4XEZA

Cysteine dioxygenase variant - y157f at ph 8.0 with dithionite
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
186
structure length
186
Chain Sequence
ELLKPRTLADLIRILHELFAGDEVNVEEVQAVLEAYESNPAEWALYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTDSHCFLKLLQGNLKETLFDWPDKKSNEMIKKSERTLRENQCAYINDSIGLHRVENVSHTEPAVSLHLFSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cysteine dioxygenase type 1
publication title Structure-Based Insights into the Role of the Cys-Tyr Crosslink and Inhibitor Recognition by Mammalian Cysteine Dioxygenase.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 56
structure length 186
sequence length 186
ec nomenclature ec 1.13.11.20: Cysteine dioxygenase.
pdb deposition date 2014-12-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05995 CDO_I Cysteine dioxygenase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4xezA00
4DINB 1Q43A 2FMYA 3NVCA 1ZZ6A 3H1MA 3BALA 3NJZA 1RL3A 5D1IA 2D40A 2QJVA 1JUHA 4A2UA 4N9HA 2GU9A 2HKXA 2DCTA 1O5LA 2BYVE 4E2QA 2KXLA 3I54A 1CAVB 2K0GA 4Q0QA 1J3RA 4JTNA 5JR7B 3PVBB 1CGPA 3GYDA 5I0RA 3HQXA 3UKNA 2CGPA 2V09A 1TQ5A 4EROA 2N7GA 3ETQA 4JTOA 1UIJA 1L3JA 1HW5A 4LULA 3RYPA 4HVOA 5LRSA 1CAXA 2VPVA 4LUKA 5LRRA 2XHKA 1OI6A 4EWDA 1H1IA 5I0SA 3E5UA 3SMHA 3S7EA 3H7JA 3I59B 2Y0OA 2OPKA 1SFNA 3ES4A 3LA3A 1ZZ7A 5FPZA 5LEKA 1YFYA 1OFNA 3CF6E 3H9AA 2EAAA 4HN1A 3KGZA 1CAUB 3IBMA 4AQ2A 1PMIA 3O14A 4IEVA 4IEPA 1J58A 4IEYA 4XFFA 2Q1ZB 4L11A 5T3NA 3RYKA 4LLOA 1U12A 4N9IA 5JAXA 4QGLA 4F8AA 4OLLA 4BHPA 2B5HA 3QACA 2O8QA 4JV4A 1NE6A 1WA4A 4KL1A 3OD0A 3U10A 2IXJA 3H8UA 2PQQA 2B8MA 3KGLA 2IXLA 3G7DA 2OZ6A 2IC1A 3L2HA 4QMAA 4AVAA 2BNMA 4FAGA 5I8YA 3SCGA 4WZCA 2GC0A 2ET7A 5J3UA 4I2OA 2P17A 1YFXA 3H50A 1ZVFA 2O1QA 1O3TA 4I01A 1GQGA 3WW4A 4X6QB 4IEOA 4R8HA 3H3ZA 4NVPA 3C3VA 1XRUA 3LA2A 5FPXA 3NL1A 1EY2A 4XF4A 3KCCA 4LA2A 3NKTA 4EWAA 1V70A 2D5FA 3FJSA 1EPZA 4MGZE 2H6CA 3IWZA 1CAVA 3DKWA 3IIAA 4KU8A 2H0VA 2UY9A 5JSPA 1NE4A 4XFHA 4EV0A 4MV2A 1NYWA 3CEWA 1CAWB 4HLTA 4YRDA 2BNOA 1RUNA 2PTMA 3PLQA 1J3PA 1SEFA 4O9GA 5CVRA 5EFUA 1ZZCA 5JSRA 2MPFA 2PHLA 4I02A 3KSCA 2QCSB 2Q30A 2WFPA 3KMHA 5HI0A 1PM7A 1YFWA 4WBBA 4MGKE 1ZZBA 2MNGA 5K8SA 4K8FA 5BV6A 3RNSA 1EP0A 3HT2A 1EYBA 4WVZA 4HVRA 4HSLA 4IERA 4IEZA 1WGPA 1QY4A 1WLTA 1FI2A 4LUMA 3H1YA 3RYRA 1O4TA 3UKVA 4XETA 3JZVA 2ETEA 2QDRA 3MYXA 4I09A 3I59A 4I0BA 4HZFA 3FX3A 4E2SA 4IEXA 3U11A 5F1RA 1XE7A 1ZNPA 3LAGA 5I0TA 3U0ZA 1LR5A 1UIKA 3LZZA 4J1WA 4FAHA 4F7ZA 4H7LA 2OZJA 1J3QA 4YYOA 1ZZ8A 3E6CC 1YFUA 2GC3A 4BYYA 1FT9A 4BIFA 5KHJA 3D0SA 1CAUA 1J59A 5FLJA 3B02A 5KHIA 3CJXA 4XFIA 4FBFA 1X82A 4MH0E 3FHIB 2F4PA 3BU7A 4MX3A 4D7TA 5LEJA 5KHHA 1OMIA 3R6SA 5BPXA 3E97A 2CAUA 4LTAA 4META 5I8SA 3ACLA 1XE8A 3WW1A 3E6DA 2XKPA 3SXWA 5I91A 2XLFA 5E1RA 2XLAA 2UYBA 4PJYA 2CV6A 5J48A 1NXMA 1I5ZA 5J7MA 3MPBA 1YUDA 3TNQA 1I6XA 3IDBB 1O5UA 2ZCWA 3BB6A 4Q0VA 4RD7A 2IXKA 1LKNA 2QNKA 4HBNA 3S7IA 4TLFA 2EVXA 5BUVA 1SQ4A 4L2NA 4ZU4A 5FQ0A 2ZKLA 2D93A 3N4MA 2PFWA 1GQHA 1ZRDA 1RUOA 3SCHA 4I0AA 3E5XA 3FE5A 4MGYE 1RTVA 1ZX5A 3SCFA 3ES1A 3EQEA 3CO2A 5KHGA 5FQ0B 3M3IA 4QM8A 2C0ZA 3FZ3A 3OCPA 1ZRFA 3EBRA 1FXZA 3RDIA 1X8EA 4IESA 3TNPB 4HN0A 3EJKA 2Q0AA 4PIZA 4QGMA 3H7YA 1J1LA 1CAWA 2BEOA 1RC6A 3DV8A 1X7NA 3MDPA 1YWKA 4ZU5A 5JSOA 1QXRA 1QWRA 4UBGA 4XFGA 1CX4A 4E2GA 1DZTA 1ZRRA 2UY8A 5CADA 1DZRA 2IXHA 4KWLA 3OTFA 4UXAA 1O3QA 4XFCA 2ATFA 3IDCB 4JVAA 2Z2SB 3PNAA 2HJIA 2PYTA 3USSA 2XLGA 2OYZA 4MUVA 5BY5A 2BNNA 3BCWA 4QX5A 2GC2A 3M70A 3DL3A 1QXJA 1VP6A 4UBHA 5I8TA 1Y9QA 5BXXA 4KWKA 2GH2A 3MZHA 5FLHA 4IEQA 4Z82A 4ZU7A 2IXCA 4YARA 4AVBA 2PHDA 3D0JA 4YSFA 2BGCA 1UD1A 5KBFA 3LWCA 2EA7A 4PIXA 4LEJA 3VHRA 4I3PA 3OGJA 2GAUA 4X6RB 4HVQA 3H3UA 3WW2A 1O7FA 3LA7A 3EO6A 4ORFA 5I93A 1O3RA 4AQ6A 5C6CA 1YHFA 2XL9A 3OF1A 4AXOA 4IEWA 2B9UA 2PAEA 2VQAA 4MZUA 4Q0PA 3RZZA 3EHKA 4QM9A 2GZWA 4KWJA 4XEZA 2XGXA 4B29A 2XL7A 1VR3A 3HIFA 4Q29A 1NZCA 4LA3A 2Z69A 4Q0UA 4QXKA 4FT8A 4XFBA 5EZWA 5FCCA 4KU7A 4EWEA 2UYAA 3RPQA 1IPJA 2ET1A 3S0MA 4MGIE 1UW8A 2WC2A 1ZZ9A 2PA7A 4OFGA 4HMZA 1CAXB 3I7DA 4XF1A 1LB2A 3FFQA 4XF3A 3DN7A 4IETA 4R52A 5C8WA 1DGRA 4YNIA 1IPKA 4XF0A 4P9GA 2QVSB 4HSJA 5CU1A 3E5QA 3H1WA 4Z07A 2FQPA 3LOIA 2OA2A 1LRHA 5JCTA 3GBFA 3CL1A 1ZREA 5FLIA 1G6NA 3ST7A 1X8MA 4O9EA 2H6BA 4IEUA 3NW4A 2GC1A 2D5HA 3WW3A 1Q5OA 3ELNA 1H1MA 3QOPA 4XF9A 5E16A 1OD5A 1ZRCA 2XKOA 4BH9A 4GULA 4QGNA 1RGSA 2PAKA 5I0UA 2MHFA 4CYDA 3ZDSA 5KHKA 1UPIA 1Q3EA 5FDBA 2VECA 3ROUA 4Q0SA 5AVPA 1DGWA 3HT1A 3D82A 2Q4SA 1YLLA 4D7SA 3SHRA 1O3SA 3NSTA 3UKTA 4ONUA 4PIYA 4XFAA 1VJ2A 2IXIA 2I45A 3BPZA 1UCXA 1Y3TA 3FWEA 4AVCA 3CLPA 3E6BA 2CAVA 2E9QA 2K9ZA 4J1XA 2PAMA
chains in the Genus database with same CATH superfamily
1OF3A 2WNUB 1XB9A 5A3PA 1RVF1 5ERLA 3GNEA 3TWIA 3DF0A 4KG8A 3NJZA 1DQ6A 5DAWA 4NMIA 2YGMA 2D40A 1AX1A 1JUHA 4A2UA 2GMEA 4BWOA 4N9HA 3W5NA 2GU9A 4AL9A 2O0OA 2OW4A 5KC5A 2K0GA 1TME2 1W90A 4Q0QA 1J3RA 5FKCA 2QQOA 1ZBA1 3PVBB 1O6UA 2AR6A 1D0GA 3GYDA 4R9DA 5DG2A 3VKLA 5A1FA 1N3PA 2QFEA 4IV1A 4Q8LA 4CCCA 5CKNA 3NNJA 1BEV2 1CZVA 4GMP0 4MXWB 5JIAA 2XJQA 2D6MA 2HYKA 2XG3A 4N7IA 2YMZA 3ZN6B 2CWMA 3DYMA 5C3PA 4FP3A 2PLV1 1CONA 1AYN1 3H8RA 4ISQA 2QUOA 3AB0A 3H8OA 4N43C 2VAUA 2J1EA 4MYEA 3SH4A 4D0QA 2R1BA 1R083 1HN0A 1W0NA 2ARXA 5DUVA 1F31A 1ULDA 4BLJA 1QQP2 1QHDA 5A80A 3WNNA 2VNOA 4QPYA 2XOMA 4YZ4A 4XABA 4HVOA 3A7QA 1ZBE1 5J09A 1CAXA 5FUIA 4XDPA 2EXJA 3TOJA 4Y1VA 5F6LB 3ZFFC 5FTTC 3ZSLA 3WNPA 3RZMA 3VBFB 3JB4C 1GWLA 2OQ6A 1KITA 1RUF2 5FP4A 3TEYA 1DYOA 1BBT3 5EQUA 2V5YA 4AI9A 5L7OC 1HRI3 1NOVA 4YGCA 5LB6A 3WQ0A 5JMOA 1Q8QA 2FDFA 3A4UA 5F2SA 2C9AA 1JTZX 2HWC1 2RV9A 1E5SA 2WNUC 2YG0A 3POEA 1NLRA 2Y6HA 1QOSA 2F4LA 4Q4W1 3T4VA 5JR2A 3VZLA 3LA3A 1AL0G 4AQSA 5LEKA 3ABZA 1AR72 3AMNA 1UWWA 3N7MA 3KCYA 1GWMA 2IZWA 2OUJA 5LA1A 4IXLA 3HWJA 1AR83 4CCNA 1WW7A 4QKDA 5JZGA 2BUKA 3V64A 4EN8B 1FNZA 1J1TA 4M0NA 4B1MA 3RFRA 2QE3A 5F7UA 4FXKB 1QNWA 3O14A 1GZ9A 1WMFA 2P3IA 2DYCA 2VD7A 2WSVA 3K2OA 3KT4A 4OULA 3LEIA 4XFFA 1QOTA 2Q1ZB 1JZ4A 3PVEA 3D4KA 5EP9A 4ZZ8A 3K77A 2RVAA 1EUTA 3OGSA 2P6CA 5D8AB 4BMEA 3POYA 2Y8KA 2QQWA 1SBEA 2YV8A 3THPA 4UW5A 1CR7A 5ISLA 4AI1A 3LF7A 1QNYA 3WUCA 1PX3A 4LOSA 2O8QA 5SV5A 3J7HA 2W2IA 4FPEA 1WA4A 3ZFGA 1XNDA 3AKQA 4GWMA 5C9AA 2ZPXA 2XONA 2IXJA 3FN9A 4Y4YA 1U0AA 3H8UA 3KGLA 2D7FA 4AI3A 2UWBA 1Z7S1 2WL1A 1W3XA 3L2HA 4NUBA 1WLDA 3NKGA 3VKNA 2D3SA 2ET7A 4MGSA 3SISA 1UOJA 1D0HA 2P17A 2ZZJA 5IVEA 2O1QA 5C3QA 2BPA2 1OQEA 3GHMA 4ZXEA 3P6BA 1QOOA 3M2MA 4YWAA 4UFMA 3VBFC 1UKRA 5GZCA 3GF6A 1G9DA 3N9PA 4CVUA 1FPN1 5JMCA 3USUA 2ZXQA 4XXAA 4AEDB 1F4HA 2R062 3BKZA 5FMBA 2WIIB 4DRRA 1OA4A 2CTVA 3KCCA 1QIQA 3Q8EA 1KDKA 3LD8A 1CWPA 4OVEA 4EJRA 1EV12 5FWEA 2FZ2A 2Y33A 5LY1A 4C91A 4L97A 4MGZE 3J7MA 3IWZA 4QX3A 1K5JA 1ZYBA 2H0VA 5HPOA 5JSPA 1WLCA 3RMXA 4WVWA 5IT6A 3BOPA 4EV0A 3VKFC 4CDWB 4N53A 1YO8A 4Y26A 2ORXA 1PVC2 3CEWA 4HONA 3I2DA 1RUH3 3O5SA 4YRDA 1RUNA 1CPNA 3AP4A 3GCWA 2EF6A 3VBSA 2Q1FA 2JG9B 4MHRA 4UAPA 1ACCA 4OZXA 3WDYA 4A45A 5D8AC 5IAXA 3KD4A 1F8VA 2E6VA 1DGLA 1H8TB 5EFUA 3O1RA 3S5AA 5T50A 3VDBA 2VUCA 1HIXA 2E7QA 4FOYA 2PHLA 3KSCA 5SV8A 5FPUA 4E8DA 1DLLA 2Y6JA 1WCSA 4GKXA 5A33A 4Y1ZA 2K2SA 4P14A 4C0BA 1ZZBA 4I30A 5K8SA 4K8FA 2X09A 1PO11 5GALA 3MFCA 1LOBA 3POBA 3RJ2X 2ZGNA 4HVRA 4HSLA 2GH8A 4XVHA 1AF9A 1RXGA 1WLTA 2VBDA 4DOUA 2AC1A 3IDAA 3RYRA 3MEPA 2QQMA 1UNBA 4LBKA 2QQPA 4QQPA 3M4FA 3S5QA 3N9LA 3WP3A 3IPVA 1O4ZA 3I59A 4CCEA 5IWFA 3FX3A 3B7MA 2WQ8A 5F1RA 3E1F1 4AEDC 2BV4A 5LBCA 2WWSA 1VBB2 1C1FA 1ASJ3 2WN3A 2LROA 1GICA 3ME2A 5I0TA 3MUZ1 4A4AA 5K7PA 1LR5A 1AR91 1HB4A 2HWD3 2R32A 1ENXA 1NA1B 3L9JT 1SACA 1POV0 1JOBA 1WMEA 4OUEA 4WM7B 4OI1A 4LKSA 3LGRA 1J3QA 3O0VA 4FOQA 2DVGA 2VXJA 4FO9A 3VB9A 2JJ6A 5EPAA 1FT9A 1MZ5A 3JQXA 4GWJA 1OOPA 4LBMA 5DABA 1CAUA 3J9SA 1QJU3 1WZXA 4XFIA 5IVCA 4FBFA 4CDWC 2EAKA 2XDVA 3B9CA 1S2EA 1YQ6A 3AP5A 4A3ZA 3VV1A 1SMVA 2WN2A 3D5OA 1MZFA 2F4PA 3VHOA 3BU7A 3AM2A 1LOCA 1IG3A 4OYUA 5BPXA 4XIOA 1PGSA 1U5XA 5FJHA 4GQ7A 2JG9C 3MHZA 3QCWA 1H8TC 4D3WA 1ONAA 3ACLA 5IK5A 2XJTA 2BW8A 1XE8A 1PK6B 3E6DA 4LBLA 4XYXA 2HBUA 5JXGA 2WJSA 3AMPA 4H3WA 5C8CC 5I91A 5FZ1A 4NAMA 4H55A 3CZJA 3MV11 5J48A 1NXMA 2VH9A 2ZMNA 5JI7A 3WP4A 5ACA2 1VBA3 2A3XA 1YUDA 4YVWB 2ZCWA 3BB6A 2J1AA 4KWUA 2Q8OA 2WQ4A 1LKNA 5JPNB 2JIGA 2QNKA 3OGGA 5A3OA 1C5IA 4M0HA 1RJ7A 2EVXA 3JD73 4OMCA 4NWWA 4QXHA 2WKKA 4GXLA 1RUG2 1C4RA 1W9TA 1AUYA 2VZOA 3WG2A 1LOFC 1RUOA 1AR61 2E51A 3GJAA 1G8WA 2BTVC 5AC93 2C1FA 1OA3A 3P5BA 1ZX5A 3WG3A 5IK4A 2DDUA 3UESA 1NA1C 4Q1RA 4WM7C 4QB2A 4O61A 3SITA 2HLEA 3M1HA 2Q8CA 1XYNA 4YLZA 3ZX7A 3CIHA 1JOJA 3RZKA 5FZOA 1QF3A 3TBDA 3VBHA 3IAQA 4IGOA 4QGMA 3RMYA 3WP6A 1OKOA 2BEOA 2VCMA 4C90A 2HYXA 3S57A 3GZAA 1ENRA 3MDPA 4CU8A 1JN2P 3POSA 4E4DX 1BHGA 3DYOA 4GMP3 4LO4B 4UBGA 5FZOB 1GKBA 2WS92 3VLBB 2D6PA 4Q8KA 3JB8A 3ILFA 4DEQA 2UY8A 2NYYA 2DTYA 2RS31 3I2OA 5F5QA 3SH3A 4CP9A 3W59A 1R1A1 4DUWA 1PK6C 3BTZA 5FBZA 1JI6A 5FPAA 5GJ6A 4JKMA 1OUXA 1MS1A 1PIV1 5FZFA 1UZVA 2IVIB 2JEMA 4YM2A 4CUGA 1K3IA 2ATFA 1JZ8A 5FYHA 4MADA 1AVBA 4IQPA 4BXSV 2HJIA 2RR12 3USSA 4YVWC 2TEPA 4OZOA 2VOVA 3LQCA 1NLSA 3BCWA 1XNBA 1HLCA 4P9IA 4Q4Y2 2WRAA 3OYWA 4RS5B 1UMZA 3THTA 1W2NA 1HQNA 3O1PA 2WDBA 5I8TA 1Y9QA 4URTA 4V1PA 2GH2A 2Y34A 2W46A 2VMFA 1KD7A 3ZR5A 1R64A 3N7JA 2ZGLA 2DV9A 3SEPA 1LCLA 1UMIA 2G1MA 5DG1A 3WHTA 4NPLA 4B4QA 1QU0A 4AVSA 1QDCA 3FLTA 2ZMKA 4FOWA 2CSGA 1TME1 5KBFA 5KWRA 2EA7A 5CIRA 4DUVA 3A23A 3VHRA 2JDZA 2ZGPA 4I3PA 4EQVA 3IKWA 1I1EA 2DWRA 1V0AA 1H8VA 4HVQA 3H3UA 1Z0HA 1V6KA 3B3QE 3LEGA 5I93A 3LFIA 4GJYA 1MQTA 2WZR1 4AQ6A 4Q1PA 3AZXA 5K0UA 5FY4A 1W3VA 5HCFA 1PMJX 5A6XA 2EICA 2GNDA 4DXRA 2PAEA 3ZXFA 2CWSA 1EAH2 1GLHA 1DFQA 1ZA7A 5BNPB 1AHSA 1OLMA 1CZSA 3PU8A 2XGXA 4XUOA 3PUIA 3ACIA 1K5MB 1NZCA 2Z69A 3PL0A 1JH5A 1S55A 4M3CF 4XFBA 2DVFA 4FPFA 4XQWA 5CKQA 5EYYA 5FCCA 5GKAC 2VCBA 4YZ1A 1QQP1 1FMD3 1E57A 3J8F3 5A70A 1LTEA 4RSUA 4MGIE 2G4IA 2ZAAA 2ZGMA 2ZHKA 3I3QA 2PA7A 1ND3B 1H0BA 1GYKA 4LOTA 1SBFA 4CU9A 4OI4A 1SLBA 2LALA 2WFF1 4QDSA 1RUF1 3WDTA 4BQ3A 1LHNA 5IVJA 1S0EA 1OHFA 3DN7A 4KGGA 4Q4X3 3MIHA 3WG4A 4HETA 1LOGA 4JGZA 3SKJE 4R9BA 4IV3A 2YC4A 1VMJA 4RS5C 1DBNA 4XF0A 1PMHX 2ZA9A 1TE1B 3AK0A 5GLUA 4P9GA 5DQ0A 3VKOA 1YQ2A 3DYPA 4V2WA 1BZWA 2C6SA 3H1WA 1LULA 4Y5Z0 1AR71 2A1XA 4XJAA 3VZOA 3LOIA 1W6PB 4FSJA 5LATA 1A8DA 2OA2A 2YYOA 4U2AA 2BFUL 1NCRB 3GBFA 4IV3B 3WF4A 1ZREA 1I9RA 4QPIA 3ST7A 2H6BA 4AFBA 3WNOA 1GZCA 4GH4B 5IVVA 2D5HA 4L0PA 4NIIA 1Q5OA 1GZWA 3ELNA 3PJQA 5H9SA 1SPPB 2X5IB 5L9BA 1AJKA 3MO4A 4PCRA 1CQ9A 1VB2A 5E16A 3FHQA 2ZHNA 4HPKB 1RUI3 3GALA 4ATEA 4BH9A 3C2UA 2J7MA 5LBFA 2WO1A 3NJXA 3R4DB 1UXZA 2NPIA 2QQIA 2BWAA 2MHFA 3HD8B 5FPLA 5IAVA 3T2QA 1D4M1 5BNPC 3CJIB 3ZYGA 1GWKA 1Q3EA 2NM1A 4E27A 1JZ5A 1HRI2 2RDQA 3MF6A 4CTEA 1DGWA 1TMF3 5FREA 2Q8DA 4QPGA 2IUWA 1K5MC 1PZ9A 4UF0B 5GZDA 3NSTA 1RJ8A 4H14A 4XJ9A 1YJKA 2D6OX 1BKZA 1WW5A 2IXIA 4QQHA 2J42A 4LHSA 4P08A 3THDA 4CSWA 4Z1VA 1CVNA 1ULOA 2I45A 3BPZA 1ND3C 1AR82 1UCXA 2D43A 2X8KA 3T0AA 5KXEA 3MICA 1HQWA 2VZPA 2HWB1 3ATGA 4AVCA 3CLPA 2JIJA 2YBSA 2CYFA 4AF9A 2WNEA 2CAVA 3ORJA 2K9ZA 3ILNA 4K40A 4YM1A 3ALQA 3ZYPA 1JZ7A 1ULPA 3FBYA 4QHBA 2PAMA 5H9PA 2R061 5DUXA 4AQTA 1MZ6A 2E53A 4LKEA 4OHYA 4UFKA 5CKMA 5CG9A 1ZZ6A 3OUJA 1EV11 1UOGA 1RUJ3 3GZUC 3KS7A 5B4NA 2GDFA 5D1IA 2QTWB 1VALA 2EIEA 3DECA 2Y38A 4JGYA 4UT5A 4XBQA 5FZ9A 3MIGA 1O5LA 2BYVE 1NCRC 4IV3C 1BVP1 5FV3A 5FWJA 1CAVB 2XJRA 1SLCA 4ES8A 1W06A 2YPDA 4PF1A 2GP3A 3N9OA 3GHNA 4LBNA 5DZFA 5JPMB 4GH4C 1R1ZA 1PVC1 4JTNA 5JR7B 3JBG3 4GWNA 4G9SB 1JU4A 3V0AB 4UW4A 3UGGA 2X5IC 1AR92 4JGYB 4CPBD 1FV3A 1T6BX 1W8TA 2JWPA 3RG0A 4OI2A 1W8OA 2VW0A 5IK7A 2VBBA 3ACHA 2RMU2 4TLGA 4P9JA 2JG8B 2ZGQA 4XXPA 1WCDJ 3AVRA 1VRBA 3CJIC 3MLKA 2CGPA 4AHXA 2V09A 5GZGA 1TQ5A 1JHNA 3WXPA 5IATA 5FP8A 4EROA 1I3HA 1H9PA 1J83A 2N7GA 3ETQA 2FHRA 5FUNA 1S0BA 3HBZA 2JDAA 4JHZA 5LW9A 2WABA 1JMUB 2WO2A 5T52A 5TSWA 4YGDA 2OXBA 2VPVA 2ENRA 2VMDA 2ZEXA 3VBOB 3BTXA 1WW6A 1COV3 1CJDA 2DU1A 2XHKA 3AZWA 3WG1A 5F5IA 3WY6A 2XPJA 1AL23 1HX6A 3W58A 5LWBA 4OHWA 1OI6A 4CEWB 4XPVA 1VAMA 1W04A 2YBPA 3AYAA 1H1IA 5DZEA 4AFMA 2RS53 3E5UA 3ZXGA 3SMHA 3S7EA 1FOD3 3WT3A 3KLSA 2XR4A 4AAPA 2E26A 1W9FA 1VBB1 2RDRA 2Y0OA 4WVMB 2HEWF 4D69A 2OPKA 2UU8A 3VBRB 3HJRA 1R091 5IYYA 2Q8EA 1ZZ7A 1MVEA 1YCIA 1ZRIA 4NE9A 2ZHLA 4AVVA 4OUSA 2ZTNA 2EXIA 3M3OA 4E8CA 2EAAA 1DDLA 2KD7A 4KNCA 3WCRA 5T5LA 3NNLA 4QXCA 3MPPG 1DGRN 4XJWA 4AGRA 5FZ7A 1G9AA 3WF0A 4A7YA 1PMIA 1X9TA 4QKBA 4XBLA 1NQDA 1MS9A 3T09A 1MPXA 1OVPA 3ZR6A 4JGYC 2ZGTA 4GIQA 3THCA 3RYKA 2F17A 4LLOA 5A32A 2QZ3A 1KJLA 5FFOC 1T2XA 2JG8C 2BP6A 4NIAA 3POWA 2VCAA 2WSUA 2HEVF 1ZBA3 4OLLA 3KM5A 4N43A 2Y6LA 1NE6A 3SNMA 4CUBA 5JLVA 4A6OA 3RZGA 4K1ZA 1ASJ2 1DQ2A 2QQJA 2ZMLA 2OS2A 1GMMA 4PLMA 4AFDA 2HWD2 3WP5A 5DPNA 1X36A 1E5IA 2DVDA 3WNMA 4AVAA 4HXCA 4DNYA 4S2FA 1LEMA 2GC0A 2OIIA 2VJXA 3H50A 2EIDA 1ZVFA 4LO7A 4NN0A 4DXZA 3VBOC 1AYN3 4YW2A 1C28A 1GQGA 1RMU3 1QJU2 3WW4A 2R1DA 4BJ0A 3RZLA 3N7LA 3O1TA 2XMLA 4CEWC 5L7OA 3DCQA 2FCUA 4FTBA 4CA9A 1PIV2 4IEOA 4R8HA 1LESA 4NVPA 2ZEZA 3O0WA 2ZX4A 3HN3A 2YDEA 3RZHA 3MUY1 1XRUA 3LA2A 1AYM3 3NL1A 1QJY1 2D6NA 4LA2A 4BLIA 5FYIA 5JOWA 3VBRC 2AEYA 4W50A 2VO5A 2ORZA 4C1XA 4QB1A 1YIFA 2E63A 1G7YA 1SCSA 3FJSA 4CUAA 2H6CA 5JXIA 5FZDA 2VNVA 4W6WA 1YQCA 1CIYA 1VE0A 3KCXA 4JQRA 5FRAA 4Y33A 1NE4A 3X29B 1PGW1 3U75A 2ZACA 3CDZB 5FZHA 4MV2A 1NYWA 2BBAA 1U5YA 2P1BA 3N9NA 1OLRA 1AXKA 2HWF3 3IN9A 4Y24A 2BQPA 1JW6A 1DP0A 4HLTA 2VUAA 3BVCA 2VTXJ 2E33A 4AGVA 3ILRA 4IE5A 3OEBA 2PELA 4QX7A 4MXWA 4U36A 1J3PA 1UZYA 1AX2A 1EPWA 4NIDA 3CU7A 2WS91 4WZFA 5FYZA 4QKFA 3C7OA 2EIGA 2XHNA 3ZN6A 5J98B 3UGFA 4BB3A 1PNFA 1S0DA 4Y1UA 2MPFA 1BK1A 5K9YA 1SLTA 2WZR2 4AW7A 1POQA 4J6GA 1OBNA 2QCSB 1UY3A 4FVVA 5J36A 1H6YA 1YQ5A 1OLQA 2WFPA 3I3DA 3OSDA 1YFWA 3KT7A 5FXWA 2RE9A 2MNGA 3LEKA 3I2FA 5F3EA 2VULA 4JQTA 5BV6A 1B35B 2A6WA 2MEV3 3HT2A 4PQQA 3APBA 3KF3A 4IERA 4AI8A 2GMMA 2RR11 4BM8A 1X9PA 2WWUA 4IGQA 4UFIA 3SC7X 4Y22B 1WGPA 4QAWA 4NHLA 2WT0A 3VBFA 4Q4Y1 2PHWA 4YW7A 3UKVA 2LTNA 3WF2A 5J1XA 4CRQA 3IZOA 2VOXA 2B7YA 1NG0A 3LOBA 2ETEA 4AHYA 3Q8FA 2LW8A 3H0OA 3V56A 1GP5A 3OB8A 4E2SA 3TEZA 2JX9A 3AKPA 1PO22 4W6YA 1SLAA 3WQBA 1H1AA 2WFF2 3U0ZA 3OPWA 1BMV1 3WD5A 1QMJA 1J84A 5FOBB 3ZYJB 1V9U3 4BIOA 1N1YA 1FPN3 3E6CC 2VZ3A 2A6VA 3LSDA 1Q8OA 2GC3A 5FK8A 4BIFA 2CU5A 5KHJA 4I0WB 3D0SA 3MW2A 3P1IA 2WZPP 4TZDA 4LJHA 3B01A 2LUWA 3VD3A 1XYOA 4IDZA 3ZXLA 2OUHA 3FHIB 4MH0E 3VDCA 4YZ2A 4M3CA 2VZRA 4MX3A 1EAH1 4B1LA 3PMEA 4D7TA 1V6IA 1W39A 2DF7A 5KHHA 5D8AA 3E97A 3I3BA 3PURA 1T6GC 2FD8A 4DO0A 4P9LA 4L99A 1WW4A 2Y6KA 5FK7A 1W8FA 1H2KA 2TBVA 4XC9A 5F8PA 5FY7A 5LY2A 1D2QA 4M3CB 3WW1A 2XKPA 5IVFA 2ZGUA 3P3NA 3SXWA 2VE1A 4YW5A 5FPVA 2CY6A 2I74A 2PN5A 1YRZA 3KT1A 2XLFA 3U78A 4UOJA 4NR1A 4LHKA 2I07B 2UYBA 3JUUA 4PJYA 1D4M2 5CAZA 1B35C 1YYNA 2BGOA 3GBWA 3MPBA 3WQ1A 3ZYHA 1D4VB 1MS8A 4INDA 5F39A 2DCZA 3ZFEB 4Q0VA 4RD7A 2B45X 1VBE3 3NJYA 5E88A 5FMCA 3O1VA 5IW0A 3ZKUA 4CE8A 1U5ZA 2YPJA 1RUD3 3S7IA 4S2DA 4TLFA 1PGL2 3SH5A 1TZOA 3WZ1A 5BUVA 2ZOEB 1ULEA 1PO13 3AZVA 4AEDA 5FQ0A 5FO9B 1IS3A 4SLIA 3BUCA 1LGBA 1GQHA 1UU4A 4LIUA 2HWB2 2D97A 1ZRDA 2F6BA 3AYDA 4P00B 3HAGA 3L2YA 5F32A 1RHI3 1RTVA 5FZ4A 2R30A 4CDQB 1WBFA 2A70A 2AYHA 5FQ0B 4QM8A 4RGAA 3OCPA 2W1WA 1ZRFA 5GLVA 1FMD2 1FXZA 2A71A 4BDVB 1X8EA 3J8F2 4CDWA 3D3AA 4HN0A 2BJSA 2GMPA 2JE8A 3EJKA 2Q0AA 4FQ4A 1RUC3 4KBZA 4KMQA 3TN93 1FAYA 3OGVA 4Q2FA 2D44A 3CNAA 1YWKA 3G6JB 2QKDA 3I3MA 2VVFA 2JG9A 4FQZA 5H9QA 3KQ4B 2R7EB 3KHBA 5GZFA 5K4LA 1BBT1 1QWRA 3SKVA 4JDOA 1ND2A 1HRI1 1HV0A 4NHKA 1H8TA 2XWJB 1UL9A 4XFGA 1CX4A 4JX0A 1NLQA 5F6KA 4E2GA 1DZTA 1O4YA 2C9KA 2W1SA 3UJQA 5KXDA 3KF5A 3NMBA 4MG2A 4AHZA 5C8CA 4UWDA 5LA2A 2IXHA 1IKPA 3OTFA 4UXAA 1O3QA 1V6JA 4NRPA 1LHUA 2LRPA 2BOJA 1G9FA 4GJZA 2YROA 1ND2B 3FUOA 1AR81 4K9SA 2A5ZA 5FYBA 1H2LA 4XUQA 5AFEA 2VZQA 1GZTA 2Z2SB 2BRTA 4B4RA 1KRIA 5GZEA 2UWAA 2VBPA 1NY72 2XLGA 3AZZA 1HB1A 1N1TA 3QLQA 2OYZA 1IQDC 4URAA 5C8CB 5T5PA 1VBC3 1WA6X 4FFGA 5L9VA 2DU0A 2VVDA 5HCHA 2RDSA 2GC2A 3M70A 1IOAA 2DCJA 3T1MA 1VBD3 3DL3A 1QXJA 2XVKA 4B4PA 1RB8G 1KXGA 1HXS2 3EYPA 1US3A 5CA6A 3U14A 1LOFA 1MEC2 1F35A 4DY5A 4E9KA 4IEQA 4Z82A 4ZU7A 4QT6A 5IHRA 1NA1A 3WDVA 2PHDA 3D0JA 4WM7A 1TMF2 3GZTB 2BGCA 1Z78A 5A7QA 1WMDA 3AZYA 3OBRA 3GXUA 4JDNA 1A3KA 4QQOA 1NCQB 3ASIA 2OKXA 4CDQC 4LEJA 2LS6A 2G9FA 1YC61 4YW6A 1O7FA 2RG4A 4LO6B 2ERFA 1KDMA 3EO6A 1R092 1O3RA 1MACA 3CBNA 1C8M2 1YHFA 2XL9A 2WWJA 3NNGA 4I3GA 5FBJA 5FJKA 5A7NA 1DQ4A 4BQWA 3RRDA 4AXOA 4IEWA 2RMU1 1Y7BA 4XCAA 4XACA 3LEMA 3RZZA 5C3OA 3ZYIB 3OPZA 1NUKA 5DDJ2 2YU2A 2W0XA 2GZWA 3AX4A 3ZSMA 1UY1A 1REFA 4KWJA 2ID4A 2W08A 2XL7A 1VR3A 1FX5A 2CGOA 2ZHMA 3A0KA 4PQ9A 1PK6A 3J7NA 4F83A 4MOAA 3FLPA 5CB7A 2UYAA 1XNCA 1IPJA 3S0MA 1RUJ2 1VAKA 2YFUA 4OQ8A 1NT0A 1ST8A 2B42B 1WMXA 2I2SA 3WDXA 1ZZ9A 3BTYA 4ASMB 1ND2C 5CISA 2A75A 1IKQA 3DKQA 3R05A 4X8NA 4YVWA 3CKHA 1C3HA 5E89A 3FFQA 3K48A 1R1A3 5DAXA 5FY8A 3VN4A 5C8WA 2R16A 2BZDA 4Y3OA 5ABJA 1S0JA 1S0GA 1JZ3A 2P2KA 2ZX0A 2C5DA 4P9WA 5T5JA 2QVSB 5DAVA 4JAAA 3Q9OA 2JICA 1OXCA 4Z07A 3WHUA 2WINB 1Q8PA 3ZDVA 2Z79A 2B4KA 4BE3A 2E32A 1HKDA 3MF9A 4YFZA 5A6QA 5JCTA 5ABJB 3CL1A 1AX0A 4N90A 5FLIA 1YEWA 1X8MA 1W05A 1NCQC 2PMWB 3WNLA 3TAYA 5KXCA 2QQNA 2R49A 3D6EA 4A3XA 1F2NA 1QJY2 2VW2A 1GOHA 4Z2WA 4W4ZA 4XF9A 5FAXA 4UW3A 1COV2 1GV9A 4XILA 3UT0A 5JVVA 1AL22 1TME3 1N1SA 2FCVA 5C4WB 5JIUA 1PGW2 5KHKA 1UPIA 3HR9A 4Y1YA 2RS52 3V0BB 5FDBA 1FOD2 1REDA 4NWVA 1DU3D 4Q0SA 5AVPA 3B00A 3DXTA 4OHZA 2Y0IA 3D82A 4H7MA 1ASJ1 1F4AA 3PU3A 4Q27A 1TVGA 2DURA 2QBXA 3QH6A 3VZMA 1LHOA 4WM8C 1O3SA 1SG3A 2HWD1 1OQDA 4ONUA 2ZGKA 1BEV3 4PIYA 1VJ2A 5GM0A 4AFCA 2VNGA 1GSLA 3PUAA 4RHV3 4ZHNA 4S2GA 3F2ZA 2ZX2A 3UYJA 2ZJCA 4BQ1A 1OLME 1QJU1 4LK6A 4DPNA 3TRSB 3BI3A 1OH3A 2NP0A 3DPRB 4XQDA 4RS5A 5A7SA 4CCKA 2G9ZA 3M3QA 4FFFA 2XJPA 3WEZA 4LNVA 1UX7A 2V4VA 1DZQA 5LASA 1ULFA 4DINB 5KR7A 5CG8A 3M8LA 3I49A 1Q43A 2FMYA 3NVCA 4NPMA 4GZ9A 4NAOA 4XHXA 3WCSA 4ZZ5A 1S2KA 4Q4V3 2GSYA 5A3UA 1RUF3 1RL3A 5BNOB 3AMHA 1W2AX 4MO3M 1U5IA 5A1LA 2SLIA 4EZ4A 5JOXA 3WNKA 2P3JA 4JDMA 2DCTA 5ABJC 4JRAA 2KXLA 3RJRA 4E4HA 2FDKA 1PM4A 2R042 4ZXKA 1GOGA 2YFZA 3I2KA 2ZEYA 1BMV2 3LIGA 1GNZA 1IPSA 2IWGB 3NQHA 2EALA 1IGOA 2RM23 3OUHA 1V6NA 1RUE3 4JC1A 4COUA 5BNPA 3ZKYA 1W6OB 3PTRB 4D6SA 3JD71 1W8ZA 1NXD1 2ZEWA 3LDRA 3OY8B 3GGLA 5C4WC 1K5MA 3A0NA 3FC0A 4KI5M 4XOGA 1K45A 4JTOA 1UIJA 1QJFA 4COVA 5AC91 1L3JA 5BNNB 4LULA 4TYSA 2FCTA 5FY1A 5L9RA 3LPGA 3SEEA 1ND3A 2P34A 4BPZA 3RYPA 3UV9A 3VL9A 5FO8B 4LQRA 5FZGA 1JYXA 1UPSA 5LRSA 5FY5A 1V6MA 1VRH3 2GNBA 4CU6A 1VB4A 2XBO3 3AJYA 2ILMA 4GAZA 1JYTA 1IZ3A 3DPRC 4FXGB 4WVVA 4EWDA 2HWF2 3I97A 4PBPA 1UYXA 4PI2A 3BYWA 5DAQA 1JS9A 2VY0A 4LHNA 1L7RA 3H7JA 5IVBA 1GUIA 3B93A 4Q26A 1PO21 4GMP1 4OHXA 2R073 5B2GB 1SFNA 3LB9A 2NQYA 1W6PA 4AOCA 5BNOC 3RWKX 1YQ8A 2WAAA 4EZHA 3KV6A 1NCRA 1YFYA 2CL2A 2RDNA 1JZ2A 1OFNA 1VMHA 2WNOA 3T2PA 2A3YA 1Q8SA 1LU1A 3CF6E 3GBGA 1AJOA 2JD9A 4GH4A 1CD3G 4HN1A 3SLIA 5F9TA 2B9VA 5F37A 1B09A 3IM0A 2P6HA 2VM9A 4CCJA 5J96B 3IBMA 4AQ2A 3VGIA 1SPPA 4GB33 2X5IA 2MEV2 3O7OA 3T0DA 1ZM1A 1LEDA 4IEPA 1J58A 3WOGA 1XJAA 4IEYA 5DAPA 1FYUA 4HPKA 4AI2A 1OQ1A 2J22A 4P5HA 3NAPB 2JXAA 1R082 3RVHA 1DG6A 1GANA 1MR5A 3CJIA 1URXA 2FBEA 2WT2A 4N9IA 3WDWA 5HCAA 3AVSA 3O1SA 5JAXA 3OG2A 2BBVA 4KGQA 3C8XA 4BHPA 2B5HA 2VOKA 5FXZA 4JV4A 1QKQA 3PMSA 4KL1A 4UF0A 3ZIXA 4CCDA 2WNVB 4W6XA 3U10A 1OF4A 1KJRA 3I2JA 2IXLA 3FHAA 3G7DA 3WR0A 5EJ3A 2IC1A 3WX5A 5BNNC 5EIYB 5FZ3A 1BBT2 2BNMA 3TYJA 2D6KA 1V9U2 2KR2A 3HQUA 4WZCA 3ZM8A 5J3UA 4DQAA 4I2OA 1C8NA 1YFXA 3ZXEA 2IFWA 3QBQA 2UWCA 2W5FA 4I01A 4OI0A 2A6ZA 2ZGOA 5DXDA 3UGHA 5EYXA 1H2NA 1PGL1 3MFAA 3HBKA 2JKBA 3I4IA 3MIDA 1QJX3 1US2A 2GNTA 3KWVA 4N8MA 2PHRA 4OQ9A 1CX1A 2FMDA 2WZ8A 4DZGA 4YGBA 5IJRA 3C3VA 1QJEA 2P3YA 4CEYB 1N3OA 5FPXA 4XF4A 2JDPA 2DCYA 4LT5A 1SBDA 1C5HA 3RSJA 3VD7A 3N35A 3AKTA 5HXVA 1ULGA 1WUVA 5IFTA 3R4SA 2JDNA 3OD4A 1JYNA 3LIHA 3MLLA 1CAVA 5FZIA 1FMD1 4XE9A 5A3WA 3DKWA 3IIAA 1DQ0A 3J8F1 1K12A 2UY9A 1BJQA 1F9KA 2DCKA 2NZ9A 3U1XA 2ZABA 5FYSA 2FDGA 2WUHA 4CP2A 1AXYA 4XDQA 2DUOA 1W6MB 2ARCA 2DVAA 3AP6A 4TXWA 3N36A 4X8PA 1CAWB 1S0FA 3Q8CA 1F5JA 2Z4FA 3LKJA 4BOWA 1GNHA 2JDYA 5AVAA 2BNOA 2XB6C 3POFA 2W68A 1CPMA 1XU2A 3H3LA 3NRUA 3NAPC 4EN6B 2B46X 2JG8A 3CMGA 1RUD2 3NV3A 4O9GA 5LZ6A 5FIXA 5CVRA 5FKBA 1ODMA 1H4GA 1ZZCA 1D2SA 1VIWB 4RL7A 2RS13 3AYCA 3FFZA 1WCUA 1JYVA 3U37A 4I02A 3ZMOA 4YG6A 2FZ1A 3ZSKA 1UN1A 1YNAA 5HI0A 1PM7A 2WNVC 4P5YA 4WBBA 3IT8A 5D2AA 3JCIA 1RHI2 2HWE3 4WVZA 4KG0A 2JB4A 3NNFA 3RGBA 2Z5WA 4DXSA 5CYYA 3IB3A 1NY71 3VBOA 4NIHA 4QU1A 2V4AA 4LUMA 1XYPA 2CHHA 2Y26A 5E8AA 2VQ0A 2ZBJA 1C57A 4ZONA 5F5CA 5FZ8A 3RQ0A 1WKYA 4CEWA 4XETA 4SBVA 1RUC2 3TN92 1W2OA 1HXS1 1RUI1 3MYXA 1SZBA 1PZ7A 5ACA3 1DHKB 1MEC1 4HZFA 2VZTA 2VZ1A 4WVMA 3U11A 4CDXB 5I0DA 1XE7A 4M00A 1W2TA 1HRV3 5ANNA 1GNYA 1ZNPA 3VBRA 4L92A 4CEYC 1KFXL 2YU1A 4CDUB 1TMF1 2VGDA 1UIKA 3MIBA 4GWIA 3LZZA 4FAHA 3ZXKA 4H7LA 2OZJA 1S0IA 5CFDB 1RUH2 4Y4RA 2GN7A 1ZZ8A 1YFUA 4COWA 1NKGA 1RUG3 4XAEA 5HV0A 4BYYA 3DEMA 4QPWA 1DQ5A 4NO4A 3PTYA 4PI0A 1J59A 3B02A 4IE0A 4A7ZA 1C8M1 3ZPOA 2VL4A 3VKMA 2XVLA 1OURA 3AL6A 3JU9A 1YIPA 3PHMA 1FATA 1C1LA 2W39A 5LEJA 5LA9A 3ZFEC 5DDJ1 3R6SA 1VBC2 1W03A 4EYUA 1RVF3 4FI9A 2JDUA 2CAUA 2V5DA 4IUGA 1VBD2 2SBAA 3LFMA 4Z8BA 4LR4A 5I8SA 1G9CA 5EHDA 3OBAA 5GLTA 1LECA 1RUJ1 1BYHA 3O1MA 5J37A 5G04L 3PIGA 2ZGSA 1POV1 3T0BA 4YG3A 2BDRA 1JXNA 3AMMA 1I5ZA 1L7QA 5J7MA 2GNMA 1RYYA 2NLRA 4MVTA 4RFT0 4XTMA 1W6NB 1I6XA 1JOPA 3TNQA 4L8QA 4LORA 4EN9B 4ZS3A 5KXBA 4BXFA 1W0PA 5A7OA 4D6QA 5CZKA 2VMHA 4HBNA 4ATFA 1DIWA 4HL0A 3T4HB 4QWNA 2WYSA 1KQRA 1SQ4A 2BERA 5FYTA 5FP9A 2AREA 2ZKLA 2XJUA 1NX9A 2D93A 4FPOB 5IVYA 4CDXC 3N4MA 2R6QA 2K46A 2PLV3 4G4FA 3CQOA 5C5UA 1QXPA 3OOXA 1QDOA 3W5MA 3E5XA 4Z2AA 3VBUB 4MGYE 4PF5A 4CDUC 1YI9A 1SFPA 3SCFA 2EXKA 5T55A 5FMOS 3EQEA 3CO2A 3M3IA 4YVSA 3FZ3A 4XURA 3U4SA 5CFDC 1ZBE3 5FYYA 4C0HA 3I2HA 3IIIA 3RDIA 5FR3A 3TNPB 1NQJA 3LSEA 4PIZA 3H7YA 4XJZA 1W28A 1J1LA 2KM2A 4XQ4A 3T3YA 4RQPB 1COV1 1RC6A 3PIJA 3DV8A 1X7NA 2R0FA 1AL21 4QX2A 4YM3A 3RWNA 2O8OA 4YVSB 1QXRA 5JSOA 2RJKA 1IG0A 4M4RA 4P9XA 3WLUA 2HWC3 2RS51 3T30A 1ALYA 2AUYA 1FOD1 4CXWA 2FDIA 3DXUA 4F3JA 1APNA 4Q4W3 4RR3B 3KZ4C 1VBA2 2TUNA 4GKYA 4LK7A 2YGLA 1XC6A 5CADA 1DZRA 3AJZA 5M0TA 4HKLA 1XNAA 4KWLA 5HCBA 2DUQA 4Y20B 4XFCA 4CPBA 1B35A 3PVNA 4LBOA 4M3CE 3A21A 1XBFA 2WO7A 4HKOA 3JD72 3IDCB 1LENA 1WBLA 2DVBA 4RGGA 5JOYA 4Y22A 1SLLA 1V00A 3PNAA 3IMMA 1XE0A 3KB5A 2BNNA 5DZGA 5AC92 3MI8A 2ZS6B 4QX5A 3RS6A 1LNSA 1UZ0A 4H2AA 3PUQA 1WCQA 4BQXA 1VP6A 1P8JA 2AACA 4UBHA 4MGTA 4KWKA 3MZHA 3FLRA 2E7AA 1O8PA 2P3KA 3DGTA 3R4UA 1JU3A 5DUWA 1M4WA 2PHFA 3PUHA 1STMA 2WZEA 4AVBA 3T08A 1SDWA 3GJBA 1HN1A 1XOYA 3OJBA 3VBUC 2VOWA 4FTSA 1Z7S3 3NV2A 1UD1A 4PT6A 1OH4A 2BU9A 3LDBA 2R041 4BK5A 4PIXA 2Q5TA 1TNFA 4NHYA 4O65A 2FDJA 4G3YC 4PDWA 2XJSA 4X6RB 4M4PA 4IGPA 3ZOIA 4AYUA 1LJ7A 1UYZA 3P3PA 4GD4A 4K20A 4ORFA 4RHV2 1W9SA 4AVTA 2Y6FA 4QKNA 3WNXA 4ZPIA 3NJVA 4RQPC 1W8UA 1IS6A 1RMU1 1DQ1A 2YC0A 4LPLA 4N7UA 4OHVA 2VR4A 2A6XA 4MZUA 4Q0PA 3QH7A 4YVSC 3EHKA 4QQ2A 4IV1B 5IUQA 1AZDA 4PDWB 3C7GA 5C5TA 3H42B 4BQ5A 4XTPA 4Y5TA 3ZPYA 2ZX1A 4Q29A 3AYEA 2A73B 1KS5A 4FPHA 4NPRA 2ARBA 4Q0UA 1AYM1 4QXKA 4FT8A 4RR3C 5F2WA 4DB5A 5C71A 5LCWL 3ECQA 4Q4V2 5G05L 3GM8A 1UY2A 2O14A 4E4ZA 4JHTA 1UW8A 2ADEA 4OFGA 2JB8A 1QH7A 4D94A 1CAXB 1W8WA 1XXNA 5CFCA 2XQXA 3I7DA 4LHLA 4AEMA 1O91A 4HANA 4XF1A 1LB2A 3AP9A 4XJ8A 4HT1T 5LBEA 2HWF1 3MIEA 4XJUA 4AGGA 5L73A 4AHWA 2GALA 4IETA 4R52A 1QH6A 4OCTA 2YXSA 1DGRA 4YNIA 1IPKA 2W95A 4XZPA 4MXVA 3W9AA 1UU6A 2JECA 3IDEA 1W2UA 3H8XA 3WSOA 4HSJA 2OQ7A 3TEWA 4KBBA 1OD3A 5CFCB 5JXJA 2RM22 5CEHA 1RUE2 1SHWB 3E5QA 4LO8A 1W99A 2W47A 2Y6GA 3EB7A 4W8JA 1LRHA 1QEXA 3VDDA 4CDQA 2R0HA 4PHZA 1W6QA 2ZKNA 3K3OA 2WA3A 2AENA 5CFCC 4O9EA 5JZGB 2W1QA 2X05A 4B8EA 4CP0A 2BVVA 2GN3A 2VZVA 2MEV1 4B7KA 4ES9A 1IQAA 2QQUA 4IE6A 2PXJA 4O7XA 3WV6A 1BCXA 2H0BA 4K6BA 1BK0A 2DFBA 3KVBA 3VDDB 3AC0A 1ZRCA 2XKOA 1W6QB 1JHJA 1R081 1RGSA 1VRH2 2Y64A 2XBO2 4NHMA 3T1LA 4Y5SA 1LAJA 1RINA 1UKGA 3N3HA 4IV1C 3ZDSA 4LE4A 4PDWC 4AE2A 1UY4A 4E4SA 1CZTA 2VUJA 2QQLA 3ROUA 3ZXAC 4AI0A 1AR93 3ETPA 1E5HA 2GP5A 3HT1A 4QX0A 5C3RA 3ZFGB 5C9AB 2R072 4DFSA 4D7SA 4DXTA 3SHRA 2HEYF 3MGUA 3RI9A 3D8CA 2RMU3 4Q4X2 1BLZA 1MZEA 4QXBA 4NIGA 3K4AA 3W21A 1V9U1 3QD6A 2WO3A 1GFF2 3U4XA 4YM0A 1UF2C 1Y3TA 2LM3A 1UY0A 3JXSA 3C7EA 1JUIA 3BIWE 1OUSA 2JDMA 1HDKA 3E6BA 3OEAA 4KH9A 3WF1A 5JWPA 4A7KA 5EJ1B 3HQRA 1KS4A 4GB32 1OKQA 4GA9A 5EV7A 3USUB 1DGWX 3VZNA 3NV1A 4YW3A 3MIFA 1PZ8A 3VUOA 1H6XA 2DBIA 2ZX3A 3H1MA 1H2MA 3BALA 3PDQA 4ITCA 1OPMA 4EN0A 4PLOA 3UL2A 2QJVA 1HV1A 3N7KA 4LBJA 2KA3A 3MLJA 4UFLA 4TSVA 2HKXA 2W87A 1NCQA 1RUI2 4E2QA 3I54A 5APAA 5EWSA 4RFRB 4FPKA 2ES3A 3PUSA 5JDBA 3INAA 5JZGC 2QZ2A 4KQ7A 4YW1A 3TEXA 4ARXA 1HQLA 4BISA 4N53B 1XPWA 4YPJA 4NJ4A 5AFBA 4XW3A 5IK8A 1CGPA 1VBE1 5L19A 3VDDC 2EIBA 4FPLA 4J25A 3OBZA 5FXVA 4CCOA 4FPGA 5I0RA 4XIKA 1A78A 1RUD1 3HQXA 3LPFA 4CCMA 1GQPA 3UKNA 4UW6A 3VBSB 3AKRA 4AZZA 1QJX2 2A3WA 1SLIA 3ACFA 1AR63 1UAIA 1UQXA 2D3PA 2VMIA 3TB0A 5DUUA 1UOFA 1W9YA 4WM8A 2QQVA 1A34A 5T54A 4JKLA 4D6RA 3ZFGC 3Q8AA 5C9AC 2XJVA 1RHI1 2YB7A 3AXDA 3V65A 1HW5A 5A33B 3MV01 5A6ZA 3AKSA 1OSGA 3CZUA 5C7GA 3S6PA 4NOTA 2VXRA 2CGNA 2OPWA 3WQ7A 5A3NA 1UMHA 2Z42A 3LDKA 4LUKA 5LRRA 4WM8B 1MS4A 3ZN5A 1S2BA 2X29A 1RUC1 5T5OA 3TN91 4Z92B 1JBCA 3RZJA 4XUNA 4P02B 5LK5A 3EMRA 1LGNA 5I0SA 1OPOA 5ANQA 1GR3A 3IPVB 3I59B 1SFYA 4DMIA 1VLNA 1BQPA 4XAAA 2XVGA 4WV8A 5D21A 3K4DA 2CNAA 3SQOA 2RS33 1UYYA 3WUDA 1NZIA 3ES4A 3C7HA 5FPZA 3JBG2 3K4ZA 2BWCA 1RUH1 2RS12 3R0RA 3I3EA 1PIV3 3O12A 4W65A 5CNAA 4A44A 4A42A 5FP7A 4COYA 1UU5A 4ZS2A 1DCSA 1NAEA 4MHUA 3W20A 3H9AA 2D3RA 3BOWA 4LE3A 3KGZA 4K8RB 4Q5OA 1OOPB 3GZEA 1CAUB 5A7PA 2HWE2 5FUPA 4IEVA 4XBNA 3HOBA 3ZVXA 4N53C 4L11A 5T3NA 4IE4A 1VBC1 3Q8BA 3AL5A 3ZYFA 5C4WA 3ZXJA 1VBD1 5FZLA 4K7JA 1ENQA 2C4XA 2PHTA 1U12A 1MVQA 3VBSC 2JDKA 3V0BA 1OT5A 5A3MA 3IMNA 4QGLA 4RGKA 5DN2A 4F8AA 4K21A 3QACA 1TNRA 4YGEA 2PHXA 1HRV2 3OD0A 4QHOA 2J1RA 3MBWA 2PQQA 2B8MA 5JOZA 1G86A 1O8SA 2OZ6A 3BODA 5F5AA 1YXWA 3I8TA 3K3NA 4QMAA 4GALA 4R4ZA 1ULCA 3B9IA 1IHMA 1SCRA 3VHNA 4FAGA 5I8YA 4ZY9A 3SCGA 2V73A 1ODNA 2WZR3 3F95A 4IL7A 2OT7A 2P5BA 2YHJA 1CESA 5A7WA 4DIQA 1O3TA 3POIA 1HJFA 3DPRA 4LKFA 1UYPA 4JKKA 3BU0A 4S2HA 4AFAA 2QDNA 4X6QB 5FZBA 3H3ZA 3CHXA 3AMQA 3VZJA 5DMYA 1OVSA 2IVJA 1FNYA 2WYFA 1EY2A 4YFWA 1RVF2 5A7WB 5BNOA 1RIRA 3FL7A 5FY9A 3NKTA 4EWAA 1QQP3 1V70A 2C24A 1PHMA 2D5FA 4QHZA 1EPZA 4COZA 4LLFA 4R9AA 1WD3A 1WWYA 3KV5A 4C1WA 1VPHA 4KU8A 1XQNA 1H4HA 4M01A 1LOAA 2YY1A 4BK4A 1PO23 2VNRA 4FPJA 4JRLA 4XFHA 2WFF3 5EJZB 5BYNA 1OOPC 1JYCA 3ZO0B 4CUCA 5FZCA 3VBHB 4QD2A 5FXXA 3HNBM 4UI9L 1ZBA2 4CZSA 2EXHA 1GOFA 1E5RA 5HBAA 5LK7B 3BN6A 4BZ4A 1N3QA 2PTMA 2WQZC 3PLQA 1Y43B 4HG6B 3C7FA 2V72A 1PVXA 1W6OA 1SEFA 2XUMA 4TWTA 5LBBA 3UETA 4A6SA 3OY8A 2J1VA 2ADDA 1VBA1 1AR73 5JSRA 2OVUA 3OGRA 1REEA 3HEIA 1H30A 2PLV2 2Q30A 1AYN2 3KMHA 4CP9B 1RMU2 5BNNA 1S1AA 4MGKE 4HK8A 1W8NA 3DUIA 5C33A 3RNSA 1EP0A 4YG0A 1XNTA 1PX4A 3VDAA 4QDQA 2VC9A 1EYBA 1Y4WA 4Y1XA 4L9BA 4FOVA 1A6CA 4IEZA 3B5LB 1ZBE2 5C3SA 4DY3A 1QY4A 4OMDA 1FI2A 1AYM2 2J1UA 4RN5A 3AFGA 4YZ3A 3H1YA 4CCLA 1O4TA 3GCXA 1JYIA 4QU2A 1BXHA 4BMBA 3JZVA 3OYWB 2QDRA 4NROA 1D4M3 1LHVA 4I09A 5FY0A 2D6LX 2VQUA 3IAPA 3M3CA 4I0BA 4RA0A 1M06G 2DTWA 2NMOA 4IEXA 2G19A 1JZ6A 1YJLA 1HB2A 1GP6A 3AXEA 4A41A 4B7EA 1UZZA 4LBQD 2HWC2 3RI8A 4AWDA 3LAGA 4EE2A 3FUQA 3WINE 1X33A 4Q4W2 2VU9A 4LO5B 1W8HA 4J1WA 5JXHA 4F7ZA 3M7AA 3MW4A 3NWKA 5FZKA 5FOJB 4YYOA 4BCUA 4LKDA 1K42A 2B39A 1BEV1 2JE7A 4LMFA 3MW3A 4BA6A 4C8DA 4IW3A 5GLZA 2HWB3 3BGAA 5FLJA 4RHV1 4LXLA 4D7YA 5KHIA 2W9XA 3CJXA 1RXFA 4XMIA 5EXOA 1EUUA 4HKWA 4NHXA 3VD4A 1X82A 1MQTB 3VBHC 5K0UB 2L9LA 3NAPA 4ZKTB 2BOIA 5FPBA 2W91A 2R063 1OMIA 1S4CA 1VAVA 2YBKA 2P37A 1OA2A 5FMOL 5FYMA 4JZRA 1L7LA 1EV13 1QJZA 5F3GA 3JQWA 1H9WA 4LTAA 4META 4EN7B 2WNVA 4Q4V1 3ENRA 1UX6A 3PVOA 2WR9A 1G9BA 5FZMA 1X50A 5E1RA 3ON7A 3VL8A 2W3JA 4FP2A 2XLAA 1KGYA 2W52A 2HBTA 2CV6A 2BVBA 1Z7S2 4R4XA 1PVC3 2A6YA 4ISRA 4AR2A 3NNMA 4XCBA 3FMGA 3BTAA 2DBNA 2VMGA 3IDBB 1ZA4A 1O5UA 2RJ2A 4XDOA 2WLQA 2IXKA 1XSRA 2VCCA 3K46A 1SDDB 3OUIA 1S0CA 4UFJA 3OBTA 3ZN4A 4QDRA 2RJLA 4FCAA 2XWBB 3URFA 4JGZB 1MS3A 4K3UA 4ASKA 2VOTA 2X10A 4L2NA 4NRMA 4ZU4A 4AEKA 1FPN2 2XQRA 5FZEA 2RM21 2VW1A 1RUE1 3T2TA 4CEYA 4XZUG 1MS5A 4HK9A 2PFWA 2VTFA 2ZAHA 3NV4A 3SCHA 4I0AA 1XSQA 3O1OA 3FE5A 1LU2A 4AK3A 5HV4A 3A22A 2AH2A 3ES1A 1HXS3 2JDHA 3B69A 4HOOA 5A6YA 2G9GA 5KHGA 2C0ZA 4QPIB 4AAXA 2VZUA 3N9MA 3EBRA 2VMCA 1MEC3 2J1SA 1KFUL 4IESA 4ASLA 5FMDA 3VD5A 1TG7A 1V6OA 1W6MA 1GZWB 3J7LA 1CAWA 4FFIA 2YUEA 4QX1A 4D8MA 1VRH1 1MQTC 2XBO1 3ZFEA 5K0UC 1TEIA 4B3NA 4ZU5A 5BNQA 3ZIWA 4XMAA 1OFSA 2TNFA 5GLWA 1VBB3 3HNYM 2XH6A 2JKXA 2C26A 2QQKA 1JYWA 5LA0A 1R093 1C8M3 1GBGA 1ZRRA 2R071 2AZ5A 4QPGB 2RHPA 1UO9A 3GDBA 3KVAA 3ZYRA 4Q4X1 5L36A 3FBMA 1VBE2 5FO7B 1OC1A 3BIEA 3ZXDA 1N47A 5DDJ3 1W9WA 1AXZA 2PQSA 3ITQA 3ACGA 1PO12 4TN7A 4BU2A 5KC6A 3LE0A 4JVAA 3K51A 4FFHA 3UJOA 2PYTA 2VMEA 4QQLA 4MUVA 4BQ4A 2VZSA 4GB31 5BY5A 4DUXA 3POGA 3ZLIA 3AFKA 1POV3 2XXZA 2YC2A 1BVVA 4JGZC 4XHBA 3WDUA 4CDXA 2HH9A 5BXXA 3HVDA 5FLHA 3WF3A 4CXYA 1PNGA 2W94A 4ET7A 5IFPA 2IXCA 1FV2A 4CDUA 4CP1A 4YARA 1RITA 3EXUA 5FZ6A 2WBKA 4LBQA 3K75B 4QB6A 4YSFA 4MLOA 5CFDA 4MGQA 5B4XA 4K1YA 1CIWA 3LWCA 3M3EA 3HNMA 3OGJA 4QPIC 4RYDA 2GAUA 2AEZA 5FYVA 3AP7A 3HN1A 1HB3A 3WW2A 1XU1A 3WVJA 3LA7A 5A1AA 2FDHA 1LGCA 2P4EA 2VUDA 5C6CA 1WLWA 3OF1A 3VZKA 4LBQB 4V2VA 4CU7A 2DUPA 2B9UA 3ZSEA 2VQAA 2OX0A 5FP3A 3I2GA 1QJX1 4QM9A 3I2IA 1Y9GA 1QJY3 3KQRA 4XEZA 3LCPA 1XNKA 4B29A 3HIFA 2UURA 4LA3A 2CDPA 3HMYA 3ZSJA 2ZZQA 2WA4A 5EZWA 4KU7A 1CN1A 5JI9A 4EWEA 1O59A 2JE9A 4NRQA 4QPGC 5E6HA 1N1VA 2ET1A 3RPQA 4DEVA 2DFCA 5F3CA 4TTGA 3POJA 4OUMA 4HFSA 2WC2A 2CDOA 2VQTA 3KHCA 4HMZA 1W6NA 3VD9A 3PJYA 3V0AA 5FZ0A 4BQ2A 2VG9A 3B94A 4R9CA 1Y9MA 2NMNA 4XF3A 5F3IA 4DRVA 2W92A 4FPYA 1LHWA 4IE7A 1MS0A 4P9YA 4YZ5A 1IS5A 3KV9A 3KV4A 3O0XA 2WS93 3HPNA 4XUTA 5CU1A 5A3TA 4UYBA 1LOEA 1V6LA 4LITA 2FQPA 3NO8A 3JBG1 3VBUA 3UNPA 2RS11 1W0OA 3T2OA 1AR62 4PLNA 5HXMA 2A7AA 5A3LA 2VVEA 3UK9A 1DLCA 1F15A 2JENA 3J4UH 1DF0A 1G6NA 1HJGA 4MSVA 4IEUA 3VHPA 4AEJA 2RR13 3NW4A 2GC1A 2ZGRA 4DS0A 2HWE1 3WW3A 2W1UA 1D7PM 3O1UA 1KEXA 1QGLA 4Q4Y3 3U07A 1H1MA 2NN8A 4RQPA 3QOPA 2AGSA 1UOBA 4QX8A 1OD5A 4ARYA 1YI7A 2X53S 4GULA 4QGNA 2E7TA 5FZAA 2D98A 2R043 2PAKA 5I0UA 4AG4A 5FYCA 3J26N 4BQYA 4CYDA 4PBOA 2J1TA 2XUEA 5A32B 1DYKA 1F5FA 3BPSA 5JUVA 2WAOA 2WLPA 5ACA1 2JD4A 1LODA 2ARAA 2E31A 2VECA 4RR3A 3ZFFA 2IFRA 4CXXA 1CJPA 5FYUA 1I5PA 1HRV1 2YZ4A 2BGPA 2Q4SA 4N43B 1YLLA 4XUPA 1Q8VA 2Y60A 1A8MA 2RS32 3N9QA 4FPCA 1R1A2 4Y20A 3UKTA 4XFAA 4YW4A 1DYPA 1GU3A 4UFHA 3S30A 1JODA 1Q56A 1RUG1 2WNUA 4JCKA 1UXXX 4LIVA 3ZFFB 3FWEA 1GP4A 4FTEA 5H9RA 3OPTA 1ENSA 2Q1MA 2BFUS 1IS4A 1EAH3 1WD4A 2E9QA 3ZMNA 4J1XA 3ZYBA 1WCKA 2WT1A 5L7OB 5CBLA 5C70A 1VMFA 1UZWA 2PHUA 2VTXA
chains in the Genus database with same CATH topology
2WNUB 1RVF1 3GNEA 3TWIA 3DF0A 4KG8A 3NJZA 1DQ6A 2YGMA 2D40A 1AX1A 1JUHA 4A2UA 2GMEA 4BWOA 4N9HA 2GU9A 2O0OA 2OW4A 5KC5A 2K0GA 1TME2 4Q0QA 1J3RA 1ZBA1 3PVBB 2AR6A 1D0GA 3GYDA 4R9DA 5DG2A 3VKLA 1N3PA 2QFEA 4IV1A 4Q8LA 4GMP0 1BEV2 4MXWB 5JIAA 2XJQA 2D6MA 2HYKA 2XG3A 4N7IA 2YMZA 3ZN6B 2CWMA 4FP3A 2PLV1 1CONA 1AYN1 4ISQA 2QUOA 3AB0A 4N43C 4MYEA 3SH4A 2R1BA 1R083 2ARXA 5DUVA 1F31A 1ULDA 4BLJA 1QQP2 1QHDA 2VNOA 4QPYA 4YZ4A 4HVOA 5J09A 1ZBE1 1CAXA 2EXJA 3TOJA 4Y1VA 5F6LB 3ZFFC 5FTTC 3ZSLA 3VBFB 3JB4C 1KITA 1RUF2 1BBT3 2V5YA 5L7OC 1HRI3 1NOVA 4YGCA 3WQ0A 1Q8QA 3A4UA 2C9AA 1JTZX 2HWC1 2WNUC 1NLRA 1QOSA 4Q4W1 3VZLA 3LA3A 1AL0G 4AQSA 5LEKA 3N7MA 1AR72 3AMNA 3KCYA 2IZWA 2OUJA 4IXLA 3HWJA 1AR83 1WW7A 5JZGA 2BUKA 3V64A 4EN8B 1FNZA 1J1TA 4M0NA 2QE3A 4FXKB 1QNWA 3O14A 1GZ9A 1WMFA 2P3IA 2DYCA 2WSVA 4OULA 3KT4A 4XFFA 1QOTA 2Q1ZB 3PVEA 3D4KA 5D8AB 4BMEA 3POYA 2YV8A 1SBEA 3THPA 4UW5A 1CR7A 4AI1A 3WUCA 1QNYA 4EN7B 2O8QA 5SV5A 3ZFGA 5C9AA 4FPEA 1WA4A 1XNDA 3AKQA 4GWMA 2ZPXA 2IXJA 4Y4YA 1U0AA 3H8UA 3KGLA 2D7FA 4AI3A 2UWBA 1Z7S1 2WL1A 3L2HA 1WLDA 3NKGA 3VKNA 2D3SA 2ET7A 3SISA 2P17A 1D0HA 2ZZJA 2BPA2 2O1QA 1OQEA 3GHMA 1QOOA 3M2MA 3VBFC 1UKRA 5GZCA 3GF6A 1G9DA 1FPN1 5JMCA 3USUA 4XXAA 4AEDB 2R062 2WIIB 4DRRA 1OA4A 2CTVA 3KCCA 1KDKA 4OVEA 4EJRA 1EV12 2FZ2A 4C91A 4L97A 4MGZE 3IWZA 1ZYBA 2H0VA 5JSPA 1WLCA 3RMXA 4WVWA 5IT6A 3BOPA 4EV0A 3VKFC 4CDWB 4N53A 1YO8A 4Y26A 1PVC2 3CEWA 3I2DA 1RUH3 3O5SA 4YRDA 1RUNA 1CPNA 3AP4A 2EF6A 3VBSA 3WDYA 2JG9B 4OZXA 5D8AC 3KD4A 1F8VA 1DGLA 2E6VA 1H8TB 5EFUA 5T50A 1HIXA 2E7QA 4FOYA 2PHLA 3KSCA 5SV8A 1DLLA 1WCSA 4GKXA 5A33A 4Y1ZA 2K2SA 4P14A 4C0BA 1ZZBA 4I30A 5K8SA 4K8FA 5GALA 1PO11 3MFCA 1LOBA 3RJ2X 2ZGNA 4HVRA 4HSLA 2GH8A 1AF9A 1WLTA 4DOUA 3RYRA 3MEPA 4LBKA 2QQPA 4QQPA 3M4FA 3WP3A 3IPVA 1O4ZA 3I59A 3FX3A 3B7MA 5F1RA 4AEDC 2WWSA 1VBB2 1C1FA 1ASJ3 3ME2A 1GICA 5I0TA 5K7PA 1LR5A 1AR91 2HWD3 2R32A 3L9JT 1ENXA 1NA1B 1SACA 1POV0 1WMEA 4WM7B 4OI1A 3LGRA 1J3QA 3O0VA 4FOQA 2DVGA 4FO9A 2JJ6A 1FT9A 1MZ5A 3JQXA 1OOPA 4LBMA 1CAUA 3J9SA 1QJU3 4XFIA 4FBFA 4CDWC 2EAKA 3B9CA 3AP5A 3VV1A 1SMVA 3D5OA 1MZFA 2F4PA 3VHOA 3BU7A 3AM2A 1LOCA 5BPXA 4XIOA 1PGSA 1U5XA 4GQ7A 2JG9C 3QCWA 1H8TC 4D3WA 1ONAA 3ACLA 5IK5A 2XJTA 2BW8A 1XE8A 1PK6B 3E6DA 4LBLA 4XYXA 2WJSA 3AMPA 4H3WA 5C8CC 5I91A 4H55A 5J48A 1NXMA 2VH9A 2ZMNA 5JI7A 3WP4A 5ACA2 1VBA3 2A3XA 1YUDA 4YVWB 2ZCWA 3BB6A 2Q8OA 2WQ4A 1LKNA 5JPNB 2QNKA 3OGGA 1C5IA 4M0HA 1RJ7A 2EVXA 3JD73 4NWWA 2WKKA 4GXLA 1RUG2 1C4RA 1AUYA 3WG2A 1RUOA 1LOFC 1AR61 2E51A 1G8WA 2BTVC 5AC93 2C1FA 1OA3A 3WG3A 1ZX5A 5IK4A 1NA1C 4Q1RA 4WM7C 3SITA 3ZX7A 3M1HA 1XYNA 4YLZA 1JOJA 1QF3A 3TBDA 3VBHA 4QGMA 3RMYA 3WP6A 2BEOA 4C90A 3GZAA 1ENRA 3MDPA 1JN2P 3POSA 4E4DX 4GMP3 4LO4B 4UBGA 1GKBA 2WS92 3VLBB 2D6PA 4Q8KA 3JB8A 3ILFA 2UY8A 2NYYA 2DTYA 2RS31 5F5QA 3SH3A 3W59A 1R1A1 1PK6C 5FBZA 5GJ6A 1MS1A 1PIV1 4YM2A 2JEMA 2ATFA 1AVBA 4IQPA 2HJIA 2RR12 3USSA 4YVWC 2TEPA 2VOVA 1NLSA 3BCWA 1XNBA 1HLCA 4P9IA 4Q4Y2 3OYWA 4RS5B 1UMZA 3THTA 1HQNA 5I8TA 1Y9QA 4URTA 4V1PA 2GH2A 1KD7A 3N7JA 2ZGLA 2DV9A 1LCLA 5DG1A 3WHTA 4B4QA 1QU0A 4AVSA 1QDCA 3FLTA 2ZMKA 4FOWA 5KBFA 1TME1 5KWRA 2EA7A 5CIRA 3VHRA 2JDZA 2ZGPA 4I3PA 3IKWA 1I1EA 2DWRA 1H8VA 4HVQA 3H3UA 1Z0HA 1V6KA 3B3QE 5I93A 1MQTA 2WZR1 4AQ6A 4Q1PA 3AZXA 5K0UA 5HCFA 2GNDA 2PAEA 3ZXFA 2CWSA 1EAH2 1GLHA 1DFQA 5BNPB 1AHSA 2XGXA 1K5MB 1NZCA 2Z69A 1JH5A 1S55A 4M3CF 4XFBA 2DVFA 4FPFA 4XQWA 5EYYA 5FCCA 5GKAC 4YZ1A 1QQP1 1FMD3 1E57A 3J8F3 1LTEA 4RSUA 4MGIE 2G4IA 2ZAAA 2ZGMA 2ZHKA 2PA7A 1ND3B 1H0BA 1GYKA 1SBFA 4OI4A 1SLBA 2LALA 2WFF1 1RUF1 3WDTA 1LHNA 1S0EA 1OHFA 3DN7A 4KGGA 4Q4X3 3MIHA 3WG4A 4HETA 1LOGA 4JGZA 4R9BA 4IV3A 4RS5C 1DBNA 4XF0A 2ZA9A 1TE1B 3AK0A 5GLUA 4P9GA 3VKOA 1BZWA 3H1WA 1LULA 4Y5Z0 1AR71 4XJAA 3VZOA 3LOIA 1W6PB 4FSJA 1A8DA 2OA2A 2YYOA 4U2AA 2BFUL 1NCRB 3GBFA 4IV3B 1ZREA 1I9RA 4QPIA 3ST7A 2H6BA 4AFBA 1GZCA 4GH4B 2D5HA 1Q5OA 1GZWA 3ELNA 3PJQA 5H9SA 2X5IB 1AJKA 4PCRA 1CQ9A 1VB2A 5E16A 4ATEA 2ZHNA 4HPKB 1RUI3 3GALA 4BH9A 3C2UA 3R4DB 4DS0A 2NPIA 2BWAA 2MHFA 3HD8B 1D4M1 5BNPC 3CJIB 3ZYGA 1Q3EA 4E27A 2NM1A 1HRI2 3MF6A 4CTEA 1DGWA 1TMF3 5FREA 4QPGA 1K5MC 1PZ9A 5GZDA 3NSTA 1RJ8A 4H14A 4XJ9A 1YJKA 2D6OX 1BKZA 1WW5A 2IXIA 4QQHA 4Z1VA 1CVNA 2I45A 3BPZA 1ND3C 1AR82 1UCXA 2D43A 2X8KA 5KXEA 3MICA 1HQWA 3ATGA 2HWB1 4AVCA 3CLPA 2CYFA 4AF9A 2WNEA 2CAVA 2K9ZA 3ILNA 4K40A 4YM1A 3ALQA 3ZYPA 3FBYA 4QHBA 2PAMA 5H9PA 2R061 5DUXA 4AQTA 1MZ6A 2E53A 4OHYA 5CG9A 1ZZ6A 1EV11 1RUJ3 3GZUC 3KS7A 2GDFA 5D1IA 1VALA 2Y38A 4JGYA 4XBQA 3MIGA 1O5LA 2BYVE 1NCRC 4IV3C 1BVP1 1CAVB 2XJRA 1SLCA 4ES8A 4LBNA 3GHNA 5DZFA 5JPMB 4GH4C 1R1ZA 1PVC1 4JTNA 5JR7B 3JBG3 4GWNA 4G9SB 4UW4A 2X5IC 1AR92 4JGYB 1FV3A 3RG0A 4OI2A 2VW0A 5IK7A 2RMU2 4P9JA 2JG8B 2ZGQA 4XXPA 1WCDJ 3CJIC 3MLKA 2CGPA 4AHXA 2V09A 5GZGA 1TQ5A 1JHNA 3WXPA 4EROA 1I3HA 1H9PA 2N7GA 3ETQA 2FHRA 1S0BA 3HBZA 5T52A 5TSWA 4YGDA 2VPVA 2ENRA 3VBOB 1WW6A 1COV3 1CJDA 2DU1A 2XHKA 3AZWA 3WG1A 3WY6A 2XPJA 1AL23 1HX6A 3W58A 4OHWA 1OI6A 4CEWB 4XPVA 1VAMA 3AYAA 1H1IA 5DZEA 4AFMA 2RS53 3E5UA 3ZXGA 3SMHA 3S7EA 1FOD3 3WT3A 3KLSA 1VBB1 2Y0OA 4WVMB 2HEWF 4D69A 2OPKA 2UU8A 3VBRB 1R091 1ZZ7A 1MVEA 1YCIA 4AVVA 2ZHLA 4OUSA 2ZTNA 2EXIA 3M3OA 2EAAA 1DDLA 3WCRA 4KNCA 5T5LA 3MPPG 1DGRN 4XJWA 4AGRA 1G9AA 4A7YA 1PMIA 4XBLA 1NQDA 1MS9A 4JGYC 2ZGTA 4GIQA 3RYKA 4LLOA 5A32A 2QZ3A 1KJLA 5FFOC 2JG8C 3POWA 2WSUA 2HEVF 1ZBA3 4OLLA 3KM5A 4N43A 1NE6A 3SNMA 5JLVA 4K1ZA 1ASJ2 1DQ2A 2ZMLA 4PLMA 4AFDA 2HWD2 3WP5A 1X36A 2DVDA 4AVAA 4DNYA 4S2FA 1LEMA 2GC0A 2OIIA 3H50A 4NN0A 1ZVFA 4LO7A 4DXZA 3VBOC 1AYN3 4YW2A 1C28A 1GQGA 1RMU3 1QJU2 3WW4A 2R1DA 3N7LA 4CEWC 5L7OA 4FTBA 1PIV2 4IEOA 4R8HA 1LESA 4NVPA 3O0WA 2ZX4A 2YDEA 1XRUA 3LA2A 1AYM3 3NL1A 1QJY1 2D6NA 4LA2A 4BLIA 5JOWA 3VBRC 4C1XA 1YIFA 2E63A 1G7YA 1SCSA 3FJSA 2H6CA 4W6WA 5FRAA 3KCXA 4JQRA 1NE4A 3X29B 1PGW1 2ZACA 4MV2A 1NYWA 1U5YA 1OLRA 1AXKA 2HWF3 3IN9A 4Y24A 2BQPA 1JW6A 4HLTA 2VUAA 4AGVA 3ILRA 2PELA 4U36A 4MXWA 1J3PA 1UZYA 1AX2A 1EPWA 3CU7A 2WS91 4WZFA 3ZN6A 2EIGA 5J98B 1PNFA 1S0DA 4Y1UA 2MPFA 1BK1A 5K9YA 1SLTA 2WZR2 4AW7A 5J36A 4J6GA 2QCSB 4FVVA 2WFPA 1OLQA 1YFWA 3KT7A 2RE9A 2MNGA 5BV6A 2VULA 1B35B 2A6WA 2MEV3 3HT2A 3APBA 4AI8A 4IERA 2GMMA 2RR11 4BM8A 4Y22B 1WGPA 4NHLA 2WT0A 3VBFA 4Q4Y1 2PHWA 3UKVA 2LTNA 4CRQA 2VOXA 2B7YA 1NG0A 3LOBA 2ETEA 4AHYA 3H0OA 3V56A 4E2SA 2JX9A 3AKPA 1PO22 4W6YA 1SLAA 1H1AA 2WFF2 3U0ZA 1BMV1 3WD5A 1QMJA 5FOBB 3ZYJB 1V9U3 4BIOA 1N1YA 1FPN3 3E6CC 2A6VA 3LSDA 1Q8OA 2GC3A 4BIFA 5KHJA 4I0WB 3D0SA 3MW2A 2WZPP 4TZDA 3B01A 2LUWA 1XYOA 3ZXLA 2OUHA 3FHIB 4MH0E 4YZ2A 4M3CA 4MX3A 1EAH1 4D7TA 3PMEA 1V6IA 1W39A 2DF7A 5KHHA 5D8AA 3E97A 1T6GC 4P9LA 4L99A 1WW4A 1H2KA 2TBVA 1D2QA 4M3CB 3WW1A 2XKPA 2ZGUA 3P3NA 3SXWA 4YW5A 2CY6A 2I74A 2PN5A 1YRZA 3KT1A 2XLFA 4NR1A 4LHKA 2I07B 2UYBA 3JUUA 4PJYA 1D4M2 5CAZA 1B35C 1YYNA 3GBWA 3MPBA 3WQ1A 1D4VB 1MS8A 4INDA 2DCZA 4Q0VA 4RD7A 2B45X 1VBE3 5E88A 1U5ZA 2YPJA 1RUD3 3S7IA 4S2DA 4TLFA 1PGL2 3SH5A 3WZ1A 5BUVA 2ZOEB 1ULEA 1PO13 3AZVA 4AEDA 5FQ0A 5FO9B 1IS3A 4SLIA 1LGBA 1GQHA 1UU4A 1ZRDA 2HWB2 2D97A 2F6BA 3AYDA 3HAGA 3L2YA 1RHI3 1RTVA 2R30A 4CDQB 1WBFA 2A70A 2AYHA 5FQ0B 4QM8A 4RGAA 3OCPA 1ZRFA 5GLVA 1FMD2 1FXZA 2A71A 1X8EA 3J8F2 4CDWA 4HN0A 2GMPA 3EJKA 2Q0AA 4FQ4A 1RUC3 3TN93 1FAYA 4Q2FA 2D44A 3CNAA 1YWKA 3G6JB 2QKDA 2VVFA 2JG9A 4FQZA 5H9QA 5GZFA 1BBT1 1QWRA 4JDOA 1ND2A 1HRI1 1HV0A 4NHKA 1H8TA 2XWJB 1UL9A 4XFGA 1CX4A 5F6KA 4E2GA 1DZTA 1O4YA 3UJQA 5KXDA 4AHZA 5C8CA 2IXHA 1IKPA 3OTFA 4UXAA 1O3QA 1V6JA 1LHUA 1G9FA 2YROA 1ND2B 3FUOA 1AR81 4K9SA 2A5ZA 1H2LA 5AFEA 2Z2SB 4B4RA 1KRIA 5GZEA 2UWAA 1NY72 2XLGA 3AZZA 1N1TA 3QLQA 2OYZA 5C8CB 5T5PA 1VBC3 2DU0A 2VVDA 3T1MA 2GC2A 3M70A 1IOAA 2DCJA 1VBD3 3DL3A 1QXJA 2XVKA 4B4PA 1RB8G 1KXGA 1HXS2 5CA6A 1LOFA 1MEC2 4DY5A 4E9KA 4IEQA 4Z82A 4ZU7A 4QT6A 1NA1A 3WDVA 2PHDA 3D0JA 4WM7A 1TMF2 3GZTB 2BGCA 1Z78A 1WMDA 3AZYA 3OBRA 4JDNA 4QQOA 1A3KA 4CDQC 1NCQB 3ASIA 4LEJA 2G9FA 1O7FA 4LO6B 2ERFA 1KDMA 3EO6A 1R092 1O3RA 1MACA 1C8M2 1YHFA 2XL9A 4I3GA 1DQ4A 3RRDA 4AXOA 4IEWA 2RMU1 1Y7BA 3RZZA 3ZYIB 3OPZA 5DDJ2 2W0XA 2GZWA 3AX4A 3ZSMA 1REFA 4KWJA 2W08A 2ZHMA 2XL7A 1VR3A 1FX5A 2CGOA 3A0KA 4PQ9A 1PK6A 4F83A 3FLPA 5CB7A 2UYAA 1XNCA 1IPJA 3S0MA 1RUJ2 1VAKA 2B42B 2I2SA 3WDXA 1ZZ9A 4ASMB 1ND2C 2A75A 1IKQA 3R05A 4X8NA 4YVWA 5E89A 1C3HA 3FFQA 3K48A 1R1A3 3VN4A 5C8WA 2R16A 5ABJA 1S0JA 1S0GA 2P2KA 2ZX0A 2C5DA 4P9WA 5T5JA 2QVSB 4JAAA 3Q9OA 2JICA 4Z07A 3WHUA 2WINB 1Q8PA 2Z79A 4BE3A 1HKDA 3MF9A 4YFZA 5JCTA 5ABJB 3CL1A 1AX0A 4N90A 5FLIA 1X8MA 1NCQC 3TAYA 5KXCA 2R49A 3D6EA 4A3XA 1F2NA 1QJY2 2VW2A 4Z2WA 4XF9A 5FAXA 4UW3A 1COV2 1GV9A 4XILA 5JVVA 1AL22 1TME3 1N1SA 5C4WB 5JIUA 1PGW2 5KHKA 1UPIA 3HR9A 4Y1YA 2RS52 3V0BB 5FDBA 1FOD2 1REDA 4NWVA 1DU3D 4Q0SA 5AVPA 3B00A 4OHZA 2Y0IA 3D82A 4H7MA 1ASJ1 4Q27A 2DURA 3VZMA 3QH6A 1O3SA 1LHOA 4WM8C 2HWD1 1OQDA 4ONUA 2ZGKA 1BEV3 4PIYA 1VJ2A 5GM0A 4AFCA 2VNGA 1GSLA 4RHV3 4S2GA 2ZX2A 2ZJCA 4BQ1A 1QJU1 4DPNA 3TRSB 2NP0A 3DPRB 4XQDA 4RS5A 3M3QA 2XJPA 4LNVA 1DZQA 1ULFA 4DINB 5CG8A 3M8LA 1Q43A 2FMYA 3NVCA 4XHXA 3WCSA 1S2KA 4Q4V3 2GSYA 5BNOB 1RUF3 1RL3A 3AMHA 1U5IA 2SLIA 5JOXA 2P3JA 4JDMA 2DCTA 5ABJC 4JRAA 2KXLA 3RJRA 4ZXKA 2R042 1BMV2 1GNZA 2IWGB 2EALA 1IGOA 2RM23 4JC1A 1V6NA 1RUE3 4COUA 5BNPA 1W6OB 3JD71 1NXD1 3OY8B 5C4WC 1K5MA 3A0NA 3FC0A 4XOGA 4JTOA 1UIJA 4COVA 5AC91 1L3JA 5BNNB 4LULA 4TYSA 1ND3A 2P34A 4BPZA 3RYPA 3UV9A 3VL9A 5FO8B 5LRSA 1UPSA 1V6MA 1VRH3 2GNBA 1VB4A 2XBO3 3AJYA 2ILMA 1IZ3A 3DPRC 4FXGB 4WVVA 4EWDA 2HWF2 4PBPA 2VY0A 4LHNA 3H7JA 4Q26A 3B93A 1PO21 4GMP1 4OHXA 2R073 5B2GB 1SFNA 3LB9A 2NQYA 1W6PA 5BNOC 1NCRA 1YFYA 2CL2A 1OFNA 2A3YA 1Q8SA 1LU1A 3CF6E 3GBGA 1AJOA 3SLIA 4GH4A 1CD3G 4HN1A 5F9TA 1B09A 3IM0A 5J96B 3IBMA 4AQ2A 3VGIA 4GB33 2X5IA 2MEV2 3O7OA 1ZM1A 1LEDA 4IEPA 1J58A 3WOGA 4IEYA 1FYUA 4HPKA 4AI2A 1OQ1A 4P5HA 3NAPB 2JXAA 1R082 1DG6A 1GANA 1MR5A 3CJIA 1URXA 2FBEA 2WT2A 4N9IA 3WDWA 5HCAA 5JAXA 2BBVA 4KGQA 4BHPA 2B5HA 2VOKA 4JV4A 1QKQA 3PMSA 4KL1A 3ZIXA 2WNVB 4W6XA 3U10A 1KJRA 2IXLA 3G7DA 3WR0A 5EJ3A 2IC1A 3WX5A 5BNNC 1BBT2 2BNMA 3TYJA 2D6KA 1V9U2 4WZCA 5J3UA 4DQAA 4I2OA 1C8NA