3C8XA

Crystal structure of the ligand binding domain of human ephrin a2 (epha2) receptor protein kinase
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
174
structure length
160
Chain Sequence
KEVVLLDFAAALGWLTHPYGKGWDLMQNIMNDMPIYMYSVCNVMSGDQDNWLRTNWVYRGEAERIFIELKFTVRDCNSFPGGASSCKETFNLYYAESDLDYGTNFQKRLFTKIDTIAPDHVKLNVEERSVGPLTRKGFYLAFQDIGACVALLSVRVYYKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Architecture of Eph receptor clusters.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Ephrin type-A receptor 2
total genus 30
structure length 160
sequence length 174
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2008-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01404 Ephrin_lbd Ephrin receptor ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 3c8xA00
3I3DA 3I2HA 3NRUA 3OG2A 3A22A 3A23A 3OB8A 3K4DA 3NJVA 2R7EB 4ZZ5A 5B4NA 4A45A 4DXTA 2VMDA 3C7FA 1L7RA 3W5MA 1JZ8A 2W95A 2VR4A 4MGQA 5DPNA 1F4HA 2J1RA 4MGSA 4CU9A 1OD3A 3LEGA 1UYYA 2X10A 4MO3M 1JZ4A 3A7QA 2W5FA 1EUTA 3W5NA 2L9LA 4P08A 2ORXA 4A4AA 5HXMA 1GMMA 2W94A 2J1VA 4XUNA 3VD4A 5EIYB 2VCCA 4QAWA 3K75B 1D7PM 2W1SA 4E8CA 3BN6A 3P6BA 1O8PA 1W0NA 3HPNA 2W46A 3SKVA 1CZTA 1UYXA 1L7QA 5IFPA 3WF4A 4CUCA 1JZ6A 3OEAA 2BGOA 5IYYA 2VZUA 2WN3A 3HJRA 5F7UA 2JKXA 2WN2A 4QB1A 3WNNA 4QB2A 2YC2A 4KMQA 2WO2A 3T08A 4CVUA 4LPLA 3GDBA 5CYYA 4XUQA 2WUHA 1GQPA 2YFZA 4W8JA 4W50A 1ULPA 4UOJA 1JZ2A 1IQDC 3CIHA 5CZKA 4P02B 4ZY9A 2CDOA 1NAEA 2WQ8A 3LEIA 3T0DA 3FHAA 4OMDA 2V72A 2V5DA 2Y6JA 3C7OA 4LHSA 4P5YA 5C71A 3OBAA 3THCA 2W92A 1UY1A 3FN9A 2YC4A 3WF2A 3LEKA 3NJXA 1OF3A 4UAPA 3C7GA 3ABZA 2B9VA 4GZ9A 2C4XA 1GOFA 4DEQA 4GWIA 5J1XA 2VQTA 4DUVA 5HPOA 1RYYA 3P1IA 3I2JA 4GWJA 4QX3A 1K42A 1GU3A 4A6OA 1UXXX 1O59A 2JDAA 4QX0A 3VD5A 3FL7A 2X09A 1NKGA 2HYXA 3C7HA 1F4AA 1NUKA 3OGVA 1O8SA 5JXJA 2W91A 2W1QA 3I2FA 5IJRA 2E32A 2J1TA 2WZ8A 4HG6B 2BERA 2RJ2A 4M4PA 1NX9A 4RYDA 2Y6LA 3GXUA 4BJ0A 2VQUA 3C8XA 3PUHA 4FI9A 3VD3A 4JKKA 2HLEA 2E31A 1WKYA 2WBKA 2QBXA 4BDVB 2VM9A 2V4VA 1PX4A 4BK4A 4XVHA 1J83A 1UMIA 2CDPA 2ZEZA 3DYPA 4QX2A 3I2IA 2VOTA 3IIIA 1H6XA 4D0QA 2VCAA 1JI6A 5JXGA 1K45A 4AAXA 4XURA 2C9KA 2EIBA 4L0PA 3MV11 3K46A 3U37A 4DUWA 4PF1A 3J7HA 4CU6A 4A42A 2WDBA 3T0AA 1W9SA 1K3IA 3NNGA 3T0BA 4CUBA 3I2KA 2W1UA 1DP0A 5I0DA 1JYVA 1PX3A 3AC0A 3VD7A 3WQBA 1CZSA 1UX7A 3LQCA 4PQQA 2Z4FA 3HOBA 1J84A 2J7MA 3C7EA 4OMCA 2VJXA 4DXRA 3SKJE 2VMCA 3HNMA 1UYZA 2QQKA 2W9XA 4JKLA 1UY2A 3LPGA 1US3A 3BGAA 2DDUA 4YPJA 5A1AA 2VO5A 1UY4A 5DQ0A 1TVGA 3FHQA 4ARYA 1CZVA 1W99A 1LNSA 2Y8KA 4QB6A 2XHNA 1JU4A 2BGPA 3WF3A 1DYOA 1W9WA 1JU3A 1SHWB 1GUIA 1GNYA 1PMJX 5IFTA 2BZDA 3MUZ1 1PMHX 2QQMA 3IAPA 2VMEA 2VZVA 4CU7A 1T2XA 2PQSA 4CUAA 5JXIA 1P8JA 4KWUA 2QQOA 2RV9A 2J1UA 1JZ7A 3NQHA 3GGLA 3K77A 1H6YA 5LA0A 1TG7A 5JUVA 4DEVA 1R64A 3IAQA 2VCBA 1KEXA 3HNYM 3WEZA 3ACHA 3I3EA 2J1SA 3HEIA 1JYWA 3WNKA 3VD9A 4XZUG 3CZJA 3WF0A 2WO3A 2DCJA 4A41A 1K12A 3D3AA 5FUIA 2Y64A 4RN5A 5LA2A 2BBAA 3LE0A 2QQJA 5G04L 3CMGA 2VMFA 1I5PA 3CDZB 3CZUA 2VTFA 2QQLA 4P00B 1JYXA 2XONA 3VDAA 4M4RA 3UESA 1JZ5A 2VZ1A 3WNOA 1BHGA 2J1EA 5G05L 4MADA 3MV01 4OUEA 4W4ZA 1JHJA 1OH4A 3ZM8A 4QDRA 2VZTA 3DYMA 4ET7A 3F2ZA 2KD7A 3E1F1 2WABA 3ETPA 5DN2A 5C70A 2JD9A 1GOGA 4XUTA 4BXSV 1JYNA 4JKMA 3WNPA 2J1AA 2RVAA 3PUIA 1YQ2A 2VZOA 3DECA 1UY3A 1UZ0A 3K4AA 4CU8A 3OGSA 4A3ZA 4KI5M 1CX1A 1XNAA 5EJZB 1OT5A 2VZPA 4BK5A 3UNPA 4JX0A 1W8NA 2Y6KA 2WAAA 2X05A 4A44A 3WSOA 5C7GA 2W47A 2VZRA 4E8DA 1UXZA 5JXHA 2QQNA 2C26A 2QQIA 3T2OA 4MOAA 4QPWA 2VC9A 1XNTA 2VL4A 4OYUA 1XC6A 1W8OA 3GM8A 3VDBA 1WCQA 1UWWA 5JR2A 1EUUA 4QX1A 3ECQA 2EICA 4DUXA 1KGYA 2LS6A 3ACGA 3T09A 2W87A 3I3BA 2EIDA 3HN3A 2WO1A 4UI9L 3SEEA 4QDQA 2ID4A 1ULOA 5LA1A 3SEPA 5IHRA 4TTGA 2VZQA 4LKSA 1XPWA 1HN1A 2J22A 4LQRA 3MO4A 2OKXA 3WF1A 2W1WA 2WZEA 4XUPA 4D8MA 4AG4A 2E26A 4TXWA 2DCKA 2WYSA 3ACIA 3I97A 3UETA 4JHZA 2XQXA 3ACFA 2XOMA 2W3JA 2YB7A 3CQOA 3WNLA 5EJ1B 3DYOA 1DLCA 2VZSA 3A21A 1UY0A 2Y6HA 3HNBM 2ZEXA 2E33A 3OEBA 2ORZA 4Z2AA 4ZZ8A 1GOHA 2LW8A 3T2PA 3MUY1 3IB3A 3IDAA 3WNMA 4IUGA 3CKHA 1MPXA 4ARXA 2VZ3A 4OZOA 5JMOA 2B4KA 2Y6GA 5DMYA 3EYPA 1W9TA 1US2A 2YG0A 3THDA 2ZXQA 1UMHA 1CIYA 4QDSA 3OGRA 5B4XA 3T2QA 2JE8A 3JXSA 3K4ZA 1OF4A 3LPFA 2WAOA 1SDDB 3MBWA 2EIEA 2ZEWA 4PT6A 4XUOA 4DXSA 1SG3A 1JZ3A 3I2GA 2YFUA 3EB7A 5LCWL 3VDCA 2ZEYA 4ZXEA
chains in the Genus database with same CATH superfamily
3I3DA 4N9IA 3A0NA 1ULEA 4UBHA 1LOAA 5L36A 3QD6A 4OULA 1Q8QA 1ODNA 2JIGA 2QQWA 2ZX4A 4YWAA 3IMNA 3IWZA 1TNFA 4CCCA 1XYPA 1AR61 4Q4W2 4AVAA 3MLJA 4Y5TA 3WLUA 1BJQA 1L3JA 5LY2A 1L7RA 3PHMA 5FMDA 4E27A 1OOPB 3LFIA 2W95A 4I0AA 4WZCA 3WOGA 2D43A 5BNPC 3HN1A 4EZHA 4IV3C 1W2NA 2GMEA 1W8HA 4PLMA 1QMJA 3IPVA 4XJ8A 5HXVA 3MDPA 5T55A 1KDMA 3LEGA 2ET7A 5F5AA 4FAHA 1KFUL 4R4XA 1WD3A 1JZ4A 4C8DA 3TWIA 4JV4A 2GH8A 3A7QA 2GN7A 1CIWA 1QH6A 2A6VA 2GC0A 5ACA2 1S2EA 5K0UB 1JYVA 2QQVA 2WA3A 1DHKB 1N3PA 3AYEA 5K0UA 3W5NA 4GH4C 2XL9A 4P08A 4AI1A 4Y3OA 2ORXA 3ACLA 5A7SA 1XBFA 4RFT0 1ZZCA 1QQP2 3N9QA 5A70A 3AYAA 5FZ1A 5JAXA 2VMGA 5EV7A 4Q5OA 3O1UA 4RQPB 1PVC2 4MYEA 3ZOIA 3POJA 4JRAA 3WP4A 1ZBE3 2VCCA 4K8RB 5EIYB 2A6WA 1QJX2 1S1AA 2JJ6A 2VXJA 2W1SA 3L9JT 2PELA 3AK0A 2JXAA 4XF1A 5CFDA 1X7NA 4FPEA 3RJRA 2P3IA 4XMAA 2XUEA 3HWJA 3PLQA 2CAVA 4Q0SA 1L7QA 5IFPA 5T5LA 3WF4A 2W68A 3PUQA 1YQ6A 4QGMA 5FJKA 2E9QA 2XUMA 5BPXA 4BXFA 1QXJA 5L7OB 2BP6A 2RDNA 4M3CA 1JTZX 1ND2B 2WN2A 3AL5A 5CNAA 5H9PA 1UW8A 2ATFA 3SLIA 3WNNA 1A8DA 4ASKA 1Q8VA 1A78A 1UKGA 2DCZA 2PHLA 4KMQA 4CCMA 5F9TA 1QDOA 3RPQA 2P6CA 4LPLA 2JD4A 2VOWA 1D4M2 1DLLA 1FMD1 1UZVA 2ZTNA 4AVSA 5C3RA 3WCSA 2R071 1RUI1 2PA7A 2WUHA 5FYHA 1C57A 1JODA 2VU9A 1DGWX 2YFZA 4YW2A 2HWD3 4AFAA 4PDWC 4B7EA 1ULPA 4UOJA 5A6QA 1IQDC 2E7AA 3TN92 4P02B 3TYJA 2P3KA 1NAEA 2WQ8A 3RRDA 5HCBA 5LEKA 2V72A 3SCFA 2Y6JA 1DG6A 3GHMA 3JQWA 1WUVA 3LSEA 4CDXB 5C71A 2EXJA 3OBAA 3THCA 3IZOA 5IVCA 1UY1A 1UAIA 3W9AA 2YC4A 3AXEA 2F4LA 3NJXA 3S7EA 2GSYA 1W05A 4KG0A 1Y9MA 3BTZA 2WFF3 1SFPA 3O12A 4CDQA 2NMOA 4B4RA 2Y0OA 4DEQA 4GWIA 3VKMA 2VQTA 1YHFA 1YWKA 5FP8A 3U14A 3P1IA 4OHVA 1VR3A 4LOTA 3M3IA 3GALA 2P2KA 4GWJA 3JZVA 4FOVA 3AMMA 1K42A 4NHXA 5LBEA 3KVAA 4KGQA 1W9FA 3GHNA 3ILNA 3VD5A 4B4QA 3U0ZA 2HYXA 3MIGA 4OQ9A 1NUKA 1YCIA 2W91A 3OD4A 2WR9A 5FMOL 1V0AA 4MG2A 1AL0G 1RTVA 1O91A 3I59A 1MQTC 3TN91 2E32A 2J1TA 5FREA 5DUWA 1VRH3 2ZGNA 3SH4A 1AYM3 4LHLA 2RJ2A 4NHMA 4X8PA 3H3LA 3QH7A 4M4PA 1NX9A 3BOWA 2AZ5A 1KDKA 1RUF3 1TMF1 4I02A 1GWKA 2HWB3 2OX0A 4LTAA 2DTYA 2NLRA 1HRI1 1WCDJ 2O0OA 3K2OA 3C8XA 2D6OX 2ILMA 2WSUA 5GZGA 1V6IA 2DVDA 5F3CA 1VBD3 2FBEA 4XC9A 2CAUA 1WCKA 2WL1A 3E6DA 2RS52 3MPPG 5HCHA 3UGFA 2R041 1S0CA 2VW0A 3U07A 2VOKA 3N36A 1RMU2 2BOIA 3S7IA 2E6VA 3CBNA 4GB33 2VOXA 4LKFA 3ZO0B 1J83A 2MEV3 3CNAA 4ZU4A 4QX2A 2PLV3 4YGEA 5GLTA 1YEWA 3TAYA 4CP0A 4W6WA 5FZOB 4EWAA 1D0HA 2OQ6A 2DYCA 1H6XA 1U5YA 5JOWA 5A3LA 4LBMA 4YZ4A 5IK8A 4IV1C 3ZN6A 3VV1A 4I3GA 5FRAA 4XURA 4L9BA 5FJHA 2EIBA 1BBT3 1ZA4A 4KQ7A 1JZ6A 3G7DA 3VBUA 4CP9B 3POWA 1C8M2 3NJYA 1UKRA 4EN0A 4A42A 2V09A 4GH4A 4P9YA 3U11A 3N9LA 1W9SA 5CFCB 1K3IA 3JU9A 3PJYA 4WM7C 2ZCWA 4OI2A 4YZ1A 1QDCA 3M2MA 4IW3A 3WCRA 2W1UA 1W90A 4UF0A 4GJYA 3VD7A 1SBFA 4WM8B 4GMP0 1QOTA 4N53C 4Q4Y3 5E16A 5FPUA 4QXCA 1UX7A 3TBDA 2AACA 4AI9A 2MNGA 2DVAA 1RB8G 4JAAA 3B3QE 3C7EA 3ZXGA 2DBIA 4OMCA 5FUPA 2JECA 3PIGA 4C0BA 4D7YA 4K3UA 5KHIA 2A70A 2C24A 1RUC1 5H9SA 2BTVC 5FP4A 4ZU5A 3VBFB 2VCMA 3ZYJB 1AR71 2FMDA 3VBHA 1NG0A 3TRSB 3VBFA 4MVTA 5FZ3A 2BUKA 1R082 3ALQA 4S2HA 3BGAA 1JW6A 2DDUA 1RUJ1 3MIFA 4YPJA 5A1AA 5JOYA 5EYXA 3BTAA 1IS5A 1LENA 4EROA 1RHI2 4E4DX 1J59A 5LY1A 4ARYA 1RIRA 2XKOA 5CADA 1G9BA 4MGTA 5FKCA 2UURA 5FY0A 1CD3G 2XHKA 1H0BA 2D97A 5ERLA 2Y8KA 1OXCA 1QJY3 2SLIA 1Y3TA 3DN7A 3IMMA 2BGPA 2D93A 2ENRA 4QGLA 4BPZA 4M00A 5M0TA 4XTPA 2XR4A 3OY8A 4X8NA 1GNYA 1PMJX 2HEVF 4QPYA 5EPAA 1LGBA 3TEXA 3N7LA 1OH3A 1X9TA 1J3PA 3E5XA 3RZLA 3N9PA 2WFF2 2VZVA 1EP0A 3T30A 4M3CE 1F9KA 5A33B 3M7AA 4BQYA 1FPN2 4FP3A 1BK0A 1MZEA 2VNRA 5JXIA 3IDEA 2QQOA 2RV9A 3AXDA 4FFHA 4HKOA 1NXMA 3EXUA 1V6MA 1GLHA 2TBVA 1UOJA 3JD72 1RJ8A 4ZS2A 3RMYA 5CFCA 3GGLA 5A6ZA 1CAUB 2OXBA 3D6EA 4HK8A 4DUVA 1RUG2 5JUVA 4XFGA 3N4MA 1SQ4A 1RXFA 1R64A 1UZZA 1NCRA 2Q30A 1Q8OA 2VCBA 3HNYM 1QEXA 4ZONA 4BM8A 2F6BA 3SH3A 1K5MC 3ZYIB 3RZJA 3V0AA 5CG9A 4NHKA 3PVNA 1PZ8A 2D6KA 4Q4V2 1RL3A 1C8NA 5T54A 2HJIA 4XJUA 3VHOA 2D3PA 4LHNA 4XZUG 5F5CA 2WYFA 5CU1A 3RWKX 1AR73 4PIXA 5FO9B 3WF0A 4EN7B 3NNLA 1SBEA 3WR0A 2JG8A 1AXYA 3AZXA 1S2KA 4QHZA 3JD71 4RR3C 1VBB2 3D3AA 2ZEYA 4OHZA 3VBHB 3R4SA 4CSWA 2BBAA 4Z2WA 2VMFA 5JVVA 1SCRA 3CZUA 4WVWA 5K8SA 4XBLA 1DBNA 2AENA 5C3PA 2VTFA 2CNAA 4Q4Y1 4IEPA 3VL9A 1SLTA 3VBSA 5I93A 2PTMA 3R05A 3WW1A 2FHRA 4M4RA 5F3EA 3ZYFA 2R061 3ZXJA 3WNXA 4D6SA 1MEC2 1JYTA 1TME2 4XABA 1HW5A 2VW1A 1PO12 4TYSA 2D6PA 1BHGA 2J1EA 4CP1A 4ISQA 5FY1A 1UOFA 4FTEA 4W4ZA 1WA4A 2O8QA 4Y22B 2C0ZA 3ZM8A 2WQ4A 1HXS3 3NAPB 2VZTA 1AR91 4PI2A 4HMZA 3F2ZA 2AC1A 4AHWA 4MV2A 4YVWB 1ND2C 2DVBA 4C1WA 3ZFGA 1O6UA 3O7OA 4CCOA 1XE7A 5FY9A 2AUYA 2ERFA 2WABA 3H9AA 1ZZ9A 3ZXEA 1RUF1 1TMF3 4PBPA 5JOZA 4LO5B 1QJZA 4LJHA 4JKMA 3WNPA 3EQEA 4AEMA 2KM2A 2RDSA 4R9BA 2XVKA 1Q3EA 5FBJA 2ARXA 1I5ZA 5IW0A 2EXIA 5FDBA 1O3RA 3DECA 3KSCA 1YFUA 4QKBA 5C9AC 5FP3A 3I2OA 4K21A 3VZJA 3USSA 5FTTC 5K7PA 1CX1A 1HJFA 4COWA 1SLAA 5FK7A 1WLWA 4XHXA 1VBA1 3SCHA 1OT5A 3NNFA 3H1YA 2HWB1 2YBKA 2Y6KA 1DGWA 1VBB1 2JG9A 3BKZA 4A44A 2P3JA 5FP7A 3LA2A 2QNKA 4UW6A 2JG9C 2WINB 3B69A 2YXSA 2UY9A 4Y1UA 5ANQA 2QQNA 5FY7A 5FZGA 4BLJA 4CTEA 5FZ4A 4IETA 4LBQB 1GBGA 4ORFA 4QPWA 3ATGA 3BU7A 3ZFEC 3WV6A 1XNTA 1JOJA 1GKBA 4OYUA 4B3NA 2ZX2A 1PIV2 5JIAA 3VZOA 4ZHNA 4EWEA 3PJQA 3OD0A 4ITCA 1O4YA 3W59A 4AQTA 2PHTA 4MGYE 4QX1A 4YSFA 3FC0A 3J8F2 2R1DA 1AL22 1F2NA 2VGDA 4B7KA 3PTYA 3ZKYA 4OVEA 1F35A 1S0GA 1RGSA 4AFMA 2O1QA 1OURA 5FMCA 4SBVA 1OOPC 2VVDA 1ZRDA 1U0AA 3JBG2 2ID4A 3AKRA 5FMOS 4Y22A 4QWNA 4ZKTB 2A5ZA 5FZBA 2WZPP 4YFZA 2BQPA 3NAPA 4FO9A 3SEPA 2OPKA 3FHIB 1EAH3 2DU0A 1ENSA 1UQXA 4K7JA 1YFYA 4HN0A 4CEWB 1OA2A 2J22A 2WNEA 1PMIA 4NRPA 4JGZB 2OS2A 4PBOA 5HI0A 2OKXA 3AVRA 3WF1A 4XMIA 2W1WA 2B46X 5FXVA 4E9KA 4ASLA 1OUSA 2HWD1 1NA1B 3NJZA 4UFIA 4WM8C 2BEOA 3ACIA 3E5QA 4AW7A 4RQPA 4Y24A 2R073 4JHZA 1QJU3 2W3JA 2A71A 3RYRA 1H1IA 4DQAA 1FMD3 5IK7A 4DMIA 2WNVC 3GCXA 4CP2A 4EYUA 2Q8EA 4Q29A 4BH9A 4XZPA 2GNDA 3CU7A 2VQAA 3KD4A 1DQ2A 3KF3A 1DFQA 1NLSA 2RE9A 3KHBA 4BHPA 1G9CA 1UY0A 3HNBM 1LESA 2JG9B 1QNWA 4V2VA 1EV12 1IG3A 3FLPA 2ORZA 2IWGB 1LAJA 1LKNA 3J7NA 4ZZ8A 1GOHA 2LW8A 2HWC3 3T2PA 3FZ3A 4QX8A 5EXOA 3MUY1 4UXAA 3IB3A 5FZAA 1SPPB 3QACA 4IUGA 3CKHA 5DDJ3 5FKBA 3AFKA 4MGZE 4R52A 4AK3A 4HKWA 4OZOA 4QQHA 4RGKA 5DMYA 1GZ9A 1O5LA 3EYPA 1QHDA 2WNVB 1W6OA 1VB4A 2K46A 3MFAA 2YPJA 5GLVA 3LCPA 4IEXA 2XL7A 4QHOA 3J8F3 3CJXA 2HBTA 1VALA 2WSVA 1W6PA 4YVWC 4YW5A 1CIYA 3M3CA 4QDSA 4J1WA 1ZBE1 2HWF1 3T2QA 1YRZA 1LHUA 3JXSA 2DURA 3PURA 1MZFA 4NVPA 2CTVA 1NE4A 3LPFA 1NXD1 1SDDB 3WP3A 3MBWA 1UCXA 2P5BA 2ZEWA 1WLTA 2AEYA 3H7YA 4LK6A 1Y4WA 3D4KA 1YFWA 5EWSA 2HWC2 2QUOA 4B8EA 2WZR3 4ZXEA 5F39A 1PO13 1E5SA 1FOD1 3I2HA 1UPSA 4IV3B 4JQRA 4YVSC 4XQWA 5FWEA 3TOJA 3NRUA 4BMEA 1FAYA 3OG2A 1W3VA 1TEIA 3A22A 4HXCA 3A23A 5HCAA 3M3EA 3K4DA 1BCXA 4L97A 2KXLA 2Y0IA 4H14A 5IAVA 5B4NA 4Q4W1 2G9FA 3C7FA 4N43A 4DXTA 3W5MA 5AC91 2Y34A 3USUB 3GZAA 3S5QA 1R1A3 3POIA 2VR4A 4MGQA 4O65A 4N53B 5FYUA 2YROA 1F4HA 4LBNA 4CU9A 3AZVA 3LDBA 4IXLA 1AZDA 2VUCA 5I0TA 2X10A 3ZKUA 2Q8OA 1H2KA 4A3XA 3WW4A 2QQUA 4M3CB 4XAEA 1T6BX 4U2AA 4META 2X5IC 4BQ2A 1ONAA 1EUTA 1XXNA 1EPWA 5BNNC 3AP9A 4CEWC 2L9LA 5JMCA 3UGHA 2WT2A 4PJYA 3VHRA 3BI3A 1WCUA 2DCYA 4BOWA 1XU1A 1HXS2 4WZFA 3ZFEB 3JB4C 3J26N 4XBNA 2ZGKA 1BKZA 4NJ4A 1QXRA 4P14A 2RR13 5EYYA 5KXBA 3T1LA 5CKNA 3GCWA 4CDXC 3GJBA 4IE4A 4QQ2A 3O1RA 1FOD2 4LKDA 1NCQA 1D0GA 4FXGB 1UZWA 5C3SA 2YC0A 1JMUB 2WIIB 3BN6A 3GYDA 1TME1 2I45A 4K8FA 1LOFC 1W0NA 2WJSA 4XBQA 4DS0A 2RS32 4COZA 1T6GC 1OA4A 3LAGA 3WW3A 4NMIA 4PDWA 2P34A 2XBO3 2VULA 2NM1A 5F2SA 1CZTA 2PHXA 2CHHA 3ES1A 5FZ6A 2VBBA 4QD2A 4QU2A 2OA2A 4XDPA 5I0SA 1CN1A 1YI9A 1UD1A 1V6JA 5CB7A 5LBFA 5BY5A 4LULA 4Y4RA 1IG0A 1LU2A 1S2BA 1NA1C 4H7MA 5GM0A 5E6HA 1W8ZA 2GALA 5FZFA 5JZGC 4ES9A 1MACA 3ST7A 4Y1VA 4E2GA 4AGVA 3O1SA 1ZRCA 4URAA 5A7QA 1WW6A 4CVUA 2NMNA 5E89A 2Y38A 3ELNA 3WQ1A 2WT0A 1EPZA 5CYYA 3SISA 4O9EA 4YM0A 5FY8A 1ZBA2 3OPZA 4W8JA 2ZJCA 4JTNA 2Q1FA 4LA3A 1VMFA 5DUXA 1JZ2A 1OC1A 1ZYBA 2BVBA 3VBUB 5CZKA 4ZY9A 2ZAHA 1XB9A 4CP9A 4I2OA 4OI1A 3T0DA 3FHAA 2QDRA 5EFUA 4DXZA 1Y9GA 2JDPA 3N9MA 1RUF2 1HIXA 2JENA 3C7OA 1NQDA 3FUQA 3JD73 2C1FA 4MX3A 3WW2A 1EYBA 1XYOA 2JDHA 3Q8CA 4WM8A 1V9U1 1QXPA 1V6OA 2EF6A 3WF2A 4HSLA 5F6LB 5FUNA 4K40A 5LEJA 1NLQA 3H8XA 1OF3A 4IEVA 4UAPA 3ABZA 2B9VA 5IVFA 3OYWB 3ZXLA 5HPOA 4C0HA 3SXWA 3ZXKA 3SMHA 3I2JA 1JN2P 3MIDA 5FOJB 5KHGA 3AM2A 4L11A 4A6OA 1POQA 1MEC3 1R091 2JDAA 5C4WC 2JE9A 3ZPOA 4RS5A 5F3GA 1X8EA 1YFXA 2VH9A 4RS5B 5DZEA 2LROA 3FL7A 3THPA 1YC61 2QVSB 2X09A 2XJUA 2GC2A 1W6NB 5K4LA 1NKGA 1XYNA 3W58A 4WM7B 1CAVB 2X5IA 4RGAA 3CEWA 4AQSA 2NP0A 1CGPA 3OGVA 4YM1A 4ES8A 3POEA 3I2FA 5KR7A 2K2SA 4YG6A 4XJAA 4FPCA 5AVPA 2WZ8A 1YJKA 4AI0A 4HG6B 5FZDA 5KC5A 1A8MA 2D6LX 1KFXL 1VAKA 4QPGB 2RS33 3TB0A 5FZ9A 1JS9A 2VNGA 1OLMA 5JI7A 3ZFFA 2PHWA 4DIQA 3OUJA 1HKDA 1URXA 2Y6LA 3GXUA 2VQUA 3PUHA 4FI9A 5JSRA 2LALA 1XSQA 2CYFA 2HLEA 2XWJB 2ADDA 1OQDA 2RS53 1COV3 4IESA 1COV2 3BPSA 4YLZA 3MHZA 4JHTA 4BDVB 5KHJA 5FXZA 2VM9A 3N35A 2EXKA 3NV1A 4P9XA 4BA6A 3B9IA 4Q8KA 1ZZ8A 1UMIA 1OVSA 3UT0A 1RUNA 3R0RA 5FV3A 2ZGQA 4YW1A 4Q26A 3UKVA 1CX4A 3NW4A 4AHZA 3RZHA 2VCAA 4XFIA 1JI6A 3N7KA 2ZHLA 4CA9A 3AZZA 1K45A 2RDRA 2C9KA 1YNAA 1BVP1 3K46A 1RVF1 1UN1A 4IV1A 3ZSLA 2P37A 2CV6A 3ZR6A 3LKJA 4CU6A 3NVCA 4KWKA 4RD7A 1UIKA 2WDBA 2YGMA 1QJX3 3VBFC 3DF0A 1FV2A 5DABA 5LBBA 4CDUB 4RHV1 4FBFA 1FNYA 1RUE1 2DUPA 1QGLA 2XB6C 1IKPA 5DAXA 4M01A 5DAWA 4AE2A 3B93A 1GR3A 3AZWA 2RR12 1RXGA 1J1LA 1CAVA 2VBPA 2WZR2 2X5IB 3BALA 4FPFA 1CPNA 1KS4A 4AVCA 1LCLA 5JR7B 3VLBB 3VB9A 4AOCA 1NOVA 5FZCA 1E5IA 3VBSB 1B35A 3DPRA 2RS51 5D2AA 4CPBA 3IDBB 3Q9OA 5LB6A 2VMHA 2Q8DA 2DFCA 2GZWA 2D44A 4H3WA 1KJLA 2VNVA 3DKQA 5FFOC 1Q56A 2RMU2 4LLFA 4MUVA 3OGJA 1AYM2 2C5DA 4AQ2A 1GZCA 2Y6FA 4M0HA 1F31A 4GWNA 3V64A 4IEUA 1Q5OA 1AYN1 3AP5A 2VO5A 1FYUA 1NT0A 4JC1A 5DQ0A 1OA3A 1A6CA 1TVGA 2RDQA 2ZX0A 3ASIA 4CXXA 4JGYC 3O14A 3ZXAC 2JKBA 1W99A 4JVAA 4R8HA 4QQOA 1ZREA 3KS7A 2GNTA 1LNSA 4NN0A 3T1MA 2OUJA 1B09A 4X6RB 2PAEA 2WLPA 4NHLA 4XW3A 5EQUA 4K1YA 4QKNA 1XSRA 4GULA 4AEKA 1C3HA 1GUIA 3HT1A 5FYVA 2IUWA 2IVIB 1VLNA 2BZDA 3DEMA 4K6BA 3RS6A 2GMMA 3D0JA 1PMHX 1K5MB 2BOJA 5H9QA 2Z79A 3P3PA 2QQMA 3IAPA 3P5BA 3ZIWA 1DDLA 1HRV2 1LHOA 4NR1A 1W8UA 1JZ8A 1K5JA 1M06G 4AGRA 3ZN5A 3HAGA 3O1PA 2PQSA 1H8TA 1VMHA 5I0RA 1WA6X 4KWUA 5JPMB 2B8MA 1CAXA 1HX6A 4CEYC 1XOYA 4NO4A 1JZ7A 2BWAA 2KA3A 2Q1ZB 1FOD3 1H6YA 3WDWA 1S55A 4WV8A 2WZR1 2FZ1A 4LORA 2IXKA 5ABJA 2QDNA 3IAQA 4COUA 1KEXA 5JI9A 1EAH2 2KR2A 5IVJA 2YPDA 5KBFA 4W6YA 3I3EA 5ABJC 3MIBA 1AXKA 5FPZA 1QQP3 2WFF1 3HEIA 1XNBA 4RS5C 3G6JB 1SEFA 2G9ZA 4P9JA 5J09A 1JYWA 2DVGA 3CZJA 4XILA 1PO21 2HWF3 5A3WA 2DCJA 1H8TC 1WBFA 3BVCA 3J7LA 3FE5A 2DCTA 2UYAA 4Q1RA 3D8CA 4R9AA 5LA2A 4U36A 2RJKA 2ZHNA 3PIJA 4AVBA 2QQPA 1FMD2 2VUDA 1KS5A 5FY5A 4UFHA 1QJU2 1ASJ1 1PIV3 3LE0A 5G04L 3T2TA 4PF5A 4EN8B 1BEV3 4TSVA 1I5PA 3QCWA 3HQXA 3SNMA 5C3OA 1YJLA 4P00B 2ZGPA 2YDEA 2XONA 4AEDB 2FDKA 3T4VA 4ASMB 4XF4A 4CCEA 4AEDA 1DQ5A 2VECA 1XNCA 3FMGA 3UESA 2DV9A 3ZYPA 4AXOA 1JZ5A 4B1LA 3SITA 5IVYA 5A7WA 4AEDC 3O5SA 4GMP1 4JDOA 5A7WB 1VMJA 3D0SA 3ILRA 3RNSA 3OBRA 4QXBA 1WMDA 3C3VA 4D6RA 1ZBA1 1LEDA 4MHUA 1QJU1 3WG4A 1OH4A 1O7FA 5DAPA 4QDRA 3IT8A 3ZMOA 2IFRA 3ZYRA 2BFUS 1O3TA 5L9VA 1W6MA 5L7OC 3J4UH 2Q1MA 4DNYA 1E5HA 1KQRA 4GIQA 2Q0AA 4S2FA 5L7OA 3VBOC 4BXSV 2IC1A 2ZS6B 2FDJA 1QY4A 1ND2A 2G4IA 3B01A 2W39A 1UL9A 1WMFA 4LO6B 4XPVA 1JYNA 3CL1A 3POYA 4CDQC 1MS5A 2J1AA 3KF5A 2ARCA 1OSGA 4IERA 5FPLA 3PUIA 1W28A 1YQ2A 5ABJB 2AH2A 2ZA9A 1EAH1 2ZKLA 2A75A 1H2NA 2VZOA 3ZX7A 1JBCA 1UU6A 1UZ0A 1S0DA 2C6SA 5FO8B 1FATA 2FDIA 3P3NA 3K4AA 4CU8A 3OGSA 3NV3A 5AC93 4KI5M 1A3KA 4Q4W3 1DYKA 4Y5SA 4HSJA 4LE4A 4FQ4A 1DQ6A 4Z82A 3JB8A 1EV13 2WNUB 4GAZA 1G7YA 1GWLA 3KB5A 3LDKA 3MLLA 5DUVA 4JGZA 1RJ7A 5JLVA 2PAKA 3FFZA 1SDWA 1ASJ2 2A3WA 4SLIA 4G3YC 4I0BA 3RSJA 3V65A 4E8DA 4LBKA 2VBDA 5FOBB 1BLZA 3CJIC 3V0BB 3R6SA 1J58A 5A7NA 4Y20A 3VN4A 2ES3A 1VRBA 5DXDA 1GZWA 2VL4A 2ZMLA 3HR9A 1W8OA 3VDBA 1FV3A 1HB1A 5EJ3A 1MR5A 4MLOA 4OUSA 4UYBA 5FYBA 1VBB3 1D2SA 3QH6A 3KM5A 3DXUA 2B45X 2LS6A 3ACGA 1BXHA 2D40A 3J8F1 4XTMA 2HEWF 3I3BA 1SLIA 5A7OA 1OFNA 1TQ5A 2HWF2 3HN3A 1IS4A 1VJ2A 2WO1A 3H3ZA 3H1WA 4LBOA 5BXXA 4FTSA 3USUA 1WLDA 1SMVA 3AMNA 4RQPC 4QDQA 3AFGA 4FPOB 2YU1A 3OBZA 1RHI1 1REFA 1ULDA 1UU4A 2XJQA 5B2GB 5IUQA 5BNPB 1PGL1 4NIIA 3M3OA 5T50A 5TSWA 1RC6A 4NRQA 4JCKA 3ZYBA 4KU8A 4F3JA 3EMRA 2G1MA 4Y1XA 3H8RA 3B9CA 1W6PB 3ZSMA 3M70A 4BISA 4LHKA 5IWFA 5IATA 2PHRA 4FQZA 5CVRA 3R4UA 3RWNA 4UBGA 1VIWB 3PUAA 5CKQA 3ZVXA 5L19A 3IBMA 4XACA 2H6BA 1MZ5A 1UO9A 4Y4YA 1MS4A 1W6QB 1R1A2 2V4AA 4YW6A 2WYSA 3I97A 3RI9A 5C3QA 3RYPA 3RZMA 2XQXA 5GKAC 2P3YA 1PGL2 1BEV1 4TLFA 3WDXA 2CY6A 1ASJ3 1PIV1 2WNUC 5CEHA 3OBTA 5FK8A 1HQNA 2R16A 1W8TA 4IEYA 4Y5Z0 1XRUA 4AVVA 5J37A 5IVBA 2VZSA 4EWDA 1SLBA 2ZACA 5KWRA 2Y6HA 3I49A 4P9IA 2WNUA 3LOBA 1V6KA 2FZ2A 3CHXA 3I2DA 5DZFA 3VZKA 1JH5A 4TLGA 1OBNA 4QU1A 4J1XA 3VDDB 4Z92B 3CLPA 3PUSA 2CGOA 3VDDA 3V0BA 4HFSA 5A3PA 3AP7A 4HVQA 4GD4A 5JMOA 4N53A 2B4KA 1WW7A 1MS3A 3VDDC 2YBPA 1SACA 1MZ6A 2ZX3A 4RA0A 3VBRA 3WG3A 3FJSA 5GZCA 3THDA 3C2UA 2ZXQA 4IL7A 1HQLA 2YYOA 1CVNA 1U5ZA 4DRRA 1R081 3HQRA 4WVVA 5B4XA 4W65A 1LU1A 5IVVA 2OPWA 3LIHA 3QLQA 2R49A 3K4ZA 1OF4A 4WVMB 3AB0A 4FSJA 5J96B 1G86A 3VBSC 2ZGTA 4AF9A 2F17A 4K9SA 3AP6A 4PT6A 5SV8A 3U1XA 2AEZA 2JWPA 3I2GA 3TNPB 3CJIA 5LASA 1PGW2 1ZRFA 4E4HA 2VTXA 2D6MA 4NPMA 3RI8A 2E63A 2AGSA 3MICA 3LB9A 1NYWA 4YW4A 4Q0VA 3VBRC 1D2QA 3UJQA 3W20A 1PZ7A 2ADEA 3FX3A 3OB8A 2R32A 3NJVA 4IE6A 5HCFA 4BQ4A 2R7EB 3MZHA 2FDGA 2TNFA 2VOVA 4ZZ5A 1W6NA 4BIOA 2WT1A 2VMDA 2VTXJ 3RMXA 1C4RA 4Q4V1 1HJGA 1GZTA 1S0FA 5DPNA 3Q8AA 5LK7B 4MGSA 4CCLA 5AFEA 5AFBA 1OD3A 3POSA 1UYYA 2D6NA 3FBYA 3O1VA 5JSPA 4QGNA 1W0PA 2IXCA 5FZIA 1W3XA 1ULFA 3ZN4A 1OQEA 3ZFFB 3AL6A 1W9YA 1AR72 3GBFA 1EY2A 4BQWA 4YG3A 1N1VA 3GJAA 4A7KA 2Z5WA 1LULA 2A6YA 1GMMA 3BOPA 4CCDA 4XAAA 3VKOA 5AC92 3N9OA 4Q27A 1HXS1 3K3OA 1NCRC 4A6SA 1GP5A 3FFQA 5L9BA 2XVGA 1S0BA 2ZGMA 3CF6E 1RUD1 1PGSA 1OPOA 1W2TA 4LXLA 4QPGA 5A33A 1CPMA 1E57A 4IE7A 1KJRA 1RUG3 3ROUA 4Z8BA 1H30A 1I9RA 4OI4A 4FCAA 1G9FA 4QAWA 5C5UA 1D7PM 3CO2A 4E8CA 3O1MA 3O0WA 3P6BA 2WWSA 4XJWA 5A32A 1O8PA 1QJX1 2D7FA 1C8M3 3HPNA 4V2WA 2FDFA 3LGRA 1MQTA 4UF0B 1LOEA 3OOXA 4WVMA 1FPN3 3KVBA 3V0AB 2IXHA 4KU7A 3F95A 2OZJA 2VQ0A 3J9SA 4TWTA 5LZ6A 1OVPA 2ZAAA 1N1YA 3CJIB 1NZIA 3AYDA 4CUCA 4L8QA 4QPIA 4F8AA 5FLIA 2DUQA 1R1ZA 2BGOA 4BQXA 5IYYA 2VZUA 5F7UA 3HJRA 3PTRB 2JKXA 5I0DA 3BTXA 3ZSEA 1DGRN 4QB1A 4BQ5A 1QJY2 2YC2A 5BNOC 2WO2A 3NAPC 4XXAA 4RR3A 3KHCA 3GDBA 4IGQA 4XUQA 5FYZA 2E53A 1GQPA 3KV5A 1C1FA 1VAVA 4LOSA 1O4ZA 1REDA 2CDOA 4ZXKA 5A3NA 1FPN1 3LEIA 1ND3B 4QKFA 4YRDA 2WS91 4OMDA 4DPNA 2GC1A 2V5DA 5I91A 3HMYA 2EAAA 2QCSB 2VY0A 2ZMNA 4P5YA 2BNMA 2A1XA 3RQ0A 1ZVFA 2FMYA 2W92A 2BWCA 2P6HA 3WP6A 2IVJA 3LIGA 4LKEA 4NWWA 3WDUA 3FN9A 3LEKA 1IQAA 4XFBA 3RJ2X 5L73A 3C7GA 3VBUC 1B35B 4FOQA 3KV6A 5FBZA 1AJKA 5K0UC 2DTWA 3H50A 5J1XA 4Q4V3 1GANA 1H4GA 4Q4Y2 4FPJA 3PVEA 2PHUA 4N90A 1OKOA 1D4M3 4YVWA 2ZGLA 3AZYA 1GU3A 4TN7A 1UXXX 5FPVA 4QX0A 1AL21 3MFCA 4XF9A 1YIFA 1AF9A 2ZPXA 4O9GA 5FQ0B 1YIPA 4IEZA 2ZKNA 1ZRIA 4NPLA 1RINA 4MXWA 1F4AA 1LRHA 4MGKE 2VUJA 2W1QA 5F8PA 3KMHA 1DZTA 3IDCB 5DG1A 2B7YA 2CWMA 2EA7A 2YV8A 3R4DB 3ZR5A 5GZFA 5IVEA 5D8AB 2JIJA 1HB2A 1RUJ3 2BERA 5FO7B 2W52A 2Y33A 4CXYA 2HYKA 1S4CA 4DY5A 3PMEA 4I09A 4D3WA 1NE6A 4LA2A 1CAXB 5CG8A 2QKDA 4GB32 1U12A 4QQPA 1H1MA 4EN9B 1RMU3 2DU1A 2OIIA 3AP4A 5E88A 5JDBA 3AVSA 4JRLA 1GV9A 2W08A 2HWD2 2E31A 2PYTA 2YBSA 1WKYA 4JDNA 4QKDA 4AFCA 1ZX5A 4AZZA 2VNOA 2QBXA 1OOPA 3NNMA 1VBD2 3PMSA 5BYNA 3KV4A 4YW7A 1XQNA 5T3NA 4FFGA 2G9GA 4Z1VA 3GZTB 4BK4A 1E5RA 3KQRA 5FYIA 4XVHA 5BNNB 1R083 4C91A 2CDPA 5LWBA 1GYKA 2ZEZA 3DV8A 4UT5A 4YGCA 2VOTA 3ZSKA 4CEYB 3IIIA 4XQDA 1SLCA 3U4SA 4NPRA 4D0QA 1CESA 4XFFA 5JCTA 1J1TA 4Q4X1 5JXGA 1IPKA 2R6QA 4QPGC 4AAXA 2VD7A 5LW9A 2FCTA 1JOPA 1UNBA 1LHWA 5J48A 5LA9A 4LNVA 3U37A 3I54A 2WKKA 4DUWA 3EO6A 2HBUA 3MIEA 3J7HA 4PF1A 4CEWA 4KNCA 3VBOB 4LT5A 3ZYGA 1OMIA 2Y26A 2JB4A 2RS11 1UZYA 5K9YA 3NNGA 3T0BA 5IK4A 1AUYA 3I2KA 4QX5A 1IHMA 2UY8A 4H7LA 1DZRA 1DP0A 5C8CC 1DYPA 1PX3A 2YGLA 3AC0A 2XLAA 1XE8A 3B94A 3DGTA 3JBG1 5C4WB 5CA6A 1GQHA 5E8AA 1CZSA 1DGRA 2GP5A 2DWRA 1O3QA 1SBDA 1NA1A 1YYNA 3LQCA 4FOYA 5DAVA 1RHI3 5GALA 3KQ4B 1J84A 1AHSA 2CGNA 2J7MA 3EHKA 3ZSJA 4COVA 3VZLA 3M4FA 2VJXA 4V1PA 5D1IA 4DXRA 1CAWA 2LTNA 4QT6A 3WZ1A 1QH7A 1HRI3 1V70A 2H0BA 5FP9A 1CAWB 1JXNA 1UOBA 1HQWA 2VMCA 3PL0A 5DG2A 1V6NA 1S0EA 2R0HA 4I01A 1AVBA 1UYZA 3N9NA 5T5PA 1BQPA 2QQKA 1W04A 2MEV2 5BNQA 1US3A 4HLTA 1AYM1 3M3QA 4HPKA 1SPPA 3NO8A 2X53S 5FYSA 1GQGA 4QPIC 4BMBA 3FHQA 1PGW1 1CZVA 2JDZA 4LO8A 3H8UA 2A3XA 2CL2A 4Y1YA 4E2QA 5A1FA 1DF0A 2D98A 2Y60A 2ARBA 5JZGB 1AX1A 3IPVB 4LO4B 2OUHA 1NLRA 3NL1A 1LHVA 5FY4A 4FVVA 4FPHA 4DINB 3DCQA 5BNNA 3LZZA 1DYOA 1W9WA 4J25A 1Y43B 1JU3A 5FZHA 1LEMA 3H1MA 3MUZ1 5KHHA 1GSLA 2TUNA 1VRH2 3NKGA 1ACCA 1BBT2 2IZWA 3WT3A 2BJSA 2NN8A 3EJKA 2OZ6A 3LSDA 1NY71 2XBO2 3I7DA 4N43C 4XXPA 4Y20B 3SH5A 4CU7A 4XYXA 2UWCA 2ZGOA 5FAXA 3ZPYA 4GQ7A 1AR63 1P8JA 2GH2A 3PU8A 4IV3A 1U5XA 2LUWA 1EV11 5D8AC 1X33A 3NQHA 2ZMKA 5H9RA 4FOWA 4DO0A 1TG7A 2YZ4A 4XCAA 4DEVA 4BE3A 4GKYA 4UFMA 4NIGA 4XETA 1PM7A 1H4HA 3ACHA 4XIOA 5DDJ1 4AVTA 4OHYA 5A3TA 1G6NA 2J1SA 5CBLA 3HVDA 1RUI3 1W6MB 5BNPA 1N1SA 2GC3A 2ZZQA 1WMEA 3JBG3 1WWYA 1C1LA 4CUGA 3WNKA 5HBAA 5JOXA 5KXEA 3VD9A 1W06A 3WG2A 4YARA 4GA9A 3PNAA 3ZXFA 2WO3A 4YZ5A 3WHTA 3LF7A 3E6BA 1JUHA 3ZDSA 4XFAA 2PXJA 3KGLA 3OPWA 1PM4A 1X9PA 3D5OA 4YYOA 5T5OA 3ZFEA 4INDA 3ZIXA 2AR6A 2VAUA 4GXLA 3CMGA 3S5AA 5LRRA 5LATA 3NV2A 2E7QA 2B42B 1ZBA3 3WY6A 1JYXA 4AI3A 5IK5A 1TNRA 1VB2A 3D82A 2YU2A 2XG3A 3S30A 2XGXA 4MGIE 5SV5A 4GMP3 3VDAA 5FZ8A 4CXWA 2RS13 4CDXA 4IGPA 4HBNA 4AL9A 5F2WA 2GNMA 1NCQC 3BIWE 4RFRB 1KD7A 1LODA 4PDWB 5EHDA 2VZ1A 2BDRA 1W6QA 4MADA 1MS9A 4OUEA 1IPJA 1JHJA 2XLFA 3UL2A 2GDFA 5FZKA 4O61A 2HWE3 1LB2A 2VE1A 1VBE2 4A2UA 4ET7A 1DIWA 2ZHMA 3NSTA 4LIVA 4Q4X3 3VGIA 3BIEA 4YNIA 1RUH2 2KD7A 3E1F1 1IS3A 3ETPA 5DN2A 2AYHA 1GOGA 4XUTA 5T52A 3U75A 1Q43A 1JUIA 5KC6A 3MF6A 1OLQA 4KGGA 4BZ4A 3E5UA 1PO23 1CQ9A 1IOAA 1CJDA 2JICA 5GLWA 4NOTA 4D69A 1CJPA 3ZMNA 3KT1A 1QQP1 1O4TA 1UY3A 4AGGA 2OYZA 2A3YA 1ZM1A 1ZZ6A 1VBA2 2R0FA 1RMU1 1N1TA 2VZPA 4BK5A 5C8WA 3UNPA 4B29A 4JX0A 2OT7A 2PHFA 1J3QA 5CFDB 1AL23 4LBLA 1M4WA 4FPGA 3RYKA 5C7GA 3OCPA 1VBA3 2W47A 2JG8C 3OYWA 5JXHA 4C90A 2O8OA 3IM0A 2QQIA 4NAMA 4PIZA 3T2OA 3WDTA 4LBJA 2VC9A 2IXIA 4KG8A 3AMPA 4OUMA 5FYCA 4QXHA 2GAUA 4UW3A 3ZFFC 1OI6A 1XC6A 2W0XA 3AJZA 3GM8A 2BV4A 1NCQB 1JYIA 1POV1 3W21A 3ECQA 2EICA 3KCCA 4NRMA 5C8CB 3H42B 1F8VA 1KGYA 1NZCA 4Q2FA 4AEJA 1Z78A 2EIDA 1V9U2 3PVOA 3Q8EA 1D4M1 2WS93 3N7JA 5CFDC 4UI9L 3SEEA 2V5YA 4H2AA 4Y26A 1ULOA 4Q1PA 1LHNA 5JWPA 4NUBA 5IHRA 1AYN3 4C1XA 2VZQA 1RUH1 1XU2A 1DGLA 4LKSA 2YHJA 1XPWA 2GN3A 3H3UA 2H6CA 3HQUA 4HETA 4R9DA 3MGUA 2JDMA 2BNNA 1HN1A 4RHV2 4LQRA 5GZEA 3MO4A 4LEJA 1CAUA 4Y1ZA 5FXXA 5A32B 1PNFA 2MHFA 1WBLA 5A6YA 2WZEA 3DPRC 4XUPA 1RVF3 2XXZA 4YW3A 3VKLA 4D8MA 2E26A 1RVF2 4N8MA 2DCKA 1H9PA 2NPIA 3UETA 3ACFA 1YXWA 5FR3A 5C6CA 1VPHA 2B39A 3CQOA 4L92A 5EJ1B 3S6PA 1R092 1RUE3 1DLCA 3QBQA 4LITA 4DB5A 2ZGUA 1C8M1 2ZGSA 4RHV3 3THTA 4ONUA 5JPNB 3BTYA 3A21A 2JG8B 4IDZA 2ZEXA 1AX0A 3ITQA 4L99A 1O5UA 2XMLA 2PN5A 3H8OA 3FLTA 1RUG1 3WD5A 1KITA 1OFSA 3BB6A 3M1HA 1RUD3 4LBQD 3DKWA 4KBBA 1SFYA 1W2UA 2JDUA 3INAA 3WNMA 2RM23 3KGZA 1MPXA 4QPIB 5IT6A 2VZ3A 5CAZA 1LTEA 2YUEA 3B02A 5FPXA 4FT8A 1BEV2 2GMPA 1LOFA 1W9TA 2UWBA 4I30A 1GNZA 5KXDA 5FZ0A 4XF3A 1D4VB 4NROA 1GICA 4CDUA 4JDMA 3URFA 4LUKA 2TEPA 1TZOA 5ACA1 3UGGA 2BW8A 1RUC2 4I0WB 4PLNA 3KCYA 4WM7A 1RUH3 1WMXA 4GKXA 4JGZC 4YM2A 4XDOA 5LBCA 2LRPA 3X29B 5FYMA 5I8SA 3DPRB 3OSDA 2YFUA 3U10A 1SLLA 3EB7A 3TEZA 2ZHKA 3VDCA 3Q8BA 2XJSA 1B35C 5F6KA 1LECA 3MI8A 4NE9A 4B4PA 1MVEA 4KH9A 2G19A 4M3CF 3O1TA 1BMV1 1AJOA 1I3HA 4K1ZA 2XVLA 3NNJA 4QHBA 5CISA 3QOPA 5JIUA 1POV3 1Q8SA 4NIHA 1CR7A 1R093 1RUE2 2D3SA 1QJY1 2VG9A 2I07B 2VPVA 3OF1A 4HZFA 1MQTB 4YZ3A 5FQ0A 1V6LA 4XIKA 4A45A 4AFDA 2ARAA 2DUOA 2K9ZA 3ZXDA 4LUMA 1ZRRA 2PMWB 5FXWA 3KV9A 3ETQA 4N7IA 1HRV3 1VAMA 1AR92 1J3RA 2WWUA 2J1RA 2JDNA 2GNBA 2WRAA 4BCUA 4CDWC 4PCRA 4UFJA 1PO22 2R1BA 5BUVA 4MO3M 5D21A 3BCWA 4Q0QA 3RZGA 4UFLA 3T4HB 2EXHA 5FLHA 2W5FA 4HN1A 4BQ1A 1IKQA 2AREA 1MEC1 3MW3A 1W8WA 5LK5A 1HB3A 1K5MA 4W6XA 4D94A 3S0MA 3VUOA 4RR3B 1UU5A 5FIXA 1JHNA 1AYN2 1JYCA 3ON7A 4UFKA 1ST8A 5FLJA 4A4AA 5HXMA 3UJOA 3ORJA 2W94A 4CPBD 2DFBA 4XE9A 1PVC1 5KXCA 2J1VA 4IV1B 4XQ4A 3Q8FA 1W0OA 3WX5A 4XUNA 1STMA 1V9U3 4OHXA 2N7GA 3VD4A 4GJZA 3RDIA 4ZU7A 3ZYHA 2P17A 2XPJA 1RITA 2FD8A 5BNOA 3K75B 2HKXA 2HWB2 2OW4A 4DOUA 1N3OA 5EZWA 3TEWA 3E6CC 4BYYA 1QNYA 4CEYA 1H9WA 5JSOA 3KT7A 4XDQA 3AKTA 3HD8B 2FQPA 2CSGA 4PQ9A 2W46A 3SKVA 4XHBA 1OKQA 4BQ3A 1UYXA 1AR83 3TEYA 3WINE 2BFUL 3I4IA 3FUOA 4ZS3A 1ZNPA 2JEMA 4AAPA 2Z69A 4WVZA 3U4XA 5F5QA 3OEAA 3DL3A 1S0JA 2XKPA 1ENRA 2WN3A 4N9HA 4E2SA 1TME3 2RJLA 2XJRA 4QB2A 5A6XA 2CGPA 1LGCA 4IEOA 3T08A 5F1RA 3M8LA 4GB31 3UYJA 2OVUA 1RUI2 3I3MA 1LOGA 2X29A 3BUCA 3VZNA 3VHNA 1HV1A 2R043 2VVEA 3DUIA 1F15A 1PHMA 2I74A 3ILFA 3APBA 1DU3D 2P4EA 5CIRA 5GLUA 4W50A 1F5JA 3CIHA 4XOGA 4XCBA 3VBOA 2IXLA 1Y9QA 1VBC3 4XJ9A 3WQ7A 2HH9A 2W2IA 3GNEA 2ZBJA 2BYVE 3LFMA 4URTA 4QM9A 2R30A 5FZLA 2D5FA 1FNZA 1W03A 1DZQA 2IFWA 4LHSA 5L9RA 3SCGA 3WUCA 4AFBA 4F83A 4J6GA 2UU8A 2VW2A 1UIJA 1UPIA 4XF0A 4A7YA 1GWMA 4HL0A 3L2HA 3JQXA 3LD8A 4HPKB 3TN93 2BGCA 2EVXA 2GU9A 4GZ9A 2C4XA 1GOFA 2XQRA 3T3YA 1GP4A 1RYYA 3PU3A 2JE7A 5A1LA 4QX3A 4WBBA 1H8TB 3VKFC 1WLCA 2VXRA 4CDWB 1W6OB 1O59A 3VBHC 5JZGA 5GJ6A 4O7XA 4CDWA 1XE0A 1SCSA 1PVXA 5J98B 2P1BA 5AVAA 3WP5A 4EN6B 4P5HA 1PO11 4LR4A 3BPZA 3C7HA 4OHWA 5FPAA 4MXVA 5FZEA 1W2OA 2A73B 1O8SA 3BYWA 5JXJA 4HANA 1QWRA 5IAXA 3MF9A 1R1A1 4P9GA 1WD4A 5IJRA 5C33A 1QU0A 3ME2A 1MVQA 3MPBA 2JB8A 4FP2A 4D6QA 2A6XA 1FT9A 1N47A 2B9UA 2RMU3 5I8YA 2LM3A 4HT1T 4BWOA 5F37A 1RUOA 2R062 4YGDA 2UYBA 4RYDA 2ZGRA 2A7AA 4ZPIA 4GWMA 4BJ0A 3B5LB 4KL1A 1PNGA 4CCNA 3VD3A 4JKKA 4CDQB 4EV0A 4N43B 1WZXA 2WBKA 1ULCA 2R042 1YLLA 2QTWB 4NAOA 2VVFA 2V73A 2JX9A 2V4VA 1PX4A 2HWC1 2PHDA 3FLRA 2IXJA 1QJFA 3KWVA 2MPFA 5A80A 4EJRA 2FDHA 3DYPA 3GBGA 3I2IA 3NKTA 2NQYA 3UK9A 3ZFGC 4UWDA 4FPLA 3AJYA 4LO7A 2BVVA 1H8VA 1DQ1A 1RUJ2 2YY1A 3AKQA 4OLLA 4MZUA 2XH6A 4Q0PA 1YQ5A 1F5FA 1BYHA 3I59B 1OLME 4L0PA 3MV11 2FCUA 3BU0A 1FI2A 4AI8A 3OPTA 1HLCA 3JUUA 4R9CA 4YG0A 4FPKA 3RFRA 2PQQA 3T0AA 2WNVA 3MEPA 2CU5A 4CUBA 4E4SA 3LA3A 1I1EA 2F4PA 4BU2A 3MW2A 4Y33A 3J7MA 1O3SA 2RG4A 1UF2C 3WQBA 3H0OA 3AMHA 3PVBB 4D7SA 2YMZA 1WCSA 4PQQA 4FPYA 2Z4FA 3HOBA 3KT4A 4XFCA 3SC7X 4QX7A 4PI0A 3TNQA 4EQVA 1GFF2 1LR5A 2WWJA 4HK9A 3WDYA 1LJ7A 4OI0A 2ZABA 3SKJE 1BMV2 2Q4SA 4QQLA 1OPMA 1ND3C 1UOGA 3HNMA 3OGGA 4NHYA 1G9DA 1HRI2 1KXGA 2PLV2 1N3QA 4IE5A 2W9XA 4JKLA 5FZOA 2RMU1 4L2NA 3IKWA 1UY2A 3N7MA 1H2LA 3KCXA 3LPGA 2JDYA 1IZ3A 1VBC2 4Q8LA 1KRIA 3ZN6B 1PVC3 1UY4A 1REEA 3POGA 1SFNA 4YVSB 3WDVA 4DZGA 2EIGA 5ISLA 4G9SB 1TE1B 4YVSA 4OQ8A 2NZ9A 1GZWB 3AMQA 2WFPA 1NQJA 4RSUA 5CKMA 4MHRA 4Q0UA 2XHNA 4QB6A 4S2DA 1UX6A 1QOSA 5J36A 1JU4A 1JOBA 1YQ8A 3WF3A 1S0IA 3SQOA 1AXZA 1OD5A 4UW4A 4IGOA 3NV4A 1V00A 2O14A 3GF6A 1SHWB 5IFTA 3LOIA 2ZOEB 1PK6B 4IE0A 1HRV1 2HEYF 3VKNA 2XJPA 2EAKA 2VMEA 3O0VA 5T5JA 4K20A 5F32A 5KHKA 3S57A 2Z2SB 3IIAA 4FFIA 3LDRA 2WC2A 3WUDA 1C5IA 4FAGA 1T2XA 1YQCA 1GNHA 3V56A 4CUAA 5A3UA 4FFFA 5F3IA 1W39A 2J1UA 4CE8A 5FMBA 4XFHA 5FZMA 5I8TA 3I3QA 4HKLA 2ETEA 5C9AB 1ZBE2 3K77A 3EBRA 5LA0A 5C9AA 1G9AA 2OQ7A 1X8MA 3RGBA 1VBC1 2I2SA 3K3NA 5ANNA 1Z7S1 2RM22 3WEZA 2CWSA 4TZDA 1RUD2 3FBMA 4F7ZA 3DXTA 4CCJA 2FCVA 2BNOA 2J42A 3O0XA 3OJBA 3HBZA 2WS92 1XNDA 1Y7BA 2A6ZA 4XJZA 5ACA3 2VMIA 2R063 4A41A 4GH4B 1ENQA 1K12A 3VZMA 3OUHA 3OY8B 5FUIA 1Z0HA 2Y64A 3AX4A 4RN5A 2BPA2 5CFCC 3RZKA 3NMBA 4AYUA 2QQJA 1G8WA 5HV4A 1UMZA 1AR93 4N7UA 4NIDA 5DAQA 3HIFA 1LOCA 2RM21 3CDZB 4G4FA 1AR81 5DDJ2 1I6XA 5FYYA 2QQLA 4A7ZA 1A34A 5APAA 2DVFA 3RZZA 2Q8CA 3VBRB 2QZ3A 4LIUA 2Q5TA 2ZZJA 1X82A 3WHUA 4BIFA 3L2YA 1ODMA 4RL7A 1ZA7A 4AQ6A 1WW4A 2WQZC 1POV0 2WLQA 5DZGA 3WQ0A 1XNKA 2E51A 3WNOA 4HVOA 5G05L 1WW5A 4KWLA 5A3OA 1PK6A 3MV01 2Z42A 4P9LA 4LE3A 4PHZA 4Z07A 2R072 2SBAA 3DYMA 1COV1 1QF3A 1SZBA 4BB3A 2H0VA 2UWAA 3LWCA 5F5IA 4E4ZA 3NWKA 4MSVA 1OUXA 4LLOA 2BRTA 4H55A 4YGBA 4AI2A 2JD9A 5C70A 5C8CA 3U78A 4AHYA 2D5HA 4CZSA 2RS31 2RVAA 4QM8A 1H2MA 4YM3A 5E1RA 1MS0A 1DCSA 1Z7S2 1VP6A 2XJVA 3KLSA 4Q4X2 3UV9A 1AX2A 1VBE3 3AKPA 3KZ4C 1BK1A 4ISRA 1APNA 4LK7A 5J7MA 3VL8A 4A3ZA 1ENXA 4QXKA 4AR2A 4DRVA 1IPSA 1XNAA 3N3HA 5EJZB 4B1MA 4LMFA 1ND3A 3H7JA 2QZ2A 4EZ4A 1YO8A 4YFWA 1XJAA 2PFWA 3POBA 2GP3A 1W8NA 4GALA 1BVVA 4OFGA 4X6QB 2D3RA 4D7TA 1QJEA 2RS12 2WAAA 4CRQA 2JDKA 1OHFA 4S2GA 2X05A 3WSOA 1QKQA 4FXKB 2QE3A 4CYDA 1CWPA 5A3MA 2VZRA 1H1AA 2XWBB 4IQPA 1UXZA 1OLRA 2QFEA 3SHRA 1NCRB 2C26A 3B00A 1C5HA 1AR82 3BODA 4MOAA 2BBVA 3GZEA 5FPBA 1VBE1 4MH0E 5C5TA 1ALYA 1WGPA 1WCQA 4HVRA 5J3UA 1UWWA 5JR2A 1EUUA 3OUIA 3FWEA 5FZ7A 4BLIA 4KWJA 4PLOA 5DUUA 4DUXA 1ZZBA 2XLGA 3T09A 3LA7A 2W87A 4I3PA 3B7MA 2DF7A 5HV0A 5A7PA 4CCKA 1GP6A 2NYYA 4MXWB 4AWDA 1Q8PA 3LEMA 3ENRA 1UYPA 1W8FA 5LA1A 2PAMA 1HV0A 3E97A 3GBWA 2WO7A 2XJTA 4XEZA 4HONA 4JQTA 4TTGA 3MIHA 5D8AA 2EALA 2ET1A 4ATFA 3UKNA 1YUDA 3A4UA 1RUC3 1TMF2 4COYA 4DY3A 5BNOB 2X8KA 1HDKA 1FX5A 4FTBA 3IN9A 4HOOA 2BU9A 3MYXA 1QIQA 4NWVA 5GLZA 2E7TA 2VUAA 4EE2A 4AG4A 1IS6A 2HWE1 4RGGA 4LBQA 4TXWA 3JCIA 1PZ9A 1X50A 4AHXA 1ULGA 2XOMA 2YB7A 1IGOA 1PK6C 4NIAA 1QOOA 3POFA 4CDUC 3I8TA 3K48A 4IEQA 3RG0A 3WNLA 3DYOA 5LRSA 3WXPA 3WVJA 2XDVA 1L7LA 3ES4A 1X36A 5FYTA 2E33A 3OEBA 3GZUC 4M0NA 1YI7A 3AYCA 3HT2A 4UW5A 4P9WA 1MS8A 4ATEA 4Z2AA 2WNOA 2ZX1A 3VHPA 1DQ0A 1HN0A 4JGYA 3A0KA 4OCTA 1BBT1 4JGYB 1FXZA 3IDAA 2B5HA 3ZLIA 5GZDA 1VBD1 4ARXA 2WA4A 5EP9A 2RHPA 1NY72 2XBO1 3PDQA 3O1OA 1LGNA 1Z7S3 3ZFGB 2C9AA 2Y6GA 4KBZA 3RVHA 3AKSA 1OQ1A 1US2A 5FCCA 3UKTA 2YG0A 3HBKA 1CONA 2QJVA 2PLV1 2K0GA 1UMHA 1BZWA 1U5IA 4JZRA 4IEWA 1DQ4A 2MEV1 3OGRA 1VE0A 4PIYA 3MW4A 2JE8A 3ZDVA 4YZ2A 1AR62 2DBNA 5C4WA 1HB4A 4OZXA 1VRH1 2RR11 3WG1A 2WAOA 5BV6A 2HWE2 2EIEA 3K51A 4JTOA 1C28A 4R4ZA 4XUOA 4DFSA 4DXSA 1SG3A 1JZ3A 3MLKA 5FWJA 1W2AX 1ZZ7A 4QMAA 5LCWL 1LOBA 3OTFA 1MS1A 5I0UA
chains in the Genus database with same CATH topology
3I3DA 3I2HA 3NRUA 3OG2A 3A22A 3A23A 3OB8A 3K4DA 3NJVA 2R7EB 4ZZ5A 5B4NA 4A45A 4DXTA 2VMDA 3C7FA 1L7RA 3W5MA 1JZ8A 2W95A 2VR4A 4MGQA 5DPNA 1F4HA 2J1RA 4MGSA 4CU9A 1OD3A 3LEGA 1UYYA 2X10A 4MO3M 1JZ4A 3A7QA 2W5FA 1EUTA 3W5NA 2L9LA 4P08A 2ORXA 4A4AA 5HXMA 1GMMA 2W94A 2J1VA 4XUNA 3VD4A 5EIYB 2VCCA 4QAWA 3K75B 1D7PM 2W1SA 4E8CA 3BN6A 3P6BA 1O8PA 1W0NA 3HPNA 2W46A 3SKVA 1CZTA 1UYXA 1L7QA 5IFPA 3WF4A 4CUCA 1JZ6A 3OEAA 2BGOA 5IYYA 2VZUA 2WN3A 3HJRA 5F7UA 2JKXA 2WN2A 4QB1A 3WNNA 4QB2A 2YC2A 4KMQA 2WO2A 3T08A 4CVUA 4LPLA 3GDBA 5CYYA 4XUQA 2WUHA 1GQPA 2YFZA 4W8JA 4W50A 1ULPA 4UOJA 1JZ2A 1IQDC 3CIHA 5CZKA 4P02B 4ZY9A 2CDOA 1NAEA 2WQ8A 3LEIA 3T0DA 3FHAA 4OMDA 2V72A 2V5DA 2Y6JA 3C7OA 4LHSA 4P5YA 5C71A 3OBAA 3THCA 2W92A 1UY1A 3FN9A 2YC4A 3WF2A 3LEKA 3NJXA 1OF3A 4UAPA 3C7GA 3ABZA 2B9VA 4GZ9A 2C4XA 1GOFA 4DEQA 4GWIA 5J1XA 2VQTA 4DUVA 5HPOA 1RYYA 3P1IA 3I2JA 4GWJA 4QX3A 1K42A 1GU3A 4A6OA 1UXXX 1O59A 2JDAA 4QX0A 3VD5A 3FL7A 2X09A 1NKGA 2HYXA 3C7HA 1F4AA 1NUKA 3OGVA 1O8SA 5JXJA 2W91A 2W1QA 3I2FA 5IJRA 2E32A 2J1TA 2WZ8A 4HG6B 2BERA 2RJ2A 4M4PA 1NX9A 4RYDA 2Y6LA 3GXUA 4BJ0A 2VQUA 3C8XA 3PUHA 4FI9A 3VD3A 4JKKA 2HLEA 2E31A 1WKYA 2WBKA 2QBXA 4BDVB 2VM9A 2V4VA 1PX4A 4BK4A 4XVHA 1J83A 1UMIA 2CDPA 2ZEZA 3DYPA 4QX2A 3I2IA 2VOTA 3IIIA 1H6XA 4D0QA 2VCAA 1JI6A 5JXGA 1K45A 4AAXA 4XURA 2C9KA 2EIBA 4L0PA 3MV11 3K46A 3U37A 4DUWA 4PF1A 3J7HA 4CU6A 4A42A 2WDBA 3T0AA 1W9SA 1K3IA 3NNGA 3T0BA 4CUBA 3I2KA 2W1UA 1DP0A 5I0DA 1JYVA 1PX3A 3AC0A 3VD7A 3WQBA 1CZSA 1UX7A 3LQCA 4PQQA 2Z4FA 3HOBA 1J84A 2J7MA 3C7EA 4OMCA 2VJXA 4DXRA 3SKJE 2VMCA 3HNMA 1UYZA 2QQKA 2W9XA 4JKLA 1UY2A 3LPGA 1US3A 3BGAA 2DDUA 4YPJA 5A1AA 2VO5A 1UY4A 5DQ0A 1TVGA 3FHQA 4ARYA 1CZVA 1W99A 1LNSA 2Y8KA 4QB6A 2XHNA 1JU4A 2BGPA 3WF3A 1DYOA 1W9WA 1JU3A 1SHWB 1GUIA 1GNYA 1PMJX 5IFTA 2BZDA 3MUZ1 1PMHX 2QQMA 3IAPA 2VMEA 2VZVA 4CU7A 1T2XA 2PQSA 4CUAA 5JXIA 1P8JA 4KWUA 2QQOA 2RV9A 2J1UA 1JZ7A 3NQHA 3GGLA 3K77A 1H6YA 5LA0A 1TG7A 5JUVA 4DEVA 1R64A 3IAQA 2VCBA 1KEXA 3HNYM 3WEZA 3ACHA 3I3EA 2J1SA 3HEIA 1JYWA 3WNKA 3VD9A 4XZUG 3CZJA 3WF0A 2WO3A 2DCJA 4A41A 1K12A 3D3AA 5FUIA 2Y64A 4RN5A 5LA2A 2BBAA 3LE0A 2QQJA 5G04L 3CMGA 2VMFA 1I5PA 3CDZB 3CZUA 2VTFA 2QQLA 4P00B 1JYXA 2XONA 3VDAA 4M4RA 3UESA 1JZ5A 2VZ1A 3WNOA 1BHGA 2J1EA 5G05L 4MADA 3MV01 4OUEA 4W4ZA 1JHJA 1OH4A 3ZM8A 4QDRA 2VZTA 3DYMA 4ET7A 3F2ZA 2KD7A 3E1F1 2WABA 3ETPA 5DN2A 5C70A 2JD9A 1GOGA 4XUTA 4BXSV 1JYNA 4JKMA 3WNPA 2J1AA 2RVAA 3PUIA 1YQ2A 2VZOA 3DECA 1UY3A 1UZ0A 3K4AA 4CU8A 3OGSA 4A3ZA 4KI5M 1CX1A 1XNAA 5EJZB 1OT5A 2VZPA 4BK5A 3UNPA 4JX0A 1W8NA 2Y6KA 2WAAA 2X05A 4A44A 3WSOA 5C7GA 2W47A 2VZRA 4E8DA 1UXZA 5JXHA 2QQNA 2C26A 2QQIA 3T2OA 4MOAA 4QPWA 2VC9A 1XNTA 2VL4A 4OYUA 1XC6A 1W8OA 3GM8A 3VDBA 1WCQA 1UWWA 5JR2A 1EUUA 4QX1A 3ECQA 2EICA 4DUXA 1KGYA 2LS6A 3ACGA 3T09A 2W87A 3I3BA 2EIDA 3HN3A 2WO1A 4UI9L 3SEEA 4QDQA 2ID4A 1ULOA 5LA1A 3SEPA 5IHRA 4TTGA 2VZQA 4LKSA 1XPWA 1HN1A 2J22A 4LQRA 3MO4A 2OKXA 3WF1A 2W1WA 2WZEA 4XUPA 4D8MA 4AG4A 2E26A 4TXWA 2DCKA 2WYSA 3ACIA 3I97A 3UETA 4JHZA 2XQXA 3ACFA 2XOMA 2W3JA 2YB7A 3CQOA 3WNLA 5EJ1B 3DYOA 1DLCA 2VZSA 3A21A 1UY0A 2Y6HA 3HNBM 2ZEXA 2E33A 3OEBA 2ORZA 4Z2AA 4ZZ8A 1GOHA 2LW8A 3T2PA 3MUY1 3IB3A 3IDAA 3WNMA 4IUGA 3CKHA 1MPXA 4ARXA 2VZ3A 4OZOA 5JMOA 2B4KA 2Y6GA 5DMYA 3EYPA 1W9TA 1US2A 2YG0A 3THDA 2ZXQA 1UMHA 1CIYA 4QDSA 3OGRA 5B4XA 3T2QA 2JE8A 3JXSA 3K4ZA 1OF4A 3LPFA 2WAOA 1SDDB 3MBWA 2EIEA 2ZEWA 4PT6A 4XUOA 4DXSA 1SG3A 1JZ3A 3I2GA 2YFUA 3EB7A 5LCWL 3VDCA 2ZEYA 4ZXEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I3D A;  3I2H A;  3NRU A;  3OG2 A;  3A22 A;  3A23 A;  3OB8 A;  3K4D A;  3NJV A;  2R7E B;  4ZZ5 A;  5B4N A;  4A45 A;  4DXT A;  2VMD A;  3C7F A;  1L7R A;  3W5M A;  1JZ8 A;  2W95 A;  2VR4 A;  4MGQ A;  5DPN A;  1F4H A;  2J1R A;  4MGS A;  4CU9 A;  1OD3 A;  3LEG A;  1UYY A;  2X10 A;  4MO3 M;  1JZ4 A;  3A7Q A;  2W5F A;  1EUT A;  3W5N A;  2L9L A;  4P08 A;  2ORX A;  4A4A A;  5HXM A;  1GMM A;  2W94 A;  2J1V A;  4XUN A;  3VD4 A;  5EIY B;  2VCC A;  4QAW A;  3K75 B;  1D7P M;  2W1S A;  4E8C A;  3BN6 A;  3P6B A;  1O8P A;  1W0N A;  3HPN A;  2W46 A;  3SKV A;  1CZT A;  1UYX A;  1L7Q A;  5IFP A;  3WF4 A;  4CUC A;  1JZ6 A;  3OEA A;  2BGO A;  5IYY A;  2VZU A;  2WN3 A;  3HJR A;  5F7U A;  2JKX A;  2WN2 A;  4QB1 A;  3WNN A;  4QB2 A;  2YC2 A;  4KMQ A;  2WO2 A;  3T08 A;  4CVU A;  4LPL A;  3GDB A;  5CYY A;  4XUQ A;  2WUH A;  1GQP A;  2YFZ A;  4W8J A;  4W50 A;  1ULP A;  4UOJ A;  1JZ2 A;  1IQD C;  3CIH A;  5CZK A;  4P02 B;  4ZY9 A;  2CDO A;  1NAE A;  2WQ8 A;  3LEI A;  3T0D A;  3FHA A;  4OMD A;  2V72 A;  2V5D A;  2Y6J A;  3C7O A;  4LHS A;  4P5Y A;  5C71 A;  3OBA A;  3THC A;  2W92 A;  1UY1 A;  3FN9 A;  2YC4 A;  3WF2 A;  3LEK A;  3NJX A;  1OF3 A;  4UAP A;  3C7G A;  3ABZ A;  2B9V A;  4GZ9 A;  2C4X A;  1GOF A;  4DEQ A;  4GWI A;  5J1X A;  2VQT A;  4DUV A;  5HPO A;  1RYY A;  3P1I A;  3I2J A;  4GWJ A;  4QX3 A;  1K42 A;  1GU3 A;  4A6O A;  1UXX X;  1O59 A;  2JDA A;  4QX0 A;  3VD5 A;  3FL7 A;  2X09 A;  1NKG A;  2HYX A;  3C7H A;  1F4A A;  1NUK A;  3OGV A;  1O8S A;  5JXJ A;  2W91 A;  2W1Q A;  3I2F A;  5IJR A;  2E32 A;  2J1T A;  2WZ8 A;  4HG6 B;  2BER A;  2RJ2 A;  4M4P A;  1NX9 A;  4RYD A;  2Y6L A;  3GXU A;  4BJ0 A;  2VQU A;  3C8X A;  3PUH A;  4FI9 A;  3VD3 A;  4JKK A;  2HLE A;  2E31 A;  1WKY A;  2WBK A;  2QBX A;  4BDV B;  2VM9 A;  2V4V A;  1PX4 A;  4BK4 A;  4XVH A;  1J83 A;  1UMI A;  2CDP A;  2ZEZ A;  3DYP A;  4QX2 A;  3I2I A;  2VOT A;  3III A;  1H6X A;  4D0Q A;  2VCA A;  1JI6 A;  5JXG A;  1K45 A;  4AAX A;  4XUR A;  2C9K A;  2EIB A;  4L0P A;  3MV1 1;  3K46 A;  3U37 A;  4DUW A;  4PF1 A;  3J7H A;  4CU6 A;  4A42 A;  2WDB A;  3T0A A;  1W9S A;  1K3I A;  3NNG A;  3T0B A;  4CUB A;  3I2K A;  2W1U A;  1DP0 A;  5I0D A;  1JYV A;  1PX3 A;  3AC0 A;  3VD7 A;  3WQB A;  1CZS A;  1UX7 A;  3LQC A;  4PQQ A;  2Z4F A;  3HOB A;  1J84 A;  2J7M A;  3C7E A;  4OMC A;  2VJX A;  4DXR A;  3SKJ E;  2VMC A;  3HNM A;  1UYZ A;  2QQK A;  2W9X A;  4JKL A;  1UY2 A;  3LPG A;  1US3 A;  3BGA A;  2DDU A;  4YPJ A;  5A1A A;  2VO5 A;  1UY4 A;  5DQ0 A;  1TVG A;  3FHQ A;  4ARY A;  1CZV A;  1W99 A;  1LNS A;  2Y8K A;  4QB6 A;  2XHN A;  1JU4 A;  2BGP A;  3WF3 A;  1DYO A;  1W9W A;  1JU3 A;  1SHW B;  1GUI A;  1GNY A;  1PMJ X;  5IFT A;  2BZD A;  3MUZ 1;  1PMH X;  2QQM A;  3IAP A;  2VME A;  2VZV A;  4CU7 A;  1T2X A;  2PQS A;  4CUA A;  5JXI A;  1P8J A;  4KWU A;  2QQO A;  2RV9 A;  2J1U A;  1JZ7 A;  3NQH A;  3GGL A;  3K77 A;  1H6Y A;  5LA0 A;  1TG7 A;  5JUV A;  4DEV A;  1R64 A;  3IAQ A;  2VCB A;  1KEX A;  3HNY M;  3WEZ A;  3ACH A;  3I3E A;  2J1S A;  3HEI A;  1JYW A;  3WNK A;  3VD9 A;  4XZU G;  3CZJ A;  3WF0 A;  2WO3 A;  2DCJ A;  4A41 A;  1K12 A;  3D3A A;  5FUI A;  2Y64 A;  4RN5 A;  5LA2 A;  2BBA A;  3LE0 A;  2QQJ A;  5G04 L;  3CMG A;  2VMF A;  1I5P A;  3CDZ B;  3CZU A;  2VTF A;  2QQL A;  4P00 B;  1JYX A;  2XON A;  3VDA A;  4M4R A;  3UES A;  1JZ5 A;  2VZ1 A;  3WNO A;  1BHG A;  2J1E A;  5G05 L;  4MAD A;  3MV0 1;  4OUE A;  4W4Z A;  1JHJ A;  1OH4 A;  3ZM8 A;  4QDR A;  2VZT A;  3DYM A;  4ET7 A;  3F2Z A;  2KD7 A;  3E1F 1;  2WAB A;  3ETP A;  5DN2 A;  5C70 A;  2JD9 A;  1GOG A;  4XUT A;  4BXS V;  1JYN A;  4JKM A;  3WNP A;  2J1A A;  2RVA A;  3PUI A;  1YQ2 A;  2VZO A;  3DEC A;  1UY3 A;  1UZ0 A;  3K4A A;  4CU8 A;  3OGS A;  4A3Z A;  4KI5 M;  1CX1 A;  1XNA A;  5EJZ B;  1OT5 A;  2VZP A;  4BK5 A;  3UNP A;  4JX0 A;  1W8N A;  2Y6K A;  2WAA A;  2X05 A;  4A44 A;  3WSO A;  5C7G A;  2W47 A;  2VZR A;  4E8D A;  1UXZ A;  5JXH A;  2QQN A;  2C26 A;  2QQI A;  3T2O A;  4MOA A;  4QPW A;  2VC9 A;  1XNT A;  2VL4 A;  4OYU A;  1XC6 A;  1W8O A;  3GM8 A;  3VDB A;  1WCQ A;  1UWW A;  5JR2 A;  1EUU A;  4QX1 A;  3ECQ A;  2EIC A;  4DUX A;  1KGY A;  2LS6 A;  3ACG A;  3T09 A;  2W87 A;  3I3B A;  2EID A;  3HN3 A;  2WO1 A;  4UI9 L;  3SEE A;  4QDQ A;  2ID4 A;  1ULO A;  5LA1 A;  3SEP A;  5IHR A;  4TTG A;  2VZQ A;  4LKS A;  1XPW A;  1HN1 A;  2J22 A;  4LQR A;  3MO4 A;  2OKX A;  3WF1 A;  2W1W A;  2WZE A;  4XUP A;  4D8M A;  4AG4 A;  2E26 A;  4TXW A;  2DCK A;  2WYS A;  3ACI A;  3I97 A;  3UET A;  4JHZ A;  2XQX A;  3ACF A;  2XOM A;  2W3J A;  2YB7 A;  3CQO A;  3WNL A;  5EJ1 B;  3DYO A;  1DLC A;  2VZS A;  3A21 A;  1UY0 A;  2Y6H A;  3HNB M;  2ZEX A;  2E33 A;  3OEB A;  2ORZ A;  4Z2A A;  4ZZ8 A;  1GOH A;  2LW8 A;  3T2P A;  3MUY 1;  3IB3 A;  3IDA A;  3WNM A;  4IUG A;  3CKH A;  1MPX A;  4ARX A;  2VZ3 A;  4OZO A;  5JMO A;  2B4K A;  2Y6G A;  5DMY A;  3EYP A;  1W9T A;  1US2 A;  2YG0 A;  3THD A;  2ZXQ A;  1UMH A;  1CIY A;  4QDS A;  3OGR A;  5B4X A;  3T2Q A;  2JE8 A;  3JXS A;  3K4Z A;  1OF4 A;  3LPF A;  2WAO A;  1SDD B;  3MBW A;  2EIE A;  2ZEW A;  4PT6 A;  4XUO A;  4DXS A;  1SG3 A;  1JZ3 A;  3I2G A;  2YFU A;  3EB7 A;  5LCW L;  3VDC A;  2ZEY A;  4ZXE A; 
#chains in the Genus database with same CATH topology
 3I3D A;  4N9I A;  3A0N A;  1ULE A;  4UBH A;  1LOA A;  5L36 A;  3QD6 A;  4OUL A;  1Q8Q A;  1ODN A;  2JIG A;  2QQW A;  2ZX4 A;  4YWA A;  3IMN A;  3IWZ A;  1TNF A;  4CCC A;  1XYP A;  1AR6 1;  4Q4W 2;  4AVA A;  3MLJ A;  4Y5T A;  3WLU A;  1BJQ A;  1L3J A;  5LY2 A;  1L7R A;  3PHM A;  5FMD A;  4E27 A;  1OOP B;  3LFI A;  2W95 A;  4I0A A;  4WZC A;  3WOG A;  2D43 A;  5BNP C;  3HN1 A;  4EZH A;  4IV3 C;  1W2N A;  2GME A;  1W8H A;  4PLM A;  1QMJ A;  3IPV A;  4XJ8 A;  5HXV A;  3MDP A;  5T55 A;  1KDM A;  3LEG A;  2ET7 A;  5F5A A;  4FAH A;  1KFU L;  4R4X A;  1WD3 A;  1JZ4 A;  4C8D A;  3TWI A;  4JV4 A;  2GH8 A;  3A7Q A;  2GN7 A;  1CIW A;  1QH6 A;  2A6V A;  2GC0 A;  5ACA 2;  1S2E A;  5K0U B;  1JYV A;  2QQV A;  2WA3 A;  1DHK B;  1N3P A;  3AYE A;  5K0U A;  3W5N A;  4GH4 C;  2XL9 A;  4P08 A;  4AI1 A;  4Y3O A;  2ORX A;  3ACL A;  5A7S A;  1XBF A;  4RFT 0;  1ZZC A;  1QQP 2;  3N9Q A;  5A70 A;  3AYA A;  5FZ1 A;  5JAX A;  2VMG A;  5EV7 A;  4Q5O A;  3O1U A;  4RQP B;  1PVC 2;  4MYE A;  3ZOI A;  3POJ A;  4JRA A;  3WP4 A;  1ZBE 3;  2VCC A;  4K8R B;  5EIY B;  2A6W A;  1QJX 2;  1S1A A;  2JJ6 A;  2VXJ A;  2W1S A;  3L9J T;  2PEL A;  3AK0 A;  2JXA A;  4XF1 A;  5CFD A;  1X7N A;  4FPE A;  3RJR A;  2P3I A;  4XMA A;  2XUE A;  3HWJ A;  3PLQ A;  2CAV A;  4Q0S A;  1L7Q A;  5IFP A;  5T5L A;  3WF4 A;  2W68 A;  3PUQ A;  1YQ6 A;  4QGM A;  5FJK A;  2E9Q A;  2XUM A;  5BPX A;  4BXF A;  1QXJ A;  5L7O B;  2BP6 A;  2RDN A;  4M3C A;  1JTZ X;  1ND2 B;  2WN2 A;  3AL5 A;  5CNA A;  5H9P A;  1UW8 A;  2ATF A;  3SLI A;  3WNN A;  1A8D A;  4ASK A;  1Q8V A;  1A78 A;  1UKG A;  2DCZ A;  2PHL A;  4KMQ A;  4CCM A;  5F9T A;  1QDO A;  3RPQ A;  2P6C A;  4LPL A;  2JD4 A;  2VOW A;  1D4M 2;  1DLL A;  1FMD 1;  1UZV A;  2ZTN A;  4AVS A;  5C3R A;  3WCS A;  2R07 1;  1RUI 1;  2PA7 A;  2WUH A;  5FYH A;  1C57 A;  1JOD A;  2VU9 A;  1DGW X;  2YFZ A;  4YW2 A;  2HWD 3;  4AFA A;  4PDW C;  4B7E A;  1ULP A;  4UOJ A;  5A6Q A;  1IQD C;  2E7A A;  3TN9 2;  4P02 B;  3TYJ A;  2P3K A;  1NAE A;  2WQ8 A;  3RRD A;  5HCB A;  5LEK A;  2V72 A;  3SCF A;  2Y6J A;  1DG6 A;  3GHM A;  3JQW A;  1WUV A;  3LSE A;  4CDX B;  5C71 A;  2EXJ A;  3OBA A;  3THC A;  3IZO A;  5IVC A;  1UY1 A;  1UAI A;  3W9A A;  2YC4 A;  3AXE A;  2F4L A;  3NJX A;  3S7E A;  2GSY A;  1W05 A;  4KG0 A;  1Y9M A;  3BTZ A;  2WFF 3;  1SFP A;  3O12 A;  4CDQ A;  2NMO A;  4B4R A;  2Y0O A;  4DEQ A;  4GWI A;  3VKM A;  2VQT A;  1YHF A;  1YWK A;  5FP8 A;  3U14 A;  3P1I A;  4OHV A;  1VR3 A;  4LOT A;  3M3I A;  3GAL A;  2P2K A;  4GWJ A;  3JZV A;  4FOV A;  3AMM A;  1K42 A;  4NHX A;  5LBE A;  3KVA A;  4KGQ A;  1W9F A;  3GHN A;  3ILN A;  3VD5 A;  4B4Q A;  3U0Z A;  2HYX A;  3MIG A;  4OQ9 A;  1NUK A;  1YCI A;  2W91 A;  3OD4 A;  2WR9 A;  5FMO L;  1V0A A;  4MG2 A;  1AL0 G;  1RTV A;  1O91 A;  3I59 A;  1MQT C;  3TN9 1;  2E32 A;  2J1T A;  5FRE A;  5DUW A;  1VRH 3;  2ZGN A;  3SH4 A;  1AYM 3;  4LHL A;  2RJ2 A;  4NHM A;  4X8P A;  3H3L A;  3QH7 A;  4M4P A;  1NX9 A;  3BOW A;  2AZ5 A;  1KDK A;  1RUF 3;  1TMF 1;  4I02 A;  1GWK A;  2HWB 3;  2OX0 A;  4LTA A;  2DTY A;  2NLR A;  1HRI 1;  1WCD J;  2O0O A;  3K2O A;  3C8X A;  2D6O X;  2ILM A;  2WSU A;  5GZG A;  1V6I A;  2DVD A;  5F3C A;  1VBD 3;  2FBE A;  4XC9 A;  2CAU A;  1WCK A;  2WL1 A;  3E6D A;  2RS5 2;  3MPP G;  5HCH A;  3UGF A;  2R04 1;  1S0C A;  2VW0 A;  3U07 A;  2VOK A;  3N36 A;  1RMU 2;  2BOI A;  3S7I A;  2E6V A;  3CBN A;  4GB3 3;  2VOX A;  4LKF A;  3ZO0 B;  1J83 A;  2MEV 3;  3CNA A;  4ZU4 A;  4QX2 A;  2PLV 3;  4YGE A;  5GLT A;  1YEW A;  3TAY A;  4CP0 A;  4W6W A;  5FZO B;  4EWA A;  1D0H A;  2OQ6 A;  2DYC A;  1H6X A;  1U5Y A;  5JOW A;  5A3L A;  4LBM A;  4YZ4 A;  5IK8 A;  4IV1 C;  3ZN6 A;  3VV1 A;  4I3G A;  5FRA A;  4XUR A;  4L9B A;  5FJH A;  2EIB A;  1BBT 3;  1ZA4 A;  4KQ7 A;  1JZ6 A;  3G7D A;  3VBU A;  4CP9 B;  3POW A;  1C8M 2;  3NJY A;  1UKR A;  4EN0 A;  4A42 A;  2V09 A;  4GH4 A;  4P9Y A;  3U11 A;  3N9L A;  1W9S A;  5CFC B;  1K3I A;  3JU9 A;  3PJY A;  4WM7 C;  2ZCW A;  4OI2 A;  4YZ1 A;  1QDC A;  3M2M A;  4IW3 A;  3WCR A;  2W1U A;  1W90 A;  4UF0 A;  4GJY A;  3VD7 A;  1SBF A;  4WM8 B;  4GMP 0;  1QOT A;  4N53 C;  4Q4Y 3;  5E16 A;  5FPU A;  4QXC A;  1UX7 A;  3TBD A;  2AAC A;  4AI9 A;  2MNG A;  2DVA A;  1RB8 G;  4JAA A;  3B3Q E;  3C7E A;  3ZXG A;  2DBI A;  4OMC A;  5FUP A;  2JEC A;  3PIG A;  4C0B A;  4D7Y A;  4K3U A;  5KHI A;  2A70 A;  2C24 A;  1RUC 1;  5H9S A;  2BTV C;  5FP4 A;  4ZU5 A;  3VBF B;  2VCM A;  3ZYJ B;  1AR7 1;  2FMD A;  3VBH A;  1NG0 A;  3TRS B;  3VBF A;  4MVT A;  5FZ3 A;  2BUK A;  1R08 2;  3ALQ A;  4S2H A;  3BGA A;  1JW6 A;  2DDU A;  1RUJ 1;  3MIF A;  4YPJ A;  5A1A A;  5JOY A;  5EYX A;  3BTA A;  1IS5 A;  1LEN A;  4ERO A;  1RHI 2;  4E4D X;  1J59 A;  5LY1 A;  4ARY A;  1RIR A;  2XKO A;  5CAD A;  1G9B A;  4MGT A;  5FKC A;  2UUR A;  5FY0 A;  1CD3 G;  2XHK A;  1H0B A;  2D97 A;  5ERL A;  2Y8K A;  1OXC A;  1QJY 3;  2SLI A;  1Y3T A;  3DN7 A;  3IMM A;  2BGP A;  2D93 A;  2ENR A;  4QGL A;  4BPZ A;  4M00 A;  5M0T A;  4XTP A;  2XR4 A;  3OY8 A;  4X8N A;  1GNY A;  1PMJ X;  2HEV F;  4QPY A;  5EPA A;  1LGB A;  3TEX A;  3N7L A;  1OH3 A;  1X9T A;  1J3P A;  3E5X A;  3RZL A;  3N9P A;  2WFF 2;  2VZV A;  1EP0 A;  3T30 A;  4M3C E;  1F9K A;  5A33 B;  3M7A A;  4BQY A;  1FPN 2;  4FP3 A;  1BK0 A;  1MZE A;  2VNR A;  5JXI A;  3IDE A;  2QQO A;  2RV9 A;  3AXD A;  4FFH A;  4HKO A;  1NXM A;  3EXU A;  1V6M A;  1GLH A;  2TBV A;  1UOJ A;  3JD7 2;  1RJ8 A;  4ZS2 A;  3RMY A;  5CFC A;  3GGL A;  5A6Z A;  1CAU B;  2OXB A;  3D6E A;  4HK8 A;  4DUV A;  1RUG 2;  5JUV A;  4XFG A;  3N4M A;  1SQ4 A;  1RXF A;  1R64 A;  1UZZ A;  1NCR A;  2Q30 A;  1Q8O A;  2VCB A;  3HNY M;  1QEX A;  4ZON A;  4BM8 A;  2F6B A;  3SH3 A;  1K5M C;  3ZYI B;  3RZJ A;  3V0A A;  5CG9 A;  4NHK A;  3PVN A;  1PZ8 A;  2D6K A;  4Q4V 2;  1RL3 A;  1C8N A;  5T54 A;  2HJI A;  4XJU A;  3VHO A;  2D3P A;  4LHN A;  4XZU G;  5F5C A;  2WYF A;  5CU1 A;  3RWK X;  1AR7 3;  4PIX A;  5FO9 B;  3WF0 A;  4EN7 B;  3NNL A;  1SBE A;  3WR0 A;  2JG8 A;  1AXY A;  3AZX A;  1S2K A;  4QHZ A;  3JD7 1;  4RR3 C;  1VBB 2;  3D3A A;  2ZEY A;  4OHZ A;  3VBH B;  3R4S A;  4CSW A;  2BBA A;  4Z2W A;  2VMF A;  5JVV A;  1SCR A;  3CZU A;  4WVW A;  5K8S A;  4XBL A;  1DBN A;  2AEN A;  5C3P A;  2VTF A;  2CNA A;  4Q4Y 1;  4IEP A;  3VL9 A;  1SLT A;  3VBS A;  5I93 A;  2PTM A;  3R05 A;  3WW1 A;  2FHR A;  4M4R A;  5F3E A;  3ZYF A;  2R06 1;  3ZXJ A;  3WNX A;  4D6S A;  1MEC 2;  1JYT A;  1TME 2;  4XAB A;  1HW5 A;  2VW1 A;  1PO1 2;  4TYS A;  2D6P A;  1BHG A;  2J1E A;  4CP1 A;  4ISQ A;  5FY1 A;  1UOF A;  4FTE A;  4W4Z A;  1WA4 A;  2O8Q A;  4Y22 B;  2C0Z A;  3ZM8 A;  2WQ4 A;  1HXS 3;  3NAP B;  2VZT A;  1AR9 1;  4PI2 A;  4HMZ A;  3F2Z A;  2AC1 A;  4AHW A;  4MV2 A;  4YVW B;  1ND2 C;  2DVB A;  4C1W A;  3ZFG A;  1O6U A;  3O7O A;  4CCO A;  1XE7 A;  5FY9 A;  2AUY A;  2ERF A;  2WAB A;  3H9A A;  1ZZ9 A;  3ZXE A;  1RUF 1;  1TMF 3;  4PBP A;  5JOZ A;  4LO5 B;  1QJZ A;  4LJH A;  4JKM A;  3WNP A;  3EQE A;  4AEM A;  2KM2 A;  2RDS A;  4R9B A;  2XVK A;  1Q3E A;  5FBJ A;  2ARX A;  1I5Z A;  5IW0 A;  2EXI A;  5FDB A;  1O3R A;  3DEC A;  3KSC A;  1YFU A;  4QKB A;  5C9A C;  5FP3 A;  3I2O A;  4K21 A;  3VZJ A;  3USS A;  5FTT C;  5K7P A;  1CX1 A;  1HJF A;  4COW A;  1SLA A;  5FK7 A;  1WLW A;  4XHX A;  1VBA 1;  3SCH A;  1OT5 A;  3NNF A;  3H1Y A;  2HWB 1;  2YBK A;  2Y6K A;  1DGW A;  1VBB 1;  2JG9 A;  3BKZ A;  4A44 A;  2P3J A;  5FP7 A;  3LA2 A;  2QNK A;  4UW6 A;  2JG9 C;  2WIN B;  3B69 A;  2YXS A;  2UY9 A;  4Y1U A;  5ANQ A;  2QQN A;  5FY7 A;  5FZG A;  4BLJ A;  4CTE A;  5FZ4 A;  4IET A;  4LBQ B;  1GBG A;  4ORF A;  4QPW A;  3ATG A;  3BU7 A;  3ZFE C;  3WV6 A;  1XNT A;  1JOJ A;  1GKB A;  4OYU A;  4B3N A;  2ZX2 A;  1PIV 2;  5JIA A;  3VZO A;  4ZHN A;  4EWE A;  3PJQ A;  3OD0 A;  4ITC A;  1O4Y A;  3W59 A;  4AQT A;  2PHT A;  4MGY E;  4QX1 A;  4YSF A;  3FC0 A;  3J8F 2;  2R1D A;  1AL2 2;  1F2N A;  2VGD A;  4B7K A;  3PTY A;  3ZKY A;  4OVE A;  1F35 A;  1S0G A;  1RGS A;  4AFM A;  2O1Q A;  1OUR A;  5FMC A;  4SBV A;  1OOP C;  2VVD A;  1ZRD A;  1U0A A;  3JBG 2;  2ID4 A;  3AKR A;  5FMO S;  4Y22 A;  4QWN A;  4ZKT B;  2A5Z A;  5FZB A;  2WZP P;  4YFZ A;  2BQP A;  3NAP A;  4FO9 A;  3SEP A;  2OPK A;  3FHI B;  1EAH 3;  2DU0 A;  1ENS A;  1UQX A;  4K7J A;  1YFY A;  4HN0 A;  4CEW B;  1OA2 A;  2J22 A;  2WNE A;  1PMI A;  4NRP A;  4JGZ B;  2OS2 A;  4PBO A;  5HI0 A;  2OKX A;  3AVR A;  3WF1 A;  4XMI A;  2W1W A;  2B46 X;  5FXV A;  4E9K A;  4ASL A;  1OUS A;  2HWD 1;  1NA1 B;  3NJZ A;  4UFI A;  4WM8 C;  2BEO A;  3ACI A;  3E5Q A;  4AW7 A;  4RQP A;  4Y24 A;  2R07 3;  4JHZ A;  1QJU 3;  2W3J A;  2A71 A;  3RYR A;  1H1I A;  4DQA A;  1FMD 3;  5IK7 A;  4DMI A;  2WNV C;  3GCX A;  4CP2 A;  4EYU A;  2Q8E A;  4Q29 A;  4BH9 A;  4XZP A;  2GND A;  3CU7 A;  2VQA A;  3KD4 A;  1DQ2 A;  3KF3 A;  1DFQ A;  1NLS A;  2RE9 A;  3KHB A;  4BHP A;  1G9C A;  1UY0 A;  3HNB M;  1LES A;  2JG9 B;  1QNW A;  4V2V A;  1EV1 2;  1IG3 A;  3FLP A;  2ORZ A;  2IWG B;  1LAJ A;  1LKN A;  3J7N A;  4ZZ8 A;  1GOH A;  2LW8 A;  2HWC 3;  3T2P A;  3FZ3 A;  4QX8 A;  5EXO A;  3MUY 1;  4UXA A;  3IB3 A;  5FZA A;  1SPP B;  3QAC A;  4IUG A;  3CKH A;  5DDJ 3;  5FKB A;  3AFK A;  4MGZ E;  4R52 A;  4AK3 A;  4HKW A;  4OZO A;  4QQH A;  4RGK A;  5DMY A;  1GZ9 A;  1O5L A;  3EYP A;  1QHD A;  2WNV B;  1W6O A;  1VB4 A;  2K46 A;  3MFA A;  2YPJ A;  5GLV A;  3LCP A;  4IEX A;  2XL7 A;  4QHO A;  3J8F 3;  3CJX A;  2HBT A;  1VAL A;  2WSV A;  1W6P A;  4YVW C;  4YW5 A;  1CIY A;  3M3C A;  4QDS A;  4J1W A;  1ZBE 1;  2HWF 1;  3T2Q A;  1YRZ A;  1LHU A;  3JXS A;  2DUR A;  3PUR A;  1MZF A;  4NVP A;  2CTV A;  1NE4 A;  3LPF A;  1NXD 1;  1SDD B;  3WP3 A;  3MBW A;  1UCX A;  2P5B A;  2ZEW A;  1WLT A;  2AEY A;  3H7Y A;  4LK6 A;  1Y4W A;  3D4K A;  1YFW A;  5EWS A;  2HWC 2;  2QUO A;  4B8E A;  2WZR 3;  4ZXE A;  5F39 A;  1PO1 3;  1E5S A;  1FOD 1;  3I2H A;  1UPS A;  4IV3 B;  4JQR A;  4YVS C;  4XQW A;  5FWE A;  3TOJ A;  3NRU A;  4BME A;  1FAY A;  3OG2 A;  1W3V A;  1TEI A;  3A22 A;  4HXC A;  3A23 A;  5HCA A;  3M3E A;  3K4D A;  1BCX A;  4L97 A;  2KXL A;  2Y0I A;  4H14 A;  5IAV A;  5B4N A;  4Q4W 1;  2G9F A;  3C7F A;  4N43 A;  4DXT A;  3W5M A;  5AC9 1;  2Y34 A;  3USU B;  3GZA A;  3S5Q A;  1R1A 3;  3POI A;  2VR4 A;  4MGQ A;  4O65 A;  4N53 B;  5FYU A;  2YRO A;  1F4H A;  4LBN A;  4CU9 A;  3AZV A;  3LDB A;  4IXL A;  1AZD A;  2VUC A;  5I0T A;  2X10 A;  3ZKU A;  2Q8O A;  1H2K A;  4A3X A;  3WW4 A;  2QQU A;  4M3C B;  4XAE A;  1T6B X;  4U2A A;  4MET A;  2X5I C;  4BQ2 A;  1ONA A;  1EUT A;  1XXN A;  1EPW A;  5BNN C;  3AP9 A;  4CEW C;  2L9L A;  5JMC A;  3UGH A;  2WT2 A;  4PJY A;  3VHR A;  3BI3 A;  1WCU A;  2DCY A;  4BOW A;  1XU1 A;  1HXS 2;  4WZF A;  3ZFE B;  3JB4 C;  3J26 N;  4XBN A;  2ZGK A;  1BKZ A;  4NJ4 A;  1QXR A;  4P14 A;  2RR1 3;  5EYY A;  5KXB A;  3T1L A;  5CKN A;  3GCW A;  4CDX C;  3GJB A;  4IE4 A;  4QQ2 A;  3O1R A;  1FOD 2;  4LKD A;  1NCQ A;  1D0G A;  4FXG B;  1UZW A;  5C3S A;  2YC0 A;  1JMU B;  2WII B;  3BN6 A;  3GYD A;  1TME 1;  2I45 A;  4K8F A;  1LOF C;  1W0N A;  2WJS A;  4XBQ A;  4DS0 A;  2RS3 2;  4COZ A;  1T6G C;  1OA4 A;  3LAG A;  3WW3 A;  4NMI A;  4PDW A;  2P34 A;  2XBO 3;  2VUL A;  2NM1 A;  5F2S A;  1CZT A;  2PHX A;  2CHH A;  3ES1 A;  5FZ6 A;  2VBB A;  4QD2 A;  4QU2 A;  2OA2 A;  4XDP A;  5I0S A;  1CN1 A;  1YI9 A;  1UD1 A;  1V6J A;  5CB7 A;  5LBF A;  5BY5 A;  4LUL A;  4Y4R A;  1IG0 A;  1LU2 A;  1S2B A;  1NA1 C;  4H7M A;  5GM0 A;  5E6H A;  1W8Z A;  2GAL A;  5FZF A;  5JZG C;  4ES9 A;  1MAC A;  3ST7 A;  4Y1V A;  4E2G A;  4AGV A;  3O1S A;  1ZRC A;  4URA A;  5A7Q A;  1WW6 A;  4CVU A;  2NMN A;  5E89 A;  2Y38 A;  3ELN A;  3WQ1 A;  2WT0 A;  1EPZ A;  5CYY A;  3SIS A;  4O9E A;  4YM0 A;  5FY8 A;  1ZBA 2;  3OPZ A;  4W8J A;  2ZJC A;  4JTN A;  2Q1F A;  4LA3 A;  1VMF A;  5DUX A;  1JZ2 A;  1OC1 A;  1ZYB A;  2BVB A;  3VBU B;  5CZK A;  4ZY9 A;  2ZAH A;  1XB9 A;  4CP9 A;  4I2O A;  4OI1 A;  3T0D A;  3FHA A;  2QDR A;  5EFU A;  4DXZ A;  1Y9G A;  2JDP A;  3N9M A;  1RUF 2;  1HIX A;  2JEN A;  3C7O A;  1NQD A;  3FUQ A;  3JD7 3;  2C1F A;  4MX3 A;  3WW2 A;  1EYB A;  1XYO A;  2JDH A;  3Q8C A;  4WM8 A;  1V9U 1;  1QXP A;  1V6O A;  2EF6 A;  3WF2 A;  4HSL A;  5F6L B;  5FUN A;  4K40 A;  5LEJ A;  1NLQ A;  3H8X A;  1OF3 A;  4IEV A;  4UAP A;  3ABZ A;  2B9V A;  5IVF A;  3OYW B;  3ZXL A;  5HPO A;  4C0H A;  3SXW A;  3ZXK A;  3SMH A;  3I2J A;  1JN2 P;  3MID A;  5FOJ B;  5KHG A;  3AM2 A;  4L11 A;  4A6O A;  1POQ A;  1MEC 3;  1R09 1;  2JDA A;  5C4W C;  2JE9 A;  3ZPO A;  4RS5 A;  5F3G A;  1X8E A;  1YFX A;  2VH9 A;  4RS5 B;  5DZE A;  2LRO A;  3FL7 A;  3THP A;  1YC6 1;  2QVS B;  2X09 A;  2XJU A;  2GC2 A;  1W6N B;  5K4L A;  1NKG A;  1XYN A;  3W58 A;  4WM7 B;  1CAV B;  2X5I A;  4RGA A;  3CEW A;  4AQS A;  2NP0 A;  1CGP A;  3OGV A;  4YM1 A;  4ES8 A;  3POE A;  3I2F A;  5KR7 A;  2K2S A;  4YG6 A;  4XJA A;  4FPC A;  5AVP A;  2WZ8 A;  1YJK A;  4AI0 A;  4HG6 B;  5FZD A;  5KC5 A;  1A8M A;  2D6L X;  1KFX L;  1VAK A;  4QPG B;  2RS3 3;  3TB0 A;  5FZ9 A;  1JS9 A;  2VNG A;  1OLM A;  5JI7 A;  3ZFF A;  2PHW A;  4DIQ A;  3OUJ A;  1HKD A;  1URX A;  2Y6L A;  3GXU A;  2VQU A;  3PUH A;  4FI9 A;  5JSR A;  2LAL A;  1XSQ A;  2CYF A;  2HLE A;  2XWJ B;  2ADD A;  1OQD A;  2RS5 3;  1COV 3;  4IES A;  1COV 2;  3BPS A;  4YLZ A;  3MHZ A;  4JHT A;  4BDV B;  5KHJ A;  5FXZ A;  2VM9 A;  3N35 A;  2EXK A;  3NV1 A;  4P9X A;  4BA6 A;  3B9I A;  4Q8K A;  1ZZ8 A;  1UMI A;  1OVS A;  3UT0 A;  1RUN A;  3R0R A;  5FV3 A;  2ZGQ A;  4YW1 A;  4Q26 A;  3UKV A;  1CX4 A;  3NW4 A;  4AHZ A;  3RZH A;  2VCA A;  4XFI A;  1JI6 A;  3N7K A;  2ZHL A;  4CA9 A;  3AZZ A;  1K45 A;  2RDR A;  2C9K A;  1YNA A;  1BVP 1;  3K46 A;  1RVF 1;  1UN1 A;  4IV1 A;  3ZSL A;  2P37 A;  2CV6 A;  3ZR6 A;  3LKJ A;  4CU6 A;  3NVC A;  4KWK A;  4RD7 A;  1UIK A;  2WDB A;  2YGM A;  1QJX 3;  3VBF C;  3DF0 A;  1FV2 A;  5DAB A;  5LBB A;  4CDU B;  4RHV 1;  4FBF A;  1FNY A;  1RUE 1;  2DUP A;  1QGL A;  2XB6 C;  1IKP A;  5DAX A;  4M01 A;  5DAW A;  4AE2 A;  3B93 A;  1GR3 A;  3AZW A;  2RR1 2;  1RXG A;  1J1L A;  1CAV A;  2VBP A;  2WZR 2;  2X5I B;  3BAL A;  4FPF A;  1CPN A;  1KS4 A;  4AVC A;  1LCL A;  5JR7 B;  3VLB B;  3VB9 A;  4AOC A;  1NOV A;  5FZC A;  1E5I A;  3VBS B;  1B35 A;  3DPR A;  2RS5 1;  5D2A A;  4CPB A;  3IDB B;  3Q9O A;  5LB6 A;  2VMH A;  2Q8D A;  2DFC A;  2GZW A;  2D44 A;  4H3W A;  1KJL A;  2VNV A;  3DKQ A;  5FFO C;  1Q56 A;  2RMU 2;  4LLF A;  4MUV A;  3OGJ A;  1AYM 2;  2C5D A;  4AQ2 A;  1GZC A;  2Y6F A;  4M0H A;  1F31 A;  4GWN A;  3V64 A;  4IEU A;  1Q5O A;  1AYN 1;  3AP5 A;  2VO5 A;  1FYU A;  1NT0 A;  4JC1 A;  5DQ0 A;  1OA3 A;  1A6C A;  1TVG A;  2RDQ A;  2ZX0 A;  3ASI A;  4CXX A;  4JGY C;  3O14 A;  3ZXA C;  2JKB A;  1W99 A;  4JVA A;  4R8H A;  4QQO A;  1ZRE A;  3KS7 A;  2GNT A;  1LNS A;  4NN0 A;  3T1M A;  2OUJ A;  1B09 A;  4X6R B;  2PAE A;  2WLP A;  4NHL A;  4XW3 A;  5EQU A;  4K1Y A;  4QKN A;  1XSR A;  4GUL A;  4AEK A;  1C3H A;  1GUI A;  3HT1 A;  5FYV A;  2IUW A;  2IVI B;  1VLN A;  2BZD A;  3DEM A;  4K6B A;  3RS6 A;  2GMM A;  3D0J A;  1PMH X;  1K5M B;  2BOJ A;  5H9Q A;  2Z79 A;  3P3P A;  2QQM A;  3IAP A;  3P5B A;  3ZIW A;  1DDL A;  1HRV 2;  1LHO A;  4NR1 A;  1W8U A;  1JZ8 A;  1K5J A;  1M06 G;  4AGR A;  3ZN5 A;  3HAG A;  3O1P A;  2PQS A;  1H8T A;  1VMH A;  5I0R A;  1WA6 X;  4KWU A;  5JPM B;  2B8M A;  1CAX A;  1HX6 A;  4CEY C;  1XOY A;  4NO4 A;  1JZ7 A;  2BWA A;  2KA3 A;  2Q1Z B;  1FOD 3;  1H6Y A;  3WDW A;  1S55 A;  4WV8 A;  2WZR 1;  2FZ1 A;  4LOR A;  2IXK A;  5ABJ A;  2QDN A;  3IAQ A;  4COU A;  1KEX A;  5JI9 A;  1EAH 2;  2KR2 A;  5IVJ A;  2YPD A;  5KBF A;  4W6Y A;  3I3E A;  5ABJ C;  3MIB A;  1AXK A;  5FPZ A;  1QQP 3;  2WFF 1;  3HEI A;  1XNB A;  4RS5 C;  3G6J B;  1SEF A;  2G9Z A;  4P9J A;  5J09 A;  1JYW A;  2DVG A;  3CZJ A;  4XIL A;  1PO2 1;  2HWF 3;  5A3W A;  2DCJ A;  1H8T C;  1WBF A;  3BVC A;  3J7L A;  3FE5 A;  2DCT A;  2UYA A;  4Q1R A;  3D8C A;  4R9A A;  5LA2 A;  4U36 A;  2RJK A;  2ZHN A;  3PIJ A;  4AVB A;  2QQP A;  1FMD 2;  2VUD A;  1KS5 A;  5FY5 A;  4UFH A;  1QJU 2;  1ASJ 1;  1PIV 3;  3LE0 A;  5G04 L;  3T2T A;  4PF5 A;  4EN8 B;  1BEV 3;  4TSV A;  1I5P A;  3QCW A;  3HQX A;  3SNM A;  5C3O A;  1YJL A;  4P00 B;  2ZGP A;  2YDE A;  2XON A;  4AED B;  2FDK A;  3T4V A;  4ASM B;  4XF4 A;  4CCE A;  4AED A;  1DQ5 A;  2VEC A;  1XNC A;  3FMG A;  3UES A;  2DV9 A;  3ZYP A;  4AXO A;  1JZ5 A;  4B1L A;  3SIT A;  5IVY A;  5A7W A;  4AED C;  3O5S A;  4GMP 1;  4JDO A;  5A7W B;  1VMJ A;  3D0S A;  3ILR A;  3RNS A;  3OBR A;  4QXB A;  1WMD A;  3C3V A;  4D6R A;  1ZBA 1;  1LED A;  4MHU A;  1QJU 1;  3WG4 A;  1OH4 A;  1O7F A;  5DAP A;  4QDR A;  3IT8 A;  3ZMO A;  2IFR A;  3ZYR A;  2BFU S;  1O3T A;  5L9V A;  1W6M A;  5L7O C;  3J4U H;  2Q1M A;  4DNY A;  1E5H A;  1KQR A;  4GIQ A;  2Q0A A;  4S2F A;  5L7O A;  3VBO C;  4BXS V;  2IC1 A;  2ZS6 B;  2FDJ A;  1QY4 A;  1ND2 A;  2G4I A;  3B01 A;  2W39 A;  1UL9 A;  1WMF A;  4LO6 B;  4XPV A;  1JYN A;  3CL1 A;  3POY A;  4CDQ C;  1MS5 A;  2J1A A;  3KF5 A;  2ARC A;  1OSG A;  4IER A;  5FPL A;  3PUI A;  1W28 A;  1YQ2 A;  5ABJ B;  2AH2 A;  2ZA9 A;  1EAH 1;  2ZKL A;  2A75 A;  1H2N A;  2VZO A;  3ZX7 A;  1JBC A;  1UU6 A;  1UZ0 A;  1S0D A;  2C6S A;  5FO8 B;  1FAT A;  2FDI A;  3P3N A;  3K4A A;  4CU8 A;  3OGS A;  3NV3 A;  5AC9 3;  4KI5 M;  1A3K A;  4Q4W 3;  1DYK A;  4Y5S A;  4HSJ A;  4LE4 A;  4FQ4 A;  1DQ6 A;  4Z82 A;  3JB8 A;  1EV1 3;  2WNU B;  4GAZ A;  1G7Y A;  1GWL A;  3KB5 A;  3LDK A;  3MLL A;  5DUV A;  4JGZ A;  1RJ7 A;  5JLV A;  2PAK A;  3FFZ A;  1SDW A;  1ASJ 2;  2A3W A;  4SLI A;  4G3Y C;  4I0B A;  3RSJ A;  3V65 A;  4E8D A;  4LBK A;  2VBD A;  5FOB B;  1BLZ A;  3CJI C;  3V0B B;  3R6S A;  1J58 A;  5A7N A;  4Y20 A;  3VN4 A;  2ES3 A;  1VRB A;  5DXD A;  1GZW A;  2VL4 A;  2ZML A;  3HR9 A;  1W8O A;  3VDB A;  1FV3 A;  1HB1 A;  5EJ3 A;  1MR5 A;  4MLO A;  4OUS A;  4UYB A;  5FYB A;  1VBB 3;  1D2S A;  3QH6 A;  3KM5 A;  3DXU A;  2B45 X;  2LS6 A;  3ACG A;  1BXH A;  2D40 A;  3J8F 1;  4XTM A;  2HEW F;  3I3B A;  1SLI A;  5A7O A;  1OFN A;  1TQ5 A;  2HWF 2;  3HN3 A;  1IS4 A;  1VJ2 A;  2WO1 A;  3H3Z A;  3H1W A;  4LBO A;  5BXX A;  4FTS A;  3USU A;  1WLD A;  1SMV A;  3AMN A;  4RQP C;  4QDQ A;  3AFG A;  4FPO B;  2YU1 A;  3OBZ A;  1RHI 1;  1REF A;  1ULD A;  1UU4 A;  2XJQ A;  5B2G B;  5IUQ A;  5BNP B;  1PGL 1;  4NII A;  3M3O A;  5T50 A;  5TSW A;  1RC6 A;  4NRQ A;  4JCK A;  3ZYB A;  4KU8 A;  4F3J A;  3EMR A;  2G1M A;  4Y1X A;  3H8R A;  3B9C A;  1W6P B;  3ZSM A;  3M70 A;  4BIS A;  4LHK A;  5IWF A;  5IAT A;  2PHR A;  4FQZ A;  5CVR A;  3R4U A;  3RWN A;  4UBG A;  1VIW B;  3PUA A;  5CKQ A;  3ZVX A;  5L19 A;  3IBM A;  4XAC A;  2H6B A;  1MZ5 A;  1UO9 A;  4Y4Y A;  1MS4 A;  1W6Q B;  1R1A 2;  2V4A A;  4YW6 A;  2WYS A;  3I97 A;  3RI9 A;  5C3Q A;  3RYP A;  3RZM A;  2XQX A;  5GKA C;  2P3Y A;  1PGL 2;  1BEV 1;  4TLF A;  3WDX A;  2CY6 A;  1ASJ 3;  1PIV 1;  2WNU C;  5CEH A;  3OBT A;  5FK8 A;  1HQN A;  2R16 A;  1W8T A;  4IEY A;  4Y5Z 0;  1XRU A;  4AVV A;  5J37 A;  5IVB A;  2VZS A;  4EWD A;  1SLB A;  2ZAC A;  5KWR A;  2Y6H A;  3I49 A;  4P9I A;  2WNU A;  3LOB A;  1V6K A;  2FZ2 A;  3CHX A;  3I2D A;  5DZF A;  3VZK A;  1JH5 A;  4TLG A;  1OBN A;  4QU1 A;  4J1X A;  3VDD B;  4Z92 B;  3CLP A;  3PUS A;  2CGO A;  3VDD A;  3V0B A;  4HFS A;  5A3P A;  3AP7 A;  4HVQ A;  4GD4 A;  5JMO A;  4N53 A;  2B4K A;  1WW7 A;  1MS3 A;  3VDD C;  2YBP A;  1SAC A;  1MZ6 A;  2ZX3 A;  4RA0 A;  3VBR A;  3WG3 A;  3FJS A;  5GZC A;  3THD A;  3C2U A;  2ZXQ A;  4IL7 A;  1HQL A;  2YYO A;  1CVN A;  1U5Z A;  4DRR A;  1R08 1;  3HQR A;  4WVV A;  5B4X A;  4W65 A;  1LU1 A;  5IVV A;  2OPW A;  3LIH A;  3QLQ A;  2R49 A;  3K4Z A;  1OF4 A;  4WVM B;  3AB0 A;  4FSJ A;  5J96 B;  1G86 A;  3VBS C;  2ZGT A;  4AF9 A;  2F17 A;  4K9S A;  3AP6 A;  4PT6 A;  5SV8 A;  3U1X A;  2AEZ A;  2JWP A;  3I2G A;  3TNP B;  3CJI A;  5LAS A;  1PGW 2;  1ZRF A;  4E4H A;  2VTX A;  2D6M A;  4NPM A;  3RI8 A;  2E63 A;  2AGS A;  3MIC A;  3LB9 A;  1NYW A;  4YW4 A;  4Q0V A;  3VBR C;  1D2Q A;  3UJQ A;  3W20 A;  1PZ7 A;  2ADE A;  3FX3 A;  3OB8 A;  2R32 A;  3NJV A;  4IE6 A;  5HCF A;  4BQ4 A;  2R7E B;  3MZH A;  2FDG A;  2TNF A;  2VOV A;  4ZZ5 A;  1W6N A;  4BIO A;  2WT1 A;  2VMD A;  2VTX J;  3RMX A;  1C4R A;  4Q4V 1;  1HJG A;  1GZT A;  1S0F A;  5DPN A;  3Q8A A;  5LK7 B;  4MGS A;  4CCL A;  5AFE A;  5AFB A;  1OD3 A;  3POS A;  1UYY A;  2D6N A;  3FBY A;  3O1V A;  5JSP A;  4QGN A;  1W0P A;  2IXC A;  5FZI A;  1W3X A;  1ULF A;  3ZN4 A;  1OQE A;  3ZFF B;  3AL6 A;  1W9Y A;  1AR7 2;  3GBF A;  1EY2 A;  4BQW A;  4YG3 A;  1N1V A;  3GJA A;  4A7K A;  2Z5W A;  1LUL A;  2A6Y A;  1GMM A;  3BOP A;  4CCD A;  4XAA A;  3VKO A;  5AC9 2;  3N9O A;  4Q27 A;  1HXS 1;  3K3O A;  1NCR C;  4A6S A;  1GP5 A;  3FFQ A;  5L9B A;  2XVG A;  1S0B A;  2ZGM A;  3CF6 E;  1RUD 1;  1PGS A;  1OPO A;  1W2T A;  4LXL A;  4QPG A;  5A33 A;  1CPM A;  1E57 A;  4IE7 A;  1KJR A;  1RUG 3;  3ROU A;  4Z8B A;  1H30 A;  1I9R A;  4OI4 A;  4FCA A;  1G9F A;  4QAW A;  5C5U A;  1D7P M;  3CO2 A;  4E8C A;  3O1M A;  3O0W A;  3P6B A;  2WWS A;  4XJW A;  5A32 A;  1O8P A;  1QJX 1;  2D7F A;  1C8M 3;  3HPN A;  4V2W A;  2FDF A;  3LGR A;  1MQT A;  4UF0 B;  1LOE A;  3OOX A;  4WVM A;  1FPN 3;  3KVB A;  3V0A B;  2IXH A;  4KU7 A;  3F95 A;  2OZJ A;  2VQ0 A;  3J9S A;  4TWT A;  5LZ6 A;  1OVP A;  2ZAA A;  1N1Y A;  3CJI B;  1NZI A;  3AYD A;  4CUC A;  4L8Q A;  4QPI A;  4F8A A;  5FLI A;  2DUQ A;  1R1Z A;  2BGO A;  4BQX A;  5IYY A;  2VZU A;  5F7U A;  3HJR A;  3PTR B;  2JKX A;  5I0D A;  3BTX A;  3ZSE A;  1DGR N;  4QB1 A;  4BQ5 A;  1QJY 2;  2YC2 A;  5BNO C;  2WO2 A;  3NAP C;  4XXA A;  4RR3 A;  3KHC A;  3GDB A;  4IGQ A;  4XUQ A;  5FYZ A;  2E53 A;  1GQP A;  3KV5 A;  1C1F A;  1VAV A;  4LOS A;  1O4Z A;  1RED A;  2CDO A;  4ZXK A;  5A3N A;  1FPN 1;  3LEI A;  1ND3 B;  4QKF A;  4YRD A;  2WS9 1;  4OMD A;  4DPN A;  2GC1 A;  2V5D A;  5I91 A;  3HMY A;  2EAA A;  2QCS B;  2VY0 A;  2ZMN A;  4P5Y A;  2BNM A;  2A1X A;  3RQ0 A;  1ZVF A;  2FMY A;  2W92 A;  2BWC A;  2P6H A;  3WP6 A;  2IVJ A;  3LIG A;  4LKE A;  4NWW A;  3WDU A;  3FN9 A;  3LEK A;  1IQA A;  4XFB A;  3RJ2 X;  5L73 A;  3C7G A;  3VBU C;  1B35 B;  4FOQ A;  3KV6 A;  5FBZ A;  1AJK A;  5K0U C;  2DTW A;  3H50 A;  5J1X A;  4Q4V 3;  1GAN A;  1H4G A;  4Q4Y 2;  4FPJ A;  3PVE A;  2PHU A;  4N90 A;  1OKO A;  1D4M 3;  4YVW A;  2ZGL A;  3AZY A;  1GU3 A;  4TN7 A;  1UXX X;  5FPV A;  4QX0 A;  1AL2 1;  3MFC A;  4XF9 A;  1YIF A;  1AF9 A;  2ZPX A;  4O9G A;  5FQ0 B;  1YIP A;  4IEZ A;  2ZKN A;  1ZRI A;  4NPL A;  1RIN A;  4MXW A;  1F4A A;  1LRH A;  4MGK E;  2VUJ A;  2W1Q A;  5F8P A;  3KMH A;  1DZT A;  3IDC B;  5DG1 A;  2B7Y A;  2CWM A;  2EA7 A;  2YV8 A;  3R4D B;  3ZR5 A;  5GZF A;  5IVE A;  5D8A B;  2JIJ A;  1HB2 A;  1RUJ 3;  2BER A;  5FO7 B;  2W52 A;  2Y33 A;  4CXY A;  2HYK A;  1S4C A;  4DY5 A;  3PME A;  4I09 A;  4D3W A;  1NE6 A;  4LA2 A;  1CAX B;  5CG8 A;  2QKD A;  4GB3 2;  1U12 A;  4QQP A;  1H1M A;  4EN9 B;  1RMU 3;  2DU1 A;  2OII A;  3AP4 A;  5E88 A;  5JDB A;  3AVS A;  4JRL A;  1GV9 A;  2W08 A;  2HWD 2;  2E31 A;  2PYT A;  2YBS A;  1WKY A;  4JDN A;  4QKD A;  4AFC A;  1ZX5 A;  4AZZ A;  2VNO A;  2QBX A;  1OOP A;  3NNM A;  1VBD 2;  3PMS A;  5BYN A;  3KV4 A;  4YW7 A;  1XQN A;  5T3N A;  4FFG A;  2G9G A;  4Z1V A;  3GZT B;  4BK4 A;  1E5R A;  3KQR A;  5FYI A;  4XVH A;  5BNN B;  1R08 3;  4C91 A;  2CDP A;  5LWB A;  1GYK A;  2ZEZ A;  3DV8 A;  4UT5 A;  4YGC A;  2VOT A;  3ZSK A;  4CEY B;  3III A;  4XQD A;  1SLC A;  3U4S A;  4NPR A;  4D0Q A;  1CES A;  4XFF A;  5JCT A;  1J1T A;  4Q4X 1;  5JXG A;  1IPK A;  2R6Q A;  4QPG C;  4AAX A;  2VD7 A;  5LW9 A;  2FCT A;  1JOP A;  1UNB A;  1LHW A;  5J48 A;  5LA9 A;  4LNV A;  3U37 A;  3I54 A;  2WKK A;  4DUW A;  3EO6 A;  2HBU A;  3MIE A;  3J7H A;  4PF1 A;  4CEW A;  4KNC A;  3VBO B;  4LT5 A;  3ZYG A;  1OMI A;  2Y26 A;  2JB4 A;  2RS1 1;  1UZY A;  5K9Y A;  3NNG A;  3T0B A;  5IK4 A;  1AUY A;  3I2K A;  4QX5 A;  1IHM A;  2UY8 A;  4H7L A;  1DZR A;  1DP0 A;  5C8C C;  1DYP A;  1PX3 A;  2YGL A;  3AC0 A;  2XLA A;  1XE8 A;  3B94 A;  3DGT A;  3JBG 1;  5C4W B;  5CA6 A;  1GQH A;  5E8A A;  1CZS A;  1DGR A;  2GP5 A;  2DWR A;  1O3Q A;  1SBD A;  1NA1 A;  1YYN A;  3LQC A;  4FOY A;  5DAV A;  1RHI 3;  5GAL A;  3KQ4 B;  1J84 A;  1AHS A;  2CGN A;  2J7M A;  3EHK A;  3ZSJ A;  4COV A;  3VZL A;  3M4F A;  2VJX A;  4V1P A;  5D1I A;  4DXR A;  1CAW A;  2LTN A;  4QT6 A;  3WZ1 A;  1QH7 A;  1HRI 3;  1V70 A;  2H0B A;  5FP9 A;  1CAW B;  1JXN A;  1UOB A;  1HQW A;  2VMC A;  3PL0 A;  5DG2 A;  1V6N A;  1S0E A;  2R0H A;  4I01 A;  1AVB A;  1UYZ A;  3N9N A;  5T5P A;  1BQP A;  2QQK A;  1W04 A;  2MEV 2;  5BNQ A;  1US3 A;  4HLT A;  1AYM 1;  3M3Q A;  4HPK A;  1SPP A;  3NO8 A;  2X53 S;  5FYS A;  1GQG A;  4QPI C;  4BMB A;  3FHQ A;  1PGW 1;  1CZV A;  2JDZ A;  4LO8 A;  3H8U A;  2A3X A;  2CL2 A;  4Y1Y A;  4E2Q A;  5A1F A;  1DF0 A;  2D98 A;  2Y60 A;  2ARB A;  5JZG B;  1AX1 A;  3IPV B;  4LO4 B;  2OUH A;  1NLR A;  3NL1 A;  1LHV A;  5FY4 A;  4FVV A;  4FPH A;  4DIN B;  3DCQ A;  5BNN A;  3LZZ A;  1DYO A;  1W9W A;  4J25 A;  1Y43 B;  1JU3 A;  5FZH A;  1LEM A;  3H1M A;  3MUZ 1;  5KHH A;  1GSL A;  2TUN A;  1VRH 2;  3NKG A;  1ACC A;  1BBT 2;  2IZW A;  3WT3 A;  2BJS A;  2NN8 A;  3EJK A;  2OZ6 A;  3LSD A;  1NY7 1;  2XBO 2;  3I7D A;  4N43 C;  4XXP A;  4Y20 B;  3SH5 A;  4CU7 A;  4XYX A;  2UWC A;  2ZGO A;  5FAX A;  3ZPY A;  4GQ7 A;  1AR6 3;  1P8J A;  2GH2 A;  3PU8 A;  4IV3 A;  1U5X A;  2LUW A;  1EV1 1;  5D8A C;  1X33 A;  3NQH A;  2ZMK A;  5H9R A;  4FOW A;  4DO0 A;  1TG7 A;  2YZ4 A;  4XCA A;  4DEV A;  4BE3 A;  4GKY A;  4UFM A;  4NIG A;  4XET A;  1PM7 A;  1H4H A;  3ACH A;  4XIO A;  5DDJ 1;  4AVT A;  4OHY A;  5A3T A;  1G6N A;  2J1S A;  5CBL A;  3HVD A;  1RUI 3;  1W6M B;  5BNP A;  1N1S A;  2GC3 A;  2ZZQ A;  1WME A;  3JBG 3;  1WWY A;  1C1L A;  4CUG A;  3WNK A;  5HBA A;  5JOX A;  5KXE A;  3VD9 A;  1W06 A;  3WG2 A;  4YAR A;  4GA9 A;  3PNA A;  3ZXF A;  2WO3 A;  4YZ5 A;  3WHT A;  3LF7 A;  3E6B A;  1JUH A;  3ZDS A;  4XFA A;  2PXJ A;  3KGL A;  3OPW A;  1PM4 A;  1X9P A;  3D5O A;  4YYO A;  5T5O A;  3ZFE A;  4IND A;  3ZIX A;  2AR6 A;  2VAU A;  4GXL A;  3CMG A;  3S5A A;  5LRR A;  5LAT A;  3NV2 A;  2E7Q A;  2B42 B;  1ZBA 3;  3WY6 A;  1JYX A;  4AI3 A;  5IK5 A;  1TNR A;  1VB2 A;  3D82 A;  2YU2 A;  2XG3 A;  3S30 A;  2XGX A;  4MGI E;  5SV5 A;  4GMP 3;  3VDA A;  5FZ8 A;  4CXW A;  2RS1 3;  4CDX A;  4IGP A;  4HBN A;  4AL9 A;  5F2W A;  2GNM A;  1NCQ C;  3BIW E;  4RFR B;  1KD7 A;  1LOD A;  4PDW B;  5EHD A;  2VZ1 A;  2BDR A;  1W6Q A;  4MAD A;  1MS9 A;  4OUE A;  1IPJ A;  1JHJ A;  2XLF A;  3UL2 A;  2GDF A;  5FZK A;  4O61 A;  2HWE 3;  1LB2 A;  2VE1 A;  1VBE 2;  4A2U A;  4ET7 A;  1DIW A;  2ZHM A;  3NST A;  4LIV A;  4Q4X 3;  3VGI A;  3BIE A;  4YNI A;  1RUH 2;  2KD7 A;  3E1F 1;  1IS3 A;  3ETP A;  5DN2 A;  2AYH A;  1GOG A;  4XUT A;  5T52 A;  3U75 A;  1Q43 A;  1JUI A;  5KC6 A;  3MF6 A;  1OLQ A;  4KGG A;  4BZ4 A;  3E5U A;  1PO2 3;  1CQ9 A;  1IOA A;  1CJD A;  2JIC A;  5GLW A;  4NOT A;  4D69 A;  1CJP A;  3ZMN A;  3KT1 A;  1QQP 1;  1O4T A;  1UY3 A;  4AGG A;  2OYZ A;  2A3Y A;  1ZM1 A;  1ZZ6 A;  1VBA 2;  2R0F A;  1RMU 1;  1N1T A;  2VZP A;  4BK5 A;  5C8W A;  3UNP A;  4B29 A;  4JX0 A;  2OT7 A;  2PHF A;  1J3Q A;  5CFD B;  1AL2 3;  4LBL A;  1M4W A;  4FPG A;  3RYK A;  5C7G A;  3OCP A;  1VBA 3;  2W47 A;  2JG8 C;  3OYW A;  5JXH A;  4C90 A;  2O8O A;  3IM0 A;  2QQI A;  4NAM A;  4PIZ A;  3T2O A;  3WDT A;  4LBJ A;  2VC9 A;  2IXI A;  4KG8 A;  3AMP A;  4OUM A;  5FYC A;  4QXH A;  2GAU A;  4UW3 A;  3ZFF C;  1OI6 A;  1XC6 A;  2W0X A;  3AJZ A;  3GM8 A;  2BV4 A;  1NCQ B;  1JYI A;  1POV 1;  3W21 A;  3ECQ A;  2EIC A;  3KCC A;  4NRM A;  5C8C B;  3H42 B;  1F8V A;  1KGY A;  1NZC A;  4Q2F A;  4AEJ A;  1Z78 A;  2EID A;  1V9U 2;  3PVO A;  3Q8E A;  1D4M 1;  2WS9 3;  3N7J A;  5CFD C;  4UI9 L;  3SEE A;  2V5Y A;  4H2A A;  4Y26 A;  1ULO A;  4Q1P A;  1LHN A;  5JWP A;  4NUB A;  5IHR A;  1AYN 3;  4C1X A;  2VZQ A;  1RUH 1;  1XU2 A;  1DGL A;  4LKS A;  2YHJ A;  1XPW A;  2GN3 A;  3H3U A;  2H6C A;  3HQU A;  4HET A;  4R9D A;  3MGU A;  2JDM A;  2BNN A;  1HN1 A;  4RHV 2;  4LQR A;  5GZE A;  3MO4 A;  4LEJ A;  1CAU A;  4Y1Z A;  5FXX A;  5A32 B;  1PNF A;  2MHF A;  1WBL A;  5A6Y A;  2WZE A;  3DPR C;  4XUP A;  1RVF 3;  2XXZ A;  4YW3 A;  3VKL A;  4D8M A;  2E26 A;  1RVF 2;  4N8M A;  2DCK A;  1H9P A;  2NPI A;  3UET A;  3ACF A;  1YXW A;  5FR3 A;  5C6C A;  1VPH A;  2B39 A;  3CQO A;  4L92 A;  5EJ1 B;  3S6P A;  1R09 2;  1RUE 3;  1DLC A;  3QBQ A;  4LIT A;  4DB5 A;  2ZGU A;  1C8M 1;  2ZGS A;  4RHV 3;  3THT A;  4ONU A;  5JPN B;  3BTY A;  3A21 A;  2JG8 B;  4IDZ A;  2ZEX A;  1AX0 A;  3ITQ A;  4L99 A;  1O5U A;  2XML A;  2PN5 A;  3H8O A;  3FLT A;  1RUG 1;  3WD5 A;  1KIT A;  1OFS A;  3BB6 A;  3M1H A;  1RUD 3;  4LBQ D;  3DKW A;  4KBB A;  1SFY A;  1W2U A;  2JDU A;  3INA A;  3WNM A;  2RM2 3;  3KGZ A;  1MPX A;  4QPI B;  5IT6 A;  2VZ3 A;  5CAZ A;  1LTE A;  2YUE A;  3B02 A;  5FPX A;  4FT8 A;  1BEV 2;  2GMP A;  1LOF A;  1W9T A;  2UWB A;  4I30 A;  1GNZ A;  5KXD A;  5FZ0 A;  4XF3 A;  1D4V B;  4NRO A;  1GIC A;  4CDU A;  4JDM A;  3URF A;  4LUK A;  2TEP A;  1TZO A;  5ACA 1;  3UGG A;  2BW8 A;  1RUC 2;  4I0W B;  4PLN A;  3KCY A;  4WM7 A;  1RUH 3;  1WMX A;  4GKX A;  4JGZ C;  4YM2 A;  4XDO A;  5LBC A;  2LRP A;  3X29 B;  5FYM A;  5I8S A;  3DPR B;  3OSD A;  2YFU A;  3U10 A;  1SLL A;  3EB7 A;  3TEZ A;  2ZHK A;  3VDC A;  3Q8B A;  2XJS A;  1B35 C;  5F6K A;  1LEC A;  3MI8 A;  4NE9 A;  4B4P A;  1MVE A;  4KH9 A;  2G19 A;  4M3C F;  3O1T A;  1BMV 1;  1AJO A;  1I3H A;  4K1Z A;  2XVL A;  3NNJ A;  4QHB A;  5CIS A;  3QOP A;  5JIU A;  1POV 3;  1Q8S A;  4NIH A;  1CR7 A;  1R09 3;  1RUE 2;  2D3S A;  1QJY 1;  2VG9 A;  2I07 B;  2VPV A;  3OF1 A;  4HZF A;  1MQT B;  4YZ3 A;  5FQ0 A;  1V6L A;  4XIK A;  4A45 A;  4AFD A;  2ARA A;  2DUO A;  2K9Z A;  3ZXD A;  4LUM A;  1ZRR A;  2PMW B;  5FXW A;  3KV9 A;  3ETQ A;  4N7I A;  1HRV 3;  1VAM A;  1AR9 2;  1J3R A;  2WWU A;  2J1R A;  2JDN A;  2GNB A;  2WRA A;  4BCU A;  4CDW C;  4PCR A;  4UFJ A;  1PO2 2;  2R1B A;  5BUV A;  4MO3 M;  5D21 A;  3BCW A;  4Q0Q A;  3RZG A;  4UFL A;  3T4H B;  2EXH A;  5FLH A;  2W5F A;  4HN1 A;  4BQ1 A;  1IKQ A;  2ARE A;  1MEC 1;  3MW3 A;  1W8W A;  5LK5 A;  1HB3 A;  1K5M A;  4W6X A;  4D94 A;  3S0M A;  3VUO A;  4RR3 B;  1UU5 A;  5FIX A;  1JHN A;  1AYN 2;  1JYC A;  3ON7 A;  4UFK A;  1ST8 A;  5FLJ A;  4A4A A;  5HXM A;  3UJO A;  3ORJ A;  2W94 A;  4CPB D;  2DFB A;  4XE9 A;  1PVC 1;  5KXC A;  2J1V A;  4IV1 B;  4XQ4 A;  3Q8F A;  1W0O A;  3WX5 A;  4XUN A;  1STM A;  1V9U 3;  4OHX A;  2N7G A;  3VD4 A;  4GJZ A;  3RDI A;  4ZU7 A;  3ZYH A;  2P17 A;  2XPJ A;  1RIT A;  2FD8 A;  5BNO A;  3K75 B;  2HKX A;  2HWB 2;  2OW4 A;  4DOU A;  1N3O A;  5EZW A;  3TEW A;  3E6C C;  4BYY A;  1QNY A;  4CEY A;  1H9W A;  5JSO A;  3KT7 A;  4XDQ A;  3AKT A;  3HD8 B;  2FQP A;  2CSG A;  4PQ9 A;  2W46 A;  3SKV A;  4XHB A;  1OKQ A;  4BQ3 A;  1UYX A;  1AR8 3;  3TEY A;  3WIN E;  2BFU L;  3I4I A;  3FUO A;  4ZS3 A;  1ZNP A;  2JEM A;  4AAP A;  2Z69 A;  4WVZ A;  3U4X A;  5F5Q A;  3OEA A;  3DL3 A;  1S0J A;  2XKP A;  1ENR A;  2WN3 A;  4N9H A;  4E2S A;  1TME 3;  2RJL A;  2XJR A;  4QB2 A;  5A6X A;  2CGP A;  1LGC A;  4IEO A;  3T08 A;  5F1R A;  3M8L A;  4GB3 1;  3UYJ A;  2OVU A;  1RUI 2;  3I3M A;  1LOG A;  2X29 A;  3BUC A;  3VZN A;  3VHN A;  1HV1 A;  2R04 3;  2VVE A;  3DUI A;  1F15 A;  1PHM A;  2I74 A;  3ILF A;  3APB A;  1DU3 D;  2P4E A;  5CIR A;  5GLU A;  4W50 A;  1F5J A;  3CIH A;  4XOG A;  4XCB A;  3VBO A;  2IXL A;  1Y9Q A;  1VBC 3;  4XJ9 A;  3WQ7 A;  2HH9 A;  2W2I A;  3GNE A;  2ZBJ A;  2BYV E;  3LFM A;  4URT A;  4QM9 A;  2R30 A;  5FZL A;  2D5F A;  1FNZ A;  1W03 A;  1DZQ A;  2IFW A;  4LHS A;  5L9R A;  3SCG A;  3WUC A;  4AFB A;  4F83 A;  4J6G A;  2UU8 A;  2VW2 A;  1UIJ A;  1UPI A;  4XF0 A;  4A7Y A;  1GWM A;  4HL0 A;  3L2H A;  3JQX A;  3LD8 A;  4HPK B;  3TN9 3;  2BGC A;  2EVX A;  2GU9 A;  4GZ9 A;  2C4X A;  1GOF A;  2XQR A;  3T3Y A;  1GP4 A;  1RYY A;  3PU3 A;  2JE7 A;  5A1L A;  4QX3 A;  4WBB A;  1H8T B;  3VKF C;  1WLC A;  2VXR A;  4CDW B;  1W6O B;  1O59 A;  3VBH C;  5JZG A;  5GJ6 A;  4O7X A;  4CDW A;  1XE0 A;  1SCS A;  1PVX A;  5J98 B;  2P1B A;  5AVA A;  3WP5 A;  4EN6 B;  4P5H A;  1PO1 1;  4LR4 A;  3BPZ A;  3C7H A;  4OHW A;  5FPA A;  4MXV A;  5FZE A;  1W2O A;  2A73 B;  1O8S A;  3BYW A;  5JXJ A;  4HAN A;  1QWR A;  5IAX A;  3MF9 A;  1R1A 1;  4P9G A;  1WD4 A;  5IJR A;  5C33 A;  1QU0 A;  3ME2 A;  1MVQ A;  3MPB A;  2JB8 A;  4FP2 A;  4D6Q A;  2A6X A;  1FT9 A;  1N47 A;  2B9U A;  2RMU 3;  5I8Y A;  2LM3 A;  4HT1 T;  4BWO A;  5F37 A;  1RUO A;  2R06 2;  4YGD A;  2UYB A;  4RYD A;  2ZGR A;  2A7A A;  4ZPI A;  4GWM A;  4BJ0 A;  3B5L B;  4KL1 A;  1PNG A;  4CCN A;  3VD3 A;  4JKK A;  4CDQ B;  4EV0 A;  4N43 B;  1WZX A;  2WBK A;  1ULC A;  2R04 2;  1YLL A;  2QTW B;  4NAO A;  2VVF A;  2V73 A;  2JX9 A;  2V4V A;  1PX4 A;  2HWC 1;  2PHD A;  3FLR A;  2IXJ A;  1QJF A;  3KWV A;  2MPF A;  5A80 A;  4EJR A;  2FDH A;  3DYP A;  3GBG A;  3I2I A;  3NKT A;  2NQY A;  3UK9 A;  3ZFG C;  4UWD A;  4FPL A;  3AJY A;  4LO7 A;  2BVV A;  1H8V A;  1DQ1 A;  1RUJ 2;  2YY1 A;  3AKQ A;  4OLL A;  4MZU A;  2XH6 A;  4Q0P A;  1YQ5 A;  1F5F A;  1BYH A;  3I59 B;  1OLM E;  4L0P A;  3MV1 1;  2FCU A;  3BU0 A;  1FI2 A;  4AI8 A;  3OPT A;  1HLC A;  3JUU A;  4R9C A;  4YG0 A;  4FPK A;  3RFR A;  2PQQ A;  3T0A A;  2WNV A;  3MEP A;  2CU5 A;  4CUB A;  4E4S A;  3LA3 A;  1I1E A;  2F4P A;  4BU2 A;  3MW2 A;  4Y33 A;  3J7M A;  1O3S A;  2RG4 A;  1UF2 C;  3WQB A;  3H0O A;  3AMH A;  3PVB B;  4D7S A;  2YMZ A;  1WCS A;  4PQQ A;  4FPY A;  2Z4F A;  3HOB A;  3KT4 A;  4XFC A;  3SC7 X;  4QX7 A;  4PI0 A;  3TNQ A;  4EQV A;  1GFF 2;  1LR5 A;  2WWJ A;  4HK9 A;  3WDY A;  1LJ7 A;  4OI0 A;  2ZAB A;  3SKJ E;  1BMV 2;  2Q4S A;  4QQL A;  1OPM A;  1ND3 C;  1UOG A;  3HNM A;  3OGG A;  4NHY A;  1G9D A;  1HRI 2;  1KXG A;  2PLV 2;  1N3Q A;  4IE5 A;  2W9X A;  4JKL A;  5FZO A;  2RMU 1;  4L2N A;  3IKW A;  1UY2 A;  3N7M A;  1H2L A;  3KCX A;  3LPG A;  2JDY A;  1IZ3 A;  1VBC 2;  4Q8L A;  1KRI A;  3ZN6 B;  1PVC 3;  1UY4 A;  1REE A;  3POG A;  1SFN A;  4YVS B;  3WDV A;  4DZG A;  2EIG A;  5ISL A;  4G9S B;  1TE1 B;  4YVS A;  4OQ8 A;  2NZ9 A;  1GZW B;  3AMQ A;  2WFP A;  1NQJ A;  4RSU A;  5CKM A;  4MHR A;  4Q0U A;  2XHN A;  4QB6 A;  4S2D A;  1UX6 A;  1QOS A;  5J36 A;  1JU4 A;  1JOB A;  1YQ8 A;  3WF3 A;  1S0I A;  3SQO A;  1AXZ A;  1OD5 A;  4UW4 A;  4IGO A;  3NV4 A;  1V00 A;  2O14 A;  3GF6 A;  1SHW B;  5IFT A;  3LOI A;  2ZOE B;  1PK6 B;  4IE0 A;  1HRV 1;  2HEY F;  3VKN A;  2XJP A;  2EAK A;  2VME A;  3O0V A;  5T5J A;  4K20 A;  5F32 A;  5KHK A;  3S57 A;  2Z2S B;  3IIA A;  4FFI A;  3LDR A;  2WC2 A;  3WUD A;  1C5I A;  4FAG A;  1T2X A;  1YQC A;  1GNH A;  3V56 A;  4CUA A;  5A3U A;  4FFF A;  5F3I A;  1W39 A;  2J1U A;  4CE8 A;  5FMB A;  4XFH A;  5FZM A;  5I8T A;  3I3Q A;  4HKL A;  2ETE A;  5C9A B;  1ZBE 2;  3K77 A;  3EBR A;  5LA0 A;  5C9A A;  1G9A A;  2OQ7 A;  1X8M A;  3RGB A;  1VBC 1;  2I2S A;  3K3N A;  5ANN A;  1Z7S 1;  2RM2 2;  3WEZ A;  2CWS A;  4TZD A;  1RUD 2;  3FBM A;  4F7Z A;  3DXT A;  4CCJ A;  2FCV A;  2BNO A;  2J42 A;  3O0X A;  3OJB A;  3HBZ A;  2WS9 2;  1XND A;  1Y7B A;  2A6Z A;  4XJZ A;  5ACA 3;  2VMI A;  2R06 3;  4A41 A;  4GH4 B;  1ENQ A;  1K12 A;  3VZM A;  3OUH A;  3OY8 B;  5FUI A;  1Z0H A;  2Y64 A;  3AX4 A;  4RN5 A;  2BPA 2;  5CFC C;  3RZK A;  3NMB A;  4AYU A;  2QQJ A;  1G8W A;  5HV4 A;  1UMZ A;  1AR9 3;  4N7U A;  4NID A;  5DAQ A;  3HIF A;  1LOC A;  2RM2 1;  3CDZ B;  4G4F A;  1AR8 1;  5DDJ 2;  1I6X A;  5FYY A;  2QQL A;  4A7Z A;  1A34 A;  5APA A;  2DVF A;  3RZZ A;  2Q8C A;  3VBR B;  2QZ3 A;  4LIU A;  2Q5T A;  2ZZJ A;  1X82 A;  3WHU A;  4BIF A;  3L2Y A;  1ODM A;  4RL7 A;  1ZA7 A;  4AQ6 A;  1WW4 A;  2WQZ C;  1POV 0;  2WLQ A;  5DZG A;  3WQ0 A;  1XNK A;  2E51 A;  3WNO A;  4HVO A;  5G05 L;  1WW5 A;  4KWL A;  5A3O A;  1PK6 A;  3MV0 1;  2Z42 A;  4P9L A;  4LE3 A;  4PHZ A;  4Z07 A;  2R07 2;  2SBA A;  3DYM A;  1COV 1;  1QF3 A;  1SZB A;  4BB3 A;  2H0V A;  2UWA A;  3LWC A;  5F5I A;  4E4Z A;  3NWK A;  4MSV A;  1OUX A;  4LLO A;  2BRT A;  4H55 A;  4YGB A;  4AI2 A;  2JD9 A;  5C70 A;  5C8C A;  3U78 A;  4AHY A;  2D5H A;  4CZS A;  2RS3 1;  2RVA A;  4QM8 A;  1H2M A;  4YM3 A;  5E1R A;  1MS0 A;  1DCS A;  1Z7S 2;  1VP6 A;  2XJV A;  3KLS A;  4Q4X 2;  3UV9 A;  1AX2 A;  1VBE 3;  3AKP A;  3KZ4 C;  1BK1 A;  4ISR A;  1APN A;  4LK7 A;  5J7M A;  3VL8 A;  4A3Z A;  1ENX A;  4QXK A;  4AR2 A;  4DRV A;  1IPS A;  1XNA A;  3N3H A;  5EJZ B;  4B1M A;  4LMF A;  1ND3 A;  3H7J A;  2QZ2 A;  4EZ4 A;  1YO8 A;  4YFW A;  1XJA A;  2PFW A;  3POB A;  2GP3 A;  1W8N A;  4GAL A;  1BVV A;  4OFG A;  4X6Q B;  2D3R A;  4D7T A;  1QJE A;  2RS1 2;  2WAA A;  4CRQ A;  2JDK A;  1OHF A;  4S2G A;  2X05 A;  3WSO A;  1QKQ A;  4FXK B;  2QE3 A;  4CYD A;  1CWP A;  5A3M A;  2VZR A;  1H1A A;  2XWB B;  4IQP A;  1UXZ A;  1OLR A;  2QFE A;  3SHR A;  1NCR B;  2C26 A;  3B00 A;  1C5H A;  1AR8 2;  3BOD A;  4MOA A;  2BBV A;  3GZE A;  5FPB A;  1VBE 1;  4MH0 E;  5C5T A;  1ALY A;  1WGP A;  1WCQ A;  4HVR A;  5J3U A;  1UWW A;  5JR2 A;  1EUU A;  3OUI A;  3FWE A;  5FZ7 A;  4BLI A;  4KWJ A;  4PLO A;  5DUU A;  4DUX A;  1ZZB A;  2XLG A;  3T09 A;  3LA7 A;  2W87 A;  4I3P A;  3B7M A;  2DF7 A;  5HV0 A;  5A7P A;  4CCK A;  1GP6 A;  2NYY A;  4MXW B;  4AWD A;  1Q8P A;  3LEM A;  3ENR A;  1UYP A;  1W8F A;  5LA1 A;  2PAM A;  1HV0 A;  3E97 A;  3GBW A;  2WO7 A;  2XJT A;  4XEZ A;  4HON A;  4JQT A;  4TTG A;  3MIH A;  5D8A A;  2EAL A;  2ET1 A;  4ATF A;  3UKN A;  1YUD A;  3A4U A;  1RUC 3;  1TMF 2;  4COY A;  4DY3 A;  5BNO B;  2X8K A;  1HDK A;  1FX5 A;  4FTB A;  3IN9 A;  4HOO A;  2BU9 A;  3MYX A;  1QIQ A;  4NWV A;  5GLZ A;  2E7T A;  2VUA A;  4EE2 A;  4AG4 A;  1IS6 A;  2HWE 1;  4RGG A;  4LBQ A;  4TXW A;  3JCI A;  1PZ9 A;  1X50 A;  4AHX A;  1ULG A;  2XOM A;  2YB7 A;  1IGO A;  1PK6 C;  4NIA A;  1QOO A;  3POF A;  4CDU C;  3I8T A;  3K48 A;  4IEQ A;  3RG0 A;  3WNL A;  3DYO A;  5LRS A;  3WXP A;  3WVJ A;  2XDV A;  1L7L A;  3ES4 A;  1X36 A;  5FYT A;  2E33 A;  3OEB A;  3GZU C;  4M0N A;  1YI7 A;  3AYC A;  3HT2 A;  4UW5 A;  4P9W A;  1MS8 A;  4ATE A;  4Z2A A;  2WNO A;  2ZX1 A;  3VHP A;  1DQ0 A;  1HN0 A;  4JGY A;  3A0K A;  4OCT A;  1BBT 1;  4JGY B;  1FXZ A;  3IDA A;  2B5H A;  3ZLI A;  5GZD A;  1VBD 1;  4ARX A;  2WA4 A;  5EP9 A;  2RHP A;  1NY7 2;  2XBO 1;  3PDQ A;  3O1O A;  1LGN A;  1Z7S 3;  3ZFG B;  2C9A A;  2Y6G A;  4KBZ A;  3RVH A;  3AKS A;  1OQ1 A;  1US2 A;  5FCC A;  3UKT A;  2YG0 A;  3HBK A;  1CON A;  2QJV A;  2PLV 1;  2K0G A;  1UMH A;  1BZW A;  1U5I A;  4JZR A;  4IEW A;  1DQ4 A;  2MEV 1;  3OGR A;  1VE0 A;  4PIY A;  3MW4 A;  2JE8 A;  3ZDV A;  4YZ2 A;  1AR6 2;  2DBN A;  5C4W A;  1HB4 A;  4OZX A;  1VRH 1;  2RR1 1;  3WG1 A;  2WAO A;  5BV6 A;  2HWE 2;  2EIE A;  3K51 A;  4JTO A;  1C28 A;  4R4Z A;  4XUO A;  4DFS A;  4DXS A;  1SG3 A;  1JZ3 A;  3MLK A;  5FWJ A;  1W2A X;  1ZZ7 A;  4QMA A;  5LCW L;  1LOB A;  3OTF A;  1MS1 A;  5I0U A; 
#chains in the Genus database with same CATH homology
 3I3D A;  3I2H A;  3NRU A;  3OG2 A;  3A22 A;  3A23 A;  3OB8 A;  3K4D A;  3NJV A;  2R7E B;  4ZZ5 A;  5B4N A;  4A45 A;  4DXT A;  2VMD A;  3C7F A;  1L7R A;  3W5M A;  1JZ8 A;  2W95 A;  2VR4 A;  4MGQ A;  5DPN A;  1F4H A;  2J1R A;  4MGS A;  4CU9 A;  1OD3 A;  3LEG A;  1UYY A;  2X10 A;  4MO3 M;  1JZ4 A;  3A7Q A;  2W5F A;  1EUT A;  3W5N A;  2L9L A;  4P08 A;  2ORX A;  4A4A A;  5HXM A;  1GMM A;  2W94 A;  2J1V A;  4XUN A;  3VD4 A;  5EIY B;  2VCC A;  4QAW A;  3K75 B;  1D7P M;  2W1S A;  4E8C A;  3BN6 A;  3P6B A;  1O8P A;  1W0N A;  3HPN A;  2W46 A;  3SKV A;  1CZT A;  1UYX A;  1L7Q A;  5IFP A;  3WF4 A;  4CUC A;  1JZ6 A;  3OEA A;  2BGO A;  5IYY A;  2VZU A;  2WN3 A;  3HJR A;  5F7U A;  2JKX A;  2WN2 A;  4QB1 A;  3WNN A;  4QB2 A;  2YC2 A;  4KMQ A;  2WO2 A;  3T08 A;  4CVU A;  4LPL A;  3GDB A;  5CYY A;  4XUQ A;  2WUH A;  1GQP A;  2YFZ A;  4W8J A;  4W50 A;  1ULP A;  4UOJ A;  1JZ2 A;  1IQD C;  3CIH A;  5CZK A;  4P02 B;  4ZY9 A;  2CDO A;  1NAE A;  2WQ8 A;  3LEI A;  3T0D A;  3FHA A;  4OMD A;  2V72 A;  2V5D A;  2Y6J A;  3C7O A;  4LHS A;  4P5Y A;  5C71 A;  3OBA A;  3THC A;  2W92 A;  1UY1 A;  3FN9 A;  2YC4 A;  3WF2 A;  3LEK A;  3NJX A;  1OF3 A;  4UAP A;  3C7G A;  3ABZ A;  2B9V A;  4GZ9 A;  2C4X A;  1GOF A;  4DEQ A;  4GWI A;  5J1X A;  2VQT A;  4DUV A;  5HPO A;  1RYY A;  3P1I A;  3I2J A;  4GWJ A;  4QX3 A;  1K42 A;  1GU3 A;  4A6O A;  1UXX X;  1O59 A;  2JDA A;  4QX0 A;  3VD5 A;  3FL7 A;  2X09 A;  1NKG A;  2HYX A;  3C7H A;  1F4A A;  1NUK A;  3OGV A;  1O8S A;  5JXJ A;  2W91 A;  2W1Q A;  3I2F A;  5IJR A;  2E32 A;  2J1T A;  2WZ8 A;  4HG6 B;  2BER A;  2RJ2 A;  4M4P A;  1NX9 A;  4RYD A;  2Y6L A;  3GXU A;  4BJ0 A;  2VQU A;  3C8X A;  3PUH A;  4FI9 A;  3VD3 A;  4JKK A;  2HLE A;  2E31 A;  1WKY A;  2WBK A;  2QBX A;  4BDV B;  2VM9 A;  2V4V A;  1PX4 A;  4BK4 A;  4XVH A;  1J83 A;  1UMI A;  2CDP A;  2ZEZ A;  3DYP A;  4QX2 A;  3I2I A;  2VOT A;  3III A;  1H6X A;  4D0Q A;  2VCA A;  1JI6 A;  5JXG A;  1K45 A;  4AAX A;  4XUR A;  2C9K A;  2EIB A;  4L0P A;  3MV1 1;  3K46 A;  3U37 A;  4DUW A;  4PF1 A;  3J7H A;  4CU6 A;  4A42 A;  2WDB A;  3T0A A;  1W9S A;  1K3I A;  3NNG A;  3T0B A;  4CUB A;  3I2K A;  2W1U A;  1DP0 A;  5I0D A;  1JYV A;  1PX3 A;  3AC0 A;  3VD7 A;  3WQB A;  1CZS A;  1UX7 A;  3LQC A;  4PQQ A;  2Z4F A;  3HOB A;  1J84 A;  2J7M A;  3C7E A;  4OMC A;  2VJX A;  4DXR A;  3SKJ E;  2VMC A;  3HNM A;  1UYZ A;  2QQK A;  2W9X A;  4JKL A;  1UY2 A;  3LPG A;  1US3 A;  3BGA A;  2DDU A;  4YPJ A;  5A1A A;  2VO5 A;  1UY4 A;  5DQ0 A;  1TVG A;  3FHQ A;  4ARY A;  1CZV A;  1W99 A;  1LNS A;  2Y8K A;  4QB6 A;  2XHN A;  1JU4 A;  2BGP A;  3WF3 A;  1DYO A;  1W9W A;  1JU3 A;  1SHW B;  1GUI A;  1GNY A;  1PMJ X;  5IFT A;  2BZD A;  3MUZ 1;  1PMH X;  2QQM A;  3IAP A;  2VME A;  2VZV A;  4CU7 A;  1T2X A;  2PQS A;  4CUA A;  5JXI A;  1P8J A;  4KWU A;  2QQO A;  2RV9 A;  2J1U A;  1JZ7 A;  3NQH A;  3GGL A;  3K77 A;  1H6Y A;  5LA0 A;  1TG7 A;  5JUV A;  4DEV A;  1R64 A;  3IAQ A;  2VCB A;  1KEX A;  3HNY M;  3WEZ A;  3ACH A;  3I3E A;  2J1S A;  3HEI A;  1JYW A;  3WNK A;  3VD9 A;  4XZU G;  3CZJ A;  3WF0 A;  2WO3 A;  2DCJ A;  4A41 A;  1K12 A;  3D3A A;  5FUI A;  2Y64 A;  4RN5 A;  5LA2 A;  2BBA A;  3LE0 A;  2QQJ A;  5G04 L;  3CMG A;  2VMF A;  1I5P A;  3CDZ B;  3CZU A;  2VTF A;  2QQL A;  4P00 B;  1JYX A;  2XON A;  3VDA A;  4M4R A;  3UES A;  1JZ5 A;  2VZ1 A;  3WNO A;  1BHG A;  2J1E A;  5G05 L;  4MAD A;  3MV0 1;  4OUE A;  4W4Z A;  1JHJ A;  1OH4 A;  3ZM8 A;  4QDR A;  2VZT A;  3DYM A;  4ET7 A;  3F2Z A;  2KD7 A;  3E1F 1;  2WAB A;  3ETP A;  5DN2 A;  5C70 A;  2JD9 A;  1GOG A;  4XUT A;  4BXS V;  1JYN A;  4JKM A;  3WNP A;  2J1A A;  2RVA A;  3PUI A;  1YQ2 A;  2VZO A;  3DEC A;  1UY3 A;  1UZ0 A;  3K4A A;  4CU8 A;  3OGS A;  4A3Z A;  4KI5 M;  1CX1 A;  1XNA A;  5EJZ B;  1OT5 A;  2VZP A;  4BK5 A;  3UNP A;  4JX0 A;  1W8N A;  2Y6K A;  2WAA A;  2X05 A;  4A44 A;  3WSO A;  5C7G A;  2W47 A;  2VZR A;  4E8D A;  1UXZ A;  5JXH A;  2QQN A;  2C26 A;  2QQI A;  3T2O A;  4MOA A;  4QPW A;  2VC9 A;  1XNT A;  2VL4 A;  4OYU A;  1XC6 A;  1W8O A;  3GM8 A;  3VDB A;  1WCQ A;  1UWW A;  5JR2 A;  1EUU A;  4QX1 A;  3ECQ A;  2EIC A;  4DUX A;  1KGY A;  2LS6 A;  3ACG A;  3T09 A;  2W87 A;  3I3B A;  2EID A;  3HN3 A;  2WO1 A;  4UI9 L;  3SEE A;  4QDQ A;  2ID4 A;  1ULO A;  5LA1 A;  3SEP A;  5IHR A;  4TTG A;  2VZQ A;  4LKS A;  1XPW A;  1HN1 A;  2J22 A;  4LQR A;  3MO4 A;  2OKX A;  3WF1 A;  2W1W A;  2WZE A;  4XUP A;  4D8M A;  4AG4 A;  2E26 A;  4TXW A;  2DCK A;  2WYS A;  3ACI A;  3I97 A;  3UET A;  4JHZ A;  2XQX A;  3ACF A;  2XOM A;  2W3J A;  2YB7 A;  3CQO A;  3WNL A;  5EJ1 B;  3DYO A;  1DLC A;  2VZS A;  3A21 A;  1UY0 A;  2Y6H A;  3HNB M;  2ZEX A;  2E33 A;  3OEB A;  2ORZ A;  4Z2A A;  4ZZ8 A;  1GOH A;  2LW8 A;  3T2P A;  3MUY 1;  3IB3 A;  3IDA A;  3WNM A;  4IUG A;  3CKH A;  1MPX A;  4ARX A;  2VZ3 A;  4OZO A;  5JMO A;  2B4K A;  2Y6G A;  5DMY A;  3EYP A;  1W9T A;  1US2 A;  2YG0 A;  3THD A;  2ZXQ A;  1UMH A;  1CIY A;  4QDS A;  3OGR A;  5B4X A;  3T2Q A;  2JE8 A;  3JXS A;  3K4Z A;  1OF4 A;  3LPF A;  2WAO A;  1SDD B;  3MBW A;  2EIE A;  2ZEW A;  4PT6 A;  4XUO A;  4DXS A;  1SG3 A;  1JZ3 A;  3I2G A;  2YFU A;  3EB7 A;  5LCW L;  3VDC A;  2ZEY A;  4ZXE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...