3NJZA

Crystal structure of salicylate 1,2-dioxygenase from pseudoaminobacter salicylatoxidans adducts with salicylate
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
364
structure length
364
Chain Sequence
EKLDHESVTQAMQPKDTPELRALYKSFEEESIIPLWTQLGDLMPIHPKSKAVPHVWKWSTLLRLARKSGELVPVGRGGERRALGLANPGLGGNAYISPTMWAGIQYLGPRETAPEHRHSQNAFRFVVEGEGVWTVVNGDPVRMSRGDLLLTPGWCFHGHMNDTDQPMAWIDGLDIPFSQQMDVGFFEFGSDRVTDYATPNFSRGERLWCHPGLRPLSGLQNTVASPIGAYRWEFTDRALTEQLLLEDEGQPATVAPGHAAIRYVNPTTGGDVMPTLRCEFHRLRAGTETATRNEVGSTVFQVFEGAGAVVMNGETTKLEKGDMFVVPSWVPWSLQAETQFDLFRFSDAPIMEALSFMRTKIEGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gentisate 1,2-dioxygenase
publication title Crystal structures of salicylate 1,2-dioxygenase-substrates adducts: A step towards the comprehension of the structural basis for substrate selection in class III ring cleaving dioxygenases.
pubmed doi rcsb
source organism Pseudaminobacter salicylatoxidans
molecule tags Oxidoreductase
total genus 102
structure length 364
sequence length 364
ec nomenclature ec 1.13.11.4: Gentisate 1,2-dioxygenase.
pdb deposition date 2010-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3njzA01
1Y3TA 3HT2A 4E2QA 1LR5A 3KCCA 1RL3A 4ZU5A 1OI6A 1LKNA 1VJ2A 2GZWA 2IC1A 4WVZA 4HMZA 4NVPA 4XEZA 1CX4A 2P17A 5KHHA 4HVQA 3PVBB 3CEWA 4IEPA 3UKVA 2Z2SB 2MNGA 3MDPA 3BU7A 3L2HA 1YFWA 3IDCB 3CO2A 1VR3A 2GC0A 3ACLA 3H1YA 4YRDA 3LOIA 2EA7A 2ET7A 2Q30A 3C3VA 4LUKA 1ZREA 3WW3A 3E6CC 4WBBA 4KU8A 4KWJA 1NZCA 2QVSB 4BIFA 4D7SA 5HI0A 1J3QA 4XFIA 2N7GA 1X82A 5FPZA 3FZ3A 2OPKA 2OZJA 3UKTA 3RYPA 3M70A 4QGMA 4IEZA 3E5XA 3FJSA 1ZZBA 4D7TA 3B02A 1QWRA 2VPVA 1FT9A 1O3SA 2BNMA 2CV6A 3LZZA 4XFHA 1X7NA 2H6CA 3D82A 2CGPA 4MZUA 3LA3A 2OZ6A 2FMYA 4RD7A 3H8UA 4X6RB 1XE8A 1ZZ8A 4WZCA 4QM9A 4XF0A 2B8MA 4XF3A 2PA7A 4BH9A 1WGPA 2H0VA 1DGWA 4DINB 1CGPA 2PHDA 1H1MA 4PJYA 4L2NA 1OFNA 4HVRA 4OFGA 1UIJA 1G6NA 2UY8A 3IWZA 3ZDSA 2UY9A 3RYKA 2QNKA 3H7JA 1QXJA 4EWEA 2VECA 4FT8A 5BV6A 3D0JA 2QDRA 1H1IA 1UPIA 4HLTA 2IXCA 4O9GA 4MGIE 4PIZA 4I2OA 2MPFA 4Z82A 5I8YA 5E16A 5LRRA 4LEJA 4N9IA 5I0TA 1ZRDA 5LEJA 4EV0A 3O14A 1CAUA 1EYBA 3BPZA 1O7FA 3EJKA 4YNIA 4J1WA 5EFUA 4JTOA 3U10A 5D1IA 4CYDA 1CAVB 3GYDA 5FLIA 4QGNA 2K9ZA 1IPKA 5J7MA 2GC2A 3NL1A 1HW5A 3EQEA 3PLQA 5FPXA 4F8AA 3MYXA 1NE6A 1OD5A 2GC1A 1L3JA 3NSTA 4LA3A 3VHRA 1RGSA 3RZZA 1CAXB 4Q0QA 4K8FA 3E5QA 3E6DA 1PM7A 3ST7A 3S7EA 3U0ZA 5T3NA 4Q0SA 5BUVA 1ZZ6A 1XRUA 4JTNA 2XKPA 1QY4A 2XLGA 3QACA 3H1MA 4UBHA 3H9AA 5BPXA 3CLPA 1J59A 3DL3A 4IERA 4UBGA 2H6BA 3DKWA 2PFWA 2OA2A 3FFQA 5I8TA 3ES1A 3HIFA 3USSA 2GH2A 4B29A 3E6BA 4AVCA 1J3RA 3NKTA 3OF1A 2XKOA 2BNOA 1Q5OA 3E5UA 3FHIB 3SCFA 4FAHA 3QOPA 5JSRA 1I6XA 4ZU7A 5C6CA 1ZRCA 5FDBA 1ZRFA 2ATFA 2O1QA 1UIKA 2D5HA 2K0GA 5JCTA 5JAXA 3SCHA 3I59A 2QJVA 4O9EA 2BNNA 1RUNA 4Q0VA 4TLFA 4XFBA 1GQHA 4HSJA 5E1RA 2B5HA 4YARA 4Q0PA 2XHKA 1Y9QA 4ZU4A 3S7IA 1RC6A 5KHJA 4XFGA 5CADA 2CAUA 2GU9A 2UYBA 1RUOA 2O8QA 3GBFA 3I7DA 3ETQA 1XE7A 5K8SA 4KWLA 2GAUA 2I45A 4I0BA 1X8EA 3BALA 3BCWA 1LRHA 1CAWA 1NXMA 4AVAA 4JV4A 4AQ2A 2PAEA 3U11A 3EHKA 3TNPB 2XGXA 5C8WA 1YFXA 3KGZA 3H50A 5I93A 4HN0A 3RDIA 3RPQA 1NYWA 1ZRRA 3OCPA 4EWDA 2DCTA 5KBFA 2UYAA 4EWAA 5FQ0B 2D40A 3SCGA 2ET1A 1J58A 4QM8A 4HVOA 3H3ZA 4LULA 1CAUB 3KGLA 4QMAA 1UCXA 1YWKA 5I0RA 4IEUA 4BYYA 4KU7A 4KWKA 2PAMA 2ZKLA 2IXKA 4ORFA 4H7LA 4FBFA 3MPBA 3CF6E 4LTAA 3SHRA 3HT1A 2V09A 4LLOA 4HN1A 1YUDA 4L11A 2IXLA 4E2GA 1UW8A 3IDBB 5KHGA 4BHPA 1CAVA 2XL7A 3FWEA 5J3UA 2Q1ZB 5FLHA 4IEWA 2CAVA 4IEQA 2Y0OA 1FI2A 4N9HA 4IEOA 5AVPA 4XFAA 2E9QA 4MH0E 2EAAA 4AXOA 3D0SA 1I5ZA 1QXRA 3RNSA 2XLAA 3H3UA 4I09A 5JSPA 4LUMA 1CAXA 3NW4A 2BGCA 4J1XA 2PQQA 4X6QB 4F7ZA 3MZHA 1J1LA 1ZZ9A 1YFUA 2ZCWA 3DV8A 3H7YA 1DGRA 4XFFA 3FE5A 4EROA 3ELNA 4QXKA 2GC3A 1YLLA 4IESA 5F1RA 3S0MA 5CVRA 4KL1A 3PNAA 3OGJA 2QCSB 4R8HA 3CJXA 2OYZA 3ROUA 1SQ4A 4YYOA 1OMIA 1IPJA 4A2UA 3WW4A 4Z07A 1RTVA 1ZNPA 2IXJA 4GULA 2Q4SA 1J3PA 4IEVA 3IBMA 5JR7B 2KXLA 4HZFA 5CU1A 5KHKA 4XF9A 5I0SA 2XLFA 3I59B 3R6SA 1UD1A 2MHFA 2XL9A 1JUHA 5FLJA 2Z69A 5J48A 3NJZA 3WW2A 1DZRA 4I01A 2VQAA 1EPZA 2IXIA 3G7DA 4XFCA 3CL1A 3BB6A 3N4MA 3H1WA 3LWCA 4MGKE 4XETA 1PMIA 3LAGA 5JSOA 4MV2A 3SXWA 3IIAA 3FX3A 4IETA 1TQ5A 4XF1A 1VP6A 5I8SA 5BY5A 1EY2A 2D93A 3HQXA 1V70A 3OTFA 4R52A 2PHLA 3KMHA 3E97A 2PYTA 4JVAA 1CAWB 2HKXA 2WC2A 1SEFA 1WA4A 4IEYA 1GQGA 4XF4A 5BXXA 4AQ6A 3OD0A 5LEKA 2PAKA 4ONUA 3NVCA 1O3QA 1O3TA 2PTMA 3ES4A 4QX5A 1SFNA 1ZVFA 1ZX5A 1O5LA 1NE4A 2D5FA 2EVXA 1ZZCA 5FCCA 1FXZA 2BYVE 4Q0UA 5I0UA 1EP0A 1YHFA 5EZWA 5FQ0A 3KSCA 4PIXA 1Q43A 3TNQA 1O4TA 4META 4I0AA 4MX3A 2B9UA 2BEOA 3UKNA 4IEXA 2FQPA 4HSLA 1WLTA 4PIYA 3EO6A 3EBRA 3LA7A 4MGYE 5KHIA 1ZZ7A 3DN7A 4MGZE 4I3PA 3LA2A 2C0ZA 4UXAA 4YSFA 2ETEA 5LRSA 4OLLA 4FAGA 4AVBA 4E2SA 1Q3EA 1X8MA 4LA2A 1O5UA 3RYRA 2Q0AA 5I91A 3JZVA 2F4PA 3I54A 1U12A 4P9GA 1LB2A 3WW1A 1O3RA 4HBNA 1DZTA 2HJIA 4Q29A 2IXHA 4I02A 1YFYA 4MUVA 3SMHA 3M3IA 4QGLA 2WFPA
chains in the Genus database with same CATH superfamily
2R073 2VNVA 3RS6A 1W8UA 3B7MA 1PO11 4NHKA 1BBT2 1ND3A 2HWE1 4Y20A 5FMBA 4AQTA 4E2QA 3O1OA 4E8CA 1RL3A 5IATA 1C3HA 1NCQA 1ZRIA 1FOD1 3MLKA 2YZ4A 3H42B 3M3EA 3ZFFC 3MIFA 3I97A 2JICA 3KT1A 1FPN1 4BJ0A 1RUF2 5EYXA 1RUG1 5KXEA 2WSUA 3ON7A 4NVPA 1W8NA 4B4QA 1PNFA 1IS4A 1LODA 2ADDA 2RS33 5KC5A 5BYNA 1DQ4A 5LBBA 1HKDA 1MS3A 1DQ6A 3JQXA 2R041 1NZIA 4LO6B 2Z2SB 2W0XA 4AHZA 3H8XA 1LTEA 3BU7A 1W2UA 2OUJA 4GB32 1GANA 1UXXX 2RDQA 3IDCB 4AYUA 1TE1B 2H0BA 3ZFEC 1XYNA 2E33A 1AR91 3WF4A 2UWAA 1HRV1 3HEIA 3C3VA 1RIRA 1BBT3 3IMMA 3WW3A 4Y4YA 2ORZA 1CONA 2BERA 4PF5A 1DCSA 4PLMA 4KU8A 4WBBA 1NZCA 5C3SA 4BIFA 5HI0A 3P3PA 1J3QA 2XQXA 3R4UA 1ZA4A 5FPZA 3FZ3A 1BQPA 4CTEA 5A1FA 4YM0A 1EUTA 1VBC1 4QPIA 3RYPA 2VZOA 1CQ9A 4CUAA 3E5XA 1ZZBA 1W8FA 2ZHMA 1OUSA 3AKQA 4FP3A 4AFCA 1JZ6A 3NKGA 1QWRA 2XQRA 1FT9A 1O3SA 1AZDA 1CZVA 4IQPA 5J1XA 4D7YA 4CUCA 1U5YA 3WP3A 2DCJA 2OZ6A 3K4DA 3V0BA 1NY71 4OMDA 3AZVA 2YY1A 1G9DA 3BTAA 3AP5A 1HXS1 4FQZA 1EV13 3H8UA 2DVFA 4X6RB 1XE8A 5JPMB 3FMGA 1MEC3 5F3GA 4ZS2A 4CCOA 2YPJA 4LO7A 4HONA 4XF0A 5FO9B 3OUIA 4A41A 2VBPA 1H2NA 1NOVA 5LB6A 2PLV1 4BH9A 3BIEA 4O7XA 1DGWA 1FYUA 1PK6C 2WZPP 1WW6A 1ST8A 4D3WA 2PHDA 1UXZA 2YROA 2FDGA 4PJYA 4L2NA 1OFNA 4GQ7A 5DUXA 2JECA 4HVRA 3VZNA 3WDXA 4B7EA 4P00B 1OURA 2CY6A 4YG6A 1AR62 1S0IA 2XXZA 3A4UA 2FCTA 2GNTA 5DUUA 2UY9A 2WS92 2QNKA 2AC1A 3DEMA 3VHPA 3AMQA 2Q5TA 4XIOA 5A32A 5FZFA 3PJYA 4JDNA 1W6PB 3WF0A 1QJY2 1X36A 3WQ7A 3AMPA 4BISA 1T6GC 5FWJA 3U78A 1TMF1 4RS5A 3D0JA 3PUSA 4MGIE 3PMSA 2FDHA 2RS53 1D0HA 5DG1A 1PIV3 2E7QA 5E16A 2ZX4A 3UNPA 1VRH2 1CR7A 3UV9A 5LEJA 4J25A 1QJFA 2WABA 2EIDA 5L36A 4QDSA 1KS4A 2Z5WA 3DYMA 1GZWB 4NPRA 3R05A 1SLAA 4K9SA 3LEIA 4CCNA 2PHUA 5HV0A 2SLIA 4H2AA 4Y1ZA 3VBHA 3N36A 3LD8A 1OH4A 3VBRC 1C8M1 3ZR6A 1RUE1 4CEWB 4YNIA 1OKOA 3K4ZA 4CEYC 2ZX2A 4JTOA 4GKYA 1UMHA 3U10A 4SLIA 4ES8A 4IE6A 4RL7A 2VNOA 4IE7A 2VOKA 3GHNA 2ZGLA 3U4XA 4PBPA 4DNYA 2W5FA 4UFHA 4H3WA 5D8AA 2WNOA 3WP5A 4ZZ5A 1HW5A 1O4YA 3PDQA 5LATA 3UJOA 3PLQA 2R0FA 4UI9L 1JYVA 4LKEA 2WWJA 1RVF2 3NSTA 1IZ3A 3W20A 5IJRA 1RGSA 2F17A 3RZZA 1AYM3 3AYCA 2JJ6A 3VBSA 3ZFGA 1G8WA 2VMGA 5F3EA 3AC0A 3E5QA 3E6DA 1HB3A 3M7AA 3ST7A 4YVWB 2XBO3 1MR5A 2HEYF 1DDLA 4KQ7A 1HRI3 2NYYA 1R1A2 5A33A 4MG2A 1D7PM 2Y6GA 5FY4A 1RB8G 5FP7A 2XOMA 3QACA 3T2QA 5LWBA 2OUHA 4FOYA 1GZTA 4EZ4A 1W39A 2VMCA 3H9AA 1J59A 1O8PA 1PGSA 2B9VA 4IERA 4CA9A 3RI9A 3GZAA 4CP2A 3D4KA 1UU4A 4W8JA 2OA2A 5I8TA 2WFF1 4QU2A 1PX4A 3ES1A 1J84A 5IK7A 1ULFA 5C3RA 2VOVA 2WZR2 1DHKB 2R6QA 2WUHA 4FTEA 3S30A 2W92A 2HLEA 3U1XA 2GH2A 3FC0A 4L9BA 3E6BA 4B29A 2Y34A 1J3RA 1BYHA 4MHUA 5JXGA 1XE0A 1OA3A 2VZ1A 2XKOA 2BNOA 1R1A3 4ASLA 1X33A 3JCIA 3LGRA 2F4LA 1ASJ2 3FHIB 2D6NA 2RJKA 3D3AA 2ZHLA 3QOPA 2VZVA 4RR3B 4XQDA 4FAHA 1JTZX 4ZU7A 4M00A 5FUIA 4EN0A 2JG8A 5HV4A 1H30A 5JZGA 1COV3 1ZRFA 1OC1A 1YNAA 3I3MA 5C33A 2D5HA 5C3OA 1F2NA 2VM9A 3LEMA 3J9SA 3MPPG 2OPWA 1QXPA 1WCQA 2BGOA 4ISQA 2BW8A 3UL2A 4R9DA 4JC1A 3MW2A 1WD3A 2XB6C 2A6VA 2JEMA 4DFSA 2CDOA 1X9PA 2G9GA 2YC4A 3WVJA 5E1RA 4ITCA 3HMYA 1RUD2 5B4NA 2WZR3 1RUJ3 5KR7A 4YARA 3T09A 3GBWA 3VKLA 2Y8KA 2VE1A 1UZ0A 3K75B 5FP4A 2W68A 1XNBA 2WA3A 4Q2FA 5CADA 1ASJ3 1W9WA 1LHOA 2XWJB 5KWRA 4IXLA 2GU9A 5T5JA 1QJEA 1RUOA 4PHZA 1WBFA 4XZPA 2VU9A 1DQ5A 2JDHA 1KFUL 3HNBM 3GNEA 4KWLA 4PI0A 1LJ7A 1GFF2 2GAUA 1K5MB 3IN9A 2X29A 3WV6A 2DUPA 2GNBA 3MO4A 3BALA 1LRHA 4TTGA 1CAWA 1R093 4QT6A 4WVVA 4RQPB 4IE0A 4C8DA 2PN5A 2ZABA 4AQ2A 4CDXC 3U11A 1PVXA 2RJ2A 2WQZC 3QBQA 4XDOA 4OQ9A 4OYUA 1IKQA 4EE2A 3ZXDA 3LF7A 2A70A 2BWAA 3WSOA 1DBNA 2X05A 3I2OA 4M3CB 1S0BA 4ZONA 4QPYA 4XOGA 5FXXA 2JG9B 1GUIA 1MVQA 1NYWA 2V5DA 1VBE1 3MI8A 5LA1A 1RUI3 1W6PA 5L9VA 1X9TA 4NRMA 1Z7S2 3TEWA 4B8EA 2D40A 1YQ6A 2ET1A 1CESA 3ZSMA 3CMGA 2FDJA 5F37A 2OQ6A 1O91A 3H3ZA 3LEGA 4NHLA 2W95A 3HR9A 4DB5A 2Z42A 2R061 4LULA 1V6OA 2KR2A 1V9U1 2AR6A 2WKKA 4HKOA 2BP6A 4PLNA 3P1IA 2VNRA 4OUMA 5IVYA 5CFDB 4QXBA 5I0RA 4WM8C 2VVDA 1QJU1 4CP9B 3J8F1 4A6OA 1GQPA 1IG3A 1GZWA 1S55A 3ILNA 4XABA 5GLUA 4DIQA 3KF5A 4NO4A 4QAWA 3LB9A 1RHI2 1ZBE2 1LAJA 4YFZA 4RSUA 2IXKA 3OGRA 4FBFA 1AL21 3MPBA 4Y4RA 2WAAA 4CEWA 3ZKUA 1A8DA 3J7NA 3SHRA 5IVVA 1KRIA 1AF9A 3PTRB 1Z7S3 3K3NA 5LZ6A 4L11A 4AGGA 4AVSA 3IDBB 4IV3C 5KHGA 4BHPA 3KV9A 3JD72 4M4RA 2XL7A 2JE9A 3DUIA 4Q4V2 4QHBA 3A0NA 5FLHA 2J1AA 4CDUC 2R16A 2UURA 4LIUA 3AZZA 3PJQA 4IV1C 3ZXLA 4JRLA 3GF6A 4MH0E 2OS2A 3NAPB 4V2VA 4AXOA 2AUYA 1UAIA 3PTYA 1RUC1 5A6ZA 2V4VA 1CD3G 4KMQA 2VCBA 1JZ4A 4X6QB 4CSWA 4TXWA 5CFCC 1LOBA 3BTYA 4EN9B 5LBEA 4YVWA 4YW5A 4D0QA 1ZZ9A 2XWBB 1ZYBA 2P6CA 4W6WA 3CNAA 1DGRA 2Y6LA 4AL9A 5JOZA 5FZLA 1OLQA 5FZGA 4MHRA 4W4ZA 4GKXA 2IZWA 4EROA 3ZYHA 2DTWA 1PZ8A 4BCUA 5LCWL 1N1YA 1PO12 4XAEA 1Y9GA 1UU6A 2DBNA 2HWE2 1MS4A 2VZTA 4DXSA 4D8MA 2WO2A 1L7LA 2NMNA 3ACHA 4Y3OA 1FOD2 1JZ3A 1G9CA 2OYZA 1SPPB 5JPNB 5IK8A 2YPDA 1Q56A 4YYOA 1OMIA 5C7GA 2D6MA 1FPN2 1IPJA 1LHVA 1RUG2 4A44A 4TWTA 4E4DX 1WA6X 4B7KA 3H3LA 4Z07A 2EICA 4DXZA 3I2IA 2R042 3DPRC 4TZDA 4C0HA 3ETPA 4YVSB 1HIXA 4QPGC 4ZXKA 4IEVA 5FOBB 5GZDA 2W3JA 2ZEWA 1AR92 1FMD3 4L97A 1GWMA 1HRV2 5E88A 5I0SA 4N43B 2Y6JA 4A4AA 3POBA 2OW4A 5FZOB 3R6SA 1JUHA 1STMA 4I01A 3NJVA 1AVBA 3IDAA 5M0TA 2XPJA 2VQAA 1EPZA 4DUVA 1AR81 2W1UA 5FY1A 4DQAA 3IZOA 1BEV3 4JGYB 1VBC2 2P3KA 4OI1A 5E89A 3VL9A 2A6ZA 1RUH3 1WLDA 3LWCA 3MW4A 1CJDA 1GOHA 1PMIA 3JB4C 1DYPA 1DZQA 4QDQA 2BVBA 4NAOA 4QU1A 5JSOA 4Q8LA 1H9WA 4YGDA 3T2TA 3A22A 2PHTA 2HWD1 2Y0IA 3MLLA 4XF1A 1W2OA 4LK6A 4H7MA 4KNCA 1V70A 2YC2A 3NNLA 3DXUA 2ZGNA 3MICA 5FK7A 3VHOA 4URAA 4Y5TA 2EIEA 3K51A 1HXS2 3E97A 3MEPA 3KT4A 2ZBJA 4GH4B 1K5MA 1SEFA 3H0OA 2A5ZA 1UYZA 2WQ4A 1KDMA 2JX9A 4Y22B 5BXXA 4EJRA 2GSYA 2PLV2 4RQPA 4AEKA 2PAKA 2ZMNA 3VL8A 3VBUC 2PTMA 3ES4A 1OVPA 2WAOA 2VR4A 2WNVB 3Q8AA 4QX5A 4R9AA 4XDPA 3ZYPA 1CPNA 4Q27A 5ANQA 4CCCA 4D6QA 1UWWA 4M3CA 4XJAA 5L19A 4FTBA 4JKLA 5LBFA 1SLLA 5H9SA 2FCUA 2VBDA 5DDJ1 4A6SA 2HBUA 5HCBA 3R0RA 2W1SA 3ZPOA 2E63A 2NQYA 4AGRA 4PIXA 1Q43A 4FPCA 4QXCA 1PNGA 5A7WB 4DRVA 5C8CA 5G04L 2B9UA 3HJRA 2OKXA 2ZMKA 4N90A 5DPNA 2K2SA 1TMF2 2VMHA 2VOTA 1QHDA 1K3IA 3EO6A 1MQTB 3WDYA 1Q8VA 5F6KA 2C4XA 1AR71 1V6JA 1ENQA 3LA7A 2GP3A 3OBTA 3K4AA 1ZZ7A 4CP9A 4MGZE 1UZZA 5CYYA 4Z2WA 4L8QA 1LHUA 4I3PA 1JW6A 3MFCA 3VDDB 1JI6A 1VBB3 3VZMA 3AYAA 5LRSA 4CCJA 2TEPA 3HQRA 3KZ4C 4LA2A 2AENA 5APAA 5FZMA 5GKAC 3RYRA 4YZ1A 4OHYA 3WOGA 1LB2A 3WW1A 4BZ4A 1KGYA 1LOFA 3GCXA 1JMUB 2TNFA 1C8M2 3WDWA 5FYMA 1RUE2 3K48A 3ZN6B 1CX1A 3OPWA 4MSVA 4GXLA 1PK6B 2YBKA 4FCAA 2JIGA 3BOPA 1QJX1 2IXHA 4LBJA 1YFYA 1C1FA 2NPIA 1L7RA 3PVNA 5GLWA 3MF6A 3UESA 2ZGUA 3OSDA 5KXDA 4AFAA 3M3IA 2ZGRA 4DEVA 5K9YA 1JU3A 1E5IA 4MADA 5A33B 2EIGA 4FXGB 1G7YA 3NAPA 4RFRB 3N9MA 2DWRA 1I3HA 1VJ2A 4FOQA 4UYBA 5T50A 2X10A 5JI9A 2GP5A 4QQ2A 1Z0HA 2Y6KA 4QB6A 4WVZA 1AXZA 4FSJA 3GBGA 1RUE3 3N7JA 2IUWA 2R1DA 3O0VA 4XEZA 3TOJA 4XXPA 3O1VA 4FPJA 4HVQA 2F6BA 4IEPA 5CB7A 2D6LX 4BB3A 2J42A 1HB1A 3DECA 2Y6FA 3L2HA 3OB8A 3B69A 1YFWA 3CO2A 4YRDA 5DAQA 1PVC3 4LUKA 1ZREA 2PXJA 5IUQA 3WD5A 3E6CC 3T08A 3HOBA 4RGAA 2QVSB 4D7SA 1SPPA 1AL0G 2N7GA 1H2MA 3PIGA 4AHYA 1TEIA 3TYJA 3LIGA 3FLPA 2EXJA 1G9AA 2P2KA 4JQRA 4QGMA 1YO8A 2RM22 1PGL1 4IEZA 2WFF2 3FJSA 1SHWB 3B9CA 1WD4A 2VZ3A 1FATA 4CDWC 2XONA 1MZ6A 2A3WA 4DMIA 1OUXA 3O1PA 1TNFA 4XFHA 4YVSA 1ODNA 3ZN4A 2CGPA 1VBD3 4Z8BA 1FX5A 1QU0A 5FZ7A 5IVCA 5F2SA 4UFLA 2VOXA 4N43A 1IG0A 1LNSA 2BRTA 5FZOA 3AYDA 1DU3D 5LA2A 5FO7B 4QM9A 2VUAA 3RQ0A 4JGYA 2B7YA 1AX0A 2W91A 2WWUA 1WGPA 3S5AA 2RM23 1HQLA 2G4IA 5JVVA 2PHRA 1WMXA 1R083 4N53A 5LA9A 4E9KA 5EV7A 4U36A 1BLZA 4C91A 1BCXA 4OFGA 1H0BA 2UY8A 3IWZA 1H8VA 3RYKA 2XJRA 5CISA 4YW2A 4JDOA 1H6XA 2VXRA 5EXOA 3VKFC 4AEDC 4CCMA 2YGLA 4YZ2A 5FJHA 4BWOA 4MYEA 1S0EA 2JWPA 3M3QA 4K7JA 1MS1A 1H8TA 1JH5A 2DVDA 4GA9A 4GH4A 2GN7A 3ZIWA 3I49A 1ZM1A 4H14A 3ZPYA 4Y22A 2DVAA 1H1IA 5FMCA 1POQA 4O9GA 4LO5B 4S2DA 1HLCA 4LKDA 1NUKA 2ZKNA 3IT8A 2WNVA 3B94A 3FBMA 1D4M1 1OF4A 2RR11 4WM7C 2RDSA 1DLCA 3AKTA 4FFGA 2JE8A 1OOPB 3BN6A 3T3YA 3TWIA 5F7UA 1YI9A 1VBA1 1VIWB 4DY5A 2ID4A 3IB3A 2VBBA 3ZXKA 1YCIA 1DG6A 4RHV3 1VBE2 4FO9A 5KXCA 4OHVA 5A3OA 4J1WA 3K46A 5FZCA 1GP5A 5EJ1B 1V6MA 1W2AX 2QDNA 2ZJCA 4COVA 4COUA 3QD6A 3UETA 4IGOA 3PMEA 5D1IA 4CYDA 1MQTA 1NX9A 1ND2B 1UPSA 1A8MA 5GM0A 4Y1UA 2R062 2A75A 2D43A 2PMWB 1V9U2 2K9ZA 5LBCA 3VDDA 4UW3A 2GC2A 3T4HB 3NL1A 1ULGA 2O14A 4UW5A 1QJU2 2VG9A 2V5YA 2JXAA 3J8F2 1EAH3 3USUB 1MVEA 5FPXA 1YQ5A 4HOOA 4P9XA 1NE6A 5F5AA 2D7FA 3VDBA 2DUOA 2QTWB 3ZN6A 1AL22 2Y33A 2Q1FA 1PK6A 4Q0QA 3AKSA 3PU8A 5FXWA 3KVBA 2ARBA 4S2FA 2X5IC 4LBQB 5A3TA 1OHFA 1JN2P 4CDQC 5LW9A 2P5BA 3AL5A 3O0WA 5T3NA 2B46X 5HCFA 5L7OB 4QDRA 4M3CE 1XBFA 5J98B 1LEDA 4LITA 1V9U3 4MOAA 1F8VA 1G86A 1XRUA 4JTNA 3TEZA 5LK7B 1QY4A 2XLGA 3H1MA 3EB7A 3I2KA 4LHNA 1QQP3 5FBJA 3HBZA 2JD9A 5IFPA 2R30A 3OEAA 5BPXA 2R1BA 4PDWB 3T30A 4NMIA 5TSWA 1SCSA 4Q4Y1 3O1UA 5FPLA 2H6BA 2PFWA 1U0AA 5JXHA 1NAEA 1RUC2 5L9BA 1O8SA 1TNRA 2W94A 4AI9A 1JYIA 5H9RA 5FFOC 5A6XA 1A78A 2RJLA 4MGQA 1V6KA 4XDQA 5FPVA 2R0HA 3USSA 4IE4A 4BQ5A 2ZEZA 1F4HA 1RUF3 1DGWX 1JYWA 4WM8B 1LU2A 2ZTNA 4P02B 4DXRA 1VAKA 2YBSA 4IUGA 1F31A 1UNBA 2AYHA 2NMOA 5T5LA 1UYXA 4MXVA 3ACGA 3N9QA 4ES9A 2Z4FA 1KDKA 1S4CA 1ZRCA 4IGPA 5FDBA 3SH5A 1UY0A 2ATFA 1UIKA 1XC6A 2K0GA 4GB33 3THCA 1QDOA 1W9FA 3LDBA 2LALA 3FUOA 3SCHA 1W2TA 3I59A 3WNMA 4DOUA 1H9PA 1RUC3 4TLFA 2J1VA 3PUHA 4TLGA 3OG2A 3VZKA 2B45X 4NHYA 4K20A 4DPNA 2VTXJ 4Q0PA 4P08A 4XUTA 4CDUB 1CZTA 4ZU4A 4XCBA 2VGDA 4QQPA 4IW3A 1QOOA 1D2SA 3OBRA 4LE4A 4SBVA 4U2AA 4C1XA 1XYOA 2CAUA 2E32A 5AC91 4BQ4A 3A21A 1HJFA 2UYBA 3GZEA 1SZBA 2O8QA 3I7DA 3QCWA 4B4RA 5FR3A 4FI9A 3T1MA 4FTSA 5CIRA 2VH9A 4B3NA 2I45A 5B4XA 5JOYA 2ZHNA 1X8EA 1AR82 3WG4A 5BNOC 1W2NA 1QKQA 1UO9A 1YEWA 3BCWA 4XJWA 2HH9A 4XBLA 4C1WA 1ND3C 1PX3A 3ZLIA 1OSGA 2VQ0A 4LORA 3R4SA 3EHKA 1EPWA 5FY9A 4YZ4A 1BVP1 1C57A 1DQ1A 1NCQC 4GWJA 4ZZ8A 4S2GA 1H1AA 5FXVA 3VZLA 1XPWA 2BFUL 4K40A 2V73A 3CJIC 3H50A 4ZXEA 4HN0A 5IVJA 3RDIA 1E57A 2HWD2 4YGCA 4XZUG 5ACA1 1HB2A 5GZFA 1Q8PA 1UQXA 5FZKA 2BWCA 3VD7A 4EWDA 2XDVA 5ERLA 5KBFA 5BNPA 4K21A 3FUQA 2FDKA 4Y1XA 3ZO0B 1W8ZA 1AR63 1CJPA 4GJYA 5FZDA 1XOYA 1REEA 2HWF1 2WS93 4LLFA 1J58A 3JBG1 4OCTA 1JZ8A 3OD4A 4HL0A 1XSRA 3NNJA 5ABJB 2GN3A 1CAUB 3VDAA 1QJY3 4CU6A 3RGBA 4OULA 1S1AA 3Q8EA 1OOPA 4QPGB 3ZSKA 2XVLA 3POSA 4IEUA 5DZEA 3AXEA 1JXNA 3POIA 1T2XA 1REDA 1IS5A 4QPIC 3SH3A 1POV0 5CKMA 2PAMA 5A1AA 3RZHA 4ORFA 1LCLA 4NWVA 5DDJ2 2A7AA 1VRH3 3CF6E 1ULOA 2J22A 1GYKA 3U14A 4NR1A 1LEMA 1US3A 4HN1A 1YUDA 4XHBA 1UF2C 3W5NA 3DYPA 4NPMA 4O61A 3IAQA 4RYDA 2JE7A 1KJRA 4AG4A 1ND2A 3POFA 2LTNA 5BNNB 1LU1A 5J3UA 2QKDA 1XYPA 1WBLA 2Q1ZB 2JDPA 5LY2A 1IGOA 4IEWA 1HJGA 2BV4A 2Y0OA 1LHWA 1AR72 1W99A 3TN91 1F9KA 1PZ9A 4GMP0 2A6YA 2OIIA 4IEOA 2FMDA 2VMDA 1WLCA 5FK8A 4OI0A 3WY6A 4XFAA 1OT5A 3MHZA 2E9QA 3Q8CA 2EAAA 3ZYBA 2DFBA 2EXIA 4JAAA 4UFIA 1XSQA 3QH7A 4M3CF 1QXRA 3I2DA 4LQRA 3LDRA 4LR4A 3H3UA 2ZOEB 5JSPA 4Q4X1 3J7MA 5T54A 3RZMA 1OLMA 2JKBA 2VXJA 2BGCA 2ES3A 2B4KA 2CYFA 4IDZA 4LBQA 4QQOA 5DAWA 2Q8EA 1F35A 4CVUA 5A7QA 4OZXA 2Y60A 4BK4A 4F7ZA 2D3PA 4NIGA 3DV8A 1KEXA 1QJX2 1RVF3 1SDDB 2WSVA 5L7OA 5J96B 4XFFA 4YG3A 2VUDA 1GWLA 3FE5A 1Q8OA 3DGTA 2GC3A 5C3PA 1NLRA 2JDAA 4TN7A 1RJ7A 5A7SA 5F1RA 3U07A 5G05L 4B4PA 3S0MA 5CVRA 3BU0A 5CG9A 1BMV1 3WNPA 3C7OA 4G3YC 4KL1A 1URXA 1S2BA 4UW6A 3RI8A 4PDWA 4RS5C 1WMEA 3EMRA 4G4FA 4R4ZA 5IHRA 1WUVA 1C8NA 1GV9A 3ROUA 1SQ4A 3HBKA 1WCSA 2WRAA 1OVSA 2WA4A 1XXNA 5IVEA 5HCHA 4JHTA 4A2UA 2GH8A 2JD4A 4RN5A 1QEXA 3N3HA 3ZMNA 3BUCA 4GULA 1GZCA 2XJSA 4P9LA 4B1MA 1QJX3 4COYA 3VZJA 2I07B 4WM8A 3POEA 2Q8DA 2C9AA 5LASA 4X8NA 4KGQA 1J3PA 1IS3A 3WP6A 2KD7A 5SV8A 1UMIA 2GMPA 4H55A 5JR7B 3AP7A 3WHUA 5KHKA 4HZFA 5CU1A 1RMU1 5IT6A 2VVEA 1NT0A 4BA6A 3VKNA 4LBOA 1VPHA 3N35A 3FLRA 4ARXA 2MHFA 4Q4W1 1HB4A 5FLJA 3C7FA 5FMOL 3NJZA 1DZRA 1ENXA 3THDA 4LBKA 4XYXA 4NIIA 1O59A 3G7DA 4XFCA 5IAVA 3EXUA 3T0AA 1GICA 3BB6A 2HYXA 3VBFB 5J09A 3ZXAC 3N4MA 1PGL2 2NN8A 2XUEA 5JUVA 3VUOA 2YU1A 1JOJA 1O4ZA 2WWSA 3AKPA 5DUVA 5T55A 1MS8A 3ZSEA 2VZUA 2WT1A 3GM8A 4CDUA 5DAPA 1RYYA 4MV2A 4ASKA 2C6SA 3WDVA 3ILFA 3IIAA 3FHAA 5B2GB 1TQ5A 1J83A 5BY5A 2RS11 2D93A 3HQXA 4BOWA 4R9CA 1W9YA 3OTFA 4R9BA 1RUD3 3ZFGC 1QNYA 3VBSC 3WR0A 2VMEA 2HEWF 2WNUB 3D6EA 4COWA 5C3QA 1PM4A 1IHMA 1VMFA 2DF7A 1GLHA 4FPEA 5IVBA 1AYN1 5DAXA 5F8PA 2DVGA 1HX6A 4IEYA 1GQGA 1N1VA 5JI7A 4XF4A 4A7YA 2VTFA 3THTA 4XJ8A 3OUJA 4AQ6A 4M0NA 4OMCA 4CDXB 3NVCA 4E4ZA 2RMU1 3SITA 3CZJA 3WQ1A 1LOGA 1W05A 1O5LA 5DMYA 1E5SA 4MGSA 3ZM8A 3NNMA 5FCCA 2DU1A 5FO8B 3U4SA 3WCSA 1FAYA 4Q0UA 1XQNA 2WT0A 2JDUA 3C7HA 3VN4A 5EZWA 1POV3 1UN1A 2MEV1 1VLNA 2R071 2ZMLA 4QQLA 4LT5A 5FUPA 4I0AA 1SG3A 2YG0A 4HG6B 1XJAA 4N8MA 1NCRB 2E7TA 4BQWA 3ZKYA 5ABJA 5HPOA 4CDWB 1JZ5A 2I2SA 1PO21 3EBRA 1QH6A 2X53S 4LBQD 4NE9A 3MF9A 1D4M2 5KHIA 2JG8C 2RR12 5F5QA 2JDKA 5JZGC 4V2WA 3LA2A 2RS31 2XUMA 2WN3A 4GMP3 4OLLA 4Y24A 5GLTA 4PBOA 1Q8SA 1SACA 4OI2A 1Q3EA 1VBA2 3B9IA 4E2SA 1XNAA 2WLQA 1DF0A 3VZOA 4NWWA 1NG0A 3JZVA 5FJKA 4P9GA 1U12A 5FYYA 3AMMA 5HCAA 5IK4A 2GMEA 1I5PA 3P3NA 1RHI3 4XQWA 1MS5A 1ZBE3 2VMIA 3LFIA 5BNNA 3H8OA 1B35B 1BK0A 5A3WA 1DYKA 4MUVA 4QKDA 4YG0A 1JZ2A 1GR3A 5FY5A 5C9AC 5FAXA 4QGLA 1D4M3 1E5RA 2RR13 3M2MA 5C4WB 1KITA 1LR5A 3EYPA 3HNYM 3JD73 4QKNA 4AEDB 1AXKA 4LE3A 1LKNA 3V0AB 2A71A 4C0BA 4Q4V3 3H8RA 5DZGA 3I2GA 1BHGA 5EQUA 3ZN5A 4WVMB 2IC1A 1YYNA 2D6OX 4UFKA 3D8CA 3SKVA 1SLCA 2WINB 2LUWA 3VD3A 4LBLA 4LOSA 4AR2A 2JDNA 2P17A 4XHXA 4FOVA 1EV11 2HYKA 5KHHA 5FV3A 3CEWA 2XHNA 4PF1A 3BPSA 5BNQA 3B93A 1MEC1 4XUNA 2C5DA 4YW6A 1DGLA 4J6GA 3UKVA 3O0XA 1H4GA 2MNGA 1YXWA 4WM7B 5CKQA 2OXBA 1NLQA 2XJQA 3DF0A 3H1YA 3ACLA 3O12A 5FIXA 4AZZA 3LOIA 4QPWA 2EA7A 2WJSA 1PGW1 2CNAA 3HAGA 3Q8FA 3GJBA 4LHSA 4LNVA 5JOXA 3AJYA 3VBOB 3WG3A 4JHZA 1V0AA 4YW3A 5I0DA 3OGVA 3ZYFA 2ZHKA 4G9SB 1MPXA 1PHMA 4QX3A 3MUY1 1X82A 1F15A 1YJKA 2WNEA 4XFIA 2OPKA 2DVBA 4RR3A 2ZX3A 3WHTA 1NA1B 2J1EA 2OZJA 4Q4Y2 3VD5A 3M70A 1VB4A 4XVHA 1PO13 1OXCA 3AZXA 2HWE3 5FYCA 5ISLA 2W1WA 3AL6A 3ILRA 1OD3A 4P9JA 3T0BA 1J1TA 3T2PA 1FOD3 4BQYA 3B02A 2K46A 2DFCA 2VPVA 3PHMA 2CV6A 2WBKA 1X7NA 2H6CA 4HKWA 5LK5A 1KS5A 3DKQA 4CU7A 1FPN3 4MZUA 1W9SA 1RUG3 3LA3A 5FP8A 3TEXA 3CDZB 2RS51 2HWB1 2QQNA 1K42A 4QX7A 1QF3A 4Z1VA 1PIV1 3KHCA 1JU4A 4QD2A 4WZCA 2R043 3WNXA 2W08A 1OLME 2W2IA 4OVEA 1IKPA 3K77A 2CGNA 4XF3A 3VBFA 4QX2A 1NY72 1AR93 4NIDA 2JENA 1HRV3 5A7PA 2G9ZA 2DCZA 1H1MA 3AP4A 5FPAA 3ZFFB 3M3CA 5F39A 4A3XA 3A23A 1WCUA 2WZ8A 2E31A 2QQMA 1S2KA 2UWBA 2CSGA 2QQJA 4YZ5A 2ARAA 1UIJA 1VBC3 4XIKA 4DXTA 5F32A 4AVTA 5A3MA 1W6MB 4DRRA 4QHZA 5A80A 1YQ8A 2J1UA 4EWEA 3CU7A 5FYHA 2WNUA 2YHJA 4XUQA 2EAKA 3KB5A 1YC61 4M0HA 5AC92 3ZFEB 2JG9A 4Q5OA 3WQ0A 5FZ6A 4FT8A 5GLZA 5BV6A 4XMAA 2QDRA 3JUUA 5FYVA 2IXCA 2VULA 4PIZA 5IW0A 4A7ZA 1NQDA 1HXS3 3ABZA 4Z2AA 4Z82A 4LK7A 4W6YA 4AW7A 5EIYB 2WL1A 5LRRA 3QH6A 2DV9A 4LEJA 4K3UA 3WF3A 4XPVA 1ZRDA 1AYM1 2VQTA 3KVAA 2W46A 2PLV3 5KC6A 3BPZA 2XBO1 4K1YA 5CFDA 2JB4A 2ZA9A 1HRI1 1XNTA 1SLIA 3NRUA 4UFJA 5CEHA 2BZDA 3EJKA 4GWNA 1NCRA 2VJXA 1MS9A 2HWF2 1HV0A 4CDWA 4XILA 3JBG2 3GYDA 2D6KA 4L92A 5JIUA 2ZGQA 3TB0A 1OA2A 2TUNA 4NN0A 5SV5A 4AHXA 2YBPA 5FZ0A 4CCDA 1IPKA 5J7MA 5J37A 4CE8A 3OOXA 4AEMA 4ATFA 3FHQA 1TMF3 3VGIA 4XBQA 3AZWA 3EQEA 3PU3A 2PHWA 1CIYA 4F8AA 4FFIA 2JIJA 2NM1A 3MYXA 4FFHA 3UT0A 3WDTA 1KD7A 2D98A 4LA3A 3VHRA 1R1A1 4XW3A 1PMHX 2VZPA 2QFEA 3F2ZA 1QMJA 1B35A 1V6NA 4BQ1A 5A3UA 4NAMA 2W39A 1COV1 2DUQA 3S7EA 1EUUA 4QKBA 1CPMA 2A3YA 2FZ2A 3KLSA 5FYSA 1C8M3 1ZZ6A 2P34A 4O65A 3TRSB 3O1SA 5C4WA 4BQXA 3TN92 3CJIB 4P14A 4AEJA 2XKPA 3PVOA 3V0BB 1K5MC 1AHSA 4FPGA 4JRAA 1DYOA 4PLOA 4UBHA 4BIOA 3V0AA 4BU2A 3OYWB 3KCYA 4CRQA 1LULA 4WVMA 1P8JA 3CLPA 1AUYA 1ENSA 1RUJ1 3HQUA 4CXWA 1ZBA1 4RQPC 1JYXA 2WO3A 2V72A 3W5MA 3RJRA 3FFQA 1GZ9A 4K6BA 4Q4X2 1MZEA 1ULDA 5K0UC 1O6UA 3K2OA 1ASJ1 3M4FA 2VQUA 3VBRB 2QUOA 2WIIB 5EYYA 3FN9A 4LMFA 4CEYB 3LEKA 4DEQA 3OF1A 1APNA 2QZ2A 3AMHA 1LGBA 1GNHA 1UOFA 3T0DA 3E5UA 1NXD1 4KG0A 3SCFA 3VBOA 5C8CC 1R091 1C1LA 5JSRA 3WEZA 2HWC1 2C26A 3N9PA 1BMV2 3E1F1 1V6LA 2ZAHA 1W0OA 4ZHNA 3I3QA 5T52A 1W3VA 4P9WA 3TBDA 3PUAA 4DO0A 5CKNA 1NA1A 4LXLA 4P5HA 2AACA 4E27A 4FOWA 1NQJA 4LBNA 1ALYA 3ZYRA 5JAXA 5JCTA 1X50A 4I3GA 5H9QA 2E53A 2QJVA 4O9EA 4CU9A 2BQPA 2BNNA 3LFMA 4A3ZA 3RZKA 4N7UA 4Q0VA 3SKJE 3VHNA 1RUNA 4F83A 2CU5A 2LM3A 1GQHA 1XNDA 1LESA 1RUI1 3C8XA 4HSJA 3AYEA 2QQWA 5A7NA 1U5IA 3I2HA 3OY8B 4CCKA 2XHKA 1DP0A 4BQ2A 2VOWA 4YPJA 2WFF3 5KHJA 1WWYA 1SLTA 1SMVA 1LECA 1HDKA 1HN1A 3OBAA 1LOFC 4DUWA 4YM3A 2WO7A 3SISA 1RMU2 3HN1A 4GIQA 3WINE 3GBFA 4YM2A 4I0WB 3ATGA 4Q4W2 4LBMA 2P3IA 3I8TA 2P37A 5K8SA 3P6BA 4UF0B 4I0BA 3GGLA 1WZXA 3QLQA 3RFRA 3SQOA 3VDCA 1W8OA 3ORJA 5L73A 4UT5A 4JGZC 3ZFFA 4AVAA 4JV4A 2D97A 5F6LB 2PAEA 2YYOA 4Q8KA 1M4WA 4D6SA 3NAPC 2XGXA 5JXJA 2VY0A 5C8WA 1VRBA 1W6MA 1YFXA 3KGZA 4BDVB 2KM2A 2ZZJA 3CZUA 3OCPA 1S0FA 4Z92B 4A42A 4Q1PA 2RS12 3A7QA 3KF3A 3ZFEA 3BI3A 1JUIA 5DABA 2ZEYA 1CWPA 1H2LA 4EWAA 2ZGTA 3LOBA 4I30A 5FQ0B 1RXFA 4CCEA 1W8WA 5FZHA 3SCGA 4Q4W3 3SH4A 4A45A 1HQWA 3CBNA 2IVIB 5A3PA 5IYYA 4QM8A 1HN0A 4IGQA 4EZHA 5A7WA 1MACA 4E8DA 3ME2A 3RZGA 4NROA 1RITA 3T2OA 1YWKA 5FP3A 2JDYA 1MZFA 3Q9OA 2BBVA 2QQLA 1LOEA 4BYYA 2PQSA 4KU7A 4KWKA 1GWKA 2JDMA 4Y26A 4CP1A 4A7KA 2ZKLA 4BMEA 4YW1A 3UK9A 5T5PA 4AVVA 5CBLA 2V09A 2DTYA 3AJZA 4LLOA 2MEV2 1REFA 3N9LA 3S5QA 2R072 4ZS3A 4YVSC 4E2GA 3MGUA 4OHXA 1VBE3 4N43C 5C71A 1PO22 4IEQA 3I2FA 3CQOA 3INAA 1FI2A 3C2UA 2J7MA 2XJVA 2VW2A 4N9HA 5EP9A 2RS32 2ZGPA 4JGYC 3WX5A 3PVEA 1TME1 4OZOA 4QX0A 4HT1T 4YWAA 3RG0A 3RMXA 3M8LA 2O0OA 2R063 5FP9A 2XJTA 3CKHA 1I5ZA 2WT2A 1UKRA 3RNSA 2B42B 2XLAA 1FNZA 1UY1A 4LUMA 1Y9MA 4UWDA 5FWEA 3VD9A 3NW4A 4N53C 5GZCA 1CVNA 1H4HA 1QJU3 3J8F3 1FMD1 2J1SA 3NV1A 4YGEA 1XU1A 2Q1MA 3WUCA 3OPTA 1J1LA 4CP0A 1UYPA 2ZCWA 2C24A 2QQVA 4XJ9A 1YJLA 2WYSA 4XMIA 2VC9A 3B01A 4NPLA 1AL23 4MLOA 3N9OA 1PO23 4QXKA 1BEV1 1NLSA 3CJIA 4IESA 3POYA 3ZOIA 5C5TA 1AJKA 1H2KA 1H8TC 4GH4C 1I1EA 1KFXL 1RUH1 3RWKX 4JX0A 1VAVA 3OYWA 5FRAA 3OGJA 5JR2A 1A3KA 4CXYA 2QCSB 3I3BA 5A6YA 4R8HA 1KJLA 2QE3A 4M4PA 2C9KA 3KT7A 1IQDC 2WNVC 3V64A 3KS7A 4NUBA 1W8HA 4K8RB 3WUDA 5FOJB 3WW4A 2CDPA 3VBRA 3O1MA 4AFDA 2QBXA 3GJAA 5EWSA 1EV12 4QX1A 2IXJA 3WQBA 4CEYA 1OQ1A 2Q4SA 1MEC2 1OPOA 3IIIA 4LO4B 5GALA 2JG8B 4IV3B 2R32A 5JZGB 2VW0A 4HPKB 3IBMA 2VNGA 2KXLA 3J7LA 1PGW2 4URTA 4XF9A 4JQTA 4NRPA 2XLFA 3AMNA 3AKRA 3LQCA 1ZA7A 2XL9A 2Z69A 2B39A 1UYYA 3SEPA 5H9PA 1MQTC 4FPLA 3ZVXA 2IXIA 4IV1B 2ARXA 4LHKA 3VLBB 4YFWA 1LOCA 3MIBA 3D5OA 4COZA 5IWFA 2XR4A 3VDDC 3N9NA 4MGKE 1KXGA 4KI5M 5FUNA 4TYSA 4XETA 1SBFA 2Q8CA 3OY8A 3G6JB 3GDBA 3ZYGA 3ACIA 1I9RA 5C9AB 1QIQA 3KV6A 4D6RA 3OEBA 5CFCB 5T5OA 2YC0A 1A6CA 3SXWA 1BJQA 1WW5A 3ZMOA 4IETA 2J1RA 3S6PA 1EY2A 1KQRA 2VW1A 5FZIA 3WF1A 4AFBA 4WV8A 3MIEA 2RS52 2HWB2 4R52A 4KBZA 2CWMA 2PYTA 4JVAA 4ARYA 1PIV2 3THPA 4UF0A 1CAWB 2HKXA 2WC2A 3KM5A 4XQ4A 5EHDA 3B00A 5F3IA 4AGVA 1OH3A 1VBB1 4JKKA 1U5XA 2BTVC 3ZSJA 4V1PA 4LIVA 3AK0A 4ONUA 5FKBA 2IWGB 1O3QA 4HXCA 1O3TA 1ZVFA 4L0PA 1OLRA 1YI7A 3A0KA 4R4XA 3AP6A 3M3OA 4B1LA 5LY1A 5A6QA 1R64A 2EVXA 1ZZCA 1AR83 1GP6A 1YIFA 2EXKA 1UOBA 3IM0A 4AFMA 2O8OA 4LPLA 3ZXEA 2BYVE 5FZ1A 4D94A 3DPRB 3NQHA 5I0UA 5F9TA 5JMCA 1WLWA 1YHFA 2HWB3 5FREA 5FQ0A 2X8KA 2SBAA 1UU5A 3TNQA 1GOGA 1O4TA 2PHFA 3R4DB 4M01A 4META 1AX1A 4MX3A 3HD8B 5FYTA 1RJ8A 4K1ZA 4OQ8A 4UOJA 2BEOA 2LRPA 2ZS6B 2HWD3 1GU3A 2VUCA 4IEXA 2A1XA 3NV3A 2EALA 4HSLA 5FZ3A 3KWVA 1WLTA 3MIGA 4PIYA 2Y6HA 4AF9A 4E4SA 2E51A 3N7MA 4FPYA 1N47A 5CA6A 2YUEA 1QNWA 4MGYE 3WZ1A 3OGGA 3DN7A 2YFUA 4WZFA 2C0ZA 2BPA2 1W03A 4YSFA 1AYM2 4FVVA 1MS0A 4AI3A 1FV3A 3POGA 3FBYA 2XBO2 5C5UA 2D3RA 2VZSA 3I54A 2RDNA 5FYZA 3W21A 1HRI2 3USUA 1O3RA 1PVC1 1VALA 4ET7A 4HBNA 2XG3A 1DZTA 4LO8A 3JQWA 3LIHA 4I02A 3ASIA 2WDBA 5DDJ3 2BJSA 2G1MA 2WLPA 3ZIXA 2Z79A 1WMFA 5A70A 1W8TA 2OT7A 2WFPA 4ASMB 1Y3TA 1TZOA 2DCYA 3HT2A 5A3NA 3AM2A 3W9AA 4CDXA 3WNKA 3KCCA 1C4RA 1OPMA 4ZU5A 3VBUB 5DZFA 4BE3A 1OI6A 5IAXA 1W28A 2ZGMA 3IAPA 3OGSA 1N1SA 4HETA 2GZWA 1XU2A 5FYBA 3L2YA 1VBD1 1AXYA 1AR73 2ZX0A 3BYWA 4FPHA 4AOCA 4OUEA 2VZRA 4HMZA 1QJZA 4JDMA 3RJ2X 2RE9A 3NNFA 1CX4A 1MZ5A 3PVBB 4DZGA 2G9FA 1IQAA 1N3PA 2RVAA 3RWNA 1VMJA 1VAMA 1COV2 3MDPA 1WMDA 5JLVA 5F2WA 1VR3A 2BOIA 2GC0A 3B5LB 3IPVB 5BNPC 2BUKA 2ET7A 2Q30A 2RM21 5DN2A 4BLIA 4XC9A 5EPAA 1W0PA 2ZXQA 1FNYA 1YQCA 1R081 1RXGA 4KWJA 5D2AA 3OJBA 1W90A 2WO1A 1UY3A 3VBHC 3VKMA 1RUJ2 1JOPA 1ZBA2 3KCXA 3UKTA 3NJYA 3OPZA 2VD7A 1NKGA 3TAYA 3J7HA 4LJHA 4NJ4A 1OOPC 2XVGA 3PURA 4D7TA 3ECQA 3KQRA 5JXIA 2XVKA 2BNMA 3N7LA 3LZZA 4XJZA 4IV3A 2ERFA 4PQ9A 1PMJX 2YV8A 3D82A 3V56A 4HPKA 1CZSA 5D8AC 1V6IA 3APBA 2FMYA 3NWKA 5J36A 4BQ3A 4RD7A 5DXDA 2YXSA 1R092 1ZZ8A 2HWC2 2P3JA 2AGSA 4P9YA 2AZ5A 4IV1A 1ND2C 1UZVA 1IOAA 1GSLA 2B8MA 5FY0A 2PA7A 2BOJA 4KH9A 1ZBA3 4CZSA 2FHRA 2YFZA 2H0VA 4NOTA 1BXHA 2FBEA 1V00A 4DINB 4Y33A 4HFSA 4YW4A 1CGPA 5FPUA 2ZX1A 2GNMA 2BGPA 2DURA 2VCAA 4RHV1 2E7AA 2VAUA 5C9AA 1RUI2 4KWUA 5CFCA 3I3DA 4BXFA 1UOJA 2FDIA 1G6NA 4FPOB 5D21A 3ZDSA 5FPBA 3MBWA 3ENRA 1TG7A 3H7JA 1QXJA 4GZ9A 4PCRA 5LEKA 5FZ8A 2VECA 2HWC3 4FPKA 5L7OC 4HLTA 5K0UB 1EAH1 1UPIA 2YGMA 4Y1VA 4DUXA 1WCKA 1B09A 4JCKA 2VZQA 1LGNA 4I2OA 2OX0A 3URFA 4YGBA 4AWDA 2MPFA 3UYJA 4BM8A 2NZ9A 5I8YA 3AVRA 5E8AA 4N9IA 4LHLA 4PDWC 5I0TA 2LS6A 3AXDA 2VO5A 4EV0A 2ZGKA 2DYCA 1CAUA 3MLJA 3O14A 3C7GA 1EYBA 4QB2A 4BMBA 5C8CB 3DPRA 1UX6A 4FP2A 4ZY9A 1O7FA 1WW4A 3BIWE 4QPGA 4XXAA 5FZAA 2RV9A 3RZLA 3KV4A 3U75A 3LE0A 2D3SA 1Y43B 3NJXA 4RA0A 5EFUA 4XCAA 2RHPA 3SNMA 3VV1A 5HBAA 4LOTA 3HPNA 5DQ0A 1QQP1 3LDKA 3MW3A 1CAVB 1T6BX 2VCCA 1DFQA 1W6QB 5FXZA 1JOBA 2YB7A 2W52A 4NIAA 5FLIA 1H6YA 1JS9A 3NV4A 4QGNA 1BBT1 1G9BA 2AREA 4IE5A 2EF6A 5CAZA 3IKWA 2ZEXA 2FCVA 4PT6A 4QHOA 5K4LA 1A34A 3RMYA 1OKQA 3VB9A 1OD5A 2GC1A 1L3JA 3GZUC 1JYCA 1RUF1 3CHXA 2FDFA 4NRQA 4AHWA 4BLJA 4RGKA 1CAXB 4K8FA 3AVSA 1K12A 2GDFA 4PI2A 5C70A 1SBEA 3CIHA 1PM7A 4JGZB 2XJPA 2ENRA 1VBA3 5JWPA 5F5CA 1SFPA 1SBDA 5CG8A 3U0ZA 3K3OA 4GB31 4Q0SA 1QOTA 1RINA 1C28A 3GXUA 4HKLA 5BUVA 2R7EB 4F3JA 3ZSLA 3ZYJB 2ZAAA 4TSVA 5JDBA 1L7QA 4Y5SA 3O7OA 3UGGA 3VBUA 4P9IA 3LPFA 5LA0A 1W9TA 3HVDA 3MIHA 3PIJA 1TME2 4DY3A 1W3XA 4EYUA 1SFYA 2AEYA 3DL3A 1LHNA 4UBGA 2GNDA 3DKWA 1QH7A 5E6HA 1C5HA 3NMBA 4Y1YA 3O1RA 1FMD2 3HIFA 1ULPA 2HEVF 3T4VA 3BKZA 4AVCA 1ACCA 3IPVA 3NKTA 4FPFA 4QWNA 1W04A 2P1BA 4UFMA 3ZXFA 1Q5OA 1LENA 1QGLA 1S0JA 1BEV2 1F4AA 3GALA 3KHBA 2CGOA 4GAZA 4QX8A 4HK9A 1RUH2 1I6XA 5FY8A 5C6CA 1N3QA 2UU8A 2YMZA 3IDEA 2G19A 3GHMA 1WKYA 1UY2A 5FBZA 3NNGA 4AK3A 2O1QA 3DCQA 1TME3 2WZEA 1DQ0A 1S0DA 3AP9A 2XMLA 4NHMA 4XUPA 4ZPIA 5ABJC 4CEWC 3VD4A 5FTTC 2L9LA 2BU9A 1XB9A 2PHXA 3W58A 2ILMA 1DIWA 2KA3A 2W9XA 1JZ7A 2Y64A 3KD4A 4MXWB 4XFBA 3UGFA 4D69A 3BTZA 4AI1A 4KGGA 5ANNA 2B5HA 2A6WA 1AR61 1R1ZA 1W6NB 3NO8A 4N7IA 4OHZA 4Q4Y3 5EJZB 2A6XA 2WS91 1UL9A 2X5IB 4EQVA 1Y9QA 2BVVA 4L99A 1RC6A 4CDQB 3N7KA 5FYIA 4AI8A 4XFGA 4BK5A 1W6OB 4QXHA 2VCMA 3L9JT 4CUGA 2D44A 4MGTA 1QJY1 2WR9A 1BK1A 5BNNC 3ETQA 1XE7A 1HV1A 3ITQA 2FD8A 2DCKA 3PUQA 3J26N 4N53B 1D4VB 3WXPA 4JZRA 4DS0A 1IPSA 1NXMA 4YVWC 3DYOA 3T1LA 4UAPA 2JB8A 1DGRN 1VRH1 4YM1A 5F3CA 1C5IA 3TNPB 4XTMA 1UOGA 5FZ4A 1SLBA 3P5BA 1H8TB 5I93A 4CCLA 1UMZA 3JB8A 5CZKA 4BPZA 2BFUS 3RPQA 4UW4A 1DLLA 1GP4A 1ZRRA 3I4IA 3FL7A 3MFAA 1OBNA 2DCTA 2UYAA 2C1FA 3S7IA 3BOWA 2ZACA 3GCWA 4FXKB 5K0UA 4FFFA 2W47A 1W06A 1S0GA 3GZTB 4INDA 3SLIA 2OQ7A 1VBB2 3DXTA 4HVOA 5ACA2 4IL7A 1W0NA 1OF3A 3KV5A 3WT3A 2JDZA 3WF2A 4QQHA 2BBAA 5AC93 3KGLA 3M1HA 4QMAA 1UCXA 5FYUA 3IMNA 4CUBA 3OBZA 1JYNA 1BZWA 1YRZA 2QQKA 5AVAA 3AB0A 3B3QE 5HXVA 1GNZA 1D0GA 1Y4WA 3NV2A 4RR3C 3UGHA 3LCPA 5DAVA 2QQUA 4CXXA 1AJOA 3MV01 1K5JA 2LW8A 4YLZA 1RVF1 5FZEA 3WLUA 4H7LA 1CIWA 1F5JA 2OVUA 2Y26A 4AQSA 2R49A 4LTAA 3HT1A 4GJZA 4XUOA 5FZ9A 4AE2A 4C90A 2VVFA 1US2A 2IXLA 2W1QA 5GZGA 1UW8A 3SEEA 1LGCA 1UZYA 2Q8OA 1CAVA 3KQ4B 3FLTA 1JHJA 1W6QA 1YIPA 2J1TA 3FWEA 4WVWA 5ACA3 4AAXA 5JIAA 5GZEA 3RSJA 2CAVA 3HNMA 1LOAA 3JU9A 5AVPA 1WW7A 3U37A 5BNOB 2P3YA 2RG4A 2HWF3 4XJUA 4Y20B 2P4EA 1ND3B 1XNCA 3JBG3 3WG1A 4AI0A 2QQPA 4S2HA 1ENRA 3VBFC 4Y5Z0 1NCQB 3D0SA 2ZZQA 2RDRA 3RVHA 3HN3A 1SDWA 4I09A 4PQQA 3X29B 4MO3M 4AEDA 1WCDJ 1CAXA 4AI2A 4LKFA 1GBGA 2HBTA 4X8PA 4J1XA 2AEZA 4XTPA 2PQQA 1PVC2 4JGZA 3MZHA 3ZX7A 2WZR1 4GWMA 1YFUA 2GALA 3H7YA 4LKSA 4GALA 2VUJA 4ZKTB 1U5ZA 5A1LA 4ATEA 3ACFA 4E4HA 3ALQA 1YQ2A 3ELNA 2WNUC 1ONAA 1YLLA 5DG2A 2ARCA 3ZXGA 3WG2A 2DU0A 5A3LA 5IFTA 2JG9C 4RFT0 4CPBA 4Q1RA 3PNAA 4WM7A 2UWCA 1UZWA 2W87A 2IVJA 2ZPXA 5EJ3A 1JHNA 2LROA 3BGAA 2VMFA 3CJXA 4CU8A 2QZ3A 4OI4A 1OQEA 5FY7A 1AX2A 2GMMA 2NLRA 3TN93 2E6VA 1VBD2 2CTVA 2QQIA 1TVGA 4FQ4A 2ZGOA 4QPIB 1ULCA 2YU2A 3RRDA 1OFSA 1VMHA 3I2JA 1RUD1 1Q8QA 1RTVA 1ZNPA 3AZYA 2XJUA 1GNYA 3I3EA 5CFDC 3AFKA 4Q4X3 2DDUA 1F5FA 5IK5A 1ODMA 3ZR5A 1S2EA 2CWSA 1G9FA 1DQ2A 1NCRC 3I59B 2IFWA 4EN6B 1UD1A 3MV11 2Y38A 1QOSA 1R082 5J48A 4NHXA 3WW2A 3RZJA 3VKOA 2PELA 3BTXA 3BODA 5FMOS 1M06G 3CL1A 5CNAA 4MXWA 1OQDA 1VE0A 4KG8A 2AH2A 3H1WA 2ORXA 4XACA 1UKGA 4RGGA 3MUZ1 2WYFA 1ULEA 2CHHA 1POV1 4OUSA 1W6NA 3C7EA 3ZYIB 4EN7B 5JMOA 3Q8BA 3LAGA 2JKXA 2X5IA 3PUIA 3AX4A 3WP4A 4CDQA 5GLVA 1BVVA 3FX3A 4W6XA 5I8SA 1VP6A 4Q26A 2ZGSA 1W6OA 4P5YA 3JXSA 2TBVA 1BKZA 2PHLA 3KMHA 5DUWA 1Z7S1 1B35C 5A32B 3WNOA 2EXHA 4JKMA 1WA4A 2ADEA 3POJA 5A7OA 5KXBA 2A3XA 4OHWA 1IS6A 4GMP1 2BDRA 4RS5B 2X09A 4XE9A 3OD0A 1RMU3 1D2QA 1XNKA 1Y7BA 3BVCA 3POWA 5F5IA 3WCRA 5C4WC 3AFGA 3PL0A 1UX7A 2D6PA 4HK8A 4XAAA 3ZXJA 4EN8B 2XH6A 1QDCA 1SFNA 3S57A 1HQNA 1ZX5A 4RHV2 3SC7X 4BXSV 4HANA 2D5FA 1AYN2 1NE4A 5BNPB 1GKBA 1PZ7A 2A73B 1RHI1 1CN1A 1ZBE1 5HXMA 1FXZA 1EP0A 3LSDA 2NP0A 5AFBA 2RMU2 3WNLA 4YZ3A 3KSCA 3VBHB 5FZBA 3LSEA 1N1TA 3W59A 2IFRA 3WDUA 1FV2A 3HWJA 2V4AA 3JD71 3WNNA 1Z78A 3UKNA 2FQPA 1GMMA 5IVFA 2RS13 1EAH2 4Q4V1 2P6HA 4YW7A 3VBOC 4ISRA 1E5HA 5K7PA 3OUHA 2CL2A 2DBIA 4W50A 4XURA 1K45A 3O5SA 5FMDA 4XBNA 3V65A 2I74A 5D8AB 1AYN3 4UXAA 2ETEA 1NA1C 4CPBD 1JYTA 4FAGA 2FZ1A 4AVBA 2WQ8A 5AFEA 4QB1A 5L9RA 1X8MA 5FKCA 1O5UA 3FFZA 2Q0AA 5I91A 2YDEA 2E26A 2WN2A 2F4PA 3F95A 2RMU3 1UY4A 4GWIA 4AAPA 1N3OA 1JBCA 2EIBA 2QQOA 3TEYA 4NIHA 3MIDA 1VB2A 4W65A 4GD4A 3ZDVA 3LKJA 4KBBA 3UJQA 1SCRA 5GJ6A 2HJIA 3VBSB 4Q29A 3ZFGB 1OA4A 1GOFA 1QQP2 5JOWA 2VL4A 4MVTA 4QKFA 1S0CA 2VTXA 3LPGA 3SMHA 3O1TA 3J4UH 5BNOA 2MEV3 1JODA
chains in the Genus database with same CATH topology
2R073 3RS6A 5A33B 3B7MA 1PO11 4NHKA 1BBT2 1ND3A 2HWE1 4Y20A 4AQTA 4E2QA 1RL3A 1C3HA 1NCQA 1FOD1 3MLKA 2YZ4A 3ZFFC 3M3EA 3MIFA 2JICA 3KT1A 1FPN1 1RUF2 5EYXA 1RUG1 5KXEA 2WSUA 4NVPA 4B4QA 1PNFA 1IS4A 1LODA 2RS33 5KC5A 5BYNA 1DQ4A 1HKDA 1MS3A 1DQ6A 3JQXA 2R041 4LO6B 2Z2SB 2W0XA 4AHZA 1LTEA 3BU7A 1W2UA 2OUJA 4GB32 1GANA 3U4XA 3IDCB 4AYUA 1TE1B 2H0BA 3ZFEC 1XYNA 1AR91 2UWAA 1HRV1 3C3VA 1RIRA 1BBT3 3WW3A 4Y4YA 1CONA 4PF5A 4WBBA 4PLMA 4KU8A 1NZCA 4BIFA 5HI0A 3P3PA 1J3QA 3R4UA 1ZA4A 5FPZA 3FZ3A 1BQPA 4CTEA 4YM0A 1VBC1 4QPIA 3RYPA 1CQ9A 3E5XA 1ZZBA 2ZHMA 3AKQA 4FP3A 4AFCA 3NKGA 1QWRA 1FT9A 1O3SA 1AZDA 4IQPA 4D7YA 1U5YA 3WP3A 2DCJA 2OZ6A 1NY71 3AZVA 2YY1A 1G9DA 3BTAA 3AP5A 1HXS1 4FQZA 1EV13 3H8UA 2DVFA 4X6RB 1XE8A 5JPMB 3FMGA 1MEC3 2YPJA 4LO7A 4XF0A 5FO9B 4BH9A 1H2NA 1NOVA 2PLV1 1DGWA 1FYUA 1PK6C 2WZPP 1WW6A 4D3WA 2PHDA 2YROA 4PJYA 4L2NA 1OFNA 4GQ7A 5DUXA 2JECA 4HVRA 3VZNA 3WDXA 4B7EA 4YG6A 2CY6A 1AR62 1S0IA 3A4UA 2GNTA 5DUUA 2UY9A 2WS92 2QNKA 3VHPA 3AMQA 2Q5TA 4XIOA 5A32A 3PJYA 4JDNA 1W6PB 1QJY2 1X36A 3WQ7A 3AMPA 1T6GC 1TMF1 4RS5A 3D0JA 4MGIE 3PMSA 2RS53 1D0HA 5DG1A 1PIV3 2E7QA 5E16A 2ZX4A 1VRH2 1CR7A 3UV9A 5LEJA 5L36A 1KS4A 2Z5WA 4NPRA 1GZWB 3R05A 1SLAA 4K9SA 2PHUA 2SLIA 4Y1ZA 3VBHA 3N36A 3VBRC 1C8M1 1RUE1 4CEWB 4YNIA 4CEYC 2ZX2A 4JTOA 4GKYA 3U10A 4SLIA 4ES8A 4RL7A 2VNOA 2VOKA 3GHNA 2ZGLA 4PBPA 4DNYA 4H3WA 5D8AA 3WP5A 1HW5A 1O4YA 3UJOA 3PLQA 2R0FA 1RVF2 3NSTA 1IZ3A 1RGSA 3RZZA 1AYM3 3AYCA 2JJ6A 3VBSA 3ZFGA 1G8WA 2VMGA 3E5QA 3E6DA 3M7AA 3ST7A 4YVWB 2XBO3 1MR5A 2HEYF 1DDLA 4KQ7A 1HRI3 2NYYA 1R1A2 5A33A 1RB8G 3QACA 2OUHA 4FOYA 1W39A 3H9AA 1J59A 1PGSA 4IERA 4CP2A 3RI9A 3GZAA 3D4KA 1UU4A 5I8TA 2OA2A 2WFF1 4QU2A 3ES1A 5IK7A 1ULFA 2VOVA 2WZR2 1DHKB 2R6QA 4FTEA 3S30A 2GH2A 3FC0A 4L9BA 3E6BA 4B29A 1J3RA 1BYHA 2XKOA 1OA3A 2BNOA 1R1A3 4ASLA 1X33A 3JCIA 3LGRA 1ASJ2 3FHIB 2D6NA 2RJKA 4RR3B 2ZHLA 3QOPA 4XQDA 4FAHA 1JTZX 4ZU7A 4M00A 4EN0A 2JG8A 1H30A 5JZGA 1COV3 1ZRFA 1YNAA 5C33A 2D5HA 1F2NA 3J9SA 3MPPG 1QXPA 4ISQA 2BW8A 3UL2A 4R9DA 4JC1A 3MW2A 1WD3A 2XB6C 2A6VA 2JEMA 4DFSA 3WVJA 2G9GA 5E1RA 4ITCA 3HMYA 1RUD2 2WZR3 1RUJ3 4YARA 3GBWA 3VKLA 2W68A 1XNBA 2WA3A 4Q2FA 5CADA 1ASJ3 2XWJB 1LHOA 5KWRA 4IXLA 2GU9A 5T5JA 1RUOA 4XZPA 1WBFA 2VU9A 1DQ5A 1KFUL 4KWLA 3GNEA 1LJ7A 1GFF2 2GAUA 1K5MB 3IN9A 2X29A 3WV6A 2DUPA 2GNBA 3BALA 1LRHA 1CAWA 1R093 4QT6A 4WVVA 4RQPB 2PN5A 2ZABA 4AQ2A 4CDXC 3U11A 1PVXA 2WQZC 3QBQA 1IKQA 3ZXDA 2A70A 2BWAA 1DBNA 4M3CB 1S0BA 4QPYA 4XOGA 2JG9B 1MVQA 1NYWA 1VBE1 3MI8A 1RUI3 1W6PA 1Z7S2 4B8EA 2D40A 2ET1A 1CESA 3ZSMA 1O91A 3H3ZA 4NHLA 3HR9A 4DB5A 2Z42A 2R061 4LULA 1V6OA 4PLNA 1V9U1 2AR6A 2WKKA 4HKOA 2VNRA 4OUMA 5CFDB 5I0RA 4WM8C 2VVDA 1QJU1 3J8F1 1GZWA 1S55A 3ILNA 5GLUA 4NO4A 3LB9A 1RHI2 1ZBE2 4YFZA 4RSUA 2IXKA 4FBFA 1AL21 3MPBA 4CEWA 1A8DA 3SHRA 1KRIA 1AF9A 1Z7S3 4L11A 4AGGA 4AVSA 3IDBB 4IV3C 5KHGA 4BHPA 3JD72 2XL7A 2JE9A 3DUIA 4Q4V2 4QHBA 3A0NA 5FLHA 4CDUC 2R16A 2UURA 3AZZA 3PJQA 4IV1C 3ZXLA 4JRLA 3GF6A 4MH0E 3NAPB 4AXOA 2AUYA 1UAIA 3PTYA 1RUC1 1CD3G 4X6QB 5CFCC 1LOBA 4EN9B 4YVWA 4YW5A 1ZZ9A 2XWBB 1ZYBA 4W6WA 3CNAA 1DGRA 5JOZA 1OLQA 4GKXA 2IZWA 4EROA 2DTWA 1PZ8A 4BCUA 1N1YA 1PO12 1UU6A 2HWE2 1MS4A 1G9CA 2NMNA 1FOD2 5IK8A 2OYZA 5JPNB 1Q56A 4YYOA 1OMIA 2D6MA 1FPN2 1IPJA 1LHVA 1RUG2 4E4DX 4TWTA 4B7KA 4Z07A 4DXZA 2R042 3DPRC 4TZDA 4C0HA 4YVSB 4ZXKA 1HIXA 4QPGC 4IEVA 5FOBB 5GZDA 1AR92 1FMD3 4L97A 1HRV2 5E88A 5I0SA 4N43B 2OW4A 3R6SA 1JUHA 4I01A 1AVBA 2XPJA 2VQAA 1EPZA 1AR81 4DQAA 4JGYB 1BEV3 1VBC2 2P3KA 4OI1A 5E89A 3VL9A 2A6ZA 1RUH3 1WLDA 3LWCA 3MW4A 1CJDA 1PMIA 3JB4C 1DYPA 1DZQA 2BVBA 5JSOA 4Q8LA 1H9WA 4YGDA 3T2TA 2PHTA 2HWD1 2Y0IA 3MLLA 4XF1A 4H7MA 4KNCA 1V70A 2ZGNA 3MICA 3VHOA 3K51A 1HXS2 3E97A 3MEPA 3KT4A 2ZBJA 4GH4B 1K5MA 1SEFA 3H0OA 2A5ZA 2WQ4A 1KDMA 2JX9A 4Y22B 5BXXA 4EJRA 2GSYA 2PLV2 4RQPA 4AEKA 2PAKA 2ZMNA 3VL8A 3VBUC 2PTMA 3ES4A 4QX5A 2WNVB 4R9AA 3ZYPA 1CPNA 4Q27A 4M3CA 4XJAA 5L19A 4FTBA 1SLLA 5H9SA 5DDJ1 5HCBA 3R0RA 2E63A 2NQYA 4AGRA 4PIXA 1Q43A 4FPCA 5C8CA 1PNGA 4DRVA 2B9UA 2ZMKA 4N90A 2K2SA 1TMF2 2VMHA 1QHDA 3EO6A 1MQTB 3WDYA 1Q8VA 5F6KA 1AR71 1V6JA 1ENQA 3LA7A 3OBTA 4Z2WA 1ZZ7A 4MGZE 1UZZA 4L8QA 1LHUA 4I3PA 1JW6A 3MFCA 3VDDB 1VBB3 3VZMA 3AYAA 5LRSA 2TEPA 3KZ4C 4LA2A 4OHYA 2AENA 3RYRA 5GKAC 4YZ1A 3WOGA 1LB2A 3WW1A 4BZ4A 1LOFA 2TNFA 1C8M2 3WDWA 3ZN6B 1RUE2 3K48A 4MSVA 4GXLA 1PK6B 4FCAA 3BOPA 1QJX1 2IXHA 4LBJA 1YFYA 1C1FA 2NPIA 3PVNA 5GLWA 3MF6A 2ZGUA 5KXDA 3M3IA 2ZGRA 5K9YA 2EIGA 4FXGB 1G7YA 3NAPA 2DWRA 1I3HA 1VJ2A 4FOQA 5T50A 5JI9A 4QQ2A 1Z0HA 4WVZA 1AXZA 4FSJA 3GBGA 1RUE3 3N7JA 4XEZA 2R1DA 3O0VA 3TOJA 4XXPA 4FPJA 4HVQA 2F6BA 4IEPA 5CB7A 2D6LX 3L2HA 3B69A 1YFWA 3CO2A 4YRDA 1PVC3 4LUKA 1ZREA 5IUQA 3WD5A 3E6CC 4RGAA 2QVSB 4D7SA 1AL0G 2N7GA 1H2MA 4AHYA 1TEIA 3TYJA 3FLPA 2EXJA 1G9AA 2P2KA 4JQRA 4QGMA 1YO8A 2RM22 1PGL1 4IEZA 2WFF2 3FJSA 3B9CA 1WD4A 4CDWC 1FATA 1MZ6A 2A3WA 4DMIA 1TNFA 4XFHA 4YVSA 3ZN4A 2CGPA 1VBD3 4Z8BA 1FX5A 1QU0A 2VOXA 4N43A 3AYDA 1DU3D 5FO7B 4QM9A 2VUAA 3RQ0A 4JGYA 2B7YA 1AX0A 1WGPA 2RM23 1HQLA 2G4IA 5JVVA 2PHRA 1R083 4N53A 4E9KA 5EV7A 4U36A 4C91A 1BCXA 4OFGA 1H0BA 2UY8A 3IWZA 1H8VA 3RYKA 2XJRA 4YW2A 4JDOA 5EXOA 2VXRA 3VKFC 4AEDC 4YZ2A 2YGLA 4BWOA 4MYEA 1S0EA 3M3QA 4K7JA 1MS1A 1H8TA 1JH5A 2DVDA 4GA9A 4GH4A 2GN7A 3ZIWA 1ZM1A 4H14A 3ZPYA 4Y22A 2DVAA 1H1IA 4O9GA 4S2DA 4LO5B 1HLCA 2ZKNA 3IT8A 2WNVA 3B94A 3FBMA 1D4M1 2RR11 4WM7C 3AKTA 1OOPB 3TWIA 1YI9A 1VBA1 1VIWB 4DY5A 3ZXKA 1YCIA 1DG6A 4RHV3 1VBE2 4FO9A 5KXCA 4OHVA 4J1WA 1V6MA 4COVA 2QDNA 2ZJCA 4COUA 3QD6A 3PMEA 5D1IA 4CYDA 1MQTA 1ND2B 1UPSA 1A8MA 5GM0A 4Y1UA 2R062 2A75A 2D43A 1V9U2 2K9ZA 3VDDA 4UW3A 2GC2A 3NL1A 1ULGA 4UW5A 1QJU2 2VG9A 2V5YA 2JXAA 3J8F2 1EAH3 3USUB 1MVEA 5FPXA 4P9XA 1NE6A 2D7FA 2DUOA 3ZN6A 1AL22 1PK6A 4Q0QA 3AKSA 2ARBA 4S2FA 2X5IC 4LBQB 1OHFA 1JN2P 4CDQC 3O0WA 5T3NA 2B46X 5HCFA 5L7OB 4M3CE 5J98B 1LEDA 1F8VA 1V9U3 1G86A 1XRUA 4JTNA 5LK7B 1QY4A 2XLGA 3H1MA 4LHNA 1QQP3 3HBZA 2R30A 5BPXA 2R1BA 4PDWB 5TSWA 1SCSA 4Q4Y1 2H6BA 2PFWA 1U0AA 1RUC2 1TNRA 1JYIA 5H9RA 5FFOC 1A78A 2RJLA 1V6KA 4XDQA 2R0HA 3USSA 1RUF3 1DGWX 4WM8B 1LU2A 2ZTNA 1VAKA 1F31A 2NMOA 2AYHA 5T5LA 4MXVA 4ES9A 1KDKA 1ZRCA 5FDBA 3SH5A 2ATFA 1UIKA 2K0GA 4GB33 1QDOA 3SCHA 2LALA 3FUOA 3I59A 4DOUA 1H9PA 1RUC3 4TLFA 3VZKA 2B45X 4K20A 4DPNA 4Q0PA 4CDUB 4ZU4A 3S7IA 2VGDA 4QQPA 4YZ5A 1QOOA 1D2SA 3OBRA 4LE4A 4SBVA 4U2AA 4C1XA 1XYOA 2CAUA 5AC91 2UYBA 2O8QA 3I7DA 3QCWA 4B4RA 3T1MA 4FTSA 5CIRA 2VH9A 4B3NA 2I45A 5JOYA 2ZHNA 1X8EA 1AR82 3WG4A 5BNOC 3BCWA 1QKQA 4XJWA 4XBLA 4C1WA 1ND3C 1OSGA 2VQ0A 3R4SA 3EHKA 1EPWA 4YZ4A 1BVP1 1C57A 1DQ1A 1NCQC 4S2GA 1H1AA 3VZLA 2BFUL 4K40A 2V73A 3CJIC 3H50A 4HN0A 3RDIA 1E57A 2HWD2 4YGCA 5ACA1 5GZFA 1Q8PA 4EWDA 2BWCA 5KBFA 5BNPA 4K21A 3FUQA 4Y1XA 3ZO0B 1AR63 1CJPA 1REEA 2HWF1 2WS93 4LLFA 1J58A 3JBG1 3OD4A 4HL0A 5ABJB 2GN3A 1CAUB 1QJY3 4OULA 1S1AA 1OOPA 4QPGB 3ZSKA 2XVLA 3POSA 4IEUA 5DZEA 3AXEA 1JXNA 1REDA 1IS5A 4QPIC 3SH3A 1POV0 2PAMA 4ORFA 1LCLA 4NWVA 5DDJ2 2A7AA 1VRH3 3CF6E 1GYKA 4NR1A 1LEMA 4HN1A 4XHBA 1YUDA 1UF2C 2JE7A 1KJRA 4AG4A 1ND2A 2LTNA 5BNNB 1LU1A 5J3UA 2QKDA 1XYPA 1WBLA 2Q1ZB 1IGOA 4IEWA 3TN91 2Y0OA 1LHWA 1AR72 1F9KA 1PZ9A 4GMP0 2A6YA 2OIIA 4IEOA 2FMDA 1WLCA 4OI0A 3WY6A 4XFAA 2E9QA 2EAAA 2DFBA 2EXIA 4JAAA 3QH7A 4M3CF 1QXRA 3I2DA 4LR4A 3H3UA 2ZOEB 5JSPA 4Q4X1 5T54A 2JKBA 2BGCA 2ES3A 2CYFA 4QQOA 4LBQA 4F7ZA 4OZXA 2D3PA 3DV8A 1QJX2 1RVF3 2WSVA 5L7OA 5J96B 4XFFA 4YG3A 3FE5A 1Q8OA 3DGTA 2GC3A 1NLRA 5F1RA 1RJ7A 3U07A 4B4PA 3S0MA 5CVRA 5CG9A 1BMV1 4KL1A 4G3YC 1URXA 1S2BA 4UW6A 3RI8A 4PDWA 4RS5C 1WMEA 4G4FA 4R4ZA 1WUVA 1C8NA 1GV9A 3ROUA 1SQ4A 1WCSA 2WA4A 1XXNA 4A2UA 2GH8A 2JD4A 3N3HA 3ZMNA 4GULA 1GZCA 2XJSA 4P9LA 1QJX3 4COYA 3VZJA 2I07B 4WM8A 2C9AA 4X8NA 4KGQA 1J3PA 1IS3A 3WP6A 5SV8A 2GMPA 4H55A 5JR7B 3AP7A 3WHUA 5KHKA 4HZFA 5CU1A 1RMU1 5IT6A 2VVEA 4BA6A 3VKNA 4LBOA 3N35A 3FLRA 2MHFA 4Q4W1 5FLJA 5FMOL 3NJZA 1DZRA 1ENXA 4LBKA 4XYXA 3G7DA 4XFCA 3EXUA 1GICA 3BB6A 3VBFB 5J09A 3ZXAC 3N4MA 1PGL2 2NN8A 3VUOA 1JOJA 1O4ZA 2WWSA 3AKPA 5DUVA 5T55A 1MS8A 3ZSEA 2WT1A 4CDUA 4MV2A 3WDVA 3ILFA 3IIAA 5B2GB 1TQ5A 5BY5A 2RS11 2D93A 3HQXA 4BOWA 4R9CA 3OTFA 4R9BA 1RUD3 3ZFGC 1QNYA 3VBSC 3WR0A 2HEWF 2WNUB 3D6EA 4COWA 1IHMA 4FPEA 2DF7A 1GLHA 1AYN1 4A7YA 2DVGA 1HX6A 4IEYA 1GQGA 1N1VA 5JI7A 4XF4A 3THTA 4XJ8A 4AQ6A 4M0NA 3NVCA 4E4ZA 2RMU1 3SITA 3WQ1A 1LOGA 1O5LA 5FCCA 2DU1A 5FO8B 3WCSA 1FAYA 4Q0UA 1XQNA 2WT0A 3VN4A 5EZWA 1POV3 1UN1A 2MEV1 1VLNA 2R071 2ZMLA 4QQLA 4LT5A 4I0AA 1NCRB 2E7TA 5ABJA 4CDWB 2I2SA 1PO21 3EBRA 1QH6A 2X53S 4LBQD 3MF9A 1D4M2 5KHIA 2JG8C 2RR12 5F5QA 5JZGC 3LA2A 2RS31 2XUMA 4GMP3 4OLLA 4Y24A 5GLTA 4PBOA 1Q8SA 1SACA 4OI2A 1Q3EA 1VBA2 3B9IA 4E2SA 2WLQA 1DF0A 3VZOA 4NWWA 1NG0A 3JZVA 4P9GA 1U12A 3AMMA 5HCAA 5IK4A 2GMEA 3P3NA 1RHI3 4XQWA 1MS5A 1ZBE3 2VMIA 5BNNA 1B35B 1DYKA 4MUVA 4YG0A 1GR3A 5C9AC 5FAXA 4QGLA 1D4M3 2RR13 3M2MA 5C4WB 1KITA 1LR5A 3JD73 4AEDB 1AXKA 4LE3A 1LKNA 3V0AB 2A71A 4C0BA 4Q4V3 5DZGA 3ZN5A 4WVMB 2IC1A 1YYNA 2D6OX 3D8CA 1SLCA 2WINB 2LUWA 4LBLA 2P17A 4XHXA 4FOVA 1EV11 2HYKA 5KHHA 3CEWA 5BNQA 3B93A 1MEC1 3UKVA 2C5DA 1DGLA 4J6GA 3O0XA 1H4GA 2MNGA 1YXWA 4WM7B 2XJQA 3DF0A 3H1YA 3ACLA 3O12A 3LOIA 4AFAA 2EA7A 2WJSA 1PGW1 2CNAA 3HAGA 5JOXA 4LNVA 3AJYA 3VBOB 3WG3A 4YW3A 2ZHKA 4G9SB 1PHMA 4XFIA 1X82A 1YJKA 2WNEA 2OPKA 2DVBA 4RR3A 2ZX3A 3WHTA 1NA1B 2OZJA 4Q4Y2 3M70A 1VB4A 1PO13 3AZXA 2HWE3 3ILRA 4P9JA 1J1TA 1FOD3 3B02A 2DFCA 2VPVA 3PHMA 2CV6A 1X7NA 2H6CA 4HKWA 5LK5A 1KS5A 1FPN3 4MZUA 1RUG3 3LA3A 2RS51 2HWB1 1QF3A 4Z1VA 1PIV1 4QD2A 4WZCA 2R043 3WNXA 2W08A 4OVEA 1IKPA 4XF3A 2CGNA 3VBFA 1NY72 1AR93 2JENA 1HRV3 2DCZA 1H1MA 3AP4A 3ZFFB 3M3CA 4A3XA 2UWBA 1S2KA 1UIJA 1VBC3 4XIKA 4AVTA 5A3MA 1W6MB 4DRRA 4EWEA 3CU7A 2WNUA 2YHJA 2EAKA 3KB5A 4M0HA 5AC92 3ZFEB 2JG9A 3WQ0A 4FT8A 5GLZA 5BV6A 4XMAA 2QDRA 3JUUA 2IXCA 2VULA 4PIZA 4A7ZA 1NQDA 1HXS3 4Z82A 4W6YA 4AW7A 2WL1A 5LRRA 3QH6A 2DV9A 4LEJA 4K3UA 4XPVA 1ZRDA 1AYM1 2PLV3 5KC6A 3BPZA 2XBO1 4K1YA 5CFDA 2ZA9A 1HRI1 1SLIA 3EJKA 4GWNA 1NCRA 1MS9A 2HWF2 1HV0A 4CDWA 4XILA 3JBG2 3GYDA 2D6KA 4L92A 5JIUA 2ZGQA 3TB0A 1OA2A <