2OUJA

The crystal structure of the thrombospondin-1 n-terminal domain in complex with fractionated heparin dp8
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
204
structure length
204
Chain Sequence
SVFDIFELTGAARKGSGRRLVKGPDPSSPAFRIEDANLIPPVPDDKFQDLVDAVRTEKGFLLLASLRQMKKTRGTLLALERKDHSGQVFSVVSNGKAGTLDLSLTVQGKQHVVSVEEALLATGQWKSITLFVQEDRAQLYIDCEKMENAELDVPIQSVFTRDLASIARLRIAKGGVNDNFQGVLQNVRFVFGTTPEDILRNKGC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Thrombospondin-1
publication title Heparin-induced cis- and trans-Dimerization Modes of the Thrombospondin-1 N-terminal Domain.
pubmed doi rcsb
source organism Homo sapiens
total genus 52
structure length 204
sequence length 204
ec nomenclature
pdb deposition date 2007-02-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2oujA00
3OYWA 1WCSA 2R49A 1SLTA 2C5DA 3M3EA 1LU1A 3PVEA 2A6WA 4P9WA 4UW6A 1CPNA 4FPJA 5IUQA 5HCAA 1F5FA 5KXEA 2D3PA 1BZWA 2AR6A 1FV2A 3T1MA 4LBMA 1LOFA 3C2UA 4YM2A 2ARXA 4Y1VA 3ATGA 1GKBA 2D44A 3OPZA 4FPFA 1MS4A 4R9DA 2DU0A 4U2AA 1DQ4A 3WDYA 1LENA 1LU2A 2JKBA 4YM0A 2RHPA 3OBRA 4ATEA 2GMPA 2LTNA 3PMEA 2DVBA 1R1ZA 3U4XA 5E8AA 4BMBA 3AP5A 1VAVA 3IN9A 1G86A 3OJBA 4YLZA 5CNAA 3WNXA 1LGBA 1JW6A 1Q8PA 4YZ5A 1C4RA 5F5QA 2A6VA 1WBLA 1MVQA 4LBOA 1KDKA 3N7LA 4PCRA 1H9PA 4XTPA 3ZXFA 2ZHLA 4Y1YA 1G9BA 3O0VA 1DQ5A 3AYAA 1UZZA 1JN2P 4XIOA 4XHBA 1QOOA 2WKKA 1YRZA 4SLIA 5T54A 1JUIA 1N47A 1Q8VA 1D0HA 1MVEA 2V73A 2YMZA 4XMIA 4AGGA 1G9FA 2A7AA 2PHRA 4Q1PA 5T5LA 1MS0A 1GLHA 1W6PB 2HYKA 2ENRA 5DZFA 2JJ6A 5BYNA 3AYDA 1SCSA 3M1HA 2WT2A 2ZMLA 3SH4A 3N7KA 1KRIA 1LULA 3O5SA 3AK0A 3O0XA 4XJ9A 1KQRA 1FV3A 4FPHA 4XILA 1DBNA 4XJ8A 4FOWA 5DG1A 1X50A 1G8WA 2GNTA 4FPGA 3ILNA 5HCFA 1W6PA 5T52A 1IS4A 4AGVA 1GNZA 2NN8A 2TEPA 4DQAA 1C1LA 1QF3A 5T50A 1Z78A 1BYHA 2A6YA 1PZ8A 3DUIA 4PBPA 4LBKA 4YG3A 3NV3A 1LGCA 4FQ4A 5FRAA 5GJ6A 2CWSA 5H9RA 1LGNA 2DYCA 1IS5A 5EYYA 1YI7A 2DVDA 1NXD1 1GZ9A 3HR9A 2H0BA 2LALA 3FLRA 3A0NA 1LOBA 1MS1A 4M00A 5SV8A 2DVGA 4CZSA 1GZWA 5IK7A 2P2KA 1ULCA 2R0FA 1VLNA 3ILRA 4PF5A 5DZEA 4RA0A 2B7YA 4DFSA 1FYUA 2SBAA 3IKWA 1S0IA 4ITCA 2D6NA 3MW2A 4GWNA 3SITA 1QNWA 4P9XA 3MW3A 1VAMA 2XB6C 2KM2A 5KXCA 2EF6A 4Q8LA 3V65A 4ATFA 3I4IA 4YW3A 4M3CB 3KQRA 5LK5A 4XTMA 4GALA 2R1DA 2W52A 4YZ1A 2D6KA 1ENQA 4XE9A 1CVNA 2E7QA 5JOZA 2ZBJA 3AYCA 2G4IA 3PJQA 4OZXA 1F9KA 2FHRA 2YV8A 1W6OB 4GWMA 4M3CE 3NV4A 4HANA 1F31A 2A6ZA 4BMEA 1S1AA 4XBLA 3RG0A 1GSLA 5IT6A 2A3XA 4XMAA 1V6JA 1G7YA 2WSUA 3HMYA 1FNYA 5H9SA 3RMXA 1W6MB 4YGBA 4FOQA 4K1ZA 4YGDA 5DUUA 1RITA 2ZGLA 3B01A 1O4YA 1V6NA 1C1FA 1WD3A 4R9BA 3W58A 4FP2A 4GKYA 2ZHNA 4L8QA 4XJAA 5AVAA 3WDWA 3WV6A 3WDUA 2AENA 2NZ9A 4FOYA 1LCLA 1LODA 4BM8A 4FP3A 2YROA 2OUHA 1LTEA 2ZGKA 1ULGA 3LSEA 1UMZA 4YW2A 5EWSA 2GMMA 1DQ1A 4ISRA 1ULEA 4Y22A 5GLUA 1GICA 1WLDA 2UWBA 3MW4A 1V6KA 3AXEA 4YW1A 2YZ4A 2DU1A 4C1XA 1JOJA 4WZFA 1MZ6A 1OQ1A 2ES3A 1WUVA 1JYCA 2P3IA 3WCSA 3POYA 1ULFA 2PHWA 3FLTA 1QNYA 3VV1A 1N1TA 1QOSA 2D3RA 3M3CA 1DZQA 4YZ4A 1G9AA 2C9AA 1Q8QA 4UW3A 1I1EA 1AF9A 1ONAA 1AXYA 4XIKA 1AXZA 3SH3A 4AVSA 1BJQA 4RL7A 1W6NA 2DTWA 3SISA 3OGGA 2ZGOA 3QCWA 3RSJA 5JOXA 2ZMKA 3WUDA 1QDOA 3LCPA 2GN7A 4YG6A 4C1WA 4Q27A 4F83A 2EIGA 2ZGRA 1G9CA 3AZYA 3HN1A 5EXOA 2I2SA 1YO8A 2DV9A 3N3HA 5H9QA 3WDXA 1G9DA 2AH2A 3SH5A 3SLIA 2ZGQA 3DGTA 1CPMA 2D7FA 3M3QA 5DUXA 2VUAA 5T55A 1Z0HA 3ZXKA 3AJZA 1MACA 2P3KA 2W68A 5GZCA 4BLIA 1C57A 1W0PA 1LHUA 1LOGA 1S0DA 4XYXA 3ZYRA 2ERFA 3IM0A 1LHNA 3POWA 4GKXA 4KBBA 4NO4A 4DRVA 1J1TA 1WW6A 1UAIA 1MS5A 2EALA 3WVJA 1D2SA 3KM5A 3VKNA 4HL0A 1AX0A 3TAYA 1QGLA 3RS6A 3IPVA 3VKFC 1DQ6A 3WG4A 3B00A 1JXNA 1ENRA 5GLVA 1GV9A 5KXBA 5GZEA 4ISQA 4CRQA 2ZGPA 1GYKA 3WG1A 3A0KA 3CNAA 4W65A 3QLQA 4FQZA 1OFSA 4XBNA 1V6IA 2SLIA 1U0AA 1CONA 3WZ1A 4DRRA 1S0JA 1N3OA 2D6MA 2YXSA 4WV8A 2ZKNA 3APBA 3V0BA 1MR5A 2JE9A 1Q8SA 1Q56A 1QU0A 4YW4A 1MS9A 1GZWB 3WUCA 1EPWA 5CB7A 3RMYA 3L2YA 3O0WA 4XBQA 3LSDA 1ZA4A 1DHKB 2R1BA 3AP4A 4LBNA 3V0AA 1QDCA 2VXRA 4XXAA 3NV1A 1W6QA 3T2TA 4Y26A 5GZGA 4BQ1A 4YFWA 3B3QE 3D6EA 1Y7BA 1AX1A 4I30A 2FMDA 4FPLA 1XQNA 1I3HA 3WOGA 2VW1A 1URXA 2ZGMA 3AP7A 2D6OX 3BODA 4MYEA 1MZ5A 2AUYA 5L73A 1BXHA 4LBQA 2UURA 4AGRA 3ILFA 3V64A 4M3CF 2E7TA 3M3OA 3W59A 2GALA 1GZCA 2WSVA 1CIWA 2JDZA 2PHUA 2WJSA 3ZSMA 1QOTA 5DUVA 2ZMNA 3M2MA 2GDFA 1GANA 2UWAA 3ASIA 4H55A 2WNEA 1AXKA 1LEDA 1DIWA 3RRDA 1AJKA 1LOEA 3N7MA 3UK9A 2A70A 1JHNA 4AWDA 4ZKTB 2CYFA 3BIWE 4XXPA 1O4ZA 2A75A 2D43A 1LJ7A 1N1SA 3WDTA 2ZGNA 1DFQA 1YIFA 5F9TA 2OVUA 3FUQA 3POSA 4YG0A 4Y22B 5CBLA 1VIWB 2ZZJA 4YM3A 1SLAA 3INAA 5GLWA 1IOAA 1DQ0A 3ZPYA 4FPEA 2WT1A 1FATA 3OY8A 1LECA 1AJOA 1KJRA 1IS3A 4P14A 4R9AA 4YFZA 2CY6A 5DUWA 4FPOB 3ZSKA 5KXDA 3AZVA 2EXKA 1UPSA 4K21A 1UN1A 1WW7A 3WHTA 1W6NB 5DG2A 1ENSA 1QMJA 5JDBA 1S0EA 1S0BA 2PHXA 3AZXA 1GBGA 4M01A 4K1YA 5JOYA 3GNEA 4AVVA 1SLBA 5CA6A 3USUA 4U36A 5GALA 4JC1A 4DPNA 1WW5A 3O12A 4R9CA 2V5YA 1UL9A 1S0FA 2R0HA 2JD4A 2VU9A 2NP0A 4XJZA 2D6PA 1S0GA 3PVOA 5JMCA 1UZYA 2A71A 3AXDA 5GLTA 1IKPA 1CQ9A 3AP9A 1LOCA 3BTAA 4UW4A 2R16A 2DUPA 1HDKA 2ZACA 3Q9OA 3WG2A 1JYIA 1BQPA 4BPZA 4JCKA 2Q5TA 4YW5A 4XOGA 2ZGUA 1KDMA 3B9CA 5T5PA 4PQ9A 1APNA 4FPCA 1H9WA 1SBFA 4FPKA 4ZXKA 1CR7A 1PZ9A 5JLVA 3IPVB 1LOFC 3H0OA 3I8TA 4XDQA 1PZ7A 2E53A 2A6XA 2AGSA 4K20A 3VKMA 3R05A 2EXIA 3AP6A 5JOWA 1WW4A 1HKDA 1KJLA 1A8DA 1HQLA 4Z8BA 2EAKA 1SLLA 1DQ2A 3NV2A 2DWRA 4PBOA 2UWCA 4FOVA 1DLLA 5IK5A 2A3WA 2GNDA 1SLIA 2WQZC 2ARBA 3T1LA 3OBTA 2EXHA 2ZHKA 3PVNA 4GXLA 3V0BB 1HLCA 4JRAA 3N35A 1LESA 3D5OA 4BLJA 3RQ0A 2VH9A 5T5OA 4UW5A 2DURA 1IS6A 1N3QA 2ZGSA 2A3YA 4XHXA 2VY0A 5FREA 1IKQA 3V0AB 3ZXEA 1WBFA 1W6QB 2A5ZA 2AYHA 1LHVA 2W39A 4FVVA 4Y24A 3R4UA 1SACA 1YXWA 3TB0A 4NOTA 5GM0A 4IQPA 1RIRA 1ULDA 1LOAA 1V6OA 2D6LX 2DUQA 2P34A 1DYPA 3UL2A 5GZDA 5CAZA 4WVVA 3IMNA 3MEPA 4LBQB 5H9PA 5HCBA 3ZXLA 1V00A 1B09A 1N3PA 4ASMB 4AVTA 1WD4A 3D4KA 3N7JA 4YM1A 4Y20B 1CJPA 4YGCA 1RINA 2E51A 4TZDA 1SBDA 4Q26A 2VW0A 2NMOA 3NWKA 1WLCA 2OUJA 5E89A 1GNHA 3AFKA 2ZAAA 1SCRA 1FX5A 3A4UA 5GZFA 2PELA 3FBYA 4Q2FA 2NMNA 1WLWA 2P3JA 2JECA 3MPPG 4Y20A 3UJQA 1QKQA 4YGEA 3VKLA 1AZDA 1N1YA 1NLSA 1A78A 1LHOA 2DVAA 2XG3A 2JE7A 4DS0A 4TYSA 1SLCA 1AVBA 3WDVA 3ZVXA 1CESA 2GNMA 2CTVA 1CN1A 2ZHMA 1JBCA 3JUUA 3VKOA 4GA9A 3FFZA 1HQWA 5DZGA 4XJUA 4LBLA 2WT0A 2CWMA 1UKGA 3AX4A 3OY8B 2PHFA 2PHTA 3ZXJA 2GNBA 2GMEA 5DXDA 1UX6A 2DTYA 1V6LA 1VALA 1LEMA 3AYEA 1N1VA 2VW2A 3WLUA 3AZZA 4P9YA 4CTEA 2D3SA 3UJOA 1MS3A 3R4SA 1FNZA 3WCRA 3AJYA 2AREA 1KITA 3SNMA 3WG3A 3ENRA 3USUB 1DYKA 2NM1A 4Y1UA 2W08A 3VUOA 2EXJA 4YZ3A 4Q8KA 3GALA 1V6MA 4Y1ZA 4XZPA 5E88A 3WHUA 1W0OA 2CNAA 1S0CA 5GLZA 3ZSJA 1LHWA 2E6VA 2CL2A 4AYUA 4BOWA 1DGLA 4M3CA 1MS8A 1A3KA 5EYXA 4YZ2A 1OKQA 3FLPA 1AX2A 2P37A 5IK8A 4Y1XA 2UU8A 2ZABA 2ZA9A 1W6OA 1BKZA 3FUOA 3ZYPA 1SFYA 2YY1A 2ZGTA 3AZWA 2DVFA 1Q8OA 2NYYA 2Z42A 3OYWB 5IK4A 3BOPA 4XJWA 3JU9A 2GN3A 1H30A 1W6MA 4FPYA 5T5JA 1FAYA 3B69A 3N36A 1SBEA 1TEIA 3ZSLA 2BQPA 2OW4A 1ZM1A 5JVVA 1YYNA 4WVWA 4D69A 4LBQD 2DUOA 4LBJA 2WLQA 4Q1RA
chains in the Genus database with same CATH superfamily
4F3JA 3RJ2X 3G6JB 2V4VA 4C91A 4NAMA 1W3VA 4AQTA 3T30A 5A7OA 4MGQA 2W1QA 4D6SA 2VVFA 4FPJA 1ASJ1 2XJQA 4Y5Z0 3ON7A 1ZRRA 3K77A 5AFBA 2XPJA 2VD7A 4MHRA 1BZWA 1KEXA 1FV2A 3T1MA 1GNYA 3J9SA 4LBMA 5LASA 3CBNA 5CFCC 3UGFA 3C2UA 2Y6GA 1E5RA 5CISA 5HI0A 3MLLA 3ATGA 5FYUA 3SC7X 2BBAA 2Z5WA 3Q8BA 2DU0A 4MH0E 1K12A 1LENA 5ABJC 2ID4A 5D1IA 4OYUA 4FO9A 3NW4A 1UZ0A 4ATEA 2JG9A 1W2NA 5FUNA 2VE1A 1LKNA 2WUHA 3LGRA 1MEC3 4N43B 5EPAA 4ASKA 5FZ6A 4QPYA 2KXLA 3AP5A 1AL23 3NNJA 5A7PA 3IN9A 4BMBA 2BPA2 4EN6B 1G86A 5JR2A 1RMU3 3ALQA 4O9EA 4QB2A 2ARAA 3FFQA 4P9GA 4UAPA 3EO6A 5E1RA 1COV2 3WW1A 1MVQA 4PCRA 1KDKA 2DCKA 3N7LA 4LHSA 3ZXFA 1GP6A 1UOJA 5A6YA 2XJSA 3LD8A 4H7LA 5JMOA 5LW9A 2YU2A 4QQPA 3UESA 4XZUG 5ERLA 3LIGA 4KQ7A 3O1SA 3KV6A 1YQ8A 2PHRA 1QH6A 2A7AA 4X6RB 2QJVA 4MX3A 4AFCA 1RUG2 3LE0A 2I45A 4UWDA 2B45X 1DP0A 2ENRA 3FWEA 1FPN1 1SCSA 3M1HA 5D8AC 1XU1A 2WO2A 3AMHA 1X8MA 1AR81 1LULA 2XBO3 4Y33A 4XJ9A 5C3QA 1KQRA 5G04L 2MNGA 5DG1A 1W8UA 4FOWA 1X50A 4E4ZA 2BTVC 4FPGA 3A22A 3ILNA 4F7ZA 4XF0A 1HRV2 5JZGA 4IEZA 1GNZA 2B5HA 3CJIB 4DQAA 1ULOA 2WR9A 1LR5A 4PBPA 4YG3A 1PZ8A 5T50A 3U11A 3KT7A 3KGLA 5FRAA 1LGCA 2DBIA 4FQ4A 5LRRA 1CAWB 3MO4A 4CP2A 1YI7A 5FUPA 1NXD1 1GZ9A 1OPOA 1XSQA 5FO8B 4AQ6A 3NJYA 4N7UA 4QPWA 3A0NA 4M00A 3P3PA 3B9IA 5LA0A 2LUWA 2P1BA 2DVGA 4CU9A 1SPPB 4RQPC 4CZSA 5FZ1A 2YHJA 3POGA 5FKCA 1ULCA 2V4AA 1VLNA 5J7MA 1WGPA 1JYTA 1TME3 3I2JA 2VTXA 3MUY1 1RXFA 3JD71 2FDIA 5FMDA 1IHMA 4OHYA 5A7WB 4R52A 1UF2C 3EXUA 4WZCA 1QQP3 4CSWA 1K3IA 5BNNA 3M4FA 2JIJA 2RM22 5KBFA 3J7LA 1R081 5EJZB 5C4WB 3NMBA 2Q30A 2XLGA 3WP3A 5K0UB 4OHWA 5AC92 4XTMA 2R6QA 1NA1C 1QH7A 4YSFA 4TLGA 2FHRA 1W6OB 5A7QA 2RR11 2VOVA 3NV4A 2WYFA 4CUBA 2Z4FA 1VAKA 1YC61 1NXMA 2RG4A 1Y9GA 4CXXA 4UFJA 2OQ6A 4FSJA 3OD0A 4S2HA 1OBNA 1G7YA 1V6JA 1V9U3 3C7GA 1PX4A 3GBGA 2KR2A 1NE6A 1W9TA 4AEKA 5A3PA 4FOQA 1RUH3 4K1ZA 4YGDA 3ZFFA 4AI2A 2JDPA 1NQDA 5I93A 4R9BA 1WD3A 4Q0PA 4FP2A 1L7QA 1RHI3 4GKYA 2PQSA 1HB2A 4OI2A 2ZHNA 4L8QA 2VUDA 3LEIA 1W2UA 5AVAA 4CUCA 3WV6A 4BQYA 4CUAA 2NZ9A 1VJ2A 1LCLA 1LODA 4I01A 1W0NA 4LKEA 4CDWA 4CDXC 1LTEA 4BYYA 5IVEA 2GMMA 1DQ1A 2UWBA 1W8HA 1E5SA 1QXPA 2E63A 4GMP3 4LEJA 4YW1A 5FY7A 2JG8B 2ORZA 4BU2A 2YZ4A 5CFDB 4P5YA 1R093 2PAKA 2VQTA 5CYYA 3MF9A 4CDQC 4LKDA 5C5UA 5KHIA 1Y9MA 3FLTA 2PHDA 2Q8DA 1QNYA 1W8OA 3VV1A 2D3RA 1QOSA 2ORXA 1U5IA 1DZQA 4QDQA 1Z7S1 5EJ1B 1Q8QA 5K4LA 2VOTA 4PIYA 5CZKA 3T0DA 1W6NA 5K8SA 3OGGA 3WW2A 4CCMA 2ZGOA 3J7NA 3RSJA 2ZMKA 3ECQA 3N9MA 5FPAA 4C1WA 4F83A 2JICA 4Q27A 2GAUA 4B4PA 1E57A 1G9CA 3H8XA 3AZYA 4DXSA 4Z1VA 5H9QA 1W8NA 2WFF1 3M70A 1XC6A 2ZGQA 4QQLA 5FP4A 4E27A 4EZHA 3OOXA 4C0BA 2VUAA 3JXSA 3LDKA 5T55A 3OPTA 3B94A 1Z0HA 3ZXKA 5JCTA 4CDUB 2OX0A 3CJXA 1A6CA 1AYM1 2Q8OA 3AKQA 1MACA 4Q0UA 2W68A 1TMF2 2XL7A 4Q4V3 2AEZA 3O1OA 1EAH2 2YC4A 4XURA 4M4RA 1XNTA 3GHNA 1LHNA 2PHLA 3WD5A 4KBBA 4QKFA 1FT9A 2RS51 3WVJA 4DZGA 4JKMA 4HL0A 3TAYA 3LZZA 3IPVA 4E4HA 5K7PA 4I09A 2LRPA 1GMMA 1JXNA 1ENRA 3UKTA 1GV9A 2OA2A 4JDOA 1PX3A 2HJIA 4LA3A 3O1PA 1JHJA 5FY5A 2FDJA 4KG0A 4Q0VA 5IHRA 4CRQA 3WG1A 2TUNA 1PO23 3E97A 3QLQA 1IQAA 3JBG2 1H8TB 1V6IA 4A6SA 1U0AA 2JDUA 4XACA 1PMHX 1HJGA 1UY3A 1SZBA 3TN91 4N43C 2DCTA 2YXSA 5FJKA 3S0MA 1AYN2 3APBA 3KLSA 5DAXA 2HWC2 3VDDB 2WAOA 3J8F3 3V0BA 3MLJA 5FMBA 5FZ9A 2HEYF 1Q8SA 1Q56A 2JE9A 1UOGA 1MS9A 4YW4A 1GZWB 5ACA1 5CB7A 1EPZA 4Q4X3 1OOPB 3O0WA 4LPLA 4I0AA 1VBC1 1J83A 2HWD1 1DHKB 3WNNA 1POV3 4EV0A 3V0AA 4GH4A 1QDCA 4I3PA 4XXAA 4IW3A 1QJX2 4Y26A 4BQ1A 1AX1A 4IV3B 1SFNA 4FPLA 4PIZA 3H3ZA 5APAA 5FPBA 3MGUA 2ZGMA 4KWKA 2IXIA 3W21A 3AP7A 2D6OX 2YGMA 1SQ4A 2WZPP 1CAXB 5L73A 4COVA 1XNKA 1YFWA 1YFXA 3V64A 4BQ5A 1UYYA 2QQIA 5BNPA 4BISA 4GB33 5FXZA 3PHMA 1CIWA 4CCCA 1E5HA 2PHUA 2VO5A 5L7OB 1JZ6A 1Y4WA 1WLTA 3CJIC 5C9AA 1DDLA 4NROA 5F3IA 4WVMA 2ZMNA 4H55A 3ASIA 2UWAA 2ZTNA 2WWUA 1AXKA 1LEDA 3VD4A 2YU1A 4DO0A 1RUI1 2VQ0A 1AJKA 1RUD1 1GP4A 4A42A 3PTRB 2A70A 5FPXA 4A6OA 1VBD3 1LJ7A 3WDTA 4HXCA 1UD1A 3SMHA 1DFQA 2OVUA 4CUGA 4Y22B 1IQDC 1HIXA 4RGKA 4TN7A 2RJLA 4SBVA 5LBCA 4YM3A 4HSLA 4HVRA 2WFPA 1IOAA 3DYMA 1RUG3 4AAPA 3ZXGA 1AJOA 4M4PA 2WABA 3U4SA 5JXJA 1OSGA 2CY6A 3CIHA 3T4VA 4PT6A 3EQEA 2J22A 5C4WC 4AEDC 5FYTA 1VMJA 4M0NA 4PI0A 3RZKA 4E2QA 5DG2A 3JB4C 3W9AA 4M01A 3S57A 3TNPB 4K1YA 5IVBA 5KHHA 3KSCA 3EYPA 5JXIA 1J3QA 2QQUA 4JC1A 4BWOA 1B35B 3VHOA 3PUQA 2C1FA 1GP5A 2IUWA 4YVSA 1IGOA 3E6CC 1H2NA 2J1SA 2XJPA 4QX5A 5C8CA 2XVKA 4NRMA 5DAPA 5FO9B 2BP6A 3K4ZA 1BK0A 2NP0A 4CXYA 1O8PA 1S0GA 1XPWA 3PVOA 5JMCA 2A71A 3AXDA 5A3UA 3MPBA 2RJ2A 4LLFA 3WP5A 1CQ9A 3AP9A 1LOCA 2XQXA 1R64A 1HDKA 1BBT1 3H1YA 1RUJ2 4LIUA 4JVAA 2WS91 2K2SA 5FZ7A 3WG2A 5BNOB 2BYVE 2ZX3A 4JCKA 3ES1A 4KU8A 4YW5A 3N9OA 4XOGA 2ZGUA 5T5PA 1HB1A 1H8VA 3OEBA 1APNA 1GU3A 2ZXQA 4FFHA 2FDHA 2HLEA 2RM23 2VZ3A 4IE7A 3BU0A 1LOFC 5CFDC 3RZGA 3I8TA 1YQ6A 1PZ7A 2E53A 5AC93 4Y5TA 2AGSA 4DIQA 5JPMB 5A6XA 5FV3A 4KWJA 4AHYA 4BQ2A 2W46A 5I0DA 4CEWB 2VMFA 4Z82A 3SCFA 4BQ3A 2ZEZA 4QDSA 1JH5A 3NV2A 2DWRA 4GIQA 3ZIXA 2BEOA 5A1AA 2X05A 2JDMA 4AZZA 2GNDA 1VBE1 3KCXA 1SLIA 2CV6A 2QUOA 2WQZC 1G6NA 2ARBA 2QDRA 3PUIA 4C90A 4GXLA 4JKLA 5EZWA 5LCWL 3D5OA 1ND3B 2RMU3 2WWSA 4JGZC 3FX3A 2WNUA 4QMAA 3LA2A 5T5OA 4ZPIA 3RZHA 3THCA 3KF3A 2DURA 5FZOA 1CAUB 2HWB2 2ZGSA 4Z92B 2B4KA 3U78A 1WBFA 2A5ZA 2AYHA 2W39A 1EV11 3R4UA 1SACA 3TB0A 1BMV2 5GM0A 4FFIA 3UL2A 1YHFA 1RJ7A 2YPJA 4NWVA 2JB8A 4WVVA 5HCBA 4AW7A 2F4PA 1EP0A 4P9IA 2QKDA 4GWJA 4ASMB 4B4RA 5EQUA 1XYNA 1WD4A 4QPIB 1RVF1 3C8XA 4YM1A 1WMFA 3AMQA 3N9PA 1AR72 1CJPA 4RHV2 4Y20B 3T2QA 4TZDA 3P1IA 4PLMA 4HVOA 5JAXA 2OUJA 3I59B 3NAPA 4QWNA 4DUVA 3RZLA 1ZBA3 3ZKUA 2HEVF 5C3SA 2JX9A 4K7JA 5G05L 4DNYA 1FMD2 2IXLA 4NPRA 4P00B 4Q2FA 3T2PA 1JZ3A 2P3JA 3DKWA 3UJQA 1AZDA 1N1YA 1O4TA 1ND2C 4MGTA 5FPZA 5JPNB 5FP3A 2PLV2 2JE7A 4S2GA 3CF6E 4DS0A 4B4QA 1SLCA 3ZVXA 2WO3A 1CESA 1CN1A 1J3RA 4JGYA 2XXZA 3JUUA 3BCWA 3FFZA 4B7EA 3OPWA 1Q43A 1TMF3 4ET7A 1OA3A 3OY8B 2PHFA 2PHTA 3J7MA 4YVWA 3ZXJA 4EWEA 5A3WA 2QBXA 5A6ZA 1VALA 5IJRA 4DEVA 5A1LA 2ADEA 1N1VA 4G4FA 3WLUA 3AZZA 1PO12 4IGPA 1S55A 4P9YA 1X82A 4PDWB 1UMIA 4NPLA 2JKXA 2JWPA 3R4SA 1OURA 2OQ7A 2VPVA 5F2SA 3AJYA 5A32B 3WG3A 3ENRA 3LB9A 4XF1A 2W08A 1XNAA 2DF7A 3JBG3 3RFRA 5E88A 5LA9A 3IDEA 1BEV1 3UNPA 2CL2A 5FY8A 4H2AA 2VG9A 4M3CA 2HWC3 1X7NA 3PUSA 1RUNA 3KHCA 3WINE 2RS11 2ZABA 3GJAA 1F15A 2R30A 1BKZA 3ZYPA 1D0GA 3VBOB 4HT1T 2DVFA 3FBMA 2Z42A 3GXUA 2N7GA 2FMYA 4UFIA 3VBUA 4GZ9A 4XJWA 1ODMA 3B02A 1YUDA 1QHDA 5IVCA 1ZBE2 1J84A 1OF4A 3B69A 3M3IA 1QJX3 4IEUA 1K5MA 2OW4A 2W5FA 5FZLA 2X5IC 3RGBA 5J09A 1YYNA 4D69A 1T2XA 4LULA 1L3JA 3O12A 1HRI1 2XONA 3OYWA 3ZFGA 1PK6C 2R49A 4LE4A 1RUOA 4RR3C 3FHQA 3M3EA 4K3UA 4DXZA 1PK6A 3THDA 1QXJA 4P9WA 4UW6A 3OD4A 1KD7A 1CPNA 1POQA 3KWVA 5IUQA 5LY2A 4CU8A 2WZR1 3CO2A 5KXEA 1Y9QA 2D3PA 3E1F1 3FJSA 3MYXA 1T6BX 2AR6A 2JG9B 2VMIA 4IEQA 4EJRA 2KA3A 3JQWA 5JIAA 3OB8A 4TSVA 3GBFA 1B35C 3OPZA 1REDA 4CCKA 5DDJ1 1C8M2 1PIV1 4WM8B 4YM0A 3CEWA 4L11A 1A8MA 3OBRA 4MGIE 2GMPA 3PMEA 5ANNA 4DXTA 4N8MA 3WY6A 2VBBA 3LEKA 1PVXA 1UU4A 1VR3A 3MI8A 3U4XA 1RUC1 2WO7A 5CG9A 3AMMA 2NPIA 4YLZA 5CNAA 5BNOC 4QAWA 4A45A 1PVC2 1Q8PA 4WM7C 4R8HA 2VQAA 2PXJA 2UYAA 3ZDSA 3DPRB 5L9VA 3WNKA 4XCBA 4QKBA 3KCCA 1LAJA 2XKOA 2ZHLA 5DQ0A 3O0VA 3AYAA 1UZZA 5D21A 4S2FA 1JN2P 1QOOA 2WKKA 1H4GA 4SLIA 1MVEA 3BTXA 2YMZA 4MXWA 5BY5A 4AGGA 4Q1PA 5T5LA 5JZGB 1GLHA 4AK3A 2PN5A 2DCYA 1STMA 5EP9A 3AYDA 2PFWA 2W92A 3R6SA 3VZNA 3OBZA 4DXRA 5BYNA 2FDFA 3N7KA 1KRIA 3O5SA 4QX2A 2XR4A 4CEYB 3WR0A 2CGPA 5IW0A 3SKJE 5E6HA 5T52A 3AL5A 3O1MA 3MFAA 1ND3C 2Y26A 4IE0A 1BYHA 1EUTA 2A6YA 5H9RA 3UKNA 3CLPA 5GJ6A 4EN9B 4LO8A 2DYCA 3ZM8A 1RMU1 1OVPA 3Q8AA 4CE8A 4I02A 5CU1A 2H0BA 2LALA 3FLRA 1GOGA 3SCHA 1LOBA 1H4HA 4QU1A 3LKJA 1ZZ8A 3KF5A 1WWYA 1UIJA 4Y5SA 1PM7A 3MIEA 1O8SA 2BW8A 3WQ7A 3P3NA 1AR61 3ZSEA 4XAEA 1KGYA 1FYUA 4PI2A 5FPUA 4MUVA 4ZU7A 4QPIC 1S0IA 4ITCA 3RI8A 5L19A 2XWBB 3MW2A 2QE3A 4GJYA 3C7EA 4GWNA 2I74A 3DXTA 4RS5C 1QNWA 4XUOA 3BTYA 3MW3A 1VAMA 2BFUL 3ETQA 1QIQA 1HN1A 2KM2A 4AFAA 1UIKA 1X36A 2JDAA 4P9JA 4ATFA 3KQRA 2W9XA 4YZ1A 2R1DA 1FPN2 3HWJA 2D6KA 1ENQA 1CVNA 2E7QA 3WUCA 4GWMA 1OLMA 2YV8A 4MXVA 1AR82 2BFUS 4AI3A 2OZJA 2XJTA 4LTAA 5LB6A 2A6ZA 3HNYM 3ZXDA 1S1AA 3AKTA 3Q8EA 3RG0A 4COUA 4XMAA 4KGGA 3AM2A 1O7FA 2HWB3 2R063 2HKXA 3HMYA 1FNYA 1UU6A 3HNMA 5H9SA 4YGBA 3RMXA 3WQ1A 5KWRA 1C3HA 4LORA 4CA9A 1ZZ9A 2WINB 1IPKA 3O1TA 2E26A 1C1FA 3PDQA 2WWJA 2D97A 1RB8G 3A23A 4XPVA 1UYPA 2K9ZA 2BU9A 5FP9A 5FZBA 4ZZ8A 3M8LA 1O6UA 3POIA 4UYBA 4BM8A 1H2MA 2VMEA 2YROA 3UYJA 1BVP1 2Y6KA 1VRH1 4QGMA 3LSEA 2O0OA 4PDWC 1AR73 3DXUA 4RHV3 5EWSA 4YW2A 3JD72 4EWDA 1JYVA 5F8PA 1WLDA 3MW4A 5FZ0A 3AXEA 4LMFA 3LPGA 4XVHA 2DU1A 1JOJA 4ZS3A 4WZFA 4R4ZA 2YFUA 3K4DA 2BOJA 3T08A 1R082 1FMD3 3VBSC 1XSRA 4JDMA 5CIRA 2VOKA 1G9AA 1I1EA 2J42A 1AXYA 1X33A 3UGGA 1AXZA 3HQRA 4AVSA 4JTOA 3SISA 2RR12 5LY1A 4X8PA 4AVBA 5CFCA 1X9TA 1V9U1 4COWA 2WN3A 1OD5A 3WUDA 2XHNA 1QDOA 1VB2A 2GN7A 3LCPA 4BIFA 1RUH1 3ZN6A 2DFCA 4BHPA 2VAUA 1RHI1 2I2SA 3N3HA 2DV9A 1ST8A 5ABJA 3WDXA 4CCEA 5I8YA 1HB4A 3DGTA 2Y0OA 2VZRA 2XJRA 3IAPA 1W2TA 3IDCB 4JDNA 4LKFA 3WEZA 5JXHA 3BTZA 4KMQA 3NSTA 2OT7A 3OCPA 2FZ2A 2Y6FA 1UY1A 3AJZA 2RS31 4PQQA 4RFRB 5EV7A 1VBB1 4PLNA 1C57A 1S0DA 1LHUA 2ERFA 1NCQB 2VVDA 3IM0A 4GMP1 4N53C 3FZ3A 1J1TA 4JRLA 1R091 3DF0A 1MS5A 1AR93 1D2SA 3RI9A 5C70A 2HH9A 1QGLA 4ES9A 3N9NA 5FZKA 2G1MA 4BJ0A 3MF6A 1QXRA 2BNNA 2P6HA 2GP5A 1Z7S2 4E8CA 2ZGPA 1GYKA 1OF3A 1BK1A 3CNAA 2V72A 3LFIA 3POBA 4W65A 4WM8C 1D4M2 4FQZA 5FY4A 5LA2A 1OFSA 5D8AA 2SLIA 5FLHA 1NCRB 4GQ7A 3DL3A 1U12A 1V70A 5FWEA 2D6MA 4WV8A 4GH4B 4NIGA 1ZBE3 1NE4A 1MR5A 3HT2A 1W2AX 2MEV3 5TSWA 5IYYA 2WFF2 1ULPA 3DPRC 3PLQA 3QBQA 4AI1A 4XBQA 2K0GA 2IVJA 4FAHA 1NT0A 3R4DB 1ZA4A 2B42B 5LATA 3VBRB 4LBNA 1DF0A 4Q4V1 1UY2A 3H7JA 1AYM2 5FYSA 3T2TA 2C26A 4MHUA 3VZKA 4UBHA 5GZGA 4OULA 2GH8A 4YFWA 4AXOA 5C3OA 4RQPA 1UXXX 3KMHA 3AFGA 1I3HA 3KT4A 1Y3TA 1URXA 2ET7A 2VJXA 1UW8A 2RS52 3ACLA 2L9LA 3ZKYA 5FZHA 1MZ5A 4UXAA 2XHKA 1BXHA 3N9LA 4A7KA 3ILFA 1NQJA 3ZR6A 1OLQA 1C8M3 4ZY9A 2H6BA 2WSVA 4L0PA 4CEYC 1PO21 2BBVA 2JDZA 2H0VA 2WJSA 3ZSMA 2AZ5A 2BNOA 4LK7A 4MVTA 5JSOA 3SCGA 4IE5A 1NA1A 5FK7A 3HJRA 3M2MA 1GANA 1WCUA 3SQOA 4OLLA 1UXZA 4CP9A 4ZZ5A 3J8F1 1D4VB 3TN92 4HPKA 1YWKA 2YG0A 4LKSA 3RRDA 5IVJA 2YBKA 3N7MA 1CAVA 1JHNA 2ZEXA 4JV4A 3IBMA 4YYOA 4ZKTB 1O91A 3BIWE 1W8WA 4XXPA 1O4ZA 3S5AA 4KL1A 1N1SA 2JENA 4NHLA 1U5XA 3GZAA 1BLZA 1QJZA 5ACA2 3RDIA 4YG0A 2O8OA 3LFMA 4LUMA 4YW7A 2OYZA 1POV1 1RUE3 2VZUA 1VBC2 5LZ6A 5FPVA 2K46A 2HWD2 4MG2A 1W99A 4IDZA 4MSVA 5F32A 3ZPYA 1FOD3 3EHKA 4NE9A 2X53S 4LK6A 4P02B 4P14A 4R9AA 2W95A 4CDXA 5FYYA 2ZS6B 5DUWA 4FPOB 3VD9A 3ZSKA 4OZOA 1C5HA 3LA3A 5C8CB 3AZVA 2O8QA 2YDEA 4J6GA 2RDSA 4JHZA 2IXHA 1WW7A 4JKKA 1NZCA 4GB31 1ENSA 5FCCA 3AZXA 1GBGA 3ZYJB 4AVVA 3ZXAC 1OI6A 3HPNA 3PL0A 4U36A 4GULA 3USUA 3RYPA 1WW5A 3GF6A 4CDQA 4DPNA 1I5PA 1MQTC 4OUMA 3ZMNA 3MICA 4HSJA 3VHPA 3WSOA 4XETA 3OG2A 3NVCA 2YUEA 1VBD1 3RPQA 1DG6A 1RUI2 3WQBA 1RUD2 4JTNA 5I0SA 2GU9A 4XUNA 1J3PA 2TNFA 4A7ZA 1JYIA 4ARYA 3H1MA 1HJFA 4XF4A 1UY4A 1UNBA 1UX7A 3TEWA 1W39A 1MZEA 1OD3A 3NJZA 4Q4Y3 3VBHC 4B1MA 4CXWA 4DY5A 2BNMA 4FPCA 4HVQA 1SBFA 4FPKA 4HG6B 5JIUA 1UPIA 5KXDA 1CX1A 1QJU3 4IESA 1CR7A 1NYWA 3VHNA 4W50A 1ZVFA 1BVVA 1XE7A 1JOBA 1YIPA 4BK5A 3NNMA 5I8SA 3BU7A 3R05A 2EXIA 5JOWA 1GWLA 1HKDA 2G9FA 5IWFA 2EAKA 1SLLA 1DQ2A 2XUMA 1YFUA 1R1A3 5KR7A 2WNUB 3VD7A 4XEZA 5IVYA 4OQ8A 3N4MA 2WLPA 1X9PA 4E2SA 1FI2A 1HLCA 3CL1A 3O7OA 1QJFA 4D3WA 2WNVB 1S2KA 1JZ8A 5C7GA 2R043 5A80A 3KB5A 3RQ0A 1REEA 3I54A 3Q8CA 4D6RA 4FTBA 1ZYBA 2B46X 4NIIA 2F6BA 1N3QA 2LROA 2Q8CA 2A3YA 4LJHA 3D8CA 2AACA 2FDGA 1IKQA 4N43A 1W6QB 2OZ6A 4BA6A 1BBT2 4YW6A 2WS92 3JD73 4AI9A 2VZVA 1RIRA 1OUXA 1ULDA 1SHWB 2RE9A 3BPSA 4IQPA 1DYPA 5GZDA 1NCQC 2VBDA 5CAZA 1YCIA 2IFRA 3IMNA 2Q4SA 4LBQB 4UFMA 4OHZA 2A73B 4AVTA 1R083 1GOHA 3N7JA 2QQPA 3U1XA 1F4HA 4Y4YA 1RINA 2VW0A 1H6YA 3FL7A 2NMOA 3NL1A 2P4EA 1IPSA 2ZX2A 2OS2A 3AVSA 4URAA 4IEYA 3IT8A 3KVAA 2ZAHA 5BXXA 4AR2A 5A3TA 1JYXA 4KGQA 1GWKA 4JGYB 3G7DA 1PGL1 3NQHA 1IG3A 5FIXA 1UKRA 1VBE2 1NCRC 4E9KA 2NMNA 3RYKA 4QDRA 2VZPA 3JCIA 3FHIB 4YGEA 4HKOA 1Q3EA 2RMU1 2XG3A 1W05A 2Y8KA 3WNPA 3WDVA 2BERA 2GNMA 3CJIA 4IEWA 3OUIA 1HQWA 4EN7B 3VZMA 1COV3 4LBLA 2WT0A 2CWMA 1CAWA 1NY72 5J1XA 1S4CA 3HBKA 1BCXA 2CU5A 5DXDA 1UX6A 4O9GA 4RGGA 1V6LA 5FK8A 1LEMA 4I0BA 1OMIA 3BKZA 4IGOA 3MIBA 4YNIA 2D3SA 3UJOA 1MS3A 5KHGA 2C9KA 2WA3A 2DBNA 4RGAA 5BNQA 1RVF2 1KITA 2IXJA 5CKMA 1JI6A 1Z7S3 2NM1A 4W4ZA 3DEMA 3VUOA 4YZ3A 5B2GB 2E32A 1VBA1 1D4M3 1V6MA 3GALA 2Q0AA 5FJHA 2OXBA 3VBUB 1ZBA1 1OT5A 2W1UA 2VMDA 1W0OA 2XKPA 2DFBA 3ZSJA 1S0CA 1O5UA 5C4WA 1LHWA 2E6VA 4MGZE 4AEDA 2CHHA 5FY0A 4AYUA 4BDVB 4HOOA 4O65A 1KFUL 5AVPA 2QCSB 1HRV3 4BZ4A 5EYXA 3MBWA 3VHRA 5FZGA 4EN8B 2GC2A 4I0WB 4Y1XA 3RZMA 2QTWB 4J1XA 1W6OA 3FUOA 2WFF3 2YC2A 2ZGTA 2YY1A 3AB0A 4ZXEA 2NYYA 4H3WA 3E5UA 3OYWB 1O3QA 3POEA 3ACGA 4NRQA 1H6XA 2HWF1 3JU9A 2GN3A 1C28A 3NKTA 1NOVA 5JR7B 1TMF1 3MFCA 5T5JA 5FZFA 1AYM3 3K3NA 1TEIA 2YGLA 2BV4A 4MGKE 1IZ3A 4XFHA 3ZSLA 1OKOA 1ZM1A 4LO6B 1W8TA 1XU2A 2Y38A 3GGLA 3KM5A 1WKYA 1WCSA 1SLTA 2DDUA 2C5DA 2FBEA 2NLRA 3MLKA 5J3UA 1LU1A 5FR3A 3PVEA 1PNGA 2A6WA 2ZZQA 4P08A 3VBFB 1MZFA 3SEPA 1QJY1 1F5FA 4K6BA 4QQHA 3GZEA 5FP7A 1A34A 3QH6A 2JG8C 2C0ZA 4DUWA 1LOFA 4QHBA 5CFDA 1JYNA 4XUPA 2ARXA 2YBSA 3ZR5A 1SDDB 2J1EA 1OPMA 1HX6A 3PU8A 3OBAA 4X8NA 1MS4A 2VZTA 5HXMA 1BEV2 2HWC1 3LF7A 1F2NA 3ACHA 3ZO0B 1LB2A 3U10A 2JKBA 2D93A 4MGYE 4O7XA 2XLAA 3EBRA 5KC6A 1RUF1 2LTNA 2RS12 2W3JA 5DAWA 5F6KA 3ES4A 1O59A 2DVBA 1R1ZA 4COZA 1KS5A 4AI8A 3BUCA 4FT8A 5FQ0B 5JI7A 5JUVA 3OJBA 5I91A 3PVBB 4QPGB 1VBC3 4AG4A 1LGBA 4TWTA 1D7PM 4FI9A 1HV0A 1EY2A 2HWD3 1HXS1 1C4RA 1XBFA 4GD4A 4Q0SA 5F5QA 1XYOA 1WBLA 4JGZA 5FLIA 4ARXA 5A3LA 4Y1YA 1TZOA 3DV8A 1G9BA 1DQ5A 2Q8EA 4XIOA 2C4XA 4XHBA 4CDUC 1HRI2 1NUKA 5IAVA 1WZXA 2V73A 4LT5A 1ZZCA 3ZYBA 1G9FA 2R071 4AQ2A 2E31A 1CZVA 2GZWA 2WZR2 5DZFA 2JJ6A 3LDRA 4RFT0 4AVCA 3FN9A 3T0BA 3W5MA 3I3MA 1OC1A 2RDQA 3T3YA 2F4LA 5LEJA 1U5ZA 4XJ8A 2GNTA 2WNVC 5DDJ2 3CKHA 3OF1A 2JIGA 4NJ4A 1W6PA 3IIAA 5F3GA 4AGVA 3I3EA 1PIV2 2NN8A 2HWE1 1WMDA 2VVEA 2TEPA 1YEWA 3VL9A 1C1LA 4D6QA 1H8TC 3DUIA 1JZ4A 4L92A 5DABA 4JZRA 5L36A 1H8TA 4A3ZA 1RUC2 1ZRIA 3K75B 4XFIA 4BQWA 3HR9A 4E4SA 3VDDC 1U5YA 3GZUC 3VZJA 1ND2A 4N9HA 3VLBB 3U14A 1GZWA 3ORJA 5IK7A 2P2KA 3ITQA 4Z07A 1OOPC 3CZUA 5C33A 5DZEA 5CADA 4RA0A 2B7YA 3LIHA 4DFSA 1EAH3 4F8AA 3WW4A 2SBAA 1JMUB 3IKWA 2XLFA 4EE2A 2XMLA 2D6NA 3ST7A 1OLME 4P9XA 4IV3C 1YQ5A 2J1UA 2RV9A 1RC6A 5KXCA 2EF6A 2WDBA 3V65A 3I4IA 5J98B 4ZHNA 2W52A 4N90A 2C6SA 4M0HA 4XE9A 3AYCA 4LE3A 2XH6A 1F9KA 1CAXA 5FBZA 2P17A 5HV4A 1K5JA 4HANA 4IV1B 4AHWA 2WO1A 1UU5A 4JX0A 4BMEA 3DYPA 2QNKA 4Z2WA 2X10A 3NNFA 2A3XA 3POFA 5L7OC 2WSUA 2Z79A 3DN7A 1AYN3 1W6MB 2JD9A 4QD2A 5F2WA 1UQXA 4XDOA 3NKGA 5FOJB 5LA1A 5DAQA 1RITA 3B01A 3ZFEB 5C3PA 1O4YA 1BBT3 3HQXA 5F5IA 5FAXA 4Q4W1 5FMOL 4QX1A 5JWPA 1RMU2 5JI9A 4XJAA 4TTGA 2CSGA 1OHFA 2W91A 3B93A 4RN5A 3VN4A 2QQJA 4LNVA 2AENA 4DEQA 3CU7A 1HW5A 5FMOS 4FP3A 2OUHA 4ORFA 1O3SA 3D82A 2ZGKA 4LQRA 1ULGA 4FXKB 3S7EA 4IGQA 1TNRA 1W9WA 2P6CA 4ISRA 5GLUA 1ULEA 4Y22A 4A2UA 1L7RA 3HIFA 1AR62 3IDBB 3RWKX 1V6KA 2X5IA 1SDWA 4OHVA 4BCUA 1GOFA 1MZ6A 2FCVA 1WUVA 1CJDA 2P3IA 5CVRA 5J96B 3WCSA 4RR3A 3ZN6B 1ULFA 2PHWA 1VBE3 3WNLA 3WF1A 2IZWA 2C9AA 1QWRA 4UW3A 5ABJB 1AF9A 2VECA 4XIKA 4XFCA 2OIIA 3H8OA 2DTWA 3VDBA 1GFF2 3THPA 1IG0A 3WP4A 4XQ4A 1PM4A 3QCWA 1JYWA 5FO7B 2R061 2Q1ZB 4LOTA 4KWUA 5FKBA 1B35A 4ONUA 4GMP0 2EIGA 5LEKA 4LITA 5EXOA 2CDOA 2Y0IA 1YO8A 4KWLA 5EJ3A 1G9DA 2AH2A 1XJAA 3SH5A 3SLIA 3RWNA 1CPMA 2D7FA 3M3QA 4OUEA 4PHZA 2VZQA 5DAVA 3ABZA 5LBEA 3HBZA 4NMIA 5LWBA 2Q1FA 2F17A 5FYBA 1DLCA 2O14A 3LEMA 4RHV1 5FYMA 1AR71 3DCQA 3OGRA 3WF2A 5BNOA 4BLIA 4WM7A 4XYXA 3KVBA 1VRH2 2CGNA 1UYXA 2X09A 3BVCA 3POWA 4GKXA 1WW6A 1UAIA 3UV9A 1PMIA 4BQ4A 1JOPA 2ZX0A 1OQDA 1AX0A 1J59A 4COYA 4INDA 2BUKA 1AL0G 1DQ6A 1NZIA 1RTVA 2W2IA 3WG4A 1LRHA 2JDKA 2PTMA 3B00A 1W90A 1PGW1 4HN0A 4IERA 3PU3A 5KXBA 4CU6A 1ASJ2 4PLOA 4V2WA 4CEWC 5GZEA 4ISQA 4ZS2A 3KT1A 3W20A 1VRBA 1NKGA 2X29A 3WXPA 3A0KA 4LHNA 4XBNA 1KXGA 3WZ1A 1WA4A 4XABA 2NQYA 1S0JA 3HVDA 1N3OA 4XAAA 4A3XA 1HV1A 1V9U2 2XWJB 4E8DA 3C7HA 3P6BA 1RUH2 4NPMA 4D7TA 1TVGA 4MLOA 3LPFA 4HK9A 2WZEA 4QQOA 4QPGC 1RHI2 3HT1A 1MEC1 3OGVA 1EPWA 2YFZA 4RQPB 3RMYA 4C8DA 1ND3A 1AL21 1RUJ3 3L2YA 2UY9A 4IETA 1CX4A 3LSDA 2QVSB 1OFNA 1C8NA 1CAUA 2R1BA 1O5LA 5K0UC 5BNNB 2BGOA 2RS32 2YC0A 1US2A 4QX0A 1VBB2 3D6EA 1Y7BA 3L9JT 1YFYA 1AR91 1JZ5A 1W9YA 1R092 1BHGA 3BODA 1NA1B 3ZIWA 2AUYA 4CP9B 2UURA 4YWAA 2V09A 2O1QA 3I2GA 4M3CF 2E7TA 2D98A 3M3OA 4HPKB 2JDNA 4QQ2A 4QPIA 4TXWA 2UYBA 1GZCA 5J37A 3PUHA 4RS5A 1CZSA 2RS13 2PQQA 1ZZ7A 1POV0 1WCQA 2IXCA 1W3XA 2YPDA 2XBO1 3AKPA 1QOTA 5DUVA 3ZFFB 3H7YA 2BOIA 1XB9A 5AFEA 3C7FA 1JZ2A 2JDHA 1ZBE1 5T3NA 1Q5OA 2MEV1 3RZZA 1LOEA 3SXWA 3UK9A 5FZMA 3TBDA 5IAXA 2CYFA 4CDWB 2A75A 2D43A 3OEAA 3LOBA 2ZGNA 3KV4A 3FUQA 5F9TA 2ETEA 2Y64A 4QT6A 4E4DX 1JS9A 4LO7A 1HRI3 1YNAA 1ZRCA 1VB4A 3E5QA 1VIWB 2ZZJA 4QXKA 4K8FA 3SKVA 3TNQA 5BUVA 1SLAA 3INAA 1VMFA 2Z69A 1H1IA 3KS7A 5GLWA 4DB5A 1DQ0A 3Q8FA 4Q4V2 2DCZA 3OY8A 1FATA 4FPEA 1LECA 1CWPA 4DINB 1KJRA 2WZR3 4ZU5A 1WMEA 3ZYIB 1TME1 2JE8A 3BIEA 5CKQA 2IFWA 1UO9A 4EN0A 1HQNA 2WIIB 1UPSA 3VD5A 1QQP1 1UN1A 4PDWA 3WHTA 1W6NB 2XL9A 5D2AA 1QMJA 5DDJ3 1DZTA 1S0EA 4D94A 5JOYA 3GDBA 3URFA 3MV01 4Z2AA 5A32A 1SLBA 4IV1C 5GALA 3W5NA 1GR3A 4TLFA 1PO22 4AFMA 5F1RA 5HV0A 4R9CA 3IIIA 2V5YA 2PMWB 3VBSA 4YRDA 1UL9A 4I2OA 1K45A 4LO5B 4XFAA 4WBBA 1UOBA 2VNGA 4XJZA 5FP8A 4MV2A 2W47A 2PLV3 3CQOA 1UZYA 2ZCWA 3J8F2 3M7AA 4KBZA 1DCSA 3K4AA 1IKPA 1CD3G 3VBOC 4QGNA 4UW4A 3OSDA 2VXJA 1US3A 2ZACA 5FWJA 3HOBA 1W04A 2EIDA 2YYOA 2OPWA 1BQPA 1RUE1 4S2DA 3RVHA 1H2LA 1ENXA 3VDCA 1VE0A 1DGWX 2WYSA 2D5FA 3ZN5A 4EZ4A 4NIDA 1KDMA 1FOD1 2TBVA 4HBNA 4ZXKA 4QXCA 2E9QA 2RDNA 1H1AA 1PZ9A 1PO13 2ZJCA 3H1WA 3IPVB 5I0TA 3H0OA 4XDQA 4ASLA 5JLVA 4XCAA 5ISLA 4CCNA 5A33A 3NJXA 2B9UA 2A6XA 4K20A 3VKMA 4KNCA 4FAGA 4DUXA 3AP6A 3EJKA 1WW4A 5M0TA 4HKWA 4XDPA 3A7QA 3PUAA 3I49A 1A8DA 4Z8BA 1ZNPA 4OHXA 4C0HA 4N53A 1HN0A 1VMHA 2VUJA 3KCYA 4CPBD 4QGLA 4GB32 4ZU4A 3UKVA 2ILMA 2UWCA 4FOVA 2JG9C 2B8MA 4EROA 5IK5A 2A3WA 3GZTB 1YLLA 2GH2A 2EXHA 3OBTA 2VULA 3PVNA 3V0BB 2VBPA 2ZPXA 5A70A 4BE3A 3N35A 2G9ZA 1LESA 2V5DA 5FY9A 1OA2A 2PAMA 1DGRN 3S6PA 4QB6A 2VH9A 4B8EA 1OQEA 4UW5A 1W8ZA 4WM8A 4D7SA 4B29A 3VZLA 4AEMA 3KHBA 1VBD2 3V0AB 4CP1A 3DECA 4CVUA 1LHVA 3PTYA 4FVVA 1JZ7A 5F37A 3F95A 5JXGA 1AR63 4NOTA 4Q4Y1 3UGHA 1LOAA 2D6LX 4IL7A 2P34A 1RL3A 1OXCA 1UOFA 3LEGA 1QJU1 3ETPA 5FY1A 3DPRA 4BQXA 3WW3A 4QX8A 4CP0A 5H9PA 5BPXA 4OFGA 4BLJA 2VQUA 1XNDA 2WRAA 4YARA 3EMRA 3D4KA 5BNPB 3ZOIA 3E6BA 3TRSB 4YGCA 3EB7A 4NVPA 1SBDA 4Q26A 3VB9A 5E16A 5JZGC 1R1A1 3ZYGA 2JDYA 2CDPA 4UFLA 5C9AB 1GNHA 5F5AA 2DCJA 5F6LB 4A7YA 3AFKA 4DOUA 2MPFA 4WVMB 2J1TA 3SHRA 1SCRA 1FX5A 1XRUA 3U37A 2OKXA 3FBYA 1PMJX 2QDNA 2QQWA 1WLWA 2JECA 2R041 3MPPG 4K40A 1W28A 1OH4A 3VKLA 5IFPA 2ATFA 1A78A 1LHOA 2VCAA 4CEYA 3ME2A 5A7SA 1EYBA 1NAEA 4RD7A 4TYSA 3D0JA 1UZWA 4IEPA 1H2KA 4OVEA 4XW3A 3ZYHA 1JBCA 2Y6JA 2ZEWA 2VGDA 4GA9A 3H3UA 1W9SA 1PVC3 4IEXA 2ZX1A 3AL6A 3GCWA 1VRH3 5FBJA 2GNBA 3J7HA 1Y43B 1H1MA 4Q4X1 1XNCA 5BNNC 2FZ1A 5C5TA 2DTYA 2Q1MA 2VW2A 4XFGA 4AEDB 2XOMA 4CTEA 4FXGB 1OLRA 2WQ4A 3KZ4C 3IDAA 3L2HA 1XNBA 3WCRA 2EIBA 1GWMA 1ASJ3 2AREA 3SNMA 4QKNA 1DYKA 4Y1UA 4XQWA 3CMGA 3LQCA 2ZKLA 3QD6A 3GHMA 4YVSB 4CCLA 4Q8KA 4Y1ZA 2ET1A 4XZPA 3USSA 5GLZA 2W1SA 3ZFFC 4AFBA 4BOWA 1DGLA 3J4UH 1MS8A 5CKNA 1PGL2 4NAOA 1A3KA 3HN3A 4L97A 2LM3A 1OKQA 3FLPA 2P37A 4B1LA 4WVZA 2VZ1A 5IK8A 1F8VA 4AL9A 4CCOA 1GQPA 1S2BA 2RMU2 3AZWA 4BB3A 1YI9A 1QJEA 3H50A 5IK4A 3R0RA 3BOPA 4QX7A 4CDWC 1MQTA 4NHYA 4MOAA 2A1XA 1COV1 3H9AA 3N36A 1SBEA 5LBFA 1CIYA 2RS33 5C3RA 2WZ8A 1VBB3 1WA6X 2WL1A 4LBQD 4UF0A 2DUOA 2IC1A 4LBJA 2WLQA 2IWGB 4Q1RA 5IFTA 1OUSA 3NJVA 1ZRDA 5HCAA 1CGPA 1RUG1 1SG3A 4EQVA 2VMGA 3VBHA 4AOCA 3TEZA 1D4M1 5FUIA 1RGSA 4YM2A 1FPN3 5A6QA 4B7KA 1PHMA 4Y1VA 3HEIA 1VBA2 2CGOA 4LOSA 1GKBA 4XUQA 1ZBA2 2D44A 3GM8A 1AR83 2C24A 4W8JA 4FPFA 4R9DA 4U2AA 1HRV1 1DQ4A 3WDYA 5BV6A 3QH7A 1LU2A 4JGZB 2RHPA 5F3CA 5FZOB 4NHXA 3D3AA 5FMCA 1KFXL 3IB3A 2JB4A 4QM8A 2HBTA 2R7EB 5E8AA 4K8RB 1VAVA 2ZOEB 3H42B 3WNXA 2HWF2 2BJSA 1JW6A 4YZ5A 1VP6A 4IXLA 2A6VA 2QQOA 4LBOA 3ZPOA 1H9PA 4XTPA 1H0BA 2P3YA 1EUUA 1NLRA 2KD7A 2J1VA 3PIJA 1YRZA 5T54A 1JUIA 1N47A 1Q8VA 1D0HA 3GJBA 3HNBM 4XMIA 5I0UA 2VZSA 2ARCA 3I2IA 4J1WA 2RM21 3KV9A 3T0AA 2VOXA 1MS0A 1W6PB 1GUIA 2HYKA 4CU7A 3NAPB 1I5ZA 1QJY2 1NCQA 2WAAA 3MHZA 2XJVA 5EFUA 5AC91 3O1UA 5FYCA 2WT2A 2VTFA 5HXVA 2ZMLA 3SH4A 4XF3A 1UWWA 4QXHA 3ZLIA 3AK0A 3O0XA 4D7YA 1O3TA 3I2OA 1FV3A 4FPHA 4XILA 1DBNA 1G8WA 2RR13 5HCFA 1ND2B 1IS4A 1VPHA 4AFDA 1SEFA 1QF3A 1Z78A 2GC0A 1YJLA 1RUF2 3NV3A 4LBKA 1WCDJ 5IVVA 2CWSA 5C8WA 1NCRA 4YVWB 1LGNA 4RSUA 1IS5A 1GQGA 5EYYA 5SV5A 2DVDA 4GH4C 1C5IA 2EICA 2HYXA 3O14A 5L9BA 5FDBA 1MS1A 2G19A 4KI5M 5SV8A 3ZDVA 5A1FA 1HXS2 3GYDA 3WF3A 3MZHA 2Y6LA 1F5JA 2FDKA 2R0FA 3ILRA 4PF5A 3GBWA 3BPZA 4AE2A 5FYIA 2H6CA 3VBRC 2VNRA 1EV12 3AMNA 5BNPC 3VBRA 4DMIA 2Z2SB 1QY4A 3WF0A 3BGAA 5LRSA 2VCCA 2Y34A 1J1LA 4HONA 3SITA 4AI0A 1SPPA 2R072 2XB6C 3QOPA 4LXLA 4N9IA 5FZDA 3S30A 4Q8LA 1D2QA 2FQPA 4M3CB 4OMDA 4YW3A 2AC1A 4GALA 5FPLA 5LK5A 3VGIA 3WT3A 5C9AC 2VMCA 5JOZA 4LHLA 2ZBJA 2G4IA 3AVRA 3PJQA 1RJ8A 4OZXA 2VTXJ 4M3CE 5A7WA 3RJRA 3BN6A 3TWIA 1NG0A 1F31A 2D5HA 5FZEA 3PNAA 3IAQA 4Q0QA 4XBLA 1GSLA 5IT6A 3UT0A 1GZTA 1J58A 4AEJA 2HWE2 5K0UA 5C71A 4CPBA 3WP6A 3PURA 4URTA 2EAAA 5DUUA 2ZGLA 5EHDA 4D0QA 1V6NA 4JQRA 1K5MB 5DN2A 5FYVA 5J36A 2ZEYA 4V2VA 1PNFA 2X5IB 4AAXA 4G9SB 3ZFGB 3WDWA 3WDUA 2FD8A 4FOYA 1PK6B 2PA7A 2FCUA 1XYPA 4QX3A 4RR3B 1EAH1 1MPXA 5HPOA 5CG8A 1UMZA 2WBKA 3TEXA 2VM9A 3KQ4B 2R32A 2QZ3A 1GICA 4GAZA 2D40A 4HN1A 3ACFA 4Q29A 2VMHA 4C1XA 2RS53 4BH9A 4MADA 5JSRA 1OQ1A 2ES3A 4YVSC 1JYCA 3I2HA 3K51A 3POYA 5C8CC 4OI1A 3CHXA 1N1TA 4YZ4A 3S7IA 3M3CA 1JU3A 2OPKA 1ONAA 3KV5A 3K3OA 3JBG1 1BJQA 3BYWA 4RL7A 3SH3A 4EWAA 2JG8A 3POJA 2WN2A 4BK4A 4JAAA 5JOXA 3GCXA 1HB3A 1TG7A 1AYN1 1T6GC 4AVAA 4HKLA 4YG6A 5F3EA 4L99A 4LR4A 3TN93 2ZGRA 4HMZA 4QM9A 4Y3OA 4AHXA 3HN1A 1JTZX 4WM7B 5KHJA 1W2OA 1YQCA 5FZAA 4Q4W2 4PIXA 4OQ9A 4Q5OA 5ACA3 5FFOC 2W94A 4LO4B 4HLTA 4NN0A 5DUXA 2BDRA 2FCTA 1AHSA 4MXWB 3BI3A 1QJX1 2Y6HA 1UZVA 1I6XA 2GC3A 2P3KA 3NNLA 5GZCA 5K9YA 1W0PA 1LOGA 5FLJA 3ZYRA 4NO4A 1P8JA 2EALA 3VKNA 3HAGA 5FOBB 3RS6A 3A21A 3VKFC 2EIEA 1REFA 5FXXA 4CDUA 2LS6A 1ZX5A 2JXAA 3RNSA 5GLVA 4X6QB 5FXWA 1K42A 1RYYA 3ELNA 2LW8A 3C3VA 2J1AA 2HEWF 1W9FA 4HETA 2WNUC 4AQSA 3IWZA 1I9RA 5I8TA 5L9RA 3B7MA 1WCKA 4DRRA 1CONA 5FYHA 3WQ0A 4O61A 2RDRA 3H8RA 2R062 2ZKNA 3VL8A 2VNVA 3ZX7A 3TEYA 1NY71 3MDPA 2WNVA 5J48A 1M4WA 1RUI3 1QU0A 1RUD3 1JU4A 3E6DA 4PF1A 4XUTA 1IPJA 3WNOA 4KH9A 3WF4A 3T4HB 2CAVA 2B39A 1DGWA 3AP4A 2W0XA 3LWCA 2VXRA 4MGSA 3NV1A 1W6QA 3VDDA 2VCMA 2PAEA 3F2ZA 3B3QE 4N7IA 4RS5B 5DPNA 4IUGA 5FXVA 4A41A 2VUCA 4I30A 2WNOA 2FMDA 1XQNA 2QQKA 3PJYA 4V1PA 2VW1A 3NAPC 3WOGA 1OOPA 3OGSA 4B3NA 1VBA3 5F5CA 4MYEA 2P5BA 5C6CA 4QHZA 3FE5A 4LBQA 4NRPA 4AGRA 3PIGA 1OA4A 3ACIA 4QXBA 4FBFA 3AMPA 2RJKA 3W59A 2GALA 2X8KA 1PGW2 5LBBA 1QEXA 4IV3A 4JQTA 4KU7A 3ZMOA 4MZUA 4W6XA 3P5BA 1GQHA 3TOJA 4JGYC 4NHKA 3C7OA 2YBPA 4XFBA 3PMSA 1JUHA 2GDFA 4OMCA 4XFFA 2WNEA 2BRTA 1UYZA 2HWF3 1DIWA 4YVWC 5GKAC 5F39A 2JEMA 1L7LA 3I2FA 4AWDA 3BALA 3JB8A 1FXZA 4IE4A 1RUJ1 5FYZA 5L7OA 1MEC2 1YIFA 3T2OA 3POSA 1RXGA 1AL22 1XXNA 2WS93 4HFSA 4UBGA 1ZRFA 2VOWA 5CBLA 1DYOA 1W03A 3H3LA 1ODNA 2CAUA 2I07B 3E5XA 2IXKA 4A44A 2WT1A 3TYJA 5IATA 1YQ2A 1QJY3 4BIOA 2QFEA 1IS3A 4IEVA 4YFZA 3QACA 4BXFA 1AR92 2B9VA 3CDZB 2G9GA 4NWWA 4ZONA 2Y33A 3U75A 3VBSB 2EXKA 4GJZA 5FZ4A 2VR4A 4K21A 5FZIA 3I2KA 2YB7A 5F7UA 3BOWA 2BVBA 1F4AA 4BXSV 5JDBA 1S0BA 2PHXA 5CFCB 4OUSA 3GNEA 1UCXA 3O1VA 2MHFA 4LIVA 3MV11 5CA6A 2BZDA 3IMMA 3THTA 2VL4A 4EYUA 3VBUC 3RZJA 4I3GA 3KD4A 1RUF3 5FZ8A 3JZVA 4UI9L 1S0FA 2XBO2 2R0HA 3K2OA 2JD4A 3LA7A 5I0RA 2VU9A 2D6PA 1W06A 1K5MC 4OCTA 4CYDA 5GLTA 4W6YA 2HWB1 4QB1A 2MEV2 1HXS3 1SMVA 4LHKA 3U0ZA 4HK8A 3BTAA 1ZREA 3IZOA 2R16A 2DUPA 5A33B 3J26N 3Q9OA 3ZFGC 4FTSA 5CEHA 1BMV1 4BPZA 1EV13 2Q5TA 1DU3D 3HD8B 5FTTC 3I3QA 1WMXA 4KG8A 4N53B 3B9CA 4R4XA 4PQ9A 1PGSA 5A3MA 1H9WA 3H8UA 3MUZ1 2R073 4RYDA 3FHAA 3OGJA 3K46A 3B5LB 1F35A 3AC0A 4LA2A 1TME2 3MIFA 4NIHA 1RVF3 2AEYA 4NHMA 1KJLA 1HQLA 1SFPA 3VBFC 2EVXA 1QQP2 4UFKA 2GP3A 3S5QA 3VBFA 5D8AB 4QU2A 4PBOA 1DLLA 2ZX4A 1FMD1 2VCBA 4P9LA 3W58A 2HWE3 4OI4A 2UY8A 3T1LA 1ZZBA 2ZHKA 3VDAA 2E7AA 4JRAA 1M06G 2XQRA 4PJYA 4K9SA 2PLV1 5A7NA 4CEWA 1JODA 2QQMA 2W87A 4NIAA 4CCJA 5IVFA 3LDBA 1IS6A 3OUJA 1ZZ6A 4XHXA 2VY0A 5FREA 4W6WA 2WA4A 3ZXEA 5KC5A 3V56A 3VZOA 4Y24A 1CZTA 2XGXA 4AHZA 1YXWA 4YPJA 5FQ0A 1RUE2 3NRUA 1V6OA 2DUQA 2IVIB 4QPGA 2VC9A 3FC0A 2J7MA 1S2EA 1DZRA 3I3BA 1XE8A 1PO11 5EIYB 2WQ8A 1FOD2 4DY3A 2GSYA 1XOYA 4P5HA 3MEPA 4DRVA 4ES8A 3ZXLA 1O3RA 1V00A 1B09A 1N3PA 1ZA7A 3I3DA 3SEEA 5KHKA 3LAGA 4FFFA 4XQDA 5B4NA 3BB6A 3VD3A 2E33A 2E51A 1UMHA 3AKSA 4MO3M 3RYRA 4D8MA 3NWKA 4UOJA 1NLQA 1WLCA 3I2DA 5E89A 3NNGA 2XDVA 3KGZA 2ZAAA 2EA7A 3A4UA 2BGCA 2XUEA 1BEV3 5ANQA 2PELA 3JQXA 4NUBA 5GZFA 1OH3A 4QHOA 4OI0A 4XC9A 5FZCA 5DMYA 4Y20A 1CAVB 3OTFA 1QKQA 4XF9A 1NLSA 3DKQA 4FFGA 2DVAA 3U07A 4Q4W3 5HCHA 2HBUA 4A4AA 4NR1A 3ROUA 3ZN4A 1E5IA 2BWAA 3I59A 1AVBA 4G3YC 4L9BA 3X29B 2ZHMA 2CTVA 3VKOA 1TNFA 2GC1A 4AF9A 5DZGA 4XJUA 2Y60A 4HZFA 3AX4A 1TQ5A 1UKGA 4UFHA 2QQVA 4H14A 4UT5A 5JSPA 2GMEA 1X8EA 3I97A 3WX5A 2RVAA 4GWIA 4Q4Y2 4CDXB 5LK7B 2XVGA 1TE1B 2WC2A 4H7MA 2VNOA 3AYEA 1QJU2 1LNSA 2QZ2A 3O1RA 1FNZA 3MIDA 4CCDA 3I7DA 3USUB 1KS4A 4IE6A 3T09A 1V0AA 2EXJA 3MIGA 3D0SA 4CDQB 5B4XA 1R1A2 3CZJA 4E2GA 4META 4JHTA 2BVVA 4Y4RA 3WHUA 2VZOA 2XJUA 3ZYFA 2CNAA 1AUYA 1DGRA 3N9QA 1MQTB 1C8M1 1XE0A 2QQLA 2BWCA 2XVLA 3K48A 3OUHA 4FCAA 4J25A 1W8FA 3UETA 1UY0A 5FZ3A 4YZ2A 1AX2A 1ALYA 2PYTA 1PIV3 3HQUA 2UU8A 3FMGA 3NO8A 3WNMA 2R042 2ZA9A 1SFYA 4IV1A 2J1RA 4UF0B 5A3OA 3AKRA 1Q8OA 4IEOA 4LLOA 4LUKA 2QQNA 1RUC3 2ADDA 1YJKA 1OVSA 1PVC1 1H30A 1ACCA 1W6MA 3ZFEC 2W1WA 4FPYA 5HBAA 1FAYA 3DYOA 4L2NA 3VBHB 3ZFEA 2BQPA 4FTEA 4QKDA 5JVVA 5A3NA 4WVWA 3VBOA 3LOIA 2BGPA 4Q4X2 1NX9A 3MIHA
chains in the Genus database with same CATH topology
4F3JA 3RJ2X 3G6JB 4C91A 4AQTA 2VVFA 4FPJA 1ASJ1 2XJQA 4Y5Z0 2XPJA 1ZRRA 5AFBA 1BZWA 1FV2A 3T1MA 3J9SA 4LBMA 5CFCC 3C2UA 5HI0A 3MLLA 3ATGA 2Z5WA 2DU0A 4MH0E 1LENA 5ABJC 5D1IA 4FO9A 3NW4A 4ATEA 2JG9A 1LKNA 3LGRA 1MEC3 4N43B 4QPYA 2KXLA 3AP5A 1AL23 4BMBA 2BPA2 3IN9A 4EN6B 1G86A 1RMU3 3ALQA 4O9EA 3FFQA 4P9GA 5E1RA 3EO6A 1COV2 3WW1A 1MVQA 4PCRA 1KDKA 2DCKA 3N7LA 3ZXFA 2XJSA 4H7LA 4QQPA 4KQ7A 2PHRA 1QH6A 2A7AA 4X6RB 2QJVA 4MX3A 4AFCA 1RUG2 2I45A 2B45X 2ENRA 3FWEA 1FPN1 1SCSA 3M1HA 5D8AC 1XU1A 3AMHA 1X8MA 1AR81 1LULA 2XBO3 4XJ9A 1KQRA 2MNGA 5DG1A 4FOWA 4E4ZA 1X50A 2BTVC 4FPGA 3ILNA 5JZGA 4F7ZA 4XF0A 1HRV2 4IEZA 1GNZA 2B5HA 3CJIB 4DQAA 5T50A 3U11A 1LR5A 4PBPA 4YG3A 1PZ8A 3KT7A 3KGLA 5FRAA 1LGCA 4FQ4A 5LRRA 1CAWB 4CP2A 1YI7A 1NXD1 1GZ9A 1OPOA 5FO8B 4AQ6A 4N7UA 3A0NA 4M00A 3P3PA 3B9IA 2LUWA 2DVGA 4RQPC 4CZSA 2YHJA 1ULCA 5J7MA 1VLNA 1WGPA 1TME3 3JD71 1IHMA 4OHYA 4R52A 1UF2C 3EXUA 4WZCA 1QQP3 5BNNA 3M4FA 2RM22 5KBFA 1R081 5C4WB 2Q30A 2XLGA 3WP3A 5K0UB 4OHWA 5AC92 4XTMA 2R6QA 1NA1C 1QH7A 4YSFA 2FHRA 1W6OB 2RR11 2VOVA 3NV4A 1VAKA 1NXMA 4FSJA 3OD0A 4S2HA 1V6JA 1G7YA 1V9U3 3GBGA 1NE6A 4AEKA 4FOQA 1RUH3 4K1ZA 4YGDA 3ZFFA 4AI2A 1NQDA 5I93A 4R9BA 1WD3A 4Q0PA 4FP2A 1RHI3 4GKYA 4OI2A 3W58A 2ZHNA 4L8QA 1W2UA 5AVAA 3WV6A 2NZ9A 1VJ2A 1LCLA 1LODA 4I01A 4CDWA 4CDXC 1LTEA 4BYYA 2GMMA 1DQ1A 2UWBA 2E63A 1QXPA 4GMP3 4LEJA 4YW1A 5CFDB 2JG8B 2YZ4A 1R093 2PAKA 3MF9A 4CDQC 5KHIA 3FLTA 2PHDA 1QNYA 3VV1A 2D3RA 1QOSA 1U5IA 1DZQA 1Z7S1 1Q8QA 4PIYA 1W6NA 5K8SA 3OGGA 3WW2A 2ZGOA 3RSJA 2ZMKA 3ECQA 4C1WA 4F83A 2JICA 4Q27A 2GAUA 4B4PA 1E57A 1G9CA 3AZYA 4Z1VA 5H9QA 2WFF1 3M70A 2ZGQA 4QQLA 4E27A 4C0BA 2VUAA 5T55A 3B94A 1Z0HA 3ZXKA 5JCTA 4CDUB 3CJXA 1A6CA 1AYM1 2Q8OA 3AKQA 1MACA 4Q0UA 2W68A 1TMF2 2XL7A 4Q4V3 1EAH2 3WD5A 3GHNA 1LHNA 2PHLA 4KBBA 1FT9A 2RS51 3WVJA 4DZGA 4HL0A 3TAYA 3LZZA 3IPVA 5K7PA 4I09A 1JXNA 1ENRA 3UKTA 1GV9A 2OA2A 4JDOA 2HJIA 4LA3A 4KG0A 4Q0VA 3WG1A 2TUNA 1PO23 3E97A 3QLQA 1IQAA 3JBG2 1H8TB 1V6IA 1U0AA 3TN91 4N43C 2DCTA 2YXSA 3S0MA 1AYN2 3APBA 3KLSA 2HWC2 3VDDB 3J8F3 3V0BA 3MLJA 2JE9A 1Q8SA 1Q56A 2HEYF 4YW4A 1MS9A 1GZWB 5ACA1 5CB7A 1EPZA 4Q4X3 1OOPB 3O0WA 4I0AA 1VBC1 2HWD1 1DHKB 1POV3 4EV0A 3V0AA 4GH4A 1QDCA 4I3PA 4XXAA 1QJX2 4Y26A 4BQ1A 1AX1A 4IV3B 1SFNA 4FPLA 4PIZA 3H3ZA 3MGUA 2ZGMA 4KWKA 2IXIA 3AP7A 2D6OX 2YGMA 1SQ4A 2WZPP 1CAXB 5L73A 4COVA 1XNKA 1YFWA 1YFXA 3V64A 5BNPA 4GB33 3PHMA 1CIWA 2PHUA 5L7OB 1WLTA 3CJIC 5C9AA 1DDLA 4WVMA 2ZMNA 4H55A 3ASIA 2UWAA 2ZTNA 1AXKA 1LEDA 2VQ0A 1RUI1 1AJKA 1RUD1 2A70A 5FPXA 1VBD3 1LJ7A 3WDTA 1UD1A 3SMHA 1DFQA 2OVUA 4Y22B 4YM3A 1HIXA 2RJLA 4SBVA 4HSLA 4HVRA 2WFPA 1IOAA 1RUG3 3ZXGA 1AJOA 1OSGA 2CY6A 3EQEA 5C4WC 4AEDC 4M0NA 4E2QA 5DG2A 3JB4C 3W9AA 4M01A 3TNPB 4K1YA 5KHHA 3KSCA 1J3QA 4JC1A 4BWOA 1B35B 3VHOA 2C1FA 4YVSA 3E6CC 1IGOA 1H2NA 2XJPA 4QX5A 5C8CA 2XVKA 5FO9B 2NP0A 1S0GA 3PVOA 5JMCA 2A71A 3AXDA 3MPBA 4LLFA 3WP5A 1CQ9A 3AP9A 1LOCA 1HDKA 1BBT1 3H1YA 1RUJ2 3WG2A 4JVAA 2WS91 2K2SA 5BNOB 2BYVE 2ZX3A 4JCKA 3ES1A 4KU8A 4YW5A 4XOGA 2ZGUA 5T5PA 1H8VA 1APNA 2RM23 1LOFC 5CFDC 3I8TA 1PZ7A 2E53A 5AC93 2AGSA 5JPMB 4KWJA 4AHYA 4CEWB 4Z82A 3SCFA 1JH5A 3NV2A 2DWRA 4GIQA 3ZIXA 2BEOA 2GNDA 1VBE1 3KCXA 2QUOA 1SLIA 2CV6A 2WQZC 1G6NA 2ARBA 2QDRA 4C90A 4GXLA 5EZWA 3D5OA 1ND3B 2RMU3 2WWSA 4JGZC 3FX3A 2WNUA 4QMAA 3LA2A 5T5OA 2DURA 1CAUB 2HWB2 2ZGSA 4Z92B 1WBFA 2A5ZA 2AYHA 2W39A 1EV11 3R4UA 1SACA 3TB0A 1BMV2 5GM0A 3UL2A 1YHFA 1RJ7A 2YPJA 4NWVA 4WVVA 5HCBA 4AW7A 2F4PA 1EP0A 4P9IA 2QKDA 4B4RA 4ASMB 4BZ4A 4CRQA 1XYNA 1WD4A 4QPIB 1RVF1 4YM1A 1WMFA 3AMQA 4RHV2 1AR72 1CJPA 4Y20B 4TZDA 4PLMA 5JAXA 4HVOA 2OUJA 3I59B 3NAPA 1ZBA3 2HEVF 2JX9A 4K7JA 4DNYA 1FMD2 2IXLA 4NPRA 4Q2FA 2P3JA 3DKWA 3UJQA 1AZDA 1N1YA 1O4TA 1ND2C 5FPZA 5JPNB 2PLV2 2JE7A 4S2GA 3CF6E 4DS0A 4B4QA 1SLCA 3ZVXA 1CESA 1CN1A 1J3RA 4JGYA 3JUUA 3BCWA 3FFZA 4B7EA 1Q43A 1TMF3 1OA3A 3OY8B 2PHFA 2PHTA 4YVWA 3ZXJA 4EWEA 1VALA 1N1VA 4G4FA 3WLUA 3AZZA 1PO12 4P9YA 1S55A 4PDWB 1X82A 3R4SA 2VPVA 3AJYA 5A32B 3WG3A 3ENRA 3LB9A 4XF1A 2W08A 2DF7A 3JBG3 5E88A 3IDEA 1BEV1 2CL2A 2VG9A 4M3CA 2HWC3 1X7NA 1RUNA 3WINE 2RS11 2ZABA 2R30A 1BKZA 3ZYPA 1D0GA 3VBOB 4HT1T 2DVFA 3FBMA 2Z42A 3VBUA 2N7GA 2FMYA 4XJWA 3B02A 1YUDA 1QHDA 1ZBE2 3B69A 3M3IA 4IEUA 1QJX3 1K5MA 2OW4A 2X5IC 5J09A 1YYNA 4D69A 4LULA 1L3JA 3O12A 1HRI1 3OYWA 3ZFGA 1PK6C 2R49A 4LE4A 1RUOA 4RR3C 3M3EA 4K3UA 4DXZA 1PK6A 1QXJA 4P9WA 4UW6A 3OD4A 1KD7A 1CPNA 5IUQA 2WZR1 3CO2A 5KXEA 1Y9QA 2D3PA 3FJSA 3MYXA 2AR6A 2JG9B 2VMIA 4IEQA 4EJRA 2KA3A 3JQWA 5JIAA 4TSVA 3GBFA 1B35C 3OPZA 1REDA 5DDJ1 1C8M2 1PIV1 4WM8B 4YM0A 3CEWA 4L11A 1A8MA 3OBRA 4MGIE 2GMPA 3PMEA 3WY6A 1PVXA 1UU4A 1VR3A 3MI8A 3U4XA 1RUC1 5CG9A 3AMMA 2NPIA 4YLZA 5CNAA 5BNOC 1PVC2 1Q8PA 4WM7C 4R8HA 2VQAA 3ZDSA 2UYAA 3DPRB 3KCCA 2XKOA 2ZHLA 3O0VA 3AYAA 1UZZA 4S2FA 1JN2P 1QOOA 2WKKA 1H4GA 4SLIA 1MVEA 2YMZA 4MXWA 5BY5A 4AGGA 4Q1PA 5T5LA 5JZGB 1GLHA 4AK3A 2PN5A 2DCYA 3VZNA 5BYNA 3AYDA 2PFWA 3R6SA 3N7KA 1KRIA 3O5SA 4CEYB 3WR0A 2CGPA 5T52A 3MFAA 1ND3C 2Y26A 1BYHA 2A6YA 5H9RA 3UKNA 3CLPA 5GJ6A 4EN9B 4LO8A 2DYCA 1RMU1 4I02A 5CU1A 2H0BA 2LALA 3FLRA 3SCHA 1LOBA 1H4HA 3LKJA 1ZZ8A 1UIJA 1PM7A 3MIEA 2BW8A 3WQ7A 3P3NA 1AR61 3ZSEA 1FYUA 4MUVA 4ZU7A 4QPIC 1S0IA 4ITCA 3RI8A 2XWBB 3MW2A 2QE3A 4GWNA 2I74A 4RS5C 1QNWA 3MW3A 1VAMA 2BFUL 3ETQA 2KM2A 4AFAA 1UIKA 1X36A 4P9JA 4ATFA 3KQRA 4YZ1A 2R1DA 1FPN2 3HWJA 2D6KA 1ENQA 1CVNA 2E7QA 3WUCA 4GWMA 2YV8A 4MXVA 4AI3A 1AR82 2BFUS 2OZJA 2XJTA 4LTAA 2A6ZA 3ZXDA 1S1AA 3AKTA 3RG0A 4COUA 4XMAA 4KGGA 3AM2A 1O7FA 2HWB3 2R063 2HKXA 3HMYA 1FNYA 1UU6A 5H9SA 3RMXA 4YGBA 3WQ1A 5KWRA 1C3HA 1ZZ9A 2WINB 1IPKA 1C1FA 2D97A 1RB8G 4XPVA 2K9ZA 3M8LA 4BM8A 1H2MA 2YROA 1BVP1 1VRH1 4QGMA 3LSEA 2O0OA 4PDWC 1AR73 4RHV3 5EWSA 4YW2A 4EWDA 3JD72 1WLDA 3MW4A 3AXEA 2DU1A 1JOJA 4WZFA 4R4ZA 1R082 1FMD3 3VBSC 4JDMA 5CIRA 2VOKA 1G9AA 1I1EA 1AXYA 1X33A 1AXZA 4AVSA 4JTOA 3SISA 2RR12 4X8PA 4AVBA 5CFCA 1V9U1 4COWA 1OD5A 3WUDA 4BIFA 1QDOA 1VB2A 2GN7A 3LCPA 1RUH1 3ZN6A 2DFCA 4BHPA 1RHI1 2I2SA 3N3HA 2DV9A 5ABJA 3WDXA 5I8YA 3DGTA 2Y0OA 2XJRA 3IDCB 4JDNA 3NSTA 3OCPA 2FZ2A 3AJZA 2RS31 5EV7A 1VBB1 4PLNA 1C57A 1S0DA 1LHUA 2ERFA 1NCQB 2VVDA 3IM0A 4GMP1 4N53C 3FZ3A 1J1TA 4JRLA 1R091 3DF0A 1MS5A 1AR93 1D2SA 3RI9A 1QGLA 4ES9A 3MF6A 1QXRA 2BNNA 1Z7S2 2ZGPA 1GYKA 1BK1A 3CNAA 4WM8C 4W65A 1D4M2 4FQZA 1OFSA 5D8AA 2SLIA 5FLHA 1NCRB 4GQ7A 3DL3A 1U12A 1V70A 2D6MA 4WV8A 4GH4B 1ZBE3 1NE4A 1MR5A 3HT2A 2MEV3 5TSWA 2WFF2 3DPRC 3PLQA 3QBQA 4AI1A 4XBQA 2K0GA 4FAHA 3R4DB 1ZA4A 2B42B 3VBRB 4LBNA 1DF0A 4Q4V1 3H7JA 1AYM2 3T2TA 3VZKA 4UBHA 5GZGA 4OULA 2GH8A 4YFWA 4AXOA 4RQPA 3KMHA 3AFGA 1I3HA 3KT4A 1Y3TA 1URXA 2ET7A 1UW8A 2RS52 3ACLA 1MZ5A 4UXAA 2XHKA 1BXHA 4A7KA 3ILFA 1NQJA 1OLQA 1C8M3 2H6BA 2WSVA 4CEYC 1PO21 2BBVA 2JDZA 2H0VA 2WJSA 3ZSMA 2AZ5A 2BNOA 4MVTA 5JSOA 3SCGA 1NA1A 3M2MA 1GANA 4OLLA 3J8F1 1D4VB 3TN92 4HPKA 1YWKA 3RRDA 3N7MA 1CAVA 1JHNA 4JV4A 4YYOA 3IBMA 4ZKTB 1O91A 3BIWE 4XXPA 1O4ZA 4KL1A 1N1SA 2JENA 4NHLA 1U5XA 3GZAA 5ACA2 1QJZA 3RDIA 4YG0A 2O8OA 4LUMA 2OYZA 1POV1 1RUE3 1VBC2 2HWD2 4MSVA 3ZPYA 1FOD3 3EHKA 2X53S 4P14A 4R9AA 4CDXA 2ZS6B 5DUWA 4FPOB 3ZSKA 5C8CB 3LA3A 3AZVA 2O8QA 2YDEA 4J6GA 2IXHA 1WW7A 1NZCA 4GB31 1ENSA 5FCCA 3AZXA 1GBGA 3ZYJB 4AVVA 3ZXAC 1OI6A 4U36A 3USUA 4GULA 3RYPA 1WW5A 3GF6A 4CDQA 4DPNA 1MQTC 4OUMA 3ZMNA 3MICA 4HSJA 3VHPA 4XETA 3NVCA 2YUEA 1VBD1 3RPQA 1DG6A 1RUI2 5I0SA 1RUD2 4JTNA 2GU9A 1J3PA 2TNFA 4A7ZA 1JYIA 3H1MA 4XF4A 1W39A 1MZEA 3NJZA 4Q4Y3 3VBHC 4DY5A 4HVQA 5JIUA 2BNMA 4FPCA 1SBFA 4FPKA 1UPIA 1QJU3 4IESA 1CR7A 1NYWA 3VHNA 1ZVFA 1BVVA 1XE7A 1YIPA 5I8SA 3BU7A 3R05A 2EXIA 5JOWA 1HKDA 2G9FA 2EAKA 1SLLA 1DQ2A 2XUMA 1YFUA 1R1A3 2WNUB 4XEZA 3N4MA 2WLPA 4E2SA 1FI2A 1HLCA 3CL1A 3O7OA 4D3WA 2WNVB 1S2KA 2R043