3C8XA

Crystal structure of the ligand binding domain of human ephrin a2 (epha2) receptor protein kinase
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
174
structure length
160
Chain Sequence
KEVVLLDFAAALGWLTHPYGKGWDLMQNIMNDMPIYMYSVCNVMSGDQDNWLRTNWVYRGEAERIFIELKFTVRDCNSFPGGASSCKETFNLYYAESDLDYGTNFQKRLFTKIDTIAPDHVKLNVEERSVGPLTRKGFYLAFQDIGACVALLSVRVYYKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ephrin type-A receptor 2
publication title Architecture of Eph receptor clusters.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 30
structure length 160
sequence length 174
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2008-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01404 Ephrin_lbd Ephrin receptor ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 3c8xA00
5JXGA 1KEXA 3U37A 2VTFA 2JKXA 5LA1A 1BHGA 2VZPA 3SKJE 2J7MA 5C70A 2Y6HA 3UETA 5EJZB 1GU3A 4GWIA 5JXHA 4QAWA 4LKSA 2W87A 2VMCA 1NAEA 2WBKA 3T0DA 3HPNA 3A21A 2QBXA 3WNKA 2WN3A 3J7HA 1UXZA 3WEZA 3ABZA 1CX1A 2XQXA 2BGOA 1EUTA 2L9LA 4HG6B 1SHWB 4A45A 4JKMA 4AAXA 4P00B 3VDCA 1UX7A 4P08A 3NJXA 1JZ6A 2BBAA 2VC9A 4ZZ5A 5DQ0A 1JYWA 1UZ0A 1XNTA 2VZOA 2WQ8A 1NKGA 2JDAA 2J1SA 2E26A 2W1UA 4OZOA 4QPWA 1PMJX 3WF0A 1OD3A 1HN1A 2VCCA 3ACGA 3OEAA 3ZM8A 3CMGA 3NJVA 3T2PA 3T0BA 3ACHA 1ULPA 3K4DA 4TXWA 4IUGA 3F2ZA 3OGVA 2YC2A 1UY0A 1W99A 1UYYA 3WF1A 3I97A 1GNYA 3WNPA 4A41A 1ULOA 3A23A 5DPNA 3IDAA 4JX0A 3GM8A 1UWWA 2E31A 3C7EA 4ZY9A 4DEQA 4MGSA 1JI6A 4JHZA 3ETPA 3CZJA 1JZ4A 4XUNA 3LEIA 3P1IA 1OF4A 3HNMA 2BGPA 4DUWA 3OG2A 3T2QA 3DYOA 4KMQA 4OUEA 4A3ZA 2X10A 2W1WA 5HXMA 5IYYA 2C26A 3DECA 3LPGA 2ORZA 1JZ5A 2RJ2A 3MV01 2V72A 1D7PM 2VZQA 4LQRA 3WF3A 3WNMA 3I2HA 1XC6A 3A22A 4UAPA 3C7GA 3PUIA 1KGYA 3VDBA 2VQUA 3A7QA 1OT5A 1UMIA 2XHNA 1US3A 5LCWL 1T2XA 1IQDC 1J83A 4P02B 4CUAA 1US2A 4QX1A 3I2FA 3OGRA 3CDZB 3LE0A 4QB1A 4QDRA 2J1VA 1GMMA 2C9KA 2W3JA 1JYVA 1GOHA 4BDVB 3C7OA 3FL7A 3PUHA 3GDBA 3FHAA 4JKKA 2WUHA 3WNOA 5F7UA 2EIBA 2LS6A 2VZ1A 4QDSA 1UY1A 4XUPA 3OB8A 2Y6LA 2J1EA 3NQHA 3I3DA 3D3AA 1GUIA 3C7FA 5IHRA 2ID4A 3K46A 1CZSA 2EIDA 4A44A 1L7QA 4M4RA 1TVGA 2WN2A 5FUIA 4GWJA 2KD7A 2W47A 4M4PA 3BGAA 4W4ZA 1W8OA 1UYZA 1GQPA 3IB3A 3MBWA 4UI9L 2W5FA 2VOTA 5HPOA 1JYNA 1SDDB 3CKHA 5JUVA 4ET7A 4CVUA 4XZUG 5LA2A 3LQCA 2QQOA 1J84A 4BK5A 1TG7A 1PX3A 1EUUA 3WNLA 1P8JA 2BZDA 4L0PA 3I2KA 4LHSA 4TTGA 5JMOA 4ZZ8A 2RVAA 3SEEA 5CZKA 1GOFA 4KI5M 3I3EA 2W46A 1XNAA 4OMDA 3P6BA 4DXSA 5IFPA 1O8PA 3T08A 1CIYA 2B4KA 1K45A 2EICA 3NNGA 4MO3M 2VJXA 2QQJA 4DUXA 4OMCA 2WZ8A 3UESA 2E32A 2VR4A 3LEGA 3I2JA 3OEBA 3I3BA 4XURA 5EJ1B 1JZ8A 2ZEZA 2J1TA 1UY3A 4PT6A 5JXJA 2VMFA 3HOBA 3OBAA 3CZUA 4RN5A 3T0AA 2ZEXA 4CUBA 2Y6KA 3MUZ1 4JKLA 3SKVA 3C7HA 5DN2A 3BN6A 1O59A 2EIEA 5G04L 3VD5A 1DLCA 3FN9A 2DDUA 2ORXA 3I2IA 4BJ0A 2Y8KA 3MUY1 3THDA 3HEIA 4OYUA 2YFUA 2W1QA 1W9WA 2VZVA 2X05A 5JXIA 3E1F1 4ZXEA 4D8MA 2VCAA 2VMEA 2J1UA 2QQMA 5G05L 1K42A 2VM9A 2W91A 2CDPA 3CIHA 1JYXA 2LW8A 2VZSA 3IAPA 5EIYB 3GGLA 3K4AA 3K75B 3OGSA 1WCQA 2CDOA 3EYPA 5A1AA 3C8XA 1UYXA 2VMDA 4QX2A 2W1SA 2J1RA 3K4ZA 3WF4A 2YG0A 3JXSA 2QQIA 4DXTA 3LPFA 1UY2A 4A42A 1JZ7A 1OH4A 1CZVA 4DXRA 3WQBA 3DYPA 1O8SA 4A6OA 2ZXQA 4RYDA 1DP0A 2W9XA 2WO1A 3MV11 1PX4A 2Y6GA 5B4NA 2R7EB 2QQNA 2JE8A 4LPLA 3HN3A 5JR2A 1NUKA 3VDAA 1W9TA 4CUCA 4ARXA 4MOAA 2J1AA 2J22A 2YB7A 5J1XA 2VCBA 2JD9A 4UOJA 4P5YA 4CU9A 5DMYA 1CZTA 1F4AA 2WO2A 2XOMA 4AG4A 1UMHA 3T2OA 3THCA 1JHJA 2VO5A 1LNSA 5C7GA 1MPXA 3VD4A 3W5NA 2XONA 2WO3A 2ZEYA 4MGQA 5IJRA 1JU3A 2B9VA 5I0DA 3NRUA 2X09A 5CYYA 2YFZA 4CU7A 4XVHA 1GOGA 3LEKA 3FHQA 2W92A 4XUQA 1H6XA 4FI9A 1PMHX 1YQ2A 3K77A 2V5DA 1K12A 3AC0A 2VQTA 1DYOA 2V4VA 2OKXA 2WAAA 4QB2A 1JU4A 3VD7A 4E8DA 3I2GA 3CQOA 4QX0A 2WAOA 3GXUA 4W8JA 4Z2AA 1W0NA 4GZ9A 1K3IA 2HLEA 4PF1A 1L7RA 4BXSV 2VZUA 4W50A 1R64A 4PQQA 3ECQA 4BK4A 2VZ3A 1W8NA 2BERA 2DCJA 2QQKA 2WABA 2YC4A 4MADA 3ACIA 1JZ2A 1H6YA 4CU8A 3HJRA 4DUVA 4KWUA 4A4AA 4CU6A 3IAQA 3DYMA 2PQSA 1NX9A 4DEVA 4E8CA 3EB7A 3WNNA 5C71A 2VL4A 3T09A 2VZRA 4QX3A 1JZ3A 3ACFA 5LA0A 2WZEA 3SEPA 2WDBA 4YPJA 2VZTA 2W94A 3VD9A 2E33A 2HYXA 1UXXX 4XUOA 2RV9A 2DCKA 1OF3A 3IIIA 4ARYA 2ZEWA 3WSOA 4QB6A 5B4XA 1F4HA 2WYSA 1W9SA 4XUTA 2Y64A 3HNYM 2Z4FA 3VD3A 3MO4A 2W95A 2C4XA 1I5PA 3W5MA 1XPWA 2QQLA 3UNPA 1UY4A 1WKYA 1SG3A 4QDQA 4D0QA 5IFTA 3WF2A 1RYYA 3HNBM 2Y6JA
chains in the Genus database with same CATH superfamily
3B93A 2D3SA 2VTFA 5CKQA 5LA1A 4AFBA 2VZPA 3MIDA 2XVGA 2CAVA 1YRZA 5EJZB 1C4RA 2ZA9A 3ELNA 2UWCA 1GU3A 3KV5A 3LA7A 1IS4A 5FIXA 2HWC2 1S55A 5F32A 4CP9B 3LDKA 5A3MA 1XNBA 4N43A 4RA0A 1LHNA 4OQ9A 5IVYA 4LLFA 2D43A 1VIWB 5I8YA 1LOGA 3HQRA 2EXJA 3A0KA 4JDNA 4AEDA 4COZA 3A21A 2NP0A 3OSDA 1QH7A 1XYOA 3J7HA 5HCAA 4FPLA 5K0UB 3WEZA 1ZZ8A 4W6WA 4FAHA 1SHWB 4DINB 2B42B 5DZGA 1LODA 4P00B 3HR9A 5CAZA 1DQ5A 3VDCA 1UX7A 4LE3A 3E6CC 1N1SA 1MQTC 1PK6C 2VC9A 5LATA 3ZN6B 1UZ0A 2RR12 4PLNA 4Q0UA 3ZYRA 4LHNA 1NKGA 3POYA 5FY4A 3U10A 4XF3A 1ZZCA 2R0FA 1I3HA 2J1SA 3DV8A 3QOPA 2W1UA 1R1A2 3K2OA 4OZOA 1YFWA 1VPHA 2QNKA 1QH6A 4IEPA 4W6XA 5FZOA 3U14A 1GBGA 4Y26A 1RUE3 2VCCA 5CADA 1RUJ2 5DAQA 1OFSA 1W04A 3ZM8A 1LHUA 4IEYA 4NE9A 1RHI2 3O1OA 4Q26A 4LR4A 3VBHB 2IUWA 3QACA 3SHRA 1DQ0A 3ZYIB 2DCYA 3K4DA 1UU6A 5D1IA 3LIHA 4N53C 1W2TA 4EYUA 1CAUA 3OGVA 1UOBA 4C0HA 2IC1A 4A2UA 1W99A 2HWF1 2PHTA 2YROA 4Y22B 3T1LA 5JWPA 4AK3A 1QJX3 3ZFGC 4IE0A 1SLCA 2D40A 3I97A 4DY3A 1DGLA 4DO0A 4A41A 1UU5A 2QQUA 4BQ1A 2RS32 1UMZA 3KS7A 4JX0A 2A3XA 4QXKA 4C8DA 1UWWA 2BU9A 2E31A 4ZONA 1GZWA 4R9DA 4RD7A 1RUE1 4BPZA 3JZVA 4DEQA 2D6MA 3O0WA 1ZZ7A 1DGRA 1KJRA 2MPFA 1SCSA 3ETPA 2ZCWA 3WP4A 4RQPB 3APBA 3NWKA 2GC3A 3QD6A 4IV1A 5A80A 1ZREA 3P1IA 4K8FA 1XSRA 3AZWA 1ENRA 3HNMA 3FE5A 3ZKUA 2OX0A 3BOPA 4KGGA 2PLV1 3A0NA 3BOWA 3NJZA 4KMQA 2CYFA 1KJLA 1IG0A 5A7OA 2XQRA 2HWD2 2NPIA 1OQEA 2ZPXA 3C3VA 1KS5A 4A3ZA 2X10A 4ES8A 1IS6A 2NMOA 5KHGA 1JN2P 4AFDA 3AVSA 3AL6A 2G19A 2PAEA 5IAVA 4EE2A 2GU9A 1JTZX 3ZX7A 4EN8B 3O1MA 2AH2A 4BWOA 1PMIA 4C91A 1W8TA 2X5IB 5IK8A 1E5RA 1JZ5A 4UW3A 4BCUA 2WRAA 3WNMA 2OA2A 4V2VA 3NV2A 4AVCA 5M0TA 1EYBA 4LEJA 1H8TB 2A71A 1DZTA 4GKXA 2HJIA 1OT5A 3BALA 5BNPA 3VZNA 1ZZ6A 1WCKA 2XHNA 5C9AA 1US3A 2WNUC 5DAXA 5GZGA 3INAA 1G9DA 4IGQA 1IPKA 1S0BA 5FMOS 1IQAA 1QXPA 4CUAA 2OUJA 4XIKA 2CSGA 1EP0A 3OD4A 1UZYA 2VQ0A 4JZRA 3ZSJA 3T1MA 3OGRA 1OA3A 2CWMA 1D4M3 1ZRIA 3CJIB 1JOJA 2XDVA 1GMMA 1JYVA 4PI2A 1FOD3 2I07B 2XHKA 4AI2A 5FZDA 4GB33 2LRPA 3AP4A 1V6IA 2WKKA 2CWSA 5F7UA 3VHOA 2EIBA 2GC2A 2Q30A 1RUD3 2PYTA 2EAKA 3LSDA 4QDSA 2HBUA 1ZBE3 5L7OB 2XBO3 4YVWC 3IDBB 4XFHA 4YZ1A 5DG1A 3H9AA 4NJ4A 3KD4A 1TME2 2NYYA 3U11A 2CGPA 1OSGA 5FUNA 3ILFA 3D3AA 5EFUA 3TOJA 4EROA 5IHRA 1LHOA 1POQA 4QKFA 1TMF3 1X36A 5JDBA 1N3OA 2D7FA 4IEXA 1WMXA 3AYAA 3O1RA 5ACA3 2B39A 2X8KA 3NVCA 5FZLA 5EHDA 2CNAA 1QXJA 1D4M1 3DCQA 1G8WA 1PGL1 1HB1A 2KD7A 2W47A 1VAVA 1FOD1 3ZFFB 1GWMA 2DFBA 2P34A 3CNAA 2VOTA 3N9PA 1PM4A 4HK8A 4ZU4A 5HPOA 3ZXAC 1YFUA 2Q5TA 3CKHA 4M3CA 5E16A 1AUYA 1WCSA 2WR9A 2QQOA 3NMBA 1ZBE1 2ZHMA 1C5HA 4OULA 4XJUA 2Z42A 1DGRN 1AJKA 3MIHA 4L0PA 3I2KA 1R083 5LEJA 4YG3A 1QQP3 3MIFA 3J8F2 1IZ3A 1Q3EA 4TTGA 3Q9OA 1D2QA 2YUEA 3VZOA 3I4IA 1TMF1 3SEEA 1S1AA 3IDEA 1I9RA 5ACA1 2DVBA 2VVDA 4QQLA 5FYVA 1QJFA 3NL1A 2Q1ZB 1FI2A 1XNAA 1MVEA 4Q1PA 2JJ6A 2DBNA 2P3KA 2VOVA 4OHWA 5ANQA 3M3QA 4Y24A 2BW8A 5F3GA 1V9U2 5FMDA 5KXDA 1STMA 4LA3A 5LW9A 4OHZA 4LT5A 3ST7A 1RVF2 1FNZA 2B7YA 1CN1A 3MLKA 4B4RA 4UFKA 5F3CA 2VJXA 3QCWA 3VDDC 4FPHA 2WO7A 1XNCA 4N43C 3UESA 3CF6E 1EAH2 2QQVA 5FJKA 5SV8A 1R081 3OEBA 4PDWB 2VPVA 1QQP1 5D2AA 3I3BA 3USUA 3BYWA 3K48A 1JZ8A 2QKDA 2ZEZA 3GZEA 3KLSA 4R4XA 4PT6A 3A4UA 4HL0A 4WBBA 4DXZA 5T5OA 3ZPYA 5FMCA 2VMFA 3RWKX 3WW3A 3PUQA 1FAYA 3GNEA 3MEPA 4GH4C 3ZYPA 1SLTA 2XJUA 3T0AA 2K9ZA 3E5QA 4NVPA 5DUWA 2QJVA 1VE0A 5T50A 2Q8DA 3J7NA 4COWA 4KBZA 5DN2A 1HDKA 1O59A 1YWKA 2KXLA 4H2AA 5L73A 4DRVA 1DBNA 4FXKB 2ILMA 2F17A 4PIZA 4XFIA 1F9KA 5C8WA 4K6BA 2XWJB 1CAXA 2ORXA 4B7EA 3UKNA 1FMD3 5T5PA 2E7TA 3THDA 2VE1A 4HBNA 4XF0A 4ZS2A 5SV5A 2X05A 3UT0A 4CEWC 3L2HA 1E57A 4PQ9A 3WNXA 1C28A 2XJVA 2VCAA 4KBBA 4OFGA 1WMEA 3AZXA 2J1UA 5G05L 1BMV1 1MS5A 2A6YA 4QXBA 2WNOA 3VKMA 1LU1A 4XJZA 4OHYA 4GALA 1WW6A 5FBJA 3TAYA 1JYXA 1W06A 4WM8B 4YFWA 1IPJA 4CDQC 3VKLA 1NCQA 2DYCA 2OUHA 1QJZA 1UYPA 4PHZA 4R52A 1WMFA 2XLFA 4LBJA 4NHXA 4MHRA 3GCWA 3OF1A 4IGOA 5FZHA 2MEV3 1WLWA 2Z2SB 2W1SA 5FO7B 3DPRA 2RDNA 1FMD1 3BTXA 4AWDA 3N9NA 4KG8A 3D4KA 3IBMA 5CFDA 2EF6A 3PU8A 4CXWA 2QQIA 2D97A 2W0XA 4XIOA 4W6YA 4DXTA 1BVVA 1Q8VA 1JZ7A 3IM0A 5EJ3A 2HH9A 1AYM2 1LOAA 1VBD2 5JI7A 3MIBA 1AXYA 3SXWA 2VXJA 4WVVA 3WDYA 3DYPA 2P17A 3SH3A 1O8SA 3B9IA 4LUMA 5C4WA 4EZ4A 4UWDA 2MNGA 3I59B 1AXKA 1PX4A 2CV6A 1WMDA 1OQDA 2LM3A 2Y6GA 4QQPA 4LO7A 4QPGB 3AM2A 1VBB3 2XWBB 2DU0A 3D0JA 2H6BA 1NUKA 1VRH3 1X9TA 1OBNA 3MIGA 2ZJCA 5LBFA 3KF5A 4AI1A 2MEV1 4QT6A 5A3WA 2K0GA 1PO23 4MX3A 1GYKA 1HN0A 2GN7A 4ORFA 5KR7A 1HRI2 2OPWA 4FP2A 1J3RA 1WLDA 2CY6A 5DMYA 1CZTA 5LRSA 1MZ5A 1EV12 1UCXA 2G9GA 2NQYA 2WO2A 3LSEA 2KR2A 2ZZJA 1KITA 3AXDA 3PURA 2FCVA 3THCA 3T2OA 1GP6A 1NY72 2VO5A 3H1MA 1LNSA 3PIJA 3PNAA 3VZJA 4DRRA 2WSVA 2VAUA 3NKGA 5I0SA 2AUYA 1HB4A 2XONA 4Q4W3 3KT1A 3NAPA 4Y20B 5FZCA 1VBB1 3POWA 4BU2A 2DVFA 1MEC3 1HB3A 1S0JA 4JHTA 5FP3A 1PIV2 3WVJA 3ZIWA 2VW0A 3S30A 1VRH1 3T3YA 3HVDA 5FY8A 5K7PA 1F35A 4XJAA 3VBFA 1AR92 1PO21 3BODA 2WQZC 1BCXA 1HV1A 1XRUA 2YFZA 5CYYA 5FZ4A 4XFGA 4Q4V2 1ULFA 1G6NA 5FYSA 5A3LA 3LEKA 5FYUA 3ETQA 3B5LB 3FHQA 3ZFEA 1ZZ9A 2JG9C 3SLIA 1J1TA 1PMHX 4AHYA 1H2NA 2GALA 1COV2 1K12A 3RQ0A 2VQTA 2XH6A 2A6XA 1REDA 1RMU2 3EO6A 4XFCA 1W0PA 4QMAA 5FYBA 1OLQA 1VJ2A 1W6OA 3UGFA 4META 2WA3A 4GIQA 1OKOA 4Q4W1 4QB2A 2HWB2 1ZNPA 1RUF1 2YPJA 4P9LA 1JU4A 4QPIB 2GNTA 3MLJA 3KQ4B 1ZBA3 5A3OA 2ZX0A 2A3WA 1PO13 2JG8A 1PVC3 3N7KA 4HVRA 4Q2FA 1YXWA 4QX0A 5CG9A 4Q4V1 3VBOC 4Q8KA 3U4XA 2Q8CA 4S2HA 5CFCC 3JQXA 4MGTA 3N9LA 1UOJA 1KS4A 2HLEA 4FT8A 2VZUA 1GP4A 1UU4A 4BXFA 4LBQA 4NIHA 1LGNA 1X33A 1JODA 1ZRFA 1G7YA 5FQ0A 2D6PA 4RHV3 4IGPA 1G86A 1QU0A 1C1LA 3CBNA 2WABA 3FUOA 2ES3A 1H1MA 5DAPA 2YC4A 2EXIA 2VOWA 4NHLA 3UL2A 1H30A 2BDRA 5C8CB 1JZ2A 4BIOA 3RZLA 1H6YA 5A6QA 3WQ1A 3JU9A 5FV3A 4Z07A 1O5LA 3IAQA 1LHVA 4CEYC 2D5FA 2BNNA 1G9BA 4AVAA 3EB7A 2XLGA 2PN5A 3NNLA 5CB7A 4I0BA 1ZBA1 1VBC2 1PO11 4RS5B 1PVC1 5F1RA 3ILRA 1Q43A 5FREA 2EVXA 1B35B 1OMIA 5T3NA 4H7LA 1SPPA 3HT1A 4KGQA 2WZEA 4KG0A 1KDKA 5FZKA 1UO9A 3SEPA 1A34A 3NV3A 4D6SA 3MI8A 5CG8A 1S2KA 1WW4A 1OOPB 5A7PA 4BLIA 3L9JT 2RDRA 2HYXA 2D6NA 4QM8A 1UXXX 1HRV3 1FPN3 1QHDA 1VMJA 4WV8A 2VNOA 4RHV1 1PVXA 1UKRA 3OPTA 2AEZA 3AX4A 1OF3A 2WFPA 2PHFA 1GNHA 4FP3A 1CAVB 1OLRA 4MH0E 4Q27A 1HB2A 1LECA 4B29A 1C8M2 5KHJA 4XJ8A 2W52A 4UXAA 5B4XA 3IDCB 1O4ZA 2WYSA 1GLHA 1K5MA 2R073 1U0AA 2Y33A 4IETA 5EXOA 5CA6A 4P9WA 4Q0VA 5FO9B 4QXCA 2OQ7A 3PUSA 3VBSC 5FZ8A 3H3UA 2NZ9A 4ZXKA 5A32A 3RZMA 4HETA 5DG2A 1MQTA 1PK6A 1ZX5A 4XHBA 4CCMA 3VHPA 2OVUA 5IVEA 4FO9A 2RDSA 3ZPOA 1VBA3 1S4CA 4BA6A 1RUG3 3ACLA 1WKYA 3POEA 4N9HA 1IKQA 4QDQA 3UGHA 1QNYA 4MXWA 3WF2A 5A7SA 2O14A 5HV0A 1DG6A 1BBT2 3WR0A 4EV0A 1KEXA 1HRV1 1FPN1 5KHIA 2E53A 2BBVA 1W90A 4B7KA 2RS13 2ZX1A 1BHGA 5JOYA 4JQTA 3RPQA 5C70A 5I0RA 1LKNA 2D3PA 2YGMA 1W6QA 3RSJA 4XCBA 4E4DX 2BEOA 5H9RA 1H4HA 5JXHA 2R071 1RIRA 1GZTA 1NCQC 2VMIA 5EYXA 4FVVA 4XQ4A 3ZLIA 1DHKB 5FLJA 3WT3A 4GA9A 3WLUA 3AP7A 2RJLA 3GZUC 5LBCA 3T4VA 1QF3A 3ZFGA 1NAEA 4G4FA 4MV2A 2BP6A 4UFHA 3MPPG 1Q8OA 1RUG1 1YCIA 3HPNA 4LITA 4RR3B 4WVMB 1ND3C 2WN3A 4MVTA 5CFDC 3L2YA 3ABZA 4HPKA 1PHMA 1SMVA 1N1TA 2BGOA 4HG6B 1KFUL 2WLQA 4XACA 3SQOA 1JZ6A 2HEYF 4B3NA 1WW5A 4ZZ5A 4IEUA 2WT0A 1JYWA 3BTZA 3MDPA 3KCXA 4YW5A 5IK4A 2BPA2 1XNTA 1Z7S3 3B00A 5DUXA 3TB0A 1CAWA 3IMMA 5FJHA 3WV6A 2ATFA 4PLOA 2JDAA 2VBDA 3FLPA 4YSFA 4UFMA 3S5AA 2XKOA 4YM0A 2CGOA 3NO8A 4QPWA 1HQLA 1FX5A 1RUH3 4FQ4A 2WZR3 4XC9A 1VAMA 1QXRA 2HEVF 5J3UA 5LY1A 4I30A 4KWLA 1BVP1 3WP5A 4CCCA 1CPMA 1PNFA 3VGIA 2OZ6A 4AZZA 1W0OA 1XB9A 3H8OA 4AI8A 2VBBA 1AR82 4L9BA 1H2LA 4L11A 1XYPA 2F6BA 3H50A 4L2NA 5FPUA 4NIGA 2UURA 1ULPA 4A7YA 1OA2A 5DDJ3 1JYTA 3B69A 4IEWA 3AKQA 3F2ZA 4NRMA 3FBYA 4OCTA 1OA4A 3JCIA 3V0AA 4N7UA 4LULA 4YW7A 4AEKA 1AR73 2PFWA 1Z7S1 1MVQA 3LOIA 5FPVA 2P3JA 5JZGC 1GNYA 4QX7A 3WNPA 4NOTA 3NAPC 4GWMA 3ORJA 1RUI3 2BJSA 1X8MA 2JDPA 4M0HA 4UF0A 3RWNA 3C7EA 1G9AA 2ZMKA 1FXZA 1GSLA 2WZR1 4JHZA 4LKEA 1H0BA 1AJOA 1JZ4A 3VBFC 1W6MB 4XUNA 4FPGA 1F5FA 1DYKA 2BGPA 2HWE2 4NO4A 4CCLA 3OG2A 3T2QA 4DUWA 3DYOA 3BVCA 4CDXA 5AFBA 1FV3A 4OUEA 4F8AA 5DDJ1 3R0RA 5A7NA 2W1WA 3BUCA 2CTVA 4Y5Z0 5KC6A 1HJFA 2C26A 2R32A 2ZKNA 3RGBA 3DECA 5IYYA 1ND2C 1TE1B 1LCLA 3JUUA 3AXEA 1AR71 5JMCA 3PUAA 1JXNA 4UBGA 2ORZA 4YRDA 1IHMA 1RUC3 1DDLA 3WF3A 2OYZA 3O1PA 3I2HA 2WNEA 3K51A 4UAPA 5GJ6A 3W58A 4AEMA 1LR5A 1YQ6A 4CSWA 1JUIA 2P3IA 4N43B 5A33A 1S2BA 4P5HA 5FCCA 1GICA 4YLZA 5LCWL 4Q0PA 5J98B 1T2XA 4MGYE 2YZ4A 4LE4A 2Q8OA 4XF1A 4AEDB 1J83A 3O7OA 1YHFA 4CDWC 3TWIA 3I2FA 1S0DA 2FZ2A 3ZMNA 4RGAA 5D21A 4QDRA 4QX8A 1LOBA 4Y4YA 5FPLA 2J1VA 3TRSB 2R063 4Q4Y2 4BDVB 5BNNC 5ABJB 3FL7A 3PUHA 2IFWA 2DVGA 2OZJA 2WUHA 4XE9A 3FLRA 1XE7A 3ITQA 4PBPA 4HK9A 1QJU1 1RUC1 3CL1A 4XUPA 2WYFA 3Q8AA 2HWC3 3OB8A 2XJSA 4FCAA 5FAXA 5FZ0A 4YG0A 4OQ8A 2A1XA 2IXIA 5FYCA 1C3HA 1JS9A 3H7YA 3N7MA 5FZOB 4FTSA 1CGPA 4KWJA 4LLOA 3TBDA 1S0CA 1X7NA 3VDDA 5FXVA 4CCDA 4BMBA 1MS9A 1NA1B 1RUNA 4HVOA 3OGGA 3ZSLA 5IVBA 1L7QA 2O1QA 4M4RA 3VBRA 2WL1A 2WN2A 1A8DA 3U75A 4WZCA 3AK0A 1LRHA 1APNA 1T6GC 4FPCA 2R061 4LTAA 2V5YA 1ZM1A 4M4PA 5KWRA 3SCHA 1W8OA 1MR5A 1GQPA 3IB3A 3BPSA 5J7MA 5F9TA 1CAUB 1OUXA 4WVWA 4XAEA 5JUVA 4GH4A 2XUEA 1K5MC 3LAGA 2UYAA 4YNIA 2RR13 3J4UH 2OQ6A 1J84A 2ZZQA 2R6QA 3TN92 2HWC1 1MZ6A 1BEV2 1PX3A 2HWF3 1RITA 4LIVA 2BZDA 2RM22 3RFRA 3RVHA 5FOJB 3GHNA 3AL5A 1R1A3 3BKZA 2VUAA 3TEZA 4JGYC 4IDZA 1V00A 1RUJ3 4UFIA 4ZZ8A 4D7SA 5CZKA 1Q8SA 2VCMA 4GMP3 3MF6A 2EIGA 1XQNA 3IKWA 4IV1B 4Q1RA 1GOFA 2KA3A 4QKDA 4AI3A 3ZYJB 5E1RA 2W46A 3OBRA 3H3LA 2FDJA 1O91A 2VGDA 5F37A 4OMDA 3P6BA 4IERA 2C5DA 4DXSA 1I5ZA 5IFPA 4CEWA 1O8PA 4COVA 1CIYA 5EP9A 5J96B 4K1YA 5A3PA 2B4KA 1K45A 2PLV3 2W08A 5FP9A 1QDOA 4DUXA 2RR11 4FPJA 4OMCA 3ZXJA 2Z69A 1N3QA 2DTYA 2WZ8A 4BQ4A 5C3RA 3BTAA 5CVRA 2IFRA 1SCRA 4XQDA 4FFIA 3IIAA 2RS33 1FT9A 2WNVB 4CDQA 4CZSA 4FBFA 5A3UA 1R1A1 4XURA 4QHOA 5EJ1B 3AZZA 4DOUA 5ISLA 4QM9A 1ODNA 5J09A 1RUJ1 5BNPB 3U0ZA 1V6MA 4GMP1 2XL9A 5C9AB 4GXLA 1SBFA 3NNFA 4HN0A 1RHI1 3JB8A 4AYUA 5C6CA 5IATA 2Q0AA 2WZPP 5HI0A 1CJPA 4RN5A 1WA6X 2ZHNA 3QLQA 1DZRA 3NV1A 5K0UA 4XBLA 4AFCA 2BTVC 1RB8G 2FCTA 2Y6KA 4WVZA 5A6XA 2WQ4A 1RGSA 3WG4A 4OVEA 3RI8A 1SBEA 3C7HA 1U5ZA 5FYHA 3MW2A 2JECA 1QNWA 3SNMA 1W2UA 5G04L 4BQXA 2FZ1A 1DLCA 3ZXFA 3BIWE 3I2IA 1QJX2 3ZR5A 3O1VA 1BKZA 2RS31 3RZKA 2Y8KA 3VBUC 4NAOA 1VBE2 3POFA 4RFRB 5FMBA 3HQUA 3O0XA 3ZSMA 1W9WA 1GR3A 2Y6FA 5FZ3A 1LESA 4FXGB 4JTNA 1QEXA 5K8SA 2VMEA 4WM7C 4XFFA 2VM9A 2W91A 1I6XA 2SBAA 4TZDA 3I8TA 2JDHA 4XDOA 2HWD1 4S2DA 2D6OX 2ZS6B 3LCPA 2Q4SA 1HQWA 4Y1XA 3OGSA 4GJZA 1AX2A 2AACA 3EYPA 3DEMA 1NXMA 5F8PA 4JGZB 5A1AA 3C8XA 5DZFA 2VMDA 2ET1A 2H6CA 4KQ7A 2J1RA 1W39A 4V1PA 4Y33A 3V64A 1SQ4A 3ZYGA 4Z92B 4XQWA 2YG0A 2XXZA 3N7LA 1A6CA 3PIGA 3ILNA 1TME3 4X8NA 2CGNA 2Z5WA 3OPWA 1AX0A 4TSVA 4H3WA 1OH4A 1W2NA 1CZVA 4L97A 3WQBA 4B4PA 4BYYA 2RG4A 4CDXC 1OUSA 4A6OA 5FPBA 3CU7A 3OD0A 1DGWA 3DL3A 4B8EA 3MLLA 1NZCA 4AAPA 2VNRA 1VR3A 5FZ9A 3GF6A 3URFA 5GZDA 4CP2A 5I0TA 2JG9A 1RTVA 2R7EB 2JE8A 3OY8A 5FWJA 4HKOA 5FYZA 4DQAA 3HN3A 2OXBA 5GLZA 4HFSA 4UFJA 4COYA 2BVVA 4I3GA 3VDAA 2UYBA 4CDUB 4CUCA 4Y1VA 4GB32 4XXAA 3EHKA 5FDBA 5FPXA 1S0EA 2YHJA 5KHHA 4AQ2A 4MOAA 3JBG2 4BE3A 2J22A 1RUD2 2FBEA 2X5IA 4Z2WA 5J1XA 1TME1 2VD7A 2WWUA 3FFZA 2XBO2 4P5YA 5FXZA 4A6SA 1F5JA 4FPEA 3USUB 2Y34A 3NNMA 3J8F3 3RJ2X 1SDWA 1QIQA 1PZ7A 4Q0QA 3VBOA 2XOMA 3KT4A 3M3OA 5CFCA 1LOEA 4MZUA 1VB2A 4J1WA 3H8XA 4R9AA 4K20A 3FMGA 1N1VA 2ZHLA 5FZMA 1NQDA 3LWCA 2ERFA 3IPVA 4J1XA 4RGGA 1BZWA 1TNFA 1V9U3 2D93A 1SLAA 3LF7A 3F95A 1YFXA 2GP5A 1NLQA 1REFA 1JU3A 2B9VA 3GJAA 2QDRA 5L19A 1AL22 1S0GA 2BQPA 4YZ4A 1W3XA 1HV0A 1HXS2 3NKTA 4UW5A 3VL8A 2A6VA 3KCCA 4CEYA 4AHZA 4XJ9A 2Q1FA 3AKTA 1EAH3 2NMNA 4IL7A 4XF4A 2JXAA 1O4YA 2R1BA 5L7OA 1QWRA 3J8F1 1ZA7A 2B5HA 4FAGA 3LOBA 4HSJA 3VBRC 4PF5A 4FPFA 3K77A 2V5DA 3AC0A 2GMPA 2V4VA 2DVAA 1DQ2A 2O8QA 4D69A 2WAAA 3ES4A 1NZIA 3KGLA 3MFCA 2XUMA 2ET7A 1UKGA 4HOOA 2C6SA 1V9U1 2QZ3A 3OUJA 4L8QA 5AC92 3IN9A 2P37A 4EZHA 4MSVA 1R1ZA 1RVF1 1WBFA 3CQOA 3P3PA 4IW3A 3GXUA 4YVSB 2JIGA 4R9CA 3GZTB 1K3IA 3NNJA 4GZ9A 5D8AB 1UF2C 1XNDA 3VBSA 4BXSV 1EAH1 4W50A 4YW4A 3DPRB 1R64A 3QBQA 4JTOA 1NLRA 3ATGA 4MG2A 1NCRB 3ECQA 2D44A 3O1UA 2DCJA 4D7YA 5FYYA 1SLLA 2HBTA 2V73A 5HV4A 3LD8A 1DZQA 4INDA 4UYBA 4LO8A 3FHIB 4DUVA 4KWUA 2WC2A 4CU6A 2YGLA 5DZEA 4DFSA 2VMHA 1CESA 4O7XA 5C4WB 5JOZA 5ERLA 4YFZA 1MACA 1UOGA 4DEVA 3LDBA 4YM3A 5E8AA 4E8CA 2AENA 3T09A 4LUKA 4N7IA 4NRPA 3ROUA 2LROA 3N9MA 3ZSKA 4XAAA 5EQUA 2WINB 4FSJA 1J59A 1OC1A 5I91A 3ACFA 2Y0IA 1W8WA 1J3PA 2D6LX 4YPJA 5BNOB 1QKQA 4XZPA 2F4LA 2C24A 3EMRA 2PHDA 1UZVA 3AZVA 1UPSA 4HN1A 1W6NB 5GLWA 4GJYA 2ARCA 3IIIA 2PAKA 5LASA 2A7AA 3SH5A 4PDWA 1ND3A 3WSOA 2BYVE 4DB5A 1YUDA 4Y3OA 3M3EA 4Q29A 5H9PA 5F2WA 4DMIA 2Y64A 3HNYM 4LMFA 5K0UC 5FYMA 2BRTA 4FQZA 4BZ4A 2R042 5A6ZA 2W95A 2AGSA 5FY7A 3IT8A 4XBQA 3VHRA 3PJQA 3HT2A 1I5PA 5BXXA 1YQ8A 1F15A 3BI3A 1XPWA 2GN3A 5FFOC 5IVVA 4AI0A 5KXEA 2JE9A 2ZOEB 4CCNA 3AVRA 5IFTA 4YW1A 5JLVA 3HNBM 1V6JA 1W3VA 1HW5A 2G9FA 2OW4A 3N4MA 1HRI3 4LHKA 3ZXDA 4ASKA 2JKXA 1JW6A 4TYSA 4R8HA 3ZFEB 1X9PA 4FPKA 5CU1A 3SKJE 2J7MA 4QGMA 1AYM1 1EV13 1VBD1 1WWYA 2B46X 3FFQA 3LB9A 5A70A 5C3SA 1KQRA 2XJPA 4EN0A 2GC1A 1R092 4GWIA 1SZBA 2YDEA 4IE6A 4QAWA 5J36A 3VBHC 1RXGA 5FR3A 1W6OB 4AW7A 2P3YA 4S2FA 4K3UA 1IOAA 1S2EA 2WA4A 3DKQA 4Q4X2 5HCHA 2ZBJA 5A3NA 5IVCA 1C8NA 1GZ9A 1Z78A 4IV3B 3PMSA 1PIV3 4RL7A 5JZGA 3T0DA 2WLPA 1RJ8A 2JG8B 3FC0A 4WM8A 5BNQA 2QBXA 1RUF3 4N90A 4L99A 1GFF2 4GKYA 5JPMB 2XQXA 1EUTA 2L9LA 5JSRA 4JKMA 3VZMA 4CCKA 2P6CA 5E89A 4Q4V3 1HRI1 5B2GB 1FNYA 4I01A 5JIAA 4XJWA 4DNYA 4P08A 3D82A 5FQ0B 2CAUA 1PZ8A 1EV11 2BBAA 3ZVXA 2JDUA 4OHXA 4RQPC 1LTEA 3LA3A 1YFYA 1NY71 2VZOA 2WQ8A 1GQHA 1NE4A 3H1WA 4N9IA 1SLBA 2R1DA 2ZKLA 1BK0A 4Q0SA 4R4ZA 4ZPIA 4QQHA 2E26A 2ZABA 2UWBA 1V6NA 3RDIA 1IS5A 1ULEA 1ND2A 2P4EA 1UD1A 1FV2A 1HN1A 3IZOA 3I59A 5LEKA 1F8VA 3HN1A 3ACGA 3AMHA 3RZJA 1PIV1 1Y43B 3CMGA 2GDFA 1MEC2 1GV9A 4AE2A 1EPWA 2X5IC 3NJVA 2H0VA 3T2PA 4NMIA 1AR91 2QDNA 5FZ7A 2K2SA 3T0BA 3ZKYA 2XVKA 1KDMA 1UZZA 5EWSA 3V65A 3DXTA 1H8TC 5T52A 1PGW2 1OI6A 3AKSA 4YGBA 1X8EA 1HQNA 2YC2A 3WP3A 3WDVA 3AKRA 3UGGA 4CDWA 4FFHA 4XETA 4B4QA 2HEWF 3SISA 1COV1 1AHSA 3H0OA 3KQRA 1RMU1 3GBWA 1YJLA 2WFF2 3A23A 3OOXA 3WHTA 2MHFA 1HIXA 4DPNA 3M3IA 2ZGTA 1RC6A 3CJIC 3IDAA 1AXZA 4ISQA 5APAA 4YWAA 5BNNA 3V0BB 2HWB1 5JR7B 2R49A 4MGSA 2DTWA 1MQTB 1PK6B 4XMIA 1DCSA 3CZJA 4NPLA 1VBC3 4QQ2A 4FOWA 1T6BX 3LEIA 5GM0A 1D0HA 4LBKA 5DUVA 3ASIA 1H1AA 3ALQA 4P14A 4XW3A 4MXWB 4YZ2A 4EWDA 3BCWA 1LENA 3Q8BA 4QQOA 5L7OC 2FHRA 3H42B 3H8UA 1IKPA 1BJQA 3EBRA 5F39A 3KT7A 5HXMA 1S0FA 5FKBA 3LPGA 2ZGKA 3PLQA 3ZN4A 2BWCA 4NHKA 5L36A 1OH3A 1H9PA 1LOFA 3N7JA 1C8M3 1Y4WA 1W6QB 1POV0 1E5IA 3WXPA 2RJ2A 3GJBA 4LQRA 1D7PM 2VZQA 4F3JA 3W21A 3WW2A 1XC6A 3A22A 1E5HA 4N53B 1YJKA 3C7GA 3PUIA 3VDBA 1F2NA 4AQSA 3TEYA 1UAIA 1VRBA 1LULA 3ZFFC 4MUVA 4LBOA 2HYKA 4H55A 1VBC1 1W6PA 2V4AA 4E2QA 3ZFGB 1AYN2 2FDGA 1IQDC 4EN6B 4QX1A 3AP5A 2D5HA 3LE0A 4QB1A 3AJYA 4K9SA 4HPKB 1BBT3 2Q1MA 2W3JA 3S5QA 2ARBA 4JGYA 4RSUA 3EJKA 1GOHA 4F83A 4XCAA 4P9YA 3GDBA 3FHAA 5FP7A 4AVVA 5FYIA 4YGDA 1W2AX 4X8PA 3SMHA 1C8M1 1DGWX 2PXJA 2VZ1A 4YYOA 4AVSA 4CP0A 3J7MA 2JD4A 1UY1A 4CCEA 1CAWB 2ZX2A 4IE5A 4YZ3A 2B9UA 5C8CA 5DAVA 2PQQA 4M3CE 4FTBA 1AF9A 5AFEA 2J1EA 4LBLA 2ZMNA 4O9GA 3NQHA 3I3DA 1GUIA 4LO6B 4CYDA 3LFIA 3SITA 2J42A 4UFLA 4AFMA 3PL0A 2SLIA 4D94A 2ID4A 4KWKA 1XSQA 1YEWA 3TNQA 3VL9A 2EIDA 4A44A 1TVGA 2PHWA 4BQ2A 5FUIA 5LK7B 4GWJA 1VBA2 2VUCA 3THPA 2X29A 4IEVA 2OS2A 1BBT1 1JUHA 2BNMA 4XDPA 4W4ZA 3BGAA 2LUWA 4PDWC 1OPMA 3AYCA 3M4FA 3MBWA 3U07A 3H1YA 1BYHA 2W5FA 1OOPA 2WNUB 4Y1YA 3V0AB 3IWZA 4Y5TA 5GLVA 4AR2A 5A7WA 3VUOA 3S7EA 3UJQA 2RS12 3BIEA 4BK5A 1N1YA 5F5QA 3M2MA 5C3QA 5LK5A 1EUUA 3ZIXA 5FXXA 4GD4A 1ASJ2 1QY4A 4JAAA 2ZX3A 4LHSA 1KFXL 4ZS3A 3WZ1A 2CL2A 4TLFA 4K21A 4AL9A 5FZBA 3VV1A 1NT0A 3B02A 3O1TA 1XE8A 2E7AA 4S2GA 3WINE 5ANNA 1DF0A 1IGOA 1LEDA 3G7DA 3I3EA 4YVWB 3LEMA 2F4PA 3KF3A 3VBUA 3AFGA 4P9GA 2XMLA 5FY0A 1IG3A 3ZOIA 3W59A 3T08A 3LIGA 3E5UA 4IEOA 4PJYA 3VHNA 2EICA 3WDXA 2VW1A 2GC0A 2VW2A 3WQ7A 2QQJA 4WM7A 4JRLA 5IT6A 4MGKE 5FPZA 3U4SA 5FRAA 2PTMA 4GWNA 2BWAA 1ST8A 2VR4A 3LEGA 3W9AA 2G9ZA 4ATEA 4CE8A 2P1BA 1AZDA 2BVBA 5EYYA 4X6RB 4QU2A 4NUBA 2C9AA 4D6QA 2BNOA 4WM8C 3I7DA 4QU1A 1UY3A 1POV1 3GBFA 2QZ2A 5JXJA 3MICA 2YU2A 4BIFA 1RUH2 2PHUA 1MS0A 3HOBA 1O3RA 1LB2A 1MS4A 4ITCA 1W03A 3OBAA 2UY9A 3CZUA 3ZSEA 1UW8A 1AR81 2HWE3 2JICA 3JD72 1TEIA 4RR3A 2DF7A 4WVMA 2FDKA 3TEXA 3I49A 3DUIA 5GZCA 2RMU2 1AR62 2IXCA 3ON7A 1PZ9A 4D7TA 3BU0A 1BQPA 3I2DA 3SKVA 3DXUA 1J1LA 2PMWB 3PVEA 2WS92 3BN6A 3RYPA 2EIEA 3WQ0A 4K1ZA 3VD5A 1VB4A 2DUPA 3Q8CA 3GCXA 4Z82A 2D3RA 1GZCA 2DDUA 3N35A 3GYDA 1H2MA 3KGZA 4GAZA 3E5XA 1LJ7A 1WUVA 4NIAA 1PNGA 2RS52 4NPRA 1QJY2 3QH6A 3TYJA 4AVBA 4YM1A 4OYUA 2FD8A 2YFUA 3C2UA 1QJU3 3O12A 5FP8A 5LRRA 1FATA 2VZVA 4QPGC 1OD5A 4OI1A 3E1F1 1RUI2 3M70A 5FMOL 2VNVA 3WCSA 4LHLA 5JXIA 1JBCA 3H8RA 1IS3A 3PVOA 4EN9B 5FK8A 2BUKA 3VDDB 2FDIA 4UW4A 3MGUA 2UU8A 2W2IA 3MYXA 2QQMA 1XYNA 5IUQA 1K42A 1D2SA 2HWE1 2CDPA 1YQCA 4WZFA 1RJ7A 4FPYA 4NIIA 3IAPA 2JB4A 1J58A 4PI0A 4XF9A 5JAXA 4NR1A 5EIYB 3WCRA 3KMHA 3K4AA 4Q4Y3 4AHXA 1O7FA 2CDOA 2DV9A 4XABA 1ULDA 4LJHA 2I74A 4GH4B 1OVPA 1W8UA 5DABA 4BH9A 4NPMA 5GLTA 1ZRCA 5A6YA 3E6BA 3MW4A 3K4ZA 3WF4A 4CTEA 3JXSA 2WWJA 4Y1UA 1UY2A 4A42A 2JDNA 4E4HA 5HCFA 4BLJA 1C5IA 1PGSA 1L3JA 2AREA 2CU5A 5LBEA 3RI9A 5CKNA 4AXOA 2ZXQA 4CA9A 1URXA 5CEHA 3VKNA 1WD3A 1XXNA 3E97A 1V6KA 3N9QA 2OT7A 2D6KA 2RHPA 2QQNA 1CWPA 3EQEA 4LKFA 4Q4Y1 4N8MA 4LPLA 4CEWB 1LOFC 5JR2A 2GAUA 1CQ9A 4QGNA 3P3NA 1AL0G 4M00A 2BFUL 3OBZA 1U12A 1YI9A 1W9TA 2AEYA 3I3QA 4ARXA 2PHXA 1KD7A 3WUDA 4LIUA 2J1AA 3TN93 2IWGB 2OIIA 2JX9A 2YB7A 2IXKA 3DN7A 1BEV3 4D3WA 5C3OA 4EJRA 2QTWB 3D5OA 2RM23 3ZR6A 4CDQB 1LU2A 4QPIC 1OKQA 2JIJA 1ZRDA 3SCFA 5LWBA 2DVDA 2XJRA 3FWEA 3WOGA 5CBLA 1GZWB 3HQXA 4AHWA 4E9KA 3K3OA 1MPXA 4ASMB 3W5NA 2ZMLA 1AVBA 2YXSA 4IE4A 1N3PA 2YYOA 4CPBD 2ZEYA 1RHI3 5LY2A 2YY1A 3S6PA 1SFNA 1A3KA 3BB6A 2QCSB 5I0DA 2H0BA 5C8CC 5ABJA 1W2OA 3CEWA 1Y3TA 4ZHNA 3NRUA 5FY9A 2X09A 1YLLA 3MHZA 4E4SA 4XBNA 2C0ZA 3AB0A 4Y4RA 1O5UA 4HKWA 3TN91 3OYWA 4CU7A 1BEV1 3OGJA 4XVHA 4IE7A 4ES9A 2RM21 2W92A 4JDMA 1JYIA 2JDKA 5IVJA 4Y5SA 1YQ5A 2HWF2 1H6XA 4FI9A 4DS0A 4RS5C 4AI9A 1YQ2A 1B35C 1GANA 2ZGQA 5FZAA 4M3CF 1DYOA 1CIWA 1SACA 1QGLA 4OUSA 2VG9A 4QWNA 4YGEA 4CP9A 4KU7A 2OKXA 4BMEA 1NA1A 4O65A 1W8ZA 1OOPC 1RUE2 2VY0A 3LA2A 2ZGLA 3LDRA 3S7IA 4E8DA 1XJAA 3BPZA 4XYXA 5FOBB 2WAOA 4NIDA 2DCZA 4W8JA 4Z2AA 2HWD3 4Z8BA 1OVSA 2BOJA 3IMNA 2PLV2 4NAMA 4PF1A 4JV4A 3V56A 2BGCA 3T30A 2JDMA 1ZZBA 1J3QA 3ME2A 4BK4A 1O3SA 1W8NA 1VBE3 2BERA 4RGKA 2E6VA 4BQYA 2XJQA 1OXCA 3ZN6A 5TSWA 5KBFA 4MADA 3I54A 1ODMA 2JWPA 2WWSA 5FLIA 1ZYBA 4XPVA 3X29B 4CU8A 4YZ5A 4E2SA 2N7GA 3N9OA 5FBZA 2DUQA 5F5AA 1WLTA 2ADEA 1HJGA 1EY2A 1RXFA 1CX4A 1NX9A 1U5XA 1WZXA 2YC0A 3D6EA 4V2WA 1VAKA 5JOXA 3WG3A 2ETEA 2IXLA 1OLMA 2JG9B 2XKPA 1QOTA 3D8CA 2VL4A 3OY8B 1Y7BA 2JE7A 4YM2A 2VZRA 2FDFA 4QX3A 3R6SA 5JVVA 4ZU7A 1WCDJ 2A3YA 5BV6A 5LA0A 1UQXA 3AYDA 3VBHA 1W28A 1NLSA 3UKTA 1GNZA 2VZTA 4E4ZA 2QUOA 3WDTA 4IESA 1QJX1 3OBTA 4U36A 4M3CB 3WW1A 3PTYA 3WD5A 1VBE1 2PELA 5EZWA 4Y22A 4XUOA 2DCKA 2PAMA 4B1LA 4CP1A 1X50A 2W39A 2EAAA 2WNVA 2ENRA 3VBOB 2P5BA 3BU7A 3N36A 4QB6A 3ZDVA 1F4HA 2IXHA 4RR3C 5CFCB 1WA4A 5F3IA 2VTXA 2VQAA 4XUTA 1WCUA 5KXCA 1RUOA 1DQ4A 3T4HB 3VKOA 2RE9A 4FOVA 3MO4A 3IPVB 4BISA 4EWEA 4YW2A 4ASLA 2UWAA 4OI0A 1YC61 4Z1VA 3RZZA 4RQPA 4TWTA 1Q5OA 3W5MA 1YYNA 2QQLA 3Q8EA 4K40A 1UY4A 4OI2A 5EPAA 5FLHA 5JSPA 2YV8A 5DAWA 1SG3A 4HZFA 3MZHA 1S0IA 2PHLA 4FTEA 1RYYA 1D4M2 5T54A 4MGIE 1V6LA 1VLNA 4BQ3A 3JBG3 3OPZA 2ZGMA 2Y6JA 2DWRA 1FOD2 4LOSA 4MLOA 4CEYB 5JXGA 5CNAA 3U37A 2VVFA 3HMYA 3KV4A 4LNVA 2VTXJ 3VZLA 2VOKA 2VOXA 4BB3A 2Y6HA 1H2KA 3UETA 2I2SA 1ZBE2 5T5JA 3AZYA 5HXVA 5FP4A 4CCJA 1JH5A 4ONUA 1Q8PA 4JC1A 3RMXA 3PJYA 1H8TA 1MZEA 5H9QA 2P2KA 4LKSA 1HLCA 4K8RB 1UN1A 2W87A 4IXLA 4FOQA 2VMCA 3UKVA 2Q8EA 5C5UA 5C33A 2VULA 1UNBA 2XB6C 1TMF2 2GSYA 1WBLA 2BV4A 2ZGNA 4C1WA 5J48A 4NHMA 2WBKA 5ACA2 5F6KA 4IEZA 5FZ6A 1AL23 3EXUA 3WNKA 4GB31 2ZTNA 4XTPA 1UXZA 3LKJA 3LZZA 4U2AA 3CJIA 1HXS3 5I8SA 5LZ6A 3JBG1 1CX1A 5I0UA 3ENRA 3TNPB 4JGZA 4A45A 1H1IA 1RUD1 1RVF3 1XOYA 2TBVA 3RNSA 3VBSB 2IVJA 5L9BA 5A1LA 2LTNA 5AVPA 4AAXA 2X53S 2BFUS 4NHYA 4UT5A 2XBO1 3WG1A 3KZ4C 3NJXA 4H7MA 3SCGA 1UX6A 1VMHA 2GNBA 2K46A 4LORA 5DQ0A 1CAXB 5F6LB 2Y38A 5BPXA 1MS8A 4CXXA 2W68A 4XFAA 3OTFA 2PHRA 1YO8A 5DUUA 4BM8A 1BXHA 1Y9MA 3I2OA 1R082 1ALYA 1QQP2 1PMJX 3WF0A 3NW4A 4G9SB 3BTYA 1OD3A 1GWLA 5AC93 4JQRA 1ENSA 1YIFA 2C1FA 3M8LA 3OEAA 5GZFA 1AL21 1GQGA 3THTA 5K4LA 2PA7A 2IXJA 3AKPA 2R0HA 3W20A 1HXS1 3ACHA 1MZFA 4F7ZA 4YW3A 4CDUA 1NCQB 3GBGA 4TXWA 5IW0A 4OI4A 3ZFFA 4IUGA 3ZXGA 4E2GA 5I8TA 5KC5A 4M0NA 1A78A 2CHHA 1UY0A 4P9IA 1M06G 3KV9A 2JKBA 4I3PA 1UYYA 1JMUB 3WF1A 1ND3B 1CPNA 2ADDA 3WG2A 5A3TA 4URTA 4AEDC 5CFDB 1X82A 4YW6A 3WY6A 1ULOA 3LGRA 1TQ5A 2FQPA 2GMEA 2GZWA 1SFPA 4YARA 2ARAA 5DPNA 5A1FA 3GM8A 4ZY9A 1W8FA 4OHVA 5AC91 2ZAHA 2TUNA 4FFFA 4I0WB 5ABJC 5H9SA 1JI6A 1O4TA 4HKLA 1BK1A 1GKBA 1XBFA 3VKFC 4CUGA 4PIXA 4E27A 1UL9A 4QXHA 1OF4A 4HSLA 4YG6A 1O3TA 4UW6A 1BMV2 5KXBA 1WGPA 1REEA 1DIWA 2UY8A 5GKAC 3RG0A 3ZYFA 2QVSB 3DKWA 3FBMA 3PVNA 3FJSA 4LK7A 1MS1A 4B1MA 3JB4C 3CHXA 1G9FA 4PCRA 1M4WA 1DLLA 1C1FA 3AMMA 4XFBA 4BQWA 4Q8LA 3RYRA 2FCUA 1NA1C 4HONA 4XDQA 2GMMA 1TZOA 1O6UA 3MV01 4I02A 2V72A 5J37A 1FMD2 3RRDA 5E6HA 1HX6A 2YBPA 4MXVA 1AYM3 1VBD3 2E51A 1N47A 4LO4B 2O8OA 1KGYA 3NSTA 2VQUA 3A7QA 3FZ3A 3Q8FA 4PIYA 2R043 2VUDA 1UMIA 1QOSA 5EV7A 2GP3A 1UZWA 1UPIA 2YBSA 4OUMA 1Y9QA 1NQJA 4J25A 5T55A 4NWWA 5JZGB 3R05A 2XPJA 3AP9A 3RZGA 4P02B 2VBPA 2VUJA 1US2A 3O14A 4TN7A 5FY1A 1QJEA 2YU1A 3NAPB 3AP6A 3NJYA 4ISRA 4XXPA 3QH7A 3CDZB 4XOGA 4YVSA 2E9QA 2C9KA 2HKXA 3T2TA 5D8AA 2Z79A 4SLIA 3C7OA 5L9RA 2ZAAA 3AJZA 4JKKA 3WNOA 3VBFB 2TNFA 1NCRA 4HMZA 4C90A 3UJOA 2EA7A 5A7QA 3UYJA 2GH8A 2LS6A 3KHBA 1DQ1A 2MEV2 4IV1C 1R093 3SH4A 3ZN5A 2Y6LA 1L7LA 1OURA 5DXDA 1DYPA 1Z0HA 2KM2A 2Y60A 2R041 2B8MA 1LOCA 2WT1A 5GZEA 4Q4X3 1AX1A 3C7FA 1ND2B 4EWAA 2RJKA 4ATFA 1ULCA 5F5CA 3PDQA 1A8MA 3K46A 1CZSA 1V0AA 1W9YA 4KL1A 4AQ6A 1QDCA 4FOYA 4PLMA 2ZGRA 2WSUA 1VBB2 2WNVC 5BNOA 4SBVA 1UYZA 4UI9L 1Y9GA 4MGZE 4QPYA 3HBZA 1VRH2 1SDDB 3ZXLA 1JYNA 1AR93 3M3CA 5BNPC 4ET7A 4CVUA 4XZUG 3VLBB 1UIKA 5LA2A 2ZGSA 5C9AC 1W6NA 3LQCA 4UBHA 3U78A 3WUCA 4CDWB 1PO22 4LBQB 1R091 4QHBA 1TG7A 3CJXA 2XLAA 4OZXA 3WNLA 1P8JA 1DU3D 4AEJA 5BNNB 1JOBA 4XEZA 3J9SA 4MYEA 4Q4X1 1COV3 3OJBA 1RMU3 5JMOA 2EXHA 2RVAA 5JSOA 5K9YA 2YBKA 3USSA 4XMAA 3POSA 3J7LA 2AR6A 2HWB3 4KI5M 3M1HA 5GLUA 1LGBA 2ZHKA 4LA2A 5FZFA 2VNGA 2A73B 1XU2A 2QQWA 4Q4W2 3HAGA 4KH9A 1RUF2 3S0MA 4QPGA 4CXYA 3FX3A 1CVNA 1SPPB 1NOVA 2ZGPA 1U5YA 1DQ6A 3NNGA 4AVTA 3GHMA 4LBMA 4MO3M 4HVQA 1W8HA 3B9CA 4KNCA 3KCYA 1JHNA 3FUQA 1LGCA 2XG3A 1Q8QA 1W9FA 2JENA 2YPDA 5LB6A 1PM7A 2E32A 4URAA 2WFF3 1JYCA 5IVFA 3ZYBA 1K5JA 4AGRA 3I2JA 1IPSA 3HBKA 5LBBA 1O3QA 3PVBB 5C3PA 4KU8A 1YIPA 2J1TA 2NN8A 5L9VA 2GH2A 1K5MB 4JRAA 1W6PB 4AOCA 2AZ5A 3M7AA 2VH9A 3ZMOA 4JGZC 1MEC1 1VP6A 1W05A 3PMEA 4IV3A 5A32B 4CCOA 5FYTA 1UOFA 1OHFA 1QOOA 3KWVA 4Y20A 5BUVA 2ZEXA 3KV6A 2XVLA 4X6QB 1OLME 1PGW1 1OFNA 4ZU5A 1ZBA2 2VMGA 4JGYB 3SC7X 1PO12 4CUBA 1PVC2 3MUZ1 4JKLA 1XNKA 4AFAA 1Q56A 2A75A 5FY5A 3U1XA 3OUHA 2V09A 1HKDA 2QFEA 2DU1A 3B94A 3FN9A 4HXCA 3POJA 3POBA 2WFF1 4GQ7A 4BJ0A 2I45A 3O1SA 2BOIA 5FWEA 3MUY1 3MIEA 3HEIA 2JDYA 4HT1T 4RHV2 1D4VB 4HLTA 2W1QA 3O0VA 5JIUA 3WHUA 1WD4A 4XHXA 4ZXEA 4D8MA 4R9BA 3WX5A 3VN4A 2LALA 5IWFA 1AYN3 4CDUC 5IK7A 3DF0A 4G3YC 1SLIA 1CJDA 3HIFA 3ZO0B 5CISA 2NM1A 3CIHA 5JI9A 2EALA 2LW8A 2VZSA 3CLPA 1BLZA 4LKDA 4A3XA 4QPIA 1LAJA 4XTMA 3R4DB 5HCBA 4AQTA 5HBAA 3KB5A 3CO2A 3GGLA 3K75B 3S57A 1WCQA 4QKNA 4NROA 3B7MA 3AMNA 4BOWA 5A7WB 3VZKA 1UYXA 2FDHA 1CR7A 3HWJA 4QX2A 3H7JA 5F5IA 2ZACA 5KHKA 1YNAA 4QKBA 3WDWA 1HRV2 1FPN2 1SBDA 3FLTA 3NV4A 2DURA 1QMJA 2O0OA 3LPFA 2FMDA 4C0BA 2VVEA 4YGCA 1KXGA 3V0BA 1CONA 1OQ1A 4DXRA 4I09A 4AF9A 4BHPA 1AYN1 1C57A 2B45X 5GALA 2XL7A 2R072 2VU9A 3WDUA 4HANA 4D6RA 2G1MA 2FMYA 5BY5A 4RYDA 3E6DA 1DP0A 2R16A 2W9XA 2WO1A 3MV11 3VBUB 3B01A 5B4NA 1VALA 1WLCA 3KHCA 3MFAA 1ENXA 2E63A 5F3EA 2NLRA 4RS5A 2DFCA 4J6GA 1H9WA 1B35A 3DGTA 1RUG2 4OLLA 3AMQA 2WIIB 1ONAA 4WM7B 5FPAA 1SEFA 2VXRA 4EQVA 2R30A 3AYEA 3D0SA 1H8VA 1MS3A 1XU1A 4LXLA 2VCBA 1DFQA 2JD9A 4MHUA 1NG0A 4EN7B 3MF9A 5FTTC 2JEMA 1ASJ3 2ZX4A 4UOJA 5CIRA 4CU9A 1F4AA 1B09A 1CAVA 4QGLA 4N53A 4H14A 3OCPA 1PGL2 4AG4A 1ENQA 2Y0OA 1UMHA 2A70A 1JHJA 4UF0B 4YVSC 5FXWA 1NYWA 2DUOA 3TEWA 5D8AC 5C7GA 3VD4A 1VBA1 4IEQA 4O9EA 1POV3 3GALA 3KSCA 3DPRC 3MW3A 3AFKA 2WO3A 3WW4A 1NCRC 5FZIA 4MGQA 4IQPA 5IJRA 3ZXKA 1AR83 3N3HA 4CDXB 2EXKA 5FZ1A 4AGGA 2RS11 1H4GA 4LBQD 3P5BA 5C5TA 4A7ZA 3VB9A 5IK5A 3PTRB 2D98A 4LK6A 3UV9A 4COUA 1KRIA 3RMYA 1I1EA 5C4WC 2A6WA 1GOGA 1ASJ1 2XR4A 4M01A 5FO8B 4XUQA 3LFMA 2XJTA 5T5LA 4LOTA 2QQPA 1Z7S2 1WW7A 3POIA 3O5SA 2TEPA 5CKMA 1CD3G 1NE6A 5FUPA 2A6ZA 5F2SA 5FZGA 2DBIA 5JPNB 5A33B 5BNOC 4DY5A 3ZYHA 3HD8B 3JD73 3R4UA 3VD7A 1XE0A 2RMU3 2WZR2 1AR63 3I2GA 4TLGA 5LA9A 1GP5A 4DZGA 3JQWA 2P6HA 3GZAA 4CPBA 2YMZA 2ZGUA 3POGA 2WJSA 4AGVA 1E5SA 2WNUA 2WS93 1ACCA 1W0NA 1L7RA 5FZEA 1FYUA 5JCTA 4C1XA 4PQQA 5DDJ2 2JDZA 2VECA 1OPOA 2RS53 2VZ3A 1QJY3 4DIQA 4I2OA 2QQKA 5E88A 3KM5A 3AMPA 2DCTA 4NN0A 1AR72 4LBNA 3ACIA 4JVAA 3H3ZA 4QD2A 1RUH1 3HJRA 1YI7A 4NWVA 4A4AA 4Q5OA 4FPOB 5FKCA 2ZGOA 4FFGA 3JD71 3DYMA 2PQSA 2RDQA 5I93A 2QE3A 4YVWA 4JCKA 1D0GA 3KVAA 3PHMA 2GNMA 3RS6A 2RMU1 3WNNA 1AR61 1EPZA 5C71A 5JOWA 3ZFEC 4ZKTB 3PU3A 3VBRB 1JZ3A 4BQ5A 1ZRRA 2AYHA 2WS91 1VMFA 4GULA 1JOPA 4A7KA 2WT2A 4O61A 4P9JA 4RFT0 2WDBA 4P9XA 5BYNA 2W94A 1RL3A 1G9CA 2G4IA 3J26N 3K3NA 4NRQA 2E33A 2IVIB 3VD9A 1F31A 2RS51 3OUIA 1QJY1 4K7JA 3R4SA 3RYKA 1V70A 1GWKA 4GMP0 2RV9A 3B3QE 3RZHA 4ARYA 1RUI1 4XILA 5IAXA 2ARXA 2ZEWA 4JDOA 1UIJA 2JB8A 4IV3C 2A5ZA 1QJU2 2Y26A 1RUC2 1TNRA 2JG8C 5FK7A 4W65A 3KVBA 3MPBA 2GNDA 1V6OA 1W9SA 5AVAA 3ZXEA 2Z4FA 4Y1ZA 2XGXA 2AC1A 4LO5B 3VD3A 3UK9A 2C4XA 1ZVFA 1ZA4A 4L92A 1RINA 4QHZA 3ES1A 1W6MA 3UNPA 1SFYA 2E7QA 1LEMA 4PBOA 3WP6A 3G6JB 3ZDSA 4QX5A 1LHWA 1NXD1 3I3MA 4D0QA 4I0AA 4CRQA 2IZWA 1U5IA 2OPKA 1ULGA 3RJRA 2R062 3OYWB
chains in the Genus database with same CATH topology
5JXGA 1KEXA 3U37A 2VTFA 2JKXA 5LA1A 1BHGA 2VZPA 3SKJE 2J7MA 5C70A 2Y6HA 3UETA 5EJZB 1GU3A 4GWIA 5JXHA 4QAWA 4LKSA 2W87A 2VMCA 1NAEA 2WBKA 3T0DA 3HPNA 3A21A 2QBXA 3WNKA 2WN3A 3J7HA 1UXZA 3WEZA 3ABZA 1CX1A 2XQXA 2BGOA 1EUTA 2L9LA 4HG6B 1SHWB 4A45A 4JKMA 4AAXA 4P00B 3VDCA 1UX7A 4P08A 3NJXA 1JZ6A 2BBAA 2VC9A 4ZZ5A 5DQ0A 1JYWA 1UZ0A 1XNTA 2VZOA 2WQ8A 1NKGA 2JDAA 2J1SA 2E26A 2W1UA 4OZOA 4QPWA 1PMJX 3WF0A 1OD3A 1HN1A 2VCCA 3ACGA 3OEAA 3ZM8A 3CMGA 3NJVA 3T2PA 3T0BA 3ACHA 1ULPA 3K4DA 4TXWA 4IUGA 3F2ZA 3OGVA 2YC2A 1UY0A 1W99A 1UYYA 3WF1A 3I97A 1GNYA 3WNPA 4A41A 1ULOA 3A23A 5DPNA 3IDAA 4JX0A 3GM8A 1UWWA 2E31A 3C7EA 4ZY9A 4DEQA 4MGSA 1JI6A 4JHZA 3ETPA 3CZJA 1JZ4A 4XUNA 3LEIA 3P1IA 1OF4A 3HNMA 2BGPA 4DUWA 3OG2A 3T2QA 3DYOA 4KMQA 4OUEA 4A3ZA 2X10A 2W1WA 5HXMA 5IYYA 2C26A 3DECA 3LPGA 2ORZA 1JZ5A 2RJ2A 3MV01 2V72A 1D7PM 2VZQA 4LQRA 3WF3A 3WNMA 3I2HA 1XC6A 3A22A 4UAPA 3C7GA 3PUIA 1KGYA 3VDBA 2VQUA 3A7QA 1OT5A 1UMIA 2XHNA 1US3A 5LCWL 1T2XA 1IQDC 1J83A 4P02B 4CUAA 1US2A 4QX1A 3I2FA 3OGRA 3CDZB 3LE0A 4QB1A 4QDRA 2J1VA 1GMMA 2C9KA 2W3JA 1JYVA 1GOHA 4BDVB 3C7OA 3FL7A 3PUHA 3GDBA 3FHAA 4JKKA 2WUHA 3WNOA 5F7UA 2EIBA 2LS6A 2VZ1A 4QDSA 1UY1A 4XUPA 3OB8A 2Y6LA 2J1EA 3NQHA 3I3DA 3D3AA 1GUIA 3C7FA 5IHRA 2ID4A 3K46A 1CZSA 2EIDA 4A44A 1L7QA 4M4RA 1TVGA 2WN2A 5FUIA 4GWJA 2KD7A 2W47A 4M4PA 3BGAA 4W4ZA 1W8OA 1UYZA 1GQPA 3IB3A 3MBWA 4UI9L 2W5FA 2VOTA 5HPOA 1JYNA 1SDDB 3CKHA 5JUVA 4ET7A 4CVUA 4XZUG 5LA2A 3LQCA 2QQOA 1J84A 4BK5A 1TG7A 1PX3A 1EUUA 3WNLA 1P8JA 2BZDA 4L0PA 3I2KA 4LHSA 4TTGA 5JMOA 4ZZ8A 2RVAA 3SEEA 5CZKA 1GOFA 4KI5M 3I3EA 2W46A 1XNAA 4OMDA 3P6BA 4DXSA 5IFPA 1O8PA 3T08A 1CIYA 2B4KA 1K45A 2EICA 3NNGA 4MO3M 2VJXA 2QQJA 4DUXA 4OMCA 2WZ8A 3UESA 2E32A 2VR4A 3LEGA 3I2JA 3OEBA 3I3BA 4XURA 5EJ1B 1JZ8A 2ZEZA 2J1TA 1UY3A 4PT6A 5JXJA 2VMFA 3HOBA 3OBAA 3CZUA 4RN5A 3T0AA 2ZEXA 4CUBA 2Y6KA 3MUZ1 4JKLA 3SKVA 3C7HA 5DN2A 3BN6A 1O59A 2EIEA 5G04L 3VD5A 1DLCA 3FN9A 2DDUA 2ORXA 3I2IA 4BJ0A 2Y8KA 3MUY1 3THDA 3HEIA 4OYUA 2YFUA 2W1QA 1W9WA 2VZVA 2X05A 5JXIA 3E1F1 4ZXEA 4D8MA 2VCAA 2VMEA 2J1UA 2QQMA 5G05L 1K42A 2VM9A 2W91A 2CDPA 3CIHA 1JYXA 2LW8A 2VZSA 3IAPA 5EIYB 3GGLA 3K4AA 3K75B 3OGSA 1WCQA 2CDOA 3EYPA 5A1AA 3C8XA 1UYXA 2VMDA 4QX2A 2W1SA 2J1RA 3K4ZA 3WF4A 2YG0A 3JXSA 2QQIA 4DXTA 3LPFA 1UY2A 4A42A 1JZ7A 1OH4A 1CZVA 4DXRA 3WQBA 3DYPA 1O8SA 4A6OA 2ZXQA 4RYDA 1DP0A 2W9XA 2WO1A 3MV11 1PX4A 2Y6GA 5B4NA 2R7EB 2QQNA 2JE8A 4LPLA 3HN3A 5JR2A 1NUKA 3VDAA 1W9TA 4CUCA 4ARXA 4MOAA 2J1AA 2J22A 2YB7A 5J1XA 2VCBA 2JD9A 4UOJA 4P5YA 4CU9A 5DMYA 1CZTA 1F4AA 2WO2A 2XOMA 4AG4A 1UMHA 3T2OA 3THCA 1JHJA 2VO5A 1LNSA 5C7GA 1MPXA 3VD4A 3W5NA 2XONA 2WO3A 2ZEYA 4MGQA 5IJRA 1JU3A 2B9VA 5I0DA 3NRUA 2X09A 5CYYA 2YFZA 4CU7A 4XVHA 1GOGA 3LEKA 3FHQA 2W92A 4XUQA 1H6XA 4FI9A 1PMHX 1YQ2A 3K77A 2V5DA 1K12A 3AC0A 2VQTA 1DYOA 2V4VA 2OKXA 2WAAA 4QB2A 1JU4A 3VD7A 4E8DA 3I2GA 3CQOA 4QX0A 2WAOA 3GXUA 4W8JA 4Z2AA 1W0NA 4GZ9A 1K3IA 2HLEA 4PF1A 1L7RA 4BXSV 2VZUA 4W50A 1R64A 4PQQA 3ECQA 4BK4A 2VZ3A 1W8NA 2BERA 2DCJA 2QQKA 2WABA 2YC4A 4MADA 3ACIA 1JZ2A 1H6YA 4CU8A 3HJRA 4DUVA 4KWUA 4A4AA 4CU6A 3IAQA 3DYMA 2PQSA 1NX9A 4DEVA 4E8CA 3EB7A 3WNNA 5C71A 2VL4A 3T09A 2VZRA 4QX3A 1JZ3A 3ACFA 5LA0A 2WZEA 3SEPA 2WDBA 4YPJA 2VZTA 2W94A 3VD9A 2E33A 2HYXA 1UXXX 4XUOA 2RV9A 2DCKA 1OF3A 3IIIA 4ARYA 2ZEWA 3WSOA 4QB6A 5B4XA 1F4HA 2WYSA 1W9SA 4XUTA 2Y64A 3HNYM 2Z4FA 3VD3A 3MO4A 2W95A 2C4XA 1I5PA 3W5MA 1XPWA 2QQLA 3UNPA 1UY4A 1WKYA 1SG3A 4QDQA 4D0QA 5IFTA 3WF2A 1RYYA 3HNBM 2Y6JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JXG A;  1KEX A;  3U37 A;  2VTF A;  2JKX A;  5LA1 A;  1BHG A;  2VZP A;  3SKJ E;  2J7M A;  5C70 A;  2Y6H A;  3UET A;  5EJZ B;  1GU3 A;  4GWI A;  5JXH A;  4QAW A;  4LKS A;  2W87 A;  2VMC A;  1NAE A;  2WBK A;  3T0D A;  3HPN A;  3A21 A;  2QBX A;  3WNK A;  2WN3 A;  3J7H A;  1UXZ A;  3WEZ A;  3ABZ A;  1CX1 A;  2XQX A;  2BGO A;  1EUT A;  2L9L A;  4HG6 B;  1SHW B;  4A45 A;  4JKM A;  4AAX A;  4P00 B;  3VDC A;  1UX7 A;  4P08 A;  3NJX A;  1JZ6 A;  2BBA A;  2VC9 A;  4ZZ5 A;  5DQ0 A;  1JYW A;  1UZ0 A;  1XNT A;  2VZO A;  2WQ8 A;  1NKG A;  2JDA A;  2J1S A;  2E26 A;  2W1U A;  4OZO A;  4QPW A;  1PMJ X;  3WF0 A;  1OD3 A;  1HN1 A;  2VCC A;  3ACG A;  3OEA A;  3ZM8 A;  3CMG A;  3NJV A;  3T2P A;  3T0B A;  3ACH A;  1ULP A;  3K4D A;  4TXW A;  4IUG A;  3F2Z A;  3OGV A;  2YC2 A;  1UY0 A;  1W99 A;  1UYY A;  3WF1 A;  3I97 A;  1GNY A;  3WNP A;  4A41 A;  1ULO A;  3A23 A;  5DPN A;  3IDA A;  4JX0 A;  3GM8 A;  1UWW A;  2E31 A;  3C7E A;  4ZY9 A;  4DEQ A;  4MGS A;  1JI6 A;  4JHZ A;  3ETP A;  3CZJ A;  1JZ4 A;  4XUN A;  3LEI A;  3P1I A;  1OF4 A;  3HNM A;  2BGP A;  4DUW A;  3OG2 A;  3T2Q A;  3DYO A;  4KMQ A;  4OUE A;  4A3Z A;  2X10 A;  2W1W A;  5HXM A;  5IYY A;  2C26 A;  3DEC A;  3LPG A;  2ORZ A;  1JZ5 A;  2RJ2 A;  3MV0 1;  2V72 A;  1D7P M;  2VZQ A;  4LQR A;  3WF3 A;  3WNM A;  3I2H A;  1XC6 A;  3A22 A;  4UAP A;  3C7G A;  3PUI A;  1KGY A;  3VDB A;  2VQU A;  3A7Q A;  1OT5 A;  1UMI A;  2XHN A;  1US3 A;  5LCW L;  1T2X A;  1IQD C;  1J83 A;  4P02 B;  4CUA A;  1US2 A;  4QX1 A;  3I2F A;  3OGR A;  3CDZ B;  3LE0 A;  4QB1 A;  4QDR A;  2J1V A;  1GMM A;  2C9K A;  2W3J A;  1JYV A;  1GOH A;  4BDV B;  3C7O A;  3FL7 A;  3PUH A;  3GDB A;  3FHA A;  4JKK A;  2WUH A;  3WNO A;  5F7U A;  2EIB A;  2LS6 A;  2VZ1 A;  4QDS A;  1UY1 A;  4XUP A;  3OB8 A;  2Y6L A;  2J1E A;  3NQH A;  3I3D A;  3D3A A;  1GUI A;  3C7F A;  5IHR A;  2ID4 A;  3K46 A;  1CZS A;  2EID A;  4A44 A;  1L7Q A;  4M4R A;  1TVG A;  2WN2 A;  5FUI A;  4GWJ A;  2KD7 A;  2W47 A;  4M4P A;  3BGA A;  4W4Z A;  1W8O A;  1UYZ A;  1GQP A;  3IB3 A;  3MBW A;  4UI9 L;  2W5F A;  2VOT A;  5HPO A;  1JYN A;  1SDD B;  3CKH A;  5JUV A;  4ET7 A;  4CVU A;  4XZU G;  5LA2 A;  3LQC A;  2QQO A;  1J84 A;  4BK5 A;  1TG7 A;  1PX3 A;  1EUU A;  3WNL A;  1P8J A;  2BZD A;  4L0P A;  3I2K A;  4LHS A;  4TTG A;  5JMO A;  4ZZ8 A;  2RVA A;  3SEE A;  5CZK A;  1GOF A;  4KI5 M;  3I3E A;  2W46 A;  1XNA A;  4OMD A;  3P6B A;  4DXS A;  5IFP A;  1O8P A;  3T08 A;  1CIY A;  2B4K A;  1K45 A;  2EIC A;  3NNG A;  4MO3 M;  2VJX A;  2QQJ A;  4DUX A;  4OMC A;  2WZ8 A;  3UES A;  2E32 A;  2VR4 A;  3LEG A;  3I2J A;  3OEB A;  3I3B A;  4XUR A;  5EJ1 B;  1JZ8 A;  2ZEZ A;  2J1T A;  1UY3 A;  4PT6 A;  5JXJ A;  2VMF A;  3HOB A;  3OBA A;  3CZU A;  4RN5 A;  3T0A A;  2ZEX A;  4CUB A;  2Y6K A;  3MUZ 1;  4JKL A;  3SKV A;  3C7H A;  5DN2 A;  3BN6 A;  1O59 A;  2EIE A;  5G04 L;  3VD5 A;  1DLC A;  3FN9 A;  2DDU A;  2ORX A;  3I2I A;  4BJ0 A;  2Y8K A;  3MUY 1;  3THD A;  3HEI A;  4OYU A;  2YFU A;  2W1Q A;  1W9W A;  2VZV A;  2X05 A;  5JXI A;  3E1F 1;  4ZXE A;  4D8M A;  2VCA A;  2VME A;  2J1U A;  2QQM A;  5G05 L;  1K42 A;  2VM9 A;  2W91 A;  2CDP A;  3CIH A;  1JYX A;  2LW8 A;  2VZS A;  3IAP A;  5EIY B;  3GGL A;  3K4A A;  3K75 B;  3OGS A;  1WCQ A;  2CDO A;  3EYP A;  5A1A A;  3C8X A;  1UYX A;  2VMD A;  4QX2 A;  2W1S A;  2J1R A;  3K4Z A;  3WF4 A;  2YG0 A;  3JXS A;  2QQI A;  4DXT A;  3LPF A;  1UY2 A;  4A42 A;  1JZ7 A;  1OH4 A;  1CZV A;  4DXR A;  3WQB A;  3DYP A;  1O8S A;  4A6O A;  2ZXQ A;  4RYD A;  1DP0 A;  2W9X A;  2WO1 A;  3MV1 1;  1PX4 A;  2Y6G A;  5B4N A;  2R7E B;  2QQN A;  2JE8 A;  4LPL A;  3HN3 A;  5JR2 A;  1NUK A;  3VDA A;  1W9T A;  4CUC A;  4ARX A;  4MOA A;  2J1A A;  2J22 A;  2YB7 A;  5J1X A;  2VCB A;  2JD9 A;  4UOJ A;  4P5Y A;  4CU9 A;  5DMY A;  1CZT A;  1F4A A;  2WO2 A;  2XOM A;  4AG4 A;  1UMH A;  3T2O A;  3THC A;  1JHJ A;  2VO5 A;  1LNS A;  5C7G A;  1MPX A;  3VD4 A;  3W5N A;  2XON A;  2WO3 A;  2ZEY A;  4MGQ A;  5IJR A;  1JU3 A;  2B9V A;  5I0D A;  3NRU A;  2X09 A;  5CYY A;  2YFZ A;  4CU7 A;  4XVH A;  1GOG A;  3LEK A;  3FHQ A;  2W92 A;  4XUQ A;  1H6X A;  4FI9 A;  1PMH X;  1YQ2 A;  3K77 A;  2V5D A;  1K12 A;  3AC0 A;  2VQT A;  1DYO A;  2V4V A;  2OKX A;  2WAA A;  4QB2 A;  1JU4 A;  3VD7 A;  4E8D A;  3I2G A;  3CQO A;  4QX0 A;  2WAO A;  3GXU A;  4W8J A;  4Z2A A;  1W0N A;  4GZ9 A;  1K3I A;  2HLE A;  4PF1 A;  1L7R A;  4BXS V;  2VZU A;  4W50 A;  1R64 A;  4PQQ A;  3ECQ A;  4BK4 A;  2VZ3 A;  1W8N A;  2BER A;  2DCJ A;  2QQK A;  2WAB A;  2YC4 A;  4MAD A;  3ACI A;  1JZ2 A;  1H6Y A;  4CU8 A;  3HJR A;  4DUV A;  4KWU A;  4A4A A;  4CU6 A;  3IAQ A;  3DYM A;  2PQS A;  1NX9 A;  4DEV A;  4E8C A;  3EB7 A;  3WNN A;  5C71 A;  2VL4 A;  3T09 A;  2VZR A;  4QX3 A;  1JZ3 A;  3ACF A;  5LA0 A;  2WZE A;  3SEP A;  2WDB A;  4YPJ A;  2VZT A;  2W94 A;  3VD9 A;  2E33 A;  2HYX A;  1UXX X;  4XUO A;  2RV9 A;  2DCK A;  1OF3 A;  3III A;  4ARY A;  2ZEW A;  3WSO A;  4QB6 A;  5B4X A;  1F4H A;  2WYS A;  1W9S A;  4XUT A;  2Y64 A;  3HNY M;  2Z4F A;  3VD3 A;  3MO4 A;  2W95 A;  2C4X A;  1I5P A;  3W5M A;  1XPW A;  2QQL A;  3UNP A;  1UY4 A;  1WKY A;  1SG3 A;  4QDQ A;  4D0Q A;  5IFT A;  3WF2 A;  1RYY A;  3HNB M;  2Y6J A; 
#chains in the Genus database with same CATH topology
 3B93 A;  2D3S A;  2VTF A;  5CKQ A;  5LA1 A;  4AFB A;  2VZP A;  3MID A;  2XVG A;  2CAV A;  1YRZ A;  5EJZ B;  1C4R A;  2ZA9 A;  3ELN A;  2UWC A;  1GU3 A;  3KV5 A;  3LA7 A;  1IS4 A;  5FIX A;  2HWC 2;  1S55 A;  5F32 A;  4CP9 B;  3LDK A;  5A3M A;  1XNB A;  4N43 A;  4RA0 A;  1LHN A;  4OQ9 A;  5IVY A;  4LLF A;  2D43 A;  1VIW B;  5I8Y A;  1LOG A;  3HQR A;  2EXJ A;  3A0K A;  4JDN A;  4AED A;  4COZ A;  3A21 A;  2NP0 A;  3OSD A;  1QH7 A;  1XYO A;  3J7H A;  5HCA A;  4FPL A;  5K0U B;  3WEZ A;  1ZZ8 A;  4W6W A;  4FAH A;  1SHW B;  4DIN B;  2B42 B;  5DZG A;  1LOD A;  4P00 B;  3HR9 A;  5CAZ A;  1DQ5 A;  3VDC A;  1UX7 A;  4LE3 A;  3E6C C;  1N1S A;  1MQT C;  1PK6 C;  2VC9 A;  5LAT A;  3ZN6 B;  1UZ0 A;  2RR1 2;  4PLN A;  4Q0U A;  3ZYR A;  4LHN A;  1NKG A;  3POY A;  5FY4 A;  3U10 A;  4XF3 A;  1ZZC A;  2R0F A;  1I3H A;  2J1S A;  3DV8 A;  3QOP A;  2W1U A;  1R1A 2;  3K2O A;  4OZO A;  1YFW A;  1VPH A;  2QNK A;  1QH6 A;  4IEP A;  4W6X A;  5FZO A;  3U14 A;  1GBG A;  4Y26 A;  1RUE 3;  2VCC A;  5CAD A;  1RUJ 2;  5DAQ A;  1OFS A;  1W04 A;  3ZM8 A;  1LHU A;  4IEY A;  4NE9 A;  1RHI 2;  3O1O A;  4Q26 A;  4LR4 A;  3VBH B;  2IUW A;  3QAC A;  3SHR A;  1DQ0 A;  3ZYI B;  2DCY A;  3K4D A;  1UU6 A;  5D1I A;  3LIH A;  4N53 C;  1W2T A;  4EYU A;  1CAU A;  3OGV A;  1UOB A;  4C0H A;  2IC1 A;  4A2U A;  1W99 A;  2HWF 1;  2PHT A;  2YRO A;  4Y22 B;  3T1L A;  5JWP A;  4AK3 A;  1QJX 3;  3ZFG C;  4IE0 A;  1SLC A;  2D40 A;  3I97 A;  4DY3 A;  1DGL A;  4DO0 A;  4A41 A;  1UU5 A;  2QQU A;  4BQ1 A;  2RS3 2;  1UMZ A;  3KS7 A;  4JX0 A;  2A3X A;  4QXK A;  4C8D A;  1UWW A;  2BU9 A;  2E31 A;  4ZON A;  1GZW A;  4R9D A;  4RD7 A;  1RUE 1;  4BPZ A;  3JZV A;  4DEQ A;  2D6M A;  3O0W A;  1ZZ7 A;  1DGR A;  1KJR A;  2MPF A;  1SCS A;  3ETP A;  2ZCW A;  3WP4 A;  4RQP B;  3APB A;  3NWK A;  2GC3 A;  3QD6 A;  4IV1 A;  5A80 A;  1ZRE A;  3P1I A;  4K8F A;  1XSR A;  3AZW A;  1ENR A;  3HNM A;  3FE5 A;  3ZKU A;  2OX0 A;  3BOP A;  4KGG A;  2PLV 1;  3A0N A;  3BOW A;  3NJZ A;  4KMQ A;  2CYF A;  1KJL A;  1IG0 A;  5A7O A;  2XQR A;  2HWD 2;  2NPI A;  1OQE A;  2ZPX A;  3C3V A;  1KS5 A;  4A3Z A;  2X10 A;  4ES8 A;  1IS6 A;  2NMO A;  5KHG A;  1JN2 P;  4AFD A;  3AVS A;  3AL6 A;  2G19 A;  2PAE A;  5IAV A;  4EE2 A;  2GU9 A;  1JTZ X;  3ZX7 A;  4EN8 B;  3O1M A;  2AH2 A;  4BWO A;  1PMI A;  4C91 A;  1W8T A;  2X5I B;  5IK8 A;  1E5R A;  1JZ5 A;  4UW3 A;  4BCU A;  2WRA A;  3WNM A;  2OA2 A;  4V2V A;  3NV2 A;  4AVC A;  5M0T A;  1EYB A;  4LEJ A;  1H8T B;  2A71 A;  1DZT A;  4GKX A;  2HJI A;  1OT5 A;  3BAL A;  5BNP A;  3VZN A;  1ZZ6 A;  1WCK A;  2XHN A;  5C9A A;  1US3 A;  2WNU C;  5DAX A;  5GZG A;  3INA A;  1G9D A;  4IGQ A;  1IPK A;  1S0B A;  5FMO S;  1IQA A;  1QXP A;  4CUA A;  2OUJ A;  4XIK A;  2CSG A;  1EP0 A;  3OD4 A;  1UZY A;  2VQ0 A;  4JZR A;  3ZSJ A;  3T1M A;  3OGR A;  1OA3 A;  2CWM A;  1D4M 3;  1ZRI A;  3CJI B;  1JOJ A;  2XDV A;  1GMM A;  1JYV A;  4PI2 A;  1FOD 3;  2I07 B;  2XHK A;  4AI2 A;  5FZD A;  4GB3 3;  2LRP A;  3AP4 A;  1V6I A;  2WKK A;  2CWS A;  5F7U A;  3VHO A;  2EIB A;  2GC2 A;  2Q30 A;  1RUD 3;  2PYT A;  2EAK A;  3LSD A;  4QDS A;  2HBU A;  1ZBE 3;  5L7O B;  2XBO 3;  4YVW C;  3IDB B;  4XFH A;  4YZ1 A;  5DG1 A;  3H9A A;  4NJ4 A;  3KD4 A;  1TME 2;  2NYY A;  3U11 A;  2CGP A;  1OSG A;  5FUN A;  3ILF A;  3D3A A;  5EFU A;  3TOJ A;  4ERO A;  5IHR A;  1LHO A;  1POQ A;  4QKF A;  1TMF 3;  1X36 A;  5JDB A;  1N3O A;  2D7F A;  4IEX A;  1WMX A;  3AYA A;  3O1R A;  5ACA 3;  2B39 A;  2X8K A;  3NVC A;  5FZL A;  5EHD A;  2CNA A;  1QXJ A;  1D4M 1;  3DCQ A;  1G8W A;  1PGL 1;  1HB1 A;  2KD7 A;  2W47 A;  1VAV A;  1FOD 1;  3ZFF B;  1GWM A;  2DFB A;  2P34 A;  3CNA A;  2VOT A;  3N9P A;  1PM4 A;  4HK8 A;  4ZU4 A;  5HPO A;  3ZXA C;  1YFU A;  2Q5T A;  3CKH A;  4M3C A;  5E16 A;  1AUY A;  1WCS A;  2WR9 A;  2QQO A;  3NMB A;  1ZBE 1;  2ZHM A;  1C5H A;  4OUL A;  4XJU A;  2Z42 A;  1DGR N;  1AJK A;  3MIH A;  4L0P A;  3I2K A;  1R08 3;  5LEJ A;  4YG3 A;  1QQP 3;  3MIF A;  3J8F 2;  1IZ3 A;  1Q3E A;  4TTG A;  3Q9O A;  1D2Q A;  2YUE A;  3VZO A;  3I4I A;  1TMF 1;  3SEE A;  1S1A A;  3IDE A;  1I9R A;  5ACA 1;  2DVB A;  2VVD A;  4QQL A;  5FYV A;  1QJF A;  3NL1 A;  2Q1Z B;  1FI2 A;  1XNA A;  1MVE A;  4Q1P A;  2JJ6 A;  2DBN A;  2P3K A;  2VOV A;  4OHW A;  5ANQ A;  3M3Q A;  4Y24 A;  2BW8 A;  5F3G A;  1V9U 2;  5FMD A;  5KXD A;  1STM A;  4LA3 A;  5LW9 A;  4OHZ A;  4LT5 A;  3ST7 A;  1RVF 2;  1FNZ A;  2B7Y A;  1CN1 A;  3MLK A;  4B4R A;  4UFK A;  5F3C A;  2VJX A;  3QCW A;  3VDD C;  4FPH A;  2WO7 A;  1XNC A;  4N43 C;  3UES A;  3CF6 E;  1EAH 2;  2QQV A;  5FJK A;  5SV8 A;  1R08 1;  3OEB A;  4PDW B;  2VPV A;  1QQP 1;  5D2A A;  3I3B A;  3USU A;  3BYW A;  3K48 A;  1JZ8 A;  2QKD A;  2ZEZ A;  3GZE A;  3KLS A;  4R4X A;  4PT6 A;  3A4U A;  4HL0 A;  4WBB A;  4DXZ A;  5T5O A;  3ZPY A;  5FMC A;  2VMF A;  3RWK X;  3WW3 A;  3PUQ A;  1FAY A;  3GNE A;  3MEP A;  4GH4 C;  3ZYP A;  1SLT A;  2XJU A;  3T0A A;  2K9Z A;  3E5Q A;  4NVP A;  5DUW A;  2QJV A;  1VE0 A;  5T50 A;  2Q8D A;  3J7N A;  4COW A;  4KBZ A;  5DN2 A;  1HDK A;  1O59 A;  1YWK A;  2KXL A;  4H2A A;  5L73 A;  4DRV A;  1DBN A;  4FXK B;  2ILM A;  2F17 A;  4PIZ A;  4XFI A;  1F9K A;  5C8W A;  4K6B A;  2XWJ B;  1CAX A;  2ORX A;  4B7E A;  3UKN A;  1FMD 3;  5T5P A;  2E7T A;  3THD A;  2VE1 A;  4HBN A;  4XF0 A;  4ZS2 A;  5SV5 A;  2X05 A;  3UT0 A;  4CEW C;  3L2H A;  1E57 A;  4PQ9 A;  3WNX A;  1C28 A;  2XJV A;  2VCA A;  4KBB A;  4OFG A;  1WME A;  3AZX A;  2J1U A;  5G05 L;  1BMV 1;  1MS5 A;  2A6Y A;  4QXB A;  2WNO A;  3VKM A;  1LU1 A;  4XJZ A;  4OHY A;  4GAL A;  1WW6 A;  5FBJ A;  3TAY A;  1JYX A;  1W06 A;  4WM8 B;  4YFW A;  1IPJ A;  4CDQ C;  3VKL A;  1NCQ A;  2DYC A;  2OUH A;  1QJZ A;  1UYP A;  4PHZ A;  4R52 A;  1WMF A;  2XLF A;  4LBJ A;  4NHX A;  4MHR A;  3GCW A;  3OF1 A;  4IGO A;  5FZH A;  2MEV 3;  1WLW A;  2Z2S B;  2W1S A;  5FO7 B;  3DPR A;  2RDN A;  1FMD 1;  3BTX A;  4AWD A;  3N9N A;  4KG8 A;  3D4K A;  3IBM A;  5CFD A;  2EF6 A;  3PU8 A;  4CXW A;  2QQI A;  2D97 A;  2W0X A;  4XIO A;  4W6Y A;  4DXT A;  1BVV A;  1Q8V A;  1JZ7 A;  3IM0 A;  5EJ3 A;  2HH9 A;  1AYM 2;  1LOA A;  1VBD 2;  5JI7 A;  3MIB A;  1AXY A;  3SXW A;  2VXJ A;  4WVV A;  3WDY A;  3DYP A;  2P17 A;  3SH3 A;  1O8S A;  3B9I A;  4LUM A;  5C4W A;  4EZ4 A;  4UWD A;  2MNG A;  3I59 B;  1AXK A;  1PX4 A;  2CV6 A;  1WMD A;  1OQD A;  2LM3 A;  2Y6G A;  4QQP A;  4LO7 A;  4QPG B;  3AM2 A;  1VBB 3;  2XWB B;  2DU0 A;  3D0J A;  2H6B A;  1NUK A;  1VRH 3;  1X9T A;  1OBN A;  3MIG A;  2ZJC A;  5LBF A;  3KF5 A;  4AI1 A;  2MEV 1;  4QT6 A;  5A3W A;  2K0G A;  1PO2 3;  4MX3 A;  1GYK A;  1HN0 A;  2GN7 A;  4ORF A;  5KR7 A;  1HRI 2;  2OPW A;  4FP2 A;  1J3R A;  1WLD A;  2CY6 A;  5DMY A;  1CZT A;  5LRS A;  1MZ5 A;  1EV1 2;  1UCX A;  2G9G A;  2NQY A;  2WO2 A;  3LSE A;  2KR2 A;  2ZZJ A;  1KIT A;  3AXD A;  3PUR A;  2FCV A;  3THC A;  3T2O A;  1GP6 A;  1NY7 2;  2VO5 A;  3H1M A;  1LNS A;  3PIJ A;  3PNA A;  3VZJ A;  4DRR A;  2WSV A;  2VAU A;  3NKG A;  5I0S A;  2AUY A;  1HB4 A;  2XON A;  4Q4W 3;  3KT1 A;  3NAP A;  4Y20 B;  5FZC A;  1VBB 1;  3POW A;  4BU2 A;  2DVF A;  1MEC 3;  1HB3 A;  1S0J A;  4JHT A;  5FP3 A;  1PIV 2;  3WVJ A;  3ZIW A;  2VW0 A;  3S30 A;  1VRH 1;  3T3Y A;  3HVD A;  5FY8 A;  5K7P A;  1F35 A;  4XJA A;  3VBF A;  1AR9 2;  1PO2 1;  3BOD A;  2WQZ C;  1BCX A;  1HV1 A;  1XRU A;  2YFZ A;  5CYY A;  5FZ4 A;  4XFG A;  4Q4V 2;  1ULF A;  1G6N A;  5FYS A;  5A3L A;  3LEK A;  5FYU A;  3ETQ A;  3B5L B;  3FHQ A;  3ZFE A;  1ZZ9 A;  2JG9 C;  3SLI A;  1J1T A;  1PMH X;  4AHY A;  1H2N A;  2GAL A;  1COV 2;  1K12 A;  3RQ0 A;  2VQT A;  2XH6 A;  2A6X A;  1RED A;  1RMU 2;  3EO6 A;  4XFC A;  1W0P A;  4QMA A;  5FYB A;  1OLQ A;  1VJ2 A;  1W6O A;  3UGF A;  4MET A;  2WA3 A;  4GIQ A;  1OKO A;  4Q4W 1;  4QB2 A;  2HWB 2;  1ZNP A;  1RUF 1;  2YPJ A;  4P9L A;  1JU4 A;  4QPI B;  2GNT A;  3MLJ A;  3KQ4 B;  1ZBA 3;  5A3O A;  2ZX0 A;  2A3W A;  1PO1 3;  2JG8 A;  1PVC 3;  3N7K A;  4HVR A;  4Q2F A;  1YXW A;  4QX0 A;  5CG9 A;  4Q4V 1;  3VBO C;  4Q8K A;  3U4X A;  2Q8C A;  4S2H A;  5CFC C;  3JQX A;  4MGT A;  3N9L A;  1UOJ A;  1KS4 A;  2HLE A;  4FT8 A;  2VZU A;  1GP4 A;  1UU4 A;  4BXF A;  4LBQ A;  4NIH A;  1LGN A;  1X33 A;  1JOD A;  1ZRF A;  1G7Y A;  5FQ0 A;  2D6P A;  4RHV 3;  4IGP A;  1G86 A;  1QU0 A;  1C1L A;  3CBN A;  2WAB A;  3FUO A;  2ES3 A;  1H1M A;  5DAP A;  2YC4 A;  2EXI A;  2VOW A;  4NHL A;  3UL2 A;  1H30 A;  2BDR A;  5C8C B;  1JZ2 A;  4BIO A;  3RZL A;  1H6Y A;  5A6Q A;  3WQ1 A;  3JU9 A;  5FV3 A;  4Z07 A;  1O5L A;  3IAQ A;  1LHV A;  4CEY C;  2D5F A;  2BNN A;  1G9B A;  4AVA A;  3EB7 A;  2XLG A;  2PN5 A;  3NNL A;  5CB7 A;  4I0B A;  1ZBA 1;  1VBC 2;  1PO1 1;  4RS5 B;  1PVC 1;  5F1R A;  3ILR A;  1Q43 A;  5FRE A;  2EVX A;  1B35 B;  1OMI A;  5T3N A;  4H7L A;  1SPP A;  3HT1 A;  4KGQ A;  2WZE A;  4KG0 A;  1KDK A;  5FZK A;  1UO9 A;  3SEP A;  1A34 A;  3NV3 A;  4D6S A;  3MI8 A;  5CG8 A;  1S2K A;  1WW4 A;  1OOP B;  5A7P A;  4BLI A;  3L9J T;  2RDR A;  2HYX A;  2D6N A;  4QM8 A;  1UXX X;  1HRV 3;  1FPN 3;  1QHD A;  1VMJ A;  4WV8 A;  2VNO A;  4RHV 1;  1PVX A;  1UKR A;  3OPT A;  2AEZ A;  3AX4 A;  1OF3 A;  2WFP A;  2PHF A;  1GNH A;  4FP3 A;  1CAV B;  1OLR A;  4MH0 E;  4Q27 A;  1HB2 A;  1LEC A;  4B29 A;  1C8M 2;  5KHJ A;  4XJ8 A;  2W52 A;  4UXA A;  5B4X A;  3IDC B;  1O4Z A;  2WYS A;  1GLH A;  1K5M A;  2R07 3;  1U0A A;  2Y33 A;  4IET A;  5EXO A;  5CA6 A;  4P9W A;  4Q0V A;  5FO9 B;  4QXC A;  2OQ7 A;  3PUS A;  3VBS C;  5FZ8 A;  3H3U A;  2NZ9 A;  4ZXK A;  5A32 A;  3RZM A;  4HET A;  5DG2 A;  1MQT A;  1PK6 A;  1ZX5 A;  4XHB A;  4CCM A;  3VHP A;  2OVU A;  5IVE A;  4FO9 A;  2RDS A;  3ZPO A;  1VBA 3;  1S4C A;  4BA6 A;  1RUG 3;  3ACL A;  1WKY A;  3POE A;  4N9H A;  1IKQ A;  4QDQ A;  3UGH A;  1QNY A;  4MXW A;  3WF2 A;  5A7S A;  2O14 A;  5HV0 A;  1DG6 A;  1BBT 2;  3WR0 A;  4EV0 A;  1KEX A;  1HRV 1;  1FPN 1;  5KHI A;  2E53 A;  2BBV A;  1W90 A;  4B7K A;  2RS1 3;  2ZX1 A;  1BHG A;  5JOY A;  4JQT A;  3RPQ A;  5C70 A;  5I0R A;  1LKN A;  2D3P A;  2YGM A;  1W6Q A;  3RSJ A;  4XCB A;  4E4D X;  2BEO A;  5H9R A;  1H4H A;  5JXH A;  2R07 1;  1RIR A;  1GZT A;  1NCQ C;  2VMI A;  5EYX A;  4FVV A;  4XQ4 A;  3ZLI A;  1DHK B;  5FLJ A;  3WT3 A;  4GA9 A;  3WLU A;  3AP7 A;  2RJL A;  3GZU C;  5LBC A;  3T4V A;  1QF3 A;  3ZFG A;  1NAE A;  4G4F A;  4MV2 A;  2BP6 A;  4UFH A;  3MPP G;  1Q8O A;  1RUG 1;  1YCI A;  3HPN A;  4LIT A;  4RR3 B;  4WVM B;  1ND3 C;  2WN3 A;  4MVT A;  5CFD C;  3L2Y A;  3ABZ A;  4HPK A;  1PHM A;  1SMV A;  1N1T A;  2BGO A;  4HG6 B;  1KFU L;  2WLQ A;  4XAC A;  3SQO A;  1JZ6 A;  2HEY F;  4B3N A;  1WW5 A;  4ZZ5 A;  4IEU A;  2WT0 A;  1JYW A;  3BTZ A;  3MDP A;  3KCX A;  4YW5 A;  5IK4 A;  2BPA 2;  1XNT A;  1Z7S 3;  3B00 A;  5DUX A;  3TB0 A;  1CAW A;  3IMM A;  5FJH A;  3WV6 A;  2ATF A;  4PLO A;  2JDA A;  2VBD A;  3FLP A;  4YSF A;  4UFM A;  3S5A A;  2XKO A;  4YM0 A;  2CGO A;  3NO8 A;  4QPW A;  1HQL A;  1FX5 A;  1RUH 3;  4FQ4 A;  2WZR 3;  4XC9 A;  1VAM A;  1QXR A;  2HEV F;  5J3U A;  5LY1 A;  4I30 A;  4KWL A;  1BVP 1;  3WP5 A;  4CCC A;  1CPM A;  1PNF A;  3VGI A;  2OZ6 A;  4AZZ A;  1W0O A;  1XB9 A;  3H8O A;  4AI8 A;  2VBB A;  1AR8 2;  4L9B A;  1H2L A;  4L11 A;  1XYP A;  2F6B A;  3H50 A;  4L2N A;  5FPU A;  4NIG A;  2UUR A;  1ULP A;  4A7Y A;  1OA2 A;  5DDJ 3;  1JYT A;  3B69 A;  4IEW A;  3AKQ A;  3F2Z A;  4NRM A;  3FBY A;  4OCT A;  1OA4 A;  3JCI A;  3V0A A;  4N7U A;  4LUL A;  4YW7 A;  4AEK A;  1AR7 3;  2PFW A;  1Z7S 1;  1MVQ A;  3LOI A;  5FPV A;  2P3J A;  5JZG C;  1GNY A;  4QX7 A;  3WNP A;  4NOT A;  3NAP C;  4GWM A;  3ORJ A;  1RUI 3;  2BJS A;  1X8M A;  2JDP A;  4M0H A;  4UF0 A;  3RWN A;  3C7E A;  1G9A A;  2ZMK A;  1FXZ A;  1GSL A;  2WZR 1;  4JHZ A;  4LKE A;  1H0B A;  1AJO A;  1JZ4 A;  3VBF C;  1W6M B;  4XUN A;  4FPG A;  1F5F A;  1DYK A;  2BGP A;  2HWE 2;  4NO4 A;  4CCL A;  3OG2 A;  3T2Q A;  4DUW A;  3DYO A;  3BVC A;  4CDX A;  5AFB A;  1FV3 A;  4OUE A;  4F8A A;  5DDJ 1;  3R0R A;  5A7N A;  2W1W A;  3BUC A;  2CTV A;  4Y5Z 0;  5KC6 A;  1HJF A;  2C26 A;  2R32 A;  2ZKN A;  3RGB A;  3DEC A;  5IYY A;  1ND2 C;  1TE1 B;  1LCL A;  3JUU A;  3AXE A;  1AR7 1;  5JMC A;  3PUA A;  1JXN A;  4UBG A;  2ORZ A;  4YRD A;  1IHM A;  1RUC 3;  1DDL A;  3WF3 A;  2OYZ A;  3O1P A;  3I2H A;  2WNE A;  3K51 A;  4UAP A;  5GJ6 A;  3W58 A;  4AEM A;  1LR5 A;  1YQ6 A;  4CSW A;  1JUI A;  2P3I A;  4N43 B;  5A33 A;  1S2B A;  4P5H A;  5FCC A;  1GIC A;  4YLZ A;  5LCW L;  4Q0P A;  5J98 B;  1T2X A;  4MGY E;  2YZ4 A;  4LE4 A;  2Q8O A;  4XF1 A;  4AED B;  1J83 A;  3O7O A;  1YHF A;  4CDW C;  3TWI A;  3I2F A;  1S0D A;  2FZ2 A;  3ZMN A;  4RGA A;  5D21 A;  4QDR A;  4QX8 A;  1LOB A;  4Y4Y A;  5FPL A;  2J1V A;  3TRS B;  2R06 3;  4Q4Y 2;  4BDV B;  5BNN C;  5ABJ B;  3FL7 A;  3PUH A;  2IFW A;  2DVG A;  2OZJ A;  2WUH A;  4XE9 A;  3FLR A;  1XE7 A;  3ITQ A;  4PBP A;  4HK9 A;  1QJU 1;  1RUC 1;  3CL1 A;  4XUP A;  2WYF A;  3Q8A A;  2HWC 3;  3OB8 A;  2XJS A;  4FCA A;  5FAX A;  5FZ0 A;  4YG0 A;  4OQ8 A;  2A1X A;  2IXI A;  5FYC A;  1C3H A;  1JS9 A;  3H7Y A;  3N7M A;  5FZO B;  4FTS A;  1CGP A;  4KWJ A;  4LLO A;  3TBD A;  1S0C A;  1X7N A;  3VDD A;  5FXV A;  4CCD A;  4BMB A;  1MS9 A;  1NA1 B;  1RUN A;  4HVO A;  3OGG A;  3ZSL A;  5IVB A;  1L7Q A;  2O1Q A;  4M4R A;  3VBR A;  2WL1 A;  2WN2 A;  1A8D A;  3U75 A;  4WZC A;  3AK0 A;  1LRH A;  1APN A;  1T6G C;  4FPC A;  2R06 1;  4LTA A;  2V5Y A;  1ZM1 A;  4M4P A;  5KWR A;  3SCH A;  1W8O A;  1MR5 A;  1GQP A;  3IB3 A;  3BPS A;  5J7M A;  5F9T A;  1CAU B;  1OUX A;  4WVW A;  4XAE A;  5JUV A;  4GH4 A;  2XUE A;  1K5M C;  3LAG A;  2UYA A;  4YNI A;  2RR1 3;  3J4U H;  2OQ6 A;  1J84 A;  2ZZQ A;  2R6Q A;  3TN9 2;  2HWC 1;  1MZ6 A;  1BEV 2;  1PX3 A;  2HWF 3;  1RIT A;  4LIV A;  2BZD A;  2RM2 2;  3RFR A;  3RVH A;  5FOJ B;  3GHN A;  3AL5 A;  1R1A 3;  3BKZ A;  2VUA A;  3TEZ A;  4JGY C;  4IDZ A;  1V00 A;  1RUJ 3;  4UFI A;  4ZZ8 A;  4D7S A;  5CZK A;  1Q8S A;  2VCM A;  4GMP 3;  3MF6 A;  2EIG A;  1XQN A;  3IKW A;  4IV1 B;  4Q1R A;  1GOF A;  2KA3 A;  4QKD A;  4AI3 A;  3ZYJ B;  5E1R A;  2W46 A;  3OBR A;  3H3L A;  2FDJ A;  1O91 A;  2VGD A;  5F37 A;  4OMD A;  3P6B A;  4IER A;  2C5D A;  4DXS A;  1I5Z A;  5IFP A;  4CEW A;  1O8P A;  4COV A;  1CIY A;  5EP9 A;  5J96 B;  4K1Y A;  5A3P A;  2B4K A;  1K45 A;  2PLV 3;  2W08 A;  5FP9 A;  1QDO A;  4DUX A;  2RR1 1;  4FPJ A;  4OMC A;  3ZXJ A;  2Z69 A;  1N3Q A;  2DTY A;  2WZ8 A;  4BQ4 A;  5C3R A;  3BTA A;  5CVR A;  2IFR A;  1SCR A;  4XQD A;  4FFI A;  3IIA A;  2RS3 3;  1FT9 A;  2WNV B;  4CDQ A;  4CZS A;  4FBF A;  5A3U A;  1R1A 1;  4XUR A;  4QHO A;  5EJ1 B;  3AZZ A;  4DOU A;  5ISL A;  4QM9 A;  1ODN A;  5J09 A;  1RUJ 1;  5BNP B;  3U0Z A;  1V6M A;  4GMP 1;  2XL9 A;  5C9A B;  4GXL A;  1SBF A;  3NNF A;  4HN0 A;  1RHI 1;  3JB8 A;  4AYU A;  5C6C A;  5IAT A;  2Q0A A;  2WZP P;  5HI0 A;  1CJP A;  4RN5 A;  1WA6 X;  2ZHN A;  3QLQ A;  1DZR A;  3NV1 A;  5K0U A;  4XBL A;  4AFC A;  2BTV C;  1RB8 G;  2FCT A;  2Y6K A;  4WVZ A;  5A6X A;  2WQ4 A;  1RGS A;  3WG4 A;  4OVE A;  3RI8 A;  1SBE A;  3C7H A;  1U5Z A;  5FYH A;  3MW2 A;  2JEC A;  1QNW A;  3SNM A;  1W2U A;  5G04 L;  4BQX A;  2FZ1 A;  1DLC A;  3ZXF A;  3BIW E;  3I2I A;  1QJX 2;  3ZR5 A;  3O1V A;  1BKZ A;  2RS3 1;  3RZK A;  2Y8K A;  3VBU C;  4NAO A;  1VBE 2;  3POF A;  4RFR B;  5FMB A;  3HQU A;  3O0X A;  3ZSM A;  1W9W A;  1GR3 A;  2Y6F A;  5FZ3 A;  1LES A;  4FXG B;  4JTN A;  1QEX A;  5K8S A;  2VME A;  4WM7 C;  4XFF A;  2VM9 A;  2W91 A;  1I6X A;  2SBA A;  4TZD A;  3I8T A;  2JDH A;  4XDO A;  2HWD 1;  4S2D A;  2D6O X;  2ZS6 B;  3LCP A;  2Q4S A;  1HQW A;  4Y1X A;  3OGS A;  4GJZ A;  1AX2 A;  2AAC A;  3EYP A;  3DEM A;  1NXM A;  5F8P A;  4JGZ B;  5A1A A;  3C8X A;  5DZF A;  2VMD A;  2ET1 A;  2H6C A;  4KQ7 A;  2J1R A;  1W39 A;  4V1P A;  4Y33 A;  3V64 A;  1SQ4 A;  3ZYG A;  4Z92 B;  4XQW A;  2YG0 A;  2XXZ A;  3N7L A;  1A6C A;  3PIG A;  3ILN A;  1TME 3;  4X8N A;  2CGN A;  2Z5W A;  3OPW A;  1AX0 A;  4TSV A;  4H3W A;  1OH4 A;  1W2N A;  1CZV A;  4L97 A;  3WQB A;  4B4P A;  4BYY A;  2RG4 A;  4CDX C;  1OUS A;  4A6O A;  5FPB A;  3CU7 A;  3OD0 A;  1DGW A;  3DL3 A;  4B8E A;  3MLL A;  1NZC A;  4AAP A;  2VNR A;  1VR3 A;  5FZ9 A;  3GF6 A;  3URF A;  5GZD A;  4CP2 A;  5I0T A;  2JG9 A;  1RTV A;  2R7E B;  2JE8 A;  3OY8 A;  5FWJ A;  4HKO A;  5FYZ A;  4DQA A;  3HN3 A;  2OXB A;  5GLZ A;  4HFS A;  4UFJ A;  4COY A;  2BVV A;  4I3G A;  3VDA A;  2UYB A;  4CDU B;  4CUC A;  4Y1V A;  4GB3 2;  4XXA A;  3EHK A;  5FDB A;  5FPX A;  1S0E A;  2YHJ A;  5KHH A;  4AQ2 A;  4MOA A;  3JBG 2;  4BE3 A;  2J22 A;  1RUD 2;  2FBE A;  2X5I A;  4Z2W A;  5J1X A;  1TME 1;  2VD7 A;  2WWU A;  3FFZ A;  2XBO 2;  4P5Y A;  5FXZ A;  4A6S A;  1F5J A;  4FPE A;  3USU B;  2Y34 A;  3NNM A;  3J8F 3;  3RJ2 X;  1SDW A;  1QIQ A;  1PZ7 A;  4Q0Q A;  3VBO A;  2XOM A;  3KT4 A;  3M3O A;  5CFC A;  1LOE A;  4MZU A;  1VB2 A;  4J1W A;  3H8X A;  4R9A A;  4K20 A;  3FMG A;  1N1V A;  2ZHL A;  5FZM A;  1NQD A;  3LWC A;  2ERF A;  3IPV A;  4J1X A;  4RGG A;  1BZW A;  1TNF A;  1V9U 3;  2D93 A;  1SLA A;  3LF7 A;  3F95 A;  1YFX A;  2GP5 A;  1NLQ A;  1REF A;  1JU3 A;  2B9V A;  3GJA A;  2QDR A;  5L19 A;  1AL2 2;  1S0G A;  2BQP A;  4YZ4 A;  1W3X A;  1HV0 A;  1HXS 2;  3NKT A;  4UW5 A;  3VL8 A;  2A6V A;  3KCC A;  4CEY A;  4AHZ A;  4XJ9 A;  2Q1F A;  3AKT A;  1EAH 3;  2NMN A;  4IL7 A;  4XF4 A;  2JXA A;  1O4Y A;  2R1B A;  5L7O A;  1QWR A;  3J8F 1;  1ZA7 A;  2B5H A;  4FAG A;  3LOB A;  4HSJ A;  3VBR C;  4PF5 A;  4FPF A;  3K77 A;  2V5D A;  3AC0 A;  2GMP A;  2V4V A;  2DVA A;  1DQ2 A;  2O8Q A;  4D69 A;  2WAA A;  3ES4 A;  1NZI A;  3KGL A;  3MFC A;  2XUM A;  2ET7 A;  1UKG A;  4HOO A;  2C6S A;  1V9U 1;  2QZ3 A;  3OUJ A;  4L8Q A;  5AC9 2;  3IN9 A;  2P37 A;  4EZH A;  4MSV A;  1R1Z A;  1RVF 1;  1WBF A;  3CQO A;  3P3P A;  4IW3 A;  3GXU A;  4YVS B;  2JIG A;  4R9C A;  3GZT B;  1K3I A;  3NNJ A;  4GZ9 A;  5D8A B;  1UF2 C;  1XND A;  3VBS A;  4BXS V;  1EAH 1;  4W50 A;  4YW4 A;  3DPR B;  1R64 A;  3QBQ A;  4JTO A;  1NLR A;  3ATG A;  4MG2 A;  1NCR B;  3ECQ A;  2D44 A;  3O1U A;  2DCJ A;  4D7Y A;  5FYY A;  1SLL A;  2HBT A;  2V73 A;  5HV4 A;  3LD8 A;  1DZQ A;  4IND A;  4UYB A;  4LO8 A;  3FHI B;  4DUV A;  4KWU A;  2WC2 A;  4CU6 A;  2YGL A;  5DZE A;  4DFS A;  2VMH A;  1CES A;  4O7X A;  5C4W B;  5JOZ A;  5ERL A;  4YFZ A;  1MAC A;  1UOG A;  4DEV A;  3LDB A;  4YM3 A;  5E8A A;  4E8C A;  2AEN A;  3T09 A;  4LUK A;  4N7I A;  4NRP A;  3ROU A;  2LRO A;  3N9M A;  3ZSK A;  4XAA A;  5EQU A;  2WIN B;  4FSJ A;  1J59 A;  1OC1 A;  5I91 A;  3ACF A;  2Y0I A;  1W8W A;  1J3P A;  2D6L X;  4YPJ A;  5BNO B;  1QKQ A;  4XZP A;  2F4L A;  2C24 A;  3EMR A;  2PHD A;  1UZV A;  3AZV A;  1UPS A;  4HN1 A;  1W6N B;  5GLW A;  4GJY A;  2ARC A;  3III A;  2PAK A;  5LAS A;  2A7A A;  3SH5 A;  4PDW A;  1ND3 A;  3WSO A;  2BYV E;  4DB5 A;  1YUD A;  4Y3O A;  3M3E A;  4Q29 A;  5H9P A;  5F2W A;  4DMI A;  2Y64 A;  3HNY M;  4LMF A;  5K0U C;  5FYM A;  2BRT A;  4FQZ A;  4BZ4 A;  2R04 2;  5A6Z A;  2W95 A;  2AGS A;  5FY7 A;  3IT8 A;  4XBQ A;  3VHR A;  3PJQ A;  3HT2 A;  1I5P A;  5BXX A;  1YQ8 A;  1F15 A;  3BI3 A;  1XPW A;  2GN3 A;  5FFO C;  5IVV A;  4AI0 A;  5KXE A;  2JE9 A;  2ZOE B;  4CCN A;  3AVR A;  5IFT A;  4YW1 A;  5JLV A;  3HNB M;  1V6J A;  1W3V A;  1HW5 A;  2G9F A;  2OW4 A;  3N4M A;  1HRI 3;  4LHK A;  3ZXD A;  4ASK A;  2JKX A;  1JW6 A;  4TYS A;  4R8H A;  3ZFE B;  1X9P A;  4FPK A;  5CU1 A;  3SKJ E;  2J7M A;  4QGM A;  1AYM 1;  1EV1 3;  1VBD 1;  1WWY A;  2B46 X;  3FFQ A;  3LB9 A;  5A70 A;  5C3S A;  1KQR A;  2XJP A;  4EN0 A;  2GC1 A;  1R09 2;  4GWI A;  1SZB A;  2YDE A;  4IE6 A;  4QAW A;  5J36 A;  3VBH C;  1RXG A;  5FR3 A;  1W6O B;  4AW7 A;  2P3Y A;  4S2F A;  4K3U A;  1IOA A;  1S2E A;  2WA4 A;  3DKQ A;  4Q4X 2;  5HCH A;  2ZBJ A;  5A3N A;  5IVC A;  1C8N A;  1GZ9 A;  1Z78 A;  4IV3 B;  3PMS A;  1PIV 3;  4RL7 A;  5JZG A;  3T0D A;  2WLP A;  1RJ8 A;  2JG8 B;  3FC0 A;  4WM8 A;  5BNQ A;  2QBX A;  1RUF 3;  4N90 A;  4L99 A;  1GFF 2;  4GKY A;  5JPM B;  2XQX A;  1EUT A;  2L9L A;  5JSR A;  4JKM A;  3VZM A;  4CCK A;  2P6C A;  5E89 A;  4Q4V 3;  1HRI 1;  5B2G B;  1FNY A;  4I01 A;  5JIA A;  4XJW A;  4DNY A;  4P08 A;  3D82 A;  5FQ0 B;  2CAU A;  1PZ8 A;  1EV1 1;  2BBA A;  3ZVX A;  2JDU A;  4OHX A;  4RQP C;  1LTE A;  3LA3 A;  1YFY A;  1NY7 1;  2VZO A;  2WQ8 A;  1GQH A;  1NE4 A;  3H1W A;  4N9I A;  1SLB A;  2R1D A;  2ZKL A;  1BK0 A;  4Q0S A;  4R4Z A;  4ZPI A;  4QQH A;  2E26 A;  2ZAB A;  2UWB A;  1V6N A;  3RDI A;  1IS5 A;  1ULE A;  1ND2 A;  2P4E A;  1UD1 A;  1FV2 A;  1HN1 A;  3IZO A;  3I59 A;  5LEK A;  1F8V A;  3HN1 A;  3ACG A;  3AMH A;  3RZJ A;  1PIV 1;  1Y43 B;  3CMG A;  2GDF A;  1MEC 2;  1GV9 A;  4AE2 A;  1EPW A;  2X5I C;  3NJV A;  2H0V A;  3T2P A;  4NMI A;  1AR9 1;  2QDN A;  5FZ7 A;  2K2S A;  3T0B A;  3ZKY A;  2XVK A;  1KDM A;  1UZZ A;  5EWS A;  3V65 A;  3DXT A;  1H8T C;  5T52 A;  1PGW 2;  1OI6 A;  3AKS A;  4YGB A;  1X8E A;  1HQN A;  2YC2 A;  3WP3 A;  3WDV A;  3AKR A;  3UGG A;  4CDW A;  4FFH A;  4XET A;  4B4Q A;  2HEW F;  3SIS A;  1COV 1;  1AHS A;  3H0O A;  3KQR A;  1RMU 1;  3GBW A;  1YJL A;  2WFF 2;  3A23 A;  3OOX A;  3WHT A;  2MHF A;  1HIX A;  4DPN A;  3M3I A;  2ZGT A;  1RC6 A;  3CJI C;  3IDA A;  1AXZ A;  4ISQ A;  5APA A;  4YWA A;  5BNN A;  3V0B B;  2HWB 1;  5JR7 B;  2R49 A;  4MGS A;  2DTW A;  1MQT B;  1PK6 B;  4XMI A;  1DCS A;  3CZJ A;  4NPL A;  1VBC 3;  4QQ2 A;  4FOW A;  1T6B X;  3LEI A;  5GM0 A;  1D0H A;  4LBK A;  5DUV A;  3ASI A;  1H1A A;  3ALQ A;  4P14 A;  4XW3 A;  4MXW B;  4YZ2 A;  4EWD A;  3BCW A;  1LEN A;  3Q8B A;  4QQO A;  5L7O C;  2FHR A;  3H42 B;  3H8U A;  1IKP A;  1BJQ A;  3EBR A;  5F39 A;  3KT7 A;  5HXM A;  1S0F A;  5FKB A;  3LPG A;  2ZGK A;  3PLQ A;  3ZN4 A;  2BWC A;  4NHK A;  5L36 A;  1OH3 A;  1H9P A;  1LOF A;  3N7J A;  1C8M 3;  1Y4W A;  1W6Q B;  1POV 0;  1E5I A;  3WXP A;  2RJ2 A;  3GJB A;  4LQR A;  1D7P M;  2VZQ A;  4F3J A;  3W21 A;  3WW2 A;  1XC6 A;  3A22 A;  1E5H A;  4N53 B;  1YJK A;  3C7G A;  3PUI A;  3VDB A;  1F2N A;  4AQS A;  3TEY A;  1UAI A;  1VRB A;  1LUL A;  3ZFF C;  4MUV A;  4LBO A;  2HYK A;  4H55 A;  1VBC 1;  1W6P A;  2V4A A;  4E2Q A;  3ZFG B;  1AYN 2;  2FDG A;  1IQD C;  4EN6 B;  4QX1 A;  3AP5 A;  2D5H A;  3LE0 A;  4QB1 A;  3AJY A;  4K9S A;  4HPK B;  1BBT 3;  2Q1M A;  2W3J A;  3S5Q A;  2ARB A;  4JGY A;  4RSU A;  3EJK A;  1GOH A;  4F83 A;  4XCA A;  4P9Y A;  3GDB A;  3FHA A;  5FP7 A;  4AVV A;  5FYI A;  4YGD A;  1W2A X;  4X8P A;  3SMH A;  1C8M 1;  1DGW X;  2PXJ A;  2VZ1 A;  4YYO A;  4AVS A;  4CP0 A;  3J7M A;  2JD4 A;  1UY1 A;  4CCE A;  1CAW B;  2ZX2 A;  4IE5 A;  4YZ3 A;  2B9U A;  5C8C A;  5DAV A;  2PQQ A;  4M3C E;  4FTB A;  1AF9 A;  5AFE A;  2J1E A;  4LBL A;  2ZMN A;  4O9G A;  3NQH A;  3I3D A;  1GUI A;  4LO6 B;  4CYD A;  3LFI A;  3SIT A;  2J42 A;  4UFL A;  4AFM A;  3PL0 A;  2SLI A;  4D94 A;  2ID4 A;  4KWK A;  1XSQ A;  1YEW A;  3TNQ A;  3VL9 A;  2EID A;  4A44 A;  1TVG A;  2PHW A;  4BQ2 A;  5FUI A;  5LK7 B;  4GWJ A;  1VBA 2;  2VUC A;  3THP A;  2X29 A;  4IEV A;  2OS2 A;  1BBT 1;  1JUH A;  2BNM A;  4XDP A;  4W4Z A;  3BGA A;  2LUW A;  4PDW C;  1OPM A;  3AYC A;  3M4F A;  3MBW A;  3U07 A;  3H1Y A;  1BYH A;  2W5F A;  1OOP A;  2WNU B;  4Y1Y A;  3V0A B;  3IWZ A;  4Y5T A;  5GLV A;  4AR2 A;  5A7W A;  3VUO A;  3S7E A;  3UJQ A;  2RS1 2;  3BIE A;  4BK5 A;  1N1Y A;  5F5Q A;  3M2M A;  5C3Q A;  5LK5 A;  1EUU A;  3ZIX A;  5FXX A;  4GD4 A;  1ASJ 2;  1QY4 A;  4JAA A;  2ZX3 A;  4LHS A;  1KFX L;  4ZS3 A;  3WZ1 A;  2CL2 A;  4TLF A;  4K21 A;  4AL9 A;  5FZB A;  3VV1 A;  1NT0 A;  3B02 A;  3O1T A;  1XE8 A;  2E7A A;  4S2G A;  3WIN E;  5ANN A;  1DF0 A;  1IGO A;  1LED A;  3G7D A;  3I3E A;  4YVW B;  3LEM A;  2F4P A;  3KF3 A;  3VBU A;  3AFG A;  4P9G A;  2XML A;  5FY0 A;  1IG3 A;  3ZOI A;  3W59 A;  3T08 A;  3LIG A;  3E5U A;  4IEO A;  4PJY A;  3VHN A;  2EIC A;  3WDX A;  2VW1 A;  2GC0 A;  2VW2 A;  3WQ7 A;  2QQJ A;  4WM7 A;  4JRL A;  5IT6 A;  4MGK E;  5FPZ A;  3U4S A;  5FRA A;  2PTM A;  4GWN A;  2BWA A;  1ST8 A;  2VR4 A;  3LEG A;  3W9A A;  2G9Z A;  4ATE A;  4CE8 A;  2P1B A;  1AZD A;  2BVB A;  5EYY A;  4X6R B;  4QU2 A;  4NUB A;  2C9A A;  4D6Q A;  2BNO A;  4WM8 C;  3I7D A;  4QU1 A;  1UY3 A;  1POV 1;  3GBF A;  2QZ2 A;  5JXJ A;  3MIC A;  2YU2 A;  4BIF A;  1RUH 2;  2PHU A;  1MS0 A;  3HOB A;  1O3R A;  1LB2 A;  1MS4 A;  4ITC A;  1W03 A;  3OBA A;  2UY9 A;  3CZU A;  3ZSE A;  1UW8 A;  1AR8 1;  2HWE 3;  2JIC A;  3JD7 2;  1TEI A;  4RR3 A;  2DF7 A;  4WVM A;  2FDK A;  3TEX A;  3I49 A;  3DUI A;  5GZC A;  2RMU 2;  1AR6 2;  2IXC A;  3ON7 A;  1PZ9 A;  4D7T A;  3BU0 A;  1BQP A;  3I2D A;  3SKV A;  3DXU A;  1J1L A;  2PMW B;  3PVE A;  2WS9 2;  3BN6 A;  3RYP A;  2EIE A;  3WQ0 A;  4K1Z A;  3VD5 A;  1VB4 A;  2DUP A;  3Q8C A;  3GCX A;  4Z82 A;  2D3R A;  1GZC A;  2DDU A;  3N35 A;  3GYD A;  1H2M A;  3KGZ A;  4GAZ A;  3E5X A;  1LJ7 A;  1WUV A;  4NIA A;  1PNG A;  2RS5 2;  4NPR A;  1QJY 2;  3QH6 A;  3TYJ A;  4AVB A;  4YM1 A;  4OYU A;  2FD8 A;  2YFU A;  3C2U A;  1QJU 3;  3O12 A;  5FP8 A;  5LRR A;  1FAT A;  2VZV A;  4QPG C;  1OD5 A;  4OI1 A;  3E1F 1;  1RUI 2;  3M70 A;  5FMO L;  2VNV A;  3WCS A;  4LHL A;  5JXI A;  1JBC A;  3H8R A;  1IS3 A;  3PVO A;  4EN9 B;  5FK8 A;  2BUK A;  3VDD B;  2FDI A;  4UW4 A;  3MGU A;  2UU8 A;  2W2I A;  3MYX A;  2QQM A;  1XYN A;  5IUQ A;  1K42 A;  1D2S A;  2HWE 1;  2CDP A;  1YQC A;  4WZF A;  1RJ7 A;  4FPY A;  4NII A;  3IAP A;  2JB4 A;  1J58 A;  4PI0 A;  4XF9 A;  5JAX A;  4NR1 A;  5EIY B;  3WCR A;  3KMH A;  3K4A A;  4Q4Y 3;  4AHX A;  1O7F A;  2CDO A;  2DV9 A;  4XAB A;  1ULD A;  4LJH A;  2I74 A;  4GH4 B;  1OVP A;  1W8U A;  5DAB A;  4BH9 A;  4NPM A;  5GLT A;  1ZRC A;  5A6Y A;  3E6B A;  3MW4 A;  3K4Z A;  3WF4 A;  4CTE A;  3JXS A;  2WWJ A;  4Y1U A;  1UY2 A;  4A42 A;  2JDN A;  4E4H A;  5HCF A;  4BLJ A;  1C5I A;  1PGS A;  1L3J A;  2ARE A;  2CU5 A;  5LBE A;  3RI9 A;  5CKN A;  4AXO A;  2ZXQ A;  4CA9 A;  1URX A;  5CEH A;  3VKN A;  1WD3 A;  1XXN A;  3E97 A;  1V6K A;  3N9Q A;  2OT7 A;  2D6K A;  2RHP A;  2QQN A;  1CWP A;  3EQE A;  4LKF A;  4Q4Y 1;  4N8M A;  4LPL A;  4CEW B;  1LOF C;  5JR2 A;  2GAU A;  1CQ9 A;  4QGN A;  3P3N A;  1AL0 G;  4M00 A;  2BFU L;  3OBZ A;  1U12 A;  1YI9 A;  1W9T A;  2AEY A;  3I3Q A;  4ARX A;  2PHX A;  1KD7 A;  3WUD A;  4LIU A;  2J1A A;  3TN9 3;  2IWG B;  2OII A;  2JX9 A;  2YB7 A;  2IXK A;  3DN7 A;  1BEV 3;  4D3W A;  5C3O A;  4EJR A;  2QTW B;  3D5O A;  2RM2 3;  3ZR6 A;  4CDQ B;  1LU2 A;  4QPI C;  1OKQ A;  2JIJ A;  1ZRD A;  3SCF A;  5LWB A;  2DVD A;  2XJR A;  3FWE A;  3WOG A;  5CBL A;  1GZW B;  3HQX A;  4AHW A;  4E9K A;  3K3O A;  1MPX A;  4ASM B;  3W5N A;  2ZML A;  1AVB A;  2YXS A;  4IE4 A;  1N3P A;  2YYO A;  4CPB D;  2ZEY A;  1RHI 3;  5LY2 A;  2YY1 A;  3S6P A;  1SFN A;  1A3K A;  3BB6 A;  2QCS B;  5I0D A;  2H0B A;  5C8C C;  5ABJ A;  1W2O A;  3CEW A;  1Y3T A;  4ZHN A;  3NRU A;  5FY9 A;  2X09 A;  1YLL A;  3MHZ A;  4E4S A;  4XBN A;  2C0Z A;  3AB0 A;  4Y4R A;  1O5U A;  4HKW A;  3TN9 1;  3OYW A;  4CU7 A;  1BEV 1;  3OGJ A;  4XVH A;  4IE7 A;  4ES9 A;  2RM2 1;  2W92 A;  4JDM A;  1JYI A;  2JDK A;  5IVJ A;  4Y5S A;  1YQ5 A;  2HWF 2;  1H6X A;  4FI9 A;  4DS0 A;  4RS5 C;  4AI9 A;  1YQ2 A;  1B35 C;  1GAN A;  2ZGQ A;  5FZA A;  4M3C F;  1DYO A;  1CIW A;  1SAC A;  1QGL A;  4OUS A;  2VG9 A;  4QWN A;  4YGE A;  4CP9 A;  4KU7 A;  2OKX A;  4BME A;  1NA1 A;  4O65 A;  1W8Z A;  1OOP C;  1RUE 2;  2VY0 A;  3LA2 A;  2ZGL A;  3LDR A;  3S7I A;  4E8D A;  1XJA A;  3BPZ A;  4XYX A;  5FOB B;  2WAO A;  4NID A;  2DCZ A;  4W8J A;  4Z2A A;  2HWD 3;  4Z8B A;  1OVS A;  2BOJ A;  3IMN A;  2PLV 2;  4NAM A;  4PF1 A;  4JV4 A;  3V56 A;  2BGC A;  3T30 A;  2JDM A;  1ZZB A;  1J3Q A;  3ME2 A;  4BK4 A;  1O3S A;  1W8N A;  1VBE 3;  2BER A;  4RGK A;  2E6V A;  4BQY A;  2XJQ A;  1OXC A;  3ZN6 A;  5TSW A;  5KBF A;  4MAD A;  3I54 A;  1ODM A;  2JWP A;  2WWS A;  5FLI A;  1ZYB A;  4XPV A;  3X29 B;  4CU8 A;  4YZ5 A;  4E2S A;  2N7G A;  3N9O A;  5FBZ A;  2DUQ A;  5F5A A;  1WLT A;  2ADE A;  1HJG A;  1EY2 A;  1RXF A;  1CX4 A;  1NX9 A;  1U5X A;  1WZX A;  2YC0 A;  3D6E A;  4V2W A;  1VAK A;  5JOX A;  3WG3 A;  2ETE A;  2IXL A;  1OLM A;  2JG9 B;  2XKP A;  1QOT A;  3D8C A;  2VL4 A;  3OY8 B;  1Y7B A;  2JE7 A;  4YM2 A;  2VZR A;  2FDF A;  4QX3 A;  3R6S A;  5JVV A;  4ZU7 A;  1WCD J;  2A3Y A;  5BV6 A;  5LA0 A;  1UQX A;  3AYD A;  3VBH A;  1W28 A;  1NLS A;  3UKT A;  1GNZ A;  2VZT A;  4E4Z A;  2QUO A;  3WDT A;  4IES A;  1QJX 1;  3OBT A;  4U36 A;  4M3C B;  3WW1 A;  3PTY A;  3WD5 A;  1VBE 1;  2PEL A;  5EZW A;  4Y22 A;  4XUO A;  2DCK A;  2PAM A;  4B1L A;  4CP1 A;  1X50 A;  2W39 A;  2EAA A;  2WNV A;  2ENR A;  3VBO B;  2P5B A;  3BU7 A;  3N36 A;  4QB6 A;  3ZDV A;  1F4H A;  2IXH A;  4RR3 C;  5CFC B;  1WA4 A;  5F3I A;  2VTX A;  2VQA A;  4XUT A;  1WCU A;  5KXC A;  1RUO A;  1DQ4 A;  3T4H B;  3VKO A;  2RE9 A;  4FOV A;  3MO4 A;  3IPV B;  4BIS A;  4EWE A;  4YW2 A;  4ASL A;  2UWA A;  4OI0 A;  1YC6 1;  4Z1V A;  3RZZ A;  4RQP A;  4TWT A;  1Q5O A;  3W5M A;  1YYN A;  2QQL A;  3Q8E A;  4K40 A;  1UY4 A;  4OI2 A;  5EPA A;  5FLH A;  5JSP A;  2YV8 A;  5DAW A;  1SG3 A;  4HZF A;  3MZH A;  1S0I A;  2PHL A;  4FTE A;  1RYY A;  1D4M 2;  5T54 A;  4MGI E;  1V6L A;  1VLN A;  4BQ3 A;  3JBG 3;  3OPZ A;  2ZGM A;  2Y6J A;  2DWR A;  1FOD 2;  4LOS A;  4MLO A;  4CEY B;  5JXG A;  5CNA A;  3U37 A;  2VVF A;  3HMY A;  3KV4 A;  4LNV A;  2VTX J;  3VZL A;  2VOK A;  2VOX A;  4BB3 A;  2Y6H A;  1H2K A;  3UET A;  2I2S A;  1ZBE 2;  5T5J A;  3AZY A;  5HXV A;  5FP4 A;  4CCJ A;  1JH5 A;  4ONU A;  1Q8P A;  4JC1 A;  3RMX A;  3PJY A;  1H8T A;  1MZE A;  5H9Q A;  2P2K A;  4LKS A;  1HLC A;  4K8R B;  1UN1 A;  2W87 A;  4IXL A;  4FOQ A;  2VMC A;  3UKV A;  2Q8E A;  5C5U A;  5C33 A;  2VUL A;  1UNB A;  2XB6 C;  1TMF 2;  2GSY A;  1WBL A;  2BV4 A;  2ZGN A;  4C1W A;  5J48 A;  4NHM A;  2WBK A;  5ACA 2;  5F6K A;  4IEZ A;  5FZ6 A;  1AL2 3;  3EXU A;  3WNK A;  4GB3 1;  2ZTN A;  4XTP A;  1UXZ A;  3LKJ A;  3LZZ A;  4U2A A;  3CJI A;  1HXS 3;  5I8S A;  5LZ6 A;  3JBG 1;  1CX1 A;  5I0U A;  3ENR A;  3TNP B;  4JGZ A;  4A45 A;  1H1I A;  1RUD 1;  1RVF 3;  1XOY A;  2TBV A;  3RNS A;  3VBS B;  2IVJ A;  5L9B A;  5A1L A;  2LTN A;  5AVP A;  4AAX A;  2X53 S;  2BFU S;  4NHY A;  4UT5 A;  2XBO 1;  3WG1 A;  3KZ4 C;  3NJX A;  4H7M A;  3SCG A;  1UX6 A;  1VMH A;  2GNB A;  2K46 A;  4LOR A;  5DQ0 A;  1CAX B;  5F6L B;  2Y38 A;  5BPX A;  1MS8 A;  4CXX A;  2W68 A;  4XFA A;  3OTF A;  2PHR A;  1YO8 A;  5DUU A;  4BM8 A;  1BXH A;  1Y9M A;  3I2O A;  1R08 2;  1ALY A;  1QQP 2;  1PMJ X;  3WF0 A;  3NW4 A;  4G9S B;  3BTY A;  1OD3 A;  1GWL A;  5AC9 3;  4JQR A;  1ENS A;  1YIF A;  2C1F A;  3M8L A;  3OEA A;  5GZF A;  1AL2 1;  1GQG A;  3THT A;  5K4L A;  2PA7 A;  2IXJ A;  3AKP A;  2R0H A;  3W20 A;  1HXS 1;  3ACH A;  1MZF A;  4F7Z A;  4YW3 A;  4CDU A;  1NCQ B;  3GBG A;  4TXW A;  5IW0 A;  4OI4 A;  3ZFF A;  4IUG A;  3ZXG A;  4E2G A;  5I8T A;  5KC5 A;  4M0N A;  1A78 A;  2CHH A;  1UY0 A;  4P9I A;  1M06 G;  3KV9 A;  2JKB A;  4I3P A;  1UYY A;  1JMU B;  3WF1 A;  1ND3 B;  1CPN A;  2ADD A;  3WG2 A;  5A3T A;  4URT A;  4AED C;  5CFD B;  1X82 A;  4YW6 A;  3WY6 A;  1ULO A;  3LGR A;  1TQ5 A;  2FQP A;  2GME A;  2GZW A;  1SFP A;  4YAR A;  2ARA A;  5DPN A;  5A1F A;  3GM8 A;  4ZY9 A;  1W8F A;  4OHV A;  5AC9 1;  2ZAH A;  2TUN A;  4FFF A;  4I0W B;  5ABJ C;  5H9S A;  1JI6 A;  1O4T A;  4HKL A;  1BK1 A;  1GKB A;  1XBF A;  3VKF C;  4CUG A;  4PIX A;  4E27 A;  1UL9 A;  4QXH A;  1OF4 A;  4HSL A;  4YG6 A;  1O3T A;  4UW6 A;  1BMV 2;  5KXB A;  1WGP A;  1REE A;  1DIW A;  2UY8 A;  5GKA C;  3RG0 A;  3ZYF A;  2QVS B;  3DKW A;  3FBM A;  3PVN A;  3FJS A;  4LK7 A;  1MS1 A;  4B1M A;  3JB4 C;  3CHX A;  1G9F A;  4PCR A;  1M4W A;  1DLL A;  1C1F A;  3AMM A;  4XFB A;  4BQW A;  4Q8L A;  3RYR A;  2FCU A;  1NA1 C;  4HON A;  4XDQ A;  2GMM A;  1TZO A;  1O6U A;  3MV0 1;  4I02 A;  2V72 A;  5J37 A;  1FMD 2;  3RRD A;  5E6H A;  1HX6 A;  2YBP A;  4MXV A;  1AYM 3;  1VBD 3;  2E51 A;  1N47 A;  4LO4 B;  2O8O A;  1KGY A;  3NST A;  2VQU A;  3A7Q A;  3FZ3 A;  3Q8F A;  4PIY A;  2R04 3;  2VUD A;  1UMI A;  1QOS A;  5EV7 A;  2GP3 A;  1UZW A;  1UPI A;  2YBS A;  4OUM A;  1Y9Q A;  1NQJ A;  4J25 A;  5T55 A;  4NWW A;  5JZG B;  3R05 A;  2XPJ A;  3AP9 A;  3RZG A;  4P02 B;  2VBP A;  2VUJ A;  1US2 A;  3O14 A;  4TN7 A;  5FY1 A;  1QJE A;  2YU1 A;  3NAP B;  3AP6 A;  3NJY A;  4ISR A;  4XXP A;  3QH7 A;  3CDZ B;  4XOG A;  4YVS A;  2E9Q A;  2C9K A;  2HKX A;  3T2T A;  5D8A A;  2Z79 A;  4SLI A;  3C7O A;  5L9R A;  2ZAA A;  3AJZ A;  4JKK A;  3WNO A;  3VBF B;  2TNF A;  1NCR A;  4HMZ A;  4C90 A;  3UJO A;  2EA7 A;  5A7Q A;  3UYJ A;  2GH8 A;  2LS6 A;  3KHB A;  1DQ1 A;  2MEV 2;  4IV1 C;  1R09 3;  3SH4 A;  3ZN5 A;  2Y6L A;  1L7L A;  1OUR A;  5DXD A;  1DYP A;  1Z0H A;  2KM2 A;  2Y60 A;  2R04 1;  2B8M A;  1LOC A;  2WT1 A;  5GZE A;  4Q4X 3;  1AX1 A;  3C7F A;  1ND2 B;  4EWA A;  2RJK A;  4ATF A;  1ULC A;  5F5C A;  3PDQ A;  1A8M A;  3K46 A;  1CZS A;  1V0A A;  1W9Y A;  4KL1 A;  4AQ6 A;  1QDC A;  4FOY A;  4PLM A;  2ZGR A;  2WSU A;  1VBB 2;  2WNV C;  5BNO A;  4SBV A;  1UYZ A;  4UI9 L;  1Y9G A;  4MGZ E;  4QPY A;  3HBZ A;  1VRH 2;  1SDD B;  3ZXL A;  1JYN A;  1AR9 3;  3M3C A;  5BNP C;  4ET7 A;  4CVU A;  4XZU G;  3VLB B;  1UIK A;  5LA2 A;  2ZGS A;  5C9A C;  1W6N A;  3LQC A;  4UBH A;  3U78 A;  3WUC A;  4CDW B;  1PO2 2;  4LBQ B;  1R09 1;  4QHB A;  1TG7 A;  3CJX A;  2XLA A;  4OZX A;  3WNL A;  1P8J A;  1DU3 D;  4AEJ A;  5BNN B;  1JOB A;  4XEZ A;  3J9S A;  4MYE A;  4Q4X 1;  1COV 3;  3OJB A;  1RMU 3;  5JMO A;  2EXH A;  2RVA A;  5JSO A;  5K9Y A;  2YBK A;  3USS A;  4XMA A;  3POS A;  3J7L A;  2AR6 A;  2HWB 3;  4KI5 M;  3M1H A;  5GLU A;  1LGB A;  2ZHK A;  4LA2 A;  5FZF A;  2VNG A;  2A73 B;  1XU2 A;  2QQW A;  4Q4W 2;  3HAG A;  4KH9 A;  1RUF 2;  3S0M A;  4QPG A;  4CXY A;  3FX3 A;  1CVN A;  1SPP B;  1NOV A;  2ZGP A;  1U5Y A;  1DQ6 A;  3NNG A;  4AVT A;  3GHM A;  4LBM A;  4MO3 M;  4HVQ A;  1W8H A;  3B9C A;  4KNC A;  3KCY A;  1JHN A;  3FUQ A;  1LGC A;  2XG3 A;  1Q8Q A;  1W9F A;  2JEN A;  2YPD A;  5LB6 A;  1PM7 A;  2E32 A;  4URA A;  2WFF 3;  1JYC A;  5IVF A;  3ZYB A;  1K5J A;  4AGR A;  3I2J A;  1IPS A;  3HBK A;  5LBB A;  1O3Q A;  3PVB B;  5C3P A;  4KU8 A;  1YIP A;  2J1T A;  2NN8 A;  5L9V A;  2GH2 A;  1K5M B;  4JRA A;  1W6P B;  4AOC A;  2AZ5 A;  3M7A A;  2VH9 A;  3ZMO A;  4JGZ C;  1MEC 1;  1VP6 A;  1W05 A;  3PME A;  4IV3 A;  5A32 B;  4CCO A;  5FYT A;  1UOF A;  1OHF A;  1QOO A;  3KWV A;  4Y20 A;  5BUV A;  2ZEX A;  3KV6 A;  2XVL A;  4X6Q B;  1OLM E;  1PGW 1;  1OFN A;  4ZU5 A;  1ZBA 2;  2VMG A;  4JGY B;  3SC7 X;  1PO1 2;  4CUB A;  1PVC 2;  3MUZ 1;  4JKL A;  1XNK A;  4AFA A;  1Q56 A;  2A75 A;  5FY5 A;  3U1X A;  3OUH A;  2V09 A;  1HKD A;  2QFE A;  2DU1 A;  3B94 A;  3FN9 A;  4HXC A;  3POJ A;  3POB A;  2WFF 1;  4GQ7 A;  4BJ0 A;  2I45 A;  3O1S A;  2BOI A;  5FWE A;  3MUY 1;  3MIE A;  3HEI A;  2JDY A;  4HT1 T;  4RHV 2;  1D4V B;  4HLT A;  2W1Q A;  3O0V A;  5JIU A;  3WHU A;  1WD4 A;  4XHX A;  4ZXE A;  4D8M A;  4R9B A;  3WX5 A;  3VN4 A;  2LAL A;  5IWF A;  1AYN 3;  4CDU C;  5IK7 A;  3DF0 A;  4G3Y C;  1SLI A;  1CJD A;  3HIF A;  3ZO0 B;  5CIS A;  2NM1 A;  3CIH A;  5JI9 A;  2EAL A;  2LW8 A;  2VZS A;  3CLP A;  1BLZ A;  4LKD A;  4A3X A;  4QPI A;  1LAJ A;  4XTM A;  3R4D B;  5HCB A;  4AQT A;  5HBA A;  3KB5 A;  3CO2 A;  3GGL A;  3K75 B;  3S57 A;  1WCQ A;  4QKN A;  4NRO A;  3B7M A;  3AMN A;  4BOW A;  5A7W B;  3VZK A;  1UYX A;  2FDH A;  1CR7 A;  3HWJ A;  4QX2 A;  3H7J A;  5F5I A;  2ZAC A;  5KHK A;  1YNA A;  4QKB A;  3WDW A;  1HRV 2;  1FPN 2;  1SBD A;  3FLT A;  3NV4 A;  2DUR A;  1QMJ A;  2O0O A;  3LPF A;  2FMD A;  4C0B A;  2VVE A;  4YGC A;  1KXG A;  3V0B A;  1CON A;  1OQ1 A;  4DXR A;  4I09 A;  4AF9 A;  4BHP A;  1AYN 1;  1C57 A;  2B45 X;  5GAL A;  2XL7 A;  2R07 2;  2VU9 A;  3WDU A;  4HAN A;  4D6R A;  2G1M A;  2FMY A;  5BY5 A;  4RYD A;  3E6D A;  1DP0 A;  2R16 A;  2W9X A;  2WO1 A;  3MV1 1;  3VBU B;  3B01 A;  5B4N A;  1VAL A;  1WLC A;  3KHC A;  3MFA A;  1ENX A;  2E63 A;  5F3E A;  2NLR A;  4RS5 A;  2DFC A;  4J6G A;  1H9W A;  1B35 A;  3DGT A;  1RUG 2;  4OLL A;  3AMQ A;  2WII B;  1ONA A;  4WM7 B;  5FPA A;  1SEF A;  2VXR A;  4EQV A;  2R30 A;  3AYE A;  3D0S A;  1H8V A;  1MS3 A;  1XU1 A;  4LXL A;  2VCB A;  1DFQ A;  2JD9 A;  4MHU A;  1NG0 A;  4EN7 B;  3MF9 A;  5FTT C;  2JEM A;  1ASJ 3;  2ZX4 A;  4UOJ A;  5CIR A;  4CU9 A;  1F4A A;  1B09 A;  1CAV A;  4QGL A;  4N53 A;  4H14 A;  3OCP A;  1PGL 2;  4AG4 A;  1ENQ A;  2Y0O A;  1UMH A;  2A70 A;  1JHJ A;  4UF0 B;  4YVS C;  5FXW A;  1NYW A;  2DUO A;  3TEW A;  5D8A C;  5C7G A;  3VD4 A;  1VBA 1;  4IEQ A;  4O9E A;  1POV 3;  3GAL A;  3KSC A;  3DPR C;  3MW3 A;  3AFK A;  2WO3 A;  3WW4 A;  1NCR C;  5FZI A;  4MGQ A;  4IQP A;  5IJR A;  3ZXK A;  1AR8 3;  3N3H A;  4CDX B;  2EXK A;  5FZ1 A;  4AGG A;  2RS1 1;  1H4G A;  4LBQ D;  3P5B A;  5C5T A;  4A7Z A;  3VB9 A;  5IK5 A;  3PTR B;  2D98 A;  4LK6 A;  3UV9 A;  4COU A;  1KRI A;  3RMY A;  1I1E A;  5C4W C;  2A6W A;  1GOG A;  1ASJ 1;  2XR4 A;  4M01 A;  5FO8 B;  4XUQ A;  3LFM A;  2XJT A;  5T5L A;  4LOT A;  2QQP A;  1Z7S 2;  1WW7 A;  3POI A;  3O5S A;  2TEP A;  5CKM A;  1CD3 G;  1NE6 A;  5FUP A;  2A6Z A;  5F2S A;  5FZG A;  2DBI A;  5JPN B;  5A33 B;  5BNO C;  4DY5 A;  3ZYH A;  3HD8 B;  3JD7 3;  3R4U A;  3VD7 A;  1XE0 A;  2RMU 3;  2WZR 2;  1AR6 3;  3I2G A;  4TLG A;  5LA9 A;  1GP5 A;  4DZG A;  3JQW A;  2P6H A;  3GZA A;  4CPB A;  2YMZ A;  2ZGU A;  3POG A;  2WJS A;  4AGV A;  1E5S A;  2WNU A;  2WS9 3;  1ACC A;  1W0N A;  1L7R A;  5FZE A;  1FYU A;  5JCT A;  4C1X A;  4PQQ A;  5DDJ 2;  2JDZ A;  2VEC A;  1OPO A;  2RS5 3;  2VZ3 A;  1QJY 3;  4DIQ A;  4I2O A;  2QQK A;  5E88 A;  3KM5 A;  3AMP A;  2DCT A;  4NN0 A;  1AR7 2;  4LBN A;  3ACI A;  4JVA A;  3H3Z A;  4QD2 A;  1RUH 1;  3HJR A;  1YI7 A;  4NWV A;  4A4A A;  4Q5O A;  4FPO B;  5FKC A;  2ZGO A;  4FFG A;  3JD7 1;  3DYM A;  2PQS A;  2RDQ A;  5I93 A;  2QE3 A;  4YVW A;  4JCK A;  1D0G A;  3KVA A;  3PHM A;  2GNM A;  3RS6 A;  2RMU 1;  3WNN A;  1AR6 1;  1EPZ A;  5C71 A;  5JOW A;  3ZFE C;  4ZKT B;  3PU3 A;  3VBR B;  1JZ3 A;  4BQ5 A;  1ZRR A;  2AYH A;  2WS9 1;  1VMF A;  4GUL A;  1JOP A;  4A7K A;  2WT2 A;  4O61 A;  4P9J A;  4RFT 0;  2WDB A;  4P9X A;  5BYN A;  2W94 A;  1RL3 A;  1G9C A;  2G4I A;  3J26 N;  3K3N A;  4NRQ A;  2E33 A;  2IVI B;  3VD9 A;  1F31 A;  2RS5 1;  3OUI A;  1QJY 1;  4K7J A;  3R4S A;  3RYK A;  1V70 A;  1GWK A;  4GMP 0;  2RV9 A;  3B3Q E;  3RZH A;  4ARY A;  1RUI 1;  4XIL A;  5IAX A;  2ARX A;  2ZEW A;  4JDO A;  1UIJ A;  2JB8 A;  4IV3 C;  2A5Z A;  1QJU 2;  2Y26 A;  1RUC 2;  1TNR A;  2JG8 C;  5FK7 A;  4W65 A;  3KVB A;  3MPB A;  2GND A;  1V6O A;  1W9S A;  5AVA A;  3ZXE A;  2Z4F A;  4Y1Z A;  2XGX A;  2AC1 A;  4LO5 B;  3VD3 A;  3UK9 A;  2C4X A;  1ZVF A;  1ZA4 A;  4L92 A;  1RIN A;  4QHZ A;  3ES1 A;  1W6M A;  3UNP A;  1SFY A;  2E7Q A;  1LEM A;  4PBO A;  3WP6 A;  3G6J B;  3ZDS A;  4QX5 A;  1LHW A;  1NXD 1;  3I3M A;  4D0Q A;  4I0A A;  4CRQ A;  2IZW A;  1U5I A;  2OPK A;  1ULG A;  3RJR A;  2R06 2;  3OYW B; 
#chains in the Genus database with same CATH homology
 5JXG A;  1KEX A;  3U37 A;  2VTF A;  2JKX A;  5LA1 A;  1BHG A;  2VZP A;  3SKJ E;  2J7M A;  5C70 A;  2Y6H A;  3UET A;  5EJZ B;  1GU3 A;  4GWI A;  5JXH A;  4QAW A;  4LKS A;  2W87 A;  2VMC A;  1NAE A;  2WBK A;  3T0D A;  3HPN A;  3A21 A;  2QBX A;  3WNK A;  2WN3 A;  3J7H A;  1UXZ A;  3WEZ A;  3ABZ A;  1CX1 A;  2XQX A;  2BGO A;  1EUT A;  2L9L A;  4HG6 B;  1SHW B;  4A45 A;  4JKM A;  4AAX A;  4P00 B;  3VDC A;  1UX7 A;  4P08 A;  3NJX A;  1JZ6 A;  2BBA A;  2VC9 A;  4ZZ5 A;  5DQ0 A;  1JYW A;  1UZ0 A;  1XNT A;  2VZO A;  2WQ8 A;  1NKG A;  2JDA A;  2J1S A;  2E26 A;  2W1U A;  4OZO A;  4QPW A;  1PMJ X;  3WF0 A;  1OD3 A;  1HN1 A;  2VCC A;  3ACG A;  3OEA A;  3ZM8 A;  3CMG A;  3NJV A;  3T2P A;  3T0B A;  3ACH A;  1ULP A;  3K4D A;  4TXW A;  4IUG A;  3F2Z A;  3OGV A;  2YC2 A;  1UY0 A;  1W99 A;  1UYY A;  3WF1 A;  3I97 A;  1GNY A;  3WNP A;  4A41 A;  1ULO A;  3A23 A;  5DPN A;  3IDA A;  4JX0 A;  3GM8 A;  1UWW A;  2E31 A;  3C7E A;  4ZY9 A;  4DEQ A;  4MGS A;  1JI6 A;  4JHZ A;  3ETP A;  3CZJ A;  1JZ4 A;  4XUN A;  3LEI A;  3P1I A;  1OF4 A;  3HNM A;  2BGP A;  4DUW A;  3OG2 A;  3T2Q A;  3DYO A;  4KMQ A;  4OUE A;  4A3Z A;  2X10 A;  2W1W A;  5HXM A;  5IYY A;  2C26 A;  3DEC A;  3LPG A;  2ORZ A;  1JZ5 A;  2RJ2 A;  3MV0 1;  2V72 A;  1D7P M;  2VZQ A;  4LQR A;  3WF3 A;  3WNM A;  3I2H A;  1XC6 A;  3A22 A;  4UAP A;  3C7G A;  3PUI A;  1KGY A;  3VDB A;  2VQU A;  3A7Q A;  1OT5 A;  1UMI A;  2XHN A;  1US3 A;  5LCW L;  1T2X A;  1IQD C;  1J83 A;  4P02 B;  4CUA A;  1US2 A;  4QX1 A;  3I2F A;  3OGR A;  3CDZ B;  3LE0 A;  4QB1 A;  4QDR A;  2J1V A;  1GMM A;  2C9K A;  2W3J A;  1JYV A;  1GOH A;  4BDV B;  3C7O A;  3FL7 A;  3PUH A;  3GDB A;  3FHA A;  4JKK A;  2WUH A;  3WNO A;  5F7U A;  2EIB A;  2LS6 A;  2VZ1 A;  4QDS A;  1UY1 A;  4XUP A;  3OB8 A;  2Y6L A;  2J1E A;  3NQH A;  3I3D A;  3D3A A;  1GUI A;  3C7F A;  5IHR A;  2ID4 A;  3K46 A;  1CZS A;  2EID A;  4A44 A;  1L7Q A;  4M4R A;  1TVG A;  2WN2 A;  5FUI A;  4GWJ A;  2KD7 A;  2W47 A;  4M4P A;  3BGA A;  4W4Z A;  1W8O A;  1UYZ A;  1GQP A;  3IB3 A;  3MBW A;  4UI9 L;  2W5F A;  2VOT A;  5HPO A;  1JYN A;  1SDD B;  3CKH A;  5JUV A;  4ET7 A;  4CVU A;  4XZU G;  5LA2 A;  3LQC A;  2QQO A;  1J84 A;  4BK5 A;  1TG7 A;  1PX3 A;  1EUU A;  3WNL A;  1P8J A;  2BZD A;  4L0P A;  3I2K A;  4LHS A;  4TTG A;  5JMO A;  4ZZ8 A;  2RVA A;  3SEE A;  5CZK A;  1GOF A;  4KI5 M;  3I3E A;  2W46 A;  1XNA A;  4OMD A;  3P6B A;  4DXS A;  5IFP A;  1O8P A;  3T08 A;  1CIY A;  2B4K A;  1K45 A;  2EIC A;  3NNG A;  4MO3 M;  2VJX A;  2QQJ A;  4DUX A;  4OMC A;  2WZ8 A;  3UES A;  2E32 A;  2VR4 A;  3LEG A;  3I2J A;  3OEB A;  3I3B A;  4XUR A;  5EJ1 B;  1JZ8 A;  2ZEZ A;  2J1T A;  1UY3 A;  4PT6 A;  5JXJ A;  2VMF A;  3HOB A;  3OBA A;  3CZU A;  4RN5 A;  3T0A A;  2ZEX A;  4CUB A;  2Y6K A;  3MUZ 1;  4JKL A;  3SKV A;  3C7H A;  5DN2 A;  3BN6 A;  1O59 A;  2EIE A;  5G04 L;  3VD5 A;  1DLC A;  3FN9 A;  2DDU A;  2ORX A;  3I2I A;  4BJ0 A;  2Y8K A;  3MUY 1;  3THD A;  3HEI A;  4OYU A;  2YFU A;  2W1Q A;  1W9W A;  2VZV A;  2X05 A;  5JXI A;  3E1F 1;  4ZXE A;  4D8M A;  2VCA A;  2VME A;  2J1U A;  2QQM A;  5G05 L;  1K42 A;  2VM9 A;  2W91 A;  2CDP A;  3CIH A;  1JYX A;  2LW8 A;  2VZS A;  3IAP A;  5EIY B;  3GGL A;  3K4A A;  3K75 B;  3OGS A;  1WCQ A;  2CDO A;  3EYP A;  5A1A A;  3C8X A;  1UYX A;  2VMD A;  4QX2 A;  2W1S A;  2J1R A;  3K4Z A;  3WF4 A;  2YG0 A;  3JXS A;  2QQI A;  4DXT A;  3LPF A;  1UY2 A;  4A42 A;  1JZ7 A;  1OH4 A;  1CZV A;  4DXR A;  3WQB A;  3DYP A;  1O8S A;  4A6O A;  2ZXQ A;  4RYD A;  1DP0 A;  2W9X A;  2WO1 A;  3MV1 1;  1PX4 A;  2Y6G A;  5B4N A;  2R7E B;  2QQN A;  2JE8 A;  4LPL A;  3HN3 A;  5JR2 A;  1NUK A;  3VDA A;  1W9T A;  4CUC A;  4ARX A;  4MOA A;  2J1A A;  2J22 A;  2YB7 A;  5J1X A;  2VCB A;  2JD9 A;  4UOJ A;  4P5Y A;  4CU9 A;  5DMY A;  1CZT A;  1F4A A;  2WO2 A;  2XOM A;  4AG4 A;  1UMH A;  3T2O A;  3THC A;  1JHJ A;  2VO5 A;  1LNS A;  5C7G A;  1MPX A;  3VD4 A;  3W5N A;  2XON A;  2WO3 A;  2ZEY A;  4MGQ A;  5IJR A;  1JU3 A;  2B9V A;  5I0D A;  3NRU A;  2X09 A;  5CYY A;  2YFZ A;  4CU7 A;  4XVH A;  1GOG A;  3LEK A;  3FHQ A;  2W92 A;  4XUQ A;  1H6X A;  4FI9 A;  1PMH X;  1YQ2 A;  3K77 A;  2V5D A;  1K12 A;  3AC0 A;  2VQT A;  1DYO A;  2V4V A;  2OKX A;  2WAA A;  4QB2 A;  1JU4 A;  3VD7 A;  4E8D A;  3I2G A;  3CQO A;  4QX0 A;  2WAO A;  3GXU A;  4W8J A;  4Z2A A;  1W0N A;  4GZ9 A;  1K3I A;  2HLE A;  4PF1 A;  1L7R A;  4BXS V;  2VZU A;  4W50 A;  1R64 A;  4PQQ A;  3ECQ A;  4BK4 A;  2VZ3 A;  1W8N A;  2BER A;  2DCJ A;  2QQK A;  2WAB A;  2YC4 A;  4MAD A;  3ACI A;  1JZ2 A;  1H6Y A;  4CU8 A;  3HJR A;  4DUV A;  4KWU A;  4A4A A;  4CU6 A;  3IAQ A;  3DYM A;  2PQS A;  1NX9 A;  4DEV A;  4E8C A;  3EB7 A;  3WNN A;  5C71 A;  2VL4 A;  3T09 A;  2VZR A;  4QX3 A;  1JZ3 A;  3ACF A;  5LA0 A;  2WZE A;  3SEP A;  2WDB A;  4YPJ A;  2VZT A;  2W94 A;  3VD9 A;  2E33 A;  2HYX A;  1UXX X;  4XUO A;  2RV9 A;  2DCK A;  1OF3 A;  3III A;  4ARY A;  2ZEW A;  3WSO A;  4QB6 A;  5B4X A;  1F4H A;  2WYS A;  1W9S A;  4XUT A;  2Y64 A;  3HNY M;  2Z4F A;  3VD3 A;  3MO4 A;  2W95 A;  2C4X A;  1I5P A;  3W5M A;  1XPW A;  2QQL A;  3UNP A;  1UY4 A;  1WKY A;  1SG3 A;  4QDQ A;  4D0Q A;  5IFT A;  3WF2 A;  1RYY A;  3HNB M;  2Y6J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...