3NL1A

Crystal structure of salicylate 1,2-dioxygenase from pseudoaminobacter salicylatoxidans adducts with gentisate
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
366
structure length
366
Chain Sequence
b'QNEKLDHESVTQAMQPKDTPELRALYKSFEEESIIPLWTQLGDLMPIHPKSKAVPHVWKWSTLLRLARKSGELVPVGRGGERRALGLANPGLGGNAYISPTMWAGIQYLGPRETAPEHRHSQNAFRFVVEGEGVWTVVNGDPVRMSRGDLLLTPGWCFHGHMNDTDQPMAWIDGLDIPFSQQMDVGFFEFGSDRVTDYATPNFSRGERLWCHPGLRPLSGLQNTVASPIGAYRWEFTDRALTEQLLLEDEGQPATVAPGHAAIRYVNPTTGGDVMPTLRCEFHRLRAGTETATRNEVGSTVFQVFEGAGAVVMNGETTKLEKGDMFVVPSWVPWSLQAETQFDLFRFSDAPIMEALSFMRTKIEGQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gentisate 1,2-Dioxygenase
publication title Crystal structures of salicylate 1,2-dioxygenase-substrates adducts: A step towards the comprehension of the structural basis for substrate selection in class III ring cleaving dioxygenases.
pubmed doi rcsb
source organism Pseudaminobacter salicylatoxidans
molecule tags Oxidoreductase
total genus 103
structure length 366
sequence length 366
ec nomenclature ec 1.13.11.4: Gentisate 1,2-dioxygenase.
pdb deposition date 2010-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3nl1A01
1NE4A 2OYZA 1LKNA 1IPKA 2O8QA 2ZKLA 3OGJA 1YFUA 3SCHA 4R52A 4TLFA 1UIKA 2CAVA 3MPBA 4IEVA 4KWKA 2WC2A 4LUMA 4LULA 2IXCA 1WA4A 5JSRA 3U11A 2QDRA 1ZRRA 4X6RB 2C0ZA 3JZVA 3CEWA 5FLIA 1ZZ6A 4LLOA 3RDIA 3FWEA 1J1LA 3B02A 2B8MA 2PAEA 1RUNA 1H1MA 3M3IA 5CADA 3I54A 5FPXA 4MGIE 5BUVA 1ZVFA 4OFGA 5KHGA 5I0RA 2DCTA 1O3SA 5FCCA 2CGPA 4MGZE 4XFHA 5J48A 1HW5A 2IXIA 4XF9A 4I3PA 4QGLA 4F8AA 4XFBA 2PTMA 3ELNA 2BGCA 2ET1A 5KBFA 3CL1A 5T3NA 4IEUA 4MZUA 1YHFA 5AVPA 1G6NA 4QM8A 1J3PA 1FI2A 1NYWA 2V09A 2N7GA 3I59B 3BU7A 2D5HA 4XFAA 5KHHA 5BPXA 2VPVA 4NVPA 1ZRDA 2GC1A 1V70A 4O9GA 2D5FA 3LAGA 1LB2A 4EV0A 4MGKE 3WW1A 4MGYE 4JV4A 1QWRA 4PIZA 4QGMA 2UY9A 5I93A 2XLAA 4UBGA 4Z82A 3RYKA 3M70A 3FE5A 4CYDA 5EZWA 1VJ2A 3FFQA 5JR7B 4JVAA 4YNIA 5I0SA 2B9UA 4MV2A 3C3VA 3LA3A 4YRDA 3H1YA 1U12A 3RYRA 4I0BA 4QMAA 2HKXA 4QXKA 2F4PA 3D0JA 2Q0AA 3EHKA 1UPIA 2E9QA 1Y3TA 1ZZ9A 1ZX5A 3DL3A 2H0VA 4LUKA 2BNNA 1O3TA 1ZZCA 4EWDA 5FQ0B 3NJZA 5I0TA 1H1IA 1EYBA 2PQQA 2CV6A 3HT2A 3I59A 4XEZA 1NZCA 3H3UA 3H9AA 3LOIA 2MHFA 4IEXA 5I91A 4AQ2A 4MX3A 4FBFA 1O5UA 4I09A 3DKWA 2QCSB 1I5ZA 4IESA 1PMIA 1DGRA 2XHKA 3I7DA 4KWJA 4Q0VA 3BB6A 4N9HA 3E5XA 4FAGA 5LEKA 1YWKA 4JTOA 2P17A 3MYXA 3MDPA 1X7NA 1VP6A 3NVCA 1SEFA 2BNOA 2WFPA 4F7ZA 1O5LA 2GAUA 4IEPA 1PM7A 4X6QB 1YFWA 1EY2A 4ORFA 3FHIB 3O14A 4LA2A 2IXLA 3DV8A 2IC1A 1QY4A 1WLTA 3SXWA 3E5QA 1X8MA 2PYTA 2BYVE 1O3RA 3FJSA 3S7IA 4R8HA 3U10A 4XETA 5LEJA 3OD0A 4ZU4A 1SQ4A 1X8EA 2XGXA 3ZDSA 4XFGA 4IEYA 5BV6A 5FQ0A 3BALA 3R6SA 3SCFA 2VECA 3EO6A 4BHPA 2EA7A 4AQ6A 4J1WA 1SFNA 3NL1A 4Q0QA 4AVAA 3H1WA 1TQ5A 1EP0A 5C6CA 4HVQA 2XKPA 2UYAA 1RC6A 4E2QA 4A2UA 4B29A 4UBHA 2K9ZA 5LRSA 5EFUA 3SMHA 3ETQA 2UY8A 2XKOA 3E5UA 5I0UA 3WW2A 1YFXA 2VQAA 2FMYA 3E97A 4GULA 3HT1A 3GYDA 1RTVA 4Z07A 2PAMA 1O7FA 4WVZA 3NW4A 4IERA 2QVSB 2XLFA 1RGSA 1CX4A 3EQEA 1OD5A 3VHRA 1WGPA 2Q4SA 4HZFA 1JUHA 1Y9QA 4Q29A 1RL3A 5LRRA 3KGLA 4JTNA 5CVRA 2GH2A 4AVBA 5JCTA 3USSA 4I2OA 5FLJA 3H50A 4YYOA 1CAXB 2PFWA 3EBRA 3IDCB 1FXZA 4YSFA 1O3QA 4UXAA 4XFCA 4BIFA 1CAWB 1NXMA 2CAUA 1XE7A 2H6CA 3BPZA 5J3UA 5BY5A 4RD7A 3KCCA 4EROA 3S0MA 2MPFA 3KMHA 4HSLA 5BXXA 4PIYA 2PAKA 2QJVA 5FLHA 5F1RA 4OLLA 3EJKA 1CAUB 3E6BA 1ZRFA 1GQGA 1X82A 3KSCA 1XRUA 4D7TA 1XE8A 2OZ6A 3HQXA 1CAVB 4IEQA 1DGWA 3CF6E 3OCPA 4KL1A 2EVXA 4MH0E 5KHJA 5KHIA 1EPZA 2HJIA 4XFIA 4KWLA 3OTFA 4QX5A 4IEWA 1RUOA 1L3JA 2D93A 4KU8A 3MZHA 4PIXA 3ST7A 4ZU7A 2EAAA 5FDBA 2I45A 1VR3A 1OFNA 5I8SA 4HLTA 4IETA 3GBFA 5I8YA 5JSPA 1UW8A 4E2GA 4IEZA 3FZ3A 2FQPA 4XF0A 3CLPA 2XL9A 4HSJA 5KHKA 3IDBB 2Q1ZB 3QACA 2H6BA 3L2HA 4J1XA 1Q3EA 1DZRA 3QOPA 1CAXA 4Q0PA 1CAWA 4EWAA 2UYBA 4WBBA 5E16A 4BYYA 2Q30A 4I02A 4PJYA 4HBNA 1DZTA 2OPKA 3RYPA 3PVBB 3U0ZA 3E6CC 4XFFA 4LA3A 1YLLA 1I6XA 2OZJA 4HVRA 3H7JA 1CAUA 3ROUA 3UKTA 4WZCA 4AVCA 5D1IA 1O4TA 1CGPA 4BH9A 1CAVA 3RPQA 3CO2A 1ZREA 1ZRCA 4E2SA 2Z2SB 3CJXA 5JSOA 1J59A 1J3RA 4HMZA 3IWZA 2XL7A 5J7MA 4O9EA 3TNPB 1Q5OA 2IXKA 3G7DA 4YARA 4KU7A 2IXHA 2B5HA 3SHRA 1NE6A 4D7SA 1ZZ7A 1ZZ8A 2OA2A 4AXOA 5C8WA 4L2NA 3LZZA 2XLGA 2GC2A 3TNQA 1YUDA 4MUVA 5K8SA 3ACLA 3BCWA 2GC0A 4I0AA 2PHDA 2Y0OA 3H7YA 3DN7A 4LEJA 3SCGA 4FT8A 4QGNA 1Q43A 1YFYA 3IBMA 3FX3A 1OI6A 2QNKA 3LWCA 1UCXA 4ONUA 4P9GA 4XF4A 2GU9A 1UD1A 1ZNPA 1QXJA 2IXJA 4HN1A 3H3ZA 3E6DA 2BNMA 3KGZA 3NSTA 4LTAA 3H1MA 4L11A 4Q0UA 4DINB 3D0SA 3RNSA 3WW3A 1J58A 3OF1A 2ATFA 4I01A 2GC3A 3ES4A 3LA2A 1QXRA 4H7LA 4N9IA 1LRHA 3ES1A 1UIJA 4Q0SA 2MNGA 1FT9A 1LR5A 3HIFA 1OMIA 2KXLA 2Z69A 3PNAA 5CU1A 3N4MA 3UKVA 3WW4A 1IPJA 2PHLA 5HI0A 2D40A 2ET7A 4ZU5A 4HN0A 4HVOA 5JAXA 3IIAA 2BEOA 2ETEA 2K0GA 5FPZA 3H8UA 3S7EA 2GZWA 4XF1A 2O1QA 3NKTA 1ZZBA 4QM9A 3PLQA 3UKNA 2PA7A 4META 1J3QA 5E1RA 1GQHA 3RZZA 4EWEA 4XF3A 4FAHA 4IEOA 5I8TA 2ZCWA 4K8FA 3D82A 3LA7A
chains in the Genus database with same CATH superfamily
1W8UA 2B42B 4Q2FA 4K3UA 3ZVXA 1LKNA 1VBB3 3POSA 2XPJA 1RUE2 3B9IA 3N7LA 3PTRB 1XXNA 1J84A 1SLIA 3HMYA 5CG9A 1E5RA 3RWKX 2XJRA 3AZWA 3SCHA 2E31A 4W65A 3VDBA 4A7KA 1WCKA 1PO12 4YG3A 4LUMA 1UOBA 2IXCA 5JSRA 2ENRA 3NAPB 3U11A 3ON7A 1SG3A 5A3LA 4BM8A 1NX9A 3CQOA 1DQ1A 3CEWA 5D8AA 1ZZ6A 3FWEA 4MVTA 3B02A 4A41A 2QQJA 1AX1A 1RUE3 3VZJA 4DXSA 1RUNA 1ULOA 4QKNA 1GP4A 1QH6A 4H7MA 4M00A 3M3IA 3P5BA 1HJFA 2BW8A 1GICA 3GCWA 4C1XA 1DLLA 1POQA 2DVDA 1AF9A 2PHRA 2YB7A 4PDWA 1YI7A 4YVSA 4LITA 1NOVA 2HWD2 1G7YA 1XB9A 5KHGA 3AFKA 3MBWA 3AMMA 3CJIB 1UXXX 2W1SA 4AZZA 4S2HA 4FTBA 5F3CA 4MSVA 2I2SA 5JI7A 1ND3A 3VBHB 1QNWA 4MGZE 4K1ZA 5J48A 1MVEA 2IXIA 2VE1A 5C3QA 5H9PA 3O0VA 5C3OA 3WNKA 1QOOA 2P5BA 3GHNA 1W6MA 3D4KA 5EYYA 1OOPB 2HEWF 3V0BB 2ET1A 2ADDA 3FLRA 1WMEA 3LE0A 1R082 4GH4C 3WQ0A 4MXWA 4CDWA 4JCKA 2DVAA 1YHFA 1W0PA 4NRQA 3VBOA 3RZMA 2DDUA 4B7EA 1G6NA 2ZEWA 4XCBA 2WT1A 3I2KA 4NHKA 4QU2A 3W59A 5CKNA 4JDMA 5FYZA 2ZHMA 2D5HA 3AP7A 1HDKA 1C8M2 1OLME 1XPWA 4Q4W2 1URXA 2JKXA 1R083 1DF0A 2WSUA 3P1IA 5K4LA 5FY1A 3WEZA 5F3GA 4O9GA 5FOJB 5FXZA 4P00B 1ZBA1 1WCDJ 3WW1A 1RHI1 3VZLA 4YZ3A 3WNOA 1SLLA 2ZGRA 3AFGA 1PIV3 1QWRA 2HYKA 3M1HA 2XLAA 4Z82A 1C8M3 4XE9A 1PGL2 1POV1 4Q4W3 5BNQA 2YFZA 1V6OA 2MEV2 4N43C 5CNAA 3RYKA 3NAPA 4YZ5A 1IQAA 2JG8C 3FE5A 1RMU1 4QHZA 3ZPOA 4CYDA 1C5HA 4XTPA 4IE0A 5EZWA 5LA2A 4DIQA 1PGW1 3WUDA 3A21A 4DQAA 4AYUA 3FFQA 4BIOA 2EICA 4YNIA 2D43A 4B4RA 1SBDA 5I0SA 4EQVA 1KD7A 2RDNA 2VGDA 4NAOA 3HPNA 3ZM8A 1E57A 4YRDA 3VD4A 2J22A 2RS52 4H14A 2MEV3 4LJHA 1AXYA 4QMAA 1Q8VA 2CWSA 4CEYC 2HWB1 3LKJA 4I0WB 5FMDA 3CJIA 5IVEA 1HXS2 3C7FA 3GF6A 5JOXA 2LS6A 3VBHA 4MGQA 5FYHA 4K7JA 3VKLA 1IKQA 1OQ1A 2XBO2 1G9BA 2VBPA 1JZ7A 5FWJA 1HRV1 1OH3A 1OOPA 2DURA 2F17A 3S5QA 3IDAA 4O65A 2GN3A 2C1FA 2Y6JA 4QAWA 5JVVA 3UESA 1ZZ9A 1J1TA 3ABZA 2RS53 3DL3A 5D2AA 4AHYA 2X05A 1OKQA 4LUKA 4OHWA 1LOEA 3F95A 3DPRB 2GP5A 1W3VA 1ZZCA 1XNTA 1HXS3 1ASJ1 3SH3A 3ZKYA 2TBVA 3HT2A 2XBO3 2XB6C 2D3SA 2LALA 4UWDA 1A78A 4GZ9A 4OI2A 3B00A 3LIGA 4WVWA 2QZ3A 5AC91 3H3UA 1CX1A 3LOIA 4CTEA 4G9SB 4GA9A 2ERFA 5FZ9A 1CIWA 4LBKA 2P1BA 1Z7S1 2VOKA 4RQPB 1SCSA 4E4DX 4XCAA 2JDHA 1A6CA 2X5IC 1G8WA 4BXFA 2WNVC 1BJQA 4Q0VA 1YI9A 3THDA 3EMRA 1I5PA 4OI1A 1BMV1 4UW3A 3VDAA 3E5XA 2EXKA 1C57A 3HD8B 4J6GA 1F5JA 3I2GA 4HL0A 3ZXDA 4BXSV 2GALA 2JDKA 1Y9MA 5DAXA 3MDPA 3T30A 1X7NA 5F5CA 1OF3A 1RB8G 1JOBA 3C2UA 1VALA 5T5OA 2BNOA 3PL0A 4DY3A 3THCA 2X8KA 4ZKTB 4F7ZA 1S0FA 1TE1B 2NN8A 2BWCA 3KT1A 5HV0A 4IEPA 5HXVA 2WQ8A 3ZXEA 3PJQA 5A6XA 3BU0A 4ORFA 5SV8A 5I0DA 4QHBA 2WL1A 3FHIB 4ASLA 5FJHA 3BOWA 4RA0A 1CR7A 2IC1A 1NCQB 3SXWA 1RINA 3HN3A 1Q8OA 2JDYA 1GWMA 3E5QA 4QPGC 5FAXA 2G9FA 3DCQA 2DBIA 2XHNA 1NXD1 4CPBA 1T6GC 4E27A 4P08A 1F4AA 5KC6A 3FJSA 2ZBJA 1Q56A 1VBA1 3FLTA 3IM0A 1DGLA 4UAPA 1RUI3 2YMZA 3IPVB 4X8PA 1SQ4A 2WWUA 1W9SA 1VBC2 5GLWA 2ZGKA 3MI8A 4LO8A 3NQHA 4CRQA 3BTXA 3DPRA 2I74A 4Y20B 2ID4A 3IKWA 4IEYA 2QZ2A 2JKBA 3W21A 1CD3G 3JQWA 2ZGLA 2VUCA 4S2FA 4AQSA 4C1WA 1MR5A 2C6SA 4IV1C 3LQCA 1QJY1 1D4M1 2EA7A 2QQVA 5C4WC 1S0CA 1ZM1A 3PTYA 2JD9A 1VBC3 2P34A 1HJGA 2R0HA 4ITCA 5C6CA 4AQTA 3BUCA 2PELA 4NPLA 4RQPA 1QOSA 3NV2A 2WLQA 5ACA2 1JBCA 3BYWA 1IGOA 4V2VA 1NG0A 3B01A 2BOJA 2WO1A 4QWNA 5C71A 3C7HA 3PVOA 3HOBA 3VN4A 1MS0A 2P3YA 3KV4A 3OYWB 4YM0A 4XHBA 3WR0A 5C9AC 4Y5Z0 4GKXA 4GULA 3TRSB 5IK8A 3VBFB 4D3WA 3Q8AA 4IQPA 2HWF1 4AI8A 3GZAA 2HEVF 1NLSA 2XH6A 4CDUC 4NHMA 1LTEA 5F6LB 5ACA3 3R4DB 1K12A 1W05A 3DXTA 2A7AA 1PO22 2VCBA 2QQKA 4NMIA 3ZYHA 3SH5A 4YW6A 4E4HA 3GM8A 5DDJ2 1NCQA 4YM2A 3LDRA 4LBQD 2WO2A 1OA4A 1KEXA 2WRAA 4E9KA 3MLKA 3QBQA 1GNYA 3POBA 3OB8A 4HZFA 1CPMA 4Q29A 1OF4A 5A3OA 1MQTC 1XSQA 2GH2A 3S6PA 1ZRIA 1OUSA 2WLPA 1NUKA 1JH5A 3P3NA 5T5LA 3D3AA 3IPVA 3K46A 3H50A 2BERA 4P9WA 4I2OA 4HT1T 2AZ5A 4XDQA 1CAXB 3EBRA 1FXZA 1A34A 4Q8KA 3PUHA 1TG7A 3IMNA 4Y5SA 1K5JA 4Y20A 1SDDB 2R6QA 3LPFA 2H6CA 2D97A 2XOMA 3AP5A 3KVBA 1OFSA 4FPKA 4YW2A 1UX6A 2EAKA 3KCCA 4RD7A 3WNNA 1RHI3 1FPN2 2CGNA 3KMHA 4MHUA 2JECA 3AZVA 4HSLA 3ZYPA 2P2KA 5FLHA 2W0XA 5F1RA 3BTZA 5CFDC 4NAMA 1TMF2 3E1F1 4OLLA 3PDQA 1POV3 1ZRFA 1GQGA 1X82A 1RMU3 1KS5A 2DVBA 1XRUA 4XYXA 5FKCA 5FZ3A 3ZPYA 4D7TA 4EJRA 1Y43B 4LIVA 4N90A 3AJYA 2OZ6A 3FHQA 2V4AA 2VZRA 2VVFA 3ZYFA 5FP7A 1AYN2 1DGWA 3CF6E 2ZPXA 3OYWA 4XVHA 3WP3A 4NIHA 5EP9A 5CYYA 4KL1A 4Q1RA 2QDNA 4DY5A 2JD4A 2DTWA 4JZRA 5LA0A 1EPZA 1TMF3 3I2FA 3VBFA 2NQYA 4D69A 2BBVA 2VZUA 2GNDA 3PU3A 1F31A 1NA1A 5DUWA 2Q1MA 4AGGA 5BNOA 5ISLA 5FXVA 5JXIA 2D93A 1LEMA 4KU8A 3MZHA 1ASJ2 1O59A 2NYYA 4PIXA 2WO7A 4RHV1 5FDBA 2R072 4Y1YA 4DRVA 1PGL1 5CISA 1HRV3 1UW8A 3BPSA 1F5FA 1UOFA 5DAVA 3I4IA 1SZBA 2FQPA 2YU2A 1T6BX 1V6NA 4XF0A 4EN7B 1YRZA 2ZGQA 1XYNA 2XL9A 4QXHA 3IDBB 3WF3A 3QACA 4FPYA 2W95A 1T2XA 4CP9B 1ENXA 1ASJ3 4ZPIA 1W8HA 4AI3A 1O91A 2WBKA 3OGSA 4A4AA 4LBQB 1Q3EA 2SLIA 3BGAA 2GDFA 1CAXA 3I3QA 3U4XA 1S2KA 1H2LA 4GXLA 1UWWA 1W39A 4GWMA 1GV9A 5FTTC 1CPNA 4EWAA 3TN92 3BOPA 4WBBA 2QQLA 2VOTA 3T4VA 5T50A 4BYYA 1RUG2 2BOIA 4PJYA 4HBNA 3AKSA 4FFIA 5FZIA 1AR72 2B45X 4MO3M 4INDA 3RYPA 2AEZA 2R041 1BQPA 1XE0A 1PK6B 3GZTB 3AKRA 3E6CC 2HWC2 1MPXA 1ND2C 4XHXA 3MHZA 1I6XA 1NZIA 4JQTA 1H8TB 5EXOA 5BNPC 5C4WB 3U4SA 3TN93 2AENA 3UKTA 2IVJA 3T0DA 2ZZQA 3AVRA 1QGLA 2HYXA 4NIDA 2KM2A 3ZXGA 5DMYA 3WF0A 1DYKA 3DYPA 3WZ1A 5FPUA 3RPQA 3CKHA 3AC0A 1IZ3A 1ZRCA 3I8TA 1I9RA 3CJXA 3POGA 1U5IA 4DUVA 4EN6B 2W3JA 2WQ4A 1NY72 2FCTA 2JDZA 4AEMA 3ILFA 3IWZA 4MLOA 5F5QA 1W2OA 3WNMA 4CCKA 1XQNA 2LROA 1OLRA 5FMBA 1YNAA 5F7UA 1JOPA 1F8VA 1Q5OA 2IXKA 4HXCA 1Y7BA 1SLCA 2V5DA 1PZ8A 1CIYA 2PXJA 1UOGA 2WT0A 3G7DA 4PF1A 5IATA 4YLZA 5A70A 1U0AA 2XJUA 2CWMA 2YBPA 2XUEA 5C7GA 3UGGA 1DLCA 3K75B 3LDBA 1UKGA 1W8OA 4AVVA 5C8WA 1UZYA 4LLFA 3OUIA 3VBSC 4W4ZA 2GN7A 1O4ZA 5FP3A 1A8MA 2WS91 3MIHA 2ARAA 4URTA 4CP9A 4AGVA 3J7NA 2GC2A 3ACHA 3ZX7A 1IOAA 1W99A 1COV1 2XVGA 3O7OA 3M2MA 4LBQA 3WG1A 2YBKA 3Q8FA 4I0AA 1UF2C 5A7NA 4DUXA 1L7LA 3C7OA 1H1AA 4LEJA 4Z2AA 1D4M3 2WJSA 4KGGA 5CKQA 1Q43A 5FY0A 5IVYA 4YZ4A 4F3JA 5KXEA 3KF5A 3OY8B 3IBMA 4CCMA 5IVBA 4CA9A 1OI6A 1V6MA 4QD2A 2QQPA 4B7KA 5FY8A 3LWCA 3MUZ1 2BQPA 4ES8A 1LOCA 2V73A 1UD1A 4NPRA 1QEXA 4N7UA 4OHYA 2VW0A 5LA1A 2QQMA 2IXJA 5FZLA 1NLRA 3E6DA 3H3ZA 1PK6A 1TZOA 2E53A 3EB7A 3H1MA 5IK5A 3D0SA 2R062 3WW3A 4GB32 1GBGA 4ARXA 1LOFA 1J58A 1H8TA 4I01A 4IV3B 3VHPA 3ES4A 2AYHA 2W1WA 5GLVA 2NPIA 1YC61 4JGYB 2WABA 3ES1A 4D8MA 2XQXA 2WA4A 5A3WA 3NV1A 1DBNA 3MF9A 3HIFA 3H42B 2KXLA 4I3GA 2VOWA 2WUHA 2ZKNA 1HQNA 3PJYA 2ET7A 1RUE1 4ZU5A 2GNTA 2R063 4HVOA 1RJ8A 4JX0A 4L0PA 5DG2A 2YZ4A 2RHPA 2X53S 4LHNA 5H9RA 4A3XA 3WCRA 4CDXC 3O1RA 4RFRB 1PO11 4GWJA 5GZDA 4JDNA 4BE3A 2O1QA 3H8OA 2JDMA 3MEPA 2J1SA 2WR9A 3MFAA 4B4QA 4B4PA 1AJKA 2PA7A 2WAAA 3U37A 3BTAA 4EWEA 3ME2A 1GQHA 4P5HA 3RZZA 3WHTA 3JBG2 1QDCA 4XF3A 5A7SA 2VCMA 4FAHA 2TUNA 3ALQA 5C70A 5LW9A 4CDQC 4D6QA 5DG1A 5I8TA 2TEPA 2W46A 1ODMA 1ST8A 4PI2A 5A33B 2XXZA 5FO7B 1G9CA 3D82A 3VZKA 2HWD1 4ASKA 4QDQA 5DABA 2OYZA 5CBLA 3VKFC 3ZFFB 5B4XA 1NQJA 3JBG3 5HCAA 3I3BA 5CIRA 1YFUA 1M4WA 1GNHA 4R52A 3WDUA 4TLFA 3O1MA 2DVFA 1BZWA 1CZSA 4P14A 5FXXA 4IEVA 3VD5A 5JZGC 2JB8A 2C4XA 2W68A 3OY8A 1NLQA 4GJZA 1R081 1WA4A 5KR7A 3TEYA 2DU0A 5FY9A 1UN1A 1W6NB 4CZSA 1V6KA 1AL22 4FPCA 3ENRA 4X6RB 3JZVA 4FCAA 1FMD2 2P6CA 5FLIA 2VO5A 1J1LA 1VAKA 4TYSA 4CUAA 3OBAA 1HB4A 2YPDA 4OHXA 4FQ4A 1REFA 1JW6A 1RXFA 4IV3A 5FMOS 3UL2A 2OX0A 2WWSA 1C8M1 1W03A 5FPXA 5GKAC 4Q4W1 1LECA 3ZXAC 2JE8A 1H2MA 1C4RA 1MS5A 2E32A 3HQUA 4JGYA 4LOSA 3MV11 4UF0B 4GWNA 3WQBA 1JZ6A 1AL23 1JYWA 4CEWC 2DTYA 1S0DA 2CL2A 4XJAA 1WUVA 1YQ2A 4JGZC 4PI0A 1US3A 2WKKA 1JZ3A 2D6LX 4XBQA 3T2TA 4RHV3 2Q8OA 4XFBA 1H30A 1RYYA 1R1A2 3GBWA 2R1BA 3WDXA 1FOD2 2BGCA 3ELNA 5KBFA 2OS2A 5J37A 1UYZA 3CL1A 3CHXA 5F2WA 2BUKA 3MO4A 4AHXA 1VBD2 2D7FA 2MEV1 1UKRA 4PLMA 4CP2A 3O1VA 1K5MC 1M06G 4LBLA 5HBAA 4HK8A 4HONA 3ZSEA 3RRDA 1F15A 4CXXA 1NYWA 4L99A 4Z2WA 1TVGA 4AF9A 4CUCA 2R042 3KB5A 1Z0HA 4XFAA 1FX5A 5KHHA 5ABJC 4MXVA 4FP2A 4LNVA 1FOD3 2VPVA 2NLRA 3N7KA 2FDGA 2FD8A 4M01A 4YW4A 3HNMA 2RS51 1N1YA 2D5FA 3KQRA 5A33A 4D0QA 1LB2A 4E4ZA 3AYAA 1QU0A 4NHYA 4MGKE 1CESA 2E7TA 3J9SA 1HXS1 4ET7A 4YVWC 4MGYE 2WZEA 4JV4A 2YBSA 3J4UH 3ZFFA 2XBO1 3I97A 2O0OA 3K3OA 2R043 1HB1A 2UY9A 1Q8QA 2YG0A 1SLTA 3PMSA 4UBGA 5I93A 2ARBA 5F3IA 1GYKA 2PQSA 3HNBM 1W6OB 1W6NA 3SKJE 1CJPA 4ISQA 1XU2A 4NR1A 4S2DA 3WHUA 2NP0A 2EXJA 2VMEA 4AK3A 3VDDB 1LENA 5LBBA 1RUJ2 3LA3A 5FOBB 2BTVC 5IVCA 2JWPA 1U5YA 2VVDA 4HFSA 5A7PA 3ZSLA 3D0JA 4TSVA 1KS4A 3AVSA 3WDVA 3EHKA 3MF6A 3BODA 1N1SA 4YW1A 2A75A 1BK1A 1MZ6A 4AG4A 3NMBA 3WXPA 2BPA2 1UMIA 4XOGA 4LOTA 3ZFGC 1ZBE1 3H8XA 1ODNA 1AJOA 1ZX5A 3LEGA 1J83A 3ZFEA 3WF2A 3U14A 2PHXA 5KXCA 3ZIXA 5BYNA 4QPIC 4OI0A 3GALA 1EYBA 4JKLA 4AEDC 2WZR2 4XEZA 1QF3A 2ADEA 2Y6FA 3PIJA 3ZYGA 1NZCA 2QUOA 2VCCA 3H9AA 4M0NA 3WV6A 3WNLA 1X50A 3WDYA 1H8VA 4EE2A 5FZ8A 1XBFA 2ZGTA 4LR4A 4HG6B 4XBNA 1W8NA 3NNFA 5FUIA 4A6OA 4ZONA 1QJX2 5FUPA 1V6JA 2W9XA 3I7DA 2XHKA 5LCWL 2WZR3 5EJ3A 4YGBA 2XVKA 4N9HA 2ZGOA 1KITA 1Y4WA 4GH4B 2YV8A 5LEKA 3ACFA 1SMVA 4N53C 1VBC1 2W94A 4UW6A 5J36A 3PIGA 1VBE2 4AFDA 4YGDA 3OPTA 4P9YA 5L73A 4J25A 3Q8EA 3NVCA 1GMMA 1REEA 1O5LA 1QJX3 1JODA 2VXRA 3FFZA 3N35A 3IAQA 5EV7A 1N3QA 4X6QB 4NE9A 1YFWA 1EY2A 2WIIB 3WNXA 3O14A 2IXLA 3DV8A 1OSGA 5CKMA 1YXWA 3AL6A 1CQ9A 4NWWA 4Y22B 3NWKA 4URAA 1VBE3 1PO13 3A22A 2PYTA 3PURA 3T2QA 2BYVE 3S7IA 4NPMA 3A0NA 5ACA1 3UGHA 4Q4V2 4ATEA 4AFCA 3OBRA 2ZACA 4M4PA 3T0AA 2Z42A 4HK9A 3RI8A 4N43B 2JG8B 3RZLA 4AVTA 4OHVA 1K45A 3AK0A 4Q4X2 2XG3A 4LHKA 3RZKA 1S1AA 2W5FA 4OZXA 3BALA 2HWD3 4M0HA 5LY2A 3N7JA 4Q4V3 1QJEA 4OMCA 4DEQA 1PO21 4AQ6A 2JDAA 3NL1A 4D7YA 4Q0QA 2VNOA 3H1WA 5DDJ1 1XC6A 2WNUA 4EN9B 2VUJA 5FO8B 1SLAA 5H9QA 3ZXJA 2XKPA 4FXGB 2UYAA 1RC6A 2GP3A 5GLUA 2VM9A 2VZVA 4Q4X3 4CEYB 1Q8SA 4B29A 5A32B 5LRSA 5EFUA 1IG3A 3VD7A 1JUIA 4XQDA 3T09A 3UGFA 4HETA 3MW3A 4IGOA 4OYUA 3GNEA 5T5PA 1FNZA 2D98A 2VL4A 5GLTA 3WW2A 1QHDA 5FMOL 3ZKUA 1YFXA 1VMJA 1H2NA 4PT6A 4CU9A 1C28A 2DUPA 3B69A 5EJZB 4Z07A 2WFF1 3VUOA 2VMGA 2PAMA 5TSWA 1JN2P 1O7FA 5IT6A 3MPPG 2CDOA 1JU4A 1MZ5A 3GBGA 3NW4A 2QVSB 4KG0A 1WMXA 4KBBA 3PHMA 4AFMA 5FZGA 2QKDA 4HKOA 1WKYA 5FYYA 2VOVA 3J8F2 1FPN1 4JKMA 2YHJA 4A7YA 1W9FA 3KT4A 3ATGA 4WVVA 5IYYA 4Y22A 3FC0A 4NN0A 5T54A 1Y9QA 3UV9A 1TMF1 3FLPA 5LRRA 3N3HA 4JTNA 3FUOA 4AVBA 2XWBB 3M3CA 5KXDA 1XYOA 4AL9A 3USSA 3KWVA 2X5IB 2LTNA 2IVIB 3HVDA 2FBEA 4XUOA 2P3KA 3Q8CA 4UW4A 2QQUA 3J8F3 1AYN1 2PFWA 5EJ1B 2GMEA 4N43A 1UYPA 2VTFA 4WM8C 2JG8A 5JWPA 4KQ7A 4UXAA 2QQNA 5HPOA 4BIFA 1O3QA 2P4EA 4LORA 2ARXA 1W9YA 3ETPA 1XE7A 2ZHLA 5J3UA 1YIFA 2ZXQA 5HCHA 1BBT2 2E33A 3OUHA 1GR3A 3LFIA 5BY5A 1GWLA 1HN1A 1UMHA 3HN1A 4EROA 1KXGA 3SITA 1HKDA 2PN5A 3DEMA 3PUSA 4KBZA 3ILRA 2DVGA 2YY1A 1LCLA 2R071 5LB6A 4JKKA 5BXXA 4E4SA 1F35A 2G9GA 2PAKA 2QJVA 4QPGB 4AVSA 4EZHA 1GSLA 4O7XA 3AP6A 2JJ6A 2NMOA 3VKMA 3AM2A 3R0RA 4MGSA 4W50A 4D94A 3P3PA 3E6BA 5JI9A 5A32A 2WDBA 3KSCA 1TME2 2XQRA 2BFUS 2J1UA 1JHNA 3NKGA 2RMU2 2RS32 5FYIA 3HNYM 3ZMNA 1PX3A 5A80A 1CAVB 1Q8PA 4IEQA 4K9SA 3LEKA 4CU6A 2J1EA 4RGAA 5FUNA 5A6QA 1BLZA 3UETA 1ZBE2 2HJIA 4Q4Y2 3TN91 3N7MA 5IFPA 4XFIA 3OTFA 3IDEA 3Q8BA 1L3JA 1RUG1 2RS33 4YGCA 2R0FA 4IV1B 4XUPA 3ZIWA 1AR71 4P5YA 4IL7A 1C3HA 2VQTA 4FFFA 1VR3A 2D3PA 1OFNA 2IZWA 2W47A 4OUMA 4W6XA 4Y1XA 5I8SA 1E5HA 4HLTA 1UMZA 1DQ5A 3GBFA 4BCUA 5I8YA 4OZOA 2HWC1 5JSPA 1LHOA 1XU1A 1OA2A 3ZSKA 4E2GA 3W5MA 1ZBE3 1RUH2 5FBZA 1S2BA 5IK4A 1VB4A 3MUY1 5FZ0A 5A7OA 2ZGSA 5KHKA 4QKFA 2H6BA 2X5IA 3KZ4C 5C3SA 1UAIA 1XNCA 4XJZA 4DNYA 3M8LA 3KD4A 1C8NA 2ZX1A 5IW0A 5C8CC 2OPWA 2Z4FA 3VV1A 3GHMA 5LATA 1RUH3 2VG9A 1NY71 4RL7A 2BGPA 4CDUB 2WWJA 1X33A 5DZEA 1DZTA 2OPKA 3T08A 4LHLA 1LODA 3PVBB 3SLIA 3WVJA 4MG2A 3DKQA 3QCWA 4QPGA 4Q27A 2ZZJA 4IE4A 1VIWB 3DECA 3CZUA 3H7JA 3N9PA 4CVUA 2VQ0A 4GKYA 1LGCA 1BVVA 1MQTB 4ARYA 3NJYA 5D1IA 1O4TA 3ORJA 3I49A 4FFHA 3CDZB 3EYPA 1CAVA 5GJ6A 1R1ZA 1XNKA 3VDCA 4BMBA 1ZREA 1WD4A 2VY0A 3I3EA 4FFGA 4OMDA 1YQCA 4QPWA 3RFRA 3B3QE 3F2ZA 2VXJA 3MICA 1UY4A 2PHTA 1UYYA 4NIGA 2LM3A 2A1XA 5J7MA 3ZR6A 1XNDA 3JD72 4IV1A 2A71A 4XJWA 2DU1A 4R9DA 2ZGPA 4AEKA 5C4WA 2AEYA 3ZXKA 2IXHA 3IB3A 1JYCA 4Q5OA 2R061 5JIUA 1KGYA 3MFCA 4GB31 4OI4A 5F3EA 2OKXA 1NE6A 3LB9A 3X29B 4D7SA 1ZZ7A 3T2PA 2OA2A 4PCRA 3RWNA 4L2NA 1HV1A 1OUXA 2XLGA 1PX4A 3NNLA 1U5XA 1W04A 1W8ZA 4RR3C 4AR2A 1HRI2 4V1PA 2FDFA 2XDVA 3WQ1A 5K8SA 3ACLA 3WDTA 2GC0A 4XBLA 3DN7A 3N9MA 3SCGA 4EYUA 1PO23 4QGNA 2CSGA 2XJQA 3LFMA 4QHOA 1PNGA 5F39A 1JYXA 5A6YA 3FX3A 2A73B 5DDJ3 1KRIA 4QX8A 4M3CB 3WSOA 3RI9A 5A6ZA 4CCDA 4YPJA 2WFF2 4DEVA 1PHMA 4Y33A 3WG4A 4HN1A 1C5IA 4Q0UA 2BNMA 2VBDA 4WV8A 3PUAA 4L92A 1BXHA 2DUOA 3RQ0A 2NZ9A 3HR9A 3I2IA 1SLBA 1BK0A 3JBG1 1LGBA 4HOOA 1SDWA 2VUAA 5A1AA 1RUD2 3OF1A 2KD7A 1WLDA 4NRMA 3HBZA 4NIAA 3AX4A 4N9IA 1MQTA 5L9RA 4AI2A 1UIJA 1WW7A 2OW4A 1ULPA 1FT9A 4Y1VA 1UYXA 1LR5A 1YCIA 2WFF3 3BIWE 1OMIA 5CU1A 2Z69A 3I3DA 5DUXA 5HCBA 4BOWA 4COZA 2V72A 3N36A 2YDEA 4W6WA 2D40A 4Y24A 1XNAA 4FO9A 4LXLA 4YZ1A 2BEOA 4L9BA 1FPN3 1W0OA 1RUD3 1S0IA 3H8UA 2GZWA 4XF1A 5A7WB 2ZAAA 1V00A 4E8DA 3J7MA 3U1XA 1NA1C 1WZXA 4FTSA 2C9AA 2JX9A 4FPLA 3I3MA 5BNOC 1OLQA 3ILNA 1AVBA 1X9PA 1AL21 1C1FA 3KV6A 1V6LA 1FMD1 5A1LA 5A3MA 1ENQA 3ZOIA 3A23A 5G04L 1UXZA 5FYCA 1ND2B 1W28A 1DYPA 2VTXJ 5CFDA 1AYN3 2C9KA 5BNPB 4L8QA 4IEOA 1BEV2 4AGRA 1MS4A 5FKBA 3GJAA 5F37A 1IPSA 2GMPA 3C7EA 2VVEA 3LA7A 2PHUA 1NE4A 4RYDA 2ORZA 2GNMA 3GJBA 1IPKA 2IUWA 3KCYA 3IMMA 1PGSA 2EALA 1FV2A 2JIGA 4CCLA 4FVVA 3QLQA 4TZDA 3KVAA 2CYFA 3P6BA 1UIKA 2CAVA 2P37A 1QDOA 2R073 1R1A1 1YQ5A 3MPBA 4JHZA 3SISA 1FOD1 4LULA 1JZ4A 1BEV3 1WBLA 4M3CA 2RDRA 1WW5A 2TNFA 2QDRA 2ZX4A 1DYOA 1VBD1 3MIBA 2BFUL 2C0ZA 4QX7A 2UURA 3N9QA 5FZ4A 2B8MA 3IIIA 4LKFA 2PAEA 2PLV2 2XWJB 3BKZA 4C8DA 5GLZA 2WSVA 5EIYB 2VZ3A 3WOGA 2VZQA 3H3LA 5CADA 2WYSA 3I54A 1K3IA 4LE4A 4KWUA 1ZVFA 3VBSB 3O1TA 4ISRA 2Q5TA 3OJBA 3OUJA 5I0RA 2DCTA 4XUTA 1F4HA 3KM5A 4C91A 4AWDA 5FCCA 4LKSA 3WP5A 4BLJA 4XFHA 1RUG3 1ENSA 2PLV3 5A3NA 1IS4A 4R9AA 1AR73 2EIDA 4LBNA 3ACIA 3VD9A 2P6HA 4B1LA 2HWC3 5A7WA 4JQRA 3AMHA 2B39A 4D6RA 5FY7A 4MZUA 3LCPA 5JMCA 3W9AA 3GZUC 1GOHA 2JXAA 3POYA 5FYBA 4N8MA 4UFMA 2HLEA 1J3PA 3V0BA 1LU1A 1UO9A 2N7GA 3BIEA 2CHHA 2ZGMA 1ND2A 2Y8KA 3BU7A 2RM22 3QH7A 5FY4A 1FATA 5K7PA 1RUJ1 5BNPA 1ZRDA 4DPNA 2GC1A 1EUUA 5C33A 1ULCA 4FSJA 1XYPA 3LAGA 4EV0A 2F6BA 3DF0A 2UU8A 1HQWA 5FZCA 5FY5A 3UT0A 5CFCC 2D6NA 4XPVA 1UQXA 4A6SA 4S2GA 5EYXA 1NCRC 4PIZA 4QGMA 2ILMA 1PNFA 2RM23 4CDXB 1NAEA 4QQ2A 3ZLIA 2JG9C 4QKDA 4DOUA 3IN9A 1LESA 1MVQA 4B3NA 4AHWA 1Y9GA 1QJU2 5FRAA 1LGNA 2ARCA 1ULGA 5JR7B 4K21A 4YM3A 1TEIA 2JDUA 2VUDA 1RVF2 4MV2A 3C3VA 1F2NA 1B35C 1LHWA 2HWE2 2WNEA 2WZR1 1UZVA 4FTEA 2WO3A 1KJLA 2Y26A 3TAYA 2D6KA 4M3CE 4CDQB 2IWGB 4CCEA 2JB4A 3H1YA 1U12A 4XACA 4I0BA 1W2UA 4GALA 4XILA 4PLNA 5T5JA 3RYRA 5JAXA 2QTWB 1ZA7A 4QXKA 1RUF2 3POEA 2GMMA 3UJQA 1TNFA 4DRRA 2Q0AA 3LD8A 2FDHA 1OD3A 4E8CA 1UPIA 3FHAA 2E9QA 1QJX1 4XDPA 1LU2A 5GZFA 5FIXA 3LPGA 1H2KA 1Y3TA 2CNAA 2R49A 4XXPA 1KDKA 1R092 5JZGB 3WX5A 2AACA 4QQPA 3KHCA 1K42A 4GB33 2DV9A 2H0VA 5DAWA 3ZYJB 1O3TA 1RUF3 1VBE1 4AOCA 4ZXEA 5IFTA 3J26N 3G6JB 3JUUA 3NJZA 3OG2A 5FQ0B 1NQDA 5I0TA 4XZPA 2CV6A 4YG0A 4NHLA 2AR6A 2C24A 4YGEA 5F5AA 4QX1A 2RR12 1AYM2 1R093 2ZJCA 2VZOA 5BNNC 4A7ZA 4BB3A 5I91A 1OPOA 5J1XA 5FP9A 4HKWA 2WN3A 1FYUA 4MX3A 5J09A 3PVEA 1O5UA 1MEC2 3T2OA 4CEWB 5A3PA 4OQ9A 1DQ2A 2WT2A 1NT0A 4JGZB 4YW7A 3WCSA 1I5ZA 4CU7A 1PMIA 2PHWA 3R4SA 2JDPA 2BBAA 4Q4V1 4PQQA 2WN2A 4CDXA 3SNMA 4GWIA 4FAGA 3NV3A 1FAYA 5K0UC 3CU7A 4JTOA 1W2AX 1JOJA 1GOGA 5HCFA 4BQ4A 1K5MB 3MYXA 1LOGA 2W1UA 5ERLA 1VP6A 4Q4X1 1G9AA 3OGVA 4R9BA 5CA6A 2JICA 1JTZX 2GAUA 1WMFA 1YQ6A 5JDBA 3V0AB 3U07A 3VBUC 2J7MA 5ABJB 5IVFA 4GMP0 1N1TA 4TTGA 5CZKA 5G05L 5SV5A 4CDQA 1UZWA 3OSDA 1X8MA 2VZ1A 1EUTA 2AGSA 2SBAA 4H55A 3O1OA 1O3RA 1WMDA 2ZA9A 1NKGA 2VZTA 4R8HA 4UFLA 5E8AA 2EXIA 4YVWB 4XETA 3POWA 5LEJA 1FMD3 1P8JA 3R4UA 4A42A 3AXDA 2CTVA 4BQ3A 4DXRA 5JZGA 4PBPA 4EN8B 4XC9A 1X8EA 2D6OX 1O8PA 2XGXA 4MHRA 4OQ8A 4XFGA 3NNMA 1CWPA 4NO4A 3KF3A 3ACGA 2JEMA 2UWBA 2DBNA 3SC7X 1ULEA 3V64A 2Y34A 3BN6A 4QXCA 1MS1A 4ASMB 2W91A 3R6SA 4BISA 2VZSA 3AL5A 1S4CA 2EXHA 5F9TA 5FQ0A 2VBBA 2C26A 4BHPA 1W8WA 4J1WA 1SFNA 2B9VA 5DZGA 3J8F1 4AVAA 4WM7C 1LOAA 4K40A 4XZUG 2VR4A 1R1A3 5FZDA 3KQ4B 3K2OA 1AR82 1H4GA 2G1MA 3MW2A 4XQ4A 4CEWA 2K9ZA 4K1YA 4JGZA 4XQWA 4IGPA 1MZFA 1AR92 1VBD3 1G9DA 4H2AA 4RGGA 4KI5M 4EZ4A 2G19A 3SMHA 3ETQA 5FZHA 2BVBA 3AKQA 4RSUA 5IVJA 2XKOA 3OOXA 4OVEA 4IUGA 5FPAA 3ZFGB 3VKNA 3N9LA 3I2JA 4WVMB 4K8RB 1HV0A 5KXBA 1JYVA 3K4ZA 2FMYA 2B46X 1Z78A 3HT1A 4AI0A 1DGWX 1K5MA 1SBFA 1QQP2 3DYOA 2DFCA 3INAA 4XIOA 3VBRC 4QPIB 3O12A 1PVC2 4OHZA 3ZMOA 4AAXA 1BBT1 3KV5A 4AEDB 3V0AA 2G9ZA 5L9BA 1S2EA 2GNBA 1XNBA 3HQRA 2QQOA 3ECQA 1VMHA 1RGSA 3GCXA 3H0OA 3RSJA 5ABJA 3JB8A 2P3IA 3EQEA 3POJA 1OD5A 2J1VA 3ITQA 3VHRA 4FOVA 1WGPA 5IAXA 3UJOA 5A1FA 1RL3A 5F8PA 5LBEA 4CXWA 4BJ0A 4QB6A 1D0HA 5A3TA 4UF0A 1BYHA 3O1PA 5LK5A 2WYFA 1TME1 4M3CF 3O1SA 3WLUA 4PLOA 2RMU1 5LK7B 2RS31 2HH9A 1WD3A 4RGKA 1EV11 3AMQA 4YFWA 1DHKB 4YYOA 3VLBB 3IDCB 4PQ9A 3GXUA 1RUJ3 4LO7A 4N53B 1H6YA 3WDWA 3ZFEC 4CCJA 4XFCA 5FZBA 3J7HA 4YW3A 1NXMA 2E63A 4Q4Y1 5EPAA 2CAUA 4AI1A 3BPZA 4XMIA 4ZHNA 2FDJA 4BDVB 2IFRA 4Y26A 4RS5C 1GLHA 2MPFA 3JQXA 2JE7A 2OUHA 1D2QA 3TEXA 1OURA 4DFSA 3A0KA 1JU3A 2Y38A 5L7OC 4LBJA 1RUH1 2FMDA 2Y33A 3U78A 3ZN6B 2BDRA 4QDSA 5FZOB 3AXEA 1UY2A 1CZTA 1VPHA 1A8DA 5EQUA 1EAH2 1DIWA 2W52A 2Y6LA 4XABA 4YG6A 1FNYA 3ZFGA 1JYNA 2PMWB 4WVMA 4XJUA 4DO0A 4HANA 1OLMA 3A4UA 4UYBA 2EVXA 1ZA4A 1YJLA 3O1UA 4CE8A 1LULA 1L7QA 5DN2A 1WCUA 1VBB2 4KWLA 3THPA 4QPYA 1W6OA 2AUYA 4QPIA 3RJRA 3RMYA 3O0WA 1RUOA 4W6YA 3I2HA 1JMUB 1V9U2 5D8AC 2EAAA 1E5IA 2KR2A 1EAH3 4XUQA 3WQ7A 3ZYIB 4IETA 3VDDA 3OBTA 3R05A 1AX0A 4IGQA 1W6PB 4XXAA 2VMFA 3OPWA 4XW3A 4PDWC 1F9KA 1US2A 3D6EA 1DU3D 3OEAA 2EIBA 4Y3OA 4YVSC 4HSJA 2UWCA 1A3KA 4ZS2A 4JAAA 3AKPA 3AZYA 2EIEA 1V9U3 1LNSA 1ND3C 2D44A 2WINB 2ZEZA 4J1XA 1RITA 1S55A 1VRBA 3QOPA 1UOJA 2ZHKA 2JE9A 1QXPA 2YUEA 3AYDA 4N53A 3WINE 3AYEA 4Q0PA 4YM1A 1STMA 3KCXA 4C0HA 1SPPB 1GANA 3AMNA 1UU5A 5JPMB 4CDWC 5E16A 1GZTA 4OUEA 4I02A 2W39A 4CPBD 3VBOC 2K2SA 3TB0A 1YYNA 2QQWA 3JD71 3U0ZA 3OBZA 2VNGA 1CVNA 4XFFA 2YROA 3IT8A 4LA3A 2WNUC 2XJVA 4UW5A 2OZJA 4HVRA 1X36A 1WBFA 1UZZA 3HEIA 5LZ6A 2A6VA 1DP0A 1CZVA 3ZN6A 4Z92B 3M4FA 4AVCA 5FZOA 2GSYA 1CGPA 1HRI1 4FOYA 1YQ8A 1OPMA 4CU8A 1AUYA 1DQ0A 2Z2SB 3Q9OA 2K46A 1VRH2 4QQHA 4WM8B 4NRPA 1OBNA 3KHBA 3SEPA 3SKVA 5JSOA 4GH4A 3CZJA 4FPGA 3NAPC 5E88A 4NROA 4XAEA 2HEYF 4O9EA 4DMIA 5FR3A 1PIV2 2R30A 3MW4A 4IXLA 4LO5B 4R4XA 3FMGA 3TNPB 3M3QA 2D3RA 2HBTA 1MZEA 2RVAA 5C3RA 4LK7A 4JC1A 4KU7A 1W2TA 3POFA 4YARA 2DYCA 2VW2A 4XUNA 5A3UA 1W6PA 1VRH3 2Q8DA 1GP5A 4BQ5A 3T1MA 1RUD1 1ZZ8A 3NRUA 3VL9A 4LBOA 2BV4A 3LZZA 4L97A 4NWVA 3LSEA 1G9FA 1ZYBA 4K6BA 5KWRA 1AX2A 3CJIC 1TNRA 3VBHC 4CCOA 1H9WA 4MUVA 3TYJA 2DCJA 5JLVA 1HIXA 3H7YA 1L7RA 1W9WA 2WNVB 4FT8A 1SHWB 3MIGA 5AFEA 1OOPC 1YFYA 3V65A 3HWJA 2RS11 1SPPA 4LHSA 4CUBA 3AB0A 4Y1ZA 1QH7A 2QNKA 4CCNA 3AZXA 4Q8LA 3WF4A 2I07B 4ONUA 4P9GA 1ACCA 1BCXA 2VMHA 3S57A 3ZDVA 1GP6A 3RVHA 2JENA 2X10A 1AR62 4BPZA 2A5ZA 2CY6A 3NSTA 4LTAA 4OCTA 4DINB 5L36A 2R1DA 1JZ5A 4ZZ5A 1GZ9A 4PBOA 1D7PM 2VMDA 2VULA 2W2IA 4MADA 1VAMA 2GC3A 5FWEA 4H7LA 1BEV1 1LRHA 2XMLA 3C8XA 3LEMA 2Q8CA 2MNGA 4CEYA 3D5OA 2BU9A 2R7EB 1QKQA 2WZ8A 3BI3A 5FP4A 3N4MA 1JI6A 3UKVA 1AR63 3URFA 4CUGA 1RUC2 1E5SA 2GH8A 1BBT3 1GNZA 2PHLA 3OEBA 4U36A 1EV12 2VJXA 3RZHA 4WM8A 2K0GA 2YXSA 5C8CB 3AYCA 1JHJA 3RJ2X 2YYOA 4B8EA 1CJDA 4BZ4A 1AZDA 3VB9A 1ZZBA 2E51A 4QM9A 4JRLA 1W9TA 3NJXA 3PLQA 5FZFA 4BK5A 3GDBA 2R16A 4P9IA 2AC1A 4META 2RJKA 1TME3 3NV4A 5DZFA 5E1RA 5B2GB 2Z5WA 1RUC3 2RMU3 5FBJA 5FK8A 2PLV1 3T0BA 2OUJA 1EV13 4QDRA 3RGBA 3BTYA 1UX7A 4GJYA 4FP3A 4AI9A 1VLNA 5FZKA 5J96B 1UY3A 2OQ6A 2XVLA 5DAPA 4K8FA 2Y64A 4Q4Y3 5ANQA 5FYUA 2O8QA 4IE5A 2BJSA 2ZKLA 4QB2A 3OGJA 2WNVA 2XJPA 3PVNA 4K20A 1VAVA 4FPFA 4KWKA 2WC2A 3T1LA 1IKPA 2O8OA 5C9AB 2VZPA 3PUQA 5E6HA 2FZ2A 2XJTA 2ZEXA 1JZ8A 5JXGA 1ZRRA 1PZ9A 3DPRC 3M3EA 4GQ7A 4NJ4A 4BQ1A 4BQ2A 5E89A 1RUI2 2Y60A 4LLOA 3RDIA 5FREA 3K48A 2W87A 5D21A 2W08A 4QX2A 1DG6A 1H1MA 2XR4A 4NIIA 3U75A 2RM21 5GALA 1LOBA 4MGIE 1V6IA 5BUVA 4OFGA 5FPBA 3LSDA 4R9CA 5CFDB 1H9PA 4RQPC 5L9VA 1O3SA 1WA6X 4RR3B 2ZHNA 2CGPA 3KT7A 2A6XA 3C7GA 4QQOA 1HW5A 4XF9A 5IUQA 4I3PA 4QGLA 2ZTNA 1W0NA 4F8AA 2PTMA 1GZWB 5C8CA 5LY1A 4SBVA 3JB4C 5T3NA 1QJFA 2QFEA 3IZOA 4IEUA 1QMJA 2C5DA 5F5IA 3ZN4A 2J42A 5JOWA 4LBMA 5DQ0A 5AVPA 2BWAA 4G4FA 2E7QA 2RJ2A 4QM8A 1FI2A 1QJU1 1W6QB 1IHMA 2V09A 1POV0 3I59B 4OULA 1R64A 5HXMA 3PU8A 1RVF1 4D6SA 2HWE1 5BPXA 2ZEYA 3N9NA 4YW5A 3JCIA 1CONA 1NCQC 4GAZA 4NVPA 1V70A 2UWAA 2YFUA 2VW1A 2LW8A 1RUF1 4V2WA 2XONA 3WP4A 5IHRA 1UL9A 2WZPP 4QB1A 1S0GA 1SFYA 1H4HA 1LHVA 2A6YA 1GFF2 3JD73 2VTXA 3VL8A 3ZSJA 4LO4B 5JMOA 4TWTA 1V0AA 1R091 5C9AA 4COYA 5FZAA 1XSRA 1NA1B 3M70A 4JRAA 5LBCA 4A45A 3TEWA 1OA3A 4UFKA 5AFBA 5BNOB 3RMXA 1VJ2A 5EHDA 3USUB 4CDUA 4JVAA 4DXZA 2B9UA 3DXUA 1HRI3 2J1AA 1VB2A 3OGGA 4XDOA 1N3PA 2A3WA 2RR11 3T4HB 3O5SA 5C5TA 1AYM1 1UY1A 2RDSA 3TBDA 4XMAA 2HKXA 4KMQA 2F4PA 2Y6GA 3ZYBA 2DFBA 1ZBA2 2AREA 1MEC1 1RHI2 4RR3A 4Y1UA 4B1MA 1JZ2A 2Z79A 2HBUA 3B7MA 3K77A 3NNGA 5JR2A 3VZMA 3BVCA 2OXBA 4BWOA 2A3YA 3UNPA 1GZWA 5LBFA 3EXUA 1KFXL 2A3XA 4Z8BA 3GGLA 3WY6A 3OGRA 1RMU2 1UZ0A 3DUIA 2RS12 3MIEA 1U5ZA 3LIHA 2BNNA 2OT7A 1PGW2 3VBFC 4XIKA 4EWDA 2WQZC 1O4YA 1KQRA 1ZBA3 4XURA 1W6QA 1H1IA 4QU1A 1OHFA 1H6XA 2PQQA 3B93A 4Y4YA 3I59A 1WCSA 2DF7A 3PMEA 5DAQA 5IWFA 3FUQA 5LA9A 1IQDC 3I2DA 3CMGA 5B4NA 2MHFA 4IEXA 3J7LA 4BQXA 5FPVA 2HWB2 2RS13 4AQ2A 4FBFA 1W90A 5T52A 4I09A 4C0BA 3DKWA 4XJ8A 1IS3A 1BHGA 5FZEA 1D4VB 2QCSB 4IESA 3LOBA 2EF6A 5F32A 4KWJA 1DGRA 3AZZA 3VGIA 4YFZA 1HRV2 2R32A 2D6PA 3BB6A 1D2SA 4CXYA 1HB2A 1BKZA 4UFHA 4A3ZA 1YWKA 3FBMA 1W2NA 2VCAA 3TOJA 1DGRN 2VD7A 2P17A 1YO8A 2HWB3 4TLGA 3AP9A 1SEFA 3USUA 2WFPA 3APBA 2B4KA 4HPKB 4UI9L 1C1LA 4MGTA 5EWSA 2G4IA 2CGOA 1PM7A 3DGTA 2BVVA 1DZQA 5AC92 5LASA 3W58A 1OKOA 4KG8A 4LA2A 2PHFA 1QY4A 1WLTA 4BQWA 1Z7S2 5CFCB 3HBKA 1AR81 1X9TA 2LRPA 3PUIA 5FYVA 1AXKA 2VC9A 1AR91 2WA3A 3U10A 1WWYA 1NCRB 2F4LA 3MIFA 1BMV2 3OD0A 4Y5TA 2J1RA 1LJ7A 1ULDA 5AC93 4ZU4A 2DCYA 1VE0A 4AHZA 3KLSA 2JG9B 1B09A 2FDKA 2IFWA 3ZDSA 1IS5A 4QQLA 3CNAA 2E7AA 1Z7S3 3POIA 4GMP1 1RXGA 1QQP1 3K51A 5BV6A 4LPLA 3IAPA 1N3OA 3SCFA 4AAPA 2DCZA 4IDZA 1KJRA 2VECA 3EO6A 1PVC1 2VQUA 4FI9A 2BP6A 4FPJA 1B35B 1PMJX 5JOYA 3WF1A 4AE2A 3MV01 5L19A 1OVPA 1TQ5A 1EP0A 4ZXKA 1QOTA 1IG0A 3QD6A 3SQOA 2B7YA 4HVQA 4E2QA 4N7IA 4A2UA 4UBHA 1VBA2 2RE9A 4U2AA 1GU3A 4O61A 3CBNA 1I3HA 4FXKB 4UT5A 3I2OA 4QX3A 4A44A 3M3OA 4RN5A 4QX0A 5JIAA 2UY8A 3E5UA 5I0UA 2CU5A 3RZJA 2XJSA 2YGLA 1LHNA 4DUWA 2VQAA 4M4RA 3MGUA 3E97A 5AVAA 4KH9A 2ORXA 4NUBA 2NM1A 3NJVA 3GYDA 1RTVA 2LUWA 3K4AA 5GZEA 3W20A 3ZXFA 3W5NA 1VBA3 4HPKA 1I1EA 1O8SA 2ES3A 2OVUA 4WVZA 4IERA 5T55A 1UNBA 1QJY2 1MS9A 2J1TA 1D4M2 2YC0A 2VNRA 3H8RA 2XLFA 4LMFA 3D8CA 1PK6C 5GZCA 3A7QA 1CX4A 5ANNA 3VD3A 4AEJA 1KFUL 5BNNB 1QJZA 1LOFC 2Q4SA 4RFT0 1H8TC 2D6MA 2VNVA 1JUHA 3L9JT 5CFCA 4CSWA 5F2SA 3WG3A 3KGLA 4SLIA 4XTMA 5CVRA 5JCTA 3VBSA 2ZX3A 1SACA 2L9LA 3MLJA 4BLIA 1YJKA 5H9SA 1NCRA 1QJY3 3T3YA 1QJU3 3VHOA 5FLJA 1EAH1 1PM4A 1EPWA 1RVF3 1PZ7A 2JG9A 1WLWA 2HWE3 4YSFA 5K0UB 2OQ7A 2DUQA 3JXSA 2HWF2 5DUVA 1CAWB 2YC4A 4TN7A 3N9OA 5FYMA 4KGQA 5IK7A 5FXWA 2P3JA 4LKEA 3UK9A 1HLCA 4MOAA 1VBB1 2DWRA 4COWA 2ZABA 4FQZA 3S0MA 1B35A 5FJKA 1XJAA 1V9U1 4P9XA 2E6VA 3VBUB 1PVXA 2ZGUA 3RS6A 1GQPA 1WW6A 3ZO0B 4COUA 1LAJA 4PIYA 4JHTA 2HWF3 3EJKA 4YZ2A 1CAUB 4R4ZA 4XJ9A 5FO9B 1O6UA 1WW4A 2VOXA 3VZOA 3WNPA 3ZN5A 2O14A 1XE8A 2JIJA 2ZMLA 3WP6A 4AFBA 3L2YA 4CCCA 1JYTA 4BQYA 2V4VA 3HQXA 1IS6A 1REDA 3OCPA 1MS8A 5FK7A 3B9CA 2FCUA 2KA3A 4MH0E 2RR13 3AMPA 3KV9A 5KHIA 1GOFA 5KHJA 3S5AA 3WG2A 1AYM3 5KC5A 4C90A 1AHSA 4QX5A 4IEWA 1AL0G 4LQRA 3DYMA 1MEC3 3ST7A 4ZU7A 5FZ6A 4AFAA 5K9YA 2I45A 3TEZA 2VMIA 5CAZA 4ATFA 2A6WA 3HJRA 4WM7B 5BNNA 1GUIA 4IV3C 4IEZA 5FP8A 4EN0A 3FZ3A 1G86A 3NO8A 2ZGNA 5F6KA 2Y0IA 5GM0A 4JGYC 3CLPA 2VU9A 1QNYA 2CDPA 1DCSA 1ULFA 2VMCA 2ZX0A 2Q1ZB 4G3YC 4FOWA 3MIDA 4TXWA 2QBXA 2X09A 1LHUA 3L2HA 4DZGA 3KS7A 2RG4A 3WUCA 3WD5A 4P9LA 2NMNA 1DZRA 4Q1PA 3OPZA 4UFIA 5K0UA 1VRH1 3QH6A 4FPEA 4ZZ8A 2AH2A 5C3PA 2QQIA 1CAWA 2UYBA 1W8FA 2Q1FA 2ZMNA 5FYSA 3VBRB 4BK4A 4ZS3A 3AJZA 2Q30A 5FZ1A 2X29A 3AKTA 4P9JA 4F83A 4RHV2 3GZEA 1JS9A 2V5YA 1PIV1 4NOTA 5DUUA 3VBUA 5C5UA 1ALYA 2ZMKA 1W3XA 4HKLA 4IE6A 4NHXA 4X8NA 1SCRA 1HN0A 5FZ7A 1UY0A 1YLLA 5FYTA 2JDNA 1CAUA 3B5LB 4XAAA 4UOJA 2Q8EA 3ROUA 1GKBA 2Y6KA 3HAGA 3VKOA 4WZCA 1S0EA 5FPLA 1S0BA 3VHNA 4AW7A 2YGMA 2RDQA 4BH9A 3AP4A 5JPNB 3CO2A 3ZFFC 4LO6B 4FPHA 3OD4A 5FZMA 4E2SA 1W06A 1UU4A 3ZR5A 2FDIA 2W1QA 5APAA 3S30A 3ZFEB 1DDLA 2BRTA 4I30A 3FBYA 5LWBA 2YPJA 4Z1VA 5CB7A 5M0TA 1J59A 1J3RA 1OC1A 4HMZA 4CP1A 2ZOEB 2XL7A 2XUMA 1DFQA 1AR83 1S0JA 4Q26A 5FFOC 2YC2A 4RS5B 3FN9A 3MLLA 4BU2A 2RJLA 1AR93 1AR61 1RIRA 1OVSA 5CG8A 1AXZA 4WM7A 5FMCA 5GZGA 5JXJA 5JXHA 1JYIA 1HQLA 2B5HA 1JXNA 3K3NA 3B94A 2W92A 3LDKA 4W8JA 3SHRA 1MS3A 2FCVA 2RV9A 4GIQA 3ZXLA 5L7OB 4AXOA 1HX6A 4P02B 2H0BA 4LT5A 4DS0A 3M7AA 1D0GA 1WCQA 4GMP3 1OT5A 4H3WA 3ZYRA 1ONAA 1QQP3 2EIGA 1DQ6A 1QIQA 3FL7A 2A70A 4FPOB 1GWKA 1YUDA 3TNQA 1N1VA 4YVWA 3BCWA 2BGOA 1PVC3 2PHDA 1RUC1 2Y0OA 1VMFA 1OQDA 1WLCA 5IVVA 3NNJA 3SH4A 1W8TA 4BA6A 1UPSA 4LE3A 1RJ7A 2QE3A 3LEIA 2BZDA 3ASIA 3V56A 3VBRA 2FZ1A 1ENRA 1LEDA 1UCXA 4XF4A 4DB5A 4ES9A 2GU9A 1ZNPA 5D8AB 4QXBA 1QXJA 4COVA 3KGZA 4L11A 3RG0A 1DQ4A 3RNSA 3VZNA 4KNCA 4PHZA 5HV4A 3K4DA 1KDMA 5DPNA 4UFJA 2ATFA 4BMEA 1H0BA 3LA2A 1QXRA 2Y6HA 1OQEA 1YEWA 3LGRA 4PDWB 3ZSMA 4YVSB 2WS92 4GD4A 4Q0SA 1MACA 2WAOA 4QT6A 4OUSA 4QKBA 4WZFA 4Y4RA 3JU9A 4LK6A 1CN1A 1COV2 5A7QA 4DXTA 3PNAA 1PMHX 1SBEA 1ND3B 5JUVA 3WW4A 2VAUA 1IPJA 1N47A 2ZX2A 5HI0A 3RZGA 2VH9A 3WT3A 1FV3A 4HN0A 1XOYA 3TWIA 1W6MB 1GZCA 2ETEA 3IIAA 4LIUA 2ZAHA 5FPZA 5CEHA 1BVP1 3S7EA 2OIIA 4MXWB 3NKTA 4CDWB 3THTA 1HB3A 2WS93 4ZY9A 3SEEA 2E26A 1OXCA 3VBOB 4IE7A 1YIPA 4RS5A 1COV3 5J98B 3UKNA 4CP0A 1RUI1 5FV3A 1J3QA 4YWAA 4IW3A 1APNA 3O0XA 5IJRA 3VDDC 4AEDA 2A6ZA 3CIHA 4MYEA 3LF7A 2WNUB 4JDOA 2FHRA 2WNOA 5DXDA 5L7OA 5JOZA 2YU1A 1UU6A 4FOQA 4PF5A 1OH4A 2DCKA 2ZCWA 2ZS6B 5IAVA 1SFPA 4LKDA 3UYJA
chains in the Genus database with same CATH topology
2B42B 4Q2FA 4K3UA 3ZVXA 1LKNA 1VBB3 3POSA 2XPJA 1RUE2 3B9IA 3N7LA 1XXNA 1SLIA 3HMYA 2XJRA 3AZWA 3SCHA 4W65A 4A7KA 1WCKA 1PO12 4YG3A 4LUMA 2IXCA 5JSRA 2ENRA 3NAPB 3U11A 5A3LA 4BM8A 1DQ1A 3CEWA 5D8AA 1ZZ6A 3FWEA 4MVTA 3B02A 1AX1A 1RUE3 3VZJA 1RUNA 1QH6A 4H7MA 4M00A 3M3IA 2BW8A 1GICA 4C1XA 1DLLA 2DVDA 1AF9A 2PHRA 4PDWA 1YI7A 4YVSA 1NOVA 2HWD2 1G7YA 5KHGA 3AFKA 3AMMA 3CJIB 4FTBA 4OHYA 4S2HA 4MSVA 2I2SA 5JI7A 1ND3A 3VBHB 1QNWA 4MGZE 4K1ZA 5J48A 1MVEA 2IXIA 5H9PA 3O0VA 1QOOA 3GHNA 1W6MA 3D4KA 5EYYA 1OOPB 2HEWF 3V0BB 2ET1A 3FLRA 1WMEA 1R082 4GH4C 3WQ0A 4MXWA 4CDWA 4JCKA 2DVAA 1YHFA 1W0PA 3VBOA 4B7EA 1G6NA 2WT1A 4NHKA 4QU2A 3W59A 4JDMA 2ZHMA 2D5HA 3AP7A 1HDKA 1C8M2 4Q4W2 1URXA 1R083 1DF0A 2WSUA 5FOJB 4O9GA 1ZBA1 1WCDJ 3WW1A 1RHI1 3VZLA 4YZ3A 1SLLA 2ZGRA 3AFGA 1PIV3 1QWRA 2HYKA 3M1HA 2XLAA 4Z82A 1C8M3 4XE9A 1PGL2 1POV1 4Q4W3 5BNQA 1V6OA 2MEV2 4N43C 5CNAA 3RYKA 3NAPA 4YZ5A 1IQAA 2JG8C 3FE5A 1RMU1 4CYDA 1C5HA 4XTPA 5EZWA 1PGW1 3WUDA 4DQAA 4AYUA 3FFQA 4BIOA 4YNIA 2D43A 4B4RA 1SBDA 5I0SA 1KD7A 2VGDA 1E57A 4YRDA 2RS52 4H14A 2MEV3 1AXYA 4QMAA 1Q8VA 2CWSA 4CEYC 2HWB1 3LKJA 4I0WB 3CJIA 1HXS2 3GF6A 5JOXA 3VBHA 4K7JA 3VKLA 1IKQA 1OQ1A 2XBO2 1G9BA 1HRV1 1OOPA 3V0BA 2DURA 5JVVA 2GN3A 2C1FA 1ZZ9A 1J1TA 2RS53 3DL3A 4AHYA 1OKQA 4LUKA 4OHWA 1LOEA 3DPRB 1ZZCA 1HXS3 1ASJ1 3SH3A 2TBVA 3HT2A 2XBO3 2XB6C 2D3SA 2LALA 1A78A 4OI2A 3B00A 4WVWA 2QZ3A 5AC91 3H3UA 3LOIA 4CTEA 4G9SB 4GA9A 2ERFA 1CIWA 4LBKA 4RQPB 1Z7S1 2VOKA 1SCSA 4E4DX 1A6CA 2X5IC 1G8WA 2WNVC 1BJQA 4Q0VA 1YI9A 4OI1A 1BMV1 4UW3A 3E5XA 2EXKA 1C57A 3HD8B 4J6GA 1F5JA 4HL0A 3ZXDA 2GALA 3MDPA 1X7NA 1RB8G 3C2UA 1VALA 5T5OA 2BNOA 4DY3A 4ZKTB 2X8KA 4F7ZA 1S0FA 1TE1B 2NN8A 2BWCA 3KT1A 4IEPA 5HXVA 3ZXEA 3PJQA 4ORFA 5SV8A 4QHBA 2WL1A 3FHIB 4ASLA 3BOWA 4RA0A 1CR7A 2IC1A 1NCQB 3SXWA 1RINA 4QPGC 1Q8OA 5FAXA 3E5QA 2G9FA 1NXD1 4E27A 1T6GC 5KC6A 3FJSA 2ZBJA 1Q56A 1VBA1 3FLTA 3IM0A 1DGLA 1RUI3 2YMZA 3IPVB 4X8PA 1SQ4A 1VBC2 5GLWA 2ZGKA 3MI8A 4LO8A 4CRQA 3DPRA 2I74A 4Y20B 3IKWA 4IEYA 2QZ2A 2JKBA 1CD3G 3JQWA 2ZGLA 4S2FA 4AQSA 4C1WA 1MR5A 4IV1C 1QJY1 1D4M1 2EA7A 5C4WC 1S0CA 1ZM1A 3PTYA 1VBC3 2P34A 2R0HA 4ITCA 5C6CA 4AQTA 2PELA 4RQPA 1QOSA 3NV2A 2WLQA 5ACA2 1JBCA 1IGOA 1NG0A 3B01A 3PVOA 3VN4A 1MS0A 3OYWB 4YM0A 3WR0A 4XHBA 5C9AC 4Y5Z0 4GKXA 4GULA 3TRSB 5IK8A 3VBFB 4D3WA 4IQPA 2HWF1 4AI8A 3GZAA 2HEVF 1NLSA 2XH6A 4CDUC 4NHMA 1LTEA 5F6LB 5ACA3 3R4DB 2A7AA 1PO22 3SH5A 5DDJ2 1NCQA 4YM2A 4LBQD 1OA4A 4E9KA 3MLKA 3QBQA 4HZFA 1CPMA 4Q29A 1MQTC 2GH2A 3S6PA 2WLPA 5T5LA 1JH5A 3P3NA 3IPVA 4I2OA 3H50A 4P9WA 4HT1T 2AZ5A 4XDQA 1CAXB 3EBRA 1FXZA 4Q8KA 3IMNA 4Y20A 2R6QA 2H6CA 2D97A 3AP5A 1OFSA 4FPKA 4YW2A 1UX6A 2EAKA 3KCCA 4RD7A 1RHI3 1FPN2 2CGNA 3KMHA 2JECA 3AZVA 4HSLA 3ZYPA 2P2KA 5FLHA 2W0XA 5F1RA 5CFDC 1TMF2 4OLLA 1POV3 1ZRFA 1GQGA 1X82A 1RMU3 1KS5A 2DVBA 1XRUA 4XYXA 3ZPYA 4D7TA 4EJRA 1Y43B 4N90A 3AJYA 2OZ6A 2VVFA 1AYN2 1DGWA 3CF6E 2ZPXA 3OYWA 3WP3A 4KL1A 4Q1RA 2QDNA 4DY5A 2JD4A 2DTWA 1EPZA 1TMF3 3VBFA 2NQYA 4D69A 2BBVA 2GNDA 1F31A 1NA1A 5DUWA 2Q1MA 4AGGA 5BNOA 2D93A 1LEMA 4KU8A 3MZHA 1ASJ2 4PIXA 2NYYA 4RHV1 5FDBA 2R072 4Y1YA 4DRVA 1HRV3 1UW8A 1F5FA 3I4IA 2FQPA 4EN7B 1V6NA 4XF0A 1YRZA 2ZGQA 1XYNA 2XL9A 3IDBB 3QACA 4FPYA 1ENXA 1ASJ3 4AI3A 1O91A 4LBQB 1Q3EA 2SLIA 2GDFA 1CAXA 3U4XA 1S2KA 1H2LA 4GXLA 1W39A 4GWMA 1GV9A 5FTTC 1CPNA 4EWAA 3TN92 3BOPA 4WBBA 5T50A 4BYYA 1RUG2 4PJYA 4HBNA 3AKSA 1AR72 2B45X 4INDA 3RYPA 2R041 1BQPA 1PK6B 3GZTB 3AKRA 3E6CC 2HWC2 1ND2C 4XHXA 1I6XA 1H8TB 5EXOA 5BNPC 3TN93 2AENA 3UKTA 2ZZQA 1QGLA 2KM2A 3ZXGA 1DYKA 3WZ1A 3RPQA 1IZ3A 1ZRCA 3I8TA 1I9RA 3CJXA 1U5IA 4EN6B 2WQ4A 1NY72 2JDZA 4AEMA 3ILFA 3IWZA 4MLOA 5F5QA 1XQNA 1OLRA 1YNAA 1F8VA 1Q5OA 2IXKA 4AGVA 1Y7BA 1SLCA 1PZ8A 2WT0A 3G7DA 4YLZA 1U0AA 2XJUA 2CWMA 1UKGA 4AVVA 5C8WA 1UZYA 4LLFA 3VBSC 2GN7A 1O4ZA 1A8MA 2WS91 3MIHA 4URTA 2GC2A 3ZX7A 1IOAA 3O7OA 1COV1 2XVGA 3M2MA 4LBQA 3WG1A 4I0AA 1UF2C 1H1AA 4LEJA 1D4M3 2WJSA 4KGGA 1Q43A 4F3JA 4YZ4A 5KXEA 3OY8B 3IBMA 1OI6A 1V6MA 4QD2A 2QQPA 4B7KA 3LWCA 2BQPA 4ES8A 1LOCA 2V73A 1UD1A 4NPRA 4N7UA 2VW0A 2IXJA 1NLRA 3E6DA 3H3ZA 1PK6A 2E53A 3H1MA 5IK5A 3D0SA 2R062 3WW3A 4GB32 1GBGA 1LOFA 1J58A 1H8TA 4I01A 4IV3B 3VHPA 3ES4A 2AYHA 5GLVA 2NPIA 4JGYB 3ES1A 2WA4A 3NV1A 1DBNA 3MF9A 3HIFA 4I3GA 2KXLA 2VOWA 2ZKNA 1HQNA 3PJYA 2ET7A 1RUE1 4ZU5A 2GNTA 2R063 4HVOA 1RJ8A 5DG2A 5H9RA 5JAXA 2YZ4A 2RHPA 2X53S 4LHNA 4A3XA 3WCRA 4CDXC 1PO11 5GZDA 4JDNA 4BE3A 2O1QA 3MEPA 3MFAA 4B4QA 4B4PA 1AJKA 2PA7A 3BTAA 4EWEA 3ME2A 1GQHA 4P5HA 3RZZA 3WHTA 3JBG2 1QDCA 4XF3A 4FAHA 2TUNA 3ALQA 4CDQC 5DG1A 5I8TA 2TEPA 5A33B 5FO7B 1G9CA 3D82A 3VZKA 2HWD1 2OYZA 5CBLA 3VKFC 3ZFFB 5HCAA 1NQJA 3JBG3 5CIRA 1YFUA 1M4WA 1GNHA 4R52A 3WDUA 4TLFA 2DVFA 1BZWA 4P14A 4IEVA 5JZGC 3OY8A 2W68A 1R081 1WA4A 2DU0A 1UN1A 1W6NB 4CZSA 1V6KA 1AL22 4FPCA 3ENRA 4X6RB 3JZVA 4FCAA 1FMD2 5FLIA 1J1LA 1VAKA 4TYSA 4OHXA 4FQ4A 1REFA 1JW6A 4IV3A 5FMOS 3UL2A 2WWSA 1C8M1 5FPXA 5GKAC 4Q4W1 1LECA 3ZXAC 1H2MA 1C4RA 1MS5A 4JGYA 4GWNA 1AL23 4CEWC 2DTYA 1S0DA 2CL2A 4XJAA 1WUVA 4JGZC 2WKKA 2D6LX 4XBQA 3T2TA 4RHV3 2Q8OA 4XFBA 1H30A 1R1A2 3GBWA 2R1BA 3WDXA 1FOD2 2BGCA 3ELNA 5KBFA 5J37A 3CL1A 1PGL1 2BUKA 4AHXA 1VBD2 2D7FA 2MEV1 1UKRA 4PLMA 4CP2A 1K5MC 1M06G 4LBLA 5HBAA 4HK8A 3ZSEA 3RRDA 1NYWA 4L99A 4Z2WA 4AF9A 2R042 3KB5A 1Z0HA 4XFAA 1FX5A 5KHHA 5ABJC 4MXVA 4FP2A 4LNVA 1FOD3 2VPVA 2NLRA 3N7KA 4M01A 4YW4A 2RS51 1N1YA 2D5FA 3KQRA 5A33A 1LB2A 4E4ZA 3AYAA 1QU0A 4MGKE 1CESA 2E7TA 3J9SA 1HXS1 4YVWC 4MGYE 4JV4A 3J4UH 3ZFFA 2XBO1 2O0OA 2R043 2UY9A 1Q8QA 5I93A 1SLTA 3PMSA 4UBGA 2ARBA 1GYKA 1W6OB 1W6NA 1CJPA 4ISQA 1XU2A 4NR1A 4S2DA 3WHUA 2NP0A 2EXJA 4AK3A 3VDDB 1LENA 1RUJ2 3LA3A 5FOBB 2BTVC 1U5YA 2VVDA 4HFSA 3ZSLA 3D0JA 4TSVA 1KS4A 3WDVA 3EHKA 3MF6A 3BODA 1N1SA 4YW1A 2A75A 1BK1A 1MZ6A 4AG4A 3WXPA 2BPA2 4XOGA 3ZFGC 1ZBE1 1AJOA 1ZX5A 3ZFEA 2PHXA 5KXCA 3ZIXA 5BYNA 4QPIC 4OI0A 3GALA 1EYBA 4AEDC 2WZR2 4XEZA 1QF3A 3ZYGA 1NZCA 2QUOA 3H9AA 4M0NA 3WV6A 1X50A 3WDYA 1H8VA 2ZGTA 4LR4A 4XBNA 1QJX2 1V6JA 3I7DA 2XHKA 2WZR3 5EJ3A 4YGBA 2XVKA 4N9HA 2ZGOA 1KITA 4GH4B 5LEKA 2YV8A 4UW6A 1SMVA 4N53C 1VBC1 5J36A 1VBE2 4AFDA 4YGDA 4P9YA 5L73A 3NVCA 1REEA 1O5LA 1QJX3 2VXRA 3FFZA 3N35A 5EV7A 1N3QA 4X6QB 3WNXA 1YFWA 1EY2A 2WIIB 3O14A 2IXLA 3DV8A 1OSGA 1YXWA 1CQ9A 4NWWA 4Y22B 3NWKA 1VBE3 1PO13 2PYTA 2BYVE 3S7IA 3A0NA 5ACA1 4Q4V2 4ATEA 4AFCA 3OBRA 2ZACA 2Z42A 4HK9A 3RI8A 4N43B 2JG8B 4AVTA 4OHVA 3AK0A 4Q4X2 2XG3A 4LHKA 1S1AA 4OZXA 3BALA 2HWD3 4M0HA 3N7JA 4Q4V3 1PO21 4AQ6A 3NL1A 4D7YA 4Q0QA 2VNOA 3H1WA 5DDJ1 2WNUA 4EN9B 5FO8B 2VUJA 1SLAA 5H9QA 3ZXJA 2XKPA 4FXGB 2UYAA 1RC6A 5GLUA 4CEYB 4Q4X3 1Q8SA 4B29A 5A32B 5LRSA 5EFUA 1JUIA 4XQDA 4HETA 3MW3A 3GNEA 5T5PA 1FNZA 2D98A 5GLTA 3WW2A 1QHDA 5FMOL 1YFXA 1H2NA 1C28A 2DUPA 3B69A 4Z07A 2WFF1 3VUOA 2VMGA 2PAMA 5TSWA 1JN2P 1O7FA 5IT6A 3MPPG 3NW4A 4AFMA 1MZ5A 3GBGA 4KG0A 2QVSB 4KBBA 3PHMA 2QKDA 4HKOA 2VOVA 3J8F2 1FPN1 2YHJA 4A7YA 3KT4A 3ATGA 4WVVA 4Y22A 3FC0A 4NN0A 5T54A 1Y9QA 3UV9A 1TMF1 3FLPA 5LRRA 3N3HA 4JTNA 3FUOA 4AVBA 2XWBB 3M3CA 5KXDA 1XYOA 3USSA 2X5IB 2LTNA 2FBEA 2P3KA 4UW4A 3J8F3 1AYN1 2PFWA 2GMEA 4N43A 4WM8C 1O3QA 5JWPA 2JG8A 4KQ7A 4UXAA 4BIFA 2ARXA 1XE7A 2ZHLA 5J3UA 1YIFA 1BBT2 1GR3A 5BY5A 4EROA 3HN1A 1KXGA 3SITA 1HKDA 2PN5A 3ILRA 2DVGA 2YY1A 1LCLA 2R071 4E4SA 5BXXA 5CG9A 2G9GA 2PAKA 2QJVA 4QPGB 4AVSA 1GSLA 3AP6A 2JJ6A 2NMOA 3VKMA 3AM2A 3R0RA 4D94A 3P3PA 3E6BA 5JI9A 5A32A 3KSCA 1TME2 2BFUS 1JHNA 3NKGA 2RMU2 2RS32 3ZMNA 1CAVB 1Q8PA 4IEQA 4K9SA 4RGAA 1ZBE2 2HJIA 4Q4Y2 3TN91 3N7MA 4XFIA 3OTFA 3IDEA 1L3JA 1RUG1 2RS33 4YGCA 2R0FA 4IV1B 3ZIWA 1AR71 4IL7A 1C3HA 4OUMA 5AFEA 1VR3A 2D3PA 1OFNA 2IZWA 4W6XA 4Y1XA 5I8SA 4BCUA 5C4WB 4HLTA 1UMZA 1DQ5A 3GBFA 5I8YA 2HWC1 5JSPA 1LHOA 1XU1A 1OA2A 3ZSKA 4E2GA 1ZBE3 1RUH2 5FBZA 1S2BA 5IK4A 1VB4A 5KHKA 2ZGSA 2H6BA 2X5IA 3KZ4C 1UAIA 1XNCA 4XJZA 4DNYA 3M8LA 3KD4A 1C8NA 2ZX1A 5C8CC 3VV1A 3GHMA 1RUH3 2VG9A 1NY71 4RL7A 4CDUB 1X33A 5DZEA 1DZTA 2OPKA 4LHLA 1LODA 3PVBB 3SLIA 3WVJA 3QCWA 4QPGA 4Q27A 2ZZJA 1VIWB 3H7JA 2VQ0A 4GKYA 1LGCA 1BVVA 1MQTB 5D1IA 1O4TA 1CAVA 5GJ6A 1R1ZA 1XNKA 4BMBA 1ZREA 1WD4A 2VY0A 3B3QE 3MICA 2PHTA 2LM3A 5J7MA 1XNDA 3JD72 4IV1A 2A71A 4XJWA 2DU1A 4R9DA 2ZGPA 4AEKA 5C4WA 3ZXKA 2IXHA 1JYCA 2R061 5JIUA 4GB31 3MFCA 4OI4A 5CFDB 1NE6A 3LB9A 3X29B 4D7SA 1ZZ7A 2OA2A 4PCRA 3RWNA 4L2NA 1HV1A 2XLGA 1U5XA 4RR3C 1HRI2 4V1PA 3WQ1A 5K8SA 3ACLA 3WDTA 2GC0A 4XBLA 3DN7A 3SCGA 1PO23 4QGNA 2XJQA 1PNGA 3FX3A 2A73B 5DDJ3 1KRIA 4M3CB 3RI9A 2WFF2 1PHMA 3WG4A 4HN1A 1C5IA 4Q0UA 2BNMA 4WV8A 4L92A 1BXHA 2DUOA 3RQ0A 2NZ9A 3HR9A 3JBG1 1SLBA 1LGBA 1SDWA 2VUAA 1RUD2 3OF1A 1WLDA 3HBZA 3AX4A 4N9IA 1MQTA 4AI2A 1UIJA 1WW7A 2OW4A 1FT9A 4Y1VA 1LR5A 1YCIA 2WFF3 3BIWE 1OMIA 5CU1A 2Z69A 5DUXA 5HCBA 4COZA 4BOWA 3N36A 2YDEA 4W6WA 2D40A 4Y24A 4FO9A 4YZ1A 2BEOA 4L9BA 1FPN3 1W0OA 1RUD3 1S0IA 3H8UA 2GZWA 4XF1A 2ZAAA 1V00A 1NA1C 4FTSA 2C9AA 2JX9A 4FPLA 5BNOC 1OLQA 3ILNA 1AVBA 1AL21 1C1FA 1V6LA 1FMD1 5A3MA 1ENQA 1ND2B 1DYPA 5CFDA 1AYN3 5BNPB 4L8QA 4IEOA 1BEV2 4AGRA 1MS4A 2GMPA 2VVEA 3LA7A 2PHUA 1NE4A 2GNMA 3KCYA 1IPKA 1PGSA 2EALA 1FV2A 4FVVA 3QLQA 4TZDA 2CYFA 1UIKA 2CAVA 2P37A 1QDOA 2R073 1R1A1 3MPBA 3SISA 1FOD1 4LULA 1BEV3 1WBLA 4M3CA 1WW5A 2TNFA 2QDRA 2ZX4A 1VBD1 3MIBA 2BFUL 2C0ZA 2UURA 2B8MA 2PAEA 2PLV2 2XWJB 5GLZA 2WSVA 3WOGA 5CADA 3I54A 4LE4A 1ZVFA 3VBSB 4ISRA 2Q5TA 3OJBA 5I0RA 2DCTA 3KM5A 4C91A 4AWDA 5FCCA 3WP5A 4BLJA 4XFHA 1RUG3 1ENSA 2PLV3 1IS4A 4R9AA 1AR73 4LBNA 2HWC3 4JQRA 3AMHA 2B39A 4MZUA 3LCPA 5JMCA 3W9AA 3GZUC 2JXAA 3POYA 1J3PA 1LU1A 2N7GA 2ZGMA 1ND2A 3BU7A 2RM22 3QH7A 5K7PA 1FATA 1RUJ1 5BNPA 1ZRDA 4DPNA 2GC1A 5C33A 1ULCA 4FSJA 1XYPA 3LAGA 4EV0A 2F6BA 3DF0A 2UU8A 1HQWA 5CFCC 2D6NA 4XPVA 4S2GA 5EYXA 1NCRC 4PIZA 4QGMA 2ILMA 1PNFA 2RM23 4CDXB 4QQ2A 2JG9C 4DOUA 3IN9A 1LESA 1MVQA 4B3NA 4AHWA 1QJU2 5FRAA 1LGNA 5JR7B 1ULGA 4YM3A 4K21A 1TEIA 1RVF2 4MV2A 3C3VA 1F2NA 1B35C 1LHWA 2HWE2 2WNEA 2WZR1 4FTEA 1KJLA 2Y26A 3TAYA 2D6KA 4M3CE 4CDQB 2IWGB 3H1YA 1U12A 3RYRA 4I0BA 1W2UA 4GALA 4XILA 4PLNA 5T5JA 4QXKA 1RUF2 2GMMA 3UJQA 1TNFA 4DRRA 2Q0AA 1UPIA 2E9QA 1QJX1 5GZFA 1LU2A 1H2KA