4CUBA

Unravelling the multiple functions of the architecturally intricate streptococcus pneumoniae beta-galactosidase, bgaa
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
179
structure length
179
Chain Sequence
QGANISDQWTGSELPLAFASDSNPSDPVSNVNDKLISYNNQPANRWTNWNRSNPEASVGVLFGDSGILSKRSVDNLSVGFHEDHGVGAPKSYVIEYYVGKTVPTAPKNPSFVGNEDHVFNDSANWKPVTNLKAPAQLKAGEMNHFSFDKVETYAIRIRMVKADNKRGTSITEVQIFAKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords BETA-GALACTOSIDASE
publication title Unravelling the Multiple Functions of the Architecturally Intricate Streptococcus Pneumoniae Beta-Galactosidase, Bgaa.
pubmed doi rcsb
source organism Streptococcus pneumoniae
total genus 41
structure length 179
sequence length 179
chains with identical sequence B
ec nomenclature ec 3.2.1.23: Beta-galactosidase.
pdb deposition date 2014-03-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4cubA00
3NRUA 3DYOA 4ARYA 2YFZA 4A3ZA 3J7HA 3WNPA 4LKSA 4MO3M 1JU3A 1GUIA 2VC9A 3I2FA 1HN1A 3CIHA 2XQXA 2WAOA 2VZSA 3WNKA 4QB2A 4KI5M 3LPGA 2ORZA 3A21A 2V4VA 3C7GA 2VMFA 1TG7A 4XUTA 4A44A 3IIIA 3IDAA 4MOAA 3JXSA 4XUNA 3WF2A 1EUTA 2ZEYA 2QQJA 3LEKA 4ZZ5A 1UWWA 3CMGA 2XHNA 2VMCA 1UY4A 3ECQA 4TXWA 3T0DA 3T0AA 3C7HA 1H6YA 2QBXA 1DLCA 2RJ2A 5G04L 1CIYA 2JE8A 3W5MA 3ACIA 3BGAA 3OBAA 3T2PA 2Y8KA 1I5PA 4JKMA 4TTGA 3C7EA 3OGRA 4DUXA 2Y64A 3LE0A 4UAPA 2W1QA 1JU4A 2XONA 4LPLA 1XPWA 3E1F1 4A41A 2E33A 1UYYA 4QDRA 4QX2A 4ARXA 3CZUA 4DUWA 2YFUA 5CYYA 3NNGA 1UY3A 3A22A 3FHQA 2J1EA 1KEXA 1UXXX 2B9VA 3CZJA 3ETPA 2J22A 3D3AA 1GOFA 1CX1A 2W5FA 4P08A 1O8PA 1D7PM 4A6OA 1CZTA 1GOGA 4BK4A 3I2KA 1RYYA 1TVGA 2VZTA 5JXGA 2VOTA 5LCWL 4QX1A 3FN9A 1JI6A 2J1TA 1UYXA 2DDUA 1W8NA 1KGYA 3A7QA 4QB6A 2VZVA 2DCJA 5EJZB 2W1SA 2WDBA 3T2QA 4JX0A 1WCQA 4BXSV 2J1VA 2X09A 5FUIA 2VL4A 3HJRA 3VD3A 3F2ZA 2W94A 2VZ3A 1J84A 4XURA 2ID4A 5B4XA 2EIEA 5DPNA 3OGVA 4BK5A 2KD7A 5JUVA 3GDBA 1P8JA 2WABA 5DQ0A 3DECA 4LQRA 4ZY9A 3T09A 2W46A 5IFTA 2R7EB 3VD9A 2V72A 4GZ9A 3UESA 1UMHA 2VCBA 4KWUA 3VD4A 5JR2A 4RN5A 3I3BA 5LA2A 3BN6A 2E26A 1JZ5A 3OGSA 2VMEA 2Y6HA 1W8OA 4DUVA 1NAEA 1JZ7A 3VDCA 3WF0A 5C70A 1XNTA 5J1XA 3FL7A 4CU8A 4DXRA 2WZ8A 2QQIA 2L9LA 2DCKA 3CQOA 2VTFA 3OEAA 3ACHA 1NX9A 1JYNA 5DN2A 3HNYM 1H6XA 4OMDA 4LHSA 3DYPA 1J83A 3K75B 4QX0A 2JKXA 4W8JA 3UETA 3HEIA 2LW8A 5IHRA 2VM9A 3MO4A 3SEPA 4P5YA 1OD3A 4E8CA 2BZDA 2E32A 2WBKA 3I3EA 4DXSA 1LNSA 3HPNA 4CVUA 1CZVA 4HG6B 1UXZA 4DEQA 4CUCA 2YB7A 3I2IA 2WYSA 1US2A 4M4RA 4XZUG 4P02B 2QQNA 1UYZA 4OMCA 4IUGA 3VDAA 3C8XA 4D8MA 1O59A 1JYWA 4GWJA 1IQDC 2VR4A 3C7FA 4P00B 3IB3A 3WNOA 3IAQA 1T2XA 5EJ1B 1WKYA 2BERA 3MV11 2E31A 3PUIA 1K3IA 3HNMA 2CDOA 4YPJA 1SG3A 4W50A 1L7RA 1OF3A 4QDSA 5JXHA 3UNPA 2CDPA 4BDVB 3WQBA 2W1UA 1NKGA 3ACFA 2WO3A 2YC2A 4DEVA 1W99A 3P1IA 5HXMA 4QAWA 1K12A 2W47A 4QX3A 1XC6A 4DXTA 1PMJX 5HPOA 3P6BA 1OF4A 2WO1A 3LPFA 2QQMA 2W1WA 3MV01 3DYMA 3WSOA 3SEEA 1ULOA 3NJVA 4PQQA 3CDZB 3WF4A 3WNLA 4MGQA 5G05L 1GU3A 2WQ8A 3MUZ1 2J1SA 2OKXA 2VZQA 2W91A 1F4HA 2C26A 3VDBA 2HYXA 2EICA 2WN2A 1UZ0A 2BBAA 2JD9A 4CUAA 1PX4A 1JZ3A 2WAAA 3THCA 4KMQA 2EIBA 3VD5A 3WNNA 3VD7A 3IAPA 2J1AA 3C7OA 4OUEA 1R64A 5A1AA 2WZEA 4QPWA 4ZXEA 2Y6GA 5IJRA 1W0NA 1JZ6A 1BHGA 4XUPA 2VZUA 1W9SA 1PMHX 3GM8A 2YC4A 4QDQA 3SKVA 2JDAA 4UOJA 5DMYA 1UY2A 3K77A 4W4ZA 4CU7A 2ZEZA 2VZ1A 4PT6A 3FHAA 2VCCA 3EB7A 2LS6A 2QQLA 2YG0A 2VCAA 3WNMA 4XUOA 2X10A 2B4KA 1OH4A 4JKKA 2W92A 5C7GA 3I2GA 2VZPA 3AC0A 3LEIA 2RV9A 4CUBA 3MBWA 3I2HA 4ZZ8A 1F4AA 1SDDB 5IYYA 3NJXA 3EYPA 4A4AA 3K46A 1EUUA 4CU9A 2X05A 1K42A 1NUKA 3I97A 5LA0A 2QQOA 3LQCA 2Y6LA 5EIYB 1JZ8A 1JZ4A 3W5NA 4UI9L 3WF1A 2WO2A 5CZKA 1JZ2A 5JMOA 2XOMA 1W9WA 3U37A 3I3DA 5LA1A 3T08A 4AAXA 2C4XA 2ZXQA 1DP0A 1GNYA 2BGOA 3ABZA 3GXUA 5JXIA 3HN3A 1US3A 2J1RA 5I0DA 2WN3A 2Y6KA 2ZEXA 3T2OA 2RVAA 1GMMA 1SHWB 1XNAA 4L0PA 2QQKA 4A45A 3ZM8A 3SKJE 2VQTA 1ULPA 2VMDA 3THDA 1MPXA 1JYXA 2ORXA 3HNBM 3I2JA 3HOBA 3ACGA 3GGLA 3K4AA 1GOHA 2VQUA 4MADA 1UY0A 1L7QA 2W9XA 3K4DA 1OT5A 4Z2AA 3CKHA 5IFPA 2HLEA 3A23A 4CU6A 4E8DA 4OYUA 1DYOA 5C71A 2BGPA 4AG4A 4XUQA 2C9KA 2J1UA 4MGSA 1W9TA 3OEBA 3MUY1 5B4NA 2VJXA 3PUHA 2W3JA 1CZSA 2V5DA 3LEGA 2VZOA 4D0QA 4OZOA 1O8SA 1JYVA 2PQSA 4GWIA 1JHJA 3K4ZA 1UX7A 2Z4FA 4PF1A 5F7UA 3OG2A 2EIDA 5JXJA 4QB1A 4RYDA 4JKLA 1K45A 3WF3A 1UMIA 2WUHA 3NQHA 4BJ0A 1YQ2A 2J7MA 2VZRA 4M4PA 4ET7A 4JHZA 1GQPA 4XVHA 2W87A 2W95A 2Y6JA 4FI9A 3T0BA 2VO5A 4A42A 3OB8A 1UY1A 3WEZA 1PX3A 2ZEWA
chains in the Genus database with same CATH superfamily
4FPOB 4JAAA 4CEYA 2XUMA 4QKFA 3J7HA 4EWDA 3WNPA 1SFYA 4MO3M 4B29A 3O1RA 5F3CA 2XLGA 4FSJA 3AP9A 1ZM1A 1OLMA 3AX4A 1HN1A 4LHNA 5L7OC 1R1A3 4WVZA 5LRSA 2VZSA 2Q30A 4P5HA 1Z78A 4XBQA 3WNKA 4QB2A 2EVXA 4LBQD 4GWMA 1YI9A 4YM2A 1BVP1 4KI5M 1WCSA 4M01A 1S0GA 2ZGPA 4NRPA 1TG7A 4XUTA 2ZGLA 3PMEA 3I49A 2H0BA 1GR3A 3ACLA 1SBFA 4W6XA 4CDWB 4OCTA 5K8SA 4ZU7A 1H4GA 2WZR3 2VVFA 2ZGQA 4N7IA 1AXYA 3ZSEA 2E6VA 4NIAA 4UFKA 4WM7B 1RJ7A 3N7LA 3AL5A 1JYTA 1F9KA 4UYBA 3AKTA 5KWRA 3H8XA 3DPRC 4YVSA 2Q0AA 1W04A 3GHNA 4ZZ5A 2AENA 1S0CA 1RUF3 3GZEA 5CFDB 5FZBA 1UY4A 5LW9A 1NY71 1EV11 2DCZA 1QGLA 3AMQA 4TXWA 1HJGA 4YFWA 3T0AA 3V65A 1XE8A 2CWMA 4BIOA 2GC1A 2QFEA 3Q8AA 3LDRA 5FUPA 3Q8FA 2XPJA 4MGKE 5FOJB 1QDCA 5C9AB 4AEKA 1B35C 4FOYA 3DN7A 4B1LA 1AXKA 1I9RA 4AVVA 1KJLA 1W8HA 2WC2A 1AL21 3CL1A 3FFZA 1C5IA 4WV8A 1D2QA 4XCAA 1Z7S2 3PVNA 1MZFA 2KXLA 4UAPA 5C8CC 5K7PA 4RS5C 2W1QA 3PDQA 3OYWB 4HANA 1YEWA 3FZ3A 5C5UA 3TN92 4CXYA 4JGYC 3NSTA 4A41A 1V70A 2JDZA 4HKWA 1UYYA 2DCYA 2ZHLA 4QX2A 4DUWA 1TNFA 3GCXA 4K8FA 5FZ8A 4CEYC 1Y9QA 4H55A 3NWKA 4R9AA 1UY3A 1ZA7A 5FUNA 3WG4A 2ZZJA 3LFMA 2NM1A 1WMXA 1O3SA 1ULFA 3FLRA 1DGRA 5EWSA 3D3AA 3B69A 4CCEA 1CX1A 2WWSA 4OZXA 3CLPA 4Q4X3 1AYN2 4PLOA 1C1LA 4BK4A 3I2KA 1JH5A 1YNAA 2VOTA 2VZTA 1LULA 5JXGA 1DF0A 4QX1A 2O0OA 1IPSA 1POV0 4CDQB 2FZ2A 3FLTA 3ITQA 2QZ3A 1W8NA 1KGYA 1KDMA 5HBAA 5F3EA 1RUI3 1BMV1 4CSWA 2VVEA 3J8F3 1WCQA 4FFGA 1FI2A 4H2AA 4JX0A 2J1VA 2DVFA 1RUH2 4HPKB 4CP0A 5FPXA 3IKWA 3EO6A 1U0AA 2JENA 2Y0OA 1QJFA 4HK9A 5LEJA 3F2ZA 1PM7A 1U5ZA 2PYTA 1DYKA 1W2OA 3PURA 2HWD3 2VOXA 2YBKA 4P9WA 4W6WA 4XURA 1CQ9A 4YVSC 5FQ0B 2X53S 5FO7B 4AEDA 2FDFA 2OZJA 1C57A 3OGVA 2KD7A 4MZUA 3NV3A 2WABA 1HRV3 4FBFA 1REDA 4CCMA 1XB9A 2EA7A 1EAH2 3VBFC 2W46A 1ND2A 1QQP2 1J1TA 5GM0A 4GZ9A 3OTFA 2XBO3 2DUOA 3D6EA 4E4ZA 3WDYA 3OGGA 3JBG2 4IETA 5LA2A 1LKNA 1QJU3 2CU5A 3LIGA 4LBQA 2E26A 4MXWB 4Q0SA 4GB33 3WDUA 2JG9A 3KSCA 2ZAHA 1NZCA 1AR81 1IS5A 3EBRA 3L2HA 3A4UA 3MIBA 3TNQA 1IKPA 3ZXKA 5L7OB 3H8RA 5J1XA 3P3PA 4CP9A 2WA3A 4DXRA 1PVC1 4IEZA 2QQIA 1XNCA 3PIJA 2DCKA 3PUSA 3LDKA 3RRDA 2LUWA 5FZ3A 5C3QA 3QOPA 1I5ZA 3VHPA 2PHFA 4ZS2A 4AR2A 2IXKA 3SMHA 2ZGTA 4LLOA 2R043 2X5IA 1BYHA 4LHSA 3SITA 5FXWA 2HWB2 2RS12 1UCXA 1CAVB 1CIWA 5JI9A 4QX0A 3K75B 2JKXA 4XDOA 4CRQA 2WNUA 1JYCA 4JRAA 1JS9A 3HEIA 5GLTA 5A7WB 3UT0A 4DS0A 1EY2A 1YJLA 2D6PA 3M3EA 4XDPA 3ZSKA 1GNZA 2AYHA 3ETQA 3DPRB 3PTRB 3AJYA 3S5AA 4ASKA 2XHKA 3GBWA 4NMIA 4HG6B 1VBB2 5JDBA 3ST7A 1KFXL 1K5MA 2G1MA 2GH2A 3I2IA 4PIZA 1RUD2 3DKQA 4XC9A 4DIQA 4XZUG 1W05A 3I4IA 4IL7A 3UK9A 3U0ZA 4Q4Y1 2WS93 4WBBA 1B35B 4AEDC 4QHOA 4IUGA 2WSUA 4OULA 3ZXAC 2Z42A 4IQPA 3J7MA 3VDDB 4D8MA 3BIEA 1BBT2 1WA4A 1ZBA2 3BVCA 2CGPA 5A32B 4BHPA 2HEVF 3IB3A 5A7QA 1E5IA 1LOGA 3T2TA 4JDNA 3RWKX 1FV2A 5ERLA 2DF7A 4BYYA 4GJYA 1ND2C 3UV9A 2E31A 2LM3A 5BUVA 2E9QA 3DXTA 3HNMA 1W2UA 4JGYB 4NE9A 5FPAA 1KFUL 3GCWA 4AI2A 2LALA 4CEYB 2Y6FA 4F7ZA 3POWA 1L7RA 1OF3A 1X36A 5FY1A 2JG9C 3CBNA 1TMF1 4G9SB 5FMOS 2JWPA 1RXFA 5KC6A 2MPFA 1RGSA 5A3PA 1W6PA 2WO3A 4OVEA 1RC6A 4PBPA 4C0BA 3WY6A 1W99A 4QQHA 3Q8BA 2RS53 1SPPA 3GZTB 3RMYA 1UQXA 4BWOA 5FXVA 1FNYA 3OY8A 4ZXKA 2QQMA 4K20A 2W1WA 3MV01 3DYMA 2WT0A 1ULOA 4L97A 3ILRA 2D6OX 2X5IC 1REFA 1MEC3 3EMRA 2P1BA 3VKMA 4RA0A 3UGGA 4S2GA 3V0BB 1GFF2 1HB2A 3N9LA 4MGQA 1CWPA 4LO8A 3TEWA 3K3OA 5BNOB 5KBFA 2WNUC 1J3QA 3LAGA 4IV3A 5I8TA 4RQPB 4Q0PA 3FE5A 5CNAA 1W06A 3R0RA 2A6VA 2G19A 2C26A 4W6YA 2DFBA 1JTZX 4YVSB 5FYUA 4AYUA 1LESA 4TZDA 3N9NA 1YFXA 3U11A 5HCFA 2TEPA 4CUAA 1PX4A 1CAWA 4EWEA 4META 4DMIA 2VPVA 1OA3A 3IN9A 3LFIA 4XAEA 5J09A 1DDLA 4IE7A 1K5MC 2PAMA 4KMQA 3VD5A 4DNYA 5J7MA 1BEV3 2J1AA 5BNNB 1DHKB 5M0TA 3IT8A 2PN5A 3VBFB 3O1VA 1R64A 5LB6A 1AL0G 1Q8OA 2WZEA 3T4VA 1NE6A 3K51A 1ASJ3 4R4ZA 1LOEA 2VTXA 3ASIA 1BHGA 1FOD2 1SLTA 1YQ5A 1CESA 2VGDA 2VTXJ 1PMHX 4GJZA 5E88A 2NYYA 2JB8A 4OUSA 3SKVA 5FKBA 2UYBA 4XHBA 1COV1 5FZFA 5FZDA 1SBDA 5DMYA 3ON7A 1WLDA 1AYM2 1LEMA 1OA2A 1VP6A 4AVTA 3K77A 4MYEA 2B8MA 1XSRA 2GN7A 2MEV2 3MHZA 4NVPA 2A1XA 4ORFA 4AGVA 1PMIA 4XF1A 1W3XA 2BWAA 2IFRA 1VRH1 2FDGA 3C2UA 1CVNA 5FY7A 2VCAA 3WNMA 1HJFA 2SBAA 2W52A 1G86A 2X10A 5E6HA 5EV7A 3W59A 1CAXA 4CXXA 3MFCA 4IEOA 4FAGA 2GALA 4CUBA 3N7KA 4XIOA 2VBBA 2ZMKA 3POIA 4EJRA 1F5JA 2D40A 1H9PA 4LBKA 2CY6A 2AR6A 3ZYRA 4C1XA 1NZIA 5SV5A 2JD4A 1F4AA 1D4M2 1Z7S1 1PNFA 1VAMA 3AFKA 3EYPA 3BTXA 1HDKA 2UWBA 1HQWA 2ZX4A 4LA2A 5ABJA 5LA0A 1YWKA 2C24A 4ASMB 5C3OA 5IVVA 2Y6LA 3S0MA 1GICA 3W9AA 4CCDA 1VBC3 2P6HA 5KHJA 4YG3A 4Q4V1 3WF1A 2VQAA 3AM2A 5IW0A 4YW1A 1XYPA 3INAA 3KMHA 3ROUA 4AI1A 2GNMA 4AHZA 5C3PA 1S1AA 5LA1A 2WWUA 4IEVA 3RQ0A 2ATFA 3D0SA 3IMMA 4AEDB 3MIGA 4Y3OA 4D69A 1GNYA 2BGOA 2HJIA 2ZX2A 3HAGA 2DFCA 2VW2A 4W65A 5BNPA 4ZONA 4YRDA 5K0UA 4C0HA 3BU7A 1WBLA 5JOXA 2J1RA 2RMU3 4Q0VA 5I0DA 2BQPA 2ARXA 2DCTA 3WX5A 4PI0A 1NYWA 4BXFA 2WNEA 1ND2B 2ZEXA 2Q1FA 5APAA 5A6YA 2I45A 4LULA 4UFMA 1SHWB 2ERFA 4L0PA 1W9FA 1RUH1 3O0VA 2VQTA 3PNAA 4Q29A 4YW7A 1NA1A 4JGZA 4LBQB 2ZKLA 3KHCA 1MPXA 1JYXA 1W8FA 2CTVA 3I2JA 3W21A 3HOBA 4KWJA 2ZHMA 1ST8A 2YZ4A 2PAEA 2QDRA 1NQDA 3JQWA 3GGLA 1UY0A 4XJ8A 4YVWA 1AX0A 2UY8A 3U07A 4BU2A 3K4DA 2ZCWA 3LA3A 1ND3A 1YYNA 2Q8CA 1I6XA 2VNRA 3UL2A 2HLEA 4I2OA 3FWEA 4E8DA 3H7YA 4PLNA 1EAH1 4LK6A 1AVBA 1QQP1 1EV12 1VE0A 4MXVA 1OLRA 4UXAA 5C71A 1WCKA 4KH9A 2R072 3EXUA 2X5IB 1QMJA 2JG8C 2RDQA 4XFCA 4E2GA 5CEHA 1SLLA 3JBG1 5HCBA 1WGPA 3MUY1 1CX4A 1MS8A 2Y0IA 2VJXA 4YZ2A 2E7TA 2Q1MA 2W3JA 2CAUA 2WFF3 3LIHA 3NV2A 2A75A 2VG9A 3OBRA 1TMF3 4O65A 1WLTA 2CGNA 3I3QA 4P9LA 3A0NA 1YI7A 5EYXA 5FZKA 3TOJA 2AUYA 1AL22 4IE6A 4QKNA 1U5YA 5FLHA 3WG1A 4AHXA 2BNNA 3O1SA 1HQLA 4GWIA 2JDHA 1AX2A 4R52A 3ZPYA 2NMOA 2R1BA 1K5MB 4IE0A 4XE9A 4XBLA 4PF1A 2P17A 2QQVA 1G8WA 3OG2A 4XJUA 4UBGA 4QB1A 2HWB1 4E4HA 2RS11 5DDJ2 3K2OA 3WF3A 1ZZ8A 1MVEA 1FAYA 4KQ7A 3MIEA 1OHFA 2OQ6A 4PCRA 3H1YA 2BDRA 4CEWB 4WVWA 4AK3A 3DEMA 4RD7A 1YXWA 2P37A 5BNPC 1OQDA 4FOVA 5K0UC 3SC7X 5GKAC 1MACA 2V09A 4QGLA 3NW4A 3P3NA 4FI9A 4FPJA 3UGHA 4AZZA 3RZJA 5FY9A 4NIHA 3KV9A 1A34A 2YUEA 2R49A 2X29A 4LUMA 2CNAA 4NOTA 3OB8A 4QHBA 1RITA 3A0KA 3RSJA 3ZYJB 1PX3A 4PDWA 4UFLA 4AXOA 4M3CF 3GHMA 4I0AA 5ISLA 1UPIA 1BMV2 1NA1C 4JGZC 1MS0A 4ONUA 4A3ZA 4GKYA 5FMBA 1IKQA 1JU3A 4J1WA 3HIFA 4L99A 1BBT1 1ZBA1 1PO21 3CIHA 4XQ4A 3R6SA 2WAOA 4HSLA 5LBEA 4COWA 4YVWC 1UNBA 3U4XA 3AP7A 2CWSA 1ND3C 4EE2A 1S2BA 4GD4A 4LOTA 1SPPB 4IESA 4XQDA 2OYZA 3ZFEA 2C9AA 2UYAA 1WBFA 3OY8B 2HEYF 3N7MA 4A7YA 2K0GA 3IIAA 5FMDA 4MG2A 3AL6A 1OLQA 4OLLA 5T54A 3IIIA 4D6SA 1OKQA 1XNKA 4QD2A 3H9AA 2IUWA 4CYDA 4YW6A 2FQPA 2PELA 3MFAA 4WVVA 4MOAA 4URAA 3ZDVA 4XFGA 1QJY2 4U2AA 2R1DA 1UYPA 2Z5WA 1AR92 5FYVA 1ENQA 5LK5A 2A6ZA 3U10A 2RDRA 1EUTA 2Q8EA 2RJKA 1A78A 1N47A 2QUOA 4AE2A 5BYNA 4AFCA 1G9DA 4XFBA 3ZMNA 2OPKA 2PA7A 1AR82 1CAWB 4YSFA 5GLUA 1Z7S3 1QNWA 1VRBA 4AVCA 1UWWA 2QKDA 5E89A 1CPMA 1NOVA 2XHNA 4I30A 1YC61 4CCOA 4BQ1A 3ECQA 4HN1A 4EN9B 3WDXA 1G6NA 1G9FA 5FZ7A 1PVC2 4J6GA 3TN93 3ZFFB 2ZGUA 4KL1A 3VL8A 4C90A 4EWAA 2VAUA 1LOCA 5G04L 1NLQA 2YGLA 3E6BA 2F4LA 3GNEA 4MHRA 3RFRA 4E4SA 4S2HA 3B94A 4AW7A 1LOFA 2XXZA 3AZVA 5FZLA 1Y43B 1SQ4A 3KT1A 1Z0HA 1R083 2QQUA 1W6MA 2BOIA 2P34A 1LGCA 5FTTC 4YG0A 1RUJ2 4DRRA 3N36A 1C1FA 3H8UA 4K40A 1AYN3 3RYRA 3HBKA 2EXHA 4ZKTB 1H9WA 5GALA 2XG3A 1TE1B 2D93A 3LE0A 3E6DA 2F4PA 2ILMA 4M00A 1JU4A 1TME3 4C1WA 2NMNA 1RUC1 4LHLA 4PDWC 4LKDA 1XPWA 2E33A 2VE1A 3I59B 4ARXA 3WDVA 2B46X 4XYXA 1OVSA 5FAXA 1SCRA 1CAXB 1RUH3 2JG8B 1T6GC 3A22A 3JD72 3SCGA 1OMIA 5KXCA 2JKBA 2D3RA 4GAZA 1FOD1 1IQAA 4XPVA 3FHQA 2OW4A 1UIJA 3J26N 4Y20A 5E8AA 3H3ZA 2D97A 5FZOB 5A7NA 5DZFA 2J22A 1MQTB 4DY3A 1GOFA 4Q1PA 4P08A 1D7PM 3M3IA 1CZTA 4COYA 1GV9A 1AYM1 4DINB 2YGMA 5FCCA 3ZFEC 1RYYA 2AH2A 1F5FA 4FTEA 3FN9A 3SHRA 4LIVA 2DDUA 2EAKA 4XETA 4NRQA 4AQ6A 1J1LA 2E7QA 4QB6A 5HCHA 1EAH3 1ZX5A 2D6NA 4UF0A 3VBSA 3MEPA 2DWRA 2VZVA 1F2NA 2W1SA 4BXSV 5FXZA 2A5ZA 2QQPA 4ITCA 4BQ5A 3VKNA 4AVAA 2FBEA 3HJRA 3JBG3 5FZ9A 3GF6A 4AFMA 3K48A 1L3JA 2V4AA 3NJYA 2FCUA 2UURA 4E27A 4F83A 3FC0A 4YW3A 3PUQA 2Y34A 4HVRA 2G9ZA 1D4M1 5B4XA 4AAPA 4AOCA 3X29B 3AMNA 5DPNA 5AFEA 4BK5A 5FYZA 3GDBA 3IPVB 2IWGB 2IXLA 3BCWA 5SV8A 3DECA 2CYFA 1R1ZA 4XFIA 1V6NA 3WT3A 1GQGA 1O6UA 1MZEA 3MDPA 2RM21 4JVAA 3QLQA 4QX7A 3JB4C 3U75A 4KU7A 4B4RA 4CDUA 3D0JA 2V72A 1LOFC 3ZFGB 2VCBA 5A33B 2FDKA 3KZ4C 1LEDA 1NA1B 2RS13 1ODNA 2HBTA 2ZX0A 1SLIA 4S2FA 2VBDA 4EN8B 3MLKA 5JR2A 3KQRA 1PNGA 2WLQA 1YFYA 2JX9A 2HWE3 5DG2A 1U12A 4FFIA 2Y6HA 1Q8QA 1J3RA 2YYOA 1NAEA 4SLIA 5LASA 1JZ7A 5EQUA 2XH6A 4YVWB 1RHI1 1ND3B 1BCXA 1KJRA 3P5BA 1CR7A 4BM8A 4CU8A 2UU8A 4DRVA 2GN3A 3VZJA 2R0HA 1BQPA 4KNCA 2L9LA 5T3NA 4RGAA 1VBB3 3MYXA 5C33A 1NX9A 4H7LA 1PK6B 5DUXA 4AI8A 4ASLA 2Z79A 5DN2A 4AVSA 1H6XA 4FPKA 3K3NA 4RGKA 2VU9A 1L7LA 2ZMNA 4K1YA 5F2WA 4IEUA 4ISRA 1RUD3 1UPSA 3LB9A 3OOXA 4IV1A 4AFDA 5JOYA 1KDKA 1ZRIA 2FZ1A 2VNOA 1J83A 1PIV2 4YGCA 1GANA 2OXBA 4LK7A 3N9MA 4DOUA 2VY0A 2VM9A 5IK5A 3THTA 2W08A 1ZBA3 3LSEA 3MO4A 1OD3A 1G9BA 2YU1A 4E8CA 5C4WA 4XBNA 4LR4A 1COV2 2E7AA 4FAHA 1LNSA 3HPNA 1LHOA 2BFUL 1Q8PA 4CVUA 2IVJA 2BPA2 1CZVA 4YNIA 3VBSC 5FKCA 4ATFA 4RL7A 1ACCA 1VRH2 2R071 4QM9A 5F8PA 1TQ5A 3O1UA 2YB7A 1QEXA 1DGWA 5JLVA 3AZYA 1US2A 3POEA 4OI2A 4U36A 4Y1VA 2RS32 1RUE2 1QH7A 2ZACA 4L2NA 2QCSB 2H0VA 2JE9A 2UWAA 4Q0QA 4OMCA 3LZZA 2HEWF 4XABA 2XJRA 3PU3A 3QH6A 4PLMA 1QHDA 4GKXA 3S30A 1O59A 3ZN6A 1JYWA 1QJX1 2GAUA 3WR0A 4QX8A 1IQDC 3AZZA 3KF3A 1NCQB 5DUUA 2A3WA 4LMFA 4N43B 1JYIA 2K2SA 2ZS6B 2PHTA 4ZU4A 1HIXA 1CPNA 5F37A 4HMZA 4K7JA 4PQ9A 1UZWA 1WW6A 3RS6A 5A3UA 3KGZA 1ZRFA 2HWF2 5EHDA 4CDUC 1LB2A 4PDWB 1WW5A 4DXZA 4M0HA 4BPZA 5DDJ1 3JB8A 5C6CA 5IAXA 1SG3A 4Q4V2 4RHV1 3DKWA 3MPBA 3ZXGA 5F6LB 1VALA 1KRIA 3VD4A 3MICA 4GIQA 5F32A 1J3PA 3GJBA 2Q8DA 1X8EA 3ACFA 1B09A 3LF7A 3KWVA 4YZ3A 5HV0A 5E16A 1X82A 3P1IA 4QAWA 5FZHA 2D43A 1NCRB 1EPWA 3ZFEB 3ZSMA 5J98B 3CO2A 1BVVA 5IK8A 2RR12 5E1RA 2PHWA 2VXJA 2WO1A 3LPFA 2ZGMA 3MW3A 4LO4B 4XJ9A 5FDBA 4FTBA 4NUBA 2VECA 1POV1 4FP2A 5FWEA 3WSOA 2NPIA 1UO9A 4K9SA 1OQ1A 3SH3A 5JZGA 4IE5A 3GALA 2D5FA 1A8MA 3LA2A 3S7IA 4AHWA 1OFSA 2LROA 3AKQA 4AGRA 4CCLA 4IV1C 3ZX7A 1XNDA 1GU3A 2A71A 2WQ8A 2A6YA 4CCNA 5LWBA 1EP0A 3MUZ1 5JR7B 1FOD3 2BJSA 2XJSA 1V9U1 4LKFA 5CKMA 3UJOA 5J37A 1E5SA 1JXNA 2YBSA 5LRRA 1UD1A 2DV9A 4QPGA 3VN4A 1ZZ7A 2CHHA 5C4WC 2EXIA 2WN2A 4UFIA 1UN1A 2JD9A 2MEV3 3WDWA 1Q43A 4KGQA 1VMHA 5FRAA 1OC1A 1QDOA 4AHYA 3KCYA 3LKJA 3WNNA 1C3HA 3FFQA 3MIDA 3OBZA 2WT1A 1DGRN 3OD4A 1HLCA 1UKGA 5A1AA 1BZWA 5FPZA 4HKOA 3ZO0B 1I1EA 5FY4A 1RMU1 4CDXA 1QJY1 1UU6A 1O5LA 1JZ6A 2N7GA 3JUUA 1AR91 4D7SA 2VZUA 1YO8A 2BUKA 1UMZA 3GM8A 1IHMA 1STMA 3WLUA 1V6OA 2TUNA 3L9JT 2D7FA 5FYCA 1D4M3 5ACA1 2JDNA 4RFT0 1OQEA 3NNJA 1XYOA 4QQ2A 1MS1A 2PHXA 3RYPA 3TB0A 1Q56A 4Q2FA 1RINA 4LITA 4Q1RA 4RR3A 2NP0A 2QJVA 1VB4A 3MIFA 2D44A 3U1XA 2YG0A 1HXS2 2P5BA 3USUA 4XUOA 4XJWA 5FYHA 3EQEA 3M70A 4PJYA 4MV2A 1OH4A 5C7GA 1JUIA 5L9VA 1QIQA 1ZZBA 3LEIA 4KG8A 1A8DA 4NHXA 4MGTA 4WVMB 2BWCA 4KWKA 1J59A 1RUJ1 2ARBA 3I2HA 5LK7B 4QQOA 2A6WA 4QXHA 5FZ1A 2ET7A 5L73A 4CZSA 1SDDB 4QU2A 2BV4A 2DVBA 1YRZA 4FFFA 4QXCA 2X05A 4BCUA 1K42A 4BQ3A 5FWJA 4NR1A 5A70A 4DPNA 3ZR5A 2ADEA 3AZXA 4EN7B 2AGSA 2ENRA 2RE9A 1W39A 1H2KA 3IDCB 3I7DA 3WUDA 5JZGC 4YM0A 3VBSB 4M3CE 3UKNA 2XKOA 1W03A 4BA6A 1JZ4A 1NLRA 4BISA 4UI9L 4Y22B 1UU5A 5JSPA 5GZFA 2XGXA 4Z8BA 3JD71 1QXRA 4HN0A 3N9OA 5CZKA 5A3NA 1JZ2A 3O1TA 2XOMA 1CONA 1YLLA 4R9BA 2DUQA 3I3DA 2XL7A 1OKOA 4XF9A 4AAXA 2C4XA 5BXXA 2JE7A 5A3LA 1WCDJ 3ES4A 3OPZA 4QPGC 1HB1A 4QX5A 3T1MA 2CAVA 4WM8A 3HQRA 4I3PA 1DIWA 1OA4A 1PO22 2YY1A 1WW4A 3B7MA 2G9FA 1FV3A 3NAPA 5D1IA 4NHYA 1IG0A 3CNAA 5TSWA 1H1AA 3TWIA 4D7YA 5C8CB 5IK7A 1LGNA 2WKKA 4RS5B 5KHKA 2ZZQA 3T2OA 4C91A 1EV13 3BALA 2WA4A 2IFWA 4V2VA 2DVGA 1XNAA 2BEOA 2R073 4CDXC 3B00A 2P3IA 1YFWA 3DUIA 3ZM8A 5JMCA 1A6CA 3SKJE 2VUCA 3AKSA 1ZVFA 4XTMA 5FXXA 1O4YA 3R4UA 5I0UA 3DGTA 3VHRA 4H7MA 3ZKYA 5C3RA 3V0AA 3ACGA 3K4AA 2CL2A 3OBTA 1GOHA 2VQUA 4MADA 4NRMA 5FP7A 1AL23 1UOJA 3QACA 5FREA 3S6PA 4DFSA 2W9XA 5IVBA 2HBUA 1X50A 1D0HA 3JZVA 4M0NA 3H42B 3KQ4B 3CKHA 4RR3C 5DAWA 3H7JA 4HONA 5IFPA 2XJVA 3AK0A 4EN6B 1I3HA 1DYOA 2XJUA 2BGPA 2VW0A 3LCPA 2E51A 3RNSA 4AG4A 5KXDA 4BLIA 2J1UA 4XZPA 4NIIA 5A1LA 4MGSA 5CG8A 1W9TA 1VBA2 3NKTA 3OEBA 5FZIA 2XL9A 2PTMA 5B4NA 2ZAAA 5LATA 2GSYA 2QE3A 3PUHA 5DG1A 5DAPA 5A1FA 4GMP0 4G4FA 5FP8A 2Y26A 1CZSA 4F3JA 4PIXA 3LD8A 3MZHA 4AGGA 5GLZA 1O5UA 1H1MA 1OURA 2VZOA 4Y1ZA 4D0QA 1QKQA 4N7UA 5CA6A 2IXCA 5BPXA 4NIGA 2PQSA 4EV0A 3OF1A 2E53A 1RUG1 2Z4FA 5FO8B 3AMPA 1POV3 2BRTA 1CJPA 4BQ2A 5F7UA 1RUC2 1MS5A 3TYJA 4BMEA 2EIDA 5I8SA 4LLFA 3MF9A 4RYDA 3ZOIA 4Z1VA 5T5LA 4XAAA 2VNVA 1PIV1 5AC92 4BJ0A 4CCCA 1YQ2A 4A2UA 4WM8C 3ZN6B 3RI8A 5EFUA 1Y9GA 2ZTNA 3D8CA 4ET7A 3BU0A 2FCVA 4JHZA 3ZIWA 2YROA 4X8NA 3NAPC 1GQPA 1W6QA 3B01A 4YGEA 5DZEA 2GU9A 4XF4A 2J42A 3HQUA 4XVHA 5DXDA 4F8AA 1QY4A 5IVJA 1PO11 5CIRA 1GZWA 2QNKA 3BPZA 4PF5A 1ZNPA 1DQ2A 1UY1A 1Y4WA 2R062 4LBNA 4PI2A 2B9UA 3J8F2 5I91A 4MH0E 2A3YA 2XKPA 3CEWA 2BVVA 3IM0A 3NRUA 3ZLIA 5FPVA 3DYOA 2RS31 1RUE1 2ES3A 1GBGA 2H6BA 1C5HA 1QJY3 5FJKA 2OX0A 4LJHA 5CFCA 4LKSA 4TWTA 4D6RA 2ZHNA 1S0JA 1S0FA 2VC9A 2XMLA 3I2FA 1DZRA 1RB8G 2XQXA 1PGSA 1OOPA 3G7DA 1AR83 4FO9A 3M1HA 3TEXA 2GZWA 1VBD2 2ORZA 3LPGA 4ES9A 3A21A 2V4VA 3AP6A 3E97A 3RPQA 3C7GA 3WP6A 2HWF1 2VMFA 4X6RB 1SBEA 5DABA 1PVC3 4I0WB 4A44A 5JZGB 1LU1A 3VB9A 3IDAA 1POQA 3IDBB 1SLCA 2XUEA 3VZLA 2RM22 5FIXA 1OPMA 2XBO2 2HWC2 1FNZA 3AYAA 4FVVA 2B7YA 4IV3C 3KF5A 1QJU2 3WW2A 2VUJA 3WF2A 4N8MA 3H3UA 4EROA 2C6SA 3APBA 4QPGB 5CVRA 1RUNA 1FYUA 1N3QA 1RUJ3 2ZEYA 3IMNA 4AF9A 2QVSB 1CAUA 3KV6A 5CKNA 4LXLA 5D2AA 1W90A 2XLFA 3LEKA 1GWKA 2RR11 3CMGA 1GWMA 1RHI2 2VMCA 1O91A 1O4ZA 4I0BA 5KC5A 3E5UA 1RJ8A 1GZTA 3C7HA 3GBFA 4HETA 4K21A 2QBXA 1FX5A 3NJZA 4MSVA 3KT4A 2RJ2A 1X33A 3E5XA 1C8M2 5FMCA 1HRI1 1CIYA 2PFWA 4DZGA 2O8OA 3ACIA 3BGAA 3OBAA 4OHXA 5JIAA 2Y8KA 5KHGA 3OUHA 2WFPA 1GP6A 2VH9A 1BKZA 4JKMA 4Q4Y3 3EHKA 4YG6A 2JG9B 3C7EA 2D6LX 3OGRA 1AR62 3BOWA 2CGOA 3O0XA 1SFNA 4XEZA 3BOPA 3T1LA 1W6NA 1XOYA 4OHWA 4YGDA 4XQWA 1Q3EA 2Y64A 4CP9B 1EYBA 2GDFA 1PZ8A 2KM2A 4LPLA 1IZ3A 3E1F1 2K46A 1O3TA 4MVTA 3WNXA 1HB3A 4QDRA 3WHUA 5L9RA 2ZJCA 3CZUA 5JOZA 2YFUA 4SBVA 1E57A 5CYYA 5KHHA 3NNGA 4UW5A 5F3IA 3RZKA 1PZ7A 5FZEA 4XF0A 1LOAA 4OQ9A 5CFCC 3I2DA 1CGPA 5KR7A 4PIYA 5KHIA 1GYKA 4QWNA 2J1EA 4GULA 1UXXX 2WNUB 2VXRA 1NT0A 3MPPG 5FZ4A 1OOPC 3NKGA 2W5FA 4BMBA 4IDZA 1OVPA 1O8PA 4AI0A 3B9CA 2BW8A 3NNMA 2Q5TA 1QJX2 3DF0A 5EXOA 1TVGA 2Y33A 2EALA 5ABJC 1KQRA 4HXCA 1JI6A 5LY1A 4FPFA 4Q8LA 1UYXA 4XDQA 2YV8A 2AREA 2BVBA 2OUJA 3WCSA 3MW2A 4EZHA 3MGUA 1HXS1 4N53A 1DBNA 3BPSA 1RIRA 2VUAA 2DCJA 5EJZB 3WW4A 4CDWA 3T2QA 3JU9A 4IE4A 3PJQA 1N1VA 4X6QB 4E4DX 2V73A 5FUIA 4XJAA 5F1RA 2VL4A 4RHV2 3VD3A 4OQ8A 2WT2A 1W8UA 1XBFA 3R4DB 3ZPOA 2W94A 4GXLA 4S2DA 4WM7A 1H1IA 1OUXA 3KB5A 3BI3A 4WM8B 4YM1A 3D5OA 1Q8VA 1O3RA 5IUQA 5LY2A 2MHFA 1UOGA 3N3HA 1JMUB 1BK1A 2BU9A 3WHTA 4GH4A 3MLLA 5DQ0A 4YW2A 1PGL1 5CFDA 4LQRA 1V00A 5HI0A 2NLRA 4ZY9A 5IWFA 3GJAA 3PVEA 4AVBA 3T09A 1GZ9A 1GNHA 1MEC2 2OT7A 4HK8A 1VBE2 2WQ4A 5IFTA 2R7EB 4JHTA 3MI8A 1DCSA 4YYOA 1V6IA 2ARCA 2DBIA 2PHRA 4RN5A 3ZXFA 3I3BA 5CISA 3RJRA 1PIV3 3AMMA 4JTOA 5H9SA 2EAAA 4MUVA 1JZ5A 1JN2P 2DURA 3GZUC 4QMAA 5FJHA 3V0AB 1RVF2 3OGSA 2VMEA 1Q5OA 1V9U2 1W6PB 3BB6A 4L11A 5FZMA 4COZA 1W8OA 4DUVA 1PVXA 4IERA 5LBCA 3VDCA 3WF0A 1W0PA 5C70A 3LGRA 4EZ4A 1VJ2A 3HD8B 1COV3 3NNFA 4B7KA 5I0SA 1WMFA 1OXCA 4XMIA 3UGFA 1WCUA 3OYWA 3UKVA 3N4MA 2VTFA 2A70A 4UW6A 4V2WA 4EN0A 3ACHA 3I54A 5FZAA 1JYNA 1VRH3 1VPHA 2VD7A 5FBZA 2WZR1 4QKBA 3WUCA 5EZWA 1ASJ2 3RG0A 4A7KA 1SEFA 4LHKA 1C4RA 5J36A 3LDBA 2RS33 1RUE3 2VW1A 1GQHA 4LIUA 1RMU2 5I0RA 4IV3B 1ULDA 1X8MA 3SLIA 4W8JA 3UETA 2LW8A 5IHRA 5JPMB 3OUJA 1QH6A 2RDSA 4P14A 4BLJA 3SEPA 3RZHA 1M06G 1ZA4A 1RUF1 2B39A 4O9GA 1YIPA 2G4IA 2E32A 2WBKA 3I3EA 1QOSA 5ACA2 2QQWA 1MZ5A 1O7FA 4N53C 1S0EA 4DEQA 4AWDA 2WINB 4CDWC 4CUCA 3TNPB 1LAJA 4LNVA 4P9IA 4MGZE 5A3TA 2JDYA 3FHIB 1BK0A 3RZGA 1C28A 5T55A 2JECA 1VBA1 4Q4V3 4M4RA 3WP5A 3KHBA 2D6KA 2AACA 2ZHKA 1SFPA 4ZPIA 4WM7C 2QQNA 3PTYA 4YW4A 2JB4A 1K5JA 3VDAA 5FQ0A 4Q4W2 3H50A 1S2EA 4GWJA 2PLV2 5FP9A 3TEZA 1OH3A 2VR4A 4IEYA 4GH4C 4PHZA 5FBJA 1TZOA 5H9RA 2IVIB 2PHLA 3R4SA 5CFDC 3WNOA 3FBYA 5AFBA 3IAQA 1T2XA 3HQXA 1XE7A 5EJ1B 2RHPA 1G7YA 3OSDA 4OI1A 2XJPA 2ZX1A 4YLZA 3MV11 3SXWA 3O12A 1ENXA 3PUIA 2AC1A 4NN0A 3WDTA 3ZXEA 4DB5A 1FPN2 3OUIA 2CDOA 2JXAA 2VMGA 4OI4A 5LBFA 3NV4A 3EJKA 1H8TA 3FBMA 4QU1A 4CP1A 4FXGB 1QOTA 1GSLA 5FR3A 5AC91 1PHMA 4RGGA 2WNOA 5JXHA 2ZX3A 2P3JA 4MXWA 4QGNA 2CDPA 4Q4X1 4BDVB 2W1UA 3UYJA 1OOPB 1DQ1A 1YQ8A 4C8DA 3RZMA 5HXMA 5LZ6A 3I8TA 1W6OA 2W47A 4O61A 3POBA 4QX3A 1XC6A 2PHUA 3RMXA 4HOOA 4DXTA 5HPOA 4GWNA 3ZXJA 5ABJB 3P6BA 1OF4A 4FPGA 3HVDA 4FQ4A 1RUI1 4HKLA 2R061 3SEEA 1DFQA 1W3VA 3J8F1 3WV6A 1YQ6A 1UZYA 1ZZCA 1QQP3 1ZRRA 3LSDA 4PQQA 3VZMA 1F35A 1BLZA 1XE0A 3S7EA 3WF4A 3WNLA 1ZBE2 1RUOA 1O4TA 1H2NA 1LODA 3CU7A 3FMGA 1J58A 1IS4A 1SMVA 2VZQA 4RFRB 2BP6A 3POYA 2P6CA 3CJIA 4QQLA 2W91A 1CAUB 3L2YA 3O5SA 5A3OA 3SQOA 5BNPB 2EICA 4CPBD 4TLFA 1UZ0A 1VMFA 5K0UB 2QTWB 2BBAA 3DPRA 3VGIA 1VBD1 2Z2SB 5J3UA 4HT1T 4Q0UA 3I3MA 1XU2A 2WAAA 4AQSA 2QZ2A 2WJSA 1LGBA 2IZWA 2VCMA 3IAPA 3VD7A 4Z07A 4HLTA 3HMYA 4IGPA 3AMHA 3J4UH 5A7SA 1HXS3 5FYMA 2XBO1 2HWC1 4QM8A 4KGGA 4NO4A 5FK7A 4CA9A 5F2SA 1LECA 1QJU1 1W0NA 5IAVA 4Q27A 4B4QA 4EYUA 2HWB3 1OPOA 4GB31 4JGZB 3LEMA 1B35A 1XNBA 1W9SA 4UBHA 2D3SA 2CSGA 3VDDA 1PGW1 4MGIE 4IEQA 4QDQA 5DZGA 4QHZA 2JDAA 1W6NB 5A32A 4R8HA 1YIFA 1UY2A 4W4ZA 3ILNA 2AZ5A 4K3UA 4CU7A 1JOJA 1LR5A 1WUVA 2ZEZA 3PL0A 3Q9OA 4PT6A 3FHAA 4RSUA 5CB7A 1VLNA 2VOKA 1Y7BA 2VCCA 3AP5A 1LENA 3EB7A 1ENSA 4LO6B 4NAMA 1EPZA 2LS6A 1MS4A 2QQLA 4QKDA 4IEWA 2WIIB 1IGOA 5T5OA 2FD8A 1LOBA 1C8M1 1RUG2 1H8TC 1QXJA 1S2KA 3WOGA 3ZYGA 2B4KA 1LHWA 3RGBA 1RXGA 4JKKA 2W92A 3R05A 5FYBA 2IXIA 2K9ZA 1M4WA 1AR72 2Y38A 3AC0A 4NPLA 5FYSA 5IATA 3MBWA 4BZ4A 1XSQA 3MIHA 4ATEA 5IT6A 1AR61 1H30A 2WQZC 1BBT3 1S4CA 1PO23 3ALQA 3KVAA 1LU2A 3ENRA 3NJXA 1EUUA 1NUKA 2OPWA 2VMIA 3ZYFA 1UAIA 2I07B 3ZXDA 3I97A 3S57A 4YZ5A 3PU8A 3W58A 3LQCA 4V1PA 1V6MA 5LBBA 3JQXA 1W28A 1CJDA 5EIYB 1JZ8A 2FMYA 4N53B 2GC3A 1PO12 1NXMA 4YZ4A 2RDNA 3O14A 1UL9A 1AXZA 2Q4SA 2WLPA 1OI6A 1V6JA 1UF2C 1LCLA 1XRUA 4Q5OA 3V0BA 4XXAA 3MF6A 2WS91 4Y4RA 5BNOA 5JMOA 1W9WA 3SCHA 4HFSA 3POJA 4FPHA 1IPKA 4NWWA 4RQPA 3CJIC 2WO7A 5GJ6A 3WQ7A 1XXNA 1RTVA 1ZZ6A 3GXUA 3HN1A 4INDA 3WINE 3HN3A 5IVCA 4GH4B 2LTNA 4HZFA 4CE8A 4FOQA 5I0TA 5EP9A 3ZKUA 2WZPP 2WN3A 1SLBA 2Y6KA 5BNNA 4TLGA 3O0WA 3BODA 5L9BA 4A7ZA 1GMMA 3VBFA 4A45A 4OFGA 3ZSJA 3C3VA 3VL9A 3CHXA 5BY5A 5C3SA 1OUSA 2PAKA 4K1ZA 3KV4A 1W2NA 2VVDA 1S0IA 1C8NA 3G6JB 1VBA3 4OHVA 4Y5Z0 4FTSA 4FPEA 4COUA 1UKRA 2VMDA 3THDA 3VDDC 3I2OA 4QGMA 1JODA 2ORXA 3HNBM 3USSA 4UT5A 4ZU5A 5A6XA 1NQJA 2XQRA 1AHSA 2RS51 1IS6A 3WXPA 4NHMA 2GNTA 4XIKA 4BIFA 5JSRA 4GQ7A 1L7QA 1OT5A 1S55A 1ONAA 2RJLA 2BGCA 3A23A 2WWJA 3AYCA 3BIWE 1JHNA 5IVYA 4CU6A 4LO7A 4NIDA 1MEC1 1VBE1 1HN0A 1ZREA 2WL1A 4KU8A 3URFA 1RUC3 4XUQA 1T6BX 2GC2A 1N3OA 1MVQA 1ULEA 4QPYA 3SH4A 4Z82A 1HRI2 2YHJA 4CPBA 1FMD2 2ZABA 3NNLA 5AC93 1R082 3N35A 2RG4A 4A6SA 1S0DA 1WWYA 1DZTA 1RVF1 3FLPA 4XFHA 5F3GA 5FPLA 3ZYBA 5LEKA 2EXJA 4QXBA 4LEJA 2V5DA 4Y24A 2JDKA 1QJZA 4I02A 3M2MA 3LEGA 1AYM3 1VR3A 3RWNA 1O8SA 1TME2 1BEV1 2ET1A 1JHJA 1VB2A 3J7LA 4A3XA 4BQ4A 4Y5TA 5ANQA 2R063 5JI7A 4B4PA 3PIGA 1ASJ1 5FMOL 2YDEA 5BNOC 2AEYA 1U5IA 4JKLA 1N1YA 3O7OA 3W20A 4RQPC 3MW4A 4JRLA 3FJSA 2WUHA 4FQZA 1MZ6A 1W6MB 4P9JA 2Q8OA 4HVQA 1ZRCA 2R0FA 5FLIA 2D3PA 4DUXA 4FT8A 5JVVA 1UU4A 2IXJA 4NPMA 2W95A 2W39A 2Y6JA 1VBD3 3T0BA 1TNRA 2A6XA 5A3WA 2XDVA 4IEPA 4UFHA 5J96B 4URTA 5BNNC 4A42A 5FP3A 3B3QE 2C5DA 5DAXA 4FP3A 1UOBA 1QNYA 2JIJA 2RM23 3VBHA 1D0GA 2PQQA 1H8TB 4XILA 2HWC3 2BFUS 1Y9MA 2ZEWA 5FYIA 1X9TA 2KR2A 2JIGA 2YFZA 3Q8CA 4HL0A 4ARYA 2OUHA 4Y20B 1YHFA 5HXVA 5A7OA 4Q4W1 4TYSA 3T3YA 1GUIA 2PLV1 2BBVA 4XW3A 5FY5A 1ULCA 5ANNA 1GP4A 1R092 3ZXLA 1DYPA 1W6OB 2A3XA 4JDMA 2XB6C 1F8VA 2BNOA 3ELNA 1XYNA 4JDOA 1RHI3 2UY9A 1PGL2 1VBC1 1FPN1 5C5TA 4UF0B 2DU0A 1UIKA 4OUMA 5EJ3A 3VKOA 3B5LB 2B42B 1C8M3 3M3QA 4ISQA 1JUHA 1KITA 4J1XA 5DUVA 3JXSA 2PXJA 1DGLA 4XUNA 1MR5A 3AJZA 3VLBB 1IPJA 2HWE2 1N1SA 3NL1A 3CJIB 3KD4A 5F5CA 5FZCA 3PLQA 1OD5A 2XJQA 5C8WA 1R1A2 4BQXA 2ZKNA 1ODMA 1AR63 2RMU1 3AZWA 4KBZA 1QWRA 2QQJA 4LBJA 3WW3A 5GZGA 3NVCA 2Z69A 2I2SA 4Y33A 3IZOA 1X9PA 3WQ0A 3T0DA 3VBOA 3KGLA 4L92A 5JOWA 1H6YA 3O1OA 1CD3G 1DLCA 4JCKA 2W0XA 1HV1A 4CDUB 1ZYBA 5J48A 5CADA 4JZRA 3ZN4A 2ZPXA 1JW6A 1ZBE1 3OGJA 4NAOA 5D8AA 2JE8A 2C0ZA 4KWLA 2X8KA 4EQVA 1OFNA 2R6QA 2WZR2 5FK8A 4K6BA 3W5MA 1BXHA 2DUPA 3E5QA 1DQ0A 3T2PA 1DZQA 1WD4A 3DV8A 3ZMOA 5CBLA 3ATGA 1I5PA 4CEWA 3VBUA 4DQAA 4CUGA 2HKXA 4TTGA 4M3CA 4N9IA 3ZVXA 4YZ1A 1PZ9A 3WW1A 2WNVA 4AL9A 3RI9A 1QJX3 1F31A 3PJYA 2H6CA 4BE3A 3VUOA 2GMEA 3J7NA 3O1MA 1RUF2 3ZYHA 3TBDA 4QPIA 3MLJA 2OZ6A 2HYKA 5FYYA 2XONA 4DO0A 3RDIA 1HW5A 2XWBB 4FOWA 1UZZA 3VBHC 2D6MA 5HCAA 2PHDA 1WW7A 1SZBA 2Y60A 3WZ1A 3HT1A 2Q1ZB 3ZSLA 3ZYPA 5KXBA 1UX6A 4QXKA 1JOPA 5F6KA 4IV1B 5DDJ3 2WFF1 3ILFA 4RHV3 5FFOC 1KEXA 3ETPA 2B9VA 3CZJA 3PMSA 3TRSB 5BNQA 5L19A 5K9YA 1A3KA 1H0BA 4Q8KA 2VUDA 4A6OA 1GOGA 2DYCA 3B9IA 4GMP1 5H9QA 3S5QA 4IGOA 2AEZA 5H9PA 5C4WB 5LCWL 2YC0A 1UZVA 2J1TA 3PUAA 5F5AA 3VZNA 3AXEA 5A6QA 2O14A 2GNBA 1ULGA 3B93A 3GBGA 2UWCA 2XWJB 3A7QA 1HKDA 3VHNA 4B3NA 1HB4A 1RL3A 1TEIA 1U5XA 1VBE3 3N9PA 1NLSA 1REEA 2WDBA 3THPA 4UFJA 1QJEA 1IS3A 4GA9A 2X09A 1AR71 1E5HA 3AB0A 1QOOA 2OIIA 4I09A 4N90A 2VZ3A 4CCKA 3ZYIB 1J84A 2ID4A 1GP5A 1RVF3 2EIGA 2W68A 1V9U3 4COVA 4JC1A 4Q4X2 1XJAA 3KS7A 3SH5A 2EIEA 3WP3A 5JUVA 1W8ZA 4BOWA 1P8JA 3VBOC 3RYKA 4AI3A 2F17A 5HV4A 3ZFFA 2G9GA 2EF6A 4LO5B 5D8AC 1RUI2 3FX3A 2WR9A 3VD9A 1H2MA 2FHRA 4NHKA 1UMHA 3UESA 4KWUA 4YFZA 3VKFC 3Q8EA 3D82A 4LBOA 4MGYE 4CEWC 3VBUC 1RMU3 2P3KA 4YM3A 3BN6A 4IW3A 3WP4A 3HR9A 2JJ6A 2BOJA 2HWD2 2WNVC 1AR93 3OJBA 2R16A 4AFAA 5FY8A 5A7PA 3WG2A 1HV0A 1XNTA 4NJ4A 4QPIC 1WLCA 3FL7A 2P3YA 4L9BA 5ACA3 1HRV2 1SACA 5F9TA 5T50A 2YPDA 3T4HB 1QF3A 2WZ8A 2YMZA 3CQOA 4TN7A 2DU1A 4P9XA 2FCTA 3F95A 3OEAA 4Y5SA 2IXHA 4QT6A 3I59A 4L8QA 3AKPA 5DAVA 3HNYM 1NE4A 2OS2A 4XACA 4OMDA 1YJKA 4LKEA 3ZIXA 4BH9A 4Y26A 4JV4A 1YUDA 4Y1YA 2JG8A 4D7TA 4OHYA 1V6LA 2PMWB 1W8WA 4XFFA 3RJ2X 3RZLA 1F15A 3DYPA 4BQWA 5FZOA 3U14A 4CTEA 1MQTA 4GB32 4LBMA 2VULA 1W9YA 2JDMA 4Q4W3 2PLV3 3VBRA 5CU1A 1NG0A 1PGW2 4P5YA 1KS5A 1QU0A 2DTYA 4P9GA 2BZDA 4DXSA 2TBVA 3TN91 3BKZA 3NO8A 4O7XA 3RZZA 1VIWB 1UXZA 1FXZA 3HWJA 1FPN3 3LOIA 5F5QA 1UW8A 3FUOA 1ENRA 4IEXA 4D94A 2R042 1URXA 1XQNA 2WYFA 1SDWA 4LA3A 5FP4A 2WYSA 4CDXB 3POSA 1FMD1 1R081 4P02B 3JD73 3LA7A 3IDEA 4P9YA 3V56A 1UYZA 1YQCA 1MS3A 2YXSA 4XF3A 2JICA 5FZGA 3E6CC 4NROA 3C8XA 1AYN1 3LOBA 1DU3D 2GNDA 5FO9B 2GMMA 3ZN5A 5BV6A 3C7FA 4P00B 4E2SA 1LJ7A 5GLWA 2GP3A 2ADDA 2KA3A 3IPVA 4AEMA 1X7NA 1TME1 2SLIA 3ME2A 5GZEA 5D21A 5JCTA 1WKYA 3ZFFC 2BERA 1LTEA 4RR3B 1K3IA 3IWZA 2BYVE 3OD0A 2B45X 3RVHA 3USUB 3VBHB 5GLVA 4YPJA 3ZFGA 5A33A 1GWLA 3V64A 1AUYA 1ZBE3 4Y22A 5DUWA 3VZOA 3GZAA 5JSOA 3SCFA 1GZCA 4W50A 2FDHA 1SCSA 2WS92 2I74A 4QDSA 1V6KA 4BQYA 3UNPA 1VAVA 3WQBA 1NKGA 3U78A 1W0OA 4NPRA 3WCRA 2O1QA 1IOAA 4AEJA 4MLOA 2D98A 2YC2A 4LOSA 3BTAA 1VAKA 3H1MA 3NMBA 4AI9A 4CXWA 1XU1A 4DEVA 4E2QA 4TSVA 1K12A 1H2LA 5K4LA 4FPCA 4G3YC 2V5YA 4BB3A 1PMJX 5GZDA 4CP2A 3TAYA 5I93A 4XTPA 1H8VA 1CN1A 1IG3A 1NY72 3VZKA 1BJQA 3H1WA 5F5IA 1PK6A 2HH9A 4WZCA 3PVOA 5B2GB 1W8TA 1W2TA 3NJVA 4LE4A 1QXPA 3ZDSA 3CDZB 5FY0A 4E9KA 3KLSA 5G05L 3BTZA 3M3OA 3CF6E 5FYTA 5LA9A 4YARA 1AZDA 1MQTC 5FPBA 3B02A 3AYEA 2J1SA 2OKXA 5IVFA 4LBLA 1DQ6A 4FCAA 4UWDA 3VBRC 2ZMLA 1F4HA 4JTNA 1R091 3AXDA 5EYYA 5T52A 3VDBA 2HYXA 4YGBA 1WMDA 5I8YA 4GMP3 3KT7A 4FFHA 4XJZA 2RS52 2C1FA 4AQTA 2NN8A 3J9SA 3NAPB 1JZ3A 5IVEA 2GMPA 3OCPA 3H8OA 1H4HA 3VBOB 3THCA 2EIBA 1LHNA 1N1TA 3POFA 4R9DA 3SISA 4CCJA 3C7OA 4OUEA 1VMJA 4I01A 4I3GA 2XLAA 5AVPA 1RUG3 1W2AX 5D8AB 4NWVA 4QPWA 4XHXA 4ZXEA 1UOFA 2BTVC 4NHLA 2Y6GA 5IJRA 3U4SA 1LHVA 5IK4A 5JAXA 2CV6A 2ZGKA 5C9AA 1AR73 2HWE1 3VBUB 4XUPA 3DCQA 4M3CB 1AJOA 1R1A1 3AYDA 1S0BA 4FPLA 5A6ZA 5FOBB 2YC4A 1FATA 2WNVB 1HX6A 2E63A 4Y1XA 1NCQA 2ZGSA 4UOJA 2VOVA 1JOBA 1Y3TA 3DL3A 4N43A 3WVJA 2VMHA 1AF9A 2MNGA 4QPIB 4LTAA 5A3MA 1VBB1 2VZ1A 3CJXA 2VQ0A 1WLWA 3WG3A 3KV5A 2GC0A 1BEV2 5DAQA 1PO13 3M7AA 4N9HA 3M4FA 1G9CA 3ZFGC 1O3QA 1FT9A 2A7AA 1RUD1 2DTWA 1NXD1 3HBZA 2ZGNA 1SLAA 3I2GA 2GH8A 1ALYA 2VZPA 2YBPA 2XVLA 3HT2A 2TNFA 1LRHA 2IC1A 3NV1A 2RV9A 4LUKA 4MHUA 4Y1UA 2XVKA 4O9EA 3WQ1A 1D4VB 4OI0A 2B5HA 1YFUA 4Z2WA 4B1MA 3KCXA 3PVBB 4ZZ8A 3KCCA 1N3PA 5JPNB 2QDNA 5IYYA 3QH7A 4A4AA 4CU9A 3K46A 4IGQA 4ZS3A 1NCRA 1KXGA 3VHOA 4LE3A 2JDUA 3OPTA 5JIUA 1JBCA 2QQOA 4Y4YA 4CDQA 1PK6C 2YU2A 4WZFA 2FMDA 4JQRA 1GKBA 5AVAA 2HWF3 2P4EA 4J25A 3ORJA 2R32A 2EXKA 3W5NA 1MS9A 4H3WA 2WO2A 2OVUA 1KD7A 3KM5A 4HPKA 4KBBA 3T30A 4GALA 3U37A 3UJQA 2NZ9A 5FV3A 3T08A 1DQ4A 4MX3A 1ZZ9A 2ZXQA 1AJKA 1DP0A 4IXLA 3ABZA 3AVRA 5JXIA 2P2KA 1US3A 3D4KA 4XMAA 4Q26A 1W6QB 4D6QA 1E5RA 1AX1A 3N7JA 2DVAA 2JEMA 5EPAA 3JCIA 2RR13 3AP4A 2ZBJA 1GZWB 4QQPA 1Q8SA 3DXUA 5CKQA 3UKTA 4XOGA 3QBQA 4HSJA 2RVAA 4DY5A 1VBC2 4X8PA 3VV1A 2QQKA 2XVGA 5A80A 2ARAA 2WRAA 3SNMA 5F39A 5C9AC 1HRI3 1HQNA 1ULPA 5FLJA 1FMD3 5CFCB 3TEYA 4KG0A 2VOWA 3VKLA 3H0OA 1KS4A 1NCQC 4AFBA 4B7EA 1YCIA 4K8RB 4R9CA 4N43C 5L7OA 2A73B 4AQ2A 2ZA9A 2VBPA 1WD3A 1LHUA 2RMU2 2XJTA 3KVBA 3O1PA 4Z2AA 1WA6X 2NQYA 2OQ7A 4PBOA 4R4XA 3H3LA 4OYUA 3IBMA 2ZGOA 1WMEA 1PM4A 4B8EA 4HVOA 4FXKB 2C9KA 3WD5A 2ZGRA 1OBNA 5FZ0A 1DG6A 1CAVA 2O8QA 2DVDA 4WVMA 4OHZA 4Q4Y2 2HWD1 1ZRDA 2OA2A 3ZR6A 3OPWA 5A7WA 4YW5A 3VBRB 4Z92B 3M8LA 2GP5A 1D2SA 1NCRC 5T5JA 1GLHA 2BNMA 4XFAA 2MEV1 1HRV1 4XXPA 4OZOA 4CDQC 1WZXA 3AVSA 1JYVA 3POGA 3K4ZA 4ZHNA 1UX7A 5CG9A 3N9QA 5CAZA 5FZ6A 4JQTA 1OLME 2R30A 2D5HA 3AKRA 2ZOEB 2DBNA 2WSVA 3QD6A 5JXJA 3GYDA 3FUQA 4FPYA 1K45A 5KXEA 2LRPA 1UMIA 4YWAA 2F6BA 2XR4A 5GZCA 4UW3A 4HBNA 3NQHA 2JDPA 1DQ5A 2WFF2 4H14A 2J7MA 3ES1A 2VZRA 1TMF2 1G9AA 4M4PA 4UW4A 4XCBA 3PHMA 5FPUA 1APNA 1R093 3M3CA 5T5PA 2FDIA 2FDJA 3BTYA 1V0AA 2W87A 5JWPA 2VO5A 1DLLA 2VNGA 4LORA 4D3WA 3BYWA 2YPJA 5C8CA 4RS5A 3AFGA 3LWCA 3WEZA 5L36A 2ETEA 2R041 4JGYA 3BUCA 1DGWX 4LT5A 4ES8A 3QCWA 2W2IA 1OSGA
chains in the Genus database with same CATH topology
3NRUA 3DYOA 4ARYA 2YFZA 4A3ZA 3J7HA 3WNPA 4LKSA 4MO3M 1JU3A 1GUIA 2VC9A 3I2FA 1HN1A 3CIHA 2XQXA 2WAOA 2VZSA 3WNKA 4QB2A 4KI5M 3LPGA 2ORZA 3A21A 2V4VA 3C7GA 2VMFA 1TG7A 4XUTA 4A44A 3IIIA 3IDAA 4MOAA 3JXSA 4XUNA 3WF2A 1EUTA 2ZEYA 2QQJA 3LEKA 4ZZ5A 1UWWA 3CMGA 2XHNA 2VMCA 1UY4A 3ECQA 4TXWA 3T0DA 3T0AA 3C7HA 1H6YA 2QBXA 1DLCA 2RJ2A 5G04L 1CIYA 2JE8A 3W5MA 3ACIA 3BGAA 3OBAA 3T2PA 2Y8KA 1I5PA 4JKMA 4TTGA 3C7EA 3OGRA 4DUXA 2Y64A 3LE0A 4UAPA 2W1QA 1JU4A 2XONA 4LPLA 1XPWA 3E1F1 4A41A 2E33A 1UYYA 4QDRA 4QX2A 4ARXA 3CZUA 4DUWA 2YFUA 5CYYA 3NNGA 1UY3A 3A22A 3FHQA 2J1EA 1KEXA 1UXXX 2B9VA 3CZJA 3ETPA 2J22A 3D3AA 1GOFA 1CX1A 2W5FA 4P08A 1O8PA 1D7PM 4A6OA 1CZTA 1GOGA 4BK4A 3I2KA 1RYYA 1TVGA 2VZTA 5JXGA 2VOTA 5LCWL 4QX1A 3FN9A 1JI6A 2J1TA 1UYXA 2DDUA 1W8NA 1KGYA 3A7QA 4QB6A 2VZVA 2DCJA 5EJZB 2W1SA 2WDBA 3T2QA 4JX0A 1WCQA 4BXSV 2J1VA 2X09A 5FUIA 2VL4A 3HJRA 3VD3A 3F2ZA 2W94A 2VZ3A 1J84A 4XURA 2ID4A 5B4XA 2EIEA 5DPNA 3OGVA 4BK5A 2KD7A 5JUVA 3GDBA 1P8JA 2WABA 5DQ0A 3DECA 4LQRA 4ZY9A 3T09A 2W46A 5IFTA 2R7EB 3VD9A 2V72A 4GZ9A 3UESA 1UMHA 2VCBA 4KWUA 3VD4A 5JR2A 4RN5A 3I3BA 5LA2A 3BN6A 2E26A 1JZ5A 3OGSA 2VMEA 2Y6HA 1W8OA 4DUVA 1NAEA 1JZ7A 3VDCA 3WF0A 5C70A 1XNTA 5J1XA 3FL7A 4CU8A 4DXRA 2WZ8A 2QQIA 2L9LA 2DCKA 3CQOA 2VTFA 3OEAA 3ACHA 1NX9A 1JYNA 5DN2A 3HNYM 1H6XA 4OMDA 4LHSA 3DYPA 1J83A 3K75B 4QX0A 2JKXA 4W8JA 3UETA 3HEIA 2LW8A 5IHRA 2VM9A 3MO4A 3SEPA 4P5YA 1OD3A 4E8CA 2BZDA 2E32A 2WBKA 3I3EA 4DXSA 1LNSA 3HPNA 4CVUA 1CZVA 4HG6B 1UXZA 4DEQA 4CUCA 2YB7A 3I2IA 2WYSA 1US2A 4M4RA 4XZUG 4P02B 2QQNA 1UYZA 4OMCA 4IUGA 3VDAA 3C8XA 4D8MA 1O59A 1JYWA 4GWJA 1IQDC 2VR4A 3C7FA 4P00B 3IB3A 3WNOA 3IAQA 1T2XA 5EJ1B 1WKYA 2BERA 3MV11 2E31A 3PUIA 1K3IA 3HNMA 2CDOA 4YPJA 1SG3A 4W50A 1L7RA 1OF3A 4QDSA 5JXHA 3UNPA 2CDPA 4BDVB 3WQBA 2W1UA 1NKGA 3ACFA 2WO3A 2YC2A 4DEVA 1W99A 3P1IA 5HXMA 4QAWA 1K12A 2W47A 4QX3A 1XC6A 4DXTA 1PMJX 5HPOA 3P6BA 1OF4A 2WO1A 3LPFA 2QQMA 2W1WA 3MV01 3DYMA 3WSOA 3SEEA 1ULOA 3NJVA 4PQQA 3CDZB 3WF4A 3WNLA 4MGQA 5G05L 1GU3A 2WQ8A 3MUZ1 2J1SA 2OKXA 2VZQA 2W91A 1F4HA 2C26A 3VDBA 2HYXA 2EICA 2WN2A 1UZ0A 2BBAA 2JD9A 4CUAA 1PX4A 1JZ3A 2WAAA 3THCA 4KMQA 2EIBA 3VD5A 3WNNA 3VD7A 3IAPA 2J1AA 3C7OA 4OUEA 1R64A 5A1AA 2WZEA 4QPWA 4ZXEA 2Y6GA 5IJRA 1W0NA 1JZ6A 1BHGA 4XUPA 2VZUA 1W9SA 1PMHX 3GM8A 2YC4A 4QDQA 3SKVA 2JDAA 4UOJA 5DMYA 1UY2A 3K77A 4W4ZA 4CU7A 2ZEZA 2VZ1A 4PT6A 3FHAA 2VCCA 3EB7A 2LS6A 2QQLA 2YG0A 2VCAA 3WNMA 4XUOA 2X10A 2B4KA 1OH4A 4JKKA 2W92A 5C7GA 3I2GA 2VZPA 3AC0A 3LEIA 2RV9A 4CUBA 3MBWA 3I2HA 4ZZ8A 1F4AA 1SDDB 5IYYA 3NJXA 3EYPA 4A4AA 3K46A 1EUUA 4CU9A 2X05A 1K42A 1NUKA 3I97A 5LA0A 2QQOA 3LQCA 2Y6LA 5EIYB 1JZ8A 1JZ4A 3W5NA 4UI9L 3WF1A 2WO2A 5CZKA 1JZ2A 5JMOA 2XOMA 1W9WA 3U37A 3I3DA 5LA1A 3T08A 4AAXA 2C4XA 2ZXQA 1DP0A 1GNYA 2BGOA 3ABZA 3GXUA 5JXIA 3HN3A 1US3A 2J1RA 5I0DA 2WN3A 2Y6KA 2ZEXA 3T2OA 2RVAA 1GMMA 1SHWB 1XNAA 4L0PA 2QQKA 4A45A 3ZM8A 3SKJE 2VQTA 1ULPA 2VMDA 3THDA 1MPXA 1JYXA 2ORXA 3HNBM 3I2JA 3HOBA 3ACGA 3GGLA 3K4AA 1GOHA 2VQUA 4MADA 1UY0A 1L7QA 2W9XA 3K4DA 1OT5A 4Z2AA 3CKHA 5IFPA 2HLEA 3A23A 4CU6A 4E8DA 4OYUA 1DYOA 5C71A 2BGPA 4AG4A 4XUQA 2C9KA 2J1UA 4MGSA 1W9TA 3OEBA 3MUY1 5B4NA 2VJXA 3PUHA 2W3JA 1CZSA 2V5DA 3LEGA 2VZOA 4D0QA 4OZOA 1O8SA 1JYVA 2PQSA 4GWIA 1JHJA 3K4ZA 1UX7A 2Z4FA 4PF1A 5F7UA 3OG2A 2EIDA 5JXJA 4QB1A 4RYDA 4JKLA 1K45A 3WF3A 1UMIA 2WUHA 3NQHA 4BJ0A 1YQ2A 2J7MA 2VZRA 4M4PA 4ET7A 4JHZA 1GQPA 4XVHA 2W87A 2W95A 2Y6JA 4FI9A 3T0BA 2VO5A 4A42A 3OB8A 1UY1A 3WEZA 1PX3A 2ZEWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NRU A;  3DYO A;  4ARY A;  2YFZ A;  4A3Z A;  3J7H A;  3WNP A;  4LKS A;  4MO3 M;  1JU3 A;  1GUI A;  2VC9 A;  3I2F A;  1HN1 A;  3CIH A;  2XQX A;  2WAO A;  2VZS A;  3WNK A;  4QB2 A;  4KI5 M;  3LPG A;  2ORZ A;  3A21 A;  2V4V A;  3C7G A;  2VMF A;  1TG7 A;  4XUT A;  4A44 A;  3III A;  3IDA A;  4MOA A;  3JXS A;  4XUN A;  3WF2 A;  1EUT A;  2ZEY A;  2QQJ A;  3LEK A;  4ZZ5 A;  1UWW A;  3CMG A;  2XHN A;  2VMC A;  1UY4 A;  3ECQ A;  4TXW A;  3T0D A;  3T0A A;  3C7H A;  1H6Y A;  2QBX A;  1DLC A;  2RJ2 A;  5G04 L;  1CIY A;  2JE8 A;  3W5M A;  3ACI A;  3BGA A;  3OBA A;  3T2P A;  2Y8K A;  1I5P A;  4JKM A;  4TTG A;  3C7E A;  3OGR A;  4DUX A;  2Y64 A;  3LE0 A;  4UAP A;  2W1Q A;  1JU4 A;  2XON A;  4LPL A;  1XPW A;  3E1F 1;  4A41 A;  2E33 A;  1UYY A;  4QDR A;  4QX2 A;  4ARX A;  3CZU A;  4DUW A;  2YFU A;  5CYY A;  3NNG A;  1UY3 A;  3A22 A;  3FHQ A;  2J1E A;  1KEX A;  1UXX X;  2B9V A;  3CZJ A;  3ETP A;  2J22 A;  3D3A A;  1GOF A;  1CX1 A;  2W5F A;  4P08 A;  1O8P A;  1D7P M;  4A6O A;  1CZT A;  1GOG A;  4BK4 A;  3I2K A;  1RYY A;  1TVG A;  2VZT A;  5JXG A;  2VOT A;  5LCW L;  4QX1 A;  3FN9 A;  1JI6 A;  2J1T A;  1UYX A;  2DDU A;  1W8N A;  1KGY A;  3A7Q A;  4QB6 A;  2VZV A;  2DCJ A;  5EJZ B;  2W1S A;  2WDB A;  3T2Q A;  4JX0 A;  1WCQ A;  4BXS V;  2J1V A;  2X09 A;  5FUI A;  2VL4 A;  3HJR A;  3VD3 A;  3F2Z A;  2W94 A;  2VZ3 A;  1J84 A;  4XUR A;  2ID4 A;  5B4X A;  2EIE A;  5DPN A;  3OGV A;  4BK5 A;  2KD7 A;  5JUV A;  3GDB A;  1P8J A;  2WAB A;  5DQ0 A;  3DEC A;  4LQR A;  4ZY9 A;  3T09 A;  2W46 A;  5IFT A;  2R7E B;  3VD9 A;  2V72 A;  4GZ9 A;  3UES A;  1UMH A;  2VCB A;  4KWU A;  3VD4 A;  5JR2 A;  4RN5 A;  3I3B A;  5LA2 A;  3BN6 A;  2E26 A;  1JZ5 A;  3OGS A;  2VME A;  2Y6H A;  1W8O A;  4DUV A;  1NAE A;  1JZ7 A;  3VDC A;  3WF0 A;  5C70 A;  1XNT A;  5J1X A;  3FL7 A;  4CU8 A;  4DXR A;  2WZ8 A;  2QQI A;  2L9L A;  2DCK A;  3CQO A;  2VTF A;  3OEA A;  3ACH A;  1NX9 A;  1JYN A;  5DN2 A;  3HNY M;  1H6X A;  4OMD A;  4LHS A;  3DYP A;  1J83 A;  3K75 B;  4QX0 A;  2JKX A;  4W8J A;  3UET A;  3HEI A;  2LW8 A;  5IHR A;  2VM9 A;  3MO4 A;  3SEP A;  4P5Y A;  1OD3 A;  4E8C A;  2BZD A;  2E32 A;  2WBK A;  3I3E A;  4DXS A;  1LNS A;  3HPN A;  4CVU A;  1CZV A;  4HG6 B;  1UXZ A;  4DEQ A;  4CUC A;  2YB7 A;  3I2I A;  2WYS A;  1US2 A;  4M4R A;  4XZU G;  4P02 B;  2QQN A;  1UYZ A;  4OMC A;  4IUG A;  3VDA A;  3C8X A;  4D8M A;  1O59 A;  1JYW A;  4GWJ A;  1IQD C;  2VR4 A;  3C7F A;  4P00 B;  3IB3 A;  3WNO A;  3IAQ A;  1T2X A;  5EJ1 B;  1WKY A;  2BER A;  3MV1 1;  2E31 A;  3PUI A;  1K3I A;  3HNM A;  2CDO A;  4YPJ A;  1SG3 A;  4W50 A;  1L7R A;  1OF3 A;  4QDS A;  5JXH A;  3UNP A;  2CDP A;  4BDV B;  3WQB A;  2W1U A;  1NKG A;  3ACF A;  2WO3 A;  2YC2 A;  4DEV A;  1W99 A;  3P1I A;  5HXM A;  4QAW A;  1K12 A;  2W47 A;  4QX3 A;  1XC6 A;  4DXT A;  1PMJ X;  5HPO A;  3P6B A;  1OF4 A;  2WO1 A;  3LPF A;  2QQM A;  2W1W A;  3MV0 1;  3DYM A;  3WSO A;  3SEE A;  1ULO A;  3NJV A;  4PQQ A;  3CDZ B;  3WF4 A;  3WNL A;  4MGQ A;  5G05 L;  1GU3 A;  2WQ8 A;  3MUZ 1;  2J1S A;  2OKX A;  2VZQ A;  2W91 A;  1F4H A;  2C26 A;  3VDB A;  2HYX A;  2EIC A;  2WN2 A;  1UZ0 A;  2BBA A;  2JD9 A;  4CUA A;  1PX4 A;  1JZ3 A;  2WAA A;  3THC A;  4KMQ A;  2EIB A;  3VD5 A;  3WNN A;  3VD7 A;  3IAP A;  2J1A A;  3C7O A;  4OUE A;  1R64 A;  5A1A A;  2WZE A;  4QPW A;  4ZXE A;  2Y6G A;  5IJR A;  1W0N A;  1JZ6 A;  1BHG A;  4XUP A;  2VZU A;  1W9S A;  1PMH X;  3GM8 A;  2YC4 A;  4QDQ A;  3SKV A;  2JDA A;  4UOJ A;  5DMY A;  1UY2 A;  3K77 A;  4W4Z A;  4CU7 A;  2ZEZ A;  2VZ1 A;  4PT6 A;  3FHA A;  2VCC A;  3EB7 A;  2LS6 A;  2QQL A;  2YG0 A;  2VCA A;  3WNM A;  4XUO A;  2X10 A;  2B4K A;  1OH4 A;  4JKK A;  2W92 A;  5C7G A;  3I2G A;  2VZP A;  3AC0 A;  3LEI A;  2RV9 A;  4CUB A;  3MBW A;  3I2H A;  4ZZ8 A;  1F4A A;  1SDD B;  5IYY A;  3NJX A;  3EYP A;  4A4A A;  3K46 A;  1EUU A;  4CU9 A;  2X05 A;  1K42 A;  1NUK A;  3I97 A;  5LA0 A;  2QQO A;  3LQC A;  2Y6L A;  5EIY B;  1JZ8 A;  1JZ4 A;  3W5N A;  4UI9 L;  3WF1 A;  2WO2 A;  5CZK A;  1JZ2 A;  5JMO A;  2XOM A;  1W9W A;  3U37 A;  3I3D A;  5LA1 A;  3T08 A;  4AAX A;  2C4X A;  2ZXQ A;  1DP0 A;  1GNY A;  2BGO A;  3ABZ A;  3GXU A;  5JXI A;  3HN3 A;  1US3 A;  2J1R A;  5I0D A;  2WN3 A;  2Y6K A;  2ZEX A;  3T2O A;  2RVA A;  1GMM A;  1SHW B;  1XNA A;  4L0P A;  2QQK A;  4A45 A;  3ZM8 A;  3SKJ E;  2VQT A;  1ULP A;  2VMD A;  3THD A;  1MPX A;  1JYX A;  2ORX A;  3HNB M;  3I2J A;  3HOB A;  3ACG A;  3GGL A;  3K4A A;  1GOH A;  2VQU A;  4MAD A;  1UY0 A;  1L7Q A;  2W9X A;  3K4D A;  1OT5 A;  4Z2A A;  3CKH A;  5IFP A;  2HLE A;  3A23 A;  4CU6 A;  4E8D A;  4OYU A;  1DYO A;  5C71 A;  2BGP A;  4AG4 A;  4XUQ A;  2C9K A;  2J1U A;  4MGS A;  1W9T A;  3OEB A;  3MUY 1;  5B4N A;  2VJX A;  3PUH A;  2W3J A;  1CZS A;  2V5D A;  3LEG A;  2VZO A;  4D0Q A;  4OZO A;  1O8S A;  1JYV A;  2PQS A;  4GWI A;  1JHJ A;  3K4Z A;  1UX7 A;  2Z4F A;  4PF1 A;  5F7U A;  3OG2 A;  2EID A;  5JXJ A;  4QB1 A;  4RYD A;  4JKL A;  1K45 A;  3WF3 A;  1UMI A;  2WUH A;  3NQH A;  4BJ0 A;  1YQ2 A;  2J7M A;  2VZR A;  4M4P A;  4ET7 A;  4JHZ A;  1GQP A;  4XVH A;  2W87 A;  2W95 A;  2Y6J A;  4FI9 A;  3T0B A;  2VO5 A;  4A42 A;  3OB8 A;  1UY1 A;  3WEZ A;  1PX3 A;  2ZEW A; 
#chains in the Genus database with same CATH topology
 4FPO B;  4JAA A;  4CEY A;  2XUM A;  4QKF A;  3J7H A;  4EWD A;  3WNP A;  1SFY A;  4MO3 M;  4B29 A;  3O1R A;  5F3C A;  2XLG A;  4FSJ A;  3AP9 A;  1ZM1 A;  1OLM A;  3AX4 A;  1HN1 A;  4LHN A;  5L7O C;  1R1A 3;  4WVZ A;  5LRS A;  2VZS A;  2Q30 A;  4P5H A;  1Z78 A;  4XBQ A;  3WNK A;  4QB2 A;  2EVX A;  4LBQ D;  4GWM A;  1YI9 A;  4YM2 A;  1BVP 1;  4KI5 M;  1WCS A;  4M01 A;  1S0G A;  2ZGP A;  4NRP A;  1TG7 A;  4XUT A;  2ZGL A;  3PME A;  3I49 A;  2H0B A;  1GR3 A;  3ACL A;  1SBF A;  4W6X A;  4CDW B;  4OCT A;  5K8S A;  4ZU7 A;  1H4G A;  2WZR 3;  2VVF A;  2ZGQ A;  4N7I A;  1AXY A;  3ZSE A;  2E6V A;  4NIA A;  4UFK A;  4WM7 B;  1RJ7 A;  3N7L A;  3AL5 A;  1JYT A;  1F9K A;  4UYB A;  3AKT A;  5KWR A;  3H8X A;  3DPR C;  4YVS A;  2Q0A A;  1W04 A;  3GHN A;  4ZZ5 A;  2AEN A;  1S0C A;  1RUF 3;  3GZE A;  5CFD B;  5FZB A;  1UY4 A;  5LW9 A;  1NY7 1;  1EV1 1;  2DCZ A;  1QGL A;  3AMQ A;  4TXW A;  1HJG A;  4YFW A;  3T0A A;  3V65 A;  1XE8 A;  2CWM A;  4BIO A;  2GC1 A;  2QFE A;  3Q8A A;  3LDR A;  5FUP A;  3Q8F A;  2XPJ A;  4MGK E;  5FOJ B;  1QDC A;  5C9A B;  4AEK A;  1B35 C;  4FOY A;  3DN7 A;  4B1L A;  1AXK A;  1I9R A;  4AVV A;  1KJL A;  1W8H A;  2WC2 A;  1AL2 1;  3CL1 A;  3FFZ A;  1C5I A;  4WV8 A;  1D2Q A;  4XCA A;  1Z7S 2;  3PVN A;  1MZF A;  2KXL A;  4UAP A;  5C8C C;  5K7P A;  4RS5 C;  2W1Q A;  3PDQ A;  3OYW B;  4HAN A;  1YEW A;  3FZ3 A;  5C5U A;  3TN9 2;  4CXY A;  4JGY C;  3NST A;  4A41 A;  1V70 A;  2JDZ A;  4HKW A;  1UYY A;  2DCY A;  2ZHL A;  4QX2 A;  4DUW A;  1TNF A;  3GCX A;  4K8F A;  5FZ8 A;  4CEY C;  1Y9Q A;  4H55 A;  3NWK A;  4R9A A;  1UY3 A;  1ZA7 A;  5FUN A;  3WG4 A;  2ZZJ A;  3LFM A;  2NM1 A;  1WMX A;  1O3S A;  1ULF A;  3FLR A;  1DGR A;  5EWS A;  3D3A A;  3B69 A;  4CCE A;  1CX1 A;  2WWS A;  4OZX A;  3CLP A;  4Q4X 3;  1AYN 2;  4PLO A;  1C1L A;  4BK4 A;  3I2K A;  1JH5 A;  1YNA A;  2VOT A;  2VZT A;  1LUL A;  5JXG A;  1DF0 A;  4QX1 A;  2O0O A;  1IPS A;  1POV 0;  4CDQ B;  2FZ2 A;  3FLT A;  3ITQ A;  2QZ3 A;  1W8N A;  1KGY A;  1KDM A;  5HBA A;  5F3E A;  1RUI 3;  1BMV 1;  4CSW A;  2VVE A;  3J8F 3;  1WCQ A;  4FFG A;  1FI2 A;  4H2A A;  4JX0 A;  2J1V A;  2DVF A;  1RUH 2;  4HPK B;  4CP0 A;  5FPX A;  3IKW A;  3EO6 A;  1U0A A;  2JEN A;  2Y0O A;  1QJF A;  4HK9 A;  5LEJ A;  3F2Z A;  1PM7 A;  1U5Z A;  2PYT A;  1DYK A;  1W2O A;  3PUR A;  2HWD 3;  2VOX A;  2YBK A;  4P9W A;  4W6W A;  4XUR A;  1CQ9 A;  4YVS C;  5FQ0 B;  2X53 S;  5FO7 B;  4AED A;  2FDF A;  2OZJ A;  1C57 A;  3OGV A;  2KD7 A;  4MZU A;  3NV3 A;  2WAB A;  1HRV 3;  4FBF A;  1RED A;  4CCM A;  1XB9 A;  2EA7 A;  1EAH 2;  3VBF C;  2W46 A;  1ND2 A;  1QQP 2;  1J1T A;  5GM0 A;  4GZ9 A;  3OTF A;  2XBO 3;  2DUO A;  3D6E A;  4E4Z A;  3WDY A;  3OGG A;  3JBG 2;  4IET A;  5LA2 A;  1LKN A;  1QJU 3;  2CU5 A;  3LIG A;  4LBQ A;  2E26 A;  4MXW B;  4Q0S A;  4GB3 3;  3WDU A;  2JG9 A;  3KSC A;  2ZAH A;  1NZC A;  1AR8 1;  1IS5 A;  3EBR A;  3L2H A;  3A4U A;  3MIB A;  3TNQ A;  1IKP A;  3ZXK A;  5L7O B;  3H8R A;  5J1X A;  3P3P A;  4CP9 A;  2WA3 A;  4DXR A;  1PVC 1;  4IEZ A;  2QQI A;  1XNC A;  3PIJ A;  2DCK A;  3PUS A;  3LDK A;  3RRD A;  2LUW A;  5FZ3 A;  5C3Q A;  3QOP A;  1I5Z A;  3VHP A;  2PHF A;  4ZS2 A;  4AR2 A;  2IXK A;  3SMH A;  2ZGT A;  4LLO A;  2R04 3;  2X5I A;  1BYH A;  4LHS A;  3SIT A;  5FXW A;  2HWB 2;  2RS1 2;  1UCX A;  1CAV B;  1CIW A;  5JI9 A;  4QX0 A;  3K75 B;  2JKX A;  4XDO A;  4CRQ A;  2WNU A;  1JYC A;  4JRA A;  1JS9 A;  3HEI A;  5GLT A;  5A7W B;  3UT0 A;  4DS0 A;  1EY2 A;  1YJL A;  2D6P A;  3M3E A;  4XDP A;  3ZSK A;  1GNZ A;  2AYH A;  3ETQ A;  3DPR B;  3PTR B;  3AJY A;  3S5A A;  4ASK A;  2XHK A;  3GBW A;  4NMI A;  4HG6 B;  1VBB 2;  5JDB A;  3ST7 A;  1KFX L;  1K5M A;  2G1M A;  2GH2 A;  3I2I A;  4PIZ A;  1RUD 2;  3DKQ A;  4XC9 A;  4DIQ A;  4XZU G;  1W05 A;  3I4I A;  4IL7 A;  3UK9 A;  3U0Z A;  4Q4Y 1;  2WS9 3;  4WBB A;  1B35 B;  4AED C;  4QHO A;  4IUG A;  2WSU A;  4OUL A;  3ZXA C;  2Z42 A;  4IQP A;  3J7M A;  3VDD B;  4D8M A;  3BIE A;  1BBT 2;  1WA4 A;  1ZBA 2;  3BVC A;  2CGP A;  5A32 B;  4BHP A;  2HEV F;  3IB3 A;  5A7Q A;  1E5I A;  1LOG A;  3T2T A;  4JDN A;  3RWK X;  1FV2 A;  5ERL A;  2DF7 A;  4BYY A;  4GJY A;  1ND2 C;  3UV9 A;  2E31 A;  2LM3 A;  5BUV A;  2E9Q A;  3DXT A;  3HNM A;  1W2U A;  4JGY B;  4NE9 A;  5FPA A;  1KFU L;  3GCW A;  4AI2 A;  2LAL A;  4CEY B;  2Y6F A;  4F7Z A;  3POW A;  1L7R A;  1OF3 A;  1X36 A;  5FY1 A;  2JG9 C;  3CBN A;  1TMF 1;  4G9S B;  5FMO S;  2JWP A;  1RXF A;  5KC6 A;  2MPF A;  1RGS A;  5A3P A;  1W6P A;  2WO3 A;  4OVE A;  1RC6 A;  4PBP A;  4C0B A;  3WY6 A;  1W99 A;  4QQH A;  3Q8B A;  2RS5 3;  1SPP A;  3GZT B;  3RMY A;  1UQX A;  4BWO A;  5FXV A;  1FNY A;  3OY8 A;  4ZXK A;  2QQM A;  4K20 A;  2W1W A;  3MV0 1;  3DYM A;  2WT0 A;  1ULO A;  4L97 A;  3ILR A;  2D6O X;  2X5I C;  1REF A;  1MEC 3;  3EMR A;  2P1B A;  3VKM A;  4RA0 A;  3UGG A;  4S2G A;  3V0B B;  1GFF 2;  1HB2 A;  3N9L A;  4MGQ A;  1CWP A;  4LO8 A;  3TEW A;  3K3O A;  5BNO B;  5KBF A;  2WNU C;  1J3Q A;  3LAG A;  4IV3 A;  5I8T A;  4RQP B;  4Q0P A;  3FE5 A;  5CNA A;  1W06 A;  3R0R A;  2A6V A;  2G19 A;  2C26 A;  4W6Y A;  2DFB A;  1JTZ X;  4YVS B;  5FYU A;  4AYU A;  1LES A;  4TZD A;  3N9N A;  1YFX A;  3U11 A;  5HCF A;  2TEP A;  4CUA A;  1PX4 A;  1CAW A;  4EWE A;  4MET A;  4DMI A;  2VPV A;  1OA3 A;  3IN9 A;  3LFI A;  4XAE A;  5J09 A;  1DDL A;  4IE7 A;  1K5M C;  2PAM A;  4KMQ A;  3VD5 A;  4DNY A;  5J7M A;  1BEV 3;  2J1A A;  5BNN B;  1DHK B;  5M0T A;  3IT8 A;  2PN5 A;  3VBF B;  3O1V A;  1R64 A;  5LB6 A;  1AL0 G;  1Q8O A;  2WZE A;  3T4V A;  1NE6 A;  3K51 A;  1ASJ 3;  4R4Z A;  1LOE A;  2VTX A;  3ASI A;  1BHG A;  1FOD 2;  1SLT A;  1YQ5 A;  1CES A;  2VGD A;  2VTX J;  1PMH X;  4GJZ A;  5E88 A;  2NYY A;  2JB8 A;  4OUS A;  3SKV A;  5FKB A;  2UYB A;  4XHB A;  1COV 1;  5FZF A;  5FZD A;  1SBD A;  5DMY A;  3ON7 A;  1WLD A;  1AYM 2;  1LEM A;  1OA2 A;  1VP6 A;  4AVT A;  3K77 A;  4MYE A;  2B8M A;  1XSR A;  2GN7 A;  2MEV 2;  3MHZ A;  4NVP A;  2A1X A;  4ORF A;  4AGV A;  1PMI A;  4XF1 A;  1W3X A;  2BWA A;  2IFR A;  1VRH 1;  2FDG A;  3C2U A;  1CVN A;  5FY7 A;  2VCA A;  3WNM A;  1HJF A;  2SBA A;  2W52 A;  1G86 A;  2X10 A;  5E6H A;  5EV7 A;  3W59 A;  1CAX A;  4CXX A;  3MFC A;  4IEO A;  4FAG A;  2GAL A;  4CUB A;  3N7K A;  4XIO A;  2VBB A;  2ZMK A;  3POI A;  4EJR A;  1F5J A;  2D40 A;  1H9P A;  4LBK A;  2CY6 A;  2AR6 A;  3ZYR A;  4C1X A;  1NZI A;  5SV5 A;  2JD4 A;  1F4A A;  1D4M 2;  1Z7S 1;  1PNF A;  1VAM A;  3AFK A;  3EYP A;  3BTX A;  1HDK A;  2UWB A;  1HQW A;  2ZX4 A;  4LA2 A;  5ABJ A;  5LA0 A;  1YWK A;  2C24 A;  4ASM B;  5C3O A;  5IVV A;  2Y6L A;  3S0M A;  1GIC A;  3W9A A;  4CCD A;  1VBC 3;  2P6H A;  5KHJ A;  4YG3 A;  4Q4V 1;  3WF1 A;  2VQA A;  3AM2 A;  5IW0 A;  4YW1 A;  1XYP A;  3INA A;  3KMH A;  3ROU A;  4AI1 A;  2GNM A;  4AHZ A;  5C3P A;  1S1A A;  5LA1 A;  2WWU A;  4IEV A;  3RQ0 A;  2ATF A;  3D0S A;  3IMM A;  4AED B;  3MIG A;  4Y3O A;  4D69 A;  1GNY A;  2BGO A;  2HJI A;  2ZX2 A;  3HAG A;  2DFC A;  2VW2 A;  4W65 A;  5BNP A;  4ZON A;  4YRD A;  5K0U A;  4C0H A;  3BU7 A;  1WBL A;  5JOX A;  2J1R A;  2RMU 3;  4Q0V A;  5I0D A;  2BQP A;  2ARX A;  2DCT A;  3WX5 A;  4PI0 A;  1NYW A;  4BXF A;  2WNE A;  1ND2 B;  2ZEX A;  2Q1F A;  5APA A;  5A6Y A;  2I45 A;  4LUL A;  4UFM A;  1SHW B;  2ERF A;  4L0P A;  1W9F A;  1RUH 1;  3O0V A;  2VQT A;  3PNA A;  4Q29 A;  4YW7 A;  1NA1 A;  4JGZ A;  4LBQ B;  2ZKL A;  3KHC A;  1MPX A;  1JYX A;  1W8F A;  2CTV A;  3I2J A;  3W21 A;  3HOB A;  4KWJ A;  2ZHM A;  1ST8 A;  2YZ4 A;  2PAE A;  2QDR A;  1NQD A;  3JQW A;  3GGL A;  1UY0 A;  4XJ8 A;  4YVW A;  1AX0 A;  2UY8 A;  3U07 A;  4BU2 A;  3K4D A;  2ZCW A;  3LA3 A;  1ND3 A;  1YYN A;  2Q8C A;  1I6X A;  2VNR A;  3UL2 A;  2HLE A;  4I2O A;  3FWE A;  4E8D A;  3H7Y A;  4PLN A;  1EAH 1;  4LK6 A;  1AVB A;  1QQP 1;  1EV1 2;  1VE0 A;  4MXV A;  1OLR A;  4UXA A;  5C71 A;  1WCK A;  4KH9 A;  2R07 2;  3EXU A;  2X5I B;  1QMJ A;  2JG8 C;  2RDQ A;  4XFC A;  4E2G A;  5CEH A;  1SLL A;  3JBG 1;  5HCB A;  1WGP A;  3MUY 1;  1CX4 A;  1MS8 A;  2Y0I A;  2VJX A;  4YZ2 A;  2E7T A;  2Q1M A;  2W3J A;  2CAU A;  2WFF 3;  3LIH A;  3NV2 A;  2A75 A;  2VG9 A;  3OBR A;  1TMF 3;  4O65 A;  1WLT A;  2CGN A;  3I3Q A;  4P9L A;  3A0N A;  1YI7 A;  5EYX A;  5FZK A;  3TOJ A;  2AUY A;  1AL2 2;  4IE6 A;  4QKN A;  1U5Y A;  5FLH A;  3WG1 A;  4AHX A;  2BNN A;  3O1S A;  1HQL A;  4GWI A;  2JDH A;  1AX2 A;  4R52 A;  3ZPY A;  2NMO A;  2R1B A;  1K5M B;  4IE0 A;  4XE9 A;  4XBL A;  4PF1 A;  2P17 A;  2QQV A;  1G8W A;  3OG2 A;  4XJU A;  4UBG A;  4QB1 A;  2HWB 1;  4E4H A;  2RS1 1;  5DDJ 2;  3K2O A;  3WF3 A;  1ZZ8 A;  1MVE A;  1FAY A;  4KQ7 A;  3MIE A;  1OHF A;  2OQ6 A;  4PCR A;  3H1Y A;  2BDR A;  4CEW B;  4WVW A;  4AK3 A;  3DEM A;  4RD7 A;  1YXW A;  2P37 A;  5BNP C;  1OQD A;  4FOV A;  5K0U C;  3SC7 X;  5GKA C;  1MAC A;  2V09 A;  4QGL A;  3NW4 A;  3P3N A;  4FI9 A;  4FPJ A;  3UGH A;  4AZZ A;  3RZJ A;  5FY9 A;  4NIH A;  3KV9 A;  1A34 A;  2YUE A;  2R49 A;  2X29 A;  4LUM A;  2CNA A;  4NOT A;  3OB8 A;  4QHB A;  1RIT A;  3A0K A;  3RSJ A;  3ZYJ B;  1PX3 A;  4PDW A;  4UFL A;  4AXO A;  4M3C F;  3GHM A;  4I0A A;  5ISL A;  1UPI A;  1BMV 2;  1NA1 C;  4JGZ C;  1MS0 A;  4ONU A;  4A3Z A;  4GKY A;  5FMB A;  1IKQ A;  1JU3 A;  4J1W A;  3HIF A;  4L99 A;  1BBT 1;  1ZBA 1;  1PO2 1;  3CIH A;  4XQ4 A;  3R6S A;  2WAO A;  4HSL A;  5LBE A;  4COW A;  4YVW C;  1UNB A;  3U4X A;  3AP7 A;  2CWS A;  1ND3 C;  4EE2 A;  1S2B A;  4GD4 A;  4LOT A;  1SPP B;  4IES A;  4XQD A;  2OYZ A;  3ZFE A;  2C9A A;  2UYA A;  1WBF A;  3OY8 B;  2HEY F;  3N7M A;  4A7Y A;  2K0G A;  3IIA A;  5FMD A;  4MG2 A;  3AL6 A;  1OLQ A;  4OLL A;  5T54 A;  3III A;  4D6S A;  1OKQ A;  1XNK A;  4QD2 A;  3H9A A;  2IUW A;  4CYD A;  4YW6 A;  2FQP A;  2PEL A;  3MFA A;  4WVV A;  4MOA A;  4URA A;  3ZDV A;  4XFG A;  1QJY 2;  4U2A A;  2R1D A;  1UYP A;  2Z5W A;  1AR9 2;  5FYV A;  1ENQ A;  5LK5 A;  2A6Z A;  3U10 A;  2RDR A;  1EUT A;  2Q8E A;  2RJK A;  1A78 A;  1N47 A;  2QUO A;  4AE2 A;  5BYN A;  4AFC A;  1G9D A;  4XFB A;  3ZMN A;  2OPK A;  2PA7 A;  1AR8 2;  1CAW B;  4YSF A;  5GLU A;  1Z7S 3;  1QNW A;  1VRB A;  4AVC A;  1UWW A;  2QKD A;  5E89 A;  1CPM A;  1NOV A;  2XHN A;  4I30 A;  1YC6 1;  4CCO A;  4BQ1 A;  3ECQ A;  4HN1 A;  4EN9 B;  3WDX A;  1G6N A;  1G9F A;  5FZ7 A;  1PVC 2;  4J6G A;  3TN9 3;  3ZFF B;  2ZGU A;  4KL1 A;  3VL8 A;  4C90 A;  4EWA A;  2VAU A;  1LOC A;  5G04 L;  1NLQ A;  2YGL A;  3E6B A;  2F4L A;  3GNE A;  4MHR A;  3RFR A;  4E4S A;  4S2H A;  3B94 A;  4AW7 A;  1LOF A;  2XXZ A;  3AZV A;  5FZL A;  1Y43 B;  1SQ4 A;  3KT1 A;  1Z0H A;  1R08 3;  2QQU A;  1W6M A;  2BOI A;  2P34 A;  1LGC A;  5FTT C;  4YG0 A;  1RUJ 2;  4DRR A;  3N36 A;  1C1F A;  3H8U A;  4K40 A;  1AYN 3;  3RYR A;  3HBK A;  2EXH A;  4ZKT B;  1H9W A;  5GAL A;  2XG3 A;  1TE1 B;  2D93 A;  3LE0 A;  3E6D A;  2F4P A;  2ILM A;  4M00 A;  1JU4 A;  1TME 3;  4C1W A;  2NMN A;  1RUC 1;  4LHL A;  4PDW C;  4LKD A;  1XPW A;  2E33 A;  2VE1 A;  3I59 B;  4ARX A;  3WDV A;  2B46 X;  4XYX A;  1OVS A;  5FAX A;  1SCR A;  1CAX B;  1RUH 3;  2JG8 B;  1T6G C;  3A22 A;  3JD7 2;  3SCG A;  1OMI A;  5KXC A;  2JKB A;  2D3R A;  4GAZ A;  1FOD 1;  1IQA A;  4XPV A;  3FHQ A;  2OW4 A;  1UIJ A;  3J26 N;  4Y20 A;  5E8A A;  3H3Z A;  2D97 A;  5FZO B;  5A7N A;  5DZF A;  2J22 A;  1MQT B;  4DY3 A;  1GOF A;  4Q1P A;  4P08 A;  1D7P M;  3M3I A;  1CZT A;  4COY A;  1GV9 A;  1AYM 1;  4DIN B;  2YGM A;  5FCC A;  3ZFE C;  1RYY A;  2AH2 A;  1F5F A;  4FTE A;  3FN9 A;  3SHR A;  4LIV A;  2DDU A;  2EAK A;  4XET A;  4NRQ A;  4AQ6 A;  1J1L A;  2E7Q A;  4QB6 A;  5HCH A;  1EAH 3;  1ZX5 A;  2D6N A;  4UF0 A;  3VBS A;  3MEP A;  2DWR A;  2VZV A;  1F2N A;  2W1S A;  4BXS V;  5FXZ A;  2A5Z A;  2QQP A;  4ITC A;  4BQ5 A;  3VKN A;  4AVA A;  2FBE A;  3HJR A;  3JBG 3;  5FZ9 A;  3GF6 A;  4AFM A;  3K48 A;  1L3J A;  2V4A A;  3NJY A;  2FCU A;  2UUR A;  4E27 A;  4F83 A;  3FC0 A;  4YW3 A;  3PUQ A;  2Y34 A;  4HVR A;  2G9Z A;  1D4M 1;  5B4X A;  4AAP A;  4AOC A;  3X29 B;  3AMN A;  5DPN A;  5AFE A;  4BK5 A;  5FYZ A;  3GDB A;  3IPV B;  2IWG B;  2IXL A;  3BCW A;  5SV8 A;  3DEC A;  2CYF A;  1R1Z A;  4XFI A;  1V6N A;  3WT3 A;  1GQG A;  1O6U A;  1MZE A;  3MDP A;  2RM2 1;  4JVA A;  3QLQ A;  4QX7 A;  3JB4 C;  3U75 A;  4KU7 A;  4B4R A;  4CDU A;  3D0J A;  2V72 A;  1LOF C;  3ZFG B;  2VCB A;  5A33 B;  2FDK A;  3KZ4 C;  1LED A;  1NA1 B;  2RS1 3;  1ODN A;  2HBT A;  2ZX0 A;  1SLI A;  4S2F A;  2VBD A;  4EN8 B;  3MLK A;  5JR2 A;  3KQR A;  1PNG A;  2WLQ A;  1YFY A;  2JX9 A;  2HWE 3;  5DG2 A;  1U12 A;  4FFI A;  2Y6H A;  1Q8Q A;  1J3R A;  2YYO A;  1NAE A;  4SLI A;  5LAS A;  1JZ7 A;  5EQU A;  2XH6 A;  4YVW B;  1RHI 1;  1ND3 B;  1BCX A;  1KJR A;  3P5B A;  1CR7 A;  4BM8 A;  4CU8 A;  2UU8 A;  4DRV A;  2GN3 A;  3VZJ A;  2R0H A;  1BQP A;  4KNC A;  2L9L A;  5T3N A;  4RGA A;  1VBB 3;  3MYX A;  5C33 A;  1NX9 A;  4H7L A;  1PK6 B;  5DUX A;  4AI8 A;  4ASL A;  2Z79 A;  5DN2 A;  4AVS A;  1H6X A;  4FPK A;  3K3N A;  4RGK A;  2VU9 A;  1L7L A;  2ZMN A;  4K1Y A;  5F2W A;  4IEU A;  4ISR A;  1RUD 3;  1UPS A;  3LB9 A;  3OOX A;  4IV1 A;  4AFD A;  5JOY A;  1KDK A;  1ZRI A;  2FZ1 A;  2VNO A;  1J83 A;  1PIV 2;  4YGC A;  1GAN A;  2OXB A;  4LK7 A;  3N9M A;  4DOU A;  2VY0 A;  2VM9 A;  5IK5 A;  3THT A;  2W08 A;  1ZBA 3;  3LSE A;  3MO4 A;  1OD3 A;  1G9B A;  2YU1 A;  4E8C A;  5C4W A;  4XBN A;  4LR4 A;  1COV 2;  2E7A A;  4FAH A;  1LNS A;  3HPN A;  1LHO A;  2BFU L;  1Q8P A;  4CVU A;  2IVJ A;  2BPA 2;  1CZV A;  4YNI A;  3VBS C;  5FKC A;  4ATF A;  4RL7 A;  1ACC A;  1VRH 2;  2R07 1;  4QM9 A;  5F8P A;  1TQ5 A;  3O1U A;  2YB7 A;  1QEX A;  1DGW A;  5JLV A;  3AZY A;  1US2 A;  3POE A;  4OI2 A;  4U36 A;  4Y1V A;  2RS3 2;  1RUE 2;  1QH7 A;  2ZAC A;  4L2N A;  2QCS B;  2H0V A;  2JE9 A;  2UWA A;  4Q0Q A;  4OMC A;  3LZZ A;  2HEW F;  4XAB A;  2XJR A;  3PU3 A;  3QH6 A;  4PLM A;  1QHD A;  4GKX A;  3S30 A;  1O59 A;  3ZN6 A;  1JYW A;  1QJX 1;  2GAU A;  3WR0 A;  4QX8 A;  1IQD C;  3AZZ A;  3KF3 A;  1NCQ B;  5DUU A;  2A3W A;  4LMF A;  4N43 B;  1JYI A;  2K2S A;  2ZS6 B;  2PHT A;  4ZU4 A;  1HIX A;  1CPN A;  5F37 A;  4HMZ A;  4K7J A;  4PQ9 A;  1UZW A;  1WW6 A;  3RS6 A;  5A3U A;  3KGZ A;  1ZRF A;  2HWF 2;  5EHD A;  4CDU C;  1LB2 A;  4PDW B;  1WW5 A;  4DXZ A;  4M0H A;  4BPZ A;  5DDJ 1;  3JB8 A;  5C6C A;  5IAX A;  1SG3 A;  4Q4V 2;  4RHV 1;  3DKW A;  3MPB A;  3ZXG A;  5F6L B;  1VAL A;  1KRI A;  3VD4 A;  3MIC A;  4GIQ A;  5F32 A;  1J3P A;  3GJB A;  2Q8D A;  1X8E A;  3ACF A;  1B09 A;  3LF7 A;  3KWV A;  4YZ3 A;  5HV0 A;  5E16 A;  1X82 A;  3P1I A;  4QAW A;  5FZH A;  2D43 A;  1NCR B;  1EPW A;  3ZFE B;  3ZSM A;  5J98 B;  3CO2 A;  1BVV A;  5IK8 A;  2RR1 2;  5E1R A;  2PHW A;  2VXJ A;  2WO1 A;  3LPF A;  2ZGM A;  3MW3 A;  4LO4 B;  4XJ9 A;  5FDB A;  4FTB A;  4NUB A;  2VEC A;  1POV 1;  4FP2 A;  5FWE A;  3WSO A;  2NPI A;  1UO9 A;  4K9S A;  1OQ1 A;  3SH3 A;  5JZG A;  4IE5 A;  3GAL A;  2D5F A;  1A8M A;  3LA2 A;  3S7I A;  4AHW A;  1OFS A;  2LRO A;  3AKQ A;  4AGR A;  4CCL A;  4IV1 C;  3ZX7 A;  1XND A;  1GU3 A;  2A71 A;  2WQ8 A;  2A6Y A;  4CCN A;  5LWB A;  1EP0 A;  3MUZ 1;  5JR7 B;  1FOD 3;  2BJS A;  2XJS A;  1V9U 1;  4LKF A;  5CKM A;  3UJO A;  5J37 A;  1E5S A;  1JXN A;  2YBS A;  5LRR A;  1UD1 A;  2DV9 A;  4QPG A;  3VN4 A;  1ZZ7 A;  2CHH A;  5C4W C;  2EXI A;  2WN2 A;  4UFI A;  1UN1 A;  2JD9 A;  2MEV 3;  3WDW A;  1Q43 A;  4KGQ A;  1VMH A;  5FRA A;  1OC1 A;  1QDO A;  4AHY A;  3KCY A;  3LKJ A;  3WNN A;  1C3H A;  3FFQ A;  3MID A;  3OBZ A;  2WT1 A;  1DGR N;  3OD4 A;  1HLC A;  1UKG A;  5A1A A;  1BZW A;  5FPZ A;  4HKO A;  3ZO0 B;  1I1E A;  5FY4 A;  1RMU 1;  4CDX A;  1QJY 1;  1UU6 A;  1O5L A;  1JZ6 A;  2N7G A;  3JUU A;  1AR9 1;  4D7S A;  2VZU A;  1YO8 A;  2BUK A;  1UMZ A;  3GM8 A;  1IHM A;  1STM A;  3WLU A;  1V6O A;  2TUN A;  3L9J T;  2D7F A;  5FYC A;  1D4M 3;  5ACA 1;  2JDN A;  4RFT 0;  1OQE A;  3NNJ A;  1XYO A;  4QQ2 A;  1MS1 A;  2PHX A;  3RYP A;  3TB0 A;  1Q56 A;  4Q2F A;  1RIN A;  4LIT A;  4Q1R A;  4RR3 A;  2NP0 A;  2QJV A;  1VB4 A;  3MIF A;  2D44 A;  3U1X A;  2YG0 A;  1HXS 2;  2P5B A;  3USU A;  4XUO A;  4XJW A;  5FYH A;  3EQE A;  3M70 A;  4PJY A;  4MV2 A;  1OH4 A;  5C7G A;  1JUI A;  5L9V A;  1QIQ A;  1ZZB A;  3LEI A;  4KG8 A;  1A8D A;  4NHX A;  4MGT A;  4WVM B;  2BWC A;  4KWK A;  1J59 A;  1RUJ 1;  2ARB A;  3I2H A;  5LK7 B;  4QQO A;  2A6W A;  4QXH A;  5FZ1 A;  2ET7 A;  5L73 A;  4CZS A;  1SDD B;  4QU2 A;  2BV4 A;  2DVB A;  1YRZ A;  4FFF A;  4QXC A;  2X05 A;  4BCU A;  1K42 A;  4BQ3 A;  5FWJ A;  4NR1 A;  5A70 A;  4DPN A;  3ZR5 A;  2ADE A;  3AZX A;  4EN7 B;  2AGS A;  2ENR A;  2RE9 A;  1W39 A;  1H2K A;  3IDC B;  3I7D A;  3WUD A;  5JZG C;  4YM0 A;  3VBS B;  4M3C E;  3UKN A;  2XKO A;  1W03 A;  4BA6 A;  1JZ4 A;  1NLR A;  4BIS A;  4UI9 L;  4Y22 B;  1UU5 A;  5JSP A;  5GZF A;  2XGX A;  4Z8B A;  3JD7 1;  1QXR A;  4HN0 A;  3N9O A;  5CZK A;  5A3N A;  1JZ2 A;  3O1T A;  2XOM A;  1CON A;  1YLL A;  4R9B A;  2DUQ A;  3I3D A;  2XL7 A;  1OKO A;  4XF9 A;  4AAX A;  2C4X A;  5BXX A;  2JE7 A;  5A3L A;  1WCD J;  3ES4 A;  3OPZ A;  4QPG C;  1HB1 A;  4QX5 A;  3T1M A;  2CAV A;  4WM8 A;  3HQR A;  4I3P A;  1DIW A;  1OA4 A;  1PO2 2;  2YY1 A;  1WW4 A;  3B7M A;  2G9F A;  1FV3 A;  3NAP A;  5D1I A;  4NHY A;  1IG0 A;  3CNA A;  5TSW A;  1H1A A;  3TWI A;  4D7Y A;  5C8C B;  5IK7 A;  1LGN A;  2WKK A;  4RS5 B;  5KHK A;  2ZZQ A;  3T2O A;  4C91 A;  1EV1 3;  3BAL A;  2WA4 A;  2IFW A;  4V2V A;  2DVG A;  1XNA A;  2BEO A;  2R07 3;  4CDX C;  3B00 A;  2P3I A;  1YFW A;  3DUI A;  3ZM8 A;  5JMC A;  1A6C A;  3SKJ E;  2VUC A;  3AKS A;  1ZVF A;  4XTM A;  5FXX A;  1O4Y A;  3R4U A;  5I0U A;  3DGT A;  3VHR A;  4H7M A;  3ZKY A;  5C3R A;  3V0A A;  3ACG A;  3K4A A;  2CL2 A;  3OBT A;  1GOH A;  2VQU A;  4MAD A;  4NRM A;  5FP7 A;  1AL2 3;  1UOJ A;  3QAC A;  5FRE A;  3S6P A;  4DFS A;  2W9X A;  5IVB A;  2HBU A;  1X50 A;  1D0H A;  3JZV A;  4M0N A;  3H42 B;  3KQ4 B;  3CKH A;  4RR3 C;  5DAW A;  3H7J A;  4HON A;  5IFP A;  2XJV A;  3AK0 A;  4EN6 B;  1I3H A;  1DYO A;  2XJU A;  2BGP A;  2VW0 A;  3LCP A;  2E51 A;  3RNS A;  4AG4 A;  5KXD A;  4BLI A;  2J1U A;  4XZP A;  4NII A;  5A1L A;  4MGS A;  5CG8 A;  1W9T A;  1VBA 2;  3NKT A;  3OEB A;  5FZI A;  2XL9 A;  2PTM A;  5B4N A;  2ZAA A;  5LAT A;  2GSY A;  2QE3 A;  3PUH A;  5DG1 A;  5DAP A;  5A1F A;  4GMP 0;  4G4F A;  5FP8 A;  2Y26 A;  1CZS A;  4F3J A;  4PIX A;  3LD8 A;  3MZH A;  4AGG A;  5GLZ A;  1O5U A;  1H1M A;  1OUR A;  2VZO A;  4Y1Z A;  4D0Q A;  1QKQ A;  4N7U A;  5CA6 A;  2IXC A;  5BPX A;  4NIG A;  2PQS A;  4EV0 A;  3OF1 A;  2E53 A;  1RUG 1;  2Z4F A;  5FO8 B;  3AMP A;  1POV 3;  2BRT A;  1CJP A;  4BQ2 A;  5F7U A;  1RUC 2;  1MS5 A;  3TYJ A;  4BME A;  2EID A;  5I8S A;  4LLF A;  3MF9 A;  4RYD A;  3ZOI A;  4Z1V A;  5T5L A;  4XAA A;  2VNV A;  1PIV 1;  5AC9 2;  4BJ0 A;  4CCC A;  1YQ2 A;  4A2U A;  4WM8 C;  3ZN6 B;  3RI8 A;  5EFU A;  1Y9G A;  2ZTN A;  3D8C A;  4ET7 A;  3BU0 A;  2FCV A;  4JHZ A;  3ZIW A;  2YRO A;  4X8N A;  3NAP C;  1GQP A;  1W6Q A;  3B01 A;  4YGE A;  5DZE A;  2GU9 A;  4XF4 A;  2J42 A;  3HQU A;  4XVH A;  5DXD A;  4F8A A;  1QY4 A;  5IVJ A;  1PO1 1;  5CIR A;  1GZW A;  2QNK A;  3BPZ A;  4PF5 A;  1ZNP A;  1DQ2 A;  1UY1 A;  1Y4W A;  2R06 2;  4LBN A;  4PI2 A;  2B9U A;  3J8F 2;  5I91 A;  4MH0 E;  2A3Y A;  2XKP A;  3CEW A;  2BVV A;  3IM0 A;  3NRU A;  3ZLI A;  5FPV A;  3DYO A;  2RS3 1;  1RUE 1;  2ES3 A;  1GBG A;  2H6B A;  1C5H A;  1QJY 3;  5FJK A;  2OX0 A;  4LJH A;  5CFC A;  4LKS A;  4TWT A;  4D6R A;  2ZHN A;  1S0J A;  1S0F A;  2VC9 A;  2XML A;  3I2F A;  1DZR A;  1RB8 G;  2XQX A;  1PGS A;  1OOP A;  3G7D A;  1AR8 3;  4FO9 A;  3M1H A;  3TEX A;  2GZW A;  1VBD 2;  2ORZ A;  3LPG A;  4ES9 A;  3A21 A;  2V4V A;  3AP6 A;  3E97 A;  3RPQ A;  3C7G A;  3WP6 A;  2HWF 1;  2VMF A;  4X6R B;  1SBE A;  5DAB A;  1PVC 3;  4I0W B;  4A44 A;  5JZG B;  1LU1 A;  3VB9 A;  3IDA A;  1POQ A;  3IDB B;  1SLC A;  2XUE A;  3VZL A;  2RM2 2;  5FIX A;  1OPM A;  2XBO 2;  2HWC 2;  1FNZ A;  3AYA A;  4FVV A;  2B7Y A;  4IV3 C;  3KF5 A;  1QJU 2;  3WW2 A;  2VUJ A;  3WF2 A;  4N8M A;  3H3U A;  4ERO A;  2C6S A;  3APB A;  4QPG B;  5CVR A;  1RUN A;  1FYU A;  1N3Q A;  1RUJ 3;  2ZEY A;  3IMN A;  4AF9 A;  2QVS B;  1CAU A;  3KV6 A;  5CKN A;  4LXL A;  5D2A A;  1W90 A;  2XLF A;  3LEK A;  1GWK A;  2RR1 1;  3CMG A;  1GWM A;  1RHI 2;  2VMC A;  1O91 A;  1O4Z A;  4I0B A;  5KC5 A;  3E5U A;  1RJ8 A;  1GZT A;  3C7H A;  3GBF A;  4HET A;  4K21 A;  2QBX A;  1FX5 A;  3NJZ A;  4MSV A;  3KT4 A;  2RJ2 A;  1X33 A;  3E5X A;  1C8M 2;  5FMC A;  1HRI 1;  1CIY A;  2PFW A;  4DZG A;  2O8O A;  3ACI A;  3BGA A;  3OBA A;  4OHX A;  5JIA A;  2Y8K A;  5KHG A;  3OUH A;  2WFP A;  1GP6 A;  2VH9 A;  1BKZ A;  4JKM A;  4Q4Y 3;  3EHK A;  4YG6 A;  2JG9 B;  3C7E A;  2D6L X;  3OGR A;  1AR6 2;  3BOW A;  2CGO A;  3O0X A;  1SFN A;  4XEZ A;  3BOP A;  3T1L A;  1W6N A;  1XOY A;  4OHW A;  4YGD A;  4XQW A;  1Q3E A;  2Y64 A;  4CP9 B;  1EYB A;  2GDF A;  1PZ8 A;  2KM2 A;  4LPL A;  1IZ3 A;  3E1F 1;  2K46 A;  1O3T A;  4MVT A;  3WNX A;  1HB3 A;  4QDR A;  3WHU A;  5L9R A;  2ZJC A;  3CZU A;  5JOZ A;  2YFU A;  4SBV A;  1E57 A;  5CYY A;  5KHH A;  3NNG A;  4UW5 A;  5F3I A;  3RZK A;  1PZ7 A;  5FZE A;  4XF0 A;  1LOA A;  4OQ9 A;  5CFC C;  3I2D A;  1CGP A;  5KR7 A;  4PIY A;  5KHI A;  1GYK A;  4QWN A;  2J1E A;  4GUL A;  1UXX X;  2WNU B;  2VXR A;  1NT0 A;  3MPP G;  5FZ4 A;  1OOP C;  3NKG A;  2W5F A;  4BMB A;  4IDZ A;  1OVP A;  1O8P A;  4AI0 A;  3B9C A;  2BW8 A;  3NNM A;  2Q5T A;  1QJX 2;  3DF0 A;  5EXO A;  1TVG A;  2Y33 A;  2EAL A;  5ABJ C;  1KQR A;  4HXC A;  1JI6 A;  5LY1 A;  4FPF A;  4Q8L A;  1UYX A;  4XDQ A;  2YV8 A;  2ARE A;  2BVB A;  2OUJ A;  3WCS A;  3MW2 A;  4EZH A;  3MGU A;  1HXS 1;  4N53 A;  1DBN A;  3BPS A;  1RIR A;  2VUA A;  2DCJ A;  5EJZ B;  3WW4 A;  4CDW A;  3T2Q A;  3JU9 A;  4IE4 A;  3PJQ A;  1N1V A;  4X6Q B;  4E4D X;  2V73 A;  5FUI A;  4XJA A;  5F1R A;  2VL4 A;  4RHV 2;  3VD3 A;  4OQ8 A;  2WT2 A;  1W8U A;  1XBF A;  3R4D B;  3ZPO A;  2W94 A;  4GXL A;  4S2D A;  4WM7 A;  1H1I A;  1OUX A;  3KB5 A;  3BI3 A;  4WM8 B;  4YM1 A;  3D5O A;  1Q8V A;  1O3R A;  5IUQ A;  5LY2 A;  2MHF A;  1UOG A;  3N3H A;  1JMU B;  1BK1 A;  2BU9 A;  3WHT A;  4GH4 A;  3MLL A;  5DQ0 A;  4YW2 A;  1PGL 1;  5CFD A;  4LQR A;  1V00 A;  5HI0 A;  2NLR A;  4ZY9 A;  5IWF A;  3GJA A;  3PVE A;  4AVB A;  3T09 A;  1GZ9 A;  1GNH A;  1MEC 2;  2OT7 A;  4HK8 A;  1VBE 2;  2WQ4 A;  5IFT A;  2R7E B;  4JHT A;  3MI8 A;  1DCS A;  4YYO A;  1V6I A;  2ARC A;  2DBI A;  2PHR A;  4RN5 A;  3ZXF A;  3I3B A;  5CIS A;  3RJR A;  1PIV 3;  3AMM A;  4JTO A;  5H9S A;  2EAA A;  4MUV A;  1JZ5 A;  1JN2 P;  2DUR A;  3GZU C;  4QMA A;  5FJH A;  3V0A B;  1RVF 2;  3OGS A;  2VME A;  1Q5O A;  1V9U 2;  1W6P B;  3BB6 A;  4L11 A;  5FZM A;  4COZ A;  1W8O A;  4DUV A;  1PVX A;  4IER A;  5LBC A;  3VDC A;  3WF0 A;  1W0P A;  5C70 A;  3LGR A;  4EZ4 A;  1VJ2 A;  3HD8 B;  1COV 3;  3NNF A;  4B7K A;  5I0S A;  1WMF A;  1OXC A;  4XMI A;  3UGF A;  1WCU A;  3OYW A;  3UKV A;  3N4M A;  2VTF A;  2A70 A;  4UW6 A;  4V2W A;  4EN0 A;  3ACH A;  3I54 A;  5FZA A;  1JYN A;  1VRH 3;  1VPH A;  2VD7 A;  5FBZ A;  2WZR 1;  4QKB A;  3WUC A;  5EZW A;  1ASJ 2;  3RG0 A;  4A7K A;  1SEF A;  4LHK A;  1C4R A;  5J36 A;  3LDB A;  2RS3 3;  1RUE 3;  2VW1 A;  1GQH A;  4LIU A;  1RMU 2;  5I0R A;  4IV3 B;  1ULD A;  1X8M A;  3SLI A;  4W8J A;  3UET A;  2LW8 A;  5IHR A;  5JPM B;  3OUJ A;  1QH6 A;  2RDS A;  4P14 A;  4BLJ A;  3SEP A;  3RZH A;  1M06 G;  1ZA4 A;  1RUF 1;  2B39 A;  4O9G A;  1YIP A;  2G4I A;  2E32 A;  2WBK A;  3I3E A;  1QOS A;  5ACA 2;  2QQW A;  1MZ5 A;  1O7F A;  4N53 C;  1S0E A;  4DEQ A;  4AWD A;  2WIN B;  4CDW C;  4CUC A;  3TNP B;  1LAJ A;  4LNV A;  4P9I A;  4MGZ E;  5A3T A;  2JDY A;  3FHI B;  1BK0 A;  3RZG A;  1C28 A;  5T55 A;  2JEC A;  1VBA 1;  4Q4V 3;  4M4R A;  3WP5 A;  3KHB A;  2D6K A;  2AAC A;  2ZHK A;  1SFP A;  4ZPI A;  4WM7 C;  2QQN A;  3PTY A;  4YW4 A;  2JB4 A;  1K5J A;  3VDA A;  5FQ0 A;  4Q4W 2;  3H50 A;  1S2E A;  4GWJ A;  2PLV 2;  5FP9 A;  3TEZ A;  1OH3 A;  2VR4 A;  4IEY A;  4GH4 C;  4PHZ A;  5FBJ A;  1TZO A;  5H9R A;  2IVI B;  2PHL A;  3R4S A;  5CFD C;  3WNO A;  3FBY A;  5AFB A;  3IAQ A;  1T2X A;  3HQX A;  1XE7 A;  5EJ1 B;  2RHP A;  1G7Y A;  3OSD A;  4OI1 A;  2XJP A;  2ZX1 A;  4YLZ A;  3MV1 1;  3SXW A;  3O12 A;  1ENX A;  3PUI A;  2AC1 A;  4NN0 A;  3WDT A;  3ZXE A;  4DB5 A;  1FPN 2;  3OUI A;  2CDO A;  2JXA A;  2VMG A;  4OI4 A;  5LBF A;  3NV4 A;  3EJK A;  1H8T A;  3FBM A;  4QU1 A;  4CP1 A;  4FXG B;  1QOT A;  1GSL A;  5FR3 A;  5AC9 1;  1PHM A;  4RGG A;  2WNO A;  5JXH A;  2ZX3 A;  2P3J A;  4MXW A;  4QGN A;  2CDP A;  4Q4X 1;  4BDV B;  2W1U A;  3UYJ A;  1OOP B;  1DQ1 A;  1YQ8 A;  4C8D A;  3RZM A;  5HXM A;  5LZ6 A;  3I8T A;  1W6O A;  2W47 A;  4O61 A;  3POB A;  4QX3 A;  1XC6 A;  2PHU A;  3RMX A;  4HOO A;  4DXT A;  5HPO A;  4GWN A;  3ZXJ A;  5ABJ B;  3P6B A;  1OF4 A;  4FPG A;  3HVD A;  4FQ4 A;  1RUI 1;  4HKL A;  2R06 1;  3SEE A;  1DFQ A;  1W3V A;  3J8F 1;  3WV6 A;  1YQ6 A;  1UZY A;  1ZZC A;  1QQP 3;  1ZRR A;  3LSD A;  4PQQ A;  3VZM A;  1F35 A;  1BLZ A;  1XE0 A;  3S7E A;  3WF4 A;  3WNL A;  1ZBE 2;  1RUO A;  1O4T A;  1H2N A;  1LOD A;  3CU7 A;  3FMG A;  1J58 A;  1IS4 A;  1SMV A;  2VZQ A;  4RFR B;  2BP6 A;  3POY A;  2P6C A;  3CJI A;  4QQL A;  2W91 A;  1CAU B;  3L2Y A;  3O5S A;  5A3O A;  3SQO A;  5BNP B;  2EIC A;  4CPB D;  4TLF A;  1UZ0 A;  1VMF A;  5K0U B;  2QTW B;  2BBA A;  3DPR A;  3VGI A;  1VBD 1;  2Z2S B;  5J3U A;  4HT1 T;  4Q0U A;  3I3M A;  1XU2 A;  2WAA A;  4AQS A;  2QZ2 A;  2WJS A;  1LGB A;  2IZW A;  2VCM A;  3IAP A;  3VD7 A;  4Z07 A;  4HLT A;  3HMY A;  4IGP A;  3AMH A;  3J4U H;  5A7S A;  1HXS 3;  5FYM A;  2XBO 1;  2HWC 1;  4QM8 A;  4KGG A;  4NO4 A;  5FK7 A;  4CA9 A;  5F2S A;  1LEC A;  1QJU 1;  1W0N A;  5IAV A;  4Q27 A;  4B4Q A;  4EYU A;  2HWB 3;  1OPO A;  4GB3 1;  4JGZ B;  3LEM A;  1B35 A;  1XNB A;  1W9S A;  4UBH A;  2D3S A;  2CSG A;  3VDD A;  1PGW 1;  4MGI E;  4IEQ A;  4QDQ A;  5DZG A;  4QHZ A;  2JDA A;  1W6N B;  5A32 A;  4R8H A;  1YIF A;  1UY2 A;  4W4Z A;  3ILN A;  2AZ5 A;  4K3U A;  4CU7 A;  1JOJ A;  1LR5 A;  1WUV A;  2ZEZ A;  3PL0 A;  3Q9O A;  4PT6 A;  3FHA A;  4RSU A;  5CB7 A;  1VLN A;  2VOK A;  1Y7B A;  2VCC A;  3AP5 A;  1LEN A;  3EB7 A;  1ENS A;  4LO6 B;  4NAM A;  1EPZ A;  2LS6 A;  1MS4 A;  2QQL A;  4QKD A;  4IEW A;  2WII B;  1IGO A;  5T5O A;  2FD8 A;  1LOB A;  1C8M 1;  1RUG 2;  1H8T C;  1QXJ A;  1S2K A;  3WOG A;  3ZYG A;  2B4K A;  1LHW A;  3RGB A;  1RXG A;  4JKK A;  2W92 A;  3R05 A;  5FYB A;  2IXI A;  2K9Z A;  1M4W A;  1AR7 2;  2Y38 A;  3AC0 A;  4NPL A;  5FYS A;  5IAT A;  3MBW A;  4BZ4 A;  1XSQ A;  3MIH A;  4ATE A;  5IT6 A;  1AR6 1;  1H30 A;  2WQZ C;  1BBT 3;  1S4C A;  1PO2 3;  3ALQ A;  3KVA A;  1LU2 A;  3ENR A;  3NJX A;  1EUU A;  1NUK A;  2OPW A;  2VMI A;  3ZYF A;  1UAI A;  2I07 B;  3ZXD A;  3I97 A;  3S57 A;  4YZ5 A;  3PU8 A;  3W58 A;  3LQC A;  4V1P A;  1V6M A;  5LBB A;  3JQX A;  1W28 A;  1CJD A;  5EIY B;  1JZ8 A;  2FMY A;  4N53 B;  2GC3 A;  1PO1 2;  1NXM A;  4YZ4 A;  2RDN A;  3O14 A;  1UL9 A;  1AXZ A;  2Q4S A;  2WLP A;  1OI6 A;  1V6J A;  1UF2 C;  1LCL A;  1XRU A;  4Q5O A;  3V0B A;  4XXA A;  3MF6 A;  2WS9 1;  4Y4R A;  5BNO A;  5JMO A;  1W9W A;  3SCH A;  4HFS A;  3POJ A;  4FPH A;  1IPK A;  4NWW A;  4RQP A;  3CJI C;  2WO7 A;  5GJ6 A;  3WQ7 A;  1XXN A;  1RTV A;  1ZZ6 A;  3GXU A;  3HN1 A;  4IND A;  3WIN E;  3HN3 A;  5IVC A;  4GH4 B;  2LTN A;  4HZF A;  4CE8 A;  4FOQ A;  5I0T A;  5EP9 A;  3ZKU A;  2WZP P;  2WN3 A;  1SLB A;  2Y6K A;  5BNN A;  4TLG A;  3O0W A;  3BOD A;  5L9B A;  4A7Z A;  1GMM A;  3VBF A;  4A45 A;  4OFG A;  3ZSJ A;  3C3V A;  3VL9 A;  3CHX A;  5BY5 A;  5C3S A;  1OUS A;  2PAK A;  4K1Z A;  3KV4 A;  1W2N A;  2VVD A;  1S0I A;  1C8N A;  3G6J B;  1VBA 3;  4OHV A;  4Y5Z 0;  4FTS A;  4FPE A;  4COU A;  1UKR A;  2VMD A;  3THD A;  3VDD C;  3I2O A;  4QGM A;  1JOD A;  2ORX A;  3HNB M;  3USS A;  4UT5 A;  4ZU5 A;  5A6X A;  1NQJ A;  2XQR A;  1AHS A;  2RS5 1;  1IS6 A;  3WXP A;  4NHM A;  2GNT A;  4XIK A;  4BIF A;  5JSR A;  4GQ7 A;  1L7Q A;  1OT5 A;  1S55 A;  1ONA A;  2RJL A;  2BGC A;  3A23 A;  2WWJ A;  3AYC A;  3BIW E;  1JHN A;  5IVY A;  4CU6 A;  4LO7 A;  4NID A;  1MEC 1;  1VBE 1;  1HN0 A;  1ZRE A;  2WL1 A;  4KU8 A;  3URF A;  1RUC 3;  4XUQ A;  1T6B X;  2GC2 A;  1N3O A;  1MVQ A;  1ULE A;  4QPY A;  3SH4 A;  4Z82 A;  1HRI 2;  2YHJ A;  4CPB A;  1FMD 2;  2ZAB A;  3NNL A;  5AC9 3;  1R08 2;  3N35 A;  2RG4 A;  4A6S A;  1S0D A;  1WWY A;  1DZT A;  1RVF 1;  3FLP A;  4XFH A;  5F3G A;  5FPL A;  3ZYB A;  5LEK A;  2EXJ A;  4QXB A;  4LEJ A;  2V5D A;  4Y24 A;  2JDK A;  1QJZ A;  4I02 A;  3M2M A;  3LEG A;  1AYM 3;  1VR3 A;  3RWN A;  1O8S A;  1TME 2;  1BEV 1;  2ET1 A;  1JHJ A;  1VB2 A;  3J7L A;  4A3X A;  4BQ4 A;  4Y5T A;  5ANQ A;  2R06 3;  5JI7 A;  4B4P A;  3PIG A;  1ASJ 1;  5FMO L;  2YDE A;  5BNO C;  2AEY A;  1U5I A;  4JKL A;  1N1Y A;  3O7O A;  3W20 A;  4RQP C;  3MW4 A;  4JRL A;  3FJS A;  2WUH A;  4FQZ A;  1MZ6 A;  1W6M B;  4P9J A;  2Q8O A;  4HVQ A;  1ZRC A;  2R0F A;  5FLI A;  2D3P A;  4DUX A;  4FT8 A;  5JVV A;  1UU4 A;  2IXJ A;  4NPM A;  2W95 A;  2W39 A;  2Y6J A;  1VBD 3;  3T0B A;  1TNR A;  2A6X A;  5A3W A;  2XDV A;  4IEP A;  4UFH A;  5J96 B;  4URT A;  5BNN C;  4A42 A;  5FP3 A;  3B3Q E;  2C5D A;  5DAX A;  4FP3 A;  1UOB A;  1QNY A;  2JIJ A;  2RM2 3;  3VBH A;  1D0G A;  2PQQ A;  1H8T B;  4XIL A;  2HWC 3;  2BFU S;  1Y9M A;  2ZEW A;  5FYI A;  1X9T A;  2KR2 A;  2JIG A;  2YFZ A;  3Q8C A;  4HL0 A;  4ARY A;  2OUH A;  4Y20 B;  1YHF A;  5HXV A;  5A7O A;  4Q4W 1;  4TYS A;  3T3Y A;  1GUI A;  2PLV 1;  2BBV A;  4XW3 A;  5FY5 A;  1ULC A;  5ANN A;  1GP4 A;  1R09 2;  3ZXL A;  1DYP A;  1W6O B;  2A3X A;  4JDM A;  2XB6 C;  1F8V A;  2BNO A;  3ELN A;  1XYN A;  4JDO A;  1RHI 3;  2UY9 A;  1PGL 2;  1VBC 1;  1FPN 1;  5C5T A;  4UF0 B;  2DU0 A;  1UIK A;  4OUM A;  5EJ3 A;  3VKO A;  3B5L B;  2B42 B;  1C8M 3;  3M3Q A;  4ISQ A;  1JUH A;  1KIT A;  4J1X A;  5DUV A;  3JXS A;  2PXJ A;  1DGL A;  4XUN A;  1MR5 A;  3AJZ A;  3VLB B;  1IPJ A;  2HWE 2;  1N1S A;  3NL1 A;  3CJI B;  3KD4 A;  5F5C A;  5FZC A;  3PLQ A;  1OD5 A;  2XJQ A;  5C8W A;  1R1A 2;  4BQX A;  2ZKN A;  1ODM A;  1AR6 3;  2RMU 1;  3AZW A;  4KBZ A;  1QWR A;  2QQJ A;  4LBJ A;  3WW3 A;  5GZG A;  3NVC A;  2Z69 A;  2I2S A;  4Y33 A;  3IZO A;  1X9P A;  3WQ0 A;  3T0D A;  3VBO A;  3KGL A;  4L92 A;  5JOW A;  1H6Y A;  3O1O A;  1CD3 G;  1DLC A;  4JCK A;  2W0X A;  1HV1 A;  4CDU B;  1ZYB A;  5J48 A;  5CAD A;  4JZR A;  3ZN4 A;  2ZPX A;  1JW6 A;  1ZBE 1;  3OGJ A;  4NAO A;  5D8A A;  2JE8 A;  2C0Z A;  4KWL A;  2X8K A;  4EQV A;  1OFN A;  2R6Q A;  2WZR 2;  5FK8 A;  4K6B A;  3W5M A;  1BXH A;  2DUP A;  3E5Q A;  1DQ0 A;  3T2P A;  1DZQ A;  1WD4 A;  3DV8 A;  3ZMO A;  5CBL A;  3ATG A;  1I5P A;  4CEW A;  3VBU A;  4DQA A;  4CUG A;  2HKX A;  4TTG A;  4M3C A;  4N9I A;  3ZVX A;  4YZ1 A;  1PZ9 A;  3WW1 A;  2WNV A;  4AL9 A;  3RI9 A;  1QJX 3;  1F31 A;  3PJY A;  2H6C A;  4BE3 A;  3VUO A;  2GME A;  3J7N A;  3O1M A;  1RUF 2;  3ZYH A;  3TBD A;  4QPI A;  3MLJ A;  2OZ6 A;  2HYK A;  5FYY A;  2XON A;  4DO0 A;  3RDI A;  1HW5 A;  2XWB B;  4FOW A;  1UZZ A;  3VBH C;  2D6M A;  5HCA A;  2PHD A;  1WW7 A;  1SZB A;  2Y60 A;  3WZ1 A;  3HT1 A;  2Q1Z B;  3ZSL A;  3ZYP A;  5KXB A;  1UX6 A;  4QXK A;  1JOP A;  5F6K A;  4IV1 B;  5DDJ 3;  2WFF 1;  3ILF A;  4RHV 3;  5FFO C;  1KEX A;  3ETP A;  2B9V A;  3CZJ A;  3PMS A;  3TRS B;  5BNQ A;  5L19 A;  5K9Y A;  1A3K A;  1H0B A;  4Q8K A;  2VUD A;  4A6O A;  1GOG A;  2DYC A;  3B9I A;  4GMP 1;  5H9Q A;  3S5Q A;  4IGO A;  2AEZ A;  5H9P A;  5C4W B;  5LCW L;  2YC0 A;  1UZV A;  2J1T A;  3PUA A;  5F5A A;  3VZN A;  3AXE A;  5A6Q A;  2O14 A;  2GNB A;  1ULG A;  3B93 A;  3GBG A;  2UWC A;  2XWJ B;  3A7Q A;  1HKD A;  3VHN A;  4B3N A;  1HB4 A;  1RL3 A;  1TEI A;  1U5X A;  1VBE 3;  3N9P A;  1NLS A;  1REE A;  2WDB A;  3THP A;  4UFJ A;  1QJE A;  1IS3 A;  4GA9 A;  2X09 A;  1AR7 1;  1E5H A;  3AB0 A;  1QOO A;  2OII A;  4I09 A;  4N90 A;  2VZ3 A;  4CCK A;  3ZYI B;  1J84 A;  2ID4 A;  1GP5 A;  1RVF 3;  2EIG A;  2W68 A;  1V9U 3;  4COV A;  4JC1 A;  4Q4X 2;  1XJA A;  3KS7 A;  3SH5 A;  2EIE A;  3WP3 A;  5JUV A;  1W8Z A;  4BOW A;  1P8J A;  3VBO C;  3RYK A;  4AI3 A;  2F17 A;  5HV4 A;  3ZFF A;  2G9G A;  2EF6 A;  4LO5 B;  5D8A C;  1RUI 2;  3FX3 A;  2WR9 A;  3VD9 A;  1H2M A;  2FHR A;  4NHK A;  1UMH A;  3UES A;  4KWU A;  4YFZ A;  3VKF C;  3Q8E A;  3D82 A;  4LBO A;  4MGY E;  4CEW C;  3VBU C;  1RMU 3;  2P3K A;  4YM3 A;  3BN6 A;  4IW3 A;  3WP4 A;  3HR9 A;  2JJ6 A;  2BOJ A;  2HWD 2;  2WNV C;  1AR9 3;  3OJB A;  2R16 A;  4AFA A;  5FY8 A;  5A7P A;  3WG2 A;  1HV0 A;  1XNT A;  4NJ4 A;  4QPI C;  1WLC A;  3FL7 A;  2P3Y A;  4L9B A;  5ACA 3;  1HRV 2;  1SAC A;  5F9T A;  5T50 A;  2YPD A;  3T4H B;  1QF3 A;  2WZ8 A;  2YMZ A;  3CQO A;  4TN7 A;  2DU1 A;  4P9X A;  2FCT A;  3F95 A;  3OEA A;  4Y5S A;  2IXH A;  4QT6 A;  3I59 A;  4L8Q A;  3AKP A;  5DAV A;  3HNY M;  1NE4 A;  2OS2 A;  4XAC A;  4OMD A;  1YJK A;  4LKE A;  3ZIX A;  4BH9 A;  4Y26 A;  4JV4 A;  1YUD A;  4Y1Y A;  2JG8 A;  4D7T A;  4OHY A;  1V6L A;  2PMW B;  1W8W A;  4XFF A;  3RJ2 X;  3RZL A;  1F15 A;  3DYP A;  4BQW A;  5FZO A;  3U14 A;  4CTE A;  1MQT A;  4GB3 2;  4LBM A;  2VUL A;  1W9Y A;  2JDM A;  4Q4W 3;  2PLV 3;  3VBR A;  5CU1 A;  1NG0 A;  1PGW 2;  4P5Y A;  1KS5 A;  1QU0 A;  2DTY A;  4P9G A;  2BZD A;  4DXS A;  2TBV A;  3TN9 1;  3BKZ A;  3NO8 A;  4O7X A;  3RZZ A;  1VIW B;  1UXZ A;  1FXZ A;  3HWJ A;  1FPN 3;  3LOI A;  5F5Q A;  1UW8 A;  3FUO A;  1ENR A;  4IEX A;  4D94 A;  2R04 2;  1URX A;  1XQN A;  2WYF A;  1SDW A;  4LA3 A;  5FP4 A;  2WYS A;  4CDX B;  3POS A;  1FMD 1;  1R08 1;  4P02 B;  3JD7 3;  3LA7 A;  3IDE A;  4P9Y A;  3V56 A;  1UYZ A;  1YQC A;  1MS3 A;  2YXS A;  4XF3 A;  2JIC A;  5FZG A;  3E6C C;  4NRO A;  3C8X A;  1AYN 1;  3LOB A;  1DU3 D;  2GND A;  5FO9 B;  2GMM A;  3ZN5 A;  5BV6 A;  3C7F A;  4P00 B;  4E2S A;  1LJ7 A;  5GLW A;  2GP3 A;  2ADD A;  2KA3 A;  3IPV A;  4AEM A;  1X7N A;  1TME 1;  2SLI A;  3ME2 A;  5GZE A;  5D21 A;  5JCT A;  1WKY A;  3ZFF C;  2BER A;  1LTE A;  4RR3 B;  1K3I A;  3IWZ A;  2BYV E;  3OD0 A;  2B45 X;  3RVH A;  3USU B;  3VBH B;  5GLV A;  4YPJ A;  3ZFG A;  5A33 A;  1GWL A;  3V64 A;  1AUY A;  1ZBE 3;  4Y22 A;  5DUW A;  3VZO A;  3GZA A;  5JSO A;  3SCF A;  1GZC A;  4W50 A;  2FDH A;  1SCS A;  2WS9 2;  2I74 A;  4QDS A;  1V6K A;  4BQY A;  3UNP A;  1VAV A;  3WQB A;  1NKG A;  3U78 A;  1W0O A;  4NPR A;  3WCR A;  2O1Q A;  1IOA A;  4AEJ A;  4MLO A;  2D98 A;  2YC2 A;  4LOS A;  3BTA A;  1VAK A;  3H1M A;  3NMB A;  4AI9 A;  4CXW A;  1XU1 A;  4DEV A;  4E2Q A;  4TSV A;  1K12 A;  1H2L A;  5K4L A;  4FPC A;  4G3Y C;  2V5Y A;  4BB3 A;  1PMJ X;  5GZD A;  4CP2 A;  3TAY A;  5I93 A;  4XTP A;  1H8V A;  1CN1 A;  1IG3 A;  1NY7 2;  3VZK A;  1BJQ A;  3H1W A;  5F5I A;  1PK6 A;  2HH9 A;  4WZC A;  3PVO A;  5B2G B;  1W8T A;  1W2T A;  3NJV A;  4LE4 A;  1QXP A;  3ZDS A;  3CDZ B;  5FY0 A;  4E9K A;  3KLS A;  5G05 L;  3BTZ A;  3M3O A;  3CF6 E;  5FYT A;  5LA9 A;  4YAR A;  1AZD A;  1MQT C;  5FPB A;  3B02 A;  3AYE A;  2J1S A;  2OKX A;  5IVF A;  4LBL A;  1DQ6 A;  4FCA A;  4UWD A;  3VBR C;  2ZML A;  1F4H A;  4JTN A;  1R09 1;  3AXD A;  5EYY A;  5T52 A;  3VDB A;  2HYX A;  4YGB A;  1WMD A;  5I8Y A;  4GMP 3;  3KT7 A;  4FFH A;  4XJZ A;  2RS5 2;  2C1F A;  4AQT A;  2NN8 A;  3J9S A;  3NAP B;  1JZ3 A;  5IVE A;  2GMP A;  3OCP A;  3H8O A;  1H4H A;  3VBO B;  3THC A;  2EIB A;  1LHN A;  1N1T A;  3POF A;  4R9D A;  3SIS A;  4CCJ A;  3C7O A;  4OUE A;  1VMJ A;  4I01 A;  4I3G A;  2XLA A;  5AVP A;  1RUG 3;  1W2A X;  5D8A B;  4NWV A;  4QPW A;  4XHX A;  4ZXE A;  1UOF A;  2BTV C;  4NHL A;  2Y6G A;  5IJR A;  3U4S A;  1LHV A;  5IK4 A;  5JAX A;  2CV6 A;  2ZGK A;  5C9A A;  1AR7 3;  2HWE 1;  3VBU B;  4XUP A;  3DCQ A;  4M3C B;  1AJO A;  1R1A 1;  3AYD A;  1S0B A;  4FPL A;  5A6Z A;  5FOB B;  2YC4 A;  1FAT A;  2WNV B;  1HX6 A;  2E63 A;  4Y1X A;  1NCQ A;  2ZGS A;  4UOJ A;  2VOV A;  1JOB A;  1Y3T A;  3DL3 A;  4N43 A;  3WVJ A;  2VMH A;  1AF9 A;  2MNG A;  4QPI B;  4LTA A;  5A3M A;  1VBB 1;  2VZ1 A;  3CJX A;  2VQ0 A;  1WLW A;  3WG3 A;  3KV5 A;  2GC0 A;  1BEV 2;  5DAQ A;  1PO1 3;  3M7A A;  4N9H A;  3M4F A;  1G9C A;  3ZFG C;  1O3Q A;  1FT9 A;  2A7A A;  1RUD 1;  2DTW A;  1NXD 1;  3HBZ A;  2ZGN A;  1SLA A;  3I2G A;  2GH8 A;  1ALY A;  2VZP A;  2YBP A;  2XVL A;  3HT2 A;  2TNF A;  1LRH A;  2IC1 A;  3NV1 A;  2RV9 A;  4LUK A;  4MHU A;  4Y1U A;  2XVK A;  4O9E A;  3WQ1 A;  1D4V B;  4OI0 A;  2B5H A;  1YFU A;  4Z2W A;  4B1M A;  3KCX A;  3PVB B;  4ZZ8 A;  3KCC A;  1N3P A;  5JPN B;  2QDN A;  5IYY A;  3QH7 A;  4A4A A;  4CU9 A;  3K46 A;  4IGQ A;  4ZS3 A;  1NCR A;  1KXG A;  3VHO A;  4LE3 A;  2JDU A;  3OPT A;  5JIU A;  1JBC A;  2QQO A;  4Y4Y A;  4CDQ A;  1PK6 C;  2YU2 A;  4WZF A;  2FMD A;  4JQR A;  1GKB A;  5AVA A;  2HWF 3;  2P4E A;  4J25 A;  3ORJ A;  2R32 A;  2EXK A;  3W5N A;  1MS9 A;  4H3W A;  2WO2 A;  2OVU A;  1KD7 A;  3KM5 A;  4HPK A;  4KBB A;  3T30 A;  4GAL A;  3U37 A;  3UJQ A;  2NZ9 A;  5FV3 A;  3T08 A;  1DQ4 A;  4MX3 A;  1ZZ9 A;  2ZXQ A;  1AJK A;  1DP0 A;  4IXL A;  3ABZ A;  3AVR A;  5JXI A;  2P2K A;  1US3 A;  3D4K A;  4XMA A;  4Q26 A;  1W6Q B;  4D6Q A;  1E5R A;  1AX1 A;  3N7J A;  2DVA A;  2JEM A;  5EPA A;  3JCI A;  2RR1 3;  3AP4 A;  2ZBJ A;  1GZW B;  4QQP A;  1Q8S A;  3DXU A;  5CKQ A;  3UKT A;  4XOG A;  3QBQ A;  4HSJ A;  2RVA A;  4DY5 A;  1VBC 2;  4X8P A;  3VV1 A;  2QQK A;  2XVG A;  5A80 A;  2ARA A;  2WRA A;  3SNM A;  5F39 A;  5C9A C;  1HRI 3;  1HQN A;  1ULP A;  5FLJ A;  1FMD 3;  5CFC B;  3TEY A;  4KG0 A;  2VOW A;  3VKL A;  3H0O A;  1KS4 A;  1NCQ C;  4AFB A;  4B7E A;  1YCI A;  4K8R B;  4R9C A;  4N43 C;  5L7O A;  2A73 B;  4AQ2 A;  2ZA9 A;  2VBP A;  1WD3 A;  1LHU A;  2RMU 2;  2XJT A;  3KVB A;  3O1P A;  4Z2A A;  1WA6 X;  2NQY A;  2OQ7 A;  4PBO A;  4R4X A;  3H3L A;  4OYU A;  3IBM A;  2ZGO A;  1WME A;  1PM4 A;  4B8E A;  4HVO A;  4FXK B;  2C9K A;  3WD5 A;  2ZGR A;  1OBN A;  5FZ0 A;  1DG6 A;  1CAV A;  2O8Q A;  2DVD A;  4WVM A;  4OHZ A;  4Q4Y 2;  2HWD 1;  1ZRD A;  2OA2 A;  3ZR6 A;  3OPW A;  5A7W A;  4YW5 A;  3VBR B;  4Z92 B;  3M8L A;  2GP5 A;  1D2S A;  1NCR C;  5T5J A;  1GLH A;  2BNM A;  4XFA A;  2MEV 1;  1HRV 1;  4XXP A;  4OZO A;  4CDQ C;  1WZX A;  3AVS A;  1JYV A;  3POG A;  3K4Z A;  4ZHN A;  1UX7 A;  5CG9 A;  3N9Q A;  5CAZ A;  5FZ6 A;  4JQT A;  1OLM E;  2R30 A;  2D5H A;  3AKR A;  2ZOE B;  2DBN A;  2WSV A;  3QD6 A;  5JXJ A;  3GYD A;  3FUQ A;  4FPY A;  1K45 A;  5KXE A;  2LRP A;  1UMI A;  4YWA A;  2F6B A;  2XR4 A;  5GZC A;  4UW3 A;  4HBN A;  3NQH A;  2JDP A;  1DQ5 A;  2WFF 2;  4H14 A;  2J7M A;  3ES1 A;  2VZR A;  1TMF 2;  1G9A A;  4M4P A;  4UW4 A;  4XCB A;  3PHM A;  5FPU A;  1APN A;  1R09 3;  3M3C A;  5T5P A;  2FDI A;  2FDJ A;  3BTY A;  1V0A A;  2W87 A;  5JWP A;  2VO5 A;  1DLL A;  2VNG A;  4LOR A;  4D3W A;  3BYW A;  2YPJ A;  5C8C A;  4RS5 A;  3AFG A;  3LWC A;  3WEZ A;  5L36 A;  2ETE A;  2R04 1;  4JGY A;  3BUC A;  1DGW X;  4LT5 A;  4ES8 A;  3QCW A;  2W2I A;  1OSG A; 
#chains in the Genus database with same CATH homology
 3NRU A;  3DYO A;  4ARY A;  2YFZ A;  4A3Z A;  3J7H A;  3WNP A;  4LKS A;  4MO3 M;  1JU3 A;  1GUI A;  2VC9 A;  3I2F A;  1HN1 A;  3CIH A;  2XQX A;  2WAO A;  2VZS A;  3WNK A;  4QB2 A;  4KI5 M;  3LPG A;  2ORZ A;  3A21 A;  2V4V A;  3C7G A;  2VMF A;  1TG7 A;  4XUT A;  4A44 A;  3III A;  3IDA A;  4MOA A;  3JXS A;  4XUN A;  3WF2 A;  1EUT A;  2ZEY A;  2QQJ A;  3LEK A;  4ZZ5 A;  1UWW A;  3CMG A;  2XHN A;  2VMC A;  1UY4 A;  3ECQ A;  4TXW A;  3T0D A;  3T0A A;  3C7H A;  1H6Y A;  2QBX A;  1DLC A;  2RJ2 A;  5G04 L;  1CIY A;  2JE8 A;  3W5M A;  3ACI A;  3BGA A;  3OBA A;  3T2P A;  2Y8K A;  1I5P A;  4JKM A;  4TTG A;  3C7E A;  3OGR A;  4DUX A;  2Y64 A;  3LE0 A;  4UAP A;  2W1Q A;  1JU4 A;  2XON A;  4LPL A;  1XPW A;  3E1F 1;  4A41 A;  2E33 A;  1UYY A;  4QDR A;  4QX2 A;  4ARX A;  3CZU A;  4DUW A;  2YFU A;  5CYY A;  3NNG A;  1UY3 A;  3A22 A;  3FHQ A;  2J1E A;  1KEX A;  1UXX X;  2B9V A;  3CZJ A;  3ETP A;  2J22 A;  3D3A A;  1GOF A;  1CX1 A;  2W5F A;  4P08 A;  1O8P A;  1D7P M;  4A6O A;  1CZT A;  1GOG A;  4BK4 A;  3I2K A;  1RYY A;  1TVG A;  2VZT A;  5JXG A;  2VOT A;  5LCW L;  4QX1 A;  3FN9 A;  1JI6 A;  2J1T A;  1UYX A;  2DDU A;  1W8N A;  1KGY A;  3A7Q A;  4QB6 A;  2VZV A;  2DCJ A;  5EJZ B;  2W1S A;  2WDB A;  3T2Q A;  4JX0 A;  1WCQ A;  4BXS V;  2J1V A;  2X09 A;  5FUI A;  2VL4 A;  3HJR A;  3VD3 A;  3F2Z A;  2W94 A;  2VZ3 A;  1J84 A;  4XUR A;  2ID4 A;  5B4X A;  2EIE A;  5DPN A;  3OGV A;  4BK5 A;  2KD7 A;  5JUV A;  3GDB A;  1P8J A;  2WAB A;  5DQ0 A;  3DEC A;  4LQR A;  4ZY9 A;  3T09 A;  2W46 A;  5IFT A;  2R7E B;  3VD9 A;  2V72 A;  4GZ9 A;  3UES A;  1UMH A;  2VCB A;  4KWU A;  3VD4 A;  5JR2 A;  4RN5 A;  3I3B A;  5LA2 A;  3BN6 A;  2E26 A;  1JZ5 A;  3OGS A;  2VME A;  2Y6H A;  1W8O A;  4DUV A;  1NAE A;  1JZ7 A;  3VDC A;  3WF0 A;  5C70 A;  1XNT A;  5J1X A;  3FL7 A;  4CU8 A;  4DXR A;  2WZ8 A;  2QQI A;  2L9L A;  2DCK A;  3CQO A;  2VTF A;  3OEA A;  3ACH A;  1NX9 A;  1JYN A;  5DN2 A;  3HNY M;  1H6X A;  4OMD A;  4LHS A;  3DYP A;  1J83 A;  3K75 B;  4QX0 A;  2JKX A;  4W8J A;  3UET A;  3HEI A;  2LW8 A;  5IHR A;  2VM9 A;  3MO4 A;  3SEP A;  4P5Y A;  1OD3 A;  4E8C A;  2BZD A;  2E32 A;  2WBK A;  3I3E A;  4DXS A;  1LNS A;  3HPN A;  4CVU A;  1CZV A;  4HG6 B;  1UXZ A;  4DEQ A;  4CUC A;  2YB7 A;  3I2I A;  2WYS A;  1US2 A;  4M4R A;  4XZU G;  4P02 B;  2QQN A;  1UYZ A;  4OMC A;  4IUG A;  3VDA A;  3C8X A;  4D8M A;  1O59 A;  1JYW A;  4GWJ A;  1IQD C;  2VR4 A;  3C7F A;  4P00 B;  3IB3 A;  3WNO A;  3IAQ A;  1T2X A;  5EJ1 B;  1WKY A;  2BER A;  3MV1 1;  2E31 A;  3PUI A;  1K3I A;  3HNM A;  2CDO A;  4YPJ A;  1SG3 A;  4W50 A;  1L7R A;  1OF3 A;  4QDS A;  5JXH A;  3UNP A;  2CDP A;  4BDV B;  3WQB A;  2W1U A;  1NKG A;  3ACF A;  2WO3 A;  2YC2 A;  4DEV A;  1W99 A;  3P1I A;  5HXM A;  4QAW A;  1K12 A;  2W47 A;  4QX3 A;  1XC6 A;  4DXT A;  1PMJ X;  5HPO A;  3P6B A;  1OF4 A;  2WO1 A;  3LPF A;  2QQM A;  2W1W A;  3MV0 1;  3DYM A;  3WSO A;  3SEE A;  1ULO A;  3NJV A;  4PQQ A;  3CDZ B;  3WF4 A;  3WNL A;  4MGQ A;  5G05 L;  1GU3 A;  2WQ8 A;  3MUZ 1;  2J1S A;  2OKX A;  2VZQ A;  2W91 A;  1F4H A;  2C26 A;  3VDB A;  2HYX A;  2EIC A;  2WN2 A;  1UZ0 A;  2BBA A;  2JD9 A;  4CUA A;  1PX4 A;  1JZ3 A;  2WAA A;  3THC A;  4KMQ A;  2EIB A;  3VD5 A;  3WNN A;  3VD7 A;  3IAP A;  2J1A A;  3C7O A;  4OUE A;  1R64 A;  5A1A A;  2WZE A;  4QPW A;  4ZXE A;  2Y6G A;  5IJR A;  1W0N A;  1JZ6 A;  1BHG A;  4XUP A;  2VZU A;  1W9S A;  1PMH X;  3GM8 A;  2YC4 A;  4QDQ A;  3SKV A;  2JDA A;  4UOJ A;  5DMY A;  1UY2 A;  3K77 A;  4W4Z A;  4CU7 A;  2ZEZ A;  2VZ1 A;  4PT6 A;  3FHA A;  2VCC A;  3EB7 A;  2LS6 A;  2QQL A;  2YG0 A;  2VCA A;  3WNM A;  4XUO A;  2X10 A;  2B4K A;  1OH4 A;  4JKK A;  2W92 A;  5C7G A;  3I2G A;  2VZP A;  3AC0 A;  3LEI A;  2RV9 A;  4CUB A;  3MBW A;  3I2H A;  4ZZ8 A;  1F4A A;  1SDD B;  5IYY A;  3NJX A;  3EYP A;  4A4A A;  3K46 A;  1EUU A;  4CU9 A;  2X05 A;  1K42 A;  1NUK A;  3I97 A;  5LA0 A;  2QQO A;  3LQC A;  2Y6L A;  5EIY B;  1JZ8 A;  1JZ4 A;  3W5N A;  4UI9 L;  3WF1 A;  2WO2 A;  5CZK A;  1JZ2 A;  5JMO A;  2XOM A;  1W9W A;  3U37 A;  3I3D A;  5LA1 A;  3T08 A;  4AAX A;  2C4X A;  2ZXQ A;  1DP0 A;  1GNY A;  2BGO A;  3ABZ A;  3GXU A;  5JXI A;  3HN3 A;  1US3 A;  2J1R A;  5I0D A;  2WN3 A;  2Y6K A;  2ZEX A;  3T2O A;  2RVA A;  1GMM A;  1SHW B;  1XNA A;  4L0P A;  2QQK A;  4A45 A;  3ZM8 A;  3SKJ E;  2VQT A;  1ULP A;  2VMD A;  3THD A;  1MPX A;  1JYX A;  2ORX A;  3HNB M;  3I2J A;  3HOB A;  3ACG A;  3GGL A;  3K4A A;  1GOH A;  2VQU A;  4MAD A;  1UY0 A;  1L7Q A;  2W9X A;  3K4D A;  1OT5 A;  4Z2A A;  3CKH A;  5IFP A;  2HLE A;  3A23 A;  4CU6 A;  4E8D A;  4OYU A;  1DYO A;  5C71 A;  2BGP A;  4AG4 A;  4XUQ A;  2C9K A;  2J1U A;  4MGS A;  1W9T A;  3OEB A;  3MUY 1;  5B4N A;  2VJX A;  3PUH A;  2W3J A;  1CZS A;  2V5D A;  3LEG A;  2VZO A;  4D0Q A;  4OZO A;  1O8S A;  1JYV A;  2PQS A;  4GWI A;  1JHJ A;  3K4Z A;  1UX7 A;  2Z4F A;  4PF1 A;  5F7U A;  3OG2 A;  2EID A;  5JXJ A;  4QB1 A;  4RYD A;  4JKL A;  1K45 A;  3WF3 A;  1UMI A;  2WUH A;  3NQH A;  4BJ0 A;  1YQ2 A;  2J7M A;  2VZR A;  4M4P A;  4ET7 A;  4JHZ A;  1GQP A;  4XVH A;  2W87 A;  2W95 A;  2Y6J A;  4FI9 A;  3T0B A;  2VO5 A;  4A42 A;  3OB8 A;  1UY1 A;  3WEZ A;  1PX3 A;  2ZEW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...