3NJZA

Crystal structure of salicylate 1,2-dioxygenase from pseudoaminobacter salicylatoxidans adducts with salicylate
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
364
structure length
364
Chain Sequence
EKLDHESVTQAMQPKDTPELRALYKSFEEESIIPLWTQLGDLMPIHPKSKAVPHVWKWSTLLRLARKSGELVPVGRGGERRALGLANPGLGGNAYISPTMWAGIQYLGPRETAPEHRHSQNAFRFVVEGEGVWTVVNGDPVRMSRGDLLLTPGWCFHGHMNDTDQPMAWIDGLDIPFSQQMDVGFFEFGSDRVTDYATPNFSRGERLWCHPGLRPLSGLQNTVASPIGAYRWEFTDRALTEQLLLEDEGQPATVAPGHAAIRYVNPTTGGDVMPTLRCEFHRLRAGTETATRNEVGSTVFQVFEGAGAVVMNGETTKLEKGDMFVVPSWVPWSLQAETQFDLFRFSDAPIMEALSFMRTKIEGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Gentisate 1,2-dioxygenase
publication title Crystal structures of salicylate 1,2-dioxygenase-substrates adducts: A step towards the comprehension of the structural basis for substrate selection in class III ring cleaving dioxygenases.
pubmed doi rcsb
source organism Pseudaminobacter salicylatoxidans
total genus 102
structure length 364
sequence length 364
ec nomenclature ec 1.13.11.4: Gentisate 1,2-dioxygenase.
pdb deposition date 2010-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3njzA01
4HSJA 5AVPA 2CV6A 5I93A 1DZTA 1YWKA 2XHKA 4MV2A 5FCCA 5I8YA 3IDBB 1JUHA 1TQ5A 2OYZA 1QY4A 2MHFA 2Q0AA 3D0SA 2UYBA 2K9ZA 4PIYA 3MZHA 3UKNA 3LZZA 3H1MA 4LA2A 3FE5A 2PTMA 5KHGA 2GH2A 3H1WA 1RUOA 2PHDA 2BNMA 3E5QA 1XE7A 4K8FA 4AQ6A 3FFQA 2ETEA 4EWEA 3ZDSA 3FWEA 5I0TA 3ROUA 4BH9A 1YFUA 3E6DA 2E9QA 3H3ZA 4IEQA 3L2HA 4E2QA 1ZRFA 1ZZCA 4LLOA 3LA7A 2GC2A 3OF1A 4BIFA 1EP0A 1ZVFA 4XF4A 3RDIA 1EYBA 5LRRA 4IEYA 4O9GA 4RD7A 3H8UA 3I59A 4WVZA 5I8TA 2KXLA 4I3PA 2ET7A 4QX5A 4Q0VA 4R52A 4IEUA 4TLFA 3IDCB 4XFFA 1FI2A 4KWJA 5KHJA 3FZ3A 1O5UA 4QGLA 4O9EA 1CAVB 4XF3A 3BB6A 1UW8A 1CAXA 1RC6A 4META 5F1RA 4Q0SA 4HSLA 4I0BA 5LRSA 1O3QA 1GQGA 3MPBA 5BXXA 4ZU4A 2XLFA 1FT9A 5J3UA 4ZU5A 5CADA 4E2GA 4XF9A 2D40A 3E6BA 1U12A 2N7GA 1NE4A 4FAHA 4IEOA 4J1WA 2Z2SB 3RYRA 5JCTA 4LTAA 3NKTA 4ONUA 2B5HA 4B29A 3WW1A 4R8HA 1SFNA 4H7LA 1CAUA 3U0ZA 3S7EA 2CGPA 5EZWA 4E2SA 2IXLA 2H0VA 1O3SA 1J58A 3OGJA 1ZNPA 5I0SA 2OZ6A 1H1MA 1PM7A 1DGRA 3KCCA 4MGIE 1RL3A 1NE6A 1J59A 1UIJA 1LB2A 4I01A 2F4PA 1EPZA 3WW2A 1NXMA 2QJVA 3H7YA 1O3RA 1IPJA 2BEOA 3H9AA 4AXOA 2Q1ZB 1RTVA 1O7FA 3RYKA 3SXWA 1DZRA 3RYPA 1FXZA 1WA4A 5FLIA 2B8MA 3QACA 3BPZA 1X8MA 4I09A 5KHHA 1OFNA 1PMIA 4I2OA 4JTOA 3ST7A 1VJ2A 2IXCA 4IEVA 2PYTA 5FLJA 2GAUA 2OA2A 1DGWA 1J3RA 4LUMA 1CAWA 3H50A 3NW4A 3SMHA 3CF6E 5FDBA 4GULA 5J7MA 1UPIA 4EWAA 2IXHA 4KWKA 1J3QA 5KBFA 5KHKA 3RPQA 3EHKA 3I59B 1LRHA 1Y3TA 2C0ZA 1G6NA 3CEWA 2Q30A 4J1XA 2MNGA 4JV4A 3S7IA 3N4MA 3R6SA 4N9HA 3UKVA 4AVBA 5I91A 2PQQA 1L3JA 4UXAA 5C8WA 5LEJA 3GBFA 3DV8A 1RGSA 3GYDA 3LOIA 2XLGA 3EBRA 1ZZBA 4MUVA 3S0MA 2OPKA 3ES1A 1XE8A 3FHIB 4IEXA 5FQ0A 4MGKE 2H6BA 1WLTA 2ATFA 3OTFA 1O4TA 3SCFA 3BALA 4I0AA 1IPKA 1OMIA 4KWLA 3U11A 4XFIA 1ZZ9A 2UYAA 1GQHA 1SQ4A 2XKPA 1XRUA 4LULA 5LEKA 3PVBB 1ZX5A 1X8EA 5C6CA 3BU7A 1YUDA 4X6RB 3JZVA 2VPVA 2HJIA 3RNSA 3E6CC 3PLQA 2BNOA 4JTNA 4BHPA 4WBBA 5JSPA 3SCHA 4QM9A 1UD1A 3I54A 2UY8A 3NVCA 1Q3EA 1WGPA 5E1RA 4FAGA 1YHFA 5BPXA 2GC3A 1CAUB 2PFWA 5KHIA 4D7SA 3KGZA 4KL1A 1NYWA 2CAUA 1Y9QA 4XETA 5JR7B 2K0GA 4Q0PA 4YRDA 3H7JA 1YLLA 2EVXA 3DKWA 3EQEA 2VQAA 2Z69A 5FPXA 1LR5A 3HIFA 1CAVA 4LEJA 4XF0A 1X82A 4YARA 3OD0A 4HVRA 2XGXA 2ZCWA 4LUKA 1O3TA 2O1QA 2DCTA 3PNAA 5BV6A 4MGYE 2ZKLA 1HW5A 3KSCA 4MX3A 4FT8A 4XFCA 5JSRA 4NVPA 4CYDA 4QGNA 3O14A 5JAXA 1CGPA 3NL1A 1EY2A 4Q0QA 4MZUA 1H1IA 2XL7A 2Q4SA 4PJYA 3SHRA 1YFYA 4N9IA 3ELNA 1SEFA 3KMHA 4QMAA 5HI0A 2PAKA 2XLAA 5BY5A 2XL9A 2GZWA 3IWZA 4FBFA 2WC2A 4MH0E 3EJKA 3HQXA 4F8AA 1ZREA 1X7NA 5I0RA 2QNKA 3EO6A 4AVCA 4AQ2A 2OZJA 2GC1A 4IEZA 5CVRA 1I5ZA 1QXJA 4HBNA 4DINB 2EA7A 1QWRA 4MGZE 5I0UA 4L11A 2FMYA 3MDPA 3USSA 4X6QB 2IXKA 4HVOA 4IEWA 4IETA 2H6CA 3C3VA 2BGCA 2O8QA 4A2UA 4Z07A 3FJSA 3ACLA 4HN1A 3H1YA 4XFHA 3LAGA 4WZCA 4YYOA 2FQPA 3CL1A 4EV0A 3FX3A 1OI6A 2QDRA 5FQ0B 5J48A 4HZFA 1ZZ8A 1J3PA 2I45A 5K8SA 2P17A 1ZRDA 4L2NA 5FLHA 4XEZA 1Q43A 2QVSB 1RUNA 2PA7A 2QCSB 4QXKA 3LA3A 4F7ZA 3LWCA 1NZCA 1CAXB 2IXJA 3D82A 5T3NA 5E16A 4PIZA 2VECA 4HVQA 3M3IA 2CAVA 4D7TA 3CO2A 1YFXA 4UBGA 2BNNA 4PIXA 3WW3A 3QOPA 4OFGA 3WW4A 2EAAA 2D5FA 2GC0A 4KU7A 4XFAA 3DN7A 1QXRA 4AVAA 3E5XA 2B9UA 3CLPA 2ET1A 3DL3A 4XF1A 1UIKA 4HN0A 3NJZA 4YNIA 4YSFA 5CU1A 2PAEA 2MPFA 4JVAA 5FPZA 2BYVE 5D1IA 2PAMA 4QM8A 3MYXA 1Q5OA 3ETQA 1VR3A 5JSOA 3LA2A 4UBHA 2XKOA 3KGLA 3BCWA 4OLLA 3HT1A 3CJXA 2UY9A 1LKNA 3E5UA 4EWDA 3IIAA 3IBMA 2IXIA 4QGMA 3HT2A 4EROA 4ZU7A 1ZZ6A 4I02A 2GU9A 1ZRRA 2D93A 4XFBA 5EFUA 3TNPB 3RZZA 2PHLA 3ES4A 4Z82A 2HKXA 3SCGA 4Q29A 4IERA 4HMZA 1ZZ7A 4Q0UA 4LA3A 3G7DA 2Y0OA 2WFPA 3U10A 1I6XA 2IC1A 4HLTA 3UKTA 3B02A 1CX4A 2V09A 1O5LA 1YFWA 2D5HA 4IESA 4IEPA 3TNQA 5I8SA 1VP6A 3E97A 3NSTA 1UCXA 3D0JA 3VHRA 1CAWB 3M70A 4KU8A 4ORFA 3I7DA 1V70A 3OCPA 3H3UA 4BYYA 4XFGA 1J1LA 1ZRCA 5BUVA 4P9GA 1OD5A
chains in the Genus database with same CATH superfamily
2VZVA 3POGA 5FMDA 5GLZA 4OULA 1F4AA 5I93A 1C4RA 1QGLA 5ANNA 5A1LA 4M3CA 2XHKA 4MV2A 3RZGA 1LENA 3FMGA 1JUHA 2Q5TA 3IDBB 1TQ5A 4GD4A 4YG6A 5JPNB 3P5BA 3ZFGC 2JB8A 1RUH2 2RJKA 2QZ2A 1VRH2 3DPRB 2UYBA 1QQP1 3GDBA 2K9ZA 3WDTA 2FZ1A 2XUMA 1H6YA 2NM1A 3LZZA 3R05A 3H1MA 1OH3A 5CEHA 3O7OA 4LA2A 4QB2A 2GDFA 2PTMA 3KS7A 1JS9A 1MS1A 3J7HA 4CEWB 2GH2A 3H1WA 4WM8C 2ZEZA 4OCTA 3ZXDA 4CCJA 3ZXLA 3IPVA 4IV3A 2YPJA 3ZFEC 4Q4W3 2ZX0A 4AQTA 1AVBA 4PLOA 4XILA 1VBB1 4O7XA 4EWEA 1FYUA 1OHFA 3C7FA 2V5YA 3ROUA 3T0BA 3MICA 4CDXC 4J6GA 2VC9A 3H3ZA 2ZGQA 3J7NA 3HNBM 2HWC2 5FAXA 4PI0A 2GMMA 3LA7A 1XJAA 4YGCA 2RM23 4Y1VA 2W94A 3AP9A 5T55A 4JZRA 4GH4A 3ZN4A 4XF4A 3ACHA 1RUF2 5ABJA 5HPOA 4J25A 4DXSA 3WF3A 2VZUA 1AR62 2P4EA 4XPVA 1KJLA 2VMIA 4XDQA 3I49A 1VB4A 4FPLA 1XNBA 3IN9A 3H8UA 1GZTA 4QXHA 3SITA 3THTA 3HQUA 2BJSA 2VG9A 2K2SA 1NLSA 1XC6A 4LE3A 1CN1A 4FQZA 3A0NA 1HB3A 1D2SA 1D4M2 4Q0VA 5JVVA 1BJQA 4TLFA 2VW0A 4LO7A 3UYJA 5FYYA 4EZ4A 2V5DA 1PO22 3NNLA 4XFFA 4NIAA 1MPXA 2AACA 4LITA 3FZ3A 2GN7A 4QGLA 5F37A 4O9EA 3WP5A 1T6BX 4OI4A 1IKPA 1C5HA 1ENRA 1G7YA 2EXKA 4OUSA 5FIXA 4CUGA 1ULPA 4MVTA 5FREA 5F3EA 3VKFC 1OT5A 1C57A 3OJBA 1ASJ3 3ASIA 4FOVA 3OPZA 1ENSA 1SBDA 4Y20A 5FO7B 4CU7A 4META 1ALYA 4Q0SA 1O3QA 4I0BA 1YO8A 2B7YA 2PELA 2HWB3 3MPBA 2HEWF 3OG2A 5BXXA 4AGRA 3G6JB 2FDJA 4ZU4A 4SLIA 4N7UA 4Z8BA 3C7OA 1FT9A 2YMZA 1HRV3 1UY1A 4JDMA 1JHNA 4RGAA 5CADA 2RMU1 4XF9A 1YIPA 2VD7A 1RB8G 5KXCA 1NE4A 3O1SA 5FZ1A 2CDPA 4JX0A 5JLVA 3H8RA 4DUXA 1SCSA 2Z2SB 1WMEA 4C91A 3VDDA 5EP9A 3WNNA 3PIGA 4A4AA 2BBVA 4LTAA 3MW2A 3N9LA 2VZRA 4N43C 1JOBA 3OB8A 1ODNA 4ONUA 1UU4A 2B5HA 2E26A 5FPAA 4LBNA 1UO9A 4H7LA 3U0ZA 2JX9A 5F5QA 1OC1A 1HJFA 1NA1A 1S4CA 2OUJA 1HXS2 4CVUA 5BNNB 2A6WA 3VHPA 3B3QE 2ZAAA 4PDWC 1KFXL 4QQ2A 3OD4A 1W6OA 4WVMA 5APAA 1CPMA 1H1MA 3CBNA 4YG0A 1PM7A 1WW4A 3GHNA 3VBSB 2EIEA 5F3GA 3ZPOA 1BKZA 4BOWA 1GSLA 3WCRA 4MGIE 4W6WA 3T2OA 4NIIA 4W50A 1NE6A 1J59A 3RS6A 4IV1C 1U5IA 5T5JA 2DBNA 1UIJA 3B00A 1LB2A 3CU7A 3OBRA 4QAWA 1RXGA 5GZFA 4CCNA 4EN7B 2VQTA 2ZXQA 3USUB 3WG3A 2QJVA 2L9LA 1IPJA 4QQOA 5IATA 2QQJA 2BEOA 3PUHA 3H9AA 2P6CA 4AXOA 4FO9A 5FWJA 3JQXA 1Z7S3 1DZRA 4N8MA 4ET7A 5JXHA 1WA4A 2B8MA 3QACA 3IAQA 2YDEA 4GB31 5JDBA 4I09A 4DMIA 4P08A 2WO7A 3WF0A 4JTOA 3AKPA 1R083 5GJ6A 5FK7A 4UFLA 1WBLA 5A32A 3ZSKA 4IEVA 2PYTA 1CWPA 3S5QA 3HMYA 1DGWA 4LUMA 4EZHA 3OPTA 2ZGUA 3H50A 1QNWA 2HEYF 2WUHA 3I2GA 4NUBA 3CF6E 1ZA4A 3M3QA 2VTXA 3OY8B 3JU9A 5H9PA 3ZXFA 5J7MA 1WW6A 3M3EA 1ENXA 1SLBA 5C5TA 2IXHA 1V6NA 4QKBA 4KWKA 4QPGB 4UI9L 4E27A 4DIQA 1QQP3 4Q27A 5KHKA 1SLTA 1G9CA 2OW4A 2WNUC 2AH2A 2Y38A 2XVLA 3I59B 4ASLA 1US3A 3HN1A 4LBOA 3UJQA 2WZR2 1YJKA 2C0ZA 3FBMA 3CEWA 2XWJB 3H8XA 2Q30A 2HWD2 3LSEA 2R7EB 1AR71 4J1XA 3VB9A 3I4IA 4JV4A 3K3NA 3R6SA 3N4MA 1MS4A 3KV4A 3LEKA 1L3JA 3D4KA 4JGZA 1YRZA 3C7GA 4UXAA 1VBB3 2B39A 2XONA 3L2YA 3D3AA 1ZZBA 2YV8A 2ZBJA 4QHBA 4E4SA 4LBJA 3ZR6A 5A3LA 5IFTA 4XE9A 3BYWA 2ZHKA 3ES1A 1H9WA 4XABA 2MEV2 4AEDA 3TN92 3DECA 3P3NA 5JZGC 2ATFA 2G9GA 1W6NA 3O0VA 1C3HA 2DCZA 3IDAA 1QJU2 1K5MC 4I0AA 2I07B 5L9BA 2W39A 1MZEA 1X36A 2OKXA 4IUGA 3AK0A 5GLUA 5DUXA 1ZZ9A 1GQHA 1DYOA 2ZGPA 3AYEA 3M1HA 1UKRA 5LEKA 2RDNA 2VZQA 1YQ2A 3NO8A 4YW5A 1HIXA 3THPA 3URFA 3I8TA 3HNYM 2VPVA 1ZBE2 4BJ0A 3T30A 3PLQA 2X09A 2KR2A 1SHWB 5F3IA 1BMV1 5J09A 4A7KA 4BHPA 4C90A 2W47A 4WBBA 4ES9A 1UNBA 1AR81 4LOSA 2WWUA 5F6LB 1UOJA 1W03A 3N9MA 2JDUA 3NVCA 3VZJA 3Q8FA 4NPLA 3WV6A 3M8LA 1JMUB 1PX4A 2WZ8A 1GOFA 2P3IA 3J8F2 1F35A 1GNYA 4YG3A 3VBRB 1YIFA 1HB1A 4KGGA 2GC3A 1R1A2 2VVEA 3WQ1A 1S0EA 3ZLIA 4D7SA 1EAH2 1LHVA 3T1LA 4KWUA 2ZGNA 3B5LB 1NYWA 5FXWA 1W0NA 1SBEA 3MIBA 4JDOA 1GZ9A 3MIDA 4DRVA 2VBBA 4BXFA 2GP3A 1UOBA 4HT1T 1OURA 3DKWA 3GGLA 4LBLA 4RHV1 4Q2FA 2PHTA 2Z69A 4E4HA 2HWE1 5FPUA 1CAVA 1J83A 2DVGA 1MS9A 1FPN2 1X82A 3MF6A 2RMU3 1AR92 4CCDA 2XDVA 1V9U1 2PQSA 3A0KA 4HVRA 5LBEA 4LUKA 4CCCA 5KC5A 1LOBA 2YGLA 5FXVA 3PNAA 3NNMA 3FUOA 4CDUC 1H4HA 1HW5A 4B7EA 3D5OA 4GJYA 4L0PA 4LOTA 4OYUA 1AYN1 4HKOA 1BEV2 2ZMNA 1LECA 5JR2A 4XZUG 3ZFFA 2YBSA 5L7OA 5IHRA 4QGNA 5FZCA 3V56A 2LRPA 3AKSA 4YW4A 1STMA 3T3YA 1CGPA 4PQQA 1EUTA 4I30A 5FZBA 4C0BA 1IKQA 3Q9OA 4CP0A 2Q4SA 5JWPA 1ULEA 1DU3D 3SH4A 2IWGB 4N9IA 2Y34A 3S57A 1UZWA 2G1MA 3PVOA 3KMHA 4QMAA 1VB2A 1XYOA 2PAKA 1GQPA 5IVJA 1VE0A 2Q8EA 1SG3A 3A23A 3AP7A 5DUVA 2ZGOA 4CUAA 5A3MA 5A6XA 3MEPA 1DZQA 1GWKA 4OUMA 3HQXA 2SBAA 2W1UA 3DXUA 2J1RA 1RMU2 4PLNA 4XYXA 4IV3B 3EO6A 2VMHA 3VUOA 3PUSA 4AQ2A 3WUDA 1MEC2 2AEZA 1DYKA 2R0FA 3AVRA 2GC1A 4WZFA 3KB5A 4LBQD 1E5HA 1W6QA 1I5ZA 3LPGA 3ILFA 3WF1A 2YZ4A 3HJRA 5T54A 3ZYPA 2UU8A 5FXZA 1DIWA 4YVSC 5G04L 1DGLA 2WFF1 5DABA 3P1IA 5A3WA 5DAVA 1EPWA 4GB33 2WNOA 4ZONA 3LB9A 4GH4B 4D0QA 2VL4A 2WR9A 2IXKA 1ZBA1 5ABJB 4FFIA 1VMHA 4Q4Y2 4HVOA 4YGBA 4ZHNA 4Y1YA 1LHOA 1VAMA 4XACA 1OF4A 1A8DA 2FMDA 3VL9A 1GR3A 1DQ1A 3NKGA 2SLIA 1NUKA 2FQPA 1W8OA 1ULOA 1S0FA 4K9SA 3FX3A 1XQNA 4BQ2A 3OGVA 4EV0A 5CFCC 2Y26A 4HK8A 4R9DA 2PHXA 1J1TA 2XJUA 1COV2 3DPRA 1KJRA 4RQPC 5LY2A 2VULA 3MV01 2DV9A 1CJDA 1H2KA 2P17A 3N7KA 2QBXA 2DCYA 4F3JA 1ZRDA 2GNDA 2WABA 2WNVC 3AVSA 3HVDA 4M4RA 2QCSB 1YEWA 1FV2A 4NROA 2D44A 4QXKA 4CEWA 3ZYJB 3B69A 3AL5A 4YM1A 3W58A 5D2AA 2AZ5A 3RSJA 3T2TA 2BDRA 3AZZA 1LAJA 4FFFA 3AFGA 1AR73 1VBC2 4Y20B 1OUSA 3WX5A 4UFKA 2VECA 1W8TA 3S30A 4NOTA 4XUNA 3W20A 5FZLA 1UMHA 2CAVA 1NCQB 1VAVA 1CZTA 2GSYA 4UBGA 4JRLA 1PO12 2OQ7A 4OFGA 5F5IA 1BBT2 1HQLA 2VNOA 1Y9GA 5FUNA 1RUD1 4C1XA 5LY1A 2XWBB 4AE2A 4UF0B 1V6IA 5HCHA 3VDDB 2RR12 1DQ0A 3MIGA 4JCKA 2CGOA 1GWMA 2VBPA 3KV9A 1DHKB 4DEVA 4QU2A 1UYXA 4AHZA 2WNEA 1G86A 4K3UA 2HYXA 1WLWA 2NLRA 2WLPA 4QHOA 4Q4X2 4XURA 4FOWA 3VD4A 2MPFA 5FPZA 1H8TC 2BZDA 1NA1B 1IS5A 1GNHA 3WNLA 5AFEA 2YY1A 5BNPA 4LKDA 2AC1A 2D7FA 2JDMA 4XJUA 4A42A 3T4HB 3LA2A 3POEA 3P3PA 4GIQA 1FX5A 1WCUA 3KGLA 4R4XA 5F6KA 3W59A 1AR83 2HEVF 1W6OB 3NJYA 4LBQB 2B9VA 3NV2A 4YFWA 1QIQA 2UY9A 3K46A 5A6YA 4COYA 2TEPA 4UW5A 2XQXA 3IIAA 3IBMA 4LMFA 4YVWB 3MI8A 4EROA 2W3JA 2R1DA 3PUAA 4LO5B 3TYJA 3I3QA 4OVEA 1LODA 4XFBA 5EFUA 1RUE2 4RS5C 3OPWA 1SPPB 2J22A 5FZ0A 3W9AA 5LK7B 3ES4A 4DRRA 1PGW1 2QQVA 4Y3OA 4Z82A 3SCGA 4IERA 1VBD2 1Y7BA 3KCYA 3POIA 1N3QA 4Q0UA 1ND3C 4R9AA 2YFZA 3VBOB 4RHV3 4XW3A 2ZZJA 4W4ZA 2HWE3 3ZPYA 3TEWA 3TEYA 5ACA3 1PVC2 5DAXA 1V9U3 4W6YA 3KT7A 1KGYA 2LROA 4EE2A 4URTA 3O1MA 1QXPA 1V6KA 1YFWA 2BRTA 2VZPA 2A3XA 2DUOA 4AGGA 4ATEA 3CQOA 3JBG2 5FZDA 1PK6C 3CZUA 3VKLA 3ATGA 5A3NA 4NWVA 5A32B 1AYN3 2YXSA 3J7MA 2P3JA 3E97A 3D0JA 1GKBA 1NY72 2A5ZA 1YI7A 1UF2C 3LE0A 3FLTA 2CDOA 2UWBA 3Q8AA 4XJ8A 2W46A 3IM0A 2X29A 2W91A 1QOTA 3I7DA 4CCOA 3NAPC 5AFBA 1SACA 4Y1XA 1VBA1 4FPEA 4FTBA 4BYYA 1UX7A 2R072 1OXCA 1WKYA 4XFGA 2QQOA 1J1LA 4QWNA 1GZWA 1MR5A 3VBSA 2CSGA 3K77A 5BUVA 1OD5A 2Z42A 4HETA 4QX1A 1UY4A 2BQPA 5E8AA 2JEMA 4P9IA 3AXEA 5K4LA 4B4PA 1TNRA 4XTPA 1YWKA 4TLGA 1PMJX 2V73A 4A3XA 3WOGA 1FV3A 1QY4A 1WD3A 2FBEA 3ZYFA 3USUA 3SQOA 3MO4A 2MHFA 2VUCA 1KS4A 4I0WB 1NLQA 4IE7A 3MZHA 1WLCA 5GZGA 2AREA 1MZFA 1JHJA 2VOTA 1RUG2 3FE5A 4AEJA 4BCUA 2VZ3A 1OPOA 2WFF3 1OLME 1LHWA 1W06A 4AEDB 1D7PM 2EXJA 4ZPIA 2BNMA 3I2JA 1UQXA 1OOPC 1OA4A 3E5QA 4NR1A 5GLTA 3FFQA 4Y26A 5IK7A 1N3OA 4AZZA 1ZBA3 3MUY1 1ZRIA 3FWEA 4ZS2A 3RJRA 5I0TA 5HBAA 3M3OA 5LASA 2G9FA 3E6DA 1L7RA 4IEQA 3L2HA 4DOUA 3K2OA 3U75A 3W5NA 3IZOA 1YJLA 1ZRFA 4OHYA 4LLOA 2ZA9A 2OUHA 1KQRA 1PNFA 1XSQA 2VE1A 2Q1MA 3F95A 1EP0A 2ZEXA 4FFGA 1ULFA 2P5BA 4YM2A 4AI9A 4D3WA 5IK8A 1G9BA 5H9RA 3SLIA 4D6QA 2X5IA 1RUJ1 1OLQA 1A78A 5BNQA 5LRRA 2YC2A 5FYTA 3KF3A 4OMDA 3I59A 1PIV1 2I74A 1AL21 1OF3A 4H14A 4QT6A 4WVZA 4COZA 4XBQA 5I8TA 2CGNA 4IE4A 4QDQA 4OHZA 3ZFGA 4KG0A 1AL0G 1FNYA 1KDKA 4HG6B 1POV1 4LNVA 5JOZA 2PLV2 2JKXA 2ARXA 5G05L 2ENRA 1T6GC 1N1VA 2YC4A 3ORJA 2OT7A 2WRAA 3RI8A 3VN4A 2VUDA 1U5YA 4A6OA 4E8CA 1ZM1A 4KWJA 4NMIA 5HCFA 4BQWA 4WM8A 2PXJA 1BK1A 2D6LX 2EIBA 1CAVB 3ZFEA 1RUH1 2ARAA 2ZOEB 1UW8A 3BB6A 4HXCA 2CY6A 4OUEA 1VRH1 1UOGA 2A1XA 1H2MA 1CAXA 2WA3A 4L9BA 1RUD3 3LFMA 5IVBA 4NIGA 2ZPXA 1NQDA 4CDXA 2O14A 3WQ7A 1SLCA 2FCTA 5LRSA 5JOWA 2VNGA 3ZKYA 4LO4B 4Y22A 1W2AX 4F83A 4KMQA 1UY0A 3ZFFB 4ZU5A 5L7OB 1OFSA 1WZXA 2Y0IA 4BM8A 1NAEA 2E51A 4HL0A 2GNMA 2NMNA 2HWF1 1VRBA 5FY9A 1MS5A 4P5YA 3UGHA 3OUHA 3OYWB 2I2SA 3AYAA 2HWC1 1IS4A 4W6XA 2EF6A 3VDBA 1WW5A 4P00B 5IAVA 3VBRA 2OXBA 2G9ZA 4R8HA 4Q4W2 2FCVA 1RUF1 2EICA 2VMFA 2WDBA 1PX3A 5E88A 1AR61 2CGPA 3B9CA 3NV4A 2AENA 1V6OA 1XNDA 4AFDA 5K0UC 3B01A 2H0VA 2A3YA 5FBJA 1J58A 1JOJA 3EB7A 3INAA 4BMBA 4D8MA 3OGJA 4AI3A 2O8OA 2EIGA 3ZN6B 4NAOA 4A41A 2P2KA 3MW3A 4EN8B 3JXSA 3WNPA 3RG0A 2RM22 1JU3A 4XXPA 4AAPA 5JMOA 4PCRA 3FUQA 3I2KA 1W6QB 4EN9B 2NYYA 4AWDA 4LHNA 3KCCA 3MBWA 5DAPA 4AR2A 5C8CC 1RL3A 3D8CA 2DURA 3ZYRA 5FO8B 4W65A 2F4PA 4XJZA 1MQTC 3LFIA 3WW2A 2YC0A 1NXMA 3H7YA 3LPFA 1LOEA 3UJOA 1O3RA 2WJSA 4JKKA 1SLIA 1KDMA 2NQYA 2VMEA 4CDWC 1RTVA 3RYPA 2EAKA 1UZZA 1JZ5A 1PVXA 1F8VA 1V6LA 3BPZA 5CKQA 2WA4A 1X8MA 3FL7A 4NRPA 3UNPA 3TB0A 4KQ7A 1N47A 2DU1A 1PMIA 2RS12 1VBA3 3VD5A 1VJ2A 4AVVA 4XHBA 1ODMA 4PBOA 3PDQA 5C3OA 4JKMA 1NCRC 1KRIA 1V0AA 5FLJA 5CFDB 2OA2A 1UX6A 1J3RA 3ACGA 1CAWA 2VNVA 2HWB2 4PDWA 5FMOS 1GANA 4RYDA 3AKTA 3VBHC 3AJZA 2VCAA 2DTYA 1B35C 1SBFA 1CX1A 1GUIA 1GNZA 1GP5A 4GULA 1PM4A 5IFPA 2JD4A 1DGWX 2R042 5EIYB 5JOXA 1N3PA 5C3QA 4NIHA 1JXNA 2RJ2A 5JIAA 3N35A 5KBFA 1HXS1 1VMFA 4FPYA 4KBBA 4XXAA 3LCPA 4AHWA 2A73B 3PURA 4IV1A 1G9FA 4TTGA 2NPIA 1PGSA 2JDZA 2Y64A 3GBGA 3UGGA 1JYCA 1ND2C 4ITCA 5DZEA 3OGSA 5BYNA 4P14A 1LOFC 3GZTB 3S7IA 2AYHA 4N9HA 1BLZA 1LU2A 5IVCA 3DYOA 4AHXA 1EV11 2ADEA 5C4WC 4V2VA 1W9TA 3DV8A 3GYDA 4JAAA 1DF0A 4OHWA 2W87A 3MIEA 3EBRA 3A4UA 1H1AA 2D6KA 4OHVA 1TE1B 2Y6HA 1PMHX 4NHKA 1LOCA 2OPKA 5D8AC 4FXKB 3AZXA 1XE8A 1JYVA 2O0OA 3U1XA 4IEXA 1R092 3HR9A 1LTEA 4NHYA 4XAEA 5H9QA 3O12A 2Z79A 5BNPB 1RHI1 1GU3A 4P9LA 1IPKA 4XFIA 1RUJ3 1UXZA 1I9RA 2UYAA 2WQZC 4BPZA 2D43A 4QQLA 4XC9A 4DXZA 2B4KA 2XKPA 1PIV3 4YLZA 1AL23 4LULA 1QJFA 1SDDB 2DFBA 5FP4A 2A70A 2XJQA 5FPVA 4JQRA 5JIUA 5A3TA 1QJX1 2C9AA 2XVGA 4FOQA 4X6RB 4KGQA 2HJIA 4RA0A 5ERLA 3ZXKA 5FXXA 1POV3 3BOWA 5FOJB 3BKZA 2FZ2A 2F17A 1AX1A 1O91A 1Y43B 4JRAA 4RL7A 3U78A 2WNUA 2XJTA 1LNSA 2YROA 1NCQA 3MFCA 4OHXA 1UD1A 3WLUA 4ASKA 1TZOA 2FCUA 1WGPA 3GJAA 5E1RA 3ZO0B 4FAGA 3M3CA 4M3CF 3IB3A 4QQPA 5C3PA 1YHFA 5DZGA 1RUH3 1Q8PA 2Z4FA 2PFWA 5FYBA 3GZEA 4UF0A 1O6UA 1VRH3 3WNOA 5KHIA 4IE5A 5FY0A 3GHMA 3I2HA 2CAUA 2TUNA 4XETA 5JR7B 2K0GA 3I2DA 4BDVB 5FYUA 1BHGA 3JD73 3VHOA 2ORXA 2WZR1 3H7JA 4XUPA 4HFSA 4YFZA 5JZGA 2VQAA 1LR5A 3H3LA 3HIFA 4LEJA 3LIHA 4XF0A 2CL2A 4D6SA 3OBTA 1AX0A 2XGXA 2ZCWA 1HV1A 2DVFA 2ILMA 1RVF2 5A33A 3O1TA 1O3TA 1QQP2 2HWF3 2VMDA 2VOWA 3CIHA 4OI0A 4E4ZA 1GFF2 4LBQA 1S2KA 1HQNA 2HWC3 4M01A 1FNZA 2WINB 1L7LA 4ES8A 1W2NA 3OGGA 2V4AA 1A8MA 4YGEA 3DEMA 4Q4V1 1M4WA 4YVWA 1GZWB 4EYUA 4CYDA 2FDFA 3B93A 2VM9A 1OBNA 2WBKA 2ZGKA 3MHZA 1HRI1 3O14A 1S0BA 3OBZA 1RUF3 4CDQB 4AHYA 3M7AA 4CCMA 5KXBA 2VQUA 5CKNA 1AR63 1EY2A 4MHUA 1VBB2 1Z78A 4PF5A 4IE6A 4AI1A 4CEYC 1JYXA 2XPJA 4PJYA 2E31A 1SPPA 1YFYA 3OEBA 1NOVA 5KWRA 3IT8A 2DCJA 2XOMA 1TMF1 3T0DA 4XDOA 3VBOA 4QDSA 1ZBE1 5IVEA 2G19A 2KA3A 3C8XA 4ISQA 4UFMA 2XL9A 4YZ3A 4ZS3A 5BY5A 1W0PA 2WC2A 5F39A 4BB3A 2CWMA 5CIRA 4FXGB 3AMQA 1RINA 1NZIA 1OUXA 3EJKA 4PT6A 2QQUA 2E33A 5KXEA 2JE7A 1GV9A 1OKOA 3VBFC 3THDA 1ZREA 1X7NA 3J8F1 4L92A 1N1TA 5FUPA 4ARYA 5DG2A 5BNOA 4N53C 2FDKA 1VMJA 3BI3A 5A80A 3RZLA 1PZ8A 2VJXA 5JXIA 5CVRA 2W9XA 1QXJA 1QHDA 4CXWA 5ABJC 4DINB 2WIIB 4CDUA 5A7SA 5F8PA 1F31A 4FI9A 4MGZE 5C9AA 3EMRA 1IPSA 3K48A 3FHAA 5A7WB 2VH9A 4PQ9A 1FPN1 2X5IB 4GMP1 4TSVA 1AR91 4UW4A 1HDKA 3HNMA 3VGIA 4GAZA 5LA1A 4NO4A 2CU5A 4G4FA 5I0DA 4Z07A 4FFHA 1G8WA 2BGOA 3ACLA 5HV4A 3O1RA 4YYOA 1W8UA 5CB7A 5T5LA 2J1EA 4MG2A 4FSJA 3ZXAC 3WDVA 3O1UA 2DF7A 3ZFGB 5FY8A 3WEZA 2RDQA 2QDRA 2P6HA 5CZKA 2HYKA 3UETA 5ISLA 5DXDA 2DDUA 1B09A 5FP9A 4ZXEA 5L9VA 4MGQA 2RMU2 2A6YA 4AG4A 5A6QA 1D2QA 4BU2A 1X9TA 3RFRA 3TBDA 4FVVA 3VKMA 4MGSA 1HXS3 4CP2A 4WM8B 1DDLA 2PA7A 5L9RA 3UK9A 2BUKA 4FPFA 5J96B 4FPGA 3ZFEB 2DVAA 3LWCA 1QU0A 3ZM8A 1MACA 1CAXB 1LGCA 2VO5A 1AYM1 3D82A 5EJ3A 5T3NA 3U4SA 5E16A 1AJKA 4CDXB 2DWRA 4YZ1A 3M3IA 1WLDA 5FZAA 4MXWA 3K4AA 3DGTA 1EV13 4SBVA 1H4GA 4YVSA 4AI2A 4Y22B 4DFSA 4QX2A 3CO2A 4B4QA 3N9QA 1YFXA 2KM2A 1RMU1 3HAGA 3KWVA 3WW3A 3ZSLA 1W28A 4GQ7A 1ACCA 5IVFA 2Y6LA 4QXCA 2GC0A 2D6NA 2PMWB 3Q8EA 2RG4A 2WKKA 1QXRA 4AVAA 1IG3A 1TNFA 3E5XA 3DYPA 2B9UA 4COUA 1RHI3 4YZ5A 2DFCA 3WXPA 5FYIA 1WWYA 4YNIA 4CCLA 1GICA 3O1VA 5GZCA 2WS91 4ATFA 3LEGA 4YSFA 2D6PA 5JI9A 3LDRA 2PAEA 1NX9A 4Y5SA 4JVAA 1MS3A 4Q4Y1 4RQPA 5D1IA 2B45X 1QJX3 2ZS6B 1GMMA 3MYXA 5C3SA 2JENA 4YM0A 3MIFA 1W3XA 4WM7C 4OLLA 4C0HA 2ZJCA 4MYEA 3CDZB 4PI2A 4WV8A 4D6RA 3KF5A 1C8M2 3THCA 4A44A 4R9CA 2IXIA 4QGMA 1RJ8A 2XG3A 1HJGA 2XBO1 3HT2A 4I02A 3HQRA 1JBCA 1VBE1 5LK5A 3CHXA 1ZRRA 2D93A 4G9SB 4XMIA 5JXJA 3AMPA 5DUWA 2VGDA 1AHSA 4XUTA 1W6PB 4YZ2A 5F3CA 5FRAA 1K45A 1K3IA 1YXWA 5JPMB 4HMZA 2WZR3 2Q8CA 5FY4A 4K20A 1GLHA 2WFPA 3FLPA 1D0GA 2JKBA 4HLTA 3ZX7A 1YYNA 3B02A 4RSUA 2DUPA 5JI7A 2JG8A 1O5LA 3OYWA 4N43B 1NQJA 3VZKA 4FPJA 4QU1A 2VTFA 2ZAHA 2P1BA 5LW9A 2QQNA 4TXWA 1TME2 4IESA 1JYIA 1BBT1 2QQLA 2VUJA 3SISA 4CPBA 4E9KA 2GMEA 1H8TA 1BZWA 3RZHA 2FDGA 1ZYBA 2VVDA 3KHCA 4Q4V3 3VZNA 2VW1A 1AR72 5DAWA 4H7MA 3ON7A 4C8DA 5ACA1 2RR11 2QQMA 5F2WA 4OQ9A 1HRI3 1CAWB 1S0IA 1S2EA 3IAPA 3PIJA 3M70A 4PDWB 5DDJ1 2VY0A 2F4LA 4K6BA 4YGDA 2LM3A 2UWAA 4H2AA 1QKQA 3JQWA 5M0TA 4Q4X1 1JI6A 3UESA 3ZN6A 5DAQA 3WINE 3HBZA 1OA3A 1YC61 2VCCA 1WMFA 1W05A 1TMF3 1Y4WA 3AZYA 3H3UA 4AK3A 2PHWA 1W6MB 2C1FA 1ZBE3 4ZZ8A 4NWWA 1PGL2 4HSJA 1IHMA 1X9PA 2JG9C 4JDNA 5AVPA 3CKHA 3ZSMA 4IV1B 2CV6A 1A34A 4JGZC 2B46X 4WVWA 4LXLA 2K46A 1XBFA 5FZ9A 1G9DA 3OEAA 3J8F3 4UFIA 3WSOA 2WYSA 2ERFA 1IS3A 3DXTA 1UWWA 2E53A 3D0SA 2JD9A 1RUI1 4UW3A 1ONAA 1JZ2A 4NAMA 4LE4A 1BYHA 1DQ5A 1OH4A 4CU6A 1RUE1 3IMNA 3PUQA 1Q56A 1AR82 4LKFA 1VBD1 5IUQA 4UW6A 2PHDA 1PK6A 3HN3A 3SH3A 1S0DA 2IVIB 4CUBA 1W2UA 1XE7A 4K8FA 4AQ6A 5FOBB 1FPN3 1Q8QA 2ETEA 1DLCA 1AR93 2JIGA 4GMP3 5CFDA 3ZDSA 4ARXA 1W9WA 1YFUA 3RI9A 2E9QA 3RMYA 4E2QA 4CCKA 4OQ8A 2ORZA 2RS51 3WT3A 3NAPA 2GN3A 4QKDA 4XVHA 2GC2A 3JBG1 4AFBA 4BIFA 3OSDA 4HANA 3V0BB 4QPIC 2BBAA 2BV4A 1W3VA 2HWE2 2WNUB 4Q1RA 4IEYA 2NZ9A 4RD7A 1V9U2 3J7LA 1VIWB 4BWOA 3AMMA 2W0XA 3KV6A 3N9OA 2ET7A 4M3CE 2W08A 1U5XA 1U5ZA 3NMBA 4YM3A 1RUC2 1E57A 3MLLA 4IDZA 4QX5A 3WHTA 2Y6JA 3GBWA 3K51A 2AUYA 1CZSA 4HONA 1AYM3 3IDCB 1K12A 5FKCA 1HB4A 3CZJA 3A22A 2GALA 1F5FA 5KHJA 1JYNA 4NN0A 5FYZA 3GM8A 2OX0A 4RR3C 1SMVA 4DNYA 5JZGB 1RMU3 3QH7A 4NPMA 4AGVA 1OOPA 1QMJA 1C28A 4XF3A 2F6BA 1K5MB 1XU1A 3RJ2X 4BXSV 2P34A 4K40A 5A33B 1QOOA 5L7OC 2ZX3A 1UYYA 1RC6A 4HSLA 1S1AA 2R6QA 4Y5TA 4ASMB 1RUG1 3S6PA 2C9KA 3BN6A 1NKGA 4FPOB 2ARCA 5F9TA 2C4XA 3WNKA 2QQIA 2X8KA 4AFCA 1UZYA 2WS93 3TOJA 1TEIA 3PVNA 4IGOA 2PHRA 4E2GA 2D40A 2YBPA 3E6BA 3FFZA 1U12A 1HB2A 2N7GA 2ZX1A 3AFKA 5H9SA 4GWIA 1FOD1 4Q4Y3 4LK7A 4JQTA 3VBUC 3CJIC 3KHBA 2RDRA 2W2IA 1BVVA 1QJY1 4NIDA 2ADDA 3NKTA 2X05A 2W52A 5FZ3A 2WN3A 3UL2A 2HBUA 2PN5A 1IQDC 3J26N 1UAIA 3WW1A 1I1EA 2AGSA 5J1XA 1LEMA 5A70A 5EHDA 2QUOA 4E2SA 2XBO3 3KQ4B 5FMOL 4JGYC 1C8NA 4A6SA 1E5SA 4XJAA 1VBE3 2BWAA 1K5JA 4CZSA 2BOJA 1ZNPA 1QH7A 3V65A 2GP5A 2A6XA 2VXJA 1OD3A 2CYFA 1AF9A 2A71A 2A7AA 5FFOC 5BNOB 2PLV1 4XHXA 4B1MA 1KITA 4EN6B 5EWSA 2YBKA 3GZUC 4S2DA 3JB4C 2XXZA 4M4PA 1DGRA 4CDUB 1FMD2 4L97A 5E6HA 1PNGA 3PL0A 3ZXGA 5C9AB 2AR6A 3H8OA 2ZGLA 1EPZA 1H6XA 2VAUA 4QPWA 5EJZB 3WR0A 5AC91 1BBT3 4XBLA 5DN2A 3ZDVA 2QTWB 5FZKA 4CDQA 2Q1ZB 1EUUA 5FY1A 3JCIA 1XNKA 3DPRC 4FTSA 3RYKA 2RR13 1JZ6A 1C5IA 1FXZA 1LJ7A 3KLSA 5DDJ3 1SZBA 2JIJA 2D97A 4BISA 2JXAA 2VZTA 4DY3A 5KHHA 1OFNA 4CEWC 4Q4X3 4UFJA 4I2OA 1W0OA 3ST7A 2YUEA 4XUOA 2R16A 5K0UA 5C33A 5LBCA 1W9YA 1RUD2 4AF9A 1GYKA 2D3SA 4DUWA 2FDIA 2QQKA 4CPBD 3AL6A 1SFYA 1UYZA 1WW7A 1W9SA 3N7LA 4HKWA 1W90A 3NW4A 1GOGA 4E4DX 1DP0A 5LATA 1JYWA 1YQCA 4L99A 2BW8A 1UPIA 1ULCA 4UT5A 3VD7A 1WCSA 4MXWB 1WCQA 5FPBA 1RUI3 4YVSB 4L8QA 1QJEA 3EHKA 5C8CA 1WMXA 4C1WA 1JYTA 4IE0A 1RUE3 2VCMA 3R0RA 1Y9MA 3X29B 1Y3TA 3H0OA 5A7WA 1MQTA 1G6NA 3BGAA 3SH5A 5FZMA 1VBD3 2CNAA 1IS6A 5CISA 2EXHA 2MNGA 2VW2A 3ITQA 2PHUA 4BZ4A 2Y6KA 5I91A 2PQQA 3QD6A 3VV1A 5LEJA 1W99A 3GBFA 5LBFA 3ZIXA 3LOIA 2C6SA 4AAXA 2JWPA 3P6BA 5CFCB 4FP2A 1V00A 4QXBA 3A7QA 4ZY9A 2R061 1DQ6A 4MUVA 2RS32 3N36A 5LA0A 3S0MA 5A7NA 4TZDA 2RS53 3FHIB 2W92A 3HBKA 2H6BA 2GNBA 3JBG3 4PLMA 4RQPB 1WLTA 3BU0A 3OTFA 2A6ZA 1O4TA 3SCFA 3BALA 2VMCA 4RN5A 2ZX4A 2WNVB 1OMIA 3ENRA 4DZGA 4I3GA 3WP6A 1Q8VA 2BFUS 3NV3A 4AYUA 1US2A 3ZMOA 3O1OA 1SQ4A 4DB5A 1HX6A 1W8ZA 3GCXA 3I2FA 3LF7A 1XRUA 3VBHA 4URAA 5EQUA 2V72A 3PVBB 1X8EA 2ZGRA 4AW7A 3BU7A 2RS11 1KXGA 4BLJA 2A75A 1YUDA 2OIIA 2XJSA 1X50A 3JZVA 2V4VA 4P9YA 1LHUA 4CP9A 2BNOA 4JTNA 3ZYBA 1HKDA 5JSPA 3KQRA 4QM9A 4HK9A 4DXTA 3I54A 2UY8A 1RJ7A 3Q8CA 1IOAA 3BOPA 2J1UA 1ND2A 3UGFA 4BMEA 1JZ3A 3BTZA 1JODA 3AXDA 3FLRA 1LOFA 2R041 4QKFA 3ALQA 1BVP1 4Z2AA 1HV0A 2J7MA 5BPXA 1CAUB 1GP4A 5T5OA 4AOCA 2PHFA 2JG8B 4BQ5A 1YCIA 2HLEA 3KGZA 4KL1A 3QH6A 4ZKTB 3IMMA 3U4XA 1XU2A 2J1AA 4Q0PA 4TYSA 2ZABA 4FPCA 4GZ9A 4QX7A 1RUG3 1YLLA 4XTMA 5D8AA 5FTTC 5DMYA 5BNNC 3ACIA 1H8TB 3AMHA 2P37A 3EQEA 5A3UA 5FPXA 3BTXA 4XMAA 2IFWA 4M0NA 5FYMA 3OD0A 4NPRA 2JDAA 1DGRN 2FHRA 2O1QA 5IT6A 1FOD3 4XCBA 3VBSC 3B94A 5BV6A 5FZ4A 3E1F1 2ZKLA 3KSCA 1S55A 1QJY3 4FT8A 1D4M1 3WG2A 3WZ1A 5JSRA 1R091 1RYYA 4MO3M 4NVPA 1OA2A 2WZPP 3NJVA 3WUCA 1PO21 2XUEA 2BVBA 2P3KA 4RS5B 4A7ZA 2OS2A 2XL7A 3VKNA 1LHNA 3SHRA 3ZXJA 5J37A 1W6PA 2VTXJ 4GJZA 1ND3B 3VD3A 1JZ7A 3N7MA 3C7EA 1NT0A 1K42A 1SLLA 4OI2A 4QDRA 4BK5A 3ACFA 5K7PA 2PLV3 4INDA 1I5PA 1CJPA 1N1SA 2VR4A 5LA9A 2QFEA 3IDEA 3IKWA 4UAPA 1CIWA 1AUYA 4N43A 4S2HA 3AYCA 5L19A 3JUUA 4F8AA 2BPA2 1XYNA 1LOAA 2G4IA 1PIV2 1PK6B 1AL22 3KV5A 3O5SA 5I0RA 2CHHA 2P3YA 2QNKA 1BQPA 4AVCA 4QB6A 3M2MA 1ASJ2 3POBA 1CR7A 5AC93 3MLJA 5LA2A 1RXFA 1HQWA 1XPWA 4HBNA 4HOOA 4QPGC 2ZEYA 2EA7A 1ST8A 4LKSA 1QWRA 3NAPB 5I0UA 5CG8A 4QHZA 1HRV2 3GALA 4IW3A 5IJRA 4XDPA 3MUZ1 3L9JT 4WVVA 3MDPA 5GALA 4D94A 5KXDA 1J84A 4X6QB 2YPDA 4AL9A 4ISRA 2LW8A 1W6MA 4CXXA 4M0HA 2X53S 4IETA 2H6CA 4YW1A 1RVF1 1CD3G 1WCKA 3C3VA 4RFT0 2O8QA 2Q8OA 2EALA 4A2UA 4CEYA 4BQ1A 3DCQA 3WD5A 1O59A 1LU1A 3H1YA 4X8PA 1AXKA 3LAGA 5HCAA 2D3PA 2E6VA 3FBYA 3IIIA 3JD72 3WDYA 2OPWA 3BIWE 4LJHA 2BGPA 2X10A 4XIOA 5EYXA 4EQVA 4ZXKA 1D0HA 5FQ0B 5J48A 4HZFA 1ZZ8A 3BVCA 1I3HA 3BIEA 3AZVA 3BPSA 2BWCA 1OQDA 4COWA 2JDYA 3NNGA 4L2NA 2EXIA 1H2NA 1DG6A 1OQ1A 2HWF2 2QVSB 3AP6A 3TAYA 2LUWA 3HEIA 1CONA 3VBFA 1VALA 3KM5A 3U14A 3RWKX 1OOPB 3LA3A 3LDKA 3UV9A 3HOBA 1LEDA 1JZ8A 3ZSEA 3FC0A 1D4VB 4N53A 4B8EA 2IXJA 5SV8A 2VZ1A 3ZYIB 4PIZA 4HVQA 2VNRA 4YW2A 3WQBA 1POQA 5GLVA 4DY5A 2W1QA 3POFA 4KI5M 2WT2A 3T2PA 4IGQA 3AKRA 4H55A 2VVFA 5A7QA 3QOPA 4UOJA 5A7OA 5FYHA 3VZOA 2R063 3WW4A 4BK4A 1OQEA 2EAAA 3V0BA 1DCSA 2D5FA 5HXVA 1JOPA 1BXHA 2IUWA 3DN7A 4XFAA 3N7JA 3VBRC 3T4VA 1APNA 1Z7S2 4XUQA 2JE9A 5C5UA 2R1BA 4LHSA 2ET1A 3DL3A 4XF1A 4XJWA 1SFPA 2D98A 2ZMLA 3NJZA 4K21A 1O4ZA 1OPMA 1KEXA 4KG8A 1OLRA 5C71A 1F15A 1R082 2BYVE 1F9KA 2RS13 3R4SA 1M06G 2VXRA 5IW0A 4QM8A 4GWMA 4FTEA 1VR3A 5JSOA 4XJ9A 3TEZA 4N7IA 2XKOA 1AXYA 1MS0A 3HT1A 3WP4A 2HWD1 3J4UH 4B3NA 1LKNA 4GXLA 3E5UA 2E7TA 2XR4A 1T2XA 1K5MA 3M4FA 2VOKA 2WT0A 3NV1A 2R043 1BK0A 5EJ1B 5SV5A 4ZU7A 3OBAA 1UU6A 1UZVA 2FD8A 2GU9A 5HCBA 2W95A 1GBGA 2YU1A 5EYYA 3TNPB 2KD7A 3RZZA 2PHLA 2MEV1 4XCAA 1UY2A 3TN91 4Q29A 5FBZA 5C70A 1UN1A 1CVNA 1ZZ7A 3I3EA 4U36A 1QJU1 3G7DA 2W1WA 2Y0OA 1L7QA 1I6XA 3ILNA 1XOYA 1AZDA 3U10A 3UKTA 4AEMA 3NNJA 4N90A 2XJPA 4COVA 3MFAA 4QD2A 1WMDA 5CKMA 1CZVA 2DU0A 1OVSA 1OLMA 1QEXA 4YZ4A 3KD4A 1YQ6A 5HXMA 5JOYA 3ZMNA 4IEPA 1S0CA 4DXRA 1D4M3 2Y6FA 1R093 4IV3C 3TNQA 3SEPA 2W1SA 3T08A 4DS0A 5K0UB 3NSTA 1V6MA 3VHRA 3I2IA 4QKNA 3I2OA 2GMPA 5FUIA 5FZ8A 1PZ7A 1PO23 2WO1A 5FZOB 5T5PA 5IVVA 1W04A 1EV12 4KU8A 4WM7A 2ZHLA 4ORFA 3SKVA 5FY7A 3MGUA 4MOAA 4M00A 1QF3A 4IGPA 4GA9A 3OCPA 3V0AA 5C3RA 1R1A1 3LGRA 1R1ZA 4OMCA 4JKLA 1EAH1 2NP0A 4GH4C 4MXVA 3LEMA 4P9GA 5C8CB 1WCDJ 1JUIA 1RHI2 3KZ4C 1MZ6A 3RRDA 1DZTA 2WLQA 5FZHA 1MQTB 1H9PA 1YQ8A 5FCCA 5I8YA 1C8M1 1OKQA 2DYCA 4LQRA 2OYZA 4LPLA 1UY3A 1JU4A 4EJRA 4LT5A 2GNTA 2QZ3A 5JMCA 2C26A 4CDWB 2Q0AA 2WN2A 2Y6GA 3AP5A 1QJX2 4NHMA 4Q1PA 4PIYA 5F32A 4Z2WA 1OVPA 3POSA 4P5HA 3PMSA 3K4DA 2D6MA 3UKNA 2WSUA 3MPPG 1QDOA 5FYVA 2VMGA 3FN9A 2D3RA 3I3DA 2DCKA 4IXLA 2VQ0A 1BEV1 5KHGA 1RUOA 1Q8SA 3NQHA 4XQ4A 3MV11 3AKQA 4HPKB 5DQ0A 1XYPA 1NCRB 5A3PA 1W2OA 2J42A 3MF9A 2IVJA 2WZEA 4K1YA 2VUAA 1QDCA 4K8RB 2XJRA 4BH9A 2JDNA 1RVF3 2QE3A 3VBHB 2WO2A 2Q1FA 1B35B 4MHRA 5FJHA 5DUUA 2CWSA 1TME1 1NCQC 1ZZCA 2ARBA 4K7JA 3OF1A 1XSRA 1ZVFA 1VPHA 1GOHA 3PHMA 4Q5OA 3VL8A 4CP9B 3ZN5A 4PBPA 3RDIA 1EYBA 4LHLA 1URXA 2JG9A 4R9BA 4O9GA 4FQ4A 1REEA 1XNCA 2JE8A 2RV9A 1LGBA 3VDDC 1A6CA 2HBTA 5C7GA 4P9WA 4DEQA 4V2WA 3SC7X 2Y8KA 1ND2B 1GZCA 1YQ5A 2KXLA 3GXUA 3PMEA 4I3PA 4TN7A 1Q8OA 1W2TA 4B1LA 1C1FA 1MEC1 1H0BA 1SLAA 4R52A 1AX2A 5C4WB 4IEUA 4Q4V2 1GP6A 1PGL1 1IG0A 4QX3A 3PU8A 2LALA 1NA1C 2H0BA 1HRI2 3OOXA 4DQAA 2VCBA 3RZKA 1QH6A 3H42B 4RFRB 5D8AB 1FI2A 5FZFA 5CFCA 5GZEA 1O5UA 3PTRB 3GF6A 5CG9A 3EXUA 1TMF2 1G9AA 2ZHMA 5A6ZA 2DTWA 2WNVA 4YVWC 3QCWA 1RITA 5F1RA 2YGMA 3VDCA 2ZEWA 1GQGA 1UKGA 4Y5Z0 1DBNA 4U2AA 5ANQA 4GMP0 4GB32 3WDWA 1HLCA 4BA6A 2XLFA 4LR4A 5J3UA 1COV1 2LS6A 4Z1VA 4QPIA 5A7PA 4KH9A 1F4HA 3VBOC 1CIYA 4NHLA 3DUIA 4PHZA 5DPNA 4FAHA 4IEOA 4J1WA 4OZOA 5BNOC 5GLWA 1UPSA 5EXOA 3RYRA 5JCTA 1YI9A 3NJXA 4CE8A 3BTYA 4Q26A 2AEYA 2YU2A 1XE0A 3ZYGA 3TWIA 3C2UA 3LD8A 5J36A 4B4RA 1XNAA 2BTVC 2HWD3 2WQ4A 4P9JA 4B29A 1VBC1 1UZ0A 2NMOA 4AVSA 4LO8A 3R4UA 1SFNA 2IZWA 1CAUA 2GH8A 4LLFA 3S7EA 2UURA 5EZWA 4G3YC 1XB9A 2QQPA 1KD7A 2ZACA 3RZJA 2IXLA 4QX8A 5JXGA 2ZHNA 4A45A 3HPNA 4Y33A 5DG1A 1PO11 1O3SA 4RR3A 5I0SA 2OZ6A 2MEV3 1RUC1 5C9AC 2C5DA 4TWTA 5F5CA 3TN93 2WWJA 5CNAA 2WYFA 4A3ZA 3VZMA 1QJU3 3WNXA 4BE3A 4GKXA 2XH6A 3WP3A 4PF1A 4P02B 2WT1A 4Y1UA 1SDWA 4M3CB 2XMLA 3RWNA 4I01A 1LULA 4MLOA 5A3OA 5LWBA 5HV0A 2WQ8A 3QLQA 1DLLA 3ECQA 4O61A 1W8NA 4HKLA 4Y4RA 3R4DB 4S2FA 1FAYA 3MW4A 4XBNA 5F7UA 2DUQA 4CEYB 5GKAC 3VBUA 1AYM2 1Z0HA 2JDPA 1O7FA 3CJIA 4RS5A 3U37A 4BQ3A 3SXWA 3LEIA 2E7QA 2DVDA 4CP1A 5FLIA 3C7HA 4DO0A 1ND3A 4K1ZA 2A6VA 3SKJE 3W21A 1MVEA 5FZGA 3IPVB 5IVYA 3WF2A 4AEDC 4AQSA 4AI8A 3GCWA 5LCWL 1R1A3 2IXCA 3D6EA 2RJLA 2JECA 2BFUL 1EAH3 1QOSA 4DUVA 2GAUA 4JGYA 4UYBA 5F2SA 5IWFA 1WD4A 1BMV2 2J1SA 4NRMA 3VBFB 1UMZA 3VZLA 3SMHA 4N53B 5FDBA 1C8M3 2WS92 3ABZA 1PVC1 2BERA 4EWAA 3WQ0A 3T0AA 5T50A 1J3QA 3CNAA 3N3HA 3GZAA 3RPQA 3AJYA 3VDAA 1H30A 4BQ4A 4FPHA 3FHQA 2A3WA 1LRHA 1LCLA 1RIRA 4GWNA 3LOBA 5GM0A 4IQPA 1BEV3 2Y33A 3O0XA 1WBFA 3J9SA 4RHV2 1NY71 3WG1A 3AP4A 1REDA 3HD8B 2EIDA 3UKVA 1LESA 2C24A 5FY5A 4AVBA 3DKQA 5ACA2 5C8WA 1FMD1 1RGSA 2XBO2 3KT4A 2XLGA 3BUCA 2DVBA 2R0HA 1VBE2 1VLNA 4V1PA 2R071 2J1TA 3KVAA 2R32A 1HN0A 1TME3 2WSVA 4X8NA 1AYN2 4MGKE 4OI1A 5FQ0A 4CA9A 5FMBA 2YHJA 4BIOA 4XQWA 4YWAA 3AX4A 3U11A 4KWLA 2ZX2A 4BQYA 5FR3A 1FATA 4LO6B 1UYPA 4MSVA 1DYPA 3I97A 1F5JA 5FP3A 1NG0A 1ZX5A 2CTVA 2XB6C 5C6CA 5J98B 2ES3A 4XAAA 4KBZA 1MEC3 5GZDA 1JZ4A 2B42B 3ZFFC 3DYMA 5IK5A 3RNSA 1UOFA 3E6CC 1OSGA 1MS8A 3ILRA 5CA6A 1SCRA 3O0WA 4LK6A 5D21A 2WO3A 3SCHA 1DQ2A 2JG8C 5DDJ2 5FK8A 5CAZA 5FP8A 1Q3EA 4YW7A 1CESA 3WVJA 3ZIWA 4QX0A 3POYA 3WNMA 1LGNA 4XQDA 1W9FA 1IGOA 3CMGA 2WWSA 2ZGMA 1PHMA 1H8VA 3K75B 1W8FA 3I3MA 1Y9QA 3NWKA 4YRDA 3WDXA 2WFF2 4R4ZA 4RGGA 3PJYA 5F5AA 2EVXA 4WVMB 4BLIA 2OVUA 3AZWA 1DFQA 4NHXA 1CQ9A 1COV3 1ZBA2 4YARA 4D7YA 1AJOA 1TG7A 2LTNA 1ULGA 4ZZ5A 3LKJA 3K4ZA 1WA6X 5CBLA 1RUI2 1TVGA 4WM7B 5FZIA 1ULDA 2DCTA 4Q8KA 4FOYA 2BOIA 4FPKA 4MGYE 3V64A 1W39A 2W5FA 3POJA 2RS31 2ZGTA 3POWA 3WG4A 3V0AB 3PU3A 4MX3A 4XFCA 4Y4YA 5EV7A 5FZEA 5FPLA 5LB6A 2YB7A 2XVKA 2NN8A 2ZTNA 4JHZA 4AI0A 4CU9A 1HN1A 4CXYA 3MLKA 2HH9A 3O1PA 1VBC3 2XQRA 2D6OX 5FZ6A 3T1MA 3VLBB 3ZVXA 4E8DA 5JAXA 2YFUA 3NL1A 5FWEA 2DBIA 1NXD1 2BVVA 4Q0QA 3VD9A 4MZUA 1H1IA 3ETPA 3RGBA 3ZR5A 2VZOA 5B4XA 2R30A 3ELNA 1PO13 4CRQA 1SEFA 5B4NA 1KFUL 1ENQA 2RS52 1JW6A 5T52A 3WF4A 4EN0A 4S2GA 5B2GB 5HI0A 3W5MA 1RUC3 4JHTA 2Z5WA 2XLAA 3JB8A 5FV3A 2GZWA 3AB0A 3IWZA 3N9PA 4FBFA 4MH0E 4NE9A 5CFDC 2J1VA 5BNNA 3T2QA 2E63A 3KT1A 3KVBA 3Q8BA 3SNMA 1S0GA 3ZOIA 1QNYA 2JJ6A 2R49A 4H3WA 4D69A 2OQ6A 2OZJA 3PVEA 2ZGSA 4RGKA 4W8JA 1XNTA 3BODA 4YW6A 4Y1ZA 4IEZA 2VOXA 1JN2P 5FMCA 5FZOA 4BQXA 5EPAA 1U0AA 1CPNA 4Q8LA 3RMXA 1KS5A 3PTYA 1MVQA 5FZ7A 4L11A 2ID4A 4NRQA 3QBQA 3A21A 4Q4W1 2FMYA 2RHPA 3USSA 2BU9A 3U07A 3LDBA 1YNAA 2JG9B 3AM2A 4IEWA 5FYCA 2Y60A 4GWJA 2BGCA 2TNFA 4JGZB 1O4YA 1A3KA 2RDSA 2VOVA 1R64A 3OUJA 3FJSA 4HN1A 4XFHA 4WZCA 3VKOA 3CL1A 2RM21 1JH5A 4MGTA 1OI6A 4CDWA 1J3PA 1W6NB 2I45A 1MZ5A 4KNCA 4XZPA 3VHNA 2FDHA 1W8HA 1PVC3 4P9XA 1REFA 3LQCA 5BNPC 4Y24A 3APBA 1FOD2 4CSWA 4LIUA 5FLHA 4XEZA 3NNFA 1Q43A 4LHKA 3LIGA 1RUNA 4MADA 5DZFA 2XJVA 2ZMKA 3AC0A 5E89A 4AEKA 3WCSA 3ZSJA 1GWLA 1QJY2 1PGW2 4LORA 4F7ZA 3RZMA 4HPKA 1NZCA 2XHNA 3AYDA 3OY8A 1NCRA 2JB4A 5IK4A 1C1LA 3GNEA 5A1AA 2WAOA 5AVAA 1LOGA 2BP6A 1E5IA 1E5RA 1ZA7A 4IL7A 1V6JA 4QPGA 3ZYHA 4D7TA 3ZXEA 1FMD3 1B35A 2RE9A 4AVTA 2BNNA 4PIXA 1BCXA 3LSDA 2JICA 4QPIB 2R073 1O8PA 2E32A 4KU7A 4AFAA 1ASJ1 2VU9A 2ZKNA 1UU5A 3OUIA 5FJKA 2E7AA 3CLPA 2HWB1 1QJZA 1UIKA 3PUIA 3MIHA 4HN0A 3TEXA 1P8JA 3NRUA 1IQAA 1HRV1 3N9NA 5CU1A 1VBA2 3ME2A 5C4WA 4LIVA 5FO9B 3ZKUA 2ZZQA 3F2ZA 3I3BA 4GKYA 5AC92 2PAMA 4XOGA 5IYYA 2JDKA 5TSWA 1Q5OA 3ETQA 3RVHA 2WAAA 3AMNA 4UBHA 4RR3B 3RQ0A 3BCWA 3JD71 4QQHA 1IZ3A 3CJXA 1JTZX 4A7YA 3BTAA 4O65A 4QB1A 4GALA 2RVAA 4EWDA 4XIKA 1W8WA 4LBKA 4OZXA 3OGRA 5L73A 2QQWA 1F2NA 1ZZ6A 2VBDA 5CYYA 5JUVA 5FKBA 3WHUA 2IFRA 1O8SA 4LKEA 4CDQC 2YYOA 1X33A 3DF0A 1UXXX 2HKXA 3HWJA 4QPYA 5FYSA 2QKDA 3T09A 4LA3A 1UMIA 3WY6A 4B7KA 4LBMA 2IC1A 3VBUB 5KR7A 3CJIB 5K9YA 2JDHA 1CX4A 2V09A 3B9IA 3GJBA 1AXZA 1UL9A 2UWCA 1POV0 2TBVA 3K3OA 3KCXA 1DQ4A 3WDUA 2W68A 4UWDA 2QDNA 2YG0A 1S0JA 2D5HA 3PJQA 2RS33 3UT0A 1WUVA 3SEEA 4DPNA 5LZ6A 1VAKA 3B7MA 4FP3A 4YW3A 5I8SA 1VP6A 1UCXA 1Z7S1 2WL1A 5KC6A 3S5AA 4JGYB 4NJ4A 5FP7A 1RUJ2 1PZ9A 4YPJA 1S2BA 1H2LA 4Z92B 3TRSB 1NLRA 3EYPA 4CUCA 2Q8DA 1N1YA 2VZSA 1XXNA 1V70A 4FCAA 4UFHA 5LBBA 4JC1A 4AFMA 1R081 2R062 4CCEA 4CU8A 5IAXA 5K8SA 1ZRCA 5A1FA 5L36A 2X5IC 4CTEA
chains in the Genus database with same CATH topology
5GLZA 4OULA 5I93A 1C4RA 1QGLA 4M3CA 2XHKA 4MV2A 1LENA 3FMGA 1JUHA 2Q5TA 3IDBB 1TQ5A 4YG6A 5JPNB 3ZFGC 1RUH2 2RJKA 2QZ2A 1VRH2 3DPRB 2UYBA 1QQP1 2K9ZA 3WDTA 2FZ1A 2XUMA 2NM1A 3LZZA 3R05A 3H1MA 3O7OA 4LA2A 2GDFA 2PTMA 3KS7A 1MS1A 4CEWB 2GH2A 3H1WA 4WM8C 3ZXDA 3ZXLA 3IPVA 4IV3A 2YPJA 3ZFEC 4Q4W3 2ZX0A 4AQTA 1AVBA 4PLOA 4XILA 1VBB1 4EWEA 1FYUA 1OHFA 2V5YA 3ROUA 4CDXC 3MICA 4J6GA 3H3ZA 2ZGQA 2HWC2 5FAXA 2GMMA 3LA7A 4YGCA 2RM23 4Y1VA 3AP9A 5T55A 4GH4A 3ZN4A 4XF4A 1RUF2 5ABJA 1AR62 4XPVA 1KJLA 2VMIA 4XDQA 1VB4A 4FPLA 1XNBA 3IN9A 3H8UA 3SITA 3THTA 2VG9A 2K2SA 1NLSA 4LE3A 1CN1A 4FQZA 3A0NA 1D2SA 1D4M2 4Q0VA 5JVVA 1BJQA 4TLFA 2VW0A 4LO7A 1PO22 4XFFA 3FZ3A 2GN7A 4QGLA 4O9EA 3WP5A 4OI4A 1IKPA 1C5HA 1ENRA 1G7YA 2EXKA 4OUSA 5FREA 4MVTA 3VKFC 1C57A 3OJBA 1ASJ3 3ASIA 4FOVA 3OPZA 1ENSA 1SBDA 4Y20A 5FO7B 4META 1ALYA 4Q0SA 1O3QA 4I0BA 1YO8A 2B7YA 2PELA 2HWB3 3MPBA 2HEWF 4AGRA 5BXXA 3G6JB 4ZU4A 4SLIA 4N7UA 4Z8BA 1FT9A 2YMZA 1HRV3 4JDMA 1JHNA 4RGAA 5CADA 2RMU1 4XF9A 1YIPA 1RB8G 5KXCA 1NE4A 5JLVA 1SCSA 2Z2SB 1WMEA 4C91A 3VDDA 2BBVA 4LTAA 3MW2A 4N43C 4ONUA 1UU4A 2B5HA 4LBNA 4H7LA 3U0ZA 2JX9A 5F5QA 1NA1A 2OUJA 1HXS2 5BNNB 2A6WA 3VHPA 3B3QE 2ZAAA 4PDWC 1KFXL 4QQ2A 3OD4A 1W6OA 4WVMA 1CPMA 1H1MA 4YG0A 1PM7A 1WW4A 3GHNA 3VBSB 1BKZA 4BOWA 1GSLA 3WCRA 4MGIE 4W6WA 1NE6A 1J59A 3RS6A 4IV1C 1U5IA 5T5JA 1UIJA 3B00A 1LB2A 3CU7A 3OBRA 5GZFA 4EN7B 3USUB 3WG3A 2QJVA 1IPJA 4QQOA 2BEOA 3H9AA 4AXOA 4FO9A 3JQXA 1Z7S3 1DZRA 1WA4A 2B8MA 3QACA 2YDEA 4GB31 5JDBA 4I09A 4DMIA 4JTOA 3AKPA 1R083 5GJ6A 1WBLA 5A32A 3ZSKA 4IEVA 2PYTA 3HMYA 1DGWA 4LUMA 2ZGUA 3H50A 1QNWA 2HEYF 3CF6E 1ZA4A 3M3QA 3OY8B 3JU9A 5H9PA 3ZXFA 5J7MA 1WW6A 3M3EA 1ENXA 1SLBA 2IXHA 1V6NA 4QPGB 4KWKA 4E27A 1G9CA 1QQP3 4Q27A 5KHKA 1SLTA 2OW4A 2WNUC 2AH2A 2Y38A 2XVLA 3I59B 4ASLA 3HN1A 4LBOA 3UJQA 2WZR2 1YJKA 2C0ZA 3FBMA 3CEWA 2XWJB 2Q30A 2HWD2 3LSEA 1AR71 4J1XA 3I4IA 4JV4A 3N4MA 3R6SA 1MS4A 1L3JA 3D4KA 4JGZA 1YRZA 4UXAA 1VBB3 2B39A 3L2YA 1ZZBA 2YV8A 2ZBJA 4QHBA 4E4SA 4LBJA 5A3LA 4XE9A 2ZHKA 3ES1A 1H9WA 2MEV2 4AEDA 3TN92 3P3NA 5JZGC 2ATFA 2G9GA 1W6NA 3O0VA 1C3HA 2DCZA 1QJU2 1K5MC 4I0AA 2I07B 2W39A 1MZEA 1X36A 3AK0A 5GLUA 5DUXA 1ZZ9A 1GQHA 2ZGPA 3AYEA 3M1HA 1UKRA 5LEKA 3NO8A 4YW5A 1HIXA 3THPA 3URFA 3I8TA 2VPVA 1ZBE2 3PLQA 1BMV1 5J09A 4A7KA 4BHPA 4C90A 4WBBA 4ES9A 1AR81 5F6LB 3VZJA 4COUA 3NVCA 3WV6A 3M8LA 2P3IA 3J8F2 4YG3A 3VBRB 1YIFA 4KGGA 2GC3A 1R1A2 2VVEA 3WQ1A 1S0EA 4D7SA 1EAH2 1LHVA 3T1LA 2ZGNA 3B5LB 1NYWA 1SBEA 3MIBA 4JDOA 1GZ9A 3MIDA 4DRVA 4HT1T 3DKWA 4LBLA 4RHV1 4Q2FA 2PHTA 2Z69A 2HWE1 1CAVA 2DVGA 1MS9A 1FPN2 1X82A 3MF6A 2RMU3 1AR92 5ACA1 5BNOC 1V9U1 3A0KA 4HVRA 5KC5A 4LUKA 1LOBA 2YGLA 3PNAA 3FUOA 4CDUC 1H4HA 1HW5A 4B7EA 3D5OA 1AYN1 4HKOA 1BEV2 2ZMNA 1LECA 3ZFFA 5L7OA 4QGNA 3V56A 1CGPA 3AKSA 4YW4A 4I30A 4C0BA 1IKQA 3Q9OA 4CP0A 2Q4SA 5JWPA 1ULEA 1DU3D 3SH4A 2IWGB 4N9IA 3PVOA 3KMHA 4QMAA 1VB2A 1XYOA 2PAKA 3AP7A 5DUVA 2ZGOA 5A3MA 3MEPA 1DZQA 4OUMA 3HQXA 2SBAA 1RMU2 4PLNA 4XYXA 4IV3B 3EO6A 2VMHA 3VUOA 4AQ2A 3WUDA 1MEC2 1DYKA 2R0FA 2GC1A 4WZFA 3KB5A 4LBQD 1W6QA 1I5ZA 3ILFA 2YZ4A 5T54A 3ZYPA 2UU8A 1DIWA 4YVSC 1DGLA 2WFF1 1EPWA 4GB33 3LB9A 4GH4B 2IXKA 1ZBA1 5ABJB 4Q4Y2 4HVOA 4YGBA 4Y1YA 1LHOA 1VAMA 1A8DA 2FMDA 3VL9A 1GR3A 1DQ1A 3NKGA 2SLIA 2FQPA 1S0FA 4K9SA 3FX3A 1XQNA 4EV0A 5CFCC 2Y26A 4HK8A 4R9DA 2PHXA 2XJUA 1J1TA 1COV2 3DPRA 1KJRA 4RQPC 5K8SA 2VULA 4F3JA 2DV9A 1CJDA 1H2KA 2P17A 3N7KA 1ZRDA 2DCYA 2GNDA 2WNVC 2QCSB 1FV2A 4QXKA 2D44A 4CEWA 3ZYJB 3B69A 4YM1A 3W58A 3T2TA 2AZ5A 3RSJA 3AZZA 3AFGA 1AR73 1VBC2 4Y20B 3WX5A 2VECA 3S30A 4NOTA 2CAVA 1NCQB 1VAVA 2GSYA 4UBGA 4JRLA 1PO12 4OFGA 1BBT2 1HQLA 2VNOA 4C1XA 1RUD1 2XWBB 4AE2A 1V6IA 3VDDB 2RR12 1DQ0A 3MIGA 4JCKA 2CGOA 1DHKB 4QU2A 4AHZA 2WNEA 1G86A 4K3UA 1WLWA 2NLRA 2WLPA 4Q4X2 4FOWA 2MPFA 5FPZA 1H8TC 1NA1B 1IS5A 1GNHA 5BNPA 5AFEA 2YY1A 2D7FA 4XJUA 3LA2A 4GIQA 3P3PA 1FX5A 3KGLA 4R4XA 5F6KA 3W59A 1AR83 2HEVF 1W6OB 4YFWA 4LBQB 3NV2A 2UY9A 4COYA 2TEPA 4UW5A 3IIAA 3IBMA 4YVWB 3MI8A 4EROA 2R1DA 4LO5B 3TYJA 4OVEA 1LODA 4XFBA 5EFUA 1RUE2 4RS5C 3W9AA 5LK7B 3ES4A 4DRRA 1PGW1 4Z82A 3SCGA 4IERA 1VBD2 1Y7BA 3KCYA 4R9AA 1N3QA 4Q0UA 1ND3C 3VBOB 4RHV3 4XW3A 2ZZJA 2HWE3 3ZPYA 5ACA3 1PVC2 1V9U3 4W6YA 3KT7A 4URTA 1QXPA 1V6KA 1YFWA 2A3XA 2DUOA 4AGGA 4ATEA 3JBG2 1PK6C 3VKLA 3ATGA 4NWVA 5A32B 1AYN3 2YXSA 2P3JA 3E97A 3D0JA 1GKBA 1NY72 2A5ZA 1YI7A 1UF2C 3FLTA 2UWBA 4XJ8A 3IM0A 2X29A 1QOTA 3I7DA 3NAPC 5AFBA 1SACA 4Y1XA 1VBA1 4FPEA 4FTBA 4BYYA 2R072 4XFGA 1J1LA 1GZWA 1MR5A 3VBSA 5BUVA 1OD5A 2Z42A 4HETA 2BQPA 5E8AA 2JEMA 4P9IA 3AXEA 4B4PA 1TNRA 4XTPA 1YWKA 2V73A 3WOGA 1FV3A 1QY4A 1WD3A 2FBEA 3USUA 2MHFA 1KS4A 4I0WB 3MZHA 1WLCA 5GZGA 2AREA 1MZFA 1RUG2 3FE5A 4AEJA 4BCUA 1OPOA 2WFF3 1LHWA 4AEDB 2EXJA 2BNMA 1OOPC 1OA4A 3E5QA 4NR1A 5GLTA 3FFQA 4Y26A 5IK7A 1N3OA 1ZBA3 3FWEA 3RJRA 5I0TA 5HBAA 3M3OA 2G9FA 3E6DA 4IEQA 3L2HA 4DOUA 1YJLA 1ZRFA 4OHYA 4LLOA 2ZA9A 2OUHA 1KQRA 1PNFA 2Q1MA 4D3WA 1EP0A 4YM2A 1ULFA 5IK8A 1G9BA 5H9RA 3SLIA 2X5IA 1RUJ1 1OLQA 1A78A 5BNQA 5LRRA 3I59A 1PIV1 2I74A 1AL21 4H14A 4QT6A 4WVZA 4COZA 4XBQA 5I8TA 2CGNA 4OHZA 3ZFGA 4KG0A 1AL0G 1FNYA 1KDKA 4LNVA 1POV1 5JOZA 2PLV2 2ARXA 2ENRA 1T6GC 1N1VA 3RI8A 3VN4A 1U5YA 1ZM1A 4KWJA 5HCFA 4WM8A 1BK1A 2D6LX 1CAVB 3ZFEA 1RUH1 2ZOEB 3BB6A 1UW8A 2CY6A 1VRH1 1H2MA 1CAXA 2WA3A 4L9BA 1RUD3 2ZPXA 1NQDA 4CDXA 3WQ7A 1SLCA 5LRSA 5JOWA 2VNGA 4LO4B 4Y22A 4F83A 3ZFFB 4ZU5A 5L7OB 1OFSA 2Y0IA 4BM8A 2E51A 4HL0A 2GNMA 2NMNA 2HWF1 1MS5A 3OYWB 2I2SA 3AYAA 2HWC1 1IS4A 4W6XA 2EF6A 1WW5A 3VBRA 4R8HA 4Q4W2 1RUF1 5E88A 2CGPA 1AR61 3B9CA 3NV4A 2AENA 1V6OA 1XNDA 4AFDA 5K0UC 3B01A 2H0VA 2A3YA 1J58A 1JOJA 3INAA 4BMBA 3OGJA 4AI3A 2O8OA 2EIGA 3ZN6B 2P2KA 3MW3A 4EN8B 3RG0A 2RM22 4XXPA 4PCRA 3FUQA 1W6QB 4EN9B 2NYYA 4AWDA 4LHNA 3KCCA 5C8CC 1RL3A 3D8CA 2DURA 3ZYRA 5FO8B 4W65A 2F4PA 4XJZA 1MQTC 3WW2A 2YC0A 1NXMA 3H7YA 3UJOA 1LOEA 1O3RA 2WJSA 1SLIA 1KDMA 2NQYA 4CDWC 1RTVA 3RYPA 2EAKA 1UZZA 1PVXA 1F8VA 1V6LA 3BPZA 2WA4A 1X8MA 3TB0A 4KQ7A 1N47A 2DU1A 1PMIA 2RS12 1VBA3 1VJ2A 4AVVA 4XHBA 4PBOA 1KRIA 1NCRC 5FLJA 5CFDB 2OA2A 1UX6A 1J3RA 1CAWA 2HWB2 4PDWA 5FMOS 1GANA 3AKTA 3VBHC 3AJZA 2DTYA 1B35C 1SBFA 1GNZA 4GULA 2JD4A 1DGWX 2R042 5JOXA 1N3PA 1JXNA 5JIAA 3N35A 5KBFA 1HXS1 4FPYA 4KBBA 4XXAA 3LCPA 4AHWA 2A73B 4IV1A 1G9FA 2NPIA 1PGSA 2JDZA 3GBGA 1JYCA 1ND2C 4ITCA 5DZEA 5BYNA 4P14A 1LOFC 3GZTB 3S7IA 2AYHA 4N9HA 1LU2A 4AHXA 1EV11 5C4WC 3DV8A 3GYDA 4JAAA 1DF0A 4OHWA 3MIEA 3EBRA 3A4UA 1H1AA 2D6KA 4OHVA 1TE1B 4NHKA 1LOCA 2OPKA 5D8AC 4FXKB 3AZXA 1XE8A 2O0OA 4IEXA 1R092 3HR9A 1LTEA 5H9QA 3O12A 2Z79A 5BNPB 1RHI1 4P9LA 1IPKA 4XFIA 1RUJ3 1I9RA 2UYAA 2WQZC 4BPZA 2D43A 4QQLA 4DXZA 2XKPA 1PIV3 4YLZA 1AL23 4LULA 2DFBA 2A70A 2XJQA 4JQRA 5JIUA 1QJX1 2C9AA 2XVGA 4FOQA 4X6RB 4KGQA 2HJIA 4RA0A 3ZXKA 5FOJB 1POV3 3BOWA 2FZ2A 4RL7A 1AX1A 1O91A 1Y43B 4JRAA 2WNUA 2XJTA 2YROA 3MFCA 1NCQA 4OHXA 1UD1A 3WLUA 1WGPA 5E1RA 3ZO0B 4FAGA 3M3CA 4M3CF 4QQPA 1YHFA 5DZGA 1RUH3 1Q8PA 2PFWA 1VRH3 5KHIA 3GHMA 2CAUA 2TUNA 4XETA 5JR7B 2K0GA 3I2DA 3JD73 3VHOA 2WZR1 3H7JA 4YFZA 4HFSA 5JZGA 2VQAA 1LR5A 3HIFA 4LEJA 4XF0A 2CL2A 3OBTA 1AX0A 2XGXA 2ZCWA 1HV1A 2DVFA 2ILMA 1RVF2 5A33A 1O3TA 1QQP2 2HWF3 2VOWA 4OI0A 4E4ZA 1GFF2 4LBQA 1S2KA 1HQNA 2HWC3 4M01A 1FNZA 2WINB 4ES8A 3OGGA 4YGEA 1A8MA 4Q4V1 1M4WA 4YVWA 1GZWB 4CYDA 3B93A 2ZGKA 1HRI1 3O14A 1S0BA 5KXBA 1RUF3 4CDQB 4AHYA 3M7AA 1AR63 1EY2A 4CEYC 1VBB2 1Z78A 4PF5A 4AI1A 2XPJA 4PJYA 1YFYA 1NOVA 5KWRA 3IT8A 2DCJA 1TMF1 3VBOA 1ZBE1 4YZ3A 2KA3A 4ISQA 5BY5A 2XL9A 1W0PA 2WC2A 2CWMA 5CIRA 4FXGB 3AMQA 1RINA 3EJKA 5KXEA 2JE7A 1GV9A 3VBFC 1ZREA 1X7NA 3J8F1 4L92A 1N1TA 5DG2A 5BNOA 4N53C 1PZ8A 5CVRA 1QXJA 1QHDA 5ABJC 4DINB 2WIIB 4CDUA 1F31A 4MGZE 5C9AA 3K48A 2VH9A 4PQ9A 1FPN1 2X5IB 4GMP1 4TSVA 1AR91 4UW4A 1HDKA 3VGIA 4NO4A 4G4FA 4Z07A 1G8WA 3ACLA 4YYOA 5CB7A 5T5LA 4FSJA 3ZXAC 3WDVA 2DF7A 3ZFGB 2QDRA 2HYKA 5DXDA 1B09A 2RMU2 2A6YA 4AG4A 1D2QA 3TBDA 4FVVA 3VKMA 1HXS3 4CP2A 4WM8B 1DDLA 2PA7A 3UK9A 2BUKA 4FPFA 5J96B 4FPGA 3ZFEB 2DVAA 3LWCA 1QU0A 1MACA 1CAXB 1LGCA 3D82A 1AYM1 5EJ3A 5T3NA 5E16A 1AJKA 4CDXB 2DWRA 4YZ1A 3M3IA 1WLDA 4MXWA 3DGTA 1EV13 4SBVA 1H4GA 4YVSA 4AI2A 4Y22B 4DFSA 3CO2A 4B4QA 1YFXA 2KM2A 1RMU1 3HAGA 3WW3A 3ZSLA 4GQ7A 2GC0A 2D6NA 2WKKA 1QXRA 4AVAA 1TNFA 3E5XA 2B9UA 1RHI3 4YZ5A 2DFCA 3WXPA 4YNIA 1GICA 5GZCA 2WS91 4ATFA 4YSFA 2D6PA 5JI9A 2PAEA 4JVAA 1MS3A 4Q4Y1 4RQPA 5D1IA 2B45X 1QJX3 2ZS6B 3MYXA 2JENA 4YM0A 3MIFA 4WM7C 4OLLA 4C0HA 2ZJCA 4MYEA 4WV8A 1C8M2 4R9CA 2IXIA 4QGMA 1RJ8A 2XG3A 2XBO1 3HT2A 4I02A 1JBCA 1VBE1 5LK5A 4G9SB 1ZRRA 2D93A 4XMIA 3AMPA 5DUWA 2VGDA 1AHSA 1W6PB 4YZ2A 5FRAA 5JPMB 1YXWA 4HMZA 2WZR3 4K20A 1GLHA 2WFPA 3FLPA 1D0GA 2JKBA 4HLTA 3ZX7A 1YYNA 3B02A 4RSUA 2DUPA 5JI7A 2JG8A 1O5LA 3OYWA 4N43B 1NQJA 3VZKA 4FPJA 2ZAHA 1TME2 4IESA 1JYIA 1BBT1 2VUJA 4E9KA 3SISA 2GMEA 1H8TA 1BZWA 1ZYBA 2VVDA 4Q4V3 3VZNA 2VW1A 1AR72 4H7MA 2RR11 1HRI3 1CAWB 1S0IA 4A3XA 5DDJ1 3M70A 4PDWB 2VY0A 4YGDA 4K6BA 2LM3A 2UWAA 1QKQA 3JQWA 4Q4X1 3ZN6A 3WINE 3HBZA 1OA3A 3AZYA 3H3UA 1WMFA 1TMF3 4AK3A 2PHWA 1W6MB 2C1FA 1ZBE3 4NWWA 1PGL2 4HSJA 1IHMA 2JG9C 5AVPA 4JDNA 3ZSMA 4IV1B 2CV6A 4JGZC 2B46X 4WVWA 1G9DA 3J8F3 2ERFA 1IS3A 2E53A 3D0SA 1RUI1 4UW3A 1ONAA 4LE4A 1BYHA 1DQ5A 1RUE1 3IMNA 1Q56A 1AR82 5IUQA 1VBD1 4UW6A 2PHDA 1PK6A 3SH3A 1S0DA 1W2UA 1XE7A 4K8FA 4AQ6A 5FOBB 1FPN3 1Q8QA 2ETEA 4GMP3 1AR93 5CFDA 3ZDSA 1YFUA 3RI9A 2E9QA 3RMYA 4E2QA 2RS51 3WT3A 3NAPA 2GN3A 2GC2A 3JBG1 4AFBA 4BIFA 4HANA 3V0BB 4QPIC 2HWE2 2WNUB 4Q1RA 4IEYA 2NZ9A 4RD7A 1V9U2 1VIWB 4BWOA 3AMMA 2W0XA 2ET7A 4M3CE 2W08A 1U5XA 1U5ZA 4YM3A 1RUC2 1E57A 3MLLA 4QX5A 3WHTA 3GBWA 3K51A 2AUYA 1AYM3 3IDCB 2GALA 1F5FA 5KHJA 4NN0A 4RR3C 1SMVA 4DNYA 5JZGB 1RMU3 3QH7A 4AGVA 1OOPA 1QMJA 1C28A 4XF3A 2F6BA 1K5MB 1XU1A 3RJ2X 2P34A 4K40A 5A33B 1QOOA 5L7OC 2ZX3A 1RC6A 4HSLA 1S1AA 2R6QA 4ASMB 1RUG1 3S6PA 4FPOB 5F9TA 2X8KA 4AFCA 1UZYA 2WS93 3TOJA 1TEIA 3PVNA 4E2GA 2PHRA 2D40A 3E6BA 3FFZA 1U12A 2N7GA 2ZX1A 3AFKA 5H9SA 1FOD1 4Q4Y3 3VBUC 3CJIC 1BVVA 1QJY1 3NKTA 2W52A 3UL2A 2PN5A 3J26N 3WW1A 1UAIA 1I1EA 2AGSA 1LEMA 2QUOA 4E2SA 2XBO3 5FMOL 4JGYC