3C8XA

Crystal structure of the ligand binding domain of human ephrin a2 (epha2) receptor protein kinase
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
174
structure length
160
Chain Sequence
KEVVLLDFAAALGWLTHPYGKGWDLMQNIMNDMPIYMYSVCNVMSGDQDNWLRTNWVYRGEAERIFIELKFTVRDCNSFPGGASSCKETFNLYYAESDLDYGTNFQKRLFTKIDTIAPDHVKLNVEERSVGPLTRKGFYLAFQDIGACVALLSVRVYYKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ephrin type-A receptor 2
publication title Architecture of Eph receptor clusters.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 30
structure length 160
sequence length 174
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2008-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01404 Ephrin_lbd Ephrin receptor ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 3c8xA00
3C8XA 5C71A 1OT5A 1XPWA 4LKSA 2BGPA 3IDAA 1PX4A 2VZVA 3DYMA 3T2OA 1CIYA 3OEBA 3P6BA 3VD3A 3GXUA 1W99A 4UAPA 3F2ZA 5HXMA 4QB2A 4TXWA 3VDAA 1CX1A 4MOAA 2C4XA 3K4AA 1SHWB 3SEPA 4BXSV 1NKGA 1W9WA 1SG3A 2EICA 2V4VA 1W0NA 2W9XA 5B4NA 3LEKA 4GZ9A 4A44A 3HJRA 1UZ0A 3WF4A 2J1UA 3WQBA 5LCWL 2VQTA 2W5FA 2CDPA 2DCJA 1H6YA 3LPGA 2W91A 5CZKA 2WN2A 3T0AA 2VL4A 2QQKA 4DXSA 1UWWA 3FL7A 3I3EA 4XUOA 4M4RA 4KI5M 1PX3A 4QDRA 3MUZ1 2JDAA 4AAXA 4CU8A 2YFZA 4LQRA 3MUY1 3WNMA 3A22A 4QAWA 3OG2A 3I2GA 1JHJA 2VZPA 4OUEA 1UYYA 2Z4FA 3T09A 4XVHA 3T0BA 5FUIA 4BK4A 2ZEXA 5HPOA 4QB6A 1SDDB 2VZ1A 3I2IA 2KD7A 3VDCA 2QQOA 2BGOA 2VQUA 3GM8A 5JXIA 3NNGA 1OF4A 3W5NA 2EIDA 2VCBA 3CZUA 2OKXA 1OH4A 3IB3A 4P5YA 1L7RA 3OGRA 1US3A 1CZSA 4CUAA 3T2PA 1NX9A 3WNNA 4AG4A 1GOHA 2HLEA 2LS6A 2WZEA 2W92A 4MADA 3WNKA 4OMDA 2B9VA 1W9TA 5F7UA 4A45A 4BK5A 1JI6A 4Z2AA 1CZTA 3GGLA 2RVAA 2JKXA 4ZZ8A 3LPFA 4ARYA 2QQJA 3I2FA 4W8JA 1HN1A 2W94A 3ZM8A 2J1RA 3A7QA 2XOMA 3MV01 2VMDA 3ACFA 3BGAA 1F4HA 1UMHA 1LNSA 3T0DA 4MO3M 1UYZA 4E8CA 1DLCA 1UY0A 1XNAA 3WNLA 4QX0A 2VMEA 2W1QA 4KWUA 1K42A 1XNTA 1UMIA 3ABZA 4ZXEA 1XC6A 2WO2A 4XUTA 1JU3A 3I97A 4OMCA 4RYDA 4JX0A 2R7EB 3CDZB 3WF0A 4QPWA 3DYPA 1W8NA 4A42A 5IFPA 5JMOA 3OB8A 1MPXA 1K45A 2E33A 3UESA 2VCCA 2J1AA 4OZOA 2ZEWA 1PMHX 4JKMA 1JZ6A 3OBAA 4LPLA 2ZEZA 2WDBA 1GQPA 1GU3A 5B4XA 3LEIA 3JXSA 3UNPA 2V72A 3WNOA 4JKKA 1JZ3A 4D0QA 3FHQA 2WO3A 2DCKA 5IHRA 3FN9A 3PUIA 1T2XA 2VZSA 4QX2A 4ZY9A 2J1TA 2VOTA 3WSOA 3K4DA 4DEQA 2VZ3A 2BERA 2YG0A 2VZRA 2X10A 1R64A 3WNPA 4A4AA 2WQ8A 3MBWA 2HYXA 2YC4A 2E26A 4UOJA 3GDBA 3HN3A 3SKJE 4P02B 2RV9A 2WABA 2ID4A 3J7HA 2QBXA 1IQDC 3AC0A 1ULOA 2XQXA 1DP0A 3BN6A 1UY1A 1UXXX 1F4AA 1O8PA 3IIIA 2J22A 2Y6LA 2J7MA 4MGSA 3CZJA 2EIEA 2ORZA 2L9LA 5I0DA 4XUQA 2XONA 5CYYA 4M4PA 2Y64A 2E32A 1EUTA 4UI9L 3UETA 2XHNA 3VD9A 1EUUA 3LQCA 2WAOA 2E31A 5J1XA 1JZ4A 4BDVB 3T08A 5JXGA 3DECA 2C9KA 1J84A 3C7FA 3I3BA 3U37A 3NJXA 3I3DA 3ETPA 4JHZA 2QQLA 1P8JA 5IFTA 1JYXA 2VO5A 2YFUA 1BHGA 2RJ2A 3CQOA 3LE0A 5DQ0A 3CKHA 1D7PM 2ZXQA 1O59A 2J1SA 2WUHA 1TVGA 1YQ2A 2X09A 3THCA 4QB1A 3OGVA 1H6XA 1W8OA 5G04L 2QQNA 5DPNA 2EIBA 1NAEA 2VTFA 3HPNA 1UY4A 3VD7A 5LA1A 3ACGA 2W46A 3E1F1 4XZUG 3MO4A 3PUHA 2PQSA 2W87A 1UY2A 4IUGA 4DUXA 1PMJX 1WKYA 2WN3A 2WO1A 3MV11 4ZZ5A 2WYSA 3C7GA 3VDBA 3WF3A 4HG6B 2VZQA 2V5DA 3HNYM 3SKVA 1CZVA 3ECQA 2VM9A 4W50A 2BZDA 1OF3A 4CVUA 2W47A 3IAPA 4D8MA 1OD3A 4MGQA 4XUPA 4BJ0A 2Y6JA 2YC2A 1JZ5A 4GWIA 2QQIA 4TTGA 4L0PA 4QX3A 5DN2A 2QQMA 3I2KA 3K4ZA 1GMMA 5LA2A 5C70A 3NQHA 4GWJA 4P08A 2YB7A 2B4KA 2WAAA 3THDA 3C7HA 2W1UA 3VD4A 3HNMA 3OGSA 1JZ2A 1W9SA 5G05L 2VMFA 4DXTA 3IAQA 2J1EA 4W4ZA 2LW8A 3EB7A 4CUBA 3K77A 3P1IA 4FI9A 4CU9A 3VD5A 2Y6HA 3HNBM 3A21A 1JYVA 3A23A 2WZ8A 3K75B 3T2QA 1GNYA 1ULPA 4PT6A 2W3JA 4RN5A 2W1SA 4P00B 3OEAA 1GUIA 4ARXA 3FHAA 2Y8KA 4PQQA 1US2A 2DDUA 2VMCA 3K46A 1O8SA 2VCAA 3HOBA 3I2JA 4OYUA 1UYXA 1JYNA 5IYYA 5JUVA 5A1AA 2JE8A 5JXHA 2VJXA 4CU6A 4LHSA 3DYOA 4DUVA 4E8DA 5EJ1B 4YPJA 2VC9A 3WF1A 2X05A 4CUCA 1JYWA 1TG7A 5JXJA 2BBAA 4XUNA 3NJVA 5IJRA 2J1VA 5C7GA 1WCQA 1UXZA 4DUWA 2JD9A 2VR4A 3ACIA 5JR2A 4QDSA 4KMQA 1L7QA 2Y6KA 4QDQA 3WEZA 2CDOA 3C7EA 2VZUA 1UY3A 1GOGA 4A41A 3D3AA 3CMGA 1I5PA 2ZEYA 4XURA 3EYPA 3WF2A 3ACHA 3SEEA 2Y6GA 1JZ8A 2WBKA 1K3IA 5DMYA 1KEXA 4JKLA 1JZ7A 4DXRA 5EIYB 1K12A 1UX7A 3HEIA 4QX1A 2ORXA 2VZTA 4A3ZA 1KGYA 4DEVA 2C26A 3W5MA 3CIHA 1GOFA 4A6OA 2W1WA 1DYOA 3LEGA 5EJZB 5LA0A 4CU7A 2W95A 1NUKA 1RYYA 2VZOA 1J83A 3C7OA 1JU4A 3NRUA 4ET7A 4PF1A 3I2HA
chains in the Genus database with same CATH superfamily
4DY3A 3VB9A 2Q5TA 3FUOA 3C8XA 4G3YC 2Y38A 3H1MA 5CFDB 1VMHA 1XPWA 1WCKA 3DPRC 3POEA 1IS5A 3AP5A 1PX4A 2NQYA 1SFYA 5A3MA 1FPN2 2XJVA 4CDWC 4AOCA 2IUWA 5DABA 3ZO0B 1B35C 5A32A 3N9LA 3WINE 3U14A 2QQPA 2XKOA 4LBQA 2LUWA 1JUIA 3VD3A 3T2TA 4RHV1 3GXUA 4K8RB 1W99A 5CVRA 4QU1A 4FP3A 3MICA 1UZWA 3F2ZA 1AR92 2WFF3 5HXMA 1CWPA 3OD0A 4QB2A 4RS5C 3VKNA 5FQ0A 1CX1A 3ZSJA 3V0BB 4BOWA 3VKFC 4BXSV 2ZHKA 4NOTA 3TOJA 5IVEA 4QQHA 2Q8DA 1W9WA 3GF6A 1FMD2 2R043 2R073 3U10A 4Q4Y3 2JDZA 3ZOIA 4AL9A 5GZGA 5B2GB 3LEKA 1FAYA 1GV9A 4YVWB 4CP1A 4A44A 4HFSA 2AENA 5C4WA 3WF4A 2Z79A 3CF6E 4ISRA 4GA9A 2K0GA 2QTWB 2JDHA 2VQTA 4MV2A 5LCWL 1MVEA 4HVOA 1GZ9A 4FAGA 5FZHA 2XL7A 1ULEA 1J3QA 2QZ3A 2Y26A 5JSPA 3QLQA 3T30A 3VKLA 2W91A 4Q4X2 1LULA 3DPRA 1HXS1 3JD72 5BV6A 1V00A 2ZA9A 2QQKA 2WQ4A 1UX6A 4CDWA 3MPPG 1KFXL 3AFGA 3I3EA 4D7TA 2EAAA 3D82A 5KC5A 2HWE3 3OCPA 4M4RA 2WYFA 4KI5M 4TLFA 2GNMA 2QNKA 1PX3A 1PGSA 2V73A 3EO6A 4BQXA 1FOD3 4NRQA 4KU7A 4Q4V2 4Q26A 3LAGA 1BK1A 1OLME 3K3OA 4RS5A 4QAWA 3U4SA 5FMBA 1GR3A 1WGPA 5KHHA 3PDQA 1HRI2 1UOFA 2XUMA 3IDBB 3ZYJB 2W52A 1OLRA 2YU2A 3T09A 1WBLA 4LE4A 4PI2A 4XVHA 3FJSA 3T0BA 3W59A 4BK4A 1W6PB 4Y1VA 2JEMA 4LO4B 5JPMB 1N1SA 1R091 1N1TA 1UMZA 1X33A 3ZKYA 2KD7A 2PHWA 4XFAA 5A3PA 3AXEA 1J3PA 3LA3A 4B1LA 2R063 2ET7A 5AC91 3I2DA 4FOYA 4O7XA 4XMAA 3S7IA 2EIDA 3ZSKA 1QJX2 2LTNA 2XPJA 3CZUA 1WD4A 1Q8PA 2OKXA 3IB3A 1RUNA 5E16A 3GCXA 1AYN2 1CZSA 1NG0A 5FTTC 1NX9A 4AG4A 2LRPA 1GOHA 1PGW1 4XFGA 4AGGA 5AFEA 1KD7A 4OUSA 3LFMA 4CCCA 1UL9A 2VH9A 2WNUB 5FO9B 2W92A 5L7OB 1VP6A 4MADA 4W6XA 5CG9A 1O3SA 2ADEA 4RFRB 1VBD3 2B9VA 1YC61 4EQVA 2AC1A 4MX3A 3SH4A 3KV9A 5LA9A 4CDXB 2NMOA 5KWRA 2RVAA 4EN9B 5JSRA 5KXDA 3I3MA 1YFWA 2E63A 2W94A 3ZM8A 3OD4A 1SLBA 3H1YA 3A7QA 3VBFC 1Q8OA 5IWFA 4AVSA 1ZBE3 1C8NA 5FLIA 1OUSA 3ACFA 1G9CA 3TBDA 5CBLA 1UMHA 2FCVA 1YFYA 1SZBA 1UYZA 2AEZA 3RJRA 2DBIA 1QJFA 1W2AX 3THPA 2D5FA 3IZOA 1RINA 2W1QA 2NN8A 4KWUA 4PLOA 2F4PA 1V6JA 4XC9A 2JDYA 3WXPA 3LFIA 4I30A 1XC6A 2UWAA 2RMU2 4P9JA 4QGLA 1JU3A 4OMCA 3ZMOA 1GWLA 2ZGLA 2ZS6B 3S30A 3OUJA 3AZWA 1S4CA 2QJVA 4BA6A 2JKBA 1X50A 4YW4A 3VGIA 1O4YA 2K2SA 3OBTA 3A0KA 1DFQA 5EPAA 2CNAA 2DTYA 1AR83 3QCWA 2EXJA 1W8NA 3WF0A 2JG8C 5FYIA 1OLMA 2E33A 2QVSB 4U36A 4GXLA 2VCCA 5IK7A 2GN3A 3B01A 1XSRA 1YRZA 5LB6A 1W2NA 5LRRA 1JZ6A 2WA4A 3J4UH 1ND2C 1WCUA 1BVP1 1PIV2 2ZEZA 5C33A 4I0BA 2D7FA 2OQ6A 4BIOA 3VBFA 1JODA 3QOPA 4R4ZA 3UK9A 2ET1A 3E5QA 3OGGA 1LECA 1VBB1 3JXSA 3FZ3A 3SQOA 3WNOA 2HWB1 3HBKA 1LHUA 2Y6FA 4LUMA 3RZHA 3ZXGA 1LEMA 4GALA 1GQHA 2O1QA 2QQVA 1JHNA 3BODA 1AX0A 3HVDA 1T6BX 2JIJA 1RUD2 4NWVA 1ENRA 3FN9A 3VZMA 4UW4A 1GLHA 4QX2A 4Z92B 2VOTA 5KHKA 3K4DA 1EAH1 1W39A 1B09A 1RUC1 5JZGB 2UURA 1MEC1 1WD3A 3CNAA 4Q4W3 4KBZA 4LIUA 1QJU3 4N7IA 4PBOA 1WMEA 1S0DA 2H6BA 4UWDA 3H42B 2X10A 4QKFA 1R64A 4TLGA 3TN92 3WNPA 1GNZA 1ND3C 2D3SA 1G8WA 1RVF1 3MBWA 3RJ2X 4B3NA 1IQAA 3ENRA 1GWMA 3RZJA 2E26A 2YU1A 2Y60A 4UOJA 2JG8A 3GDBA 3HN3A 2P5BA 1Q8QA 1H4GA 2RV9A 4Q1RA 2WABA 3POGA 2A71A 1WLTA 4Y22B 1DZTA 1JOBA 4FFFA 5T50A 3WG2A 4WVZA 1IQDC 3D0JA 1DIWA 3AC0A 3ZFFC 5BNPB 3JU9A 1EPWA 4JGZB 1VR3A 1AF9A 4A2UA 1AJOA 1ND2A 1KS4A 1LTEA 1W6QA 1WMFA 2ARBA 1OOPC 4XQDA 2P37A 4OLLA 1Q5OA 2WL1A 3IIIA 4JC1A 1SBFA 2GAUA 5F5AA 5FUPA 3ZN4A 1Q3EA 3ZPYA 3JBG1 3O14A 2W2IA 1RC6A 5EYXA 3O1OA 4EN8B 4MGSA 4AFCA 2JXAA 2VU9A 2GNTA 3CZJA 3CJIB 2EIEA 4IEPA 2VW2A 1DHKB 4LOTA 2D6MA 5LK5A 3WG3A 1PO13 4KGQA 5HCBA 2JE7A 2JX9A 1S0IA 3LWCA 4TYSA 2P2KA 5K7PA 5DDJ3 4XUQA 1RMU1 2XONA 3LCPA 3LGRA 5CYYA 3WQ1A 3AM2A 3WZ1A 3ZXDA 5A3TA 4UI9L 3UETA 1QJY2 5FPUA 5C8CC 5CA6A 2WAOA 3JB4C 2E31A 4LO5B 1H2MA 5J1XA 2OUHA 5BNNA 1LR5A 2E7AA 4FPJA 1OBNA 1ND3A 4CPBD 1AR91 3J9SA 4BH9A 5BUVA 4EZ4A 4LLFA 1Y43B 4LA3A 3N9MA 4PHZA 3RYPA 3I3DA 4YARA 4LIVA 1P8JA 2WQZC 2UY9A 5IFTA 4X6QB 5IK5A 3POJA 3Q8AA 1BHGA 3WR0A 1ZZ7A 3ZFFA 5BNQA 2PAMA 1O3TA 5HXVA 1W6NA 2ZGRA 1SMVA 4NHMA 4AF9A 2BBVA 4NVPA 2ARXA 1OOPA 4IEUA 3U75A 4FO9A 2XG3A 2JE9A 3T4VA 1ZRIA 1TVGA 2XBO3 1REDA 3QH7A 4FQZA 3AKPA 3VZNA 2A6YA 2JG9B 4K21A 5LBFA 4QB1A 1H9WA 3OGVA 1IKQA 1HQWA 4LKFA 1SPPB 3VD7A 5DAXA 5LA1A 2Z42A 1OFNA 3M7AA 4XOGA 5F8PA 2RJLA 2W46A 4CCOA 2PFWA 1SCSA 4MHRA 2GC1A 1W06A 3PUHA 1TNRA 2PQSA 5C8CA 2BNMA 2VECA 5GKAC 1LGBA 2LALA 2WO1A 1D0HA 4V2WA 3HT2A 2VY0A 4KG8A 4ZZ5A 4DRRA 3BIWE 1X8MA 1LGCA 2D97A 2X5IC 2AZ5A 5E6HA 5EFUA 5T5PA 1O5LA 1OURA 1S0FA 1CAUA 2KXLA 3KT7A 4AQ6A 5A3UA 1HRI1 3J7NA 1O7FA 3OYWA 5JR7B 3TRSB 4NIDA 3NAPB 3S57A 3ECQA 3TEWA 4MHUA 4W50A 4IV1B 2VD7A 3NVCA 1NZIA 1ULCA 1Y3TA 1YYNA 2BW8A 2WT1A 5BNOA 4RL7A 1BEV3 1OA2A 5EXOA 4QPGC 1CAXB 2OZ6A 3R0RA 5KC6A 3WDUA 4ASKA 3MLJA 4XUPA 4F83A 4WM8B 2I74A 1AR72 4UBHA 2R0HA 4EYUA 2GC2A 3VHPA 4XQ4A 1DGLA 1AYN1 4L0PA 1ZNPA 2KA3A 1PK6B 1REEA 1EPZA 1YFUA 3LOBA 2IXJA 3NL1A 2ZGNA 5F37A 2QQMA 1JYIA 1ZRCA 1HJGA 4X8PA 2B4KA 5L73A 2RS53 2FDFA 2ARAA 4YLZA 3THDA 3C7HA 4CEWC 2E9QA 4GULA 3PJQA 4AFBA 1JZ2A 5JIAA 1W9SA 4YG0A 2X5IA 4CSWA 1RUE2 3NNLA 4K3UA 5G05L 2RDQA 3WT3A 4BIFA 5K0UB 1SLAA 3E6BA 5FREA 4XPVA 2HBTA 1A8MA 4WVMB 1OI6A 2J1EA 1MS0A 2LW8A 4IQPA 2W08A 4CUBA 2JDMA 3C2UA 3P1IA 2DU0A 2PXJA 1RXFA 4QXKA 3UT0A 2Y6HA 4FCAA 4M0HA 5FXWA 3DXUA 2KR2A 1BYHA 1RUH3 3LOIA 4MUVA 2NLRA 4XTPA 1ZBA3 4G9SB 3WX5A 2ARCA 4QPGA 3H3UA 4DO0A 4UF0B 2DFCA 5JI7A 2W3JA 2ILMA 2WZR3 4XEZA 2RM22 3B94A 2RMU1 3LEMA 4P00B 4FBFA 1KJRA 2LROA 1K5MC 4QGNA 2BQPA 3GBFA 4JDOA 4CDUB 3WDYA 3FLRA 3ZYPA 3IPVA 4ZXKA 5J98B 3WVJA 2RS13 5ABJC 1CJDA 1O8SA 1QQP3 2SBAA 3AMNA 3PL0A 1ZYBA 4RR3B 4ATEA 3I59A 4EZHA 1UYXA 5FZGA 1CJPA 3HQXA 3ASIA 3PJYA 3BTXA 3O1UA 5FYCA 2P6CA 1C8M2 3BTAA 3ZYGA 4CEWA 4GB33 3MHZA 2FDGA 3CJXA 5A3WA 1YQ5A 4J1XA 4WM7C 4E8DA 5FZ8A 3ZXKA 1PIV1 1TME1 3FX3A 1W3VA 4YRDA 5FZIA 1NE6A 1XQNA 2VC9A 3NJZA 3WF1A 4NIHA 4YNIA 4CUCA 3ZFGC 1F5FA 4ZKTB 5ANNA 4PIYA 4MSVA 4MGTA 4IW3A 5IJRA 5FP4A 2EIGA 3AX4A 1WCQA 4LHKA 4EE2A 5K4LA 2JD9A 1IS3A 2HWF2 2VR4A 5C3PA 4XIKA 1VAKA 5EZWA 4CXXA 4UXAA 1VBC1 5FK7A 1W3XA 5L9VA 2Y6KA 4QDQA 1A78A 1PGL2 2CDOA 2A6ZA 3C7EA 4MH0E 1S0CA 2ZHNA 2VZUA 1GFF2 1UY3A 4A41A 2WS91 3PIGA 3NSTA 3IDEA 1K5MA 3PVNA 3WW1A 4YVSB 1OQDA 4BQ2A 3UJOA 2PHFA 1VBE3 5ABJA 2WT2A 2GC3A 5F5CA 4QKBA 3VZOA 3VBHC 1EP0A 2Q8EA 3BU0A 4XBLA 3PMEA 2Z2SB 1MVQA 2FDJA 1N3PA 1XNDA 5T3NA 3HAGA 4AGVA 4IEZA 1DDLA 4JKLA 1JZ7A 4UFKA 5FZ1A 5DG2A 2QKDA 4JRLA 1ZRFA 4BQ5A 2ZGPA 3AL5A 4IEOA 1D2SA 1C3HA 1K12A 4XFBA 3N7MA 5LY2A 2HWC3 3HEIA 4WM7A 3GZEA 2ZZQA 2XGXA 4LORA 2C1FA 3OF1A 4KL1A 1UCXA 2VZTA 4Y4YA 1MQTB 4JZRA 5FYZA 2RR11 4NROA 3RI8A 4QM8A 3W5MA 4E2GA 3I8TA 3CIHA 4NAOA 1VBA1 1JOPA 1GOFA 1TQ5A 1VAVA 3ZFGA 3UKNA 4HXCA 1DYOA 2RS33 3LEGA 4KU8A 3I3QA 2IVIB 1XNCA 2PHXA 5FY7A 3C7OA 3DCQA 3JQWA 2JECA 4GAZA 3O0WA 3WW4A 5A33B 4E4SA 5A3NA 4E9KA 1OPMA 4WBBA 3TB0A 1W2UA 3I2HA 4ATFA 4K20A 2PMWB 4F8AA 5J3UA 3ROUA 2FDHA 4JTOA 3SH5A 5C71A 4C0HA 3OUIA 1W6MB 2FCUA 3ITQA 1UPIA 3ZXLA 1UKRA 1R1A2 3IDAA 5DAPA 1DZRA 4YZ1A 3VBHA 3N36A 4XAEA 3DYMA 1ASJ1 1V70A 1NQDA 5DAVA 5ISLA 4KH9A 3OEBA 1ULFA 4YFZA 4BK5A 2IXKA 1V6KA 2GALA 3LKJA 2D98A 3ALQA 3ELNA 4PIXA 2B9UA 3FFZA 4R9BA 3EXUA 2W68A 3QBQA 1RHI2 4EJRA 3WP4A 4YWAA 4UAPA 4GKYA 2ZKNA 5A3OA 2XVGA 1VRH3 2BU9A 4HK8A 1U12A 4X6RB 4IXLA 4JHTA 1NKGA 2CYFA 1RTVA 1OA4A 1VALA 3MIHA 4I01A 5A7WA 2WFF2 1J3RA 4COZA 4BWOA 2FBEA 1WBFA 2W9XA 5I8TA 5B4NA 2G4IA 3DF0A 1S2BA 3K48A 4EN6B 2DUOA 4Y1XA 2MEV2 1F8VA 1TE1B 1D2QA 2A3YA 2J1UA 2R042 2R072 4Q4Y2 3RFRA 1LODA 3UKTA 1XYPA 3WQBA 1LEDA 2VVEA 1H9PA 5FYMA 2UYBA 1R083 3EHKA 2AACA 3ORJA 4FPOB 4HT1T 5IVYA 1GICA 3POIA 3VV1A 2XQRA 4FQ4A 3BALA 1KITA 2VPVA 3KQ4B 2P4EA 2P3KA 3LDKA 3T0AA 3VBUC 1PVC3 4BPZA 1JYCA 4GJZA 4Q0SA 1FT9A 5FZ6A 1EYBA 5FZ7A 4TN7A 4XUOA 2HEVF 3OBZA 1DLLA 3SLIA 1AXZA 3D4KA 3M3CA 4LO7A 4QDRA 4HETA 1HRV1 1LOFC 4DNYA 2JDAA 2P6HA 2HYKA 3D5OA 2YFZA 3N9NA 2FQPA 2EAKA 1JH5A 1AX2A 1RUG3 2HWE2 2WKKA 2DCYA 5DG1A 3WNMA 5JSOA 4W65A 1FNYA 1ONAA 1VB2A 4GWNA 1O3RA 2VZPA 1FOD2 1VJ2A 5T55A 3USUA 2A5ZA 4CDQC 4OHZA 1UOGA 2TUNA 3NNMA 3ZR6A 1G9FA 5LEJA 1HQNA 5HPOA 4GH4C 2E7QA 4QB6A 1SDDB 1DQ6A 3E6DA 3LF7A 3OPTA 1DQ0A 3MIEA 4QMAA 4W6WA 3CLPA 3WW2A 5F5IA 3PUQA 1QJEA 4NAMA 4MZUA 4V2VA 2QQOA 2VQUA 5CKQA 4Y33A 4HKLA 4YGDA 5M0TA 2VOKA 5FLHA 1MR5A 5FZOB 3W5NA 2VCBA 3VBSB 1WW4A 2UWCA 4LHNA 2R062 2IXLA 1US3A 4CUAA 4NIGA 4RHV3 3WNNA 3VBUA 2NM1A 5KHJA 4PLMA 2HLEA 1EY2A 1IPJA 2LS6A 2ADDA 2PHDA 2YGMA 3MW2A 4F3JA 1OLQA 2I45A 4OMDA 2VUDA 2JD4A 4PJYA 1W9TA 4YW7A 2OS2A 4M0NA 1LOFA 1LESA 3GGLA 2VG9A 3NO8A 2VQAA 4Y20A 1QOOA 4YM0A 1KFUL 1MZ5A 5EV7A 4RFT0 4ARYA 1VBD2 4CP0A 5FV3A 1HN1A 4E27A 1W90A 2ZAAA 2ZX0A 4IEXA 1AL21 2J1RA 4CDQA 1BZWA 2XOMA 3MV01 5JOYA 5FCCA 5JMCA 3BGAA 3BUCA 3KVAA 1GBGA 5JOZA 1LNSA 3DL3A 4MO3M 4GH4A 1DLCA 2VCMA 1OPOA 1JMUB 5JPNB 1LHWA 1ZBE2 4RSUA 2XH6A 4YZ4A 5LEKA 1HXS3 3DUIA 3MF6A 1PHMA 4FFIA 1VMJA 3VDDC 4ZZ8A 3VZJA 2UYAA 4QD2A 3ZSLA 1NCRB 1UMIA 3ABZA 3OBRA 5LWBA 2VMHA 4CCNA 5E89A 1TMF1 2X8KA 3I97A 4L2NA 4RYDA 1W28A 2R7EB 2XB6C 1UU4A 1OSGA 2RJKA 3INAA 4JV4A 4QX7A 4XF4A 4AEDC 4CUGA 3UL2A 1QOTA 5L9BA 4HPKB 3O1MA 1ZM1A 4CYDA 2WR9A 4DOUA 4MG2A 1K45A 2YGLA 3FMGA 1AXKA 5A6XA 3ZKUA 1UOBA 2GMEA 5FYVA 4AXOA 2ES3A 1AR82 1NXD1 1PO21 2IVJA 1Q56A 1W05A 4JKMA 2HWF1 3RS6A 1R093 3OJBA 2WDBA 3V0AA 1W6MA 2YC0A 3CU7A 3KSCA 3JB8A 2VXJA 2VGDA 2O0OA 4N53B 4N43B 4OI2A 3LEIA 4HVRA 2DVGA 5I0RA 2ETEA 5AC93 4AQSA 1YJKA 1J59A 3WW3A 4PIZA 4AEJA 4D0QA 4KWLA 2ZACA 3ZDVA 2DCKA 4XFHA 3IWZA 3VDDA 4BCUA 1VE0A 1CX4A 4XDQA 3WSOA 4RD7A 1CAVB 2XR4A 4HOOA 1ENQA 1ZRRA 4NMIA 5D1IA 4ES9A 3RG0A 2OYZA 2DFBA 3PMSA 3H8OA 1PMIA 4G4FA 5F3EA 4AEDA 1DBNA 1UU6A 2VOVA 4ITCA 4XBNA 3BTZA 1LENA 2HYXA 2X29A 3NV2A 5KXCA 1CVNA 3IDCB 1ZREA 4Q4W2 4BZ4A 2GU9A 3RSJA 1QJU2 1LOGA 1B35A 3SKJE 4P02B 1YXWA 5CB7A 2WLQA 3M3EA 5GLZA 1D0GA 3M3QA 3J7HA 4C1WA 5IATA 2QBXA 2XQXA 3HT1A 1ZZ6A 1DP0A 5FBJA 5FY9A 3BN6A 1UY1A 2JIGA 4JQRA 2VNOA 5AFBA 2VUJA 3BOPA 1GWKA 1AR61 4FSJA 1F4AA 1O8PA 4PDWA 5FP7A 4A3XA 2RDNA 2Y6LA 2VBDA 5CKNA 1NCQB 1BXHA 1REFA 3BYWA 1N1YA 3MLKA 4IGQA 1V9U1 1WA6X 4N8MA 2WWUA 3BI3A 3N7KA 3AVRA 1VIWB 5CNAA 3H50A 1R1A1 2L9LA 3VN4A 4CA9A 5I0DA 1POV1 3R4SA 2Y64A 4XF9A 1QNWA 1PO12 1EUUA 2YPJA 2VBPA 3LQCA 3E97A 4PDWC 5EP9A 1RHI1 1RL3A 4QQPA 4DS0A 2WWSA 1AZDA 1LOAA 3IT8A 1AYM1 3T08A 4DZGA 5JXGA 3U4XA 2DCZA 1BJQA 2WNVB 4R9DA 4UW5A 1J84A 2VUAA 1X36A 3C7FA 3PHMA 1DGWA 1V0AA 2A6VA 4QKNA 5FY4A 3NJXA 4XHXA 5LBCA 1N1VA 4LE3A 3ZFEC 4JHZA 3JUUA 1H8TC 3J26N 4B4RA 4YFWA 1HV0A 2BFUS 3J8F2 5DZFA 1COV1 1DF0A 2QDRA 4CP9A 5CFCB 1VBB3 5ACA2 4JDMA 3GALA 5H9PA 2HWB3 2PQQA 4M3CB 5DQ0A 2G19A 5I0TA 4URAA 5A7SA 5FYSA 2MEV1 2ZXQA 1OUXA 1O59A 4Q0PA 4AYUA 5CG8A 4IV3B 2J1SA 3VKMA 1U5ZA 5CFDC 2X09A 1W6OB 2C6SA 4OZXA 4DFSA 3SXWA 1GZWB 1EAH3 4S2DA 1QY4A 1SLIA 2EIBA 2QQNA 1RUC3 1UY4A 1MEC3 2XBO2 4C8DA 3E1F1 2B46X 1ZX5A 3ZPOA 1Z7S1 4Y3OA 4P9IA 4XZUG 3MO4A 3O7OA 4L97A 4COVA 4ORFA 1RVF3 3U07A 2DTWA 3POBA 4NN0A 5FP9A 2WZPP 3PU3A 5FLJA 1RUJ1 3MV11 4IEVA 3WV6A 4XE9A 3KCXA 1ULGA 2YUEA 3GZTB 4IDZA 4D69A 1IHMA 5FZEA 5DXDA 2XJSA 2CAUA 1HV1A 3MLLA 4RGAA 3FBYA 2V5DA 4IGOA 4CXWA 3ZFEA 3HNYM 1O5UA 4YVWC 4B7KA 2ZCWA 1H8TA 1RGSA 4UFIA 3AZVA 1OC1A 4XETA 5JIUA 1VB4A 4Q29A 2JJ6A 4B1MA 1JXNA 3JBG3 5K9YA 2VM9A 3DEMA 4CZSA 1UO9A 4ASLA 1ENSA 4Y4RA 1DQ2A 1OQEA 4QHBA 4HSLA 3ZMNA 3ZYHA 2FDIA 1N47A 3ETQA 3I7DA 4LTAA 2F17A 1MS4A 3WDWA 2RDSA 2W0XA 1IS6A 4JAAA 5CFDA 4UW3A 1RMU3 5HI0A 3MIGA 4MGQA 2FHRA 3L9JT 1EV11 2VUCA 1XYOA 2QDNA 3VL8A 3WQ7A 4BJ0A 5F1RA 3O1RA 3KM5A 4PI0A 1BEV2 2YC2A 2EXHA 4ES8A 1JZ5A 1XE0A 1GQGA 5A6YA 4TTGA 3H0OA 2D6PA 2ZTNA 2HWD2 4ISQA 4QX3A 1QHDA 5FZBA 3NW4A 4OI4A 5FZKA 4AQ2A 4F7ZA 1AR93 1GP5A 4HONA 3I2KA 3ES1A 4XJ9A 3SCFA 2YB7A 2DBNA 3O5SA 2OT7A 3KGZA 3KQRA 4JGYB 2JWPA 4FOWA 1RXGA 4NRPA 3CBNA 5C5UA 2IXCA 5F6LB 2BDRA 3V0BA 2VTXA 1NCQC 3OGSA 4M3CE 4W6YA 2CGNA 1NY71 3CEWA 5HV4A 5FZ4A 1LOEA 4HVQA 5FIXA 4MXWB 2RS52 1CONA 2IXIA 1S0GA 2NPIA 4YVWA 1CAWB 3ZSEA 1LCLA 2SLIA 3H8UA 4W4ZA 1X82A 5GLVA 3EB7A 3O1VA 4QXHA 3K77A 1RUI1 1UF2C 3BCWA 2PLV1 4EN7B 3KV6A 3A21A 2BNOA 4FPYA 3OPZA 1UZYA 2Q1FA 4HLTA 1LU2A 5H9QA 3R4DB 3T2QA 1XB9A 4I3GA 1M4WA 4LA2A 4MGZE 4QKDA 4KGGA 2GP5A 2ZGTA 1RUH2 3J7MA 4RN5A 5C3SA 1ZBA2 4XJZA 2W1SA 1OVSA 3I4IA 3WG1A 5L7OC 2WNUC 1VMFA 5F39A 4ARXA 2UWBA 1URXA 3SITA 1HJFA 4PQQA 4Y24A 1US2A 4WV8A 3K46A 1WW5A 3KF3A 4XJWA 5FWJA 2VCAA 4CDXC 1FPN1 3I2JA 4MGKE 3AB0A 3M70A 1HRI3 5IYYA 1WMXA 5CU1A 2P34A 5I93A 1JOJA 3BU7A 4DPNA 5A1AA 1QQP2 2VJXA 4L99A 4CEYB 4N9IA 1NCQA 3AYCA 4CU6A 1JUHA 2DU1A 3KHCA 2YXSA 1W0OA 3DYOA 1Y9MA 5DUVA 3RZZA 3S5QA 1BLZA 4YPJA 1GNHA 1W6PA 2ZZJA 5FZCA 3O1PA 1DU3D 3N3HA 1QXPA 2AUYA 2YBSA 2ERFA 2X05A 1TG7A 5FZLA 2BBAA 3NJVA 1JBCA 3NWKA 1FMD1 4FVVA 1YQCA 2YBKA 5FMOL 2J1VA 5LATA 5C7GA 3JCIA 2ZAHA 3E5XA 5FZ0A 1IPKA 4IETA 1HB2A 4AK3A 1AYN3 3ACIA 2TBVA 3LD8A 3WEZA 3UGHA 3SHRA 1HDKA 2DVAA 3UGGA 3VBOB 1ODMA 4KG0A 3GYDA 4XQWA 4GD4A 3D3AA 4ASMB 5LZ6A 2BUKA 4YW3A 5BPXA 5L7OA 2WNUA 3CMGA 4HMZA 5FZMA 5TSWA 4Q4X1 2IFRA 3APBA 1Z78A 1XNKA 3JD71 4H14A 4QQLA 2CHHA 2E53A 2ZMLA 1K3IA 1TNFA 4BLIA 4XJ8A 5FPVA 4CDXA 5CISA 1QXRA 4PF5A 4DIQA 1BMV2 3DKWA 2TNFA 2XVKA 1KEXA 4LBKA 3VBRB 1VBE2 5A1LA 4MYEA 3CHXA 5EIYB 4OHXA 5A1FA 1S0EA 3JQXA 3D0SA 3P5BA 4Q4V1 1I3HA 3DN7A 3KLSA 4QX1A 3AL6A 5T5LA 4OFGA 2C26A 1MZEA 1HN0A 4ZU5A 2HWC2 3EBRA 3PURA 4R8HA 4IEWA 1F5JA 4CTEA 3AMHA 4FFGA 5J48A 2RMU3 4YM3A 5FYUA 2VZOA 1XJAA 4AFAA 1WUVA 2G9FA 3NMBA 4XXAA 1YQ8A 2PHLA 4NHXA 2RS32 5SV5A 5JZGC 4Z07A 1N3OA 4PF1A 3AMPA 4ZU4A 3D6EA 1D4VB 1OT5A 1QJX1 4AVCA 5DAQA 2B8MA 1IPSA 3KD4A 5BYNA 3QACA 3PVBB 2AGSA 4LBMA 2NZ9A 4LKSA 4FPCA 1LHNA 3RZGA 4NJ4A 1YCIA 2BJSA 3FE5A 1CIYA 4NO4A 1NA1B 5I8YA 4QPIB 1PIV3 1TME3 5BNPC 2VMGA 4JGZC 1WZXA 3ZSMA 2D43A 5APAA 4YYOA 2XLGA 4HL0A 1WCSA 2A70A 1PM4A 1WLWA 5ACA1 3S6PA 3KT4A 4FAHA 1X9PA 4K40A 3VDAA 4FTSA 4RQPB 4ZU7A 2XMLA 4LULA 1SHWB 4LHLA 2BV4A 3SH3A 3CJIC 2WO7A 1C1FA 1VBC3 1SG3A 3ILNA 5FYHA 2FDKA 2EICA 3EMRA 4N90A 2A3XA 5FYBA 3V64A 1W0NA 4D6SA 4H7LA 5A3LA 3VL9A 1VRH2 3NNFA 4DY5A 1CIWA 2WS93 5GLTA 1WWYA 1UZ0A 3WDTA 5FOBB 3M2MA 2G9GA 2WA3A 5JZGA 3TN93 2XUEA 5FZAA 2CDPA 2O8OA 3AJYA 4LBOA 2DCJA 4O61A 4GMP3 3MZHA 1NLQA 2QCSB 3WCSA 3LPGA 3GZUC 1R082 3ATGA 2VL4A 2ZX1A 1S2EA 4D3WA 1MACA 1UWWA 3FL7A 4Y22A 2YYOA 5FPXA 1KDMA 3WP5A 5FYYA 5C3RA 3B3QE 3IN9A 5BNPA 1ZRDA 2RR13 4JGZA 2IXHA 3RGBA 3B5LB 1PVC2 2PELA 3MIBA 1VBA3 1YUDA 3MUZ1 4AAXA 3N7LA 1OHFA 4XFFA 3H7JA 4LLOA 3SISA 1YFXA 1H1MA 3MUY1 5CIRA 2BRTA 2XJRA 3RVHA 4A7YA 3N9QA 4L92A 2JG9C 3IKWA 2Z4FA 4TWTA 4P14A 4CPBA 3CJIA 3MW4A 4HN0A 1RUG2 3BVCA 2FMDA 5CAZA 4MGIE 5HCAA 3U1XA 1V6MA 5GZFA 1BVVA 4EWEA 2ZEXA 5FMDA 1BBT2 2QFEA 1DYPA 2HWD1 4PCRA 2FZ2A 2AH2A 5FFOC 5A6QA 2NP0A 4YM2A 5IT6A 4AFDA 1LB2A 4XYXA 3GM8A 1ASJ3 5JXIA 3NNGA 3ZN6B 1RUD1 1OF4A 3HMYA 4JQTA 5F2WA 5JLVA 2D6OX 3FLPA 4X8NA 5CEHA 1OH4A 1WMDA 2AYHA 1SLLA 4QGMA 1UOJA 4CCLA 3BPZA 3AK0A 3MI8A 1AVBA 3OGRA 4P5YA 5DUWA 2LM3A 5FMCA 3UV9A 1VRBA 1QKQA 3QH6A 4Y5TA 3NAPC 2BWCA 3PVOA 3NJYA 2WT0A 3TN91 3WNKA 2D6NA 1RUF2 3GHNA 4RHV2 5F5QA 4IESA 2XJUA 2CTVA 1JI6A 2D3PA 4GMP1 4IV1C 1JW6A 3H3ZA 1CZTA 1D4M2 2R1BA 4BQ4A 4Z2AA 5C3QA 5FO8B 1YWKA 2AREA 3LPFA 1F2NA 2QQJA 3I2FA 4XW3A 5D2AA 4XMIA 3LIHA 4LOSA 3RPQA 4BQWA 2JG9A 5F32A 3IIAA 4FOVA 4R52A 4WM8C 1QXJA 1SPPA 4ZS3A 3CL1A 4AVTA 1UW8A 2OPKA 3M8LA 3T0DA 4E8CA 3AP9A 1PK6C 1ALYA 1XNAA 5IK8A 4A7KA 1NA1C 4QPIC 1G9DA 5FPBA 4B29A 1M06G 4QX0A 1LKNA 3MW3A 3WUCA 3ZVXA 3ZXJA 1FV3A 2OVUA 2P3YA 1C5IA 1W0PA 2IWGB 4ZXEA 1QJY1 2BWAA 2QUOA 4XUTA 1HXS2 2P17A 3THTA 1CPNA 5K0UC 4JX0A 4OI0A 2FCTA 4H7MA 1HRV3 4R9CA 4DQAA 1AL0G 1QH6A 3VZKA 2YV8A 4ZHNA 4AAPA 4CXYA 3NAPA 4Z8BA 5FXVA 2CWSA 2GP3A 4QPWA 3DYPA 4LKDA 4FPKA 4A42A 5IFPA 1F15A 4MVTA 3CO2A 1ENXA 4FPEA 4IV1A 3UESA 3UKVA 2OIIA 4OZOA 5A32B 1H0BA 4AI3A 4H3WA 1W03A 3PVEA 5KR7A 4OVEA 4LBQB 1CAXA 1AR73 4QWNA 4Y5Z0 3OBAA 3ZXAC 4AHYA 2PYTA 1MS3A 1LJ7A 3IM0A 3M3OA 5JOXA 3AP4A 4WM8A 3GBGA 2R32A 3ZXEA 1U5IA 2V4AA 1GU3A 4BQYA 5B4XA 2C9AA 5FQ0B 2IFWA 4CDUC 4CP2A 1H8VA 3FUQA 3UNPA 1PK6A 1NYWA 1R092 4JKKA 2DURA 3G6JB 3GJBA 4XBQA 1NA1A 1XU2A 5FPLA 4YSFA 4I2OA 4CRQA 2WFPA 3FHQA 1E5HA 2DWRA 3KB5A 4RR3C 2BOJA 3N9PA 2VE1A 5AC92 3DGTA 4QU2A 5CKMA 1NOVA 2F6BA 4BB3A 3PUIA 4LBQD 4AGRA 1PZ7A 1LHOA 1RUE3 1GP6A 1HKDA 1T2XA 2WNEA 3D8CA 3POSA 5C4WB 1QJZA 4UBGA 2OXBA 1OA3A 5K0UA 3RRDA 3L2YA 2JDUA 4GWMA 1PGW2 2VZ3A 1DZQA 3LZZA 1GYKA 4FPGA 4QXCA 3K2OA 4Z82A 4OUMA 4EROA 4WVMA 4LBLA 4KWKA 5FP8A 2YG0A 2VZRA 3KWVA 1FX5A 4AHXA 1KRIA 2WQ8A 3HN1A 2YC4A 1CPMA 3LDRA 3KCCA 4NWWA 5EWSA 3DPRB 4AEKA 5IVBA 1HX6A 2GC0A 5DAWA 1AL23 1BK0A 4CDWB 3ZX7A 4FPHA 2ID4A 2PN5A 3Q8BA 1SBDA 1ULOA 2VNVA 4CCJA 2A6WA 1XSQA 2EF6A 4EWAA 4UF0A 1UXXX 1W8UA 4PBPA 4AR2A 4FPFA 3AJZA 1H2LA 4Q0UA 1AUYA 4META 1UNBA 2IC1A 4QX8A 5DUUA 4YVSC 1SLCA 4CDUA 2XDVA 2ZGUA 2A6XA 2UY8A 1CQ9A 3GCWA 2ORZA 1E5SA 1I6XA 1TMF3 3H3LA 3ZYFA 1AR71 1H2KA 4RR3A 4XXPA 1C8M3 1W9YA 4YGEA 1IG3A 2BP6A 2BGCA 3O1SA 1EUTA 4NPRA 2P3IA 2P3JA 3TNQA 3VD9A 4Q8LA 4N7UA 4FTBA 4I02A 4LO6B 4IE4A 2D44A 3RWNA 1XNBA 2A1XA 3P3NA 3W20A 1U5XA 3B00A 1JZ4A 4J25A 1MQTC 2OX0A 4K7JA 1YEWA 4RGKA 2XLFA 4UT5A 1OVPA 2O14A 3DECA 4LNVA 2C9KA 2GZWA 2Z69A 5FAXA 1PO23 3TEYA 1UAIA 3BIEA 2HWF3 3AKTA 1RUE1 4PQ9A 5LW9A 4OHVA 2QZ2A 1JYXA 2VO5A 5HV0A 1W8ZA 5IVVA 2PHUA 2RJ2A 3FC0A 2ZMKA 3CQOA 1RITA 2BYVE 3A0NA 4I09A 3CKHA 4FT8A 4YW2A 1LU1A 3GHMA 3IMNA 3KS7A 3WQ0A 1VBB2 2WUHA 4YM1A 1YQ2A 3THCA 3RZMA 2HWB2 3PUAA 3R05A 4YVSA 3RMXA 4WVVA 3AP6A 4K8FA 4O65A 2V5YA 1SFNA 1H6XA 1W8OA 4V1PA 5DPNA 1LHVA 2VTFA 2RM21 3ZXFA 2ZBJA 2PAKA 3ACGA 4LT5A 3LSDA 3K51A 2W39A 4AQTA 3WP3A 1S0JA 1EAH2 1H1IA 2IZWA 3PNAA 1RUC2 1X9TA 2W87A 3PIJA 3X29B 2GH8A 4IUGA 4DUXA 1SBEA 4HK9A 4JTNA 5AVPA 4QXBA 1MQTA 3AXDA 1RVF2 3C7GA 2ZX2A 4LXLA 1C8M1 1IKPA 1Q43A 3H9AA 3VDBA 4RGGA 2RE9A 4HG6B 4XF1A 2XJQA 2HH9A 1H30A 1QOSA 3WHTA 1AR63 2VVDA 3SKVA 1G6NA 3S0MA 2QQUA 1OQ1A 1CZVA 2PAEA 3NV4A 1W2OA 4NR1A 5A33A 3VHNA 1LGNA 2Q4SA 5FXZA 5H9SA 5FKBA 4KWJA 4XCAA 4IERA 1V9U3 4NHKA 4AFMA 1OF3A 3WY6A 2HEYF 1BBT1 3PUSA 4L9BA 3R4UA 4NPMA 2JDPA 2Y0IA 2ZABA 5I0SA 3JBG2 1R1A3 5FBZA 5FPZA 1OD3A 4BHPA 1POV3 2GDFA 5LASA 4D7SA 2PHRA 3TEXA 2GNBA 1PGL1 4O9GA 3VBFB 4XABA 4PLNA 1UIKA 2JENA 4GWIA 4JRAA 2R16A 1RMU2 4XJAA 5GZCA 1RHI3 3URFA 3C3VA 5DN2A 3MIDA 2ZPXA 1AYM3 3NV1A 1U0AA 2MNGA 3BB6A 1E5IA 2ZKLA 4U2AA 3MYXA 1GMMA 4IE7A 4AWDA 3NQHA 3Q8CA 1RUF1 1SQ4A 1UKGA 4BLJA 1HLCA 4DINB 2D40A 2WAAA 2ZJCA 3M3IA 3OY8B 1D4M1 2Q30A 1W8HA 2CAVA 1QIQA 1COV3 3HNMA 3KV5A 4XJUA 4CCDA 2VTXJ 2RG4A 2A7AA 3N35A 1SACA 4DXTA 1AJKA 4LITA 2MEV3 5GALA 2DVDA 5I8SA 3IAQA 1WLCA 1YLLA 5F2SA 3ZYBA 3G7DA 2JDNA 3SCHA 4YGBA 2JG8B 4R9AA 3VD5A 5A7OA 3MGUA 1H4HA 3SCGA 1JYVA 3HIFA 3WCRA 2ZHLA 1UU5A 1UZVA 1W04A 2WZ8A 2ZX4A 3B9CA 3K75B 3VBSC 3VUOA 1GNYA 5DUXA 3Q8EA 1Z7S3 4ONUA 3ZIWA 4PT6A 2A3WA 1ND2B 1W6QB 1Z0HA 2BTVC 1FXZA 1QF3A 5L36A 1XU1A 4XAAA 3E6CC 1LRHA 1QEXA 1MS8A 1RUJ3 2ATFA 2VQ0A 3FHAA 2Y8KA 5IAXA 2VMCA 1I9RA 2DDUA 2DYCA 4FXKB 4OCTA 5C3OA 1PVXA 2B45X 3HOBA 3BPSA 3WG4A 4OYUA 1ULDA 3POWA 2Y0OA 3ACLA 4D6QA 1NLSA 3PTYA 2CV6A 1V6LA 3GBWA 2R30A 5FPAA 1DGRN 3I2OA 5DDJ2 5L9RA 5E8AA 1ZVFA 3AZXA 3TYJA 5A7PA 4FFHA 3DV8A 5EJ1B 4NIAA 1MS1A 2B39A 5BNNB 1ND3B 1QWRA 2ZX3A 1NT0A 5DZEA 3ES4A 1YIFA 1ST8A 4COWA 5JXJA 1HB1A 1V6NA 2CU5A 1EV13 1WCDJ 2WFF1 4XTMA 5IUQA 2JB8A 1JS9A 3A4UA 3KZ4C 1SEFA 3POYA 5FZOA 1NCRC 3VBSA 3LIGA 3HR9A 2VAUA 3ZFFB 2WC2A 4QDSA 2R041 2R071 4KMQA 1WW7A 1W6NB 4Q4Y1 2FMYA 1AXYA 4ZPIA 5C9AB 3ILRA 5F3GA 1OOPB 2F4LA 2BEOA 3S5AA 2DF7A 2Q8CA 1I5PA 2ZEYA 3AKSA 1L3JA 4XURA 2BVVA 2OZJA 3EYPA 3T3YA 2Q1ZB 2Y6GA 1S0BA 4Q0QA 3RZLA 5EHDA 1UPSA 3ZIXA 1MS5A 4NHLA 4HKWA 2XJTA 1GZCA 4OULA 4E2SA 3HWJA 3RQ0A 1CGPA 3UGFA 4AEMA 5C8CB 1RUI3 4I0AA 1UX7A 1YJLA 2VW0A 4N43C 4UFMA 2VVFA 4N53C 4CCKA 2PLV3 3TEZA 2HWE1 2PTMA 3KV4A 4NE9A 4NRMA 3WP6A 4A3ZA 5A70A 3H8XA 4DEVA 4AI9A 1KXGA 2XXZA 4IEYA 1FOD1 2D5HA 3OPWA 4A6OA 1UD1A 2ZGMA 1CAUB 3AZZA 3PLQA 4FPLA 1ZZBA 5LA0A 1A3KA 4Y1UA 4CU7A 2FZ1A 4B4QA 1NUKA 3OYWB 1LOCA 1J1TA 4LBJA 1NCRA 1LOBA 4GMP0 3NRUA 4J1WA 3FLTA 5FRAA 1G86A 1C5HA 2YROA 5EQUA 1CR7A 1SLTA 5FDBA 4WZFA 2XJPA 1YO8A 4BM8A 5BNOB 1FPN3 5AVAA 3FWEA 1H2NA 4LK7A 4OQ8A 1GZTA 4NIIA 3H8RA 1TZOA 5FJHA 3WDVA 3BKZA 2FD8A 2ZGKA 2BGPA 3GZAA 4HPKA 4AW7A 1RB8G 2VZVA 2R061 3T2OA 3POFA 3P6BA 1YIPA 4DMIA 1KDKA 4DXZA 1W9FA 1I1EA 5IVCA 2CY6A 3FHIB 2WWJA 4JVAA 4INDA 1ZZ9A 5HBAA 4N43A 1FMD3 4N53A 1TME2 4UFJA 1DQ5A 3W58A 4D6RA 4TXWA 3TWIA 4MOAA 3UYJA 1VBD1 2C4XA 3K4AA 3SEPA 1F31A 4BYYA 1QMJA 3TAYA 4BQ3A 2X5IB 2WNOA 2V4VA 2XWJB 5ERLA 4UYBA 3KT1A 4YG6A 4GZ9A 4AVBA 3HJRA 1IZ3A 2B7YA 2XWBB 1VBC2 2EVXA 3OY8A 1CAVA 4XDPA 4DB5A 1ZBE1 2GMPA 4Q4X3 3ZYRA 3JD73 2AR6A 1O4TA 2W5FA 2WS92 3N4MA 4NHYA 4HKOA 1IG0A 1H6YA 4QPGB 4XF3A 2WNVC 3RDIA 4K9SA 2XKPA 1XBFA 5CZKA 2WN2A 1VLNA 4B8EA 4EN0A 4UFHA 4DXSA 4FTEA 2ZMNA 4Q4V3 2WZR2 3DKQA 1VAMA 4XF0A 4Z1VA 2VOXA 5CFCC 3IPVB 2N7GA 4AVVA 1SCRA 4C1XA 4H2AA 4JDNA 4CU8A 1BQPA 1SDWA 2GNDA 4B4PA 5LY1A 2VNGA 2RS12 3I59B 4IV3C 4LQRA 5C9AC 1NXMA 5BNNC 4Y26A 1IS4A 3A22A 2RR12 4IE0A 3UJQA 3OG2A 3RZKA 3VHOA 1AR81 3I2GA 3S7EA 1JHJA 1VBA2 5E88A 4CEWB 4OUEA 1F35A 1UYYA 3KF5A 3MDPA 5F9TA 4D7YA 4QPYA 1X7NA 5FUIA 3ZLIA 4GB32 4S2HA 5FY5A 2EALA 2GH2A 4GIQA 1IOAA 4ZS2A 3U78A 5E1RA 2G9ZA 4XZPA 4URTA 2VZ1A 3I2IA 1QJX3 1UN1A 2B5HA 1XXNA 3VDCA 5GZEA 2ZGSA 2BVBA 1YNAA 2BGOA 4CCMA 5KXBA 4MGYE 3IBMA 4S2FA 3RI9A 3RWKX 4QT6A 2VULA 2WIIB 3RMYA 3ZYIB 3ST7A 2WNVA 1APNA 1Q8SA 4GKXA 2MHFA 1L7RA 3AFKA 1Y9QA 1ASJ2 2R6QA 3J8F3 4RA0A 3T2PA 1GKBA 3LDBA 5KHGA 5KXEA 4DRVA 3M4FA 5ACA3 4K1YA 1YQ6A 1K5MB 1UIJA 2WZEA 3AMQA 4XILA 5T54A 4AI2A 3O0VA 1OKOA 5CFCA 5ABJB 3O1TA 4QQOA 4Q4W1 3FBMA 4M3CA 4A45A 3HQUA 4WZCA 1QJU1 5I0UA 1YHFA 1UQXA 2OA2A 5C9AA 4IV3A 1XYNA 2H0BA 2JKXA 4HSJA 4SLIA 2K46A 2O8QA 3B9IA 1PNGA 4W8JA 2VXRA 4KBBA 3TNPB 5BNOC 1IGOA 4LBNA 4TZDA 5IK4A 1W6OA 3M1HA 3MEPA 1GZWA 3N7JA 5JOWA 2WRAA 2VMDA 4WM7B 1F4HA 2VNRA 1K5JA 5FY0A 1UY0A 5J36A 4Q27A 4K1ZA 3L2HA 5FUNA 1FNZA 5T5OA 3WNLA 5DZGA 5J7MA 3ZFGB 4CCEA 2Q8OA 2UU8A 2VMEA 4P9YA 2OUJA 2R49A 2DV9A 1N3QA 4JGYC 1K42A 3PTRB 3LA2A 1XNTA 4YW5A 5A80A 1AHSA 1C57A 1ZZ8A 3KHBA 2WO2A 1PO11 1YI7A 3T4HB 2YZ4A 5FR3A 1V6IA 1QU0A 4GQ7A 4XCBA 2BNNA 5BXXA 1JYTA 5DDJ1 5FZ9A 3CDZB 3NNJA 1MS9A 5FO7B 1V6OA 5HCHA 3W21A 3AKRA 1HRV2 1RJ8A 4IGPA 4YZ5A 5JMOA 3VBHB 3OB8A 3SC7X 1MPXA 4LO8A 5LBBA 3I49A 2J1AA 3MFCA 2D93A 3FFQA 5IAVA 4Q2FA 5FZDA 4C90A 2CL2A 2ZGQA 2ZEWA 3RYKA 1PMHX 3J8F1 2Q0AA 3P3PA 4FXGB 5GJ6A 3HD8B 1VPHA 2NMNA 5H9RA 3OSDA 4L11A 3VHRA 1ZA4A 4FOQA 2CGOA 2DVBA 2QQWA 4LPLA 1W8TA 3NV3A 2CWMA 2RHPA 2HWD3 1GQPA 4LEJA 4YZ3A 5D21A 4BMEA 2V72A 1RUD3 4COYA 5JAXA 3U0ZA 1JZ3A 1ODNA 1PNFA 5A7WB 4HANA 2WO3A 5F7UA 2BPA2 3DXTA 1OKQA 1X8EA 5IHRA 4Q0VA 3SMHA 2XBO1 4JGYA 1NLRA 1QDCA 2YDEA 1RJ7A 1HB4A 2VZSA 4ZY9A 4CEYC 2J1TA 1FATA 2I2SA 4DEQA 1W8FA 4P5HA 3ZDSA 1WLDA 3J7LA 1XE7A 4MXWA 4OHWA 4Y1YA 2BERA 1W2TA 1CAWA 3NKTA 1J58A 4M01A 4S2GA 4LR4A 3V56A 4A4AA 5JCTA 1SFPA 4IL7A 4IE6A 1WW6A 2H0VA 3LSEA 2Y34A 5CADA 1O6UA 3OUHA 1F9KA 3RNSA 4AHWA 4I3PA 5FZ3A 1RUOA 2C24A 4GJYA 5GZDA 3HQRA 4KQ7A 1AL22 3VBOC 2MPFA 3AP7A 3F95A 3OGJA 4QM9A 5FXXA 1S1AA 2Z5WA 2R1DA 2J22A 4E2QA 4EWDA 5J96B 2OQ7A 4N9HA 2J7MA 2YMZA 3MPBA 4P9WA 1NE4A 2JICA 4AHZA 4AI1A 4P9LA 3USUB 2OPWA 1QJY3 2XL9A 2WLPA 3H7YA 2GSYA 4MXVA 5FWEA 3ON7A 1BEV1 5T5JA 5K8SA 2EXIA 5ANQA 2P1BA 3VBRC 4M4PA 2E32A 3W9AA 1OMIA 1QGLA 2XHNA 4BXFA 4CEYA 1TMF2 4YG3A 4L8QA 5JDBA 5KBFA 4HN1A 4C91A 4BDVB 2G1MA 1Y4WA 5KHIA 2D6LX 1A6CA 1YI9A 1I5ZA 3R6SA 4E4HA 1JN2P 1HQLA 2PHTA 3I3BA 1DGRA 1BCXA 3U37A 3VBUB 3WUDA 4WVWA 4Q1PA 2RS51 3ETPA 2QQLA 3ILFA 3B02A 4OI1A 2E6VA 2VBBA 3GNEA 1T6GC 1GP4A 4YW6A 1R1ZA 4AVAA 1PZ9A 1PO22 2YFUA 1H1AA 4K6BA 3JZVA 1POV0 3AYAA 3LE0A 2YBPA 1D7PM 3VBOA 2A75A 4Y20B 5IVJA 1Y7BA 1OXCA 1POQA 5D8AB 5F3IA 3B93A 5I91A 1DYKA 3WOGA 4LK6A 4CDQB 3LB9A 5G04L 1RUH1 1NAEA 3HPNA 2TEPA 1L7LA 4QQ2A 1ZBA1 4Q5OA 1NQJA 3AKQA 2HJIA 4GH4B 1HB3A 3VBRA 5JI9A 3Q8FA 2JB4A 1XRUA 2B42B 1XE8A 2WZR1 1FV2A 2CSGA 5LRSA 1CESA 1UY2A 1PMJX 1DG6A 1STMA 1WKYA 2WN3A 3Q9OA 1A8DA 2A73B 2DUQA 3AMMA 4RQPC 4BU2A 2RDRA 2RS11 2WYSA 2PA7A 1QQP1 1QDOA 1MZFA 5FMOS 4LJHA 3WF3A 3VKOA 3WLUA 2R0FA 2HKXA 2ZHMA 1PM7A 2VZQA 3OOXA 5HCFA 1OD5A 1U5YA 1C4RA 5LBEA 2GN7A 2YHJA 3EJKA 3LA7A 2X53S 3KVBA 4KNCA 3T1MA 2YPDA 4GB31 3ME2A 3AZYA 2VOWA 2BZDA 1AR62 4CVUA 4IE5A 1RIRA 2W47A 3IAPA 1KJLA 4FP2A 3WDXA 3B7MA 3QD6A 1CN1A 3PU8A 4D8MA 4R4XA 1V9U2 1KQRA 1O4ZA 3HBZA 2D6KA 4O9EA 2XHKA 5GLUA 5BY5A 1FYUA 3V0AB 2K9ZA 5JVVA 2Y6JA 5FKCA 3ZN5A 1E5RA 2J42A 2QQIA 4XFIA 1G7YA 1Y9GA 4QPIA 1PZ8A 4YZ2A 1QH7A 1S55A 1HW5A 3K4ZA 5LA2A 1GSLA 2E7TA 4GWJA 3K3NA 5C70A 4P08A 1BMV1 2KM2A 3KCYA 5FK8A 3VDDB 1AYM2 1DQ4A 2I07B 3EQEA 1VBE1 4HZFA 2W1UA 4RQPA 4UW6A 5EYYA 3VD4A 5IW0A 4COUA 4MLOA 4BQ1A 4J6GA 3U11A 3IMMA 1C28A 2VMFA 4P9XA 5LK7B 4AEDB 2QE3A 1COV2 1FI2A 3BOWA 5A7QA 2C5DA 3H1WA 4AI8A 3VZLA 5J09A 1ACCA 4FI9A 2HWC1 5T52A 4CU9A 2Q1MA 1B35B 1KS5A 1TEIA 1W8WA 4A6SA 1G9AA 5C8WA 1JTZX 2EA7A 3HNBM 4LUKA 2RM23 3A23A 3O12A 4BE3A 2DUPA 2BFUL 1UYPA 2DCTA 1ULPA 4QHZA 4LKEA 3ZR5A 4H55A 2RS31 3OTFA 4UFLA 4YGCA 5GM0A 4C0BA 4RS5B 3RYRA 4CE8A 4PDWB 2NYYA 3OEAA 3WNXA 2H6CA 1GUIA 5C6CA 4AI0A 1Z7S2 3VLBB 2DVFA 1J1LA 2YY1A 2EXKA 4I0WB 4XACA 1DQ1A 3USSA 3KGLA 4P9GA 4AZZA 1QNYA 3BTYA 1RUJ2 1E57A 1JYNA 5JUVA 1O3QA 2Y33A 1CD3G 5L19A 3MFAA 2JE8A 4BISA 5JXHA 1OFSA 4QHOA 2HBUA 4M3CF 5D8AC 3T1LA 4LHSA 3B69A 4DUVA 2OW4A 5F6KA 1G9BA 1BBT3 3WHUA 2BOIA 1GANA 5FJKA 5F3CA 2E51A 1JYWA 2VW1A 1A34A 4XUNA 4AE2A 5C5TA 4HBNA 5JWPA 2ZOEB 4Y5SA 1UXZA 4DUWA 1VRH1 3ZN6A 1DCSA 5A7NA 4CP9B 1NZCA 1C1LA 3N9OA 4LMFA 5JR2A 1EV12 2WSUA 1L7QA 4XDOA 1ZA7A 3WD5A 1O91A 4Y1ZA 1UZZA 1GOGA 4A7ZA 3MF9A 5FY8A 1RUF3 5FYTA 2D3RA 4B7EA 2CGPA 3AYDA 2WINB 4XIOA 5FOJB 4TSVA 1D4M3 2C0ZA 3SNMA 3WF2A 4E4DX 4EV0A 3ACHA 3SEEA 1JZ8A 2WBKA 1MZ6A 1R081 3O0XA 2JDKA 5SV8A 5DMYA 1Q8VA 4OHYA 4D94A 4BMBA 1AX1A 5A6ZA 3I54A 1MEC2 2V09A 4NPLA 4DXRA 1NY72 1PVC1 3KMHA 4M00A 4ZONA 5D8AA 2GMMA 4QX5A 1S2KA 4YW1A 2WSVA 2ORXA 5J37A 3MIFA 3E5UA 1KGYA 1XOYA 1RUI2 4JCKA 4Z2WA 4XHBA 4Q8KA 2XLAA 1OH3A 2PLV2 2W1WA 3GJAA 1ZZCA 2WJSA 1RUG1 4XFCA 4NUBA 3ZFEB 5EJZB 1BKZA 3AYEA 4SBVA 4OQ9A 2AEYA 1H8TB 2W95A 5FP3A 2VMIA 2ENRA 1RYYA 1WA4A 1J83A 4IEQA 4E4ZA 5C4WC 3NKGA 3V65A 1DGWX 1JU4A 3AVSA 2HEWF 4ET7A 5EJ3A 2XVLA 5FY1A 5FZFA 2ZGOA 5GLWA 5IVFA 1HIXA 1LAJA
chains in the Genus database with same CATH topology
3C8XA 5C71A 1OT5A 1XPWA 4LKSA 2BGPA 3IDAA 1PX4A 2VZVA 3DYMA 3T2OA 1CIYA 3OEBA 3P6BA 3VD3A 3GXUA 1W99A 4UAPA 3F2ZA 5HXMA 4QB2A 4TXWA 3VDAA 1CX1A 4MOAA 2C4XA 3K4AA 1SHWB 3SEPA 4BXSV 1NKGA 1W9WA 1SG3A 2EICA 2V4VA 1W0NA 2W9XA 5B4NA 3LEKA 4GZ9A 4A44A 3HJRA 1UZ0A 3WF4A 2J1UA 3WQBA 5LCWL 2VQTA 2W5FA 2CDPA 2DCJA 1H6YA 3LPGA 2W91A 5CZKA 2WN2A 3T0AA 2VL4A 2QQKA 4DXSA 1UWWA 3FL7A 3I3EA 4XUOA 4M4RA 4KI5M 1PX3A 4QDRA 3MUZ1 2JDAA 4AAXA 4CU8A 2YFZA 4LQRA 3MUY1 3WNMA 3A22A 4QAWA 3OG2A 3I2GA 1JHJA 2VZPA 4OUEA 1UYYA 2Z4FA 3T09A 4XVHA 3T0BA 5FUIA 4BK4A 2ZEXA 5HPOA 4QB6A 1SDDB 2VZ1A 3I2IA 2KD7A 3VDCA 2QQOA 2BGOA 2VQUA 3GM8A 5JXIA 3NNGA 1OF4A 3W5NA 2EIDA 2VCBA 3CZUA 2OKXA 1OH4A 3IB3A 4P5YA 1L7RA 3OGRA 1US3A 1CZSA 4CUAA 3T2PA 1NX9A 3WNNA 4AG4A 1GOHA 2HLEA 2LS6A 2WZEA 2W92A 4MADA 3WNKA 4OMDA 2B9VA 1W9TA 5F7UA 4A45A 4BK5A 1JI6A 4Z2AA 1CZTA 3GGLA 2RVAA 2JKXA 4ZZ8A 3LPFA 4ARYA 2QQJA 3I2FA 4W8JA 1HN1A 2W94A 3ZM8A 2J1RA 3A7QA 2XOMA 3MV01 2VMDA 3ACFA 3BGAA 1F4HA 1UMHA 1LNSA 3T0DA 4MO3M 1UYZA 4E8CA 1DLCA 1UY0A 1XNAA 3WNLA 4QX0A 2VMEA 2W1QA 4KWUA 1K42A 1XNTA 1UMIA 3ABZA 4ZXEA 1XC6A 2WO2A 4XUTA 1JU3A 3I97A 4OMCA 4RYDA 4JX0A 2R7EB 3CDZB 3WF0A 4QPWA 3DYPA 1W8NA 4A42A 5IFPA 5JMOA 3OB8A 1MPXA 1K45A 2E33A 3UESA 2VCCA 2J1AA 4OZOA 2ZEWA 1PMHX 4JKMA 1JZ6A 3OBAA 4LPLA 2ZEZA 2WDBA 1GQPA 1GU3A 5B4XA 3LEIA 3JXSA 3UNPA 2V72A 3WNOA 4JKKA 1JZ3A 4D0QA 3FHQA 2WO3A 2DCKA 5IHRA 3FN9A 3PUIA 1T2XA 2VZSA 4QX2A 4ZY9A 2J1TA 2VOTA 3WSOA 3K4DA 4DEQA 2VZ3A 2BERA 2YG0A 2VZRA 2X10A 1R64A 3WNPA 4A4AA 2WQ8A 3MBWA 2HYXA 2YC4A 2E26A 4UOJA 3GDBA 3HN3A 3SKJE 4P02B 2RV9A 2WABA 2ID4A 3J7HA 2QBXA 1IQDC 3AC0A 1ULOA 2XQXA 1DP0A 3BN6A 1UY1A 1UXXX 1F4AA 1O8PA 3IIIA 2J22A 2Y6LA 2J7MA 4MGSA 3CZJA 2EIEA 2ORZA 2L9LA 5I0DA 4XUQA 2XONA 5CYYA 4M4PA 2Y64A 2E32A 1EUTA 4UI9L 3UETA 2XHNA 3VD9A 1EUUA 3LQCA 2WAOA 2E31A 5J1XA 1JZ4A 4BDVB 3T08A 5JXGA 3DECA 2C9KA 1J84A 3C7FA 3I3BA 3U37A 3NJXA 3I3DA 3ETPA 4JHZA 2QQLA 1P8JA 5IFTA 1JYXA 2VO5A 2YFUA 1BHGA 2RJ2A 3CQOA 3LE0A 5DQ0A 3CKHA 1D7PM 2ZXQA 1O59A 2J1SA 2WUHA 1TVGA 1YQ2A 2X09A 3THCA 4QB1A 3OGVA 1H6XA 1W8OA 5G04L 2QQNA 5DPNA 2EIBA 1NAEA 2VTFA 3HPNA 1UY4A 3VD7A 5LA1A 3ACGA 2W46A 3E1F1 4XZUG 3MO4A 3PUHA 2PQSA 2W87A 1UY2A 4IUGA 4DUXA 1PMJX 1WKYA 2WN3A 2WO1A 3MV11 4ZZ5A 2WYSA 3C7GA 3VDBA 3WF3A 4HG6B 2VZQA 2V5DA 3HNYM 3SKVA 1CZVA 3ECQA 2VM9A 4W50A 2BZDA 1OF3A 4CVUA 2W47A 3IAPA 4D8MA 1OD3A 4MGQA 4XUPA 4BJ0A 2Y6JA 2YC2A 1JZ5A 4GWIA 2QQIA 4TTGA 4L0PA 4QX3A 5DN2A 2QQMA 3I2KA 3K4ZA 1GMMA 5LA2A 5C70A 3NQHA 4GWJA 4P08A 2YB7A 2B4KA 2WAAA 3THDA 3C7HA 2W1UA 3VD4A 3HNMA 3OGSA 1JZ2A 1W9SA 5G05L 2VMFA 4DXTA 3IAQA 2J1EA 4W4ZA 2LW8A 3EB7A 4CUBA 3K77A 3P1IA 4FI9A 4CU9A 3VD5A 2Y6HA 3HNBM 3A21A 1JYVA 3A23A 2WZ8A 3K75B 3T2QA 1GNYA 1ULPA 4PT6A 2W3JA 4RN5A 2W1SA 4P00B 3OEAA 1GUIA 4ARXA 3FHAA 2Y8KA 4PQQA 1US2A 2DDUA 2VMCA 3K46A 1O8SA 2VCAA 3HOBA 3I2JA 4OYUA 1UYXA 1JYNA 5IYYA 5JUVA 5A1AA 2JE8A 5JXHA 2VJXA 4CU6A 4LHSA 3DYOA 4DUVA 4E8DA 5EJ1B 4YPJA 2VC9A 3WF1A 2X05A 4CUCA 1JYWA 1TG7A 5JXJA 2BBAA 4XUNA 3NJVA 5IJRA 2J1VA 5C7GA 1WCQA 1UXZA 4DUWA 2JD9A 2VR4A 3ACIA 5JR2A 4QDSA 4KMQA 1L7QA 2Y6KA 4QDQA 3WEZA 2CDOA 3C7EA 2VZUA 1UY3A 1GOGA 4A41A 3D3AA 3CMGA 1I5PA 2ZEYA 4XURA 3EYPA 3WF2A 3ACHA 3SEEA 2Y6GA 1JZ8A 2WBKA 1K3IA 5DMYA 1KEXA 4JKLA 1JZ7A 4DXRA 5EIYB 1K12A 1UX7A 3HEIA 4QX1A 2ORXA 2VZTA 4A3ZA 1KGYA 4DEVA 2C26A 3W5MA 3CIHA 1GOFA 4A6OA 2W1WA 1DYOA 3LEGA 5EJZB 5LA0A 4CU7A 2W95A 1NUKA 1RYYA 2VZOA 1J83A 3C7OA 1JU4A 3NRUA 4ET7A 4PF1A 3I2HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C8X A;  5C71 A;  1OT5 A;  1XPW A;  4LKS A;  2BGP A;  3IDA A;  1PX4 A;  2VZV A;  3DYM A;  3T2O A;  1CIY A;  3OEB A;  3P6B A;  3VD3 A;  3GXU A;  1W99 A;  4UAP A;  3F2Z A;  5HXM A;  4QB2 A;  4TXW A;  3VDA A;  1CX1 A;  4MOA A;  2C4X A;  3K4A A;  1SHW B;  3SEP A;  4BXS V;  1NKG A;  1W9W A;  1SG3 A;  2EIC A;  2V4V A;  1W0N A;  2W9X A;  5B4N A;  3LEK A;  4GZ9 A;  4A44 A;  3HJR A;  1UZ0 A;  3WF4 A;  2J1U A;  3WQB A;  5LCW L;  2VQT A;  2W5F A;  2CDP A;  2DCJ A;  1H6Y A;  3LPG A;  2W91 A;  5CZK A;  2WN2 A;  3T0A A;  2VL4 A;  2QQK A;  4DXS A;  1UWW A;  3FL7 A;  3I3E A;  4XUO A;  4M4R A;  4KI5 M;  1PX3 A;  4QDR A;  3MUZ 1;  2JDA A;  4AAX A;  4CU8 A;  2YFZ A;  4LQR A;  3MUY 1;  3WNM A;  3A22 A;  4QAW A;  3OG2 A;  3I2G A;  1JHJ A;  2VZP A;  4OUE A;  1UYY A;  2Z4F A;  3T09 A;  4XVH A;  3T0B A;  5FUI A;  4BK4 A;  2ZEX A;  5HPO A;  4QB6 A;  1SDD B;  2VZ1 A;  3I2I A;  2KD7 A;  3VDC A;  2QQO A;  2BGO A;  2VQU A;  3GM8 A;  5JXI A;  3NNG A;  1OF4 A;  3W5N A;  2EID A;  2VCB A;  3CZU A;  2OKX A;  1OH4 A;  3IB3 A;  4P5Y A;  1L7R A;  3OGR A;  1US3 A;  1CZS A;  4CUA A;  3T2P A;  1NX9 A;  3WNN A;  4AG4 A;  1GOH A;  2HLE A;  2LS6 A;  2WZE A;  2W92 A;  4MAD A;  3WNK A;  4OMD A;  2B9V A;  1W9T A;  5F7U A;  4A45 A;  4BK5 A;  1JI6 A;  4Z2A A;  1CZT A;  3GGL A;  2RVA A;  2JKX A;  4ZZ8 A;  3LPF A;  4ARY A;  2QQJ A;  3I2F A;  4W8J A;  1HN1 A;  2W94 A;  3ZM8 A;  2J1R A;  3A7Q A;  2XOM A;  3MV0 1;  2VMD A;  3ACF A;  3BGA A;  1F4H A;  1UMH A;  1LNS A;  3T0D A;  4MO3 M;  1UYZ A;  4E8C A;  1DLC A;  1UY0 A;  1XNA A;  3WNL A;  4QX0 A;  2VME A;  2W1Q A;  4KWU A;  1K42 A;  1XNT A;  1UMI A;  3ABZ A;  4ZXE A;  1XC6 A;  2WO2 A;  4XUT A;  1JU3 A;  3I97 A;  4OMC A;  4RYD A;  4JX0 A;  2R7E B;  3CDZ B;  3WF0 A;  4QPW A;  3DYP A;  1W8N A;  4A42 A;  5IFP A;  5JMO A;  3OB8 A;  1MPX A;  1K45 A;  2E33 A;  3UES A;  2VCC A;  2J1A A;  4OZO A;  2ZEW A;  1PMH X;  4JKM A;  1JZ6 A;  3OBA A;  4LPL A;  2ZEZ A;  2WDB A;  1GQP A;  1GU3 A;  5B4X A;  3LEI A;  3JXS A;  3UNP A;  2V72 A;  3WNO A;  4JKK A;  1JZ3 A;  4D0Q A;  3FHQ A;  2WO3 A;  2DCK A;  5IHR A;  3FN9 A;  3PUI A;  1T2X A;  2VZS A;  4QX2 A;  4ZY9 A;  2J1T A;  2VOT A;  3WSO A;  3K4D A;  4DEQ A;  2VZ3 A;  2BER A;  2YG0 A;  2VZR A;  2X10 A;  1R64 A;  3WNP A;  4A4A A;  2WQ8 A;  3MBW A;  2HYX A;  2YC4 A;  2E26 A;  4UOJ A;  3GDB A;  3HN3 A;  3SKJ E;  4P02 B;  2RV9 A;  2WAB A;  2ID4 A;  3J7H A;  2QBX A;  1IQD C;  3AC0 A;  1ULO A;  2XQX A;  1DP0 A;  3BN6 A;  1UY1 A;  1UXX X;  1F4A A;  1O8P A;  3III A;  2J22 A;  2Y6L A;  2J7M A;  4MGS A;  3CZJ A;  2EIE A;  2ORZ A;  2L9L A;  5I0D A;  4XUQ A;  2XON A;  5CYY A;  4M4P A;  2Y64 A;  2E32 A;  1EUT A;  4UI9 L;  3UET A;  2XHN A;  3VD9 A;  1EUU A;  3LQC A;  2WAO A;  2E31 A;  5J1X A;  1JZ4 A;  4BDV B;  3T08 A;  5JXG A;  3DEC A;  2C9K A;  1J84 A;  3C7F A;  3I3B A;  3U37 A;  3NJX A;  3I3D A;  3ETP A;  4JHZ A;  2QQL A;  1P8J A;  5IFT A;  1JYX A;  2VO5 A;  2YFU A;  1BHG A;  2RJ2 A;  3CQO A;  3LE0 A;  5DQ0 A;  3CKH A;  1D7P M;  2ZXQ A;  1O59 A;  2J1S A;  2WUH A;  1TVG A;  1YQ2 A;  2X09 A;  3THC A;  4QB1 A;  3OGV A;  1H6X A;  1W8O A;  5G04 L;  2QQN A;  5DPN A;  2EIB A;  1NAE A;  2VTF A;  3HPN A;  1UY4 A;  3VD7 A;  5LA1 A;  3ACG A;  2W46 A;  3E1F 1;  4XZU G;  3MO4 A;  3PUH A;  2PQS A;  2W87 A;  1UY2 A;  4IUG A;  4DUX A;  1PMJ X;  1WKY A;  2WN3 A;  2WO1 A;  3MV1 1;  4ZZ5 A;  2WYS A;  3C7G A;  3VDB A;  3WF3 A;  4HG6 B;  2VZQ A;  2V5D A;  3HNY M;  3SKV A;  1CZV A;  3ECQ A;  2VM9 A;  4W50 A;  2BZD A;  1OF3 A;  4CVU A;  2W47 A;  3IAP A;  4D8M A;  1OD3 A;  4MGQ A;  4XUP A;  4BJ0 A;  2Y6J A;  2YC2 A;  1JZ5 A;  4GWI A;  2QQI A;  4TTG A;  4L0P A;  4QX3 A;  5DN2 A;  2QQM A;  3I2K A;  3K4Z A;  1GMM A;  5LA2 A;  5C70 A;  3NQH A;  4GWJ A;  4P08 A;  2YB7 A;  2B4K A;  2WAA A;  3THD A;  3C7H A;  2W1U A;  3VD4 A;  3HNM A;  3OGS A;  1JZ2 A;  1W9S A;  5G05 L;  2VMF A;  4DXT A;  3IAQ A;  2J1E A;  4W4Z A;  2LW8 A;  3EB7 A;  4CUB A;  3K77 A;  3P1I A;  4FI9 A;  4CU9 A;  3VD5 A;  2Y6H A;  3HNB M;  3A21 A;  1JYV A;  3A23 A;  2WZ8 A;  3K75 B;  3T2Q A;  1GNY A;  1ULP A;  4PT6 A;  2W3J A;  4RN5 A;  2W1S A;  4P00 B;  3OEA A;  1GUI A;  4ARX A;  3FHA A;  2Y8K A;  4PQQ A;  1US2 A;  2DDU A;  2VMC A;  3K46 A;  1O8S A;  2VCA A;  3HOB A;  3I2J A;  4OYU A;  1UYX A;  1JYN A;  5IYY A;  5JUV A;  5A1A A;  2JE8 A;  5JXH A;  2VJX A;  4CU6 A;  4LHS A;  3DYO A;  4DUV A;  4E8D A;  5EJ1 B;  4YPJ A;  2VC9 A;  3WF1 A;  2X05 A;  4CUC A;  1JYW A;  1TG7 A;  5JXJ A;  2BBA A;  4XUN A;  3NJV A;  5IJR A;  2J1V A;  5C7G A;  1WCQ A;  1UXZ A;  4DUW A;  2JD9 A;  2VR4 A;  3ACI A;  5JR2 A;  4QDS A;  4KMQ A;  1L7Q A;  2Y6K A;  4QDQ A;  3WEZ A;  2CDO A;  3C7E A;  2VZU A;  1UY3 A;  1GOG A;  4A41 A;  3D3A A;  3CMG A;  1I5P A;  2ZEY A;  4XUR A;  3EYP A;  3WF2 A;  3ACH A;  3SEE A;  2Y6G A;  1JZ8 A;  2WBK A;  1K3I A;  5DMY A;  1KEX A;  4JKL A;  1JZ7 A;  4DXR A;  5EIY B;  1K12 A;  1UX7 A;  3HEI A;  4QX1 A;  2ORX A;  2VZT A;  4A3Z A;  1KGY A;  4DEV A;  2C26 A;  3W5M A;  3CIH A;  1GOF A;  4A6O A;  2W1W A;  1DYO A;  3LEG A;  5EJZ B;  5LA0 A;  4CU7 A;  2W95 A;  1NUK A;  1RYY A;  2VZO A;  1J83 A;  3C7O A;  1JU4 A;  3NRU A;  4ET7 A;  4PF1 A;  3I2H A; 
#chains in the Genus database with same CATH topology
 4DY3 A;  3VB9 A;  2Q5T A;  3FUO A;  3C8X A;  4G3Y C;  2Y38 A;  3H1M A;  5CFD B;  1VMH A;  1XPW A;  1WCK A;  3DPR C;  3POE A;  1IS5 A;  3AP5 A;  1PX4 A;  2NQY A;  1SFY A;  5A3M A;  1FPN 2;  2XJV A;  4CDW C;  4AOC A;  2IUW A;  5DAB A;  3ZO0 B;  1B35 C;  5A32 A;  3N9L A;  3WIN E;  3U14 A;  2QQP A;  2XKO A;  4LBQ A;  2LUW A;  1JUI A;  3VD3 A;  3T2T A;  4RHV 1;  3GXU A;  4K8R B;  1W99 A;  5CVR A;  4QU1 A;  4FP3 A;  3MIC A;  1UZW A;  3F2Z A;  1AR9 2;  2WFF 3;  5HXM A;  1CWP A;  3OD0 A;  4QB2 A;  4RS5 C;  3VKN A;  5FQ0 A;  1CX1 A;  3ZSJ A;  3V0B B;  4BOW A;  3VKF C;  4BXS V;  2ZHK A;  4NOT A;  3TOJ A;  5IVE A;  4QQH A;  2Q8D A;  1W9W A;  3GF6 A;  1FMD 2;  2R04 3;  2R07 3;  3U10 A;  4Q4Y 3;  2JDZ A;  3ZOI A;  4AL9 A;  5GZG A;  5B2G B;  3LEK A;  1FAY A;  1GV9 A;  4YVW B;  4CP1 A;  4A44 A;  4HFS A;  2AEN A;  5C4W A;  3WF4 A;  2Z79 A;  3CF6 E;  4ISR A;  4GA9 A;  2K0G A;  2QTW B;  2JDH A;  2VQT A;  4MV2 A;  5LCW L;  1MVE A;  4HVO A;  1GZ9 A;  4FAG A;  5FZH A;  2XL7 A;  1ULE A;  1J3Q A;  2QZ3 A;  2Y26 A;  5JSP A;  3QLQ A;  3T30 A;  3VKL A;  2W91 A;  4Q4X 2;  1LUL A;  3DPR A;  1HXS 1;  3JD7 2;  5BV6 A;  1V00 A;  2ZA9 A;  2QQK A;  2WQ4 A;  1UX6 A;  4CDW A;  3MPP G;  1KFX L;  3AFG A;  3I3E A;  4D7T A;  2EAA A;  3D82 A;  5KC5 A;  2HWE 3;  3OCP A;  4M4R A;  2WYF A;  4KI5 M;  4TLF A;  2GNM A;  2QNK A;  1PX3 A;  1PGS A;  2V73 A;  3EO6 A;  4BQX A;  1FOD 3;  4NRQ A;  4KU7 A;  4Q4V 2;  4Q26 A;  3LAG A;  1BK1 A;  1OLM E;  3K3O A;  4RS5 A;  4QAW A;  3U4S A;  5FMB A;  1GR3 A;  1WGP A;  5KHH A;  3PDQ A;  1HRI 2;  1UOF A;  2XUM A;  3IDB B;  3ZYJ B;  2W52 A;  1OLR A;  2YU2 A;  3T09 A;  1WBL A;  4LE4 A;  4PI2 A;  4XVH A;  3FJS A;  3T0B A;  3W59 A;  4BK4 A;  1W6P B;  4Y1V A;  2JEM A;  4LO4 B;  5JPM B;  1N1S A;  1R09 1;  1N1T A;  1UMZ A;  1X33 A;  3ZKY A;  2KD7 A;  2PHW A;  4XFA A;  5A3P A;  3AXE A;  1J3P A;  3LA3 A;  4B1L A;  2R06 3;  2ET7 A;  5AC9 1;  3I2D A;  4FOY A;  4O7X A;  4XMA A;  3S7I A;  2EID A;  3ZSK A;  1QJX 2;  2LTN A;  2XPJ A;  3CZU A;  1WD4 A;  1Q8P A;  2OKX A;  3IB3 A;  1RUN A;  5E16 A;  3GCX A;  1AYN 2;  1CZS A;  1NG0 A;  5FTT C;  1NX9 A;  4AG4 A;  2LRP A;  1GOH A;  1PGW 1;  4XFG A;  4AGG A;  5AFE A;  1KD7 A;  4OUS A;  3LFM A;  4CCC A;  1UL9 A;  2VH9 A;  2WNU B;  5FO9 B;  2W92 A;  5L7O B;  1VP6 A;  4MAD A;  4W6X A;  5CG9 A;  1O3S A;  2ADE A;  4RFR B;  1VBD 3;  2B9V A;  1YC6 1;  4EQV A;  2AC1 A;  4MX3 A;  3SH4 A;  3KV9 A;  5LA9 A;  4CDX B;  2NMO A;  5KWR A;  2RVA A;  4EN9 B;  5JSR A;  5KXD A;  3I3M A;  1YFW A;  2E63 A;  2W94 A;  3ZM8 A;  3OD4 A;  1SLB A;  3H1Y A;  3A7Q A;  3VBF C;  1Q8O A;  5IWF A;  4AVS A;  1ZBE 3;  1C8N A;  5FLI A;  1OUS A;  3ACF A;  1G9C A;  3TBD A;  5CBL A;  1UMH A;  2FCV A;  1YFY A;  1SZB A;  1UYZ A;  2AEZ A;  3RJR A;  2DBI A;  1QJF A;  1W2A X;  3THP A;  2D5F A;  3IZO A;  1RIN A;  2W1Q A;  2NN8 A;  4KWU A;  4PLO A;  2F4P A;  1V6J A;  4XC9 A;  2JDY A;  3WXP A;  3LFI A;  4I30 A;  1XC6 A;  2UWA A;  2RMU 2;  4P9J A;  4QGL A;  1JU3 A;  4OMC A;  3ZMO A;  1GWL A;  2ZGL A;  2ZS6 B;  3S30 A;  3OUJ A;  3AZW A;  1S4C A;  2QJV A;  4BA6 A;  2JKB A;  1X50 A;  4YW4 A;  3VGI A;  1O4Y A;  2K2S A;  3OBT A;  3A0K A;  1DFQ A;  5EPA A;  2CNA A;  2DTY A;  1AR8 3;  3QCW A;  2EXJ A;  1W8N A;  3WF0 A;  2JG8 C;  5FYI A;  1OLM A;  2E33 A;  2QVS B;  4U36 A;  4GXL A;  2VCC A;  5IK7 A;  2GN3 A;  3B01 A;  1XSR A;  1YRZ A;  5LB6 A;  1W2N A;  5LRR A;  1JZ6 A;  2WA4 A;  3J4U H;  1ND2 C;  1WCU A;  1BVP 1;  1PIV 2;  2ZEZ A;  5C33 A;  4I0B A;  2D7F A;  2OQ6 A;  4BIO A;  3VBF A;  1JOD A;  3QOP A;  4R4Z A;  3UK9 A;  2ET1 A;  3E5Q A;  3OGG A;  1LEC A;  1VBB 1;  3JXS A;  3FZ3 A;  3SQO A;  3WNO A;  2HWB 1;  3HBK A;  1LHU A;  2Y6F A;  4LUM A;  3RZH A;  3ZXG A;  1LEM A;  4GAL A;  1GQH A;  2O1Q A;  2QQV A;  1JHN A;  3BOD A;  1AX0 A;  3HVD A;  1T6B X;  2JIJ A;  1RUD 2;  4NWV A;  1ENR A;  3FN9 A;  3VZM A;  4UW4 A;  1GLH A;  4QX2 A;  4Z92 B;  2VOT A;  5KHK A;  3K4D A;  1EAH 1;  1W39 A;  1B09 A;  1RUC 1;  5JZG B;  2UUR A;  1MEC 1;  1WD3 A;  3CNA A;  4Q4W 3;  4KBZ A;  4LIU A;  1QJU 3;  4N7I A;  4PBO A;  1WME A;  1S0D A;  2H6B A;  4UWD A;  3H42 B;  2X10 A;  4QKF A;  1R64 A;  4TLG A;  3TN9 2;  3WNP A;  1GNZ A;  1ND3 C;  2D3S A;  1G8W A;  1RVF 1;  3MBW A;  3RJ2 X;  4B3N A;  1IQA A;  3ENR A;  1GWM A;  3RZJ A;  2E26 A;  2YU1 A;  2Y60 A;  4UOJ A;  2JG8 A;  3GDB A;  3HN3 A;  2P5B A;  1Q8Q A;  1H4G A;  2RV9 A;  4Q1R A;  2WAB A;  3POG A;  2A71 A;  1WLT A;  4Y22 B;  1DZT A;  1JOB A;  4FFF A;  5T50 A;  3WG2 A;  4WVZ A;  1IQD C;  3D0J A;  1DIW A;  3AC0 A;  3ZFF C;  5BNP B;  3JU9 A;  1EPW A;  4JGZ B;  1VR3 A;  1AF9 A;  4A2U A;  1AJO A;  1ND2 A;  1KS4 A;  1LTE A;  1W6Q A;  1WMF A;  2ARB A;  1OOP C;  4XQD A;  2P37 A;  4OLL A;  1Q5O A;  2WL1 A;  3III A;  4JC1 A;  1SBF A;  2GAU A;  5F5A A;  5FUP A;  3ZN4 A;  1Q3E A;  3ZPY A;  3JBG 1;  3O14 A;  2W2I A;  1RC6 A;  5EYX A;  3O1O A;  4EN8 B;  4MGS A;  4AFC A;  2JXA A;  2VU9 A;  2GNT A;  3CZJ A;  3CJI B;  2EIE A;  4IEP A;  2VW2 A;  1DHK B;  4LOT A;  2D6M A;  5LK5 A;  3WG3 A;  1PO1 3;  4KGQ A;  5HCB A;  2JE7 A;  2JX9 A;  1S0I A;  3LWC A;  4TYS A;  2P2K A;  5K7P A;  5DDJ 3;  4XUQ A;  1RMU 1;  2XON A;  3LCP A;  3LGR A;  5CYY A;  3WQ1 A;  3AM2 A;  3WZ1 A;  3ZXD A;  5A3T A;  4UI9 L;  3UET A;  1QJY 2;  5FPU A;  5C8C C;  5CA6 A;  2WAO A;  3JB4 C;  2E31 A;  4LO5 B;  1H2M A;  5J1X A;  2OUH A;  5BNN A;  1LR5 A;  2E7A A;  4FPJ A;  1OBN A;  1ND3 A;  4CPB D;  1AR9 1;  3J9S A;  4BH9 A;  5BUV A;  4EZ4 A;  4LLF A;  1Y43 B;  4LA3 A;  3N9M A;  4PHZ A;  3RYP A;  3I3D A;  4YAR A;  4LIV A;  1P8J A;  2WQZ C;  2UY9 A;  5IFT A;  4X6Q B;  5IK5 A;  3POJ A;  3Q8A A;  1BHG A;  3WR0 A;  1ZZ7 A;  3ZFF A;  5BNQ A;  2PAM A;  1O3T A;  5HXV A;  1W6N A;  2ZGR A;  1SMV A;  4NHM A;  4AF9 A;  2BBV A;  4NVP A;  2ARX A;  1OOP A;  4IEU A;  3U75 A;  4FO9 A;  2XG3 A;  2JE9 A;  3T4V A;  1ZRI A;  1TVG A;  2XBO 3;  1RED A;  3QH7 A;  4FQZ A;  3AKP A;  3VZN A;  2A6Y A;  2JG9 B;  4K21 A;  5LBF A;  4QB1 A;  1H9W A;  3OGV A;  1IKQ A;  1HQW A;  4LKF A;  1SPP B;  3VD7 A;  5DAX A;  5LA1 A;  2Z42 A;  1OFN A;  3M7A A;  4XOG A;  5F8P A;  2RJL A;  2W46 A;  4CCO A;  2PFW A;  1SCS A;  4MHR A;  2GC1 A;  1W06 A;  3PUH A;  1TNR A;  2PQS A;  5C8C A;  2BNM A;  2VEC A;  5GKA C;  1LGB A;  2LAL A;  2WO1 A;  1D0H A;  4V2W A;  3HT2 A;  2VY0 A;  4KG8 A;  4ZZ5 A;  4DRR A;  3BIW E;  1X8M A;  1LGC A;  2D97 A;  2X5I C;  2AZ5 A;  5E6H A;  5EFU A;  5T5P A;  1O5L A;  1OUR A;  1S0F A;  1CAU A;  2KXL A;  3KT7 A;  4AQ6 A;  5A3U A;  1HRI 1;  3J7N A;  1O7F A;  3OYW A;  5JR7 B;  3TRS B;  4NID A;  3NAP B;  3S57 A;  3ECQ A;  3TEW A;  4MHU A;  4W50 A;  4IV1 B;  2VD7 A;  3NVC A;  1NZI A;  1ULC A;  1Y3T A;  1YYN A;  2BW8 A;  2WT1 A;  5BNO A;  4RL7 A;  1BEV 3;  1OA2 A;  5EXO A;  4QPG C;  1CAX B;  2OZ6 A;  3R0R A;  5KC6 A;  3WDU A;  4ASK A;  3MLJ A;  4XUP A;  4F83 A;  4WM8 B;  2I74 A;  1AR7 2;  4UBH A;  2R0H A;  4EYU A;  2GC2 A;  3VHP A;  4XQ4 A;  1DGL A;  1AYN 1;  4L0P A;  1ZNP A;  2KA3 A;  1PK6 B;  1REE A;  1EPZ A;  1YFU A;  3LOB A;  2IXJ A;  3NL1 A;  2ZGN A;  5F37 A;  2QQM A;  1JYI A;  1ZRC A;  1HJG A;  4X8P A;  2B4K A;  5L73 A;  2RS5 3;  2FDF A;  2ARA A;  4YLZ A;  3THD A;  3C7H A;  4CEW C;  2E9Q A;  4GUL A;  3PJQ A;  4AFB A;  1JZ2 A;  5JIA A;  1W9S A;  4YG0 A;  2X5I A;  4CSW A;  1RUE 2;  3NNL A;  4K3U A;  5G05 L;  2RDQ A;  3WT3 A;  4BIF A;  5K0U B;  1SLA A;  3E6B A;  5FRE A;  4XPV A;  2HBT A;  1A8M A;  4WVM B;  1OI6 A;  2J1E A;  1MS0 A;  2LW8 A;  4IQP A;  2W08 A;  4CUB A;  2JDM A;  3C2U A;  3P1I A;  2DU0 A;  2PXJ A;  1RXF A;  4QXK A;  3UT0 A;  2Y6H A;  4FCA A;  4M0H A;  5FXW A;  3DXU A;  2KR2 A;  1BYH A;  1RUH 3;  3LOI A;  4MUV A;  2NLR A;  4XTP A;  1ZBA 3;  4G9S B;  3WX5 A;  2ARC A;  4QPG A;  3H3U A;  4DO0 A;  4UF0 B;  2DFC A;  5JI7 A;  2W3J A;  2ILM A;  2WZR 3;  4XEZ A;  2RM2 2;  3B94 A;  2RMU 1;  3LEM A;  4P00 B;  4FBF A;  1KJR A;  2LRO A;  1K5M C;  4QGN A;  2BQP A;  3GBF A;  4JDO A;  4CDU B;  3WDY A;  3FLR A;  3ZYP A;  3IPV A;  4ZXK A;  5J98 B;  3WVJ A;  2RS1 3;  5ABJ C;  1CJD A;  1O8S A;  1QQP 3;  2SBA A;  3AMN A;  3PL0 A;  1ZYB A;  4RR3 B;  4ATE A;  3I59 A;  4EZH A;  1UYX A;  5FZG A;  1CJP A;  3HQX A;  3ASI A;  3PJY A;  3BTX A;  3O1U A;  5FYC A;  2P6C A;  1C8M 2;  3BTA A;  3ZYG A;  4CEW A;  4GB3 3;  3MHZ A;  2FDG A;  3CJX A;  5A3W A;  1YQ5 A;  4J1X A;  4WM7 C;  4E8D A;  5FZ8 A;  3ZXK A;  1PIV 1;  1TME 1;  3FX3 A;  1W3V A;  4YRD A;  5FZI A;  1NE6 A;  1XQN A;  2VC9 A;  3NJZ A;  3WF1 A;  4NIH A;  4YNI A;  4CUC A;  3ZFG C;  1F5F A;  4ZKT B;  5ANN A;  4PIY A;  4MSV A;  4MGT A;  4IW3 A;  5IJR A;  5FP4 A;  2EIG A;  3AX4 A;  1WCQ A;  4LHK A;  4EE2 A;  5K4L A;  2JD9 A;  1IS3 A;  2HWF 2;  2VR4 A;  5C3P A;  4XIK A;  1VAK A;  5EZW A;  4CXX A;  4UXA A;  1VBC 1;  5FK7 A;  1W3X A;  5L9V A;  2Y6K A;  4QDQ A;  1A78 A;  1PGL 2;  2CDO A;  2A6Z A;  3C7E A;  4MH0 E;  1S0C A;  2ZHN A;  2VZU A;  1GFF 2;  1UY3 A;  4A41 A;  2WS9 1;  3PIG A;  3NST A;  3IDE A;  1K5M A;  3PVN A;  3WW1 A;  4YVS B;  1OQD A;  4BQ2 A;  3UJO A;  2PHF A;  1VBE 3;  5ABJ A;  2WT2 A;  2GC3 A;  5F5C A;  4QKB A;  3VZO A;  3VBH C;  1EP0 A;  2Q8E A;  3BU0 A;  4XBL A;  3PME A;  2Z2S B;  1MVQ A;  2FDJ A;  1N3P A;  1XND A;  5T3N A;  3HAG A;  4AGV A;  4IEZ A;  1DDL A;  4JKL A;  1JZ7 A;  4UFK A;  5FZ1 A;  5DG2 A;  2QKD A;  4JRL A;  1ZRF A;  4BQ5 A;  2ZGP A;  3AL5 A;  4IEO A;  1D2S A;  1C3H A;  1K12 A;  4XFB A;  3N7M A;  5LY2 A;  2HWC 3;  3HEI A;  4WM7 A;  3GZE A;  2ZZQ A;  2XGX A;  4LOR A;  2C1F A;  3OF1 A;  4KL1 A;  1UCX A;  2VZT A;  4Y4Y A;  1MQT B;  4JZR A;  5FYZ A;  2RR1 1;  4NRO A;  3RI8 A;  4QM8 A;  3W5M A;  4E2G A;  3I8T A;  3CIH A;  4NAO A;  1VBA 1;  1JOP A;  1GOF A;  1TQ5 A;  1VAV A;  3ZFG A;  3UKN A;  4HXC A;  1DYO A;  2RS3 3;  3LEG A;  4KU8 A;  3I3Q A;  2IVI B;  1XNC A;  2PHX A;  5FY7 A;  3C7O A;  3DCQ A;  3JQW A;  2JEC A;  4GAZ A;  3O0W A;  3WW4 A;  5A33 B;  4E4S A;  5A3N A;  4E9K A;  1OPM A;  4WBB A;  3TB0 A;  1W2U A;  3I2H A;  4ATF A;  4K20 A;  2PMW B;  4F8A A;  5J3U A;  3ROU A;  2FDH A;  4JTO A;  3SH5 A;  5C71 A;  4C0H A;  3OUI A;  1W6M B;  2FCU A;  3ITQ A;  1UPI A;  3ZXL A;  1UKR A;  1R1A 2;  3IDA A;  5DAP A;  1DZR A;  4YZ1 A;  3VBH A;  3N36 A;  4XAE A;  3DYM A;  1ASJ 1;  1V70 A;  1NQD A;  5DAV A;  5ISL A;  4KH9 A;  3OEB A;  1ULF A;  4YFZ A;  4BK5 A;  2IXK A;  1V6K A;  2GAL A;  3LKJ A;  2D98 A;  3ALQ A;  3ELN A;  4PIX A;  2B9U A;  3FFZ A;  4R9B A;  3EXU A;  2W68 A;  3QBQ A;  1RHI 2;  4EJR A;  3WP4 A;  4YWA A;  4UAP A;  4GKY A;  2ZKN A;  5A3O A;  2XVG A;  1VRH 3;  2BU9 A;  4HK8 A;  1U12 A;  4X6R B;  4IXL A;  4JHT A;  1NKG A;  2CYF A;  1RTV A;  1OA4 A;  1VAL A;  3MIH A;  4I01 A;  5A7W A;  2WFF 2;  1J3R A;  4COZ A;  4BWO A;  2FBE A;  1WBF A;  2W9X A;  5I8T A;  5B4N A;  2G4I A;  3DF0 A;  1S2B A;  3K48 A;  4EN6 B;  2DUO A;  4Y1X A;  2MEV 2;  1F8V A;  1TE1 B;  1D2Q A;  2A3Y A;  2J1U A;  2R04 2;  2R07 2;  4Q4Y 2;  3RFR A;  1LOD A;  3UKT A;  1XYP A;  3WQB A;  1LED A;  2VVE A;  1H9P A;  5FYM A;  2UYB A;  1R08 3;  3EHK A;  2AAC A;  3ORJ A;  4FPO B;  4HT1 T;  5IVY A;  1GIC A;  3POI A;  3VV1 A;  2XQR A;  4FQ4 A;  3BAL A;  1KIT A;  2VPV A;  3KQ4 B;  2P4E A;  2P3K A;  3LDK A;  3T0A A;  3VBU C;  1PVC 3;  4BPZ A;  1JYC A;  4GJZ A;  4Q0S A;  1FT9 A;  5FZ6 A;  1EYB A;  5FZ7 A;  4TN7 A;  4XUO A;  2HEV F;  3OBZ A;  1DLL A;  3SLI A;  1AXZ A;  3D4K A;  3M3C A;  4LO7 A;  4QDR A;  4HET A;  1HRV 1;  1LOF C;  4DNY A;  2JDA A;  2P6H A;  2HYK A;  3D5O A;  2YFZ A;  3N9N A;  2FQP A;  2EAK A;  1JH5 A;  1AX2 A;  1RUG 3;  2HWE 2;  2WKK A;  2DCY A;  5DG1 A;  3WNM A;  5JSO A;  4W65 A;  1FNY A;  1ONA A;  1VB2 A;  4GWN A;  1O3R A;  2VZP A;  1FOD 2;  1VJ2 A;  5T55 A;  3USU A;  2A5Z A;  4CDQ C;  4OHZ A;  1UOG A;  2TUN A;  3NNM A;  3ZR6 A;  1G9F A;  5LEJ A;  1HQN A;  5HPO A;  4GH4 C;  2E7Q A;  4QB6 A;  1SDD B;  1DQ6 A;  3E6D A;  3LF7 A;  3OPT A;  1DQ0 A;  3MIE A;  4QMA A;  4W6W A;  3CLP A;  3WW2 A;  5F5I A;  3PUQ A;  1QJE A;  4NAM A;  4MZU A;  4V2V A;  2QQO A;  2VQU A;  5CKQ A;  4Y33 A;  4HKL A;  4YGD A;  5M0T A;  2VOK A;  5FLH A;  1MR5 A;  5FZO B;  3W5N A;  2VCB A;  3VBS B;  1WW4 A;  2UWC A;  4LHN A;  2R06 2;  2IXL A;  1US3 A;  4CUA A;  4NIG A;  4RHV 3;  3WNN A;  3VBU A;  2NM1 A;  5KHJ A;  4PLM A;  2HLE A;  1EY2 A;  1IPJ A;  2LS6 A;  2ADD A;  2PHD A;  2YGM A;  3MW2 A;  4F3J A;  1OLQ A;  2I45 A;  4OMD A;  2VUD A;  2JD4 A;  4PJY A;  1W9T A;  4YW7 A;  2OS2 A;  4M0N A;  1LOF A;  1LES A;  3GGL A;  2VG9 A;  3NO8 A;  2VQA A;  4Y20 A;  1QOO A;  4YM0 A;  1KFU L;  1MZ5 A;  5EV7 A;  4RFT 0;  4ARY A;  1VBD 2;  4CP0 A;  5FV3 A;  1HN1 A;  4E27 A;  1W90 A;  2ZAA A;  2ZX0 A;  4IEX A;  1AL2 1;  2J1R A;  4CDQ A;  1BZW A;  2XOM A;  3MV0 1;  5JOY A;  5FCC A;  5JMC A;  3BGA A;  3BUC A;  3KVA A;  1GBG A;  5JOZ A;  1LNS A;  3DL3 A;  4MO3 M;  4GH4 A;  1DLC A;  2VCM A;  1OPO A;  1JMU B;  5JPN B;  1LHW A;  1ZBE 2;  4RSU A;  2XH6 A;  4YZ4 A;  5LEK A;  1HXS 3;  3DUI A;  3MF6 A;  1PHM A;  4FFI A;  1VMJ A;  3VDD C;  4ZZ8 A;  3VZJ A;  2UYA A;  4QD2 A;  3ZSL A;  1NCR B;  1UMI A;  3ABZ A;  3OBR A;  5LWB A;  2VMH A;  4CCN A;  5E89 A;  1TMF 1;  2X8K A;  3I97 A;  4L2N A;  4RYD A;  1W28 A;  2R7E B;  2XB6 C;  1UU4 A;  1OSG A;  2RJK A;  3INA A;  4JV4 A;  4QX7 A;  4XF4 A;  4AED C;  4CUG A;  3UL2 A;  1QOT A;  5L9B A;  4HPK B;  3O1M A;  1ZM1 A;  4CYD A;  2WR9 A;  4DOU A;  4MG2 A;  1K45 A;  2YGL A;  3FMG A;  1AXK A;  5A6X A;  3ZKU A;  1UOB A;  2GME A;  5FYV A;  4AXO A;  2ES3 A;  1AR8 2;  1NXD 1;  1PO2 1;  2IVJ A;  1Q56 A;  1W05 A;  4JKM A;  2HWF 1;  3RS6 A;  1R09 3;  3OJB A;  2WDB A;  3V0A A;  1W6M A;  2YC0 A;  3CU7 A;  3KSC A;  3JB8 A;  2VXJ A;  2VGD A;  2O0O A;  4N53 B;  4N43 B;  4OI2 A;  3LEI A;  4HVR A;  2DVG A;  5I0R A;  2ETE A;  5AC9 3;  4AQS A;  1YJK A;  1J59 A;  3WW3 A;  4PIZ A;  4AEJ A;  4D0Q A;  4KWL A;  2ZAC A;  3ZDV A;  2DCK A;  4XFH A;  3IWZ A;  3VDD A;  4BCU A;  1VE0 A;  1CX4 A;  4XDQ A;  3WSO A;  4RD7 A;  1CAV B;  2XR4 A;  4HOO A;  1ENQ A;  1ZRR A;  4NMI A;  5D1I A;  4ES9 A;  3RG0 A;  2OYZ A;  2DFB A;  3PMS A;  3H8O A;  1PMI A;  4G4F A;  5F3E A;  4AED A;  1DBN A;  1UU6 A;  2VOV A;  4ITC A;  4XBN A;  3BTZ A;  1LEN A;  2HYX A;  2X29 A;  3NV2 A;  5KXC A;  1CVN A;  3IDC B;  1ZRE A;  4Q4W 2;  4BZ4 A;  2GU9 A;  3RSJ A;  1QJU 2;  1LOG A;  1B35 A;  3SKJ E;  4P02 B;  1YXW A;  5CB7 A;  2WLQ A;  3M3E A;  5GLZ A;  1D0G A;  3M3Q A;  3J7H A;  4C1W A;  5IAT A;  2QBX A;  2XQX A;  3HT1 A;  1ZZ6 A;  1DP0 A;  5FBJ A;  5FY9 A;  3BN6 A;  1UY1 A;  2JIG A;  4JQR A;  2VNO A;  5AFB A;  2VUJ A;  3BOP A;  1GWK A;  1AR6 1;  4FSJ A;  1F4A A;  1O8P A;  4PDW A;  5FP7 A;  4A3X A;  2RDN A;  2Y6L A;  2VBD A;  5CKN A;  1NCQ B;  1BXH A;  1REF A;  3BYW A;  1N1Y A;  3MLK A;  4IGQ A;  1V9U 1;  1WA6 X;  4N8M A;  2WWU A;  3BI3 A;  3N7K A;  3AVR A;  1VIW B;  5CNA A;  3H50 A;  1R1A 1;  2L9L A;  3VN4 A;  4CA9 A;  5I0D A;  1POV 1;  3R4S A;  2Y64 A;  4XF9 A;  1QNW A;  1PO1 2;  1EUU A;  2YPJ A;  2VBP A;  3LQC A;  3E97 A;  4PDW C;  5EP9 A;  1RHI 1;  1RL3 A;  4QQP A;  4DS0 A;  2WWS A;  1AZD A;  1LOA A;  3IT8 A;  1AYM 1;  3T08 A;  4DZG A;  5JXG A;  3U4X A;  2DCZ A;  1BJQ A;  2WNV B;  4R9D A;  4UW5 A;  1J84 A;  2VUA A;  1X36 A;  3C7F A;  3PHM A;  1DGW A;  1V0A A;  2A6V A;  4QKN A;  5FY4 A;  3NJX A;  4XHX A;  5LBC A;  1N1V A;  4LE3 A;  3ZFE C;  4JHZ A;  3JUU A;  1H8T C;  3J26 N;  4B4R A;  4YFW A;  1HV0 A;  2BFU S;  3J8F 2;  5DZF A;  1COV 1;  1DF0 A;  2QDR A;  4CP9 A;  5CFC B;  1VBB 3;  5ACA 2;  4JDM A;  3GAL A;  5H9P A;  2HWB 3;  2PQQ A;  4M3C B;  5DQ0 A;  2G19 A;  5I0T A;  4URA A;  5A7S A;  5FYS A;  2MEV 1;  2ZXQ A;  1OUX A;  1O59 A;  4Q0P A;  4AYU A;  5CG8 A;  4IV3 B;  2J1S A;  3VKM A;  1U5Z A;  5CFD C;  2X09 A;  1W6O B;  2C6S A;  4OZX A;  4DFS A;  3SXW A;  1GZW B;  1EAH 3;  4S2D A;  1QY4 A;  1SLI A;  2EIB A;  2QQN A;  1RUC 3;  1UY4 A;  1MEC 3;  2XBO 2;  4C8D A;  3E1F 1;  2B46 X;  1ZX5 A;  3ZPO A;  1Z7S 1;  4Y3O A;  4P9I A;  4XZU G;  3MO4 A;  3O7O A;  4L97 A;  4COV A;  4ORF A;  1RVF 3;  3U07 A;  2DTW A;  3POB A;  4NN0 A;  5FP9 A;  2WZP P;  3PU3 A;  5FLJ A;  1RUJ 1;  3MV1 1;  4IEV A;  3WV6 A;  4XE9 A;  3KCX A;  1ULG A;  2YUE A;  3GZT B;  4IDZ A;  4D69 A;  1IHM A;  5FZE A;  5DXD A;  2XJS A;  2CAU A;  1HV1 A;  3MLL A;  4RGA A;  3FBY A;  2V5D A;  4IGO A;  4CXW A;  3ZFE A;  3HNY M;  1O5U A;  4YVW C;  4B7K A;  2ZCW A;  1H8T A;  1RGS A;  4UFI A;  3AZV A;  1OC1 A;  4XET A;  5JIU A;  1VB4 A;  4Q29 A;  2JJ6 A;  4B1M A;  1JXN A;  3JBG 3;  5K9Y A;  2VM9 A;  3DEM A;  4CZS A;  1UO9 A;  4ASL A;  1ENS A;  4Y4R A;  1DQ2 A;  1OQE A;  4QHB A;  4HSL A;  3ZMN A;  3ZYH A;  2FDI A;  1N47 A;  3ETQ A;  3I7D A;  4LTA A;  2F17 A;  1MS4 A;  3WDW A;  2RDS A;  2W0X A;  1IS6 A;  4JAA A;  5CFD A;  4UW3 A;  1RMU 3;  5HI0 A;  3MIG A;  4MGQ A;  2FHR A;  3L9J T;  1EV1 1;  2VUC A;  1XYO A;  2QDN A;  3VL8 A;  3WQ7 A;  4BJ0 A;  5F1R A;  3O1R A;  3KM5 A;  4PI0 A;  1BEV 2;  2YC2 A;  2EXH A;  4ES8 A;  1JZ5 A;  1XE0 A;  1GQG A;  5A6Y A;  4TTG A;  3H0O A;  2D6P A;  2ZTN A;  2HWD 2;  4ISQ A;  4QX3 A;  1QHD A;  5FZB A;  3NW4 A;  4OI4 A;  5FZK A;  4AQ2 A;  4F7Z A;  1AR9 3;  1GP5 A;  4HON A;  3I2K A;  3ES1 A;  4XJ9 A;  3SCF A;  2YB7 A;  2DBN A;  3O5S A;  2OT7 A;  3KGZ A;  3KQR A;  4JGY B;  2JWP A;  4FOW A;  1RXG A;  4NRP A;  3CBN A;  5C5U A;  2IXC A;  5F6L B;  2BDR A;  3V0B A;  2VTX A;  1NCQ C;  3OGS A;  4M3C E;  4W6Y A;  2CGN A;  1NY7 1;  3CEW A;  5HV4 A;  5FZ4 A;  1LOE A;  4HVQ A;  5FIX A;  4MXW B;  2RS5 2;  1CON A;  2IXI A;  1S0G A;  2NPI A;  4YVW A;  1CAW B;  3ZSE A;  1LCL A;  2SLI A;  3H8U A;  4W4Z A;  1X82 A;  5GLV A;  3EB7 A;  3O1V A;  4QXH A;  3K77 A;  1RUI 1;  1UF2 C;  3BCW A;  2PLV 1;  4EN7 B;  3KV6 A;  3A21 A;  2BNO A;  4FPY A;  3OPZ A;  1UZY A;  2Q1F A;  4HLT A;  1LU2 A;  5H9Q A;  3R4D B;  3T2Q A;  1XB9 A;  4I3G A;  1M4W A;  4LA2 A;  4MGZ E;  4QKD A;  4KGG A;  2GP5 A;  2ZGT A;  1RUH 2;  3J7M A;  4RN5 A;  5C3S A;  1ZBA 2;  4XJZ A;  2W1S A;  1OVS A;  3I4I A;  3WG1 A;  5L7O C;  2WNU C;  1VMF A;  5F39 A;  4ARX A;  2UWB A;  1URX A;  3SIT A;  1HJF A;  4PQQ A;  4Y24 A;  1US2 A;  4WV8 A;  3K46 A;  1WW5 A;  3KF3 A;  4XJW A;  5FWJ A;  2VCA A;  4CDX C;  1FPN 1;  3I2J A;  4MGK E;  3AB0 A;  3M70 A;  1HRI 3;  5IYY A;  1WMX A;  5CU1 A;  2P34 A;  5I93 A;  1JOJ A;  3BU7 A;  4DPN A;  5A1A A;  1QQP 2;  2VJX A;  4L99 A;  4CEY B;  4N9I A;  1NCQ A;  3AYC A;  4CU6 A;  1JUH A;  2DU1 A;  3KHC A;  2YXS A;  1W0O A;  3DYO A;  1Y9M A;  5DUV A;  3RZZ A;  3S5Q A;  1BLZ A;  4YPJ A;  1GNH A;  1W6P A;  2ZZJ A;  5FZC A;  3O1P A;  1DU3 D;  3N3H A;  1QXP A;  2AUY A;  2YBS A;  2ERF A;  2X05 A;  1TG7 A;  5FZL A;  2BBA A;  3NJV A;  1JBC A;  3NWK A;  1FMD 1;  4FVV A;  1YQC A;  2YBK A;  5FMO L;  2J1V A;  5LAT A;  5C7G A;  3JCI A;  2ZAH A;  3E5X A;  5FZ0 A;  1IPK A;  4IET A;  1HB2 A;  4AK3 A;  1AYN 3;  3ACI A;  2TBV A;  3LD8 A;  3WEZ A;  3UGH A;  3SHR A;  1HDK A;  2DVA A;  3UGG A;  3VBO B;  1ODM A;  4KG0 A;  3GYD A;  4XQW A;  4GD4 A;  3D3A A;  4ASM B;  5LZ6 A;  2BUK A;  4YW3 A;  5BPX A;  5L7O A;  2WNU A;  3CMG A;  4HMZ A;  5FZM A;  5TSW A;  4Q4X 1;  2IFR A;  3APB A;  1Z78 A;  1XNK A;  3JD7 1;  4H14 A;  4QQL A;  2CHH A;  2E53 A;  2ZML A;  1K3I A;  1TNF A;  4BLI A;  4XJ8 A;  5FPV A;  4CDX A;  5CIS A;  1QXR A;  4PF5 A;  4DIQ A;  1BMV 2;  3DKW A;  2TNF A;  2XVK A;  1KEX A;  4LBK A;  3VBR B;  1VBE 2;  5A1L A;  4MYE A;  3CHX A;  5EIY B;  4OHX A;  5A1F A;  1S0E A;  3JQX A;  3D0S A;  3P5B A;  4Q4V 1;  1I3H A;  3DN7 A;  3KLS A;  4QX1 A;  3AL6 A;  5T5L A;  4OFG A;  2C26 A;  1MZE A;  1HN0 A;  4ZU5 A;  2HWC 2;  3EBR A;  3PUR A;  4R8H A;  4IEW A;  1F5J A;  4CTE A;  3AMH A;  4FFG A;  5J48 A;  2RMU 3;  4YM3 A;  5FYU A;  2VZO A;  1XJA A;  4AFA A;  1WUV A;  2G9F A;  3NMB A;  4XXA A;  1YQ8 A;  2PHL A;  4NHX A;  2RS3 2;  5SV5 A;  5JZG C;  4Z07 A;  1N3O A;  4PF1 A;  3AMP A;  4ZU4 A;  3D6E A;  1D4V B;  1OT5 A;  1QJX 1;  4AVC A;  5DAQ A;  2B8M A;  1IPS A;  3KD4 A;  5BYN A;  3QAC A;  3PVB B;  2AGS A;  4LBM A;  2NZ9 A;  4LKS A;  4FPC A;  1LHN A;  3RZG A;  4NJ4 A;  1YCI A;  2BJS A;  3FE5 A;  1CIY A;  4NO4 A;  1NA1 B;  5I8Y A;  4QPI B;  1PIV 3;  1TME 3;  5BNP C;  2VMG A;  4JGZ C;  1WZX A;  3ZSM A;  2D43 A;  5APA A;  4YYO A;  2XLG A;  4HL0 A;  1WCS A;  2A70 A;  1PM4 A;  1WLW A;  5ACA 1;  3S6P A;  3KT4 A;  4FAH A;  1X9P A;  4K40 A;  3VDA A;  4FTS A;  4RQP B;  4ZU7 A;  2XML A;  4LUL A;  1SHW B;  4LHL A;  2BV4 A;  3SH3 A;  3CJI C;  2WO7 A;  1C1F A;  1VBC 3;  1SG3 A;  3ILN A;  5FYH A;  2FDK A;  2EIC A;  3EMR A;  4N90 A;  2A3X A;  5FYB A;  3V64 A;  1W0N A;  4D6S A;  4H7L A;  5A3L A;  3VL9 A;  1VRH 2;  3NNF A;  4DY5 A;  1CIW A;  2WS9 3;  5GLT A;  1WWY A;  1UZ0 A;  3WDT A;  5FOB B;  3M2M A;  2G9G A;  2WA3 A;  5JZG A;  3TN9 3;  2XUE A;  5FZA A;  2CDP A;  2O8O A;  3AJY A;  4LBO A;  2DCJ A;  4O61 A;  4GMP 3;  3MZH A;  1NLQ A;  2QCS B;  3WCS A;  3LPG A;  3GZU C;  1R08 2;  3ATG A;  2VL4 A;  2ZX1 A;  1S2E A;  4D3W A;  1MAC A;  1UWW A;  3FL7 A;  4Y22 A;  2YYO A;  5FPX A;  1KDM A;  3WP5 A;  5FYY A;  5C3R A;  3B3Q E;  3IN9 A;  5BNP A;  1ZRD A;  2RR1 3;  4JGZ A;  2IXH A;  3RGB A;  3B5L B;  1PVC 2;  2PEL A;  3MIB A;  1VBA 3;  1YUD A;  3MUZ 1;  4AAX A;  3N7L A;  1OHF A;  4XFF A;  3H7J A;  4LLO A;  3SIS A;  1YFX A;  1H1M A;  3MUY 1;  5CIR A;  2BRT A;  2XJR A;  3RVH A;  4A7Y A;  3N9Q A;  4L92 A;  2JG9 C;  3IKW A;  2Z4F A;  4TWT A;  4P14 A;  4CPB A;  3CJI A;  3MW4 A;  4HN0 A;  1RUG 2;  3BVC A;  2FMD A;  5CAZ A;  4MGI E;  5HCA A;  3U1X A;  1V6M A;  5GZF A;  1BVV A;  4EWE A;  2ZEX A;  5FMD A;  1BBT 2;  2QFE A;  1DYP A;  2HWD 1;  4PCR A;  2FZ2 A;  2AH2 A;  5FFO C;  5A6Q A;  2NP0 A;  4YM2 A;  5IT6 A;  4AFD A;  1LB2 A;  4XYX A;  3GM8 A;  1ASJ 3;  5JXI A;  3NNG A;  3ZN6 B;  1RUD 1;  1OF4 A;  3HMY A;  4JQT A;  5F2W A;  5JLV A;  2D6O X;  3FLP A;  4X8N A;  5CEH A;  1OH4 A;  1WMD A;  2AYH A;  1SLL A;  4QGM A;  1UOJ A;  4CCL A;  3BPZ A;  3AK0 A;  3MI8 A;  1AVB A;  3OGR A;  4P5Y A;  5DUW A;  2LM3 A;  5FMC A;  3UV9 A;  1VRB A;  1QKQ A;  3QH6 A;  4Y5T A;  3NAP C;  2BWC A;  3PVO A;  3NJY A;  2WT0 A;  3TN9 1;  3WNK A;  2D6N A;  1RUF 2;  3GHN A;  4RHV 2;  5F5Q A;  4IES A;  2XJU A;  2CTV A;  1JI6 A;  2D3P A;  4GMP 1;  4IV1 C;  1JW6 A;  3H3Z A;  1CZT A;  1D4M 2;  2R1B A;  4BQ4 A;  4Z2A A;  5C3Q A;  5FO8 B;  1YWK A;  2ARE A;  3LPF A;  1F2N A;  2QQJ A;  3I2F A;  4XW3 A;  5D2A A;  4XMI A;  3LIH A;  4LOS A;  3RPQ A;  4BQW A;  2JG9 A;  5F32 A;  3IIA A;  4FOV A;  4R52 A;  4WM8 C;  1QXJ A;  1SPP A;  4ZS3 A;  3CL1 A;  4AVT A;  1UW8 A;  2OPK A;  3M8L A;  3T0D A;  4E8C A;  3AP9 A;  1PK6 C;  1ALY A;  1XNA A;  5IK8 A;  4A7K A;  1NA1 C;  4QPI C;  1G9D A;  5FPB A;  4B29 A;  1M06 G;  4QX0 A;  1LKN A;  3MW3 A;  3WUC A;  3ZVX A;  3ZXJ A;  1FV3 A;  2OVU A;  2P3Y A;  1C5I A;  1W0P A;  2IWG B;  4ZXE A;  1QJY 1;  2BWA A;  2QUO A;  4XUT A;  1HXS 2;  2P17 A;  3THT A;  1CPN A;  5K0U C;  4JX0 A;  4OI0 A;  2FCT A;  4H7M A;  1HRV 3;  4R9C A;  4DQA A;  1AL0 G;  1QH6 A;  3VZK A;  2YV8 A;  4ZHN A;  4AAP A;  4CXY A;  3NAP A;  4Z8B A;  5FXV A;  2CWS A;  2GP3 A;  4QPW A;  3DYP A;  4LKD A;  4FPK A;  4A42 A;  5IFP A;  1F15 A;  4MVT A;  3CO2 A;  1ENX A;  4FPE A;  4IV1 A;  3UES A;  3UKV A;  2OII A;  4OZO A;  5A32 B;  1H0B A;  4AI3 A;  4H3W A;  1W03 A;  3PVE A;  5KR7 A;  4OVE A;  4LBQ B;  1CAX A;  1AR7 3;  4QWN A;  4Y5Z 0;  3OBA A;  3ZXA C;  4AHY A;  2PYT A;  1MS3 A;  1LJ7 A;  3IM0 A;  3M3O A;  5JOX A;  3AP4 A;  4WM8 A;  3GBG A;  2R32 A;  3ZXE A;  1U5I A;  2V4A A;  1GU3 A;  4BQY A;  5B4X A;  2C9A A;  5FQ0 B;  2IFW A;  4CDU C;  4CP2 A;  1H8V A;  3FUQ A;  3UNP A;  1PK6 A;  1NYW A;  1R09 2;  4JKK A;  2DUR A;  3G6J B;  3GJB A;  4XBQ A;  1NA1 A;  1XU2 A;  5FPL A;  4YSF A;  4I2O A;  4CRQ A;  2WFP A;  3FHQ A;  1E5H A;  2DWR A;  3KB5 A;  4RR3 C;  2BOJ A;  3N9P A;  2VE1 A;  5AC9 2;  3DGT A;  4QU2 A;  5CKM A;  1NOV A;  2F6B A;  4BB3 A;  3PUI A;  4LBQ D;  4AGR A;  1PZ7 A;  1LHO A;  1RUE 3;  1GP6 A;  1HKD A;  1T2X A;  2WNE A;  3D8C A;  3POS A;  5C4W B;  1QJZ A;  4UBG A;  2OXB A;  1OA3 A;  5K0U A;  3RRD A;  3L2Y A;  2JDU A;  4GWM A;  1PGW 2;  2VZ3 A;  1DZQ A;  3LZZ A;  1GYK A;  4FPG A;  4QXC A;  3K2O A;  4Z82 A;  4OUM A;  4ERO A;  4WVM A;  4LBL A;  4KWK A;  5FP8 A;  2YG0 A;  2VZR A;  3KWV A;  1FX5 A;  4AHX A;  1KRI A;  2WQ8 A;  3HN1 A;  2YC4 A;  1CPM A;  3LDR A;  3KCC A;  4NWW A;  5EWS A;  3DPR B;  4AEK A;  5IVB A;  1HX6 A;  2GC0 A;  5DAW A;  1AL2 3;  1BK0 A;  4CDW B;  3ZX7 A;  4FPH A;  2ID4 A;  2PN5 A;  3Q8B A;  1SBD A;  1ULO A;  2VNV A;  4CCJ A;  2A6W A;  1XSQ A;  2EF6 A;  4EWA A;  4UF0 A;  1UXX X;  1W8U A;  4PBP A;  4AR2 A;  4FPF A;  3AJZ A;  1H2L A;  4Q0U A;  1AUY A;  4MET A;  1UNB A;  2IC1 A;  4QX8 A;  5DUU A;  4YVS C;  1SLC A;  4CDU A;  2XDV A;  2ZGU A;  2A6X A;  2UY8 A;  1CQ9 A;  3GCW A;  2ORZ A;  1E5S A;  1I6X A;  1TMF 3;  3H3L A;  3ZYF A;  1AR7 1;  1H2K A;  4RR3 A;  4XXP A;  1C8M 3;  1W9Y A;  4YGE A;  1IG3 A;  2BP6 A;  2BGC A;  3O1S A;  1EUT A;  4NPR A;  2P3I A;  2P3J A;  3TNQ A;  3VD9 A;  4Q8L A;  4N7U A;  4FTB A;  4I02 A;  4LO6 B;  4IE4 A;  2D44 A;  3RWN A;  1XNB A;  2A1X A;  3P3N A;  3W20 A;  1U5X A;  3B00 A;  1JZ4 A;  4J25 A;  1MQT C;  2OX0 A;  4K7J A;  1YEW A;  4RGK A;  2XLF A;  4UT5 A;  1OVP A;  2O14 A;  3DEC A;  4LNV A;  2C9K A;  2GZW A;  2Z69 A;  5FAX A;  1PO2 3;  3TEY A;  1UAI A;  3BIE A;  2HWF 3;  3AKT A;  1RUE 1;  4PQ9 A;  5LW9 A;  4OHV A;  2QZ2 A;  1JYX A;  2VO5 A;  5HV0 A;  1W8Z A;  5IVV A;  2PHU A;  2RJ2 A;  3FC0 A;  2ZMK A;  3CQO A;  1RIT A;  2BYV E;  3A0N A;  4I09 A;  3CKH A;  4FT8 A;  4YW2 A;  1LU1 A;  3GHM A;  3IMN A;  3KS7 A;  3WQ0 A;  1VBB 2;  2WUH A;  4YM1 A;  1YQ2 A;  3THC A;  3RZM A;  2HWB 2;  3PUA A;  3R05 A;  4YVS A;  3RMX A;  4WVV A;  3AP6 A;  4K8F A;  4O65 A;  2V5Y A;  1SFN A;  1H6X A;  1W8O A;  4V1P A;  5DPN A;  1LHV A;  2VTF A;  2RM2 1;  3ZXF A;  2ZBJ A;  2PAK A;  3ACG A;  4LT5 A;  3LSD A;  3K51 A;  2W39 A;  4AQT A;  3WP3 A;  1S0J A;  1EAH 2;  1H1I A;  2IZW A;  3PNA A;  1RUC 2;  1X9T A;  2W87 A;  3PIJ A;  3X29 B;  2GH8 A;  4IUG A;  4DUX A;  1SBE A;  4HK9 A;  4JTN A;  5AVP A;  4QXB A;  1MQT A;  3AXD A;  1RVF 2;  3C7G A;  2ZX2 A;  4LXL A;  1C8M 1;  1IKP A;  1Q43 A;  3H9A A;  3VDB A;  4RGG A;  2RE9 A;  4HG6 B;  4XF1 A;  2XJQ A;  2HH9 A;  1H30 A;  1QOS A;  3WHT A;  1AR6 3;  2VVD A;  3SKV A;  1G6N A;  3S0M A;  2QQU A;  1OQ1 A;  1CZV A;  2PAE A;  3NV4 A;  1W2O A;  4NR1 A;  5A33 A;  3VHN A;  1LGN A;  2Q4S A;  5FXZ A;  5H9S A;  5FKB A;  4KWJ A;  4XCA A;  4IER A;  1V9U 3;  4NHK A;  4AFM A;  1OF3 A;  3WY6 A;  2HEY F;  1BBT 1;  3PUS A;  4L9B A;  3R4U A;  4NPM A;  2JDP A;  2Y0I A;  2ZAB A;  5I0S A;  3JBG 2;  1R1A 3;  5FBZ A;  5FPZ A;  1OD3 A;  4BHP A;  1POV 3;  2GDF A;  5LAS A;  4D7S A;  2PHR A;  3TEX A;  2GNB A;  1PGL 1;  4O9G A;  3VBF B;  4XAB A;  4PLN A;  1UIK A;  2JEN A;  4GWI A;  4JRA A;  2R16 A;  1RMU 2;  4XJA A;  5GZC A;  1RHI 3;  3URF A;  3C3V A;  5DN2 A;  3MID A;  2ZPX A;  1AYM 3;  3NV1 A;  1U0A A;  2MNG A;  3BB6 A;  1E5I A;  2ZKL A;  4U2A A;  3MYX A;  1GMM A;  4IE7 A;  4AWD A;  3NQH A;  3Q8C A;  1RUF 1;  1SQ4 A;  1UKG A;  4BLJ A;  1HLC A;  4DIN B;  2D40 A;  2WAA A;  2ZJC A;  3M3I A;  3OY8 B;  1D4M 1;  2Q30 A;  1W8H A;  2CAV A;  1QIQ A;  1COV 3;  3HNM A;  3KV5 A;  4XJU A;  4CCD A;  2VTX J;  2RG4 A;  2A7A A;  3N35 A;  1SAC A;  4DXT A;  1AJK A;  4LIT A;  2MEV 3;  5GAL A;  2DVD A;  5I8S A;  3IAQ A;  1WLC A;  1YLL A;  5F2S A;  3ZYB A;  3G7D A;  2JDN A;  3SCH A;  4YGB A;  2JG8 B;  4R9A A;  3VD5 A;  5A7O A;  3MGU A;  1H4H A;  3SCG A;  1JYV A;  3HIF A;  3WCR A;  2ZHL A;  1UU5 A;  1UZV A;  1W04 A;  2WZ8 A;  2ZX4 A;  3B9C A;  3K75 B;  3VBS C;  3VUO A;  1GNY A;  5DUX A;  3Q8E A;  1Z7S 3;  4ONU A;  3ZIW A;  4PT6 A;  2A3W A;  1ND2 B;  1W6Q B;  1Z0H A;  2BTV C;  1FXZ A;  1QF3 A;  5L36 A;  1XU1 A;  4XAA A;  3E6C C;  1LRH A;  1QEX A;  1MS8 A;  1RUJ 3;  2ATF A;  2VQ0 A;  3FHA A;  2Y8K A;  5IAX A;  2VMC A;  1I9R A;  2DDU A;  2DYC A;  4FXK B;  4OCT A;  5C3O A;  1PVX A;  2B45 X;  3HOB A;  3BPS A;  3WG4 A;  4OYU A;  1ULD A;  3POW A;  2Y0O A;  3ACL A;  4D6Q A;  1NLS A;  3PTY A;  2CV6 A;  1V6L A;  3GBW A;  2R30 A;  5FPA A;  1DGR N;  3I2O A;  5DDJ 2;  5L9R A;  5E8A A;  1ZVF A;  3AZX A;  3TYJ A;  5A7P A;  4FFH A;  3DV8 A;  5EJ1 B;  4NIA A;  1MS1 A;  2B39 A;  5BNN B;  1ND3 B;  1QWR A;  2ZX3 A;  1NT0 A;  5DZE A;  3ES4 A;  1YIF A;  1ST8 A;  4COW A;  5JXJ A;  1HB1 A;  1V6N A;  2CU5 A;  1EV1 3;  1WCD J;  2WFF 1;  4XTM A;  5IUQ A;  2JB8 A;  1JS9 A;  3A4U A;  3KZ4 C;  1SEF A;  3POY A;  5FZO A;  1NCR C;  3VBS A;  3LIG A;  3HR9 A;  2VAU A;  3ZFF B;  2WC2 A;  4QDS A;  2R04 1;  2R07 1;  4KMQ A;  1WW7 A;  1W6N B;  4Q4Y 1;  2FMY A;  1AXY A;  4ZPI A;  5C9A B;  3ILR A;  5F3G A;  1OOP B;  2F4L A;  2BEO A;  3S5A A;  2DF7 A;  2Q8C A;  1I5P A;  2ZEY A;  3AKS A;  1L3J A;  4XUR A;  2BVV A;  2OZJ A;  3EYP A;  3T3Y A;  2Q1Z B;  2Y6G A;  1S0B A;  4Q0Q A;  3RZL A;  5EHD A;  1UPS A;  3ZIX A;  1MS5 A;  4NHL A;  4HKW A;  2XJT A;  1GZC A;  4OUL A;  4E2S A;  3HWJ A;  3RQ0 A;  1CGP A;  3UGF A;  4AEM A;  5C8C B;  1RUI 3;  4I0A A;  1UX7 A;  1YJL A;  2VW0 A;  4N43 C;  4UFM A;  2VVF A;  4N53 C;  4CCK A;  2PLV 3;  3TEZ A;  2HWE 1;  2PTM A;  3KV4 A;  4NE9 A;  4NRM A;  3WP6 A;  4A3Z A;  5A70 A;  3H8X A;  4DEV A;  4AI9 A;  1KXG A;  2XXZ A;  4IEY A;  1FOD 1;  2D5H A;  3OPW A;  4A6O A;  1UD1 A;  2ZGM A;  1CAU B;  3AZZ A;  3PLQ A;  4FPL A;  1ZZB A;  5LA0 A;  1A3K A;  4Y1U A;  4CU7 A;  2FZ1 A;  4B4Q A;  1NUK A;  3OYW B;  1LOC A;  1J1T A;  4LBJ A;  1NCR A;  1LOB A;  4GMP 0;  3NRU A;  4J1W A;  3FLT A;  5FRA A;  1G86 A;  1C5H A;  2YRO A;  5EQU A;  1CR7 A;  1SLT A;  5FDB A;  4WZF A;  2XJP A;  1YO8 A;  4BM8 A;  5BNO B;  1FPN 3;  5AVA A;  3FWE A;  1H2N A;  4LK7 A;  4OQ8 A;  1GZT A;  4NII A;  3H8R A;  1TZO A;  5FJH A;  3WDV A;  3BKZ A;  2FD8 A;  2ZGK A;  2BGP A;  3GZA A;  4HPK A;  4AW7 A;  1RB8 G;  2VZV A;  2R06 1;  3T2O A;  3POF A;  3P6B A;  1YIP A;  4DMI A;  1KDK A;  4DXZ A;  1W9F A;  1I1E A;  5IVC A;  2CY6 A;  3FHI B;  2WWJ A;  4JVA A;  4IND A;  1ZZ9 A;  5HBA A;  4N43 A;  1FMD 3;  4N53 A;  1TME 2;  4UFJ A;  1DQ5 A;  3W58 A;  4D6R A;  4TXW A;  3TWI A;  4MOA A;  3UYJ A;  1VBD 1;  2C4X A;  3K4A A;  3SEP A;  1F31 A;  4BYY A;  1QMJ A;  3TAY A;  4BQ3 A;  2X5I B;  2WNO A;  2V4V A;  2XWJ B;  5ERL A;  4UYB A;  3KT1 A;  4YG6 A;  4GZ9 A;  4AVB A;  3HJR A;  1IZ3 A;  2B7Y A;  2XWB B;  1VBC 2;  2EVX A;  3OY8 A;  1CAV A;  4XDP A;  4DB5 A;  1ZBE 1;  2GMP A;  4Q4X 3;  3ZYR A;  3JD7 3;  2AR6 A;  1O4T A;  2W5F A;  2WS9 2;  3N4M A;  4NHY A;  4HKO A;  1IG0 A;  1H6Y A;  4QPG B;  4XF3 A;  2WNV C;  3RDI A;  4K9S A;  2XKP A;  1XBF A;  5CZK A;  2WN2 A;  1VLN A;  4B8E A;  4EN0 A;  4UFH A;  4DXS A;  4FTE A;  2ZMN A;  4Q4V 3;  2WZR 2;  3DKQ A;  1VAM A;  4XF0 A;  4Z1V A;  2VOX A;  5CFC C;  3IPV B;  2N7G A;  4AVV A;  1SCR A;  4C1X A;  4H2A A;  4JDN A;  4CU8 A;  1BQP A;  1SDW A;  2GND A;  4B4P A;  5LY1 A;  2VNG A;  2RS1 2;  3I59 B;  4IV3 C;  4LQR A;  5C9A C;  1NXM A;  5BNN C;  4Y26 A;  1IS4 A;  3A22 A;  2RR1 2;  4IE0 A;  3UJQ A;  3OG2 A;  3RZK A;  3VHO A;  1AR8 1;  3I2G A;  3S7E A;  1JHJ A;  1VBA 2;  5E88 A;  4CEW B;  4OUE A;  1F35 A;  1UYY A;  3KF5 A;  3MDP A;  5F9T A;  4D7Y A;  4QPY A;  1X7N A;  5FUI A;  3ZLI A;  4GB3 2;  4S2H A;  5FY5 A;  2EAL A;  2GH2 A;  4GIQ A;  1IOA A;  4ZS2 A;  3U78 A;  5E1R A;  2G9Z A;  4XZP A;  4URT A;  2VZ1 A;  3I2I A;  1QJX 3;  1UN1 A;  2B5H A;  1XXN A;  3VDC A;  5GZE A;  2ZGS A;  2BVB A;  1YNA A;  2BGO A;  4CCM A;  5KXB A;  4MGY E;  3IBM A;  4S2F A;  3RI9 A;  3RWK X;  4QT6 A;  2VUL A;  2WII B;  3RMY A;  3ZYI B;  3ST7 A;  2WNV A;  1APN A;  1Q8S A;  4GKX A;  2MHF A;  1L7R A;  3AFK A;  1Y9Q A;  1ASJ 2;  2R6Q A;  3J8F 3;  4RA0 A;  3T2P A;  1GKB A;  3LDB A;  5KHG A;  5KXE A;  4DRV A;  3M4F A;  5ACA 3;  4K1Y A;  1YQ6 A;  1K5M B;  1UIJ A;  2WZE A;  3AMQ A;  4XIL A;  5T54 A;  4AI2 A;  3O0V A;  1OKO A;  5CFC A;  5ABJ B;  3O1T A;  4QQO A;  4Q4W 1;  3FBM A;  4M3C A;  4A45 A;  3HQU A;  4WZC A;  1QJU 1;  5I0U A;  1YHF A;  1UQX A;  2OA2 A;  5C9A A;  4IV3 A;  1XYN A;  2H0B A;  2JKX A;  4HSJ A;  4SLI A;  2K46 A;  2O8Q A;  3B9I A;  1PNG A;  4W8J A;  2VXR A;  4KBB A;  3TNP B;  5BNO C;  1IGO A;  4LBN A;  4TZD A;  5IK4 A;  1W6O A;  3M1H A;  3MEP A;  1GZW A;  3N7J A;  5JOW A;  2WRA A;  2VMD A;  4WM7 B;  1F4H A;  2VNR A;  1K5J A;  5FY0 A;  1UY0 A;  5J36 A;  4Q27 A;  4K1Z A;  3L2H A;  5FUN A;  1FNZ A;  5T5O A;  3WNL A;  5DZG A;  5J7M A;  3ZFG B;  4CCE A;  2Q8O A;  2UU8 A;  2VME A;  4P9Y A;  2OUJ A;  2R49 A;  2DV9 A;  1N3Q A;  4JGY C;  1K42 A;  3PTR B;  3LA2 A;  1XNT A;  4YW5 A;  5A80 A;  1AHS A;  1C57 A;  1ZZ8 A;  3KHB A;  2WO2 A;  1PO1 1;  1YI7 A;  3T4H B;  2YZ4 A;  5FR3 A;  1V6I A;  1QU0 A;  4GQ7 A;  4XCB A;  2BNN A;  5BXX A;  1JYT A;  5DDJ 1;  5FZ9 A;  3CDZ B;  3NNJ A;  1MS9 A;  5FO7 B;  1V6O A;  5HCH A;  3W21 A;  3AKR A;  1HRV 2;  1RJ8 A;  4IGP A;  4YZ5 A;  5JMO A;  3VBH B;  3OB8 A;  3SC7 X;  1MPX A;  4LO8 A;  5LBB A;  3I49 A;  2J1A A;  3MFC A;  2D93 A;  3FFQ A;  5IAV A;  4Q2F A;  5FZD A;  4C90 A;  2CL2 A;  2ZGQ A;  2ZEW A;  3RYK A;  1PMH X;  3J8F 1;  2Q0A A;  3P3P A;  4FXG B;  5GJ6 A;  3HD8 B;  1VPH A;  2NMN A;  5H9R A;  3OSD A;  4L11 A;  3VHR A;  1ZA4 A;  4FOQ A;  2CGO A;  2DVB A;  2QQW A;  4LPL A;  1W8T A;  3NV3 A;  2CWM A;  2RHP A;  2HWD 3;  1GQP A;  4LEJ A;  4YZ3 A;  5D21 A;  4BME A;  2V72 A;  1RUD 3;  4COY A;  5JAX A;  3U0Z A;  1JZ3 A;  1ODN A;  1PNF A;  5A7W B;  4HAN A;  2WO3 A;  5F7U A;  2BPA 2;  3DXT A;  1OKQ A;  1X8E A;  5IHR A;  4Q0V A;  3SMH A;  2XBO 1;  4JGY A;  1NLR A;  1QDC A;  2YDE A;  1RJ7 A;  1HB4 A;  2VZS A;  4ZY9 A;  4CEY C;  2J1T A;  1FAT A;  2I2S A;  4DEQ A;  1W8F A;  4P5H A;  3ZDS A;  1WLD A;  3J7L A;  1XE7 A;  4MXW A;  4OHW A;  4Y1Y A;  2BER A;  1W2T A;  1CAW A;  3NKT A;  1J58 A;  4M01 A;  4S2G A;  4LR4 A;  3V56 A;  4A4A A;  5JCT A;  1SFP A;  4IL7 A;  4IE6 A;  1WW6 A;  2H0V A;  3LSE A;  2Y34 A;  5CAD A;  1O6U A;  3OUH A;  1F9K A;  3RNS A;  4AHW A;  4I3P A;  5FZ3 A;  1RUO A;  2C24 A;  4GJY A;  5GZD A;  3HQR A;  4KQ7 A;  1AL2 2;  3VBO C;  2MPF A;  3AP7 A;  3F95 A;  3OGJ A;  4QM9 A;  5FXX A;  1S1A A;  2Z5W A;  2R1D A;  2J22 A;  4E2Q A;  4EWD A;  5J96 B;  2OQ7 A;  4N9H A;  2J7M A;  2YMZ A;  3MPB A;  4P9W A;  1NE4 A;  2JIC A;  4AHZ A;  4AI1 A;  4P9L A;  3USU B;  2OPW A;  1QJY 3;  2XL9 A;  2WLP A;  3H7Y A;  2GSY A;  4MXV A;  5FWE A;  3ON7 A;  1BEV 1;  5T5J A;  5K8S A;  2EXI A;  5ANQ A;  2P1B A;  3VBR C;  4M4P A;  2E32 A;  3W9A A;  1OMI A;  1QGL A;  2XHN A;  4BXF A;  4CEY A;  1TMF 2;  4YG3 A;  4L8Q A;  5JDB A;  5KBF A;  4HN1 A;  4C91 A;  4BDV B;  2G1M A;  1Y4W A;  5KHI A;  2D6L X;  1A6C A;  1YI9 A;  1I5Z A;  3R6S A;  4E4H A;  1JN2 P;  1HQL A;  2PHT A;  3I3B A;  1DGR A;  1BCX A;  3U37 A;  3VBU B;  3WUD A;  4WVW A;  4Q1P A;  2RS5 1;  3ETP A;  2QQL A;  3ILF A;  3B02 A;  4OI1 A;  2E6V A;  2VBB A;  3GNE A;  1T6G C;  1GP4 A;  4YW6 A;  1R1Z A;  4AVA A;  1PZ9 A;  1PO2 2;  2YFU A;  1H1A A;  4K6B A;  3JZV A;  1POV 0;  3AYA A;  3LE0 A;  2YBP A;  1D7P M;  3VBO A;  2A75 A;  4Y20 B;  5IVJ A;  1Y7B A;  1OXC A;  1POQ A;  5D8A B;  5F3I A;  3B93 A;  5I91 A;  1DYK A;  3WOG A;  4LK6 A;  4CDQ B;  3LB9 A;  5G04 L;  1RUH 1;  1NAE A;  3HPN A;  2TEP A;  1L7L A;  4QQ2 A;  1ZBA 1;  4Q5O A;  1NQJ A;  3AKQ A;  2HJI A;  4GH4 B;  1HB3 A;  3VBR A;  5JI9 A;  3Q8F A;  2JB4 A;  1XRU A;  2B42 B;  1XE8 A;  2WZR 1;  1FV2 A;  2CSG A;  5LRS A;  1CES A;  1UY2 A;  1PMJ X;  1DG6 A;  1STM A;  1WKY A;  2WN3 A;  3Q9O A;  1A8D A;  2A73 B;  2DUQ A;  3AMM A;  4RQP C;  4BU2 A;  2RDR A;  2RS1 1;  2WYS A;  2PA7 A;  1QQP 1;  1QDO A;  1MZF A;  5FMO S;  4LJH A;  3WF3 A;  3VKO A;  3WLU A;  2R0F A;  2HKX A;  2ZHM A;  1PM7 A;  2VZQ A;  3OOX A;  5HCF A;  1OD5 A;  1U5Y A;  1C4R A;  5LBE A;  2GN7 A;  2YHJ A;  3EJK A;  3LA7 A;  2X53 S;  3KVB A;  4KNC A;  3T1M A;  2YPD A;  4GB3 1;  3ME2 A;  3AZY A;  2VOW A;  2BZD A;  1AR6 2;  4CVU A;  4IE5 A;  1RIR A;  2W47 A;  3IAP A;  1KJL A;  4FP2 A;  3WDX A;  3B7M A;  3QD6 A;  1CN1 A;  3PU8 A;  4D8M A;  4R4X A;  1V9U 2;  1KQR A;  1O4Z A;  3HBZ A;  2D6K A;  4O9E A;  2XHK A;  5GLU A;  5BY5 A;  1FYU A;  3V0A B;  2K9Z A;  5JVV A;  2Y6J A;  5FKC A;  3ZN5 A;  1E5R A;  2J42 A;  2QQI A;  4XFI A;  1G7Y A;  1Y9G A;  4QPI A;  1PZ8 A;  4YZ2 A;  1QH7 A;  1S55 A;  1HW5 A;  3K4Z A;  5LA2 A;  1GSL A;  2E7T A;  4GWJ A;  3K3N A;  5C70 A;  4P08 A;  1BMV 1;  2KM2 A;  3KCY A;  5FK8 A;  3VDD B;  1AYM 2;  1DQ4 A;  2I07 B;  3EQE A;  1VBE 1;  4HZF A;  2W1U A;  4RQP A;  4UW6 A;  5EYY A;  3VD4 A;  5IW0 A;  4COU A;  4MLO A;  4BQ1 A;  4J6G A;  3U11 A;  3IMM A;  1C28 A;  2VMF A;  4P9X A;  5LK7 B;  4AED B;  2QE3 A;  1COV 2;  1FI2 A;  3BOW A;  5A7Q A;  2C5D A;  3H1W A;  4AI8 A;  3VZL A;  5J09 A;  1ACC A;  4FI9 A;  2HWC 1;  5T52 A;  4CU9 A;  2Q1M A;  1B35 B;  1KS5 A;  1TEI A;  1W8W A;  4A6S A;  1G9A A;  5C8W A;  1JTZ X;  2EA7 A;  3HNB M;  4LUK A;  2RM2 3;  3A23 A;  3O12 A;  4BE3 A;  2DUP A;  2BFU L;  1UYP A;  2DCT A;  1ULP A;  4QHZ A;  4LKE A;  3ZR5 A;  4H55 A;  2RS3 1;  3OTF A;  4UFL A;  4YGC A;  5GM0 A;  4C0B A;  4RS5 B;  3RYR A;  4CE8 A;  4PDW B;  2NYY A;  3OEA A;  3WNX A;  2H6C A;  1GUI A;  5C6C A;  4AI0 A;  1Z7S 2;  3VLB B;  2DVF A;  1J1L A;  2YY1 A;  2EXK A;  4I0W B;  4XAC A;  1DQ1 A;  3USS A;  3KGL A;  4P9G A;  4AZZ A;  1QNY A;  3BTY A;  1RUJ 2;  1E57 A;  1JYN A;  5JUV A;  1O3Q A;  2Y33 A;  1CD3 G;  5L19 A;  3MFA A;  2JE8 A;  4BIS A;  5JXH A;  1OFS A;  4QHO A;  2HBU A;  4M3C F;  5D8A C;  3T1L A;  4LHS A;  3B69 A;  4DUV A;  2OW4 A;  5F6K A;  1G9B A;  1BBT 3;  3WHU A;  2BOI A;  1GAN A;  5FJK A;  5F3C A;  2E51 A;  1JYW A;  2VW1 A;  1A34 A;  4XUN A;  4AE2 A;  5C5T A;  4HBN A;  5JWP A;  2ZOE B;  4Y5S A;  1UXZ A;  4DUW A;  1VRH 1;  3ZN6 A;  1DCS A;  5A7N A;  4CP9 B;  1NZC A;  1C1L A;  3N9O A;  4LMF A;  5JR2 A;  1EV1 2;  2WSU A;  1L7Q A;  4XDO A;  1ZA7 A;  3WD5 A;  1O91 A;  4Y1Z A;  1UZZ A;  1GOG A;  4A7Z A;  3MF9 A;  5FY8 A;  1RUF 3;  5FYT A;  2D3R A;  4B7E A;  2CGP A;  3AYD A;  2WIN B;  4XIO A;  5FOJ B;  4TSV A;  1D4M 3;  2C0Z A;  3SNM A;  3WF2 A;  4E4D X;  4EV0 A;  3ACH A;  3SEE A;  1JZ8 A;  2WBK A;  1MZ6 A;  1R08 1;  3O0X A;  2JDK A;  5SV8 A;  5DMY A;  1Q8V A;  4OHY A;  4D94 A;  4BMB A;  1AX1 A;  5A6Z A;  3I54 A;  1MEC 2;  2V09 A;  4NPL A;  4DXR A;  1NY7 2;  1PVC 1;  3KMH A;  4M00 A;  4ZON A;  5D8A A;  2GMM A;  4QX5 A;  1S2K A;  4YW1 A;  2WSV A;  2ORX A;  5J37 A;  3MIF A;  3E5U A;  1KGY A;  1XOY A;  1RUI 2;  4JCK A;  4Z2W A;  4XHB A;  4Q8K A;  2XLA A;  1OH3 A;  2PLV 2;  2W1W A;  3GJA A;  1ZZC A;  2WJS A;  1RUG 1;  4XFC A;  4NUB A;  3ZFE B;  5EJZ B;  1BKZ A;  3AYE A;  4SBV A;  4OQ9 A;  2AEY A;  1H8T B;  2W95 A;  5FP3 A;  2VMI A;  2ENR A;  1RYY A;  1WA4 A;  1J83 A;  4IEQ A;  4E4Z A;  5C4W C;  3NKG A;  3V65 A;  1DGW X;  1JU4 A;  3AVS A;  2HEW F;  4ET7 A;  5EJ3 A;  2XVL A;  5FY1 A;  5FZF A;  2ZGO A;  5GLW A;  5IVF A;  1HIX A;  1LAJ A; 
#chains in the Genus database with same CATH homology
 3C8X A;  5C71 A;  1OT5 A;  1XPW A;  4LKS A;  2BGP A;  3IDA A;  1PX4 A;  2VZV A;  3DYM A;  3T2O A;  1CIY A;  3OEB A;  3P6B A;  3VD3 A;  3GXU A;  1W99 A;  4UAP A;  3F2Z A;  5HXM A;  4QB2 A;  4TXW A;  3VDA A;  1CX1 A;  4MOA A;  2C4X A;  3K4A A;  1SHW B;  3SEP A;  4BXS V;  1NKG A;  1W9W A;  1SG3 A;  2EIC A;  2V4V A;  1W0N A;  2W9X A;  5B4N A;  3LEK A;  4GZ9 A;  4A44 A;  3HJR A;  1UZ0 A;  3WF4 A;  2J1U A;  3WQB A;  5LCW L;  2VQT A;  2W5F A;  2CDP A;  2DCJ A;  1H6Y A;  3LPG A;  2W91 A;  5CZK A;  2WN2 A;  3T0A A;  2VL4 A;  2QQK A;  4DXS A;  1UWW A;  3FL7 A;  3I3E A;  4XUO A;  4M4R A;  4KI5 M;  1PX3 A;  4QDR A;  3MUZ 1;  2JDA A;  4AAX A;  4CU8 A;  2YFZ A;  4LQR A;  3MUY 1;  3WNM A;  3A22 A;  4QAW A;  3OG2 A;  3I2G A;  1JHJ A;  2VZP A;  4OUE A;  1UYY A;  2Z4F A;  3T09 A;  4XVH A;  3T0B A;  5FUI A;  4BK4 A;  2ZEX A;  5HPO A;  4QB6 A;  1SDD B;  2VZ1 A;  3I2I A;  2KD7 A;  3VDC A;  2QQO A;  2BGO A;  2VQU A;  3GM8 A;  5JXI A;  3NNG A;  1OF4 A;  3W5N A;  2EID A;  2VCB A;  3CZU A;  2OKX A;  1OH4 A;  3IB3 A;  4P5Y A;  1L7R A;  3OGR A;  1US3 A;  1CZS A;  4CUA A;  3T2P A;  1NX9 A;  3WNN A;  4AG4 A;  1GOH A;  2HLE A;  2LS6 A;  2WZE A;  2W92 A;  4MAD A;  3WNK A;  4OMD A;  2B9V A;  1W9T A;  5F7U A;  4A45 A;  4BK5 A;  1JI6 A;  4Z2A A;  1CZT A;  3GGL A;  2RVA A;  2JKX A;  4ZZ8 A;  3LPF A;  4ARY A;  2QQJ A;  3I2F A;  4W8J A;  1HN1 A;  2W94 A;  3ZM8 A;  2J1R A;  3A7Q A;  2XOM A;  3MV0 1;  2VMD A;  3ACF A;  3BGA A;  1F4H A;  1UMH A;  1LNS A;  3T0D A;  4MO3 M;  1UYZ A;  4E8C A;  1DLC A;  1UY0 A;  1XNA A;  3WNL A;  4QX0 A;  2VME A;  2W1Q A;  4KWU A;  1K42 A;  1XNT A;  1UMI A;  3ABZ A;  4ZXE A;  1XC6 A;  2WO2 A;  4XUT A;  1JU3 A;  3I97 A;  4OMC A;  4RYD A;  4JX0 A;  2R7E B;  3CDZ B;  3WF0 A;  4QPW A;  3DYP A;  1W8N A;  4A42 A;  5IFP A;  5JMO A;  3OB8 A;  1MPX A;  1K45 A;  2E33 A;  3UES A;  2VCC A;  2J1A A;  4OZO A;  2ZEW A;  1PMH X;  4JKM A;  1JZ6 A;  3OBA A;  4LPL A;  2ZEZ A;  2WDB A;  1GQP A;  1GU3 A;  5B4X A;  3LEI A;  3JXS A;  3UNP A;  2V72 A;  3WNO A;  4JKK A;  1JZ3 A;  4D0Q A;  3FHQ A;  2WO3 A;  2DCK A;  5IHR A;  3FN9 A;  3PUI A;  1T2X A;  2VZS A;  4QX2 A;  4ZY9 A;  2J1T A;  2VOT A;  3WSO A;  3K4D A;  4DEQ A;  2VZ3 A;  2BER A;  2YG0 A;  2VZR A;  2X10 A;  1R64 A;  3WNP A;  4A4A A;  2WQ8 A;  3MBW A;  2HYX A;  2YC4 A;  2E26 A;  4UOJ A;  3GDB A;  3HN3 A;  3SKJ E;  4P02 B;  2RV9 A;  2WAB A;  2ID4 A;  3J7H A;  2QBX A;  1IQD C;  3AC0 A;  1ULO A;  2XQX A;  1DP0 A;  3BN6 A;  1UY1 A;  1UXX X;  1F4A A;  1O8P A;  3III A;  2J22 A;  2Y6L A;  2J7M A;  4MGS A;  3CZJ A;  2EIE A;  2ORZ A;  2L9L A;  5I0D A;  4XUQ A;  2XON A;  5CYY A;  4M4P A;  2Y64 A;  2E32 A;  1EUT A;  4UI9 L;  3UET A;  2XHN A;  3VD9 A;  1EUU A;  3LQC A;  2WAO A;  2E31 A;  5J1X A;  1JZ4 A;  4BDV B;  3T08 A;  5JXG A;  3DEC A;  2C9K A;  1J84 A;  3C7F A;  3I3B A;  3U37 A;  3NJX A;  3I3D A;  3ETP A;  4JHZ A;  2QQL A;  1P8J A;  5IFT A;  1JYX A;  2VO5 A;  2YFU A;  1BHG A;  2RJ2 A;  3CQO A;  3LE0 A;  5DQ0 A;  3CKH A;  1D7P M;  2ZXQ A;  1O59 A;  2J1S A;  2WUH A;  1TVG A;  1YQ2 A;  2X09 A;  3THC A;  4QB1 A;  3OGV A;  1H6X A;  1W8O A;  5G04 L;  2QQN A;  5DPN A;  2EIB A;  1NAE A;  2VTF A;  3HPN A;  1UY4 A;  3VD7 A;  5LA1 A;  3ACG A;  2W46 A;  3E1F 1;  4XZU G;  3MO4 A;  3PUH A;  2PQS A;  2W87 A;  1UY2 A;  4IUG A;  4DUX A;  1PMJ X;  1WKY A;  2WN3 A;  2WO1 A;  3MV1 1;  4ZZ5 A;  2WYS A;  3C7G A;  3VDB A;  3WF3 A;  4HG6 B;  2VZQ A;  2V5D A;  3HNY M;  3SKV A;  1CZV A;  3ECQ A;  2VM9 A;  4W50 A;  2BZD A;  1OF3 A;  4CVU A;  2W47 A;  3IAP A;  4D8M A;  1OD3 A;  4MGQ A;  4XUP A;  4BJ0 A;  2Y6J A;  2YC2 A;  1JZ5 A;  4GWI A;  2QQI A;  4TTG A;  4L0P A;  4QX3 A;  5DN2 A;  2QQM A;  3I2K A;  3K4Z A;  1GMM A;  5LA2 A;  5C70 A;  3NQH A;  4GWJ A;  4P08 A;  2YB7 A;  2B4K A;  2WAA A;  3THD A;  3C7H A;  2W1U A;  3VD4 A;  3HNM A;  3OGS A;  1JZ2 A;  1W9S A;  5G05 L;  2VMF A;  4DXT A;  3IAQ A;  2J1E A;  4W4Z A;  2LW8 A;  3EB7 A;  4CUB A;  3K77 A;  3P1I A;  4FI9 A;  4CU9 A;  3VD5 A;  2Y6H A;  3HNB M;  3A21 A;  1JYV A;  3A23 A;  2WZ8 A;  3K75 B;  3T2Q A;  1GNY A;  1ULP A;  4PT6 A;  2W3J A;  4RN5 A;  2W1S A;  4P00 B;  3OEA A;  1GUI A;  4ARX A;  3FHA A;  2Y8K A;  4PQQ A;  1US2 A;  2DDU A;  2VMC A;  3K46 A;  1O8S A;  2VCA A;  3HOB A;  3I2J A;  4OYU A;  1UYX A;  1JYN A;  5IYY A;  5JUV A;  5A1A A;  2JE8 A;  5JXH A;  2VJX A;  4CU6 A;  4LHS A;  3DYO A;  4DUV A;  4E8D A;  5EJ1 B;  4YPJ A;  2VC9 A;  3WF1 A;  2X05 A;  4CUC A;  1JYW A;  1TG7 A;  5JXJ A;  2BBA A;  4XUN A;  3NJV A;  5IJR A;  2J1V A;  5C7G A;  1WCQ A;  1UXZ A;  4DUW A;  2JD9 A;  2VR4 A;  3ACI A;  5JR2 A;  4QDS A;  4KMQ A;  1L7Q A;  2Y6K A;  4QDQ A;  3WEZ A;  2CDO A;  3C7E A;  2VZU A;  1UY3 A;  1GOG A;  4A41 A;  3D3A A;  3CMG A;  1I5P A;  2ZEY A;  4XUR A;  3EYP A;  3WF2 A;  3ACH A;  3SEE A;  2Y6G A;  1JZ8 A;  2WBK A;  1K3I A;  5DMY A;  1KEX A;  4JKL A;  1JZ7 A;  4DXR A;  5EIY B;  1K12 A;  1UX7 A;  3HEI A;  4QX1 A;  2ORX A;  2VZT A;  4A3Z A;  1KGY A;  4DEV A;  2C26 A;  3W5M A;  3CIH A;  1GOF A;  4A6O A;  2W1W A;  1DYO A;  3LEG A;  5EJZ B;  5LA0 A;  4CU7 A;  2W95 A;  1NUK A;  1RYY A;  2VZO A;  1J83 A;  3C7O A;  1JU4 A;  3NRU A;  4ET7 A;  4PF1 A;  3I2H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...