1JODA

Crystal structure of murine olfactory marker protein in spacegroup p43212
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
160
structure length
160
Chain Sequence
b'DGPQKQQLEMPLVLDQDLTQQMRLRVESLKQRGEKKQDGEKLIRPAESVYRLDFIQQQKLQFDHWNVVLDKPGKVTITGTSQNWTPDLTNLMTRQLLDPAAIFWRKEDSDAMDWNEADALEFGERLSDLAKIRKVMYFLITFGEGVEPANLKASVVFNQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Olfactory Marker Protein
publication title The crystal structure of the olfactory marker protein at 2.3 A resolution.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 29
structure length 160
sequence length 160
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06554 Olfactory_mark Olfactory marker protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.390 Mainly Beta Sandwich Jelly Rolls Olfactory marker 1jodA00
1JODA 1JYTA 1JOBA 1ZRIA 1F35A
chains in the Genus database with same CATH superfamily
4CCLA 3AZWA 2VBBA 5LK5A 4LBOA 3ZFFC 1SFPA 1SBFA 2OZJA 2X5IC 2WR9A 1J59A 1US3A 4WVZA 2HWD1 3O1VA 2FDJA 3O1OA 2RS11 1V9U2 5CKQA 2W94A 4KWJA 1LCLA 5FK7A 3VBHA 1GZCA 3HN1A 3IKWA 4K40A 3UT0A 1HXS3 1UW8A 3ZYGA 2ID4A 5BNPC 2DYCA 4ASKA 4FBFA 4LMFA 4ARYA 5A1LA 2OKXA 2ET7A 4M3CB 2VMDA 3ZFEA 1QJY1 2ZHLA 4XCBA 5AC91 2LUWA 1HJGA 2IUWA 3HNBM 1TNRA 4GKXA 4QX3A 3PMSA 4N53B 5D8AA 4LE4A 4HBNA 5CFCC 2A6YA 5FCCA 4NHLA 4AQTA 1CX4A 1QQP1 1T6BX 1KJLA 4CCCA 2A70A 1LULA 4IEOA 5FY1A 5H9SA 4XFCA 1G9DA 1LB2A 3MGUA 3C7FA 3WG4A 2NMOA 4QPIC 2ZAAA 5DN2A 3IIAA 3K4DA 1SACA 2D6MA 2ZX0A 1QKQA 4QGMA 3PJQA 2R7EB 2VC9A 3PVOA 1SZBA 2CDPA 2Y38A 5B4NA 3UNPA 1LHWA 3CJIB 2JE9A 3K51A 4RGGA 1CAXB 4DUVA 2OQ6A 1OLQA 1Q5OA 2AREA 2R072 4XDQA 1KRIA 2D43A 4JAAA 3AP7A 3ZYFA 3W59A 2QUOA 4WVWA 1YUDA 4YNIA 2HLEA 1GYKA 1EPWA 2VCMA 3CO2A 3N9NA 1QNWA 4AK3A 5ACA1 1AL22 3I2GA 3RZMA 1SDDB 4GJZA 1FOD3 4COVA 3VD9A 1QDCA 1W6PA 5C8CA 4ATFA 4YZ2A 5LWBA 4PBPA 3ZOIA 3SCGA 1QXJA 4MLOA 3BPSA 2P37A 5EHDA 2E33A 2VUJA 1DYPA 3GM8A 4Y1VA 1OH4A 2W0XA 3CIHA 2YU2A 2XH6A 1RUJ3 3I2JA 3I2OA 4ATEA 1XYNA 1RUF1 4LA3A 1TMF2 4XF9A 1N3OA 4IESA 1GZ9A 3DEMA 2DWRA 4YG6A 4AE2A 1OF4A 5F9TA 2A3XA 5JWPA 4KU7A 3HT2A 2ZHMA 4NMIA 5KWRA 1PVC2 2D5HA 3GCWA 4FVVA 1JH5A 2DF7A 1RUI1 1RHI1 4RQPB 4ASLA 5FZAA 5I0DA 2RDNA 5TSWA 4AEJA 1T6GC 3RZJA 5CBLA 1DDLA 4R4ZA 4AZZA 4EWDA 1UY0A 3MLLA 2RMU1 4CDWA 4ASMB 2EF6A 1DG6A 2WT2A 5FZGA 3NO8A 1W2NA 4YZ3A 1Z7S1 5L19A 2Y26A 1UY2A 3ZYJB 4PDWB 5EJ1B 2PFWA 1C1FA 4M3CA 2QE3A 1K3IA 3SITA 4Z8BA 1BZWA 3IWZA 1YJLA 3UJOA 1PX3A 3TYJA 3NV4A 3WNKA 3N35A 4CRQA 2KD7A 5FPXA 2VZ1A 1EV13 5JXGA 1NAEA 1CZVA 1XYOA 2YPJA 3DPRB 4LUKA 4P02B 1F5JA 2ORZA 1VBE3 4NPLA 3S7EA 4HK8A 3ZXLA 1DGLA 3TEYA 1Q43A 2XUMA 4GXLA 4FXGB 3CJIA 4XOGA 1LENA 4LBQA 4XF3A 3ZPYA 3QLQA 5KC6A 1AXKA 1Z0HA 3K46A 5FMBA 3VBHC 1ZZBA 3QBQA 1B09A 5DZFA 1AXZA 5FZHA 4D6SA 2DTWA 3AVRA 1VRH3 1KDMA 2P3JA 5DXDA 4NAOA 3ZFEC 1WW5A 4BOWA 4D0QA 3WDYA 3CZUA 3B93A 5JPNB 3PL0A 1VBC1 3I2IA 3VL9A 1D2QA 4Z92B 5F3CA 1R082 3TNPB 3FL7A 3ZR6A 3O1SA 3PHMA 5JAXA 3NAPA 1OLRA 3K4ZA 4AEDA 2A6XA 3O1TA 5J3UA 1NX9A 5GZDA 2BDRA 1UIKA 4JQTA 4Q4V2 1MZ5A 2HYXA 5BXXA 2ZZQA 2LTNA 4Z07A 1LKNA 1NKGA 2D6LX 1XSQA 1PK6A 2VMHA 3E1F1 4GA9A 4QX5A 4SBVA 2X53S 5EZWA 4MH0E 2PELA 1IPJA 5F5AA 5B4XA 3BTYA 3RI8A 3IBMA 2CV6A 3G7DA 1AR63 1PMJX 4DXRA 3BYWA 3JU9A 2MEV1 1OH3A 4IEYA 4L92A 5T50A 3DN7A 4XVHA 3ZYHA 4C0HA 4EZHA 4DUWA 1ZYBA 1OD5A 2Y6HA 5FBZA 1O3RA 2XJRA 2CY6A 1FT9A 2F17A 4LORA 2EXIA 4XACA 5A7PA 3AZXA 5C8CC 1ZZ7A 1GQGA 5FDBA 1XB9A 1R1ZA 3VBOA 2UYAA 3HMYA 2ZGOA 5JXHA 4AYUA 5GM0A 5C70A 1D4M1 3POJA 2ZAHA 5A6YA 4LXLA 3ZM8A 3BU7A 3OBTA 1VBB1 2W92A 3BOWA 4MGZE 3LZZA 3R6SA 4ARXA 4MGSA 1WBLA 2JDPA 4LBNA 1O8PA 2GH2A 2VQ0A 4PLMA 4I01A 4CU9A 5LEKA 3CNAA 3D0JA 1BJQA 4CXWA 4LQRA 4M0NA 5C3QA 2BU9A 2HBTA 2WAAA 3MF6A 4Z2WA 3W21A 5JMCA 3OG2A 5LY1A 3RRDA 4JKKA 3HD8B 2DTYA 3WW4A 2XLGA 3GJBA 1Q8VA 1Y7BA 1K5JA 5EJ3A 4DEQA 4LBQD 2Z4FA 3NSTA 2BOIA 3NV3A 5DUXA 1UY1A 1JMUB 1Q3EA 2A71A 4GD4A 1F31A 3N9OA 1UYZA 1CONA 4ZU5A 5FIXA 3ZR5A 5FKBA 2HWB1 4ZONA 4CDQA 4Q8KA 4CDWC 3UKNA 3WDXA 4JHTA 4NPMA 3AJZA 5SV8A 5HV0A 2B7YA 2LW8A 1HDKA 1UPIA 1PIV3 3IAPA 1XU1A 1WGPA 3LFMA 1DYKA 3THPA 3RJRA 1QOSA 1LU1A 4P14A 5J48A 4KWUA 4K1ZA 2AEYA 2Q1MA 5A7OA 3EO6A 3V0AB 1OLME 3WY6A 5C33A 4BQ4A 2PHWA 5IK7A 5F3GA 5KHIA 5KHJA 3OB8A 2DVGA 2FZ2A 4N7UA 3S57A 3ECQA 1S2KA 3NQHA 4X8PA 3ST7A 2WO3A 2B4KA 2DCZA 4QQPA 3CJIC 2OZ6A 3OGSA 4OHVA 5L9VA 4YW3A 3WR0A 4EYUA 4UFJA 2WYSA 1C3HA 1SLLA 4IEXA 1BK1A 5F2SA 3B3QE 1VIWB 1KFXL 4JGYB 2PLV2 4B8EA 2BUKA 5LA2A 1WCQA 3LDKA 3A0NA 1RUG1 2D6OX 4YGBA 3W58A 1U5XA 3FFZA 4AVCA 5C7GA 1CESA 4QWNA 1HRI3 2ADEA 2X8KA 2RS31 4IEUA 4LE3A 5LBBA 3VZLA 1UPSA 4KG8A 1DZTA 1VE0A 2XJPA 3PU8A 4KMQA 4OQ9A 2PTMA 1LNSA 1HV0A 1V6JA 3HNMA 4AAXA 2BP6A 2ARAA 3NAPC 4AEDC 5JUVA 2ZBJA 4G3YC 4JKLA 1N1SA 1LOBA 5F37A 2VY0A 4B4QA 5FMOL 1Q8OA 2WZ8A 1ZBA1 4CU7A 3PUHA 1UQXA 4KNCA 5GLZA 5HXVA 5CG8A 4HSLA 2ARCA 1FI2A 2XVKA 3MUZ1 1BKZA 1ALYA 1PK6C 2AGSA 2LS6A 3JBG3 3LQCA 4IV1B 4R4XA 4WVVA 1LECA 2ZMNA 3WINE 1YEWA 2CL2A 3MICA 4DZGA 2VH9A 5A6XA 2ARBA 3H1WA 2VR4A 1C5HA 4RQPC 3GZAA 2RM22 3CDZB 4LHKA 2O1QA 4RS5A 4DMIA 3Q8CA 4IEPA 1ZA4A 3OD4A 4UFIA 3I3MA 1JI6A 2WDBA 4S2DA 2PLV3 2GDFA 4FPGA 4QX2A 2V4VA 1V6NA 1DHKB 3CZJA 3ENRA 4MADA 5EFUA 1AL0G 1X36A 3VBOC 4BISA 3BUCA 4UAPA 1YYNA 2VQUA 3CHXA 1UD1A 2TEPA 1MS5A 1OVSA 1C8M3 1DCSA 2XLAA 3EHKA 5IK8A 1LAJA 1J3QA 3WW3A 1XNKA 2BEOA 3SH5A 4COYA 2BNOA 4LKFA 1GP6A 3V0AA 2A6ZA 3M4FA 2ZHKA 3Q9OA 2J1TA 2JENA 3J8F2 2GMPA 5FO8B 2WWSA 1AR91 3OBZA 4Q4W1 1COV2 1W04A 4RA0A 3ZXAC 4EWAA 5JCTA 3HBKA 4Y4YA 2SLIA 1GV9A 2Y6KA 3T08A 1W8ZA 5IVVA 4HONA 5CFDB 1MACA 3CLPA 2ZXQA 2ZKLA 2OUJA 1CVNA 2HWD3 4QX1A 1QY4A 1JHNA 4MGKE 2HEWF 2JX9A 4ZPIA 1CIWA 5FPBA 2J1UA 2RM23 1QNYA 1S0IA 4FI9A 2XJSA 1Y3TA 3WF3A 4JGYA 4AWDA 4IQPA 4DINB 2ENRA 3DKWA 4AXOA 1UWWA 3P1IA 1W6MA 4QQOA 5JI7A 2VOKA 4YPJA 3VHRA 4GULA 1A8DA 2VW0A 3AP5A 2D6NA 2XHNA 5D21A 3N9MA 5HCBA 2C4XA 2D6KA 1BBT1 4DY5A 5C9AA 2VZUA 4D7SA 4RFT0 2DCJA 2VECA 5I8SA 4QKNA 3T0DA 1F35A 1HW5A 3OGGA 3AFGA 4XAAA 1GANA 1W0NA 1O8SA 3J7HA 4FQZA 2Y8KA 3AYAA 3ON7A 2I07B 4PF5A 2JKXA 4IV1A 5A7WB 2Q4SA 5T54A 4AHXA 3SH4A 4MXVA 1FOD1 2Z42A 5ACA3 2Q8OA 4PI2A 4QX8A 1CJDA 2RJ2A 4UFLA 1STMA 1V6KA 2BNMA 5FV3A 1W0PA 2FCVA 4QM8A 4XABA 1NCQA 4XMIA 3GYDA 2QQKA 3TN91 1ZNPA 1OXCA 1AYN2 1UAIA 1RUJ1 5DUUA 2XL7A 3PUSA 2XUEA 4EV0A 1LRHA 2HWE2 2W08A 3USUA 2PHDA 2WO1A 4CCJA 1ULPA 1NY71 3K77A 1W9FA 4RGAA 1RUF3 1AJOA 1VB2A 1H8TB 5EWSA 5A70A 5ABJB 5FKCA 4A41A 1MQTB 4KL1A 5F8PA 4IV3B 4CU6A 3POFA 4KH9A 1LODA 4LKDA 2C24A 3VBUB 1DZQA 1JOJA 1LR5A 1O3QA 3KVBA 3VDDB 4JHZA 1TME2 1S2EA 2ATFA 2JIGA 2QFEA 2YXSA 2YG0A 4DFSA 2Q30A 2JWPA 1ZA7A 3CL1A 1RUI3 1RHI3 1H1MA 2X10A 2ZGQA 5FLJA 5CFDA 2VVEA 4GWNA 5F7UA 4C8DA 1AR83 2YBPA 2YGMA 3WG3A 5KBFA 2FDIA 2ZX3A 2P4EA 4BIFA 5DAVA 4O9EA 1OFNA 4FPYA 2WRAA 5FRAA 3KV9A 2RMU3 3WUDA 3ZXFA 3S0MA 2C26A 4MGQA 1M06G 3L9JT 2W1SA 1Z7S3 3EMRA 3NV2A 4Y20B 2JG8B 1H0BA 4XAEA 1E5SA 3U10A 5FY0A 2E51A 4XF0A 3LIHA 4OUEA 1EY2A 2V72A 4EN8B 3OEAA 3MBWA 3P3NA 2IFWA 5F5IA 1W8WA 3ILRA 3PTRB 2BGOA 3SXWA 4UBHA 2B8MA 2DBNA 3I49A 2RDRA 2CYFA 5CVRA 2ZEXA 3H1YA 5J36A 2B46X 4ZY9A 1PVC1 1H8VA 1NXD1 3H1MA 4Y1UA 1GOFA 4JKMA 1TNFA 3NJVA 1GUIA 4CXYA 1RMU2 3KV5A 4NHXA 2WSVA 4FP3A 1U12A 1WMDA 4HXCA 2P34A 4IDZA 4XJ9A 4QB2A 2VVFA 2MHFA 2PMWB 1IQDC 2YC2A 4FPOB 5IVEA 2D3PA 4FO9A 3C7OA 3QOPA 3DCQA 4ITCA 1SPPA 5FFOC 4JGYC 3ZX7A 3T0AA 3ZLIA 3MLJA 4QB6A 1H2MA 1YFWA 3POGA 4YM2A 5HCHA 4KWLA 5FO9B 1OHFA 3D4KA 4N8MA 1EPZA 4MXWB 5JSPA 3KCYA 3IMMA 3SMHA 3KCXA 4MHRA 1OOPB 1GFF2 1VBC3 4P08A 4D7TA 3LFIA 2JIJA 2FDKA 4BLIA 4S2FA 4WBBA 1ZREA 3I4IA 3KCCA 2YB7A 4DY3A 1H8TA 3EXUA 3WXPA 4CXXA 5ABJA 2VBDA 1MQTA 1RUE2 1LGCA 2GNMA 4IV3A 4Q0SA 4CCNA 2AEZA 5LASA 3BTZA 5FUNA 3VDDA 1XRUA 1L7RA 2HBUA 1KEXA 3KGLA 2BV4A 4IV1C 1LHOA 3KB5A 4JX0A 2YROA 2MEV3 4ZHNA 3MZHA 4XURA 3GXUA 3T1LA 1PM7A 3LF7A 4KWKA 3U11A 2LALA 4TYSA 1V00A 4U36A 5IUQA 4ZKTB 3I54A 5GZCA 1XNTA 5DAXA 2O0OA 4GB32 3WG1A 2Y0IA 2EAKA 1QJU2 4Q0QA 1BCXA 4BXFA 3MIHA 5E1RA 3ZO0B 4CDXA 4YW5A 1K5MB 3HNYM 3FHQA 3ZKYA 1NCQC 4H55A 4JGZA 3PUIA 4IE0A 5JVVA 3L2HA 5FZ3A 2P6CA 1D4M3 2Y6FA 5HPOA 1R081 4LHLA 3T1MA 5FYUA 3MHZA 3OCPA 2CGPA 4ZU7A 3UGFA 3H8OA 1XNCA 4B4PA 4Q4V1 1LHNA 3V56A 4Y1YA 4Q0UA 3B5LB 1I9RA 1O7FA 3AXEA 3ZFFA 5FPLA 1JYTA 4HETA 4UW3A 4HN0A 3WNLA 2RR12 1DIWA 1CAWB 2ZPXA 3V65A 4AFMA 3C7EA 2CHHA 1ULFA 1JZ2A 1SLIA 1NA1B 2WN2A 5CFDC 1XE8A 2Q8EA 1UOGA 4CDUA 3IDAA 4XJAA 4RFRB 1BHGA 5FYHA 1NE4A 5A3OA 4C0BA 5JLVA 4YARA 4LLOA 2VM9A 1W3XA 5FZCA 1OURA 1VBD3 1MS4A 3N7LA 1ZRRA 4CP9B 4NOTA 5FY8A 3T2TA 2DV9A 2HWF2 1PHMA 4I09A 4MXWA 3WT3A 4ZXEA 5LW9A 1JZ7A 1QMJA 4WM7B 1PM4A 2WA3A 1OOPA 4AQSA 3VLBB 4DO0A 1NZIA 1ZZ6A 3F2ZA 3O1RA 5JOZA 3NJZA 2GP3A 2CTVA 4TLGA 1LTEA 1SBEA 1V0AA 5C3OA 3VN4A 3VKMA 3VBRB 2DDUA 5K7PA 1L7QA 4E2QA 2BFUL 2V4AA 4EE2A 2VULA 3WLUA 1E5RA 2VTXJ 3AK0A 2A75A 5DG2A 5L73A 4IEZA 4XPVA 5JPMB 4WV8A 3ZSLA 1YC61 1YLLA 4YW6A 4XHBA 4JTOA 4A7KA 3TAYA 1GMMA 2PHXA 1RUG3 3NJXA 2ES3A 4QX7A 1DQ0A 3SH3A 2WLPA 3RPQA 3VGIA 2Q8DA 2C0ZA 1PGW2 1K5MA 2RS33 1IHMA 2JB4A 1JZ5A 1GSLA 2MNGA 4FFHA 4UBGA 5EPAA 1RUOA 2QNKA 2OW4A 1OFSA 1H6XA 1PNGA 2HWF3 3O12A 3SHRA 1OKQA 1MS8A 1JUIA 2ZGKA 4QMAA 3M2MA 4W6XA 3BIWE 3M3OA 3U4XA 1WCKA 3RZLA 4DQAA 5JXJA 2JD4A 4QXCA 4FAGA 2RDQA 3H8RA 4GIQA 1H8TC 3FBMA 5ABJC 3AMMA 1ZBA3 4AQ6A 1MQTC 5FUIA 3I97A 4IV3C 4FTBA 3PIJA 3R05A 3TN93 1J58A 4CP0A 5GALA 4H7LA 3M70A 3VDDC 3PNAA 1CAWA 3LEGA 5A3WA 1A6CA 4RN5A 1GZWB 3VDCA 2ZGTA 4Q0PA 2ZA9A 1NA1A 3BOPA 3OGJA 2PLV1 2J22A 3AL5A 1UYXA 4AI0A 4QD2A 1H6YA 2XG3A 1GWKA 4YGEA 3WNPA 3GDBA 5FY9A 4CEWB 2AC1A 5EIYB 1C28A 3ROUA 4EN9B 1GR3A 3AZYA 3DV8A 3POSA 5JIAA 1I1EA 2AR6A 2QQUA 4GMP0 2QBXA 1ZVFA 5DDJ3 4CP9A 1XE7A 2AYHA 2BZDA 2VZSA 3C3VA 4FOWA 5A3PA 2RJLA 3V0BA 1E5HA 2L9LA 3WP4A 3WP3A 2N7GA 4OI2A 3KT7A 3RZHA 4Y1ZA 3POBA 1AR93 4Q4W3 5DZEA 3VBRA 3U07A 1U5IA 5B2GB 1ULEA 1EYBA 4D8MA 2ETEA 1B35A 1C8NA 4JDOA 1W6NA 3PUAA 2RM21 5KC5A 4HK9A 5FXVA 4TWTA 2WFF3 2DVBA 3KQ4B 4NUBA 2EXKA 1OA4A 4A7YA 2VCAA 4FPKA 4CDUC 1GNYA 3S7IA 3U4SA 5FPVA 5IVJA 3WP5A 2Q0AA 4K8FA 1AUYA 5FZBA 5CIRA 1UN1A 4XJ8A 2Y60A 1JZ6A 2RE9A 2VL4A 2I2SA 3JUUA 4Y33A 4A7ZA 4NIDA 4P9XA 4OHYA 2ZABA 1QDOA 3X29B 4MHUA 4P5HA 1OOPC 2IXLA 4RL7A 4W6YA 2PHRA 1BBT3 4ET7A 3GZEA 3J8F1 5LRRA 3PURA 1BXHA 5JZGA 4XFGA 5A3NA 1NE6A 2IVJA 3O1PA 2NZ9A 4DXTA 5FXZA 4OZOA 2HH9A 4QGLA 1XC6A 1FMD2 1VB4A 3QACA 4XDOA 3A21A 3VBFB 3AYCA 2C6SA 1V9U3 2EA7A 2D5FA 1K42A 4GWJA 4NWWA 5K8SA 1XSRA 4XILA 5F1RA 2XMLA 3CBNA 1ENXA 3PJYA 3B00A 4QPWA 5FZEA 4CA9A 5I0RA 4KG0A 4QGNA 1RJ7A 1PZ7A 3I3EA 4OHZA 1PVXA 3ZIWA 4PQQA 1AXYA 3ES4A 1UZ0A 4LR4A 5FP4A 2RG4A 2DUOA 3AVSA 4AVAA 1WW6A 1O4YA 2ZOEB 3OY8B 1K5MC 1PO12 1UOFA 1GP4A 1W8NA 3OUJA 1TZOA 4JRLA 4F7ZA 4UFHA 2GNBA 1FNYA 3WQ7A 3KGZA 3MFCA 2UY8A 5SV5A 3VZOA 4AFBA 4ZZ8A 4PT6A 3MUY1 2QVSB 3HQRA 1OI6A 2GN7A 4CTEA 5CAZA 3J7NA 1NT0A 1SHWB 1Z78A 2GC1A 4U2AA 4E4DX 2LM3A 3TWIA 1OD3A 5KHKA 2R073 4GWMA 3K2OA 4YZ5A 3N9LA 4AGGA 2E26A 1POV1 1HRV2 1WBFA 1M4WA 3ZVXA 1WMEA 1URXA 3H3LA 1I6XA 1AR81 4G4FA 4OMCA 4E4SA 4GMP1 3IAQA 2OPKA 3VKFC 1AL23 4LOSA 1RYYA 1NA1C 3UETA 4FOQA 5IHRA 2CGOA 3JB8A 4EJRA 5C3SA 5KXEA 1CAVB 4Q29A 2G9ZA 4OHWA 5BUVA 2VCCA 5DAWA 5G04L 2DFCA 5DMYA 1AYN1 1N3PA 5FK8A 2W2IA 3VL8A 2HWE1 3TNQA 2XKPA 4N53A 2F6BA 2EXJA 3BODA 4HZFA 4AVBA 2ZCWA 2GALA 5LATA 2YPDA 4HN1A 4UW6A 1TMF3 3H8XA 4E8CA 3NKTA 1XE0A 3AMHA 4RSUA 2NLRA 1REFA 4WM7C 1RL3A 1V6MA 3IDEA 1NLSA 3HJRA 3U14A 3R4SA 1R1A2 1TME1 4Y5SA 1CAXA 3RQ0A 1FAYA 3W9AA 1PVC3 3VBRC 3AMQA 5HI0A 5FYYA 2WQZC 1VAMA 2Y6JA 1LJ7A 5DAPA 1DYOA 1B35C 2YFUA 4NRQA 4XXPA 3NJYA 1QJX2 3V64A 1YCIA 1BYHA 1YFYA 2ZX1A 3VBFA 2XR4A 1G9BA 2ORXA 5BY5A 1JU4A 1G9CA 4FCAA 3JQWA 3ZMOA 2XQRA 2IXHA 4H7MA 4HOOA 2Z79A 1BK0A 4TTGA 3B9IA 5A33B 1FNZA 5KHHA 3MW2A 4YSFA 1SCSA 4V1PA 3ZDSA 4BHPA 3LDRA 3H0OA 3KM5A 2OS2A 2AACA 4MYEA 3OY8A 4BQYA 2J1AA 3W5NA 4P00B 1DP0A 5JOXA 5F5QA 2R30A 3LA7A 2BBAA 4IW3A 3U0ZA 2WJSA 3WCSA 4XQDA 1AYM2 2C1FA 3R0RA 1NOVA 4HLTA 3RJ2X 2WT1A 3ABZA 4NRPA 4BH9A 3O5SA 2X05A 2WA4A 1RMU1 3ZFGB 4E2GA 5KXBA 1O4ZA 4RQPA 3AP4A 5F5CA 3QH6A 1ND2B 4XUNA 1WW4A 1OVPA 2QJVA 1ZBE2 4YLZA 4CEYB 2K2SA 1FPN2 5LA1A 1AVBA 3WF0A 4G9SB 4GJYA 2VO5A 1BLZA 4QDRA 4CPBA 2PA7A 4LBKA 4IL7A 2JG9B 3OJBA 1N1YA 4FFIA 1F4HA 1ASJ2 3BVCA 2ZGPA 2QQVA 4YVSB 1JYCA 1VMJA 2A7AA 1HQWA 1A3KA 2C5DA 3AP6A 2PHTA 1XU2A 1Q8PA 3NWKA 4PDWA 2ZEWA 5FOBB 1OA3A 1LGNA 4CEWC 3KZ4C 1L7LA 2VNGA 1MPXA 4XBNA 1R083 1R64A 4UFMA 3AKTA 2WO2A 2AUYA 4LO4B 2OYZA 3S6PA 2WBKA 3DPRA 3R4DB 2DUPA 4E2SA 3LA2A 4Q4V3 4XJWA 1RUE1 2KM2A 5FWJA 4NR1A 5H9PA 1KD7A 4MX3A 3OPWA 2A5ZA 2Y34A 5FMCA 1PGSA 1S0CA 2PAMA 4HG6B 1SCRA 4BIOA 4BQ5A 4NHKA 5HV4A 5FZ0A 1EP0A 3AKQA 3J26N 3I3DA 5A7NA 4BQXA 3RMXA 1ZBE3 3OD0A 5IWFA 3THCA 5AVAA 3ZN5A 4GB31 1E5IA 3ME2A 1QJU1 2VW2A 3N9QA 5LCWL 4LBLA 1LHVA 1VBD1 4XQ4A 4CZSA 4XJZA 5E89A 2YUEA 4JZRA 4LJHA 4AFDA 5EXOA 1GQHA 4WM8B 1V6OA 4OCTA 3K4AA 2JJ6A 2E31A 4N53C 4ZS2A 4ZU4A 1ENQA 5CYYA 1IKQA 3RGBA 2WN3A 3O0VA 2FCUA 1J3RA 4CUCA 1LU2A 2PXJA 2FDHA 4JTNA 5K9YA 1KFUL 3MV11 2XJUA 5FYBA 3PVNA 3I2DA 1JYXA 2BVVA 3K3OA 1TG7A 3JD72 4MO3M 4LTAA 5FQ0B 3PUQA 1O59A 3HR9A 3L2YA 4N9HA 4K7JA 1DQ5A 2WNUB 3C7GA 2NMNA 1EAH2 3RYPA 1X9PA 3VBFC 1C1LA 2VJXA 4HL0A 1XYPA 4CEYA 4RR3B 3AX4A 3KWVA 3ZYBA 2QQNA 3WCRA 4B3NA 1H30A 4CPBD 4BK5A 2GMMA 3HOBA 4K6BA 2X29A 3CEWA 3BCWA 3SQOA 1DLCA 1GICA 4YVSA 4KQ7A 4B4RA 2HWF1 1O5LA 4GALA 5CISA 5LK7B 3Q8BA 5FYSA 4NIGA 1CQ9A 2HJIA 2EIGA 3AKPA 5JR2A 2YBSA 2FBEA 1N1TA 4RD7A 3NNFA 4BXSV 1CN1A 1QH7A 3DL3A 3LE0A 3M1HA 2XDVA 1OPOA 5F3IA 1ULGA 3B94A 3ZPOA 2HEVF 2Y6LA 1WA4A 3BALA 2VNRA 2H6CA 2TUNA 4GAZA 4Q1RA 4S2GA 5E6HA 4ZS3A 4Q0VA 1NQDA 4YG0A 1XNAA 3PLQA 5I8TA 1IG0A 4XC9A 3AM2A 3DF0A 3OYWB 1OC1A 1RXFA 5L36A 4LA2A 4P9LA 4W65A 5IK5A 2JB8A 3C8XA 3NNMA 2CU5A 5FP3A 3IN9A 1O91A 1PO22 2DVFA 3AB0A 1NLRA 2RDSA 4XFBA 1HIXA 4DB5A 1GWLA 1UX6A 2IXJA 3IM0A 1PGW1 1S4CA 5DDJ1 1JZ8A 2ZTNA 1REDA 1UXZA 4BM8A 4Q8LA 4F3JA 4OQ8A 4PDWC 1RB8G 2LRPA 3WHUA 1PZ9A 1RGSA 1VLNA 4QX0A 4LO8A 1AX0A 2YU1A 5L9RA 4O7XA 1IQAA 2WZR2 3AYDA 2BNNA 2VG9A 5FYIA 1H4GA 1JS9A 2D44A 2PHUA 4X6QB 4NHMA 2FZ1A 5FY4A 5FR3A 5HBAA 3DPRC 3FJSA 3M7AA 3QD6A 4YFZA 5CU1A 1RUD2 3VD7A 5IYYA 3ZXEA 5BV6A 1TE1B 5AC92 3JZVA 1QJY2 3T2QA 4DRRA 5FZ8A 4NIIA 3VZMA 3ZXJA 4AI9A 1WCDJ 2W5FA 4FPHA 2WFF1 3M3CA 2Q5TA 1Y9QA 5FQ0A 2XJTA 4TZDA 2GAUA 2C9AA 4K21A 4BMEA 4CE8A 3Q8FA 1UOJA 3ORJA 1QQP2 4BQ1A 1JU3A 2VGDA 4QU1A 4XEZA 5D2AA 4M00A 4TSVA 4E8DA 4OLLA 1MVQA 4RR3A 2XGXA 1F9KA 3O14A 3H3ZA 2JDAA 4AOCA 3BPZA 5HCAA 1ENSA 4XE9A 1WUVA 1V6IA 1MS3A 1OUXA 2PHLA 4Y24A 4A42A 4CSWA 2H0BA 3PU3A 1X9TA 1XOYA 1ZRFA 1QJZA 1QOTA 5CZKA 3NW4A 1JODA 1YQ5A 3J8F3 5DG1A 4PIYA 2BQPA 3UGGA 4A3ZA 1COV3 1GBGA 3NNGA 3ACGA 1UU6A 2IFRA 2YDEA 4GKYA 4BQWA 5DQ0A 2WC2A 1CX1A 2YFZA 2OT7A 1V9U1 1UXXX 3B69A 3GJAA 3LEMA 3N36A 1HB2A 2Q8CA 3H8UA 1S0DA 3J9SA 2VOWA 2BRTA 1W3VA 3OYWA 3RG0A 1J84A 1W05A 1DFQA 2VOVA 1IS6A 1OA2A 1W99A 2D93A 3CF6E 1ND2C 4XF1A 3M8LA 3WSOA 4XIKA 1LOGA 2IC1A 4CEYC 4HPKB 4N43B 4XTMA 4OI0A 2WNEA 1YO8A 2J1SA 2VE1A 2GNDA 3H3UA 4QKDA 3O1MA 5FXWA 2JG9C 3RDIA 3SNMA 4RHV2 4NHYA 3ZSJA 3N4MA 4YVSC 3OEBA 3SCHA 1OPMA 4OFGA 5LA0A 3WZ1A 3WQBA 2WYFA 5KHGA 4CUBA 1MVEA 2VMCA 3E97A 3OGVA 4L11A 3S5QA 1JW6A 2RJKA 2OX0A 2XQXA 1NCRB 3N7KA 2R071 5J98B 4AAPA 1ULDA 2D97A 4YZ1A 3H9AA 4META 2R062 2WQ4A 5H9RA 1JTZX 3LCPA 3N7MA 1PMHX 1CJPA 2ZGMA 2CSGA 1AL21 1POV3 2VMIA 2WS92 1OLMA 1POQA 3N3HA 5LBEA 2B9VA 4A2UA 1JN2P 1WCUA 4GMP3 4LUMA 2MPFA 1YQ2A 5DUWA 3ETPA 1IG3A 3WNMA 1WZXA 3KLSA 3A22A 3LD8A 2XVLA 4LHNA 2XL9A 2P17A 5IVCA 4EN7B 1AYN3 1PO11 3MPPG 3MIDA 3K75B 2HWE3 4RHV3 1K12A 1TMF1 2PN5A 2ZMLA 5AFEA 5FZFA 2EIEA 1CZTA 1CD3G 2ZGRA 4LHSA 2DURA 3ZYPA 4FTEA 1KS5A 4IXLA 2VPVA 5F2WA 1US2A 2FHRA 1VBA2 1YQCA 2DU0A 1MZFA 4AGRA 1QXRA 1WLCA 2EIBA 4EZ4A 1QIQA 1HX6A 1TME3 3KHBA 2WO7A 2FDFA 1LEDA 1N1VA 3WQ1A 1G86A 2JDUA 2E9QA 2ZGLA 3NNJA 1RVF2 5A7WA 1N47A 4HANA 3ZDVA 1QWRA 2WNUC 1DZRA 5FWEA 4MGYE 4J1WA 2FQPA 5J1XA 2TBVA 4XZUG 2JE8A 1AX2A 2CAUA 4QU2A 3THDA 4HPKA 1KQRA 3JQXA 3MW3A 4N43A 4RR3C 1D0GA 3BGAA 4SLIA 5F6LB 1YIPA 2G19A 5CKMA 3ZSKA 1YFUA 2BOJA 4XFAA 4NAMA 4NROA 1W6OB 3WF2A 3MIEA 2K46A 4IGPA 4QKBA 2A73B 4HKLA 3VD5A 5C71A 5FYVA 2J42A 3D6EA 2A3WA 5J37A 1XQNA 2XBO2 4AVTA 4EROA 1ND3B 3UESA 2VQTA 3WDWA 5C5UA 1R1A1 1BEV2 1UY3A 2DVDA 1NCRA 1R092 2GU9A 3AXDA 1HKDA 4TLFA 1MEC2 2VOXA 4YYOA 3VBUA 5JOWA 2Q1ZB 1EUUA 1W6QB 1OSGA 3LIGA 4EN0A 1QGLA 3W5MA 1EUTA 2FD8A 1RMU3 1QJX1 1S0BA 2UWCA 1VBB2 1IKPA 5T5PA 1I5PA 1RVF3 4TXWA 5E88A 5LBCA 3LA3A 1ZRIA 2W47A 1ULOA 3ATGA 4C1WA 5I0UA 4D6RA 2KXLA 3WF4A 5LB6A 5C6CA 5FZDA 1JZ4A 2JXAA 2BPA2 1CR7A 4Y20A 2JG8A 5A80A 5T5OA 4YM3A 4M01A 1UYPA 1AR72 2CAVA 2RS52 3FC0A 5ANNA 4R8HA 2NYYA 5JI9A 1AYM1 1SEFA 5LY2A 3MYXA 3NMBA 4TN7A 4URTA 2XBO3 2EIDA 1RUE3 2HWB2 2YZ4A 2V5DA 2E7TA 5LBFA 1KS4A 1XPWA 4Q4Y2 2W9XA 2Z2SB 1DQ1A 4XUTA 2BBVA 1JUHA 4KI5M 2QQMA 3IPVB 4YRDA 4QQHA 3AYEA 4NVPA 4WVMB 1ZBE1 1LGBA 1LOFC 1RUC2 1FPN1 3WNNA 4I2OA 1NYWA 3ZXGA 1UY4A 3ZXKA 2DCTA 1E57A 3VKLA 3D82A 3WV6A 3Q8AA 4GB33 3SKVA 1ASJ1 3POIA 5IK4A 1QJU3 1X8EA 5GLVA 1CPMA 2GP5A 2GC0A 3FHAA 3IIIA 3PVBB 1WLWA 1OT5A 3I8TA 3OBAA 1RUH2 1WW7A 5FO7B 1RIRA 4LULA 1KXGA 2G9GA 1DGRN 3QCWA 4B29A 3A4UA 2RV9A 1OUSA 2R6QA 1W6OA 2ZX2A 5A6ZA 4XZPA 1A78A 2VVDA 1UKRA 2RS53 3DYMA 4XMAA 3IZOA 2UYBA 3HVDA 4XETA 1X82A 5FUPA 1FX5A 3IDBB 3MIFA 1H4HA 1ND3A 2R042 2P3IA 1RXGA 2RR13 4AGVA 3BU0A 5ISLA 2BWCA 2R49A 3KD4A 1GOGA 2XJQA 4PJYA 1DQ6A 3GBFA 3MIBA 1W6QA 3RSJA 3T4VA 4MOAA 2YGLA 1PNFA 4NWVA 1HQLA 1CAUB 2NN8A 3CU7A 3E5XA 3GBWA 1YWKA 4YM0A 4AEKA 1DBNA 2E32A 2IVIB 2WZEA 1J1TA 3NV1A 4JQRA 2Y64A 2EVXA 2GC2A 4QPGB 4HSJA 5FJKA 3VHNA 4N43C 2QKDA 1IS5A 3JB4C 3EBRA 1IS4A 2V5YA 4L9BA 4RYDA 1IS3A 4COZA 2D3SA 5C3PA 3VBHB 2UWAA 1S0GA 1Q8SA 5IVBA 4IETA 2GN3A 1ACCA 2BJSA 2EXHA 4F83A 3OTFA 1OQDA 2IWGB 2YMZA 3FZ3A 1OQEA 1XBFA 5APAA 1UMIA 1NCRC 4YGCA 3JD71 5D8AB 3VBUC 3M3EA 2VQAA 4NIAA 3MFAA 3N9PA 5FLIA 5FAXA 3LEIA 1EAH1 1ZX5A 2HYKA 4FFGA 1J83A 1VAKA 3KT1A 4PHZA 3IPVA 2P6HA 1W06A 2VCBA 1DLLA 4ISQA 4LBJA 4L8QA 1DF0A 2WNVB 2QCSB 1DGRA 1YJKA 2A3YA 4H14A 2X09A 5FLHA 4DUXA 2YV8A 5BPXA 3RS6A 4DPNA 4IUGA 2XOMA 1MS1A 2B45X 2JG8C 4XFFA 2Y33A 3FWEA 2ZGUA 3WOGA 4A6SA 3ETQA 3WHTA 3NRUA 3BIEA 3ILFA 4LK7A 4OULA 4WM7A 1HXS2 1YHFA 2VD7A 1I3HA 1W6PB 2PAEA 4YW2A 4FOVA 5LRSA 5JIUA 1F4AA 1LOEA 3I2HA 4PI0A 5L9BA 3VD4A 3RFRA 5IFPA 5KXDA 2VZPA 2W1WA 3UKVA 5IAVA 3CJXA 3B02A 3WF1A 1UZWA 4D6QA 3K3NA 1D0HA 1DU3D 3RWNA 3ZYIB 5IVFA 4UYBA 5FTTC 3RMYA 2QDRA 5BNNB 3AKRA 1H1IA 5FYCA 1WLDA 2WWUA 3A0KA 4QM9A 4ES9A 4AVVA 2EAAA 1S1AA 1PO21 4MV2A 4Y5Z0 5GLUA 4BB3A 4Y3OA 1CAUA 2XXZA 5G05L 4BYYA 3J7LA 3MIGA 4PIXA 4AFAA 4I0BA 1RTVA 2QQLA 3LPGA 3IT8A 1QU0A 3AC0A 4QPGA 1QOOA 1OF3A 4AI1A 5JSRA 4MUVA 3ZN6B 3ELNA 4ZXKA 3VDAA 1OQ1A 1HJFA 4I3PA 4O65A 3J4UH 2WZR1 4YWAA 4J1XA 1FOD2 1PX4A 2VNOA 1WD4A 1HQNA 4CDWB 3USSA 1COV1 1H9PA 1RUD1 5GZEA 4CP1A 3FBYA 1ZZ8A 3AKSA 4YGDA 1X8MA 1RUNA 2HWC2 2NPIA 2YC0A 4DS0A 1ND3C 1Y9GA 4YG3A 4YVWB 4A44A 4QHZA 1RUJ2 4XYXA 1H1AA 4XF4A 4CVUA 3D0SA 3DECA 3WP6A 2PYTA 3POEA 1GZWA 1NY72 5FPUA 4P9YA 3BN6A 3O7OA 5FOJB 2IXCA 1WLTA 1FATA 2ARXA 3HPNA 2P3KA 3P5BA 1RJ8A 2WNVA 3D5OA 3DXTA 1Q8QA 2DUQA 2WINB 3RYRA 4CEWA 1L3JA 4QQLA 2PQQA 4LBQB 2W68A 1TEIA 1KITA 1SFYA 1SQ4A 5E16A 4DXSA 3DUIA 3VHPA 1S55A 4AVSA 3AMPA 3ZN4A 3TEWA 4JDNA 2OUHA 4HVOA 4OYUA 4A4AA 1FV3A 3EB7A 1WWYA 4AL9A 2XJVA 4FSJA 4N7IA 1XNBA 1O6UA 2WSUA 4LLFA 1OMIA 2B5HA 2R16A 2NP0A 3KSCA 1UU5A 3KT4A 1O4TA 3QH7A 4F8AA 2HWC3 3CQOA 1K45A 1KGYA 1FMD3 4LITA 4UOJA 4HKWA 5T5JA 1Q56A 3EYPA 3NAPB 3I7DA 4K9SA 4XTPA 4AEDB 1N3QA 2O8QA 2DCYA 2ILMA 4NIHA 1EV12 1MS9A 4PCRA 3ALQA 3F95A 4GH4B 5BNNA 2ZX4A 4C1XA 1VBE2 4EWEA 2XKOA 3VBSB 3VKNA 5K0UB 1W8FA 4D7YA 1PK6B 1G6NA 1QJFA 2CWSA 2BTVC 4RHV1 1REEA 1W9YA 1ZZ9A 1PO13 2Z5WA 1T2XA 3LB9A 4X6RB 3NKGA 5FY5A 3ZN6A 3A7QA 4FAHA 1WA6X 3VDBA 2K9ZA 2PQSA 1D7PM 3VD3A 3VBOB 1VRH2 5C5TA 2R061 2YBKA 4MG2A 1I5ZA 3I3QA 1A34A 4ORFA 2AZ5A 5FP9A 4W50A 4DXZA 1W9SA 2WS91 1HRV3 3U75A 3AL6A 1FV2A 4YVWA 4XHXA 5GLWA 3WNOA 3SC7X 4C91A 4Z82A 5FZ1A 1LESA 2R0HA 1CGPA 2WFPA 4L0PA 4FPEA 1GNZA 5E8AA 4IGOA 4QDSA 4Q4X2 1MR5A 2UURA 3ITQA 3SKJE 3S30A 2GMEA 3E5UA 5JXIA 1HN0A 2VZ3A 3R4UA 2I74A 4LIVA 4KU8A 4XCAA 3HT1A 4HVQA 1UMHA 2B9UA 1LOAA 2D6PA 2OQ7A 2WABA 1GP5A 1AR62 4I3GA 4QPGC 2P1BA 3EJKA 2FMDA 4AEMA 3MO4A 1JOBA 5DAQA 5FZ6A 1ENRA 1VBA1 4QDQA 2J1RA 2VUAA 4P9IA 2AH2A 1DGWA 1D4VB 3DGTA 4CDQB 4YW1A 4EQVA 3GZTB 5CB7A 4CUAA 4B1MA 2VZTA 2P5BA 2XONA 4CCOA 1H2KA 4FPLA 4DNYA 3DYPA 1R1A3 4XUQA 2WIIB 1W9TA 2VU9A 4BCUA 2QZ3A 1HV1A 1VR3A 1RVF1 4JRAA 1GQPA 5D8AC 5DABA 4B7EA 2CNAA 1QJX3 2ZJCA 5FP8A 2KR2A 5EV7A 1SBDA 3WW2A 3M3IA 3OOXA 1S0EA 2QQIA 4GH4A 4Q4X3 1PMIA 1CAVA 1JBCA 2WWJA 3HQXA 5K0UA 3FUQA 2WNVC 4LO7A 3RYKA 3VBSA 2GH8A 1W2UA 2BW8A 1W8HA 3MF9A 1F8VA 2IXKA 2WNOA 4C90A 2O8OA 2R1BA 5EJZB 2CGNA 5EP9A 4NO4A 4QXBA 1BVVA 1YXWA 3FX3A 3JCIA 3URFA 5JOYA 2W1UA 4YM1A 3W20A 1PGL2 3OSDA 4H3WA 5F32A 1C57A 2XBO1 4AG4A 2UU8A 4R9CA 1AYM3 4Y26A 1BEV1 1UX7A 1R091 4I30A 1MEC1 2V73A 4UFKA 4PF1A 1PIV2 3WEZA 3VZJA 2O14A 5BYNA 3HEIA 5HCFA 3ZIXA 1GU3A 3KVAA 3DYOA 1FPN3 3I59B 3RI9A 2G4IA 3I2FA 5BNNC 5FZKA 3AJYA 5GJ6A 3NVCA 2GNTA 1ZZCA 4Z2AA 1HB4A 3FLPA 2Q1FA 1ASJ3 4MGTA 2G1MA 4LO5B 1KDKA 4QHBA 5FZ9A 1YFXA 5A33A 4HVRA 2BWAA 3VKOA 1BMV2 2W39A 4KGGA 2ZHNA 4XBQA 1SDWA 4CP2A 3MI8A 1VRBA 1AR71 2WL1A 2RS51 3LPFA 4RS5B 3N7JA 1U0AA 4CU8A 4JDMA 4LOTA 1RINA 2J7MA 4HT1T 1J1LA 3TB0A 5A3MA 1W9WA 2OIIA 2QZ2A 2RR11 3GALA 5GLTA 4AI2A 1HRI2 4K8RB 4DOUA 2VMFA 4Q4Y1 5IW0A 3H7YA 2C9KA 4HFSA 2OA2A 3ZFGA 3GNEA 1VALA 1MZEA 2E53A 2JDHA 1RUC1 2XWBB 1F2NA 4YVWC 1ND2A 2BERA 1JOPA 2PHFA 5JR7B 2YYOA 5JSOA 4W4ZA 4COUA 3BTXA 3HWJA 5CNAA 4AI3A 5GKAC 2QTWB 5JMOA 1YRZA 1LOCA 1HLCA 1SMVA 4WZFA 2JG9A 2QDNA 3FLTA 4IE4A 4R9AA 1JXNA 3CMGA 1MS0A 3JBG2 4GWIA 4XBLA 5FYZA 1GLHA 2ZMKA 1RUH1 1ONAA 2G9FA 5IAXA 5FMOS 1W8OA 5EYYA 4PBOA 1W2AX 1VMHA 4QHOA 2WUHA 2F4PA 1UF2C 5IJRA 3TRSB 2E63A 5FYMA 5J09A 1UMZA 3C7HA 4XFIA 4CCEA 1D2SA 4YFWA 4P5YA 2IZWA 2XLFA 3RWKX 3WDTA 1W6MB 3SCFA 1S0JA 2R041 4AF9A 1ODMA 4LKEA 3UYJA 5CADA 1HB3A 4AI8A 5A6QA 3JD73 1NXMA 4NJ4A 2W52A 4NN0A 4PLOA 5FREA 1VP6A 3MPBA 5AFBA 1ZM1A 1C8M2 2B39A 4OMDA 1AHSA 2EALA 5ANQA 1S0FA 3T09A 5FZOB 5C9AB 2H0VA 1EAH3 2JDKA 2ZGNA 5FYTA 4B7KA 3GZUC 2OVUA 3I59A 2DVAA 2VNVA 3E6CC 1YQ6A 4GH4C 5I91A 1H2NA 1LEMA 4PLNA 3SEEA 1SLBA 3VBSC 5K0UC 1W2OA 2R32A 4ES8A 2W91A 1F5FA 1YI9A 1W90A 3MDPA 3KQRA 3OPTA 4WM8A 1SLCA 2HWD2 3T2OA 2VUDA 3RZGA 4M4RA 5JZGC 2RS12 1BQPA 4MZUA 2JDZA 3PIGA 1BVP1 4N9IA 5F6KA 2D40A 3Q8EA 3LEKA 5A7SA 4Q1PA 5KXCA 4UF0B 5EQUA 4LT5A 3IB3A 4W6WA 4OHXA 5FPZA 5A7QA 1NCQB 5C4WB 1ST8A 4J6GA 3FLRA 4H2AA 5L7OB 3AP9A 1UCXA 4R52A 4FPCA 2ADDA 3IMNA 3USUB 2ZACA 1RITA 1AX1A 1W03A 4LK6A 3B7MA 3T4HB 1H9WA 2RHPA 4QAWA 5FZLA 1W2TA 1IZ3A 2WNUA 3POWA 1H2LA 2VXJA 3P3PA 1IOAA 4CUGA 2ZEYA 1RC6A 4PIZA 3AMNA 1OKOA 1WMFA 3ZMNA 3ACFA 4BMBA 1HB1A 1PO23 2PAKA 4LNVA 2VZRA 2VBPA 3WW1A 2DU1A 4IE5A 1Y4WA 1F15A 1Y43B 3SLIA 3ACHA 4AHWA 2D7FA 4MSVA 2VAUA 2SBAA 4MGIE 1CZSA 1HXS1 2RS13 3GHNA 4L99A 5ACA2 1UL9A 3C2UA 2YHJA 2OPWA 2WZR3 1UZVA 3FE5A 1PZ8A 3ES1A 3ACIA 4K20A 3KV6A 3BKZA 3KHCA 2ET1A 3OPZA 2Z69A 1RUD3 3M3QA 1G9AA 1X33A 2CDOA 2IXIA 3HBZA 4QXHA 5AVPA 3WNXA 4CDQC 5CG9A 5AC93 1SG3A 1O3SA 1QJY3 2W87A 4XW3A 1DGWX 3HN3A 4M4PA 5T52A 3A23A 5A3LA 4OUMA 3ZFGC 1GKBA 5BNOB 4QT6A 4HKOA 1NLQA 4BK4A 1VJ2A 1RUF2 2WLQA 3VB9A 1QQP3 4O61A 3PMEA 5FZOA 1ODNA 4INDA 1JYIA 3I2KA 4CCMA 5JDBA 2K0GA 2A6WA 1NUKA 2QQWA 3LAGA 4P9JA 1XJAA 1QHDA 3T3YA 1GOHA 4ONUA 1RUI2 1RHI2 4NPRA 1WMXA 4I02A 4Q5OA 4IEVA 5FZ7A 4QXKA 1AR82 4N90A 2KA3A 3S5AA 4EN6B 3ASIA 1W8UA 1SPPB 2H6BA 3TBDA 5FJHA 4BQ2A 2RMU2 1ZRCA 1V6LA 2HWC1 4S2HA 4UF0A 4UWDA 1FMD1 1Z7S2 5C4WA 2RVAA 3TEXA 4R9DA 4E27A 1G9FA 2HEYF 3NL1A 5L7OA 2LROA 2BYVE 4JV4A 4E4HA 4IE7A 1LOFA 1QXPA 4NRMA 2BGPA 3D8CA 3KV4A 1CWPA 3AZZA 3OGRA 3VZKA 1VPHA 1SLTA 3DXUA 1GNHA 2QQPA 2D3RA 3SEPA 4A3XA 2XWJB 5IATA 4UXAA 4P9WA 5K4LA 2W95A 3WX5A 3FMGA 3PTYA 4PQ9A 4OI4A 3T2PA 2ZS6B 3U37A 1YIFA 4Y4RA 2B42B 3B01A 2WAOA 4QPYA 3UV9A 4P9GA 1X50A 3UK9A 5LZ6A 4OI1A 3BB6A 2VMGA 4WM8C 3VHOA 4LBMA 3B9CA 3GHMA 3POYA 2HKXA 1V70A 1UZZA 2JICA 3MV01 1G8WA 1WKYA 3PDQA 4RS5C 3LDBA 3LOBA 4IEQA 3WDVA 1NQJA 3G6JB 4BWOA 4CDXB 4V2WA 3I3BA 4JGZB 1MZ6A 3T30A 2W1QA 3SISA 2R063 1HRV1 4FP2A 2GC3A 4FQ4A 4MVTA 4JVAA 2XHKA 2BVBA 1IPKA 1VBC2 3LWCA 2I45A 2FMYA 2VZOA 4COWA 2ERFA 2TNFA 2WS93 1WCSA 4D3WA 1EV11 3U1XA 1KJRA 2A1XA 5BNOA 1SLAA 4E4ZA 1VBE1 5H9QA 4M0HA 2WKKA 5GZFA 2D98A 5DUVA 3ZFFB 2X5IB 2A6VA 3ZXDA 4IE6A 2UY9A 5GZGA 1XXNA 2NQYA 3LGRA 4R9BA 4GZ9A 4K3UA 4IGQA 1S2BA 1UZYA 3GBGA 4L97A 3H42B 4UW5A 4K1YA 3O0WA 2MEV2 4BU2A 5BNPB 3LOIA 4CDUB 3WQ0A 4GQ7A 5F39A 2VMEA 2ZEZA 1VBA3 5I93A 2R1DA 2W3JA 1VRH1 5A32B 5HXMA 3UL2A 2JDMA 5FY7A 3E6BA 5CFCB 4JC1A 4CCDA 2FDGA 1D4M2 1IGOA 5I0SA 1DQ2A 1DQ4A 1HN1A 3GF6A 4QPIB 1O5UA 2DCKA 5F3EA 5CKNA 3DKQA 1YNAA 4DIQA 1CPNA 2JEMA 1CIYA 4FFFA 4Q2FA 4Q4X1 2CWMA 1GWMA 4BPZA 5C9AC 4L2NA 4Y22B 2JDYA 2P3YA 1VAVA 3ACLA 1AR61 4D69A 1UIJA 2JKBA 4UT5A 4URAA 5BNQA 2XVGA 2E7AA 2ZZJA 4KBZA 3TEZA 5J7MA 3D3AA 5T55A 4DEVA 4D94A 1UNBA 2W46A 4AQ2A 4FTSA 2GSYA 2VUCA 4LEJA 2QQJA 4W8JA 5M0TA 2UWBA 3P6BA 4Y5TA 1U5YA 5A1AA 1JHJA 4JCKA 1BEV3 1R093 1VBD2 5DPNA 1MEC3 5C4WC 4CCKA 3KF3A 3LKJA 4XUOA 5L7OC 4QB1A 2EICA 2FCTA 2F4LA 3AFKA 3BI3A 3HQUA 1NZCA 2J1EA 1LHUA 3WD5A 1VBB3 4BJ0A 4Z1VA 1W28A 4XXAA 4BZ4A 3WG2A 3FN9A 1ULCA 2E7QA 4QKFA 4AFCA 3RZZA 2NM1A 5CA6A 2VZVA 1C5IA 3E6DA 4V2VA 1QF3A 3CKHA 2X5IA 4UI9L 4XDPA 1U5ZA 1G7YA 5FMDA 2OXBA 3LSDA 1QEXA 3WUCA 5A3TA 4XIOA 1JZ3A 2BFUS 5FXXA 3FFQA 1QJEA 3ILNA 1PGL1 2YY1A 2Y6GA 1AR73 1QH6A 3OUHA 3RNSA 1YQ8A 3OBRA 5BNPA 1YI7A 4BLJA 1APNA 2VTXA 1W8TA 3GCXA 3FUOA 5C8WA 2WZPP 3MEPA 3HAGA 1RUG2 1UKGA 4AHYA 5A3UA 4BE3A 5FZ4A 2HWB3 1PIV1 5A32A 2VXRA 3APBA 5CFCA 2RS32 4Q27A 3H50A 2VW1A 4XFHA 5T3NA 4FT8A 4Q4Y3 4X8NA 5FPAA 5IFTA 3E5QA 3KMHA 2JE7A 3WDUA 2R0FA 5J96B 4QPIA 4XUPA 1RUC3 3V0BB 2VOTA 1NG0A 5EYXA 4Y1XA 3THTA 2ZKNA 5BNOC 4OZXA 3PVEA 1GZTA 1TVGA 5C3RA 5I8YA 4BQ3A 3O1UA 5FP7A 1ZBA2 2ZGSA 3MLKA 4FPFA 4Y22A 4XQWA 2GZWA 1C4RA 1P8JA 3TN92 4M3CE 1B35B 4UW4A 1UOBA 1Y9MA 4IERA 4CYDA 2JD9A 3HIFA 1W6NB 1RUH3 3U78A 1AZDA 4BA6A 5I0TA 4ISRA 2XB6C 1JYNA 4FPJA 1OBNA 3UJQA 4LO6B 1O3TA 5KR7A 1ZRDA 3K48A 4HMZA 3MW4A 5FZIA 3T0BA 1UU4A 4YW4A 4J25A 1FYUA 4KGQA 2AENA 3ZFEB 3INAA 3VUOA 3UGHA 2DFBA 1HRI1 2Y0OA 2V09A 3RZKA 1J3PA 4I0AA 2E6VA 3EQEA 3H7JA 2R043 5CEHA 1A8MA 5DDJ2 4IEWA 4ZZ5A 2QQOA 1WD3A 2WT0A 3KS7A 4AW7A 4QQ2A 1W0OA 4NE9A 4YZ4A 4FXKB 5T5LA 1UO9A 4YW7A 3NNLA 4WVMA 3AZVA 4KBBA 5FZMA 5JZGB 1VMFA 3WVJA 4LKSA 3ZSEA 3ZKUA 3OUIA 3O0XA 5FBJA 2J1VA 1AR92 3JBG1 3OF1A 4Q4W2 2VZQA 5DZGA 3VZNA 1AF9A 5A1FA 3BTAA 3JXSA 4O9GA 4AR2A 4M3CF 1JYVA 3IDCB 4AHZA 4A45A 3TOJA 4A6OA 3ZSMA 5LA9A 4LIUA 1FXZA 3VV1A 2WFF2 3KF5A 5C8CB 3GGLA 4Q26A 1TQ5A 5IVYA 5IT6A 2WQ8A 2JECA 4OUSA 1AJKA 1SFNA 1JYWA 4FOYA 4B1LA 2JDNA 2YC4A 4CDXC 1UYYA 1BMV1 4WZCA 1POV0 5D1IA 2P2KA 3RVHA 4JGZC 4LPLA 4XJUA 3UKTA 1C8M1 4I0WB 5LEJA 1IPSA 2DBIA 4BDVB 2VTFA 3J7MA 4OVEA 3LSEA 1BBT2 3FHIB 2XPJA 2BGCA 5ERLA 3ZYRA 4DRVA 1XNDA 1W39A 4RGKA 4E9KA 1X7NA
chains in the Genus database with same CATH topology
1JODA 1JYTA 1JOBA 1ZRIA 1F35A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JOD A;  1JYT A;  1JOB A;  1ZRI A;  1F35 A; 
#chains in the Genus database with same CATH topology
 4CCL A;  3AZW A;  2VBB A;  5LK5 A;  4LBO A;  3ZFF C;  1SFP A;  1SBF A;  2OZJ A;  2X5I C;  2WR9 A;  1J59 A;  1US3 A;  4WVZ A;  2HWD 1;  3O1V A;  2FDJ A;  3O1O A;  2RS1 1;  1V9U 2;  5CKQ A;  2W94 A;  4KWJ A;  1LCL A;  5FK7 A;  3VBH A;  1GZC A;  3HN1 A;  3IKW A;  4K40 A;  3UT0 A;  1HXS 3;  1UW8 A;  3ZYG A;  2ID4 A;  5BNP C;  2DYC A;  4ASK A;  4FBF A;  4LMF A;  4ARY A;  5A1L A;  2OKX A;  2ET7 A;  4M3C B;  2VMD A;  3ZFE A;  1QJY 1;  2ZHL A;  4XCB A;  5AC9 1;  2LUW A;  1HJG A;  2IUW A;  3HNB M;  1TNR A;  4GKX A;  4QX3 A;  3PMS A;  4N53 B;  5D8A A;  4LE4 A;  4HBN A;  5CFC C;  2A6Y A;  5FCC A;  4NHL A;  4AQT A;  1CX4 A;  1QQP 1;  1T6B X;  1KJL A;  4CCC A;  2A70 A;  1LUL A;  4IEO A;  5FY1 A;  5H9S A;  4XFC A;  1G9D A;  1LB2 A;  3MGU A;  3C7F A;  3WG4 A;  2NMO A;  4QPI C;  2ZAA A;  5DN2 A;  3IIA A;  3K4D A;  1SAC A;  2D6M A;  2ZX0 A;  1QKQ A;  4QGM A;  3PJQ A;  2R7E B;  2VC9 A;  3PVO A;  1SZB A;  2CDP A;  2Y38 A;  5B4N A;  3UNP A;  1LHW A;  3CJI B;  2JE9 A;  3K51 A;  4RGG A;  1CAX B;  4DUV A;  2OQ6 A;  1OLQ A;  1Q5O A;  2ARE A;  2R07 2;  4XDQ A;  1KRI A;  2D43 A;  4JAA A;  3AP7 A;  3ZYF A;  3W59 A;  2QUO A;  4WVW A;  1YUD A;  4YNI A;  2HLE A;  1GYK A;  1EPW A;  2VCM A;  3CO2 A;  3N9N A;  1QNW A;  4AK3 A;  5ACA 1;  1AL2 2;  3I2G A;  3RZM A;  1SDD B;  4GJZ A;  1FOD 3;  4COV A;  3VD9 A;  1QDC A;  1W6P A;  5C8C A;  4ATF A;  4YZ2 A;  5LWB A;  4PBP A;  3ZOI A;  3SCG A;  1QXJ A;  4MLO A;  3BPS A;  2P37 A;  5EHD A;  2E33 A;  2VUJ A;  1DYP A;  3GM8 A;  4Y1V A;  1OH4 A;  2W0X A;  3CIH A;  2YU2 A;  2XH6 A;  1RUJ 3;  3I2J A;  3I2O A;  4ATE A;  1XYN A;  1RUF 1;  4LA3 A;  1TMF 2;  4XF9 A;  1N3O A;  4IES A;  1GZ9 A;  3DEM A;  2DWR A;  4YG6 A;  4AE2 A;  1OF4 A;  5F9T A;  2A3X A;  5JWP A;  4KU7 A;  3HT2 A;  2ZHM A;  4NMI A;  5KWR A;  1PVC 2;  2D5H A;  3GCW A;  4FVV A;  1JH5 A;  2DF7 A;  1RUI 1;  1RHI 1;  4RQP B;  4ASL A;  5FZA A;  5I0D A;  2RDN A;  5TSW A;  4AEJ A;  1T6G C;  3RZJ A;  5CBL A;  1DDL A;  4R4Z A;  4AZZ A;  4EWD A;  1UY0 A;  3MLL A;  2RMU 1;  4CDW A;  4ASM B;  2EF6 A;  1DG6 A;  2WT2 A;  5FZG A;  3NO8 A;  1W2N A;  4YZ3 A;  1Z7S 1;  5L19 A;  2Y26 A;  1UY2 A;  3ZYJ B;  4PDW B;  5EJ1 B;  2PFW A;  1C1F A;  4M3C A;  2QE3 A;  1K3I A;  3SIT A;  4Z8B A;  1BZW A;  3IWZ A;  1YJL A;  3UJO A;  1PX3 A;  3TYJ A;  3NV4 A;  3WNK A;  3N35 A;  4CRQ A;  2KD7 A;  5FPX A;  2VZ1 A;  1EV1 3;  5JXG A;  1NAE A;  1CZV A;  1XYO A;  2YPJ A;  3DPR B;  4LUK A;  4P02 B;  1F5J A;  2ORZ A;  1VBE 3;  4NPL A;  3S7E A;  4HK8 A;  3ZXL A;  1DGL A;  3TEY A;  1Q43 A;  2XUM A;  4GXL A;  4FXG B;  3CJI A;  4XOG A;  1LEN A;  4LBQ A;  4XF3 A;  3ZPY A;  3QLQ A;  5KC6 A;  1AXK A;  1Z0H A;  3K46 A;  5FMB A;  3VBH C;  1ZZB A;  3QBQ A;  1B09 A;  5DZF A;  1AXZ A;  5FZH A;  4D6S A;  2DTW A;  3AVR A;  1VRH 3;  1KDM A;  2P3J A;  5DXD A;  4NAO A;  3ZFE C;  1WW5 A;  4BOW A;  4D0Q A;  3WDY A;  3CZU A;  3B93 A;  5JPN B;  3PL0 A;  1VBC 1;  3I2I A;  3VL9 A;  1D2Q A;  4Z92 B;  5F3C A;  1R08 2;  3TNP B;  3FL7 A;  3ZR6 A;  3O1S A;  3PHM A;  5JAX A;  3NAP A;  1OLR A;  3K4Z A;  4AED A;  2A6X A;  3O1T A;  5J3U A;  1NX9 A;  5GZD A;  2BDR A;  1UIK A;  4JQT A;  4Q4V 2;  1MZ5 A;  2HYX A;  5BXX A;  2ZZQ A;  2LTN A;  4Z07 A;  1LKN A;  1NKG A;  2D6L X;  1XSQ A;  1PK6 A;  2VMH A;  3E1F 1;  4GA9 A;  4QX5 A;  4SBV A;  2X53 S;  5EZW A;  4MH0 E;  2PEL A;  1IPJ A;  5F5A A;  5B4X A;  3BTY A;  3RI8 A;  3IBM A;  2CV6 A;  3G7D A;  1AR6 3;  1PMJ X;  4DXR A;  3BYW A;  3JU9 A;  2MEV 1;  1OH3 A;  4IEY A;  4L92 A;  5T50 A;  3DN7 A;  4XVH A;  3ZYH A;  4C0H A;  4EZH A;  4DUW A;  1ZYB A;  1OD5 A;  2Y6H A;  5FBZ A;  1O3R A;  2XJR A;  2CY6 A;  1FT9 A;  2F17 A;  4LOR A;  2EXI A;  4XAC A;  5A7P A;  3AZX A;  5C8C C;  1ZZ7 A;  1GQG A;  5FDB A;  1XB9 A;  1R1Z A;  3VBO A;  2UYA A;  3HMY A;  2ZGO A;  5JXH A;  4AYU A;  5GM0 A;  5C70 A;  1D4M 1;  3POJ A;  2ZAH A;  5A6Y A;  4LXL A;  3ZM8 A;  3BU7 A;  3OBT A;  1VBB 1;  2W92 A;  3BOW A;  4MGZ E;  3LZZ A;  3R6S A;  4ARX A;  4MGS A;  1WBL A;  2JDP A;  4LBN A;  1O8P A;  2GH2 A;  2VQ0 A;  4PLM A;  4I01 A;  4CU9 A;  5LEK A;  3CNA A;  3D0J A;  1BJQ A;  4CXW A;  4LQR A;  4M0N A;  5C3Q A;  2BU9 A;  2HBT A;  2WAA A;  3MF6 A;  4Z2W A;  3W21 A;  5JMC A;  3OG2 A;  5LY1 A;  3RRD A;  4JKK A;  3HD8 B;  2DTY A;  3WW4 A;  2XLG A;  3GJB A;  1Q8V A;  1Y7B A;  1K5J A;  5EJ3 A;  4DEQ A;  4LBQ D;  2Z4F A;  3NST A;  2BOI A;  3NV3 A;  5DUX A;  1UY1 A;  1JMU B;  1Q3E A;  2A71 A;  4GD4 A;  1F31 A;  3N9O A;  1UYZ A;  1CON A;  4ZU5 A;  5FIX A;  3ZR5 A;  5FKB A;  2HWB 1;  4ZON A;  4CDQ A;  4Q8K A;  4CDW C;  3UKN A;  3WDX A;  4JHT A;  4NPM A;  3AJZ A;  5SV8 A;  5HV0 A;  2B7Y A;  2LW8 A;  1HDK A;  1UPI A;  1PIV 3;  3IAP A;  1XU1 A;  1WGP A;  3LFM A;  1DYK A;  3THP A;  3RJR A;  1QOS A;  1LU1 A;  4P14 A;  5J48 A;  4KWU A;  4K1Z A;  2AEY A;  2Q1M A;  5A7O A;  3EO6 A;  3V0A B;  1OLM E;  3WY6 A;  5C33 A;  4BQ4 A;  2PHW A;  5IK7 A;  5F3G A;  5KHI A;  5KHJ A;  3OB8 A;  2DVG A;  2FZ2 A;  4N7U A;  3S57 A;  3ECQ A;  1S2K A;  3NQH A;  4X8P A;  3ST7 A;  2WO3 A;  2B4K A;  2DCZ A;  4QQP A;  3CJI C;  2OZ6 A;  3OGS A;  4OHV A;  5L9V A;  4YW3 A;  3WR0 A;  4EYU A;  4UFJ A;  2WYS A;  1C3H A;  1SLL A;  4IEX A;  1BK1 A;  5F2S A;  3B3Q E;  1VIW B;  1KFX L;  4JGY B;  2PLV 2;  4B8E A;  2BUK A;  5LA2 A;  1WCQ A;  3LDK A;  3A0N A;  1RUG 1;  2D6O X;  4YGB A;  3W58 A;  1U5X A;  3FFZ A;  4AVC A;  5C7G A;  1CES A;  4QWN A;  1HRI 3;  2ADE A;  2X8K A;  2RS3 1;  4IEU A;  4LE3 A;  5LBB A;  3VZL A;  1UPS A;  4KG8 A;  1DZT A;  1VE0 A;  2XJP A;  3PU8 A;  4KMQ A;  4OQ9 A;  2PTM A;  1LNS A;  1HV0 A;  1V6J A;  3HNM A;  4AAX A;  2BP6 A;  2ARA A;  3NAP C;  4AED C;  5JUV A;  2ZBJ A;  4G3Y C;  4JKL A;  1N1S A;  1LOB A;  5F37 A;  2VY0 A;  4B4Q A;  5FMO L;  1Q8O A;  2WZ8 A;  1ZBA 1;  4CU7 A;  3PUH A;  1UQX A;  4KNC A;  5GLZ A;  5HXV A;  5CG8 A;  4HSL A;  2ARC A;  1FI2 A;  2XVK A;  3MUZ 1;  1BKZ A;  1ALY A;  1PK6 C;  2AGS A;  2LS6 A;  3JBG 3;  3LQC A;  4IV1 B;  4R4X A;  4WVV A;  1LEC A;  2ZMN A;  3WIN E;  1YEW A;  2CL2 A;  3MIC A;  4DZG A;  2VH9 A;  5A6X A;  2ARB A;  3H1W A;  2VR4 A;  1C5H A;  4RQP C;  3GZA A;  2RM2 2;  3CDZ B;  4LHK A;  2O1Q A;  4RS5 A;  4DMI A;  3Q8C A;  4IEP A;  1ZA4 A;  3OD4 A;  4UFI A;  3I3M A;  1JI6 A;  2WDB A;  4S2D A;  2PLV 3;  2GDF A;  4FPG A;  4QX2 A;  2V4V A;  1V6N A;  1DHK B;  3CZJ A;  3ENR A;  4MAD A;  5EFU A;  1AL0 G;  1X36 A;  3VBO C;  4BIS A;  3BUC A;  4UAP A;  1YYN A;  2VQU A;  3CHX A;  1UD1 A;  2TEP A;  1MS5 A;  1OVS A;  1C8M 3;  1DCS A;  2XLA A;  3EHK A;  5IK8 A;  1LAJ A;  1J3Q A;  3WW3 A;  1XNK A;  2BEO A;  3SH5 A;  4COY A;  2BNO A;  4LKF A;  1GP6 A;  3V0A A;  2A6Z A;  3M4F A;  2ZHK A;  3Q9O A;  2J1T A;  2JEN A;  3J8F 2;  2GMP A;  5FO8 B;  2WWS A;  1AR9 1;  3OBZ A;  4Q4W 1;  1COV 2;  1W04 A;  4RA0 A;  3ZXA C;  4EWA A;  5JCT A;  3HBK A;  4Y4Y A;  2SLI A;  1GV9 A;  2Y6K A;  3T08 A;  1W8Z A;  5IVV A;  4HON A;  5CFD B;  1MAC A;  3CLP A;  2ZXQ A;  2ZKL A;  2OUJ A;  1CVN A;  2HWD 3;  4QX1 A;  1QY4 A;  1JHN A;  4MGK E;  2HEW F;  2JX9 A;  4ZPI A;  1CIW A;  5FPB A;  2J1U A;  2RM2 3;  1QNY A;  1S0I A;  4FI9 A;  2XJS A;  1Y3T A;  3WF3 A;  4JGY A;  4AWD A;  4IQP A;  4DIN B;  2ENR A;  3DKW A;  4AXO A;  1UWW A;  3P1I A;  1W6M A;  4QQO A;  5JI7 A;  2VOK A;  4YPJ A;  3VHR A;  4GUL A;  1A8D A;  2VW0 A;  3AP5 A;  2D6N A;  2XHN A;  5D21 A;  3N9M A;  5HCB A;  2C4X A;  2D6K A;  1BBT 1;  4DY5 A;  5C9A A;  2VZU A;  4D7S A;  4RFT 0;  2DCJ A;  2VEC A;  5I8S A;  4QKN A;  3T0D A;  1F35 A;  1HW5 A;  3OGG A;  3AFG A;  4XAA A;  1GAN A;  1W0N A;  1O8S A;  3J7H A;  4FQZ A;  2Y8K A;  3AYA A;  3ON7 A;  2I07 B;  4PF5 A;  2JKX A;  4IV1 A;  5A7W B;  2Q4S A;  5T54 A;  4AHX A;  3SH4 A;  4MXV A;  1FOD 1;  2Z42 A;  5ACA 3;  2Q8O A;  4PI2 A;  4QX8 A;  1CJD A;  2RJ2 A;  4UFL A;  1STM A;  1V6K A;  2BNM A;  5FV3 A;  1W0P A;  2FCV A;  4QM8 A;  4XAB A;  1NCQ A;  4XMI A;  3GYD A;  2QQK A;  3TN9 1;  1ZNP A;  1OXC A;  1AYN 2;  1UAI A;  1RUJ 1;  5DUU A;  2XL7 A;  3PUS A;  2XUE A;  4EV0 A;  1LRH A;  2HWE 2;  2W08 A;  3USU A;  2PHD A;  2WO1 A;  4CCJ A;  1ULP A;  1NY7 1;  3K77 A;  1W9F A;  4RGA A;  1RUF 3;  1AJO A;  1VB2 A;  1H8T B;  5EWS A;  5A70 A;  5ABJ B;  5FKC A;  4A41 A;  1MQT B;  4KL1 A;  5F8P A;  4IV3 B;  4CU6 A;  3POF A;  4KH9 A;  1LOD A;  4LKD A;  2C24 A;  3VBU B;  1DZQ A;  1JOJ A;  1LR5 A;  1O3Q A;  3KVB A;  3VDD B;  4JHZ A;  1TME 2;  1S2E A;  2ATF A;  2JIG A;  2QFE A;  2YXS A;  2YG0 A;  4DFS A;  2Q30 A;  2JWP A;  1ZA7 A;  3CL1 A;  1RUI 3;  1RHI 3;  1H1M A;  2X10 A;  2ZGQ A;  5FLJ A;  5CFD A;  2VVE A;  4GWN A;  5F7U A;  4C8D A;  1AR8 3;  2YBP A;  2YGM A;  3WG3 A;  5KBF A;  2FDI A;  2ZX3 A;  2P4E A;  4BIF A;  5DAV A;  4O9E A;  1OFN A;  4FPY A;  2WRA A;  5FRA A;  3KV9 A;  2RMU 3;  3WUD A;  3ZXF A;  3S0M A;  2C26 A;  4MGQ A;  1M06 G;  3L9J T;  2W1S A;  1Z7S 3;  3EMR A;  3NV2 A;  4Y20 B;  2JG8 B;  1H0B A;  4XAE A;  1E5S A;  3U10 A;  5FY0 A;  2E51 A;  4XF0 A;  3LIH A;  4OUE A;  1EY2 A;  2V72 A;  4EN8 B;  3OEA A;  3MBW A;  3P3N A;  2IFW A;  5F5I A;  1W8W A;  3ILR A;  3PTR B;  2BGO A;  3SXW A;  4UBH A;  2B8M A;  2DBN A;  3I49 A;  2RDR A;  2CYF A;  5CVR A;  2ZEX A;  3H1Y A;  5J36 A;  2B46 X;  4ZY9 A;  1PVC 1;  1H8V A;  1NXD 1;  3H1M A;  4Y1U A;  1GOF A;  4JKM A;  1TNF A;  3NJV A;  1GUI A;  4CXY A;  1RMU 2;  3KV5 A;  4NHX A;  2WSV A;  4FP3 A;  1U12 A;  1WMD A;  4HXC A;  2P34 A;  4IDZ A;  4XJ9 A;  4QB2 A;  2VVF A;  2MHF A;  2PMW B;  1IQD C;  2YC2 A;  4FPO B;  5IVE A;  2D3P A;  4FO9 A;  3C7O A;  3QOP A;  3DCQ A;  4ITC A;  1SPP A;  5FFO C;  4JGY C;  3ZX7 A;  3T0A A;  3ZLI A;  3MLJ A;  4QB6 A;  1H2M A;  1YFW A;  3POG A;  4YM2 A;  5HCH A;  4KWL A;  5FO9 B;  1OHF A;  3D4K A;  4N8M A;  1EPZ A;  4MXW B;  5JSP A;  3KCY A;  3IMM A;  3SMH A;  3KCX A;  4MHR A;  1OOP B;  1GFF 2;  1VBC 3;  4P08 A;  4D7T A;  3LFI A;  2JIJ A;  2FDK A;  4BLI A;  4S2F A;  4WBB A;  1ZRE A;  3I4I A;  3KCC A;  2YB7 A;  4DY3 A;  1H8T A;  3EXU A;  3WXP A;  4CXX A;  5ABJ A;  2VBD A;  1MQT A;  1RUE 2;  1LGC A;  2GNM A;  4IV3 A;  4Q0S A;  4CCN A;  2AEZ A;  5LAS A;  3BTZ A;  5FUN A;  3VDD A;  1XRU A;  1L7R A;  2HBU A;  1KEX A;  3KGL A;  2BV4 A;  4IV1 C;  1LHO A;  3KB5 A;  4JX0 A;  2YRO A;  2MEV 3;  4ZHN A;  3MZH A;  4XUR A;  3GXU A;  3T1L A;  1PM7 A;  3LF7 A;  4KWK A;  3U11 A;  2LAL A;  4TYS A;  1V00 A;  4U36 A;  5IUQ A;  4ZKT B;  3I54 A;  5GZC A;  1XNT A;  5DAX A;  2O0O A;  4GB3 2;  3WG1 A;  2Y0I A;  2EAK A;  1QJU 2;  4Q0Q A;  1BCX A;  4BXF A;  3MIH A;  5E1R A;  3ZO0 B;  4CDX A;  4YW5 A;  1K5M B;  3HNY M;  3FHQ A;  3ZKY A;  1NCQ C;  4H55 A;  4JGZ A;  3PUI A;  4IE0 A;  5JVV A;  3L2H A;  5FZ3 A;  2P6C A;  1D4M 3;  2Y6F A;  5HPO A;  1R08 1;  4LHL A;  3T1M A;  5FYU A;  3MHZ A;  3OCP A;  2CGP A;  4ZU7 A;  3UGF A;  3H8O A;  1XNC A;  4B4P A;  4Q4V 1;  1LHN A;  3V56 A;  4Y1Y A;  4Q0U A;  3B5L B;  1I9R A;  1O7F A;  3AXE A;  3ZFF A;  5FPL A;  1JYT A;  4HET A;  4UW3 A;  4HN0 A;  3WNL A;  2RR1 2;  1DIW A;  1CAW B;  2ZPX A;  3V65 A;  4AFM A;  3C7E A;  2CHH A;  1ULF A;  1JZ2 A;  1SLI A;  1NA1 B;  2WN2 A;  5CFD C;  1XE8 A;  2Q8E A;  1UOG A;  4CDU A;  3IDA A;  4XJA A;  4RFR B;  1BHG A;  5FYH A;  1NE4 A;  5A3O A;  4C0B A;  5JLV A;  4YAR A;  4LLO A;  2VM9 A;  1W3X A;  5FZC A;  1OUR A;  1VBD 3;  1MS4 A;  3N7L A;  1ZRR A;  4CP9 B;  4NOT A;  5FY8 A;  3T2T A;  2DV9 A;  2HWF 2;  1PHM A;  4I09 A;  4MXW A;  3WT3 A;  4ZXE A;  5LW9 A;  1JZ7 A;  1QMJ A;  4WM7 B;  1PM4 A;  2WA3 A;  1OOP A;  4AQS A;  3VLB B;  4DO0 A;  1NZI A;  1ZZ6 A;  3F2Z A;  3O1R A;  5JOZ A;  3NJZ A;  2GP3 A;  2CTV A;  4TLG A;  1LTE A;  1SBE A;  1V0A A;  5C3O A;  3VN4 A;  3VKM A;  3VBR B;  2DDU A;  5K7P A;  1L7Q A;  4E2Q A;  2BFU L;  2V4A A;  4EE2 A;  2VUL A;  3WLU A;  1E5R A;  2VTX J;  3AK0 A;  2A75 A;  5DG2 A;  5L73 A;  4IEZ A;  4XPV A;  5JPM B;  4WV8 A;  3ZSL A;  1YC6 1;  1YLL A;  4YW6 A;  4XHB A;  4JTO A;  4A7K A;  3TAY A;  1GMM A;  2PHX A;  1RUG 3;  3NJX A;  2ES3 A;  4QX7 A;  1DQ0 A;  3SH3 A;  2WLP A;  3RPQ A;  3VGI A;  2Q8D A;  2C0Z A;  1PGW 2;  1K5M A;  2RS3 3;  1IHM A;  2JB4 A;  1JZ5 A;  1GSL A;  2MNG A;  4FFH A;  4UBG A;  5EPA A;  1RUO A;  2QNK A;  2OW4 A;  1OFS A;  1H6X A;  1PNG A;  2HWF 3;  3O12 A;  3SHR A;  1OKQ A;  1MS8 A;  1JUI A;  2ZGK A;  4QMA A;  3M2M A;  4W6X A;  3BIW E;  3M3O A;  3U4X A;  1WCK A;  3RZL A;  4DQA A;  5JXJ A;  2JD4 A;  4QXC A;  4FAG A;  2RDQ A;  3H8R A;  4GIQ A;  1H8T C;  3FBM A;  5ABJ C;  3AMM A;  1ZBA 3;  4AQ6 A;  1MQT C;  5FUI A;  3I97 A;  4IV3 C;  4FTB A;  3PIJ A;  3R05 A;  3TN9 3;  1J58 A;  4CP0 A;  5GAL A;  4H7L A;  3M70 A;  3VDD C;  3PNA A;  1CAW A;  3LEG A;  5A3W A;  1A6C A;  4RN5 A;  1GZW B;  3VDC A;  2ZGT A;  4Q0P A;  2ZA9 A;  1NA1 A;  3BOP A;  3OGJ A;  2PLV 1;  2J22 A;  3AL5 A;  1UYX A;  4AI0 A;  4QD2 A;  1H6Y A;  2XG3 A;  1GWK A;  4YGE A;  3WNP A;  3GDB A;  5FY9 A;  4CEW B;  2AC1 A;  5EIY B;  1C28 A;  3ROU A;  4EN9 B;  1GR3 A;  3AZY A;  3DV8 A;  3POS A;  5JIA A;  1I1E A;  2AR6 A;  2QQU A;  4GMP 0;  2QBX A;  1ZVF A;  5DDJ 3;  4CP9 A;  1XE7 A;  2AYH A;  2BZD A;  2VZS A;  3C3V A;  4FOW A;  5A3P A;  2RJL A;  3V0B A;  1E5H A;  2L9L A;  3WP4 A;  3WP3 A;  2N7G A;  4OI2 A;  3KT7 A;  3RZH A;  4Y1Z A;  3POB A;  1AR9 3;  4Q4W 3;  5DZE A;  3VBR A;  3U07 A;  1U5I A;  5B2G B;  1ULE A;  1EYB A;  4D8M A;  2ETE A;  1B35 A;  1C8N A;  4JDO A;  1W6N A;  3PUA A;  2RM2 1;  5KC5 A;  4HK9 A;  5FXV A;  4TWT A;  2WFF 3;  2DVB A;  3KQ4 B;  4NUB A;  2EXK A;  1OA4 A;  4A7Y A;  2VCA A;  4FPK A;  4CDU C;  1GNY A;  3S7I A;  3U4S A;  5FPV A;  5IVJ A;  3WP5 A;  2Q0A A;  4K8F A;  1AUY A;  5FZB A;  5CIR A;  1UN1 A;  4XJ8 A;  2Y60 A;  1JZ6 A;  2RE9 A;  2VL4 A;  2I2S A;  3JUU A;  4Y33 A;  4A7Z A;  4NID A;  4P9X A;  4OHY A;  2ZAB A;  1QDO A;  3X29 B;  4MHU A;  4P5H A;  1OOP C;  2IXL A;  4RL7 A;  4W6Y A;  2PHR A;  1BBT 3;  4ET7 A;  3GZE A;  3J8F 1;  5LRR A;  3PUR A;  1BXH A;  5JZG A;  4XFG A;  5A3N A;  1NE6 A;  2IVJ A;  3O1P A;  2NZ9 A;  4DXT A;  5FXZ A;  4OZO A;  2HH9 A;  4QGL A;  1XC6 A;  1FMD 2;  1VB4 A;  3QAC A;  4XDO A;  3A21 A;  3VBF B;  3AYC A;  2C6S A;  1V9U 3;  2EA7 A;  2D5F A;  1K42 A;  4GWJ A;  4NWW A;  5K8S A;  1XSR A;  4XIL A;  5F1R A;  2XML A;  3CBN A;  1ENX A;  3PJY A;  3B00 A;  4QPW A;  5FZE A;  4CA9 A;  5I0R A;  4KG0 A;  4QGN A;  1RJ7 A;  1PZ7 A;  3I3E A;  4OHZ A;  1PVX A;  3ZIW A;  4PQQ A;  1AXY A;  3ES4 A;  1UZ0 A;  4LR4 A;  5FP4 A;  2RG4 A;  2DUO A;  3AVS A;  4AVA A;  1WW6 A;  1O4Y A;  2ZOE B;  3OY8 B;  1K5M C;  1PO1 2;  1UOF A;  1GP4 A;  1W8N A;  3OUJ A;  1TZO A;  4JRL A;  4F7Z A;  4UFH A;  2GNB A;  1FNY A;  3WQ7 A;  3KGZ A;  3MFC A;  2UY8 A;  5SV5 A;  3VZO A;  4AFB A;  4ZZ8 A;  4PT6 A;  3MUY 1;  2QVS B;  3HQR A;  1OI6 A;  2GN7 A;  4CTE A;  5CAZ A;  3J7N A;  1NT0 A;  1SHW B;  1Z78 A;  2GC1 A;  4U2A A;  4E4D X;  2LM3 A;  3TWI A;  1OD3 A;  5KHK A;  2R07 3;  4GWM A;  3K2O A;  4YZ5 A;  3N9L A;  4AGG A;  2E26 A;  1POV 1;  1HRV 2;  1WBF A;  1M4W A;  3ZVX A;  1WME A;  1URX A;  3H3L A;  1I6X A;  1AR8 1;  4G4F A;  4OMC A;  4E4S A;  4GMP 1;  3IAQ A;  2OPK A;  3VKF C;  1AL2 3;  4LOS A;  1RYY A;  1NA1 C;  3UET A;  4FOQ A;  5IHR A;  2CGO A;  3JB8 A;  4EJR A;  5C3S A;  5KXE A;  1CAV B;  4Q29 A;  2G9Z A;  4OHW A;  5BUV A;  2VCC A;  5DAW A;  5G04 L;  2DFC A;  5DMY A;  1AYN 1;  1N3P A;  5FK8 A;  2W2I A;  3VL8 A;  2HWE 1;  3TNQ A;  2XKP A;  4N53 A;  2F6B A;  2EXJ A;  3BOD A;  4HZF A;  4AVB A;  2ZCW A;  2GAL A;  5LAT A;  2YPD A;  4HN1 A;  4UW6 A;  1TMF 3;  3H8X A;  4E8C A;  3NKT A;  1XE0 A;  3AMH A;  4RSU A;  2NLR A;  1REF A;  4WM7 C;  1RL3 A;  1V6M A;  3IDE A;  1NLS A;  3HJR A;  3U14 A;  3R4S A;  1R1A 2;  1TME 1;  4Y5S A;  1CAX A;  3RQ0 A;  1FAY A;  3W9A A;  1PVC 3;  3VBR C;  3AMQ A;  5HI0 A;  5FYY A;  2WQZ C;  1VAM A;  2Y6J A;  1LJ7 A;  5DAP A;  1DYO A;  1B35 C;  2YFU A;  4NRQ A;  4XXP A;  3NJY A;  1QJX 2;  3V64 A;  1YCI A;  1BYH A;  1YFY A;  2ZX1 A;  3VBF A;  2XR4 A;  1G9B A;  2ORX A;  5BY5 A;  1JU4 A;  1G9C A;  4FCA A;  3JQW A;  3ZMO A;  2XQR A;  2IXH A;  4H7M A;  4HOO A;  2Z79 A;  1BK0 A;  4TTG A;  3B9I A;  5A33 B;  1FNZ A;  5KHH A;  3MW2 A;  4YSF A;  1SCS A;  4V1P A;  3ZDS A;  4BHP A;  3LDR A;  3H0O A;  3KM5 A;  2OS2 A;  2AAC A;  4MYE A;  3OY8 A;  4BQY A;  2J1A A;  3W5N A;  4P00 B;  1DP0 A;  5JOX A;  5F5Q A;  2R30 A;  3LA7 A;  2BBA A;  4IW3 A;  3U0Z A;  2WJS A;  3WCS A;  4XQD A;  1AYM 2;  2C1F A;  3R0R A;  1NOV A;  4HLT A;  3RJ2 X;  2WT1 A;  3ABZ A;  4NRP A;  4BH9 A;  3O5S A;  2X05 A;  2WA4 A;  1RMU 1;  3ZFG B;  4E2G A;  5KXB A;  1O4Z A;  4RQP A;  3AP4 A;  5F5C A;  3QH6 A;  1ND2 B;  4XUN A;  1WW4 A;  1OVP A;  2QJV A;  1ZBE 2;  4YLZ A;  4CEY B;  2K2S A;  1FPN 2;  5LA1 A;  1AVB A;  3WF0 A;  4G9S B;  4GJY A;  2VO5 A;  1BLZ A;  4QDR A;  4CPB A;  2PA7 A;  4LBK A;  4IL7 A;  2JG9 B;  3OJB A;  1N1Y A;  4FFI A;  1F4H A;  1ASJ 2;  3BVC A;  2ZGP A;  2QQV A;  4YVS B;  1JYC A;  1VMJ A;  2A7A A;  1HQW A;  1A3K A;  2C5D A;  3AP6 A;  2PHT A;  1XU2 A;  1Q8P A;  3NWK A;  4PDW A;  2ZEW A;  5FOB B;  1OA3 A;  1LGN A;  4CEW C;  3KZ4 C;  1L7L A;  2VNG A;  1MPX A;  4XBN A;  1R08 3;  1R64 A;  4UFM A;  3AKT A;  2WO2 A;  2AUY A;  4LO4 B;  2OYZ A;  3S6P A;  2WBK A;  3DPR A;  3R4D B;  2DUP A;  4E2S A;  3LA2 A;  4Q4V 3;  4XJW A;  1RUE 1;  2KM2 A;  5FWJ A;  4NR1 A;  5H9P A;  1KD7 A;  4MX3 A;  3OPW A;  2A5Z A;  2Y34 A;  5FMC A;  1PGS A;  1S0C A;  2PAM A;  4HG6 B;  1SCR A;  4BIO A;  4BQ5 A;  4NHK A;  5HV4 A;  5FZ0 A;  1EP0 A;  3AKQ A;  3J26 N;  3I3D A;  5A7N A;  4BQX A;  3RMX A;  1ZBE 3;  3OD0 A;  5IWF A;  3THC A;  5AVA A;  3ZN5 A;  4GB3 1;  1E5I A;  3ME2 A;  1QJU 1;  2VW2 A;  3N9Q A;  5LCW L;  4LBL A;  1LHV A;  1VBD 1;  4XQ4 A;  4CZS A;  4XJZ A;  5E89 A;  2YUE A;  4JZR A;  4LJH A;  4AFD A;  5EXO A;  1GQH A;  4WM8 B;  1V6O A;  4OCT A;  3K4A A;  2JJ6 A;  2E31 A;  4N53 C;  4ZS2 A;  4ZU4 A;  1ENQ A;  5CYY A;  1IKQ A;  3RGB A;  2WN3 A;  3O0V A;  2FCU A;  1J3R A;  4CUC A;  1LU2 A;  2PXJ A;  2FDH A;  4JTN A;  5K9Y A;  1KFU L;  3MV1 1;  2XJU A;  5FYB A;  3PVN A;  3I2D A;  1JYX A;  2BVV A;  3K3O A;  1TG7 A;  3JD7 2;  4MO3 M;  4LTA A;  5FQ0 B;  3PUQ A;  1O59 A;  3HR9 A;  3L2Y A;  4N9H A;  4K7J A;  1DQ5 A;  2WNU B;  3C7G A;  2NMN A;  1EAH 2;  3RYP A;  1X9P A;  3VBF C;  1C1L A;  2VJX A;  4HL0 A;  1XYP A;  4CEY A;  4RR3 B;  3AX4 A;  3KWV A;  3ZYB A;  2QQN A;  3WCR A;  4B3N A;  1H30 A;  4CPB D;  4BK5 A;  2GMM A;  3HOB A;  4K6B A;  2X29 A;  3CEW A;  3BCW A;  3SQO A;  1DLC A;  1GIC A;  4YVS A;  4KQ7 A;  4B4R A;  2HWF 1;  1O5L A;  4GAL A;  5CIS A;  5LK7 B;  3Q8B A;  5FYS A;  4NIG A;  1CQ9 A;  2HJI A;  2EIG A;  3AKP A;  5JR2 A;  2YBS A;  2FBE A;  1N1T A;  4RD7 A;  3NNF A;  4BXS V;  1CN1 A;  1QH7 A;  3DL3 A;  3LE0 A;  3M1H A;  2XDV A;  1OPO A;  5F3I A;  1ULG A;  3B94 A;  3ZPO A;  2HEV F;  2Y6L A;  1WA4 A;  3BAL A;  2VNR A;  2H6C A;  2TUN A;  4GAZ A;  4Q1R A;  4S2G A;  5E6H A;  4ZS3 A;  4Q0V A;  1NQD A;  4YG0 A;  1XNA A;  3PLQ A;  5I8T A;  1IG0 A;  4XC9 A;  3AM2 A;  3DF0 A;  3OYW B;  1OC1 A;  1RXF A;  5L36 A;  4LA2 A;  4P9L A;  4W65 A;  5IK5 A;  2JB8 A;  3C8X A;  3NNM A;  2CU5 A;  5FP3 A;  3IN9 A;  1O91 A;  1PO2 2;  2DVF A;  3AB0 A;  1NLR A;  2RDS A;  4XFB A;  1HIX A;  4DB5 A;  1GWL A;  1UX6 A;  2IXJ A;  3IM0 A;  1PGW 1;  1S4C A;  5DDJ 1;  1JZ8 A;  2ZTN A;  1RED A;  1UXZ A;  4BM8 A;  4Q8L A;  4F3J A;  4OQ8 A;  4PDW C;  1RB8 G;  2LRP A;  3WHU A;  1PZ9 A;  1RGS A;  1VLN A;  4QX0 A;  4LO8 A;  1AX0 A;  2YU1 A;  5L9R A;  4O7X A;  1IQA A;  2WZR 2;  3AYD A;  2BNN A;  2VG9 A;  5FYI A;  1H4G A;  1JS9 A;  2D44 A;  2PHU A;  4X6Q B;  4NHM A;  2FZ1 A;  5FY4 A;  5FR3 A;  5HBA A;  3DPR C;  3FJS A;  3M7A A;  3QD6 A;  4YFZ A;  5CU1 A;  1RUD 2;  3VD7 A;  5IYY A;  3ZXE A;  5BV6 A;  1TE1 B;  5AC9 2;  3JZV A;  1QJY 2;  3T2Q A;  4DRR A;  5FZ8 A;  4NII A;  3VZM A;  3ZXJ A;  4AI9 A;  1WCD J;  2W5F A;  4FPH A;  2WFF 1;  3M3C A;  2Q5T A;  1Y9Q A;  5FQ0 A;  2XJT A;  4TZD A;  2GAU A;  2C9A A;  4K21 A;  4BME A;  4CE8 A;  3Q8F A;  1UOJ A;  3ORJ A;  1QQP 2;  4BQ1 A;  1JU3 A;  2VGD A;  4QU1 A;  4XEZ A;  5D2A A;  4M00 A;  4TSV A;  4E8D A;  4OLL A;  1MVQ A;  4RR3 A;  2XGX A;  1F9K A;  3O14 A;  3H3Z A;  2JDA A;  4AOC A;  3BPZ A;  5HCA A;  1ENS A;  4XE9 A;  1WUV A;  1V6I A;  1MS3 A;  1OUX A;  2PHL A;  4Y24 A;  4A42 A;  4CSW A;  2H0B A;  3PU3 A;  1X9T A;  1XOY A;  1ZRF A;  1QJZ A;  1QOT A;  5CZK A;  3NW4 A;  1JOD A;  1YQ5 A;  3J8F 3;  5DG1 A;  4PIY A;  2BQP A;  3UGG A;  4A3Z A;  1COV 3;  1GBG A;  3NNG A;  3ACG A;  1UU6 A;  2IFR A;  2YDE A;  4GKY A;  4BQW A;  5DQ0 A;  2WC2 A;  1CX1 A;  2YFZ A;  2OT7 A;  1V9U 1;  1UXX X;  3B69 A;  3GJA A;  3LEM A;  3N36 A;  1HB2 A;  2Q8C A;  3H8U A;  1S0D A;  3J9S A;  2VOW A;  2BRT A;  1W3V A;  3OYW A;  3RG0 A;  1J84 A;  1W05 A;  1DFQ A;  2VOV A;  1IS6 A;  1OA2 A;  1W99 A;  2D93 A;  3CF6 E;  1ND2 C;  4XF1 A;  3M8L A;  3WSO A;  4XIK A;  1LOG A;  2IC1 A;  4CEY C;  4HPK B;  4N43 B;  4XTM A;  4OI0 A;  2WNE A;  1YO8 A;  2J1S A;  2VE1 A;  2GND A;  3H3U A;  4QKD A;  3O1M A;  5FXW A;  2JG9 C;  3RDI A;  3SNM A;  4RHV 2;  4NHY A;  3ZSJ A;  3N4M A;  4YVS C;  3OEB A;  3SCH A;  1OPM A;  4OFG A;  5LA0 A;  3WZ1 A;  3WQB A;  2WYF A;  5KHG A;  4CUB A;  1MVE A;  2VMC A;  3E97 A;  3OGV A;  4L11 A;  3S5Q A;  1JW6 A;  2RJK A;  2OX0 A;  2XQX A;  1NCR B;  3N7K A;  2R07 1;  5J98 B;  4AAP A;  1ULD A;  2D97 A;  4YZ1 A;  3H9A A;  4MET A;  2R06 2;  2WQ4 A;  5H9R A;  1JTZ X;  3LCP A;  3N7M A;  1PMH X;  1CJP A;  2ZGM A;  2CSG A;  1AL2 1;  1POV 3;  2VMI A;  2WS9 2;  1OLM A;  1POQ A;  3N3H A;  5LBE A;  2B9V A;  4A2U A;  1JN2 P;  1WCU A;  4GMP 3;  4LUM A;  2MPF A;  1YQ2 A;  5DUW A;  3ETP A;  1IG3 A;  3WNM A;  1WZX A;  3KLS A;  3A22 A;  3LD8 A;  2XVL A;  4LHN A;  2XL9 A;  2P17 A;  5IVC A;  4EN7 B;  1AYN 3;  1PO1 1;  3MPP G;  3MID A;  3K75 B;  2HWE 3;  4RHV 3;  1K12 A;  1TMF 1;  2PN5 A;  2ZML A;  5AFE A;  5FZF A;  2EIE A;  1CZT A;  1CD3 G;  2ZGR A;  4LHS A;  2DUR A;  3ZYP A;  4FTE A;  1KS5 A;  4IXL A;  2VPV A;  5F2W A;  1US2 A;  2FHR A;  1VBA 2;  1YQC A;  2DU0 A;  1MZF A;  4AGR A;  1QXR A;  1WLC A;  2EIB A;  4EZ4 A;  1QIQ A;  1HX6 A;  1TME 3;  3KHB A;  2WO7 A;  2FDF A;  1LED A;  1N1V A;  3WQ1 A;  1G86 A;  2JDU A;  2E9Q A;  2ZGL A;  3NNJ A;  1RVF 2;  5A7W A;  1N47 A;  4HAN A;  3ZDV A;  1QWR A;  2WNU C;  1DZR A;  5FWE A;  4MGY E;  4J1W A;  2FQP A;  5J1X A;  2TBV A;  4XZU G;  2JE8 A;  1AX2 A;  2CAU A;  4QU2 A;  3THD A;  4HPK A;  1KQR A;  3JQX A;  3MW3 A;  4N43 A;  4RR3 C;  1D0G A;  3BGA A;  4SLI A;  5F6L B;  1YIP A;  2G19 A;  5CKM A;  3ZSK A;  1YFU A;  2BOJ A;  4XFA A;  4NAM A;  4NRO A;  1W6O B;  3WF2 A;  3MIE A;  2K46 A;  4IGP A;  4QKB A;  2A73 B;  4HKL A;  3VD5 A;  5C71 A;  5FYV A;  2J42 A;  3D6E A;  2A3W A;  5J37 A;  1XQN A;  2XBO 2;  4AVT A;  4ERO A;  1ND3 B;  3UES A;  2VQT A;  3WDW A;  5C5U A;  1R1A 1;  1BEV 2;  1UY3 A;  2DVD A;  1NCR A;  1R09 2;  2GU9 A;  3AXD A;  1HKD A;  4TLF A;  1MEC 2;  2VOX A;  4YYO A;  3VBU A;  5JOW A;  2Q1Z B;  1EUU A;  1W6Q B;  1OSG A;  3LIG A;  4EN0 A;  1QGL A;  3W5M A;  1EUT A;  2FD8 A;  1RMU 3;  1QJX 1;  1S0B A;  2UWC A;  1VBB 2;  1IKP A;  5T5P A;  1I5P A;  1RVF 3;  4TXW A;  5E88 A;  5LBC A;  3LA3 A;  1ZRI A;  2W47 A;  1ULO A;  3ATG A;  4C1W A;  5I0U A;  4D6R A;  2KXL A;  3WF4 A;  5LB6 A;  5C6C A;  5FZD A;  1JZ4 A;  2JXA A;  2BPA 2;  1CR7 A;  4Y20 A;  2JG8 A;  5A80 A;  5T5O A;  4YM3 A;  4M01 A;  1UYP A;  1AR7 2;  2CAV A;  2RS5 2;  3FC0 A;  5ANN A;  4R8H A;  2NYY A;  5JI9 A;  1AYM 1;  1SEF A;  5LY2 A;  3MYX A;  3NMB A;  4TN7 A;  4URT A;  2XBO 3;  2EID A;  1RUE 3;  2HWB 2;  2YZ4 A;  2V5D A;  2E7T A;  5LBF A;  1KS4 A;  1XPW A;  4Q4Y 2;  2W9X A;  2Z2S B;  1DQ1 A;  4XUT A;  2BBV A;  1JUH A;  4KI5 M;  2QQM A;  3IPV B;  4YRD A;  4QQH A;  3AYE A;  4NVP A;  4WVM B;  1ZBE 1;  1LGB A;  1LOF C;  1RUC 2;  1FPN 1;  3WNN A;  4I2O A;  1NYW A;  3ZXG A;  1UY4 A;  3ZXK A;  2DCT A;  1E57 A;  3VKL A;  3D82 A;  3WV6 A;  3Q8A A;  4GB3 3;  3SKV A;  1ASJ 1;  3POI A;  5IK4 A;  1QJU 3;  1X8E A;  5GLV A;  1CPM A;  2GP5 A;  2GC0 A;  3FHA A;  3III A;  3PVB B;  1WLW A;  1OT5 A;  3I8T A;  3OBA A;  1RUH 2;  1WW7 A;  5FO7 B;  1RIR A;  4LUL A;  1KXG A;  2G9G A;  1DGR N;  3QCW A;  4B29 A;  3A4U A;  2RV9 A;  1OUS A;  2R6Q A;  1W6O A;  2ZX2 A;  5A6Z A;  4XZP A;  1A78 A;  2VVD A;  1UKR A;  2RS5 3;  3DYM A;  4XMA A;  3IZO A;  2UYB A;  3HVD A;  4XET A;  1X82 A;  5FUP A;  1FX5 A;  3IDB B;  3MIF A;  1H4H A;  1ND3 A;  2R04 2;  2P3I A;  1RXG A;  2RR1 3;  4AGV A;  3BU0 A;  5ISL A;  2BWC A;  2R49 A;  3KD4 A;  1GOG A;  2XJQ A;  4PJY A;  1DQ6 A;  3GBF A;  3MIB A;  1W6Q A;  3RSJ A;  3T4V A;  4MOA A;  2YGL A;  1PNF A;  4NWV A;  1HQL A;  1CAU B;  2NN8 A;  3CU7 A;  3E5X A;  3GBW A;  1YWK A;  4YM0 A;  4AEK A;  1DBN A;  2E32 A;  2IVI B;  2WZE A;  1J1T A;  3NV1 A;  4JQR A;  2Y64 A;  2EVX A;  2GC2 A;  4QPG B;  4HSJ A;  5FJK A;  3VHN A;  4N43 C;  2QKD A;  1IS5 A;  3JB4 C;  3EBR A;  1IS4 A;  2V5Y A;  4L9B A;  4RYD A;  1IS3 A;  4COZ A;  2D3S A;  5C3P A;  3VBH B;  2UWA A;  1S0G A;  1Q8S A;  5IVB A;  4IET A;  2GN3 A;  1ACC A;  2BJS A;  2EXH A;  4F83 A;  3OTF A;  1OQD A;  2IWG B;  2YMZ A;  3FZ3 A;  1OQE A;  1XBF A;  5APA A;  1UMI A;  1NCR C;  4YGC A;  3JD7 1;  5D8A B;  3VBU C;  3M3E A;  2VQA A;  4NIA A;  3MFA A;  3N9P A;  5FLI A;  5FAX A;  3LEI A;  1EAH 1;  1ZX5 A;  2HYK A;  4FFG A;  1J83 A;  1VAK A;  3KT1 A;  4PHZ A;  3IPV A;  2P6H A;  1W06 A;  2VCB A;  1DLL A;  4ISQ A;  4LBJ A;  4L8Q A;  1DF0 A;  2WNV B;  2QCS B;  1DGR A;  1YJK A;  2A3Y A;  4H14 A;  2X09 A;  5FLH A;  4DUX A;  2YV8 A;  5BPX A;  3RS6 A;  4DPN A;  4IUG A;  2XOM A;  1MS1 A;  2B45 X;  2JG8 C;  4XFF A;  2Y33 A;  3FWE A;  2ZGU A;  3WOG A;  4A6S A;  3ETQ A;  3WHT A;  3NRU A;  3BIE A;  3ILF A;  4LK7 A;  4OUL A;  4WM7 A;  1HXS 2;  1YHF A;  2VD7 A;  1I3H A;  1W6P B;  2PAE A;  4YW2 A;  4FOV A;  5LRS A;  5JIU A;  1F4A A;  1LOE A;  3I2H A;  4PI0 A;  5L9B A;  3VD4 A;  3RFR A;  5IFP A;  5KXD A;  2VZP A;  2W1W A;  3UKV A;  5IAV A;  3CJX A;  3B02 A;  3WF1 A;  1UZW A;  4D6Q A;  3K3N A;  1D0H A;  1DU3 D;  3RWN A;  3ZYI B;  5IVF A;  4UYB A;  5FTT C;  3RMY A;  2QDR A;  5BNN B;  3AKR A;  1H1I A;  5FYC A;  1WLD A;  2WWU A;  3A0K A;  4QM9 A;  4ES9 A;  4AVV A;  2EAA A;  1S1A A;  1PO2 1;  4MV2 A;  4Y5Z 0;  5GLU A;  4BB3 A;  4Y3O A;  1CAU A;  2XXZ A;  5G05 L;  4BYY A;  3J7L A;  3MIG A;  4PIX A;  4AFA A;  4I0B A;  1RTV A;  2QQL A;  3LPG A;  3IT8 A;  1QU0 A;  3AC0 A;  4QPG A;  1QOO A;  1OF3 A;  4AI1 A;  5JSR A;  4MUV A;  3ZN6 B;  3ELN A;  4ZXK A;  3VDA A;  1OQ1 A;  1HJF A;  4I3P A;  4O65 A;  3J4U H;  2WZR 1;  4YWA A;  4J1X A;  1FOD 2;  1PX4 A;  2VNO A;  1WD4 A;  1HQN A;  4CDW B;  3USS A;  1COV 1;  1H9P A;  1RUD 1;  5GZE A;  4CP1 A;  3FBY A;  1ZZ8 A;  3AKS A;  4YGD A;  1X8M A;  1RUN A;  2HWC 2;  2NPI A;  2YC0 A;  4DS0 A;  1ND3 C;  1Y9G A;  4YG3 A;  4YVW B;  4A44 A;  4QHZ A;  1RUJ 2;  4XYX A;  1H1A A;  4XF4 A;  4CVU A;  3D0S A;  3DEC A;  3WP6 A;  2PYT A;  3POE A;  1GZW A;  1NY7 2;  5FPU A;  4P9Y A;  3BN6 A;  3O7O A;  5FOJ B;  2IXC A;  1WLT A;  1FAT A;  2ARX A;  3HPN A;  2P3K A;  3P5B A;  1RJ8 A;  2WNV A;  3D5O A;  3DXT A;  1Q8Q A;  2DUQ A;  2WIN B;  3RYR A;  4CEW A;  1L3J A;  4QQL A;  2PQQ A;  4LBQ B;  2W68 A;  1TEI A;  1KIT A;  1SFY A;  1SQ4 A;  5E16 A;  4DXS A;  3DUI A;  3VHP A;  1S55 A;  4AVS A;  3AMP A;  3ZN4 A;  3TEW A;  4JDN A;  2OUH A;  4HVO A;  4OYU A;  4A4A A;  1FV3 A;  3EB7 A;  1WWY A;  4AL9 A;  2XJV A;  4FSJ A;  4N7I A;  1XNB A;  1O6U A;  2WSU A;  4LLF A;  1OMI A;  2B5H A;  2R16 A;  2NP0 A;  3KSC A;  1UU5 A;  3KT4 A;  1O4T A;  3QH7 A;  4F8A A;  2HWC 3;  3CQO A;  1K45 A;  1KGY A;  1FMD 3;  4LIT A;  4UOJ A;  4HKW A;  5T5J A;  1Q56 A;  3EYP A;  3NAP B;  3I7D A;  4K9S A;  4XTP A;  4AED B;  1N3Q A;  2O8Q A;  2DCY A;  2ILM A;  4NIH A;  1EV1 2;  1MS9 A;  4PCR A;  3ALQ A;  3F95 A;  4GH4 B;  5BNN A;  2ZX4 A;  4C1X A;  1VBE 2;  4EWE A;  2XKO A;  3VBS B;  3VKN A;  5K0U B;  1W8F A;  4D7Y A;  1PK6 B;  1G6N A;  1QJF A;  2CWS A;  2BTV C;  4RHV 1;  1REE A;  1W9Y A;  1ZZ9 A;  1PO1 3;  2Z5W A;  1T2X A;  3LB9 A;  4X6R B;  3NKG A;  5FY5 A;  3ZN6 A;  3A7Q A;  4FAH A;  1WA6 X;  3VDB A;  2K9Z A;  2PQS A;  1D7P M;  3VD3 A;  3VBO B;  1VRH 2;  5C5T A;  2R06 1;  2YBK A;  4MG2 A;  1I5Z A;  3I3Q A;  1A34 A;  4ORF A;  2AZ5 A;  5FP9 A;  4W50 A;  4DXZ A;  1W9S A;  2WS9 1;  1HRV 3;  3U75 A;  3AL6 A;  1FV2 A;  4YVW A;  4XHX A;  5GLW A;  3WNO A;  3SC7 X;  4C91 A;  4Z82 A;  5FZ1 A;  1LES A;  2R0H A;  1CGP A;  2WFP A;  4L0P A;  4FPE A;  1GNZ A;  5E8A A;  4IGO A;  4QDS A;  4Q4X 2;  1MR5 A;  2UUR A;  3ITQ A;  3SKJ E;  3S30 A;  2GME A;  3E5U A;  5JXI A;  1HN0 A;  2VZ3 A;  3R4U A;  2I74 A;  4LIV A;  4KU8 A;  4XCA A;  3HT1 A;  4HVQ A;  1UMH A;  2B9U A;  1LOA A;  2D6P A;  2OQ7 A;  2WAB A;  1GP5 A;  1AR6 2;  4I3G A;  4QPG C;  2P1B A;  3EJK A;  2FMD A;  4AEM A;  3MO4 A;  1JOB A;  5DAQ A;  5FZ6 A;  1ENR A;  1VBA 1;  4QDQ A;  2J1R A;  2VUA A;  4P9I A;  2AH2 A;  1DGW A;  1D4V B;  3DGT A;  4CDQ B;  4YW1 A;  4EQV A;  3GZT B;  5CB7 A;  4CUA A;  4B1M A;  2VZT A;  2P5B A;  2XON A;  4CCO A;  1H2K A;  4FPL A;  4DNY A;  3DYP A;  1R1A 3;  4XUQ A;  2WII B;  1W9T A;  2VU9 A;  4BCU A;  2QZ3 A;  1HV1 A;  1VR3 A;  1RVF 1;  4JRA A;  1GQP A;  5D8A C;  5DAB A;  4B7E A;  2CNA A;  1QJX 3;  2ZJC A;  5FP8 A;  2KR2 A;  5EV7 A;  1SBD A;  3WW2 A;  3M3I A;  3OOX A;  1S0E A;  2QQI A;  4GH4 A;  4Q4X 3;  1PMI A;  1CAV A;  1JBC A;  2WWJ A;  3HQX A;  5K0U A;  3FUQ A;  2WNV C;  4LO7 A;  3RYK A;  3VBS A;  2GH8 A;  1W2U A;  2BW8 A;  1W8H A;  3MF9 A;  1F8V A;  2IXK A;  2WNO A;  4C90 A;  2O8O A;  2R1B A;  5EJZ B;  2CGN A;  5EP9 A;  4NO4 A;  4QXB A;  1BVV A;  1YXW A;  3FX3 A;  3JCI A;  3URF A;  5JOY A;  2W1U A;  4YM1 A;  3W20 A;  1PGL 2;  3OSD A;  4H3W A;  5F32 A;  1C57 A;  2XBO 1;  4AG4 A;  2UU8 A;  4R9C A;  1AYM 3;  4Y26 A;  1BEV 1;  1UX7 A;  1R09 1;  4I30 A;  1MEC 1;  2V73 A;  4UFK A;  4PF1 A;  1PIV 2;  3WEZ A;  3VZJ A;  2O14 A;  5BYN A;  3HEI A;  5HCF A;  3ZIX A;  1GU3 A;  3KVA A;  3DYO A;  1FPN 3;  3I59 B;  3RI9 A;  2G4I A;  3I2F A;  5BNN C;  5FZK A;  3AJY A;  5GJ6 A;  3NVC A;  2GNT A;  1ZZC A;  4Z2A A;  1HB4 A;  3FLP A;  2Q1F A;  1ASJ 3;  4MGT A;  2G1M A;  4LO5 B;  1KDK A;  4QHB A;  5FZ9 A;  1YFX A;  5A33 A;  4HVR A;  2BWA A;  3VKO A;  1BMV 2;  2W39 A;  4KGG A;  2ZHN A;  4XBQ A;  1SDW A;  4CP2 A;  3MI8 A;  1VRB A;  1AR7 1;  2WL1 A;  2RS5 1;  3LPF A;  4RS5 B;  3N7J A;  1U0A A;  4CU8 A;  4JDM A;  4LOT A;  1RIN A;  2J7M A;  4HT1 T;  1J1L A;  3TB0 A;  5A3M A;  1W9W A;  2OII A;  2QZ2 A;  2RR1 1;  3GAL A;  5GLT A;  4AI2 A;  1HRI 2;  4K8R B;  4DOU A;  2VMF A;  4Q4Y 1;  5IW0 A;  3H7Y A;  2C9K A;  4HFS A;  2OA2 A;  3ZFG A;  3GNE A;  1VAL A;  1MZE A;  2E53 A;  2JDH A;  1RUC 1;  2XWB B;  1F2N A;  4YVW C;  1ND2 A;  2BER A;  1JOP A;  2PHF A;  5JR7 B;  2YYO A;  5JSO A;  4W4Z A;  4COU A;  3BTX A;  3HWJ A;  5CNA A;  4AI3 A;  5GKA C;  2QTW B;  5JMO A;  1YRZ A;  1LOC A;  1HLC A;  1SMV A;  4WZF A;  2JG9 A;  2QDN A;  3FLT A;  4IE4 A;  4R9A A;  1JXN A;  3CMG A;  1MS0 A;  3JBG 2;  4GWI A;  4XBL A;  5FYZ A;  1GLH A;  2ZMK A;  1RUH 1;  1ONA A;  2G9F A;  5IAX A;  5FMO S;  1W8O A;  5EYY A;  4PBO A;  1W2A X;  1VMH A;  4QHO A;  2WUH A;  2F4P A;  1UF2 C;  5IJR A;  3TRS B;  2E63 A;  5FYM A;  5J09 A;  1UMZ A;  3C7H A;  4XFI A;  4CCE A;  1D2S A;  4YFW A;  4P5Y A;  2IZW A;  2XLF A;  3RWK X;  3WDT A;  1W6M B;  3SCF A;  1S0J A;  2R04 1;  4AF9 A;  1ODM A;  4LKE A;  3UYJ A;  5CAD A;  1HB3 A;  4AI8 A;  5A6Q A;  3JD7 3;  1NXM A;  4NJ4 A;  2W52 A;  4NN0 A;  4PLO A;  5FRE A;  1VP6 A;  3MPB A;  5AFB A;  1ZM1 A;  1C8M 2;  2B39 A;  4OMD A;  1AHS A;  2EAL A;  5ANQ A;  1S0F A;  3T09 A;  5FZO B;  5C9A B;  2H0V A;  1EAH 3;  2JDK A;  2ZGN A;  5FYT A;  4B7K A;  3GZU C;  2OVU A;  3I59 A;  2DVA A;  2VNV A;  3E6C C;  1YQ6 A;  4GH4 C;  5I91 A;  1H2N A;  1LEM A;  4PLN A;  3SEE A;  1SLB A;  3VBS C;  5K0U C;  1W2O A;  2R32 A;  4ES8 A;  2W91 A;  1F5F A;  1YI9 A;  1W90 A;  3MDP A;  3KQR A;  3OPT A;  4WM8 A;  1SLC A;  2HWD 2;  3T2O A;  2VUD A;  3RZG A;  4M4R A;  5JZG C;  2RS1 2;  1BQP A;  4MZU A;  2JDZ A;  3PIG A;  1BVP 1;  4N9I A;  5F6K A;  2D40 A;  3Q8E A;  3LEK A;  5A7S A;  4Q1P A;  5KXC A;  4UF0 B;  5EQU A;  4LT5 A;  3IB3 A;  4W6W A;  4OHX A;  5FPZ A;  5A7Q A;  1NCQ B;  5C4W B;  1ST8 A;  4J6G A;  3FLR A;  4H2A A;  5L7O B;  3AP9 A;  1UCX A;  4R52 A;  4FPC A;  2ADD A;  3IMN A;  3USU B;  2ZAC A;  1RIT A;  1AX1 A;  1W03 A;  4LK6 A;  3B7M A;  3T4H B;  1H9W A;  2RHP A;  4QAW A;  5FZL A;  1W2T A;  1IZ3 A;  2WNU A;  3POW A;  1H2L A;  2VXJ A;  3P3P A;  1IOA A;  4CUG A;  2ZEY A;  1RC6 A;  4PIZ A;  3AMN A;  1OKO A;  1WMF A;  3ZMN A;  3ACF A;  4BMB A;  1HB1 A;  1PO2 3;  2PAK A;  4LNV A;  2VZR A;  2VBP A;  3WW1 A;  2DU1 A;  4IE5 A;  1Y4W A;  1F15 A;  1Y43 B;  3SLI A;  3ACH A;  4AHW A;  2D7F A;  4MSV A;  2VAU A;  2SBA A;  4MGI E;  1CZS A;  1HXS 1;  2RS1 3;  3GHN A;  4L99 A;  5ACA 2;  1UL9 A;  3C2U A;  2YHJ A;  2OPW A;  2WZR 3;  1UZV A;  3FE5 A;  1PZ8 A;  3ES1 A;  3ACI A;  4K20 A;  3KV6 A;  3BKZ A;  3KHC A;  2ET1 A;  3OPZ A;  2Z69 A;  1RUD 3;  3M3Q A;  1G9A A;  1X33 A;  2CDO A;  2IXI A;  3HBZ A;  4QXH A;  5AVP A;  3WNX A;  4CDQ C;  5CG9 A;  5AC9 3;  1SG3 A;  1O3S A;  1QJY 3;  2W87 A;  4XW3 A;  1DGW X;  3HN3 A;  4M4P A;  5T52 A;  3A23 A;  5A3L A;  4OUM A;  3ZFG C;  1GKB A;  5BNO B;  4QT6 A;  4HKO A;  1NLQ A;  4BK4 A;  1VJ2 A;  1RUF 2;  2WLQ A;  3VB9 A;  1QQP 3;  4O61 A;  3PME A;  5FZO A;  1ODN A;  4IND A;  1JYI A;  3I2K A;  4CCM A;  5JDB A;  2K0G A;  2A6W A;  1NUK A;  2QQW A;  3LAG A;  4P9J A;  1XJA A;  1QHD A;  3T3Y A;  1GOH A;  4ONU A;  1RUI 2;  1RHI 2;  4NPR A;  1WMX A;  4I02 A;  4Q5O A;  4IEV A;  5FZ7 A;  4QXK A;  1AR8 2;  4N90 A;  2KA3 A;  3S5A A;  4EN6 B;  3ASI A;  1W8U A;  1SPP B;  2H6B A;  3TBD A;  5FJH A;  4BQ2 A;  2RMU 2;  1ZRC A;  1V6L A;  2HWC 1;  4S2H A;  4UF0 A;  4UWD A;  1FMD 1;  1Z7S 2;  5C4W A;  2RVA A;  3TEX A;  4R9D A;  4E27 A;  1G9F A;  2HEY F;  3NL1 A;  5L7O A;  2LRO A;  2BYV E;  4JV4 A;  4E4H A;  4IE7 A;  1LOF A;  1QXP A;  4NRM A;  2BGP A;  3D8C A;  3KV4 A;  1CWP A;  3AZZ A;  3OGR A;  3VZK A;  1VPH A;  1SLT A;  3DXU A;  1GNH A;  2QQP A;  2D3R A;  3SEP A;  4A3X A;  2XWJ B;  5IAT A;  4UXA A;  4P9W A;  5K4L A;  2W95 A;  3WX5 A;  3FMG A;  3PTY A;  4PQ9 A;  4OI4 A;  3T2P A;  2ZS6 B;  3U37 A;  1YIF A;  4Y4R A;  2B42 B;  3B01 A;  2WAO A;  4QPY A;  3UV9 A;  4P9G A;  1X50 A;  3UK9 A;  5LZ6 A;  4OI1 A;  3BB6 A;  2VMG A;  4WM8 C;  3VHO A;  4LBM A;  3B9C A;  3GHM A;  3POY A;  2HKX A;  1V70 A;  1UZZ A;  2JIC A;  3MV0 1;  1G8W A;  1WKY A;  3PDQ A;  4RS5 C;  3LDB A;  3LOB A;  4IEQ A;  3WDV A;  1NQJ A;  3G6J B;  4BWO A;  4CDX B;  4V2W A;  3I3B A;  4JGZ B;  1MZ6 A;  3T30 A;  2W1Q A;  3SIS A;  2R06 3;  1HRV 1;  4FP2 A;  2GC3 A;  4FQ4 A;  4MVT A;  4JVA A;  2XHK A;  2BVB A;  1IPK A;  1VBC 2;  3LWC A;  2I45 A;  2FMY A;  2VZO A;  4COW A;  2ERF A;  2TNF A;  2WS9 3;  1WCS A;  4D3W A;  1EV1 1;  3U1X A;  1KJR A;  2A1X A;  5BNO A;  1SLA A;  4E4Z A;  1VBE 1;  5H9Q A;  4M0H A;  2WKK A;  5GZF A;  2D98 A;  5DUV A;  3ZFF B;  2X5I B;  2A6V A;  3ZXD A;  4IE6 A;  2UY9 A;  5GZG A;  1XXN A;  2NQY A;  3LGR A;  4R9B A;  4GZ9 A;  4K3U A;  4IGQ A;  1S2B A;  1UZY A;  3GBG A;  4L97 A;  3H42 B;  4UW5 A;  4K1Y A;  3O0W A;  2MEV 2;  4BU2 A;  5BNP B;  3LOI A;  4CDU B;  3WQ0 A;  4GQ7 A;  5F39 A;  2VME A;  2ZEZ A;  1VBA 3;  5I93 A;  2R1D A;  2W3J A;  1VRH 1;  5A32 B;  5HXM A;  3UL2 A;  2JDM A;  5FY7 A;  3E6B A;  5CFC B;  4JC1 A;  4CCD A;  2FDG A;  1D4M 2;  1IGO A;  5I0S A;  1DQ2 A;  1DQ4 A;  1HN1 A;  3GF6 A;  4QPI B;  1O5U A;  2DCK A;  5F3E A;  5CKN A;  3DKQ A;  1YNA A;  4DIQ A;  1CPN A;  2JEM A;  1CIY A;  4FFF A;  4Q2F A;  4Q4X 1;  2CWM A;  1GWM A;  4BPZ A;  5C9A C;  4L2N A;  4Y22 B;  2JDY A;  2P3Y A;  1VAV A;  3ACL A;  1AR6 1;  4D69 A;  1UIJ A;  2JKB A;  4UT5 A;  4URA A;  5BNQ A;  2XVG A;  2E7A A;  2ZZJ A;  4KBZ A;  3TEZ A;  5J7M A;  3D3A A;  5T55 A;  4DEV A;  4D94 A;  1UNB A;  2W46 A;  4AQ2 A;  4FTS A;  2GSY A;  2VUC A;  4LEJ A;  2QQJ A;  4W8J A;  5M0T A;  2UWB A;  3P6B A;  4Y5T A;  1U5Y A;  5A1A A;  1JHJ A;  4JCK A;  1BEV 3;  1R09 3;  1VBD 2;  5DPN A;  1MEC 3;  5C4W C;  4CCK A;  3KF3 A;  3LKJ A;  4XUO A;  5L7O C;  4QB1 A;  2EIC A;  2FCT A;  2F4L A;  3AFK A;  3BI3 A;  3HQU A;  1NZC A;  2J1E A;  1LHU A;  3WD5 A;  1VBB 3;  4BJ0 A;  4Z1V A;  1W28 A;  4XXA A;  4BZ4 A;  3WG2 A;  3FN9 A;  1ULC A;  2E7Q A;  4QKF A;  4AFC A;  3RZZ A;  2NM1 A;  5CA6 A;  2VZV A;  1C5I A;  3E6D A;  4V2V A;  1QF3 A;  3CKH A;  2X5I A;  4UI9 L;  4XDP A;  1U5Z A;  1G7Y A;  5FMD A;  2OXB A;  3LSD A;  1QEX A;  3WUC A;  5A3T A;  4XIO A;  1JZ3 A;  2BFU S;  5FXX A;  3FFQ A;  1QJE A;  3ILN A;  1PGL 1;  2YY1 A;  2Y6G A;  1AR7 3;  1QH6 A;  3OUH A;  3RNS A;  1YQ8 A;  3OBR A;  5BNP A;  1YI7 A;  4BLJ A;  1APN A;  2VTX A;  1W8T A;  3GCX A;  3FUO A;  5C8W A;  2WZP P;  3MEP A;  3HAG A;  1RUG 2;  1UKG A;  4AHY A;  5A3U A;  4BE3 A;  5FZ4 A;  2HWB 3;  1PIV 1;  5A32 A;  2VXR A;  3APB A;  5CFC A;  2RS3 2;  4Q27 A;  3H50 A;  2VW1 A;  4XFH A;  5T3N A;  4FT8 A;  4Q4Y 3;  4X8N A;  5FPA A;  5IFT A;  3E5Q A;  3KMH A;  2JE7 A;  3WDU A;  2R0F A;  5J96 B;  4QPI A;  4XUP A;  1RUC 3;  3V0B B;  2VOT A;  1NG0 A;  5EYX A;  4Y1X A;  3THT A;  2ZKN A;  5BNO C;  4OZX A;  3PVE A;  1GZT A;  1TVG A;  5C3R A;  5I8Y A;  4BQ3 A;  3O1U A;  5FP7 A;  1ZBA 2;  2ZGS A;  3MLK A;  4FPF A;  4Y22 A;  4XQW A;  2GZW A;  1C4R A;  1P8J A;  3TN9 2;  4M3C E;  1B35 B;  4UW4 A;  1UOB A;  1Y9M A;  4IER A;  4CYD A;  2JD9 A;  3HIF A;  1W6N B;  1RUH 3;  3U78 A;  1AZD A;  4BA6 A;  5I0T A;  4ISR A;  2XB6 C;  1JYN A;  4FPJ A;  1OBN A;  3UJQ A;  4LO6 B;  1O3T A;  5KR7 A;  1ZRD A;  3K48 A;  4HMZ A;  3MW4 A;  5FZI A;  3T0B A;  1UU4 A;  4YW4 A;  4J25 A;  1FYU A;  4KGQ A;  2AEN A;  3ZFE B;  3INA A;  3VUO A;  3UGH A;  2DFB A;  1HRI 1;  2Y0O A;  2V09 A;  3RZK A;  1J3P A;  4I0A A;  2E6V A;  3EQE A;  3H7J A;  2R04 3;  5CEH A;  1A8M A;  5DDJ 2;  4IEW A;  4ZZ5 A;  2QQO A;  1WD3 A;  2WT0 A;  3KS7 A;  4AW7 A;  4QQ2 A;  1W0O A;  4NE9 A;  4YZ4 A;  4FXK B;  5T5L A;  1UO9 A;  4YW7 A;  3NNL A;  4WVM A;  3AZV A;  4KBB A;  5FZM A;  5JZG B;  1VMF A;  3WVJ A;  4LKS A;  3ZSE A;  3ZKU A;  3OUI A;  3O0X A;  5FBJ A;  2J1V A;  1AR9 2;  3JBG 1;  3OF1 A;  4Q4W 2;  2VZQ A;  5DZG A;  3VZN A;  1AF9 A;  5A1F A;  3BTA A;  3JXS A;  4O9G A;  4AR2 A;  4M3C F;  1JYV A;  3IDC B;  4AHZ A;  4A45 A;  3TOJ A;  4A6O A;  3ZSM A;  5LA9 A;  4LIU A;  1FXZ A;  3VV1 A;  2WFF 2;  3KF5 A;  5C8C B;  3GGL A;  4Q26 A;  1TQ5 A;  5IVY A;  5IT6 A;  2WQ8 A;  2JEC A;  4OUS A;  1AJK A;  1SFN A;  1JYW A;  4FOY A;  4B1L A;  2JDN A;  2YC4 A;  4CDX C;  1UYY A;  1BMV 1;  4WZC A;  1POV 0;  5D1I A;  2P2K A;  3RVH A;  4JGZ C;  4LPL A;  4XJU A;  3UKT A;  1C8M 1;  4I0W B;  5LEJ A;  1IPS A;  2DBI A;  4BDV B;  2VTF A;  3J7M A;  4OVE A;  3LSE A;  1BBT 2;  3FHI B;  2XPJ A;  2BGC A;  5ERL A;  3ZYR A;  4DRV A;  1XND A;  1W39 A;  4RGK A;  4E9K A;  1X7N A; 
#chains in the Genus database with same CATH homology
 1JOD A;  1JYT A;  1JOB A;  1ZRI A;  1F35 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...