3NL1A

Crystal structure of salicylate 1,2-dioxygenase from pseudoaminobacter salicylatoxidans adducts with gentisate
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
366
structure length
366
Chain Sequence
QNEKLDHESVTQAMQPKDTPELRALYKSFEEESIIPLWTQLGDLMPIHPKSKAVPHVWKWSTLLRLARKSGELVPVGRGGERRALGLANPGLGGNAYISPTMWAGIQYLGPRETAPEHRHSQNAFRFVVEGEGVWTVVNGDPVRMSRGDLLLTPGWCFHGHMNDTDQPMAWIDGLDIPFSQQMDVGFFEFGSDRVTDYATPNFSRGERLWCHPGLRPLSGLQNTVASPIGAYRWEFTDRALTEQLLLEDEGQPATVAPGHAAIRYVNPTTGGDVMPTLRCEFHRLRAGTETATRNEVGSTVFQVFEGAGAVVMNGETTKLEKGDMFVVPSWVPWSLQAETQFDLFRFSDAPIMEALSFMRTKIEGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Gentisate 1,2-Dioxygenase
publication title Crystal structures of salicylate 1,2-dioxygenase-substrates adducts: A step towards the comprehension of the structural basis for substrate selection in class III ring cleaving dioxygenases.
pubmed doi rcsb
source organism Pseudaminobacter salicylatoxidans
total genus 103
structure length 366
sequence length 366
ec nomenclature ec 1.13.11.4: Gentisate 1,2-dioxygenase.
pdb deposition date 2010-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3nl1A01
3LWCA 3E6BA 1VJ2A 5LRRA 2OZ6A 5LEKA 3N4MA 4XF1A 3IWZA 5I0SA 5KHJA 3CO2A 4ZU4A 3L2HA 3UKVA 1PMIA 3S7IA 2EAAA 2XL7A 3ROUA 3PLQA 1ZREA 4AVAA 4J1XA 1Y3TA 1ZZ6A 4R52A 1RL3A 3BPZA 1Q3EA 3QOPA 1H1MA 2Q0AA 2WFPA 4QX5A 3SHRA 4Q29A 3E5UA 3C3VA 5EFUA 3D0JA 1V70A 5BUVA 4IEYA 1ZZ9A 2IC1A 4JTNA 4MGIE 1UCXA 1O7FA 4KL1A 4OLLA 4A2UA 3I59A 1UD1A 2PFWA 4EV0A 3MDPA 4IEWA 1VR3A 1SFNA 4UBHA 5LEJA 4MV2A 4YSFA 3OF1A 1GQGA 4EROA 3ES1A 3KMHA 4R8HA 2IXIA 5KHIA 2O1QA 4ZU5A 3RYRA 2H0VA 4LEJA 1X7NA 1DZRA 4L2NA 4IEQA 5K8SA 1UW8A 1O5LA 3LZZA 3DN7A 4XF4A 2Q4SA 2H6CA 1YFXA 4Z82A 1CAWB 2XL9A 2GC3A 4IEZA 4XF9A 2QDRA 3NVCA 5J7MA 5I8YA 3SMHA 3B02A 3UKTA 1J1LA 3CEWA 3RYKA 3UKNA 5BV6A 2KXLA 4CYDA 4I3PA 4FAHA 5EZWA 1NE4A 1Q5OA 3JZVA 2XHKA 4HLTA 2GC0A 4HVRA 1J58A 1ZZ8A 3OGJA 1ZX5A 1L3JA 2MPFA 2D5FA 1O3SA 4PJYA 2BYVE 4J1WA 2V09A 4HBNA 2XLAA 3H7YA 4L11A 1O3RA 1DGRA 3WW3A 1CAXA 3BALA 3FE5A 4LUKA 1YWKA 2ZCWA 5E16A 3QACA 3EO6A 3LA2A 3CF6E 4EWAA 4YYOA 4IEOA 2IXJA 5BXXA 4KWKA 5FPXA 3O14A 4BIFA 4IEPA 1RGSA 5FQ0A 2PYTA 4QM9A 2PA7A 3S7EA 1WGPA 3KSCA 3PNAA 3E6DA 4QM8A 3ES4A 2ZKLA 5FPZA 1TQ5A 4I2OA 2MNGA 4FBFA 1OMIA 3GBFA 1RC6A 2H6BA 3HQXA 4IERA 5T3NA 3FHIB 3FFQA 3H3UA 4LUMA 5J48A 3LA3A 3E6CC 4MX3A 5E1RA 5JSOA 4LA2A 4X6QB 4IEXA 5I91A 1WLTA 1UIJA 1RUNA 3BB6A 4LA3A 1FT9A 5KHKA 1QXRA 3CL1A 4AVBA 4JVAA 3IBMA 2E9QA 3H50A 1XE8A 3U10A 4MUVA 2HJIA 4N9IA 4KU7A 4XFCA 1NYWA 3VHRA 5JR7B 4F8AA 2D40A 4ORFA 2UY9A 1EPZA 4I01A 2VQAA 4LULA 4Q0SA 4XFAA 1J3RA 5D1IA 1XRUA 3PVBB 4MZUA 2WC2A 4K8FA 5KHHA 3NL1A 2O8QA 4O9GA 3H9AA 2UYBA 3SCFA 2PHLA 4XFHA 2OA2A 1EYBA 4FAGA 3FX3A 4Q0VA 1YUDA 1SQ4A 3OCPA 1DZTA 3I54A 4YRDA 3HIFA 2B8MA 2Y0OA 1CAUA 2XGXA 4QXKA 1UPIA 4MGZE 4BYYA 3OD0A 4RD7A 4Q0PA 3G7DA 4XFBA 1LB2A 4HSLA 4XFGA 1IPKA 1NZCA 3I7DA 4UXAA 2PAEA 3IDBB 4HZFA 4TLFA 5JCTA 1GQHA 3U0ZA 4IETA 4I09A 1IPJA 2UYAA 2B9UA 3CLPA 5LRSA 5CADA 2Q1ZB 4AQ2A 3EJKA 3D82A 1JUHA 3EHKA 1X82A 1UIKA 2F4PA 2IXCA 5JSRA 4FT8A 4QGNA 4XFFA 4N9HA 2CGPA 4Q0UA 4XF0A 4X6RB 3TNPB 1CAVA 2BNOA 3ETQA 3M70A 4AVCA 1ZRDA 3KGLA 2ETEA 5I0UA 5BY5A 3HT1A 3LAGA 4EWDA 3OTFA 4ONUA 4E2GA 1G6NA 4PIYA 4B29A 3M3IA 4WZCA 3MYXA 5I8SA 3RYPA 3DL3A 5CVRA 5KBFA 2OYZA 3RNSA 2FQPA 5JAXA 2ATFA 1X8MA 4HN1A 3RZZA 2GC2A 1CAXB 3H1YA 4KWJA 4JV4A 2BGCA 2D5HA 2K9ZA 4UBGA 1RUOA 2C0ZA 1LR5A 2K0GA 2GZWA 1OD5A 4E2QA 2MHFA 5HI0A 4EWEA 5FQ0B 1I5ZA 4AQ6A 1EP0A 3FWEA 2XLFA 4XETA 2IXKA 2OPKA 5I8TA 1ZVFA 4WBBA 3EQEA 3H1MA 4GULA 1O5UA 1ZZBA 2PQQA 3KCCA 3DV8A 2GC1A 4O9EA 1ZRCA 4LLOA 2Z69A 3GYDA 3CJXA 3RPQA 1Y9QA 4QMAA 2Z2SB 4QGLA 1VP6A 1NE6A 4KWLA 2QNKA 3EBRA 2EVXA 3H3ZA 3IDCB 4P9GA 3ZDSA 4F7ZA 4HMZA 2I45A 4AXOA 3ELNA 3E5QA 5C8WA 5FDBA 3ACLA 2VECA 1ZRRA 2DCTA 1QXJA 2D93A 4I0BA 3NKTA 1NXMA 4IEUA 4MGYE 5JSPA 4JTOA 4PIXA 3IIAA 4PIZA 3WW4A 2PHDA 3NW4A 3LA7A 5CU1A 1OFNA 3FZ3A 2BNMA 1X8EA 3MZHA 4BH9A 1YHFA 1I6XA 2PAMA 3I59B 1CGPA 1CAWA 2BEOA 3LOIA 3KGZA 3SCGA 2Q30A 1RTVA 3D0SA 3WW1A 1ZZCA 1YFUA 3H1WA 1O3TA 3NSTA 2GAUA 2CV6A 1FI2A 4NVPA 2XLGA 5KHGA 1ZNPA 3BU7A 2BNNA 1H1IA 3E97A 4E2SA 2CAUA 1QWRA 1CAUB 2QCSB 2PAKA 2B5HA 2PTMA 1CX4A 4MGKE 4HVQA 4XFIA 1EY2A 4KU8A 2IXLA 3FJSA 4XF3A 5J3UA 4QGMA 4I02A 1O4TA 4ZU7A 4YARA 4Z07A 1PM7A 2P17A 1ZRFA 1U12A 2N7GA 3SCHA 5FLIA 1LRHA 1J3QA 3DKWA 3H7JA 1FXZA 2UY8A 3R6SA 1J59A 5BPXA 1YFWA 2FMYA 4H7LA 1LKNA 4YNIA 2ET7A 4BHPA 1Q43A 4D7TA 4HVOA 3ST7A 5FCCA 1WA4A 4LTAA 4IEVA 1SEFA 2VPVA 1O3QA 2XKOA 1XE7A 3HT2A 1CAVB 4HN0A 5FLJA 4META 5I0RA 3S0MA 3NJZA 4I0AA 4DINB 2EA7A 1QY4A 4OFGA 1HW5A 2CAVA 3BCWA 5I93A 1YLLA 2QJVA 5AVPA 1J3PA 3TNQA 5F1RA 3H8UA 2OZJA 5FLHA 4D7SA 1YFYA 4MH0E 1ZZ7A 2GU9A 2XKPA 3SXWA 5I0TA 2HKXA 2GH2A 4HSJA 4IESA 1DGWA 2IXHA 5C6CA 3WW2A 3MPBA 4WVZA 3USSA 4Q0QA 1OI6A 2ET1A 3E5XA 3U11A 4XEZA 2QVSB 3RDIA
chains in the Genus database with same CATH superfamily
2VGDA 3JU9A 3M3CA 1DU3D 1VJ2A 5LRRA 5DZFA 1VAMA 1XPWA 2WAOA 1W9FA 1YJKA 3AFGA 3IWZA 5I0DA 1JZ5A 3AYEA 5KHJA 2VE1A 3CO2A 2C9AA 5CNAA 4YGCA 5E8AA 3AL6A 4NUBA 1UY1A 3IDAA 3VBOB 2EAAA 3MW3A 2WWUA 2D6KA 3ZXEA 4AVAA 3FUQA 2YDEA 1GOGA 1MEC2 4HPKB 4CCLA 3U78A 1Q3EA 1H1MA 4GJYA 4QPIC 2Q0AA 3A0NA 1MEC3 1W6PA 2VNGA 4Q29A 4XW3A 1AXZA 3SHRA 3VBHA 2VQUA 2PHXA 5EFUA 3A23A 5SV5A 1RMU2 3TEWA 2NQYA 4B4QA 2IZWA 2V4AA 3PJQA 1SDDB 1CD3G 1RMU3 1UZWA 4P14A 1RMU1 2FHRA 4C8DA 1UCXA 2JECA 4LKDA 1OFSA 3LFIA 4JRLA 4OI0A 2VAUA 1I3HA 2R0FA 5FY0A 3RGBA 5CFDB 1X9PA 2PFWA 1XXNA 3MDPA 1R092 2WZR2 1DGWX 4Y5TA 3RS6A 4BQ1A 1CVNA 1ZRIA 2C5DA 1PK6A 4KG8A 1R093 2WZR3 2L9LA 5FKCA 3U14A 3BVCA 1OQ1A 3O0WA 4Y20B 3T0AA 3KMHA 1E5RA 4R8HA 2IXIA 3EYPA 3K2OA 3DXUA 4RR3B 1OKQA 1S0JA 3APBA 1CJDA 3CZUA 1PGL1 3JD72 2GNMA 4L2NA 3KZ4C 5GZEA 4IEQA 3O1SA 3JD71 1UW8A 1O5LA 4GWMA 3DN7A 4QB1A 4UFIA 4XMIA 5K0UC 1HJGA 4QHZA 5F6LB 3H8XA 1V9U2 1IGOA 3OOXA 2GC3A 3RZLA 1V9U3 3PIJA 1AYM2 4GWIA 4LLFA 4RFRB 2QDRA 1IKQA 1AYM3 5FZ9A 1AYM1 4AFMA 4IW3A 4EN8B 2LRPA 3RYKA 2CHHA 3UKNA 1WMXA 1GZCA 2R30A 4I3PA 4WM7B 1PGSA 1PMHX 4V2WA 4XIOA 3CJIA 3WG2A 1F35A 4XYXA 1C1LA 3ZSLA 4YM2A 3WZ1A 1TZOA 1XSRA 1NE4A 2VUDA 1X36A 4NROA 4SBVA 5T5LA 4IV3B 4P9JA 4DFSA 2CDPA 2WYFA 1SDWA 3AMPA 1WCKA 1LHNA 5FPBA 3N9QA 2W2IA 2P6HA 4JC1A 5H9QA 4RHV1 3UJOA 3IDEA 1IS6A 3NV2A 3ZFEA 1L3JA 4NHYA 1I5PA 4QQLA 1G9CA 1H9PA 4PJYA 5T54A 1Z0HA 2VXRA 1PZ7A 2E32A 2KD7A 4L11A 2W94A 1W8FA 4NRQA 3BALA 1W9YA 3I2IA 2VW2A 4ISRA 2YGLA 2ZCWA 3TN92 3AKTA 4JGZB 3AMMA 3WXPA 3TN93 2VZQA 3TN91 1CZTA 3MV01 4IEOA 5IFTA 3N9NA 5EWSA 2UWCA 1WZXA 3CMGA 3VBRC 3KCYA 1OA4A 1BKZA 1RGSA 3LSEA 2PYTA 5C4WC 1DCSA 4N8MA 1WCUA 2HLEA 1BBT2 1GANA 2VZRA 4QM9A 4LO8A 4R9DA 1IG0A 1WGPA 1COV2 3S7EA 3WSOA 3PNAA 3E6DA 1LHWA 3HN3A 4A7YA 4DZGA 1BBT1 1COV3 1ZA4A 2E7TA 2XUEA 1COV1 3WV6A 4ES8A 1W0NA 1E5HA 5FY5A 3THTA 3TYJA 2OS2A 1MS1A 4YW1A 1OUXA 4RQPB 2YY1A 5D8AB 3FFQA 2P4EA 3WF4A 3HPNA 3AP4A 4JQRA 5J48A 5FZ3A 1NKGA 3TRSB 4R9AA 5ACA1 3Q8BA 4IXLA 5FYYA 1ST8A 2VCMA 4LA2A 1TE1B 3WUCA 4LT5A 4C1XA 4IEXA 5I91A 4QDSA 3DXTA 1WLTA 2GALA 3HWJA 4XPVA 5GLVA 1VIWB 1W9TA 4XUTA 2IWGB 1QXRA 1CN1A 3CL1A 1SHWB 2ZHKA 1LULA 4JVAA 1LJ7A 4KBZA 1XE8A 3S6PA 3U10A 1CZSA 2E33A 3I3DA 1EV12 4XFCA 2RV9A 2WJSA 2Y64A 1QEXA 4BWOA 1EV13 4CCOA 4ORFA 1OBNA 2VMEA 2B4KA 3I2DA 3AZXA 4DEVA 2ARXA 3Q8EA 1AXKA 1W3XA 2ZPXA 2VZ3A 4H2AA 5C9AB 3B5LB 1UYXA 4M3CB 4LULA 2Y6HA 4XFAA 1WCQA 1J3RA 4NRPA 5JXIA 5LZ6A 3PVEA 3OBZA 3WDXA 4C91A 5F7UA 4NIHA 1T6BX 4L0PA 5FUPA 3ME2A 1HRV1 4UFJA 3SCFA 2DU1A 2HBUA 4UFKA 5CKNA 3THDA 1KRIA 2W5FA 1JTZX 4FXKB 4QPGA 2BFUS 4OVEA 1N3PA 1ND3C 3MLJA 4M3CE 4OMCA 4BE3A 5IK4A 4H7MA 1DLCA 3ILRA 1KQRA 1DZTA 4GA9A 1EUUA 4YVSB 3VDCA 3ZKYA 3ZSJA 2CYFA 3ZX7A 2B8MA 3MUY1 5FYSA 2B7YA 2ORZA 2X5IC 2DYCA 2WLQA 1UPIA 3ZOIA 3EMRA 3SQOA 3ZYBA 3GZTB 4FOQA 3BTXA 2D6OX 2WL1A 3M2MA 3MI8A 2X10A 4RGGA 1LB2A 3J7LA 4HSLA 5A7WA 1OKOA 2ZEYA 1WWYA 2NLRA 1W6OA 1F15A 1XJAA 2QKDA 5C70A 5FMOS 3PDQA 1GQHA 2RJKA 2WABA 2DV9A 2VZTA 1VBC1 5T52A 2WFF2 4I09A 2JDPA 2ZACA 3CLPA 4RS5C 3WOGA 1F31A 2WFF3 5JMCA 2P6CA 5EYYA 4YLZA 3LEMA 1JUHA 1NX9A 3T30A 2E63A 2WNOA 2YV8A 3PHMA 1E57A 4GKXA 2G9GA 4JDNA 1OF4A 3ZFGC 1H8TB 4Q26A 3SITA 4BQ3A 3HD8B 3MLKA 4FT8A 4QGNA 5FZKA 3TB0A 1JS9A 2ZS6B 4N9HA 3WCRA 2CGPA 2YC4A 1R1A3 3NAPA 4Q0UA 2JE8A 4XF0A 2F17A 2ZHMA 4WM8A 4CCDA 2WR9A 2ZGTA 1ND2B 1C57A 2BNOA 2VY0A 5FXZA 5FZOA 3M70A 1RUD1 3M1HA 3AX4A 2FDKA 4A41A 4E27A 4YGBA 1S0FA 3DEMA 5FWJA 2VMGA 2ETEA 4TTGA 1VE0A 4EN9B 5BY5A 1OPMA 3HNBM 2BOJA 3HT1A 1D2SA 3H3LA 5E88A 1H4HA 5FK8A 1PHMA 3LKJA 5FYTA 1XYOA 3OY8A 3THCA 5IVCA 3H8RA 1T2XA 2W1SA 4Q4X1 1PO12 4PIYA 4LXLA 2DUOA 1HB4A 3M3IA 3ZR6A 4WZCA 2OVUA 3LOBA 1PO13 5I8SA 2AH2A 1NCQA 1PO11 3MW2A 2YUEA 4XUOA 2QQKA 5L7OB 3DL3A 5CVRA 4TSVA 3MUZ1 5JIAA 2A3XA 3BU0A 3IAPA 3ILNA 1Q8PA 1WLCA 2HEVF 2WQ4A 1LU1A 3AZYA 4CDWC 2JDZA 3RZZA 4XUNA 1UXXX 3NRUA 4KWJA 4FPCA 1NLQA 1UY2A 2VH9A 4XE9A 1NAEA 5D8AA 2XWBB 1ULDA 4GKYA 2MEV1 4MYEA 2ZAAA 1LOBA 2HEYF 1MS4A 2GN3A 4QPIB 5L19A 1DQ2A 1DLLA 4AWDA 3MIEA 4JHTA 3WDUA 3PUSA 4LBNA 5A7QA 3VHPA 4E2QA 2OQ7A 2P3IA 2GDFA 3V64A 2RJLA 1AUYA 1QJX2 3VBSC 1I5ZA 1UX6A 5F3EA 2ZGQA 4X8NA 4IE7A 4D94A 1QJX3 3JCIA 1QJX1 2VW0A 2WSVA 1SBFA 4WBBA 1H8VA 3EQEA 4HK8A 1MVEA 5C7GA 1TG7A 3RMYA 1GFF2 4ITCA 4ZXEA 1BLZA 1PZ8A 3WF1A 3ZXLA 4FOYA 5FZ4A 1QGLA 3NO8A 5FZLA 1LESA 2D6MA 2RJ2A 2XBO2 3R4DB 1G9BA 2Z69A 2R1BA 3GYDA 1H0BA 3RPQA 1F5FA 2XBO3 3LEKA 1Y9QA 3LPGA 2XBO1 2Z2SB 4QMAA 3RFRA 3O1PA 1RUJ1 2R6QA 2QNKA 3EBRA 3IDCB 4UWDA 2ZX0A 1TEIA 4F7ZA 2BW8A 3ELNA 5FDBA 2W3JA 5FYMA 1W2AX 2X53S 3ACLA 1C5IA 2VECA 3LDRA 2DCTA 5FYCA 1QJZA 1QKQA 5DXDA 4XIKA 2IFRA 2RDNA 2ZGNA 3NJYA 3NKTA 4I0BA 5F39A 1BQPA 3ZN5A 2PHFA 5FY9A 4HONA 4BB3A 4OZOA 3IIAA 5IK7A 1YYNA 4YZ5A 2R062 1NG0A 3OYWA 1K5MB 4TXWA 3WT3A 3RZMA 3ZPYA 2R063 2R061 4LBKA 3RRDA 1JYVA 3AP6A 3M3EA 5CAZA 2WNVC 4N53A 1HB2A 1QDOA 1YHFA 2DTWA 2VR4A 4IGQA 3VZLA 4O65A 2ZTNA 4FQZA 3GCXA 1GZTA 3I59B 5C33A 3ZIWA 2WO3A 2LUWA 3QCWA 1CAWA 1Z7S2 2BEOA 5KWRA 1OUSA 3PVOA 1UOFA 1NXD1 5A1AA 1AR92 1Z7S1 2ZX2A 1ZZCA 4OCTA 3MFCA 3H1WA 3A7QA 1WLWA 1AR91 2XLGA 4XTMA 3BUCA 5L36A 2DVAA 4YZ4A 3VKNA 1H1IA 1LENA 3OUJA 3A0KA 1G9FA 2PAKA 2VZSA 3KS7A 1H8TA 2WNEA 2ZGKA 4L8QA 1R082 4CVUA 1HN0A 4GXLA 1R083 1DQ0A 5LBEA 5FP4A 4BXSV 1MZ6A 3KT4A 3K4ZA 1EY2A 1D0GA 2IXLA 4KU8A 2XJSA 3FJSA 1HX6A 1GZWA 1VBD2 3EXUA 1BEV1 4I3GA 4XF3A 4I02A 5A7NA 3VZJA 2GNBA 1O4TA 4NHKA 4ZU7A 1AL22 1VBD3 1GWMA 1PX4A 2YMZA 4LE4A 4Z07A 1Q8QA 1AL23 3VBRB 1PM7A 1IKPA 1AL21 2JDYA 2P17A 5EJ1B 3WP3A 1ZRFA 1U12A 4QKFA 1LHOA 1XYPA 2JDNA 4I30A 4AEDC 5C4WB 5FLIA 1LRHA 1J3QA 3DKWA 3H7JA 3FMGA 3AYDA 3I2JA 4HG6B 3I2HA 1FXZA 1UYPA 3VD5A 3O5SA 5FP9A 5BPXA 4MXWA 2FMYA 4K7JA 4UT5A 3ZDVA 1V0AA 2EICA 4LPLA 1LKNA 1NQJA 4YNIA 3K4DA 1H2MA 1Q43A 3O7OA 3VLBB 1HV1A 4LTAA 4CU8A 4EE2A 4IL7A 1BMV2 1LEDA 2NMOA 2VPVA 2FZ2A 3VBUC 1P8JA 1GQPA 4Q4W2 1WMFA 3WDVA 1POQA 1CAVB 4Q4W3 1O59A 4Q4W1 3UETA 2WA4A 1YQ5A 4META 4Y1YA 3WF3A 4CEYA 1GWLA 5I0RA 3BOWA 2B46X 3ORJA 4I0AA 2WS92 5CISA 1LEMA 1OSGA 1W8OA 3W9AA 3CIHA 1NA1A 2WS91 1MPXA 3BCWA 5I93A 4GIQA 1KJRA 4PDWA 2QJVA 5AVPA 4D6SA 2NZ9A 3UT0A 2YHJA 2YU2A 5FLHA 3ZMNA 1MS8A 1E5SA 4KQ7A 2VMIA 1HRI1 4FFGA 2WN3A 5DUVA 3VD7A 4BISA 3CHXA 3HMYA 4JGYA 4P9XA 5C3QA 3AKPA 3AC0A 1W2TA 3RZKA 1NLSA 1MZ5A 2R041 2XQRA 4Q8KA 4HSJA 5J09A 2W95A 2XUMA 4PQQA 1DGWA 1UU6A 5F8PA 3DCQA 3MPPG 4CEWC 2V5YA 4ET7A 3JQXA 4MXVA 1DYPA 3VD4A 2Y6FA 3WW2A 5BNNC 4R9BA 3USSA 2R32A 4Q0QA 2FDGA 1VMHA 2E51A 2VD7A 1OI6A 1U0AA 3IN9A 1AR72 5A7SA 3ETPA 4KMQA 3E5XA 4I0WB 1J1TA 1AR73 1ND3B 3VKMA 4XEZA 1JU4A 3PTRB 1ODMA 3KHCA 3RDIA 3LWCA 3E6BA 1VBB2 1MVQA 2HWC2 2OW4A 2OZ6A 1VBB3 2JE9A 2HWC3 5FXWA 2X5IB 5I0SA 5G05L 1WKYA 3EB7A 4ZU4A 1LU2A 1JYWA 3C8XA 2DF7A 3VDDA 4CU7A 2CGOA 1IS5A 4J1XA 4PI0A 4J25A 1Y3TA 2JICA 4GJZA 4OULA 4ASMB 1DYOA 4IE4A 5EIYB 4J6GA 2A71A 1D4M1 1W6QB 4AYUA 3UGFA 2D43A 1K5MA 1HB3A 1V70A 3I97A 5CEHA 5HPOA 1I9RA 3PMEA 5FXVA 5BYNA 4C1WA 1S2BA 2EIEA 4JTNA 4RS5B 4LBQD 1H6XA 4E9KA 1OLQA 1O7FA 2ES3A 4LR4A 4XAEA 3ZYGA 3I59A 4S2GA 2DCYA 4NHMA 1SG3A 5BNPA 5GJ6A 5KXEA 3ZFGB 4C90A 1JYCA 2BV4A 3POBA 3VDBA 5LEJA 4MV2A 3PURA 4YG6A 1JZ2A 4EROA 4CP9B 2ZGLA 2LTNA 3J8F1 3ES1A 2EIBA 4P9YA 5CFCA 5KHIA 2GMPA 5FXXA 3WY6A 1AX2A 5C5UA 3I2FA 3RYRA 5FBZA 4IV1A 3K77A 3VZMA 3F95A 5HCAA 4MGTA 1N1YA 2H0VA 4JDOA 3I2KA 4D7YA 3S5AA 4AGRA 5K8SA 5LK7B 3SKJE 4N90A 5TSWA 3IMNA 3ZXJA 2GNTA 4BU2A 3U4XA 5DAQA 3K46A 2H6CA 1QU0A 1YFXA 4Z82A 5DMYA 2JDKA 5JOYA 1FV3A 1DGLA 5L9VA 5A70A 3DPRA 3NNMA 4BOWA 4OHWA 1LOCA 3MEPA 4Z2AA 1YIFA 3NVCA 3WVJA 4IGPA 4BQXA 2DFBA 5J7MA 1VBE3 3KWVA 4AF9A 4X8PA 1OA3A 3SMHA 1J1LA 1RUC1 3POEA 1RVF1 4AHXA 4CYDA 4E4ZA 4N7IA 1OURA 4QPYA 2Y26A 5IAVA 5A3LA 3OG2A 5FZAA 5EZWA 2XJTA 4CDWB 2R49A 1K45A 1R1ZA 4HLTA 1BJQA 1ENRA 2ILMA 1XOYA 3SISA 4M4RA 1H2NA 4NHXA 3ZN4A 3UGHA 2X05A 1J58A 1ZZ8A 4O7XA 5H9RA 4AFBA 5IHRA 1F9KA 2NP0A 3VV1A 2JD9A 2MPFA 1W6NB 5FZFA 2KA3A 4N43A 5LA9A 1O3SA 2HWE2 1RXFA 2WLPA 4J1WA 4D6RA 3W5MA 2FCVA 2RVAA 3UJQA 2XLAA 1SLBA 2HWE3 3HQRA 4AVSA 2HWE1 4LBMA 3VBSB 1PX3A 1U5ZA 4GWJA 5GLWA 1O3RA 3WW3A 1KD7A 5HCBA 4QQPA 1UWWA 2QQVA 4FXGB 2WIIB 2ZGMA 2FD8A 1W03A 4XQWA 2QDNA 3VUOA 5C8CB 3CF6E 1VLNA 2WNUA 2G1MA 5KR7A 1OLME 3MHZA 2B39A 3RQ0A 2W08A 4GB32 1W9WA 3V0BB 1ASJ2 5F9TA 3OGGA 1QNYA 1NCRA 4GB33 4PCRA 1ASJ3 1GNHA 2ZZJA 4IEPA 4OHZA 3SH5A 3W20A 3KCXA 1DBNA 1GU3A 2BRTA 5K7PA 5IVJA 3NWKA 4LO5B 4XDOA 1QOTA 3ZKUA 4AI1A 1MQTA 4CDXC 3ZYIB 1OLRA 4ZS3A 3AL5A 2BVBA 4I2OA 2MNGA 2D3SA 3GBFA 4ZPIA 1PM4A 4YZ3A 2QE3A 2E7QA 1LOGA 1KDMA 1O8SA 2BTVC 1WMEA 2P34A 2P2KA 3IKWA 2ZJCA 4MX3A 4YW7A 3RJ2X 5ABJC 4PLOA 4X6QB 3RI9A 1QJFA 3ACFA 4NPMA 4QDRA 4YW3A 1RUNA 2PMWB 3BB6A 4XDPA 4QKNA 1GZ9A 2WNVB 1S0GA 3KM5A 2XOMA 3ZMOA 1NQDA 4NOTA 4AVBA 5JLVA 4B4PA 4RYDA 1WLDA 4LKFA 3VHRA 2YXSA 5E6HA 3B3QE 2D40A 3PMSA 1PVXA 1XB9A 5FMOL 1MEC1 4AR2A 3KF3A 4M3CF 4XBQA 3FBMA 4A3XA 3HJRA 1C4RA 3ABZA 3R05A 2VQAA 5DN2A 5A3OA 4XXAA 4Q0SA 5DAWA 2WZ8A 2ZA9A 5FPUA 1TNRA 3PVBB 4MZUA 4UW6A 4YW2A 1YCIA 3KD4A 3WUDA 1WD4A 2OPWA 4Y22A 5KHHA 3VBFC 2YPJA 5FV3A 2HWB2 3VZKA 5LBCA 5K4LA 5CKMA 2HWB3 4MADA 2OA2A 2HWB1 1EYBA 3SC7X 1MS9A 1C8M2 1R091 1ZA7A 2WZR1 1FX5A 1K5JA 3FX3A 3M4FA 2RDQA 4GZ9A 4BQYA 3RI8A 4BA6A 2W39A 1C8M3 1JI6A 1UY4A 1C8M1 1UZZA 4Q4Y2 4DIQA 4YVWC 1UMHA 1SQ4A 1YUDA 3OCPA 2JG8C 4R4ZA 2ZX4A 5AVAA 3GGLA 4Q4Y3 4RGKA 4L92A 1UO9A 3VN4A 3ZYHA 1CAUA 1XU1A 2XGXA 4GH4C 1BZWA 5FZ0A 2JKXA 3WHTA 1GSLA 4AEDB 4FPLA 2E7AA 2YBKA 4LIVA 4QWNA 5A6YA 4BDVB 4AEJA 4XFGA 4PLNA 1IPKA 3I7DA 3WNXA 4LOSA 2VOVA 4ARYA 4Q5OA 2Y0IA 2PAEA 3IDBB 3C7GA 4LHSA 2PXJA 1Y9MA 2ZKNA 4LQRA 1V9U1 4IETA 2BPA2 2Q1MA 1KXGA 2Z4FA 5C71A 2WKKA 1F4HA 2WO2A 2WO7A 5LRSA 2AREA 3AYCA 3B7MA 3IIIA 3KVAA 2A75A 2FCTA 3BYWA 4UF0A 4E4DX 4HKWA 1YQ8A 2SLIA 4P08A 2VCAA 3JBG2 5JR2A 2ZMLA 1SPPA 2Y33A 3JBG3 4DQAA 2BWCA 5AC92 3JBG1 1LOAA 4Z8BA 1XYNA 4A44A 5AC93 2B42B 5AC91 4G3YC 4DXRA 2DTYA 1DZQA 1GICA 1YJLA 3OJBA 1C28A 4AG4A 1K42A 4BK5A 1V6LA 1G8WA 4Y24A 5FMBA 3ETQA 2YBSA 2P3KA 3C2UA 4JAAA 4OHXA 4XZUG 1EAH2 2DUQA 1YO8A 4EN6B 3BI3A 2R072 3RG0A 4CCJA 1BYHA 1EAH3 5KC6A 2WBKA 3OUHA 1A3KA 5I0UA 3RZHA 2C9KA 2R073 3POYA 2R071 4WVMB 2HH9A 4CEWB 4AVTA 2E26A 1LOFC 3LAGA 1B35C 4LKEA 4EN0A 3OTFA 4ONUA 4Z2WA 2DBNA 5C8CA 4E2GA 2TBVA 3J7MA 1Q8SA 1W8ZA 4W65A 3ZYRA 2ZXQA 5BNNB 3JB8A 3P5BA 3V0BA 5EPAA 4AK3A 4JZRA 3MYXA 4Q1RA 3WQBA 1AJOA 3FN9A 2AEZA 4Q4V2 2W9XA 3RYPA 1AX0A 4FFIA 4Q4V3 2OYZA 3PU8A 1GP4A 4XVHA 4OMDA 1OOPA 1QQP2 4V1PA 1X8MA 2D7FA 2GP5A 1VRBA 1EUTA 2EXJA 2ZX3A 4KGGA 1A78A 4Q2FA 2QTWB 1OHFA 1QQP3 4PLMA 5EP9A 3USUA 2CNAA 4A4AA 4CDUA 1UY0A 5JZGA 2J42A 3K48A 1CAXB 3H1YA 4UFHA 1QXPA 3NJXA 1DG6A 2BGCA 4JV4A 1RJ8A 2JDUA 1RIRA 4OUEA 3HBKA 1GYKA 2OQ6A 1M4WA 2D5HA 3AMNA 4TYSA 4UW4A 1W39A 3M8LA 1HB1A 3LFMA 4FQ4A 3LSDA 4UBGA 1M06G 3GDBA 1RUOA 2YGMA 1LR5A 4CPBA 1V6KA 1OD5A 5FO7B 1N1VA 4FPYA 5IW0A 4DS0A 2EXKA 5CG8A 1PVC2 4FI9A 5ANQA 4YWAA 5FQ0B 3WP5A 2WWJA 1EP0A 1OF3A 1PVC3 4XCAA 4AQ6A 4CUAA 3FWEA 2JD4A 1HDKA 5GM0A 3VBOA 4XETA 1SLTA 4CDQC 5I8TA 3O1TA 5FY7A 1JUIA 2UURA 2ZHNA 4GULA 4HPKA 5FAXA 3M3OA 4R9CA 3ZFFC 3KT7A 2QQLA 3KCCA 1PZ9A 4E4HA 2YB7A 4QX0A 3N9OA 4XJZA 1EV11 2W46A 3J9SA 2VOKA 3LIGA 4XQ4A 3URFA 3MFAA 4MLOA 1JW6A 4XOGA 1SCSA 2P3YA 2BDRA 3PTYA 4PBPA 2KR2A 5SV8A 1JYNA 1H30A 1JYTA 2RR12 1VP6A 4N7UA 3WNLA 3RVHA 3AB0A 4CCKA 3H3ZA 3ZVXA 3ZSKA 3ZDSA 2RR13 3T1MA 1O4YA 2RR11 2I45A 3CDZB 5CFDA 4NE9A 3IT8A 1H6YA 1XNCA 4BQ4A 4A6SA 4BXFA 2Q8OA 3I4IA 2ZHLA 1PO22 2D93A 3G6JB 4GWNA 4YW5A 4JDMA 1GMMA 1XE0A 4K20A 3WQ0A 1PO23 5IK8A 1JOBA 3ON7A 4IUGA 4Y20A 4RSUA 1ENXA 3FL7A 4NIIA 5IYYA 3O1RA 4LMFA 2VULA 1BVP1 1UKRA 2JG9C 1TME3 2XVLA 4RR3A 3I8TA 2C1FA 1MS3A 2PHDA 3NW4A 2BBVA 1POV0 4AGVA 2RM22 5F5QA 5DAPA 2DUPA 3W58A 2W92A 5FZEA 2RM23 4K1ZA 1RUG2 2BERA 1ZYBA 3V56A 3I3EA 1RUG3 4W8JA 1RUG1 1I6XA 1FPN2 1CGPA 2XQXA 3HQUA 3LOIA 1LECA 1FPN3 2RDRA 2XJUA 1FPN1 1UN1A 1SBEA 1YC61 2WINB 3D0SA 3HOBA 4QKDA 3WW1A 1YFUA 2GH8A 1HXS2 5DZGA 2F6BA 3NSTA 4CXXA 2ADEA 2JEMA 1HXS3 3DYMA 4HK9A 4NAOA 4YG3A 3RWNA 5GLUA 3N7KA 1W8HA 1KEXA 4WM7A 2WFF1 5JVVA 1X9TA 2BNNA 3JUUA 4E2SA 2JENA 4K40A 2CAUA 3BTZA 5FK7A 4E4SA 2R0HA 5JPNB 4IV3A 4IDZA 4LHLA 4COYA 3NQHA 1GWKA 3O0VA 1CX4A 5FPAA 1R1A2 1ULEA 3NMBA 4Y4RA 4HVQA 2HYKA 4RFT0 5F5IA 3IB3A 5J37A 1R1A1 4CCNA 3BTYA 4W4ZA 2Y6KA 4LIUA 4IE6A 2VBBA 3VBHC 2ADDA 1K12A 2YC0A 4TZDA 5G04L 2H0BA 4ARXA 2B45X 4LBQB 4CUGA 4M00A 3SCHA 4NWVA 1JYIA 1RUI2 4DNYA 2J7MA 2YG0A 3B9CA 1VB4A 4GMP0 5FZ1A 1RUI3 1W90A 4CDXB 5A1FA 1SZBA 3IM0A 1VRH2 4CUCA 5A6ZA 3Q9OA 3BIEA 2DVGA 2Q8CA 4JGZA 1YFWA 4DRVA 1VRH3 1JYXA 1PK6C 4BHPA 4KG0A 4NIGA 2F4LA 1UPSA 5DAVA 3PUQA 3GCWA 3Q8AA 4HT1T 3KQRA 2XKOA 2EF6A 1XE7A 1YQCA 5ABJB 5DAXA 4HN0A 4ATEA 5FLJA 4S2HA 2ZZQA 3T2QA 1SBDA 4QKBA 3GJBA 1XBFA 3AP9A 3GZAA 2EA7A 5JUVA 1QY4A 3OSDA 4OFGA 1HW5A 3GHMA 3AVRA 3IAQA 5LA2A 3OBAA 1YLLA 4RQPA 1J3PA 4DXZA 1KS4A 3H8UA 4A3ZA 2A6ZA 2W87A 5A6XA 1ONAA 2AUYA 5JXGA 4D7SA 4ASKA 1G7YA 1CONA 1DFQA 5A32B 1ZZ7A 1UYZA 5FZIA 3DECA 2X09A 1YQ6A 3B69A 3WX5A 1YRZA 5FYZA 1AX1A 4QXBA 3AMHA 2IXHA 4WVWA 1CX1A 3R4SA 3GALA 3CJIC 3PJYA 5KC5A 3VBFB 4B3NA 5FOJB 3MPBA 1REEA 4PHZA 4QXCA 5CB7A 5JI9A 1VB2A 2QZ3A 5HBAA 4QHOA 4YPJA 1Q8OA 2QQWA 4DUWA 3U11A 3CKHA 1FNZA 4NO4A 2UWAA 3ZFEC 4C0BA 2I07B 4M3CA 5C9AA 4YVWB 5FPLA 3A22A 2JG8B 5C3RA 2DVFA 3B01A 4NPRA 1ULPA 3ALQA 4MOAA 5LB6A 3N4MA 1US2A 4GH4B 1GUIA 1CIWA 1UOBA 5F37A 3W59A 1H4GA 3D5OA 3L2HA 2JKBA 1PMIA 3OBRA 3UKVA 1OT5A 3WDYA 4AVVA 1ZREA 3ILFA 4QU2A 4R52A 4URTA 1S2EA 3BPZA 2R7EB 2A1XA 2A6YA 3UGGA 2WFPA 4Y5SA 3IPVB 3AP7A 3BOPA 1FATA 4YVSA 3HN1A 3NNJA 3WG3A 4H14A 2WZEA 3D0JA 3MIBA 2R16A 5BUVA 2JE7A 4YZ1A 1S55A 2JIGA 2VQTA 3BGAA 4RL7A 4ZZ8A 3L9JT 2YYOA 2IC1A 1CPNA 4AL9A 5FOBB 4MGIE 3RSJA 3GBGA 2BGPA 5IUQA 4KL1A 1IQDC 1AXYA 1AR83 2VXJA 4OLLA 4A2UA 3VL9A 1UD1A 2VVEA 2WAAA 4CCCA 4FPEA 3OEBA 4EV0A 2VNRA 1SFNA 2QQNA 4MHRA 1UZYA 5F3GA 2XONA 4YSFA 1N3QA 1R64A 5A7PA 2XB6C 3ZR5A 5JPMB 2Q5TA 2A5ZA 4IQPA 5A3PA 2Q8DA 1DF0A 5IVVA 2ARAA 2FBEA 2O1QA 4ZU5A 1VMJA 3ITQA 3U37A 4BIOA 1AHSA 1WBLA 1PIV2 4NIAA 1XNDA 5ANNA 1H9WA 2QQMA 1PIV3 2VTXA 1PIV1 4XJAA 1L7QA 5AFEA 3Q8CA 3LZZA 2PHTA 1CPMA 1QJU2 2DU0A 4XF4A 1B35B 1R081 3AKSA 4B4RA 4XURA 1QJU3 5C5TA 1QJU1 1ND2A 4BLIA 3N7MA 2DDUA 4IEZA 4PBOA 2DVBA 4W6YA 1UU4A 1VBD1 1W6MB 1NLRA 2FDFA 5I8YA 1ULOA 1UX7A 4WV8A 1OQDA 3CEWA 4M4PA 5BV6A 1QF3A 5IAXA 5A33B 1Q5OA 3AZZA 3JZVA 4FPFA 3AM2A 4P02B 1OA2A 5BNOB 2HBTA 2GC0A 2JB8A 4HVRA 1S0EA 4IGOA 1X50A 4L97A 2LM3A 4QPGC 5L7OA 3T2OA 2SBAA 3OGJA 4Q1PA 1ZBE2 2VZOA 2WDBA 4XZPA 1WW6A 1BMV1 1ZBE3 3ASIA 5T5JA 2CGNA 2V09A 3MIHA 4HBNA 3SLIA 4XDQA 2JIJA 4XILA 1S2KA 1F5JA 1UXZA 3QD6A 3DYPA 1ZM1A 2QQOA 2D6LX 1DGRA 4FOWA 4MGQA 3WQ1A 1PNGA 3FE5A 4AI2A 3HNMA 3WNOA 4ATFA 1RITA 3KVBA 4CDQB 3FLTA 1YWKA 3FC0A 5F2WA 3ZIXA 3QACA 4BLJA 3WQ7A 1A6CA 4LK7A 3ZFFB 3EO6A 4B8EA 3ZN6B 3AVSA 4QPIA 4YYOA 3WG1A 2HWF2 4EWAA 3QBQA 5CKQA 3TEYA 5BXXA 2AGSA 2HWF3 3ZM8A 5KXCA 1IOAA 2HWF1 1H2LA 4CP0A 4BIFA 5JWPA 2E53A 1W05A 3VZOA 2W68A 4M0HA 1RUE2 2VL4A 4G4FA 4NJ4A 4WM7C 3OUIA 1S0CA 1RUE3 4UFLA 1RUE1 4QM8A 3WDWA 2CU5A 1DYKA 2ZKLA 1S1AA 3VKLA 1MS0A 3N9MA 4Y33A 1RC6A 1A8DA 2OUJA 2CL2A 1C1FA 3HQXA 4IERA 1OVSA 3NAPC 1W3VA 3H3UA 1SLLA 4WM8C 1SFPA 3LA3A 2JWPA 2VU9A 4A7KA 5GLZA 1AR71 4P00B 1AF9A 5E1RA 4AQTA 1QH7A 2XG3A 3MICA 2JG9B 4BK4A 1VMFA 3THPA 2VMHA 1XNBA 2VOXA 3WNPA 1CESA 1UIJA 4XJ9A 3VD9A 1VBB1 4PI2A 2HWC1 4XBNA 1VBA2 1JU3A 2B9VA 3WDTA 1WBFA 4HKOA 3UESA 4K8RB 4D69A 2YBPA 4CU6A 1VBA3 3HEIA 5K0UA 1VBA1 1NY72 2VM9A 3CZJA 2QUOA 4D8MA 3OBTA 4MUVA 1DQ6A 5A3UA 4UFMA 5APAA 5JR7B 1NY71 3SEEA 2OX0A 2WQZC 3DF0A 1RUH2 2UY9A 1VALA 3KB5A 4OQ9A 1EPZA 1NCQC 4JKLA 2PN5A 2TNFA 3AMQA 4QXHA 1RUH3 4XC9A 3ZYFA 1RUH1 1C5HA 4Y26A 1J84A 3JB4C 2ZGPA 1UZVA 3RWKX 3KF5A 4NR1A 5LASA 1N47A 4QB2A 4XUQA 1HQNA 2FZ1A 4NWWA 4AW7A 1DQ4A 2WWSA 4AHWA 4XQDA 2AR6A 4GD4A 4K3UA 1FNYA 1UAIA 1Q56A 1HV0A 1SLCA 3RZGA 5FZ6A 4XFHA 4C0HA 5D8AC 1UKGA 4FAGA 2RHPA 2Y60A 2VVDA 4XHBA 4Q0VA 5CZKA 5FYVA 1WW7A 4EZ4A 1SACA 2ID4A 2RS52 1W6PB 5LK5A 3VBHB 4FFHA 3OPZA 1QJY3 2EAKA 3MBWA 4YRDA 3HIFA 4B1LA 2RS53 4XUPA 2RS51 1V6IA 1ODNA 2Y0OA 3UV9A 1BK1A 4QXKA 1S4CA 3BN6A 2WT1A 2Y34A 3FLPA 4XHXA 3LD8A 1FYUA 4H3WA 2DCJA 2VJXA 4YW6A 4K1YA 2I74A 3OGSA 3OD0A 4RN5A 1FOD3 1NT0A 5FP8A 4B1MA 5DG1A 3J4UH 3G7DA 4P5YA 3VL8A 2WYSA 1NZCA 4MGSA 4UXAA 4ZS2A 5KXBA 5FYHA 3WNNA 4HZFA 1PK6B 3MIGA 3OGVA 1SLIA 4LOTA 2DWRA 5D2AA 1VBE2 4FPHA 3VBRA 3X29B 5JXHA 5JDBA 5FZGA 5FZ8A 5C4WA 1VBE1 2TUNA 1L7RA 2QQIA 4W6WA 5CADA 2Q1ZB 4AQ2A 2VO5A 3D82A 3AKQA 2AACA 4O61A 4YM3A 2WRAA 3POIA 1DP0A 3HVDA 2P3JA 3JQWA 2F4PA 2PHWA 2IXCA 4AZZA 5C3SA 1ALYA 4XFFA 3ZPOA 2Y6JA 2D3PA 4FVVA 4AFCA 3MLLA 3POWA 1AZDA 5A7OA 1LNSA 5JOWA 2VBPA 2XWJB 3AJZA 2WN2A 3I2OA 2GN7A 1CAVA 4LHKA 1WCDJ 4M0NA 1W0OA 2ZAHA 3WF0A 4AVCA 3PL0A 2KM2A 2A6VA 3I49A 4AAXA 2CDOA 4N53C 4FP3A 2EALA 3TOJA 2FCUA 2WUHA 3U1XA 3CJIB 4UI9L 3MO4A 4Y1VA 4FFFA 1G6NA 2VZUA 5CBLA 5FYBA 4B29A 5J96B 3FUOA 1KJLA 4MG2A 3H0OA 4XJUA 3UNPA 4A42A 1G9DA 4CU9A 4DB5A 2CY6A 3N7LA 2P1BA 4GB31 1LHVA 2WT0A 3K3NA 2DBIA 3ZFEB 1ASJ1 5KBFA 2FQPA 3B93A 1O8PA 1GOFA 3OGRA 2ATFA 2ZEZA 4BM8A 4FTSA 1AVBA 1W0PA 3KHBA 2RS12 5DDJ2 4FPGA 2G4IA 2IUWA 4LBJA 4NMIA 1H8TC 4NPLA 3ZYJB 5DDJ3 2RS13 4AHZA 2ZEWA 1WW5A 4LKSA 4D0QA 3LGRA 2G9ZA 3AXDA 1N3OA 2O14A 2VNVA 4R4XA 5EYXA 3U4SA 4URAA 1ZBA2 3ZSMA 1IPSA 1ND3A 1YNAA 2BFUL 5J98B 2NMNA 2VUAA 1AR62 4DRRA 1W04A 1ZBA3 2JB4A 3ECQA 1CR7A 3D4KA 1VPHA 1AR63 1NZIA 2GZWA 2J1TA 2K0GA 3WNMA 1FMD2 1RUF2 2ERFA 2D44A 5EXOA 2X5IA 5LATA 4OUSA 5HI0A 5IVEA 4FP2A 1FMD3 1RUF3 5FTTC 1RUF1 3ZO0B 3S5QA 3AKRA 1ZVFA 2V4VA 1PGW2 3H1MA 2HWD2 1QIQA 4DUXA 1OC1A 2PQQA 1W6QA 3I3BA 1REDA 2HWD3 2LALA 3DV8A 5BNQA 2GC1A 4PT6A 4O9EA 1XNTA 1ZRCA 3TWIA 4W50A 2ZMKA 3N35A 3VGIA 1F2NA 2Z79A 4LLOA 2PLV2 4YM1A 2FDJA 3CJXA 3AZWA 4DY5A 5LY1A 4OHYA 2PLV3 4RS5A 2Z5WA 1NE6A 2J1AA 2PLV1 1W2NA 1W8WA 2EVXA 2YU1A 3QH7A 2EXIA 3D3AA 1KITA 2G19A 4CEYC 4P9LA 5C8WA 4MVTA 5GZGA 2AZ5A 2EIDA 3ZFGA 1LAJA 1NA1C 3WR0A 4JHZA 1ZRRA 2C4XA 4PDWC 5B4XA 4COZA 3O1MA 1NXMA 3N3HA 4IEUA 4CP9A 4MGYE 2GSYA 5JIUA 3FFZA 5JSPA 3BODA 4PIXA 3P1IA 4Z1VA 3F2ZA 3KT1A 1ACCA 4JGYC 4Q4Y1 2EIGA 2E6VA 5CU1A 1OFNA 1DGRN 1W9SA 1X8EA 1Y7BA 1GP5A 3FZ3A 1G9AA 3MZHA 4BH9A 3T2TA 1S0BA 2W47A 3N9PA 3VD3A 4PF1A 1JXNA 5FMDA 4A6OA 1JOPA 4BMBA 2PAMA 5DZEA 2WZPP 3SCGA 1K3IA 1Y9GA 1RTVA 2LW8A 2QFEA 4QPGB 3VHNA 3GJAA 2GAUA 3NNFA 2CV6A 4NVPA 5DUXA 2BBAA 2LS6A 3VBUB 2EXHA 1JZ8A 1PGL2 5EV7A 1H1AA 1D2QA 4LO7A 2UU8A 1B09A 3BU7A 4Y1XA 4NIDA 3DYOA 3R0RA 2VG9A 2QCSB 3AP5A 4CDWA 5AFBA 3JD73 2OUHA 1LGBA 4QX3A 3VDDC 5EHDA 1XU2A 1EPWA 1W2OA 4QX8A 4XFIA 2A3WA 2J22A 5A7WB 3T4HB 5J3UA 1W6OB 2W1QA 1W6NA 2D3RA 2Y8KA 1LTEA 3DUIA 1OLMA 4KBBA 5DABA 1K5MC 4XACA 1S0DA 4B7KA 4YARA 4DMIA 5FMCA 3SH4A 4XJ8A 4JRAA 4YW4A 5GZFA 3C7EA 5CYYA 1GKBA 1OVPA 2N7GA 5FPVA 2YC2A 3HBZA 5FP7A 2Q8EA 3VBSA 4OUMA 4DEQA 1W8UA 4HKLA 4MHUA 1EAH1 3S57A 4CUBA 2I2SA 4EQVA 3WD5A 4F83A 2JDMA 3R6SA 3K75B 2O8OA 5BNPC 4H7LA 4QAWA 3OD4A 2WQ8A 4RHV2 2JDAA 2ET7A 4D7TA 4QX2A 2BGOA 1KFXL 4RHV3 3NAPB 4IEVA 1WMDA 4WM8B 2JJ6A 3GNEA 2A7AA 1REFA 4ZXKA 4COWA 4BPZA 5CFCC 1O3QA 3UL2A 3O0XA 1DIWA 2VZVA 4KI5M 4Q4V1 1OH4A 3AJYA 5FZOB 5GLTA 4ZHNA 2RMU2 4IV1C 1UMZA 2XVKA 3LCPA 4DINB 5F2SA 2RMU3 1QQP1 5C3PA 2RMU1 2OKXA 2CTVA 3T3YA 1TMF2 1QNWA 5F1RA 3TNQA 5K9YA 3OY8B 1TMF3 3OB8A 1TMF1 1T6GC 2A70A 4XMAA 3VZNA 5GZDA 1YI7A 3U07A 2GNDA 4L9BA 4LO4B 5FP3A 4L99A 5A3NA 1IS4A 3DPRC 1CWPA 5F6KA 1S0IA 2ZGOA 4MH0E 1NCQB 1POV3 1GR3A 1POV1 2XKPA 3ACIA 4LNVA 2HKXA 4HXCA 4CP1A 4E8DA 1UY3A 4IESA 4M01A 2J1VA 2V5DA 2XHNA 1PVC1 2WNVA 3E1F1 1BBT3 4CZSA 4BCUA 4CSWA 2WSUA 2K2SA 4RGAA 4UYBA 3P6BA 5A3WA 3WNKA 1QDCA 2ORXA 5T50A 4GAZA 5ACA2 4P9IA 4CCMA 3LIHA 2OIIA 2ET1A 5ACA3 3CU7A 1WUVA 3N9LA 2XPJA 1RYYA 5IVYA 4N43C 3IZOA 3TAYA 5LEKA 3K51A 4XF1A 1JZ6A 2J1EA 3T0DA 1C3HA 3J7NA 4F3JA 2X29A 2ZBJA 3CNAA 4AGGA 2VOTA 3S7IA 2XL7A 3ROUA 3FBYA 3PLQA 3KV9A 1ZZ6A 2DCKA 1OQEA 3L2YA 3MW4A 1RL3A 4QPWA 2WNUC 3QOPA 1LHUA 1PO21 4V2VA 1TME2 4QX5A 3SH3A 3E5UA 1JH5A 1XNKA 3C3VA 1GBGA 2ZX1A 3NV3A 3NV4A 1W99A 2V73A 4QQ2A 5F32A 1TME1 1NCRC 1ULCA 2VNOA 5LA0A 4IEYA 3MGUA 1ZZ9A 3K4AA 5T5PA 1APNA 4AEDA 2C26A 3HR9A 3C7FA 4GMP3 4LE3A 4GMP1 1HRV2 2RM21 1MQTC 3SKVA 4FCAA 4BZ4A 3WEZA 1BVVA 1HRV3 4DXTA 1GP6A 2QQUA 1A34A 3A21A 4OHVA 4BQ2A 3J26N 4IEWA 1W28A 1VR3A 5DPNA 5FREA 5IVFA 3O12A 2YZ4A 5JOZA 3HAGA 4UBHA 1XNAA 3P3NA 3T4VA 3OF1A 1YEWA 1GQGA 4KGQA 1PNFA 1JOJA 5KXDA 3PU3A 1V6OA 3VBUA 1GNZA 1U5XA 3R4UA 4ZZ5A 3LEIA 1HN1A 1HXS1 1N1TA 2PHUA 1OXCA 3OYWB 2XDVA 5FY8A 3WLUA 4LEJA 1X7NA 1DZRA 1GLHA 1VAVA 3GZEA 2AEYA 4EJRA 2IFWA 4N53B 4YGDA 4AEKA 4COUA 5FIXA 1GV9A 2Z42A 1GOHA 4UW5A 2RS32 4Q27A 1PMJX 5FZMA 1HJFA 2Q4SA 2VMFA 5LBFA 3IMMA 3RZJA 2RS33 2FDHA 2BUKA 1CAWB 2RS31 1YI9A 1VBC2 2XL9A 3KV5A 2VCCA 3LE0A 1KDKA 2P37A 2CWMA 5IATA 1W06A 1HKDA 1URXA 1VBC3 2XH6A 4XF9A 3SNMA 1E5IA 3GM8A 1QJEA 1IHMA 3ZXDA 4LO6B 1A8MA 2VTFA 4D3WA 3B02A 3UKTA 4TWTA 4LBOA 4OI2A 2KXLA 4WVMA 3W5NA 4CEWA 4P5HA 3W21A 4KWUA 1RUI1 2D6PA 4FAHA 5BNNA 1G86A 4CTEA 2WA3A 5HXVA 2XHKA 2OT7A 3DGTA 1VRH1 3KV6A 1RINA 4AFAA 5DUUA 5LBBA 4NHLA 1JZ3A 3BIWE 1JODA 4XJWA 3I2GA 1RUD2 3UYJA 1GZWB 1ZX5A 3M3QA 4Y1ZA 4AFDA 4FTEA 2D5FA 1RUD3 4WZFA 2DURA 3PIGA 1SFYA 1RXGA 3POJA 2BYVE 5FJHA 5A1LA 5EJZB 3O1OA 3H7YA 3RMXA 4CPBD 2LROA 2QZ2A 1Y43B 3VB9A 3WG4A 1CAXA 4PQ9A 3J7HA 4LUKA 3D8CA 4Q4X2 3T09A 4Y3OA 5IK5A 1RJ7A 5E16A 2FDIA 4W6XA 2ENRA 4Q4X3 3HNYM 1ULFA 3LA2A 1UYYA 4MXWB 3V0AA 3ZXAC 2A6XA 2GMMA 2VW1A 2X8KA 1V00A 4ISQA 2IXJA 4KWKA 2W52A 2VUCA 5FUIA 5GALA 5FPXA 3O14A 5FRAA 4NN0A 4QD2A 5FQ0A 2XMLA 2Y6LA 1UF2C 5IT6A 2PA7A 4CA9A 5HCHA 3KSCA 1MACA 1OH3A 4BMEA 5FY1A 4CEYB 3ES4A 4HOOA 5J36A 2K46A 1JHJA 1TQ5A 4FOVA 5FPZA 2A6WA 3O1VA 3K3OA 3PVNA 3O1UA 4FBFA 4DO0A 1OMIA 1NA1B 2MEV2 2H6BA 2Y6GA 4DY3A 2BU9A 2RDSA 4PDWB 5T3NA 5CG9A 2DCZA 2MEV3 3FHIB 2J1UA 4LUMA 3E6CC 5F5AA 1UMIA 3ZXGA 5FO9B 5JSOA 5E89A 1RB8G 4GALA 3KV4A 2NPIA 3FHAA 1CIYA 3NNLA 4JGYB 5L9RA 1MZFA 3TEXA 3POGA 4JQTA 5L9BA 3PUIA 4LA3A 1ULGA 4AI3A 1FT9A 4U36A 3LPFA 5KHKA 4Z92B 2VVFA 3T1LA 1JMUB 5FZCA 3IBMA 4WVVA 2ZGSA 2E9QA 3H50A 1BK0A 2BJSA 5C8CC 4ASLA 2HJIA 4AEMA 4N9IA 4KU7A 5BNOC 1NYWA 1N1SA 4MO3M 4F8AA 2BVVA 5FWEA 1UQXA 3QLQA 3MF9A 1IZ3A 1ENSA 1RUJ2 4I01A 1TNFA 5LWBA 4KH9A 2Y38A 1RUJ3 1DDLA 4FTBA 3POSA 3AXEA 5DG2A 1WW4A 4BQ5A 1OOPC 2AYHA 1AR82 5D1IA 1XRUA 3A4UA 5L73A 3MF6A 4XAAA 4QX7A 3GHNA 1XSQA 2WC2A 4K8FA 4CDUC 3NL1A 2O8QA 4LITA 1AR81 4O9GA 3H9AA 5JZGC 1D0HA 2UYBA 4LBLA 1V6MA 4QQOA 1WD3A 4Y5Z0 2PHLA 1LGCA 2IVIB 4P9WA 1BXHA 3VDDB 4UW3A 2ARCA 2J1RA 4YFWA 1NOVA 1KFUL 3DKQA 5FZHA 2D97A 3OEAA 4CXWA 5FZ7A 2W1UA 3I54A 4XTPA 4OYUA 1UNBA 4JX0A 4XXPA 3PUHA 4U2AA 4DPNA 2UWBA 4MGZE 4BYYA 3VBOC 3WCSA 2R1DA 4RD7A 2NYYA 4YZ2A 5JOXA 1W8NA 2ZGRA 4Q0PA 4XFBA 3V65A 3SEPA 5BNPB 2RG4A 4HL0A 3AK0A 3B94A 4QT6A 4S2DA 1CZVA 4TLFA 5F5CA 5J1XA 1Z7S3 5GKAC 5H9SA 3LQCA 3WF2A 5JCTA 2XXZA 3NJVA 3B00A 4LBQA 1IQAA 1AR93 3LDKA 1W2UA 4DUVA 3U0ZA 4OQ8A 1J83A 1IPJA 1UZ0A 2B9UA 2UYAA 3C7HA 3U75A 5CFCB 3NNGA 4IE0A 4OI4A 3EJKA 3Q8FA 1SLAA 4CDXA 3GBWA 1GNYA 1JHNA 1SCRA 4IV1B 2PELA 4UOJA 5CA6A 5CFDC 5HV0A 3EHKA 5FKBA 4CCEA 3OPWA 1X82A 1UIKA 1JN2P 2ZABA 5JSRA 5JXJA 1BEV2 2NN8A 3BPSA 1BEV3 4QDQA 1BCXA 2VZ1A 2C24A 3TBDA 4COVA 4X6RB 3TNPB 5ABJA 3DPRB 5EJ3A 1O4ZA 4RR3C 2QQPA 1QOOA 1ZRDA 1ZBE1 4XBLA 5LW9A 2XJRA 1YIPA 3GXUA 4K21A 3ACHA 3KGLA 3GF6A 4BJ0A 2VBDA 4ZONA 3VDAA 3BKZA 2CWSA 2VZPA 3VKFC 3WP6A 1MS5A 2XJVA 5F3IA 3VKOA 4AAPA 4EWDA 3B9IA 4JKKA 2V72A 3P3PA 3M7AA 4AHYA 4K6BA 1VAKA 2QQJA 3BTAA 5A32A 2XJPA 3CBNA 3WP4A 4LK6A 4A45A 2BZDA 3RNSA 2ZGUA 3VHOA 1CQ9A 4N43B 5JAXA 4D6QA 4HN1A 3ZXFA 1LODA 3VBFA 4UAPA 2GC2A 2WS93 4IE5A 2YFUA 2CSGA 4IV3C 1UOGA 3N7JA 4FPKA 4OI1A 3T0BA 1NUKA 3ACGA 3LF7A 4CE8A 1DQ1A 1UOJA 3KQ4B 1HRI2 2D6NA 1F8VA 2BP6A 2K9ZA 1O6UA 4AQSA 1HRI3 1FV2A 2WNUB 1UU5A 4YVWA 2C0ZA 4MSVA 4TN7A 2JG8A 3MIFA 1YQ2A 4INDA 2R042 4FPJA 1YXWA 1I1EA 5IWFA 2MHFA 1MZEA 3GZUC 1NCRB 4FSJA 2R043 4GH4A 4EWEA 3V0AB 3I3MA 4ES9A 2BOIA 2HYXA 2XLFA 3CQOA 4LORA 4K9SA 1C8NA 4NAMA 1W8TA 2IXKA 1MQTB 2OPKA 4YFZA 2Q1FA 5DUWA 5ERLA 2GMEA 5FBJA 2O0OA 4JKMA 4JGZC 4TLGA 1O5UA 1ZZBA 2ARBA 3JXSA 2TEPA 3IPVA 1CJPA 1Y4WA 5A3TA 1RHI2 1XC6A 1RHI3 5LA1A 1RHI1 5GZCA 1FAYA 4QGLA 1Z78A 4KNCA 2PHRA 4KWLA 1STMA 4P9GA 4QB6A 2C6SA 1HIXA 5FY4A 5ISLA 2VOWA 4HMZA 4AXOA 2HEWF 4EN7B 3E5QA 3MV11 4DXSA 2VMCA 4CP2A 5B4NA 1DHKB 4QX1A 5FO8B 3ZXKA 3RJRA 1QXJA 4RQPC 1DQ5A 1D4M2 2W91A 2YFZA 4QQHA 5D21A 4AOCA 5M0TA 1X33A 1U5YA 4DOUA 1D4M3 2G9FA 3ZLIA 2XJQA 1QJY2 4JTOA 4EZHA 4A7ZA 4PIZA 1QMJA 3NKGA 2FMDA 5HXMA 2WO1A 5K0UB 3WW4A 1QJY1 3LA7A 5JI7A 1HLCA 1BHGA 2BNMA 4RA0A 4CRQA 4H55A 4HANA 4BQWA 1FOD2 2OXBA 1AJKA 1AYN2 3LB9A 2D98A 2JXAA 1LOFA 1FOD1 1B35A 4Y22B 1WA6X 2P5BA 1AYN3 4EYUA 1AYN1 5JMOA 2XR4A 5A3MA 3FLRA 3LEGA 1Q8VA 3J8F2 3KGZA 3H42B 2YROA 2Q30A 4YG0A 1OD3A 3J8F3 5FYIA 1W6MA 5LCWL 1IS3A 3KLSA 1O3TA 1MR5A 5C9AC 5FUNA 1FI2A 4AI9A 3NV1A 1WCSA 2WT2A 4XCBA 4JCKA 5KHGA 1ZNPA 1JBCA 5B2GB 3E97A 1L7LA 1SMVA 2VTXJ 4XABA 1QWRA 1CAUB 3UK9A 5FYUA 4YGEA 5FZDA 5A33A 2DFCA 2JDHA 4SLIA 3WHUA 2B5HA 3S30A 2PTMA 5H9PA 5F3CA 1JZ7A 4G9SB 4MGKE 2VMDA 1KS5A 5BNOA 2E31A 2VCBA 2NM1A 1HQWA 3I3QA 2DVDA 2RE9A 1LCLA 5EQUA 4PF5A 1QH6A 1QOSA 1D7PM 3PUAA 2XVGA 4QGMA 5HV4A 1D4VB 4YVSC 2YPDA 1U5IA 4AI0A 4AE2A 1RUC2 1RVF2 3AFKA 1AL0G 3C7OA 4GQ7A 3FHQA 1RUC3 3OPTA 5A6QA 3ENRA 3D6EA 1RVF3 4LJHA 4UF0B 2VC9A 1ENQA 4Y4YA 4AI8A 4CDQA 1US3A 4Y1UA 1F4AA 1SPPB 2JX9A 2UY8A 3ATGA 1J59A 1TVGA 3ZFFA 1OPOA 3MIDA 2ZEXA 3ZN6A 5IFPA 5LY2A 1O91A 4HVOA 4OZXA 5FCCA 3ST7A 1WA4A 1H2KA 1XQNA 5A80A 3ZYPA 5IVBA 1SEFA 3POFA 5C3OA 4ZY9A 5FZBA 2AENA 2A3YA 4ZKTB 3HT2A 2W1WA 5FFOC 3N36A 2BQPA 2QBXA 2IVJA 3S0MA 3T08A 3NJZA 1HQLA 3QH6A 3INAA 4QU1A 5FJKA 2GP3A 1KGYA 4HETA 2VQ0A 2CAVA 5DDJ1 2RS11 4FO9A 4HFSA 1V6JA 1V6NA 5T5OA 3H8OA 4B7EA 4S2FA 1QHDA 2J1SA 3LDBA 2OZJA 1ND2C 1IG3A 2AC1A 5HCFA 4E8CA 1JZ4A 5T55A 1ZBA1 2JG9A 5IJRA 1YFYA 3AYAA 2A73B 2ZOEB 1AR61 2GU9A 3ZSEA 2BWAA 2VUJA 3SXWA 5FR3A 2W0XA 5I0TA 2GH2A 1FMD1 1OOPB 5C6CA 1LGNA 3AZVA 3USUB 4CDUB 4Q8LA 2PQSA 5JZGB 4WVZA 4CXYA 4NRMA 1UL9A 3WINE 1PGW1 4YM0A 2HWD1 5DQ0A 3T2PA 4FPOB 4LHNA 5CIRA 5L7OC 1LOEA 4QHBA 3TEZA 2QVSB 2ZMNA
chains in the Genus database with same CATH topology
2VGDA 3JU9A 3M3CA 1DU3D 1VJ2A 5LRRA 5DZFA 1VAMA 1YJKA 3AFGA 3IWZA 3AYEA 5KHJA 5CNAA 3CO2A 2C9AA 4YGCA 5E8AA 3VBOB 2EAAA 3MW3A 2D6KA 3ZXEA 4AVAA 3FUQA 2YDEA 1MEC2 4HPKB 1Q3EA 1H1MA 4QPIC 2Q0AA 3A0NA 1MEC3 1W6PA 2VNGA 4Q29A 4XW3A 1AXZA 3SHRA 3VBHA 5EFUA 2PHXA 5SV5A 1RMU2 2NQYA 4B4QA 2IZWA 3PJQA 1CD3G 1RMU3 4P14A 1RMU1 2FHRA 1UCXA 2JECA 1OFSA 4JRLA 4OI0A 1I3HA 2R0FA 5CFDB 2PFWA 1XXNA 3MDPA 1R092 2WZR2 1DGWX 3RS6A 4BQ1A 1CVNA 2C5DA 4KG8A 1PK6A 1R093 2WZR3 1OQ1A 3O0WA 4Y20B 3KMHA 4R8HA 2IXIA 4RR3B 1OKQA 1S0JA 3APBA 1CJDA 1PGL1 3JD72 2GNMA 4L2NA 3KZ4C 5GZEA 4IEQA 3JD71 1UW8A 1O5LA 4GWMA 3DN7A 5K0UC 4XMIA 5F6LB 1V9U2 1IGOA 2GC3A 1V9U3 1AYM2 4LLFA 2QDRA 1IKQA 1AYM3 1AYM1 4AFMA 4EN8B 3RYKA 3UKNA 1GZCA 2R30A 4I3PA 4WM7B 1PGSA 4XIOA 3ZSLA 3CJIA 3WG2A 4XYXA 1C1LA 4YM2A 3WZ1A 4SBVA 1NE4A 5T5LA 1X36A 4IV3B 4P9JA 4DFSA 3AMPA 1SDWA 1WCKA 1LHNA 4JC1A 5H9QA 4RHV1 3UJOA 3IDEA 1IS6A 3NV2A 3ZFEA 1L3JA 1G9CA 4QQLA 1H9PA 4PJYA 5T54A 1Z0HA 2VXRA 1PZ7A 4L11A 3BALA 2VW2A 4ISRA 2YGLA 2ZCWA 3TN92 3AKTA 4JGZB 3AMMA 3WXPA 3TN93 3TN91 4IEOA 5EWSA 2UWCA 3VBRC 3KCYA 1OA4A 1BKZA 1RGSA 3LSEA 2PYTA 5C4WC 1BBT2 1GANA 4R9DA 4QM9A 4LO8A 3S7EA 1WGPA 1COV2 3PNAA 3E6DA 1LHWA 4A7YA 4DZGA 1BBT1 1COV3 1ZA4A 2E7TA 3WV6A 1COV1 4ES8A 3THTA 3TYJA 1MS1A 4YW1A 4RQPB 2YY1A 5D8AB 3FFQA 3AP4A 4JQRA 5J48A 3TRSB 4R9AA 5ACA1 4IXLA 4LA2A 3WUCA 1TE1B 4LT5A 4C1XA 4IEXA 5I91A 1WLTA 2GALA 3HWJA 4XPVA 5GLVA 1VIWB 2IWGB 1QXRA 1CN1A 3CL1A 2ZHKA 1LULA 4JVAA 1LJ7A 1XE8A 3S6PA 3U10A 1EV12 4XFCA 2WJSA 4BWOA 1EV13 4ORFA 3I2DA 3AZXA 2ARXA 1AXKA 2ZPXA 5C9AB 3B5LB 4M3CB 4LULA 4XFAA 1J3RA 3PVEA 3WDXA 4C91A 3ME2A 1HRV1 3SCFA 2DU1A 1KRIA 1JTZX 4FXKB 4QPGA 2BFUS 4OVEA 1N3PA 1ND3C 3MLJA 4M3CE 4BE3A 5IK4A 4H7MA 3ILRA 1KQRA 1DZTA 4GA9A 4YVSB 3ZSJA 2CYFA 3ZX7A 2B8MA 2B7YA 2X5IC 2DYCA 2WLQA 1UPIA 3GZTB 4FOQA 2D6OX 2WL1A 3M2MA 3MI8A 4RGGA 1LB2A 4HSLA 2NLRA 1W6OA 2QKDA 5FMOS 1GQHA 2RJKA 2DV9A 1VBC1 5T52A 2WFF2 4I09A 2ZACA 3CLPA 4RS5C 3WOGA 1F31A 2WFF3 5JMCA 5EYYA 4YLZA 1JUHA 2E63A 2YV8A 3PHMA 1E57A 4GKXA 2G9GA 4JDNA 3ZFGC 1H8TB 4Q26A 3SITA 3HD8B 3MLKA 4FT8A 4QGNA 3TB0A 2ZS6B 4N9HA 3WCRA 2CGPA 1R1A3 3NAPA 4Q0UA 4XF0A 2ZHMA 4WM8A 2ZGTA 1ND2B 1C57A 2BNOA 2VY0A 3M70A 1RUD1 3M1HA 3AX4A 4E27A 4YGBA 1S0FA 2VMGA 2ETEA 4EN9B 5BY5A 1OPMA 3HT1A 1D2SA 5E88A 1H4HA 1PHMA 3LKJA 1XYOA 3OY8A 4Q4X1 1PO12 4PIYA 2DUOA 3M3IA 3LOBA 4WZCA 2OVUA 1PO13 5I8SA 2AH2A 1NCQA 1PO11 3MW2A 2YUEA 5L7OB 3DL3A 5CVRA 4TSVA 5JIAA 2A3XA 3ILNA 1Q8PA 1WLCA 2HEVF 2WQ4A 1LU1A 3AZYA 4CDWC 2JDZA 3RZZA 4KWJA 4FPCA 2VH9A 4XE9A 5D8AA 2XWBB 1ULDA 4GKYA 2MEV1 4MYEA 2ZAAA 1LOBA 2HEYF 1MS4A 2GN3A 4QPIB 5L19A 1DQ2A 1DLLA 4AWDA 3MIEA 3WDUA 4LBNA 3VHPA 4E2QA 2P3IA 2GDFA 3V64A 2RJLA 1AUYA 1QJX2 3VBSC 1I5ZA 1UX6A 2ZGQA 4X8NA 4D94A 1QJX3 3JCIA 1QJX1 2VW0A 2WSVA 1SBFA 4WBBA 1H8VA 3EQEA 4HK8A 1MVEA 3RMYA 1GFF2 4ITCA 1PZ8A 3ZXLA 4FOYA 1QGLA 3NO8A 1LESA 2D6MA 2XBO2 3R4DB 1G9BA 2Z69A 2R1BA 3GYDA 1H0BA 3RPQA 1F5FA 2XBO3 1Y9QA 4QMAA 2XBO1 2Z2SB 1RUJ1 2R6QA 2QNKA 3EBRA 3IDCB 2ZX0A 1TEIA 4F7ZA 2BW8A 3ELNA 5FDBA 2X53S 3ACLA 1C5IA 2VECA 2DCTA 1QJZA 1QKQA 5DXDA 4XIKA 2IFRA 2ZGNA 4I0BA 5K0UB 3NKTA 1BQPA 3ZN5A 2PHFA 3IIAA 5IK7A 1YYNA 4YZ5A 2R062 1NG0A 3OYWA 1K5MB 3WT3A 3ZPYA 2R063 2R061 4LBKA 3RRDA 3AP6A 3M3EA 5CAZA 2WNVC 4N53A 1QDOA 1YHFA 2DTWA 3VZLA 2ZTNA 4FQZA 3I59B 5C33A 3ZIWA 2LUWA 3QCWA 1CAWA 1Z7S2 2BEOA 5KWRA 3PVOA 1NXD1 1AR92 1Z7S1 2ZX2A 1ZZCA 3MFCA 3H1WA 1WLWA 1AR91 2XLGA 4XTMA 5L36A 2DVAA 4YZ4A 3VKNA 1H1IA 1LENA 3A0KA 1G9FA 2PAKA 3KS7A 4L8QA 1H8TA 2WNEA 2ZGKA 1R082 4GXLA 1R083 1DQ0A 1MZ6A 3KT4A 1EY2A 1D0GA 2IXLA 4KU8A 2XJSA 3FJSA 1HX6A 1GZWA 1VBD2 3EXUA 1BEV1 4I3GA 4XF3A 4I02A 3VZJA 2GNBA 1O4TA 4NHKA 4ZU7A 1AL22 1VBD3 2YMZA 4LE4A 4Z07A 1Q8QA 1AL23 3VBRB 1PM7A 1IKPA 1AL21 2P17A 1ZRFA 1U12A 1LHOA 1XYPA 4I30A 4AEDC 5C4WB 5FLIA 1LRHA 1J3QA 3DKWA 3H7JA 3FMGA 3AYDA 1FXZA 3O5SA 5BPXA 4MXWA 2FMYA 4K7JA 1LKNA 1NQJA 4YNIA 1H2MA 1Q43A 3O7OA 3VLBB 1HV1A 4LTAA 4IL7A 1BMV2 1LEDA 2NMOA 2VPVA 2FZ2A 3VBUC 4Q4W2 1WMFA 3WDVA 1CAVB 4Q4W3 4Q4W1 2WA4A 4META 4Y1YA 4CEYA 5I0RA 3BOWA 2B46X 4I0AA 2WS92 1LEMA 1OSGA 3W9AA 1NA1A 2WS91 3BCWA 5I93A 4GIQA 1KJRA 4PDWA 2QJVA 5AVPA 2NZ9A 2YHJA 5FLHA 3ZMNA 1MS8A 4KQ7A 2VMIA 1HRI1 5DUVA 3HMYA 4JGYA 4P9XA 3AKPA 1NLSA 1MZ5A 2R041 4Q8KA 4HSJA 5J09A 2XUMA 1DGWA 1UU6A 4CEWC 3MPPG 2V5YA 3JQXA 4MXVA 1DYPA 3WW2A 5BNNC 4R9BA 3USSA 2R32A 4Q0QA 2E51A 1OI6A 1U0AA 3IN9A 1AR72 3E5XA 4I0WB 1J1TA 1AR73 1ND3B 3VKMA 4XEZA 3RDIA 3LWCA 3E6BA 1VBB2 1MVQA 2HWC2 2OW4A 2OZ6A 1VBB3 2JE9A 2HWC3 2X5IB 5I0SA 4ZU4A 1LU2A 2DF7A 3VDDA 2CGOA 1IS5A 4J1XA 1Y3TA 2JICA 4OULA 4ASMB 4J6GA 2A71A 1D4M1 1W6QB 4AYUA 2D43A 1K5MA 1V70A 1I9RA 3PMEA 5BYNA 4C1WA 1S2BA 4JTNA 4RS5B 4LBQD 4E9KA 1OLQA 1O7FA 2ES3A 4LR4A 3ZYGA 3I59A 4S2GA 2DCYA 4NHMA 5BNPA 5GJ6A 5KXEA 3ZFGB 4C90A 1JYCA 5LEJA 4MV2A 4EROA 2ZGLA 2LTNA 3J8F1 3ES1A 4P9YA 5CFCA 5KHIA 2GMPA 3WY6A 1AX2A 3RYRA 5FBZA 4IV1A 3VZMA 5HCAA 1N1YA 2H0VA 4JDOA 4D7YA 4AGRA 5K8SA 5LK7B 4N90A 5TSWA 3IMNA 3ZXJA 2GNTA 3U4XA 2H6CA 1QU0A 1YFXA 4Z82A 5JOYA 1FV3A 1DGLA 3DPRA 4BOWA 4OHWA 1LOCA 3MEPA 1YIFA 3NVCA 3WVJA 5J7MA 2DFBA 1VBE3 4AF9A 4X8PA 1OA3A 3SMHA 1J1LA 1RUC1 1RVF1 4AHXA 4CYDA 4E4ZA 4N7IA 4QPYA 2Y26A 5A3LA 5EZWA 2XJTA 4CDWB 2R49A 1R1ZA 4HLTA 1BJQA 1ENRA 2ILMA 3SISA 1H2NA 3ZN4A 4AFBA 1J58A 1ZZ8A 5H9RA 2NP0A 1F9KA 3VV1A 2MPFA 1W6NB 1O3SA 2KA3A 4N43A 2HWE2 2WLPA 4J1WA 3UJQA 2XLAA 1SLBA 2HWE3 4AVSA 2HWE1 4LBMA 3VBSB 1U5ZA 5GLWA 1O3RA 3WW3A 1KD7A 5HCBA 4QQPA 4FXGB 2WIIB 2ZGMA 4XQWA 2QDNA 3VUOA 5C8CB 3CF6E 1VLNA 2WNUA 2B39A 3RQ0A 2W08A 4GB32 3V0BB 1ASJ2 5F9TA 3OGGA 1QNYA 1NCRA 4GB33 4PCRA 1ASJ3 1GNHA 2ZZJA 4IEPA 4OHZA 3SH5A 3V0AA 3KCXA 1DBNA 5K7PA 3NWKA 4LO5B 1QOTA 4AI1A 1MQTA 4CDXC 3ZYIB 1OLRA 2BVBA 4I2OA 2MNGA 2D3SA 3GBFA 4YZ3A 2QE3A 2E7QA 1LOGA 1KDMA 2BTVC 1WMEA 2P34A 2P2KA 3IKWA 2ZJCA 4MX3A 3RJ2X 5ABJC 4PLOA 4X6QB 3RI9A 4YW3A 1RUNA 3BB6A 1GZ9A 2WNVB 1S0GA 3KM5A 3ZMOA 1NQDA 4NOTA 4AVBA 5JLVA 4B4PA 1WLDA 3VHRA 2YXSA 3B3QE 2D40A 3PMSA 1PVXA 5FMOL 1MEC1 4M3CF 4XBQA 3FBMA 4A3XA 1C4RA 3R05A 2VQAA 4XXAA 4Q0SA 2ZA9A 1TNRA 3PVBB 4MZUA 4UW6A 4YW2A 1YCIA 3KD4A 3WUDA 1WD4A 4Y22A 5KHHA 3VBFC 2YPJA 2HWB2 3VZKA 2HWB3 2OA2A 2HWB1 1EYBA 1MS9A 1C8M2 1R091 2WZR1 3FX3A 1FX5A 3M4FA 3RI8A 4BA6A 2W39A 1C8M3 1C8M1 1UZZA 4Q4Y2 4YVWC 1YUDA 1SQ4A 3OCPA 2JG8C 4R4ZA 2ZX4A 5AVAA 4Q4Y3 4L92A 3VN4A 1CAUA 1XU1A 2XGXA 4GH4C 1BZWA 3WHTA 1GSLA 4AEDB 4FPLA 2E7AA 4AEJA 4XFGA 4PLNA 1IPKA 3I7DA 3WNXA 2VOVA 2Y0IA 2PAEA 3IDBB 2ZKNA 1V9U1 4IETA 2BPA2 2Q1MA 1KXGA 2WKKA 5LRSA 2AREA 3AYCA 3B7MA 2A75A 4E4DX 4HKWA 2SLIA 3JBG2 2ZMLA 3JBG3 4DQAA 2BWCA 5AC92 3JBG1 1LOAA 4Z8BA 1XYNA 5AC93 2B42B 5AC91 4G3YC 2DTYA 1DZQA 1GICA 1YJLA 3OJBA 1C28A 4AG4A 1V6LA 1G8WA 4Y24A 3ETQA 2P3KA 3C2UA 4JAAA 4OHXA 1EAH2 2DUQA 1YO8A 4EN6B 2R072 3RG0A 1BYHA 1EAH3 5KC6A 1A3KA 5I0UA 2R073 3POYA 2R071 4WVMB 4CEWB 4AVTA 4EN0A 1LOFC 3LAGA 1B35C 4Z2WA 5C8CA 3OTFA 4ONUA 4TZDA 4E2GA 2TBVA 4W65A 1Q8SA 3ZYRA 5BNNB 3JB8A 3V0BA 4AK3A 3MYXA 4Q1RA 1AJOA 4Q4V2 3RYPA 1AX0A 4Q4V3 2OYZA 1OOPA 1QQP2 4V1PA 1X8MA 2D7FA 2EXJA 2ZX3A 4KGGA 1A78A 4Q2FA 3USUA 1OHFA 1QQP3 4PLMA 4CDUA 2CNAA 5JZGA 3K48A 1CAXB 3H1YA 1QXPA 4JV4A 1DG6A 2BGCA 4YG6A 1RJ8A 5FREA 1RIRA 5BNOC 4FTSA 1GYKA 3AMNA 1M4WA 2D5HA 4UW4A 4TYSA 1W39A 3M8LA 4FQ4A 4UBGA 3LSDA 1M06G 1RUOA 2YGMA 1LR5A 1V6KA 1OD5A 5FO7B 1N1VA 4FPYA 4DS0A 2EXKA 5CG8A 1PVC2 3WP5A 5FQ0B 4AQ6A 1EP0A 1PVC3 3FWEA 2JD4A 1HDKA 5GM0A 3VBOA 4XETA 1SLTA 4CDQC 5I8TA 1JUIA 2UURA 2ZHNA 4GULA 4HPKA 5FAXA 3M3OA 4R9CA 3ZFFC 3KT7A 3KCCA 1PZ9A 4XJZA 1EV11 3J9SA 2VOKA 4XQ4A 3URFA 3MFAA 4MLOA 1JW6A 4XOGA 1SCSA 3PTYA 4PBPA 5SV8A 1H30A 2RR12 1VP6A 4N7UA 3AB0A 3H3ZA 3ZVXA 3ZSKA 3ZDSA 2RR13 3T1MA 1O4YA 2RR11 2I45A 5CFDA 3IT8A 1XNCA 2Q8OA 3I4IA 2ZHLA 1PO22 2D93A 3G6JB 4GWNA 4YW5A 4JDMA 4K20A 3WQ0A 1PO23 5IK8A 4Y20A 4RSUA 1ENXA 2VULA 1BVP1 1UKRA 2JG9C 1TME3 2XVLA 4RR3A 3I8TA 2C1FA 1MS3A 2PHDA 3NW4A 2BBVA 1POV0 4AGVA 2RM22 5F5QA 3W58A 2DUPA 2RM23 4K1ZA 1RUG2 1ZYBA 3V56A 1RUG3 1RUG1 1I6XA 1FPN2 1CGPA 3LOIA 1LECA 1FPN3 2XJUA 1FPN1 1UN1A 1SBEA 3D0SA 2WINB 3WW1A 1YFUA 2GH8A 1HXS2 5DZGA 2F6BA 3NSTA 2JEMA 1HXS3 4HK9A 4YG3A 3RWNA 5GLUA 3N7KA 4WM7A 2WFF1 5JVVA 2BNNA 4E2SA 3JUUA 2JENA 4K40A 2CAUA 4E4SA 2R0HA 5JPNB 4IV3A 4LHLA 4COYA 3O0VA 1CX4A 1R1A2 1ULEA 4HVQA 2HYKA 4RFT0 5J37A 1R1A1 3VBHC 2YC0A 2H0BA 2B45X 4LBQB 4M00A 3SCHA 4NWVA 1JYIA 1RUI2 4DNYA 3B9CA 1VB4A 4GMP0 1RUI3 4CDXB 3IM0A 1VRH2 3Q9OA 2DVGA 4DRVA 4JGZA 1YFWA 1VRH3 1PK6C 4BHPA 4KG0A 1UPSA 4HT1T 3KQRA 2XKOA 2EF6A 1XE7A 5ABJB 4HN0A 4ATEA 5FLJA 4S2HA 2ZZQA 1SBDA 3AP9A 3GZAA 2EA7A 1QY4A 4OFGA 1HW5A 3GHMA 1YLLA 4RQPA 1J3PA 4DXZA 1KS4A 3H8UA 2A6ZA 1ONAA 2AUYA 4D7SA 1G7YA 1CONA 1DFQA 5A32B 1ZZ7A 3B69A 3WX5A 1YRZA 1AX1A 3AMHA 2IXHA 4WVWA 3R4SA 3GALA 3CJIC 3PJYA 5KC5A 3VBFB 4B3NA 5FOJB 3MPBA 1REEA 5JI9A 5CB7A 1VB2A 2QZ3A 5HBAA 1Q8OA 3U11A 5C9AA 1FNZA 4NO4A 2UWAA 3ZFEC 4C0BA 2I07B 4M3CA 4YVWB 2JG8B 2DVFA 3B01A 4NPRA 3ALQA 3N4MA 4GH4B 1CIWA 3W59A 1H4GA 3D5OA 3L2HA 2JKBA 1PMIA 3OBRA 3UKVA 4AVVA 3WDYA 1ZREA 3ILFA 4QU2A 4R52A 4URTA 3BPZA 2A6YA 2WFPA 3IPVB 3AP7A 3BOPA 1FATA 4YVSA 3HN1A 3WG3A 4H14A 3D0JA 3MIBA 2R16A 5BUVA 2JE7A 4YZ1A 1S55A 4RL7A 3L9JT 2YYOA 2IC1A 1CPNA 5FOBB 4MGIE 3RSJA 3GBGA 5IUQA 4KL1A 1AXYA 1AR83 4OLLA 4A2UA 3VL9A 1UD1A 2VVEA 4FPEA 4EV0A 2VNRA 1SFNA 1UZYA 4YSFA 1N3QA 2XB6C 5JPMB 2Q5TA 2A5ZA 4IQPA 1DF0A 2FBEA 2O1QA 4ZU5A 4BIOA 1AHSA 1WBLA 1PIV2 1XNDA 1H9WA 1PIV3 1PIV1 4XJAA 5AFEA 3LZZA 2PHTA 1CPMA 1QJU2 2DU0A 4XF4A 1B35B 1R081 3AKSA 4B4RA 1QJU3 1QJU1 1ND2A 4BLIA 3N7MA 4IEZA 4PBOA 2DVBA 4W6YA 1UU4A 1VBD1 1W6MB 1NLRA 5I8YA 4WV8A 1OQDA 3CEWA 5BV6A 1QF3A 5A33B 1Q5OA 3AZZA 3JZVA 4FPFA 3AM2A 1OA2A 5BNOB 2GC0A 4L97A 4HVRA 1S0EA 4QPGC 1X50A 5L7OA 2LM3A 2SBAA 3OGJA 4Q1PA 1ZBE2 4XZPA 1WW6A 1BMV1 1ZBE3 3ASIA 5T5JA 2CGNA 2V09A 3MIHA 4HBNA 3SLIA 4XDQA 4XILA 1S2KA 1F5JA 3QD6A 1ZM1A 2D6LX 1DGRA 4FOWA 3WQ1A 1PNGA 3FE5A 4AI2A 4ATFA 1RITA 4CDQB 3FLTA 1YWKA 3FC0A 3ZIXA 3QACA 4BLJA 3WQ7A 1A6CA 3ZFFB 3EO6A 4B8EA 3ZN6B 4EWAA 4QPIA 4YYOA 3WG1A 2HWF2 3QBQA 5BXXA 2AGSA 2HWF3 5KXCA