2VUDA

Pa-iil lectin from pseudomonas aeruginosa complexed with fucose- derived glycomimetics
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
114
structure length
114
Chain Sequence
b'ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNETAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILTNELNFALVGSEDGTDNDYNDAVVVINWPLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FUCOSE-BINDING LECTIN PA-IIL
publication title Fucose-Derived Glycomimetics as High Affinity Ligands for Bacterial Lectin Pa-Iil from Pseudomonas Aeruginosa
rcsb
source organism Pseudomonas aeruginosa
molecule tags Sugar binding protein
total genus 20
structure length 114
sequence length 114
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07472 PA-IIL Fucose-binding lectin II (PA-IIL)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.400 Mainly Beta Sandwich Jelly Rolls Calcium-mediated lectin 2vudA00
2VUDA 5A6YA 2WR9A 2JDMA 4AOCA 2BV4A 1OURA 5A3OA 2JDNA 2WRAA 4CE8A 5A70A 2JDHA 5D2AA 1UQXA 1OVPA 2JDPA 3DCQA 1OXCA 2BOIA 1GZTA 1W8FA 1W8HA 2BOJA 2JDYA 5A6QA 4UT5A 3ZDVA 2JDUA 2BP6A 2XR4A 1OUXA 2JDKA 2VNVA 2CHHA 2VUCA 5A6XA 5HCHA 5A6ZA 1OUSA 1OVSA 1UZVA
chains in the Genus database with same CATH superfamily
2ZHMA 5A1AA 3SMHA 3ZSJA 4CA9A 5L7OC 3DPRB 2BGPA 1LENA 4PI0A 5KXBA 4XF4A 1AX0A 4NIGA 4E4DX 1NG0A 3LGRA 1GKBA 1UY3A 5FPUA 1GNZA 4YNIA 3C7OA 3VGIA 1NX9A 1WLWA 1X82A 2XG3A 4IE0A 4RGKA 3IMNA 3M70A 1IOAA 4LULA 4L2NA 3WQ7A 4OULA 3FFQA 2ZGQA 2RV9A 1RUNA 2EXKA 3ZXDA 1RVF2 2CL2A 1Z7S3 5IVVA 1FPN2 1VBC1 2YGLA 5I8SA 4D7TA 2WLPA 3MIGA 3HT2A 3T1MA 1RUC3 3VBFC 4CTEA 1WW6A 4NHYA 5A3MA 4Q1PA 4XHXA 3S0MA 4FI9A 1CAWB 5IK8A 3OD4A 5H9RA 3I59A 2C9AA 5C6CA 2ATFA 3G7DA 3CJIC 1GWMA 4EN8B 1W9WA 1H1AA 1DGWX 1KITA 2ET7A 2YY1A 3Q8CA 3ZKUA 1SLTA 3KVAA 4GB32 4BQ2A 1US3A 3MPBA 5FYYA 3WNOA 1PGSA 1PVC3 2VVDA 1BHGA 5L19A 2QVSB 2FMDA 1W0NA 1QXPA 2R071 3WF3A 1UU6A 2F4LA 4V1PA 2PHXA 2RG4A 3CKHA 4W6WA 3PU8A 1ZZBA 1LRHA 1PIV2 4CDQC 1XU2A 4CCKA 2WNVB 1JYIA 4XUOA 1HQWA 4M4RA 3MIFA 4LBQD 4QXHA 5F5CA 3WY6A 2IVJA 2ZGNA 4E4SA 2C5DA 1DYPA 3ECQA 3U14A 4YVWA 4D3WA 1MVEA 4P9IA 5K7PA 1AUYA 1LOFA 2X5IC 1N1TA 2NYYA 5FZOB 3ES4A 4R4ZA 3IWZA 4C8DA 3RNSA 2Y64A 2Y60A 4JDMA 4CVUA 2HJIA 3WW4A 1CESA 4MXWA 3T0BA 1VBA2 2FMYA 3S7EA 4B4PA 2KA3A 2GMPA 5FZEA 4GMP0 1O8SA 5A7SA 4XDOA 1QKQA 3AP7A 2XJSA 2Z69A 4ARYA 2Q1ZB 2ZKNA 3WCSA 5FY9A 1GQHA 1BK1A 5FWEA 5A3PA 1J1TA 3J9SA 2VAUA 3IM0A 4KH9A 2VOVA 4ES9A 1YQ2A 1UWWA 4N43A 3MUY1 5FZ8A 3RPQA 1W2UA 1WBLA 3AMPA 2AYHA 3HIFA 5K9YA 2DU1A 2UWCA 3CHXA 4CDQB 1WKYA 1POV0 3I8TA 4XIKA 3H50A 1LESA 1Q8VA 2RDNA 4IE7A 1IPSA 1TNRA 1VLNA 1VBE1 1ZBE3 4G4FA 1OA4A 5JUVA 2YZ4A 1QJY2 1U0AA 2XLAA 2GU9A 2WZR3 4QAWA 5CZKA 1H2LA 4GXLA 2GNBA 2ZZJA 2O14A 3G6JB 3WOGA 3RZMA 3BI3A 5L9BA 3ZN6A 3JUUA 3RDIA 3WP3A 2BZDA 4KGGA 1E5SA 1YI7A 4LIVA 4A6OA 2VVEA 3EB7A 1AYM1 1RUE3 5IVEA 4AEKA 3ALQA 5JDBA 2Q30A 2WA3A 1QY4A 1HXS3 5A33A 2VQUA 3P5BA 1NOVA 2VU9A 5GLWA 4WVZA 1R1ZA 3BVCA 5JVVA 3E97A 4MGIE 5KHHA 1ZRIA 1QDOA 3IAPA 1YFWA 3QH6A 4E2QA 3AVSA 1C1LA 2Q5TA 1Z7S2 5JIUA 4BWOA 1HRI3 3ZO0B 2HWD3 2C6SA 2VUJA 1ZM1A 4QXKA 1WCUA 1QJFA 1FMD2 1RUC2 3KT4A 1LHVA 2WC2A 1W2NA 4OHVA 3RI8A 1DZRA 2W1UA 3RZKA 1A8MA 4YW1A 1KEXA 2XKOA 4J6GA 1PK6B 2D6LX 1RJ7A 4OFGA 4AFCA 1H9WA 4BCUA 1BMV2 1RXGA 4N53A 2WT0A 4GAZA 3ZFGB 1MZ5A 3GALA 3MLKA 5CKNA 1QH6A 2Y6KA 3I2HA 1E5RA 2ZHLA 4RHV3 1D0GA 1W8ZA 1PVC2 3U4XA 4PLMA 3O1OA 3WW2A 1VAMA 3MV01 3DEMA 3ATGA 4DPNA 1YYNA 2YV8A 1GP4A 1SBFA 1RJ8A 3THDA 1JYXA 4YG3A 1Y9MA 4LTAA 4MGTA 1S0DA 2JB4A 2Y34A 2P1BA 5KXEA 3BUCA 2IXLA 3AFKA 2VUCA 3CO2A 4XCBA 5FRAA 4EWAA 1IKQA 4HSLA 3WX5A 5L7OA 4CP0A 2VW2A 3WHUA 3CZUA 3R05A 1OPOA 1RUF1 4MOAA 3U11A 2IXKA 2AREA 2Y6LA 3PDQA 3F2ZA 1EAH3 2WNVC 1TEIA 3RZJA 5FZFA 3B69A 3WG3A 1OSGA 2VZRA 4NUBA 5C3SA 2W39A 1D2SA 4IUGA 4LBOA 5J37A 1JUIA 5DAXA 1IS4A 1YCIA 1SZBA 2N7GA 1VMFA 3H1MA 4HBNA 1DP0A 2Y6FA 3D4KA 4HSJA 4Y33A 5FZHA 2BOJA 1BJQA 3PUAA 4QB1A 3ZFFB 1LOEA 1OLQA 1A6CA 1L7RA 1O4ZA 4CU8A 2HH9A 3J7HA 1S1AA 4GWNA 3NVCA 3DKQA 4XBLA 5CIRA 1C3HA 1FV3A 2W9XA 3OPTA 3IPVB 1CIWA 3DL3A 3NSTA 3ORJA 4N9HA 2JIJA 3AJZA 2WR9A 3D0SA 3AJYA 3I2DA 2E32A 2WN2A 3M7AA 3CJIA 2RJLA 1JXNA 1S0CA 5FYIA 1CD3G 2AH2A 2Y38A 5DAWA 1VMJA 4EWDA 4D69A 1GQPA 5LEKA 2Y26A 1ZBE2 2E31A 3V0BA 1MZFA 1PGL1 2VCBA 1X9PA 5B2GB 2WZR2 2V72A 2WKKA 1GWLA 3FZ3A 4Q4W1 3K51A 1UY0A 3ZXEA 1RUD1 3AYDA 5BNNB 2FD8A 1TQ5A 1CAXB 4FOQA 5FYMA 4Q8LA 4CDQA 1QQP1 3N9OA 1WMEA 1ASJ1 4JTNA 4E2SA 2D7FA 3VV1A 1KDMA 3LA3A 2YFZA 1RUE2 2JG8B 4YVSC 1YQ6A 4K9SA 1OKOA 3FC0A 1KQRA 1J3PA 1OURA 2DBIA 1D0HA 1ZYBA 1EUUA 1WW5A 2WYFA 2X5IA 3OJBA 3THTA 3MIHA 4OMCA 4QHOA 2A6WA 4PDWB 2WQ4A 2VZSA 3O0XA 4I30A 4I0BA 4QX7A 4PBPA 4A7YA 3QCWA 1HRI2 5D8AB 2HWD2 4OZOA 1ULDA 4MGZE 3LPGA 4U2AA 2RM23 1IG3A 2HBTA 4UFIA 1GSLA 1AL21 4NIAA 3VBRB 2WINB 2RS13 1BBT3 4AI2A 2PAKA 2UY8A 3MEPA 3WEZA 2WSUA 3U1XA 1KFXL 5HCAA 4EJRA 5A7NA 4ONUA 2HYKA 4IV3C 3K3OA 5LY2A 1J1LA 5IVBA 4HVRA 4W4ZA 5ABJB 5AFEA 4RHV2 5FJKA 1GNHA 1I6XA 1LHNA 1SFNA 3A4UA 4NHLA 1PK6C 2R0HA 3OTFA 3H8OA 2IXJA 3NWKA 4M3CB 2HWB3 1VRH3 4WM7C 1UPIA 2ZEXA 3WR0A 4HLTA 4OHWA 1RUG3 4CXYA 2VXRA 1FXZA 5CBLA 1MEC1 4MX3A 3I2FA 1LHUA 4Q4X1 4YWAA 2JENA 3SC7X 4CDWB 2GP5A 1PMIA 1W28A 2MHFA 4IGQA 3KCYA 4K21A 5JSOA 2OUJA 3UNPA 2SLIA 1EAH2 3CNAA 4BPZA 4ASKA 3PJYA 2BNMA 1X50A 5DZGA 1OD5A 1RTVA 1N3PA 1TMF1 2PHLA 3B94A 3OPZA 3V56A 3V0AB 3DPRA 4XZUG 1W99A 1Z78A 4I2OA 3S5QA 4AEJA 5C3PA 1U5IA 5EPAA 1W06A 1NY72 2B39A 2C4XA 2QCSB 3B93A 5GLVA 2O8OA 2A3WA 5KWRA 4NRPA 3GBFA 1CZTA 3GZAA 5J1XA 2VMDA 3O1VA 5D2AA 3HMYA 1UX6A 2AENA 4IW3A 2HBUA 5C9AC 1JYWA 1N3QA 3ZFFC 2VH9A 5BNOC 1YJLA 5FY7A 1TNFA 2YB7A 4OI2A 1NAEA 2W47A 4NHMA 4V2VA 5ERLA 3BIEA 2R063 3AZYA 4DFSA 1CONA 2RVAA 1CAWA 2UU8A 2W1QA 4HG6B 3BU7A 3MUZ1 2VZOA 5FY4A 4AI0A 2UY9A 1U5YA 3DCQA 4BQ4A 3I3EA 5LBBA 1Q43A 2QZ2A 1V6IA 3FBMA 2RR13 4BIFA 3OBTA 4BHPA 2XMLA 1A3KA 4CU9A 5IT6A 4JQTA 1EV12 2D93A 4NN0A 2Q8DA 4P9GA 3HPNA 4BXSV 1RVF1 3KGLA 1FPN1 3NV3A 2VW0A 3ASIA 3NJYA 3PU3A 3PMSA 4IQPA 4XQDA 5J3UA 4B8EA 2BVVA 3WNXA 4B4RA 2D5FA 2WFF3 3WLUA 4DMIA 1JZ8A 3USUB 2WNVA 4AFBA 4QQPA 5CKQA 5FZGA 3O1TA 1TVGA 2JG8C 2W0XA 3WCRA 3CJXA 3QLQA 1AXZA 2K0GA 2RM22 5FMBA 3P3PA 2JKXA 5LK5A 5FZOA 3T3YA 5FOJB 5F8PA 3AP5A 5HV4A 2RS12 4XFHA 1BBT2 1DLLA 2XH6A 5LBEA 1GFF2 3FHIB 2UYBA 4PDWC 4XQWA 1J3QA 4BB3A 2VNVA 4CCLA 5D8AC 1NUKA 3T4HB 3LDRA 3GDBA 3J7LA 2DBNA 4C91A 2XHNA 1HB1A 3N36A 1CX1A 3MICA 2XQXA 3UGHA 5L36A 5IHRA 2ZAAA 1F2NA 1H4GA 2HKXA 3H42B 3JBG3 3GBWA 4O9GA 3C7HA 2BNNA 2O8QA 2HWC3 1REFA 1I5PA 1JS9A 1RUJ3 3OOXA 1X36A 2IXHA 4MO3M 4UBHA 2CWMA 1VRH2 4YFWA 3WVJA 3J7MA 4PIYA 4XETA 3Q8FA 1GU3A 2UYAA 1NQDA 1K5MB 2Y6JA 1JYCA 1SEFA 3VDBA 1TE1B 4DEVA 3CIHA 3VZOA 1UY4A 4KBBA 3IDCB 2LW8A 3FLTA 5FUNA 1ZA7A 4CU7A 1CJPA 4I01A 4F3JA 1N1SA 2RMU2 3NMBA 4ISRA 4LHSA 3J8F3 3M3OA 2JB8A 1Q56A 4XBNA 1UOGA 4NO4A 5A70A 1V6JA 5IVYA 5LY1A 3WDWA 4GWJA 2PXJA 4LKDA 3RI9A 2D6MA 4AVBA 5EIYB 1ZRRA 4YM0A 5APAA 2QFEA 3IZOA 1URXA 4I3PA 2J42A 1QHDA 4LBKA 5F2WA 5GKAC 1SPPA 5EYYA 1W8FA 2CAVA 4UOJA 1WMXA 4IERA 5CB7A 2V4AA 4AVCA 1LECA 3FLPA 1DGRA 5J98B 3ST7A 1GANA 1QJY1 4YRDA 2WT1A 2QTWB 3F95A 4LO7A 4E4HA 5AFBA 2QQPA 2VR4A 4LNVA 2FDKA 4GJYA 4LKFA 1AR73 4IV3A 5FZ0A 1RINA 4JKMA 4XC9A 1X7NA 1NLQA 4F7ZA 1L3JA 2DFBA 2P3KA 2R062 4GWIA 2QQOA 4DOUA 5FJHA 4PLNA 1H2NA 3RZHA 1PK6A 1ZZ6A 2QQKA 3FE5A 3K4ZA 2EVXA 4WM7A 2RR12 5F6KA 2D40A 3POEA 4D6SA 3LKJA 1HJGA 3R6SA 3RFRA 2VY0A 3SH5A 4B7KA 2YC0A 4URAA 1Z7S1 4AFMA 3CMGA 4XDPA 4Q4V2 2QQNA 4S2HA 5C8CC 1RUH3 1BZWA 2GN3A 1RUC1 4XJWA 4CZSA 4RR3B 2JE8A 3SCFA 2WFF2 4YGBA 5FKBA 3ZMOA 2WS92 4ZS2A 3UL2A 2D6OX 1LNSA 3ZXAC 4Y3OA 1UU4A 3TN92 4Q2FA 5FUIA 3EQEA 3KF5A 3E6DA 4X8NA 3O1PA 2RJKA 4XFBA 3ZSKA 5JR2A 1MQTB 4OHZA 3THCA 4OVEA 5TSWA 4LITA 3Q8AA 1HQLA 1R082 2ENRA 4CCCA 1PVC1 1AR63 1XE7A 4CCEA 2Y0OA 3HAGA 4YW4A 1Y7BA 2QQVA 4JVAA 4LO8A 3CF6E 5AC93 1L7LA 4WV8A 5FZ4A 2Q8CA 2B9VA 4OUMA 4COVA 3HOBA 1UIKA 5C9AA 5DZFA 1OUSA 1Z0HA 3ZFFA 3JBG2 1ENSA 1KDKA 1O59A 5IAXA 2WIIB 1R1A3 4P9WA 1E5IA 3LFIA 2EIGA 4AVVA 5FY1A 1STMA 4YVWC 3IPVA 3T30A 5FPZA 4MV2A 1NA1B 2P3YA 3VZMA 4Z8BA 1UCXA 2RDQA 4FPYA 2A6YA 4LOTA 2XVGA 2WZ8A 2CDPA 1NT0A 1OFSA 3AKTA 3D82A 1ALYA 1K45A 2JJ6A 2X8KA 4IV1C 3I3MA 1O3QA 1SG3A 3PUQA 2Q1FA 4HOOA 3WF0A 1YWKA 4HPKB 3WT3A 5T54A 2VZUA 2BBVA 3IB3A 3LD8A 2H0VA 1ACCA 2PHTA 5HCHA 3RGBA 5BNNA 4M0NA 3EBRA 1XXNA 3LEMA 4LBMA 4XVHA 5GALA 4PQQA 5L9RA 1CAXA 3IT8A 3TBDA 5DG2A 3S7IA 2J1RA 3IDEA 2DUPA 4OHXA 2PTMA 3WG2A 3KGZA 3ZYPA 2PHRA 3LIHA 5FTTC 4FTEA 4A3ZA 5FZKA 1RXFA 1ULPA 1RMU1 2JG8A 3AYEA 4QGLA 2WWSA 4YW3A 2VOTA 1JTZX 4JDNA 3A21A 4FSJA 4J25A 1LKNA 4FO9A 1JODA 4UW5A 4WBBA 4X6RB 1PMHX 4QKFA 5CKMA 3WW3A 2OXBA 1JOBA 1ZBE1 4A7ZA 4GH4B 1UZWA 4GB33 4PDWA 2JKBA 2VOWA 2WO7A 5AVAA 4CEYC 2PHWA 5FZDA 2WZR1 2VM9A 3LIGA 1G7YA 5A3TA 2XJTA 4K7JA 1DQ1A 5D8AA 3C3VA 1TG7A 1OUXA 1AR72 1D7PM 1S2BA 2QQWA 3P6BA 1XSRA 3ON7A 1J3RA 2QQLA 1PIV3 4OZXA 3A0KA 1MR5A 2BV4A 3LFMA 3W5NA 1GOFA 3TNPB 1LCLA 1PGW2 1RUE1 1ZNPA 4AI8A 4DS0A 3I54A 4WVMB 5DQ0A 1HXS1 3OPWA 4AL9A 5JMCA 4RGAA 3WQBA 2W3JA 4LHNA 3U0ZA 3L2HA 2R043 3TNQA 5ABJA 1H1IA 2AACA 1J59A 4PIZA 1QJEA 1CAVB 1A8DA 2R0FA 2D43A 4M4PA 5F6LB 5FUPA 4AYUA 5HPOA 1HRI1 4XFIA 2HWD1 1QF3A 1VBA3 3LEKA 2CV6A 1RUH2 1OFNA 1DU3D 1C8NA 1WZXA 5JIAA 3U37A 4QWNA 1WW4A 2JD4A 1J83A 2P3IA 4IEPA 3VD7A 4YW5A 4NHKA 1NZIA 2Y6HA 4UFJA 4IL7A 1AYN3 4JV4A 2NMNA 4CDWA 1ULCA 4K3UA 1OOPB 3EHKA 3QD6A 4META 3RS6A 2W1SA 2ZMLA 3GNEA 4X6QB 1DYOA 4RR3C 4N9IA 4NPRA 4RHV1 4HK8A 4CRQA 2B7YA 3URFA 2G1MA 4LUMA 5FZIA 3WD5A 3RYPA 5A6QA 4MGYE 4XYXA 3V0AA 2ADEA 1GUIA 1W0PA 3OEBA 4FOWA 3HWJA 3WNNA 3ILFA 4XEZA 2X05A 5C5UA 1MQTC 3ZFEB 5A6XA 4YM1A 2R30A 1ZZ9A 1ZX5A 1R1A2 4ARXA 4YM2A 2WNUB 3I2JA 1MS5A 3WP6A 3BODA 1UO9A 2ZA9A 4D6RA 4O9EA 1VAVA 4UFKA 4ZU5A 2BEOA 2GDFA 4Q27A 3QH7A 5GLTA 5F5QA 1DDLA 1W04A 1AF9A 1EAH1 5JPNB 4CP1A 3N35A 2ZMKA 5T5OA 4ASMB 3MDPA 3NNMA 3FUOA 4YFZA 2Y0IA 2KR2A 1PM4A 5DUWA 2ET1A 3AK0A 1NA1C 2A73B 3WF4A 3RWKX 5CA6A 4C90A 2VCAA 2A3XA 3GXUA 5C8CA 2QQJA 5IK7A 3PJQA 1D2QA 5LK7B 1LOBA 1NY71 1FMD3 2CNAA 2VQAA 2WO3A 4M0HA 3OGJA 5JR7B 4AEMA 3I3QA 3OGVA 4I0WB 4I09A 4QQOA 1YQ8A 3SKJE 2BW8A 3AL5A 1AX2A 3E5XA 4D0QA 1OT5A 2YU1A 1C4RA 1HJFA 3VBUB 5FZ6A 1JZ3A 1ENQA 4FPJA 3C7FA 1QOSA 2EALA 3OSDA 3GZTB 3USUA 3MW3A 3EYPA 5E89A 2QQUA 3R4UA 5LB6A 1OH3A 3RZZA 5CAZA 3HQUA 4ORFA 1JOJA 1MS8A 2ARXA 2YBPA 3LQCA 5GZDA 3UJQA 1I1EA 1UXXX 4CXWA 3U07A 4BOWA 2UWAA 2ID4A 4MVTA 5LBFA 2XOMA 1JHJA 1AJOA 1UPSA 3N7MA 2GMEA 1WMDA 4KMQA 4GH4C 1ONAA 3NJXA 1H8TB 4BH9A 3WZ1A 4JC1A 3SCHA 4YARA 1FX5A 1ULOA 2ZGLA 4FQZA 4B1LA 4DNYA 5F7UA 1N3OA 2JDHA 4RL7A 4PCRA 3TYJA 2BYVE 4NAOA 4JKKA 2RS33 1UOJA 1AXKA 3JB8A 5E1RA 5J36A 2R042 5DG1A 1UN1A 1A78A 3GBGA 1UMHA 3ZYJB 4IV1A 1DGWA 4NIDA 5HI0A 2PHDA 3K48A 3FL7A 4KU7A 1TME2 2YHJA 4LO4B 2EA7A 2RM21 2JXAA 4ZS3A 3GCXA 4IEYA 1LEMA 1WGPA 1JYNA 5IAVA 2BUKA 2RS11 4FVVA 1BBT1 2VZQA 4XJAA 2AR6A 5T50A 3PLQA 3PVOA 2JX9A 2W87A 3VKLA 2ZGRA 1S0IA 4MSVA 1AYN2 5A1FA 3BTXA 4MH0E 3SQOA 2JDNA 1W05A 4ZONA 4KBZA 1XBFA 1S0JA 4ITCA 2J1TA 2GALA 2VMEA 2YYOA 3WDYA 3FHAA 1DF0A 3JD71 2ZGUA 4A42A 4FCAA 2E63A 5I8TA 4TSVA 5K8SA 2HWB1 4KU8A 4CEYA 5I8YA 1VRH1 2ES3A 2WNEA 3PUIA 4LBNA 3KWVA 5DAVA 1OOPC 4GQ7A 5D1IA 4AAPA 2CU5A 2OUHA 4XTPA 4IE4A 2YC2A 5E8AA 3ZPOA 4K40A 4ES8A 1LOAA 1RUG1 3OYWB 3C7EA 2PAEA 1VR3A 3D8CA 5LA1A 1QOTA 1ZZ7A 3N9PA 4ZXKA 2R1DA 2ERFA 5FYZA 2F6BA 1COV3 3OUHA 1IHMA 4NRMA 5DDJ3 3AX4A 4XDQA 4FTBA 3N9MA 3LEIA 3K2OA 5JSPA 1WLCA 4AHXA 3ZN5A 1H0BA 1UX7A 1Y3TA 2XL9A 5FFOC 1DQ2A 3ZFEC 2YUEA 1CX4A 2QJVA 5EQUA 2BWAA 1O91A 2WNUC 2DYCA 2W1WA 2PELA 3VDCA 1AR81 5IFPA 5FKCA 3WDXA 2ZKLA 5C3OA 1BK0A 2YFUA 3DPRC 1DQ5A 2F4PA 4KWJA 4XFGA 5F5IA 5LBCA 2ZGSA 2AGSA 4M3CE 1PO13 1S2KA 5F1RA 1H8VA 4H55A 3MZHA 3S30A 3OBRA 5LRSA 2Q8OA 2XONA 4PF1A 1OQEA 2R7EB 3O0VA 4DQAA 1ND2B 3M3CA 3WNKA 2C26A 4BQYA 3AKPA 2E7TA 1ODMA 4AOCA 3OCPA 3MF6A 4P14A 2XBO3 4AG4A 4W50A 4BQ5A 1GICA 2BFUS 2XVKA 4GALA 5FMCA 2OYZA 4W6XA 4MADA 5FZMA 3H8RA 4FOVA 4RR3A 3UGFA 1AXYA 2R061 1V6LA 4K1ZA 4EZHA 3OGGA 5CU1A 1O4TA 3JCIA 5SV5A 3WHTA 4P9YA 1PX3A 3GM8A 4QPGB 5FPLA 5JI7A 2GZWA 4BISA 4BU2A 2CGPA 3HBKA 2RR11 3VBUC 1W6NB 1UIJA 1MQTA 4AE2A 3KS7A 4O65A 1W8UA 4URTA 2WZPP 3T2PA 1KS5A 3NKGA 4LLFA 3N9QA 4GKYA 2J1VA 1BEV3 2YG0A 5IFTA 5E16A 1DCSA 3BTYA 2XDVA 4LOSA 3BPSA 2RS32 1O3RA 5JAXA 3AKQA 2FZ2A 1AJKA 2WFF1 1FATA 2E9QA 4COWA 3IAQA 2YU2A 3C8XA 1Q3EA 4V2WA 1YRZA 4AI3A 1H8TC 1WBFA 2X29A 1RHI3 2D6KA 4JGZB 3H7JA 4OMDA 4IGOA 4CPBD 2J22A 1EY2A 5BYNA 4HETA 1NA1A 2Z5WA 4AHWA 3POJA 3KQ4B 1OF4A 3RG0A 3WG4A 3SCGA 3RMXA 1GLHA 4L92A 1UAIA 2FCTA 1LB2A 5C8WA 3B00A 4QM9A 3THPA 4XFFA 5JMOA 1K12A 1PX4A 4HPKA 2DDUA 3DYMA 4N8MA 4P5YA 5IUQA 1APNA 3JBG1 1JZ2A 3K77A 4B29A 5A7OA 4L97A 2J1EA 3LSDA 2HWC1 3E6BA 3RYRA 4CSWA 1RUJ1 4Z2AA 4Y1ZA 3AMMA 1DG6A 2RJ2A 2YBKA 4AR2A 2JD9A 3CZJA 3N7LA 3LEGA 4BQXA 1GYKA 3KM5A 2JDYA 2HWF3 1DQ6A 3M1HA 3MV11 1US2A 4FPCA 1F35A 4XQ4A 4DEQA 3B02A 4UW6A 5C7GA 4NVPA 3WF1A 1YHFA 2B4KA 4AEDB 4HN0A 4YG6A 5FQ0A 1CN1A 1COV2 1JH5A 1EV13 4GH4A 3HJRA 1SFYA 3ZMNA 5DDJ2 3PURA 3AYAA 1UD1A 2ZEYA 3J8F1 5F9TA 4NROA 1P8JA 1XNDA 2V5DA 3W9AA 4YZ1A 2E6VA 1W9FA 4AI1A 5EP9A 1XC6A 4GMP3 4L0PA 3O12A 2FDJA 4HKWA 1PO12 3KB5A 5KC5A 1IPJA 2DVGA 4RS5B 4WVMA 3R4DB 3RRDA 1XYOA 2VZVA 4JGYB 1WCDJ 4RGGA 2VCCA 1CPMA 5DUXA 1SCRA 5KC6A 4LBQB 2RE9A 1EYBA 1Y9GA 3MW2A 5EJ3A 1GBGA 5JSRA 3RZGA 1CAVA 1QXJA 3ZSLA 4ZXEA 3FHQA 2XBO2 1POV3 3CLPA 4K6BA 4Y20B 1FNYA 3M2MA 4HKOA 1GR3A 1AVBA 3KV5A 4Y24A 2VZ1A 3NJZA 4YZ2A 4ZPIA 3ZYFA 3POIA 1QXRA 4JTOA 1PGW1 4Y22B 4BQ1A 2G19A 3LOBA 5A7PA 3HQRA 4QX1A 3ACLA 1NCQB 3IN9A 1C8M2 5A3UA 2IXIA 1OOPA 1UKRA 3DECA 1W2AX 5FLJA 2VCMA 3PTRB 1JW6A 3ZFGC 5KHKA 2W91A 3ZDVA 1DLCA 2GH8A 2BP6A 3BCWA 2BDRA 4QQHA 4QPGC 2ZGMA 1BEV2 1O6UA 4JQRA 5DAQA 1RUH1 3VDAA 1FAYA 3M3IA 2FDHA 4MHUA 3VD3A 3H1YA 3ZFEA 3VHRA 5FDBA 2I74A 2RMU3 1IPKA 1YLLA 4PBOA 3ZIXA 1W6PB 5T5JA 2WNUA 4P9JA 1RHI2 2JG9B 4XPVA 3N7KA 4SBVA 4Y4YA 3I3BA 3E5UA 2OX0A 4CCNA 2V09A 4R9AA 2DFCA 2BBAA 2ORZA 1AR92 2A1XA 2BJSA 5FP3A 4S2FA 3MW4A 1TZOA 5F5AA 1ZREA 3TRSB 1AR61 3FMGA 2UURA 3ZYBA 2EF6A 3CU7A 2XHKA 4YG0A 4YW7A 4BLJA 5B4XA 1QGLA 5AC91 2EIDA 1NZCA 4JGZC 5FP9A 4DO0A 2VBDA 4H3WA 3DV8A 2IXCA 2VMIA 4ZZ5A 2GP3A 3AMQA 4UI9L 2C1FA 3BN6A 1YIFA 3UK9A 4XF9A 4UFMA 4R4XA 5A7QA 4F8AA 5ACA3 1R1A1 3KMHA 3HEIA 1SDDB 2JEMA 1W3VA 1G9BA 1AZDA 4TZDA 4RD7A 2PFWA 5H9SA 3AXEA 5FZ3A 2BU9A 1XRUA 4OLLA 2HWF2 1G9AA 1K5JA 3VBUA 2AZ5A 1S4CA 4HKLA 1ODNA 3AKRA 3KF3A 2X09A 3I3DA 1RIRA 1VAKA 1OA3A 3O5SA 2NM1A 4QX8A 5KBFA 2G9FA 3IBMA 4QPYA 3HR9A 4Q4V3 1FOD3 4Y1UA 3EMRA 2HWE3 1SBEA 2J7MA 1CR7A 2PA7A 4PI2A 3ZYRA 5BNNC 2VZ3A 3NNGA 5LATA 4AEDC 4Q0VA 1HW5A 3DYPA 5HV0A 3OGSA 1UL9A 2WS93 4HANA 3PUHA 3U10A 1HIXA 1H8TA 2O1QA 1OVPA 4GJZA 1WMFA 3DN7A 4UF0B 5FMOS 3TN93 2OPKA 3UJOA 1WCSA 2ZX1A 2I2SA 2ZBJA 4E9KA 3ZKYA 2VOXA 4AZZA 4A45A 2FZ1A 4RQPB 4Y1VA 3WXPA 4HMZA 2EAAA 4GB31 2D6NA 1V9U3 4W65A 1R083 1F5JA 1NKGA 2ARCA 3ETPA 1OLME 3LE0A 4QX5A 3UGGA 4M3CF 1XYPA 1SLAA 3QACA 4AVSA 4AXOA 5F39A 1ZZCA 3ZN4A 4XAAA 1JOPA 2ZGKA 1KJLA 4I0AA 1O4YA 3SITA 5FV3A 2ZX3A 4FBFA 2VBBA 1PIV1 2CYFA 2P6CA 3GJBA 2ZGOA 4N7UA 3VBRC 3JU9A 2WWJA 1UY1A 4LA3A 4CCDA 4LORA 5JZGB 3MFCA 2R49A 2WSVA 3H0OA 2DTWA 3JXSA 4KL1A 4MG2A 2IFWA 1W6OB 4HZFA 4QHZA 2ZOEB 2R041 4FPFA 3WNMA 5ABJC 4XJZA 3PTYA 4QDSA 3T2OA 4LUKA 2LTNA 3APBA 3TB0A 5G05L 1JMUB 1VBA1 4CU6A 5FIXA 1V6MA 5A7WB 3D6EA 1M4WA 1W2OA 3H3ZA 5FYHA 3U75A 3W21A 5A6ZA 4EROA 1GP6A 4IE6A 2JWPA 2WQZC 5FYTA 4ZKTB 4MXWB 4PF5A 2VE1A 3OYWA 1HRV3 2MEV3 1OA2A 2DCJA 3MLLA 3ZYGA 2NPIA 4XMAA 1W3XA 1AYN1 5DZEA 1XNAA 1BVP1 2GC3A 5CFDB 1BQPA 4RFRB 1KGYA 4CDWC 1SMVA 4A44A 5KXCA 2PQQA 4COZA 2MNGA 2ZHKA 3W59A 2A7AA 2X53S 2ZMNA 5LA2A 4A4AA 1F15A 5CFCB 1MS0A 3VHPA 1QQP3 1SLLA 1XU1A 3ME2A 3W58A 4QX2A 1ST8A 3VBSB 3SKVA 1D4M3 1YO8A 3HVDA 4NR1A 5BNPB 4DUXA 1XE8A 2AUYA 3PVBB 1OVSA 1VBB3 4HVQA 5C70A 2JIGA 2BQPA 5ACA2 2QBXA 2OKXA 4KG8A 2RS53 4BXFA 4LKEA 5FPXA 1SBDA 3ELNA 2GC0A 2XVLA 4MGQA 3LA2A 4Q0SA 4CXXA 5C71A 3VUOA 1ND2A 3POFA 3VBOB 2DCZA 3JQWA 5EZWA 2VNOA 5FPBA 2H0BA 4EN0A 2P17A 1XE0A 1QNYA 2CTVA 5FMDA 4BE3A 1W9SA 4MZUA 4KG0A 4R8HA 1IQAA 3ZFGA 2H6BA 1RL3A 2W08A 5IJRA 2FBEA 4LK7A 2FCVA 3IDBB 4CP9B 3SH3A 4AHYA 5BUVA 2PLV3 1ZRCA 4IESA 4QPGA 1FOD2 3K4DA 2W68A 1D4VB 1UMZA 2HWE2 2KD7A 2NP0A 3INAA 1FMD1 2VUDA 2R6QA 2EIBA 4FPHA 2LM3A 1W6NA 3WDTA 4CDXB 4BLIA 1DGRN 5LZ6A 4XACA 3B5LB 4ASLA 1K42A 4IGPA 3X29B 3IIAA 3KV9A 3DXUA 1Q8SA 3L2YA 4JCKA 2VECA 4AGRA 1HV0A 1BMV1 4H7LA 3A0NA 3WP4A 2FDFA 2WJSA 3UKNA 4QDRA 2H6CA 2XWJB 1YFUA 1WD4A 1V9U2 3RJRA 5E6HA 2UWBA 4NIIA 5GM0A 1N47A 2PAMA 1IS5A 3AMHA 3OY8B 2B46X 4JGZA 3A22A 5FK8A 1WUVA 1CIYA 2CHHA 3M3EA 2VQTA 4O7XA 4EN6B 2LROA 3LDKA 5LA0A 4L9BA 4A41A 2TEPA 4DINB 1B35B 5DUVA 3WINE 1JBCA 1SACA 4EV0A 2DF7A 2XGXA 4RQPC 4NWWA 1S2EA 4QQ2A 4XMIA 5J7MA 4BQ3A 4UXAA 5FWJA 4HONA 4UW4A 4Q0QA 2JE9A 4TLGA 2VGDA 3ETQA 3NRUA 5FO9B 5KHJA 5I0RA 1IS6A 3I2KA 5IK4A 5SV8A 5L7OB 1JZ7A 3NV4A 4HT1T 2CGOA 4NAMA 1NLSA 4XXPA 5JZGC 4FT8A 2HYXA 3BB6A 3VB9A 4COYA 5DMYA 4P5HA 4HL0A 5EV7A 2FHRA 2OT7A 5F3EA 1HRV2 1POQA 2MEV2 4FFGA 1K5MC 2BGOA 2WQ8A 4AEDA 2B42B 5FXWA 4ATFA 2QE3A 3BOPA 1W9TA 3AL6A 1YNAA 1F4AA 1CGPA 2OQ7A 3Q9OA 2ZX4A 2NN8A 3TWIA 2B45X 3VBFB 3VKMA 4DIQA 1QEXA 1ND3B 1QQP2 3FN9A 4LE3A 1ZZ8A 4Y1YA 4KWKA 3VDDB 3P3NA 4AAXA 4C0HA 1M06G 3ZXJA 4LLOA 1D4M2 1LAJA 1MS1A 1VBB2 3H9AA 1UXZA 2BTVC 1JN2P 4BYYA 2GAUA 3ZXGA 2K46A 2XLGA 2RS52 3UETA 3FX3A 5A6YA 4FAGA 5CFCC 4NMIA 2VMHA 4Q29A 1KRIA 4LBQA 3VBRA 1COV1 4LK6A 3VBSC 1O5LA 4JHTA 3UKTA 3PHMA 5DDJ1 1R64A 4J1XA 4NHXA 5FY8A 5BNPC 3VKNA 4AHZA 4Z82A 2PHFA 4Y20A 4OQ9A 2BFUL 1RITA 3NL1A 1E57A 1H30A 2BNOA 2D3SA 3UV9A 1X9TA 4TYSA 4GWMA 1AL22 5GZFA 2A6ZA 5I0SA 3ABZA 3MI8A 4XILA 2PLV2 4HFSA 4JAAA 2XJVA 4QMAA 1QJX3 4FPOB 2E7AA 1ZA4A 4UWDA 1PO11 3DKWA 3SHRA 4C1WA 1NCQA 3POSA 4M3CA 1TME3 3NQHA 2YXSA 1LODA 3WV6A 5IATA 3RSJA 5LWBA 3CEWA 4HN1A 1ENRA 5FZAA 4CUAA 1YC61 2OA2A 2W95A 1T6BX 2XBO1 5GLUA 5LEJA 4PJYA 1UKGA 1UQXA 3T08A 2XXZA 5JXIA 2XJUA 3LCPA 2ZPXA 5LA9A 3VZLA 3VHOA 4YSFA 5BY5A 2FDIA 2CAUA 4NWVA 2WL1A 5L9VA 4CDXC 4WVWA 1MEC2 3ENRA 5DXDA 1YIPA 1SLBA 1W6PA 1NCRB 2XJRA 2YMZA 2XJQA 2VUAA 2JG9A 2XLFA 1PO23 4K8FA 2DTYA 2YBSA 3NW4A 1V6NA 2VPVA 2ZCWA 4EN9B 1QU0A 1RB8G 3KLSA 1QJU3 3KVBA 4XCAA 2WNOA 1OQDA 4ET7A 1FYUA 1GOGA 4DXTA 1EP0A 2DUQA 1TMF2 1WLTA 1NLRA 3T1LA 1QNWA 1ULFA 1BEV1 1F31A 5FP7A 4PIXA 3ILNA 1CJDA 1HB4A 5HXVA 2TNFA 4LHLA 2LS6A 3HQXA 4XABA 1B35C 1RUI3 1C5IA 2CWSA 4IE5A 3UYJA 1EPWA 4IXLA 5FO7B 1L7QA 1VRBA 1QWRA 2TBVA 3I4IA 1U5ZA 4XUPA 1RHI1 1KXGA 1SLIA 3AP4A 2X10A 3MLJA 2KXLA 1GZWB 1HN0A 2CDOA 1KFUL 2TUNA 2Y33A 2ZXQA 4YW2A 4B1MA 5IYYA 5IVCA 3ZR6A 1HDKA 5FY0A 3AYCA 2R16A 1NE4A 2LUWA 3KCCA 4BA6A 1GOHA 4FP2A 4JDOA 1FI2A 1ZBA3 4IEXA 4LO6B 2JDAA 5JOXA 1PHMA 2E53A 2NMOA 3TEWA 4E8CA 4RSUA 5JWPA 4FOYA 3KHCA 1ZRFA 4CYDA 2J1UA 4IEZA 3U78A 1KJRA 1REEA 5A1LA 5FBJA 3OEAA 1BXHA 3BPZA 3MFAA 4XURA 4OHYA 2WABA 2WO1A 3N9NA 2GNMA 2YGMA 1QJZA 1W6QB 4UF0A 1UYZA 2HWF1 4FPLA 4D7SA 4LPLA 3O14A 2EXJA 4YGEA 1DIWA 1C28A 1HLCA 1ND3C 4CEWB 4U36A 1QIQA 1BLZA 3VDDC 2BERA 3HBZA 4E8DA 2C0ZA 4RQPA 3OG2A 1EV11 2VQ0A 4XUTA 4XOGA 2HLEA 1MS9A 2EIEA 2WO2A 2DVBA 4QDQA 2VW1A 2D98A 4I02A 1ULGA 4ZU4A 4OI1A 3EO6A 1SQ4A 3BTZA 4GMP1 5FLHA 1QJX2 2VJXA 2ZX0A 3RVHA 2Z2SB 4CPBA 2E26A 1I5ZA 4CUCA 5FYBA 1W8HA 5JZGA 1CZVA 1UYYA 3A7QA 2J1AA 5FPAA 4CDUB 5FAXA 4P08A 4Y5SA 5FLIA 3SH4A 1OC1A 1H2MA 2ZJCA 4Z92B 3GYDA 1W6OA 1W8TA 2C24A 2OIIA 1QH7A 1IQDC 1LULA 4H7MA 1K5MA 1LGCA 3D3AA 3MO4A 4PT6A 4R9BA 2ZAHA 1GMMA 5H9PA 4AF9A 2Y6GA 2VTFA 4AVTA 1POV1 5J09A 3POWA 1F9KA 1JYTA 5A7WA 4GA9A 3M8LA 1MVQA 4NOTA 3OUIA 1GQGA 3FFZA 1B09A 2V4VA 1EUTA 3POBA 3GZEA 2W2IA 1KS4A 2D44A 3NAPB 5DN2A 4BJ0A 4NPLA 2MPFA 4CCMA 1VBD3 3GCWA 5K4LA 4FAHA 2DVFA 1JHNA 1OD3A 1PO22 1T2XA 5CFDA 1N1VA 2ORXA 1UF2C 4IEOA 4LJHA 2WBKA 5I91A 2WFPA 5A3NA 1QJU2 3IMMA 2P34A 3WNPA 4C0BA 2D3PA 3PNAA 3W5MA 2RDRA 5CFCA 1A34A 1YQ5A 4XJUA 1CVNA 1UYXA 4BDVB 2CGNA 1NCRC 3IKWA 3VBSA 5KHIA 2D5HA 2PQSA 1RMU3 3ZPYA 5BNPA 4Q26A 1R093 1O8PA 1RUI2 2RMU1 3JZVA 1DQ0A 5GLZA 3O7OA 4ZU7A 5FK7A 1NYWA 1GWKA 1S0EA 4AQ2A 4IEVA 4GULA 1VB4A 2IWGB 2F17A 4YVSB 1GZTA 4QU2A 3AP9A 3JQXA 3KHBA 2Z79A 5FZ9A 3TOJA 3VBOA 5IVFA 4WVVA 4YZ5A 2YROA 3DYOA 3Q8EA 4FPGA 4QKDA 2I45A 1V00A 4RA0A 2WUHA 2VNRA 1VALA 2WN3A 2EXHA 4G3YC 3LWCA 4OUSA 4Z2WA 1ZBA2 3V65A 3ACHA 5FZ1A 1UZYA 1VMHA 3AMNA 5EYXA 1WWYA 4CP9A 5A32B 5GZCA 3N3HA 5ANQA 3O1SA 3ZOIA 2WDBA 4HVOA 4GD4A 5DABA 3B9CA 1F4HA 1SPPB 2DCKA 2DVAA 1N1YA 5ACA1 1CAUB 1ULEA 5FR3A 1JYVA 2PN5A 1G9DA 5CG8A 3HN1A 3KZ4C 2ZEZA 4HXCA 2V5YA 4CDXA 2K9ZA 3PIJA 1C5HA 5AVPA 5FMOL 2VZTA 3D5OA 4NRQA 4IV3B 3B9IA 2ZS6B 4QB2A 3VD5A 1C8M3 5J96B 1XNTA 4XHBA 1U5XA 3IIIA 3WW1A 3WUDA 4MLOA 5CVRA 2JDKA 1Q8OA 2DV9A 4FPKA 5JXHA 4XJ8A 2LALA 4NJ4A 5B4NA 1OPMA 2KM2A 3B3QE 4NE9A 4FPEA 4WM7B 4Y5Z0 3GHNA 3OY8A 1FOD1 4Q4V1 3M3QA 5KR7A 1K3IA 5FBZA 2HWE1 2WAAA 3BGAA 4AW7A 4D8MA 3LF7A 5JCTA 1UOBA 4CEWC 1B35A 5F3CA 1QOOA 5FYVA 2WS91 4RN5A 4FFIA 2ZHNA 3M4FA 1LR5A 4WM8B 2IUWA 2Y8KA 4Q4Y3 1OLRA 1JUHA 4XIOA 3TN91 5FZCA 4BK5A 4OQ8A 3U4SA 1UW8A 3OBZA 1H4HA 2P3JA 4WZFA 3O1RA 1C57A 2AC1A 2R32A 4DRRA 1AR93 3H1WA 5DUUA 1RC6A 1V9U1 3NNFA 3WQ0A 1LOGA 1R081 5K0UB 1GP5A 1CQ9A 2VXJA 5F3IA 4DZGA 1CZSA 4EQVA 5I0DA 3BKZA 3VZNA 1OLMA 5FYCA 2ETEA 1FT9A 2GSYA 4OCTA 5EXOA 4Y1XA 4CDUC 2XL7A 3DXTA 4FP3A 3VBHB 3ZYIB 1DQ4A 1JU3A 2YC4A 3AXDA 4GZ9A 1XSQA 2K2SA 2A6XA 3WP5A 3RWNA 3S5AA 2A5ZA 1GNYA 4LMFA 4L11A 1YQCA 5F3GA 1VBD2 3VKFC 2DURA 3VZJA 4JZRA 4MUVA 3EJKA 1C1FA 2NZ9A 3I2GA 5C9AB 4AWDA 3ROUA 1XNBA 4EN7B 5BNOB 5IWFA 3J26N 1VBC3 2XQRA 2Q1MA 2A75A 3LPFA 5T52A 3VBFA 1SHWB 1PNFA 1ND3A 3NAPC 4LR4A 2XJPA 4YYOA 3VDDA 1JZ5A 3IDAA 3AZVA 5HCFA 4OI4A 2D6PA 1DZQA 1RMU2 2ADDA 2G9ZA 4QM8A 2VD7A 1RUOA 2ILMA 4QGNA 4OYUA 5C33A 3B01A 5M0TA 4UAPA 1WLDA 1R092 3KCXA 3NV1A 5T55A 4BMBA 1U12A 2E7QA 2GN7A 1HRV1 2MEV1 4XE9A 1HKDA 4UFLA 1O5UA 3D0JA 3J4UH 3RMYA 2NLRA 5BV6A 4L8QA 5FZLA 3SLIA 3BALA 1T6GC 1S0BA 1WCQA 4IETA 1XNCA 3V64A 2R073 3ZYHA 1IKPA 4QKBA 2YPDA 1JZ6A 2SBAA 1LTEA 3NNJA 1Q8QA 4FQ4A 4YPJA 3FJSA 4WZCA 3CDZB 3ILRA 3MPPG 1GZCA 2BWCA 1D4M1 2XUEA 4X8PA 4QPIB 1XYNA 3NO8A 1X33A 2VMFA 4QKNA 1OKQA 1YUDA 1HXS2 1VBB1 3MIDA 2GNDA 3WUCA 1AR71 2BGCA 4H14A 4TXWA 4Y26A 2IVIB 2RS51 2W5FA 3UT0A 1W6MB 4FFHA 1AL0G 3N4MA 4DUWA 3S57A 5JI9A 3B7MA 1V0AA 2OQ6A 1ND2C 3CL1A 1XNKA 3K75B 2CSGA 4LQRA 4NPMA 3SXWA 1LGNA 5C3RA 5BPXA 4JRAA 3ZXFA 4M00A 4AQTA 4MXVA 3E6CC 1F5FA 2WWUA 1H9PA 4Q0PA 5FO8B 3P1IA 4LEJA 2GH2A 3O1UA 2A71A 2VNGA 2PLV1 3MF9A 3MBWA 3VL9A 4CCJA 2PYTA 2VVFA 2HEVF 5C4WB 4N90A 5JXGA 5CG9A 1NCRA 3I7DA 5FYSA 2Q8EA 2QQIA 1FNZA 1XQNA 5E88A 1O3SA 4S2DA 3T09A 2AEYA 3WDUA 1I3HA 5ANNA 1LU2A 2Q0AA 3KSCA 4E4ZA 1LU1A 3C7GA 3NJVA 1SFPA 1OHFA 1VB2A 1XB9A 1UOFA 4KQ7A 3JD73 4LBJA 1QDCA 4YGDA 2XB6C 3AZZA 4AI9A 4E2GA 1VBE3 4Q4Y2 2JDZA 2B9UA 2GMMA 4K20A 3MIEA 2WA4A 4XUNA 3AZWA 1GV9A 4YM3A 5CEHA 3HNYM 1HV1A 3ZX7A 3FUQA 3K4AA 2ZEWA 3N9LA 4UFHA 1S0FA 2PHUA 3PVNA 4O61A 1CPNA 3SISA 2VBPA 2YPJA 1FV2A 2OVUA 2JICA 2OZJA 4WM8C 2P5BA 2ZGPA 4AQ6A 4DRVA 4J1WA 1PZ8A 2BRTA 1DGLA 1GZWA 3L9JT 1AYM3 1MS3A 1HB2A 1PZ9A 2WZEA 3N7JA 1G86A 3OB8A 4JX0A 4QPWA 3T0AA 5A3OA 1DBNA 3OBAA 1SCSA 2OW4A 4XUQA 5GZGA 1ENXA 3AB0A 3Q8BA 4Q8KA 5CADA 4UBGA 5K0UC 1AR83 4OI0A 1I9RA 3RJ2X 2QDRA 4QGMA 4MHRA 1YFYA 2JDPA 1VJ2A 5FPVA 3ZSEA 1NE6A 1MPXA 4FXGB 1UZZA 1VBC2 5IK5A 4YZ3A 4LHKA 5HCBA 3VBHC 3DGTA 4CUBA 5BXXA 3KV6A 5F37A 4ISQA 5EWSA 3VD9A 2B8MA 2P6HA 1W90A 4I3GA 3ACIA 4KI5M 4TTGA 2GC1A 3OUJA 4XF3A 1O3TA 4FFFA 1UZVA 4P9LA 2GNTA 3MIBA 1W6QA 5A3WA 3LOIA 3S6PA 1VE0A 3W20A 1MS4A 2D97A 1UMIA 2WRAA 4B4QA 5GJ6A 4KWLA 4XBQA 3LB9A 2P37A 4CEWA 4R9DA 1E5HA 3PVEA 1YJKA 2ZZQA 5I0UA 4B7EA 2W52A 1MZ6A 5FOBB 4LT5A 4P02B 2R072 5C8CB 2V73A 4IDZA 4K8RB 4RYDA 1DFQA 3AVRA 1SDWA 1NXMA 3I97A 1H1MA 2P2KA 5J48A 2JDUA 3I59B 1OF3A 1H6XA 3O0WA 3GZUC 5FP8A 4DXRA 3VLBB 1G9FA 3LA7A 4QHBA 1OQ1A 1UZ0A 2NQYA 1EPZA 3GHMA 4LBLA 4A2UA 4D7YA 4QU1A 1PM7A 4RS5C 4CDUA 2BPA2 1VP6A 1RUF3 4BQWA 4INDA 3TEXA 5KXDA 5F2SA 4JGYC 4P00B 5A3LA 1BYHA 4QX0A 4K1YA 4QQLA 1W8WA 4MYEA 2VMGA 5CISA 1HX6A 4QPIC 4XXAA 3RYKA 3SNMA 4AFDA 2VL4A 4CP2A 1W39A 3WQ1A 4TWTA 2WT2A 3I2OA 2XKPA 4JRLA 2IC1A 3ZXKA 3RZLA 1YXWA 1V6KA 1X8EA 2W92A 4N7IA 5CNAA 3ZIWA 3SEEA 1LGBA 5T5LA 4BMEA 1OH4A 1QJX1 3AP6A 4DY5A 3NAPA 4RFT0 3ACGA 2YDEA 1V70A 3E1F1 4YVWB 1XPWA 5FCCA 3LZZA 2P4EA 3ES1A 1PMJX 3TAYA 1TME1 4BK4A 1H6YA 1NCQC 3CQOA 4MGSA 3VL8A 5LCWL 4W8JA 4IV1B 3JD72 3K46A 1WCKA 2WYSA 4H2AA 4W6YA 3T4VA 4YGCA 1S55A 1VBE2 5HXMA 2HWB2 3PIGA 2VTXJ 5JOZA 3PL0A 5C4WC 4Y5TA 4S2GA 4M01A 5I93A 5FY5A 1UY2A 2PMWB 4PLOA 4Q4W3 4Z07A 1RUD3 2RDSA 1RUG2 3AKSA 4COUA 4BM8A 3POYA 1W8OA 3LAGA 4AGGA 3ACFA 4N43B 3I2IA 1ASJ3 1DHKB 4UT5A 3POGA 4B3NA 2GC2A 1NQJA 2D3RA 2VMCA 1PO21 2JG9C 4YVSA 1AYM2 1DZTA 2W46A 2DCTA 1QJU1 4EE2A 3ZR5A 3VZKA 5C5TA 4FTSA 1UYPA 4Z1VA 4CEYB 5FXXA 2XUMA 4Q0UA 1AR82 2BVBA 3VD4A 4QX3A 3BYWA 4A6SA 1PVXA 2FQPA 5A32A 3PUSA 4P9XA 3HNMA 3MHZA 1MACA 1WW7A 2VG9A 4YW6A 1REDA 4AK3A 1UNBA 1OXCA 3ZN6B 1RUI1 3J7NA 4BZ4A 5KHGA 3T2QA 1YFXA 3UESA 1CAUA 1AL23 1MZEA 3OGRA 4LIUA 3MGUA 3USSA 2DU0A 1Q8PA 2DUOA 3ITQA 5A33B 4LXLA 1IS3A 5T5PA 1YI9A 3HD8B 2JECA 2DWRA 1ZBA1 3FLRA 5EFUA 1O7FA 4LA2A 3WNLA 2IZWA 5IW0A 1G6NA 3QBQA 3ZSMA 3DF0A 4XFCA 5G04L 1V6OA 4DY3A 1BCXA 2W94A 1HN1A 4XW3A 4KNCA 2DCYA 4QT6A 1NXD1 5CYYA 5FXZA 3H8XA 1S0GA 4XJ9A 1MEC3 2OZ6A 1XOYA 4Q4X3 3KV4A 4WM8A 4N53B 5LASA 2R1BA 2XWBB 2ZTNA 4GIQA 1RUF2 1W03A 2ARBA 5I0TA 1DYKA 4A7KA 4E27A 5FZBA 5FREA 3O1MA 3TEYA 1J58A 3HN3A 4G9SB 4KGQA 4DB5A 5K0UA 2Z4FA 2HEYF 4CCOA 4D94A 4ZZ8A 1TMF3 5A80A 1H2KA 2L9LA 2RS31 3VBHA 3KQRA 1X8MA 1IG0A 4IEWA 1LHOA 4EWEA 1OMIA 1YEWA 4F83A 1VPHA 5H9QA 3R4SA 4DXZA 4HK9A 4AQSA 3VKOA 4XF1A 2B5HA 1RGSA 1UU5A 4OUEA 4SLIA 1BVVA 1XJAA 2DVDA 3NV2A 4XTMA 5EJZB 2HEWF 4UYBA 5BNOA 2QDNA 2HWC2 2Q4SA 4AGVA 4IEUA 1RUJ2 4QD2A 4R52A 4CE8A 1W9YA 3GGLA 3RQ0A 1PGL2 5GZEA 1LOFC 2WAOA 4Q4W2 1GZ9A 4PHZA 4EYUA 1RUD2 2ARAA 3PMEA 3E5QA 3KT7A 4C1XA 2OPWA 2ZX2A 4Y4RA 1ASJ2 2G4IA 3OF1A 2WLQA 1VBD1 3DUIA 3FWEA 4KWUA 4ATEA 1JI6A 2EAKA 1RVF3 3CJIB 5CFDC 1IZ3A 5FP4A 1FPN3 4XFAA 4NIHA 3LDBA 3J8F2 3VN4A 4RS5A 2A3YA 4EZ4A 1OBNA 1VIWB 4JGYA 2JDMA 3V0BB 4JHZA 1LOCA 4N43C 4Q5OA 3T2TA 1G9CA 1BKZA 1PZ7A 1HB3A 5LRRA 1W8NA 3AFGA 4PQ9A 1QMJA 4QPIA 1PNGA 3NNLA 4UW3A 2JE7A 3JB4C 1R091 3QOPA 4MGKE 2QZ3A 3WF2A 3GJAA 3FBYA 3C2UA 5JLVA 5FQ0B 5HBAA 1AX1A 2O0OA 3AM2A 1W6MA 5DAPA 4IEQA 5D21A 4QXBA 2VULA 2LRPA 5ISLA 3H3LA 4D6QA 1LEDA 4A3XA 1KD7A 4Y22A 3I49A 1G8WA 2XR4A 3VBOC 3A23A 2X5IB 1W2TA 3K3NA 2OS2A 3BIWE 5C3QA 5JPMB 5DPNA 3KD4A 4XF0A 1HQNA 2ZGTA 2FDGA 1JU4A 2RHPA 5FYUA 4ZHNA 1ZRDA 5IVJA 4QXCA 2CY6A 3H3UA 3ZM8A 1WD3A 1WA4A 4FXKB 4XZPA 3EXUA 5C4WA 4LO5B 2A70A 5EJ1B 5JOWA 3UKVA 4Q1RA 1F8VA 2A6VA 3NKTA 4AFAA 1Q5OA 1LJ7A 2QKDA 4TN7A 4JKLA 4CUGA 3LSEA 3BOWA 4YLZA 3ZDSA 2BOIA 2QQMA 4GKXA 3ZXLA 1JZ4A 5EHDA 4LKSA 4Q4X2 4ZY9A 3HNBM 3TEZA 1Y4WA 1W0OA 5LW9A 1RYYA 1Y43B 2J1SA 2VO5A 3OD0A 5FZ7A 3VHNA 1C8M1 2EXIA 2ZACA 2E51A 5FXVA 3T0DA 2VC9A 3R0RA 3WSOA 2C9KA 4TLFA 5T3NA 2VTXA 4BIOA 2Z42A 3HT1A 2G9GA 2QNKA 2I07B 1J84A 4N53C 1Y9QA 4R9CA 2EICA 4DXSA 5JOYA 4XAEA 3GF6A 3H7YA 3KT1A 2AEZA 2ZABA 3CBNA 5JXJA 3WDVA 1AR62 4YZ4A 2E33A 1OI6A 4QB6A 3ZVXA 1AHSA 5AC92 3BTAA 3AC0A 4Q4Y1 4DUVA 5BNQA 2QUOA 5L73A 1QJY3 3BU0A 4L99A 1ZVFA 1LHWA 2FCUA 1SLCA 2IFRA 3WG1A 2VZPA 1AR91 3AZXA 5F32A 2VOKA 3H8UA 3MYXA 1IGOA 4LE4A 1CWPA 3ZLIA 3SEPA 2XPJA 1WA6X 4AVAA
chains in the Genus database with same CATH topology
2VUDA 5A6YA 2WR9A 2JDMA 4AOCA 2BV4A 1OURA 5A3OA 2JDNA 2WRAA 4CE8A 5A70A 2JDHA 5D2AA 1UQXA 1OVPA 2JDPA 3DCQA 1OXCA 2BOIA 1GZTA 1W8FA 1W8HA 2BOJA 2JDYA 5A6QA 4UT5A 3ZDVA 2JDUA 2BP6A 2XR4A 1OUXA 2JDKA 2VNVA 2CHHA 2VUCA 5A6XA 5HCHA 5A6ZA 1OUSA 1OVSA 1UZVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VUD A;  5A6Y A;  2WR9 A;  2JDM A;  4AOC A;  2BV4 A;  1OUR A;  5A3O A;  2JDN A;  2WRA A;  4CE8 A;  5A70 A;  2JDH A;  5D2A A;  1UQX A;  1OVP A;  2JDP A;  3DCQ A;  1OXC A;  2BOI A;  1GZT A;  1W8F A;  1W8H A;  2BOJ A;  2JDY A;  5A6Q A;  4UT5 A;  3ZDV A;  2JDU A;  2BP6 A;  2XR4 A;  1OUX A;  2JDK A;  2VNV A;  2CHH A;  2VUC A;  5A6X A;  5HCH A;  5A6Z A;  1OUS A;  1OVS A;  1UZV A; 
#chains in the Genus database with same CATH topology
 2ZHM A;  5A1A A;  3SMH A;  3ZSJ A;  4CA9 A;  5L7O C;  3DPR B;  2BGP A;  1LEN A;  4PI0 A;  5KXB A;  4XF4 A;  1AX0 A;  4NIG A;  4E4D X;  1NG0 A;  3LGR A;  1GKB A;  1UY3 A;  5FPU A;  1GNZ A;  4YNI A;  3C7O A;  3VGI A;  1NX9 A;  1WLW A;  1X82 A;  2XG3 A;  4IE0 A;  4RGK A;  3IMN A;  3M70 A;  1IOA A;  4LUL A;  4L2N A;  3WQ7 A;  4OUL A;  3FFQ A;  2ZGQ A;  2RV9 A;  1RUN A;  2EXK A;  3ZXD A;  1RVF 2;  2CL2 A;  1Z7S 3;  5IVV A;  1FPN 2;  1VBC 1;  2YGL A;  5I8S A;  4D7T A;  2WLP A;  3MIG A;  3HT2 A;  3T1M A;  1RUC 3;  3VBF C;  4CTE A;  1WW6 A;  4NHY A;  5A3M A;  4Q1P A;  4XHX A;  3S0M A;  4FI9 A;  1CAW B;  5IK8 A;  3OD4 A;  5H9R A;  3I59 A;  2C9A A;  5C6C A;  2ATF A;  3G7D A;  3CJI C;  1GWM A;  4EN8 B;  1W9W A;  1H1A A;  1DGW X;  1KIT A;  2ET7 A;  2YY1 A;  3Q8C A;  3ZKU A;  1SLT A;  3KVA A;  4GB3 2;  4BQ2 A;  1US3 A;  3MPB A;  5FYY A;  3WNO A;  1PGS A;  1PVC 3;  2VVD A;  1BHG A;  5L19 A;  2QVS B;  2FMD A;  1W0N A;  1QXP A;  2R07 1;  3WF3 A;  1UU6 A;  2F4L A;  4V1P A;  2PHX A;  2RG4 A;  3CKH A;  4W6W A;  3PU8 A;  1ZZB A;  1LRH A;  1PIV 2;  4CDQ C;  1XU2 A;  4CCK A;  2WNV B;  1JYI A;  4XUO A;  1HQW A;  4M4R A;  3MIF A;  4LBQ D;  4QXH A;  5F5C A;  3WY6 A;  2IVJ A;  2ZGN A;  4E4S A;  2C5D A;  1DYP A;  3ECQ A;  3U14 A;  4YVW A;  4D3W A;  1MVE A;  4P9I A;  5K7P A;  1AUY A;  1LOF A;  2X5I C;  1N1T A;  2NYY A;  5FZO B;  3ES4 A;  4R4Z A;  3IWZ A;  4C8D A;  3RNS A;  2Y64 A;  2Y60 A;  4JDM A;  4CVU A;  2HJI A;  3WW4 A;  1CES A;  4MXW A;  3T0B A;  1VBA 2;  2FMY A;  3S7E A;  4B4P A;  2KA3 A;  2GMP A;  5FZE A;  4GMP 0;  1O8S A;  5A7S A;  4XDO A;  1QKQ A;  3AP7 A;  2XJS A;  2Z69 A;  4ARY A;  2Q1Z B;  2ZKN A;  3WCS A;  5FY9 A;  1GQH A;  1BK1 A;  5FWE A;  5A3P A;  1J1T A;  3J9S A;  2VAU A;  3IM0 A;  4KH9 A;  2VOV A;  4ES9 A;  1YQ2 A;  1UWW A;  4N43 A;  3MUY 1;  5FZ8 A;  3RPQ A;  1W2U A;  1WBL A;  3AMP A;  2AYH A;  3HIF A;  5K9Y A;  2DU1 A;  2UWC A;  3CHX A;  4CDQ B;  1WKY A;  1POV 0;  3I8T A;  4XIK A;  3H50 A;  1LES A;  1Q8V A;  2RDN A;  4IE7 A;  1IPS A;  1TNR A;  1VLN A;  1VBE 1;  1ZBE 3;  4G4F A;  1OA4 A;  5JUV A;  2YZ4 A;  1QJY 2;  1U0A A;  2XLA A;  2GU9 A;  2WZR 3;  4QAW A;  5CZK A;  1H2L A;  4GXL A;  2GNB A;  2ZZJ A;  2O14 A;  3G6J B;  3WOG A;  3RZM A;  3BI3 A;  5L9B A;  3ZN6 A;  3JUU A;  3RDI A;  3WP3 A;  2BZD A;  4KGG A;  1E5S A;  1YI7 A;  4LIV A;  4A6O A;  2VVE A;  3EB7 A;  1AYM 1;  1RUE 3;  5IVE A;  4AEK A;  3ALQ A;  5JDB A;  2Q30 A;  2WA3 A;  1QY4 A;  1HXS 3;  5A33 A;  2VQU A;  3P5B A;  1NOV A;  2VU9 A;  5GLW A;  4WVZ A;  1R1Z A;  3BVC A;  5JVV A;  3E97 A;  4MGI E;  5KHH A;  1ZRI A;  1QDO A;  3IAP A;  1YFW A;  3QH6 A;  4E2Q A;  3AVS A;  1C1L A;  2Q5T A;  1Z7S 2;  5JIU A;  4BWO A;  1HRI 3;  3ZO0 B;  2HWD 3;  2C6S A;  2VUJ A;  1ZM1 A;  4QXK A;  1WCU A;  1QJF A;  1FMD 2;  1RUC 2;  3KT4 A;  1LHV A;  2WC2 A;  1W2N A;  4OHV A;  3RI8 A;  1DZR A;  2W1U A;  3RZK A;  1A8M A;  4YW1 A;  1KEX A;  2XKO A;  4J6G A;  1PK6 B;  2D6L X;  1RJ7 A;  4OFG A;  4AFC A;  1H9W A;  4BCU A;  1BMV 2;  1RXG A;  4N53 A;  2WT0 A;  4GAZ A;  3ZFG B;  1MZ5 A;  3GAL A;  3MLK A;  5CKN A;  1QH6 A;  2Y6K A;  3I2H A;  1E5R A;  2ZHL A;  4RHV 3;  1D0G A;  1W8Z A;  1PVC 2;  3U4X A;  4PLM A;  3O1O A;  3WW2 A;  1VAM A;  3MV0 1;  3DEM A;  3ATG A;  4DPN A;  1YYN A;  2YV8 A;  1GP4 A;  1SBF A;  1RJ8 A;  3THD A;  1JYX A;  4YG3 A;  1Y9M A;  4LTA A;  4MGT A;  1S0D A;  2JB4 A;  2Y34 A;  2P1B A;  5KXE A;  3BUC A;  2IXL A;  3AFK A;  2VUC A;  3CO2 A;  4XCB A;  5FRA A;  4EWA A;  1IKQ A;  4HSL A;  3WX5 A;  5L7O A;  4CP0 A;  2VW2 A;  3WHU A;  3CZU A;  3R05 A;  1OPO A;  1RUF 1;  4MOA A;  3U11 A;  2IXK A;  2ARE A;  2Y6L A;  3PDQ A;  3F2Z A;  1EAH 3;  2WNV C;  1TEI A;  3RZJ A;  5FZF A;  3B69 A;  3WG3 A;  1OSG A;  2VZR A;  4NUB A;  5C3S A;  2W39 A;  1D2S A;  4IUG A;  4LBO A;  5J37 A;  1JUI A;  5DAX A;  1IS4 A;  1YCI A;  1SZB A;  2N7G A;  1VMF A;  3H1M A;  4HBN A;  1DP0 A;  2Y6F A;  3D4K A;  4HSJ A;  4Y33 A;  5FZH A;  2BOJ A;  1BJQ A;  3PUA A;  4QB1 A;  3ZFF B;  1LOE A;  1OLQ A;  1A6C A;  1L7R A;  1O4Z A;  4CU8 A;  2HH9 A;  3J7H A;  1S1A A;  4GWN A;  3NVC A;  3DKQ A;  4XBL A;  5CIR A;  1C3H A;  1FV3 A;  2W9X A;  3OPT A;  3IPV B;  1CIW A;  3DL3 A;  3NST A;  3ORJ A;  4N9H A;  2JIJ A;  3AJZ A;  2WR9 A;  3D0S A;  3AJY A;  3I2D A;  2E32 A;  2WN2 A;  3M7A A;  3CJI A;  2RJL A;  1JXN A;  1S0C A;  5FYI A;  1CD3 G;  2AH2 A;  2Y38 A;  5DAW A;  1VMJ A;  4EWD A;  4D69 A;  1GQP A;  5LEK A;  2Y26 A;  1ZBE 2;  2E31 A;  3V0B A;  1MZF A;  1PGL 1;  2VCB A;  1X9P A;  5B2G B;  2WZR 2;  2V72 A;  2WKK A;  1GWL A;  3FZ3 A;  4Q4W 1;  3K51 A;  1UY0 A;  3ZXE A;  1RUD 1;  3AYD A;  5BNN B;  2FD8 A;  1TQ5 A;  1CAX B;  4FOQ A;  5FYM A;  4Q8L A;  4CDQ A;  1QQP 1;  3N9O A;  1WME A;  1ASJ 1;  4JTN A;  4E2S A;  2D7F A;  3VV1 A;  1KDM A;  3LA3 A;  2YFZ A;  1RUE 2;  2JG8 B;  4YVS C;  1YQ6 A;  4K9S A;  1OKO A;  3FC0 A;  1KQR A;  1J3P A;  1OUR A;  2DBI A;  1D0H A;  1ZYB A;  1EUU A;  1WW5 A;  2WYF A;  2X5I A;  3OJB A;  3THT A;  3MIH A;  4OMC A;  4QHO A;  2A6W A;  4PDW B;  2WQ4 A;  2VZS A;  3O0X A;  4I30 A;  4I0B A;  4QX7 A;  4PBP A;  4A7Y A;  3QCW A;  1HRI 2;  5D8A B;  2HWD 2;  4OZO A;  1ULD A;  4MGZ E;  3LPG A;  4U2A A;  2RM2 3;  1IG3 A;  2HBT A;  4UFI A;  1GSL A;  1AL2 1;  4NIA A;  3VBR B;  2WIN B;  2RS1 3;  1BBT 3;  4AI2 A;  2PAK A;  2UY8 A;  3MEP A;  3WEZ A;  2WSU A;  3U1X A;  1KFX L;  5HCA A;  4EJR A;  5A7N A;  4ONU A;  2HYK A;  4IV3 C;  3K3O A;  5LY2 A;  1J1L A;  5IVB A;  4HVR A;  4W4Z A;  5ABJ B;  5AFE A;  4RHV 2;  5FJK A;  1GNH A;  1I6X A;  1LHN A;  1SFN A;  3A4U A;  4NHL A;  1PK6 C;  2R0H A;  3OTF A;  3H8O A;  2IXJ A;  3NWK A;  4M3C B;  2HWB 3;  1VRH 3;  4WM7 C;  1UPI A;  2ZEX A;  3WR0 A;  4HLT A;  4OHW A;  1RUG 3;  4CXY A;  2VXR A;  1FXZ A;  5CBL A;  1MEC 1;  4MX3 A;  3I2F A;  1LHU A;  4Q4X 1;  4YWA A;  2JEN A;  3SC7 X;  4CDW B;  2GP5 A;  1PMI A;  1W28 A;  2MHF A;  4IGQ A;  3KCY A;  4K21 A;  5JSO A;  2OUJ A;  3UNP A;  2SLI A;  1EAH 2;  3CNA A;  4BPZ A;  4ASK A;  3PJY A;  2BNM A;  1X50 A;  5DZG A;  1OD5 A;  1RTV A;  1N3P A;  1TMF 1;  2PHL A;  3B94 A;  3OPZ A;  3V56 A;  3V0A B;  3DPR A;  4XZU G;  1W99 A;  1Z78 A;  4I2O A;  3S5Q A;  4AEJ A;  5C3P A;  1U5I A;  5EPA A;  1W06 A;  1NY7 2;  2B39 A;  2C4X A;  2QCS B;  3B93 A;  5GLV A;  2O8O A;  2A3W A;  5KWR A;  4NRP A;  3GBF A;  1CZT A;  3GZA A;  5J1X A;  2VMD A;  3O1V A;  5D2A A;  3HMY A;  1UX6 A;  2AEN A;  4IW3 A;  2HBU A;  5C9A C;  1JYW A;  1N3Q A;  3ZFF C;  2VH9 A;  5BNO C;  1YJL A;  5FY7 A;  1TNF A;  2YB7 A;  4OI2 A;  1NAE A;  2W47 A;  4NHM A;  4V2V A;  5ERL A;  3BIE A;  2R06 3;  3AZY A;  4DFS A;  1CON A;  2RVA A;  1CAW A;  2UU8 A;  2W1Q A;  4HG6 B;  3BU7 A;  3MUZ 1;  2VZO A;  5FY4 A;  4AI0 A;  2UY9 A;  1U5Y A;  3DCQ A;  4BQ4 A;  3I3E A;  5LBB A;  1Q43 A;  2QZ2 A;  1V6I A;  3FBM A;  2RR1 3;  4BIF A;  3OBT A;  4BHP A;  2XML A;  1A3K A;  4CU9 A;  5IT6 A;  4JQT A;  1EV1 2;  2D93 A;  4NN0 A;  2Q8D A;  4P9G A;  3HPN A;  4BXS V;  1RVF 1;  3KGL A;  1FPN 1;  3NV3 A;  2VW0 A;  3ASI A;  3NJY A;  3PU3 A;  3PMS A;  4IQP A;  4XQD A;  5J3U A;  4B8E A;  2BVV A;  3WNX A;  4B4R A;  2D5F A;  2WFF 3;  3WLU A;  4DMI A;  1JZ8 A;  3USU B;  2WNV A;  4AFB A;  4QQP A;  5CKQ A;  5FZG A;  3O1T A;  1TVG A;  2JG8 C;  2W0X A;  3WCR A;  3CJX A;  3QLQ A;  1AXZ A;  2K0G A;  2RM2 2;  5FMB A;  3P3P A;  2JKX A;  5LK5 A;  5FZO A;  3T3Y A;  5FOJ B;  5F8P A;  3AP5 A;  5HV4 A;  2RS1 2;  4XFH A;  1BBT 2;  1DLL A;  2XH6 A;  5LBE A;  1GFF 2;  3FHI B;  2UYB A;  4PDW C;  4XQW A;  1J3Q A;  4BB3 A;  2VNV A;  4CCL A;  5D8A C;  1NUK A;  3T4H B;  3LDR A;  3GDB A;  3J7L A;  2DBN A;  4C91 A;  2XHN A;  1HB1 A;  3N36 A;  1CX1 A;  3MIC A;  2XQX A;  3UGH A;  5L36 A;  5IHR A;  2ZAA A;  1F2N A;  1H4G A;  2HKX A;  3H42 B;  3JBG 3;  3GBW A;  4O9G A;  3C7H A;  2BNN A;  2O8Q A;  2HWC 3;  1REF A;  1I5P A;  1JS9 A;  1RUJ 3;  3OOX A;  1X36 A;  2IXH A;  4MO3 M;  4UBH A;  2CWM A;  1VRH 2;  4YFW A;  3WVJ A;  3J7M A;  4PIY A;  4XET A;  3Q8F A;  1GU3 A;  2UYA A;  1NQD A;  1K5M B;  2Y6J A;  1JYC A;  1SEF A;  3VDB A;  1TE1 B;  4DEV A;  3CIH A;  3VZO A;  1UY4 A;  4KBB A;  3IDC B;  2LW8 A;  3FLT A;  5FUN A;  1ZA7 A;  4CU7 A;  1CJP A;  4I01 A;  4F3J A;  1N1S A;  2RMU 2;  3NMB A;  4ISR A;  4LHS A;  3J8F 3;  3M3O A;  2JB8 A;  1Q56 A;  4XBN A;  1UOG A;  4NO4 A;  5A70 A;  1V6J A;  5IVY A;  5LY1 A;  3WDW A;  4GWJ A;  2PXJ A;  4LKD A;  3RI9 A;  2D6M A;  4AVB A;  5EIY B;  1ZRR A;  4YM0 A;  5APA A;  2QFE A;  3IZO A;  1URX A;  4I3P A;  2J42 A;  1QHD A;  4LBK A;  5F2W A;  5GKA C;  1SPP A;  5EYY A;  1W8F A;  2CAV A;  4UOJ A;  1WMX A;  4IER A;  5CB7 A;  2V4A A;  4AVC A;  1LEC A;  3FLP A;  1DGR A;  5J98 B;  3ST7 A;  1GAN A;  1QJY 1;  4YRD A;  2WT1 A;  2QTW B;  3F95 A;  4LO7 A;  4E4H A;  5AFB A;  2QQP A;  2VR4 A;  4LNV A;  2FDK A;  4GJY A;  4LKF A;  1AR7 3;  4IV3 A;  5FZ0 A;  1RIN A;  4JKM A;  4XC9 A;  1X7N A;  1NLQ A;  4F7Z A;  1L3J A;  2DFB A;  2P3K A;  2R06 2;  4GWI A;  2QQO A;  4DOU A;  5FJH A;  4PLN A;  1H2N A;  3RZH A;  1PK6 A;  1ZZ6 A;  2QQK A;  3FE5 A;  3K4Z A;  2EVX A;  4WM7 A;  2RR1 2;  5F6K A;  2D40 A;  3POE A;  4D6S A;  3LKJ A;  1HJG A;  3R6S A;  3RFR A;  2VY0 A;  3SH5 A;  4B7K A;  2YC0 A;  4URA A;  1Z7S 1;  4AFM A;  3CMG A;  4XDP A;  4Q4V 2;  2QQN A;  4S2H A;  5C8C C;  1RUH 3;  1BZW A;  2GN3 A;  1RUC 1;  4XJW A;  4CZS A;  4RR3 B;  2JE8 A;  3SCF A;  2WFF 2;  4YGB A;  5FKB A;  3ZMO A;  2WS9 2;  4ZS2 A;  3UL2 A;  2D6O X;  1LNS A;  3ZXA C;  4Y3O A;  1UU4 A;  3TN9 2;  4Q2F A;  5FUI A;  3EQE A;  3KF5 A;  3E6D A;  4X8N A;  3O1P A;  2RJK A;  4XFB A;  3ZSK A;  5JR2 A;  1MQT B;  4OHZ A;  3THC A;  4OVE A;  5TSW A;  4LIT A;  3Q8A A;  1HQL A;  1R08 2;  2ENR A;  4CCC A;  1PVC 1;  1AR6 3;  1XE7 A;  4CCE A;  2Y0O A;  3HAG A;  4YW4 A;  1Y7B A;  2QQV A;  4JVA A;  4LO8 A;  3CF6 E;  5AC9 3;  1L7L A;  4WV8 A;  5FZ4 A;  2Q8C A;  2B9V A;  4OUM A;  4COV A;  3HOB A;  1UIK A;  5C9A A;  5DZF A;  1OUS A;  1Z0H A;  3ZFF A;  3JBG 2;  1ENS A;  1KDK A;  1O59 A;  5IAX A;  2WII B;  1R1A 3;  4P9W A;  1E5I A;  3LFI A;  2EIG A;  4AVV A;  5FY1 A;  1STM A;  4YVW C;  3IPV A;  3T30 A;  5FPZ A;  4MV2 A;  1NA1 B;  2P3Y A;  3VZM A;  4Z8B A;  1UCX A;  2RDQ A;  4FPY A;  2A6Y A;  4LOT A;  2XVG A;  2WZ8 A;  2CDP A;  1NT0 A;  1OFS A;  3AKT A;  3D82 A;  1ALY A;  1K45 A;  2JJ6 A;  2X8K A;  4IV1 C;  3I3M A;  1O3Q A;  1SG3 A;  3PUQ A;  2Q1F A;  4HOO A;  3WF0 A;  1YWK A;  4HPK B;  3WT3 A;  5T54 A;  2VZU A;  2BBV A;  3IB3 A;  3LD8 A;  2H0V A;  1ACC A;  2PHT A;  5HCH A;  3RGB A;  5BNN A;  4M0N A;  3EBR A;  1XXN A;  3LEM A;  4LBM A;  4XVH A;  5GAL A;  4PQQ A;  5L9R A;  1CAX A;  3IT8 A;  3TBD A;  5DG2 A;  3S7I A;  2J1R A;  3IDE A;  2DUP A;  4OHX A;  2PTM A;  3WG2 A;  3KGZ A;  3ZYP A;  2PHR A;  3LIH A;  5FTT C;  4FTE A;  4A3Z A;  5FZK A;  1RXF A;  1ULP A;  1RMU 1;  2JG8 A;  3AYE A;  4QGL A;  2WWS A;  4YW3 A;  2VOT A;  1JTZ X;  4JDN A;  3A21 A;  4FSJ A;  4J25 A;  1LKN A;  4FO9 A;  1JOD A;  4UW5 A;  4WBB A;  4X6R B;  1PMH X;  4QKF A;  5CKM A;  3WW3 A;  2OXB A;  1JOB A;  1ZBE 1;  4A7Z A;  4GH4 B;  1UZW A;  4GB3 3;  4PDW A;  2JKB A;  2VOW A;  2WO7 A;  5AVA A;  4CEY C;  2PHW A;  5FZD A;  2WZR 1;  2VM9 A;  3LIG A;  1G7Y A;  5A3T A;  2XJT A;  4K7J A;  1DQ1 A;  5D8A A;  3C3V A;  1TG7 A;  1OUX A;  1AR7 2;  1D7P M;  1S2B A;  2QQW A;  3P6B A;  1XSR A;  3ON7 A;  1J3R A;  2QQL A;  1PIV 3;  4OZX A;  3A0K A;  1MR5 A;  2BV4 A;  3LFM A;  3W5N A;  1GOF A;  3TNP B;  1LCL A;  1PGW 2;  1RUE 1;  1ZNP A;  4AI8 A;  4DS0 A;  3I54 A;  4WVM B;  5DQ0 A;  1HXS 1;  3OPW A;  4AL9 A;  5JMC A;  4RGA A;  3WQB A;  2W3J A;  4LHN A;  3U0Z A;  3L2H A;  2R04 3;  3TNQ A;  5ABJ A;  1H1I A;  2AAC A;  1J59 A;  4PIZ A;  1QJE A;  1CAV B;  1A8D A;  2R0F A;  2D43 A;  4M4P A;  5F6L B;  5FUP A;  4AYU A;  5HPO A;  1HRI 1;  4XFI A;  2HWD 1;  1QF3 A;  1VBA 3;  3LEK A;  2CV6 A;  1RUH 2;  1OFN A;  1DU3 D;  1C8N A;  1WZX A;  5JIA A;  3U37 A;  4QWN A;  1WW4 A;  2JD4 A;  1J83 A;  2P3I A;  4IEP A;  3VD7 A;  4YW5 A;  4NHK A;  1NZI A;  2Y6H A;  4UFJ A;  4IL7 A;  1AYN 3;  4JV4 A;  2NMN A;  4CDW A;  1ULC A;  4K3U A;  1OOP B;  3EHK A;  3QD6 A;  4MET A;  3RS6 A;  2W1S A;  2ZML A;  3GNE A;  4X6Q B;  1DYO A;  4RR3 C;  4N9I A;  4NPR A;  4RHV 1;  4HK8 A;  4CRQ A;  2B7Y A;  3URF A;  2G1M A;  4LUM A;  5FZI A;  3WD5 A;  3RYP A;  5A6Q A;  4MGY E;  4XYX A;  3V0A A;  2ADE A;  1GUI A;  1W0P A;  3OEB A;  4FOW A;  3HWJ A;  3WNN A;  3ILF A;  4XEZ A;  2X05 A;  5C5U A;  1MQT C;  3ZFE B;  5A6X A;  4YM1 A;  2R30 A;  1ZZ9 A;  1ZX5 A;  1R1A 2;  4ARX A;  4YM2 A;  2WNU B;  3I2J A;  1MS5 A;  3WP6 A;  3BOD A;  1UO9 A;  2ZA9 A;  4D6R A;  4O9E A;  1VAV A;  4UFK A;  4ZU5 A;  2BEO A;  2GDF A;  4Q27 A;  3QH7 A;  5GLT A;  5F5Q A;  1DDL A;  1W04 A;  1AF9 A;  1EAH 1;  5JPN B;  4CP1 A;  3N35 A;  2ZMK A;  5T5O A;  4ASM B;  3MDP A;  3NNM A;  3FUO A;  4YFZ A;  2Y0I A;  2KR2 A;  1PM4 A;  5DUW A;  2ET1 A;  3AK0 A;  1NA1 C;  2A73 B;  3WF4 A;  3RWK X;  5CA6 A;  4C90 A;  2VCA A;  2A3X A;  3GXU A;  5C8C A;  2QQJ A;  5IK7 A;  3PJQ A;  1D2Q A;  5LK7 B;  1LOB A;  1NY7 1;  1FMD 3;  2CNA A;  2VQA A;  2WO3 A;  4M0H A;  3OGJ A;  5JR7 B;  4AEM A;  3I3Q A;  3OGV A;  4I0W B;  4I09 A;  4QQO A;  1YQ8 A;  3SKJ E;  2BW8 A;  3AL5 A;  1AX2 A;  3E5X A;  4D0Q A;  1OT5 A;  2YU1 A;  1C4R A;  1HJF A;  3VBU B;  5FZ6 A;  1JZ3 A;  1ENQ A;  4FPJ A;  3C7F A;  1QOS A;  2EAL A;  3OSD A;  3GZT B;  3USU A;  3MW3 A;  3EYP A;  5E89 A;  2QQU A;  3R4U A;  5LB6 A;  1OH3 A;  3RZZ A;  5CAZ A;  3HQU A;  4ORF A;  1JOJ A;  1MS8 A;  2ARX A;  2YBP A;  3LQC A;  5GZD A;  3UJQ A;  1I1E A;  1UXX X;  4CXW A;  3U07 A;  4BOW A;  2UWA A;  2ID4 A;  4MVT A;  5LBF A;  2XOM A;  1JHJ A;  1AJO A;  1UPS A;  3N7M A;  2GME A;  1WMD A;  4KMQ A;  4GH4 C;  1ONA A;  3NJX A;  1H8T B;  4BH9 A;  3WZ1 A;  4JC1 A;  3SCH A;  4YAR A;  1FX5 A;  1ULO A;  2ZGL A;  4FQZ A;  4B1L A;  4DNY A;  5F7U A;  1N3O A;  2JDH A;  4RL7 A;  4PCR A;  3TYJ A;  2BYV E;  4NAO A;  4JKK A;  2RS3 3;  1UOJ A;  1AXK A;  3JB8 A;  5E1R A;  5J36 A;  2R04 2;  5DG1 A;  1UN1 A;  1A78 A;  3GBG A;  1UMH A;  3ZYJ B;  4IV1 A;  1DGW A;  4NID A;  5HI0 A;  2PHD A;  3K48 A;  3FL7 A;  4KU7 A;  1TME 2;  2YHJ A;  4LO4 B;  2EA7 A;  2RM2 1;  2JXA A;  4ZS3 A;  3GCX A;  4IEY A;  1LEM A;  1WGP A;  1JYN A;  5IAV A;  2BUK A;  2RS1 1;  4FVV A;  1BBT 1;  2VZQ A;  4XJA A;  2AR6 A;  5T50 A;  3PLQ A;  3PVO A;  2JX9 A;  2W87 A;  3VKL A;  2ZGR A;  1S0I A;  4MSV A;  1AYN 2;  5A1F A;  3BTX A;  4MH0 E;  3SQO A;  2JDN A;  1W05 A;  4ZON A;  4KBZ A;  1XBF A;  1S0J A;  4ITC A;  2J1T A;  2GAL A;  2VME A;  2YYO A;  3WDY A;  3FHA A;  1DF0 A;  3JD7 1;  2ZGU A;  4A42 A;  4FCA A;  2E63 A;  5I8T A;  4TSV A;  5K8S A;  2HWB 1;  4KU8 A;  4CEY A;  5I8Y A;  1VRH 1;  2ES3 A;  2WNE A;  3PUI A;  4LBN A;  3KWV A;  5DAV A;  1OOP C;  4GQ7 A;  5D1I A;  4AAP A;  2CU5 A;  2OUH A;  4XTP A;  4IE4 A;  2YC2 A;  5E8A A;  3ZPO A;  4K40 A;  4ES8 A;  1LOA A;  1RUG 1;  3OYW B;  3C7E A;  2PAE A;  1VR3 A;  3D8C A;  5LA1 A;  1QOT A;  1ZZ7 A;  3N9P A;  4ZXK A;  2R1D A;  2ERF A;  5FYZ A;  2F6B A;  1COV 3;  3OUH A;  1IHM A;  4NRM A;  5DDJ 3;  3AX4 A;  4XDQ A;  4FTB A;  3N9M A;  3LEI A;  3K2O A;  5JSP A;  1WLC A;  4AHX A;  3ZN5 A;  1H0B A;  1UX7 A;  1Y3T A;  2XL9 A;  5FFO C;  1DQ2 A;  3ZFE C;  2YUE A;  1CX4 A;  2QJV A;  5EQU A;  2BWA A;  1O91 A;  2WNU C;  2DYC A;  2W1W A;  2PEL A;  3VDC A;  1AR8 1;  5IFP A;  5FKC A;  3WDX A;  2ZKL A;  5C3O A;  1BK0 A;  2YFU A;  3DPR C;  1DQ5 A;  2F4P A;  4KWJ A;  4XFG A;  5F5I A;  5LBC A;  2ZGS A;  2AGS A;  4M3C E;  1PO1 3;  1S2K A;  5F1R A;  1H8V A;  4H55 A;  3MZH A;  3S30 A;  3OBR A;  5LRS A;  2Q8O A;  2XON A;  4PF1 A;  1OQE A;  2R7E B;  3O0V A;  4DQA A;  1ND2 B;  3M3C A;  3WNK A;  2C26 A;  4BQY A;  3AKP A;  2E7T A;  1ODM A;  4AOC A;  3OCP A;  3MF6 A;  4P14 A;  2XBO 3;  4AG4 A;  4W50 A;  4BQ5 A;  1GIC A;  2BFU S;  2XVK A;  4GAL A;  5FMC A;  2OYZ A;  4W6X A;  4MAD A;  5FZM A;  3H8R A;  4FOV A;  4RR3 A;  3UGF A;  1AXY A;  2R06 1;  1V6L A;  4K1Z A;  4EZH A;  3OGG A;  5CU1 A;  1O4T A;  3JCI A;  5SV5 A;  3WHT A;  4P9Y A;  1PX3 A;  3GM8 A;  4QPG B;  5FPL A;  5JI7 A;  2GZW A;  4BIS A;  4BU2 A;  2CGP A;  3HBK A;  2RR1 1;  3VBU C;  1W6N B;  1UIJ A;  1MQT A;  4AE2 A;  3KS7 A;  4O65 A;  1W8U A;  4URT A;  2WZP P;  3T2P A;  1KS5 A;  3NKG A;  4LLF A;  3N9Q A;  4GKY A;  2J1V A;  1BEV 3;  2YG0 A;  5IFT A;  5E16 A;  1DCS A;  3BTY A;  2XDV A;  4LOS A;  3BPS A;  2RS3 2;  1O3R A;  5JAX A;  3AKQ A;  2FZ2 A;  1AJK A;  2WFF 1;  1FAT A;  2E9Q A;  4COW A;  3IAQ A;  2YU2 A;  3C8X A;  1Q3E A;  4V2W A;  1YRZ A;  4AI3 A;  1H8T C;  1WBF A;  2X29 A;  1RHI 3;  2D6K A;  4JGZ B;  3H7J A;  4OMD A;  4IGO A;  4CPB D;  2J22 A;  1EY2 A;  5BYN A;  4HET A;  1NA1 A;  2Z5W A;  4AHW A;  3POJ A;  3KQ4 B;  1OF4 A;  3RG0 A;  3WG4 A;  3SCG A;  3RMX A;  1GLH A;  4L92 A;  1UAI A;  2FCT A;  1LB2 A;  5C8W A;  3B00 A;  4QM9 A;  3THP A;  4XFF A;  5JMO A;  1K12 A;  1PX4 A;  4HPK A;  2DDU A;  3DYM A;  4N8M A;  4P5Y A;  5IUQ A;  1APN A;  3JBG 1;  1JZ2 A;  3K77 A;  4B29 A;  5A7O A;  4L97 A;  2J1E A;  3LSD A;  2HWC 1;  3E6B A;  3RYR A;  4CSW A;  1RUJ 1;  4Z2A A;  4Y1Z A;  3AMM A;  1DG6 A;  2RJ2 A;  2YBK A;  4AR2 A;  2JD9 A;  3CZJ A;  3N7L A;  3LEG A;  4BQX A;  1GYK A;  3KM5 A;  2JDY A;  2HWF 3;  1DQ6 A;  3M1H A;  3MV1 1;  1US2 A;  4FPC A;  1F35 A;  4XQ4 A;  4DEQ A;  3B02 A;  4UW6 A;  5C7G A;  4NVP A;  3WF1 A;  1YHF A;  2B4K A;  4AED B;  4HN0 A;  4YG6 A;  5FQ0 A;  1CN1 A;  1COV 2;  1JH5 A;  1EV1 3;  4GH4 A;  3HJR A;  1SFY A;  3ZMN A;  5DDJ 2;  3PUR A;  3AYA A;  1UD1 A;  2ZEY A;  3J8F 1;  5F9T A;  4NRO A;  1P8J A;  1XND A;  2V5D A;  3W9A A;  4YZ1 A;  2E6V A;  1W9F A;  4AI1 A;  5EP9 A;  1XC6 A;  4GMP 3;  4L0P A;  3O12 A;  2FDJ A;  4HKW A;  1PO1 2;  3KB5 A;  5KC5 A;  1IPJ A;  2DVG A;  4RS5 B;  4WVM A;  3R4D B;  3RRD A;  1XYO A;  2VZV A;  4JGY B;  1WCD J;  4RGG A;  2VCC A;  1CPM A;  5DUX A;  1SCR A;  5KC6 A;  4LBQ B;  2RE9 A;  1EYB A;  1Y9G A;  3MW2 A;  5EJ3 A;  1GBG A;  5JSR A;  3RZG A;  1CAV A;  1QXJ A;  3ZSL A;  4ZXE A;  3FHQ A;  2XBO 2;  1POV 3;  3CLP A;  4K6B A;  4Y20 B;  1FNY A;  3M2M A;  4HKO A;  1GR3 A;  1AVB A;  3KV5 A;  4Y24 A;  2VZ1 A;  3NJZ A;  4YZ2 A;  4ZPI A;  3ZYF A;  3POI A;  1QXR A;  4JTO A;  1PGW 1;  4Y22 B;  4BQ1 A;  2G19 A;  3LOB A;  5A7P A;  3HQR A;  4QX1 A;  3ACL A;  1NCQ B;  3IN9 A;  1C8M 2;  5A3U A;  2IXI A;  1OOP A;  1UKR A;  3DEC A;  1W2A X;  5FLJ A;  2VCM A;  3PTR B;  1JW6 A;  3ZFG C;  5KHK A;  2W91 A;  3ZDV A;  1DLC A;  2GH8 A;  2BP6 A;  3BCW A;  2BDR A;  4QQH A;  4QPG C;  2ZGM A;  1BEV 2;  1O6U A;  4JQR A;  5DAQ A;  1RUH 1;  3VDA A;  1FAY A;  3M3I A;  2FDH A;  4MHU A;  3VD3 A;  3H1Y A;  3ZFE A;  3VHR A;  5FDB A;  2I74 A;  2RMU 3;  1IPK A;  1YLL A;  4PBO A;  3ZIX A;  1W6P B;  5T5J A;  2WNU A;  4P9J A;  1RHI 2;  2JG9 B;  4XPV A;  3N7K A;  4SBV A;  4Y4Y A;  3I3B A;  3E5U A;  2OX0 A;  4CCN A;  2V09 A;  4R9A A;  2DFC A;  2BBA A;  2ORZ A;  1AR9 2;  2A1X A;  2BJS A;  5FP3 A;  4S2F A;  3MW4 A;  1TZO A;  5F5A A;  1ZRE A;  3TRS B;  1AR6 1;  3FMG A;  2UUR A;  3ZYB A;  2EF6 A;  3CU7 A;  2XHK A;  4YG0 A;  4YW7 A;  4BLJ A;  5B4X A;  1QGL A;  5AC9 1;  2EID A;  1NZC A;  4JGZ C;  5FP9 A;  4DO0 A;  2VBD A;  4H3W A;  3DV8 A;  2IXC A;  2VMI A;  4ZZ5 A;  2GP3 A;  3AMQ A;  4UI9 L;  2C1F A;  3BN6 A;  1YIF A;  3UK9 A;  4XF9 A;  4UFM A;  4R4X A;  5A7Q A;  4F8A A;  5ACA 3;  1R1A 1;  3KMH A;  3HEI A;  1SDD B;  2JEM A;  1W3V A;  1G9B A;  1AZD A;  4TZD A;  4RD7 A;  2PFW A;  5H9S A;  3AXE A;  5FZ3 A;  2BU9 A;  1XRU A;  4OLL A;  2HWF 2;  1G9A A;  1K5J A;  3VBU A;  2AZ5 A;  1S4C A;  4HKL A;  1ODN A;  3AKR A;  3KF3 A;  2X09 A;  3I3D A;  1RIR A;  1VAK A;  1OA3 A;  3O5S A;  2NM1 A;  4QX8 A;  5KBF A;  2G9F A;  3IBM A;  4QPY A;  3HR9 A;  4Q4V 3;  1FOD 3;  4Y1U A;  3EMR A;  2HWE 3;  1SBE A;  2J7M A;  1CR7 A;  2PA7 A;  4PI2 A;  3ZYR A;  5BNN C;  2VZ3 A;  3NNG A;  5LAT A;  4AED C;  4Q0V A;  1HW5 A;  3DYP A;  5HV0 A;  3OGS A;  1UL9 A;  2WS9 3;  4HAN A;  3PUH A;  3U10 A;  1HIX A;  1H8T A;  2O1Q A;  1OVP A;  4GJZ A;  1WMF A;  3DN7 A;  4UF0 B;  5FMO S;  3TN9 3;  2OPK A;  3UJO A;  1WCS A;  2ZX1 A;  2I2S A;  2ZBJ A;  4E9K A;  3ZKY A;  2VOX A;  4AZZ A;  4A45 A;  2FZ1 A;  4RQP B;  4Y1V A;  3WXP A;  4HMZ A;  2EAA A;  4GB3 1;  2D6N A;  1V9U 3;  4W65 A;  1R08 3;  1F5J A;  1NKG A;  2ARC A;  3ETP A;  1OLM E;  3LE0 A;  4QX5 A;  3UGG A;  4M3C F;  1XYP A;  1SLA A;  3QAC A;  4AVS A;  4AXO A;  5F39 A;  1ZZC A;  3ZN4 A;  4XAA A;  1JOP A;  2ZGK A;  1KJL A;  4I0A A;  1O4Y A;  3SIT A;  5FV3 A;  2ZX3 A;  4FBF A;  2VBB A;  1PIV 1;  2CYF A;  2P6C A;  3GJB A;  2ZGO A;  4N7U A;  3VBR C;  3JU9 A;  2WWJ A;  1UY1 A;  4LA3 A;  4CCD A;  4LOR A;  5JZG B;  3MFC A;  2R49 A;  2WSV A;  3H0O A;  2DTW A;  3JXS A;  4KL1 A;  4MG2 A;  2IFW A;  1W6O B;  4HZF A;  4QHZ A;  2ZOE B;  2R04 1;  4FPF A;  3WNM A;  5ABJ C;  4XJZ A;  3PTY A;  4QDS A;  3T2O A;  4LUK A;  2LTN A;  3APB A;  3TB0 A;  5G05 L;  1JMU B;  1VBA 1;  4CU6 A;  5FIX A;  1V6M A;  5A7W B;  3D6E A;  1M4W A;  1W2O A;  3H3Z A;  5FYH A;  3U75 A;  3W21 A;  5A6Z A;  4ERO A;  1GP6 A;  4IE6 A;  2JWP A;  2WQZ C;  5FYT A;  4ZKT B;  4MXW B;  4PF5 A;  2VE1 A;  3OYW A;  1HRV 3;  2MEV 3;  1OA2 A;  2DCJ A;  3MLL A;  3ZYG A;  2NPI A;  4XMA A;  1W3X A;  1AYN 1;  5DZE A;  1XNA A;  1BVP 1;  2GC3 A;  5CFD B;  1BQP A;  4RFR B;  1KGY A;  4CDW C;  1SMV A;  4A44 A;  5KXC A;  2PQQ A;  4COZ A;  2MNG A;  2ZHK A;  3W59 A;  2A7A A;  2X53 S;  2ZMN A;  5LA2 A;  4A4A A;  1F15 A;  5CFC B;  1MS0 A;  3VHP A;  1QQP 3;  1SLL A;  1XU1 A;  3ME2 A;  3W58 A;  4QX2 A;  1ST8 A;  3VBS B;  3SKV A;  1D4M 3;  1YO8 A;  3HVD A;  4NR1 A;  5BNP B;  4DUX A;  1XE8 A;  2AUY A;  3PVB B;  1OVS A;  1VBB 3;  4HVQ A;  5C70 A;  2JIG A;  2BQP A;  5ACA 2;  2QBX A;  2OKX A;  4KG8 A;  2RS5 3;  4BXF A;  4LKE A;  5FPX A;  1SBD A;  3ELN A;  2GC0 A;  2XVL A;  4MGQ A;  3LA2 A;  4Q0S A;  4CXX A;  5C71 A;  3VUO A;  1ND2 A;  3POF A;  3VBO B;  2DCZ A;  3JQW A;  5EZW A;  2VNO A;  5FPB A;  2H0B A;  4EN0 A;  2P17 A;  1XE0 A;  1QNY A;  2CTV A;  5FMD A;  4BE3 A;  1W9S A;  4MZU A;  4KG0 A;  4R8H A;  1IQA A;  3ZFG A;  2H6B A;  1RL3 A;  2W08 A;  5IJR A;  2FBE A;  4LK7 A;  2FCV A;  3IDB B;  4CP9 B;  3SH3 A;  4AHY A;  5BUV A;  2PLV 3;  1ZRC A;  4IES A;  4QPG A;  1FOD 2;  3K4D A;  2W68 A;  1D4V B;  1UMZ A;  2HWE 2;  2KD7 A;  2NP0 A;  3INA A;  1FMD 1;  2VUD A;  2R6Q A;  2EIB A;  4FPH A;  2LM3 A;  1W6N A;  3WDT A;  4CDX B;  4BLI A;  1DGR N;  5LZ6 A;  4XAC A;  3B5L B;  4ASL A;  1K42 A;  4IGP A;  3X29 B;  3IIA A;  3KV9 A;  3DXU A;  1Q8S A;  3L2Y A;  4JCK A;  2VEC A;  4AGR A;  1HV0 A;  1BMV 1;  4H7L A;  3A0N A;  3WP4 A;  2FDF A;  2WJS A;  3UKN A;  4QDR A;  2H6C A;  2XWJ B;  1YFU A;  1WD4 A;  1V9U 2;  3RJR A;  5E6H A;  2UWB A;  4NII A;  5GM0 A;  1N47 A;  2PAM A;  1IS5 A;  3AMH A;  3OY8 B;  2B46 X;  4JGZ A;  3A22 A;  5FK8 A;  1WUV A;  1CIY A;  2CHH A;  3M3E A;  2VQT A;  4O7X A;  4EN6 B;  2LRO A;  3LDK A;  5LA0 A;  4L9B A;  4A41 A;  2TEP A;  4DIN B;  1B35 B;  5DUV A;  3WIN E;  1JBC A;  1SAC A;  4EV0 A;  2DF7 A;  2XGX A;  4RQP C;  4NWW A;  1S2E A;  4QQ2 A;  4XMI A;  5J7M A;  4BQ3 A;  4UXA A;  5FWJ A;  4HON A;  4UW4 A;  4Q0Q A;  2JE9 A;  4TLG A;  2VGD A;  3ETQ A;  3NRU A;  5FO9 B;  5KHJ A;  5I0R A;  1IS6 A;  3I2K A;  5IK4 A;  5SV8 A;  5L7O B;  1JZ7 A;  3NV4 A;  4HT1 T;  2CGO A;  4NAM A;  1NLS A;  4XXP A;  5JZG C;  4FT8 A;  2HYX A;  3BB6 A;  3VB9 A;  4COY A;  5DMY A;  4P5H A;  4HL0 A;  5EV7 A;  2FHR A;  2OT7 A;  5F3E A;  1HRV 2;  1POQ A;  2MEV 2;  4FFG A;  1K5M C;  2BGO A;  2WQ8 A;  4AED A;  2B42 B;  5FXW A;  4ATF A;  2QE3 A;  3BOP A;  1W9T A;  3AL6 A;  1YNA A;  1F4A A;  1CGP A;  2OQ7 A;  3Q9O A;  2ZX4 A;  2NN8 A;  3TWI A;  2B45 X;  3VBF B;  3VKM A;  4DIQ A;  1QEX A;  1ND3 B;  1QQP 2;  3FN9 A;  4LE3 A;  1ZZ8 A;  4Y1Y A;  4KWK A;  3VDD B;  3P3N A;  4AAX A;  4C0H A;  1M06 G;  3ZXJ A;  4LLO A;  1D4M 2;  1LAJ A;  1MS1 A;  1VBB 2;  3H9A A;  1UXZ A;  2BTV C;  1JN2 P;  4BYY A;  2GAU A;  3ZXG A;  2K46 A;  2XLG A;  2RS5 2;  3UET A;  3FX3 A;  5A6Y A;  4FAG A;  5CFC C;  4NMI A;  2VMH A;  4Q29 A;  1KRI A;  4LBQ A;  3VBR A;  1COV 1;  4LK6 A;  3VBS C;  1O5L A;  4JHT A;  3UKT A;  3PHM A;  5DDJ 1;  1R64 A;  4J1X A;  4NHX A;  5FY8 A;  5BNP C;  3VKN A;  4AHZ A;  4Z82 A;  2PHF A;  4Y20 A;  4OQ9 A;  2BFU L;  1RIT A;  3NL1 A;  1E57 A;  1H30 A;  2BNO A;  2D3S A;  3UV9 A;  1X9T A;  4TYS A;  4GWM A;  1AL2 2;  5GZF A;  2A6Z A;  5I0S A;  3ABZ A;  3MI8 A;  4XIL A;  2PLV 2;  4HFS A;  4JAA A;  2XJV A;  4QMA A;  1QJX 3;  4FPO B;  2E7A A;  1ZA4 A;  4UWD A;  1PO1 1;  3DKW A;  3SHR A;  4C1W A;  1NCQ A;  3POS A;  4M3C A;  1TME 3;  3NQH A;  2YXS A;  1LOD A;  3WV6 A;  5IAT A;  3RSJ A;  5LWB A;  3CEW A;  4HN1 A;  1ENR A;  5FZA A;  4CUA A;  1YC6 1;  2OA2 A;  2W95 A;  1T6B X;  2XBO 1;  5GLU A;  5LEJ A;  4PJY A;  1UKG A;  1UQX A;  3T08 A;  2XXZ A;  5JXI A;  2XJU A;  3LCP A;  2ZPX A;  5LA9 A;  3VZL A;  3VHO A;  4YSF A;  5BY5 A;  2FDI A;  2CAU A;  4NWV A;  2WL1 A;  5L9V A;  4CDX C;  4WVW A;  1MEC 2;  3ENR A;  5DXD A;  1YIP A;  1SLB A;  1W6P A;  1NCR B;  2XJR A;  2YMZ A;  2XJQ A;  2VUA A;  2JG9 A;  2XLF A;  1PO2 3;  4K8F A;  2DTY A;  2YBS A;  3NW4 A;  1V6N A;  2VPV A;  2ZCW A;  4EN9 B;  1QU0 A;  1RB8 G;  3KLS A;  1QJU 3;  3KVB A;  4XCA A;  2WNO A;  1OQD A;  4ET7 A;  1FYU A;  1GOG A;  4DXT A;  1EP0 A;  2DUQ A;  1TMF 2;  1WLT A;  1NLR A;  3T1L A;  1QNW A;  1ULF A;  1BEV 1;  1F31 A;  5FP7 A;  4PIX A;  3ILN A;  1CJD A;  1HB4 A;  5HXV A;  2TNF A;  4LHL A;  2LS6 A;  3HQX A;  4XAB A;  1B35 C;  1RUI 3;  1C5I A;  2CWS A;  4IE5 A;  3UYJ A;  1EPW A;  4IXL A;  5FO7 B;  1L7Q A;  1VRB A;  1QWR A;  2TBV A;  3I4I A;  1U5Z A;  4XUP A;  1RHI 1;  1KXG A;  1SLI A;  3AP4 A;  2X10 A;  3MLJ A;  2KXL A;  1GZW B;  1HN0 A;  2CDO A;  1KFU L;  2TUN A;  2Y33 A;  2ZXQ A;  4YW2 A;  4B1M A;  5IYY A;  5IVC A;  3ZR6 A;  1HDK A;  5FY0 A;  3AYC A;  2R16 A;  1NE4 A;  2LUW A;  3KCC A;  4BA6 A;  1GOH A;  4FP2 A;  4JDO A;  1FI2 A;  1ZBA 3;  4IEX A;  4LO6 B;  2JDA A;  5JOX A;  1PHM A;  2E53 A;  2NMO A;  3TEW A;  4E8C A;  4RSU A;  5JWP A;  4FOY A;  3KHC A;  1ZRF A;  4CYD A;  2J1U A;  4IEZ A;  3U78 A;  1KJR A;  1REE A;  5A1L A;  5FBJ A;  3OEA A;  1BXH A;  3BPZ A;  3MFA A;  4XUR A;  4OHY A;  2WAB A;  2WO1 A;  3N9N A;  2GNM A;  2YGM A;  1QJZ A;  1W6Q B;  4UF0 A;  1UYZ A;  2HWF 1;  4FPL A;  4D7S A;  4LPL A;  3O14 A;  2EXJ A;  4YGE A;  1DIW A;  1C28 A;  1HLC A;  1ND3 C;  4CEW B;  4U36 A;  1QIQ A;  1BLZ A;  3VDD C;  2BER A;  3HBZ A;  4E8D A;  2C0Z A;  4RQP A;  3OG2 A;  1EV1 1;  2VQ0 A;  4XUT A;  4XOG A;  2HLE A;  1MS9 A;  2EIE A;  2WO2 A;  2DVB A;  4QDQ A;  2VW1 A;  2D98 A;  4I02 A;  1ULG A;  4ZU4 A;  4OI1 A;  3EO6 A;  1SQ4 A;  3BTZ A;  4GMP 1;  5FLH A;  1QJX 2;  2VJX A;  2ZX0 A;  3RVH A;  2Z2S B;  4CPB A;  2E26 A;  1I5Z A;  4CUC A;  5FYB A;  1W8H A;  5JZG A;  1CZV A;  1UYY A;  3A7Q A;  2J1A A;  5FPA A;  4CDU B;  5FAX A;  4P08 A;  4Y5S A;  5FLI A;  3SH4 A;  1OC1 A;  1H2M A;  2ZJC A;  4Z92 B;  3GYD A;  1W6O A;  1W8T A;  2C24 A;  2OII A;  1QH7 A;  1IQD C;  1LUL A;  4H7M A;  1K5M A;  1LGC A;  3D3A A;  3MO4 A;  4PT6 A;  4R9B A;  2ZAH A;  1GMM A;  5H9P A;  4AF9 A;  2Y6G A;  2VTF A;  4AVT A;  1POV 1;  5J09 A;  3POW A;  1F9K A;  1JYT A;  5A7W A;  4GA9 A;  3M8L A;  1MVQ A;  4NOT A;  3OUI A;  1GQG A;  3FFZ A;  1B09 A;  2V4V A;  1EUT A;  3POB A;  3GZE A;  2W2I A;  1KS4 A;  2D44 A;  3NAP B;  5DN2 A;  4BJ0 A;  4NPL A;  2MPF A;  4CCM A;  1VBD 3;  3GCW A;  5K4L A;  4FAH A;  2DVF A;  1JHN A;  1OD3 A;  1PO2 2;  1T2X A;  5CFD A;  1N1V A;  2ORX A;  1UF2 C;  4IEO A;  4LJH A;  2WBK A;  5I91 A;  2WFP A;  5A3N A;  1QJU 2;  3IMM A;  2P34 A;  3WNP A;  4C0B A;  2D3P A;  3PNA A;  3W5M A;  2RDR A;  5CFC A;  1A34 A;  1YQ5 A;  4XJU A;  1CVN A;  1UYX A;  4BDV B;  2CGN A;  1NCR C;  3IKW A;  3VBS A;  5KHI A;  2D5H A;  2PQS A;  1RMU 3;  3ZPY A;  5BNP A;  4Q26 A;  1R09 3;  1O8P A;  1RUI 2;  2RMU 1;  3JZV A;  1DQ0 A;  5GLZ A;  3O7O A;  4ZU7 A;  5FK7 A;  1NYW A;  1GWK A;  1S0E A;  4AQ2 A;  4IEV A;  4GUL A;  1VB4 A;  2IWG B;  2F17 A;  4YVS B;  1GZT A;  4QU2 A;  3AP9 A;  3JQX A;  3KHB A;  2Z79 A;  5FZ9 A;  3TOJ A;  3VBO A;  5IVF A;  4WVV A;  4YZ5 A;  2YRO A;  3DYO A;  3Q8E A;  4FPG A;  4QKD A;  2I45 A;  1V00 A;  4RA0 A;  2WUH A;  2VNR A;  1VAL A;  2WN3 A;  2EXH A;  4G3Y C;  3LWC A;  4OUS A;  4Z2W A;  1ZBA 2;  3V65 A;  3ACH A;  5FZ1 A;  1UZY A;  1VMH A;  3AMN A;  5EYX A;  1WWY A;  4CP9 A;  5A32 B;  5GZC A;  3N3H A;  5ANQ A;  3O1S A;  3ZOI A;  2WDB A;  4HVO A;  4GD4 A;  5DAB A;  3B9C A;  1F4H A;  1SPP B;  2DCK A;  2DVA A;  1N1Y A;  5ACA 1;  1CAU B;  1ULE A;  5FR3 A;  1JYV A;  2PN5 A;  1G9D A;  5CG8 A;  3HN1 A;  3KZ4 C;  2ZEZ A;  4HXC A;  2V5Y A;  4CDX A;  2K9Z A;  3PIJ A;  1C5H A;  5AVP A;  5FMO L;  2VZT A;  3D5O A;  4NRQ A;  4IV3 B;  3B9I A;  2ZS6 B;  4QB2 A;  3VD5 A;  1C8M 3;  5J96 B;  1XNT A;  4XHB A;  1U5X A;  3III A;  3WW1 A;  3WUD A;  4MLO A;  5CVR A;  2JDK A;  1Q8O A;  2DV9 A;  4FPK A;  5JXH A;  4XJ8 A;  2LAL A;  4NJ4 A;  5B4N A;  1OPM A;  2KM2 A;  3B3Q E;  4NE9 A;  4FPE A;  4WM7 B;  4Y5Z 0;  3GHN A;  3OY8 A;  1FOD 1;  4Q4V 1;  3M3Q A;  5KR7 A;  1K3I A;  5FBZ A;  2HWE 1;  2WAA A;  3BGA A;  4AW7 A;  4D8M A;  3LF7 A;  5JCT A;  1UOB A;  4CEW C;  1B35 A;  5F3C A;  1QOO A;  5FYV A;  2WS9 1;  4RN5 A;  4FFI A;  2ZHN A;  3M4F A;  1LR5 A;  4WM8 B;  2IUW A;  2Y8K A;  4Q4Y 3;  1OLR A;  1JUH A;  4XIO A;  3TN9 1;  5FZC A;  4BK5 A;  4OQ8 A;  3U4S A;  1UW8 A;  3OBZ A;  1H4H A;  2P3J A;  4WZF A;  3O1R A;  1C57 A;  2AC1 A;  2R32 A;  4DRR A;  1AR9 3;  3H1W A;  5DUU A;  1RC6 A;  1V9U 1;  3NNF A;  3WQ0 A;  1LOG A;  1R08 1;  5K0U B;  1GP5 A;  1CQ9 A;  2VXJ A;  5F3I A;  4DZG A;  1CZS A;  4EQV A;  5I0D A;  3BKZ A;  3VZN A;  1OLM A;  5FYC A;  2ETE A;  1FT9 A;  2GSY A;  4OCT A;  5EXO A;  4Y1X A;  4CDU C;  2XL7 A;  3DXT A;  4FP3 A;  3VBH B;  3ZYI B;  1DQ4 A;  1JU3 A;  2YC4 A;  3AXD A;  4GZ9 A;  1XSQ A;  2K2S A;  2A6X A;  3WP5 A;  3RWN A;  3S5A A;  2A5Z A;  1GNY A;  4LMF A;  4L11 A;  1YQC A;  5F3G A;  1VBD 2;  3VKF C;  2DUR A;  3VZJ A;  4JZR A;  4MUV A;  3EJK A;  1C1F A;  2NZ9 A;  3I2G A;  5C9A B;  4AWD A;  3ROU A;  1XNB A;  4EN7 B;  5BNO B;  5IWF A;  3J26 N;  1VBC 3;  2XQR A;  2Q1M A;  2A75 A;  3LPF A;  5T52 A;  3VBF A;  1SHW B;  1PNF A;  1ND3 A;  3NAP C;  4LR4 A;  2XJP A;  4YYO A;  3VDD A;  1JZ5 A;  3IDA A;  3AZV A;  5HCF A;  4OI4 A;  2D6P A;  1DZQ A;  1RMU 2;  2ADD A;  2G9Z A;  4QM8 A;  2VD7 A;  1RUO A;  2ILM A;  4QGN A;  4OYU A;  5C33 A;  3B01 A;  5M0T A;  4UAP A;  1WLD A;  1R09 2;  3KCX A;  3NV1 A;  5T55 A;  4BMB A;  1U12 A;  2E7Q A;  2GN7 A;  1HRV 1;  2MEV 1;  4XE9 A;  1HKD A;  4UFL A;  1O5U A;  3D0J A;  3J4U H;  3RMY A;  2NLR A;  5BV6 A;  4L8Q A;  5FZL A;  3SLI A;  3BAL A;  1T6G C;  1S0B A;  1WCQ A;  4IET A;  1XNC A;  3V64 A;  2R07 3;  3ZYH A;  1IKP A;  4QKB A;  2YPD A;  1JZ6 A;  2SBA A;  1LTE A;  3NNJ A;  1Q8Q A;  4FQ4 A;  4YPJ A;  3FJS A;  4WZC A;  3CDZ B;  3ILR A;  3MPP G;  1GZC A;  2BWC A;  1D4M 1;  2XUE A;  4X8P A;  4QPI B;  1XYN A;  3NO8 A;  1X33 A;  2VMF A;  4QKN A;  1OKQ A;  1YUD A;  1HXS 2;  1VBB 1;  3MID A;  2GND A;  3WUC A;  1AR7 1;  2BGC A;  4H14 A;  4TXW A;  4Y26 A;  2IVI B;  2RS5 1;  2W5F A;  3UT0 A;  1W6M B;  4FFH A;  1AL0 G;  3N4M A;  4DUW A;  3S57 A;  5JI9 A;  3B7M A;  1V0A A;  2OQ6 A;  1ND2 C;  3CL1 A;  1XNK A;  3K75 B;  2CSG A;  4LQR A;  4NPM A;  3SXW A;  1LGN A;  5C3R A;  5BPX A;  4JRA A;  3ZXF A;  4M00 A;  4AQT A;  4MXV A;  3E6C C;  1F5F A;  2WWU A;  1H9P A;  4Q0P A;  5FO8 B;  3P1I A;  4LEJ A;  2GH2 A;  3O1U A;  2A71 A;  2VNG A;  2PLV 1;  3MF9 A;  3MBW A;  3VL9 A;  4CCJ A;  2PYT A;  2VVF A;  2HEV F;  5C4W B;  4N90 A;  5JXG A;  5CG9 A;  1NCR A;  3I7D A;  5FYS A;  2Q8E A;  2QQI A;  1FNZ A;  1XQN A;  5E88 A;  1O3S A;  4S2D A;  3T09 A;  2AEY A;  3WDU A;  1I3H A;  5ANN A;  1LU2 A;  2Q0A A;  3KSC A;  4E4Z A;  1LU1 A;  3C7G A;  3NJV A;  1SFP A;  1OHF A;  1VB2 A;  1XB9 A;  1UOF A;  4KQ7 A;  3JD7 3;  4LBJ A;  1QDC A;  4YGD A;  2XB6 C;  3AZZ A;  4AI9 A;  4E2G A;  1VBE 3;  4Q4Y 2;  2JDZ A;  2B9U A;  2GMM A;  4K20 A;  3MIE A;  2WA4 A;  4XUN A;  3AZW A;  1GV9 A;  4YM3 A;  5CEH A;  3HNY M;  1HV1 A;  3ZX7 A;  3FUQ A;  3K4A A;  2ZEW A;  3N9L A;  4UFH A;  1S0F A;  2PHU A;  3PVN A;  4O61 A;  1CPN A;  3SIS A;  2VBP A;  2YPJ A;  1FV2 A;  2OVU A;  2JIC A;  2OZJ A;  4WM8 C;  2P5B A;  2ZGP A;  4AQ6 A;  4DRV A;  4J1W A;  1PZ8 A;  2BRT A;  1DGL A;  1GZW A;  3L9J T;  1AYM 3;  1MS3 A;  1HB2 A;  1PZ9 A;  2WZE A;  3N7J A;  1G86 A;  3OB8 A;  4JX0 A;  4QPW A;  3T0A A;  5A3O A;  1DBN A;  3OBA A;  1SCS A;  2OW4 A;  4XUQ A;  5GZG A;  1ENX A;  3AB0 A;  3Q8B A;  4Q8K A;  5CAD A;  4UBG A;  5K0U C;  1AR8 3;  4OI0 A;  1I9R A;  3RJ2 X;  2QDR A;  4QGM A;  4MHR A;  1YFY A;  2JDP A;  1VJ2 A;  5FPV A;  3ZSE A;  1NE6 A;  1MPX A;  4FXG B;  1UZZ A;  1VBC 2;  5IK5 A;  4YZ3 A;  4LHK A;  5HCB A;  3VBH C;  3DGT A;  4CUB A;  5BXX A;  3KV6 A;  5F37 A;  4ISQ A;  5EWS A;  3VD9 A;  2B8M A;  2P6H A;  1W90 A;  4I3G A;  3ACI A;  4KI5 M;  4TTG A;  2GC1 A;  3OUJ A;  4XF3 A;  1O3T A;  4FFF A;  1UZV A;  4P9L A;  2GNT A;  3MIB A;  1W6Q A;  5A3W A;  3LOI A;  3S6P A;  1VE0 A;  3W20 A;  1MS4 A;  2D97 A;  1UMI A;  2WRA A;  4B4Q A;  5GJ6 A;  4KWL A;  4XBQ A;  3LB9 A;  2P37 A;  4CEW A;  4R9D A;  1E5H A;  3PVE A;  1YJK A;  2ZZQ A;  5I0U A;  4B7E A;  2W52 A;  1MZ6 A;  5FOB B;  4LT5 A;  4P02 B;  2R07 2;  5C8C B;  2V73 A;  4IDZ A;  4K8R B;  4RYD A;  1DFQ A;  3AVR A;  1SDW A;  1NXM A;  3I97 A;  1H1M A;  2P2K A;  5J48 A;  2JDU A;  3I59 B;  1OF3 A;  1H6X A;  3O0W A;  3GZU C;  5FP8 A;  4DXR A;  3VLB B;  1G9F A;  3LA7 A;  4QHB A;  1OQ1 A;  1UZ0 A;  2NQY A;  1EPZ A;  3GHM A;  4LBL A;  4A2U A;  4D7Y A;  4QU1 A;  1PM7 A;  4RS5 C;  4CDU A;  2BPA 2;  1VP6 A;  1RUF 3;  4BQW A;  4IND A;  3TEX A;  5KXD A;  5F2S A;  4JGY C;  4P00 B;  5A3L A;  1BYH A;  4QX0 A;  4K1Y A;  4QQL A;  1W8W A;  4MYE A;  2VMG A;  5CIS A;  1HX6 A;  4QPI C;  4XXA A;  3RYK A;  3SNM A;  4AFD A;  2VL4 A;  4CP2 A;  1W39 A;  3WQ1 A;  4TWT A;  2WT2 A;  3I2O A;  2XKP A;  4JRL A;  2IC1 A;  3ZXK A;  3RZL A;  1YXW A;  1V6K A;  1X8E A;  2W92 A;  4N7I A;  5CNA A;  3ZIW A;  3SEE A;  1LGB A;  5T5L A;  4BME A;  1OH4 A;  1QJX 1;  3AP6 A;  4DY5 A;  3NAP A;  4RFT 0;  3ACG A;  2YDE A;  1V70 A;  3E1F 1;  4YVW B;  1XPW A;  5FCC A;  3LZZ A;  2P4E A;  3ES1 A;  1PMJ X;  3TAY A;  1TME 1;  4BK4 A;  1H6Y A;  1NCQ C;  3CQO A;  4MGS A;  3VL8 A;  5LCW L;  4W8J A;  4IV1 B;  3JD7 2;  3K46 A;  1WCK A;  2WYS A;  4H2A A;  4W6Y A;  3T4V A;  4YGC A;  1S55 A;  1VBE 2;  5HXM A;  2HWB 2;  3PIG A;  2VTX J;  5JOZ A;  3PL0 A;  5C4W C;  4Y5T A;  4S2G A;  4M01 A;  5I93 A;  5FY5 A;  1UY2 A;  2PMW B;  4PLO A;  4Q4W 3;  4Z07 A;  1RUD 3;  2RDS A;  1RUG 2;  3AKS A;  4COU A;  4BM8 A;  3POY A;  1W8O A;  3LAG A;  4AGG A;  3ACF A;  4N43 B;  3I2I A;  1ASJ 3;  1DHK B;  4UT5 A;  3POG A;  4B3N A;  2GC2 A;  1NQJ A;  2D3R A;  2VMC A;  1PO2 1;  2JG9 C;  4YVS A;  1AYM 2;  1DZT A;  2W46 A;  2DCT A;  1QJU 1;  4EE2 A;  3ZR5 A;  3VZK A;  5C5T A;  4FTS A;  1UYP A;  4Z1V A;  4CEY B;  5FXX A;  2XUM A;  4Q0U A;  1AR8 2;  2BVB A;  3VD4 A;  4QX3 A;  3BYW A;  4A6S A;  1PVX A;  2FQP A;  5A32 A;  3PUS A;  4P9X A;  3HNM A;  3MHZ A;  1MAC A;  1WW7 A;  2VG9 A;  4YW6 A;  1RED A;  4AK3 A;  1UNB A;  1OXC A;  3ZN6 B;  1RUI 1;  3J7N A;  4BZ4 A;  5KHG A;  3T2Q A;  1YFX A;  3UES A;  1CAU A;  1AL2 3;  1MZE A;  3OGR A;  4LIU A;  3MGU A;  3USS A;  2DU0 A;  1Q8P A;  2DUO A;  3ITQ A;  5A33 B;  4LXL A;  1IS3 A;  5T5P A;  1YI9 A;  3HD8 B;  2JEC A;  2DWR A;  1ZBA 1;  3FLR A;  5EFU A;  1O7F A;  4LA2 A;  3WNL A;  2IZW A;  5IW0 A;  1G6N A;  3QBQ A;  3ZSM A;  3DF0 A;  4XFC A;  5G04 L;  1V6O A;  4DY3 A;  1BCX A;  2W94 A;  1HN1 A;  4XW3 A;  4KNC A;  2DCY A;  4QT6 A;  1NXD 1;  5CYY A;  5FXZ A;  3H8X A;  1S0G A;  4XJ9 A;  1MEC 3;  2OZ6 A;  1XOY A;  4Q4X 3;  3KV4 A;  4WM8 A;  4N53 B;  5LAS A;  2R1B A;  2XWB B;  2ZTN A;  4GIQ A;  1RUF 2;  1W03 A;  2ARB A;  5I0T A;  1DYK A;  4A7K A;  4E27 A;  5FZB A;  5FRE A;  3O1M A;  3TEY A;  1J58 A;  3HN3 A;  4G9S B;  4KGQ A;  4DB5 A;  5K0U A;  2Z4F A;  2HEY F;  4CCO A;  4D94 A;  4ZZ8 A;  1TMF 3;  5A80 A;  1H2K A;  2L9L A;  2RS3 1;  3VBH A;  3KQR A;  1X8M A;  1IG0 A;  4IEW A;  1LHO A;  4EWE A;  1OMI A;  1YEW A;  4F83 A;  1VPH A;  5H9Q A;  3R4S A;  4DXZ A;  4HK9 A;  4AQS A;  3VKO A;  4XF1 A;  2B5H A;  1RGS A;  1UU5 A;  4OUE A;  4SLI A;  1BVV A;  1XJA A;  2DVD A;  3NV2 A;  4XTM A;  5EJZ B;  2HEW F;  4UYB A;  5BNO A;  2QDN A;  2HWC 2;  2Q4S A;  4AGV A;  4IEU A;  1RUJ 2;  4QD2 A;  4R52 A;  4CE8 A;  1W9Y A;  3GGL A;  3RQ0 A;  1PGL 2;  5GZE A;  1LOF C;  2WAO A;  4Q4W 2;  1GZ9 A;  4PHZ A;  4EYU A;  1RUD 2;  2ARA A;  3PME A;  3E5Q A;  3KT7 A;  4C1X A;  2OPW A;  2ZX2 A;  4Y4R A;  1ASJ 2;  2G4I A;  3OF1 A;  2WLQ A;  1VBD 1;  3DUI A;  3FWE A;  4KWU A;  4ATE A;  1JI6 A;  2EAK A;  1RVF 3;  3CJI B;  5CFD C;  1IZ3 A;  5FP4 A;  1FPN 3;  4XFA A;  4NIH A;  3LDB A;  3J8F 2;  3VN4 A;  4RS5 A;  2A3Y A;  4EZ4 A;  1OBN A;  1VIW B;  4JGY A;  2JDM A;  3V0B B;  4JHZ A;  1LOC A;  4N43 C;  4Q5O A;  3T2T A;  1G9C A;  1BKZ A;  1PZ7 A;  1HB3 A;  5LRR A;  1W8N A;  3AFG A;  4PQ9 A;  1QMJ A;  4QPI A;  1PNG A;  3NNL A;  4UW3 A;  2JE7 A;  3JB4 C;  1R09 1;  3QOP A;  4MGK E;  2QZ3 A;  3WF2 A;  3GJA A;  3FBY A;  3C2U A;  5JLV A;  5FQ0 B;  5HBA A;  1AX1 A;  2O0O A;  3AM2 A;  1W6M A;  5DAP A;  4IEQ A;  5D21 A;  4QXB A;  2VUL A;  2LRP A;  5ISL A;  3H3L A;  4D6Q A;  1LED A;  4A3X A;  1KD7 A;  4Y22 A;  3I49 A;  1G8W A;  2XR4 A;  3VBO C;  3A23 A;  2X5I B;  1W2T A;  3K3N A;  2OS2 A;  3BIW E;  5C3Q A;  5JPM B;  5DPN A;  3KD4 A;  4XF0 A;  1HQN A;  2ZGT A;  2FDG A;  1JU4 A;  2RHP A;  5FYU A;  4ZHN A;  1ZRD A;  5IVJ A;  4QXC A;  2CY6 A;  3H3U A;  3ZM8 A;  1WD3 A;  1WA4 A;  4FXK B;  4XZP A;  3EXU A;  5C4W A;  4LO5 B;  2A70 A;  5EJ1 B;  5JOW A;  3UKV A;  4Q1R A;  1F8V A;  2A6V A;  3NKT A;  4AFA A;  1Q5O A;  1LJ7 A;  2QKD A;  4TN7 A;  4JKL A;  4CUG A;  3LSE A;  3BOW A;  4YLZ A;  3ZDS A;  2BOI A;  2QQM A;  4GKX A;  3ZXL A;  1JZ4 A;  5EHD A;  4LKS A;  4Q4X 2;  4ZY9 A;  3HNB M;  3TEZ A;  1Y4W A;  1W0O A;  5LW9 A;  1RYY A;  1Y43 B;  2J1S A;  2VO5 A;  3OD0 A;  5FZ7 A;  3VHN A;  1C8M 1;  2EXI A;  2ZAC A;  2E51 A;  5FXV A;  3T0D A;  2VC9 A;  3R0R A;  3WSO A;  2C9K A;  4TLF A;  5T3N A;  2VTX A;  4BIO A;  2Z42 A;  3HT1 A;  2G9G A;  2QNK A;  2I07 B;  1J84 A;  4N53 C;  1Y9Q A;  4R9C A;  2EIC A;  4DXS A;  5JOY A;  4XAE A;  3GF6 A;  3H7Y A;  3KT1 A;  2AEZ A;  2ZAB A;  3CBN A;  5JXJ A;  3WDV A;  1AR6 2;  4YZ4 A;  2E33 A;  1OI6 A;  4QB6 A;  3ZVX A;  1AHS A;  5AC9 2;  3BTA A;  3AC0 A;  4Q4Y 1;  4DUV A;  5BNQ A;  2QUO A;  5L73 A;  1QJY 3;  3BU0 A;  4L99 A;  1ZVF A;  1LHW A;  2FCU A;  1SLC A;  2IFR A;  3WG1 A;  2VZP A;  1AR9 1;  3AZX A;  5F32 A;  2VOK A;  3H8U A;  3MYX A;  1IGO A;  4LE4 A;  1CWP A;  3ZLI A;  3SEP A;  2XPJ A;  1WA6 X;  4AVA A; 
#chains in the Genus database with same CATH homology
 2VUD A;  5A6Y A;  2WR9 A;  2JDM A;  4AOC A;  2BV4 A;  1OUR A;  5A3O A;  2JDN A;  2WRA A;  4CE8 A;  5A70 A;  2JDH A;  5D2A A;  1UQX A;  1OVP A;  2JDP A;  3DCQ A;  1OXC A;  2BOI A;  1GZT A;  1W8F A;  1W8H A;  2BOJ A;  2JDY A;  5A6Q A;  4UT5 A;  3ZDV A;  2JDU A;  2BP6 A;  2XR4 A;  1OUX A;  2JDK A;  2VNV A;  2CHH A;  2VUC A;  5A6X A;  5HCH A;  5A6Z A;  1OUS A;  1OVS A;  1UZV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...