1HRI1

Structure determination of antiviral compound sch 38057 complexed with human rhinovirus 14
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
273
structure length
273
Chain Sequence
TVASISSGPKHTQKVPILTANETGATMPVLPSDSIETRTTYMHFNGSETDVECFLGRAACVHVTEIQNKDATGIDNHREAKLFNDWKINLSSLVQLRKKLELFTYVRFDSEYTILATASQPDSANYSSNLVVQAMYVPPGAPNPKEWDDYTWQSASNPSVFFKVGDTSRFSVPYVGLASAYNCFYDGYSHDDAETQYGITVLNHMGSMAFRIVNEHDEHKTLVKIRVYHRAKHVEAWIPRAPRALPYTSIGRTNYPKNTEPVIKKRKGDIKSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title Structure determination of antiviral compound SCH 38057 complexed with human rhinovirus 14.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
total genus 40
structure length 273
sequence length 273
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1992-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1hri100
4N53C 1ND2A 1QJU1 1V9U1 1VBC1 1VRH1 1C8M1 4RQPB 4GB32 3J8F3 2RS11 4GB33 1HXS1 1AYN2 5BNNB 1RHI1 4N43B 1AYN3 1MEC2 3ZFGA 1MEC3 2MEV3 5ABJA 4JGYC 3VDDB 1MQTA 1RUG2 1RUG3 1QJY1 1RUJ1 3DPRC 4QPIA 3JD72 3JD73 2BFUS 2RR12 5J96B 2HWC2 4GMP0 4AEDB 2HWC3 4WM7A 1OPOA 5C9AB 5CFDA 1AR81 2QQPA 5CFCB 4RHV1 1PO22 1RMU1 1AL23 1EAH2 1RVF2 1RUD1 1RVF3 2X5IA 5BNPB 1BEV3 1C8NA 1AR72 2WZR2 4QPIC 1ND3B 1AR73 5JZGB 4Q4X1 2WS91 4WM7C 2GSYA 2HWB2 1VBA3 5CFDC 1RUC2 1RUC3 1VB4A 2R072 4CEYC 1DDLA 5DDJ2 2R073 4RR3B 5DDJ3 1PO11 4NWWA 5BNNA 4RS5C 1ZBA3 1FOD2 4N53B 1X36A 2X5IC 3HAGA 1TME1 1AL0G 2PLV2 1RUF1 3VBRA 2WFF1 4FTEA 4Y4YA 4YVSB 1BBT2 5C8CB 1ZBE3 4AEDA 5L7OB 1R091 1CD3G 4GMP1 1NA1C 3VBHC 1AR92 1HRV2 2HWD1 1ASJ2 1QJX2 1ASJ3 1QJX3 1TMF1 1AYM2 1FPN1 1ND2B 2R041 1QQP3 3ZFFA 2IZWA 3JBG3 5JZGA 1HRI3 1R1A1 1AR62 3ZFGB 5ABJB 2DF7A 2RS52 1MQTB 3JB4C 4Y5Z0 1NCRA 1D4M2 1R083 1D4M3 1RUE3 2R062 4QPIB 1AUYA 2R063 5A32A 1HQNA 3ZFEA 4WM7B 3J8F1 2HWE2 2ZZQA 3VBSC 3ZFFC 2HWE3 5CFDB 1FMD2 1AYN1 2MEV1 4CDWA 1RUH3 4CEYB 5AC91 2RM22 2BBVA 4LLFA 2RM23 1NY71 3LOBA 1NCRC 2X5IB 4JGYA 3NAPA 3JD71 1PVC3 1VBB2 1RUI3 4Q4V1 4YVWA 3ZFEC 5FMOS 3DPRA 1Z7S2 2ZAHA 2BUKA 4EJRA 4CDWC 4JGZC 1AL21 5J98B 2FZ1A 2FZ2A 1BEV1 1AR71 1EV12 3NAPC 1COV1 4YVWC 1POV0 4PDWC 1VBA1 1B35C 3VBRB 4NWVA 2RS32 2RS33 1NOVA 2HWF2 5GKAC 2R071 2HWF3 2RR13 1BMV1 1ZBA1 4QPGC 2XBO2 4CEYA 1PIV2 1PIV3 1PO23 1VBD2 4RS5A 4Q4Y2 1VBD3 1EAH3 4Q4Y3 3ZFFB 1SMVA 2WZR3 1ZBE1 1VBE2 2HWB3 5A33B 1ASJ1 1QJX1 1NCRB 1V9U2 1VBC2 1VRH2 1C8M2 1NA1A 3VBHA 1VBC3 5A32B 3TN91 1QQP1 3ZFEB 2RS12 3VBOA 1HXS2 2RS13 1RHI2 1FOD3 3JBG1 5D8AA 1HRI1 4CDWB 4GH4A 5K0UC 2PLV3 1H8TA 4IV3A 1R081 1D4M1 1RUE1 4CDXA 2R061 4JGYB 1BBT3 1WCDJ 3NAPB 1OOPA 4YVWB 5FOJB 2BFUL 4CDQA 1AR93 1HRV3 4FSJA 3VBOC 3DPRB 1AR82 2GH8A 5D8AC 1AYM3 1RUH1 4RHV2 5ACA1 1RMU2 4Q4W2 4RHV3 4Q4W3 4GH4C 3VBSA 4FTBA 1RUD2 2RM21 1H8TC 5BNOA 4IV3C 2RMU2 1AR63 2RMU3 4Q4X2 1PVC1 1NCQA 2Y26A 1RUI1 4CDXC 1PGL1 1OOPC 2RS53 1POV3 5A33A 4CDQC 3VBFA 4N43C 1PO12 3S6PA 4CDUC 4GB31 1K5MA 1FMD3 1MEC1 5C4WA 5BNOC 1X33A 1CJDA 4JGZA 4BCUA 1NCQC 1TME2 1RUG1 4RS5B 4RR3C 1RUF2 2WFF2 3VBFC 2HWF1 1VBB3 2RR11 2HWC1 4PDWA 1B35A 1W39A 3VBUA 1K5MC 1TMF2 5LK7B 1TMF3 1FPN2 1Z7S3 2BPA2 2R042 4WM8A 1FPN3 5C4WC 2R043 1PO21 1NA1B 3VBHB 1VBD1 4QPGA 1EAH1 1RVF1 4IV1A 4FTSA 3VBOB 2WZR1 5D8AB 1PGW2 1EV13 4RFT0 4GH4B 2HWB1 1H8TB 2ZTNA 1RUC1 4IV3B 1VB2A 3VBUC 1F2NA 1OHFA 4WM8C 3CJIC 1GFF2 4CDXB 5DDJ1 1OOPB 3J8F2 1FOD1 4CDQB 4IV1C 2MEV2 2XBO3 4YVSC 5C8CC 5AC92 5L7OC 5AC93 4CDUB 2PLV1 3VBSB 1NY72 1RB8G 5BNOB 1ND2C 1BBT1 4CEWA 4Q4V2 1NCQB 1E57A 1VAKA 4Q4V3 5K0UA 1VBE3 1AR91 1HRV1 1QJU2 3VBFB 1QJU3 1AYM1 1V9U3 3ZFGC 5FMOL 1VRH3 1C8M3 4Q4W1 5ABJC 1AL22 1MQTC 1HXS3 1BEV2 1K5MB 1RHI3 1AR61 2RMU1 5C4WB 1COV2 2TBVA 1COV3 4JGZB 4CEWC 2RS51 1POV1 1QJY2 1QJY3 1VBA2 3JB8A 1RUJ2 1RUJ3 1M06G 4RQPA 1BMV2 1ZBA2 4PDWB 2HWE1 4N43A 1B35B 3FBMA 1FMD1 2WLPA 3VBUB 1AR83 1A6CA 3VDDA 4WM8B 3CJIB 1F8VA 1RMU3 4CDUA 4QPGB 1RUD3 4IV1B 4SBVA 1ZBE2 2WS92 4Q4X3 1VBB1 4RQPC 2WS93 5C9AA 5BNNC 5CFCA 1Z7S1 3VDDC 3TN92 1QQP2 1PO13 3M8LA 1NG0A 3TN93 2VQ0A 5BNPA 3JBG2 3VBRC 1HRI2 1ND3A 1PGW1 1EV11 4AEDC 2XPJA 1TME3 5C9AC 1RUF3 2WFF3 1R082 1RUE2 2RS31 5CFCC 1R092 4RR3A 4CEWB 1R093 4GMP3 5K0UB 1IHMA 4Z92B 3IDEA 2HWD2 4N53A 2HWD3 5BNPC 2XBO1 1ND3C 1RUH2 3CJIA 1QJZA 5ACA2 5JZGC 1PIV1 3ZXAC 5ACA3 4Q4Y1 2WWSA 1HX6A 1R1A2 4YVSA 1R1A3 5C8CA 1PVC2 1RUI2 5L7OA 1PGL2 1VBE1
chains in the Genus database with same CATH superfamily
3ZKUA 2J1TA 1YHFA 3BN6A 4K20A 4S2GA 4CCEA 4YGBA 4BMBA 4M3CF 3POFA 1GNYA 4QHOA 3KT7A 1ND2A 1QJU1 4Z8BA 3LEIA 1JW6A 4PLNA 1OVSA 2DDUA 5CKMA 1VBC1 1G86A 1C8M1 3G6JB 3ZDVA 2BRTA 2VMHA 2YGLA 1EUUA 1H30A 2E7TA 4LLOA 3VL8A 2RS11 1GZCA 3C7EA 1HXS1 1AYN2 1AYN3 4XJUA 3ZN6A 2D93A 4ONUA 2ZGQA 3CLPA 2ZEXA 4JKLA 4OUSA 5DAVA 1MQTA 3IPVB 4GWIA 1UPIA 5HCAA 1RITA 4O65A 3D5OA 5KHJA 4FPOB 3V0AA 1ZRRA 4IE4A 4AFAA 5ANQA 3EB7A 5DMYA 1JZ7A 4FPJA 1VMFA 3RWNA 2RR12 3USSA 5J96B 4I01A 4GMP0 2WBKA 4IEOA 5C9AB 1QWRA 5CFDA 3VKOA 1C28A 1N3QA 4HVOA 5GLVA 4HANA 5A7WB 4M4PA 5LRRA 3P5BA 2D44A 3UJQA 4NUBA 4WV8A 1CZVA 3T4VA 1UQXA 4GULA 1CPMA 4QPIC 2WNVB 1G8WA 1N1VA 1ZA4A 3AKRA 3IM0A 4OZXA 3LFMA 1A3KA 2XWJB 4TLGA 3ZVXA 1OXCA 5F1RA 1G9BA 2R1BA 5FO7B 2V4AA 1XNCA 4W4ZA 3POWA 4CEYC 3VD9A 4FOVA 1W6QA 1RUNA 5GALA 4YSFA 4DUVA 4AVCA 1MZ5A 3HVDA 1UX7A 1UW8A 1ZZCA 2Q4SA 4JCKA 3H7YA 4IEQA 3ACHA 1OQEA 4QM9A 4E27A 2OUHA 4LBLA 3BGAA 2WUHA 5A7OA 3BI3A 4A2UA 2QUOA 2X29A 4ZS2A 5FRAA 5LA0A 3ON7A 1V70A 2BTVC 2EIEA 1OURA 1W03A 5FPXA 2FDGA 1SDDB 1TME1 1V0AA 2DBNA 2D6NA 1UN1A 1W99A 4A6OA 2W1WA 1O6UA 2RE9A 4YM0A 1YWKA 2VECA 4GZ9A 4R8HA 4FTEA 2W1SA 2LM3A 1AXKA 2XQXA 3C7OA 2CYFA 4M0HA 4YVSB 4YW2A 4BK4A 3FHAA 5C8CB 3A7QA 2FQPA 1LGCA 1SPPA 3OJBA 1UY3A 4ASLA 2WZPP 5IAXA 2HWD1 1W6NB 5ERLA 4DUWA 1EY2A 3NV4A 1IGOA 4NAMA 4P02B 4DUXA 1JYTA 4IUGA 2XB6C 1JN2P 5FUIA 2HH9A 1GZWB 5JI7A 1JYWA 3DXTA 1REDA 1XPWA 1Y9GA 2IZWA 5JOWA 2NP0A 3L2YA 2P34A 3FC0A 1NQJA 3MLLA 1HRI3 5I8SA 2QQOA 3ZFGB 5F6LB 1AR62 4O7XA 5FP7A 2QDRA 4B3NA 3USUA 2DF7A 4I02A 4PF1A 3NVCA 1L7LA 4QXCA 2BV4A 4LO4B 4XFAA 3AMQA 1LOCA 1JZ2A 1WLDA 1N1TA 1RXGA 1RUE3 2WA4A 1AF9A 1Q8OA 1OFNA 4UYBA 4DNYA 2D5FA 3VBSC 3ZFFC 4I0BA 1J59A 2V5YA 5T5LA 2VZQA 3IKWA 4Y3OA 3NO8A 2MEV1 4PIXA 2VUCA 3VKNA 4URAA 1HDKA 1RUH3 2Y33A 3BTAA 4Y5TA 5HBAA 2GZWA 2LS6A 2XVGA 1H9PA 2BU9A 4MLOA 5F3EA 5JOXA 5EQUA 5FKCA 4XTMA 2A71A 3LF7A 4G4FA 3ORJA 3A22A 4CP0A 3FN9A 2X5IB 1ZZ6A 4FQ4A 3WDXA 1VBB2 5F7UA 4YVWA 1MS1A 2X53S 1O8PA 1YQCA 4OHXA 5IVCA 3ZFEC 4AI3A 5EXOA 1SLBA 5LEJA 1RINA 2XG3A 3UL2A 2EF6A 3WDWA 1G6NA 2A3YA 2ZAHA 4EJRA 2D3PA 1EYBA 3AKPA 5FP9A 5A3TA 1W3XA 4JGZC 3E5XA 4MGZE 1HQWA 4YFZA 4BDVB 2ZX3A 3HIFA 5BNQA 2OA2A 2GC2A 4UFKA 1AR71 3OGSA 4LK6A 2Z69A 3NAPC 3U14A 2NLRA 2VZSA 2DTWA 3I7DA 3OUHA 1POV0 4PDWC 2JE8A 3DGTA 3VKLA 4ZZ5A 3BB6A 1B35C 5JI9A 1BXHA 2IXKA 4CCJA 2JIGA 3WXPA 1SHWB 2RG4A 5A3UA 4S2DA 2DU0A 1G7YA 2VH9A 2W1QA 1U12A 5FZAA 3KM5A 1NX9A 2ZX2A 1ZBA1 2Q5TA 4CZSA 1F4AA 4CCLA 4LO5B 4JDMA 4QPYA 3O7OA 5L9RA 1QXRA 3J26N 1PIV2 4YGDA 5JXHA 1PIV3 1PO23 2ZGTA 3FUOA 2ZGPA 3RNSA 3RZGA 3RFRA 2JDYA 3TRSB 2DCTA 4QDRA 4XF9A 2WZR3 2Z2SB 2Y38A 3MO4A 1S55A 4AEMA 4C91A 3MPBA 2JG8B 3NRUA 1VBE2 1W2AX 3OBAA 4HVRA 3RJRA 2ZX0A 3TYJA 5KXBA 5AVAA 2RDNA 1DLCA 2GC1A 1QJX1 4XDQA 5E6HA 1ULEA 4DEQA 2VQAA 3R6SA 1YFUA 1FX5A 3KB5A 4NO4A 5CB7A 1XJAA 5EHDA 2XJUA 4N9IA 5A32B 2DVAA 3TN91 5C3PA 1DBNA 4XF3A 4AFCA 5AFEA 4META 1Q8PA 2DV9A 4MADA 1JH5A 4LOSA 2SLIA 1IPJA 3BPZA 5T3NA 4CDWB 4IXLA 1UYZA 4PIZA 2ZHLA 3OPWA 3VZLA 3DCQA 4Z2AA 2R0HA 3CO2A 2PLV3 2QQUA 4KI5M 2VVFA 3THCA 2H6CA 1DQ0A 4EE2A 4CU6A 2LUWA 4K21A 5FYIA 3WHUA 1WWYA 3CHXA 3Q8CA 1D4M1 4W8JA 4JGYB 5FYTA 4AQSA 4AI0A 4XQWA 2GP5A 5BPXA 4BQ4A 1UL9A 2D98A 1ACCA 3I2IA 4PLOA 5TSWA 4BQWA 4OYUA 3LKJA 4XACA 2VXRA 4M4RA 4XIOA 2IXJA 2Y6GA 4M3CB 4FSJA 4C1WA 5CZKA 1GP5A 1A34A 2GH8A 3C8XA 1ULGA 3FFZA 4FFHA 2IXLA 4AVBA 4AZZA 4Q0PA 1S2KA 1SLIA 4Q4W2 4Q4W3 1T6BX 3AFKA 4N7IA 1CR7A 4OHWA 1ODNA 2D3SA 3OBRA 5GJ6A 4OHYA 1DQ6A 3I3MA 3MW3A 4AHWA 2IVJA 4IV3C 4KU8A 3NJVA 1MACA 4O61A 3E97A 3VKMA 4LQRA 5KR7A 2A1XA 3VHOA 2YFUA 3WQ7A 3LDBA 1DU3D 5GLZA 1ZZ7A 4XUQA 2D6LX 4XFHA 3WP5A 2OXBA 2PQQA 3KCXA 1SQ4A 5FWEA 5FY5A 1A8MA 1LOAA 2DU1A 3T3YA 1QXJA 3MI8A 3KLSA 2C9AA 3PIJA 4NRMA 4CVUA 3JXSA 2VMFA 5E88A 5CKNA 3H8RA 4ZXKA 1PO12 3W9AA 4HZFA 2F17A 2WC2A 3I2FA 5LBBA 3V0BA 4I09A 3RMXA 4C8DA 4NOTA 5LA2A 1FMD3 3HBZA 4R4XA 2WABA 4IE7A 4YW5A 4FPLA 4P9GA 2DUOA 1Y9QA 5T54A 2DYCA 4AR2A 1RXFA 2JICA 3LEMA 3KVAA 4P9IA 3ZDSA 1RUF2 2PFWA 3C7GA 4D6QA 3N4MA 4Q2FA 3TWIA 3OBTA 4QX3A 5FPVA 4KWKA 5F9TA 1J58A 2HWF1 2RR11 2A6YA 2GNTA 2G9ZA 4OUEA 3BCWA 4TYSA 3ABZA 3ST7A 1OT5A 2W47A 4ZS3A 4XUPA 5IW0A 3QCWA 4H3WA 1OA3A 1WGPA 2CHHA 2E53A 5C3SA 1C1FA 3RZMA 2FCTA 2C1FA 1RJ7A 3KT1A 3V65A 3ZLIA 2XJQA 1URXA 3WX5A 2JXAA 5DAXA 1VBD1 2Q8EA 1W0NA 3ZSLA 4FQZA 4D69A 2K46A 5JWPA 3LFIA 2A3WA 3IDAA 1PGW2 4FPCA 5A1FA 2O0OA 4HMZA 1EV13 4RFT0 2WRAA 3N7JA 2W52A 1HIXA 4IEYA 2ID4A 3OY8B 1H8TB 2BDRA 2XUMA 3VBUC 1YEWA 2JIJA 2PHXA 2AENA 2WT1A 5F5AA 3ETPA 3R05A 3SISA 4R52A 4CDXB 1QH7A 4Z2WA 3F95A 1OOPB 1N1SA 1VP6A 2HEYF 1MVEA 3FBYA 2O8QA 1O91A 4IV1C 5IFPA 2XBO3 1W6PA 4YVSC 5JAXA 5C8CC 3KCYA 1V6IA 4M01A 2JECA 3GF6A 3ZXLA 3UKVA 2ET1A 3ZSEA 4NIGA 4BOWA 4QU1A 2OVUA 2WA3A 3AYAA 3CEWA 5F5CA 1YC61 2G19A 4F7ZA 2E32A 4CEWA 4DO0A 3BVCA 4Q4V2 2QE3A 1NCQB 1W3VA 1UOJA 1UU6A 3GHNA 4Q4V3 3LA3A 1H6XA 2VUJA 4R9BA 2E51A 2ZGUA 1QJU2 1WUVA 3B02A 1ZA7A 1QJU3 3QD6A 3ZFGC 4D0QA 1JUHA 3MHZA 5CIRA 4ARXA 1C8M3 3U1XA 4JHZA 3S5AA 5GZEA 4IEPA 1UWWA 4OHZA 5FLJA 1UYPA 2E26A 5L19A 4CSWA 1R64A 1HXS3 2OQ7A 1NXMA 1UY2A 4M00A 4COZA 1LTEA 3N9NA 1AR61 4AE2A 4Y20B 4X6QB 3WD5A 1C1LA 1XU1A 3WCSA 1DGWX 1WW7A 3VZKA 1LRHA 1POV1 4IE6A 1W2OA 2DCJA 5FCCA 4DS0A 1ZM1A 1M06G 1GUIA 3THPA 5D21A 1BMV2 2AACA 3C2UA 3WT3A 2JWPA 2VJXA 1BVVA 3FBMA 4AWDA 4XTPA 1PM4A 1WBFA 1QXPA 5FY7A 1A6CA 5FUPA 5IHRA 3FE5A 3VDDA 5FYZA 4PCRA 3CJIB 5FZ6A 5KHHA 1F8VA 5DUXA 4MGKE 5JXIA 2GAUA 1IS4A 5FZGA 4QPGB 2HEVF 4XILA 2WN3A 2CV6A 5JLVA 2WDBA 4QQLA 4HK8A 2QCSB 1ZBE2 3LPGA 2HJIA 3O1PA 2ZKLA 4YM3A 1VBB1 3PHMA 4RQPC 3SXWA 3WF1A 2IVIB 3BUCA 4IGOA 5JDBA 4Y22B 3WW3A 5BNNC 4QX5A 1NZIA 1S0DA 2N7GA 3UKNA 1D4VB 3Q8EA 5CVRA 2BWAA 1WA4A 1QQP2 2VPVA 1WLCA 2VMIA 4F3JA 1ENRA 1S0JA 2ZGMA 3JBG2 4XAAA 2VQTA 1QJFA 3KV4A 1W6OB 2LW8A 2JDPA 4FP3A 2KXLA 3OOXA 1Y7BA 3Q8FA 4GALA 5T5OA 5LA1A 3A4UA 2C0ZA 2FHRA 4FCAA 3RZZA 1TME3 4NJ4A 3NJZA 5I0TA 1CWPA 4OMDA 3RMYA 2CWSA 4Y24A 3FWEA 5CFCC 5KC6A 4CPBD 2G4IA 5FOBB 2ZEZA 4RR3A 2VVDA 4W65A 2JEMA 1L7RA 1OKOA 4NR1A 5BYNA 1REEA 3TEZA 1W2TA 5K0UB 4Z92B 3IDEA 2HWD2 2GH2A 3MW4A 1SLAA 4ZU4A 1ZX5A 2HWD3 5FZIA 5JSRA 4XC9A 1XNBA 5GLWA 1DP0A 2CSGA 3CJIA 1UOGA 1W8OA 5DAPA 1PIV1 5EV7A 4AHXA 4YM1A 5GZFA 5DG2A 4LO6B 1KDKA 5C5UA 4NPLA 2BOIA 3S57A 2WWUA 1UZ0A 1LODA 2MPFA 3LSEA 3WW4A 5CEHA 2UWCA 2ZBJA 1G9AA 4ES9A 1O8SA 3OTFA 3TEWA 3FZ3A 3K51A 1VBE1 3LDKA 2WYSA 1E5HA 5J09A 2VCCA 4HN0A 4KU7A 3O1OA 3EJKA 4N53C 5M0TA 4FP2A 3U75A 1XNKA 2DBIA 1LHWA 3N7KA 1XXNA 2XJVA 3WNNA 3O1TA 4NN0A 2B45X 3W20A 2ZOEB 1D0HA 1LOEA 4WVVA 1XU2A 3ZSKA 2WN2A 4UFIA 3AXEA 4N43B 2W92A 3GBFA 1W6OA 4AI8A 1H9WA 2MEV3 2XKOA 4JGYC 4QX2A 5KHGA 2ZS6B 2IUWA 3ZN5A 5A3LA 1DQ5A 5BV6A 5CISA 1K12A 2C26A 2V5DA 5IFTA 2Z4FA 4GD4A 4QPIA 3UNPA 5LY2A 1GQGA 4KL1A 2BFUS 4TXWA 4LE4A 4HETA 4AEDB 4YG0A 2E63A 4ZY9A 1OPOA 1VE0A 4B7KA 1POQA 3AZZA 3PU3A 3ZO0B 3I3QA 2QQPA 1RGSA 2QVSB 3DYOA 5GLUA 1XYPA 4AQ6A 2XLAA 1QF3A 4HK9A 1WMDA 1YI9A 5FLIA 2P3KA 3T1LA 4LOTA 3IZOA 1EAH2 3WOGA 2BGCA 5HV0A 1BLZA 2ES3A 2QQJA 3CBNA 5BNPB 5I8TA 4LBQB 2YY1A 4NHXA 1AR72 5SV5A 3MFAA 1ND3B 1AR73 1KGYA 3IMNA 5JZGB 1MZEA 2PAEA 3HBKA 4GQ7A 1O3SA 2VNRA 2VL4A 1NZCA 4WM7C 3ENRA 1IKPA 2J22A 1RUC2 1GOGA 3T2TA 5DN2A 1UMZA 1RUC3 2B9VA 5T50A 3OF1A 4MUVA 5BXXA 2D43A 2PELA 3OYWB 4FAHA 1DDLA 4K6BA 1KDMA 5DDJ2 3RJ2X 2RHPA 2WZEA 1PO11 5DDJ3 5E8AA 2WINB 1ZBA3 4C90A 4NVPA 3RI8A 1FOD2 4LKFA 3AL6A 2BBAA 4XJZA 5F5QA 4UF0B 1GWLA 3PUIA 3WP6A 1RUF1 3VBRA 2PHFA 5HXVA 1O59A 5FY8A 2BQPA 4UW3A 1WCSA 2ZMKA 5A3WA 1BBT2 4AEDA 1BKZA 1X9PA 3SMHA 1QOOA 1R091 1S2EA 1CD3G 2DCYA 3SHRA 5L7OB 3HPNA 1KEXA 2E33A 2NN8A 1AR92 1HRV2 3GHMA 3WSOA 3WY6A 1QJX2 2NYYA 4PLMA 4W6WA 5FUNA 1QJX3 1SCSA 5I0DA 1GOHA 1AYM2 1ND2B 5FTTC 5CBLA 5F3CA 2QQKA 2B9UA 2VD7A 2FDFA 5FP8A 3ZFFA 5D1IA 3KVBA 1PK6A 5CAZA 1UF2C 4P5YA 3GNEA 3SKJE 4Y33A 4OI1A 5JZGA 1X8MA 2SBAA 1IKQA 3GBWA 4HSLA 5FYVA 2ARCA 2RS52 4QM8A 5JR7B 1MQTB 4MHRA 3INAA 4C0BA 4N7UA 2DTYA 1D4M2 3V0AB 5LEKA 2V4VA 2XVLA 1D4M3 4PJYA 1NQDA 2PQSA 3AX4A 3WG1A 2P3JA 5IWFA 3T0AA 3WP3A 1DGLA 3ZFEA 2ZZQA 5DQ0A 4EWDA 1OA4A 5CFDB 3SH4A 3U11A 1QOTA 3BIEA 2RDRA 3H8OA 2YC0A 3AMNA 5L36A 4B1LA 1I5ZA 1STMA 3BTYA 1RUOA 5F6KA 2QTWB 2QQLA 3TOJA 3M2MA 5FV3A 1NCRC 2Y6HA 3ZPOA 2P37A 3NAPA 3SLIA 4XHXA 3KGLA 4Q4V1 1VPHA 2OKXA 1U5YA 4FOYA 4XOGA 2JG9C 2DWRA 2VZRA 4LIVA 4XF1A 3FX3A 1ENXA 1HV1A 2W0XA 2E7QA 3DPRA 2QZ3A 5FMOS 1GQPA 4IW3A 1Z0HA 1MS8A 1Z7S2 4XE9A 3NV1A 2BUKA 2PTMA 2VM9A 5DZFA 1Q8VA 4IETA 3I54A 5EP9A 3RZKA 3ACIA 4GJYA 3FLTA 1W6QB 3HT2A 3WNXA 4N8MA 4E4SA 5K7PA 4CPBA 4L92A 2FZ1A 4XJWA 1A78A 4XQDA 4CA9A 1XB9A 3WR0A 5DXDA 2AEZA 1NT0A 2H6BA 2GALA 4MXVA 4XFFA 5DUUA 5SV8A 4AQ2A 4QX7A 1HB2A 1ZRDA 2C9KA 3VD3A 5I8YA 3I59A 2OYZA 3E6BA 2AUYA 5HCBA 5F3GA 5IATA 2FBEA 3E6CC 1HQLA 1FT9A 5FZ7A 2VC9A 3N9PA 2ERFA 1TNRA 2HWF2 1JYVA 2R071 2HWF3 2VTFA 2RR13 5LWBA 3PIGA 1BMV1 3K3OA 4MO3M 1SPPB 3GCXA 2ZPXA 3N9QA 5C3OA 3E5UA 3HNYM 4QPGC 1W90A 4XMIA 3SH3A 2FD8A 3N3HA 1FAYA 1GQHA 4QXBA 4I3PA 4LTAA 3WVJA 1UPSA 1IS5A 4J1XA 3VL9A 5LY1A 3GBGA 2BYVE 1GNHA 1VBD2 1YRZA 4RS5A 4UXAA 3SEPA 4Q4Y2 1VBD3 2YUEA 3ZSJA 4N90A 4Q4Y3 4Y1UA 2B46X 3OSDA 3TEYA 3RYRA 4OULA 1HN1A 2ENRA 4BWOA 2FDKA 5F2WA 1ULDA 3I2DA 1ZBE1 1S0IA 1FV3A 4FXKB 4ARYA 4BU2A 3USUB 4ATEA 4ZHNA 4NE9A 4UW4A 3AMPA 2XOMA 4W6XA 3AZYA 1KS4A 2JDMA 3BPSA 1W28A 4MVTA 1ASJ1 2VMCA 3SCFA 3SEEA 1WW4A 2BOJA 2VBPA 5JPNB 2CY6A 2A75A 4L11A 3LE0A 4MGQA 1VRH2 1NA1A 4NPMA 3VBHA 3VDCA 5IVVA 1QQP1 3PU8A 4CUCA 5FZBA 1WBLA 3JBG1 3NL1A 4LUMA 4A42A 2C5DA 1XNDA 1WD3A 2HKXA 4Q8KA 4OQ8A 1WCKA 1H1IA 5F37A 4JTOA 4DPNA 1WA6X 1H2KA 3K2OA 4MV2A 1AJKA 1UZVA 5A3PA 4HBNA 1WZXA 5K0UC 1IZ3A 2GU9A 1US3A 3AYDA 1W9TA 1R1ZA 2W08A 4IV3A 4NAOA 1XE7A 2PYTA 1GP4A 2WZ8A 4A7YA 1OA2A 2VG9A 5FMCA 4AEJA 3KD4A 2GDFA 5FMDA 1GZTA 4ZKTB 2JB4A 4YVWB 2OIIA 5A6ZA 2DCZA 3VBOC 4I0WB 1AR82 3OGVA 5D8AC 1SFPA 1CPNA 3KQRA 1CAUB 4E2SA 5FZ8A 1RMU2 4XAEA 4DRRA 3DL3A 1MZFA 5J1XA 4GH4C 2HBUA 2RVAA 4NIAA 2OS2A 3QOPA 4MZUA 1QOSA 2RM21 3Q9OA 4IE0A 2WNUC 1AR63 1F31A 3RYKA 2Y26A 1LOGA 5GM0A 4OVEA 2NMNA 2WIIB 2ZJCA 5T5PA 1POV3 1UOBA 1C5IA 2ZZJA 4CDQC 2D7FA 4N43C 4QWNA 1EUTA 1S0BA 5A6QA 1UCXA 4EZ4A 4B4PA 1NYWA 1WW6A 1LULA 1OD3A 3RYPA 1V6MA 3VDAA 1BCXA 2XR4A 4CU9A 3N7MA 5KXDA 5JSPA 4EROA 2BZDA 4Q0UA 1YI7A 4Q5OA 1UIJA 3LSDA 4AFDA 4DIQA 4LBKA 4OUMA 2RDSA 4KG8A 5BNOC 5FO9B 4BISA 3AL5A 4MG2A 5EFUA 3H1YA 3ZXJA 4V1PA 4HSJA 2BGOA 1GKBA 5J48A 1QEXA 1UMHA 2IFRA 2E9QA 4NMIA 3D4KA 2WFF2 2YZ4A 1KFXL 1VAMA 3VBFC 3B94A 4AFBA 1H4GA 1DHKB 3URFA 1OLMA 1VBB3 3N7LA 4DQAA 3HEIA 1HKDA 1QDCA 2R32A 4MGSA 2GNBA 3U10A 2VNGA 3VBUA 1K5MC 1TMF2 3WZ1A 3THTA 5LK7B 1CAUA 1TMF3 1FPN2 1L7QA 2R042 5C4WC 1FPN3 2R043 1UD1A 1BK0A 1DZTA 1XNAA 3ILRA 4IERA 4QPWA 3RI9A 3SC7X 2B5HA 2JD9A 3J7HA 4AI1A 1EAH1 1LKNA 4K8RB 5FBJA 1HV0A 2VCBA 4IV1A 3KMHA 4LBMA 4UBHA 4EV0A 4XZPA 4RD7A 3FJSA 4P9JA 4XF4A 4WZCA 5G05L 3ILNA 2VOWA 3HNMA 1F5FA 4Y1XA 5FDBA 4FI9A 3WF3A 5KXCA 1DFQA 2KM2A 3RS6A 2P3YA 4AQTA 4CP1A 4JDNA 1QNWA 4MOAA 1GP6A 4JHTA 2ZTNA 1RUC1 1WLWA 1OHFA 2K9ZA 2JE7A 1DGRA 3KF3A 1GFF2 1CIYA 4WM8C 5DDJ1 1D7PM 1VALA 3CJXA 1FYUA 3J8F2 1OF4A 2WR9A 1FOD1 2EVXA 3DXUA 1MVQA 1W04A 2XH6A 4B1MA 3RRDA 5AC92 5L7OC 2BEOA 4PT6A 5AC93 3CNAA 4CDUB 3GM8A 2EXKA 3E6DA 1NY72 3OGJA 3V56A 3AKSA 1LHVA 1LHNA 1RB8G 2BW8A 3JCIA 2VCMA 3FL7A 1ND2C 4ZU5A 4YZ3A 1BBT1 3OBZA 4R4ZA 3WF0A 1E57A 4EN6B 3T0DA 1VBE3 4NHLA 4S2HA 2UURA 1AR91 1HRV1 2TEPA 2JB8A 3HOBA 5DZEA 1JOJA 4LA2A 5DAWA 5K9YA 2HBTA 4KBBA 4CCDA 1AYM1 1S0CA 4AGGA 4FPKA 3FHIB 1OLME 2ARXA 4H14A 1YYNA 4PQ9A 2Y6LA 1AL22 1LECA 4XJ9A 1MQTC 3A0NA 2PA7A 2OPKA 3GYDA 4P9WA 2VU9A 3HQXA 1OI6A 1BEV2 1Y3TA 1OUSA 2YXSA 2QDNA 3V0BB 4IEZA 3B9IA 3RGBA 2VZVA 3J7MA 2RMU1 2PHTA 3P3PA 2Y8KA 2TBVA 5FY4A 5DAQA 3Q8AA 2XLGA 1C57A 2DUPA 2RS51 4MXWA 3K3NA 1W8FA 5FZHA 5I0SA 1VBA2 2FDHA 3BOWA 1MS0A 3J7LA 2ZX4A 3UGFA 2VOKA 1WMXA 1WMEA 4RQPA 2Z79A 2D6PA 2Y34A 1BQPA 1LHOA 1X82A 1LOFC 5GLTA 5LBEA 4GAZA 3ES4A 4X8NA 1YNAA 1V6JA 3WW2A 1KRIA 2VMDA 2Q1MA 2H0VA 3POSA 4CDUA 1H1AA 4JQRA 3B00A 2VW1A 1WCQA 3WNMA 1RC6A 2P1BA 3S7EA 3W5NA 4BIFA 3JQWA 3NV3A 4YW1A 2WKKA 2E31A 1DLLA 5E1RA 3DKWA 1IPKA 5A80A 4CU8A 4FXGB 5K4LA 1W2UA 2OZ6A 1CONA 1P8JA 2AH2A 5CFCA 1HB4A 1Z7S1 2DUQA 4NHKA 2WAOA 1Z78A 3ALQA 1PO13 1NG0A 2XHKA 1AX1A 2XDVA 5LRSA 3WNPA 2YPJA 5IJRA 1AZDA 5IVFA 4L97A 2VBBA 1IG0A 1LU2A 2VGDA 1ZYBA 3NKGA 4XMAA 3FHQA 1W6PB 1X9TA 3D8CA 4IEVA 2WSVA 4Z82A 3M3QA 5A7SA 1J3QA 1JZ8A 1DYKA 2P17A 5C9AC 1L3JA 1RUF3 1UX6A 4J1WA 5IVEA 1JMUB 1TNFA 1R082 1UZYA 1UAIA 2ZABA 1C5HA 3E5QA 4UW6A 1R092 2XL9A 4CEWB 3VD7A 1R093 1D2SA 4A7KA 3ZYFA 3VZJA 4N53A 2JKBA 3WG4A 1KFUL 2W87A 2AC1A 2Y6JA 1XSRA 3NMBA 1LGNA 2WNVC 5DUWA 5ACA2 1SDWA 5ACA3 3NV2A 2K0GA 4Q29A 4LULA 4FT8A 1YLLA 3CQOA 4Q4Y1 1SZBA 1HX6A 3D6EA 4DFSA 3NW4A 2PN5A 3AC0A 3MICA 3ZOIA 2XWBB 4EQVA 1PVC2 2CTVA 1SFNA 3BTXA 1RUI2 2Y6KA 4YWAA 3H1MA 4CCKA 4AI9A 5LB6A 2AEYA 3N9MA 3ASIA 1S0EA 2D6MA 2VULA 5T52A 2F6BA 4EN7B 1Y4WA 4G3YC 2J1VA 2DCKA 3DKQA 2UWBA 1VRH1 4LE3A 3J9SA 1J1TA 3L9JT 3RDIA 1QMJA 2VVEA 2ZX1A 3IIIA 4H55A 4K7JA 4RGGA 4QAWA 2A70A 5LBCA 2WLQA 5KWRA 5ABJA 2B8MA 3VDDB 1WCUA 4IGQA 2ZAAA 1RUG2 2XONA 4GWJA 1RUG3 3I4IA 2YC2A 2ZGRA 3R0RA 3ZYPA 3O1RA 1PNFA 1RUJ1 3M3EA 1MS4A 3GZUC 2GN3A 1BHGA 4LHNA 4BYYA 2XLFA 1GWKA 2EICA 3GZEA 2H0BA 4FVVA 4IEWA 4WM7A 3AJZA 3EYPA 1DF0A 4BJ0A 1AR81 1RJ8A 1EPWA 2X09A 1O3RA 4BH9A 2JD4A 3AP7A 2JDNA 3PUAA 1RMU1 3APBA 1H2MA 4QQHA 4D7SA 3Q8BA 3O0XA 3GJBA 1U5ZA 3AM2A 1GOFA 3M3OA 1JZ5A 3VHRA 2B7YA 3MFCA 4JKKA 3TNQA 1LENA 2A6VA 1U5XA 3NSTA 3ACFA 3LIGA 1XQNA 1IQAA 4MGTA 3SNMA 2EALA 2UU8A 3ZN4A 2HWB2 3P1IA 4DXZA 2WQ4A 4PI0A 1DZQA 2WT2A 5DABA 3H3UA 4URTA 1YQ8A 1VB4A 2R072 3PVEA 2ZKNA 3I97A 4FO9A 2ZHMA 2R073 4IEUA 5DG1A 4R9AA 4RR3B 5FZ9A 4EZHA 1J1LA 4R9CA 5C8WA 3MIHA 2A6ZA 1LNSA 2BVBA 5FMBA 3GZTB 1X36A 2X5IC 4XQ4A 2JDAA 4LBNA 1GICA 3SQOA 3NNLA 4PF5A 4BLJA 5AFBA 3V64A 3H8XA 2YDEA 3CMGA 4JZRA 4YG6A 3AMMA 4G9SB 3HAGA 3OEBA 5KHIA 1KQRA 3NNFA 3PDQA 4Y1VA 1UKRA 2HYKA 3T1MA 2WFF1 5FPBA 4CXXA 1YQ2A 4E2GA 4GWMA 2A6XA 2VBDA 4H2AA 3TNPB 4RSUA 1ZBE3 1G9DA 3U78A 4O9EA 1ULOA 1SBFA 4TN7A 5FK7A 2E6VA 3WEZA 1GBGA 1PNGA 5FYCA 1ASJ2 4XUNA 1W8UA 1ASJ3 1TMF1 1H2LA 1GV9A 1FPN1 2JX9A 4AVVA 2R041 1UY1A 4LKSA 3U37A 3FFQA 1QQP3 5IVYA 1OPMA 1YCIA 4P9LA 1HLCA 3NJYA 4BZ4A 2BNMA 1HJFA 3JBG3 4QU2A 1PMHX 4HLTA 1I9RA 5CU1A 2DFBA 4XVHA 5EJ3A 4QQPA 2WQZC 4OLLA 4TLFA 1GSLA 3JB4C 2A5ZA 4Y5Z0 1NCRA 4AHYA 3ZXDA 4FAGA 3I3EA 3ELNA 2ARBA 4QPIB 4EN0A 4JDOA 1AUYA 3EQEA 4KWLA 2I74A 1DIWA 1HQNA 1YUDA 4HN1A 4ISRA 2JJ6A 3J8F1 5C3RA 4BMEA 2HWE2 2W94A 1MS3A 2HWE3 2HLEA 2CAVA 3ROUA 1MPXA 1OLQA 2EA7A 4CEYB 2JG8C 5AC91 1N1YA 1NLSA 3CL1A 5I0UA 3RG0A 2EXHA 5IYYA 1LU1A 2RM22 5BY5A 4LLFA 2RM23 3SCGA 1NY71 2J1AA 5FZLA 2VUAA 4SLIA 1ZZBA 3JD71 4LNVA 2ZEYA 4D8MA 4LXLA 3HR9A 3U0ZA 3M70A 5IK5A 2VNVA 2B42B 1SCRA 3M1HA 2VR4A 4OFGA 4HPKA 5JOZA 1GYKA 2LALA 2XGXA 4ITCA 4UOJA 2IXIA 1W9FA 3HN3A 4KWJA 4CDWC 1H8VA 4OCTA 1UKGA 4HONA 3KHCA 3AXDA 1AL21 3BALA 5T5JA 5J98B 2O8OA 2ZCWA 2FZ2A 4BQXA 3JUUA 1CAXA 1DCSA 1BEV1 1QU0A 1QH6A 3D3AA 2EIGA 4L2NA 4QX1A 3AYEA 4QKFA 4Y1YA 5FAXA 1D2QA 5EZWA 3CKHA 1ODMA 2F4LA 4HL0A 4WVMA 4XETA 4HFSA 3WDTA 1ZREA 3I3DA 4AXOA 3ACLA 4YPJA 5JMOA 5A3NA 4CP9A 1VBA1 3OEAA 2Q30A 3VBRB 4NWVA 4ZU7A 3ILFA 3D0JA 4BM8A 2GC3A 1TQ5A 1W9YA 2JDZA 2XJTA 1FV2A 2VW0A 1QNYA 5FZOA 2YG0A 3M3CA 3IB3A 1O3TA 2Y0OA 4PHZA 2R7EB 3OB8A 1OQDA 3QLQA 3BKZA 2WNEA 1GWMA 4FPGA 1UU5A 4P9XA 4PIYA 4CEYA 3RZJA 5FZ0A 1GNZA 5IK4A 4CCMA 1HW5A 2P4EA 3EO6A 4IE5A 5FK8A 3A23A 5IK7A 2A3XA 4CRQA 1EAH3 1QDOA 2XMLA 3ZFFB 1VRBA 2I45A 1S1AA 1PK6B 1HN0A 2ZGNA 3UJOA 2NM1A 3DECA 1SMVA 1XBFA 3DUIA 1CAWA 3RZLA 1OF3A 3OGGA 1HB3A 5C5TA 2BJSA 1XE8A 1DGWA 3POGA 1AX0A 1JOBA 3EXUA 2J1EA 3VN4A 3H3ZA 1GANA 4V2WA 1BJQA 2YBPA 2ZGKA 1LOBA 3CU7A 1V9U2 1KD7A 4LHLA 4KQ7A 1QIQA 4JTNA 2RDQA 3SKVA 4XF0A 5FY1A 3ZFEB 1Q5OA 3E1F1 3VBOA 5EJZB 1RHI2 1FOD3 5H9PA 5D8AA 2J1SA 3VHNA 5FY9A 2XVKA 1PHMA 3K4ZA 2VCAA 1VMHA 4GH4A 4QXHA 4L99A 4KWUA 4XCAA 3AMHA 3BYWA 2VUDA 3U4SA 3T0BA 3WUCA 2WO3A 4NHYA 5FP3A 4CP2A 2WNUA 4Q8LA 1R081 1TEIA 4XBQA 5I0RA 5B4NA 3K4AA 1O4ZA 2R16A 3MIDA 1AVBA 1QGLA 2R061 1BBT3 3LB9A 3NAPB 3OD4A 4J25A 5FXZA 2ZACA 5F3IA 4GKXA 5FOJB 2BFUL 4CDQA 1AR93 1HRV3 4QMAA 5FPAA 5KHKA 1O4TA 3DPRB 5KBFA 1RL3A 3AP9A 1AYM3 4RHV2 5ACA1 4RHV3 1W6MA 2V73A 5FYBA 1YIPA 2WFPA 4ET7A 1ONAA 3VBSA 1C4RA 3LGRA 4FTBA 1RUD2 4XFCA 2XJSA 1H8TC 4RL7A 5BNOA 5DZGA 2RMU2 4XFGA 1CAVA 2AR6A 2RMU3 4UWDA 1JOPA 1PVC1 3JZVA 4Q4X2 4QGMA 1RUI1 2UY8A 4CDXC 2O14A 2ZHNA 4JAAA 2WO7A 4W50A 4DINB 1OOPC 2RS53 3GZAA 1CJPA 3I59B 4O9GA 3RQ0A 3MIGA 4WVWA 1JXNA 4HKLA 3N35A 4QDQA 3VBFA 2VMEA 1YFXA 4D7TA 1MR5A 4OI4A 3FLRA 3D0SA 5A3MA 4AGVA 4BQ5A 4DXRA 5FXVA 1I3HA 4GA9A 4LJHA 3S6PA 3T2PA 1Q8QA 4AK3A 1W9WA 1K5MA 2VOVA 1IS6A 3OG2A 3K77A 2ILMA 2WAAA 4NRPA 5C4WA 3FLPA 3ZR6A 1X33A 4BCUA 4JGZA 1NCQC 3LWCA 4BQYA 2BP6A 1RUG1 2LTNA 4ISQA 2TUNA 4QQOA 4RS5B 4ZXEA 2J1UA 4QB1A 1XRUA 4XBLA 4YM2A 2O1QA 1VMJA 3GCWA 3IWZA 4XCBA 3PJQA 4PDWA 1QHDA 5F2SA 1B35A 3IMMA 4YRDA 1W39A 2W39A 4QT6A 2WO2A 3LZZA 3PURA 5F32A 3T2OA 3ZIXA 1Z7S3 4E4HA 2BPA2 4LA3A 4WM8A 5FYSA 1LEDA 4LMFA 4A3XA 1AJOA 2R30A 1LESA 1NA1B 3HN1A 2ZMNA 3PUSA 4LHSA 3RVHA 3VBHB 5C3QA 1JYXA 5EYXA 4FTSA 4BXSV 1VAVA 2VAUA 2WSUA 2WYFA 4BB3A 4UT5A 3TAYA 2EIBA 1E5IA 1W8NA 4GWNA 4HKWA 3PJYA 4XZUG 3ZM8A 1O3QA 4CXYA 1IG3A 1VJ2A 3BIWE 2HWB1 5F5IA 5K8SA 2OQ6A 5IK8A 3NNGA 3K4DA 4IV3B 1VB2A 4C0HA 1OH4A 4GJZA 3KQ4B 1X7NA 3CJIC 3VD4A 1JU4A 1PGSA 2QZ2A 3B7MA 1W9SA 4MX3A 5FREA 2P2KA 1LGBA 4LBJA 2JDUA 3AFGA 4CUGA 4IQPA 3IDBB 2ADDA 3QACA 3PTYA 3QH6A 3S7IA 4CE8A 1W0PA 3H42B 2PHDA 1PX4A 2FCVA 3RSJA 1TE1B 4QX0A 3WG3A 4RN5A 4P08A 5A70A 3M3IA 2R6QA 5JMCA 4AEKA 4ORFA 4LO7A 3K75B 4BHPA 3KWVA 1VAKA 2CWMA 3WF4A 4E4ZA 3DEMA 4Q26A 5F39A 4E8DA 2WO1A 5C6CA 3PMSA 1JU3A 4TZDA 5B2GB 4B7EA 4GIQA 2QQMA 5FMOL 2W91A 1ULCA 4UFHA 5ANNA 4BQ3A 1VRH3 2FMYA 4IGPA 5FYYA 4CTEA 2ZXQA 1LOFA 4W6YA 3WQ1A 1ZRFA 1VLNA 1YQ5A 3T2QA 1SEFA 4LKEA 3R4DB 1COV2 2YU1A 2DFCA 1COV3 3OGRA 1M4WA 2CL2A 4EN9B 3ZR5A 4AG4A 2ZHKA 1S4CA 2D6KA 2EXIA 4QQ2A 4NIDA 3GJAA 3JB8A 4LR4A 1RUJ2 5LW9A 3ACGA 1RUJ3 4JQTA 2VZ3A 3O14A 5HCFA 5GZGA 5HCHA 1GMMA 1SBDA 3HMYA 2A73B 3IAQA 3KS7A 3PUQA 3MV01 3C3VA 1NAEA 3PTRB 2UY9A 1JYCA 1XNTA 5F8PA 4EWEA 2AYHA 4QD2A 4AF9A 1PMJX 1JHNA 2HWE1 1N47A 3LAGA 2JDHA 2X10A 2I2SA 3MYXA 2WLPA 2AREA 3VBUB 1AR83 1NE4A 3ATGA 2VQUA 4EN8B 3H3LA 5EIYB 4FBFA 3IPVA 3WF2A 1RMU3 2CGOA 3KSCA 1Y9MA 2P3IA 4JKMA 5CKQA 4BE3A 5FXXA 4ASKA 1FNYA 4XYXA 1WLTA 1Q3EA 4I30A 3BOPA 4IV1B 4OHVA 4Q1PA 1LR5A 3CF6E 5FQ0B 1IOAA 2VZTA 1US2A 4COVA 2XL7A 1JZ6A 2HYXA 5DUVA 5C9AA 3WQ0A 5IT6A 4IDZA 3LA2A 1F4HA 4MGIE 2VZOA 3I8TA 1K42A 3UETA 4OI2A 5A7WA 1A8DA 2VOTA 3T30A 1F35A 1OH3A 4L0PA 1GU3A 2ZGOA 2Z42A 1J83A 1YFYA 2QQWA 1HRI2 2VE1A 3VBRC 5J7MA 2WNVA 3ZMNA 2B39A 4E8CA 4CUAA 1OFSA 3B5LB 1JS9A 3LEGA 3VB9A 5LZ6A 4TSVA 2V72A 1EPZA 1ULFA 1IS3A 3CZUA 3N36A 4NHMA 4PBOA 2Z5WA 4MHUA 3RPQA 4AEDC 3VDBA 2GNDA 2GNMA 3MGUA 2WFF3 4NRQA 1Q8SA 4ASMB 1CZTA 1RUE2 4XDOA 1U5IA 3MBWA 4FPFA 4X8PA 5GZCA 4K3UA 3DV8A 3AKTA 3EBRA 3ZYHA 1CQ9A 3POJA 5IVBA 3WDVA 4U36A 2X05A 2UWAA 1ZNPA 4IL7A 4QGNA 4YW7A 5BNPC 1PK6C 1BVP1 3P3NA 1UYYA 1NE6A 1UXZA 4ATFA 1ND3C 1RUH2 4F8AA 5JZGC 3AK0A 3M7AA 1NXD1 2CU5A 4TWTA 2NMOA 4P5HA 5CYYA 2PHLA 2YU2A 4AAXA 2IFWA 3MIFA 4C1XA 3ZXEA 1CESA 2YB7A 3W5MA 3DF0A 5FJHA 3J7NA 3MW2A 4YLZA 4YVSA 5FQ0A 5C8CA 4PBPA 2OW4A 2Q8OA 1G9CA 5T55A 4TTGA 1Q56A 5J37A 2Y64A 1PGL2 3O5SA 4HKOA 5HI0A 4RA0A 5BUVA 4MXWB 1W6NA 4LO8A 1ENSA 4LT5A 5JPMB 1SBEA 5APAA 1H4HA 3HNBM 4LKDA 4NROA 4BIOA 1V9U1 5I93A 3AZWA 1S0FA 1GZWA 4RQPB 2YBKA 2FDJA 5AVPA 4GB32 5LATA 4AVTA 3J8F3 3WDUA 4GB33 5BNNB 1RHI1 1ZVFA 2EAAA 1ULPA 1MEC2 3NWKA 4XPVA 2PAKA 3ZFGA 1MEC3 1W8ZA 1OBNA 3QH7A 4K40A 2BNOA 4A6SA 1FATA 3MV11 1QJY1 4LORA 3VZMA 3UV9A 2R1DA 5JXGA 3MZHA 3PNAA 1TVGA 5FIXA 2ZA9A 3DPRC 4LK7A 3JD72 2J7MA 3MLJA 3JD73 4U2AA 2HWC2 5A1LA 2HWC3 1G9FA 3MUY1 3POYA 4I3GA 5LASA 3UKTA 4XURA 1XYNA 3WG2A 1SG3A 1W05A 2A7AA 1RYYA 1W8WA 4KGGA 1Y43B 4OMCA 2R49A 4LITA 5H9RA 5CFCB 3UT0A 2C6SA 4CCNA 3WINE 2UYBA 4RHV1 5JIUA 1EP0A 1PO22 5IVJA 4A7ZA 1DYOA 1AL23 1JBCA 2QQNA 1OKQA 2NZ9A 3ZX7A 1RVF2 1RUD1 1J3RA 3MDPA 3POIA 3PVBB 1RVF3 2X5IA 3UGGA 1BEV3 1C8NA 1FI2A 3VHPA 3H8UA 2XHNA 2WZR2 5J36A 1APNA 2YC4A 3DYMA 4S2FA 5IUQA 3T08A 2IWGB 4Q4X1 2ORXA 2QBXA 1T2XA 3X29B 1YIFA 2WS91 5JOYA 4D94A 1N3PA 5FJKA 3AKQA 2GSYA 3G7DA 1AX2A 3VKFC 4Z1VA 1VBA3 4NPRA 4B4QA 4N9HA 5CFDC 2YHJA 2IXCA 3QBQA 4H7LA 2JKXA 3T4HB 2X8KA 3WNKA 4A44A 4D6SA 1ALYA 2D6OX 2YBSA 4NWWA 4YW4A 2RJLA 3U4XA 4LPLA 5BNNA 4RS5C 1SACA 1RIRA 3I2KA 4N53B 1CN1A 3CDZB 4K1ZA 2C4XA 1UNBA 2QQVA 3BU0A 1O7FA 1HB1A 2L9LA 5L73A 5CA6A 2MNGA 2XXZA 1AL0G 2PLV2 1U0AA 2PXJA 2VTXJ 3ZMOA 4YZ2A 1UO9A 2BWCA 3TBDA 2QFEA 3I2OA 3VZNA 4XXAA 4Y4YA 2OPWA 2BNNA 1D0GA 2Y0IA 5HPOA 2JENA 4FPYA 4Y4RA 4JV4A 1JUIA 3ITQA 4GMP1 1NA1C 5FZ1A 3VBHC 3W59A 1O5UA 3LEKA 4LEJA 1S2BA 3AJYA 3UYJA 4CUBA 3IIAA 5L9BA 2GP3A 2QJVA 3OUJA 4RYDA 4LBOA 1WMFA 2BGPA 5FZ3A 3AVRA 4ES8A 4YZ4A 1QJEA 2OX0A 4YZ1A 4EYUA 3O1MA 5FZFA 1R1A1 2RJKA 4A4AA 4UFJA 2W2IA 4A45A 2K2SA 2JG8A 1OUXA 2GMEA 1T6GC 3GALA 3ZYGA 5ABJB 4UFLA 4Y26A 5LA9A 5HV4A 3I3BA 2VNOA 3PL0A 4MH0E 4OZOA 4XW3A 2KA3A 3MF6A 2YGMA 3FMGA 1R083 2R062 1LEMA 1LCLA 2R063 5FPUA 5A32A 3UGHA 5JIAA 2Q8DA 4XABA 5DPNA 4AW7A 4V2VA 1GR3A 1DQ1A 1PZ9A 1SFYA 4WM7B 4XJ8A 2VXJA 4UI9L 4AOCA 2VZPA 1FMD2 1AYN1 5KC5A 3K46A 3WCRA 4CDWA 1OC1A 2Y6FA 3KV9A 1UZZA 3P6BA 3HQRA 3R4UA 4AAPA 3POEA 1UYXA 2BBVA 1K3IA 1H0BA 4L9BA 2WT0A 5FXWA 3J4UH 3BTZA 4QXKA 3LOBA 4JGYA 4FFFA 2ATFA 4KNCA 4RGKA 1PVC3 1NKGA 5JVVA 1RUI3 4DB5A 5J3UA 1DQ4A 1XOYA 1YO8A 4KH9A 1DG6A 5H9QA 2PHUA 4M3CA 3MPPG 1V00A 1DZRA 2RV9A 3DN7A 3NNJA 4XUOA 2BERA 1V6NA 3M4FA 5EPAA 1V6KA 3GXUA 1JYNA 4I2OA 5EJ1B 4J6GA 3UESA 1BK1A 1ZZ8A 1K5JA 3VZOA 3KT4A 4XJAA 3B01A 1VIWB 3WUDA 4RFRB 2CDPA 4AYUA 4DXTA 3GGLA 4FPEA 2NPIA 1EV12 1COV1 1X8EA 1Q43A 2I07B 4E9KA 5C71A 4AFMA 2R0FA 4YVWC 2CGPA 2NQYA 4QKDA 1UY4A 4DZGA 3SCHA 4RGAA 1K45A 4UBGA 3THDA 2DVDA 2RS32 3IBMA 1OMIA 3HD8B 3H50A 2RS33 5H9SA 3WW1A 4A3ZA 3H0OA 4UW5A 1NOVA 2WWJA 5GKAC 2XUEA 3B3QE 4ZPIA 5B4XA 4AL9A 4JRAA 2GMPA 4OQ9A 5FPZA 4H7MA 5FYMA 4KBZA 1FNZA 2W9XA 1CZSA 2XBO2 4PQQA 2YPDA 5JR2A 2DVFA 2ETEA 4BPZA 3DYPA 3AP4A 4CCOA 4YW6A 2XJPA 1O5LA 3WNOA 4XEZA 1QKQA 4CYDA 2VY0A 4WBBA 2YROA 1F9KA 2Q1FA 2XJRA 3ZYBA 1UOFA 1E5RA 5I91A 4INDA 4BXFA 3HQUA 1MS5A 3I2HA 1W0OA 5A6XA 5FYUA 4BQ2A 4B4RA 2HWB3 2QQIA 5A33B 3VV1A 2DURA 2W1UA 1NCRB 4LUKA 1UIKA 1UZWA 4JVAA 4AGRA 2ZGSA 4DXSA 1VBC2 1PZ7A 1NLRA 1C8M2 1X50A 2F4PA 1VBC3 3EHKA 3LPFA 4FFGA 4DY5A 2EIDA 3I49A 2JG9B 3N9OA 4QKBA 1PX3A 3ZIWA 1I5PA 3O12A 2RS12 4M3CE 1HXS2 2RS13 4ZONA 1F15A 1VR3A 1CIWA 1F5JA 1HRI1 3O1UA 3IT8A 1YXWA 3SITA 2W5FA 3KGZA 3OD0A 3NQHA 3PVNA 4E4DX 3IN9A 1XC6A 5A3OA 1JYIA 5FZKA 3BU7A 3AP6A 3OY8A 4XXPA 4DOUA 4CU7A 3VLBB 1H8TA 3A0KA 3FUQA 2IC1A 3JU9A 2WQ8A 3AYCA 1RUE1 2J42A 5E16A 2WL1A 1N3OA 4CDXA 2GN7A 2VZUA 4Q0VA 1WCDJ 4LBQD 1OOPA 3OCPA 2MHFA 3OPZA 4P00B 3UK9A 4JX0A 3W21A 1HJGA 2BVVA 4XFBA 2DVBA 3ZYJB 3EMRA 4FFIA 4HPKB 2E7AA 2RJ2A 5CNAA 1UY0A 2AZ5A 4K1YA 1RUH1 4QGLA 2J1RA 3ZXGA 4FOQA 4YGCA 1IPSA 2OUJA 4I0AA 1KXGA 4Q27A 5GZDA 4AHZA 4COUA 2VTXA 2OZJA 5HXMA 1CX1A 4LHKA 2EAKA 1CAXB 1RTVA 3MF9A 5FBZA 2CDOA 3KZ4C 4DMIA 3MIEA 1NCQA 2LROA 4GKYA 5ISLA 3B93A 4WVMB 3IAPA 2PHRA 2D3RA 5FR3A 1PGL1 1SLTA 4D6RA 1CX4A 1DGRN 1FXZA 2P6HA 5FZEA 5A33A 3W58A 3B69A 4JRLA 4CP9B 1DYPA 2A6WA 2B4KA 4QHBA 3OPTA 3U07A 3H7JA 2WNOA 5A7PA 3ZYRA 2JG9A 4Z07A 2AGSA 1B09A 4IESA 3KF5A 5C33A 3RWKX 5FZOB 2G9GA 4QB2A 4GB31 4CDUC 4LIUA 4YG3A 1WW5A 2Y60A 3ZPYA 2D97A 2KD7A 3KHBA 3AZVA 3B9CA 1BZWA 1MEC1 3OUIA 5G04L 2C24A 4Y20A 3WLUA 3ZKYA 1CJDA 2W68A 3PVOA 2PHWA 3ME2A 4E2QA 1TME2 2JDKA 4XFIA 3PMEA 4EWAA 1V6LA 3NKTA 1YFWA 1E5SA 4XIKA 3LD8A 4HG6B 4BQ1A 5FWJA 5A7NA 5FZDA 3KV5A 2ARAA 3CIHA 1CAWB 2HWC1 3MUZ1 1ZRCA 3AP5A 4Q0SA 1OD5A 1WKYA 1UXXX 3O1VA 2Q8CA 1XSQA 2WJSA 3VGIA 5FKBA 3NNMA 1TZOA 3ETQA 1V6OA 4K8FA 3POBA 1J3PA 1PO21 4HT1T 3SH5A 4QPGA 2OT7A 5CG8A 4COYA 1RVF1 3VBOB 2D5HA 5A7QA 5L9VA 2G9FA 2LRPA 3LA7A 2WZR1 4YFWA 3LIHA 2VMGA 5D8AB 5FZMA 4OI0A 2YFZA 2HEWF 4HOOA 3HWJA 4GH4B 4Y22A 4PI2A 3R4SA 4KGQA 5E89A 5FO8B 4CXWA 3VUOA 1KJLA 1QY4A 5FZCA 4AI2A 4XHBA 1JTZX 4BA6A 4HVQA 1F2NA 2WNUB 4DRVA 2CGNA 1JI6A 3PLQA 2TNFA 4Q0QA 3ZSMA 3T09A 3WHTA 3S5QA 4KG0A 3ZXFA 5CG9A 2FDIA 4BLIA 2P5BA 2ORZA 4F83A 3MEPA 4CDQB 1UMIA 3D82A 4AVAA 3JQXA 3KV6A 4Q1RA 2MEV2 2D40A 2YV8A 4D3WA 1I1EA 3KCCA 1XYOA 1REFA 1W6MB 4XDPA 4NIIA 1LAJA 2PLV1 2Q1ZB 3VBSB 1OLRA 2PAMA 4L8QA 4WVZA 3VD5A 1H2NA 1NLQA 3C7FA 2QKDA 1SLCA 4DY3A 1CAVB 5BNOB 1JZ3A 5D2AA 5K0UA 1OVPA 4MGYE 3BODA 3C7HA 2FMDA 1CGPA 4COWA 3O0WA 3VBFB 2CAUA 1V9U3 2W95A 1PMIA 4MYEA 4Q4W1 5ABJC 5C7GA 1W2NA 4YZ5A 2QNKA 4FOWA 2CNAA 5IAVA 5EYYA 1PVXA 1KJRA 3CZJA 3LCPA 1GZ9A 2ZEWA 4YGEA 1K5MB 1RHI3 1CVNA 1I6XA 1LJ7A 1XE0A 3S0MA 5C4WB 1SLLA 4IEXA 3IDCB 4Y5SA 4JGZB 4CEWC 1W06A 4B8EA 2GMMA 2DVGA 1QJY2 2VO5A 3ES1A 3A21A 3H9AA 1TG7A 1QJY3 4UFMA 3ECQA 5LBFA 2IXHA 1ENQA 2V09A 1OQ1A 2EXJA 4FPHA 1AXYA 3L2HA 1MS9A 1WD4A 1ST8A 2ADEA 1O4YA 1S0GA 1ZBA2 4PDWB 4N43A 3WQBA 4B29A 5FZ4A 1B35B 3NJXA 4YARA 5JXJA 1FMD1 2KR2A 2UYAA 4AVSA 3ZXKA 2Q0AA 2W3JA 2XKPA 3AB0A 4WM8B 5FPLA 2VOXA 1GLHA 5JCTA 5C70A 5KXEA 1H6YA 1AHSA 1JODA 4QB6A 1RUD3 2YMZA 4BK5A 1YQ6A 4P14A 1LB2A 3PUHA 4X6RB 3WDYA 4UAPA 2P6CA 4SBVA 5EWSA 1BYHA 2VZ1A 2WS92 4M0NA 4Q4X3 2FCUA 4QHZA 2WS93 3TB0A 3RZHA 4KMQA 1C3HA 3LQCA 3MIBA 3LOIA 1DQ2A 2ZGLA 3I2GA 4QDSA 2YYOA 1YJLA 4K9SA 4XUTA 5FP4A 3S30A 2ET7A 3VDDC 3TN92 2PMWB 3M8LA 3TN93 2JE9A 4CCCA 3K48A 2VQ0A 4MSVA 5BNPA 4LBQA 3AVSA 1UU4A 3F2ZA 1LHUA 1ND3A 4YNIA 1KS5A 1PGW1 1MZ6A 1EV11 3AZXA 3ZN6B 3TEXA 2VW2A 4GXLA 5FFOC 2GC0A 3WV6A 1JZ4A 2XPJA 5LK5A 5CADA 5JSOA 4P9YA 1ZZ9A 4D7YA 2RS31 3LDRA 5FLHA 4YYOA 3OYWA 2G1MA 3HJRA 5FYHA 5A1AA 4A41A 4GMP3 4YW3A 1IHMA 1JHJA 1YJKA 4XBNA 3GDBA 3H1WA 3WP4A 3ZYIB 4WZFA 1OSGA 3I2JA 2XQRA 1AXZA 2XBO1 1W8HA 4UF0A 1QJZA 3ZXAC 4R9DA 4JC1A 1PZ8A 1PM7A 4ZZ8A 1IQDC 4Y1ZA 5LCWL 4QKNA 5FY0A 3O1SA 1NUKA 2WWSA 1R1A2 3N9LA 1W8TA 3HT1A 5JUVA 1R1A3 5A6YA 1KITA 2ZMLA 4HXCA 2W46A 4QX8A 5L7OA 1J84A 3O0VA 3MLKA 4DEVA 3WNLA 1ZRIA 1H1MA 4RR3C 4NIHA
chains in the Genus database with same CATH topology
1YHFA 4S2GA 4K20A 4YGBA 4BMBA 4M3CF 3KT7A 1ND2A 1QJU1 4Z8BA 1JW6A 4PLNA 1VBC1 1G86A 1C8M1 3G6JB 2VMHA 2YGLA 2E7TA 1H30A 4LLOA 3VL8A 2RS11 1GZCA 1HXS1 1AYN2 1AYN3 4XJUA 3ZN6A 2D93A 4ONUA 2ZGQA 3CLPA 4OUSA 1MQTA 3IPVB 1UPIA 5HCAA 1RITA 5KHJA 3D5OA 4FPOB 3V0AA 1ZRRA 4AFAA 4FPJA 3RWNA 2RR12 3USSA 5J96B 4I01A 4GMP0 4IEOA 5C9AB 1QWRA 5CFDA 3VKOA 1C28A 1N3QA 4HVOA 5GLVA 4HANA 5LRRA 2D44A 3UJQA 4WV8A 4GULA 1CPMA 4QPIC 2WNVB 1G8WA 1N1VA 1ZA4A 3AKRA 3IM0A 4OZXA 1A3KA 2XWJB 3ZVXA 5F1RA 1G9BA 2R1BA 5FO7B 1XNCA 4CEYC 3POWA 4FOVA 1W6QA 1RUNA 5GALA 4YSFA 4AVCA 1MZ5A 1UW8A 1ZZCA 2Q4SA 4JCKA 3H7YA 4IEQA 1OQEA 4QM9A 4E27A 2OUHA 4LBLA 4A2UA 2QUOA 2X29A 5FRAA 1V70A 2BTVC 5FPXA 1TME1 2D6NA 1UN1A 4YM0A 2RE9A 1YWKA 2VECA 4R8HA 4FTEA 2LM3A 1AXKA 4M0HA 4YVSB 2CYFA 4YW2A 5C8CB 2FQPA 1LGCA 3OJBA 4ASLA 2WZPP 2HWD1 1W6NB 1EY2A 3NV4A 1IGOA 2XB6C 1JN2P 1GZWB 5JI7A 1REDA 2IZWA 5JOWA 2NP0A 3L2YA 2P34A 3FC0A 1NQJA 3MLLA 1HRI3 5I8SA 1AR62 3ZFGB 5F6LB 2QDRA 4B3NA 3USUA 2DF7A 4I02A 3NVCA 4LO4B 4XFAA 3AMQA 1LOCA 1WLDA 1N1TA 1RUE3 2WA4A 1AF9A 1Q8OA 1OFNA 4DNYA 2D5FA 3VBSC 3ZFFC 4I0BA 1J59A 2V5YA 5T5LA 3IKWA 3NO8A 2MEV1 4PIXA 3VKNA 1HDKA 1RUH3 3BTAA 5HBAA 2GZWA 2XVGA 5JOXA 1H9PA 4MLOA 4XTMA 2A71A 4G4FA 4CP0A 2X5IB 1ZZ6A 4FQ4A 3WDXA 1VBB2 4YVWA 1MS1A 2X53S 4OHXA 3ZFEC 4AI3A 5EXOA 1SLBA 5LEJA 1RINA 2XG3A 3UL2A 2EF6A 3WDWA 1G6NA 2A3YA 2ZAHA 4EJRA 2D3PA 1EYBA 3AKPA 4JGZC 3E5XA 4MGZE 1HQWA 4YFZA 2ZX3A 3HIFA 5BNQA 2OA2A 2GC2A 1AR71 2Z69A 3NAPC 2NLRA 2DTWA 3I7DA 1POV0 4PDWC 3DGTA 3VKLA 3BB6A 1B35C 5JI9A 1BXHA 2IXKA 3WXPA 4S2DA 2DU0A 1G7YA 2VH9A 1U12A 3KM5A 2ZX2A 1ZBA1 2Q5TA 4CZSA 4LO5B 4JDMA 4QPYA 3O7OA 1QXRA 3J26N 1PIV2 4YGDA 1PIV3 1PO23 2ZGTA 3FUOA 2ZGPA 3RNSA 3TRSB 2DCTA 4XF9A 2WZR3 2Z2SB 2Y38A 1S55A 4AEMA 4C91A 3MPBA 2JG8B 1VBE2 4HVRA 3RJRA 2ZX0A 3TYJA 5KXBA 5AVAA 1QJX1 2GC1A 4XDQA 1ULEA 2VQAA 3R6SA 1FX5A 1YFUA 3KB5A 4NO4A 5CB7A 5A32B 3TN91 2XJUA 4N9IA 2DVAA 1DBNA 4XF3A 4AFCA 5AFEA 4META 1Q8PA 2DV9A 1JH5A 2SLIA 1IPJA 3BPZA 5T3NA 4CDWB 4IXLA 4PIZA 2ZHLA 3VZLA 2R0HA 3CO2A 2PLV3 2VVFA 2H6CA 1DQ0A 2LUWA 4K21A 3WHUA 1D4M1 4JGYB 4AQSA 4AI0A 4XQWA 5BPXA 1UL9A 2D98A 4PLOA 5TSWA 3LKJA 2VXRA 4XIOA 4FSJA 2IXJA 4M3CB 4C1WA 2GH8A 1ULGA 3FFZA 2IXLA 4AVBA 4Q0PA 1S2KA 1SLIA 4Q4W2 4Q4W3 3AFKA 4N7IA 1CR7A 4OHWA 2D3SA 3OBRA 5GJ6A 4OHYA 1DQ6A 3MW3A 4AHWA 4IV3C 4KU8A 1MACA 3E97A 3VKMA 3VHOA 3WQ7A 1DU3D 5GLZA 1ZZ7A 2D6LX 4XFHA 3WP5A 2PQQA 3KCXA 1SQ4A 1A8MA 1LOAA 2DU1A 1QXJA 3MI8A 3KLSA 2C9AA 5E88A 4ZXKA 1PO12 3W9AA 4HZFA 2WC2A 3V0BA 4I09A 3RMXA 4NOTA 1FMD3 3HBZA 4R4XA 4YW5A 4FPLA 4P9GA 2DUOA 1Y9QA 5T54A 2DYCA 2JICA 4P9IA 3ZDSA 1RUF2 2PFWA 3N4MA 4Q2FA 3TWIA 3OBTA 4KWKA 5F9TA 1J58A 2HWF1 2RR11 2A6YA 2GNTA 3BCWA 4TYSA 3ST7A 3QCWA 4H3WA 1OA3A 1WGPA 2E53A 1C1FA 2C1FA 1RJ7A 3KT1A 3V65A 2XJQA 1URXA 3WX5A 2JXAA 1VBD1 3ZSLA 4FQZA 4D69A 5JWPA 2A3WA 4FPCA 1PGW2 2O0OA 4HMZA 1EV13 4RFT0 3N7JA 2W52A 1HIXA 4IEYA 3OY8B 1H8TB 2XUMA 3VBUC 2PHXA 2AENA 2WT1A 3SISA 3R05A 4R52A 4CDXB 1QH7A 4Z2WA 1OOPB 1N1SA 1VP6A 2HEYF 1MVEA 3FBYA 2O8QA 1O91A 4IV1C 2XBO3 1W6PA 4YVSC 5JAXA 5C8CC 3KCYA 1V6IA 4M01A 2JECA 3GF6A 3ZXLA 3UKVA 2ET1A 3ZSEA 4BOWA 2OVUA 2WA3A 3AYAA 3CEWA 4F7ZA 4CEWA 4Q4V2 2QE3A 1NCQB 3GHNA 1UU6A 4Q4V3 3LA3A 2VUJA 4R9BA 2E51A 2ZGUA 1QJU2 1WUVA 3B02A 1QJU3 3QD6A 3ZFGC 1JUHA 5CIRA 1C8M3 5GZEA 4IEPA 4OHZA 5FLJA 5L19A 1HXS3 1NXMA 4M00A 4COZA 1LTEA 1AR61 4AE2A 4Y20B 4X6QB 3WD5A 1C1LA 1XU1A 3WCSA 1DGWX 1WW7A 3VZKA 1LRHA 1POV1 2DCJA 5FCCA 4DS0A 1ZM1A 1M06G 3THPA 1BMV2 3C2UA 3WT3A 1BVVA 3FBMA 4AWDA 4XTPA 1WBFA 1QXPA 1A6CA 3FE5A 3VDDA 4PCRA 3CJIB 5KHHA 1F8VA 5DUXA 4MGKE 2GAUA 1IS4A 4QPGB 2HEVF 4XILA 2CV6A 5JLVA 4QQLA 4HK8A 2QCSB 1ZBE2 2HJIA 2ZKLA 4YM3A 1VBB1 3PHMA 4RQPC 3SXWA 5JDBA 4Y22B 3WW3A 5BNNC 4QX5A 1S0DA 2N7GA 3UKNA 1D4VB 5CVRA 2BWAA 1WA4A 1QQP2 2VPVA 1WLCA 2VMIA 4F3JA 1ENRA 1S0JA 2ZGMA 3JBG2 1W6OB 4FP3A 2KXLA 1Y7BA 4GALA 5T5OA 3A4UA 2C0ZA 2FHRA 4FCAA 3RZZA 1TME3 5I0TA 3NJZA 3RMYA 2CWSA 4Y24A 3FWEA 5CFCC 5KC6A 2G4IA 5FOBB 4RR3A 2VVDA 4W65A 2JEMA 4NR1A 5BYNA 1REEA 5K0UB 4Z92B 3IDEA 2HWD2 2GH2A 3MW4A 1SLAA 4ZU4A 1ZX5A 2HWD3 5JSRA 1XNBA 5GLWA 3CJIA 1PIV1 5EV7A 4AHXA 4YM1A 5GZFA 5DG2A 4LO6B 1KDKA 1LODA 2MPFA 3LSEA 3WW4A 2UWCA 2ZBJA 4ES9A 3OTFA 3FZ3A 3K51A 1VBE1 5J09A 4HN0A 4KU7A 3EJKA 4N53C 4FP2A 1XNKA 1LHWA 3N7KA 1XXNA 2XJVA 4NN0A 2B45X 2ZOEB 1D0HA 1LOEA 4WVVA 1XU2A 3ZSKA 3AXEA 4N43B 3GBFA 1W6OA 4AI8A 1H9WA 2MEV3 2XKOA 4JGYC 5KHGA 2ZS6B 5A3LA 3ZN5A 5BV6A 1DQ5A 4QPIA 1GQGA 4KL1A 2BFUS 4LE4A 4HETA 4AEDB 4YG0A 2E63A 1OPOA 4B7KA 3AZZA 3ZO0B 2QQPA 1RGSA 2QVSB 5GLUA 1XYPA 4AQ6A 2XLAA 1QF3A 4HK9A 1WMDA 1YI9A 5FLIA 2P3KA 3T1LA 1EAH2 3WOGA 2BGCA 2ES3A 5I8TA 5BNPB 4LBQB 2YY1A 1AR72 5SV5A 3MFAA 1ND3B 1AR73 5JZGB 3IMNA 1MZEA 2PAEA 4GQ7A 1O3SA 2VNRA 4WM7C 1NZCA 3ENRA 1IKPA 1RUC2 3T2TA 1UMZA 1RUC3 5T50A 3OF1A 4MUVA 5BXXA 2D43A 2PELA 3OYWB 4FAHA 1DDLA 4K6BA 1KDMA 5DDJ2 3RJ2X 2RHPA 5DDJ3 1PO11 5E8AA 2WINB 1ZBA3 4C90A 4NVPA 3RI8A 1FOD2 4XJZA 5F5QA 3WP6A 1RUF1 3VBRA 2PHFA 5HXVA 2BQPA 4UW3A 1WCSA 2ZMKA 1BBT2 4AEDA 1BKZA 3SMHA 1QOOA 1R091 2DCYA 1CD3G 3SHRA 5L7OB 2NN8A 1AR92 1HRV2 3GHMA 3WY6A 1QJX2 2NYYA 4PLMA 4W6WA 1QJX3 1SCSA 1AYM2 1ND2B 5FTTC 5CBLA 2B9UA 3ZFFA 5D1IA 1PK6A 5CAZA 1UF2C 5JZGA 3GNEA 4OI1A 1X8MA 2SBAA 1IKQA 3GBWA 4HSLA 5JR7B 2RS52 4QM8A 1MQTB 3INAA 4C0BA 4N7UA 2DTYA 1D4M2 3V0AB 5LEKA 2XVLA 1D4M3 4PJYA 1NQDA 3AX4A 3WG1A 2P3JA 3WP3A 1DGLA 3ZFEA 2ZZQA 4EWDA 1OA4A 5CFDB 3SH4A 3U11A 1QOTA 2YC0A 3AMNA 5L36A 1I5ZA 1RUOA 5F6KA 3TOJA 3M2MA 1NCRC 2P37A 3NAPA 3SLIA 4XHXA 3KGLA 4Q4V1 1U5YA 4FOYA 4XOGA 2JG9C 2DWRA 4XF1A 3FX3A 1ENXA 1HV1A 2W0XA 2E7QA 3DPRA 2QZ3A 5FMOS 1Z0HA 1MS8A 1Z7S2 4XE9A 3NV1A 2BUKA 2PTMA 5DZFA 1Q8VA 4IETA 3I54A 3FLTA 1W6QB 3HT2A 3WNXA 4E4SA 5K7PA 4L92A 2FZ1A 4XJWA 1A78A 4XQDA 3WR0A 5DXDA 2H6BA 2GALA 4MXVA 4XFFA 5DUUA 5SV8A 4AQ2A 1ZRDA 5I8YA 3I59A 2OYZA 3E6BA 2AUYA 5HCBA 2FBEA 3E6CC 1HQLA 1FT9A 2ERFA 1TNRA 2HWF2 2R071 2HWF3 2RR13 1BMV1 2ZPXA 3E5UA 4QPGC 4XMIA 3SH3A 3N3HA 1FAYA 1GQHA 4I3PA 4LTAA 3WVJA 1UPSA 1IS5A 4J1XA 3VL9A 3GBGA 2BYVE 1GNHA 1VBD2 1YRZA 4RS5A 4UXAA 3ZSJA 4Q4Y2 1VBD3 2YUEA 4N90A 4Q4Y3 4Y1UA 2B46X 3RYRA 4OULA 2ENRA 4BWOA 1ULDA 3I2DA 1ZBE1 1S0IA 1FV3A 4FXKB 3USUB 4ATEA 4UW4A 3AMPA 4W6XA 3AZYA 1KS4A 4MVTA 1ASJ1 3SCFA 1WW4A 5JPNB 2CY6A 2A75A 4L11A 1VRH2 1NA1A 3VBHA 1QQP1 1WBLA 3JBG1 3NL1A 4LUMA 2C5DA 1XNDA 1WD3A 2HKXA 4Q8KA 1WCKA 1H1IA 4JTOA 4DPNA 4MV2A 1H2KA 1AJKA 5K0UC 4HBNA 1IZ3A 2GU9A 3AYDA 1R1ZA 2W08A 4IV3A 1XE7A 2PYTA 4A7YA 1OA2A 2VG9A 4AEJA 3KD4A 2GDFA 4ZKTB 4YVWB 2OIIA 2DCZA 3VBOC 4I0WB 1AR82 5D8AC 3KQRA 1CPNA 1CAUB 4E2SA 1RMU2 4DRRA 3DL3A 1MZFA 4GH4C 3QOPA 4MZUA 1QOSA 2RM21 3Q9OA 2WNUC 1AR63 1F31A 3RYKA 2Y26A 1LOGA 5GM0A 4OVEA 2NMNA 2WIIB 2ZJCA 5T5PA 1POV3 1C5IA 2ZZJA 4CDQC 2D7FA 4N43C 1S0BA 1UCXA 4B4PA 1NYWA 1WW6A 1LULA 3RYPA 1V6MA 1BCXA 3N7MA 5KXDA 5JSPA 4EROA 4Q0UA 1YI7A 1UIJA 3LSDA 4AFDA 4LBKA 4OUMA 5BNOC 4KG8A 5FO9B 5EFUA 3H1YA 3ZXJA 4V1PA 4HSJA 1GKBA 5J48A 2IFRA 2E9QA 3D4KA 2WFF2 2YZ4A 1KFXL 1VAMA 3VBFC 3B94A 4AFBA 1H4GA 1DHKB 3URFA 1VBB3 3N7LA 4DQAA 1HKDA 1QDCA 2R32A 2GNBA 3U10A 2VNGA 3VBUA 1K5MC 1TMF2 3WZ1A 3THTA 5LK7B 1CAUA 1TMF3 1FPN2 2R042 5C4WC 1FPN3 2R043 1UD1A 1DZTA 4IERA 3ILRA 4AI1A 3RI9A 2B5HA 1EAH1 1LKNA 1HV0A 4IV1A 3KMHA 4LBMA 4UBHA 4EV0A 4XZPA 4RD7A 3FJSA 4P9JA 4XF4A 4WZCA 3ILNA 2VOWA 5FDBA 1F5FA 4Y1XA 5KXCA 1DFQA 2KM2A 3RS6A 4AQTA 4CP1A 4JDNA 1QNWA 2ZTNA 1RUC1 1WLWA 1OHFA 2K9ZA 2JE7A 1DGRA 4WM8C 1GFF2 5DDJ1 1VALA 3CJXA 1FYUA 3J8F2 1FOD1 2EVXA 1MVQA 2XH6A 3RRDA 5AC92 5L7OC 2BEOA 5AC93 3CNAA 4CDUB 2EXKA 3E6DA 1NY72 3OGJA 3V56A 3AKSA 1LHVA 1LHNA 1RB8G 2BW8A 3JCIA 1ND2C 4ZU5A 4YZ3A 1BBT1 4R4ZA 4EN6B 1E57A 1VBE3 4NHLA 4S2HA 2UURA 1AR91 1HRV1 2TEPA 5DZEA 1JOJA 4LA2A 5K9YA 4KBBA 1AYM1 1S0CA 4AGGA 4FPKA 3FHIB 2ARXA 4H14A 1YYNA 4PQ9A 1AL22 1LECA 4XJ9A 1MQTC 3A0NA 2PA7A 2OPKA 3GYDA 4P9WA 2VU9A 3HQXA 1OI6A 1BEV2 1Y3TA 3V0BB 2YXSA 2QDNA 4IEZA 3B9IA 3P3PA 2RMU1 2PHTA 2TBVA 2XLGA 1C57A 2DUPA 2RS51 4MXWA 5I0SA 1VBA2 3BOWA 1MS0A 2ZX4A 2VOKA 1WMEA 4RQPA 2Z79A 2D6PA 1BQPA 1LHOA 1X82A 1LOFC 5GLTA 4X8NA 3ES4A 1YNAA 1V6JA 3WW2A 1KRIA 2Q1MA 2H0VA 3POSA 4CDUA 1H1AA 4JQRA 3B00A 2VW1A 1RC6A 3S7EA 4BIFA 3JQWA 3NV3A 4YW1A 2WKKA 1DLLA 5E1RA 3DKWA 1IPKA 4FXGB 1W2UA 2OZ6A 1CONA 2AH2A 5CFCA 1Z7S1 2DUQA 4NHKA 1Z78A 3ALQA 1PO13 1NG0A 2XHKA 1AX1A 5LRSA 2YPJA 1AZDA 4L97A 1LU2A 2VGDA 1ZYBA 3NKGA 4XMAA 1W6PB 3D8CA 4IEVA 2WSVA 4Z82A 3M3QA 1J3QA 1DYKA 2P17A 5C9AC 1L3JA 1RUF3 1UX6A 4J1WA 1TNFA 1R082 1UZYA 1UAIA 2ZABA 1C5HA 3E5QA 4UW6A 1R092 2XL9A 4CEWB 1R093 1D2SA 4A7KA 3VZJA 4N53A 2JKBA 3WG4A 1KFUL 1LGNA 2WNVC 5DUWA 5ACA2 1SDWA 5ACA3 3NV2A 2K0GA 4Q29A 4LULA 4FT8A 1YLLA 4Q4Y1 1HX6A 3D6EA 4DFSA 3NW4A 2PN5A 3MICA 2XWBB 1PVC2 2CTVA 1SFNA 1RUI2 3H1MA 3ASIA 1S0EA 2D6MA 2VULA 5T52A 2F6BA 4EN7B 4G3YC 2DCKA 2UWBA 1VRH1 4LE3A 3J9SA 1J1TA 3L9JT 3RDIA 1QMJA 2VVEA 2ZX1A 4H55A 4K7JA 4RGGA 2A70A 2WLQA 5KWRA 5ABJA 2B8MA 3VDDB 2ZAAA 1RUG2 1RUG3 3I4IA 3R0RA 2ZGRA 3ZYPA 1PNFA 1RUJ1 3M3EA 1MS4A 3GZUC 2GN3A 4LHNA 4BYYA 2XLFA 4FVVA 4WM7A 2H0BA 4IEWA 3AJZA 1DF0A 1AR81 1RJ8A 1EPWA 1O3RA 4BH9A 2JD4A 3AP7A 1RMU1 3APBA 1H2MA 4QQHA 4D7SA 3O0XA 1U5ZA 3AM2A 3M3OA 3VHRA 2B7YA 3MFCA 3TNQA 1LENA 2A6VA 1U5XA 3NSTA 1XQNA 1IQAA 3SNMA 2EALA 2UU8A 3ZN4A 2HWB2 4DXZA 2WQ4A 1DZQA 2WT2A 3H3UA 4URTA 1VB4A 2R072 3PVEA 2ZKNA 4FO9A 2ZHMA 2R073 4IEUA 5DG1A 4R9AA 4RR3B 1J1LA 4R9CA 5C8WA 3MIHA 2A6ZA 2BVBA 3GZTB 1X36A 2X5IC 4XQ4A 4BLJA 4LBNA 1GICA 5AFBA 4PF5A 3V64A 2YDEA 4YG6A 3AMMA 4G9SB 3HAGA 5KHIA 1KQRA 4Y1VA 1UKRA 2HYKA 3T1MA 2WFF1 4E2GA 4GWMA 2A6XA 3TNPB 4RSUA 1ZBE3 1G9DA 4O9EA 1SBFA 2E6VA 1GBGA 1PNGA 1ASJ2 1ASJ3 1TMF1 1H2LA 1GV9A 1FPN1 2JX9A 4AVVA 2R041 3FFQA 1QQP3 1OPMA 1YCIA 4P9LA 1HLCA 4BZ4A 2BNMA 3JBG3 4QU2A 4HLTA 1I9RA 5CU1A 2DFBA 5EJ3A 4QQPA 2WQZC 4OLLA 4TLFA 1GSLA 3JB4C 2A5ZA 4Y5Z0 1NCRA 4AHYA 3ZXDA 4FAGA 3ELNA 2ARBA 4QPIB 4EN0A 4JDOA 1AUYA 3EQEA 4KWLA 2I74A 1DIWA 1HQNA 1YUDA 4HN1A 4ISRA 2JJ6A 3J8F1 4BMEA 2HWE2 1MS3A 2HWE3 2CAVA 3ROUA 1OLQA 2EA7A 4CEYB 2JG8C 5AC91 1N1YA 1NLSA 3CL1A 5I0UA 3RG0A 2EXHA 1LU1A 2RM22 5BY5A 4LLFA 2RM23 3SCGA 1NY71 2VUAA 4SLIA 1ZZBA 3JD71 4LNVA 3HR9A 3U0ZA 3M70A 5IK5A 2B42B 1SCRA 3M1HA 4OFGA 4HPKA 5JOZA 1GYKA 2LALA 2XGXA 4ITCA 2IXIA 4KWJA 4CDWC 1H8VA 1UKGA 3AXDA 1AL21 3BALA 5T5JA 5J98B 2O8OA 2ZCWA 2FZ2A 3JUUA 1CAXA 1QU0A 1BEV1 4DRVA 1QH6A 2EIGA