1JODA

Crystal structure of murine olfactory marker protein in spacegroup p43212
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
160
structure length
160
Chain Sequence
b'DGPQKQQLEMPLVLDQDLTQQMRLRVESLKQRGEKKQDGEKLIRPAESVYRLDFIQQQKLQFDHWNVVLDKPGKVTITGTSQNWTPDLTNLMTRQLLDPAAIFWRKEDSDAMDWNEADALEFGERLSDLAKIRKVMYFLITFGEGVEPANLKASVVFNQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Olfactory Marker Protein
molecule tags Signaling protein
source organism Mus musculus
publication title The crystal structure of the olfactory marker protein at 2.3 A resolution.
pubmed doi rcsb
total genus 29
structure length 160
sequence length 160
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06554 Olfactory_mark Olfactory marker protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.390 Mainly Beta Sandwich Jelly Rolls Olfactory marker 1jodA00
1JOBA 1JYTA 1F35A 1ZRIA 1JODA
chains in the Genus database with same CATH superfamily
1RVF3 4KU8A 3ZYJB 4GAZA 2JX9A 4LHNA 3AZWA 4IEXA 5C70A 1H9PA 4FFGA 4NHYA 4PBOA 3ZYGA 1H1MA 2DTWA 3VL8A 2IZWA 5HCHA 5BNPB 4XXAA 1UYYA 2G9ZA 4AW7A 1IQDC 1EAH1 4N43C 1QH7A 4BLIA 3I2IA 2D6MA 3IBMA 1UMIA 1HV0A 2QBXA 5HBAA 1LHWA 1WCUA 1XJAA 3WP4A 5AC92 1LODA 5LATA 4RYDA 4RGGA 4BK5A 2ZGNA 4QPWA 4F8AA 3RQ0A 4AXOA 2RS33 2W1WA 1YJLA 4YZ5A 1ZM1A 3WF3A 3HVDA 1KRIA 4CEYA 3H3LA 4IGPA 3ZYPA 1Q56A 1HB4A 5LRRA 3B93A 1GQHA 2JECA 1ZZBA 4NAMA 1N3QA 1PNGA 1UO9A 3MPPG 5EYXA 4CEYB 5JWPA 3JB8A 4XW3A 3ZXJA 3HOBA 4CU6A 1G9DA 3WQBA 2CHHA 4GJYA 4HSJA 4QHBA 3WY6A 2UURA 3CMGA 4QB1A 2LALA 2VGDA 5FZ8A 5CISA 1GU3A 5T5JA 3R6SA 4FBFA 1TNFA 2ZGTA 5A3UA 1W39A 5F5QA 2R16A 1LENA 5C3QA 2D6OX 2IVJA 3EB7A 3SH5A 5JCTA 5FAXA 1VRBA 3OY8A 3N35A 5DAVA 1VBE2 2W1UA 1TG7A 4QX7A 4GWJA 4CTEA 3VZMA 2D5HA 3M70A 2HEYF 1LOEA 2KM2A 4Q4X3 1JYCA 2TEPA 1OH4A 3LEKA 3ON7A 3VBHC 5HCBA 5FWEA 1XNAA 2FDFA 4B1LA 2R32A 1RL3A 1G9FA 2RDRA 1F4HA 2X5IA 5FIXA 3QBQA 5FPUA 4WM8B 4BK4A 5A70A 3HQUA 3M3QA 1BMV1 4LT5A 1RUF1 1US2A 2RS31 3ST7A 2QVSB 1EUTA 2XVGA 5BNNA 4HANA 3PJYA 5I0DA 1S0BA 1MEC2 4OI4A 1LRHA 3ACGA 5FYUA 1BBT2 2LS6A 5F5CA 1L7LA 1XNKA 2BRTA 5FMCA 1MS0A 1SDWA 1UU5A 3A21A 3I3MA 1QJEA 3ECQA 3ZN6B 4E8DA 4EWAA 4NIGA 4YVSB 1ULGA 2GNMA 4V2VA 2ZZJA 2RG4A 4JV4A 1VAMA 1QJX2 3FE5A 1CZVA 4ZXKA 1YI7A 5FZEA 3RI9A 2W3JA 2B45X 1W0NA 2PLV2 4J1XA 5LA2A 4Z2WA 1QEXA 2W95A 5EQUA 1POV1 3WLUA 1AR72 1UQXA 1DP0A 1YYNA 3U07A 1VRH3 3RZJA 1H4GA 4OCTA 4FI9A 3ZYHA 4LO6B 2ZGOA 2Z2SB 4Q4V3 4YVWC 3ZIXA 1W8HA 4C1XA 2CAUA 5FY0A 3URFA 4CDXC 1PIV1 3KCCA 1C5HA 4Q29A 4WZCA 5FZ0A 1IPJA 3UT0A 3WVJA 3SKJE 1UXZA 1WCKA 4B3NA 1JI6A 1SBEA 4CDUB 4XC9A 3K3OA 5F6LB 1N1SA 4LTAA 1MZEA 3AJYA 4AQTA 1ENRA 3L9JT 2XDVA 1PMHX 3J8F3 4H7LA 5FO7B 4CDUA 2DVDA 1DGWX 1I5PA 2ZCWA 3LB9A 1UKRA 3SLIA 5JOYA 1O3RA 3SH3A 3WW4A 2CWMA 1WGPA 3W5MA 1F5JA 1OMIA 3KMHA 4FXKB 3FJSA 2D6KA 4GIQA 1C4RA 3MLLA 1W05A 3PJQA 4LHLA 4ORFA 4W65A 2FDKA 1QJU3 5LBFA 4QWNA 3Q8AA 3AK0A 3LWCA 5JOZA 4CDQB 5FYBA 1KS5A 4W6XA 2D97A 4AI0A 2R7EB 4KG0A 4HBNA 3VBHB 4J1WA 3J26N 4A3ZA 1YEWA 3OYWA 5FMOS 5DUXA 1ZZ6A 2GSYA 3MV01 2YFZA 3UK9A 4AEDC 4LBOA 3B00A 4COYA 2G9FA 4XF1A 1LOGA 2Y60A 1DQ4A 2EF6A 4UBGA 1ULFA 2WSVA 4A2UA 1GBGA 1W06A 4LULA 4DINB 4N53C 1F2NA 1AR83 1YJKA 4GH4B 5I0RA 4M3CE 4LLFA 5LK5A 3KGLA 1RUG2 4FTEA 4MHRA 4Q0QA 1JOBA 4NPRA 5L7OB 1L7RA 1Y3TA 3PUAA 4JCKA 4LHKA 5ANQA 4C90A 3OTFA 2CDOA 5JLVA 5FY1A 4D6QA 3AJZA 1VMJA 2W47A 2ZGKA 1TNRA 4XAAA 4Q8LA 3H9AA 3ZYIB 4QQPA 4B8EA 2BGPA 4B29A 2E7AA 2YMZA 2NMNA 2ES3A 1CGPA 2R073 1RUE1 4YM0A 3M2MA 2EXJA 2VZPA 1H2KA 5DQ0A 5KC5A 1AYM3 2VZ1A 5BNPA 2Q8OA 1WCDJ 1RUD3 3CKHA 3SCGA 1VBC2 4U36A 4Y24A 1C8NA 1WA6X 2VMGA 2J1SA 1QOSA 3EBRA 4HN0A 5D2AA 1OBNA 3TWIA 4CDWA 4ASKA 1O3QA 2VD7A 3AKQA 4H7MA 4QU2A 4UWDA 1V00A 4LKDA 5FJHA 4ZZ8A 4DEVA 4QQLA 1VBC3 4XBLA 4D94A 4LE3A 3IDEA 4CCOA 1REFA 1VALA 1O91A 2LM3A 1RITA 2IXIA 1O59A 4BWOA 4GB32 5J37A 5T50A 4I0WB 1PZ7A 3H1WA 3VD9A 1UY3A 3VD5A 2AC1A 1W6QB 2YXSA 2VMIA 1U5IA 1VMFA 1XE7A 2VMHA 3AL5A 1W8OA 2FQPA 5DABA 2XPJA 4XQ4A 2XLFA 2O14A 4RHV3 4JAAA 4WVWA 2R062 1W9YA 5DZFA 1IG3A 5F8PA 3B02A 3E97A 1LAJA 2XLGA 1DGRN 5T55A 4IV1C 1JU3A 3ELNA 2JB4A 5J98B 1W9SA 2XXZA 1ZRCA 2QQUA 4YG6A 3QCWA 2QQVA 1SCSA 1U5ZA 1WWYA 2DUPA 1Q43A 3D6EA 4IW3A 1FOD1 1HJFA 5CKMA 1FPN1 3NV4A 3SISA 2G9GA 2ORZA 3H3UA 5C8CC 1YQ8A 1S0GA 4AVVA 1QWRA 4N9HA 1DZTA 5EIYB 3KZ4C 1K42A 2CY6A 4LA2A 2P3KA 1FATA 2VTFA 5JOWA 4XIOA 1O5UA 1S55A 3U14A 1AR63 1WLCA 5FUIA 4AFBA 2YPDA 2GC3A 4GB31 3J4UH 4RHV2 3U0ZA 3AMMA 1EPWA 2VH9A 1RUC3 3B9IA 3BTAA 3N4MA 5FBJA 4JGZB 1BVVA 4FPLA 4ZONA 3CU7A 4EYUA 1MQTC 5CFCC 1YQCA 1JZ3A 3FLPA 1JYNA 1OOPB 3RRDA 1AYN1 4KWKA 2BJSA 1VP6A 3E5XA 4M00A 2VOTA 2QQKA 5CFDC 1LHVA 5A7QA 2IXHA 2VOXA 4YFWA 3WSOA 1XNCA 2EIGA 2YUEA 2R30A 3Q8BA 2YB7A 4A45A 3LDBA 4YZ1A 3WCRA 1LHUA 1VB4A 3BCWA 4CCLA 5GZCA 1I6XA 2J1TA 1SPPA 3UNPA 2JXAA 5JR2A 3ACLA 4BA6A 2UU8A 3ZFFA 1YFUA 3NSTA 2ZHNA 3ILFA 1LOFA 4MVTA 3SNMA 1AR73 1OFNA 4COZA 3IZOA 5KWRA 2W1SA 1O4TA 1W6OB 2OS2A 3K2OA 4M4RA 3ZFGA 4ET7A 5FZKA 2BTVC 4XUPA 1RJ7A 5AVPA 3VBFB 4AFAA 4RQPB 1QJY1 4OHYA 2ZGQA 2YU1A 4A42A 1XC6A 1OLQA 1DDLA 1ZX5A 2QFEA 4I09A 4OZOA 5LY2A 4NMIA 3MYXA 4COUA 3IB3A 5J09A 4NWVA 2YDEA 4XJ9A 2ARXA 1OOPC 1RYYA 3FWEA 4A6OA 2VU9A 1CX1A 1PK6A 2W91A 4K40A 1F9KA 1XNDA 5D8AA 3RFRA 5ABJC 1ZBA2 2ZPXA 1TME2 3AC0A 5IVYA 2WN2A 1NCQB 4K6BA 3WXPA 3POFA 3VZJA 3V0AB 1NUKA 4JHZA 3FBMA 2IXJA 2O8OA 5LY1A 1R091 1RMU3 2HWB1 2VM9A 2X53S 5FLHA 1ODNA 4O7XA 4OMCA 3W58A 5DG1A 4XUNA 1R64A 2HWE1 1HW5A 2FCUA 3U4XA 2WQ8A 1J1TA 1ENXA 3BN6A 4AHXA 2WZ8A 2X09A 3QH7A 4CCKA 2NN8A 1QXPA 5FYMA 5FMOL 2HWD1 2D6LX 4AEDB 3DV8A 5BY5A 3WF1A 1WMXA 4GALA 4N9IA 5C3RA 2WNEA 4BQXA 1G6NA 1LGNA 1SDDB 3HN3A 2CTVA 4PBPA 1O8SA 1SMVA 4YW1A 5LASA 4QDSA 5I0TA 4JDMA 4DIQA 3NNGA 4CEWC 4CDWC 4YLZA 5FR3A 5FYZA 4D6RA 1CPMA 2LW8A 3DGTA 3W21A 2GP5A 3CJIA 2Q8EA 3IDAA 4IEOA 4D7SA 4I2OA 2Y26A 3ZDSA 1R1ZA 3KHCA 1W6NB 4HN1A 4HT1T 1Q8PA 2J1RA 5B2GB 1X36A 3AZXA 3M4FA 3MIEA 2WINB 3VBUB 4EN7B 2DWRA 2JICA 2D5FA 4XE9A 4IUGA 2D3SA 3F2ZA 4K20A 4GWNA 1J83A 5JMCA 4LO4B 4CDWB 3NNMA 3ETPA 3N9PA 2P3IA 3MW3A 5JIUA 2CGNA 3LKJA 4MGQA 4ZKTB 3ACIA 1Y9QA 3KCXA 5L9BA 2R041 4JC1A 4IL7A 3Q9OA 2I2SA 4CRQA 4NO4A 3NKGA 3HBZA 5EJ3A 4UW4A 1JS9A 4WM8C 3WP6A 3JBG2 2IXKA 3AP6A 1XYOA 2JD9A 4YVSA 1OLMA 3DUIA 4RS5C 4A4AA 5DN2A 1H2NA 1UU4A 1SPPB 1QXRA 1V6JA 3KF5A 4AGGA 1ZYBA 2WLPA 3AP4A 5FZMA 2Y38A 4QU1A 2EIDA 1UPSA 3WW3A 5C8CA 5KBFA 3N7LA 2ZX3A 4NPMA 1UD1A 5A1FA 1HB1A 2JG9C 3ZSKA 2BDRA 4PQ9A 2D43A 3B7MA 2JWPA 1H9WA 3DPRA 4GKYA 4UW6A 5IK5A 1D4M3 3KSCA 4MG2A 5GZDA 1XSQA 3T08A 3RDIA 2V4AA 3NW4A 5L73A 1ZREA 4KWJA 5K7PA 1UXXX 1ULPA 5F2WA 1ZZ7A 4BOWA 3BPZA 3WG1A 1GOGA 3ENRA 2NZ9A 3K75B 2UWCA 2DCKA 2X29A 2XHKA 2HWD2 2ZMNA 2PHUA 2BPA2 2OQ7A 3P3NA 1DYKA 2PELA 2ZGSA 3SQOA 3VB9A 3RZMA 2B7YA 1C57A 4AVBA 1G8WA 3MIBA 5EWSA 4PDWA 1MS5A 4M3CF 2RR13 4PJYA 5LK7B 3CF6E 2KD7A 4QGLA 5CIRA 3VBOA 1UMHA 1OLME 2W52A 3SCFA 2RV9A 3K4DA 3K51A 1REEA 1K5MB 3HWJA 1UY1A 1NZCA 3PVOA 3ZKUA 3U1XA 4FP3A 3GNEA 5LEJA 1E57A 3ZVXA 4Z92B 4FOWA 1Y9GA 1OA4A 5FYIA 1ZBA1 2EXIA 3F95A 1AL22 2XBO2 4Q5OA 4Y1ZA 2WO7A 3R4SA 1YI9A 3WQ7A 3I2JA 4E4HA 4D0QA 4F7ZA 1MEC3 2WNVC 1PO23 4U2AA 4E2GA 5DAPA 4E8CA 4TXWA 1ULEA 1O5LA 2JDMA 4S2GA 1ONAA 4LXLA 3NAPB 2A6XA 1QJY2 4L8QA 1UF2C 4BB3A 4WVMB 4XF9A 4KQ7A 4XJZA 2QE3A 4B4PA 4MO3M 3ACFA 1UIKA 5GLTA 3ETQA 3OB8A 4Q4X2 3RYKA 1Z78A 1RHI1 5FPBA 3VDDA 1W2OA 3ZFGB 3GJAA 1VIWB 5FP9A 4CUGA 1R083 1RUJ3 4TYSA 2QQPA 2DVBA 5FOJB 3TYJA 4GMP0 5DMYA 2VMFA 1GZWB 1IGOA 1OPOA 3FLTA 5LEKA 1QIQA 2W68A 2WT2A 1V6KA 1JOPA 2DU1A 2EIEA 1C28A 3LPFA 4MSVA 3DL3A 2XL9A 2CU5A 2VO5A 5AFBA 4IE5A 2RM22 1AYN2 3UGGA 3OOXA 3GF6A 4HG6B 3FL7A 3QACA 4H14A 3O1TA 1UOFA 4BZ4A 2EALA 1CONA 1W8NA 1MS3A 2WWSA 4INDA 5FZ3A 5F5IA 1DYOA 1OVPA 3POEA 2UY8A 1RXFA 2RS13 2AYHA 2VCBA 4CE8A 2FMYA 2HWE3 3HR9A 2BGOA 1HRV1 1RUI2 1ZBE2 1OSGA 1KFXL 2BBAA 4PLNA 5L9RA 5HPOA 1OVSA 1TME3 2ZZQA 2QQIA 3SHRA 2FCTA 4Q8KA 2RS11 2WYFA 4QGNA 4RR3A 4XFCA 1QQP3 3IIIA 1C1FA 4LITA 4LOTA 5JZGA 2ERFA 4E27A 1WBLA 5FYHA 5EJZB 4ZZ5A 1EY2A 1BLZA 1FPN2 3OUIA 4S2FA 1PVXA 3HQRA 3FUQA 2BERA 1BYHA 3PL0A 3BB6A 5B4XA 2F4LA 4XF4A 1L7QA 1SLLA 2XJSA 3WDXA 4P9WA 3E5QA 4A7ZA 3UYJA 4XTMA 2EAKA 4UBHA 3VKFC 1DFQA 1GWKA 5BV6A 2W08A 5EP9A 2Y6KA 3GGLA 4HL0A 1PIV3 1ZZ9A 2GNBA 2YU2A 3OJBA 5A80A 3RS6A 2QUOA 3HPNA 5FZIA 1X7NA 5LRSA 2JDUA 2QDNA 5JXIA 3ZSJA 3VBUA 2WUHA 2JDHA 5FY7A 2TNFA 2GU9A 3ZN5A 3ALQA 3W59A 5BNOA 3O1OA 2RS51 5IATA 3OGRA 2AGSA 3CIHA 5F5AA 5FBZA 4YW3A 4BMBA 2Q8DA 4Q0VA 1WD4A 5BNOB 3OGGA 1JOJA 3H8RA 3GZUC 1XSRA 4QT6A 2VC9A 2NPIA 2JG9A 4CPBA 3J8F1 1Y9MA 2D6PA 3MIGA 1WW7A 2XQRA 3DPRC 3KV5A 1AJKA 2G4IA 4AFDA 1W3VA 2ZEWA 3JBG3 3USUA 3BTZA 1UYXA 4HVQA 5DDJ2 1TQ5A 2W2IA 3WG2A 1K3IA 1OHFA 3FBYA 5B4NA 2BFUL 2XJRA 1OF3A 1VBA3 2ZAAA 3I7DA 2VOWA 4CUCA 3A0NA 1XU1A 4I0BA 3T4VA 2PAEA 4Q1RA 3P1IA 2MHFA 4ISRA 4AK3A 4ASMB 3OGJA 3GBGA 2Q8CA 1ALYA 1GNHA 4YW5A 2VTXJ 4AR2A 3DXTA 4NHKA 1Q8SA 2RR11 2ATFA 4ISQA 4K7JA 1LU2A 3GZAA 2K9ZA 5F7UA 2XJVA 1ULDA 2A1XA 2VW1A 5A7OA 5A7WA 4X8NA 4QM8A 5J48A 3VDAA 5GALA 2WQZC 2W1QA 2ZAHA 4NOTA 3BKZA 3O14A 1SLIA 4CU9A 2GC2A 4JDNA 4Y26A 1DBNA 4G3YC 1D4M2 2JG8C 3OEAA 3DYPA 4P9GA 4A7KA 4CXYA 4FVVA 1PX4A 1A8MA 3LF7A 1QNYA 2BYVE 3K46A 3PUQA 4IV3A 1OQEA 4UW5A 5FMBA 2VPVA 3HBKA 3T1LA 3UKVA 3AYCA 4NIAA 4BMEA 5C33A 3WP5A 5A3MA 1NZIA 2G19A 5C71A 2FZ2A 2BVBA 3NNJA 3KM5A 3M1HA 3BALA 4JKLA 4EZHA 1TEIA 1W2NA 2VMDA 3VBRA 2VXRA 4LBMA 2XVKA 4RFT0 3P5BA 1LB2A 1DLLA 1OA3A 4XQWA 1HX6A 1YIPA 2J1UA 2AREA 2WNOA 4PI0A 4DNYA 4C8DA 4QHZA 5L9VA 1GZCA 1QNWA 2ZHMA 1E5RA 5A6ZA 4N43B 3FUOA 1G86A 2YC4A 3ILRA 3VDBA 2Y0IA 1X50A 3AVSA 2PHXA 1G9AA 2X5IC 2ZGUA 2ZXQA 1B09A 1AHSA 1NQJA 4BQ4A 1NCQC 2H0BA 5T5OA 3O1MA 1Y7BA 4NJ4A 2DVFA 5DZGA 3AKTA 4HKWA 2YFUA 2QCSB 5BNNC 2JIGA 4IGOA 3JU9A 1QQP1 1JHNA 2FBEA 2GH2A 4XFHA 4I02A 4WVMA 2B46X 4XMAA 5I8YA 4Y1XA 1H1AA 2VULA 1RHI2 1DGRA 2VQ0A 4AAPA 1RUI3 1ZBE3 2OW4A 3T09A 2QKDA 1BEV3 3NJVA 2Y6FA 4A3XA 3VBSC 2UWAA 3TNPB 3ZSMA 2BV4A 3B94A 2QQJA 4MUVA 2PXJA 4P00B 3ZYFA 3PTRB 4PF1A 3OPTA 4LO7A 3BU7A 5D21A 3V64A 2CAVA 5FZHA 2JENA 4MLOA 4Y22B 4XF3A 3C7GA 4D8MA 2BEOA 3MF9A 5HCAA 4A6SA 1QJX1 5FP8A 5LBEA 2B5HA 2I74A 4CYDA 4NHMA 2QTWB 1IS4A 1OD5A 1VR3A 3Q8EA 4CDXA 1OI6A 3EXUA 2DUOA 2K0GA 2XLAA 1W9TA 3DXUA 2R49A 4K1YA 3AKRA 4XEZA 1AYM1 1S2KA 3IPVB 3T4HB 1C8M1 4HONA 1VB2A 5DZEA 4I3GA 3SMHA 3VBFC 5IAXA 1GP4A 1RUJ1 5APAA 5JUVA 3C3VA 1W9WA 1AF9A 3ES1A 1IPSA 4Z82A 4NROA 5FKCA 3C7FA 2GN3A 1I5ZA 3GHNA 2C1FA 1PGW1 3FHQA 3QD6A 1LTEA 1UKGA 4RGKA 2VBDA 4X8PA 4XUQA 2D40A 5CVRA 1YFWA 5F3GA 3OBTA 1FNZA 1NT0A 2ORXA 4NHLA 1ZRRA 1KDMA 2ARCA 3LA7A 5F2SA 4I30A 1N1YA 2P3YA 4Q4W2 3AMPA 5DAQA 5FLIA 3ZXLA 1ODMA 3Q8FA 4AWDA 4YSFA 1UWWA 4IE6A 2ID4A 5DG2A 5FUPA 5KR7A 3UGFA 4QPIC 2XJQA 1CIWA 4IEVA 2F6BA 4FPEA 4KGQA 3GALA 4P5HA 4R8HA 1OOPA 4AEDA 1N1VA 3O1RA 3JD71 3NVCA 1AYN3 2A6VA 5CFDB 4K1ZA 1GWLA 3V56A 2V09A 4UFLA 4BDVB 3I3BA 4XHBA 4LR4A 1NLSA 4EQVA 3HNMA 2W0XA 2ZX0A 4XURA 5I8SA 4HZFA 4XFGA 2VVFA 2RMU3 2WDBA 1YHFA 3ZN4A 1NX9A 4K9SA 1F31A 1WMFA 3CLPA 5E8AA 3BUCA 4TLGA 4W6WA 5CNAA 1PZ8A 2Y6HA 1XNBA 3VBRB 4Y3OA 5FZ9A 4RFRB 3CJIB 5FQ0B 2WAOA 5A3OA 3RZHA 1VBA1 2P17A 2WABA 2VZQA 3IN9A 3LEMA 3LIGA 5FY5A 1W6MB 1W03A 3CEWA 2E7TA 2OIIA 2Y0OA 4UFJA 4PI2A 1SQ4A 4Y5TA 2L9LA 1JYXA 1BBT1 4W50A 2MEV1 1GOFA 5CG9A 2V4VA 1C8M2 1SZBA 1U12A 4FPYA 4HVRA 3MUZ1 3SEPA 2WLQA 4UFHA 4ES9A 3GDBA 2QQWA 3LA3A 1SBFA 1K12A 1GQGA 5C5TA 5DAWA 1QOOA 1LEDA 2E9QA 3IPVA 4Q4V1 1KD7A 1X9TA 3WUCA 2SLIA 1WCQA 3ZFFB 4AVTA 5BUVA 1GV9A 1BEV1 4IV3C 3PVEA 1AR91 4AEJA 1H6YA 4G4FA 1RUNA 4B1MA 3ZXEA 3NL1A 4BQ5A 3JB4C 2XH6A 5CG8A 4HOOA 2BQPA 1PHMA 2C5DA 2ZEYA 4FCAA 2V72A 1YXWA 4BQWA 1ZA4A 1TZOA 2HWC1 4TTGA 1VE0A 1PGL2 1YC61 1UZWA 2ET7A 3J7MA 4CCDA 2YYOA 1XE8A 1HN0A 4YW4A 2Z69A 5T3NA 2DVAA 2HWD3 2DURA 3DKQA 1DZQA 1J1LA 3S6PA 1W99A 4N90A 2MEV3 5FZFA 1QHDA 4NAOA 2C9KA 1UX7A 4YVSC 3TN93 2CDPA 4MGKE 1M4WA 4XOGA 3AMHA 3K48A 3OUHA 1W8UA 3GM8A 3D0JA 5GLWA 3ZDVA 4TZDA 1NCQA 3MV11 1XYNA 1JZ8A 1VMHA 3I2OA 3D0SA 1RMU1 3BIWE 3BODA 5IVCA 2VY0A 2BOJA 2VBPA 2D3PA 3EYPA 3TEYA 1DIWA 4SBVA 5FZOA 3UL2A 4W6YA 1TME1 5FY8A 3RMXA 3GZEA 2WZEA 3N36A 3ZO0B 1S0DA 4HLTA 4LIVA 2VCAA 5T5PA 4FPFA 4L2NA 3VBSA 4N43A 4ES8A 1N3OA 2ZACA 3WNMA 3IT8A 5FQ0A 1DQ6A 4IE4A 1EAH2 4OQ8A 3VBSB 1NE6A 1VBE3 2P34A 2ENRA 4XZUG 1S0JA 1DQ0A 1NLQA 2Z5WA 3KT4A 3PIJA 4OVEA 4YG0A 1GYKA 1BBT3 1LHOA 3OPZA 1W8WA 4CEYC 3H8XA 5FO8B 4N53B 3PU8A 3KV6A 2HWC3 3MIHA 4FO9A 5K9YA 4S2DA 4YW7A 4BISA 1EV12 5HCFA 1W6NA 2R071 4PIYA 4AFCA 2HYXA 1D0GA 3PVBB 3ZSLA 4Y1YA 2DCTA 4I0AA 5JAXA 2OUJA 2H0VA 1ZRDA 1OFSA 1PM4A 3ZOIA 3AVRA 1ULOA 1OXCA 1XB9A 5FPAA 1RUC2 2A71A 4XFBA 2BU9A 3S0MA 1BKZA 4IV1B 3DPRB 4KI5M 4YW2A 1J3PA 3LQCA 1AL23 2XBO3 1QJFA 2RM23 3AFKA 3IDBB 4LLOA 3U10A 3O1UA 2A3XA 3NO8A 4IXLA 3ZXKA 4CCCA 3CZJA 4DUXA 1ND2A 2WO1A 1O4YA 2XJTA 4OUSA 5IFTA 2DU0A 3WF4A 3TEWA 1A78A 5F9TA 5FZ1A 4P9XA 3QLQA 1CVNA 3DF0A 1NKGA 2BWAA 2Q0AA 1VBD2 3PU3A 3W5NA 1RGSA 5FTTC 4L99A 3H0OA 4YNIA 5CEHA 3WW1A 4Y4YA 1FMD1 2W94A 1Y4WA 2ZX2A 4XDOA 5FYSA 4DZGA 1IZ3A 1AJOA 1FOD2 3MPBA 3OGVA 1WW6A 3MFAA 5IK8A 4QPYA 1XPWA 3POSA 4CU8A 3S5AA 1ASJ2 1Z7S3 1T6BX 1MS4A 1JUIA 5FXWA 3S5QA 4XCAA 4R9CA 3E5UA 3RYRA 3LEGA 5JXGA 1FI2A 3C7OA 4YRDA 2AH2A 5FP4A 3EJKA 2IC1A 5CB7A 5JI7A 2FD8A 1UX6A 1IKPA 5L7OA 3JZVA 3NJXA 4ZPIA 4CP0A 3RZLA 2YROA 2WZPP 4CDQC 3M3OA 5EYYA 1POQA 1L3JA 2BP6A 3H3ZA 1FMD2 4HFSA 5H9SA 1W2UA 4NIDA 1TE1B 3WNXA 1CR7A 3OY8B 3POBA 4MGYE 4D3WA 1RUH3 3SH4A 2BGCA 1CJDA 4IEUA 1STMA 3KS7A 5JZGC 3MZHA 1VBD1 2DYCA 5EHDA 4XDQA 1XE0A 2YBSA 1WZXA 2PLV3 1J58A 1RUOA 4L9BA 4CP2A 1LGBA 4GWMA 5KHIA 4UFMA 1YLLA 1PO12 2P5BA 3G7DA 3PNAA 1RMU2 5KHKA 1GZWA 5J96B 3TNQA 3I2GA 4EWDA 3POYA 1C8M3 4KH9A 2MPFA 4GMP3 3I49A 4AZZA 1CAVA 4BXFA 1VBC1 2HWF1 1GNYA 1N1TA 2WRAA 1HDKA 4ATEA 1JYWA 1FT9A 3RZGA 3I54A 3AFGA 5GLVA 3OBRA 4CCMA 4F83A 2LROA 2ZMKA 4AI2A 1HRI3 1MS8A 3MIDA 4AQ6A 4UAPA 2VZOA 2ZJCA 1H8VA 4JQTA 4FPGA 1AUYA 5A6QA 3NV3A 2D44A 3DYMA 2IFWA 5LB6A 1NAEA 3ORJA 3UKTA 1UZ0A 5LCWL 2GNDA 4LJHA 4QKNA 1E5HA 5AFEA 1UAIA 4QXHA 5JR7B 3BTXA 4LORA 4CZSA 1KQRA 3L2YA 4PIZA 1S0CA 1WKYA 1YFYA 5H9RA 4Q4X1 4X6RB 2IVIB 5JSPA 4RS5A 2LUWA 3I59B 1RC6A 4TLFA 1RUD2 1LOAA 1RVF2 5IWFA 4Z1VA 1UYZA 4C0BA 2AACA 3O7OA 4QPGB 3WNOA 5C6CA 4JVAA 4KL1A 1G7YA 4FTBA 4IEPA 3LIHA 4Y20B 1SHWB 2C6SA 2VG9A 1CAXA 1OQDA 4Y22A 4BIOA 3PTYA 1MR5A 4JZRA 4AGVA 1W2AX 2HWF3 2NP0A 1UMZA 3D82A 3RMYA 2CGPA 4K8RB 2JDYA 2UWBA 1V6IA 1QY4A 4BJ0A 4YM1A 2ZBJA 4L92A 2P3JA 4NE9A 3TOJA 5C9AA 3AYAA 1NYWA 5FLJA 5FZOB 1NY71 5EZWA 5E1RA 4BXSV 4IV3B 3WDUA 2XONA 1H4HA 2JDKA 3R4UA 4GXLA 4JGYA 4RR3B 3WDVA 5FFOC 5IT6A 5FOBB 2D98A 2ZX4A 3RGBA 2FDGA 2WO3A 2VUAA 4LBJA 4PDWC 2RDSA 3HMYA 4QQHA 2RVAA 3LCPA 3INAA 2W46A 4YZ4A 3MFCA 3PLQA 4P08A 3OYWB 3WCSA 4J25A 1G9BA 1DG6A 1W6OA 3LAGA 2QDRA 3A4UA 3A7QA 3FZ3A 4QB6A 5CAZA 4AAXA 3BVCA 3MGUA 3RJRA 4LBLA 3I2KA 2GAUA 1KGYA 3J9SA 1EAH3 4WV8A 4XZPA 5CKNA 3FLRA 1O4ZA 2RHPA 5JIAA 5K0UB 3JD72 1GQPA 3T0AA 1K5MC 1NXMA 1SFNA 4E2SA 3IIAA 5ACA2 2V73A 3VBRC 1YRZA 2VZ3A 5A3NA 2EA7A 1CAWA 1E5IA 3ZM8A 4AQSA 1AR71 5CZKA 2XUEA 3JXSA 5A7PA 2ADEA 1POV3 1XOYA 3VZNA 1OH3A 3VV1A 1BEV2 1H6XA 2A3YA 2N7GA 3AP9A 2Y33A 2A3WA 1C5IA 4MX3A 1X8MA 3V0AA 3VLBB 4PHZA 1HQNA 2O0OA 4LUKA 1X82A 4IV1A 1JHJA 3PUIA 3PMEA 2VVDA 1GANA 1KS4A 4FOVA 2QQOA 3DN7A 1PNFA 1IS6A 2PA7A 5IVBA 4NN0A 4OI2A 2ZGRA 4UFIA 4OI0A 4AQ2A 3JBG1 1KJRA 4OHVA 3NJZA 3V65A 3CJXA 3KHBA 1ND2B 4E4SA 3KGZA 2JE7A 3HQXA 4MGIE 3T2TA 2DTYA 1B35A 4CDXB 1H0BA 2Z4FA 2GDFA 2DUQA 1FYUA 3ES4A 3ZMOA 3RYPA 4JTOA 1FAYA 4DFSA 2PAKA 3T2OA 2P37A 3T30A 3WUDA 4HK9A 5FZBA 4CDQA 1HN1A 2E63A 5FY9A 1HB3A 1OKQA 4OUMA 1WMEA 2BZDA 4P5YA 1IQAA 2KA3A 2ET1A 3LOIA 5FZLA 2JE9A 4RN5A 1HQLA 4R52A 4MXWA 1EPZA 1JODA 1PVC3 4QHOA 3TBDA 5ACA1 5CFCA 4XETA 4COVA 4QKBA 3LFIA 3T3YA 1FPN3 2HLEA 3SKVA 1UOGA 1REDA 2HBUA 3VN4A 2W39A 3B3QE 1XYPA 2DDUA 3RZZA 3ZR5A 1HQWA 1DF0A 1R1A2 1VBB3 1QQP2 5ISLA 4LKEA 4NHXA 3OD4A 3E6CC 4GKXA 4XHXA 2ZS6B 3R4DB 4BH9A 1I9RA 1MVQA 4KU7A 3WZ1A 4WVZA 4FXGB 5T5LA 2WT1A 3J7NA 4XFFA 3WP3A 4GMP1 2CGOA 4GZ9A 2VAUA 3GXUA 4Q4W1 4W8JA 2J1EA 2DV9A 2KR2A 3RPQA 3MW2A 1Z7S1 4M01A 5C9AB 5I93A 1V6MA 2ZKLA 4FPOB 1LOFC 2WA4A 3OBAA 3HEIA 2WAAA 3H7YA 4QX1A 1SLCA 2ZTNA 2D6NA 1OPMA 4JDOA 3MEPA 3FC0A 3NRUA 5C4WC 2DBIA 5IK4A 5J7MA 2HWB2 2WC2A 4QPIA 1UZZA 4XMIA 3POJA 2P2KA 4OHZA 1Q8QA 2EVXA 3NAPC 1OUSA 1V6NA 1W8FA 2VCMA 2VBBA 3ABZA 4YPJA 4R4XA 2WYSA 5I8TA 5AVAA 3UJOA 3SEEA 1AYM2 1NA1A 5ANNA 3TN91 1NCRC 5FPLA 4O9EA 5FK8A 1VBB1 4P9LA 3MI8A 4DOUA 2IXCA 4RQPC 4BYYA 2IWGB 4FFIA 4XJAA 1PZ9A 2PN5A 5JPMB 1APNA 1MZ5A 2EAAA 2VOVA 4XPVA 4XJUA 4LBQD 4YM3A 2JDNA 1Q3EA 4EROA 5KXDA 2XWJB 4YG3A 4GJZA 1V70A 1X33A 4J6GA 5IJRA 4GB33 1HXS3 4O9GA 3O0WA 5C9AC 1CAUB 4Q4Y2 2YV8A 2RJKA 4XUTA 3ZFEC 4B7EA 3AB0A 5FZAA 2QQNA 3I8TA 1NOVA 2E26A 1T2XA 1TMF2 3CL1A 3LD8A 4EN6B 3N9LA 1V0AA 2JDAA 3HT1A 2RMU1 3JCIA 2CL2A 2VNOA 4LE4A 1ST8A 3AMQA 4DRVA 4YARA 2GC1A 2HWF2 1H30A 1DCSA 1Q5OA 4CEWA 1QU0A 2R0FA 4AYUA 3P6BA 3O1PA 1UL9A 1BK1A 3PMSA 1GSLA 4P9YA 1S1AA 2C26A 4KBBA 4BLJA 4Y5Z0 3WHUA 5FPVA 2XMLA 3O1SA 5KXBA 3H8OA 1RUF3 3M3CA 3ZYBA 5FXZA 4H3WA 4V2WA 5JMOA 3S7IA 3WX5A 3N9QA 4IE7A 3MICA 2R0HA 3HAGA 1K5MA 4RHV1 5HV4A 2ZGLA 1JYIA 3QOPA 1AR61 1HXS1 2VW2A 1ENQA 3D8CA 3CZUA 1C3HA 4YGCA 2VR4A 2FMDA 1RTVA 5I0UA 1UY0A 4Y33A 3B5LB 4PLMA 1RJ8A 5FPZA 1O3SA 4QKFA 1XNTA 2VZTA 4JGZA 2GMPA 2F17A 3CHXA 5CBLA 3NV1A 3VKOA 1C1LA 3LE0A 3DYOA 4YGEA 4H55A 3ZIWA 3MLJA 4AFMA 2WO2A 4KBZA 4FFFA 4WM7C 4XABA 5A33B 5AC93 2FDHA 1DQ1A 1IS3A 1LECA 2WJSA 1CD3G 2W5FA 3AL6A 3D4KA 1ASJ1 4YFZA 3DEMA 1BHGA 1EV13 1H1IA 3V0BB 3MF6A 2BFUS 5G05L 2AEZA 4MH0E 2DBNA 2PQQA 3VZOA 4LOSA 2RR12 1IG0A 1CAWB 1HJGA 3I3EA 3BU0A 3V0BA 1W28A 2ZEZA 3GBFA 4FFHA 3VUOA 5BYNA 4URTA 1GZTA 3VDDB 4Q2FA 3WNLA 3BPSA 1Q8OA 3T0BA 2E33A 2YZ4A 3KQ4B 3ZLIA 4LKSA 2KXLA 3A0KA 2XUMA 4XAEA 1QF3A 4XBQA 1RUI1 1ZBE1 3ZMNA 2WZR2 4CXWA 4QXKA 1AXKA 2OPKA 5FZ6A 1IPKA 3KF3A 1ENSA 2P1BA 4NVPA 4QM9A 1GKBA 2DVGA 2JG9B 4E2QA 3IKWA 2PAMA 2YGLA 3J8F2 4IEZA 3WDYA 5A32B 5F3CA 1RXGA 4IEQA 4KG8A 2VZRA 4JHTA 4KMQA 1W0PA 1K5JA 5K0UC 1UPIA 2VW0A 4XYXA 2PFWA 4L97A 4GD4A 4SLIA 2XGXA 1PVC1 5CU1A 2B8MA 5ACA3 4C0HA 4BIFA 1VRH2 1R082 2C4XA 4DUVA 2PHLA 1F8VA 4MXWB 1GR3A 1YCIA 2J22A 2JJ6A 4LBNA 3RSJA 1AX0A 5CFCB 5F6KA 4FP2A 1ZA7A 3EO6A 3OD0A 5T54A 3NJYA 2XWBB 4NUBA 2XJPA 2JE8A 4XVHA 4FPHA 4CUAA 2OT7A 3GYDA 2WNVA 3B01A 3UETA 1PO21 5JOXA 3SC7X 3I59A 3ZXFA 3PUSA 2GZWA 1T6GC 4DXZA 4QPGA 1UZYA 4QX5A 4CCJA 2JEMA 3POGA 4LMFA 3UGHA 3RNSA 2VECA 1W8TA 4FPJA 3CBNA 3AXDA 4NRMA 1RUG1 5FRAA 4N53A 3RVHA 1VBB2 3DECA 5A33A 4QDQA 2HJIA 4O65A 4QDRA 1O3TA 2RS12 4HK8A 1ZBA3 1GP5A 5M0TA 1GMMA 1UY2A 1WCSA 2IUWA 1HRV2 4FPKA 3H7JA 1VBD3 3R0RA 2RE9A 3VZKA 3VD4A 1KEXA 5K8SA 2PQSA 3AZZA 3VL9A 1ZRIA 5FYCA 2XR4A 1W9FA 4YW6A 2HKXA 3U4SA 5FYYA 2R6QA 4OI1A 3IMNA 4O61A 3WDWA 3VHRA 3ZFEA 2OUHA 3NNLA 5ERLA 3S7EA 5IUQA 4FAGA 2ETEA 2VUCA 2A6ZA 1COV2 5E6HA 5CA6A 3ZFEB 4XJ8A 3C7HA 2VZUA 4HXCA 2PMWB 1KDKA 3USUB 3WG3A 5BNPC 3K3NA 2PHWA 3BOWA 2GMMA 4DXSA 4B7KA 2WA3A 3MDPA 4OMDA 1CIYA 4E4DX 5LWBA 4KNCA 4L0PA 2NMOA 1XXNA 2OX0A 2X8KA 1LJ7A 1J59A 4LBKA 2EXHA 2FZ1A 1J3QA 2VQUA 4UT5A 2JDPA 2Y8KA 1ACCA 1EUUA 2VXJA 4CP9B 1HIXA 4DY3A 1SG3A 1JZ6A 5DUVA 4D69A 4PT6A 1GNZA 3RWNA 2AZ5A 3LDKA 4MZUA 5I91A 1RINA 2GNTA 4L11A 4AHZA 4FSJA 3PDQA 2GMEA 3BI3A 4IE0A 1FV2A 2MEV2 4IEYA 3UJQA 2OZ6A 5FCCA 1WW4A 2WNVB 3RI8A 4DXTA 4URAA 1VJ2A 4B4RA 2CSGA 4LO8A 3MIFA 2MNGA 2JDZA 1AL0G 1QMJA 1S2EA 1AL21 2XBO1 4CCEA 3S57A 3N9MA 4NIIA 4K21A 1OLRA 4WM7A 1VBA2 3AZVA 3PURA 2K46A 1AX2A 2BWCA 2O1QA 4Y4RA 3O5SA 4PIXA 1B35B 3FHIB 2JB8A 1JUHA 4LBQA 4XJWA 1V9U1 3VBOB 4AGRA 5DDJ3 5LZ6A 4EV0A 4A44A 5BNOC 4JGYB 1LU1A 2Q4SA 4ARYA 2H6BA 1BMV2 4DY5A 2YG0A 1DLCA 4BQYA 1K45A 3I2HA 4MGZE 3ASIA 4XIKA 1WD3A 3JQWA 1J84A 2WQ4A 3HT2A 3P3PA 5TSWA 2ZX1A 3MLKA 2ZGPA 4XF0A 3B9CA 1S0IA 1O7FA 2YBKA 2Q1ZB 1ND3A 2R063 3HIFA 1U5XA 2EIBA 4R4ZA 1KITA 2X05A 1JYVA 5BPXA 1FV3A 1SLTA 4WVVA 1W6PB 4JTNA 3N3HA 3APBA 2P6CA 3LSDA 2B39A 1QOTA 1A6CA 1MQTA 2VOKA 4QXBA 5HI0A 1VLNA 2JIJA 4HKOA 5CYYA 5K0UA 4R9BA 4NWWA 3ACHA 2V5YA 2FHRA 5LA1A 3NV2A 1F35A 3C8XA 5SV5A 5FZDA 1CWPA 1H2LA 1R093 1V9U2 5GKAC 1BXHA 1R092 3H50A 4RS5B 2JG8B 4DS0A 2SBAA 2Q30A 2WNUC 1RUJ2 4P02B 1YO8A 1JXNA 1MZ6A 1QDCA 4S2HA 4ZHNA 1JN2P 2EICA 2E7QA 5FXXA 1MZFA 4R9DA 2R042 2JG8A 3WNKA 2WR9A 1E5SA 4OZXA 2QZ3A 3AKSA 3J7HA 2WBKA 4DQAA 3PUHA 2OA2A 3E6DA 3DCQA 3UV9A 3ZXDA 5FMDA 1HLCA 1VAVA 4KWUA 4QPGC 3M8LA 2I07B 4Y1UA 3PIGA 4UF0A 4Z07A 5C3OA 1W04A 1GLHA 3DKWA 4FOQA 3WR0A 1JTZX 5LBBA 5A1AA 1PO22 1N3PA 1ND2C 5IYYA 5H9QA 2DCZA 2R1DA 1NXD1 2A5ZA 4QX3A 4CVUA 2IXLA 5A1LA 1RVF1 5KC6A 2RS53 2X5IB 3D3AA 4TSVA 4YZ2A 5IVVA 3LPGA 3VHOA 3HNYM 1V9U3 2AUYA 2WS93 1YIFA 4WZFA 1AZDA 5FV3A 3WF0A 1GWMA 3CO2A 4Y20A 4PLOA 1QKQA 1EYBA 2TBVA 3UKNA 4ASLA 5FDBA 4AI8A 1PVC2 5CADA 2UYBA 2A6WA 1U0AA 3L2HA 2A75A 5C5UA 1VPHA 1ZZCA 5FO9B 1XQNA 2ZABA 4GULA 1UNBA 1WLWA 4EWEA 2TUNA 2WKKA 2VVEA 2WFF3 4MGSA 3KV9A 3B69A 3M3EA 2HWE2 1OKOA 2E6VA 1QJU2 3ZPOA 4Z2AA 2OXBA 4C91A 1DGLA 3LA2A 3FFZA 2XOMA 3POWA 3BTYA 2YBPA 3AM2A 5L7OC 1D2QA 1LNSA 3HNBM 2BBVA 1WW5A 4RA0A 1SACA 4BU2A 4JRLA 1POV0 1WMDA 1CQ9A 3JUUA 1BZWA 1NG0A 3N7MA 2YPJA 4JKKA 2Q1MA 3C2UA 4OLLA 3SXWA 3X29B 5IK7A 2OKXA 3KD4A 1FOD3 3ZSEA 3EHKA 2BW8A 1W8ZA 3AYEA 1N47A 3CJIC 2IFRA 2OVUA 2RDNA 2VL4A 2WNUB 2HEWF 3I4IA 2ILMA 4META 2W92A 4CDUC 1OC1A 4FQZA 3FHAA 2W87A 3WHTA 4DRRA 1JZ2A 1RIRA 3VBFA 4MV2A 3WF2A 2XL7A 4MADA 1FNYA 2YC2A 5LBCA 3TB0A 5GLZA 3FMGA 4AI1A 1GFF2 1COV3 2QZ2A 3O1VA 1OD3A 1UIJA 2JKXA 3FX3A 3K4ZA 4AOCA 4NRPA 3LFMA 4Q0PA 3ZXAC 1RUH2 4MGTA 1HV1A 4R9AA 1PK6B 1CESA 3E1F1 1NQDA 3HD8B 4LO5B 5D8AB 4EZ4A 4RL7A 1R081 1CAUA 1VRH1 2VZVA 3ZXGA 4ZU7A 3I3QA 4LEJA 3WOGA 4Q4Y3 4TWTA 1JU4A 1HXS2 2BNMA 4NPLA 2PYTA 3LGRA 5DDJ1 4FT8A 1UCXA 4OFGA 2HBTA 5CKQA 1LKNA 3NQHA 4RQPA 4Q4W3 2NYYA 5T52A 4D7YA 3U78A 1BJQA 5DUWA 3WINE 2WFPA 4JKMA 4AVAA 2ZA9A 3KB5A 1V6OA 2GC0A 3LZZA 1AR82 2A6YA 2GH8A 3I3DA 4MOAA 5F32A 5FUNA 3VKMA 5I0SA 3K77A 1YFXA 1CAXB 2PHDA 4EJRA 1ND3C 3LDRA 4LBQB 4P9JA 3TRSB 3IAQA 4UI9L 5FYVA 2J1AA 4BCUA 4ONUA 2ZMLA 1UOBA 1SLAA 2RMU2 1PMJX 1XBFA 3PVNA 1IHMA 4DXRA 5IVJA 1RUE3 2VE1A 2Y34A 1CZTA 1RUE2 3MW4A 5FZCA 4Y5SA 3U37A 2CNAA 3KV4A 3ZYRA 5JDBA 5H9PA 5C3SA 1RUH1 4Q4Y1 4XCBA 3J7LA 3VBOC 4GWIA 5F1RA 3E6BA 4IERA 5FP3A 5FXVA 4JGYC 4QGMA 1ND3B 3KLSA 3AP5A 3GHMA 2R072 3BIEA 3A23A 1W6PA 1F4AA 2FCVA 3IMMA 3S30A 4OHWA 2WNUA 2E31A 2CWSA 1SFPA 2ZGMA 1OURA 1MQTB 2UYAA 5FK7A 2CYFA 4AI9A 4OULA 3AX4A 4OQ9A 4A41A 1QJY3 1HB2A 3H1MA 1S0EA 1X8EA 1IOAA 4I3PA 3OG2A 3NNFA 2X10A 4AF9A 3TN92 5GZEA 4QX2A 1UOJA 2Z42A 2V5DA 3RJ2X 3G6JB 1AR62 4UW3A 3VDCA 4LKFA 4ZU4A 2G1MA 1UYPA 3KQRA 3RWKX 2ARAA 1W2TA 2XVLA 3TAYA 1MACA 4CUBA 1QJU1 2NLRA 5IHRA 5DXDA 5L19A 4JQRA 3VBHA 4ZXEA 5E89A 5IW0A 2E51A 4GA9A 3VDDC 4FAHA 4YGBA 4ZU5A 2VZSA 1HKDA 5ABJB 5HXMA 4CEWB 5JSOA 4A7YA 2GP3A 4LA3A 4YGDA 5IFPA 5KXEA 3SITA 1ULCA 2YC0A 1A3KA 4ZY9A 3ZKYA 1ZZ8A 1DGWA 4QKDA 2WWJA 5IVFA 3JQXA 1Y43B 4KGGA 5A3WA 5A32A 1MS9A 1TMF1 2A70A 1PGSA 4WBBA 5GZFA 1BVP1 3THPA 3T0DA 1KJLA 2B42B 4P14A 4DO0A 4M0NA 5FY4A 3THDA 1B35C 2HWC2 1YWKA 1PGL1 3H42B 2D3RA 4C1WA 3T1MA 4XQDA 5FWJA 2GALA 4QAWA 1CJPA 4M4PA 5IVEA 3THTA 2YGMA 3LEIA 2RJ2A 4HETA 4YYOA 3KWVA 3KT1A 4BPZA 2HYKA 3ZR6A 2AENA 1GOHA 4LPLA 1OQ1A 2WZR3 5FREA 4AVSA 3TEZA 3N9NA 1QJZA 4IDZA 3MBWA 4Q4V2 5IAVA 4F3JA 5CFDA 1XRUA 2VTXA 4RR3C 1LULA 5FJKA 5C8WA 2OPWA 1JH5A 1D7PM 2VNVA 2VCCA 4GH4A 3OPWA 3OBZA 1D0HA 4NIHA 1SLBA 3VGIA 1GICA 1S4CA 4XTPA 3T2QA 4XBNA 2WWUA 1VAKA 2DFBA 3WNPA 3ZN6A 2RDQA 5JXHA 5KXCA 2FDIA 5E88A 4QXCA 2J7MA 5EPAA 3WEZA 1I3HA 2FDJA 3ZFFC 1MPXA 4Q1PA 4AI3A 3AMNA 2BVVA 3Q8CA 1LCLA 3EMRA 1WLTA 2BOIA 5GJ6A 3ZFGC 5J3UA 5EJ1B 5G04L 1HRV3 4HKLA 3WV6A 5F39A 4FPCA 1DZRA 3THCA 1DHKB 1Z7S2 2ZOEB 4X6QB 1W6MA 5C4WA 1IKQA 3OF1A 5DUUA 5A7SA 3VBUC 3WDTA 1CAVB 3W20A 4DEQA 1DU3D 5J1XA 1RUG3 5D1IA 1VBE1 1YQ5A 4EN0A 1R1A1 2B9VA 4TN7A 1LR5A 4IQPA 2VMCA 1G9CA 4BE3A 1H8TB 4AEMA 5ABJA 5GM0A 1NA1C 3UESA 1PIV2 1URXA 5FKBA 5KHJA 2XKPA 4LK7A 3VHPA 2CV6A 4M0HA 2ARBA 2OQ6A 1QDOA 4FTSA 1DYPA 3WQ1A 1D4VB 3TEXA 1FMD3 2WN3A 2PHFA 4YVWB 5J36A 3MHZA 2WL1A 2PLV1 1AR93 4CP9A 3H8UA 5SV8A 1A8DA 3USSA 1I1EA 4Y1VA 1H8TC 5KHHA 4IETA 1LESA 4LNVA 3H1YA 5F3EA 1PGW2 4AHWA 3U75A 2W9XA 2ZHLA 2ADDA 4AE2A 1H2MA 1OA2A 3BOPA 3PHMA 3BGAA 3I2FA 4LQRA 4N7UA 1MEC1 3W9AA 1MVEA 1MS1A 5AC91 1JBCA 5LA0A 3FN9A 5EFUA 1JW6A 1UY4A 1W3XA 1ZNPA 2NM1A 2RS32 1RUF2 1LGCA 1PX3A 2PTMA 2VUDA 3GCWA 4QQOA 4WM7B 2K2SA 4FOYA 2XG3A 3VKNA 3AP7A 2LRPA 2WSUA 2OYZA 3NMBA 5KHGA 4XACA 4OUEA 4G9SB 4NR1A 4BQ1A 2RJLA 3WD5A 1PM7A 4IESA 2DF7A 4QX8A 2VUJA 1BK0A 2VQAA 1WA4A 1BQPA 2E53A 4B4QA 2Z79A 5JZGB 3HN1A 5FPXA 4MXVA 1TMF3 4IEWA 1JMUB 4EN9B 4MHUA 5EV7A 1LEMA 2YY1A 2AEYA 3SCHA 3AXEA 1AXYA 1COV1 3ITQA 2GN7A 5C4WB 3VHNA 5FZ7A 4JGZC 5LW9A 1UZVA 3CDZB 3RZKA 1KFUL 1W90A 4XDPA 3KVAA 3VD7A 4OYUA 2WT0A 1YQ6A 2ZKNA 3NWKA 1O6UA 2LTNA 4N8MA 4OHXA 3ROUA 2XB6C 4P9IA 4AHYA 4D6SA 5A6XA 3OEBA 5HV0A 4QX0A 2EXKA 1SCRA 2Q5TA 1OF4A 2Q1FA 1TVGA 1KXGA 5E16A 1PO11 5A3PA 1LHNA 1WUVA 2B4KA 1AX1A 1V6LA 4QPIB 4V1PA 1NLRA 1EP0A 3VZLA 4XUOA 4ZS3A 5FZGA 1NY72 3GCXA 1W6QA 2XKOA 2ZEXA 2UY9A 4YM2A 3BYWA 4ZS2A 5EXOA 2WIIB 3N7JA 4HPKA 5JI9A 3VKLA 1US3A 2ZHKA 2HEVF 4AEKA 4EN8B 3KVBA 1SEFA 3OGSA 3EQEA 4E4ZA 5JVVA 4HPKB 1YUDA 3OCPA 4PF5A 3JD73 3ME2A 4RGAA 4AVCA 3OUJA 5HXVA 1QH6A 2VQTA 4LUMA 1D4M1 1QJX3 4H2AA 4QD2A 3GJBA 4PDWB 1CX4A 1BCXA 4CXXA 4QB2A 1F5FA 4HMZA 1RUD1 4JX0A 1AXZA 2XJUA 2Y6JA 4GH4C 1WBFA 2QJVA 3I97A 5GLUA 2Y6GA 2Y64A 3FFQA 3WT3A 5GZGA 4XILA 4Q0SA 3IAPA 4K3UA 1F15A 2PHRA 3AZYA 4I01A 4LIUA 1QGLA 2BNOA 4XFAA 5FP7A 1CN1A 1RHI3 2C24A 1OUXA 1FXZA 3AKPA 1UU6A 1DQ5A 3ATGA 3U11A 4HSLA 1CPNA 3WG4A 4MYEA 2C9AA 4RSUA 1Z0HA 1HRI1 2WFF2 2R043 2D93A 2JKBA 5JXJA 1NA1B 1JZ5A 1S0FA 4Q26A 3ZX7A 4BQ2A 1LOBA 4ITCA 4XXPA 5A7NA 1M06G 1GP6A 2Y6LA 2DCYA 4ARXA 2QQMA 2A7AA 3O12A 2AR6A 3T2PA 1S2BA 4DB5A 3M7AA 3IDCB 5BXXA 1JZ4A 1AR81 2A73B 2WZR1 5L36A 1D2SA 3IM0A 1LOCA 4QQ2A 2BUKA 2F4PA 2WS92 4RD7A 5DAXA 4CSWA 1O8PA 2HWB3 5LA9A 2VJXA 5F3IA 5BNQA 1Q8VA 4NRQA 1YQ2A 2RS52 4Q27A 4D7TA 1PK6C 5D8AC 2JD4A 1IS5A 2BNNA 2B9UA 2P6HA 4K8FA 3WQ0A 4ATFA 1YNAA 2H6CA 1UW8A 3A22A 2VNRA 2PHTA 4E9KA 3N7KA 5C8CB 2D7FA 1EV11 4DPNA 1ZVFA 4KWLA 1UN1A 2VMEA 2E32A 1H8TA 5A7WB 3QH6A 3KCYA 1A34A 3RG0A 5C7GA 3CNAA 2DFCA 1OT5A 3N9OA 4UOJA 4DUWA 1R1A3 2XQXA 5DPNA 3O0VA 3MO4A 2C0ZA 4LK6A 1ASJ3 5A6YA 2R061 3GBWA 1PMIA 4EE2A 5A3LA 3M3IA 1QXJA 2O8QA 4Z8BA 4UYBA 4BM8A 4IGQA 4YVWA 1GUIA 4N7IA 3WW2A 5C3PA 3LSEA 3K4AA 4QMAA 4BHPA 1PO13 3NKTA 1XU2A 1P8JA 1NE4A 1RB8G 1X9PA 4AG4A 4CU7A 4YZ3A 1FX5A 4CA9A 4Q0UA 5JPNB 2WS91 3WNNA 3O0XA 4JRAA 4BQ3A 3D5OA 4YWAA 3ZPYA 2J1VA 1JZ7A 5BNNB 2NQYA 4HVOA 1SFYA 4FQ4A 4UXAA 1GZ9A 4PCRA 2P4EA 3AYDA 4XFIA 4COWA 1W0OA 3POIA 5FYTA 1AVBA 2QQLA 2XHNA 3I2DA 4M3CB 4DMIA 4UF0B 2R1BA 5A3TA 2RM21 1HRI2 2WFF1 1DQ2A 2DCJA 2J42A 4AL9A 3IWZA 2YHJA 4LHSA 4M3CA 4CCNA 1RUC1 3CQOA 1ZRFA 1JYTA 3GZTB 2I45A 1WLDA 2QNKA 3R05A 4W4ZA 2HH9A 2VNGA 3C7EA 1NCRB 2OZJA 3KT7A 3NAPA 4GQ7A 5FZ4A 3VD3A 3MUY1 3OSDA 3ILNA 4WM8A 3HJRA 1J3RA 5JSRA 1SBDA 1U5YA 4PQQA 5F37A 4UFKA 5K4LA 4CP1A 4CPBD 1NCRA 1CZSA 3LOBA 1AR92
chains in the Genus database with same CATH topology
1JOBA 1JYTA 1F35A 1ZRIA 1JODA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JOB A;  1JYT A;  1F35 A;  1ZRI A;  1JOD A; 
#chains in the Genus database with same CATH topology
 1RVF 3;  4KU8 A;  3ZYJ B;  4GAZ A;  2JX9 A;  4LHN A;  3AZW A;  4IEX A;  5C70 A;  1H9P A;  4FFG A;  4NHY A;  4PBO A;  3ZYG A;  1H1M A;  2DTW A;  3VL8 A;  2IZW A;  5HCH A;  5BNP B;  4XXA A;  1UYY A;  2G9Z A;  4AW7 A;  1IQD C;  1EAH 1;  4N43 C;  1QH7 A;  4BLI A;  3I2I A;  2D6M A;  3IBM A;  1UMI A;  1HV0 A;  2QBX A;  5HBA A;  1LHW A;  1WCU A;  1XJA A;  3WP4 A;  5AC9 2;  1LOD A;  5LAT A;  4RYD A;  4RGG A;  4BK5 A;  2ZGN A;  4QPW A;  4F8A A;  3RQ0 A;  4AXO A;  2RS3 3;  2W1W A;  1YJL A;  4YZ5 A;  1ZM1 A;  3WF3 A;  3HVD A;  1KRI A;  4CEY A;  3H3L A;  4IGP A;  3ZYP A;  1Q56 A;  1HB4 A;  5LRR A;  3B93 A;  1GQH A;  2JEC A;  1ZZB A;  4NAM A;  1N3Q A;  1PNG A;  1UO9 A;  3MPP G;  5EYX A;  4CEY B;  5JWP A;  3JB8 A;  4XW3 A;  3ZXJ A;  3HOB A;  4CU6 A;  1G9D A;  3WQB A;  2CHH A;  4GJY A;  4HSJ A;  4QHB A;  3WY6 A;  2UUR A;  3CMG A;  4QB1 A;  2LAL A;  2VGD A;  5FZ8 A;  5CIS A;  1GU3 A;  5T5J A;  3R6S A;  4FBF A;  1TNF A;  2ZGT A;  5A3U A;  1W39 A;  5F5Q A;  2R16 A;  1LEN A;  5C3Q A;  2D6O X;  2IVJ A;  3EB7 A;  3SH5 A;  5JCT A;  5FAX A;  1VRB A;  3OY8 A;  3N35 A;  5DAV A;  1VBE 2;  2W1U A;  1TG7 A;  4QX7 A;  4GWJ A;  4CTE A;  3VZM A;  2D5H A;  3M70 A;  2HEY F;  1LOE A;  2KM2 A;  4Q4X 3;  1JYC A;  2TEP A;  1OH4 A;  3LEK A;  3ON7 A;  3VBH C;  5HCB A;  5FWE A;  1XNA A;  2FDF A;  4B1L A;  2R32 A;  1RL3 A;  1G9F A;  2RDR A;  1F4H A;  2X5I A;  5FIX A;  3QBQ A;  5FPU A;  4WM8 B;  4BK4 A;  5A70 A;  3HQU A;  3M3Q A;  1BMV 1;  4LT5 A;  1RUF 1;  1US2 A;  2RS3 1;  3ST7 A;  2QVS B;  1EUT A;  2XVG A;  5BNN A;  4HAN A;  3PJY A;  5I0D A;  1S0B A;  1MEC 2;  4OI4 A;  1LRH A;  3ACG A;  5FYU A;  1BBT 2;  2LS6 A;  5F5C A;  1L7L A;  1XNK A;  2BRT A;  5FMC A;  1MS0 A;  1SDW A;  1UU5 A;  3A21 A;  3I3M A;  1QJE A;  3ECQ A;  3ZN6 B;  4E8D A;  4EWA A;  4NIG A;  4YVS B;  1ULG A;  2GNM A;  4V2V A;  2ZZJ A;  2RG4 A;  4JV4 A;  1VAM A;  1QJX 2;  3FE5 A;  1CZV A;  4ZXK A;  1YI7 A;  5FZE A;  3RI9 A;  2W3J A;  2B45 X;  1W0N A;  2PLV 2;  4J1X A;  5LA2 A;  4Z2W A;  1QEX A;  2W95 A;  5EQU A;  1POV 1;  3WLU A;  1AR7 2;  1UQX A;  1DP0 A;  1YYN A;  3U07 A;  1VRH 3;  3RZJ A;  1H4G A;  4OCT A;  4FI9 A;  3ZYH A;  4LO6 B;  2ZGO A;  2Z2S B;  4Q4V 3;  4YVW C;  3ZIX A;  1W8H A;  4C1X A;  2CAU A;  5FY0 A;  3URF A;  4CDX C;  1PIV 1;  3KCC A;  1C5H A;  4Q29 A;  4WZC A;  5FZ0 A;  1IPJ A;  3UT0 A;  3WVJ A;  3SKJ E;  1UXZ A;  1WCK A;  4B3N A;  1JI6 A;  1SBE A;  4CDU B;  4XC9 A;  3K3O A;  5F6L B;  1N1S A;  4LTA A;  1MZE A;  3AJY A;  4AQT A;  1ENR A;  3L9J T;  2XDV A;  1PMH X;  3J8F 3;  4H7L A;  5FO7 B;  4CDU A;  2DVD A;  1DGW X;  1I5P A;  2ZCW A;  3LB9 A;  1UKR A;  3SLI A;  5JOY A;  1O3R A;  3SH3 A;  3WW4 A;  2CWM A;  1WGP A;  3W5M A;  1F5J A;  1OMI A;  3KMH A;  4FXK B;  3FJS A;  2D6K A;  4GIQ A;  1C4R A;  3MLL A;  1W05 A;  3PJQ A;  4LHL A;  4ORF A;  4W65 A;  2FDK A;  1QJU 3;  5LBF A;  4QWN A;  3Q8A A;  3AK0 A;  3LWC A;  5JOZ A;  4CDQ B;  5FYB A;  1KS5 A;  4W6X A;  2D97 A;  4AI0 A;  2R7E B;  4KG0 A;  4HBN A;  3VBH B;  4J1W A;  3J26 N;  4A3Z A;  1YEW A;  3OYW A;  5FMO S;  5DUX A;  1ZZ6 A;  2GSY A;  3MV0 1;  2YFZ A;  3UK9 A;  4AED C;  4LBO A;  3B00 A;  4COY A;  2G9F A;  4XF1 A;  1LOG A;  2Y60 A;  1DQ4 A;  2EF6 A;  4UBG A;  1ULF A;  2WSV A;  4A2U A;  1GBG A;  1W06 A;  4LUL A;  4DIN B;  4N53 C;  1F2N A;  1AR8 3;  1YJK A;  4GH4 B;  5I0R A;  4M3C E;  4LLF A;  5LK5 A;  3KGL A;  1RUG 2;  4FTE A;  4MHR A;  4Q0Q A;  1JOB A;  4NPR A;  5L7O B;  1L7R A;  1Y3T A;  3PUA A;  4JCK A;  4LHK A;  5ANQ A;  4C90 A;  3OTF A;  2CDO A;  5JLV A;  5FY1 A;  4D6Q A;  3AJZ A;  1VMJ A;  2W47 A;  2ZGK A;  1TNR A;  4XAA A;  4Q8L A;  3H9A A;  3ZYI B;  4QQP A;  4B8E A;  2BGP A;  4B29 A;  2E7A A;  2YMZ A;  2NMN A;  2ES3 A;  1CGP A;  2R07 3;  1RUE 1;  4YM0 A;  3M2M A;  2EXJ A;  2VZP A;  1H2K A;  5DQ0 A;  5KC5 A;  1AYM 3;  2VZ1 A;  5BNP A;  2Q8O A;  1WCD J;  1RUD 3;  3CKH A;  3SCG A;  1VBC 2;  4U36 A;  4Y24 A;  1C8N A;  1WA6 X;  2VMG A;  2J1S A;  1QOS A;  3EBR A;  4HN0 A;  5D2A A;  1OBN A;  3TWI A;  4CDW A;  4ASK A;  1O3Q A;  2VD7 A;  3AKQ A;  4H7M A;  4QU2 A;  4UWD A;  1V00 A;  4LKD A;  5FJH A;  4ZZ8 A;  4DEV A;  4QQL A;  1VBC 3;  4XBL A;  4D94 A;  4LE3 A;  3IDE A;  4CCO A;  1REF A;  1VAL A;  1O91 A;  2LM3 A;  1RIT A;  2IXI A;  1O59 A;  4BWO A;  4GB3 2;  5J37 A;  5T50 A;  4I0W B;  1PZ7 A;  3H1W A;  3VD9 A;  1UY3 A;  3VD5 A;  2AC1 A;  1W6Q B;  2YXS A;  2VMI A;  1U5I A;  1VMF A;  1XE7 A;  2VMH A;  3AL5 A;  1W8O A;  2FQP A;  5DAB A;  2XPJ A;  4XQ4 A;  2XLF A;  2O14 A;  4RHV 3;  4JAA A;  4WVW A;  2R06 2;  1W9Y A;  5DZF A;  1IG3 A;  5F8P A;  3B02 A;  3E97 A;  1LAJ A;  2XLG A;  1DGR N;  5T55 A;  4IV1 C;  1JU3 A;  3ELN A;  2JB4 A;  5J98 B;  1W9S A;  2XXZ A;  1ZRC A;  2QQU A;  4YG6 A;  3QCW A;  2QQV A;  1SCS A;  1U5Z A;  1WWY A;  2DUP A;  1Q43 A;  3D6E A;  4IW3 A;  1FOD 1;  1HJF A;  5CKM A;  1FPN 1;  3NV4 A;  3SIS A;  2G9G A;  2ORZ A;  3H3U A;  5C8C C;  1YQ8 A;  1S0G A;  4AVV A;  1QWR A;  4N9H A;  1DZT A;  5EIY B;  3KZ4 C;  1K42 A;  2CY6 A;  4LA2 A;  2P3K A;  1FAT A;  2VTF A;  5JOW A;  4XIO A;  1O5U A;  1S55 A;  3U14 A;  1AR6 3;  1WLC A;  5FUI A;  4AFB A;  2YPD A;  2GC3 A;  4GB3 1;  3J4U H;  4RHV 2;  3U0Z A;  3AMM A;  1EPW A;  2VH9 A;  1RUC 3;  3B9I A;  3BTA A;  3N4M A;  5FBJ A;  4JGZ B;  1BVV A;  4FPL A;  4ZON A;  3CU7 A;  4EYU A;  1MQT C;  5CFC C;  1YQC A;  1JZ3 A;  3FLP A;  1JYN A;  1OOP B;  3RRD A;  1AYN 1;  4KWK A;  2BJS A;  1VP6 A;  3E5X A;  4M00 A;  2VOT A;  2QQK A;  5CFD C;  1LHV A;  5A7Q A;  2IXH A;  2VOX A;  4YFW A;  3WSO A;  1XNC A;  2EIG A;  2YUE A;  2R30 A;  3Q8B A;  2YB7 A;  4A45 A;  3LDB A;  4YZ1 A;  3WCR A;  1LHU A;  1VB4 A;  3BCW A;  4CCL A;  5GZC A;  1I6X A;  2J1T A;  1SPP A;  3UNP A;  2JXA A;  5JR2 A;  3ACL A;  4BA6 A;  2UU8 A;  3ZFF A;  1YFU A;  3NST A;  2ZHN A;  3ILF A;  1LOF A;  4MVT A;  3SNM A;  1AR7 3;  1OFN A;  4COZ A;  3IZO A;  5KWR A;  2W1S A;  1O4T A;  1W6O B;  2OS2 A;  3K2O A;  4M4R A;  3ZFG A;  4ET7 A;  5FZK A;  2BTV C;  4XUP A;  1RJ7 A;  5AVP A;  3VBF B;  4AFA A;  4RQP B;  1QJY 1;  4OHY A;  2ZGQ A;  2YU1 A;  4A42 A;  1XC6 A;  1OLQ A;  1DDL A;  1ZX5 A;  2QFE A;  4I09 A;  4OZO A;  5LY2 A;  4NMI A;  3MYX A;  4COU A;  3IB3 A;  5J09 A;  4NWV A;  2YDE A;  4XJ9 A;  2ARX A;  1OOP C;  1RYY A;  3FWE A;  4A6O A;  2VU9 A;  1CX1 A;  1PK6 A;  2W91 A;  4K40 A;  1F9K A;  1XND A;  5D8A A;  3RFR A;  5ABJ C;  1ZBA 2;  2ZPX A;  1TME 2;  3AC0 A;  5IVY A;  2WN2 A;  1NCQ B;  4K6B A;  3WXP A;  3POF A;  3VZJ A;  3V0A B;  1NUK A;  4JHZ A;  3FBM A;  2IXJ A;  2O8O A;  5LY1 A;  1R09 1;  1RMU 3;  2HWB 1;  2VM9 A;  2X53 S;  5FLH A;  1ODN A;  4O7X A;  4OMC A;  3W58 A;  5DG1 A;  4XUN A;  1R64 A;  2HWE 1;  1HW5 A;  2FCU A;  3U4X A;  2WQ8 A;  1J1T A;  1ENX A;  3BN6 A;  4AHX A;  2WZ8 A;  2X09 A;  3QH7 A;  4CCK A;  2NN8 A;  1QXP A;  5FYM A;  5FMO L;  2HWD 1;  2D6L X;  4AED B;  3DV8 A;  5BY5 A;  3WF1 A;  1WMX A;  4GAL A;  4N9I A;  5C3R A;  2WNE A;  4BQX A;  1G6N A;  1LGN A;  1SDD B;  3HN3 A;  2CTV A;  4PBP A;  1O8S A;  1SMV A;  4YW1 A;  5LAS A;  4QDS A;  5I0T A;  4JDM A;  4DIQ A;  3NNG A;  4CEW C;  4CDW C;  4YLZ A;  5FR3 A;  5FYZ A;  4D6R A;  1CPM A;  2LW8 A;  3DGT A;  3W21 A;  2GP5 A;  3CJI A;  2Q8E A;  3IDA A;  4IEO A;  4D7S A;  4I2O A;  2Y26 A;  3ZDS A;  1R1Z A;  3KHC A;  1W6N B;  4HN1 A;  4HT1 T;  1Q8P A;  2J1R A;  5B2G B;  1X36 A;  3AZX A;  3M4F A;  3MIE A;  2WIN B;  3VBU B;  4EN7 B;  2DWR A;  2JIC A;  2D5F A;  4XE9 A;  4IUG A;  2D3S A;  3F2Z A;  4K20 A;  4GWN A;  1J83 A;  5JMC A;  4LO4 B;  4CDW B;  3NNM A;  3ETP A;  3N9P A;  2P3I A;  3MW3 A;  5JIU A;  2CGN A;  3LKJ A;  4MGQ A;  4ZKT B;  3ACI A;  1Y9Q A;  3KCX A;  5L9B A;  2R04 1;  4JC1 A;  4IL7 A;  3Q9O A;  2I2S A;  4CRQ A;  4NO4 A;  3NKG A;  3HBZ A;  5EJ3 A;  4UW4 A;  1JS9 A;  4WM8 C;  3WP6 A;  3JBG 2;  2IXK A;  3AP6 A;  1XYO A;  2JD9 A;  4YVS A;  1OLM A;  3DUI A;  4RS5 C;  4A4A A;  5DN2 A;  1H2N A;  1UU4 A;  1SPP B;  1QXR A;  1V6J A;  3KF5 A;  4AGG A;  1ZYB A;  2WLP A;  3AP4 A;  5FZM A;  2Y38 A;  4QU1 A;  2EID A;  1UPS A;  3WW3 A;  5C8C A;  5KBF A;  3N7L A;  2ZX3 A;  4NPM A;  1UD1 A;  5A1F A;  1HB1 A;  2JG9 C;  3ZSK A;  2BDR A;  4PQ9 A;  2D43 A;  3B7M A;  2JWP A;  1H9W A;  3DPR A;  4GKY A;  4UW6 A;  5IK5 A;  1D4M 3;  3KSC A;  4MG2 A;  5GZD A;  1XSQ A;  3T08 A;  3RDI A;  2V4A A;  3NW4 A;  5L73 A;  1ZRE A;  4KWJ A;  5K7P A;  1UXX X;  1ULP A;  5F2W A;  1ZZ7 A;  4BOW A;  3BPZ A;  3WG1 A;  1GOG A;  3ENR A;  2NZ9 A;  3K75 B;  2UWC A;  2DCK A;  2X29 A;  2XHK A;  2HWD 2;  2ZMN A;  2PHU A;  2BPA 2;  2OQ7 A;  3P3N A;  1DYK A;  2PEL A;  2ZGS A;  3SQO A;  3VB9 A;  3RZM A;  2B7Y A;  1C57 A;  4AVB A;  1G8W A;  3MIB A;  5EWS A;  4PDW A;  1MS5 A;  4M3C F;  2RR1 3;  4PJY A;  5LK7 B;  3CF6 E;  2KD7 A;  4QGL A;  5CIR A;  3VBO A;  1UMH A;  1OLM E;  2W52 A;  3SCF A;  2RV9 A;  3K4D A;  3K51 A;  1REE A;  1K5M B;  3HWJ A;  1UY1 A;  1NZC A;  3PVO A;  3ZKU A;  3U1X A;  4FP3 A;  3GNE A;  5LEJ A;  1E57 A;  3ZVX A;  4Z92 B;  4FOW A;  1Y9G A;  1OA4 A;  5FYI A;  1ZBA 1;  2EXI A;  3F95 A;  1AL2 2;  2XBO 2;  4Q5O A;  4Y1Z A;  2WO7 A;  3R4S A;  1YI9 A;  3WQ7 A;  3I2J A;  4E4H A;  4D0Q A;  4F7Z A;  1MEC 3;  2WNV C;  1PO2 3;  4U2A A;  4E2G A;  5DAP A;  4E8C A;  4TXW A;  1ULE A;  1O5L A;  2JDM A;  4S2G A;  1ONA A;  4LXL A;  3NAP B;  2A6X A;  1QJY 2;  4L8Q A;  1UF2 C;  4BB3 A;  4WVM B;  4XF9 A;  4KQ7 A;  4XJZ A;  2QE3 A;  4B4P A;  4MO3 M;  3ACF A;  1UIK A;  5GLT A;  3ETQ A;  3OB8 A;  4Q4X 2;  3RYK A;  1Z78 A;  1RHI 1;  5FPB A;  3VDD A;  1W2O A;  3ZFG B;  3GJA A;  1VIW B;  5FP9 A;  4CUG A;  1R08 3;  1RUJ 3;  4TYS A;  2QQP A;  2DVB A;  5FOJ B;  3TYJ A;  4GMP 0;  5DMY A;  2VMF A;  1GZW B;  1IGO A;  1OPO A;  3FLT A;  5LEK A;  1QIQ A;  2W68 A;  2WT2 A;  1V6K A;  1JOP A;  2DU1 A;  2EIE A;  1C28 A;  3LPF A;  4MSV A;  3DL3 A;  2XL9 A;  2CU5 A;  2VO5 A;  5AFB A;  4IE5 A;  2RM2 2;  1AYN 2;  3UGG A;  3OOX A;  3GF6 A;  4HG6 B;  3FL7 A;  3QAC A;  4H14 A;  3O1T A;  1UOF A;  4BZ4 A;  2EAL A;  1CON A;  1W8N A;  1MS3 A;  2WWS A;  4IND A;  5FZ3 A;  5F5I A;  1DYO A;  1OVP A;  3POE A;  2UY8 A;  1RXF A;  2RS1 3;  2AYH A;  2VCB A;  4CE8 A;  2FMY A;  2HWE 3;  3HR9 A;  2BGO A;  1HRV 1;  1RUI 2;  1ZBE 2;  1OSG A;  1KFX L;  2BBA A;  4PLN A;  5L9R A;  5HPO A;  1OVS A;  1TME 3;  2ZZQ A;  2QQI A;  3SHR A;  2FCT A;  4Q8K A;  2RS1 1;  2WYF A;  4QGN A;  4RR3 A;  4XFC A;  1QQP 3;  3III A;  1C1F A;  4LIT A;  4LOT A;  5JZG A;  2ERF A;  4E27 A;  1WBL A;  5FYH A;  5EJZ B;  4ZZ5 A;  1EY2 A;  1BLZ A;  1FPN 2;  3OUI A;  4S2F A;  1PVX A;  3HQR A;  3FUQ A;  2BER A;  1BYH A;  3PL0 A;  3BB6 A;  5B4X A;  2F4L A;  4XF4 A;  1L7Q A;  1SLL A;  2XJS A;  3WDX A;  4P9W A;  3E5Q A;  4A7Z A;  3UYJ A;  4XTM A;  2EAK A;  4UBH A;  3VKF C;  1DFQ A;  1GWK A;  5BV6 A;  2W08 A;  5EP9 A;  2Y6K A;  3GGL A;  4HL0 A;  1PIV 3;  1ZZ9 A;  2GNB A;  2YU2 A;  3OJB A;  5A80 A;  3RS6 A;  2QUO A;  3HPN A;  5FZI A;  1X7N A;  5LRS A;  2JDU A;  2QDN A;  5JXI A;  3ZSJ A;  3VBU A;  2WUH A;  2JDH A;  5FY7 A;  2TNF A;  2GU9 A;  3ZN5 A;  3ALQ A;  3W59 A;  5BNO A;  3O1O A;  2RS5 1;  5IAT A;  3OGR A;  2AGS A;  3CIH A;  5F5A A;  5FBZ A;  4YW3 A;  4BMB A;  2Q8D A;  4Q0V A;  1WD4 A;  5BNO B;  3OGG A;  1JOJ A;  3H8R A;  3GZU C;  1XSR A;  4QT6 A;  2VC9 A;  2NPI A;  2JG9 A;  4CPB A;  3J8F 1;  1Y9M A;  2D6P A;  3MIG A;  1WW7 A;  2XQR A;  3DPR C;  3KV5 A;  1AJK A;  2G4I A;  4AFD A;  1W3V A;  2ZEW A;  3JBG 3;  3USU A;  3BTZ A;  1UYX A;  4HVQ A;  5DDJ 2;  1TQ5 A;  2W2I A;  3WG2 A;  1K3I A;  1OHF A;  3FBY A;  5B4N A;  2BFU L;  2XJR A;  1OF3 A;  1VBA 3;  2ZAA A;  3I7D A;  2VOW A;  4CUC A;  3A0N A;  1XU1 A;  4I0B A;  3T4V A;  2PAE A;  4Q1R A;  3P1I A;  2MHF A;  4ISR A;  4AK3 A;  4ASM B;  3OGJ A;  3GBG A;  2Q8C A;  1ALY A;  1GNH A;  4YW5 A;  2VTX J;  4AR2 A;  3DXT A;  4NHK A;  1Q8S A;  2RR1 1;  2ATF A;  4ISQ A;  4K7J A;  1LU2 A;  3GZA A;  2K9Z A;  5F7U A;  2XJV A;  1ULD A;  2A1X A;  2VW1 A;  5A7O A;  5A7W A;  4X8N A;  4QM8 A;  5J48 A;  3VDA A;  5GAL A;  2WQZ C;  2W1Q A;  2ZAH A;  4NOT A;  3BKZ A;  3O14 A;  1SLI A;  4CU9 A;  2GC2 A;  4JDN A;  4Y26 A;  1DBN A;  4G3Y C;  1D4M 2;  2JG8 C;  3OEA A;  3DYP A;  4P9G A;  4A7K A;  4CXY A;  4FVV A;  1PX4 A;  1A8M A;  3LF7 A;  1QNY A;  2BYV E;  3K46 A;  3PUQ A;  4IV3 A;  1OQE A;  4UW5 A;  5FMB A;  2VPV A;  3HBK A;  3T1L A;  3UKV A;  3AYC A;  4NIA A;  4BME A;  5C33 A;  3WP5 A;  5A3M A;  1NZI A;  2G19 A;  5C71 A;  2FZ2 A;  2BVB A;  3NNJ A;  3KM5 A;  3M1H A;  3BAL A;  4JKL A;  4EZH A;  1TEI A;  1W2N A;  2VMD A;  3VBR A;  2VXR A;  4LBM A;  2XVK A;  4RFT 0;  3P5B A;  1LB2 A;  1DLL A;  1OA3 A;  4XQW A;  1HX6 A;  1YIP A;  2J1U A;  2ARE A;  2WNO A;  4PI0 A;  4DNY A;  4C8D A;  4QHZ A;  5L9V A;  1GZC A;  1QNW A;  2ZHM A;  1E5R A;  5A6Z A;  4N43 B;  3FUO A;  1G86 A;  2YC4 A;  3ILR A;  3VDB A;  2Y0I A;  1X50 A;  3AVS A;  2PHX A;  1G9A A;  2X5I C;  2ZGU A;  2ZXQ A;  1B09 A;  1AHS A;  1NQJ A;  4BQ4 A;  1NCQ C;  2H0B A;  5T5O A;  3O1M A;  1Y7B A;  4NJ4 A;  2DVF A;  5DZG A;  3AKT A;  4HKW A;  2YFU A;  2QCS B;  5BNN C;  2JIG A;  4IGO A;  3JU9 A;  1QQP 1;  1JHN A;  2FBE A;  2GH2 A;  4XFH A;  4I02 A;  4WVM A;  2B46 X;  4XMA A;  5I8Y A;  4Y1X A;  1H1A A;  2VUL A;  1RHI 2;  1DGR A;  2VQ0 A;  4AAP A;  1RUI 3;  1ZBE 3;  2OW4 A;  3T09 A;  2QKD A;  1BEV 3;  3NJV A;  2Y6F A;  4A3X A;  3VBS C;  2UWA A;  3TNP B;  3ZSM A;  2BV4 A;  3B94 A;  2QQJ A;  4MUV A;  2PXJ A;  4P00 B;  3ZYF A;  3PTR B;  4PF1 A;  3OPT A;  4LO7 A;  3BU7 A;  5D21 A;  3V64 A;  2CAV A;  5FZH A;  2JEN A;  4MLO A;  4Y22 B;  4XF3 A;  3C7G A;  4D8M A;  2BEO A;  3MF9 A;  5HCA A;  4A6S A;  1QJX 1;  5FP8 A;  5LBE A;  2B5H A;  2I74 A;  4CYD A;  4NHM A;  2QTW B;  1IS4 A;  1OD5 A;  1VR3 A;  3Q8E A;  4CDX A;  1OI6 A;  3EXU A;  2DUO A;  2K0G A;  2XLA A;  1W9T A;  3DXU A;  2R49 A;  4K1Y A;  3AKR A;  4XEZ A;  1AYM 1;  1S2K A;  3IPV B;  3T4H B;  1C8M 1;  4HON A;  1VB2 A;  5DZE A;  4I3G A;  3SMH A;  3VBF C;  5IAX A;  1GP4 A;  1RUJ 1;  5APA A;  5JUV A;  3C3V A;  1W9W A;  1AF9 A;  3ES1 A;  1IPS A;  4Z82 A;  4NRO A;  5FKC A;  3C7F A;  2GN3 A;  1I5Z A;  3GHN A;  2C1F A;  1PGW 1;  3FHQ A;  3QD6 A;  1LTE A;  1UKG A;  4RGK A;  2VBD A;  4X8P A;  4XUQ A;  2D40 A;  5CVR A;  1YFW A;  5F3G A;  3OBT A;  1FNZ A;  1NT0 A;  2ORX A;  4NHL A;  1ZRR A;  1KDM A;  2ARC A;  3LA7 A;  5F2S A;  4I30 A;  1N1Y A;  2P3Y A;  4Q4W 2;  3AMP A;  5DAQ A;  5FLI A;  3ZXL A;  1ODM A;  3Q8F A;  4AWD A;  4YSF A;  1UWW A;  4IE6 A;  2ID4 A;  5DG2 A;  5FUP A;  5KR7 A;  3UGF A;  4QPI C;  2XJQ A;  1CIW A;  4IEV A;  2F6B A;  4FPE A;  4KGQ A;  3GAL A;  4P5H A;  4R8H A;  1OOP A;  4AED A;  1N1V A;  3O1R A;  3JD7 1;  3NVC A;  1AYN 3;  2A6V A;  5CFD B;  4K1Z A;  1GWL A;  3V56 A;  2V09 A;  4UFL A;  4BDV B;  3I3B A;  4XHB A;  4LR4 A;  1NLS A;  4EQV A;  3HNM A;  2W0X A;  2ZX0 A;  4XUR A;  5I8S A;  4HZF A;  4XFG A;  2VVF A;  2RMU 3;  2WDB A;  1YHF A;  3ZN4 A;  1NX9 A;  4K9S A;  1F31 A;  1WMF A;  3CLP A;  5E8A A;  3BUC A;  4TLG A;  4W6W A;  5CNA A;  1PZ8 A;  2Y6H A;  1XNB A;  3VBR B;  4Y3O A;  5FZ9 A;  4RFR B;  3CJI B;  5FQ0 B;  2WAO A;  5A3O A;  3RZH A;  1VBA 1;  2P17 A;  2WAB A;  2VZQ A;  3IN9 A;  3LEM A;  3LIG A;  5FY5 A;  1W6M B;  1W03 A;  3CEW A;  2E7T A;  2OII A;  2Y0O A;  4UFJ A;  4PI2 A;  1SQ4 A;  4Y5T A;  2L9L A;  1JYX A;  1BBT 1;  4W50 A;  2MEV 1;  1GOF A;  5CG9 A;  2V4V A;  1C8M 2;  1SZB A;  1U12 A;  4FPY A;  4HVR A;  3MUZ 1;  3SEP A;  2WLQ A;  4UFH A;  4ES9 A;  3GDB A;  2QQW A;  3LA3 A;  1SBF A;  1K12 A;  1GQG A;  5C5T A;  5DAW A;  1QOO A;  1LED A;  2E9Q A;  3IPV A;  4Q4V 1;  1KD7 A;  1X9T A;  3WUC A;  2SLI A;  1WCQ A;  3ZFF B;  4AVT A;  5BUV A;  1GV9 A;  1BEV 1;  4IV3 C;  3PVE A;  1AR9 1;  4AEJ A;  1H6Y A;  4G4F A;  1RUN A;  4B1M A;  3ZXE A;  3NL1 A;  4BQ5 A;  3JB4 C;  2XH6 A;  5CG8 A;  4HOO A;  2BQP A;  1PHM A;  2C5D A;  2ZEY A;  4FCA A;  2V72 A;  1YXW A;  4BQW A;  1ZA4 A;  1TZO A;  2HWC 1;  4TTG A;  1VE0 A;  1PGL 2;  1YC6 1;  1UZW A;  2ET7 A;  3J7M A;  4CCD A;  2YYO A;  1XE8 A;  1HN0 A;  4YW4 A;  2Z69 A;  5T3N A;  2DVA A;  2HWD 3;  2DUR A;  3DKQ A;  1DZQ A;  1J1L A;  3S6P A;  1W99 A;  4N90 A;  2MEV 3;  5FZF A;  1QHD A;  4NAO A;  2C9K A;  1UX7 A;  4YVS C;  3TN9 3;  2CDP A;  4MGK E;  1M4W A;  4XOG A;  3AMH A;  3K48 A;  3OUH A;  1W8U A;  3GM8 A;  3D0J A;  5GLW A;  3ZDV A;  4TZD A;  1NCQ A;  3MV1 1;  1XYN A;  1JZ8 A;  1VMH A;  3I2O A;  3D0S A;  1RMU 1;  3BIW E;  3BOD A;  5IVC A;  2VY0 A;  2BOJ A;  2VBP A;  2D3P A;  3EYP A;  3TEY A;  1DIW A;  4SBV A;  5FZO A;  3UL2 A;  4W6Y A;  1TME 1;  5FY8 A;  3RMX A;  3GZE A;  2WZE A;  3N36 A;  3ZO0 B;  1S0D A;  4HLT A;  4LIV A;  2VCA A;  5T5P A;  4FPF A;  4L2N A;  3VBS A;  4N43 A;  4ES8 A;  1N3O A;  2ZAC A;  3WNM A;  3IT8 A;  5FQ0 A;  1DQ6 A;  4IE4 A;  1EAH 2;  4OQ8 A;  3VBS B;  1NE6 A;  1VBE 3;  2P34 A;  2ENR A;  4XZU G;  1S0J A;  1DQ0 A;  1NLQ A;  2Z5W A;  3KT4 A;  3PIJ A;  4OVE A;  4YG0 A;  1GYK A;  1BBT 3;  1LHO A;  3OPZ A;  1W8W A;  4CEY C;  3H8X A;  5FO8 B;  4N53 B;  3PU8 A;  3KV6 A;  2HWC 3;  3MIH A;  4FO9 A;  5K9Y A;  4S2D A;  4YW7 A;  4BIS A;  1EV1 2;  5HCF A;  1W6N A;  2R07 1;  4PIY A;  4AFC A;  2HYX A;  1D0G A;  3PVB B;  3ZSL A;  4Y1Y A;  2DCT A;  4I0A A;  5JAX A;  2OUJ A;  2H0V A;  1ZRD A;  1OFS A;  1PM4 A;  3ZOI A;  3AVR A;  1ULO A;  1OXC A;  1XB9 A;  5FPA A;  1RUC 2;  2A71 A;  4XFB A;  2BU9 A;  3S0M A;  1BKZ A;  4IV1 B;  3DPR B;  4KI5 M;  4YW2 A;  1J3P A;  3LQC A;  1AL2 3;  2XBO 3;  1QJF A;  2RM2 3;  3AFK A;  3IDB B;  4LLO A;  3U10 A;  3O1U A;  2A3X A;  3NO8 A;  4IXL A;  3ZXK A;  4CCC A;  3CZJ A;  4DUX A;  1ND2 A;  2WO1 A;  1O4Y A;  2XJT A;  4OUS A;  5IFT A;  2DU0 A;  3WF4 A;  3TEW A;  1A78 A;  5F9T A;  5FZ1 A;  4P9X A;  3QLQ A;  1CVN A;  3DF0 A;  1NKG A;  2BWA A;  2Q0A A;  1VBD 2;  3PU3 A;  3W5N A;  1RGS A;  5FTT C;  4L99 A;  3H0O A;  4YNI A;  5CEH A;  3WW1 A;  4Y4Y A;  1FMD 1;  2W94 A;  1Y4W A;  2ZX2 A;  4XDO A;  5FYS A;  4DZG A;  1IZ3 A;  1AJO A;  1FOD 2;  3MPB A;  3OGV A;  1WW6 A;  3MFA A;  5IK8 A;  4QPY A;  1XPW A;  3POS A;  4CU8 A;  3S5A A;  1ASJ 2;  1Z7S 3;  1T6B X;  1MS4 A;  1JUI A;  5FXW A;  3S5Q A;  4XCA A;  4R9C A;  3E5U A;  3RYR A;  3LEG A;  5JXG A;  1FI2 A;  3C7O A;  4YRD A;  2AH2 A;  5FP4 A;  3EJK A;  2IC1 A;  5CB7 A;  5JI7 A;  2FD8 A;  1UX6 A;  1IKP A;  5L7O A;  3JZV A;  3NJX A;  4ZPI A;  4CP0 A;  3RZL A;  2YRO A;  2WZP P;  4CDQ C;  3M3O A;  5EYY A;  1POQ A;  1L3J A;  2BP6 A;  3H3Z A;  1FMD 2;  4HFS A;  5H9S A;  1W2U A;  4NID A;  1TE1 B;  3WNX A;  1CR7 A;  3OY8 B;  3POB A;  4MGY E;  4D3W A;  1RUH 3;  3SH4 A;  2BGC A;  1CJD A;  4IEU A;  1STM A;  3KS7 A;  5JZG C;  3MZH A;  1VBD 1;  2DYC A;  5EHD A;  4XDQ A;  1XE0 A;  2YBS A;  1WZX A;  2PLV 3;  1J58 A;  1RUO A;  4L9B A;  4CP2 A;  1LGB A;  4GWM A;  5KHI A;  4UFM A;  1YLL A;  1PO1 2;  2P5B A;  3G7D A;  3PNA A;  1RMU 2;  5KHK A;  1GZW A;  5J96 B;  3TNQ A;  3I2G A;  4EWD A;  3POY A;  1C8M 3;  4KH9 A;  2MPF A;  4GMP 3;  3I49 A;  4AZZ A;  1CAV A;  4BXF A;  1VBC 1;  2HWF 1;  1GNY A;  1N1T A;  2WRA A;  1HDK A;  4ATE A;  1JYW A;  1FT9 A;  3RZG A;  3I54 A;  3AFG A;  5GLV A;  3OBR A;  4CCM A;  4F83 A;  2LRO A;  2ZMK A;  4AI2 A;  1HRI 3;  1MS8 A;  3MID A;  4AQ6 A;  4UAP A;  2VZO A;  2ZJC A;  1H8V A;  4JQT A;  4FPG A;  1AUY A;  5A6Q A;  3NV3 A;  2D44 A;  3DYM A;  2IFW A;  5LB6 A;  1NAE A;  3ORJ A;  3UKT A;  1UZ0 A;  5LCW L;  2GND A;  4LJH A;  4QKN A;  1E5H A;  5AFE A;  1UAI A;  4QXH A;  5JR7 B;  3BTX A;  4LOR A;  4CZS A;  1KQR A;  3L2Y A;  4PIZ A;  1S0C A;  1WKY A;  1YFY A;  5H9R A;  4Q4X 1;  4X6R B;  2IVI B;  5JSP A;  4RS5 A;  2LUW A;  3I59 B;  1RC6 A;  4TLF A;  1RUD 2;  1LOA A;  1RVF 2;  5IWF A;  4Z1V A;  1UYZ A;  4C0B A;  2AAC A;  3O7O A;  4QPG B;  3WNO A;  5C6C A;  4JVA A;  4KL1 A;  1G7Y A;  4FTB A;  4IEP A;  3LIH A;  4Y20 B;  1SHW B;  2C6S A;  2VG9 A;  1CAX A;  1OQD A;  4Y22 A;  4BIO A;  3PTY A;  1MR5 A;  4JZR A;  4AGV A;  1W2A X;  2HWF 3;  2NP0 A;  1UMZ A;  3D82 A;  3RMY A;  2CGP A;  4K8R B;  2JDY A;  2UWB A;  1V6I A;  1QY4 A;  4BJ0 A;  4YM1 A;  2ZBJ A;  4L92 A;  2P3J A;  4NE9 A;  3TOJ A;  5C9A A;  3AYA A;  1NYW A;  5FLJ A;  5FZO B;  1NY7 1;  5EZW A;  5E1R A;  4BXS V;  4IV3 B;  3WDU A;  2XON A;  1H4H A;  2JDK A;  3R4U A;  4GXL A;  4JGY A;  4RR3 B;  3WDV A;  5FFO C;  5IT6 A;  5FOB B;  2D98 A;  2ZX4 A;  3RGB A;  2FDG A;  2WO3 A;  2VUA A;  4LBJ A;  4PDW C;  2RDS A;  3HMY A;  4QQH A;  2RVA A;  3LCP A;  3INA A;  2W46 A;  4YZ4 A;  3MFC A;  3PLQ A;  4P08 A;  3OYW B;  3WCS A;  4J25 A;  1G9B A;  1DG6 A;  1W6O A;  3LAG A;  2QDR A;  3A4U A;  3A7Q A;  3FZ3 A;  4QB6 A;  5CAZ A;  4AAX A;  3BVC A;  3MGU A;  3RJR A;  4LBL A;  3I2K A;  2GAU A;  1KGY A;  3J9S A;  1EAH 3;  4WV8 A;  4XZP A;  5CKN A;  3FLR A;  1O4Z A;  2RHP A;  5JIA A;  5K0U B;  3JD7 2;  1GQP A;  3T0A A;  1K5M C;  1NXM A;  1SFN A;  4E2S A;  3IIA A;  5ACA 2;  2V73 A;  3VBR C;  1YRZ A;  2VZ3 A;  5A3N A;  2EA7 A;  1CAW A;  1E5I A;  3ZM8 A;  4AQS A;  1AR7 1;  5CZK A;  2XUE A;  3JXS A;  5A7P A;  2ADE A;  1POV 3;  1XOY A;  3VZN A;  1OH3 A;  3VV1 A;  1BEV 2;  1H6X A;  2A3Y A;  2N7G A;  3AP9 A;  2Y33 A;  2A3W A;  1C5I A;  4MX3 A;  1X8M A;  3V0A A;  3VLB B;  4PHZ A;  1HQN A;  2O0O A;  4LUK A;  1X82 A;  4IV1 A;  1JHJ A;  3PUI A;  3PME A;  2VVD A;  1GAN A;  1KS4 A;  4FOV A;  2QQO A;  3DN7 A;  1PNF A;  1IS6 A;  2PA7 A;  5IVB A;  4NN0 A;  4OI2 A;  2ZGR A;  4UFI A;  4OI0 A;  4AQ2 A;  3JBG 1;  1KJR A;  4OHV A;  3NJZ A;  3V65 A;  3CJX A;  3KHB A;  1ND2 B;  4E4S A;  3KGZ A;  2JE7 A;  3HQX A;  4MGI E;  3T2T A;  2DTY A;  1B35 A;  4CDX B;  1H0B A;  2Z4F A;  2GDF A;  2DUQ A;  1FYU A;  3ES4 A;  3ZMO A;  3RYP A;  4JTO A;  1FAY A;  4DFS A;  2PAK A;  3T2O A;  2P37 A;  3T30 A;  3WUD A;  4HK9 A;  5FZB A;  4CDQ A;  1HN1 A;  2E63 A;  5FY9 A;  1HB3 A;  1OKQ A;  4OUM A;  1WME A;  2BZD A;  4P5Y A;  1IQA A;  2KA3 A;  2ET1 A;  3LOI A;  5FZL A;  2JE9 A;  4RN5 A;  1HQL A;  4R52 A;  4MXW A;  1EPZ A;  1JOD A;  1PVC 3;  4QHO A;  3TBD A;  5ACA 1;  5CFC A;  4XET A;  4COV A;  4QKB A;  3LFI A;  3T3Y A;  1FPN 3;  2HLE A;  3SKV A;  1UOG A;  1RED A;  2HBU A;  3VN4 A;  2W39 A;  3B3Q E;  1XYP A;  2DDU A;  3RZZ A;  3ZR5 A;  1HQW A;  1DF0 A;  1R1A 2;  1VBB 3;  1QQP 2;  5ISL A;  4LKE A;  4NHX A;  3OD4 A;  3E6C C;  4GKX A;  4XHX A;  2ZS6 B;  3R4D B;  4BH9 A;  1I9R A;  1MVQ A;  4KU7 A;  3WZ1 A;  4WVZ A;  4FXG B;  5T5L A;  2WT1 A;  3J7N A;  4XFF A;  3WP3 A;  4GMP 1;  2CGO A;  4GZ9 A;  2VAU A;  3GXU A;  4Q4W 1;  4W8J A;  2J1E A;  2DV9 A;  2KR2 A;  3RPQ A;  3MW2 A;  1Z7S 1;  4M01 A;  5C9A B;  5I93 A;  1V6M A;  2ZKL A;  4FPO B;  1LOF C;  2WA4 A;  3OBA A;  3HEI A;  2WAA A;  3H7Y A;  4QX1 A;  1SLC A;  2ZTN A;  2D6N A;  1OPM A;  4JDO A;  3MEP A;  3FC0 A;  3NRU A;  5C4W C;  2DBI A;  5IK4 A;  5J7M A;  2HWB 2;  2WC2 A;  4QPI A;  1UZZ A;  4XMI A;  3POJ A;  2P2K A;  4OHZ A;  1Q8Q A;  2EVX A;  3NAP C;  1OUS A;  1V6N A;  1W8F A;  2VCM A;  2VBB A;  3ABZ A;  4YPJ A;  4R4X A;  2WYS A;  5I8T A;  5AVA A;  3UJO A;  3SEE A;  1AYM 2;  1NA1 A;  5ANN A;  3TN9 1;  1NCR C;  5FPL A;  4O9E A;  5FK8 A;  1VBB 1;  4P9L A;  3MI8 A;  4DOU A;  2IXC A;  4RQP C;  4BYY A;  2IWG B;  4FFI A;  4XJA A;  1PZ9 A;  2PN5 A;  5JPM B;  1APN A;  1MZ5 A;  2EAA A;  2VOV A;  4XPV A;  4XJU A;  4LBQ D;  4YM3 A;  2JDN A;  1Q3E A;  4ERO A;  5KXD A;  2XWJ B;  4YG3 A;  4GJZ A;  1V70 A;  1X33 A;  4J6G A;  5IJR A;  4GB3 3;  1HXS 3;  4O9G A;  3O0W A;  5C9A C;  1CAU B;  4Q4Y 2;  2YV8 A;  2RJK A;  4XUT A;  3ZFE C;  4B7E A;  3AB0 A;  5FZA A;  2QQN A;  3I8T A;  1NOV A;  2E26 A;  1T2X A;  1TMF 2;  3CL1 A;  3LD8 A;  4EN6 B;  3N9L A;  1V0A A;  2JDA A;  3HT1 A;  2RMU 1;  3JCI A;  2CL2 A;  2VNO A;  4LE4 A;  1ST8 A;  3AMQ A;  4DRV A;  4YAR A;  2GC1 A;  2HWF 2;  1H30 A;  1DCS A;  1Q5O A;  4CEW A;  1QU0 A;  2R0F A;  4AYU A;  3P6B A;  3O1P A;  1UL9 A;  1BK1 A;  3PMS A;  1GSL A;  4P9Y A;  1S1A A;  2C26 A;  4KBB A;  4BLJ A;  4Y5Z 0;  3WHU A;  5FPV A;  2XML A;  3O1S A;  5KXB A;  3H8O A;  1RUF 3;  3M3C A;  3ZYB A;  5FXZ A;  4H3W A;  4V2W A;  5JMO A;  3S7I A;  3WX5 A;  3N9Q A;  4IE7 A;  3MIC A;  2R0H A;  3HAG A;  1K5M A;  4RHV 1;  5HV4 A;  2ZGL A;  1JYI A;  3QOP A;  1AR6 1;  1HXS 1;  2VW2 A;  1ENQ A;  3D8C A;  3CZU A;  1C3H A;  4YGC A;  2VR4 A;  2FMD A;  1RTV A;  5I0U A;  1UY0 A;  4Y33 A;  3B5L B;  4PLM A;  1RJ8 A;  5FPZ A;  1O3S A;  4QKF A;  1XNT A;  2VZT A;  4JGZ A;  2GMP A;  2F17 A;  3CHX A;  5CBL A;  3NV1 A;  3VKO A;  1C1L A;  3LE0 A;  3DYO A;  4YGE A;  4H55 A;  3ZIW A;  3MLJ A;  4AFM A;  2WO2 A;  4KBZ A;  4FFF A;  4WM7 C;  4XAB A;  5A33 B;  5AC9 3;  2FDH A;  1DQ1 A;  1IS3 A;  1LEC A;  2WJS A;  1CD3 G;  2W5F A;  3AL6 A;  3D4K A;  1ASJ 1;  4YFZ A;  3DEM A;  1BHG A;  1EV1 3;  1H1I A;  3V0B B;  3MF6 A;  2BFU S;  5G05 L;  2AEZ A;  4MH0 E;  2DBN A;  2PQQ A;  3VZO A;  4LOS A;  2RR1 2;  1IG0 A;  1CAW B;  1HJG A;  3I3E A;  3BU0 A;  3V0B A;  1W28 A;  2ZEZ A;  3GBF A;  4FFH A;  3VUO A;  5BYN A;  4URT A;  1GZT A;  3VDD B;  4Q2F A;  3WNL A;  3BPS A;  1Q8O A;  3T0B A;  2E33 A;  2YZ4 A;  3KQ4 B;  3ZLI A;  4LKS A;  2KXL A;  3A0K A;  2XUM A;  4XAE A;  1QF3 A;  4XBQ A;  1RUI 1;  1ZBE 1;  3ZMN A;  2WZR 2;  4CXW A;  4QXK A;  1AXK A;  2OPK A;  5FZ6 A;  1IPK A;  3KF3 A;  1ENS A;  2P1B A;  4NVP A;  4QM9 A;  1GKB A;  2DVG A;  2JG9 B;  4E2Q A;  3IKW A;  2PAM A;  2YGL A;  3J8F 2;  4IEZ A;  3WDY A;  5A32 B;  5F3C A;  1RXG A;  4IEQ A;  4KG8 A;  2VZR A;  4JHT A;  4KMQ A;  1W0P A;  1K5J A;  5K0U C;  1UPI A;  2VW0 A;  4XYX A;  2PFW A;  4L97 A;  4GD4 A;  4SLI A;  2XGX A;  1PVC 1;  5CU1 A;  2B8M A;  5ACA 3;  4C0H A;  4BIF A;  1VRH 2;  1R08 2;  2C4X A;  4DUV A;  2PHL A;  1F8V A;  4MXW B;  1GR3 A;  1YCI A;  2J22 A;  2JJ6 A;  4LBN A;  3RSJ A;  1AX0 A;  5CFC B;  5F6K A;  4FP2 A;  1ZA7 A;  3EO6 A;  3OD0 A;  5T54 A;  3NJY A;  2XWB B;  4NUB A;  2XJP A;  2JE8 A;  4XVH A;  4FPH A;  4CUA A;  2OT7 A;  3GYD A;  2WNV A;  3B01 A;  3UET A;  1PO2 1;  5JOX A;  3SC7 X;  3I59 A;  3ZXF A;  3PUS A;  2GZW A;  1T6G C;  4DXZ A;  4QPG A;  1UZY A;  4QX5 A;  4CCJ A;  2JEM A;  3POG A;  4LMF A;  3UGH A;  3RNS A;  2VEC A;  1W8T A;  4FPJ A;  3CBN A;  3AXD A;  4NRM A;  1RUG 1;  5FRA A;  4N53 A;  3RVH A;  1VBB 2;  3DEC A;  5A33 A;  4QDQ A;  2HJI A;  4O65 A;  4QDR A;  1O3T A;  2RS1 2;  4HK8 A;  1ZBA 3;  1GP5 A;  5M0T A;  1GMM A;  1UY2 A;  1WCS A;  2IUW A;  1HRV 2;  4FPK A;  3H7J A;  1VBD 3;  3R0R A;  2RE9 A;  3VZK A;  3VD4 A;  1KEX A;  5K8S A;  2PQS A;  3AZZ A;  3VL9 A;  1ZRI A;  5FYC A;  2XR4 A;  1W9F A;  4YW6 A;  2HKX A;  3U4S A;  5FYY A;  2R6Q A;  4OI1 A;  3IMN A;  4O61 A;  3WDW A;  3VHR A;  3ZFE A;  2OUH A;  3NNL A;  5ERL A;  3S7E A;  5IUQ A;  4FAG A;  2ETE A;  2VUC A;  2A6Z A;  1COV 2;  5E6H A;  5CA6 A;  3ZFE B;  4XJ8 A;  3C7H A;  2VZU A;  4HXC A;  2PMW B;  1KDK A;  3USU B;  3WG3 A;  5BNP C;  3K3N A;  2PHW A;  3BOW A;  2GMM A;  4DXS A;  4B7K A;  2WA3 A;  3MDP A;  4OMD A;  1CIY A;  4E4D X;  5LWB A;  4KNC A;  4L0P A;  2NMO A;  1XXN A;  2OX0 A;  2X8K A;  1LJ7 A;  1J59 A;  4LBK A;  2EXH A;  2FZ1 A;  1J3Q A;  2VQU A;  4UT5 A;  2JDP A;  2Y8K A;  1ACC A;  1EUU A;  2VXJ A;  4CP9 B;  1HIX A;  4DY3 A;  1SG3 A;  1JZ6 A;  5DUV A;  4D69 A;  4PT6 A;  1GNZ A;  3RWN A;  2AZ5 A;  3LDK A;  4MZU A;  5I91 A;  1RIN A;  2GNT A;  4L11 A;  4AHZ A;  4FSJ A;  3PDQ A;  2GME A;  3BI3 A;  4IE0 A;  1FV2 A;  2MEV 2;  4IEY A;  3UJQ A;  2OZ6 A;  5FCC A;  1WW4 A;  2WNV B;  3RI8 A;  4DXT A;  4URA A;  1VJ2 A;  4B4R A;  2CSG A;  4LO8 A;  3MIF A;  2MNG A;  2JDZ A;  1AL0 G;  1QMJ A;  1S2E A;  1AL2 1;  2XBO 1;  4CCE A;  3S57 A;  3N9M A;  4NII A;  4K21 A;  1OLR A;  4WM7 A;  1VBA 2;  3AZV A;  3PUR A;  2K46 A;  1AX2 A;  2BWC A;  2O1Q A;  4Y4R A;  3O5S A;  4PIX A;  1B35 B;  3FHI B;  2JB8 A;  1JUH A;  4LBQ A;  4XJW A;  1V9U 1;  3VBO B;  4AGR A;  5DDJ 3;  5LZ6 A;  4EV0 A;  4A44 A;  5BNO C;  4JGY B;  1LU1 A;  2Q4S A;  4ARY A;  2H6B A;  1BMV 2;  4DY5 A;  2YG0 A;  1DLC A;  4BQY A;  1K45 A;  3I2H A;  4MGZ E;  3ASI A;  4XIK A;  1WD3 A;  3JQW A;  1J84 A;  2WQ4 A;  3HT2 A;  3P3P A;  5TSW A;  2ZX1 A;  3MLK A;  2ZGP A;  4XF0 A;  3B9C A;  1S0I A;  1O7F A;  2YBK A;  2Q1Z B;  1ND3 A;  2R06 3;  3HIF A;  1U5X A;  2EIB A;  4R4Z A;  1KIT A;  2X05 A;  1JYV A;  5BPX A;  1FV3 A;  1SLT A;  4WVV A;  1W6P B;  4JTN A;  3N3H A;  3APB A;  2P6C A;  3LSD A;  2B39 A;  1QOT A;  1A6C A;  1MQT A;  2VOK A;  4QXB A;  5HI0 A;  1VLN A;  2JIJ A;  4HKO A;  5CYY A;  5K0U A;  4R9B A;  4NWW A;  3ACH A;  2V5Y A;  2FHR A;  5LA1 A;  3NV2 A;  1F35 A;  3C8X A;  5SV5 A;  5FZD A;  1CWP A;  1H2L A;  1R09 3;  1V9U 2;  5GKA C;  1BXH A;  1R09 2;  3H50 A;  4RS5 B;  2JG8 B;  4DS0 A;  2SBA A;  2Q30 A;  2WNU C;  1RUJ 2;  4P02 B;  1YO8 A;  1JXN A;  1MZ6 A;  1QDC A;  4S2H A;  4ZHN A;  1JN2 P;  2EIC A;  2E7Q A;  5FXX A;  1MZF A;  4R9D A;  2R04 2;  2JG8 A;  3WNK A;  2WR9 A;  1E5S A;  4OZX A;  2QZ3 A;  3AKS A;  3J7H A;  2WBK A;  4DQA A;  3PUH A;  2OA2 A;  3E6D A;  3DCQ A;  3UV9 A;  3ZXD A;  5FMD A;  1HLC A;  1VAV A;  4KWU A;  4QPG C;  3M8L A;  2I07 B;  4Y1U A;  3PIG A;  4UF0 A;  4Z07 A;  5C3O A;  1W04 A;  1GLH A;  3DKW A;  4FOQ A;  3WR0 A;  1JTZ X;  5LBB A;  5A1A A;  1PO2 2;  1N3P A;  1ND2 C;  5IYY A;  5H9Q A;  2DCZ A;  2R1D A;  1NXD 1;  2A5Z A;  4QX3 A;  4CVU A;  2IXL A;  5A1L A;  1RVF 1;  5KC6 A;  2RS5 3;  2X5I B;  3D3A A;  4TSV A;  4YZ2 A;  5IVV A;  3LPG A;  3VHO A;  3HNY M;  1V9U 3;  2AUY A;  2WS9 3;  1YIF A;  4WZF A;  1AZD A;  5FV3 A;  3WF0 A;  1GWM A;  3CO2 A;  4Y20 A;  4PLO A;  1QKQ A;  1EYB A;  2TBV A;  3UKN A;  4ASL A;  5FDB A;  4AI8 A;  1PVC 2;  5CAD A;  2UYB A;  2A6W A;  1U0A A;  3L2H A;  2A75 A;  5C5U A;  1VPH A;  1ZZC A;  5FO9 B;  1XQN A;  2ZAB A;  4GUL A;  1UNB A;  1WLW A;  4EWE A;  2TUN A;  2WKK A;  2VVE A;  2WFF 3;  4MGS A;  3KV9 A;  3B69 A;  3M3E A;  2HWE 2;  1OKO A;  2E6V A;  1QJU 2;  3ZPO A;  4Z2A A;  2OXB A;  4C91 A;  1DGL A;  3LA2 A;  3FFZ A;  2XOM A;  3POW A;  3BTY A;  2YBP A;  3AM2 A;  5L7O C;  1D2Q A;  1LNS A;  3HNB M;  2BBV A;  1WW5 A;  4RA0 A;  1SAC A;  4BU2 A;  4JRL A;  1POV 0;  1WMD A;  1CQ9 A;  3JUU A;  1BZW A;  1NG0 A;  3N7M A;  2YPJ A;  4JKK A;  2Q1M A;  3C2U A;  4OLL A;  3SXW A;  3X29 B;  5IK7 A;  2OKX A;  3KD4 A;  1FOD 3;  3ZSE A;  3EHK A;  2BW8 A;  1W8Z A;  3AYE A;  1N47 A;  3CJI C;  2IFR A;  2OVU A;  2RDN A;  2VL4 A;  2WNU B;  2HEW F;  3I4I A;  2ILM A;  4MET A;  2W92 A;  4CDU C;  1OC1 A;  4FQZ A;  3FHA A;  2W87 A;  3WHT A;  4DRR A;  1JZ2 A;  1RIR A;  3VBF A;  4MV2 A;  3WF2 A;  2XL7 A;  4MAD A;  1FNY A;  2YC2 A;  5LBC A;  3TB0 A;  5GLZ A;  3FMG A;  4AI1 A;  1GFF 2;  1COV 3;  2QZ2 A;  3O1V A;  1OD3 A;  1UIJ A;  2JKX A;  3FX3 A;  3K4Z A;  4AOC A;  4NRP A;  3LFM A;  4Q0P A;  3ZXA C;  1RUH 2;  4MGT A;  1HV1 A;  4R9A A;  1PK6 B;  1CES A;  3E1F 1;  1NQD A;  3HD8 B;  4LO5 B;  5D8A B;  4EZ4 A;  4RL7 A;  1R08 1;  1CAU A;  1VRH 1;  2VZV A;  3ZXG A;  4ZU7 A;  3I3Q A;  4LEJ A;  3WOG A;  4Q4Y 3;  4TWT A;  1JU4 A;  1HXS 2;  2BNM A;  4NPL A;  2PYT A;  3LGR A;  5DDJ 1;  4FT8 A;  1UCX A;  4OFG A;  2HBT A;  5CKQ A;  1LKN A;  3NQH A;  4RQP A;  4Q4W 3;  2NYY A;  5T52 A;  4D7Y A;  3U78 A;  1BJQ A;  5DUW A;  3WIN E;  2WFP A;  4JKM A;  4AVA A;  2ZA9 A;  3KB5 A;  1V6O A;  2GC0 A;  3LZZ A;  1AR8 2;  2A6Y A;  2GH8 A;  3I3D A;  4MOA A;  5F32 A;  5FUN A;  3VKM A;  5I0S A;  3K77 A;  1YFX A;  1CAX B;  2PHD A;  4EJR A;  1ND3 C;  3LDR A;  4LBQ B;  4P9J A;  3TRS B;  3IAQ A;  4UI9 L;  5FYV A;  2J1A A;  4BCU A;  4ONU A;  2ZML A;  1UOB A;  1SLA A;  2RMU 2;  1PMJ X;  1XBF A;  3PVN A;  1IHM A;  4DXR A;  5IVJ A;  1RUE 3;  2VE1 A;  2Y34 A;  1CZT A;  1RUE 2;  3MW4 A;  5FZC A;  4Y5S A;  3U37 A;  2CNA A;  3KV4 A;  3ZYR A;  5JDB A;  5H9P A;  5C3S A;  1RUH 1;  4Q4Y 1;  4XCB A;  3J7L A;  3VBO C;  4GWI A;  5F1R A;  3E6B A;  4IER A;  5FP3 A;  5FXV A;  4JGY C;  4QGM A;  1ND3 B;  3KLS A;  3AP5 A;  3GHM A;  2R07 2;  3BIE A;  3A23 A;  1W6P A;  1F4A A;  2FCV A;  3IMM A;  3S30 A;  4OHW A;  2WNU A;  2E31 A;  2CWS A;  1SFP A;  2ZGM A;  1OUR A;  1MQT B;  2UYA A;  5FK7 A;  2CYF A;  4AI9 A;  4OUL A;  3AX4 A;  4OQ9 A;  4A41 A;  1QJY 3;  1HB2 A;  3H1M A;  1S0E A;  1X8E A;  1IOA A;  4I3P A;  3OG2 A;  3NNF A;  2X10 A;  4AF9 A;  3TN9 2;  5GZE A;  4QX2 A;  1UOJ A;  2Z42 A;  2V5D A;  3RJ2 X;  3G6J B;  1AR6 2;  4UW3 A;  3VDC A;  4LKF A;  4ZU4 A;  2G1M A;  1UYP A;  3KQR A;  3RWK X;  2ARA A;  1W2T A;  2XVL A;  3TAY A;  1MAC A;  4CUB A;  1QJU 1;  2NLR A;  5IHR A;  5DXD A;  5L19 A;  4JQR A;  3VBH A;  4ZXE A;  5E89 A;  5IW0 A;  2E51 A;  4GA9 A;  3VDD C;  4FAH A;  4YGB A;  4ZU5 A;  2VZS A;  1HKD A;  5ABJ B;  5HXM A;  4CEW B;  5JSO A;  4A7Y A;  2GP3 A;  4LA3 A;  4YGD A;  5IFP A;  5KXE A;  3SIT A;  1ULC A;  2YC0 A;  1A3K A;  4ZY9 A;  3ZKY A;  1ZZ8 A;  1DGW A;  4QKD A;  2WWJ A;  5IVF A;  3JQX A;  1Y43 B;  4KGG A;  5A3W A;  5A32 A;  1MS9 A;  1TMF 1;  2A70 A;  1PGS A;  4WBB A;  5GZF A;  1BVP 1;  3THP A;  3T0D A;  1KJL A;  2B42 B;  4P14 A;  4DO0 A;  4M0N A;  5FY4 A;  3THD A;  1B35 C;  2HWC 2;  1YWK A;  1PGL 1;  3H42 B;  2D3R A;  4C1W A;  3T1M A;  4XQD A;  5FWJ A;  2GAL A;  4QAW A;  1CJP A;  4M4P A;  5IVE A;  3THT A;  2YGM A;  3LEI A;  2RJ2 A;  4HET A;  4YYO A;  3KWV A;  3KT1 A;  4BPZ A;  2HYK A;  3ZR6 A;  2AEN A;  1GOH A;  4LPL A;  1OQ1 A;  2WZR 3;  5FRE A;  4AVS A;  3TEZ A;  3N9N A;  1QJZ A;  4IDZ A;  3MBW A;  4Q4V 2;  5IAV A;  4F3J A;  5CFD A;  1XRU A;  2VTX A;  4RR3 C;  1LUL A;  5FJK A;  5C8W A;  2OPW A;  1JH5 A;  1D7P M;  2VNV A;  2VCC A;  4GH4 A;  3OPW A;  3OBZ A;  1D0H A;  4NIH A;  1SLB A;  3VGI A;  1GIC A;  1S4C A;  4XTP A;  3T2Q A;  4XBN A;  2WWU A;  1VAK A;  2DFB A;  3WNP A;  3ZN6 A;  2RDQ A;  5JXH A;  5KXC A;  2FDI A;  5E88 A;  4QXC A;  2J7M A;  5EPA A;  3WEZ A;  1I3H A;  2FDJ A;  3ZFF C;  1MPX A;  4Q1P A;  4AI3 A;  3AMN A;  2BVV A;  3Q8C A;  1LCL A;  3EMR A;  1WLT A;  2BOI A;  5GJ6 A;  3ZFG C;  5J3U A;  5EJ1 B;  5G04 L;  1HRV 3;  4HKL A;  3WV6 A;  5F39 A;  4FPC A;  1DZR A;  3THC A;  1DHK B;  1Z7S 2;  2ZOE B;  4X6Q B;  1W6M A;  5C4W A;  1IKQ A;  3OF1 A;  5DUU A;  5A7S A;  3VBU C;  3WDT A;  1CAV B;  3W20 A;  4DEQ A;  1DU3 D;  5J1X A;  1RUG 3;  5D1I A;  1VBE 1;  1YQ5 A;  4EN0 A;  1R1A 1;  2B9V A;  4TN7 A;  1LR5 A;  4IQP A;  2VMC A;  1G9C A;  4BE3 A;  1H8T B;  4AEM A;  5ABJ A;  5GM0 A;  1NA1 C;  3UES A;  1PIV 2;  1URX A;  5FKB A;  5KHJ A;  2XKP A;  4LK7 A;  3VHP A;  2CV6 A;  4M0H A;  2ARB A;  2OQ6 A;  1QDO A;  4FTS A;  1DYP A;  3WQ1 A;  1D4V B;  3TEX A;  1FMD 3;  2WN3 A;  2PHF A;  4YVW B;  5J36 A;  3MHZ A;  2WL1 A;  2PLV 1;  1AR9 3;  4CP9 A;  3H8U A;  5SV8 A;  1A8D A;  3USS A;  1I1E A;  4Y1V A;  1H8T C;  5KHH A;  4IET A;  1LES A;  4LNV A;  3H1Y A;  5F3E A;  1PGW 2;  4AHW A;  3U75 A;  2W9X A;  2ZHL A;  2ADD A;  4AE2 A;  1H2M A;  1OA2 A;  3BOP A;  3PHM A;  3BGA A;  3I2F A;  4LQR A;  4N7U A;  1MEC 1;  3W9A A;  1MVE A;  1MS1 A;  5AC9 1;  1JBC A;  5LA0 A;  3FN9 A;  5EFU A;  1JW6 A;  1UY4 A;  1W3X A;  1ZNP A;  2NM1 A;  2RS3 2;  1RUF 2;  1LGC A;  1PX3 A;  2PTM A;  2VUD A;  3GCW A;  4QQO A;  4WM7 B;  2K2S A;  4FOY A;  2XG3 A;  3VKN A;  3AP7 A;  2LRP A;  2WSU A;  2OYZ A;  3NMB A;  5KHG A;  4XAC A;  4OUE A;  4G9S B;  4NR1 A;  4BQ1 A;  2RJL A;  3WD5 A;  1PM7 A;  4IES A;  2DF7 A;  4QX8 A;  2VUJ A;  1BK0 A;  2VQA A;  1WA4 A;  1BQP A;  2E53 A;  4B4Q A;  2Z79 A;  5JZG B;  3HN1 A;  5FPX A;  4MXV A;  1TMF 3;  4IEW A;  1JMU B;  4EN9 B;  4MHU A;  5EV7 A;  1LEM A;  2YY1 A;  2AEY A;  3SCH A;  3AXE A;  1AXY A;  1COV 1;  3ITQ A;  2GN7 A;  5C4W B;  3VHN A;  5FZ7 A;  4JGZ C;  5LW9 A;  1UZV A;  3CDZ B;  3RZK A;  1KFU L;  1W90 A;  4XDP A;  3KVA A;  3VD7 A;  4OYU A;  2WT0 A;  1YQ6 A;  2ZKN A;  3NWK A;  1O6U A;  2LTN A;  4N8M A;  4OHX A;  3ROU A;  2XB6 C;  4P9I A;  4AHY A;  4D6S A;  5A6X A;  3OEB A;  5HV0 A;  4QX0 A;  2EXK A;  1SCR A;  2Q5T A;  1OF4 A;  2Q1F A;  1TVG A;  1KXG A;  5E16 A;  1PO1 1;  5A3P A;  1LHN A;  1WUV A;  2B4K A;  1AX1 A;  1V6L A;  4QPI B;  4V1P A;  1NLR A;  1EP0 A;  3VZL A;  4XUO A;  4ZS3 A;  5FZG A;  1NY7 2;  3GCX A;  1W6Q A;  2XKO A;  2ZEX A;  2UY9 A;  4YM2 A;  3BYW A;  4ZS2 A;  5EXO A;  2WII B;  3N7J A;  4HPK A;  5JI9 A;  3VKL A;  1US3 A;  2ZHK A;  2HEV F;  4AEK A;  4EN8 B;  3KVB A;  1SEF A;  3OGS A;  3EQE A;  4E4Z A;  5JVV A;  4HPK B;  1YUD A;  3OCP A;  4PF5 A;  3JD7 3;  3ME2 A;  4RGA A;  4AVC A;  3OUJ A;  5HXV A;  1QH6 A;  2VQT A;  4LUM A;  1D4M 1;  1QJX 3;  4H2A A;  4QD2 A;  3GJB A;  4PDW B;  1CX4 A;  1BCX A;  4CXX A;  4QB2 A;  1F5F A;  4HMZ A;  1RUD 1;  4JX0 A;  1AXZ A;  2XJU A;  2Y6J A;  4GH4 C;  1WBF A;  2QJV A;  3I97 A;  5GLU A;  2Y6G A;  2Y64 A;  3FFQ A;  3WT3 A;  5GZG A;  4XIL A;  4Q0S A;  3IAP A;  4K3U A;  1F15 A;  2PHR A;  3AZY A;  4I01 A;  4LIU A;  1QGL A;  2BNO A;  4XFA A;  5FP7 A;  1CN1 A;  1RHI 3;  2C24 A;  1OUX A;  1FXZ A;  3AKP A;  1UU6 A;  1DQ5 A;  3ATG A;  3U11 A;  4HSL A;  1CPN A;  3WG4 A;  4MYE A;  2C9A A;  4RSU A;  1Z0H A;  1HRI 1;  2WFF 2;  2R04 3;  2D93 A;  2JKB A;  5JXJ A;  1NA1 B;  1JZ5 A;  1S0F A;  4Q26 A;  3ZX7 A;  4BQ2 A;  1LOB A;  4ITC A;  4XXP A;  5A7N A;  1M06 G;  1GP6 A;  2Y6L A;  2DCY A;  4ARX A;  2QQM A;  2A7A A;  3O12 A;  2AR6 A;  3T2P A;  1S2B A;  4DB5 A;  3M7A A;  3IDC B;  5BXX A;  1JZ4 A;  1AR8 1;  2A73 B;  2WZR 1;  5L36 A;  1D2S A;  3IM0 A;  1LOC A;  4QQ2 A;  2BUK A;  2F4P A;  2WS9 2;  4RD7 A;  5DAX A;  4CSW A;  1O8P A;  2HWB 3;  5LA9 A;  2VJX A;  5F3I A;  5BNQ A;  1Q8V A;  4NRQ A;  1YQ2 A;  2RS5 2;  4Q27 A;  4D7T A;  1PK6 C;  5D8A C;  2JD4 A;  1IS5 A;  2BNN A;  2B9U A;  2P6H A;  4K8F A;  3WQ0 A;  4ATF A;  1YNA A;  2H6C A;  1UW8 A;  3A22 A;  2VNR A;  2PHT A;  4E9K A;  3N7K A;  5C8C B;  2D7F A;  1EV1 1;  4DPN A;  1ZVF A;  4KWL A;  1UN1 A;  2VME A;  2E32 A;  1H8T A;  5A7W B;  3QH6 A;  3KCY A;  1A34 A;  3RG0 A;  5C7G A;  3CNA A;  2DFC A;  1OT5 A;  3N9O A;  4UOJ A;  4DUW A;  1R1A 3;  2XQX A;  5DPN A;  3O0V A;  3MO4 A;  2C0Z A;  4LK6 A;  1ASJ 3;  5A6Y A;  2R06 1;  3GBW A;  1PMI A;  4EE2 A;  5A3L A;  3M3I A;  1QXJ A;  2O8Q A;  4Z8B A;  4UYB A;  4BM8 A;  4IGQ A;  4YVW A;  1GUI A;  4N7I A;  3WW2 A;  5C3P A;  3LSE A;  3K4A A;  4QMA A;  4BHP A;  1PO1 3;  3NKT A;  1XU2 A;  1P8J A;  1NE4 A;  1RB8 G;  1X9P A;  4AG4 A;  4CU7 A;  4YZ3 A;  1FX5 A;  4CA9 A;  4Q0U A;  5JPN B;  2WS9 1;  3WNN A;  3O0X A;  4JRA A;  4BQ3 A;  3D5O A;  4YWA A;  3ZPY A;  2J1V A;  1JZ7 A;  5BNN B;  2NQY A;  4HVO A;  1SFY A;  4FQ4 A;  4UXA A;  1GZ9 A;  4PCR A;  2P4E A;  3AYD A;  4XFI A;  4COW A;  1W0O A;  3POI A;  5FYT A;  1AVB A;  2QQL A;  2XHN A;  3I2D A;  4M3C B;  4DMI A;  4UF0 B;  2R1B A;  5A3T A;  2RM2 1;  1HRI 2;  2WFF 1;  1DQ2 A;  2DCJ A;  2J42 A;  4AL9 A;  3IWZ A;  2YHJ A;  4LHS A;  4M3C A;  4CCN A;  1RUC 1;  3CQO A;  1ZRF A;  1JYT A;  3GZT B;  2I45 A;  1WLD A;  2QNK A;  3R05 A;  4W4Z A;  2HH9 A;  2VNG A;  3C7E A;  1NCR B;  2OZJ A;  3KT7 A;  3NAP A;  4GQ7 A;  5FZ4 A;  3VD3 A;  3MUY 1;  3OSD A;  3ILN A;  4WM8 A;  3HJR A;  1J3R A;  5JSR A;  1SBD A;  1U5Y A;  4PQQ A;  5F37 A;  4UFK A;  5K4L A;  4CP1 A;  4CPB D;  1NCR A;  1CZS A;  3LOB A;  1AR9 2; 
#chains in the Genus database with same CATH homology
 1JOB A;  1JYT A;  1F35 A;  1ZRI A;  1JOD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...