1JODA

Crystal structure of murine olfactory marker protein in spacegroup p43212
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
160
structure length
160
Chain Sequence
DGPQKQQLEMPLVLDQDLTQQMRLRVESLKQRGEKKQDGEKLIRPAESVYRLDFIQQQKLQFDHWNVVLDKPGKVTITGTSQNWTPDLTNLMTRQLLDPAAIFWRKEDSDAMDWNEADALEFGERLSDLAKIRKVMYFLITFGEGVEPANLKASVVFNQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Olfactory Marker Protein
publication title The crystal structure of the olfactory marker protein at 2.3 A resolution.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 29
structure length 160
sequence length 160
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06554 Olfactory_mark Olfactory marker protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.390 Mainly Beta Sandwich Jelly Rolls Olfactory marker 1jodA00
1JYTA 1JODA 1ZRIA 1F35A 1JOBA
chains in the Genus database with same CATH superfamily
3IM0A 4FPKA 5FIXA 5CFDC 2R042 1GZWB 2E6VA 3CU7A 4C1XA 3TEYA 2YZ4A 1BMV1 4EJRA 5C9AA 3ZIWA 3VBFB 4XQDA 1XOYA 3K4ZA 5E88A 2W1QA 3LFIA 1D2QA 2RE9A 1MZFA 2XB6C 1LKNA 2WIIB 1ND2B 2OIIA 4JDNA 1N1YA 1PNGA 1KJRA 3G6JB 3HQXA 4HPKA 2QQIA 1IG0A 3BODA 2EA7A 5I93A 4Q4W3 4CDUC 1JYTA 1LOFC 4EWDA 5GM0A 4EQVA 5FV3A 4GJYA 4XFHA 2RDNA 1QOTA 5BNOA 1N1VA 3A0NA 2EF6A 1D4VB 3O1RA 2I07B 5F37A 4P02B 3UV9A 3FL7A 1UAIA 3SH5A 2ADDA 3DYPA 5AVAA 2DUPA 4PHZA 4Z8BA 4NRPA 1HRV2 1WCUA 4BK4A 2VY0A 3N7LA 3OSDA 3WP6A 4FP2A 4AEDA 1WW6A 1C57A 4Q0QA 3VD4A 1ULOA 2CDOA 4LK6A 4A7ZA 2WZ8A 4JGYC 1W9TA 2HEVF 3D0JA 3LEKA 1V00A 1Y43B 1O8PA 5FMDA 4XMIA 4AVSA 4BXFA 1FAYA 4Y1YA 3ILFA 4M3CF 4D6RA 2HWB2 3H8OA 1NAEA 5JOWA 2PYTA 3KCXA 4QHBA 1HV1A 1UZWA 3RZGA 2ILMA 1LGBA 3UESA 3POIA 5FYIA 2LS6A 1OURA 2RS33 3N9QA 4YARA 2W0XA 1MQTB 2DBNA 3F2ZA 4Q2FA 2VZUA 3KM5A 1OLME 4D6SA 1GOGA 1WD3A 5KXCA 2K0GA 2VMEA 1AL22 4MHUA 1MS8A 1CAUA 4DPNA 5C8CA 5DDJ3 1XU1A 5A6XA 2W68A 3WT3A 4ISRA 2F4LA 4FQZA 5DAWA 1E5IA 3ZSEA 4AVVA 3ZFGB 1UY3A 4CCEA 2YBSA 5I0DA 4UFIA 1UZYA 2DVDA 2CHHA 2H0BA 2WWUA 5FZDA 5IYYA 5DG2A 1VBD3 4FTBA 2BNNA 2VQ0A 4A4AA 2XR4A 4L8QA 4FI9A 4K21A 1DFQA 3W9AA 3RMYA 1HN0A 3QOPA 1XYNA 2VZ1A 3E6BA 1RUJ1 1KD7A 1WW5A 2VZPA 4QGLA 2VD7A 4G3YC 2BNMA 4KU8A 4ET7A 2JIGA 1C1FA 1VBC2 3U78A 3AX4A 4YVSA 4Q4X2 4UFKA 3HT2A 4ARXA 1W9SA 3TEZA 4ZZ8A 4Q26A 1GP4A 4AE2A 1D4M2 4P9WA 4YFWA 1HQWA 1CGPA 3MBWA 5FQ0A 4ASKA 5CFDA 3PIGA 1EP0A 4BQ5A 4YM0A 2R043 2GH8A 3I7DA 2WAAA 1AR62 4B4PA 1AXZA 4AGRA 4CXYA 5JIUA 2ZGNA 1WCSA 4P9YA 5DZGA 5EJ3A 4D94A 2A3YA 4AL9A 3LOBA 2DCZA 3PL0A 1GOFA 1NCQB 5LBFA 5K0UC 4MGYE 4FSJA 4E4HA 1UXZA 2JDZA 1ND3B 5I0RA 2WT2A 4TWTA 2G9FA 1AJOA 1X8EA 1QDCA 3PJYA 3UGFA 2PMWB 4PIYA 2WKKA 3MUY1 3SITA 3FUQA 1LOFA 2VNVA 5HXMA 4MVTA 3N9OA 1X9PA 4L9BA 1AUYA 4LHNA 3KF3A 3NNLA 3MFAA 4IEVA 4Q1RA 4UFMA 4AEJA 3IMNA 1AL0G 1CONA 2R1DA 3HR9A 1HRV3 1W6QA 4FFFA 3C7GA 3NNJA 4Q4W1 4GALA 3DYMA 2PN5A 4JGYA 3NJVA 2WNUC 4HT1T 3ON7A 3POYA 1N1TA 3NAPC 5HI0A 2UWBA 4LJHA 1EAH2 4XUTA 4XE9A 1DYOA 1OPOA 2BGOA 2HWB3 3EMRA 1W8FA 2CDPA 3OPWA 3ME2A 2IC1A 1ZBA2 4N53B 5DUUA 1S0JA 2Q4SA 5APAA 3BCWA 4SLIA 1LODA 2D6NA 4XBLA 1JHNA 3ZFFC 2WWSA 1AL23 1UL9A 1LU1A 4C90A 5ABJA 4KU7A 3D0SA 2VZSA 4IERA 4BIFA 3N9LA 1LHWA 4MG2A 1H2KA 3VZNA 2WQ8A 2WT0A 3L2HA 5A1FA 1OT5A 1W8WA 3I2DA 1SBFA 4FFIA 1PIV1 3KCCA 1QJEA 1FV2A 2RS31 4KWLA 2Q1ZB 3BB6A 1ZBE2 1X9TA 2B4KA 4AQ6A 4Q0UA 3IIAA 3SNMA 4MGTA 1UKRA 3HN1A 4GA9A 4ORFA 1URXA 3MIEA 4NOTA 1EPZA 4AGGA 3LCPA 4ASLA 4AVCA 3TEWA 2IFWA 5M0TA 3MYXA 3S5AA 1AJKA 3AMQA 3S7EA 5DDJ1 4M4RA 1DCSA 1RMU2 1H8TC 5F5AA 2B8MA 1FNZA 2ET7A 2JE7A 3PNAA 4IEOA 4M4PA 3AL5A 2C24A 5T5JA 5F39A 2DU0A 2C26A 4GH4B 1GZCA 1UY1A 1VB2A 1US3A 1VBC3 1IS3A 2CTVA 5IAVA 3WUCA 1VBD1 3K3NA 2Y38A 4Y4YA 1OQ1A 4E9KA 2BOJA 4OULA 1W0NA 4LHSA 3B5LB 1D4M3 4LTAA 5IAXA 3M3IA 4XF9A 4XEZA 2VUJA 4P9IA 3LEGA 3ST7A 3FJSA 1S4CA 3TB0A 4CDQC 1CESA 4QPGC 4MGIE 4NJ4A 1AR63 2E7AA 1G9BA 2D5FA 4ITCA 3UGHA 4WM8C 1M06G 3DL3A 1UKGA 3KLSA 4QB2A 2XJSA 5EJ1B 2VZOA 2PHWA 2XHNA 2Y8KA 5K0UA 3JD72 3BIEA 4NRQA 3MEPA 5CIRA 3LKJA 5H9RA 3ILNA 3VZKA 4B4RA 4KWUA 2R041 1V9U2 1QJX2 4ZXEA 2YROA 2TUNA 4WM7B 1RVF2 4GMP0 2VW0A 3WDTA 2OA2A 4HVQA 2WS93 1J3RA 3AL6A 1SLAA 2ARBA 1XPWA 2J22A 2A6VA 4JX0A 4DRRA 2Y64A 5GZFA 5J96B 1AR92 4IESA 3CJXA 4XHBA 1EUUA 3VBRB 5H9SA 4AI0A 4E8DA 2AZ5A 5IUQA 4ZPIA 1SCSA 1UOGA 2YGLA 3U07A 3ZDVA 2JDAA 3R05A 3JCIA 3Q8EA 4G9SB 3U37A 1U5ZA 2WNUA 4QPYA 3W5NA 3NAPA 1LJ7A 5ANQA 4LOSA 5C33A 1EAH3 2ZMLA 1IKQA 5K7PA 1DQ5A 4Y1UA 1V6IA 3SC7X 4BB3A 5FPXA 1CIWA 1KFXL 2Y6HA 1ENQA 1Y9GA 4FXKB 3IDCB 4OMDA 4AI9A 3ZFFA 2W92A 2QCSB 5LZ6A 1W28A 1ZRFA 2E31A 1STMA 3C7EA 5G04L 2HWB1 4QKNA 1APNA 2JKXA 5HCBA 5FUIA 4L0PA 1Z7S2 2W91A 4MHRA 5LRRA 1ZZ9A 3OBRA 3ZN5A 3ZYBA 5FZOA 2D93A 2V72A 1SDDB 1ZYBA 1NKGA 3HMYA 4DUVA 5ACA2 5E89A 2W39A 4P08A 1AL21 2W08A 5FYSA 3VDDC 4AFAA 5HV0A 1B35B 3SH3A 2VMGA 2JEMA 1FNYA 1H8TA 1RMU3 1T6GC 5FYUA 4ATEA 2Q1MA 2QZ3A 2NZ9A 4LKSA 2PQSA 5BNPC 2G1MA 4E4DX 1O3QA 5JZGA 2TBVA 2YB7A 2GC1A 1ULFA 3RG0A 5CFCC 3Q8FA 2QQMA 5J3UA 1JI6A 2RV9A 3JZVA 3PMEA 3WF2A 2IXLA 5CA6A 3I59B 1CWPA 4IEXA 2Q8CA 4QAWA 4JKLA 5EIYB 4FT8A 4YVWB 1JHJA 4CP1A 4IV3C 3CJIC 1NOVA 1RJ8A 5FP9A 4A2UA 3CBNA 1UZZA 2ZX0A 3B9CA 1T6BX 4MGQA 4PIZA 3RWNA 4CDQA 4OI2A 4QPGA 1VBC1 2RDRA 1N47A 2XUMA 4WM8A 2WFF3 1YIFA 1UU5A 2D97A 1VIWB 1MZEA 5FLJA 4GXLA 3HBKA 3OPTA 3HQRA 3HT1A 1D4M1 3JD73 1A78A 4Y22B 4AYUA 4UF0B 5LK7B 2J1RA 4Y1ZA 2WO7A 4X8NA 3A21A 2GALA 3WG4A 3X29B 1TME2 5HCAA 1UIKA 3P1IA 1W03A 4QWNA 1QJX3 1AR61 2QNKA 1OKQA 3W58A 4DINB 1UYPA 4XJZA 4XOGA 2YFZA 2XWJB 5FOBB 1RVF3 2OQ7A 5KXBA 5FMCA 3RRDA 3U4SA 1ZA7A 3ACIA 1QJY2 1WA6X 5A3WA 5KR7A 5EV7A 4QX1A 2VNGA 3HEIA 1QH7A 4B3NA 2BBVA 2VMDA 3A23A 3V0AA 3VUOA 2RS11 4AI8A 1CJDA 1RUD2 1NZIA 4Z07A 4Y1XA 3HWJA 1ENSA 1UPSA 1W6PB 3KV4A 2Y33A 5FP3A 2RJ2A 5FMOL 2D3RA 2ES3A 2WS91 3T0BA 2EALA 5SV8A 2VO5A 4AG4A 1J58A 3O1VA 1NA1C 5FYHA 3OUIA 2J1TA 2QQLA 4MADA 4OZXA 5CNAA 3WDYA 5FJHA 4YG0A 5FK7A 5GLWA 4DIQA 1JZ7A 2JDMA 1E5HA 4BYYA 3WF3A 4P00B 1HV0A 4LBQB 4W6WA 1UU4A 2BJSA 3T09A 1GFF2 1W6NA 3J8F2 4ES8A 5IVEA 5FPBA 3J4UH 1X33A 2VOKA 3WQ0A 1UF2C 2O8OA 2QQWA 2Y34A 2WFPA 3KT4A 2J1UA 3H1MA 3IAPA 1EAH1 1KS5A 2PHDA 4JHTA 5FCCA 4BQ3A 1UYYA 3PJQA 4HMZA 5FY5A 1IKPA 2G9GA 2WT1A 3U1XA 4IE5A 4ONUA 4BWOA 4CXXA 3GDBA 1Z7S3 3BOWA 1DQ2A 2LRPA 2VE1A 1NLQA 2ZGQA 3P3PA 1G8WA 3V64A 3ZFEC 5FXXA 4CCLA 4C0BA 1XU2A 5ACA3 1G6NA 1O4TA 3VDDA 3T2TA 4FXGB 1S55A 3CIHA 2F17A 3I2FA 4KBZA 2UYBA 4OUSA 5IVFA 1KRIA 2C9KA 5FUNA 3BTZA 2A1XA 2VW2A 3FFQA 5C9AB 2JDKA 2Q5TA 2YC4A 1HW5A 1UWWA 5BNPA 4EZHA 4FPGA 4JHZA 3ES4A 1LESA 4K20A 1LECA 1UOBA 3QLQA 4IQPA 2OQ6A 3MICA 5T5PA 1WA4A 4CSWA 3IWZA 4CPBA 1HRI2 5JMCA 3SH4A 2P4EA 2ERFA 1TE1B 2DU1A 4LE3A 2WC2A 4YG6A 1UNBA 2AEZA 4IV3A 3CJIA 3NL1A 4K7JA 1RITA 2AENA 3VL9A 5L36A 4I0WB 1C8NA 1UMIA 5FPAA 3BGAA 3INAA 5FK8A 4J6GA 4AAXA 2HYXA 1YI7A 3SCHA 1UX6A 2WA4A 4GZ9A 4WBBA 4TZDA 3DPRC 2O1QA 2P5BA 2VR4A 1PGL1 1RUG3 1IS5A 1PVC1 3OBTA 3V65A 3LDBA 2P17A 2WQ4A 2I2SA 4W8JA 1TME3 1VMJA 3WV6A 2VUCA 3NKTA 3HIFA 4QT6A 1F35A 2OXBA 3RVHA 2YV8A 2WFF1 2R0HA 1NZCA 3N7JA 5LCWL 1QJY3 4EROA 2GH2A 4LPLA 3JD71 2BRTA 5EZWA 5CB7A 4I3PA 2KXLA 3K51A 2B46X 4DUWA 1REDA 1RUD3 4NHYA 2P1BA 1FPN1 4QPWA 2JDPA 4WVWA 3LA7A 2WINB 1CAUB 3LDKA 4ZU5A 3SEEA 3SMHA 1UOJA 1FI2A 1LU2A 3OGRA 1G9DA 1RVF1 4R4ZA 3T2PA 5FPUA 1JODA 1ULGA 4DZGA 1YQ6A 1NA1A 4ZZ5A 2FDJA 5FYVA 5A7WA 4Q0VA 4YRDA 5A6QA 5JLVA 3DXUA 3VD9A 1AR82 4AHZA 4H7MA 2E32A 2ZACA 4XCAA 4U2AA 3WDWA 4XJAA 3ZSKA 3J8F3 1JOPA 3EHKA 3H42B 1K5MC 5T50A 1VLNA 4BQ4A 4QD2A 3Q8BA 1UX7A 1NUKA 1RJ7A 1YFUA 1YO8A 4H7LA 5FXVA 5C8WA 5FTTC 2HWD2 3ZN4A 5FPZA 5FZ8A 4E2GA 5JXJA 4YVSB 3PUQA 3VZLA 2PHFA 1W8NA 3PVBB 3WNXA 4CEYC 1GWKA 2VM9A 1DDLA 4CA9A 3KQ4B 3WF0A 3WP5A 2IWGB 1AX1A 2ATFA 1FOD2 2CYFA 2C4XA 3CMGA 2OZ6A 1C28A 1H9PA 1EV12 3PUSA 2P6HA 4V2WA 2GU9A 3ACGA 5BNNB 5CFDB 5CKNA 3AZYA 1VB4A 2P3KA 3GZUC 1SFNA 4CUAA 1YUDA 3C7OA 5IVCA 2AH2A 1WLTA 3WINE 2HWC1 4YW2A 2VC9A 3WNMA 2OPKA 3NMBA 5DQ0A 2DTWA 5ACA1 2UURA 4PQQA 4ZONA 1BVVA 4XC9A 4KH9A 3RQ0A 4OCTA 4BISA 1NT0A 1DGWA 2ADEA 2CL2A 1HRI3 4IEUA 4MH0E 1S0IA 4INDA 4SBVA 5JMOA 3SISA 2WZPP 5KHIA 4CDUB 1CR7A 1UXXX 3RI9A 1JOBA 1GMMA 4QM9A 2SLIA 2E33A 3FHIB 1W05A 2NM1A 4AEKA 3JXSA 4IGQA 3N35A 4FFHA 3WW4A 1IPSA 3ZN6B 2UYAA 3C3VA 5FP4A 3DPRA 4FOWA 3POEA 1OC1A 1V6OA 2EXJA 3H8UA 4EV0A 2YY1A 3OG2A 4RSUA 3MPPG 2MNGA 1QHDA 3AK0A 3VN4A 3VBHC 3ZO0B 4Q4V1 4CU9A 5JCTA 1MS9A 1AYN1 3O12A 2ZABA 2D5HA 4RGKA 4MO3M 3HVDA 3TBDA 1W6OA 5BNOC 4NIIA 4E4ZA 2QDRA 5JIAA 4YGEA 4ZY9A 5LA2A 4DFSA 3AB0A 4BQ1A 5F9TA 5JOZA 4N43C 1RUG1 3GHMA 2DVGA 2VMHA 3VBUA 2ZHKA 3MIHA 1W8OA 3OGVA 1W8TA 3UKNA 2B5HA 3POFA 2JB4A 1W2OA 1R082 3GF6A 2W47A 5C5TA 5IVYA 1LOBA 1QJY1 2VCBA 4PBPA 4XUPA 5F6KA 1AF9A 4L97A 3PHMA 5F3IA 3MPBA 3JQXA 2K2SA 3DUIA 4DQAA 1J3QA 1RUD1 5DMYA 1AR83 1Q8SA 4HZFA 2DF7A 2IVJA 2XG3A 5DABA 4LQRA 1XYPA 5FZFA 1G86A 4LE4A 5C8CC 4H2AA 1XJAA 1PO22 1DGRA 3FHAA 2CGNA 4UFJA 1F4AA 3VHRA 3BPSA 4AHYA 3K4AA 1H2NA 3BU0A 1C8M1 4TLGA 4FPHA 1PGW1 4Y24A 3T30A 2HWD3 4ES9A 3M3EA 2WA3A 1SLIA 5AFEA 4IXLA 3NW4A 3AKRA 2YU1A 3J8F1 4CEYA 4RFT0 2GNDA 1BXHA 2WLPA 1DGLA 3LIGA 1RXGA 1GP5A 1UMHA 2X29A 1JUHA 2YUEA 1FOD3 4TSVA 4HK9A 4DXZA 5D8AC 2JG8C 4XDOA 1QIQA 1VPHA 3D4KA 1QMJA 3UETA 1REFA 5EYXA 4A6OA 1H9WA 1SHWB 4AI3A 3C7HA 1K12A 4XJ8A 5FZ7A 4ZKTB 1COV2 3IB3A 4FTEA 5EYYA 3FX3A 3CEWA 4COWA 1O3TA 3IDEA 2BOIA 1TG7A 1GYKA 3MUZ1 1CZTA 4QDRA 3EJKA 3I3BA 4QX3A 2XOMA 4LO7A 1ODNA 3AJZA 1VAMA 2JG9C 2ZGUA 3C8XA 4PBOA 4PI0A 2FDIA 2ZKNA 2R32A 1VE0A 3OJBA 3P6BA 3NQHA 3SKJE 2GDFA 2OT7A 5F2WA 3JBG2 4B8EA 1RUE2 3LDRA 1SPPA 4JTNA 2KM2A 3ZYHA 1W2AX 1FMD3 2WQZC 4OUEA 1YIPA 1ACCA 3ZX7A 1NXD1 2ZAHA 2WNVC 3T3YA 4CTEA 5HBAA 3RZMA 4Z1VA 1HRI1 2FDHA 1POQA 1WCDJ 3WW3A 3JB4C 4DS0A 1WBLA 2ZX2A 2DURA 2D43A 2H0VA 2WNUB 3VBHA 4XF0A 3FWEA 3ZYIB 2QDNA 1BK0A 2EAKA 3KGLA 3JQWA 3PIJA 2Z79A 2BFUL 3CL1A 4IE7A 3RI8A 3T1MA 4ZS2A 3WG2A 2ID4A 1EUTA 5CYYA 3S57A 1R1A2 2JDNA 1DIWA 2D6OX 3OUJA 1YI9A 2F4PA 4FP3A 4N43A 3OEAA 2JICA 3QCWA 2WUHA 3ZFFB 1ALYA 1VBA3 3QH7A 4FPOB 3DN7A 4I0BA 2FCVA 3U0ZA 5SV5A 2O0OA 4JAAA 4LA2A 3PVNA 4WVZA 1V6NA 2VQAA 3NRUA 1SLBA 2XQRA 1R083 3BALA 3WOGA 5KBFA 4NHXA 4HKLA 5FZOB 1OQEA 1LHVA 2VOTA 4GD4A 1GQPA 3A4UA 2P3JA 5FZEA 4LA3A 4GWIA 5DZFA 3I3MA 3L2YA 5IATA 3E5UA 1AYM2 2RDSA 4BMBA 4OYUA 2ZX4A 2Z4FA 5ABJC 5FUPA 3DGTA 3GBFA 1PO23 1JMUB 1UQXA 3LEIA 4QX2A 3WG1A 3U4XA 5E6HA 2D6PA 2B42B 2UY9A 4RS5B 5FAXA 3N9NA 3B01A 3N4MA 1AR81 2WN3A 2QQJA 3AMPA 3CNAA 3E5XA 4UW6A 4LBNA 2VU9A 1MPXA 4XIKA 1T2XA 3LPFA 2VMFA 3DEMA 3JU9A 3J9SA 4AQSA 1H1IA 5FP8A 5D8AA 2JG8A 3T0AA 4Q4Y2 3NJYA 4BH9A 4QU1A 1NX9A 2HWD1 3WDVA 5FJKA 2RMU2 4QPGB 4OHWA 2RR11 3HAGA 4JRAA 5FZAA 4AQTA 2NLRA 4QX0A 1BBT2 1H1AA 1MVEA 4QU2A 4CU7A 4FAHA 4I0AA 2X5IC 3VZJA 4GWNA 1O8SA 4D69A 3RZZA 4JGZB 4J1WA 4W6YA 4BQ2A 1K42A 1FOD1 2QBXA 2XJTA 2VTXJ 1UYXA 4PQ9A 3V0BA 2ZXQA 3HNBM 2JG9A 4OHZA 2A6XA 3SKVA 1FT9A 4NO4A 4UBHA 4RGAA 1SLCA 1QXJA 2DFBA 5FKBA 3FLTA 3POBA 3JBG3 3WP3A 1RUE3 4R9AA 2QTWB 2NPIA 5FWEA 1JYIA 1JYWA 5FDBA 2PAEA 4BXSV 2VBPA 2VQUA 2ZX3A 2WNVA 2D3PA 1IQDC 2YFUA 3NKGA 3P3NA 1R1ZA 1OA3A 2BWAA 1GU3A 2VPVA 4QB6A 3OTFA 2JB8A 3NNFA 5FZMA 1VMHA 3N9MA 3A22A 4R9CA 1JZ6A 2H6BA 3N3HA 1C3HA 4XIOA 3G7DA 3O0VA 1FMD1 4X8PA 2DWRA 2B9VA 5I0UA 4RHV2 2FCUA 2DBIA 1OSGA 4QQ2A 3MIDA 5F5CA 4XAAA 3ZIXA 2FD8A 4YM2A 1IS6A 1MS3A 1CX4A 1WLCA 1R1A3 5A6ZA 1ZVFA 4LT5A 1ZZCA 3WUDA 5FY4A 5AC92 2GC3A 5D2AA 1DYPA 2D98A 4XPVA 4CDXB 4YWAA 1IOAA 4E2QA 1W2NA 1Y9MA 2GP5A 2GZWA 2X8KA 5ERLA 4X6RB 4CUGA 2XH6A 3T2OA 5IVVA 5DG1A 1CAXA 4FPCA 1FYUA 3ZR5A 2A71A 4A44A 4P5HA 1TZOA 4N9HA 3RYPA 3K3OA 5FZ3A 4PDWA 4AFDA 2O8QA 4ZS3A 2R072 4I09A 1BEV2 1KGYA 1UY0A 1O5UA 2WYFA 1VBA1 1S2KA 3CZUA 2Y6LA 1I5ZA 1A34A 1AYM3 4IEQA 4B29A 5IK5A 1R081 4WZCA 4O9GA 1AR72 1TVGA 3WXPA 1KXGA 3NV4A 4PLNA 2CNAA 2BNOA 4Z82A 5T52A 5FY9A 1PK6C 1MS0A 5CFCB 2OW4A 1GWMA 4ZU4A 4ZXKA 4RQPA 4YZ3A 2N7GA 2VZ3A 2ZGSA 1LEMA 3AYAA 4KI5M 4UW5A 2XJRA 4XW3A 3JB8A 1OI6A 4LOTA 2VULA 4LXLA 1PO21 2WR9A 2RM22 1ZM1A 4IV3B 4Q4Y3 1YWKA 5A7SA 2XLGA 3ZYGA 2RMU3 4D8MA 4HLTA 3Q9OA 4DUXA 1SFYA 2E51A 2ZGKA 5J09A 2WRAA 4AK3A 5JZGC 3M3OA 3I8TA 5JSOA 1YFYA 2X5IA 1QJU2 3OGJA 1RGSA 1U12A 4C0HA 1PMIA 4Q4X3 1OA2A 3GM8A 3HPNA 1OQDA 4QKBA 3L9JT 4KGQA 5IFTA 4AI2A 2WN2A 4FPEA 2RS52 2BBAA 2CGOA 3NVCA 4OI0A 2ZCWA 4I02A 4K9SA 3UKVA 2JE9A 5LASA 2LROA 3AZXA 3ZFEA 5I0TA 4YW7A 3VDCA 5FYCA 1RINA 1CPMA 3PU3A 2VVFA 1LULA 2Q8EA 2ZA9A 2IXIA 3ZFGC 1Q8OA 1US2A 2OUJA 2Y6JA 3ASIA 1W3VA 2VMIA 4QPIB 2P3YA 4MZUA 2XVGA 3OB8A 3SCFA 4JQTA 3H1WA 3MLKA 4NE9A 5JR2A 1GKBA 1P8JA 3W21A 5JAXA 1ZRCA 3JBG1 3MF6A 1H4GA 2ZEXA 4XTPA 4YGCA 3T2QA 2AEYA 1W6MA 3ZYPA 4FOQA 5FYTA 3M2MA 2VECA 5FYZA 4RHV3 3ZLIA 4CP9B 1VRBA 2ZAAA 4R9DA 3VD5A 4BM8A 5B2GB 3OYWA 3O1MA 5ANNA 4LO8A 4RL7A 1O3SA 2CU5A 3VDBA 4A42A 4E27A 5GZEA 1LR5A 4WZFA 1ZZ6A 5FZ6A 5AC93 1QOOA 2WDBA 1CAWA 4LITA 2IFRA 2LM3A 4YW3A 1QY4A 1JBCA 1PMHX 3DV8A 1KQRA 3KVBA 1GQHA 3I2IA 3MIGA 3LFMA 2DVBA 2A5ZA 2A7AA 1YQ5A 1YJKA 3MW2A 2UY8A 1R64A 4F3JA 2QQVA 4B1LA 5IJRA 3I54A 1RUOA 1WCQA 1HRV1 1ZBA3 4EN9B 2R073 3KMHA 3UT0A 1YFXA 2VL4A 1DLLA 2DVFA 3HJRA 1N3QA 1S0CA 2VVEA 2XHKA 4NHKA 1IS4A 2BFUS 2W52A 5A32A 3EQEA 4LO4B 1ND2A 2H6CA 1AR73 5F2SA 2VG9A 3HD8B 4A41A 3ZXAC 1PK6A 4QX7A 2W5FA 3J7LA 3MHZA 4XBQA 2KR2A 3WNKA 4ASMB 2ZGOA 1ZBE3 1Q8VA 3BKZA 2YG0A 4F7ZA 1ZZ7A 2A3WA 2G19A 2YBKA 4LUKA 1AYM1 3IZOA 2JECA 1MS5A 1H30A 3NV1A 4IEWA 5EP9A 3FLRA 4XXPA 1KDKA 3MFCA 1WMDA 3WQ7A 1W2TA 1UMZA 2RM23 3WDUA 3FMGA 4XFCA 1A8DA 2A70A 3ZR6A 1CX1A 2YU2A 2JXAA 5FYMA 4XF4A 1LHNA 1RXFA 2G4IA 4CCNA 3FBMA 5LW9A 2NP0A 2HYKA 4DXTA 1XNDA 1NLRA 1QJU3 1XB9A 4CPBD 2XPJA 2QVSB 4K1ZA 4K8RB 4LK7A 5FLIA 5FRAA 2VUAA 4FOVA 4Q4Y1 4Y20A 1BHGA 1QKQA 2RS53 1RUC2 1HB3A 1RUF2 3GALA 3R4SA 3ETQA 4MXVA 2RMU1 2ZKLA 3USUB 1XSQA 3CKHA 1W6OB 3B93A 1J3PA 1VAKA 3AC0A 1DHKB 4Q4X1 3ZXDA 1OKOA 1LB2A 2ZJCA 1O91A 1V0AA 3OY8B 4L11A 4ARYA 2EXKA 4N90A 1VAVA 4M0NA 4I01A 3ZFGA 5FO8B 3THDA 1NQJA 3B00A 3VBUB 4XTMA 5IHRA 2PXJA 2ZGMA 3OCPA 4YSFA 2D6KA 3LQCA 3TRSB 2QQUA 1XSRA 3H0OA 2K9ZA 4Q0PA 4AR2A 1V9U3 1WW4A 5FO7B 3IBMA 4PI2A 1K45A 2DCKA 3KV6A 3TN92 1CJPA 2WABA 2D44A 1YQ2A 5FZ0A 3WCSA 1U5IA 3R0RA 4COYA 1OF4A 3R6SA 4GH4C 1V6MA 1F4HA 4AVTA 1AR93 4BLJA 2L9LA 1K5MB 1V6KA 1JU3A 3KVAA 1X8MA 2JX9A 1V70A 1DF0A 2E9QA 3BTAA 2OVUA 3VBSC 3MV11 1D0HA 5A3MA 4L99A 2FZ2A 4KBBA 4N7UA 4RHV1 3WVJA 4GAZA 3J7NA 2BPA2 4Q5OA 5C3OA 2GMMA 4CYDA 1GLHA 4Q0SA 4CP0A 5DUWA 1RUH2 2IZWA 3CO2A 4XVHA 4CEYB 2BZDA 4DNYA 5AC91 3NNGA 3OD0A 2V4AA 2XL7A 4OZOA 2P2KA 3MV01 5DAQA 3SCGA 4CP2A 2VZVA 3S7IA 5J1XA 5A3PA 4M01A 5FMOS 4A7YA 1L7RA 4JDOA 3H8RA 1AVBA 2JDHA 3VHNA 1DP0A 1NY72 4QX8A 2RG4A 1RTVA 2LALA 1AXYA 3LSEA 4NWWA 1G9CA 3VD7A 2XLFA 4XJWA 1ZBA1 4TYSA 2R071 4W4ZA 4OHXA 4PF1A 5JVVA 4X6QB 3AJYA 3A0KA 3WP4A 2FQPA 1PHMA 1VR3A 2Q8DA 4XZPA 3KHCA 1LTEA 3PTRB 2PELA 4BZ4A 1ODMA 1CQ9A 4HN0A 1AR71 2Y0OA 3UGGA 2BV4A 4A3ZA 1QDOA 3C7FA 4BDVB 1SPPB 1TMF2 2IVIB 3ZXLA 1IHMA 4IGPA 1ZBE1 3KB5A 3QACA 4LIUA 5HXVA 5LEJA 2RHPA 1I3HA 2QE3A 2R49A 2VVDA 5FZBA 3H7JA 1R092 3MW4A 4D7TA 5CBLA 4HSLA 4P5YA 5C3PA 3CHXA 2RM21 4HPKB 1RMU1 4N53A 4GB32 4O9EA 2FHRA 3IT8A 2VW1A 5F6LB 1RUC3 1RUF3 4IE0A 4JTOA 5A3OA 2RJLA 3O5SA 2HJIA 4LORA 1W90A 5BNOB 2FCTA 5BYNA 3ZYRA 5L9BA 1DGWX 1QJU1 2R6QA 4NUBA 3LA2A 5C3QA 2EIEA 4QKDA 3URFA 4IEYA 1W8UA 4HN1A 4K1YA 5FZKA 4AQ2A 3O1SA 2FDFA 2WO1A 2YXSA 3IDBB 2BVBA 2HEYF 2RS51 4AEDB 2EIGA 4K40A 4YYOA 3RZLA 4EN8B 1RHI2 4EWEA 4CEWC 3O1PA 1JZ5A 2E26A 4IEPA 4XFIA 3WZ1A 3KS7A 3WF1A 2YPDA 3T08A 1B35C 4UWDA 4COUA 5L9VA 3TN93 1AHSA 2VXRA 1PM7A 2JKBA 4MUVA 4XETA 3N36A 1NE4A 3KF5A 3FC0A 4M0HA 5DUVA 4LO6B 4FPYA 2QJVA 4FPFA 4GH4A 3B94A 3HNMA 5HCFA 1SEFA 3O1UA 1V9U1 5C8CB 1QJX1 4QXHA 2PHRA 3AKPA 4CVUA 5BY5A 2ZPXA 3N7MA 2VZQA 5CAZA 1F2NA 4LKEA 2ORXA 3VBSA 4YVWC 3T1LA 3ZMOA 1BQPA 4QDSA 3ZSLA 1MZ6A 1QWRA 2PTMA 1IGOA 3K77A 1RIRA 1WD4A 5IWFA 3RJRA 2I74A 1ST8A 4LIVA 1DQ0A 1OH4A 1UPIA 5I8SA 3U10A 2E53A 2EIBA 2LTNA 1AR91 1LHOA 1RUH3 1QQP2 4YZ1A 3RNSA 5GLZA 2PA7A 3KWVA 5D8AB 5KHHA 4D6QA 4Y4RA 1EPWA 2ZTNA 4P9GA 2XVKA 1OPMA 3QH6A 5FR3A 5DZEA 3ALQA 2OS2A 3N9PA 1QJFA 3RYKA 1SG3A 1WMEA 1TQ5A 1HKDA 4AFCA 5FYBA 3A7QA 3V0BB 3LWCA 1HN1A 2ZHLA 1PNFA 1RC6A 2ZEZA 1OOPC 1J1LA 3POGA 4COZA 2HH9A 3VB9A 1W2UA 1HB2A 3W59A 5GKAC 2A6ZA 4D7YA 5FQ0B 4I30A 4Q1PA 4CU6A 3GCXA 3VBRA 1XNCA 4URAA 5C7GA 4URTA 1W8HA 1CVNA 1YRZA 2VBBA 3IN9A 1TMF3 3E6DA 3ELNA 3T0DA 1Z7S1 4U36A 1SMVA 3FN9A 3MW3A 3H1YA 4HOOA 1S0DA 3NO8A 4N7IA 1XE8A 4YM3A 3ACFA 4M3CA 3ROUA 1X7NA 1PVXA 1JS9A 4PCRA 1G9AA 3PUAA 1RUI2 1VRH2 4BQYA 1R093 5FBJA 3BOPA 1ZZ8A 1D7PM 4FO9A 3KSCA 4A6SA 2ET1A 1N1SA 5LBBA 1DLCA 4BLIA 3LSDA 4LULA 2DUOA 1LCLA 2XJPA 2ZS6B 2CAVA 3GJAA 5LA1A 4LBLA 3B02A 3HOBA 2YPJA 3ZVXA 4GWMA 5CU1A 2XJUA 1VJ2A 2RVAA 5A33A 2QKDA 3VKOA 4FTSA 1GANA 4BJ0A 1ZREA 5B4XA 4WVVA 4IETA 1UW8A 1ENRA 1ONAA 3I4IA 4NHLA 3AVSA 5EQUA 3VL8A 1HLCA 4Y5SA 4YNIA 4B4QA 1W6QB 4DXSA 1RUC1 1RUF1 4AOCA 2DCYA 5CISA 1F5JA 1RHI3 4JGYB 1LGCA 5BPXA 4CEWA 4E8CA 3FHQA 4K6BA 5JOXA 1PZ9A 4H14A 1DG6A 5C70A 3BTYA 1B35A 1YQCA 2WL1A 3LPGA 5CVRA 2QFEA 2YHJA 3VBOC 1GZTA 5A6YA 4R8HA 5JI7A 3WCRA 1MS1A 2AGSA 3ETPA 5F5QA 1GNYA 1NCRC 3RWKX 5KXEA 1U0AA 1MR5A 1QH6A 2ARAA 1IG3A 1TME1 1G7YA 4YZ4A 4BQXA 5L7OC 1HJGA 1D2SA 5ABJB 5LWBA 3TN91 3BN6A 3E97A 1FX5A 2ORZA 2WNOA 3B69A 4YVWA 3WY6A 3I3DA 4Y33A 2CAUA 3O0XA 3MDPA 5CG9A 1L3JA 2KA3A 4KWJA 5FOJB 4GWJA 3POWA 4S2GA 3UK9A 2B7YA 1DYKA 1Z0HA 1QQP3 3M1HA 5LB6A 1GZ9A 2UWAA 3VKNA 1UY4A 3D3AA 1XXNA 4V2VA 3VLBB 1LEDA 3J7MA 1HB1A 5JUVA 1PO12 2B39A 1RUH1 5KHJA 2X5IB 1LRHA 1J84A 1NXMA 2HBTA 4JKMA 4UYBA 1PIV2 2PHUA 3RZJA 3ZXJA 3GXUA 1OOPA 1UIJA 4MGSA 3T4HB 3WSOA 1EV13 5KXDA 1NY71 2BGPA 5LY2A 2CWSA 5FZGA 3GZAA 2SBAA 3WNNA 4UBGA 5FY0A 2WAOA 3WNOA 2XVLA 2PHTA 2F6BA 2R30A 4HONA 1JYXA 1OD3A 3PVEA 2XONA 3AXDA 5T55A 4OQ8A 3VDAA 5K0UB 3J26N 4LHLA 1RUI3 5LBCA 3WW2A 3DKQA 3ZYJB 1VRH3 1H0BA 3TYJA 2XWBB 3HQUA 4TLFA 3K48A 4WV8A 2FMDA 4LBQA 1WUVA 2VNRA 5DAXA 1RB8G 3M4FA 1TMF1 1FATA 4UXAA 4NPLA 1W6MB 4HVOA 4Q29A 3AVRA 3KCYA 4QHOA 4XFBA 2QQNA 4B7KA 4D0QA 4EN6B 2XGXA 4CXWA 4NROA 2BEOA 1V6JA 4BOWA 1J59A 4LMFA 1K5JA 2VMCA 2AYHA 1R091 1H2MA 2V09A 2BUKA 5JI9A 3Q8AA 5DAPA 3TNQA 1H6YA 4QB1A 4UW4A 5BNQA 3IKWA 3VHOA 3POJA 1V6LA 1YNAA 1F5FA 1CAWB 4NPRA 1JU4A 4P14A 5C4WC 1YXWA 4IE4A 2EICA 1JN2P 3ACLA 3POSA 4GJZA 3T4VA 2QQKA 3NAPB 4C1WA 1HXS2 2XJVA 4H3WA 4RFRB 4AXOA 5BNNC 4Y26A 3I97A 4NIAA 4I2OA 1Z78A 2ZMKA 4HKOA 4BHPA 1YJLA 2CWMA 2IXCA 2HBUA 2RDQA 5GJ6A 3VBOA 3WEZA 3PUIA 1JYNA 3MGUA 1VP6A 3AKQA 3AYDA 5EWSA 1HB4A 1NCRA 4BK5A 1XNKA 1RHI1 4YGDA 5CADA 4MXWA 5GLVA 4Q8KA 3CZJA 5A32B 1OUSA 4MSVA 1OFNA 3I3EA 3TOJA 5FZIA 1JUIA 1OXCA 3K75B 1CAVA 3MIBA 4BMEA 5L7OA 3ZXGA 3GYDA 3ENRA 3KD4A 5FPLA 1N3PA 2JJ6A 3U75A 4EN7B 2CGPA 2BERA 4P9LA 3O1OA 4CUCA 2W1WA 1W8ZA 1PK6B 5LBEA 1HX6A 4YZ2A 4PDWC 1BK1A 5HV4A 3WHTA 4R9BA 2R062 5CKQA 4CDWC 1XRUA 1W04A 4AW7A 5J98B 5T3NA 2VCAA 2FDKA 4MGZE 2MHFA 4XZUG 1JZ3A 3GZTB 4UFLA 1H8TB 4XF1A 2DCJA 4HG6B 1ZA4A 1OA4A 4BIOA 2D7FA 3E1F1 3NJZA 1GBGA 4OVEA 3UYJA 1AX0A 4WVMA 1C1LA 3RZKA 3RZHA 2PHXA 2V4VA 5JZGB 1PO13 5K4LA 5I8YA 1ULPA 4QKFA 4RQPC 1QQP1 3VKFC 4RD7A 2Y6KA 3VKLA 3AMMA 3F95A 1JZ8A 2WWJA 2WSUA 1PIV3 3K46A 1BKZA 3K4DA 4Y20B 1TEIA 3LE0A 5DUXA 2JENA 2YDEA 2PLV2 3WW1A 1MVQA 4AFBA 3HN3A 2YGMA 2XUEA 2JWPA 2DDUA 2J1SA 4AF9A 3I3QA 1BVP1 2O14A 1XBFA 5GZDA 4CDQB 3OBZA 4IW3A 3KV5A 3ZPYA 1Q8QA 4R4XA 3M70A 2LUWA 1COV3 4RR3C 4WM8B 2EXHA 2OUHA 2VOXA 4NN0A 5D1IA 1JH5A 2ZOEB 2IXKA 1LOEA 2BP6A 2MPFA 1UN1A 2C5DA 1EV11 4IV1C 5LATA 4CUBA 3BI3A 2GAUA 5FXZA 3H50A 4AHWA 3AZZA 1VBB2 3S30A 2FBEA 4JRLA 5FY7A 4XDPA 2X05A 3ZDSA 1OVPA 1RUI1 1DZQA 2EIDA 4LNVA 1VRH1 5A1LA 3V0AB 2XQXA 4PIXA 1S2EA 3UJOA 3ATGA 3PURA 3IMMA 4IL7A 3WX5A 1FXZA 2VNOA 3GGLA 2HWF2 1F31A 3LAGA 4Y3OA 4V1PA 2GNBA 4NIGA 2Y26A 5IK7A 4FCAA 1O4YA 3B7MA 4HVRA 5C4WA 1F9KA 5BNNA 1HXS3 3MIFA 2BTVC 2AACA 1C5IA 3MLLA 1H1MA 1YLLA 5CKMA 1B09A 4KWKA 1NE6A 4OUMA 4D3WA 5T5LA 1W6NB 2DYCA 2ETEA 4CCCA 4Y1VA 4YZ5A 1H6XA 2P34A 4AAPA 3B3QE 2HLEA 5H9QA 1DZRA 4ZU7A 2RS12 5LA9A 3W5MA 2E7TA 1DQ1A 1WKYA 1LHUA 4XILA 4CDUA 4P9XA 5I8TA 1OBNA 1XQNA 5FZ4A 2WS92 3VD3A 2XXZA 1Y9QA 2DUQA 4XF3A 3VBFC 2D6MA 2ENRA 2BU9A 2R063 4PF5A 5F3GA 4CDWA 1GUIA 5F3CA 3S0MA 4Q8LA 5FZLA 3VDDB 3ZN6A 5IVBA 2XBO2 1ZNPA 5A7OA 1ZRDA 3KT1A 1L7LA 1IQAA 4GMP3 2ARXA 3OD4A 2D40A 1ND2C 4IGOA 5C6CA 2W87A 4N8MA 4YW6A 3S6PA 4XQ4A 4XQWA 2GMPA 3AP7A 3ITQA 1LAJA 4EE2A 5BNPB 2VCCA 2NMNA 3W20A 3DYOA 1UO9A 4AGVA 1ZRIA 2PQQA 1X82A 5A1AA 4HK8A 2HWE2 3BVCA 3R4UA 5A3LA 3BU7A 1ZZBA 5C3RA 5GLUA 5F8PA 5IT6A 5AVPA 2PLV3 5JXHA 1HQNA 2PHLA 3CJIB 2BWCA 2GP3A 2Z2SB 3NWKA 4AWDA 1PO11 2A75A 4NWVA 3ZOIA 3BUCA 1DQ4A 2W1SA 2DTYA 2J7MA 1BBT3 1WLDA 2VZTA 2YMZA 2HKXA 4RR3A 3TNPB 4AI1A 4XDQA 4EWAA 5I91A 4FOYA 2BW8A 1XE0A 2DV9A 2QZ2A 4XMAA 1H2LA 3TEXA 2ZHMA 3ACHA 4PJYA 5L9RA 4XJUA 3SXWA 4IV1A 4CE8A 4HFSA 1MQTC 1VBE2 1O3RA 3ZYFA 5IVJA 3P5BA 5JSRA 5J36A 2HEWF 1LOCA 3FZ3A 1HJFA 1COV1 1VBB3 4LLFA 3UKTA 1JZ4A 4LBMA 5KHKA 4KG8A 5J37A 2GN3A 4LBKA 4LKDA 4GQ7A 4XFGA 1NLSA 4TTGA 5EJZB 4R52A 2XKOA 5A3UA 1GV9A 1SZBA 4ISQA 4RS5C 1ASJ2 1KITA 1WMFA 3KZ4C 4A3XA 3EO6A 2NYYA 3NJXA 1UD1A 2HWF3 3LZZA 5EXOA 3ZKYA 5BUVA 5JWPA 2XL9A 3AFKA 2Q1FA 1GQGA 3VBSB 1OLQA 1YQ8A 2GC0A 3IPVA 1RUE1 4NAOA 3PU8A 2X10A 4JQRA 5FZ1A 3H8XA 1YC61 1PGL2 3LF7A 3FUOA 1PVC2 2EXIA 1GNHA 1LNSA 1NA1B 1VALA 5C3SA 1YEWA 4IE6A 5KHGA 5A7WB 1UOFA 2VTFA 4MLOA 3RMXA 4OHVA 3H7YA 2VJXA 2Z5WA 2WFF2 4NR1A 2LW8A 5LA0A 1GP6A 5CG8A 1XC6A 4GKXA 4BE3A 4JGZC 4XURA 1QGLA 1W06A 4ZHNA 3I2JA 3RSJA 1HXS1 3FE5A 2RS13 4UFHA 4BQWA 3CDZB 1FPN2 2ZGPA 1AZDA 4QHZA 5JDBA 3DCQA 1ULEA 3GNEA 4A7KA 1GZWA 1R1A1 3KGZA 3KT7A 4LR4A 2ARCA 2OX0A 5FBZA 3RS6A 2W9XA 2YC0A 5IK8A 3C2UA 4DOUA 3VBFA 4QMAA 1BEV3 3ZFEB 1LENA 3H3UA 1OLRA 4NMIA 1NCQC 2RJKA 2XBO3 1JZ2A 2WLQA 2CSGA 2JIJA 3WQ1A 1ND3C 4Q27A 2ZZJA 2XJQA 4TXWA 1SLTA 1CN1A 2V5YA 1ULCA 1PGSA 3U14A 5IK4A 5KC5A 4M3CB 3VKMA 5FMBA 4AZZA 3GHNA 4M3CE 2JDUA 2ZMNA 1YFWA 2IXHA 2R061 3AYEA 1S1AA 3OF1A 1BJQA 4QXBA 4J1XA 3D5OA 2Y0IA 1E5SA 3JUUA 2HWE3 5LK5A 1HQLA 4UI9L 2FDGA 4GMP1 2G9ZA 1CZSA 4PT6A 2J1VA 1KJLA 2WO3A 4GKYA 4FBFA 2QUOA 4AVAA 1BZWA 5IFPA 1S0FA 3NV3A 5F32A 2WBKA 5FY1A 4CDXC 4LEJA 3WR0A 2DVAA 5A33B 3K2OA 1KDMA 1YCIA 4NAMA 3OEBA 2OZJA 1GWLA 1MS4A 1Q5OA 3NV2A 5JR7B 1N3OA 3SHRA 4BU2A 2VH9A 3DPRB 3PDQA 1QF3A 3AKSA 4LUMA 4CCKA 5AFBA 5CEHA 2HWC2 2PAKA 3MI8A 2PLV1 3UNPA 5FYYA 1A6CA 2E7QA 4CEWB 4Z2AA 4LO5B 4N53C 3DKWA 1W39A 1QOSA 3AMHA 1MQTA 4XFAA 1VBE3 3MZHA 1OLMA 5HCHA 4MV2A 1QXPA 2CY6A 2XKPA 1PZ7A 4OI1A 1GICA 1BBT1 1WZXA 4XUQA 4DEQA 1A8MA 3AZWA 3H3ZA 5DN2A 2A6WA 3VGIA 4EN0A 3D6EA 3ZMNA 1H4HA 1I1EA 4JC1A 3VZMA 3E5QA 4IUGA 3GZEA 4RS5A 1ASJ3 5A7PA 4MX3A 4XAEA 4E2SA 1O59A 3MF9A 5FXWA 5GZGA 3DF0A 4NVPA 1CPNA 1XE7A 2XLAA 1VBB1 5E8AA 3IAQA 1BCXA 4XACA 1MEC2 2VTXA 1POV3 1MZ5A 1PMJX 4HKWA 3ILRA 5K9YA 2VZRA 3KHBA 3THTA 1PVC3 1WLWA 4Q4V2 1HIXA 1AYN2 1JYVA 1RUNA 4OI4A 2HWF1 2P6CA 2Q0AA 3UL2A 3D8CA 5F3EA 5IW0A 1UU6A 1SDWA 2WSVA 2Y6FA 4JGZA 3ZM8A 2K46A 1BYHA 1RUG2 5J48A 5FLHA 3AMNA 4JDMA 3PVOA 1FPN3 2BQPA 1PX4A 4QQHA 4PLMA 4MOAA 3AP4A 4QQOA 3ZKUA 1O4ZA 1VMFA 5DPNA 2PAMA 1NQDA 4XUNA 2QQOA 5JPMB 1QU0A 5JXGA 2WJSA 1OOPB 2BGCA 4O65A 4HANA 1DGRN 4N9IA 4FQ4A 1NG0A 3O7OA 1U5XA 1NCQA 5F5IA 4QPIC 4KL1A 5GLTA 2X09A 5GALA 2W94A 2Q30A 3WLUA 2VOWA 3SQOA 1ND3A 2JDYA 2WZR2 5FZCA 1W9FA 3RYRA 2Z69A 5EFUA 1PX3A 4WM7C 1BLZA 4TN7A 1BEV1 5H9PA 1C8M2 1LOGA 1PGW2 2GN7A 5FY8A 2Y60A 2VBDA 1S2BA 2XBO1 1Q43A 3APBA 1SACA 4KG0A 2JE8A 3NSTA 2PFWA 4PLOA 4Y5TA 1Y7BA 5DXDA 1QNYA 1D0GA 4DY3A 3D82A 3VBRC 2NQYA 5FKCA 3ZXKA 2UU8A 4LHKA 5HPOA 4LKFA 2QQPA 1F15A 4FPJA 4CDXA 2AREA 1F8VA 3BTXA 1X50A 5FPVA 3RPQA 3I2GA 1SLLA 1EY2A 3AZVA 4XBNA 1W99A 3IIIA 5TSWA 2BYVE 4QM8A 2IUWA 2HWE1 4QXCA 4F83A 4NPMA 3SLIA 1NYWA 2TNFA 3AKTA 4HETA 2WYSA 2HWC3 1U5YA 2MEV2 1JOJA 1IZ3A 4RA0A 4QX5A 5LY1A 3VBHB 2IXJA 3ZXFA 2FZ1A 2ZZQA 3AP5A 3USSA 4XUOA 4NIHA 1ZRRA 2AR6A 1W9YA 3ZXEA 5ISLA 4CCJA 3RGBA 2YC2A 3EB7A 4QXKA 4OFGA 3VBOB 3GBWA 3GCWA 2J1EA 3PLQA 1POV0 4OLLA 1NCRB 5CZKA 4CCOA 4I3GA 4N43B 1Y3TA 2C6SA 4KQ7A 4DXRA 1BMV2 5T54A 4M00A 1E57A 3AM2A 4MXWB 4OQ9A 2C1FA 3VZOA 1VBE1 2ZGLA 4MYEA 5CFCA 4Z92B 2C9AA 3AXEA 5L7OB 3PMSA 1CAVB 1S0GA 4QDQA 4G4FA 5A7QA 1SFPA 1EYBA 3WG3A 4LBOA 4AVBA 4HL0A 3RFRA 1PZ8A 1MEC3 3WF4A 1OH3A 2GC2A 3THPA 3GJBA 4CCDA 1C5HA 1E5RA 3QBQA 2B9UA 3PUHA 4GULA 3M8LA 3AYCA 1ENXA 3EBRA 1GSLA 1OD5A 4Q4V3 1JYCA 4YLZA 5A7NA 5K8SA 1AYN3 4JCKA 1ASJ1 4AFMA 1M4WA 1UZVA 1J83A 1J1TA 4COVA 1I5PA 1YYNA 3B9IA 5BXXA 2GNMA 1WWYA 1POV1 4W6XA 4CZSA 3DECA 3FBYA 3LEMA 5A80A 5BV6A 1TNRA 4WVMB 1KFUL 5JXIA 1OF3A 3ES1A 4P9JA 2ZX1A 1WCKA 1KEXA 1RYYA 1YHFA 2UWCA 4H55A 5E1RA 1S0BA 1W0PA 2D3SA 2DCTA 2YBPA 2E63A 4QGNA 1WMXA 2BDRA 2W95A 3CLPA 4S2FA 5LEKA 3LD8A 1OFSA 4XJ9A 2JG8B 5A70A 3ZSJA 2W46A 4S2DA 4QPIA 5DAVA 5FFOC 3ZSMA 3V56A 1A3KA 1CD3G 4RGGA 2WZR3 4DO0A 4L2NA 4WM7A 2R7EB 4FVVA 2VQTA 3N7KA 1QNWA 4LBJA 4LLOA 4YG3A 5T5OA 4S2HA 1C8M3 2R16A 4CP9A 4YPJA 4CCMA 4XHXA 4Y5Z0 4F8AA 2VGDA 1L7QA 1CZVA 1OVSA 2JG9B 2Z42A 5FZHA 4KGGA 2JD9A 2OYZA 2ZHNA 1UYZA 3QD6A 3I49A 4XABA 3MLJA 3KQRA 1XYOA 1JXNA 4NHMA 3H3LA 3VHPA 4YGBA 1IPJA 3J7HA 4HBNA 3H9AA 3RJ2X 5A3TA 1C4RA 3M3QA 2A3XA 1DQ6A 3VBUC 1OHFA 2I45A 4CU8A 3S5QA 1DZTA 3CF6E 2WNEA 5D21A 2XMLA 2EAAA 4QQPA 2WNVB 1OMIA 3LA3A 1RUJ2 4KNCA 4QGMA 3THCA 3O1TA 2RR12 2AUYA 3M7AA 4UW3A 3KV9A 3TAYA 2W1UA 2Q8OA 4BCUA 4LBQD 2MEV3 5C4WB 5C71A 1JW6A 5B4NA 3WHUA 4GB33 1CIYA 1ULDA 4O61A 5FP7A 3I2OA 3HBZA 5FWJA 2ZGTA 4XCBA 3M3CA 4OMCA 2EVXA 3GBGA 3OGSA 1HDKA 3OOXA 3LIHA 2NMOA 4JZRA 3WQBA 1DBNA 4A45A 2OKXA 2J1AA 4AHXA 4K3UA 4DEVA 1FV3A 4L92A 3LGRA 3PTYA 2DFCA 3MO4A 5FO9B 2A73B 2Y6GA 3E6CC 1GNZA 4IDZA 3ZPOA 3ABZA 4J25A 4META 1SQ4A 2CV6A 1O6UA 4K8FA 2R1BA 1QXRA 1CAXB 1G9FA 1I9RA 1S0EA 2ZEWA 3ECQA 5E16A 3AP9A 5J7MA 4PDWB 2V5DA 5FZ9A 3WNPA 1O7FA 4GIQA 5C9AC 1FMD2 1JTZX 4JV4A 4CDWB 2ZEYA 4MGKE 2XDVA 1RL3A 1AXKA 2WZEA 5LRSA 3LOIA 4HSJA 1X36A 1MACA 1MEC1 2R0FA 1QEXA 3NNMA 4Z2WA 4EYUA 3I59A 1REEA 3WDXA 4JVAA 1SBDA 1TNFA 2W2IA 4KMQA 1H8VA 2P37A 2A6YA 4RN5A 1GOHA 4Q4W2 3UJQA 2BVVA 2JD4A 3O14A 3USUA 2AC1A 1K3IA 1Y4WA 4RQPB 3Q8CA 1UCXA 3I2KA 1DU3D 1W9WA 2J42A 1XNBA 4HXCA 5FREA 2WO2A 5F7UA 4QQLA 2V73A 4C91A 1WGPA 5F1RA 1WW7A 3OY8A 4YW1A 4BA6A 4E4SA 2P3IA 2GNTA 2GSYA 1XNAA 5JPNB 3OPZA 5JSPA 4AEDC 1KS4A 2C0ZA 1VBA2 2ZBJA 5JOYA 1XNTA 4Y22A 4UF0A 5KWRA 4EZ4A 1GR3A 3WNLA 2D6LX 3AP6A 4CRQA 4DY5A 2YYOA 4RR3B 2ZGRA 4AEMA 5GZCA 1W3XA 5EPAA 3LB9A 1PM4A 3OGGA 2FMYA 3EXUA 3I2HA 5G05L 3TWIA 1W0OA 1LGNA 2RS32 4YW4A 4IV1B 1UZ0A 4C8DA 4FPLA 4NIDA 5A3NA 1Q8PA 3OBAA 4UT5A 1ZX5A 4XFFA 4JKKA 3HNYM 2WZR1 1K5MA 1SCRA 4XYXA 2B45X 1OUXA 4W50A 4YM1A 4FFGA 5DDJ2 1W6PA 3IDAA 4B7EA 4O7XA 4DRVA 3FFZA 2VCMA 2OPWA 4W65A 3OUHA 1Q3EA 2W3JA 3BIWE 1RUJ3 4XXAA 2TEPA 3CQOA 2RR13 4FAGA 4YW5A 3VV1A 1I6XA 5EHDA 4RYDA 5L19A 4UAPA 3ORJA 3IPVB 3BPZA 1VBD2 4IEZA 4OHYA 1Q56A 4ATFA 4UOJA 2KD7A 3SEPA 1QJZA 4DB5A 5L73A 5I0SA 3R4DB 1IPKA 2VAUA 4YFZA 3OYWB 4NRMA 3AFGA 2NN8A 3U11A 1WBFA 2GMEA 1AX2A 4D7SA 3WD5A 5C5UA 1UY2A 2MEV1 3BYWA 4YVSC 4BPZA 3DXTA 3RDIA 2VXJA 4DMIA 4GB31 2VUDA 3EYPA 3O0WA 4B1MA 5KC6A 1O5LA 1LOAA 2VOVA 3FLPA 2X53S 1SBEA
chains in the Genus database with same CATH topology
1JYTA 1JODA 1ZRIA 1F35A 1JOBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JYT A;  1JOD A;  1ZRI A;  1F35 A;  1JOB A; 
#chains in the Genus database with same CATH topology
 3IM0 A;  4FPK A;  5FIX A;  5CFD C;  2R04 2;  1GZW B;  2E6V A;  3CU7 A;  4C1X A;  3TEY A;  2YZ4 A;  1BMV 1;  4EJR A;  5C9A A;  3ZIW A;  3VBF B;  4XQD A;  1XOY A;  3K4Z A;  5E88 A;  2W1Q A;  3LFI A;  1D2Q A;  2RE9 A;  1MZF A;  2XB6 C;  1LKN A;  2WII B;  1ND2 B;  2OII A;  4JDN A;  1N1Y A;  1PNG A;  1KJR A;  3G6J B;  3HQX A;  4HPK A;  2QQI A;  1IG0 A;  3BOD A;  2EA7 A;  5I93 A;  4Q4W 3;  4CDU C;  1JYT A;  1LOF C;  4EWD A;  5GM0 A;  4EQV A;  5FV3 A;  4GJY A;  4XFH A;  2RDN A;  1QOT A;  5BNO A;  1N1V A;  3A0N A;  2EF6 A;  1D4V B;  3O1R A;  2I07 B;  5F37 A;  4P02 B;  3UV9 A;  3FL7 A;  1UAI A;  3SH5 A;  2ADD A;  3DYP A;  5AVA A;  2DUP A;  4PHZ A;  4Z8B A;  4NRP A;  1HRV 2;  1WCU A;  4BK4 A;  2VY0 A;  3N7L A;  3OSD A;  3WP6 A;  4FP2 A;  4AED A;  1WW6 A;  1C57 A;  4Q0Q A;  3VD4 A;  1ULO A;  2CDO A;  4LK6 A;  4A7Z A;  2WZ8 A;  4JGY C;  1W9T A;  2HEV F;  3D0J A;  3LEK A;  1V00 A;  1Y43 B;  1O8P A;  5FMD A;  4XMI A;  4AVS A;  4BXF A;  1FAY A;  4Y1Y A;  3ILF A;  4M3C F;  4D6R A;  2HWB 2;  3H8O A;  1NAE A;  5JOW A;  2PYT A;  3KCX A;  4QHB A;  1HV1 A;  1UZW A;  3RZG A;  2ILM A;  1LGB A;  3UES A;  3POI A;  5FYI A;  2LS6 A;  1OUR A;  2RS3 3;  3N9Q A;  4YAR A;  2W0X A;  1MQT B;  2DBN A;  3F2Z A;  4Q2F A;  2VZU A;  3KM5 A;  1OLM E;  4D6S A;  1GOG A;  1WD3 A;  5KXC A;  2K0G A;  2VME A;  1AL2 2;  4MHU A;  1MS8 A;  1CAU A;  4DPN A;  5C8C A;  5DDJ 3;  1XU1 A;  5A6X A;  2W68 A;  3WT3 A;  4ISR A;  2F4L A;  4FQZ A;  5DAW A;  1E5I A;  3ZSE A;  4AVV A;  3ZFG B;  1UY3 A;  4CCE A;  2YBS A;  5I0D A;  4UFI A;  1UZY A;  2DVD A;  2CHH A;  2H0B A;  2WWU A;  5FZD A;  5IYY A;  5DG2 A;  1VBD 3;  4FTB A;  2BNN A;  2VQ0 A;  4A4A A;  2XR4 A;  4L8Q A;  4FI9 A;  4K21 A;  1DFQ A;  3W9A A;  3RMY A;  1HN0 A;  3QOP A;  1XYN A;  2VZ1 A;  3E6B A;  1RUJ 1;  1KD7 A;  1WW5 A;  2VZP A;  4QGL A;  2VD7 A;  4G3Y C;  2BNM A;  4KU8 A;  4ET7 A;  2JIG A;  1C1F A;  1VBC 2;  3U78 A;  3AX4 A;  4YVS A;  4Q4X 2;  4UFK A;  3HT2 A;  4ARX A;  1W9S A;  3TEZ A;  4ZZ8 A;  4Q26 A;  1GP4 A;  4AE2 A;  1D4M 2;  4P9W A;  4YFW A;  1HQW A;  1CGP A;  3MBW A;  5FQ0 A;  4ASK A;  5CFD A;  3PIG A;  1EP0 A;  4BQ5 A;  4YM0 A;  2R04 3;  2GH8 A;  3I7D A;  2WAA A;  1AR6 2;  4B4P A;  1AXZ A;  4AGR A;  4CXY A;  5JIU A;  2ZGN A;  1WCS A;  4P9Y A;  5DZG A;  5EJ3 A;  4D94 A;  2A3Y A;  4AL9 A;  3LOB A;  2DCZ A;  3PL0 A;  1GOF A;  1NCQ B;  5LBF A;  5K0U C;  4MGY E;  4FSJ A;  4E4H A;  1UXZ A;  2JDZ A;  1ND3 B;  5I0R A;  2WT2 A;  4TWT A;  2G9F A;  1AJO A;  1X8E A;  1QDC A;  3PJY A;  3UGF A;  2PMW B;  4PIY A;  2WKK A;  3MUY 1;  3SIT A;  3FUQ A;  1LOF A;  2VNV A;  5HXM A;  4MVT A;  3N9O A;  1X9P A;  4L9B A;  1AUY A;  4LHN A;  3KF3 A;  3NNL A;  3MFA A;  4IEV A;  4Q1R A;  4UFM A;  4AEJ A;  3IMN A;  1AL0 G;  1CON A;  2R1D A;  3HR9 A;  1HRV 3;  1W6Q A;  4FFF A;  3C7G A;  3NNJ A;  4Q4W 1;  4GAL A;  3DYM A;  2PN5 A;  4JGY A;  3NJV A;  2WNU C;  4HT1 T;  3ON7 A;  3POY A;  1N1T A;  3NAP C;  5HI0 A;  2UWB A;  4LJH A;  1EAH 2;  4XUT A;  4XE9 A;  1DYO A;  1OPO A;  2BGO A;  2HWB 3;  3EMR A;  1W8F A;  2CDP A;  3OPW A;  3ME2 A;  2IC1 A;  1ZBA 2;  4N53 B;  5DUU A;  1S0J A;  2Q4S A;  5APA A;  3BCW A;  4SLI A;  1LOD A;  2D6N A;  4XBL A;  1JHN A;  3ZFF C;  2WWS A;  1AL2 3;  1UL9 A;  1LU1 A;  4C90 A;  5ABJ A;  4KU7 A;  3D0S A;  2VZS A;  4IER A;  4BIF A;  3N9L A;  1LHW A;  4MG2 A;  1H2K A;  3VZN A;  2WQ8 A;  2WT0 A;  3L2H A;  5A1F A;  1OT5 A;  1W8W A;  3I2D A;  1SBF A;  4FFI A;  1PIV 1;  3KCC A;  1QJE A;  1FV2 A;  2RS3 1;  4KWL A;  2Q1Z B;  3BB6 A;  1ZBE 2;  1X9T A;  2B4K A;  4AQ6 A;  4Q0U A;  3IIA A;  3SNM A;  4MGT A;  1UKR A;  3HN1 A;  4GA9 A;  4ORF A;  1URX A;  3MIE A;  4NOT A;  1EPZ A;  4AGG A;  3LCP A;  4ASL A;  4AVC A;  3TEW A;  2IFW A;  5M0T A;  3MYX A;  3S5A A;  1AJK A;  3AMQ A;  3S7E A;  5DDJ 1;  4M4R A;  1DCS A;  1RMU 2;  1H8T C;  5F5A A;  2B8M A;  1FNZ A;  2ET7 A;  2JE7 A;  3PNA A;  4IEO A;  4M4P A;  3AL5 A;  2C24 A;  5T5J A;  5F39 A;  2DU0 A;  2C26 A;  4GH4 B;  1GZC A;  1UY1 A;  1VB2 A;  1US3 A;  1VBC 3;  1IS3 A;  2CTV A;  5IAV A;  3WUC A;  1VBD 1;  3K3N A;  2Y38 A;  4Y4Y A;  1OQ1 A;  4E9K A;  2BOJ A;  4OUL A;  1W0N A;  4LHS A;  3B5L B;  1D4M 3;  4LTA A;  5IAX A;  3M3I A;  4XF9 A;  4XEZ A;  2VUJ A;  4P9I A;  3LEG A;  3ST7 A;  3FJS A;  1S4C A;  3TB0 A;  4CDQ C;  1CES A;  4QPG C;  4MGI E;  4NJ4 A;  1AR6 3;  2E7A A;  1G9B A;  2D5F A;  4ITC A;  3UGH A;  4WM8 C;  1M06 G;  3DL3 A;  1UKG A;  3KLS A;  4QB2 A;  2XJS A;  5EJ1 B;  2VZO A;  2PHW A;  2XHN A;  2Y8K A;  5K0U A;  3JD7 2;  3BIE A;  4NRQ A;  3MEP A;  5CIR A;  3LKJ A;  5H9R A;  3ILN A;  3VZK A;  4B4R A;  4KWU A;  2R04 1;  1V9U 2;  1QJX 2;  4ZXE A;  2YRO A;  2TUN A;  4WM7 B;  1RVF 2;  4GMP 0;  2VW0 A;  3WDT A;  2OA2 A;  4HVQ A;  2WS9 3;  1J3R A;  3AL6 A;  1SLA A;  2ARB A;  1XPW A;  2J22 A;  2A6V A;  4JX0 A;  4DRR A;  2Y64 A;  5GZF A;  5J96 B;  1AR9 2;  4IES A;  3CJX A;  4XHB A;  1EUU A;  3VBR B;  5H9S A;  4AI0 A;  4E8D A;  2AZ5 A;  5IUQ A;  4ZPI A;  1SCS A;  1UOG A;  2YGL A;  3U07 A;  3ZDV A;  2JDA A;  3R05 A;  3JCI A;  3Q8E A;  4G9S B;  3U37 A;  1U5Z A;  2WNU A;  4QPY A;  3W5N A;  3NAP A;  1LJ7 A;  5ANQ A;  4LOS A;  5C33 A;  1EAH 3;  2ZML A;  1IKQ A;  5K7P A;  1DQ5 A;  4Y1U A;  1V6I A;  3SC7 X;  4BB3 A;  5FPX A;  1CIW A;  1KFX L;  2Y6H A;  1ENQ A;  1Y9G A;  4FXK B;  3IDC B;  4OMD A;  4AI9 A;  3ZFF A;  2W92 A;  2QCS B;  5LZ6 A;  1W28 A;  1ZRF A;  2E31 A;  1STM A;  3C7E A;  5G04 L;  2HWB 1;  4QKN A;  1APN A;  2JKX A;  5HCB A;  5FUI A;  4L0P A;  1Z7S 2;  2W91 A;  4MHR A;  5LRR A;  1ZZ9 A;  3OBR A;  3ZN5 A;  3ZYB A;  5FZO A;  2D93 A;  2V72 A;  1SDD B;  1ZYB A;  1NKG A;  3HMY A;  4DUV A;  5ACA 2;  5E89 A;  2W39 A;  4P08 A;  1AL2 1;  2W08 A;  5FYS A;  3VDD C;  4AFA A;  5HV0 A;  1B35 B;  3SH3 A;  2VMG A;  2JEM A;  1FNY A;  1H8T A;  1RMU 3;  1T6G C;  5FYU A;  4ATE A;  2Q1M A;  2QZ3 A;  2NZ9 A;  4LKS A;  2PQS A;  5BNP C;  2G1M A;  4E4D X;  1O3Q A;  5JZG A;  2TBV A;  2YB7 A;  2GC1 A;  1ULF A;  3RG0 A;  5CFC C;  3Q8F A;  2QQM A;  5J3U A;  1JI6 A;  2RV9 A;  3JZV A;  3PME A;  3WF2 A;  2IXL A;  5CA6 A;  3I59 B;  1CWP A;  4IEX A;  2Q8C A;  4QAW A;  4JKL A;  5EIY B;  4FT8 A;  4YVW B;  1JHJ A;  4CP1 A;  4IV3 C;  3CJI C;  1NOV A;  1RJ8 A;  5FP9 A;  4A2U A;  3CBN A;  1UZZ A;  2ZX0 A;  3B9C A;  1T6B X;  4MGQ A;  4PIZ A;  3RWN A;  4CDQ A;  4OI2 A;  4QPG A;  1VBC 1;  2RDR A;  1N47 A;  2XUM A;  4WM8 A;  2WFF 3;  1YIF A;  1UU5 A;  2D97 A;  1VIW B;  1MZE A;  5FLJ A;  4GXL A;  3HBK A;  3OPT A;  3HQR A;  3HT1 A;  1D4M 1;  3JD7 3;  1A78 A;  4Y22 B;  4AYU A;  4UF0 B;  5LK7 B;  2J1R A;  4Y1Z A;  2WO7 A;  4X8N A;  3A21 A;  2GAL A;  3WG4 A;  3X29 B;  1TME 2;  5HCA A;  1UIK A;  3P1I A;  1W03 A;  4QWN A;  1QJX 3;  1AR6 1;  2QNK A;  1OKQ A;  3W58 A;  4DIN B;  1UYP A;  4XJZ A;  4XOG A;  2YFZ A;  2XWJ B;  5FOB B;  1RVF 3;  2OQ7 A;  5KXB A;  5FMC A;  3RRD A;  3U4S A;  1ZA7 A;  3ACI A;  1QJY 2;  1WA6 X;  5A3W A;  5KR7 A;  5EV7 A;  4QX1 A;  2VNG A;  3HEI A;  1QH7 A;  4B3N A;  2BBV A;  2VMD A;  3A23 A;  3V0A A;  3VUO A;  2RS1 1;  4AI8 A;  1CJD A;  1RUD 2;  1NZI A;  4Z07 A;  4Y1X A;  3HWJ A;  1ENS A;  1UPS A;  1W6P B;  3KV4 A;  2Y33 A;  5FP3 A;  2RJ2 A;  5FMO L;  2D3R A;  2ES3 A;  2WS9 1;  3T0B A;  2EAL A;  5SV8 A;  2VO5 A;  4AG4 A;  1J58 A;  3O1V A;  1NA1 C;  5FYH A;  3OUI A;  2J1T A;  2QQL A;  4MAD A;  4OZX A;  5CNA A;  3WDY A;  5FJH A;  4YG0 A;  5FK7 A;  5GLW A;  4DIQ A;  1JZ7 A;  2JDM A;  1E5H A;  4BYY A;  3WF3 A;  4P00 B;  1HV0 A;  4LBQ B;  4W6W A;  1UU4 A;  2BJS A;  3T09 A;  1GFF 2;  1W6N A;  3J8F 2;  4ES8 A;  5IVE A;  5FPB A;  3J4U H;  1X33 A;  2VOK A;  3WQ0 A;  1UF2 C;  2O8O A;  2QQW A;  2Y34 A;  2WFP A;  3KT4 A;  2J1U A;  3H1M A;  3IAP A;  1EAH 1;  1KS5 A;  2PHD A;  4JHT A;  5FCC A;  4BQ3 A;  1UYY A;  3PJQ A;  4HMZ A;  5FY5 A;  1IKP A;  2G9G A;  2WT1 A;  3U1X A;  4IE5 A;  4ONU A;  4BWO A;  4CXX A;  3GDB A;  1Z7S 3;  3BOW A;  1DQ2 A;  2LRP A;  2VE1 A;  1NLQ A;  2ZGQ A;  3P3P A;  1G8W A;  3V64 A;  3ZFE C;  5FXX A;  4CCL A;  4C0B A;  1XU2 A;  5ACA 3;  1G6N A;  1O4T A;  3VDD A;  3T2T A;  4FXG B;  1S55 A;  3CIH A;  2F17 A;  3I2F A;  4KBZ A;  2UYB A;  4OUS A;  5IVF A;  1KRI A;  2C9K A;  5FUN A;  3BTZ A;  2A1X A;  2VW2 A;  3FFQ A;  5C9A B;  2JDK A;  2Q5T A;  2YC4 A;  1HW5 A;  1UWW A;  5BNP A;  4EZH A;  4FPG A;  4JHZ A;  3ES4 A;  1LES A;  4K20 A;  1LEC A;  1UOB A;  3QLQ A;  4IQP A;  2OQ6 A;  3MIC A;  5T5P A;  1WA4 A;  4CSW A;  3IWZ A;  4CPB A;  1HRI 2;  5JMC A;  3SH4 A;  2P4E A;  2ERF A;  1TE1 B;  2DU1 A;  4LE3 A;  2WC2 A;  4YG6 A;  1UNB A;  2AEZ A;  4IV3 A;  3CJI A;  3NL1 A;  4K7J A;  1RIT A;  2AEN A;  3VL9 A;  5L36 A;  4I0W B;  1C8N A;  1UMI A;  5FPA A;  3BGA A;  3INA A;  5FK8 A;  4J6G A;  4AAX A;  2HYX A;  1YI7 A;  3SCH A;  1UX6 A;  2WA4 A;  4GZ9 A;  4WBB A;  4TZD A;  3DPR C;  2O1Q A;  2P5B A;  2VR4 A;  1PGL 1;  1RUG 3;  1IS5 A;  1PVC 1;  3OBT A;  3V65 A;  3LDB A;  2P17 A;  2WQ4 A;  2I2S A;  4W8J A;  1TME 3;  1VMJ A;  3WV6 A;  2VUC A;  3NKT A;  3HIF A;  4QT6 A;  1F35 A;  2OXB A;  3RVH A;  2YV8 A;  2WFF 1;  2R0H A;  1NZC A;  3N7J A;  5LCW L;  1QJY 3;  4ERO A;  2GH2 A;  4LPL A;  3JD7 1;  2BRT A;  5EZW A;  5CB7 A;  4I3P A;  2KXL A;  3K51 A;  2B46 X;  4DUW A;  1RED A;  1RUD 3;  4NHY A;  2P1B A;  1FPN 1;  4QPW A;  2JDP A;  4WVW A;  3LA7 A;  2WIN B;  1CAU B;  3LDK A;  4ZU5 A;  3SEE A;  3SMH A;  1UOJ A;  1FI2 A;  1LU2 A;  3OGR A;  1G9D A;  1RVF 1;  4R4Z A;  3T2P A;  5FPU A;  1JOD A;  1ULG A;  4DZG A;  1YQ6 A;  1NA1 A;  4ZZ5 A;  2FDJ A;  5FYV A;  5A7W A;  4Q0V A;  4YRD A;  5A6Q A;  5JLV A;  3DXU A;  3VD9 A;  1AR8 2;  4AHZ A;  4H7M A;  2E32 A;  2ZAC A;  4XCA A;  4U2A A;  3WDW A;  4XJA A;  3ZSK A;  3J8F 3;  1JOP A;  3EHK A;  3H42 B;  1K5M C;  5T50 A;  1VLN A;  4BQ4 A;  4QD2 A;  3Q8B A;  1UX7 A;  1NUK A;  1RJ7 A;  1YFU A;  1YO8 A;  4H7L A;  5FXV A;  5C8W A;  5FTT C;  2HWD 2;  3ZN4 A;  5FPZ A;  5FZ8 A;  4E2G A;  5JXJ A;  4YVS B;  3PUQ A;  3VZL A;  2PHF A;  1W8N A;  3PVB B;  3WNX A;  4CEY C;  1GWK A;  2VM9 A;  1DDL A;  4CA9 A;  3KQ4 B;  3WF0 A;  3WP5 A;  2IWG B;  1AX1 A;  2ATF A;  1FOD 2;  2CYF A;  2C4X A;  3CMG A;  2OZ6 A;  1C28 A;  1H9P A;  1EV1 2;  3PUS A;  2P6H A;  4V2W A;  2GU9 A;  3ACG A;  5BNN B;  5CFD B;  5CKN A;  3AZY A;  1VB4 A;  2P3K A;  3GZU C;  1SFN A;  4CUA A;  1YUD A;  3C7O A;  5IVC A;  2AH2 A;  1WLT A;  3WIN E;  2HWC 1;  4YW2 A;  2VC9 A;  3WNM A;  2OPK A;  3NMB A;  5DQ0 A;  2DTW A;  5ACA 1;  2UUR A;  4PQQ A;  4ZON A;  1BVV A;  4XC9 A;  4KH9 A;  3RQ0 A;  4OCT A;  4BIS A;  1NT0 A;  1DGW A;  2ADE A;  2CL2 A;  1HRI 3;  4IEU A;  4MH0 E;  1S0I A;  4IND A;  4SBV A;  5JMO A;  3SIS A;  2WZP P;  5KHI A;  4CDU B;  1CR7 A;  1UXX X;  3RI9 A;  1JOB A;  1GMM A;  4QM9 A;  2SLI A;  2E33 A;  3FHI B;  1W05 A;  2NM1 A;  4AEK A;  3JXS A;  4IGQ A;  3N35 A;  4FFH A;  3WW4 A;  1IPS A;  3ZN6 B;  2UYA A;  3C3V A;  5FP4 A;  3DPR A;  4FOW A;  3POE A;  1OC1 A;  1V6O A;  2EXJ A;  3H8U A;  4EV0 A;  2YY1 A;  3OG2 A;  4RSU A;  3MPP G;  2MNG A;  1QHD A;  3AK0 A;  3VN4 A;  3VBH C;  3ZO0 B;  4Q4V 1;  4CU9 A;  5JCT A;  1MS9 A;  1AYN 1;  3O12 A;  2ZAB A;  2D5H A;  4RGK A;  4MO3 M;  3HVD A;  3TBD A;  1W6O A;  5BNO C;  4NII A;  4E4Z A;  2QDR A;  5JIA A;  4YGE A;  4ZY9 A;  5LA2 A;  4DFS A;  3AB0 A;  4BQ1 A;  5F9T A;  5JOZ A;  4N43 C;  1RUG 1;  3GHM A;  2DVG A;  2VMH A;  3VBU A;  2ZHK A;  3MIH A;  1W8O A;  3OGV A;  1W8T A;  3UKN A;  2B5H A;  3POF A;  2JB4 A;  1W2O A;  1R08 2;  3GF6 A;  2W47 A;  5C5T A;  5IVY A;  1LOB A;  1QJY 1;  2VCB A;  4PBP A;  4XUP A;  5F6K A;  1AF9 A;  4L97 A;  3PHM A;  5F3I A;  3MPB A;  3JQX A;  2K2S A;  3DUI A;  4DQA A;  1J3Q A;  1RUD 1;  5DMY A;  1AR8 3;  1Q8S A;  4HZF A;  2DF7 A;  2IVJ A;  2XG3 A;  5DAB A;  4LQR A;  1XYP A;  5FZF A;  1G86 A;  4LE4 A;  5C8C C;  4H2A A;  1XJA A;  1PO2 2;  1DGR A;  3FHA A;  2CGN A;  4UFJ A;  1F4A A;  3VHR A;  3BPS A;  4AHY A;  3K4A A;  1H2N A;  3BU0 A;  1C8M 1;  4TLG A;  4FPH A;  1PGW 1;  4Y24 A;  3T30 A;  2HWD 3;  4ES9 A;  3M3E A;  2WA3 A;  1SLI A;  5AFE A;  4IXL A;  3NW4 A;  3AKR A;  2YU1 A;  3J8F 1;  4CEY A;  4RFT 0;  2GND A;  1BXH A;  2WLP A;  1DGL A;  3LIG A;  1RXG A;  1GP5 A;  1UMH A;  2X29 A;  1JUH A;  2YUE A;  1FOD 3;  4TSV A;  4HK9 A;  4DXZ A;  5D8A C;  2JG8 C;  4XDO A;  1QIQ A;  1VPH A;  3D4K A;  1QMJ A;  3UET A;  1REF A;  5EYX A;  4A6O A;  1H9W A;  1SHW B;  4AI3 A;  3C7H A;  1K12 A;  4XJ8 A;  5FZ7 A;  4ZKT B;  1COV 2;  3IB3 A;  4FTE A;  5EYY A;  3FX3 A;  3CEW A;  4COW A;  1O3T A;  3IDE A;  2BOI A;  1TG7 A;  1GYK A;  3MUZ 1;  1CZT A;  4QDR A;  3EJK A;  3I3B A;  4QX3 A;  2XOM A;  4LO7 A;  1ODN A;  3AJZ A;  1VAM A;  2JG9 C;  2ZGU A;  3C8X A;  4PBO A;  4PI0 A;  2FDI A;  2ZKN A;  2R32 A;  1VE0 A;  3OJB A;  3P6B A;  3NQH A;  3SKJ E;  2GDF A;  2OT7 A;  5F2W A;  3JBG 2;  4B8E A;  1RUE 2;  3LDR A;  1SPP A;  4JTN A;  2KM2 A;  3ZYH A;  1W2A X;  1FMD 3;  2WQZ C;  4OUE A;  1YIP A;  1ACC A;  3ZX7 A;  1NXD 1;  2ZAH A;  2WNV C;  3T3Y A;  4CTE A;  5HBA A;  3RZM A;  4Z1V A;  1HRI 1;  2FDH A;  1POQ A;  1WCD J;  3WW3 A;  3JB4 C;  4DS0 A;  1WBL A;  2ZX2 A;  2DUR A;  2D43 A;  2H0V A;  2WNU B;  3VBH A;  4XF0 A;  3FWE A;  3ZYI B;  2QDN A;  1BK0 A;  2EAK A;  3KGL A;  3JQW A;  3PIJ A;  2Z79 A;  2BFU L;  3CL1 A;  4IE7 A;  3RI8 A;  3T1M A;  4ZS2 A;  3WG2 A;  2ID4 A;  1EUT A;  5CYY A;  3S57 A;  1R1A 2;  2JDN A;  1DIW A;  2D6O X;  3OUJ A;  1YI9 A;  2F4P A;  4FP3 A;  4N43 A;  3OEA A;  2JIC A;  3QCW A;  2WUH A;  3ZFF B;  1ALY A;  1VBA 3;  3QH7 A;  4FPO B;  3DN7 A;  4I0B A;  2FCV A;  3U0Z A;  5SV5 A;  2O0O A;  4JAA A;  4LA2 A;  3PVN A;  4WVZ A;  1V6N A;  2VQA A;  3NRU A;  1SLB A;  2XQR A;  1R08 3;  3BAL A;  3WOG A;  5KBF A;  4NHX A;  4HKL A;  5FZO B;  1OQE A;  1LHV A;  2VOT A;  4GD4 A;  1GQP A;  3A4U A;  2P3J A;  5FZE A;  4LA3 A;  4GWI A;  5DZF A;  3I3M A;  3L2Y A;  5IAT A;  3E5U A;  1AYM 2;  2RDS A;  4BMB A;  4OYU A;  2ZX4 A;  2Z4F A;  5ABJ C;  5FUP A;  3DGT A;  3GBF A;  1PO2 3;  1JMU B;  1UQX A;  3LEI A;  4QX2 A;  3WG1 A;  3U4X A;  5E6H A;  2D6P A;  2B42 B;  2UY9 A;  4RS5 B;  5FAX A;  3N9N A;  3B01 A;  3N4M A;  1AR8 1;  2WN3 A;  2QQJ A;  3AMP A;  3CNA A;  3E5X A;  4UW6 A;  4LBN A;  2VU9 A;  1MPX A;  4XIK A;  1T2X A;  3LPF A;  2VMF A;  3DEM A;  3JU9 A;  3J9S A;  4AQS A;  1H1I A;  5FP8 A;  5D8A A;  2JG8 A;  3T0A A;  4Q4Y 2;  3NJY A;  4BH9 A;  4QU1 A;  1NX9 A;  2HWD 1;  3WDV A;  5FJK A;  2RMU 2;  4QPG B;  4OHW A;  2RR1 1;  3HAG A;  4JRA A;  5FZA A;  4AQT A;  2NLR A;  4QX0 A;  1BBT 2;  1H1A A;  1MVE A;  4QU2 A;  4CU7 A;  4FAH A;  4I0A A;  2X5I C;  3VZJ A;  4GWN A;  1O8S A;  4D69 A;  3RZZ A;  4JGZ B;  4J1W A;  4W6Y A;  4BQ2 A;  1K42 A;  1FOD 1;  2QBX A;  2XJT A;  2VTX J;  1UYX A;  4PQ9 A;  3V0B A;  2ZXQ A;  3HNB M;  2JG9 A;  4OHZ A;  2A6X A;  3SKV A;  1FT9 A;  4NO4 A;  4UBH A;  4RGA A;  1SLC A;  1QXJ A;  2DFB A;  5FKB A;  3FLT A;  3POB A;  3JBG 3;  3WP3 A;  1RUE 3;  4R9A A;  2QTW B;  2NPI A;  5FWE A;  1JYI A;  1JYW A;  5FDB A;  2PAE A;  4BXS V;  2VBP A;  2VQU A;  2ZX3 A;  2WNV A;  2D3P A;  1IQD C;  2YFU A;  3NKG A;  3P3N A;  1R1Z A;  1OA3 A;  2BWA A;  1GU3 A;  2VPV A;  4QB6 A;  3OTF A;  2JB8 A;  3NNF A;  5FZM A;  1VMH A;  3N9M A;  3A22 A;  4R9C A;  1JZ6 A;  2H6B A;  3N3H A;  1C3H A;  4XIO A;  3G7D A;  3O0V A;  1FMD 1;  4X8P A;  2DWR A;  2B9V A;  5I0U A;  4RHV 2;  2FCU A;  2DBI A;  1OSG A;  4QQ2 A;  3MID A;  5F5C A;  4XAA A;  3ZIX A;  2FD8 A;  4YM2 A;  1IS6 A;  1MS3 A;  1CX4 A;  1WLC A;  1R1A 3;  5A6Z A;  1ZVF A;  4LT5 A;  1ZZC A;  3WUD A;  5FY4 A;  5AC9 2;  2GC3 A;  5D2A A;  1DYP A;  2D98 A;  4XPV A;  4CDX B;  4YWA A;  1IOA A;  4E2Q A;  1W2N A;  1Y9M A;  2GP5 A;  2GZW A;  2X8K A;  5ERL A;  4X6R B;  4CUG A;  2XH6 A;  3T2O A;  5IVV A;  5DG1 A;  1CAX A;  4FPC A;  1FYU A;  3ZR5 A;  2A71 A;  4A44 A;  4P5H A;  1TZO A;  4N9H A;  3RYP A;  3K3O A;  5FZ3 A;  4PDW A;  4AFD A;  2O8Q A;  4ZS3 A;  2R07 2;  4I09 A;  1BEV 2;  1KGY A;  1UY0 A;  1O5U A;  2WYF A;  1VBA 1;  1S2K A;  3CZU A;  2Y6L A;  1I5Z A;  1A34 A;  1AYM 3;  4IEQ A;  4B29 A;  5IK5 A;  1R08 1;  4WZC A;  4O9G A;  1AR7 2;  1TVG A;  3WXP A;  1KXG A;  3NV4 A;  4PLN A;  2CNA A;  2BNO A;  4Z82 A;  5T52 A;  5FY9 A;  1PK6 C;  1MS0 A;  5CFC B;  2OW4 A;  1GWM A;  4ZU4 A;  4ZXK A;  4RQP A;  4YZ3 A;  2N7G A;  2VZ3 A;  2ZGS A;  1LEM A;  3AYA A;  4KI5 M;  4UW5 A;  2XJR A;  4XW3 A;  3JB8 A;  1OI6 A;  4LOT A;  2VUL A;  4LXL A;  1PO2 1;  2WR9 A;  2RM2 2;  1ZM1 A;  4IV3 B;  4Q4Y 3;  1YWK A;  5A7S A;  2XLG A;  3ZYG A;  2RMU 3;  4D8M A;  4HLT A;  3Q9O A;  4DUX A;  1SFY A;  2E51 A;  2ZGK A;  5J09 A;  2WRA A;  4AK3 A;  5JZG C;  3M3O A;  3I8T A;  5JSO A;  1YFY A;  2X5I A;  1QJU 2;  3OGJ A;  1RGS A;  1U12 A;  4C0H A;  1PMI A;  4Q4X 3;  1OA2 A;  3GM8 A;  3HPN A;  1OQD A;  4QKB A;  3L9J T;  4KGQ A;  5IFT A;  4AI2 A;  2WN2 A;  4FPE A;  2RS5 2;  2BBA A;  2CGO A;  3NVC A;  4OI0 A;  2ZCW A;  4I02 A;  4K9S A;  3UKV A;  2JE9 A;  5LAS A;  2LRO A;  3AZX A;  3ZFE A;  5I0T A;  4YW7 A;  3VDC A;  5FYC A;  1RIN A;  1CPM A;  3PU3 A;  2VVF A;  1LUL A;  2Q8E A;  2ZA9 A;  2IXI A;  3ZFG C;  1Q8O A;  1US2 A;  2OUJ A;  2Y6J A;  3ASI A;  1W3V A;  2VMI A;  4QPI B;  2P3Y A;  4MZU A;  2XVG A;  3OB8 A;  3SCF A;  4JQT A;  3H1W A;  3MLK A;  4NE9 A;  5JR2 A;  1GKB A;  1P8J A;  3W21 A;  5JAX A;  1ZRC A;  3JBG 1;  3MF6 A;  1H4G A;  2ZEX A;  4XTP A;  4YGC A;  3T2Q A;  2AEY A;  1W6M A;  3ZYP A;  4FOQ A;  5FYT A;  3M2M A;  2VEC A;  5FYZ A;  4RHV 3;  3ZLI A;  4CP9 B;  1VRB A;  2ZAA A;  4R9D A;  3VD5 A;  4BM8 A;  5B2G B;  3OYW A;  3O1M A;  5ANN A;  4LO8 A;  4RL7 A;  1O3S A;  2CU5 A;  3VDB A;  4A42 A;  4E27 A;  5GZE A;  1LR5 A;  4WZF A;  1ZZ6 A;  5FZ6 A;  5AC9 3;  1QOO A;  2WDB A;  1CAW A;  4LIT A;  2IFR A;  2LM3 A;  4YW3 A;  1QY4 A;  1JBC A;  1PMH X;  3DV8 A;  1KQR A;  3KVB A;  1GQH A;  3I2I A;  3MIG A;  3LFM A;  2DVB A;  2A5Z A;  2A7A A;  1YQ5 A;  1YJK A;  3MW2 A;  2UY8 A;  1R64 A;  4F3J A;  2QQV A;  4B1L A;  5IJR A;  3I54 A;  1RUO A;  1WCQ A;  1HRV 1;  1ZBA 3;  4EN9 B;  2R07 3;  3KMH A;  3UT0 A;  1YFX A;  2VL4 A;  1DLL A;  2DVF A;  3HJR A;  1N3Q A;  1S0C A;  2VVE A;  2XHK A;  4NHK A;  1IS4 A;  2BFU S;  2W52 A;  5A32 A;  3EQE A;  4LO4 B;  1ND2 A;  2H6C A;  1AR7 3;  5F2S A;  2VG9 A;  3HD8 B;  4A41 A;  3ZXA C;  1PK6 A;  4QX7 A;  2W5F A;  3J7L A;  3MHZ A;  4XBQ A;  2KR2 A;  3WNK A;  4ASM B;  2ZGO A;  1ZBE 3;  1Q8V A;  3BKZ A;  2YG0 A;  4F7Z A;  1ZZ7 A;  2A3W A;  2G19 A;  2YBK A;  4LUK A;  1AYM 1;  3IZO A;  2JEC A;  1MS5 A;  1H30 A;  3NV1 A;  4IEW A;  5EP9 A;  3FLR A;  4XXP A;  1KDK A;  3MFC A;  1WMD A;  3WQ7 A;  1W2T A;  1UMZ A;  2RM2 3;  3WDU A;  3FMG A;  4XFC A;  1A8D A;  2A70 A;  3ZR6 A;  1CX1 A;  2YU2 A;  2JXA A;  5FYM A;  4XF4 A;  1LHN A;  1RXF A;  2G4I A;  4CCN A;  3FBM A;  5LW9 A;  2NP0 A;  2HYK A;  4DXT A;  1XND A;  1NLR A;  1QJU 3;  1XB9 A;  4CPB D;  2XPJ A;  2QVS B;  4K1Z A;  4K8R B;  4LK7 A;  5FLI A;  5FRA A;  2VUA A;  4FOV A;  4Q4Y 1;  4Y20 A;  1BHG A;  1QKQ A;  2RS5 3;  1RUC 2;  1HB3 A;  1RUF 2;  3GAL A;  3R4S A;  3ETQ A;  4MXV A;  2RMU 1;  2ZKL A;  3USU B;  1XSQ A;  3CKH A;  1W6O B;  3B93 A;  1J3P A;  1VAK A;  3AC0 A;  1DHK B;  4Q4X 1;  3ZXD A;  1OKO A;  1LB2 A;  2ZJC A;  1O91 A;  1V0A A;  3OY8 B;  4L11 A;  4ARY A;  2EXK A;  4N90 A;  1VAV A;  4M0N A;  4I01 A;  3ZFG A;  5FO8 B;  3THD A;  1NQJ A;  3B00 A;  3VBU B;  4XTM A;  5IHR A;  2PXJ A;  2ZGM A;  3OCP A;  4YSF A;  2D6K A;  3LQC A;  3TRS B;  2QQU A;  1XSR A;  3H0O A;  2K9Z A;  4Q0P A;  4AR2 A;  1V9U 3;  1WW4 A;  5FO7 B;  3IBM A;  4PI2 A;  1K45 A;  2DCK A;  3KV6 A;  3TN9 2;  1CJP A;  2WAB A;  2D44 A;  1YQ2 A;  5FZ0 A;  3WCS A;  1U5I A;  3R0R A;  4COY A;  1OF4 A;  3R6S A;  4GH4 C;  1V6M A;  1F4H A;  4AVT A;  1AR9 3;  4BLJ A;  2L9L A;  1K5M B;  1V6K A;  1JU3 A;  3KVA A;  1X8M A;  2JX9 A;  1V70 A;  1DF0 A;  2E9Q A;  3BTA A;  2OVU A;  3VBS C;  3MV1 1;  1D0H A;  5A3M A;  4L99 A;  2FZ2 A;  4KBB A;  4N7U A;  4RHV 1;  3WVJ A;  4GAZ A;  3J7N A;  2BPA 2;  4Q5O A;  5C3O A;  2GMM A;  4CYD A;  1GLH A;  4Q0S A;  4CP0 A;  5DUW A;  1RUH 2;  2IZW A;  3CO2 A;  4XVH A;  4CEY B;  2BZD A;  4DNY A;  5AC9 1;  3NNG A;  3OD0 A;  2V4A A;  2XL7 A;  4OZO A;  2P2K A;  3MV0 1;  5DAQ A;  3SCG A;  4CP2 A;  2VZV A;  3S7I A;  5J1X A;  5A3P A;  4M01 A;  5FMO S;  4A7Y A;  1L7R A;  4JDO A;  3H8R A;  1AVB A;  2JDH A;  3VHN A;  1DP0 A;  1NY7 2;  4QX8 A;  2RG4 A;  1RTV A;  2LAL A;  1AXY A;  3LSE A;  4NWW A;  1G9C A;  3VD7 A;  2XLF A;  4XJW A;  1ZBA 1;  4TYS A;  2R07 1;  4W4Z A;  4OHX A;  4PF1 A;  5JVV A;  4X6Q B;  3AJY A;  3A0K A;  3WP4 A;  2FQP A;  1PHM A;  1VR3 A;  2Q8D A;  4XZP A;  3KHC A;  1LTE A;  3PTR B;  2PEL A;  4BZ4 A;  1ODM A;  1CQ9 A;  4HN0 A;  1AR7 1;  2Y0O A;  3UGG A;  2BV4 A;  4A3Z A;  1QDO A;  3C7F A;  4BDV B;  1SPP B;  1TMF 2;  2IVI B;  3ZXL A;  1IHM A;  4IGP A;  1ZBE 1;  3KB5 A;  3QAC A;  4LIU A;  5HXV A;  5LEJ A;  2RHP A;  1I3H A;  2QE3 A;  2R49 A;  2VVD A;  5FZB A;  3H7J A;  1R09 2;  3MW4 A;  4D7T A;  5CBL A;  4HSL A;  4P5Y A;  5C3P A;  3CHX A;  2RM2 1;  4HPK B;  1RMU 1;  4N53 A;  4GB3 2;  4O9E A;  2FHR A;  3IT8 A;  2VW1 A;  5F6L B;  1RUC 3;  1RUF 3;  4IE0 A;  4JTO A;  5A3O A;  2RJL A;  3O5S A;  2HJI A;  4LOR A;  1W90 A;  5BNO B;  2FCT A;  5BYN A;  3ZYR A;  5L9B A;  1DGW X;  1QJU 1;  2R6Q A;  4NUB A;  3LA2 A;  5C3Q A;  2EIE A;  4QKD A;  3URF A;  4IEY A;  1W8U A;  4HN1 A;  4K1Y A;  5FZK A;  4AQ2 A;  3O1S A;  2FDF A;  2WO1 A;  2YXS A;  3IDB B;  2BVB A;  2HEY F;  2RS5 1;  4AED B;  2EIG A;  4K40 A;  4YYO A;  3RZL A;  4EN8 B;  1RHI 2;  4EWE A;  4CEW C;  3O1P A;  1JZ5 A;  2E26 A;  4IEP A;  4XFI A;  3WZ1 A;  3KS7 A;  3WF1 A;  2YPD A;  3T08 A;  1B35 C;  4UWD A;  4COU A;  5L9V A;  3TN9 3;  1AHS A;  2VXR A;  1PM7 A;  2JKB A;  4MUV A;  4XET A;  3N36 A;  1NE4 A;  3KF5 A;  3FC0 A;  4M0H A;  5DUV A;  4LO6 B;  4FPY A;  2QJV A;  4FPF A;  4GH4 A;  3B94 A;  3HNM A;  5HCF A;  1SEF A;  3O1U A;  1V9U 1;  5C8C B;  1QJX 1;  4QXH A;  2PHR A;  3AKP A;  4CVU A;  5BY5 A;  2ZPX A;  3N7M A;  2VZQ A;  5CAZ A;  1F2N A;  4LKE A;  2ORX A;  3VBS A;  4YVW C;  3T1L A;  3ZMO A;  1BQP A;  4QDS A;  3ZSL A;  1MZ6 A;  1QWR A;  2PTM A;  1IGO A;  3K77 A;  1RIR A;  1WD4 A;  5IWF A;  3RJR A;  2I74 A;  1ST8 A;  4LIV A;  1DQ0 A;  1OH4 A;  1UPI A;  5I8S A;  3U10 A;  2E53 A;  2EIB A;  2LTN A;  1AR9 1;  1LHO A;  1RUH 3;  1QQP 2;  4YZ1 A;  3RNS A;  5GLZ A;  2PA7 A;  3KWV A;  5D8A B;  5KHH A;  4D6Q A;  4Y4R A;  1EPW A;  2ZTN A;  4P9G A;  2XVK A;  1OPM A;  3QH6 A;  5FR3 A;  5DZE A;  3ALQ A;  2OS2 A;  3N9P A;  1QJF A;  3RYK A;  1SG3 A;  1WME A;  1TQ5 A;  1HKD A;  4AFC A;  5FYB A;  3A7Q A;  3V0B B;  3LWC A;  1HN1 A;  2ZHL A;  1PNF A;  1RC6 A;  2ZEZ A;  1OOP C;  1J1L A;  3POG A;  4COZ A;  2HH9 A;  3VB9 A;  1W2U A;  1HB2 A;  3W59 A;  5GKA C;  2A6Z A;  4D7Y A;  5FQ0 B;  4I30 A;  4Q1P A;  4CU6 A;  3GCX A;  3VBR A;  1XNC A;  4URA A;  5C7G A;  4URT A;  1W8H A;  1CVN A;  1YRZ A;  2VBB A;  3IN9 A;  1TMF 3;  3E6D A;  3ELN A;  3T0D A;  1Z7S 1;  4U36 A;  1SMV A;  3FN9 A;  3MW3 A;  3H1Y A;  4HOO A;  1S0D A;  3NO8 A;  4N7I A;  1XE8 A;  4YM3 A;  3ACF A;  4M3C A;  3ROU A;  1X7N A;  1PVX A;  1JS9 A;  4PCR A;  1G9A A;  3PUA A;  1RUI 2;  1VRH 2;  4BQY A;  1R09 3;  5FBJ A;  3BOP A;  1ZZ8 A;  1D7P M;  4FO9 A;  3KSC A;  4A6S A;  2ET1 A;  1N1S A;  5LBB A;  1DLC A;  4BLI A;  3LSD A;  4LUL A;  2DUO A;  1LCL A;  2XJP A;  2ZS6 B;  2CAV A;  3GJA A;  5LA1 A;  4LBL A;  3B02 A;  3HOB A;  2YPJ A;  3ZVX A;  4GWM A;  5CU1 A;  2XJU A;  1VJ2 A;  2RVA A;  5A33 A;  2QKD A;  3VKO A;  4FTS A;  1GAN A;  4BJ0 A;  1ZRE A;  5B4X A;  4WVV A;  4IET A;  1UW8 A;  1ENR A;  1ONA A;  3I4I A;  4NHL A;  3AVS A;  5EQU A;  3VL8 A;  1HLC A;  4Y5S A;  4YNI A;  4B4Q A;  1W6Q B;  4DXS A;  1RUC 1;  1RUF 1;  4AOC A;  2DCY A;  5CIS A;  1F5J A;  1RHI 3;  4JGY B;  1LGC A;  5BPX A;  4CEW A;  4E8C A;  3FHQ A;  4K6B A;  5JOX A;  1PZ9 A;  4H14 A;  1DG6 A;  5C70 A;  3BTY A;  1B35 A;  1YQC A;  2WL1 A;  3LPG A;  5CVR A;  2QFE A;  2YHJ A;  3VBO C;  1GZT A;  5A6Y A;  4R8H A;  5JI7 A;  3WCR A;  1MS1 A;  2AGS A;  3ETP A;  5F5Q A;  1GNY A;  1NCR C;  3RWK X;  5KXE A;  1U0A A;  1MR5 A;  1QH6 A;  2ARA A;  1IG3 A;  1TME 1;  1G7Y A;  4YZ4 A;  4BQX A;  5L7O C;  1HJG A;  1D2S A;  5ABJ B;  5LWB A;  3TN9 1;  3BN6 A;  3E97 A;  1FX5 A;  2ORZ A;  2WNO A;  3B69 A;  4YVW A;  3WY6 A;  3I3D A;  4Y33 A;  2CAU A;  3O0X A;  3MDP A;  5CG9 A;  1L3J A;  2KA3 A;  4KWJ A;  5FOJ B;  4GWJ A;  3POW A;  4S2G A;  3UK9 A;  2B7Y A;  1DYK A;  1Z0H A;  1QQP 3;  3M1H A;  5LB6 A;  1GZ9 A;  2UWA A;  3VKN A;  1UY4 A;  3D3A A;  1XXN A;  4V2V A;  3VLB B;  1LED A;  3J7M A;  1HB1 A;  5JUV A;  1PO1 2;  2B39 A;  1RUH 1;  5KHJ A;  2X5I B;  1LRH A;  1J84 A;  1NXM A;  2HBT A;  4JKM A;  4UYB A;  1PIV 2;  2PHU A;  3RZJ A;  3ZXJ A;  3GXU A;  1OOP A;  1UIJ A;  4MGS A;  3T4H B;  3WSO A;  1EV1 3;  5KXD A;  1NY7 1;  2BGP A;  5LY2 A;  2CWS A;  5FZG A;  3GZA A;  2SBA A;  3WNN A;  4UBG A;  5FY0 A;  2WAO A;  3WNO A;  2XVL A;  2PHT A;  2F6B A;  2R30 A;  4HON A;  1JYX A;  1OD3 A;  3PVE A;  2XON A;  3AXD A;  5T55 A;  4OQ8 A;  3VDA A;  5K0U B;  3J26 N;  4LHL A;  1RUI 3;  5LBC A;  3WW2 A;  3DKQ A;  3ZYJ B;  1VRH 3;  1H0B A;  3TYJ A;  2XWB B;  3HQU A;  4TLF A;  3K48 A;  4WV8 A;  2FMD A;  4LBQ A;  1WUV A;  2VNR A;  5DAX A;  1RB8 G;  3M4F A;  1TMF 1;  1FAT A;  4UXA A;  4NPL A;  1W6M B;  4HVO A;  4Q29 A;  3AVR A;  3KCY A;  4QHO A;  4XFB A;  2QQN A;  4B7K A;  4D0Q A;  4EN6 B;  2XGX A;  4CXW A;  4NRO A;  2BEO A;  1V6J A;  4BOW A;  1J59 A;  4LMF A;  1K5J A;  2VMC A;  2AYH A;  1R09 1;  1H2M A;  2V09 A;  2BUK A;  5JI9 A;  3Q8A A;  5DAP A;  3TNQ A;  1H6Y A;  4QB1 A;  4UW4 A;  5BNQ A;  3IKW A;  3VHO A;  3POJ A;  1V6L A;  1YNA A;  1F5F A;  1CAW B;  4NPR A;  1JU4 A;  4P14 A;  5C4W C;  1YXW A;  4IE4 A;  2EIC A;  1JN2 P;  3ACL A;  3POS A;  4GJZ A;  3T4V A;  2QQK A;  3NAP B;  4C1W A;  1HXS 2;  2XJV A;  4H3W A;  4RFR B;  4AXO A;  5BNN C;  4Y26 A;  3I97 A;  4NIA A;  4I2O A;  1Z78 A;  2ZMK A;  4HKO A;  4BHP A;  1YJL A;  2CWM A;  2IXC A;  2HBU A;  2RDQ A;  5GJ6 A;  3VBO A;  3WEZ A;  3PUI A;  1JYN A;  3MGU A;  1VP6 A;  3AKQ A;  3AYD A;  5EWS A;  1HB4 A;  1NCR A;  4BK5 A;  1XNK A;  1RHI 1;  4YGD A;  5CAD A;  4MXW A;  5GLV A;  4Q8K A;  3CZJ A;  5A32 B;  1OUS A;  4MSV A;  1OFN A;  3I3E A;  3TOJ A;  5FZI A;  1JUI A;  1OXC A;  3K75 B;  1CAV A;  3MIB A;  4BME A;  5L7O A;  3ZXG A;  3GYD A;  3ENR A;  3KD4 A;  5FPL A;  1N3P A;  2JJ6 A;  3U75 A;  4EN7 B;  2CGP A;  2BER A;  4P9L A;  3O1O A;  4CUC A;  2W1W A;  1W8Z A;  1PK6 B;  5LBE A;  1HX6 A;  4YZ2 A;  4PDW C;  1BK1 A;  5HV4 A;  3WHT A;  4R9B A;  2R06 2;  5CKQ A;  4CDW C;  1XRU A;  1W04 A;  4AW7 A;  5J98 B;  5T3N A;  2VCA A;  2FDK A;  4MGZ E;  2MHF A;  4XZU G;  1JZ3 A;  3GZT B;  4UFL A;  1H8T B;  4XF1 A;  2DCJ A;  4HG6 B;  1ZA4 A;  1OA4 A;  4BIO A;  2D7F A;  3E1F 1;  3NJZ A;  1GBG A;  4OVE A;  3UYJ A;  1AX0 A;  4WVM A;  1C1L A;  3RZK A;  3RZH A;  2PHX A;  2V4V A;  5JZG B;  1PO1 3;  5K4L A;  5I8Y A;  1ULP A;  4QKF A;  4RQP C;  1QQP 1;  3VKF C;  4RD7 A;  2Y6K A;  3VKL A;  3AMM A;  3F95 A;  1JZ8 A;  2WWJ A;  2WSU A;  1PIV 3;  3K46 A;  1BKZ A;  3K4D A;  4Y20 B;  1TEI A;  3LE0 A;  5DUX A;  2JEN A;  2YDE A;  2PLV 2;  3WW1 A;  1MVQ A;  4AFB A;  3HN3 A;  2YGM A;  2XUE A;  2JWP A;  2DDU A;  2J1S A;  4AF9 A;  3I3Q A;  1BVP 1;  2O14 A;  1XBF A;  5GZD A;  4CDQ B;  3OBZ A;  4IW3 A;  3KV5 A;  3ZPY A;  1Q8Q A;  4R4X A;  3M70 A;  2LUW A;  1COV 3;  4RR3 C;  4WM8 B;  2EXH A;  2OUH A;  2VOX A;  4NN0 A;  5D1I A;  1JH5 A;  2ZOE B;  2IXK A;  1LOE A;  2BP6 A;  2MPF A;  1UN1 A;  2C5D A;  1EV1 1;  4IV1 C;  5LAT A;  4CUB A;  3BI3 A;  2GAU A;  5FXZ A;  3H50 A;  4AHW A;  3AZZ A;  1VBB 2;  3S30 A;  2FBE A;  4JRL A;  5FY7 A;  4XDP A;  2X05 A;  3ZDS A;  1OVP A;  1RUI 1;  1DZQ A;  2EID A;  4LNV A;  1VRH 1;  5A1L A;  3V0A B;  2XQX A;  4PIX A;  1S2E A;  3UJO A;  3ATG A;  3PUR A;  3IMM A;  4IL7 A;  3WX5 A;  1FXZ A;  2VNO A;  3GGL A;  2HWF 2;  1F31 A;  3LAG A;  4Y3O A;  4V1P A;  2GNB A;  4NIG A;  2Y26 A;  5IK7 A;  4FCA A;  1O4Y A;  3B7M A;  4HVR A;  5C4W A;  1F9K A;  5BNN A;  1HXS 3;  3MIF A;  2BTV C;  2AAC A;  1C5I A;  3MLL A;  1H1M A;  1YLL A;  5CKM A;  1B09 A;  4KWK A;  1NE6 A;  4OUM A;  4D3W A;  5T5L A;  1W6N B;  2DYC A;  2ETE A;  4CCC A;  4Y1V A;  4YZ5 A;  1H6X A;  2P34 A;  4AAP A;  3B3Q E;  2HLE A;  5H9Q A;  1DZR A;  4ZU7 A;  2RS1 2;  5LA9 A;  3W5M A;  2E7T A;  1DQ1 A;  1WKY A;  1LHU A;  4XIL A;  4CDU A;  4P9X A;  5I8T A;  1OBN A;  1XQN A;  5FZ4 A;  2WS9 2;  3VD3 A;  2XXZ A;  1Y9Q A;  2DUQ A;  4XF3 A;  3VBF C;  2D6M A;  2ENR A;  2BU9 A;  2R06 3;  4PF5 A;  5F3G A;  4CDW A;  1GUI A;  5F3C A;  3S0M A;  4Q8L A;  5FZL A;  3VDD B;  3ZN6 A;  5IVB A;  2XBO 2;  1ZNP A;  5A7O A;  1ZRD A;  3KT1 A;  1L7L A;  1IQA A;  4GMP 3;  2ARX A;  3OD4 A;  2D40 A;  1ND2 C;  4IGO A;  5C6C A;  2W87 A;  4N8M A;  4YW6 A;  3S6P A;  4XQ4 A;  4XQW A;  2GMP A;  3AP7 A;  3ITQ A;  1LAJ A;  4EE2 A;  5BNP B;  2VCC A;  2NMN A;  3W20 A;  3DYO A;  1UO9 A;  4AGV A;  1ZRI A;  2PQQ A;  1X82 A;  5A1A A;  4HK8 A;  2HWE 2;  3BVC A;  3R4U A;  5A3L A;  3BU7 A;  1ZZB A;  5C3R A;  5GLU A;  5F8P A;  5IT6 A;  5AVP A;  2PLV 3;  5JXH A;  1HQN A;  2PHL A;  3CJI B;  2BWC A;  2GP3 A;  2Z2S B;  3NWK A;  4AWD A;  1PO1 1;  2A75 A;  4NWV A;  3ZOI A;  3BUC A;  1DQ4 A;  2W1S A;  2DTY A;  2J7M A;  1BBT 3;  1WLD A;  2VZT A;  2YMZ A;  2HKX A;  4RR3 A;  3TNP B;  4AI1 A;  4XDQ A;  4EWA A;  5I91 A;  4FOY A;  2BW8 A;  1XE0 A;  2DV9 A;  2QZ2 A;  4XMA A;  1H2L A;  3TEX A;  2ZHM A;  3ACH A;  4PJY A;  5L9R A;  4XJU A;  3SXW A;  4IV1 A;  4CE8 A;  4HFS A;  1MQT C;  1VBE 2;  1O3R A;  3ZYF A;  5IVJ A;  3P5B A;  5JSR A;  5J36 A;  2HEW F;  1LOC A;  3FZ3 A;  1HJF A;  1COV 1;  1VBB 3;  4LLF A;  3UKT A;  1JZ4 A;  4LBM A;  5KHK A;  4KG8 A;  5J37 A;  2GN3 A;  4LBK A;  4LKD A;  4GQ7 A;  4XFG A;  1NLS A;  4TTG A;  5EJZ B;  4R52 A;  2XKO A;  5A3U A;  1GV9 A;  1SZB A;  4ISQ A;  4RS5 C;  1ASJ 2;  1KIT A;  1WMF A;  3KZ4 C;  4A3X A;  3EO6 A;  2NYY A;  3NJX A;  1UD1 A;  2HWF 3;  3LZZ A;  5EXO A;  3ZKY A;  5BUV A;  5JWP A;  2XL9 A;  3AFK A;  2Q1F A;  1GQG A;  3VBS B;  1OLQ A;  1YQ8 A;  2GC0 A;  3IPV A;  1RUE 1;  4NAO A;  3PU8 A;  2X10 A;  4JQR A;  5FZ1 A;  3H8X A;  1YC6 1;  1PGL 2;  3LF7 A;  3FUO A;  1PVC 2;  2EXI A;  1GNH A;  1LNS A;  1NA1 B;  1VAL A;  5C3S A;  1YEW A;  4IE6 A;  5KHG A;  5A7W B;  1UOF A;  2VTF A;  4MLO A;  3RMX A;  4OHV A;  3H7Y A;  2VJX A;  2Z5W A;  2WFF 2;  4NR1 A;  2LW8 A;  5LA0 A;  1GP6 A;  5CG8 A;  1XC6 A;  4GKX A;  4BE3 A;  4JGZ C;  4XUR A;  1QGL A;  1W06 A;  4ZHN A;  3I2J A;  3RSJ A;  1HXS 1;  3FE5 A;  2RS1 3;  4UFH A;  4BQW A;  3CDZ B;  1FPN 2;  2ZGP A;  1AZD A;  4QHZ A;  5JDB A;  3DCQ A;  1ULE A;  3GNE A;  4A7K A;  1GZW A;  1R1A 1;  3KGZ A;  3KT7 A;  4LR4 A;  2ARC A;  2OX0 A;  5FBZ A;  3RS6 A;  2W9X A;  2YC0 A;  5IK8 A;  3C2U A;  4DOU A;  3VBF A;  4QMA A;  1BEV 3;  3ZFE B;  1LEN A;  3H3U A;  1OLR A;  4NMI A;  1NCQ C;  2RJK A;  2XBO 3;  1JZ2 A;  2WLQ A;  2CSG A;  2JIJ A;  3WQ1 A;  1ND3 C;  4Q27 A;  2ZZJ A;  2XJQ A;  4TXW A;  1SLT A;  1CN1 A;  2V5Y A;  1ULC A;  1PGS A;  3U14 A;  5IK4 A;  5KC5 A;  4M3C B;  3VKM A;  5FMB A;  4AZZ A;  3GHN A;  4M3C E;  2JDU A;  2ZMN A;  1YFW A;  2IXH A;  2R06 1;  3AYE A;  1S1A A;  3OF1 A;  1BJQ A;  4QXB A;  4J1X A;  3D5O A;  2Y0I A;  1E5S A;  3JUU A;  2HWE 3;  5LK5 A;  1HQL A;  4UI9 L;  2FDG A;  4GMP 1;  2G9Z A;  1CZS A;  4PT6 A;  2J1V A;  1KJL A;  2WO3 A;  4GKY A;  4FBF A;  2QUO A;  4AVA A;  1BZW A;  5IFP A;  1S0F A;  3NV3 A;  5F32 A;  2WBK A;  5FY1 A;  4CDX C;  4LEJ A;  3WR0 A;  2DVA A;  5A33 B;  3K2O A;  1KDM A;  1YCI A;  4NAM A;  3OEB A;  2OZJ A;  1GWL A;  1MS4 A;  1Q5O A;  3NV2 A;  5JR7 B;  1N3O A;  3SHR A;  4BU2 A;  2VH9 A;  3DPR B;  3PDQ A;  1QF3 A;  3AKS A;  4LUM A;  4CCK A;  5AFB A;  5CEH A;  2HWC 2;  2PAK A;  3MI8 A;  2PLV 1;  3UNP A;  5FYY A;  1A6C A;  2E7Q A;  4CEW B;  4Z2A A;  4LO5 B;  4N53 C;  3DKW A;  1W39 A;  1QOS A;  3AMH A;  1MQT A;  4XFA A;  1VBE 3;  3MZH A;  1OLM A;  5HCH A;  4MV2 A;  1QXP A;  2CY6 A;  2XKP A;  1PZ7 A;  4OI1 A;  1GIC A;  1BBT 1;  1WZX A;  4XUQ A;  4DEQ A;  1A8M A;  3AZW A;  3H3Z A;  5DN2 A;  2A6W A;  3VGI A;  4EN0 A;  3D6E A;  3ZMN A;  1H4H A;  1I1E A;  4JC1 A;  3VZM A;  3E5Q A;  4IUG A;  3GZE A;  4RS5 A;  1ASJ 3;  5A7P A;  4MX3 A;  4XAE A;  4E2S A;  1O59 A;  3MF9 A;  5FXW A;  5GZG A;  3DF0 A;  4NVP A;  1CPN A;  1XE7 A;  2XLA A;  1VBB 1;  5E8A A;  3IAQ A;  1BCX A;  4XAC A;  1MEC 2;  2VTX A;  1POV 3;  1MZ5 A;  1PMJ X;  4HKW A;  3ILR A;  5K9Y A;  2VZR A;  3KHB A;  3THT A;  1PVC 3;  1WLW A;  4Q4V 2;  1HIX A;  1AYN 2;  1JYV A;  1RUN A;  4OI4 A;  2HWF 1;  2P6C A;  2Q0A A;  3UL2 A;  3D8C A;  5F3E A;  5IW0 A;  1UU6 A;  1SDW A;  2WSV A;  2Y6F A;  4JGZ A;  3ZM8 A;  2K46 A;  1BYH A;  1RUG 2;  5J48 A;  5FLH A;  3AMN A;  4JDM A;  3PVO A;  1FPN 3;  2BQP A;  1PX4 A;  4QQH A;  4PLM A;  4MOA A;  3AP4 A;  4QQO A;  3ZKU A;  1O4Z A;  1VMF A;  5DPN A;  2PAM A;  1NQD A;  4XUN A;  2QQO A;  5JPM B;  1QU0 A;  5JXG A;  2WJS A;  1OOP B;  2BGC A;  4O65 A;  4HAN A;  1DGR N;  4N9I A;  4FQ4 A;  1NG0 A;  3O7O A;  1U5X A;  1NCQ A;  5F5I A;  4QPI C;  4KL1 A;  5GLT A;  2X09 A;  5GAL A;  2W94 A;  2Q30 A;  3WLU A;  2VOW A;  3SQO A;  1ND3 A;  2JDY A;  2WZR 2;  5FZC A;  1W9F A;  3RYR A;  2Z69 A;  5EFU A;  1PX3 A;  4WM7 C;  1BLZ A;  4TN7 A;  1BEV 1;  5H9P A;  1C8M 2;  1LOG A;  1PGW 2;  2GN7 A;  5FY8 A;  2Y60 A;  2VBD A;  1S2B A;  2XBO 1;  1Q43 A;  3APB A;  1SAC A;  4KG0 A;  2JE8 A;  3NST A;  2PFW A;  4PLO A;  4Y5T A;  1Y7B A;  5DXD A;  1QNY A;  1D0G A;  4DY3 A;  3D82 A;  3VBR C;  2NQY A;  5FKC A;  3ZXK A;  2UU8 A;  4LHK A;  5HPO A;  4LKF A;  2QQP A;  1F15 A;  4FPJ A;  4CDX A;  2ARE A;  1F8V A;  3BTX A;  1X50 A;  5FPV A;  3RPQ A;  3I2G A;  1SLL A;  1EY2 A;  3AZV A;  4XBN A;  1W99 A;  3III A;  5TSW A;  2BYV E;  4QM8 A;  2IUW A;  2HWE 1;  4QXC A;  4F83 A;  4NPM A;  3SLI A;  1NYW A;  2TNF A;  3AKT A;  4HET A;  2WYS A;  2HWC 3;  1U5Y A;  2MEV 2;  1JOJ A;  1IZ3 A;  4RA0 A;  4QX5 A;  5LY1 A;  3VBH B;  2IXJ A;  3ZXF A;  2FZ1 A;  2ZZQ A;  3AP5 A;  3USS A;  4XUO A;  4NIH A;  1ZRR A;  2AR6 A;  1W9Y A;  3ZXE A;  5ISL A;  4CCJ A;  3RGB A;  2YC2 A;  3EB7 A;  4QXK A;  4OFG A;  3VBO B;  3GBW A;  3GCW A;  2J1E A;  3PLQ A;  1POV 0;  4OLL A;  1NCR B;  5CZK A;  4CCO A;  4I3G A;  4N43 B;  1Y3T A;  2C6S A;  4KQ7 A;  4DXR A;  1BMV 2;  5T54 A;  4M00 A;  1E57 A;  3AM2 A;  4MXW B;  4OQ9 A;  2C1F A;  3VZO A;  1VBE 1;  2ZGL A;  4MYE A;  5CFC A;  4Z92 B;  2C9A A;  3AXE A;  5L7O B;  3PMS A;  1CAV B;  1S0G A;  4QDQ A;  4G4F A;  5A7Q A;  1SFP A;  1EYB A;  3WG3 A;  4LBO A;  4AVB A;  4HL0 A;  3RFR A;  1PZ8 A;  1MEC 3;  3WF4 A;  1OH3 A;  2GC2 A;  3THP A;  3GJB A;  4CCD A;  1C5H A;  1E5R A;  3QBQ A;  2B9U A;  3PUH A;  4GUL A;  3M8L A;  3AYC A;  1ENX A;  3EBR A;  1GSL A;  1OD5 A;  4Q4V 3;  1JYC A;  4YLZ A;  5A7N A;  5K8S A;  1AYN 3;  4JCK A;  1ASJ 1;  4AFM A;  1M4W A;  1UZV A;  1J83 A;  1J1T A;  4COV A;  1I5P A;  1YYN A;  3B9I A;  5BXX A;  2GNM A;  1WWY A;  1POV 1;  4W6X A;  4CZS A;  3DEC A;  3FBY A;  3LEM A;  5A80 A;  5BV6 A;  1TNR A;  4WVM B;  1KFU L;  5JXI A;  1OF3 A;  3ES1 A;  4P9J A;  2ZX1 A;  1WCK A;  1KEX A;  1RYY A;  1YHF A;  2UWC A;  4H55 A;  5E1R A;  1S0B A;  1W0P A;  2D3S A;  2DCT A;  2YBP A;  2E63 A;  4QGN A;  1WMX A;  2BDR A;  2W95 A;  3CLP A;  4S2F A;  5LEK A;  3LD8 A;  1OFS A;  4XJ9 A;  2JG8 B;  5A70 A;  3ZSJ A;  2W46 A;  4S2D A;  4QPI A;  5DAV A;  5FFO C;  3ZSM A;  3V56 A;  1A3K A;  1CD3 G;  4RGG A;  2WZR 3;  4DO0 A;  4L2N A;  4WM7 A;  2R7E B;  4FVV A;  2VQT A;  3N7K A;  1QNW A;  4LBJ A;  4LLO A;  4YG3 A;  5T5O A;  4S2H A;  1C8M 3;  2R16 A;  4CP9 A;  4YPJ A;  4CCM A;  4XHX A;  4Y5Z 0;  4F8A A;  2VGD A;  1L7Q A;  1CZV A;  1OVS A;  2JG9 B;  2Z42 A;  5FZH A;  4KGG A;  2JD9 A;  2OYZ A;  2ZHN A;  1UYZ A;  3QD6 A;  3I49 A;  4XAB A;  3MLJ A;  3KQR A;  1XYO A;  1JXN A;  4NHM A;  3H3L A;  3VHP A;  4YGB A;  1IPJ A;  3J7H A;  4HBN A;  3H9A A;  3RJ2 X;  5A3T A;  1C4R A;  3M3Q A;  2A3X A;  1DQ6 A;  3VBU C;  1OHF A;  2I45 A;  4CU8 A;  3S5Q A;  1DZT A;  3CF6 E;  2WNE A;  5D21 A;  2XML A;  2EAA A;  4QQP A;  2WNV B;  1OMI A;  3LA3 A;  1RUJ 2;  4KNC A;  4QGM A;  3THC A;  3O1T A;  2RR1 2;  2AUY A;  3M7A A;  4UW3 A;  3KV9 A;  3TAY A;  2W1U A;  2Q8O A;  4BCU A;  4LBQ D;  2MEV 3;  5C4W B;  5C71 A;  1JW6 A;  5B4N A;  3WHU A;  4GB3 3;  1CIY A;  1ULD A;  4O61 A;  5FP7 A;  3I2O A;  3HBZ A;  5FWJ A;  2ZGT A;  4XCB A;  3M3C A;  4OMC A;  2EVX A;  3GBG A;  3OGS A;  1HDK A;  3OOX A;  3LIH A;  2NMO A;  4JZR A;  3WQB A;  1DBN A;  4A45 A;  2OKX A;  2J1A A;  4AHX A;  4K3U A;  4DEV A;  1FV3 A;  4L92 A;  3LGR A;  3PTY A;  2DFC A;  3MO4 A;  5FO9 B;  2A73 B;  2Y6G A;  3E6C C;  1GNZ A;  4IDZ A;  3ZPO A;  3ABZ A;  4J25 A;  4MET A;  1SQ4 A;  2CV6 A;  1O6U A;  4K8F A;  2R1B A;  1QXR A;  1CAX B;  1G9F A;  1I9R A;  1S0E A;  2ZEW A;  3ECQ A;  5E16 A;  3AP9 A;  5J7M A;  4PDW B;  2V5D A;  5FZ9 A;  3WNP A;  1O7F A;  4GIQ A;  5C9A C;  1FMD 2;  1JTZ X;  4JV4 A;  4CDW B;  2ZEY A;  4MGK E;  2XDV A;  1RL3 A;  1AXK A;  2WZE A;  5LRS A;  3LOI A;  4HSJ A;  1X36 A;  1MAC A;  1MEC 1;  2R0F A;  1QEX A;  3NNM A;  4Z2W A;  4EYU A;  3I59 A;  1REE A;  3WDX A;  4JVA A;  1SBD A;  1TNF A;  2W2I A;  4KMQ A;  1H8V A;  2P37 A;  2A6Y A;  4RN5 A;  1GOH A;  4Q4W 2;  3UJQ A;  2BVV A;  2JD4 A;  3O14 A;  3USU A;  2AC1 A;  1K3I A;  1Y4W A;  4RQP B;  3Q8C A;  1UCX A;  3I2K A;  1DU3 D;  1W9W A;  2J42 A;  1XNB A;  4HXC A;  5FRE A;  2WO2 A;  5F7U A;  4QQL A;  2V73 A;  4C91 A;  1WGP A;  5F1R A;  1WW7 A;  3OY8 A;  4YW1 A;  4BA6 A;  4E4S A;  2P3I A;  2GNT A;  2GSY A;  1XNA A;  5JPN B;  3OPZ A;  5JSP A;  4AED C;  1KS4 A;  2C0Z A;  1VBA 2;  2ZBJ A;  5JOY A;  1XNT A;  4Y22 A;  4UF0 A;  5KWR A;  4EZ4 A;  1GR3 A;  3WNL A;  2D6L X;  3AP6 A;  4CRQ A;  4DY5 A;  2YYO A;  4RR3 B;  2ZGR A;  4AEM A;  5GZC A;  1W3X A;  5EPA A;  3LB9 A;  1PM4 A;  3OGG A;  2FMY A;  3EXU A;  3I2H A;  5G05 L;  3TWI A;  1W0O A;  1LGN A;  2RS3 2;  4YW4 A;  4IV1 B;  1UZ0 A;  4C8D A;  4FPL A;  4NID A;  5A3N A;  1Q8P A;  3OBA A;  4UT5 A;  1ZX5 A;  4XFF A;  4JKK A;  3HNY M;  2WZR 1;  1K5M A;  1SCR A;  4XYX A;  2B45 X;  1OUX A;  4W50 A;  4YM1 A;  4FFG A;  5DDJ 2;  1W6P A;  3IDA A;  4B7E A;  4O7X A;  4DRV A;  3FFZ A;  2VCM A;  2OPW A;  4W65 A;  3OUH A;  1Q3E A;  2W3J A;  3BIW E;  1RUJ 3;  4XXA A;  2TEP A;  3CQO A;  2RR1 3;  4FAG A;  4YW5 A;  3VV1 A;  1I6X A;  5EHD A;  4RYD A;  5L19 A;  4UAP A;  3ORJ A;  3IPV B;  3BPZ A;  1VBD 2;  4IEZ A;  4OHY A;  1Q56 A;  4ATF A;  4UOJ A;  2KD7 A;  3SEP A;  1QJZ A;  4DB5 A;  5L73 A;  5I0S A;  3R4D B;  1IPK A;  2VAU A;  4YFZ A;  3OYW B;  4NRM A;  3AFG A;  2NN8 A;  3U11 A;  1WBF A;  2GME A;  1AX2 A;  4D7S A;  3WD5 A;  5C5U A;  1UY2 A;  2MEV 1;  3BYW A;  4YVS C;  4BPZ A;  3DXT A;  3RDI A;  2VXJ A;  4DMI A;  4GB3 1;  2VUD A;  3EYP A;  3O0W A;  4B1M A;  5KC6 A;  1O5L A;  1LOA A;  2VOV A;  3FLP A;  2X53 S;  1SBE A; 
#chains in the Genus database with same CATH homology
 1JYT A;  1JOD A;  1ZRI A;  1F35 A;  1JOB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...