2VUDA

Pa-iil lectin from pseudomonas aeruginosa complexed with fucose- derived glycomimetics
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
114
structure length
114
Chain Sequence
ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNETAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILTNELNFALVGSEDGTDNDYNDAVVVINWPLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Fucose-Derived Glycomimetics as High Affinity Ligands for Bacterial Lectin Pa-Iil from Pseudomonas Aeruginosa
rcsb
source organism Pseudomonas aeruginosa
molecule tags Sugar binding protein
molecule keywords FUCOSE-BINDING LECTIN PA-IIL
total genus 20
structure length 114
sequence length 114
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07472 PA-IIL Fucose-binding lectin II (PA-IIL)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.400 Mainly Beta Sandwich Jelly Rolls Calcium-mediated lectin 2vudA00
1OVSA 2JDPA 2JDHA 2JDNA 1OVPA 2VUCA 2BOIA 1OXCA 2BOJA 1UZVA 5A6XA 1W8FA 2WRAA 2JDYA 2WR9A 2BP6A 5A70A 4UT5A 1W8HA 5A3OA 1UQXA 2JDKA 1OURA 2BV4A 2JDUA 2VUDA 4AOCA 2CHHA 1GZTA 5A6ZA 3ZDVA 2XR4A 4CE8A 1OUXA 5HCHA 5A6YA 5D2AA 3DCQA 2VNVA 1OUSA 2JDMA 5A6QA
chains in the Genus database with same CATH superfamily
2RVAA 2MEV3 2RS13 4Y3OA 5EFUA 3SXWA 2EF6A 5FZFA 2D6KA 4IE4A 5ANQA 5CEHA 1M4WA 4IETA 4BLJA 2CGPA 2I07B 2X10A 2W95A 2ZAHA 4N53A 4UF0A 5CADA 2XL9A 4TTGA 3I3EA 3T2OA 3VZMA 1F35A 2R061 3O1SA 3VDDB 4CDQB 1PMIA 1Q56A 4D7YA 5F8PA 3QBQA 1Q5OA 1YI7A 2YHJA 4ISQA 1KEXA 4Y1UA 2PN5A 2R0HA 3MPPG 2D5HA 3N9QA 5FMCA 5F39A 4CA9A 3JXSA 2CHHA 1GZTA 2YC4A 1BEV3 4MGSA 4BH9A 5BNPA 5BNQA 4J1WA 5C3PA 4YZ3A 1YFWA 2VMCA 3RYPA 1ULFA 3S6PA 2FDFA 5CYYA 4CP0A 3M8LA 5FYUA 4CP9A 5KC5A 1A3KA 3AL6A 1LHUA 1O4YA 4ASLA 4BDVB 4CCCA 4AHXA 1LECA 1RVF1 3I2KA 2GAUA 1W8FA 2E7AA 3M3IA 4XFFA 2YV8A 1CAXB 4QDSA 1QQP3 3DECA 4JCKA 4KG0A 1J1TA 3TOJA 4E4SA 3T09A 1PZ7A 1QJU2 5A7NA 4QXHA 1VBA2 5IAXA 1HRV1 1LU1A 1VBD1 4F7ZA 5A3NA 4NHKA 5FUNA 5JVVA 5EV7A 3CJIC 1PK6B 2VMDA 3X29B 1XNCA 3KT1A 5HPOA 2ZOEB 3H50A 3KF3A 4IV3A 5FY1A 1Q8PA 5D2AA 1QXJA 2VNVA 2HWB1 4QT6A 1HRV3 1BZWA 4N8MA 5FP8A 5C3OA 2DFBA 4LTAA 3RZJA 2VZRA 3AC0A 1I3HA 2DTWA 5BNNB 2ZAAA 1BCXA 1XE8A 5EIYB 2BFUL 1UZVA 3AYEA 3U4SA 2WN3A 3POYA 2PYTA 2VNRA 5LA2A 4BQYA 2DWRA 2ERFA 2QCSB 3A23A 4LKDA 4ATEA 2E53A 4DIQA 1SBFA 3BOPA 3MLKA 5JR2A 1C8M2 2AREA 3WF0A 4NIDA 3GJBA 5ABJB 1GANA 1C5HA 1ULPA 3ZVXA 4KG8A 4ARXA 1MQTC 1NCRA 1VR3A 1NYWA 1Q8QA 2GMEA 4URAA 3N7KA 5DAPA 1OQ1A 4DXZA 3RMYA 2WWJA 1ND3A 2D98A 3SH3A 3WG3A 5FDBA 5CFCB 2WA3A 1LGBA 2QQIA 4QQOA 5FZ7A 4QPGB 1PVC3 1PMJX 5FXXA 3N7LA 5CZKA 4JGYB 1YFYA 1XSQA 4M01A 1UCXA 1RL3A 3I4IA 4XE9A 5L7OB 3ACIA 2GN3A 3BPZA 1QKQA 5F1RA 4QGLA 4R52A 2FMDA 1SCRA 3KQRA 3FWEA 3VV1A 5JUVA 5IVJA 1WD3A 5FZAA 2VQ0A 1LOAA 5FYTA 3BIWE 4AW7A 3H8RA 3RDIA 1OQEA 1LJ7A 1MPXA 2XJSA 3ZM8A 1GFF2 2VUDA 1GV9A 5JI7A 1LB2A 4AI9A 2WNEA 4UYBA 1ULEA 2AENA 4RR3A 3AZYA 1RJ8A 4XF0A 3NNFA 2C9KA 3CJXA 4IQPA 3TEYA 4AAPA 1LOEA 1CZVA 1OHFA 1AL23 2R1DA 2GU9A 1DBNA 1W8TA 2BERA 1NT0A 1OH3A 1D4M3 2VY0A 4QQ2A 5JSPA 1XNBA 2XBO1 4GB33 4MADA 5DG2A 3AKPA 5FZCA 1XU2A 2XLAA 3J7NA 2B5HA 4EN6B 4IV1A 1LHWA 1W04A 1ZM1A 3CL1A 5IK5A 3HMYA 4FFGA 3O1TA 3H1YA 4QQLA 1AZDA 1AR61 5DXDA 3VDDA 4A3XA 4CDQA 4KL1A 5F5AA 3POEA 4ISRA 4HN1A 4L92A 3CEWA 5LWBA 3RWNA 3T0DA 4Q4Y2 2O0OA 3WY6A 1YO8A 4YM3A 1W39A 4HT1T 5KC6A 1W6OA 3HIFA 5D21A 1TNFA 4LOTA 5CFDB 5F3IA 1AL22 2G9GA 2BFUS 1QNWA 3U37A 2VQUA 3I2IA 2JDAA 2Y8KA 3C7FA 4CP9B 1NY72 5FYCA 4O7XA 4CUGA 3NV2A 1C4RA 2Y33A 3OGGA 3OUHA 5BUVA 1D4VB 1TEIA 1RHI1 4ASKA 3B9CA 1SCSA 4OLLA 2XB6C 3B01A 2YB7A 3M1HA 2EXHA 3VBSC 2ZGTA 4XMAA 5J09A 3TN91 1WA4A 2EXJA 1VE0A 1OT5A 2WABA 1XNKA 3FJSA 3PLQA 4JV4A 3WCRA 2NLRA 2ZACA 1WW5A 1KDMA 4TLFA 4I3PA 2GNBA 4DRRA 3WUDA 4FAHA 1E5IA 4W6YA 5CBLA 5JXJA 4PI2A 1OKQA 4A3ZA 4EWAA 3PDQA 4XVHA 2JDMA 1OPMA 4ITCA 1XXNA 1LCLA 1WD4A 2JDPA 1UPSA 3AXEA 4W8JA 2BOIA 4LIVA 4XFBA 3I3MA 2WRAA 3OF1A 4GKXA 1ZREA 3B94A 4GIQA 2RR12 1QJY3 1CPMA 2VZUA 1GWMA 3DN7A 3HQRA 2NMNA 2Q8EA 4RYDA 5IW0A 4JVAA 2YBSA 5DUXA 3PURA 4Z07A 2FCVA 4AFCA 1ASJ3 5EHDA 4AI1A 4E2GA 4E4DX 5CKMA 4GWJA 3H8OA 1SLLA 5KBFA 4IV3C 2BV4A 2F17A 2RS32 3U78A 4KBZA 2OYZA 4JKLA 4KWUA 5LEJA 4IE6A 1ASJ1 2LROA 1YRZA 4QPGA 3CQOA 4GWMA 1VRH3 3DYMA 4P9LA 2JG9A 1UZ0A 1V6OA 4B4RA 2DU0A 3CJIB 3N3HA 2VNOA 5ERLA 4CU8A 4ZKTB 3JUUA 5IK7A 1D4M2 4UT5A 4OUSA 4A41A 2D5FA 2XGXA 3IAPA 3RZHA 5A7PA 4K8RB 1C28A 1AX2A 2WNUB 1AR83 4NIAA 4XTMA 4NRQA 4CDXB 5CFDC 1XQNA 3VBRC 4Y33A 5FOJB 2BNOA 3HT2A 3OUJA 4FP2A 3ZXAC 1ND2A 2R043 3M70A 3QH6A 3WDYA 3GCWA 2IWGB 2QQMA 1NCQB 4LKSA 1RIRA 4MGQA 4GH4B 4RS5B 4JGZC 3FHIB 1W03A 1AXYA 4J6GA 5A1FA 3P6BA 2BEOA 1YC61 1F15A 1STMA 1POV0 3OBZA 2WNVB 1MEC1 3FMGA 1UNBA 1XE7A 2XOMA 4LBOA 4OI2A 2G19A 3TWIA 2HWE1 3JQXA 4L2NA 1O6UA 4CXYA 4ARYA 4CXXA 2AEYA 3AFKA 4DUXA 2P3JA 2YC2A 3GJAA 2VUAA 4Q4W1 2RDSA 1WWYA 1NG0A 2CL2A 3BALA 1W8OA 3ILNA 4KU7A 1I5PA 5LBCA 3UNPA 3WUCA 4OQ8A 4GXLA 4HL0A 4LK7A 2X09A 3ZFFC 1R1A3 4Y4YA 1W6NA 3OB8A 4ONUA 4G9SB 2V5YA 2YROA 5F32A 3GALA 3J4UH 1ZZBA 3ACGA 1EUTA 1IPKA 3ZDVA 3ETQA 5FZGA 4TSVA 1OVPA 4XUQA 2LM3A 3WDTA 3M3CA 5L19A 1LR5A 1C3HA 4KWJA 4UOJA 2B7YA 3DV8A 4N7IA 5FLHA 5F6LB 5IWFA 4BISA 5LY1A 4FPFA 1XJAA 2ZMKA 4BHPA 1MQTB 2B9VA 2FDIA 3ACFA 3I49A 1MR5A 1PNFA 3KT4A 5C9AC 1JYXA 3GCXA 2ZEYA 5TSWA 1BLZA 1SLTA 3E1F1 3V56A 2OIIA 4NAMA 3NO8A 1UY0A 1VB2A 3GXUA 1APNA 2PMWB 1X36A 4DB5A 1POV1 1V6MA 5JXHA 1HB4A 4CDWB 1I6XA 3B02A 1F4HA 1RUE1 5FZIA 1LOGA 2J1UA 2MHFA 2D6MA 1HDKA 5BY5A 3Q8FA 4LBLA 4PIZA 3ZKUA 5LEKA 1HX6A 1NCRC 3VZKA 4FBFA 2P6HA 3VZLA 1KJLA 3DPRB 4Y1VA 1H9PA 1QQP2 4LHLA 2E9QA 4LJHA 4IEOA 4NN0A 4MGTA 2YU1A 3NJZA 3BTAA 3VBHC 1G9CA 4P5YA 2VZTA 2QNKA 2E51A 4OUMA 1DDLA 2B42B 4AWDA 3IDEA 3MICA 4OZOA 4HBNA 3TNQA 3ZMOA 1O8PA 4FT8A 4JDMA 3I2HA 1COV1 1RUD1 1Z78A 2WZR3 2Z79A 4DFSA 2RG4A 1GYKA 2CWMA 4PCRA 4XXAA 4IGOA 2AR6A 4P9JA 4ZU5A 5FPBA 4AFMA 4FSJA 1JBCA 4ET7A 2FD8A 2ZGSA 1WLWA 1B35C 2WFF1 5FY7A 3RI8A 1U5XA 1MS9A 2ZCWA 4DPNA 4AXOA 5CG9A 2PTMA 4DEQA 4I0WB 2HWD1 5H9PA 1H1IA 2LS6A 4FO9A 3ZXJA 4CUCA 1SZBA 3DL3A 5FZ0A 5DDJ2 1BQPA 2WT1A 3ZN5A 4E9KA 3T4VA 3VKFC 4QB1A 2XLFA 5A3MA 3CF6E 4MHRA 1FATA 4ZHNA 2DYCA 4YVWC 1R1A2 5BNNC 1QJU1 4YVSB 3I59B 5E8AA 1YFUA 3DGTA 3J8F2 2GDFA 5FXWA 3CNAA 1TMF1 2I74A 3OGRA 3B5LB 5FZDA 4AEJA 4RA0A 1WCSA 1X82A 4N43C 3W58A 1ZRDA 3POBA 1W3XA 3IDCB 5FPAA 4DRVA 4A7ZA 1MZFA 3DUIA 2WA4A 3LIHA 2TEPA 3T0BA 3UKVA 4R9DA 1ZA4A 1OD5A 1ACCA 1J1LA 3OGSA 1HXS3 4QKBA 4GKYA 4AGRA 4ZXEA 5J1XA 2ZEXA 1IS5A 1YQ5A 2B4KA 3JZVA 4U2AA 4Y22B 1J3RA 5FMOL 3AYCA 1R091 2JJ6A 2I2SA 2AUYA 4LA2A 2RM23 5G04L 3ZXFA 2FZ2A 1IS6A 1WKYA 2OPKA 1OMIA 4OMCA 2WNOA 2TUNA 1QOTA 1JODA 2HLEA 3CMGA 3MW2A 4AK3A 4FQZA 4V1PA 5L9RA 4QDRA 4DMIA 1AX0A 1V0AA 1RUG1 1VRBA 3OCPA 3KMHA 4NHLA 3H8UA 2W5FA 4BLIA 1W6PB 4CEYB 4IV3B 1RUH1 5A6XA 4Q4X3 5CFCA 2ES3A 2HKXA 1R1ZA 1ND3B 2DFCA 1NCRB 3PJQA 4UW5A 3LEGA 4BQ4A 1G9DA 1RUG3 5FWJA 1DQ0A 2OZJA 1JYVA 4GH4C 4RS5C 1FT9A 1DFQA 2JE8A 3OPTA 4Q4X1 3S5AA 3U4XA 4DXTA 2QQOA 4KGGA 2JICA 3MUY1 5LATA 3ROUA 4AOCA 4E4HA 2D44A 1O5LA 1RUF2 5E16A 1W90A 2ADDA 4CPBD 5BNNA 2WO7A 4DO0A 1VBD2 5HXVA 4W4ZA 1K45A 2R32A 1BYHA 3POWA 3NKGA 1UOGA 1PM4A 1WW4A 1GOGA 2OXBA 2HWB2 3KHBA 1V9U3 2GNDA 1D2SA 2WR9A 3MF9A 4GZ9A 5GJ6A 4AVCA 4YVSA 2QDRA 2VW1A 5C9AA 1HB1A 1W6MB 2FDGA 1H8VA 1UD1A 1KJRA 1B35A 5JLVA 2A3WA 1V9U1 2BNNA 5H9SA 2ARCA 3AZXA 3PU8A 4O9GA 4A4AA 3ZIWA 2J1RA 4XF9A 1YQ2A 2UWAA 2VM9A 1C8M1 2XDVA 3ME2A 3IAQA 4W50A 2VUJA 4IXLA 1RUC3 3DEMA 4TN7A 2XJPA 3VBSB 3DKQA 1IG0A 3I97A 1HN1A 5IK8A 4CU7A 2VZSA 4YW6A 3A7QA 4IW3A 3OSDA 1RITA 4FPEA 4L99A 4LE4A 1S0FA 5FR3A 1DGWA 2GMMA 1RUC1 3RZMA 3WG4A 4UFIA 2R0FA 2ZGKA 1XYPA 2HH9A 1HW5A 4MYEA 1CD3G 2DF7A 2VPVA 4Z2WA 3ON7A 5BXXA 4AFBA 2C0ZA 1K3IA 4ASMB 1JYWA 1XB9A 3E5XA 1O3RA 5KWRA 3ZFGA 2OPWA 4AQ6A 5A6ZA 5FY8A 4TLGA 5FIXA 3JB4C 4MXVA 3QACA 1ULDA 1PO21 3BOWA 3SISA 4M0HA 5T3NA 1LOFA 3OTFA 5KHKA 2VAUA 3LZZA 2VW0A 4LHSA 5JPNB 1OQDA 2PHLA 4O61A 2IXCA 3FBYA 3WVJA 4BE3A 3BU7A 2PXJA 1ZX5A 1OF4A 1SLIA 1T6BX 1LRHA 1CESA 1WW7A 4YGCA 2RR11 3NJVA 2XONA 2ZGPA 5I0UA 3IPVB 4EV0A 5LA1A 1Q43A 1A8MA 4FP3A 1AR93 1ENRA 3CLPA 2ZKLA 3PVOA 4K1ZA 2X5IB 4XUNA 1RUF3 1UOBA 1S0GA 2JG9C 5DDJ3 3S30A 2JEMA 1AF9A 2P3IA 1VAVA 4WZCA 4XHXA 5SV8A 4DY5A 1M06G 2A73B 4D94A 3HQUA 3T1LA 1LESA 1DP0A 4IEUA 3UKTA 5M0TA 2UU8A 3EBRA 4IEYA 3U14A 4Z92B 4NVPA 3WNPA 5LBFA 3K77A 3I3BA 3PNAA 3O5SA 3VDAA 2ET7A 4MGYE 4RQPA 2YPDA 5CG8A 4DOUA 2FDHA 1AL21 5A3PA 2WSUA 1CZTA 4XQ4A 3ZSEA 2J1EA 4AI2A 5B4NA 4MH0E 1PO13 3S0MA 1VBC1 1D4M1 5I8SA 1CGPA 3WDXA 1B35B 5K0UB 3OY8A 3BU0A 3AM2A 3D0JA 1WGPA 5A7SA 3RG0A 5JR7B 3LDRA 4UBHA 5IT6A 4KQ7A 3AZVA 1AR72 4R4XA 4CP1A 3JD72 1EYBA 1XYOA 3UYJA 4ZS3A 4LORA 4HN0A 1E5SA 1OVSA 4LQRA 3K3OA 2JDNA 3ZYJB 3WG2A 3K4DA 4OI1A 5IK4A 1F4AA 3VBOA 3ZFFB 1POQA 3VKOA 3WHUA 1IQDC 1IS3A 1OA3A 2WO3A 3D8CA 5CFCC 2QQNA 1RTVA 2SLIA 4AVSA 1UU5A 2LW8A 3HNMA 1VAMA 1OFSA 3LDKA 3PTYA 1PX3A 3W5NA 4Q0PA 2YBKA 4Q1RA 4XQDA 1N3PA 4N53C 5L9BA 1J59A 4NIHA 3HAGA 2BWCA 3MI8A 4OCTA 2WAAA 3SH4A 2O8QA 2JDKA 5T5JA 4CEYC 1NLSA 5A3TA 1W8WA 3WW2A 3GBGA 4WV8A 2Q1FA 3VBRA 3ZYGA 1UW8A 3I2GA 1QEXA 2C4XA 2ZZJA 2DCYA 2V73A 3FBMA 4G4FA 5FQ0B 3AX4A 2J1TA 5DZFA 2V09A 2PQQA 1J3QA 3POIA 2VMIA 2PHFA 1R64A 4NAOA 1BK0A 4BQWA 4LKFA 4CDWC 1ASJ2 4LBQA 2VW2A 4YG0A 4YZ4A 1OFNA 3RPQA 3K46A 4EWDA 1NOVA 5HBAA 5LY2A 2AYHA 1CQ9A 3GBWA 3ZPYA 5KXEA 4HOOA 1SPPB 1BEV2 1LENA 1QY4A 3Q8CA 2LUWA 4NHYA 3I2OA 5A7WA 4I2OA 2GH8A 1ZYBA 3APBA 5FZ4A 2VULA 4FOVA 1W9FA 4RN5A 1Y4WA 4QX1A 1CJPA 3LFMA 1G7YA 2QKDA 3GZEA 5C3QA 4XETA 4TXWA 4IEWA 4FOYA 4XFHA 4QQHA 1W28A 2ZABA 4P00B 1H2NA 3AKTA 3CHXA 3MDPA 5A1LA 3PUHA 4YLZA 1FOD1 5JPMB 3MV01 5FYIA 1UU4A 3ELNA 3B9IA 1RVF3 3OEBA 5AC91 1W6NB 3SLIA 2VZVA 5FZ6A 1AR82 3SEPA 1FOD2 1UU6A 3SKVA 4AE2A 1XOYA 1HLCA 2QQJA 3K2OA 5GZFA 2MEV1 2RS11 2VMEA 3NJXA 1GNYA 3AMQA 2H6CA 4QPIB 5I93A 1LOFC 1NZIA 1AR81 1F2NA 1ZBA1 4NPLA 3U75A 4LK6A 5AC93 1ZRCA 3V0AB 3WF3A 3SC7X 1CN1A 5BNOB 2C5DA 4RR3C 3U07A 1FPN1 4LITA 2ZGRA 2DCZA 2JG8B 3KVAA 4LBQB 4QPWA 4Y24A 2P6CA 5BYNA 5FQ0A 3KVBA 3JBG3 3T08A 2HWB3 1SG3A 1JS9A 4EN0A 4Q0SA 1OI6A 3F95A 1ZZCA 4YSFA 2BQPA 5ACA2 3FFZA 1ULGA 1UYXA 1Q3EA 1CIYA 3OY8B 3HBKA 3WP3A 5G05L 5DQ0A 1RUJ2 4BWOA 1W9YA 2ORXA 3HBZA 3MIGA 1DGRN 3FHAA 2XKOA 4P9IA 4BK5A 3GDBA 4MOAA 2P3KA 4DZGA 3SNMA 1H4HA 4DEVA 5KXCA 1ZBE2 4FI9A 2P1BA 4YM0A 1CJDA 2JDZA 1FV3A 2UY9A 4MZUA 5FP9A 1AYN2 3VKNA 3ZFFA 3IZOA 3AFGA 1ZBE1 1QDCA 2VUCA 2JG9B 4HK8A 3IT8A 1GZCA 3P5BA 4DINB 3AP9A 1PIV2 4LO8A 2VZQA 3M3OA 1SDDB 2JDYA 3V65A 1PVC1 1KDKA 2VTXJ 5LA9A 3W5MA 2WLQA 1TG7A 2XXZA 1RUJ3 3ASIA 3LEIA 1DYKA 4LHKA 3ABZA 2HWF3 3GGLA 2UYAA 4PQQA 3WHTA 1RB8G 1UZWA 1MVEA 4Y22A 4HONA 3SHRA 3QCWA 5I0DA 3WF4A 1YUDA 5IYYA 3NL1A 4NJ4A 4BQ3A 1ZZ7A 5JI9A 4NIGA 1Q8OA 5A6YA 3FL7A 1COV2 1GZ9A 1VP6A 5FY4A 4C0BA 5JZGA 3ENRA 1X8EA 3JQWA 5A3WA 4DS0A 1VBE2 2ZHLA 4P9WA 4XDQA 5F37A 4AVBA 2B46X 2HBUA 4YFZA 2RS33 3ES4A 1NA1A 2Y26A 4FPJA 2QQPA 3LFIA 1RUH2 3T30A 2WSVA 1HRI1 3ZN4A 1VBE1 4IEQA 3VHRA 5GLVA 3WNMA 4BYYA 4EROA 3O1UA 1HN0A 1UYZA 3UGHA 3KV4A 1VRH2 4LLFA 3AL5A 2C24A 1G9AA 1YJKA 1EV12 3K3NA 5GZEA 1A78A 1MACA 4HPKA 1IQAA 3IN9A 5GZDA 5F3CA 2PQSA 4FXGB 1REDA 1RUNA 3NV1A 5AFBA 4IEZA 1CAWB 2YXSA 1QJX3 5JOWA 2WWUA 3HR9A 3ZXGA 2QQWA 1OSGA 2WN2A 4N53B 4CCMA 3ATGA 3B93A 3K4ZA 3USUA 4AI8A 2ZS6B 3G7DA 3SCHA 3VBUA 1BJQA 2DVFA 4XUTA 1OXCA 2BOJA 3PVNA 4UFKA 3AP7A 3FLRA 4AHYA 4ZU4A 1GWLA 5AVPA 2UYBA 1S0IA 1ZVFA 1O59A 5FZ1A 4EZ4A 4CSWA 1Q8SA 2OUHA 5JSOA 1OA2A 1GZWA 2ZTNA 1IS4A 5FO8B 4RGKA 1YQCA 5C9AB 1O3TA 1CR7A 1QNYA 5GLTA 4QKFA 3BCWA 5L73A 4YG3A 1WMEA 4LUKA 4BXSV 1U5IA 1R083 5JIUA 2FQPA 5E88A 5FLJA 1QQP1 2E26A 3E6DA 3GM8A 5A32B 4XYXA 1QGLA 1U12A 2JIGA 3RS6A 3FFQA 2ARAA 4PBPA 3NRUA 3ZMNA 4IESA 1R081 2KM2A 1W0OA 1RMU3 1PHMA 2YY1A 5JMCA 3VBUC 3LOBA 2ET1A 3PJYA 4XURA 1DLLA 1NLQA 2VOTA 4JZRA 4LMFA 4P08A 4W6XA 3TBDA 2OS2A 3M3QA 2XJRA 4N43A 5T52A 3I3DA 2VXJA 5FK8A 3K51A 2VE1A 3TEXA 3WNLA 1KQRA 4K6BA 4IGPA 3WW4A 5GZCA 5L7OA 1VALA 3POJA 2JB8A 2CNAA 3HWJA 4AVTA 1O91A 1QIQA 3SKJE 2XJUA 2B45X 2IFWA 2X5IC 2D6NA 1G86A 4HK9A 4NRPA 1HJGA 3KCCA 5L9VA 1UZZA 4XJAA 1R1A1 5FZOB 5FY5A 4RR3B 1X50A 2G9ZA 2Q4SA 5KXDA 4CCOA 5J98B 4XJ9A 3OOXA 4IEPA 3AMNA 2YG0A 3H8XA 4Y4RA 3AMHA 2WFPA 1W2NA 3VHOA 3KD4A 4NPMA 2OZ6A 4Q0UA 1LOBA 2EIEA 1LHNA 3E97A 4JQRA 1NKGA 1O8SA 3I2DA 1ZRRA 5LCWL 1OBNA 1OUXA 1DYPA 3AVRA 3LD8A 3MFAA 1V9U2 5FZMA 3RJ2X 2PLV2 3IBMA 1K5MA 4N9HA 5JXIA 4A42A 3HNYM 3MIBA 3GHNA 4ZONA 2Q1ZB 1H2KA 3ZYBA 1X9TA 2WS92 5FZ8A 4B1MA 1FYUA 4SBVA 3BI3A 1AJOA 5FBZA 4OVEA 2X29A 3CDZB 3T2QA 4ZZ8A 3RSJA 5BNOC 1JZ5A 3KM5A 4GA9A 4XBNA 1QOSA 4HPKB 5D8AA 3Q8BA 2VNGA 3K4AA 5JCTA 5APAA 5C8CA 1SBEA 4XHBA 4KWKA 1WZXA 2D3PA 4GB31 1WCDJ 2I45A 3MYXA 4TYSA 2EAAA 4MSVA 1RVF2 4B7KA 1NX9A 2W0XA 4KNCA 1VMJA 4A6OA 1X8MA 4NHMA 3VD5A 3LA2A 4M3CA 1N3QA 4S2FA 1VAKA 5C8CB 5C3RA 5FV3A 2X5IA 2MPFA 4A7KA 2WC2A 2UWBA 4Y5SA 5FK7A 3NV4A 2YBPA 4EN9B 2W1UA 2Y6KA 5C3SA 1HJFA 1ND3C 1WMDA 3M3EA 1EPWA 3KGZA 4K7JA 3KCYA 3T3YA 1GZWB 1HXS2 3S5QA 4A2UA 3RVHA 1LEDA 1V6KA 2ZHMA 3HJRA 3RGBA 5ISLA 4E2QA 1DU3D 1UKRA 2RMU2 2XVLA 4L11A 5FPXA 1RJ7A 4JTNA 3H42B 3U11A 4RSUA 2A3XA 5IVBA 4XDPA 3RNSA 4CDXC 2UURA 2UY8A 2XQXA 3ILRA 5KHIA 2WYSA 1UIJA 3KS7A 1SEFA 4Q1PA 4AFAA 4R4ZA 1QH7A 3TEWA 4QB6A 4BCUA 1ZZ6A 1DCSA 1W6QB 1CAWA 3MV11 4LLOA 1UY4A 4M3CE 4PLNA 4E8DA 3SH5A 5CISA 5FJHA 2EIBA 1UYPA 4META 1UWWA 3NV3A 5T5PA 2IZWA 4M0NA 2ZMLA 1TZOA 3POSA 1VBE3 4N7UA 3QD6A 2XLGA 3OYWA 3Q9OA 5FO7B 3W20A 4XJUA 1JZ6A 3L9JT 2F4LA 4MHUA 4E4ZA 3UKNA 4EYUA 4K8FA 2PLV3 4XF1A 1TNRA 1U5ZA 3CZUA 3PTRB 3WQ7A 2DBIA 3I7DA 3KF5A 4Q0QA 3CKHA 1QJX1 3VBSA 3WF2A 3LIGA 1US2A 4CDWA 4FPCA 4H14A 3WNXA 3BPSA 1PGL1 4KGQA 2G9FA 1QJEA 4MXWA 2VVFA 1EY2A 2BDRA 1PGL2 4XCBA 5DAXA 3O1OA 5JOYA 1NUKA 4P14A 3VD3A 2XR4A 4X6RB 1IKQA 1ZBA2 4XF4A 1RC6A 2VZOA 2TNFA 5HI0A 4JAAA 2VOWA 4XEZA 5FPZA 1VB4A 4OMDA 2V72A 1O4TA 5LK5A 2VMGA 3IWZA 4LBNA 3FHQA 3LEKA 4Z8BA 3AXDA 3QLQA 5E6HA 3D4KA 3WNOA 3EMRA 4CDXA 1W06A 1Z0HA 2P2KA 5IVCA 2G4IA 4OZXA 2RM22 4HLTA 3ZYPA 3R4UA 1V00A 1K5MC 1FXZA 4BIFA 4JKKA 4HFSA 4MVTA 4HKOA 2VOXA 4YYOA 4CE8A 2WT2A 1X33A 2EA7A 4PBOA 3U0ZA 3VBUB 1ZNPA 3MEPA 3I54A 2PAEA 2BZDA 3ITQA 3NW4A 4LHNA 2Q0AA 3MFCA 3BTXA 1GICA 1FI2A 4PDWA 1SFYA 2FZ1A 4D6QA 5FXVA 1S55A 5BNOA 5BV6A 3KLSA 1N47A 2DCTA 4WM8A 4FFFA 4QX0A 3RRDA 3C7HA 5C6CA 2NN8A 3ZXDA 2FCUA 4X8PA 3ZYFA 5C4WC 1JW6A 1A6CA 2WQ4A 3ZSMA 4D3WA 2PAKA 2ZMNA 3NNGA 5DN2A 3BB6A 1TME3 2E7TA 4UW4A 2YMZA 1J58A 4Q27A 4XIOA 5IVYA 1G8WA 4RD7A 3OG2A 5FO9B 1JYNA 3H1MA 2H0VA 3VN4A 1PNGA 2E63A 2GC0A 2VGDA 3TN92 3H3LA 3WP6A 4UFMA 1CAVA 5JSRA 2MEV2 2RS12 3H3ZA 1FAYA 1GBGA 4D0QA 1JTZX 4FPHA 2E31A 1PGW1 2SBAA 3O7OA 4UFLA 3EQEA 5FFOC 2WIIB 4AHWA 4B4PA 1KS4A 4CEWA 1IPSA 2Y6JA 1VBB3 3PVEA 3VKMA 3JU9A 3PMSA 1PGW2 4WVMA 3AP6A 3N7MA 4Y5TA 4MGKE 5FYYA 4FPGA 4QKDA 2PHXA 4CTEA 3ZFEA 4YG6A 2GP5A 5ACA1 3MO4A 5EQUA 5K4LA 2ATFA 3WQ1A 1ZRIA 3HQXA 1CONA 2D6PA 1IPJA 3O0VA 1OLQA 5FZEA 4Q4V2 4BK4A 3V0BA 3WF1A 1YXWA 5EWSA 2AH2A 3FUOA 1ZBA3 1JMUB 3ECQA 4JHTA 2R7EB 3JBG2 4COWA 1GSLA 2VBBA 1F9KA 5DAWA 3WEZA 1BMV1 2W08A 4CDUB 2QQVA 1COV3 1IOAA 2BW8A 1EUUA 1W05A 4Z82A 1JXNA 1JUHA 3J7HA 3JBG1 5LBEA 5F2SA 2YPJA 3AYDA 4DXRA 2R041 4OYUA 2VOKA 2WDBA 1OLME 5L7OC 3WD5A 2DCKA 3UL2A 1UL9A 1GQHA 1UXXX 1HB3A 5DUVA 2D43A 5FRAA 4ZPIA 2K2SA 1P8JA 4FFHA 1ST8A 1DLCA 3UV9A 2P17A 2P3YA 2BJSA 1PIV3 3KHCA 1BBT3 4UF0B 5GLZA 1QDOA 4CZSA 1AYN3 1Y9MA 2AC1A 1ALYA 2XKPA 3D3AA 3IMNA 3M7AA 3N9NA 3LF7A 3PIGA 4PF1A 1PO23 1FV2A 2QZ3A 4UW6A 5FMDA 4NE9A 4XACA 3THPA 2GC3A 1RUD2 2H0BA 1AJKA 5ABJC 2YDEA 2GNMA 4YW3A 2RE9A 5LZ6A 4RFT0 5FP7A 3MW3A 1JHJA 4I30A 4MGZE 2FHRA 2ZGUA 4SLIA 1MEC2 2V5DA 1BKZA 3AP5A 3UESA 4B1LA 4EN8B 1V70A 4NWWA 3QH7A 4HKLA 5FYZA 1Z7S3 2A6XA 1H8TA 1JU3A 2PELA 2WJSA 3NNJA 4JTOA 4B3NA 4BMEA 3VUOA 3K48A 3R4DB 4Q4W2 1RUF1 2FCTA 5DDJ1 4LO7A 3WG1A 3F2ZA 4C1XA 2YGMA 4I02A 3BIEA 1ENSA 3O0XA 1Z7S1 4M00A 4G3YC 2C26A 4F3JA 1H9WA 2Y38A 5FMBA 3UGGA 4H3WA 3PUAA 4AI3A 2Q8OA 4N90A 3MIEA 4D6SA 4HXCA 3HT1A 2XL7A 1LGCA 2XUEA 4AEKA 4XMIA 1VIWB 2W52A 4UI9L 3N9OA 4HG6B 1S0DA 3O14A 4YNIA 3EXUA 5C33A 2FDKA 3J7MA 4WM8B 2GC2A 2XVGA 3J8F3 5JOZA 3ZIXA 2D93A 3IPVA 2W92A 4LO6B 4CXWA 4XJZA 4AVAA 5CVRA 2OQ6A 1CAUA 1RUH3 4RHV1 4A7YA 1DHKB 3PMEA 2W9XA 3PUQA 1GP4A 1UOJA 1V6IA 2Y64A 3USUB 1H30A 1G9FA 4TZDA 2P37A 5JDBA 1D0GA 2VZ3A 4QAWA 2RR13 3VZOA 1K5MB 3MGUA 4CRQA 2GNTA 4BQ2A 2JENA 2BGPA 3WNNA 4NUBA 1REEA 2PHTA 3EHKA 4X8NA 3C8XA 2BUKA 1XNTA 1YNAA 2X05A 3JCIA 2Q30A 2RS51 2W94A 2R1BA 4CDUC 4OHXA 3OEAA 5F5CA 4WVZA 4CU9A 4DQAA 4QX2A 5F5IA 1GP5A 2WFF3 1EAH2 1LTEA 4A45A 4B8EA 3KSCA 1SLCA 3VZNA 2VBDA 5F3GA 1RUI1 2JECA 5C5TA 4NIIA 1VBB2 4XILA 1GP6A 1ZRFA 1W9WA 1WLTA 4F83A 2KR2A 1N3OA 1PO22 5A32A 2WNVA 3RYKA 3BTZA 4LEJA 5CA6A 5FY9A 1RUI2 3GBFA 4CUBA 3A0NA 1QU0A 2VMFA 4Q4X2 1NXMA 4QGNA 5F6KA 3V0AA 1EV11 2WFF2 5E1RA 4W65A 2NPIA 3BVCA 3O1PA 4L0PA 4PT6A 1MS0A 2LTNA 2J7MA 1W8NA 2WS93 4XCAA 1RXFA 5IAVA 4KWLA 4MXWB 3THCA 3RZKA 2ZKNA 4DY3A 3RI9A 4HMZA 5KHJA 2BGOA 4GMP3 2DUQA 3ZYHA 2IUWA 2JKBA 3O12A 3VHNA 4LBKA 4QPYA 2YU2A 4YGEA 3C2UA 1F31A 5FZLA 1UY1A 2WL1A 1JOPA 2RMU1 1HIXA 1O5UA 1CZSA 1DZQA 5EJ1B 1TME1 4YZ2A 5FAXA 3N9LA 4INDA 1S2EA 4XZPA 5FYBA 4XFCA 4QKNA 5LB6A 2C9AA 4CCJA 2ADEA 1R092 2BP6A 1PVXA 2PHDA 2RMU3 5F9TA 3S57A 1MS1A 2VVDA 4WM7B 4AF9A 5DABA 3NNLA 2PHRA 3VKLA 3WSOA 1WUVA 2D6LX 2VXRA 4GQ7A 1LOCA 4IEVA 1VPHA 1D7PM 4RL7A 1W6QA 3PL0A 2R062 1IGOA 1KFUL 5AFEA 4IL7A 5A33A 1RUC2 4XAAA 3MW4A 1MZEA 4IEXA 1E5HA 1S2BA 2HWF2 3JD71 1ND2C 3OGVA 2CDPA 4JRAA 2TBVA 4K21A 4N9IA 1RUOA 2JG8A 1MS8A 3LWCA 1R082 1W6OB 4AQTA 5F7UA 3B69A 3OBRA 4H7MA 3TEZA 3L2YA 4HVQA 2A5ZA 2XUMA 4QHBA 5FPVA 5LASA 2HWF1 5IVEA 1DGRA 1D2QA 3HPNA 1YQ8A 3Q8EA 3AKSA 3ZDSA 4NR1A 2XQRA 1K5JA 3K75B 2F6BA 1UPIA 3S7EA 1RMU2 4Q0VA 2QVSB 3THDA 3ZSKA 5C70A 5JMOA 3KV6A 2HWC2 1QXRA 5KXBA 4E8CA 2QE3A 4AEDA 2NMOA 4IE5A 3T2PA 1JOJA 4KBBA 4XDOA 3E6BA 4H2AA 2XBO2 4FOWA 5IFTA 2HWC1 3MLLA 3KT7A 1ZZ8A 3MIFA 2WUHA 2W91A 1S4CA 5I91A 5ANNA 3WXPA 4A44A 4ES9A 2VVEA 2VCAA 4NWVA 1JZ7A 1MS5A 4S2HA 2NM1A 2ZGNA 4XJWA 2HWC3 2AGSA 4E27A 5FUIA 3RQ0A 4OHZA 2L9LA 4GMP0 4I0BA 3BKZA 3RZLA 2X8KA 3DKWA 3ZSLA 4M3CF 4LIUA 3BUCA 3VZJA 4D69A 4R8HA 2XJQA 1C8M3 2DBNA 4XIKA 5FZ9A 3THTA 4V2VA 3ZFEB 4C90A 2A1XA 2WZR2 2DDUA 1H2MA 3WDWA 3WP5A 1K12A 4K9SA 5GM0A 4Y1XA 4YM1A 3QOPA 4IV1B 4CEYA 1AL0G 2ZX1A 5LW9A 4F8AA 2A75A 1YIFA 2FDJA 2ID4A 4HETA 2IXHA 4CPBA 1UMHA 3NMBA 5C4WB 3VD7A 2A71A 1XU1A 4Q4Y1 4Y1YA 5I0SA 1UOFA 5HCBA 2GN7A 1V6LA 5C8WA 1CAVB 5A1AA 4XUOA 3PHMA 3MIHA 3WR0A 3H9AA 4QHOA 4OI4A 3ZN6A 3M2MA 2E6VA 3FN9A 2A6VA 3ETPA 1NE4A 2WNUA 4UW3A 1W0PA 3ILFA 4YZ5A 3D0SA 5EYYA 2VTXA 3IB3A 5FZOA 3RJRA 4HZFA 1ENXA 5JZGC 4AHZA 2O14A 4YVWB 3UGFA 4BMBA 2XHNA 1SACA 4XBQA 5A6QA 1BVVA 1W8UA 2W46A 3LEMA 4JGYA 3ZX7A 3VBHB 2CU5A 4BA6A 5FOBB 4FTBA 4GWNA 3D5OA 4H55A 3H7JA 1G6NA 3EB7A 2V4VA 4D7SA 1NCQA 1TQ5A 1AR91 3D82A 1W99A 1X7NA 4AQSA 1PX4A 3RZZA 2D97A 3R05A 1EP0A 5CKNA 4AVVA 2GSYA 1AR92 4QXKA 1B09A 1C5IA 4TWTA 2JDUA 2ZEZA 4I01A 1KRIA 3LSEA 4HANA 1TE1B 4YW2A 3HN1A 1Y7BA 2DUOA 3C7OA 1FOD3 3VD9A 2RS31 4BQ1A 3NVCA 5H9RA 5CNAA 2WKKA 4FAGA 1BEV1 1GQPA 1NQDA 1ODMA 2BTVC 1GQGA 4LXLA 4AL9A 4YGDA 1KD7A 3UT0A 4PF5A 1BMV2 1UIKA 1HQLA 2J42A 2PA7A 2VMHA 4QM8A 2IVIB 3CU7A 3HNBM 1VLNA 4QX3A 1VBA3 4CVUA 1FMD2 2YGLA 1S2KA 3MIDA 1L7QA 1W9SA 1H1MA 1QWRA 3O1RA 1IHMA 1NY71 4N43B 1TVGA 5JXGA 3EYPA 1EV13 5I8TA 3I3QA 4D8MA 3O0WA 3ZFEC 1UX6A 3L2HA 3DPRA 2DVGA 4GULA 3B7MA 1GUIA 1AR63 2R063 1O3QA 1F5FA 3ZXEA 2Y0IA 2EXKA 1WA6X 2HBTA 1CX4A 1FX5A 2W1SA 4CYDA 4P9YA 5CAZA 5HV0A 4Z2AA 1JYCA 2DTYA 4XF3A 4FOQA 2ZGOA 1QJFA 3LQCA 1QHDA 3O1VA 1HV0A 1Y43B 2PFWA 1OLRA 2XVKA 4UWDA 4P5HA 3NAPB 3B3QE 4CU6A 3ZYIB 1U5YA 3P3NA 1JN2P 2NZ9A 3CZJA 2JXAA 3U10A 1RGSA 3FE5A 1NA1B 4CDUA 1C57A 1E57A 1W2AX 5FUPA 1MS4A 1OOPA 4AG4A 2WZEA 1RUJ1 4D6RA 3ACHA 1C8NA 1W8ZA 4OULA 2HYXA 1JI6A 2WBKA 4RFRB 4WVWA 4BZ4A 2R49A 3DYPA 4QM9A 4EE2A 2QDNA 3NNMA 2D6OX 1EPZA 1AUYA 1OH4A 2IXJA 2WT0A 3OD4A 2W3JA 2VH9A 1Y9GA 3R4SA 4I09A 1AR62 2KA3A 1EAH3 3Q8AA 1KITA 2BNMA 1JH5A 4X6QB 3PVBB 4ZU7A 3A4UA 3ZOIA 3R0RA 4QQPA 1MZ5A 1ONAA 4MGIE 5CFDA 1A8DA 3UJQA 5HCHA 3CIHA 3EO6A 1W2OA 2XG3A 1SFPA 3KB5A 2Q8DA 1F5JA 4IDZA 3AJYA 3I8TA 3VBFA 3T2TA 1UMZA 2O8OA 1MS3A 2W2IA 1QMJA 4LBMA 2A6ZA 5K7PA 2ZPXA 4C0HA 1NZCA 1HQNA 1RHI2 1RYYA 1Q8VA 5LK7B 5GZGA 2Y6HA 4BB3A 1JOBA 4S2DA 4CCNA 1LODA 1J84A 1SFNA 1YHFA 3MUZ1 5J48A 1T2XA 5IVVA 1OF3A 4PIYA 4HSJA 3BYWA 4Y20B 4EN7B 1PMHX 3WCSA 2RJKA 3I59A 2RS52 3IIAA 4B29A 4QWNA 5FWEA 1FPN3 5BNPC 5IVFA 1OPOA 2LRPA 2VZPA 3ES1A 1NQJA 3FLTA 3OJBA 4Q26A 2VZ1A 2WZ8A 2Q8CA 3BGAA 2XJVA 1SDWA 1XNDA 4UXAA 4UAPA 2OUJA 1CVNA 1DG6A 1DQ2A 3POGA 4ORFA 5CU1A 3USSA 2HYKA 2ARBA 2ZHKA 1SLAA 4L9BA 5CIRA 4LR4A 4XQWA 4XW3A 2GZWA 1L7LA 1ZA7A 2W1WA 2Q5TA 4ZXKA 2ZEWA 5A80A 3M4FA 2JX9A 3J7LA 2DURA 3GZUC 1FNYA 1WBLA 1PO12 3WOGA 3ACLA 2VTFA 4GALA 3NAPA 4YW1A 1SLBA 5GALA 1I5ZA 4BXFA 1DYOA 1WBFA 5FZKA 5DG1A 1W6MA 3TYJA 2NP0A 3D6EA 2JIJA 2HEVF 3E5UA 2EXIA 1YIPA 2VU9A 4FVVA 2XPJA 1LU2A 4K1YA 4P9XA 4Q4V1 3GYDA 4IGQA 1GR3A 5AVAA 1NE6A 2Y6LA 4Q4W3 4NRMA 4WM7C 2JE9A 1IG3A 4XJ8A 5EZWA 3WINE 5IATA 1CIWA 1LNSA 4QXBA 4OHWA 2W1QA 3A21A 3KCXA 1LGNA 3VDDC 3VLBB 4CDQC 5FZBA 5J37A 4AFDA 3N36A 5LRSA 2GALA 2VECA 4LE3A 4MUVA 1H6XA 3T1MA 2D7FA 2LALA 3AJZA 3LGRA 4GD4A 4YW7A 3VDBA 3LAGA 3WNKA 2EAKA 2IXLA 3TB0A 1KGYA 2WAOA 4ZY9A 1W3VA 3FX3A 5F3EA 4LULA 4BQXA 2N7GA 3NJYA 1PVC2 3LA7A 1N1VA 3ZYRA 1LHOA 1R093 1H4GA 3U1XA 2ZGMA 1W2TA 1YCIA 4QX7A 4RGAA 2VJXA 4YARA 3LCPA 3KWVA 3UK9A 5T54A 4WVVA 5DZEA 4FPKA 4JRLA 1YI9A 1S0CA 1HRI3 4KI5M 4FCAA 3W9AA 1DQ5A 1RUE3 4HSLA 2IXKA 4KH9A 3KZ4C 4QB2A 3VBRB 2HWE2 5A33B 2CGOA 3BTYA 3LA3A 4PIXA 4XTPA 5DUUA 1VRH1 3T0AA 4JKMA 1DGWX 5C7GA 3FZ3A 4R9CA 5B4XA 4OI0A 1AYM3 3ZR5A 1NCQC 3IM0A 4PHZA 4PDWC 2Z69A 3PIJA 3S7IA 1O4ZA 2D3RA 5H9QA 4QDQA 1AHSA 1H1AA 1HRI2 1VBA1 5GLWA 1UN1A 2A7AA 1W2UA 2OT7A 4V2WA 1ULOA 3C7EA 3I2FA 1UX7A 3OUIA 1PM7A 2V4AA 3PUIA 1WCUA 2W39A 5D8AC 2W47A 5A3OA 2CY6A 3UETA 3VBFB 3WDVA 5FTTC 5C71A 3P1IA 4GAZA 2JDHA 1RUI3 1QJY1 5FYHA 5IJRA 2A70A 3BODA 1TMF2 3VBHA 3VL9A 2WWSA 3B00A 2CAVA 3O1MA 2CAUA 2RHPA 4YGBA 1HKDA 2YFUA 4AEMA 1CAUB 1QJY2 4I3GA 2Q1MA 3ZPOA 1OKOA 1PK6A 3LPGA 3N9MA 2BPA2 2OW4A 2A6WA 2Y60A 2A3YA 3RYRA 2CDOA 1OURA 1DQ6A 4IERA 3HN3A 1MQTA 2WS91 4M4PA 3TN93 1L7RA 3SMHA 1OUSA 1C1FA 3AZZA 5L36A 1UY2A 4RQPB 4M3CB 3WP4A 4NPRA 4FTSA 5FXZA 2VL4A 2XHKA 4GMP1 1TMF3 3HOBA 2BWAA 5JZGB 2WNUC 3NAPC 1BBT2 2BU9A 5IFPA 3CO2A 1OC1A 1DZRA 4NROA 1RUG2 5ABJA 1H8TB 2YFZA 4JGZA 3KV9A 3IKWA 2QBXA 3HD8B 1WMXA 2R6QA 1BBT1 1GU3A 1WLDA 2W68A 4XFGA 1UXZA 1GKBA 2WQZC 1VBB1 3OPZA 4AZZA 4BPZA 5T50A 4D7TA 5T55A 1J3PA 4COUA 4DUVA 3W21A 2BBVA 1ENQA 2RJLA 1V6NA 4NOTA 3DCQA 3LKJA 2QQKA 5DZGA 3OD0A 3KGLA 2K46A 4GH4A 4RS5A 2R16A 2HWE3 2MNGA 4B4QA 2OQ7A 2QTWB 5FZHA 4LT5A 1WCQA 1REFA 4QHZA 5K9YA 4YVWA 4UBGA 4GJYA 2H6BA 2B8MA 2AEZA 4LO4B 4YM2A 1HRV2 2Z2SB 3WW3A 1MVQA 3INAA 3GZAA 5EYXA 1JZ3A 3RZGA 1NAEA 5FKBA 5A3LA 1WW6A 2ZHNA 2P34A 4QPIC 2YUEA 1BVP1 5KR7A 5DUWA 4GJZA 2CWSA 1XSRA 1UZYA 4Y26A 2C6SA 2ZJCA 1GLHA 3AP4A 3ZN6B 1LHVA 2JG8C 4ZZ5A 2PLV1 3WV6A 3PU3A 2XWBB 5KHGA 5BPXA 3IDBB 3LE0A 4AI0A 4E2SA 3MLJA 2YYOA 4PQ9A 1AXZA 2DVAA 4XZUG 1GWKA 2C1FA 1RUD3 2WZR1 3P3PA 3RWKX 1X9PA 4PLOA 3RFRA 2J1SA 4JC1A 1VJ2A 1YLLA 4AEDC 4XUPA 4BQ5A 5B2GB 2GH2A 3MF6A 5BNPB 5HCAA 2VCBA 4PI0A 1QH6A 3TNPB 2J1VA 4PJYA 1AR71 1SQ4A 4CEWC 1S0JA 2AACA 4O9EA 3ZKYA 3ZXLA 5A7WB 3VDCA 2ZGQA 4FXKB 3VL8A 1YEWA 2ENRA 1SPPA 2IFRA 1VMHA 1ULCA 2K9ZA 1OOPC 2VCCA 2P5BA 3OBAA 1VBC2 4FPYA 3GNEA 4QD2A 1O3SA 1U0AA 2RV9A 1CAXA 4MX3A 5LRRA 4C91A 3N4MA 1JZ4A 2JD4A 2E7QA 5KHHA 1N1YA 3MHZA 2OKXA 3DPRC 4EQVA 5FYSA 2BGCA 2WQ8A 5DPNA 3WQ0A 4P02B 1JYIA 1OLMA 2CSGA 4DNYA 3ZFGC 2BYVE 4Q4V3 2RS53 4Z1VA 2GC1A 2CGNA 1DQ4A 4RGGA 1XE0A 4RQPC 4GB32 4ES8A 4Q4Y3 4I0AA 5E89A 3ZSJA 5A70A 2CV6A 3C3VA 3OPWA 3FC0A 4COZA 1UO9A 1HXS1 3IIIA 4Y20A 2Y34A 3ZO0B 2UWCA 1QF3A 3ZLIA 2HEWF 1XBFA 4XOGA 4WZFA 4Y1ZA 1G9BA 2OVUA 3A0KA 2PHWA 1AVBA 1AXKA 2HWD3 1JU4A 3DYOA 5FBJA 1O7FA 4PDWB 1POV3 3I2JA 4IE7A 1RHI3 2GMPA 3NSTA 3VGIA 2EIDA 4FPOB 4COYA 1T6GC 5FPUA 4HKWA 4EZHA 2E33A 4LBQD 5DAVA 5FY0A 1RXGA 3H7YA 1GNZA 3UJOA 4COVA 2VBPA 4YVSC 2ZX4A 1DGLA 1I1EA 3DXTA 2BVBA 1H0BA 2K0GA 4XAEA 4AGGA 1N1SA 2FMYA 4WVMB 4ZS2A 2JD9A 2ILMA 1S0BA 2R072 4M4RA 4K40A 1J83A 2R042 2QUOA 2EICA 4B7EA 1URXA 2ZX3A 1FMD1 5J36A 4JGZB 2ZGLA 1V6JA 4URTA 3WDUA 1HV1A 3JB8A 2R071 2VO5A 2ZX2A 2WINB 2RDNA 5EPAA 4AR2A 3AMPA 3DXUA 1JHNA 4XBLA 5JOXA 1QJX2 5EJZB 3WW1A 2O1QA 3J26N 3N7JA 5FJKA 4IV1C 1JZ2A 1LAJA 5CB7A 2WZPP 2ETEA 3OGJA 3ST7A 2R073 5I0RA 5JWPA 2RJ2A 4S2GA 2VR4A 3POFA 4AEDB 1SMVA 3FLPA 2R30A 1PZ8A 1SBDA 5D8AB 1FNZA 4QGMA 1E5RA 1W8HA 2QJVA 5EP9A 3AKRA 1YYNA 2F4PA 3LDBA 4FPLA 2RDQA 2A6YA 1KXGA 1OA4A 2NQYA 5FPLA 4IUGA 5HCFA 3WQBA 2Z5WA 5AC92 1XNAA 4JGYC 4NMIA 4H7LA 5K0UA 3SCFA 5J96B 4CCKA 5HXMA 1GMMA 5T5LA 2XMLA 2ZXQA 2XH6A 1UY3A 2FBEA 4J25A 5FKCA 1OOPB 4OFGA 4YFWA 5A3UA 4BJ0A 1OD3A 1RINA 4KU8A 1QJU3 4KMQA 1LKNA 2QFEA 2VC9A 3ZXKA 3KV5A 2RDRA 2ZA9A 2ZZQA 4J1XA 4WM8C 3R6SA 5FZ3A 4XXPA 1ZZ9A 4Q29A 3BN6A 1Z7S2 4QPIA 1S0EA 3ZFGB 4XABA 4AQ2A 2QQLA 1HQWA 5GLUA 1PGSA 3OYWB 4MV2A 4BU2A 2HEYF 1BXHA 2DVDA 1H6YA 3VBOC 1LEMA 3MBWA 4R9AA 1AYN1 5EXOA 1L3JA 4AGVA 5C5UA 2D3SA 3RMXA 3AZWA 3E6CC 1N1TA 2WYFA 2ORZA 2QZ2A 4UFJA 4K20A 3H3UA 3DF0A 1MEC3 3MZHA 2RM21 1H8TC 2ZBJA 3H1WA 3CBNA 4BOWA 4XC9A 1GOHA 1D0HA 1UKGA 3AYAA 3LPFA 4JQTA 5GKAC 4Q8LA 3TRSB 2D40A 4HVOA 4OQ9A 1VBD3 1PZ9A 1YFXA 1AX1A 4BIOA 2E32A 5F5QA 1DF0A 4Q2FA 5FMOS 1DIWA 1JUIA 4K3UA 2JB4A 3V64A 4JHZA 2W87A 4LNVA 3SCGA 2AZ5A 3AVSA 2DV9A 4QU2A 3N9PA 4LBJA 4LA3A 2JWPA 3NWKA 5T5OA 1XYNA 1EAH1 2VG9A 1S1AA 4GWIA 4LPLA 4CEWB 1DZTA 3EJKA 3HEIA 5FYVA 3T4HB 4EWEA 2JKXA 3H0OA 5K0UC 3URFA 2WO2A 1VMFA 1CX1A 1NXD1 4CUAA 1WCKA 5LA0A 1SHWB 1ODNA 1PK6C 1NLRA 5K8SA 3OBTA 4AYUA 5JAXA 1YWKA 3SEEA 2J22A 1H2LA 2B9UA 2HWD2 2OX0A 4L8QA 3IMMA 3SITA 2DU1A 2Y0OA 5ACA3 3VBFC 2B39A 1DQ1A 2QQUA 3GZTB 4RHV3 4XFAA 4CCEA 2VCMA 1YJLA 2VQAA 3PUSA 2OA2A 1XRUA 2J1AA 4A6SA 1Y3TA 3IDAA 3ZR6A 3JD73 1PO11 4PLMA 2XWJB 4P9GA 1AR73 4OHVA 5IHRA 5D1IA 1WMFA 1C1LA 4OHYA 1QJZA 2KD7A 3NQHA 5DMYA 5FREA 3KQ4B 2P4EA 5FLIA 1JZ8A 1IZ3A 4LO5B 4FTEA 1LULA 4Y5Z0 2Y6GA 5CKQA 5FP3A 1A34A 3VB9A 5C8CC 1Y9QA 4WBBA 3ALQA 3VHPA 3FUQA 5FCCA 5FP4A 2BRTA 3NKTA 1NA1C 1UAIA 3LB9A 4HVRA 4MG2A 2DUPA 4LOSA 1UF2C 3ORJA 4IE0A 3A22A 1KS5A 3AK0A 1ND2B 4QX8A 5EJ3A 2YC0A 2EVXA 2ARXA 4O65A 2IXIA 4LUMA 1PIV1 2DVBA 1F8VA 1BHGA 4UFHA 4YPJA 1BK1A 4CCLA 3GHMA 3GF6A 2XBO3 3VBOB 5HV4A 5JIAA 2WO1A 5A7OA 5A7QA 1K42A 5I8YA 4L97A 2VQTA 1W6PA 5FYMA 1GOFA 3V0BB 5I0TA 5J3UA 5IUQA 4C8DA 4R9BA 3C7GA 3WX5A 3N35A 1VBC3 4JX0A 4JDNA 4NO4A 4W6WA 4Q5OA 4LKEA 2HJIA 4U36A 4YRDA 5C4WA 3AKQA 4C1WA 4XPVA 3SQOA 4DXSA 1GNHA 2Y6FA 4Q8KA 2IC1A 2VD7A 4JDOA 1CWPA 4YW5A 1CPNA 1ZBE3 1UMIA 3G6JB 3WLUA 1UYYA 2VOVA 2XJTA 1KFXL 1RMU1 2KXLA 4MLOA 4ATFA 1MZ6A 4EJRA 2NYYA 5DAQA 1WLCA 1US3A 2IVJA 1IKPA 2WNVC 5F2WA 5J7MA 4QXCA 5LBBA 1I9RA 2Z42A 3HVDA 2CYFA 4XFIA 1FPN2 2PAMA 3WZ1A 3VD4A 1JYTA 2G1MA 1YQ6A 1W9TA 4CCDA 2YZ4A 1QXPA 3CJIA 4BM8A 1FMD3 3E5QA 4FQ4A 4MO3M 1XC6A 4NHXA 5SV5A 4OUEA 2JE7A 1XPWA 3AMMA 3LSDA 2X53S 2ZX0A 1AYM2 3LOIA 2WLPA 2DCJA 3J8F1 2BBAA 3J9SA 2Z4FA 1UQXA 4QU1A 3W59A 4DUWA 4AAXA 4YW4A 4WM7A 4CP2A 2EIGA 2BVVA 3WT3A 4FFIA 1RUE2 1W0NA 1AYM1 1TME2 4RHV2 2EALA 3TAYA 1QOOA 4YZ1A 3AB0A 4QMAA 4QPGC 2GP3A 2PHUA 3MPBA 2CTVA 4YWAA 1HB2A 4QX5A
chains in the Genus database with same CATH topology
1OVSA 2JDPA 2JDHA 2JDNA 1OVPA 2VUCA 2BOIA 1OXCA 2BOJA 1UZVA 5A6XA 1W8FA 2WRAA 2JDYA 2WR9A 2BP6A 5A70A 4UT5A 1W8HA 5A3OA 1UQXA 2JDKA 1OURA 2BV4A 2JDUA 2VUDA 4AOCA 2CHHA 1GZTA 5A6ZA 3ZDVA 2XR4A 4CE8A 1OUXA 5HCHA 5A6YA 5D2AA 3DCQA 2VNVA 1OUSA 2JDMA 5A6QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OVS A;  2JDP A;  2JDH A;  2JDN A;  1OVP A;  2VUC A;  2BOI A;  1OXC A;  2BOJ A;  1UZV A;  5A6X A;  1W8F A;  2WRA A;  2JDY A;  2WR9 A;  2BP6 A;  5A70 A;  4UT5 A;  1W8H A;  5A3O A;  1UQX A;  2JDK A;  1OUR A;  2BV4 A;  2JDU A;  2VUD A;  4AOC A;  2CHH A;  1GZT A;  5A6Z A;  3ZDV A;  2XR4 A;  4CE8 A;  1OUX A;  5HCH A;  5A6Y A;  5D2A A;  3DCQ A;  2VNV A;  1OUS A;  2JDM A;  5A6Q A; 
#chains in the Genus database with same CATH topology
 2RVA A;  2MEV 3;  2RS1 3;  4Y3O A;  5EFU A;  3SXW A;  2EF6 A;  5FZF A;  2D6K A;  4IE4 A;  5ANQ A;  5CEH A;  1M4W A;  4IET A;  4BLJ A;  2CGP A;  2I07 B;  2X10 A;  2W95 A;  2ZAH A;  4N53 A;  4UF0 A;  5CAD A;  2XL9 A;  4TTG A;  3I3E A;  3T2O A;  3VZM A;  1F35 A;  2R06 1;  3O1S A;  3VDD B;  4CDQ B;  1PMI A;  1Q56 A;  4D7Y A;  5F8P A;  3QBQ A;  1Q5O A;  1YI7 A;  2YHJ A;  4ISQ A;  1KEX A;  4Y1U A;  2PN5 A;  2R0H A;  3MPP G;  2D5H A;  3N9Q A;  5FMC A;  5F39 A;  4CA9 A;  3JXS A;  2CHH A;  1GZT A;  2YC4 A;  1BEV 3;  4MGS A;  4BH9 A;  5BNP A;  5BNQ A;  4J1W A;  5C3P A;  4YZ3 A;  1YFW A;  2VMC A;  3RYP A;  1ULF A;  3S6P A;  2FDF A;  5CYY A;  4CP0 A;  3M8L A;  5FYU A;  4CP9 A;  5KC5 A;  1A3K A;  3AL6 A;  1LHU A;  1O4Y A;  4ASL A;  4BDV B;  4CCC A;  4AHX A;  1LEC A;  1RVF 1;  3I2K A;  2GAU A;  1W8F A;  2E7A A;  3M3I A;  4XFF A;  2YV8 A;  1CAX B;  4QDS A;  1QQP 3;  3DEC A;  4JCK A;  4KG0 A;  1J1T A;  3TOJ A;  4E4S A;  3T09 A;  1PZ7 A;  1QJU 2;  5A7N A;  4QXH A;  1VBA 2;  5IAX A;  1HRV 1;  1LU1 A;  1VBD 1;  4F7Z A;  5A3N A;  4NHK A;  5FUN A;  5JVV A;  5EV7 A;  3CJI C;  1PK6 B;  2VMD A;  3X29 B;  1XNC A;  3KT1 A;  5HPO A;  2ZOE B;  3H50 A;  3KF3 A;  4IV3 A;  5FY1 A;  1Q8P A;  5D2A A;  1QXJ A;  2VNV A;  2HWB 1;  4QT6 A;  1HRV 3;  1BZW A;  4N8M A;  5FP8 A;  5C3O A;  2DFB A;  4LTA A;  3RZJ A;  2VZR A;  3AC0 A;  1I3H A;  2DTW A;  5BNN B;  2ZAA A;  1BCX A;  1XE8 A;  5EIY B;  2BFU L;  1UZV A;  3AYE A;  3U4S A;  2WN3 A;  3POY A;  2PYT A;  2VNR A;  5LA2 A;  4BQY A;  2DWR A;  2ERF A;  2QCS B;  3A23 A;  4LKD A;  4ATE A;  2E53 A;  4DIQ A;  1SBF A;  3BOP A;  3MLK A;  5JR2 A;  1C8M 2;  2ARE A;  3WF0 A;  4NID A;  3GJB A;  5ABJ B;  1GAN A;  1C5H A;  1ULP A;  3ZVX A;  4KG8 A;  4ARX A;  1MQT C;  1NCR A;  1VR3 A;  1NYW A;  1Q8Q A;  2GME A;  4URA A;  3N7K A;  5DAP A;  1OQ1 A;  4DXZ A;  3RMY A;  2WWJ A;  1ND3 A;  2D98 A;  3SH3 A;  3WG3 A;  5FDB A;  5CFC B;  2WA3 A;  1LGB A;  2QQI A;  4QQO A;  5FZ7 A;  4QPG B;  1PVC 3;  1PMJ X;  5FXX A;  3N7L A;  5CZK A;  4JGY B;  1YFY A;  1XSQ A;  4M01 A;  1UCX A;  1RL3 A;  3I4I A;  4XE9 A;  5L7O B;  3ACI A;  2GN3 A;  3BPZ A;  1QKQ A;  5F1R A;  4QGL A;  4R52 A;  2FMD A;  1SCR A;  3KQR A;  3FWE A;  3VV1 A;  5JUV A;  5IVJ A;  1WD3 A;  5FZA A;  2VQ0 A;  1LOA A;  5FYT A;  3BIW E;  4AW7 A;  3H8R A;  3RDI A;  1OQE A;  1LJ7 A;  1MPX A;  2XJS A;  3ZM8 A;  1GFF 2;  2VUD A;  1GV9 A;  5JI7 A;  1LB2 A;  4AI9 A;  2WNE A;  4UYB A;  1ULE A;  2AEN A;  4RR3 A;  3AZY A;  1RJ8 A;  4XF0 A;  3NNF A;  2C9K A;  3CJX A;  4IQP A;  3TEY A;  4AAP A;  1LOE A;  1CZV A;  1OHF A;  1AL2 3;  2R1D A;  2GU9 A;  1DBN A;  1W8T A;  2BER A;  1NT0 A;  1OH3 A;  1D4M 3;  2VY0 A;  4QQ2 A;  5JSP A;  1XNB A;  2XBO 1;  4GB3 3;  4MAD A;  5DG2 A;  3AKP A;  5FZC A;  1XU2 A;  2XLA A;  3J7N A;  2B5H A;  4EN6 B;  4IV1 A;  1LHW A;  1W04 A;  1ZM1 A;  3CL1 A;  5IK5 A;  3HMY A;  4FFG A;  3O1T A;  3H1Y A;  4QQL A;  1AZD A;  1AR6 1;  5DXD A;  3VDD A;  4A3X A;  4CDQ A;  4KL1 A;  5F5A A;  3POE A;  4ISR A;  4HN1 A;  4L92 A;  3CEW A;  5LWB A;  3RWN A;  3T0D A;  4Q4Y 2;  2O0O A;  3WY6 A;  1YO8 A;  4YM3 A;  1W39 A;  4HT1 T;  5KC6 A;  1W6O A;  3HIF A;  5D21 A;  1TNF A;  4LOT A;  5CFD B;  5F3I A;  1AL2 2;  2G9G A;  2BFU S;  1QNW A;  3U37 A;  2VQU A;  3I2I A;  2JDA A;  2Y8K A;  3C7F A;  4CP9 B;  1NY7 2;  5FYC A;  4O7X A;  4CUG A;  3NV2 A;  1C4R A;  2Y33 A;  3OGG A;  3OUH A;  5BUV A;  1D4V B;  1TEI A;  1RHI 1;  4ASK A;  3B9C A;  1SCS A;  4OLL A;  2XB6 C;  3B01 A;  2YB7 A;  3M1H A;  2EXH A;  3VBS C;  2ZGT A;  4XMA A;  5J09 A;  3TN9 1;  1WA4 A;  2EXJ A;  1VE0 A;  1OT5 A;  2WAB A;  1XNK A;  3FJS A;  3PLQ A;  4JV4 A;  3WCR A;  2NLR A;  2ZAC A;  1WW5 A;  1KDM A;  4TLF A;  4I3P A;  2GNB A;  4DRR A;  3WUD A;  4FAH A;  1E5I A;  4W6Y A;  5CBL A;  5JXJ A;  4PI2 A;  1OKQ A;  4A3Z A;  4EWA A;  3PDQ A;  4XVH A;  2JDM A;  1OPM A;  4ITC A;  1XXN A;  1LCL A;  1WD4 A;  2JDP A;  1UPS A;  3AXE A;  4W8J A;  2BOI A;  4LIV A;  4XFB A;  3I3M A;  2WRA A;  3OF1 A;  4GKX A;  1ZRE A;  3B94 A;  4GIQ A;  2RR1 2;  1QJY 3;  1CPM A;  2VZU A;  1GWM A;  3DN7 A;  3HQR A;  2NMN A;  2Q8E A;  4RYD A;  5IW0 A;  4JVA A;  2YBS A;  5DUX A;  3PUR A;  4Z07 A;  2FCV A;  4AFC A;  1ASJ 3;  5EHD A;  4AI1 A;  4E2G A;  4E4D X;  5CKM A;  4GWJ A;  3H8O A;  1SLL A;  5KBF A;  4IV3 C;  2BV4 A;  2F17 A;  2RS3 2;  3U78 A;  4KBZ A;  2OYZ A;  4JKL A;  4KWU A;  5LEJ A;  4IE6 A;  1ASJ 1;  2LRO A;  1YRZ A;  4QPG A;  3CQO A;  4GWM A;  1VRH 3;  3DYM A;  4P9L A;  2JG9 A;  1UZ0 A;  1V6O A;  4B4R A;  2DU0 A;  3CJI B;  3N3H A;  2VNO A;  5ERL A;  4CU8 A;  4ZKT B;  3JUU A;  5IK7 A;  1D4M 2;  4UT5 A;  4OUS A;  4A41 A;  2D5F A;  2XGX A;  3IAP A;  3RZH A;  5A7P A;  4K8R B;  1C28 A;  1AX2 A;  2WNU B;  1AR8 3;  4NIA A;  4XTM A;  4NRQ A;  4CDX B;  5CFD C;  1XQN A;  3VBR C;  4Y33 A;  5FOJ B;  2BNO A;  3HT2 A;  3OUJ A;  4FP2 A;  3ZXA C;  1ND2 A;  2R04 3;  3M70 A;  3QH6 A;  3WDY A;  3GCW A;  2IWG B;  2QQM A;  1NCQ B;  4LKS A;  1RIR A;  4MGQ A;  4GH4 B;  4RS5 B;  4JGZ C;  3FHI B;  1W03 A;  1AXY A;  4J6G A;  5A1F A;  3P6B A;  2BEO A;  1YC6 1;  1F15 A;  1STM A;  1POV 0;  3OBZ A;  2WNV B;  1MEC 1;  3FMG A;  1UNB A;  1XE7 A;  2XOM A;  4LBO A;  4OI2 A;  2G19 A;  3TWI A;  2HWE 1;  3JQX A;  4L2N A;  1O6U A;  4CXY A;  4ARY A;  4CXX A;  2AEY A;  3AFK A;  4DUX A;  2P3J A;  2YC2 A;  3GJA A;  2VUA A;  4Q4W 1;  2RDS A;  1WWY A;  1NG0 A;  2CL2 A;  3BAL A;  1W8O A;  3ILN A;  4KU7 A;  1I5P A;  5LBC A;  3UNP A;  3WUC A;  4OQ8 A;  4GXL A;  4HL0 A;  4LK7 A;  2X09 A;  3ZFF C;  1R1A 3;  4Y4Y A;  1W6N A;  3OB8 A;  4ONU A;  4G9S B;  2V5Y A;  2YRO A;  5F32 A;  3GAL A;  3J4U H;  1ZZB A;  3ACG A;  1EUT A;  1IPK A;  3ZDV A;  3ETQ A;  5FZG A;  4TSV A;  1OVP A;  4XUQ A;  2LM3 A;  3WDT A;  3M3C A;  5L19 A;  1LR5 A;  1C3H A;  4KWJ A;  4UOJ A;  2B7Y A;  3DV8 A;  4N7I A;  5FLH A;  5F6L B;  5IWF A;  4BIS A;  5LY1 A;  4FPF A;  1XJA A;  2ZMK A;  4BHP A;  1MQT B;  2B9V A;  2FDI A;  3ACF A;  3I49 A;  1MR5 A;  1PNF A;  3KT4 A;  5C9A C;  1JYX A;  3GCX A;  2ZEY A;  5TSW A;  1BLZ A;  1SLT A;  3E1F 1;  3V56 A;  2OII A;  4NAM A;  3NO8 A;  1UY0 A;  1VB2 A;  3GXU A;  1APN A;  2PMW B;  1X36 A;  4DB5 A;  1POV 1;  1V6M A;  5JXH A;  1HB4 A;  4CDW B;  1I6X A;  3B02 A;  1F4H A;  1RUE 1;  5FZI A;  1LOG A;  2J1U A;  2MHF A;  2D6M A;  1HDK A;  5BY5 A;  3Q8F A;  4LBL A;  4PIZ A;  3ZKU A;  5LEK A;  1HX6 A;  1NCR C;  3VZK A;  4FBF A;  2P6H A;  3VZL A;  1KJL A;  3DPR B;  4Y1V A;  1H9P A;  1QQP 2;  4LHL A;  2E9Q A;  4LJH A;  4IEO A;  4NN0 A;  4MGT A;  2YU1 A;  3NJZ A;  3BTA A;  3VBH C;  1G9C A;  4P5Y A;  2VZT A;  2QNK A;  2E51 A;  4OUM A;  1DDL A;  2B42 B;  4AWD A;  3IDE A;  3MIC A;  4OZO A;  4HBN A;  3TNQ A;  3ZMO A;  1O8P A;  4FT8 A;  4JDM A;  3I2H A;  1COV 1;  1RUD 1;  1Z78 A;  2WZR 3;  2Z79 A;  4DFS A;  2RG4 A;  1GYK A;  2CWM A;  4PCR A;  4XXA A;  4IGO A;  2AR6 A;  4P9J A;  4ZU5 A;  5FPB A;  4AFM A;  4FSJ A;  1JBC A;  4ET7 A;  2FD8 A;  2ZGS A;  1WLW A;  1B35 C;  2WFF 1;  5FY7 A;  3RI8 A;  1U5X A;  1MS9 A;  2ZCW A;  4DPN A;  4AXO A;  5CG9 A;  2PTM A;  4DEQ A;  4I0W B;  2HWD 1;  5H9P A;  1H1I A;  2LS6 A;  4FO9 A;  3ZXJ A;  4CUC A;  1SZB A;  3DL3 A;  5FZ0 A;  5DDJ 2;  1BQP A;  2WT1 A;  3ZN5 A;  4E9K A;  3T4V A;  3VKF C;  4QB1 A;  2XLF A;  5A3M A;  3CF6 E;  4MHR A;  1FAT A;  4ZHN A;  2DYC A;  4YVW C;  1R1A 2;  5BNN C;  1QJU 1;  4YVS B;  3I59 B;  5E8A A;  1YFU A;  3DGT A;  3J8F 2;  2GDF A;  5FXW A;  3CNA A;  1TMF 1;  2I74 A;  3OGR A;  3B5L B;  5FZD A;  4AEJ A;  4RA0 A;  1WCS A;  1X82 A;  4N43 C;  3W58 A;  1ZRD A;  3POB A;  1W3X A;  3IDC B;  5FPA A;  4DRV A;  4A7Z A;  1MZF A;  3DUI A;  2WA4 A;  3LIH A;  2TEP A;  3T0B A;  3UKV A;  4R9D A;  1ZA4 A;  1OD5 A;  1ACC A;  1J1L A;  3OGS A;  1HXS 3;  4QKB A;  4GKY A;  4AGR A;  4ZXE A;  5J1X A;  2ZEX A;  1IS5 A;  1YQ5 A;  2B4K A;  3JZV A;  4U2A A;  4Y22 B;  1J3R A;  5FMO L;  3AYC A;  1R09 1;  2JJ6 A;  2I2S A;  2AUY A;  4LA2 A;  2RM2 3;  5G04 L;  3ZXF A;  2FZ2 A;  1IS6 A;  1WKY A;  2OPK A;  1OMI A;  4OMC A;  2WNO A;  2TUN A;  1QOT A;  1JOD A;  2HLE A;  3CMG A;  3MW2 A;  4AK3 A;  4FQZ A;  4V1P A;  5L9R A;  4QDR A;  4DMI A;  1AX0 A;  1V0A A;  1RUG 1;  1VRB A;  3OCP A;  3KMH A;  4NHL A;  3H8U A;  2W5F A;  4BLI A;  1W6P B;  4CEY B;  4IV3 B;  1RUH 1;  5A6X A;  4Q4X 3;  5CFC A;  2ES3 A;  2HKX A;  1R1Z A;  1ND3 B;  2DFC A;  1NCR B;  3PJQ A;  4UW5 A;  3LEG A;  4BQ4 A;  1G9D A;  1RUG 3;  5FWJ A;  1DQ0 A;  2OZJ A;  1JYV A;  4GH4 C;  4RS5 C;  1FT9 A;  1DFQ A;  2JE8 A;  3OPT A;  4Q4X 1;  3S5A A;  3U4X A;  4DXT A;  2QQO A;  4KGG A;  2JIC A;  3MUY 1;  5LAT A;  3ROU A;  4AOC A;  4E4H A;  2D44 A;  1O5L A;  1RUF 2;  5E16 A;  1W90 A;  2ADD A;  4CPB D;  5BNN A;  2WO7 A;  4DO0 A;  1VBD 2;  5HXV A;  4W4Z A;  1K45 A;  2R32 A;  1BYH A;  3POW A;  3NKG A;  1UOG A;  1PM4 A;  1WW4 A;  1GOG A;  2OXB A;  2HWB 2;  3KHB A;  1V9U 3;  2GND A;  1D2S A;  2WR9 A;  3MF9 A;  4GZ9 A;  5GJ6 A;  4AVC A;  4YVS A;  2QDR A;  2VW1 A;  5C9A A;  1HB1 A;  1W6M B;  2FDG A;  1H8V A;  1UD1 A;  1KJR A;  1B35 A;  5JLV A;  2A3W A;  1V9U 1;  2BNN A;  5H9S A;  2ARC A;  3AZX A;  3PU8 A;  4O9G A;  4A4A A;  3ZIW A;  2J1R A;  4XF9 A;  1YQ2 A;  2UWA A;  2VM9 A;  1C8M 1;  2XDV A;  3ME2 A;  3IAQ A;  4W50 A;  2VUJ A;  4IXL A;  1RUC 3;  3DEM A;  4TN7 A;  2XJP A;  3VBS B;  3DKQ A;  1IG0 A;  3I97 A;  1HN1 A;  5IK8 A;  4CU7 A;  2VZS A;  4YW6 A;  3A7Q A;  4IW3 A;  3OSD A;  1RIT A;  4FPE A;  4L99 A;  4LE4 A;  1S0F A;  5FR3 A;  1DGW A;  2GMM A;  1RUC 1;  3RZM A;  3WG4 A;  4UFI A;  2R0F A;  2ZGK A;  1XYP A;  2HH9 A;  1HW5 A;  4MYE A;  1CD3 G;  2DF7 A;  2VPV A;  4Z2W A;  3ON7 A;  5BXX A;  4AFB A;  2C0Z A;  1K3I A;  4ASM B;  1JYW A;  1XB9 A;  3E5X A;  1O3R A;  5KWR A;  3ZFG A;  2OPW A;  4AQ6 A;  5A6Z A;  5FY8 A;  4TLG A;  5FIX A;  3JB4 C;  4MXV A;  3QAC A;  1ULD A;  1PO2 1;  3BOW A;  3SIS A;  4M0H A;  5T3N A;  1LOF A;  3OTF A;  5KHK A;  2VAU A;  3LZZ A;  2VW0 A;  4LHS A;  5JPN B;  1OQD A;  2PHL A;  4O61 A;  2IXC A;  3FBY A;  3WVJ A;  4BE3 A;  3BU7 A;  2PXJ A;  1ZX5 A;  1OF4 A;  1SLI A;  1T6B X;  1LRH A;  1CES A;  1WW7 A;  4YGC A;  2RR1 1;  3NJV A;  2XON A;  2ZGP A;  5I0U A;  3IPV B;  4EV0 A;  5LA1 A;  1Q43 A;  1A8M A;  4FP3 A;  1AR9 3;  1ENR A;  3CLP A;  2ZKL A;  3PVO A;  4K1Z A;  2X5I B;  4XUN A;  1RUF 3;  1UOB A;  1S0G A;  2JG9 C;  5DDJ 3;  3S30 A;  2JEM A;  1AF9 A;  2P3I A;  1VAV A;  4WZC A;  4XHX A;  5SV8 A;  4DY5 A;  1M06 G;  2A73 B;  4D94 A;  3HQU A;  3T1L A;  1LES A;  1DP0 A;  4IEU A;  3UKT A;  5M0T A;  2UU8 A;  3EBR A;  4IEY A;  3U14 A;  4Z92 B;  4NVP A;  3WNP A;  5LBF A;  3K77 A;  3I3B A;  3PNA A;  3O5S A;  3VDA A;  2ET7 A;  4MGY E;  4RQP A;  2YPD A;  5CG8 A;  4DOU A;  2FDH A;  1AL2 1;  5A3P A;  2WSU A;  1CZT A;  4XQ4 A;  3ZSE A;  2J1E A;  4AI2 A;  5B4N A;  4MH0 E;  1PO1 3;  3S0M A;  1VBC 1;  1D4M 1;  5I8S A;  1CGP A;  3WDX A;  1B35 B;  5K0U B;  3OY8 A;  3BU0 A;  3AM2 A;  3D0J A;  1WGP A;  5A7S A;  3RG0 A;  5JR7 B;  3LDR A;  4UBH A;  5IT6 A;  4KQ7 A;  3AZV A;  1AR7 2;  4R4X A;  4CP1 A;  3JD7 2;  1EYB A;  1XYO A;  3UYJ A;  4ZS3 A;  4LOR A;  4HN0 A;  1E5S A;  1OVS A;  4LQR A;  3K3O A;  2JDN A;  3ZYJ B;  3WG2 A;  3K4D A;  4OI1 A;  5IK4 A;  1F4A A;  3VBO A;  3ZFF B;  1POQ A;  3VKO A;  3WHU A;  1IQD C;  1IS3 A;  1OA3 A;  2WO3 A;  3D8C A;  5CFC C;  2QQN A;  1RTV A;  2SLI A;  4AVS A;  1UU5 A;  2LW8 A;  3HNM A;  1VAM A;  1OFS A;  3LDK A;  3PTY A;  1PX3 A;  3W5N A;  4Q0P A;  2YBK A;  4Q1R A;  4XQD A;  1N3P A;  4N53 C;  5L9B A;  1J59 A;  4NIH A;  3HAG A;  2BWC A;  3MI8 A;  4OCT A;  2WAA A;  3SH4 A;  2O8Q A;  2JDK A;  5T5J A;  4CEY C;  1NLS A;  5A3T A;  1W8W A;  3WW2 A;  3GBG A;  4WV8 A;  2Q1F A;  3VBR A;  3ZYG A;  1UW8 A;  3I2G A;  1QEX A;  2C4X A;  2ZZJ A;  2DCY A;  2V73 A;  3FBM A;  4G4F A;  5FQ0 B;  3AX4 A;  2J1T A;  5DZF A;  2V09 A;  2PQQ A;  1J3Q A;  3POI A;  2VMI A;  2PHF A;  1R64 A;  4NAO A;  1BK0 A;  4BQW A;  4LKF A;  4CDW C;  1ASJ 2;  4LBQ A;  2VW2 A;  4YG0 A;  4YZ4 A;  1OFN A;  3RPQ A;  3K46 A;  4EWD A;  1NOV A;  5HBA A;  5LY2 A;  2AYH A;  1CQ9 A;  3GBW A;  3ZPY A;  5KXE A;  4HOO A;  1SPP B;  1BEV 2;  1LEN A;  1QY4 A;  3Q8C A;  2LUW A;  4NHY A;  3I2O A;  5A7W A;  4I2O A;  2GH8 A;  1ZYB A;  3APB A;  5FZ4 A;  2VUL A;  4FOV A;  1W9F A;  4RN5 A;  1Y4W A;  4QX1 A;  1CJP A;  3LFM A;  1G7Y A;  2QKD A;  3GZE A;  5C3Q A;  4XET A;  4TXW A;  4IEW A;  4FOY A;  4XFH A;  4QQH A;  1W28 A;  2ZAB A;  4P00 B;  1H2N A;  3AKT A;  3CHX A;  3MDP A;  5A1L A;  3PUH A;  4YLZ A;  1FOD 1;  5JPM B;  3MV0 1;  5FYI A;  1UU4 A;  3ELN A;  3B9I A;  1RVF 3;  3OEB A;  5AC9 1;  1W6N B;  3SLI A;  2VZV A;  5FZ6 A;  1AR8 2;  3SEP A;  1FOD 2;  1UU6 A;  3SKV A;  4AE2 A;  1XOY A;  1HLC A;  2QQJ A;  3K2O A;  5GZF A;  2MEV 1;  2RS1 1;  2VME A;  3NJX A;  1GNY A;  3AMQ A;  2H6C A;  4QPI B;  5I93 A;  1LOF C;  1NZI A;  1AR8 1;  1F2N A;  1ZBA 1;  4NPL A;  3U75 A;  4LK6 A;  5AC9 3;  1ZRC A;  3V0A B;  3WF3 A;  3SC7 X;  1CN1 A;  5BNO B;  2C5D A;  4RR3 C;  3U07 A;  1FPN 1;  4LIT A;  2ZGR A;  2DCZ A;  2JG8 B;  3KVA A;  4LBQ B;  4QPW A;  4Y24 A;  2P6C A;  5BYN A;  5FQ0 A;  3KVB A;  3JBG 3;  3T08 A;  2HWB 3;  1SG3 A;  1JS9 A;  4EN0 A;  4Q0S A;  1OI6 A;  3F95 A;  1ZZC A;  4YSF A;  2BQP A;  5ACA 2;  3FFZ A;  1ULG A;  1UYX A;  1Q3E A;  1CIY A;  3OY8 B;  3HBK A;  3WP3 A;  5G05 L;  5DQ0 A;  1RUJ 2;  4BWO A;  1W9Y A;  2ORX A;  3HBZ A;  3MIG A;  1DGR N;  3FHA A;  2XKO A;  4P9I A;  4BK5 A;  3GDB A;  4MOA A;  2P3K A;  4DZG A;  3SNM A;  1H4H A;  4DEV A;  5KXC A;  1ZBE 2;  4FI9 A;  2P1B A;  4YM0 A;  1CJD A;  2JDZ A;  1FV3 A;  2UY9 A;  4MZU A;  5FP9 A;  1AYN 2;  3VKN A;  3ZFF A;  3IZO A;  3AFG A;  1ZBE 1;  1QDC A;  2VUC A;  2JG9 B;  4HK8 A;  3IT8 A;  1GZC A;  3P5B A;  4DIN B;  3AP9 A;  1PIV 2;  4LO8 A;  2VZQ A;  3M3O A;  1SDD B;  2JDY A;  3V65 A;  1PVC 1;  1KDK A;  2VTX J;  5LA9 A;  3W5M A;  2WLQ A;  1TG7 A;  2XXZ A;  1RUJ 3;  3ASI A;  3LEI A;  1DYK A;  4LHK A;  3ABZ A;  2HWF 3;  3GGL A;  2UYA A;  4PQQ A;  3WHT A;  1RB8 G;  1UZW A;  1MVE A;  4Y22 A;  4HON A;  3SHR A;  3QCW A;  5I0D A;  3WF4 A;  1YUD A;  5IYY A;  3NL1 A;  4NJ4 A;  4BQ3 A;  1ZZ7 A;  5JI9 A;  4NIG A;  1Q8O A;  5A6Y A;  3FL7 A;  1COV 2;  1GZ9 A;  1VP6 A;  5FY4 A;  4C0B A;  5JZG A;  3ENR A;  1X8E A;  3JQW A;  5A3W A;  4DS0 A;  1VBE 2;  2ZHL A;  4P9W A;  4XDQ A;  5F37 A;  4AVB A;  2B46 X;  2HBU A;  4YFZ A;  2RS3 3;  3ES4 A;  1NA1 A;  2Y26 A;  4FPJ A;  2QQP A;  3LFI A;  1RUH 2;  3T30 A;  2WSV A;  1HRI 1;  3ZN4 A;  1VBE 1;  4IEQ A;  3VHR A;  5GLV A;  3WNM A;  4BYY A;  4ERO A;  3O1U A;  1HN0 A;  1UYZ A;  3UGH A;  3KV4 A;  1VRH 2;  4LLF A;  3AL5 A;  2C24 A;  1G9A A;  1YJK A;  1EV1 2;  3K3N A;  5GZE A;  1A78 A;  1MAC A;  4HPK A;  1IQA A;  3IN9 A;  5GZD A;  5F3C A;  2PQS A;  4FXG B;  1RED A;  1RUN A;  3NV1 A;  5AFB A;  4IEZ A;  1CAW B;  2YXS A;  1QJX 3;  5JOW A;  2WWU A;  3HR9 A;  3ZXG A;  2QQW A;  1OSG A;  2WN2 A;  4N53 B;  4CCM A;  3ATG A;  3B93 A;  3K4Z A;  3USU A;  4AI8 A;  2ZS6 B;  3G7D A;  3SCH A;  3VBU A;  1BJQ A;  2DVF A;  4XUT A;  1OXC A;  2BOJ A;  3PVN A;  4UFK A;  3AP7 A;  3FLR A;  4AHY A;  4ZU4 A;  1GWL A;  5AVP A;  2UYB A;  1S0I A;  1ZVF A;  1O59 A;  5FZ1 A;  4EZ4 A;  4CSW A;  1Q8S A;  2OUH A;  5JSO A;  1OA2 A;  1GZW A;  2ZTN A;  1IS4 A;  5FO8 B;  4RGK A;  1YQC A;  5C9A B;  1O3T A;  1CR7 A;  1QNY A;  5GLT A;  4QKF A;  3BCW A;  5L73 A;  4YG3 A;  1WME A;  4LUK A;  4BXS V;  1U5I A;  1R08 3;  5JIU A;  2FQP A;  5E88 A;  5FLJ A;  1QQP 1;  2E26 A;  3E6D A;  3GM8 A;  5A32 B;  4XYX A;  1QGL A;  1U12 A;  2JIG A;  3RS6 A;  3FFQ A;  2ARA A;  4PBP A;  3NRU A;  3ZMN A;  4IES A;  1R08 1;  2KM2 A;  1W0O A;  1RMU 3;  1PHM A;  2YY1 A;  5JMC A;  3VBU C;  3LOB A;  2ET1 A;  3PJY A;  4XUR A;  1DLL A;  1NLQ A;  2VOT A;  4JZR A;  4LMF A;  4P08 A;  4W6X A;  3TBD A;  2OS2 A;  3M3Q A;  2XJR A;  4N43 A;  5T52 A;  3I3D A;  2VXJ A;  5FK8 A;  3K51 A;  2VE1 A;  3TEX A;  3WNL A;  1KQR A;  4K6B A;  4IGP A;  3WW4 A;  5GZC A;  5L7O A;  1VAL A;  3POJ A;  2JB8 A;  2CNA A;  3HWJ A;  4AVT A;  1O91 A;  1QIQ A;  3SKJ E;  2XJU A;  2B45 X;  2IFW A;  2X5I C;  2D6N A;  1G86 A;  4HK9 A;  4NRP A;  1HJG A;  3KCC A;  5L9V A;  1UZZ A;  4XJA A;  1R1A 1;  5FZO B;  5FY5 A;  4RR3 B;  1X50 A;  2G9Z A;  2Q4S A;  5KXD A;  4CCO A;  5J98 B;  4XJ9 A;  3OOX A;  4IEP A;  3AMN A;  2YG0 A;  3H8X A;  4Y4R A;  3AMH A;  2WFP A;  1W2N A;  3VHO A;  3KD4 A;  4NPM A;  2OZ6 A;  4Q0U A;  1LOB A;  2EIE A;  1LHN A;  3E97 A;  4JQR A;  1NKG A;  1O8S A;  3I2D A;  1ZRR A;  5LCW L;  1OBN A;  1OUX A;  1DYP A;  3AVR A;  3LD8 A;  3MFA A;  1V9U 2;  5FZM A;  3RJ2 X;  2PLV 2;  3IBM A;  1K5M A;  4N9H A;  5JXI A;  4A42 A;  3HNY M;  3MIB A;  3GHN A;  4ZON A;  2Q1Z B;  1H2K A;  3ZYB A;  1X9T A;  2WS9 2;  5FZ8 A;  4B1M A;  1FYU A;  4SBV A;  3BI3 A;  1AJO A;  5FBZ A;  4OVE A;  2X29 A;  3CDZ B;  3T2Q A;  4ZZ8 A;  3RSJ A;  5BNO C;  1JZ5 A;  3KM5 A;  4GA9 A;  4XBN A;  1QOS A;  4HPK B;  5D8A A;  3Q8B A;  2VNG A;  3K4A A;  5JCT A;  5APA A;  5C8C A;  1SBE A;  4XHB A;  4KWK A;  1WZX A;  2D3P A;  4GB3 1;  1WCD J;  2I45 A;  3MYX A;  4TYS A;  2EAA A;  4MSV A;  1RVF 2;  4B7K A;  1NX9 A;  2W0X A;  4KNC A;  1VMJ A;  4A6O A;  1X8M A;  4NHM A;  3VD5 A;  3LA2 A;  4M3C A;  1N3Q A;  4S2F A;  1VAK A;  5C8C B;  5C3R A;  5FV3 A;  2X5I A;  2MPF A;  4A7K A;  2WC2 A;  2UWB A;  4Y5S A;  5FK7 A;  3NV4 A;  2YBP A;  4EN9 B;  2W1U A;  2Y6K A;  5C3S A;  1HJF A;  1ND3 C;  1WMD A;  3M3E A;  1EPW A;  3KGZ A;  4K7J A;  3KCY A;  3T3Y A;  1GZW B;  1HXS 2;  3S5Q A;  4A2U A;  3RVH A;  1LED A;  1V6K A;  2ZHM A;  3HJR A;  3RGB A;  5ISL A;  4E2Q A;  1DU3 D;  1UKR A;  2RMU 2;  2XVL A;  4L11 A;  5FPX A;  1RJ7 A;  4JTN A;  3H42 B;  3U11 A;  4RSU A;  2A3X A;  5IVB A;  4XDP A;  3RNS A;  4CDX C;  2UUR A;  2UY8 A;  2XQX A;  3ILR A;  5KHI A;  2WYS A;  1UIJ A;  3KS7 A;  1SEF A;  4Q1P A;  4AFA A;  4R4Z A;  1QH7 A;  3TEW A;  4QB6 A;  4BCU A;  1ZZ6 A;  1DCS A;  1W6Q B;  1CAW A;  3MV1 1;  4LLO A;  1UY4 A;  4M3C E;  4PLN A;  4E8D A;  3SH5 A;  5CIS A;  5FJH A;  2EIB A;  1UYP A;  4MET A;  1UWW A;  3NV3 A;  5T5P A;  2IZW A;  4M0N A;  2ZML A;  1TZO A;  3POS A;  1VBE 3;  4N7U A;  3QD6 A;  2XLG A;  3OYW A;  3Q9O A;  5FO7 B;  3W20 A;  4XJU A;  1JZ6 A;  3L9J T;  2F4L A;  4MHU A;  4E4Z A;  3UKN A;  4EYU A;  4K8F A;  2PLV 3;  4XF1 A;  1TNR A;  1U5Z A;  3CZU A;  3PTR B;  3WQ7 A;  2DBI A;  3I7D A;  3KF5 A;  4Q0Q A;  3CKH A;  1QJX 1;  3VBS A;  3WF2 A;  3LIG A;  1US2 A;  4CDW A;  4FPC A;  4H14 A;  3WNX A;  3BPS A;  1PGL 1;  4KGQ A;  2G9F A;  1QJE A;  4MXW A;  2VVF A;  1EY2 A;  2BDR A;  1PGL 2;  4XCB A;  5DAX A;  3O1O A;  5JOY A;  1NUK A;  4P14 A;  3VD3 A;  2XR4 A;  4X6R B;  1IKQ A;  1ZBA 2;  4XF4 A;  1RC6 A;  2VZO A;  2TNF A;  5HI0 A;  4JAA A;  2VOW A;  4XEZ A;  5FPZ A;  1VB4 A;  4OMD A;  2V72 A;  1O4T A;  5LK5 A;  2VMG A;  3IWZ A;  4LBN A;  3FHQ A;  3LEK A;  4Z8B A;  3AXD A;  3QLQ A;  5E6H A;  3D4K A;  3WNO A;  3EMR A;  4CDX A;  1W06 A;  1Z0H A;  2P2K A;  5IVC A;  2G4I A;  4OZX A;  2RM2 2;  4HLT A;  3ZYP A;  3R4U A;  1V00 A;  1K5M C;  1FXZ A;  4BIF A;  4JKK A;  4HFS A;  4MVT A;  4HKO A;  2VOX A;  4YYO A;  4CE8 A;  2WT2 A;  1X33 A;  2EA7 A;  4PBO A;  3U0Z A;  3VBU B;  1ZNP A;  3MEP A;  3I54 A;  2PAE A;  2BZD A;  3ITQ A;  3NW4 A;  4LHN A;  2Q0A A;  3MFC A;  3BTX A;  1GIC A;  1FI2 A;  4PDW A;  1SFY A;  2FZ1 A;  4D6Q A;  5FXV A;  1S55 A;  5BNO A;  5BV6 A;  3KLS A;  1N47 A;  2DCT A;  4WM8 A;  4FFF A;  4QX0 A;  3RRD A;  3C7H A;  5C6C A;  2NN8 A;  3ZXD A;  2FCU A;  4X8P A;  3ZYF A;  5C4W C;  1JW6 A;  1A6C A;  2WQ4 A;  3ZSM A;  4D3W A;  2PAK A;  2ZMN A;  3NNG A;  5DN2 A;  3BB6 A;  1TME 3;  2E7T A;  4UW4 A;  2YMZ A;  1J58 A;  4Q27 A;  4XIO A;  5IVY A;  1G8W A;  4RD7 A;  3OG2 A;  5FO9 B;  1JYN A;  3H1M A;  2H0V A;  3VN4 A;  1PNG A;  2E63 A;  2GC0 A;  2VGD A;  3TN9 2;  3H3L A;  3WP6 A;  4UFM A;  1CAV A;  5JSR A;  2MEV 2;  2RS1 2;  3H3Z A;  1FAY A;  1GBG A;  4D0Q A;  1JTZ X;  4FPH A;  2E31 A;  1PGW 1;  2SBA A;  3O7O A;  4UFL A;  3EQE A;  5FFO C;  2WII B;  4AHW A;  4B4P A;  1KS4 A;  4CEW A;  1IPS A;  2Y6J A;  1VBB 3;  3PVE A;  3VKM A;  3JU9 A;  3PMS A;  1PGW 2;  4WVM A;  3AP6 A;  3N7M A;  4Y5T A;  4MGK E;  5FYY A;  4FPG A;  4QKD A;  2PHX A;  4CTE A;  3ZFE A;  4YG6 A;  2GP5 A;  5ACA 1;  3MO4 A;  5EQU A;  5K4L A;  2ATF A;  3WQ1 A;  1ZRI A;  3HQX A;  1CON A;  2D6P A;  1IPJ A;  3O0V A;  1OLQ A;  5FZE A;  4Q4V 2;  4BK4 A;  3V0B A;  3WF1 A;  1YXW A;  5EWS A;  2AH2 A;  3FUO A;  1ZBA 3;  1JMU B;  3ECQ A;  4JHT A;  2R7E B;  3JBG 2;  4COW A;  1GSL A;  2VBB A;  1F9K A;  5DAW A;  3WEZ A;  1BMV 1;  2W08 A;  4CDU B;  2QQV A;  1COV 3;  1IOA A;  2BW8 A;  1EUU A;  1W05 A;  4Z82 A;  1JXN A;  1JUH A;  3J7H A;  3JBG 1;  5LBE A;  5F2S A;  2YPJ A;  3AYD A;  4DXR A;  2R04 1;  4OYU A;  2VOK A;  2WDB A;  1OLM E;  5L7O C;  3WD5 A;  2DCK A;  3UL2 A;  1UL9 A;  1GQH A;  1UXX X;  1HB3 A;  5DUV A;  2D43 A;  5FRA A;  4ZPI A;  2K2S A;  1P8J A;  4FFH A;  1ST8 A;  1DLC A;  3UV9 A;  2P17 A;  2P3Y A;  2BJS A;  1PIV 3;  3KHC A;  1BBT 3;  4UF0 B;  5GLZ A;  1QDO A;  4CZS A;  1AYN 3;  1Y9M A;  2AC1 A;  1ALY A;  2XKP A;  3D3A A;  3IMN A;  3M7A A;  3N9N A;  3LF7 A;  3PIG A;  4PF1 A;  1PO2 3;  1FV2 A;  2QZ3 A;  4UW6 A;  5FMD A;  4NE9 A;  4XAC A;  3THP A;  2GC3 A;  1RUD 2;  2H0B A;  1AJK A;  5ABJ C;  2YDE A;  2GNM A;  4YW3 A;  2RE9 A;  5LZ6 A;  4RFT 0;  5FP7 A;  3MW3 A;  1JHJ A;  4I30 A;  4MGZ E;  2FHR A;  2ZGU A;  4SLI A;  1MEC 2;  2V5D A;  1BKZ A;  3AP5 A;  3UES A;  4B1L A;  4EN8 B;  1V70 A;  4NWW A;  3QH7 A;  4HKL A;  5FYZ A;  1Z7S 3;  2A6X A;  1H8T A;  1JU3 A;  2PEL A;  2WJS A;  3NNJ A;  4JTO A;  4B3N A;  4BME A;  3VUO A;  3K48 A;  3R4D B;  4Q4W 2;  1RUF 1;  2FCT A;  5DDJ 1;  4LO7 A;  3WG1 A;  3F2Z A;  4C1X A;  2YGM A;  4I02 A;  3BIE A;  1ENS A;  3O0X A;  1Z7S 1;  4M00 A;  4G3Y C;  2C26 A;  4F3J A;  1H9W A;  2Y38 A;  5FMB A;  3UGG A;  4H3W A;  3PUA A;  4AI3 A;  2Q8O A;  4N90 A;  3MIE A;  4D6S A;  4HXC A;  3HT1 A;  2XL7 A;  1LGC A;  2XUE A;  4AEK A;  4XMI A;  1VIW B;  2W52 A;  4UI9 L;  3N9O A;  4HG6 B;  1S0D A;  3O14 A;  4YNI A;  3EXU A;  5C33 A;  2FDK A;  3J7M A;  4WM8 B;  2GC2 A;  2XVG A;  3J8F 3;  5JOZ A;  3ZIX A;  2D93 A;  3IPV A;  2W92 A;  4LO6 B;  4CXW A;  4XJZ A;  4AVA A;  5CVR A;  2OQ6 A;  1CAU A;  1RUH 3;  4RHV 1;  4A7Y A;  1DHK B;  3PME A;  2W9X A;  3PUQ A;  1GP4 A;  1UOJ A;  1V6I A;  2Y64 A;  3USU B;  1H30 A;  1G9F A;  4TZD A;  2P37 A;  5JDB A;  1D0G A;  2VZ3 A;  4QAW A;  2RR1 3;  3VZO A;  1K5M B;  3MGU A;  4CRQ A;  2GNT A;  4BQ2 A;  2JEN A;  2BGP A;  3WNN A;  4NUB A;  1REE A;  2PHT A;  3EHK A;  4X8N A;  3C8X A;  2BUK A;  1XNT A;  1YNA A;  2X05 A;  3JCI A;  2Q30 A;  2RS5 1;  2W94 A;  2R1B A;  4CDU C;  4OHX A;  3OEA A;  5F5C A;  4WVZ A;  4CU9 A;  4DQA A;  4QX2 A;  5F5I A;  1GP5 A;  2WFF 3;  1EAH 2;  1LTE A;  4A45 A;  4B8E A;  3KSC A;  1SLC A;  3VZN A;  2VBD A;  5F3G A;  1RUI 1;  2JEC A;  5C5T A;  4NII A;  1VBB 2;  4XIL A;  1GP6 A;  1ZRF A;  1W9W A;  1WLT A;  4F83 A;  2KR2 A;  1N3O A;  1PO2 2;  5A32 A;  2WNV A;  3RYK A;  3BTZ A;  4LEJ A;  5CA6 A;  5FY9 A;  1RUI 2;  3GBF A;  4CUB A;  3A0N A;  1QU0 A;  2VMF A;  4Q4X 2;  1NXM A;  4QGN A;  5F6K A;  3V0A A;  1EV1 1;  2WFF 2;  5E1R A;  4W65 A;  2NPI A;  3BVC A;  3O1P A;  4L0P A;  4PT6 A;  1MS0 A;  2LTN A;  2J7M A;  1W8N A;  2WS9 3;  4XCA A;  1RXF A;  5IAV A;  4KWL A;  4MXW B;  3THC A;  3RZK A;  2ZKN A;  4DY3 A;  3RI9 A;  4HMZ A;  5KHJ A;  2BGO A;  4GMP 3;  2DUQ A;  3ZYH A;  2IUW A;  2JKB A;  3O12 A;  3VHN A;  4LBK A;  4QPY A;  2YU2 A;  4YGE A;  3C2U A;  1F31 A;  5FZL A;  1UY1 A;  2WL1 A;  1JOP A;  2RMU 1;  1HIX A;  1O5U A;  1CZS A;  1DZQ A;  5EJ1 B;  1TME 1;  4YZ2 A;  5FAX A;  3N9L A;  4IND A;  1S2E A;  4XZP A;  5FYB A;  4XFC A;  4QKN A;  5LB6 A;  2C9A A;  4CCJ A;  2ADE A;  1R09 2;  2BP6 A;  1PVX A;  2PHD A;  2RMU 3;  5F9T A;  3S57 A;  1MS1 A;  2VVD A;  4WM7 B;  4AF9 A;  5DAB A;  3NNL A;  2PHR A;  3VKL A;  3WSO A;  1WUV A;  2D6L X;  2VXR A;  4GQ7 A;  1LOC A;  4IEV A;  1VPH A;  1D7P M;  4RL7 A;  1W6Q A;  3PL0 A;  2R06 2;  1IGO A;  1KFU L;  5AFE A;  4IL7 A;  5A33 A;  1RUC 2;  4XAA A;  3MW4 A;  1MZE A;  4IEX A;  1E5H A;  1S2B A;  2HWF 2;  3JD7 1;  1ND2 C;  3OGV A;  2CDP A;  4JRA A;  2TBV A;  4K21 A;  4N9I A;  1RUO A;  2JG8 A;  1MS8 A;  3LWC A;  1R08 2;  1W6O B;  4AQT A;  5F7U A;  3B69 A;  3OBR A;  4H7M A;  3TEZ A;  3L2Y A;  4HVQ A;  2A5Z A;  2XUM A;  4QHB A;  5FPV A;  5LAS A;  2HWF 1;  5IVE A;  1DGR A;  1D2Q A;  3HPN A;  1YQ8 A;  3Q8E A;  3AKS A;  3ZDS A;  4NR1 A;  2XQR A;  1K5J A;  3K75 B;  2F6B A;  1UPI A;  3S7E A;  1RMU 2;  4Q0V A;  2QVS B;  3THD A;  3ZSK A;  5C70 A;  5JMO A;  3KV6 A;  2HWC 2;  1QXR A;  5KXB A;  4E8C A;  2QE3 A;  4AED A;  2NMO A;  4IE5 A;  3T2P A;  1JOJ A;  4KBB A;  4XDO A;  3E6B A;  4H2A A;  2XBO 2;  4FOW A;  5IFT A;  2HWC 1;  3MLL A;  3KT7 A;  1ZZ8 A;  3MIF A;  2WUH A;  2W91 A;  1S4C A;  5I91 A;  5ANN A;  3WXP A;  4A44 A;  4ES9 A;  2VVE A;  2VCA A;  4NWV A;  1JZ7 A;  1MS5 A;  4S2H A;  2NM1 A;  2ZGN A;  4XJW A;  2HWC 3;  2AGS A;  4E27 A;  5FUI A;  3RQ0 A;  4OHZ A;  2L9L A;  4GMP 0;  4I0B A;  3BKZ A;  3RZL A;  2X8K A;  3DKW A;  3ZSL A;  4M3C F;  4LIU A;  3BUC A;  3VZJ A;  4D69 A;  4R8H A;  2XJQ A;  1C8M 3;  2DBN A;  4XIK A;  5FZ9 A;  3THT A;  4V2V A;  3ZFE B;  4C90 A;  2A1X A;  2WZR 2;  2DDU A;  1H2M A;  3WDW A;  3WP5 A;  1K12 A;  4K9S A;  5GM0 A;  4Y1X A;  4YM1 A;  3QOP A;  4IV1 B;  4CEY A;  1AL0 G;  2ZX1 A;  5LW9 A;  4F8A A;  2A75 A;  1YIF A;  2FDJ A;  2ID4 A;  4HET A;  2IXH A;  4CPB A;  1UMH A;  3NMB A;  5C4W B;  3VD7 A;  2A71 A;  1XU1 A;  4Q4Y 1;  4Y1Y A;  5I0S A;  1UOF A;  5HCB A;  2GN7 A;  1V6L A;  5C8W A;  1CAV B;  5A1A A;  4XUO A;  3PHM A;  3MIH A;  3WR0 A;  3H9A A;  4QHO A;  4OI4 A;  3ZN6 A;  3M2M A;  2E6V A;  3FN9 A;  2A6V A;  3ETP A;  1NE4 A;  2WNU A;  4UW3 A;  1W0P A;  3ILF A;  4YZ5 A;  3D0S A;  5EYY A;  2VTX A;  3IB3 A;  5FZO A;  3RJR A;  4HZF A;  1ENX A;  5JZG C;  4AHZ A;  2O14 A;  4YVW B;  3UGF A;  4BMB A;  2XHN A;  1SAC A;  4XBQ A;  5A6Q A;  1BVV A;  1W8U A;  2W46 A;  3LEM A;  4JGY A;  3ZX7 A;  3VBH B;  2CU5 A;  4BA6 A;  5FOB B;  4FTB A;  4GWN A;  3D5O A;  4H55 A;  3H7J A;  1G6N A;  3EB7 A;  2V4V A;  4D7S A;  1NCQ A;  1TQ5 A;  1AR9 1;  3D82 A;  1W99 A;  1X7N A;  4AQS A;  1PX4 A;  3RZZ A;  2D97 A;  3R05 A;  1EP0 A;  5CKN A;  4AVV A;  2GSY A;  1AR9 2;  4QXK A;  1B09 A;  1C5I A;  4TWT A;  2JDU A;  2ZEZ A;  4I01 A;  1KRI A;  3LSE A;  4HAN A;  1TE1 B;  4YW2 A;  3HN1 A;  1Y7B A;  2DUO A;  3C7O A;  1FOD 3;  3VD9 A;  2RS3 1;  4BQ1 A;  3NVC A;  5H9R A;  5CNA A;  2WKK A;  4FAG A;  1BEV 1;  1GQP A;  1NQD A;  1ODM A;  2BTV C;  1GQG A;  4LXL A;  4AL9 A;  4YGD A;  1KD7 A;  3UT0 A;  4PF5 A;  1BMV 2;  1UIK A;  1HQL A;  2J42 A;  2PA7 A;  2VMH A;  4QM8 A;  2IVI B;  3CU7 A;  3HNB M;  1VLN A;  4QX3 A;  1VBA 3;  4CVU A;  1FMD 2;  2YGL A;  1S2K A;  3MID A;  1L7Q A;  1W9S A;  1H1M A;  1QWR A;  3O1R A;  1IHM A;  1NY7 1;  4N43 B;  1TVG A;  5JXG A;  3EYP A;  1EV1 3;  5I8T A;  3I3Q A;  4D8M A;  3O0W A;  3ZFE C;  1UX6 A;  3L2H A;  3DPR A;  2DVG A;  4GUL A;  3B7M A;  1GUI A;  1AR6 3;  2R06 3;  1O3Q A;  1F5F A;  3ZXE A;  2Y0I A;  2EXK A;  1WA6 X;  2HBT A;  1CX4 A;  1FX5 A;  2W1S A;  4CYD A;  4P9Y A;  5CAZ A;  5HV0 A;  4Z2A A;  1JYC A;  2DTY A;  4XF3 A;  4FOQ A;  2ZGO A;  1QJF A;  3LQC A;  1QHD A;  3O1V A;  1HV0 A;  1Y43 B;  2PFW A;  1OLR A;  2XVK A;  4UWD A;  4P5H A;  3NAP B;  3B3Q E;  4CU6 A;  3ZYI B;  1U5Y A;  3P3N A;  1JN2 P;  2NZ9 A;  3CZJ A;  2JXA A;  3U10 A;  1RGS A;  3FE5 A;  1NA1 B;  4CDU A;  1C57 A;  1E57 A;  1W2A X;  5FUP A;  1MS4 A;  1OOP A;  4AG4 A;  2WZE A;  1RUJ 1;  4D6R A;  3ACH A;  1C8N A;  1W8Z A;  4OUL A;  2HYX A;  1JI6 A;  2WBK A;  4RFR B;  4WVW A;  4BZ4 A;  2R49 A;  3DYP A;  4QM9 A;  4EE2 A;  2QDN A;  3NNM A;  2D6O X;  1EPZ A;  1AUY A;  1OH4 A;  2IXJ A;  2WT0 A;  3OD4 A;  2W3J A;  2VH9 A;  1Y9G A;  3R4S A;  4I09 A;  1AR6 2;  2KA3 A;  1EAH 3;  3Q8A A;  1KIT A;  2BNM A;  1JH5 A;  4X6Q B;  3PVB B;  4ZU7 A;  3A4U A;  3ZOI A;  3R0R A;  4QQP A;  1MZ5 A;  1ONA A;  4MGI E;  5CFD A;  1A8D A;  3UJQ A;  5HCH A;  3CIH A;  3EO6 A;  1W2O A;  2XG3 A;  1SFP A;  3KB5 A;  2Q8D A;  1F5J A;  4IDZ A;  3AJY A;  3I8T A;  3VBF A;  3T2T A;  1UMZ A;  2O8O A;  1MS3 A;  2W2I A;  1QMJ A;  4LBM A;  2A6Z A;  5K7P A;  2ZPX A;  4C0H A;  1NZC A;  1HQN A;  1RHI 2;  1RYY A;  1Q8V A;  5LK7 B;  5GZG A;  2Y6H A;  4BB3 A;  1JOB A;  4S2D A;  4CCN A;  1LOD A;  1J84 A;  1SFN A;  1YHF A;  3MUZ 1;  5J48 A;  1T2X A;  5IVV A;  1OF3 A;  4PIY A;  4HSJ A;  3BYW A;  4Y20 B;  4EN7 B;  1PMH X;  3WCS A;  2RJK A;  3I59 A;  2RS5 2;  3IIA A;  4B29 A;  4QWN A;  5FWE A;  1FPN 3;  5BNP C;  5IVF A;  1OPO A;  2LRP A;  2VZP A;  3ES1 A;  1NQJ A;  3FLT A;  3OJB A;  4Q26 A;  2VZ1 A;  2WZ8 A;  2Q8C A;  3BGA A;  2XJV A;  1SDW A;  1XND A;  4UXA A;  4UAP A;  2OUJ A;  1CVN A;  1DG6 A;  1DQ2 A;  3POG A;  4ORF A;  5CU1 A;  3USS A;  2HYK A;  2ARB A;  2ZHK A;  1SLA A;  4L9B A;  5CIR A;  4LR4 A;  4XQW A;  4XW3 A;  2GZW A;  1L7L A;  1ZA7 A;  2W1W A;  2Q5T A;  4ZXK A;  2ZEW A;  5A80 A;  3M4F A;  2JX9 A;  3J7L A;  2DUR A;  3GZU C;  1FNY A;  1WBL A;  1PO1 2;  3WOG A;  3ACL A;  2VTF A;  4GAL A;  3NAP A;  4YW1 A;  1SLB A;  5GAL A;  1I5Z A;  4BXF A;  1DYO A;  1WBF A;  5FZK A;  5DG1 A;  1W6M A;  3TYJ A;  2NP0 A;  3D6E A;  2JIJ A;  2HEV F;  3E5U A;  2EXI A;  1YIP A;  2VU9 A;  4FVV A;  2XPJ A;  1LU2 A;  4K1Y A;  4P9X A;  4Q4V 1;  3GYD A;  4IGQ A;  1GR3 A;  5AVA A;  1NE6 A;  2Y6L A;  4Q4W 3;  4NRM A;  4WM7 C;  2JE9 A;  1IG3 A;  4XJ8 A;  5EZW A;  3WIN E;  5IAT A;  1CIW A;  1LNS A;  4QXB A;  4OHW A;  2W1Q A;  3A21 A;  3KCX A;  1LGN A;  3VDD C;  3VLB B;  4CDQ C;  5FZB A;  5J37 A;  4AFD A;  3N36 A;  5LRS A;  2GAL A;  2VEC A;  4LE3 A;  4MUV A;  1H6X A;  3T1M A;  2D7F A;  2LAL A;  3AJZ A;  3LGR A;  4GD4 A;  4YW7 A;  3VDB A;  3LAG A;  3WNK A;  2EAK A;  2IXL A;  3TB0 A;  1KGY A;  2WAO A;  4ZY9 A;  1W3V A;  3FX3 A;  5F3E A;  4LUL A;  4BQX A;  2N7G A;  3NJY A;  1PVC 2;  3LA7 A;  1N1V A;  3ZYR A;  1LHO A;  1R09 3;  1H4G A;  3U1X A;  2ZGM A;  1W2T A;  1YCI A;  4QX7 A;  4RGA A;  2VJX A;  4YAR A;  3LCP A;  3KWV A;  3UK9 A;  5T54 A;  4WVV A;  5DZE A;  4FPK A;  4JRL A;  1YI9 A;  1S0C A;  1HRI 3;  4KI5 M;  4FCA A;  3W9A A;  1DQ5 A;  1RUE 3;  4HSL A;  2IXK A;  4KH9 A;  3KZ4 C;  4QB2 A;  3VBR B;  2HWE 2;  5A33 B;  2CGO A;  3BTY A;  3LA3 A;  4PIX A;  4XTP A;  5DUU A;  1VRH 1;  3T0A A;  4JKM A;  1DGW X;  5C7G A;  3FZ3 A;  4R9C A;  5B4X A;  4OI0 A;  1AYM 3;  3ZR5 A;  1NCQ C;  3IM0 A;  4PHZ A;  4PDW C;  2Z69 A;  3PIJ A;  3S7I A;  1O4Z A;  2D3R A;  5H9Q A;  4QDQ A;  1AHS A;  1H1A A;  1HRI 2;  1VBA 1;  5GLW A;  1UN1 A;  2A7A A;  1W2U A;  2OT7 A;  4V2W A;  1ULO A;  3C7E A;  3I2F A;  1UX7 A;  3OUI A;  1PM7 A;  2V4A A;  3PUI A;  1WCU A;  2W39 A;  5D8A C;  2W47 A;  5A3O A;  2CY6 A;  3UET A;  3VBF B;  3WDV A;  5FTT C;  5C71 A;  3P1I A;  4GAZ A;  2JDH A;  1RUI 3;  1QJY 1;  5FYH A;  5IJR A;  2A70 A;  3BOD A;  1TMF 2;  3VBH A;  3VL9 A;  2WWS A;  3B00 A;  2CAV A;  3O1M A;  2CAU A;  2RHP A;  4YGB A;  1HKD A;  2YFU A;  4AEM A;  1CAU B;  1QJY 2;  4I3G A;  2Q1M A;  3ZPO A;  1OKO A;  1PK6 A;  3LPG A;  3N9M A;  2BPA 2;  2OW4 A;  2A6W A;  2Y60 A;  2A3Y A;  3RYR A;  2CDO A;  1OUR A;  1DQ6 A;  4IER A;  3HN3 A;  1MQT A;  2WS9 1;  4M4P A;  3TN9 3;  1L7R A;  3SMH A;  1OUS A;  1C1F A;  3AZZ A;  5L36 A;  1UY2 A;  4RQP B;  4M3C B;  3WP4 A;  4NPR A;  4FTS A;  5FXZ A;  2VL4 A;  2XHK A;  4GMP 1;  1TMF 3;  3HOB A;  2BWA A;  5JZG B;  2WNU C;  3NAP C;  1BBT 2;  2BU9 A;  5IFP A;  3CO2 A;  1OC1 A;  1DZR A;  4NRO A;  1RUG 2;  5ABJ A;  1H8T B;  2YFZ A;  4JGZ A;  3KV9 A;  3IKW A;  2QBX A;  3HD8 B;  1WMX A;  2R6Q A;  1BBT 1;  1GU3 A;  1WLD A;  2W68 A;  4XFG A;  1UXZ A;  1GKB A;  2WQZ C;  1VBB 1;  3OPZ A;  4AZZ A;  4BPZ A;  5T50 A;  4D7T A;  5T55 A;  1J3P A;  4COU A;  4DUV A;  3W21 A;  2BBV A;  1ENQ A;  2RJL A;  1V6N A;  4NOT A;  3DCQ A;  3LKJ A;  2QQK A;  5DZG A;  3OD0 A;  3KGL A;  2K46 A;  4GH4 A;  4RS5 A;  2R16 A;  2HWE 3;  2MNG A;  4B4Q A;  2OQ7 A;  2QTW B;  5FZH A;  4LT5 A;  1WCQ A;  1REF A;  4QHZ A;  5K9Y A;  4YVW A;  4UBG A;  4GJY A;  2H6B A;  2B8M A;  2AEZ A;  4LO4 B;  4YM2 A;  1HRV 2;  2Z2S B;  3WW3 A;  1MVQ A;  3INA A;  3GZA A;  5EYX A;  1JZ3 A;  3RZG A;  1NAE A;  5FKB A;  5A3L A;  1WW6 A;  2ZHN A;  2P34 A;  4QPI C;  2YUE A;  1BVP 1;  5KR7 A;  5DUW A;  4GJZ A;  2CWS A;  1XSR A;  1UZY A;  4Y26 A;  2C6S A;  2ZJC A;  1GLH A;  3AP4 A;  3ZN6 B;  1LHV A;  2JG8 C;  4ZZ5 A;  2PLV 1;  3WV6 A;  3PU3 A;  2XWB B;  5KHG A;  5BPX A;  3IDB B;  3LE0 A;  4AI0 A;  4E2S A;  3MLJ A;  2YYO A;  4PQ9 A;  1AXZ A;  2DVA A;  4XZU G;  1GWK A;  2C1F A;  1RUD 3;  2WZR 1;  3P3P A;  3RWK X;  1X9P A;  4PLO A;  3RFR A;  2J1S A;  4JC1 A;  1VJ2 A;  1YLL A;  4AED C;  4XUP A;  4BQ5 A;  5B2G B;  2GH2 A;  3MF6 A;  5BNP B;  5HCA A;  2VCB A;  4PI0 A;  1QH6 A;  3TNP B;  2J1V A;  4PJY A;  1AR7 1;  1SQ4 A;  4CEW C;  1S0J A;  2AAC A;  4O9E A;  3ZKY A;  3ZXL A;  5A7W B;  3VDC A;  2ZGQ A;  4FXK B;  3VL8 A;  1YEW A;  2ENR A;  1SPP A;  2IFR A;  1VMH A;  1ULC A;  2K9Z A;  1OOP C;  2VCC A;  2P5B A;  3OBA A;  1VBC 2;  4FPY A;  3GNE A;  4QD2 A;  1O3S A;  1U0A A;  2RV9 A;  1CAX A;  4MX3 A;  5LRR A;  4C91 A;  3N4M A;  1JZ4 A;  2JD4 A;  2E7Q A;  5KHH A;  1N1Y A;  3MHZ A;  2OKX A;  3DPR C;  4EQV A;  5FYS A;  2BGC A;  2WQ8 A;  5DPN A;  3WQ0 A;  4P02 B;  1JYI A;  1OLM A;  2CSG A;  4DNY A;  3ZFG C;  2BYV E;  4Q4V 3;  2RS5 3;  4Z1V A;  2GC1 A;  2CGN A;  1DQ4 A;  4RGG A;  1XE0 A;  4RQP C;  4GB3 2;  4ES8 A;  4Q4Y 3;  4I0A A;  5E89 A;  3ZSJ A;  5A70 A;  2CV6 A;  3C3V A;  3OPW A;  3FC0 A;  4COZ A;  1UO9 A;  1HXS 1;  3III A;  4Y20 A;  2Y34 A;  3ZO0 B;  2UWC A;  1QF3 A;  3ZLI A;  2HEW F;  1XBF A;  4XOG A;  4WZF A;  4Y1Z A;  1G9B A;  2OVU A;  3A0K A;  2PHW A;  1AVB A;  1AXK A;  2HWD 3;  1JU4 A;  3DYO A;  5FBJ A;  1O7F A;  4PDW B;  1POV 3;  3I2J A;  4IE7 A;  1RHI 3;  2GMP A;  3NST A;  3VGI A;  2EID A;  4FPO B;  4COY A;  1T6G C;  5FPU A;  4HKW A;  4EZH A;  2E33 A;  4LBQ D;  5DAV A;  5FY0 A;  1RXG A;  3H7Y A;  1GNZ A;  3UJO A;  4COV A;  2VBP A;  4YVS C;  2ZX4 A;  1DGL A;  1I1E A;  3DXT A;  2BVB A;  1H0B A;  2K0G A;  4XAE A;  4AGG A;  1N1S A;  2FMY A;  4WVM B;  4ZS2 A;  2JD9 A;  2ILM A;  1S0B A;  2R07 2;  4M4R A;  4K40 A;  1J83 A;  2R04 2;  2QUO A;  2EIC A;  4B7E A;  1URX A;  2ZX3 A;  1FMD 1;  5J36 A;  4JGZ B;  2ZGL A;  1V6J A;  4URT A;  3WDU A;  1HV1 A;  3JB8 A;  2R07 1;  2VO5 A;  2ZX2 A;  2WIN B;  2RDN A;  5EPA A;  4AR2 A;  3AMP A;  3DXU A;  1JHN A;  4XBL A;  5JOX A;  1QJX 2;  5EJZ B;  3WW1 A;  2O1Q A;  3J26 N;  3N7J A;  5FJK A;  4IV1 C;  1JZ2 A;  1LAJ A;  5CB7 A;  2WZP P;  2ETE A;  3OGJ A;  3ST7 A;  2R07 3;  5I0R A;  5JWP A;  2RJ2 A;  4S2G A;  2VR4 A;  3POF A;  4AED B;  1SMV A;  3FLP A;  2R30 A;  1PZ8 A;  1SBD A;  5D8A B;  1FNZ A;  4QGM A;  1E5R A;  1W8H A;  2QJV A;  5EP9 A;  3AKR A;  1YYN A;  2F4P A;  3LDB A;  4FPL A;  2RDQ A;  2A6Y A;  1KXG A;  1OA4 A;  2NQY A;  5FPL A;  4IUG A;  5HCF A;  3WQB A;  2Z5W A;  5AC9 2;  1XNA A;  4JGY C;  4NMI A;  4H7L A;  5K0U A;  3SCF A;  5J96 B;  4CCK A;  5HXM A;  1GMM A;  5T5L A;  2XML A;  2ZXQ A;  2XH6 A;  1UY3 A;  2FBE A;  4J25 A;  5FKC A;  1OOP B;  4OFG A;  4YFW A;  5A3U A;  4BJ0 A;  1OD3 A;  1RIN A;  4KU8 A;  1QJU 3;  4KMQ A;  1LKN A;  2QFE A;  2VC9 A;  3ZXK A;  3KV5 A;  2RDR A;  2ZA9 A;  2ZZQ A;  4J1X A;  4WM8 C;  3R6S A;  5FZ3 A;  4XXP A;  1ZZ9 A;  4Q29 A;  3BN6 A;  1Z7S 2;  4QPI A;  1S0E A;  3ZFG B;  4XAB A;  4AQ2 A;  2QQL A;  1HQW A;  5GLU A;  1PGS A;  3OYW B;  4MV2 A;  4BU2 A;  2HEY F;  1BXH A;  2DVD A;  1H6Y A;  3VBO C;  1LEM A;  3MBW A;  4R9A A;  1AYN 1;  5EXO A;  1L3J A;  4AGV A;  5C5U A;  2D3S A;  3RMX A;  3AZW A;  3E6C C;  1N1T A;  2WYF A;  2ORZ A;  2QZ2 A;  4UFJ A;  4K20 A;  3H3U A;  3DF0 A;  1MEC 3;  3MZH A;  2RM2 1;  1H8T C;  2ZBJ A;  3H1W A;  3CBN A;  4BOW A;  4XC9 A;  1GOH A;  1D0H A;  1UKG A;  3AYA A;  3LPF A;  4JQT A;  5GKA C;  4Q8L A;  3TRS B;  2D40 A;  4HVO A;  4OQ9 A;  1VBD 3;  1PZ9 A;  1YFX A;  1AX1 A;  4BIO A;  2E32 A;  5F5Q A;  1DF0 A;  4Q2F A;  5FMO S;  1DIW A;  1JUI A;  4K3U A;  2JB4 A;  3V64 A;  4JHZ A;  2W87 A;  4LNV A;  3SCG A;  2AZ5 A;  3AVS A;  2DV9 A;  4QU2 A;  3N9P A;  4LBJ A;  4LA3 A;  2JWP A;  3NWK A;  5T5O A;  1XYN A;  1EAH 1;  2VG9 A;  1S1A A;  4GWI A;  4LPL A;  4CEW B;  1DZT A;  3EJK A;  3HEI A;  5FYV A;  3T4H B;  4EWE A;  2JKX A;  3H0O A;  5K0U C;  3URF A;  2WO2 A;  1VMF A;  1CX1 A;  1NXD 1;  4CUA A;  1WCK A;  5LA0 A;  1SHW B;  1ODN A;  1PK6 C;  1NLR A;  5K8S A;  3OBT A;  4AYU A;  5JAX A;  1YWK A;  3SEE A;  2J22 A;  1H2L A;  2B9U A;  2HWD 2;  2OX0 A;  4L8Q A;  3IMM A;  3SIT A;  2DU1 A;  2Y0O A;  5ACA 3;  3VBF C;  2B39 A;  1DQ1 A;  2QQU A;  3GZT B;  4RHV 3;  4XFA A;  4CCE A;  2VCM A;  1YJL A;  2VQA A;  3PUS A;  2OA2 A;  1XRU A;  2J1A A;  4A6S A;  1Y3T A;  3IDA A;  3ZR6 A;  3JD7 3;  1PO1 1;  4PLM A;  2XWJ B;  4P9G A;  1AR7 3;  4OHV A;  5IHR A;  5D1I A;  1WMF A;  1C1L A;  4OHY A;  1QJZ A;  2KD7 A;  3NQH A;  5DMY A;  5FRE A;  3KQ4 B;  2P4E A;  5FLI A;  1JZ8 A;  1IZ3 A;  4LO5 B;  4FTE A;  1LUL A;  4Y5Z 0;  2Y6G A;  5CKQ A;  5FP3 A;  1A34 A;  3VB9 A;  5C8C C;  1Y9Q A;  4WBB A;  3ALQ A;  3VHP A;  3FUQ A;  5FCC A;  5FP4 A;  2BRT A;  3NKT A;  1NA1 C;  1UAI A;  3LB9 A;  4HVR A;  4MG2 A;  2DUP A;  4LOS A;  1UF2 C;  3ORJ A;  4IE0 A;  3A22 A;  1KS5 A;  3AK0 A;  1ND2 B;  4QX8 A;  5EJ3 A;  2YC0 A;  2EVX A;  2ARX A;  4O65 A;  2IXI A;  4LUM A;  1PIV 1;  2DVB A;  1F8V A;  1BHG A;  4UFH A;  4YPJ A;  1BK1 A;  4CCL A;  3GHM A;  3GF6 A;  2XBO 3;  3VBO B;  5HV4 A;  5JIA A;  2WO1 A;  5A7O A;  5A7Q A;  1K42 A;  5I8Y A;  4L97 A;  2VQT A;  1W6P A;  5FYM A;  1GOF A;  3V0B B;  5I0T A;  5J3U A;  5IUQ A;  4C8D A;  4R9B A;  3C7G A;  3WX5 A;  3N35 A;  1VBC 3;  4JX0 A;  4JDN A;  4NO4 A;  4W6W A;  4Q5O A;  4LKE A;  2HJI A;  4U36 A;  4YRD A;  5C4W A;  3AKQ A;  4C1W A;  4XPV A;  3SQO A;  4DXS A;  1GNH A;  2Y6F A;  4Q8K A;  2IC1 A;  2VD7 A;  4JDO A;  1CWP A;  4YW5 A;  1CPN A;  1ZBE 3;  1UMI A;  3G6J B;  3WLU A;  1UYY A;  2VOV A;  2XJT A;  1KFX L;  1RMU 1;  2KXL A;  4MLO A;  4ATF A;  1MZ6 A;  4EJR A;  2NYY A;  5DAQ A;  1WLC A;  1US3 A;  2IVJ A;  1IKP A;  2WNV C;  5F2W A;  5J7M A;  4QXC A;  5LBB A;  1I9R A;  2Z42 A;  3HVD A;  2CYF A;  4XFI A;  1FPN 2;  2PAM A;  3WZ1 A;  3VD4 A;  1JYT A;  2G1M A;  1YQ6 A;  1W9T A;  4CCD A;  2YZ4 A;  1QXP A;  3CJI A;  4BM8 A;  1FMD 3;  3E5Q A;  4FQ4 A;  4MO3 M;  1XC6 A;  4NHX A;  5SV5 A;  4OUE A;  2JE7 A;  1XPW A;  3AMM A;  3LSD A;  2X53 S;  2ZX0 A;  1AYM 2;  3LOI A;  2WLP A;  2DCJ A;  3J8F 1;  2BBA A;  3J9S A;  2Z4F A;  1UQX A;  4QU1 A;  3W59 A;  4DUW A;  4AAX A;  4YW4 A;  4WM7 A;  4CP2 A;  2EIG A;  2BVV A;  3WT3 A;  4FFI A;  1RUE 2;  1W0N A;  1AYM 1;  1TME 2;  4RHV 2;  2EAL A;  3TAY A;  1QOO A;  4YZ1 A;  3AB0 A;  4QMA A;  4QPG C;  2GP3 A;  2PHU A;  3MPB A;  2CTV A;  4YWA A;  1HB2 A;  4QX5 A; 
#chains in the Genus database with same CATH homology
 1OVS A;  2JDP A;  2JDH A;  2JDN A;  1OVP A;  2VUC A;  2BOI A;  1OXC A;  2BOJ A;  1UZV A;  5A6X A;  1W8F A;  2WRA A;  2JDY A;  2WR9 A;  2BP6 A;  5A70 A;  4UT5 A;  1W8H A;  5A3O A;  1UQX A;  2JDK A;  1OUR A;  2BV4 A;  2JDU A;  2VUD A;  4AOC A;  2CHH A;  1GZT A;  5A6Z A;  3ZDV A;  2XR4 A;  4CE8 A;  1OUX A;  5HCH A;  5A6Y A;  5D2A A;  3DCQ A;  2VNV A;  1OUS A;  2JDM A;  5A6Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...