2VUDA

Pa-iil lectin from pseudomonas aeruginosa complexed with fucose- derived glycomimetics
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
114
structure length
114
Chain Sequence
ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNETAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILTNELNFALVGSEDGTDNDYNDAVVVINWPLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords FUCOSE-BINDING LECTIN PA-IIL
publication title Fucose-Derived Glycomimetics as High Affinity Ligands for Bacterial Lectin Pa-Iil from Pseudomonas Aeruginosa
rcsb
source organism Pseudomonas aeruginosa
total genus 20
structure length 114
sequence length 114
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07472 PA-IIL Fucose-binding lectin II (PA-IIL)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.400 Mainly Beta Sandwich Jelly Rolls Calcium-mediated lectin 2vudA00
2XR4A 2JDMA 5A3OA 1OVSA 2JDYA 1OUSA 2BOJA 2JDNA 2JDPA 5A6QA 1W8FA 1UZVA 2WR9A 5A70A 2VUCA 2VUDA 5A6ZA 1OUXA 2VNVA 5A6YA 5A6XA 3DCQA 2BV4A 2JDHA 2JDUA 2BOIA 2JDKA 4CE8A 1OVPA 4AOCA 1W8HA 2WRAA 5HCHA 1OXCA 2CHHA 3ZDVA 1OURA 1UQXA 1GZTA 5D2AA 2BP6A 4UT5A
chains in the Genus database with same CATH superfamily
4IERA 4C1WA 2AENA 1UYYA 4LA3A 4OMDA 3WF0A 3KV6A 2WDBA 4GWMA 2PFWA 2CNAA 1OQEA 1AX2A 1CN1A 3H9AA 2Y33A 3TAYA 1AL22 1XNDA 4CCNA 1G8WA 1PZ8A 1S0GA 1NXD1 1X33A 1MZ6A 3NO8A 4O61A 3VDDC 1UMZA 4HXCA 1JU4A 1W9SA 3NV1A 1WD3A 2GMPA 1G6NA 3ZYRA 3AK0A 2YG0A 4JDNA 1NCQB 4FSJA 1H2LA 1RVF2 3RDIA 4AI2A 5JCTA 3O0XA 2WL1A 3ENRA 5F37A 5DPNA 1AYM1 5LA0A 1X50A 1ZZ8A 2J1RA 5FY9A 3RVHA 3NSTA 3ZFFC 1MS0A 2P37A 1PK6A 3U11A 2EXKA 4DIQA 3K46A 3LB9A 3VDAA 1VBE3 2DTWA 2AGSA 2ZX4A 4AF9A 3I54A 1L7RA 1BYHA 4BA6A 2NP0A 1A78A 1ZA7A 1LOAA 3OGGA 3PUHA 4IQPA 4JGYB 4JZRA 1W8HA 2DCTA 4YFWA 1REEA 3ZFGA 4OQ8A 4Q2FA 4UWDA 3MLKA 1UMIA 3J8F1 3SMHA 1GZTA 4B7EA 3PUQA 2Y6FA 2YC2A 1LGNA 1LKNA 1F5FA 3UETA 1UMHA 4LHKA 4JV4A 3ZSLA 5CA6A 2W3JA 3ZYHA 3TEZA 5AC91 4R8HA 2HWF1 1J1LA 1RJ8A 1ZX5A 2XWJB 4K7JA 1AYN1 5LBBA 1YLLA 3RZZA 4H7LA 3UK9A 1POQA 1TMF3 4YGBA 4XVHA 2R1DA 2A3WA 2GC1A 2WINB 1IG3A 3RI8A 3EHKA 1Q8OA 2ZAAA 1R093 2EAAA 2ZGTA 3AKTA 5FY7A 4AHZA 4DOUA 2RM21 1XQNA 1AR72 2VOWA 2UWCA 3B02A 1W9WA 4WM7C 2MEV3 3DN7A 4JTOA 5A1AA 1V0AA 2Y0IA 3ES4A 2BW8A 1UX6A 4PIZA 3OUHA 1OKOA 4AEKA 5JXIA 3LA2A 4MYEA 3ZYPA 1DQ6A 4YRDA 2MPFA 2V4AA 2WWJA 3GJBA 3ZN6A 1MZ5A 2OQ7A 2ES3A 3MBWA 2QQKA 5FOJB 1ULDA 2DVFA 3SH5A 3HT2A 5FZFA 4M01A 4COYA 1OD3A 5C3PA 3KLSA 2R043 3I2JA 1ENQA 1J83A 1NKGA 4QMAA 2AH2A 4FBFA 4JRAA 1WWYA 3RJ2X 3ZN6B 2H6CA 1GU3A 1F35A 1Y4WA 1Z78A 4K1YA 1LEMA 1XB9A 2LUWA 5DUWA 3MIDA 3O1OA 1POV3 4NIDA 1DLCA 2ENRA 2Y0OA 5DMYA 4P14A 3PTRB 4LKSA 5BNPB 1RUD3 1LOGA 3TWIA 3DF0A 1FT9A 3J9SA 3WSOA 2J1SA 1XNKA 4RHV3 1PX4A 2E26A 1HRI2 2RR11 2BFUS 5DZEA 3VBOA 2ZGLA 4ZS2A 1W2NA 4Y20A 3LOIA 3NJYA 2WO1A 4OQ9A 1UZVA 4LITA 2VBBA 4FCAA 1DDLA 4RS5A 3AYCA 1UPIA 3M4FA 1GKBA 1X36A 1O8SA 2VOKA 4Y5SA 5DN2A 4GIQA 2V72A 1J59A 5J1XA 4UBHA 2WNVA 3T4HB 2X10A 2DV9A 2O14A 1RUH1 1W6QB 3S7EA 1DYKA 3SQOA 1DYOA 4JTNA 4DINB 5C8WA 1CZVA 2ZCWA 2VZRA 4DXSA 4Y20B 5F3EA 4YM2A 4RS5B 4XW3A 2GH2A 2WQ4A 4M3CE 3JQWA 4LPLA 1OOPC 1W0OA 5IVFA 4AI1A 1QHDA 2GALA 4YFZA 1WGPA 5C33A 2B5HA 1LENA 4XUOA 1BBT1 5J7MA 2ID4A 1A8DA 4LK7A 1G86A 1GNZA 1Q8PA 2YPJA 2R0FA 4QDSA 3B5LB 3LFMA 2ZX2A 3P3PA 2H0BA 3KGLA 1HX6A 5HCHA 2G1MA 1JZ4A 4CEWC 5FMBA 3OBAA 2OXBA 2WAOA 4Z8BA 1Y9QA 1M4WA 3J7NA 3NVCA 2Y6KA 2WQ8A 3C8XA 3KS7A 1D4M3 3POBA 3PVEA 1H2KA 4XOGA 3ZYBA 4FTSA 2WZR2 3N35A 1TVGA 3VBRC 4AAXA 2NPIA 4AI9A 1OLMA 1XC6A 1CQ9A 3HWJA 2WJSA 4XFBA 2VUJA 1NCRA 3Q8FA 4DRVA 1PO22 2QQOA 4K8RB 4OUSA 4YSFA 4S2DA 4D69A 2B8MA 3ZIXA 1JXNA 1WZXA 4QQOA 1RUI3 1JUIA 3AP6A 3NNMA 5ACA3 1CAVA 4HZFA 1LOEA 2ZMKA 4Y5TA 3WT3A 3LDRA 1DBNA 1O4ZA 3BI3A 1UKGA 1CAUA 2H0VA 4M3CF 4OHXA 5C8CB 1NZCA 1NYWA 1QDOA 2VQTA 5EWSA 2A7AA 1BK1A 1AL21 3RJRA 4YWAA 3AZXA 1DGRN 3AVSA 1W3VA 4RR3C 4COZA 4LO7A 2CGNA 3HMYA 5D2AA 3C7FA 3JBG3 3T2PA 3RZJA 4JGZA 1FMD2 2XJSA 3ZXJA 3PMSA 2B7YA 2AC1A 3SLIA 5FO9B 2FDFA 3I2FA 1W6OA 4KWJA 1HB3A 2P1BA 1V9U3 3NV2A 1HXS2 4XILA 4OLLA 3BPSA 1VPHA 2W2IA 4B3NA 4XPVA 5FZBA 1D4M2 2EA7A 3FFQA 5F5QA 5IT6A 1G9DA 2XWBB 3AZYA 3PVNA 1H8TA 2HWE3 4DB5A 4XUQA 2VOVA 2JIGA 3PUSA 5K4LA 4FVVA 2HLEA 5EXOA 1AR63 3R4UA 2BBVA 2WN3A 1BKZA 3MPPG 4GULA 1RINA 4I3GA 1OKQA 4BXFA 2JKBA 1LHNA 4DUWA 4XCBA 4O7XA 5FP9A 2VVFA 4AVBA 3IDBB 4HL0A 5JXJA 3WDVA 1C3HA 5BNNA 4IUGA 4BYYA 5FBZA 3GNEA 5C6CA 2J42A 1NE4A 3PIGA 4DY3A 5A3OA 2BBAA 4FOWA 1V00A 1RUJ2 1UWWA 3BN6A 1MS8A 2E9QA 4MOAA 5T54A 5A6YA 2R063 2WIIB 3VBUC 2RVAA 4QPYA 1U5ZA 4RGKA 2BGCA 4JX0A 3ZXEA 3MV11 4Z1VA 4EROA 1WLDA 4NAOA 5T3NA 4YG6A 5CG9A 1XYNA 2AR6A 4J6GA 3W58A 5K9YA 1RUG2 5IVEA 3LDKA 5LEKA 4K8FA 1CZTA 3JBG2 2A3XA 4P00B 2B4KA 2BU9A 3CLPA 3H50A 1DGWX 1LHVA 2B46X 1AXKA 1PVC3 3CNAA 4AEDA 1GYKA 2HWB2 4AEJA 5EFUA 3EO6A 4C0HA 4CDWC 1AR71 1X7NA 1ULGA 2IXJA 3KVAA 2EXIA 2ORZA 4DXTA 4EQVA 4LIVA 3BUCA 3V0BA 1VBC1 2Z5WA 4FPKA 3N7MA 4JKLA 2HWE2 4CDUA 3ZFEA 4W8JA 5GLUA 1BMV2 2L9LA 1S0DA 4TLFA 4HK9A 2XVLA 1AR83 5E16A 3WX5A 4COVA 1DQ2A 3H1MA 3ZXLA 2GN7A 2I07B 4UI9L 3V0BB 4UW4A 2JENA 1AUYA 3VKOA 1TME2 2GH8A 4CDUB 3JD71 3O1RA 4D94A 1BLZA 4F8AA 1VBB3 2EXHA 2ZABA 3V0AB 1SCRA 3K51A 4AR2A 4CEYC 2OPKA 1SLTA 3O12A 2PHRA 2ZEXA 1GP5A 4E2SA 1URXA 2EIBA 3JUUA 5BNOA 3GYDA 4H14A 5EYYA 5JMOA 2Q4SA 1QH6A 1HRI1 1S0EA 4PCRA 5CFCC 1OLQA 4Q0UA 3WQ7A 5LZ6A 1W0NA 4FPGA 5DDJ2 1BHGA 4IESA 4NOTA 4BLIA 4D7TA 1FATA 3KT4A 1QJEA 3RZKA 5IJRA 1F5JA 3PHMA 4TXWA 1CR7A 1FOD3 4AVCA 3VBHA 3CO2A 2FCUA 3CEWA 4K40A 4L92A 2OUJA 2VMIA 2ZGOA 3HPNA 4X6QB 5C3QA 1BQPA 4NVPA 4AZZA 1PM4A 2XONA 3Q8BA 4HPKA 3S0MA 3EYPA 3KVBA 4Q27A 3D0JA 3EXUA 4YM0A 3I3EA 3Q8EA 4QX1A 4MGSA 3IMMA 5KR7A 2PLV3 1O5UA 5LBCA 2W94A 4GMP3 1N1TA 1NCQC 2DDUA 1ENRA 4WM8B 3VBHB 2BNOA 1U12A 1VBD3 3JQXA 4MGIE 3IPVB 1Y7BA 4CP1A 5LASA 4CDQA 4HPKB 1OUXA 5A7WB 4A7YA 1FYUA 2FHRA 2JB4A 4DY5A 1V6NA 3ZIWA 3KCCA 2HBTA 4H55A 2CTVA 5DZGA 5FZ7A 1W2OA 3R4DB 1PM7A 4XFIA 4C0BA 2E53A 1CX1A 1W9TA 1CJPA 3DUIA 2QVSB 5IW0A 4JGYC 2BDRA 4Q8LA 3AMQA 3TNQA 4AEMA 4CDQB 3N9MA 2OZJA 1UY2A 2NLRA 2Z42A 2VTFA 2ZEWA 1JHNA 5FWEA 3WY6A 5K0UC 3QH7A 3VDDA 4ASMB 3K3OA 4D3WA 2K9ZA 3HN3A 3GBGA 4KG8A 4DQAA 5AFBA 4JDMA 5I8TA 3BU0A 1PIV3 3BIWE 4N53A 2E7TA 4NRQA 1PVXA 3OBRA 5D8AC 4AGVA 2W1WA 3LEMA 1YFYA 2RG4A 2D7FA 4W4ZA 4ES8A 3TEYA 1KGYA 2OVUA 1I6XA 2UURA 4ZU5A 4F83A 3QD6A 2PAKA 3PNAA 1Q3EA 1WW7A 2PYTA 3BOWA 3DPRB 1H6YA 1KEXA 1W6PA 3HD8B 1LAJA 1CPNA 4GB33 1FPN2 4E4DX 1VAKA 4LKEA 4IV1C 4JCKA 3MIBA 3AX4A 2BYVE 1OC1A 4FP3A 1Y9GA 5FPLA 2JDPA 3WD5A 4ZY9A 4YG3A 3AP7A 1GANA 4LBQD 2GZWA 2CY6A 4MSVA 5A7SA 3KD4A 3OGJA 1FMD1 4UAPA 1DZQA 3M2MA 5FDBA 2XGXA 5LK7B 3C3VA 5FY4A 2ZGQA 1NY71 4N7UA 1CIYA 2UYBA 4I30A 4AQTA 1NXMA 1Q5OA 3MF6A 1HXS1 4CCOA 1QMJA 3KT1A 4QX8A 2ZGPA 3H0OA 3J7LA 3N7LA 4BU2A 2XPJA 3KHCA 2RMU2 4OI0A 4Q5OA 3NL1A 4IETA 4WVMA 4BK5A 1JW6A 2VE1A 4N90A 4MLOA 5H9SA 1DZRA 5JIUA 5E89A 1Y43B 3E6CC 5A33A 3CJIB 1C1FA 5BNPC 2I2SA 4KU7A 3ILNA 2B9UA 2Z69A 4YZ4A 4W6XA 5CB7A 1ODNA 2HEYF 2CAUA 3FWEA 1JZ7A 2CGPA 3TN92 4WM7A 1D2SA 2VJXA 1W9YA 2W87A 5FYMA 4CDXB 1NLQA 1RXFA 1CONA 1UOGA 3NV4A 4URTA 4ES9A 3TRSB 2VECA 3M7AA 2YFUA 1TNRA 1RUJ1 5TSWA 2DU0A 4A7ZA 2YBSA 5A33B 4D0QA 1AYM3 3DV8A 5LA2A 5FP3A 4ZZ5A 2RS12 2DUPA 5A32B 1PGL2 1S2BA 4LA2A 4FAHA 1QJY2 2D6LX 2LTNA 4NE9A 4Q1PA 1Q8QA 4KL1A 4RFT0 5C70A 4XHBA 5IVJA 1RUG1 4QPWA 5DZFA 3VHOA 1UZYA 3VZLA 5GLWA 4LTAA 1JZ8A 3I3MA 3PMEA 5JVVA 3J8F3 3T2TA 4HN1A 1IQAA 3FJSA 4PF5A 4QB6A 4ZU4A 1EP0A 3KZ4C 3LDBA 2JE7A 2HWB1 5FLIA 5AVAA 3GJAA 4AI0A 2VY0A 1WW6A 3FUQA 5FMOS 3D5OA 2HWF3 1FXZA 1OI6A 1AYN3 1NUKA 3WQ0A 1HB2A 3PIJA 3SXWA 2JICA 2HEVF 3LE0A 3AKRA 1BMV1 4FOQA 5DAVA 1YCIA 5FYBA 5FFOC 4X6RB 1QGLA 2IUWA 4L11A 2D5FA 1HV1A 1DCSA 2RM23 2D3SA 2JG9A 4CUAA 4CYDA 1DFQA 3AYEA 2XBO2 1G9CA 1TME1 4Y4YA 1QXRA 2V09A 3K4DA 1LOFC 2D97A 1SLCA 2YGMA 5ABJC 1F31A 1OOPA 1KDMA 1Q43A 1YQ2A 4B8EA 2ETEA 2RV9A 4SBVA 2R49A 1Q8SA 5FOBB 2HWC1 4AG4A 1PO13 2ZKLA 2KD7A 2VNOA 5IFTA 2WFF1 3LPGA 4GWJA 1KDKA 1DQ4A 3VD3A 4DMIA 3ITQA 4ARYA 5H9RA 3VBFA 5C8CC 2IZWA 5DDJ1 2OYZA 2P17A 2JX9A 4PIXA 4QXCA 4P9WA 3RZMA 4CEWA 5BYNA 4A6SA 3OEBA 1NLSA 4QDQA 2JDAA 2PHUA 5FY5A 1O3SA 1VRH1 2G19A 1JN2P 5C3OA 1H0BA 5LK5A 5AC92 4RQPA 1YO8A 4V1PA 1KITA 5FV3A 1OUSA 3MI8A 2QDNA 2QQWA 2RR13 4HBNA 4ZXKA 3A0KA 3VBFB 4DO0A 4I09A 3AMPA 3AXEA 2XQXA 3J7MA 4QHZA 1MEC2 1OLME 4CCCA 1DG6A 2OW4A 4R52A 3CZUA 4BQ3A 2LRPA 2R072 3ZVXA 1F8VA 4PQQA 4RQPB 3FC0A 1HN1A 2RM22 1UYPA 3OGSA 2PQQA 4MV2A 1QJZA 4XF9A 2VTXA 4AFCA 5FQ0A 3ZR6A 4FXGB 1WA4A 3ZPYA 3DXUA 1LU1A 2YC0A 4ATEA 4NJ4A 4YW3A 3GXUA 3HOBA 3VBSC 1B35B 3GM8A 3N9PA 2P5BA 3U0ZA 3HBZA 1DP0A 5A3MA 4MHRA 4AQSA 4C1XA 5KC6A 3ETQA 3ON7A 1X9PA 2Q0AA 4QQ2A 3WP6A 1BBT3 1E5SA 1EV11 1XE8A 2ZTNA 4QPGA 1IZ3A 5IK8A 1W28A 4U36A 5JDBA 1RL3A 4NHYA 2VQ0A 5FXXA 2BUKA 2WLQA 1VRBA 2WKKA 4EZ4A 2XOMA 3OPZA 1YJKA 3KM5A 4P5HA 5FUIA 1GR3A 1ZZCA 2XG3A 3OGVA 4RD7A 4NIHA 2DVGA 4PJYA 1JU3A 4NRMA 1L7QA 3SEEA 1QIQA 1RUE2 2YMZA 5CU1A 2OT7A 4HLTA 4IGOA 2DFCA 1ASJ2 4B1LA 1QEXA 3T4VA 4KNCA 4ZZ8A 1AHSA 3PUIA 2E7AA 3VD5A 3IDCB 2WT2A 5A3PA 3MW3A 5DUXA 3WHTA 1REDA 2FDGA 1FPN1 4IE7A 3U75A 4K6BA 5CFDA 5JXGA 1E5HA 1LGBA 3VKNA 2XMLA 4RFRB 1CAXA 5A6ZA 1RUH2 5KWRA 1YHFA 1AZDA 1PNGA 4Y5Z0 4QT6A 4UOJA 4Q4Y2 3ZO0B 5LEJA 4HANA 3WG3A 2UU8A 2MHFA 1B09A 3WNXA 4JVAA 4QX5A 2VTXJ 1NAEA 1AVBA 4FOYA 2BVVA 3H8XA 3VBUA 5CFDB 2XDVA 1UNBA 4PDWC 3ZN5A 2LROA 2XUEA 5GLTA 3OCPA 5CVRA 2RDSA 1XE7A 1AL23 4LO5B 2RMU1 2D6KA 4XEZA 3WQ1A 5HPOA 4BISA 2YBPA 4NWVA 3OYWA 2PAEA 5FAXA 2JWPA 2YB7A 4E4SA 5GZEA 2B9VA 3KV4A 1GUIA 3TN91 4CVUA 3VLBB 3OY8B 1O3RA 2ET1A 2YC4A 1QJX2 4XBQA 1ND3A 3LSDA 3MLJA 1BEV2 5FYVA 1CD3G 1QQP2 5LY1A 2JDKA 3IIAA 4N43A 1LR5A 3C7HA 4S2GA 3V56A 4E27A 5T55A 3MFCA 2ZA9A 2QTWB 4LO4B 2W1SA 1GSLA 4YVSB 1XRUA 2RS11 2V5YA 4KWLA 5HCAA 1PGL1 2HYKA 1N3QA 4G3YC 1QJY1 1QF3A 3GCXA 4CUBA 2VZPA 1X8MA 1ND3B 1UU4A 2R16A 2CWSA 2XKOA 3AKSA 4RYDA 4B29A 4YNIA 3THCA 4C91A 5JIAA 4N43B 1JH5A 1MQTB 3DYOA 4WM8C 4XABA 4E8CA 3BTAA 5HCBA 3MIEA 2E7QA 5F5CA 4XFGA 3TBDA 3GF6A 1I3HA 2D43A 1QY4A 3FN9A 2XHNA 3MGUA 1SQ4A 3W9AA 2XL7A 1VMHA 2VXRA 2Y6LA 1WKYA 4YGDA 4ET7A 4CXYA 2QUOA 1KFUL 2W9XA 4URAA 4AGGA 4I0WB 2XKPA 2A1XA 4BZ4A 3D0SA 3OF1A 5KBFA 1IS4A 5IVCA 1MZEA 5A3LA 3BYWA 3D8CA 1UQXA 3P1IA 4R4XA 2VZVA 3SISA 2GNBA 1EAH2 2ZXQA 3N9OA 2PHFA 1JS9A 2ZHLA 2EICA 3ZPOA 1A8MA 3O1VA 2C1FA 3V64A 1XBFA 1D7PM 1AR73 4L0PA 4NHXA 2XBO1 1VBC3 4YZ1A 1H6XA 4BK4A 2FDHA 1WLWA 1LESA 4WVVA 4UFHA 4LMFA 2FQPA 3GCWA 4PLOA 2C26A 1I9RA 5KXBA 1GOGA 4IEZA 1UZWA 3DPRC 1H1IA 3E6BA 3ZKUA 3WCSA 4D7SA 3E1F1 5HXVA 2P34A 3JD73 4IDZA 2Y6JA 1LJ7A 1PK6B 2WZEA 1O6UA 4LT5A 2Q1FA 2WUHA 4IW3A 3GHNA 4JKKA 5SV8A 3BTXA 3APBA 3ZFGB 1TEIA 2A6ZA 2QQNA 4I01A 4IV3A 4FPCA 1OFSA 1HRI3 1UYZA 1KXGA 4YW7A 1HLCA 3SKVA 3EQEA 1O8PA 2XJPA 5HBAA 3W20A 3KQRA 4BQWA 5FR3A 1GBGA 1W05A 1MEC1 3BB6A 3ETPA 1HIXA 3ACFA 3KHBA 4N7IA 5BUVA 5D8AA 3I49A 1O3TA 2CYFA 5F2WA 1A34A 2R071 3KF5A 2ZGKA 1LEDA 5C3RA 2HJIA 3ZXDA 1W2TA 3INAA 4IV3B 5C4WA 4JAAA 4NN0A 3U1XA 5EHDA 5JLVA 1VBC2 1UKRA 5C71A 2B39A 5GKAC 5JWPA 3RZGA 1XNCA 5A6QA 4I0BA 5HCFA 1Z7S2 4QGMA 5A7QA 1KJLA 4QX0A 3W5MA 4CDXC 4META 4Q26A 1BVVA 2VNVA 4BJ0A 2VW0A 1TE1B 2ZGUA 2O8QA 3LPFA 5C4WB 2PXJA 3VKFC 1VP6A 4UW3A 3C7GA 5FK8A 4NPLA 5FK7A 5A1FA 5F8PA 3I2GA 3JD72 1NA1A 4Z07A 2VZQA 1RB8G 1A3KA 5J48A 5K7PA 4YW2A 1RUE1 1O4TA 4WZFA 4FPOB 2VBDA 1SDDB 4PBPA 3PU3A 3WEZA 4FT8A 1ASJ1 2I45A 4XQDA 5EYXA 2WZR3 4QPIC 2BTVC 1NA1B 3VGIA 1FNYA 3JZVA 2DURA 5C7GA 5FY1A 2JEMA 3O1TA 3NNJA 1LOCA 3OJBA 2EIGA 2JDHA 1PO23 5FO7B 4D6SA 4LOSA 1W04A 2CDOA 3T0BA 4XHXA 1UZ0A 3USUA 4IEVA 4Q4Y1 4P5YA 1SPPA 1YRZA 3VBOB 4E2GA 1ZRRA 3I3BA 1QKQA 1ZA4A 2IXHA 4QD2A 1ZM1A 3H7YA 2V5DA 4LQRA 4W6WA 3VD4A 3UYJA 3H3ZA 4LOTA 2LALA 2WNVB 3L2HA 5FZ1A 1R082 1W3XA 3VZOA 3BTYA 2GC0A 5CEHA 5I0DA 4ONUA 3IDEA 2QQMA 4OZXA 2QDRA 4BIFA 3R4SA 3AYDA 5JR2A 2X29A 1W6MA 4AHXA 4Z92B 3IN9A 1C5HA 1FMD3 1WCDJ 2PHXA 2Q1MA 3OPWA 4MHUA 4S2HA 3ZM8A 1NQDA 4LIUA 3T0AA 1HXS3 3AVRA 1QJX1 1SMVA 4XTMA 5J09A 1BEV1 4Y24A 1QQP1 3ZDVA 3CKHA 4HT1T 4WVWA 1W6MB 4NAMA 5EJ1B 5GLVA 1UY4A 1ND2A 3U14A 4YVWA 2QNKA 3KMHA 4XBLA 4AQ2A 1J3QA 3TNPB 5C9AC 2HEWF 3OSDA 3MIFA 4Y1VA 2ZGMA 1WCQA 2DBNA 5A3UA 2NMNA 2EAKA 3ZN4A 1BXHA 3FLPA 5CADA 2F6BA 1RUJ3 5ABJA 1SLAA 1ND2B 1G9BA 1MS5A 4YVWB 1YQ8A 4GKXA 3MYXA 4XTPA 2VZ1A 3UT0A 1NCRB 3ZSMA 4QX7A 5FZOA 4B4RA 5SV5A 2PHTA 5FZLA 4QGNA 2PELA 3AMHA 2NYYA 3ZR5A 3GBWA 1CWPA 3DXTA 3DECA 5FZHA 4MO3M 1RUG3 1YFXA 3NJZA 1CAVB 4XJZA 2ZKNA 5IFPA 3NNGA 2YXSA 1B35C 5FZ8A 4FQZA 4LLOA 1E5RA 1CAUB 1QOSA 5EP9A 3D6EA 5FXWA 4BB3A 4GAZA 4PLNA 1EAH1 1NY72 5FZOB 4BM8A 4E4HA 1SACA 4UFJA 5KHJA 2HWB3 5I93A 1EPZA 5FXVA 4WV8A 3KGZA 3TYJA 3POIA 5FZIA 4A45A 5A7NA 4Q0PA 1ONAA 4CP9A 2Y34A 5DABA 1YFWA 1GWMA 1H1MA 3TEWA 1O59A 1QXJA 1W99A 1DIWA 4GXLA 3WNOA 1C57A 4JGZB 4WBBA 2V4VA 3SHRA 3ZYFA 2OA2A 4P08A 2IWGB 5L7OA 4JHTA 4MVTA 1V70A 4OHVA 1W6OB 1OXCA 1S1AA 2NMOA 3K4AA 2Y60A 2P3YA 5IAVA 3S5QA 2KXLA 4XQWA 1LECA 4CZSA 5JOXA 2WO3A 5JZGA 1JYWA 1VALA 3CBNA 1SDWA 1H8TB 5F5AA 1TME3 3ME2A 3T1LA 2Q8EA 3IBMA 4LHNA 1OA2A 1IPKA 4A42A 1DZTA 3LCPA 3VBSA 3WDXA 3UGFA 2VZTA 2EXJA 1JYTA 3WW4A 1F2NA 2Q8OA 2ARAA 2WNUA 2NZ9A 2VMGA 1U5IA 3WG4A 2PAMA 5A1LA 5BNNB 2WFF3 4CPBD 3B7MA 3RFRA 1UYXA 1V6OA 1J84A 2E6VA 3I2IA 4KGQA 4LE3A 1IGOA 5DDJ3 4Y3OA 2J1EA 2NQYA 4PI2A 4RA0A 1K5MA 3NAPC 2BEOA 4OCTA 1KFXL 1VLNA 4XC9A 4M0HA 3WHUA 4GH4A 4ZHNA 4ASLA 1HQLA 1VRH3 3ZOIA 4CCEA 5J36A 3KCXA 1G7YA 1KQRA 2C4XA 4INDA 1SLIA 4DRRA 2ATFA 3NJXA 5HI0A 3T30A 1DHKB 1MACA 5JXHA 3LA7A 4HSJA 4KH9A 2QQIA 3UL2A 3N4MA 4MG2A 1K5MB 1OD5A 3FLRA 3ZX7A 2VQAA 1Z7S1 4AEDB 3AM2A 4N8MA 1PZ9A 2J1UA 4GH4B 5F1RA 4YG0A 2BOIA 4LBQA 5EPAA 3UJQA 4BE3A 1OT5A 4GA9A 3RGBA 3WW3A 5LA1A 3POGA 3GZEA 4YVSC 2YDEA 1QU0A 3ZFEB 4AQ6A 3N36A 4H3WA 4CCJA 4TN7A 1K5JA 2FCTA 1FAYA 2J22A 3QBQA 3WW1A 1OH3A 1Z0HA 4UF0A 4PDWA 4XAAA 3BALA 1AXZA 5DXDA 3N3HA 4AGRA 4YARA 4LBQB 1K3IA 3AZVA 4L2NA 2HWC2 3LQCA 1MQTC 3THTA 5FPUA 2JG8A 2WFF2 4E9KA 2AREA 1VBE1 4QU1A 4D8MA 5A3TA 4IEOA 4AVSA 1QJU2 2XLGA 3DGTA 3IKWA 4NO4A 2ERFA 2C5DA 2W92A 4UW5A 3U4SA 2X5IA 4IE0A 5L19A 4UF0B 3OEAA 2WA4A 4QB1A 2J7MA 1WLTA 4MXWA 2C9AA 1JOPA 3PTYA 3SH4A 5BNOB 4HVRA 1VRH2 4KWKA 4UXAA 2OKXA 2JG8B 3QH6A 1K12A 4A2UA 4COUA 4BXSV 2VQUA 4LHLA 1AL0G 1PMJX 2IFRA 1C1LA 2BWAA 1JOBA 2DTYA 3RNSA 3VZKA 2WZPP 2X5IB 2IXCA 2QCSB 3IIIA 1ZNPA 1ENSA 3AFKA 3POYA 3WDYA 4TSVA 2WN2A 4JKMA 1FPN3 2VULA 1GP6A 5GLZA 4COWA 3ZMNA 2ZHNA 1RUC2 1R081 1O91A 4NR1A 4GD4A 5LRSA 1ZBE2 1S0IA 2IXLA 2LS6A 5IVYA 1HRV2 5AFEA 5IAXA 4PI0A 4S2FA 3A22A 4YW1A 2WC2A 4OI1A 3Q8AA 1RHI2 5KHGA 3ILRA 5T5JA 5HV4A 3N9LA 3ZSKA 3ASIA 4CXWA 1SHWB 1ULFA 2QZ2A 3DYMA 3LF7A 3POJA 4A44A 1L7LA 1ULCA 4ZU7A 1WUVA 4RGAA 3AXDA 1QDCA 2RMU3 1EV12 3FL7A 3OB8A 1OQDA 4EN7B 5A7PA 4P9XA 1OLRA 1SFNA 5FP8A 2GNMA 3LKJA 4YW5A 1RMU2 3THPA 5J98B 1F4HA 3ZFGC 5FBJA 3TN93 1EYBA 2ADEA 5DUUA 3SH3A 1IS6A 3PDQA 2W1QA 3VDDB 5FPVA 3ZFFA 1UXXX 2W0XA 3WP4A 4AI3A 3NQHA 3JCIA 1DQ0A 4N53B 4K21A 2RS13 4HN0A 2BVBA 1I5ZA 4YGEA 4Q0QA 3IAQA 1QJY3 1H8VA 2HWD2 4PLMA 4ZONA 5DUVA 1MS9A 2WT1A 2WR9A 4DS0A 4CCMA 2ZAHA 1KJRA 1UOBA 3ZFFB 4AW7A 1FV3A 4GJYA 1W6PB 5F2SA 1XNBA 4AFDA 1NZIA 1T6GC 2RJLA 3IMNA 4NWWA 4P9LA 2FDIA 2GC3A 1N1YA 1WW5A 3GZTB 2BWCA 3VN4A 1YQ6A 2ZOEB 1YI9A 3WCRA 1RTVA 3UESA 1X9TA 1I1EA 4MGQA 1VR3A 2ZBJA 5FZ4A 1IHMA 3SKJE 3FBYA 2VCCA 4IEWA 1MS4A 2DUOA 5FCCA 1OF4A 4QU2A 3PUAA 2WNOA 3LD8A 1N3PA 1GNHA 1WCKA 1J3RA 1LHWA 1N1SA 2EF6A 1W9FA 2VD7A 4HONA 2QJVA 5FZDA 2VZUA 5GZFA 4WVMB 4EN8B 2JE8A 5FYTA 4UFLA 2XBO3 3NKTA 1JYCA 2XHKA 4SLIA 2DCYA 5HV0A 5L73A 3M3CA 3FX3A 3EB7A 4XBNA 1WCUA 4MH0E 1OA4A 3WW2A 1J58A 1GOFA 4LE4A 3VL8A 2WS92 4RL7A 4WM7B 5FMCA 4AOCA 5FLJA 2PN5A 3VBOC 1LRHA 2VZ3A 3N9QA 3J7HA 3W21A 1UY3A 4RSUA 3RZHA 2DCZA 4RS5C 4LNVA 3I59A 5FP4A 4Y22A 3FHAA 4BOWA 4L8QA 3S57A 1W6NA 2X53S 2Q8CA 1RUOA 2R6QA 4NPMA 5FKBA 4DEVA 3WVJA 4FPEA 1N3OA 1DQ1A 3AKPA 3SCHA 1VMFA 2VMDA 2YV8A 1WA6X 5FYHA 4NHLA 5AC93 5JAXA 4Y26A 4AXOA 4M3CA 4Y22B 1TNFA 3TEXA 4XF1A 5DAWA 3LEKA 4GWIA 2FZ2A 1W6NB 2QQVA 4TLGA 3B01A 4BQ4A 2RJ2A 4KBBA 4KMQA 1MEC3 4LBNA 4LKFA 3WNLA 4CCDA 2WAAA 1OFNA 3HNBM 3I2DA 2E31A 3RWNA 4LO6B 2R073 3WOGA 4R9AA 3O1MA 4TWTA 3UKNA 5LA9A 2VL4A 3HQRA 3HBKA 4EYUA 1N1VA 3E5QA 3ACGA 2P3KA 3RI9A 1WD4A 2YU2A 1YEWA 4P9JA 1HQNA 2W52A 3MIHA 1SZBA 3WQBA 2VUAA 5FY0A 2DVAA 5FRAA 5APAA 1T2XA 3I7DA 2RJKA 3TB0A 3BOPA 1SCSA 2JG9B 2WABA 1HB1A 1ZBA1 2UY8A 4BQ2A 1UOJA 1ENXA 1COV2 2QQUA 3HNMA 2W68A 1QJU1 1ULEA 2VZOA 2XJTA 4FQ4A 4NIGA 1W0PA 4D7YA 4EV0A 2D44A 3KSCA 3MFAA 1OOPB 3ZYGA 1H2NA 2XVGA 3B9CA 2G4IA 5JSRA 1GV9A 2JD4A 2KA3A 1QOOA 2WT0A 1RUE3 1SLBA 3KB5A 2CAVA 4GKYA 5J37A 1GZWA 1W8UA 3LAGA 3VDCA 1ASJ3 1NOVA 3VBRA 2K2SA 3T3YA 2YU1A 3ALQA 1NG0A 4XF3A 4PQ9A 2RDQA 1AR92 1JYXA 4CEWB 2D6OX 4V2WA 1JODA 3MUZ1 2YYOA 4KI5M 1UF2C 1ODMA 1RUC1 5C9AA 4UFMA 4Z82A 4DPNA 1SG3A 1MZFA 4R9BA 1DGRA 1RUH3 1UN1A 1ZBE1 1PVC1 2O8OA 2UWAA 3AP4A 2EIEA 3C7OA 4XMIA 3B93A 5L9BA 2XJUA 3DKWA 4Q4Y3 1HRV1 1R1A2 3VBRB 3N9NA 1VB4A 2JJ6A 1E57A 1RHI1 5ERLA 2CU5A 2QQPA 1UW8A 2IXKA 1ZZ7A 4HKWA 2ZACA 1FV2A 4IEQA 2D6PA 2G9FA 1QXPA 3ZYIB 2JE9A 3VKLA 1CX4A 1H8TC 4HVOA 4R9CA 5DAPA 2VH9A 5FQ0B 3KQ4B 4RR3A 1CAWA 2VPVA 3H8UA 2R1BA 2P4EA 2GNTA 2A75A 3A4UA 4C90A 2BRTA 1RMU1 2SLIA 3WV6A 5IUQA 3ZLIA 5BNNC 3LA3A 2QQJA 4QAWA 5BY5A 2IC1A 3JB8A 2EIDA 4AVAA 4LUMA 4OHZA 3SNMA 1NE6A 1W8TA 1W8WA 2VR4A 1QJX3 1TG7A 4P9YA 1UXZA 4QPGB 4RR3B 5ANQA 5FZGA 3BTZA 4H2AA 1BEV3 1GNYA 3FE5A 4XUPA 1QQP3 2DWRA 3E5XA 3WNPA 3I2OA 2WNEA 1ZRFA 5JOYA 3NRUA 4JC1A 4XJ9A 3FHIB 4Q0SA 5LATA 2PA7A 4EZHA 3GDBA 4GALA 2DU1A 3VZMA 3M3EA 3WXPA 2W5FA 1DF0A 2TNFA 4O9GA 2HWD1 1CGPA 1OQ1A 4B7KA 1UOFA 3P3NA 2OPWA 1S0FA 4LBKA 2BZDA 1FOD1 4ITCA 4P02B 4XFCA 5FPAA 4LJHA 2ADDA 5ISLA 4AEDC 5LBFA 5FY8A 2YPDA 3R0RA 1EPWA 4ISRA 1JZ6A 4HVQA 5BXXA 4XURA 1TZOA 1GMMA 1GQGA 2CWMA 2BQPA 5FP7A 1V6JA 2WSUA 3IM0A 4MGKE 3THDA 1CAXB 3P5BA 5CBLA 4CDUC 3ZFEC 5I0TA 2Y8KA 4ZKTB 5T50A 1W8ZA 4LR4A 2P3JA 2HH9A 2XB6C 4LHSA 4AVVA 5LRRA 4DXRA 3T08A 3MPBA 3URFA 3VBUB 4W65A 2A5ZA 1HQWA 5FLHA 1WBLA 3TOJA 2WO7A 4CRQA 1EAH3 1ZVFA 3HAGA 1XU1A 2HKXA 2WSVA 4CDWA 2RS32 1M06G 2WBKA 3DCQA 2Z4FA 2P6HA 3LZZA 4KG0A 4FTBA 3ACLA 1Q56A 5AVPA 5E88A 5E6HA 3OYWB 2JDZA 4BHPA 4B4PA 1JYNA 2BNNA 5BNOC 3WZ1A 4ASKA 1IKPA 2R0HA 3O14A 4QB2A 5KHHA 5ACA1 2WS91 4FFIA 3EBRA 4LORA 4CDWB 2XVKA 2D6MA 4Y1UA 2RS52 3A23A 2FDJA 4PBOA 2P6CA 3ZXAC 2C9KA 4XJWA 5EZWA 4LLFA 4D6QA 4Q4X1 1W8FA 5E8AA 2A6XA 2D3RA 3C2UA 3ROUA 2GNDA 3VBHC 2Q5TA 4JRLA 1UZZA 2W46A 4P9IA 5FREA 4CEYA 1XYPA 1POV0 1SFYA 5LY2A 5JOWA 2NM1A 3ACIA 3LSEA 4FAGA 4U2AA 2W95A 4LBMA 5FZ3A 2GSYA 4BQYA 1HJGA 3SCFA 4MGZE 5EQUA 4V2VA 2Q1ZB 2B45X 5CFCA 3X29B 1XNAA 3I3DA 3NV3A 4AHWA 1VBA1 3OPTA 3G7DA 1C28A 1C8M2 4AWDA 2VVDA 4CDQC 3VHNA 3RYRA 5IK5A 2OUHA 3AMNA 3K48A 4Y4RA 3GHMA 2W47A 2ZEZA 3K75B 5CFCB 3VZNA 4BCUA 1UPSA 4RGGA 3ZKYA 1SLLA 2VZSA 1IQDC 1F9KA 4JDOA 2ARXA 3BCWA 1NCQA 2VMEA 3M3IA 4GJZA 4LBOA 3J4UH 5LBEA 1Z7S3 4B4QA 2GU9A 1CZSA 5FYCA 4N9HA 3ZXKA 5G05L 4Q4W2 3M70A 2CGOA 3UV9A 1YNAA 3O0VA 2J1AA 1GP4A 2CSGA 2VOTA 4IE6A 5FYIA 3RQ0A 1COV1 2E32A 4N53C 3CQOA 2TBVA 4WVZA 5GZCA 2GP3A 3PVOA 3UJOA 2QZ3A 4JGYA 4AL9A 1BJQA 3PJYA 3A7QA 2NN8A 4A7KA 1NT0A 1LHOA 1RUF2 2B42B 3FBMA 5A80A 2GN3A 1XU2A 5FJHA 5C3SA 3B3QE 2LW8A 1UU5A 2VO5A 4Q4V2 5K0UA 5A6XA 1DGWA 5IYYA 4M00A 2QBXA 3A0NA 4QDRA 4FXKB 1AR91 1RGSA 3HJRA 5BV6A 1VMJA 4XJ8A 5FUNA 2X05A 5JUVA 3NMBA 1VIWB 1DU3D 4CSWA 3KV5A 4QKBA 4XJUA 3WNKA 5KXEA 1H4HA 2A3YA 4OFGA 5DQ0A 4LULA 3MO4A 2BERA 2UWBA 1YC61 4L97A 4QHOA 4DFSA 5K0UB 4AK3A 2QFEA 3CJIC 1R1A1 2XH6A 1QWRA 2XLFA 3E97A 1IG0A 3VD7A 4XIOA 5F7UA 2VUCA 3BVCA 1H30A 5D8AB 3ST7A 4IV1A 1DYPA 3L2YA 2G9ZA 1AJOA 4FPHA 4MGYE 2ZX1A 1Y9MA 4E4ZA 3H7JA 1R083 1XSRA 4TYSA 5L9VA 3WDTA 1XNTA 3O7OA 4PIYA 4CCLA 1L3JA 4HFSA 5I0UA 2PQSA 2FCVA 3DYPA 3WDUA 4IV1B 3QOPA 1HKDA 5F3IA 3VKMA 2XL9A 3RMXA 1XXNA 4A4AA 3WLUA 4K20A 1DQ5A 1UX7A 2ZX3A 4GZ9A 1H4GA 2G9GA 2UY9A 4W6YA 4XFAA 5CZKA 4FPYA 1XE0A 4OI2A 1VBE2 2DVBA 1LHUA 2FBEA 1PO11 5BNPA 1T6BX 2QKDA 4Y33A 4BQ5A 3H42B 1BZWA 3POSA 2DYCA 4YZ2A 3PJQA 2EALA 3AB0A 2R7EB 5L36A 3DEMA 3AP9A 3OOXA 4BPZA 3IT8A 5KXDA 4F7ZA 4AHYA 3M3OA 4CP2A 1CIWA 4FFGA 3O1PA 3LFIA 1AX1A 4QQLA 2DCKA 3H8OA 3ELNA 1GLHA 2YFZA 1W6QA 2SBAA 2WWSA 4CPBA 1YFUA 4XAEA 5EJ3A 5F32A 3VHPA 1TMF2 2JDYA 2XUMA 2Y64A 4OUMA 1W90A 4OUEA 1LB2A 4QHBA 3USUB 3D3AA 1RYYA 1SPPB 1R092 1HJFA 3MLLA 4IL7A 5D1IA 2CDPA 5FWJA 1OA3A 1IS3A 2OIIA 4A3XA 2VC9A 5JOZA 3V65A 5LB6A 4CU8A 2MEV2 2VW1A 3ATGA 3POFA 1WBFA 2JDUA 2N7GA 3Q8CA 4XACA 2ZGRA 5CNAA 1CPMA 2JG9C 5FYSA 3ZYJB 4BQ1A 5HXMA 2RS31 4NRPA 2AEZA 1SFPA 2XJRA 5CAZA 4QM9A 1O3QA 3OGRA 4FFHA 3OUJA 4LBLA 4EE2A 4AYUA 3WF1A 1YIFA 5D21A 2RDRA 2R042 1QH7A 1W2UA 4Q0VA 5FKCA 3CF6E 4EJRA 5BNQA 5C5TA 2JDNA 3F2ZA 3LGRA 4A3ZA 2ZGSA 2FMDA 3GZAA 1G9AA 2DUQA 2RS51 4EWEA 2CV6A 3VBFC 1PMIA 5FYUA 5L9RA 5FMDA 3I4IA 3HIFA 1MR5A 1V6MA 2ZHMA 4LKDA 3D4KA 2WA3A 4NROA 4OMCA 5GZDA 1LOFA 4OHYA 4O65A 3FMGA 1HV0A 1RUD2 4I2OA 1C5IA 1UY0A 2Y26A 4K1ZA 3UNPA 1IPJA 1SBFA 3G6JB 2XXZA 4RHV2 1U5YA 4RQPC 5JMCA 1JYVA 5T5LA 3W59A 2K0GA 3JU9A 3MDPA 2ZMNA 1UIKA 2BFUL 2GAUA 4NUBA 1C4RA 5I0RA 5F6KA 3GZUC 4AAPA 4DNYA 2R32A 2I74A 3FFZA 5C8CA 5FZ0A 3WG2A 3RS6A 5ABJB 3I8TA 5DG2A 5FYZA 4QKDA 1C8M1 1KD7A 5F9TA 2WFPA 3KWVA 1J3PA 4N9IA 3EMRA 3J26N 1A6CA 1YJLA 3M3QA 2A6YA 2H6BA 4J1WA 1PNFA 2VCBA 1ULOA 2ZPXA 5T52A 3UKVA 3WP5A 1YQCA 1AF9A 1D2QA 4LK6A 4R4ZA 2DF7A 3MUY1 5GZGA 3C7EA 4KGGA 3E5UA 5FIXA 5CKNA 4QX2A 5I8YA 4GMP0 3RWKX 2IFWA 1F4AA 4IEYA 2VCMA 3NW4A 4RN5A 3NNFA 4Z2AA 4QPGC 1CVNA 5LW9A 4YLZA 3AZZA 4EWAA 3RPQA 1JOJA 1YXWA 4Q4W1 5F5IA 4CP9B 5KC5A 1S4CA 1BCXA 2WWUA 3O0WA 3CU7A 4XZPA 1QJFA 2Y38A 3QLQA 4OHWA 2HBUA 2GMMA 1S2KA 2YZ4A 3H1WA 2FD8A 1RVF1 2F4PA 1LODA 5L7OB 4HETA 5BPXA 2W39A 1KRIA 1RUF1 4IEUA 4J1XA 2GDFA 2HWC3 4IV3C 3NWKA 5F39A 1YIPA 1ZBA3 3POWA 4Q4V1 5H9PA 4AFBA 5JZGB 1K42A 4BWOA 5IWFA 4ISQA 1QJU3 4I0AA 5CFDC 3LWCA 5GJ6A 3VBSB 4J25A 4IE5A 1K45A 4OI4A 1RUI2 4M4RA 3PURA 4FPLA 4O9EA 1UCXA 4DUVA 2VCAA 2WNUB 4FO9A 3WF4A 2BJSA 4XYXA 4AFMA 5DG1A 1MS1A 1E5IA 1S0BA 1JHJA 3N7JA 2FMYA 5ANNA 3UGHA 4YZ5A 3M8LA 3I3QA 2RE9A 4XF0A 4C8DA 2ZJCA 4XETA 4Y1YA 5FZ9A 4CU7A 5T5PA 4YW6A 5GM0A 1UD1A 2PHWA 4E2QA 1ZYBA 4YM1A 1RUC3 3PL0A 1LU2A 4NMIA 1GWKA 1RITA 1UL9A 1UY1A 1ZBE3 4MZUA 2VMCA 5E1RA 2RDNA 3BIEA 1LCLA 3B9IA 3DKQA 4QX3A 1HRV3 1V9U2 4XDOA 5LWBA 4IEPA 2WYFA 1RHI3 3OG2A 4Z2WA 4XCAA 1ND3C 3VZJA 1YQ5A 5T5OA 1AX0A 4ARXA 4NIAA 1RXGA 4N43C 1AR62 4PT6A 3VD9A 1ZBA2 1MPXA 5JPMB 1EV13 4YYOA 4YPJA 3V0AA 3DL3A 2AACA 3O1SA 1HDKA 4HKLA 4IGPA 4CCKA 4AI8A 3VB9A 1ZRIA 2VNRA 3MW4A 4PDWB 1QOTA 1RMU3 2F17A 5FZCA 1XJAA 4I3PA 5J3UA 1JTZX 1KS4A 4L99A 1EUUA 3SC7X 3AC0A 4LEJA 1LGCA 2HYXA 1BK0A 2R062 3BGAA 1YWKA 2D6NA 3S5AA 2Y6GA 2C6SA 4I02A 3E6DA 2EVXA 2WO2A 3BPZA 3AKQA 3CDZB 1JZ3A 3UKTA 2A73B 4MXWB 3FZ3A 2ORXA 1TMF1 2P3IA 2ZHKA 1IOAA 3FUOA 3H1YA 4HSLA 4WZCA 4BMBA 1XYOA 2HWD3 3WINE 3WF2A 1W8NA 3IDAA 5M0TA 1PVC2 1R091 1JUHA 2C24A 1WMXA 2R30A 3AFGA 4WM8A 5FPZA 4CU9A 4Q8KA 1US2A 3P6BA 1P8JA 3IPVA 3O5SA 2UYAA 2MEV1 5A7WA 2AZ5A 4UYBA 2CHHA 2KR2A 4E8DA 1V6IA 4NHMA 3RMYA 3RYKA 3B69A 5J96B 2OQ6A 4P9GA 2D5HA 3WF3A 3WP3A 5FZEA 1WMEA 2YHJA 2WYSA 5I8SA 1F15A 1OVSA 3HQXA 5IK4A 3OBTA 1PK6C 1AR82 4QQPA 2V73A 4BH9A 4QQHA 1CESA 4XFFA 2R041 3IWZA 4XF4A 5CKQA 2E51A 4OULA 4ATFA 2YUEA 2E63A 3HT1A 3U07A 4NPRA 1OPOA 2IXIA 1D0HA 3I2HA 5B4NA 1VBB2 1POV1 1R64A 1J1TA 2X8KA 2Q30A 3MICA 2XJQA 1RUD1 3ZDSA 4PHZA 2VOXA 3U78A 3I97A 2O0OA 4QKNA 2ZGNA 4G9SB 4RHV1 4LXLA 2D98A 3K4ZA 1U5XA 1GZ9A 1WMFA 1OH4A 4LO8A 2WZR1 2DBIA 2QE3A 2WS93 1HN0A 1AJKA 3M1HA 2ARBA 3DPRA 1ZZBA 3AL6A 3POEA 4IEXA 1VAVA 4MUVA 4EN6B 5C5UA 1SBDA 2JB8A 2VGDA 2W91A 2D3PA 2YROA 4K9SA 2PMWB 3RG0A 1FOD2 1REFA 3NNLA 3LEIA 3FHQA 1X82A 3KV9A 3MEPA 1PO21 4Q4X3 4YGCA 3MHZA 1ZRDA 5A70A 4LUKA 2GC2A 1ZZ6A 4JHZA 1XPWA 1LULA 1RJ7A 4QXKA 1Q8VA 1D0GA 2DVDA 5C4WC 1GZCA 3OD4A 1Y3TA 2PLV2 3HQUA 1PGW2 4XXAA 2BGOA 2W1UA 4K3UA 4FOVA 5JR7B 3L9JT 1H9WA 4QXHA 4OVEA 1W8OA 1VBD2 4UW6A 1VBA3 4XUNA 4AVTA 3ZSEA 2Z2SB 4TTGA 2JKXA 2QQLA 2ZX0A 2BOJA 4A41A 3AJZA 4MXVA 4M4PA 3HN1A 2ZMLA 4CXXA 2VUDA 1UIJA 1BVP1 1JZ2A 1QNWA 3CJIA 1NA1C 4XUTA 4CU6A 1IKQA 3LIHA 2BV4A 5IVBA 2A6WA 1GQPA 3ES1A 3U10A 3CIHA 2YY1A 1V6KA 5B4XA 5FPXA 1GFF2 2Z79A 3R05A 4CDXA 1D4M1 3PLQA 3NJVA 5JSPA 5ACA2 2PTMA 3KT7A 3MV01 1W06A 2WLPA 3ZSJA 3OTFA 1WCSA 4JQTA 5FXZA 4FFFA 1IS5A 1PIV2 3MIGA 5I91A 3W5NA 3MF9A 4Q4X2 1MS3A 1COV3 5A32A 2BP6A 3AYAA 5A3NA 4BLJA 1S2EA 1OF3A 2PHDA 2WNVC 4UBGA 2X09A 4GQ7A 4YW4A 2BNMA 2F4LA 3Q9OA 1D4VB 4DUXA 4L9BA 1W39A 2TUNA 3HEIA 1RUI1 3IB3A 1APNA 3OBZA 2GMEA 3R6SA 3CHXA 4IGQA 4ORFA 4Q1RA 2VMFA 3CMGA 4M0NA 3U37A 3ILFA 4PF1A 4XMAA 4GB32 2YBKA 1FNZA 2VU9A 5LCWL 3I59B 1O5LA 4G4FA 3S6PA 2ZS6B 4QPIA 4FTEA 4FI9A 3D82A 2MNGA 4Y1ZA 1ACCA 1VBA2 3JB4C 1IPSA 1O4YA 1HB4A 1AR93 1UO9A 2ARCA 2DFBA 4QM8A 3USSA 1SEFA 1G9FA 2W08A 3AMMA 1OHFA 3JBG1 4QKFA 1OURA 1HW5A 3RRDA 2XQRA 3QACA 4BDVB 3H3UA 4M3CB 4MX3A 4D6RA 4QPIB 5DAXA 2D93A 2YGLA 1V9U1 1R1A3 2VXJA 2WZ8A 3KCYA 2O1QA 3H8RA 1OMIA 5KHKA 4NHKA 2VG9A 3HR9A 3S7IA 3RYPA 2A6VA 1WLCA 1JMUB 3T0DA 4EN9B 3OD0A 4F3JA 2HWE1 3SCGA 2JIJA 2C0ZA 1NLRA 1AR61 2VNGA 2A70A 1RUNA 1ND2C 1PX3A 4YVWC 1FX5A 1GOHA 3O1UA 2WRAA 3ZXFA 3AJYA 1PGSA 5GALA 1NCRC 3T09A 5JI7A 4IXLA 4BIOA 1XOYA 2OX0A 1S0CA 3N7KA 4QXBA 1MVEA 4HKOA 1PMHX 2TEPA 2JDMA 3NKGA 1SBEA 1AYM2 2CL2A 4HOOA 5FUPA 1US3A 4ZXEA 3LOBA 4X8PA 4DEQA 4CTEA 5FPBA 2R061 3OUIA 4H7MA 1UAIA 4W50A 5A3WA 2VAUA 3KF3A 2ZZJA 1EUTA 3WG1A 1N47A 2JD9A 2OS2A 4EN0A 3GBFA 1H1AA 5CYYA 3PVBB 1DGLA 3ABZA 3WNMA 2P2KA 1YI7A 1YYNA 2BGPA 5FTTC 1S55A 4CP0A 1WMDA 3K3NA 2IVJA 1GZWB 4MADA 3HVDA 3J8F2 3T2OA 2ZEYA 4JGZC 5DAQA 1JBCA 3T1MA 4UFIA 5F6LB 1TQ5A 2HWF2 3WR0A 4XFHA 1ULPA 5IATA 1AYN2 5C9AB 2GP5A 5FMOL 3SEPA 3VHRA 4JQRA 3WUCA 4XE9A 3WNNA 1OBNA 1RIRA 5KHIA 3CL1A 1ZZ9A 4OYUA 1MVQA 1LTEA 5L7OC 1AR81 3CZJA 5FZAA 2VMHA 3EJKA 1B35A 3K2OA 2JECA 3LIGA 5KXCA 3U4XA 1VE0A 4KQ7A 3ECQA 5EJZB 4EWDA 2DCJA 3AP5A 2AUYA 5G04L 2KM2A 2K46A 5JZGC 1OSGA 5F3CA 4XIKA 3JXSA 3ACHA 2RS33 2VW2A 4R9DA 4Y1XA 4CA9A 5H9QA 5IVVA 5IK7A 4QGLA 1VBB1 4OZOA 1JI6A 2D40A 1CAWB 1VAMA 4ZS3A 2IVIB 4XDPA 3F95A 3B94A 2VBPA 3FLTA 4CUGA 3IAPA 3QCWA 1PO12 4UT5A 1X8EA 2J1VA 1NX9A 3LEGA 3T2QA 1DLLA 1VJ2A 2WNUC 4UFKA 2VM9A 1GICA 1RC6A 4DXZA 5FZ6A 5K8SA 2RS53 2A71A 1PZ7A 1LOBA 1K5MC 4AFAA 4XDQA 5CIRA 1V6LA 4HK8A 1H9PA 4GH4C 3MZHA 3BU7A 1UU6A 3AZWA 4BQXA 5JPNB 3UGGA 1GQHA 5FYYA 3VV1A 1GWLA 2RR12 2WQZC 2ZZQA 2FZ1A 4TZDA 2PLV1 3VUOA 1PGW1 4HG6B 3ZMOA 2OZ6A 2Y6HA 4CUCA 1I5PA 4GMP1 5CG8A 5CISA 3ORJA 1EY2A 2XR4A 3H3LA 3RSJA 5F3GA 3SITA 1VBD1 1KS5A 3PU8A 4XXPA 3I2KA 2ET7A 3NAPA 1ZRCA 1NQJA 5IHRA 4Q29A 3BKZA 4XQ4A 1C8M3 1H2MA 4X8NA 1ZREA 4FPFA 1OPMA 1R1ZA 4LBJA 1S0JA 2RHPA 5FZKA 4A6OA 1U0AA 1ST8A 2JXAA 3BODA 3IZOA 3WUDA 1CJDA 4CE8A 1W03A 3VDBA 3ZXGA 1XSQA 4MGTA 3NAPB 5CKMA 1LNSA 5FZMA 4AE2A 3OY8A 2Q8DA 4DZGA 1YUDA 1BBT2 3S30A 2J1TA 1WW4A 4BMEA 4FP2A 1QNYA 2JG8C 2XJVA 2AEYA 3HNYM 3MW2A 4IE4A 1STMA 4ZPIA 4NIIA 2E33A 3GGLA 4B1MA 4Q4W3 4KU8A 3A21A 1ALYA 1JYIA 1W2AX 2BPA2 1PIV1 5JI9A 4YVSA 2X5IC 2PHLA 5FO8B 5B2GB 3VL9A 5JSOA 2LM3A 4KWUA 2XLAA 2FDKA 1RVF3 5I0SA 3AL5A 3B00A 1VB2A 4XZUG 2ILMA 4YZ3A 1MQTA 1RUF3 1C8NA 5EV7A 5A7OA 1OVPA 3CJXA 4GB31 4HMZA 2AYHA 1O7FA 4Q4V3 5FJKA 4GWNA 3WDWA 4YM3A 4XJAA 1AXYA 1FI2A 5EIYB 1PHMA 2VVEA 4KBZA 4QWNA 4CEYB 3K77A 3GALA 4FPJA 1JZ5A 3RZLA
chains in the Genus database with same CATH topology
2XR4A 2JDMA 5A3OA 1OVSA 2JDYA 1OUSA 2BOJA 2JDNA 2JDPA 5A6QA 1W8FA 1UZVA 2WR9A 5A70A 2VUCA 2VUDA 5A6ZA 1OUXA 2VNVA 5A6YA 5A6XA 3DCQA 2BV4A 2JDHA 2JDUA 2BOIA 2JDKA 4CE8A 1OVPA 4AOCA 1W8HA 2WRAA 5HCHA 1OXCA 2CHHA 3ZDVA 1OURA 1UQXA 1GZTA 5D2AA 2BP6A 4UT5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XR4 A;  2JDM A;  5A3O A;  1OVS A;  2JDY A;  1OUS A;  2BOJ A;  2JDN A;  2JDP A;  5A6Q A;  1W8F A;  1UZV A;  2WR9 A;  5A70 A;  2VUC A;  2VUD A;  5A6Z A;  1OUX A;  2VNV A;  5A6Y A;  5A6X A;  3DCQ A;  2BV4 A;  2JDH A;  2JDU A;  2BOI A;  2JDK A;  4CE8 A;  1OVP A;  4AOC A;  1W8H A;  2WRA A;  5HCH A;  1OXC A;  2CHH A;  3ZDV A;  1OUR A;  1UQX A;  1GZT A;  5D2A A;  2BP6 A;  4UT5 A; 
#chains in the Genus database with same CATH topology
 4IER A;  4C1W A;  2AEN A;  1UYY A;  4LA3 A;  4OMD A;  3WF0 A;  3KV6 A;  2WDB A;  4GWM A;  2PFW A;  2CNA A;  1OQE A;  1AX2 A;  1CN1 A;  3H9A A;  2Y33 A;  3TAY A;  1AL2 2;  1XND A;  4CCN A;  1G8W A;  1PZ8 A;  1S0G A;  1NXD 1;  1X33 A;  1MZ6 A;  3NO8 A;  4O61 A;  3VDD C;  1UMZ A;  4HXC A;  1JU4 A;  1W9S A;  3NV1 A;  1WD3 A;  2GMP A;  1G6N A;  3ZYR A;  3AK0 A;  2YG0 A;  4JDN A;  1NCQ B;  4FSJ A;  1H2L A;  1RVF 2;  3RDI A;  4AI2 A;  5JCT A;  3O0X A;  2WL1 A;  3ENR A;  5F37 A;  5DPN A;  1AYM 1;  5LA0 A;  1X50 A;  1ZZ8 A;  2J1R A;  5FY9 A;  3RVH A;  3NST A;  3ZFF C;  1MS0 A;  2P37 A;  1PK6 A;  3U11 A;  2EXK A;  4DIQ A;  3K46 A;  3LB9 A;  3VDA A;  1VBE 3;  2DTW A;  2AGS A;  2ZX4 A;  4AF9 A;  3I54 A;  1L7R A;  1BYH A;  4BA6 A;  2NP0 A;  1A78 A;  1ZA7 A;  1LOA A;  3OGG A;  3PUH A;  4IQP A;  4JGY B;  4JZR A;  1W8H A;  2DCT A;  4YFW A;  1REE A;  3ZFG A;  4OQ8 A;  4Q2F A;  4UWD A;  3MLK A;  1UMI A;  3J8F 1;  3SMH A;  1GZT A;  4B7E A;  3PUQ A;  2Y6F A;  2YC2 A;  1LGN A;  1LKN A;  1F5F A;  3UET A;  1UMH A;  4LHK A;  4JV4 A;  3ZSL A;  5CA6 A;  2W3J A;  3ZYH A;  3TEZ A;  5AC9 1;  4R8H A;  2HWF 1;  1J1L A;  1RJ8 A;  1ZX5 A;  2XWJ B;  4K7J A;  1AYN 1;  5LBB A;  1YLL A;  3RZZ A;  4H7L A;  3UK9 A;  1POQ A;  1TMF 3;  4YGB A;  4XVH A;  2R1D A;  2A3W A;  2GC1 A;  2WIN B;  1IG3 A;  3RI8 A;  3EHK A;  1Q8O A;  2ZAA A;  1R09 3;  2EAA A;  2ZGT A;  3AKT A;  5FY7 A;  4AHZ A;  4DOU A;  2RM2 1;  1XQN A;  1AR7 2;  2VOW A;  2UWC A;  3B02 A;  1W9W A;  4WM7 C;  2MEV 3;  3DN7 A;  4JTO A;  5A1A A;  1V0A A;  2Y0I A;  3ES4 A;  2BW8 A;  1UX6 A;  4PIZ A;  3OUH A;  1OKO A;  4AEK A;  5JXI A;  3LA2 A;  4MYE A;  3ZYP A;  1DQ6 A;  4YRD A;  2MPF A;  2V4A A;  2WWJ A;  3GJB A;  3ZN6 A;  1MZ5 A;  2OQ7 A;  2ES3 A;  3MBW A;  2QQK A;  5FOJ B;  1ULD A;  2DVF A;  3SH5 A;  3HT2 A;  5FZF A;  4M01 A;  4COY A;  1OD3 A;  5C3P A;  3KLS A;  2R04 3;  3I2J A;  1ENQ A;  1J83 A;  1NKG A;  4QMA A;  2AH2 A;  4FBF A;  4JRA A;  1WWY A;  3RJ2 X;  3ZN6 B;  2H6C A;  1GU3 A;  1F35 A;  1Y4W A;  1Z78 A;  4K1Y A;  1LEM A;  1XB9 A;  2LUW A;  5DUW A;  3MID A;  3O1O A;  1POV 3;  4NID A;  1DLC A;  2ENR A;  2Y0O A;  5DMY A;  4P14 A;  3PTR B;  4LKS A;  5BNP B;  1RUD 3;  1LOG A;  3TWI A;  3DF0 A;  1FT9 A;  3J9S A;  3WSO A;  2J1S A;  1XNK A;  4RHV 3;  1PX4 A;  2E26 A;  1HRI 2;  2RR1 1;  2BFU S;  5DZE A;  3VBO A;  2ZGL A;  4ZS2 A;  1W2N A;  4Y20 A;  3LOI A;  3NJY A;  2WO1 A;  4OQ9 A;  1UZV A;  4LIT A;  2VBB A;  4FCA A;  1DDL A;  4RS5 A;  3AYC A;  1UPI A;  3M4F A;  1GKB A;  1X36 A;  1O8S A;  2VOK A;  4Y5S A;  5DN2 A;  4GIQ A;  2V72 A;  1J59 A;  5J1X A;  4UBH A;  2WNV A;  3T4H B;  2X10 A;  2DV9 A;  2O14 A;  1RUH 1;  1W6Q B;  3S7E A;  1DYK A;  3SQO A;  1DYO A;  4JTN A;  4DIN B;  5C8W A;  1CZV A;  2ZCW A;  2VZR A;  4DXS A;  4Y20 B;  5F3E A;  4YM2 A;  4RS5 B;  4XW3 A;  2GH2 A;  2WQ4 A;  4M3C E;  3JQW A;  4LPL A;  1OOP C;  1W0O A;  5IVF A;  4AI1 A;  1QHD A;  2GAL A;  4YFZ A;  1WGP A;  5C33 A;  2B5H A;  1LEN A;  4XUO A;  1BBT 1;  5J7M A;  2ID4 A;  1A8D A;  4LK7 A;  1G86 A;  1GNZ A;  1Q8P A;  2YPJ A;  2R0F A;  4QDS A;  3B5L B;  3LFM A;  2ZX2 A;  3P3P A;  2H0B A;  3KGL A;  1HX6 A;  5HCH A;  2G1M A;  1JZ4 A;  4CEW C;  5FMB A;  3OBA A;  2OXB A;  2WAO A;  4Z8B A;  1Y9Q A;  1M4W A;  3J7N A;  3NVC A;  2Y6K A;  2WQ8 A;  3C8X A;  3KS7 A;  1D4M 3;  3POB A;  3PVE A;  1H2K A;  4XOG A;  3ZYB A;  4FTS A;  2WZR 2;  3N35 A;  1TVG A;  3VBR C;  4AAX A;  2NPI A;  4AI9 A;  1OLM A;  1XC6 A;  1CQ9 A;  3HWJ A;  2WJS A;  4XFB A;  2VUJ A;  1NCR A;  3Q8F A;  4DRV A;  1PO2 2;  2QQO A;  4K8R B;  4OUS A;  4YSF A;  4S2D A;  4D69 A;  2B8M A;  3ZIX A;  1JXN A;  1WZX A;  4QQO A;  1RUI 3;  1JUI A;  3AP6 A;  3NNM A;  5ACA 3;  1CAV A;  4HZF A;  1LOE A;  2ZMK A;  4Y5T A;  3WT3 A;  3LDR A;  1DBN A;  1O4Z A;  3BI3 A;  1UKG A;  1CAU A;  2H0V A;  4M3C F;  4OHX A;  5C8C B;  1NZC A;  1NYW A;  1QDO A;  2VQT A;  5EWS A;  2A7A A;  1BK1 A;  1AL2 1;  3RJR A;  4YWA A;  3AZX A;  1DGR N;  3AVS A;  1W3V A;  4RR3 C;  4COZ A;  4LO7 A;  2CGN A;  3HMY A;  5D2A A;  3C7F A;  3JBG 3;  3T2P A;  3RZJ A;  4JGZ A;  1FMD 2;  2XJS A;  3ZXJ A;  3PMS A;  2B7Y A;  2AC1 A;  3SLI A;  5FO9 B;  2FDF A;  3I2F A;  1W6O A;  4KWJ A;  1HB3 A;  2P1B A;  1V9U 3;  3NV2 A;  1HXS 2;  4XIL A;  4OLL A;  3BPS A;  1VPH A;  2W2I A;  4B3N A;  4XPV A;  5FZB A;  1D4M 2;  2EA7 A;  3FFQ A;  5F5Q A;  5IT6 A;  1G9D A;  2XWB B;  3AZY A;  3PVN A;  1H8T A;  2HWE 3;  4DB5 A;  4XUQ A;  2VOV A;  2JIG A;  3PUS A;  5K4L A;  4FVV A;  2HLE A;  5EXO A;  1AR6 3;  3R4U A;  2BBV A;  2WN3 A;  1BKZ A;  3MPP G;  4GUL A;  1RIN A;  4I3G A;  1OKQ A;  4BXF A;  2JKB A;  1LHN A;  4DUW A;  4XCB A;  4O7X A;  5FP9 A;  2VVF A;  4AVB A;  3IDB B;  4HL0 A;  5JXJ A;  3WDV A;  1C3H A;  5BNN A;  4IUG A;  4BYY A;  5FBZ A;  3GNE A;  5C6C A;  2J42 A;  1NE4 A;  3PIG A;  4DY3 A;  5A3O A;  2BBA A;  4FOW A;  1V00 A;  1RUJ 2;  1UWW A;  3BN6 A;  1MS8 A;  2E9Q A;  4MOA A;  5T54 A;  5A6Y A;  2R06 3;  2WII B;  3VBU C;  2RVA A;  4QPY A;  1U5Z A;  4RGK A;  2BGC A;  4JX0 A;  3ZXE A;  3MV1 1;  4Z1V A;  4ERO A;  1WLD A;  4NAO A;  5T3N A;  4YG6 A;  5CG9 A;  1XYN A;  2AR6 A;  4J6G A;  3W58 A;  5K9Y A;  1RUG 2;  5IVE A;  3LDK A;  5LEK A;  4K8F A;  1CZT A;  3JBG 2;  2A3X A;  4P00 B;  2B4K A;  2BU9 A;  3CLP A;  3H50 A;  1DGW X;  1LHV A;  2B46 X;  1AXK A;  1PVC 3;  3CNA A;  4AED A;  1GYK A;  2HWB 2;  4AEJ A;  5EFU A;  3EO6 A;  4C0H A;  4CDW C;  1AR7 1;  1X7N A;  1ULG A;  2IXJ A;  3KVA A;  2EXI A;  2ORZ A;  4DXT A;  4EQV A;  4LIV A;  3BUC A;  3V0B A;  1VBC 1;  2Z5W A;  4FPK A;  3N7M A;  4JKL A;  2HWE 2;  4CDU A;  3ZFE A;  4W8J A;  5GLU A;  1BMV 2;  2L9L A;  1S0D A;  4TLF A;  4HK9 A;  2XVL A;  1AR8 3;  5E16 A;  3WX5 A;  4COV A;  1DQ2 A;  3H1M A;  3ZXL A;  2GN7 A;  2I07 B;  4UI9 L;  3V0B B;  4UW4 A;  2JEN A;  1AUY A;  3VKO A;  1TME 2;  2GH8 A;  4CDU B;  3JD7 1;  3O1R A;  4D94 A;  1BLZ A;  4F8A A;  1VBB 3;  2EXH A;  2ZAB A;  3V0A B;  1SCR A;  3K51 A;  4AR2 A;  4CEY C;  2OPK A;  1SLT A;  3O12 A;  2PHR A;  2ZEX A;  1GP5 A;  4E2S A;  1URX A;  2EIB A;  3JUU A;  5BNO A;  3GYD A;  4H14 A;  5EYY A;  5JMO A;  2Q4S A;  1QH6 A;  1HRI 1;  1S0E A;  4PCR A;  5CFC C;  1OLQ A;  4Q0U A;  3WQ7 A;  5LZ6 A;  1W0N A;  4FPG A;  5DDJ 2;  1BHG A;  4IES A;  4NOT A;  4BLI A;  4D7T A;  1FAT A;  3KT4 A;  1QJE A;  3RZK A;  5IJR A;  1F5J A;  3PHM A;  4TXW A;  1CR7 A;  1FOD 3;  4AVC A;  3VBH A;  3CO2 A;  2FCU A;  3CEW A;  4K40 A;  4L92 A;  2OUJ A;  2VMI A;  2ZGO A;  3HPN A;  4X6Q B;  5C3Q A;  1BQP A;  4NVP A;  4AZZ A;  1PM4 A;  2XON A;  3Q8B A;  4HPK A;  3S0M A;  3EYP A;  3KVB A;  4Q27 A;  3D0J A;  3EXU A;  4YM0 A;  3I3E A;  3Q8E A;  4QX1 A;  4MGS A;  3IMM A;  5KR7 A;  2PLV 3;  1O5U A;  5LBC A;  2W94 A;  4GMP 3;  1N1T A;  1NCQ C;  2DDU A;  1ENR A;  4WM8 B;  3VBH B;  2BNO A;  1U12 A;  1VBD 3;  3JQX A;  4MGI E;  3IPV B;  1Y7B A;  4CP1 A;  5LAS A;  4CDQ A;  4HPK B;  1OUX A;  5A7W B;  4A7Y A;  1FYU A;  2FHR A;  2JB4 A;  4DY5 A;  1V6N A;  3ZIW A;  3KCC A;  2HBT A;  4H55 A;  2CTV A;  5DZG A;  5FZ7 A;  1W2O A;  3R4D B;  1PM7 A;  4XFI A;  4C0B A;  2E53 A;  1CX1 A;  1W9T A;  1CJP A;  3DUI A;  2QVS B;  5IW0 A;  4JGY C;  2BDR A;  4Q8L A;  3AMQ A;  3TNQ A;  4AEM A;  4CDQ B;  3N9M A;  2OZJ A;  1UY2 A;  2NLR A;  2Z42 A;  2VTF A;  2ZEW A;  1JHN A;  5FWE A;  3WY6 A;  5K0U C;  3QH7 A;  3VDD A;  4ASM B;  3K3O A;  4D3W A;  2K9Z A;  3HN3 A;  3GBG A;  4KG8 A;  4DQA A;  5AFB A;  4JDM A;  5I8T A;  3BU0 A;  1PIV 3;  3BIW E;  4N53 A;  2E7T A;  4NRQ A;  1PVX A;  3OBR A;  5D8A C;  4AGV A;  2W1W A;  3LEM A;  1YFY A;  2RG4 A;  2D7F A;  4W4Z A;  4ES8 A;  3TEY A;  1KGY A;  2OVU A;  1I6X A;  2UUR A;  4ZU5 A;  4F83 A;  3QD6 A;  2PAK A;  3PNA A;  1Q3E A;  1WW7 A;  2PYT A;  3BOW A;  3DPR B;  1H6Y A;  1KEX A;  1W6P A;  3HD8 B;  1LAJ A;  1CPN A;  4GB3 3;  1FPN 2;  4E4D X;  1VAK A;  4LKE A;  4IV1 C;  4JCK A;  3MIB A;  3AX4 A;  2BYV E;  1OC1 A;  4FP3 A;  1Y9G A;  5FPL A;  2JDP A;  3WD5 A;  4ZY9 A;  4YG3 A;  3AP7 A;  1GAN A;  4LBQ D;  2GZW A;  2CY6 A;  4MSV A;  5A7S A;  3KD4 A;  3OGJ A;  1FMD 1;  4UAP A;  1DZQ A;  3M2M A;  5FDB A;  2XGX A;  5LK7 B;  3C3V A;  5FY4 A;  2ZGQ A;  1NY7 1;  4N7U A;  1CIY A;  2UYB A;  4I30 A;  4AQT A;  1NXM A;  1Q5O A;  3MF6 A;  1HXS 1;  4CCO A;  1QMJ A;  3KT1 A;  4QX8 A;  2ZGP A;  3H0O A;  3J7L A;  3N7L A;  4BU2 A;  2XPJ A;  3KHC A;  2RMU 2;  4OI0 A;  4Q5O A;  3NL1 A;  4IET A;  4WVM A;  4BK5 A;  1JW6 A;  2VE1 A;  4N90 A;  4MLO A;  5H9S A;  1DZR A;  5JIU A;  5E89 A;  1Y43 B;  3E6C C;  5A33 A;  3CJI B;  1C1F A;  5BNP C;  2I2S A;  4KU7 A;  3ILN A;  2B9U A;  2Z69 A;  4YZ4 A;  4W6X A;  5CB7 A;  1ODN A;  2HEY F;  2CAU A;  3FWE A;  1JZ7 A;  2CGP A;  3TN9 2;  4WM7 A;  1D2S A;  2VJX A;  1W9Y A;  2W87 A;  5FYM A;  4CDX B;  1NLQ A;  1RXF A;  1CON A;  1UOG A;  3NV4 A;  4URT A;  4ES9 A;  3TRS B;  2VEC A;  3M7A A;  2YFU A;  1TNR A;  1RUJ 1;  5TSW A;  2DU0 A;  4A7Z A;  2YBS A;  5A33 B;  4D0Q A;  1AYM 3;  3DV8 A;  5LA2 A;  5FP3 A;  4ZZ5 A;  2RS1 2;  2DUP A;  5A32 B;  1PGL 2;  1S2B A;  4LA2 A;  4FAH A;  1QJY 2;  2D6L X;  2LTN A;  4NE9 A;  4Q1P A;  1Q8Q A;  4KL1 A;  4RFT 0;  5C70 A;  4XHB A;  5IVJ A;  1RUG 1;  4QPW A;  5DZF A;  3VHO A;  1UZY A;  3VZL A;  5GLW A;  4LTA A;  1JZ8 A;  3I3M A;  3PME A;  5JVV A;  3J8F 3;  3T2T A;  4HN1 A;  1IQA A;  3FJS A;  4PF5 A;  4QB6 A;  4ZU4 A;  1EP0 A;  3KZ4 C;  3LDB A;  2JE7 A;  2HWB 1;  5FLI A;  5AVA A;  3GJA A;  4AI0 A;  2VY0 A;  1WW6 A;  3FUQ A;  5FMO S;  3D5O A;  2HWF 3;  1FXZ A;  1OI6 A;  1AYN 3;  1NUK A;  3WQ0 A;  1HB2 A;  3PIJ A;  3SXW A;  2JIC A;  2HEV F;  3LE0 A;  3AKR A;  1BMV 1;  4FOQ A;  5DAV A;  1YCI A;  5FYB A;  5FFO C;  4X6R B;  1QGL A;  2IUW A;  4L11 A;  2D5F A;  1HV1 A;  1DCS A;  2RM2 3;  2D3S A;  2JG9 A;  4CUA A;  4CYD A;  1DFQ A;  3AYE A;  2XBO 2;  1G9C A;  1TME 1;  4Y4Y A;  1QXR A;  2V09 A;  3K4D A;  1LOF C;  2D97 A;  1SLC A;  2YGM A;  5ABJ C;  1F31 A;  1OOP A;  1KDM A;  1Q43 A;  1YQ2 A;  4B8E A;  2ETE A;  2RV9 A;  4SBV A;  2R49 A;  1Q8S A;  5FOB B;  2HWC 1;  4AG4 A;  1PO1 3;  2ZKL A;  2KD7 A;  2VNO A;  5IFT A;  2WFF 1;  3LPG A;  4GWJ A;  1KDK A;  1DQ4 A;  3VD3 A;  4DMI A;  3ITQ A;  4ARY A;  5H9R A;  3VBF A;  5C8C C;  2IZW A;  5DDJ 1;  2OYZ A;  2P17 A;  2JX9 A;  4PIX A;  4QXC A;  4P9W A;  3RZM A;  4CEW A;  5BYN A;  4A6S A;  3OEB A;  1NLS A;  4QDQ A;  2JDA A;  2PHU A;  5FY5 A;  1O3S A;  1VRH 1;  2G19 A;  1JN2 P;  5C3O A;  1H0B A;  5LK5 A;  5AC9 2;  4RQP A;  1YO8 A;  4V1P A;  1KIT A;  5FV3 A;  1OUS A;  3MI8 A;  2QDN A;  2QQW A;  2RR1 3;  4HBN A;  4ZXK A;  3A0K A;  3VBF B;  4DO0 A;  4I09 A;  3AMP A;  3AXE A;  2XQX A;  3J7M A;  4QHZ A;  1MEC 2;  1OLM E;  4CCC A;  1DG6 A;  2OW4 A;  4R52 A;  3CZU A;  4BQ3 A;  2LRP A;  2R07 2;  3ZVX A;  1F8V A;  4PQQ A;  4RQP B;  3FC0 A;  1HN1 A;  2RM2 2;  1UYP A;  3OGS A;  2PQQ A;  4MV2 A;  1QJZ A;  4XF9 A;  2VTX A;  4AFC A;  5FQ0 A;  3ZR6 A;  4FXG B;  1WA4 A;  3ZPY A;  3DXU A;  1LU1 A;  2YC0 A;  4ATE A;  4NJ4 A;  4YW3 A;  3GXU A;  3HOB A;  3VBS C;  1B35 B;  3GM8 A;  3N9P A;  2P5B A;  3U0Z A;  3HBZ A;  1DP0 A;  5A3M A;  4MHR A;  4AQS A;  4C1X A;  5KC6 A;  3ETQ A;  3ON7 A;  1X9P A;  2Q0A A;  4QQ2 A;  3WP6 A;  1BBT 3;  1E5S A;  1EV1 1;  1XE8 A;  2ZTN A;  4QPG A;  1IZ3 A;  5IK8 A;  1W28 A;  4U36 A;  5JDB A;  1RL3 A;  4NHY A;  2VQ0 A;  5FXX A;  2BUK A;  2WLQ A;  1VRB A;  2WKK A;  4EZ4 A;  2XOM A;  3OPZ A;  1YJK A;  3KM5 A;  4P5H A;  5FUI A;  1GR3 A;  1ZZC A;  2XG3 A;  3OGV A;  4RD7 A;  4NIH A;  2DVG A;  4PJY A;  1JU3 A;  4NRM A;  1L7Q A;  3SEE A;  1QIQ A;  1RUE 2;  2YMZ A;  5CU1 A;  2OT7 A;  4HLT A;  4IGO A;  2DFC A;  1ASJ 2;  4B1L A;  1QEX A;  3T4V A;  4KNC A;  4ZZ8 A;  1AHS A;  3PUI A;  2E7A A;  3VD5 A;  3IDC B;  2WT2 A;  5A3P A;  3MW3 A;  5DUX A;  3WHT A;  1RED A;  2FDG A;  1FPN 1;  4IE7 A;  3U75 A;  4K6B A;  5CFD A;  5JXG A;  1E5H A;  1LGB A;  3VKN A;  2XML A;  4RFR B;  1CAX A;  5A6Z A;  1RUH 2;  5KWR A;  1YHF A;  1AZD A;  1PNG A;  4Y5Z 0;  4QT6 A;  4UOJ A;  4Q4Y 2;  3ZO0 B;  5LEJ A;  4HAN A;  3WG3 A;  2UU8 A;  2MHF A;  1B09 A;  3WNX A;  4JVA A;  4QX5 A;  2VTX J;  1NAE A;  1AVB A;  4FOY A;  2BVV A;  3H8X A;  3VBU A;  5CFD B;  2XDV A;  1UNB A;  4PDW C;  3ZN5 A;  2LRO A;  2XUE A;  5GLT A;  3OCP A;  5CVR A;  2RDS A;  1XE7 A;  1AL2 3;  4LO5 B;  2RMU 1;  2D6K A;  4XEZ A;  3WQ1 A;  5HPO A;  4BIS A;  2YBP A;  4NWV A;  3OYW A;  2PAE A;  5FAX A;  2JWP A;  2YB7 A;  4E4S A;  5GZE A;  2B9V A;  3KV4 A;  1GUI A;  3TN9 1;  4CVU A;  3VLB B;  3OY8 B;  1O3R A;  2ET1 A;  2YC4 A;  1QJX 2;  4XBQ A;  1ND3 A;  3LSD A;  3MLJ A;  1BEV 2;  5FYV A;  1CD3 G;  1QQP 2;  5LY1 A;  2JDK A;  3IIA A;  4N43 A;  1LR5 A;  3C7H A;  4S2G A;  3V56 A;  4E27 A;  5T55 A;  3MFC A;  2ZA9 A;  2QTW B;  4LO4 B;  2W1S A;  1GSL A;  4YVS B;  1XRU A;  2RS1 1;  2V5Y A;  4KWL A;  5HCA A;  1PGL 1;  2HYK A;  1N3Q A;  4G3Y C;  1QJY 1;  1QF3 A;  3GCX A;  4CUB A;  2VZP A;  1X8M A;  1ND3 B;  1UU4 A;  2R16 A;  2CWS A;  2XKO A;  3AKS A;  4RYD A;  4B29 A;  4YNI A;  3THC A;  4C91 A;  5JIA A;  4N43 B;  1JH5 A;  1MQT B;  3DYO A;  4WM8 C;  4XAB A;  4E8C A;  3BTA A;  5HCB A;  3MIE A;  2E7Q A;  5F5C A;  4XFG A;  3TBD A;  3GF6 A;  1I3H A;  2D43 A;  1QY4 A;  3FN9 A;  2XHN A;  3MGU A;  1SQ4 A;  3W9A A;  2XL7 A;  1VMH A;  2VXR A;  2Y6L A;  1WKY A;  4YGD A;  4ET7 A;  4CXY A;  2QUO A;  1KFU L;  2W9X A;  4URA A;  4AGG A;  4I0W B;  2XKP A;  2A1X A;  4BZ4 A;  3D0S A;  3OF1 A;  5KBF A;  1IS4 A;  5IVC A;  1MZE A;  5A3L A;  3BYW A;  3D8C A;  1UQX A;  3P1I A;  4R4X A;  2VZV A;  3SIS A;  2GNB A;  1EAH 2;  2ZXQ A;  3N9O A;  2PHF A;  1JS9 A;  2ZHL A;  2EIC A;  3ZPO A;  1A8M A;  3O1V A;  2C1F A;  3V64 A;  1XBF A;  1D7P M;  1AR7 3;  4L0P A;  4NHX A;  2XBO 1;  1VBC 3;  4YZ1 A;  1H6X A;  4BK4 A;  2FDH A;  1WLW A;  1LES A;  4WVV A;  4UFH A;  4LMF A;  2FQP A;  3GCW A;  4PLO A;  2C26 A;  1I9R A;  5KXB A;  1GOG A;  4IEZ A;  1UZW A;  3DPR C;  1H1I A;  3E6B A;  3ZKU A;  3WCS A;  4D7S A;  3E1F 1;  5HXV A;  2P34 A;  3JD7 3;  4IDZ A;  2Y6J A;  1LJ7 A;  1PK6 B;  2WZE A;  1O6U A;  4LT5 A;  2Q1F A;  2WUH A;  4IW3 A;  3GHN A;  4JKK A;  5SV8 A;  3BTX A;  3APB A;  3ZFG B;  1TEI A;  2A6Z A;  2QQN A;  4I01 A;  4IV3 A;  4FPC A;  1OFS A;  1HRI 3;  1UYZ A;  1KXG A;  4YW7 A;  1HLC A;  3SKV A;  3EQE A;  1O8P A;  2XJP A;  5HBA A;  3W20 A;  3KQR A;  4BQW A;  5FR3 A;  1GBG A;  1W05 A;  1MEC 1;  3BB6 A;  3ETP A;  1HIX A;  3ACF A;  3KHB A;  4N7I A;  5BUV A;  5D8A A;  3I49 A;  1O3T A;  2CYF A;  5F2W A;  1A34 A;  2R07 1;  3KF5 A;  2ZGK A;  1LED A;  5C3R A;  2HJI A;  3ZXD A;  1W2T A;  3INA A;  4IV3 B;  5C4W A;  4JAA A;  4NN0 A;  3U1X A;  5EHD A;  5JLV A;  1VBC 2;  1UKR A;  5C71 A;  2B39 A;  5GKA C;  5JWP A;  3RZG A;  1XNC A;  5A6Q A;  4I0B A;  5HCF A;  1Z7S 2;  4QGM A;  5A7Q A;  1KJL A;  4QX0 A;  3W5M A;  4CDX C;  4MET A;  4Q26 A;  1BVV A;  2VNV A;  4BJ0 A;  2VW0 A;  1TE1 B;  2ZGU A;  2O8Q A;  3LPF A;  5C4W B;  2PXJ A;  3VKF C;  1VP6 A;  4UW3 A;  3C7G A;  5FK8 A;  4NPL A;  5FK7 A;  5A1F A;  5F8P A;  3I2G A;  3JD7 2;  1NA1 A;  4Z07 A;  2VZQ A;  1RB8 G;  1A3K A;  5J48 A;  5K7P A;  4YW2 A;  1RUE 1;  1O4T A;  4WZF A;  4FPO B;  2VBD A;  1SDD B;  4PBP A;  3PU3 A;  3WEZ A;  4FT8 A;  1ASJ 1;  2I45 A;  4XQD A;  5EYX A;  2WZR 3;  4QPI C;  2BTV C;  1NA1 B;  3VGI A;  1FNY A;  3JZV A;  2DUR A;  5C7G A;  5FY1 A;  2JEM A;  3O1T A;  3NNJ A;  1LOC A;  3OJB A;  2EIG A;  2JDH A;  1PO2 3;  5FO7 B;  4D6S A;  4LOS A;  1W04 A;  2CDO A;  3T0B A;  4XHX A;  1UZ0 A;  3USU A;  4IEV A;  4Q4Y 1;  4P5Y A;  1SPP A;  1YRZ A;  3VBO B;  4E2G A;  1ZRR A;  3I3B A;  1QKQ A;  1ZA4 A;  2IXH A;  4QD2 A;  1ZM1 A;  3H7Y A;  2V5D A;  4LQR A;  4W6W A;  3VD4 A;  3UYJ A;  3H3Z A;  4LOT A;  2LAL A;  2WNV B;  3L2H A;  5FZ1 A;  1R08 2;  1W3X A;  3VZO A;  3BTY A;  2GC0 A;  5CEH A;  5I0D A;  4ONU A;  3IDE A;  2QQM A;  4OZX A;  2QDR A;  4BIF A;  3R4S A;  3AYD A;  5JR2 A;  2X29 A;  1W6M A;  4AHX A;  4Z92 B;  3IN9 A;  1C5H A;  1FMD 3;  1WCD J;  2PHX A;  2Q1M A;  3OPW A;  4MHU A;  4S2H A;  3ZM8 A;  1NQD A;  4LIU A;  3T0A A;  1HXS 3;  3AVR A;  1QJX 1;  1SMV A;  4XTM A;  5J09 A;  1BEV 1;  4Y24 A;  1QQP 1;  3ZDV A;  3CKH A;  4HT1 T;  4WVW A;  1W6M B;  4NAM A;  5EJ1 B;  5GLV A;  1UY4 A;  1ND2 A;  3U14 A;  4YVW A;  2QNK A;  3KMH A;  4XBL A;  4AQ2 A;  1J3Q A;  3TNP B;  5C9A C;  2HEW F;  3OSD A;  3MIF A;  4Y1V A;  2ZGM A;  1WCQ A;  2DBN A;  5A3U A;  2NMN A;  2EAK A;  3ZN4 A;  1BXH A;  3FLP A;  5CAD A;  2F6B A;  1RUJ 3;  5ABJ A;  1SLA A;  1ND2 B;  1G9B A;  1MS5 A;  4YVW B;  1YQ8 A;  4GKX A;  3MYX A;  4XTP A;  2VZ1 A;  3UT0 A;  1NCR B;  3ZSM A;  4QX7 A;  5FZO A;  4B4R A;  5SV5 A;  2PHT A;  5FZL A;  4QGN A;  2PEL A;  3AMH A;  2NYY A;  3ZR5 A;  3GBW A;  1CWP A;  3DXT A;  3DEC A;  5FZH A;  4MO3 M;  1RUG 3;  1YFX A;  3NJZ A;  1CAV B;  4XJZ A;  2ZKN A;  5IFP A;  3NNG A;  2YXS A;  1B35 C;  5FZ8 A;  4FQZ A;  4LLO A;  1E5R A;  1CAU B;  1QOS A;  5EP9 A;  3D6E A;  5FXW A;  4BB3 A;  4GAZ A;  4PLN A;  1EAH 1;  1NY7 2;  5FZO B;  4BM8 A;  4E4H A;  1SAC A;  4UFJ A;  5KHJ A;  2HWB 3;  5I93 A;  1EPZ A;  5FXV A;  4WV8 A;  3KGZ A;  3TYJ A;  3POI A;  5FZI A;  4A45 A;  5A7N A;  4Q0P A;  1ONA A;  4CP9 A;  2Y34 A;  5DAB A;  1YFW A;  1GWM A;  1H1M A;  3TEW A;  1O59 A;  1QXJ A;  1W99 A;  1DIW A;  4GXL A;  3WNO A;  1C57 A;  4JGZ B;  4WBB A;  2V4V A;  3SHR A;  3ZYF A;  2OA2 A;  4P08 A;  2IWG B;  5L7O A;  4JHT A;  4MVT A;  1V70 A;  4OHV A;  1W6O B;  1OXC A;  1S1A A;  2NMO A;  3K4A A;  2Y60 A;  2P3Y A;  5IAV A;  3S5Q A;  2KXL A;  4XQW A;  1LEC A;  4CZS A;  5JOX A;  2WO3 A;  5JZG A;  1JYW A;  1VAL A;  3CBN A;  1SDW A;  1H8T B;  5F5A A;  1TME 3;  3ME2 A;  3T1L A;  2Q8E A;  3IBM A;  4LHN A;  1OA2 A;  1IPK A;  4A42 A;  1DZT A;  3LCP A;  3VBS A;  3WDX A;  3UGF A;  2VZT A;  2EXJ A;  1JYT A;  3WW4 A;  1F2N A;  2Q8O A;  2ARA A;  2WNU A;  2NZ9 A;  2VMG A;  1U5I A;  3WG4 A;  2PAM A;  5A1L A;  5BNN B;  2WFF 3;  4CPB D;  3B7M A;  3RFR A;  1UYX A;  1V6O A;  1J84 A;  2E6V A;  3I2I A;  4KGQ A;  4LE3 A;  1IGO A;  5DDJ 3;  4Y3O A;  2J1E A;  2NQY A;  4PI2 A;  4RA0 A;  1K5M A;  3NAP C;  2BEO A;  4OCT A;  1KFX L;  1VLN A;  4XC9 A;  4M0H A;  3WHU A;  4GH4 A;  4ZHN A;  4ASL A;  1HQL A;  1VRH 3;  3ZOI A;  4CCE A;  5J36 A;  3KCX A;  1G7Y A;  1KQR A;  2C4X A;  4IND A;  1SLI A;  4DRR A;  2ATF A;  3NJX A;  5HI0 A;  3T30 A;  1DHK B;  1MAC A;  5JXH A;  3LA7 A;  4HSJ A;  4KH9 A;  2QQI A;  3UL2 A;  3N4M A;  4MG2 A;  1K5M B;  1OD5 A;  3FLR A;  3ZX7 A;  2VQA A;  1Z7S 1;  4AED B;  3AM2 A;  4N8M A;  1PZ9 A;  2J1U A;  4GH4 B;  5F1R A;  4YG0 A;  2BOI A;  4LBQ A;  5EPA A;  3UJQ A;  4BE3 A;  1OT5 A;  4GA9 A;  3RGB A;  3WW3 A;  5LA1 A;  3POG A;  3GZE A;  4YVS C;  2YDE A;  1QU0 A;  3ZFE B;  4AQ6 A;  3N36 A;  4H3W A;  4CCJ A;  4TN7 A;  1K5J A;  2FCT A;  1FAY A;  2J22 A;  3QBQ A;  3WW1 A;  1OH3 A;  1Z0H A;  4UF0 A;  4PDW A;  4XAA A;  3BAL A;  1AXZ A;  5DXD A;  3N3H A;  4AGR A;  4YAR A;  4LBQ B;  1K3I A;  3AZV A;  4L2N A;  2HWC 2;  3LQC A;  1MQT C;  3THT A;  5FPU A;  2JG8 A;  2WFF 2;  4E9K A;  2ARE A;  1VBE 1;  4QU1 A;  4D8M A;  5A3T A;  4IEO A;  4AVS A;  1QJU 2;  2XLG A;  3DGT A;  3IKW A;  4NO4 A;  2ERF A;  2C5D A;  2W92 A;  4UW5 A;  3U4S A;  2X5I A;  4IE0 A;  5L19 A;  4UF0 B;  3OEA A;  2WA4 A;  4QB1 A;  2J7M A;  1WLT A;  4MXW A;  2C9A A;  1JOP A;  3PTY A;  3SH4 A;  5BNO B;  4HVR A;  1VRH 2;  4KWK A;  4UXA A;  2OKX A;  2JG8 B;  3QH6 A;  1K12 A;  4A2U A;  4COU A;  4BXS V;  2VQU A;  4LHL A;  1AL0 G;  1PMJ X;  2IFR A;  1C1L A;  2BWA A;  1JOB A;  2DTY A;  3RNS A;  3VZK A;  2WZP P;  2X5I B;  2IXC A;  2QCS B;  3III A;  1ZNP A;  1ENS A;  3AFK A;  3POY A;  3WDY A;  4TSV A;  2WN2 A;  4JKM A;  1FPN 3;  2VUL A;  1GP6 A;  5GLZ A;  4COW A;  3ZMN A;  2ZHN A;  1RUC 2;  1R08 1;  1O91 A;  4NR1 A;  4GD4 A;  5LRS A;  1ZBE 2;  1S0I A;  2IXL A;  2LS6 A;  5IVY A;  1HRV 2;  5AFE A;  5IAX A;  4PI0 A;  4S2F A;  3A22 A;  4YW1 A;  2WC2 A;  4OI1 A;  3Q8A A;  1RHI 2;  5KHG A;  3ILR A;  5T5J A;  5HV4 A;  3N9L A;  3ZSK A;  3ASI A;  4CXW A;  1SHW B;  1ULF A;  2QZ2 A;  3DYM A;  3LF7 A;  3POJ A;  4A44 A;  1L7L A;  1ULC A;  4ZU7 A;  1WUV A;  4RGA A;  3AXD A;  1QDC A;  2RMU 3;  1EV1 2;  3FL7 A;  3OB8 A;  1OQD A;  4EN7 B;  5A7P A;  4P9X A;  1OLR A;  1SFN A;  5FP8 A;  2GNM A;  3LKJ A;  4YW5 A;  1RMU 2;  3THP A;  5J98 B;  1F4H A;  3ZFG C;  5FBJ A;  3TN9 3;  1EYB A;  2ADE A;  5DUU A;  3SH3 A;  1IS6 A;  3PDQ A;  2W1Q A;  3VDD B;  5FPV A;  3ZFF A;  1UXX X;  2W0X A;  3WP4 A;  4AI3 A;  3NQH A;  3JCI A;  1DQ0 A;  4N53 B;  4K21 A;  2RS1 3;  4HN0 A;  2BVB A;  1I5Z A;  4YGE A;  4Q0Q A;  3IAQ A;  1QJY 3;  1H8V A;  2HWD 2;  4PLM A;  4ZON A;  5DUV A;  1MS9 A;  2WT1 A;  2WR9 A;  4DS0 A;  4CCM A;  2ZAH A;  1KJR A;  1UOB A;  3ZFF B;  4AW7 A;  1FV3 A;  4GJY A;  1W6P B;  5F2S A;  1XNB A;  4AFD A;  1NZI A;  1T6G C;  2RJL A;  3IMN A;  4NWW A;  4P9L A;  2FDI A;  2GC3 A;  1N1Y A;  1WW5 A;  3GZT B;  2BWC A;  3VN4 A;  1YQ6 A;  2ZOE B;  1YI9 A;  3WCR A;  1RTV A;  3UES A;  1X9T A;  1I1E A;  4MGQ A;  1VR3 A;  2ZBJ A;  5FZ4 A;  1IHM A;  3SKJ E;  3FBY A;  2VCC A;  4IEW A;  1MS4 A;  2DUO A;  5FCC A;  1OF4 A;  4QU2 A;  3PUA A;  2WNO A;  3LD8 A;  1N3P A;  1GNH A;  1WCK A;  1J3R A;  1LHW A;  1N1S A;  2EF6 A;  1W9F A;  2VD7 A;  4HON A;  2QJV A;  5FZD A;  2VZU A;  5GZF A;  4WVM B;  4EN8 B;  2JE8 A;  5FYT A;  4UFL A;  2XBO 3;  3NKT A;  1JYC A;  2XHK A;  4SLI A;  2DCY A;  5HV0 A;  5L73 A;  3M3C A;  3FX3 A;  3EB7 A;  4XBN A;  1WCU A;  4MH0 E;  1OA4 A;  3WW2 A;  1J58 A;  1GOF A;  4LE4 A;  3VL8 A;  2WS9 2;  4RL7 A;  4WM7 B;  5FMC A;  4AOC A;  5FLJ A;  2PN5 A;  3VBO C;  1LRH A;  2VZ3 A;  3N9Q A;  3J7H A;  3W21 A;  1UY3 A;  4RSU A;  3RZH A;  2DCZ A;  4RS5 C;  4LNV A;  3I59 A;  5FP4 A;  4Y22 A;  3FHA A;  4BOW A;  4L8Q A;  3S57 A;  1W6N A;  2X53 S;  2Q8C A;  1RUO A;  2R6Q A;  4NPM A;  5FKB A;  4DEV A;  3WVJ A;  4FPE A;  1N3O A;  1DQ1 A;  3AKP A;  3SCH A;  1VMF A;  2VMD A;  2YV8 A;  1WA6 X;  5FYH A;  4NHL A;  5AC9 3;  5JAX A;  4Y26 A;  4AXO A;  4M3C A;  4Y22 B;  1TNF A;  3TEX A;  4XF1 A;  5DAW A;  3LEK A;  4GWI A;  2FZ2 A;  1W6N B;  2QQV A;  4TLG A;  3B01 A;  4BQ4 A;  2RJ2 A;  4KBB A;  4KMQ A;  1MEC 3;  4LBN A;  4LKF A;  3WNL A;  4CCD A;  2WAA A;  1OFN A;  3HNB M;  3I2D A;  2E31 A;  3RWN A;  4LO6 B;  2R07 3;  3WOG A;  4R9A A;  3O1M A;  4TWT A;  3UKN A;  5LA9 A;  2VL4 A;  3HQR A;  3HBK A;  4EYU A;  1N1V A;  3E5Q A;  3ACG A;  2P3K A;  3RI9 A;  1WD4 A;  2YU2 A;  1YEW A;  4P9J A;  1HQN A;  2W52 A;  3MIH A;  1SZB A;  3WQB A;  2VUA A;  5FY0 A;  2DVA A;  5FRA A;  5APA A;  1T2X A;  3I7D A;  2RJK A;  3TB0 A;  3BOP A;  1SCS A;  2JG9 B;  2WAB A;  1HB1 A;  1ZBA 1;  2UY8 A;  4BQ2 A;  1UOJ A;  1ENX A;  1COV 2;  2QQU A;  3HNM A;  2W68 A;  1QJU 1;  1ULE A;  2VZO A;  2XJT A;  4FQ4 A;  4NIG A;  1W0P A;  4D7Y A;  4EV0 A;  2D44 A;  3KSC A;  3MFA A;  1OOP B;  3ZYG A;  1H2N A;  2XVG A;  3B9C A;  2G4I A;  5JSR A;  1GV9 A;  2JD4 A;  2KA3 A;  1QOO A;  2WT0 A;  1RUE 3;  1SLB A;  3KB5 A;  2CAV A;  4GKY A;  5J37 A;  1GZW A;  1W8U A;  3LAG A;  3VDC A;  1ASJ 3;  1NOV A;  3VBR A;  2K2S A;  3T3Y A;  2YU1 A;  3ALQ A;  1NG0 A;  4XF3 A;  4PQ9 A;  2RDQ A;  1AR9 2;  1JYX A;  4CEW B;  2D6O X;  4V2W A;  1JOD A;  3MUZ 1;  2YYO A;  4KI5 M;  1UF2 C;  1ODM A;  1RUC 1;  5C9A A;  4UFM A;  4Z82 A;  4DPN A;  1SG3 A;  1MZF A;  4R9B A;  1DGR A;  1RUH 3;  1UN1 A;  1ZBE 1;  1PVC 1;  2O8O A;  2UWA A;  3AP4 A;  2EIE A;  3C7O A;  4XMI A;  3B93 A;  5L9B A;  2XJU A;  3DKW A;  4Q4Y 3;  1HRV 1;  1R1A 2;  3VBR B;  3N9N A;  1VB4 A;  2JJ6 A;  1E57 A;  1RHI 1;  5ERL A;  2CU5 A;  2QQP A;  1UW8 A;  2IXK A;  1ZZ7 A;  4HKW A;  2ZAC A;  1FV2 A;  4IEQ A;  2D6P A;  2G9F A;  1QXP A;  3ZYI B;  2JE9 A;  3VKL A;  1CX4 A;  1H8T C;  4HVO A;  4R9C A;  5DAP A;  2VH9 A;  5FQ0 B;  3KQ4 B;  4RR3 A;  1CAW A;  2VPV A;  3H8U A;  2R1B A;  2P4E A;  2GNT A;  2A75 A;  3A4U A;  4C90 A;  2BRT A;  1RMU 1;  2SLI A;  3WV6 A;  5IUQ A;  3ZLI A;  5BNN C;  3LA3 A;  2QQJ A;  4QAW A;  5BY5 A;  2IC1 A;  3JB8 A;  2EID A;  4AVA A;  4LUM A;  4OHZ A;  3SNM A;  1NE6 A;  1W8T A;  1W8W A;  2VR4 A;  1QJX 3;  1TG7 A;  4P9Y A;  1UXZ A;  4QPG B;  4RR3 B;  5ANQ A;  5FZG A;  3BTZ A;  4H2A A;  1BEV 3;  1GNY A;  3FE5 A;  4XUP A;  1QQP 3;  2DWR A;  3E5X A;  3WNP A;  3I2O A;  2WNE A;  1ZRF A;  5JOY A;  3NRU A;  4JC1 A;  4XJ9 A;  3FHI B;  4Q0S A;  5LAT A;  2PA7 A;  4EZH A;  3GDB A;  4GAL A;  2DU1 A;  3VZM A;  3M3E A;  3WXP A;  2W5F A;  1DF0 A;  2TNF A;  4O9G A;  2HWD 1;  1CGP A;  1OQ1 A;  4B7K A;  1UOF A;  3P3N A;  2OPW A;  1S0F A;  4LBK A;  2BZD A;  1FOD 1;  4ITC A;  4P02 B;  4XFC A;  5FPA A;  4LJH A;  2ADD A;  5ISL A;  4AED C;  5LBF A;  5FY8 A;  2YPD A;  3R0R A;  1EPW A;  4ISR A;  1JZ6 A;  4HVQ A;  5BXX A;  4XUR A;  1TZO A;  1GMM A;  1GQG A;  2CWM A;  2BQP A;  5FP7 A;  1V6J A;  2WSU A;  3IM0 A;  4MGK E;  3THD A;  1CAX B;  3P5B A;  5CBL A;  4CDU C;  3ZFE C;  5I0T A;  2Y8K A;  4ZKT B;  5T50 A;  1W8Z A;  4LR4 A;  2P3J A;  2HH9 A;  2XB6 C;  4LHS A;  4AVV A;  5LRR A;  4DXR A;  3T08 A;  3MPB A;  3URF A;  3VBU B;  4W65 A;  2A5Z A;  1HQW A;  5FLH A;  1WBL A;  3TOJ A;  2WO7 A;  4CRQ A;  1EAH 3;  1ZVF A;  3HAG A;  1XU1 A;  2HKX A;  2WSV A;  4CDW A;  2RS3 2;  1M06 G;  2WBK A;  3DCQ A;  2Z4F A;  2P6H A;  3LZZ A;  4KG0 A;  4FTB A;  3ACL A;  1Q56 A;  5AVP A;  5E88 A;  5E6H A;  3OYW B;  2JDZ A;  4BHP A;  4B4P A;  1JYN A;  2BNN A;  5BNO C;  3WZ1 A;  4ASK A;  1IKP A;  2R0H A;  3O14 A;  4QB2 A;  5KHH A;  5ACA 1;  2WS9 1;  4FFI A;  3EBR A;  4LOR A;  4CDW B;  2XVK A;  2D6M A;  4Y1U A;  2RS5 2;  3A23 A;  2FDJ A;  4PBO A;  2P6C A;  3ZXA C;  2C9K A;  4XJW A;  5EZW A;  4LLF A;  4D6Q A;  4Q4X 1;  1W8F A;  5E8A A;  2A6X A;  2D3R A;  3C2U A;  3ROU A;  2GND A;  3VBH C;  2Q5T A;  4JRL A;  1UZZ A;  2W46 A;  4P9I A;  5FRE A;  4CEY A;  1XYP A;  1POV 0;  1SFY A;  5LY2 A;  5JOW A;  2NM1 A;  3ACI A;  3LSE A;  4FAG A;  4U2A A;  2W95 A;  4LBM A;  5FZ3 A;  2GSY A;  4BQY A;  1HJG A;  3SCF A;  4MGZ E;  5EQU A;  4V2V A;  2Q1Z B;  2B45 X;  5CFC A;  3X29 B;  1XNA A;  3I3D A;  3NV3 A;  4AHW A;  1VBA 1;  3OPT A;  3G7D A;  1C28 A;  1C8M 2;  4AWD A;  2VVD A;  4CDQ C;  3VHN A;  3RYR A;  5IK5 A;  2OUH A;  3AMN A;  3K48 A;  4Y4R A;  3GHM A;  2W47 A;  2ZEZ A;  3K75 B;  5CFC B;  3VZN A;  4BCU A;  1UPS A;  4RGG A;  3ZKY A;  1SLL A;  2VZS A;  1IQD C;  1F9K A;  4JDO A;  2ARX A;  3BCW A;  1NCQ A;  2VME A;  3M3I A;  4GJZ A;  4LBO A;  3J4U H;  5LBE A;  1Z7S 3;  4B4Q A;  2GU9 A;  1CZS A;  5FYC A;  4N9H A;  3ZXK A;  5G05 L;  4Q4W 2;  3M70 A;  2CGO A;  3UV9 A;  1YNA A;  3O0V A;  2J1A A;  1GP4 A;  2CSG A;  2VOT A;  4IE6 A;  5FYI A;  3RQ0 A;  1COV 1;  2E32 A;  4N53 C;  3CQO A;  2TBV A;  4WVZ A;  5GZC A;  2GP3 A;  3PVO A;  3UJO A;  2QZ3 A;  4JGY A;  4AL9 A;  1BJQ A;  3PJY A;  3A7Q A;  2NN8 A;  4A7K A;  1NT0 A;  1LHO A;  1RUF 2;  2B42 B;  3FBM A;  5A80 A;  2GN3 A;  1XU2 A;  5FJH A;  5C3S A;  3B3Q E;  2LW8 A;  1UU5 A;  2VO5 A;  4Q4V 2;  5K0U A;  5A6X A;  1DGW A;  5IYY A;  4M00 A;  2QBX A;  3A0N A;  4QDR A;  4FXK B;  1AR9 1;  1RGS A;  3HJR A;  5BV6 A;  1VMJ A;  4XJ8 A;  5FUN A;  2X05 A;  5JUV A;  3NMB A;  1VIW B;  1DU3 D;  4CSW A;  3KV5 A;  4QKB A;  4XJU A;  3WNK A;  5KXE A;  1H4H A;  2A3Y A;  4OFG A;  5DQ0 A;  4LUL A;  3MO4 A;  2BER A;  2UWB A;  1YC6 1;  4L97 A;  4QHO A;  4DFS A;  5K0U B;  4AK3 A;  2QFE A;  3CJI C;  1R1A 1;  2XH6 A;  1QWR A;  2XLF A;  3E97 A;  1IG0 A;  3VD7 A;  4XIO A;  5F7U A;  2VUC A;  3BVC A;  1H30 A;  5D8A B;  3ST7 A;  4IV1 A;  1DYP A;  3L2Y A;  2G9Z A;  1AJO A;  4FPH A;  4MGY E;  2ZX1 A;  1Y9M A;  4E4Z A;  3H7J A;  1R08 3;  1XSR A;  4TYS A;  5L9V A;  3WDT A;  1XNT A;  3O7O A;  4PIY A;  4CCL A;  1L3J A;  4HFS A;  5I0U A;  2PQS A;  2FCV A;  3DYP A;  3WDU A;  4IV1 B;  3QOP A;  1HKD A;  5F3I A;  3VKM A;  2XL9 A;  3RMX A;  1XXN A;  4A4A A;  3WLU A;  4K20 A;  1DQ5 A;  1UX7 A;  2ZX3 A;  4GZ9 A;  1H4G A;  2G9G A;  2UY9 A;  4W6Y A;  4XFA A;  5CZK A;  4FPY A;  1XE0 A;  4OI2 A;  1VBE 2;  2DVB A;  1LHU A;  2FBE A;  1PO1 1;  5BNP A;  1T6B X;  2QKD A;  4Y33 A;  4BQ5 A;  3H42 B;  1BZW A;  3POS A;  2DYC A;  4YZ2 A;  3PJQ A;  2EAL A;  3AB0 A;  2R7E B;  5L36 A;  3DEM A;  3AP9 A;  3OOX A;  4BPZ A;  3IT8 A;  5KXD A;  4F7Z A;  4AHY A;  3M3O A;  4CP2 A;  1CIW A;  4FFG A;  3O1P A;  3LFI A;  1AX1 A;  4QQL A;  2DCK A;  3H8O A;  3ELN A;  1GLH A;  2YFZ A;  1W6Q A;  2SBA A;  2WWS A;  4CPB A;  1YFU A;  4XAE A;  5EJ3 A;  5F32 A;  3VHP A;  1TMF 2;  2JDY A;  2XUM A;  2Y64 A;  4OUM A;  1W90 A;  4OUE A;  1LB2 A;  4QHB A;  3USU B;  3D3A A;  1RYY A;  1SPP B;  1R09 2;  1HJF A;  3MLL A;  4IL7 A;  5D1I A;  2CDP A;  5FWJ A;  1OA3 A;  1IS3 A;  2OII A;  4A3X A;  2VC9 A;  5JOZ A;  3V65 A;  5LB6 A;  4CU8 A;  2MEV 2;  2VW1 A;  3ATG A;  3POF A;  1WBF A;  2JDU A;  2N7G A;  3Q8C A;  4XAC A;  2ZGR A;  5CNA A;  1CPM A;  2JG9 C;  5FYS A;  3ZYJ B;  4BQ1 A;  5HXM A;  2RS3 1;  4NRP A;  2AEZ A;  1SFP A;  2XJR A;  5CAZ A;  4QM9 A;  1O3Q A;  3OGR A;  4FFH A;  3OUJ A;  4LBL A;  4EE2 A;  4AYU A;  3WF1 A;  1YIF A;  5D21 A;  2RDR A;  2R04 2;  1QH7 A;  1W2U A;  4Q0V A;  5FKC A;  3CF6 E;  4EJR A;  5BNQ A;  5C5T A;  2JDN A;  3F2Z A;  3LGR A;  4A3Z A;  2ZGS A;  2FMD A;  3GZA A;  1G9A A;  2DUQ A;  2RS5 1;  4EWE A;  2CV6 A;  3VBF C;  1PMI A;  5FYU A;  5L9R A;  5FMD A;  3I4I A;  3HIF A;  1MR5 A;  1V6M A;  2ZHM A;  4LKD A;  3D4K A;  2WA3 A;  4NRO A;  4OMC A;  5GZD A;  1LOF A;  4OHY A;  4O65 A;  3FMG A;  1HV0 A;  1RUD 2;  4I2O A;  1C5I A;  1UY0 A;  2Y26 A;  4K1Z A;  3UNP A;  1IPJ A;  1SBF A;  3G6J B;  2XXZ A;  4RHV 2;  1U5Y A;  4RQP C;  5JMC A;  1JYV A;  5T5L A;  3W59 A;  2K0G A;  3JU9 A;  3MDP A;  2ZMN A;  1UIK A;  2BFU L;  2GAU A;  4NUB A;  1C4R A;  5I0R A;  5F6K A;  3GZU C;  4AAP A;  4DNY A;  2R32 A;  2I74 A;  3FFZ A;  5C8C A;  5FZ0 A;  3WG2 A;  3RS6 A;  5ABJ B;  3I8T A;  5DG2 A;  5FYZ A;  4QKD A;  1C8M 1;  1KD7 A;  5F9T A;  2WFP A;  3KWV A;  1J3P A;  4N9I A;  3EMR A;  3J26 N;  1A6C A;  1YJL A;  3M3Q A;  2A6Y A;  2H6B A;  4J1W A;  1PNF A;  2VCB A;  1ULO A;  2ZPX A;  5T52 A;  3UKV A;  3WP5 A;  1YQC A;  1AF9 A;  1D2Q A;  4LK6 A;  4R4Z A;  2DF7 A;  3MUY 1;  5GZG A;  3C7E A;  4KGG A;  3E5U A;  5FIX A;  5CKN A;  4QX2 A;  5I8Y A;  4GMP 0;  3RWK X;  2IFW A;  1F4A A;  4IEY A;  2VCM A;  3NW4 A;  4RN5 A;  3NNF A;  4Z2A A;  4QPG C;  1CVN A;  5LW9 A;  4YLZ A;  3AZZ A;  4EWA A;  3RPQ A;  1JOJ A;  1YXW A;  4Q4W 1;  5F5I A;  4CP9 B;  5KC5 A;  1S4C A;  1BCX A;  2WWU A;  3O0W A;  3CU7 A;  4XZP A;  1QJF A;  2Y38 A;  3QLQ A;  4OHW A;  2HBU A;  2GMM A;  1S2K A;  2YZ4 A;  3H1W A;  2FD8 A;  1RVF 1;  2F4P A;  1LOD A;  5L7O B;  4HET A;  5BPX A;  2W39 A;  1KRI A;  1RUF 1;  4IEU A;  4J1X A;  2GDF A;  2HWC 3;  4IV3 C;  3NWK A;  5F39 A;  1YIP A;  1ZBA 3;  3POW A;  4Q4V 1;  5H9P A;  4AFB A;  5JZG B;  1K42 A;  4BWO A;  5IWF A;  4ISQ A;  1QJU 3;  4I0A A;  5CFD C;  3LWC A;  5GJ6 A;  3VBS B;  4J25 A;  4IE5 A;  1K45 A;  4OI4 A;  1RUI 2;  4M4R A;  3PUR A;  4FPL A;  4O9E A;  1UCX A;  4DUV A;  2VCA A;  2WNU B;  4FO9 A;  3WF4 A;  2BJS A;  4XYX A;  4AFM A;  5DG1 A;  1MS1 A;  1E5I A;  1S0B A;  1JHJ A;  3N7J A;  2FMY A;  5ANN A;  3UGH A;  4YZ5 A;  3M8L A;  3I3Q A;  2RE9 A;  4XF0 A;  4C8D A;  2ZJC A;  4XET A;  4Y1Y A;  5FZ9 A;  4CU7 A;  5T5P A;  4YW6 A;  5GM0 A;  1UD1 A;  2PHW A;  4E2Q A;  1ZYB A;  4YM1 A;  1RUC 3;  3PL0 A;  1LU2 A;  4NMI A;  1GWK A;  1RIT A;  1UL9 A;  1UY1 A;  1ZBE 3;  4MZU A;  2VMC A;  5E1R A;  2RDN A;  3BIE A;  1LCL A;  3B9I A;  3DKQ A;  4QX3 A;  1HRV 3;  1V9U 2;  4XDO A;  5LWB A;  4IEP A;  2WYF A;  1RHI 3;  3OG2 A;  4Z2W A;  4XCA A;  1ND3 C;  3VZJ A;  1YQ5 A;  5T5O A;  1AX0 A;  4ARX A;  4NIA A;  1RXG A;  4N43 C;  1AR6 2;  4PT6 A;  3VD9 A;  1ZBA 2;  1MPX A;  5JPM B;  1EV1 3;  4YYO A;  4YPJ A;  3V0A A;  3DL3 A;  2AAC A;  3O1S A;  1HDK A;  4HKL A;  4IGP A;  4CCK A;  4AI8 A;  3VB9 A;  1ZRI A;  2VNR A;  3MW4 A;  4PDW B;  1QOT A;  1RMU 3;  2F17 A;  5FZC A;  1XJA A;  4I3P A;  5J3U A;  1JTZ X;  1KS4 A;  4L99 A;  1EUU A;  3SC7 X;  3AC0 A;  4LEJ A;  1LGC A;  2HYX A;  1BK0 A;  2R06 2;  3BGA A;  1YWK A;  2D6N A;  3S5A A;  2Y6G A;  2C6S A;  4I02 A;  3E6D A;  2EVX A;  2WO2 A;  3BPZ A;  3AKQ A;  3CDZ B;  1JZ3 A;  3UKT A;  2A73 B;  4MXW B;  3FZ3 A;  2ORX A;  1TMF 1;  2P3I A;  2ZHK A;  1IOA A;  3FUO A;  3H1Y A;  4HSL A;  4WZC A;  4BMB A;  1XYO A;  2HWD 3;  3WIN E;  3WF2 A;  1W8N A;  3IDA A;  5M0T A;  1PVC 2;  1R09 1;  1JUH A;  2C24 A;  1WMX A;  2R30 A;  3AFG A;  4WM8 A;  5FPZ A;  4CU9 A;  4Q8K A;  1US2 A;  3P6B A;  1P8J A;  3IPV A;  3O5S A;  2UYA A;  2MEV 1;  5A7W A;  2AZ5 A;  4UYB A;  2CHH A;  2KR2 A;  4E8D A;  1V6I A;  4NHM A;  3RMY A;  3RYK A;  3B69 A;  5J96 B;  2OQ6 A;  4P9G A;  2D5H A;  3WF3 A;  3WP3 A;  5FZE A;  1WME A;  2YHJ A;  2WYS A;  5I8S A;  1F15 A;  1OVS A;  3HQX A;  5IK4 A;  3OBT A;  1PK6 C;  1AR8 2;  4QQP A;  2V73 A;  4BH9 A;  4QQH A;  1CES A;  4XFF A;  2R04 1;  3IWZ A;  4XF4 A;  5CKQ A;  2E51 A;  4OUL A;  4ATF A;  2YUE A;  2E63 A;  3HT1 A;  3U07 A;  4NPR A;  1OPO A;  2IXI A;  1D0H A;  3I2H A;  5B4N A;  1VBB 2;  1POV 1;  1R64 A;  1J1T A;  2X8K A;  2Q30 A;  3MIC A;  2XJQ A;  1RUD 1;  3ZDS A;  4PHZ A;  2VOX A;  3U78 A;  3I97 A;  2O0O A;  4QKN A;  2ZGN A;  4G9S B;  4RHV 1;  4LXL A;  2D98 A;  3K4Z A;  1U5X A;  1GZ9 A;  1WMF A;  1OH4 A;  4LO8 A;  2WZR 1;  2DBI A;  2QE3 A;  2WS9 3;  1HN0 A;  1AJK A;  3M1H A;  2ARB A;  3DPR A;  1ZZB A;  3AL6 A;  3POE A;  4IEX A;  1VAV A;  4MUV A;  4EN6 B;  5C5U A;  1SBD A;  2JB8 A;  2VGD A;  2W91 A;  2D3P A;  2YRO A;  4K9S A;  2PMW B;  3RG0 A;  1FOD 2;  1REF A;  3NNL A;  3LEI A;  3FHQ A;  1X82 A;  3KV9 A;  3MEP A;  1PO2 1;  4Q4X 3;  4YGC A;  3MHZ A;  1ZRD A;  5A70 A;  4LUK A;  2GC2 A;  1ZZ6 A;  4JHZ A;  1XPW A;  1LUL A;  1RJ7 A;  4QXK A;  1Q8V A;  1D0G A;  2DVD A;  5C4W C;  1GZC A;  3OD4 A;  1Y3T A;  2PLV 2;  3HQU A;  1PGW 2;  4XXA A;  2BGO A;  2W1U A;  4K3U A;  4FOV A;  5JR7 B;  3L9J T;  1H9W A;  4QXH A;  4OVE A;  1W8O A;  1VBD 2;  4UW6 A;  1VBA 3;  4XUN A;  4AVT A;  3ZSE A;  2Z2S B;  4TTG A;  2JKX A;  2QQL A;  2ZX0 A;  2BOJ A;  4A41 A;  3AJZ A;  4MXV A;  4M4P A;  3HN1 A;  2ZML A;  4CXX A;  2VUD A;  1UIJ A;  1BVP 1;  1JZ2 A;  1QNW A;  3CJI A;  1NA1 C;  4XUT A;  4CU6 A;  1IKQ A;  3LIH A;  2BV4 A;  5IVB A;  2A6W A;  1GQP A;  3ES1 A;  3U10 A;  3CIH A;  2YY1 A;  1V6K A;  5B4X A;  5FPX A;  1GFF 2;  2Z79 A;  3R05 A;  4CDX A;  1D4M 1;  3PLQ A;  3NJV A;  5JSP A;  5ACA 2;  2PTM A;  3KT7 A;  3MV0 1;  1W06 A;  2WLP A;  3ZSJ A;  3OTF A;  1WCS A;  4JQT A;  5FXZ A;  4FFF A;  1IS5 A;  1PIV 2;  3MIG A;  5I91 A;  3W5N A;  3MF9 A;  4Q4X 2;  1MS3 A;  1COV 3;  5A32 A;  2BP6 A;  3AYA A;  5A3N A;  4BLJ A;  1S2E A;  1OF3 A;  2PHD A;  2WNV C;  4UBG A;  2X09 A;  4GQ7 A;  4YW4 A;  2BNM A;  2F4L A;  3Q9O A;  1D4V B;  4DUX A;  4L9B A;  1W39 A;  2TUN A;  3HEI A;  1RUI 1;  3IB3 A;  1APN A;  3OBZ A;  2GME A;  3R6S A;  3CHX A;  4IGQ A;  4ORF A;  4Q1R A;  2VMF A;  3CMG A;  4M0N A;  3U37 A;  3ILF A;  4PF1 A;  4XMA A;  4GB3 2;  2YBK A;  1FNZ A;  2VU9 A;  5LCW L;  3I59 B;  1O5L A;  4G4F A;  3S6P A;  2ZS6 B;  4QPI A;  4FTE A;  4FI9 A;  3D82 A;  2MNG A;  4Y1Z A;  1ACC A;  1VBA 2;  3JB4 C;  1IPS A;  1O4Y A;  1HB4 A;  1AR9 3;  1UO9 A;  2ARC A;  2DFB A;  4QM8 A;  3USS A;  1SEF A;  1G9F A;  2W08 A;  3AMM A;  1OHF A;  3JBG 1;  4QKF A;  1OUR A;  1HW5 A;  3RRD A;  2XQR A;  3QAC A;  4BDV B;  3H3U A;  4M3C B;  4MX3 A;  4D6R A;  4QPI B;  5DAX A;  2D93 A;  2YGL A;  1V9U 1;  1R1A 3;  2VXJ A;  2WZ8 A;  3KCY A;  2O1Q A;  3H8R A;  1OMI A;  5KHK A;  4NHK A;  2VG9 A;  3HR9 A;  3S7I A;  3RYP A;  2A6V A;  1WLC A;  1JMU B;  3T0D A;  4EN9 B;  3OD0 A;  4F3J A;  2HWE 1;  3SCG A;  2JIJ A;  2C0Z A;  1NLR A;  1AR6 1;  2VNG A;  2A70 A;  1RUN A;  1ND2 C;  1PX3 A;  4YVW C;  1FX5 A;  1GOH A;  3O1U A;  2WRA A;  3ZXF A;  3AJY A;  1PGS A;  5GAL A;  1NCR C;  3T09 A;  5JI7 A;  4IXL A;  4BIO A;  1XOY A;  2OX0 A;  1S0C A;  3N7K A;  4QXB A;  1MVE A;  4HKO A;  1PMH X;  2TEP A;  2JDM A;  3NKG A;  1SBE A;  1AYM 2;  2CL2 A;  4HOO A;  5FUP A;  1US3 A;  4ZXE A;  3LOB A;  4X8P A;  4DEQ A;  4CTE A;  5FPB A;  2R06 1;  3OUI A;  4H7M A;  1UAI A;  4W50 A;  5A3W A;  2VAU A;  3KF3 A;  2ZZJ A;  1EUT A;  3WG1 A;  1N47 A;  2JD9 A;  2OS2 A;  4EN0 A;  3GBF A;  1H1A A;  5CYY A;  3PVB B;  1DGL A;  3ABZ A;  3WNM A;  2P2K A;  1YI7 A;  1YYN A;  2BGP A;  5FTT C;  1S55 A;  4CP0 A;  1WMD A;  3K3N A;  2IVJ A;  1GZW B;  4MAD A;  3HVD A;  3J8F 2;  3T2O A;  2ZEY A;  4JGZ C;  5DAQ A;  1JBC A;  3T1M A;  4UFI A;  5F6L B;  1TQ5 A;  2HWF 2;  3WR0 A;  4XFH A;  1ULP A;  5IAT A;  1AYN 2;  5C9A B;  2GP5 A;  5FMO L;  3SEP A;  3VHR A;  4JQR A;  3WUC A;  4XE9 A;  3WNN A;  1OBN A;  1RIR A;  5KHI A;  3CL1 A;  1ZZ9 A;  4OYU A;  1MVQ A;  1LTE A;  5L7O C;  1AR8 1;  3CZJ A;  5FZA A;  2VMH A;  3EJK A;  1B35 A;  3K2O A;  2JEC A;  3LIG A;  5KXC A;  3U4X A;  1VE0 A;  4KQ7 A;  3ECQ A;  5EJZ B;  4EWD A;  2DCJ A;  3AP5 A;  2AUY A;  5G04 L;  2KM2 A;  2K46 A;  5JZG C;  1OSG A;  5F3C A;  4XIK A;  3JXS A;  3ACH A;  2RS3 3;  2VW2 A;  4R9D A;  4Y1X A;  4CA9 A;  5H9Q A;  5IVV A;  5IK7 A;  4QGL A;  1VBB 1;  4OZO A;  1JI6 A;  2D40 A;  1CAW B;  1VAM A;  4ZS3 A;  2IVI B;  4XDP A;  3F95 A;  3B94 A;  2VBP A;  3FLT A;  4CUG A;  3IAP A;  3QCW A;  1PO1 2;  4UT5 A;  1X8E A;  2J1V A;  1NX9 A;  3LEG A;  3T2Q A;  1DLL A;  1VJ2 A;  2WNU C;  4UFK A;  2VM9 A;  1GIC A;  1RC6 A;  4DXZ A;  5FZ6 A;  5K8S A;  2RS5 3;  2A71 A;  1PZ7 A;  1LOB A;  1K5M C;  4AFA A;  4XDQ A;  5CIR A;  1V6L A;  4HK8 A;  1H9P A;  4GH4 C;  3MZH A;  3BU7 A;  1UU6 A;  3AZW A;  4BQX A;  5JPN B;  3UGG A;  1GQH A;  5FYY A;  3VV1 A;  1GWL A;  2RR1 2;  2WQZ C;  2ZZQ A;  2FZ1 A;  4TZD A;  2PLV 1;  3VUO A;  1PGW 1;  4HG6 B;  3ZMO A;  2OZ6 A;  2Y6H A;  4CUC A;  1I5P A;  4GMP 1;  5CG8 A;  5CIS A;  3ORJ A;  1EY2 A;  2XR4 A;  3H3L A;  3RSJ A;  5F3G A;  3SIT A;  1VBD 1;  1KS5 A;  3PU8 A;  4XXP A;  3I2K A;  2ET7 A;  3NAP A;  1ZRC A;  1NQJ A;  5IHR A;  4Q29 A;  3BKZ A;  4XQ4 A;  1C8M 3;  1H2M A;  4X8N A;  1ZRE A;  4FPF A;  1OPM A;  1R1Z A;  4LBJ A;  1S0J A;  2RHP A;  5FZK A;  4A6O A;  1U0A A;  1ST8 A;  2JXA A;  3BOD A;  3IZO A;  3WUD A;  1CJD A;  4CE8 A;  1W03 A;  3VDB A;  3ZXG A;  1XSQ A;  4MGT A;  3NAP B;  5CKM A;  1LNS A;  5FZM A;  4AE2 A;  3OY8 A;  2Q8D A;  4DZG A;  1YUD A;  1BBT 2;  3S30 A;  2J1T A;  1WW4 A;  4BME A;  4FP2 A;  1QNY A;  2JG8 C;  2XJV A;  2AEY A;  3HNY M;  3MW2 A;  4IE4 A;  1STM A;  4ZPI A;  4NII A;  2E33 A;  3GGL A;  4B1M A;  4Q4W 3;  4KU8 A;  3A21 A;  1ALY A;  1JYI A;  1W2A X;  2BPA 2;  1PIV 1;  5JI9 A;  4YVS A;  2X5I C;  2PHL A;  5FO8 B;  5B2G B;  3VL9 A;  5JSO A;  2LM3 A;  4KWU A;  2XLA A;  2FDK A;  1RVF 3;  5I0S A;  3AL5 A;  3B00 A;  1VB2 A;  4XZU G;  2ILM A;  4YZ3 A;  1MQT A;  1RUF 3;  1C8N A;  5EV7 A;  5A7O A;  1OVP A;  3CJX A;  4GB3 1;  4HMZ A;  2AYH A;  1O7F A;  4Q4V 3;  5FJK A;  4GWN A;  3WDW A;  4YM3 A;  4XJA A;  1AXY A;  1FI2 A;  5EIY B;  1PHM A;  2VVE A;  4KBZ A;  4QWN A;  4CEY B;  3K77 A;  3GAL A;  4FPJ A;  1JZ5 A;  3RZL A; 
#chains in the Genus database with same CATH homology
 2XR4 A;  2JDM A;  5A3O A;  1OVS A;  2JDY A;  1OUS A;  2BOJ A;  2JDN A;  2JDP A;  5A6Q A;  1W8F A;  1UZV A;  2WR9 A;  5A70 A;  2VUC A;  2VUD A;  5A6Z A;  1OUX A;  2VNV A;  5A6Y A;  5A6X A;  3DCQ A;  2BV4 A;  2JDH A;  2JDU A;  2BOI A;  2JDK A;  4CE8 A;  1OVP A;  4AOC A;  1W8H A;  2WRA A;  5HCH A;  1OXC A;  2CHH A;  3ZDV A;  1OUR A;  1UQX A;  1GZT A;  5D2A A;  2BP6 A;  4UT5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...