1JODA

Crystal structure of murine olfactory marker protein in spacegroup p43212
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
160
structure length
160
Chain Sequence
DGPQKQQLEMPLVLDQDLTQQMRLRVESLKQRGEKKQDGEKLIRPAESVYRLDFIQQQKLQFDHWNVVLDKPGKVTITGTSQNWTPDLTNLMTRQLLDPAAIFWRKEDSDAMDWNEADALEFGERLSDLAKIRKVMYFLITFGEGVEPANLKASVVFNQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the olfactory marker protein at 2.3 A resolution.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
molecule keywords Olfactory Marker Protein
total genus 29
structure length 160
sequence length 160
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06554 Olfactory_mark Olfactory marker protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.390 Mainly Beta Sandwich Jelly Rolls Olfactory marker 1jodA00
1JODA 1F35A 1JOBA 1JYTA 1ZRIA
chains in the Genus database with same CATH superfamily
1KS4A 3AFGA 3Q8CA 4YM0A 3VBHA 4IE6A 3POYA 2QTWB 3ZM8A 4BHPA 2JD4A 1W6PA 3ZFEA 4CU7A 3UK9A 1W8TA 1SG3A 4YM3A 5ABJC 4R4ZA 3WF3A 3KS7A 3LPGA 1YFUA 2NM1A 4PF5A 1AR62 5E16A 2D6NA 2ZHNA 4QHZA 2WZR3 3AKSA 2QZ2A 5FZGA 1AX1A 1I5ZA 1PO13 3EJKA 1AR61 2GDFA 2ADEA 3EXUA 4XAEA 2ZAAA 2GNDA 5I0UA 3SH5A 4EWAA 4Q0SA 5FYBA 3IWZA 4XQDA 5FYTA 4CP2A 1UX7A 3ZYBA 4ASKA 3LCPA 1UL9A 4K7JA 4XF9A 2OPKA 1J3QA 1T2XA 2KD7A 1VJ2A 4FQ4A 3MUY1 1K3IA 3AZWA 1NA1B 3M3QA 4JV4A 2YHJA 5FY5A 1CPMA 1L7LA 2A71A 5F39A 1SEFA 1UOJA 4AQ6A 3VDDC 1S0IA 2WO2A 2LS6A 4UWDA 2PHUA 1DLCA 2C0ZA 1HB4A 2PYTA 1X50A 1YJLA 1Y9GA 2XQRA 3MLKA 1QJX3 4MOAA 3OBTA 1RUJ2 2LW8A 5FYVA 1KDKA 5BNPA 3GHMA 2YC4A 4EN6B 2HEVF 3EBRA 5BNQA 1CIYA 1RUE1 1JZ8A 1L7RA 1SLIA 3T30A 1IS3A 1QQP2 4QXCA 1WZXA 3ILFA 2ZZQA 3TEXA 3OOXA 2RG4A 1RB8G 2HWD2 4L11A 2XOMA 4QXHA 1S55A 3AKPA 1WW5A 2BQPA 1LESA 3ITQA 1QJY2 4FCAA 1QXPA 1BEV3 1D4M2 1UPIA 2FBEA 3JB8A 3MDPA 4N7IA 4Y1ZA 2IWGB 2OPWA 5F8PA 5FK8A 5LBFA 1ONAA 5KC6A 1XBFA 5J36A 1W90A 4HKOA 3LFMA 2KR2A 3ST7A 3SKVA 2XDVA 1W9WA 4NAMA 1MS4A 1N1SA 4LHNA 3ZSKA 4L0PA 4AFDA 2DU0A 3T08A 5CBLA 1YIFA 4Q1RA 5DDJ3 2QQLA 4XCAA 4UBGA 2XBO3 3JBG2 4UFJA 5F6KA 3ZXEA 1G9DA 3HOBA 2JECA 1CZTA 1EAH2 1RTVA 3CLPA 3H1MA 4I0BA 2CDPA 4RN5A 3ZXJA 1BEV1 4AVVA 4LA2A 4NHMA 3R4UA 2E63A 2VUJA 3ACHA 2F6BA 4LKFA 4QHOA 2FDIA 2VZTA 5FKBA 2TBVA 3SH3A 2WZPP 4CDXB 2GMMA 4D7TA 5FK7A 2JE9A 3ZVXA 4YPJA 4QKBA 1YFXA 3MPPG 4COZA 1W2UA 1PO22 3UESA 3FLTA 4UW6A 4OCTA 2Q8EA 3J7MA 1QJU3 4PBPA 5FKCA 3VZLA 2GC3A 4OUSA 1NXD1 4LKEA 2VUCA 3IAPA 3ZXFA 2IVIB 4XXPA 3PIGA 4H3WA 2GNTA 2XJTA 5FO8B 2DCTA 3MLJA 4LA3A 1ZBA1 3B5LB 5A1AA 5FZ9A 5IFPA 1YQ2A 4WVZA 1DQ6A 1G8WA 4Q8KA 5A7WA 5L9VA 5IWFA 1UD1A 3I2IA 1AZDA 4OQ8A 1TQ5A 5L7OA 4Q4Y2 3D82A 3IDEA 4KGGA 1DGLA 4R52A 2WUHA 1ND2A 3RMYA 1F4AA 1UZYA 1QIQA 1G9FA 1GYKA 2WC2A 3U10A 4C1XA 4IV1A 4JDMA 1GZ9A 1UAIA 4QKNA 2VH9A 4I2OA 4XBLA 1STMA 1ZRIA 2WS93 4W8JA 2VCCA 1BK0A 1UX6A 2JE7A 3SEEA 1GR3A 2WT0A 2YFUA 5BNPB 1YXWA 1RVF3 3U75A 4RFRB 4AOCA 4JVAA 2RDNA 4PDWA 4URTA 3VDDB 4R9CA 2XUEA 2QZ3A 4FVVA 1C57A 2EXHA 2KXLA 1WMXA 2PLV3 3VL9A 4AHYA 3ZO0B 3VB9A 4Z2WA 4R9BA 3ZKYA 1LODA 1R1ZA 3PVEA 1SQ4A 1ULDA 2A6XA 3HQUA 2YBKA 2YPJA 4QDQA 4Y3OA 2BTVC 5HXMA 4RR3B 5K7PA 2D97A 3TB0A 1AR82 2Y6LA 5LA2A 3O1OA 3N36A 1V70A 3PU3A 2VMHA 1Q8QA 1HQWA 2GZWA 4LO8A 2HLEA 1LHNA 4XCBA 1YJKA 2VXRA 3OGVA 4AF9A 3RMXA 5KWRA 1C8M1 3THPA 4FPEA 4DUVA 1JUHA 4O61A 3LA3A 2ZABA 4Y22B 2E26A 5LK7B 1X82A 2VJXA 1BQPA 2L9LA 1JTZX 3J26N 4NROA 1QOSA 2D6PA 1OQEA 5E1RA 4QKFA 4BIFA 3E1F1 2WQ8A 2O8QA 3T09A 2E53A 1QJY1 3M3CA 2V09A 4WM8B 3Q9OA 4O7XA 2HWC3 2ZPXA 2DCKA 2V5YA 1ALYA 3SC7X 5FO9B 2BRTA 4ZZ5A 2CAVA 1RUG3 5J98B 3RWKX 4ONUA 1CAXB 3CBNA 4R9DA 5KHGA 1COV2 4A7YA 2Q8OA 4CDWA 1AXKA 3CMGA 2WFF2 1B35C 1SPPB 2O8OA 2XL9A 3DV8A 1MZFA 5EPAA 1UIKA 3LDBA 1R64A 5BNPC 3I2FA 1KFUL 1PX4A 2HWE3 1E5RA 2ARCA 2W3JA 3OPZA 4GAZA 5L9RA 1ZZ9A 2D40A 1HN1A 3O1PA 2Y6JA 4PIYA 4S2FA 2R043 2A6ZA 1O5LA 4HETA 4QHBA 1MZ5A 1UOGA 5EJZB 1N1YA 2J1RA 2VVFA 3J7LA 1XXNA 3SKJE 5LWBA 2WNUA 4CU9A 1GSLA 2PMWB 4CU6A 1VBC2 2XJSA 2OX0A 4IEVA 1J59A 3HPNA 2P3IA 5A7WB 3O7OA 5KXCA 2W92A 3AK0A 4D6QA 2VZOA 4IEXA 4YVWB 1UWWA 4M3CA 5JR2A 2WRAA 2D3RA 4Y24A 1OMIA 3WINE 3BKZA 1GBGA 3IDAA 1R092 5JPNB 5FP8A 3O1UA 1ULOA 4OI0A 2FCUA 1RMU2 3PVBB 3GM8A 1TVGA 2BUKA 4RGGA 4UAPA 4BYYA 5F5IA 4YZ5A 2GU9A 1RUG1 2ZEYA 5GJ6A 2YG0A 1GICA 1W6MA 2VMCA 2VPVA 3RSJA 1WCUA 2MPFA 3BOWA 5A7PA 5T55A 5GLWA 3F95A 4LJHA 2GSYA 4P9XA 4D8MA 3BI3A 4AVAA 4I01A 5L9BA 4Q4W3 1DGWX 3U37A 3ROUA 2W39A 2ZACA 4R8HA 5DUVA 1OSGA 1MQTB 1NY72 1PZ9A 4OUMA 3T1LA 1PNFA 3WW4A 1CR7A 3T1MA 5C6CA 1EP0A 3HT1A 3RYKA 2EAAA 2ZZJA 1OLME 1PVC1 4TLFA 3J7HA 2RM22 3FFQA 3AC0A 1GNHA 2V73A 4Y5Z0 1CAVA 1YQ8A 4YZ4A 5HXVA 1O3QA 1DIWA 2VNRA 4AQSA 1OA3A 3VGIA 4Q4V2 2XG3A 4IE0A 2XXZA 4MGTA 4AFBA 1FV2A 1H1IA 1S0GA 1HX6A 5DUXA 5GZDA 3C2UA 4QPIA 4N43A 1FMD2 1XRUA 2B45X 1Y3TA 1X9TA 2PQQA 3MV01 5A3OA 4YVSC 2A6YA 1WCKA 2PAMA 3ALQA 3THTA 2WN3A 1OFNA 3WW2A 5E6HA 3VD5A 2LALA 2WYSA 4YW6A 5F9TA 2DVFA 4A7KA 3IPVA 4FAHA 1UNBA 4HSJA 5TSWA 3ZSEA 3ATGA 4SBVA 5C3QA 5IFTA 1H2MA 4CA9A 1SLLA 1G9AA 4CXXA 1BKZA 2G9FA 4QX5A 5JLVA 2NN8A 3PL0A 2WIIB 3K3OA 2ZA9A 2JEMA 2P1BA 4NPRA 2F17A 4PLNA 2VL4A 2DV9A 4B3NA 2VBPA 3O0XA 1NA1A 3BB6A 3IMMA 4PCRA 4RHV3 4UYBA 4XFIA 5FXWA 3GYDA 4RGAA 3S7IA 1A78A 1FOD3 1PM7A 4PQ9A 4YRDA 1PMJX 2BW8A 2EIDA 4TYSA 1UKRA 4K40A 4PLMA 4PQQA 4Q29A 5CKQA 3PUIA 5A3UA 1KJRA 2JG9C 4YW7A 3TN92 3DGTA 5CFDB 1XNKA 2C5DA 3Q8FA 3POBA 2C9AA 3U11A 3S5AA 2JDKA 2RMU2 3IKWA 3NNGA 2OVUA 4QD2A 5F3IA 2B9VA 3ECQA 1K12A 3KB5A 3VZMA 4PIXA 3ZFEB 1OKOA 4B4QA 1W6NB 3AP7A 3VBHB 1WCSA 5JSPA 3N4MA 1UYYA 4JQRA 4Y4RA 5FZOA 1AYN2 4LBQB 1G86A 4CPBD 5IAXA 1PVC2 1AXYA 4LBMA 2VQTA 4H7MA 4NRMA 5FY0A 3CL1A 5CG8A 3D5OA 1D2QA 1SBEA 1YEWA 4WZFA 5I8YA 1F4HA 1QF3A 3MEPA 3M7AA 4S2DA 1RUD1 1YQ6A 4ZXKA 2P2KA 1AHSA 1LULA 1JS9A 1LGCA 4UW3A 1TME1 4D6SA 2BPA2 3ZDVA 2FDKA 1QU0A 3OEAA 1U5ZA 1UYPA 4K1YA 4LBJA 4QX3A 5ISLA 3GCWA 5AFEA 1AYN1 2DUPA 4KI5M 4M01A 3OGSA 2BNMA 4RL7A 4A7ZA 3WW1A 3WF2A 4AI8A 2OZJA 1E5IA 1RUH3 1S0BA 3IB3A 4YW5A 4RR3C 3WQ0A 4OZXA 5LA9A 1WLWA 1TNRA 3MBWA 1XB9A 3ZSJA 4W6YA 2CL2A 1JOPA 3VBUB 1CAVB 1J3PA 2PLV1 3WD5A 3UV9A 1N1VA 4EZ4A 1O59A 4AFCA 4LMFA 1NAEA 1V0AA 4YGDA 1RMU1 2OKXA 1BBT2 2AACA 1URXA 3PJYA 1BZWA 4IDZA 1TZOA 1C1FA 4IEPA 4NIIA 4XFCA 4TSVA 1GZWA 3V56A 4DOUA 3URFA 1Y9QA 2AYHA 4I3PA 3KSCA 5D2AA 1CAUB 3VN4A 5GZCA 1LEDA 1EV13 1AL21 2J1EA 4AAPA 5FJKA 2WFPA 3LKJA 2RR12 5FZFA 4CVUA 1BBT1 5IVBA 1PZ8A 1WUVA 2D6OX 3N3HA 4Q4V3 4OHZA 5FZEA 3VBFC 3WUDA 3N9QA 3OEBA 4GMP0 2FDHA 1S2EA 1UIJA 5M0TA 1QOTA 1JYCA 4FPGA 3QH6A 4CP1A 2WFF1 4NPLA 4LUKA 4P9YA 2JJ6A 1H8TB 1VPHA 5JIAA 5C71A 3JUUA 2P6CA 1LECA 2VTFA 1ND2C 3AKTA 3NV1A 5FLHA 4FTSA 4C1WA 3O1VA 4JGZB 3NAPC 2GN7A 2CWSA 2ZEZA 4Y1VA 4FOVA 4Q4V1 3VDBA 4NVPA 3KMHA 1POV0 1SHWB 3VBHC 1VBA2 3NV2A 1AR91 3POIA 2Y34A 4B7KA 2B9UA 2VZVA 5BUVA 2RM21 2UYAA 2MNGA 1OT5A 1K5JA 3GZTB 5FYSA 1ZA4A 3WW3A 1H2KA 3ZR6A 1NZIA 1VBB3 1GU3A 3VLBB 4AR2A 4B8EA 3KHCA 2ZX2A 1W3VA 4Q27A 1EPWA 3TOJA 1XE7A 2EXIA 5C9AA 4NR1A 5C33A 1O8SA 2FQPA 1ZVFA 4U36A 2W91A 1MS0A 1PVXA 1UY1A 2ZBJA 4N90A 3TYJA 4CDQA 1MS5A 1GZTA 2ZMNA 3AXDA 1HB1A 3M3OA 2HYKA 1NG0A 3B93A 3RZKA 3BTAA 4YSFA 4LHSA 1DBNA 1H8VA 4XW3A 3LB9A 5GZGA 5F2SA 1EY2A 2QNKA 1W6NA 1U5YA 4R9AA 4BK5A 4F7ZA 4LPLA 4IEWA 2VNOA 2VQAA 3OUHA 1QDCA 5FYCA 5T5OA 5JOXA 2RS33 3ES1A 1XSQA 4MGKE 2AC1A 4HT1T 3VZNA 2DF7A 4CDQC 3USUB 4CU8A 4W6WA 1PIV2 1I5PA 3FBMA 2X05A 2ZGQA 2VCBA 2CAUA 4MGSA 1SLBA 1UMIA 3H1WA 3HD8B 5FRAA 3KCCA 1MVEA 2ATFA 1C8M3 4YLZA 3WDWA 1XYPA 3QLQA 1E5HA 4B4RA 1GZWB 3T2PA 3CKHA 5FY9A 3R4SA 1A6CA 1YQCA 2E7AA 3P1IA 3ZPOA 2XJUA 1S4CA 2P3JA 4MVTA 4RGKA 4CCOA 1VIWB 4YW1A 4DEQA 4XDPA 1OC1A 4Q4W1 3THCA 1G9CA 4O9EA 5J37A 3AJZA 1O4YA 5FY7A 5F5AA 4HPKA 2FDGA 2AUYA 1RUE3 5FP3A 3ZFFB 2BGCA 1WBLA 4XYXA 4J6GA 3UT0A 1QH7A 3LOIA 3POFA 1K45A 4CEWC 3WVJA 4KU7A 3T4HB 5H9RA 3ZXDA 1UW8A 1NLRA 2XR4A 4OZOA 1V9U1 1RUF1 4MHRA 3WP4A 3X29B 4JHZA 3AL6A 3D0JA 4WM7A 2VZRA 1S0JA 2AZ5A 4YZ3A 3J8F1 2ZEWA 2ZGPA 4OHWA 5B4NA 3NAPB 2C24A 4B1LA 1DF0A 4COYA 2MEV3 2MEV2 3P3PA 5CIRA 2Y6GA 4D94A 5IHRA 3RQ0A 2C9KA 3LFIA 2P4EA 4EROA 5FOJB 4Q2FA 1PO21 5T3NA 1JOJA 1REEA 1PM4A 4LUMA 3OB8A 4CDXC 3KQ4B 4FOYA 1LENA 4N53A 3V64A 1V6IA 3AP6A 3K46A 1S0FA 4IE4A 4NWWA 3WDTA 1AR71 1IQDC 4QPIC 2CDOA 1RUE2 2BNNA 3OY8B 4D3WA 1KD7A 2D43A 2A75A 2Q1ZB 4META 4AL9A 4DNYA 3JD73 2ZX0A 5C8CC 1W2NA 5EIYB 4L8QA 4DRRA 4AHZA 1FAYA 4A3XA 5FZKA 4OI2A 4Q0UA 2VZUA 2YMZA 4MH0E 5AFBA 4GB31 5CFDA 1VALA 5EHDA 3QBQA 4FPCA 4SLIA 5GZFA 2ZGRA 4LKDA 3GBFA 1QY4A 4YM2A 4WBBA 4GJYA 2JIGA 2IFRA 3ZN6A 1CVNA 1XSRA 5J3UA 1CPNA 4COWA 3B00A 5DMYA 5JDBA 2Y6FA 2IXJA 2D7FA 1EPZA 3CZUA 2Y6HA 4KG8A 4YGCA 4KWJA 4L99A 2WR9A 3AP4A 2VU9A 4LE4A 4NHYA 4L92A 1F15A 3Q8EA 4AE2A 2QFEA 1F31A 4FXGB 4CDUA 2J7MA 4W50A 1DFQA 2AREA 2G9GA 4N9IA 4AHWA 2EF6A 1BXHA 4GJZA 1WCQA 4IV3C 5FPAA 1POV3 4Q8LA 3R6SA 5FZHA 5ABJB 3UGHA 4QX2A 5DDJ2 5FOBB 4U2AA 1RUF3 2PAEA 2X5IB 4BQ1A 2UY8A 2QBXA 2W95A 4LO6B 1LOFA 3DYMA 2JG9A 3M2MA 4Z82A 4IERA 5BXXA 4MZUA 1TEIA 2QKDA 3ZKUA 3L2HA 2RJLA 4LK7A 5JMCA 2YC0A 1IOAA 2HKXA 4I0WB 1BEV2 1D4M3 3E5XA 5AVPA 1G7YA 3H50A 3SCHA 4A6OA 3LWCA 4M0HA 2BBAA 1LRHA 1QQP3 3WP5A 1JHNA 2VVDA 2A7AA 5FYYA 1WKYA 5FP9A 3UGGA 3ZN6B 4CEYA 1QJFA 2B4KA 3WF0A 4L97A 4ZU7A 1RUNA 2PAKA 3I97A 2D6LX 2Q1MA 3I49A 2DCJA 3UGFA 4YVWC 4QX7A 3S6PA 2R061 4XQ4A 2WZR1 3N7JA 1VBD2 2VNGA 4IW3A 3RJ2X 1XU2A 3QH7A 1RITA 1ULPA 4MO3M 2P6HA 5FWJA 2R062 5CB7A 1ULEA 4BLJA 1V6JA 2D98A 5FYHA 2BV4A 1OPMA 4QGNA 2H6CA 3HNYM 4FFFA 4B1MA 3E97A 1VRH1 4RS5A 5EXOA 1C1LA 5FZCA 4DY3A 3C7EA 1MS9A 2W46A 5CVRA 1OOPA 3KD4A 3VDDA 5C70A 5LRSA 1MR5A 5DAWA 2Y60A 3EMRA 1MQTC 3I2GA 2YYOA 4BIOA 2DDUA 5BYNA 1VRH2 3NNFA 5IW0A 3A22A 5FPUA 3OGJA 1VB4A 1LNSA 2YFZA 3M3IA 5FFOC 1LU2A 5K8SA 4M00A 3ZFGB 4QX0A 3KGZA 1XJAA 5I8TA 5DG1A 3WLUA 4GIQA 1FYUA 4E4DX 3I2JA 1YQ5A 5CKNA 1NQJA 2VVEA 4Y5SA 5FZLA 4RHV2 3TEZA 4QX1A 1LR5A 2JICA 2VM9A 1VMHA 3HN3A 2UYBA 1LCLA 2HJIA 1O4TA 1VBD3 1J58A 1HXS2 3H8RA 1HV1A 1E5SA 3VKMA 4JCKA 2Y38A 3H8OA 4GD4A 4UBHA 2B8MA 2VTXA 4FAGA 1ULGA 1UU5A 4ZPIA 5A3LA 3KV5A 2BBVA 1PK6B 4ZZ8A 1IG0A 4Q26A 4QMAA 5FXZA 1UMHA 3FLPA 5A6ZA 1W9TA 1JZ4A 1BYHA 3T0DA 3MZHA 1Y7BA 5T5LA 4BE3A 4OLLA 1O3SA 2Y64A 3ES4A 1GOGA 3DPRB 4AGRA 1VBA3 2VUAA 4JTNA 5GM0A 1DQ4A 4Q4Y1 4G9SB 1JYIA 4MYEA 2LRPA 2VOWA 3AB0A 1S0EA 2VECA 4ORFA 5CYYA 2RJ2A 1DQ2A 3WCRA 5CFCB 5JSRA 1C8NA 2XHKA 3KT1A 3T0AA 4ITCA 3T0BA 3MYXA 4XUPA 1BVP1 2BNOA 2J1VA 3LE0A 1CAWA 4DEVA 5FZBA 4FFGA 1ZX5A 3OYWA 1WGPA 2XKPA 3LEIA 3VHNA 4XHXA 1MEC1 1JHJA 4FT8A 4DUWA 2QJVA 2QQNA 3RWNA 1AJKA 2RM23 1CWPA 3LZZA 4AVCA 1IS6A 1AR93 2YBSA 3JU9A 2HWE1 1YLLA 4K3UA 4EN0A 5C5TA 2NP0A 1D0HA 2E6VA 3KGLA 4PI0A 4D0QA 2B7YA 1ND3C 1DGWA 3MIBA 1NLQA 1OURA 1Z7S2 3OGGA 2QQUA 4LK6A 4HN1A 5IVYA 5FDBA 2BERA 4HKLA 4Y20A 1QEXA 2E33A 3B94A 3HN1A 4XTMA 4RSUA 3ZYPA 2X5IA 2QQWA 1L3JA 3HBZA 4HBNA 2VZQA 4CDWC 4BH9A 5IAVA 1KJLA 3PMSA 3I7DA 1PGL1 2PQSA 3GHNA 2DVDA 5DQ0A 3NV3A 3PTYA 4LEJA 5A7QA 4FO9A 3SCGA 3U14A 2VZSA 4AI2A 4XDQA 3KQRA 1UZVA 4IGQA 4HANA 2PHRA 3WNOA 4XUTA 1LOFC 1R093 2ADDA 1BMV1 4CDUB 1AJOA 4JGZC 5L73A 3KVBA 5L7OB 4XJ9A 2UWAA 2F4LA 4ASMB 1YCIA 3LPFA 3P5BA 3I3MA 3LAGA 3RYRA 4BPZA 2EALA 4QPWA 1XQNA 2HWD1 2WNOA 4P9GA 5FZ0A 5JXHA 1LEMA 1YI7A 5GZEA 2EVXA 4JZRA 1TMF2 2JKBA 3AVRA 3TWIA 5C4WA 1EV12 5JZGB 3W59A 2W68A 3UKTA 4RS5C 1IPSA 2I74A 1CZVA 3NVCA 4P5HA 5DZFA 4YW3A 2R071 5F3GA 4GB33 1GWKA 4WV8A 3H8UA 3PIJA 4B29A 1VRH3 1ZREA 1RXGA 1YUDA 1HKDA 1W0NA 3I2KA 4XFGA 5F3CA 3SH4A 1JZ6A 2ZEXA 1SDDB 1AR92 1LB2A 3THDA 3MIHA 1GNYA 1W8ZA 1NA1C 5JVVA 1RYYA 1COV3 4JAAA 2ES3A 2Q0AA 5FR3A 4Q4X3 4ZU4A 3ZIWA 5K9YA 4XBNA 1UZWA 1AYN3 2WZEA 2B42B 2WS91 2R063 3WDUA 3L2YA 2TNFA 2BP6A 2J1SA 2YGMA 1W03A 3S7EA 1DGRN 2ZAHA 3JXSA 4BA6A 2ZJCA 3CHXA 1DP0A 4RYDA 2BZDA 2W1UA 3PU8A 3UJQA 2OS2A 2E32A 4K6BA 5CFCC 2VBDA 2V4VA 3WR0A 1UY4A 1NCRA 4MSVA 4F8AA 1PO11 3K4AA 3NNJA 4XTPA 3O0WA 1EUUA 3VBRA 3WNNA 3FWEA 4J1WA 1UY0A 3TNPB 2WINB 1IS4A 2A6VA 1QDOA 4KL1A 1JOBA 1Q3EA 3KF5A 3S30A 3AJYA 2DVGA 1W05A 3ZFFA 4AQTA 4LORA 3K2OA 4Q4X2 2DBNA 3JB4C 5FZ8A 2NZ9A 3IN9A 4XJAA 5JZGC 1SFNA 4Z8BA 1WMFA 3UNPA 2QDRA 3FHQA 1UOFA 4FI9A 1N3PA 1UYXA 3CJIB 2Y6KA 1LHWA 5A70A 5ACA2 4V1PA 2R042 4XMIA 5FZ1A 2A1XA 4LQRA 4XPVA 4EE2A 2H0VA 1IGOA 2RMU3 3NKGA 3VBSB 5ANQA 3U1XA 3ZYIB 1ENSA 5DDJ1 3LA2A 2K9ZA 4NE9A 3NNLA 4QM9A 4LBQA 2GC0A 1FNZA 3MI8A 5EYXA 1OQ1A 3W5NA 1U0AA 4IETA 4QQ2A 5FMDA 1J3RA 4XIOA 3D8CA 1O6UA 4ZS2A 1X7NA 2ETEA 2OW4A 4C0BA 1K5MA 4Y22A 2IXLA 5JOWA 3S0MA 5GLUA 1KFXL 5IK8A 5BNNA 1X33A 5A32A 4TTGA 1Q8VA 1M4WA 4JGYA 5FTTC 4GH4A 1ENQA 2ZTNA 5JZGA 1C8M2 3BOPA 5K0UC 1H2NA 2A6WA 1V6OA 3N9LA 3OBAA 5KR7A 5JXGA 3WDXA 4ARXA 1IQAA 3ACIA 2ZCWA 2W1SA 3OUIA 3K77A 2NYYA 3UJOA 3FMGA 1XE0A 2ENRA 1ASJ1 3EO6A 5FY1A 5H9SA 2AR6A 1RUC1 5BNNC 3D6EA 3N7KA 5C5UA 1O3TA 1UN1A 1VMJA 5FREA 5LB6A 4DB5A 1Z78A 1SFYA 4LIUA 4MX3A 1W2TA 1TG7A 4AGGA 1B35A 2QQKA 4CE8A 1GANA 5E8AA 3ELNA 4PJYA 2QQPA 5IVJA 2VNVA 2XJRA 4BLIA 3ZXAC 3HJRA 1ACCA 4YYOA 5AC91 1SMVA 3H7JA 3AFKA 3AYCA 3ZYHA 3QCWA 4CUAA 4OVEA 1AYM2 1AYM3 1ASJ2 3CNAA 3PHMA 2WL1A 4LLOA 2XMLA 3PNAA 4AW7A 2WSVA 1GNZA 4C91A 1J83A 5I0SA 3KWVA 2LROA 4IV1C 2ZMKA 1CJPA 5FUIA 3TEYA 1VBB2 2UWCA 2WSUA 1CD3G 2A73B 1SLTA 5E89A 5DUWA 1AXZA 1KDMA 5KHHA 2OA2A 3DKWA 3Q8AA 3H8XA 5GLVA 4E9KA 3CZJA 4UFHA 5DAXA 3I3BA 3WUCA 2WAAA 5IK5A 4QXKA 1WCDJ 2JE8A 2VMFA 4MXVA 1FOD1 4MGZE 4JTOA 3E6CC 2F4PA 3NW4A 1RUG2 4HK8A 4YG0A 3ZN5A 1AX2A 2JG8C 4OFGA 1ZBA3 2JDPA 2E51A 1RUF2 2PHFA 4BQXA 4JRAA 4IGOA 1YNAA 5GKAC 1EUTA 3VBFA 2YY1A 5BY5A 1G9BA 4HKWA 1UY3A 4P00B 4AAXA 3T2QA 2JWPA 5F32A 5F5QA 2HWF2 1LHOA 3QOPA 1WA6X 4HG6B 3IZOA 2XUMA 3CDZB 3ENRA 3MO4A 1Q8OA 4NMIA 1Y9MA 4PF1A 4YGEA 1RUOA 3LSDA 4RD7A 2BWAA 2RR11 1FATA 1W3XA 2PHXA 2QE3A 3BVCA 5GALA 4AEJA 2ORXA 4EV0A 5A33B 3NL1A 3WF4A 3WNMA 2VZ1A 3POWA 5JIUA 1EAH3 1QHDA 5A3TA 3LEKA 4WM7B 4BU2A 5L7OC 5ACA3 3WSOA 1P8JA 1QJX1 2XL7A 4AHXA 1OHFA 3AZYA 2OUHA 3WQ1A 4CXYA 4X8NA 2FMYA 5LATA 1FPN1 2EXKA 2J22A 3HNMA 2WQ4A 4XF4A 2YU2A 4AEDA 3I2DA 3VZKA 3U4SA 4JKMA 4BJ0A 4OI4A 2H0BA 1VR3A 4ZU5A 1SPPA 2Q8CA 3N9PA 3AXEA 4XQWA 1UZZA 1JYVA 4N8MA 4QM8A 1W6QB 5K0UA 3WNXA 5SV8A 1JYNA 3U4XA 2XJQA 3K4ZA 2WS92 3RZHA 3NJZA 3GBWA 4OULA 1KS5A 4AVSA 2Z4FA 2BGOA 3A4UA 1CQ9A 4QX8A 2XHNA 3S5QA 4WM8A 3ZDSA 2NMOA 3LSEA 4XC9A 1ZZ8A 4PI2A 1VE0A 4URAA 3ZSLA 1QJU1 1OUXA 2E31A 2CTVA 4GH4B 4BISA 3RJRA 3H3UA 4LXLA 2UURA 4IE7A 2J1AA 3AMQA 1YI9A 3BCWA 5KHIA 3SLIA 1FNYA 2W52A 2ARBA 4QPGB 4AQ2A 1OF4A 1VAKA 3VHRA 1H9WA 1N47A 1UKGA 4ISRA 2UY9A 4GKXA 2QQIA 3VDCA 3NSTA 2PLV2 1DGRA 3ZYJB 1PO23 1WMEA 4LO4B 3PUAA 1W6PB 1WW4A 3NJVA 4I0AA 2EIGA 4FQZA 5JOZA 1C4RA 2R1DA 1BMV2 2WA3A 3FN9A 4CDQB 5FMCA 3ZFEC 5K0UB 2AGSA 4UW5A 4COUA 3OD0A 4NN0A 4KH9A 3RGBA 5HI0A 2EXJA 4JDOA 4Q4Y3 2C6SA 1G6NA 2R49A 2R32A 5T5PA 2YROA 4GQ7A 3RZJA 5ERLA 3I2HA 4W65A 3J4UH 2D6KA 1JZ3A 1PZ7A 4YZ2A 2J1TA 2QQVA 1OXCA 1UOBA 3RZMA 4NIDA 3WOGA 1NCRC 2WNVB 4FTEA 3DXTA 2IUWA 4QT6A 4QPIB 2YUEA 1H1MA 3A0NA 1ZZCA 2DBIA 2EAKA 4JGZA 5CNAA 2BJSA 1QJU2 3IAQA 3K3NA 5I0DA 5FLJA 4YZ1A 4HK9A 3FX3A 5LBCA 1NZCA 2JX9A 4F83A 4DO0A 3FUOA 2XBO1 1NOVA 3C3VA 4KBBA 4Q0PA 1QJZA 2XWBB 2WT1A 3RI9A 5C3PA 2PTMA 4HMZA 1UXXX 4AVBA 3WXPA 5F5CA 4ATFA 3HVDA 4LR4A 3S57A 1R091 4DFSA 5LA0A 1QOOA 1CAWB 1DCSA 3OJBA 2O0OA 1MQTA 1V6MA 5I0TA 4A41A 1XYNA 2XVKA 3JZVA 4MG2A 3VBFB 1YC61 2JXAA 3DXUA 2QQMA 2SBAA 3FC0A 3O1MA 2XJVA 1A3KA 4ES9A 2BDRA 4A2UA 4CDXA 3RNSA 4KGQA 3ZYFA 1EAH1 5FCCA 5FQ0B 3FHAA 1H1AA 1WD3A 1A34A 5IYYA 4CCCA 3WQBA 1XNAA 4XMAA 1FX5A 3B7MA 3N9NA 4FBFA 1VBC3 1DYKA 5I8SA 3I3EA 4GKYA 4EN7B 4XAAA 4RFT0 5I0RA 1W6OA 5FY4A 3EQEA 1X36A 1GP6A 2JDUA 3VBRC 1NY71 3AZZA 5A3MA 2NLRA 2RS51 2VW1A 4AVTA 4BCUA 1IHMA 1H6XA 3FLRA 3ZSMA 1PMIA 4H7LA 4IXLA 4M3CB 4BQ4A 3WNPA 2BEOA 1DQ1A 1RJ8A 2WNUB 3ETQA 1LU1A 5LY2A 1GV9A 1KRIA 2W1WA 3OG2A 5D21A 2D3PA 4G3YC 4WM8C 1VLNA 4D69A 1CIWA 5KXBA 2XH6A 1D0GA 2VZ3A 1ND3B 2PHLA 2GH2A 2HWC2 4FTBA 3KM5A 1BCXA 3AKQA 1WLTA 3TNQA 1RUC2 2ZX1A 5EJ3A 5FZ3A 1B35B 2BVVA 3MGUA 4M3CE 3BPSA 1LOBA 4AFAA 4CCMA 3JD72 1HRI2 5AVAA 3MW2A 2E9QA 2Q8DA 4PIZA 1VBC1 1PIV3 3I59A 3P6BA 1OH3A 4B7EA 3RDIA 4OQ9A 2Z42A 1W0PA 2QDNA 5FZOB 4CUCA 1HDKA 2R073 1RUH1 3ASIA 3CU7A 4DZGA 4MUVA 1JYTA 2Z69A 3OSDA 1YFYA 3W20A 1DU3D 4JC1A 4D7YA 2YDEA 1WWYA 3BGAA 3VZJA 1KXGA 3JQWA 3A21A 4LT5A 2FMDA 4JGYB 5F1RA 1PVC3 1VAVA 3LIGA 4DXTA 5BPXA 5BNNB 2VW0A 1UQXA 3LDRA 3RVHA 3N9OA 3AL5A 3MF6A 4JKKA 4NRQA 4XUNA 4ET7A 1F2NA 4XJ8A 5FXVA 2RMU1 2YU1A 4CZSA 2ARAA 3FE5A 2WQZC 2RJKA 1J1TA 4LOSA 4F3JA 4RR3A 3HAGA 3T2OA 2G1MA 1RVF2 4LBLA 4XUOA 2Z2SB 2GH8A 1EYBA 3OBZA 3POSA 4N9HA 4Y26A 5JOYA 5ACA1 1F8VA 2D6MA 1UF2C 3TN93 3VD7A 3RZLA 1NYWA 4PBOA 5C3OA 3VBSA 3KT7A 1I1EA 2VOXA 1A8DA 1O7FA 1I3HA 4QB1A 1XE8A 2JG9B 5LBEA 3HQXA 1HJFA 3OCPA 2XJPA 1F5FA 2DUOA 2W0XA 2VO5A 5ABJA 2RHPA 4B4PA 4V2VA 1AR83 3G7DA 1OA4A 2R30A 4KQ7A 4YW2A 1OUSA 2R0FA 5D1IA 5EP9A 1ND3A 4TLGA 3TRSB 3I8TA 3VKLA 2VMEA 4FSJA 1DYPA 3MFAA 4E4HA 3FUQA 1GQGA 1REDA 3DEMA 3J7NA 2VXJA 1QQP1 4HONA 3AVSA 3WP6A 3ZX7A 4CEWB 2WNUC 2R041 2OUJA 1O8PA 4P9WA 2VBBA 1BJQA 1GOFA 1AR63 4LHLA 5FBZA 2Q4SA 4FPHA 4AEDC 4CCLA 4UFKA 2DWRA 2VGDA 2FCVA 4MLOA 3PVOA 1TMF3 4GULA 4I30A 1AL22 1FXZA 4XETA 2VCAA 2PFWA 1OLRA 2X29A 4M3CF 1D7PM 1W6OB 5D8AC 2W2IA 3ZOIA 1W8NA 2NMNA 1Q8SA 2ZMLA 5CAZA 3H3LA 2Y33A 3PURA 4IEQA 4IEZA 4HZFA 1XC6A 1CONA 4GALA 1W6MB 3CJIC 4Q5OA 3D0SA 4BK4A 4E2GA 3LIHA 2CGOA 2ZX3A 5HCAA 2D3SA 1W9FA 1Z7S1 1W8HA 2YGLA 2Z79A 5BNOA 1HN0A 5C9AC 2KM2A 1SACA 3RZZA 3ZFFC 3OBRA 1WMDA 3WV6A 2RDRA 1US2A 5KC5A 1SBFA 4X8PA 5KXEA 4S2GA 3N7MA 5JAXA 5FPLA 5C4WB 5FPXA 5F37A 2WAOA 3B9IA 4LIVA 5EV7A 1MVQA 3J8F2 4NRPA 4CP9B 2H6BA 3NAPA 1Z7S3 2HEYF 4GZ9A 4MGQA 2VE1A 4DRVA 1R081 3RYPA 1HB3A 1LTEA 5T52A 1DYOA 3VHOA 2HWB1 2OYZA 4P9IA 5JCTA 2AEYA 2JDNA 2RVAA 1S0CA 3BUCA 2RV9A 4WVVA 3OPTA 3VBOC 5L36A 2Z5WA 1LGBA 2ZHMA 5A80A 1VBE2 4BMEA 5F6LB 2RR13 2VQ0A 5HCHA 3ILNA 4NPMA 4YFWA 4BZ4A 2WBKA 3NKTA 4JHTA 2IZWA 3MICA 2NPIA 4QWNA 4GMP1 3HBKA 4EQVA 3BTZA 1HXS1 4H2AA 1VMFA 1CX1A 3ACFA 2PHWA 4X6QB 2HWE2 4NWVA 5CU1A 1NQDA 4NHLA 3K48A 3VD9A 3BALA 1LHVA 1KEXA 3CEWA 1MEC3 2J1UA 5FZAA 3ZMOA 1T6GC 2TEPA 4CCEA 5L19A 3HNBM 3FL7A 1ST8A 1FOD2 4GWJA 1AUYA 4XFBA 4YG6A 3I3DA 2PXJA 3N9MA 4XFFA 2FD8A 4S2HA 1LOAA 3WQ7A 1MZEA 4XILA 4AI0A 1HXS3 4X6RB 2P3YA 1W2AX 3WY6A 2WYFA 1OPOA 2KA3A 1IG3A 4FP2A 3KLSA 2DVAA 2OIIA 3USUA 2EIBA 4KWKA 4Y5TA 5HCFA 1JMUB 3TAYA 1YIPA 3T2TA 3VUOA 2R1BA 2E7TA 4YWAA 3E5QA 5A6QA 2PHDA 5JSOA 3POEA 3I54A 4FFHA 1CGPA 2EA7A 4K1ZA 4NIGA 5IVFA 4J25A 4A42A 3I59B 3LEGA 3TBDA 4LTAA 1VBD1 1XOYA 1R082 4MV2A 3LDKA 1K5MC 3VZOA 3BYWA 1AX0A 4P14A 2DU1A 2WABA 2X5IC 4H55A 4RHV1 1YRZA 2DTYA 1S2KA 2BVBA 4FOWA 4W6XA 4QPGC 4FFIA 5EFUA 3GXUA 5C9AB 3BTYA 3MIFA 3GZAA 5JXIA 2FHRA 1N3QA 1CX4A 2XBO2 3JBG3 3KV4A 3UETA 4TZDA 3AYEA 3ILRA 1H0BA 2WZ8A 4IV1B 1BVVA 2XB6C 1VBA1 4NAOA 3HMYA 3W5MA 3M70A 3MV11 1PHMA 1O91A 2GMEA 4Y1UA 3WF1A 5J7MA 1RXFA 2YBPA 4ZKTB 2G19A 5FUNA 3INAA 1ZRFA 3F2ZA 2RDQA 1GOHA 2ZS6B 2VG9A 5A33A 2I45A 1NX9A 2G9ZA 4R4XA 5C8CA 2CV6A 3KF3A 3VD4A 2XGXA 3HIFA 4HPKB 1W2OA 1V6NA 5FP4A 2B5HA 4LNVA 2GP3A 4Z2AA 3BN6A 3GZEA 4DIQA 4GA9A 5FMOL 2BYVE 3LA7A 3PUHA 5FWEA 4PT6A 1J1LA 1D2SA 3AYAA 1YFWA 3OPWA 5KHJA 1GLHA 3NQHA 3C7GA 3DN7A 2ZOEB 5DAQA 3PDQA 4NHKA 4CDUC 4E4SA 1VAMA 5APAA 1XU1A 3A23A 4TWTA 1JN2P 3A7QA 3DYOA 4YM1A 1PMHX 2LUWA 4XABA 5EYYA 3UL2A 4ARYA 2R16A 1JZ2A 1HRV3 1C5HA 2HBUA 5LEKA 1H8TC 4ZONA 4UFLA 1AF9A 3APBA 5FZDA 5FPZA 2JIJA 1TNFA 3J8F3 3BU7A 5CFDC 2ZGUA 1VB2A 3WT3A 1QGLA 5JWPA 1OLQA 4K8RB 1GQHA 2GP5A 1DQ0A 2XVGA 1X8MA 1QXRA 3IIAA 1QWRA 4YVWA 5HBAA 1DHKB 1OKQA 1R1A1 2EICA 4CCJA 2A3WA 4QDRA 3VBUA 1CN1A 5DAPA 2X53S 3ZPYA 4LBQD 3ZXGA 4FPJA 3POJA 4D7SA 2WFF3 4AEKA 1F35A 4OUEA 1UU4A 3BTXA 2A3YA 5FZ6A 2CGPA 2RDSA 2VAUA 1LKNA 3EHKA 3D4KA 3DKQA 5AC93 1ENRA 3GJAA 3ETPA 2W94A 2C26A 1H6YA 3AM2A 4I3GA 4LBKA 3WHUA 3LF7A 3ZXKA 5C7GA 5GLTA 4FP3A 4ZY9A 1NLSA 1W9YA 2VC9A 3PLQA 4KG0A 4L9BA 2CY6A 1ZRCA 4CDWB 4HXCA 5H9QA 3B01A 2K2SA 1RUJ1 1JXNA 5FPBA 4O9GA 4CSWA 5JXJA 3C7HA 2P3KA 2D5FA 3SQOA 3ZYGA 1N3OA 1W8UA 4IEOA 4BQWA 3NJXA 1SDWA 2W08A 1GKBA 2X10A 4G4FA 1RMU3 2VTXJ 5IVCA 4DXRA 1QJEA 4Q1PA 1HRV2 1LGNA 2GNBA 3R4DB 1HV0A 4AGVA 1H8TA 2G4IA 3WDVA 4N43C 5IT6A 2ZGNA 3V0AB 1LAJA 5A32B 4QPGA 4M4PA 5DABA 4ISQA 1GQPA 3JD71 2XLAA 1IZ3A 3U0ZA 3CQOA 3ON7A 2GN3A 2VMGA 1V00A 4MXWB 1UYZA 2A3XA 3JCIA 3CF6E 5LK5A 4M0NA 1PNGA 2ZGMA 1RUD3 1ZRDA 2HWD3 2K46A 4GH4C 4W4ZA 1QXJA 2RS11 4BXSV 2PELA 2VW2A 3DPRA 5FYUA 2MHFA 1SCSA 2WO1A 4K8FA 4CUGA 4UOJA 5J1XA 4QQHA 1HRI1 4OI1A 2JB8A 4Q0VA 3P3NA 3KT4A 3FJSA 3POGA 4LLFA 3E6BA 2WKKA 1ZNPA 4XF3A 5G04L 3O1RA 4AFMA 3DYPA 1RUD2 4FPFA 2WT2A 1FI2A 1JW6A 3AZVA 3OF1A 1DDLA 1ZZBA 3IPVB 3AYDA 4NIHA 1QMJA 1V9U3 1W06A 2E7QA 1UCXA 1VRBA 3ACLA 2WN2A 3W58A 2JENA 1W28A 2Q1FA 1WW6A 2VQUA 2WNEA 2WLQA 4JQTA 4UFMA 3RG0A 3MUZ1 1AR73 2RE9A 1LOEA 3M8LA 1HJGA 5D8AA 3WCSA 3GGLA 5CA6A 4O65A 1AYM1 1WA4A 2V5DA 1NE4A 4XHBA 4Y33A 1OF3A 1A8MA 2IXIA 1RC6A 4CCKA 4XVHA 4XJWA 3UKVA 1T6BX 4P02B 3H42B 5G05L 1JU3A 4FXKB 4CPBA 2D5HA 2RS32 1W9SA 2BU9A 1DZQA 4LKSA 2W9XA 1NCRB 2WNVC 4M4RA 4WVMA 4XBQA 1RHI3 4XF0A 2DUQA 3VL8A 4NO4A 2XPJA 3RI8A 2MEV1 5DXDA 4ATEA 4A44A 4BQYA 4FPLA 4L2NA 1VBE1 5FZ4A 3LGRA 4MHUA 4AYUA 4BDVB 1K42A 1ZM1A 1RUC3 5FUPA 1E57A 3KCYA 3KV9A 2OZ6A 1Q56A 2OQ6A 5HCBA 2RS53 1XYOA 3H1YA 5SV5A 4I09A 2JD9A 3WDYA 1CZSA 3GF6A 3WG2A 5C3SA 3ZMNA 4HVQA 3QD6A 5FQ0A 2ZGSA 5CISA 1XNCA 2JDZA 4IESA 3WZ1A 3MPBA 1POQA 2DCZA 4XIKA 1OLMA 2Y0OA 1J84A 4XURA 3VBSC 2RS12 2XWJB 1RUI1 1ZBE1 2JDYA 1APNA 4XF1A 1SFPA 4EN9B 1H4HA 5JMOA 2J42A 2YV8A 3DECA 1W8OA 4KWUA 2XLGA 5HV4A 2GMPA 2BFUL 2ARXA 5T54A 2Y0IA 4YGBA 1REFA 2VOVA 1NCQB 4CP0A 3NO8A 3PJQA 2GC1A 5LEJA 3MW3A 5C3RA 5CEHA 4YVSB 1RUJ3 3O14A 3K51A 2A5ZA 2RS13 5IUQA 1C3HA 4A3ZA 1VBE3 4BM8A 4N7UA 3SISA 4DS0A 1NT0A 2ET7A 4EYUA 2VMDA 4HN0A 2BFUS 4JKLA 2JG8B 5EZWA 1W8FA 1UO9A 3MIGA 1WLDA 1ZRRA 2QVSB 4IEUA 4QKDA 1N1TA 2ZGLA 4HVOA 2RS52 3BU0A 1QNWA 2LM3A 3FZ3A 4GWMA 4E2QA 4V2WA 2IFWA 3MHZA 3NWKA 3WG3A 2ZGOA 4Y4YA 4BXFA 3TEWA 1H30A 1PIV1 1Q5OA 2JKXA 3VV1A 4Q0QA 4C8DA 5C8WA 1HB2A 2JB4A 2ZHLA 1CAXA 2WDBA 1RL3A 4QXBA 1MS3A 3IDCB 3M3EA 3HWJA 2PA7A 4N43B 4Y1XA 2K0GA 4NHXA 3DL3A 4KU8A 4TN7A 3AMPA 1UMZA 4CP9A 5IVVA 4EZHA 1RINA 2Y8KA 4E8CA 1BBT3 5BNOC 1NCQA 3GCXA 3H9AA 5FZMA 4TXWA 3VKOA 4KMQA 4CEYC 3UKNA 4K20A 1U12A 4JDNA 1RHI1 5ANNA 1R1A2 2WWJA 2V4AA 1DQ5A 3Q8BA 1OVSA 4MGIE 5DPNA 4K9SA 1UPSA 5CFCA 1NUKA 2C1FA 2R0HA 2YZ4A 1YYNA 1RUH2 1AR81 3R05A 5FIXA 4KNCA 3BODA 2WO7A 1H2LA 2EIEA 3KCXA 2OT7A 2P17A 1FPN3 3USSA 3FHIB 2QQOA 3PUSA 3K4DA 3DPRC 2VCMA 1QJX2 1VP6A 1Z0HA 2D93A 2ID4A 4HSLA 5FZ7A 3VD3A 4CUBA 2X09A 2W87A 4CYDA 1XPWA 1HQNA 1U5IA 3MF9A 4XXAA 3VBOA 1DLLA 4XUQA 3O1SA 3DF0A 5K4LA 3RS6A 4C0HA 3NV4A 2HWC1 4DY5A 1BK1A 4RA0A 4BQ5A 2O14A 1ZBE2 2YB7A 2R7EB 2YPDA 3ZXLA 3WG1A 4NOTA 1JYWA 1DZRA 1YHFA 4DQAA 1NE6A 4RQPB 4NUBA 5A1FA 3OUJA 2UWBA 1ENXA 5A6XA 1FV3A 3C7OA 5FYZA 1ND2B 4CXWA 3V65A 3W9AA 1Q8PA 1ZZ6A 4N53C 1SLCA 1ULFA 3AP5A 2HH9A 3MLLA 1W99A 1SCRA 1Y4WA 2HEWF 4FOQA 3ZFGA 1FT9A 1UXZA 5F3EA 4LO5B 4P9JA 2DFCA 3BIWE 4QU1A 4YNIA 4Z92B 3DUIA 5DZEA 2OXBA 1C28A 5A6YA 1JU4A 1RIRA 5DG2A 4QB2A 3PUQA 3AZXA 5EWSA 1I6XA 3RPQA 4H14A 1IKPA 4HL0A 2AEZA 3B69A 3N35A 4AG4A 2B46X 3MIEA 5DAVA 3SITA 5AC92 1F5JA 3LOBA 4D6RA 1MS1A 3T3YA 2DCYA 4DXSA 1MS8A 5DZGA 1RVF1 1S1AA 1OQDA 1TME2 4AEMA 5HPOA 2VY0A 4P9LA 2FZ2A 1YO8A 1PGW2 3G6JB 4I02A 4MXWA 1OH4A 3LD8A 5C4WC 1JBCA 1GWLA 2IC1A 4GWNA 2XVLA 5KHKA 2BGPA 3CO2A 1VBB1 4HVRA 4CEYB 3WNLA 1NXMA 1UZ0A 3V0AA 3I3QA 1D4VB 1FMD3 3HQRA 3LEMA 1D4M1 1B09A 3VHPA 3RZGA 4GMP3 2BOJA 2DVBA 4XEZA 2PHTA 2W47A 2VR4A 4GWIA 2Q5TA 2VOKA 4XACA 4YARA 4Z1VA 1AVBA 1V9U2 2FCTA 1ZBA2 4DMIA 2WWUA 1W04A 1PGW1 1R1A3 3BPZA 3SHRA 5FBJA 1NCQC 4UFIA 3SMHA 2W1QA 1F9KA 1UY2A 3TN91 4QQLA 1PK6C 2HWB3 4HOOA 4XJZA 1GZCA 4E4ZA 5LZ6A 1JYXA 4E27A 2I2SA 1ZZ7A 1MZ6A 1YWKA 2C4XA 1KITA 2JDMA 1ZA7A 3T4VA 5IK7A 3ZLIA 1WW7A 3H7YA 4Q4W2 4CRQA 1GWMA 4XFAA 1PX3A 2JG8A 2LTNA 3N7LA 2B39A 3AMNA 2ZXQA 3AMHA 4JX0A 4NJ4A 4Z07A 4PHZA 5JR7B 4BQ2A 4YW4A 1LOGA 1US3A 1W8WA 2CHHA 5EQUA 5IATA 1IS5A 5FMOS 4XE9A 5FMBA 1OD5A 2ERFA 2ZGTA 3RRDA 4XZUG 3MIDA 4UT5A 4QQPA 3WEZA 4IGPA 2ZX4A 2IXKA 1ASJ3 1X9PA 1IPJA 2IXCA 4QGMA 3WP3A 5FYMA 2VOTA 1LOCA 1S0DA 3OYWB 5LY1A 3GJBA 4AXOA 3MW4A 4IEYA 4UF0B 4BOWA 4INDA 1ZBE3 2ZHKA 2QUOA 1W0OA 2Y26A 2XKOA 4AI1A 4EJRA 5CADA 4BMBA 2JDHA 4EWEA 5BNOB 1DZTA 4UXAA 3U78A 1RUI3 2UU8A 4AI9A 4DPNA 1GUIA 4IE5A 1PO12 5JI7A 4WM7C 5A3WA 1UU6A 2WZR2 3ABZA 4DINB 2IVJA 4OYUA 3OY8A 3KV6A 1Y43B 3QACA 2FZ1A 3B02A 1HW5A 2XQXA 4C90A 2CGNA 2XLFA 1FMD1 4MADA 1TME3 5KBFA 2OQ7A 3CJIA 1W6QA 5FZIA 3SXWA 1LHUA 1W39A 3H3ZA 1H9PA 4WVMB 3FBYA 1GP4A 2CWMA 2PN5A 4IUGA 2X8KA 5FAXA 1PGSA 3H0OA 3K75B 3NNMA 3E6DA 4QGLA 4QAWA 5FV3A 3KZ4C 1AL0G 2D44A 3AKRA 4AEDB 2CYFA 4KWLA 4ES8A 1OBNA 2QCSB 2ILMA 2ET1A 3WG4A 2VD7A 4CCNA 3IIIA 2WJSA 5A7SA 5D8AB 4ZHNA 2WNVA 5CZKA 3HR9A 5KXDA 1NKGA 1RHI2 4HFSA 3I4IA 2R072 4YFZA 3M4FA 5DN2A 1CESA 3OTFA 1OOPB 2VMIA 4COVA 3ZN4A 3UYJA 4AZZA 2GNMA 4LE3A 4ZS3A 1WD4A 2Q30A 4IV3B 1HRI3 3LQCA 3PTRB 1WBFA 4LHKA 3PMEA 1KGYA 3IT8A 4XFHA 5A1LA 1M06G 2WWSA 4AK3A 4A4AA 5JPMB 2VZPA 5LASA 1EV11 2YC2A 2WO3A 4BQ3A 4PLOA 1CJDA 1TE1B 3MFCA 3SNMA 4XOGA 4P5YA 3JQXA 5A7NA 2CNAA 4XDOA 5LRRA 5CKMA 1OFSA 5FO7B 1X8EA 3GALA 3ACGA 2BOIA 4EN8B 4LOTA 5J96B 1MACA 2ORZA 3C8XA 4E2SA 1LJ7A 4UF0A 5IK4A 1COV1 1DG6A 1GP5A 1HQLA 2DYCA 4LBNA 4IQPA 2FDFA 1C5IA 2ZKNA 1OD3A 1SLAA 1O4ZA 2V72A 4QPYA 2R6QA 2RS31 1XNDA 3NMBA 5EJ1B 1JZ7A 2AH2A 3I2OA 5T5JA 2GC2A 3A0KA 2TUNA 5GLZA 1O3RA 3BIEA 5LA1A 3VDAA 3B9CA 4LBOA 3SEPA 4DUXA 3EYPA 1BLZA 4LITA 3O12A 3V0BA 4AWDA 1TMF1 2O1QA 3O1TA 4LULA 5DUUA 4YG3A 4FPYA 4GXLA 4XZPA 1GFF2 5B2GB 3CJXA 1QH6A 3IMNA 4E8DA 3WNKA 4CCDA 3IBMA 5LBBA 5F7UA 4PDWB 3R0RA 2VULA 2DFBA 4OHVA 1I9RA 3VBUC 1SBDA 3VKFC 4A6SA 5E88A 5FY8A 4GB32 4A45A 3FFZA 3VKNA 4QB6A 1RUI2 4WVWA 2GALA 5A3NA 1FPN2 1ULCA 4MGYE 5FYIA 5J48A 1JODA 3KHBA 4Y20B 4IL7A 2HWF3 4EWDA 2WLPA 2ZKLA 3B3QE 4OMCA 5I91A 4FPKA 5CG9A 4YVSA 3J9SA 5JUVA 2DURA 3RFRA 5HV0A 1AR72 3ZFGC 1L7QA 4WZCA 4ASLA 4QU2A 4KBZA 4OHXA 3GZUC 1H4GA 4P08A 3IM0A 3O5SA 2W5FA 1OOPC 1POV1 2JDAA 1GMMA 2GAUA 3AMMA 5B4XA 1BHGA 3GDBA 1K5MB 2HWF1 1RGSA 3SCFA 3DCQA 3O0VA 1QJY3 5FJHA 4QQOA 2SLIA 3ZR5A 4AI3A 1MPXA 1IKQA 1MEC2 4ZXEA 1CAUA 5BV6A 5LCWL 1JZ5A 2CU5A 3E5UA 1AL23 3NRUA 2QQJA 1HRV1 5FP7A 3WX5A 3KVAA 1XNTA 3L9JT 4BWOA 3C7FA 3D3AA 4RQPC 1WLCA 3W21A 5J09A 2HBTA 5JI9A 2P34A 3M1HA 2FDJA 5A3PA 2HWB2 4N53B 4OMDA 3AX4A 1HIXA 3PVNA 1PK6A 2A70A 4UI9L 1IPKA 1JI6A 1U5XA 4IV3A 2XONA 4K21A 4Q4X1 4CTEA 1ODMA 1PGL2 2WA4A 2P5BA 5C8CB 3GNEA 5FXXA 1XNBA 2BWCA 2IXHA 2HYXA 4UW4A 1V6LA 2I07B 1Q43A 2N7GA 3NJYA 1QKQA 5I93A 3EB7A 4OHYA 4CEWA 2VUDA 3IDBB 2P37A 1OVPA 3CIHA 1KQRA 1R083 4DXZA 1JH5A 1OI6A 2DTWA 5T50A 5FPVA 5IJRA 1OA2A 1SZBA 3JBG1 2YXSA 4RQPA 3VBRB 3ZYRA 3OD4A 3OGRA 5F2WA 1QNYA 1S2BA 2ZGKA 1ZYBA 3AP9A 4J1XA 4QDSA 3WHTA 4JGYC 3GBGA 4Y1YA 2AENA 2NQYA 1V6KA 4PDWC 5H9PA 4JRLA 4RS5B 3ZIXA 5IVEA 3VBOB 4BB3A 3ME2A 1RJ7A 1ODNA 2CSGA 4XJUA 3HEIA 3HT2A 5FLIA 1HLCA 5LW9A 1JUIA 3U07A 5A7OA 4HLTA 1O5UA 3ORJA 4NIAA 3V0BB 4LO7A 4FPOB
chains in the Genus database with same CATH topology
1JODA 1F35A 1JOBA 1JYTA 1ZRIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JOD A;  1F35 A;  1JOB A;  1JYT A;  1ZRI A; 
#chains in the Genus database with same CATH topology
 1KS4 A;  3AFG A;  3Q8C A;  4YM0 A;  3VBH A;  4IE6 A;  3POY A;  2QTW B;  3ZM8 A;  4BHP A;  2JD4 A;  1W6P A;  3ZFE A;  4CU7 A;  3UK9 A;  1W8T A;  1SG3 A;  4YM3 A;  5ABJ C;  4R4Z A;  3WF3 A;  3KS7 A;  3LPG A;  1YFU A;  2NM1 A;  4PF5 A;  1AR6 2;  5E16 A;  2D6N A;  2ZHN A;  4QHZ A;  2WZR 3;  3AKS A;  2QZ2 A;  5FZG A;  1AX1 A;  1I5Z A;  1PO1 3;  3EJK A;  1AR6 1;  2GDF A;  2ADE A;  3EXU A;  4XAE A;  2ZAA A;  2GND A;  5I0U A;  3SH5 A;  4EWA A;  4Q0S A;  5FYB A;  3IWZ A;  4XQD A;  5FYT A;  4CP2 A;  1UX7 A;  3ZYB A;  4ASK A;  3LCP A;  1UL9 A;  4K7J A;  4XF9 A;  2OPK A;  1J3Q A;  1T2X A;  2KD7 A;  1VJ2 A;  4FQ4 A;  3MUY 1;  1K3I A;  3AZW A;  1NA1 B;  3M3Q A;  4JV4 A;  2YHJ A;  5FY5 A;  1CPM A;  1L7L A;  2A71 A;  5F39 A;  1SEF A;  1UOJ A;  4AQ6 A;  3VDD C;  1S0I A;  2WO2 A;  2LS6 A;  4UWD A;  2PHU A;  1DLC A;  2C0Z A;  1HB4 A;  2PYT A;  1X50 A;  1YJL A;  1Y9G A;  2XQR A;  3MLK A;  1QJX 3;  4MOA A;  3OBT A;  1RUJ 2;  2LW8 A;  5FYV A;  1KDK A;  5BNP A;  3GHM A;  2YC4 A;  4EN6 B;  2HEV F;  3EBR A;  5BNQ A;  1CIY A;  1RUE 1;  1JZ8 A;  1L7R A;  1SLI A;  3T30 A;  1IS3 A;  1QQP 2;  4QXC A;  1WZX A;  3ILF A;  2ZZQ A;  3TEX A;  3OOX A;  2RG4 A;  1RB8 G;  2HWD 2;  4L11 A;  2XOM A;  4QXH A;  1S55 A;  3AKP A;  1WW5 A;  2BQP A;  1LES A;  3ITQ A;  1QJY 2;  4FCA A;  1QXP A;  1BEV 3;  1D4M 2;  1UPI A;  2FBE A;  3JB8 A;  3MDP A;  4N7I A;  4Y1Z A;  2IWG B;  2OPW A;  5F8P A;  5FK8 A;  5LBF A;  1ONA A;  5KC6 A;  1XBF A;  5J36 A;  1W90 A;  4HKO A;  3LFM A;  2KR2 A;  3ST7 A;  3SKV A;  2XDV A;  1W9W A;  4NAM A;  1MS4 A;  1N1S A;  4LHN A;  3ZSK A;  4L0P A;  4AFD A;  2DU0 A;  3T08 A;  5CBL A;  1YIF A;  4Q1R A;  5DDJ 3;  2QQL A;  4XCA A;  4UBG A;  2XBO 3;  3JBG 2;  4UFJ A;  5F6K A;  3ZXE A;  1G9D A;  3HOB A;  2JEC A;  1CZT A;  1EAH 2;  1RTV A;  3CLP A;  3H1M A;  4I0B A;  2CDP A;  4RN5 A;  3ZXJ A;  1BEV 1;  4AVV A;  4LA2 A;  4NHM A;  3R4U A;  2E63 A;  2VUJ A;  3ACH A;  2F6B A;  4LKF A;  4QHO A;  2FDI A;  2VZT A;  5FKB A;  2TBV A;  3SH3 A;  2WZP P;  4CDX B;  2GMM A;  4D7T A;  5FK7 A;  2JE9 A;  3ZVX A;  4YPJ A;  4QKB A;  1YFX A;  3MPP G;  4COZ A;  1W2U A;  1PO2 2;  3UES A;  3FLT A;  4UW6 A;  4OCT A;  2Q8E A;  3J7M A;  1QJU 3;  4PBP A;  5FKC A;  3VZL A;  2GC3 A;  4OUS A;  1NXD 1;  4LKE A;  2VUC A;  3IAP A;  3ZXF A;  2IVI B;  4XXP A;  3PIG A;  4H3W A;  2GNT A;  2XJT A;  5FO8 B;  2DCT A;  3MLJ A;  4LA3 A;  1ZBA 1;  3B5L B;  5A1A A;  5FZ9 A;  5IFP A;  1YQ2 A;  4WVZ A;  1DQ6 A;  1G8W A;  4Q8K A;  5A7W A;  5L9V A;  5IWF A;  1UD1 A;  3I2I A;  1AZD A;  4OQ8 A;  1TQ5 A;  5L7O A;  4Q4Y 2;  3D82 A;  3IDE A;  4KGG A;  1DGL A;  4R52 A;  2WUH A;  1ND2 A;  3RMY A;  1F4A A;  1UZY A;  1QIQ A;  1G9F A;  1GYK A;  2WC2 A;  3U10 A;  4C1X A;  4IV1 A;  4JDM A;  1GZ9 A;  1UAI A;  4QKN A;  2VH9 A;  4I2O A;  4XBL A;  1STM A;  1ZRI A;  2WS9 3;  4W8J A;  2VCC A;  1BK0 A;  1UX6 A;  2JE7 A;  3SEE A;  1GR3 A;  2WT0 A;  2YFU A;  5BNP B;  1YXW A;  1RVF 3;  3U75 A;  4RFR B;  4AOC A;  4JVA A;  2RDN A;  4PDW A;  4URT A;  3VDD B;  4R9C A;  2XUE A;  2QZ3 A;  4FVV A;  1C57 A;  2EXH A;  2KXL A;  1WMX A;  2PLV 3;  3VL9 A;  4AHY A;  3ZO0 B;  3VB9 A;  4Z2W A;  4R9B A;  3ZKY A;  1LOD A;  1R1Z A;  3PVE A;  1SQ4 A;  1ULD A;  2A6X A;  3HQU A;  2YBK A;  2YPJ A;  4QDQ A;  4Y3O A;  2BTV C;  5HXM A;  4RR3 B;  5K7P A;  2D97 A;  3TB0 A;  1AR8 2;  2Y6L A;  5LA2 A;  3O1O A;  3N36 A;  1V70 A;  3PU3 A;  2VMH A;  1Q8Q A;  1HQW A;  2GZW A;  4LO8 A;  2HLE A;  1LHN A;  4XCB A;  1YJK A;  2VXR A;  3OGV A;  4AF9 A;  3RMX A;  5KWR A;  1C8M 1;  3THP A;  4FPE A;  4DUV A;  1JUH A;  4O61 A;  3LA3 A;  2ZAB A;  4Y22 B;  2E26 A;  5LK7 B;  1X82 A;  2VJX A;  1BQP A;  2L9L A;  1JTZ X;  3J26 N;  4NRO A;  1QOS A;  2D6P A;  1OQE A;  5E1R A;  4QKF A;  4BIF A;  3E1F 1;  2WQ8 A;  2O8Q A;  3T09 A;  2E53 A;  1QJY 1;  3M3C A;  2V09 A;  4WM8 B;  3Q9O A;  4O7X A;  2HWC 3;  2ZPX A;  2DCK A;  2V5Y A;  1ALY A;  3SC7 X;  5FO9 B;  2BRT A;  4ZZ5 A;  2CAV A;  1RUG 3;  5J98 B;  3RWK X;  4ONU A;  1CAX B;  3CBN A;  4R9D A;  5KHG A;  1COV 2;  4A7Y A;  2Q8O A;  4CDW A;  1AXK A;  3CMG A;  2WFF 2;  1B35 C;  1SPP B;  2O8O A;  2XL9 A;  3DV8 A;  1MZF A;  5EPA A;  1UIK A;  3LDB A;  1R64 A;  5BNP C;  3I2F A;  1KFU L;  1PX4 A;  2HWE 3;  1E5R A;  2ARC A;  2W3J A;  3OPZ A;  4GAZ A;  5L9R A;  1ZZ9 A;  2D40 A;  1HN1 A;  3O1P A;  2Y6J A;  4PIY A;  4S2F A;  2R04 3;  2A6Z A;  1O5L A;  4HET A;  4QHB A;  1MZ5 A;  1UOG A;  5EJZ B;  1N1Y A;  2J1R A;  2VVF A;  3J7L A;  1XXN A;  3SKJ E;  5LWB A;  2WNU A;  4CU9 A;  1GSL A;  2PMW B;  4CU6 A;  1VBC 2;  2XJS A;  2OX0 A;  4IEV A;  1J59 A;  3HPN A;  2P3I A;  5A7W B;  3O7O A;  5KXC A;  2W92 A;  3AK0 A;  4D6Q A;  2VZO A;  4IEX A;  4YVW B;  1UWW A;  4M3C A;  5JR2 A;  2WRA A;  2D3R A;  4Y24 A;  1OMI A;  3WIN E;  3BKZ A;  1GBG A;  3IDA A;  1R09 2;  5JPN B;  5FP8 A;  3O1U A;  1ULO A;  4OI0 A;  2FCU A;  1RMU 2;  3PVB B;  3GM8 A;  1TVG A;  2BUK A;  4RGG A;  4UAP A;  4BYY A;  5F5I A;  4YZ5 A;  2GU9 A;  1RUG 1;  2ZEY A;  5GJ6 A;  2YG0 A;  1GIC A;  1W6M A;  2VMC A;  2VPV A;  3RSJ A;  1WCU A;  2MPF A;  3BOW A;  5A7P A;  5T55 A;  5GLW A;  3F95 A;  4LJH A;  2GSY A;  4P9X A;  4D8M A;  3BI3 A;  4AVA A;  4I01 A;  5L9B A;  4Q4W 3;  1DGW X;  3U37 A;  3ROU A;  2W39 A;  2ZAC A;  4R8H A;  5DUV A;  1OSG A;  1MQT B;  1NY7 2;  1PZ9 A;  4OUM A;  3T1L A;  1PNF A;  3WW4 A;  1CR7 A;  3T1M A;  5C6C A;  1EP0 A;  3HT1 A;  3RYK A;  2EAA A;  2ZZJ A;  1OLM E;  1PVC 1;  4TLF A;  3J7H A;  2RM2 2;  3FFQ A;  3AC0 A;  1GNH A;  2V73 A;  4Y5Z 0;  1CAV A;  1YQ8 A;  4YZ4 A;  5HXV A;  1O3Q A;  1DIW A;  2VNR A;  4AQS A;  1OA3 A;  3VGI A;  4Q4V 2;  2XG3 A;  4IE0 A;  2XXZ A;  4MGT A;  4AFB A;  1FV2 A;  1H1I A;  1S0G A;  1HX6 A;  5DUX A;  5GZD A;  3C2U A;  4QPI A;  4N43 A;  1FMD 2;  1XRU A;  2B45 X;  1Y3T A;  1X9T A;  2PQQ A;  3MV0 1;  5A3O A;  4YVS C;  2A6Y A;  1WCK A;  2PAM A;  3ALQ A;  3THT A;  2WN3 A;  1OFN A;  3WW2 A;  5E6H A;  3VD5 A;  2LAL A;  2WYS A;  4YW6 A;  5F9T A;  2DVF A;  4A7K A;  3IPV A;  4FAH A;  1UNB A;  4HSJ A;  5TSW A;  3ZSE A;  3ATG A;  4SBV A;  5C3Q A;  5IFT A;  1H2M A;  4CA9 A;  1SLL A;  1G9A A;  4CXX A;  1BKZ A;  2G9F A;  4QX5 A;  5JLV A;  2NN8 A;  3PL0 A;  2WII B;  3K3O A;  2ZA9 A;  2JEM A;  2P1B A;  4NPR A;  2F17 A;  4PLN A;  2VL4 A;  2DV9 A;  4B3N A;  2VBP A;  3O0X A;  1NA1 A;  3BB6 A;  3IMM A;  4PCR A;  4RHV 3;  4UYB A;  4XFI A;  5FXW A;  3GYD A;  4RGA A;  3S7I A;  1A78 A;  1FOD 3;  1PM7 A;  4PQ9 A;  4YRD A;  1PMJ X;  2BW8 A;  2EID A;  4TYS A;  1UKR A;  4K40 A;  4PLM A;  4PQQ A;  4Q29 A;  5CKQ A;  3PUI A;  5A3U A;  1KJR A;  2JG9 C;  4YW7 A;  3TN9 2;  3DGT A;  5CFD B;  1XNK A;  2C5D A;  3Q8F A;  3POB A;  2C9A A;  3U11 A;  3S5A A;  2JDK A;  2RMU 2;  3IKW A;  3NNG A;  2OVU A;  4QD2 A;  5F3I A;  2B9V A;  3ECQ A;  1K12 A;  3KB5 A;  3VZM A;  4PIX A;  3ZFE B;  1OKO A;  4B4Q A;  1W6N B;  3AP7 A;  3VBH B;  1WCS A;  5JSP A;  3N4M A;  1UYY A;  4JQR A;  4Y4R A;  5FZO A;  1AYN 2;  4LBQ B;  1G86 A;  4CPB D;  5IAX A;  1PVC 2;  1AXY A;  4LBM A;  2VQT A;  4H7M A;  4NRM A;  5FY0 A;  3CL1 A;  5CG8 A;  3D5O A;  1D2Q A;  1SBE A;  1YEW A;  4WZF A;  5I8Y A;  1F4H A;  1QF3 A;  3MEP A;  3M7A A;  4S2D A;  1RUD 1;  1YQ6 A;  4ZXK A;  2P2K A;  1AHS A;  1LUL A;  1JS9 A;  1LGC A;  4UW3 A;  1TME 1;  4D6S A;  2BPA 2;  3ZDV A;  2FDK A;  1QU0 A;  3OEA A;  1U5Z A;  1UYP A;  4K1Y A;  4LBJ A;  4QX3 A;  5ISL A;  3GCW A;  5AFE A;  1AYN 1;  2DUP A;  4KI5 M;  4M01 A;  3OGS A;  2BNM A;  4RL7 A;  4A7Z A;  3WW1 A;  3WF2 A;  4AI8 A;  2OZJ A;  1E5I A;  1RUH 3;  1S0B A;  3IB3 A;  4YW5 A;  4RR3 C;  3WQ0 A;  4OZX A;  5LA9 A;  1WLW A;  1TNR A;  3MBW A;  1XB9 A;  3ZSJ A;  4W6Y A;  2CL2 A;  1JOP A;  3VBU B;  1CAV B;  1J3P A;  2PLV 1;  3WD5 A;  3UV9 A;  1N1V A;  4EZ4 A;  1O59 A;  4AFC A;  4LMF A;  1NAE A;  1V0A A;  4YGD A;  1RMU 1;  2OKX A;  1BBT 2;  2AAC A;  1URX A;  3PJY A;  1BZW A;  4IDZ A;  1TZO A;  1C1F A;  4IEP A;  4NII A;  4XFC A;  4TSV A;  1GZW A;  3V56 A;  4DOU A;  3URF A;  1Y9Q A;  2AYH A;  4I3P A;  3KSC A;  5D2A A;  1CAU B;  3VN4 A;  5GZC A;  1LED A;  1EV1 3;  1AL2 1;  2J1E A;  4AAP A;  5FJK A;  2WFP A;  3LKJ A;  2RR1 2;  5FZF A;  4CVU A;  1BBT 1;  5IVB A;  1PZ8 A;  1WUV A;  2D6O X;  3N3H A;  4Q4V 3;  4OHZ A;  5FZE A;  3VBF C;  3WUD A;  3N9Q A;  3OEB A;  4GMP 0;  2FDH A;  1S2E A;  1UIJ A;  5M0T A;  1QOT A;  1JYC A;  4FPG A;  3QH6 A;  4CP1 A;  2WFF 1;  4NPL A;  4LUK A;  4P9Y A;  2JJ6 A;  1H8T B;  1VPH A;  5JIA A;  5C71 A;  3JUU A;  2P6C A;  1LEC A;  2VTF A;  1ND2 C;  3AKT A;  3NV1 A;  5FLH A;  4FTS A;  4C1W A;  3O1V A;  4JGZ B;  3NAP C;  2GN7 A;  2CWS A;  2ZEZ A;  4Y1V A;  4FOV A;  4Q4V 1;  3VDB A;  4NVP A;  3KMH A;  1POV 0;  1SHW B;  3VBH C;  1VBA 2;  3NV2 A;  1AR9 1;  3POI A;  2Y34 A;  4B7K A;  2B9U A;  2VZV A;  5BUV A;  2RM2 1;  2UYA A;  2MNG A;  1OT5 A;  1K5J A;  3GZT B;  5FYS A;  1ZA4 A;  3WW3 A;  1H2K A;  3ZR6 A;  1NZI A;  1VBB 3;  1GU3 A;  3VLB B;  4AR2 A;  4B8E A;  3KHC A;  2ZX2 A;  1W3V A;  4Q27 A;  1EPW A;  3TOJ A;  1XE7 A;  2EXI A;  5C9A A;  4NR1 A;  5C33 A;  1O8S A;  2FQP A;  1ZVF A;  4U36 A;  2W91 A;  1MS0 A;  1PVX A;  1UY1 A;  2ZBJ A;  4N90 A;  3TYJ A;  4CDQ A;  1MS5 A;  1GZT A;  2ZMN A;  3AXD A;  1HB1 A;  3M3O A;  2HYK A;  1NG0 A;  3B93 A;  3RZK A;  3BTA A;  4YSF A;  4LHS A;  1DBN A;  1H8V A;  4XW3 A;  3LB9 A;  5GZG A;  5F2S A;  1EY2 A;  2QNK A;  1W6N A;  1U5Y A;  4R9A A;  4BK5 A;  4F7Z A;  4LPL A;  4IEW A;  2VNO A;  2VQA A;  3OUH A;  1QDC A;  5FYC A;  5T5O A;  5JOX A;  2RS3 3;  3ES1 A;  1XSQ A;  4MGK E;  2AC1 A;  4HT1 T;  3VZN A;  2DF7 A;  4CDQ C;  3USU B;  4CU8 A;  4W6W A;  1PIV 2;  1I5P A;  3FBM A;  2X05 A;  2ZGQ A;  2VCB A;  2CAU A;  4MGS A;  1SLB A;  1UMI A;  3H1W A;  3HD8 B;  5FRA A;  3KCC A;  1MVE A;  2ATF A;  1C8M 3;  4YLZ A;  3WDW A;  1XYP A;  3QLQ A;  1E5H A;  4B4R A;  1GZW B;  3T2P A;  3CKH A;  5FY9 A;  3R4S A;  1A6C A;  1YQC A;  2E7A A;  3P1I A;  3ZPO A;  2XJU A;  1S4C A;  2P3J A;  4MVT A;  4RGK A;  4CCO A;  1VIW B;  4YW1 A;  4DEQ A;  4XDP A;  1OC1 A;  4Q4W 1;  3THC A;  1G9C A;  4O9E A;  5J37 A;  3AJZ A;  1O4Y A;  5FY7 A;  5F5A A;  4HPK A;  2FDG A;  2AUY A;  1RUE 3;  5FP3 A;  3ZFF B;  2BGC A;  1WBL A;  4XYX A;  4J6G A;  3UT0 A;  1QH7 A;  3LOI A;  3POF A;  1K45 A;  4CEW C;  3WVJ A;  4KU7 A;  3T4H B;  5H9R A;  3ZXD A;  1UW8 A;  1NLR A;  2XR4 A;  4OZO A;  1V9U 1;  1RUF 1;  4MHR A;  3WP4 A;  3X29 B;  4JHZ A;  3AL6 A;  3D0J A;  4WM7 A;  2VZR A;  1S0J A;  2AZ5 A;  4YZ3 A;  3J8F 1;  2ZEW A;  2ZGP A;  4OHW A;  5B4N A;  3NAP B;  2C24 A;  4B1L A;  1DF0 A;  4COY A;  2MEV 3;  2MEV 2;  3P3P A;  5CIR A;  2Y6G A;  4D94 A;  5IHR A;  3RQ0 A;  2C9K A;  3LFI A;  2P4E A;  4ERO A;  5FOJ B;  4Q2F A;  1PO2 1;  5T3N A;  1JOJ A;  1REE A;  1PM4 A;  4LUM A;  3OB8 A;  4CDX C;  3KQ4 B;  4FOY A;  1LEN A;  4N53 A;  3V64 A;  1V6I A;  3AP6 A;  3K46 A;  1S0F A;  4IE4 A;  4NWW A;  3WDT A;  1AR7 1;  1IQD C;  4QPI C;  2CDO A;  1RUE 2;  2BNN A;  3OY8 B;  4D3W A;  1KD7 A;  2D43 A;  2A75 A;  2Q1Z B;  4MET A;  4AL9 A;  4DNY A;  3JD7 3;  2ZX0 A;  5C8C C;  1W2N A;  5EIY B;  4L8Q A;  4DRR A;  4AHZ A;  1FAY A;  4A3X A;  5FZK A;  4OI2 A;  4Q0U A;  2VZU A;  2YMZ A;  4MH0 E;  5AFB A;  4GB3 1;  5CFD A;  1VAL A;  5EHD A;  3QBQ A;  4FPC A;  4SLI A;  5GZF A;  2ZGR A;  4LKD A;  3GBF A;  1QY4 A;  4YM2 A;  4WBB A;  4GJY A;  2JIG A;  2IFR A;  3ZN6 A;  1CVN A;  1XSR A;  5J3U A;  1CPN A;  4COW A;  3B00 A;  5DMY A;  5JDB A;  2Y6F A;  2IXJ A;  2D7F A;  1EPZ A;  3CZU A;  2Y6H A;  4KG8 A;  4YGC A;  4KWJ A;  4L99 A;  2WR9 A;  3AP4 A;  2VU9 A;  4LE4 A;  4NHY A;  4L92 A;  1F15 A;  3Q8E A;  4AE2 A;  2QFE A;  1F31 A;  4FXG B;  4CDU A;  2J7M A;  4W50 A;  1DFQ A;  2ARE A;  2G9G A;  4N9I A;  4AHW A;  2EF6 A;  1BXH A;  4GJZ A;  1WCQ A;  4IV3 C;  5FPA A;  1POV 3;  4Q8L A;  3R6S A;  5FZH A;  5ABJ B;  3UGH A;  4QX2 A;  5DDJ 2;  5FOB B;  4U2A A;  1RUF 3;  2PAE A;  2X5I B;  4BQ1 A;  2UY8 A;  2QBX A;  2W95 A;  4LO6 B;  1LOF A;  3DYM A;  2JG9 A;  3M2M A;  4Z82 A;  4IER A;  5BXX A;  4MZU A;  1TEI A;  2QKD A;  3ZKU A;  3L2H A;  2RJL A;  4LK7 A;  5JMC A;  2YC0 A;  1IOA A;  2HKX A;  4I0W B;  1BEV 2;  1D4M 3;  3E5X A;  5AVP A;  1G7Y A;  3H50 A;  3SCH A;  4A6O A;  3LWC A;  4M0H A;  2BBA A;  1LRH A;  1QQP 3;  3WP5 A;  1JHN A;  2VVD A;  2A7A A;  5FYY A;  1WKY A;  5FP9 A;  3UGG A;  3ZN6 B;  4CEY A;  1QJF A;  2B4K A;  3WF0 A;  4L97 A;  4ZU7 A;  1RUN A;  2PAK A;  3I97 A;  2D6L X;  2Q1M A;  3I49 A;  2DCJ A;  3UGF A;  4YVW C;  4QX7 A;  3S6P A;  2R06 1;  4XQ4 A;  2WZR 1;  3N7J A;  1VBD 2;  2VNG A;  4IW3 A;  3RJ2 X;  1XU2 A;  3QH7 A;  1RIT A;  1ULP A;  4MO3 M;  2P6H A;  5FWJ A;  2R06 2;  5CB7 A;  1ULE A;  4BLJ A;  1V6J A;  2D98 A;  5FYH A;  2BV4 A;  1OPM A;  4QGN A;  2H6C A;  3HNY M;  4FFF A;  4B1M A;  3E97 A;  1VRH 1;  4RS5 A;  5EXO A;  1C1L A;  5FZC A;  4DY3 A;  3C7E A;  1MS9 A;  2W46 A;  5CVR A;  1OOP A;  3KD4 A;  3VDD A;  5C70 A;  5LRS A;  1MR5 A;  5DAW A;  2Y60 A;  3EMR A;  1MQT C;  3I2G A;  2YYO A;  4BIO A;  2DDU A;  5BYN A;  1VRH 2;  3NNF A;  5IW0 A;  3A22 A;  5FPU A;  3OGJ A;  1VB4 A;  1LNS A;  2YFZ A;  3M3I A;  5FFO C;  1LU2 A;  5K8S A;  4M00 A;  3ZFG B;  4QX0 A;  3KGZ A;  1XJA A;  5I8T A;  5DG1 A;  3WLU A;  4GIQ A;  1FYU A;  4E4D X;  3I2J A;  1YQ5 A;  5CKN A;  1NQJ A;  2VVE A;  4Y5S A;  5FZL A;  4RHV 2;  3TEZ A;  4QX1 A;  1LR5 A;  2JIC A;  2VM9 A;  1VMH A;  3HN3 A;  2UYB A;  1LCL A;  2HJI A;  1O4T A;  1VBD 3;  1J58 A;  1HXS 2;  3H8R A;  1HV1 A;  1E5S A;  3VKM A;  4JCK A;  2Y38 A;  3H8O A;  4GD4 A;  4UBH A;  2B8M A;  2VTX A;  4FAG A;  1ULG A;  1UU5 A;  4ZPI A;  5A3L A;  3KV5 A;  2BBV A;  1PK6 B;  4ZZ8 A;  1IG0 A;  4Q26 A;  4QMA A;  5FXZ A;  1UMH A;  3FLP A;  5A6Z A;  1W9T A;  1JZ4 A;  1BYH A;  3T0D A;  3MZH A;  1Y7B A;  5T5L A;  4BE3 A;  4OLL A;  1O3S A;  2Y64 A;  3ES4 A;  1GOG A;  3DPR B;  4AGR A;  1VBA 3;  2VUA A;  4JTN A;  5GM0 A;  1DQ4 A;  4Q4Y 1;  4G9S B;  1JYI A;  4MYE A;  2LRP A;  2VOW A;  3AB0 A;  1S0E A;  2VEC A;  4ORF A;  5CYY A;  2RJ2 A;  1DQ2 A;  3WCR A;  5CFC B;  5JSR A;  1C8N A;  2XHK A;  3KT1 A;  3T0A A;  4ITC A;  3T0B A;  3MYX A;  4XUP A;  1BVP 1;  2BNO A;  2J1V A;  3LE0 A;  1CAW A;  4DEV A;  5FZB A;  4FFG A;  1ZX5 A;  3OYW A;  1WGP A;  2XKP A;  3LEI A;  3VHN A;  4XHX A;  1MEC 1;  1JHJ A;  4FT8 A;  4DUW A;  2QJV A;  2QQN A;  3RWN A;  1AJK A;  2RM2 3;  1CWP A;  3LZZ A;  4AVC A;  1IS6 A;  1AR9 3;  2YBS A;  3JU9 A;  2HWE 1;  1YLL A;  4K3U A;  4EN0 A;  5C5T A;  2NP0 A;  1D0H A;  2E6V A;  3KGL A;  4PI0 A;  4D0Q A;  2B7Y A;  1ND3 C;  1DGW A;  3MIB A;  1NLQ A;  1OUR A;  1Z7S 2;  3OGG A;  2QQU A;  4LK6 A;  4HN1 A;  5IVY A;  5FDB A;  2BER A;  4HKL A;  4Y20 A;  1QEX A;  2E33 A;  3B94 A;  3HN1 A;  4XTM A;  4RSU A;  3ZYP A;  2X5I A;  2QQW A;  1L3J A;  3HBZ A;  4HBN A;  2VZQ A;  4CDW C;  4BH9 A;  5IAV A;  1KJL A;  3PMS A;  3I7D A;  1PGL 1;  2PQS A;  3GHN A;  2DVD A;  5DQ0 A;  3NV3 A;  3PTY A;  4LEJ A;  5A7Q A;  4FO9 A;  3SCG A;  3U14 A;  2VZS A;  4AI2 A;  4XDQ A;  3KQR A;  1UZV A;  4IGQ A;  4HAN A;  2PHR A;  3WNO A;  4XUT A;  1LOF C;  1R09 3;  2ADD A;  1BMV 1;  4CDU B;  1AJO A;  4JGZ C;  5L73 A;  3KVB A;  5L7O B;  4XJ9 A;  2UWA A;  2F4L A;  4ASM B;  1YCI A;  3LPF A;  3P5B A;  3I3M A;  3LAG A;  3RYR A;  4BPZ A;  2EAL A;  4QPW A;  1XQN A;  2HWD 1;  2WNO A;  4P9G A;  5FZ0 A;  5JXH A;  1LEM A;  1YI7 A;  5GZE A;  2EVX A;  4JZR A;  1TMF 2;  2JKB A;  3AVR A;  3TWI A;  5C4W A;  1EV1 2;  5JZG B;  3W59 A;  2W68 A;  3UKT A;  4RS5 C;  1IPS A;  2I74 A;  1CZV A;  3NVC A;  4P5H A;  5DZF A;  4YW3 A;  2R07 1;  5F3G A;  4GB3 3;  1GWK A;  4WV8 A;  3H8U A;  3PIJ A;  4B29 A;  1VRH 3;  1ZRE A;  1RXG A;  1YUD A;  1HKD A;  1W0N A;  3I2K A;  4XFG A;  5F3C A;  3SH4 A;  1JZ6 A;  2ZEX A;  1SDD B;  1AR9 2;  1LB2 A;  3THD A;  3MIH A;  1GNY A;  1W8Z A;  1NA1 C;  5JVV A;  1RYY A;  1COV 3;  4JAA A;  2ES3 A;  2Q0A A;  5FR3 A;  4Q4X 3;  4ZU4 A;  3ZIW A;  5K9Y A;  4XBN A;  1UZW A;  1AYN 3;  2WZE A;  2B42 B;  2WS9 1;  2R06 3;  3WDU A;  3L2Y A;  2TNF A;  2BP6 A;  2J1S A;  2YGM A;  1W03 A;  3S7E A;  1DGR N;  2ZAH A;  3JXS A;  4BA6 A;  2ZJC A;  3CHX A;  1DP0 A;  4RYD A;  2BZD A;  2W1U A;  3PU8 A;  3UJQ A;  2OS2 A;  2E32 A;  4K6B A;  5CFC C;  2VBD A;  2V4V A;  3WR0 A;  1UY4 A;  1NCR A;  4MSV A;  4F8A A;  1PO1 1;  3K4A A;  3NNJ A;  4XTP A;  3O0W A;  1EUU A;  3VBR A;  3WNN A;  3FWE A;  4J1W A;  1UY0 A;  3TNP B;  2WIN B;  1IS4 A;  2A6V A;  1QDO A;  4KL1 A;  1JOB A;  1Q3E A;  3KF5 A;  3S30 A;  3AJY A;  2DVG A;  1W05 A;  3ZFF A;  4AQT A;  4LOR A;  3K2O A;  4Q4X 2;  2DBN A;  3JB4 C;  5FZ8 A;  2NZ9 A;  3IN9 A;  4XJA A;  5JZG C;  1SFN A;  4Z8B A;  1WMF A;  3UNP A;  2QDR A;  3FHQ A;  1UOF A;  4FI9 A;  1N3P A;  1UYX A;  3CJI B;  2Y6K A;  1LHW A;  5A70 A;  5ACA 2;  4V1P A;  2R04 2;  4XMI A;  5FZ1 A;  2A1X A;  4LQR A;  4XPV A;  4EE2 A;  2H0V A;  1IGO A;  2RMU 3;  3NKG A;  3VBS B;  5ANQ A;  3U1X A;  3ZYI B;  1ENS A;  5DDJ 1;  3LA2 A;  2K9Z A;  4NE9 A;  3NNL A;  4QM9 A;  4LBQ A;  2GC0 A;  1FNZ A;  3MI8 A;  5EYX A;  1OQ1 A;  3W5N A;  1U0A A;  4IET A;  4QQ2 A;  5FMD A;  1J3R A;  4XIO A;  3D8C A;  1O6U A;  4ZS2 A;  1X7N A;  2ETE A;  2OW4 A;  4C0B A;  1K5M A;  4Y22 A;  2IXL A;  5JOW A;  3S0M A;  5GLU A;  1KFX L;  5IK8 A;  5BNN A;  1X33 A;  5A32 A;  4TTG A;  1Q8V A;  1M4W A;  4JGY A;  5FTT C;  4GH4 A;  1ENQ A;  2ZTN A;  5JZG A;  1C8M 2;  3BOP A;  5K0U C;  1H2N A;  2A6W A;  1V6O A;  3N9L A;  3OBA A;  5KR7 A;  5JXG A;  3WDX A;  4ARX A;  1IQA A;  3ACI A;  2ZCW A;  2W1S A;  3OUI A;  3K77 A;  2NYY A;  3UJO A;  3FMG A;  1XE0 A;  2ENR A;  1ASJ 1;  3EO6 A;  5FY1 A;  5H9S A;  2AR6 A;  1RUC 1;  5BNN C;  3D6E A;  3N7K A;  5C5U A;  1O3T A;  1UN1 A;  1VMJ A;  5FRE A;  5LB6 A;  4DB5 A;  1Z78 A;  1SFY A;  4LIU A;  4MX3 A;  1W2T A;  1TG7 A;  4AGG A;  1B35 A;  2QQK A;  4CE8 A;  1GAN A;  5E8A A;  3ELN A;  4PJY A;  2QQP A;  5IVJ A;  2VNV A;  2XJR A;  4BLI A;  3ZXA C;  3HJR A;  1ACC A;  4YYO A;  5AC9 1;  1SMV A;  3H7J A;  3AFK A;  3AYC A;  3ZYH A;  3QCW A;  4CUA A;  4OVE A;  1AYM 2;  1AYM 3;  1ASJ 2;  3CNA A;  3PHM A;  2WL1 A;  4LLO A;  2XML A;  3PNA A;  4AW7 A;  2WSV A;  1GNZ A;  4C91 A;  1J83 A;  5I0S A;  3KWV A;  2LRO A;  4IV1 C;  2ZMK A;  1CJP A;  5FUI A;  3TEY A;  1VBB 2;  2UWC A;  2WSU A;  1CD3 G;  2A73 B;  1SLT A;  5E89 A;  5DUW A;  1AXZ A;  1KDM A;  5KHH A;  2OA2 A;  3DKW A;  3Q8A A;  3H8X A;  5GLV A;  4E9K A;  3CZJ A;  4UFH A;  5DAX A;  3I3B A;  3WUC A;  2WAA A;  5IK5 A;  4QXK A;  1WCD J;  2JE8 A;  2VMF A;  4MXV A;  1FOD 1;  4MGZ E;  4JTO A;  3E6C C;  2F4P A;  3NW4 A;  1RUG 2;  4HK8 A;  4YG0 A;  3ZN5 A;  1AX2 A;  2JG8 C;  4OFG A;  1ZBA 3;  2JDP A;  2E51 A;  1RUF 2;  2PHF A;  4BQX A;  4JRA A;  4IGO A;  1YNA A;  5GKA C;  1EUT A;  3VBF A;  2YY1 A;  5BY5 A;  1G9B A;  4HKW A;  1UY3 A;  4P00 B;  4AAX A;  3T2Q A;  2JWP A;  5F32 A;  5F5Q A;  2HWF 2;  1LHO A;  3QOP A;  1WA6 X;  4HG6 B;  3IZO A;  2XUM A;  3CDZ B;  3ENR A;  3MO4 A;  1Q8O A;  4NMI A;  1Y9M A;  4PF1 A;  4YGE A;  1RUO A;  3LSD A;  4RD7 A;  2BWA A;  2RR1 1;  1FAT A;  1W3X A;  2PHX A;  2QE3 A;  3BVC A;  5GAL A;  4AEJ A;  2ORX A;  4EV0 A;  5A33 B;  3NL1 A;  3WF4 A;  3WNM A;  2VZ1 A;  3POW A;  5JIU A;  1EAH 3;  1QHD A;  5A3T A;  3LEK A;  4WM7 B;  4BU2 A;  5L7O C;  5ACA 3;  3WSO A;  1P8J A;  1QJX 1;  2XL7 A;  4AHX A;  1OHF A;  3AZY A;  2OUH A;  3WQ1 A;  4CXY A;  4X8N A;  2FMY A;  5LAT A;  1FPN 1;  2EXK A;  2J22 A;  3HNM A;  2WQ4 A;  4XF4 A;  2YU2 A;  4AED A;  3I2D A;  3VZK A;  3U4S A;  4JKM A;  4BJ0 A;  4OI4 A;  2H0B A;  1VR3 A;  4ZU5 A;  1SPP A;  2Q8C A;  3N9P A;  3AXE A;  4XQW A;  1UZZ A;  1JYV A;  4N8M A;  4QM8 A;  1W6Q B;  5K0U A;  3WNX A;  5SV8 A;  1JYN A;  3U4X A;  2XJQ A;  3K4Z A;  2WS9 2;  3RZH A;  3NJZ A;  3GBW A;  4OUL A;  1KS5 A;  4AVS A;  2Z4F A;  2BGO A;  3A4U A;  1CQ9 A;  4QX8 A;  2XHN A;  3S5Q A;  4WM8 A;  3ZDS A;  2NMO A;  3LSE A;  4XC9 A;  1ZZ8 A;  4PI2 A;  1VE0 A;  4URA A;  3ZSL A;  1QJU 1;  1OUX A;  2E31 A;  2CTV A;  4GH4 B;  4BIS A;  3RJR A;  3H3U A;  4LXL A;  2UUR A;  4IE7 A;  2J1A A;  3AMQ A;  1YI9 A;  3BCW A;  5KHI A;  3SLI A;  1FNY A;  2W52 A;  2ARB A;  4QPG B;  4AQ2 A;  1OF4 A;  1VAK A;  3VHR A;  1H9W A;  1N47 A;  1UKG A;  4ISR A;  2UY9 A;  4GKX A;  2QQI A;  3VDC A;  3NST A;  2PLV 2;  1DGR A;  3ZYJ B;  1PO2 3;  1WME A;  4LO4 B;  3PUA A;  1W6P B;  1WW4 A;  3NJV A;  4I0A A;  2EIG A;  4FQZ A;  5JOZ A;  1C4R A;  2R1D A;  1BMV 2;  2WA3 A;  3FN9 A;  4CDQ B;  5FMC A;  3ZFE C;  5K0U B;  2AGS A;  4UW5 A;  4COU A;  3OD0 A;  4NN0 A;  4KH9 A;  3RGB A;  5HI0 A;  2EXJ A;  4JDO A;  4Q4Y 3;  2C6S A;  1G6N A;  2R49 A;  2R32 A;  5T5P A;  2YRO A;  4GQ7 A;  3RZJ A;  5ERL A;  3I2H A;  4W65 A;  3J4U H;  2D6K A;  1JZ3 A;  1PZ7 A;  4YZ2 A;  2J1T A;  2QQV A;  1OXC A;  1UOB A;  3RZM A;  4NID A;  3WOG A;  1NCR C;  2WNV B;  4FTE A;  3DXT A;  2IUW A;  4QT6 A;  4QPI B;  2YUE A;  1H1M A;  3A0N A;  1ZZC A;  2DBI A;  2EAK A;  4JGZ A;  5CNA A;  2BJS A;  1QJU 2;  3IAQ A;  3K3N A;  5I0D A;  5FLJ A;  4YZ1 A;  4HK9 A;  3FX3 A;  5LBC A;  1NZC A;  2JX9 A;  4F83 A;  4DO0 A;  3FUO A;  2XBO 1;  1NOV A;  3C3V A;  4KBB A;  4Q0P A;  1QJZ A;  2XWB B;  2WT1 A;  3RI9 A;  5C3P A;  2PTM A;  4HMZ A;  1UXX X;  4AVB A;  3WXP A;  5F5C A;  4ATF A;  3HVD A;  4LR4 A;  3S57 A;  1R09 1;  4DFS A;  5LA0 A;  1QOO A;  1CAW B;  1DCS A;  3OJB A;  2O0O A;  1MQT A;  1V6M A;  5I0T A;  4A41 A;  1XYN A;  2XVK A;  3JZV A;  4MG2 A;  3VBF B;  1YC6 1;  2JXA A;  3DXU A;  2QQM A;  2SBA A;  3FC0 A;  3O1M A;  2XJV A;  1A3K A;  4ES9 A;  2BDR A;  4A2U A;  4CDX A;  3RNS A;  4KGQ A;  3ZYF A;  1EAH 1;  5FCC A;  5FQ0 B;  3FHA A;  1H1A A;  1WD3 A;  1A34 A;  5IYY A;  4CCC A;  3WQB A;  1XNA A;  4XMA A;  1FX5 A;  3B7M A;  3N9N A;  4FBF A;  1VBC 3;  1DYK A;  5I8S A;  3I3E A;  4GKY A;  4EN7 B;  4XAA A;  4RFT 0;  5I0R A;  1W6O A;  5FY4 A;  3EQE A;  1X36 A;  1GP6 A;  2JDU A;  3VBR C;  1NY7 1;  3AZZ A;  5A3M A;  2NLR A;  2RS5 1;  2VW1 A;  4AVT A;  4BCU A;  1IHM A;  1H6X A;  3FLR A;  3ZSM A;  1PMI A;  4H7L A;  4IXL A;  4M3C B;  4BQ4 A;  3WNP A;  2BEO A;  1DQ1 A;  1RJ8 A;  2WNU B;  3ETQ A;  1LU1 A;  5LY2 A;  1GV9 A;  1KRI A;  2W1W A;  3OG2 A;  5D21 A;  2D3P A;  4G3Y C;  4WM8 C;  1VLN A;  4D69 A;  1CIW A;  5KXB A;  2XH6 A;  1D0G A;  2VZ3 A;  1ND3 B;  2PHL A;  2GH2 A;  2HWC 2;  4FTB A;  3KM5 A;  1BCX A;  3AKQ A;  1WLT A;  3TNQ A;  1RUC 2;  2ZX1 A;  5EJ3 A;  5FZ3 A;  1B35 B;  2BVV A;  3MGU A;  4M3C E;  3BPS A;  1LOB A;  4AFA A;  4CCM A;  3JD7 2;  1HRI 2;  5AVA A;  3MW2 A;  2E9Q A;  2Q8D A;  4PIZ A;  1VBC 1;  1PIV 3;  3I59 A;  3P6B A;  1OH3 A;  4B7E A;  3RDI A;  4OQ9 A;  2Z42 A;  1W0P A;  2QDN A;  5FZO B;  4CUC A;  1HDK A;  2R07 3;  1RUH 1;  3ASI A;  3CU7 A;  4DZG A;  4MUV A;  1JYT A;  2Z69 A;  3OSD A;  1YFY A;  3W20 A;  1DU3 D;  4JC1 A;  4D7Y A;  2YDE A;  1WWY A;  3BGA A;  3VZJ A;  1KXG A;  3JQW A;  3A21 A;  4LT5 A;  2FMD A;  4JGY B;  5F1R A;  1PVC 3;  1VAV A;  3LIG A;  4DXT A;  5BPX A;  5BNN B;  2VW0 A;  1UQX A;  3LDR A;  3RVH A;  3N9O A;  3AL5 A;  3MF6 A;  4JKK A;  4NRQ A;  4XUN A;  4ET7 A;  1F2N A;  4XJ8 A;  5FXV A;  2RMU 1;  2YU1 A;  4CZS A;  2ARA A;  3FE5 A;  2WQZ C;  2RJK A;  1J1T A;  4LOS A;  4F3J A;  4RR3 A;  3HAG A;  3T2O A;  2G1M A;  1RVF 2;  4LBL A;  4XUO A;  2Z2S B;  2GH8 A;  1EYB A;  3OBZ A;  3POS A;  4N9H A;  4Y26 A;  5JOY A;  5ACA 1;  1F8V A;  2D6M A;  1UF2 C;  3TN9 3;  3VD7 A;  3RZL A;  1NYW A;  4PBO A;  5C3O A;  3VBS A;  3KT7 A;  1I1E A;  2VOX A;  1A8D A;  1O7F A;  1I3H A;  4QB1 A;  1XE8 A;  2JG9 B;  5LBE A;  3HQX A;  1HJF A;  3OCP A;  2XJP A;  1F5F A;  2DUO A;  2W0X A;  2VO5 A;  5ABJ A;  2RHP A;  4B4P A;  4V2V A;  1AR8 3;  3G7D A;  1OA4 A;  2R30 A;  4KQ7 A;  4YW2 A;  1OUS A;  2R0F A;  5D1I A;  5EP9 A;  1ND3 A;  4TLG A;  3TRS B;  3I8T A;  3VKL A;  2VME A;  4FSJ A;  1DYP A;  3MFA A;  4E4H A;  3FUQ A;  1GQG A;  1RED A;  3DEM A;  3J7N A;  2VXJ A;  1QQP 1;  4HON A;  3AVS A;  3WP6 A;  3ZX7 A;  4CEW B;  2WNU C;  2R04 1;  2OUJ A;  1O8P A;  4P9W A;  2VBB A;  1BJQ A;  1GOF A;  1AR6 3;  4LHL A;  5FBZ A;  2Q4S A;  4FPH A;  4AED C;  4CCL A;  4UFK A;  2DWR A;  2VGD A;  2FCV A;  4MLO A;  3PVO A;  1TMF 3;  4GUL A;  4I30 A;  1AL2 2;  1FXZ A;  4XET A;  2VCA A;  2PFW A;  1OLR A;  2X29 A;  4M3C F;  1D7P M;  1W6O B;  5D8A C;  2W2I A;  3ZOI A;  1W8N A;  2NMN A;  1Q8S A;  2ZML A;  5CAZ A;  3H3L A;  2Y33 A;  3PUR A;  4IEQ A;  4IEZ A;  4HZF A;  1XC6 A;  1CON A;  4GAL A;  1W6M B;  3CJI C;  4Q5O A;  3D0S A;  4BK4 A;  4E2G A;  3LIH A;  2CGO A;  2ZX3 A;  5HCA A;  2D3S A;  1W9F A;  1Z7S 1;  1W8H A;  2YGL A;  2Z79 A;  5BNO A;  1HN0 A;  5C9A C;  2KM2 A;  1SAC A;  3RZZ A;  3ZFF C;  3OBR A;  1WMD A;  3WV6 A;  2RDR A;  1US2 A;  5KC5 A;  1SBF A;  4X8P A;  5KXE A;  4S2G A;  3N7M A;  5JAX A;  5FPL A;  5C4W B;  5FPX A;  5F37 A;  2WAO A;  3B9I A;  4LIV A;  5EV7 A;  1MVQ A;  3J8F 2;  4NRP A;  4CP9 B;  2H6B A;  3NAP A;  1Z7S 3;  2HEY F;  4GZ9 A;  4MGQ A;  2VE1 A;  4DRV A;  1R08 1;  3RYP A;  1HB3 A;  1LTE A;  5T52 A;  1DYO A;  3VHO A;  2HWB 1;  2OYZ A;  4P9I A;  5JCT A;  2AEY A;  2JDN A;  2RVA A;  1S0C A;  3BUC A;  2RV9 A;  4WVV A;  3OPT A;  3VBO C;  5L36 A;  2Z5W A;  1LGB A;  2ZHM A;  5A80 A;  1VBE 2;  4BME A;  5F6L B;  2RR1 3;  2VQ0 A;  5HCH A;  3ILN A;  4NPM A;  4YFW A;  4BZ4 A;  2WBK A;  3NKT A;  4JHT A;  2IZW A;  3MIC A;  2NPI A;  4QWN A;  4GMP 1;  3HBK A;  4EQV A;  3BTZ A;  1HXS 1;  4H2A A;  1VMF A;  1CX1 A;  3ACF A;  2PHW A;  4X6Q B;  2HWE 2;  4NWV A;  5CU1 A;  1NQD A;  4NHL A;  3K48 A;  3VD9 A;  3BAL A;  1LHV A;  1KEX A;  3CEW A;  1MEC 3;  2J1U A;  5FZA A;  3ZMO A;  1T6G C;  2TEP A;  4CCE A;  5L19 A;  3HNB M;  3FL7 A;  1ST8 A;  1FOD 2;  4GWJ A;  1AUY A;  4XFB A;  4YG6 A;  3I3D A;  2PXJ A;  3N9M A;  4XFF A;  2FD8 A;  4S2H A;  1LOA A;  3WQ7 A;  1MZE A;  4XIL A;  4AI0 A;  1HXS 3;  4X6R B;  2P3Y A;  1W2A X;  3WY6 A;  2WYF A;  1OPO A;  2KA3 A;  1IG3 A;  4FP2 A;  3KLS A;  2DVA A;  2OII A;  3USU A;  2EIB A;  4KWK A;  4Y5T A;  5HCF A;  1JMU B;  3TAY A;  1YIP A;  3T2T A;  3VUO A;  2R1B A;  2E7T A;  4YWA A;  3E5Q A;  5A6Q A;  2PHD A;  5JSO A;  3POE A;  3I54 A;  4FFH A;  1CGP A;  2EA7 A;  4K1Z A;  4NIG A;  5IVF A;  4J25 A;  4A42 A;  3I59 B;  3LEG A;  3TBD A;  4LTA A;  1VBD 1;  1XOY A;  1R08 2;  4MV2 A;  3LDK A;  1K5M C;  3VZO A;  3BYW A;  1AX0 A;  4P14 A;  2DU1 A;  2WAB A;  2X5I C;  4H55 A;  4RHV 1;  1YRZ A;  2DTY A;  1S2K A;  2BVB A;  4FOW A;  4W6X A;  4QPG C;  4FFI A;  5EFU A;  3GXU A;  5C9A B;  3BTY A;  3MIF A;  3GZA A;  5JXI A;  2FHR A;  1N3Q A;  1CX4 A;  2XBO 2;  3JBG 3;  3KV4 A;  3UET A;  4TZD A;  3AYE A;  3ILR A;  1H0B A;  2WZ8 A;  4IV1 B;  1BVV A;  2XB6 C;  1VBA 1;  4NAO A;  3HMY A;  3W5M A;  3M70 A;  3MV1 1;  1PHM A;  1O91 A;  2GME A;  4Y1U A;  3WF1 A;  5J7M A;  1RXF A;  2YBP A;  4ZKT B;  2G19 A;  5FUN A;  3INA A;  1ZRF A;  3F2Z A;  2RDQ A;  1GOH A;  2ZS6 B;  2VG9 A;  5A33 A;  2I45 A;  1NX9 A;  2G9Z A;  4R4X A;  5C8C A;  2CV6 A;  3KF3 A;  3VD4 A;  2XGX A;  3HIF A;  4HPK B;  1W2O A;  1V6N A;  5FP4 A;  2B5H A;  4LNV A;  2GP3 A;  4Z2A A;  3BN6 A;  3GZE A;  4DIQ A;  4GA9 A;  5FMO L;  2BYV E;  3LA7 A;  3PUH A;  5FWE A;  4PT6 A;  1J1L A;  1D2S A;  3AYA A;  1YFW A;  3OPW A;  5KHJ A;  1GLH A;  3NQH A;  3C7G A;  3DN7 A;  2ZOE B;  5DAQ A;  3PDQ A;  4NHK A;  4CDU C;  4E4S A;  1VAM A;  5APA A;  1XU1 A;  3A23 A;  4TWT A;  1JN2 P;  3A7Q A;  3DYO A;  4YM1 A;  1PMH X;  2LUW A;  4XAB A;  5EYY A;  3UL2 A;  4ARY A;  2R16 A;  1JZ2 A;  1HRV 3;  1C5H A;  2HBU A;  5LEK A;  1H8T C;  4ZON A;  4UFL A;  1AF9 A;  3APB A;  5FZD A;  5FPZ A;  2JIJ A;  1TNF A;  3J8F 3;  3BU7 A;  5CFD C;  2ZGU A;  1VB2 A;  3WT3 A;  1QGL A;  5JWP A;  1OLQ A;  4K8R B;  1GQH A;  2GP5 A;  1DQ0 A;  2XVG A;  1X8M A;  1QXR A;  3IIA A;  1QWR A;  4YVW A;  5HBA A;  1DHK B;  1OKQ A;  1R1A 1;  2EIC A;  4CCJ A;  2A3W A;  4QDR A;  3VBU A;  1CN1 A;  5DAP A;  2X53 S;  3ZPY A;  4LBQ D;  3ZXG A;  4FPJ A;  3POJ A;  4D7S A;  2WFF 3;  4AEK A;  1F35 A;  4OUE A;  1UU4 A;  3BTX A;  2A3Y A;  5FZ6 A;  2CGP A;  2RDS A;  2VAU A;  1LKN A;  3EHK A;  3D4K A;  3DKQ A;  5AC9 3;  1ENR A;  3GJA A;  3ETP A;  2W94 A;  2C26 A;  1H6Y A;  3AM2 A;  4I3G A;  4LBK A;  3WHU A;  3LF7 A;  3ZXK A;  5C7G A;  5GLT A;  4FP3 A;  4ZY9 A;  1NLS A;  1W9Y A;  2VC9 A;  3PLQ A;  4KG0 A;  4L9B A;  2CY6 A;  1ZRC A;  4CDW B;  4HXC A;  5H9Q A;  3B01 A;  2K2S A;  1RUJ 1;  1JXN A;  5FPB A;  4O9G A;  4CSW A;  5JXJ A;  3C7H A;  2P3K A;  2D5F A;  3SQO A;  3ZYG A;  1N3O A;  1W8U A;  4IEO A;  4BQW A;  3NJX A;  1SDW A;  2W08 A;  1GKB A;  2X10 A;  4G4F A;  1RMU 3;  2VTX J;  5IVC A;  4DXR A;  1QJE A;  4Q1P A;  1HRV 2;  1LGN A;  2GNB A;  3R4D B;  1HV0 A;  4AGV A;  1H8T A;  2G4I A;  3WDV A;  4N43 C;  5IT6 A;  2ZGN A;  3V0A B;  1LAJ A;  5A32 B;  4QPG A;  4M4P A;  5DAB A;  4ISQ A;  1GQP A;  3JD7 1;  2XLA A;  1IZ3 A;  3U0Z A;  3CQO A;  3ON7 A;  2GN3 A;  2VMG A;  1V00 A;  4MXW B;  1UYZ A;  2A3X A;  3JCI A;  3CF6 E;  5LK5 A;  4M0N A;  1PNG A;  2ZGM A;  1RUD 3;  1ZRD A;  2HWD 3;  2K46 A;  4GH4 C;  4W4Z A;  1QXJ A;  2RS1 1;  4BXS V;  2PEL A;  2VW2 A;  3DPR A;  5FYU A;  2MHF A;  1SCS A;  2WO1 A;  4K8F A;  4CUG A;  4UOJ A;  5J1X A;  4QQH A;  1HRI 1;  4OI1 A;  2JB8 A;  4Q0V A;  3P3N A;  3KT4 A;  3FJS A;  3POG A;  4LLF A;  3E6B A;  2WKK A;  1ZNP A;  4XF3 A;  5G04 L;  3O1R A;  4AFM A;  3DYP A;  1RUD 2;  4FPF A;  2WT2 A;  1FI2 A;  1JW6 A;  3AZV A;  3OF1 A;  1DDL A;  1ZZB A;  3IPV B;  3AYD A;  4NIH A;  1QMJ A;  1V9U 3;  1W06 A;  2E7Q A;  1UCX A;  1VRB A;  3ACL A;  2WN2 A;  3W58 A;  2JEN A;  1W28 A;  2Q1F A;  1WW6 A;  2VQU A;  2WNE A;  2WLQ A;  4JQT A;  4UFM A;  3RG0 A;  3MUZ 1;  1AR7 3;  2RE9 A;  1LOE A;  3M8L A;  1HJG A;  5D8A A;  3WCS A;  3GGL A;  5CA6 A;  4O65 A;  1AYM 1;  1WA4 A;  2V5D A;  1NE4 A;  4XHB A;  4Y33 A;  1OF3 A;  1A8M A;  2IXI A;  1RC6 A;  4CCK A;  4XVH A;  4XJW A;  3UKV A;  1T6B X;  4P02 B;  3H42 B;  5G05 L;  1JU3 A;  4FXK B;  4CPB A;  2D5H A;  2RS3 2;  1W9S A;  2BU9 A;  1DZQ A;  4LKS A;  2W9X A;  1NCR B;  2WNV C;  4M4R A;  4WVM A;  4XBQ A;  1RHI 3;  4XF0 A;  2DUQ A;  3VL8 A;  4NO4 A;  2XPJ A;  3RI8 A;  2MEV 1;  5DXD A;  4ATE A;  4A44 A;  4BQY A;  4FPL A;  4L2N A;  1VBE 1;  5FZ4 A;  3LGR A;  4MHU A;  4AYU A;  4BDV B;  1K42 A;  1ZM1 A;  1RUC 3;  5FUP A;  1E57 A;  3KCY A;  3KV9 A;  2OZ6 A;  1Q56 A;  2OQ6 A;  5HCB A;  2RS5 3;  1XYO A;  3H1Y A;  5SV5 A;  4I09 A;  2JD9 A;  3WDY A;  1CZS A;  3GF6 A;  3WG2 A;  5C3S A;  3ZMN A;  4HVQ A;  3QD6 A;  5FQ0 A;  2ZGS A;  5CIS A;  1XNC A;  2JDZ A;  4IES A;  3WZ1 A;  3MPB A;  1POQ A;  2DCZ A;  4XIK A;  1OLM A;  2Y0O A;  1J84 A;  4XUR A;  3VBS C;  2RS1 2;  2XWJ B;  1RUI 1;  1ZBE 1;  2JDY A;  1APN A;  4XF1 A;  1SFP A;  4EN9 B;  1H4H A;  5JMO A;  2J42 A;  2YV8 A;  3DEC A;  1W8O A;  4KWU A;  2XLG A;  5HV4 A;  2GMP A;  2BFU L;  2ARX A;  5T54 A;  2Y0I A;  4YGB A;  1REF A;  2VOV A;  1NCQ B;  4CP0 A;  3NO8 A;  3PJQ A;  2GC1 A;  5LEJ A;  3MW3 A;  5C3R A;  5CEH A;  4YVS B;  1RUJ 3;  3O14 A;  3K51 A;  2A5Z A;  2RS1 3;  5IUQ A;  1C3H A;  4A3Z A;  1VBE 3;  4BM8 A;  4N7U A;  3SIS A;  4DS0 A;  1NT0 A;  2ET7 A;  4EYU A;  2VMD A;  4HN0 A;  2BFU S;  4JKL A;  2JG8 B;  5EZW A;  1W8F A;  1UO9 A;  3MIG A;  1WLD A;  1ZRR A;  2QVS B;  4IEU A;  4QKD A;  1N1T A;  2ZGL A;  4HVO A;  2RS5 2;  3BU0 A;  1QNW A;  2LM3 A;  3FZ3 A;  4GWM A;  4E2Q A;  4V2W A;  2IFW A;  3MHZ A;  3NWK A;  3WG3 A;  2ZGO A;  4Y4Y A;  4BXF A;  3TEW A;  1H30 A;  1PIV 1;  1Q5O A;  2JKX A;  3VV1 A;  4Q0Q A;  4C8D A;  5C8W A;  1HB2 A;  2JB4 A;  2ZHL A;  1CAX A;  2WDB A;  1RL3 A;  4QXB A;  1MS3 A;  3IDC B;  3M3E A;  3HWJ A;  2PA7 A;  4N43 B;  4Y1X A;  2K0G A;  4NHX A;  3DL3 A;  4KU8 A;  4TN7 A;  3AMP A;  1UMZ A;  4CP9 A;  5IVV A;  4EZH A;  1RIN A;  2Y8K A;  4E8C A;  1BBT 3;  5BNO C;  1NCQ A;  3GCX A;  3H9A A;  5FZM A;  4TXW A;  3VKO A;  4KMQ A;  4CEY C;  3UKN A;  4K20 A;  1U12 A;  4JDN A;  1RHI 1;  5ANN A;  1R1A 2;  2WWJ A;  2V4A A;  1DQ5 A;  3Q8B A;  1OVS A;  4MGI E;  5DPN A;  4K9S A;  1UPS A;  5CFC A;  1NUK A;  2C1F A;  2R0H A;  2YZ4 A;  1YYN A;  1RUH 2;  1AR8 1;  3R05 A;  5FIX A;  4KNC A;  3BOD A;  2WO7 A;  1H2L A;  2EIE A;  3KCX A;  2OT7 A;  2P17 A;  1FPN 3;  3USS A;  3FHI B;  2QQO A;  3PUS A;  3K4D A;  3DPR C;  2VCM A;  1QJX 2;  1VP6 A;  1Z0H A;  2D93 A;  2ID4 A;  4HSL A;  5FZ7 A;  3VD3 A;  4CUB A;  2X09 A;  2W87 A;  4CYD A;  1XPW A;  1HQN A;  1U5I A;  3MF9 A;  4XXA A;  3VBO A;  1DLL A;  4XUQ A;  3O1S A;  3DF0 A;  5K4L A;  3RS6 A;  4C0H A;  3NV4 A;  2HWC 1;  4DY5 A;  1BK1 A;  4RA0 A;  4BQ5 A;  2O14 A;  1ZBE 2;  2YB7 A;  2R7E B;  2YPD A;  3ZXL A;  3WG1 A;  4NOT A;  1JYW A;  1DZR A;  1YHF A;  4DQA A;  1NE6 A;  4RQP B;  4NUB A;  5A1F A;  3OUJ A;  2UWB A;  1ENX A;  5A6X A;  1FV3 A;  3C7O A;  5FYZ A;  1ND2 B;  4CXW A;  3V65 A;  3W9A A;  1Q8P A;  1ZZ6 A;  4N53 C;  1SLC A;  1ULF A;  3AP5 A;  2HH9 A;  3MLL A;  1W99 A;  1SCR A;  1Y4W A;  2HEW F;  4FOQ A;  3ZFG A;  1FT9 A;  1UXZ A;  5F3E A;  4LO5 B;  4P9J A;  2DFC A;  3BIW E;  4QU1 A;  4YNI A;  4Z92 B;  3DUI A;  5DZE A;  2OXB A;  1C28 A;  5A6Y A;  1JU4 A;  1RIR A;  5DG2 A;  4QB2 A;  3PUQ A;  3AZX A;  5EWS A;  1I6X A;  3RPQ A;  4H14 A;  1IKP A;  4HL0 A;  2AEZ A;  3B69 A;  3N35 A;  4AG4 A;  2B46 X;  3MIE A;  5DAV A;  3SIT A;  5AC9 2;  1F5J A;  3LOB A;  4D6R A;  1MS1 A;  3T3Y A;  2DCY A;  4DXS A;  1MS8 A;  5DZG A;  1RVF 1;  1S1A A;  1OQD A;  1TME 2;  4AEM A;  5HPO A;  2VY0 A;  4P9L A;  2FZ2 A;  1YO8 A;  1PGW 2;  3G6J B;  4I02 A;  4MXW A;  1OH4 A;  3LD8 A;  5C4W C;  1JBC A;  1GWL A;  2IC1 A;  4GWN A;  2XVL A;  5KHK A;  2BGP A;  3CO2 A;  1VBB 1;  4HVR A;  4CEY B;  3WNL A;  1NXM A;  1UZ0 A;  3V0A A;  3I3Q A;  1D4V B;  1FMD 3;  3HQR A;  3LEM A;  1D4M 1;  1B09 A;  3VHP A;  3RZG A;  4GMP 3;  2BOJ A;  2DVB A;  4XEZ A;  2PHT A;  2W47 A;  2VR4 A;  4GWI A;  2Q5T A;  2VOK A;  4XAC A;  4YAR A;  4Z1V A;  1AVB A;  1V9U 2;  2FCT A;  1ZBA 2;  4DMI A;  2WWU A;  1W04 A;  1PGW 1;  1R1A 3;  3BPZ A;  3SHR A;  5FBJ A;  1NCQ C;  4UFI A;  3SMH A;  2W1Q A;  1F9K A;  1UY2 A;  3TN9 1;  4QQL A;  1PK6 C;  2HWB 3;  4HOO A;  4XJZ A;  1GZC A;  4E4Z A;  5LZ6 A;  1JYX A;  4E27 A;  2I2S A;  1ZZ7 A;  1MZ6 A;  1YWK A;  2C4X A;  1KIT A;  2JDM A;  1ZA7 A;  3T4V A;  5IK7 A;  3ZLI A;  1WW7 A;  3H7Y A;  4Q4W 2;  4CRQ A;  1GWM A;  4XFA A;  1PX3 A;  2JG8 A;  2LTN A;  3N7L A;  2B39 A;  3AMN A;  2ZXQ A;  3AMH A;  4JX0 A;  4NJ4 A;  4Z07 A;  4PHZ A;  5JR7 B;  4BQ2 A;  4YW4 A;  1LOG A;  1US3 A;  1W8W A;  2CHH A;  5EQU A;  5IAT A;  1IS5 A;  5FMO S;  4XE9 A;  5FMB A;  1OD5 A;  2ERF A;  2ZGT A;  3RRD A;  4XZU G;  3MID A;  4UT5 A;  4QQP A;  3WEZ A;  4IGP A;  2ZX4 A;  2IXK A;  1ASJ 3;  1X9P A;  1IPJ A;  2IXC A;  4QGM A;  3WP3 A;  5FYM A;  2VOT A;  1LOC A;  1S0D A;  3OYW B;  5LY1 A;  3GJB A;  4AXO A;  3MW4 A;  4IEY A;  4UF0 B;  4BOW A;  4IND A;  1ZBE 3;  2ZHK A;  2QUO A;  1W0O A;  2Y26 A;  2XKO A;  4AI1 A;  4EJR A;  5CAD A;  4BMB A;  2JDH A;  4EWE A;  5BNO B;  1DZT A;  4UXA A;  3U78 A;  1RUI 3;  2UU8 A;  4AI9 A;  4DPN A;  1GUI A;  4IE5 A;  1PO1 2;  5JI7 A;  4WM7 C;  5A3W A;  1UU6 A;  2WZR 2;  3ABZ A;  4DIN B;  2IVJ A;  4OYU A;  3OY8 A;  3KV6 A;  1Y43 B;  3QAC A;  2FZ1 A;  3B02 A;  1HW5 A;  2XQX A;  4C90 A;  2CGN A;  2XLF A;  1FMD 1;  4MAD A;  1TME 3;  5KBF A;  2OQ7 A;  3CJI A;  1W6Q A;  5FZI A;  3SXW A;  1LHU A;  1W39 A;  3H3Z A;  1H9P A;  4WVM B;  3FBY A;  1GP4 A;  2CWM A;  2PN5 A;  4IUG A;  2X8K A;  5FAX A;  1PGS A;  3H0O A;  3K75 B;  3NNM A;  3E6D A;  4QGL A;  4QAW A;  5FV3 A;  3KZ4 C;  1AL0 G;  2D44 A;  3AKR A;  4AED B;  2CYF A;  4KWL A;  4ES8 A;  1OBN A;  2QCS B;  2ILM A;  2ET1 A;  3WG4 A;  2VD7 A;  4CCN A;  3III A;  2WJS A;  5A7S A;  5D8A B;  4ZHN A;  2WNV A;  5CZK A;  3HR9 A;  5KXD A;  1NKG A;  1RHI 2;  4HFS A;  3I4I A;  2R07 2;  4YFZ A;  3M4F A;  5DN2 A;  1CES A;  3OTF A;  1OOP B;  2VMI A;  4COV A;  3ZN4 A;  3UYJ A;  4AZZ A;  2GNM A;  4LE3 A;  4ZS3 A;  1WD4 A;  2Q30 A;  4IV3 B;  1HRI 3;  3LQC A;  3PTR B;  1WBF A;  4LHK A;  3PME A;  1KGY A;  3IT8 A;  4XFH A;  5A1L A;  1M06 G;  2WWS A;  4AK3 A;  4A4A A;  5JPM B;  2VZP A;  5LAS A;  1EV1 1;  2YC2 A;  2WO3 A;  4BQ3 A;  4PLO A;  1CJD A;  1TE1 B;  3MFC A;  3SNM A;  4XOG A;  4P5Y A;  3JQX A;  5A7N A;  2CNA A;  4XDO A;  5LRR A;  5CKM A;  1OFS A;  5FO7 B;  1X8E A;  3GAL A;  3ACG A;  2BOI A;  4EN8 B;  4LOT A;  5J96 B;  1MAC A;  2ORZ A;  3C8X A;  4E2S A;  1LJ7 A;  4UF0 A;  5IK4 A;  1COV 1;  1DG6 A;  1GP5 A;  1HQL A;  2DYC A;  4LBN A;  4IQP A;  2FDF A;  1C5I A;  2ZKN A;  1OD3 A;  1SLA A;  1O4Z A;  2V72 A;  4QPY A;  2R6Q A;  2RS3 1;  1XND A;  3NMB A;  5EJ1 B;  1JZ7 A;  2AH2 A;  3I2O A;  5T5J A;  2GC2 A;  3A0K A;  2TUN A;  5GLZ A;  1O3R A;  3BIE A;  5LA1 A;  3VDA A;  3B9C A;  4LBO A;  3SEP A;  4DUX A;  3EYP A;  1BLZ A;  4LIT A;  3O12 A;  3V0B A;  4AWD A;  1TMF 1;  2O1Q A;  3O1T A;  4LUL A;  5DUU A;  4YG3 A;  4FPY A;  4GXL A;  4XZP A;  1GFF 2;  5B2G B;  3CJX A;  1QH6 A;  3IMN A;  4E8D A;  3WNK A;  4CCD A;  3IBM A;  5LBB A;  5F7U A;  4PDW B;  3R0R A;  2VUL A;  2DFB A;  4OHV A;  1I9R A;  3VBU C;  1SBD A;  3VKF C;  4A6S A;  5E88 A;  5FY8 A;  4GB3 2;  4A45 A;  3FFZ A;  3VKN A;  4QB6 A;  1RUI 2;  4WVW A;  2GAL A;  5A3N A;  1FPN 2;  1ULC A;  4MGY E;  5FYI A;  5J48 A;  1JOD A;  3KHB A;  4Y20 B;  4IL7 A;  2HWF 3;  4EWD A;  2WLP A;  2ZKL A;  3B3Q E;  4OMC A;  5I91 A;  4FPK A;  5CG9 A;  4YVS A;  3J9S A;  5JUV A;  2DUR A;  3RFR A;  5HV0 A;  1AR7 2;  3ZFG C;  1L7Q A;  4WZC A;  4ASL A;  4QU2 A;  4KBZ A;  4OHX A;  3GZU C;  1H4G A;  4P08 A;  3IM0 A;  3O5S A;  2W5F A;  1OOP C;  1POV 1;  2JDA A;  1GMM A;  2GAU A;  3AMM A;  5B4X A;  1BHG A;  3GDB A;  1K5M B;  2HWF 1;  1RGS A;  3SCF A;  3DCQ A;  3O0V A;  1QJY 3;  5FJH A;  4QQO A;  2SLI A;  3ZR5 A;  4AI3 A;  1MPX A;  1IKQ A;  1MEC 2;  4ZXE A;  1CAU A;  5BV6 A;  5LCW L;  1JZ5 A;  2CU5 A;  3E5U A;  1AL2 3;  3NRU A;  2QQJ A;  1HRV 1;  5FP7 A;  3WX5 A;  3KVA A;  1XNT A;  3L9J T;  4BWO A;  3C7F A;  3D3A A;  4RQP C;  1WLC A;  3W21 A;  5J09 A;  2HBT A;  5JI9 A;  2P34 A;  3M1H A;  2FDJ A;  5A3P A;  2HWB 2;  4N53 B;  4OMD A;  3AX4 A;  1HIX A;  3PVN A;  1PK6 A;  2A70 A;  4UI9 L;  1IPK A;  1JI6 A;  1U5X A;  4IV3 A;  2XON A;  4K21 A;  4Q4X 1;  4CTE A;  1ODM A;  1PGL 2;  2WA4 A;  2P5B A;  5C8C B;  3GNE A;  5FXX A;  1XNB A;  2BWC A;  2IXH A;  2HYX A;  4UW4 A;  1V6L A;  2I07 B;  1Q43 A;  2N7G A;  3NJY A;  1QKQ A;  5I93 A;  3EB7 A;  4OHY A;  4CEW A;  2VUD A;  3IDB B;  2P37 A;  1OVP A;  3CIH A;  1KQR A;  1R08 3;  4DXZ A;  1JH5 A;  1OI6 A;  2DTW A;  5T50 A;  5FPV A;  5IJR A;  1OA2 A;  1SZB A;  3JBG 1;  2YXS A;  4RQP A;  3VBR B;  3ZYR A;  3OD4 A;  3OGR A;  5F2W A;  1QNY A;  1S2B A;  2ZGK A;  1ZYB A;  3AP9 A;  4J1X A;  4QDS A;  3WHT A;  4JGY C;  3GBG A;  4Y1Y A;  2AEN A;  2NQY A;  1V6K A;  4PDW C;  5H9P A;  4JRL A;  4RS5 B;  3ZIX A;  5IVE A;  3VBO B;  4BB3 A;  3ME2 A;  1RJ7 A;  1ODN A;  2CSG A;  4XJU A;  3HEI A;  3HT2 A;  5FLI A;  1HLC A;  5LW9 A;  1JUI A;  3U07 A;  5A7O A;  4HLT A;  1O5U A;  3ORJ A;  4NIA A;  3V0B B;  4LO7 A;  4FPO B; 
#chains in the Genus database with same CATH homology
 1JOD A;  1F35 A;  1JOB A;  1JYT A;  1ZRI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...