 1W9SA 4FOQA 4GB32 4AEMA 2XKOA 4BQ5A 3JUUA 3WY6A 3AFGA 2R073 1RJ8A 4L8QA 1TNRA 2VXRA 2ZABA 2XLAA 1IQAA 5FAXA 2JG9A 1GUIA 2ZTNA 1Y7BA 4C0HA 4H7LA 5EPAA 3ZYGA 4Q4Y2 1DGRN 3RGBA 4MGYE 2OVUA 1GZWB 3LA7A 1UMZA 3GZEA 1CIWA 4LUMA 1NG0A 4QDQA 3VDCA 2ZX3A 4IV3C 3N7LA 2ZHMA 3AYEA 5F5AA 2NPIA 1HV0A 1CESA 3MO4A 4LIVA 5GLVA 3GHNA 1KRIA 5FZ0A 1DGWA 4BXSV 4CP1A 2YYOA 1AF9A 4GWIA 2ZEZA 2JG9B 1TZOA 2WNVB 3WCSA 1D2QA 2YBKA 2BEOA 3D4KA 2V72A 4JKLA 1Q8VA 3GGLA 2J1VA 3KCYA 3CIHA 5BXXA 2QKDA 3J8F2 4G9SB 3I7DA 4BQWA 1K12A 4JGYC 1V6MA 2HWD2 2JJ6A 3H8UA 4M01A 4TYSA 2DVBA 2VBBA 2XJSA 5FK8A 4XJWA 3I49A 2EXIA 1QJU3 5FZFA 2YY1A 4XUPA 1NAEA 3HQUA 2XL9A 2VO5A 2PMWB 2A70A 2GNTA 2YMZA 4ET7A 2ID4A 4L97A 4N9IA 3ZYBA 2VVEA 3UKVA 1UOGA 1W0NA 1W9YA 5DN2A 2AACA 5FYYA 2PLV1 4RS5C 4OZOA 1GLHA 4BCUA 2EIEA 3N3HA 2DCZA 1S2EA 1Z78A 4XFGA 4E27A 4DUXA 3JD71 1L7QA 2HWC1 2Y60A 3NNJA 1W2NA 2HWB2 1WCQA 3MLLA 4MGQA 4XZUG 3ZXEA 1GR3A 5C3RA 2AYHA 2OKXA
chains in the Genus database with same CATH topology
1H0BA 2TBVA 3O5SA 4GMP0 3SH3A 2EXKA 2XG3A 4FO9A 5GZDA 2FZ1A 2ZACA 1KDKA 3E6CC 1GICA 2MHFA 3VV1A 2B9UA 4OHVA 3VHNA 1Q8PA 3ROUA 4A7YA 1DDLA 2Q1MA 4ZXKA 2ENRA 4CEYC 1UZYA 1D2SA 1VBB2 1HXS1 1R1A1 1VAKA 1RUC1 4XJAA 2PTMA 4P9IA 4NPRA 2JE9A 2G9FA 2WFF2 1YXWA 3ZYIB 1LOBA 4K40A 1QXJA 1O3RA 4N7UA 2ZOEB 1PGW2 2YXSA 3TBDA 4QQLA 4QPIA 1ULFA 1PVC2 1RUI3 1EAH2 4BLJA 1ENQA 3GYDA 1PIV2 2FHRA 3KD4A 2P37A 4Y1UA 4DFSA 5BNQA 1OA4A 4YGCA 2ZGLA 4NVPA 5JI7A 1BBT2 3RJRA 1CAUA 1WBFA 2Q1ZB 4FAHA 1PO22 4Q1PA 4P9GA 1TME2 4QPIB 4AEJA 5BNOC 4JCKA 4Q26A 2GMMA 2I45A 4PBPA 4Q4X1 4Y1YA 3PVNA 3ZYJB 4WZFA 1U5XA 3RQ0A 1IS5A 4Q8KA 3HWJA 3WOGA 4YZ4A 3VZLA 3NKTA 1N1TA 5J09A 3AZXA 4QX5A 1UL9A 2HWF2 4BMBA 3IM0A 1CAUB 2QNKA 5KC5A 4QGNA 3VUOA 5IK8A 1O4ZA 2XL7A 1ZBA3 2HYKA 2RM23 4X8NA 1C8M2 3HQXA 2ZGOA 4NWVA 4AI1A 4Q4W2 2R32A 1JHNA 5A33B 3AMQA 3KQRA 2NM1A 4WM7A 4WVMA 1UW8A 2EALA 1YYNA 2R061 3FX3A 3E5QA 3VBFA 2ZGSA 1AYM3 1GZ9A 1QXPA 2XHKA 3B7MA 1IKPA 1QGLA 3MLKA 4AHWA 2EIGA 3IDEA 3H1MA 3RYRA 3CO2A 5FOJB 5HI0A 1I1EA 4I3GA 2XJPA 2RMU3 1TMF1 5JSOA 4LO5B 3GNEA 5DUUA 1W6QA 4WM7B 2D98A 3HR9A 4WVMB 1H8TC 1RL3A 2VNGA 2R071 3SISA 1IPKA 1FNYA 1JUIA 3AZVA 5HCFA 1J59A 4XBLA 4FXKB 5FFOC 1KJLA 1XNKA 1HV1A 1W6PB 2XLFA 2ZGQA 4QHBA 3NO8A 3VBSA 2X53S 2BPA2 2RR13 2Y26A 1RIRA 4QPGA 1MS9A 3FLRA 1OOPC 1LOAA 2JX9A 1W6QB 3JBG3 3M3EA 4Z2WA 4GH4C 3M3OA 4E9KA 2GH8A 1DGWX 4ONUA 2A5ZA 5CFCC 1XYOA 1RGSA 1OHFA 3AB0A 1UKGA 2RS52 3I4IA 4D7TA 1QHDA 1DQ1A 1DGRA 3CJXA 1UPSA 4WZCA 2EXJA 3VBUC 3VBSB 5LRSA 1AR82 2B8MA 3ZN6A 2DVFA 2W52A 3HBZA 3O7OA 3SLIA 4JAAA 2WZR2 1QJU1 2XGXA 1YFWA 3ZFGC 3W58A 1N3OA 3M2MA 5L36A 1COV3 1LESA 1RMU2 3UK9A 1CJPA 5LEKA 2TEPA 5BNNA 4COYA 2HWE3 4LLFA 4FTSA 3MIFA 2XWBB 2ZGMA 4FPEA 4QD2A 5F6LB 3FHIB 3ZN6B 2GALA 3ZYRA 5CG9A 3NWKA 3SCHA 3T1LA 2IXIA 1ZM1A 2D6LX 3WV6A 1SBFA 4OI0A 1SLLA 2A3WA 2D6KA 4TSVA 1BEV3 2F6BA 5BNNB 4ATFA 4Q0PA 1O7FA 2WS92 2XVLA 1PNGA 5FLHA 1BMV1 2E6VA 4XHXA 1LHWA 4GKXA 2WNEA 3FLPA 4WV8A 1NQDA 3AX4A 5C8CA 4FTBA 3B02A 1RVF1 4WM8A 5JI9A 4JDNA 2JD4A 3VZOA 4HLTA 2NMOA 4K3UA 3LSDA 2IFRA 4O9GA 3S6PA 1ND3C 3VHOA 2YZ4A 3VL9A 4AI2A 1X36A 1RUI1 1CAVA 1DZRA 1UX6A 1FOD3 2NYYA 2HKXA 4CDWC 4IESA 1VALA 2BQPA 4K6BA 1AYN3 2CNAA 5C8CB 3KGLA 1CAWA 1Z7S3 4WM8B 4RR3A 2OZ6A 3GHMA 1XNCA 2Z2SB 1PO13 1H2MA 1FMD2 3WX5A 1W6MA 1JTZX 3U11A 2WL1A 2DTWA 1IS3A 5I0UA 4XTPA 1CAVB 1I9RA 2VVFA 5FMOL 2PHLA 4D7SA 3OF1A 2E63A 3DL3A 1CAWB 1R093 2XB6C 2P17A 1OQ1A 1WD4A 5JAXA 3H7YA 4GQ7A 4RR3B 3K51A 3PVBB 4XILA 1UU5A 2GNMA 3AKTA 3AP4A 1LECA 3ZXAC 1RUD3 3KS7A 4UW3A 2XLGA 3ZFEC 2Q0AA 5FBZA 4TLFA 1ZBA1 2RM21 3D5OA 1LHOA 1RUNA 2NMNA 5JPNB 2RS32 3FZ3A 5CFDC 2VOVA 1UIJA 4XZPA 4EV0A 4FAGA 1QJX3 3WNXA 3VBOA 1AYM1 1SCSA 1OPMA 2DYCA 4PDWC 2XJQA 2CL2A 2VG9A 4CYDA 3KB5A 4I0WB 3MW2A 1YIFA 3PHMA 5CB7A 1AJKA 3SCGA 1H1AA 1G9CA 1QDOA 5GZCA 4B8EA 4B4PA 3X29B 2RMU1 2ZGUA 4INDA 1VAMA 2UU8A 4R9CA 4YZ1A 1LU1A 2PFWA 3N7MA 3VBOB 2GSYA 1G8WA 4DMIA 5JOWA 2VVDA 1Q8QA 3GZUC 3ZDSA 5JIUA 3ACLA 2EAAA 3JCIA 3IPVA 3DKWA 3CU7A 4QM9A 1AL0G 4RQPC 4R9BA 1SLBA 4R9AA 1ULDA 1OQEA 1W0PA 5BNPA 2RR11 2XVKA 3ZXDA 3JBG1 3WCRA 1QH6A 4AQSA 1CONA 1S0JA 1ALYA 4KU8A 4L2NA 4DOUA 2VQAA 4BIOA 4I0AA 4GA9A 3IPVB 1TNFA 1BXHA 1DQ2A 4DZGA 1IOAA 5FPZA 3EQEA 4MV2A 5BNPB 3VHRA 4AHZA 5JSPA 3RYPA 1H8VA 1COV1 1MS5A 1YRZA 4AQ2A 1V9U3 5FDBA 3V0AA 2PAMA 1JH5A 1H2NA 3ENRA 3S30A 3D82A 1KJRA 2HWE1 3IT8A 3UV9A 3VZMA 1AR73 1LULA 3WXPA 3ILFA 2RJLA 1WUVA 2ZX2A 1QQP3 1YUDA 2DVAA 3HT2A 4HBNA 3D6EA 2VMIA 3WLUA 4FTEA 1L3JA 4FPFA 4MUVA 1CX4A 4XF3A 2R6QA 2VMGA 3H9AA 3V0AB 1DHKB 1EV13 2D6PA 3VDDA 1BEV1 1NA1A 2NLRA 2OA2A 4LA2A 2YGLA 1ND2C 2EVXA 2MEV3 2DUPA 1RUJ3 2YUEA 3MIGA 2ZJCA 3DUIA 2VNRA 5CG8A 3GALA 5GJ6A 1IKQA 1OLRA 3GBFA 1RUE3 4YM0A 4AI0A 2IXCA 1HRI3 2FBEA 3J9SA 2JECA 3LCPA 4LBLA 4CZSA 4PIXA 4AF9A 4RD7A 4DS0A 2D6NA 1ULCA 2H6CA 3IDBB 1JYIA 5FRAA 1DQ6A 4LHNA 3QH6A 4FPHA 1NA1B 1WMFA 5T55A 5KXBA 4COZA 2ZX4A 4PIZA 4HSJA 1S0BA 3ILNA 4BM8A 3KCCA 1FOD1 3WUDA 1HQNA 3V0BA 4OHZA 1AYN1 1WCDJ 4XETA 1V6NA 1Z7S1 3O0XA 2CAVA 1B09A 4LO6B 5JVVA 1YFYA 4I2OA 5J96B 1X33A 1PO11 1RITA 2WKKA 1AX1A 1ZZ6A 3LB9A 3MYXA 3M3CA 2XJTA 4EWAA 3AYDA 3EO6A 2PHDA 1CAXA 4IXLA 4J1WA 3KT4A 4HVQA 2R0HA 2A6ZA 1SLCA 4R4XA 4W6YA 1QMJA 2MPFA 2XH6A 3JQXA 4XW3A 5CAZA 3VBHC 3OBRA 4I3PA 4ITCA 4XEZA 3V0BB 1NCQC 4X6QB 4Z92B 1LGBA 2BVVA 4URTA 1YLLA 4JVAA 3URFA 1U12A 1R091 2WA4A 2VW0A 1K5MA 3WW4A 1PGL1 4EROA 1O3QA 1RUD1 2DCTA 5T5JA 4BLIA 2Y0OA 5J98B 2D3SA 1CAXB 4I09A 2K2SA 3VKNA 1J1TA 1UAIA 1VBC3 2DCYA 4PF5A 2HEYF 1RUF3 4IETA 4HPKA 3WW3A 2DUQA 1K5MB 3H1YA 1D4M3 1PMIA 4JGZC 1ZRCA 3POSA 1QJX1 1YCIA 1XYPA 3E5XA 1CR7A 2WSUA 2QVSB 3ZXKA 2E7TA 1YO8A 4YFWA 3AJYA 4N43C 3TN93 3BB6A 4WVVA 5KHJA 2Y38A 2AENA 2P3KA 1JBCA 3S7IA 2CGPA 4LLOA 4AVCA 3GBGA 4HPKB 5T5PA 1X50A 2BGCA 4R4ZA 5CA6A 4AYUA 4Y24A 5FTTC 2IZWA 1GBGA 2BBVA 3ATGA 4AWDA 1F9KA 4X8PA 5DDJ3 3SCFA 1RINA 3R4SA 2ES3A 3AXEA 3PMSA 5LK5A 4P9XA 3VKOA 2ZGRA 2SBAA 5BV6A 1V6IA 5KBFA 2WNUA 3FLTA 5DUVA 1UU4A 4LBJA 5K0UA 2DTYA 3VBRB 3MZHA 4B29A 3VHPA 3B9CA 2D93A 4R9DA 4CDQA 1SDWA 1X8EA 2WZPP 1QJY2 4ISRA 2D40A 2RS53 1HKDA 4L11A 1H2KA 3V64A 3ZMOA 3KT1A 4Z07A 4AFAA 1LKNA 4KU7A 4XHBA 1HRV3 2WNVA 2ZAHA 1ZBE3 3DF0A 2Y0IA 2WNUB 5IUQA 3RJ2X 4EN9B 5K0UB 1OA2A 2ZKLA 2ZS6B 4L9BA 5D8AC 1I6XA 4MGIE 4X6RB 2Q5TA 4CDQB 5JZGA 1M4WA 4W6WA 3EXUA 4EN6B 1R082 3DGTA 3POYA 4M0HA 4Q29A 1F8VA 1RHI2 4P9WA 1VBE2 4Q4V3 1YHFA 4TWTA 4WM7C 2Q4SA 1KFXL 1V9U1 3WZ1A 5AC93 5ACA2 1FYUA 1LOFC 3NJZA 1VB4A 3D8CA 1A3KA 3VBFC 5JOYA 4A7KA 2GC3A 1VBA3 4XIOA 4G3YC 4JV4A 5FPXA 1MZ5A 4IERA 3RG0A 1AR71 4CEWA 3QACA 4NOTA 4P9JA 4AVAA 2XWJB 4DQAA 1G9AA 5F1RA 1QQP1 3WG1A 3ZSEA 4BMEA 5JZGB 1AL22 5C4WA 3T1MA 2JICA 1H4GA 1X8MA 1MVEA 2LTNA 3GBWA 1WLWA 2B45X 4OLLA 1EV11 1CQ9A 1S2BA 4YW1A 4YGEA 3POWA 2D43A 2MEV1 3IIAA 4L99A 1UU6A 5DG1A 1U0AA 4CEWB 1N1VA 1RUJ1 3MW3A 4RGAA 4I30A 3L9JT 1W2UA 3PVOA 1A6CA 4EN7B 4AGRA 5FLJA 1RUE1 2ZZJA 1RUH3 1HRI1 5C4WB 4K9SA 2BNOA 4QPGC 3G7DA 2RS13 2IXJA 5C6CA 2HEVF 4HN0A 1BYHA 2WT0A 3MDPA 3CNAA 3K48A 4PQ9A 4OHXA 1JOJA 2CYFA 1V6OA 1AZDA 3USUA 1LCLA 1X7NA 3I59A 5CNAA 2OUHA 5A32A 1PVXA 5IK5A 4GWNA 3WP6A 5I93A 1BVP1 2P2KA 4E4SA 4KL1A 3NW4A 3ZN4A 1A78A 3WHUA 5DXDA 4XJUA 3M4FA 3WP5A 5BNNC 1LHVA 3DN7A 1AR93 3LAGA 3AMNA 4QQOA 3USUB 2A3XA 2W0XA 5KXDA 4RSUA 5JSRA 3M3QA 3T2TA 1AR63 4COUA 4E2SA 4YVSC 4EWDA 3I59B 1DFQA 5A32B 4AEDA 3KGZA 5BY5A 3AKRA 4N53C 2PLV2 4PJYA 1S1AA 4CP2A 2VPVA 5H9SA 3JD72 2HWC2 5KHHA 2FMYA 2XBO3 2VOWA 1LJ7A 1H1MA 1VBC1 4AFCA 5ABJA 4TZDA 1RUF1 2D5HA 5A33A 2V73A 3ELNA 1C3HA 3RWNA 4AHYA 1O5LA 5EZWA 1D4M1 2JG8A 4AEDB 3N7JA 4YG0A 4Y22A 2ERFA 4WM8C 3AM2A 2QZ2A 3GZTB 1ZRRA 3O0WA 4FPGA 2BW8A 1RC6A 3OBTA 3H3UA 3AZWA 1NCRC 3TN91 4FVVA 1R1A2 4YVWC 3V65A 1RUC2 4HETA 3N36A 2QDRA 3WP3A 5ABJB 5DZEA 1PGSA 3TOJA 1OFNA 4G4FA 1RUOA 2Z5WA 4D69A 3AP5A 2JG8B 1VR3A 3INAA 1QJZA 1DGLA 1UZZA 2QE3A 3FUOA 4Y22B 1NY71 4E4DX 3IBMA 5DDJ1 1VBD3 1W6OB 1OA3A 4RR3C 3SMHA 4YSFA 4KWLA 1MZEA 2VNOA 1BCXA 4RHV3 4HANA 1W6PA 1D0HA 4K1YA 3NVCA 3AKQA 3BTAA 5JCTA 2BWCA 3OY8A 1EYBA 4U36A 2H0VA 4LNVA 3VZNA 4A7ZA 5C8WA 5GLTA 1PZ9A 3A4UA 1RUG3 3CEWA 4S2GA 3RDIA 2RS51 4C91A 1BKZA 3ZPYA 2XJRA 2DU1A 1SFNA 4Q4X2 5SV5A 1HRV1 3VLBB 2BYVE 1ZBE1 4B3NA 3THPA 4ISQA 2KM2A 4JGYA 3O14A 2DUOA 4DRRA 3W9AA 3UL2A 1H30A 2Z79A 3OY8B 1S55A 4CDXC 5LEJA 5GZFA 2UY8A 5BPXA 2B5HA 2R16A 3LOIA 3IWZA 2EF6A 4FPKA 2R30A 4Q4V1 1JXNA 1YI9A 5AC91 4YGBA 3WW2A 1FNZA 5L73A 3THTA 2BFUS 4XOGA 2VOKA 1VBA1 2K0GA 1C5HA 4RS5A 1KITA 3L2HA 2ZKNA 4N9HA 1BVVA 2ZHKA 3MIEA 4AHXA 2VH9A 4JGYB 2WLPA 2R062 2IWGB 3A0NA 3WT3A 4AXOA 2XVGA 2B42B 4Z1VA 4FP2A 4CTEA 4LHLA 1U5YA 5I91A 4XQ4A 3S0MA 2R043 3UJQA 1WW5A 2VU9A 1S0EA 5JOXA 1TMF2 4XE9A 2B46X 4RS5B 1J3QA 1NE6A 5EFUA 3LGRA 3WG4A 1W0OA 2YROA 3OYWA 3MFAA 1Q8SA 3H3ZA 5JR7B 2YPJA 3ES4A 1SLIA 2R072 1B35C 1MQTC 1HQWA 2YDEA 4FP3A 1JUHA 4K21A 1RUH1 2ZGPA 2ARBA 4JTNA 5BNPC 1ZA4A 2C9AA 3R6SA 3KZ4C 2RS11 2BWAA 2IXKA 2ZX0A 5LK7B 3M8LA 3MF6A 2GMPA 3RYKA 4GMP3 1ZVFA 5E88A 4Q0VA 4MYEA 3OYWB 2PELA 5FLIA 3RSJA 4ZKTB 2P3IA 1FX5A 4UBHA 2R49A 1ULGA 2HJIA 2PHUA 3EJKA 3AK0A 2OW4A 3I8TA 4QU2A 5EJ3A 3L2YA 3CJIA 2OPKA 3KCXA 3GZAA 2A73B 4PCRA 3FC0A 3G6JB 3ZYPA 2X5IC 4FSJA 3NV1A 1C28A 1Y3TA 1HX6A 3ZFFC 2W08A 1OI6A 2FZ2A 1QJU2 5AVAA 1VRH3 3PJQA 1AR91 5BUVA 2GC0A 4FQ4A 3E5UA 4OHYA 5CBLA 1AR61 1KS4A 4IEPA 2PHRA 5L19A 3CJIB 3HMYA 3QBQA 1C5IA 4HMZA 3KM5A 3GF6A 5FREA 1CPNA 1ZX5A 2XBO1 2ZHLA 1EP0A 3VDDC 5FOBB 3U4XA 2BUKA 1NA1C 1VAVA 2PYTA 2UWAA 3ZSJA 3BU7A 3AP7A 4M0NA 1EPZA 1PZ7A 4MGZE 1QY4A 1H2LA 2WWSA 2WSVA 2Z69A 2DFBA 1BMV2 4MXVA 1XRUA 1YJKA 2AR6A 3RNSA 5L7OC 5C9AC 3WP4A 4SLIA 4YFZA 1RVF2 1OD5A 2XJUA 2ZAAA 1FPN3 1ASJ3 2D3RA 5H9RA 1MEC3 1PNFA 4GULA 5EYYA 3C2UA 1QU0A 1I5ZA 2ILMA 4AVVA 1H8TA 2R1DA 2I2SA 4LEJA 1EY2A 2PA7A 1LB2A 5T5LA 1HW5A 1WLCA 5DG2A 4IV1C 3WQ0A 1F2NA 1RUI2 1VBD1 2TUNA 2PHXA 2ZMNA 4YYOA 1QJY3 4RHV1 3AZZA 3MEPA 3D0SA 4HKLA 1CGPA 4GB33 4UBGA 2GN7A 3AFKA 5EWSA 4Z8BA 2GN3A 5HXVA 2JDZA 1F31A 3OTFA 2QQPA 3RS6A 4GH4A 2JEMA 1H8TB 3U07A 1S0CA 1RUG1 1AXZA 4LBQA 3MPBA 4Q4Y3 3ZX7A 1K5MC 3RZZA 4QGMA 2FMDA 1WMEA 1D4VB 1JN2P 1WGPA 2DF7A 1IPJA 2ZMLA 3IMNA 1VBE3 3TAYA 3ES1A 5ACA3 3SNMA 1CN1A 1WCKA 1CD3G 4GH4B 4I02A 1TQ5A 4LBQB 5J3UA 1LEMA 2TNFA 1ZBA2 2RM22 4D7YA 3J8F3 3CL1A 5KXCA 2WT1A 2HWD3 1EPWA 2B7YA 1H9WA 2VGDA 1C1LA 4WVZA 2QFEA 4COWA 3NL1A 4KWKA 1LR5A 2VOXA 1AYM2 3DPRC 4YZ2A 1QNYA 2DURA 4CRQA 2VULA 1SLAA 1ZZ8A 5TSWA 4OI2A 4KGQA 4BIFA 3MICA 3R0RA 1LOEA 2R041 2K9ZA 4YG3A 3A0KA 2HWB3 3OJBA 1V6LA 3QLQA 2RMU2 5EV7A 1AXKA 4ZU5A 1R1ZA 1XQNA 4MGKE 4KG0A 1VP6A 2WNUC 5AFEA 1C57A 4AW7A 5K0UC 3WDWA 4GXLA 3AJZA 4CDQC 1Y9QA 1AX0A 1ONAA 5KWRA 2A3YA 1POV3 2V09A 3RI9A 1VBB3 4K20A 1QNWA 4IEUA 4GMP1 5GALA 2RR12 3FBMA 1A8MA 3JBG2 4I0BA 2WFF3 2JG9C 2WNVC 4XTMA 1VB2A 3B94A 4NHKA 4HK9A 1KQRA 1ZZ9A 2D3PA 2QZ3A 2OYZA 4DXZA 1Z0HA 1PVC3 3JU9A 4HKWA 1EAH3 2E9QA 4AFMA 4ASMB 2BNMA 4N90A 4XFHA 1PIV3 2ZZQA 4AI3A 1BJQA 5CADA 3TWIA 4OULA 3FWEA 1OLQA 4AQ6A 3VN4A 1JW6A 1VRH1 4C1XA 4DB5A 3H0OA 4M3CE 5DZFA 1BBT3 1COV2 2G4IA 4V1PA 2VECA 4YW4A 1PO23 5HCAA 1KD7A 3RMXA 1TME3 1N1SA 4XMAA 2HWE2 5DZGA 4JRLA 4K7JA 2G9GA