3NJZA

Crystal structure of salicylate 1,2-dioxygenase from pseudoaminobacter salicylatoxidans adducts with salicylate
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
364
structure length
364
Chain Sequence
b'EKLDHESVTQAMQPKDTPELRALYKSFEEESIIPLWTQLGDLMPIHPKSKAVPHVWKWSTLLRLARKSGELVPVGRGGERRALGLANPGLGGNAYISPTMWAGIQYLGPRETAPEHRHSQNAFRFVVEGEGVWTVVNGDPVRMSRGDLLLTPGWCFHGHMNDTDQPMAWIDGLDIPFSQQMDVGFFEFGSDRVTDYATPNFSRGERLWCHPGLRPLSGLQNTVASPIGAYRWEFTDRALTEQLLLEDEGQPATVAPGHAAIRYVNPTTGGDVMPTLRCEFHRLRAGTETATRNEVGSTVFQVFEGAGAVVMNGETTKLEKGDMFVVPSWVPWSLQAETQFDLFRFSDAPIMEALSFMRTKIEGQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gentisate 1,2-dioxygenase
publication title Crystal structures of salicylate 1,2-dioxygenase-substrates adducts: A step towards the comprehension of the structural basis for substrate selection in class III ring cleaving dioxygenases.
pubmed doi rcsb
source organism Pseudaminobacter salicylatoxidans
molecule tags Oxidoreductase
total genus 102
structure length 364
sequence length 364
ec nomenclature ec 1.13.11.4: Gentisate 1,2-dioxygenase.
pdb deposition date 2010-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3njzA01
1ZZ6A 2H0VA 2IXHA 3IDBB 4UBGA 2CV6A 1YLLA 4ONUA 4LUMA 2PAKA 2XL9A 3NKTA 2QDRA 3RPQA 2PAEA 4META 3CLPA 4YNIA 2D93A 5T3NA 1X8MA 5I8TA 2PQQA 5JSPA 3KGLA 2XKOA 4LA2A 4ORFA 3BB6A 3EQEA 2ET7A 4L11A 4IEUA 4XEZA 4BH9A 4EV0A 2ETEA 4Q0QA 3BU7A 2XKPA 3I59A 2EA7A 1O3QA 4MH0E 5KHHA 3BCWA 5CU1A 4HSJA 4KL1A 1WGPA 5CADA 1JUHA 1I6XA 2OZJA 3H3ZA 4XF9A 2VECA 3H1WA 3H50A 4N9IA 4R8HA 3PNAA 4HVQA 5BV6A 1RL3A 4HVRA 1DGWA 1DZRA 1O4TA 1ZZ7A 1IPJA 5FQ0B 1O3RA 4LUKA 3OGJA 2K0GA 3E6DA 3U0ZA 1OD5A 3LAGA 1PMIA 2D5FA 5I0SA 4IEOA 4IESA 3UKNA 1QWRA 1CAWB 4EWAA 4Q29A 4J1WA 3FX3A 4BYYA 4LA3A 3IWZA 4E2SA 2BYVE 2BNMA 1UPIA 5HI0A 3SMHA 3WW3A 4FT8A 4ZU7A 1SEFA 1SFNA 3S0MA 4I09A 1UW8A 4MX3A 1ZZ9A 3S7EA 3TNPB 1LB2A 1CAVA 3MPBA 2WC2A 2PHDA 5C6CA 2IXLA 3IBMA 3VHRA 2GC3A 3CL1A 1VR3A 1ZRFA 2IXKA 4MUVA 1UIKA 3LOIA 3UKTA 4L2NA 4F8AA 5AVPA 1HW5A 4HN0A 1CAUB 4AVCA 5LEJA 3KGZA 2FQPA 5I0TA 5KHKA 1G6NA 4QMAA 4XFBA 4KWKA 3NVCA 4FBFA 4MV2A 4LULA 4YSFA 4LLOA 5I8YA 2QVSB 4HVOA 3B02A 5D1IA 4UXAA 2UYAA 4EWDA 4AXOA 1LKNA 4NVPA 4XF4A 3ES1A 3ZDSA 3MDPA 2PYTA 4HLTA 4KU7A 5JR7B 4QGNA 1RUOA 2ATFA 2GAUA 5I91A 4I2OA 2MHFA 3M3IA 3L2HA 2PHLA 1UCXA 2EVXA 2O1QA 2PTMA 2QCSB 5I8SA 4E2GA 2Z69A 5I93A 3USSA 4UBHA 5FLJA 2XLAA 1NXMA 2UY8A 4IEVA 3U10A 4KWLA 3RNSA 5BUVA 4XETA 1XE7A 4BIFA 4YRDA 1FI2A 4MGZE 3SXWA 3G7DA 4ZU4A 2XLFA 3I59B 4X6QB 3KSCA 1YFWA 3RZZA 2KXLA 3OF1A 3H1YA 2IXJA 4IEPA 2H6CA 2Q1ZB 3DV8A 4EWEA 4WZCA 4AQ6A 3LZZA 5BY5A 3H7YA 3FWEA 4Z82A 4QX5A 5FCCA 5BXXA 4JVAA 1OFNA 1O7FA 2EAAA 1WLTA 1J58A 1YFXA 3D0JA 4X6RB 4XF3A 2B8MA 3HT2A 1V70A 4XFFA 2BGCA 3MYXA 4RD7A 1EP0A 2WFPA 1O5UA 2UYBA 1SQ4A 5FDBA 2OPKA 3SCHA 2Z2SB 5J48A 2GC0A 1TQ5A 2O8QA 4O9GA 1ZVFA 1DGRA 3CF6E 1ZX5A 1OMIA 5EZWA 2Q0AA 3H7JA 4E2QA 2PAMA 2XLGA 4I0AA 2B5HA 1OI6A 4HZFA 2MPFA 3DL3A 3UKVA 5BPXA 3LA2A 1Q43A 1NYWA 4OFGA 1CAXA 4IEXA 2QNKA 1CAVB 4IETA 5I0RA 4XFHA 4A2UA 5FPXA 3PLQA 2E9QA 3FE5A 4Q0PA 2OYZA 3IDCB 3DN7A 1XRUA 2XGXA 1RTVA 3CO2A 4AVBA 2ZKLA 4XFAA 5KHGA 4TLFA 2Y0OA 3TNQA 1YFYA 4Z07A 4PIYA 3JZVA 1GQGA 4ZU5A 5JAXA 3KCCA 3RYKA 2CAVA 3E5UA 4OLLA 1ZRRA 4I01A 3ETQA 1X82A 2VQAA 2GU9A 2BNOA 3ES4A 1J59A 3D0SA 4R52A 3NW4A 5FLHA 4QM9A 3OCPA 1ZRCA 2MNGA 4QGLA 3RDIA 2D40A 2ZCWA 3HT1A 5J3UA 1X8EA 3PVBB 4XFIA 2IXIA 1J3RA 5F1RA 5C8WA 2B9UA 5JSOA 3BPZA 3H9AA 4HBNA 3EJKA 4PJYA 1Q5OA 3I7DA 1H1MA 4LTAA 4MGYE 2BEOA 3QACA 1PM7A 1YUDA 2OZ6A 1RC6A 3MZHA 3E5QA 4XFGA 3HQXA 3SHRA 3E6CC 4Q0UA 4BHPA 4XF1A 1X7NA 1GQHA 2QJVA 1WA4A 4WVZA 5FPZA 3WW1A 1ZNPA 4JTNA 4D7SA 1J1LA 2CAUA 2Q4SA 1ZZ8A 3E97A 4GULA 4J1XA 5E16A 2HJIA 4XF0A 4MZUA 2H6BA 1RUNA 4HN1A 3M70A 4PIXA 2GH2A 4QM8A 1O5LA 4Q0SA 3FHIB 2OA2A 3O14A 4H7LA 1XE8A 4F7ZA 3GYDA 2F4PA 2XHKA 5I0UA 3NL1A 3OTFA 3SCGA 3D82A 4AQ2A 1VJ2A 4Q0VA 4MGIE 2GC2A 3N4MA 3EO6A 1Y3TA 4I02A 5LRSA 4I0BA 2Q30A 4JV4A 4K8FA 2N7GA 3FFQA 1NE6A 4IEQA 4XFCA 3S7IA 2VPVA 3E6BA 1Y9QA 1J3QA 5KBFA 4QGMA 5EFUA 4D7TA 3LA7A 2P17A 4PIZA 1IPKA 1QY4A 1UD1A 5FQ0A 2I45A 1YHFA 3NSTA 1CAXB 3ELNA 3QOPA 3CJXA 4IEYA 3ST7A 1YFUA 3ROUA 3OD0A 3HIFA 3R6SA 4IEZA 1U12A 3E5XA 4EROA 3NJZA 1NE4A 5LRRA 3H1MA 1EPZA 2ET1A 2CGPA 1CAWA 3FJSA 4IERA 3EHKA 1YWKA 4KU8A 5KHIA 4JTOA 4KWJA 1RGSA 5JCTA 1J3PA 2IC1A 5FLIA 3ACLA 1EY2A 1QXRA 1FT9A 4FAGA 1O3SA 1UIJA 3KMHA 1CGPA 1ZZBA 5JSRA 4QXKA 3RYPA 2D5HA 4B29A 4FAHA 3H3UA 2PFWA 4WBBA 4MGKE 3BALA 3IIAA 4O9EA 3CEWA 1LR5A 3H8UA 1ZREA 3DKWA 1L3JA 3U11A 4IEWA 3C3VA 4YYOA 2K9ZA 2V09A 3SCFA 1ZRDA 1VP6A 1FXZA 4LEJA 2PA7A 3GBFA 3RYRA 2C0ZA 4I3PA 1CAUA 1Q3EA 1NZCA 3LWCA 2HKXA 4AVAA 3EBRA 3WW2A 3FZ3A 1DZTA 1CX4A 2XL7A 5K8SA 3I54A 1H1IA 2UY9A 2GZWA 1ZZCA 2GC1A 1I5ZA 4P9GA 2BNNA 4YARA 1O3TA 4DINB 5LEKA 5CVRA 1EYBA 3LA3A 2FMYA 3WW4A 5J7MA 5E1RA 4CYDA 1LRHA 1QXJA 5KHJA 4N9HA 2DCTA 4HMZA 4HSLA 2IXCA
chains in the Genus database with same CATH superfamily
1D0HA 1JHNA 1V6JA 2H0VA 2IXHA 4NHMA 4AEDC 1LU2A 4ISQA 2YBSA 3QBQA 4QAWA 4XW3A 1PNGA 2XL9A 3NKTA 1L7LA 3POWA 3C8XA 2PAEA 4JX0A 4FTEA 3CLPA 2W1SA 4YNIA 5FKBA 5DG2A 1PMHX 1LODA 2DVAA 1WW5A 2D93A 3DYOA 2VZ3A 3J7LA 1X8MA 3N7LA 5T3NA 4BJ0A 3CU7A 2CGNA 1MZ5A 1LULA 3KGLA 4HT1T 4OVEA 2XKOA 2RS13 4EN6B 1ULOA 1XYNA 2DDUA 3NQHA 2XJRA 4CE8A 5HCBA 4JRLA 2RDQA 4NJ4A 4EV0A 3I97A 1LHVA 1ONAA 5IFTA 3RZJA 3BN6A 2GH8A 5C3SA 2ILMA 3I2HA 3MW4A 2OUJA 3WNNA 2XKPA 4RGKA 4XTPA 1BQPA 2WNUB 4MH0E 4EJRA 3TN92 3BCWA 3VZOA 4C1XA 1SFPA 4DFSA 1POQA 3O0VA 4KL1A 4ZXEA 1DGWX 2VBPA 1QNWA 5FZHA 3W5MA 3B00A 1I6XA 1HKDA 1OOPA 1QOTA 3GHNA 2CL2A 4AW7A 3VKLA 4CVUA 1PX3A 4AFCA 4B3NA 1FPN1 4R8HA 2BTVC 1VBE1 2GNMA 4HVQA 4XACA 2FDHA 1RL3A 1XPWA 1N3OA 1V0AA 1XXNA 4N53A 1OT5A 1QJU2 1UOJA 1ZZ7A 5CYYA 1O8PA 2BOIA 2BRTA 2ZA9A 5A3WA 5FMDA 4HOOA 2K0GA 3ZYBA 3E6DA 5AC91 2V4VA 3U0ZA 2E63A 3O1UA 2P2KA 2LALA 4JRAA 2WO7A 4WVMA 4ZHNA 2D5FA 4QX1A 1K45A 3IDEA 1POV3 4AEDB 2RMU2 1PIV3 4ASKA 1MQTC 5EQUA 5A7OA 2BVBA 4Y1ZA 1QWRA 1EAH3 1Q8VA 3Q9OA 1CAWB 4UFHA 5KR7A 4Q29A 2ZACA 2EXJA 4XJ8A 2ZKNA 1DQ0A 4LA3A 3IWZA 2Y6HA 1MS9A 2Q8OA 4AFAA 2RS51 3LPFA 3JBG3 4KWUA 1SACA 2BYVE 2AC1A 4YVSA 3OPTA 1ODMA 2BNMA 2JB8A 4CU6A 5HI0A 1GYKA 3SMHA 4LO4B 4QPGC 1QJY1 5FUIA 4PI0A 1KD7A 2W2IA 4MX3A 4RHV1 3I3MA 5HCHA 2HWD3 2BV4A 4CUAA 3ME2A 3PJQA 1C1FA 3APBA 3U14A 4PT6A 3NJYA 4UW4A 4ZZ5A 3AZZA 3OUIA 1HRI2 1F5FA 4U2AA 1E5IA 3ZFGC 3IZOA 3DF0A 1LJ7A 1BEV3 2R072 2WC2A 4YLZA 1RUE3 3VGIA 4CCKA 1EV12 3WINE 3N9MA 3FLTA 1DYPA 3RRDA 4QPIA 2WT1A 1AX2A 2XB6C 1JZ5A 1GOFA 1SDDB 2WFF3 4B7EA 4Y5TA 5JI9A 5IVEA 3N9LA 1AZDA 2D6MA 3UKTA 4F8AA 5A6XA 4ASLA 1HX6A 1ZYBA 4RS5C 3LOBA 1NA1C 1UZWA 4QPWA 1A6CA 3WF2A 4QT6A 4Z8BA 2ENRA 1MQTB 3NVCA 3M3QA 3MO4A 1M06G 1OVSA 1LOAA 2A3WA 4JDOA 1CZVA 1WLWA 1Y9MA 1TMF1 3M2MA 5I8YA 2QVSB 4HVOA 2W5FA 1N1YA 2YC0A 2VL4A 3CBNA 1C5IA 1AJOA 4GALA 3B02A 3N9NA 1WMDA 1GP6A 4UXAA 5D1IA 2VY0A 1UL9A 4NRQA 3IB3A 3UJQA 1LKNA 2ZBJA 4AXOA 4GAZA 3VBRC 3J4UH 3HMYA 3OJBA 5JZGC 1OD3A 2QZ2A 4BLIA 1COV2 4QDQA 3D5OA 4OHVA 3ZN6A 2QQJA 2VTFA 4KU7A 4QPGA 2RG4A 4HL0A 1LOFA 1RUOA 2GN7A 1PO13 5I91A 1UY3A 3WHTA 3B7MA 4AHYA 3ZYIB 4NROA 3ZFGB 4BXSV 1SG3A 2DYCA 1AYM3 1HV0A 1U5ZA 2P3JA 3WDUA 3W58A 3OPWA 1VLNA 2QCSB 4Y3OA 5DABA 4EN8B 2FZ1A 5I8SA 5F5QA 2R063 1UO9A 3LGRA 2Z69A 4CEWB 1FNZA 3USSA 4E9KA 1B35B 1RUI1 5FOJB 5LA9A 1RUH2 4KWLA 3RNSA 1BYHA 3UESA 2FD8A 2NQYA 1PMJX 5DAWA 2A75A 5HV0A 1NLQA 1XE7A 4P5HA 3AYEA 2XJQA 3VKFC 1MEC3 4RS5A 2YUEA 2Q8CA 1DQ4A 1NA1A 3EXUA 2XLFA 1S2EA 2XDVA 3G7DA 3I59B 4NHLA 1NZIA 4XUNA 5F5IA 1STMA 3WDYA 4I3GA 5F3IA 5FZ9A 1V6OA 1RUC2 2BWAA 3RZZA 1I1EA 2X5IA 4IV3C 4WM8C 1QOSA 1I3HA 1UU6A 4TN7A 2WT2A 2TNFA 2Q1ZB 3AMHA 3GJAA 5L9BA 4WZCA 4AQ6A 3ZIXA 4HANA 5F8PA 3MBWA 4Z82A 5EXOA 5GZCA 4PBOA 5FZGA 4TTGA 2VR4A 3HD8B 1NCRC 2W95A 4AI2A 3J26N 1YFXA 5JZGB 1C8M1 2B8MA 2HWF1 3VBRA 2HWE3 1OH4A 5FR3A 1GQPA 3P3PA 4RD7A 1JN2P 2WFPA 4BXFA 5DMYA 3ASIA 5SV5A 3AMNA 3N3HA 4LBLA 2OPKA 4PQQA 1EPWA 2BQPA 2CSGA 4CUGA 4FPJA 2O8QA 3KCYA 4IL7A 1H6XA 2JICA 2QZ3A 5A33B 4IE0A 1R091 1ZVFA 3K2OA 5E89A 3WDVA 2JECA 1ZX5A 2IVJA 1LESA 3VBSC 1S0IA 4DB5A 2ZTNA 1NY71 2WS92 4XPVA 2XLGA 2X53S 3DYPA 3RQ0A 2B5HA 3UK9A 3LIGA 3KV9A 1W0NA 2WAOA 3DL3A 4YM1A 1RJ7A 2VXRA 2BGPA 5GLZA 2AYHA 5FZCA 4AI9A 1V6LA 3WZ1A 1PVXA 1ULGA 1Y9GA 4WM8B 4IV3B 3RI8A 3KVAA 3MFAA 3WNKA 4M3CA 1CAXA 2QQIA 4CDXC 1CAVB 4OUEA 4IE6A 3MIFA 1RYYA 2EAKA 3V56A 4Q2FA 3GALA 5FPXA 1NG0A 2R041 2E9QA 5FP3A 1WMFA 4INDA 3B01A 5ANNA 3DN7A 1S0FA 3IDAA 4G9SB 4LO5B 5LBFA 1K5MA 2R49A 4Y22A 2WO2A 2Y6JA 1B09A 1XNTA 3ORJA 1NCRA 5A7NA 5LBCA 3VZKA 5ISLA 2A71A 3POEA 5H9PA 3VKOA 5CG8A 3G6JB 2O8OA 4ARYA 3QCWA 2E33A 4RSUA 1UOGA 2AACA 4XDOA 1R64A 1DCSA 1F35A 2J1AA 2KD7A 5FZEA 5JAXA 4P9XA 3I4IA 5DXDA 1RIRA 2E6VA 4XCAA 2W3JA 3R4UA 1W8ZA 2Y60A 2EALA 1AR82 2ZGNA 2V73A 2VQAA 3PVOA 4FFGA 2BNOA 2VOVA 1JMUB 4KI5M 1TME1 1KITA 1UZYA 2WINB 4R52A 3GZEA 4COYA 2WABA 5B4XA 3AP7A 1AYN2 3VBSA 1FPN3 5FLHA 3KHCA 1IS4A 1VBE3 2DCJA 1CONA 2D44A 2MNGA 3FUOA 2B7YA 3I3EA 1G86A 3M3OA 4GMP1 3ZFEA 3MFCA 3CZJA 5J3UA 1X8EA 3PVBB 2IXIA 1J3RA 5JPNB 1GANA 3SH4A 4P9WA 5AC93 4I0WB 5F5CA 1UYPA 1A8DA 4P9JA 4B1LA 5JSOA 3J7NA 3BPZA 2NYYA 4QU2A 4HBNA 5DG1A 4AI8A 2HWC2 4CDXA 1Q5OA 3CJIC 3U78A 3LFMA 5EPAA 3KT4A 5JLVA 1W9TA 3C7HA 5FZFA 5J37A 1C28A 1JHJA 5CAZA 1HRV2 1W9WA 5F37A 2BOJA 3K48A 5FZAA 2NM1A 2ZZJA 4BPZA 2RS53 3DPRA 4Q4W2 4Z2WA 5BNNC 3EB7A 3U07A 2YXSA 3AL5A 3PL0A 4B8EA 2D7FA 3SKJE 4XYXA 5CIRA 3MI8A 4LXLA 3ZXAC 3IM0A 1QJY3 3LEIA 1X7NA 2RS31 4RHV3 1H30A 1W2NA 2ES3A 1WA4A 3S5AA 1PM4A 1HQNA 2I74A 1NCQC 3Q8AA 3AKSA 3NJVA 4WVZA 2CWSA 4JTNA 3JD72 3MICA 3SLIA 4MGQA 4AQTA 4KGQA 2Q4SA 1X33A 4N43C 4MZUA 2I2SA 2DFCA 3UNPA 2ZGUA 3T1MA 1UKGA 2TBVA 2GH2A 5LA2A 3RZMA 2JE9A 1AR92 2PHFA 2VGDA 3FHIB 1PGL2 4ZY9A 3AMPA 1FAYA 3O14A 2HBTA 1RJ8A 1HB2A 2Y38A 1HXS1 4SBVA 3OD4A 2XWJB 2XHKA 2VOTA 2YBKA 3D82A 1W6NB 5A3NA 5L7OC 4XUQA 5FTTC 4ES9A 2AEZA 4BMBA 4CP1A 4EQVA 2YHJA 3HNMA 3JUUA 2BDRA 3Q8BA 4FFHA 3EO6A 3N4MA 5BNPA 3MPPG 4GH4C 3JU9A 1HDKA 4Y4RA 2QQLA 4I02A 1ZRIA 5A6QA 1VB4A 2XWBB 4I0BA 5T5OA 1UMHA 5EJZB 1PK6C 1H9WA 3CJIA 3FFQA 4LE4A 3W59A 4BQXA 1TMF3 1R1A1 1NE6A 4FOYA 4L92A 4LIUA 2VPVA 1LENA 4QQLA 3ZYPA 2FDIA 1Y9QA 4ZPIA 4PLMA 3JCIA 3O1OA 2P17A 3C2UA 1W90A 2VZPA 1F4HA 5FZOB 5IVYA 3VBOC 5BNNA 2JWPA 2YC4A 1OH3A 5DAXA 4A44A 4S2DA 2I45A 5TSWA 4P00B 1F31A 3I2FA 3NSTA 2XH6A 3PU8A 3H8OA 2Y6KA 2A73B 3HIFA 2C1FA 1VBB2 2ZHKA 3R6SA 1NCQA 2JG8C 3J8F2 1WW7A 3GGLA 3NJZA 3B5LB 3UV9A 2W39A 3NV3A 3MIEA 2ET1A 4LLFA 4DS0A 3EHKA 4QHOA 4XHBA 3HWJA 4N43A 1DFQA 1JUIA 4CU7A 4D6SA 1RGSA 1J3PA 5FLIA 4LBJA 1AUYA 1RUI3 2YDEA 4YW6A 4LHLA 3MHZA 3WP6A 2ZX1A 4AR2A 4XJAA 3KMHA 1CGPA 2WUHA 2ZHMA 4B4RA 1MACA 2VZUA 5ACA2 3DXUA 5JMOA 4D6RA 2D5HA 4MHRA 3KT7A 4JQRA 4MYEA 1VBD1 3LSEA 4FAHA 2PFWA 5L7OA 1UX6A 4GH4B 1OLME 2KA3A 4YW7A 3TEWA 1BMV1 3IIAA 1UNBA 1UYYA 3AXDA 5C3RA 4JKMA 2D98A 2AREA 4K7JA 3VHNA 1ZREA 3U1XA 5ERLA 1W06A 1L3JA 2R16A 4H2AA 3U11A 1PK6A 4YYOA 3C3VA 5C71A 2JD4A 5FZ1A 4HKOA 3SCFA 3WR0A 3ZMOA 1E5SA 2CGOA 1FXZA 2YG0A 4DUWA 1OF4A 4AI1A 1YCIA 3GBFA 3ACGA 5L73A 1ENQA 3NMBA 3UJOA 4AFMA 1C8M3 2HWF3 3AJZA 3RYRA 3VBOA 4XQWA 3VZJA 1SHWB 2A6VA 4BQ4A 2R0HA 4BZ4A 5ABJA 1W8FA 3LWCA 2XHNA 4C0HA 4LIVA 3ZXEA 1JH5A 3NAPA 3O1SA 2OW4A 1DZTA 1CX4A 4XMIA 5K8SA 4WVVA 3KZ4C 2UURA 1C1LA 2E26A 1LAJA 1ZZCA 2JG8A 3SISA 1R082 2BNNA 3LEMA 1R093 3OG2A 4D94A 1CIWA 5HV4A 4YARA 4DZGA 5E8AA 3VL8A 3MEPA 4QX7A 4XVHA 2VU9A 4DPNA 1XNKA 4FP3A 2XBO2 3QH6A 5KXBA 3MW3A 1J1TA 1YJKA 5FBJA 5CVRA 1EYBA 4Z1VA 3SH5A 1PVC2 1QQP2 1O91A 4PF5A 1RUD1 5C5TA 1BK0A 1ND2B 3DYMA 1UXXX 1RVF1 1APNA 3LD8A 5A32A 5KHJA 1K5JA 4YM0A 1GZCA 4GJYA 5FAXA 4BK4A 1ZZ6A 3T0BA 5J36A 3X29B 4OI4A 4M3CE 4UFJA 3NV1A 1YLLA 4OYUA 4ONUA 4OUMA 4LUMA 3TN91 1ZA7A 2IVIB 2WYFA 4YFWA 2R043 4R9BA 5HPOA 4MXWB 3IT8A 1DQ5A 2E31A 4LBQB 5JSPA 3ACFA 2RJKA 5F5AA 4G3YC 4QQHA 1BJQA 2EXKA 4OHZA 1JOBA 4ORFA 5FZLA 3D6EA 4LKDA 5CKMA 4QQPA 2C5DA 3EQEA 4YM2A 1ENRA 1HV1A 1WBLA 5A7WA 4BH9A 5CEHA 3VD3A 1YQCA 2ETEA 4A42A 3GBGA 1G9FA 4GQ7A 1KRIA 4UFKA 5DDJ1 2VNGA 3LKJA 5ANQA 1O3QA 5KHHA 1RMU2 3DEMA 5CU1A 5C9AC 4OCTA 4HSJA 4YW5A 4OI0A 3ZVXA 2WN2A 1H4HA 4DNYA 2G1MA 3AP6A 2A70A 3SNMA 1H2MA 3AP5A 4YZ3A 5DZGA 2AEYA 3P5BA 1ZBE1 3H1WA 1RUG2 1VE0A 3AMMA 3PNAA 1LGCA 4W50A 1TME3 4HVRA 4AQSA 3IPVB 3B9CA 1IG0A 2D6KA 4YG3A 2B46X 4Z92B 2AENA 2ARXA 1IPJA 4E4HA 2EIGA 1AL21 5FQ0B 5A6ZA 1O3RA 4XBNA 1POV0 3T3YA 1X36A 4GMP3 1LOGA 4EZHA 5FO9B 5CFDC 3GBWA 2CNAA 3LAGA 4CCEA 4DUXA 1MR5A 3P1IA 1PMIA 4LK6A 5C8CA 5I0SA 1H6YA 2YB7A 1SLBA 3B94A 2Q5TA 4W4ZA 1UPSA 4LO7A 4GKYA 2W92A 1QF3A 1W8NA 1HRI1 4RN5A 3M4FA 2P1BA 5IVVA 3FX3A 3BTAA 4ET7A 1JODA 2R071 3IN9A 3KB5A 4BYYA 5D8AC 3U37A 4E8CA 2SLIA 1E5RA 5FYCA 1ASJ1 1CVNA 3VZNA 1I5PA 1ACCA 2J1TA 4A7ZA 1GOHA 1UPIA 1XBFA 1N1TA 2MEV2 3WW3A 4DXSA 1SEFA 3ZR5A 1SFNA 2JDPA 5K4LA 4YPJA 1UW8A 4N7IA 2R6QA 1AR61 3I3DA 1BBT2 5A1AA 2VCMA 5FPBA 1H4GA 2AR6A 2OT7A 2RS33 1CESA 3VBFB 1FV2A 3GHMA 1W6MA 3PTRB 2C9AA 1LGNA 4OQ8A 3QLQA 2DF7A 4NPMA 5C9AA 3T0DA 2K2SA 4Q4V2 4E4SA 5C6CA 4WV8A 5FP7A 3IBMA 2GC3A 4UF0B 1UQXA 2J1VA 2JG9A 2WSUA 3CL1A 4K1ZA 4Q4Y3 1VR3A 3VKMA 5LA0A 3DECA 2UWBA 4CXYA 4FPCA 4MUVA 4HPKA 2DU1A 2R30A 1UY2A 4QX2A 1UIKA 3LOIA 3N9PA 5AVPA 4HN0A 4AVCA 3MLKA 5HBAA 2J1EA 3KGZA 1HXS3 4O61A 2XUEA 3ZSEA 5F9TA 1COV1 2ZGLA 3LE0A 4ISRA 1L7QA 1LHOA 4JKLA 5CFDA 1RUJ1 3C7FA 4YG0A 1VMHA 3FMGA 1VRBA 2W91A 4FBFA 2V5YA 3T0AA 4EE2A 1OOPC 4FPEA 4FQZA 4LLOA 4LULA 4YVWC 5FY9A 2EIDA 2RS12 3HPNA 4CP0A 5D8AB 3ZMNA 2LUWA 3LQCA 2P34A 2VZ1A 3ON7A 2IWGB 3V0AA 1RUF2 2W1UA 3WCSA 4EWDA 3BOWA 1SMVA 5T54A 1REFA 3F2ZA 4N53C 3ZDSA 1DLCA 3MLJA 1UF2C 3O0XA 3OPZA 4NHXA 5FZMA 2QQMA 2PYTA 5JR7B 2A6YA 2PXJA 3RMXA 2ATFA 3NNLA 4ZONA 3T4HB 2MHFA 4RL7A 3L2HA 4IQPA 2D6OX 3HR9A 3MIBA 3Q8CA 3I2KA 1UCXA 3AZYA 1DGLA 1QOOA 5IJRA 1GZWA 2PTMA 1DQ1A 2CWMA 3KM5A 4P02B 2PHTA 1YJLA 4GWNA 2GNBA 5BNQA 5FLJA 1CN1A 1NXMA 2EICA 4YVSC 1PZ8A 2WSVA 4IEVA 4TXWA 5KBFA 2PHUA 4OMDA 4XBLA 1WLDA 3ZSKA 2VVDA 4UOJA 2VMDA 4FPLA 3OB8A 1FI2A 1PIV2 1XSQA 2JEMA 4MGZE 1FX5A 1RHI1 5D21A 3KV5A 3AB0A 3SXWA 2BBVA 3SKVA 3AYDA 1CJPA 4X6QB 5G05L 3KSCA 1FOD1 1H8TC 1VBD3 1YFWA 2KXLA 3ALQA 3J7HA 2BGOA 4FPYA 3ZYJB 3H1YA 2IXJA 2ZMKA 4FO9A 1LOEA 4XUTA 5JDBA 4BQ2A 4URTA 3MGUA 1OOPB 2H6CA 3CMGA 3DV8A 4EWEA 4DXTA 4YVWA 2FZ2A 1OFNA 2B39A 4QPIC 2JE7A 4XIOA 2OXBA 3N36A 4N53B 2NPIA 1W99A 4LBKA 4X6RB 2VULA 2HWD2 2W46A 3HT2A 3T2PA 4XFFA 4BM8A 2BGCA 3MYXA 4FXGB 1MS5A 4AZZA 3V64A 3BTYA 1QH7A 5G04L 1DF0A 3ITQA 3NNJA 1S0DA 4HFSA 4WVMB 1SQ4A 2DURA 4LHNA 2GC0A 1RUE2 1IHMA 4W6WA 5CA6A 1OUSA 2O14A 1W6OA 2Y6LA 3J7MA 1OPOA 4GB31 1PZ9A 1UOBA 2WFF2 1U5YA 1W8UA 1LNSA 3NKGA 4QX3A 1OF3A 4GJZA 3H7JA 4DXZA 4FTSA 4YVSB 2PAMA 4E2QA 2UU8A 5JOXA 3SH3A 3Q8EA 4AFDA 4GZ9A 5FYTA 1Q8PA 4FPHA 1OI6A 4MVTA 3WG4A 4WM7C 4R4ZA 2P3IA 2XJUA 5FYYA 1WW4A 2WDBA 4OHWA 3UKVA 5CBLA 3OUJA 5K0UC 1IQDC 3LA2A 5DZEA 1LOFC 2VZQA 4P9YA 3MIGA 2A7AA 5EV7A 1RUD3 4EN0A 1XNBA 2P5BA 2V72A 3AZVA 5IAVA 4RFRB 1RVF3 4OFGA 4RR3A 4YG6A 4HONA 3JB4C 4IEXA 2QNKA 1H8TA 4URAA 1DZQA 3TB0A 4IETA 4XFHA 5FPAA 3GZUC 3PLQA 4KNCA 3A4UA 3FE5A 1AR81 3TN93 4QPIB 3WQ1A 3BIEA 3CO2A 4XIKA 5DUXA 4GIQA 5IK5A 3P6BA 2ORZA 4MO3M 1H2NA 4PDWC 2Y0OA 3TNQA 1PO12 5FPUA 1F8VA 3PJYA 2D6PA 5FYBA 5CFCC 2FHRA 1W8HA 3POGA 1O4YA 1LHWA 3OGVA 4FPKA 1AYM2 4YGBA 5IHRA 4CTEA 4WZFA 5LASA 1KXGA 3RYKA 2J1UA 2CAVA 2R062 2X5IC 3WOGA 4AAPA 3E5UA 1C8NA 5K9YA 5DDJ3 3OBTA 1IS3A 4I01A 1ENSA 4FQ4A 1AHSA 4IGOA 2OS2A 4TSVA 1JU4A 3ZDVA 3ZX7A 1X82A 4PF1A 1JYXA 1W0OA 4QKNA 3ES4A 4H7MA 5EP9A 3HOBA 5A3MA 1J59A 1UKRA 2ZZQA 5EIYB 2WQZC 4XTMA 2KM2A 2CU5A 1ZBE3 1GV9A 2GSYA 2RR11 3NW4A 5GZDA 1MEC2 3GCWA 1GNHA 5J09A 5AFEA 3RDIA 2D3SA 3ZN6B 2D40A 3INAA 2WLQA 4QPGB 4WM7A 3M8LA 1QJEA 2QQUA 1AL23 3USUA 1TZOA 1WCDJ 2DTYA 5LW9A 2PQSA 5K0UA 4Q4X1 3ZPYA 4NR1A 5C8WA 1F4AA 2VMIA 5F1RA 2VTXA 4AOCA 3T1LA 1MVQA 4ES8A 5HXVA 2GP3A 4GD4A 3EJKA 4PJYA 2W1QA 4NIDA 5F2WA 4C8DA 4AGGA 4LKEA 3KS7A 1I9RA 1GICA 1P8JA 1HN1A 2VW2A 4FP2A 4CCMA 3NV4A 2OVUA 1QJZA 2YROA 1JYWA 4CCCA 5DUWA 2HWE2 1YUDA 3K4DA 2R073 3VBUA 2VW1A 1IG3A 1ULDA 1RC6A 1ASJ3 4HK9A 5FRAA 1ZA4A 3AM2A 3MZHA 3E5QA 4CXWA 5J96B 3W5NA 4KG8A 4W6YA 4PDWA 1PGL1 4Y26A 4RS5B 5J1XA 4C91A 1NA1B 3SHRA 5CFCA 1W6PB 3E6CC 3BPSA 4Q0UA 2SBAA 5JXIA 3ZKYA 1OLMA 4AGRA 2PLV1 2X5IB 4BQ3A 3ZOIA 4DEQA 1AR63 5IW0A 4K9SA 5HCFA 5FPZA 3WW1A 3VBHA 3CHXA 1V6IA 5FZ7A 4XJZA 4Y24A 2CAUA 2X09A 4YW4A 1GP4A 2VQTA 3E97A 4GULA 4J1XA 5DN2A 4XF0A 1PNFA 4BQ1A 3D4KA 1Z0HA 4JZRA 5FYSA 5T5PA 1K5MC 4PIXA 3O1MA 1URXA 4Q0SA 1DBNA 2ZABA 3VBRB 3BU0A 1S55A 2V4AA 5JXGA 4H7LA 1XE8A 3WG3A 4F7ZA 4K3UA 1BVP1 2F4PA 4BE3A 3ZM8A 3OTFA 3SCGA 4JHZA 1YI9A 1U0AA 4OI2A 4Q0VA 4MGIE 2Y6GA 1UY4A 3UT0A 3MUZ1 4CXXA 2GC2A 1RUJ3 1YQ5A 2ORXA 1N47A 2Q30A 2W94A 1HIXA 2C26A 4JV4A 3ACIA 4A41A 3IIIA 4IGQA 1UXZA 4IEQA 2VCAA 4HK8A 4XFCA 1QJFA 4B4PA 1OURA 1S2KA 1T6GC 1C5HA 2PHWA 2ZGPA 1DYKA 2VVFA 1US2A 2WA3A 3AKTA 5EFUA 4A6OA 4D7TA 4PIZA 3WQBA 1JZ8A 3ZFEC 3VD9A 3GF6A 3RS6A 3ZSJA 3B69A 4NE9A 4IXLA 5F32A 1YHFA 2J42A 1Y7BA 2W1WA 4M3CB 1CAXB 2VAUA 1PGW1 3OOXA 3QOPA 5FYUA 3THPA 1YFUA 4ITCA 4JDNA 4YFZA 1N3QA 3CQOA 3FBMA 3LDBA 1GKBA 1IPSA 3I49A 1U12A 3E5XA 4EROA 5CISA 2VTXJ 3ZYRA 1IKPA 5LRRA 1FPN2 3U75A 1K42A 3VDDC 2BWCA 4D0QA 1BVVA 3FJSA 1JS9A 1K5MB 4Y22B 2HEWF 3T09A 4XABA 1YQ8A 1CQ9A 5JCTA 5KHIA 2Z4FA 1NCRB 4LBQD 5FZ0A 3DPRC 3LB9A 5FPLA 4BQYA 1O3SA 2WJSA 4UT5A 5AC92 1S0BA 5A7SA 4AVTA 5FBZA 1G9BA 5FY5A 3M7AA 4FPOB 5FYZA 4LOTA 4QXKA 4AG4A 3URFA 3RZHA 4B29A 1H8VA 1RHI3 1FV3A 5KXEA 2BFUS 4YZ4A 5T5JA 3N35A 3BGAA 5EYYA 5CZKA 1FOD3 1W9SA 3AKQA 3RSJA 1S1AA 3AVRA 4PBPA 3VZLA 2RS52 2X10A 3POYA 1VAMA 2BERA 1U5XA 4Q1PA 2K9ZA 3VBSB 3RZKA 3RI9A 1ZRDA 3PVEA 4CU9A 2D6LX 3B93A 4P14A 1VP6A 2OQ7A 2RHPA 1QJY2 2PA7A 5LB6A 3ZFEB 4CDUC 2XBO1 2VUCA 1Z7S2 4RQPA 4RHV2 5DAVA 2BW8A 5FY8A 1W05A 4I3PA 2VO5A 3VHPA 1JW6A 1CAUA 4DY3A 1UYZA 1NZCA 2XOMA 1GP5A 2VZRA 3K4ZA 3WG2A 2HKXA 2WAAA 4LK7A 3EBRA 3KQ4B 4AVAA 2DFBA 5JI7A 5BNPC 1N1SA 4YZ1A 3FZ3A 1KS5A 4CDXB 1HB4A 4AHXA 4Q1RA 4NWWA 4CCDA 4LT5A 2ZHLA 2GZWA 2UY9A 3OBRA 2WNVC 4XQ4A 2GC1A 1I5ZA 2XJTA 4GB33 1NOVA 1OPMA 3MIDA 3ZFFA 3VDDA 2VW0A 3T4VA 4LITA 3PUSA 3DPRB 1QGLA 5D2AA 4TZDA 4LJHA 2PHXA 2HBUA 1SLLA 2FDJA 3KT1A 2W47A 4TLGA 3OY8A 1PO21 1VB2A 1SBFA 2YPDA 5J7MA 1ND3C 3A0NA 1W28A 5E1RA 1ULEA 2BBAA 2QE3A 4M0HA 2W0XA 1G8WA 5GLVA 4CYDA 3MW2A 1SBEA 4N9HA 2Z42A 5IUQA 3GZAA 5JOZA 5F7UA 4HMZA 4FOWA 3N7KA 1OHFA 4UBGA 4UFMA 1BXHA 3J9SA 1ULCA 4P9LA 2PAKA 2WZR1 4COZA 5LY1A 5GZFA 2QDRA 4META 4XMAA 2D6NA 5FJKA 4FOVA 5C33A 1AR83 4V2VA 3KF3A 2PQQA 5A3PA 1FMD1 2CDPA 3BKZA 4LA2A 4RYDA 1NAEA 4D3WA 2P37A 4O7XA 4QX8A 1IGOA 1YO8A 3BB6A 4CDUA 1LU1A 3VL9A 2ET7A 2YFUA 2ZOEB 1YYNA 4GKXA 4IEUA 1VRH2 4L11A 4XEZA 5AVAA 1LEDA 2WWSA 3SITA 5LK5A 1DG6A 3ZO0B 1E57A 3PUHA 2XMLA 5BNPB 4Q0QA 2DUPA 3POFA 4DRRA 1AXZA 2JENA 1W04A 3CJIB 4Y20A 1DU3D 1WGPA 1TE1B 1U5IA 1RUI2 2LS6A 2WNVA 4XC9A 5APAA 2VECA 2OX0A 3SEPA 3GJBA 1US3A 3PUQA 3H8XA 3AZXA 5BNOA 4ATEA 1WZXA 1AR71 1H9PA 4KQ7A 4CRQA 5BNNB 1SLTA 4GMP0 4Q4Y1 5FO8B 3GM8A 1GR3A 2RR13 4CCOA 1SFYA 1NLRA 1SLCA 2XJSA 2YU2A 4Y4YA 5F6KA 2B9VA 2YGLA 2BP6A 3FUQA 3OGJA 4LUKA 5B2GB 5JUVA 3MV11 5ABJC 1ND3A 4JGYC 3POJA 5FYHA 1SCSA 1OQ1A 4GWMA 4PQ9A 2DVGA 2WZEA 3NAPC 3UGGA 2A3YA 2UWAA 4Q4X3 1V9U2 1NCQB 2ZXQA 4A4AA 3UKNA 5GLWA 4JKKA 5LATA 2TUNA 4OQ9A 2VOWA 4AVSA 4AL9A 4EWAA 4N43B 5F39A 3B3QE 4AEKA 1UMIA 4YW3A 4Q4V1 5A3UA 2DVBA 2HWF2 3WNLA 1JZ4A 2WYSA 2Y0IA 3ZXKA 4E2SA 3CNAA 4Y1XA 2WO3A 2Y26A 5E88A 2XUMA 5C4WA 3T30A 4ZU7A 4FT8A 5KXCA 3ZXFA 5L7OB 2LRPA 3WQ0A 5EHDA 2IFRA 1A8MA 3LEGA 4FOQA 2RVAA 5C5UA 4W65A 3HN1A 1R092 4R9AA 5GM0A 2PLV3 1ZZ9A 3S7EA 4AVVA 4EN9B 1LB2A 2NLRA 2RM21 1REEA 2B45X 2QQWA 1PK6B 4HXCA 4Y5SA 3NRUA 5IATA 1YEWA 4P5YA 1WCQA 1NY72 3VHRA 4CEYA 4IE7A 2ZX0A 1PHMA 1QJX1 1W9YA 2WWJA 1D4M1 4BDVB 1ZRFA 2IXKA 4CUBA 1O6UA 1QU0A 3VKNA 1RUF1 5DQ0A 2A6XA 3AYCA 4KGGA 4L2NA 4Y5Z0 3VBOB 1BZWA 5LEJA 5ABJB 3P3NA 2FQPA 5I0TA 3WNOA 5KC6A 4LMFA 3NAPB 1AF9A 4IV1C 1G6NA 3FN9A 1WUVA 4JGYA 2HWB1 2HLEA 1DIWA 3R4DB 4KWKA 5GZGA 3NO8A 2R042 3OGGA 2Q8EA 1G7YA 2VMHA 4QXHA 2JG8B 2K46A 4MV2A 2QQPA 1PZ7A 4YSFA 2XQXA 2VVEA 1NLSA 3CKHA 3ENRA 3O5SA 1F15A 3WF3A 2JE8A 5GKAC 1JXNA 2VM9A 4NVPA 4RFT0 3ES1A 3VZMA 3ZXJA 1J84A 1DDLA 4XXAA 3FLPA 3KHBA 1OKQA 4FXKB 4DQAA 4JGZA 4AF9A 3CDZB 1VMFA 4A7YA 2GALA 5A32B 3RFRA 3KV4A 1KDKA 2Q1FA 5FYVA 3RJRA 4QB6A 5C8CC 5A80A 2F4LA 2WL1A 3K77A 3WXPA 1SLIA 1V00A 1VMJA 2Y34A 4P9IA 3WCRA 2D3RA 3KLSA 3T08A 1VBC2 4GA9A 4E2GA 2QQOA 1SPPA 2UWCA 3AX4A 4XZUG 5FWEA 5JIAA 3S57A 4NRMA 1OKOA 4UBHA 4B7KA 3PMSA 3U10A 3KV6A 4XHXA 3WG1A 1J83A 4XETA 4Q27A 3KVBA 4A45A 1W03A 1OFSA 5A7WB 1HJGA 3VN4A 3IKWA 4BIFA 2HWD1 2IUWA 3HN3A 3POSA 4DO0A 2Y8KA 4UI9L 1OA2A 1S0EA 1QJU1 1D2QA 2WBKA 1AVBA 1M4WA 1VBA2 4Z2AA 5LA1A 1UN1A 1WLCA 3VHOA 4LQRA 4YZ2A 4IV1A 3ZN5A 4N8MA 2C9KA 1HN0A 2E7TA 4ZS2A 3SC7X 4QQOA 4J6GA 5JPMB 1JI6A 4IEPA 1XQNA 1OSGA 3M3CA 5FXVA 2RMU1 2YU1A 3LZZA 3OGSA 3H7YA 3FWEA 4QX5A 2JG9C 4GWIA 1IS5A 1A3KA 1QMJA 4S2GA 5FMOS 2RJLA 2GMEA 5LWBA 2FCUA 2J22A 3TEYA 1WLTA 4M3CF 3THCA 3D0JA 4XF3A 5M0TA 1V70A 2W68A 3JXSA 4NMIA 1EP0A 2XBO3 2RV9A 5H9SA 4AEMA 4CA9A 2RS32 5K7PA 1W0PA 1O5UA 1OA3A 1NQDA 5C8CB 3N9QA 5FDBA 2GN3A 4EN7B 2YZ4A 2Z2SB 3D8CA 1KQRA 3LFIA 4XDQA 4C0BA 4D69A 4CDWA 4AGVA 1TQ5A 3S6PA 1O8SA 2H0BA 3WLUA 3BTZA 3HBKA 3CF6E 1WMEA 2DWRA 3ABZA 1YXWA 1XB9A 1OMIA 4OZOA 2Q0AA 3AMQA 5FZKA 2Q8DA 4ZS3A 3FC0A 3THTA 2XVKA 4RGGA 1EV11 5EJ1B 1HLCA 1ZM1A 1JZ6A 2QKDA 2ID4A 1ZBA2 3FL7A 4HZFA 5DAQA 1NKGA 4UFLA 4CU8A 2G4IA 1PO23 4LKFA 2O0OA 5FJHA 2VBDA 3ILRA 3O12A 5JMCA 1MPXA 1Q43A 1NYWA 1TVGA 2VH9A 4OUSA 5LZ6A 3RWKX 2DBNA 1RITA 2YFZA 1W6MB 4NN0A 4KBBA 3UL2A 4PLNA 1JZ7A 5C9AB 5BYNA 3ECQA 1W6QA 5I0RA 3VUOA 2JDAA 5T52A 4MADA 4LBOA 2A5ZA 3LEKA 4CSWA 2JG9B 2CDOA 4Q0PA 3V0BA 2OYZA 4CDQA 2WZR3 1XRUA 4HPKB 1CD3G 4L0PA 3UGHA 2ZKLA 5FIXA 3MF9A 4XFAA 4Q5OA 4ASMB 5KHGA 3UETA 1WA6X 1FMD3 2DBIA 3I3BA 4TLFA 4XJ9A 4AI3A 1JOJA 4NPLA 3KWVA 1YFYA 5FZ3A 1DHKB 5CFDB 1OVPA 3ILFA 4PIYA 2FCTA 3JZVA 1GQGA 4Y1VA 1T6BX 5FUPA 1GWKA 3H3LA 2A3XA 3KCCA 2E7AA 3KF5A 4JCKA 5E6HA 2XJVA 1ZRRA 5JVVA 1MVEA 3C7OA 3WP4A 3ETQA 5FY1A 2GU9A 3RWNA 4PI2A 4BQWA 1CPMA 3V0AB 5A1LA 2JDKA 3OYWA 1R1A3 3EYPA 4CUCA 3TAYA 1AR73 4QM9A 4LO6B 3S30A 3OCPA 4K1YA 1V6KA 2ZEYA 4QGLA 4PLOA 2EXIA 1RUH1 1BHGA 2ZCWA 2XR4A 3HT1A 3NNGA 1VBD2 2XONA 3BODA 2PELA 1XOYA 4D8MA 1BMV2 1VAVA 4XFIA 1TNFA 2GP5A 3IMMA 2B9UA 2XJPA 4Q26A 1Q56A 3I2JA 4BCUA 2DVFA 1PGSA 2RE9A 1GZWB 1LHNA 1WKYA 2WNUC 4JDMA 4XE9A 4MXVA 1RUC1 2V5DA 5L9VA 2TEPA 2PHRA 4R4XA 1T2XA 4MGYE 2BEOA 5FZIA 4XAEA 4EZ4A 4CP9A 4CPBA 5JOWA 2RDSA 2NZ9A 2DUOA 4Q4V3 3WX5A 2W9XA 1MZEA 1YQ6A 5H9QA 2OIIA 1QEXA 3O1RA 2D43A 4BHPA 4A6SA 3U4SA 1W2UA 2ZAHA 4M00A 1GZTA 4XCBA 3PTYA 3FHQA 1EAH2 2QJVA 4RR3C 5FP4A 1LCLA 3RVHA 4NHKA 5IWFA 5KWRA 4L99A 3RZLA 2R0FA 5JXJA 1K12A 5IVFA 2RDRA 1TNRA 2JXAA 3FFZA 2HEVF 4YVWB 2OKXA 2C6SA 2RM23 3JBG2 4F3JA 3M1HA 2WIIB 2H6BA 3WD5A 1XYPA 1MS8A 2XG3A 1F9KA 3GXUA 4A7KA 1CWPA 4YW1A 2FCVA 4QM8A 1QJX3 2Y64A 1O5LA 1UMZA 1D4M3 1WWYA 4DOUA 1RUD2 5FK7A 4LPLA 1VPHA 2WS91 4JHTA 1RUF3 3GYDA 3HEIA 1RVF2 3KD4A 5FZDA 3ZKUA 1G9CA 1SDWA 3NL1A 4IDZA 1MS4A 1S4CA 5DPNA 1QXPA 1XSRA 2HEYF 1XNCA 4K8RB 2YPJA 4BOWA 4L97A 1CZSA 1BEV2 4ZXKA 1W6OB 2XPJA 5HXMA 4PHZA 2HWB3 1JYCA 4M0NA 2ADEA 2WNUA 1QDCA 3DCQA 2DTWA 2JDUA 2N7GA 5A7PA 2QBXA 3K51A 2R1BA 1Q8QA 2P3KA 1JYNA 4NPRA 5J98B 2NN8A 2ZGQA 3E6BA 4X8NA 5AFBA 2ARAA 5FFOC 1J3QA 3WT3A 3E1F1 3IAQA 1Q8OA 1XNDA 3LA7A 3LDRA 1IPKA 4XILA 1HB3A 3LF7A 5JXHA 1AXYA 4QDSA 2DCYA 1HJFA 1BK1A 4M4RA 1OBNA 3TEZA 5DDJ2 4RR3B 2IZWA 3ELNA 3CJXA 1H8TB 3N7JA 1GU3A 4NO4A 4ATFA 2LTNA 2X8KA 2GNTA 4AEDA 1ALYA 3OSDA 5KXDA 5A3TA 1ZBE2 4NAMA 4QDRA 3H1MA 1CAWA 2WZPP 4IERA 1YWKA 4Y33A 3O1PA 4TWTA 5IVBA 5JWPA 3KQRA 3VBUC 1S2BA 2VMGA 2IC1A 2DVDA 1AL22 3RZGA 1DP0A 1EY2A 4FFIA 3UYJA 1AYN1 3MF6A 2ZS6B 3BUCA 2GMMA 4NWVA 1Z7S1 1ZZBA 4Q8LA 3WDWA 5JSRA 3RYPA 1W2TA 3PDQA 5F2SA 1QJU3 3EMRA 1S0GA 1QH6A 2LM3A 4MGKE 1UOFA 3PVNA 2NMNA 2ZAAA 3VBHC 3BI3A 1XU2A 2E53A 1LR5A 2WNEA 4XURA 2FMDA 2HYXA 3H8UA 3S5QA 2I07B 5EYXA 5FZ4A 3DKWA 1ASJ2 2HWC1 4DEVA 3ZN4A 4IEWA 4V2WA 2RMU3 5CG9A 3DUIA 4CEWC 2V09A 4BQ5A 1B35C 2EXHA 5FKCA 1G9DA 2YYOA 2QQNA 1HRV1 2L9LA 2VBBA 3MUY1 2WQ8A 4LEJA 4WM7B 2PN5A 1GBGA 2DU0A 1KJLA 3USUB 1AR62 2C0ZA 4Q4W1 3WUCA 3VLBB 5K0UB 4KH9A 4CCNA 3K75B 2XVGA 2E32A 4UYBA 3WW2A 3AP4A 1KGYA 1OUXA 3F95A 5FMBA 1FNYA 1UZZA 2XL7A 5C3PA 3OBZA 3AK0A 4H14A 4MGSA 1MQTA 3VDBA 4YGDA 3IAPA 1DLLA 4P9GA 3B9IA 3JD71 3OEAA 3QD6A 4IE4A 3VDAA 3VBUB 3ZLIA 2A6ZA 1HRI3 3VB9A 1ODNA 3BYWA 3C7EA 4DINB 4YZ5A 2B4KA 4MG2A 2F17A 4PDWB 4AFBA 1EV13 2G9ZA 5CFCB 1NQJA 1AR91 2FMYA 2VCCA 3POBA 3RMYA 1RUJ2 3TWIA 2RDNA 1YIPA 4LKSA 2VUJA 4XQDA 1LRHA 1VRH1 1W8OA 5F3GA 2JKBA 3A22A 5FYMA 1IKQA 3GZTB 5CB7A 5FXWA 4HSLA 3VBHB 3WP5A 2IXCA 5IYYA 2XQRA 4Y1YA 3IDBB 2CV6A 3BOPA 2JDHA 3ZFGA 1UU4A 3DKQA 1HQLA 5FY4A 1UX7A 4MHUA 3GNEA 3WP3A 4CCLA 1JU3A 2A1XA 2VQ0A 2ZGSA 4IGPA 4K21A 3RPQA 1FYUA 2JJ6A 5IVJA 1GUIA 4RGAA 2OQ6A 5I8TA 4CEWA 2PMWB 4NRPA 1UU5A 3WHUA 5F3CA 2E51A 1B35A 4BISA 4C90A 1LTEA 3ZYGA 4A3XA 4MOAA 2ZGRA 4QU1A 2ERFA 1LHUA 3SQOA 2ZMLA 1W6PA 3H0OA 4DMIA 3BU7A 2R1DA 5GALA 3PUIA 2W08A 1COV3 3I59A 2VC9A 2EA7A 3DXTA 1XYOA 2VMFA 4QD2A 1D4VB 1V9U1 3WF4A 3VD4A 5CADA 1JUHA 1KJRA 1VBB1 2OZJA 2ZEZA 4XXPA 3H3ZA 3J8F1 4XF9A 1GLHA 3MLLA 2ZX3A 3WDXA 4D6QA 1XJAA 3H50A 4N9IA 3CZUA 4BK5A 5BV6A 1DGRN 3ZYFA 1CZTA 3JQWA 1Z78A 1DGWA 4NOTA 1DZRA 1O4TA 2VCBA 4RQPC 1KS4A 1RHI2 3O7OA 3THDA 5JZGA 4QXCA 4DRVA 3I2GA 3TYJA 5IT6A 3ZXGA 4YGEA 5JOYA 1RUH3 4XUPA 3I8TA 3PMEA 1FOD2 4Q8KA 1MS1A 4S2HA 1OD5A 3LPGA 3ZXLA 5ACA1 1QHDA 1H2KA 1YQ2A 2X05A 4BMEA 4EYUA 1NXD1 4IEOA 4IESA 5A7QA 1CX1A 2QTWB 2YY1A 4I30A 1RINA 3I3QA 3WVJA 5A33A 4J1WA 1RUC3 3GDBA 4HKLA 1X9TA 5DZFA 3ZFFC 1VBE2 2VNVA 3WY6A 5DAPA 2LW8A 1AXKA 3AVSA 1LGBA 1MZFA 1OLQA 2ARBA 1PX4A 2P4EA 5LBEA 2VE1A 2QQKA 5IK8A 3S0MA 1NX9A 1WD3A 3NWKA 3WNMA 4I09A 4K40A 3BIWE 2VZOA 5DUUA 1GNYA 4GB32 2CTVA 5FV3A 2Q1MA 1JZ3A 1H2LA 3PUAA 4IV3A 3OEBA 3QH7A 4WM8A 5EJ3A 5FYIA 3TNPB 2WWUA 1CAVA 3MPBA 2PHDA 4XOGA 1JYIA 3FBYA 2BU9A 2IXLA 3ACHA 5DUVA 2R32A 2BUKA 1R081 2BPA2 4W8JA 3ZSMA 4RQPB 2ZPXA 4W6XA 4F83A 4AAXA 1HW5A 4XBQA 1CAUB 5T55A 2YC2A 1ENXA 1Y4WA 4AHZA 2WS93 2AGSA 5KHKA 1PVC1 1QQP1 5FMCA 5A70A 2FDKA 1SLAA 4QMAA 3T2TA 2RJ2A 5LCWL 1ULPA 4XFBA 1LEMA 4E27A 1YI7A 4FPGA 4QKFA 3A23A 2DCZA 1KFXL 3T2OA 3ZFFB 2ZGTA 3PHMA 3VDDB 1ULFA 4J25A 4P08A 3I2OA 4LHKA 5KC5A 2ZHNA 1IZ3A 1VBC1 5BNOC 3WDTA 1G9AA 2UYAA 2YBPA 2NP0A 3ETPA 4XF4A 3OY8B 2VZSA 1KEXA 2BZDA 3MDPA 1HQWA 4AK3A 1GFF2 2CHHA 1YIFA 1W2AX 4HLTA 2VOKA 2ZEXA 1IS6A 1Y43B 3CIHA 4QGNA 1OLRA 2G19A 2GAUA 4IE5A 1W8WA 5T50A 3H8RA 4I2OA 3M3IA 1VBA1 1L7RA 2ARCA 2ZX4A 2PHLA 3RGBA 1TMF2 1OC1A 2EVXA 5LK7B 4OZXA 2O1QA 2A6WA 4L9BA 4KMQA 3L2YA 4QQ2A 4DUVA 2VQUA 3LIHA 2GDFA 3OUHA 1EUTA 1RMU1 4M01A 4AYUA 2RR12 5C70A 5I93A 4XJUA 1YRZA 2Z5WA 2JDMA 3I2DA 4M4PA 4BLJA 2XLAA 2UY8A 3ZIWA 4SLIA 2YV8A 4LHSA 5CNAA 4B4QA 4CDUB 5BUVA 1RUG1 1UZVA 5C4WC 4YW2A 3N9OA 5FY7A 3RG0A 4Q4X2 4E8DA 1WCUA 4YRDA 5FK8A 4NIIA 1AYN3 2DCKA 4HKWA 4UW6A 1Z7S3 4ZU4A 1GSLA 3HVDA 1VALA 2WRAA 4WVWA 4COWA 4LR4A 3OF1A 5A1FA 4Y20B 2WLPA 1RB8G 2AUYA 3PIGA 1W9FA 2J1SA 4UAPA 1SBDA 4N90A 1BKZA 5FP9A 2R7EB 2WNVB 4UWDA 1CR7A 3GCXA 1S0JA 2FBEA 5BY5A 3R05A 4CEYC 1RXGA 5FCCA 1EUUA 4JVAA 5BXXA 5BNOB 2HWC3 1N3PA 2GMPA 1O7FA 2EAAA 4QX0A 4DXRA 4TYSA 2P6CA 1J58A 5FREA 3NJXA 4O65A 1HRV3 4NIGA 3ZR6A 4GWJA 4L8QA 3HNYM 4OI1A 1ZBA1 4N7UA 2PLV2 1ND3B 1KFUL 4Q4W3 2UYBA 2MEV1 4AHWA 1W6NA 5IK7A 3SCHA 5J48A 4NUBA 4AE2A 1O59A 4O9GA 4H55A 1BBT1 1F5JA 4QKDA 4OHYA 1DGRA 2BFUL 4LOSA 4OHXA 4CPBD 1N1VA 5EZWA 3PIJA 3POIA 3JD73 3A7QA 2ZX2A 3TEXA 4A3ZA 1GMMA 3L9JT 1C8M2 3AYAA 4I0AA 3ILNA 2VZTA 5C4WB 2CY6A 4AI0A 1W2OA 2JDZA 2MPFA 3PU3A 4JGZC 2GNDA 5FXZA 3T2QA 3WV6A 3W9AA 1CIYA 2WZ8A 3C7GA 3FHAA 5FZOA 5BPXA 4ZZ8A 1AR93 2Y33A 1A78A 2LROA 1K3IA 4BWOA 1UYXA 2P3YA 2Y6FA 1LOBA 2JD9A 4PCRA 3K4AA 5FZ6A 1VRH3 3SEEA 5CKQA 1KDMA 1H1AA 2OUHA 4DY5A 4LBMA 2VMCA 2WN3A 5FZ8A 5FXXA 4A2UA 4LBNA 4CEYB 1SCRA 5IAXA 3IDCB 1GZ9A 2XGXA 1RTVA 1QDOA 3UGFA 4AVBA 1WCKA 2RS11 3WNXA 4K6BA 1UY1A 3A0KA 3VV1A 4XZPA 1JZ2A 3FLRA 4JAAA 1PGW2 4Z07A 4JGYB 1ND2C 2Z79A 2C24A 1OA4A 1UZ0A 2VUDA 4ZU5A 3MV01 2VMEA 3WUDA 4E4ZA 2QDNA 1SZBA 1D2SA 2C4XA 4GH4A 4U36A 3WQ7A 4XUOA 5C3OA 3AJYA 4OLLA 4OMCA 2WKKA 3R0RA 1WBFA 4IUGA 1XNAA 1V9U3 5FOBB 1D7PM 5L19A 1XE0A 1IOAA 4XAAA 1VBB3 3DGTA 3D0SA 3J8F3 1D0GA 5JIUA 1W39A 2QUOA 2VUAA 2JDNA 1V6MA 3O1VA 3AFGA 1NT0A 5T5LA 1C4RA 4JGZB 1ZRCA 4C1WA 4UW5A 5C7GA 4K20A 3BVCA 5SV8A 3RJ2X 3W21A 3HBZA 3ZPOA 1AX1A 1O4ZA 3LCPA 3M3EA 2AZ5A 2VD7A 4AWDA 4FSJA 1Q8SA 4QPYA 2KR2A 4QWNA 2ZGKA 1GWMA 1NUKA 1LOCA 1POV1 1YNAA 4S2FA 1PIV1 2G9GA 2WNOA 4CDWC 3VDCA 5H9RA 3H9AA 2JKXA 5ACA3 1XC6A 1DQ2A 1EAH1 2EIEA 2ZGOA 5EWSA 3AFKA 2HYKA 5FY0A 5A3LA 3I7DA 1MS0A 1H1MA 3HJRA 4IW3A 4BU2A 1SPPB 5JR2A 4LTAA 1TME2 3BTXA 2G9FA 2D3PA 3I2IA 3U4XA 2P6HA 3QACA 4QHBA 3WF0A 3JBG1 3ZSLA 1PM7A 2J7MA 2JDYA 3K46A 2OZ6A 4COUA 2E7QA 2WO1A 3K3OA 1QNYA 4FI9A 4QKBA 2WA4A 1VIWB 5FWJA 4XFGA 1QKQA 1CPNA 3HQXA 4QHZA 3HAGA 4MGTA 4BB3A 1JOPA 4X8PA 5FPVA 4IV1B 4XF1A 2QFEA 5CKNA 1ND2A 2JX9A 4NHYA 1GQHA 3D3AA 1AJKA 1ZNPA 4CP2A 1BEV1 5GLTA 4D7SA 1RUE1 1J1LA 3AL6A 1ZZ8A 1IQAA 5E16A 2HJIA 3WEZA 4CDQC 1JYVA 3R4SA 1RUNA 1WW6A 2VOXA 1CJDA 4HN1A 3M70A 2WFF1 4YGCA 3ZXDA 5L9RA 2ADDA 3N7MA 1PO22 4MXWA 5LBBA 4H3WA 1R083 5IFPA 4LBQA 1A34A 1YC61 2OA2A 3AZWA 1WD4A 4RA0A 4CCJA 3MIHA 5LY2A 3OGRA 4DIQA 1AX0A 4NIHA 5FUNA 2J1RA 2QQVA 5I0UA 4AQ2A 2VJXA 1VJ2A 1UWWA 4FCAA 4MSVA 4CDWB 2VNOA 3NNFA 1F2NA 2JIGA 1PVC3 1QQP3 3AXEA 1Y3TA 4FTBA 2B42B 1BCXA 2WZR2 5LRSA 1GOGA 1TG7A 3VBFC 4D7YA 4AEJA 4K8FA 3ZYHA 4NIAA 3PURA 5GJ6A 1TEIA 2HH9A 1FMD2 1MZ6A 3S7IA 4CZSA 5IVCA 5C3QA 4BIOA 2VXJA 4UFIA 1VBC3 1HXS2 2WQ4A 5GZEA 3WNPA 3Q8FA 3TBDA 4QGMA 3IPVA 3NNMA 5F6LB 2JB4A 1E5HA 3AP9A 5I0DA 1QY4A 2ZGMA 1W8TA 4UW3A 4NAOA 3TRSB 1PO11 1UD1A 1OQDA 5FQ0A 2YMZA 2FDGA 1JYTA 3VD5A 1C3HA 3W20A 1X50A 2X29A 4IEYA 4R9DA 3ST7A 4LE3A 1RXFA 1W6QB 1AYM1 3ROUA 1VBA3 3OD0A 3A21A 1UY0A 5FP8A 4IEZA 1R1A2 5B4NA 2R061 5IK4A 4CDQB 1NE4A 4BA6A 2W87A 3V0BB 3AKPA 3H42B 1EPZA 2FDFA 1AR72 1WMXA 2CGPA 2F6BA 1UAIA 2OPWA 1RMU3 4KU8A 4Q4Y2 1DYOA 1JBCA 4ARXA 5A6YA 4JTOA 3NV2A 4KWJA 2AH2A 4LNVA 2D97A 2W52A 3ACLA 4Y1UA 1QXRA 1FT9A 4FAGA 4ZKTB 1UIJA 1RUG3 4QB2A 3HNBM 1MEC1 4E4DX 4V1PA 4FVVA 5HCAA 2CYFA 1OQEA 1XU1A 2ZJCA 3H3UA 4HETA 4YM3A 4WBBA 5A3OA 2ZEWA 3BALA 3K3NA 5L36A 3JQXA 4HG6B 4O9EA 3CEWA 3AKRA 1MS3A 4YWAA 4OULA 1OXCA 1REDA 3VBFA 3AC0A 2DV9A 2IFWA 1R1ZA 2EF6A 3OYWB 4JC1A 4XJWA 5FO7B 3OBAA 4UF0A 4B1MA 2WR9A 4FPFA 1WCSA 2HWE1 4KBZA 3WF1A 1X9PA 2DUQA 3JB8A 1GNZA 3O0WA 1DQ6A 3VD7A 3HQRA 4G4FA 4XDPA 2JIJA 2VG9A 1Q3EA 2WT0A 1ZBA3 4FFFA 1S0CA 1W3VA 2BVVA 1W3XA 3KCXA 5F3EA 2BJSA 1VAKA 1BLZA 2MEV3 2RM22 2VNRA 2ZMNA 4QXBA 5GLUA 1V6NA 1GWLA 3O1TA 4GXLA 4LORA 3I54A 1H1IA 2XVLA 1H0BA 4JQTA 1BBT3 1QJX2 2NMOA 3HQUA 2VZVA 1D4M2 1FATA 3IMNA 4KG0A 1JTZX 4LO8A 4QB1A 4CP9B 1O3TA 1C57A 5FZBA 5D8AA 3WSOA 1ST8A 2YGMA 4COVA 5LEKA 1QIQA 3LSDA 5FMOL 3LA3A 3ATGA 1LECA 2XXZA 3WW4A 2HWB2 1AL0G 4R9CA 1QXJA 3LDKA 4MLOA 2DCTA 3V65A 3TOJA 1HB1A 2EIBA
chains in the Genus database with same CATH topology
1D0HA 1JHNA 1V6JA 2H0VA 2IXHA 4NHMA 4AEDC 1LU2A 4ISQA 3QBQA 4XW3A 1PNGA 2XL9A 3NKTA 3POWA 2PAEA 4FTEA 3CLPA 4YNIA 5DG2A 1LODA 2DVAA 1WW5A 2D93A 3N7LA 5T3NA 1X8MA 4D7YA 3CU7A 2CGNA 1MZ5A 1LULA 3KGLA 4HT1T 4OVEA 2XKOA 2RS13 4EN6B 1XYNA 2XJRA 5HCBA 4JRLA 4EV0A 1LHVA 1ONAA 2GH8A 2ILMA 3MW4A 2OUJA 2XKPA 4XTPA 1BQPA 2WNUB 4MH0E 4EJRA 3TN92 3BCWA 3VZOA 4C1XA 4DFSA 3O0VA 4KL1A 1DGWX 1QNWA 3B00A 1I6XA 1HKDA 1OOPA 1QOTA 3GHNA 2CL2A 4AW7A 3VKLA 4AFCA 4B3NA 1FPN1 4R8HA 2BTVC 1VBE1 2GNMA 4HVQA 1RL3A 1N3OA 1XXNA 4N53A 1QJU2 1ZZ7A 2ZA9A 2K0GA 3E6DA 5AC91 3U0ZA 2E63A 2P2KA 2LALA 4JRAA 4WVMA 2D5FA 3IDEA 4AEDB 1POV3 2RMU2 1PIV3 1MQTC 2BVBA 4Y1ZA 1QWRA 1EAH3 1Q8VA 3Q9OA 1CAWB 4Q29A 2ZACA 2EXJA 4XJ8A 2ZKNA 1DQ0A 4LA3A 3IWZA 1MS9A 2Q8OA 4AFAA 2RS51 3JBG3 1SACA 2BYVE 4YVSA 2BNMA 5HI0A 1GYKA 3SMHA 4LO4B 4QPGC 1QJY1 1KD7A 4RHV1 4MX3A 2HWD3 3ME2A 3PJQA 1C1FA 3APBA 4UW4A 3AZZA 1HRI2 1F5FA 4U2AA 3ZFGC 3DF0A 1LJ7A 1BEV3 2R072 2WC2A 4YLZA 1RUE3 3VGIA 1EV12 3WINE 3FLTA 1DYPA 3RRDA 4QPIA 2WT1A 1AX2A 2XB6C 2WFF3 4B7EA 5JI9A 3UKTA 1AZDA 2D6MA 4F8AA 4ASLA 1HX6A 1ZYBA 4RS5C 3LOBA 1NA1C 1A6CA 4QT6A 4Z8BA 2ENRA 1MQTB 3NVCA 3M3QA 1M06G 1LOAA 2A3WA 4JDOA 1WLWA 1TMF1 3M2MA 5I8YA 2QVSB 4HVOA 2YC0A 1N1YA 1C5IA 1AJOA 4GALA 3B02A 5D1IA 1WMDA 4UXAA 2VY0A 1UL9A 3UJQA 1LKNA 2ZBJA 4AXOA 3VBRC 3J4UH 3HMYA 3OJBA 5JZGC 2QZ2A 4BLIA 1COV2 3D5OA 4OHVA 3ZN6A 4QPGA 4KU7A 4HL0A 1LOFA 1RUOA 2GN7A 1PO13 5I91A 3WHTA 3B7MA 4AHYA 3ZYIB 3ZFGB 2DYCA 1AYM3 1HV0A 1U5ZA 2P3JA 3WDUA 3W58A 1VLNA 2QCSB 4EN8B 2FZ1A 5I8SA 5F5QA 2R063 3LGRA 2Z69A 4CEWB 1FNZA 3USSA 4E9KA 1B35B 1RUI1 5FOJB 1RUH2 4KWLA 3RNSA 1BYHA 2NQYA 2A75A 1XE7A 4P5HA 3AYEA 2XJQA 3VKFC 1MEC3 4RS5A 2YUEA 3RWNA 1DQ4A 1NA1A 3EXUA 2XLFA 3G7DA 4NHLA 3WDYA 3I59B 4I3GA 1V6OA 1RUC2 2BWAA 3RZZA 1I1EA 2X5IA 4IV3C 4WM8C 1QOSA 1I3HA 1UU6A 2WT2A 2TNFA 2Q1ZB 3AMHA 4WZCA 4AQ6A 3ZIXA 4HANA 4Z82A 5EXOA 5GZCA 4PBOA 3HD8B 1NCRC 4AI2A 3J26N 1YFXA 5JZGB 1C8M1 2B8MA 2HWF1 3VBRA 2HWE3 3P3PA 4RD7A 1JN2P 2WFPA 3ASIA 5SV5A 3AMNA 3N3HA 4LBLA 2OPKA 1EPWA 2BQPA 4FPJA 2O8QA 3KCYA 4IL7A 2JICA 2QZ3A 5A33B 5E89A 1R091 1ZVFA 3WDVA 2JECA 1ZX5A 1LESA 3VBSC 1S0IA 4DB5A 2ZTNA 1NY71 2WS92 4XPVA 2XLGA 2X53S 3RQ0A 2B5HA 3UK9A 4YM1A 3DL3A 1RJ7A 2VXRA 5GLZA 2AYHA 1V6LA 3WZ1A 1PVXA 1ULGA 3RI8A 4WM8B 4IV3B 3MFAA 4M3CA 1CAXA 4CDXC 1CAVB 3MIFA 2EAKA 3V56A 4Q2FA 3GALA 5FPXA 1NG0A 2R041 2E9QA 1WMFA 4INDA 3B01A 3DN7A 1S0FA 4G9SB 4LO5B 1K5MA 2R49A 4Y22A 1B09A 1NCRA 3VZKA 2A71A 5H9PA 3VKOA 5CG8A 3G6JB 2O8OA 3QCWA 4RSUA 5JAXA 4P9XA 3I4IA 5DXDA 1RIRA 2E6VA 3R4UA 2EALA 1AR82 2ZGNA 2V73A 2VQAA 3PVOA 2BNOA 2VOVA 1TME1 1KITA 1UZYA 2WINB 4R52A 4COYA 3AP7A 1AYN2 3VBSA 1FPN3 5FLHA 1IS4A 1VBE3 2DCJA 1CONA 2D44A 2MNGA 3FUOA 2B7YA 1G86A 3M3OA 4GMP1 3ZFEA 3MFCA 5J3UA 1X8EA 3PVBB 2IXIA 1J3RA 5JPNB 1GANA 3SH4A 4P9WA 5AC93 4I0WB 1A8DA 4P9JA 5JSOA 3BPZA 2NYYA 4QU2A 4HBNA 5DG1A 4AI8A 2HWC2 4CDXA 1Q5OA 3CJIC 3KT4A 5JLVA 5J37A 1C28A 5CAZA 1HRV2 3K48A 2NM1A 2ZZJA 4BPZA 2RS53 3DPRA 4Q4W2 4Z2WA 5BNNC 3U07A 2YXSA 4B8EA 2D7FA 4XYXA 5CIRA 3MI8A 3ZXAC 3IM0A 1QJY3 1X7NA 2RS31 4RHV3 1H30A 2ES3A 1WA4A 1HQNA 2I74A 1NCQC 4WVZA 3AKSA 2CWSA 4JTNA 3JD72 3MICA 3SLIA 4AQTA 4KGQA 2Q4SA 1X33A 4N43C 4MZUA 2I2SA 2DFCA 2ZGUA 3T1MA 1UKGA 2TBVA 2GH2A 2JE9A 2VGDA 1AR92 2PHFA 3FHIB 1PGL2 3AMPA 1FAYA 3O14A 1RJ8A 2Y38A 1HXS1 4SBVA 3OD4A 2XWJB 2XHKA 3D82A 5L7OC 1W6NB 5FTTC 4ES9A 4BMBA 4CP1A 2YHJA 3JUUA 3N4MA 3EO6A 5BNPA 3MPPG 4GH4C 3JU9A 1HDKA 4I02A 1VB4A 2XWBB 4I0BA 5T5OA 1PK6C 1H9WA 3CJIA 3FFQA 4LE4A 3W59A 1TMF3 1R1A1 1NE6A 4FOYA 4L92A 2VPVA 1LENA 4QQLA 3ZYPA 1Y9QA 4PLMA 3JCIA 2P17A 3C2UA 3VBOC 5BNNA 4S2DA 2I45A 5TSWA 1F31A 3NSTA 2XH6A 2A73B 3HIFA 2C1FA 1VBB2 2ZHKA 3R6SA 1NCQA 2JG8C 3J8F2 1WW7A 3UV9A 3NJZA 3B5LB 2W39A 3NV3A 3MIEA 2ET1A 4LLFA 4DS0A 3EHKA 4XHBA 3HWJA 4N43A 1DFQA 1JUIA 1RGSA 1J3PA 5FLIA 4LBJA 1AUYA 1RUI3 2YDEA 4LHLA 3WP6A 2ZX1A 4XJAA 3KMHA 1CGPA 2ZHMA 4B4RA 1MACA 5ACA2 2D5HA 4MYEA 3KT7A 4JQRA 5L7OA 1VBD1 3LSEA 4FAHA 2PFWA 1UX6A 4GH4B 2KA3A 1BMV1 3IIAA 3AXDA 2D98A 2AREA 4K7JA 3VHNA 1ZREA 1L3JA 2R16A 3U11A 1PK6A 4YYOA 3C3VA 2JD4A 4HKOA 3SCFA 3WR0A 3ZMOA 2CGOA 1FXZA 4AI1A 1YCIA 3GBFA 5L73A 1ENQA 4AFMA 3UJOA 1C8M3 2HWF3 3AJZA 3RYRA 3VBOA 4XQWA 3VZJA 2A6VA 2R0HA 4BZ4A 5ABJA 3LWCA 4C0HA 3ZXEA 1JH5A 3NAPA 2OW4A 1DZTA 1CX4A 4XMIA 5K8SA 4WVVA 3KZ4C 2UURA 1C1LA 1ZZCA 2JG8A 3SISA 1R082 2BNNA 1R093 4D94A 1CIWA 4YARA 4DZGA 5E8AA 3VL8A 3MEPA 2VU9A 4DPNA 1XNKA 4FP3A 2XBO2 3QH6A 5KXBA 3MW3A 1J1TA 1YJKA 5CVRA 1EYBA 4Z1VA 3SH5A 1PVC2 1QQP2 1O91A 4PF5A 1RUD1 1ND2B 1RVF1 1APNA 5A32A 5KHJA 4YM0A 1GZCA 5FAXA 1ZZ6A 5J36A 3X29B 4OI4A 4M3CE 3NV1A 1YLLA 4ONUA 4OUMA 4LUMA 3TN91 4YFWA 2R043 4R9BA 4MXWB 3IT8A 1DQ5A 4LBQB 5JSPA 2RJKA 4G3YC 4QQHA 1BJQA 2EXKA 4OHZA 4ORFA 3D6EA 4QQPA 2C5DA 3EQEA 4YM2A 1ENRA 1HV1A 1WBLA 4BH9A 2ETEA 3GBGA 1G9FA 4GQ7A 1KRIA 5DDJ1 2VNGA 3LKJA 1O3QA 5KHHA 1RMU2 5CU1A 5C9AC 4HSJA 4YW5A 4OI0A 3ZVXA 1H4HA 4DNYA 3AP6A 2A70A 3SNMA 1H2MA 3AP5A 4YZ3A 5DZGA 1ZBE1 3H1WA 1RUG2 3AMMA 3PNAA 1LGCA 4AQSA 1TME3 4HVRA 3IPVB 3B9CA 2D6KA 4YG3A 2B46X 4Z92B 2AENA 2ARXA 1IPJA 2EIGA 1AL21 5FQ0B 1O3RA 4XBNA 1POV0 1X36A 4GMP3 1LOGA 5FO9B 5CFDC 3GBWA 2CNAA 3LAGA 1MR5A 5C8CA 1PMIA 5I0SA 1SLBA 3B94A 2Q5TA 1UPSA 4LO7A 4GKYA 1QF3A 1HRI1 3M4FA 3FX3A 3BTAA 2R071 3IN9A 3KB5A 4BYYA 5D8AC 2SLIA 4A7ZA 1ASJ1 1CVNA 3VZNA 1UPIA 1N1TA 2MEV2 3WW3A 1SEFA 1SFNA 1UW8A 4N7IA 2R6QA 1AR61 1BBT2 1H4GA 2AR6A 2RS33 1CESA 3VBFB 1FV2A 3GHMA 1W6MA 2C9AA 1LGNA 3QLQA 2DF7A 5C9AA 2K2SA 4Q4V2 4E4SA 5C6CA 4WV8A 3IBMA 2GC3A 2JG9A 2WSUA 3VKMA 3CL1A 4K1ZA 1VR3A 2UWBA 4FPCA 4MUVA 4HPKA 2DU1A 2R30A 1UIKA 3LOIA 5AVPA 4HN0A 4AVCA 3MLKA 5HBAA 3KGZA 1HXS3 3ZSEA 5F9TA 1COV1 2ZGLA 4ISRA 1LHOA 5CFDA 1RUJ1 4YG0A 3FMGA 4FBFA 2V5YA 1OOPC 4FPEA 4FQZA 4LLOA 4LULA 4YVWC 2RS12 4CP0A 5D8AB 3ZMNA 2LUWA 2P34A 3V0AA 2IWGB 1RUF2 3WCSA 4EWDA 3BOWA 1SMVA 5T54A 1REFA 3ZDSA 4N53C 3MLJA 1UF2C 3O0XA 3OPZA 2PYTA 5JR7B 2A6YA 3RMXA 2ATFA 2MHFA 4RL7A 3L2HA 4IQPA 2D6OX 3HR9A 3MIBA 1UCXA 3AZYA 1DGLA 1QOOA 1GZWA 2PTMA 1DQ1A 2CWMA 3KM5A 2PHTA 1YJLA 4GWNA 2GNBA 5BNQA 5FLJA 1CN1A 1NXMA 4YVSC 1PZ8A 2WSVA 4IEVA 2PHUA 4XBLA 1WLDA 3ZSKA 2VVDA 4FPLA 1FI2A 1PIV2 2JEMA 4MGZE 3SXWA 1FX5A 1RHI1 3AB0A 2BBVA 3AYDA 1CJPA 4X6QB 3KSCA 1FOD1 1H8TC 1VBD3 1YFWA 2KXLA 3ALQA 4FPYA 3ZYJB 3H1YA 2IXJA 2ZMKA 4FO9A 1LOEA 5JDBA 4URTA 3MGUA 1OOPB 2H6CA 3DV8A 4EWEA 4YVWA 2FZ2A 1OFNA 2B39A 4QPIC 2JE7A 4XIOA 3N36A 4N53B 2NPIA 4LBKA 4X6RB 2VULA 2HWD2 3HT2A 4BM8A 4XFFA 2BGCA 3MYXA 4FXGB 1MS5A 3V64A 1QH7A 1DF0A 4WVMB 1S0DA 4HFSA 1SQ4A 2DURA 4LHNA 2GC0A 1RUE2 1IHMA 4W6WA 5CA6A 1W6OA 1OPOA 4GB31 1PZ9A 2WFF2 1U5YA 3NKGA 3H7JA 4DXZA 4FTSA 4YVSB 2PAMA 4E2QA 2UU8A 5JOXA 3SH3A 4AFDA 1Q8PA 4FPHA 1OI6A 4MVTA 3WG4A 4WM7C 4R4ZA 2P3IA 2XJUA 1WW4A 4OHWA 3UKVA 5CBLA 5K0UC 3LA2A 5DZEA 1LOFC 4P9YA 3MIGA 2A7AA 5EV7A 1RUD3 4EN0A 1XNBA 3AZVA 4RR3A 1RVF3 4OFGA 4YG6A 3JB4C 4IEXA 2QNKA 1H8TA 1DZQA 3TB0A 4IETA 4XFHA 3GZUC 3PLQA 4KNCA 3A4UA 3FE5A 1AR81 3TN93 4QPIB 3WQ1A 3CO2A 4XIKA 5DUXA 4GIQA 5IK5A 1H2NA 4PDWC 2Y0OA 3TNQA 1PO12 1F8VA 3PJYA 2D6PA 5CFCC 2FHRA 1O4YA 1LHWA 4FPKA 4YGBA 1AYM2 4CTEA 4WZFA 1KXGA 3RYKA 2CAVA 2R062 2X5IC 3WOGA 3E5UA 1C8NA 5K9YA 5DDJ3 3OBTA 1IS3A 4I01A 1ENSA 4FQ4A 1AHSA 4TSVA 3ZX7A 1X82A 1W0OA 3ES4A 4H7MA 5A3MA 1J59A 1UKRA 2ZZQA 2WQZC 4XTMA 2KM2A 1ZBE3 1GV9A 2GSYA 2RR11 3NW4A 5GZDA 1MEC2 1GNHA 5J09A 5AFEA 3RDIA 2D3SA 3ZN6B 2D40A 3INAA 2WLQA 4QPGB 4WM7A 3M8LA 1AL23 3USUA 1WCDJ 2DTYA 1G9CA 5K0UA 3ZPYA 4Q4X1 4NR1A 5C8WA 2VMIA 5F1RA 3T1LA 1MVQA 4ES8A 5HXVA 3EJKA 4PJYA 4AGGA 3KS7A 1I9RA 1GICA 2VW2A 4FP2A 3NV4A 2OVUA 1QJZA 2YROA 5DUWA 2HWE2 1YUDA 2R073 3VBUA 2VW1A 1ULDA 1RC6A 1ASJ3 4HK9A 5FRAA 1ZA4A 3AM2A 3MZHA 3E5QA 5J96B 4KG8A 4W6YA 4PDWA 1PGL1 4Y26A 4RS5B 4C91A 1NA1B 3SHRA 5CFCA 1W6PB 3E6CC 4Q0UA 2SBAA 4AGRA 2PLV1 2X5IB 1AR63 4K9SA 5HCFA 5FPZA 3WW1A 3VBHA 1V6IA 4XJZA 4Y24A 2CAUA 4YW4A 3E97A 4GULA 4J1XA 4XF0A 1PNFA 4BQ1A 3D4KA 1Z0HA 5T5PA 1K5MC 4PIXA 1URXA 4Q0SA 1DBNA 2ZABA 3VBRB 1S55A 4H7LA 1XE8A 3WG3A 4F7ZA 4K3UA 1BVP1 2F4PA 4BE3A 3OTFA 3SCGA 1YI9A 1U0AA 4OI2A 4Q0VA 4MGIE 2GC2A 1RUJ3 1N47A 2Q30A 4JV4A 1HIXA 4IEQA 4HK8A 4XFCA 4B4PA 1S2KA 1T6GC 1C5HA 2PHWA 2ZGPA 1DYKA 2VVFA 3AKTA 2WA3A 5EFUA 4D7TA 5KBFA 4PIZA 3ZFEC 3GF6A 3RS6A 3ZSJA 3B69A 4IXLA 1YHFA 4M3CB 1Y7BA 3THPA 1CAXB 1PGW1 3QOPA 1YFUA 4ITCA 4JDNA 4YFZA 1N3QA 3FBMA 1GKBA 1U12A 3E5XA 4EROA 3ZYRA 1IKPA 5LRRA 1FPN2 3VDDC 2BWCA 1BVVA 3FJSA 1K5MB 4Y22B 2HEWF 5KHIA 1CQ9A 5JCTA 1NCRB 4LBQD 3DPRC 3LB9A 1O3SA 2WJSA 5AC92 1S0BA 4AVTA 5FBZA 1G9BA 3M7AA 4FPOB 4QXKA 4AG4A 3URFA 4B29A 1H8VA 1RHI3 1FV3A 5KXEA 2BFUS 4YZ4A 5T5JA 3N35A 5EYYA 1FOD3 3AKQA 3RSJA 1S1AA 4PBPA 3VZLA 2RS52 3POYA 1VAMA 1U5XA 4Q1PA 2K9ZA 3VBSB 1ZRDA 3RI9A 3PVEA 2D6LX 3B93A 4P14A 1VP6A 2RHPA 1QJY2 2PA7A 4CDUC 3ZFEB 2XBO1 1Z7S2 4RQPA 4RHV2 2BW8A 4I3PA 3VHPA 1JW6A 1CAUA 4DY3A 1NZCA 3WG2A 2HKXA 4AVAA 3EBRA 2DFBA 5JI7A 5BNPC 1N1SA 4YZ1A 3FZ3A 1KS5A 4CDXB 4AHXA 4Q1RA 4NWWA 4LT5A 2ZHLA 2GZWA 2UY9A 3OBRA 2WNVC 4XQ4A 2GC1A 1I5ZA 2XJTA 4GB33 1NOVA 1OPMA 3MIDA 3ZFFA 3VDDA 2VW0A 3DPRB 1QGLA 4TZDA 2PHXA 3KT1A 1SLLA 3OY8A 1PO21 1VB2A 1SBFA 5J7MA 1ND3C 3A0NA 5E1RA 1ULEA 2QE3A 4M0HA 2W0XA 1G8WA 5GLVA 4CYDA 3MW2A 1SBEA 4N9HA 2Z42A 5IUQA 3GZAA 5JOZA 4HMZA 4FOWA 3N7KA 1OHFA 4UBGA 1BXHA 3J9SA 1ULCA 4P9LA 2PAKA 2WZR1 4COZA 5GZFA 2QDRA 4META 4XMAA 2D6NA 4FOVA 5C33A 1AR83 2PQQA 1FMD1 4LA2A 4D3WA 2P37A 1IGOA 1YO8A 3BB6A 4CDUA 1LU1A 3VL9A 2ET7A 2ZOEB 1YYNA 4GKXA 4IEUA 1VRH2 4L11A 4XEZA 5AVAA 1LEDA 2WWSA 3SITA 5LK5A 1DG6A 3ZO0B 1E57A 5BNPB 4Q0QA 2DUPA 4DRRA 1AXZA 2JENA 3CJIB 4Y20A 1DU3D 1WGPA 1TE1B 1U5IA 1RUI2 2WNVA 2VECA 3AZXA 5BNOA 4ATEA 1AR71 1H9PA 4KQ7A 4CRQA 5BNNB 1SLTA 4GMP0 4Q4Y1 5FO8B 1GR3A 2RR13 1SFYA 1NLRA 1SLCA 2XJSA 4Y4YA 5F6KA 2YGLA 4LUKA 3FUQA 3OGJA 5B2GB 5ABJC 1ND3A 4JGYC 1SCSA 1OQ1A 4GWMA 4PQ9A 2DVGA 3NAPC 2A3YA 2UWAA 4Q4X3 1V9U2 1NCQB 3UKNA 5GLWA 2TUNA 4AVSA 2VOWA 4EWAA 4N43B 4AEKA 3B3QE 4YW3A 4Q4V1 2DVBA 2HWF2 2Y0IA 3ZXKA 4E2SA 3CNAA 4Y1XA 2Y26A 5E88A 2XUMA 5C4WA 4ZU7A 4FT8A 5KXCA 3ZXFA 5L7OB 3WQ0A 2IFRA 1A8MA