3NL1A

Crystal structure of salicylate 1,2-dioxygenase from pseudoaminobacter salicylatoxidans adducts with gentisate
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
366
structure length
366
Chain Sequence
QNEKLDHESVTQAMQPKDTPELRALYKSFEEESIIPLWTQLGDLMPIHPKSKAVPHVWKWSTLLRLARKSGELVPVGRGGERRALGLANPGLGGNAYISPTMWAGIQYLGPRETAPEHRHSQNAFRFVVEGEGVWTVVNGDPVRMSRGDLLLTPGWCFHGHMNDTDQPMAWIDGLDIPFSQQMDVGFFEFGSDRVTDYATPNFSRGERLWCHPGLRPLSGLQNTVASPIGAYRWEFTDRALTEQLLLEDEGQPATVAPGHAAIRYVNPTTGGDVMPTLRCEFHRLRAGTETATRNEVGSTVFQVFEGAGAVVMNGETTKLEKGDMFVVPSWVPWSLQAETQFDLFRFSDAPIMEALSFMRTKIEGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gentisate 1,2-Dioxygenase
publication title Crystal structures of salicylate 1,2-dioxygenase-substrates adducts: A step towards the comprehension of the structural basis for substrate selection in class III ring cleaving dioxygenases.
pubmed doi rcsb
source organism Pseudaminobacter salicylatoxidans
molecule tags Oxidoreductase
total genus 103
structure length 366
sequence length 366
ec nomenclature ec 1.13.11.4: Gentisate 1,2-dioxygenase.
pdb deposition date 2010-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3nl1A01
3HT2A 3E5QA 4QM9A 1OFNA 3CJXA 1CAWA 2O8QA 3SMHA 2OA2A 1O3QA 3KCCA 4D7SA 1EP0A 3BB6A 4P9GA 1EPZA 3E6BA 4WZCA 4UBGA 3ETQA 3QOPA 5CADA 5BPXA 1YLLA 4QX5A 3H1WA 5LEJA 1HW5A 3CL1A 4KU8A 1NXMA 2P17A 4HLTA 1OMIA 2QVSB 4CYDA 4OLLA 3UKNA 4EWEA 4Q0SA 2IXHA 4O9GA 2PAMA 3PLQA 4LULA 5JR7B 4EWAA 3FZ3A 3EJKA 1ZX5A 4E2GA 1U12A 1OD5A 1UD1A 1DGRA 4E2SA 1YHFA 3HIFA 4B29A 3NVCA 4XF3A 2XHKA 1ZRRA 2GAUA 2K0GA 4HN1A 3FJSA 3G7DA 4QGLA 5I0SA 2QNKA 2CAUA 4ZU5A 2VPVA 4HN0A 3LA3A 3IIAA 2ET1A 4WVZA 2CAVA 1QXRA 3N4MA 2HJIA 3H3UA 3JZVA 2XLFA 2OYZA 1CAWB 1J59A 2UY9A 1SQ4A 1X8EA 4IEVA 5FDBA 3FE5A 1SEFA 1DZTA 2OPKA 3CO2A 1UIKA 4A2UA 1G6NA 2CV6A 5LRSA 4KWJA 5LRRA 4I01A 2IXLA 2D40A 4AVCA 2GH2A 1J1LA 1H1IA 3D0SA 2GC1A 2D5FA 4WBBA 1UIJA 2PQQA 1CAUA 1ZZCA 1GQHA 3U0ZA 2WFPA 4HSLA 3S0MA 3H3ZA 2GZWA 2V09A 1J3QA 2GU9A 2PAEA 5I91A 3B02A 3EO6A 3RYKA 4IEPA 1PM7A 4YNIA 2BNOA 2EVXA 3RDIA 1NE4A 3ST7A 1YUDA 4YYOA 2ATFA 2XLGA 2EAAA 3BU7A 2XL9A 3ES1A 1SFNA 1J3PA 4KL1A 4Z07A 2BYVE 5J48A 5LEKA 4AQ2A 2UY8A 1WLTA 2HKXA 2PYTA 4Q0QA 5BXXA 5I8YA 3WW2A 3M3IA 3RYPA 3SCGA 4ORFA 2H0VA 2IXJA 4H7LA 4MH0E 1UW8A 4FT8A 1ZREA 5FQ0A 2PA7A 2H6BA 5K8SA 3PNAA 5I0RA 2OZ6A 3U10A 5I8SA 1DZRA 5I8TA 1WGPA 2ETEA 3MZHA 5BY5A 4IETA 5EFUA 1NZCA 4ONUA 4BH9A 3H1YA 2XL7A 2VECA 1JUHA 2KXLA 2Q1ZB 3FX3A 4QXKA 4EWDA 3SHRA 1RC6A 1Y9QA 3FHIB 3D82A 4XFAA 3LWCA 1I6XA 2BNMA 5C8WA 4KWLA 3OCPA 3H7JA 4HZFA 2Q0AA 4Z82A 1YWKA 2IXKA 3ELNA 1RUOA 1CAUB 4IEYA 5FCCA 4XFGA 3E5UA 3BALA 4FAHA 4EROA 4F8AA 2EA7A 3NJZA 4XFIA 3MDPA 3SXWA 3I7DA 3IDCB 4LLOA 5KHKA 4IERA 5J3UA 4Q0VA 1PMIA 1O5UA 1O3TA 3O14A 4YARA 4I0AA 3LOIA 2E9QA 1LB2A 3IWZA 1J58A 5FLJA 4XFHA 3H9AA 4IESA 5FQ0B 5HI0A 3FWEA 4XFCA 4QM8A 3S7EA 2PFWA 3H7YA 4HMZA 3VHRA 2MHFA 5BUVA 4J1WA 5JAXA 5JSOA 4UBHA 3I59A 3TNQA 1Q43A 5FLIA 1V70A 1IPJA 4MUVA 2DCTA 4L2NA 3EHKA 4HVRA 3WW3A 4I3PA 3HQXA 3GBFA 4IEUA 4PIZA 3LAGA 2B9UA 1RTVA 4XFFA 3ACLA 2FQPA 4FAGA 5JCTA 2IC1A 3NW4A 2GC2A 4MZUA 4XF0A 4PJYA 4IEZA 3FFQA 2XKPA 3KMHA 3OTFA 4XF9A 1LR5A 3DV8A 1O4TA 5KHIA 3LA2A 4I09A 3EQEA 1X8MA 1Y3TA 4IEOA 1X82A 1TQ5A 3C3VA 4ZU4A 5J7MA 4Q0UA 2Q4SA 4AQ6A 4DINB 4Q0PA 2IXIA 3NKTA 4EV0A 4AXOA 5FLHA 3UKVA 3RZZA 5D1IA 1Q5OA 3PVBB 2XGXA 3OF1A 4FBFA 1CAXA 5CU1A 1UPIA 5CVRA 1RUNA 5KHHA 1ZZ9A 2FMYA 3E5XA 2QDRA 4AVAA 3I59B 4J1XA 1O3SA 5KHGA 1ZRFA 4IEQA 3I54A 5I0TA 2H6CA 2I45A 1CX4A 3RNSA 3SCHA 4YSFA 3SCFA 3ES4A 4MGYE 4OFGA 3OGJA 1XRUA 2PHLA 1RL3A 2B8MA 1EYBA 4XEZA 3ZDSA 4ZU7A 4BYYA 1J3RA 1O3RA 2IXCA 5KBFA 1FI2A 3H8UA 3LZZA 4PIYA 4AVBA 1DGWA 2K9ZA 4UXAA 2O1QA 3MYXA 4BIFA 4XF4A 2OZJA 3E97A 2Z2SB 5AVPA 1VP6A 1CAXB 3L2HA 2XLAA 3LA7A 3NL1A 4NVPA 5F1RA 2WC2A 3DKWA 4N9HA 1ZRCA 1CAVA 1Q3EA 3DN7A 2MPFA 2QJVA 1GQGA 4X6QB 1X7NA 3E6DA 5JSRA 2D93A 4QGNA 1YFYA 5I0UA 4LUMA 3GYDA 1RGSA 4JVAA 1YFWA 2BGCA 4HVOA 5T3NA 4K8FA 3CF6E 2BEOA 4JTNA 3EBRA 4Q29A 3H50A 3U11A 2VQAA 4KU7A 3BCWA 1IPKA 3IBMA 4IEXA 4LA2A 5I93A 2PAKA 4MX3A 1ZNPA 3QACA 1O7FA 4L11A 2GC0A 4HVQA 3RPQA 2ET7A 1H1MA 4GULA 4LUKA 4O9EA 3H1MA 1LRHA 4F7ZA 2MNGA 3USSA 3E6CC 4MGZE 3CLPA 1YFUA 3WW1A 2PHDA 2Q30A 1FT9A 4LTAA 2B5HA 2BNNA 4JV4A 4QGMA 3S7IA 4JTOA 4XETA 1O5LA 4R8HA 5E16A 1L3JA 2Z69A 4I2OA 1VR3A 4TLFA 4E2QA 4LEJA 1ZZBA 3OD0A 4BHPA 1CGPA 1ZZ7A 5JSPA 3HT1A 5FPXA 1XE7A 2Y0OA 3ROUA 4D7TA 4I02A 4N9IA 4LA3A 3UKTA 5KHJA 4KWKA 1I5ZA 4MGIE 2ZKLA 1UCXA 1CAVB 3KSCA 1OI6A 2PTMA 4HSJA 3KGZA 1QY4A 2N7GA 5E1RA 4IEWA 4PIXA 1VJ2A 4QMAA 3CEWA 3IDBB 1WA4A 2F4PA 1ZRDA 3WW4A 2C0ZA 3D0JA 1ZZ6A 4XFBA 3TNPB 2CGPA 2ZCWA 1ZVFA 4X6RB 3BPZA 4MGKE 1EY2A 2UYAA 2XKOA 5BV6A 4MV2A 1ZZ8A 4YRDA 1NYWA 3M70A 4XF1A 5C6CA 3KGLA 3NSTA 2GC3A 3RYRA 1QXJA 1NE6A 3DL3A 5EZWA 4RD7A 1QWRA 2D5HA 3MPBA 4I0BA 1LKNA 5FPZA 2UYBA 4R52A 2QCSB 4HBNA 3R6SA 4META 1FXZA 1XE8A 1YFXA
chains in the Genus database with same CATH superfamily
4FOVA 2VTFA 5DUWA 2QQLA 4P5HA 5J37A 2Y6GA 2YFZA 2AC1A 5F39A 1OFNA 4K40A 1S0EA 5JZGC 1CAWA 1NX9A 3HBKA 5FAXA 2O8QA 5FY0A 1VBD3 1UOBA 1UY3A 2YYOA 1GWKA 2O0OA 4D7SA 4OI4A 1VBE3 2X5IA 4E27A 3K75B 3BB6A 3OEBA 4BLIA 2ZMLA 3CZUA 3BTZA 3E6BA 4UBGA 1ZYBA 1AR72 3WV6A 5ABJA 4KI5M 5F2WA 3FHQA 5F3EA 3V65A 5T55A 3WP3A 4FPFA 3WNOA 4HPKA 3I2HA 2VMHA 3CBNA 1NKGA 4HL0A 2VU9A 2AENA 4QD2A 4YW4A 2QVSB 4AI0A 2WAAA 4OLLA 5FOBB 4A42A 1WKYA 3I49A 2DVBA 4LQRA 5H9RA 4NIGA 1Q8SA 5C8CB 1LHUA 1HN1A 4LULA 3RSJA 4RFRB 1BQPA 3PIGA 2ZHMA 4N90A 2Q8EA 4M01A 2RR12 3Q8BA 4GB33 1SG3A 4XDOA 1UYZA 4XJZA 3EJKA 1N1VA 4CXYA 4LKDA 2A3YA 2R1BA 2WNVA 4PT6A 5JWPA 5FZ4A 4AEDA 2D6PA 4HT1T 2P37A 1FMD1 1Z7S3 4UW6A 2WFF2 3VBOC 4Z2AA 5D8AA 3HIFA 5JUVA 2Q5TA 2B45X 2WQ4A 5EXOA 3UL2A 3VBRC 2ZGNA 5L9BA 4Y26A 3ZYRA 2K0GA 3RRDA 1TEIA 3LEKA 1FV3A 3N9OA 4HN1A 4Q5OA 4QGLA 4XC9A 4AFMA 2QNKA 5A3LA 5I0SA 3GZUC 5GM0A 2WRAA 3H3LA 5BNPA 1NCQC 3NAPC 1YQCA 5L9VA 1WCDJ 4XAAA 5CG8A 1RB8G 4AHXA 2CAVA 3N4MA 1CPNA 1W6QB 2BWAA 1RUJ2 2HJIA 3H3UA 2P5BA 4Q2FA 3ZYHA 1S4CA 5F5AA 4N43C 4DO0A 5TSWA 1HRI2 3GBWA 3J9SA 1OKQA 2Z42A 4COUA 5BNOC 3CJIB 3UT0A 3T08A 1YI9A 1XB9A 5FPAA 3RQ0A 2CV6A 1ZBE1 1W8ZA 2JG9A 2XBO2 2WT0A 2UURA 3SEEA 1AR91 4I01A 1CIWA 2ZGRA 4Q4W2 4PQQA 3ECQA 1LHNA 4OCTA 4RS5C 4EZ4A 4OI0A 4M3CB 2GC1A 1IQDC 4K3UA 2JKBA 4YZ4A 4CEYB 5JPMB 1UKRA 2CTVA 4FPYA 4CPBD 1WBLA 1NCRC 3A23A 1H8TA 3LGRA 1ZM1A 4QPIC 1GQHA 1OUXA 2VZOA 5FTTC 3U0ZA 4D0QA 4HSLA 3S0MA 4V2VA 4ZPIA 3IN9A 1AX1A 2V09A 2V5YA 2FMDA 2PAEA 2FZ1A 2AUYA 1OC1A 5HCBA 4YM1A 1PM7A 1UZZA 1XQNA 3ST7A 4CP0A 5D21A 3VBHA 1HRV3 2W1UA 3QH7A 5DAQA 4NRPA 4QPGC 1UZYA 4QDQA 5A1AA 5E89A 4NUBA 1PGL1 1QQP2 5C4WC 2E31A 3ZVXA 4AQ2A 4LK7A 4G9SB 1WLTA 2P1BA 2P3YA 4OZXA 4Q0QA 4YW5A 1SFPA 3ZSMA 5I8YA 4IGOA 3RYPA 3UGHA 4ORFA 1JZ7A 4GIQA 1DQ1A 3WXPA 4JGYC 4N7UA 5L9RA 2XJVA 3ZYGA 4A6OA 3Q8AA 5C3QA 3MFCA 3PURA 3AC0A 5EPAA 4CCOA 2H6BA 3WDXA 5C9AB 3EMRA 5LA1A 5JOWA 5I8TA 1WGPA 3OOXA 2QE3A 1C8M1 4FPOB 5FYCA 2QBXA 4TLGA 4BH9A 4IUGA 5G05L 1R1A3 1NA1A 2VECA 2ZGTA 1JUHA 2W1WA 2W3JA 4NROA 3N3HA 4YM3A 5A80A 3ZSKA 1QNWA 5CG9A 3K2OA 3RWNA 4XUQA 3SC7X 3I3BA 4MGSA 5EIYB 4YWAA 1ASJ2 1Y9QA 2DUOA 2JXAA 3PUHA 1MZ6A 3PJQA 3AB0A 5GLZA 1I6XA 2BNMA 5FXZA 3T1MA 4ZZ8A 4K9SA 3AJYA 2X29A 3WUCA 2EIDA 3T4HB 5C5UA 2VMIA 3PDQA 4HZFA 5FZOA 1SLAA 3MIDA 4WVMB 3GZEA 4LHSA 4XYXA 4GKYA 4AQSA 1RUOA 1UX6A 2WT1A 1BMV2 1R092 3ZFGC 4TXWA 5CKNA 4UF0B 3K4DA 1V6JA 1D2SA 3AP7A 3BALA 3UK9A 4FAHA 3O5SA 2PHTA 5A6XA 4NR1A 4EROA 3ZN5A 4F8AA 2HYXA 1AR63 1MEC2 2W1SA 4W6XA 3WP5A 3SXWA 3LF7A 3FUQA 3MDPA 5FR3A 1UO9A 1RUE2 4LLOA 5KHKA 2MEV1 2J1UA 3AXDA 1BEV2 3JBG3 5E8AA 5A7WB 1CZTA 1W8TA 5J3UA 2ZX1A 4B8EA 4AEKA 5HCHA 4HANA 2CY6A 1FPN2 3WF2A 1POV3 1WW6A 2G19A 1JZ2A 2RG4A 1TVGA 4P5YA 5IVYA 4YZ3A 4E4HA 1LB2A 2W46A 3M8LA 4P9YA 5J1XA 2AGSA 2AR6A 2ILMA 3LCPA 1AR81 4CDQC 1K5MA 2YGLA 2X5IC 2Y38A 4QM8A 3ZXFA 2D7FA 3J8F3 3WOGA 5JZGB 5ABJC 3KT1A 3VBUA 3MPPG 2E7AA 3LDRA 4KWUA 4WM8C 1AL21 4IE4A 4DS0A 5T52A 3WUDA 2DCZA 1ULPA 2SBAA 4OQ8A 1LOFA 5A6QA 3DF0A 4FCAA 1JHNA 3B01A 4XBLA 5CZKA 4MUVA 3I3DA 2DVDA 1LOGA 2LTNA 3I3EA 3WQ0A 2R072 3WW3A 5IVBA 4I3PA 3HQXA 2WDBA 3AZZA 4RHV2 4W8JA 1LAJA 3LOBA 2V72A 3VBSA 3DXTA 4IQPA 1XPWA 5IK8A 4AR2A 1PMHX 1JYVA 3BN6A 4XFFA 1VBA1 2VMFA 4G3YC 5FZ9A 5JCTA 3JCIA 2QQUA 4AEDC 3S57A 5CFCC 1IOAA 4FI9A 4Y22B 3U37A 2ENRA 5A1LA 1LR5A 2ORZA 1UU5A 5LY1A 5DZEA 4Q4X1 4RGAA 1X8MA 1Y3TA 1WWYA 3POJA 3VKFC 4CA9A 3ZFEA 2I74A 4FP2A 4ZU4A 3IPVA 1JYIA 4XBNA 4DINB 4YVSC 4BMEA 3MV11 4Q26A 5BNPC 2G9FA 1CVNA 1GSLA 1H2LA 1R082 4D94A 3UKVA 4WM7C 1UYPA 3AM2A 4V2WA 5KC6A 3FFZA 2BU9A 4XTMA 5FZCA 5FOJB 3VD5A 2WR9A 2AREA 3PVBB 5BNNA 2QZ3A 2PQSA 4JKKA 2WJSA 4FBFA 3GZTB 3ZYFA 3OGSA 4AOCA 2DCJA 3ZXLA 1FATA 3DECA 1UPIA 3SISA 3U4XA 2F6BA 1NY71 4NAMA 5JSOA 5KHHA 1HX6A 1S0DA 1K45A 2OQ6A 1QJY2 4N43B 1KITA 2Y34A 1S0CA 5M0TA 5EJ3A 5A3UA 1H2MA 1W6NA 3CIHA 5IHRA 1PM4A 1QXPA 1VALA 4KBBA 3F95A 2QQPA 1O3SA 2R16A 5FP7A 1H8TC 3ZYJB 1AXKA 1H9WA 4IGPA 2YPJA 5F7UA 4RS5B 2WIIB 1CX4A 5FBZA 2WLPA 4N53C 3SCHA 1PZ7A 1JH5A 3RFRA 2JE9A 5DG2A 1JYNA 5CBLA 1E5RA 1QOSA 4R9DA 3VBHC 5F37A 4FPCA 1Y9MA 2Q8DA 5E88A 3TN92 4NHMA 3AFGA 3LEIA 4LOSA 1UNBA 2RS53 2YBPA 4UYBA 3PMEA 2GALA 3EXUA 2B8MA 3AP9A 1HB4A 4KMQA 2VL4A 1VPHA 3HOBA 4QPGB 3UGFA 5KBFA 3OUHA 3ME2A 3NQHA 1RUF2 1VBC2 2V73A 2CWMA 2VZTA 4LPLA 3VKOA 2ZA9A 4SLIA 3O1TA 1H6YA 5C3OA 2O1QA 1SLLA 3BPSA 1VE0A 2VNGA 5T5JA 4JGYB 2GNTA 5HV4A 3VZOA 2CYFA 3E97A 2Z2SB 1AR71 1N3PA 5FY5A 3LE0A 5FZFA 1NA1C 1DCSA 2W94A 5DDJ2 1VRH3 2P6CA 3L2HA 1G7YA 5LA0A 3KV5A 4BQXA 1PO13 3ABZA 1NOVA 1RUI3 4Q8KA 1YQ6A 4LBMA 1S0JA 1VRH1 1Q3EA 4O7XA 1OH4A 2WO2A 3DN7A 2JDZA 1GNZA 2QJVA 1WLWA 1OQ1A 4X6QB 1X7NA 3DYPA 4QQ2A 4YW1A 3E6DA 4CDUA 3HAGA 4YFZA 4I30A 5JSRA 1JW6A 5F5QA 3ZFFA 4FFGA 3MF9A 4QGNA 3I2DA 5H9SA 2RR11 4JDMA 1CN1A 3ZO0B 1MACA 4Q1RA 1FOD2 3CF6E 2JWPA 2J1VA 3O0XA 2E63A 4Y1YA 2RDRA 5A6ZA 1WCQA 1W2UA 1LU2A 2VUJA 4GA9A 4QHOA 2KD7A 2ZTNA 2WNUA 1IPKA 4FO9A 2FDFA 2WFF1 3ZFGB 1F5JA 1H6XA 4LA2A 4LBKA 2Y64A 2RS33 2WWJA 3M3OA 3QACA 3AVRA 4MX3A 4W4ZA 5A7SA 5CFDA 2GC0A 4W50A 2ET7A 1L7QA 3AYCA 3C7FA 2EIEA 4PCRA 2A71A 2ZX4A 4LUKA 2BP6A 2HWE2 1ENQA 1F35A 1LRHA 1W06A 2HWB2 1IKPA 2B42B 1OT5A 4NIIA 4F7ZA 1AYM2 3WNXA 5CB7A 3CLPA 1YFUA 3ZPYA 1KJRA 1RUJ1 5FIXA 2EALA 1OF4A 1FT9A 1T6GC 1W9TA 1IPSA 1K5MC 2BNNA 2OVUA 4NE9A 4QGMA 1O8PA 1JU3A 3VB9A 1JZ6A 1GLHA 3ZXGA 4GMP3 2JDPA 3D4KA 4P9IA 3UNPA 2GMPA 4YLZA 4COWA 2JG8B 2VULA 3V0AA 2J22A 5FWEA 4IV1A 4HFSA 2VZQA 4DOUA 4CDXA 4TLFA 5G04L 2VCAA 2XBO1 4E2QA 4LEJA 1K42A 1ZZBA 3HD8B 3KV4A 5FP4A 4CDQB 2FDGA 1TE1B 1ND2A 3P3PA 2IVJA 5JSPA 4Q4W1 1ZBA2 3ZOIA 4FOYA 5DN2A 4NRMA 4MGQA 4ARXA 4N9IA 3T2QA 2DV9A 4LA3A 2ERFA 3UJQA 4KWKA 4WM8B 2CU5A 3BGAA 4MGIE 3ZXAC 1AX0A 4ASLA 4OHZA 1QJEA 1VMHA 2PTMA 3U14A 1D0HA 3LFIA 1XU2A 1QY4A 3THDA 2N7GA 1KGYA 2ZMKA 2D44A 3N36A 5A33A 4TTGA 3BTXA 4PIXA 4QX0A 3W21A 3FBMA 4QMAA 2EICA 3HNBM 1HV1A 1RHI2 5AC92 1UMZA 3T2PA 3KV9A 4XJ9A 2F4PA 4IV3A 3ZX7A 1GV9A 1OOPC 1UXXX 2C0ZA 1EPWA 5FXVA 1QQP1 3WNNA 3PUQA 2OQ7A 2Q1MA 3ZFEC 1OA2A 4GD4A 5FYZA 3BPZA 5F3CA 1EY2A 3ACHA 3K48A 1JXNA 1PO22 4YVWC 5BV6A 2VM9A 4MV2A 1YQ5A 5FZLA 4LITA 1NYWA 1OFSA 2VD7A 3BOWA 1VMJA 1G9FA 2JKXA 3P5BA 1MPXA 4IGQA 4YVSB 4NHKA 3B69A 3OYWA 3RYRA 5IJRA 3USUB 1W28A 4Y33A 4BLJA 2P3JA 3KV6A 3OSDA 4RD7A 5FYUA 3MPBA 1WLDA 4FPGA 1LKNA 3HEIA 4WM7B 1JYCA 1TME3 2UYBA 4HBNA 4RGKA 5H9QA 5JIUA 3RZGA 1EUTA 1LHVA 1W6PB 1DFQA 2HYKA 2DFBA 3DPRA 4DUVA 3BU0A 2WNEA 4CCEA 1B35A 3KM5A 4ET7A 1X33A 4UFLA 3WNPA 1YFXA 3AZYA 3IDAA 1NAEA 3LDBA 1ASJ1 1E5SA 3OGVA 5ANQA 5FYYA 3VGIA 4P00B 1COV3 2W92A 3E5QA 1OXCA 4QDSA 2Y6FA 2XQRA 4RQPA 3AP6A 3VKMA 2WWUA 4OHYA 2HWF3 1IG3A 2AZ5A 2OA2A 5DZFA 1EUUA 4DPNA 4CEWA 1BMV1 1EP0A 1R091 4ES8A 3N9QA 1MZ5A 4P9GA 1V6IA 5DQ0A 4WZCA 5FY7A 3ETQA 5K0UA 1U5IA 3QOPA 5SV8A 2RE9A 2PN5A 2YMZA 5ISLA 4LT5A 4BQWA 1RUE1 2BVBA 3H1WA 4BB3A 4N53B 5LEJA 1BEV1 1TMF3 3CL1A 4KU8A 1NXMA 3KWVA 3VZKA 1GYKA 4HLTA 3SKJE 3LQCA 4FFHA 1RUC3 4CYDA 1VB2A 2P6HA 5GZGA 3O1RA 5ANNA 4EWEA 5FRAA 4Q0SA 2IXHA 3OY8A 4O9GA 5FMBA 1FPN1 2DU0A 3ZMOA 4ZKTB 1DYOA 4ZS3A 4TN7A 3OPTA 4EWAA 4FP3A 1WW7A 1PGW2 1W3XA 4NHYA 1DIWA 4Q4V2 1EAH2 3C7OA 2AACA 3KVAA 3OB8A 4XACA 5GLTA 4JRLA 1DYKA 5HCFA 4UW3A 2YHJA 2BZDA 5H9PA 4AGGA 2VQUA 1C4RA 1UD1A 2Y6HA 5IWFA 1H4HA 4RA0A 5IVVA 1CPMA 4B29A 2X8KA 1V6OA 1FYUA 3OJBA 3AMHA 3BKZA 1W6OA 1SPPA 4QHBA 2XHKA 1ZRRA 2TNFA 4XDQA 5GJ6A 1V9U3 3K4AA 3G7DA 1C3HA 4QAWA 3O0VA 4KBZA 1W6MA 2W08A 2CAUA 2DBIA 4ZU5A 4BQ2A 2D6LX 1W0PA 2VPVA 1V9U1 3LA3A 1IS5A 4UFIA 2JIJA 1UZWA 4WVZA 3W20A 4CDUC 3RZMA 3LB9A 3HN3A 4RHV1 4XJWA 3RMXA 4B3NA 1CZVA 3WP4A 2BERA 2P2KA 1LCLA 4QKFA 2XJTA 3TYJA 5FJHA 3VUOA 5LASA 2RMU3 1SQ4A 1X8EA 3R05A 4LJHA 4OQ9A 4D3WA 1WMEA 2P3IA 1X36A 2OPKA 3CO2A 5FYVA 1MZFA 4A2UA 4LBOA 5IK5A 1O6UA 2D6KA 3KHBA 4KWJA 4CCDA 1QGLA 1QH6A 1O4ZA 2ZGKA 4JHZA 4YGDA 4C1XA 3WSOA 1KDKA 2CL2A 2GH2A 4P02B 1ULGA 4QX1A 2BQPA 2J1AA 4CP9B 1AUYA 3D0SA 4LNVA 1IS6A 5FO9B 5JPNB 3D5OA 4J6GA 4BQ3A 4GWNA 2OIIA 1CAUA 3H8OA 2JD4A 4IE7A 3KVBA 1K12A 3DCQA 4YM2A 4AAPA 1MZEA 3FLPA 1ULFA 4AQTA 3VV1A 3CNAA 5I91A 3EO6A 2A3WA 4YNIA 3ZDVA 1PZ8A 3OPZA 2ATFA 2XLGA 3ZMNA 3BU7A 1DQ2A 4IV1C 3ES1A 4CDXC 1J3PA 3VDDA 1DQ6A 1NUKA 5J48A 5DAPA 1US3A 4NWVA 2JB4A 1ND2C 4H2AA 4JAAA 3T0BA 5BXXA 3ZN6B 2HWD3 4B7KA 2VZPA 4BISA 2RJ2A 3M3IA 3ZYIB 1HQLA 1KEXA 2H0VA 4JGZA 1QJU2 1LOCA 2DBNA 3ILRA 1UW8A 2Y60A 2BGOA 3SH4A 1RVF3 3OPWA 1S0IA 4AE2A 5T5LA 1G9CA 4URAA 3T30A 5I0RA 4PDWC 2OZ6A 1WMXA 1GZWB 4WVWA 5DAWA 4NIAA 1NT0A 3C7EA 2ETEA 5BY5A 4AI1A 2CGNA 1GUIA 1ND3B 3ZM8A 1J83A 1ULOA 5DPNA 1PK6C 2W95A 3AP5A 3OBZA 4CU8A 5JLVA 1HIXA 2XL7A 4EE2A 2JDHA 3TN91 5LZ6A 3W58A 3FX3A 5ACA2 3WG3A 4XUPA 1BBT2 4ZXKA 5AVAA 4EWDA 4FTBA 4NN0A 5GKAC 4GH4A 3JD72 3VD7A 3POBA 5IW0A 2VR4A 3QH6A 2J7MA 3AMPA 5C8WA 3ZXJA 1OOPB 1OLRA 1W0NA 3H7JA 5FZEA 2Q0AA 1DGRN 1YWKA 2VW0A 4XQ4A 1LODA 1RUF1 3L9JT 5DAXA 2AEZA 4TZDA 1TG7A 4SBVA 4BDVB 1JZ8A 1Z0HA 2WZEA 3C7GA 4KG8A 4G4FA 4ZZ5A 5FZ0A 2PXJA 3PU8A 4K1YA 4CUBA 2R042 3POIA 4YW6A 4EQVA 4YVWB 3AFKA 2VMGA 1S0BA 3NJZA 5C5TA 1KDMA 2GH8A 3I7DA 2ZKNA 2WL1A 3ON7A 5FZGA 3H8XA 3WEZA 4F83A 2ZAAA 3I3QA 3JQWA 5DDJ1 4UT5A 5EYXA 5FY8A 2RVAA 2A6XA 2ZJCA 1O5UA 3WG4A 5FUNA 4NOTA 1ENSA 2VXRA 1S0GA 3MIFA 1FMD3 2XPJA 1BK1A 2E9QA 5CISA 3IWZA 3IT8A 4RQPC 3SNMA 1XU1A 4XFHA 5FQ0B 5JVVA 5HI0A 2XQXA 1LHOA 3FWEA 4CEWC 3S7EA 2ZGQA 1FOD1 1SCSA 1UU6A 1W05A 2VXJA 3A7QA 1E5IA 3A0KA 4XJ8A 2VE1A 3VD3A 2YC2A 5FV3A 3QLQA 1HXS2 4J1WA 2OUHA 2WAOA 1OUSA 4MO3M 2CDOA 5HV0A 4GXLA 3I59A 3WNKA 2CDPA 1W2OA 3PUSA 1SFYA 1U5XA 1V70A 2J1RA 4FOWA 3DYMA 3VDBA 4LO7A 4XOGA 5B4NA 2JENA 2XH6A 1JYXA 2HLEA 3GJAA 5GLVA 4XIOA 1ZBE3 5FZKA 3J7NA 2HWE1 4YGCA 2HWB1 2GMMA 3WHTA 1AR93 1V6LA 2ZAHA 1AYM1 4KGQA 3GBFA 2B9UA 3RWKX 2WLQA 2FQPA 5D2AA 2BVVA 4FAGA 5FKCA 3BI3A 2ARCA 2WZR2 4MZUA 3LIHA 5K9YA 2OUJA 2XKPA 1XC6A 3KMHA 5C70A 2RM22 2ZGMA 1GU3A 1O4TA 2VNRA 2XDVA 2PELA 3IDEA 2C9AA 3N7LA 1ODMA 2BOIA 3WDWA 3C3VA 4MHRA 5J7MA 4CDWA 2BWCA 2PLV2 3VN4A 2Q4SA 2W47A 4ES9A 3ZPOA 3AZXA 3KCYA 1CD3G 2I2SA 2QTWB 2YC4A 4Q0PA 3NKTA 1XBFA 1V6KA 3NRUA 4R9BA 4AXOA 3GDBA 5LWBA 4Q4Y2 4I0WB 3M4FA 5LA9A 4XUOA 1XNDA 4FTSA 1HJFA 4GQ7A 2D6NA 3ILFA 3V0BA 4ITCA 1OLQA 2Z5WA 2XGXA 2VNVA 3OF1A 5IVCA 4XCBA 4XHXA 1I5PA 2E26A 5JIAA 1C5HA 4LHLA 1CAXA 1QOTA 5A32B 1I3HA 3HQUA 5FP3A 3WD5A 2FDJA 1RHI1 3PU3A 2UWAA 4M4PA 1REFA 5AC91 4A45A 3WF1A 3W59A 1K5JA 2W9XA 4AI2A 5C71A 5JXIA 1W3VA 4CUCA 3RZKA 1G9DA 2FMYA 2R062 3E5XA 4LE4A 2ID4A 1BVP1 4AVAA 4R4ZA 2JD9A 2I07B 1PVC2 1C8M3 1CJPA 1H30A 1D4M2 2J1EA 2RDSA 5A7OA 5KHGA 1OD3A 2VBPA 3I54A 3N7MA 5IAVA 1PO21 2BRTA 2NLRA 4LKSA 5I0TA 5JI7A 3VBFA 5LCWL 3PIJA 1PIV2 2IFRA 2QUOA 1M06G 1OQEA 4CCNA 4ZS2A 3W5MA 1Z78A 4B4PA 4L97A 3B00A 4YG0A 3BTAA 3H8RA 3J7LA 4QU2A 4QB6A 3ZYBA 2YU1A 4DY5A 4UFMA 3S6PA 1XRUA 4Y20A 3PTYA 1RL3A 4LMFA 4XDPA 4XEZA 1RUD2 2QDNA 1JZ3A 2W87A 1C1FA 2ZGPA 2WO7A 1J3RA 3KF5A 3GM8A 3OUJA 4MVTA 1D4VB 2J1SA 2HWC2 2NP0A 5FZ7A 2EF6A 2NQYA 3GNEA 1PZ9A 1XNAA 4FFFA 5J98B 1FI2A 3H8UA 5L7OC 4BMBA 4O65A 2D3SA 2MEV3 2XB6C 3WQ7A 4AVBA 1DGWA 4A7YA 1JOPA 1VBB2 2W1QA 3NV2A 4BIFA 4XF4A 4CCKA 3P6BA 3O1VA 4MG2A 1BKZA 1UN1A 4XILA 1HV0A 3RZJA 1VP6A 4KQ7A 3B93A 4NPMA 3AKTA 2DYCA 4XE9A 2YB7A 3CKHA 2RV9A 2XLAA 1RUG2 4PDWB 2WT2A 4NRQA 5FPVA 1AR83 1SHWB 2YY1A 1YXWA 4NVPA 5GLUA 4EJRA 1KS4A 3HWJA 3NV4A 5I0DA 4CUAA 4L92A 3WDYA 1PK6B 2VTXJ 2MPFA 4XABA 4GALA 1AF9A 1RMU2 1AL23 2WO3A 1A78A 1WLCA 2NZ9A 4H7MA 4YM0A 4JVAA 2VCBA 3WCRA 4AW7A 1PGW1 4HVOA 2YU2A 5T3NA 1F15A 1EAH1 1MQTA 1UOJA 4BPZA 5JXGA 1MR5A 5JXJA 1CESA 3EBRA 4Q29A 3H50A 2GP3A 2VQAA 1YQ2A 2RDNA 2WKKA 5JOXA 3I8TA 1JBCA 3AKRA 1HJGA 2GN7A 2DUPA 1OQDA 4QPWA 5I93A 3ZIWA 2J42A 2PAKA 1H8VA 2D3PA 1ZNPA 1VBA3 1O7FA 2EIGA 2FCUA 3AMMA 4BU2A 1H1MA 4GULA 2A7AA 4Y1ZA 2W68A 4YG6A 3AK0A 5T54A 1SZBA 3H42B 1LGNA 5IVJA 4ZHNA 1N1TA 2WNVC 1RIRA 4AYUA 4MGZE 4Q4X3 1DDLA 2CHHA 2JEMA 2LS6A 4K6BA 4QX8A 2A5ZA 4MXVA 2DVAA 1E5HA 4JV4A 4RR3A 4ARYA 5D8AC 4XXAA 4NO4A 2JICA 2RDQA 3HNYM 2XR4A 1VAVA 2C24A 4BWOA 2ZHNA 2VY0A 4M3CE 3HN1A 2LRPA 1OHFA 1PVXA 3CU7A 4XJUA 3WINE 3NJVA 2YGMA 3VBOB 3X29B 1ENXA 1W8NA 1GICA 1ZZ7A 2AYHA 3HT1A 5FZ8A 5F5CA 3UESA 5LW9A 1V00A 2P4EA 2Y0OA 1W8OA 3R4DB 4LBQD 5DABA 5EYYA 2XVLA 3VBRB 4AGRA 4D7TA 4DY3A 4IE5A 4CVUA 1RXGA 5KHJA 1QDOA 4UFHA 3ZLIA 4A7ZA 3FBYA 2RHPA 4NAOA 4D69A 3KZ4C 4OUEA 5FZ1A 2ZKLA 1UCXA 1CAVB 1NCQB 2WS92 3NAPB 3LIGA 5A7QA 2ZEXA 3JQXA 5B2GB 3MFAA 4XHBA 4HSJA 3PMSA 4XJAA 3KGZA 3ITQA 2JG9C 3AYAA 3RZLA 4IEWA 2VZ1A 3IKWA 1DZQA 4CUGA 3VHPA 3T3YA 1VJ2A 4OULA 3CEWA 3IDBB 5BNOB 4DXRA 1VMFA 1WA4A 1EV13 5JXHA 5FO8B 1W9SA 3LD8A 1AYN2 5JR2A 1UYYA 2VMEA 3D0JA 2CWSA 3AKSA 1QJX2 3NJYA 1UYXA 1EV11 3TNPB 5C8CA 2JE7A 3LSDA 3KB5A 5FMDA 4XBQA 1LECA 4LBJA 1N1SA 1H2NA 1LENA 2A73B 3N9PA 1QJU1 1JYTA 1M4WA 2DF7A 2QQVA 4MHUA 4XUNA 2Q8OA 4TWTA 4Y24A 5GZFA 4AHYA 1NCRB 4QPIB 4XF1A 3M70A 2QQMA 2BTVC 2ARXA 5FY4A 3WP6A 2HH9A 4MXWB 2ZABA 4QQLA 3RS6A 1H9PA 2XJSA 1QXJA 2YXSA 3IB3A 1NE6A 2NN8A 5FXWA 1YI7A 1PNGA 1AJKA 2Y8KA 4FPKA 3R6SA 2QCSB 1CR7A 4QWNA 2BFUL 2FDIA 4XQDA 3ASIA 3FHAA 2AH2A 5ACA1 1BBT1 5HCAA 1FXZA 4S2HA 4LBNA 3ZKUA 5C4WB 3JD71 3IMMA 3L2YA 3IAPA 1ZA4A 3KQRA 4IE0A 1W6QA 4BE3A 1RUH2 5C3RA 1QF3A 1WCKA 1AR73 3HT2A 1PGSA 1XSQA 3FC0A 3TAYA 3CJXA 2VMDA 3MIEA 3WDTA 3K3OA 1W8HA 3CJIA 5FXXA 2GSYA 2X05A 1UXZA 4D7YA 1QJZA 3K51A 1XNTA 3PVOA 4JRAA 3VD4A 1F8VA 4XW3A 1EPZA 4BQ4A 3JU9A 2R041 5EP9A 1OLME 3TEXA 5BPXA 5FUIA 1C1LA 4NHXA 1YLLA 1WD3A 1VBD2 2HBUA 4EYUA 4QX5A 3C2UA 4M3CA 1S2EA 4E9KA 4CEYA 1VBE2 2RR13 4B4RA 5IK4A 4NWWA 2WA3A 2P17A 1JOJA 3DKQA 1PX3A 5FPBA 4K7JA 4BK4A 3IMNA 3J7MA 2YUEA 4Z8BA 3JXSA 5IAXA 3BODA 2WFF3 1J84A 3NMBA 4QXBA 3CHXA 3LDKA 5FZ3A 1UY0A 3M7AA 2VVFA 1WCUA 2XVGA 5AFEA 5FP9A 1ZX5A 4JQRA 4KGGA 4E2GA 3C8XA 4LBQB 1OD5A 2BGPA 4XUTA 1UPSA 1AJOA 1W99A 5LB6A 5L7OB 2JDMA 4L99A 1DGRA 4E2SA 1YHFA 4AI3A 3H0OA 4XCAA 3NVCA 1NLQA 1HXS1 3LEGA 4GB32 2DFCA 4XF3A 4DQAA 1RUJ3 3GCWA 2GAUA 4DXZA 1AX2A 4AHWA 3FJSA 1N1YA 1YEWA 5GZCA 4LE3A 1HRI3 1I1EA 3BTYA 3FMGA 1Z7S2 1W90A 5F3IA 5C9AA 1W8FA 3IIAA 4JDOA 2XBO3 3MIGA 1QXRA 3KCXA 3DUIA 1HRI1 5A7NA 1BLZA 3WVJA 2GNDA 3RI9A 2OYZA 2BV4A 4DEQA 4Q4W3 4YPJA 3WNMA 1CAWB 3VBUC 3RG0A 4EN6B 5FDBA 3RMYA 2BJSA 1DZTA 2C4XA 3SITA 4A4AA 2WZR1 2X5IB 3CZJA 1UIKA 3VHNA 1BK0A 1RINA 2VZRA 1LOFC 2XJPA 2B46X 4UOJA 5LRSA 4QKDA 4AEMA 2JB8A 4FXGB 4IL7A 2RM21 5ABJB 2D40A 1T2XA 3RZHA 4AVCA 1J1LA 4CU7A 4Y1VA 2FBEA 2D5FA 4C8DA 2ZZQA 4HPKB 4WVMA 4WBBA 1UIJA 2PQQA 4DUXA 3VBSC 1MVEA 5EWSA 1ZZCA 4A6SA 3O1MA 1BXHA 2FCVA 3JUUA 1MS1A 1HDKA 2WFPA 4UF0A 5FREA 1DU3D 1ZA7A 2BFUS 2WQZC 1LHWA 2DURA 3H3ZA 1QQP3 4P14A 1XYPA 4Q4Y1 2GZWA 4CSWA 2GU9A 3AVSA 2PHXA 2BUKA 1OSGA 4QXCA 3VL9A 4CRQA 4DEVA 3RYKA 1UMIA 5DZGA 2BNOA 2EVXA 3RDIA 3POYA 3WG1A 2XONA 5A7WA 1E57A 4YYOA 3MF6A 2WNVB 2VOVA 3FLTA 1OLMA 5JOZA 4OYUA 2XL9A 4AEDB 4AI9A 1F9KA 5CFCB 3V64A 4KL1A 1YQ8A 2JDAA 5LEKA 3T0AA 2UY8A 2HKXA 2E7TA 5D8AB 3THCA 2HEYF 2W39A 1RJ7A 2R061 1X9PA 2KA3A 2O8OA 2XJRA 3D3AA 5A3WA 3POWA 1JZ4A 1HRV2 2ZACA 4MH0E 4AEJA 1YC61 5EJ1B 2PHRA 1KFUL 1PVC1 1B09A 1GNHA 1MS4A 4FT8A 4MADA 1ZREA 4YGEA 1YIFA 5BNNC 4BM8A 5BNPB 3QD6A 2UWBA 4XQWA 1XOYA 2IVIB 4C1WA 5J09A 1YRZA 4CPBA 4CZSA 2ES3A 5JZGA 2Y0IA 5SV5A 3MZHA 1FNYA 5CA6A 1ASJ3 2V4AA 3TWIA 4IETA 2P3KA 5IUQA 5FPUA 4FQZA 5FY9A 2W0XA 3T1LA 4IE6A 3JB8A 2KXLA 4QXKA 2P34A 3PJYA 2A6WA 1MVQA 4PI2A 3DGTA 1R093 4U36A 3ZR5A 5FYMA 1RC6A 2UWCA 3FHIB 4NIDA 1RUD1 4NMIA 4NHLA 4XFAA 3LWCA 4XURA 5CYYA 2WZ8A 1IQAA 1XNBA 2K2SA 4KWLA 3WDVA 1R1A2 4L9BA 1MEC3 2HWC1 4PQ9A 1YIPA 3I2GA 3MW4A 3WLUA 3I3MA 2W91A 1RUE3 1H8TB 1BEV3 4IEYA 5FCCA 1MEC1 3ACFA 4IDZA 4X8NA 3I2JA 2JX9A 4Y22A 1VBB1 2OKXA 1GNYA 1Q8QA 1FPN3 4FXKB 2VCMA 1UMHA 3IDCB 1UKGA 2R49A 2WN3A 1HQWA 3J4UH 3VBHB 1UAIA 2WZPP 2QZ2A 1GP5A 1IZ3A 4OHXA 1RUG1 2Y6LA 3AYDA 3J7HA 4BQYA 5KC5A 4Q0VA 1PMIA 1BZWA 3O14A 1JZ5A 1D7PM 1AR62 2DTWA 4ATFA 3U75A 1TNFA 3LOIA 3AMQA 2PHWA 2A3XA 1BVVA 1RMU1 3O7OA 3JBG2 3ZXKA 5FLJA 4N7IA 3T2TA 1IGOA 3CJIC 3H9AA 5BYNA 3UGGA 2XXZA 1H2KA 2OPWA 2PFWA 4Y1UA 3SQOA 5HBAA 1OF3A 1SBDA 3H7YA 2ZEZA 2MHFA 4P9WA 5BUVA 5IVEA 1FV2A 2VOWA 3Q8EA 2D6OX 2R073 1RXFA 2UU8A 3POSA 4N43A 5JAXA 3EB7A 3W9AA 1NXD1 2D3RA 4RHV3 2HEWF 3OEAA 4QXHA 4UBHA 3TNQA 1C5IA 4BK5A 5HPOA 1Q56A 1ST8A 4CEYC 4UAPA 1Q43A 1NA1B 3K4ZA 5LBEA 2R071 3NNMA 3E1F1 4K21A 2EXHA 3AYEA 3J8F2 3ZFFC 4DZGA 4YZ5A 3TEYA 2DCTA 3INAA 2FHRA 4BCUA 2GN3A 1P8JA 4RS5A 4L2NA 1NLSA 4HVRA 5IK7A 2Y6KA 3ACIA 4Y5SA 2XOMA 1RYYA 5A70A 2PHFA 5FPLA 1LOAA 3T09A 4QPIA 4IEUA 5FZOB 2WNUC 1N47A 1DP0A 2IC1A 5FYHA 3KD4A 3NW4A 3THPA 1LESA 3GBGA 3MICA 4KNCA 4OI2A 4XF0A 3VZJA 4IEZA 3FFQA 3C7HA 3OTFA 4XF9A 1R083 5CFDC 1WMFA 3DV8A 4D8MA 3LA2A 4I09A 2A70A 1JYWA 4QPGA 3I2KA 4CXWA 5AFBA 4IEOA 2VBBA 3QCWA 1QJFA 1R081 3WQBA 3OGRA 4XTPA 5IVFA 1UOFA 1YNAA 2CSGA 3GJBA 2IXIA 4BQ5A 4EV0A 4LKFA 3MO4A 5FLHA 4COVA 4JGYA 4JHTA 5D1IA 2WS91 4INDA 5FK7A 4FQ4A 1WD4A 1Q5OA 2A1XA 3K77A 4PBOA 1QJY3 2WABA 5CEHA 5DMYA 4FPJA 2XUMA 1K5MB 1IKQA 1GP4A 4PF5A 3T4VA 3ZSLA 1ALYA 2LALA 1O4YA 1QJY1 4AFBA 3MLKA 2X53S 4F3JA 1RUNA 3VBUB 1AYN1 4P9XA 2QDRA 2VG9A 2YPDA 3WX5A 1QJX1 1NY72 3MIBA 2ZOEB 1DG6A 4LHNA 1GWLA 1ULDA 3A0NA 4GKXA 1W9FA 4AI8A 1A3KA 2VW1A 1RITA 1U5YA 3TN93 3AJZA 4PLMA 1QMJA 2H6CA 3R4SA 4OMCA 4Z92B 4DUWA 2I45A 3N9NA 5GALA 1US2A 1GOFA 2YBKA 2JDKA 3VKNA 1DYPA 3FN9A 4RN5A 4IV3C 1KXGA 3VBSB 3ZFGA 4I3GA 5DUVA 1Q8OA 1J1TA 1CONA 1XNKA 3ES4A 3NKGA 3SCFA 1LJ7A 2B39A 1VAMA 3OGJA 1RUF3 2FCTA 1VBC3 3R0RA 1W9WA 2ZGLA 4PHZA 3U1XA 4Y5Z0 1WMDA 1EYBA 3PVNA 3V56A 2Y33A 4LLFA 1VBC1 1HB1A 3WDUA 3KT7A 5LK7B 2JDUA 2OW4A 1DHKB 2C26A 3ATGA 2NMNA 1UY1A 3MUY1 3ZFEB 5DUXA 1RUH1 3IPVB 2RS52 2A6ZA 3LZZA 5FYIA 2B9VA 3J26N 5DDJ3 4V1PA 5FMCA 2K9ZA 5CAZA 4UXAA 2JG8A 3RGBA 3IM0A 4H7LA 1W9YA 1W2TA 1CJDA 4CDQA 3DPRC 2FDKA 4ISRA 1B35C 5BNNB 5FZ6A 1NG0A 3BIEA 4CE8A 4OHWA 4XMIA 1VBD1 4C90A 2ADEA 1GBGA 1IHMA 3ZXEA 1GOGA 1REEA 1VBE1 2TEPA 4WM8A 2TBVA 5F1RA 1FOD3 2WC2A 3DKWA 3GZAA 2FD8A 4N9HA 1AZDA 3VD9A 4UWDA 2VZ3A 4CU6A 3N9MA 2GNMA 1W6NB 2X10A 1VRH2 3M3CA 4PLOA 1YFYA 3MEPA 1PO12 1RGSA 5K0UC 1GZTA 1YFWA 2BGCA 2YDEA 3ZN4A 2XMLA 1DQ4A 5ERLA 4AGVA 1RUI2 2Y26A 4TYSA 1F5FA 2VC9A 2NMOA 5DG1A 3VDCA 5FZAA 3PUAA 3GALA 4E4ZA 1S2KA 1UZ0A 4HKLA 3MW2A 4N8MA 1FX5A 4KU7A 2VUDA 5T5PA 2HWE3 2HWB3 4ZXEA 1D0GA 1S1AA 1QU0A 4RFT0 1AYM3 2WA4A 4UW5A 4IEXA 4OUMA 1UF2C 4GB31 5A1FA 5CFCA 1LTEA 4QKBA 4EN7B 2RS12 4L11A 3RPQA 1T6BX 1OURA 4MSVA 4ATEA 1KFXL 3JB4C 3NV3A 1Z7S1 4O9EA 3H1MA 3ILNA 1PMJX 1JODA 3USSA 4E8CA 3E6CC 2CNAA 4R4XA 4YVSA 3WW1A 2RS32 2YZ4A 3USUA 2Q30A 4CP1A 3HBZA 4LTAA 1Y4WA 2YV8A 5HXMA 2G9ZA 1ZBA3 3S7IA 1AXZA 4JTOA 4WM7A 4XETA 3WT3A 4R8HA 1ULCA 1W6PA 2Z69A 1VR3A 3M2MA 1ZBA1 4XIKA 2R30A 1C28A 4RYDA 4OI1A 1HLCA 4NPLA 3OD0A 4BHPA 4R9AA 4C0BA 4BOWA 4CCMA 2PMWB 4LK6A 1VAKA 1XE7A 5FPXA 3ROUA 4I02A 1Y43B 3TBDA 3UKTA 4GJZA 1I5ZA 1W8WA 1RHI3 5AC93 2NPIA 1G8WA 3T2OA 3UYJA 5FK8A 2QQNA 1IS3A 5EHDA 5FZBA 5F2SA 2DVFA 2JECA 4CDUB 1O91A 4W65A 4DRVA 3ZFFB 1DLLA 1F31A 3WCSA 1H4GA 4X8PA 2C6SA 1IS4A 4YFWA 5GLWA 3WF3A 2VZUA 3AL5A 3ENRA 4N53A 2R32A 4Y5TA 1PO23 1OPMA 1XNCA 3THTA 4NIHA 5F32A 4L8QA 5CKMA 2WNUB 5IFTA 2QFEA 2R0HA 2QQWA 3VZLA 1ZZ6A 4LOTA 4XFBA 4FSJA 2CGPA 2ZCWA 1ZVFA 2L9LA 3M1HA 4CXXA 5JMCA 4QX7A 3MUZ1 1HRV1 4FVVA 4MGKE 2LW8A 5CFDB 3SKVA 3P3NA 1CQ9A 4GAZA 5A3MA 5JMOA 2YC0A 3O12A 3MW3A 4YRDA 2W5FA 5A3OA 1A8DA 1REDA 4HKWA 3KGLA 3NNGA 1L7RA 1OKOA 1SACA 2ZX3A 2ADDA 3LFMA 3NSTA 3PHMA 1F4HA 3VDDC 1YO8A 3KLSA 3ZSJA 3O1PA 4M00A 2B7YA 1SMVA 3DL3A 3A22A 3IAQA 5EZWA 4IW3A 3AKPA 4R52A 2R0FA 4META 1POQA 1UY2A 3V0AB 4JGZC 4IV1B 3CQOA 4PF1A 4CDXB 4MGTA 4QQPA 4DNYA 4Q8LA 1ND2B 2C5DA 1CZSA 1GFF2 4QM9A 3NJXA 4A7KA 1R1A1 1TME2 1BHGA 3BOPA 1POV0 4QX2A 4UW4A 1W2AX 3SMHA 4AK3A 1L7LA 4CCCA 5FKBA 3KCCA 1O3QA 2ZGSA 1TNRA 4AFCA 1CX1A 4QHZA 2OXBA 3K46A 4AL9A 4Z1VA 2IZWA 4LBLA 3KT4A 3HR9A 1COV2 2QQJA 5CADA 4LO4B 5A33B 4GH4C 2JJ6A 5HXVA 2HWF2 1DF0A 1GKBA 4CP9A 2QQKA 1QDCA 4QKNA 3LPFA 1HW5A 4Q4V3 1EAH3 4EN9B 4IV3B 2BBVA 1OMIA 3AL6A 5KXEA 1URXA 3UKNA 4OMDA 4UI9L 3WF4A 3WY6A 1MS0A 1AR61 2PAMA 4FPEA 2DU1A 4Q4V1 3PLQA 1YYNA 4QQHA 3LPGA 4Y3OA 3K3NA 3AMNA 5JR7B 1SDWA 1TMF2 3JBG1 1KD7A 3FZ3A 3WZ1A 3GF6A 2WWSA 1RUC2 2JG8C 4GZ9A 2OX0A 1MS3A 1U12A 2NYYA 4D6SA 2JIGA 4QPYA 1POV1 1LNSA 1WZXA 4RSUA 4AF9A 3WNLA 3ZN6A 3OYWB 5FYSA 4LO8A 2Q1FA 2RJLA 3ZKYA 1BJQA 1O8SA 2KM2A 4AVTA 1KRIA 1V6NA 2F4LA 4MYEA 3OUIA 2ZXQA 1BYHA 1V0AA 4OUSA 1QH7A 3AZVA 3ALQA 3DPRB 1QOOA 4Q1PA 4COYA 1B35B 3J8F1 4HN0A 3PTRB 1N3QA 3W5NA 1CIYA 5FUPA 1GZWA 2ET1A 4B7EA 2WN2A 1MS9A 3JZVA 3SH5A 1ND3A 4LR4A 2XLFA 1V9U2 4JX0A 1YJLA 4B1LA 1OH3A 1J59A 4QQOA 4RQPB 2UY9A 4FFIA 2H0BA 4IEVA 4XZPA 3VHOA 1FAYA 3FE5A 1SEFA 1LOBA 4CEWB 1A8MA 1G6NA 4JZRA 5FFOC 1NLRA 4HK9A 4KH9A 2VW2A 5LRRA 1VRBA 3OG2A 2Q8CA 4BJ0A 5K0UB 2IXLA 4KG0A 4CTEA 1GOHA 3DEMA 4MLOA 2RMU2 4XZUG 4B1MA 1MS5A 1OOPA 1H1IA 1SLBA 2WNOA 4K20A 1SCRA 2GDFA 3URFA 1RJ8A 1C8NA 3SEPA 4AFAA 4A3ZA 2ZGOA 1NQJA 1A34A 3OY8B 3TOJA 1NZIA 1J3QA 2XWBB 3N7JA 4YVWA 3B02A 4A44A 4LKEA 4W6YA 4IEPA 5GZDA 5LATA 4AG4A 2A75A 2B4KA 1NE4A 4BQ1A 1YUDA 2VQ0A 2ZEWA 2XG3A 1QJU3 1W03A 4CCJA 2EAAA 1X9TA 2V4VA 2A6VA 2ZBJA 3AXEA 2CGOA 4H14A 1SFNA 4HETA 2VNOA 4CDWC 4Z07A 2BYVE 3O1OA 1OA4A 2PYTA 2VO5A 4W6WA 5FZHA 1SLCA 1UL9A 2GMEA 2ZHLA 3WW2A 4CP2A 1AXYA 1W6OB 3SCGA 1HB3A 1SPPB 2IXJA 3APBA 3B7MA 3HNMA 3HVDA 1YCIA 3MLLA 3OD4A 2D6MA 4IXLA 5KXDA 1DQ5A 1GR3A 4BZ4A 4QX3A 5FQ0A 3VZNA 1W6MB 4JC1A 2YBSA 4ASMB 2PA7A 3Q8CA 2IWGB 4O61A 1S55A 4YGBA 1W2NA 3PNAA 5ACA3 5F9TA 5K8SA 1BBT3 2HWD2 2ZMNA 1F2NA 4PBPA 5DUUA 3U10A 5J96B 2ZX2A 5I8SA 2SLIA 1DZRA 2Z79A 1DGWX 3JD73 1N3OA 2C9KA 1HB2A 4AWDA 4FTEA 5EFUA 2FZ2A 1R64A 2XJUA 3GCXA 1NZCA 3G6JB 3Q8FA 4LIUA 4ONUA 3LSEA 1WA6X 4QU1A 4DXSA 1RVF2 3H1YA 4ZY9A 2Q1ZB 3MHZA 1QKQA 1GMMA 1JUIA 2VTXA 5B4XA 3D6EA 1O59A 3SHRA 1OPOA 5KXCA 1FNZA 1WCSA 1CWPA 3VBFC 2EIBA 3D82A 3D8CA 4OHVA 4A3XA 2R043 4BIOA 4FPHA 4UFKA 3A4UA 3HQRA 3OCPA 3B3QE 4JCKA 5F6LB 4D6QA 4Z82A 2IXKA 2RS51 3ELNA 1CAUB 1JTZX 1YJKA 2EXKA 2VAUA 4XFGA 3E5UA 3RJRA 5LBCA 2GNBA 3RI8A 3CMGA 3POFA 4AFDA 1LGCA 1XYOA 4H55A 4ASKA 1LOEA 2EA7A 4XFIA 5A7PA 2DVGA 5C33A 5FZDA 4DIQA 3PL0A 3N7KA 1DQ0A 2QKDA 3NNLA 4IERA 1UU4A 2VZSA 4EZHA 5A3NA 2O14A 1OBNA 3VDDB 2BOJA 1WW4A 1O3TA 5FYBA 1Q8PA 1PNFA 4YARA 1R1ZA 2JE8A 1SLIA 4GWIA 4I0AA 4GJYA 3I4IA 1J58A 1OVPA 4JGZB 1HXS3 5F8PA 2QQIA 5CIRA 5FO7B 3N9LA 4Y1XA 1HQNA 4IESA 1PO11 4XFCA 5A32A 1XSRA 3B9CA 4E4SA 4WV8A 1RUI1 1S2BA 3T0DA 4HMZA 1I9RA 2D98A 3VHRA 1ACCA 1FMD2 4RL7A 1JHJA 3MGUA 2BPA2 1H1AA 3VLBB 4GMP0 3B5LB 4LORA 3SLIA 2ORXA 4J25A 2R7EB 1OA3A 5CNAA 1DLCA 2RS13 3BUCA 5FMOL 5FWJA 2K46A 3OBRA 1AHSA 4WVVA 1NQDA 2WSVA 3B94A 5FLIA 3I97A 2R6QA 1ENRA 1IPJA 3ETPA 2RS11 5L36A 2WZR3 2XJQA 4GH4B 3NNJA 1ZRIA 4CU9A 3EHKA 5KWRA 2TUNA 1MQTC 3VL8A 2ZHKA 2BBAA 4LO5B 2RJKA 2RM23 4JQTA 2DCKA 3Q9OA 1GZCA 2Z4FA 4COZA 4PIZA 3LAGA 2RS31 1RTVA 3ACLA 2E6VA 1VIWB 1APNA 2WINB 4M0HA 1HN0A 2VOXA 5LBFA 2PLV3 2ZPXA 2GC2A 2HBTA 2E7QA 4FPLA 3N35A 3NO8A 1ZBE2 4P9LA 4PJYA 2DDUA 3ZR6A 1PX4A 5K7PA 2VOTA 1AR92 2E33A 2ARBA 4MOAA 4YZ2A 2PLV1 4Q4Y3 4LIVA 5LBBA 4ZONA 3EQEA 5T50A 3ZXDA 5KHIA 4OZOA 5JOYA 5C3PA 2ZEYA 1X82A 4QDRA 1TQ5A 1JS9A 3GHMA 3MIHA 4Q0UA 4GMP1 4AQ6A 5JI9A 4K1ZA 2KR2A 2PHUA 2DWRA 2QQOA 1UWWA 4RR3C 4P9JA 2DUQA 1A6CA 2VVDA 3RZZA 3WQ1A 1HKDA 1IG0A 5FZMA 2BW8A 1ND3C 3TEZA 2R063 2WUHA 1QEXA 1ONAA 2WYFA 5F3GA 4S2DA 3NWKA 1PVC3 4PDWA 3KQ4B 5CU1A 3MLJA 1O3RA 5E6HA 1D4M3 4XPVA 1PGL2 5DAVA 4PLNA 5L73A 4QB2A 5CVRA 2LUWA 1XJAA 5K4LA 5LK5A 2GP5A 1ZZ9A 1PK6A 1PIV3 1D4M1 1WW5A 1XE0A 3I59B 4GWJA 4Q27A 3RVHA 3P1IA 4DFSA 4B4QA 4LHKA 1K3IA 4J1XA 1BCXA 1JI6A 1GANA 1PIV1 1ZRFA 4IEQA 1UY4A 4M3CF 1UQXA 1WUVA 1KQRA 2G1MA 3S5QA 2NM1A 3M3EA 5GZEA 4DMIA 4HKOA 2ZZJA 4DB5A 2YG0A 3RNSA 2WBKA 1XYNA 1RUD3 4YW3A 1JN2P 1C8M2 5FZIA 2YFUA 4A41A 2JG9B 4YSFA 1QIQA 2HWC3 4MGYE 4OFGA 1JMUB 2Y6JA 5C8CC 5IT6A 3F2ZA 3DXUA 3KS7A 4YZ1A 5C7GA 4XXPA 2XUEA 3I2OA 1QHDA 1V6MA 2PHLA 1LULA 5KXBA 3LKJA 5F6KA 4CCLA 3ZDSA 1TZOA 1XXNA 1VBB3 3AZWA 4XVHA 4ZU7A 4BYYA 4C91A 4M4RA 2VUCA 2IXCA 3FUOA 3ORJA 2VQTA 3WR0A 4UFJA 4L0PA 3IIIA 4CDWB 1W39A 3VKLA 5BNQA 1TME1 4LO6B 5FMOS 1H0BA 4JDNA 4PIYA 3U78A 1STMA 4AVVA 2JDYA 1RUG3 5APAA 2VGDA 3VDAA 4AZZA 3MYXA 3U07A 2R1DA 2VOKA 3AKQA 4QB1A 2OZJA 3ZIXA 1AL0G 3V0BB 4FOQA 2DCYA 1COV1 1VB4A 2AEYA 3HJRA 4WZFA 2VUAA 5AVPA 3VBOA 5J36A 4EN0A 2MEV2 1RMU3 2WQ8A 5FY1A 4URTA 2HEVF 1CAXB 2HWF1 3VBRA 5KR7A 1ODNA 1S0FA 4EN8B 2E32A 3LA7A 3NL1A 5C3SA 1PHMA 2VBDA 3TEWA 4K8RB 1AVBA 4H3WA 3HPNA 5EV7A 1ZRCA 1CAVA 1NCQA 3EYPA 5DXDA 3UETA 3NAPA 2BDRA 1GQGA 4JKLA 4E4DX 2D93A 3TB0A 4E8DA 1AR82 5I0UA 4BA6A 4LUMA 2XWJB 3GYDA 3GXUA 3I2IA 5FYTA 1TMF1 5A3TA 2LROA 3VBFB 2WO1A 4K8FA 2EAKA 5IFPA 2XHNA 1SBFA 2WSUA 2BEOA 3QBQA 4YG3A 1RUC1 5BNOA 4JTNA 3UJOA 3AP4A 3CDZB 1U5ZA 4HXCA 3U11A 2OT7A 4HOOA 1AL22 1Y9GA 3BCWA 3IBMA 3WHUA 3O0WA 4BXSV 3OBAA 1W8UA 4XAEA 3KF3A 3ACGA 1Q8VA 2XVKA 4S2FA 2EXIA 3S30A 2F17A 4DXTA 3GHNA 1LEMA 2IUWA 4Y20B 4HVQA 3O1SA 5EJZB 1SLTA 2W52A 3POEA 5L19A 4RGGA 1NCRA 3FLRA 3UV9A 4QT6A 3WG2A 1LU1A 1UOGA 4DRRA 2MNGA 1VLNA 4MXWA 4OVEA 1GWMA 5LA2A 5IATA 3I2FA 2PHDA 3PUIA 4AHZA 1VBA2 2B5HA 1DGLA 3ZSEA 3RJ2X 2EXJA 4C0HA 1GQPA 2ZX0A 1U0AA 2VZVA 4Y4RA 1MS8A 3AX4A 5FBJA 5T5OA 5A3PA 1KJLA 1O5LA 5E16A 4YW7A 4Z2WA 1L3JA 2E51A 3BYWA 3O1UA 4I2OA 1WBFA 1UZVA 4GWMA 4R9CA 1Y7BA 4Q4X2 3PVEA 5C4WA 2OS2A 3HMYA 2WS93 1SBEA 1CGPA 2W2IA 1DBNA 3DYOA 2RMU1 3B9IA 5C9AC 1G86A 4TSVA 4PI0A 3R4UA 3A21A 3OGGA 1LEDA 2VCCA 2G4IA 2VVEA 1QNYA 3MV01 3KSCA 3MI8A 5EQUA 1OI6A 5A6YA 2FDHA 4AVSA 1JOBA 2ARAA 2YROA 3POGA 3BIWE 1AYN3 3NNFA 4YW2A 2A6YA 5FP8A 3GGLA 3WF0A 1QJX3 5E1RA 3VZMA 3FL7A 3S5AA 1LGBA 5F5IA 4LXLA 3TRSB 1MQTB 4P08A 2D43A 2C1FA 5LY2A 2JDNA 5IYYA 1G9AA 1SDDB 4NPRA 3WW4A 1ZRDA 4D6RA 2LM3A 1UX7A 1JU4A 3U4SA 1W04A 2ZGUA 3BVCA 1OVSA 3MBWA 4Y4YA 3NV1A 2J1TA 5JDBA 1W0OA 2IFWA 5FJKA 1G9BA 1KS5A 4X6RB 4BXFA 2DTYA 2E53A 2UYAA 1EV12 1F4AA 2WYSA 2XKOA 3ZYPA 1ZZ8A 4JKMA 4LBQA 3OBTA 4ISQA 4XMAA 4AAXA 5C6CA 2VJXA 5L7OA 3KHCA 2HWD1 4NJ4A 5CKQA 2VH9A 1X50A 4HONA 2X09A 2GC3A 3M3QA 4S2GA 4M0NA 2VMCA 3SH3A 4RR3B 1RUH3 1C57A 1QWRA 2D5HA 5FPZA 4I0BA 3LEMA 1RVF1 2G9GA 2V5DA 1D2QA 1GP6A 1GZ9A 2ZS6B 4U2AA 2D97A 4HG6B 1ULEA 3IZOA 1XE8A 4HK8A
chains in the Genus database with same CATH topology
4FOVA 5DUWA 4P5HA 5J37A 1OFNA 4K40A 1S0EA 5JZGC 1CAWA 5FAXA 2O8QA 1VBD3 2YYOA 2O0OA 4D7SA 4OI4A 1VBE3 2X5IA 4E27A 3BB6A 4BLIA 2ZMLA 3E6BA 4UBGA 1ZYBA 1AR72 3WV6A 5ABJA 3V65A 5T55A 3WP3A 4FPFA 4HPKA 2VMHA 4HL0A 2VU9A 2AENA 4QD2A 4YW4A 2QVSB 4AI0A 4OLLA 5FOBB 2DVBA 5H9RA 1Q8SA 5C8CB 1LHUA 4LULA 3RSJA 1BQPA 4N90A 2ZHMA 4M01A 2RR12 4GB33 4XJZA 3EJKA 1N1VA 2A3YA 2R1BA 2WNVA 5JWPA 4AEDA 2D6PA 4HT1T 2P37A 1FMD1 1Z7S3 4UW6A 2WFF2 3VBOC 5D8AA 3HIFA 2Q5TA 2B45X 2WQ4A 5EXOA 3UL2A 3VBRC 2ZGNA 4Y26A 3ZYRA 2K0GA 3RRDA 1TEIA 1FV3A 4HN1A 4AFMA 4QGLA 5A3LA 5I0SA 2QNKA 3GZUC 5GM0A 5BNPA 1NCQC 3NAPC 1WCDJ 1RB8G 5CG8A 4AHXA 2CAVA 3N4MA 1CPNA 1W6QB 2BWAA 1RUJ2 2HJIA 3H3UA 4Q2FA 4N43C 5TSWA 1HRI2 3GBWA 3J9SA 1OKQA 2Z42A 4COUA 5BNOC 3CJIB 1YI9A 3RQ0A 2CV6A 1ZBE1 2JG9A 2XBO2 2WT0A 2UURA 1AR91 4I01A 1CIWA 2ZGRA 4Q4W2 3ECQA 1LHNA 4RS5C 4OI0A 4M3CB 2GC1A 4K3UA 4YZ4A 2JKBA 4CEYB 5JPMB 1UKRA 2CTVA 4FPYA 1WBLA 1NCRC 3LGRA 1H8TA 4QPIC 1ZM1A 5FTTC 1GQHA 3U0ZA 4HSLA 3S0MA 3IN9A 1AX1A 2V09A 2V5YA 2FMDA 2PAEA 2FZ1A 2AUYA 5HCBA 4YM1A 1PM7A 1UZZA 1XQNA 3ST7A 4CP0A 3VBHA 1HRV3 3QH7A 4QPGC 1UZYA 5E89A 1PGL1 1QQP2 5C4WC 3ZVXA 4AQ2A 4G9SB 1WLTA 4OZXA 4Q0QA 4YW5A 5I8YA 3ZSMA 3RYPA 4ORFA 4GIQA 1DQ1A 3WXPA 4JGYC 4N7UA 2XJVA 3ZYGA 3MFCA 2H6BA 3WDXA 5C9AB 5JOWA 5I8TA 1WGPA 2QE3A 1C8M1 4FPOB 4BH9A 1R1A3 1NA1A 2VECA 2ZGTA 1JUHA 3N3HA 4YM3A 3ZSKA 1QNWA 5CG9A 3RWNA 1ASJ2 1Y9QA 2DUOA 2JXAA 5GLZA 1MZ6A 3PJQA 3AB0A 3T1MA 1I6XA 2BNMA 4K9SA 3AJYA 2X29A 3WUCA 2VMIA 4HZFA 1SLAA 3MIDA 4WVMB 1RUOA 4XYXA 4AQSA 4GKYA 1UX6A 2WT1A 1BMV2 1R092 3ZFGC 1V6JA 1D2SA 3AP7A 3BALA 3UK9A 4FAHA 3O5SA 2PHTA 4NR1A 4EROA 3ZN5A 4F8AA 1AR63 1MEC2 4W6XA 3WP5A 3SXWA 3MDPA 3FUQA 1RUE2 4LLOA 5KHKA 2MEV1 3AXDA 1BEV2 3JBG3 5E8AA 5J3UA 2ZX1A 4B8EA 4AEKA 4HANA 2CY6A 1FPN2 1POV3 1WW6A 4YZ3A 1LB2A 3M8LA 4P9YA 2AGSA 2AR6A 2ILMA 3LCPA 1AR81 4CDQC 1K5MA 2YGLA 2X5IC 2Y38A 4QM8A 3ZXFA 2D7FA 3J8F3 3WOGA 5JZGB 5ABJC 3KT1A 3VBUA 3MPPG 2E7AA 4WM8C 1AL21 4DS0A 5T52A 3WUDA 2DCZA 2SBAA 1LOFA 3DF0A 4FCAA 1JHNA 3B01A 4XBLA 4MUVA 2DVDA 1LOGA 2LTNA 3WQ0A 2R072 3WW3A 4I3PA 3HQXA 4RHV2 3AZZA 3LOBA 3VBSA 4IQPA 5IK8A 4XFFA 1VBA1 4G3YC 5JCTA 3JCIA 4AEDC 5CFCC 1IOAA 4Y22B 2ENRA 1LR5A 1UU5A 5DZEA 4Q4X1 4RGAA 1X8MA 1Y3TA 3VKFC 3ZFEA 2I74A 4FP2A 4ZU4A 3IPVA 1JYIA 4XBNA 4DINB 4YVSC 4BMEA 4Q26A 5BNPC 2G9FA 1CVNA 1GSLA 1H2LA 1R082 4D94A 3UKVA 4WM7C 3AM2A 5KC6A 3FFZA 4XTMA 5FOJB 2AREA 3PVBB 5BNNA 2QZ3A 2WJSA 4FBFA 3GZTB 2DCJA 3ZXLA 1FATA 1UPIA 3SISA 3U4XA 2F6BA 1NY71 5KHHA 1HX6A 1S0DA 4N43B 1QJY2 1KITA 1S0CA 5EJ3A 1H2MA 1W6NA 1O3SA 1QXPA 1VALA 4KBBA 2QQPA 2R16A 1H8TC 3ZYJB 1AXKA 1H9WA 2YPJA 4RS5B 2WIIB 1CX4A 5FBZA 2WLPA 4N53C 3SCHA 1PZ7A 1JH5A 2JE9A 5DG2A 5CBLA 1QOSA 4R9DA 3VBHC 4FPCA 5E88A 3TN92 4NHMA 3AFGA 2RS53 3PMEA 2GALA 3EXUA 2B8MA 3AP9A 4QPGB 5KBFA 3ME2A 1RUF2 1VBC2 2V73A 2CWMA 3VKOA 2ZA9A 4SLIA 2O1QA 1SLLA 2VNGA 5T5JA 4JGYB 2GNTA 3VZOA 2CYFA 3E97A 2Z2SB 1AR71 1N3PA 1NA1C 5DDJ2 1VRH3 3L2HA 1G7YA 1PO13 1NOVA 1RUI3 4Q8KA 4LBMA 1S0JA 1VRH1 1Q3EA 3DN7A 2JDZA 1GNZA 2QJVA 1WLWA 1OQ1A 4X6QB 1X7NA 4QQ2A 4YW1A 4CDUA 3E6DA 4YFZA 3HAGA 5JSRA 4I30A 1JW6A 5F5QA 3ZFFA 3MF9A 4QGNA 3I2DA 5H9SA 2RR11 4JDMA 1CN1A 3ZO0B 1MACA 4Q1RA 1FOD2 3CF6E 3O0XA 2E63A 1W2UA 1LU2A 2VUJA 4GA9A 2ZTNA 2WNUA 1IPKA 4FO9A 2WFF1 3ZFGB 1F5JA 4LA2A 4LBKA 4MX3A 2RS33 3M3OA 3QACA 5CFDA 2GC0A 2ET7A 3AYCA 4PCRA 2A71A 2ZX4A 4LUKA 2HWE2 1ENQA 1LRHA 2HWB2 1IKPA 2B42B 4F7ZA 1AYM2 3WNXA 5CB7A 3CLPA 1YFUA 3ZPYA 1KJRA 1RUJ1 2OVUA 1T6GC 1FT9A 2EALA 2BNNA 1K5MC 4QGMA 1GLHA 3ZXGA 4GMP3 3D4KA 4P9IA 2GMPA 4YLZA 4COWA 2JG8B 2VULA 3V0AA 4IV1A 4HFSA 4DOUA 4CDXA 4TLFA 2XBO1 4E2QA 4LEJA 1ZZBA 3HD8B 4CDQB 1TE1B 1ND2A 3P3PA 5JSPA 4Q4W1 1ZBA2 4FOYA 4N9IA 2DV9A 4LA3A 2ERFA 3UJQA 4KWKA 4WM8B 4ASLA 4MGIE 3ZXAC 1AX0A 4OHZA 2PTMA 1D0HA 1XU2A 1QY4A 2N7GA 2ZMKA 2D44A 3N36A 5A33A 4PIXA 3FBMA 4QMAA 1HV1A 1RHI2 5AC92 1UMZA 4XJ9A 2F4PA 4IV3A 3ZX7A 1GV9A 1OOPC 2C0ZA 1EPWA 1QQP1 2Q1MA 3ZFEC 1OA2A 3BPZA 1EY2A 3K48A 1JXNA 1PO22 4YVWC 5BV6A 4MV2A 1NYWA 1OFSA 3BOWA 1G9FA 4YVSB 4NHKA 3B69A 3OYWA 3RYRA 3USUB 4BLJA 2P3JA 4RD7A 3MPBA 1WLDA 4FPGA 1LKNA 4WM7B 5H9QA 2UYBA 1JYCA 1TME3 4HBNA 5JIUA 1LHVA 1W6PB 1DFQA 2HYKA 2DFBA 3DPRA 2WNEA 1B35A 3KM5A 1X33A 1YFXA 3AZYA 1ASJ1 3VGIA 1COV3 3E5QA 4RQPA 3AP6A 3VKMA 4OHYA 2HWF3 2AZ5A 2OA2A 5DZFA 4DPNA 4CEWA 1BMV1 1EP0A 1R091 4ES8A 1MZ5A 4P9GA 1V6IA 4WZCA 5K0UA 3ETQA 1U5IA 3QOPA 5SV8A 2RE9A 2PN5A 2YMZA 4LT5A 1RUE1 2BVBA 3H1WA 4N53B 5LEJA 1BEV1 1TMF3 3CL1A 4KU8A 1NXMA 3VZKA 1GYKA 4HLTA 1RUC3 4CYDA 1VB2A 5GZGA 4EWEA 5FRAA 4Q0SA 2IXHA 3OY8A 4O9GA 3ZMOA 1FPN1 2DU0A 4ZKTB 4EWAA 4FP3A 1WW7A 1PGW2 1DIWA 4Q4V2 1EAH2 5GLTA 4JRLA 1DYKA 5HCFA 4UW3A 2YHJA 5H9PA 4AGGA 1C4RA 1UD1A 1H4HA 4RA0A 1CPMA 4B29A 2X8KA 1V6OA 1FYUA 3OJBA 3AMHA 1W6OA 4QHBA 2XHKA 1ZRRA 2TNFA 4XDQA 5GJ6A 1V9U3 3G7DA 1C3HA 3O0VA 1W6MA 2W08A 2CAUA 4ZU5A 2D6LX 1W0PA 2VPVA 1V9U1 3LA3A 1IS5A 4WVZA 4CDUC 3LB9A 4RHV1 3RMXA 4XJWA 4B3NA 3WP4A 2P2KA 1LCLA 3TYJA 2XJTA 3VUOA 2RMU3 1SQ4A 1X8EA 3R05A 4D3WA 1WMEA 2P3IA 1X36A 2OPKA 3CO2A 5IK5A 1MZFA 4A2UA 4LBOA 2D6KA 4KWJA 1QGLA 1QH6A 1O4ZA 2ZGKA 4YGDA 4C1XA 1KDKA 2CL2A 2GH2A 1ULGA 2BQPA 1AUYA 3D0SA 4LNVA 1IS6A 5FO9B 5JPNB 3D5OA 4J6GA 4GWNA 2OIIA 1CAUA 2JD4A 4YM2A 1MZEA 3FLPA 1ULFA 4AQTA 3VV1A 3CNAA 5I91A 3EO6A 2A3WA 4YNIA 1PZ8A 3OPZA 2ATFA 2XLGA 3ZMNA 3BU7A 1DQ2A 4IV1C 3ES1A 4CDXC 1J3PA 3VDDA 1DQ6A 5J48A 4NWVA 1ND2C 4JAAA 3ZN6B 4B7KA 5BXXA 2HWD3 3M3IA 3ZYIB 1HQLA 2H0VA 4JGZA 1QJU2 1LOCA 3ILRA 1UW8A 3SH4A 1RVF3 1S0IA 4AE2A 5T5LA 1G9CA 5I0RA 4PDWC 2OZ6A 1GZWB 4WVWA 2ETEA 5BY5A 4AI1A 2CGNA 1ND3B 1PK6C 3AP5A 5JLVA 1HIXA 2XL7A 3TN91 3W58A 3FX3A 5ACA2 3WG3A 1BBT2 4ZXKA 5AVAA 4EWDA 4FTBA 4NN0A 5GKAC 4GH4A 3JD72 3QH6A 5C8WA 3AMPA 3ZXJA 1OOPB 1OLRA 3H7JA 2Q0AA 1DGRN 1YWKA 2VW0A 4XQ4A 1LODA 1RUF1 3L9JT 4TZDA 4SBVA 1Z0HA 4KG8A 4G4FA 4K1YA 2R042 4YVWB 3AFKA 2VMGA 1S0BA 3NJZA 1KDMA 2GH8A 3I7DA 2ZKNA 2WL1A 4F83A 2ZAAA 3JQWA 5DDJ1 5EYXA 2A6XA 2ZJCA 1O5UA 3WG4A 4NOTA 1ENSA 2VXRA 1S0GA 3MIFA 1FMD3 2XPJA 1BK1A 2E9QA 3IWZA 3IT8A 4RQPC 3SNMA 1XU1A 4XFHA 5FQ0B 5JVVA 5HI0A 3FWEA 1LHOA 4CEWC 3S7EA 2ZGQA 1FOD1 1SCSA 1UU6A 3A0KA 4XJ8A 3QLQA 1HXS2 4J1WA 2OUHA 4GXLA 3I59A 1SFYA 1U5XA 1V70A 4FOWA 4LO7A 4XOGA 2JENA 2XH6A 5GLVA 4XIOA 1ZBE3 2HWE1 4YGCA 2HWB1 2GMMA 3WHTA 1AR93 1V6LA 2ZAHA 1AYM1 4KGQA 3GBFA 2B9UA 2WLQA 2FQPA 2BVVA 4FAGA 2WZR2 4MZUA 5K9YA 2OUJA 2XKPA 3KMHA 2RM22 2ZGMA 1O4TA 2VNRA 2PELA 3IDEA 2C9AA 3N7LA 3WDWA 3C3VA 5J7MA 4CDWA 2BWCA 2PLV2 3VN4A 2Q4SA 4ES9A 3AZXA 3KCYA 1CD3G 2I2SA 4Q0PA 3NKTA 1V6KA 4R9BA 4AXOA 4Q4Y2 4I0WB 3M4FA 1XNDA 4FTSA 4GQ7A 2D6NA 3ILFA 3V0BA 4ITCA 1OLQA 2Z5WA 2XGXA 3OF1A 4XHXA 5JIAA 1C5HA 4LHLA 1CAXA 1QOTA 5A32B 1I3HA 3WD5A 1RHI1 5AC91 2UWAA 1REFA 3W59A 4AI2A 1G9DA 2FMYA 2R062 3E5XA 4LE4A 1BVP1 4AVAA 4R4ZA 2I07B 1PVC2 1C8M3 1CJPA 1H30A 1D4M2 5KHGA 3I54A 3N7MA 3VBFA 1PO21 2NLRA 5I0TA 5JI7A 1PIV2 2IFRA 2QUOA 1M06G 1OQEA 1Z78A 4B4PA 4L97A 3B00A 4YG0A 3BTAA 4QU2A 4DY5A 3S6PA 1XRUA 4Y20A 3PTYA 1RL3A 4XEZA 1RUD2 2QDNA 1C1FA 2ZGPA 1J3RA 4MVTA 1D4VB 2HWC2 2NP0A 2EF6A 2NQYA 3GNEA 1PZ9A 5J98B 5L7OC 1FI2A 3H8UA 4BMBA 3WQ7A 2D3SA 2MEV3 2XB6C 4AVBA 1DGWA 4A7YA 1VBB2 3NV2A 4BIFA 4XF4A 1BKZA 1UN1A 4XILA 1HV0A 1VP6A 4KQ7A 3B93A 3AKTA 2DYCA 4XE9A 3SH5A 2XLAA 4PDWB 1RUG2 2WT2A 1AR83 2YY1A 4NVPA 1YXWA 5GLUA 1KS4A 3HWJA 3NV4A 4L92A 3WDYA 1PK6B 2MPFA 4GALA 1AF9A 1RMU2 1AL23 1A78A 1WLCA 2NZ9A 4H7MA 4YM0A 4JVAA 3WCRA 4AW7A 1PGW1 4HVOA 5T3NA 4BPZA 1EAH1 1MQTA 1MR5A 1CESA 3EBRA 4Q29A 3H50A 2VQAA 2WKKA 5JOXA 3I8TA 1JBCA 3AKRA 2GN7A 2DUPA 1OQDA 5I93A 3ZIWA 2PAKA 1H8VA 2D3PA 1ZNPA 1VBA3 1O7FA 2EIGA 3AMMA 1H1MA 4GULA 2A7AA 4Y1ZA 2W68A 4YG6A 3AK0A 5T54A 1LGNA 1N1TA 2WNVC 1RIRA 4AYUA 4MGZE 4Q4X3 1DDLA 2JEMA 4K6BA 2A5ZA 4MXVA 2DVAA 4JV4A 4RR3A 5D8AC 4XXAA 4NO4A 2JICA 1VAVA 4BWOA 2ZHNA 2VY0A 4M3CE 3HN1A 4XJUA 1OHFA 1PVXA 3CU7A 3WINE 2YGMA 3VBOB 3X29B 1ENXA 1ZZ7A 1GICA 2AYHA 3HT1A 1V00A 2Y0OA 3R4DB 4LBQD 5EYYA 3VBRB 4AGRA 4D7TA 2XVLA 4DY3A 5KHJA 1QDOA 4A7ZA 3FBYA 2RHPA 4D69A 3KZ4C 2ZKLA 1UCXA 1CAVB 1NCQB 2WS92 3NAPB 3JQXA 5B2GB 3MFAA 4XHBA 4HSJA 3PMSA 4XJAA 3KGZA 2JG9C 3AYAA 4IEWA 3IKWA 1DZQA 3VHPA 1VJ2A 4OULA 3CEWA 3IDBB 5BNOB 1WA4A 1EV13 5FO8B 1AYN2 3D0JA 2CWSA 3AKSA 1QJX2 5C8CA 1EV11 3TNPB 2JE7A 3LSDA 3KB5A 4XBQA 1LECA 4LBJA 1N1SA 1H2NA 1LENA 2A73B 1QJU1 1M4WA 2DF7A 2Q8OA 4TWTA 4Y24A 5GZFA 4AHYA 1NCRB 4QPIB 4XF1A 3M70A 2BTVC 2ARXA 3WP6A 4MXWB 2ZABA 4QQLA 3RS6A 1H9PA 2XJSA 1QXJA 2YXSA 1NE6A 2NN8A 1YI7A 1PNGA 1AJKA 4FPKA 3R6SA 2QCSB 1CR7A 2BFUL 4XQDA 3ASIA 2AH2A 5ACA1 1BBT1 5HCAA 1FXZA 4S2HA 4LBNA 5C4WB 3JD71 3L2YA 1ZA4A 3KQRA 1W6QA 4BE3A 1RUH2 1QF3A 1WCKA 1AR73 3HT2A 1PGSA 3FC0A 3TAYA 3CJXA 3MIEA 3WDTA 3CJIA 4D7YA 2GSYA 1QJZA 3K51A 3PVOA 4JRAA 1F8VA 4XW3A 1EPZA 3JU9A 2R041 5BPXA 1C1LA 1YLLA 1WD3A 1VBD2 4QX5A 3C2UA 4M3CA 4E9KA 4CEYA 1VBE2 2RR13 4B4RA 5IK4A 4NWWA 2WA3A 2P17A 1JOJA 4K7JA 3IMNA 2YUEA 4Z8BA 3BODA 2WFF3 4EJRA 3M7AA 2VVFA 2XVGA 5AFEA 1ZX5A 4JQRA 4KGGA 4E2GA 4LBQB 1OD5A 1UPSA 1AJOA 5L7OB 4L99A 1DGRA 1YHFA 4AI3A 3H0OA 3NVCA 1HXS1 4GB32 4DQAA 2DFCA 4XF3A 1RUJ3 2GAUA 4DXZA 1AX2A 4AHWA 3FJSA 1N1YA 5GZCA 4LE3A 1HRI3 1I1EA 3FMGA 1Z7S2 5C9AA 3IIAA 4JDOA 2XBO3 3MIGA 1QXRA 3KCXA 3DUIA 1HRI1 3WVJA 2GNDA 3RI9A 2OYZA 4Q4W3 1CAWB 3VBUC 3RG0A 4EN6B 5FDBA 3RMYA 1DZTA 3SITA 2WZR1 2X5IB 1UIKA 3VHNA 2XJPA 1RINA 5LRSA 1LOFC 2B46X 4AEMA 4FXGB 4IL7A 2RM21 5ABJB 2D40A 4AVCA 1J1LA 4Y1VA 2FBEA 2D5FA 2ZZQA 4HPKB 4WVMA 4WBBA 1UIJA 2PQQA 3VBSC 1MVEA 5EWSA 1ZZCA 1BXHA 3JUUA 1MS1A 1HDKA 2WFPA 5FREA 1DU3D 2BFUS 2WQZC 1LHWA 2DURA 3H3ZA 1QQP3 4P14A 1XYPA 4Q4Y1 2GZWA 2GU9A 2PHXA 2BUKA 1OSGA 3VL9A 4CRQA 3RYKA 5DZGA 2BNOA 2EVXA 3RDIA 3POYA 3WG1A 1E57A 4YYOA 3MF6A 2WNVB 2VOVA 3FLTA 5JOZA 2XL9A 4AEDB 1F9KA 5CFCB 3V64A 4KL1A 5LEKA 2UY8A 2HKXA 2E7TA 5D8AB 2HEYF 2W39A 1RJ7A 2R061 2O8OA 2XJRA 2KA3A 3POWA 1HRV2 2ZACA 4MH0E 4AEJA 2PHRA 1KFUL 1PVC1 1B09A 1GNHA 1MS4A 4FT8A 1ZREA 4YGEA 1YIFA 5BNNC 4BM8A 5BNPB 3QD6A 2UWBA 4XQWA 4C1WA 5J09A 1YRZA 5JZGA 4CZSA 2ES3A 2Y0IA 5SV5A 3MZHA 1FNYA 5CA6A 1ASJ3 3TWIA 4IETA 2P3KA 5IUQA