3NL1A

Crystal structure of salicylate 1,2-dioxygenase from pseudoaminobacter salicylatoxidans adducts with gentisate
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
366
structure length
366
Chain Sequence
b'QNEKLDHESVTQAMQPKDTPELRALYKSFEEESIIPLWTQLGDLMPIHPKSKAVPHVWKWSTLLRLARKSGELVPVGRGGERRALGLANPGLGGNAYISPTMWAGIQYLGPRETAPEHRHSQNAFRFVVEGEGVWTVVNGDPVRMSRGDLLLTPGWCFHGHMNDTDQPMAWIDGLDIPFSQQMDVGFFEFGSDRVTDYATPNFSRGERLWCHPGLRPLSGLQNTVASPIGAYRWEFTDRALTEQLLLEDEGQPATVAPGHAAIRYVNPTTGGDVMPTLRCEFHRLRAGTETATRNEVGSTVFQVFEGAGAVVMNGETTKLEKGDMFVVPSWVPWSLQAETQFDLFRFSDAPIMEALSFMRTKIEGQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gentisate 1,2-Dioxygenase
molecule tags Oxidoreductase
source organism Pseudaminobacter salicylatoxidans
publication title Crystal structures of salicylate 1,2-dioxygenase-substrates adducts: A step towards the comprehension of the structural basis for substrate selection in class III ring cleaving dioxygenases.
pubmed doi rcsb
total genus 103
structure length 366
sequence length 366
ec nomenclature ec 1.13.11.4: Gentisate 1,2-dioxygenase.
pdb deposition date 2010-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3nl1A01
3HT2A 3IDBB 5JAXA 4LUMA 3EJKA 2CAVA 3H3UA 3SMHA 4Z07A 1QWRA 3H7JA 3SCHA 5I0SA 1O3TA 3RNSA 2GC0A 2ATFA 1LKNA 5LRRA 4CYDA 2Y0OA 2CAUA 3CO2A 2OZ6A 1O4TA 4HVRA 4XEZA 4UBGA 4I2OA 2OPKA 4EWEA 2Z69A 2B5HA 4IERA 5FDBA 1O3SA 1OFNA 4HN0A 5AVPA 2XKOA 3BB6A 3H1MA 4QGNA 3IDCB 3I54A 3HIFA 1X8EA 5LEJA 3H7YA 4Q0SA 1QXJA 3IWZA 1ZNPA 4I09A 5C8WA 3EQEA 2QJVA 3BU7A 2ET7A 4Z82A 2FMYA 3KSCA 3S7IA 2H6BA 3IBMA 1EYBA 3FHIB 4LA3A 2MNGA 4MGKE 4UBHA 4LULA 3DL3A 1NE4A 3UKTA 2IC1A 4RD7A 1UCXA 1HW5A 4HN1A 4HLTA 3SCFA 4YARA 1WGPA 4F8AA 2CV6A 4JTNA 4WBBA 2PFWA 1PMIA 5J3UA 3KMHA 4FT8A 3FWEA 1NZCA 5LRSA 3E6BA 4MGZE 2MPFA 1XRUA 3CL1A 4WZCA 3R6SA 2BNOA 3QOPA 3RZZA 4KWKA 4XF3A 3NKTA 2Q1ZB 3S7EA 1VJ2A 4H7LA 1CAWA 4KWJA 4ZU4A 1ZZ6A 4JV4A 4JVAA 3LZZA 4MX3A 3UKNA 2FQPA 2XHKA 1FXZA 3ROUA 4L2NA 5CADA 2D40A 3IIAA 3H1YA 5KHJA 4X6QB 3RYRA 3OTFA 2WFPA 1OMIA 3ES1A 3E5QA 4IEOA 2OZJA 4O9GA 2HJIA 2D93A 1I5ZA 5JSOA 3RYPA 4XF4A 1IPKA 5J48A 2DCTA 1VR3A 3TNPB 3JZVA 5E1RA 4J1XA 2GU9A 2N7GA 3MZHA 4XETA 2QVSB 1UPIA 5F1RA 5FQ0A 2GH2A 3ST7A 4LLOA 5T3NA 4XFCA 2XL9A 4B29A 1CAVA 1UIKA 3SXWA 3ACLA 2PTMA 5FPZA 3SHRA 2ZCWA 3EHKA 2V09A 4MZUA 4XFHA 4XFFA 3G7DA 3D0SA 3M3IA 5JSRA 1Q3EA 1ZZ8A 4FAHA 1ZZCA 3KGLA 4LA2A 2XKPA 4XFIA 5K8SA 3CF6E 1IPJA 1VP6A 3DN7A 1LR5A 4TLFA 4BH9A 4E2SA 4PJYA 4XFAA 4FAGA 1CAXB 5J7MA 1YFXA 5E16A 5BUVA 4IEXA 4D7TA 2H6CA 1G6NA 2BGCA 1EP0A 1ZZBA 1RL3A 2UY8A 2ETEA 1O7FA 4I0AA 2PA7A 1J3PA 4GULA 4OFGA 4UXAA 3MDPA 3CLPA 1YWKA 5CVRA 5FQ0B 1X8MA 2GZWA 2UYAA 3DV8A 1RGSA 2GC1A 5C6CA 3BALA 4A2UA 2PHLA 3U11A 2H0VA 4R52A 4IEPA 2O8QA 4FBFA 2D5FA 2VQAA 1J58A 4XF9A 5HI0A 3NJZA 3PVBB 1TQ5A 2WC2A 2BNNA 5I0TA 3I59B 3E6DA 4HVQA 4ORFA 1EPZA 3O14A 5FLIA 1CX4A 3OF1A 1NXMA 2C0ZA 1LB2A 5CU1A 2GAUA 2XGXA 3GYDA 3E97A 2IXKA 3EBRA 3SCGA 1L3JA 5BXXA 4EROA 4QM9A 1OD5A 4BYYA 4IESA 2PHDA 3NSTA 3CEWA 4DINB 5BV6A 2B8MA 5KHGA 1ZZ9A 2QCSB 2Q0AA 3D0JA 4QX5A 4N9IA 1QXRA 1YFWA 5JCTA 4IETA 3MYXA 1YUDA 1SFNA 4IEZA 1RC6A 2BEOA 1O5LA 1O3RA 4O9EA 4HBNA 1XE7A 4R8HA 1X82A 1UD1A 4MUVA 3WW1A 4F7ZA 2OA2A 1Q43A 2VPVA 1NE6A 1Q5OA 3LA3A 2BYVE 4META 1WA4A 3BPZA 4PIYA 2UY9A 2PQQA 3I59A 2EVXA 5KBFA 3RDIA 3VHRA 1X7NA 2K0GA 2O1QA 4Q29A 3H9AA 1ZVFA 1CAUB 1ZX5A 4MGYE 1CAVB 2XL7A 4KU7A 4XFBA 4X6RB 3UKVA 5FCCA 2IXJA 2Q30A 4I3PA 4NVPA 2KXLA 2XLAA 3DKWA 3TNQA 4EWDA 4JTOA 4MV2A 1SEFA 1ZRFA 1LRHA 5I93A 3D82A 3B02A 3EO6A 4Q0VA 2IXHA 1SQ4A 4PIZA 3OCPA 3ES4A 3PNAA 4AQ2A 1ZRRA 4HVOA 4LTAA 4PIXA 2GC3A 4I0BA 4AVBA 1GQGA 2EA7A 3WW4A 1H1IA 2Z2SB 1RTVA 4Q0UA 3U0ZA 1UIJA 2BNMA 2D5HA 3L2HA 2PAMA 2OYZA 4EWAA 1J3RA 1ZREA 1FT9A 4I01A 4AXOA 4AVAA 3OGJA 1O5UA 2ZKLA 3FJSA 2Q4SA 4ZU7A 4YRDA 3N4MA 2QDRA 2PYTA 3E6CC 2CGPA 5FLJA 2F4PA 4QGLA 4ZU5A 3HT1A 3LOIA 4HZFA 4XF1A 3E5UA 3KGZA 2E9QA 1QY4A 1XE8A 4HSJA 1DZRA 4E2QA 3BCWA 1Y9QA 1J3QA 2I45A 3FZ3A 1V70A 4L11A 2PAEA 3KCCA 3PLQA 4KU8A 4KL1A 5KHHA 5EZWA 1DGRA 3NW4A 3M70A 4HMZA 3RYKA 1CAWB 2P17A 2PAKA 5KHKA 5I8SA 4YYOA 2XLGA 3H8UA 3WW2A 5D1IA 5I0UA 3NVCA 4EV0A 1DGWA 3OD0A 1O3QA 4MGIE 2IXLA 5JR7B 3LAGA 1RUOA 3WW3A 3H50A 3CJXA 1WLTA 3ZDSA 1CAXA 1J59A 3MPBA 1J1LA 2IXIA 4WVZA 1DZTA 4AVCA 3H1WA 5EFUA 3GBFA 1JUHA 4IEQA 4OLLA 4YSFA 5I8TA 1YHFA 2GC2A 2IXCA 1CAUA 4N9HA 2VECA 3USSA 3U10A 4QMAA 3FFQA 3NL1A 4LUKA 4D7SA 1ZRDA 4Q0PA 4IEWA 2ET1A 5I8YA 5LEKA 3QACA 1Y3TA 5FLHA 4Q0QA 4J1WA 1CGPA 2UYBA 5FPXA 5I91A 4BIFA 4XF0A 1YFUA 4IEYA 4XFGA 3H3ZA 1YFYA 4ONUA 3FE5A 1I6XA 3FX3A 4LEJA 1FI2A 3I7DA 4BHPA 2XLFA 5JSPA 1ZRCA 4K8FA 2MHFA 4YNIA 3RPQA 1H1MA 2EAAA 1ZZ7A 5BY5A 2HKXA 4I02A 1PM7A 2K9ZA 5KHIA 3ELNA 1EY2A 5BPXA 2QNKA 4QM8A 1GQHA 4MH0E 2B9UA 4QXKA 1U12A 4P9GA 5I0RA 3LA2A 3HQXA 1NYWA 4QGMA 1UW8A 4KWLA 3C3VA 4HSLA 3LA7A 1OI6A 4E2GA 3E5XA 1YLLA 3ETQA 4AQ6A 4IEVA 1RUNA 3S0MA 3LWCA 4IEUA
chains in the Genus database with same CATH superfamily
2NPIA 3HT2A 1RUF1 5KXDA 2D6PA 2X5IA 5JAXA 3EJKA 3THCA 5KXBA 3H3UA 4YPJA 1LGBA 2VNGA 4Z07A 3ENRA 2WNUC 4Q4X3 1VALA 3NJVA 5KWRA 2DVDA 1JHNA 5FXXA 3WCRA 4FSJA 4DO0A 2P37A 3IPVB 1O3TA 5SV8A 3JD71 5GLWA 2RJKA 2QDNA 4RGAA 4XUOA 4Z1VA 2GMMA 4D0QA 2HWD1 3POEA 2G9ZA 1UY1A 1QH7A 1H6YA 3RSJA 4M01A 3C8XA 3RJRA 3TWIA 2XMLA 3ZSJA 1HXS3 4UBGA 3KF3A 3GF6A 4I2OA 2FDHA 1RIRA 1NCQC 4GALA 4ZPIA 4BPZA 2PLV2 1QQP2 1G9DA 4OZOA 5L36A 2AC1A 4N43A 3ZX7A 2VH9A 1SZBA 1OD3A 2HWC2 3C7GA 1DHKB 1PZ8A 3ZMOA 1Q56A 5GZGA 5T52A 2XKOA 4P5YA 1BJQA 3BB6A 3H1MA 4Y1VA 2WFF2 1IKPA 1W99A 1K3IA 3KHBA 3J7LA 5LZ6A 5FO8B 5LEJA 2VMEA 2XVKA 2WNOA 5FPLA 2X5IC 5E88A 1VB4A 1QXJA 3AXEA 3NKGA 4RQPC 5FPVA 5BNPB 2LUWA 3UJOA 4YFZA 3ZYFA 3EQEA 2JX9A 1R1A1 1XNAA 4DMIA 2ET7A 2QZ2A 5FFOC 2ADDA 1ZM1A 2L9LA 3FLRA 5FBZA 3U78A 1ZRIA 2W08A 1WMXA 3K3NA 3N7MA 4KGGA 4COYA 1VRBA 1U0AA 1A34A 3W5MA 3KSCA 4FFIA 2ZGSA 4QKNA 3ZSLA 1C8M1 2WZR2 2WLQA 3FHIB 3P3PA 4UBHA 1S0IA 4JRLA 3VLBB 2FDKA 5FP8A 4HT1T 4ASMB 4LO6B 1NCQA 2AH2A 2JDZA 4K9SA 3ZYPA 3AKRA 2R071 2VOWA 1CONA 1SG3A 3N9PA 2D6LX 3ZXDA 2VZOA 4V2WA 4P9IA 1TMF3 1AYN2 2V5DA 4M3CB 1FOD1 3NJXA 3WD5A 3ZN5A 4E4SA 2GMPA 3PVEA 1XU2A 2DVFA 1VBB1 3BYWA 4CU8A 3O1MA 2FBEA 4WBBA 3GALA 3MF6A 4AEDB 2W5FA 4AL9A 4KGQA 2UWAA 4FT8A 2YPDA 5CFDC 5IFPA 5JLVA 1LHWA 3E6BA 3Q8CA 4MGZE 4BMBA 2VTXA 4UW3A 3CL1A 4DEVA 2NN8A 3R6SA 2GP3A 2BNOA 2AYHA 2DWRA 3T2TA 3UYJA 5KC5A 5JOXA 5FZFA 1G9CA 5DZEA 1CAWA 2XUMA 2YB7A 1RUE2 1ZZ6A 1ND2B 4HKOA 4L9BA 5C71A 3LZZA 4LBJA 1C5HA 2FQPA 2XHKA 3PJQA 4YVWA 1PVC2 2VC9A 1TME1 2VGDA 3ROUA 2WT0A 1IZ3A 1GQPA 5L9RA 3RG0A 1OMIA 2BUKA 4JHZA 4FP3A 1U5ZA 1NG0A 4O9GA 3TAYA 2HJIA 3JCIA 3OOXA 1SLAA 1OOPB 1DYOA 2D93A 5J1XA 1QJY1 3MW4A 4UFLA 5K9YA 1QOTA 4JKMA 2XBO2 4M00A 4LK7A 4CP2A 4HK8A 1IPKA 3TNPB 5IVEA 1ASJ1 2JDMA 4K21A 2VZ1A 2WN3A 4W8JA 4FPJA 3ZKYA 5IK5A 2CY6A 5CFDA 1H8TB 2WZ8A 4XETA 3PUSA 3T08A 3MZHA 2D6KA 1HRI1 4GAZA 2D98A 1DYKA 2W92A 3JUUA 2VW0A 2OPWA 4LLOA 3WG4A 4XFCA 4CDQC 4S2HA 4A3ZA 1CAVA 5FZ9A 3SXWA 1HKDA 4OHVA 5FPZA 2CWMA 4PBPA 4AI9A 2HWD3 5FXZA 2VUJA 3B93A 4RN5A 5BNQA 2KR2A 1XNBA 3T2PA 3WV6A 1WUVA 3B7MA 1HRV3 3AMHA 1PGW1 2JDNA 3KCYA 1UZYA 5JSRA 1Q3EA 3T09A 4QXBA 4CU7A 1UU6A 3VD9A 1EAH3 4CEWB 3M8LA 1V6IA 2VUAA 4JAAA 1HIXA 2YPJA 1HRV2 3MIBA 4LA2A 4N7IA 4OYUA 4XDOA 2XKPA 4PCRA 1QJZA 3A0KA 4XDPA 5IJRA 3WQ7A 4MG2A 3KV5A 1VP6A 3DN7A 3E1F1 4GXLA 4AHYA 4B3NA 2LRPA 4XFAA 5A80A 3ZFGB 3URFA 1DQ4A 3QH7A 1YFXA 4QB1A 4IDZA 4Y5Z0 4D7YA 4CZSA 4ZZ8A 1DG6A 5BUVA 1SHWB 2ZABA 2BGCA 3LEIA 1EP0A 4K6BA 4LIUA 4HPKA 5FOBB 2UY8A 3AX4A 3HBKA 3MI8A 4I0AA 3IZOA 5DUVA 3USUA 4BMEA 1H30A 3MEPA 5IAXA 3AM2A 1J3PA 2FDGA 3K4DA 1PNFA 3J7NA 4UXAA 3WXPA 1YRZA 1QJY3 1NY72 2ARBA 2R7EB 2JB8A 4L92A 1WW7A 2G9FA 2PELA 2ZGQA 3K4ZA 1GSLA 3LEMA 1WBLA 5FQ0B 1L7QA 5A32B 3T3YA 4Z2AA 2C5DA 4ZONA 1REDA 1GV9A 1RGSA 3AP6A 2DBNA 1C8M2 3C7EA 3WDUA 4UT5A 4WVVA 1WD4A 5A6ZA 5F32A 1GNYA 2QQOA 1HB1A 2P34A 5CB7A 4RGKA 2W68A 3HNYM 3H3LA 4FBFA 3T4HB 2VQAA 2LALA 1J58A 3GZTB 3PVBB 1AHSA 5BNOA 3SITA 1JOBA 4GD4A 2VOTA 1LCLA 3I59B 4CDUC 2NQYA 1S1AA 4B4RA 1QHDA 3VBOC 5JUVA 1H2NA 3VZJA 2VVDA 4RSUA 3O14A 1OUXA 1NXMA 1ASJ3 5A32A 2C0ZA 3AYEA 3GCWA 4YW1A 4IE6A 5C5TA 3VBSA 1ENRA 1GOFA 1LOBA 2JWPA 3GYDA 1ND3C 3N9QA 3SCGA 1STMA 5BNNC 4IV3A 1AYM1 5DG2A 1T6GC 4LQRA 2X5IB 4NHKA 4OZXA 2JENA 3J4UH 4CDQA 4CXYA 5BV6A 1CPMA 4E4DX 5KHGA 1YYNA 2WWJA 3ZVXA 3KT1A 3KWVA 3I3MA 3NV4A 4XQDA 4N53B 3S5QA 1YEWA 1H1AA 1OT5A 1YUDA 4IEZA 2HWB3 4BXSV 4PDWA 2DF7A 1FAYA 2WR9A 4NWWA 4AFAA 1NXD1 5EWSA 2WYFA 1NA1B 4BQ5A 2QQWA 3B5LB 3DPRC 1X82A 3ALQA 4MUVA 4WM7C 1PGL1 1E5SA 4F7ZA 3UGHA 2AUYA 2XJVA 3JBG1 3AFKA 4CDUA 2D3SA 1U5YA 2QUOA 1LGCA 1Q5OA 2VOKA 3GBGA 3MIEA 3POBA 3LA3A 4LKSA 4B7EA 3BPZA 3NV1A 4PIYA 2PQQA 3ATGA 3N3HA 1AYN3 4HETA 1N1YA 2QQUA 2ZZQA 2ARXA 3JBG3 4WM8B 1T6BX 2K0GA 2EIDA 2O1QA 1Y4WA 2WFF3 1ZVFA 1Z7S2 2B46X 4XQWA 3O0WA 5F9TA 4QWNA 4MGYE 1CAVB 4FPKA 1LTEA 2HWC3 3HJRA 4KU7A 1UY0A 1UY2A 2AR6A 2WJSA 5L7OC 4X6RB 3IN9A 4CEYB 4XBQA 2X8KA 1C1FA 2RJ2A 2HWF2 2IXJA 4FQZA 2ZX3A 1W06A 4UW4A 4I3PA 4NVPA 1SBFA 1B35C 2MEV1 1IS6A 4XJ9A 1ZBA3 1TME2 1LJ7A 1HXS2 1W0PA 4AEDC 3B02A 2P4EA 3EO6A 4Q0VA 4AQSA 1K5MC 4E8DA 1SQ4A 4YM0A 4FXGB 1O8SA 3U1XA 1WLCA 2XQXA 3SH4A 3CHXA 5L19A 2E33A 1G7YA 3ZXEA 4PDWB 1XNTA 1DCSA 2BERA 4URTA 1H1IA 1RTVA 2G1MA 4Q0UA 4W6YA 1UIJA 4L8QA 5FZIA 4TZDA 5K0UC 1Y7BA 2CGNA 2EIEA 3BU0A 1HB2A 3FMGA 5FMBA 2NZ9A 1VBE2 3RZJA 1ND2A 1XSRA 3P5BA 1DGLA 1PMJX 5KR7A 4M4RA 4CDUB 5FZ1A 4AVAA 3OGJA 1O5UA 1UPSA 1P8JA 2W46A 1OH3A 3FJSA 4JCKA 5DQ0A 3CJIA 2Q4SA 1O91A 2DUPA 4AHZA 3N4MA 1W9SA 4QX8A 3RMYA 5CEHA 2PYTA 2VCAA 4BJ0A 2E32A 3OGGA 2R30A 2PMWB 4RYDA 4Z2WA 3WNNA 2JDUA 5BNPC 5EHDA 4WVWA 3VKFC 4A7YA 4QGLA 4RA0A 4AEDA 5IVFA 4ZU5A 3HT1A 5DPNA 5H9RA 2BJSA 1OH4A 4XF1A 1UF2C 3KGZA 2E9QA 1W03A 3WP3A 4AR2A 1US3A 1W6NA 1SDWA 2PHUA 1UYPA 3BCWA 2OUHA 5LK5A 2ZHKA 2I45A 3AJZA 1GZCA 1BQPA 4LLFA 4QQ2A 4OCTA 4KL1A 5FZBA 1PX4A 1YQ8A 2BBAA 1OURA 4EN0A 3BUCA 1SFPA 3O1RA 4HMZA 5CKMA 3RYKA 4EN7B 1QNWA 2PAKA 5T54A 4YYOA 3GCXA 2XLGA 2LS6A 4PI2A 4BOWA 4DZGA 4JGZC 5JZGC 3HQRA 3P1IA 1QH6A 4OQ9A 2IXLA 4UOJA 5TSWA 1KFXL 3UGGA 1WMDA 3Q8FA 1OHFA 3VD3A 3DCQA 3LEKA 4RL7A 3VBRC 3Q8EA 5FJHA 5ABJA 2R32A 2ZGNA 2RG4A 4JC1A 4GB32 5FMOS 5K4LA 3T1LA 4M3CE 4AI0A 1WLTA 3ZYGA 3ACGA 5FP3A 1XQNA 3OB8A 1JS9A 4X8NA 5FUNA 2XXZA 3ILNA 4H55A 1LESA 5DUWA 4ATFA 2RVAA 4N43B 4LBQD 4K40A 4JGYB 4WVZA 2OQ6A 1O8PA 5FZCA 5ERLA 3LIGA 4B4PA 2F17A 5EJ1B 2A3WA 1UMHA 4K3UA 1V00A 4XJWA 5JXIA 3H1WA 1V6LA 4FOVA 1HDKA 1Z0HA 2VNOA 4XTPA 5GZDA 4DOUA 2JDKA 1OOPC 1NX9A 2RS53 4BISA 4IEQA 1IG3A 5I8TA 2ZPXA 2OIIA 4Q4W2 2IXCA 3GJBA 5FO9B 4N9HA 5C3OA 5GKAC 3USSA 3HN3A 3WNOA 4D69A 4ZZ5A 1W0NA 4QAWA 2XDVA 5GLTA 5A6XA 1VRH1 4IE7A 3NO8A 2WAOA 5JI7A 3FN9A 3ZOIA 3KLSA 1TME3 4NE9A 3SKVA 3S5AA 2VZSA 4Q26A 1HLCA 1AL21 4FOQA 4JDMA 4QU2A 5FLHA 3MF9A 2BDRA 1PGW2 2Q1MA 3NWKA 3VKMA 4ASKA 1HX6A 1SLLA 3OY8A 1BYHA 1Q8SA 1CGPA 1BVP1 2RS52 1AR72 2DVGA 1UX7A 5FPXA 4GKXA 1POV0 2FDIA 4YM1A 4Z8BA 3LCPA 3HD8B 1YFYA 4XDQA 3ZYJB 1Y9GA 4ONUA 1DF0A 1I6XA 5FMCA 3JBG2 3NNLA 1W39A 1FI2A 1GZ9A 2JG8B 2JIJA 3I7DA 1QIQA 2E7QA 1WW6A 1ZRCA 2A70A 3RPQA 4YNIA 3ILRA 1XJAA 4AF9A 2VW2A 1WD3A 1AR71 3THPA 3R05A 5BY5A 5IVCA 3VD5A 5DABA 1OKQA 4WZFA 1WCUA 1LOFA 1UWWA 1LHVA 4P02B 2Y6HA 4YGEA 5FZAA 1N1VA 2HWB2 1RUJ2 3PIGA 2ENRA 1PHMA 2EXHA 3ME2A 2WYSA 2R1DA 2QNKA 3PVOA 5ABJB 4YG6A 4ES8A 4MH0E 1L7LA 2B9UA 1H2MA 1OUSA 1ZBE3 3AVSA 5FYSA 2J1UA 5FUPA 4QXCA 2BRTA 3VHNA 3S30A 1DQ1A 3NQHA 1SBDA 1F5FA 4M3CA 1ONAA 1CWPA 3M3OA 4INDA 4KWLA 3C3VA 4HSLA 3GNEA 4FCAA 1AVBA 4D6SA 4S2FA 2A3XA 4QT6A 5HCHA 1WCKA 1YLLA 2WNVA 3ETQA 3LE0A 4QPIB 3S0MA 3LWCA 1C3HA 3AMNA 4ZXEA 4BQ3A 5C8CA 5BNOB 2XJRA 1UQXA 3I2GA 4LUMA 3N9LA 2D6OX 3PTYA 2AEZA 4R9BA 1FOD3 2XPJA 2DURA 3JB4C 2VZTA 3I8TA 1GBGA 1LOFC 4CCNA 2RJLA 5FP9A 2DVAA 2WKKA 1DZQA 4OI2A 5A1LA 2VBPA 3M3CA 4MLOA 5LK7B 1HV1A 1RHI3 1D4VB 1S4CA 2Q5TA 4Y22A 5IW0A 4CYDA 3ETPA 5FZHA 2CAUA 1JHJA 1KITA 1YQ5A 2P3IA 3LPGA 4XILA 3G6JB 2OZ6A 1O4TA 1C8M3 4HVRA 5C9AB 4GA9A 4D94A 4OHXA 5DAPA 4EWEA 1K5MB 1QJU1 1UY4A 2ZGRA 2YC2A 3NMBA 4IERA 3AP9A 1BK0A 5EYXA 4CP9B 2DU1A 2VMCA 3SISA 2JICA 4Y1ZA 3RFRA 1G86A 1SPPB 4YVSA 2O14A 4TTGA 3SLIA 3VKNA 3MICA 4AVVA 5FR3A 5AVPA 2YGMA 2J1SA 1JMUB 1N47A 4KWUA 1N1SA 1X8EA 1R1A2 1NAEA 2ZX2A 2RS11 3H7YA 4HXCA 4XOGA 1JN2P 3ZM8A 5FIXA 5JIUA 1Y43B 5C8WA 1HRV1 3BOWA 2WS93 4QXHA 1MS9A 1ZBA2 3IPVA 3NV3A 5ANQA 4DUVA 3NAPB 1S2KA 2FMYA 4FOYA 3S7IA 5HXMA 3IBMA 3CU7A 4CEYC 5DAXA 3THTA 1W2NA 1EYBA 4LA3A 2JDHA 2MNGA 4MGKE 2PLV1 1W04A 4XURA 4DRVA 4LULA 4PF1A 3PVNA 3POFA 5FZOB 4P14A 4ITCA 4NIHA 3ZSKA 1RMU2 2YFUA 3AVRA 5C3RA 3C2UA 3OPZA 4HN1A 4TLGA 2XJTA 3LDRA 1XNKA 3J8F1 4YVSC 2Y64A 4DXZA 4YARA 2HWD2 1FNYA 3PJYA 4YM2A 1RUF3 2BV4A 3KV9A 4F8AA 2CYFA 5FYMA 1CIWA 2QQPA 4YZ1A 1AR92 1MZ5A 1JZ5A 3SH5A 4Q2FA 1PMIA 4GKYA 4C1WA 3OYWB 3KMHA 3ZFFC 1GYKA 3AKPA 3VHOA 4LHNA 5FYZA 4F83A 4QPYA 2JDPA 1MVQA 3B9CA 4NRQA 5ACA2 2RM23 4NHLA 4WZCA 1EV13 3RWNA 1ULDA 1AR81 1BEV2 4BQYA 2K2SA 3ZSEA 1DFQA 4XF3A 3NKTA 2Q1ZB 1VJ2A 2EXKA 2IVIB 5E89A 4ZU4A 1RUG1 1C4RA 4JV4A 3O5SA 4QB6A 3VBRB 4URAA 2WS91 3VZLA 3UKNA 3BVCA 4XCBA 1KQRA 5A7OA 3WUCA 1VLNA 4ET7A 4RR3B 1HQWA 2R061 1G8WA 3RZMA 1UU5A 1V6JA 2VVFA 2OZJA 3C7HA 3O7OA 1MZ6A 4Y4RA 1Z7S1 1XXNA 1I5ZA 3W5NA 3M4FA 1YQ2A 3RYPA 1UL9A 3MGUA 3VDDC 5F7UA 1WKYA 1SMVA 1BKZA 5AC92 1VR3A 3JZVA 1EV12 3WZ1A 4IGQA 1YIPA 2GU9A 2N7GA 4QX2A 1MS5A 4V2VA 4BE3A 4Y24A 1LEDA 3CBNA 3INAA 5FOJB 3OEBA 1RVF1 3PDQA 1XSQA 3TN93 1AR93 3ST7A 2BU9A 5T3NA 2XL9A 5J36A 1ODNA 3ZO0B 1OVPA 1DLCA 1UIKA 1UKRA 2PTMA 4FPYA 3ZLIA 5FPAA 4DS0A 4QQOA 3V0BB 3EHKA 2V09A 2ZEXA 4IL7A 4M0HA 4S2DA 4Y1XA 2VNVA 4IV3C 4N53C 1DDLA 1K5MA 4ZXKA 4LBNA 1PMHX 4P9JA 2BFUL 5FZDA 3ZFEA 5IVBA 3SKJE 5AFBA 2X53S 2Y0IA 3G7DA 1UX6A 3K48A 5DZGA 1FX5A 2A5ZA 3DKQA 2DFBA 5LA9A 4DUXA 1VE0A 2YV8A 4MGTA 4HANA 5DDJ3 1ZZ8A 2P3KA 4EJRA 2E31A 2A6VA 3DYOA 2ZAAA 2WZR3 1OLQA 4PLNA 2WL1A 2XWJB 1OBNA 2PN5A 3POGA 4TLFA 3N9OA 4BH9A 4RS5C 1XYNA 3LDKA 3APBA 1RUC1 4DY3A 1LNSA 5DAVA 4DUWA 5J7MA 5JPNB 2DUQA 1C5IA 4LMFA 1FYUA 4NHXA 1VB2A 5F3EA 2HWC1 2Z42A 5FY1A 2GNDA 3BTYA 1BBT1 3W21A 5K0UB 3VL9A 4CXWA 2WNUB 3O0XA 1W2TA 3Q9OA 3ZFGA 1NOVA 2BGPA 2CGOA 4GULA 2LW8A 3ZIXA 4OFGA 4EZ4A 3ZXAC 2Y6KA 3LD8A 2W1WA 2C9KA 3ZFFA 5JXHA 1MEC1 1HV0A 2QFEA 3AK0A 5CVRA 1DYPA 1QQP3 1X8MA 4AI1A 5HCFA 1PO23 3ZXGA 3DF0A 4RFT0 4GH4C 4B1LA 5C8CB 1OQDA 2A6XA 5I0DA 1ULOA 1CR7A 5C70A 3HNMA 2E53A 3WOGA 2J1RA 3KT4A 5C6CA 5IT6A 4A6SA 2B7YA 1LU1A 3RJ2X 4A2UA 1OLMA 2A6ZA 2PHLA 5LY2A 2J42A 1SBEA 4IEPA 2O8QA 4O65A 3I97A 1COV3 2VBBA 2VCCA 1AL0G 1QJX3 1V6KA 1EV11 3MIDA 2ZAHA 3D5OA 4O7XA 4XF9A 2ZBJA 4N7UA 2JE8A 4YGDA 4BM8A 1TQ5A 4CCJA 1W28A 3R4SA 4ZY9A 2W94A 1MVEA 4W65A 4LBMA 4RR3A 4HVQA 4UWDA 3Q8AA 3B94A 3W9AA 3SNMA 3HAGA 2XBO3 2JKXA 3VBSC 1CX4A 2R062 3OF1A 5DDJ1 2SBAA 1LAJA 1LB2A 5CU1A 3VBRA 5C3PA 2NM1A 1F4HA 5CIRA 2C1FA 3SH3A 2JDYA 1ND3A 1V9U3 2B9VA 5BNNA 1MZFA 1W6QA 5L9BA 4EQVA 3E97A 1JXNA 2IXKA 3EBRA 3AJYA 1SLTA 3FL7A 3IM0A 3OY8B 4QQHA 4CCEA 1OD5A 4IESA 3WCSA 3LGRA 3CEWA 4NAMA 1UO9A 4DINB 2B8MA 1ZZ9A 2QCSB 1PO22 2Q0AA 2YHJA 2ZKNA 3D0JA 1WCDJ 4UW6A 4Y1YA 2WWUA 1QXRA 1DP0A 4TN7A 5JCTA 4IV1B 3X29B 4KG8A 2OXBA 3MYXA 1POV1 1SFNA 1MS8A 2BEOA 1O5LA 3FLTA 2BFUS 3QH6A 3HPNA 3ASIA 5DN2A 5JOYA 4R8HA 1UD1A 1CX1A 4HK9A 2FCVA 4XPVA 3J8F2 2BYVE 4QB2A 4META 3VGIA 1GWKA 1VBA3 1RHI1 2UY9A 3KS7A 4R9DA 2IUWA 5LA2A 4OUEA 4GB31 3VBUB 2WSVA 2EVXA 3DYPA 4WVMB 4A42A 1NQDA 1TG7A 3POSA 5D21A 1AXZA 3WNKA 1X7NA 2YBKA 3FUQA 4D6RA 2ZGTA 4Q29A 4E9KA 3NAPA 2R0HA 1ZX5A 3N7LA 3AZZA 5DDJ2 1HB3A 3K77A 4AI8A 3M7AA 2OT7A 2Y6JA 2E26A 2YBSA 2VO5A 3JU9A 1GZWA 2XLAA 3DKWA 1LECA 1XNDA 2CU5A 4A45A 4XE9A 2EIGA 3CDZB 5I93A 3D82A 2CDOA 5DXDA 1KJLA 1G9FA 4XHBA 3ZFFB 1DU3D 2Q8CA 1KJRA 1LHNA 2BWAA 3OCPA 4JGYA 2FZ2A 3J9SA 3PNAA 4NR1A 4FP2A 4CP9A 4JQRA 5EIYB 1IHMA 1ZRRA 3WQBA 4XACA 4HVOA 3T30A 2Z79A 4I0BA 3T0AA 5EV7A 5H9PA 1GQGA 3WW4A 4XZPA 1F5JA 3VKLA 3LEGA 5IK8A 1URXA 2E51A 2ERFA 5CYYA 1ND2C 3W58A 3LFIA 3VZKA 3TBDA 3ZSMA 4JZRA 5LY1A 5LWBA 1V6OA 4N8MA 2OYZA 1OKOA 4C0BA 2PLV3 2WT2A 4CUGA 1ZREA 4JDNA 1JYWA 1WBFA 4RR3C 4IXLA 4AXOA 1G9AA 2ZKLA 3KQRA 4EN9B 2E6VA 4OI4A 1IS5A 4IE0A 3VKOA 2QDRA 4AVTA 1A8DA 3ORJA 4YM3A 1A6CA 2YY1A 3E6CC 2VQUA 4W4ZA 1BXHA 2DBIA 5IWFA 5FYUA 1K45A 2Y26A 3EXUA 1BHGA 4PT6A 3B01A 1W9YA 4AHXA 3E5UA 5EPAA 4SBVA 2B39A 1NT0A 1BEV3 5FYYA 5H9QA 2WA3A 1XE8A 4CUAA 1W6PA 5GZFA 5LASA 3BOPA 4HKWA 1J3QA 1A8MA 1OF3A 3D8CA 4LKEA 5E8AA 5FYIA 5LA0A 4FTSA 2Q8DA 2PAEA 2PHWA 1F15A 3PLQA 4KU8A 4N90A 1KD7A 2BOJA 4FFHA 5FPUA 5KHHA 4FFGA 2R073 5EZWA 4JQTA 2MEV2 3NW4A 5C4WA 1EUTA 4KI5M 1E57A 2P1BA 5AVAA 1O59A 1QU0A 5A3WA 2P17A 3K2OA 1LU2A 5GZCA 3KT7A 2WO3A 5I8SA 2D43A 2XUEA 3R4DB 4LHSA 4M0NA 1DGWA 1RITA 3OD0A 2TEPA 5FUIA 4AEMA 4CE8A 1O4YA 2I07B 1WW4A 3H42B 5IYYA 3LAGA 3WF0A 3OUHA 1RUOA 3D4KA 2R0FA 4YZ3A 1M4WA 4GWMA 4QHZA 1VBB3 3N36A 2BWCA 5DG1A 3WW3A 5T55A 2YU2A 3M3QA 2WZPP 4C90A 2NMOA 1AR63 3CJXA 2VY0A 1VRH3 4AGGA 2HEWF 1KS4A 1DQ5A 2W47A 1QF3A 5A1AA 4UW5A 2VVEA 2B42B 3KF5A 1J59A 3MPBA 3N9NA 5A7WB 4PI0A 2IXIA 4NO4A 1F9KA 4XAEA 5T5OA 3QBQA 2F4LA 4MO3M 2VU9A 2WNEA 4Q4Y2 2RS51 3L9JT 4AVCA 4MVTA 2PHXA 1VPHA 2YU1A 3OYWA 4XUNA 4JGYC 1VBE3 4BCUA 2VG9A 4S2GA 4XUPA 2ADEA 2CNAA 3BGAA 4I30A 4Q4W1 1HXS1 5C8CC 4CEYA 4YVWC 2HEYF 3VDDB 5IVYA 3GHMA 5FPBA 2GC2A 3PIJA 3AZXA 3S6PA 1N3PA 1R1ZA 2NP0A 3MV11 1OQEA 3AFGA 3ZPYA 2OQ7A 1J84A 4QMAA 1CIYA 4LUKA 4CVUA 4XABA 4BDVB 3N7JA 5B4XA 4Q0PA 5F37A 5I8YA 3T2OA 1PNGA 1QDCA 4A4AA 3WF4A 3AP5A 3LSEA 5FWEA 4ZKTB 2CHHA 1Y3TA 4E8CA 3MHZA 3TB0A 4BZ4A 2GNMA 4Q0QA 3RZKA 2X29A 1VBB2 4IV3B 1CJDA 2E63A 1FOD2 2RDNA 3TEWA 4RS5B 3OPWA 2GDFA 4R4XA 5T5JA 4G3YC 1CJPA 2ZMKA 2JXAA 4OHYA 1PGL2 3BTXA 4LOTA 3FE5A 4A44A 1WWYA 4BHPA 1GOHA 1JBCA 3WDVA 2MHFA 4LIVA 2VUDA 1JYVA 4TYSA 1S0BA 2XHNA 4BQ2A 2EAAA 1YNAA 3EB7A 1RINA 2RV9A 4LBKA 4LJHA 2Q8OA 1VMFA 3KV6A 3A23A 3RWKX 4FXKB 3AMQA 2DYCA 2VXRA 4XMAA 3T4VA 3LFMA 3UL2A 4CPBD 4CPBA 2G4IA 2K9ZA 5C9AA 1HN1A 3U4XA 3CZJA 3ILFA 2JG9A 3VBFC 5ISLA 1WW5A 4XIKA 2BTVC 3ZYIB 4QXKA 1X33A 1U12A 4BK4A 5CFCB 4N43C 3IKWA 4P9GA 1FMD2 2BGOA 3LA2A 4DFSA 5A70A 5JXGA 1W6NB 1NYWA 2PHFA 1ENXA 4LO4B 4MSVA 2RS32 1ODMA 1UU4A 1UW8A 5FYTA 4DB5A 2J1VA 5FBJA 2W95A 4AZZA 4XUQA 1RUH2 1FV2A 4NWVA 3WP5A 4E2GA 1GWLA 1ZA7A 2WO7A 3CIHA 2EICA 1RUNA 4ARYA 1MS4A 4QKFA 1VBC1 1H8TC 4AI2A 3IDBB 3U75A 3NV2A 5FK8A 4BA6A 2CAVA 3CJIB 1QWRA 3AKSA 1H2KA 4AK3A 1JU3A 3WT3A 3CQOA 3RNSA 4EN8B 5JXJA 1F35A 3FHQA 2GC0A 1S0FA 1MEC3 2A71A 2QQIA 4Q1RA 1LKNA 3I3QA 4ZS2A 4AAXA 5C9AC 3OD4A 1NZIA 4K7JA 2Y0OA 3I49A 5EJ3A 4KBZA 4XEZA 1JZ3A 2XVLA 3VDCA 2OPKA 4AFBA 4J6GA 1PIV1 1AL22 3MUY1 2I2SA 4WM7B 1R091 1QJY2 3OPTA 4HN0A 1KXGA 2RMU3 3ZFGC 2YFZA 5M0TA 3VBHB 3MLJA 4R9AA 3HIFA 3IMNA 5T5LA 4AFMA 5A3TA 3UNPA 4Q0SA 4P9YA 4QPWA 3IWZA 2PXJA 3K51A 1MQTB 1ZNPA 1N3QA 1XBFA 1HJFA 4LBOA 3BU7A 2HWF1 4R4ZA 4Z82A 5ACA1 4QX3A 3WF3A 3I2FA 2VAUA 4XUTA 3KZ4C 1ZBE1 3ZDVA 3Q8BA 4FPCA 1S55A 1S0DA 1R64A 2VNRA 2XG3A 4A6OA 1OPOA 1DBNA 4JGZB 5GJ6A 5JZGB 1AZDA 1NE4A 2F6BA 1GANA 2GN7A 2OUJA 2WQ8A 3A7QA 4K8RB 1N1TA 2GMEA 3FHAA 4BWOA 2DVBA 2VZVA 2IC1A 4RD7A 1UCXA 2A6WA 4L99A 1GU3A 4FPEA 4FPFA 4GWIA 5LBCA 4NIAA 3VBFA 4AW7A 1JOJA 3ZXKA 2B4KA 3OBAA 1AUYA 1GP6A 1ULPA 4Q4X1 4CDWC 4KBBA 4GJZA 5EQUA 3ACIA 2XBO1 2GN3A 2R072 1U5XA 4O61A 2J22A 3FFZA 1F4AA 1VBC3 1GNHA 3GGLA 4W50A 2FDJA 4M3CF 5L7OB 2AENA 1UZ0A 2R063 4YVWB 1KS5A 2A7AA 1HN0A 1FMD1 3GZUC 2MPFA 1XPWA 1XRUA 3IAQA 1H9PA 4P08A 3AYAA 3QOPA 5FP7A 1MPXA 1V6MA 2R043 1S0CA 3S7EA 5CFCA 2PQSA 5J96B 4H7LA 1AYM2 4LKFA 2W3JA 2H0BA 2Y33A 5DZFA 3I2HA 3PUHA 1FXZA 1C8NA 4L2NA 5CADA 4TWTA 5HV4A 2D40A 1DQ6A 5C7GA 3H1YA 5KHJA 4DIQA 2VMGA 3OTFA 2D97A 1PVC3 2WFPA 3HN1A 5IK7A 5A7SA 1ACCA 2RDSA 1KGYA 5D8AB 4C1XA 3WY6A 4CU9A 4AFDA 1TE1B 4Y4YA 5JSOA 1EAH1 4XF4A 4YFWA 2AGSA 2P3JA 4PQ9A 4I3GA 5D2AA 3OGRA 5J48A 4BQ1A 4FO9A 1PK6B 4LE3A 1NCQB 1LOEA 1X9PA 1MS0A 1YJKA 4FPHA 4GMP1 4LORA 4BQ4A 2OX0A 2W0XA 3CZUA 5BYNA 1YQCA 2RDRA 2ZZJA 2QVSB 4RHV3 3K3OA 3KCXA 4FVVA 2JD4A 4MGQA 5A6YA 1GNZA 5FQ0A 1JZ2A 1W2AX 3CMGA 4CDXC 1YCIA 2DCKA 4XCAA 2WQ4A 5FK7A 4OHZA 5LBEA 3BTAA 4PBOA 4C0HA 2WZR1 3SHRA 1ST8A 2ZCWA 4QPGB 3ZFEC 1QOSA 4MZUA 3U07A 2VJXA 4XFHA 5A3MA 3IIIA 2WABA 1WLWA 3LDBA 3WNLA 2GP5A 2AACA 4UYBA 2DTWA 4HPKB 3KQ4B 4YLZA 4IGPA 1VIWB 2PHRA 3POYA 2VR4A 4XMIA 3T0DA 4D6QA 1RUD3 3ON7A 3ZXFA 2XJUA 3KGLA 1YIFA 3W59A 1VBA1 1HQNA 4EE2A 4RS5A 4Y3OA 4V1PA 1IPJA 4OUMA 4DEQA 3VBFB 5A1FA 2VE1A 4QD2A 2HYXA 4PJYA 3UETA 4FAGA 2E7AA 1D4M3 1CAXB 4QKBA 2QE3A 4NRPA 2HWE1 2Y34A 1F8VA 3N9MA 4JGZA 5JZGA 2VOVA 3TYJA 1AXYA 5A3UA 3O1VA 3OGSA 1UYXA 2GH8A 1R083 2VOXA 4OULA 1DLLA 1D0HA 1CQ9A 5JOZA 4KG0A 2ETEA 2ARCA 4AWDA 1J83A 1GP4A 2ZEZA 3U14A 3NAPC 1VAVA 1YC61 1YWKA 2RS13 5AC93 3GM8A 1GP5A 3A4UA 3AKTA 1AX0A 3AKQA 3KVBA 4U2AA 4XHXA 2QQKA 3J7MA 2UYAA 2VBDA 2Y6GA 4LHLA 3S57A 3WG3A 4PDWC 1TEIA 2X10A 3BALA 1W9WA 3UGFA 4DRRA 1S0JA 3AB0A 3U11A 2D44A 3K4AA 4R52A 4WM7A 2CL2A 1NA1A 5C4WC 2D5FA 1E5IA 1JOPA 1OOPA 1ZBA1 1ASJ2 4WM8A 1VAKA 4RHV2 5HI0A 2NMNA 5AFEA 1D7PM 2WC2A 2BNNA 5I0TA 5J37A 3TN91 5C4WB 3E6DA 3IAPA 5G04L 4OQ8A 5C3SA 2ZHMA 4CDQB 2KD7A 3RI9A 2HYKA 3LSDA 4MYEA 4ISQA 5FZGA 4COUA 2XGXA 2VUCA 1MS3A 2P5BA 5IVVA 2YG0A 3IDAA 1UNBA 2V73A 1L3JA 2WNVC 1PM4A 3ZYHA 4HFSA 3NSTA 1QJU2 2D3PA 5FZOA 4K20A 1OLRA 2EALA 4QX5A 1GWMA 1YO8A 4P9XA 5FYVA 5HPOA 4NPLA 2ZEYA 3KM5A 1AXKA 4IETA 4ISRA 4L97A 5IAVA 3ZIWA 1RUG3 1UZZA 4Q5OA 4A3XA 2XWBB 3LQCA 3HNBM 4CCOA 2G19A 2VMHA 4HBNA 4O9EA 4AOCA 4KH9A 1H9WA 4D8MA 5HV0A 4DPNA 4DY5A 2GNTA 3HMYA 4CU6A 3WW1A 4XBLA 2OA2A 4UF0B 2I74A 1VBC2 1G9BA 4AEKA 3SEEA 1TVGA 4LNVA 4CCLA 1WA4A 1XNCA 2FCTA 1RUH1 1XE0A 2WDBA 3VZMA 3I59A 4SLIA 5KBFA 1QMJA 4ZHNA 3O12A 4FQ4A 3PU3A 1UYZA 1YQ6A 3RDIA 3VHRA 1TMF1 5JWPA 4BQWA 3H9AA 5LW9A 4ZS3A 5T5PA 3KHCA 1EAH2 3USUB 1PIV3 3OUJA 4XFBA 3VD7A 1H2LA 3MLLA 4XIOA 5BNPA 1T2XA 4LO5B 4UFMA 3UKVA 1NLRA 1NUKA 3MUZ1 3PHMA 5FCCA 4DNYA 2VTFA 2Q30A 4QU1A 5EYYA 4ATEA 2A1XA 3TNQA 2LTNA 1JYTA 3PMEA 3RZHA 4JTOA 3V64A 4W6WA 4MV2A 1SEFA 4CSWA 2DTYA 4COZA 1PK6A 3AC0A 3GJAA 2IXHA 3GHNA 1S0EA 3ES4A 2WFF1 4XJAA 2ES3A 4D3WA 1RHI2 1OA4A 3GZEA 2NYYA 1H4HA 2Z2SB 4XZUG 4AYUA 3VB9A 3TOJA 3V65A 3ZR5A 3BI3A 1CD3G 4PF5A 2C24A 4OMDA 3EYPA 2PAMA 1J1TA 5GM0A 1FT9A 4I01A 4YW2A 3TEZA 4BB3A 1JI6A 1SFYA 2BBVA 3RMXA 1ULGA 2A6YA 4Y5TA 1LHOA 1LGNA 3MIGA 5FAXA 1W8NA 4E4ZA 4ZU7A 4YRDA 1DGRN 2EXJA 2O0OA 2RR12 3NNGA 1X36A 4WVMA 3WNXA 2P2KA 4A7KA 2WO1A 3AYDA 3WF2A 2CGPA 5L7OA 1F2NA 2YYOA 2YDEA 3ZPOA 3I4IA 2OVUA 3LOIA 4HZFA 4PQQA 4MXVA 4P9WA 2J1TA 1AF9A 5APAA 3O1TA 1XYPA 3JB8A 1QY4A 5F5QA 4LOSA 3JD73 1VMHA 3NNJA 5CKNA 2BZDA 1RUJ3 3I3BA 1A3KA 5A6QA 1W8FA 3O1OA 1UXZA 3LKJA 1R093 3FZ3A 1V70A 2JJ6A 4L11A 3KCCA 5IVJA 1LULA 1JYXA 3KVAA 3D3AA 1W6OB 3OJBA 2BP6A 4Q4Y1 4DXSA 3UESA 3BTZA 1LHUA 1CAWB 2QTWB 4YW6A 5KHKA 1IPSA 3WSOA 2BOIA 2ZXQA 1RJ7A 1NKGA 5D1IA 4EV0A 4CTEA 1PGSA 5BNNB 3WF1A 1O3QA 1R092 4H14A 4MGIE 3O1PA 2LM3A 2UWCA 3HVDA 4RHV1 3QLQA 2W1QA 3IDEA 1S0GA 2ZGUA 1AX2A 2EF6A 1JYNA 4YW5A 1BCXA 3H50A 3THDA 2A73B 1RMU1 3OGVA 4JHTA 2QQJA 2W9XA 3BIWE 1Q8OA 2VMDA 3ZR6A 3ZDSA 1CAXA 3WLUA 5FZ4A 4IE5A 1KDMA 4BU2A 3WDWA 1I9RA 1UKGA 1W6PB 3MFCA 4HG6B 4Q4V1 3LB9A 1BBT2 1LOCA 5F3CA 2RE9A 4NN0A 2W87A 1PK6C 2VCMA 3HBZA 2LROA 4Q4W3 1HRI3 3MIFA 5A7PA 2QZ3A 5FWJA 1PZ7A 3P6BA 2ZOEB 3P3NA 1ULEA 3VBHC 2R041 3FLPA 2EAKA 2BW8A 3EMRA 5CKQA 2R16A 5EFUA 3WG1A 1O4ZA 1JUHA 2Q1FA 3WINE 5IFTA 2O8OA 5KXEA 2VULA 3SQOA 4YSFA 4Z92B 4OVEA 1E5RA 1QJX1 1YHFA 3POJA 5BNOC 5FYHA 4Y5SA 1CAUA 1CN1A 3PMSA 2RS31 3U10A 3RZLA 3SEPA 4ARXA 2DV9A 3NL1A 4UFHA 5HCBA 2QQNA 3T0BA 1JZ8A 1U5IA 4MHRA 1DQ2A 2HLEA 4GH4B 4PLOA 1W8TA 1CPNA 4IEWA 5FZMA 4COVA 4ES9A 1NLQA 3QACA 1QQP1 1JUIA 1NQJA 3WEZA 1JTZX 1JH5A 2DCYA 2VZRA 3DPRB 1GLHA 3RI8A 2C4XA 4K1YA 1SLIA 2V4AA 1H6XA 4QPGA 5A7QA 4CP1A 4EZHA 1UZVA 4BLIA 1YFUA 4H7MA 4XW3A 5D8AA 4IEYA 5CBLA 1JU4A 3H3ZA 3VN4A 5FTTC 5EXOA 3FX3A 4Q4Y3 3H0OA 1VBE1 3VBOB 1C28A 3VBUC 5FZ3A 2WAAA 3V56A 1L7RA 2VTXJ 4XJUA 2XLFA 2JG9B 1TNFA 1H1MA 5DMYA 1OLME 2DUOA 1NY71 4W6XA 3ZN6B 2A75A 3MW3A 2HKXA 4IV1C 4LXLA 3VZOA 4I02A 4LT5A 4RFRB 5FY7A 4COWA 4Q4V3 4IW3A 4B8EA 5GALA 5LCWL 3N7KA 1MS1A 4PHZA 3POIA 3JQXA 2UWBA 4HONA 1RUG2 5DUUA 2Q8EA 5B4NA 5KHIA 3IMMA 4GJYA 1EY2A 2XVGA 2P6CA 1RXFA 2VD7A 5BPXA 4MGSA 4QM8A 1FV3A 1XYOA 2KM2A 4B7KA 3GBWA 3LIHA 2YC4A 2C26A 1RB8G 3NRUA 1ULFA 2ORXA 4XJZA 2JB4A 2WN2A 5T50A 1US2A 4LO7A 3PTRB 1OXCA 3AZWA 2W39A 2ZMNA 4QGMA 1PO12 1OQ1A 2FMDA 3ABZA 4UFKA 2YROA 3LOBA 1RUC3 3K46A 1AR91 3ACFA 4CDWA 1B35A 3I2DA 1DGWX 1OI6A 1RUI2 5JR2A 1W6OA 2WINB 5CNAA 1QOOA 4IEUA 4E4HA 5F3IA 5ANNA 1H0BA 1AR73 2WQZC 3JD72 5FZ6A 3H7JA 3SMHA 1XC6A 3CKHA 3DECA 3SCHA 3TEYA 5I0SA 3RZGA 1Q8VA 1ND3B 4EN6B 3HOBA 1YI7A 4LBQA 1X50A 1ULCA 3J26N 2XONA 3VDAA 2ATFA 3RQ0A 3WVJA 2WBKA 4L0PA 5LRRA 5JOWA 2DCJA 4LK6A 3CO2A 3I2IA 1IS3A 1JZ6A 2OS2A 4P5HA 4NJ4A 1V6NA 2YGLA 3I3DA 4NIDA 1UOGA 4NHMA 3WDYA 4CCCA 2Z69A 2B5HA 1POV3 4UFIA 4AGRA 2WZEA 3O1SA 2X09A 5A7WA 5FDBA 2RS12 1O3SA 1OFNA 1BMV2 2JIGA 1RJ8A 1IS4A 1JODA 2E7TA 1MQTA 5FV3A 2WO2A 4RQPB 2HWE2 3BN6A 3AZYA 3IDCB 3I54A 1X9TA 4QGNA 4EYUA 3V0AB 4QPGC 1AJKA 4NPRA 2P3YA 3DEMA 2A3YA 1Q8PA 2JEMA 1I1EA 2UU8A 3VV1A 1UXXX 1FPN1 1VBA2 1SPPA 1VBD1 3DXUA 4I09A 5FO7B 5IATA 2QJVA 3OUIA 2XH6A 5C33A 1F31A 2JG8C 1D4M2 2WT1A 3J8F3 4KMQA 2TBVA 3L2YA 5CG8A 4NHYA 2OKXA 4FPGA 1Y9MA 1OSGA 4IUGA 2XOMA 2H6BA 3DUIA 5EJZB 1AR83 2ZGMA 5FREA 3RS6A 1NA1C 2YC0A 4XVHA 3U37A 2ZX0A 4JRAA 1W6MB 3KD4A 5JIAA 2R49A 2ZHLA 1PIV2 4WM8C 2UURA 3DL3A 4DXRA 4GMP0 1QDOA 4NAOA 5FY5A 3UKTA 4B4QA 1QKQA 2R6QA 4MXWB 2ZGPA 4GMP3 1HW5A 3O1UA 1JW6A 4HLTA 5CZKA 5ABJC 3SCFA 1WGPA 3NNFA 4AEJA 1KDKA 4QPIC 5KC6A 4CA9A 3BKZA 3WP6A 4TSVA 2CV6A 4JTNA 4E27A 5IK4A 1V9U2 2WWSA 4GQ7A 1W2OA 4XTMA 2PFWA 1IGOA 5FKBA 5J3UA 1SLCA 1W3XA 4AAPA 3FWEA 1NZCA 5LRSA 2RDQA 3MV01 4UF0A 4NOTA 5FZLA 3H8OA 2BVVA 3ECQA 1ZA4A 2ZS6B 3MBWA 3WX5A 4FTBA 3VZNA 3OBTA 1W8WA 3RZZA 3PUQA 4KWKA 4YW4A 2W1UA 4CUBA 1HQLA 2ZGLA 2WSUA 5DAWA 1QJX2 3FC0A 1K12A 4KWJA 2HWB1 1UZWA 5FMDA 3RVHA 4JVAA 1FPN2 1VBD2 3FBYA 4MX3A 1D0GA 4YGCA 5A33B 2Y6LA 4K1ZA 3IIAA 4AHWA 4X6QB 5FYCA 3RYRA 2ORZA 3ES1A 4CP0A 3E5QA 4IEOA 4OMCA 2BPA2 5F6KA 2FHRA 1WMEA 1CZTA 2VCBA 2VL4A 1AYM3 4Q27A 4UAPA 4YG0A 5FXWA 1V9U1 1JZ7A 1AR61 2YBPA 4TXWA 2EIBA 2ID4A 3AYCA 4QHBA 5GZEA 2FD8A 2DCTA 1YI9A 4X8PA 1BLZA 5E1RA 5HXVA 4J1XA 4FPLA 3DXTA 1GUIA 3FUOA 1UPIA 4CDXA 5C5UA 1CZSA 2XB6C 1W9FA 5F1RA 1COV2 4RQPA 5JVVA 2W2IA 5J09A 2GH2A 5A3LA 1JYCA 5FP4A 4B29A 4AG4A 1NCRC 4CCMA 3ACLA 1QGLA 4ASLA 3HWJA 1DIWA 5L73A 3WG2A 3M1HA 4DXTA 1YJLA 3RGBA 2D7FA 3TEXA 5B2GB 4XFFA 1GMMA 1RUD1 2B45X 3F2ZA 3N35A 1JYIA 1WLDA 2HWF3 4JDOA 3A22A 4KQ7A 3D0SA 2JG8A 3M3IA 1D2SA 1OFSA 4BK5A 1PO21 4FAHA 4Y20A 1ZZCA 4QQPA 1HJGA 3FBMA 5FZKA 5E6HA 1OPMA 3UT0A 1Z7S3 1AR82 1BEV1 4XFIA 4AQTA 3CF6E 5K8SA 1WZXA 3AMPA 2QBXA 1LR5A 2CTVA 3R0RA 4QKDA 5F8PA 4E2SA 4H2AA 4FI9A 3ZXLA 3C7FA 1R082 1E5HA 3ACHA 4Y20B 2EXIA 2ZA9A 3VDDA 1Q8QA 4CXXA 1BMV1 1RVF3 1XU1A 1PX3A 5E16A 2V5YA 1NLSA 3UJQA 1OF4A 4FFFA 4IEXA 4D7TA 3TN92 4NROA 2H6CA 1A78A 1G6NA 1N3OA 3HEIA 3TRSB 1ZZBA 4IE4A 1RL3A 1O7FA 4Y1UA 2HWE3 2PA7A 2C6SA 2RR11 2Z4FA 5LB6A 5LATA 5GLUA 1AYN1 3MDPA 1RUD2 3CLPA 1OVSA 2KA3A 1PZ9A 1H8VA 2V72A 2Y38A 1AL23 4JKKA 2GZWA 4N53A 2RMU1 3DV8A 1SACA 1SCRA 1UOFA 2GC1A 4NRMA 3AMMA 3MW2A 2JECA 1TNRA 3T2QA 2TUNA 2K46A 2H0VA 5LBBA 1B35B 1XOYA 4YVSB 3JQWA 4BLJA 1MEC2 2ZGKA 2IZWA 3AL6A 4YW7A 3ZYRA 3OEAA 1W90A 4AI3A 1IQDC 5SV5A 4CUCA 4BIOA 3NJZA 2C9AA 2VZPA 3I2JA 4MADA 3VBSB 1FNZA 3U4SA 1W3VA 2ZX4A 2RM22 4XXPA 4ORFA 1AJOA 5F5CA 1GZTA 2Y8KA 1EPZA 3VBOA 2ZHNA 3H8XA 5FLIA 4OI0A 4Y22B 4YZ4A 5FZ8A 5A33A 1C1LA 2W1SA 4CCDA 1SLBA 2HBTA 3F95A 5JDBA 1RUI3 2GAUA 1POQA 5FRAA 2J1EA 2WUHA 1RUC2 4P00B 1OA3A 1LODA 4R9CA 3A21A 2P6HA 4NMIA 3WP4A 5BXXA 4EROA 4QM9A 1TMF2 2SLIA 3ZN6A 4BYYA 2PHDA 3B3QE 2IFWA 2QKDA 4MOAA 5FKCA 1M06G 4UI9L 5FY8A 5IHRA 3KB5A 5JPMB 3DYMA 2DCZA 1B09A 3BODA 1RMU3 4CEWC 5A3NA 4U36A 4JX0A 2ARAA 2WNVB 4N9IA 2R042 4Y33A 4CRQA 4A7ZA 4GH4A 1YFWA 2D3RA 5J98B 1BZWA 3ZXJA 2XJPA 2ZGOA 1AX1A 1LOAA 1RC6A 1REEA 2DFCA 2VZUA 4YW3A 5ACA3 5JMCA 5LA1A 1BVVA 1O3RA 4AGVA 1XE7A 3DGTA 1RXGA 3MO4A 2JE9A 2OW4A 2V4VA 4LITA 4Q4V2 5FJKA 3DPRA 1Q43A 3IB3A 3A0NA 4LO8A 4QQLA 2VPVA 1NE6A 4QDQA 1K5JA 5F3GA 2NLRA 4MHUA 1VAMA 4LR4A 4XBNA 1WMFA 2YZ4A 1RUF2 1RVF2 3MFAA 1W6MA 1I5PA 5DAQA 3NJYA 1ALYA 2JKBA 5F2SA 1GZWB 2DU0A 1GFF2 5LBFA 3M3EA 2J7MA 4Q1PA 2JG9C 5L9VA 4Q8KA 1OC1A 4NIGA 1LENA 1KRIA 3C7OA 1KEXA 3VD4A 3QCWA 5CAZA 3ZMNA 1CAUB 3CNAA 2XL7A 4PLMA 1MR5A 4DQAA 1QEXA 2ZACA 2AREA 2QQMA 4AFCA 4CEWA 3B69A 2RM21 1D4M1 4AVSA 4YZ2A 3V0AA 2VZQA 4IQPA 2KXLA 3OBZA 4EWDA 2DDUA 1ENQA 3AL5A 4YGBA 3GZAA 3PURA 1ZRFA 1LRHA 1WCQA 2WIIB 2WS92 1GICA 1QNYA 2AEYA 1MZEA 4PIZA 2CDPA 4AQ2A 4C91A 4G9SB 1QJEA 1C57A 4LTAA 4PIXA 1RYYA 2GC3A 1R1A3 2ZX1A 4AVBA 2JE7A 2EA7A 1UMZA 4IV1A 3MIHA 3B9IA 2BNMA 3U0ZA 2RMU2 5F6LB 2VXJA 3VBHA 5CFDB 1W8ZA 2BVBA 1SDDB 2D5HA 5FYBA 3L2HA 1APNA 1W2UA 3M2MA 4XC9A 4EWAA 1NCRB 1J3RA 1HRI2 2QQVA 1EUUA 3BPSA 4A41A 3LF7A 1COV1 1IG0A 3H8RA 1W9TA 1W6QB 1GKBA 3AP7A 5F5IA 1BBT3 4H3WA 2FDFA 2HEVF 4NUBA 4CDXB 5A7NA 3AP4A 4QX1A 4XQ4A 2BQPA 3K75B 4F3JA 1FPN3 1VBD3 1VRH2 1Z78A 1UOJA 1RUE3 5FLJA 2F4PA 1AR62 1VMJA 1ZBE2 4GWNA 3WUDA 3B00A 3AZVA 1ENSA 4G4FA 4GZ9A 5CFCC 2IWGB 1PVC1 1DZRA 3JXSA 4HSJA 3T1MA 4E2QA 1UMIA 1PVXA 1RUI1 1Y9QA 2G9GA 2XJQA 4XXAA 5FY4A 5FZ0A 2CWSA 3WDXA 2AZ5A 2VM9A 3LPFA 5JI9A 4YWAA 3GDBA 1RUH3 4HKLA 1DGRA 2J1AA 3M70A 3OSDA 1MACA 2RS33 3NNMA 4AE2A 3PUIA 5KXCA 1FMD3 3H8UA 3WW2A 2GALA 5I0UA 3NVCA 5HCAA 3ZYBA 1W05A 1S2EA 5JR7B 5A3PA 2Z5WA 3POWA 4OHWA 2VW1A 3I3EA 4HOOA 1XB9A 4YG3A 3D6EA 3O0VA 4QDSA 5CISA 5CG9A 3OBRA 1GR3A 1QJFA 4NIIA 5GLVA 1UAIA 4FOWA 1JZ4A 4B1MA 3PL0A 4FPOB 1W8HA 1GOGA 2IVJA 3PU8A 5JMOA 3I2OA 4LPLA 1J1LA 2RR13 3HQUA 2GSYA 1IKQA 4MXWA 1DZTA 1HB4A 4RGGA 1WA6X 4JKLA 2WNUA 2GNBA 1BK1A 5FY0A 2RHPA 4HL0A 5K0UA 3MLKA 4BQXA 1K42A 2YXSA 2HBUA 3WQ1A 1ZYBA 5FXVA 2ZJCA 4Y26A 4LHKA 3GBFA 1H4GA 4OLLA 4LKDA 5DUXA 4QX7A 3ZN4A 1QXPA 1IOAA 2Y60A 3VHPA 3WHTA 1IQAA 2ZEWA 3ITQA 1YXWA 2W91A 1KFUL 3OG2A 2VECA 3I2KA 3CJIC 1CZVA 2VQTA 2WRAA 3WHUA 5GLZA 3FFQA 5FZ7A 1UYYA 3VL8A 1REFA 1O6UA 5G05L 3BIEA 3WQ0A 2W52A 4GWJA 4XAAA 4D7SA 5CA6A 4Q8LA 4YZ5A 2VMFA 2ET1A 5LEKA 2PHTA 3KV4A 3MPPG 4P9LA 4QPIA 4KNCA 1TZOA 4GB33 1RUJ1 2YMZA 3VDBA 3HR9A 4QX0A 3ZFEB 2HH9A 4J1WA 5EP9A 2X05A 2QQLA 4Q4X2 4XYXA 2UYBA 4BXFA 3R4UA 4M4PA 5D8AC 3WDTA 3WNMA 5I91A 4BIFA 2VMIA 3V0BA 1UOBA 1UY3A 4XF0A 3PUAA 4WV8A 2ILMA 4I0WB 2D6NA 4XFGA 2CSGA 1MQTC 3VBUA 4NPMA 4LEJA 1H8TA 4QDRA 4QHOA 3UK9A 5F5AA 5FMOL 3W20A 3J7HA 1UN1A 4LE4A 5JSPA 4K8FA 1D2QA 4J25A 3WNPA 2FZ1A 3RRDA 1PO13 1SCSA 1V0AA 5IUQA 4LBQB 3AXDA 1ZZ7A 3GXUA 3VUOA 4CCKA 1DQ0A 5C3QA 3IT8A 2FCUA 2XQRA 5FY9A 5AC91 2Y6FA 1EPWA 1PM7A 3WR0A 4LBLA 1RUE1 1OA2A 2ZMLA 1FATA 1WCSA 1S2BA 3ELNA 2WLPA 1PO11 1GQHA 2XJSA 2XR4A 5F2WA 3QD6A 4IGOA 4CDWB 1I3HA 1R081 2TNFA 2VQ0A 2VZ3A 5I0RA 1W0OA 5A3OA 5K7PA 1QJU3 4GIQA 1LEMA 3HQXA 2R1BA 2IFRA 2JD9A 3UV9A 1CESA 2MEV3 1LOGA 4UFJA 4FTEA 1CVNA 5FZEA 3LA7A 5HBAA 3SC7X 1NCRA 4C8DA 5H9SA 4OUSA 2ZTNA 1W8OA 3E5XA 2JDAA 1W8UA 4AQ6A 4IEVA 2D6MA 5F39A 3ZKUA 2WA4A 1ZRDA 2YUEA 4XJ8A 4OI1A
chains in the Genus database with same CATH topology
2NPIA 3HT2A 1RUF1 5KXDA 2D6PA 2X5IA 5JAXA 3EJKA 5KXBA 2XPJA 3H3UA 1LGBA 2VNGA 4Z07A 3ENRA 2WNUC 4Q4X3 1VALA 5KWRA 2DVDA 1JHNA 3WCRA 4FSJA 2P37A 3IPVB 1O3TA 5SV8A 3JD71 5GLWA 2RJKA 2QDNA 4RGAA 4Z1VA 2GMMA 2HWD1 1QH7A 3RSJA 4M01A 3RJRA 3TWIA 3ZSJA 1HXS3 4UBGA 3GF6A 4I2OA 1RIRA 1NCQC 4GALA 4BPZA 2PLV2 1QQP2 1G9DA 5L36A 4N43A 3ZX7A 2VH9A 2HWC2 1DHKB 1PZ8A 3ZMOA 1Q56A 5GZGA 5T52A 2XKOA 1BJQA 3BB6A 3H1MA 4Y1VA 2WFF2 1IKPA 5FO8B 5LEJA 2XVKA 2X5IC 5E88A 1VB4A 1QXJA 3AXEA 3NKGA 4RQPC 5BNPB 2LUWA 3UJOA 4YFZA 3EQEA 2JX9A 1R1A1 4DMIA 2ET7A 2QZ2A 5FFOC 1ZM1A 3FLRA 5FBZA 4COYA 2W08A 3N7MA 4KGGA 1U0AA 3KSCA 3ZSLA 2ZGSA 1C8M1 2WZR2 2WLQA 3FHIB 3P3PA 4UBHA 1S0IA 4JRLA 3VLBB 4HT1T 4ASMB 4LO6B 1NCQA 2AH2A 2JDZA 4K9SA 3ZYPA 3AKRA 2R071 2VOWA 1CONA 2D6LX 3ZXDA 4P9IA 1TMF3 1AYN2 3WD5A 4M3CB 1FOD1 3ZN5A 4E4SA 4E4ZA 2GMPA 3PVEA 1XU2A 2DVFA 1VBB1 2FBEA 4WBBA 3GALA 3MF6A 4AEDB 4KGQA 2UWAA 4FT8A 5CFDC 5JLVA 1LHWA 3E6BA 4MGZE 4BMBA 4UW3A 3CL1A 2NN8A 3R6SA 2BNOA 2AYHA 2DWRA 3T2TA 5KC5A 5JOXA 1G9CA 5DZEA 1CAWA 2XUMA 1RUE2 1ZZ6A 1ND2B 4HKOA 4L9BA 3LZZA 4LBJA 1C5HA 2FQPA 2XHKA 3PJQA 4YVWA 1PVC2 3ROUA 1TME1 2VGDA 2WT0A 1IZ3A 1OMIA 2BUKA 4FP3A 1U5ZA 1NG0A 4O9GA 3TAYA 2HJIA 3JCIA 4AHXA 1SLAA 1OOPB 2D93A 1QJY1 3MW4A 5K9YA 1QOTA 2XBO2 4M00A 4CP2A 4HK8A 1IPKA 3TNPB 1ASJ1 4K21A 4FPJA 5IK5A 2CY6A 5CFDA 1H8TB 3MZHA 4XETA 2D6KA 1HRI1 2D98A 1DYKA 3JUUA 2VW0A 4LLOA 3WG4A 4XFCA 4CDQC 4S2HA 1CAVA 3SXWA 1HKDA 4OHVA 5FPZA 2CWMA 4PBPA 2HWD3 2VUJA 3B93A 5BNQA 1XNBA 3WV6A 3B7MA 1WUVA 1HRV3 3AMHA 1PGW1 3KCYA 1UZYA 5JSRA 1Q3EA 1UU6A 1EAH3 4CEWB 3M8LA 1V6IA 2VUAA 4JAAA 1HIXA 2YPJA 1HRV2 3MIBA 4LA2A 4N7IA 2XKPA 4PCRA 1QJZA 3A0KA 3WQ7A 1VP6A 3DN7A 4GXLA 4AHYA 4B3NA 4XFAA 3ZFGB 3URFA 1DQ4A 3QH7A 1YFXA 4Y5Z0 4D7YA 4CZSA 1DG6A 5BUVA 2ZABA 2BGCA 1EP0A 4K6BA 4HPKA 5FOBB 2UY8A 3AX4A 3MI8A 4I0AA 5DUVA 3USUA 4BMEA 1H30A 3MEPA 3AM2A 1J3PA 1PNFA 4UXAA 3WXPA 1YRZA 1QJY3 1NY72 2ARBA 4L92A 1WW7A 2G9FA 2ZGQA 2PELA 1GSLA 1WBLA 5FQ0B 5A32B 2C5DA 1REDA 1GV9A 1RGSA 3AP6A 1C8M2 3WDUA 4WVVA 1WD4A 2P34A 5CB7A 2W68A 4FBFA 2VQAA 2LALA 1J58A 3GZTB 3PVBB 1AHSA 5BNOA 3SITA 3I59B 1LCLA 4CDUC 2NQYA 1S1AA 4B4RA 1QHDA 3VBOC 1H2NA 3VZJA 2VVDA 4RSUA 3O14A 1NXMA 1ASJ3 5A32A 2C0ZA 3AYEA 4YW1A 3VBSA 1ENRA 1LOBA 3GYDA 1ND3C 3SCGA 5BNNC 4IV3A 1AYM1 5DG2A 1T6GC 2X5IB 4NHKA 4OZXA 2JENA 3J4UH 4CDQA 5BV6A 1CPMA 4E4DX 5KHGA 1YYNA 3ZVXA 3KT1A 3NV4A 4XQDA 4N53B 1H1AA 1YUDA 4IEZA 2HWB3 4PDWA 2DF7A 1FAYA 4AFAA 4NWWA 1NXD1 5EWSA 1NA1B 3B5LB 3DPRC 1X82A 3ALQA 4MUVA 4WM7C 1PGL1 4F7ZA 2AUYA 2XJVA 3JBG1 3AFKA 4CDUA 2D3SA 1U5YA 2QUOA 1LGCA 1Q5OA 2VOKA 3GBGA 3MIEA 3LA3A 4B7EA 3BPZA 3NV1A 4PIYA 2PQQA 3ATGA 3N3HA 1AYN3 4HETA 1N1YA 2ZZQA 2ARXA 3JBG3 4WM8B 2K0GA 2O1QA 2WFF3 1ZVFA 1Z7S2 2B46X 4XQWA 3O0WA 5F9TA 4MGYE 1CAVB 4FPKA 1LTEA 2HWC3 3RG0A 4KU7A 2AR6A 2WJSA 5L7OC 4X6RB 3IN9A 4CEYB 4XBQA 2X8KA 1C1FA 2HWF2 2IXJA 4FQZA 2ZX3A 4UW4A 4I3PA 4NVPA 1SBFA 1B35C 2MEV1 1IS6A 4XJ9A 1ZBA3 1TME2 1LJ7A 1HXS2 1W0PA 4AEDC 3B02A 3EO6A 4Q0VA 4AQSA 1K5MC 1SQ4A 4YM0A 4FXGB 1WLCA 3SH4A 5L19A 1G7YA 3ZXEA 4PDWB 4URTA 1H1IA 1RTVA 4Q0UA 4W6YA 1UIJA 4L8QA 4TZDA 5K0UC 1Y7BA 2CGNA 3FMGA 2NZ9A 1VBE2 1ND2A 1DGLA 4CDUB 4AVAA 3OGJA 1O5UA 1UPSA 3FJSA 4JCKA 3CJIA 2Q4SA 1O91A 2DUPA 4AHZA 3N4MA 3RMYA 2PYTA 3OGGA 2R30A 4Z2WA 5BNPC 4WVWA 3VKFC 4A7YA 4QGLA 4RA0A 4AEDA 4ZU5A 3HT1A 5H9RA 4XF1A 1UF2C 3KGZA 2E9QA 3WP3A 1W6NA 1SDWA 2PHUA 3BCWA 2OUHA 5LK5A 2ZHKA 2I45A 3AJZA 1GZCA 1BQPA 4LLFA 4QQ2A 4KL1A 4EN0A 4HMZA 3RYKA 4EN7B 1QNWA 2PAKA 5T54A 4YYOA 2XLGA 4BOWA 4DZGA 4JGZC 5JZGC 1QH6A 2IXLA 5TSWA 1KFXL 1WMDA 1OHFA 4RL7A 3VBRC 5ABJA 2R32A 2ZGNA 4JC1A 4GB32 5FMOS 3T1LA 4M3CE 4AI0A 1WLTA 3ZYGA 1XQNA 4X8NA 4H55A 3ILNA 1LESA 5DUWA 4ATFA 4N43B 4LBQD 4K40A 4JGYB 4WVZA 4B4PA 2A3WA 4K3UA 1V00A 4XJWA 3H1WA 1V6LA 4FOVA 1HDKA 1Z0HA 2VNOA 4XTPA 5GZDA 4DOUA 1OOPC 2RS53 4IEQA 5I8TA 2ZPXA 2OIIA 4Q4W2 2IXCA 5FO9B 4N9HA 5GKAC 3USSA 4D69A 5GLTA 1VRH1 3NO8A 5JI7A 3KLSA 1TME3 4Q26A 1HLCA 1AL21 4FOQA 4JDMA 4QU2A 5FLHA 3MF9A 1PGW2 2Q1MA 3NWKA 3VKMA 1CGPA 1HX6A 1SLLA 3OY8A 1BYHA 1Q8SA 1BVP1 2RS52 1AR72 2DVGA 5FPXA 4GKXA 1POV0 4YM1A 4Z8BA 3LCPA 3HD8B 1YFYA 4XDQA 3ZYJB 4ONUA 1DF0A 1I6XA 3JBG2 1W39A 1FI2A 1GZ9A 2JG8B 3I7DA 2E7QA 1WW6A 1ZRCA 2A70A 3RPQA 4YNIA 3ILRA 4AF9A 2VW2A 1WD3A 1AR71 3THPA 3R05A 5BY5A 1OKQA 4WZFA 1LOFA 1LHVA 4YGEA 1N1VA 2HWB2 1RUJ2 2ENRA 1PHMA 2EXHA 3ME2A 2R1DA 2QNKA 3PVOA 5ABJB 4YG6A 4ES8A 4MH0E 2B9UA 1H2MA 1ZBE3 3VHNA 3S30A 1DQ1A 4M3CA 1SBDA 1F5FA 1ONAA 3M3OA 4INDA 4KWLA 3C3VA 4HSLA 3GNEA 4FCAA 1AVBA 4S2FA 2A3XA 4QT6A 1WCKA 1YLLA 2WNVA 3ETQA 4QPIB 3S0MA 3LWCA 1C3HA 3AMNA 5C8CA 5BNOB 2XJRA 4LUMA 2D6OX 3PTYA 4R9BA 1FOD3 2DURA 3JB4C 3I8TA 1GBGA 1LOFC 2RJLA 2DVAA 2WKKA 1DZQA 4OI2A 3M3CA 4MLOA 5LK7B 1HV1A 1RHI3 1D4VB 2Q5TA 4Y22A 4CYDA 2CAUA 4XILA 1KITA 2P3IA 3G6JB 2OZ6A 1O4TA 1C8M3 4HVRA 5C9AB 4GA9A 4D94A 4OHXA 4EWEA 1K5MB 1QJU1 2ZGRA 5EYXA 4IERA 3AP9A 2DU1A 3SISA 2JICA 4Y1ZA 1G86A 4YVSA 3SLIA 3VKNA 3MICA 4AVVA 5AVPA 2YGMA 1N47A 1N1SA 1X8EA 1R1A2 2ZX2A 2RS11 3H7YA 4XOGA 1JN2P 5JIUA 1Y43B 5C8WA 1HRV1 3BOWA 2WS93 1MS9A 1ZBA2 3IPVA 3NV3A 3NAPB 1S2KA 2FMYA 4FOYA 3S7IA 3IBMA 3CU7A 4CEYC 3THTA 1EYBA 4LA3A 2MNGA 4MGKE 2PLV1 4DRVA 4LULA 3PVNA 4P14A 4ITCA 3ZSKA 1RMU2 3C2UA 3OPZA 4HN1A 4DXZA 2XJTA 4YVSC 1XNKA 3J8F1 4YARA 2HWD2 1FNYA 3PJYA 4YM2A 1RUF3 4F8AA 2CYFA 2QQPA 1CIWA 4YZ1A 1AR92 1MZ5A 3SH5A 4Q2FA 1PMIA 4GKYA 4C1WA 3OYWB 3KMHA 3ZFFC 1GYKA 3AKPA 3VHOA 4LHNA 4F83A 4QPYA 1MVQA 3B9CA 5ACA2 2RM23 4NHLA 4WZCA 1EV13 3RWNA 1ULDA 1AR81 1BEV2 2K2SA 3ZSEA 1DFQA 4XF3A 3NKTA 2Q1ZB 1VJ2A 2EXKA 5E89A 4ZU4A 1RUG1 1C4RA 4JV4A 3O5SA 3VBRB 2WS91 3VZLA 3UKNA 1KQRA 3WUCA 1VLNA 4RR3B 1HQWA 2R061 1G8WA 1UU5A 1V6JA 2VVFA 2OZJA 3O7OA 1MZ6A 1XXNA 1Z7S1 1I5ZA 3M4FA 3RYPA 1UL9A 3MGUA 3VDDC 1SMVA 1BKZA 5AC92 1VR3A 3JZVA 1EV12 3WZ1A 1YIPA 2GU9A 2N7GA 1MS5A 4BE3A 4Y24A 1LEDA 3INAA 5FOJB 1RVF1 3TN93 1AR93 3ST7A 5T3NA 5J36A 2XL9A 3ZO0B 1UKRA 1UIKA 4FPYA 4DS0A 2PTMA 4QQOA 3V0BB 3EHKA 2V09A 4IL7A 4M0HA 4S2DA 4Y1XA 1DDLA 4IV3C 4N53C 1K5MA 4ZXKA 4LBNA 3ZFEA 4P9JA 2BFUL 5AFBA 2X53S 2Y0IA 3G7DA 1UX6A 3K48A 5DZGA 1FX5A 2A5ZA 2DFBA 2YV8A 4HANA 5DDJ3 1ZZ8A 2P3KA 4EJRA 2A6VA 2ZAAA 2WZR3 1OLQA 4PLNA 2WL1A 2XWJB 2PN5A 4TLFA 4BH9A 4RS5C 1XYNA 3APBA 1RUC1 4DY3A 5JPNB 5J7MA 2DUQA 1C5IA 1FYUA 1VB2A 2HWC1 2Z42A 2GNDA 1BBT1 5K0UB 3VL9A 2WNUB 3O0XA 3Q9OA 3ZFGA 1NOVA 2CGOA 3ZIXA 4GULA 4OFGA 3ZXAC 3ZFFA 1MEC1 1HV0A 2QFEA 3AK0A 5CVRA 1DYPA 1QQP3 1X8MA 4AI1A 5HCFA 1PO23 3ZXGA 3DF0A 4RFT0 4GH4C 5C8CB 1OQDA 2A6XA 1CR7A 2E53A 3WOGA 5IT6A 3KT4A 5C6CA 2B7YA 1LU1A 3RJ2X 4A2UA 2PHLA 2A6ZA 1SBEA 4IEPA 2O8QA 1COV3 1AL0G 1QJX3 1V6KA 1EV11 3MIDA 2ZAHA 3D5OA 4XF9A 2ZBJA 4N7UA 4YGDA 4BM8A 1TQ5A 3R4SA 4W65A 1MVEA 4LBMA 4RR3A 4HVQA 3B94A 3W9AA 3SNMA 3HAGA 2XBO3 3VBSC 1CX4A 2R062 3OF1A 5DDJ1 2SBAA 1LB2A 5CU1A 3VBRA 2NM1A 5CIRA 2C1FA 3SH3A 1ND3A 1V9U3 5BNNA 1MZFA 1W6QA 3E97A 1JXNA 2IXKA 3EBRA 3AJYA 1SLTA 3IM0A 3OY8B 4QQHA 1OD5A 4IESA 3WCSA 3LGRA 3CEWA 4DINB 2B8MA 1ZZ9A 2YHJA 1PO22 2Q0AA 2QCSB 2ZKNA 3D0JA 1WCDJ 4UW6A 4Y1YA 1QXRA 5JCTA 4IV1B 3X29B 4KG8A 3MYXA 1POV1 1SFNA 1MS8A 2BEOA 1O5LA 3FLTA 2BFUS 3QH6A 3ASIA 5JOYA 4R8HA 1UD1A 4HK9A 4XPVA 3J8F2 2BYVE 4META 3VGIA 1VBA3 1RHI1 2UY9A 3KS7A 4R9DA 4GB31 3VBUB 2WSVA 2EVXA 4WVMB 1NQDA 3POSA 1AXZA 4E9KA 1X7NA 3FUQA 2ZGTA 4Q29A 3NAPA 2R0HA 1ZX5A 3N7LA 3AZZA 5DDJ2 4AI8A 3M7AA 3JU9A 1GZWA 2XLAA 3DKWA 1LECA 1XNDA 4XE9A 2EIGA 5I93A 3D82A 5DXDA 1KJLA 1G9FA 4XHBA 3ZFFB 1DU3D 1KJRA 1LHNA 2BWAA 3OCPA 4JGYA 2FZ2A 3J9SA 3PNAA 4NR1A 4FP2A 4JQRA 1IHMA 1ZRRA 4HVOA 2Z79A 4I0BA 5EV7A 5H9PA 1GQGA 3WW4A 4XZPA 1F5JA 3VKLA 5IK8A 1URXA 2E51A 2ERFA 1ND2C 3W58A 3VZKA 3TBDA 3ZSMA 1V6OA 2OYZA 4C0BA 2PLV3 2WT2A 1ZREA 4JDNA 1WBFA 4RR3C 4IXLA 4AXOA 1G9AA 2ZKLA 3KQRA 4EN9B 2E6VA 4OI4A 1IS5A 3VKOA 2QDRA 4AVTA 1A8DA 4YM3A 1A6CA 2YY1A 3E6CC 1BXHA 2Y26A 3EXUA 3B01A 3E5UA 4SBVA 2B39A 1BEV3 5H9QA 2WA3A 1XE8A 1W6PA 5GZFA 3BOPA 4HKWA 1J3QA 1A8MA 3D8CA 5E8AA 4FTSA 2PAEA 2PHWA 3PLQA 4KU8A 4N90A 1KD7A 5KHHA 2R073 5EZWA 2MEV2 3NW4A 5C4WA 1E57A 5AVAA 1QU0A 2P17A 1LU2A 5GZCA 3KT7A 5I8SA 2D43A 3R4DB 4M0NA 1DGWA 1RITA 3OD0A 2TEPA 4AEMA 1O4YA 2I07B 1WW4A 3LAGA 1RUOA 3D4KA 2R0FA 4YZ3A 1M4WA 4GWMA 1VBB3 3N36A 2BWCA 5DG1A 3WW3A 5T55A 2WZPP 3M3QA 4C90A 2NMOA 1AR63 3CJXA 2VY0A 1VRH3 4AGGA 2HEWF 1KS4A 1DQ5A 1QF3A 4UW5A 2VVEA 2B42B 1J59A 3MPBA 2IXIA 4NO4A 1F9KA 5T5OA 3QBQA 4Q4Y2 2VU9A 2WNEA 4AVCA 2RS51 3L9JT 4MVTA 2PHXA 3OYWA 4JGYC 1VBE3 4BCUA 2VG9A 4S2GA 2CNAA 4I30A 4Q4W1 1HXS1 5C8CC 4CEYA 4YVWC 2HEYF 3VDDB 3GHMA 2GC2A 3AZXA 3S6PA 1N3PA 1R1ZA 2NP0A 1OQEA 3AFGA 3ZPYA 4QMAA 4LUKA 3N7JA 4Q0PA 5I8YA 1PNGA 1QDCA 3AP5A 3LSEA 4ZKTB 1Y3TA 3TB0A 4BZ4A 2GNMA 4Q0QA 2X29A 1VBB2 4IV3B 1CJDA 2E63A 1FOD2 4RS5B 2GDFA 4R4XA 5T5JA 4G3YC 1CJPA 2ZMKA 2JXAA 4OHYA 1PGL2 3FE5A 4BHPA 1JBCA 3WDVA 2MHFA 4TYSA 1S0BA 1YNAA 2EAAA 1RINA 4LBKA 2Q8OA 4FXKB 3AMQA 2DYCA 2VXRA 4XMAA 3UL2A 2G4IA 2K9ZA 5C9AA 3U4XA 3ILFA 3VBFC 2JG9A 1WW5A 4XIKA 2BTVC 3ZYIB 4QXKA 1X33A 1U12A 5CFCB 4N43C 3IKWA 4P9GA 1FMD2 3LA2A 4DFSA 1W6NB 1NYWA 2PHFA 1ENXA 4LO4B 4MSVA 2RS32 1UU4A 1UW8A 4DB5A 1RUH2 1FV2A 4NWVA 3WP5A 4E2GA 1RUNA 1MS4A 1VBC1 1H8TC 4AI2A 3IDBB 3NV2A 4BA6A 2CAVA 3CJIB 1QWRA 3AKSA 1H2KA 4AK3A 3WT3A 3RNSA 4EN8B 2GC0A 1S0FA 1MEC3 2A71A 4Q1RA 1LKNA 5C9AC 3OD4A 4K7JA 2Y0OA 5EJ3A 4XEZA 2XVLA 2OPKA 4AFBA 4J6GA 1PIV1 1AL22 2I2SA 4WM7B 1R091 1QJY2 4HN0A 1KXGA 2RMU3 3ZFGC 3VBHB 3MLJA 4R9AA 3HIFA 3IMNA 5T5LA 4AFMA 4Q0SA 4P9YA 3IWZA 3K51A 1MQTB 1ZNPA 1N3QA 4LBOA 3BU7A 2HWF1 4R4ZA 4Z82A 5ACA1 3KZ4C 1ZBE1 4FPCA 1S55A 1S0DA 2VNRA 2XG3A 1OPOA 1DBNA 4JGZB 5GJ6A 5JZGB 1AZDA 1NE4A 2F6BA 1GANA 2GN7A 2OUJA 4LE3A 4BWOA 1N1TA 2GMEA 2DVBA 2IC1A 4RD7A 1UCXA 2A6WA 4L99A 4FPFA 4FPEA 3VBFA 4AW7A 1JOJA 3ZXKA 1AUYA 4Q4X1 4CDWC 4KBBA 2XBO1 2GN3A 2R072 1U5XA 3FFZA 1VBC3 1GNHA 4M3CF 5L7OB 2AENA 2R063 4YVWB 1KS5A 2A7AA 1FMD1 3GZUC 2MPFA 1XRUA 1H9PA 3AYAA 3QOPA 1V6MA 2R043 1S0CA 3S7EA 5CFCA 5J96B 4H7LA 1AYM2 2H0BA 5DZFA 1FXZA 1C8NA 4L2NA 5CADA 4TWTA 2D40A 1DQ6A 3H1YA 5KHJA 2VMGA 3OTFA 2D97A 1PVC3 2WFPA 3HN1A 5IK7A