2VUDA

Pa-iil lectin from pseudomonas aeruginosa complexed with fucose- derived glycomimetics
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
114
structure length
114
Chain Sequence
ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNETAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILTNELNFALVGSEDGTDNDYNDAVVVINWPLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FUCOSE-BINDING LECTIN PA-IIL
publication title Fucose-Derived Glycomimetics as High Affinity Ligands for Bacterial Lectin Pa-Iil from Pseudomonas Aeruginosa
rcsb
source organism Pseudomonas aeruginosa
molecule tags Sugar binding protein
total genus 20
structure length 114
sequence length 114
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07472 PA-IIL Fucose-binding lectin II (PA-IIL)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.400 Mainly Beta Sandwich Jelly Rolls Calcium-mediated lectin 2vudA00
5A6YA 2JDYA 4CE8A 1OUXA 1GZTA 5A3OA 2JDPA 1W8FA 2BOIA 2BP6A 4AOCA 1UQXA 5A70A 4UT5A 1UZVA 2JDHA 5A6ZA 2JDUA 2VUCA 5HCHA 2BV4A 2BOJA 2WRAA 1OUSA 1W8HA 1OURA 2JDKA 2VUDA 1OVPA 1OVSA 1OXCA 2CHHA 3ZDVA 2JDMA 2XR4A 5A6QA 5D2AA 2WR9A 2JDNA 2VNVA 5A6XA 3DCQA
chains in the Genus database with same CATH superfamily
2WNVA 3OSDA 3VBUB 3NVCA 4PDWA 5C3OA 5I8YA 2VMEA 1GZTA 4IGOA 3DPRA 5FZHA 1VLNA 1WLCA 1YFWA 2Y6LA 4D6QA 5F9TA 1UYZA 2CYFA 1XE0A 1S2KA 1MQTB 5FYVA 3WW2A 4E2SA 1YWKA 5FWJA 1JZ3A 3AVSA 4BK5A 1ASJ3 2EXHA 4IUGA 2JG9B 1KDMA 1ZZCA 2PFWA 4P5YA 5GLVA 5AC93 3HBKA 5JOXA 1JOPA 2V4AA 1KJRA 4UBHA 1DIWA 4MXWB 1V9U3 4QX1A 5IVYA 4UF0A 4NPLA 1K3IA 1VMJA 1OXCA 4G4FA 1JZ8A 5GZEA 3KHBA 5FXWA 3JD72 1MVEA 4N43A 1IHMA 2ZJCA 3HWJA 1QNYA 1ND2A 1WLDA 5DUUA 3Q9OA 5E8AA 5K0UA 3RI9A 3SH5A 3FWEA 1AL0G 4YW2A 3USUA 2VMDA 3SMHA 2JDYA 2PLV2 3BOWA 1R083 1KRIA 5B4XA 2R062 2ZGRA 1DGRN 1NLRA 5FPZA 1N1YA 2JIJA 2X10A 5DZEA 2DBNA 4JAAA 2EIGA 5GZDA 2X05A 1IGOA 3JB4C 3RI8A 1HXS1 1C4RA 4PLNA 1QDCA 1R1ZA 3KGZA 1WGPA 1V6OA 3QD6A 4BWOA 4EQVA 4MV2A 3Q8AA 3VBSC 2FCUA 2FMYA 5DDJ3 4YGBA 1U5ZA 5HI0A 1W6QB 2W1QA 1CAXB 1RC6A 2RM22 3JU9A 4HN0A 1MS5A 4XJWA 1QH7A 4K3UA 3VKOA 2Y6KA 3VBHA 4WVMA 2WWUA 5L9RA 2D6MA 5FOBB 3GGLA 1PVC3 2WN3A 2IXIA 4TZDA 5FY7A 3K75B 5JSOA 1VP6A 1JS9A 2XLAA 4CP2A 5DG1A 2WSVA 3PUAA 1RMU1 3ILFA 4UAPA 4S2FA 1UKGA 1MVQA 4S2DA 1RUE3 4AI1A 2GMEA 1MACA 2XJVA 5FZ7A 2VUAA 1BMV2 3N3HA 3SLIA 4DINB 3LDRA 3POFA 5IAXA 1WA4A 4RQPC 2VZQA 3T3YA 2ATFA 4N53C 4A7ZA 4D7SA 3WP5A 4LPLA 1PMHX 5JXJA 3WUDA 2JDMA 1I6XA 3EBRA 4LE4A 3BYWA 3FN9A 4LKEA 3ZYRA 4XCAA 4A42A 1QOSA 1VBE1 3WDXA 2YC4A 1AYM1 3W20A 5JDBA 3BTXA 3U11A 4K9SA 5T5LA 3E6BA 1WMXA 2WWSA 3OB8A 2WZEA 4OHVA 1FNYA 2YGLA 1PVXA 4M4RA 2VOTA 1V6LA 3KT1A 3NMBA 4BLIA 1K12A 5T3NA 2TBVA 1I1EA 2EA7A 4HPKB 5GZGA 2WZR3 2WA3A 5FMCA 4QU1A 5C3SA 2DVFA 1JYVA 5JOZA 3VD3A 5I93A 2Z4FA 4JHZA 5LASA 3OUJA 1RJ8A 2N7GA 4PIYA 2CHHA 3PUSA 3H3LA 4XJUA 2LUWA 2EF6A 4XQWA 5BNPB 1UZWA 2VZUA 1HB2A 3LSEA 3OEAA 2OKXA 5BYNA 4XXPA 3R4DB 3ZX7A 1S0CA 1OOPA 1SLBA 3O1SA 1C5IA 3HBZA 1H2KA 4DY3A 1O5UA 4OHYA 3HIFA 2Q5TA 4Y1VA 1ULGA 1V70A 4BQ1A 5FFOC 3NQHA 4LHSA 4JX0A 1RMU3 4H14A 2Y6JA 3CF6E 3MIFA 5FYHA 2GSYA 4UFMA 4W65A 4QX5A 4DPNA 1JTZX 3QH6A 3MV11 3Q8BA 2WFPA 1HQWA 3USSA 2JDKA 2EXJA 3SC7X 5JI7A 1NE4A 2Z69A 4N90A 5FJKA 3S5QA 4FOQA 4CDQB 5F32A 5HXMA 3GCWA 5DMYA 2JG9C 5FAXA 2J1AA 1M06G 2IXHA 5F2SA 1BEV1 1QY4A 2JIGA 1B35B 3N7JA 1XOYA 4XBLA 4AHWA 1KXGA 4D7TA 1W9YA 3VUOA 5E89A 2ZEXA 3IDBB 1R64A 3O12A 4U2AA 5C7GA 1AYM3 2BOIA 5JUVA 3MW2A 1W6NB 4GMP1 4W6XA 4AEDB 1F8VA 1QKQA 1XNAA 2WAOA 3R6SA 3AKTA 2QQMA 5C33A 3GHNA 4ET7A 1N47A 1W04A 1FV2A 1NLQA 4ZZ5A 5CA6A 1U5IA 4ZU7A 3AZYA 4QMAA 2NN8A 1QHDA 3NNMA 1OKQA 3OYWA 5EXOA 4E4SA 1DP0A 1GOGA 1QQP2 2F17A 2GNTA 2NMOA 2J1VA 4F3JA 3MO4A 3LGRA 3M7AA 2BGOA 5F5IA 4LEJA 4XDQA 3VD9A 4NN0A 3UESA 2FZ2A 1ZRFA 3WP4A 4KWUA 3VL8A 2VW1A 5FQ0B 4CDXA 1LAJA 1G7YA 1GOFA 3DEMA 1UL9A 4LKFA 4H7LA 4GAZA 5F2WA 1GWKA 4TYSA 1XJAA 2X8KA 3SH3A 5A70A 3HT1A 4ATFA 1CN1A 4IE5A 4XDPA 3ZFGB 1QOTA 2RR11 3TYJA 3ZYGA 5C5UA 3KV4A 1F4AA 4IE7A 4HXCA 4KG8A 4COUA 2V09A 2D6PA 2DVGA 3WHTA 3CL1A 3LEKA 2AEYA 1LGNA 2IFRA 1J83A 5FOJB 4Y20A 4GWJA 2ZGUA 1RUJ3 2VMIA 5DUWA 1ASJ2 1NZIA 1CZTA 3OGRA 1G86A 4CU9A 1CVNA 3RMYA 3C7GA 3EB7A 5AC92 2QQVA 3WP3A 3I2OA 2XJRA 1Y43B 2RDRA 1V9U2 3OGJA 4R52A 5FZ6A 3M3OA 2VOXA 4CCJA 1BEV3 1AYN3 1ZZ9A 3RYRA 3J7MA 1NY71 2ERFA 4LOTA 1JN2P 4YFZA 3ETPA 4L92A 3A23A 3AZWA 1AR62 3QH7A 3K3OA 1WUVA 1R082 3VDAA 4GMP3 4Q4X2 1UW8A 2YZ4A 1WW4A 1RUH3 4XPVA 2W68A 5A7OA 4HVQA 5FLIA 2YDEA 2UY9A 1WKYA 3DUIA 4CU8A 1HQNA 4D6SA 4B1LA 1UZZA 2E26A 5KR7A 3RSJA 2AUYA 2BGCA 4XIKA 5JR7B 3KS7A 1EYBA 2VCMA 1I5PA 2C5DA 1W6MA 2PELA 4R4ZA 4EE2A 3H8XA 5GLWA 1IKQA 4Z1VA 3WG2A 2KA3A 4UW3A 1PO23 3DF0A 4ZXEA 1GMMA 2R49A 4M00A 2XONA 3I3MA 1CZSA 1PVC2 2RV9A 3ZSMA 2ENRA 1SFNA 3HAGA 2EXKA 1BK1A 5FZEA 3BU0A 5LEKA 5G04L 2A71A 1SG3A 1RUE2 2AH2A 2VUJA 2YBKA 1N1VA 2QKDA 1N3PA 2Y6HA 1HV1A 2B42B 2WSUA 4XFHA 1F31A 5FWEA 1GICA 3ECQA 3B93A 3I2DA 4LUMA 5G05L 2HBUA 3M2MA 3VBSA 1S0JA 4XFGA 1XSQA 3VBFB 5FO9B 2VL4A 1C1FA 4P5HA 1ZBA1 3GNEA 3K46A 4CCNA 2VVDA 3JBG3 3JUUA 4A6SA 1VAVA 2WDBA 4LO5B 2WNVB 3HQRA 4NHMA 1NG0A 1MS3A 5HCBA 4CDQC 4PDWB 4L9BA 4XIOA 4Q0PA 5BNNC 5A3LA 4NIHA 4MUVA 3DPRB 4ASKA 3PDQA 3ZIWA 4FO9A 2JG8C 3KHCA 1LEMA 1DZQA 2Y33A 4IEOA 5KBFA 2RJ2A 4RL7A 4CP1A 4UW6A 1SFYA 1XRUA 1EV13 2DVDA 4PCRA 1YQ5A 3C8XA 3T1LA 2XHKA 1BJQA 4Y1YA 3C7HA 4FP3A 2QQJA 3J4UH 5J1XA 3OGSA 2QZ2A 3WG3A 3I2IA 4UF0B 1UX6A 1W99A 1RYYA 1J84A 1GZWB 1W0PA 2BNNA 2WZR2 2X5IC 5T54A 1UZYA 3WG1A 4RQPA 1Y9MA 4FFFA 4MGSA 4N43B 4N53A 1AVBA 4A3XA 1G8WA 1HXS2 1ND2B 3KV6A 4BB3A 4CSWA 1PNGA 1OLMA 5K0UB 2PA7A 3USUB 1QH6A 1QXPA 2JDPA 2LM3A 4QXKA 4Y4YA 5FP7A 3UJOA 4AOCA 1VBA3 4NJ4A 4P02B 4FQZA 3MZHA 4Y24A 3AFGA 3P3PA 4HKWA 1Z78A 5GZFA 5EV7A 4I30A 2ZEWA 2XBO1 1W6PB 4YSFA 3K4ZA 4A4AA 1W2OA 1VBD3 3NV4A 2DCYA 5FZOA 5LATA 4C8DA 4CDUB 1XE7A 2JKBA 4CZSA 1RMU2 3CIHA 1ZX5A 4MX3A 3E5UA 4RSUA 4GJZA 4CCLA 3S0MA 1CR7A 2Z2SB 3VBHB 1W9SA 4WVMB 3MIBA 4XMAA 1VBB1 1GZ9A 1H8TC 4V2WA 1WZXA 3BTYA 2YPJA 2ZAAA 1V6IA 1AR71 4LO4B 3THPA 3N9PA 1HQLA 2WT0A 4FPKA 1S0EA 2J1TA 2ZGKA 1MS8A 5JCTA 2FDGA 2FQPA 4BQ4A 3POBA 1DGWX 3X29B 3BKZA 3E6CC 1YQ8A 3IWZA 1GQHA 1NZCA 1WWYA 4XQDA 5I91A 2HEVF 1UYYA 4FBFA 2ORZA 4FPLA 4DUWA 2ARAA 3KF5A 4XEZA 1UY0A 4UBGA 1AYM2 3AP5A 4DEQA 1OT5A 2F6BA 5A1LA 1OD3A 1OMIA 2YFZA 1WW7A 3ETQA 4HT1T 5KHGA 3LE0A 1YXWA 1KQRA 4MH0E 1XB9A 2BU9A 4XQ4A 1NXD1 2PHWA 1QWRA 3N35A 2C9AA 4MO3M 3MF6A 4A41A 5FK7A 2ZABA 2WNOA 3WOGA 4L97A 1RUD3 2JG9A 2BGPA 2ZEYA 3KWVA 3MIHA 4I01A 5FJHA 2JDZA 1X8EA 4AVSA 1RHI3 3IZOA 2BEOA 2V72A 5DABA 3MV01 2AEZA 5FZ4A 2C0ZA 5K4LA 1HRI3 1Y9GA 3U4SA 1W8TA 2Q8OA 1C1LA 1UMIA 4YM2A 4QGMA 3U4XA 2XBO3 4Y1ZA 1AR93 2XGXA 4ASMB 3FBMA 4UOJA 5HXVA 3THTA 4YARA 1W9WA 4PF5A 4LKSA 1IPSA 3S57A 1JXNA 4M3CF 5FZ0A 1MEC3 4KH9A 4AI9A 3J26N 4LIVA 3VHPA 4XFAA 2GP5A 4EWEA 4J6GA 4NAMA 5A3PA 1RUJ2 2VJXA 2BDRA 3MW4A 1OOPB 5A3UA 1FMD3 2A1XA 3I7DA 4L99A 3OBRA 5C8WA 4YZ3A 3ZN6A 1H1IA 1HN0A 3GJAA 1AUYA 1QJY1 2JDUA 3SITA 3AFKA 1ZM1A 5F8PA 1D0HA 1PM7A 4Q0UA 5BXXA 3H0OA 5LA2A 2VO5A 5LRSA 5ACA3 1W90A 2WNVC 4OMCA 1BVP1 1BEV2 4Q4W3 2WKKA 5FYMA 3LA7A 3WF0A 4I2OA 4HOOA 4D0QA 5IVJA 5F5AA 5A6XA 4QKBA 4RHV1 4AEKA 3GYDA 4B7KA 1D4M3 1HB4A 4FFHA 4XTMA 5C3RA 1RUH2 2V4VA 3E6DA 4KL1A 2PAKA 3ZYPA 3WNXA 4XABA 1F15A 2WYFA 1WBLA 1SCSA 2L9LA 5I0UA 4LNVA 2EVXA 4U36A 5EYXA 1WMDA 4OLLA 3CQOA 1LODA 1ZVFA 1CIWA 4PQQA 4XC9A 5IVFA 1T2XA 3POSA 2J1SA 3I3QA 5FREA 4YW1A 2A75A 4HMZA 1PO22 4MGQA 4WM7B 5DUVA 3RJ2X 3TNQA 4FTSA 4L8QA 3ZMOA 2R30A 2ZEZA 4CCOA 5A33B 1A3KA 1ODMA 1GNYA 1YLLA 4I3GA 4FOWA 3FUOA 2OX0A 3GBWA 5FMDA 1OA4A 1PZ7A 1KFUL 3MPBA 4CDUC 5CISA 4LMFA 5ISLA 2VOWA 4CDXB 4LORA 3MW3A 1FOD1 2DURA 3K77A 3S5AA 3O7OA 4HPKA 1DCSA 1X36A 4H55A 3KV9A 3AZVA 2YBSA 1AR81 4KG0A 4N7IA 1CPMA 1WCQA 1R093 3IN9A 1UY3A 1IS5A 2WFF1 1J1TA 4B1MA 4BZ4A 3JBG2 3SXWA 4MGYE 4HLTA 4P9JA 2I2SA 1E5HA 1CAVB 1DYPA 2PLV3 1NKGA 4JRAA 3RG0A 1PNFA 3ZXJA 4AYUA 1RXFA 4Y22A 1EAH1 1LOGA 2RS51 4BDVB 4LITA 4Y20B 2RS11 2QQKA 2XQRA 5DQ0A 4EYUA 1EV12 4S2HA 1F9KA 1NX9A 3VV1A 4KMQA 1DQ1A 1TZOA 1A78A 3PL0A 4CUBA 5JXGA 1REDA 1XC6A 3CNAA 4EV0A 4XJ9A 2O14A 1O4ZA 4QDSA 5IK7A 1PMIA 1XU2A 1H6XA 4H3WA 3KMHA 3PHMA 3IIIA 2XDVA 3D5OA 3LOIA 5FZFA 2FDKA 1EY2A 4GWIA 1UZ0A 4CDQA 5J09A 2GC2A 5BNNA 2XXZA 4NHYA 3BTZA 1VBA2 4UXAA 5LRRA 4Z2AA 1YIFA 1HJFA 1Q8SA 1NQDA 1OHFA 1JZ5A 2XJQA 2JG8A 2HWE1 1QJFA 2E6VA 2XVKA 5EP9A 3TN93 2OVUA 3C2UA 4ZU4A 2WNEA 2ADEA 5JZGC 1ULFA 3J7LA 3ZYIB 1HX6A 1W6NA 2GALA 2MHFA 3BODA 4EWDA 3T2QA 1S0BA 2JB8A 3FFZA 1DQ6A 3ILRA 4BM8A 4C0HA 5LA1A 4JHTA 1UWWA 1W6MB 1XSRA 1LENA 2X5IA 4JTNA 2VTXJ 4Y5TA 1POV0 4GA9A 4DEVA 4E4DX 3OOXA 3HEIA 1CD3G 4W8JA 1LGBA 1YQ2A 3B3QE 4BQWA 1XNKA 2Y0OA 5FPVA 5J37A 2WYSA 1NCRA 3WQ1A 1FPN1 2XLGA 5JXHA 5C8CC 1NT0A 4YVWC 2XJPA 4CTEA 3HNMA 4NVPA 4OMDA 3BGAA 1O3RA 3GM8A 4RFRB 1YO8A 4YW7A 2P37A 4CYDA 1O4YA 3WX5A 5K9YA 4C1XA 4JKLA 3P5BA 2FDIA 4HZFA 4TXWA 3LSDA 3TEWA 3WQ0A 1OI6A 1UIKA 2EALA 4UFJA 2O0OA 1UOJA 4P9YA 1H8TA 2P6CA 5A6ZA 3T08A 2P3JA 3KT7A 3NJZA 5FMBA 4BISA 1PMJX 3MICA 4DUVA 3O1VA 4OFGA 2EIEA 1EP0A 3LIHA 5T5JA 1ND3C 1U0AA 1U12A 1RUD2 2DCZA 3I2GA 1UN1A 2LRPA 1RB8G 1YEWA 5FYUA 1RHI2 2KR2A 4YYOA 3VB9A 1D4VB 1QGLA 1U5YA 1UOGA 3CMGA 4FXGB 1HRI2 5FBZA 1BQPA 3ZSEA 2WO7A 2VPVA 4RGKA 4GJYA 1SBFA 2W1UA 3RNSA 4LO6B 2WO3A 4WM7C 1MPXA 2XBO2 2C6SA 3H9AA 4RQPB 3DL3A 3MBWA 1RUOA 4Q0QA 3UGGA 3CJIB 4GULA 1CPNA 3ASIA 3RYPA 4AQ6A 5KXDA 2ORXA 3T2TA 2HWB1 3SEPA 4ZKTB 1MEC2 4GB31 1UU6A 3WT3A 4ZZ8A 1QXJA 5I0RA 2HWF1 1FMD2 4K7JA 4YZ4A 4FTBA 2B46X 1J3PA 4AL9A 3UKVA 3O0WA 3NJVA 3VLBB 1UY4A 4BJ0A 4GD4A 1R1A1 1SBEA 3KV5A 5FZOB 4BQ2A 4WVZA 3RS6A 4FPHA 2A7AA 2YGMA 2FHRA 5LY1A 5GKAC 4FPEA 4BIOA 5ACA2 2Q1ZB 2ARCA 2BERA 2Y6GA 3I49A 4Q4W2 1X7NA 1UMHA 5L7OC 2HH9A 2OPWA 5C9AC 4YW4A 3T4HB 1OA2A 1O4TA 1W0OA 3ZXEA 1TE1B 4IEQA 4OUEA 1O3QA 4O61A 3S7EA 4FPCA 1HRV3 1RVF3 2WS91 4LULA 3MDPA 2P3KA 3ZR5A 3V65A 4TSVA 1A34A 2A70A 3P1IA 2CDOA 2DF7A 3HVDA 1FNZA 5JMCA 1WCKA 2WJSA 1UPSA 3WD5A 4XJ8A 3LB9A 5KXBA 1O59A 3L9JT 4AVTA 5FYIA 2R7EB 3KLSA 5SV5A 5IHRA 1W8NA 3J7HA 4FAHA 5FLHA 3CEWA 1ZA4A 1ENSA 2QDRA 2W95A 2OZ6A 3LAGA 1RXGA 4FQ4A 1AXKA 3A21A 1EUUA 3RZJA 2VW0A 4PIXA 2C1FA 2GZWA 2JDAA 3RGBA 2VMCA 2XL9A 4GWMA 3VHRA 1PM4A 5J98B 1JU4A 2YU1A 1I5ZA 3E97A 5F3CA 2E7TA 3AP6A 3T30A 1AX1A 2FMDA 4DXTA 4TN7A 5FP4A 4EN6B 1V6NA 1ZZBA 2HWB3 1L7QA 1P8JA 2G19A 4O9EA 4EWAA 3VL9A 1OVSA 5JSPA 4IEPA 4CRQA 1GZWA 4KBZA 2A3YA 4AR2A 4CDWC 4D8MA 1R092 2W08A 3IDAA 2A6ZA 4IDZA 4QHZA 2CL2A 4B4RA 3KM5A 1QJY2 2HWD3 4JGZC 1AR63 1S1AA 3AZZA 4XBNA 3WY6A 2VMFA 3RZGA 4P9GA 3F95A 1IOAA 4Q4X3 1Y7BA 4LHKA 5EJZB 3NO8A 4BQ5A 2HLEA 5JMOA 4P9XA 4R9BA 5FXVA 1W6PA 5DZFA 5DZGA 3AYAA 1BBT3 1X9PA 5HCHA 3ZN6B 3P3NA 4CDUA 1ZBE3 2RS31 2ES3A 1W8HA 4XBQA 4QXBA 3RFRA 5J7MA 1OVPA 1YQCA 1SCRA 2YG0A 3SH4A 2GDFA 3MIEA 4OUMA 4C1WA 3OF1A 5ABJA 1ZA7A 1MS0A 1ZREA 4RR3C 1QF3A 3LWCA 2D93A 1J3QA 1J3RA 1J58A 2PAEA 3OD0A 4JGYC 5HV0A 1V00A 5LBEA 4CPBD 4LA2A 4A7YA 4UW5A 1JYTA 1AX2A 1H4HA 5LA0A 3TN92 4XJZA 3ZXLA 4D69A 3OUHA 2J1EA 1LESA 5D21A 1GSLA 4FOYA 5FY9A 1SPPB 2GAUA 3IPVA 5C71A 5KHIA 3DV8A 2QFEA 3N36A 1GR3A 2R041 1SQ4A 3WW3A 5L9BA 5CFCA 3CJIC 2VOKA 4RA0A 2RDNA 1DYOA 2DUPA 4COVA 1GP6A 2W94A 3AYCA 4JCKA 4S2GA 4FPFA 3WLUA 1SLAA 2Y8KA 3O1PA 4INDA 3M3EA 4OZOA 1WLWA 4GALA 4WM8C 5IK8A 3WEZA 2VQ0A 1DLCA 5FZBA 4AGRA 2A3XA 2Y38A 1LOFC 5IK5A 4UFIA 2AR6A 2C26A 4LJHA 4Y33A 2WFF2 1AL21 3AJYA 2ET1A 3HNYM 3J8F1 2FDJA 5A3OA 4AGGA 5BNOB 2ZCWA 1TQ5A 4HFSA 4NMIA 3RZLA 2RMU1 1W05A 4QKFA 3JQWA 3ZFEA 5A1FA 4CP9A 2BQPA 2E51A 2YY1A 1W2NA 1XYNA 3NJYA 4KU7A 4RN5A 2MNGA 3CKHA 4XUTA 5JZGA 3E5XA 2WQ8A 3LFMA 3URFA 5A32A 4JQRA 1HXS3 3V0BB 1SBDA 2GC3A 5IYYA 3L2HA 4XFCA 3B9IA 1O5LA 2B4KA 5JLVA 1T6BX 3NKTA 3T2OA 4GWNA 4Y22B 2R6QA 5AFEA 1SMVA 2ZMNA 2QQUA 2KXLA 4MG2A 2PYTA 2XQXA 3N7KA 4BQ3A 3QBQA 1GOHA 1STMA 4AVCA 2TEPA 5C8CA 2DUQA 2P5BA 4YVWA 3D3AA 3K4DA 4E9KA 2NQYA 4GQ7A 1X82A 4FP2A 2JICA 4I3PA 4XXAA 5FZIA 2RG4A 4Q4V1 4OQ9A 3HQUA 4NOTA 2ETEA 2H6CA 5CFDB 2VNOA 4NIGA 1XNBA 4YW6A 5FTTC 4A6OA 3AP7A 4P9IA 1C3HA 3KB5A 3T0AA 1CWPA 2C4XA 2V5DA 5BNNB 3BUCA 1X33A 2QVSB 3OJBA 3ACIA 3EQEA 3N7MA 2W1SA 1VE0A 4ZY9A 4P14A 5IT6A 1HIXA 2Q1FA 2WAAA 1U5XA 5E6HA 2JG8B 3SEEA 3BTAA 4KU8A 1ND3A 3ZPOA 2ZGPA 1ENXA 3NSTA 3EJKA 1VBE3 2W47A 1SHWB 2QTWB 4LBLA 4A44A 2SBAA 4IEUA 3Q8CA 2VZPA 5I8SA 1OBNA 5FZCA 2X5IB 1J1LA 5C4WB 1AXYA 4QB1A 4WM7A 1ZZ7A 1TME1 1OQ1A 1YQ6A 5A33A 1RUI1 2YYOA 3BVCA 4XE9A 3T1MA 4DQAA 2OUJA 2Q0AA 2WIIB 2JXAA 2OS2A 1HRV2 2GN7A 1RVF2 3VKMA 3ZXDA 3EMRA 1OKOA 1NCRB 3UGFA 1DQ2A 2H0BA 4AHYA 4LQRA 4C91A 3KF3A 1UOBA 4ISRA 3VDDB 1W3VA 2ZMKA 3ACFA 4XAAA 3PUQA 2DYCA 2DWRA 4WZFA 5A80A 3IMNA 2W92A 4A45A 1A8MA 2D6LX 2JE9A 3DYMA 3LIGA 4M3CE 4URTA 3WF4A 3ZSLA 3SQOA 3BPZA 3W21A 5J36A 1OF3A 2ZACA 1CAVA 4V2VA 2YU2A 4YM0A 1C8NA 2A6YA 5L7OA 1DGWA 1H8TB 1UCXA 5C9AA 1FAYA 3HT2A 4DMIA 2OIIA 4Q4V3 4AEJA 5SV8A 5FZ9A 2W46A 1DQ4A 4QAWA 3GZEA 5KC5A 5FR3A 4AQSA 3MUZ1 1GV9A 3VHOA 1JOJA 1LB2A 2BPA2 3POWA 1AHSA 3ACLA 4E2GA 3WCSA 1G9BA 1PGW1 4RS5C 3TEXA 2HWB2 4BE3A 1BK0A 2VE1A 4Z07A 5IFPA 2WINB 5GZCA 2ZX1A 4PQ9A 3AC0A 4OI2A 1ULEA 3WQBA 4K1YA 3EXUA 4JC1A 2D6KA 5A7QA 3FX3A 3HQXA 5FZLA 2HWD2 2XMLA 2W9XA 1GU3A 1Q5OA 3LPFA 4E4HA 1YNAA 5BNOC 2R1DA 4QD2A 4HSLA 1O3TA 3IDCB 1L7RA 2VMHA 3AKSA 1BBT2 3T0BA 2UY8A 3JB8A 4YFWA 1ZBE2 2R0FA 2J22A 3GF6A 3WNNA 3CLPA 3A0KA 4QB6A 2HYKA 4OVEA 3RZHA 3N9NA 1GQGA 5FKBA 1WD4A 4PLOA 4UWDA 3U75A 3VZNA 4CDWA 2YFUA 3CBNA 1JYNA 3VBOC 1FATA 5EIYB 1SFPA 2GC1A 1UY1A 3OBTA 4ES9A 5ABJC 1YFUA 2UYAA 1RUF1 2NM1A 4JGZA 4AFMA 4AE2A 5CNAA 3A4UA 4EJRA 4M01A 5E88A 3ELNA 3ZPYA 3U1XA 2GNMA 4HANA 2RJLA 4MGIE 3H7JA 2RR13 2ZGSA 1JODA 4NPRA 2WO2A 4I0WB 4QQLA 2CAVA 2WQ4A 3KVBA 2UWBA 5DN2A 2QE3A 4Q1RA 3FLTA 5CFDC 2CTVA 2TUNA 2Z42A 1UNBA 3CHXA 4XUPA 1DBNA 5CEHA 3R05A 2R071 2ZPXA 1E5IA 1XPWA 4RR3A 3W5MA 3ABZA 4ORFA 4JGYA 4SBVA 1ULCA 2DU0A 3ZDSA 2VBBA 2ZKNA 1OQDA 1OQEA 2C9KA 3WCRA 1WCSA 5CVRA 4ZS2A 1LHWA 4ATEA 2D3SA 3QCWA 2O8QA 4MHRA 1JZ2A 1RINA 3GALA 4EZHA 5F1RA 2HWC1 5F7UA 5A6YA 3ZKYA 3E1F1 3ZXKA 4YW5A 1SEFA 5C4WC 2JENA 4QPIB 2ZGMA 1CJDA 5D1IA 1OUXA 3FUQA 3LA2A 3CJIA 4CXYA 4MZUA 1EPZA 2DVAA 4JQTA 3LKJA 4LA3A 1H1AA 2BP6A 2RS32 4ES8A 1NCRC 1NOVA 4CEWC 3DKQA 3LA3A 4WM8A 1G9AA 2VC9A 3PTRB 4MOAA 3GZAA 3VZLA 5C3QA 4Y26A 2X09A 2ZS6B 2PHTA 3VDDC 3WV6A 3CZUA 3ZYHA 1LOFA 1ENQA 1POQA 2PQSA 4TTGA 2UU8A 4QPYA 3BPSA 3MI8A 4XETA 4MGTA 1S0DA 4MSVA 1GFF2 5DG2A 2JX9A 3TAYA 3WINE 1YJLA 4YVSC 1W3XA 3OBZA 4LBOA 3OD4A 1COV1 3QOPA 4AXOA 2ZAHA 1MZEA 3JZVA 2VNRA 3HNBM 4CU6A 3PMEA 5ABJB 4ZHNA 2IVIB 3AYEA 5ANNA 3SISA 5BUVA 3TBDA 4DY5A 1VBC1 2BWCA 3PJYA 3BIWE 3HOBA 5H9SA 4XUNA 1UY2A 2R042 4M4PA 2K46A 4K21A 1GP5A 1JBCA 1LR5A 1ZBA3 4DFSA 2D5FA 4A3ZA 4DRVA 2TNFA 2QQPA 2Q1MA 4N8MA 1EUTA 4P9WA 4QM8A 2VXRA 1EPWA 5DAVA 4AQ2A 2OXBA 1VB4A 4KGQA 2V73A 5I0TA 2FCTA 3IPVB 1VBE2 2VUDA 3INAA 3VDBA 2VBDA 3DYOA 2DFCA 4UFLA 4XYXA 5F39A 2PHUA 1AL22 4R9CA 4AG4A 5CFCB 3LDBA 1M4WA 5EJ3A 2V5YA 5HPOA 4FSJA 4XF0A 5FZKA 4GZ9A 2HWC3 3FLRA 4META 5F3EA 5J3UA 1GNZA 3DKWA 5DAPA 4Y3OA 1W39A 4LR4A 2Q4SA 3AMQA 4XFIA 3PVNA 1ODNA 2VCBA 5FYTA 1JZ7A 2VTXA 4HL0A 4Z82A 5GALA 2VQTA 3ME2A 3WR0A 2ZX0A 1GWLA 4Q2FA 5ERLA 5FYBA 3C3VA 2BFUL 5JPNB 3ON7A 3H1WA 3KCXA 5CKMA 3FLPA 1XU1A 4HONA 4UYBA 1UU5A 4CP9B 3WF3A 5JZGB 2K0GA 1HKDA 2A6VA 4CUAA 3SNMA 5D2AA 5A32B 4H2AA 3UNPA 2E31A 1WLTA 1LU2A 3NJXA 3FL7A 3W58A 4BU2A 3PTYA 5BNQA 2D5HA 4KWLA 4LHNA 4D7YA 1COV3 1NCQB 1N3QA 4Q4V2 4NRQA 1LKNA 5J48A 1RL3A 4HVOA 2RDSA 1VBB3 1A6CA 4NR1A 1WA6X 5CKNA 3ZKUA 1AXZA 1OH4A 4LO8A 5T5OA 1LECA 4CCDA 1AR73 5C8CB 3OUIA 4YVWB 1TEIA 2HYXA 3E5QA 2A3WA 2RHPA 1UKRA 4B3NA 1JHJA 5J96B 5KWRA 1OPMA 4NIIA 4GH4C 2A5ZA 4UFKA 2LROA 5EWSA 3UJQA 3M3QA 1HJGA 4DXSA 1C8M1 1UXZA 2IVJA 4E27A 1DZTA 1V6KA 4URAA 2EAKA 3M70A 4BCUA 2JDNA 4NHLA 2PHLA 2R16A 5AFBA 4K8RB 3ORJA 5FMOS 4EROA 1LRHA 1RIRA 5CB7A 2FBEA 3JD71 3F2ZA 4B7EA 2MEV1 1XNCA 5FZAA 1ND3B 1SPPA 4JDOA 5FPXA 4OUSA 1JZ6A 1C57A 4IEZA 4RS5A 4QPIC 1QJU1 2D6OX 3PNAA 3MHZA 4HBNA 4PIZA 1JMUB 3EYPA 3AP9A 3N9LA 3OEBA 5F5CA 4R8HA 4X6RB 1BZWA 4O65A 4ASLA 3ZO0B 2WL1A 1Q3EA 4GKXA 5IVVA 1LTEA 3POJA 4JTOA 1N3OA 1CX4A 3H50A 2RM21 1SLLA 2P2KA 1DG6A 1KITA 2UWCA 4QX7A 2WC2A 4WZCA 5BNOA 4JVAA 1LOCA 3C7FA 2BWAA 2RR12 1DZRA 3UKTA 3W9AA 3ZYBA 4XF9A 3ST7A 1SDWA 3I59A 2ZZJA 1UIJA 1UU4A 3B7MA 3KCYA 1YFYA 2OYZA 3B9CA 5IVCA 2ARBA 2JDHA 1Q8QA 3BCWA 1JHNA 2VR4A 3V0BA 3BN6A 1QJX1 3N7LA 1OUSA 1S2BA 4UW4A 1QJY3 3B00A 4NWVA 2VZ1A 2D3RA 5L7OB 4MXVA 1ZRIA 5C9AB 3VBOA 3TB0A 4YNIA 3WNMA 1S0IA 4LK7A 2ZGLA 5HCAA 2Y0IA 3POYA 5FY5A 1NY72 1ZRRA 2ZHNA 3WHUA 3WP6A 3AP4A 4AF9A 1JYWA 4COZA 3AMNA 2UURA 4RHV3 1RUG1 3AB0A 4C0BA 5CFCC 4CXWA 1H8VA 1GLHA 4IEWA 4W6WA 5A3WA 4CU7A 3D6EA 2MEV3 5CFDA 3O0XA 4MVTA 4AI3A 1CAWA 1N1SA 4YM1A 1W8ZA 3KSCA 1PGSA 1VMFA 1DQ5A 5FPLA 3RMXA 4B4QA 1K42A 1QJU3 1IS4A 4GIQA 3WDTA 1CONA 5I0SA 3VD7A 1YC61 4IEYA 3WW4A 3KCCA 5IUQA 1J59A 5EZWA 3AM2A 4OQ8A 5L19A 5FPUA 2P17A 2E9QA 3JXSA 1MZFA 2GNDA 3BOPA 1NUKA 2E7AA 1C5HA 5FUIA 3VZKA 5C4WA 4R9DA 4JV4A 4CDWB 5KXCA 1NCQC 2GP3A 3NV1A 2WRAA 2CDPA 1YYNA 4BYYA 1FOD3 5FPBA 4JGZB 4IW3A 1AR83 5FY0A 1Y3TA 3VBRC 2CWMA 3VN4A 1CESA 1ZBA2 4CEWA 2WFF3 5IAVA 5FYSA 3C7EA 3MLJA 1QJX3 3WNPA 4DO0A 3PLQA 2VY0A 4XJAA 4OZXA 3LEGA 2HEYF 4BPZA 3VDDA 2UYBA 3PMSA 5C3PA 3V0AB 5L36A 4IGPA 2GU9A 4D6RA 5B2GB 3FFQA 1EAH3 2AC1A 2RS53 2XG3A 4I02A 2ZXQA 1IS6A 1US3A 2VGDA 2E32A 4IQPA 4NRMA 4YVSA 2RS13 1JI6A 2BVBA 3LF7A 4OI0A 3NL1A 2LALA 4UT5A 2I07B 2P4EA 1BVVA 1RUC1 1YCIA 3MF9A 2FD8A 4WBBA 5LBBA 2PMWB 2QQNA 4NPMA 3IDEA 3NV3A 4RR3B 4G9SB 2R32A 2Y64A 2HWC2 1XNTA 4JGYB 4QQOA 5FXXA 5IWFA 3ZLIA 3WF2A 4Z2WA 4Q8KA 4CXXA 1D2SA 5FO8B 3GXUA 1F5FA 4PI2A 5FY8A 3O1TA 2NP0A 1WBFA 3WDUA 2E33A 2DVBA 2OZJA 2IFWA 5FYCA 2YMZA 1QQP1 3VKLA 1TMF1 2JWPA 1JYXA 4WVVA 1ZZ8A 1SACA 3NWKA 2HWE3 3CJXA 3AYDA 3FZ3A 4XVHA 1CGPA 3NNJA 4QPGC 2FCVA 2HBTA 4XMIA 3WSOA 2JE8A 1W2AX 4F83A 3CU7A 5FXZA 2VTFA 2WQZC 4AZZA 2VW2A 1COV2 4XZPA 1UYPA 2XUMA 4WM8B 2VQAA 1VRH1 2EAAA 3H7YA 3I4IA 4NRPA 2NPIA 1VBB2 1DLLA 4ISQA 5IATA 4QU2A 4Z92B 1AR72 1UO9A 4QQ2A 3AKRA 4FFGA 4WV8A 2BRTA 2E53A 4XZUG 5CADA 1IKPA 1FPN3 2BNOA 2KM2A 4XFBA 4OULA 3LPGA 5F3IA 5JPMB 1YFXA 2BBVA 1QU0A 1ASJ1 2YV8A 2QDNA 2VCCA 1KGYA 4I0AA 3WG4A 5IVEA 5JVVA 5FYYA 5IFTA 2DCKA 2QJVA 3B69A 5APAA 4JKMA 3O1RA 1PGL1 1XNDA 2AYHA 1Q8VA 1SLTA 3OG2A 4GXLA 1KS4A 1CZVA 1D7PM 3PURA 4F8AA 2YC0A 3WQ7A 3FJSA 4QPWA 1KFXL 1FT9A 1FXZA 5F5QA 5M0TA 4C90A 1UPIA 3UGHA 1RUC3 2VECA 4LKDA 1NYWA 4ONUA 1WMEA 3J7NA 4E8DA 1OA3A 4DB5A 3RZKA 2ZHMA 4NWWA 1IQAA 4QX0A 1H4GA 4XCBA 1W06A 4HN1A 2ZBJA 5FBJA 2FDHA 1H9WA 4GH4A 4AAXA 3ZFFB 4QX3A 4MLOA 4UI9L 1URXA 1OPOA 2JJ6A 3M1HA 3ZR6A 5DDJ1 2XWJB 4CVUA 3GHMA 5EHDA 3K3NA 3AL5A 3WNKA 3S6PA 4QHBA 4L0PA 5FZGA 1LOBA 5LA9A 1QNWA 3LOBA 2QCSB 3KZ4C 5EQUA 2GMMA 3PU3A 3TEYA 3D0JA 3NAPB 4PT6A 2XPJA 3MLKA 4GB33 4AGVA 3AMMA 1BXHA 1JU3A 1VRH3 5LK5A 4BXSV 1S0FA 2HWF3 3U78A 1RUE1 1YUDA 3THCA 1PX4A 4QPIA 2J42A 2LW8A 2WNUC 5CAZA 3I54A 4IV3B 4CE8A 4D94A 1VB2A 1L7LA 1R1A3 2NZ9A 3NRUA 4AK3A 4EN9B 1WW5A 4XFFA 2Q8CA 4CEYC 1POV1 1MS9A 4FPGA 1QJEA 3LQCA 3HN1A 4Q4Y1 2QZ3A 4NIDA 2YHJA 3ZSKA 4LK6A 4XUOA 4OI1A 2CWSA 5H9RA 1LOAA 5JSRA 2A6XA 1C8M2 1YI7A 4GMP0 2G4IA 4IGQA 4FTEA 2ZGNA 1NA1B 4RHV2 1O8PA 3AMHA 3IT8A 2W52A 4E4ZA 3RJRA 5CKQA 2WS93 5FK8A 1PZ9A 2XR4A 2K2SA 5E16A 1XQNA 3CZJA 1FYUA 2MEV2 3N9OA 3NNFA 4IE0A 3ZXAC 1PHMA 1AF9A 1RTVA 4KWJA 4JRLA 4FT8A 3VGIA 4HKOA 2XJUA 1YIPA 2VZVA 1QJU2 3G7DA 5JI9A 2WZR1 2D43A 3D82A 1AJKA 2IUWA 3OGVA 2VZOA 5A7PA 2YXSA 1IQDC 1O3SA 4FFIA 3PJQA 3TOJA 4XDOA 3FHAA 3IAQA 4YLZA 5LW9A 5FO7B 3U07A 2O8OA 1RUNA 4ARYA 4XUQA 3POEA 3MIGA 1BKZA 5CU1A 4RS5B 4RFT0 1K5JA 5LZ6A 5JXIA 3U37A 4AFAA 1PO11 4ZPIA 1LU1A 1UMZA 4KWKA 3VKNA 3HD8B 5LBCA 3ROUA 4LBQA 1O7FA 2VZRA 1SLIA 4A7KA 2I45A 2VD7A 3GDBA 3VD4A 2WLPA 1FOD2 5DAXA 3D0SA 1UOFA 2DCJA 1E57A 2PHFA 5JOWA 4X8PA 1AR82 2XWBB 3H3UA 1H9PA 4LO7A 4CP0A 3FHIB 1FX5A 1QJX2 2YB7A 3MFAA 4IE6A 1XBFA 4FOVA 4BMEA 3ZFFC 2RDQA 2XL7A 2ZGTA 3I59B 1POV3 1KJLA 2NMNA 1L3JA 2GN3A 1EAH2 2PQQA 2RS52 4Q4Y3 1W28A 5GJ6A 3R0RA 3GBGA 3UK9A 2RS12 1IPKA 4YZ2A 5GM0A 1ZRCA 4IESA 2EIBA 2QBXA 3VHNA 1F4HA 1RUG2 2RS33 3GZTB 5BY5A 1NCQA 3IBMA 1PK6B 3VBOB 1APNA 1UX7A 4AW7A 5C70A 4TLGA 3UL2A 1F35A 4LXLA 5LWBA 2IZWA 4FXKB 3VBRA 1YJKA 1OC1A 4Q8LA 2Y6FA 3WNOA 3KT4A 4YWAA 3UT0A 5DXDA 4EN0A 1CIYA 1JW6A 3IIAA 2VVEA 4RD7A 1VIWB 5KXEA 5T5PA 4A2UA 2HWE2 3VD5A 2XUEA 2ID4A 4EN8B 3GBFA 4HETA 2ZGOA 4PJYA 2WO1A 4AVBA 2DFBA 1HB1A 4IXLA 1UF2C 1CAWB 2IXJA 4OCTA 5TSWA 3FE5A 2BNMA 2R043 4ITCA 2EIDA 2G9GA 3M8LA 1WCDJ 1Z7S1 1X8MA 3B01A 4K40A 1PO13 1ST8A 4ZS3A 5KC6A 4X8NA 2XVGA 3LEIA 4CCMA 5LK7B 3ITQA 1TNFA 2PHRA 3NAPC 3JCIA 4IERA 1W03A 1GYKA 2WABA 3FMGA 5FP8A 5LCWL 2FZ1A 5JIAA 5HCFA 4J1WA 1X50A 2R1BA 4QQPA 3T4VA 2I74A 1DYKA 4K1ZA 1FPN2 3VBUC 3W5NA 1AL23 3J8F3 4IV3C 1RUJ1 5GLTA 2XVLA 2FDFA 2ZMLA 4X6QB 3RZZA 3RQ0A 2VOVA 1PZ8A 1LHOA 2WWJA 3UYJA 4DS0A 3U0ZA 4YW3A 4IL7A 4RGGA 1GZCA 2RMU3 5FZ8A 1MQTC 1ENRA 2ZKLA 2GH8A 3GCXA 3I3DA 3LDKA 4QPGA 1N1TA 5DUXA 5FZ3A 3ZIXA 1HW5A 2CU5A 2P3IA 3FBYA 1AYN1 2VZSA 3IM0A 4CEWB 1JZ4A 3WVJA 2OA2A 1GUIA 1HLCA 1NA1C 1OSGA 1RUC2 3IB3A 2B9UA 1MZ5A 5A3NA 2O1QA 4IEVA 4K20A 5IW0A 4CPBA 4FPJA 2PHDA 2P3YA 1CQ9A 2IC1A 5H9QA 1QIQA 2NYYA 1VPHA 3MIDA 1LOEA 1GKBA 4NAOA 1RUH1 4YVSB 4BH9A 1DF0A 1ZNPA 2B5HA 2ZHKA 3WNLA 5LB6A 2W91A 4JDNA 1TMF2 3R4SA 4KQ7A 4Q29A 3U10A 3KGLA 2LTNA 3O5SA 2WUHA 3MPPG 2Z79A 4R4XA 4DZGA 2W2IA 2VULA 3J9SA 1LGCA 1OLME 2QQWA 3I3BA 1PO21 3OPZA 4L11A 1ULDA 1LHVA 4IE4A 4R9AA 2VXJA 3I2JA 5BV6A 1VALA 2ZX4A 2D98A 3H1MA 5AVAA 3ZN5A 1Z7S3 4GB32 1LCLA 1VRH2 4DUXA 4XF4A 3H8UA 2HWF2 3M4FA 3MLLA 2G9FA 4LE3A 2ZA9A 1YI9A 3S7IA 4AI0A 5DAWA 2W39A 3G6JB 4KNCA 4XACA 1IZ3A 4BXFA 3N9MA 1Q8PA 1R1A2 2BV4A 4LBMA 1RITA 1K5MB 3M3CA 5FUNA 3T2PA 4BMBA 3BI3A 4HKLA 3ZYFA 2H6BA 2VZTA 3B02A 4HK9A 4Y1XA 4CCCA 1V6JA 1BLZA 2VNGA 2AENA 3FC0A 3JBG1 1OLQA 1X9TA 1YHFA 3SCHA 3ZSJA 1W0NA 4LLOA 1PGL2 1TME3 4YG3A 2CY6A 1RUI3 4XOGA 4YZ5A 2CSGA 1W8WA 2ARXA 2WS92 5D8AB 2P34A 2OQ6A 3ZFEB 1DHKB 4IV1B 2WN2A 1W8OA 3WDYA 4LBNA 4OYUA 1EV11 3NV2A 4KI5M 4LUKA 3POGA 4Q27A 1PK6C 4QGNA 5LBFA 2WNUA 1V6MA 2PAMA 4HG6B 1MZ6A 2RVAA 1JYCA 4DOUA 4FVVA 3T0DA 1VAMA 4CEYA 2YPDA 1LNSA 1WCUA 4W50A 3V0AA 2PTMA 2VZ3A 4H7MA 4RYDA 1GQPA 5DDJ2 1LJ7A 2VU9A 1TG7A 3I2HA 1DGRA 1VBA1 5FCCA 3MUY1 2B39A 2BBAA 1W9FA 5GLUA 2W1WA 1XYOA 1IG3A 2P1BA 3LZZA 4OHZA 1REFA 2JD4A 4PHZA 2AGSA 3H1YA 1E5SA 4G3YC 5BNPC 5JOYA 4GH4B 1VBD1 5CIRA 3DN7A 5A7NA 2OT7A 3SCGA 3ACHA 3POIA 1KD7A 1S4CA 2VMGA 4Q26A 5DAQA 4QXCA 1VJ2A 1GANA 4YG0A 2XOMA 3VZMA 2F4PA 3P6BA 3RWKX 2ZX2A 1VAKA 3DXUA 1A8DA 4K6BA 4Y5SA 3UKNA 2Y26A 4PBOA 5JIUA 4Q4Y2 5A7WA 1NE6A 3N4MA 3RZMA 5K8SA 3IMMA 4WVWA 3MEPA 3AX4A 3R4UA 1HV0A 4AI8A 2DV9A 1DQ0A 1GNHA 1RJ7A 3OCPA 3V56A 4YM3A 1G9DA 5JAXA 1D2QA 3NW4A 5FYZA 1I3HA 1B35C 4QXHA 1ZYBA 1NQJA 1W9TA 4M3CA 1AX0A 4YG6A 5T55A 3WW1A 4XW3A 4W6YA 4XF3A 4M0NA 1OURA 4I09A 2SLIA 4AEDC 4OI4A 5A3TA 4Z8BA 3ZMNA 5AVPA 1RUF3 2BYVE 4NHKA 3VZJA 3ZFFA 4HVRA 3AL6A 4QDQA 5GLZA 1O91A 1KEXA 5C5TA 2WZ8A 1SLCA 2ZGQA 1RUD1 3PVOA 1D0GA 1Y9QA 5A1AA 1RHI1 2PHXA 4ARXA 3K51A 4OHXA 1HRI1 1OH3A 3GJBA 5F6KA 2CGPA 5BPXA 4Y5Z0 2XJSA 3BALA 1GBGA 1ACCA 1PO12 3C7OA 3AKQA 4QM9A 1K45A 2PXJA 3B94A 1LEDA 2B45X 2JE7A 1W6OA 2G9ZA 1AR91 4AAPA 1UD1A 2R073 4QKNA 4EN7B 4AQTA 3LCPA 4YGDA 4QDRA 3MFCA 3S30A 5FKCA 4CCKA 3HPNA 1MEC1 3PU8A 4BIFA 3PIJA 1UAIA 1NLSA 3ZFGC 3I97A 3PIGA 4XHBA 2D44A 3J8F2 2BVVA 3OGGA 5FP9A 5FY1A 1FMD1 4QKDA 5H9PA 5KHJA 1K5MC 2AREA 3AMPA 3O0VA 4FI9A 4LBQB 3RWNA 1PIV1 3A7QA 4PF1A 4AFDA 2RMU2 4B29A 1JUHA 4AI2A 3OPWA 4LOSA 4UFHA 2WZPP 5FIXA 1NAEA 1AZDA 3MGUA 5ACA1 1VMHA 1Y4WA 1AJOA 2ILMA 3A22A 3RPQA 4Q4W1 1S0GA 1GP4A 3PVBB 3W59A 3V64A 1H2MA 4MGKE 5FMOL 3CO2A 1BCXA 1CAUA 5T50A 3APBA 1H0BA 2XJTA 4BLJA 3NAPA 5D8AC 1XXNA 3T09A 1G9CA 3HR9A 3D4KA 3ZFEC 4IV1C 5FLJA 1D4M1 4NROA 4YGEA 3OY8A 3IKWA 3VBUA 3WF1A 4IV3A 3DCQA 2D6NA 2QQLA 2ADDA 4B8EA 1QOOA 5CG9A 4AHZA 1MQTA 4M0HA 3WXPA 3HJRA 4XHXA 5LEJA 2JB4A 3H8OA 2DTWA 4BOWA 2OUHA 5IJRA 5FZDA 3VBRB 3AJZA 2KD7A 4Q1PA 1VBC3 4MXWA 5HV4A 1NA1A 1ULPA 5A7SA 4QX8A 1ALYA 1S55A 3JQXA 3KVAA 3ZM8A 4AEMA 4COWA 1Z7S2 5CBLA 2B8MA 2XHNA 2VCAA 2XKOA 2WT1A 4XURA 1MS4A 3KQ4B 1H1MA 3SCFA 2H0VA 1OLRA 1B09A 3O14A 3Q8FA 3H3ZA 2E63A 3AKPA 1GWMA 2VM9A 4QX2A 1LHUA 5IVBA 2A6WA 1BHGA 2WT2A 3QACA 4PLMA 4JZRA 4TLFA 4SLIA 5E1RA 4AVAA 4FPYA 2DBIA 1BYHA 2WA4A 1REEA 1CJPA 1FI2A 1QEXA 1R091 2RJKA 2GNBA 4N9IA 4RGAA 5JWPA 3QLQA 3DXTA 2K9ZA 1PIV3 1KS5A 1TME2 3VBFC 2PLV1 1RUI2 1W6QA 1W2TA 1CAXA 1WD3A 2R061 2VUCA 3NNLA 5B4NA 5EJ1B 2W87A 4FCAA 3I2FA 3I8TA 1C28A 1OF4A 1AYN2 3K48A 4PDWC 3THDA 5JR2A 2BZDA 2VH9A 3DPRC 3SHRA 1MS1A 3OBAA 3OPTA 1KDKA 1HB3A 4MYEA 4AFCA 1Z0HA 2XKPA 2IWGB 4EZ4A 4QPGB 4XF1A 2QNKA 2W3JA 4V1PA 4NUBA 4GKYA 1SZBA 2BFUS 3BU7A 4O9GA 1H2NA 2BUKA 2DCTA 4TWTA 2DU1A 4LHLA 3RYKA 1HN1A 5FP3A 5A3MA 2D40A 3K2OA 1XE8A 4JKKA 5EFUA 4N43C 2YUEA 1ND2C 5K0UC 3NKGA 2C24A 1H30A 1ZZ6A 2D97A 1OD5A 3LEMA 4QT6A 3TN91 4P00B 1BMV1 4D3WA 2QQOA 1QJZA 2Y34A 1PGW2 3OYWB 1LHNA 3ZDVA 2ZZQA 3O1UA 1PK6A 3ZOIA 2F4LA 3BIEA 3WUCA 2GC0A 4O7XA 3H8RA 2LS6A 2D3PA 3ZYJB 2P6HA 3N9QA 1JYIA 1C8M3 1LULA 4MGZE 4IEXA 1W2UA 1F5JA 3FHQA 1OFNA 2WLQA 4PBPA 3TRSB 3VBHC 4P08A 5CYYA 3JD73 2HKXA 3DYPA 3ILNA 3ZXGA 5C6CA 4W4ZA 3DECA 1Q8OA 3TWIA 1T6GC 3WZ1A 1MR5A 2J1UA 2R063 2QQIA 2XB6C 5F6LB 2W5FA 4ZXKA 2Q8DA 5BNPA 3O1OA 1QDOA 4YZ1A 2VVFA 2X29A 3HN3A 2CGNA 2NLRA 3MYXA 4XAEA 1VR3A 2DDUA 4YRDA 4AFBA 4LTAA 2ZX3A 4LBKA 4BHPA 2ZTNA 4HK8A 5L73A 4CA9A 1JOBA 1XYPA 5DPNA 4LIUA 1RUF2 2RM23 3U14A 4E2QA 2Y60A 2BTVC 3LFIA 3A0NA 5EYYA 4YPJA 4DNYA 2R0HA 2DTYA 4MADA 1JUIA 2ZHLA 2JKXA 2YROA 3TEZA 2WNUB 3PUIA 2ZOEB 5FY4A 2CV6A 3HMYA 1HDKA 3Q8EA 3RDIA 5KHKA 5IK4A 2YC2A 3ACGA 4NO4A 5A6QA 4CEYB 5I0DA 1B35A 1ZRDA 2R072 1VBD2 4XTPA 3AVRA 4DRRA 1VRBA 1JH5A 5FDBA 1IG0A 3AZXA 4P9LA 4AEDA 4IETA 4AHXA 4DIQA 2GH2A 1O8SA 1SDDB 2E7QA 1W8FA 1UYXA 2OPKA 3KQRA 4CCEA 2VAUA 5ANQA 1ONAA 3ES1A 4CUGA 4PI0A 3DGTA 3LD8A 1I9RA 3IAPA 4AVVA 2VQUA 3ZN4A 4BQYA 5F37A 1RUG3 3AXDA 3CDZB 4LT5A 5FV3A 2OQ7A 2B7YA 2IXLA 4FPOB 1OOPC 3SKVA 3O1MA 1QMJA 4BK4A 2JD9A 1Q56A 3L2YA 3ATGA 4Y4RA 5L9VA 4Q0SA 3ALQA 1FV3A 1DU3D 4QGLA 4COYA 3D8CA 5FQ0A 2QUOA 5T52A 4AWDA 2CGOA 3K4AA 4Q0VA 1DDLA 2DUOA 4F7ZA 4QWNA 4NE9A 3VBSB 1HRV1 1RVF1 4J25A 5A7WB 2BW8A 2UWAA 1E5RA 2G1MA 3ZVXA 4Y1UA 2JECA 3ZFGA 2A73B 4BA6A 2WBKA 4N9HA 1K5MA 2GMPA 2EICA 5CG8A 1DFQA 3ENRA 4J1XA 2MPFA 4KBBA 3B5LB 1IS3A 3RVHA 4QB2A 4M3CB 3RRDA 3UV9A 4NIAA 1F2NA 3PVEA 3PUHA 2J1RA 3KD4A 5FRAA 1H2LA 1WW6A 4LBJA 1VBC2 3SKJE 4KGGA 3VDCA 2CAUA 2J7MA 2RE9A 5HBAA 4B4PA 1UXXX 1G6NA 1O6UA 2CNAA 4N7UA 4XILA 5D8AA 2PN5A 4ZU5A 1QXRA 2BJSA 5CZKA 3EO6A 3M3IA 4I0BA 4IV1A 2Q8EA 3I2KA 4N53B 4LLFA 4DXZA 2X53S 1AR92 3H42B 1IPJA 4OHWA 2HJIA 4ZONA 5FUPA 3OTFA 5AC91 3ES4A 1OFSA 1TVGA 1UZVA 1V9U1 2HEWF 1G9FA 2VG9A 4CUCA 1S2EA 1WMFA 2EXIA 2IXKA 5LY2A 3TNPB 4QQHA 2BOJA 2VBPA 1DGLA 5FPAA 1RGSA 4K8FA 4CDXC 3AK0A 2W0XA 1W6OB 1PIV2 3ZXFA 2HWD1 2AACA 2XLFA 1AR61 1H6YA 4LBQD 1R081 3NNGA 2AZ5A 2ET7A 3EHKA 4Q4X1 3VKFC 5EPAA 4JDMA 1YRZA 2OW4A 2Q30A 4Q5OA 1NXMA 1Q43A 4HSJA 3WDWA 4E8CA 1BBT1 2IXCA 1UQXA 1QQP3 1ZBE1 4DXRA 3VZOA 1TMF3 2XH6A 3WDVA 1D4M2 4NHXA 5K7PA 1W8UA 2Z5WA 3UETA 4MHUA 4BQXA 4YGCA 1TNRA 2D7FA 3GZUC 4FAGA 1CAUB 1PVC1 5FZMA 1ULOA 2B9VA 2YBPA 3I3EA 5KHHA 4L2NA 2JEMA 3VBFA 4QHOA 2WR9A 1PX3A 2VNVA 3AXEA 5FZ1A 1V0AA 5I8TA 3OY8B 1CX1A 1US2A 3BB6A 5F3GA
chains in the Genus database with same CATH topology
5A6YA 2JDYA 4CE8A 1OUXA 1GZTA 5A3OA 2JDPA 1W8FA 2BOIA 2BP6A 4AOCA 1UQXA 5A70A 4UT5A 1UZVA 2JDHA 5A6ZA 2JDUA 2VUCA 5HCHA 2BV4A 2BOJA 2WRAA 1OUSA 1W8HA 1OURA 2JDKA 2VUDA 1OVPA 1OVSA 1OXCA 2CHHA 3ZDVA 2JDMA 2XR4A 5A6QA 5D2AA 2WR9A 2JDNA 2VNVA 5A6XA 3DCQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A6Y A;  2JDY A;  4CE8 A;  1OUX A;  1GZT A;  5A3O A;  2JDP A;  1W8F A;  2BOI A;  2BP6 A;  4AOC A;  1UQX A;  5A70 A;  4UT5 A;  1UZV A;  2JDH A;  5A6Z A;  2JDU A;  2VUC A;  5HCH A;  2BV4 A;  2BOJ A;  2WRA A;  1OUS A;  1W8H A;  1OUR A;  2JDK A;  2VUD A;  1OVP A;  1OVS A;  1OXC A;  2CHH A;  3ZDV A;  2JDM A;  2XR4 A;  5A6Q A;  5D2A A;  2WR9 A;  2JDN A;  2VNV A;  5A6X A;  3DCQ A; 
#chains in the Genus database with same CATH topology
 2WNV A;  3OSD A;  3VBU B;  3NVC A;  4PDW A;  5C3O A;  5I8Y A;  2VME A;  1GZT A;  4IGO A;  3DPR A;  5FZH A;  1VLN A;  1WLC A;  1YFW A;  2Y6L A;  4D6Q A;  5F9T A;  1UYZ A;  2CYF A;  1XE0 A;  1S2K A;  1MQT B;  5FYV A;  3WW2 A;  4E2S A;  1YWK A;  5FWJ A;  1JZ3 A;  3AVS A;  4BK5 A;  1ASJ 3;  2EXH A;  4IUG A;  2JG9 B;  1KDM A;  1ZZC A;  2PFW A;  4P5Y A;  5GLV A;  5AC9 3;  3HBK A;  5JOX A;  1JOP A;  2V4A A;  1KJR A;  4UBH A;  1DIW A;  4MXW B;  1V9U 3;  4QX1 A;  5IVY A;  4UF0 A;  4NPL A;  1K3I A;  1VMJ A;  1OXC A;  4G4F A;  1JZ8 A;  5GZE A;  3KHB A;  5FXW A;  3JD7 2;  1MVE A;  4N43 A;  1IHM A;  2ZJC A;  3HWJ A;  1QNY A;  1ND2 A;  1WLD A;  5DUU A;  3Q9O A;  5E8A A;  5K0U A;  3RI9 A;  3SH5 A;  3FWE A;  1AL0 G;  4YW2 A;  3USU A;  2VMD A;  3SMH A;  2JDY A;  2PLV 2;  3BOW A;  1R08 3;  1KRI A;  5B4X A;  2R06 2;  2ZGR A;  1DGR N;  1NLR A;  5FPZ A;  1N1Y A;  2JIJ A;  2X10 A;  5DZE A;  2DBN A;  4JAA A;  2EIG A;  5GZD A;  2X05 A;  1IGO A;  3JB4 C;  3RI8 A;  1HXS 1;  1C4R A;  4PLN A;  1QDC A;  1R1Z A;  3KGZ A;  1WGP A;  1V6O A;  3QD6 A;  4BWO A;  4EQV A;  4MV2 A;  3Q8A A;  3VBS C;  2FCU A;  2FMY A;  5DDJ 3;  4YGB A;  1U5Z A;  5HI0 A;  1W6Q B;  2W1Q A;  1CAX B;  1RC6 A;  2RM2 2;  3JU9 A;  4HN0 A;  1MS5 A;  4XJW A;  1QH7 A;  4K3U A;  3VKO A;  2Y6K A;  3VBH A;  4WVM A;  2WWU A;  5L9R A;  2D6M A;  5FOB B;  3GGL A;  1PVC 3;  2WN3 A;  2IXI A;  4TZD A;  5FY7 A;  3K75 B;  5JSO A;  1VP6 A;  1JS9 A;  2XLA A;  4CP2 A;  5DG1 A;  2WSV A;  3PUA A;  1RMU 1;  3ILF A;  4UAP A;  4S2F A;  1UKG A;  1MVQ A;  4S2D A;  1RUE 3;  4AI1 A;  2GME A;  1MAC A;  2XJV A;  5FZ7 A;  2VUA A;  1BMV 2;  3N3H A;  3SLI A;  4DIN B;  3LDR A;  3POF A;  5IAX A;  1WA4 A;  4RQP C;  2VZQ A;  3T3Y A;  2ATF A;  4N53 C;  4A7Z A;  4D7S A;  3WP5 A;  4LPL A;  1PMH X;  5JXJ A;  3WUD A;  2JDM A;  1I6X A;  3EBR A;  4LE4 A;  3BYW A;  3FN9 A;  4LKE A;  3ZYR A;  4XCA A;  4A42 A;  1QOS A;  1VBE 1;  3WDX A;  2YC4 A;  1AYM 1;  3W20 A;  5JDB A;  3BTX A;  3U11 A;  4K9S A;  5T5L A;  3E6B A;  1WMX A;  2WWS A;  3OB8 A;  2WZE A;  4OHV A;  1FNY A;  2YGL A;  1PVX A;  4M4R A;  2VOT A;  1V6L A;  3KT1 A;  3NMB A;  4BLI A;  1K12 A;  5T3N A;  2TBV A;  1I1E A;  2EA7 A;  4HPK B;  5GZG A;  2WZR 3;  2WA3 A;  5FMC A;  4QU1 A;  5C3S A;  2DVF A;  1JYV A;  5JOZ A;  3VD3 A;  5I93 A;  2Z4F A;  4JHZ A;  5LAS A;  3OUJ A;  1RJ8 A;  2N7G A;  4PIY A;  2CHH A;  3PUS A;  3H3L A;  4XJU A;  2LUW A;  2EF6 A;  4XQW A;  5BNP B;  1UZW A;  2VZU A;  1HB2 A;  3LSE A;  3OEA A;  2OKX A;  5BYN A;  4XXP A;  3R4D B;  3ZX7 A;  1S0C A;  1OOP A;  1SLB A;  3O1S A;  1C5I A;  3HBZ A;  1H2K A;  4DY3 A;  1O5U A;  4OHY A;  3HIF A;  2Q5T A;  4Y1V A;  1ULG A;  1V70 A;  4BQ1 A;  5FFO C;  3NQH A;  4LHS A;  4JX0 A;  1RMU 3;  4H14 A;  2Y6J A;  3CF6 E;  3MIF A;  5FYH A;  2GSY A;  4UFM A;  4W65 A;  4QX5 A;  4DPN A;  1JTZ X;  3QH6 A;  3MV1 1;  3Q8B A;  2WFP A;  1HQW A;  3USS A;  2JDK A;  2EXJ A;  3SC7 X;  5JI7 A;  1NE4 A;  2Z69 A;  4N90 A;  5FJK A;  3S5Q A;  4FOQ A;  4CDQ B;  5F32 A;  5HXM A;  3GCW A;  5DMY A;  2JG9 C;  5FAX A;  2J1A A;  1M06 G;  2IXH A;  5F2S A;  1BEV 1;  1QY4 A;  2JIG A;  1B35 B;  3N7J A;  1XOY A;  4XBL A;  4AHW A;  1KXG A;  4D7T A;  1W9Y A;  3VUO A;  5E89 A;  2ZEX A;  3IDB B;  1R64 A;  3O12 A;  4U2A A;  5C7G A;  1AYM 3;  2BOI A;  5JUV A;  3MW2 A;  1W6N B;  4GMP 1;  4W6X A;  4AED B;  1F8V A;  1QKQ A;  1XNA A;  2WAO A;  3R6S A;  3AKT A;  2QQM A;  5C33 A;  3GHN A;  4ET7 A;  1N47 A;  1W04 A;  1FV2 A;  1NLQ A;  4ZZ5 A;  5CA6 A;  1U5I A;  4ZU7 A;  3AZY A;  4QMA A;  2NN8 A;  1QHD A;  3NNM A;  1OKQ A;  3OYW A;  5EXO A;  4E4S A;  1DP0 A;  1GOG A;  1QQP 2;  2F17 A;  2GNT A;  2NMO A;  2J1V A;  4F3J A;  3MO4 A;  3LGR A;  3M7A A;  2BGO A;  5F5I A;  4LEJ A;  4XDQ A;  3VD9 A;  4NN0 A;  3UES A;  2FZ2 A;  1ZRF A;  3WP4 A;  4KWU A;  3VL8 A;  2VW1 A;  5FQ0 B;  4CDX A;  1LAJ A;  1G7Y A;  1GOF A;  3DEM A;  1UL9 A;  4LKF A;  4H7L A;  4GAZ A;  5F2W A;  1GWK A;  4TYS A;  1XJA A;  2X8K A;  3SH3 A;  5A70 A;  3HT1 A;  4ATF A;  1CN1 A;  4IE5 A;  4XDP A;  3ZFG B;  1QOT A;  2RR1 1;  3TYJ A;  3ZYG A;  5C5U A;  3KV4 A;  1F4A A;  4IE7 A;  4HXC A;  4KG8 A;  4COU A;  2V09 A;  2D6P A;  2DVG A;  3WHT A;  3CL1 A;  3LEK A;  2AEY A;  1LGN A;  2IFR A;  1J83 A;  5FOJ B;  4Y20 A;  4GWJ A;  2ZGU A;  1RUJ 3;  2VMI A;  5DUW A;  1ASJ 2;  1NZI A;  1CZT A;  3OGR A;  1G86 A;  4CU9 A;  1CVN A;  3RMY A;  3C7G A;  3EB7 A;  5AC9 2;  2QQV A;  3WP3 A;  3I2O A;  2XJR A;  1Y43 B;  2RDR A;  1V9U 2;  3OGJ A;  4R52 A;  5FZ6 A;  3M3O A;  2VOX A;  4CCJ A;  1BEV 3;  1AYN 3;  1ZZ9 A;  3RYR A;  3J7M A;  1NY7 1;  2ERF A;  4LOT A;  1JN2 P;  4YFZ A;  3ETP A;  4L92 A;  3A23 A;  3AZW A;  1AR6 2;  3QH7 A;  3K3O A;  1WUV A;  1R08 2;  3VDA A;  4GMP 3;  4Q4X 2;  1UW8 A;  2YZ4 A;  1WW4 A;  1RUH 3;  4XPV A;  2W68 A;  5A7O A;  4HVQ A;  5FLI A;  2YDE A;  2UY9 A;  1WKY A;  3DUI A;  4CU8 A;  1HQN A;  4D6S A;  4B1L A;  1UZZ A;  2E26 A;  5KR7 A;  3RSJ A;  2AUY A;  2BGC A;  4XIK A;  5JR7 B;  3KS7 A;  1EYB A;  2VCM A;  1I5P A;  2C5D A;  1W6M A;  2PEL A;  4R4Z A;  4EE2 A;  3H8X A;  5GLW A;  1IKQ A;  4Z1V A;  3WG2 A;  2KA3 A;  4UW3 A;  1PO2 3;  3DF0 A;  4ZXE A;  1GMM A;  2R49 A;  4M00 A;  2XON A;  3I3M A;  1CZS A;  1PVC 2;  2RV9 A;  3ZSM A;  2ENR A;  1SFN A;  3HAG A;  2EXK A;  1BK1 A;  5FZE A;  3BU0 A;  5LEK A;  5G04 L;  2A71 A;  1SG3 A;  1RUE 2;  2AH2 A;  2VUJ A;  2YBK A;  1N1V A;  2QKD A;  1N3P A;  2Y6H A;  1HV1 A;  2B42 B;  2WSU A;  4XFH A;  1F31 A;  5FWE A;  1GIC A;  3ECQ A;  3B93 A;  3I2D A;  4LUM A;  5G05 L;  2HBU A;  3M2M A;  3VBS A;  1S0J A;  4XFG A;  1XSQ A;  3VBF B;  5FO9 B;  2VL4 A;  1C1F A;  4P5H A;  1ZBA 1;  3GNE A;  3K46 A;  4CCN A;  2VVD A;  3JBG 3;  3JUU A;  4A6S A;  1VAV A;  2WDB A;  4LO5 B;  2WNV B;  3HQR A;  4NHM A;  1NG0 A;  1MS3 A;  5HCB A;  4CDQ C;  4PDW B;  4L9B A;  4XIO A;  4Q0P A;  5BNN C;  5A3L A;  4NIH A;  4MUV A;  3DPR B;  4ASK A;  3PDQ A;  3ZIW A;  4FO9 A;  2JG8 C;  3KHC A;  1LEM A;  1DZQ A;  2Y33 A;  4IEO A;  5KBF A;  2RJ2 A;  4RL7 A;  4CP1 A;  4UW6 A;  1SFY A;  1XRU A;  1EV1 3;  2DVD A;  4PCR A;  1YQ5 A;  3C8X A;  3T1L A;  2XHK A;  1BJQ A;  4Y1Y A;  3C7H A;  4FP3 A;  2QQJ A;  3J4U H;  5J1X A;  3OGS A;  2QZ2 A;  3WG3 A;  3I2I A;  4UF0 B;  1UX6 A;  1W99 A;  1RYY A;  1J84 A;  1GZW B;  1W0P A;  2BNN A;  2WZR 2;  2X5I C;  5T54 A;  1UZY A;  3WG1 A;  4RQP A;  1Y9M A;  4FFF A;  4MGS A;  4N43 B;  4N53 A;  1AVB A;  4A3X A;  1G8W A;  1HXS 2;  1ND2 B;  3KV6 A;  4BB3 A;  4CSW A;  1PNG A;  1OLM A;  5K0U B;  2PA7 A;  3USU B;  1QH6 A;  1QXP A;  2JDP A;  2LM3 A;  4QXK A;  4Y4Y A;  5FP7 A;  3UJO A;  4AOC A;  1VBA 3;  4NJ4 A;  4P02 B;  4FQZ A;  3MZH A;  4Y24 A;  3AFG A;  3P3P A;  4HKW A;  1Z78 A;  5GZF A;  5EV7 A;  4I30 A;  2ZEW A;  2XBO 1;  1W6P B;  4YSF A;  3K4Z A;  4A4A A;  1W2O A;  1VBD 3;  3NV4 A;  2DCY A;  5FZO A;  5LAT A;  4C8D A;  4CDU B;  1XE7 A;  2JKB A;  4CZS A;  1RMU 2;  3CIH A;  1ZX5 A;  4MX3 A;  3E5U A;  4RSU A;  4GJZ A;  4CCL A;  3S0M A;  1CR7 A;  2Z2S B;  3VBH B;  1W9S A;  4WVM B;  3MIB A;  4XMA A;  1VBB 1;  1GZ9 A;  1H8T C;  4V2W A;  1WZX A;  3BTY A;  2YPJ A;  2ZAA A;  1V6I A;  1AR7 1;  4LO4 B;  3THP A;  3N9P A;  1HQL A;  2WT0 A;  4FPK A;  1S0E A;  2J1T A;  2ZGK A;  1MS8 A;  5JCT A;  2FDG A;  2FQP A;  4BQ4 A;  3POB A;  1DGW X;  3X29 B;  3BKZ A;  3E6C C;  1YQ8 A;  3IWZ A;  1GQH A;  1NZC A;  1WWY A;  4XQD A;  5I91 A;  2HEV F;  1UYY A;  4FBF A;  2ORZ A;  4FPL A;  4DUW A;  2ARA A;  3KF5 A;  4XEZ A;  1UY0 A;  4UBG A;  1AYM 2;  3AP5 A;  4DEQ A;  1OT5 A;  2F6B A;  5A1L A;  1OD3 A;  1OMI A;  2YFZ A;  1WW7 A;  3ETQ A;  4HT1 T;  5KHG A;  3LE0 A;  1YXW A;  1KQR A;  4MH0 E;  1XB9 A;  2BU9 A;  4XQ4 A;  1NXD 1;  2PHW A;  1QWR A;  3N35 A;  2C9A A;  4MO3 M;  3MF6 A;  4A41 A;  5FK7 A;  2ZAB A;  2WNO A;  3WOG A;  4L97 A;  1RUD 3;  2JG9 A;  2BGP A;  2ZEY A;  3KWV A;  3MIH A;  4I01 A;  5FJH A;  2JDZ A;  1X8E A;  4AVS A;  1RHI 3;  3IZO A;  2BEO A;  2V72 A;  5DAB A;  3MV0 1;  2AEZ A;  5FZ4 A;  2C0Z A;  5K4L A;  1HRI 3;  1Y9G A;  3U4S A;  1W8T A;  2Q8O A;  1C1L A;  1UMI A;  4YM2 A;  4QGM A;  3U4X A;  2XBO 3;  4Y1Z A;  1AR9 3;  2XGX A;  4ASM B;  3FBM A;  4UOJ A;  5HXV A;  3THT A;  4YAR A;  1W9W A;  4PF5 A;  4LKS A;  1IPS A;  3S57 A;  1JXN A;  4M3C F;  5FZ0 A;  1MEC 3;  4KH9 A;  4AI9 A;  3J26 N;  4LIV A;  3VHP A;  4XFA A;  2GP5 A;  4EWE A;  4J6G A;  4NAM A;  5A3P A;  1RUJ 2;  2VJX A;  2BDR A;  3MW4 A;  1OOP B;  5A3U A;  1FMD 3;  2A1X A;  3I7D A;  4L99 A;  3OBR A;  5C8W A;  4YZ3 A;  3ZN6 A;  1H1I A;  1HN0 A;  3GJA A;  1AUY A;  1QJY 1;  2JDU A;  3SIT A;  3AFK A;  1ZM1 A;  5F8P A;  1D0H A;  1PM7 A;  4Q0U A;  5BXX A;  3H0O A;  5LA2 A;  2VO5 A;  5LRS A;  5ACA 3;  1W90 A;  2WNV C;  4OMC A;  1BVP 1;  1BEV 2;  4Q4W 3;  2WKK A;  5FYM A;  3LA7 A;  3WF0 A;  4I2O A;  4HOO A;  4D0Q A;  5IVJ A;  5F5A A;  5A6X A;  4QKB A;  4RHV 1;  4AEK A;  3GYD A;  4B7K A;  1D4M 3;  1HB4 A;  4FFH A;  4XTM A;  5C3R A;  1RUH 2;  2V4V A;  3E6D A;  4KL1 A;  2PAK A;  3ZYP A;  3WNX A;  4XAB A;  1F15 A;  2WYF A;  1WBL A;  1SCS A;  2L9L A;  5I0U A;  4LNV A;  2EVX A;  4U36 A;  5EYX A;  1WMD A;  4OLL A;  3CQO A;  1LOD A;  1ZVF A;  1CIW A;  4PQQ A;  4XC9 A;  5IVF A;  1T2X A;  3POS A;  2J1S A;  3I3Q A;  5FRE A;  4YW1 A;  2A75 A;  4HMZ A;  1PO2 2;  4MGQ A;  4WM7 B;  5DUV A;  3RJ2 X;  3TNQ A;  4FTS A;  4L8Q A;  3ZMO A;  2R30 A;  2ZEZ A;  4CCO A;  5A33 B;  1A3K A;  1ODM A;  1GNY A;  1YLL A;  4I3G A;  4FOW A;  3FUO A;  2OX0 A;  3GBW A;  5FMD A;  1OA4 A;  1PZ7 A;  1KFU L;  3MPB A;  4CDU C;  5CIS A;  4LMF A;  5ISL A;  2VOW A;  4CDX B;  4LOR A;  3MW3 A;  1FOD 1;  2DUR A;  3K77 A;  3S5A A;  3O7O A;  4HPK A;  1DCS A;  1X36 A;  4H55 A;  3KV9 A;  3AZV A;  2YBS A;  1AR8 1;  4KG0 A;  4N7I A;  1CPM A;  1WCQ A;  1R09 3;  3IN9 A;  1UY3 A;  1IS5 A;  2WFF 1;  1J1T A;  4B1M A;  4BZ4 A;  3JBG 2;  3SXW A;  4MGY E;  4HLT A;  4P9J A;  2I2S A;  1E5H A;  1CAV B;  1DYP A;  2PLV 3;  1NKG A;  4JRA A;  3RG0 A;  1PNF A;  3ZXJ A;  4AYU A;  1RXF A;  4Y22 A;  1EAH 1;  1LOG A;  2RS5 1;  4BDV B;  4LIT A;  4Y20 B;  2RS1 1;  2QQK A;  2XQR A;  5DQ0 A;  4EYU A;  1EV1 2;  4S2H A;  1F9K A;  1NX9 A;  3VV1 A;  4KMQ A;  1DQ1 A;  1TZO A;  1A78 A;  3PL0 A;  4CUB A;  5JXG A;  1RED A;  1XC6 A;  3CNA A;  4EV0 A;  4XJ9 A;  2O14 A;  1O4Z A;  4QDS A;  5IK7 A;  1PMI A;  1XU2 A;  1H6X A;  4H3W A;  3KMH A;  3PHM A;  3III A;  2XDV A;  3D5O A;  3LOI A;  5FZF A;  2FDK A;  1EY2 A;  4GWI A;  1UZ0 A;  4CDQ A;  5J09 A;  2GC2 A;  5BNN A;  2XXZ A;  4NHY A;  3BTZ A;  1VBA 2;  4UXA A;  5LRR A;  4Z2A A;  1YIF A;  1HJF A;  1Q8S A;  1NQD A;  1OHF A;  1JZ5 A;  2XJQ A;  2JG8 A;  2HWE 1;  1QJF A;  2E6V A;  2XVK A;  5EP9 A;  3TN9 3;  2OVU A;  3C2U A;  4ZU4 A;  2WNE A;  2ADE A;  5JZG C;  1ULF A;  3J7L A;  3ZYI B;  1HX6 A;  1W6N A;  2GAL A;  2MHF A;  3BOD A;  4EWD A;  3T2Q A;  1S0B A;  2JB8 A;  3FFZ A;  1DQ6 A;  3ILR A;  4BM8 A;  4C0H A;  5LA1 A;  4JHT A;  1UWW A;  1W6M B;  1XSR A;  1LEN A;  2X5I A;  4JTN A;  2VTX J;  4Y5T A;  1POV 0;  4GA9 A;  4DEV A;  4E4D X;  3OOX A;  3HEI A;  1CD3 G;  4W8J A;  1LGB A;  1YQ2 A;  3B3Q E;  4BQW A;  1XNK A;  2Y0O A;  5FPV A;  5J37 A;  2WYS A;  1NCR A;  3WQ1 A;  1FPN 1;  2XLG A;  5JXH A;  5C8C C;  1NT0 A;  4YVW C;  2XJP A;  4CTE A;  3HNM A;  4NVP A;  4OMD A;  3BGA A;  1O3R A;  3GM8 A;  4RFR B;  1YO8 A;  4YW7 A;  2P37 A;  4CYD A;  1O4Y A;  3WX5 A;  5K9Y A;  4C1X A;  4JKL A;  3P5B A;  2FDI A;  4HZF A;  4TXW A;  3LSD A;  3TEW A;  3WQ0 A;  1OI6 A;  1UIK A;  2EAL A;  4UFJ A;  2O0O A;  1UOJ A;  4P9Y A;  1H8T A;  2P6C A;  5A6Z A;  3T08 A;  2P3J A;  3KT7 A;  3NJZ A;  5FMB A;  4BIS A;  1PMJ X;  3MIC A;  4DUV A;  3O1V A;  4OFG A;  2EIE A;  1EP0 A;  3LIH A;  5T5J A;  1ND3 C;  1U0A A;  1U12 A;  1RUD 2;  2DCZ A;  3I2G A;  1UN1 A;  2LRP A;  1RB8 G;  1YEW A;  5FYU A;  1RHI 2;  2KR2 A;  4YYO A;  3VB9 A;  1D4V B;  1QGL A;  1U5Y A;  1UOG A;  3CMG A;  4FXG B;  1HRI 2;  5FBZ A;  1BQP A;  3ZSE A;  2WO7 A;  2VPV A;  4RGK A;  4GJY A;  1SBF A;  2W1U A;  3RNS A;  4LO6 B;  2WO3 A;  4WM7 C;  1MPX A;  2XBO 2;  2C6S A;  3H9A A;  4RQP B;  3DL3 A;  3MBW A;  1RUO A;  4Q0Q A;  3UGG A;  3CJI B;  4GUL A;  1CPN A;  3ASI A;  3RYP A;  4AQ6 A;  5KXD A;  2ORX A;  3T2T A;  2HWB 1;  3SEP A;  4ZKT B;  1MEC 2;  4GB3 1;  1UU6 A;  3WT3 A;  4ZZ8 A;  1QXJ A;  5I0R A;  2HWF 1;  1FMD 2;  4K7J A;  4YZ4 A;  4FTB A;  2B46 X;  1J3P A;  4AL9 A;  3UKV A;  3O0W A;  3NJV A;  3VLB B;  1UY4 A;  4BJ0 A;  4GD4 A;  1R1A 1;  1SBE A;  3KV5 A;  5FZO B;  4BQ2 A;  4WVZ A;  3RS6 A;  4FPH A;  2A7A A;  2YGM A;  2FHR A;  5LY1 A;  5GKA C;  4FPE A;  4BIO A;  5ACA 2;  2Q1Z B;  2ARC A;  2BER A;  2Y6G A;  3I49 A;  4Q4W 2;  1X7N A;  1UMH A;  5L7O C;  2HH9 A;  2OPW A;  5C9A C;  4YW4 A;  3T4H B;  1OA2 A;  1O4T A;  1W0O A;  3ZXE A;  1TE1 B;  4IEQ A;  4OUE A;  1O3Q A;  4O61 A;  3S7E A;  4FPC A;  1HRV 3;  1RVF 3;  2WS9 1;  4LUL A;  3MDP A;  2P3K A;  3ZR5 A;  3V65 A;  4TSV A;  1A34 A;  2A70 A;  3P1I A;  2CDO A;  2DF7 A;  3HVD A;  1FNZ A;  5JMC A;  1WCK A;  2WJS A;  1UPS A;  3WD5 A;  4XJ8 A;  3LB9 A;  5KXB A;  1O59 A;  3L9J T;  4AVT A;  5FYI A;  2R7E B;  3KLS A;  5SV5 A;  5IHR A;  1W8N A;  3J7H A;  4FAH A;  5FLH A;  3CEW A;  1ZA4 A;  1ENS A;  2QDR A;  2W95 A;  2OZ6 A;  3LAG A;  1RXG A;  4FQ4 A;  1AXK A;  3A21 A;  1EUU A;  3RZJ A;  2VW0 A;  4PIX A;  2C1F A;  2GZW A;  2JDA A;  3RGB A;  2VMC A;  2XL9 A;  4GWM A;  3VHR A;  1PM4 A;  5J98 B;  1JU4 A;  2YU1 A;  1I5Z A;  3E97 A;  5F3C A;  2E7T A;  3AP6 A;  3T30 A;  1AX1 A;  2FMD A;  4DXT A;  4TN7 A;  5FP4 A;  4EN6 B;  1V6N A;  1ZZB A;  2HWB 3;  1L7Q A;  1P8J A;  2G19 A;  4O9E A;  4EWA A;  3VL9 A;  1OVS A;  5JSP A;  4IEP A;  4CRQ A;  1GZW A;  4KBZ A;  2A3Y A;  4AR2 A;  4CDW C;  4D8M A;  1R09 2;  2W08 A;  3IDA A;  2A6Z A;  4IDZ A;  4QHZ A;  2CL2 A;  4B4R A;  3KM5 A;  1QJY 2;  2HWD 3;  4JGZ C;  1AR6 3;  1S1A A;  3AZZ A;  4XBN A;  3WY6 A;  2VMF A;  3RZG A;  4P9G A;  3F95 A;  1IOA A;  4Q4X 3;  1Y7B A;  4LHK A;  5EJZ B;  3NO8 A;  4BQ5 A;  2HLE A;  5JMO A;  4P9X A;  4R9B A;  5FXV A;  1W6P A;  5DZF A;  5DZG A;  3AYA A;  1BBT 3;  1X9P A;  5HCH A;  3ZN6 B;  3P3N A;  4CDU A;  1ZBE 3;  2RS3 1;  2ES3 A;  1W8H A;  4XBQ A;  4QXB A;  3RFR A;  5J7M A;  1OVP A;  1YQC A;  1SCR A;  2YG0 A;  3SH4 A;  2GDF A;  3MIE A;  4OUM A;  4C1W A;  3OF1 A;  5ABJ A;  1ZA7 A;  1MS0 A;  1ZRE A;  4RR3 C;  1QF3 A;  3LWC A;  2D93 A;  1J3Q A;  1J3R A;  1J58 A;  2PAE A;  3OD0 A;  4JGY C;  5HV0 A;  1V00 A;  5LBE A;  4CPB D;  4LA2 A;  4A7Y A;  4UW5 A;  1JYT A;  1AX2 A;  1H4H A;  5LA0 A;  3TN9 2;  4XJZ A;  3ZXL A;  4D69 A;  3OUH A;  2J1E A;  1LES A;  5D21 A;  1GSL A;  4FOY A;  5FY9 A;  1SPP B;  2GAU A;  3IPV A;  5C71 A;  5KHI A;  3DV8 A;  2QFE A;  3N36 A;  1GR3 A;  2R04 1;  1SQ4 A;  3WW3 A;  5L9B A;  5CFC A;  3CJI C;  2VOK A;  4RA0 A;  2RDN A;  1DYO A;  2DUP A;  4COV A;  1GP6 A;  2W94 A;  3AYC A;  4JCK A;  4S2G A;  4FPF A;  3WLU A;  1SLA A;  2Y8K A;  3O1P A;  4IND A;  3M3E A;  4OZO A;  1WLW A;  4GAL A;  4WM8 C;  5IK8 A;  3WEZ A;  2VQ0 A;  1DLC A;  5FZB A;  4AGR A;  2A3X A;  2Y38 A;  1LOF C;  5IK5 A;  4UFI A;  2AR6 A;  2C26 A;  4LJH A;  4Y33 A;  2WFF 2;  1AL2 1;  3AJY A;  2ET1 A;  3HNY M;  3J8F 1;  2FDJ A;  5A3O A;  4AGG A;  5BNO B;  2ZCW A;  1TQ5 A;  4HFS A;  4NMI A;  3RZL A;  2RMU 1;  1W05 A;  4QKF A;  3JQW A;  3ZFE A;  5A1F A;  4CP9 A;  2BQP A;  2E51 A;  2YY1 A;  1W2N A;  1XYN A;  3NJY A;  4KU7 A;  4RN5 A;  2MNG A;  3CKH A;  4XUT A;  5JZG A;  3E5X A;  2WQ8 A;  3LFM A;  3URF A;  5A32 A;  4JQR A;  1HXS 3;  3V0B B;  1SBD A;  2GC3 A;  5IYY A;  3L2H A;  4XFC A;  3B9I A;  1O5L A;  2B4K A;  5JLV A;  1T6B X;  3NKT A;  3T2O A;  4GWN A;  4Y22 B;  2R6Q A;  5AFE A;  1SMV A;  2ZMN A;  2QQU A;  2KXL A;  4MG2 A;  2PYT A;  2XQX A;  3N7K A;  4BQ3 A;  3QBQ A;  1GOH A;  1STM A;  4AVC A;  2TEP A;  5C8C A;  2DUQ A;  2P5B A;  4YVW A;  3D3A A;  3K4D A;  4E9K A;  2NQY A;  4GQ7 A;  1X82 A;  4FP2 A;  2JIC A;  4I3P A;  4XXA A;  5FZI A;  2RG4 A;  4Q4V 1;  4OQ9 A;  3HQU A;  4NOT A;  2ETE A;  2H6C A;  5CFD B;  2VNO A;  4NIG A;  1XNB A;  4YW6 A;  5FTT C;  4A6O A;  3AP7 A;  4P9I A;  1C3H A;  3KB5 A;  3T0A A;  1CWP A;  2C4X A;  2V5D A;  5BNN B;  3BUC A;  1X33 A;  2QVS B;  3OJB A;  3ACI A;  3EQE A;  3N7M A;  2W1S A;  1VE0 A;  4ZY9 A;  4P14 A;  5IT6 A;  1HIX A;  2Q1F A;  2WAA A;  1U5X A;  5E6H A;  2JG8 B;  3SEE A;  3BTA A;  4KU8 A;  1ND3 A;  3ZPO A;  2ZGP A;  1ENX A;  3NST A;  3EJK A;  1VBE 3;  2W47 A;  1SHW B;  2QTW B;  4LBL A;  4A44 A;  2SBA A;  4IEU A;  3Q8C A;  2VZP A;  5I8S A;  1OBN A;  5FZC A;  2X5I B;  1J1L A;  5C4W B;  1AXY A;  4QB1 A;  4WM7 A;  1ZZ7 A;  1TME 1;  1OQ1 A;  1YQ6 A;  5A33 A;  1RUI 1;  2YYO A;  3BVC A;  4XE9 A;  3T1M A;  4DQA A;  2OUJ A;  2Q0A A;  2WII B;  2JXA A;  2OS2 A;  1HRV 2;  2GN7 A;  1RVF 2;  3VKM A;  3ZXD A;  3EMR A;  1OKO A;  1NCR B;  3UGF A;  1DQ2 A;  2H0B A;  4AHY A;  4LQR A;  4C91 A;  3KF3 A;  1UOB A;  4ISR A;  3VDD B;  1W3V A;  2ZMK A;  3ACF A;  4XAA A;  3PUQ A;  2DYC A;  2DWR A;  4WZF A;  5A80 A;  3IMN A;  2W92 A;  4A45 A;  1A8M A;  2D6L X;  2JE9 A;  3DYM A;  3LIG A;  4M3C E;  4URT A;  3WF4 A;  3ZSL A;  3SQO A;  3BPZ A;  3W21 A;  5J36 A;  1OF3 A;  2ZAC A;  1CAV A;  4V2V A;  2YU2 A;  4YM0 A;  1C8N A;  2A6Y A;  5L7O A;  1DGW A;  1H8T B;  1UCX A;  5C9A A;  1FAY A;  3HT2 A;  4DMI A;  2OII A;  4Q4V 3;  4AEJ A;  5SV8 A;  5FZ9 A;  2W46 A;  1DQ4 A;  4QAW A;  3GZE A;  5KC5 A;  5FR3 A;  4AQS A;  3MUZ 1;  1GV9 A;  3VHO A;  1JOJ A;  1LB2 A;  2BPA 2;  3POW A;  1AHS A;  3ACL A;  4E2G A;  3WCS A;  1G9B A;  1PGW 1;  4RS5 C;  3TEX A;  2HWB 2;  4BE3 A;  1BK0 A;  2VE1 A;  4Z07 A;  5IFP A;  2WIN B;  5GZC A;  2ZX1 A;  4PQ9 A;  3AC0 A;  4OI2 A;  1ULE A;  3WQB A;  4K1Y A;  3EXU A;  4JC1 A;  2D6K A;  5A7Q A;  3FX3 A;  3HQX A;  5FZL A;  2HWD 2;  2XML A;  2W9X A;  1GU3 A;  1Q5O A;  3LPF A;  4E4H A;  1YNA A;  5BNO C;  2R1D A;  4QD2 A;  4HSL A;  1O3T A;  3IDC B;  1L7R A;  2VMH A;  3AKS A;  1BBT 2;  3T0B A;  2UY8 A;  3JB8 A;  4YFW A;  1ZBE 2;  2R0F A;  2J22 A;  3GF6 A;  3WNN A;  3CLP A;  3A0K A;  4QB6 A;  2HYK A;  4OVE A;  3RZH A;  3N9N A;  1GQG A;  5FKB A;  1WD4 A;  4PLO A;  4UWD A;  3U75 A;  3VZN A;  4CDW A;  2YFU A;  3CBN A;  1JYN A;  3VBO C;  1FAT A;  5EIY B;  1SFP A;  2GC1 A;  1UY1 A;  3OBT A;  4ES9 A;  5ABJ C;  1YFU A;  2UYA A;  1RUF 1;  2NM1 A;  4JGZ A;  4AFM A;  4AE2 A;  5CNA A;  3A4U A;  4EJR A;  4M01 A;  5E88 A;  3ELN A;  3ZPY A;  3U1X A;  2GNM A;  4HAN A;  2RJL A;  4MGI E;  3H7J A;  2RR1 3;  2ZGS A;  1JOD A;  4NPR A;  2WO2 A;  4I0W B;  4QQL A;  2CAV A;  2WQ4 A;  3KVB A;  2UWB A;  5DN2 A;  2QE3 A;  4Q1R A;  3FLT A;  5CFD C;  2CTV A;  2TUN A;  2Z42 A;  1UNB A;  3CHX A;  4XUP A;  1DBN A;  5CEH A;  3R05 A;  2R07 1;  2ZPX A;  1E5I A;  1XPW A;  4RR3 A;  3W5M A;  3ABZ A;  4ORF A;  4JGY A;  4SBV A;  1ULC A;  2DU0 A;  3ZDS A;  2VBB A;  2ZKN A;  1OQD A;  1OQE A;  2C9K A;  3WCR A;  1WCS A;  5CVR A;  4ZS2 A;  1LHW A;  4ATE A;  2D3S A;  3QCW A;  2O8Q A;  4MHR A;  1JZ2 A;  1RIN A;  3GAL A;  4EZH A;  5F1R A;  2HWC 1;  5F7U A;  5A6Y A;  3ZKY A;  3E1F 1;  3ZXK A;  4YW5 A;  1SEF A;  5C4W C;  2JEN A;  4QPI B;  2ZGM A;  1CJD A;  5D1I A;  1OUX A;  3FUQ A;  3LA2 A;  3CJI A;  4CXY A;  4MZU A;  1EPZ A;  2DVA A;  4JQT A;  3LKJ A;  4LA3 A;  1H1A A;  2BP6 A;  2RS3 2;  4ES8 A;  1NCR C;  1NOV A;  4CEW C;  3DKQ A;  3LA3 A;  4WM8 A;  1G9A A;  2VC9 A;  3PTR B;  4MOA A;  3GZA A;  3VZL A;  5C3Q A;  4Y26 A;  2X09 A;  2ZS6 B;  2PHT A;  3VDD C;  3WV6 A;  3CZU A;  3ZYH A;  1LOF A;  1ENQ A;  1POQ A;  2PQS A;  4TTG A;  2UU8 A;  4QPY A;  3BPS A;  3MI8 A;  4XET A;  4MGT A;  1S0D A;  4MSV A;  1GFF 2;  5DG2 A;  2JX9 A;  3TAY A;  3WIN E;  1YJL A;  4YVS C;  1W3X A;  3OBZ A;  4LBO A;  3OD4 A;  1COV 1;  3QOP A;  4AXO A;  2ZAH A;  1MZE A;  3JZV A;  2VNR A;  3HNB M;  4CU6 A;  3PME A;  5ABJ B;  4ZHN A;  2IVI B;  3AYE A;  5ANN A;  3SIS A;  5BUV A;  3TBD A;  4DY5 A;  1VBC 1;  2BWC A;  3PJY A;  3BIW E;  3HOB A;  5H9S A;  4XUN A;  1UY2 A;  2R04 2;  4M4P A;  2K46 A;  4K21 A;  1GP5 A;  1JBC A;  1LR5 A;  1ZBA 3;  4DFS A;  2D5F A;  4A3Z A;  4DRV A;  2TNF A;  2QQP A;  2Q1M A;  4N8M A;  1EUT A;  4P9W A;  4QM8 A;  2VXR A;  1EPW A;  5DAV A;  4AQ2 A;  2OXB A;  1VB4 A;  4KGQ A;  2V73 A;  5I0T A;  2FCT A;  3IPV B;  1VBE 2;  2VUD A;  3INA A;  3VDB A;  2VBD A;  3DYO A;  2DFC A;  4UFL A;  4XYX A;  5F39 A;  2PHU A;  1AL2 2;  4R9C A;  4AG4 A;  5CFC B;  3LDB A;  1M4W A;  5EJ3 A;  2V5Y A;  5HPO A;  4FSJ A;  4XF0 A;  5FZK A;  4GZ9 A;  2HWC 3;  3FLR A;  4MET A;  5F3E A;  5J3U A;  1GNZ A;  3DKW A;  5DAP A;  4Y3O A;  1W39 A;  4LR4 A;  2Q4S A;  3AMQ A;  4XFI A;  3PVN A;  1ODN A;  2VCB A;  5FYT A;  1JZ7 A;  2VTX A;  4HL0 A;  4Z82 A;  5GAL A;  2VQT A;  3ME2 A;  3WR0 A;  2ZX0 A;  1GWL A;  4Q2F A;  5ERL A;  5FYB A;  3C3V A;  2BFU L;  5JPN B;  3ON7 A;  3H1W A;  3KCX A;  5CKM A;  3FLP A;  1XU1 A;  4HON A;  4UYB A;  1UU5 A;  4CP9 B;  3WF3 A;  5JZG B;  2K0G A;  1HKD A;  2A6V A;  4CUA A;  3SNM A;  5D2A A;  5A32 B;  4H2A A;  3UNP A;  2E31 A;  1WLT A;  1LU2 A;  3NJX A;  3FL7 A;  3W58 A;  4BU2 A;  3PTY A;  5BNQ A;  2D5H A;  4KWL A;  4LHN A;  4D7Y A;  1COV 3;  1NCQ B;  1N3Q A;  4Q4V 2;  4NRQ A;  1LKN A;  5J48 A;  1RL3 A;  4HVO A;  2RDS A;  1VBB 3;  1A6C A;  4NR1 A;  1WA6 X;  5CKN A;  3ZKU A;  1AXZ A;  1OH4 A;  4LO8 A;  5T5O A;  1LEC A;  4CCD A;  1AR7 3;  5C8C B;  3OUI A;  4YVW B;  1TEI A;  2HYX A;  3E5Q A;  2A3W A;  2RHP A;  1UKR A;  4B3N A;  1JHJ A;  5J96 B;  5KWR A;  1OPM A;  4NII A;  4GH4 C;  2A5Z A;  4UFK A;  2LRO A;  5EWS A;  3UJQ A;  3M3Q A;  1HJG A;  4DXS A;  1C8M 1;  1UXZ A;  2IVJ A;  4E27 A;  1DZT A;  1V6K A;  4URA A;  2EAK A;  3M70 A;  4BCU A;  2JDN A;  4NHL A;  2PHL A;  2R16 A;  5AFB A;  4K8R B;  3ORJ A;  5FMO S;  4ERO A;  1LRH A;  1RIR A;  5CB7 A;  2FBE A;  3JD7 1;  3F2Z A;  4B7E A;  2MEV 1;  1XNC A;  5FZA A;  1ND3 B;  1SPP A;  4JDO A;  5FPX A;  4OUS A;  1JZ6 A;  1C57 A;  4IEZ A;  4RS5 A;  4QPI C;  1QJU 1;  2D6O X;  3PNA A;  3MHZ A;  4HBN A;  4PIZ A;  1JMU B;  3EYP A;  3AP9 A;  3N9L A;  3OEB A;  5F5C A;  4R8H A;  4X6R B;  1BZW A;  4O65 A;  4ASL A;  3ZO0 B;  2WL1 A;  1Q3E A;  4GKX A;  5IVV A;  1LTE A;  3POJ A;  4JTO A;  1N3O A;  1CX4 A;  3H50 A;  2RM2 1;  1SLL A;  2P2K A;  1DG6 A;  1KIT A;  2UWC A;  4QX7 A;  2WC2 A;  4WZC A;  5BNO A;  4JVA A;  1LOC A;  3C7F A;  2BWA A;  2RR1 2;  1DZR A;  3UKT A;  3W9A A;  3ZYB A;  4XF9 A;  3ST7 A;  1SDW A;  3I59 A;  2ZZJ A;  1UIJ A;  1UU4 A;  3B7M A;  3KCY A;  1YFY A;  2OYZ A;  3B9C A;  5IVC A;  2ARB A;  2JDH A;  1Q8Q A;  3BCW A;  1JHN A;  2VR4 A;  3V0B A;  3BN6 A;  1QJX 1;  3N7L A;  1OUS A;  1S2B A;  4UW4 A;  1QJY 3;  3B00 A;  4NWV A;  2VZ1 A;  2D3R A;  5L7O B;  4MXV A;  1ZRI A;  5C9A B;  3VBO A;  3TB0 A;  4YNI A;  3WNM A;  1S0I A;  4LK7 A;  2ZGL A;  5HCA A;  2Y0I A;  3POY A;  5FY5 A;  1NY7 2;  1ZRR A;  2ZHN A;  3WHU A;  3WP6 A;  3AP4 A;  4AF9 A;  1JYW A;  4COZ A;  3AMN A;  2UUR A;  4RHV 3;  1RUG 1;  3AB0 A;  4C0B A;  5CFC C;  4CXW A;  1H8V A;  1GLH A;  4IEW A;  4W6W A;  5A3W A;  4CU7 A;  3D6E A;  2MEV 3;  5CFD A;  3O0X A;  4MVT A;  4AI3 A;  1CAW A;  1N1S A;  4YM1 A;  1W8Z A;  3KSC A;  1PGS A;  1VMF A;  1DQ5 A;  5FPL A;  3RMX A;  4B4Q A;  1K42 A;  1QJU 3;  1IS4 A;  4GIQ A;  3WDT A;  1CON A;  5I0S A;  3VD7 A;  1YC6 1;  4IEY A;  3WW4 A;  3KCC A;  5IUQ A;  1J59 A;  5EZW A;  3AM2 A;  4OQ8 A;  5L19 A;  5FPU A;  2P17 A;  2E9Q A;  3JXS A;  1MZF A;  2GND A;  3BOP A;  1NUK A;  2E7A A;  1C5H A;  5FUI A;  3VZK A;  5C4W A;  4R9D A;  4JV4 A;  4CDW B;  5KXC A;  1NCQ C;  2GP3 A;  3NV1 A;  2WRA A;  2CDP A;  1YYN A;  4BYY A;  1FOD 3;  5FPB A;  4JGZ B;  4IW3 A;  1AR8 3;  5FY0 A;  1Y3T A;  3VBR C;  2CWM A;  3VN4 A;  1CES A;  1ZBA 2;  4CEW A;  2WFF 3;  5IAV A;  5FYS A;  3C7E A;  3MLJ A;  1QJX 3;  3WNP A;  4DO0 A;  3PLQ A;  2VY0 A;  4XJA A;  4OZX A;  3LEG A;  2HEY F;  4BPZ A;  3VDD A;  2UYB A;  3PMS A;  5C3P A;  3V0A B;  5L36 A;  4IGP A;  2GU9 A;  4D6R A;  5B2G B;  3FFQ A;  1EAH 3;  2AC1 A;  2RS5 3;  2XG3 A;  4I02 A;  2ZXQ A;  1IS6 A;  1US3 A;  2VGD A;  2E32 A;  4IQP A;  4NRM A;  4YVS A;  2RS1 3;  1JI6 A;  2BVB A;  3LF7 A;  4OI0 A;  3NL1 A;  2LAL A;  4UT5 A;  2I07 B;  2P4E A;  1BVV A;  1RUC 1;  1YCI A;  3MF9 A;  2FD8 A;  4WBB A;  5LBB A;  2PMW B;  2QQN A;  4NPM A;  3IDE A;  3NV3 A;  4RR3 B;  4G9S B;  2R32 A;  2Y64 A;  2HWC 2;  1XNT A;  4JGY B;  4QQO A;  5FXX A;  5IWF A;  3ZLI A;  3WF2 A;  4Z2W A;  4Q8K A;  4CXX A;  1D2S A;  5FO8 B;  3GXU A;  1F5F A;  4PI2 A;  5FY8 A;  3O1T A;  2NP0 A;  1WBF A;  3WDU A;  2E33 A;  2DVB A;  2OZJ A;  2IFW A;  5FYC A;  2YMZ A;  1QQP 1;  3VKL A;  1TMF 1;  2JWP A;  1JYX A;  4WVV A;  1ZZ8 A;  1SAC A;  3NWK A;  2HWE 3;  3CJX A;  3AYD A;  3FZ3 A;  4XVH A;  1CGP A;  3NNJ A;  4QPG C;  2FCV A;  2HBT A;  4XMI A;  3WSO A;  2JE8 A;  1W2A X;  4F83 A;  3CU7 A;  5FXZ A;  2VTF A;  2WQZ C;  4AZZ A;  2VW2 A;  1COV 2;  4XZP A;  1UYP A;  2XUM A;  4WM8 B;  2VQA A;  1VRH 1;  2EAA A;  3H7Y A;  3I4I A;  4NRP A;  2NPI A;  1VBB 2;  1DLL A;  4ISQ A;  5IAT A;  4QU2 A;  4Z92 B;  1AR7 2;  1UO9 A;  4QQ2 A;  3AKR A;  4FFG A;  4WV8 A;  2BRT A;  2E53 A;  4XZU G;  5CAD A;  1IKP A;  1FPN 3;  2BNO A;  2KM2 A;  4XFB A;  4OUL A;  3LPG A;  5F3I A;  5JPM B;  1YFX A;  2BBV A;  1QU0 A;  1ASJ 1;  2YV8 A;  2QDN A;  2VCC A;  1KGY A;  4I0A A;  3WG4 A;  5IVE A;  5JVV A;  5FYY A;  5IFT A;  2DCK A;  2QJV A;  3B69 A;  5APA A;  4JKM A;  3O1R A;  1PGL 1;  1XND A;  2AYH A;  1Q8V A;  1SLT A;  3OG2 A;  4GXL A;  1KS4 A;  1CZV A;  1D7P M;  3PUR A;  4F8A A;  2YC0 A;  3WQ7 A;  3FJS A;  4QPW A;  1KFX L;  1FT9 A;  1FXZ A;  5F5Q A;  5M0T A;  4C90 A;  1UPI A;  3UGH A;  1RUC 3;  2VEC A;  4LKD A;  1NYW A;  4ONU A;  1WME A;  3J7N A;  4E8D A;  1OA3 A;  4DB5 A;  3RZK A;  2ZHM A;  4NWW A;  1IQA A;  4QX0 A;  1H4G A;  4XCB A;  1W06 A;  4HN1 A;  2ZBJ A;  5FBJ A;  2FDH A;  1H9W A;  4GH4 A;  4AAX A;  3ZFF B;  4QX3 A;  4MLO A;  4UI9 L;  1URX A;  1OPO A;  2JJ6 A;  3M1H A;  3ZR6 A;  5DDJ 1;  2XWJ B;  4CVU A;  3GHM A;  5EHD A;  3K3N A;  3AL5 A;  3WNK A;  3S6P A;  4QHB A;  4L0P A;  5FZG A;  1LOB A;  5LA9 A;  1QNW A;  3LOB A;  2QCS B;  3KZ4 C;  5EQU A;  2GMM A;  3PU3 A;  3TEY A;  3D0J A;  3NAP B;  4PT6 A;  2XPJ A;  3MLK A;  4GB3 3;  4AGV A;  3AMM A;  1BXH A;  1JU3 A;  1VRH 3;  5LK5 A;  4BXS V;  1S0F A;  2HWF 3;  3U78 A;  1RUE 1;  1YUD A;  3THC A;  1PX4 A;  4QPI A;  2J42 A;  2LW8 A;  2WNU C;  5CAZ A;  3I54 A;  4IV3 B;  4CE8 A;  4D94 A;  1VB2 A;  1L7L A;  1R1A 3;  2NZ9 A;  3NRU A;  4AK3 A;  4EN9 B;  1WW5 A;  4XFF A;  2Q8C A;  4CEY C;  1POV 1;  1MS9 A;  4FPG A;  1QJE A;  3LQC A;  3HN1 A;  4Q4Y 1;  2QZ3 A;  4NID A;  2YHJ A;  3ZSK A;  4LK6 A;  4XUO A;  4OI1 A;  2CWS A;  5H9R A;  1LOA A;  5JSR A;  2A6X A;  1C8M 2;  1YI7 A;  4GMP 0;  2G4I A;  4IGQ A;  4FTE A;  2ZGN A;  1NA1 B;  4RHV 2;  1O8P A;  3AMH A;  3IT8 A;  2W52 A;  4E4Z A;  3RJR A;  5CKQ A;  2WS9 3;  5FK8 A;  1PZ9 A;  2XR4 A;  2K2S A;  5E16 A;  1XQN A;  3CZJ A;  1FYU A;  2MEV 2;  3N9O A;  3NNF A;  4IE0 A;  3ZXA C;  1PHM A;  1AF9 A;  1RTV A;  4KWJ A;  4JRL A;  4FT8 A;  3VGI A;  4HKO A;  2XJU A;  1YIP A;  2VZV A;  1QJU 2;  3G7D A;  5JI9 A;  2WZR 1;  2D43 A;  3D82 A;  1AJK A;  2IUW A;  3OGV A;  2VZO A;  5A7P A;  2YXS A;  1IQD C;  1O3S A;  4FFI A;  3PJQ A;  3TOJ A;  4XDO A;  3FHA A;  3IAQ A;  4YLZ A;  5LW9 A;  5FO7 B;  3U07 A;  2O8O A;  1RUN A;  4ARY A;  4XUQ A;  3POE A;  3MIG A;  1BKZ A;  5CU1 A;  4RS5 B;  4RFT 0;  1K5J A;  5LZ6 A;  5JXI A;  3U37 A;  4AFA A;  1PO1 1;  4ZPI A;  1LU1 A;  1UMZ A;  4KWK A;  3VKN A;  3HD8 B;  5LBC A;  3ROU A;  4LBQ A;  1O7F A;  2VZR A;  1SLI A;  4A7K A;  2I45 A;  2VD7 A;  3GDB A;  3VD4 A;  2WLP A;  1FOD 2;  5DAX A;  3D0S A;  1UOF A;  2DCJ A;  1E57 A;  2PHF A;  5JOW A;  4X8P A;  1AR8 2;  2XWB B;  3H3U A;  1H9P A;  4LO7 A;  4CP0 A;  3FHI B;  1FX5 A;  1QJX 2;  2YB7 A;  3MFA A;  4IE6 A;  1XBF A;  4FOV A;  4BME A;  3ZFF C;  2RDQ A;  2XL7 A;  2ZGT A;  3I59 B;  1POV 3;  1KJL A;  2NMN A;  1L3J A;  2GN3 A;  1EAH 2;  2PQQ A;  2RS5 2;  4Q4Y 3;  1W28 A;  5GJ6 A;  3R0R A;  3GBG A;  3UK9 A;  2RS1 2;  1IPK A;  4YZ2 A;  5GM0 A;  1ZRC A;  4IES A;  2EIB A;  2QBX A;  3VHN A;  1F4H A;  1RUG 2;  2RS3 3;  3GZT B;  5BY5 A;  1NCQ A;  3IBM A;  1PK6 B;  3VBO B;  1APN A;  1UX7 A;  4AW7 A;  5C70 A;  4TLG A;  3UL2 A;  1F35 A;  4LXL A;  5LWB A;  2IZW A;  4FXK B;  3VBR A;  1YJK A;  1OC1 A;  4Q8L A;  2Y6F A;  3WNO A;  3KT4 A;  4YWA A;  3UT0 A;  5DXD A;  4EN0 A;  1CIY A;  1JW6 A;  3IIA A;  2VVE A;  4RD7 A;  1VIW B;  5KXE A;  5T5P A;  4A2U A;  2HWE 2;  3VD5 A;  2XUE A;  2ID4 A;  4EN8 B;  3GBF A;  4HET A;  2ZGO A;  4PJY A;  2WO1 A;  4AVB A;  2DFB A;  1HB1 A;  4IXL A;  1UF2 C;  1CAW B;  2IXJ A;  4OCT A;  5TSW A;  3FE5 A;  2BNM A;  2R04 3;  4ITC A;  2EID A;  2G9G A;  3M8L A;  1WCD J;  1Z7S 1;  1X8M A;  3B01 A;  4K40 A;  1PO1 3;  1ST8 A;  4ZS3 A;  5KC6 A;  4X8N A;  2XVG A;  3LEI A;  4CCM A;  5LK7 B;  3ITQ A;  1TNF A;  2PHR A;  3NAP C;  3JCI A;  4IER A;  1W03 A;  1GYK A;  2WAB A;  3FMG A;  5FP8 A;  5LCW L;  2FZ1 A;  5JIA A;  5HCF A;  4J1W A;  1X50 A;  2R1B A;  4QQP A;  3T4V A;  2I74 A;  1DYK A;  4K1Z A;  1FPN 2;  3VBU C;  3W5N A;  1AL2 3;  3J8F 3;  4IV3 C;  1RUJ 1;  5GLT A;  2XVL A;  2FDF A;  2ZML A;  4X6Q B;  3RZZ A;  3RQ0 A;  2VOV A;  1PZ8 A;  1LHO A;  2WWJ A;  3UYJ A;  4DS0 A;  3U0Z A;  4YW3 A;  4IL7 A;  4RGG A;  1GZC A;  2RMU 3;  5FZ8 A;  1MQT C;  1ENR A;  2ZKL A;  2GH8 A;  3GCX A;  3I3D A;  3LDK A;  4QPG A;  1N1T A;  5DUX A;  5FZ3 A;  3ZIX A;  1HW5 A;  2CU5 A;  2P3I A;  3FBY A;  1AYN 1;  2VZS A;  3IM0 A;  4CEW B;  1JZ4 A;  3WVJ A;  2OA2 A;  1GUI A;  1HLC A;  1NA1 C;  1OSG A;  1RUC 2;  3IB3 A;  2B9U A;  1MZ5 A;  5A3N A;  2O1Q A;  4IEV A;  4K20 A;  5IW0 A;  4CPB A;  4FPJ A;  2PHD A;  2P3Y A;  1CQ9 A;  2IC1 A;  5H9Q A;  1QIQ A;  2NYY A;  1VPH A;  3MID A;  1LOE A;  1GKB A;  4NAO A;  1RUH 1;  4YVS B;  4BH9 A;  1DF0 A;  1ZNP A;  2B5H A;  2ZHK A;  3WNL A;  5LB6 A;  2W91 A;  4JDN A;  1TMF 2;  3R4S A;  4KQ7 A;  4Q29 A;  3U10 A;  3KGL A;  2LTN A;  3O5S A;  2WUH A;  3MPP G;  2Z79 A;  4R4X A;  4DZG A;  2W2I A;  2VUL A;  3J9S A;  1LGC A;  1OLM E;  2QQW A;  3I3B A;  1PO2 1;  3OPZ A;  4L11 A;  1ULD A;  1LHV A;  4IE4 A;  4R9A A;  2VXJ A;  3I2J A;  5BV6 A;  1VAL A;  2ZX4 A;  2D98 A;  3H1M A;  5AVA A;  3ZN5 A;  1Z7S 3;  4GB3 2;  1LCL A;  1VRH 2;  4DUX A;  4XF4 A;  3H8U A;  2HWF 2;  3M4F A;  3MLL A;  2G9F A;  4LE3 A;  2ZA9 A;  1YI9 A;  3S7I A;  4AI0 A;  5DAW A;  2W39 A;  3G6J B;  4KNC A;  4XAC A;  1IZ3 A;  4BXF A;  3N9M A;  1Q8P A;  1R1A 2;  2BV4 A;  4LBM A;  1RIT A;  1K5M B;  3M3C A;  5FUN A;  3T2P A;  4BMB A;  3BI3 A;  4HKL A;  3ZYF A;  2H6B A;  2VZT A;  3B02 A;  4HK9 A;  4Y1X A;  4CCC A;  1V6J A;  1BLZ A;  2VNG A;  2AEN A;  3FC0 A;  3JBG 1;  1OLQ A;  1X9T A;  1YHF A;  3SCH A;  3ZSJ A;  1W0N A;  4LLO A;  1PGL 2;  1TME 3;  4YG3 A;  2CY6 A;  1RUI 3;  4XOG A;  4YZ5 A;  2CSG A;  1W8W A;  2ARX A;  2WS9 2;  5D8A B;  2P34 A;  2OQ6 A;  3ZFE B;  1DHK B;  4IV1 B;  2WN2 A;  1W8O A;  3WDY A;  4LBN A;  4OYU A;  1EV1 1;  3NV2 A;  4KI5 M;  4LUK A;  3POG A;  4Q27 A;  1PK6 C;  4QGN A;  5LBF A;  2WNU A;  1V6M A;  2PAM A;  4HG6 B;  1MZ6 A;  2RVA A;  1JYC A;  4DOU A;  4FVV A;  3T0D A;  1VAM A;  4CEY A;  2YPD A;  1LNS A;  1WCU A;  4W50 A;  3V0A A;  2PTM A;  2VZ3 A;  4H7M A;  4RYD A;  1GQP A;  5DDJ 2;  1LJ7 A;  2VU9 A;  1TG7 A;  3I2H A;  1DGR A;  1VBA 1;  5FCC A;  3MUY 1;  2B39 A;  2BBA A;  1W9F A;  5GLU A;  2W1W A;  1XYO A;  1IG3 A;  2P1B A;  3LZZ A;  4OHZ A;  1REF A;  2JD4 A;  4PHZ A;  2AGS A;  3H1Y A;  1E5S A;  4G3Y C;  5BNP C;  5JOY A;  4GH4 B;  1VBD 1;  5CIR A;  3DN7 A;  5A7N A;  2OT7 A;  3SCG A;  3ACH A;  3POI A;  1KD7 A;  1S4C A;  2VMG A;  4Q26 A;  5DAQ A;  4QXC A;  1VJ2 A;  1GAN A;  4YG0 A;  2XOM A;  3VZM A;  2F4P A;  3P6B A;  3RWK X;  2ZX2 A;  1VAK A;  3DXU A;  1A8D A;  4K6B A;  4Y5S A;  3UKN A;  2Y26 A;  4PBO A;  5JIU A;  4Q4Y 2;  5A7W A;  1NE6 A;  3N4M A;  3RZM A;  5K8S A;  3IMM A;  4WVW A;  3MEP A;  3AX4 A;  3R4U A;  1HV0 A;  4AI8 A;  2DV9 A;  1DQ0 A;  1GNH A;  1RJ7 A;  3OCP A;  3V56 A;  4YM3 A;  1G9D A;  5JAX A;  1D2Q A;  3NW4 A;  5FYZ A;  1I3H A;  1B35 C;  4QXH A;  1ZYB A;  1NQJ A;  1W9T A;  4M3C A;  1AX0 A;  4YG6 A;  5T55 A;  3WW1 A;  4XW3 A;  4W6Y A;  4XF3 A;  4M0N A;  1OUR A;  4I09 A;  2SLI A;  4AED C;  4OI4 A;  5A3T A;  4Z8B A;  3ZMN A;  5AVP A;  1RUF 3;  2BYV E;  4NHK A;  3VZJ A;  3ZFF A;  4HVR A;  3AL6 A;  4QDQ A;  5GLZ A;  1O91 A;  1KEX A;  5C5T A;  2WZ8 A;  1SLC A;  2ZGQ A;  1RUD 1;  3PVO A;  1D0G A;  1Y9Q A;  5A1A A;  1RHI 1;  2PHX A;  4ARX A;  3K51 A;  4OHX A;  1HRI 1;  1OH3 A;  3GJB A;  5F6K A;  2CGP A;  5BPX A;  4Y5Z 0;  2XJS A;  3BAL A;  1GBG A;  1ACC A;  1PO1 2;  3C7O A;  3AKQ A;  4QM9 A;  1K45 A;  2PXJ A;  3B94 A;  1LED A;  2B45 X;  2JE7 A;  1W6O A;  2G9Z A;  1AR9 1;  4AAP A;  1UD1 A;  2R07 3;  4QKN A;  4EN7 B;  4AQT A;  3LCP A;  4YGD A;  4QDR A;  3MFC A;  3S30 A;  5FKC A;  4CCK A;  3HPN A;  1MEC 1;  3PU8 A;  4BIF A;  3PIJ A;  1UAI A;  1NLS A;  3ZFG C;  3I97 A;  3PIG A;  4XHB A;  2D44 A;  3J8F 2;  2BVV A;  3OGG A;  5FP9 A;  5FY1 A;  1FMD 1;  4QKD A;  5H9P A;  5KHJ A;  1K5M C;  2ARE A;  3AMP A;  3O0V A;  4FI9 A;  4LBQ B;  3RWN A;  1PIV 1;  3A7Q A;  4PF1 A;  4AFD A;  2RMU 2;  4B29 A;  1JUH A;  4AI2 A;  3OPW A;  4LOS A;  4UFH A;  2WZP P;  5FIX A;  1NAE A;  1AZD A;  3MGU A;  5ACA 1;  1VMH A;  1Y4W A;  1AJO A;  2ILM A;  3A22 A;  3RPQ A;  4Q4W 1;  1S0G A;  1GP4 A;  3PVB B;  3W59 A;  3V64 A;  1H2M A;  4MGK E;  5FMO L;  3CO2 A;  1BCX A;  1CAU A;  5T50 A;  3APB A;  1H0B A;  2XJT A;  4BLJ A;  3NAP A;  5D8A C;  1XXN A;  3T09 A;  1G9C A;  3HR9 A;  3D4K A;  3ZFE C;  4IV1 C;  5FLJ A;  1D4M 1;  4NRO A;  4YGE A;  3OY8 A;  3IKW A;  3VBU A;  3WF1 A;  4IV3 A;  3DCQ A;  2D6N A;  2QQL A;  2ADD A;  4B8E A;  1QOO A;  5CG9 A;  4AHZ A;  1MQT A;  4M0H A;  3WXP A;  3HJR A;  4XHX A;  5LEJ A;  2JB4 A;  3H8O A;  2DTW A;  4BOW A;  2OUH A;  5IJR A;  5FZD A;  3VBR B;  3AJZ A;  2KD7 A;  4Q1P A;  1VBC 3;  4MXW A;  5HV4 A;  1NA1 A;  1ULP A;  5A7S A;  4QX8 A;  1ALY A;  1S55 A;  3JQX A;  3KVA A;  3ZM8 A;  4AEM A;  4COW A;  1Z7S 2;  5CBL A;  2B8M A;  2XHN A;  2VCA A;  2XKO A;  2WT1 A;  4XUR A;  1MS4 A;  3KQ4 B;  1H1M A;  3SCF A;  2H0V A;  1OLR A;  1B09 A;  3O14 A;  3Q8F A;  3H3Z A;  2E63 A;  3AKP A;  1GWM A;  2VM9 A;  4QX2 A;  1LHU A;  5IVB A;  2A6W A;  1BHG A;  2WT2 A;  3QAC A;  4PLM A;  4JZR A;  4TLF A;  4SLI A;  5E1R A;  4AVA A;  4FPY A;  2DBI A;  1BYH A;  2WA4 A;  1REE A;  1CJP A;  1FI2 A;  1QEX A;  1R09 1;  2RJK A;  2GNB A;  4N9I A;  4RGA A;  5JWP A;  3QLQ A;  3DXT A;  2K9Z A;  1PIV 3;  1KS5 A;  1TME 2;  3VBF C;  2PLV 1;  1RUI 2;  1W6Q A;  1W2T A;  1CAX A;  1WD3 A;  2R06 1;  2VUC A;  3NNL A;  5B4N A;  5EJ1 B;  2W87 A;  4FCA A;  3I2F A;  3I8T A;  1C28 A;  1OF4 A;  1AYN 2;  3K48 A;  4PDW C;  3THD A;  5JR2 A;  2BZD A;  2VH9 A;  3DPR C;  3SHR A;  1MS1 A;  3OBA A;  3OPT A;  1KDK A;  1HB3 A;  4MYE A;  4AFC A;  1Z0H A;  2XKP A;  2IWG B;  4EZ4 A;  4QPG B;  4XF1 A;  2QNK A;  2W3J A;  4V1P A;  4NUB A;  4GKY A;  1SZB A;  2BFU S;  3BU7 A;  4O9G A;  1H2N A;  2BUK A;  2DCT A;  4TWT A;  2DU1 A;  4LHL A;  3RYK A;  1HN1 A;  5FP3 A;  5A3M A;  2D40 A;  3K2O A;  1XE8 A;  4JKK A;  5EFU A;  4N43 C;  2YUE A;  1ND2 C;  5K0U C;  3NKG A;  2C24 A;  1H30 A;  1ZZ6 A;  2D97 A;  1OD5 A;  3LEM A;  4QT6 A;  3TN9 1;  4P00 B;  1BMV 1;  4D3W A;  2QQO A;  1QJZ A;  2Y34 A;  1PGW 2;  3OYW B;  1LHN A;  3ZDV A;  2ZZQ A;  3O1U A;  1PK6 A;  3ZOI A;  2F4L A;  3BIE A;  3WUC A;  2GC0 A;  4O7X A;  3H8R A;  2LS6 A;  2D3P A;  3ZYJ B;  2P6H A;  3N9Q A;  1JYI A;  1C8M 3;  1LUL A;  4MGZ E;  4IEX A;  1W2U A;  1F5J A;  3FHQ A;  1OFN A;  2WLQ A;  4PBP A;  3TRS B;  3VBH C;  4P08 A;  5CYY A;  3JD7 3;  2HKX A;  3DYP A;  3ILN A;  3ZXG A;  5C6C A;  4W4Z A;  3DEC A;  1Q8O A;  3TWI A;  1T6G C;  3WZ1 A;  1MR5 A;  2J1U A;  2R06 3;  2QQI A;  2XB6 C;  5F6L B;  2W5F A;  4ZXK A;  2Q8D A;  5BNP A;  3O1O A;  1QDO A;  4YZ1 A;  2VVF A;  2X29 A;  3HN3 A;  2CGN A;  2NLR A;  3MYX A;  4XAE A;  1VR3 A;  2DDU A;  4YRD A;  4AFB A;  4LTA A;  2ZX3 A;  4LBK A;  4BHP A;  2ZTN A;  4HK8 A;  5L73 A;  4CA9 A;  1JOB A;  1XYP A;  5DPN A;  4LIU A;  1RUF 2;  2RM2 3;  3U14 A;  4E2Q A;  2Y60 A;  2BTV C;  3LFI A;  3A0N A;  5EYY A;  4YPJ A;  4DNY A;  2R0H A;  2DTY A;  4MAD A;  1JUI A;  2ZHL A;  2JKX A;  2YRO A;  3TEZ A;  2WNU B;  3PUI A;  2ZOE B;  5FY4 A;  2CV6 A;  3HMY A;  1HDK A;  3Q8E A;  3RDI A;  5KHK A;  5IK4 A;  2YC2 A;  3ACG A;  4NO4 A;  5A6Q A;  4CEY B;  5I0D A;  1B35 A;  1ZRD A;  2R07 2;  1VBD 2;  4XTP A;  3AVR A;  4DRR A;  1VRB A;  1JH5 A;  5FDB A;  1IG0 A;  3AZX A;  4P9L A;  4AED A;  4IET A;  4AHX A;  4DIQ A;  2GH2 A;  1O8S A;  1SDD B;  2E7Q A;  1W8F A;  1UYX A;  2OPK A;  3KQR A;  4CCE A;  2VAU A;  5ANQ A;  1ONA A;  3ES1 A;  4CUG A;  4PI0 A;  3DGT A;  3LD8 A;  1I9R A;  3IAP A;  4AVV A;  2VQU A;  3ZN4 A;  4BQY A;  5F37 A;  1RUG 3;  3AXD A;  3CDZ B;  4LT5 A;  5FV3 A;  2OQ7 A;  2B7Y A;  2IXL A;  4FPO B;  1OOP C;  3SKV A;  3O1M A;  1QMJ A;  4BK4 A;  2JD9 A;  1Q56 A;  3L2Y A;  3ATG A;  4Y4R A;  5L9V A;  4Q0S A;  3ALQ A;  1FV3 A;  1DU3 D;  4QGL A;  4COY A;  3D8C A;  5FQ0 A;  2QUO A;  5T52 A;  4AWD A;  2CGO A;  3K4A A;  4Q0V A;  1DDL A;  2DUO A;  4F7Z A;  4QWN A;  4NE9 A;  3VBS B;  1HRV 1;  1RVF 1;  4J25 A;  5A7W B;  2BW8 A;  2UWA A;  1E5R A;  2G1M A;  3ZVX A;  4Y1U A;  2JEC A;  3ZFG A;  2A73 B;  4BA6 A;  2WBK A;  4N9H A;  1K5M A;  2GMP A;  2EIC A;  5CG8 A;  1DFQ A;  3ENR A;  4J1X A;  2MPF A;  4KBB A;  3B5L B;  1IS3 A;  3RVH A;  4QB2 A;  4M3C B;  3RRD A;  3UV9 A;  4NIA A;  1F2N A;  3PVE A;  3PUH A;  2J1R A;  3KD4 A;  5FRA A;  1H2L A;  1WW6 A;  4LBJ A;  1VBC 2;  3SKJ E;  4KGG A;  3VDC A;  2CAU A;  2J7M A;  2RE9 A;  5HBA A;  4B4P A;  1UXX X;  1G6N A;  1O6U A;  2CNA A;  4N7U A;  4XIL A;  5D8A A;  2PN5 A;  4ZU5 A;  1QXR A;  2BJS A;  5CZK A;  3EO6 A;  3M3I A;  4I0B A;  4IV1 A;  2Q8E A;  3I2K A;  4N53 B;  4LLF A;  4DXZ A;  2X53 S;  1AR9 2;  3H42 B;  1IPJ A;  4OHW A;  2HJI A;  4ZON A;  5FUP A;  3OTF A;  5AC9 1;  3ES4 A;  1OFS A;  1TVG A;  1UZV A;  1V9U 1;  2HEW F;  1G9F A;  2VG9 A;  4CUC A;  1S2E A;  1WMF A;  2EXI A;  2IXK A;  5LY2 A;  3TNP B;  4QQH A;  2BOJ A;  2VBP A;  1DGL A;  5FPA A;  1RGS A;  4K8F A;  4CDX C;  3AK0 A;  2W0X A;  1W6O B;  1PIV 2;  3ZXF A;  2HWD 1;  2AAC A;  2XLF A;  1AR6 1;  1H6Y A;  4LBQ D;  1R08 1;  3NNG A;  2AZ5 A;  2ET7 A;  3EHK A;  4Q4X 1;  3VKF C;  5EPA A;  4JDM A;  1YRZ A;  2OW4 A;  2Q30 A;  4Q5O A;  1NXM A;  1Q43 A;  4HSJ A;  3WDW A;  4E8C A;  1BBT 1;  2IXC A;  1UQX A;  1QQP 3;  1ZBE 1;  4DXR A;  3VZO A;  1TMF 3;  2XH6 A;  3WDV A;  1D4M 2;  4NHX A;  5K7P A;  1W8U A;  2Z5W A;  3UET A;  4MHU A;  4BQX A;  4YGC A;  1TNR A;  2D7F A;  3GZU C;  4FAG A;  1CAU B;  1PVC 1;  5FZM A;  1ULO A;  2B9V A;  2YBP A;  3I3E A;  5KHH A;  4L2N A;  2JEM A;  3VBF A;  4QHO A;  2WR9 A;  1PX3 A;  2VNV A;  3AXE A;  5FZ1 A;  1V0A A;  5I8T A;  3OY8 B;  1CX1 A;  1US2 A;  3BB6 A;  5F3G A; 
#chains in the Genus database with same CATH homology
 5A6Y A;  2JDY A;  4CE8 A;  1OUX A;  1GZT A;  5A3O A;  2JDP A;  1W8F A;  2BOI A;  2BP6 A;  4AOC A;  1UQX A;  5A70 A;  4UT5 A;  1UZV A;  2JDH A;  5A6Z A;  2JDU A;  2VUC A;  5HCH A;  2BV4 A;  2BOJ A;  2WRA A;  1OUS A;  1W8H A;  1OUR A;  2JDK A;  2VUD A;  1OVP A;  1OVS A;  1OXC A;  2CHH A;  3ZDV A;  2JDM A;  2XR4 A;  5A6Q A;  5D2A A;  2WR9 A;  2JDN A;  2VNV A;  5A6X A;  3DCQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...