2OUJA

The crystal structure of the thrombospondin-1 n-terminal domain in complex with fractionated heparin dp8
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
204
structure length
204
Chain Sequence
SVFDIFELTGAARKGSGRRLVKGPDPSSPAFRIEDANLIPPVPDDKFQDLVDAVRTEKGFLLLASLRQMKKTRGTLLALERKDHSGQVFSVVSNGKAGTLDLSLTVQGKQHVVSVEEALLATGQWKSITLFVQEDRAQLYIDCEKMENAELDVPIQSVFTRDLASIARLRIAKGGVNDNFQGVLQNVRFVFGTTPEDILRNKGC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thrombospondin-1
publication title Heparin-induced cis- and trans-Dimerization Modes of the Thrombospondin-1 N-terminal Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 52
structure length 204
sequence length 204
ec nomenclature
pdb deposition date 2007-02-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2oujA00
4W65A 3L2YA 5GJ6A 4Y24A 4XJZA 2GN3A 1GLHA 1LOFA 1YI7A 4UW6A 1DIWA 5GZFA 2R0HA 4GKXA 1OKQA 4FPKA 1FNYA 2AH2A 5FRAA 1D0HA 4Y26A 3AZVA 2E53A 1LHVA 1CR7A 4F83A 1WD4A 4BPZA 1FATA 1UL9A 3AP7A 3FUQA 3O12A 4GXLA 4JRAA 4LBQA 5IUQA 4LBJA 2JKBA 1MS9A 1QGLA 1WLDA 3AXDA 3NV3A 1DYKA 4BMBA 3SNMA 4GA9A 1MZ6A 4Y22A 1AZDA 4FVVA 3R4SA 2CWSA 2ZMNA 4AWDA 1LECA 4BLIA 2ZGNA 3WHUA 1AX1A 1HDKA 3M2MA 1WD3A 2WSVA 2VH9A 5JOWA 3A0KA 3AX4A 1LGNA 1QF3A 4XXPA 1WW4A 1IKQA 2EF6A 1PZ9A 3IKWA 2JJ6A 2W08A 4XE9A 3USUB 4WVVA 3VKNA 4YW4A 3IN9A 3UL2A 1N1YA 2A6ZA 3TB0A 2FMDA 4D69A 1MS5A 1KJRA 4XOGA 1O4YA 2A75A 5GLVA 1WW6A 2NN8A 2NYYA 3OBRA 1CPMA 2ES3A 1W6MA 2ZHNA 4XTMA 3WDTA 3R05A 1JYIA 2ZHLA 4XHXA 5L73A 1I1EA 1JW6A 4XIKA 1A3KA 1DQ5A 3N36A 2UU8A 3ZXKA 2EAKA 3MW3A 2PHTA 4CRQA 1UMZA 2XB6C 1N47A 3D4KA 3MEPA 5HCBA 1UZYA 2A3WA 3APBA 3AZWA 5GLZA 3AYAA 4FOWA 1BYHA 1VIWB 5E89A 2JE7A 2OUJA 4YW1A 4TYSA 4BMEA 1LU2A 3TAYA 4WV8A 4BLJA 2PHWA 3AJZA 5IK4A 1CQ9A 2DVFA 1G8WA 2GNDA 1SFYA 1LOBA 4Q2FA 1DQ4A 5DG2A 1BXHA 5GZEA 3ZPYA 4AVVA 3B00A 2VW2A 1YIFA 4FP3A 2CWMA 2PELA 3WV6A 4Y1VA 1ULFA 1Z78A 2GNTA 3WHTA 1ENRA 1GNHA 3WDWA 2ZHMA 3AFKA 1ENSA 2A5ZA 5KXDA 3BOPA 4ZXKA 1GKBA 1G9DA 1N3QA 3NV2A 1DQ6A 3MPPG 3M1HA 1R1ZA 4YZ1A 1N3OA 3VKFC 2ZAAA 1U0AA 5JMCA 1AJKA 2UWAA 3UJOA 2DVDA 2DUPA 1WLCA 2D6MA 4GKYA 2R16A 4ISRA 3V65A 4ATFA 2AREA 1SBFA 3ASIA 1V6NA 3KQRA 3NV4A 4LBNA 5H9RA 1MR5A 3O0XA 5LK5A 1SLAA 2OVUA 1WLWA 3M3OA 3ZVXA 4ASMB 2H0BA 1S0CA 3M3CA 1LODA 4YGEA 4FPOB 1DFQA 2ZGPA 1H30A 1IS6A 3AP6A 1ENQA 1W6OB 2D6NA 4R9CA 5EYXA 2NMOA 1ONAA 2ZA9A 3DGTA 3WZ1A 1SBDA 3H0OA 2JECA 1LTEA 1AJOA 4UW4A 4DPNA 5JDBA 3O5SA 2P3KA 2GMMA 2I2SA 1TEIA 1YYNA 1KITA 4LBLA 2PHRA 1SCSA 1LEDA 4XJ9A 4PBOA 4TZDA 1F5FA 2ZGOA 3OBTA 2D43A 1GZWB 1HQWA 2B7YA 2RHPA 5JOXA 2DU0A 2ZGMA 4YZ4A 1WUVA 1BZWA 1A8DA 3M3QA 4R9BA 3ZSLA 2R1BA 4Q8LA 4HANA 3WDXA 3ENRA 3V0AB 2A70A 1ZA4A 2ZGUA 3T2TA 2CYFA 1W6MB 4AVTA 5IK5A 4RL7A 4PCRA 4YW3A 1MS1A 1V00A 1AX0A 3AYDA 2AGSA 2VW1A 1G9FA 3Q9OA 4M3CB 4XIOA 5T5OA 4XJAA 1S0DA 4Y1ZA 2R1DA 5T54A 5JOYA 4DRVA 3UJQA 4C1WA 2E7QA 1QU0A 2GNMA 3PVOA 3R4UA 1LOCA 2AENA 4FPEA 4FP2A 4NOTA 3RMYA 2A6XA 4FOVA 1W6OA 1AXKA 1FAYA 1CESA 3AZZA 1CJPA 2E6VA 2BQPA 2GMPA 3ILNA 3WNXA 1JN2P 1S0EA 3WUCA 2SLIA 1QKQA 2P3JA 2P37A 1I3HA 3M3EA 4PQ9A 2E7TA 2Q5TA 1PZ8A 1S0IA 4XBNA 3WVJA 3SLIA 3SH4A 3WCRA 1KJLA 5SV8A 1YRZA 3AP4A 3FUOA 3PVNA 1IKPA 5AVAA 2LALA 3WUDA 1G9BA 1GZWA 5H9SA 2D6OX 2A3YA 4Y1UA 4NO4A 4SLIA 5CA6A 3ZSJA 1H9PA 3B01A 2YMZA 4U36A 1W0OA 3I8TA 4Q26A 1FX5A 5T5PA 1CN1A 4XXAA 3VKOA 3V0AA 2ZHKA 1VLNA 3A4UA 1DBNA 2V5YA 3IMNA 3AYCA 1WBFA 1AXYA 2CY6A 5E88A 4L8QA 2SBAA 3N35A 2UURA 1HQLA 2NM1A 2D44A 1CVNA 1LCLA 1MS3A 2AUYA 4M3CA 3VKMA 1KRIA 1S0JA 1APNA 4AGVA 4AGRA 2CL2A 1V6KA 2A6YA 3FFZA 3PMEA 4XBQA 2D6LX 4WVWA 2NP0A 4OZXA 4WZFA 1WW5A 1UZZA 1FV3A 1CONA 5CAZA 1ULEA 1LENA 4FPHA 5T5JA 3LCPA 4M01A 2GDFA 1GZCA 5FREA 3FLRA 2ZABA 1MS4A 3D5OA 4CZSA 2D3PA 1V6JA 1UKGA 1QDOA 1CIWA 2PHXA 3IM0A 5KXCA 1OQ1A 1LOFC 2P34A 4U2AA 5DZGA 5GALA 5JOZA 2ZGQA 4XHBA 1PZ7A 3ZYPA 4LBOA 4K20A 1LESA 4H55A 1O4ZA 1MACA 3LSDA 3N7JA 2VXRA 5H9QA 1ULGA 2PHUA 4LBKA 3NWKA 3OPZA 2HYKA 1LEMA 4XZPA 3WG4A 1AX2A 4Z8BA 5IT6A 4Y20B 5DUWA 1DLLA 5KXBA 2ZBJA 2ARBA 4FPFA 1SLLA 1G9CA 3AZXA 4M3CF 2GN7A 3V64A 1LHOA 1LU1A 1NLSA 4K21A 4BM8A 2ZMKA 1LGCA 1SLCA 1W6QB 1W6PB 1JOJA 1KDMA 1X50A 1MVEA 2ZMLA 2EXJA 1ULDA 1YXWA 3FBYA 3O0VA 4P9XA 4DFSA 4YM0A 3SH3A 3T1MA 1RITA 3QLQA 1J1TA 3GNEA 5GZGA 2DUQA 3MW2A 4YM3A 1DQ1A 2WJSA 1QOSA 1ZM1A 2P2KA 4MYEA 3ZSMA 4UW5A 5JVVA 4FPLA 3N7MA 4XJUA 4DQAA 3JU9A 1BKZA 4K1YA 5DXDA 2EIGA 1SLTA 2A6VA 4FPCA 3ZXEA 2EXKA 5F9TA 1C57A 5F5QA 1S0GA 1IS5A 2YXSA 4YM2A 4ATEA 1DGLA 1Q8QA 2DTWA 2WT1A 2OUHA 5DUVA 4YM1A 4YZ5A 1Q56A 2D3RA 1LULA 4FPGA 5IK7A 4YGDA 2OW4A 5KXEA 1UX6A 1WW7A 5EYYA 3QCWA 4CTEA 5JLVA 2W52A 5E8AA 4UW3A 1FV2A 2V73A 1LOEA 2DUOA 2GNBA 2ZGKA 5DUUA 1XQNA 3UK9A 4BQ1A 4JC1A 2DTYA 4FQ4A 2NZ9A 1NXD1 1N1SA 2CTVA 1DYPA 3V0BB 1B09A 2YY1A 1MZ5A 4YW5A 4Y20A 3WG1A 1EPWA 2EXIA 3RMXA 1W6NB 2WT2A 2DWRA 1UN1A 3PJQA 2WQZC 1W6PA 1W6QA 2G4IA 1AXZA 2P3IA 1HLCA 4XBLA 3SISA 5CB7A 4YGCA 4ITCA 2ARXA 4K1ZA 1VAMA 4FQZA 4XMIA 3ZXFA 1G9AA 3FLTA 5T50A 3W58A 3VV1A 3ZXJA 3OGGA 5BYNA 2XG3A 3JUUA 3A0NA 1JXNA 4YFWA 2WT0A 1RIRA 2ZGTA 4P9WA 4HL0A 4Q1PA 2VU9A 3T1LA 2PHFA 3OY8B 4Q27A 1V6IA 2VW0A 2D6PA 1G7YA 1VAVA 2DVGA 2W68A 2YROA 3N3HA 1D2SA 3ATGA 4I30A 4IQPA 5DZFA 3RS6A 2WSUA 4RA0A 3AJYA 3WG3A 1QOOA 4DRRA 5DG1A 1KQRA 2A6WA 1N1VA 1FNZA 4DS0A 1RINA 2DVBA 2VUAA 4Q8KA 2E51A 4R9DA 1V6LA 1WBLA 4GALA 1S0FA 1OFSA 1G86A 2CNAA 5GZDA 5T5LA 1QOTA 1BJQA 1IOAA 1UAIA 4FPJA 3V0BA 2GALA 3RQ0A 4YG6A 4FOYA 3KM5A 2LTNA 1IS3A 1N3PA 1MVQA 2KM2A 1GV9A 3IPVB 4XTPA 3RSJA 3C2UA 3ZXLA 1Z0HA 3WCSA 1W6NA 3BTAA 1UPSA 1GICA 1VALA 3B9CA 4JCKA 4XILA 1Q8SA 4KBBA 2AYHA 3HMYA 4PBPA 3POSA 2R0FA 3HN1A 1GYKA 2YV8A 5HCFA 4PF5A 2D7FA 3ILFA 1SBEA 4AYUA 3WG2A 4YG3A 1W0PA 2R49A 3GALA 4FOQA 2DVAA 5DUXA 5GLUA 3VUOA 1LOAA 1F31A 3BODA 4GWNA 2C5DA 4YFZA 3DUIA 3OY8A 4Q1RA 3AZYA 1LHWA 1F9KA 3INAA 3NV1A 1GZ9A 2JDZA 3OYWB 1Q8OA 5EWSA 3OJBA 4XYXA 5CBLA 3WDUA 1Y7BA 2WLQA 4P9YA 1N1TA 3AK0A 3O0WA 1JUIA 5T52A 5GLTA 2NMNA 1SACA 2ZACA 2ZZJA 2WNEA 3SITA 1V6MA 2UWCA 3ZSKA 2AR6A 2DV9A 2VY0A 5CNAA 4R9AA 1AF9A 2JD4A 4LBMA 2ZGLA 3AP5A 4YGBA 4Y1YA 2EALA 2TEPA 3IPVA 3D6EA 3WDYA 3RG0A 1AVBA 1MS8A 1LJ7A 3MW4A 3WLUA 4GWMA 4YG0A 2DYCA 4M00A 1YO8A 3POWA 4AVSA 1LOGA 1JYCA 3BIWE 3USUA 1ULCA 2GMEA 2A7AA 3WDVA 1JBCA 1DHKB 1QNYA 1DZQA 5GZCA 1Q8PA 4YZ3A 5EXOA 2D6KA 3SH5A 1SCRA 1V6OA 2WKKA 2ZKNA 4XDQA 3B69A 1H9WA 3AYEA 3I4IA 3CNAA 4ZKTB 3LSEA 4AGGA 2YZ4A 2DU1A 1LHUA 2JE9A 3OYWA 4FPYA 4LBQB 1IS4A 1Q8VA 4LBQD 4XJ8A 1DQ0A 1WCSA 3U4XA 1FYUA 1URXA 1GSLA 2ZGSA 1GNZA 5T55A 1QDCA 2D3SA 1SLBA 4XMAA 1C4RA 1C1FA 3PVEA 1LHNA 5H9PA 1A78A 3AXEA 4M3CE 5IK8A 4XJWA 1SLIA 4Y22B 2DURA 2Z42A 3B3QE 5DZEA 1S1AA 4YLZA 3W59A 3POYA 2UWBA 1MS0A 3ZYRA 5HCAA 4YW2A 3RRDA 3HR9A 1CPNA 1HKDA 2A3XA 5GM0A 4C1XA 1DQ2A 1C1LA 1S0BA 2ZGRA 3FLPA 3N7LA 3VKLA 2C9AA 3AP9A 3N7KA 1QMJA 2ENRA 1JHNA 3ILRA 1GBGA 1KDKA 2FHRA 1LGBA 4YZ2A 4BOWA 1QNWA 2A71A 4Y1XA 1BQPA 2W39A 2ERFA 2EXHA 5GLWA 4P14A 3WOGA 4ISQA 1GANA
chains in the Genus database with same CATH superfamily
4K8FA 3V56A 4W65A 1GLHA 3C8XA 1YI7A 4NHMA 4DMIA 3ZKUA 5GZFA 4GKXA 1OKQA 3VBUC 2VTXA 4FPKA 2AH2A 2IWGB 1K5MA 5C3PA 1NXMA 3KVAA 3POBA 4INDA 4Y26A 1KS5A 5HV4A 1U5YA 3DPRB 4DUXA 1QJY1 1FATA 5IJRA 4AQ6A 3N9LA 2CGNA 3PDQA 4LBQA 1REFA 2Y26A 2JDPA 2Z79A 1NCRC 4PLOA 1ND2C 3AL6A 2OPWA 5FZ8A 2JICA 4BMBA 2WNUC 4COWA 5FPLA 1W39A 4HVQA 3S5AA 4QQLA 1AZDA 5LRSA 3TN92 2VVFA 3SKJE 1WLTA 1O3TA 4BLIA 2ZX4A 3WHUA 1ACCA 4QAWA 4D6QA 4EN8B 1IQDC 3ACLA 4ZONA 3GXUA 4FAGA 2EICA 4FCAA 5IVBA 4Y3OA 1OLQA 2VQTA 3A0KA 2IXLA 3FBMA 1W8NA 4NR1A 4XF9A 1LGNA 1QF3A 4MGZE 4FO9A 5LATA 3I3MA 1WW4A 4HN0A 1PZ9A 4XE9A 3VKNA 1CZVA 2IVIB 1GQGA 4WVVA 2HWF3 2VUJA 5B4NA 5J7MA 1XYOA 1GFF2 1OHFA 1RVF1 5FZEA 1MEC1 3SHRA 2FMDA 3KGLA 5C33A 4NWVA 1MS5A 2ADDA 1RUF3 4AI8A 3PIJA 4XOGA 1RUG2 1AR62 4AG4A 4QQOA 1BCXA 5IVCA 1WW6A 4XF4A 2A1XA 1ZRRA 2IXKA 2D97A 3VZLA 2XJPA 2XMLA 2ZHLA 2IXCA 1W05A 3NO8A 4EYUA 1ASJ1 1DQ5A 1OOPC 4W8JA 5FZOB 1YC61 2VMFA 2D98A 2XB6C 2QQUA 1X33A 4LHNA 4CCNA 5HCBA 5K8SA 1O59A 1PNFA 2BP6A 3AZWA 1NA1A 5GLZA 1BYHA 4HMZA 4Q4W2 4TYSA 1LU2A 4WV8A 5K4LA 4AQTA 1CQ9A 1EV13 2DVFA 1LOBA 1C8M3 3ZPYA 4DEQA 4A2UA 3KT7A 5AC92 3PUSA 1YIFA 4FP3A 2ZJCA 1E5IA 1OA3A 1YJKA 2OZ6A 2RDQA 4Y1VA 1UKRA 1W3XA 1Z78A 5A3PA 1VBC1 1W90A 4OQ9A 3I3EA 1ENSA 5KXDA 1F8VA 3BOPA 1GKBA 1W0NA 2RDRA 1SEFA 2Y6FA 5FZAA 2XBO3 1QJU1 4AHWA 2WS92 3T08A 5D1IA 4AE2A 2ZAAA 1U0AA 3LGRA 2VM9A 2W0XA 2UWAA 3UJOA 2GC3A 1OQDA 1HXS3 1JODA 2V72A 4DXSA 4CDQB 4KQ7A 3M7AA 4DY3A 3EYPA 3ZVXA 1E5SA 3ACIA 3M3CA 2HWB2 1LODA 1XYNA 4GJZA 5FMOL 4FPOB 5HXVA 2NLRA 4N9IA 3FWEA 1IS6A 1EY2A 2PAMA 4GH4C 3RWKX 5FXZA 4NROA 2Z69A 5FP4A 3H0OA 1IHMA 3OEBA 4TLFA 2QVSB 3AB0A 1AJOA 4HXCA 1RVF3 4LQRA 5JXJA 3KCXA 3NAPA 2J1TA 2X09A 2GMMA 1XU1A 2I2SA 5CFDA 4YARA 4LBLA 3OUJA 1JYWA 2BJSA 4QDRA 4MVTA 3BIEA 1UYXA 5J98B 2Y0OA 1F5FA 3WP6A 1SFPA 1XNKA 4A4AA 4XW3A 2D43A 2WQ8A 3CMGA 1HQWA 2W92A 3CF6E 2RHPA 3G6JB 3WW1A 4AHZA 1SZBA 3NMBA 1WUVA 3HNMA 1BZWA 1STMA 2W1SA 5FBZA 3JBG2 4HANA 3ZLIA 4QDQA 3ZYFA 3HAGA 2CYFA 5IK5A 1DLCA 4PCRA 2VOVA 1O91A 1V00A 1AX0A 3AYDA 4WM8C 2AGSA 4OHVA 4OI0A 1G9FA 5HPOA 1R1A1 2JG8A 4UBHA 2R071 2WZR1 4XIOA 5A3LA 1S0DA 4JKMA 3OGVA 1J3PA 2OS2A 4J6GA 3ETQA 5BNOC 4SBVA 3WX5A 1UU4A 3UJQA 3H8RA 4C1WA 2W46A 4D7SA 4NOTA 1C3HA 1QXJA 3RMYA 2ZTNA 1AXKA 3BYWA 3POFA 5F3IA 2QZ2A 3TEXA 5LBBA 5LB6A 3PMSA 4LKSA 3JZVA 2JIJA 5DAQA 5A7PA 3KLSA 3WW2A 1X36A 3ILNA 1X8EA 3PU3A 5FYYA 2RG4A 4Z1VA 5CFCA 1XXNA 2RS52 2IXIA 2BW8A 4H7LA 4CEYC 1O6UA 3QBQA 4DB5A 1KJLA 5SV8A 3MIHA 4IE6A 2BWCA 1YRZA 2YPJA 3FUOA 4KWJA 4IETA 3VBUB 1AYN1 1J83A 1RUH1 2VNRA 3NJXA 2VUDA 3VZJA 4EV0A 5FYBA 5JSPA 5L36A 3DXTA 4Y5SA 3LAGA 2AEYA 3AVRA 4NO4A 2MEV2 2W87A 4W6WA 4AL9A 4GMP3 1H9PA 5CA6A 2HWC3 3UKTA 1FX5A 4XFCA 4EWEA 4K9SA 3BOWA 3J7LA 3VBFA 3O1PA 4LO4B 4PIYA 3KZ4C 4XXAA 3A4UA 5D8AC 4YW6A 5BXXA 2KR2A 3QOPA 2VL4A 3U0ZA 1NCRB 4IE0A 1ND2B 1LCLA 2AUYA 3A7QA 2RS13 4NIIA 5IWFA 3IDCB 2VZRA 2WNUB 4PF1A 1PK6A 4B1LA 4NPMA 2CL2A 1V6KA 3FFZA 4CU9A 5CG9A 3LEIA 1X8MA 3HJRA 1WW5A 4WM7A 3ZX7A 1FV3A 3K51A 4TXWA 1PO11 2J1VA 1FI2A 1LENA 2GC2A 5FZGA 3BTYA 2WFPA 4NN0A 1IQAA 5EPAA 2FDGA 1ULOA 4CZSA 2ETEA 2F17A 1ZBE3 5B2GB 1V6JA 4O9GA 3IM0A 3H1MA 1UOJA 4META 2P34A 5DZGA 5GALA 4E2SA 4GZ9A 4XHBA 5LRRA 1CX1A 4LBOA 5EQUA 5LZ6A 2XJSA 1K5MC 1MACA 3ELNA 3LSDA 3GBWA 3ZOIA 5IATA 5KC6A 2QQPA 3BTZA 2OX0A 1YQ2A 2HYKA 5A7WB 1LEMA 4MX3A 1OOPB 4Z8BA 2VECA 2FDKA 4KG0A 4XF1A 4Y20B 5A6QA 5KXBA 4MXWB 2PLV1 4IUGA 3JD72 1US3A 4M3CF 1DGRN 2HWD1 4PDWA 5FYTA 4K21A 2VOWA 2Z2SB 2FMYA 1W6QB 3AKPA 3J8F1 1X50A 2ZMLA 2EIBA 2EXJA 2O8OA 1YXWA 1YFUA 3FBYA 4P9XA 4UBGA 4CDWA 2VVEA 4Q4V2 3GNEA 2C9KA 4Q0QA 1TNFA 4QHZA 1QOSA 1UD1A 3USSA 1VR3A 5DAPA 3SCHA 4CPBD 3ZIWA 3VBSA 3MF6A 4MV2A 1W9TA 2ZOEB 5JVVA 3VL9A 2V4AA 2VUCA 4BQ3A 3JU9A 1BKZA 1DDLA 3O1RA 3I3DA 3MUY1 1SLTA 4FPCA 1UZVA 5JR2A 1IS5A 1OH3A 4AEJA 4EN7B 1YFWA 1DGLA 3X29B 4JHTA 5FWEA 1UIJA 5GKAC 1Q56A 2HH9A 4IEZA 3LD8A 4A45A 5JZGA 1WCKA 1ZRIA 3WF0A 4IGPA 5IK7A 2XH6A 1UX6A 5ANNA 1OVPA 1AYM2 2PQSA 3NJYA 5EYYA 3T2OA 1J59A 1U5IA 1ZZ8A 1W2NA 2BZDA 3AMMA 1FV2A 4JQTA 3LDBA 3MIFA 4XCBA 1LOEA 1O5LA 3KS7A 3WNLA 4ZS2A 5FP8A 3ZFEC 1K5JA 1NXD1 1N1SA 3WY6A 1RUNA 3ORJA 1V9U3 5L9RA 4KH9A 3AVSA 1VBE2 3WG1A 3TEZA 2E33A 4IEQA 1NA1C 1BK0A 4GH4B 3RMXA 2WT2A 2ADEA 1H6YA 3CZJA 1H2NA 2VZVA 4QB1A 5D2AA 5C5TA 3O1OA 1M06G 4M4PA 1AXZA 3H8UA 1FT9A 1RMU1 2ZEXA 1HW5A 2ARXA 4ZY9A 4XMIA 1VAMA 1W99A 2Q1MA 3GZEA 3MDPA 3Q8AA 3TWIA 3KV9A 3W58A 4MLOA 2ZEWA 3W20A 3JUUA 4JKLA 4O9EA 4NHKA 5FY7A 4B4RA 3C7OA 2VZPA 1RIRA 1ULPA 4ES8A 3VBRA 4COZA 2VU9A 5FWJA 4Q27A 3T0DA 1BMV2 5JPMB 2QJVA 2W68A 3VHRA 4LUMA 5DZFA 4COVA 2WSUA 3J7MA 4XABA 4CXWA 3AJYA 2JD9A 1JS9A 2A6WA 4OULA 3ZDVA 1QWRA 3J8F3 5A32A 1LRHA 3IIAA 4WM8B 4IEYA 1NE4A 3ECQA 3PUAA 3VLBB 1PVC2 4ZU4A 3KGZA 2BGOA 2R041 1G86A 3I3QA 4R4ZA 5GZDA 5BNOB 2L9LA 4BK4A 4KWLA 3ROUA 2ZX3A 3CKHA 4YG6A 4FOYA 2VZSA 1C5IA 1HJGA 2KM2A 5CADA 1BBT2 4OHZA 3WCSA 3T2PA 3BTAA 1VALA 1EAH1 2XL7A 1NY71 4KBBA 2AYHA 4RGKA 3NAPC 4WVMB 3HN1A 1GYKA 4OQ8A 5CFDC 4XDPA 1NOVA 1S2BA 5FY0A 1SBEA 2GP3A 1WZXA 5CEHA 4CEYB 1D4M1 1RUI1 1VPHA 3UV9A 4L9BA 4CDXA 3TN93 5DUXA 2E9QA 3WF3A 2QDNA 3GF6A 4GWNA 1ZRCA 3DUIA 2XVGA 4MGIE 1LHWA 5A3NA 2DFBA 2HLEA 3KV4A 3E6DA 1OFNA 2E7AA 4RHV2 5FO8B 4GULA 3WP5A 3DEMA 5A7NA 2WUHA 2WLQA 3QD6A 3G7DA 5D8AB 2HKXA 3O0WA 5T52A 2JG8C 4GWJA 3K46A 4CP0A 1GR3A 1OC1A 1QJY2 5FXVA 1RUG3 3JQXA 4LIVA 3VD4A 2WNEA 4AQ2A 2P4EA 5C3QA 1QQP2 2DV9A 3KT1A 4B3NA 4R9AA 4BZ4A 2Q0AA 1IPSA 3AM2A 4P08A 1F35A 5FKCA 2MPFA 4XQ4A 3C7HA 3D6EA 1UY3A 3J7NA 1AVBA 5FCCA 3RG0A 2ZZQA 2XVKA 4AFAA 3MW4A 4P9JA 1RYYA 2R7EB 1C5HA 3POWA 2WZPP 5CFCC 4CCOA 1LOGA 3BIWE 4JVAA 1ULCA 2XR4A 1OPOA 3EMRA 1DHKB 1QH7A 3MBWA 2TBVA 2HWE2 5G04L 3UNPA 1NE6A 4HKWA 4XUOA 2EIEA 1K5MB 1I6XA 1V6OA 4XDQA 3B69A 1MEC2 5EIYB 3CNAA 3LSEA 4AGGA 3SCFA 4OHWA 4JGYA 4P9IA 1NAEA 5FJKA 4E2QA 3NSTA 1PNGA 2JDUA 1ZBA1 4LITA 3VBFC 3OYWA 4IW3A 4MG2A 5C70A 4LBQB 1ODNA 1Q8VA 1CWPA 4LBQD 1UXXX 4EWAA 1FYUA 2X8KA 5T55A 1GSLA 2ZGSA 1GNZA 4KGQA 4C0HA 2D3SA 4FAHA 1SLBA 2VGDA 4N7IA 1YIPA 1PK6C 3LEGA 4Q0SA 1SLIA 2ZX1A 2DURA 3MHZA 1JYNA 4LKEA 5DMYA 3ZYJB 1S1AA 4Q29A 4NUBA 3W59A 3POYA 2UWBA 4HG6B 2RMU1 3WW3A 1FOD2 3ZYRA 3KV5A 4PI2A 4WM7C 5JI7A 3VZMA 3PNAA 2VR4A 1DGWA 5FY5A 2QNKA 4C1XA 4CCEA 1GMMA 3I2DA 1J1LA 5FQ0A 3AP9A 2QDRA 5JAXA 4DY5A 2ENRA 2HWB3 3ILRA 3OD4A 3NJZA 4CDQA 1LGBA 2W1WA 2Q8DA 4Y1XA 1X7NA 3PLQA 3VBOA 2W39A 1UOBA 2EXHA 2GC0A 3RWNA 3WOGA 1JYVA 2VQ0A 3L2YA 5GJ6A 4Y24A 4MZUA 3C7FA 2RJKA 4XZUG 5FPUA 3C7GA 2LROA 1RUJ3 2R0HA 1NCQA 3SEEA 1SMVA 2NPIA 4GIQA 2QTWB 1CAXA 3I2KA 2FDFA 4F83A 4BPZA 4XFFA 1UL9A 2IZWA 4PDWC 1AR93 3AP7A 4ZZ5A 3O12A 1OUSA 4GXLA 4AQSA 1NA1B 5IUQA 3WNKA 1TMF2 4MGSA 4CDWC 2GAUA 4BXSV 4I09A 4V1PA 1WLDA 3ZYBA 1DYKA 2ATFA 2YU2A 3SNMA 4XF3A 2EAAA 2ZMNA 3JCIA 1HDKA 5I8TA 1W8UA 4NIGA 4FI9A 3ZN4A 3M2MA 4QT6A 5DAVA 1HRV1 2I45A 1G6NA 3FZ3A 3CLPA 3AX4A 2VMDA 4QXKA 3IWZA 3IKWA 1RUD1 2CU5A 5F5CA 5JZGC 3VZKA 3USUB 2FZ2A 5I0SA 3EHKA 2VCBA 2XL9A 1Q43A 1PGL2 1F15A 4YW4A 3UL2A 2W1QA 3IDEA 5C8CA 1ZREA 3I2JA 4LLOA 4Y4YA 4OI1A 3HVDA 4GWIA 4Z2WA 1O4YA 2A75A 5DDJ3 3NKGA 2RS53 1W6MA 4XTMA 3WDTA 4Q4X1 2JX9A 4FTEA 1RB8G 3HQUA 1I1EA 1D7PM 1JW6A 3JB4C 4PLNA 2VQAA 4XIKA 1A3KA 1ZVFA 2WO3A 3MIGA 3N36A 2UU8A 3PURA 2RR11 4ZHNA 4P5HA 3MV01 4LXLA 2XPJA 3RZHA 1QJZA 4B7KA 2FDIA 4JQRA 1UMZA 5F5AA 3T0BA 3MICA 3MEPA 3T3YA 1POV0 1CX4A 2RVAA 5FLHA 2MEV3 4MGTA 3AYAA 4LK6A 2JE7A 2OUJA 4BMEA 2J1AA 5LEJA 3PUQA 4LNVA 1VBB2 2DCKA 2PHWA 3NAPB 4AHXA 2CDPA 5FZKA 5CFDB 4Q2FA 5FZ4A 5DG2A 1MQTA 3VDCA 2YFZA 4LULA 3B00A 2VW2A 4UI9L 2E26A 1VBD2 3VBRC 3WV6A 4N7UA 2WWSA 4GB32 1OQEA 2CHHA 3WQ7A 2WZ8A 1GNHA 4OZOA 1PGW1 4KU7A 2VG9A 4W6XA 5CKMA 4HLTA 3KSCA 1H2KA 1JMUB 1N3QA 3NV2A 1DQ6A 1TQ5A 1GWKA 1G9DA 2JWPA 5FUPA 4XAEA 1WMXA 4QXHA 4A7YA 3HT2A 1AJKA 3BUCA 1F2NA 4OI2A 5FY4A 3RPQA 4GKYA 3HQRA 4XFIA 2Q8CA 4CEWA 4ATFA 3KQRA 5H9RA 3M70A 4OFGA 1MR5A 2HWF1 1US2A 2ORXA 3M3OA 2FZ1A 2FDHA 4ASMB 1NLQA 2FBEA 4DZGA 5F3EA 4UWDA 1DFQA 2FCTA 1RUF1 1VJ2A 5FZLA 4CCCA 3AP6A 3WZ1A 5EYXA 2NMOA 2ZA9A 2WZEA 1XJAA 3F95A 3S6PA 1SBDA 1YFXA 1DCSA 4AEKA 1RUD3 2JECA 3UGHA 5A6ZA 1T6GC 3JD73 1H8TA 4R8HA 1W2TA 4Q0PA 4DXTA 5I91A 3K75B 5FPBA 1UY4A 2JE8A 4A44A 2UY9A 1TME1 5CFCB 2QFEA 4JDMA 3U78A 1RXGA 3ZXAC 1FMD1 2WAOA 4Q4V3 3FHIB 5FIXA 3WINE 4CDXC 3TRSB 1HB4A 2TNFA 5KWRA 4TZDA 3GZUC 4XUPA 3KB5A 2W2IA 1OD3A 4LTAA 2B7YA 4Y33A 1W8ZA 5JOXA 2DU0A 2WQ4A 3O1VA 1A8DA 4Z92B 3AKTA 4PIZA 2RR13 1EV11 2WFF1 4P00B 2WYSA 4FXGB 2VZOA 3BGAA 3HBKA 4Q8LA 1C8M1 5FY1A 5BPXA 3GJBA 1W8WA 3VBFB 5FYCA 1AL21 2A70A 4QM8A 4DIQA 3M8LA 4QGLA 5E1RA 3T2TA 1UY2A 2B5HA 4UFLA 4RL7A 4AVTA 4BQWA 2BBAA 4YW3A 4LLFA 5CYYA 5FAXA 4AI9A 4HKLA 3S0MA 5ISLA 2QQWA 2WNOA 3IDAA 1LKNA 3FHQA 1PK6B 3VZOA 4ZU7A 1AYM3 3EXUA 5FXXA 1RGSA 5T54A 3RJ2X 2XXZA 4BISA 4Z2AA 4DXZA 1UCXA 5J48A 3HOBA 1OA4A 2RDSA 3K77A 2XBO1 4XUNA 5LASA 3GHNA 3TNQA 4QU2A 4WM7B 3T2QA 3PVOA 3U11A 3RZGA 3S30A 2YG0A 4FPEA 4LUKA 1R082 1HXS1 2GSYA 1W6OA 2R32A 3IT8A 2WLPA 2K2SA 1OSGA 4NAOA 5FYZA 1VBE3 5FZ3A 1FAYA 1HN0A 4ASKA 1CESA 1PMHX 5CVRA 3BB6A 3ZXGA 2GMPA 4TWTA 3N9MA 4BXFA 2H6BA 2DF7A 2H0VA 3M3EA 1I3HA 2XDVA 4PQ9A 2Q5TA 2VMIA 3I2FA 4OMDA 3BCWA 3POJA 4XBNA 1H2MA 3SLIA 3SH4A 3WVJA 1DF0A 3DYPA 1QIQA 3PVNA 4A7KA 1IKPA 1EYBA 5AVAA 2QQKA 1G9BA 4MADA 5H9SA 2D6OX 2XLGA 3MI8A 3OTFA 4JGYC 2VCAA 4Y1UA 4E27A 2VC9A 3ZSJA 3B01A 2VZUA 1YNAA 2YMZA 3AKQA 4QM9A 4U36A 2YUEA 3K4ZA 2CAUA 3MIDA 4PDWB 1PX3A 1JOPA 1VLNA 2ZHKA 1DBNA 2V5YA 4X6RB 3ZSEA 4CDWB 4NIDA 4NVPA 3BU0A 1O7FA 2SBAA 2UURA 1S55A 2NM1A 2VZTA 3ZFEA 1TME3 3VKMA 5HCHA 4QXBA 1S0JA 2DCZA 1BHGA 1HV1A 1CIYA 1FMD3 1QXPA 3H50A 1PVC3 2HEVF 2W5FA 4NJ4A 4WZFA 3UESA 4D7TA 1A6CA 1REEA 5I0UA 2RS32 3IDBB 2D5HA 1KFXL 2PA7A 2YC0A 3LCPA 4JZRA 5F2WA 2WFF3 2XHNA 3FLRA 3VBOC 2BPA2 3D5OA 1BBT3 4BH9A 3NNFA 4AI1A 5JZGB 4LOSA 3CEWA 1AL23 4FFHA 4A41A 2PHXA 5KXCA 3E97A 1OQ1A 4QQ2A 1B35C 4Q4Y2 4U2AA 3LFMA 1GP5A 2ZGQA 2Q4SA 3NJVA 2E63A 5CIRA 3OBAA 2C0ZA 2WO1A 1NCQC 3MPBA 4H55A 5H9QA 2B8MA 2VXRA 2HYXA 1XRUA 4LBKA 1OMIA 3OPZA 3SCGA 2YPDA 1W03A 3H8XA 1AX2A 5IT6A 5JMOA 5I0RA 5DUWA 3WT3A 4QKBA 5C3OA 2ZBJA 2ARBA 2QQOA 1HRI2 3LPGA 3AZXA 4FPFA 4RD7A 2Q1FA 5A3MA 1BK1A 2VTXJ 1LU1A 3DL3A 1LB2A 1UNBA 2ZMKA 1QJX2 2JDHA 4KNCA 1MVEA 4RHV3 3T1MA 3UETA 3QLQA 3ZYGA 5GZGA 1K12A 5A80A 4AF9A 1EUUA 1VBA2 1DQ1A 3MYXA 1RUE2 1ZM1A 4EZHA 4YM3A 2B9UA 1CAUB 2P2KA 2V09A 3AKRA 4GMP1 2HWC1 1W9SA 4XJUA 5KHHA 4AEMA 4DQAA 1EAH2 1NUKA 4K1YA 5BNPA 2EIGA 3VBRB 4QPYA 1QQP3 4GD4A 3TEYA 3CHXA 3ZXEA 2XLAA 1RUC1 2EXKA 1RXFA 2K0GA 5I8SA 3DYOA 3VDDA 2RS11 4HONA 4AW7A 1Q8QA 2DTWA 5C8CC 2WWUA 5M0TA 1UY1A 3NNMA 4YGDA 1IGOA 1VMHA 2OW4A 3W5NA 2WN2A 5A32B 1A34A 1UU6A 5F5IA 2QQVA 5JIAA 1MZFA 4CTEA 1W2OA 2F4LA 2K9ZA 2YB7A 4UW3A 4IE7A 3OEAA 4C90A 1AL0G 4BQ1A 2DTYA 2HWE3 2NZ9A 1ZBE1 5T3NA 5A1LA 2C1FA 4BQ5A 5IW0A 3O1TA 3LKJA 4XC9A 1KEXA 3ALQA 4LO8A 4YW5A 5FUNA 4IGOA 3ZXDA 5FLIA 2Z4FA 2VPVA 1GZTA 1UY0A 3DXUA 5FPAA 3PJQA 2VE1A 2UYBA 2P3IA 1L7LA 3SISA 2WAAA 3LB9A 4YGCA 2W1UA 3OGRA 4ITCA 3I2OA 2J1RA 4FQZA 1G9AA 1MQTC 2VNVA 3ZXJA 4V2VA 5A6YA 5C71A 1R092 4QX1A 3U75A 5BYNA 3U07A 1YLLA 2ET1A 2PQQA 1L3JA 3A0NA 1X9TA 1XSRA 3HNYM 3OGSA 4CDXB 2ZEZA 1BVP1 2BV4A 2ZGTA 5FY8A 4ZU5A 2YBKA 5KHIA 3GBGA 3T4VA 1FOD3 1ZZCA 4P9WA 3KCCA 4Q1PA 3T1LA 5FP9A 4EZ4A 2PHFA 2JB4A 3UGFA 3VBSC 2FCVA 3GGLA 2QQIA 1ZX5A 2BEOA 2VW0A 2IFWA 1XOYA 3I3BA 5A3WA 1ZYBA 1COV2 2D6PA 3N3HA 2YROA 3ATGA 2BERA 4Q5OA 4DRRA 1F4AA 1QOOA 1UU5A 2ID4A 5DG1A 1KQRA 4LO5B 4QMAA 3ZFGA 1N1VA 5IVJA 1FNZA 1POQA 4MH0E 3OPTA 2CSGA 2YU1A 3K2OA 5L9BA 4Q8KA 1HJFA 4CEWC 3R6SA 3FX3A 1WBLA 5LA2A 3HPNA 4NIAA 4GJYA 5J36A 1WMDA 4OHYA 5FP3A 2XJUA 2XJTA 2RJLA 3M4FA 4N53A 4D8MA 4FT8A 5LBCA 1BJQA 2GALA 2YGMA 4LKDA 1JUHA 2LTNA 4AVBA 4XTPA 1MVQA 4R52A 4ZS3A 5FMDA 3RSJA 1W9YA 1RUC3 3J4UH 1Z0HA 3LFIA 4YWAA 5LY1A 4HSJA 1PGSA 1H8TC 5E16A 3B9CA 1Z7S3 4BA6A 3HMYA 2MNGA 4RN5A 2B9VA 2R0FA 4XFAA 5JI9A 2YV8A 1TMF3 2O0OA 3E5UA 3KD4A 1V9U1 4RR3A 4YG3A 4BCUA 1W0PA 1CD3G 2R49A 3GALA 5EP9A 1REDA 5EHDA 2RE9A 5K9YA 1MPXA 2G9ZA 1LOAA 5C7GA 4D0QA 1W9FA 4YFZA 1SDDB 4JGYB 3OY8A 1XE8A 3SEPA 5FPZA 4D3WA 5KC5A 2WINB 3NV1A 3INAA 3OYWB 4HOOA 5CISA 4QQPA 1Q8OA 2BDRA 4FFGA 3WEZA 3VBHA 2XWJB 5CBLA 3WDUA 3K48A 5CG8A 2VMEA 3E5XA 4DUVA 2W47A 3AK0A 2X5IA 1JUIA 2F6BA 2XKOA 2VCCA 1VRH2 5GLTA 1SG3A 2Y6GA 4NPRA 4CDUA 5IYYA 1GUIA 2VULA 2BGCA 5A3TA 1AR73 1V6MA 1J3QA 1KGYA 2J22A 4QPIA 2VY0A 4TTGA 2VZ3A 1P8JA 2ZGLA 3CL1A 5I0TA 5IAVA 3RI9A 2UYAA 5C4WA 2DBNA 2O8QA 4DUWA 4Y1YA 3H3ZA 5FQ0B 5I8YA 4JGZA 5L19A 5ABJA 3WDYA 3WSOA 3CO2A 5FZDA 1LJ7A 2ZKLA 4BIFA 3WLUA 2OYZA 3VBOB 1YO8A 2HBUA 5IVVA 1KFUL 4NPLA 3LA3A 4A7ZA 3AFGA 1S2EA 3AKSA 1HRV2 4IL7A 4XCAA 1VBB3 5JIUA 3WQ1A 1Q8PA 4AI0A 2D6KA 1T6BX 1DU3D 1YCIA 2R062 3DECA 3GDBA 4PT6A 1NCQB 1I5ZA 2VO5A 1PIV2 2ZKNA 4EQVA 3I4IA 1CAXB 1VBD3 4ZKTB 2CGOA 1YQ5A 2VMHA 4GB33 2DU1A 1LHUA 4CCDA 2DFCA 1IS4A 1NQDA 5FYIA 4XJ8A 4LHKA 4Q4X2 1WCSA 2J42A 4S2HA 3TN91 1WA6X 3PHMA 1WCDJ 4XMAA 1AR83 5H9PA 1C1FA 3PVEA 4LKFA 3VD3A 3AXEA 1YJLA 5F8PA 5IK8A 4KL1A 4XJWA 5DAXA 4WBBA 1Y3TA 2Z42A 3B7MA 4O7XA 5DZEA 3P5BA 4RQPA 5HCAA 5JOYA 1CPNA 1HKDA 1DQ2A 1PM4A 1C1LA 3K3OA 3N7LA 3U37A 2YDEA 4CCKA 2C9AA 2PYTA 1QMJA 4L92A 5CU1A 2QQMA 3CU7A 1RJ8A 2JG9A 4IE4A 1RUG1 1GWLA 4IEXA 2XONA 5CKQA 2MHFA 5C8CB 2RM23 3M3QA 3N9PA 3EO6A 1XNAA 2FDJA 2GN3A 2Q8EA 4BB3A 1BEV3 4IERA 1LOFA 4IV3A 3E6CC 3GM8A 1JZ4A 1E57A 1HX6A 4E8DA 4HVOA 1OT5A 1FNYA 1RHI3 3VB9A 1K42A 1D0HA 1PO23 1X82A 3AZVA 4D6RA 1LHVA 3Q8EA 5J96B 5IFTA 1WCUA 5FYMA 4C91A 3E1F1 3NQHA 4JRAA 4AAPA 1O3SA 2JKBA 5FZ9A 1MS9A 1ZNPA 4C0BA 1QGLA 1SFNA 2VCMA 3AXDA 3KHBA 3IIIA 1RL3A 3H3LA 4ARXA 4GA9A 1IPKA 1MQTB 1XU2A 4FVVA 1XNCA 3R4SA 2BYVE 3HWJA 4AWDA 1LECA 5BNPC 4CCLA 1ZZ7A 4S2FA 4NHYA 5JR7B 3KV6A 4LO6B 4BQXA 1WD3A 5FOJB 2VH9A 2QUOA 3VDDC 4X8NA 3VGIA 1UX7A 4XFBA 2EF6A 2VQUA 3MFAA 3VBSB 5ACA2 2W08A 2P5BA 3UYJA 1R083 2G1MA 1JH5A 5FK7A 3IN9A 1Y43B 2XUEA 1N1YA 1H0BA 2LS6A 3AMQA 3TB0A 1FPN2 2GZWA 2UY8A 4QD2A 3U10A 3M3IA 1KJRA 1OLME 5GLVA 5FFOC 3RZLA 2NN8A 2NYYA 3D0JA 4CEWB 4EWDA 1CPMA 2ES3A 2HWB1 5JXIA 4XUTA 3R05A 1JYIA 2AZ5A 4K3UA 5L73A 3GZTB 3PTRB 2VOXA 2JDYA 2W3JA 2TUNA 3ZXKA 2EAKA 4NRMA 1ZZ6A 2X29A 3MW3A 4CRQA 1R64A 3VHOA 5BUVA 5KBFA 2ZX2A 2A3WA 3APBA 3DF0A 1RUJ1 4FOWA 2OPKA 1VIWB 4G9SB 5E89A 4YW1A 5LCWL 1AR63 2R6QA 5EZWA 2XBO2 4I0AA 3PU8A 3WXPA 4OI4A 1SFYA 5GZEA 4AEDA 1BXHA 2IVJA 4CU8A 3CJIA 3DCQA 1U12A 4EROA 1AR91 5LEKA 4BE3A 1D0GA 2PELA 2BNOA 3B93A 3JBG1 3ME2A 2BUKA 3LDKA 3WHTA 1UZWA 3UGGA 3ZKYA 3AFKA 4ONUA 2A5ZA 4I3PA 2VOKA 4Q4W3 3LIHA 4J1XA 3MPPG 3M1HA 1XSQA 3DV8A 2GH2A 3ZFGC 1N3OA 1U5XA 4YZ1A 2XQXA 5JXGA 1GNYA 2BBVA 5JMCA 1I5PA 2DUPA 5AC93 4X6QB 1WLCA 1ZRDA 2D6MA 1RVF2 2BWAA 1H4HA 4ISRA 4JV4A 5EFUA 3V65A 4Q4Y3 2AREA 3ASIA 1PMJX 4N53C 2WBKA 5LK5A 2OVUA 5FBJA 3TYJA 1V0AA 3I2HA 4L11A 1Y9GA 2QQNA 3VN4A 2H0BA 1S0CA 4AFBA 3RNSA 5A70A 2ZGPA 4AFMA 5A3UA 4IXLA 4DOUA 4DRVA 4R9CA 1W6OB 5DDJ1 3KF5A 1WWYA 1K3IA 1ASJ2 1W8TA 2XHKA 4QB6A 3LOIA 2D40A 4NMIA 2RS51 2WS93 1HV0A 3D8CA 1HRI3 4UW4A 3RYPA 4DPNA 5JDBA 2P3KA 5TSWA 4RR3C 1QJX3 5BNNA 5C6CA 2YFUA 3E5QA 4L2NA 1TE1B 1YYNA 5C3RA 2HEYF 1YHFA 2WIIB 3C7EA 4AR2A 1SCSA 2JKXA 5DAWA 1VBA3 2OA2A 1O3RA 1RUE3 2Y60A 2MEV1 4QKFA 5FMBA 3OBTA 4H3WA 2XGXA 5FP7A 3SQOA 3T4HB 1CGPA 4S2GA 4UAPA 4N90A 3GBFA 5FLJA 3ZSLA 2G9FA 2R1BA 3VBHC 5EJ1B 3IB3A 1VBC2 2B46X 3H7YA 1B35A 3LEMA 2X5IC 5F37A 5LWBA 2LW8A 4H2AA 3WNMA 5DABA 1MS1A 4CDUC 2O1QA 1ZZBA 3GHMA 3Q9OA 3ZFEB 2BFUS 1QJU2 5T5OA 4W4ZA 2IXJA 4QPIC 4Y1ZA 2R1DA 4M0HA 4YVSA 1DZRA 5C4WC 1JHJA 4JGZC 3ZFFA 5K7PA 2WA4A 3JBG3 3R4UA 5ABJC 3SMHA 4PHZA 1RUOA 2A6XA 4FOVA 4FBFA 3LQCA 3MUZ1 3QACA 2LM3A 2HBTA 1PMIA 3AZZA 3KMHA 1CJPA 2E6VA 2Y6JA 1O4TA 3EJKA 2PN5A 3SC7X 5A3OA 3WNXA 1M4WA 1S0EA 2SLIA 1QKQA 2P37A 3FMGA 4OUSA 4CU7A 2E7TA 3ITQA 3HN3A 1OA2A 1IG0A 4RGAA 4E4ZA 2OQ6A 4OCTA 1AHSA 3WCRA 2J1UA 1T2XA 1UWWA 2VBDA 4UYBA 4YW7A 2KA3A 4DNYA 3ZYHA 2RS12 3AP4A 1KS4A 1R093 5ANQA 2LALA 2QKDA 3WUDA 1JZ3A 3BI3A 2JXAA 1GZWA 2X53S 3JD71 2W91A 2A3YA 4NHLA 4SLIA 5J3UA 1ND3A 4QDSA 3ACFA 2FD8A 5T5PA 2WC2A 4Q4V1 1CN1A 3MLKA 4JDOA 3VKOA 1DZTA 3V0AA 1COV3 3IMNA 3AYCA 3OG2A 1DG6A 4AXOA 1AXYA 2CY6A 3A22A 4A42A 4QXCA 2J1EA 2PMWB 1HQLA 5G05L 1UYZA 1KRIA 4M3CA 3J26N 3OOXA 1APNA 1YWKA 4RQPC 1DP0A 1POV3 4Q0VA 4AGVA 4HETA 3PMEA 3PTYA 2Q1ZB 2ZS6B 2OIIA 2D6LX 4WVWA 1R1A2 3GYDA 4XBQA 2R072 2WZR2 4OZXA 3I59A 3LIGA 5BNPB 2NP0A 2BVVA 3NW4A 1CONA 5C8WA 4LHSA 4IEWA 3K4DA 2JG9C 5FZIA 1ULEA 4BWOA 1QEXA 3PJYA 4EN6B 5CAZA 4FPHA 3VDDB 3I97A 4DXRA 4ES9A 1GZCA 1XNTA 4IEUA 3S7EA 3W9AA 1MS4A 3IAQA 1AYM1 2D3PA 4M0NA 1QDOA 1CIWA 1UXZA 2VMCA 1WGPA 4IV3C 1LOFC 1EUTA 3MF9A 1PZ7A 3H1YA 3FHAA 4K20A 2C6SA 3FL7A 1LESA 2ZEYA 2W95A 3URFA 1CAVA 1O4ZA 3N7JA 5A1AA 1VBE1 4IV1A 4XAAA 5EJ3A 2WABA 3NWKA 3KT4A 4EN9B 3WQBA 3PL0A 2Q8OA 5J37A 4ORFA 4XFGA 2FQPA 1HB2A 4EN0A 3TOJA 1AYN2 1RUH2 2PHLA 2AC1A 2WR9A 2GN7A 4IE5A 2JG8B 1NLSA 3BKZA 5LK7B 2R30A 1JOJA 2XJRA 3Q8FA 3RDIA 2FCUA 4DFSA 1ULDA 4LORA 4E4SA 4CXYA 2V5DA 4HK8A 1RITA 2DUQA 3MW2A 3NNJA 2OXBA 5BNQA 4QKDA 4QX0A 1O5UA 2VXJA 4L97A 4ET7A 1IPJA 4N43A 4UW5A 1VRH3 5FZ6A 3N7MA 1GOHA 4W50A 5FKBA 1BMV1 1TVGA 4N9HA 4G3YC 5DXDA 1J3RA 2A6VA 3MLJA 3DKWA 5F9TA 1C57A 5F5QA 1D4VB 2YXSA 4YM2A 4XURA 4MGYE 1H2LA 4XQWA 2WT1A 2OUHA 5DUVA 4YZ5A 5CKNA 1PO12 3THTA 4A3ZA 4FPGA 1LULA 5IFPA 4FXKB 3AL5A 1PVC1 3ZFGB 3JB8A 4QX7A 1WW7A 2WDBA 4B4PA 1I9RA 3QCWA 3FN9A 5JLVA 5KHJA 1J84A 2W52A 5E8AA 3AMNA 4K6BA 2ZGKA 2GNBA 2JEMA 3H3UA 1EP0A 2B39A 3LF7A 4N53B 2ORZA 3UK9A 1BBT1 4BK5A 4FQ4A 5AFEA 2IC1A 2R063 2CTVA 4RSUA 2Y38A 4P5YA 1B09A 4QQHA 1OF4A 2P6HA 2YY1A 1PIV3 1MZ5A 4J25A 5B4XA 2P6CA 3AMPA 4LIUA 4UFIA 2DWRA 2DBIA 2E31A 1C28A 2ILMA 2WQZC 1W6PA 5K0UA 2G4IA 4AFCA 4XBLA 1HLCA 4AVAA 4FTBA 2PLV2 3D82A 4AEDC 1HB3A 2HWD2 3CJIC 3FLTA 1XE0A 4CA9A 1UPIA 3HEIA 4RR3B 3VV1A 3J8F2 2Y6KA 2XG3A 3BU7A 3BTXA 2D93A 4AHYA 4I0BA 3QH7A 2WT0A 3OD0A 3JQWA 5FK8A 4RFRB 4RHV1 3W5MA 4JHZA 4HL0A 4LK7A 3OY8B 4CE8A 4D7YA 1ZZ9A 4KMQA 4QX2A 2VMGA 1VAVA 4IQPA 3WNPA 1D2SA 3OUHA 3LA7A 4I30A 3VBHB 3H7JA 1QJEA 3WG3A 2GP5A 2ET7A 3RZJA 2X5IB 4DS0A 1RINA 2DVBA 4KI5M 4Y4RA 1QQP1 2E51A 4LR4A 4COYA 1V6LA 4CDUB 1S0FA 5HI0A 3TBDA 2Y34A 4I01A 4N8MA 1OFSA 1PX4A 4IEOA 4QPIB 1IZ3A 2CNAA 4A6SA 1QOTA 4AK3A 1UAIA 5ERLA 5C4WB 3V0BA 3RQ0A 2JDMA 1W8FA 3KM5A 4JGZB 1IS3A 2VBPA 3I2IA 5BV6A 5ABJB 5I93A 1WA4A 5JWPA 2VAUA 4TLGA 2ZX0A 3C2UA 4MHRA 4RS5A 3RZZA 3ZXLA 1U5ZA 5JCTA 3K3NA 1W6NA 4XJ9A 3ZYIB 4F7ZA 4XILA 1Q8SA 2QBXA 2HWE1 5BNNC 1ST8A 3FJSA 4PF5A 3ILFA 3IAPA 5CZKA 2B4KA 2X10A 2BGPA 2XKPA 1RMU2 4L99A 3L2HA 3BN6A 3P3PA 2WWJA 4FOQA 1DGWX 5GLUA 3VUOA 4ASLA 4YVWA 3WF2A 3RYRA 2C5DA 4P02B 4AVCA 4P9GA 4Q1RA 4UFKA 5FPXA 1F9KA 3KQ4B 5EWSA 3OJBA 5F3GA 5DPNA 2V4VA 5ACA3 4HN1A 5KHGA 1GQPA 1Y7BA 2EVXA 1N1TA 1OUXA 4CP9A 3NVCA 4JAAA 1PGL1 1FPN3 1FOD1 3ON7A 4A6OA 5L7OA 2PAKA 3WW4A 2NMNA 4PLMA 4YVSC 4J1WA 2BNNA 4AFDA 4RQPB 5CNAA 3HD8B 3ZFFC 1AF9A 2W9XA 4LBMA 4LO7A 2BU9A 4NHXA 4Q0UA 1GQHA 3U14A 4HPKA 3J9SA 4YGBA 2TEPA 5FPVA 3IPVA 2R042 1GOGA 2J7MA 2JG9B 2P3YA 1MS8A 3E6BA 5J09A 3TNPB 1SPPA 4YG0A 2DYCA 2Y0IA 4I2OA 3R4DB 5F39A 5FMCA 4AVSA 2A73B 2PTMA 1OBNA 1QJY3 3USUA 4AI2A 1NY72 2A7AA 3WDVA 4IV3B 1JBCA 1QNYA 1JYXA 5FY9A 3MIEA 4YZ3A 4KWKA 1Y9QA 5FZ0A 1W2AX 2WA3A 2XUMA 4QKNA 4UFHA 3T0AA 1SCRA 1Z7S1 5IAXA 2YYOA 1XE7A 2QQJA 2HEWF 5DQ0A 3WF1A 4C8DA 1D4M2 1ND3C 1TMF1 2BRTA 1QJFA 1RUI2 2E32A 5FOBB 4V2WA 2VTFA 2OT7A 1OLMA 3CDZB 3CBNA 4LJHA 1JU3A 3NNGA 1X9PA 3BPZA 4B7EA 1YFYA 1W9WA 1CAWA 1QDCA 2OQ7A 4LEJA 1KD7A 1LHNA 2CGPA 3ACHA 4M3CE 4IDZA 4X8PA 5F2SA 5F6LB 2X05A 1UMIA 3D0SA 2WRAA 1NX9A 2Q30A 1MEC3 3ACGA 4IESA 2Y8KA 3RRDA 1RUJ2 3HR9A 4QPGA 2A3XA 5A1FA 3P1IA 2P17A 4KWUA 5GM0A 3ZO0B 1S0BA 3FLPA 3LPFA 3VKLA 4F8AA 5FZFA 3DKQA 3KVBA 3N7KA 5FYVA 2WNVA 1GBGA 4RFT0 1KDKA 2FHRA 4UT5A 4RGGA 4JKKA 1BQPA 3VD9A 2ERFA 1ASJ3 1AR92 1AR71 3EB7A 4LT5A 5GLWA 4P14A 4JRLA 4FSJA 1GANA 4LA3A 4CVUA 4H14A 4YSFA 2NQYA 4XJZA 4CUAA 4UW6A 4LE3A 1DIWA 1JYTA 3CQOA 4IV1C 3RI8A 5JPNB 1XBFA 4B1MA 3VHPA 5FRAA 1UO9A 4YRDA 2E53A 4QHOA 1CR7A 1WD4A 5FZCA 4E8CA 3VZNA 1VBB1 1HIXA 3FUQA 1H1MA 1OXCA 4LBJA 3ZN6A 4ZZ8A 1VBC3 1ZBA2 2BNMA 4LA2A 4E2GA 3NV3A 4OHXA 1VBD1 3NNLA 3OUIA 4AEDB 5A33A 2XJVA 1EPZA 1MZ6A 3CJIB 4GB31 4N43C 4Y22A 2CV6A 5DDJ2 1TZOA 2CWSA 2RJ2A 2RV9A 3AC0A 1QJU3 2Y6LA 2ZGNA 1AX1A 4YNIA 4XEZA 1O8SA 2D5FA 2JDNA 4XETA 4CCJA 2WSVA 5HV0A 5JOWA 3LOBA 1AR81 1OPMA 2RMU2 2YHJA 3OCPA 4XXPA 1IKQA 4P9LA 3LE0A 2JJ6A 4WZCA 2GC1A 4OYUA 5FYSA 4JDNA 4UF0A 5IVYA 2A6ZA 3OGJA 3ZN5A 3RZMA 3PVBB 4D69A 5FZ7A 5FZMA 1RC6A 2PHDA 5C9AA 3UT0A 4OUMA 4GMP0 3JXSA 3OBRA 2ZHNA 1W8OA 1NZCA 1E5HA 5EJZB 4JTNA 4XHXA 5FYHA 1VMJA 4FTSA 3H1WA 4DEVA 1WMEA 2RM21 2OZJA 3DPRA 2PHTA 1UOFA 3T09A 1N47A 3D4KA 4BU2A 1BEV1 1NZIA 1UZYA 5K0UC 3RJRA 1PM7A 3THCA 3VL8A 2VOTA 4JTOA 1JZ7A 3ES4A 4BIOA 3HT1A 1RHI1 2XJQA 4IEVA 4ZXEA 3TAYA 4NRPA 1PO21 3AJZA 5EV7A 4BLJA 5IK4A 5FXWA 3MZHA 1JI6A 4GQ7A 1G8WA 2GNDA 5BNNB 1O8PA 1QHDA 1DQ4A 1LR5A 2CAVA 1WKYA 2YC4A 4AVVA 5FZBA 2N7GA 4CSWA 2CWMA 4NWWA 3N9QA 4KG8A 2WO2A 1GOFA 5IVFA 1ULFA 2GNTA 1ENRA 3WP3A 1R1A3 2R073 2WZR3 2ZHMA 3WDWA 2OKXA 1DYOA 4URTA 2GU9A 5LW9A 3ES1A 4MOAA 3HQXA 1L7RA 4ZXKA 3OB8A 4HBNA 2BOIA 5FJHA 1R1ZA 1B35B 5FV3A 4UOJA 3OBZA 4R4XA 1OVSA 2VZ1A 3VKFC 1RUD2 3ZMNA 1A8MA 3FC0A 2DVDA 3D3AA 4XDOA 2R16A 1F4HA 1SBFA 1V6NA 3NV4A 4LBNA 4H7MA 3O0XA 4Z07A 1VMFA 1SLAA 1R081 2KD7A 1WLWA 2O14A 2VNGA 3BALA 3MGUA 4YVSB 3WP4A 4COUA 4NAMA 3ZFFB 2WL1A 5FZOA 3NKTA 2G9GA 4MGQA 4YGEA 5F1RA 3S5QA 5JSOA 4RS5C 3N4MA 4KU8A 1H30A 1ENQA 2D6NA 2BFUL 3DGTA 1ONAA 1YEWA 1OI6A 1MZEA 5JXHA 2RR12 4LHLA 1HB1A 1AYN3 1RUH3 1LTEA 4W6YA 1XNBA 2WO7A 4K8RB 3O5SA 2VJXA 1TEIA 5FZHA 4QHBA 1KITA 3LA2A 1GP4A 4YPJA 2PHRA 3ZR5A 1LEDA 4PBOA 3O14A 2ZGOA 3IZOA 3KWVA 4YVWC 1GZWB 4NE9A 1D2QA 4MHUA 1AR61 3RVHA 2ZGMA 4YZ4A 5J1XA 4R9BA 4O65A 1ND3B 4RYDA 3B9IA 3WDXA 5JSRA 2LRPA 3ENRA 2IXHA 3HNBM 3V0AB 1ZA4A 3WNNA 2VBBA 2ZGUA 4OLLA 3LWCA 1W6MB 1PGW2 4MSVA 4XPVA 5FMOS 1PO13 3H9AA 2DDUA 3VD5A 5L7OC 2VW1A 1JZ2A 4M3CB 1S2KA 1Y4WA 4QGNA 4XJAA 5AFBA 4HVRA 3VHNA 4Q4W1 2Y64A 2RS31 2XVLA 3B94A 3GJAA 4LPLA 3MIBA 4Y5Z0 1UYYA 3VD7A 5FO7B 3A23A 3BVCA 3I59B 2E7QA 2F4PA 5AVPA 1QU0A 2GNMA 1CAUA 1LOCA 2AENA 4FP2A 5AC91 4CYDA 2HWF2 2Z5WA 3LZZA 1Y9MA 1UOGA 4BYYA 4YYOA 5FO9B 4Q4Y1 2AACA 2QZ3A 1RUF2 1UF2C 5F7UA 2BQPA 2IUWA 5FTTC 5LBFA 4E9KA 1JN2P 1XYPA 3WUCA 2P3JA 2WYFA 2K46A 2VNOA 3IBMA 5APAA 2GH8A 4DINB 3KHCA 2BVBA 1PZ8A 1S0IA 2PLV3 5FDBA 1Q3EA 4BQ2A 4CUBA 2HWD3 4M4RA 1JU4A 5E6HA 1CAVB 2CDOA 1TME2 2WS91 4IV1B 2BTVC 4GAZA 4I02A 1HRI1 1NQJA 1UIKA 2XOMA 2QCSB 3MFCA 1FMD2 4IGQA 1JTZX 2YBSA 1ZA7A 3OF1A 1QJX1 1W0OA 3I8TA 4Q26A 3I7DA 5BY5A 2AEZA 1VBA1 5LBEA 2ZPXA 3BPSA 1RUE1 2WFF2 1EV12 1WBFA 2ZAHA 4PI0A 3H8OA 5HXMA 4MO3M 1C8M2 2ARAA 4BHPA 2I74A 1HN1A 2XQRA 4L8QA 5E88A 3N35A 1AL22 2D44A 1CJDA 1CVNA 1MS3A 2DCYA 2YBPA 1SQ4A 4N43B 4QPGC 4AGRA 2A6YA 1YQCA 3SKVA 5JUVA 1GU3A 3THPA 2ZCWA 1UZZA 2WNVC 1H8TB 5HBAA 1YQ6A 4QU1A 1C8NA 1UQXA 4M01A 1L7QA 2GDFA 5FREA 5FUIA 3LDRA 5T5JA 2ZABA 3S7IA 4D94A 5IVEA 3H42B 4QB2A 1VRBA 3P6BA 1VAKA 1XNDA 2C24A 1HXS2 1FXZA 4KGGA 1UKGA 2Y33A 4LOTA 4AI3A 2W94A 3AMHA 4QX8A 3RGBA 3GCWA 5JOZA 4AZZA 4E4HA 3ZYPA 4UXAA 1OF3A 3C3VA 4QWNA 1QY4A 1ULGA 1RMU3 3I2GA 2PHUA 2J1SA 3VBUA 2RS33 4B8EA 1GP6A 5A6XA 4XZPA 2YGLA 4E4DX 2I07B 3WG4A 3POGA 1DLLA 3POEA 5A7OA 1G9CA 1SLLA 2LUWA 4XACA 3ST7A 3V64A 1LHOA 2EIDA 4BM8A 5K0UB 1LGCA 1SLCA 1W6PB 2DCTA 5DN2A 1R091 1KDMA 5FYUA 1TNRA 3O0VA 4BJ0A 3PIGA 4YM0A 3SH3A 1NCRA 1J1TA 1ND2A 1NYWA 4EE2A 1TG7A 2WJSA 2WNUA 3KCYA 4MYEA 3ZSMA 3PUIA 4FPLA 4K7JA 1OH4A 1UYPA 3DN7A 3GCXA 1COV1 2DCJA 4F3JA 2XLFA 4S2DA 3CZUA 1W28A 4TN7A 1H1IA 1RJ7A 4MXVA 4XVHA 1S0GA 4LMFA 3I49A 3WNOA 4ATEA 1QXRA 2R043 1F5JA 4YM1A 1E5RA 1POV1 4NIHA 2VZQA 5C9AC 3KF3A 4ZPIA 2D3RA 3WQ0A 1OKOA 4G4FA 3ZM8A 5KXEA 5LY2A 2G19A 1HQNA 3QH6A 1EAH3 2Y6HA 1W3VA 1PHMA 2V73A 2DUOA 2PXJA 4OUEA 5DUUA 1XQNA 4JC1A 1ZRFA 1VB4A 4XFHA 1YQ8A 3DPRC 1DYPA 4LE4A 5A7WA 4CUCA 3V0BB 2JIGA 1OOPA 3Q8BA 4QX5A 1VP6A 3NL1A 4Y20A 1WCQA 4QGMA 1EPWA 4HZFA 4MXWA 4RS5B 1D4M3 2EXIA 1IG3A 4OMCA 1RUI3 3UKNA 1W6NB 3DYMA 1LNSA 4HT1T 1UN1A 3ZR6A 1W6QA 3OSDA 1S4CA 4QX3A 5CB7A 1LAJA 1Q5OA 4K1ZA 3ZXFA 1GWMA 1UZ0A 4CXXA 5T50A 3OGGA 4CPBA 4O61A 4UFMA 4D6SA 2ZXQA 4BQYA 4MUVA 1JXNA 4QPWA 4YFWA 2QE3A 3N9NA 4YVWB 2B45X 2WN3A 2HWC2 4K40A 5FR3A 1O3QA 1V6IA 1JZ8A 3I54A 1G7YA 2DVGA 3RS6A 3U1XA 1YI9A 3A21A 1RUC2 1W06A 1UMHA 1VRH1 4RA0A 5LA1A 4URAA 1AUYA 1JZ5A 5D21A 1Z7S2 2YC2A 4CP9B 4Z82A 2VUAA 4JX0A 4R9DA 3F2ZA 4GALA 2VVDA 5L7OB 1XB9A 1H4GA 3POIA 3R0RA 4DO0A 3O1SA 5T5LA 4FPJA 1IOAA 3CJXA 4HPKB 5KHKA 3IPVB 1N3PA 1ENXA 1GV9A 1PVXA 1BVVA 4PQQA 1ZBE2 3EQEA 3O7OA 4GH4A 4BQ4A 2IFRA 1CZTA 3VDAA 3CIHA 1UPSA 1GICA 1SPPB 3MO4A 3FE5A 4JCKA 2C4XA 2HJIA 2KXLA 4PBPA 3RYKA 3POSA 3T30A 4KBZA 1QH6A 1W2UA 5SV5A 5HCFA 1NLRA 2R061 2VD7A 1OURA 1J58A 2D7FA 2H6CA 1DGRA 1ZBA3 1PIV1 3ABZA 4AYUA 3WG2A 1SHWB 2RDNA 1W8HA 1NT0A 3VDBA 3ETPA 2DVAA 1AR72 3THDA 1F31A 4B4QA 3BODA 5L9VA 5A7QA 1YUDA 2JB8A 4CUGA 3AZYA 5LA9A 4B29A 1GZ9A 2JDZA 2RMU3 1OD5A 2EA7A 4XYXA 1OLRA 4FFIA 4FFFA 4XUQA 1NKGA 3GZAA 4AOCA 5LA0A 4P9YA 1CAWB 1SDWA 2XWBB 4UFJA 3FFQA 4HSLA 1XPWA 4XQDA 5KR7A 4CCMA 4WM8A 3ZPOA 1WMFA 4CDQC 4I0WB 3W21A 1SACA 2ZACA 2ZZJA 3SITA 2UWCA 3WD5A 3HBZA 4NRQA 1CZSA 2AR6A 3ZSKA 2C26A 3EBRA 2JD4A 4QPGB 5BNOA 4CP1A 3AP5A 3UKVA 2EALA 4BDVB 1VE0A 1H6XA 1NG0A 4CP2A 3J7HA 3P3NA 2WNVB 3SXWA 3TEWA 1V70A 4GWMA 3RFRA 4M00A 5FZ1A 3U4SA 4AAXA 2ARCA 4PJYA 1W04A 2PFWA 2PAEA 1UW8A 4WVMA 4PIXA 1JYCA 2JDKA 3Q8CA 2GMEA 4L0PA 1AR82 1DZQA 5GZCA 3RZKA 5EXOA 4CEYA 3SH5A 3LEKA 3O1MA 1V9U2 1H1AA 3N9OA 4IEPA 4MGKE 2WKKA 4OVEA 2JENA 4HKOA 1H9WA 3AYEA 5A7SA 1BLZA 4ARYA 4I3GA 3HIFA 3MLLA 5C5UA 1H8VA 2YZ4A 3MV11 3ZDSA 1VB2A 2JE9A 4FPYA 4WVZA 5C3SA 3ZMOA 4HK9A 4XF0A 3ZN6B 1DQ0A 5IHRA 3U4XA 1URXA 1HRV3 4HFSA 4Y5TA 5D8AA 3ZIXA 1JZ6A 2QQLA 5F32A 1C4RA 5I0DA 4TSVA 2RM22 1ODMA 1A78A 3IMMA 3WF4A 1XC6A 5A33B 4Y22B 1ALYA 3B3QE 3K4AA 1K45A 4CU6A 3PUHA 1RTVA 4YLZA 1BEV2 5F6KA 3L9JT 1JOBA 1MS0A 3B02A 4YW2A 3O1UA 5ACA1 3NRUA 2JDAA 2ZGRA 1RHI2 1PO22 4A3XA 5F3CA 3S57A 1FPN1 4EJRA 2P1BA 1JHNA 4Q4X3 3OPWA 2B42B 3WR0A 4YZ2A 4BOWA 1QNWA 2A71A 4UF0B 2BOJA 1KXGA 3B5LB 4ISQA 5C9AB
chains in the Genus database with same CATH topology
4K8FA 3V56A 4W65A 1GLHA 1YI7A 4NHMA 4DMIA 5GZFA 4GKXA 1OKQA 3VBUC 4FPKA 2AH2A 2IWGB 1K5MA 1NXMA 4INDA 4Y26A 1KS5A 1U5YA 3DPRB 1QJY1 1FATA 4AQ6A 2CGNA 4LBQA 1REFA 2Y26A 2Z79A 1NCRC 4PLOA 1ND2C 2JICA 4BMBA 2WNUC 4COWA 1W39A 4HVQA 4QQLA 1AZDA 5LRSA 3TN92 2VVFA 1WLTA 1O3TA 4BLIA 2ZX4A 3WHUA 4EN8B 3ACLA 4FAGA 4FCAA 1OLQA 3A0KA 3FBMA 2IXLA 4NR1A 4XF9A 1LGNA 1QF3A 4MGZE 4FO9A 1WW4A 4HN0A 1PZ9A 4XE9A 3VKNA 4WVVA 1GQGA 2HWF3 2VUJA 5J7MA 1XYOA 1GFF2 1OHFA 1RVF1 1MEC1 3SHRA 2FMDA 3KGLA 5C33A 4NWVA 1MS5A 4AI8A 1RUF3 4XOGA 1RUG2 1AR62 4AG4A 4QQOA 1BCXA 1WW6A 4XF4A 3VZLA 1ZRRA 2IXKA 2D97A 2XJPA 2ZHLA 2IXCA 3NO8A 1ASJ1 1DQ5A 1OOPC 2D98A 2XB6C 1X33A 4LHNA 5K8SA 5HCBA 1PNFA 3AZWA 1NA1A 5GLZA 1BYHA 4HMZA 4Q4W2 4TYSA 1LU2A 4WV8A 4AQTA 1CQ9A 1EV13 2DVFA 1LOBA 1C8M3 3ZPYA 4A2UA 3KT7A 5AC92 1YIFA 4FP3A 2ZJCA 1OA3A 1YJKA 2OZ6A 4Y1VA 1UKRA 1Z78A 1VBC1 1ENSA 5KXDA 1F8VA 3BOPA 1GKBA 1SEFA 2XBO3 1QJU1 4AHWA 2WS92 5D1IA 4AE2A 2ZAAA 1U0AA 3LGRA 2W0XA 2UWAA 3UJOA 2GC3A 1OQDA 1HXS3 4CDQB 4KQ7A 3M7AA 4DY3A 3ZVXA 3M3CA 2HWB2 1LODA 1XYNA 5HXVA 5FMOL 4FPOB 2NLRA 4N9IA 3FWEA 1IS6A 1EY2A 2PAMA 4GH4C 2Z69A 3H0OA 1IHMA 4TLFA 2QVSB 3AB0A 1AJOA 1RVF3 3KCXA 3NAPA 2GMMA 1XU1A 2I2SA 5CFDA 4YARA 4LBLA 4MVTA 5J98B 2Y0OA 1F5FA 3WP6A 1XNKA 4XW3A 2D43A 3WW1A 3G6JB 1HQWA 3CF6E 4AHZA 2RHPA 1WUVA 1BZWA 5FBZA 3JBG2 4HANA 3HAGA 2CYFA 5IK5A 4PCRA 2VOVA 1O91A 1V00A 1AX0A 3AYDA 4WM8C 2AGSA 4OHVA 4OI0A 1G9FA 1R1A1 2JG8A 4UBHA 2R071 2WZR1 4XIOA 5A3LA 1S0DA 1J3PA 4J6GA 5BNOC 3ETQA 4SBVA 3WX5A 1UU4A 3UJQA 4C1WA 4D7SA 4NOTA 1C3HA 1QXJA 3RMYA 2ZTNA 1AXKA 2QZ2A 3PMSA 3JZVA 3KLSA 3WW2A 1X36A 3ILNA 1X8EA 4Z1VA 5CFCA 1XXNA 2RS52 2IXIA 2BW8A 4H7LA 4CEYC 3QBQA 4DB5A 1KJLA 5SV8A 3MIHA 2BWCA 2YPJA 1YRZA 3FUOA 4KWJA 4IETA 3VBUB 1AYN1 2VNRA 1RUH1 4EV0A 3VZJA 5L36A 5JSPA 3LAGA 4NO4A 4W6WA 2MEV2 5CA6A 4GMP3 1H9PA 2HWC3 3UKTA 1FX5A 4XFCA 4EWEA 4K9SA 3BOWA 3VBFA 4LO4B 4PIYA 3KZ4C 4XXAA 3A4UA 5D8AC 5BXXA 3QOPA 3U0ZA 1NCRB 1ND2B 1LCLA 2AUYA 2RS13 3IDCB 2WNUB 1PK6A 2CL2A 1V6KA 3FFZA 5CG9A 1X8MA 1WW5A 4WM7A 3ZX7A 1FV3A 3K51A 1PO11 1FI2A 1LENA 2GC2A 2WFPA 4NN0A 1IQAA 4CZSA 2ETEA 1ZBE3 5B2GB 1V6JA 4O9GA 3IM0A 3H1MA 4META 2P34A 5DZGA 5GALA 4E2SA 4XHBA 5LRRA 4LBOA 2XJSA 1K5MC 1MACA 3ELNA 3LSDA 3GBWA 5KC6A 2QQPA 2HYKA 1LEMA 4MX3A 1OOPB 4Z8BA 2VECA 4KG0A 4XF1A 4Y20B 5KXBA 4MXWB 2PLV1 3JD72 4M3CF 1DGRN 2HWD1 4PDWA 4K21A 2VOWA 2Z2SB 2FMYA 1W6QB 3AKPA 3J8F1 1X50A 2ZMLA 2O8OA 2EXJA 4UBGA 1YXWA 1YFUA 3FBYA 4P9XA 4CDWA 2VVEA 4Q4V2 3GNEA 4Q0QA 1TNFA 3USSA 1QOSA 1UD1A 1VR3A 3SCHA 3ZIWA 3MF6A 4MV2A 2ZOEB 5JVVA 3VL9A 3JU9A 1BKZA 1DDLA 1SLTA 4FPCA 1IS5A 4AEJA 4EN7B 1YFWA 1DGLA 3X29B 1UIJA 1Q56A 4IEZA 5JZGA 1WCKA 5IK7A 2XH6A 1UX6A 1AYM2 5EYYA 1J59A 1U5IA 1ZZ8A 3AMMA 1FV2A 3MIFA 1LOEA 1O5LA 3KS7A 3ZFEC 1NXD1 3WY6A 1N1SA 1RUNA 1V9U3 4KH9A 1VBE2 3WG1A 4IEQA 1NA1C 4GH4B 3RMXA 2WT2A 1H2NA 1M06G 1AXZA 3H8UA 1FT9A 1RMU1 1HW5A 2ARXA 4XMIA 1VAMA 2Q1MA 3TWIA 3MDPA 3W58A 4MLOA 3JUUA 4O9EA 4NHKA 4B4RA 1RIRA 4ES8A 3VBRA 4COZA 2VU9A 4Q27A 1BMV2 5JPMB 2QJVA 2W68A 3VHRA 4LUMA 5DZFA 4COVA 2WSUA 3AJYA 2A6WA 4OULA 1QWRA 3J8F3 5A32A 1LRHA 3IIAA 4WM8B 4IEYA 1NE4A 3ECQA 3VLBB 1PVC2 4ZU4A 3KGZA 2R041 1G86A 4R4ZA 5GZDA 5BNOB 4KWLA 3ROUA 2ZX3A 4YG6A 4FOYA 1C5IA 2KM2A 5CADA 1BBT2 4OHZA 3WCSA 3BTAA 1VALA 1EAH1 2XL7A 1NY71 4KBBA 2AYHA 3NAPC 4WVMB 3HN1A 1GYKA 5CFDC 1NOVA 1S2BA 1SBEA 4CEYB 1D4M1 1RUI1 3UV9A 4L9BA 4CDXA 3TN93 5DUXA 2E9QA 2QDNA 3GF6A 4GWNA 1ZRCA 3DUIA 2XVGA 4MGIE 1LHWA 2DFBA 3E6DA 1OFNA 2E7AA 4RHV2 5FO8B 4GULA 3WP5A 5D8AB 2WLQA 3QD6A 3G7DA 2HKXA 3O0WA 5T52A 2JG8C 4CP0A 1GR3A 1QJY2 1RUG3 3JQXA 2WNEA 4AQ2A 1QQP2 2DV9A 3KT1A 4B3NA 4R9AA 4BZ4A 2Q0AA 3AM2A 2MPFA 4XQ4A 3D6EA 5FCCA 1AVBA 3RG0A 2ZZQA 2XVKA 4AFAA 3MW4A 4P9JA 1C5HA 3POWA 2WZPP 5CFCC 1LOGA 3BIWE 4JVAA 1ULCA 1OPOA 1DHKB 1QH7A 2TBVA 2HWE2 1NE6A 4HKWA 1K5MB 1I6XA 1V6OA 4XDQA 3B69A 1MEC2 3CNAA 3LSEA 4AGGA 3SCFA 4OHWA 4JGYA 4P9IA 4E2QA 3NSTA 1PNGA 3VBFC 1ZBA1 3OYWA 4LBQB 1Q8VA 4LBQD 4EWAA 1FYUA 2X8KA 5T55A 1GSLA 2ZGSA 1GNZA 4KGQA 4C0HA 2D3SA 4FAHA 1SLBA 2VGDA 4N7IA 1YIPA 1PK6C 4Q0SA 1SLIA 2ZX1A 2DURA 3ZYJB 1S1AA 4Q29A 3W59A 3POYA 2UWBA 3WW3A 2RMU1 1FOD2 3ZYRA 5JI7A 4WM7C 3VZMA 3PNAA 1DGWA 4C1XA 2QNKA 3I2DA 1J1LA 5FQ0A 3AP9A 2QDRA 5JAXA 4DY5A 2ENRA 2HWB3 3ILRA 3OD4A 3NJZA 1LGBA 4Y1XA 1X7NA 3PLQA 3VBOA 2W39A 2EXHA 2GC0A 3RWNA 3WOGA 2VQ0A 3L2YA 5GJ6A 4Y24A 4MZUA 2RJKA 1RUJ3 2R0HA 1NCQA 1SMVA 2NPIA 4GIQA 1CAXA 4F83A 4BPZA 4XFFA 1UL9A 2IZWA 4PDWC 1AR93 3AP7A 3O12A 4GXLA 4AQSA 1NA1B 5IUQA 1TMF2 4CDWC 2GAUA 4I09A 4V1PA 1WLDA 1DYKA 2ATFA 3SNMA 4XF3A 2EAAA 2ZMNA 3JCIA 1HDKA 5I8TA 3ZN4A 3M2MA 4QT6A 1HRV1 2I45A 1G6NA 3FZ3A 3CLPA 3AX4A 4QXKA 3IWZA 3IKWA 1RUD1 5JZGC 3VZKA 3USUB 2FZ2A 5I0SA 3EHKA 2XL9A 1PGL2 1Q43A 4YW4A 3UL2A 3IDEA 5C8CA 1ZREA 4LLOA 4Y4YA 4OI1A 4Z2WA 1O4YA 2A75A 5DDJ3 3NKGA 2RS53 1W6MA 4XTMA 3WDTA 4Q4X1 2JX9A 4FTEA 1RB8G 1I1EA 1JW6A 3JB4C 4XIKA 4PLNA 2VQAA 1A3KA 1ZVFA 3MIGA 3N36A 2UU8A 2RR11 4P5HA 2XPJA 1QJZA 4B7KA 4JQRA 1UMZA 3MICA 3MEPA 1POV0 1CX4A 5FLHA 2MEV3 3AYAA 2JE7A 2OUJA 4BMEA 5LEJA 4LNVA 1VBB2 2DCKA 2PHWA 3NAPB 4AHXA 5CFDB 4Q2FA 5DG2A 1MQTA 4LULA 3B00A 2VW2A 1VBD2 3VBRC 3WV6A 4N7UA 2WWSA 4GB32 1OQEA 3WQ7A 1GNHA 1PGW1 4KU7A 2VG9A 4W6XA 3VBSA 4HLTA 3KSCA 1H2KA 1N3QA 3NV2A 1G9DA 1DQ6A 1TQ5A 4A7YA 3HT2A 1AJKA 1F2NA 4OI2A 3RPQA 4GKYA 4XFIA 4CEWA 4ATFA 3KQRA 5H9RA 3M70A 4OFGA 1MR5A 2HWF1 3M3OA 2FZ1A 4ASMB 2FBEA 4DZGA 1DFQA 1RUF1 1VJ2A 3AP6A 3WZ1A 5EYXA 2NMOA 2ZA9A 3S6PA 1SBDA 1YFXA 4AEKA 1RUD3 2JECA 1T6GC 3JD73 1H8TA 4R8HA 4Q0PA 5I91A 5CFCB 2UY9A 1TME1 2QFEA 4JDMA 3ZXAC 1FMD1 4Q4V3 3FHIB 3WINE 4CDXC 3TRSB 2TNFA 5KWRA 4TZDA 3GZUC 3KB5A 4LTAA 2B7YA 5JOXA 2DU0A 2WQ4A 1A8DA 4Z92B 3AKTA 4PIZA 2RR13 1EV11 2WFF1 4FXGB 5BPXA 4Q8LA 1C8M1 3VBFB 1AL21 2A70A 4QM8A 3M8LA 4QGLA 5E1RA 3T2TA 2B5HA 4AVTA 4RL7A 4YW3A 4LLFA 5FAXA 4HKLA 3S0MA 1LKNA 3VZOA 1PK6B 4ZU7A 1AYM3 3EXUA 1RGSA 5T54A 3RJ2X 4DXZA 1UCXA 5JOYA 1OA4A 3TNQA 2XBO1 3GHNA 3U11A 4QU2A 4WM7B 3PVOA 3S30A 4FPEA 4LUKA 1R082 1HXS1 2GSYA 1W6OA 2R32A 3IT8A 2WLPA 2K2SA 1OSGA 1VBE3 1FAYA 1CESA 5CVRA 3BB6A 3ZXGA 2GMPA 4TWTA 2H6BA 2DF7A 2H0VA 3M3EA 1I3HA 4PQ9A 2Q5TA 2VMIA 3BCWA 4XBNA 1H2MA 3SLIA 3SH4A 3WVJA 1DF0A 3PVNA 4A7KA 1IKPA 1EYBA 5AVAA 1G9BA 5H9SA 2D6OX 2XLGA 3MI8A 3OTFA 4JGYC 4Y1UA 4E27A 3ZSJA 3B01A 1YNAA 2YMZA 3AKQA 4QM9A 4U36A 2YUEA 2CAUA 3MIDA 4PDWB 2ZHKA 1VLNA 4X6RB 1DBNA 2V5YA 3ZSEA 4CDWB 4NVPA 1O7FA 2SBAA 2UURA 1S55A 2NM1A 3ZFEA 1TME3 3VKMA 1S0JA 2DCZA 1HV1A 1FMD3 1QXPA 3H50A 1PVC3 2HEVF 4WZFA 4D7TA 1A6CA 1REEA 5I0UA 2RS32 3IDBB 2D5HA 1KFXL 2PA7A 2YC0A 3LCPA 3VBOC 2WFF3 3FLRA 2BPA2 3D5OA 1BBT3 4BH9A 4AI1A 5JZGB 3CEWA 1AL23 2PHXA 5KXCA 3E97A 1OQ1A 4QQ2A 1B35C 4Q4Y2 4U2AA 2ZGQA 2Q4SA 2E63A 5CIRA 2C0ZA 1NCQC 3MPBA 4H55A 5H9QA 2B8MA 2VXRA 1XRUA 4LBKA 1OMIA 3OPZA 3SCGA 1AX2A 5IT6A 5I0RA 5DUWA 3WT3A 2ZBJA 2ARBA 4FPFA 1HRI2 4RD7A 3AZXA 5A3MA 1BK1A 1LU1A 3DL3A 1LB2A 2ZMKA 1QJX2 4KNCA 1MVEA 4RHV3 3T1MA 3QLQA 3ZYGA 5GZGA 4AF9A 1VBA2 3MYXA 1DQ1A 4YM3A 1RUE2 1ZM1A 2B9UA 1CAUB 2P2KA 2V09A 3AKRA 4GMP1 2HWC1 4DQAA 4XJUA 5KHHA 4AEMA 1EAH2 5BNPA 4K1YA 2EIGA 3VBRB 4QPYA 1QQP3 3ZXEA 2XLAA 1RUC1 2EXKA 2K0GA 5I8SA 3VDDA 2RS11 4AW7A 1Q8QA 2DTWA 5C8CC 4YGDA 1IGOA 2OW4A 5A32B 1UU6A 4CTEA 5JIAA 1MZFA 2K9ZA 4UW3A 4C90A 1AL0G 4BQ1A 2DTYA 2HWE3 2NZ9A 1ZBE1 5T3NA 2C1FA 3LKJA 4LO8A 3ALQA 4YW5A 3ZXDA 5FLIA 2VPVA 3PJQA 2UYBA 2P3IA 3SISA 3LB9A 4YGCA 4ITCA 1G9AA 4FQZA 1MQTC 3ZXJA 1R092 5BYNA 3U07A 1YLLA 2ET1A 2PQQA 1L3JA 3A0NA 4CDXB 1BVP1 2ZGTA 4ZU5A 5KHIA 3GBGA 1FOD3 1ZZCA 4P9WA 3KCCA 4Q1PA 3T1LA 2PHFA 3VBSC 1ZX5A 2BEOA 2VW0A 2IFWA 1ZYBA 1COV2 2D6PA 3N3HA 2YROA 3ATGA 4DRRA 1QOOA 1UU5A 5DG1A 1KQRA 4LO5B 4QMAA 3ZFGA 1N1VA 1FNZA 4MH0E 4Q8KA 4CEWC 3R6SA