1JODA

Crystal structure of murine olfactory marker protein in spacegroup p43212
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
160
structure length
160
Chain Sequence
DGPQKQQLEMPLVLDQDLTQQMRLRVESLKQRGEKKQDGEKLIRPAESVYRLDFIQQQKLQFDHWNVVLDKPGKVTITGTSQNWTPDLTNLMTRQLLDPAAIFWRKEDSDAMDWNEADALEFGERLSDLAKIRKVMYFLITFGEGVEPANLKASVVFNQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Olfactory Marker Protein
publication title The crystal structure of the olfactory marker protein at 2.3 A resolution.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 29
structure length 160
sequence length 160
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06554 Olfactory_mark Olfactory marker protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.390 Mainly Beta Sandwich Jelly Rolls Olfactory marker 1jodA00
1JOBA 1ZRIA 1F35A 1JODA 1JYTA
chains in the Genus database with same CATH superfamily
4UT5A 4XBQA 1VBA2 1RUC3 4LLOA 5LA2A 1DDLA 4R8HA 4YWAA 1DF0A 1CAWA 2FMYA 3H3UA 4AVCA 4QAWA 1CPMA 1EYBA 4X6RB 2AYHA 2DBNA 2IXKA 3I54A 2XJVA 1PGW2 4IGQA 5FP4A 2QQVA 1KD7A 1Q8OA 4LO6B 3ST7A 1VBE2 3UL2A 4LHKA 1IPKA 1O5UA 5FAXA 5FZAA 1SPPA 2VMCA 1D2QA 1HDKA 5FWEA 4LPLA 1O59A 3TYJA 1ALYA 1Q8PA 4BISA 1H8TC 3BTYA 5CU1A 3RI8A 5F32A 3PVEA 5F37A 3PMSA 3DYMA 3LEIA 3H42B 2K0GA 2WO7A 3SQOA 1AL21 4AFMA 4META 2E63A 4XHXA 2W68A 1NKGA 2HWB2 3HAGA 5IATA 3HNMA 3TN92 3SC7X 3OJBA 2ZGMA 5C8CC 4KGGA 2YUEA 1G9DA 3THPA 3KV5A 3HT2A 3NAPA 1XNAA 1EPZA 3GDBA 4A7KA 5IK7A 4GJZA 4KU8A 2RS11 1URXA 1WA6X 4QPGA 4MGQA 3FE5A 2WS92 4MX3A 1I3HA 4XQ4A 4QGLA 4XFFA 3WNKA 4CDXB 5JAXA 3JBG3 1S1AA 2BWCA 4L97A 2DVAA 3ENRA 2WS93 1PVXA 1W6MB 1ZZ7A 4FO9A 1PVC3 3AZVA 4PDWB 4E8CA 4OCTA 3WOGA 1POV1 4UFMA 1OPOA 2DTWA 3MICA 4GWIA 1LRHA 1RUJ2 2DUQA 1R081 2WBKA 2BYVE 2ZGTA 3MIDA 1ZREA 2JIJA 3N9NA 2Y33A 4CZSA 2H6BA 3GYDA 3AL5A 1RUJ3 1GICA 3DPRC 3M3OA 4P08A 4JQTA 3ZYFA 3HQRA 1CESA 4JHZA 2WZEA 1O3TA 5BNNA 2Z69A 1OPMA 4YGBA 3BIEA 2BGOA 2V5DA 1IZ3A 5IVYA 3WDUA 2DCJA 2Q8OA 4CCKA 4MGTA 4HG6B 1YFUA 4HK9A 2XL7A 3VBUA 4CCEA 2R0HA 2AC1A 3AMQA 1PGSA 4GZ9A 4HXCA 1MQTA 4H14A 4JGYA 1NUKA 2VZ3A 3FLPA 3U37A 2CHHA 3WUCA 5CEHA 4NRMA 4NIAA 4CU9A 1UMZA 4C0HA 4B1MA 4A3ZA 2FDHA 1OQ1A 1CZSA 1PZ9A 1RUH3 4OI2A 4FQ4A 1UY0A 4FTBA 4IEXA 4CCLA 3D3AA 3HWJA 5FYTA 2RJKA 3JD71 4MO3M 5FZ7A 3DXTA 1W8TA 5JMOA 5EWSA 1LHNA 4EN7B 1VP6A 3KM5A 4NAMA 4ZS3A 5JIUA 5FPLA 1OOPA 2PN5A 5DAPA 4LJHA 4F7ZA 2JICA 3H7JA 5J36A 3BOWA 2Q0AA 2DCZA 1WCQA 3MO4A 5HCAA 5IFTA 1TVGA 5LA9A 1AJKA 3FUQA 1GV9A 4UW6A 4EN9B 3RQ0A 4ARYA 4EROA 2YU2A 1RTVA 2DDUA 3N35A 2V5YA 1K5MC 2UU8A 2VAUA 5EYYA 4BM8A 4CPBD 2ENRA 1VIWB 2C9AA 2RDRA 3SKJE 4ISQA 1JOJA 4J1XA 5EXOA 2R30A 1GNZA 1ZNPA 1L3JA 2FMDA 1LOCA 2Y64A 2OYZA 4Q4V2 3VLBB 1U5YA 5FZOB 1CN1A 3FBYA 3GBGA 4AFCA 3WG2A 5T52A 3ZFFC 1I1EA 1VRH1 3WNOA 1SACA 4CU7A 3VBSB 5CFDC 2BJSA 2W1SA 5FMDA 4URAA 3O0XA 1FV2A 4FPKA 4K20A 4BDVB 4IL7A 5FMCA 1RB8G 4CCOA 4AEJA 4MGIE 3WHUA 1UX7A 1DU3D 1WMFA 1O4YA 3RYPA 1PMJX 1EUTA 3OCPA 4M3CF 4BQ5A 1D7PM 5IAXA 4QU1A 5DZFA 3UK9A 4BA6A 3KT4A 2JDYA 5F8PA 3DCQA 5CG9A 2W0XA 1X8EA 3T0AA 5F3EA 1XYNA 1W6NA 3ZFFB 1OLQA 2VOXA 1MVEA 2MHFA 3FMGA 3IMMA 3KD4A 5CFDB 5C4WA 5EJ1B 3O0WA 4ZKTB 4L8QA 3SEPA 3LKJA 3R05A 1M4WA 2K2SA 2VMDA 4RHV3 3V65A 1IPSA 2RMU2 3VD5A 1FPN1 5IUQA 4COUA 3U0ZA 1ZRFA 4NIDA 1RMU3 4IV3B 1GQPA 2D98A 1UXZA 2CDOA 2WN2A 1QH6A 2XVKA 1Q3EA 5KHHA 5T5PA 5A3LA 5IVEA 1O4TA 1OURA 4QHBA 1LHOA 4NROA 4SBVA 3WG1A 5KHIA 5M0TA 3PMEA 4NPRA 4QDQA 2WNEA 4ZONA 5F3CA 1ZZ9A 1H9PA 1F5JA 1VR3A 2ZX4A 1CX4A 2NN8A 4XF4A 1PGL1 5KXDA 2JENA 3BVCA 4U36A 4NIIA 1MPXA 3RJ2X 1DLLA 5FYHA 1ZBE1 5IVCA 4JTOA 1HIXA 5A7WB 3ECQA 5FPZA 3GZAA 5GLWA 4XUTA 1AR62 1NA1A 1NCRA 2EIEA 1ZZ8A 3ZFEA 2ZXQA 1GNYA 1IHMA 3KMHA 3SISA 3NJZA 1FYUA 4OLLA 2IVJA 1R1A3 1GANA 2ZAAA 1VBD1 4RA0A 1JYVA 1VAMA 4BQWA 3L9JT 4XAAA 3KHCA 4AI8A 1O6UA 3PJQA 5J1XA 3OY8A 1UY3A 1GNHA 3H8UA 4B7EA 5CA6A 1W8WA 3VHPA 5FCCA 3JU9A 1ULEA 2RM22 2VC9A 1EV11 1SLTA 2P34A 1RUE2 5FYIA 1MS1A 2OQ7A 2ADEA 2WNVA 3LOIA 3S5QA 5J96B 4HFSA 4AFBA 5FRAA 3IMNA 1REEA 1DGWX 1DZRA 1QJX2 4QX5A 4XF0A 3ZX7A 1J3QA 3LPFA 3BOPA 4Y33A 3POGA 3P3NA 4WM8A 2ZABA 4K1YA 4V2WA 1QF3A 2DVGA 3H1MA 4LORA 5A6ZA 5LW9A 2C0ZA 2BPA2 1AYM3 1N3PA 2VTXA 3T2OA 1LECA 1BKZA 1AX1A 3OF1A 5FIXA 1UL9A 5FP9A 1IS4A 2AREA 1WCKA 1SEFA 4UFIA 5FY9A 1R093 3J4UH 1NOVA 3P1IA 4P00B 5KXCA 3IDEA 1MS5A 1A8MA 1SDDB 1ZZ6A 2DUOA 2EAAA 2WIIB 4YVSB 5JOWA 3E6CC 1WMEA 3KVAA 2YU1A 3IDCB 3OBZA 3KGZA 2Q1FA 5GKAC 4PLMA 4XFCA 4TZDA 1CZVA 2LROA 3CZUA 3J9SA 1H1AA 5BV6A 2WSVA 3M1HA 2WWSA 4RS5A 1UD1A 1W06A 5L36A 1UY4A 1OD5A 3K3OA 4A4AA 2WZR3 1JUHA 3WR0A 3URFA 1LODA 4K6BA 5J09A 2JDAA 5GZCA 1DQ5A 2XBO3 1POQA 4QXHA 4A44A 3VBOA 3M3QA 5FO7B 3MDPA 3C7GA 2XUEA 3IIAA 3WD5A 3A4UA 3TN91 1MEC1 2XONA 4N43C 4XC9A 3AKTA 3I2JA 1COV3 1W6OB 1O8SA 3S7EA 2B9UA 1AVBA 1V9U1 2XGXA 4AEDB 1US2A 3NV1A 4LUMA 3MYXA 3R4UA 3BKZA 3VBFA 1HRV3 1BHGA 1G8WA 1OSGA 2VMGA 3KWVA 4GH4B 1XE0A 4E4DX 4F3JA 4ES8A 5BNPC 2XLFA 5JCTA 3I2GA 4ISRA 4XABA 2IXIA 4TLFA 5H9SA 3VZLA 4QPWA 5FPBA 3NV4A 1ENSA 1RHI1 2ZA9A 2VNOA 1LGCA 4YRDA 1QNYA 3IDAA 3SEEA 3HVDA 3R4DB 4GB31 2ID4A 3GZEA 3VBHC 4K1ZA 2BGPA 1ASJ3 1HXS3 1ZRIA 4N7UA 3MPPG 4IEPA 2W39A 5FKCA 3SCGA 1JZ5A 4ZXEA 2DBIA 3OGSA 5F5CA 1AX0A 3AFKA 2IFRA 1J3RA 1VBC3 4YW7A 5GLTA 4HKLA 1PIV1 3SHRA 4NAOA 2HEVF 1FOD3 1MS0A 2HWE2 1XBFA 3R4SA 5FZHA 5SV8A 3T4HB 4E4HA 3Q8AA 5F6LB 2GAUA 3LFIA 3FX3A 2R1BA 4EN6B 2JDKA 3ZXKA 4DINB 1AJOA 2PHTA 3W20A 4LNVA 3I2OA 3KS7A 3SH5A 1OH4A 4YW5A 2O14A 3VBRB 2OXBA 1JU4A 1OVPA 1U5XA 2OZJA 3L2HA 2NPIA 3M8LA 4N9HA 3VKLA 1BBT1 1D0GA 1WD4A 3MI8A 1H6XA 1W9WA 2ERFA 5JOXA 3ACLA 5LZ6A 2P6HA 2F4PA 3ZIWA 5JXGA 1QQP2 4FP3A 4P9XA 3ZOIA 3AYEA 2XKOA 3VKOA 1C28A 4B8EA 1C5HA 1BK1A 4QHZA 1T6GC 3GNEA 2I07B 2D6MA 1UQXA 1FV3A 3SNMA 1W0PA 4OHWA 3U78A 1SPPB 5CVRA 5K0UA 1ZYBA 5JXJA 1RVF3 1B35A 1MZ5A 2BWAA 2VOWA 4MH0E 3J7NA 5JSPA 1BCXA 5K9YA 2RE9A 4TN7A 4UW3A 1YQ5A 3F95A 1GOHA 1NYWA 4K7JA 3D82A 2VGDA 5T55A 3ZYBA 4XCBA 4M01A 3N7LA 3DYPA 1HW5A 3FZ3A 4AYUA 3S30A 2WNUC 3OPWA 3OPZA 3QLQA 3OBAA 4AI2A 4IE4A 4XZUG 1FMD2 1WGPA 2DCKA 2IXLA 2RDQA 2WA4A 3JB8A 4JGZA 3O14A 4LA3A 3I7DA 2WAAA 5IFPA 1WLDA 1XYPA 2CV6A 2BW8A 1IKPA 3NAPB 5FPVA 4CDWA 1NT0A 2O0OA 4YSFA 5HXMA 1AL22 2VO5A 3HQUA 3RDIA 4GA9A 1LCLA 1W90A 1JXNA 3SH4A 1BLZA 4AVBA 2V09A 4Y1XA 1F2NA 3J7HA 4RR3A 1SFYA 2P3YA 5FV3A 5I8TA 1XQNA 2Y26A 4QDSA 5E6HA 3H0OA 5LBEA 5FXZA 4BLJA 5KHGA 1MQTC 1PHMA 2Q4SA 1HRI3 5FZKA 1V6LA 1W6PA 1OF3A 3HD8B 3UYJA 4DFSA 2ZEZA 4Y1VA 4QQ2A 4E27A 3FBMA 4O65A 5LBFA 4AFAA 4DY3A 2ARXA 1ULDA 2RS13 5KC6A 1I6XA 4FPHA 1GKBA 4AZZA 4CDUC 4C90A 3KV9A 3ZR5A 2ZOEB 1C1FA 2OPKA 4YG0A 5BNNB 4L9BA 4B29A 3G7DA 1KS5A 4BMEA 4IE7A 4GKYA 4TYSA 3VDDC 5JZGC 1PMIA 2F4LA 4ZU4A 4YM0A 3NNGA 1R082 1MACA 4FPCA 2RMU1 2ZMLA 4BQXA 1WD3A 3WZ1A 3FWEA 1DFQA 4W4ZA 3BTZA 5DZGA 1MQTB 4JGYB 5JPNB 4Q8LA 2VUDA 4CE8A 5GZGA 2AEYA 4IXLA 1GZWA 4UF0A 4GMP0 3DXUA 1CVNA 4Q1RA 4COWA 3BALA 2XVLA 3CEWA 4S2GA 3KV4A 4XBLA 5L9RA 4AGRA 4JZRA 4WZFA 4XUOA 2V73A 1W28A 4XOGA 2KR2A 1J1LA 5C71A 1G9CA 2JECA 4LITA 5FO8B 4Q0UA 2GN3A 2NP0A 2V4VA 4BQ3A 5EYXA 3WCRA 1H2LA 1XE7A 2AZ5A 5JZGB 3RMYA 4Z8BA 2DV9A 3HN1A 2QQWA 2BP6A 1S0DA 3AZYA 1RUD3 1PK6A 4TSVA 2GSYA 5FWJA 3GZTB 1OOPB 3A21A 1U12A 4DRRA 4PIXA 3E5UA 2HLEA 1NLQA 3OSDA 4HVQA 1SHWB 3P3PA 2HYXA 3NNFA 3ACFA 4K8RB 5LRSA 4IESA 3JD72 1Z7S1 4KG8A 1WLTA 1A6CA 5ABJA 3LIHA 2VNRA 4Y3OA 1XNBA 4P9JA 1TZOA 2EF6A 4I02A 1J59A 2D6NA 2DURA 4XJ9A 4XVHA 4LIUA 4Y4RA 4MZUA 3EHKA 4LULA 3ES4A 5K8SA 2E7AA 1BVVA 3WT3A 1NG0A 2D6KA 2HH9A 3J8F1 3WLUA 2C5DA 3WDWA 3DF0A 3UETA 2VZQA 4F83A 3D8CA 3KVBA 4EWAA 4HK8A 2R041 5A3MA 1MS9A 4IEOA 3RZLA 1KJLA 2TBVA 5C9AA 2Q8EA 4XURA 3SH3A 5CFCA 2GN7A 1VMFA 2E33A 1HB4A 2XLAA 1GOFA 4G4FA 2HBTA 1W8NA 4UW5A 1WA4A 3BTXA 1S0BA 1PNFA 1STMA 1NZIA 4B7KA 1VRH2 2OS2A 2QQUA 2YBPA 2ZGKA 3GCWA 3AXEA 3WF2A 1KRIA 1SCRA 3WXPA 3APBA 4CDQA 1REDA 1US3A 4LBQA 2I2SA 1W6NB 5A6XA 2AH2A 4FFFA 3NSTA 5LCWL 5C4WB 2TNFA 4EZHA 3KLSA 3H9AA 4HONA 1F9KA 2P17A 1HX6A 5T50A 3VDCA 1I5ZA 4Q26A 4XFBA 1TMF3 4QQHA 4XTPA 4V2VA 1IOAA 3U07A 3ZFEC 3D0JA 1W0OA 1RUF1 3ZYJB 1RC6A 1VJ2A 4HPKA 1X33A 2GALA 3CJIC 4ATFA 1WKYA 2ZPXA 3OBRA 4B4RA 3AFGA 3ORJA 4QX7A 4QX3A 5JSOA 2Z4FA 4C8DA 3ZXGA 2YMZA 4EWDA 4CEYA 2VZPA 4YM2A 1CR7A 4KI5M 3ETQA 4BPZA 1ENQA 3FFZA 1AHSA 1TQ5A 1UU6A 4XQDA 4W8JA 2XHNA 2ZHNA 3O5SA 4FOVA 5CZKA 1O7FA 4NRPA 2EXIA 4XFHA 1FPN2 3OGJA 2CU5A 3ZKUA 2WO2A 3OYWA 4XPVA 3GBWA 2WNVC 2GC0A 2D7FA 1XE8A 1NA1B 1NCRB 3ZFEB 4KWLA 5LASA 4R52A 1G86A 4YLZA 2ZS6B 3AP5A 2FZ2A 4UI9L 1ZM1A 2DVBA 2QKDA 5GZDA 4LK6A 1PGL2 1XJAA 4XF1A 2C26A 3K4DA 1IPJA 1YFWA 5D8AC 5E1RA 1TE1B 1ZBE2 3D6EA 3QACA 3QH7A 2RVAA 5L73A 3OY8B 1CAUA 3I3QA 4L11A 3I3MA 5FYMA 4YZ5A 2NMOA 5J98B 5FZ8A 1NE4A 4FT8A 2BVVA 3U4SA 2BQPA 2QQKA 4SLIA 5LWBA 1NXMA 1NQDA 1OVSA 1SLLA 2JG8A 5A1LA 4MG2A 1K42A 1LULA 5JMCA 2VZOA 3ZYPA 2WNVB 5HCBA 1VBD2 1G6NA 2J42A 2HWE1 2XB6C 3VZKA 5DMYA 3WQ7A 4XJ8A 5A7OA 2GU9A 4XXPA 1KGYA 2E26A 4Y4YA 5FJHA 4NE9A 4RGKA 4H7LA 1WWYA 1X8MA 4CRQA 5FYCA 3WUDA 3CKHA 1HN0A 5FZ4A 3HN3A 3QH6A 3POIA 4AL9A 1W8OA 1LR5A 1EV12 4Q2FA 4WM8B 1AR71 1OA2A 5A3OA 4H2AA 3THTA 1QNWA 4IE6A 4Z82A 1Z78A 5B4NA 2HEWF 5EFUA 4Z2WA 4G9SB 4O7XA 2CYFA 3TEWA 3E6BA 3NNJA 5F3GA 1F15A 3OGRA 1XB9A 3VL9A 1GWLA 1SFNA 4QX2A 1AR81 3WP5A 2VL4A 3WG4A 4D6SA 2Y38A 3KCCA 1UCXA 4AVTA 4CCJA 2WABA 2Y60A 3RZKA 1DQ4A 4ASMB 1VPHA 1QKQA 1HQNA 4KQ7A 3BIWE 1OT5A 1XNDA 3AP9A 4RS5B 1VBA3 2AEZA 2EIGA 2A6XA 4LKEA 3MPBA 1V6KA 1QJEA 2ZEYA 2IC1A 3VBOB 3ZXJA 1M06G 3A0NA 2NMNA 2ZGOA 4FPGA 4BXFA 2X29A 4ARXA 2DFCA 1ODMA 1VBE3 2RS31 4BXSV 1FMD1 2XMLA 3VZMA 4AHWA 3DV8A 2QE3A 5FYSA 3GBFA 3CDZB 4FOWA 2IZWA 2BOJA 2WC2A 3NVCA 3ZN5A 3GM8A 4CDXC 4FPLA 1GWKA 3VBFB 3RZZA 3RYRA 2OZ6A 3OPTA 2JDNA 4FQZA 4PDWC 1MEC2 1C4RA 4LO8A 2GMMA 3CHXA 1ZVFA 4YW4A 5JLVA 1V9U2 4KNCA 2HWB3 1NE6A 2WLQA 4GQ7A 1F31A 3TN93 1K3IA 4HT1T 1YQ2A 3O1TA 2G9ZA 4OYUA 4YVWA 3SCFA 1GU3A 1AYN1 2L9LA 4DUWA 4DXSA 1XNTA 1LESA 2XJUA 1RINA 2QZ2A 1RHI2 1DQ6A 5ANNA 5G04L 1HJFA 1ND2A 2WA3A 1QY4A 2ARAA 1JU3A 2B7YA 3QOPA 4GB32 2MPFA 4M0NA 2GH2A 1EAH2 2R16A 3OUJA 4D7TA 3J26N 3OBTA 3HOBA 3P5BA 4J25A 1RUG2 1W3VA 5G05L 2PHDA 1PIV2 2XOMA 1QXPA 3TAYA 3W59A 4LBOA 5JI9A 3FLRA 5ACA1 5FK7A 3RNSA 4Z2AA 4KBBA 2QZ3A 2HJIA 3BB6A 3ABZA 2B39A 4HBNA 1W2TA 5GLZA 3ACHA 2X05A 4QKBA 1J83A 2I45A 3AMHA 4H7MA 3NJYA 4JX0A 1D4M1 3X29B 3WINE 4QQOA 1Z0HA 1MZEA 3CL1A 4AGVA 2KA3A 2XXZA 4XUNA 4JGZC 1BBT2 5K0UB 3CJXA 2ADDA 2NZ9A 3RZMA 1B35B 1ZZCA 4KH9A 3WW2A 1CAXA 2W1UA 3KB5A 3U1XA 4YZ2A 5CKNA 2XDVA 1Y43B 4JCKA 3O0VA 4S2FA 4CEWA 1NCQA 1YWKA 3N3HA 3UKTA 1UOGA 3ILNA 5CIRA 2YHJA 1JZ3A 3MZHA 1SZBA 2J1SA 5LY2A 1UW8A 1AXKA 1V6JA 2OT7A 4L2NA 4I0AA 4IGOA 4YM1A 5FZBA 1X36A 2UYAA 1PO21 2VR4A 1LEDA 4Q4X1 4R9DA 1H6YA 4XJUA 5FBJA 4JGZB 3TB0A 3VBSC 2R071 4Q0VA 3I2HA 1BK0A 2PHUA 3AMMA 4Y1YA 5A6QA 3IPVA 4D7YA 5LK7B 4CDWB 1H1MA 4XUQA 1BJQA 1WMDA 1YC61 4FXGB 4NUBA 5C3PA 1IQDC 3Q8FA 4QPIA 1EP0A 1W9FA 2FDGA 3VD7A 5H9QA 2GZWA 4Y5TA 3FLTA 2WFF1 5AVAA 3RWKX 3VV1A 3S6PA 3T1MA 4RGGA 4RR3B 1OLME 3I2FA 5EQUA 2P37A 3UNPA 3HNYM 1ACCA 4QXCA 1Y3TA 2R6QA 4Q4V3 3CU7A 1W6PB 2VMEA 1CJPA 2EAKA 4NHMA 4XFAA 5T3NA 4J6GA 4QKDA 4N9IA 4IQPA 1L7LA 1X9PA 2JDPA 4YFWA 5I8SA 4KMQA 1F4AA 1BEV1 4XF3A 1CAVA 2XVGA 3N9MA 1XC6A 4LBMA 1L7RA 2JB8A 4IV3C 3U14A 1VB4A 2D3PA 4AAXA 4DUVA 3MIHA 1IQAA 2XQXA 5LY1A 4UFLA 2W08A 1XSQA 4R9BA 1F5FA 1YQ8A 3E5QA 4Y5SA 3T1LA 3H1YA 3OB8A 1F8VA 4UF0B 1GZWB 2A6ZA 1E5HA 4N8MA 4PJYA 2OQ6A 3DKWA 2C4XA 2GC1A 2D40A 3GF6A 2XJPA 1UU4A 2A7AA 1RJ8A 5A7SA 3CMGA 4PIZA 2VCBA 2EXHA 1W2OA 1ENXA 2D5HA 2XG3A 1RUI1 3B00A 4NPLA 4ZY9A 1MZFA 4OHXA 4I01A 4MHRA 4CYDA 4XDQA 4AI9A 2WNOA 3MUY1 3O1PA 2PMWB 3ILFA 3VHOA 2JDMA 3VHNA 4L99A 4ASKA 3BUCA 1QOTA 3RMXA 4MXWA 1UWWA 1JW6A 1IS3A 1GP4A 2RMU3 1LNSA 3CZJA 4QQPA 5CB7A 1W2AX 4CP0A 1PK6B 2Y6KA 4JV4A 1OH3A 1UZ0A 5JUVA 3PVNA 3W5NA 1OHFA 1OXCA 2RS51 2VD7A 3JB4C 2ZKNA 4NOTA 4LKDA 1G9BA 2UWAA 3RZHA 2VOTA 1ULFA 1UY1A 4GIQA 2VBBA 5K4LA 3D4KA 3AXDA 3AYAA 4OUEA 3EXUA 5ABJB 5CFCC 1YYNA 4AI0A 3WCSA 4NRQA 1LOGA 1QXRA 2QTWB 2DF7A 5D1IA 3MHZA 4AI3A 2A3YA 1AR63 4GD4A 5DXDA 3JCIA 3FFQA 1UYZA 1AR91 5FY7A 1LOFC 5BYNA 1LEMA 2PQQA 1Z7S2 2R1DA 2QJVA 4LKFA 4NHKA 5E88A 3GALA 2MEV1 5DUVA 4LO7A 5ERLA 2ZHMA 3I49A 2JB4A 4BQYA 1CIYA 2C6SA 3SKVA 1SDWA 4B3NA 1QJY1 5HCFA 1SFPA 5H9RA 4OUMA 4S2HA 1QH7A 3PUIA 4CP2A 1FXZA 1ZRCA 5CFCB 4MOAA 5JOZA 2LM3A 1XSRA 1L7QA 1K45A 3NKTA 1RUNA 2RM23 1WCUA 2DU0A 3J8F2 4YVSC 1RUE3 4UXAA 2W91A 3AMNA 5D2AA 1Q8QA 1RXGA 5FZ3A 3LWCA 3WEZA 2R042 2Q8CA 4CUGA 5K7PA 2D43A 3RJRA 4FI9A 3J8F3 4QXBA 4CDQB 3OTFA 2ZGPA 5E89A 2WQ8A 4CUAA 1QJX3 3OUHA 4UBHA 2Z42A 1Y9MA 3BPSA 2VZRA 3S7IA 3JZVA 4COYA 5CADA 5CG8A 4OHYA 2YPDA 2D5FA 3AKSA 2DTYA 4IE0A 5BNOC 4Z92B 4ZS2A 1ZRDA 3RG0A 5GALA 2PLV1 4OFGA 4LKSA 3ZSKA 4LO4B 3ZMNA 5EZWA 1LB2A 1ZA4A 4HPKB 4MGSA 4FAGA 1QDCA 2NLRA 3VKMA 3CIHA 4AEDC 4CEYB 1N1SA 3ETPA 2ES3A 5FZLA 3WP6A 2QNKA 3CLPA 2WQ4A 4KU7A 1YQCA 4RGAA 1ULCA 4GH4C 2G4IA 5LRRA 1C8M1 1RUF2 1TME1 2FCTA 2PQSA 3MBWA 4BK4A 4BZ4A 1WUVA 5FLIA 2KM2A 4CP9A 5BNOB 1VALA 2BRTA 1QOOA 2G9GA 1H30A 3OYWB 4YM3A 2D6PA 3OG2A 3WDYA 3TNPB 1OFNA 3I2DA 1GBGA 4LXLA 4HSLA 3N9QA 3H7YA 2QFEA 2VTFA 1JYNA 1YNAA 3AKPA 3PURA 3HBZA 1JOBA 1T2XA 1RGSA 4JC1A 1KXGA 4R9AA 3UGGA 5F1RA 1UIJA 1UXXX 4IETA 4QB1A 4FPJA 1FATA 5A6YA 3EMRA 4CUCA 1CAUB 1WW4A 3H3ZA 1DYKA 1W05A 2NQYA 1IG0A 2YZ4A 3IWZA 3A7QA 2BFUS 5AFEA 2QQOA 1SBEA 2JG8B 4IV1C 4E8DA 4CTEA 4EWEA 4LA2A 4A41A 3PUSA 1H2KA 3SXWA 5I93A 1V6NA 3KZ4C 2R0FA 3PUAA 1OKOA 2BFUL 3NO8A 4RL7A 1RJ7A 1EAH1 4ZHNA 4LLFA 3VBRC 1NX9A 1JMUB 4WVVA 5FZ1A 3AJYA 4HKOA 4LK7A 2YV8A 4YZ4A 3U10A 1IGOA 3LZZA 4N53C 3S0MA 1SBDA 1JS9A 3KT1A 1RUG1 1YQ6A 2B46X 5JR7B 3DKQA 3JBG1 2NM1A 4GXLA 5FP7A 4ONUA 4LBLA 1ODNA 3I8TA 3ZSJA 5C7GA 1PVC1 2WN3A 4EN8B 4IV1B 3E6DA 4O61A 2NYYA 2AR6A 2GDFA 2VULA 1ENRA 3SCHA 2WWUA 2W1QA 2HWE3 3S5AA 2BUKA 4MADA 3DEMA 4XETA 3OOXA 2UY8A 2QQIA 4O9GA 4RFT0 3UGHA 2GC3A 2CWMA 1H8TA 5DAXA 3F2ZA 2KXLA 3RFRA 1AR72 1PZ8A 5L7OA 3NWKA 5F2SA 1W2NA 5FUNA 1WBLA 4N53B 4TTGA 2JD4A 2P4EA 4EZ4A 1JYIA 4N7IA 2VZTA 4XJAA 2W87A 3WQBA 1DQ2A 1CAWB 1GWMA 1W6MA 2EXJA 2XL9A 3K46A 3AMPA 3KHBA 4IDZA 1DLCA 5FTTC 2V4AA 1K5JA 4BIOA 2RDSA 1AR82 5A33A 2A71A 5C8CA 2OA2A 2BEOA 5A80A 1QQP3 2VQ0A 3M3IA 3T0BA 4A45A 2ARBA 5EIYB 1W8ZA 3PIGA 4Q4Y1 4CA9A 1N3QA 2ZX1A 2JKBA 4I0WB 3N9OA 4BIFA 5AC91 1A78A 3NAPC 2FDIA 1RUH1 3EQEA 3ZN4A 3ZYHA 5FPUA 3ZSLA 3NV2A 3M7AA 4QPGC 4YVWC 2Y0IA 2GC2A 1Q8SA 4XE9A 1WLCA 2MNGA 4TLGA 1DQ1A 1SLAA 5KC5A 3AZXA 3ZDSA 1UYXA 3W5MA 3B5LB 4AQ2A 1D4VB 1NY72 1D2SA 2JDUA 4M0HA 4JTNA 4QHOA 1ND2C 3AP7A 5IVFA 4NIGA 3LDBA 4OVEA 1GMMA 2EA7A 1MS4A 2RS32 3KCXA 3TOJA 5DG1A 3RS6A 4PQ9A 3Q8BA 4EN0A 4OUSA 3ILRA 4ET7A 1JTZX 2LUWA 1PX3A 2BNNA 2Y6JA 1FMD3 3DPRA 4IERA 1JZ7A 4LQRA 1WW5A 1POV0 1RXFA 1SG3A 2IVIB 4KL1A 4QPGB 4YVWB 3ZSEA 3WSOA 3AVSA 2XJRA 1HQLA 4BU2A 2D3RA 5BNNC 3NNLA 3V0AA 5HCHA 3GHNA 1AL23 2VZSA 1TG7A 1QHDA 3I59A 1LGBA 3C2UA 1DBNA 3J7LA 4LBKA 4D69A 4CU6A 1PM4A 1ND2B 2DCYA 2UWBA 1XU2A 4PF5A 3VBUC 1BVP1 1HLCA 4BJ0A 4NO4A 1H4HA 1OFSA 2ARCA 4JGYC 1KS4A 1OLMA 1PZ7A 2RG4A 3VDAA 2E31A 4XXAA 3POBA 1AYN2 4PT6A 2ATFA 3RVHA 5JSRA 4PI0A 5JOYA 4HZFA 1J58A 2RV9A 5FY4A 1OQDA 3PVOA 1V6MA 3J7MA 2JEMA 2VW1A 3MW3A 1YRZA 3LQCA 3WF3A 3FHIB 2Z2SB 5GZEA 5IT6A 1YHFA 5HBAA 2VOKA 5CNAA 3O1UA 3T0DA 2Y34A 4IUGA 1TNRA 2ZHLA 5FMOL 4UYBA 3VZJA 4F8AA 1WLWA 1YEWA 1YXWA 3FHAA 4DXZA 1P8JA 3DL3A 2H0BA 4FVVA 3VBUB 2QQPA 1IS6A 1OOPC 2PFWA 4QX8A 1POV3 1W0NA 1FNZA 2UY9A 1KFXL 1R083 3I3EA 5A7NA 4AK3A 1S0IA 5ACA2 2BBVA 4RSUA 3ITQA 3V0BA 1S0CA 1H8VA 4L0PA 5BXXA 3ZR6A 1HV1A 2RHPA 4P5YA 3AJZA 2PTMA 3ZDVA 1CAXB 1K5MA 2WQZC 2VMIA 2WRAA 2A6WA 2Y6HA 4RHV1 5HXVA 3CO2A 3VUOA 3ELNA 3MIBA 4QPIC 2HWF1 4FOQA 5CYYA 1D4M2 1NCQB 3WNMA 1OF4A 4CEWB 2YG0A 2ZBJA 4M00A 3WQ0A 1VAKA 3O1OA 5FZ6A 1UNBA 5BY5A 3DUIA 4ATEA 1ZA7A 3M2MA 1C1LA 2VQUA 5FXWA 4YPJA 1QJU2 2ZHKA 4DQAA 1QXJA 3WP3A 3MW2A 1ST8A 2AUYA 2G9FA 2OX0A 5DUUA 1CGPA 1KDMA 1S0FA 1JZ8A 3IPVB 1VMHA 2GH8A 3VHRA 4COVA 4AXOA 4E2GA 4XJWA 5FQ0A 2JD9A 1S2KA 3M4FA 4QPIB 2LTNA 2WINB 1PO22 2OUHA 3JD73 4Q4X2 4UOJA 3UESA 2P2KA 2IWGB 1R1A1 2X8KA 3ZYGA 4P9IA 2BOIA 4GKXA 4QB2A 2R32A 4XHBA 4AE2A 3HJRA 5A32A 1OBNA 2R072 5HPOA 1VAVA 5I0UA 5FZMA 4HLTA 4DB5A 2FDFA 4YW3A 3TRSB 2GNDA 4Y5Z0 4LIVA 2ZZQA 3ZN6A 4I2OA 1DZQA 1JODA 2IXHA 2Y0OA 5C4WC 1DIWA 1H9WA 1GSLA 3ZVXA 2WFF2 2ZX0A 3BGAA 4QB6A 4YYOA 3P6BA 3ZIXA 1JYTA 5IVVA 1U0AA 1UMIA 3KSCA 1C8NA 4XYXA 1AXYA 3V64A 2XJTA 1CAVB 1EY2A 3O1VA 2ET1A 3EYPA 3TEZA 4Q4W2 2VCAA 3MLJA 3LFMA 4XFGA 5KXBA 2PAEA 4HVRA 4RN5A 3B94A 2WFPA 4E4ZA 1NLSA 1BZWA 2HWC2 2IFWA 2PHFA 1VRH3 1W03A 1AYM1 2CAUA 5DZEA 4JDMA 3M70A 4Q1PA 3ZSMA 2ZX2A 4BE3A 1F35A 1YFYA 2BGCA 1BEV2 3LA7A 1CIWA 1WZXA 4M3CE 3ZPYA 3JQWA 5LB6A 5E16A 3BODA 1AL0G 4AF9A 1ND3A 2K9ZA 4JDOA 4LO5B 1JI6A 3N36A 1NA1C 1NCRC 1AXZA 3LB9A 5HV4A 3BPZA 4XDOA 1OI6A 4XACA 1X82A 4JVAA 4YG6A 4UFJA 1LJ7A 2FBEA 1BQPA 2G19A 2PYTA 2WDBA 3IT8A 5CKQA 2WZPP 1DGLA 1OQEA 2VMHA 3TWIA 1BMV1 1E5SA 3ES1A 3IBMA 1YJLA 4MXWB 4QT6A 3VGIA 4D6RA 3RGBA 4ES9A 4HETA 3ACIA 5JIAA 5IK5A 1ZRRA 3FN9A 5B4XA 1JUIA 2WZR1 4KBZA 2XPJA 4KWUA 1RUI2 1V70A 1AX2A 3JUUA 3VB9A 4RQPA 2RDNA 2XBO1 2YFZA 4G3YC 1W9YA 3C7EA 3AYCA 4B4QA 4C1WA 1RUI3 1FPN3 3MV01 1DGRN 3Q8EA 4WVWA 5JXHA 4XILA 5FPXA 4QKFA 3RZGA 1OA4A 2HBUA 4XDPA 3UGFA 2RS52 1COV1 4OZXA 1GZ9A 5FOJB 4OULA 1Q8VA 1GP6A 3ZXEA 3C8XA 1HV0A 4W6XA 1JOPA 3LAGA 3ME2A 4DXRA 4CCDA 3CNAA 1PNGA 1LU2A 2YYOA 2X5IA 4WM8C 2RS53 5FP3A 1HRV1 2GNBA 3I97A 1YLLA 3NJXA 3PTYA 4QXKA 4D0QA 2VW2A 1O3QA 4YNIA 5J3UA 1W8HA 3FJSA 1WCSA 4TWTA 1RITA 1ZBE3 2RJLA 3ROUA 2N7GA 4NMIA 4AGGA 4CSWA 4OHVA 2SLIA 3K2OA 3B02A 2CL2A 5A3NA 1W39A 2YFUA 3PU3A 1I5PA 1OC1A 3POFA 4K9SA 3GJAA 1AR92 2DVDA 2ZGNA 1JHNA 5FZ0A 5A7PA 4AW7A 4I3PA 5DG2A 1ASJ1 1HXS1 2DYCA 4XQWA 1VBD3 2MEV2 4XBNA 5DN2A 2DUPA 1ULPA 4HVOA 4U2AA 1UKGA 4JKKA 3RSJA 3VDBA 1VBC1 4EV0A 1QJY2 4PF1A 1UF2C 1UYPA 2VUCA 1Y4WA 4YFZA 4D8MA 4RS5C 5JVVA 2WAOA 1FOD1 2VJXA 2EXKA 2QDNA 2F17A 1LHVA 2ZX3A 2WZ8A 5IJRA 4UBGA 2CSGA 5IAVA 1LAJA 4HMZA 1EV13 3LEKA 2GMPA 3VBOC 2R7EB 2J1TA 1UIKA 2QDRA 2VU9A 4N43A 2ILMA 2XJSA 3MV11 3OD0A 1UZWA 4BMBA 4KG0A 4FXKB 3UJQA 4DO0A 3K3NA 4W6WA 4YZ3A 3ON7A 4L92A 4FFGA 5APAA 5KWRA 3POYA 1N3OA 4KWKA 2D3SA 2FCUA 4RD7A 4PHZA 3VBFC 3B9CA 4DMIA 2PLV2 5BNPA 2G1MA 2YPJA 4I30A 5AFBA 3T2TA 1A3KA 4CP9B 2IXCA 4UW4A 1X7NA 1PO11 5HI0A 5A3PA 3HPNA 3WNNA 3ZM8A 2ZEXA 4P5HA 3W21A 1NY71 2B42B 5LBBA 3VBHA 5D21A 1RVF1 1VLNA 3W58A 4FTEA 3AK0A 2P3KA 1GUIA 1VBB1 5GJ6A 2A5ZA 1HB1A 3C7FA 4LEJA 3AZWA 3EBRA 3T30A 1C5IA 1DZTA 5FUPA 4WM7A 3GZUC 3RI9A 4A3XA 1GZTA 3V56A 1C8M2 1TME2 2HWD1 2ET7A 1RUOA 5L9BA 2YC2A 1JYXA 2P3IA 4YW2A 3ZYRA 4DOUA 2OKXA 2WR9A 2ZGUA 3K4ZA 5DAWA 4YZ1A 1C8M3 1TME3 3B01A 1O3RA 1OD3A 1DP0A 4BWOA 5FMBA 1REFA 3DN7A 3GJBA 3H8XA 5FKBA 1G9FA 2B8MA 2FZ1A 2UYBA 3LSDA 5B2GB 1MEC3 5DDJ1 3NJVA 2VVFA 3IN9A 4E4SA 4DS0A 5FZ9A 5L7OC 1OLRA 1V9U3 3ZXAC 3H8RA 2VNVA 1RL3A 2YROA 4N90A 5IVBA 4GWJA 4LUKA 2VW0A 2B9VA 4FOYA 3N9LA 3THCA 1JZ2A 2I74A 4HN1A 4PBOA 4X8NA 5IW0A 3WDVA 3EB7A 5L19A 2W3JA 3ATGA 1HRI1 1RHI3 1QJFA 2ZGLA 3O7OA 4NIHA 1CWPA 4EJRA 2Q1MA 1S0EA 5BNQA 5K0UC 4GB33 4AHZA 1B35C 2X10A 5DPNA 1EAH3 4JRLA 3JBG2 5GLUA 1H8TB 5TSWA 3WW3A 3MFAA 1O8PA 3HQXA 4Z07A 3WDXA 5L7OB 1WMXA 2OW4A 4AVSA 1GR3A 3H1WA 1RUG3 2ETEA 1PVC2 2WT2A 3LE0A 5F3IA 4AEMA 5IVJA 1PIV3 2VY0A 2Z79A 2YBKA 4MHUA 5LK5A 3K48A 4KWJA 3ALQA 1FI2A 2D44A 2WNUA 5F39A 2WKKA 2W2IA 3I2IA 1A8DA 4K21A 2WT1A 1QJZA 2GNMA 4LR4A 5A33B 5C8CB 3RYKA 3LA3A 2P6CA 2ZTNA 2BBAA 2JX9A 2YDEA 4OMCA 2TEPA 4AVAA 3ZKYA 1DYOA 2D6OX 5JWPA 5FJKA 1QJU1 1QU0A 4CDWC 3QBQA 4PBPA 1UN1A 4ZPIA 4ASLA 5F5IA 1EPWA 3Q9OA 5FY8A 4AEKA 1BBT3 3LSEA 3MFCA 2V72A 5IWFA 3BN6A 4MSVA 1D0HA 2ORXA 5EPAA 5LA0A 1UZYA 4MGKE 1NLRA 3MLLA 4KGQA 4DNYA 4RR3C 4JQRA 4Q4Y2 1RUD1 3A0KA 3WDTA 4FSJA 3WNXA 5AC92 2Q30A 1RUH2 4Y24A 1DGRA 3VZOA 3PLQA 4Q4Y3 5DAVA 2J1UA 2J7MA 3HNBM 2FD8A 2W94A 5F9TA 5SV5A 5AC93 1V6IA 3KT7A 5CAZA 4OHZA 5FZIA 1QEXA 1UX6A 2DWRA 4LHLA 4QGNA 2PHLA 4B1LA 4C1XA 4FBFA 5JR2A 4CDUA 1UPSA 3DPRB 2WUHA 1DYPA 4WV8A 3RPQA 3FL7A 1YI7A 3K51A 3H3LA 3WF0A 4P9YA 4BYYA 2A3WA 3VDDA 5JZGA 4AQSA 3V0AB 4GMP1 3A23A 3WF1A 2RR11 1LHWA 1UPIA 3I59B 1JHJA 1H4GA 4D7SA 1YCIA 3SLIA 1FT9A 1ZX5A 3K4AA 4Q4W1 1ZBA1 2H6CA 4M4RA 4MUVA 2PHWA 2VQAA 3ZXLA 1UO9A 4Y20A 5KHJA 2WSUA 1SLIA 1G9AA 1W9TA 2HWC1 1LOEA 5CKMA 3INAA 5FZGA 5A70A 1S0GA 3R6SA 4INDA 2J1VA 4AVVA 5T5OA 4DEQA 2VM9A 5T54A 4Z1VA 4RYDA 5FY1A 1J84A 4D94A 4PI2A 3IIIA 1YUDA 4AHXA 1S2EA 2EALA 3MGUA 1B09A 1V6OA 2BV4A 3NL1A 4K3UA 5FYUA 2R49A 4CXWA 2YC4A 1PK6C 5A7QA 2EIBA 1JN2P 1U5IA 3CQOA 3VL8A 4QD2A 1S0JA 1E5RA 2R061 4DIQA 4R9CA 5C3OA 3USSA 1HQWA 2ZGSA 3ZXFA 2ZACA 3V0BB 4LE3A 1O3SA 3IAQA 4YGEA 3UKVA 3VN4A 1WCDJ 4FTSA 3FUOA 3T2PA 1N1YA 1OA3A 1TMF1 2Y6LA 4QX0A 4WZCA 1KEXA 1Q5OA 5LATA 1K5MB 5ABJC 4FAHA 1UYYA 3U11A 4M3CA 5FP8A 2SBAA 4FPFA 4A7ZA 1LTEA 2XKPA 5LBCA 3POEA 4COZA 2FHRA 4ZZ5A 5J37A 4Q5OA 3EJKA 4E2SA 1YIPA 3CBNA 4AFDA 4Y22A 3OEAA 3E1F1 4QU2A 5DQ0A 4CCNA 1QGLA 1U5ZA 3UJOA 2JG9A 1WW6A 4JDNA 2OPWA 3QCWA 4NHLA 1VB2A 2WO1A 1FAYA 2Y6FA 3BYWA 3I2KA 4RHV2 5FLHA 2HWF2 3ZPOA 4P9WA 1CJDA 1RMU2 1Y9GA 3DYOA 3JQXA 4HN0A 4JRAA 4JKLA 3LEMA 4UFKA 5FZDA 4Q8KA 5I8YA 4NWWA 2CAVA 3HEIA 1PM7A 2WWJA 2BDRA 2O1QA 1GLHA 3PNAA 2VZVA 5FQ0B 2A73B 2HWF3 3ZLIA 2QQMA 4IGPA 5C3SA 4LT5A 3AVRA 4W65A 3R0RA 3RZJA 4NHYA 2P3JA 3ASIA 1YO8A 3K77A 3T09A 5A32B 1Y7BA 2YXSA 3VKNA 1WBFA 1LGNA 2XQRA 5I0DA 4CDQC 4WVMA 1APNA 5A3UA 2VE1A 3ZN6B 3KQRA 1UY2A 4CPBA 1PMHX 2DFBA 4A6OA 1UOJA 3KCYA 5FXXA 2AGSA 3AYDA 1Z7S3 4HSJA 4OI1A 3ZFGA 2HYKA 4AQ6A 5C9AB 4BK5A 1R1A2 3GCXA 2E6VA 1ND3C 1H1IA 2CGOA 2BU9A 3CJIA 2ZKLA 3WV6A 2XH6A 4FPOB 2W5FA 3C3VA 3NKGA 4LTAA 2ORZA 1S55A 4LE4A 1KITA 4XW3A 3ZO0B 2CTVA 2WT0A 4CEYC 1SQ4A 1S2BA 2JJ6A 1W6QA 3PL0A 4LBQB 3IM0A 1GOGA 4QDRA 3N4MA 2BTVC 3WY6A 2ZZJA 1UOFA 2R043 4QMAA 5FREA 3ZXDA 3ZYIB 2VXRA 3U4XA 4AQTA 1SBFA 1LHUA 2WYFA 4FPEA 4RQPC 3U75A 1SLCA 4BQ1A 2PXJA 2JE8A 3PUQA 5C33A 3VD4A 5C8WA 2UWCA 1ND3B 2AACA 3E5XA 2GP5A 4AG4A 3USUA 3DECA 1CONA 3AZZA 3O1RA 4E2QA 4AWDA 4HKWA 4IEYA 3FHQA 1AYM2 1OMIA 2UURA 5D8AA 2O8OA 1RUC1 1W8UA 2DVFA 3MUZ1 3IZOA 4TXWA 1H2NA 3TEXA 1JYWA 3UT0A 1CQ9A 2X5IC 2VCCA 3MIFA 1DG6A 2PAKA 1R092 3IDBB 5C6CA 5L9VA 4E9KA 5LA1A 1VBA1 3IKWA 2J1EA 2WJSA 3WX5A 2JG8C 4RQPB 3IB3A 5AVPA 5KR7A 4URTA 2W1WA 1BMV2 4Y1ZA 4QGMA 1LU1A 2AENA 1PGW1 2W47A 1UAIA 5FZEA 1CD3G 1DHKB 1RUF3 3A22A 2BNMA 3S57A 1C57A 1VBE1 3ACGA 4OZOA 4AI1A 3AKRA 4XUPA 4GALA 5FY5A 3KQ4B 5T5JA 4BOWA 4D6QA 1SLBA 2WZR2 2W46A 3AB0A 1NAEA 1X9TA 3C7OA 4FPYA 4XMAA 1CZTA 1W04A 2X5IB 2XBO2 2A70A 4NPMA 5JDBA 2VG9A 3N7JA 3VZNA 2A3XA 3HT1A 3W9AA 4MGYE 1MS8A 2FCVA 2QQJA 1XRUA 1E57A 2C24A 1J1TA 1JZ4A 3AKQA 4Q0SA 5E8AA 3LF7A 3NQHA 3T4VA 1COV2 3OGVA 4AHYA 3FC0A 4NR1A 2HWB1 3NNMA 3D0SA 3B69A 1WW7A 2CNAA 2E7QA 4OI0A 1HRV2 4XZPA 3POSA 4MLOA 3WW4A 3NW4A 2CY6A 1QIQA 4HL0A 2CGPA 3CF6E 5F5AA 3AL6A 4H3WA 5I0SA 4PQQA 3LIGA 2E7TA 2JDZA 1TNFA 3MLKA 1V00A 3QD6A 4X6QB 4BQ4A 3BU0A 2WS91 3AC0A 5C5UA 2VCMA 4ZZ8A 4CVUA 1N1TA 1C3HA 4DXTA 2VPVA 4Q0QA 4JHTA 5A1AA 1ASJ2 1HXS2 3KF5A 1O5LA 2LRPA 4CP1A 1UZZA 1XYOA 1IS5A 4EE2A 1MR5A 1AZDA 2FDKA 1FX5A 2CGNA 1FNYA 1R1ZA 1VBC2 4N43B 4QX1A 4NWVA 5EP9A 4IEQA 1MS3A 5IK4A 1RUJ1 2EVXA 4Q29A 2WO3A 1I9RA 4YGCA 1FOD2 3N7KA 2B4KA 4WM7C 1GYKA 5EHDA 2XR4A 3SITA 4CDXA 1JBCA 4GAZA 3IAPA 5FLJA 1UZVA 1AR73 2CDPA 2YB7A 4BHPA 1K12A 2EICA 4MYEA 4ORFA 4PDWA 5BNPB 2JXAA 4UWDA 2PAMA 2VUJA 3N9PA 4XAEA 2VOVA 4CUBA 4I0BA 1S4CA 2VECA 2ZMNA 4W50A 5FBZA 3H8OA 1AF9A 3THDA 1W2UA 1R64A 5EV7A 3AP4A 3VBHB 1AR83 3B9IA 1XNCA 4ZU7A 3OEBA 5JPMB 2VVDA 2VZUA 1ULOA 3LDKA 1DQ0A 3B93A 5J48A 3POJA 4BH9A 2VZ1A 4WM7B 4QQLA 5FZFA 5H9PA 1PO12 4OQ8A 5FZCA 2O8QA 1OUXA 1TEIA 2W92A 4QWNA 4WBBA 2J1RA 1RVF2 2DU1A 4ZXKA 3Q8CA 2JWPA 1PO13 4Y1UA 2YBSA 1VBB2 2HEYF 3WW1A 4J1WA 4BLIA 2H0VA 3WVJA 1SMVA 1H2MA 2QVSB 3NV3A 5A3WA 5C5TA 2HWD2 1VBB3 2RS33 2A1XA 5DABA 2YGLA 3K75B 2PHRA 4MVTA 5J7MA 4PLNA 3O1SA 3BTAA 3HMYA 3NRUA 4OMDA 2HWD3 3B3QE 1UOBA 1CPNA 2C9KA 1QWRA 3MIGA 4A2UA 3LGRA 4MV2A 1SCSA 5C70A 5EJZB 1KFUL 4R4XA 4UAPA 3VD3A 2W9XA 4DY5A 5A3TA 2J22A 3PTRB 5DDJ2 3M3EA 1LOAA 2VXJA 2QCSB 3DGTA 3I3DA 3SMHA 4Q4V1 4D3WA 3TBDA 1W3XA 2VQTA 5FR3A 1XU1A 3MIEA 5BPXA 4A42A 4LHNA 5T5LA 5DDJ3 2IXJA 3L2YA 4DUXA 1GQGA 2YY1A 4P9GA 5I0TA 3T2QA 5FMOS 2VUAA 1AYN3 4XIKA 3VD9A 5GLVA 1LENA 4CEWC 1NCQC 1NZCA 5C9AC 1BXHA 2JE9A 4YW6A 4AAPA 1HRI2 4WVZA 2PHXA 5FZOA 2WNUB 2JE7A 4H55A 1RIRA 3OD4A 5JXIA 5FK8A 5ISLA 3JXSA 5LEKA 3WHTA 2RS12 1O91A 5KXEA 1W99A 2XHKA 3VBSA 1KJRA 4QKNA 5C3RA 2KD7A 3N7MA 4PLOA 1HB3A 4LBQD 4NHXA 3BI3A 1YIFA 1GQHA 3LCPA 3OGGA 4Q27A 1JZ6A 2ZCWA 5ACA3 2CWSA 2B45X 4UFHA 5F2WA 3PJYA 3TEYA 3I4IA 2ZAHA 1RMU1 1VE0A 2QBXA 5BUVA 4IW3A 5HV0A 4BB3A 3EO6A 2ZGQA 2BERA 3M3CA 5FYBA 4IE5A 4O9EA 2A75A 1D4M3 1MVQA 1RYYA 5FOBB 4GWNA 3MW4A 4OI4A 3ZFFA 3KGLA 2D93A 4QPYA 2FDJA 4Q0PA 3VKFC 4A6SA 2VMFA 4IEUA 5GM0A 5CFDA 4LOTA 4BCUA 1E5IA 1J3PA 4DZGA 5KHKA 2LS6A 4P14A 1QJU3 4I09A 1PX4A 2D6LX 3PUHA 4LOSA 4MXVA 1V0AA 4CDUB 2VBPA 4YARA 2TUNA 4HANA 1CX1A 3NMBA 2BZDA 1RUD2 4S2DA 3PHMA 4A7YA 2XWBB 4IV3A 4DRVA 3MF6A 3VDDB 2E51A 1AR61 4XMIA 1DGWA 3T08A 1PO23 1NQJA 4Q4X3 2JIGA 2VH9A 3MEPA 1Q56A 3PVBB 4DPNA 3WQ1A 1ZZBA 3LDRA 3TNQA 1X50A 2R073 3PDQA 4Y20B 1Y9QA 3E97A 5A7WA 4R4ZA 4YG3A 4IEZA 5I91A 2E32A 4CXYA 1N47A 3KF3A 2Q8DA 3H50A 1QDOA 1XPWA 2RR12 1LOBA 4LBJA 3OUIA 2BVBA 2DCTA 2Q1ZB 2QUOA 4QM9A 2RM21 1RUE1 2QQNA 2WFF3 4GMP3 1H0BA 2YC0A 4P9LA 4BQ2A 5FDBA 3D5OA 2RR13 1ZBA2 5GZFA 1IKQA 4LHSA 2VTXJ 1VMJA 4K40A 4PIYA 1A34A 3GXUA 1QJX1 2Z5WA 4LMFA 4Q4W3 3AM2A 1ZBA3 2JG9C 4AOCA 4B4PA 1OUSA 4NN0A 4Y26A 2HWC3 1AUYA 1NXD1 1R091 4ITCA 4YW1A 1KDKA 2GP3A 1BEV3 4ZU5A 2W95A 2XJQA 4M3CB 4I3GA 4YGDA 3AX4A 2LW8A 2P5BA 4CU8A 1UU5A 2R062 4GJYA 4OQ9A 3LEGA 3WP4A 2ZMKA 1YI9A 1LOFA 3B7MA 3HBKA 3LA2A 2Y8KA 4P02B 4Y22B 2Y6GA 2RJ2A 5FFOC 4FFHA 2R063 5I0RA 1TMF2 4EYUA 5FYZA 2JG9B 4LBNA 2OUJA 3WNPA 2BNOA 1G7YA 1ONAA 3GGLA 4XF9A 2A6VA 4W6YA 1N1VA 2ZJCA 3PIJA 4XCAA 3ZFGC 2XWJB 4GWMA 5LEJA 2OIIA 1VRBA 3PU8A 2XLGA 3POWA 3BU7A 1MZ6A 4FCAA 4X8PA 2Q5TA 1GP5A 4YVSA 2XUMA 4CXXA 4XFIA 2B5HA 3RRDA 4FFIA 4XJZA 2GMEA 5ANQA 4GULA 4IEVA 4C0BA 5KBFA 3T3YA 3I3BA 4QM8A 1YJKA 2E9QA 1F4HA 4HOOA 4WVMB 4EQVA 1QMJA 3WG3A 3HR9A 2D97A 2X09A 4XTMA 2JDHA 3C7HA 4PCRA 2JKXA 5BNOA 3ZFGB 4AR2A 2HKXA 2J1AA 1GFF2 1UKRA 1UMHA 3UV9A 2PA7A 1GZCA 1O4ZA 2QQLA 1DCSA 5DAQA 2OVUA 4CCMA 3CJIB 5FUIA 1LKNA 1W6OA 1ULGA 2LALA 2ZGRA 4JKMA 4AEDA 5FPAA 2VBDA 5F5QA 1QOSA 3RWNA 1IG3A 1AR93 2VNGA 2A6YA 4M4PA 4MGZE 4XIOA 3WNLA 4C91A 5JI7A 1Q43A 5F7UA 2F6BA 3AP6A 5IYYA 1W6QB 2MEV3 4K8FA 3WF4A 4GH4A 3HIFA 4XEZA 5FYYA 5DUWA 2C1FA 1XNKA 1HN1A 1BYHA 2IUWA 1QJY3 2W52A 1EUUA 2EIDA 3KV6A 3LD8A 3GHMA 5FYVA 5IK8A 4JAAA 1JYCA 2YGMA 1HJGA 3USUB 3LOBA 2PELA 5F6KA 5C3QA 2VVEA 2WLPA 1W8FA 3ZMOA 5D8AB 4FP2A 5A1FA 3O12A 2X53S 5FO9B 4IEWA 4V1PA 2P1BA 1OKQA 1HKDA 3LPGA 5CISA 4IV1A 5FXVA 1XXNA 5FY0A 5DUXA 3BCWA 1QQP1 1XOYA 4DEVA 2GNTA 3G6JB 2E53A 2WYSA 2K46A 4RFRB 3MF9A 2PLV3 4NJ4A 5EJ3A 4CCCA 5CBLA 1HB2A 2ZEWA 5IHRA 1RUC2 4NVPA 3UKNA 1W9SA 3VBRA 3O1MA 2WL1A 1YFXA 2FQPA 1T6BX 1JH5A 1KQRA 4N53A
chains in the Genus database with same CATH topology
1JOBA 1ZRIA 1F35A 1JODA 1JYTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JOB A;  1ZRI A;  1F35 A;  1JOD A;  1JYT A; 
#chains in the Genus database with same CATH topology
 4UT5 A;  4XBQ A;  1VBA 2;  1RUC 3;  4LLO A;  5LA2 A;  1DDL A;  4R8H A;  4YWA A;  1DF0 A;  1CAW A;  2FMY A;  3H3U A;  4AVC A;  4QAW A;  1CPM A;  1EYB A;  4X6R B;  2AYH A;  2DBN A;  2IXK A;  3I54 A;  2XJV A;  1PGW 2;  4IGQ A;  5FP4 A;  2QQV A;  1KD7 A;  1Q8O A;  4LO6 B;  3ST7 A;  1VBE 2;  3UL2 A;  4LHK A;  1IPK A;  1O5U A;  5FAX A;  5FZA A;  1SPP A;  2VMC A;  1D2Q A;  1HDK A;  5FWE A;  4LPL A;  1O59 A;  3TYJ A;  1ALY A;  1Q8P A;  4BIS A;  1H8T C;  3BTY A;  5CU1 A;  3RI8 A;  5F32 A;  3PVE A;  5F37 A;  3PMS A;  3DYM A;  3LEI A;  3H42 B;  2K0G A;  2WO7 A;  3SQO A;  1AL2 1;  4AFM A;  4MET A;  2E63 A;  4XHX A;  2W68 A;  1NKG A;  2HWB 2;  3HAG A;  5IAT A;  3HNM A;  3TN9 2;  3SC7 X;  3OJB A;  2ZGM A;  5C8C C;  4KGG A;  2YUE A;  1G9D A;  3THP A;  3KV5 A;  3HT2 A;  3NAP A;  1XNA A;  1EPZ A;  3GDB A;  4A7K A;  5IK7 A;  4GJZ A;  4KU8 A;  2RS1 1;  1URX A;  1WA6 X;  4QPG A;  4MGQ A;  3FE5 A;  2WS9 2;  4MX3 A;  1I3H A;  4XQ4 A;  4QGL A;  4XFF A;  3WNK A;  4CDX B;  5JAX A;  3JBG 3;  1S1A A;  2BWC A;  4L97 A;  2DVA A;  3ENR A;  2WS9 3;  1PVX A;  1W6M B;  1ZZ7 A;  4FO9 A;  1PVC 3;  3AZV A;  4PDW B;  4E8C A;  4OCT A;  3WOG A;  1POV 1;  4UFM A;  1OPO A;  2DTW A;  3MIC A;  4GWI A;  1LRH A;  1RUJ 2;  2DUQ A;  1R08 1;  2WBK A;  2BYV E;  2ZGT A;  3MID A;  1ZRE A;  2JIJ A;  3N9N A;  2Y33 A;  4CZS A;  2H6B A;  3GYD A;  3AL5 A;  1RUJ 3;  1GIC A;  3DPR C;  3M3O A;  4P08 A;  4JQT A;  3ZYF A;  3HQR A;  1CES A;  4JHZ A;  2WZE A;  1O3T A;  5BNN A;  2Z69 A;  1OPM A;  4YGB A;  3BIE A;  2BGO A;  2V5D A;  1IZ3 A;  5IVY A;  3WDU A;  2DCJ A;  2Q8O A;  4CCK A;  4MGT A;  4HG6 B;  1YFU A;  4HK9 A;  2XL7 A;  3VBU A;  4CCE A;  2R0H A;  2AC1 A;  3AMQ A;  1PGS A;  4GZ9 A;  4HXC A;  1MQT A;  4H14 A;  4JGY A;  1NUK A;  2VZ3 A;  3FLP A;  3U37 A;  2CHH A;  3WUC A;  5CEH A;  4NRM A;  4NIA A;  4CU9 A;  1UMZ A;  4C0H A;  4B1M A;  4A3Z A;  2FDH A;  1OQ1 A;  1CZS A;  1PZ9 A;  1RUH 3;  4OI2 A;  4FQ4 A;  1UY0 A;  4FTB A;  4IEX A;  4CCL A;  3D3A A;  3HWJ A;  5FYT A;  2RJK A;  3JD7 1;  4MO3 M;  5FZ7 A;  3DXT A;  1W8T A;  5JMO A;  5EWS A;  1LHN A;  4EN7 B;  1VP6 A;  3KM5 A;  4NAM A;  4ZS3 A;  5JIU A;  5FPL A;  1OOP A;  2PN5 A;  5DAP A;  4LJH A;  4F7Z A;  2JIC A;  3H7J A;  5J36 A;  3BOW A;  2Q0A A;  2DCZ A;  1WCQ A;  3MO4 A;  5HCA A;  5IFT A;  1TVG A;  5LA9 A;  1AJK A;  3FUQ A;  1GV9 A;  4UW6 A;  4EN9 B;  3RQ0 A;  4ARY A;  4ERO A;  2YU2 A;  1RTV A;  2DDU A;  3N35 A;  2V5Y A;  1K5M C;  2UU8 A;  2VAU A;  5EYY A;  4BM8 A;  4CPB D;  2ENR A;  1VIW B;  2C9A A;  2RDR A;  3SKJ E;  4ISQ A;  1JOJ A;  4J1X A;  5EXO A;  2R30 A;  1GNZ A;  1ZNP A;  1L3J A;  2FMD A;  1LOC A;  2Y64 A;  2OYZ A;  4Q4V 2;  3VLB B;  1U5Y A;  5FZO B;  1CN1 A;  3FBY A;  3GBG A;  4AFC A;  3WG2 A;  5T52 A;  3ZFF C;  1I1E A;  1VRH 1;  3WNO A;  1SAC A;  4CU7 A;  3VBS B;  5CFD C;  2BJS A;  2W1S A;  5FMD A;  4URA A;  3O0X A;  1FV2 A;  4FPK A;  4K20 A;  4BDV B;  4IL7 A;  5FMC A;  1RB8 G;  4CCO A;  4AEJ A;  4MGI E;  3WHU A;  1UX7 A;  1DU3 D;  1WMF A;  1O4Y A;  3RYP A;  1PMJ X;  1EUT A;  3OCP A;  4M3C F;  4BQ5 A;  1D7P M;  5IAX A;  4QU1 A;  5DZF A;  3UK9 A;  4BA6 A;  3KT4 A;  2JDY A;  5F8P A;  3DCQ A;  5CG9 A;  2W0X A;  1X8E A;  3T0A A;  5F3E A;  1XYN A;  1W6N A;  3ZFF B;  1OLQ A;  2VOX A;  1MVE A;  2MHF A;  3FMG A;  3IMM A;  3KD4 A;  5CFD B;  5C4W A;  5EJ1 B;  3O0W A;  4ZKT B;  4L8Q A;  3SEP A;  3LKJ A;  3R05 A;  1M4W A;  2K2S A;  2VMD A;  4RHV 3;  3V65 A;  1IPS A;  2RMU 2;  3VD5 A;  1FPN 1;  5IUQ A;  4COU A;  3U0Z A;  1ZRF A;  4NID A;  1RMU 3;  4IV3 B;  1GQP A;  2D98 A;  1UXZ A;  2CDO A;  2WN2 A;  1QH6 A;  2XVK A;  1Q3E A;  5KHH A;  5T5P A;  5A3L A;  5IVE A;  1O4T A;  1OUR A;  4QHB A;  1LHO A;  4NRO A;  4SBV A;  3WG1 A;  5KHI A;  5M0T A;  3PME A;  4NPR A;  4QDQ A;  2WNE A;  4ZON A;  5F3C A;  1ZZ9 A;  1H9P A;  1F5J A;  1VR3 A;  2ZX4 A;  1CX4 A;  2NN8 A;  4XF4 A;  1PGL 1;  5KXD A;  2JEN A;  3BVC A;  4U36 A;  4NII A;  1MPX A;  3RJ2 X;  1DLL A;  5FYH A;  1ZBE 1;  5IVC A;  4JTO A;  1HIX A;  5A7W B;  3ECQ A;  5FPZ A;  3GZA A;  5GLW A;  4XUT A;  1AR6 2;  1NA1 A;  1NCR A;  2EIE A;  1ZZ8 A;  3ZFE A;  2ZXQ A;  1GNY A;  1IHM A;  3KMH A;  3SIS A;  3NJZ A;  1FYU A;  4OLL A;  2IVJ A;  1R1A 3;  1GAN A;  2ZAA A;  1VBD 1;  4RA0 A;  1JYV A;  1VAM A;  4BQW A;  3L9J T;  4XAA A;  3KHC A;  4AI8 A;  1O6U A;  3PJQ A;  5J1X A;  3OY8 A;  1UY3 A;  1GNH A;  3H8U A;  4B7E A;  5CA6 A;  1W8W A;  3VHP A;  5FCC A;  3JU9 A;  1ULE A;  2RM2 2;  2VC9 A;  1EV1 1;  1SLT A;  2P34 A;  1RUE 2;  5FYI A;  1MS1 A;  2OQ7 A;  2ADE A;  2WNV A;  3LOI A;  3S5Q A;  5J96 B;  4HFS A;  4AFB A;  5FRA A;  3IMN A;  1REE A;  1DGW X;  1DZR A;  1QJX 2;  4QX5 A;  4XF0 A;  3ZX7 A;  1J3Q A;  3LPF A;  3BOP A;  4Y33 A;  3POG A;  3P3N A;  4WM8 A;  2ZAB A;  4K1Y A;  4V2W A;  1QF3 A;  2DVG A;  3H1M A;  4LOR A;  5A6Z A;  5LW9 A;  2C0Z A;  2BPA 2;  1AYM 3;  1N3P A;  2VTX A;  3T2O A;  1LEC A;  1BKZ A;  1AX1 A;  3OF1 A;  5FIX A;  1UL9 A;  5FP9 A;  1IS4 A;  2ARE A;  1WCK A;  1SEF A;  4UFI A;  5FY9 A;  1R09 3;  3J4U H;  1NOV A;  3P1I A;  4P00 B;  5KXC A;  3IDE A;  1MS5 A;  1A8M A;  1SDD B;  1ZZ6 A;  2DUO A;  2EAA A;  2WII B;  4YVS B;  5JOW A;  3E6C C;  1WME A;  3KVA A;  2YU1 A;  3IDC B;  3OBZ A;  3KGZ A;  2Q1F A;  5GKA C;  4PLM A;  4XFC A;  4TZD A;  1CZV A;  2LRO A;  3CZU A;  3J9S A;  1H1A A;  5BV6 A;  2WSV A;  3M1H A;  2WWS A;  4RS5 A;  1UD1 A;  1W06 A;  5L36 A;  1UY4 A;  1OD5 A;  3K3O A;  4A4A A;  2WZR 3;  1JUH A;  3WR0 A;  3URF A;  1LOD A;  4K6B A;  5J09 A;  2JDA A;  5GZC A;  1DQ5 A;  2XBO 3;  1POQ A;  4QXH A;  4A44 A;  3VBO A;  3M3Q A;  5FO7 B;  3MDP A;  3C7G A;  2XUE A;  3IIA A;  3WD5 A;  3A4U A;  3TN9 1;  1MEC 1;  2XON A;  4N43 C;  4XC9 A;  3AKT A;  3I2J A;  1COV 3;  1W6O B;  1O8S A;  3S7E A;  2B9U A;  1AVB A;  1V9U 1;  2XGX A;  4AED B;  1US2 A;  3NV1 A;  4LUM A;  3MYX A;  3R4U A;  3BKZ A;  3VBF A;  1HRV 3;  1BHG A;  1G8W A;  1OSG A;  2VMG A;  3KWV A;  4GH4 B;  1XE0 A;  4E4D X;  4F3J A;  4ES8 A;  5BNP C;  2XLF A;  5JCT A;  3I2G A;  4ISR A;  4XAB A;  2IXI A;  4TLF A;  5H9S A;  3VZL A;  4QPW A;  5FPB A;  3NV4 A;  1ENS A;  1RHI 1;  2ZA9 A;  2VNO A;  1LGC A;  4YRD A;  1QNY A;  3IDA A;  3SEE A;  3HVD A;  3R4D B;  4GB3 1;  2ID4 A;  3GZE A;  3VBH C;  4K1Z A;  2BGP A;  1ASJ 3;  1HXS 3;  1ZRI A;  4N7U A;  3MPP G;  4IEP A;  2W39 A;  5FKC A;  3SCG A;  1JZ5 A;  4ZXE A;  2DBI A;  3OGS A;  5F5C A;  1AX0 A;  3AFK A;  2IFR A;  1J3R A;  1VBC 3;  4YW7 A;  5GLT A;  4HKL A;  1PIV 1;  3SHR A;  4NAO A;  2HEV F;  1FOD 3;  1MS0 A;  2HWE 2;  1XBF A;  3R4S A;  5FZH A;  5SV8 A;  3T4H B;  4E4H A;  3Q8A A;  5F6L B;  2GAU A;  3LFI A;  3FX3 A;  2R1B A;  4EN6 B;  2JDK A;  3ZXK A;  4DIN B;  1AJO A;  2PHT A;  3W20 A;  4LNV A;  3I2O A;  3KS7 A;  3SH5 A;  1OH4 A;  4YW5 A;  2O14 A;  3VBR B;  2OXB A;  1JU4 A;  1OVP A;  1U5X A;  2OZJ A;  3L2H A;  2NPI A;  3M8L A;  4N9H A;  3VKL A;  1BBT 1;  1D0G A;  1WD4 A;  3MI8 A;  1H6X A;  1W9W A;  2ERF A;  5JOX A;  3ACL A;  5LZ6 A;  2P6H A;  2F4P A;  3ZIW A;  5JXG A;  1QQP 2;  4FP3 A;  4P9X A;  3ZOI A;  3AYE A;  2XKO A;  3VKO A;  1C28 A;  4B8E A;  1C5H A;  1BK1 A;  4QHZ A;  1T6G C;  3GNE A;  2I07 B;  2D6M A;  1UQX A;  1FV3 A;  3SNM A;  1W0P A;  4OHW A;  3U78 A;  1SPP B;  5CVR A;  5K0U A;  1ZYB A;  5JXJ A;  1RVF 3;  1B35 A;  1MZ5 A;  2BWA A;  2VOW A;  4MH0 E;  3J7N A;  5JSP A;  1BCX A;  5K9Y A;  2RE9 A;  4TN7 A;  4UW3 A;  1YQ5 A;  3F95 A;  1GOH A;  1NYW A;  4K7J A;  3D82 A;  2VGD A;  5T55 A;  3ZYB A;  4XCB A;  4M01 A;  3N7L A;  3DYP A;  1HW5 A;  3FZ3 A;  4AYU A;  3S30 A;  2WNU C;  3OPW A;  3OPZ A;  3QLQ A;  3OBA A;  4AI2 A;  4IE4 A;  4XZU G;  1FMD 2;  1WGP A;  2DCK A;  2IXL A;  2RDQ A;  2WA4 A;  3JB8 A;  4JGZ A;  3O14 A;  4LA3 A;  3I7D A;  2WAA A;  5IFP A;  1WLD A;  1XYP A;  2CV6 A;  2BW8 A;  1IKP A;  3NAP B;  5FPV A;  4CDW A;  1NT0 A;  2O0O A;  4YSF A;  5HXM A;  1AL2 2;  2VO5 A;  3HQU A;  3RDI A;  4GA9 A;  1LCL A;  1W90 A;  1JXN A;  3SH4 A;  1BLZ A;  4AVB A;  2V09 A;  4Y1X A;  1F2N A;  3J7H A;  4RR3 A;  1SFY A;  2P3Y A;  5FV3 A;  5I8T A;  1XQN A;  2Y26 A;  4QDS A;  5E6H A;  3H0O A;  5LBE A;  5FXZ A;  4BLJ A;  5KHG A;  1MQT C;  1PHM A;  2Q4S A;  1HRI 3;  5FZK A;  1V6L A;  1W6P A;  1OF3 A;  3HD8 B;  3UYJ A;  4DFS A;  2ZEZ A;  4Y1V A;  4QQ2 A;  4E27 A;  3FBM A;  4O65 A;  5LBF A;  4AFA A;  4DY3 A;  2ARX A;  1ULD A;  2RS1 3;  5KC6 A;  1I6X A;  4FPH A;  1GKB A;  4AZZ A;  4CDU C;  4C90 A;  3KV9 A;  3ZR5 A;  2ZOE B;  1C1F A;  2OPK A;  4YG0 A;  5BNN B;  4L9B A;  4B29 A;  3G7D A;  1KS5 A;  4BME A;  4IE7 A;  4GKY A;  4TYS A;  3VDD C;  5JZG C;  1PMI A;  2F4L A;  4ZU4 A;  4YM0 A;  3NNG A;  1R08 2;  1MAC A;  4FPC A;  2RMU 1;  2ZML A;  4BQX A;  1WD3 A;  3WZ1 A;  3FWE A;  1DFQ A;  4W4Z A;  3BTZ A;  5DZG A;  1MQT B;  4JGY B;  5JPN B;  4Q8L A;  2VUD A;  4CE8 A;  5GZG A;  2AEY A;  4IXL A;  1GZW A;  4UF0 A;  4GMP 0;  3DXU A;  1CVN A;  4Q1R A;  4COW A;  3BAL A;  2XVL A;  3CEW A;  4S2G A;  3KV4 A;  4XBL A;  5L9R A;  4AGR A;  4JZR A;  4WZF A;  4XUO A;  2V73 A;  1W28 A;  4XOG A;  2KR2 A;  1J1L A;  5C71 A;  1G9C A;  2JEC A;  4LIT A;  5FO8 B;  4Q0U A;  2GN3 A;  2NP0 A;  2V4V A;  4BQ3 A;  5EYX A;  3WCR A;  1H2L A;  1XE7 A;  2AZ5 A;  5JZG B;  3RMY A;  4Z8B A;  2DV9 A;  3HN1 A;  2QQW A;  2BP6 A;  1S0D A;  3AZY A;  1RUD 3;  1PK6 A;  4TSV A;  2GSY A;  5FWJ A;  3GZT B;  1OOP B;  3A21 A;  1U12 A;  4DRR A;  4PIX A;  3E5U A;  2HLE A;  1NLQ A;  3OSD A;  4HVQ A;  1SHW B;  3P3P A;  2HYX A;  3NNF A;  3ACF A;  4K8R B;  5LRS A;  4IES A;  3JD7 2;  1Z7S 1;  4KG8 A;  1WLT A;  1A6C A;  5ABJ A;  3LIH A;  2VNR A;  4Y3O A;  1XNB A;  4P9J A;  1TZO A;  2EF6 A;  4I02 A;  1J59 A;  2D6N A;  2DUR A;  4XJ9 A;  4XVH A;  4LIU A;  4Y4R A;  4MZU A;  3EHK A;  4LUL A;  3ES4 A;  5K8S A;  2E7A A;  1BVV A;  3WT3 A;  1NG0 A;  2D6K A;  2HH9 A;  3J8F 1;  3WLU A;  2C5D A;  3WDW A;  3DF0 A;  3UET A;  2VZQ A;  4F83 A;  3D8C A;  3KVB A;  4EWA A;  4HK8 A;  2R04 1;  5A3M A;  1MS9 A;  4IEO A;  3RZL A;  1KJL A;  2TBV A;  5C9A A;  2Q8E A;  4XUR A;  3SH3 A;  5CFC A;  2GN7 A;  1VMF A;  2E33 A;  1HB4 A;  2XLA A;  1GOF A;  4G4F A;  2HBT A;  1W8N A;  4UW5 A;  1WA4 A;  3BTX A;  1S0B A;  1PNF A;  1STM A;  1NZI A;  4B7K A;  1VRH 2;  2OS2 A;  2QQU A;  2YBP A;  2ZGK A;  3GCW A;  3AXE A;  3WF2 A;  1KRI A;  1SCR A;  3WXP A;  3APB A;  4CDQ A;  1RED A;  1US3 A;  4LBQ A;  2I2S A;  1W6N B;  5A6X A;  2AH2 A;  4FFF A;  3NST A;  5LCW L;  5C4W B;  2TNF A;  4EZH A;  3KLS A;  3H9A A;  4HON A;  1F9K A;  2P17 A;  1HX6 A;  5T50 A;  3VDC A;  1I5Z A;  4Q26 A;  4XFB A;  1TMF 3;  4QQH A;  4XTP A;  4V2V A;  1IOA A;  3U07 A;  3ZFE C;  3D0J A;  1W0O A;  1RUF 1;  3ZYJ B;  1RC6 A;  1VJ2 A;  4HPK A;  1X33 A;  2GAL A;  3CJI C;  4ATF A;  1WKY A;  2ZPX A;  3OBR A;  4B4R A;  3AFG A;  3ORJ A;  4QX7 A;  4QX3 A;  5JSO A;  2Z4F A;  4C8D A;  3ZXG A;  2YMZ A;  4EWD A;  4CEY A;  2VZP A;  4YM2 A;  1CR7 A;  4KI5 M;  3ETQ A;  4BPZ A;  1ENQ A;  3FFZ A;  1AHS A;  1TQ5 A;  1UU6 A;  4XQD A;  4W8J A;  2XHN A;  2ZHN A;  3O5S A;  4FOV A;  5CZK A;  1O7F A;  4NRP A;  2EXI A;  4XFH A;  1FPN 2;  3OGJ A;  2CU5 A;  3ZKU A;  2WO2 A;  3OYW A;  4XPV A;  3GBW A;  2WNV C;  2GC0 A;  2D7F A;  1XE8 A;  1NA1 B;  1NCR B;  3ZFE B;  4KWL A;  5LAS A;  4R52 A;  1G86 A;  4YLZ A;  2ZS6 B;  3AP5 A;  2FZ2 A;  4UI9 L;  1ZM1 A;  2DVB A;  2QKD A;  5GZD A;  4LK6 A;  1PGL 2;  1XJA A;  4XF1 A;  2C26 A;  3K4D A;  1IPJ A;  1YFW A;  5D8A C;  5E1R A;  1TE1 B;  1ZBE 2;  3D6E A;  3QAC A;  3QH7 A;  2RVA A;  5L73 A;  3OY8 B;  1CAU A;  3I3Q A;  4L11 A;  3I3M A;  5FYM A;  4YZ5 A;  2NMO A;  5J98 B;  5FZ8 A;  1NE4 A;  4FT8 A;  2BVV A;  3U4S A;  2BQP A;  2QQK A;  4SLI A;  5LWB A;  1NXM A;  1NQD A;  1OVS A;  1SLL A;  2JG8 A;  5A1L A;  4MG2 A;  1K42 A;  1LUL A;  5JMC A;  2VZO A;  3ZYP A;  2WNV B;  5HCB A;  1VBD 2;  1G6N A;  2J42 A;  2HWE 1;  2XB6 C;  3VZK A;  5DMY A;  3WQ7 A;  4XJ8 A;  5A7O A;  2GU9 A;  4XXP A;  1KGY A;  2E26 A;  4Y4Y A;  5FJH A;  4NE9 A;  4RGK A;  4H7L A;  1WWY A;  1X8M A;  4CRQ A;  5FYC A;  3WUD A;  3CKH A;  1HN0 A;  5FZ4 A;  3HN3 A;  3QH6 A;  3POI A;  4AL9 A;  1W8O A;  1LR5 A;  1EV1 2;  4Q2F A;  4WM8 B;  1AR7 1;  1OA2 A;  5A3O A;  4H2A A;  3THT A;  1QNW A;  4IE6 A;  4Z82 A;  1Z78 A;  5B4N A;  2HEW F;  5EFU A;  4Z2W A;  4G9S B;  4O7X A;  2CYF A;  3TEW A;  3E6B A;  3NNJ A;  5F3G A;  1F15 A;  3OGR A;  1XB9 A;  3VL9 A;  1GWL A;  1SFN A;  4QX2 A;  1AR8 1;  3WP5 A;  2VL4 A;  3WG4 A;  4D6S A;  2Y38 A;  3KCC A;  1UCX A;  4AVT A;  4CCJ A;  2WAB A;  2Y60 A;  3RZK A;  1DQ4 A;  4ASM B;  1VPH A;  1QKQ A;  1HQN A;  4KQ7 A;  3BIW E;  1OT5 A;  1XND A;  3AP9 A;  4RS5 B;  1VBA 3;  2AEZ A;  2EIG A;  2A6X A;  4LKE A;  3MPB A;  1V6K A;  1QJE A;  2ZEY A;  2IC1 A;  3VBO B;  3ZXJ A;  1M06 G;  3A0N A;  2NMN A;  2ZGO A;  4FPG A;  4BXF A;  2X29 A;  4ARX A;  2DFC A;  1ODM A;  1VBE 3;  2RS3 1;  4BXS V;  1FMD 1;  2XML A;  3VZM A;  4AHW A;  3DV8 A;  2QE3 A;  5FYS A;  3GBF A;  3CDZ B;  4FOW A;  2IZW A;  2BOJ A;  2WC2 A;  3NVC A;  3ZN5 A;  3GM8 A;  4CDX C;  4FPL A;  1GWK A;  3VBF B;  3RZZ A;  3RYR A;  2OZ6 A;  3OPT A;  2JDN A;  4FQZ A;  4PDW C;  1MEC 2;  1C4R A;  4LO8 A;  2GMM A;  3CHX A;  1ZVF A;  4YW4 A;  5JLV A;  1V9U 2;  4KNC A;  2HWB 3;  1NE6 A;  2WLQ A;  4GQ7 A;  1F31 A;  3TN9 3;  1K3I A;  4HT1 T;  1YQ2 A;  3O1T A;  2G9Z A;  4OYU A;  4YVW A;  3SCF A;  1GU3 A;  1AYN 1;  2L9L A;  4DUW A;  4DXS A;  1XNT A;  1LES A;  2XJU A;  1RIN A;  2QZ2 A;  1RHI 2;  1DQ6 A;  5ANN A;  5G04 L;  1HJF A;  1ND2 A;  2WA3 A;  1QY4 A;  2ARA A;  1JU3 A;  2B7Y A;  3QOP A;  4GB3 2;  2MPF A;  4M0N A;  2GH2 A;  1EAH 2;  2R16 A;  3OUJ A;  4D7T A;  3J26 N;  3OBT A;  3HOB A;  3P5B A;  4J25 A;  1RUG 2;  1W3V A;  5G05 L;  2PHD A;  1PIV 2;  2XOM A;  1QXP A;  3TAY A;  3W59 A;  4LBO A;  5JI9 A;  3FLR A;  5ACA 1;  5FK7 A;  3RNS A;  4Z2A A;  4KBB A;  2QZ3 A;  2HJI A;  3BB6 A;  3ABZ A;  2B39 A;  4HBN A;  1W2T A;  5GLZ A;  3ACH A;  2X05 A;  4QKB A;  1J83 A;  2I45 A;  3AMH A;  4H7M A;  3NJY A;  4JX0 A;  1D4M 1;  3X29 B;  3WIN E;  4QQO A;  1Z0H A;  1MZE A;  3CL1 A;  4AGV A;  2KA3 A;  2XXZ A;  4XUN A;  4JGZ C;  1BBT 2;  5K0U B;  3CJX A;  2ADD A;  2NZ9 A;  3RZM A;  1B35 B;  1ZZC A;  4KH9 A;  3WW2 A;  1CAX A;  2W1U A;  3KB5 A;  3U1X A;  4YZ2 A;  5CKN A;  2XDV A;  1Y43 B;  4JCK A;  3O0V A;  4S2F A;  4CEW A;  1NCQ A;  1YWK A;  3N3H A;  3UKT A;  1UOG A;  3ILN A;  5CIR A;  2YHJ A;  1JZ3 A;  3MZH A;  1SZB A;  2J1S A;  5LY2 A;  1UW8 A;  1AXK A;  1V6J A;  2OT7 A;  4L2N A;  4I0A A;  4IGO A;  4YM1 A;  5FZB A;  1X36 A;  2UYA A;  1PO2 1;  2VR4 A;  1LED A;  4Q4X 1;  4R9D A;  1H6Y A;  4XJU A;  5FBJ A;  4JGZ B;  3TB0 A;  3VBS C;  2R07 1;  4Q0V A;  3I2H A;  1BK0 A;  2PHU A;  3AMM A;  4Y1Y A;  5A6Q A;  3IPV A;  4D7Y A;  5LK7 B;  4CDW B;  1H1M A;  4XUQ A;  1BJQ A;  1WMD A;  1YC6 1;  4FXG B;  4NUB A;  5C3P A;  1IQD C;  3Q8F A;  4QPI A;  1EP0 A;  1W9F A;  2FDG A;  3VD7 A;  5H9Q A;  2GZW A;  4Y5T A;  3FLT A;  2WFF 1;  5AVA A;  3RWK X;  3VV1 A;  3S6P A;  3T1M A;  4RGG A;  4RR3 B;  1OLM E;  3I2F A;  5EQU A;  2P37 A;  3UNP A;  3HNY M;  1ACC A;  4QXC A;  1Y3T A;  2R6Q A;  4Q4V 3;  3CU7 A;  1W6P B;  2VME A;  1CJP A;  2EAK A;  4NHM A;  4XFA A;  5T3N A;  4J6G A;  4QKD A;  4N9I A;  4IQP A;  1L7L A;  1X9P A;  2JDP A;  4YFW A;  5I8S A;  4KMQ A;  1F4A A;  1BEV 1;  4XF3 A;  1CAV A;  2XVG A;  3N9M A;  1XC6 A;  4LBM A;  1L7R A;  2JB8 A;  4IV3 C;  3U14 A;  1VB4 A;  2D3P A;  4AAX A;  4DUV A;  3MIH A;  1IQA A;  2XQX A;  5LY1 A;  4UFL A;  2W08 A;  1XSQ A;  4R9B A;  1F5F A;  1YQ8 A;  3E5Q A;  4Y5S A;  3T1L A;  3H1Y A;  3OB8 A;  1F8V A;  4UF0 B;  1GZW B;  2A6Z A;  1E5H A;  4N8M A;  4PJY A;  2OQ6 A;  3DKW A;  2C4X A;  2GC1 A;  2D40 A;  3GF6 A;  2XJP A;  1UU4 A;  2A7A A;  1RJ8 A;  5A7S A;  3CMG A;  4PIZ A;  2VCB A;  2EXH A;  1W2O A;  1ENX A;  2D5H A;  2XG3 A;  1RUI 1;  3B00 A;  4NPL A;  4ZY9 A;  1MZF A;  4OHX A;  4I01 A;  4MHR A;  4CYD A;  4XDQ A;  4AI9 A;  2WNO A;  3MUY 1;  3O1P A;  2PMW B;  3ILF A;  3VHO A;  2JDM A;  3VHN A;  4L99 A;  4ASK A;  3BUC A;  1QOT A;  3RMX A;  4MXW A;  1UWW A;  1JW6 A;  1IS3 A;  1GP4 A;  2RMU 3;  1LNS A;  3CZJ A;  4QQP A;  5CB7 A;  1W2A X;  4CP0 A;  1PK6 B;  2Y6K A;  4JV4 A;  1OH3 A;  1UZ0 A;  5JUV A;  3PVN A;  3W5N A;  1OHF A;  1OXC A;  2RS5 1;  2VD7 A;  3JB4 C;  2ZKN A;  4NOT A;  4LKD A;  1G9B A;  2UWA A;  3RZH A;  2VOT A;  1ULF A;  1UY1 A;  4GIQ A;  2VBB A;  5K4L A;  3D4K A;  3AXD A;  3AYA A;  4OUE A;  3EXU A;  5ABJ B;  5CFC C;  1YYN A;  4AI0 A;  3WCS A;  4NRQ A;  1LOG A;  1QXR A;  2QTW B;  2DF7 A;  5D1I A;  3MHZ A;  4AI3 A;  2A3Y A;  1AR6 3;  4GD4 A;  5DXD A;  3JCI A;  3FFQ A;  1UYZ A;  1AR9 1;  5FY7 A;  1LOF C;  5BYN A;  1LEM A;  2PQQ A;  1Z7S 2;  2R1D A;  2QJV A;  4LKF A;  4NHK A;  5E88 A;  3GAL A;  2MEV 1;  5DUV A;  4LO7 A;  5ERL A;  2ZHM A;  3I49 A;  2JB4 A;  4BQY A;  1CIY A;  2C6S A;  3SKV A;  1SDW A;  4B3N A;  1QJY 1;  5HCF A;  1SFP A;  5H9R A;  4OUM A;  4S2H A;  1QH7 A;  3PUI A;  4CP2 A;  1FXZ A;  1ZRC A;  5CFC B;  4MOA A;  5JOZ A;  2LM3 A;  1XSR A;  1L7Q A;  1K45 A;  3NKT A;  1RUN A;  2RM2 3;  1WCU A;  2DU0 A;  3J8F 2;  4YVS C;  1RUE 3;  4UXA A;  2W91 A;  3AMN A;  5D2A A;  1Q8Q A;  1RXG A;  5FZ3 A;  3LWC A;  3WEZ A;  2R04 2;  2Q8C A;  4CUG A;  5K7P A;  2D43 A;  3RJR A;  4FI9 A;  3J8F 3;  4QXB A;  4CDQ B;  3OTF A;  2ZGP A;  5E89 A;  2WQ8 A;  4CUA A;  1QJX 3;  3OUH A;  4UBH A;  2Z42 A;  1Y9M A;  3BPS A;  2VZR A;  3S7I A;  3JZV A;  4COY A;  5CAD A;  5CG8 A;  4OHY A;  2YPD A;  2D5F A;  3AKS A;  2DTY A;  4IE0 A;  5BNO C;  4Z92 B;  4ZS2 A;  1ZRD A;  3RG0 A;  5GAL A;  2PLV 1;  4OFG A;  4LKS A;  3ZSK A;  4LO4 B;  3ZMN A;  5EZW A;  1LB2 A;  1ZA4 A;  4HPK B;  4MGS A;  4FAG A;  1QDC A;  2NLR A;  3VKM A;  3CIH A;  4AED C;  4CEY B;  1N1S A;  3ETP A;  2ES3 A;  5FZL A;  3WP6 A;  2QNK A;  3CLP A;  2WQ4 A;  4KU7 A;  1YQC A;  4RGA A;  1ULC A;  4GH4 C;  2G4I A;  5LRR A;  1C8M 1;  1RUF 2;  1TME 1;  2FCT A;  2PQS A;  3MBW A;  4BK4 A;  4BZ4 A;  1WUV A;  5FLI A;  2KM2 A;  4CP9 A;  5BNO B;  1VAL A;  2BRT A;  1QOO A;  2G9G A;  1H30 A;  3OYW B;  4YM3 A;  2D6P A;  3OG2 A;  3WDY A;  3TNP B;  1OFN A;  3I2D A;  1GBG A;  4LXL A;  4HSL A;  3N9Q A;  3H7Y A;  2QFE A;  2VTF A;  1JYN A;  1YNA A;  3AKP A;  3PUR A;  3HBZ A;  1JOB A;  1T2X A;  1RGS A;  4JC1 A;  1KXG A;  4R9A A;  3UGG A;  5F1R A;  1UIJ A;  1UXX X;  4IET A;  4QB1 A;  4FPJ A;  1FAT A;  5A6Y A;  3EMR A;  4CUC A;  1CAU B;  1WW4 A;  3H3Z A;  1DYK A;  1W05 A;  2NQY A;  1IG0 A;  2YZ4 A;  3IWZ A;  3A7Q A;  2BFU S;  5AFE A;  2QQO A;  1SBE A;  2JG8 B;  4IV1 C;  4E8D A;  4CTE A;  4EWE A;  4LA2 A;  4A41 A;  3PUS A;  1H2K A;  3SXW A;  5I93 A;  1V6N A;  3KZ4 C;  2R0F A;  3PUA A;  1OKO A;  2BFU L;  3NO8 A;  4RL7 A;  1RJ7 A;  1EAH 1;  4ZHN A;  4LLF A;  3VBR C;  1NX9 A;  1JMU B;  4WVV A;  5FZ1 A;  3AJY A;  4HKO A;  4LK7 A;  2YV8 A;  4YZ4 A;  3U10 A;  1IGO A;  3LZZ A;  4N53 C;  3S0M A;  1SBD A;  1JS9 A;  3KT1 A;  1RUG 1;  1YQ6 A;  2B46 X;  5JR7 B;  3DKQ A;  3JBG 1;  2NM1 A;  4GXL A;  5FP7 A;  4ONU A;  4LBL A;  1ODN A;  3I8T A;  3ZSJ A;  5C7G A;  1PVC 1;  2WN3 A;  4EN8 B;  4IV1 B;  3E6D A;  4O61 A;  2NYY A;  2AR6 A;  2GDF A;  2VUL A;  1ENR A;  3SCH A;  2WWU A;  2W1Q A;  2HWE 3;  3S5A A;  2BUK A;  4MAD A;  3DEM A;  4XET A;  3OOX A;  2UY8 A;  2QQI A;  4O9G A;  4RFT 0;  3UGH A;  2GC3 A;  2CWM A;  1H8T A;  5DAX A;  3F2Z A;  2KXL A;  3RFR A;  1AR7 2;  1PZ8 A;  5L7O A;  3NWK A;  5F2S A;  1W2N A;  5FUN A;  1WBL A;  4N53 B;  4TTG A;  2JD4 A;  2P4E A;  4EZ4 A;  1JYI A;  4N7I A;  2VZT A;  4XJA A;  2W87 A;  3WQB A;  1DQ2 A;  1CAW B;  1GWM A;  1W6M A;  2EXJ A;  2XL9 A;  3K46 A;  3AMP A;  3KHB A;  4IDZ A;  1DLC A;  5FTT C;  2V4A A;  1K5J A;  4BIO A;  2RDS A;  1AR8 2;  5A33 A;  2A71 A;  5C8C A;  2OA2 A;  2BEO A;  5A80 A;  1QQP 3;  2VQ0 A;  3M3I A;  3T0B A;  4A45 A;  2ARB A;  5EIY B;  1W8Z A;  3PIG A;  4Q4Y 1;  4CA9 A;  1N3Q A;  2ZX1 A;  2JKB A;  4I0W B;  3N9O A;  4BIF A;  5AC9 1;  1A78 A;  3NAP C;  2FDI A;  1RUH 1;  3EQE A;  3ZN4 A;  3ZYH A;  5FPU A;  3ZSL A;  3NV2 A;  3M7A A;  4QPG C;  4YVW C;  2Y0I A;  2GC2 A;  1Q8S A;  4XE9 A;  1WLC A;  2MNG A;  4TLG A;  1DQ1 A;  1SLA A;  5KC5 A;  3AZX A;  3ZDS A;  1UYX A;  3W5M A;  3B5L B;  4AQ2 A;  1D4V B;  1NY7 2;  1D2S A;  2JDU A;  4M0H A;  4JTN A;  4QHO A;  1ND2 C;  3AP7 A;  5IVF A;  4NIG A;  3LDB A;  4OVE A;  1GMM A;  2EA7 A;  1MS4 A;  2RS3 2;  3KCX A;  3TOJ A;  5DG1 A;  3RS6 A;  4PQ9 A;  3Q8B A;  4EN0 A;  4OUS A;  3ILR A;  4ET7 A;  1JTZ X;  2LUW A;  1PX3 A;  2BNN A;  2Y6J A;  1FMD 3;  3DPR A;  4IER A;  1JZ7 A;  4LQR A;  1WW5 A;  1POV 0;  1RXF A;  1SG3 A;  2IVI B;  4KL1 A;  4QPG B;  4YVW B;  3ZSE A;  3WSO A;  3AVS A;  2XJR A;  1HQL A;  4BU2 A;  2D3R A;  5BNN C;  3NNL A;  3V0A A;  5HCH A;  3GHN A;  1AL2 3;  2VZS A;  1TG7 A;  1QHD A;  3I59 A;  1LGB A;  3C2U A;  1DBN A;  3J7L A;  4LBK A;  4D69 A;  4CU6 A;  1PM4 A;  1ND2 B;  2DCY A;  2UWB A;  1XU2 A;  4PF5 A;  3VBU C;  1BVP 1;  1HLC A;  4BJ0 A;  4NO4 A;  1H4H A;  1OFS A;  2ARC A;  4JGY C;  1KS4 A;  1OLM A;  1PZ7 A;  2RG4 A;  3VDA A;  2E31 A;  4XXA A;  3POB A;  1AYN 2;  4PT6 A;  2ATF A;  3RVH A;  5JSR A;  4PI0 A;  5JOY A;  4HZF A;  1J58 A;  2RV9 A;  5FY4 A;  1OQD A;  3PVO A;  1V6M A;  3J7M A;  2JEM A;  2VW1 A;  3MW3 A;  1YRZ A;  3LQC A;  3WF3 A;  3FHI B;  2Z2S B;  5GZE A;  5IT6 A;  1YHF A;  5HBA A;  2VOK A;  5CNA A;  3O1U A;  3T0D A;  2Y34 A;  4IUG A;  1TNR A;  2ZHL A;  5FMO L;  4UYB A;  3VZJ A;  4F8A A;  1WLW A;  1YEW A;  1YXW A;  3FHA A;  4DXZ A;  1P8J A;  3DL3 A;  2H0B A;  4FVV A;  3VBU B;  2QQP A;  1IS6 A;  1OOP C;  2PFW A;  4QX8 A;  1POV 3;  1W0N A;  1FNZ A;  2UY9 A;  1KFX L;  1R08 3;  3I3E A;  5A7N A;  4AK3 A;  1S0I A;  5ACA 2;  2BBV A;  4RSU A;  3ITQ A;  3V0B A;  1S0C A;  1H8V A;  4L0P A;  5BXX A;  3ZR6 A;  1HV1 A;  2RHP A;  4P5Y A;  3AJZ A;  2PTM A;  3ZDV A;  1CAX B;  1K5M A;  2WQZ C;  2VMI A;  2WRA A;  2A6W A;  2Y6H A;  4RHV 1;  5HXV A;  3CO2 A;  3VUO A;  3ELN A;  3MIB A;  4QPI C;  2HWF 1;  4FOQ A;  5CYY A;  1D4M 2;  1NCQ B;  3WNM A;  1OF4 A;  4CEW B;  2YG0 A;  2ZBJ A;  4M00 A;  3WQ0 A;  1VAK A;  3O1O A;  5FZ6 A;  1UNB A;  5BY5 A;  3DUI A;  4ATE A;  1ZA7 A;  3M2M A;  1C1L A;  2VQU A;  5FXW A;  4YPJ A;  1QJU 2;  2ZHK A;  4DQA A;  1QXJ A;  3WP3 A;  3MW2 A;  1ST8 A;  2AUY A;  2G9F A;  2OX0 A;  5DUU A;  1CGP A;  1KDM A;  1S0F A;  1JZ8 A;  3IPV B;  1VMH A;  2GH8 A;  3VHR A;  4COV A;  4AXO A;  4E2G A;  4XJW A;  5FQ0 A;  2JD9 A;  1S2K A;  3M4F A;  4QPI B;  2LTN A;  2WIN B;  1PO2 2;  2OUH A;  3JD7 3;  4Q4X 2;  4UOJ A;  3UES A;  2P2K A;  2IWG B;  1R1A 1;  2X8K A;  3ZYG A;  4P9I A;  2BOI A;  4GKX A;  4QB2 A;  2R32 A;  4XHB A;  4AE2 A;  3HJR A;  5A32 A;  1OBN A;  2R07 2;  5HPO A;  1VAV A;  5I0U A;  5FZM A;  4HLT A;  4DB5 A;  2FDF A;  4YW3 A;  3TRS B;  2GND A;  4Y5Z 0;  4LIV A;  2ZZQ A;  3ZN6 A;  4I2O A;  1DZQ A;  1JOD A;  2IXH A;  2Y0O A;  5C4W C;  1DIW A;  1H9W A;  1GSL A;  3ZVX A;  2WFF 2;  2ZX0 A;  3BGA A;  4QB6 A;  4YYO A;  3P6B A;  3ZIX A;  1JYT A;  5IVV A;  1U0A A;  1UMI A;  3KSC A;  1C8N A;  4XYX A;  1AXY A;  3V64 A;  2XJT A;  1CAV B;  1EY2 A;  3O1V A;  2ET1 A;  3EYP A;  3TEZ A;  4Q4W 2;  2VCA A;  3MLJ A;  3LFM A;  4XFG A;  5KXB A;  2PAE A;  4HVR A;  4RN5 A;  3B94 A;  2WFP A;  4E4Z A;  1NLS A;  1BZW A;  2HWC 2;  2IFW A;  2PHF A;  1VRH 3;  1W03 A;  1AYM 1;  2CAU A;  5DZE A;  4JDM A;  3M70 A;  4Q1P A;  3ZSM A;  2ZX2 A;  4BE3 A;  1F35 A;  1YFY A;  2BGC A;  1BEV 2;  3LA7 A;  1CIW A;  1WZX A;  4M3C E;  3ZPY A;  3JQW A;  5LB6 A;  5E16 A;  3BOD A;  1AL0 G;  4AF9 A;  1ND3 A;  2K9Z A;  4JDO A;  4LO5 B;  1JI6 A;  3N36 A;  1NA1 C;  1NCR C;  1AXZ A;  3LB9 A;  5HV4 A;  3BPZ A;  4XDO A;  1OI6 A;  4XAC A;  1X82 A;  4JVA A;  4YG6 A;  4UFJ A;  1LJ7 A;  2FBE A;  1BQP A;  2G19 A;  2PYT A;  2WDB A;  3IT8 A;  5CKQ A;  2WZP P;  1DGL A;  1OQE A;  2VMH A;  3TWI A;  1BMV 1;  1E5S A;  3ES1 A;  3IBM A;  1YJL A;  4MXW B;  4QT6 A;  3VGI A;  4D6R A;  3RGB A;  4ES9 A;  4HET A;  3ACI A;  5JIA A;  5IK5 A;  1ZRR A;  3FN9 A;  5B4X A;  1JUI A;  2WZR 1;  4KBZ A;  2XPJ A;  4KWU A;  1RUI 2;  1V70 A;  1AX2 A;  3JUU A;  3VB9 A;  4RQP A;  2RDN A;  2XBO 1;  2YFZ A;  4G3Y C;  1W9Y A;  3C7E A;  3AYC A;  4B4Q A;  4C1W A;  1RUI 3;  1FPN 3;  3MV0 1;  1DGR N;  3Q8E A;  4WVW A;  5JXH A;  4XIL A;  5FPX A;  4QKF A;  3RZG A;  1OA4 A;  2HBU A;  4XDP A;  3UGF A;  2RS5 2;  1COV 1;  4OZX A;  1GZ9 A;  5FOJ B;  4OUL A;  1Q8V A;  1GP6 A;  3ZXE A;  3C8X A;  1HV0 A;  4W6X A;  1JOP A;  3LAG A;  3ME2 A;  4DXR A;  4CCD A;  3CNA A;  1PNG A;  1LU2 A;  2YYO A;  2X5I A;  4WM8 C;  2RS5 3;  5FP3 A;  1HRV 1;  2GNB A;  3I97 A;  1YLL A;  3NJX A;  3PTY A;  4QXK A;  4D0Q A;  2VW2 A;  1O3Q A;  4YNI A;  5J3U A;  1W8H A;  3FJS A;  1WCS A;  4TWT A;  1RIT A;  1ZBE 3;  2RJL A;  3ROU A;  2N7G A;  4NMI A;  4AGG A;  4CSW A;  4OHV A;  2SLI A;  3K2O A;  3B02 A;  2CL2 A;  5A3N A;  1W39 A;  2YFU A;  3PU3 A;  1I5P A;  1OC1 A;  3POF A;  4K9S A;  3GJA A;  1AR9 2;  2DVD A;  2ZGN A;  1JHN A;  5FZ0 A;  5A7P A;  4AW7 A;  4I3P A;  5DG2 A;  1ASJ 1;  1HXS 1;  2DYC A;  4XQW A;  1VBD 3;  2MEV 2;  4XBN A;  5DN2 A;  2DUP A;  1ULP A;  4HVO A;  4U2A A;  1UKG A;  4JKK A;  3RSJ A;  3VDB A;  1VBC 1;  4EV0 A;  1QJY 2;  4PF1 A;  1UF2 C;  1UYP A;  2VUC A;  1Y4W A;  4YFZ A;  4D8M A;  4RS5 C;  5JVV A;  2WAO A;  1FOD 1;  2VJX A;  2EXK A;  2QDN A;  2F17 A;  1LHV A;  2ZX3 A;  2WZ8 A;  5IJR A;  4UBG A;  2CSG A;  5IAV A;  1LAJ A;  4HMZ A;  1EV1 3;  3LEK A;  2GMP A;  3VBO C;  2R7E B;  2J1T A;  1UIK A;  2QDR A;  2VU9 A;  4N43 A;  2ILM A;  2XJS A;  3MV1 1;  3OD0 A;  1UZW A;  4BMB A;  4KG0 A;  4FXK B;  3UJQ A;  4DO0 A;  3K3N A;  4W6W A;  4YZ3 A;  3ON7 A;  4L92 A;  4FFG A;  5APA A;  5KWR A;  3POY A;  1N3O A;  4KWK A;  2D3S A;  2FCU A;  4RD7 A;  4PHZ A;  3VBF C;  3B9C A;  4DMI A;  2PLV 2;  5BNP A;  2G1M A;  2YPJ A;  4I30 A;  5AFB A;  3T2T A;  1A3K A;  4CP9 B;  2IXC A;  4UW4 A;  1X7N A;  1PO1 1;  5HI0 A;  5A3P A;  3HPN A;  3WNN A;  3ZM8 A;  2ZEX A;  4P5H A;  3W21 A;  1NY7 1;  2B42 B;  5LBB A;  3VBH A;  5D21 A;  1RVF 1;  1VLN A;  3W58 A;  4FTE A;  3AK0 A;  2P3K A;  1GUI A;  1VBB 1;  5GJ6 A;  2A5Z A;  1HB1 A;  3C7F A;  4LEJ A;  3AZW A;  3EBR A;  3T30 A;  1C5I A;  1DZT A;  5FUP A;  4WM7 A;  3GZU C;  3RI9 A;  4A3X A;  1GZT A;  3V56 A;  1C8M 2;  1TME 2;  2HWD 1;  2ET7 A;  1RUO A;  5L9B A;  2YC2 A;  1JYX A;  2P3I A;  4YW2 A;  3ZYR A;  4DOU A;  2OKX A;  2WR9 A;  2ZGU A;  3K4Z A;  5DAW A;  4YZ1 A;  1C8M 3;  1TME 3;  3B01 A;  1O3R A;  1OD3 A;  1DP0 A;  4BWO A;  5FMB A;  1REF A;  3DN7 A;  3GJB A;  3H8X A;  5FKB A;  1G9F A;  2B8M A;  2FZ1 A;  2UYB A;  3LSD A;  5B2G B;  1MEC 3;  5DDJ 1;  3NJV A;  2VVF A;  3IN9 A;  4E4S A;  4DS0 A;  5FZ9 A;  5L7O C;  1OLR A;  1V9U 3;  3ZXA C;  3H8R A;  2VNV A;  1RL3 A;  2YRO A;  4N90 A;  5IVB A;  4GWJ A;  4LUK A;  2VW0 A;  2B9V A;  4FOY A;  3N9L A;  3THC A;  1JZ2 A;  2I74 A;  4HN1 A;  4PBO A;  4X8N A;  5IW0 A;  3WDV A;  3EB7 A;  5L19 A;  2W3J A;  3ATG A;  1HRI 1;  1RHI 3;  1QJF A;  2ZGL A;  3O7O A;  4NIH A;  1CWP A;  4EJR A;  2Q1M A;  1S0E A;  5BNQ A;  5K0U C;  4GB3 3;  4AHZ A;  1B35 C;  2X10 A;  5DPN A;  1EAH 3;  4JRL A;  3JBG 2;  5GLU A;  1H8T B;  5TSW A;  3WW3 A;  3MFA A;  1O8P A;  3HQX A;  4Z07 A;  3WDX A;  5L7O B;  1WMX A;  2OW4 A;  4AVS A;  1GR3 A;  3H1W A;  1RUG 3;  2ETE A;  1PVC 2;  2WT2 A;  3LE0 A;  5F3I A;  4AEM A;  5IVJ A;  1PIV 3;  2VY0 A;  2Z79 A;  2YBK A;  4MHU A;  5LK5 A;  3K48 A;  4KWJ A;  3ALQ A;  1FI2 A;  2D44 A;  2WNU A;  5F39 A;  2WKK A;  2W2I A;  3I2I A;  1A8D A;  4K21 A;  2WT1 A;  1QJZ A;  2GNM A;  4LR4 A;  5A33 B;  5C8C B;  3RYK A;  3LA3 A;  2P6C A;  2ZTN A;  2BBA A;  2JX9 A;  2YDE A;  4OMC A;  2TEP A;  4AVA A;  3ZKY A;  1DYO A;  2D6O X;  5JWP A;  5FJK A;  1QJU 1;  1QU0 A;  4CDW C;  3QBQ A;  4PBP A;  1UN1 A;  4ZPI A;  4ASL A;  5F5I A;  1EPW A;  3Q9O A;  5FY8 A;  4AEK A;  1BBT 3;  3LSE A;  3MFC A;  2V72 A;  5IWF A;  3BN6 A;  4MSV A;  1D0H A;  2ORX A;  5EPA A;  5LA0 A;  1UZY A;  4MGK E;  1NLR A;  3MLL A;  4KGQ A;  4DNY A;  4RR3 C;  4JQR A;  4Q4Y 2;  1RUD 1;  3A0K A;  3WDT A;  4FSJ A;  3WNX A;  5AC9 2;  2Q30 A;  1RUH 2;  4Y24 A;  1DGR A;  3VZO A;  3PLQ A;  4Q4Y 3;  5DAV A;  2J1U A;  2J7M A;  3HNB M;  2FD8 A;  2W94 A;  5F9T A;  5SV5 A;  5AC9 3;  1V6I A;  3KT7 A;  5CAZ A;  4OHZ A;  5FZI A;  1QEX A;  1UX6 A;  2DWR A;  4LHL A;  4QGN A;  2PHL A;  4B1L A;  4C1X A;  4FBF A;  5JR2 A;  4CDU A;  1UPS A;  3DPR B;  2WUH A;  1DYP A;  4WV8 A;  3RPQ A;  3FL7 A;  1YI7 A;  3K51 A;  3H3L A;  3WF0 A;  4P9Y A;  4BYY A;  2A3W A;  3VDD A;  5JZG A;  4AQS A;  3V0A B;  4GMP 1;  3A23 A;  3WF1 A;  2RR1 1;  1LHW A;  1UPI A;  3I59 B;  1JHJ A;  1H4G A;  4D7S A;  1YCI A;  3SLI A;  1FT9 A;  1ZX5 A;  3K4A A;  4Q4W 1;  1ZBA 1;  2H6C A;  4M4R A;  4MUV A;  2PHW A;  2VQA A;  3ZXL A;  1UO9 A;  4Y20 A;  5KHJ A;  2WSU A;  1SLI A;  1G9A A;  1W9T A;  2HWC 1;  1LOE A;  5CKM A;  3INA A;  5FZG A;  5A70 A;  1S0G A;  3R6S A;  4IND A;  2J1V A;  4AVV A;  5T5O A;  4DEQ A;  2VM9 A;  5T54 A;  4Z1V A;  4RYD A;  5FY1 A;  1J84 A;  4D94 A;  4PI2 A;  3III A;  1YUD A;  4AHX A;  1S2E A;  2EAL A;  3MGU A;  1B09 A;  1V6O A;  2BV4 A;  3NL1 A;  4K3U A;  5FYU A;  2R49 A;  4CXW A;  2YC4 A;  1PK6 C;  5A7Q A;  2EIB A;  1JN2 P;  1U5I A;  3CQO A;  3VL8 A;  4QD2 A;  1S0J A;  1E5R A;  2R06 1;  4DIQ A;  4R9C A;  5C3O A;  3USS A;  1HQW A;  2ZGS A;  3ZXF A;  2ZAC A;  3V0B B;  4LE3 A;  1O3S A;  3IAQ A;  4YGE A;  3UKV A;  3VN4 A;  1WCD J;  4FTS A;  3FUO A;  3T2P A;  1N1Y A;  1OA3 A;  1TMF 1;  2Y6L A;  4QX0 A;  4WZC A;  1KEX A;  1Q5O A;  5LAT A;  1K5M B;  5ABJ C;  4FAH A;  1UYY A;  3U11 A;  4M3C A;  5FP8 A;  2SBA A;  4FPF A;  4A7Z A;  1LTE A;  2XKP A;  5LBC A;  3POE A;  4COZ A;  2FHR A;  4ZZ5 A;  5J37 A;  4Q5O A;  3EJK A;  4E2S A;  1YIP A;  3CBN A;  4AFD A;  4Y22 A;  3OEA A;  3E1F 1;  4QU2 A;  5DQ0 A;  4CCN A;  1QGL A;  1U5Z A;  3UJO A;  2JG9 A;  1WW6 A;  4JDN A;  2OPW A;  3QCW A;  4NHL A;  1VB2 A;  2WO1 A;  1FAY A;  2Y6F A;  3BYW A;  3I2K A;  4RHV 2;  5FLH A;  2HWF 2;  3ZPO A;  4P9W A;  1CJD A;  1RMU 2;  1Y9G A;  3DYO A;  3JQX A;  4HN0 A;  4JRA A;  4JKL A;  3LEM A;  4UFK A;  5FZD A;  4Q8K A;  5I8Y A;  4NWW A;  2CAV A;  3HEI A;  1PM7 A;  2WWJ A;  2BDR A;  2O1Q A;  1GLH A;  3PNA A;  2VZV A;  5FQ0 B;  2A73 B;  2HWF 3;  3ZLI A;  2QQM A;  4IGP A;  5C3S A;  4LT5 A;  3AVR A;  4W65 A;  3R0R A;  3RZJ A;  4NHY A;  2P3J A;  3ASI A;  1YO8 A;  3K77 A;  3T09 A;  5A32 B;  1Y7B A;  2YXS A;  3VKN A;  1WBF A;  1LGN A;  2XQR A;  5I0D A;  4CDQ C;  4WVM A;  1APN A;  5A3U A;  2VE1 A;  3ZN6 B;  3KQR A;  1UY2 A;  4CPB A;  1PMH X;  2DFB A;  4A6O A;  1UOJ A;  3KCY A;  5FXX A;  2AGS A;  3AYD A;  1Z7S 3;  4HSJ A;  4OI1 A;  3ZFG A;  2HYK A;  4AQ6 A;  5C9A B;  4BK5 A;  1R1A 2;  3GCX A;  2E6V A;  1ND3 C;  1H1I A;  2CGO A;  2BU9 A;  3CJI A;  2ZKL A;  3WV6 A;  2XH6 A;  4FPO B;  2W5F A;  3C3V A;  3NKG A;  4LTA A;  2ORZ A;  1S55 A;  4LE4 A;  1KIT A;  4XW3 A;  3ZO0 B;  2CTV A;  2WT0 A;  4CEY C;  1SQ4 A;  1S2B A;  2JJ6 A;  1W6Q A;  3PL0 A;  4LBQ B;  3IM0 A;  1GOG A;  4QDR A;  3N4M A;  2BTV C;  3WY6 A;  2ZZJ A;  1UOF A;  2R04 3;  4QMA A;  5FRE A;  3ZXD A;  3ZYI B;  2VXR A;  3U4X A;  4AQT A;  1SBF A;  1LHU A;  2WYF A;  4FPE A;  4RQP C;  3U75 A;  1SLC A;  4BQ1 A;  2PXJ A;  2JE8 A;  3PUQ A;  5C33 A;  3VD4 A;  5C8W A;  2UWC A;  1ND3 B;  2AAC A;  3E5X A;  2GP5 A;  4AG4 A;  3USU A;  3DEC A;  1CON A;  3AZZ A;  3O1R A;  4E2Q A;  4AWD A;  4HKW A;  4IEY A;  3FHQ A;  1AYM 2;  1OMI A;  2UUR A;  5D8A A;  2O8O A;  1RUC 1;  1W8U A;  2DVF A;  3MUZ 1;  3IZO A;  4TXW A;  1H2N A;  3TEX A;  1JYW A;  3UT0 A;  1CQ9 A;  2X5I C;  2VCC A;  3MIF A;  1DG6 A;  2PAK A;  1R09 2;  3IDB B;  5C6C A;  5L9V A;  4E9K A;  5LA1 A;  1VBA 1;  3IKW A;  2J1E A;  2WJS A;  3WX5 A;  2JG8 C;  4RQP B;  3IB3 A;  5AVP A;  5KR7 A;  4URT A;  2W1W A;  1BMV 2;  4Y1Z A;  4QGM A;  1LU1 A;  2AEN A;  1PGW 1;  2W47 A;  1UAI A;  5FZE A;  1CD3 G;  1DHK B;  1RUF 3;  3A22 A;  2BNM A;  3S57 A;  1C57 A;  1VBE 1;  3ACG A;  4OZO A;  4AI1 A;  3AKR A;  4XUP A;  4GAL A;  5FY5 A;  3KQ4 B;  5T5J A;  4BOW A;  4D6Q A;  1SLB A;  2WZR 2;  2W46 A;  3AB0 A;  1NAE A;  1X9T A;  3C7O A;  4FPY A;  4XMA A;  1CZT A;  1W04 A;  2X5I B;  2XBO 2;  2A70 A;  4NPM A;  5JDB A;  2VG9 A;  3N7J A;  3VZN A;  2A3X A;  3HT1 A;  3W9A A;  4MGY E;  1MS8 A;  2FCV A;  2QQJ A;  1XRU A;  1E57 A;  2C24 A;  1J1T A;  1JZ4 A;  3AKQ A;  4Q0S A;  5E8A A;  3LF7 A;  3NQH A;  3T4V A;  1COV 2;  3OGV A;  4AHY A;  3FC0 A;  4NR1 A;  2HWB 1;  3NNM A;  3D0S A;  3B69 A;  1WW7 A;  2CNA A;  2E7Q A;  4OI0 A;  1HRV 2;  4XZP A;  3POS A;  4MLO A;  3WW4 A;  3NW4 A;  2CY6 A;  1QIQ A;  4HL0 A;  2CGP A;  3CF6 E;  5F5A A;  3AL6 A;  4H3W A;  5I0S A;  4PQQ A;  3LIG A;  2E7T A;  2JDZ A;  1TNF A;  3MLK A;  1V00 A;  3QD6 A;  4X6Q B;  4BQ4 A;  3BU0 A;  2WS9 1;  3AC0 A;  5C5U A;  2VCM A;  4ZZ8 A;  4CVU A;  1N1T A;  1C3H A;  4DXT A;  2VPV A;  4Q0Q A;  4JHT A;  5A1A A;  1ASJ 2;  1HXS 2;  3KF5 A;  1O5L A;  2LRP A;  4CP1 A;  1UZZ A;  1XYO A;  1IS5 A;  4EE2 A;  1MR5 A;  1AZD A;  2FDK A;  1FX5 A;  2CGN A;  1FNY A;  1R1Z A;  1VBC 2;  4N43 B;  4QX1 A;  4NWV A;  5EP9 A;  4IEQ A;  1MS3 A;  5IK4 A;  1RUJ 1;  2EVX A;  4Q29 A;  2WO3 A;  1I9R A;  4YGC A;  1FOD 2;  3N7K A;  2B4K A;  4WM7 C;  1GYK A;  5EHD A;  2XR4 A;  3SIT A;  4CDX A;  1JBC A;  4GAZ A;  3IAP A;  5FLJ A;  1UZV A;  1AR7 3;  2CDP A;  2YB7 A;  4BHP A;  1K12 A;  2EIC A;  4MYE A;  4ORF A;  4PDW A;  5BNP B;  2JXA A;  4UWD A;  2PAM A;  2VUJ A;  3N9P A;  4XAE A;  2VOV A;  4CUB A;  4I0B A;  1S4C A;  2VEC A;  2ZMN A;  4W50 A;  5FBZ A;  3H8O A;  1AF9 A;  3THD A;  1W2U A;  1R64 A;  5EV7 A;  3AP4 A;  3VBH B;  1AR8 3;  3B9I A;  1XNC A;  4ZU7 A;  3OEB A;  5JPM B;  2VVD A;  2VZU A;  1ULO A;  3LDK A;  1DQ0 A;  3B93 A;  5J48 A;  3POJ A;  4BH9 A;  2VZ1 A;  4WM7 B;  4QQL A;  5FZF A;  5H9P A;  1PO1 2;  4OQ8 A;  5FZC A;  2O8Q A;  1OUX A;  1TEI A;  2W92 A;  4QWN A;  4WBB A;  2J1R A;  1RVF 2;  2DU1 A;  4ZXK A;  3Q8C A;  2JWP A;  1PO1 3;  4Y1U A;  2YBS A;  1VBB 2;  2HEY F;  3WW1 A;  4J1W A;  4BLI A;  2H0V A;  3WVJ A;  1SMV A;  1H2M A;  2QVS B;  3NV3 A;  5A3W A;  5C5T A;  2HWD 2;  1VBB 3;  2RS3 3;  2A1X A;  5DAB A;  2YGL A;  3K75 B;  2PHR A;  4MVT A;  5J7M A;  4PLN A;  3O1S A;  3BTA A;  3HMY A;  3NRU A;  4OMD A;  2HWD 3;  3B3Q E;  1UOB A;  1CPN A;  2C9K A;  1QWR A;  3MIG A;  4A2U A;  3LGR A;  4MV2 A;  1SCS A;  5C70 A;  5EJZ B;  1KFU L;  4R4X A;  4UAP A;  3VD3 A;  2W9X A;  4DY5 A;  5A3T A;  2J22 A;  3PTR B;  5DDJ 2;  3M3E A;  1LOA A;  2VXJ A;  2QCS B;  3DGT A;  3I3D A;  3SMH A;  4Q4V 1;  4D3W A;  3TBD A;  1W3X A;  2VQT A;  5FR3 A;  1XU1 A;  3MIE A;  5BPX A;  4A42 A;  4LHN A;  5T5L A;  5DDJ 3;  2IXJ A;  3L2Y A;  4DUX A;  1GQG A;  2YY1 A;  4P9G A;  5I0T A;  3T2Q A;  5FMO S;  2VUA A;  1AYN 3;  4XIK A;  3VD9 A;  5GLV A;  1LEN A;  4CEW C;  1NCQ C;  1NZC A;  5C9A C;  1BXH A;  2JE9 A;  4YW6 A;  4AAP A;  1HRI 2;  4WVZ A;  2PHX A;  5FZO A;  2WNU B;  2JE7 A;  4H55 A;  1RIR A;  3OD4 A;  5JXI A;  5FK8 A;  5ISL A;  3JXS A;  5LEK A;  3WHT A;  2RS1 2;  1O91 A;  5KXE A;  1W99 A;  2XHK A;  3VBS A;  1KJR A;  4QKN A;  5C3R A;  2KD7 A;  3N7M A;  4PLO A;  1HB3 A;  4LBQ D;  4NHX A;  3BI3 A;  1YIF A;  1GQH A;  3LCP A;  3OGG A;  4Q27 A;  1JZ6 A;  2ZCW A;  5ACA 3;  2CWS A;  2B45 X;  4UFH A;  5F2W A;  3PJY A;  3TEY A;  3I4I A;  2ZAH A;  1RMU 1;  1VE0 A;  2QBX A;  5BUV A;  4IW3 A;  5HV0 A;  4BB3 A;  3EO6 A;  2ZGQ A;  2BER A;  3M3C A;  5FYB A;  4IE5 A;  4O9E A;  2A75 A;  1D4M 3;  1MVQ A;  1RYY A;  5FOB B;  4GWN A;  3MW4 A;  4OI4 A;  3ZFF A;  3KGL A;  2D93 A;  4QPY A;  2FDJ A;  4Q0P A;  3VKF C;  4A6S A;  2VMF A;  4IEU A;  5GM0 A;  5CFD A;  4LOT A;  4BCU A;  1E5I A;  1J3P A;  4DZG A;  5KHK A;  2LS6 A;  4P14 A;  1QJU 3;  4I09 A;  1PX4 A;  2D6L X;  3PUH A;  4LOS A;  4MXV A;  1V0A A;  4CDU B;  2VBP A;  4YAR A;  2TUN A;  4HAN A;  1CX1 A;  3NMB A;  2BZD A;  1RUD 2;  4S2D A;  3PHM A;  4A7Y A;  2XWB B;  4IV3 A;  4DRV A;  3MF6 A;  3VDD B;  2E51 A;  1AR6 1;  4XMI A;  1DGW A;  3T08 A;  1PO2 3;  1NQJ A;  4Q4X 3;  2JIG A;  2VH9 A;  3MEP A;  1Q56 A;  3PVB B;  4DPN A;  3WQ1 A;  1ZZB A;  3LDR A;  3TNQ A;  1X50 A;  2R07 3;  3PDQ A;  4Y20 B;  1Y9Q A;  3E97 A;  5A7W A;  4R4Z A;  4YG3 A;  4IEZ A;  5I91 A;  2E32 A;  4CXY A;  1N47 A;  3KF3 A;  2Q8D A;  3H50 A;  1QDO A;  1XPW A;  2RR1 2;  1LOB A;  4LBJ A;  3OUI A;  2BVB A;  2DCT A;  2Q1Z B;  2QUO A;  4QM9 A;  2RM2 1;  1RUE 1;  2QQN A;  2WFF 3;  4GMP 3;  1H0B A;  2YC0 A;  4P9L A;  4BQ2 A;  5FDB A;  3D5O A;  2RR1 3;  1ZBA 2;  5GZF A;  1IKQ A;  4LHS A;  2VTX J;  1VMJ A;  4K40 A;  4PIY A;  1A34 A;  3GXU A;  1QJX 1;  2Z5W A;  4LMF A;  4Q4W 3;  3AM2 A;  1ZBA 3;  2JG9 C;  4AOC A;  4B4P A;  1OUS A;  4NN0 A;  4Y26 A;  2HWC 3;  1AUY A;  1NXD 1;  1R09 1;  4ITC A;  4YW1 A;  1KDK A;  2GP3 A;  1BEV 3;  4ZU5 A;  2W95 A;  2XJQ A;  4M3C B;  4I3G A;  4YGD A;  3AX4 A;  2LW8 A;  2P5B A;  4CU8 A;  1UU5 A;  2R06 2;  4GJY A;  4OQ9 A;  3LEG A;  3WP4 A;  2ZMK A;  1YI9 A;  1LOF A;  3B7M A;  3HBK A;  3LA2 A;  2Y8K A;  4P02 B;  4Y22 B;  2Y6G A;  2RJ2 A;  5FFO C;  4FFH A;  2R06 3;  5I0R A;  1TMF 2;  4EYU A;  5FYZ A;  2JG9 B;  4LBN A;  2OUJ A;  3WNP A;  2BNO A;  1G7Y A;  1ONA A;  3GGL A;  4XF9 A;  2A6V A;  4W6Y A;  1N1V A;  2ZJC A;  3PIJ A;  4XCA A;  3ZFG C;  2XWJ B;  4GWM A;  5LEJ A;  2OII A;  1VRB A;  3PU8 A;  2XLG A;  3POW A;  3BU7 A;  1MZ6 A;  4FCA A;  4X8P A;  2Q5T A;  1GP5 A;  4YVS A;  2XUM A;  4CXX A;  4XFI A;  2B5H A;  3RRD A;  4FFI A;  4XJZ A;  2GME A;  5ANQ A;  4GUL A;  4IEV A;  4C0B A;  5KBF A;  3T3Y A;  3I3B A;  4QM8 A;  1YJK A;  2E9Q A;  1F4H A;  4HOO A;  4WVM B;  4EQV A;  1QMJ A;  3WG3 A;  3HR9 A;  2D97 A;  2X09 A;  4XTM A;  2JDH A;  3C7H A;  4PCR A;  2JKX A;  5BNO A;  3ZFG B;  4AR2 A;  2HKX A;  2J1A A;  1GFF 2;  1UKR A;  1UMH A;  3UV9 A;  2PA7 A;  1GZC A;  1O4Z A;  2QQL A;  1DCS A;  5DAQ A;  2OVU A;  4CCM A;  3CJI B;  5FUI A;  1LKN A;  1W6O A;  1ULG A;  2LAL A;  2ZGR A;  4JKM A;  4AED A;  5FPA A;  2VBD A;  5F5Q A;  1QOS A;  3RWN A;  1IG3 A;  1AR9 3;  2VNG A;  2A6Y A;  4M4P A;  4MGZ E;  4XIO A;  3WNL A;  4C91 A;  5JI7 A;  1Q43 A;  5F7U A;  2F6B A;  3AP6 A;  5IYY A;  1W6Q B;  2MEV 3;  4K8F A;  3WF4 A;  4GH4 A;  3HIF A;  4XEZ A;  5FYY A;  5DUW A;  2C1F A;  1XNK A;  1HN1 A;  1BYH A;  2IUW A;  1QJY 3;  2W52 A;  1EUU A;  2EID A;  3KV6 A;  3LD8 A;  3GHM A;  5FYV A;  5IK8 A;  4JAA A;  1JYC A;  2YGM A;  1HJG A;  3USU B;  3LOB A;  2PEL A;  5F6K A;  5C3Q A;  2VVE A;  2WLP A;  1W8F A;  3ZMO A;  5D8A B;  4FP2 A;  5A1F A;  3O12 A;  2X53 S;  5FO9 B;  4IEW A;  4V1P A;  2P1B A;  1OKQ A;  1HKD A;  3LPG A;  5CIS A;  4IV1 A;  5FXV A;  1XXN A;  5FY0 A;  5DUX A;  3BCW A;  1QQP 1;  1XOY A;  4DEV A;  2GNT A;  3G6J B;  2E53 A;  2WYS A;  2K46 A;  4RFR B;  3MF9 A;  2PLV 3;  4NJ4 A;  5EJ3 A;  4CCC A;  5CBL A;  1HB2 A;  2ZEW A;  5IHR A;  1RUC 2;  4NVP A;  3UKN A;  1W9S A;  3VBR A;  3O1M A;  2WL1 A;  1YFX A;  2FQP A;  1T6B X;  1JH5 A;  1KQR A;  4N53 A; 
#chains in the Genus database with same CATH homology
 1JOB A;  1ZRI A;  1F35 A;  1JOD A;  1JYT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...