3C8XA

Crystal structure of the ligand binding domain of human ephrin a2 (epha2) receptor protein kinase
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
174
structure length
160
Chain Sequence
KEVVLLDFAAALGWLTHPYGKGWDLMQNIMNDMPIYMYSVCNVMSGDQDNWLRTNWVYRGEAERIFIELKFTVRDCNSFPGGASSCKETFNLYYAESDLDYGTNFQKRLFTKIDTIAPDHVKLNVEERSVGPLTRKGFYLAFQDIGACVALLSVRVYYKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Ephrin type-A receptor 2
publication title Architecture of Eph receptor clusters.
pubmed doi rcsb
source organism Homo sapiens
total genus 30
structure length 160
sequence length 174
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2008-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01404 Ephrin_lbd Ephrin receptor ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 3c8xA00
5CZKA 3UETA 4ARXA 4DXTA 2E26A 5DPNA 2X05A 1WCQA 1TVGA 3I3BA 1HN1A 4GZ9A 3WF0A 2EIDA 4RN5A 4JX0A 3GM8A 2WO1A 3WNKA 4D8MA 3MV01 2L9LA 1UY4A 3SEPA 4TXWA 5LA2A 3VDCA 2B9VA 3U37A 4LPLA 2C9KA 4P00B 5EJ1B 5LA0A 2BBAA 3IDAA 2E31A 4DXRA 4BXSV 2QQOA 3T0BA 4BK4A 3NNGA 3SKVA 4ET7A 4W8JA 3VD7A 2V4VA 3A23A 3DYOA 3BN6A 2W9XA 4OMDA 1F4HA 2ID4A 4GWIA 3C7EA 4RYDA 3VD4A 2Y8KA 3LEGA 4ZZ8A 2DCKA 1CZTA 1K45A 4CU6A 2J1TA 3I2HA 2HLEA 4MO3M 3WEZA 4DEVA 4KI5M 1P8JA 2JE8A 2VMDA 3OGVA 3ACFA 3MO4A 1JHJA 4DUWA 5CYYA 3IAPA 3PUIA 5JUVA 4QAWA 2RV9A 2J1EA 3ACHA 1J84A 3T2OA 4HG6B 2CDPA 4KMQA 2VZVA 2V72A 5F7UA 2QQNA 1J83A 2VQUA 2VZ1A 4AG4A 5HXMA 4M4PA 2QBXA 3PUHA 1W9TA 1O59A 5EJZB 3HEIA 3K75B 2VC9A 2VZOA 2W92A 4LHSA 5B4NA 1PX3A 5DN2A 5IYYA 1PMHX 3DYPA 4QB2A 4UAPA 2C4XA 2W95A 2Y6JA 5C7GA 1JU3A 1UY2A 1O8SA 2Y6HA 1GQPA 5FUIA 3A22A 5LCWL 1JI6A 4CU9A 3UESA 2YC4A 3LPGA 2VZQA 3NRUA 1R64A 2YFZA 4OYUA 3OEBA 1IQDC 2VCCA 4GWJA 4D0QA 2WUHA 2W1UA 3HN3A 1NX9A 1XNAA 5JXGA 3FN9A 3T2QA 2VO5A 2XOMA 2PQSA 5IFPA 3WNOA 1JZ2A 3I3EA 4UI9L 5J1XA 4P08A 2VZTA 2XQXA 4BDVB 4A45A 4MADA 3VD9A 3VDBA 1W99A 4Z2AA 3E1F1 5IJRA 1MPXA 2YB7A 4FI9A 2OKXA 2RJ2A 4JKMA 1UWWA 3WQBA 1JZ5A 3EB7A 2W87A 3OG2A 4DUXA 2WN2A 1GUIA 2Y6GA 3THCA 2VM9A 1PMJX 3K77A 1H6XA 3HNMA 3K4DA 1JYNA 3I97A 4JKKA 1CZSA 1UMIA 4A4AA 1L7RA 3C7HA 1O8PA 2LS6A 2WQ8A 2VZRA 2Y6KA 3WNNA 1YQ2A 4A42A 3HPNA 1JYWA 2W5FA 2EICA 4XUNA 1UY3A 3I2IA 3HNYM 3LE0A 2QQJA 1UY1A 4AAXA 3K4AA 3T2PA 1OD3A 2VMEA 3BGAA 1XNTA 1D7PM 1EUUA 2VZPA 3UNPA 1OF3A 2J7MA 3WF2A 1JU4A 4CU7A 1JYXA 3NQHA 4ARYA 1H6YA 3LPFA 2E32A 4DEQA 4W50A 4XUTA 3W5MA 2BGPA 1NAEA 1UYXA 2HYXA 2J22A 2WZEA 3ACGA 5IFTA 3I2FA 3MUZ1 3I2GA 2B4KA 4OZOA 1ULPA 3T09A 5A1AA 1W8OA 3I2KA 1WKYA 4XUPA 4XUOA 3CZJA 5HPOA 1DP0A 2JKXA 3AC0A 3OB8A 3MUY1 5G05L 4YPJA 2WABA 1UY0A 1OT5A 2C26A 5I0DA 1BHGA 2VZ3A 2VCAA 1JZ3A 1SHWB 2BGOA 2W91A 4XVHA 2JD9A 1UXZA 2QQMA 4LKSA 3CQOA 2QQKA 5EIYB 2W3JA 3P6BA 4QB1A 4JHZA 1US2A 2XHNA 2WO2A 2RVAA 1PX4A 1LNSA 2WN3A 2VZUA 2V5DA 2W47A 3CZUA 4M4RA 1GMMA 2KD7A 3NJVA 2ORZA 4L0PA 2VQTA 3GXUA 3I2JA 3LEKA 4CUBA 4PT6A 4OMCA 5JMOA 1SG3A 5LA1A 3LEIA 3SEEA 2DDUA 3WF1A 4MGSA 3MV11 3CMGA 2WYSA 4PQQA 2BERA 1UYYA 4PF1A 3C7GA 1JZ7A 3FHQA 1GOHA 4P5YA 4CU8A 1CX1A 3DECA 3T08A 1OF4A 1T2XA 3OGRA 1K42A 2VCBA 3C8XA 3K46A 1UXXX 2WAOA 3C7FA 4A3ZA 4QPWA 4P02B 3HNBM 4ZXEA 3IB3A 4JKLA 4QX1A 3C7OA 1US3A 4ZZ5A 3CDZB 2XONA 1JZ6A 1DLCA 3W5NA 3ABZA 1UMHA 3A7QA 4XURA 1EUTA 2W46A 5DQ0A 3HOBA 2Z4FA 1I5PA 2ORXA 3ZM8A 2J1UA 2WDBA 1JZ8A 2VJXA 2J1SA 2Y64A 2J1RA 5C71A 1RYYA 2ZEZA 2VL4A 2VZSA 2DCJA 3GDBA 1K3IA 3CIHA 3OBAA 3JXSA 4A41A 5JXIA 2ZEYA 3MBWA 4MGQA 1TG7A 5JXJA 2EIEA 4UOJA 1CIYA 3T0AA 3T0DA 4IUGA 2VMCA 2VR4A 3LQCA 5DMYA 3WNPA 3OGSA 3HJRA 4TTGA 1KGYA 3VD5A 1UX7A 1NUKA 4A6OA 4W4ZA 1K12A 4QDQA 1UZ0A 4MOAA 4XUQA 1GOFA 3NJXA 3WNMA 1JZ4A 3ETPA 1F4AA 2W1SA 2W94A 4CUCA 1NKGA 3D3AA 1W0NA 2EIBA 3ECQA 5B4XA 3I3DA 1L7QA 1KEXA 3VD3A 2Y6LA 2YG0A 4QDRA 4ZY9A 4E8DA 3WF4A 1W9SA 5JXHA 1SDDB 2ZEWA 5JR2A 2YC2A 2BZDA 4DXSA 2JDAA 2W1WA 3GGLA 2J1AA 3J7HA 4KWUA 3F2ZA 3SKJE 1OH4A 1GOGA 4CVUA 2W1QA 4BK5A 4OUEA 3OEAA 4QDSA 3FHAA 4QB6A 2LW8A 1JYVA 4CUAA 1XPWA 1W8NA 2QQLA 5G04L 1ULOA 4LQRA 1XC6A 3IIIA 3ACIA 5IHRA 4QX2A 4BJ0A 2ZXQA 4E8CA 4DUVA 3WSOA 3IAQA 3VDAA 5C70A 1DYOA 3EYPA 3CKHA 2WAAA 3FL7A 3K4ZA 4A44A 1W9WA 2R7EB 2WZ8A 2E33A 3THDA 4XZUG 3WNLA 2CDOA 2WBKA 2X10A 2ZEXA 2QQIA 2VOTA 1UYZA 2X09A 2WO3A 4QX3A 2VTFA 3A21A 3P1IA 4QX0A 2VMFA 2J1VA 1GU3A 1GNYA 1CZVA 3WF3A 2YFUA 3DYMA
chains in the Genus database with same CATH superfamily
5CZKA 2JDMA 3UETA 4EN9B 2VCMA 2C0ZA 5L19A 1R1A2 1ZBE1 1WCQA 2PLV2 1MZEA 5FZOB 5FZDA 1PVC1 1AYM1 5A6XA 3AMPA 2VW2A 3AB0A 2DCZA 1OVPA 1HN1A 4IERA 2YC0A 1V6IA 3T30A 5HV0A 2EF6A 4JX0A 5FBJA 3WNKA 1UZZA 5FP7A 4D8MA 5JCTA 4ORFA 2B9UA 2L9LA 2P5BA 3WP4A 5LA2A 4A7KA 3DGTA 3VDCA 3GBWA 5K4LA 4LPLA 5EJ1B 1C1LA 2FMYA 3IDAA 3TNQA 4IEXA 1SFNA 4NIHA 2R061 4Z92B 3ZR6A 1W03A 1ZRRA 4DXRA 1RXGA 2NYYA 1VRH2 1W3VA 2QQOA 4IEQA 5J98B 1QH6A 2GC3A 2ZTNA 3T0BA 3DV8A 3LA2A 4YVWC 4QPIB 4YFWA 4PDWB 4ET7A 4PQ9A 1VBB1 4MX3A 1GNZA 2WA3A 3S0MA 3RZJA 3IDEA 2ZGSA 4FOYA 3KGZA 5F5CA 3G6JB 5FYCA 3BN6A 4WM8A 3KMHA 3SCGA 1W8TA 2VE1A 4F3JA 2IC1A 4GWIA 1V9U2 1TME1 3GBGA 5J09A 2G19A 3QH6A 4LLOA 5LASA 4FOWA 1YI9A 5F3GA 1AR91 1S1AA 1SLBA 2WNUA 1DBNA 4C1WA 2F17A 1PIV1 1X9PA 5LRSA 4OHYA 3UGGA 3RFRA 2VVEA 5D8AA 2X5IB 5EP9A 5F1RA 4Y5Z0 1JODA 4DEVA 2WS91 2JE8A 2VMDA 3SCHA 3U1XA 3LB9A 3ACFA 3BTAA 4RL7A 4CDWC 4FTBA 4HKOA 4XYXA 3PUQA 1RVF3 2RDRA 4PJYA 5JI7A 1QQP1 1W06A 4R4ZA 2RMU1 1ZYBA 2AR6A 2ZKNA 3PNAA 4RD7A 2RV9A 3ZSMA 5L7OB 2J1EA 2R043 2R32A 4NO4A 4FTEA 1AHSA 3ACHA 2GN3A 4XE9A 4XHXA 1FOD2 3T2OA 2QQPA 1JXNA 5I0RA 3MIFA 2YBPA 1YFUA 5EJ3A 2V72A 4L92A 3HVDA 1N47A 1YJKA 2QQNA 3M3EA 4YYOA 1J83A 2VQUA 4AVSA 5BV6A 4PLMA 2W2IA 5C3QA 4Y24A 1XBFA 2H0VA 3R05A 1GWLA 4C91A 3CO2A 4Z07A 3SC7X 3AP6A 2OUJA 3JU9A 1VBA2 3RYPA 1F5FA 2W92A 5CADA 4A6SA 4B1MA 4AZZA 1QJU3 1PX3A 2A5ZA 4QXKA 1ZZCA 4QB2A 3LIGA 4UAPA 3SMHA 3ZX7A 4CPBA 4AEKA 2W95A 1OUXA 4PHZA 4PF5A 1LODA 3DPRB 3SH5A 1UY2A 2K46A 2V09A 3OPZA 4I0AA 4RS5B 2Y6HA 4P9WA 1GQPA 4Q4Y3 3A22A 2ATFA 2P6CA 3MIGA 2JG9A 1HXS1 4ITCA 3RVHA 4XABA 2WT0A 5K0UA 2PA7A 2ZGLA 2HEVF 5KXEA 4F83A 3E5QA 5FYYA 4AE2A 4OYUA 1VBE3 4D0QA 4CEYC 3ZMOA 4NHXA 1LR5A 4LA3A 2WO7A 5FK8A 4AI8A 1NX9A 4OUMA 4CP0A 4UW4A 1SEFA 4WM7A 3DEMA 5FPLA 4AGGA 1POQA 4P9JA 3IBMA 4AI3A 4H7MA 1YQCA 4LKDA 2VO5A 3WY6A 5D1IA 3BYWA 1ZZ6A 4UF0A 5A32A 2XOMA 1OC1A 1R092 1C8M2 2VH9A 1REDA 3P3PA 2WZR2 4C0HA 1IG0A 3MLLA 3QBQA 1C8NA 1RUI3 4P08A 5F3CA 5HCAA 1QJY1 1SPPA 4HANA 3ZXEA 5TSWA 2IUWA 1MQTB 2Z42A 2ARXA 2DTYA 3VDBA 1NCQB 1GZTA 4IL7A 3VZJA 1IPSA 1Q8OA 4AQ2A 4D6RA 2W68A 4OULA 1U5ZA 3E1F1 2FDJA 1MPXA 4DRRA 5DDJ3 2ARCA 1CAWB 4LO4B 2HWF3 2G9GA 2ZHLA 1IG3A 3EB7A 4GJZA 5JSRA 2W87A 3OG2A 2WT2A 2Y6GA 2W39A 2HWE1 4J1XA 1XNDA 2BJSA 3KD4A 3DCQA 3M4FA 1Q56A 3Q8FA 5BNPB 4W6YA 2AEZA 2PHUA 1AZDA 3V65A 4MGKE 4JTOA 1CZSA 4YZ4A 3RQ0A 4N43A 1AR82 5FR3A 1UMIA 2JG8B 1FV2A 2ZX0A 3KCYA 3OCPA 5E89A 5BPXA 3HIFA 3WR0A 1WZXA 3N7LA 2BFUL 4P9XA 5T50A 3IPVB 1JYWA 3AJZA 3T4VA 1NZCA 4Q0UA 3OUHA 1UY3A 3KQRA 4HONA 3HNYM 1UY1A 2P34A 3KHCA 4CEWA 3PIGA 4QKDA 1OD3A 1UKGA 1XNTA 4GH4B 1E5SA 5H9SA 1D0GA 1U0AA 3RGBA 2VZPA 4CCDA 2J7MA 1KITA 1LHNA 2OUHA 1PZ8A 1NE4A 2D5HA 2WQ4A 4YVSB 3RMXA 1IPJA 5DAPA 1OQ1A 3NW4A 2GU9A 5DXDA 2J22A 4ONUA 3D0SA 4Y1XA 4SBVA 4Q26A 4XBLA 4XCAA 5JAXA 1EV12 5A33A 4XDQA 3RI8A 3MUZ1 4ZHNA 5HCHA 2HH9A 1RUE1 4RQPA 1UZVA 5C3OA 5FMOL 1ULPA 3T09A 3POFA 1CAVB 2XVLA 3BOPA 2XUEA 3HQUA 4GXLA 5JR7B 5IT6A 3FHIB 4QQ2A 5LK7B 5HI0A 3ACLA 4L11A 5ANNA 5CFCA 3BUCA 4I02A 4FAHA 1FYUA 4IGOA 2TUNA 3ZFFA 1V00A 1UY0A 1OT5A 3B3QE 4JGYA 2WFF3 3ENRA 4EWEA 1MEC1 3OYWA 4FBFA 1LEMA 4XAEA 2WQZC 1AJOA 1PK6A 2VBBA 4HETA 2GNMA 5FY9A 3ASIA 2IXIA 4BOWA 1UXZA 2YY1A 2QQMA 2ZAAA 4LKSA 3M3CA 5LATA 3RYRA 4J6GA 4TYSA 4QB1A 5GM0A 3VZKA 1Q8PA 4JHZA 5GLUA 1MZ6A 1JS9A 1O91A 2SBAA 3NAPB 3BTZA 4KNCA 4JRLA 1WA4A 1I6XA 5LY2A 5DAQA 3M3OA 5LWBA 4LORA 4PCRA 5FZIA 3D4KA 1UF2C 2VZUA 2V5DA 1LRHA 1GMMA 4XIKA 4MHRA 3EQEA 3VDDC 1UU5A 2ORZA 1HRI2 4YW4A 2ZX1A 1HRV2 1BBT1 5C5UA 1OLRA 4LBLA 4PT6A 4CSWA 4OMCA 5A3LA 4NUBA 4XMAA 4RR3B 5JMOA 2OPKA 2ZGTA 5LA1A 1WLDA 5KHIA 3D5OA 3WF1A 2DDUA 4L2NA 5IVYA 2YPDA 3OJBA 2VOWA 1NLSA 3VLBB 1D4M2 4AF9A 4YVWA 3H8XA 3WP6A 3MV11 4BLIA 1C28A 3A0KA 5I8YA 4NIDA 1ODNA 2X8KA 1SCRA 2GNDA 4ISQA 1JZ7A 1GOHA 4CU8A 1RHI1 5FIXA 4HFSA 5F8PA 2EIGA 5LY1A 4WVVA 3EXUA 4FFIA 4KH9A 4GWNA 4LK7A 2XXZA 3C8XA 4Y5SA 1TEIA 3D8CA 2G1MA 4OI1A 4HVQA 5JDBA 3N9MA 1N3QA 3LSDA 2YPJA 5FY4A 2ADEA 1EPWA 1VAMA 1X33A 1XOYA 5E6HA 1AYN1 5I8SA 3C7FA 4BM8A 2ZABA 4A3ZA 4QPWA 3TN93 4P02B 1RUD1 3DN7A 5FLIA 4JKLA 4S2FA 2WZPP 3NKTA 2AEYA 3FBYA 1SQ4A 4ZU7A 4CDWA 1QXRA 2MHFA 1DLCA 2NZ9A 2WINB 2R071 3ABZA 3FZ3A 4IV1B 4W65A 2UY8A 4LULA 5DQ0A 1XSRA 2YU2A 3VBFA 5FYTA 5F9TA 2Z4FA 4GKYA 1I5PA 1VBD1 5LBBA 5AC91 5IK5A 3V0AB 1LCLA 3ZM8A 3MYXA 4Q4X1 2WDBA 2P3JA 1RITA 5H9QA 3T1LA 5FJHA 5C6CA 4I2OA 2XJRA 1SLTA 1WA6X 2QZ2A 1HJGA 1GP5A 4DOUA 5IATA 1ULCA 5CKMA 4EYUA 1SBFA 4LUKA 2F4LA 3H8UA 2UYAA 4XCBA 2RM22 4N53A 1H30A 1UW8A 2VQAA 5L9RA 4A7ZA 2MNGA 4CP2A 2PLV1 3IWZA 2VL4A 1V6NA 2A7AA 2DCJA 2VZSA 3K3NA 3N9NA 3RMYA 5LRRA 2A3XA 3IKWA 3J8F3 4MGTA 4MGZE 1K3IA 3OBAA 3O0WA 2XL7A 4YGBA 1SLCA 2E53A 4IETA 5EWSA 2WYFA 1LGBA 1F31A 3N9LA 3QCWA 3J7NA 1H1AA 2ZEYA 1AX1A 3BPSA 2HEWF 4FP3A 4XDOA 2IWGB 5FPAA 4LIVA 1CIYA 5C8CC 3OY8B 4P9LA 5IVCA 1TE1B 3GCWA 1N1TA 2VMCA 1RVF2 2VR4A 1JW6A 3LQCA 3NMBA 3WNPA 3FLPA 4LKEA 2ILMA 1CWPA 2ZHNA 1D2QA 2PXJA 5A80A 1KGYA 3VD5A 1HB1A 1W90A 3C3VA 3NV3A 2E7AA 2QE3A 2YXSA 2ZGRA 1COV1 2R042 4M00A 5CFDB 3NO8A 2P3IA 3O5SA 1YQ8A 4FPOB 4A6OA 4QD2A 4W4ZA 1HQWA 1GQGA 2EVXA 1UZ0A 2JX9A 1ZA7A 2EXHA 1HIXA 3W59A 2QDNA 4WVZA 4CEYA 1LGCA 1UYPA 1A78A 3ZPOA 2JKBA 1PGSA 2W94A 3NNLA 1NKGA 4QT6A 1DIWA 4IESA 2EIBA 3GJAA 3ECQA 4UBHA 4LKFA 4XJWA 2E9QA 3B9CA 1KEXA 3ZIWA 2PYTA 5JMCA 1D4VB 3KV4A 1CJDA 1QJU2 1W9SA 2HJIA 2P2KA 4DXZA 3ZYPA 3H3UA 4XIOA 4KBBA 4UYBA 1JYIA 2V5YA 4DQAA 2D43A 3H7JA 1W6OA 5DZFA 5T3NA 4Y20A 1VLNA 4JRAA 3LOIA 4QQPA 1H8TC 1RMU1 4Q4Y2 3Q8BA 5FZ1A 4YZ5A 1CJPA 2ZZJA 3P3NA 1OFSA 4I3GA 4FAGA 4IXLA 4XJAA 3ZXFA 2LROA 5KBFA 1GOGA 3MIDA 3QLQA 4CVUA 4XDPA 2RS53 3LEMA 5FP9A 5FZLA 1VBE2 2D97A 4QDSA 1MS4A 2H0BA 1H1IA 1OURA 3NJZA 4LBQA 2JWPA 4YW3A 2VXJA 3G7DA 2O1QA 4OQ8A 1OA2A 2CU5A 4QB6A 3OBTA 2LW8A 1AX2A 4XFFA 5ANQA 4AVVA 3NNMA 1RC6A 3ZYRA 4Q4V3 5F6LB 2JXAA 5FRAA 4OI0A 5G04L 1XU1A 2NN8A 4LQRA 2VVDA 2WNVC 1VB4A 1RUI2 5IUQA 1AXZA 3IT8A 5JOYA 5D8AB 3W20A 4K8FA 1H2MA 4QX7A 3WD5A 1LTEA 4Q0SA 4TSVA 3AXDA 3VDAA 5FY5A 4FTSA 3NV2A 3RYKA 1DYOA 5IVBA 1SACA 1IKPA 3VBUB 1BYHA 3B02A 1N3PA 2OZJA 1I3HA 4YLZA 1W9WA 1JOBA 2HWF2 1W0PA 3OUJA 3RWNA 2WZ8A 2BWCA 4XJ8A 1Z7S1 2ZKLA 3U4XA 1OD5A 3WNLA 2CDOA 1KS5A 2WBKA 1BZWA 2OW4A 2VTXA 1D2SA 5FTTC 2ENRA 2VOTA 1UYZA 4HKWA 2X09A 4M3CF 2JDYA 4Q4W3 2VTFA 2WWSA 3A21A 4QX3A 4BH9A 3W58A 4EQVA 1J3PA 5C4WC 2RS11 3JD73 1CAUA 2PHLA 2J1VA 1A8MA 2WZR1 4LO5B 4PIXA 4XFIA 1GNYA 3QD6A 1CZVA 1GR3A 4AEDA 1ZZ9A 1C8M3 3VN4A 1N3OA 4ARXA 4HLTA 4DXTA 2DURA 3PUAA 3UJQA 4JHTA 5FV3A 2X05A 4QWNA 1VBC3 1W2NA 4QHBA 4E27A 1SZBA 1S0IA 5H9RA 5JZGC 3ALQA 1R081 3MHZA 3ZKYA 3USUA 4LBOA 2EALA 1GNHA 3DXUA 3WF0A 2EIDA 3ILNA 2VAUA 4RN5A 2R49A 2WLPA 5D2AA 4AVAA 4WVMA 1V6OA 1VRBA 2OT7A 3H50A 2DU0A 4GA9A 2LUWA 1UY4A 4XMIA 4YW1A 1VMHA 2BOIA 4QPGB 4EN6B 4IEPA 3U37A 2XBO1 2C9KA 2BBAA 3OOXA 4WVWA 1X9TA 1LENA 2GNTA 1AL23 1QJZA 2BYVE 3GCXA 2E31A 2BPA2 3VBOB 2D6PA 4BXSV 5J96B 2HWB2 3AM2A 1KXGA 1G9AA 3ZYBA 1AR83 2HWC3 5C3RA 4WM7B 1AR72 3SKVA 4JGZC 2BQPA 2WWJA 1UU4A 3AZZA 3PIJA 1HQLA 1IQAA 4MH0E 2XJTA 1S0GA 4UF0B 5FLJA 1RUH2 3VDDA 1W04A 4OMDA 4GMP1 1Q43A 3ZSJA 5A7SA 5BNNC 2OIIA 4ZZ8A 1MS3A 1SPPB 4NIGA 4JDNA 5KC5A 4YSFA 2RS31 2WFF2 3VB9A 1PO21 2WWUA 4CU6A 2VECA 2J1TA 5IK4A 2N7GA 3AL6A 3Q8AA 3KWVA 1H9WA 2JIGA 3TWIA 1A34A 3LIHA 2GMEA 3ZVXA 3NVCA 4OCTA 3WEZA 3WXPA 1GZ9A 4KI5M 1YIFA 1XXNA 3OGVA 5JVVA 4MV2A 3U4SA 2HWD1 2ET7A 4OVEA 2HYKA 1JHJA 4N8MA 5CYYA 4DUWA 3R0RA 3DUIA 4MGIE 1QH7A 1QIQA 3ZKUA 5DG1A 3O1RA 2QNKA 3KV9A 1LU1A 3MDPA 3VBHA 3ZYGA 3PVOA 1J84A 4OHVA 3RI9A 5ABJC 3BI3A 1RB8G 1C1FA 2CDPA 4HG6B 4PI2A 2BBVA 4KMQA 1XE8A 1E57A 1ND3C 1QJFA 3O0XA 3WP3A 5F32A 3NNJA 1ZZ8A 1Y3TA 1DQ1A 5DUVA 5CAZA 1EP0A 2VZ1A 2GC2A 3WG4A 1NA1C 3GNEA 1V6MA 2VNRA 1S2BA 1YFYA 2ARBA 3FFQA 3GHMA 4GALA 4LITA 4NAMA 5EJZB 1ASJ1 1O59A 2BOJA 4QQLA 4CEWB 1YQ5A 1QEXA 2VC9A 2VZOA 3K75B 4GB33 4H7LA 5LB6A 1OLMA 3DKWA 4OUSA 2YV8A 3VL8A 4NHYA 1C4RA 2GMMA 2OX0A 3VGIA 1DLLA 2WLQA 1N1SA 4HSJA 1SFYA 5FPBA 3DYPA 4N7IA 5J36A 3MZHA 2C4XA 2KA3A 3ETQA 4UXAA 3H8RA 1FV3A 1PZ9A 4HZFA 2K9ZA 3WUCA 1NQDA 4NMIA 1IS4A 1QJX1 2Y6JA 5DAVA 2KR2A 1HB2A 4BQ2A 3N7JA 2JIJA 2MPFA 2ZGQA 4LTAA 2K0GA 3AZYA 1JOPA 1QJEA 3ZFEC 4CCKA 1LJ7A 2YMZA 1JI6A 3OGJA 2VUCA 4RQPB 3ZFGC 5CNAA 4YGCA 2QFEA 3TN92 4AVCA 2VZQA 1HRI1 3NRUA 4COZA 5A3TA 5FP3A 5C3PA 5FZ9A 5GZGA 5C8CA 2P1BA 2CWSA 1LOBA 1S0JA 5BNOC 3FE5A 5CFCB 1XNAA 1NLQA 5FY1A 2KXLA 5JXGA 2P17A 5LBCA 3T2QA 1RUC3 4KWLA 1POV3 2B5HA 1D4M1 3ZFFB 3AKTA 5A3NA 2PQSA 5BUVA 1L7LA 4JGYB 5IFPA 3NV1A 3MEPA 3SCFA 3AZWA 4DMIA 3HR9A 1SLIA 4Y1YA 3KV6A 3BTXA 5J1XA 1WUVA 1WCSA 4AR2A 1PK6B 1RUF1 2VZTA 4A45A 4Y1VA 1F35A 3VD9A 2ARAA 1PZ7A 4MUVA 2VPVA 4IEYA 1JHNA 3MPPG 3J8F2 1RGSA 3Q9OA 3M70A 2YB7A 1K5MC 2Q1FA 4YG3A 3ZSEA 4FI9A 3IMNA 2VOVA 3WQBA 2TEPA 4Q8KA 2A70A 4XOGA 3E5XA 5I0UA 4DUXA 3OPTA 5EQUA 4XFCA 2WN2A 3HMYA 3THCA 1AXYA 3BU0A 3K77A 4EE2A 3K4DA 3ZYJB 2FD8A 4I0BA 2UWAA 5KXBA 1QDCA 2CV6A 2FCTA 3POYA 2LRPA 3UL2A 2ZGPA 3HBZA 2QJVA 4CDUC 4A4AA 3L2YA 4YWAA 3C7HA 3OGGA 1NCRB 4XQ4A 1O8PA 3ST7A 1H8TA 4IEWA 3X29B 2FCVA 1UAIA 2MEV1 2Y0IA 5GALA 3OPWA 1YQ2A 4NRMA 4A42A 5J7MA 5KHJA 3EHKA 1ZBE3 4XUNA 1VAVA 1PVC3 1AYM3 1S0FA 1PNFA 3I2IA 3LE0A 1NYWA 4RGKA 1V6KA 3Q8CA 3S57A 2ZZQA 4AAXA 2RM23 5F3IA 3K4AA 5CG9A 2O0OA 3T2PA 2VMEA 3PDQA 3U07A 1YUDA 3LFIA 3PVNA 3VHNA 4OLLA 5A6YA 2LALA 2VBDA 4JVAA 1JU4A 1B35B 2ZGNA 1JYXA 3DF0A 1NZIA 4KGQA 2XL9A 1H6YA 3LPFA 3LZZA 5CKNA 2NMNA 3VUOA 2NM1A 2WNVA 5JOWA 1UYXA 2HYXA 4M3CA 3N3HA 3ACGA 4PDWC 2XWBB 3MLJA 1Z0HA 5L9BA 3R4UA 5KHHA 2JDPA 5LBEA 4CXXA 1ZBA3 4MXWA 4META 4CDWB 3L9JT 1NE6A 5FYMA 5FXXA 5A1AA 1J1LA 1M4WA 2P37A 5ACA1 2CWMA 1RINA 2R041 5FZ0A 2ZOEB 5FP8A 3VBFB 4QPYA 3VBRC 2P3KA 3MFCA 4HVRA 2QQWA 4NHLA 4EWAA 5HPOA 2GH8A 3AFKA 1Q3EA 3D82A 5G05L 4BU2A 1HLCA 5SV8A 2WNOA 4CP9A 2RS52 3O1SA 2D3RA 3JUUA 4BMEA 3S7EA 2XVGA 4N53B 4E2SA 4EJRA 5J48A 2PHXA 2VUDA 1ZA4A 2C26A 2RE9A 3SISA 3FUOA 4XQWA 5C4WA 4DPNA 4Q4V2 2ZGKA 3U75A 1JZ3A 3M3IA 1SHWB 3LKJA 2W91A 4LJHA 3I3MA 3U0ZA 1W6PA 4FFGA 3BALA 3ZXDA 4I09A 5L7OC 1FMD1 3A0NA 2WL1A 3KT1A 5A7NA 1WCUA 1W9FA 1LECA 3ES4A 3FJSA 3I3QA 5JZGA 4OFGA 2XHNA 5IAVA 4LHKA 1BKZA 4Q4Y1 4G9SB 4OZXA 1ZRCA 2VOXA 3PUSA 5DABA 3SQOA 4AI0A 3CZUA 4M4RA 4Q1PA 3B69A 4FPEA 4UWDA 5FQ0B 2DFBA 2Y60A 4I3PA 1OVSA 1VBE1 2JDUA 2VQTA 3GXUA 3KT7A 4TZDA 3I2JA 1LOCA 3BIEA 1HKDA 2GH2A 1QOOA 2DVFA 5FMDA 4YGEA 4Q4W2 3ZLIA 3H3ZA 1T6GC 4CEYB 1AVBA 3LEIA 4P5HA 3TEZA 1DYKA 1ZREA 3JD72 3N9OA 4A3XA 4JGZA 4K9SA 2WYSA 4PQQA 4RS5C 3ZIXA 2ETEA 2Y38A 3O0VA 2R6QA 5LA9A 2WNEA 4LO7A 3IN9A 3FHQA 2C9AA 1WBFA 1CX1A 3DECA 3M8LA 1VBC2 4HT1T 5BNNA 4SLIA 1CONA 2VGDA 5HXVA 1DGWA 5C33A 1HXS3 2CHHA 5DDJ1 4XFHA 3VZOA 3WV6A 4KL1A 1WCDJ 1X36A 1W6OB 2DVBA 4PIZA 4D6QA 5C71A 1V6LA 3O1PA 2QDRA 3P5BA 4QX1A 4PIYA 2HKXA 1VALA 4UFHA 1BMV2 1IS5A 4IGQA 4ZZ5A 1CAXA 1IGOA 3IZOA 3W5NA 1UMHA 3M3QA 2ZGMA 3B94A 4CCNA 1AL22 5HBAA 2X53S 1Y9GA 3HOBA 1MQTC 2QQUA 4LBQB 1NCQC 2GAUA 2J1UA 5A7WA 2LM3A 1URXA 1XSQA 2HWC2 3WDTA 1JZ8A 1MACA 1G8WA 3KSCA 5A3WA 5ABJA 2BUKA 3TOJA 1BK0A 2IXLA 5K8SA 2A3YA 3PVEA 1K5JA 2DFCA 2ZEZA 5E8AA 1ND3A 3UYJA 3GDBA 2A71A 3O1TA 1NA1A 2XKOA 3AKSA 5BNPC 1W05A 2V4AA 2IFRA 2ZMLA 2R1DA 2YUEA 5FZHA 3BTYA 3JXSA 1ST8A 1BCXA 3JQXA 1RUJ1 4KBZA 3M1HA 5A7QA 2HWE3 1A3KA 3MW3A 1G9BA 4U2AA 5CIRA 2AACA 4MHUA 2R30A 1SLLA 2EIEA 4ISRA 4UOJA 4XPVA 3URFA 3ZXAC 4C1XA 3ZXGA 2R0HA 3T0DA 1IPKA 4IUGA 3O1OA 2FZ1A 2Q5TA 1OLME 3NWKA 5DMYA 4YM1A 3BU7A 3RWKX 3K2OA 5T5LA 3H8OA 4E4SA 3HJRA 4UFJA 1G9CA 4TTGA 1JMUB 2OYZA 3ZO0B 3HWJA 3ZFEA 2HWB3 1UX7A 3TB0A 4GH4C 4TN7A 4BIOA 2DU1A 1NY71 2VY0A 2PAMA 2YYOA 3V64A 3ZFGA 3AMHA 1AR73 4COYA 3E5UA 1CAUB 1K12A 4QDQA 1FPN3 1W2OA 1GP6A 3Q8EA 4BQ5A 4Z2WA 4YVSC 4AEDB 4JV4A 1PNGA 1OLQA 3GZAA 1H9PA 1RUH3 4XUQA 3WNMA 4CCCA 2BNMA 4ZONA 2D6OX 5BNOA 4CXYA 1F4AA 1T6BX 1TMF2 3ORJA 1W8FA 3D3AA 1MZFA 5IVJA 3FFZA 4MVTA 1CGPA 3T4HB 3WX5A 4DNYA 2DF7A 3PLQA 1PGL2 4XACA 3VD3A 3RZLA 4GB32 2YG0A 3MW4A 3PTYA 4TWTA 4QDRA 4INDA 4ZY9A 3ZSLA 2O8QA 5CU1A 3WHUA 4H3WA 1W3XA 5JLVA 5JXHA 1SDDB 3D6EA 3KZ4C 4JQTA 1OQEA 1ZRIA 2YC2A 1OPOA 4K1ZA 1O4YA 3CJIB 3VHRA 1LHWA 2GC0A 3POJA 5IAXA 2BZDA 2R0FA 3PL0A 5K7PA 4BYYA 2JDAA 2UY9A 3BPZA 1K5MA 2VULA 3GGLA 4FPCA 1X7NA 2C5DA 4L9BA 2E51A 3J7HA 2GN7A 4R9AA 3OSDA 5A7OA 4KWUA 1REEA 4CP1A 3GYDA 4IGPA 3AMQA 1MS0A 1U5IA 5K9YA 1YNAA 2W52A 3M7AA 2B39A 2W1QA 5L73A 1Y9MA 3NL1A 2QZ3A 4FOVA 5DUWA 2Q1MA 3APBA 5L36A 1V6JA 2A3WA 5BY5A 1W2AX 2BW8A 3FHAA 1MEC3 1PGW1 4RHV3 4XILA 2AC1A 3VDDB 2HEYF 2RR11 1ENRA 4CDUA 1JYVA 1UD1A 1BEV1 1RUC2 1H4HA 3KS7A 1H8VA 1PMIA 1Q8VA 2ZJCA 3NAPC 4E4DX 4RGAA 1XC6A 4OHZA 4BPZA 2D3PA 5FZ4A 4BJ0A 1MZ5A 2PAEA 1UPIA 1AR61 2WFPA 2ZXQA 5GJ6A 4E8CA 5BYNA 4NOTA 4QX5A 4LNVA 1EAH1 3TEWA 2F6BA 5J37A 4IV3B 3RZMA 2XHKA 5A3MA 2A6WA 3CKHA 2IXCA 3V0BA 4YW7A 2PELA 2WAAA 2UWCA 1SDWA 2ET1A 4RR3C 5I93A 3TN91 3OD0A 1BBT3 3VBHB 4XZUG 1UOGA 3H1MA 3WINE 3VD4A 2OS2A 5FY8A 2X10A 1PO13 4PDWA 4Y22A 1N1YA 4YM0A 1KFXL 2YBSA 2WO3A 5FZKA 1FNZA 3AK0A 3P1IA 5ERLA 4QX0A 1BK1A 4M3CE 1A6CA 4V2WA 2P3YA 1F5JA 3VBSC 5FZFA 3THDA 4FFFA 3MW2A 3WF3A 2JDZA 2GNBA 3VBRA 1DCSA 3ILFA 2YFUA 1O5LA 2CYFA 1WD4A 4FPHA 1ZBE2 3BODA 3OD4A 3N4MA 2E26A 1QWRA 4UW3A 5DPNA 4AXOA 4B4PA 1PVC2 1AYM2 1PHMA 1GANA 3ZN6B 3J8F1 4CZSA 1OQDA 1TVGA 3NJYA 3OUIA 1R1A1 4NR1A 3S5AA 2NPIA 2G4IA 1XRUA 1AYN3 1E5RA 3TYJA 4LMFA 1RUD3 2I74A 1W39A 2B46X 3GM8A 5FK7A 4FQ4A 2WO1A 1AUYA 1QNYA 1KJRA 2YU1A 4C90A 2BVVA 3SEPA 4TXWA 4AHXA 3KCXA 4YW6A 1ZNPA 3AP7A 4YG0A 2R062 3OF1A 4LBNA 2NQYA 1O7FA 1OOPB 1AF9A 5AC93 4XFGA 1VIWB 5J3UA 2A6VA 2JB8A 4BISA 1ZBA2 2EXJA 4DRVA 1VRH1 2GZWA 2JECA 5E16A 3FLTA 3WDWA 1UPSA 3LFMA 4UW6A 1DGRA 1DGLA 2WRAA 3LOBA 4X8PA 5A3OA 5CG8A 3VD7A 2PFWA 3DYOA 2XR4A 2NLRA 4HVOA 2WJSA 2Q8CA 1F4HA 1UZWA 1BQPA 3C7EA 2Z79A 4NWWA 2Y8KA 1PIV2 4QQOA 1V9U1 1TNRA 3ZXLA 1C57A 1H1MA 1WLTA 3HT1A 2BU9A 3I2HA 4JC1A 1QDOA 2OVUA 4MO3M 4Q1RA 1D0HA 1VMFA 3PJYA 5GLWA 2WS92 3FLRA 4YM2A 2PHRA 4AGVA 2CL2A 3AYDA 1BLZA 4CDXC 3LSEA 2FHRA 1YFWA 4K6BA 3MO4A 1W2UA 3MLKA 5CFDC 2RMU2 2DWRA 1PM7A 4LBQD 1W0OA 3IAPA 3PUIA 2ZGUA 4LBJA 1RUG3 3RZGA 1GFF2 5FXWA 1MVQA 1COV3 2CAUA 2G9ZA 3BCWA 2B45X 4K1YA 1VMJA 3WDUA 5FY7A 3EO6A 2ERFA 1CPNA 1DZRA 2IVIB 3KF5A 3ZDSA 1H2LA 2FDIA 2QKDA 2R16A 1QXJA 1FOD1 1O3QA 2WKKA 1W6MA 2CGOA 2QCSB 3GBFA 5A7PA 1ALYA 4AG4A 3NKGA 3HT2A 4O65A 4YW2A 3WT3A 5KXCA 3I7DA 1OA3A 1MQTA 2Z5WA 2DBIA 4WM8B 4Q4V1 1W9TA 5FUNA 5JPMB 3HEIA 3UT0A 4ASLA 1LOFC 4AFBA 4LHSA 5B4NA 4XJZA 4Q27A 1LEDA 3FUQA 1VBA1 2WNUB 5CA6A 4ZXKA 4C0BA 3FWEA 4WZCA 2ZX2A 4AYUA 4W6WA 3OBZA 4HN1A 2WNVB 4Y26A 5C7GA 1RMU3 2AUYA 1WLCA 4AI2A 2H6BA 5BNPA 3NV4A 3POGA 1DQ5A 1HXS2 1FATA 2BP6A 3PVBB 4AHWA 1RUOA 1VE0A 4IEOA 3UESA 3CU7A 5C9AC 2YC4A 1CPMA 1G9FA 1POV0 4KQ7A 1R64A 5FDBA 3EJKA 1YCIA 1IQDC 2VCCA 1LHOA 2FQPA 3H1WA 4GWJA 4QHOA 2JDKA 2UURA 5IK8A 2W1UA 1JN2P 5FYUA 3PMSA 1ND2C 1IS3A 2ZX4A 3O7OA 4NVPA 5LBFA 4OQ9A 2W08A 3ROUA 3WHTA 4CP9B 2JDHA 1O6UA 3GALA 4L99A 3SH3A 3FN9A 2RHPA 3TAYA 4AAPA 1DGWX 1PVXA 2RDQA 1H4GA 5DUXA 3U10A 2RJKA 2H6CA 1JOJA 4X8NA 3WNOA 1JZ2A 4MSVA 1YWKA 4GH4A 4ZU4A 2IXJA 3AMMA 2Q8OA 4B7KA 4YARA 1R091 1BVVA 1C8M1 3I3EA 4MZUA 4UI9L 3VBUC 3WDVA 2QVSB 3UKTA 2SLIA 5C4WB 2XQXA 1RJ7A 3N36A 5FPUA 5CKQA 1W6PB 5JSPA 4LEJA 1GYKA 4Q5OA 2DTWA 4LT5A 1AL0G 3CBNA 4P9GA 5F5AA 3PURA 4Z2AA 4NN0A 1DDLA 5IJRA 1NOVA 5E88A 1JBCA 1XNBA 2OKXA 2RJ2A 3WDXA 1JZ5A 5FZ6A 4WBBA 4JCKA 4BZ4A 2HWE2 1NQJA 2ZMKA 3HN1A 3NSTA 5FAXA 4KU8A 2VM9A 1G86A 2VD7A 2ZGOA 4R9BA 1BMV1 1YIPA 2PN5A 3MF6A 1H6XA 1QY4A 1W9YA 5F5QA 4BCUA 4NE9A 5GLVA 4ZS3A 1UMZA 3JB4C 2JG9B 3I97A 2CNAA 1AL21 1QMJA 4JKKA 4QM9A 2RS13 2ES3A 4YM3A 5A1FA 5GZCA 5K0UB 2P6HA 1L7RA 2LS6A 1AR81 2WQ8A 1IZ3A 2VZRA 5DZGA 3WNNA 4J1WA 1HV1A 3H0OA 3SHRA 3T1MA 4CE8A 1WCKA 3B5LB 3IMMA 3CF6E 5ISLA 2EICA 2PMWB 4HPKA 3VZMA 1FPN2 5L9VA 3U11A 5A32B 1R083 2W0XA 2E7QA 1CQ9A 1W8WA 4QPGC 1YO8A 1D7PM 1EUUA 4Q29A 3UNPA 1OF3A 4P9YA 2Z69A 2UU8A 3NQHA 3E6BA 1ENQA 4FP2A 4K40A 3VBOC 2XBO3 4RFRB 5FOJB 3NAPA 2E32A 4DEQA 4XUTA 2C6SA 1GZWA 1WMXA 3RSJA 3LF7A 3ZN5A 1NAEA 2WZEA 1DF0A 1QHDA 3N7MA 2VW0A 5FZCA 4CYDA 4BA6A 3GJBA 4D6SA 2DCTA 2VU9A 3J4UH 4M0HA 3I2GA 2BNOA 2DVDA 1HQNA 3W21A 1EV11 5C3SA 2O8OA 1CAXB 4OZOA 4ZU5A 5JWPA 4XBQA 1ZM1A 5F2SA 2GDFA 5APAA 3E6DA 2ZBJA 3I2KA 3VZNA 3RS6A 3RZZA 3BOWA 1WKYA 3MIBA 4RR3A 4XUOA 3WQ7A 4BQWA 1OXCA 1YRZA 2BVBA 1QOTA 2XMLA 5DAXA 4WZFA 4COUA 4N43B 2BNNA 1YJLA 2JKXA 3AC0A 3QOPA 4AFAA 2FDFA 1YLLA 1S55A 1LGNA 1WGPA 3PU8A 3KVAA 3N35A 2RS33 1PO23 4AVBA 1ZRDA 2EAKA 4IE7A 1F15A 4DIQA 1YXWA 4RHV2 1MEC2 1QXPA 3S30A 1KFUL 2A75A 4AFCA 4OHWA 1VPHA 4UW5A 1W8HA 5I0SA 2WSUA 1BHGA 1TMF3 2VZ3A 1QF3A 3OBRA 1S0BA 3VBSA 1EYBA 4FO9A 4LR4A 1NA1B 2BGOA 4QKBA 1FNYA 4XC9A 3WVJA 2JD9A 3VKFC 2XLFA 2E7TA 2HWD3 3GHNA 4EV0A 2ZHKA 5FMOS 2BRTA 2QQKA 2Q8DA 5FFOC 2W3JA 5EIYB 1YFXA 4LLFA 4CDQC 1ENSA 1SLAA 4DB5A 4YG6A 1CESA 3EMRA 4FQZA 3UV9A 3I59A 2D44A 4XEZA 1GWMA 1OFNA 1AXKA 2WN3A 5A33B 1CD3G 5FPZA 1KRIA 2PHTA 2KD7A 3CEWA 1BBT2 4CEWC 3ZFEB 3V0AA 4L0PA 1MS8A 5FYBA 1CX4A 3J7MA 1G9DA 4M0NA 1JUIA 3KV5A 3ZFGB 3LEKA 1UL9A 1PO12 5FZEA 4CUBA 4EN0A 1HRV1 4JDMA 2PHWA 3LDKA 1TNFA 3J26N 1UO9A 1LOGA 1ASJ3 3AKPA 3KB5A 1O3TA 1SG3A 2VXRA 1APNA 2YGLA 2FBEA 5BNOB 3B00A 1HX6A 1ACCA 3RPQA 4FPLA 3CMGA 1W6NA 3KT4A 4PF1A 1UYYA 2XH6A 3C7GA 4HK9A 4BQ4A 2PTMA 3ZYHA 4ES9A 1A8DA 1QJX3 4NHKA 3ZDVA 1XYPA 3OYWB 5FZBA 1T2XA 2A6YA 3RZKA 1RTVA 2VCBA 4DZGA 2BTVC 4R9DA 3MIHA 3K46A 4ATFA 1AYN2 5T5OA 5FCCA 4QU2A 1TQ5A 2XLAA 4DFSA 1YYNA 1MS9A 1RUD2 1XQNA 1GV9A 5F5IA 4CRQA 4RGGA 3IB3A 4D94A 3C7OA 3MF9A 4CDXA 3LCPA 1US3A 2CTVA 3PMEA 3POIA 4QX8A 2DVAA 4C8DA 5CFDA 3A7QA 2V73A 4XURA 5AC92 1LB2A 2BWAA 2W46A 3IDBB 4P14A 1IOAA 2FDGA 4IW3A 4NIIA 2RDNA 1VJ2A 2ORXA 5I91A 4R4XA 2DUPA 3JBG3 5LEJA 1RUF3 4AVTA 4CDUB 2XG3A 2VJXA 4YZ1A 5LK5A 2Y64A 1F2NA 1UOBA 2J1RA 2FDKA 4K20A 1RYYA 3AP4A 4S2DA 1PM4A 2J42A 2RM21 1I1EA 2Y34A 2WIIB 4YVWB 1X8EA 2YZ4A 1GLHA 3RJ2X 2GC1A 4B8EA 4BQ1A 3O1VA 5JI9A 4HSLA 5JIUA 3UK9A 4EROA 3MBWA 3HQXA 1LOFA 4MGQA 3VZLA 5FZ7A 3WCSA 4AQTA 3V0BB 4AQ6A 3S6PA 1TG7A 5CISA 1NCRC 2BDRA 4KGGA 2ZACA 1XNCA 1O3RA 3T0AA 2AREA 1DG6A 2JB4A 4IE4A 4PLNA 1SBEA 4QXHA 3RDIA 2VNVA 4EWDA 2R063 1W8UA 1ZBA1 4QPIC 5FXZA 4Q0PA 1UQXA 1RUG2 2A73B 4Y22B 1RVF1 2MEV3 3MPBA 4QHZA 1COV2 1X8MA 1Q5OA 4XF3A 1Q8QA 2GSYA 4MXVA 5D21A 4AWDA 3B93A 2JD4A 1WW7A 1R1ZA 1VBB3 1DU3D 2PAKA 3O1UA 5C9AA 3H7YA 1DZQA 3N9PA 1B35C 3H1YA 2DVGA 4LIUA 5BXXA 3VBRB 1GOFA 1TME3 4UFKA 4X6RB 2CY6A 3RG0A 1YQ6A 1H2NA 2IVJA 1NT0A 3KGLA 1ND2A 2UYBA 4CPBD 4CUCA 1AR93 4KWJA 1FXZA 5KWRA 2X5IC 1W0NA 1PIV3 2XJQA 1HV0A 3O12A 3PHMA 4Y3OA 5B4XA 4COVA 4AOCA 3I49A 2Y6LA 5T55A 2QQVA 2WS93 3VBUA 3WF4A 5SV5A 1GKBA 1QU0A 3INAA 3VBFC 2CSGA 1QJU1 2ZEWA 3KF3A 4NJ4A 2NP0A 2D6NA 3MFAA 3BKZA 1J3RA 2YGMA 1S2KA 1O4ZA 4GKXA 2KM2A 1QQP3 5ACA3 2Q30A 1RMU2 2RMU3 3ZOIA 3USSA 4DXSA 3HBKA 4CCJA 2J1AA 3WNXA 1LKNA 2XQRA 5HCFA 4N53C 2Y0OA 2DV9A 4AEMA 4RA0A 4FPFA 3HQRA 2Q0AA 4DO0A 3AFGA 4OHXA 4Q8LA 4NROA 4OUEA 5F6KA 3OEAA 4GJYA 2D93A 1TZOA 3W9AA 1ULEA 5FPVA 2TNFA 1Y9QA 2XLGA 2VTXJ 4K21A 5T52A 3AZVA 1W8NA 2X29A 4EZ4A 1ULOA 1V70A 4XTMA 1UNBA 1DQ6A 2VVFA 1FMD3 4GQ7A 4YZ3A 3ACIA 3N7KA 5FZGA 5IHRA 5EYYA 4QX2A 5EFUA 2PHFA 4KG0A 3V56A 3DPRC 4V1PA 5A6QA 5FJKA 3WSOA 1RUI1 2YHJA 2XVKA 5EYXA 1RXFA 2XUMA 3EYPA 1SFPA 1Y7BA 4QPGA 4NWVA 4Y1ZA 4BHPA 1HN0A 1JYTA 3DKQA 4COWA 3FL7A 1Z7S2 2R7EB 3VBOA 4OI2A 4U36A 4LBKA 1VR3A 5AVAA 2HWF1 2I07B 4Y20B 1HB3A 2G9FA 3JZVA 4G4FA 4GD4A 5JOZA 4FPGA 4IEZA 3B01A 2A1XA 2D3SA 3BIWE 3UGFA 1OKOA 3WP5A 2DUQA 2RS12 3VHPA 1W6MB 2XJSA 1DYPA 2VW1A 4FOQA 3RJRA 3WW3A 2RJLA 1GU3A 4NRQA 1OI6A 1W8ZA 1LHUA 2OPWA 4HOOA 4IE6A 1DFQA 3PJQA 4XTPA 5KHGA 3DYMA 4FXKB 3JQWA 5A3PA 5FYSA 4HMZA 1QJY3 4CA9A 4BB3A 1R082 4KWKA 5IWFA 3NNFA 4P9IA 4D3WA 5FZAA 4EN8B 2AH2A 5LZ6A 1W6QA 2Q8EA 2VMGA 5GZEA 3I3BA 1LHVA 4GZ9A 1IS6A 1GBGA 3I8TA 1S2EA 4HL0A 3MV01 2XBO2 3WLUA 2VUAA 3MIEA 1DQ2A 4Q2FA 3I2DA 5FREA 2B9VA 4FCAA 4P00B 3KCCA 5LA0A 1LAJA 2JG8C 4W6XA 5EXOA 4CDQA 3SXWA 4AW7A 1N1VA 4GAZA 1E5HA 2DCYA 2I2SA 4PI0A 3I54A 4BK4A 1YEWA 3B7MA 4LUMA 2HWB1 4TLGA 3NNGA 1KDMA 1WW5A 4W8JA 2OQ6A 1J59A 4NPLA 3ELNA 3OTFA 1AR71 1OMIA 2V4VA 1FPN1 3A23A 4BQYA 4CCLA 2W9XA 3VKOA 2ID4A 5IW0A 1RUH1 1WD3A 4RYDA 4BQXA 1S0DA 4LO6B 4DS0A 5A3UA 2RS32 3LEGA 3ZXJA 1PO22 3AYCA 1XU2A 2DCKA 5KHKA 1CZTA 4Y33A 1K45A 1RUJ3 3H42B 3WCRA 5C5TA 5FKCA 3I2OA 3ITQA 1LOEA 2HLEA 3WQ0A 2WFF1 1UN1A 3U14A 5IK7A 5HV4A 4FSJA 3FC0A 4YNIA 5H9PA 1C3HA 1WBLA 1SCSA 4Y1UA 1P8JA 4F8AA 1YHFA 2HWD2 2O14A 2XWJB 5T5JA 4CCMA 4QGNA 1UCXA 2D98A 1ULDA 3USUB 4XZPA 1SMVA 2ZA9A 3ZPYA 1X50A 3H3LA 1H2KA 4WVMB 5JUVA 1RUE3 3GZTB 3O1MA 1MS1A 2ZMNA 3AP5A 4XF9A 4AEDC 3VL9A 4DY3A 3EBRA 2VOKA 4QAWA 4F7ZA 1OH3A 1F8VA 4QXCA 4NAOA 2EXKA 4XETA 4S2HA 2XJPA 4LK6A 2OXBA 4YGDA 4Q0VA 4UFMA 1G6NA 4XW3A 2C24A 2GP5A 2VZVA 4G3YC 5F7UA 4RHV1 1MS5A 1NLRA 2OZ6A 4HPKB 3B9IA 5HXMA 2VBPA 5FYIA 3WQ1A 1ASJ2 1S0EA 4M4PA 5FXVA 5EPAA 4HKLA 2QBXA 3TNPB 3PUHA 1OHFA 4XF4A 3BVCA 4B29A 1EPZA 3CJIC 4CXWA 3AZXA 1U5XA 3PU3A 4L8QA 5DN2A 4YW5A 5FZOA 4D7TA 1PMHX 5IYYA 1L3JA 4UFIA 2PQQA 1QJX2 2Y6FA 4V2VA 1UIKA 4GULA 5A1LA 5JOXA 1GZWB 3AKQA 2ZPXA 3KQ4B 4H14A 1UZYA 1ODMA 4QGMA 1JU3A 4B4RA 1WMDA 2NMOA 2JDNA 1FT9A 1O8SA 2ZS6B 3K51A 3MI8A 4LHLA 4NHMA 4EN7B 4PBPA 3AYAA 2OA2A 3KM5A 5FUIA 4ATEA 2JE7A 3D0JA 4L97A 5LCWL 4CU9A 4B3NA 3GZUC 3O14A 1J1TA 1WWYA 2D5FA 2Q4SA 1JUHA 4H55A 4O61A 3LPGA 5EV7A 3MGUA 4I30A 1NCRA 5FYZA 1SBDA 2R1BA 4CCEA 2YFZA 1O4TA 3R6SA 5FWEA 3J7LA 3OEBA 1PO11 2YROA 4Z82A 5CVRA 2WUHA 2VNOA 1RUNA 1V0AA 2RR13 3HN3A 2VNGA 4ZS2A 4E4ZA 1BEV3 2ZHMA 2CGPA 4IEUA 4QPIA 4LE3A 3F95A 4IV3C 4JAAA 3JBG2 4UBGA 3MICA 4I0WB 1AR63 1RUF2 3TEYA 4Y4YA 5FO9B 5FPXA 1BXHA 3SLIA 4LOSA 1ENXA 3VBSB 1BJQA 1EAH3 1EY2A 1B35A 4BDVB 4MADA 4QGLA 1LU2A 2HBUA 1RHI3 2D7FA 1XJAA 4LBMA 4Y5TA 3IDCB 4CTEA 1W99A 3VBHC 1HW5A 2X5IA 4FXGB 2FMDA 2FZ2A 3I59B 2D6KA 4JKMA 1WMFA 3RRDA 1UWWA 3VHOA 1QNWA 1CVNA 1DZTA 4IV1C 4E2GA 5HCBA 1GUIA 2A6ZA 4FFHA 4URTA 1KJLA 3PTRB 4GWMA 4LOTA 1PMJX 4S2GA 3HNMA 4TLFA 5FBZA 3ILRA 5A70A 4YZ2A 1JYNA 2R073 3CNAA 3DL3A 2OQ7A 4B1LA 3IIAA 1FAYA 5FQ0A 5JPNB 1NXD1 1HDKA 1Z78A 4X6QB 3T2TA 4XF1A 5L7OA 4O7XA 4IE0A 1VBD3 2MEV2 5GZFA 3WW4A 1FI2A 2JEMA 5C8CB 4FPJA 4IQPA 4Q4X3 4UT5A 2VMIA 2JE9A 2Y6KA 3AX4A 1S0CA 3HPNA 3S5QA 2XJVA 1VBB2 2W5FA 4AHZA 1Y4WA 2TBVA 1AJKA 2AZ5A 4XJ9A 2WA4A 2C1FA 4Z1VA 5E1RA 1R1A3 1W6NB 4BQ3A 2PLV3 4KU7A 3ZN4A 2QQJA 3TRSB 1TME2 4RFT0 5T54A 5F37A 1KQRA 3BGAA 5KXDA 1AR92 3GZEA 2DYCA 3LGRA 3WF2A 1OOPC 3FX3A 4CU7A 2EXIA 3H9AA 4ARYA 1JYCA 4W50A 1RIRA 3W5MA 3TBDA 1G7YA 2BGPA 3DPRA 4RS5A 5IFTA 3I2FA 3DXTA 3WZ1A 4GMP0 1XYNA 4JZRA 4CDXB 1RUG1 1QQP2 1VRH3 2ZX3A 2B4KA 5ACA2 5CBLA 5CEHA 2WT1A 2Z2SB 2YBKA 4QU1A 5FOBB 1W8OA 4O9GA 3E6CC 4BXFA 4D7SA 4XUPA 3CZJA 1RL3A 4FT8A 3ZMNA 1DP0A 2IFWA 2QTWB 3OB8A 4N90A 3MUY1 1VB2A 4YRDA 1V9U3 5FKBA 4NIAA 1H8TB 4YPJA 4AI1A 2WABA 1MVEA 2RS51 2WSVA 2XB6C 3GF6A 4AL9A 5IVFA 3AL5A 3KLSA 1GP4A 5JIAA 1WLWA 4MLOA 1B09A 3E97A 2ADDA 1OSGA 1WW6A 4HBNA 5I0DA 1UOJA 3FMGA 3U78A 4IE5A 2VCAA 4JDOA 4O9EA 4ES8A 4XVHA 5FZMA 4XAAA 1DQ0A 1FMD2 1NCQA 3POSA 3WOGA 3WDYA 3R4DB 4H2AA 3CQOA 2CGNA 2WR9A 4K7JA 1E5IA 3P6BA 5AFBA 5BNQA 5FO7B 2D6MA 1CAWA 3POWA 1US2A 3SITA 2VMHA 1XYOA 3ZYIB 2WO2A 4KG8A 2RVAA 4R9CA 4M3CB 5AVPA 1XNKA 1PX4A 1LNSA 1FOD3 1HB4A 2W47A 1J58A 2I45A 4D69A 4ZKTB 2RDSA 4MXWB 4WM8C 4BE3A 3NJVA 1UX6A 4A7YA 5DZEA 3POEA 1KDKA 1AX0A 1ZZ7A 2JG8A 3JCIA 4XF0A 5C9AB 1H0BA 5FP4A 3HD8B 1KD7A 2WNUC 4AEJA 1BVP1 3THTA 1M06G 4E9KA 5GZDA 1UOFA 3IPVA 3SEEA 2F4PA 4Q4W1 2AYHA 4QMAA 1ND2B 1VBA3 4MGSA 4XJUA 4JQRA 5D8AC 3ES1A 1KS4A 4QQHA 2BERA 1ULGA 4XFBA 3JD71 1OUSA 5DUUA 1ZVFA 4B7EA 4N9IA 1IKQA 4P5YA 1QJY2 5FMCA 4BIFA 3T08A 1OF4A 3OGRA 1K42A 1HJFA 3LWCA 5AFEA 3ZSKA 5DDJ2 1C5HA 4YVSA 1VBC1 2JENA 2Y26A 1ONAA 2GALA 2VG9A 3CJXA 1UXXX 2DBNA 2WAOA 4R52A 4UFLA 1F9KA 4XFAA 1NXMA 4XQDA 4XXPA 2JJ6A 4LHNA 1ULFA 5F2WA 3HNBM 4ZXEA 4AI9A 5C8WA 1Z7S3 5JZGB 4HK8A 5B2GB 1XB9A 1OPMA 5A6ZA 3CDZB 2XONA 3KHBA 1JZ6A 1VAKA 1CAVA 4IDZA 1EUTA 1WMEA 1C5IA 5FO8B 1WW4A 4FPKA 4E4HA 5F39A 3AVRA 4AGRA 2XGXA 1R093 4AQSA 1J3QA 2WZR3 5FZ3A 2HWC1 2J1SA 5IVVA 1UU6A 3ON7A 1GWKA 3KVBA 1RJ8A 2EAAA 3SNMA 1GICA 4AK3A 2YDEA 4AFMA 1FX5A 2ZCWA 3CLPA 2XJUA 3LDBA 1STMA 2EA7A 4RSUA 2LTNA 4JGZB 5FYHA 3AJYA 4K3UA 1LOAA 3CHXA 3CIHA 1RUJ2 4OI4A 2AENA 1O5UA 1REFA 2VQ0A 3LDRA 5LEKA 4LE4A 2JG9C 4A41A 3ZXKA 5JXIA 4CUGA 3WW1A 3ATGA 3CJIA 1LESA 5K0UC 3CL1A 3WG2A 1XE0A 5BNNB 5JXJA 4I01A 1QKQA 5KC6A 3POBA 3LA7A 3UKNA 4CCOA 2E63A 1GQHA 3RNSA 4MYEA 2P4EA 3SH4A 5FY0A 3THPA 4WM7C 2WC2A 1DQ4A 3QACA 1RUE2 1LULA 3OGSA 1CIWA 3LAGA 2BFUS 1I5ZA 1NY72 4NPRA 4NPMA 1IHMA 4J25A 4R8HA 1GZCA 3WW2A 1NUKA 4A2UA 4FVVA 4QKFA 2DUOA 3JB8A 2A6XA 5FYVA 5I8TA 5JSOA 1DHKB 4GMP3 3ME2A 4MOAA 3ZYFA 1U12A 3M2MA 3NJXA 1NG0A 3QH7A 4QKNA 5A7WB 1JZ4A 3ETPA 1O3SA 1W2TA 2W1SA 2B8MA 2XKPA 5ABJB 1XE7A 1MR5A 3C2UA 1QOSA 1TMF1 2IXHA 2K2SA 3AYEA 3AVSA 3I3DA 4DINB 1L7QA 2QUOA 2FDHA 4NRPA 4IV3A 1ND3B 1W6QB 4HXCA 4Z8BA 1PGL1 4IEVA 4Y4RA 4PBOA 4GB31 4DY5A 1U5YA 4E8DA 4D7YA 2B42B 1JH5A 3L2HA 4XXAA 3UKVA 1EV13 3R4SA 3ZR5A 2BGCA 5JR2A 4LXLA 5FUPA 4LA2A 4N43C 3VKLA 4CDQB 2W1WA 5FMBA 3UGHA 4ASMB 1YC61 1DGRN 1ZX5A 3F2ZA 1ZZBA 4GIQA 1Y43B 3SKJE 3K3OA 1OH4A 2GP3A 2JICA 3VKMA 2CAVA 4IV1A 2D40A 2BV4A 4WV8A 5EZWA 1OA4A 4AFDA 3AP9A 3RZHA 2Y33A 3A4UA 5CB7A 4BK5A 4M01A 1PGW2 4QXBA 1YI7A 2RR12 3BB6A 4PLOA 1BEV2 3IM0A 1UIJA 3I4IA 4BMBA 3VV1A 5IVEA 2E6VA 4CUAA 4MG2A 4HN0A 1GSLA 3ZN6A 1XPWA 2RG4A 4XBNA 3AMNA 2QQLA 1RUC1 4QM8A 1CN1A 2GMPA 2IZWA 1POV1 1QGLA 3FBMA 2Q1ZB 3IIIA 3WUDA 5F3EA 4AHYA 5M0TA 1AR62 5LW9A 5I0TA 4ASKA 4URAA 4FPYA 1EAH2 4DUVA 4JTNA 5GKAC 2FCUA 3IAQA 1RHI2 3K48A 4ZPIA 5C70A 3WG1A 3AKRA 3AXEA 2VUJA 1Q8SA 1X82A 4RQPC 4EZHA 1CR7A 2B7YA 4LO8A 3LD8A 5T5PA 1ZRFA 1S4CA 1UKRA 5GLZA 1I9RA 2IXKA 3HAGA 4N9HA 3K4ZA 3T3YA 1OOPA 2AGSA 4A44A 3OY8A 5GLTA 5DG2A 4E2QA 2BEOA 2E33A 2ZAHA 5CFCC 1HRI3 2PHDA 1HRV3 3TEXA 2ZEXA 1K5MB 2QQIA 4BWOA 1OBNA 1W28A 5EHDA 4Q0QA 3ZFFC 4B4QA 2HBTA 2R072 4JGYC 4N7UA 5KR7A 3N9QA 3LA3A 2UWBA 5FZ8A 3WG3A 2VMFA 5FLHA 2D6LX 1VBD2 5DAWA 1JTZX 1D4M3 1PK6C 3JBG1 3UJOA 3VKNA 4BLJA 5FWJA 4Q4X2 2XDVA 2XPJA 3S7IA 4K8RB 4XHBA 4YFZA 1VP6A 4MGYE 3J9SA 1OKQA
chains in the Genus database with same CATH topology
5CZKA 3UETA 4ARXA 4DXTA 2E26A 5DPNA 2X05A 1WCQA 1TVGA 3I3BA 1HN1A 4GZ9A 3WF0A 2EIDA 4RN5A 4JX0A 3GM8A 2WO1A 3WNKA 4D8MA 3MV01 2L9LA 1UY4A 3SEPA 4TXWA 5LA2A 3VDCA 2B9VA 3U37A 4LPLA 2C9KA 4P00B 5EJ1B 5LA0A 2BBAA 3IDAA 2E31A 4DXRA 4BXSV 2QQOA 3T0BA 4BK4A 3NNGA 3SKVA 4ET7A 4W8JA 3VD7A 2V4VA 3A23A 3DYOA 3BN6A 2W9XA 4OMDA 1F4HA 2ID4A 4GWIA 3C7EA 4RYDA 3VD4A 2Y8KA 3LEGA 4ZZ8A 2DCKA 1CZTA 1K45A 4CU6A 2J1TA 3I2HA 2HLEA 4MO3M 3WEZA 4DEVA 4KI5M 1P8JA 2JE8A 2VMDA 3OGVA 3ACFA 3MO4A 1JHJA 4DUWA 5CYYA 3IAPA 3PUIA 5JUVA 4QAWA 2RV9A 2J1EA 3ACHA 1J84A 3T2OA 4HG6B 2CDPA 4KMQA 2VZVA 2V72A 5F7UA 2QQNA 1J83A 2VQUA 2VZ1A 4AG4A 5HXMA 4M4PA 2QBXA 3PUHA 1W9TA 1O59A 5EJZB 3HEIA 3K75B 2VC9A 2VZOA 2W92A 4LHSA 5B4NA 1PX3A 5DN2A 5IYYA 1PMHX 3DYPA 4QB2A 4UAPA 2C4XA 2W95A 2Y6JA 5C7GA 1JU3A 1UY2A 1O8SA 2Y6HA 1GQPA 5FUIA 3A22A 5LCWL 1JI6A 4CU9A 3UESA 2YC4A 3LPGA 2VZQA 3NRUA 1R64A 2YFZA 4OYUA 3OEBA 1IQDC 2VCCA 4GWJA 4D0QA 2WUHA 2W1UA 3HN3A 1NX9A 1XNAA 5JXGA 3FN9A 3T2QA 2VO5A 2XOMA 2PQSA 5IFPA 3WNOA 1JZ2A 3I3EA 4UI9L 5J1XA 4P08A 2VZTA 2XQXA 4BDVB 4A45A 4MADA 3VD9A 3VDBA 1W99A 4Z2AA 3E1F1 5IJRA 1MPXA 2YB7A 4FI9A 2OKXA 2RJ2A 4JKMA 1UWWA 3WQBA 1JZ5A 3EB7A 2W87A 3OG2A 4DUXA 2WN2A 1GUIA 2Y6GA 3THCA 2VM9A 1PMJX 3K77A 1H6XA 3HNMA 3K4DA 1JYNA 3I97A 4JKKA 1CZSA 1UMIA 4A4AA 1L7RA 3C7HA 1O8PA 2LS6A 2WQ8A 2VZRA 2Y6KA 3WNNA 1YQ2A 4A42A 3HPNA 1JYWA 2W5FA 2EICA 4XUNA 1UY3A 3I2IA 3HNYM 3LE0A 2QQJA 1UY1A 4AAXA 3K4AA 3T2PA 1OD3A 2VMEA 3BGAA 1XNTA 1D7PM 1EUUA 2VZPA 3UNPA 1OF3A 2J7MA 3WF2A 1JU4A 4CU7A 1JYXA 3NQHA 4ARYA 1H6YA 3LPFA 2E32A 4DEQA 4W50A 4XUTA 3W5MA 2BGPA 1NAEA 1UYXA 2HYXA 2J22A 2WZEA 3ACGA 5IFTA 3I2FA 3MUZ1 3I2GA 2B4KA 4OZOA 1ULPA 3T09A 5A1AA 1W8OA 3I2KA 1WKYA 4XUPA 4XUOA 3CZJA 5HPOA 1DP0A 2JKXA 3AC0A 3OB8A 3MUY1 5G05L 4YPJA 2WABA 1UY0A 1OT5A 2C26A 5I0DA 1BHGA 2VZ3A 2VCAA 1JZ3A 1SHWB 2BGOA 2W91A 4XVHA 2JD9A 1UXZA 2QQMA 4LKSA 3CQOA 2QQKA 5EIYB 2W3JA 3P6BA 4QB1A 4JHZA 1US2A 2XHNA 2WO2A 2RVAA 1PX4A 1LNSA 2WN3A 2VZUA 2V5DA 2W47A 3CZUA 4M4RA 1GMMA 2KD7A 3NJVA 2ORZA 4L0PA 2VQTA 3GXUA 3I2JA 3LEKA 4CUBA 4PT6A 4OMCA 5JMOA 1SG3A 5LA1A 3LEIA 3SEEA 2DDUA 3WF1A 4MGSA 3MV11 3CMGA 2WYSA 4PQQA 2BERA 1UYYA 4PF1A 3C7GA 1JZ7A 3FHQA 1GOHA 4P5YA 4CU8A 1CX1A 3DECA 3T08A 1OF4A 1T2XA 3OGRA 1K42A 2VCBA 3C8XA 3K46A 1UXXX 2WAOA 3C7FA 4A3ZA 4QPWA 4P02B 3HNBM 4ZXEA 3IB3A 4JKLA 4QX1A 3C7OA 1US3A 4ZZ5A 3CDZB 2XONA 1JZ6A 1DLCA 3W5NA 3ABZA 1UMHA 3A7QA 4XURA 1EUTA 2W46A 5DQ0A 3HOBA 2Z4FA 1I5PA 2ORXA 3ZM8A 2J1UA 2WDBA 1JZ8A 2VJXA 2J1SA 2Y64A 2J1RA 5C71A 1RYYA 2ZEZA 2VL4A 2VZSA 2DCJA 3GDBA 1K3IA 3CIHA 3OBAA 3JXSA 4A41A 5JXIA 2ZEYA 3MBWA 4MGQA 1TG7A 5JXJA 2EIEA 4UOJA 1CIYA 3T0AA 3T0DA 4IUGA 2VMCA 2VR4A 3LQCA 5DMYA 3WNPA 3OGSA 3HJRA 4TTGA 1KGYA 3VD5A 1UX7A 1NUKA 4A6OA 4W4ZA 1K12A 4QDQA 1UZ0A 4MOAA 4XUQA 1GOFA 3NJXA 3WNMA 1JZ4A 3ETPA 1F4AA 2W1SA 2W94A 4CUCA 1NKGA 3D3AA 1W0NA 2EIBA 3ECQA 5B4XA 3I3DA 1L7QA 1KEXA 3VD3A 2Y6LA 2YG0A 4QDRA 4ZY9A 4E8DA 3WF4A 1W9SA 5JXHA 1SDDB 2ZEWA 5JR2A 2YC2A 2BZDA 4DXSA 2JDAA 2W1WA 3GGLA 2J1AA 3J7HA 4KWUA 3F2ZA 3SKJE 1OH4A 1GOGA 4CVUA 2W1QA 4BK5A 4OUEA 3OEAA 4QDSA 3FHAA 4QB6A 2LW8A 1JYVA 4CUAA 1XPWA 1W8NA 2QQLA 5G04L 1ULOA 4LQRA 1XC6A 3IIIA 3ACIA 5IHRA 4QX2A 4BJ0A 2ZXQA 4E8CA 4DUVA 3WSOA 3IAQA 3VDAA 5C70A 1DYOA 3EYPA 3CKHA 2WAAA 3FL7A 3K4ZA 4A44A 1W9WA 2R7EB 2WZ8A 2E33A 3THDA 4XZUG 3WNLA 2CDOA 2WBKA 2X10A 2ZEXA 2QQIA 2VOTA 1UYZA 2X09A 2WO3A 4QX3A 2VTFA 3A21A 3P1IA 4QX0A 2VMFA 2J1VA 1GU3A 1GNYA 1CZVA 3WF3A 2YFUA 3DYMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CZK A;  3UET A;  4ARX A;  4DXT A;  2E26 A;  5DPN A;  2X05 A;  1WCQ A;  1TVG A;  3I3B A;  1HN1 A;  4GZ9 A;  3WF0 A;  2EID A;  4RN5 A;  4JX0 A;  3GM8 A;  2WO1 A;  3WNK A;  4D8M A;  3MV0 1;  2L9L A;  1UY4 A;  3SEP A;  4TXW A;  5LA2 A;  3VDC A;  2B9V A;  3U37 A;  4LPL A;  2C9K A;  4P00 B;  5EJ1 B;  5LA0 A;  2BBA A;  3IDA A;  2E31 A;  4DXR A;  4BXS V;  2QQO A;  3T0B A;  4BK4 A;  3NNG A;  3SKV A;  4ET7 A;  4W8J A;  3VD7 A;  2V4V A;  3A23 A;  3DYO A;  3BN6 A;  2W9X A;  4OMD A;  1F4H A;  2ID4 A;  4GWI A;  3C7E A;  4RYD A;  3VD4 A;  2Y8K A;  3LEG A;  4ZZ8 A;  2DCK A;  1CZT A;  1K45 A;  4CU6 A;  2J1T A;  3I2H A;  2HLE A;  4MO3 M;  3WEZ A;  4DEV A;  4KI5 M;  1P8J A;  2JE8 A;  2VMD A;  3OGV A;  3ACF A;  3MO4 A;  1JHJ A;  4DUW A;  5CYY A;  3IAP A;  3PUI A;  5JUV A;  4QAW A;  2RV9 A;  2J1E A;  3ACH A;  1J84 A;  3T2O A;  4HG6 B;  2CDP A;  4KMQ A;  2VZV A;  2V72 A;  5F7U A;  2QQN A;  1J83 A;  2VQU A;  2VZ1 A;  4AG4 A;  5HXM A;  4M4P A;  2QBX A;  3PUH A;  1W9T A;  1O59 A;  5EJZ B;  3HEI A;  3K75 B;  2VC9 A;  2VZO A;  2W92 A;  4LHS A;  5B4N A;  1PX3 A;  5DN2 A;  5IYY A;  1PMH X;  3DYP A;  4QB2 A;  4UAP A;  2C4X A;  2W95 A;  2Y6J A;  5C7G A;  1JU3 A;  1UY2 A;  1O8S A;  2Y6H A;  1GQP A;  5FUI A;  3A22 A;  5LCW L;  1JI6 A;  4CU9 A;  3UES A;  2YC4 A;  3LPG A;  2VZQ A;  3NRU A;  1R64 A;  2YFZ A;  4OYU A;  3OEB A;  1IQD C;  2VCC A;  4GWJ A;  4D0Q A;  2WUH A;  2W1U A;  3HN3 A;  1NX9 A;  1XNA A;  5JXG A;  3FN9 A;  3T2Q A;  2VO5 A;  2XOM A;  2PQS A;  5IFP A;  3WNO A;  1JZ2 A;  3I3E A;  4UI9 L;  5J1X A;  4P08 A;  2VZT A;  2XQX A;  4BDV B;  4A45 A;  4MAD A;  3VD9 A;  3VDB A;  1W99 A;  4Z2A A;  3E1F 1;  5IJR A;  1MPX A;  2YB7 A;  4FI9 A;  2OKX A;  2RJ2 A;  4JKM A;  1UWW A;  3WQB A;  1JZ5 A;  3EB7 A;  2W87 A;  3OG2 A;  4DUX A;  2WN2 A;  1GUI A;  2Y6G A;  3THC A;  2VM9 A;  1PMJ X;  3K77 A;  1H6X A;  3HNM A;  3K4D A;  1JYN A;  3I97 A;  4JKK A;  1CZS A;  1UMI A;  4A4A A;  1L7R A;  3C7H A;  1O8P A;  2LS6 A;  2WQ8 A;  2VZR A;  2Y6K A;  3WNN A;  1YQ2 A;  4A42 A;  3HPN A;  1JYW A;  2W5F A;  2EIC A;  4XUN A;  1UY3 A;  3I2I A;  3HNY M;  3LE0 A;  2QQJ A;  1UY1 A;  4AAX A;  3K4A A;  3T2P A;  1OD3 A;  2VME A;  3BGA A;  1XNT A;  1D7P M;  1EUU A;  2VZP A;  3UNP A;  1OF3 A;  2J7M A;  3WF2 A;  1JU4 A;  4CU7 A;  1JYX A;  3NQH A;  4ARY A;  1H6Y A;  3LPF A;  2E32 A;  4DEQ A;  4W50 A;  4XUT A;  3W5M A;  2BGP A;  1NAE A;  1UYX A;  2HYX A;  2J22 A;  2WZE A;  3ACG A;  5IFT A;  3I2F A;  3MUZ 1;  3I2G A;  2B4K A;  4OZO A;  1ULP A;  3T09 A;  5A1A A;  1W8O A;  3I2K A;  1WKY A;  4XUP A;  4XUO A;  3CZJ A;  5HPO A;  1DP0 A;  2JKX A;  3AC0 A;  3OB8 A;  3MUY 1;  5G05 L;  4YPJ A;  2WAB A;  1UY0 A;  1OT5 A;  2C26 A;  5I0D A;  1BHG A;  2VZ3 A;  2VCA A;  1JZ3 A;  1SHW B;  2BGO A;  2W91 A;  4XVH A;  2JD9 A;  1UXZ A;  2QQM A;  4LKS A;  3CQO A;  2QQK A;  5EIY B;  2W3J A;  3P6B A;  4QB1 A;  4JHZ A;  1US2 A;  2XHN A;  2WO2 A;  2RVA A;  1PX4 A;  1LNS A;  2WN3 A;  2VZU A;  2V5D A;  2W47 A;  3CZU A;  4M4R A;  1GMM A;  2KD7 A;  3NJV A;  2ORZ A;  4L0P A;  2VQT A;  3GXU A;  3I2J A;  3LEK A;  4CUB A;  4PT6 A;  4OMC A;  5JMO A;  1SG3 A;  5LA1 A;  3LEI A;  3SEE A;  2DDU A;  3WF1 A;  4MGS A;  3MV1 1;  3CMG A;  2WYS A;  4PQQ A;  2BER A;  1UYY A;  4PF1 A;  3C7G A;  1JZ7 A;  3FHQ A;  1GOH A;  4P5Y A;  4CU8 A;  1CX1 A;  3DEC A;  3T08 A;  1OF4 A;  1T2X A;  3OGR A;  1K42 A;  2VCB A;  3C8X A;  3K46 A;  1UXX X;  2WAO A;  3C7F A;  4A3Z A;  4QPW A;  4P02 B;  3HNB M;  4ZXE A;  3IB3 A;  4JKL A;  4QX1 A;  3C7O A;  1US3 A;  4ZZ5 A;  3CDZ B;  2XON A;  1JZ6 A;  1DLC A;  3W5N A;  3ABZ A;  1UMH A;  3A7Q A;  4XUR A;  1EUT A;  2W46 A;  5DQ0 A;  3HOB A;  2Z4F A;  1I5P A;  2ORX A;  3ZM8 A;  2J1U A;  2WDB A;  1JZ8 A;  2VJX A;  2J1S A;  2Y64 A;  2J1R A;  5C71 A;  1RYY A;  2ZEZ A;  2VL4 A;  2VZS A;  2DCJ A;  3GDB A;  1K3I A;  3CIH A;  3OBA A;  3JXS A;  4A41 A;  5JXI A;  2ZEY A;  3MBW A;  4MGQ A;  1TG7 A;  5JXJ A;  2EIE A;  4UOJ A;  1CIY A;  3T0A A;  3T0D A;  4IUG A;  2VMC A;  2VR4 A;  3LQC A;  5DMY A;  3WNP A;  3OGS A;  3HJR A;  4TTG A;  1KGY A;  3VD5 A;  1UX7 A;  1NUK A;  4A6O A;  4W4Z A;  1K12 A;  4QDQ A;  1UZ0 A;  4MOA A;  4XUQ A;  1GOF A;  3NJX A;  3WNM A;  1JZ4 A;  3ETP A;  1F4A A;  2W1S A;  2W94 A;  4CUC A;  1NKG A;  3D3A A;  1W0N A;  2EIB A;  3ECQ A;  5B4X A;  3I3D A;  1L7Q A;  1KEX A;  3VD3 A;  2Y6L A;  2YG0 A;  4QDR A;  4ZY9 A;  4E8D A;  3WF4 A;  1W9S A;  5JXH A;  1SDD B;  2ZEW A;  5JR2 A;  2YC2 A;  2BZD A;  4DXS A;  2JDA A;  2W1W A;  3GGL A;  2J1A A;  3J7H A;  4KWU A;  3F2Z A;  3SKJ E;  1OH4 A;  1GOG A;  4CVU A;  2W1Q A;  4BK5 A;  4OUE A;  3OEA A;  4QDS A;  3FHA A;  4QB6 A;  2LW8 A;  1JYV A;  4CUA A;  1XPW A;  1W8N A;  2QQL A;  5G04 L;  1ULO A;  4LQR A;  1XC6 A;  3III A;  3ACI A;  5IHR A;  4QX2 A;  4BJ0 A;  2ZXQ A;  4E8C A;  4DUV A;  3WSO A;  3IAQ A;  3VDA A;  5C70 A;  1DYO A;  3EYP A;  3CKH A;  2WAA A;  3FL7 A;  3K4Z A;  4A44 A;  1W9W A;  2R7E B;  2WZ8 A;  2E33 A;  3THD A;  4XZU G;  3WNL A;  2CDO A;  2WBK A;  2X10 A;  2ZEX A;  2QQI A;  2VOT A;  1UYZ A;  2X09 A;  2WO3 A;  4QX3 A;  2VTF A;  3A21 A;  3P1I A;  4QX0 A;  2VMF A;  2J1V A;  1GU3 A;  1GNY A;  1CZV A;  3WF3 A;  2YFU A;  3DYM A; 
#chains in the Genus database with same CATH topology
 5CZK A;  2JDM A;  3UET A;  4EN9 B;  2VCM A;  2C0Z A;  5L19 A;  1R1A 2;  1ZBE 1;  1WCQ A;  2PLV 2;  1MZE A;  5FZO B;  5FZD A;  1PVC 1;  1AYM 1;  5A6X A;  3AMP A;  2VW2 A;  3AB0 A;  2DCZ A;  1OVP A;  1HN1 A;  4IER A;  2YC0 A;  1V6I A;  3T30 A;  5HV0 A;  2EF6 A;  4JX0 A;  5FBJ A;  3WNK A;  1UZZ A;  5FP7 A;  4D8M A;  5JCT A;  4ORF A;  2B9U A;  2L9L A;  2P5B A;  3WP4 A;  5LA2 A;  4A7K A;  3DGT A;  3VDC A;  3GBW A;  5K4L A;  4LPL A;  5EJ1 B;  1C1L A;  2FMY A;  3IDA A;  3TNQ A;  4IEX A;  1SFN A;  4NIH A;  2R06 1;  4Z92 B;  3ZR6 A;  1W03 A;  1ZRR A;  4DXR A;  1RXG A;  2NYY A;  1VRH 2;  1W3V A;  2QQO A;  4IEQ A;  5J98 B;  1QH6 A;  2GC3 A;  2ZTN A;  3T0B A;  3DV8 A;  3LA2 A;  4YVW C;  4QPI B;  4YFW A;  4PDW B;  4ET7 A;  4PQ9 A;  1VBB 1;  4MX3 A;  1GNZ A;  2WA3 A;  3S0M A;  3RZJ A;  3IDE A;  2ZGS A;  4FOY A;  3KGZ A;  5F5C A;  3G6J B;  5FYC A;  3BN6 A;  4WM8 A;  3KMH A;  3SCG A;  1W8T A;  2VE1 A;  4F3J A;  2IC1 A;  4GWI A;  1V9U 2;  1TME 1;  3GBG A;  5J09 A;  2G19 A;  3QH6 A;  4LLO A;  5LAS A;  4FOW A;  1YI9 A;  5F3G A;  1AR9 1;  1S1A A;  1SLB A;  2WNU A;  1DBN A;  4C1W A;  2F17 A;  1PIV 1;  1X9P A;  5LRS A;  4OHY A;  3UGG A;  3RFR A;  2VVE A;  5D8A A;  2X5I B;  5EP9 A;  5F1R A;  4Y5Z 0;  1JOD A;  4DEV A;  2WS9 1;  2JE8 A;  2VMD A;  3SCH A;  3U1X A;  3LB9 A;  3ACF A;  3BTA A;  4RL7 A;  4CDW C;  4FTB A;  4HKO A;  4XYX A;  3PUQ A;  1RVF 3;  2RDR A;  4PJY A;  5JI7 A;  1QQP 1;  1W06 A;  4R4Z A;  2RMU 1;  1ZYB A;  2AR6 A;  2ZKN A;  3PNA A;  4RD7 A;  2RV9 A;  3ZSM A;  5L7O B;  2J1E A;  2R04 3;  2R32 A;  4NO4 A;  4FTE A;  1AHS A;  3ACH A;  2GN3 A;  4XE9 A;  4XHX A;  1FOD 2;  3T2O A;  2QQP A;  1JXN A;  5I0R A;  3MIF A;  2YBP A;  1YFU A;  5EJ3 A;  2V72 A;  4L92 A;  3HVD A;  1N47 A;  1YJK A;  2QQN A;  3M3E A;  4YYO A;  1J83 A;  2VQU A;  4AVS A;  5BV6 A;  4PLM A;  2W2I A;  5C3Q A;  4Y24 A;  1XBF A;  2H0V A;  3R05 A;  1GWL A;  4C91 A;  3CO2 A;  4Z07 A;  3SC7 X;  3AP6 A;  2OUJ A;  3JU9 A;  1VBA 2;  3RYP A;  1F5F A;  2W92 A;  5CAD A;  4A6S A;  4B1M A;  4AZZ A;  1QJU 3;  1PX3 A;  2A5Z A;  4QXK A;  1ZZC A;  4QB2 A;  3LIG A;  4UAP A;  3SMH A;  3ZX7 A;  4CPB A;  4AEK A;  2W95 A;  1OUX A;  4PHZ A;  4PF5 A;  1LOD A;  3DPR B;  3SH5 A;  1UY2 A;  2K46 A;  2V09 A;  3OPZ A;  4I0A A;  4RS5 B;  2Y6H A;  4P9W A;  1GQP A;  4Q4Y 3;  3A22 A;  2ATF A;  2P6C A;  3MIG A;  2JG9 A;  1HXS 1;  4ITC A;  3RVH A;  4XAB A;  2WT0 A;  5K0U A;  2PA7 A;  2ZGL A;  2HEV F;  5KXE A;  4F83 A;  3E5Q A;  5FYY A;  4AE2 A;  4OYU A;  1VBE 3;  4D0Q A;  4CEY C;  3ZMO A;  4NHX A;  1LR5 A;  4LA3 A;  2WO7 A;  5FK8 A;  4AI8 A;  1NX9 A;  4OUM A;  4CP0 A;  4UW4 A;  1SEF A;  4WM7 A;  3DEM A;  5FPL A;  4AGG A;  1POQ A;  4P9J A;  3IBM A;  4AI3 A;  4H7M A;  1YQC A;  4LKD A;  2VO5 A;  3WY6 A;  5D1I A;  3BYW A;  1ZZ6 A;  4UF0 A;  5A32 A;  2XOM A;  1OC1 A;  1R09 2;  1C8M 2;  2VH9 A;  1RED A;  3P3P A;  2WZR 2;  4C0H A;  1IG0 A;  3MLL A;  3QBQ A;  1C8N A;  1RUI 3;  4P08 A;  5F3C A;  5HCA A;  1QJY 1;  1SPP A;  4HAN A;  3ZXE A;  5TSW A;  2IUW A;  1MQT B;  2Z42 A;  2ARX A;  2DTY A;  3VDB A;  1NCQ B;  1GZT A;  4IL7 A;  3VZJ A;  1IPS A;  1Q8O A;  4AQ2 A;  4D6R A;  2W68 A;  4OUL A;  1U5Z A;  3E1F 1;  2FDJ A;  1MPX A;  4DRR A;  5DDJ 3;  2ARC A;  1CAW B;  4LO4 B;  2HWF 3;  2G9G A;  2ZHL A;  1IG3 A;  3EB7 A;  4GJZ A;  5JSR A;  2W87 A;  3OG2 A;  2WT2 A;  2Y6G A;  2W39 A;  2HWE 1;  4J1X A;  1XND A;  2BJS A;  3KD4 A;  3DCQ A;  3M4F A;  1Q56 A;  3Q8F A;  5BNP B;  4W6Y A;  2AEZ A;  2PHU A;  1AZD A;  3V65 A;  4MGK E;  4JTO A;  1CZS A;  4YZ4 A;  3RQ0 A;  4N43 A;  1AR8 2;  5FR3 A;  1UMI A;  2JG8 B;  1FV2 A;  2ZX0 A;  3KCY A;  3OCP A;  5E89 A;  5BPX A;  3HIF A;  3WR0 A;  1WZX A;  3N7L A;  2BFU L;  4P9X A;  5T50 A;  3IPV B;  1JYW A;  3AJZ A;  3T4V A;  1NZC A;  4Q0U A;  3OUH A;  1UY3 A;  3KQR A;  4HON A;  3HNY M;  1UY1 A;  2P34 A;  3KHC A;  4CEW A;  3PIG A;  4QKD A;  1OD3 A;  1UKG A;  1XNT A;  4GH4 B;  1E5S A;  5H9S A;  1D0G A;  1U0A A;  3RGB A;  2VZP A;  4CCD A;  2J7M A;  1KIT A;  1LHN A;  2OUH A;  1PZ8 A;  1NE4 A;  2D5H A;  2WQ4 A;  4YVS B;  3RMX A;  1IPJ A;  5DAP A;  1OQ1 A;  3NW4 A;  2GU9 A;  5DXD A;  2J22 A;  4ONU A;  3D0S A;  4Y1X A;  4SBV A;  4Q26 A;  4XBL A;  4XCA A;  5JAX A;  1EV1 2;  5A33 A;  4XDQ A;  3RI8 A;  3MUZ 1;  4ZHN A;  5HCH A;  2HH9 A;  1RUE 1;  4RQP A;  1UZV A;  5C3O A;  5FMO L;  1ULP A;  3T09 A;  3POF A;  1CAV B;  2XVL A;  3BOP A;  2XUE A;  3HQU A;  4GXL A;  5JR7 B;  5IT6 A;  3FHI B;  4QQ2 A;  5LK7 B;  5HI0 A;  3ACL A;  4L11 A;  5ANN A;  5CFC A;  3BUC A;  4I02 A;  4FAH A;  1FYU A;  4IGO A;  2TUN A;  3ZFF A;  1V00 A;  1UY0 A;  1OT5 A;  3B3Q E;  4JGY A;  2WFF 3;  3ENR A;  4EWE A;  1MEC 1;  3OYW A;  4FBF A;  1LEM A;  4XAE A;  2WQZ C;  1AJO A;  1PK6 A;  2VBB A;  4HET A;  2GNM A;  5FY9 A;  3ASI A;  2IXI A;  4BOW A;  1UXZ A;  2YY1 A;  2QQM A;  2ZAA A;  4LKS A;  3M3C A;  5LAT A;  3RYR A;  4J6G A;  4TYS A;  4QB1 A;  5GM0 A;  3VZK A;  1Q8P A;  4JHZ A;  5GLU A;  1MZ6 A;  1JS9 A;  1O91 A;  2SBA A;  3NAP B;  3BTZ A;  4KNC A;  4JRL A;  1WA4 A;  1I6X A;  5LY2 A;  5DAQ A;  3M3O A;  5LWB A;  4LOR A;  4PCR A;  5FZI A;  3D4K A;  1UF2 C;  2VZU A;  2V5D A;  1LRH A;  1GMM A;  4XIK A;  4MHR A;  3EQE A;  3VDD C;  1UU5 A;  2ORZ A;  1HRI 2;  4YW4 A;  2ZX1 A;  1HRV 2;  1BBT 1;  5C5U A;  1OLR A;  4LBL A;  4PT6 A;  4CSW A;  4OMC A;  5A3L A;  4NUB A;  4XMA A;  4RR3 B;  5JMO A;  2OPK A;  2ZGT A;  5LA1 A;  1WLD A;  5KHI A;  3D5O A;  3WF1 A;  2DDU A;  4L2N A;  5IVY A;  2YPD A;  3OJB A;  2VOW A;  1NLS A;  3VLB B;  1D4M 2;  4AF9 A;  4YVW A;  3H8X A;  3WP6 A;  3MV1 1;  4BLI A;  1C28 A;  3A0K A;  5I8Y A;  4NID A;  1ODN A;  2X8K A;  1SCR A;  2GND A;  4ISQ A;  1JZ7 A;  1GOH A;  4CU8 A;  1RHI 1;  5FIX A;  4HFS A;  5F8P A;  2EIG A;  5LY1 A;  4WVV A;  3EXU A;  4FFI A;  4KH9 A;  4GWN A;  4LK7 A;  2XXZ A;  3C8X A;  4Y5S A;  1TEI A;  3D8C A;  2G1M A;  4OI1 A;  4HVQ A;  5JDB A;  3N9M A;  1N3Q A;  3LSD A;  2YPJ A;  5FY4 A;  2ADE A;  1EPW A;  1VAM A;  1X33 A;  1XOY A;  5E6H A;  1AYN 1;  5I8S A;  3C7F A;  4BM8 A;  2ZAB A;  4A3Z A;  4QPW A;  3TN9 3;  4P02 B;  1RUD 1;  3DN7 A;  5FLI A;  4JKL A;  4S2F A;  2WZP P;  3NKT A;  2AEY A;  3FBY A;  1SQ4 A;  4ZU7 A;  4CDW A;  1QXR A;  2MHF A;  1DLC A;  2NZ9 A;  2WIN B;  2R07 1;  3ABZ A;  3FZ3 A;  4IV1 B;  4W65 A;  2UY8 A;  4LUL A;  5DQ0 A;  1XSR A;  2YU2 A;  3VBF A;  5FYT A;  5F9T A;  2Z4F A;  4GKY A;  1I5P A;  1VBD 1;  5LBB A;  5AC9 1;  5IK5 A;  3V0A B;  1LCL A;  3ZM8 A;  3MYX A;  4Q4X 1;  2WDB A;  2P3J A;  1RIT A;  5H9Q A;  3T1L A;  5FJH A;  5C6C A;  4I2O A;  2XJR A;  1SLT A;  1WA6 X;  2QZ2 A;  1HJG A;  1GP5 A;  4DOU A;  5IAT A;  1ULC A;  5CKM A;  4EYU A;  1SBF A;  4LUK A;  2F4L A;  3H8U A;  2UYA A;  4XCB A;  2RM2 2;  4N53 A;  1H30 A;  1UW8 A;  2VQA A;  5L9R A;  4A7Z A;  2MNG A;  4CP2 A;  2PLV 1;  3IWZ A;  2VL4 A;  1V6N A;  2A7A A;  2DCJ A;  2VZS A;  3K3N A;  3N9N A;  3RMY A;  5LRR A;  2A3X A;  3IKW A;  3J8F 3;  4MGT A;  4MGZ E;  1K3I A;  3OBA A;  3O0W A;  2XL7 A;  4YGB A;  1SLC A;  2E53 A;  4IET A;  5EWS A;  2WYF A;  1LGB A;  1F31 A;  3N9L A;  3QCW A;  3J7N A;  1H1A A;  2ZEY A;  1AX1 A;  3BPS A;  2HEW F;  4FP3 A;  4XDO A;  2IWG B;  5FPA A;  4LIV A;  1CIY A;  5C8C C;  3OY8 B;  4P9L A;  5IVC A;  1TE1 B;  3GCW A;  1N1T A;  2VMC A;  1RVF 2;  2VR4 A;  1JW6 A;  3LQC A;  3NMB A;  3WNP A;  3FLP A;  4LKE A;  2ILM A;  1CWP A;  2ZHN A;  1D2Q A;  2PXJ A;  5A80 A;  1KGY A;  3VD5 A;  1HB1 A;  1W90 A;  3C3V A;  3NV3 A;  2E7A A;  2QE3 A;  2YXS A;  2ZGR A;  1COV 1;  2R04 2;  4M00 A;  5CFD B;  3NO8 A;  2P3I A;  3O5S A;  1YQ8 A;  4FPO B;  4A6O A;  4QD2 A;  4W4Z A;  1HQW A;  1GQG A;  2EVX A;  1UZ0 A;  2JX9 A;  1ZA7 A;  2EXH A;  1HIX A;  3W59 A;  2QDN A;  4WVZ A;  4CEY A;  1LGC A;  1UYP A;  1A78 A;  3ZPO A;  2JKB A;  1PGS A;  2W94 A;  3NNL A;  1NKG A;  4QT6 A;  1DIW A;  4IES A;  2EIB A;  3GJA A;  3ECQ A;  4UBH A;  4LKF A;  4XJW A;  2E9Q A;  3B9C A;  1KEX A;  3ZIW A;  2PYT A;  5JMC A;  1D4V B;  3KV4 A;  1CJD A;  1QJU 2;  1W9S A;  2HJI A;  2P2K A;  4DXZ A;  3ZYP A;  3H3U A;  4XIO A;  4KBB A;  4UYB A;  1JYI A;  2V5Y A;  4DQA A;  2D43 A;  3H7J A;  1W6O A;  5DZF A;  5T3N A;  4Y20 A;  1VLN A;  4JRA A;  3LOI A;  4QQP A;  1H8T C;  1RMU 1;  4Q4Y 2;  3Q8B A;  5FZ1 A;  4YZ5 A;  1CJP A;  2ZZJ A;  3P3N A;  1OFS A;  4I3G A;  4FAG A;  4IXL A;  4XJA A;  3ZXF A;  2LRO A;  5KBF A;  1GOG A;  3MID A;  3QLQ A;  4CVU A;  4XDP A;  2RS5 3;  3LEM A;  5FP9 A;  5FZL A;  1VBE 2;  2D97 A;  4QDS A;  1MS4 A;  2H0B A;  1H1I A;  1OUR A;  3NJZ A;  4LBQ A;  2JWP A;  4YW3 A;  2VXJ A;  3G7D A;  2O1Q A;  4OQ8 A;  1OA2 A;  2CU5 A;  4QB6 A;  3OBT A;  2LW8 A;  1AX2 A;  4XFF A;  5ANQ A;  4AVV A;  3NNM A;  1RC6 A;  3ZYR A;  4Q4V 3;  5F6L B;  2JXA A;  5FRA A;  4OI0 A;  5G04 L;  1XU1 A;  2NN8 A;  4LQR A;  2VVD A;  2WNV C;  1VB4 A;  1RUI 2;  5IUQ A;  1AXZ A;  3IT8 A;  5JOY A;  5D8A B;  3W20 A;  4K8F A;  1H2M A;  4QX7 A;  3WD5 A;  1LTE A;  4Q0S A;  4TSV A;  3AXD A;  3VDA A;  5FY5 A;  4FTS A;  3NV2 A;  3RYK A;  1DYO A;  5IVB A;  1SAC A;  1IKP A;  3VBU B;  1BYH A;  3B02 A;  1N3P A;  2OZJ A;  1I3H A;  4YLZ A;  1W9W A;  1JOB A;  2HWF 2;  1W0P A;  3OUJ A;  3RWN A;  2WZ8 A;  2BWC A;  4XJ8 A;  1Z7S 1;  2ZKL A;  3U4X A;  1OD5 A;  3WNL A;  2CDO A;  1KS5 A;  2WBK A;  1BZW A;  2OW4 A;  2VTX A;  1D2S A;  5FTT C;  2ENR A;  2VOT A;  1UYZ A;  4HKW A;  2X09 A;  4M3C F;  2JDY A;  4Q4W 3;  2VTF A;  2WWS A;  3A21 A;  4QX3 A;  4BH9 A;  3W58 A;  4EQV A;  1J3P A;  5C4W C;  2RS1 1;  3JD7 3;  1CAU A;  2PHL A;  2J1V A;  1A8M A;  2WZR 1;  4LO5 B;  4PIX A;  4XFI A;  1GNY A;  3QD6 A;  1CZV A;  1GR3 A;  4AED A;  1ZZ9 A;  1C8M 3;  3VN4 A;  1N3O A;  4ARX A;  4HLT A;  4DXT A;  2DUR A;  3PUA A;  3UJQ A;  4JHT A;  5FV3 A;  2X05 A;  4QWN A;  1VBC 3;  1W2N A;  4QHB A;  4E27 A;  1SZB A;  1S0I A;  5H9R A;  5JZG C;  3ALQ A;  1R08 1;  3MHZ A;  3ZKY A;  3USU A;  4LBO A;  2EAL A;  1GNH A;  3DXU A;  3WF0 A;  2EID A;  3ILN A;  2VAU A;  4RN5 A;  2R49 A;  2WLP A;  5D2A A;  4AVA A;  4WVM A;  1V6O A;  1VRB A;  2OT7 A;  3H50 A;  2DU0 A;  4GA9 A;  2LUW A;  1UY4 A;  4XMI A;  4YW1 A;  1VMH A;  2BOI A;  4QPG B;  4EN6 B;  4IEP A;  3U37 A;  2XBO 1;  2C9K A;  2BBA A;  3OOX A;  4WVW A;  1X9T A;  1LEN A;  2GNT A;  1AL2 3;  1QJZ A;  2BYV E;  3GCX A;  2E31 A;  2BPA 2;  3VBO B;  2D6P A;  4BXS V;  5J96 B;  2HWB 2;  3AM2 A;  1KXG A;  1G9A A;  3ZYB A;  1AR8 3;  2HWC 3;  5C3R A;  4WM7 B;  1AR7 2;  3SKV A;  4JGZ C;  2BQP A;  2WWJ A;  1UU4 A;  3AZZ A;  3PIJ A;  1HQL A;  1IQA A;  4MH0 E;  2XJT A;  1S0G A;  4UF0 B;  5FLJ A;  1RUH 2;  3VDD A;  1W04 A;  4OMD A;  4GMP 1;  1Q43 A;  3ZSJ A;  5A7S A;  5BNN C;  2OII A;  4ZZ8 A;  1MS3 A;  1SPP B;  4NIG A;  4JDN A;  5KC5 A;  4YSF A;  2RS3 1;  2WFF 2;  3VB9 A;  1PO2 1;  2WWU A;  4CU6 A;  2VEC A;  2J1T A;  5IK4 A;  2N7G A;  3AL6 A;  3Q8A A;  3KWV A;  1H9W A;  2JIG A;  3TWI A;  1A34 A;  3LIH A;  2GME A;  3ZVX A;  3NVC A;  4OCT A;  3WEZ A;  3WXP A;  1GZ9 A;  4KI5 M;  1YIF A;  1XXN A;  3OGV A;  5JVV A;  4MV2 A;  3U4S A;  2HWD 1;  2ET7 A;  4OVE A;  2HYK A;  1JHJ A;  4N8M A;  5CYY A;  4DUW A;  3R0R A;  3DUI A;  4MGI E;  1QH7 A;  1QIQ A;  3ZKU A;  5DG1 A;  3O1R A;  2QNK A;  3KV9 A;  1LU1 A;  3MDP A;  3VBH A;  3ZYG A;  3PVO A;  1J84 A;  4OHV A;  3RI9 A;  5ABJ C;  3BI3 A;  1RB8 G;  1C1F A;  2CDP A;  4HG6 B;  4PI2 A;  2BBV A;  4KMQ A;  1XE8 A;  1E57 A;  1ND3 C;  1QJF A;  3O0X A;  3WP3 A;  5F32 A;  3NNJ A;  1ZZ8 A;  1Y3T A;  1DQ1 A;  5DUV A;  5CAZ A;  1EP0 A;  2VZ1 A;  2GC2 A;  3WG4 A;  1NA1 C;  3GNE A;  1V6M A;  2VNR A;  1S2B A;  1YFY A;  2ARB A;  3FFQ A;  3GHM A;  4GAL A;  4LIT A;  4NAM A;  5EJZ B;  1ASJ 1;  1O59 A;  2BOJ A;  4QQL A;  4CEW B;  1YQ5 A;  1QEX A;  2VC9 A;  2VZO A;  3K75 B;  4GB3 3;  4H7L A;  5LB6 A;  1OLM A;  3DKW A;  4OUS A;  2YV8 A;  3VL8 A;  4NHY A;  1C4R A;  2GMM A;  2OX0 A;  3VGI A;  1DLL A;  2WLQ A;  1N1S A;  4HSJ A;  1SFY A;  5FPB A;  3DYP A;  4N7I A;  5J36 A;  3MZH A;  2C4X A;  2KA3 A;  3ETQ A;  4UXA A;  3H8R A;  1FV3 A;  1PZ9 A;  4HZF A;  2K9Z A;  3WUC A;  1NQD A;  4NMI A;  1IS4 A;  1QJX 1;  2Y6J A;  5DAV A;  2KR2 A;  1HB2 A;  4BQ2 A;  3N7J A;  2JIJ A;  2MPF A;  2ZGQ A;  4LTA A;  2K0G A;  3AZY A;  1JOP A;  1QJE A;  3ZFE C;  4CCK A;  1LJ7 A;  2YMZ A;  1JI6 A;  3OGJ A;  2VUC A;  4RQP B;  3ZFG C;  5CNA A;  4YGC A;  2QFE A;  3TN9 2;  4AVC A;  2VZQ A;  1HRI 1;  3NRU A;  4COZ A;  5A3T A;  5FP3 A;  5C3P A;  5FZ9 A;  5GZG A;  5C8C A;  2P1B A;  2CWS A;  1LOB A;  1S0J A;  5BNO C;  3FE5 A;  5CFC B;  1XNA A;  1NLQ A;  5FY1 A;  2KXL A;  5JXG A;  2P17 A;  5LBC A;  3T2Q A;  1RUC 3;  4KWL A;  1POV 3;  2B5H A;  1D4M 1;  3ZFF B;  3AKT A;  5A3N A;  2PQS A;  5BUV A;  1L7L A;  4JGY B;  5IFP A;  3NV1 A;  3MEP A;  3SCF A;  3AZW A;  4DMI A;  3HR9 A;  1SLI A;  4Y1Y A;  3KV6 A;  3BTX A;  5J1X A;  1WUV A;  1WCS A;  4AR2 A;  1PK6 B;  1RUF 1;  2VZT A;  4A45 A;  4Y1V A;  1F35 A;  3VD9 A;  2ARA A;  1PZ7 A;  4MUV A;  2VPV A;  4IEY A;  1JHN A;  3MPP G;  3J8F 2;  1RGS A;  3Q9O A;  3M70 A;  2YB7 A;  1K5M C;  2Q1F A;  4YG3 A;  3ZSE A;  4FI9 A;  3IMN A;  2VOV A;  3WQB A;  2TEP A;  4Q8K A;  2A70 A;  4XOG A;  3E5X A;  5I0U A;  4DUX A;  3OPT A;  5EQU A;  4XFC A;  2WN2 A;  3HMY A;  3THC A;  1AXY A;  3BU0 A;  3K77 A;  4EE2 A;  3K4D A;  3ZYJ B;  2FD8 A;  4I0B A;  2UWA A;  5KXB A;  1QDC A;  2CV6 A;  2FCT A;  3POY A;  2LRP A;  3UL2 A;  2ZGP A;  3HBZ A;  2QJV A;  4CDU C;  4A4A A;  3L2Y A;  4YWA A;  3C7H A;  3OGG A;  1NCR B;  4XQ4 A;  1O8P A;  3ST7 A;  1H8T A;  4IEW A;  3X29 B;  2FCV A;  1UAI A;  2MEV 1;  2Y0I A;  5GAL A;  3OPW A;  1YQ2 A;  4NRM A;  4A42 A;  5J7M A;  5KHJ A;  3EHK A;  1ZBE 3;  4XUN A;  1VAV A;  1PVC 3;  1AYM 3;  1S0F A;  1PNF A;  3I2I A;  3LE0 A;  1NYW A;  4RGK A;  1V6K A;  3Q8C A;  3S57 A;  2ZZQ A;  4AAX A;  2RM2 3;  5F3I A;  3K4A A;  5CG9 A;  2O0O A;  3T2P A;  2VME A;  3PDQ A;  3U07 A;  1YUD A;  3LFI A;  3PVN A;  3VHN A;  4OLL A;  5A6Y A;  2LAL A;  2VBD A;  4JVA A;  1JU4 A;  1B35 B;  2ZGN A;  1JYX A;  3DF0 A;  1NZI A;  4KGQ A;  2XL9 A;  1H6Y A;  3LPF A;  3LZZ A;  5CKN A;  2NMN A;  3VUO A;  2NM1 A;  2WNV A;  5JOW A;  1UYX A;  2HYX A;  4M3C A;  3N3H A;  3ACG A;  4PDW C;  2XWB B;  3MLJ A;  1Z0H A;  5L9B A;  3R4U A;  5KHH A;  2JDP A;  5LBE A;  4CXX A;  1ZBA 3;  4MXW A;  4MET A;  4CDW B;  3L9J T;  1NE6 A;  5FYM A;  5FXX A;  5A1A A;  1J1L A;  1M4W A;  2P37 A;  5ACA 1;  2CWM A;  1RIN A;  2R04 1;  5FZ0 A;  2ZOE B;  5FP8 A;  3VBF B;  4QPY A;  3VBR C;  2P3K A;  3MFC A;  4HVR A;  2QQW A;  4NHL A;  4EWA A;  5HPO A;  2GH8 A;  3AFK A;  1Q3E A;  3D82 A;  5G05 L;  4BU2 A;  1HLC A;  5SV8 A;  2WNO A;  4CP9 A;  2RS5 2;  3O1S A;  2D3R A;  3JUU A;  4BME A;  3S7E A;  2XVG A;  4N53 B;  4E2S A;  4EJR A;  5J48 A;  2PHX A;  2VUD A;  1ZA4 A;  2C26 A;  2RE9 A;  3SIS A;  3FUO A;  4XQW A;  5C4W A;  4DPN A;  4Q4V 2;  2ZGK A;  3U75 A;  1JZ3 A;  3M3I A;  1SHW B;  3LKJ A;  2W91 A;  4LJH A;  3I3M A;  3U0Z A;  1W6P A;  4FFG A;  3BAL A;  3ZXD A;  4I09 A;  5L7O C;  1FMD 1;  3A0N A;  2WL1 A;  3KT1 A;  5A7N A;  1WCU A;  1W9F A;  1LEC A;  3ES4 A;  3FJS A;  3I3Q A;  5JZG A;  4OFG A;  2XHN A;  5IAV A;  4LHK A;  1BKZ A;  4Q4Y 1;  4G9S B;  4OZX A;  1ZRC A;  2VOX A;  3PUS A;  5DAB A;  3SQO A;  4AI0 A;  3CZU A;  4M4R A;  4Q1P A;  3B69 A;  4FPE A;  4UWD A;  5FQ0 B;  2DFB A;  2Y60 A;  4I3P A;  1OVS A;  1VBE 1;  2JDU A;  2VQT A;  3GXU A;  3KT7 A;  4TZD A;  3I2J A;  1LOC A;  3BIE A;  1HKD A;  2GH2 A;  1QOO A;  2DVF A;  5FMD A;  4YGE A;  4Q4W 2;  3ZLI A;  3H3Z A;  1T6G C;  4CEY B;  1AVB A;  3LEI A;  4P5H A;  3TEZ A;  1DYK A;  1ZRE A;  3JD7 2;  3N9O A;  4A3X A;  4JGZ A;  4K9S A;  2WYS A;  4PQQ A;  4RS5 C;  3ZIX A;  2ETE A;  2Y38 A;  3O0V A;  2R6Q A;  5LA9 A;  2WNE A;  4LO7 A;  3IN9 A;  3FHQ A;  2C9A A;  1WBF A;  1CX1 A;  3DEC A;  3M8L A;  1VBC 2;  4HT1 T;  5BNN A;  4SLI A;  1CON A;  2VGD A;  5HXV A;  1DGW A;  5C33 A;  1HXS 3;  2CHH A;  5DDJ 1;  4XFH A;  3VZO A;  3WV6 A;  4KL1 A;  1WCD J;  1X36 A;  1W6O B;  2DVB A;  4PIZ A;  4D6Q A;  5C71 A;  1V6L A;  3O1P A;  2QDR A;  3P5B A;  4QX1 A;  4PIY A;  2HKX A;  1VAL A;  4UFH A;  1BMV 2;  1IS5 A;  4IGQ A;  4ZZ5 A;  1CAX A;  1IGO A;  3IZO A;  3W5N A;  1UMH A;  3M3Q A;  2ZGM A;  3B94 A;  4CCN A;  1AL2 2;  5HBA A;  2X53 S;  1Y9G A;  3HOB A;  1MQT C;  2QQU A;  4LBQ B;  1NCQ C;  2GAU A;  2J1U A;  5A7W A;  2LM3 A;  1URX A;  1XSQ A;  2HWC 2;  3WDT A;  1JZ8 A;  1MAC A;  1G8W A;  3KSC A;  5A3W A;  5ABJ A;  2BUK A;  3TOJ A;  1BK0 A;  2IXL A;  5K8S A;  2A3Y A;  3PVE A;  1K5J A;  2DFC A;  2ZEZ A;  5E8A A;  1ND3 A;  3UYJ A;  3GDB A;  2A71 A;  3O1T A;  1NA1 A;  2XKO A;  3AKS A;  5BNP C;  1W05 A;  2V4A A;  2IFR A;  2ZML A;  2R1D A;  2YUE A;  5FZH A;  3BTY A;  3JXS A;  1ST8 A;  1BCX A;  3JQX A;  1RUJ 1;  4KBZ A;  3M1H A;  5A7Q A;  2HWE 3;  1A3K A;  3MW3 A;  1G9B A;  4U2A A;  5CIR A;  2AAC A;  4MHU A;  2R30 A;  1SLL A;  2EIE A;  4ISR A;  4UOJ A;  4XPV A;  3URF A;  3ZXA C;  4C1X A;  3ZXG A;  2R0H A;  3T0D A;  1IPK A;  4IUG A;  3O1O A;  2FZ1 A;  2Q5T A;  1OLM E;  3NWK A;  5DMY A;  4YM1 A;  3BU7 A;  3RWK X;  3K2O A;  5T5L A;  3H8O A;  4E4S A;  3HJR A;  4UFJ A;  1G9C A;  4TTG A;  1JMU B;  2OYZ A;  3ZO0 B;  3HWJ A;  3ZFE A;  2HWB 3;  1UX7 A;  3TB0 A;  4GH4 C;  4TN7 A;  4BIO A;  2DU1 A;  1NY7 1;  2VY0 A;  2PAM A;  2YYO A;  3V64 A;  3ZFG A;  3AMH A;  1AR7 3;  4COY A;  3E5U A;  1CAU B;  1K12 A;  4QDQ A;  1FPN 3;  1W2O A;  1GP6 A;  3Q8E A;  4BQ5 A;  4Z2W A;  4YVS C;  4AED B;  4JV4 A;  1PNG A;  1OLQ A;  3GZA A;  1H9P A;  1RUH 3;  4XUQ A;  3WNM A;  4CCC A;  2BNM A;  4ZON A;  2D6O X;  5BNO A;  4CXY A;  1F4A A;  1T6B X;  1TMF 2;  3ORJ A;  1W8F A;  3D3A A;  1MZF A;  5IVJ A;  3FFZ A;  4MVT A;  1CGP A;  3T4H B;  3WX5 A;  4DNY A;  2DF7 A;  3PLQ A;  1PGL 2;  4XAC A;  3VD3 A;  3RZL A;  4GB3 2;  2YG0 A;  3MW4 A;  3PTY A;  4TWT A;  4QDR A;  4IND A;  4ZY9 A;  3ZSL A;  2O8Q A;  5CU1 A;  3WHU A;  4H3W A;  1W3X A;  5JLV A;  5JXH A;  1SDD B;  3D6E A;  3KZ4 C;  4JQT A;  1OQE A;  1ZRI A;  2YC2 A;  1OPO A;  4K1Z A;  1O4Y A;  3CJI B;  3VHR A;  1LHW A;  2GC0 A;  3POJ A;  5IAX A;  2BZD A;  2R0F A;  3PL0 A;  5K7P A;  4BYY A;  2JDA A;  2UY9 A;  3BPZ A;  1K5M A;  2VUL A;  3GGL A;  4FPC A;  1X7N A;  2C5D A;  4L9B A;  2E51 A;  3J7H A;  2GN7 A;  4R9A A;  3OSD A;  5A7O A;  4KWU A;  1REE A;  4CP1 A;  3GYD A;  4IGP A;  3AMQ A;  1MS0 A;  1U5I A;  5K9Y A;  1YNA A;  2W52 A;  3M7A A;  2B39 A;  2W1Q A;  5L73 A;  1Y9M A;  3NL1 A;  2QZ3 A;  4FOV A;  5DUW A;  2Q1M A;  3APB A;  5L36 A;  1V6J A;  2A3W A;  5BY5 A;  1W2A X;  2BW8 A;  3FHA A;  1MEC 3;  1PGW 1;  4RHV 3;  4XIL A;  2AC1 A;  3VDD B;  2HEY F;  2RR1 1;  1ENR A;  4CDU A;  1JYV A;  1UD1 A;  1BEV 1;  1RUC 2;  1H4H A;  3KS7 A;  1H8V A;  1PMI A;  1Q8V A;  2ZJC A;  3NAP C;  4E4D X;  4RGA A;  1XC6 A;  4OHZ A;  4BPZ A;  2D3P A;  5FZ4 A;  4BJ0 A;  1MZ5 A;  2PAE A;  1UPI A;  1AR6 1;  2WFP A;  2ZXQ A;  5GJ6 A;  4E8C A;  5BYN A;  4NOT A;  4QX5 A;  4LNV A;  1EAH 1;  3TEW A;  2F6B A;  5J37 A;  4IV3 B;  3RZM A;  2XHK A;  5A3M A;  2A6W A;  3CKH A;  2IXC A;  3V0B A;  4YW7 A;  2PEL A;  2WAA A;  2UWC A;  1SDW A;  2ET1 A;  4RR3 C;  5I93 A;  3TN9 1;  3OD0 A;  1BBT 3;  3VBH B;  4XZU G;  1UOG A;  3H1M A;  3WIN E;  3VD4 A;  2OS2 A;  5FY8 A;  2X10 A;  1PO1 3;  4PDW A;  4Y22 A;  1N1Y A;  4YM0 A;  1KFX L;  2YBS A;  2WO3 A;  5FZK A;  1FNZ A;  3AK0 A;  3P1I A;  5ERL A;  4QX0 A;  1BK1 A;  4M3C E;  1A6C A;  4V2W A;  2P3Y A;  1F5J A;  3VBS C;  5FZF A;  3THD A;  4FFF A;  3MW2 A;  3WF3 A;  2JDZ A;  2GNB A;  3VBR A;  1DCS A;  3ILF A;  2YFU A;  1O5L A;  2CYF A;  1WD4 A;  4FPH A;  1ZBE 2;  3BOD A;  3OD4 A;  3N4M A;  2E26 A;  1QWR A;  4UW3 A;  5DPN A;  4AXO A;  4B4P A;  1PVC 2;  1AYM 2;  1PHM A;  1GAN A;  3ZN6 B;  3J8F 1;  4CZS A;  1OQD A;  1TVG A;  3NJY A;  3OUI A;  1R1A 1;  4NR1 A;  3S5A A;  2NPI A;  2G4I A;  1XRU A;  1AYN 3;  1E5R A;  3TYJ A;  4LMF A;  1RUD 3;  2I74 A;  1W39 A;  2B46 X;  3GM8 A;  5FK7 A;  4FQ4 A;  2WO1 A;  1AUY A;  1QNY A;  1KJR A;  2YU1 A;  4C90 A;  2BVV A;  3SEP A;  4TXW A;  4AHX A;  3KCX A;  4YW6 A;  1ZNP A;  3AP7 A;  4YG0 A;  2R06 2;  3OF1 A;  4LBN A;  2NQY A;  1O7F A;  1OOP B;  1AF9 A;  5AC9 3;  4XFG A;  1VIW B;  5J3U A;  2A6V A;  2JB8 A;  4BIS A;  1ZBA 2;  2EXJ A;  4DRV A;  1VRH 1;  2GZW A;  2JEC A;  5E16 A;  3FLT A;  3WDW A;  1UPS A;  3LFM A;  4UW6 A;  1DGR A;  1DGL A;  2WRA A;  3LOB A;  4X8P A;  5A3O A;  5CG8 A;  3VD7 A;  2PFW A;  3DYO A;  2XR4 A;  2NLR A;  4HVO A;  2WJS A;  2Q8C A;  1F4H A;  1UZW A;  1BQP A;  3C7E A;  2Z79 A;  4NWW A;  2Y8K A;  1PIV 2;  4QQO A;  1V9U 1;  1TNR A;  3ZXL A;  1C57 A;  1H1M A;  1WLT A;  3HT1 A;  2BU9 A;  3I2H A;  4JC1 A;  1QDO A;  2OVU A;  4MO3 M;  4Q1R A;  1D0H A;  1VMF A;  3PJY A;  5GLW A;  2WS9 2;  3FLR A;  4YM2 A;  2PHR A;  4AGV A;  2CL2 A;  3AYD A;  1BLZ A;  4CDX C;  3LSE A;  2FHR A;  1YFW A;  4K6B A;  3MO4 A;  1W2U A;  3MLK A;  5CFD C;  2RMU 2;  2DWR A;  1PM7 A;  4LBQ D;  1W0O A;  3IAP A;  3PUI A;  2ZGU A;  4LBJ A;  1RUG 3;  3RZG A;  1GFF 2;  5FXW A;  1MVQ A;  1COV 3;  2CAU A;  2G9Z A;  3BCW A;  2B45 X;  4K1Y A;  1VMJ A;  3WDU A;  5FY7 A;  3EO6 A;  2ERF A;  1CPN A;  1DZR A;  2IVI B;  3KF5 A;  3ZDS A;  1H2L A;  2FDI A;  2QKD A;  2R16 A;  1QXJ A;  1FOD 1;  1O3Q A;  2WKK A;  1W6M A;  2CGO A;  2QCS B;  3GBF A;  5A7P A;  1ALY A;  4AG4 A;  3NKG A;  3HT2 A;  4O65 A;  4YW2 A;  3WT3 A;  5KXC A;  3I7D A;  1OA3 A;  1MQT A;  2Z5W A;  2DBI A;  4WM8 B;  4Q4V 1;  1W9T A;  5FUN A;  5JPM B;  3HEI A;  3UT0 A;  4ASL A;  1LOF C;  4AFB A;  4LHS A;  5B4N A;  4XJZ A;  4Q27 A;  1LED A;  3FUQ A;  1VBA 1;  2WNU B;  5CA6 A;  4ZXK A;  4C0B A;  3FWE A;  4WZC A;  2ZX2 A;  4AYU A;  4W6W A;  3OBZ A;  4HN1 A;  2WNV B;  4Y26 A;  5C7G A;  1RMU 3;  2AUY A;  1WLC A;  4AI2 A;  2H6B A;  5BNP A;  3NV4 A;  3POG A;  1DQ5 A;  1HXS 2;  1FAT A;  2BP6 A;  3PVB B;  4AHW A;  1RUO A;  1VE0 A;  4IEO A;  3UES A;  3CU7 A;  5C9A C;  2YC4 A;  1CPM A;  1G9F A;  1POV 0;  4KQ7 A;  1R64 A;  5FDB A;  3EJK A;  1YCI A;  1IQD C;  2VCC A;  1LHO A;  2FQP A;  3H1W A;  4GWJ A;  4QHO A;  2JDK A;  2UUR A;  5IK8 A;  2W1U A;  1JN2 P;  5FYU A;  3PMS A;  1ND2 C;  1IS3 A;  2ZX4 A;  3O7O A;  4NVP A;  5LBF A;  4OQ9 A;  2W08 A;  3ROU A;  3WHT A;  4CP9 B;  2JDH A;  1O6U A;  3GAL A;  4L99 A;  3SH3 A;  3FN9 A;  2RHP A;  3TAY A;  4AAP A;  1DGW X;  1PVX A;  2RDQ A;  1H4G A;  5DUX A;  3U10 A;  2RJK A;  2H6C A;  1JOJ A;  4X8N A;  3WNO A;  1JZ2 A;  4MSV A;  1YWK A;  4GH4 A;  4ZU4 A;  2IXJ A;  3AMM A;  2Q8O A;  4B7K A;  4YAR A;  1R09 1;  1BVV A;  1C8M 1;  3I3E A;  4MZU A;  4UI9 L;  3VBU C;  3WDV A;  2QVS B;  3UKT A;  2SLI A;  5C4W B;  2XQX A;  1RJ7 A;  3N36 A;  5FPU A;  5CKQ A;  1W6P B;  5JSP A;  4LEJ A;  1GYK A;  4Q5O A;  2DTW A;  4LT5 A;  1AL0 G;  3CBN A;  4P9G A;  5F5A A;  3PUR A;  4Z2A A;  4NN0 A;  1DDL A;  5IJR A;  1NOV A;  5E88 A;  1JBC A;  1XNB A;  2OKX A;  2RJ2 A;  3WDX A;  1JZ5 A;  5FZ6 A;  4WBB A;  4JCK A;  4BZ4 A;  2HWE 2;  1NQJ A;  2ZMK A;  3HN1 A;  3NST A;  5FAX A;  4KU8 A;  2VM9 A;  1G86 A;  2VD7 A;  2ZGO A;  4R9B A;  1BMV 1;  1YIP A;  2PN5 A;  3MF6 A;  1H6X A;  1QY4 A;  1W9Y A;  5F5Q A;  4BCU A;  4NE9 A;  5GLV A;  4ZS3 A;  1UMZ A;  3JB4 C;  2JG9 B;  3I97 A;  2CNA A;  1AL2 1;  1QMJ A;  4JKK A;  4QM9 A;  2RS1 3;  2ES3 A;  4YM3 A;  5A1F A;  5GZC A;  5K0U B;  2P6H A;  1L7R A;  2LS6 A;  1AR8 1;  2WQ8 A;  1IZ3 A;  2VZR A;  5DZG A;  3WNN A;  4J1W A;  1HV1 A;  3H0O A;  3SHR A;  3T1M A;  4CE8 A;  1WCK A;  3B5L B;  3IMM A;  3CF6 E;  5ISL A;  2EIC A;  2PMW B;  4HPK A;  3VZM A;  1FPN 2;  5L9V A;  3U11 A;  5A32 B;  1R08 3;  2W0X A;  2E7Q A;  1CQ9 A;  1W8W A;  4QPG C;  1YO8 A;  1D7P M;  1EUU A;  4Q29 A;  3UNP A;  1OF3 A;  4P9Y A;  2Z69 A;  2UU8 A;  3NQH A;  3E6B A;  1ENQ A;  4FP2 A;  4K40 A;  3VBO C;  2XBO 3;  4RFR B;  5FOJ B;  3NAP A;  2E32 A;  4DEQ A;  4XUT A;  2C6S A;  1GZW A;  1WMX A;  3RSJ A;  3LF7 A;  3ZN5 A;  1NAE A;  2WZE A;  1DF0 A;  1QHD A;  3N7M A;  2VW0 A;  5FZC A;  4CYD A;  4BA6 A;  3GJB A;  4D6S A;  2DCT A;  2VU9 A;  3J4U H;  4M0H A;  3I2G A;  2BNO A;  2DVD A;  1HQN A;  3W21 A;  1EV1 1;  5C3S A;  2O8O A;  1CAX B;  4OZO A;  4ZU5 A;  5JWP A;  4XBQ A;  1ZM1 A;  5F2S A;  2GDF A;  5APA A;  3E6D A;  2ZBJ A;  3I2K A;  3VZN A;  3RS6 A;  3RZZ A;  3BOW A;  1WKY A;  3MIB A;  4RR3 A;  4XUO A;  3WQ7 A;  4BQW A;  1OXC A;  1YRZ A;  2BVB A;  1QOT A;  2XML A;  5DAX A;  4WZF A;  4COU A;  4N43 B;  2BNN A;  1YJL A;  2JKX A;  3AC0 A;  3QOP A;  4AFA A;  2FDF A;  1YLL A;  1S55 A;  1LGN A;  1WGP A;  3PU8 A;  3KVA A;  3N35 A;  2RS3 3;  1PO2 3;  4AVB A;  1ZRD A;  2EAK A;  4IE7 A;  1F15 A;  4DIQ A;  1YXW A;  4RHV 2;  1MEC 2;  1QXP A;  3S30 A;  1KFU L;  2A75 A;  4AFC A;  4OHW A;  1VPH A;  4UW5 A;  1W8H A;  5I0S A;  2WSU A;  1BHG A;  1TMF 3;  2VZ3 A;  1QF3 A;  3OBR A;  1S0B A;  3VBS A;  1EYB A;  4FO9 A;  4LR4 A;  1NA1 B;  2BGO A;  4QKB A;  1FNY A;  4XC9 A;  3WVJ A;  2JD9 A;  3VKF C;  2XLF A;  2E7T A;  2HWD 3;  3GHN A;  4EV0 A;  2ZHK A;  5FMO S;  2BRT A;  2QQK A;  2Q8D A;  5FFO C;  2W3J A;  5EIY B;  1YFX A;  4LLF A;  4CDQ C;  1ENS A;  1SLA A;  4DB5 A;  4YG6 A;  1CES A;  3EMR A;  4FQZ A;  3UV9 A;  3I59 A;  2D44 A;  4XEZ A;  1GWM A;  1OFN A;  1AXK A;  2WN3 A;  5A33 B;  1CD3 G;  5FPZ A;  1KRI A;  2PHT A;  2KD7 A;  3CEW A;  1BBT 2;  4CEW C;  3ZFE B;  3V0A A;  4L0P A;  1MS8 A;  5FYB A;  1CX4 A;  3J7M A;  1G9D A;  4M0N A;  1JUI A;  3KV5 A;  3ZFG B;  3LEK A;  1UL9 A;  1PO1 2;  5FZE A;  4CUB A;  4EN0 A;  1HRV 1;  4JDM A;  2PHW A;  3LDK A;  1TNF A;  3J26 N;  1UO9 A;  1LOG A;  1ASJ 3;  3AKP A;  3KB5 A;  1O3T A;  1SG3 A;  2VXR A;  1APN A;  2YGL A;  2FBE A;  5BNO B;  3B00 A;  1HX6 A;  1ACC A;  3RPQ A;  4FPL A;  3CMG A;  1W6N A;  3KT4 A;  4PF1 A;  1UYY A;  2XH6 A;  3C7G A;  4HK9 A;  4BQ4 A;  2PTM A;  3ZYH A;  4ES9 A;  1A8D A;  1QJX 3;  4NHK A;  3ZDV A;  1XYP A;  3OYW B;  5FZB A;  1T2X A;  2A6Y A;  3RZK A;  1RTV A;  2VCB A;  4DZG A;  2BTV C;  4R9D A;  3MIH A;  3K46 A;  4ATF A;  1AYN 2;  5T5O A;  5FCC A;  4QU2 A;  1TQ5 A;  2XLA A;  4DFS A;  1YYN A;  1MS9 A;  1RUD 2;  1XQN A;  1GV9 A;  5F5I A;  4CRQ A;  4RGG A;  3IB3 A;  4D94 A;  3C7O A;  3MF9 A;  4CDX A;  3LCP A;  1US3 A;  2CTV A;  3PME A;  3POI A;  4QX8 A;  2DVA A;  4C8D A;  5CFD A;  3A7Q A;  2V73 A;  4XUR A;  5AC9 2;  1LB2 A;  2BWA A;  2W46 A;  3IDB B;  4P14 A;  1IOA A;  2FDG A;  4IW3 A;  4NII A;  2RDN A;  1VJ2 A;  2ORX A;  5I91 A;  4R4X A;  2DUP A;  3JBG 3;  5LEJ A;  1RUF 3;  4AVT A;  4CDU B;  2XG3 A;  2VJX A;  4YZ1 A;  5LK5 A;  2Y64 A;  1F2N A;  1UOB A;  2J1R A;  2FDK A;  4K20 A;  1RYY A;  3AP4 A;  4S2D A;  1PM4 A;  2J42 A;  2RM2 1;  1I1E A;  2Y34 A;  2WII B;  4YVW B;  1X8E A;  2YZ4 A;  1GLH A;  3RJ2 X;  2GC1 A;  4B8E A;  4BQ1 A;  3O1V A;  5JI9 A;  4HSL A;  5JIU A;  3UK9 A;  4ERO A;  3MBW A;  3HQX A;  1LOF A;  4MGQ A;  3VZL A;  5FZ7 A;  3WCS A;  4AQT A;  3V0B B;  4AQ6 A;  3S6P A;  1TG7 A;  5CIS A;  1NCR C;  2BDR A;  4KGG A;  2ZAC A;  1XNC A;  1O3R A;  3T0A A;  2ARE A;  1DG6 A;  2JB4 A;  4IE4 A;  4PLN A;  1SBE A;  4QXH A;  3RDI A;  2VNV A;  4EWD A;  2R06 3;  1W8U A;  1ZBA 1;  4QPI C;  5FXZ A;  4Q0P A;  1UQX A;  1RUG 2;  2A73 B;  4Y22 B;  1RVF 1;  2MEV 3;  3MPB A;  4QHZ A;  1COV 2;  1X8M A;  1Q5O A;  4XF3 A;  1Q8Q A;  2GSY A;  4MXV A;  5D21 A;  4AWD A;  3B93 A;  2JD4 A;  1WW7 A;  1R1Z A;  1VBB 3;  1DU3 D;  2PAK A;  3O1U A;  5C9A A;  3H7Y A;  1DZQ A;  3N9P A;  1B35 C;  3H1Y A;  2DVG A;  4LIU A;  5BXX A;  3VBR B;  1GOF A;  1TME 3;  4UFK A;  4X6R B;  2CY6 A;  3RG0 A;  1YQ6 A;  1H2N A;  2IVJ A;  1NT0 A;  3KGL A;  1ND2 A;  2UYB A;  4CPB D;  4CUC A;  1AR9 3;  4KWJ A;  1FXZ A;  5KWR A;  2X5I C;  1W0N A;  1PIV 3;  2XJQ A;  1HV0 A;  3O12 A;  3PHM A;  4Y3O A;  5B4X A;  4COV A;  4AOC A;  3I49 A;  2Y6L A;  5T55 A;  2QQV A;  2WS9 3;  3VBU A;  3WF4 A;  5SV5 A;  1GKB A;  1QU0 A;  3INA A;  3VBF C;  2CSG A;  1QJU 1;  2ZEW A;  3KF3 A;  4NJ4 A;  2NP0 A;  2D6N A;  3MFA A;  3BKZ A;  1J3R A;  2YGM A;  1S2K A;  1O4Z A;  4GKX A;  2KM2 A;  1QQP 3;  5ACA 3;  2Q30 A;  1RMU 2;  2RMU 3;  3ZOI A;  3USS A;  4DXS A;  3HBK A;  4CCJ A;  2J1A A;  3WNX A;  1LKN A;  2XQR A;  5HCF A;  4N53 C;  2Y0O A;  2DV9 A;  4AEM A;  4RA0 A;  4FPF A;  3HQR A;  2Q0A A;  4DO0 A;  3AFG A;  4OHX A;  4Q8L A;  4NRO A;  4OUE A;  5F6K A;  3OEA A;  4GJY A;  2D93 A;  1TZO A;  3W9A A;  1ULE A;  5FPV A;  2TNF A;  1Y9Q A;  2XLG A;  2VTX J;  4K21 A;  5T52 A;  3AZV A;  1W8N A;  2X29 A;  4EZ4 A;  1ULO A;  1V70 A;  4XTM A;  1UNB A;  1DQ6 A;  2VVF A;  1FMD 3;  4GQ7 A;  4YZ3 A;  3ACI A;  3N7K A;  5FZG A;  5IHR A;  5EYY A;  4QX2 A;  5EFU A;  2PHF A;  4KG0 A;  3V56 A;  3DPR C;  4V1P A;  5A6Q A;  5FJK A;  3WSO A;  1RUI 1;  2YHJ A;  2XVK A;  5EYX A;  1RXF A;  2XUM A;  3EYP A;  1SFP A;  1Y7B A;  4QPG A;  4NWV A;  4Y1Z A;  4BHP A;  1HN0 A;  1JYT A;  3DKQ A;  4COW A;  3FL7 A;  1Z7S 2;  2R7E B;  3VBO A;  4OI2 A;  4U36 A;  4LBK A;  1VR3 A;  5AVA A;  2HWF 1;  2I07 B;  4Y20 B;  1HB3 A;  2G9F A;  3JZV A;  4G4F A;  4GD4 A;  5JOZ A;  4FPG A;  4IEZ A;  3B01 A;  2A1X A;  2D3S A;  3BIW E;  3UGF A;  1OKO A;  3WP5 A;  2DUQ A;  2RS1 2;  3VHP A;  1W6M B;  2XJS A;  1DYP A;  2VW1 A;  4FOQ A;  3RJR A;  3WW3 A;  2RJL A;  1GU3 A;  4NRQ A;  1OI6 A;  1W8Z A;  1LHU A;  2OPW A;  4HOO A;  4IE6 A;  1DFQ A;  3PJQ A;  4XTP A;  5KHG A;  3DYM A;  4FXK B;  3JQW A;  5A3P A;  5FYS A;  4HMZ A;  1QJY 3;  4CA9 A;  4BB3 A;  1R08 2;  4KWK A;  5IWF A;  3NNF A;  4P9I A;  4D3W A;  5FZA A;  4EN8 B;  2AH2 A;  5LZ6 A;  1W6Q A;  2Q8E A;  2VMG A;  5GZE A;  3I3B A;  1LHV A;  4GZ9 A;  1IS6 A;  1GBG A;  3I8T A;  1S2E A;  4HL0 A;  3MV0 1;  2XBO 2;  3WLU A;  2VUA A;  3MIE A;  1DQ2 A;  4Q2F A;  3I2D A;  5FRE A;  2B9V A;  4FCA A;  4P00 B;  3KCC A;  5LA0 A;  1LAJ A;  2JG8 C;  4W6X A;  5EXO A;  4CDQ A;  3SXW A;  4AW7 A;  1N1V A;  4GAZ A;  1E5H A;  2DCY A;  2I2S A;  4PI0 A;  3I54 A;  4BK4 A;  1YEW A;  3B7M A;  4LUM A;  2HWB 1;  4TLG A;  3NNG A;  1KDM A;  1WW5 A;  4W8J A;  2OQ6 A;  1J59 A;  4NPL A;  3ELN A;  3OTF A;  1AR7 1;  1OMI A;  2V4V A;  1FPN 1;  3A23 A;  4BQY A;  4CCL A;  2W9X A;  3VKO A;  2ID4 A;  5IW0 A;  1RUH 1;  1WD3 A;  4RYD A;  4BQX A;  1S0D A;  4LO6 B;  4DS0 A;  5A3U A;  2RS3 2;  3LEG A;  3ZXJ A;  1PO2 2;  3AYC A;  1XU2 A;  2DCK A;  5KHK A;  1CZT A;  4Y33 A;  1K45 A;  1RUJ 3;  3H42 B;  3WCR A;  5C5T A;  5FKC A;  3I2O A;  3ITQ A;  1LOE A;  2HLE A;  3WQ0 A;  2WFF 1;  1UN1 A;  3U14 A;  5IK7 A;  5HV4 A;  4FSJ A;  3FC0 A;  4YNI A;  5H9P A;  1C3H A;  1WBL A;  1SCS A;  4Y1U A;  1P8J A;  4F8A A;  1YHF A;  2HWD 2;  2O14 A;  2XWJ B;  5T5J A;  4CCM A;  4QGN A;  1UCX A;  2D98 A;  1ULD A;  3USU B;  4XZP A;  1SMV A;  2ZA9 A;  3ZPY A;  1X50 A;  3H3L A;  1H2K A;  4WVM B;  5JUV A;  1RUE 3;  3GZT B;  3O1M A;  1MS1 A;  2ZMN A;  3AP5 A;  4XF9 A;  4AED C;  3VL9 A;  4DY3 A;  3EBR A;  2VOK A;  4QAW A;  4F7Z A;  1OH3 A;  1F8V A;  4QXC A;  4NAO A;  2EXK A;  4XET A;  4S2H A;  2XJP A;  4LK6 A;  2OXB A;  4YGD A;  4Q0V A;  4UFM A;  1G6N A;  4XW3 A;  2C24 A;  2GP5 A;  2VZV A;  4G3Y C;  5F7U A;  4RHV 1;  1MS5 A;  1NLR A;  2OZ6 A;  4HPK B;  3B9I A;  5HXM A;  2VBP A;  5FYI A;  3WQ1 A;  1ASJ 2;  1S0E A;  4M4P A;  5FXV A;  5EPA A;  4HKL A;  2QBX A;  3TNP B;  3PUH A;  1OHF A;  4XF4 A;  3BVC A;  4B29 A;  1EPZ A;  3CJI C;  4CXW A;  3AZX A;  1U5X A;  3PU3 A;  4L8Q A;  5DN2 A;  4YW5 A;  5FZO A;  4D7T A;  1PMH X;  5IYY A;  1L3J A;  4UFI A;  2PQQ A;  1QJX 2;  2Y6F A;  4V2V A;  1UIK A;  4GUL A;  5A1L A;  5JOX A;  1GZW B;  3AKQ A;  2ZPX A;  3KQ4 B;  4H14 A;  1UZY A;  1ODM A;  4QGM A;  1JU3 A;  4B4R A;  1WMD A;  2NMO A;  2JDN A;  1FT9 A;  1O8S A;  2ZS6 B;  3K51 A;  3MI8 A;  4LHL A;  4NHM A;  4EN7 B;  4PBP A;  3AYA A;  2OA2 A;  3KM5 A;  5FUI A;  4ATE A;  2JE7 A;  3D0J A;  4L97 A;  5LCW L;  4CU9 A;  4B3N A;  3GZU C;  3O14 A;  1J1T A;  1WWY A;  2D5F A;  2Q4S A;  1JUH A;  4H55 A;  4O61 A;  3LPG A;  5EV7 A;  3MGU A;  4I30 A;  1NCR A;  5FYZ A;  1SBD A;  2R1B A;  4CCE A;  2YFZ A;  1O4T A;  3R6S A;  5FWE A;  3J7L A;  3OEB A;  1PO1 1;  2YRO A;  4Z82 A;  5CVR A;  2WUH A;  2VNO A;  1RUN A;  1V0A A;  2RR1 3;  3HN3 A;  2VNG A;  4ZS2 A;  4E4Z A;  1BEV 3;  2ZHM A;  2CGP A;  4IEU A;  4QPI A;  4LE3 A;  3F95 A;  4IV3 C;  4JAA A;  3JBG 2;  4UBG A;  3MIC A;  4I0W B;  1AR6 3;  1RUF 2;  3TEY A;  4Y4Y A;  5FO9 B;  5FPX A;  1BXH A;  3SLI A;  4LOS A;  1ENX A;  3VBS B;  1BJQ A;  1EAH 3;  1EY2 A;  1B35 A;  4BDV B;  4MAD A;  4QGL A;  1LU2 A;  2HBU A;  1RHI 3;  2D7F A;  1XJA A;  4LBM A;  4Y5T A;  3IDC B;  4CTE A;  1W99 A;  3VBH C;  1HW5 A;  2X5I A;  4FXG B;  2FMD A;  2FZ2 A;  3I59 B;  2D6K A;  4JKM A;  1WMF A;  3RRD A;  1UWW A;  3VHO A;  1QNW A;  1CVN A;  1DZT A;  4IV1 C;  4E2G A;  5HCB A;  1GUI A;  2A6Z A;  4FFH A;  4URT A;  1KJL A;  3PTR B;  4GWM A;  4LOT A;  1PMJ X;  4S2G A;  3HNM A;  4TLF A;  5FBZ A;  3ILR A;  5A70 A;  4YZ2 A;  1JYN A;  2R07 3;  3CNA A;  3DL3 A;  2OQ7 A;  4B1L A;  3IIA A;  1FAY A;  5FQ0 A;  5JPN B;  1NXD 1;  1HDK A;  1Z78 A;  4X6Q B;  3T2T A;  4XF1 A;  5L7O A;  4O7X A;  4IE0 A;  1VBD 3;  2MEV 2;  5GZF A;  3WW4 A;  1FI2 A;  2JEM A;  5C8C B;  4FPJ A;  4IQP A;  4Q4X 3;  4UT5 A;  2VMI A;  2JE9 A;  2Y6K A;  3AX4 A;  1S0C A;  3HPN A;  3S5Q A;  2XJV A;  1VBB 2;  2W5F A;  4AHZ A;  1Y4W A;  2TBV A;  1AJK A;  2AZ5 A;  4XJ9 A;  2WA4 A;  2C1F A;  4Z1V A;  5E1R A;  1R1A 3;  1W6N B;  4BQ3 A;  2PLV 3;  4KU7 A;  3ZN4 A;  2QQJ A;  3TRS B;  1TME 2;  4RFT 0;  5T54 A;  5F37 A;  1KQR A;  3BGA A;  5KXD A;  1AR9 2;  3GZE A;  2DYC A;  3LGR A;  3WF2 A;  1OOP C;  3FX3 A;  4CU7 A;  2EXI A;  3H9A A;  4ARY A;  1JYC A;  4W50 A;  1RIR A;  3W5M A;  3TBD A;  1G7Y A;  2BGP A;  3DPR A;  4RS5 A;  5IFT A;  3I2F A;  3DXT A;  3WZ1 A;  4GMP 0;  1XYN A;  4JZR A;  4CDX B;  1RUG 1;  1QQP 2;  1VRH 3;  2ZX3 A;  2B4K A;  5ACA 2;  5CBL A;  5CEH A;  2WT1 A;  2Z2S B;  2YBK A;  4QU1 A;  5FOB B;  1W8O A;  4O9G A;  3E6C C;  4BXF A;  4D7S A;  4XUP A;  3CZJ A;  1RL3 A;  4FT8 A;  3ZMN A;  1DP0 A;  2IFW A;  2QTW B;  3OB8 A;  4N90 A;  3MUY 1;  1VB2 A;  4YRD A;  1V9U 3;  5FKB A;  4NIA A;  1H8T B;  4YPJ A;  4AI1 A;  2WAB A;  1MVE A;  2RS5 1;  2WSV A;  2XB6 C;  3GF6 A;  4AL9 A;  5IVF A;  3AL5 A;  3KLS A;  1GP4 A;  5JIA A;  1WLW A;  4MLO A;  1B09 A;  3E97 A;  2ADD A;  1OSG A;  1WW6 A;  4HBN A;  5I0D A;  1UOJ A;  3FMG A;  3U78 A;  4IE5 A;  2VCA A;  4JDO A;  4O9E A;  4ES8 A;  4XVH A;  5FZM A;  4XAA A;  1DQ0 A;  1FMD 2;  1NCQ A;  3POS A;  3WOG A;  3WDY A;  3R4D B;  4H2A A;  3CQO A;  2CGN A;  2WR9 A;  4K7J A;  1E5I A;  3P6B A;  5AFB A;  5BNQ A;  5FO7 B;  2D6M A;  1CAW A;  3POW A;  1US2 A;  3SIT A;  2VMH A;  1XYO A;  3ZYI B;  2WO2 A;  4KG8 A;  2RVA A;  4R9C A;  4M3C B;  5AVP A;  1XNK A;  1PX4 A;  1LNS A;  1FOD 3;  1HB4 A;  2W47 A;  1J58 A;  2I45 A;  4D69 A;  4ZKT B;  2RDS A;  4MXW B;  4WM8 C;  4BE3 A;  3NJV A;  1UX6 A;  4A7Y A;  5DZE A;  3POE A;  1KDK A;  1AX0 A;  1ZZ7 A;  2JG8 A;  3JCI A;  4XF0 A;  5C9A B;  1H0B A;  5FP4 A;  3HD8 B;  1KD7 A;  2WNU C;  4AEJ A;  1BVP 1;  3THT A;  1M06 G;  4E9K A;  5GZD A;  1UOF A;  3IPV A;  3SEE A;  2F4P A;  4Q4W 1;  2AYH A;  4QMA A;  1ND2 B;  1VBA 3;  4MGS A;  4XJU A;  4JQR A;  5D8A C;  3ES1 A;  1KS4 A;  4QQH A;  2BER A;  1ULG A;  4XFB A;  3JD7 1;  1OUS A;  5DUU A;  1ZVF A;  4B7E A;  4N9I A;  1IKQ A;  4P5Y A;  1QJY 2;  5FMC A;  4BIF A;  3T08 A;  1OF4 A;  3OGR A;  1K42 A;  1HJF A;  3LWC A;  5AFE A;  3ZSK A;  5DDJ 2;  1C5H A;  4YVS A;  1VBC 1;  2JEN A;  2Y26 A;  1ONA A;  2GAL A;  2VG9 A;  3CJX A;  1UXX X;  2DBN A;  2WAO A;  4R52 A;  4UFL A;  1F9K A;  4XFA A;  1NXM A;  4XQD A;  4XXP A;  2JJ6 A;  4LHN A;  1ULF A;  5F2W A;  3HNB M;  4ZXE A;  4AI9 A;  5C8W A;  1Z7S 3;  5JZG B;  4HK8 A;  5B2G B;  1XB9 A;  1OPM A;  5A6Z A;  3CDZ B;  2XON A;  3KHB A;  1JZ6 A;  1VAK A;  1CAV A;  4IDZ A;  1EUT A;  1WME A;  1C5I A;  5FO8 B;  1WW4 A;  4FPK A;  4E4H A;  5F39 A;  3AVR A;  4AGR A;  2XGX A;  1R09 3;  4AQS A;  1J3Q A;  2WZR 3;  5FZ3 A;  2HWC 1;  2J1S A;  5IVV A;  1UU6 A;  3ON7 A;  1GWK A;  3KVB A;  1RJ8 A;  2EAA A;  3SNM A;  1GIC A;  4AK3 A;  2YDE A;  4AFM A;  1FX5 A;  2ZCW A;  3CLP A;  2XJU A;  3LDB A;  1STM A;  2EA7 A;  4RSU A;  2LTN A;  4JGZ B;  5FYH A;  3AJY A;  4K3U A;  1LOA A;  3CHX A;  3CIH A;  1RUJ 2;  4OI4 A;  2AEN A;  1O5U A;  1REF A;  2VQ0 A;  3LDR A;  5LEK A;  4LE4 A;  2JG9 C;  4A41 A;  3ZXK A;  5JXI A;  4CUG A;  3WW1 A;  3ATG A;  3CJI A;  1LES A;  5K0U C;  3CL1 A;  3WG2 A;  1XE0 A;  5BNN B;  5JXJ A;  4I01 A;  1QKQ A;  5KC6 A;  3POB A;  3LA7 A;  3UKN A;  4CCO A;  2E63 A;  1GQH A;  3RNS A;  4MYE A;  2P4E A;  3SH4 A;  5FY0 A;  3THP A;  4WM7 C;  2WC2 A;  1DQ4 A;  3QAC A;  1RUE 2;  1LUL A;  3OGS A;  1CIW A;  3LAG A;  2BFU S;  1I5Z A;  1NY7 2;  4NPR A;  4NPM A;  1IHM A;  4J25 A;  4R8H A;  1GZC A;  3WW2 A;  1NUK A;  4A2U A;  4FVV A;  4QKF A;  2DUO A;  3JB8 A;  2A6X A;  5FYV A;  5I8T A;  5JSO A;  1DHK B;  4GMP 3;  3ME2 A;  4MOA A;  3ZYF A;  1U12 A;  3M2M A;  3NJX A;  1NG0 A;  3QH7 A;  4QKN A;  5A7W B;  1JZ4 A;  3ETP A;  1O3S A;  1W2T A;  2W1S A;  2B8M A;  2XKP A;  5ABJ B;  1XE7 A;  1MR5 A;  3C2U A;  1QOS A;  1TMF 1;  2IXH A;  2K2S A;  3AYE A;  3AVS A;  3I3D A;  4DIN B;  1L7Q A;  2QUO A;  2FDH A;  4NRP A;  4IV3 A;  1ND3 B;  1W6Q B;  4HXC A;  4Z8B A;  1PGL 1;  4IEV A;  4Y4R A;  4PBO A;  4GB3 1;  4DY5 A;  1U5Y A;  4E8D A;  4D7Y A;  2B42 B;  1JH5 A;  3L2H A;  4XXA A;  3UKV A;  1EV1 3;  3R4S A;  3ZR5 A;  2BGC A;  5JR2 A;  4LXL A;  5FUP A;  4LA2 A;  4N43 C;  3VKL A;  4CDQ B;  2W1W A;  5FMB A;  3UGH A;  4ASM B;  1YC6 1;  1DGR N;  1ZX5 A;  3F2Z A;  1ZZB A;  4GIQ A;  1Y43 B;  3SKJ E;  3K3O A;  1OH4 A;  2GP3 A;  2JIC A;  3VKM A;  2CAV A;  4IV1 A;  2D40 A;  2BV4 A;  4WV8 A;  5EZW A;  1OA4 A;  4AFD A;  3AP9 A;  3RZH A;  2Y33 A;  3A4U A;  5CB7 A;  4BK5 A;  4M01 A;  1PGW 2;  4QXB A;  1YI7 A;  2RR1 2;  3BB6 A;  4PLO A;  1BEV 2;  3IM0 A;  1UIJ A;  3I4I A;  4BMB A;  3VV1 A;  5IVE A;  2E6V A;  4CUA A;  4MG2 A;  4HN0 A;  1GSL A;  3ZN6 A;  1XPW A;  2RG4 A;  4XBN A;  3AMN A;  2QQL A;  1RUC 1;  4QM8 A;  1CN1 A;  2GMP A;  2IZW A;  1POV 1;  1QGL A;  3FBM A;  2Q1Z B;  3III A;  3WUD A;  5F3E A;  4AHY A;  5M0T A;  1AR6 2;  5LW9 A;  5I0T A;  4ASK A;  4URA A;  4FPY A;  1EAH 2;  4DUV A;  4JTN A;  5GKA C;  2FCU A;  3IAQ A;  1RHI 2;  3K48 A;  4ZPI A;  5C70 A;  3WG1 A;  3AKR A;  3AXE A;  2VUJ A;  1Q8S A;  1X82 A;  4RQP C;  4EZH A;  1CR7 A;  2B7Y A;  4LO8 A;  3LD8 A;  5T5P A;  1ZRF A;  1S4C A;  1UKR A;  5GLZ A;  1I9R A;  2IXK A;  3HAG A;  4N9H A;  3K4Z A;  3T3Y A;  1OOP A;  2AGS A;  4A44 A;  3OY8 A;  5GLT A;  5DG2 A;  4E2Q A;  2BEO A;  2E33 A;  2ZAH A;  5CFC C;  1HRI 3;  2PHD A;  1HRV 3;  3TEX A;  2ZEX A;  1K5M B;  2QQI A;  4BWO A;  1OBN A;  1W28 A;  5EHD A;  4Q0Q A;  3ZFF C;  4B4Q A;  2HBT A;  2R07 2;  4JGY C;  4N7U A;  5KR7 A;  3N9Q A;  3LA3 A;  2UWB A;  5FZ8 A;  3WG3 A;  2VMF A;  5FLH A;  2D6L X;  1VBD 2;  5DAW A;  1JTZ X;  1D4M 3;  1PK6 C;  3JBG 1;  3UJO A;  3VKN A;  4BLJ A;  5FWJ A;  4Q4X 2;  2XDV A;  2XPJ A;  3S7I A;  4K8R B;  4XHB A;  4YFZ A;  1VP6 A;  4MGY E;  3J9S A;  1OKQ A; 
#chains in the Genus database with same CATH homology
 5CZK A;  3UET A;  4ARX A;  4DXT A;  2E26 A;  5DPN A;  2X05 A;  1WCQ A;  1TVG A;  3I3B A;  1HN1 A;  4GZ9 A;  3WF0 A;  2EID A;  4RN5 A;  4JX0 A;  3GM8 A;  2WO1 A;  3WNK A;  4D8M A;  3MV0 1;  2L9L A;  1UY4 A;  3SEP A;  4TXW A;  5LA2 A;  3VDC A;  2B9V A;  3U37 A;  4LPL A;  2C9K A;  4P00 B;  5EJ1 B;  5LA0 A;  2BBA A;  3IDA A;  2E31 A;  4DXR A;  4BXS V;  2QQO A;  3T0B A;  4BK4 A;  3NNG A;  3SKV A;  4ET7 A;  4W8J A;  3VD7 A;  2V4V A;  3A23 A;  3DYO A;  3BN6 A;  2W9X A;  4OMD A;  1F4H A;  2ID4 A;  4GWI A;  3C7E A;  4RYD A;  3VD4 A;  2Y8K A;  3LEG A;  4ZZ8 A;  2DCK A;  1CZT A;  1K45 A;  4CU6 A;  2J1T A;  3I2H A;  2HLE A;  4MO3 M;  3WEZ A;  4DEV A;  4KI5 M;  1P8J A;  2JE8 A;  2VMD A;  3OGV A;  3ACF A;  3MO4 A;  1JHJ A;  4DUW A;  5CYY A;  3IAP A;  3PUI A;  5JUV A;  4QAW A;  2RV9 A;  2J1E A;  3ACH A;  1J84 A;  3T2O A;  4HG6 B;  2CDP A;  4KMQ A;  2VZV A;  2V72 A;  5F7U A;  2QQN A;  1J83 A;  2VQU A;  2VZ1 A;  4AG4 A;  5HXM A;  4M4P A;  2QBX A;  3PUH A;  1W9T A;  1O59 A;  5EJZ B;  3HEI A;  3K75 B;  2VC9 A;  2VZO A;  2W92 A;  4LHS A;  5B4N A;  1PX3 A;  5DN2 A;  5IYY A;  1PMH X;  3DYP A;  4QB2 A;  4UAP A;  2C4X A;  2W95 A;  2Y6J A;  5C7G A;  1JU3 A;  1UY2 A;  1O8S A;  2Y6H A;  1GQP A;  5FUI A;  3A22 A;  5LCW L;  1JI6 A;  4CU9 A;  3UES A;  2YC4 A;  3LPG A;  2VZQ A;  3NRU A;  1R64 A;  2YFZ A;  4OYU A;  3OEB A;  1IQD C;  2VCC A;  4GWJ A;  4D0Q A;  2WUH A;  2W1U A;  3HN3 A;  1NX9 A;  1XNA A;  5JXG A;  3FN9 A;  3T2Q A;  2VO5 A;  2XOM A;  2PQS A;  5IFP A;  3WNO A;  1JZ2 A;  3I3E A;  4UI9 L;  5J1X A;  4P08 A;  2VZT A;  2XQX A;  4BDV B;  4A45 A;  4MAD A;  3VD9 A;  3VDB A;  1W99 A;  4Z2A A;  3E1F 1;  5IJR A;  1MPX A;  2YB7 A;  4FI9 A;  2OKX A;  2RJ2 A;  4JKM A;  1UWW A;  3WQB A;  1JZ5 A;  3EB7 A;  2W87 A;  3OG2 A;  4DUX A;  2WN2 A;  1GUI A;  2Y6G A;  3THC A;  2VM9 A;  1PMJ X;  3K77 A;  1H6X A;  3HNM A;  3K4D A;  1JYN A;  3I97 A;  4JKK A;  1CZS A;  1UMI A;  4A4A A;  1L7R A;  3C7H A;  1O8P A;  2LS6 A;  2WQ8 A;  2VZR A;  2Y6K A;  3WNN A;  1YQ2 A;  4A42 A;  3HPN A;  1JYW A;  2W5F A;  2EIC A;  4XUN A;  1UY3 A;  3I2I A;  3HNY M;  3LE0 A;  2QQJ A;  1UY1 A;  4AAX A;  3K4A A;  3T2P A;  1OD3 A;  2VME A;  3BGA A;  1XNT A;  1D7P M;  1EUU A;  2VZP A;  3UNP A;  1OF3 A;  2J7M A;  3WF2 A;  1JU4 A;  4CU7 A;  1JYX A;  3NQH A;  4ARY A;  1H6Y A;  3LPF A;  2E32 A;  4DEQ A;  4W50 A;  4XUT A;  3W5M A;  2BGP A;  1NAE A;  1UYX A;  2HYX A;  2J22 A;  2WZE A;  3ACG A;  5IFT A;  3I2F A;  3MUZ 1;  3I2G A;  2B4K A;  4OZO A;  1ULP A;  3T09 A;  5A1A A;  1W8O A;  3I2K A;  1WKY A;  4XUP A;  4XUO A;  3CZJ A;  5HPO A;  1DP0 A;  2JKX A;  3AC0 A;  3OB8 A;  3MUY 1;  5G05 L;  4YPJ A;  2WAB A;  1UY0 A;  1OT5 A;  2C26 A;  5I0D A;  1BHG A;  2VZ3 A;  2VCA A;  1JZ3 A;  1SHW B;  2BGO A;  2W91 A;  4XVH A;  2JD9 A;  1UXZ A;  2QQM A;  4LKS A;  3CQO A;  2QQK A;  5EIY B;  2W3J A;  3P6B A;  4QB1 A;  4JHZ A;  1US2 A;  2XHN A;  2WO2 A;  2RVA A;  1PX4 A;  1LNS A;  2WN3 A;  2VZU A;  2V5D A;  2W47 A;  3CZU A;  4M4R A;  1GMM A;  2KD7 A;  3NJV A;  2ORZ A;  4L0P A;  2VQT A;  3GXU A;  3I2J A;  3LEK A;  4CUB A;  4PT6 A;  4OMC A;  5JMO A;  1SG3 A;  5LA1 A;  3LEI A;  3SEE A;  2DDU A;  3WF1 A;  4MGS A;  3MV1 1;  3CMG A;  2WYS A;  4PQQ A;  2BER A;  1UYY A;  4PF1 A;  3C7G A;  1JZ7 A;  3FHQ A;  1GOH A;  4P5Y A;  4CU8 A;  1CX1 A;  3DEC A;  3T08 A;  1OF4 A;  1T2X A;  3OGR A;  1K42 A;  2VCB A;  3C8X A;  3K46 A;  1UXX X;  2WAO A;  3C7F A;  4A3Z A;  4QPW A;  4P02 B;  3HNB M;  4ZXE A;  3IB3 A;  4JKL A;  4QX1 A;  3C7O A;  1US3 A;  4ZZ5 A;  3CDZ B;  2XON A;  1JZ6 A;  1DLC A;  3W5N A;  3ABZ A;  1UMH A;  3A7Q A;  4XUR A;  1EUT A;  2W46 A;  5DQ0 A;  3HOB A;  2Z4F A;  1I5P A;  2ORX A;  3ZM8 A;  2J1U A;  2WDB A;  1JZ8 A;  2VJX A;  2J1S A;  2Y64 A;  2J1R A;  5C71 A;  1RYY A;  2ZEZ A;  2VL4 A;  2VZS A;  2DCJ A;  3GDB A;  1K3I A;  3CIH A;  3OBA A;  3JXS A;  4A41 A;  5JXI A;  2ZEY A;  3MBW A;  4MGQ A;  1TG7 A;  5JXJ A;  2EIE A;  4UOJ A;  1CIY A;  3T0A A;  3T0D A;  4IUG A;  2VMC A;  2VR4 A;  3LQC A;  5DMY A;  3WNP A;  3OGS A;  3HJR A;  4TTG A;  1KGY A;  3VD5 A;  1UX7 A;  1NUK A;  4A6O A;  4W4Z A;  1K12 A;  4QDQ A;  1UZ0 A;  4MOA A;  4XUQ A;  1GOF A;  3NJX A;  3WNM A;  1JZ4 A;  3ETP A;  1F4A A;  2W1S A;  2W94 A;  4CUC A;  1NKG A;  3D3A A;  1W0N A;  2EIB A;  3ECQ A;  5B4X A;  3I3D A;  1L7Q A;  1KEX A;  3VD3 A;  2Y6L A;  2YG0 A;  4QDR A;  4ZY9 A;  4E8D A;  3WF4 A;  1W9S A;  5JXH A;  1SDD B;  2ZEW A;  5JR2 A;  2YC2 A;  2BZD A;  4DXS A;  2JDA A;  2W1W A;  3GGL A;  2J1A A;  3J7H A;  4KWU A;  3F2Z A;  3SKJ E;  1OH4 A;  1GOG A;  4CVU A;  2W1Q A;  4BK5 A;  4OUE A;  3OEA A;  4QDS A;  3FHA A;  4QB6 A;  2LW8 A;  1JYV A;  4CUA A;  1XPW A;  1W8N A;  2QQL A;  5G04 L;  1ULO A;  4LQR A;  1XC6 A;  3III A;  3ACI A;  5IHR A;  4QX2 A;  4BJ0 A;  2ZXQ A;  4E8C A;  4DUV A;  3WSO A;  3IAQ A;  3VDA A;  5C70 A;  1DYO A;  3EYP A;  3CKH A;  2WAA A;  3FL7 A;  3K4Z A;  4A44 A;  1W9W A;  2R7E B;  2WZ8 A;  2E33 A;  3THD A;  4XZU G;  3WNL A;  2CDO A;  2WBK A;  2X10 A;  2ZEX A;  2QQI A;  2VOT A;  1UYZ A;  2X09 A;  2WO3 A;  4QX3 A;  2VTF A;  3A21 A;  3P1I A;  4QX0 A;  2VMF A;  2J1V A;  1GU3 A;  1GNY A;  1CZV A;  3WF3 A;  2YFU A;  3DYM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...