1HRI1

Structure determination of antiviral compound sch 38057 complexed with human rhinovirus 14
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
273
structure length
273
Chain Sequence
TVASISSGPKHTQKVPILTANETGATMPVLPSDSIETRTTYMHFNGSETDVECFLGRAACVHVTEIQNKDATGIDNHREAKLFNDWKINLSSLVQLRKKLELFTYVRFDSEYTILATASQPDSANYSSNLVVQAMYVPPGAPNPKEWDDYTWQSASNPSVFFKVGDTSRFSVPYVGLASAYNCFYDGYSHDDAETQYGITVLNHMGSMAFRIVNEHDEHKTLVKIRVYHRAKHVEAWIPRAPRALPYTSIGRTNYPKNTEPVIKKRKGDIKSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title Structure determination of antiviral compound SCH 38057 complexed with human rhinovirus 14.
pubmed doi rcsb
source organism Human rhinovirus 14
total genus 40
structure length 273
sequence length 273
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1992-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1hri100
4Q4V1 1RUG3 1NCRB 1QJU2 4N43C 1BBT3 1VBE2 1AR62 1RUE3 2PLV1 3NAPC 5C8CC 1GFF2 2RMU1 5DDJ3 1K5MA 2RS52 5CFCC 2WS93 4WM8C 5BNNC 2RS33 3VBRB 4RR3A 5FMOS 5FOJB 1RUI2 1FMD1 3ZFGA 4CEWC 1QJX1 1QJY1 1EV12 1DDLA 5C4WB 1FOD2 5D8AA 1QQP1 4JGZB 4CDXB 2HWE1 2Y26A 5BNPC 1AYM1 1RUH3 1HRI3 4N53C 3VDDC 2WFF1 2X5IB 5C9AC 2HWB1 1AR71 4WM7A 1EAH3 1ND3C 5J96B 5AC93 2XBO1 1PVC2 3VBOC 1NCQC 4GB31 1A6CA 3IDEA 1R091 5C9AA 5ABJC 1AR93 1ND3A 4BCUA 2WZR3 4RR3B 3FBMA 3CJIC 1VB4A 1RUD1 1PGW2 1MEC3 1RUJ1 1PIV1 3LOBA 4FTSA 1VBA1 3VBOA 1PO11 1RHI2 4NWWA 2WLPA 1QJU1 4SBVA 1VBE1 1B35C 4RHV2 1AR61 1F2NA 1VBB2 4RQPA 1RUF2 2RS12 4QPGA 1NCRC 1R083 1RB8G 1ASJ2 2WFF3 1RUI1 4Q4X2 1VBD3 2R071 3VBSA 4YVSA 3VBFC 1AYN3 1C8M3 1PO22 1VRH1 5ACA3 2FZ2A 5BNPB 1EV11 2XBO3 1X33A 2GSYA 3VBHC 4N53B 1FOD1 3J8F1 2TBVA 3VBRC 5C9AB 2IZWA 4GMP1 1ND3B 2DF7A 2ZAHA 2R042 1WCDJ 4IV3C 3VBOB 5C4WC 2BFUS 1PIV3 1V9U3 1PO13 2HWF2 5ABJB 4JGZC 1AUYA 5A32B 4CDXC 4FTEA 1BMV2 4JGYC 1FPN3 1MQTC 1PVC1 1NA1A 3JBG2 4QPGB 1TME2 1VBC1 2HWC2 3JD72 1POV0 1HQNA 1B35B 3VBSB 4YVSB 4NWVA 1COV3 1PGW1 1VAKA 2MEV3 5L7OA 1ZBA2 4YVWA 4CDUA 1K5MC 5J98B 1AR82 1RUC3 1RHI1 1VRH3 2ZZQA 5A33A 4RR3C 4RHV1 4CDWA 3J8F3 3ZFGC 1AL0G 3VBFB 1AL22 4AEDA 2R062 1NY72 3TN93 2BPA2 1RUF1 1BEV2 2RS11 1POV1 5D8AC 3VBHB 4Q4W2 1ZBE2 2ZTNA 1TMF1 4Q4X1 1ND2A 1PO21 4IV3B 1R1A2 2RM23 1FPN2 1HRV3 1NA1B 4WM7C 5JZGA 3JB4C 2RR11 1D4M2 5L7OB 4JGYB 2R041 1MQTB 4YVWB 1PGL2 1Z7S3 1HXS2 4Q4Y2 5A33B 2HWF1 4CEYA 1NG0A 4Q4V3 1RUG2 4CDWB 1BMV1 1BBT2 5CFDA 4AEDB 1RUE2 3JB8A 1K5MB 2PLV3 3ZXAC 5DDJ2 2RMU3 1TME1 2HWC1 3JD71 1RVF1 2WS92 3ZFFA 2HWD1 2RS32 4RQPC 3ZFGB 1TMF3 1FMD3 1ZBA1 5FMOL 4EJRA 1RMU1 1QJX3 4QPGC 1QJY3 1CJDA 5D8AB 5JZGB 3HAGA 1QJZA 3VBSC 4YVSC 4GMP0 1AL21 2RR13 1QQP3 1NY71 2HWE3 2RS51 1AYM3 1BEV1 1RUH2 4Q4W1 4GH4C 1HRI2 4WM7B 1Z7S2 1ZBE1 3S6PA 2HWB3 1AR73 1EAH2 5AC92 5CFDB 3VBUA 1R1A1 1E57A 4GB33 4GH4A 4RS5A 1R093 1AR92 1D4M1 4RFT0 2WZR2 1RUD3 1NA1C 1MEC2 1PGL1 1HXS1 1RUJ3 1VBA3 4Q4Y1 1RMU3 4CDQA 1RUG1 5L7OC 1QJU3 4RQPB 1BBT1 1VBE3 4YVWC 4CDUC 1RUE1 1AR63 1H8TA 3DPRA 4PDWA 4LLFA 5DDJ1 2RS53 2WS91 4CDWC 2RS31 1R082 4Y5Z0 5K0UA 2WFF2 1OOPC 4AEDC 1VBD2 1RUI3 2HWB2 2R073 1AYN2 1C8M2 1IHMA 5ACA2 1C8NA 1EV13 2XBO2 1F8VA 4GH4B 2BBVA 4QPIA 1FOD3 4RS5B 1OHFA 1ND2C 4GMP3 1VBB1 5LK7B 3ZFEA 1OOPA 5JZGC 1RUH1 1HRI1 4CDQB 1ASJ1 1PIV2 1V9U2 2BFUL 1PO12 5GKAC 2X5IA 5AC91 1H8TB 1PVC3 3DPRB 4PDWB 4IV1A 4CEYC 4Z92B 1AR91 1VBC3 2BUKA 5K0UB 2WZR1 5CFDC 4CDUB 1COV2 2MEV2 1MEC1 4N43A 2QQPA 2R072 1RUC2 1VRH2 1RHI3 3NAPA 3ZFFC 5C8CA 4QPIB 5CFCA 3J8F2 4RHV3 1OOPB 3ZFEB 4WM8A 5BNNA 1VBB3 3JBG1 3TN92 4CEWA 1RUF3 2RS13 1POV3 1R081 1ND2B 1ASJ3 4Y4YA 1VBD1 4Q4X3 1AYN1 1C8M1 1AR81 1PO23 5ACA1 1HX6A 2RM22 1HRV2 4IV1B 5BNPA 1X36A 4FTBA 4N53A 1CD3G 3VDDA 3VBUC 5BNOC 2R061 1VBC2 4N43B 2R043 4CEYB 4RS5C 3NAPB 1V9U1 5C8CB 1NCQA 2HWF3 4Q4V2 1OPOA 5CFCB 4WM8B 5BNOA 5BNNB 5ABJA 2GH8A 1FPN1 5A32A 3CJIA 4CDQC 1W39A 2PLV2 4CEWB 3JBG3 2RMU2 2WWSA 3ZFFB 1TME3 2HWC3 3JD73 3M8LA 1RVF3 2HWD3 1COV1 2MEV1 1H8TC 1TMF2 2FZ1A 3DPRC 4PDWC 1FMD2 1B35A 1ZBA3 1QJX2 1AR83 1RUC1 1QJY2 5K0UC 1M06G 3VDDB 1NCRA 1AL23 2RR12 1QQP2 2R063 2HWE2 3VBFA 3TN91 1NOVA 1AYM2 4QPIC 1BEV3 4Q4W3 1SMVA 1NCQB 3ZFEC 1ZBE3 3VBHA 1AR72 3VBRA 4FSJA 3VBUB 5BNOB 3CJIB 2RM21 1HRV1 1R1A3 2VQ0A 1VB2A 4GB32 4IV3A 2X5IC 5C4WA 1R092 2XPJA 1D4M3 1RVF2 4JGZA 2HWD2 4IV1C 1RUD2 4CDXA 1Z7S1 4JGYA 1RUJ2 1HXS3 1MQTA 1VBA2 1RMU2 4Q4Y3 1EAH1
chains in the Genus database with same CATH superfamily
5F1RA 4Q4V1 2K0GA 2W3JA 4B4QA 5F6LB 2Y34A 5JOWA 1QJU2 3KCCA 2QQNA 4DNYA 3PUIA 1BBT3 4Q1PA 4OVEA 4NIIA 3AYEA 3WNMA 2J1TA 4XAEA 3NAPC 5DMYA 5C8CC 4I01A 3DXUA 1GFF2 3OOXA 1UW8A 3AFGA 4TYSA 2NYYA 1ULFA 4KBZA 3LCPA 1PMJX 3PU3A 4YG0A 4MSVA 3MIEA 2B7YA 3VBRB 3BCWA 4ES8A 4RR3A 2CGNA 4GQ7A 4NPLA 3H9AA 4BQ5A 3MZHA 1MS9A 4ZPIA 5GM0A 1QJX1 4E4DX 1HDKA 1RUNA 3SEEA 1NYWA 1LAJA 3WXPA 3I8TA 3JCIA 4QKNA 2D3SA 2DCJA 1S0BA 2UY8A 4P9XA 4WZCA 3EJKA 1VP6A 5FR3A 4XFFA 5K8SA 2ES3A 3MV01 3VD4A 2X8KA 2OX0A 1LHNA 4JGZB 4Q2FA 4W50A 4RSUA 4B4RA 4P9YA 4DOUA 4D69A 4HMZA 4AFDA 1UOBA 4IL7A 2KXLA 4UAPA 1HRI3 2PHDA 4A2UA 4BMEA 2MPFA 5C9AC 3ZN5A 2E26A 3HNBM 1S2BA 4ZONA 4Z2AA 5J96B 1W6OB 3AKPA 3CJXA 3CQOA 3ETQA 2VECA 2XBO1 2GNBA 3ENRA 1GWLA 3ZOIA 4AR2A 2VQAA 2DFBA 3MBWA 1GOGA 3AKRA 1NCQC 1D2SA 3T30A 2WBKA 2ADDA 4LULA 3IDEA 4QGLA 4JQRA 2OUHA 2WNOA 1O3TA 2JDZA 5LA9A 3U37A 4EWDA 2ZS6B 2VNGA 2WKKA 3N7MA 4QB6A 1X82A 4X6RB 1ODNA 1S55A 3U75A 1PGW2 2QQWA 4I02A 4JAAA 1WW7A 4L2NA 1P8JA 3GF6A 1VBA1 1ZZ7A 3VBOA 1QXJA 4LK7A 1RHI2 4E4HA 4OQ8A 4NWWA 1V6MA 4Q0SA 2VQUA 2A75A 4E2SA 1KFUL 4AWDA 1D0GA 1QJU1 2A3WA 1B35C 2JB4A 2QBXA 4XFHA 3RG0A 3S30A 5ISLA 1F2NA 5BPXA 3GBWA 3H8RA 5FYHA 2P3KA 5FZ7A 2VZPA 3AP7A 4H7MA 1RUF2 4ZZ8A 4XFAA 3WW4A 1JZ3A 1U5YA 5FP9A 1R083 4XQWA 3LOIA 3J9SA 2P37A 4YVSA 4L97A 1H1AA 1C8M3 1W2NA 4MG2A 5ACA3 5DUUA 1JN2P 1H9PA 2XBO3 1UU6A 2AC1A 4UFMA 1DU3D 4URAA 4WBBA 1KS5A 1TNFA 1UIKA 1S2EA 3MLJA 4IEZA 4CU9A 2TBVA 5C9AB 2DCTA 2XDVA 4GMP1 4XXPA 3WY6A 4COVA 1XB9A 2QQJA 3AL5A 5H9QA 3WDVA 3VD5A 5BNQA 2YBSA 1O6UA 1LCLA 2DDUA 4LUMA 3RZGA 1ZM1A 4XUQA 1JOJA 4KWJA 4EN0A 2OYZA 3ELNA 5G04L 2B9UA 4CCOA 5C4WC 4FCAA 1VMJA 5J48A 1FV3A 1LTEA 5A1FA 5FDBA 4INDA 3B9IA 1X50A 2VR4A 4MGQA 2XXZA 2OQ7A 1CR7A 2WNEA 1ULEA 2I45A 1SPPB 2E63A 2GU9A 2YV8A 3NW4A 4JGYC 2FCTA 1W04A 2YB7A 5FYIA 3AVSA 4YGBA 2W1QA 1NQJA 5FZ8A 3FHIB 3POFA 1OKOA 2GMPA 4OCTA 4QPGB 4JHZA 1O8SA 2A6ZA 4I3GA 1TME2 2HWC2 1HB1A 3JD72 2JIGA 2XL7A 3F95A 4GD4A 4P9IA 5DABA 1UU5A 3LFIA 4GWIA 1B35B 1K5JA 3VBSB 3OPZA 4BXSV 5L7OA 1PGW1 3BTXA 4ZU7A 2LALA 2YC4A 3C7GA 3WG4A 1DZTA 1LGCA 1HQWA 1AR82 2VXRA 3GZEA 5J98B 1RHI1 5DZEA 4YPJA 1MS4A 2DCZA 2F6BA 2ZZQA 4ZU5A 5I0DA 3H3ZA 4F8AA 3AMPA 1UMHA 3WW3A 3FJSA 4P9GA 4XF1A 3POBA 1TEIA 2WNVA 2HEYF 3I2HA 5AVPA 2ZHLA 2FDGA 3TRSB 4QKDA 4KG8A 4H3WA 3WNOA 2R062 1UOJA 4AFCA 1KJRA 1NY72 4G3YC 4X6QB 1XOYA 4AGVA 1RUF1 1F5FA 4Q4W2 4AVAA 3QD6A 2JG9C 1ZBE2 2ID4A 1TMF1 1WCUA 1OD5A 2VCAA 2WNUC 2ZKNA 2VM9A 4JX0A 1O4TA 4QM8A 2X10A 4BQWA 5F2SA 3CNAA 4PLOA 3FBYA 1LHVA 3SC7X 2E53A 4GWMA 5LEKA 1HRV3 5I0RA 1QKQA 2XJSA 3MGUA 5KR7A 4XJZA 3ZR5A 3I3EA 5FP3A 4WVWA 5LATA 3LEMA 3OEAA 1LRHA 3NV4A 1WUVA 1D4M2 5F3CA 4IE5A 4LBQB 4JGYB 5I8SA 5T55A 4CCJA 4YGDA 4A7YA 4CUAA 1KFXL 2CGOA 2GNMA 2UU8A 2BNOA 5CG8A 5IAXA 1HXS2 4BIFA 1CONA 3KV6A 4OZOA 1XYOA 2CL2A 1JBCA 2Q8EA 3TBDA 1WBLA 2YY1A 3HT2A 5JAXA 3LQCA 1W9FA 4KWKA 1LHOA 2ARCA 2NLRA 3AM2A 3HNYM 5F32A 2XVGA 3PLQA 5CFDA 5FUPA 2VAUA 4YRDA 5FP7A 4AEDB 4WV8A 3ABZA 3MW4A 2JE9A 1Q3EA 4YM2A 5DDJ2 1TME1 5HCBA 2HWC1 3JD71 1Q8OA 4HONA 1BCXA 4ONUA 3ZFFA 4XF3A 2ORZA 2VMEA 2OVUA 4MZUA 1TMF3 3E6BA 5LBBA 2CAUA 2MNGA 4AVSA 1HN0A 4H55A 1LOBA 5FLHA 1CJDA 2YBPA 3ES4A 4XBQA 4OFGA 5BNPC 3GM8A 3HAGA 3POGA 4IUGA 5JZGB 4QX2A 3I59A 5LY2A 2JG9B 2JDNA 4CRQA 1LOFA 5D21A 4GMP0 4AHYA 2WNUB 2WYSA 5FY5A 4DS0A 1GZTA 3VDBA 5FPXA 4GWNA 1GR3A 4YFWA 2Q8CA 1AHSA 3C7OA 1UY2A 1NY71 2Y60A 5JSPA 1SZBA 1RJ7A 4HFSA 3ZYPA 4C0HA 4ZS3A 4L8QA 4QHZA 4URTA 4Q4W1 3ZVXA 3LB9A 3S5QA 2KA3A 3WX5A 2VJXA 2ILMA 1PK6B 1ZBE1 3O0XA 3WSOA 2XOMA 4HSLA 1EAH2 1QNWA 1C57A 2AACA 2DU1A 4G4FA 1DYPA 1MVEA 4XTMA 4BYYA 4EN9B 3VBUA 2V4AA 2ARBA 3QH6A 4GB33 3U4XA 5IFTA 4Q0VA 4AAPA 4TN7A 1SACA 4IDZA 3ZYBA 4B1LA 1D4M1 4RFT0 3O12A 5EZWA 2WQ8A 3OTFA 2YG0A 3IKWA 1RUD3 1MEC2 3N9QA 2A3XA 2F17A 3R4SA 1HXS1 1RUJ3 1UIJA 2W91A 1GP5A 1HQLA 2PA7A 4CDQA 4OULA 2YYOA 1REDA 1PM7A 2XB6C 2XKOA 4KWUA 3PVOA 1FT9A 4B29A 2OPWA 1OT5A 5I8TA 2CV6A 4HETA 4A41A 4E4SA 4FBFA 1DQ2A 1AXZA 4IGOA 4CDUC 3IIIA 1IKQA 1ACCA 4DXTA 2BJSA 2PQSA 1GQPA 3EHKA 4CCLA 5JOYA 2BVBA 4PI2A 1JYVA 4KNCA 4LTAA 3KT7A 3Q8EA 4LBOA 5DDJ1 5FTTC 4DRVA 3VLBB 5FPAA 4CDWC 2HEWF 1RGSA 3UETA 4MGZE 3USSA 1CJPA 1OOPC 1VBD2 2HWB2 2VZ1A 3HD8B 2ZGOA 4S2FA 4BOWA 1JZ6A 3AKTA 1X8MA 3AYCA 2BNMA 2XMLA 2L9LA 3KT1A 1ND2C 2RE9A 2A6VA 4P9LA 5KHKA 5CZKA 1IPJA 5FY0A 5JOXA 4YZ2A 1JI6A 1BXHA 1MS3A 2W68A 2ZOEB 5FWEA 4E2QA 5LK7B 5CKMA 4C90A 1G9AA 3O1VA 1JYWA 5F3GA 5GZGA 5DPNA 3GCXA 2VW1A 4MADA 2E33A 3D6EA 3CKHA 4YZ3A 1BK1A 1ASJ1 1PIV2 2BFUL 2DUPA 3M70A 4LHLA 1GZWA 2X5IA 2VY0A 5FAXA 3N9OA 2GAUA 3PMEA 2ZA9A 4L9BA 1TG7A 4CEYC 4D7TA 4META 4M0HA 1GNZA 2CWSA 3EYPA 5C71A 3AXEA 2QJVA 1PNGA 1VBC3 3VHPA 5K0UB 1ULOA 1XE8A 1RJ8A 4R9AA 1LKNA 3ZN6B 4CDUB 3MUZ1 3VL9A 1ZRFA 1MEC1 2ZXQA 4N43A 3NKTA 3U78A 5JSOA 1GNHA 1LJ7A 3MO4A 3RYRA 3LIHA 3TNQA 1JYXA 2Q30A 3MIGA 1DLLA 1JW6A 2JE8A 1OOPB 2A70A 3J8F2 3MFCA 4WM8A 3U07A 3ZFEB 2WIIB 4CP9B 3USUB 4FFHA 4K6BA 4NMIA 3T4VA 1GQHA 1QHDA 3OD0A 2OIIA 3WDYA 3RS6A 5B4NA 4Q1RA 2XJPA 3LA7A 4XF0A 1Y7BA 2P5BA 2RS13 1NLSA 2R16A 4XQDA 2TNFA 1ND2B 4HVRA 1YHFA 1ASJ3 2HYXA 4I0WB 4Y4YA 1VBD1 4CP2A 2Y38A 1UN1A 2A5ZA 1APNA 4LOTA 5T5JA 3C8XA 4AOCA 1LR5A 4B7EA 1OURA 2ERFA 2Y6JA 2VOKA 5LASA 4NAOA 3O1UA 1IG0A 5I0TA 2WQZC 3K3NA 1QEXA 3AJZA 2VZSA 1RTVA 3KCYA 3AYDA 4IERA 3GBGA 1J83A 1DGLA 2H6CA 3VDDA 4BB3A 3MLKA 2J1AA 5JR7B 4ZHNA 4PQ9A 3O1OA 4M4RA 5FZGA 1BJQA 2R043 2ZHNA 2WR9A 3O0WA 1JZ7A 3PL0A 4OLLA 5FY4A 1G6NA 1HB2A 4PBPA 4CEYB 4RS5C 1FAYA 4PBOA 5GALA 3RQ0A 4UW3A 3IM0A 4LR4A 5JDBA 2JECA 4ITCA 1OPOA 4AI0A 4K21A 4M4PA 5BNNB 4BM8A 1FPN1 4XC9A 4MUVA 2ZGSA 4AE2A 1W6MA 4CE8A 3ZSLA 3K3OA 2IXLA 2PLV2 3ZO0B 4C1XA 4RD7A 4CEWB 2J22A 4PIZA 2RMU2 3PUQA 4MGKE 4OHWA 2QVSB 3ES1A 2ZMNA 2FBEA 1OVSA 4UW5A 3PUHA 3O1PA 1W9TA 1UMIA 4PDWC 4IXLA 4HT1T 1CGPA 1G9BA 2WINB 1CAXA 4WZFA 4XQ4A 2GDFA 4XYXA 4BQXA 3I49A 1J1LA 1QJEA 4BU2A 3DYPA 1YI9A 1OQ1A 3K48A 4XF9A 3VKMA 3ZYJB 4N8MA 2RHPA 2Y0IA 2P17A 1CN1A 1NCRA 4FT8A 1ZNPA 1W6NA 1O3SA 4YW5A 2CHHA 1AL23 3O5SA 3PVEA 4BK5A 2YBKA 1RL3A 2Z5WA 3IMMA 1IQDC 3EB7A 4FPKA 3VBFA 3ZDSA 2XVKA 2ZGQA 4X8NA 1AYM2 4DUXA 2BGOA 1BEV3 2A7AA 3GHNA 5JI7A 3KCXA 2E32A 1RXGA 2BVVA 1D2QA 2JXAA 2Q1FA 1V6NA 2ZGUA 4QHBA 3SISA 5FJHA 4RA0A 1O91A 1AR72 5GZFA 2EAKA 1Z0HA 3GBFA 3OSDA 4EWEA 2LS6A 2FDFA 2BRTA 5IATA 1OPMA 1H1IA 1R1A3 1W9YA 4AFAA 3BUCA 1NXD1 2DFCA 1GP4A 3DECA 1L3JA 2D6KA 2ZX2A 3DN7A 4B8EA 1C1FA 3HN1A 5FPUA 3PHMA 1XYNA 1LENA 1RVF2 5DZFA 3I3DA 1MS1A 2HWD2 3PURA 4IV1C 2XGXA 3OY8B 4IESA 3K4ZA 4HOOA 1MQTA 1MS0A 2VW0A 2QTWB 1YFYA 1QIQA 2XJRA 1RMU2 3MPBA 4Q4Y3 5L9VA 4BQYA 4S2HA 3RDIA 1RUG3 2EICA 4BQ3A 1SEFA 1QXPA 1VBE2 4XAAA 3ROUA 3T0AA 2JENA 2WZ8A 3KMHA 5FZ9A 1AR62 3BIEA 2PLV1 4JC1A 1DZRA 3W21A 4LBMA 2RMU1 4XFBA 1K5MA 1UKGA 2D3RA 4QXBA 4D94A 2WS93 4UI9L 5CFCC 1NZCA 4NIGA 4Q8LA 5DZGA 3ZYHA 5A1LA 2CAVA 1WLWA 1GKBA 1R1ZA 1W8WA 4AQSA 3PJQA 2BOJA 3ZFGA 3HWJA 1UYYA 3QCWA 2VD7A 1EV12 4B3NA 3I97A 2W39A 1FOD2 5D8AA 2C26A 3L9JT 4LKDA 2DTWA 1W6QA 4CDXB 1SBFA 1AYM1 4XZUG 3VD9A 4EN7B 2ZZJA 1QOSA 3SXWA 2WFF1 4TLGA 2OZJA 2G9GA 4LE4A 1HB4A 1AR71 1DQ1A 1OUSA 2WZEA 1H2LA 3DGTA 1SLTA 3W59A 3WF0A 3WDXA 5H9SA 5FYYA 1JZ2A 1SG3A 5C3PA 1CX1A 1VMHA 3VGIA 3WNPA 4Z82A 1PVC2 3VBOC 3PTYA 2D44A 5FZFA 3WNXA 3C7EA 3JQXA 5GLUA 3ZXGA 3POJA 3DUIA 1PM4A 1Q8PA 1V6KA 1ULGA 1J59A 1AR93 3NV2A 5BYNA 2WZR3 4RR3B 1RXFA 3THTA 1V0AA 3CJIC 2I07B 2VBDA 3DV8A 4AAXA 4BE3A 1VB4A 2F4PA 1UKRA 5C33A 4EWAA 1XPWA 2WZPP 3IDBB 4UF0A 2VMGA 3SNMA 4ZZ5A 4IEXA 1OH3A 1YJLA 4YM3A 4NN0A 3P3NA 4DXSA 3VB9A 4YSFA 1VBE1 4ZY9A 4RHV2 1W8OA 3WDTA 3BU0A 1AR61 3AZVA 4MGIE 3Q8FA 2PTMA 3B94A 3RYPA 2JDUA 4XF4A 4QAWA 3RVHA 5BXXA 2OQ6A 4QQ2A 3ZPYA 5T50A 3BOPA 4UWDA 2E7TA 3OGVA 1S2KA 1V6IA 2QQKA 5IVJA 1O59A 2A1XA 2WFF3 1BZWA 5FIXA 2A3YA 4Q4X2 2R071 2WQ4A 1AYN3 3FMGA 1PO22 1L7LA 1VRH1 2GNTA 4GWJA 2FZ2A 2EIEA 1EV11 5KHHA 3W5NA 1BYHA 1X33A 2GSYA 5DAXA 1FOD1 3VBRC 3MIFA 2IZWA 5L36A 1EYBA 1GZCA 2LTNA 3NJZA 3UL2A 1JYIA 3FWEA 1H2MA 4FP3A 3M2MA 5HCAA 3KGLA 2ZAHA 4AZZA 1QJFA 1WCDJ 5A3LA 1HV0A 4IV3C 1I3HA 5CEHA 5C5TA 4Z1VA 3VBOB 1MS5A 2VVEA 1DHKB 1UZYA 4IEPA 4UFHA 1V9U3 2DVAA 2E6VA 5EJZB 4K3UA 2VE1A 4A44A 4PIYA 4JGZC 4ASKA 4BJ0A 3V0AA 1ZZCA 4FTEA 3AFKA 1BMV2 4LBLA 4OZXA 4DB5A 1S0FA 4UOJA 5F3IA 1S0EA 1JZ5A 1PVC1 1S1AA 1UOFA 1PZ8A 1NA1A 2NN8A 2W5FA 3JBG2 5FV3A 2QFEA 2JDYA 4XURA 2YC0A 2Q1ZB 4QDSA 4Y22A 4X8PA 4UW6A 3QBQA 2V73A 4MHUA 1C3HA 1POV0 4NO4A 3B9CA 1W05A 3CDZB 3PUAA 4QHOA 4YVSB 4NWVA 3ZMNA 1COV3 1VAKA 3H42B 3MIDA 4EYUA 2J1RA 1ZBA2 1DYKA 4YM1A 4YVWA 3RYKA 4D8MA 1RUC3 1VRH3 3RWNA 5I0UA 3RJ2X 5A33A 2VNRA 4AQ2A 2C24A 4K20A 2D5FA 3ZR6A 5IVFA 3POWA 4Q26A 3N7JA 2D40A 4RHV1 4D6QA 3BVCA 3FL7A 4HSJA 5IK4A 3J7HA 2ZBJA 4LLOA 4O9EA 2VCMA 1YYNA 5FRAA 4CCDA 2GP5A 2WLQA 1AXKA 5IVVA 1NT0A 3TN93 3Q8CA 2DU0A 1JZ4A 3CF6E 3MFAA 3VHRA 5FO8B 3DCQA 1DG6A 3LA2A 2ZTNA 3ZYRA 1H2NA 5JIUA 1ALYA 2VH9A 4LO8A 4Q4X1 1OQDA 2ZEWA 5FQ0B 4KL1A 1W8ZA 5IT6A 1ZRCA 1PO21 1V6OA 2ZHMA 4HKOA 4JDOA 3WINE 4C8DA 4QB1A 4IV3B 4XDPA 2PFWA 1CX4A 2VUDA 3GXUA 3H50A 4LMFA 4KU8A 4RL7A 2FMDA 2WFPA 2WO7A 4WM7C 5GJ6A 2P34A 4PLNA 5DN2A 1SDWA 5IVEA 1CAUA 4XHXA 4HG6B 3F2ZA 2FDJA 4XCBA 1WW5A 5L7OB 5EP9A 4H14A 2EF6A 1JUHA 2DBIA 5BV6A 1U5XA 2ENRA 5FXVA 4BQ4A 1GP6A 1N3OA 3ASIA 1Z7S3 4DXRA 4K1ZA 4CU6A 5KHIA 3D82A 2F4LA 3VZNA 1W0PA 2VTFA 1JOPA 4E4ZA 1HIXA 2PHTA 3NO8A 4Q4V3 5KXCA 3SCHA 1BMV1 2WNVB 4M0NA 5FZHA 2I2SA 1RUE2 3JB8A 1GYKA 3NKGA 3POEA 1ST8A 1OD3A 3CL1A 4XACA 1YXWA 3AP9A 4QX1A 4XJ8A 1TQ5A 3BGAA 3TEYA 3QOPA 4L92A 1OI6A 3N7LA 3AVRA 4FXGB 4KGQA 2FD8A 3B00A 3CO2A 2RS32 4I3PA 4RQPC 5FYUA 3GALA 5KXDA 1ULDA 1OBNA 3WP3A 1ZBA1 2RDSA 2VOXA 4EJRA 1J3QA 2CWMA 4KQ7A 5FZEA 1US3A 1QJX3 5A7WB 4QPGC 3UKTA 5I93A 2IXCA 3ILNA 2ZGNA 2WDBA 4DUWA 2XLFA 1KDKA 3VBSC 2BU9A 4BZ4A 1XSQA 5IAVA 3KB5A 1HKDA 3AP4A 4HK8A 4AEKA 1UQXA 3JQWA 3K4DA 5LK5A 1BK0A 5SV5A 2IXIA 4TLFA 1HW5A 1RUH2 2BNNA 2HYKA 3WNKA 4IE0A 4WM7B 2Y6HA 4TWTA 4YG6A 2ADEA 5T3NA 4QX3A 3PU8A 3S6PA 3T2OA 1R64A 3KGZA 3OG2A 1N3QA 4XJWA 3LEKA 5AC92 2H0BA 5CFDB 5E6HA 2WSVA 3KHCA 4QXKA 3UKVA 4XUTA 2DBNA 3I2DA 2JG8C 5FZAA 2B39A 1WLTA 2WABA 3SMHA 1JHNA 2R7EB 3WNNA 3E1F1 5I91A 3O7OA 1H30A 1UAIA 4J25A 5CKQA 4AW7A 4C0BA 4CUGA 5LZ6A 2YPJA 4LBNA 5IUQA 1EUTA 4UT5A 1NX9A 5FKBA 1FI2A 2FCUA 4COUA 1VBA3 5DXDA 1CAVA 3KVAA 2JD9A 2XLAA 3GZUC 2OS2A 3S57A 2VUCA 2ZCWA 3O14A 1QJU3 2OXBA 3LDKA 4RQPB 4BH9A 5A3WA 1AJOA 5EPAA 1RUE1 1ZZ8A 3AZZA 2RDRA 4HXCA 3WCRA 5EIYB 2XL9A 1H8TA 1XRUA 1UCXA 4N9HA 2DVFA 3DPRA 1IGOA 1JS9A 2W87A 4O9GA 4FOQA 4ASLA 3FN9A 4PF1A 3NNMA 4D7SA 3PDQA 3BI3A 3RGBA 1VAMA 2RS31 2QCSB 3CIHA 2DUOA 5C3QA 3SEPA 4OYUA 1BVP1 4KG0A 4AEDC 4CTEA 1DLCA 3VKFC 3NSTA 5J36A 2WO3A 1I5PA 1K42A 1HLCA 4YYOA 1STMA 5HBAA 2VMFA 2J1UA 4GKYA 1YFXA 4QPIA 4R52A 3TB0A 3ZXDA 3RZJA 4CA9A 1T2XA 2PAKA 2ZGPA 4GMP3 3WUCA 4QQOA 2D6LX 2BZDA 3ZSEA 4PHZA 1SBDA 3CZJA 1S4CA 4B4PA 2QQVA 5K7PA 2G9FA 3WQ0A 2Q5TA 5JZGC 1RUH1 2D6NA 5FMCA 2WYFA 4TZDA 2JG8B 4CDQB 2QDNA 3HNMA 3WP4A 3A22A 1PO12 5FK7A 1W8TA 5GKAC 2A6WA 4AG4A 4NPMA 5D2AA 2CYFA 3GYDA 5AC91 3RZKA 3ZX7A 5KWRA 4QB2A 3CZUA 1XNTA 1UX6A 3HQUA 3CLPA 2B9VA 1O5UA 4P5HA 5K4LA 3P5BA 1PK6C 5IK5A 2ZEZA 2YXSA 2ZAAA 2VU9A 3WP6A 1XNDA 2XH6A 2BP6A 5IVYA 5FPLA 5FO9B 4XOGA 2EXIA 2C1FA 4XUOA 2VCCA 3QLQA 2MEV2 5DAQA 4PLMA 3WG1A 2QQPA 3G6JB 2ZEXA 2Q4SA 3GHMA 1UO9A 1ENXA 1RHI3 3FHQA 4AFBA 3NAPA 4F7ZA 5C8CA 3JU9A 1YQ2A 3BALA 4M00A 4YGCA 4YW3A 3SKVA 1CPNA 3HVDA 5FYCA 4YZ1A 1ENRA 3HR9A 4QGNA 4UFLA 3RZMA 1CAWA 2NM1A 3AL6A 3VD7A 3RRDA 3I2FA 4XMIA 4HBNA 3VN4A 1C5HA 5EHDA 4CVUA 1DYOA 1CWPA 3IPVA 5LRSA 1DGWA 1RUF3 1W8FA 2ET7A 1WZXA 2CSGA 1WW6A 2YU2A 3B02A 2P2KA 3D0JA 3T0BA 3H7JA 2QE3A 3H1YA 5GLTA 1WD3A 3W58A 2PHRA 2JDPA 1AR81 1GWMA 3APBA 3FFQA 1CPMA 2RM22 3NRUA 3C2UA 1KEXA 3H8OA 5FY7A 2ZGTA 3R05A 1J58A 2C9AA 4BHPA 1H4HA 2R061 2IVJA 1VBC2 5FLIA 5A7NA 4ZKTB 3JZVA 4N43B 3NQHA 5FZ3A 5LBCA 1CZVA 2QNKA 2SLIA 1SCRA 2ATFA 4XDOA 5A3UA 1X9TA 2VOWA 1E5HA 1NCQA 2VW2A 4LA3A 3KQ4B 4ASMB 4LA2A 1SQ4A 1AF9A 2OW4A 4WM8B 5BNOA 1W2OA 3LWCA 4DIQA 2D93A 2P6CA 3OBTA 3KSCA 4LO4B 1Q8VA 3RFRA 3PNAA 2PHLA 4U36A 4P5YA 4R9DA 4XPVA 3EMRA 1TME3 2HWC3 3JD73 3M8LA 4LXLA 5FBZA 3AMNA 4K1YA 4DY5A 3TYJA 4R8HA 2MEV1 2BTVC 1LHWA 5JLVA 5FUNA 1FMD2 1B35A 2FDKA 1UYXA 1JHJA 3TOJA 1K3IA 1AR83 1OFNA 1QJY2 5LA1A 3NNFA 2R0FA 1WCQA 1ZZBA 1W90A 2D6PA 3LA3A 4NIAA 5K0UC 2VMCA 3D5OA 4BPZA 3FLTA 1VE0A 3VDDB 1OFSA 2RDNA 3R0RA 4HLTA 3FUQA 4Q5OA 4V2WA 4BK4A 5HPOA 1XU1A 2DTYA 3ECQA 3L2YA 2Z2SB 2RR12 1YIFA 1QQP2 5HCFA 1KITA 5B4XA 3ZXJA 3NWKA 3ZM8A 2R063 2HWE2 3I2KA 1L7RA 4P9JA 2RJKA 4QQPA 1NOVA 2XVLA 1BLZA 1W8UA 3HN3A 3KM5A 4NRPA 1S0IA 2QQIA 3B93A 2R6QA 4Q4W3 2H6BA 1UY1A 3ZFEC 1ZBE3 2JD4A 2DWRA 3ACLA 4DINB 5C3SA 1DFQA 1O3RA 4GXLA 1JMUB 1DP0A 1LEDA 1PMHX 1W2AX 4IQPA 5LB6A 5FO7B 5F39A 2RM21 3NV1A 1UXXX 3HIFA 4QPYA 1N47A 4UBHA 1OA4A 1UY3A 4NUBA 1Q43A 4IEYA 4BQ1A 5C4WA 1EUUA 4LO6B 1FNYA 3OGRA 1R092 4CP0A 3P1IA 4J1XA 4MV2A 1D4M3 3ZYFA 3DEMA 4P00B 5J09A 1QOTA 1XE0A 5KBFA 4GKXA 4NR1A 4YW7A 2WO1A 1ZA4A 3Q8BA 4JGYA 1I1EA 1HXS3 2GALA 1G9FA 3IT8A 1A3KA 4RGAA 1EAH1 1GOFA 5HCHA 2R1DA 3AKSA 5EWSA 1IQAA 5DUWA 1NQDA 1NCRB 1XJAA 2VTXJ 4JTOA 4COYA 5CKNA 4BWOA 5CYYA 2FMYA 1URXA 1GLHA 3T4HB 3N9LA 4XABA 3M3CA 1KDMA 2B46X 3T08A 4CCNA 5DDJ3 2RS52 4PQQA 1ZVFA 3PTRB 1OLMA 1FXZA 2ZX1A 5BNNC 1OC1A 1WWYA 3S7EA 1A34A 5CIRA 1VMFA 4LBKA 5FMOS 1RUI2 3T3YA 1FMD1 4Y1ZA 4O7XA 4S2GA 5C6CA 4CEWC 1DQ4A 2R49A 1QJY1 4OHZA 4PIXA 3H1MA 4NRMA 2Z79A 4NAMA 2AGSA 3E5XA 1DDLA 2VZUA 1F9KA 1GANA 1W8HA 1QGLA 5DG2A 4K8RB 2VC9A 3UT0A 2VZRA 4QX5A 2JG9A 2E51A 1QQP1 2Z4FA 1YRZA 5A70A 2WNUA 3MIBA 2VZ3A 2ARXA 2HWE1 2Y26A 3I2JA 5FZ6A 4XBLA 3V65A 2RVAA 3U11A 1YQCA 2Y0OA 4BLJA 1PZ7A 5FYSA 2NQYA 3C3VA 4AI1A 5TSWA 4N53C 2VNVA 1RYYA 2AH2A 5EFUA 3EQEA 5CVRA 1JU4A 5L9RA 2GNDA 2HWB1 4IEOA 1NXMA 1EAH3 3WVJA 5FCCA 3OUJA 4FPLA 5EYYA 1XXNA 4R4XA 1WW4A 4P08A 1AZDA 4QDRA 3ACGA 3ZKYA 4DO0A 2D97A 1ZZ6A 3WT3A 4A4AA 1U5ZA 3RZHA 4QU1A 1OLME 3PIGA 3KWVA 4Q0UA 1R091 1LULA 4EV0A 3VZOA 3RMYA 5ABJC 4MH0E 3AZYA 5AFEA 1ND3A 4FPOB 2LROA 5LBFA 4BCUA 1WCSA 3VHNA 2ARAA 5EQUA 1MEC3 1PIV1 4FTSA 1ZX5A 3LAGA 1HB3A 3D4KA 3LEGA 4XHBA 3SCFA 4DXZA 1PGSA 1YUDA 5JVVA 4AI9A 1CESA 4I09A 1UZVA 2WLPA 1KD7A 5J3UA 1UL9A 1XNAA 2A6YA 3I3QA 2YFZA 4U2AA 1IPSA 1W6QB 1VBB2 5T5PA 4K7JA 2YMZA 2GMMA 3DL3A 1JYCA 3MW3A 4ATFA 3AYAA 2R30A 3NNLA 1FATA 3Q9OA 4ZXKA 1E5IA 2C9KA 4I2OA 2QZ2A 4EE2A 5IHRA 2UYAA 2HJIA 2RJ2A 1HJGA 2P4EA 1RUI1 1VBD3 4N7IA 1D4VB 3IDAA 4MHRA 4XUPA 5BNPB 2UURA 1FV2A 4XCAA 3BODA 3J7MA 1GWKA 5HV0A 1EP0A 2PMWB 3VBHC 4N53B 3T2QA 5A6YA 1KGYA 5DAVA 3J8F1 1ZREA 2AUYA 3OBZA 5SV8A 2VQTA 2DF7A 2OA2A 1QF3A 1W6PB 1SHWB 4NHXA 1YLLA 4AI3A 1LB2A 4UF0B 2VTXA 3ME2A 2ZKLA 5LA0A 3H8UA 4YNIA 1XC6A 1PIV3 1NE6A 1RIRA 3OBRA 2HWF2 2CU5A 1G9CA 2YGMA 5ABJB 3NMBA 1AUYA 4I0AA 5A32B 2XHKA 4CDXC 5A6QA 2YFUA 4ATEA 4BMBA 1UZZA 1FPN3 1UOGA 1NZIA 1ENSA 5ERLA 4FFIA 2LM3A 3LSDA 2W94A 3WG2A 1RINA 3ZMOA 1S0JA 3I2OA 3AMQA 2BGCA 2BQPA 3ZXFA 3MUY1 3D0SA 4GZ9A 4OUSA 4UYBA 1HQNA 2WWJA 4QKFA 3PVNA 5C3OA 2WL1A 4HPKB 5FZOA 4QX0A 1LODA 2G1MA 4JDNA 4XDQA 3THPA 4WVMA 3KF5A 4CDUA 2Y64A 3KT4A 1IG3A 1W06A 2I74A 2UWBA 5A3MA 4KI5M 4M3CA 5JMOA 4RR3C 1QY4A 1C5IA 1S0DA 3N9PA 4AVTA 4IEUA 3J26N 4O65A 3T2PA 3J8F3 4CDWA 4XXAA 2DCKA 3OGGA 3QH7A 2ZX3A 4IW3A 3VUOA 1YWKA 2Q1MA 5F3EA 1VRBA 3UESA 3B01A 3ZXKA 5FZKA 1UYPA 5JWPA 2BPA2 1POV1 3VBHB 3NJVA 3HPNA 2DVBA 4NROA 4QWNA 3U4SA 1MACA 2ZMKA 3MHZA 2WN2A 4MYEA 5EXOA 1V00A 3ZN4A 4KU7A 1ND2A 2AENA 4KWLA 4N7UA 4H7LA 1WLDA 1N1TA 3FLPA 4UFIA 5KXBA 1LGBA 2WUHA 3ZXLA 2NP0A 1DQ6A 1XQNA 1NA1B 5JPNB 5F6KA 4W65A 3BTZA 3VZKA 1QMJA 1X9PA 3NNGA 4LO5B 1GUIA 3JB4C 4XJ9A 4Y22B 4J1WA 1YNAA 4AQTA 4HVQA 2VMDA 2B42B 4YFZA 4GULA 3E97A 2XWJB 2RJLA 4FQ4A 1CZSA 3HJRA 2OT7A 2YDEA 4JRLA 2Y33A 3N9NA 1DF0A 1QU0A 4YVWB 3AZWA 5F9TA 4CXWA 4MXWA 1PGL2 5BY5A 4M3CE 4LBJA 3AZXA 5FYMA 2JICA 3KQRA 2C6SA 5A33B 2HWF1 2AZ5A 2JWPA 4TSVA 4W6WA 3K46A 4CEYA 3AKQA 1NG0A 2YPDA 1VAVA 2H0VA 4UFKA 4NE9A 5CNAA 4QPWA 4JZRA 1UXZA 4OHYA 4OMDA 3ZIWA 1AVBA 1BBT2 1PZ9A 3K51A 3ST7A 2X05A 1FX5A 1T6BX 3H3LA 2PLV3 4YZ4A 3ZXAC 2V09A 3J7NA 4AVBA 2RMU3 1WMEA 1RVF1 2R1BA 4FQZA 5JSRA 2HWD1 2G4IA 5EYXA 3MDPA 4A7KA 4XW3A 3PIJA 3ZSKA 1RMU1 1XBFA 4MXVA 4Y3OA 3CBNA 5CAZA 4TTGA 1J3RA 1GU3A 4CCKA 3N7KA 2WRAA 3GZTB 4KH9A 2VO5A 4IE7A 5IK7A 5FZ1A 4LKEA 1QJZA 2EIBA 2J1EA 2TEPA 4YVSC 2VNOA 1CAUB 2CDOA 2DVGA 2CNAA 4EROA 1F35A 2BEOA 2XJVA 3OEBA 2ORXA 4JKKA 4K9SA 4Y4RA 2A6XA 1GBGA 3GJBA 3TNPB 4QMAA 3W20A 4CZSA 2GC2A 1AYM3 3LSEA 5FYZA 2W9XA 5FOBB 1HRI2 3OD4A 1Z7S2 2O8QA 1SLCA 2QKDA 5FXZA 1AR73 1LOAA 2G9ZA 5JXGA 5FYBA 1JH5A 2IC1A 1RITA 3LKJA 3KV9A 5F5IA 4ORFA 4RGGA 3V64A 2DCYA 5GLZA 1E57A 4XE9A 5DAWA 4P9WA 4LE3A 1UZ0A 1WBFA 1H0BA 2XUEA 2D7FA 4GH4A 2R0HA 4RGKA 3E6CC 4RS5A 3B5LB 2HEVF 3MF6A 3U0ZA 4CXYA 5F37A 2VMIA 1YI7A 3ITQA 1DBNA 1H1MA 5EV7A 4A7ZA 1LU2A 1KQRA 2NMOA 5EJ3A 1PGL1 3VKLA 5L9BA 2VUJA 4DEQA 1LHUA 1SLBA 2RG4A 2VVFA 3HOBA 3UYJA 4V2VA 3KHBA 1RMU3 3H3UA 4LUKA 3M3IA 4FPEA 4CCMA 4L0PA 4D0QA 2JKXA 4OHXA 2NZ9A 1WMXA 5L7OC 3IWZA 4YG3A 1BBT1 1GOHA 1VBE3 1BHGA 1TZOA 4QT6A 4DQAA 3O1SA 1AR63 3POIA 2JJ6A 4D7YA 2ZX0A 3THDA 3WLUA 4PDWA 3OJBA 3UGGA 5A6XA 1L7QA 1TNRA 1IKPA 2XR4A 3SHRA 1ODMA 4Q8KA 1D7PM 2WNVC 4EZHA 4Y5Z0 1R082 3KZ4C 4W8JA 1BKZA 4JV4A 4NJ4A 1XU2A 2Y8KA 2YHJA 2R073 1W03A 4Y24A 1C8M2 1IHMA 1PX3A 2QQUA 3ZSMA 5ACA2 1EV13 1UZWA 2XBO2 3E6DA 2B4KA 3FE5A 3N35A 4XMAA 3WUDA 4AI8A 1FOD3 3V0BA 1Y3TA 1OHFA 3HBKA 3JUUA 4MGTA 3SITA 4H2AA 3OBAA 1GICA 1IS4A 4LIVA 4ES9A 4Y20A 1JYNA 4JKMA 2AREA 3I3MA 1N1VA 1LECA 1REFA 3FUOA 3MV11 1CIYA 4BQ2A 2DURA 4XZPA 1HRI1 1M4WA 1CAVB 1O4ZA 5GLVA 5C3RA 3UGHA 3IBMA 2IFWA 5DG1A 3GDBA 4XUNA 2JX9A 1NKGA 3OUHA 5C5UA 4QDQA 3ILRA 3WQ7A 2MHFA 4MO3M 3IZOA 1H8TB 1CQ9A 1PVC3 3AB0A 3DPRB 2JKBA 4IV1A 2JDAA 3WHTA 3M7AA 4EZ4A 1ULPA 1YQ6A 2V4VA 4HZFA 5EJ1B 1DGRA 2BUKA 4BIOA 5CFDC 5IK8A 4AK3A 3LF7A 2DVDA 5D1IA 5CBLA 4HANA 3J7LA 3OUIA 1UD1A 1UY0A 2ZGRA 3A4UA 3CEWA 3WP5A 3ZFFC 4QPIB 4M01A 4AQ6A 1C28A 3R4UA 5T5OA 4GAZA 5HV4A 5CFCA 4RHV3 1Z78A 4WVZA 1OQEA 3MF9A 1JUIA 4YARA 3JBG1 2VL4A 1UYZA 2XONA 2VBPA 2BOIA 3KD4A 1J84A 3KS7A 5APAA 1LOFC 5ANNA 1R081 3H8XA 4LOSA 4D3WA 3H7YA 3OB8A 1UX7A 4QQLA 4FOVA 4Q4X3 4AGRA 2ZX4A 3BPSA 1N3PA 1V6JA 1YFWA 1C8M1 3BTYA 4E9KA 1PO23 5ACA1 5H9PA 3OYWA 1HX6A 4D6SA 1HRV2 2ZGMA 1Y43B 1GSLA 5IW0A 3SLIA 4FTBA 2AR6A 1LESA 2EA7A 1OLQA 2VZVA 5CB7A 1RUOA 5IVCA 1W2UA 2XKPA 3MEPA 2JB8A 4JTNA 4C91A 3VBUC 5BNOC 4BLIA 3ILFA 1JZ8A 1IS6A 2ETEA 5FZLA 3ACFA 1Q8SA 2J1SA 3AC0A 2FDIA 2SBAA 2G19A 3LIGA 1KS4A 5FYTA 5AVAA 3ZXEA 4AEJA 3WW2A 3MLLA 1W3XA 3QACA 3NAPB 2O1QA 5C8CB 1HV1A 3UKNA 1YO8A 5I8YA 4NRQA 4Q0QA 3IMNA 2X09A 1CAWB 2P3IA 1DQ0A 4N90A 2VG9A 1F4HA 2WC2A 3ORJA 1GMMA 2VULA 3CJIA 1F4AA 1UU4A 1V6LA 3AMMA 4XJAA 3S7IA 4CDQC 4COWA 4YGEA 1Q56A 1FYUA 2IXJA 3IPVB 3UJQA 3JBG3 3OPWA 3ZFFB 2HKXA 3VZMA 3RI9A 3S0MA 1NUKA 4Y5SA 4DFSA 5E89A 2W0XA 2EXKA 2Y6KA 1C1LA 1TMF2 3A21A 4GALA 4ZS2A 2CGPA 2FHRA 2LUWA 4QGMA 1ZBA3 1OA2A 4NIDA 5FZDA 3TWIA 2IFRA 3D8CA 2BV4A 5KHJA 3I59B 3BN6A 1W9WA 2GN7A 1ZZ9A 1U0AA 1M06G 2GP3A 2XHNA 3OF1A 1AJKA 3X29B 3N4MA 2D3PA 3MICA 4NOTA 3FLRA 1X7NA 1CIWA 1V70A 4E27A 1G9DA 3OGSA 5J7MA 3DKQA 4AHWA 4NVPA 4YW4A 2YZ4A 1H4GA 1OVPA 1J3PA 1NCQB 1QDCA 4UFJA 3AP5A 4FAGA 1VPHA 1H8VA 2BWCA 2BYVE 2IVIB 2YC2A 3VBRA 5F7UA 3VBUB 5BNOB 1JOBA 3HQRA 3LE0A 4W6YA 4Y1UA 3TEXA 5KC5A 3CMGA 4Q0PA 3WDUA 5FQ0A 2ZMLA 2E7AA 5F5QA 4R4ZA 1HRV1 3SCGA 1OSGA 5FBJA 5FXWA 4KGGA 5JCTA 3NJXA 3RMXA 1ULCA 1VB2A 2OUJA 4GB32 2W1UA 4IV3A 3POSA 5CU1A 2X5IC 5E88A 1ZYBA 1G7YA 2DYCA 5HI0A 5JI9A 3VD3A 4Z2WA 5LY1A 3RZZA 3WQ1A 2C4XA 2GMEA 4HK9A 3MYXA 4JGZA 5HXVA 1RUD2 5JMCA 1BVVA 1W99A 1QH7A 2VXJA 1RUJ2 4IEVA 1W0OA 4UBGA 5GLWA 4HVOA 1ENQA 5FWJA 2XUMA 3IAQA 3GNEA 4JHTA 5J37A 4JRAA 4LHKA 4XFIA 5JIAA 3SKJE 4N43C 1W6OA 3V0AB 3PVBB 2OZ6A 4EN8B 1RUE3 2WN3A 4MOAA 4YW2A 1F31A 4QXCA 1SFNA 5E1RA 2EALA 4JCKA 3INAA 3ZYGA 3ZIXA 3B3QE 5K9YA 5M0TA 2K46A 3GZAA 1AX0A 4WM8C 1U12A 2AEYA 2B5HA 2D43A 2RS33 4MVTA 2ZEYA 3FFZA 3DKWA 3IIAA 3I4IA 4LQRA 5FOJB 2VUAA 2OPKA 4XJUA 3R6SA 4F3JA 1Y4WA 3A23A 2V5YA 3UV9A 4ET7A 5A7WA 4RYDA 1Y9GA 5C4WB 4XIOA 4JKLA 4FPCA 1SLLA 2BW8A 3ON7A 5C8WA 3D3AA 3O0VA 4TXWA 4KBBA 4LPLA 4K8FA 1WLCA 1H6XA 2K9ZA 3K75B 2XLGA 4LBQD 1QWRA 4AFMA 2VGDA 1JYTA 1N1YA 1RUH3 4GIQA 4S2DA 2Q0AA 1GZ9A 4FOWA 4C1WA 2VZOA 1GZWB 2EAAA 2X5IB 4Y1YA 1ZRIA 3VDDC 4ARYA 4D6RA 4DPNA 2W95A 4AHXA 4WM7A 1ND3C 5CA6A 1KXGA 1HN1A 5IYYA 3UK9A 5CG9A 5AC93 2CDPA 2Z42A 4L99A 4PJYA 4R9BA 3EXUA 3I54A 4O61A 5A7QA 3WNLA 4BA6A 2ZACA 1S0CA 1W3VA 2NPIA 4GB31 1A6CA 4DUVA 4GA9A 2UYBA 3OGJA 5GZEA 5C9AA 4FAHA 4HL0A 4FI9A 2ZPXA 4IEQA 4Y1XA 4YM0A 4NHKA 5FJKA 3FBMA 4DZGA 1JTZX 5LEJA 1AXYA 2W2IA 1NLRA 1RUD1 3I7DA 3GJAA 2Y6FA 4CPBD 2Q8DA 1RUJ1 3TEZA 2QUOA 4CCCA 3LOBA 1OUXA 1PO11 1PHMA 3MIHA 3WF3A 1K12A 2BGPA 5HXMA 3SH4A 4KMQA 4SBVA 3MI8A 4LHNA 2PHUA 1SPPA 4RQPA 5FPVA 3NL1A 5FK8A 3L2HA 1UNBA 1Q8QA 3UGFA 5A3PA 2RS12 1A8MA 1EPWA 1DCSA 4QPGA 1NCRC 2GC0A 4LKSA 3LDBA 4DEVA 1YQ5A 5IVBA 1RB8G 5H9RA 3AJYA 1ASJ2 1ZRDA 1S0GA 1UY4A 3RSJA 3UJOA 3VBSA 4LEJA 3VBFC 2PHXA 1I6XA 2GZWA 2GN3A 1G86A 5GZDA 2HBTA 4FOYA 5JXIA 3POYA 5FY8A 5JXHA 5A7PA 4PF5A 3LD8A 1AX1A 3WQBA 3HMYA 4QD2A 3RPQA 4CP1A 4F83A 3WCSA 1NLQA 3C7FA 1ND3B 2V5DA 5KC6A 2QDRA 5C70A 2IXHA 1G8WA 4XBNA 2ZGLA 4XVHA 1H6YA 3WDWA 1OXCA 2R042 3GGLA 3AK0A 3DF0A 2O14A 1NE4A 5FFOC 2K2SA 2BFUS 4G9SB 4YLZA 3T1MA 1POQA 5FY1A 1PO13 1SBEA 2JG8A 5FLJA 3ATGA 2WWUA 5C7GA 4J6GA 4PCRA 5JPMB 1LNSA 5L73A 1W6MB 4I0BA 2IWGB 1XNCA 3HEIA 2YU1A 2PN5A 1MQTC 4E2GA 1OLRA 1W8NA 2B45X 2YUEA 5LW9A 1W0NA 4DY3A 4OUEA 2B8MA 2XJUA 1PNFA 4LHSA 4COZA 1I9RA 1VBC1 1A8DA 2CY6A 3RZLA 4IGPA 1JXNA 4HN1A 1O3QA 5KHGA 3BIWE 3S5AA 2ZABA 1DZQA 4NPRA 3WHUA 4AHZA 2MEV3 3HBZA 4LBQA 3I3BA 1CAXB 2JEMA 2EIDA 3PUSA 3ZDVA 3W5MA 2D98A 1K5MC 4R9CA 1MVQA 5FP8A 1YC61 3HT1A 4XFCA 2YROA 5T5LA 3PJYA 4AF9A 1W6NB 4ARXA 5F5CA 3ZFGC 1AL0G 1Y9MA 2UWAA 3N9MA 3ACHA 4OI0A 3DYOA 1AL22 3Q8AA 3VBFB 4BXFA 4AEDA 2Y6LA 4Y5TA 5ANQA 4MGYE 1LOCA 5D8AC 1BEV2 2RS11 5DUXA 3W9AA 1NAEA 4AEMA 4FO9A 3BB6A 1QXRA 3A0KA 3ETPA 1MR5A 1MS8A 5JOZA 2WT0A 4I30A 1WA4A 2YGLA 2D6OX 4ZXEA 3URFA 5JR2A 1O8PA 1IZ3A 4CPBA 5J1XA 5F8PA 5LWBA 2C0ZA 1R1A2 2RM23 5F5AA 1FPN2 3EO6A 2JDHA 1IS3A 5DAPA 3B7MA 4M3CF 3I2IA 1XSRA 2WA3A 2N7GA 4MLOA 3WR0A 4AYUA 4CCEA 2W92A 4A42A 4A6OA 4EN6B 5JZGA 3G7DA 3VZJA 5BUVA 1JODA 1WGPA 2RR11 1IPKA 3IN9A 4LITA 1ZA7A 2XJTA 5FZOB 1O7FA 2JIJA 2O8OA 1YJKA 2R041 2VZQA 4SLIA 1WKYA 1MQTB 1Y9QA 2DUQA 4WVMB 1PVXA 4PT6A 3WD5A 4GJYA 5FUIA 3V56A 4Q4Y2 4ISQA 4M3CB 4LNVA 1PK6A 4AGGA 3FZ3A 2GC3A 3WEZA 1RUG2 1PMIA 4MGSA 1O5LA 5E16A 5AFBA 3GCWA 4CDWB 2UY9A 3RWKX 1BQPA 3AP6A 5FZIA 2O0OA 2BDRA 5A3TA 1W9SA 2WT1A 1DGRN 2A71A 3ZKUA 1K5MB 4NIHA 4FPYA 4XFGA 1ONAA 5T54A 2WS92 1DGWX 1Q5OA 3AMHA 5GZCA 4FP2A 1H2KA 2PAMA 2WSUA 3ZFGB 2HBUA 2FCVA 4QU2A 4OI1A 2A73B 1FMD3 2PELA 5FMOL 4LORA 1QJY3 4A45A 1QOOA 4OI2A 5D8AB 4LT5A 1DIWA 4PI0A 3WZ1A 5E8AA 2KR2A 2LW8A 3LPFA 3WF4A 2P3YA 5IJRA 1B09A 1AL21 3CHXA 2RR13 3FHAA 1QQP3 3M4FA 1UPSA 4E8CA 3N3HA 2HWE3 2RS51 4MXWB 3WG3A 3JXSA 1BEV1 1OKQA 2VCBA 4AVCA 3OCPA 1OH4A 4GH4C 4XEZA 5A7SA 3E5QA 4DMIA 2PAEA 3LDRA 5LA2A 2HWB3 1SCSA 2W1SA 2NMNA 3IB3A 2V72A 4OHVA 4Y33A 4OI4A 1GNYA 1R1A1 1X8EA 5B2GB 1LOGA 4NHYA 3TEWA 1XE7A 2WAOA 4W6XA 2VOTA 3M1HA 4E8DA 1K45A 1MZEA 4Y26A 4MX3A 1RC6A 3BPZA 3T1LA 1LOEA 1R093 3VDAA 4ZU4A 3WOGA 1KRIA 1AR92 3KVBA 2XQXA 2WZR2 2UWCA 1YQ8A 3K77A 3A0NA 4RN5A 3VKNA 1ZRRA 2P6HA 1NA1C 4EQVA 5FPZA 3O1TA 4Z07A 2W46A 4XIKA 1XNKA 2ET1A 4Q4Y1 3I2GA 2JDMA 2QQLA 3FC0A 1A78A 2DV9A 1RUG1 2W47A 1F5JA 3HQXA 5FMBA 1J1TA 5FZBA 2RDQA 5G05L 3KLSA 3ALQA 3T2TA 1LGNA 4B7KA 1MZFA 4YVWC 4DRRA 5L19A 4N9IA 5FP4A 3VDCA 5A6ZA 4HKLA 3IAPA 1C4RA 4LLFA 4QM9A 2W08A 5FMDA 3B69A 5IWFA 2RS53 4CUCA 2WS91 4XILA 4HN0A 2QQOA 5FY9A 1UMZA 4GJZA 2IUWA 5K0UA 2AYHA 2WFF2 4FPJA 4CYDA 1RUI3 2HLEA 1AYN2 2BBAA 3ZN6A 2TUNA 4QQHA 2P1BA 1C8NA 2PHWA 3LFMA 3AXDA 4AXOA 4NHMA 1F8VA 3MPPG 1F15A 4GH4B 5A1AA 3T0DA 2XQRA 3LGRA 2BBVA 3H0OA 4RS5B 4OQ9A 2EVXA 1VBB1 1MPXA 1SLIA 1OOPA 3ZFEA 1CZTA 4CP9A 3THCA 3N36A 4RFRB 3USUA 5FYVA 3WW1A 1YCIA 3CU7A 1EY2A 4Q27A 3ZPOA 1V9U2 3RI8A 1IS5A 1KJLA 3E5UA 4FPFA 5FREA 1SLAA 1GQGA 4LJHA 3ZYIB 1VLNA 2FDHA 4BISA 3P3PA 4PDWB 1AX2A 2D6MA 3U1XA 3VHOA 1YIPA 2J42A 3C7HA 4Z92B 1SDDB 4FPHA 4AVVA 5FZ0A 1LEMA 1QDOA 3BOWA 4IE6A 1AR91 1WCKA 1H9WA 1OA3A 2WZR1 3WV6A 4JVAA 3RNSA 1UPIA 3PMSA 1E5SA 1COV2 1VALA 1WMFA 2VPVA 3R4DB 4K40A 2R072 3BTAA 1GV9A 3KV5A 1YEWA 1IOAA 1RUC2 1VRH2 5LBEA 1WD4A 5I0SA 1LU1A 4AI2A 3MW2A 3V0BB 5DQ0A 4XETA 3DXTA 1CVNA 2VVDA 1N1SA 3SQOA 5BNNA 2VBBA 2ZHKA 2ZGKA 1JU3A 1VBB3 2J7MA 4Y20B 4A3XA 4IETA 2R32A 1WMDA 3M3OA 1W28A 2Q8OA 3TN92 4CEWA 4IE4A 1POV3 1XNBA 5IFPA 1OF3A 1WA6X 3BYWA 3VL8A 3VKOA 2WA4A 4V1PA 1O4YA 1US2A 1AYN1 3RJRA 3LPGA 4Q29A 3ZSJA 2GH2A 2Y6GA 3DYMA 2KD7A 3K2OA 5A7OA 4FPGA 4LO7A 4P14A 2E9QA 3NNJA 4IV1B 4QX8A 4QXHA 2BERA 1X36A 4CSWA 5BNPA 3ACIA 2HH9A 2JE7A 1MZ5A 2VZTA 3LEIA 1E5RA 4FVVA 5FZMA 2ZJCA 2RV9A 4N53A 1CD3G 4Z8BA 3BU7A 5JXJA 2W52A 1YFUA 5FKCA 2C5DA 2CTVA 3O1RA 1QNYA 1HJFA 1REEA 1UWWA 3AX4A 3EBRA 4XTPA 3KV4A 2PQQA 3KF3A 5CADA 2VOVA 4CU8A 1W6PA 2E31A 1W2TA 5LRRA 2VMHA 3NJYA 1V9U1 3O1MA 3BKZA 2HWF3 3M3QA 4Q4V2 2BWAA 5CFCB 4UW4A 1EPZA 5CISA 2AEZA 2J1VA 5ABJA 2GH8A 2E7QA 2EIGA 2LRPA 2WT2A 5A32A 2P3JA 3M3EA 1MZ6A 1DQ5A 1W39A 4UXAA 2PXJA 3K4AA 1TE1B 4WVVA 4FFGA 4ISRA 2XG3A 2WWSA 5FPBA 4IGQA 1SFPA 3H1WA 4CXXA 2EXJA 1RVF3 2OKXA 2WAAA 3A7QA 2HWD3 2KM2A 4LK6A 1COV1 1H8TC 3NV3A 4HKWA 2FZ1A 3DPRC 4L11A 2XJQA 4B1MA 4QX7A 3OYWB 1VIWB 2PYTA 3J4UH 3OY8A 1QJX2 4HPKA 1FNZA 1RUC1 4LIUA 4BDVB 3ZLIA 3T09A 3SH5A 2IXKA 3VZLA 2QZ3A 1SFYA 2EXHA 3P6BA 5A3OA 1VR3A 3LZZA 4FXKB 2WJSA 2QQMA 5JUVA 3UNPA 1UF2C 4OUMA 2X29A 5KXEA 4A3ZA 2JDKA 3TN91 3OPTA 4QPIC 5FZCA 4YZ5A 2GC1A 2D5HA 1TVGA 4W4ZA 2PHFA 1SMVA 2FQPA 3WF1A 3WF2A 3VBHA 1D0HA 4A6SA 1OF4A 2Z69A 5F2WA 5DUVA 5FXXA 4FSJA 3U14A 4OMCA 3TAYA 3FX3A 3CJIB 5A3NA 3VV1A 2WO2A 1VJ2A 2VQ0A 4P02B 4IEWA 5FZ4A 1U5IA 1QH6A 3IDCB 5A80A 2XWBB 4Y1VA 3U10A 2XPJA 4YW6A 4AL9A 2W1WA 4LKFA 4JDMA 5T52A 4FFFA 4CDXA 4CUBA 4NHLA 1PX4A 1Z7S1 4QKBA 4CU7A 2X53S 1VBA2 1T6GC 1XYPA 3NVCA 5LCWL 4JQTA 1I5ZA 4YW1A 4YWAA 1OMIA 3SH3A
chains in the Genus database with same CATH topology
5F1RA 4Q4V1 2K0GA 4B4QA 5F6LB 5JOWA 1QJU2 3KCCA 4DNYA 1BBT3 4Q1PA 4OVEA 3AYEA 3NAPC 5C8CC 4I01A 1GFF2 1UW8A 3AFGA 4TYSA 2NYYA 1ULFA 3LCPA 4YG0A 4MSVA 3MIEA 2B7YA 3VBRB 3BCWA 4ES8A 4RR3A 2CGNA 4GQ7A 3H9AA 3MZHA 1MS9A 5GM0A 1QJX1 4E4DX 1HDKA 1RUNA 1NYWA 3WXPA 3I8TA 3JCIA 2D3SA 2DCJA 1S0BA 2UY8A 4P9XA 4WZCA 3EJKA 1VP6A 4XFFA 5K8SA 2ES3A 2X8KA 1LHNA 4JGZB 4Q2FA 4RSUA 4B4RA 4P9YA 4DOUA 4D69A 4HMZA 4AFDA 4IL7A 2KXLA 1HRI3 2PHDA 4A2UA 4BMEA 2MPFA 5C9AC 3ZN5A 1S2BA 5J96B 1W6OB 3AKPA 3CJXA 3ETQA 2VECA 2XBO1 2GNBA 3ENRA 2VQAA 2DFBA 3AKRA 1NCQC 1D2SA 4LULA 3IDEA 4QGLA 4JQRA 2OUHA 1O3TA 2JDZA 4EWDA 2ZS6B 2VNGA 2WKKA 3N7MA 4X6RB 1X82A 1S55A 1PGW2 4JAAA 4I02A 1WW7A 4L2NA 3GF6A 1VBA1 1ZZ7A 3VBOA 1QXJA 1RHI2 4NWWA 1V6MA 4Q0SA 2A75A 4E2SA 1KFUL 4AWDA 1D0GA 1QJU1 2A3WA 1B35C 4XFHA 3S30A 3RG0A 1F2NA 5BPXA 3GBWA 2P3KA 3AP7A 4H7MA 1RUF2 4XFAA 3WW4A 1U5YA 1R083 4XQWA 3LOIA 3J9SA 2P37A 4YVSA 4L97A 1H1AA 1C8M3 5ACA3 5DUUA 1JN2P 1H9PA 2XBO3 1UU6A 1DU3D 4WBBA 1KS5A 1TNFA 1UIKA 3MLJA 4IEZA 2TBVA 5C9AB 2DCTA 4GMP1 4XXPA 3WY6A 4COVA 5H9QA 5BNQA 3WDVA 1LCLA 4LUMA 1ZM1A 1JOJA 4KWJA 4EN0A 2OYZA 3ELNA 2B9UA 5C4WC 4FCAA 5J48A 1FV3A 1LTEA 5FDBA 4INDA 3B9IA 1X50A 1CR7A 2WNEA 1ULEA 2I45A 2E63A 2GU9A 2YV8A 3NW4A 4JGYC 4YGBA 1NQJA 3FHIB 2GMPA 4QPGB 2A6ZA 4I3GA 1TME2 2HWC2 3JD72 4P9IA 2XL7A 1UU5A 1B35B 3VBSB 3OPZA 5L7OA 1PGW1 4ZU7A 2LALA 3WG4A 1DZTA 1LGCA 1HQWA 1AR82 2VXRA 5J98B 1RHI1 5DZEA 1MS4A 2DCZA 2F6BA 2ZZQA 4ZU5A 3H3ZA 4F8AA 3AMPA 3WW3A 3FJSA 4P9GA 4XF1A 1TEIA 2WNVA 2HEYF 5AVPA 2ZHLA 3TRSB 4KG8A 4H3WA 2R062 4AFCA 1KJRA 1NY72 4G3YC 4X6QB 4AGVA 1RUF1 1F5FA 4Q4W2 4AVAA 3QD6A 2JG9C 1ZBE2 1TMF1 2ZKNA 1OD5A 2WNUC 4QM8A 1O4TA 3CNAA 4PLOA 3FBYA 1LHVA 2E53A 4GWMA 5LEKA 1HRV3 5I0RA 1QKQA 2XJSA 3MGUA 4XJZA 4WVWA 1LRHA 3NV4A 1WUVA 1D4M2 4LBQB 4JGYB 5I8SA 5T55A 4YGDA 4A7YA 1KFXL 2CGOA 2GNMA 2UU8A 2BNOA 5CG8A 1HXS2 4BIFA 1CONA 1XYOA 2CL2A 1JBCA 3TBDA 1WBLA 2YY1A 3HT2A 5JAXA 4KWKA 1LHOA 3AM2A 2NLRA 2XVGA 3PLQA 5CFDA 4AEDB 4YRDA 4WV8A 3MW4A 2JE9A 1Q3EA 4YM2A 5DDJ2 1TME1 5HCBA 2HWC1 3JD71 1Q8OA 4ONUA 1BCXA 3ZFFA 4XF3A 2OVUA 4MZUA 1TMF3 3E6BA 2CAUA 2MNGA 4AVSA 4H55A 1LOBA 5FLHA 1CJDA 3ES4A 4XBQA 4OFGA 5JZGB 3HAGA 3I59A 2JG9B 4CRQA 1LOFA 4GMP0 4AHYA 2WNUB 4DS0A 5FPXA 4GWNA 1GR3A 4YFWA 1AHSA 1NY71 5JSPA 1RJ7A 4HFSA 3ZYPA 4C0HA 4L8QA 4URTA 4Q4W1 3ZVXA 3LB9A 3WX5A 2KA3A 2ILMA 1PK6B 1ZBE1 3O0XA 4HSLA 1EAH2 1QNWA 1C57A 2DU1A 4G4FA 1DYPA 1MVEA 4XTMA 4BYYA 4EN9B 3VBUA 2ARBA 3QH6A 4GB33 3U4XA 4Q0VA 1SACA 1D4M1 4RFT0 3O12A 5EZWA 3OTFA 3IKWA 1RUD3 1MEC2 2A3XA 3R4SA 1HXS1 1RUJ3 1UIJA 1HQLA 2PA7A 4CDQA 4OULA 2YYOA 1REDA 1PM7A 2XB6C 2XKOA 3PVOA 1FT9A 4B29A 5I8TA 2CV6A 4HETA 4E4SA 4FBFA 1DQ2A 1AXZA 4CDUC 1IKQA 3EHKA 5JOYA 2BVBA 4KNCA 4LTAA 3KT7A 4LBOA 5DDJ1 5FTTC 4DRVA 3VLBB 4CDWC 2HEWF 1RGSA 4MGZE 3USSA 1CJPA 1OOPC 1VBD2 2HWB2 3HD8B 2ZGOA 4S2FA 4BOWA 3AKTA 1X8MA 3AYCA 2BNMA 3KT1A 1ND2C 2RE9A 2A6VA 4P9LA 5KHKA 1IPJA 5JOXA 4YZ2A 2ZOEB 1BXHA 1MS3A 2W68A 4E2QA 5LK7B 4C90A 1G9AA 5GZGA 2VW1A 3D6EA 4YZ3A 1BK1A 1ASJ1 1PIV2 2BFUL 2DUPA 3M70A 4LHLA 1GZWA 2X5IA 2VY0A 5FAXA 2GAUA 3PMEA 2ZA9A 4L9BA 4CEYC 4D7TA 4META 4M0HA 1GNZA 2CWSA 3AXEA 2QJVA 1PNGA 1VBC3 3VHPA 5K0UB 1XE8A 1RJ8A 4R9AA 1LKNA 3ZN6B 4CDUB 1ZRFA 3VL9A 1MEC1 4N43A 3NKTA 5JSOA 1GNHA 1LJ7A 3RYRA 3TNQA 2Q30A 3MIGA 1DLLA 1JW6A 3J8F2 1OOPB 2A70A 3MFCA 4WM8A 3U07A 3ZFEB 2WIIB 3USUB 4K6BA 1GQHA 1QHDA 3OD0A 2OIIA 3WDYA 3RS6A 4Q1RA 2XJPA 3LA7A 4XF0A 1Y7BA 2RS13 1NLSA 2R16A 4XQDA 2TNFA 1ND2B 4HVRA 1YHFA 1ASJ3 4I0WB 4Y4YA 1VBD1 4CP2A 2Y38A 1UN1A 2A5ZA 1APNA 5T5JA 1LR5A 4B7EA 2ERFA 2VOKA 5I0TA 2WQZC 3AJZA 3KCYA 1RTVA 4IERA 3AYDA 3GBGA 1DGLA 2H6CA 3VDDA 3MLKA 5JR7B 4PQ9A 1BJQA 2R043 2ZHNA 3O0WA 4OLLA 1G6NA 4PBPA 4CEYB 4RS5C 1FAYA 4PBOA 5GALA 3RQ0A 4UW3A 3IM0A 4LR4A 5JDBA 2JECA 4ITCA 1OPOA 4AI0A 4K21A 5BNNB 4BM8A 1FPN1 4MUVA 2ZGSA 4AE2A 1W6MA 3ZSLA 2IXLA 2PLV2 3ZO0B 4C1XA 4RD7A 4CEWB 4PIZA 2RMU2 4MGKE 4OHWA 2QVSB 3ES1A 2ZMNA 2FBEA 4UW5A 4PDWC 4IXLA 4HT1T 1CGPA 1G9BA 2WINB 1CAXA 4WZFA 4XQ4A 2GDFA 4XYXA 1J1LA 1YI9A 1OQ1A 3K48A 4XF9A 3VKMA 3ZYJB 2RHPA 2Y0IA 2P17A 1CN1A 1NCRA 4FT8A 1ZNPA 1W6NA 1O3SA 4YW5A 1AL23 3O5SA 3PVEA 1RL3A 2Z5WA 3ZDSA 4FPKA 3VBFA 2XVKA 2ZGQA 4X8NA 1AYM2 1BEV3 2A7AA 3GHNA 5JI7A 3KCXA 1D2QA 2BVVA 2JXAA 1V6NA 2ZGUA 4QHBA 3SISA 4RA0A 1O91A 1AR72 5GZFA 2EAKA 1Z0HA 3GBFA 4EWEA 1OPMA 1H1IA 1R1A3 4AFAA 1NXD1 2DFCA 1L3JA 2D6KA 2ZX2A 3DN7A 4B8EA 1C1FA 3HN1A 3PHMA 1XYNA 1LENA 1RVF2 5DZFA 1MS1A 2HWD2 4IV1C 2XGXA 3OY8B 4IESA 1MQTA 2VW0A 1MS0A 1YFYA 2XJRA 1RMU2 3MPBA 4Q4Y3 4S2HA 3RDIA 1RUG3 1SEFA 1QXPA 1VBE2 3ROUA 2JENA 3KMHA 1AR62 2PLV1 4JC1A 1DZRA 4LBMA 2RMU1 4XFBA 1K5MA 1UKGA 2D3RA 5CFCC 4D94A 2WS93 1NZCA 4Q8LA 5DZGA 2CAVA 1WLWA 1GKBA 1R1ZA 4AQSA 3PJQA 3ZFGA 3HWJA 3QCWA 1EV12 4B3NA 2W39A 1FOD2 5D8AA 3L9JT 2DTWA 1W6QA 4CDXB 1SBFA 1AYM1 4EN7B 2ZZJA 1QOSA 3SXWA 2WFF1 2OZJA 2G9GA 4LE4A 1AR71 1DQ1A 1H2LA 3DGTA 1SLTA 3W59A 3WDXA 5H9SA 3VGIA 4Z82A 1PVC2 3VBOC 3PTYA 2D44A 3WNXA 3JQXA 5GLUA 3ZXGA 3DUIA 1Q8PA 1V6KA 1ULGA 1J59A 1AR93 3NV2A 5BYNA 2WZR3 4RR3B 3THTA 3CJIC 2I07B 3DV8A 4BE3A 5C33A 1VB4A 2F4PA 1UKRA 4EWAA 2WZPP 3IDBB 2VMGA 3SNMA 4IEXA 1YJLA 4YM3A 4NN0A 3P3NA 4YSFA 1VBE1 4RHV2 3WDTA 1AR61 3AZVA 4MGIE 2PTMA 3B94A 3RYPA 4XF4A 5BXXA 4QQ2A 3ZPYA 5T50A 3BOPA 2E7TA 1S2KA 1V6IA 2WFF3 1BZWA 2A3YA 4Q4X2 2R071 2WQ4A 1AYN3 3FMGA 1PO22 1VRH1 2GNTA 2FZ2A 1EV11 5KHHA 1BYHA 1X33A 2GSYA 1FOD1 3VBRC 3MIFA 2IZWA 5L36A 1EYBA 1GZCA 2LTNA 3NJZA 3UL2A 1JYIA 3FWEA 1H2MA 4FP3A 3M2MA 5HCAA 3KGLA 2ZAHA 1WCDJ 5A3LA 1HV0A 4IV3C 1I3HA 4Z1VA 3VBOB 1MS5A 2VVEA 1DHKB 1UZYA 4IEPA 1V9U3 2DVAA 2E6VA 4K3UA 4PIYA 4JGZC 1ZZCA 4FTEA 3AFKA 1BMV2 4LBLA 4OZXA 4DB5A 1S0FA 1S0EA 1PVC1 1S1AA 1PZ8A 1NA1A 2NN8A 3JBG2 2QFEA 2YC0A 2Q1ZB 4Y22A 4X8PA 4UW6A 3QBQA 2V73A 1C3HA 1POV0 4NO4A 3B9CA 4YVSB 4NWVA 3ZMNA 1COV3 1VAKA 3MIDA 1ZBA2 1DYKA 4YM1A 4YVWA 3RYKA 1RUC3 1VRH3 3RWNA 5I0UA 3RJ2X 5A33A 2VNRA 4AQ2A 4K20A 2D5FA 3POWA 4Q26A 3N7JA 2D40A 4RHV1 5IK4A 4HSJA 2ZBJA 4LLOA 4O9EA 1YYNA 5FRAA 2WLQA 1AXKA 3TN93 2DU0A 3CF6E 3MFAA 3VHRA 5FO8B 1DG6A 3LA2A 2ZTNA 3ZYRA 1H2NA 5JIUA 1ALYA 2VH9A 4LO8A 4Q4X1 1OQDA 5FQ0B 4KL1A 5IT6A 1ZRCA 1PO21 1V6OA 2ZHMA 4HKOA 4JDOA 3WINE 4IV3B 2PFWA 1CX4A 3H50A 4KU8A 4RL7A 2FMDA 2WFPA 4WM7C 5GJ6A 2P34A 4PLNA 1SDWA 1CAUA 4XHXA 1WW5A 5L7OB 4H14A 2EF6A 1JUHA 5BV6A 1U5XA 2ENRA 1N3OA 3ASIA 1Z7S3 4K1ZA 5KHIA 3D82A 3VZNA 1W0PA 4E4ZA 1HIXA 2PHTA 3NO8A 4Q4V3 5KXCA 3SCHA 1BMV1 2WNVB 4M0NA 2I2SA 1RUE2 3JB8A 1GYKA 3NKGA 4XJ8A 3CL1A 1YXWA 3AP9A 1TQ5A 3QOPA 4L92A 1OI6A 3N7LA 4FXGB 4KGQA 3B00A 3CO2A 2RS32 4I3PA 4RQPC 3GALA 5KXDA 1ULDA 3WP3A 1ZBA1 2VOXA 4EJRA 1J3QA 2CWMA 4KQ7A 3UKTA 1QJX3 4QPGC 5I93A 2IXCA 3ILNA 2ZGNA 2XLFA 1KDKA 3VBSC 4BZ4A 3KB5A 1HKDA 3AP4A 4HK8A 4AEKA 3JQWA 5LK5A 5SV5A 2IXIA 4TLFA 1HW5A 1RUH2 2BNNA 2HYKA 4WM7B 4TWTA 4YG6A 5T3NA 3S6PA 3KGZA 1N3QA 4XJWA 5AC92 2H0BA 5CFDB 2WSVA 4QXKA 3UKVA 3I2DA 2JG8C 2B39A 1WLTA 3SMHA 1JHNA 5I91A 3O7OA 1H30A 1UAIA 4AW7A 4C0BA 2YPJA 4LBNA 5IUQA 1FI2A 4COUA 1VBA3 5DXDA 1CAVA 2XLAA 3GZUC 2ZCWA 3O14A 1QJU3 4RQPB 4BH9A 1AJOA 1RUE1 1ZZ8A 3AZZA 3WCRA 2XL9A 1H8TA 1XRUA 1UCXA 4N9HA 2DVFA 3DPRA 1IGOA 4O9GA 4ASLA 4FOQA 4D7SA 1VAMA 2RS31 2QCSB 2DUOA 4CTEA 1BVP1 4KG0A 4AEDC 3VKFC 3NSTA 5J36A 1HLCA 4YYOA 5HBAA 4GKYA 1YFXA 4QPIA 4R52A 3TB0A 3ZXDA 2PAKA 2ZGPA 4GMP3 3WUCA 3ZSEA 4QQOA 2D6LX 1SBDA 4B4PA 5K7PA 2G9FA 3WQ0A 2Q5TA 5JZGC 1RUH1 2D6NA 4TZDA 2JG8B 4CDQB 2QDNA 3WP4A 1PO12 5GKAC 2A6WA 4AG4A 2CYFA 3GYDA 5AC91 3ZX7A 5KWRA 1UX6A 4P5HA 3CLPA 1O5UA 1PK6C 5IK5A 2YXSA 2ZAAA 2VU9A 3WP6A 1XNDA 2XH6A 5FO9B 4XOGA 2EXIA 2C1FA 3QLQA 2MEV2 4PLMA 3WG1A 2QQPA 3G6JB 2Q4SA 3GHMA 1ENXA 1RHI3 4AFBA 4F7ZA 3NAPA 5C8CA 3JU9A 3BALA 4M00A 4YGCA 4YW3A 1CPNA 4YZ1A 1ENRA 3HR9A 4QGNA 1CAWA 2NM1A 3RRDA 4XMIA 4HBNA 3VN4A 1C5HA 3IPVA 5LRSA 1DGWA 1RUF3 2ET7A 1WW6A 3B02A 2P2KA 3D0JA 3H7JA 2QE3A 3H1YA 5GLTA 1WD3A 3W58A 2PHRA 1AR81 3APBA 3FFQA 1CPMA 2RM22 3C2UA 2ZGTA 3R05A 1J58A 2C9AA 4BHPA 1H4HA 2R061 1VBC2 5FLIA 4ZKTB 3JZVA 4N43B 2QNKA 2SLIA 1SCRA 2ATFA 2VOWA 1NCQA 2VW2A 4LA3A 4ASMB 4LA2A 1SQ4A 1AF9A 2OW4A 4WM8B 5BNOA 3LWCA 2D93A 3OBTA 3KSCA 4LO4B 1Q8VA 3PNAA 2PHLA 4U36A 4XPVA 4R9DA 1TME3 2HWC3 3JD73 3M8LA 5FBZA 3AMNA 4K1YA 4DY5A 3TYJA 4R8HA 2MEV1 2BTVC 1LHWA 5JLVA 1FMD2 1B35A 3TOJA 1AR83 1OFNA 1QJY2 2R0FA 2D6PA 1ZZBA 3LA3A 5K0UC 3D5OA 4BPZA 3FLTA 3VDDB 1OFSA 3R0RA 4HLTA 3FUQA 1XU1A 2DTYA 3ECQA 3L2YA 2Z2SB 2RR12 1YIFA 1QQP2 5HCFA 1KITA 3ZXJA 3V0AA 3NWKA 2R063 2HWE2 4P9JA 2RJKA 4QQPA 1NOVA 2XVLA 3KM5A 4Q4W3 1S0IA 3B93A 2R6QA 2H6BA 3ZFEC 1ZBE3 2JD4A 2DWRA 3ACLA 4DINB 1O3RA 1DFQA 4GXLA 1LEDA 4IQPA 5FO7B 2RM21 3NV1A 3HIFA 4QPYA 1N47A 4UBHA 1OA4A 1Q43A 4IEYA 4BQ1A 5C4WA 4LO6B 1FNYA 1R092 4CP0A 4J1XA 4MV2A 1D4M3 5J09A 1QOTA 5KBFA 4GKXA 4NR1A 1I1EA 1ZA4A 4JGYA 1HXS3 2GALA 1G9FA 3IT8A 1A3KA 4RGAA 1EAH1 2R1DA 3AKSA 5EWSA 1IQAA 5DUWA 1NQDA 1NCRB 4COYA 4JTOA 4BWOA 2FMYA 1URXA 1GLHA 3M3CA 1KDMA 2B46X 5DDJ3 2RS52 1ZVFA 2ZX1A 1FXZA 5BNNC 3S7EA 5CIRA 4LBKA 5FMOS 1RUI2 1FMD1 4Y1ZA 4S2GA 5C6CA 4CEWC 1DQ4A 2R49A 1QJY1 4OHZA 4PIXA 3H1MA 2Z79A 1DDLA 2AGSA 3E5XA 1F9KA 1GANA 1QGLA 5DG2A 4QX5A 2JG9A 2E51A 1QQP1 1YRZA 2WNUA 3MIBA 2ARXA 2HWE1 2Y26A 3V65A 4BLJA 4XBLA 5BNPC 3U11A 2Y0OA 1PZ7A 2NQYA 3C3VA 4AI1A 5TSWA 4N53C 2AH2A 5EFUA 3EQEA 5CVRA 2GNDA 2HWB1 4IEOA 1NXMA 1EAH3 3WVJA 5FCCA 4FPLA 5EYYA 1XXNA 4R4XA 1WW4A 1AZDA 2D97A 1ZZ6A 3WT3A 1U5ZA 4Q0UA 1R091 1LULA 4EV0A 3VZOA 3RMYA 5ABJC 4MH0E 3AZYA 5AFEA 1ND3A 4FPOB 4BCUA 1WCSA 3VHNA 1MEC3 1PIV1 4FTSA 1ZX5A 3LAGA 3D4KA 4XHBA 3SCFA 4DXZA 1PGSA 1YUDA 5JVVA 1CESA 4I09A 2WLPA 1KD7A 5J3UA 1UL9A 2A6YA 4U2AA 1W6QB 1VBB2 5T5PA 4K7JA 2YMZA 2GMMA 3DL3A 1JYCA 3MW3A 4ATFA 3AYAA 2R30A 4ZXKA 1FATA 3Q9OA 4I2OA 2QZ2A 2UYAA 2HJIA 1RUI1 1VBD3 4N7IA 1D4VB 5BNPB 2UURA 1FV2A 3BODA 1EP0A 3VBHC 4N53B 3J8F1 1ZREA 2AUYA 5SV8A 2DF7A 2OA2A 1QF3A 1W6PB 1YLLA 4AI3A 1LB2A 3ME2A 2ZKLA 3H8UA 4YNIA 1PIV3 1NE6A 1RIRA 3OBRA 2HWF2 1G9CA 2YGMA 5ABJB 1AUYA 4I0AA 5A32B 2XHKA 4CDXC 4ATEA 4BMBA 1UZZA 1FPN3 1ENSA 2LM3A 3LSDA 3WG2A 1RINA 3ZMOA 1S0JA 3AMQA 2BGCA 2BQPA 3ZXFA 3D0SA 4OUSA 1HQNA 3PVNA 2WL1A 4HPKB 1LODA 4JDNA 4XDQA 3THPA 4WVMA 4CDUA 3KT4A 2I74A 5A3MA 2UWBA 4M3CA 4RR3C 1QY4A 1C5IA 1S0DA 4AVTA 4IEUA 3J26N 4CDWA 3J8F3 4XXAA 2DCKA 3OGGA 3QH7A 2ZX3A 3VUOA 1YWKA 2Q1MA 3B01A 3ZXKA 2BPA2 5JWPA 1POV1 3VBHB 2DVBA 1MACA 2ZMKA 5EXOA