4BISA

Jmjd2a complexed with 8-hydroxyquinoline-4-carboxylic acid
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
348
structure length
348
Chain Sequence
LNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords LYSINE-SPECIFIC DEMETHYLASE 4A
publication title 5-Carboxy-8-hydroxyquinoline is a Broad Spectrum 2-Oxoglutarate Oxygenase Inhibitor which Causes Iron Translocation.
pubmed doi rcsb
source organism Homo sapiens
total genus 103
structure length 348
sequence length 348
chains with identical sequence B
ec nomenclature ec 1.14.11.-:
pdb deposition date 2013-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 4bisA01
5FZDA 2VD7A 5FYHA 3K2OA 1VRBA 4LIUA 3KVBA 4QWNA 5E6HA 5FP9A 2P5BA 5FYYA 4AI9A 5F2SA 5FZAA 4Y4RA 3PTRB 3KV6A 4IGOA 5FY5A 4Y33A 5FUPA 4NUBA 5FY0A 3ZPOA 5IVBA 4UF0A 5FZ0A 2PXJA 2OQ6A 3LD8A 5FZ8A 5FPUA 4LITA 5FYIA 3AL5A 3N9NA 2OS2A 4CCKA 5A7QA 3K3OA 4GJZA 4QXHA 5A80A 2Q8DA 5FYUA 5FZ1A 4IGPA 5FZOB 5F3IA 2YPDA 2YU1A 3OPTA 4V2VA 2YBPA 5F32A 5LW9A 5FZOA 5FPAA 5FP8A 5FYBA 5A7WB 5FYMA 3N9OA 4GAZA 4CCNA 5FZLA 4QXCA 4AAPA 3N9PA 3PUSA 3KV5A 5FZKA 4E4HA 3UYJA 5FJKA 5A3TA 4XDOA 2GP3A 5FXWA 3PUQA 5IVYA 5LY2A 5FY8A 5FPVA 5FP7A 4CCJA 3PDQA 5FYSA 5FZMA 4CCLA 4HOOA 4CSWA 5FWJA 3LDBA 5LWBA 4D6RA 4EZ4A 5F5IA 5A1FA 2GP5A 3N9MA 4BXFA 2XXZA 5A7OA 2YU2A 5A1LA 5LY1A 4Y3OA 4DO0A 4QXBA 5FZ6A 5FYVA 5FWEA 3KV9A 5ISLA 2YBKA 5FZ3A 5IWFA 4V2WA 4DIQA 3AVRA 5FYZA 5A7NA 4BU2A 4D6QA 5FXXA 2OX0A 4IGQA 4TN7A 5IVJA 5IVVA 5FZGA 5FUNA 5FZEA 5FZCA 3K3NA 5K4LA 5FZIA 5A7PA 5A7WA 4XDPA 5F39A 5F37A 5FPBA 5F3CA 5A3PA 5F2WA 3DXTA 4QX8A 5FV3A 5FXZA 5FPLA 5FBJA 3DXUA 3U4SA 5FZ4A 4BISA 5IVEA 2W2IA 4EYUA 2WWJA 3PU8A 5F5CA 5FY9A 4LIVA 5A3NA 3AL6A 5F5AA 5IVFA 5A3WA 5FP3A 2XUEA 5IW0A 4URAA 4CCMA 4GJYA 2OT7A 5FY1A 4QU1A 3KV4A 5FZBA 3PUAA 5A7SA 4EZHA 4UF0B 2XMLA 3KVAA 5CEHA 5FYTA 5ANQA 5FZ7A 5FZ9A 5IVCA 4C8DA 3PU3A 2OQ7A 5FJHA 4LXLA 5FZFA 3NJYA 3PURA 5KR7A 4CUGA 3N9QA 5FYCA 4HONA 5FY4A 5F3EA 5FY7A 2Q8EA 5FP4A 5FXVA 3OPWA 3N9LA 4GD4A 3AVSA 3RVHA 3U78A 4CCOA 2WWUA 4ASKA 2Q8CA 2XDVA 2YBSA 4D6SA 5F3GA 5FZHA 4QX7A 3ZLIA
chains in the Genus database with same CATH superfamily
4LHKA 1F15A 3DYPA 4BMBA 3C7OA 3MLLA 4LO8A 1A8DA 4BDVB 1EUTA 5JAXA 2ZZJA 1YQ6A 3O1OA 1XC6A 2TNFA 3ZFEA 4N43C 2R30A 3WNPA 5CAZA 4FPYA 2XPJA 3PMSA 2OYZA 3KHCA 4IDZA 1QJU1 4M0NA 3I2GA 4Q4Y3 5IVBA 3M3OA 4OMCA 1OF4A 4NMIA 2DVAA 2VE1A 2ZKLA 1JN2P 4P9WA 2V5DA 1AL0G 4AI0A 1SLBA 2E31A 2DUOA 2WNUC 1NAEA 5A7QA 1S2EA 1J84A 5A80A 1VBE2 2GNBA 3C2UA 2E63A 2Y26A 1SDDB 4IEUA 4QX1A 1J58A 3KF3A 5CFCA 4CRQA 2O8QA 3H3LA 5KBFA 1AR83 4WV8A 3WP5A 4LBLA 3UJQA 1WLCA 1WCKA 2IC1A 1JTZX 2ENRA 3T0BA 3U4XA 5DUUA 4NHMA 1AZDA 3JCIA 5DXDA 2UWCA 2XJSA 2QUOA 4E4HA 1R091 3ZIWA 2WC2A 5AFBA 4FOWA 2W5FA 4JQRA 4WZCA 4XJWA 5FPVA 5LATA 1GYKA 3I59A 5J98B 4QQPA 3ZXGA 5GZDA 4I02A 2B9UA 1BVVA 3FL7A 3PDQA 4DOUA 1LKNA 4B7EA 1GNHA 4NAOA 5LBFA 1O8PA 3GYDA 4UBGA 5JR7B 5FUIA 3EB7A 2KR2A 1QF3A 1LGCA 4YW5A 2E26A 1C5HA 5BPXA 1HB3A 3E6CC 4HT1T 1D0GA 5FWEA 4A41A 4XBQA 1BZWA 2YBKA 2ZGUA 4QD2A 4AEKA 2JDZA 4YRDA 1AX2A 3RZHA 5D21A 2JXAA 3ZSEA 4TN7A 1OURA 1GWMA 3INAA 1AR63 3AP5A 4XUOA 2X53S 2ZHLA 5FQ0B 1ND2C 1REDA 2RS12 3D0JA 4IL7A 4XJ9A 3SKJE 2JE9A 4GXLA 1ZZ8A 4GMP0 1R1A1 4B1LA 3W58A 4DRVA 2A75A 4MGKE 4COYA 4N90A 1YRZA 5IUQA 1WWYA 1HLCA 1ODNA 2AREA 2R0HA 3POGA 2IXHA 3DXUA 3TN92 3VD4A 1GBGA 2NLRA 1DQ2A 5F5CA 1JHNA 4AQ6A 3PJYA 3USUB 2EIDA 3DKQA 1GZCA 4N7UA 4SBVA 1W6OA 1OQDA 3E5QA 2DU0A 3NSTA 4XF0A 5D8AB 5T54A 2VR4A 4XF9A 3TEXA 4RYDA 4XIOA 4CDXC 4NOTA 2VAUA 2UY8A 3MEPA 1QIQA 3LA3A 4JTOA 3O1MA 1N47A 1UCXA 2D6NA 1KJLA 1R093 4Q0VA 2RDSA 2VM9A 1ZRFA 4CDWA 1Q8SA 2DTYA 5C4WC 1S0CA 1YNAA 2CTVA 2JIJA 5C9AC 3B00A 3R6SA 2ZAHA 4LQRA 3OPZA 2Q8EA 3H0OA 3M2MA 3WF4A 2BRTA 3FX3A 4F8AA 4DXSA 4CPBD 4AWDA 2JB4A 1JYIA 5DPNA 2BVVA 3VZOA 3O0XA 1QH7A 1RYYA 2IXLA 2B8MA 1UO9A 1MS0A 1KFUL 4E2GA 4QX7A 3K46A 4X8PA 3J26N 3QH6A 4GH4C 1W8WA 3BIWE 5JI9A 2VZQA 2Z79A 4MGIE 4Q4Y2 4QXKA 2W46A 3ZO0B 4COVA 4EN6B 4AGVA 3NL1A 3S57A 1K5MC 2G9GA 3OOXA 1ZX5A 4LLFA 5FZAA 2V4VA 2X05A 3LEKA 4Z82A 1A34A 4YZ4A 3CJIC 2Y6KA 4YGEA 2WUHA 1UAIA 4NPRA 4Q1PA 1R1A3 3ITQA 1Y9QA 4DMIA 3CL1A 3NJZA 3D0SA 2UWAA 2WQ4A 3LB9A 4IERA 3B01A 1RUD1 4IEOA 5GKAC 3ACHA 2Y60A 3U10A 4U2AA 1FYUA 4V1PA 2XJQA 4TYSA 5FZOB 3BIEA 1NT0A 4I09A 1TE1B 1UU4A 4GWMA 1DQ6A 2JDNA 2VMHA 3KMHA 4UFLA 1OA2A 3VHOA 3LDKA 2W87A 3DPRA 2QVSB 2XKOA 2YG0A 2YFZA 4LE3A 5FK7A 4H3WA 2ERFA 2QQIA 3MW4A 4HL0A 1COV3 2EXJA 2VCAA 1WD3A 1MZEA 3IN9A 2DBNA 3TEZA 1SMVA 4XDOA 1QDOA 2BU9A 3HN3A 4CDUC 3DV8A 1VMFA 1DZRA 1F4AA 4KBZA 5J1XA 4LBQB 4AFBA 2JDYA 5FO9B 3W21A 3FHIB 2JDUA 2K2SA 4QKDA 3C7HA 2X09A 2IVIB 4NPMA 4HXCA 3QLQA 1H8VA 2WBKA 4LA2A 5IVJA 4P9LA 5APAA 4PLOA 2B39A 1VLNA 1H8TA 2RS32 3MDPA 4FO9A 3ZSKA 1CIWA 1SBEA 3AFKA 4B8EA 2FQPA 4DB5A 4D7TA 5IATA 4LBMA 3WOGA 4LK6A 1XJAA 1G6NA 2DU1A 2IFWA 2VCCA 4G4FA 1OOPC 1RUC3 3ZN5A 1KJRA 1YYNA 4NAMA 4XUNA 3PIJA 4IEYA 1KQRA 4GKXA 4HKWA 5HCFA 3ZYRA 3NV3A 4LHLA 4PDWC 5DQ0A 3MYXA 4XOGA 3SLIA 3GZAA 2RM21 1AR91 1EV11 4YFWA 4I0AA 1W6NA 4QX8A 5FV3A 2HWC3 3LEIA 2A6WA 3GDBA 3UGGA 5I0UA 1PVC1 1RUD3 3ETQA 4Q2FA 3MIGA 5KXCA 1KITA 1XNBA 5A3NA 4OMDA 3RZGA 4TZDA 1O59A 3HR9A 3S7EA 1PK6B 1UY1A 4RQPB 1MS3A 3ETPA 2ID4A 1IG0A 1X8EA 4EZHA 4WM8C 2HWE1 5J36A 1LOFA 1R082 3AMPA 4P14A 2E7TA 1OUSA 3DYMA 4XBLA 1IS4A 1RVF3 2ES3A 4LO6B 3FUQA 4AQTA 1KGYA 2OZ6A 3KQ4B 2TBVA 4AXOA 3N9QA 3B9IA 5JZGA 5LEKA 2BV4A 5JIAA 2YB7A 1HDKA 1GP5A 2A6YA 3MW2A 3AXDA 1UU6A 4FPOB 4KMQA 4XETA 2A5ZA 2YC0A 2TEPA 3WQ1A 3RVHA 2NYYA 5K0UA 2WWUA 1CAXA 1I5ZA 1PO23 3JD71 1C1LA 3I2FA 3UK9A 2AH2A 2VXJA 1ZZ7A 1GOHA 4NIAA 3T2TA 4YVWA 5K9YA 1SFYA 5KXEA 1YFUA 1JI6A 4C1XA 2BNMA 2VNVA 2PN5A 1A3KA 2RR11 3RI9A 4QWNA 1VRH1 1NCQA 1ASJ1 1Q8PA 1O6UA 3KV6A 4K1ZA 5DDJ2 4AYUA 2LM3A 5CFCC 1JYCA 4N53A 4P00B 4ES8A 3CZJA 1O3SA 4AI8A 3ILNA 2DCYA 2RM23 2BNOA 1AR93 2D98A 3AKTA 4GKYA 4UW5A 1J3QA 4OFGA 4LE4A 3WLUA 4QQOA 2R6QA 4Q8KA 4N9HA 1CX4A 1TNRA 1PVC3 3ZYBA 4NRQA 5EWSA 1YEWA 3NNFA 3H1WA 5ERLA 2OKXA 4EJRA 4XURA 1ACCA 2QQMA 1COV2 4D69A 5JSOA 2VMGA 1BEV3 1H2LA 2RG4A 4RN5A 5DN2A 3TWIA 3U14A 1W2OA 1RHI2 1C1FA 5FYMA 1GICA 4CXWA 1UWWA 4CCNA 1EAH1 3KV5A 5FMOS 2J1UA 3UYJA 4XF3A 3POSA 3WQ7A 1OLME 3T3YA 1UYZA 2JG9B 2ZPXA 2PAEA 4XUQA 2ZEXA 1NE6A 4BHPA 1OLRA 2CU5A 4QX3A 1W9SA 2WABA 2HJIA 3IDEA 4BCUA 2VUJA 2D93A 1U0AA 3N7MA 2MPFA 1AHSA 1E5RA 4CP9A 3UV9A 3O1VA 5CISA 1RUC2 5A6QA 4MOAA 2YHJA 1O5LA 2O8OA 1MZ5A 4Q0UA 3SC7X 1VRH3 4D7YA 3WSOA 3ZFFB 3VGIA 4A44A 3P6BA 3VDDA 3BU0A 5E89A 3KWVA 5HI0A 2PAMA 4BU2A 2VPVA 2HWC2 2JG8A 2CWMA 4UI9L 5FDBA 1U5XA 4JC1A 4OHVA 5FZCA 5EIYB 3IZOA 1LODA 3PUHA 3VL9A 2WFPA 3I2JA 3BPSA 3IAQA 3KT7A 1DGWA 1NCRB 1WCQA 5FR3A 5F2WA 1QKQA 2I07B 3NWKA 4EV0A 5FQ0A 4DS0A 2J1SA 2DVBA 2TUNA 3WG1A 5A6YA 4Y26A 2AACA 4AQSA 2WWJA 1M06G 4YLZA 2JE7A 2CSGA 4JDMA 4OI1A 2R1DA 1MS8A 2ZGQA 3FFZA 3TYJA 1YUDA 4MX3A 4XCBA 4OQ9A 1RVF2 3MIDA 2CY6A 2EIGA 4AVCA 3USUA 3RZKA 3I3MA 4FBFA 4M01A 3NKGA 1EAH3 1UMIA 2ZGPA 1JW6A 3VL8A 1F5JA 2D44A 5FCCA 3WW3A 5A3OA 4Z92B 4MG2A 4QT6A 3AMQA 2RDQA 3V0AA 4Y1ZA 1PGW1 4Q29A 2VNGA 5BNOA 1PO22 1PZ7A 4LBQD 2CWSA 1HV0A 2EA7A 4JHZA 3ZR5A 3FE5A 4BQYA 2XKPA 5FXVA 1UZYA 1JODA 3FWEA 3N36A 4ZZ5A 1JYWA 3A7QA 3SH3A 2GMPA 2XBO1 2D6PA 3V56A 4ZKTB 5ACA2 2F4PA 3FLPA 3FUOA 2JDHA 2YBSA 2ZMNA 3N7JA 5T55A 2WJSA 4OLLA 3GBWA 3VHRA 4HMZA 3ZFGB 3ZM8A 3NAPA 4QPGB 3WW1A 4DUVA 1AR92 1EP0A 5F2SA 3CNAA 4M3CF 4ZU4A 4W65A 1F9KA 1W04A 2Z42A 2R041 2WZEA 2JKXA 1JYTA 3AX4A 5L19A 3LD8A 4XIKA 5G05L 3VN4A 3MF6A 4IESA 5TSWA 3DPRC 3DUIA 5L9VA 1W0NA 3KHBA 2H6CA 2V09A 2ADDA 4GB32 5DZEA 3VBHB 2W39A 3E97A 1BEV2 1S4CA 1NUKA 3RS6A 5F8PA 4CP0A 5F5QA 4YZ2A 3SNMA 4ASLA 1RITA 4MADA 3LPFA 3EO6A 3J7HA 2DUQA 3CHXA 3POJA 1Y43B 1Z7S1 3JUUA 1ENXA 4I2OA 4DPNA 5FZOA 1VAMA 3HT2A 5BNQA 1FATA 5LA0A 1LHWA 4F83A 4D8MA 1WUVA 5H9SA 4W50A 3VBRA 1H9PA 1FOD1 4AL9A 1UPSA 1H8TC 2XVKA 3RDIA 3RG0A 2XJUA 4JRLA 4GMP3 3WNLA 2OUHA 3NVCA 2W08A 5T5LA 3K77A 1B35B 2AYHA 3MO4A 2VW0A 1NXMA 1DYOA 4I30A 3VKFC 4AGRA 4AGGA 3NNMA 4MUVA 2WT2A 3WCSA 1IS6A 1GFF2 2HKXA 5A7OA 1JS9A 3ZXDA 2ARXA 5CADA 2ZGSA 2VY0A 4JDOA 4IETA 3HVDA 5I0DA 5L7OB 5FAXA 2E51A 1W39A 3EJKA 3MFAA 3OJBA 5EYYA 4AE2A 4EN9B 2WNUA 5CU1A 1D4M3 4NRPA 2Y0IA 4PQQA 2J22A 1KEXA 4FFIA 5ABJB 1YFXA 2A73B 4A42A 4CP2A 4YW6A 4EN0A 1LOFC 5A32A 3N7LA 1WLTA 1E5IA 1C8M1 5KHIA 4R9CA 4OUEA 2CGOA 3SCGA 3V65A 4IV3C 4RS5B 1Y9MA 3KF5A 4DEVA 4DUXA 3J4UH 4E9KA 3MPPG 4QKFA 3WHUA 1VBB3 4N8MA 5T5PA 3SHRA 5K7PA 1GUIA 1UXZA 5JZGC 3VUOA 1KFXL 1LU2A 1Z7S3 2Y6JA 2ZJCA 3WNKA 2XUEA 1HRI2 5GZGA 2BDRA 2DV9A 2GC1A 3T0AA 4JGYB 3POBA 5K0UC 5M0TA 5CEHA 3SCHA 1KD7A 2IXCA 1F35A 1FOD3 1ULOA 1CPMA 2EXKA 2VCBA 3WP4A 4YVWC 1OKQA 1R1ZA 5BNNA 3BTAA 1X33A 1CX1A 4KU8A 3MIEA 1E5SA 4Y5SA 5FYCA 1NCQC 4Q5OA 1BMV2 2UYAA 1LGBA 1KDKA 4YZ5A 2XWBB 4WM7A 4ZU5A 1H4HA 5A1AA 1W99A 4N53C 2RV9A 4OI2A 4HVOA 3TNQA 4XDQA 4E4ZA 1VBA2 5T5OA 3AYAA 1X7NA 4KH9A 4IEQA 3LIGA 1BK0A 4MO3M 5FYHA 1N1VA 2P3JA 3VBFA 4B4RA 2YROA 2ZA9A 3GZUC 5IK5A 1VBE1 2CAUA 5GLZA 4IE7A 1UQXA 1JZ5A 2VW2A 4GWJA 4QQHA 2VC9A 2ZABA 2CHHA 4QGNA 4PJYA 3RSJA 3S7IA 5FZ0A 1XNCA 4XUTA 4XW3A 2W3JA 5FPUA 5E1RA 1YJLA 5DAXA 4ASMB 1C8M3 1JOJA 5CKQA 2GNDA 1LEDA 4H2AA 1ST8A 1GWLA 4LOTA 2E33A 5FZ1A 2YYOA 4XAAA 5JIUA 2C1FA 2QQWA 5F3IA 3VDCA 1V6LA 2D40A 1K3IA 5IAVA 4LO7A 5F6LB 3QOPA 5FP8A 4UAPA 3A0NA 1WW4A 1LOEA 4XUPA 1GKBA 1G9CA 1GQGA 4PLNA 1HIXA 3QH7A 5JI7A 3AKPA 1PM4A 5EPAA 3I49A 2FD8A 1RXGA 1K5JA 2C24A 5K8SA 1UOJA 3OY8B 3ZMOA 1C28A 5D2AA 3VDDC 2Q1MA 4RHV2 1W2NA 2JG9A 5FYSA 2JG8C 3GCXA 2WQZC 3VBUA 4DXTA 4EQVA 2BNNA 2RS11 3V64A 1H6XA 1W6MB 4XBNA 4YW1A 2YUEA 5EYXA 4NHXA 4DQAA 4LBNA 4Q0SA 4W4ZA 4JKLA 5DAWA 1POV0 1WGPA 1D4M2 3J7MA 3LPGA 5FZ3A 3D4KA 3TN91 4BIFA 4V2WA 3IPVB 3K51A 1BXHA 2X5IB 1VBD2 2JIGA 4AFMA 1UY4A 4KWLA 5GALA 4BJ0A 2XHNA 3OEAA 1K45A 2QQVA 1WD4A 5JUVA 4L9BA 3RMYA 5D8AC 4XC9A 5I91A 3VD5A 1VBB2 1BK1A 3RZZA 1PO12 4QDRA 4QQ2A 5FXZA 1NCRA 1H9WA 2J1AA 3THTA 3OGRA 3CKHA 5FPXA 3Q8FA 2K0GA 2A6VA 2WNVA 2NZ9A 3M3EA 5BNOC 1V6KA 3WT3A 1BVP1 3WDUA 3ZXEA 4GIQA 4A3XA 4I3GA 4CDUA 1F5FA 1UNBA 1ZRCA 1URXA 3KV4A 5EJ1B 3KSCA 3POEA 5DG2A 4JAAA 4DEQA 3BPZA 3PUIA 3T30A 2I45A 4BQ5A 1WCUA 1CD3G 1GOGA 1VALA 3M3QA 4FOVA 4CEWB 4Q4Y1 1Y7BA 3ZYHA 4LOSA 1WBLA 3OBAA 5CG8A 1UIJA 2WA4A 1ZM1A 3OPWA 3N9LA 3WY6A 2P1BA 4BPZA 2N7GA 3AXEA 3LCPA 4XACA 5JOZA 1YFYA 2RS13 2Q8CA 4K1YA 3VBSB 3ZXJA 5L73A 5J3UA 3VV1A 3ZYIB 1TEIA 3I2OA 4XQWA 1OH4A 2QQJA 3JBG3 3NJVA 4P9YA 4PDWA 3OUHA 3X29B 1UZVA 3ZSMA 2E7QA 3OCPA 3QD6A 3OUJA 1OA3A 2WIIB 5BV6A 3RJRA 4XZUG 3K4DA 1TNFA 1YQ5A 2ZMLA 4IGOA 3DECA 4QPGA 5FUPA 5FY5A 1WW7A 3CJXA 3NJXA 4XFIA 4KG8A 2C9KA 2WNOA 1A8MA 1W0PA 3J7NA 2CV6A 1GR3A 3PIGA 4K21A 1ZYBA 3ABZA 2VZPA 5H9RA 1OI6A 2AENA 3VBRC 5LRSA 5L9BA 1SEFA 2ZZQA 3FC0A 3M1HA 2Q8DA 3HBKA 3E6BA 1OBNA 5FIXA 3USSA 2YXSA 1W0OA 5A33A 1IQAA 2GALA 4QPIB 2R7EB 1AX1A 1Y3TA 2XL7A 1VB4A 3ALQA 4MV2A 4A6OA 4V2VA 2NPIA 2CDOA 2YBPA 4UWDA 5JMOA 4IEZA 1U5YA 1I9RA 2EIEA 5KHKA 2Y34A 1KDMA 5FREA 3WDTA 4OHWA 2WYFA 4XJAA 5FJKA 4R9DA 2RS31 5C3SA 1W6PA 4QPYA 1AR61 3H3UA 5FXWA 5LY2A 3HWJA 5FP7A 1GOFA 4YYOA 1RUJ2 1WA6X 2ZGLA 4KWJA 5A70A 1DLLA 3AFGA 4Q27A 4D7SA 1H6YA 4B7KA 4CSWA 1XOYA 1V00A 2K9ZA 2VUDA 1CZSA 2XUMA 2XQRA 2NN8A 4Y1YA 2F17A 5CKMA 4EWEA 2P6HA 2VBPA 2P3KA 4KWUA 4QXBA 5I8TA 3ELNA 3BALA 1R64A 3WX5A 5FYVA 5GZEA 4BQ4A 1NE4A 3SCFA 1LJ7A 4PIXA 1SBDA 5DUWA 3TEYA 5A7NA 3ACFA 2OX0A 1HRV1 4K7JA 2QQNA 1UZWA 1WBFA 2VJXA 3PVEA 4NE9A 4O7XA 4OUSA 5IHRA 2XJVA 1AL23 5JOWA 3LOIA 1G9AA 1MQTB 3DXTA 4HG6B 4XEZA 1KRIA 3UGHA 1R081 1YIFA 3WUDA 2DVFA 4FOQA 2VL4A 1DQ1A 5BNNC 2R0FA 3ZYFA 4JGZB 2W2IA 4NIGA 1W03A 1G86A 4RFT0 1LNSA 4NIDA 1G9FA 1JMUB 4RS5A 4R8HA 3HQXA 5T50A 4WM7C 1GNYA 1SPPB 4Z8BA 1Q5OA 1RMU1 5A3MA 4FPCA 2P3IA 4QDSA 2FZ1A 1GZWA 2GMMA 3GZTB 1WCDJ 4NWWA 5FOJB 1RL3A 2RS33 2B7YA 3QACA 2Y6HA 3Q8BA 3WP6A 2P34A 2HEYF 1QNWA 3VBFC 1AYN1 2Q4SA 3J9SA 1IG3A 2VBBA 4I0WB 1X9TA 3SMHA 1GANA 1BHGA 4B29A 4F7ZA 3MZHA 2PTMA 1HXS1 3GJAA 3JBG2 1XNTA 5DDJ1 1HB1A 3KD4A 5BNPA 5KHGA 4Y20B 4BQ2A 1PMJX 1US3A 2KD7A 2W1UA 4D94A 1H1IA 5FZHA 4YG3A 4ZXEA 3ZX7A 5G04L 1AXKA 1XE7A 2VD7A 1RINA 4YGBA 3W9AA 4EE2A 4QX2A 1H2NA 5JOXA 3NO8A 2DCTA 3O0WA 2WFF1 1DGLA 1OVPA 1HRV3 3WNMA 3Q8CA 1HJFA 4MXWB 4XABA 1OXCA 1COV1 4UF0A 3FHQA 3UKTA 5FKBA 4PCRA 1R083 1MPXA 1RHI1 1LHNA 4CYDA 1QJX2 4HPKA 2FMYA 2PLV3 1ZZBA 2F6BA 4LHNA 2WAOA 2BPA2 3J8F2 2ZHMA 2GC3A 4K40A 2DYCA 1DDLA 5C8WA 2JG9C 2VOKA 4CEYA 2BFUS 1GWKA 1D4VB 1RMU3 1Q56A 3I97A 3AZWA 3CZUA 3VBUC 1STMA 5D1IA 5A7WB 5GZFA 4XJZA 1QU0A 1RUC1 4IE6A 4LMFA 1IS5A 2WO7A 5FZKA 1NQJA 2PAKA 4YZ3A 3I2IA 3FLTA 5JPNB 1AYN3 4GULA 5CNAA 4Y4YA 2VZUA 1SFNA 4Q0PA 2VZ1A 4ONUA 2J1RA 3G7DA 1HXS3 1G9DA 1PHMA 2CNAA 3EYPA 5DDJ3 2HWC1 2Y33A 3ZFFC 2PQQA 3HAGA 4D6RA 4XCAA 3U1XA 4A7ZA 1SDWA 4C90A 1LECA 3BI3A 1OA4A 3OG2A 4IEPA 2XXZA 3RGBA 1UY2A 3IM0A 5I0SA 2WN2A 4YG0A 3M4FA 3BOPA 1SCSA 1NCRC 2Y6LA 3HNYM 2HYKA 4OZXA 4KI5M 3WNNA 2WFF3 5IK8A 4MYEA 1AL22 2WNVC 5KWRA 1W6QB 4IXLA 3RZJA 2VMDA 2D6MA 5IVVA 1VAVA 4Q26A 5E8AA 3K3NA 1CAUB 3IPVA 4FSJA 1RVF1 2GSYA 1N1YA 1ULPA 1O4ZA 3RZLA 3MIFA 1RHI3 3ZN6B 1WCSA 1UF2C 3LAGA 5DUVA 3UJOA 1CIYA 1DGWX 2P2KA 1ALYA 3ZIXA 5FBJA 1LENA 3K75B 2X29A 2VECA 2R062 1MS5A 4A7YA 2DBIA 4GWNA 2DCJA 1PO21 5GJ6A 5CG9A 4CPBA 1AR72 5FP3A 4XQDA 1POV1 1C4RA 4ARXA 3ZSLA 1W28A 4GJYA 4UXAA 4D0QA 2VUAA 4NVPA 2VULA 3LZZA 1CONA 4QU1A 4CDQB 3UNPA 1AJOA 4I0BA 5ACA1 4BH9A 1AVBA 3JXSA 3HPNA 3U37A 3HT1A 2WNEA 1IQDC 3RPQA 3CQOA 5KR7A 5SV5A 1N3QA 2NM1A 2B5HA 3IMMA 4LBKA 4AVAA 1BCXA 1AXYA 5LZ6A 4LBJA 3U0ZA 2PHUA 2A7AA 2VZOA 2ZS6B 1NXD1 4HBNA 1SHWB 2DDUA 2RJ2A 3OUIA 4XHXA 3OGVA 2PFWA 1ZA7A 3P5BA 4QPGC 3WINE 4DXZA 1WMXA 4ASKA 1ONAA 2XDVA 5C8CA 4Y1XA 1HRV2 4HFSA 4IV1A 3WW2A 3C3VA 5JMCA 2O14A 5EXOA 2YFUA 4GB31 3CLPA 3VBSA 4BQ3A 2DFBA 3GALA 3Q8AA 4NR1A 1BEV1 4WVMA 3KCYA 1HN0A 4AI9A 1MS4A 3IWZA 1GZTA 3FBMA 4PBOA 3URFA 5IFPA 1ZZ9A 2ZXQA 1QQP2 3MUZ1 4XFCA 1JZ4A 1Q43A 1JZ6A 1W8ZA 1W8HA 4IV3A 4FTEA 2MEV3 2PLV2 5JDBA 2MHFA 5KXDA 4QMAA 1ZZCA 3HNMA 4LITA 2C26A 4Q4X2 5FYIA 3N9NA 2OW4A 1DZQA 4YPJA 4DXRA 2NMNA 3LFIA 1UY0A 2R32A 3AKRA 1RMU2 2XGXA 1UIKA 1TQ5A 2VVFA 4FP3A 1DP0A 4LTAA 4HETA 1POV3 1SLCA 2YC2A 3UGFA 4S2GA 1YQ2A 4IQPA 2LUWA 4AEJA 4AI3A 1XE8A 2W95A 1AYN2 4M4RA 2VMFA 3BGAA 5ACA3 3MW3A 1E57A 1X82A 2ZX0A 4QXCA 2ZAAA 1HXS2 1MS1A 1YWKA 1SG3A 2OVUA 2V73A 4BK4A 2C4XA 4QB1A 4AVSA 2ZX3A 1Z0HA 4Q1RA 5FY8A 1HB2A 4Q4V2 2JDPA 3T08A 4I3PA 3LQCA 2WFF2 3O12A 4YM1A 1Z78A 1XSRA 3THCA 4GQ7A 1MZFA 4Y3OA 4GB33 3SQOA 1O91A 1RUF2 2FDJA 3NV4A 2QQOA 3HOBA 5FZ6A 5ABJC 1CVNA 4KL1A 2IUWA 5LA2A 3I3EA 3VKNA 4YGDA 3RMXA 1YLLA 4TWTA 1V6NA 4NIIA 1RIRA 3RYPA 3WG3A 1TZOA 1KS5A 5EQUA 1OSGA 1RUNA 4GALA 4YM2A 5FZGA 2YV8A 5FZEA 4RS5C 4RGKA 1LB2A 5FZIA 4FPKA 1UKGA 1TMF3 4AF9A 1HRI1 2QFEA 2WS93 5F39A 5F3CA 1VBC3 2VTXJ 4P5YA 1CQ9A 1C8NA 1Y9GA 4URTA 5I0TA 1OUXA 3AMNA 1OT5A 2UU8A 4OYUA 2V4AA 3PU8A 5C4WB 5C9AB 1O3QA 3VBOB 3OGJA 1B09A 2ZX4A 3I3QA 1BMV1 3UETA 2GN7A 4UW3A 1WKYA 2ZOEB 3DCQA 1W8NA 1UYYA 3OYWB 4YW2A 3GGLA 5A3WA 3PVBB 1NY72 1SZBA 2UY9A 5A6XA 4ZHNA 3ZXAC 3POYA 5BNPC 3H8XA 2PHWA 4P02B 1XXNA 1VBA1 4QKBA 2H0VA 4QQLA 1SPPA 4LULA 3MHZA 1DFQA 4FXKB 1QXRA 2I2SA 3PU3A 2OQ7A 4GH4B 3VZLA 1JOPA 3NJYA 4C8DA 5HPOA 3GM8A 4HANA 1XBFA 4TLGA 1LRHA 4X6QB 2JD9A 4XFFA 4XMAA 4FAHA 1K5MB 4AG4A 4MVTA 3WZ1A 2HWD2 4A3ZA 1QY4A 2UYBA 2VUCA 3BVCA 3CJIB 1PMIA 1ZBE3 2XH6A 2XVGA 1BJQA 3ES4A 3PVNA 5LB6A 2LROA 3TNPB 3RYRA 2Z4FA 5F3GA 1ZA4A 3MFCA 1ZNPA 3ZLIA 3RWKX 1VMHA 3D3AA 4HN1A 2MEV2 2P5BA 3LA7A 4YM3A 5D8AA 1XRUA 4Y4RA 4XTMA 1NZCA 1UOFA 1NOVA 1RUH3 1BYHA 3O1UA 1T6GC 2Z5WA 4JTNA 2QDRA 3AYEA 1REFA 1RJ7A 1VAKA 4QB6A 3H7JA 1HRI3 1ZREA 1OVSA 1BBT3 4CEYC 1G7YA 3PTYA 4LORA 1SLTA 4MXWA 1LHOA 4GMP1 2UWBA 5A6ZA 5C33A 2OS2A 4PIZA 3O1TA 2PHRA 3KB5A 4FFGA 4TXWA 1LAJA 3T0DA 4XAEA 2XHKA 4JCKA 3AC0A 2XJPA 2R1BA 4COZA 3O14A 4H7MA 3BTZA 1HKDA 2P17A 4RHV1 4QX0A 2D6OX 3IAPA 5F32A 1XSQA 1VBA3 2GMEA 4BWOA 2VZ3A 4YW3A 1PNFA 3N9PA 4LR4A 2DCZA 2XG3A 3DKWA 3S6PA 2Z69A 1D4M1 2WA3A 5I0RA 3PMEA 3C8XA 3TBDA 3FBYA 2Y8KA 4P5HA 3U75A 4CCJA 3BODA 2PMWB 1VBD1 3FJSA 1H1MA 2A6ZA 3VHPA 1HQWA 1NA1B 4EZ4A 4BQ1A 5B4NA 1ND3B 1S0DA 1YI9A 4LNVA 1BKZA 5J09A 2HWF3 1F8VA 2GAUA 3CMGA 1POQA 3H50A 1XQNA 2ZKNA 4OUMA 3O1PA 3MGUA 1VBB1 2XOMA 1PO11 1O7FA 4B4QA 1TMF2 3RJ2X 1SQ4A 2WS92 1JZ3A 3LF7A 1VBC2 3RYKA 3KGZA 5AVAA 4LT5A 4MHUA 3R4SA 1Q8VA 1REEA 2VMIA 2VTFA 3ZXLA 2YDEA 3ILRA 2ZACA 5A7PA 3F2ZA 1UW8A 4FPJA 1O4TA 3E1F1 5LK5A 3AP9A 1LGNA 5A3PA 4HSLA 3AZVA 4L8QA 2J1EA 1PGL2 2E53A 4ZPIA 4FFHA 1HV1A 1D2SA 1GQHA 4FQ4A 4LBQA 4AEMA 1C57A 4E4SA 1A6CA 4ZU7A 1FNYA 1PMHX 4YNIA 4AW7A 3WDWA 3J7LA 3ZXFA 3FN9A 4RHV3 2PYTA 2V72A 3ZFEB 4O9EA 4JDNA 4P08A 3ENRA 5A7SA 4PF5A 2BUKA 1XB9A 5C8CC 5FYTA 3IB3A 2C6SA 3O1RA 3TN93 4IV1C 2FDKA 4CDQA 1OFNA 1PZ8A 1W9FA 2IZWA 1ZBE2 3VBSC 4L2NA 1SLLA 3WCRA 1K12A 4ES9A 2YC4A 1S1AA 4PLMA 1H1AA 4B3NA 2J1TA 1VBD3 4Y1UA 4RA0A 5CFCB 1GQPA 3KT4A 3NW4A 2FDIA 4Y1VA 4RR3B 3E6DA 3AVSA 2W68A 2RS52 5JSRA 5LBCA 4EN7B 1S0BA 5EJ3A 3IIIA 1RUH2 1PO13 2WO3A 3AP7A 3ZYGA 5FZDA 5I93A 5JOYA 1QJY2 1RUI2 3R4UA 1E5HA 5FFOC 4LIUA 1UYXA 3KVBA 3NMBA 1NLSA 3AJZA 4PQ9A 1BBT2 4LA3A 4A4AA 4BYYA 4IEVA 1PK6A 4W6WA 1CZTA 4RQPA 3I59B 1JYXA 4IE0A 2WN3A 5FY0A 5DMYA 2JJ6A 1LU1A 5HV0A 2OQ6A 4WVZA 2C9AA 1CJPA 3B5LB 2WT0A 3HEIA 4CCKA 4GJZA 2R073 1GP4A 2VG9A 5F1RA 2FBEA 2A3XA 4RD7A 3JQWA 2RMU2 1YQ8A 2DVDA 2X8KA 5JWPA 3TRSB 4JQTA 2Y38A 2FDHA 4MLOA 2YPJA 1HW5A 3P1IA 4L92A 4YSFA 1RUJ1 2YU1A 4ZXKA 2ZGOA 4RGAA 3N7KA 4LEJA 5EV7A 4EWDA 2D3RA 2D97A 5LW9A 5FRAA 5FYBA 3FMGA 2XLAA 2Q1FA 3AZYA 4OVEA 5FZLA 2NP0A 2XL9A 2ZBJA 3PUSA 4K20A 5CBLA 2IXKA 4EROA 1LR5A 3PUQA 4QHBA 1W8UA 2ARCA 2HBTA 2HWF2 2QKDA 3OBRA 4Y5Z0 1YQCA 4M3CB 1JU4A 3BN6A 5FZMA 1W6OB 1CZVA 2VW1A 4AK3A 4XVHA 2IVJA 4XTPA 2VOVA 5F5IA 4ZY9A 3KQRA 1FI2A 4G9SB 2YU2A 4AI2A 2IXIA 5C3PA 5HV4A 5LY1A 3AZZA 3AP4A 4NHKA 1WLWA 4BIOA 2ZX1A 3OBTA 4P9JA 2LRPA 1DQ0A 1ZRDA 5IWFA 1MEC1 4CDWB 4N9IA 4C0HA 4FP2A 4OHXA 5FYZA 4D6QA 2ZHKA 1PX4A 3BU7A 1QOOA 5K4LA 4LBOA 1OH3A 1DGRA 4PBPA 3N35A 2DTWA 1V6IA 3MF9A 3BOWA 3H8OA 5JXGA 3BUCA 1DBNA 4ZS2A 4UFKA 3KGLA 4BLJA 4ITCA 4C0BA 4MXVA 3LSDA 1GV9A 2VO5A 4CCDA 1H2KA 1SACA 4Q4W3 3U4SA 3UKVA 4B1MA 4OI4A 1EUUA 3U11A 2E7AA 2A1XA 3LSEA 4S2HA 4A2UA 4NHYA 2ZTNA 2XJRA 3CBNA 4HKOA 3SEEA 1XPWA 1RUJ3 5IVFA 1DQ4A 4QKNA 5JVVA 1NKGA 1W05A 3EXUA 1I5PA 3IDCB 4GWIA 3JBG1 4WVVA 4YGCA 5J7MA 1D2QA 1T6BX 4UFMA 2NMOA 5IK4A 4D3WA 5IVCA 2D5HA 3POFA 3T1LA 3SEPA 5FZFA 1CWPA 3ZFFA 2VVEA 4Z1VA 3WNOA 2RJKA 2VQAA 1NLQA 2LTNA 5F3EA 3TOJA 3ZVXA 3IIAA 5JPMB 2EIBA 3S5AA 1RUOA 2BJSA 3H3ZA 2Q1ZB 1HJGA 1XNDA 1FV3A 1S2BA 2PHTA 3A4UA 4XXPA 1GU3A 3U78A 4A6SA 5I8YA 1W3XA 5LA9A 1WZXA 3H8UA 3DPRB 4L97A 4AI1A 4MH0E 2JECA 1JUIA 2BGOA 3M70A 4XPVA 1QJX1 4R9AA 3POIA 1VRBA 5FP9A 1AUYA 1MEC3 3T09A 3DF0A 1BLZA 2P3YA 3KS7A 4ISQA 1EYBA 1UZZA 3MLKA 2GNTA 2AEZA 4R9BA 1WW5A 3CDZB 5C70A 2P4EA 2WWSA 2FCTA 3J8F1 4E4DX 2R072 1MVEA 2CAVA 5CZKA 1MR5A 3G6JB 3NQHA 4XXAA 2W1SA 1OPMA 2XJTA 2GH8A 3ZYJB 1JZ7A 2EALA 2GNMA 5JSPA 3AL5A 4Y22B 2AEYA 1JHJA 3OEBA 4HVQA 1H8TB 2GH2A 1DIWA 3FFQA 3GBFA 2ZMKA 1AXZA 5CFDB 4S2DA 3WQBA 5J37A 1X36A 2GU9A 1UOBA 1LEMA 1LOBA 2YPDA 3PVOA 3KM5A 1ODMA 1PVXA 5GM0A 2B46X 2CL2A 2VQUA 1J83A 1JZ2A 3GJBA 4CP1A 3L9JT 4GAZA 3ZFGA 1IZ3A 1S0JA 3OGSA 2HWB1 1ENRA 4WZFA 3MV01 4YFZA 3EMRA 5A3TA 3WNXA 4H14A 2D6KA 2JICA 2GP3A 2ATFA 2W94A 4HK9A 5J96B 2RHPA 1AL21 4JHTA 2XONA 1PX3A 3DN7A 1N3PA 4W6XA 4UT5A 5FWJA 5LWBA 2B45X 4TSVA 3MPBA 4XYXA 4QX5A 3AMHA 3VBHA 4M00A 3UL2A 5A1LA 4NRMA 3ZKYA 1NA1A 5IJRA 4F3JA 1YIPA 1ND3A 1QJX3 4AEDB 2ZGMA 3A23A 2H6BA 3THDA 3C7FA 1AF9A 4K8RB 4ARYA 1H0BA 2VXRA 4L99A 4DIQA 2R061 1P8JA 1GLHA 2IFRA 1G9BA 2VBDA 3J8F3 3LIHA 5FUNA 1LTEA 2Y64A 1AR71 1TME3 4J25A 4Q4W2 1Y4WA 4XDPA 4GA9A 1LULA 5CYYA 1WMFA 5F37A 1M4WA 5LASA 5K0UB 1CAXB 1FPN3 1JH5A 2A3WA 2ZGNA 3IMNA 1TVGA 4IE4A 1MACA 4YVWB 2W0XA 1G8WA 4CDQC 2O0OA 2QE3A 1B35A 3A21A 3ZR6A 1SLAA 3RWNA 4LIVA 1RUE3 2AZ5A 2Y0OA 3EQEA 1LHUA 4DUWA 3PNAA 5LA1A 1OQEA 4N53B 4SLIA 4QGMA 3D8CA 3KZ4C 2UURA 3B93A 4LK7A 2BERA 3BKZA 2HWB3 1V9U3 2E9QA 2PELA 4ISRA 5H9PA 5KXBA 2KA3A 4LXLA 5DAPA 4Q0QA 1L3JA 5FZ9A 4JKKA 2JDKA 1RUG2 1F2NA 2DCKA 5L7OA 1OLMA 1AYM3 2WRAA 2PQSA 3NV1A 2XWJB 4BXSV 3OD4A 2CGPA 3WF2A 2ARBA 1PK6C 3B9CA 3TAYA 4RQPC 5LRRA 1QQP1 5DG1A 5ABJA 4CXYA 4BK5A 4YVSB 1MEC2 3EBRA 4NN0A 3WXPA 3I2KA 4NJ4A 4I01A 2PLV1 4RR3A 4AFDA 4O65A 1CN1A 5FO7B 2WO2A 4Q4X1 1UMHA 2YZ4A 1RJ8A 1S2KA 1K42A 2DUPA 2NQYA 2R063 4FI9A 4W8JA 1HN1A 3ASIA 4MGQA 5DABA 1WA4A 2G1MA 1AR62 4Y33A 1AR73 1BQPA 1VIWB 4KGQA 4NUBA 4RGGA 4CU6A 4JGYA 1OHFA 1FMD2 2WO1A 4IEWA 4CP9B 4UYBA 3B7MA 2A71A 4FPLA 1XYNA 1ENQA 1X8MA 4QM8A 4JVAA 3M3IA 4FAGA 3LKJA 5LEJA 2Q0AA 2VQTA 1APNA 1O4YA 2VZTA 2WKKA 3VDDB 4Z2WA 4Y5TA 3JU9A 4Q4V1 1C5IA 2JG8B 5HCHA 4CUBA 3OPTA 2E6VA 5FMOL 1QMJA 3H1MA 5FPAA 4PF1A 5HCAA 1L7LA 3DGTA 3RFRA 5C3OA 5C6CA 5E88A 1QJU3 5AFEA 4FTBA 3HQUA 4BA6A 1RUF1 2HEWF 5IVYA 3NKTA 2YY1A 2YGLA 2ZGKA 3R05A 5DAVA 3LGRA 2ADEA 2ILMA 3B94A 2ET1A 1QQP3 3H7YA 4HOOA 1V6MA 4NHLA 4YZ1A 4LHSA 5IYYA 4M3CA 5BYNA 1GMMA 4QB2A 4FTSA 4DRRA 2EAKA 5T52A 5FMCA 4Q4X3 4J1XA 5HBAA 4C1WA 4BB3A 1TME2 3KV9A 5ISLA 5AC92 3V0AB 4LKEA 5IFTA 5BNOB 1W8FA 2QTWB 1ENSA 1FPN2 4X8NA 1FXZA 3T1MA 4OI0A 1JBCA 3VBOC 3H42B 1NY71 1ZBA2 3AP6A 3CF6E 1XNAA 1VE0A 2WLQA 3I2HA 1NQDA 1RUE2 3LEGA 1U12A 3IDAA 4AHZA 4LUKA 3FHAA 1UN1A 3IKWA 5AVPA 1ULCA 3OY8A 3ZYPA 3SH4A 1I3HA 3CO2A 3F95A 3NAPB 3QBQA 4QPWA 2BW8A 1XE0A 1N1SA 1RTVA 3VDAA 2PA7A 3AL6A 3VLBB 1CR7A 4Q4V3 2HWB2 1V9U2 4IE5A 5GLWA 4CZSA 2HWD1 4CTEA 1LOAA 4CCMA 1UYPA 5FY1A 1W6MA 1AYM2 1ZRIA 1OLQA 3SITA 2BYVE 3WDXA 1SLIA 3GZEA 1J3RA 5DAQA 1VR3A 3ZXKA 1RUF3 4ORFA 1J1LA 1TG7A 3BB6A 3OSDA 3MBWA 2X5IA 4YWAA 2JKBA 1WLDA 4CVUA 5C5TA 1DF0A 2MEV1 2VVDA 2PHXA 1CAVB 1AR82 3IBMA 5DUXA 4IUGA 2B9VA 4FT8A 4FPHA 4CCOA 3WDVA 4E2SA 3W5NA 3QCWA 5SV8A 1OFSA 3T2QA 5FZBA 3E5XA 2WZ8A 3OD0A 4XHBA 3Q8EA 2R16A 1AJKA 1J1TA 4M0HA 3K2OA 4M4PA 3VBRB 1ZZ6A 4BZ4A 3VB9A 1NG0A 2D6LX 1CPNA 4FPEA 2EICA 3PTRB 5J48A 1PNGA 1QEXA 4BOWA 2FHRA 3WF1A 3HD8B 2XB6C 1ULDA 2EAAA 1W8OA 1U5IA 4XMIA 5E16A 1IKQA 3T2OA 4B4PA 4BM8A 2ETEA 5HXMA 2AC1A 2PXJA 1ULEA 3FZ3A 5BY5A 2RVAA 2VMCA 1DCSA 2VZSA 4HSJA 1VP6A 1H2MA 4CEWA 4N43B 3MIHA 4BQXA 5LCWL 4Y22A 3OGGA 4OZOA 2VCMA 3ZDSA 2AGSA 4QDQA 4IGPA 2W92A 5H9QA 2HWD3 5DZGA 3ZFGC 5C3QA 4EWAA 1QJU2 3C7GA 4ZONA 2GZWA 3JB8A 4HKLA 1KXGA 5CFDA 2WNUB 5F9TA 2RDNA 2CYFA 3MIBA 3MUY1 1IOAA 1QWRA 2A6XA 5LK7B 1DGRN 2Z2SB 3VBHC 3WD5A 3I7DA 1PGSA 5FO8B 2JDAA 2JE8A 4PT6A 1NA1C 5A32B 4W6YA 3ZSJA 4DZGA 1ND3C 3M7AA 5HXVA 5L36A 4J6GA 1YFWA 1A78A 1TMF1 3OF1A 2WS91 1VBC1 4LPLA 5HCBA 3T2PA 4BQWA 4TTGA 5FLHA 2D5FA 2GP5A 3N9MA 2QZ2A 2W9XA 4JX0A 1R092 2WLPA 3O7OA 3ZKUA 1EY2A 4DINB 5IT6A 5BNNB 3EHKA 2G19A 3D5OA 1PGL1 2WSVA 1UZ0A 1YC61 1B35C 2WZR1 2DURA 4K9SA 2FZ2A 3VZKA 4AEDA 4QPIA 4PI2A 4IGQA 3THPA 1GSLA 1UY3A 3WVJA 4CE8A 4E8DA 1QJEA 4WM7B 3ZOIA 1QOTA 2KM2A 4MSVA 3VZMA 2JDMA 2PHLA 4Y24A 1LOGA 1LOCA 3AB0A 5FMDA 3ZFEC 1DYKA 3A22A 3WF0A 5KHHA 1QOSA 2ZX2A 3RQ0A 4CU9A 3S0MA 4BISA 3AKQA 3SISA 2WINB 4AVTA 1ND2B 3VBFB 3ECQA 4MHRA 1ZBE1 5L7OC 2VQ0A 3BYWA 4MGSA 3ACLA 5IW0A 1DYPA 2WZPP 3VZNA 3GHMA 1R1A2 2D7FA 4XILA 4XJUA 4CCCA 3PUAA 4HLTA 4P9GA 3V0BB 2RS51 1KS4A 4KNCA 1Q8QA 4G3YC 5CIRA 2QDNA 4RR3C 3AJYA 4FVVA 1QDCA 1RUH1 2LW8A 5FJHA 5T5JA 1N3OA 1EV13 1JYVA 5JLVA 4COUA 1QJY1 1RUI1 2XQXA 4CDXB 3I3DA 1ULGA 2HEVF 1BBT1 2YMZA 4QU2A 5CB7A 1FX5A 3ME2A 5FPZA 3AKSA 4O61A 3S5QA 4BE3A 1OKOA 2EF6A 2X10A 4GD4A 1S55A 5A3LA 1JUHA 3ILFA 3KCXA 1RXFA 1HX6A 4JGYC 1MQTA 2YGMA 2BBAA 3WP3A 3AZXA 4YM0A 1JU3A 1O8SA 4AZZA 4YVSA 2BOIA 3GBGA 4JGZA 4AFCA 2HWE3 4DY5A 4DY3A 2WZR3 5JXHA 1CJDA 4MGZE 4QHOA 3I54A 1N1TA 2ZCWA 3WV6A 2J1VA 1XYPA 2RMU1 3I8TA 1S0EA 2WR9A 3LWCA 3SH5A 3VZJA 5C3RA 3APBA 2D43A 2GDFA 4MGYE 3VBUB 5FZ8A 3JZVA 4UFIA 1F31A 1HB4A 4LJHA 3K3OA 4HVRA 2CGNA 5CA6A 3JD73 1U5ZA 1H30A 1RC6A 1W2AX 5B4XA 4AOCA 1W90A 1SCRA 1QNYA 3DL3A 3NV2A 4H7LA 2AUYA 2Q5TA 2RDRA 4LO4B 2H0BA 2L9LA 3WR0A 3IT8A 1LESA 2B42B 3TEWA 3K4ZA 3NNJA 1O5UA 2RR13 1CAWB 2HWF1 1QXPA 2JEMA 4J1WA 5KHJA 2J42A 2ZEYA 4Y20A 1ASJ3 2P37A 2G9FA 1LCLA 2RS53 4KU7A 2W1WA 3POWA 4FOYA 2I74A 3MICA 4IEXA 5GLVA 4AAPA 3ROUA 4L11A 2BWCA 1QGLA 1S0IA 1RUD2 1QJY3 1YI7A 1RUI3 2Y6GA 3LDRA 4JV4A 3BTXA 2ZEWA 3IDBB 2WNVB 1D0HA 3VKLA 1CGPA 4PIYA 1WW6A 5JXJA 1QXJA 1IPKA 2P6CA 4CDWC 5C71A 4CDUB 1OD3A 3D82A 3W59A 3O5SA 1UU5A 1DHKB 2QNKA 3B3QE 1WMDA 1UL9A 3KCCA 3ZPYA 3RI8A 2PHFA 4O9GA 3TB0A 3A0KA 4A7KA 3WG2A 3S30A 2ET7A 3C7EA 4ATFA 2RMU3 3WUCA 5B2GB 2XLGA 4FXGB 2DFCA 3AVRA 4UFHA 4AAXA 3NNGA 2ZHNA 4AHYA 3H1YA 3H8RA 3AYCA 1FAYA 3UKNA 3L2HA 3H9AA 2BBVA 5EJZB 3RRDA 4OHZA 1OMIA 3P3NA 5A7WA 2WAAA 1YJKA 1VPHA 1JXNA 2VNOA 1OOPB 4UW4A 4XFGA 2Y6FA 5LBEA 3UESA 1V6OA 4M3CE 1JZ8A 2ORXA 4PDWB 5IVEA 3GHNA 5FBZA 4U36A 5ANNA 2X5IC 2OZJA 1T2XA 2HBUA 4OQ8A 4XFAA 1QHDA 5IAXA 2RM22 3VKMA 4YARA 1NX9A 1EV12 2W52A 3CIHA 3OBZA 2ZEZA 2OPWA 4HK8A 1UXXX 3ON7A 4C91A 5FZ7A 1PVC2 1WMEA 1OD5A 4META 1IPJA 3VHNA 2LS6A 1W6QA 2D3SA 3KLSA 4ET7A 2VMEA 5FY7A 4WM8B 4UBHA 2G9ZA 1CAUA 1L7QA 1ZRRA 5A33B 2JB8A 2HWE2 2HYXA 4CXXA 3ZN6A 1DZTA 3WW4A 2R071 2WZR2 1EPZA 3VD9A 1CAVA 1DQ5A 1QJFA 1J3PA 2HH9A 1YHFA 2FCUA 3E5UA 4D6SA 3O1SA 4JKMA 4CCEA 4JZRA 2HLEA 4IW3A 2BQPA 1NLRA 2W47A 1PIV1 2VZVA 2BZDA 4CEWC 2JX9A 5E6HA 1W6PB 4OHYA 5EFUA 4AVBA 4CUCA 1OQ1A 4RFRB 4CA9A 2QQUA 2QZ3A 3Q9OA 3JD72 3HNBM 4RSUA 1FT9A 4E27A 5CFDC 3BCWA 5EP9A 4ZZ8A 3HMYA 5C5UA 3CEWA 3HN1A 4QHZA 4R4ZA 1X50A 3LEMA 2BEOA 5BUVA 2RR12 3I2DA 3HBZA 2XBO3 4UW6A 1VRH2 3UT0A 1JYNA 1ASJ2 2VOWA 3R4DB 1SBFA 3HQRA 4X6RB 5FYUA 4YW7A 2A70A 2FDFA 3OTFA 5C7GA 4N43A 4L0PA 1PM7A 1OF3A 3ACIA 2FCVA 2SBAA 5CVRA 1OC1A 4INDA 4ZS3A 2BGCA 4AQ2A 3B69A 2OUJA 4FCAA 2GN3A 2O1QA 4P9XA 3ST7A 2R043 1US2A 1H4GA 3ZDVA 3RNSA 2Q8OA 3T4VA 5F7UA 1DG6A 3WQ0A 5IK7A 3WEZA 4AVVA 4AEDC 4AHWA 4QPIC 3I4IA 2XVLA 4CCLA 2RE9A 2W1QA 1YCIA 5BXXA 4LKFA 4CU7A 4Q4W1 1EAH2 1UX6A 1PIV3 2DF7A 1GZWB 2JENA 2B4KA 3RZMA 3NRUA 2QBXA 1XNKA 3U07A 2IWGB 2BVBA 5GLUA 1UKRA 1VMJA 1LHVA 4XFBA 2ZGRA 5T3NA 1DLCA 3I3BA 4RL7A 5FXXA 1SFPA 4HZFA 5CKNA 2BGPA 4NROA 1QH6A 1W9TA 4AFAA 3MLJA 5FMBA 2ORZA 3GCWA 5BNPB 4DFSA 5GZCA 1UD1A 5FKCA 3LE0A 3SXWA 2FDGA 5DZFA 4LUMA 5FPLA 3R0RA 4NWVA 4XZPA 1IHMA 1W06A 5FZ4A 3VDBA 4ATEA 1UMZA 5FY9A 1RUG1 5FLIA 2QQLA 1J59A 2XR4A 5F6KA 3JQXA 1ND2A 5LBBA 4K6BA 5KC6A 2GC2A 4NIHA 1IKPA 2VH9A 2OA2A 2KXLA 1I6XA 3NNLA 2J7MA 4UF0B 1F4HA 1XU1A 3LFMA 2XMLA 1MQTC 3PHMA 3WDYA 1ULFA 2A3YA 2XLFA 3VD3A 1HQLA 3ZN4A 1Q3EA 1FV2A 2W91A 4KBBA 4EN8B 3V0BA 4YVSC 3ZMNA 1W2UA 1YO8A 3PURA 4JGZC 4K3UA 4PHZA 4HPKB 5FY4A 2QCSB 3WG4A 1C3HA 3BTYA 1RGSA 1DU3D 2DWRA 1V70A 2ARAA 2WYSA 3OB8A 4QAWA 4YG6A 2IXJA 3LA2A 4CDXA 1RB8G 4OCTA 2JD4A 2VNRA 1X9PA 2GC0A 4MZUA 4CEYB 1FMD1 1W2TA 4YW4A 1S0GA 1IPSA 3SKVA 1W9YA 1PGW2 1XYOA 1FNZA 4XJ8A 5C4WA 5C9AA 1W3VA 3VBOA 3GF6A 5FYYA 4P9IA 4KG0A 4HN0A 1QJZA 1GP6A 3OYWA 3ES1A 3AM2A 3PL0A 2LALA 2XBO2 3ZPOA 3ATGA 3HIFA 5EZWA 3AK0A 4CUAA 2VZRA 4DNYA 1OPOA 5I8SA 2G4IA 1W9WA 4R4XA 1NYWA 4XQ4A 3AYDA 4FPFA 4LKDA 4GH4A 1HQNA 4K8FA 1JOBA 2JWPA 2QQKA 4UFJA 3GNEA 2WQ8A 3HJRA 5JR2A 4QXHA 1K5MA 4FPGA 4BMEA 1RUG3 2BOJA 2VOXA 1MS9A 2BFUL 4E8CA 5JCTA 5FTTC 2R042 4Z2AA 3CJIA 3WF3A 1S0FA 1VBE3 3D6EA 1O3RA 1CAWA 5GLTA 4N7IA 2ZGTA 3CU7A 3B02A 3N9OA 3WHTA 5FOBB 2C5DA 4A45A 2RJLA 3AMMA 4BLIA 3T4HB 4E2QA 3N3HA 4R52A 1TME1 4COWA 3DEMA 5AC91 1Q8OA 3JB4C 2BP6A 2R49A 1Z7S2 5EHDA 4TLFA 3N4MA 1PIV2 1V0AA 1PZ9A 3W5MA 1FPN1 3LDBA 4KWKA 2E32A 2BTVC 2OPKA 4WBBA 4UOJA 5A1FA 2WT1A 4Q8LA 1FMD3 4XFHA 4KGGA 4BXFA 1FOD2 1ZBA1 2Q30A 4FQZA 4DO0A 2VTXA 1RUE1 4LLOA 4XF4A 4H55A 4MGTA 4FFFA 3W20A 2VU9A 4GZ9A 5FK8A 3VKOA 1I1EA 4PI0A 1MZ6A 1XU2A 2SLIA 2VOTA 3L2YA 1W8TA 2QJVA 3K4AA 4QGLA 2K46A 1D7PM 1W6NB 1AX0A 1V9U1 2CDPA 3NAPC 5L9RA 3FLRA 1V6JA 3PLQA 1UOGA 5KC5A 2F4LA 5FPBA 4OULA 2WSUA 4AR2A 2PHDA 5C8CB 1AYM1 2EXHA 2V5YA 3GXUA 3KT1A 4IV1B 1IGOA 2OIIA 4AHXA 4EYUA 1OOPA 2D3PA 1CESA 4WVMB 2BWAA 1EPWA 5JXIA 3O0VA 2OXBA 5F5AA 2FMDA 1UPIA 1UX7A 1ZVFA 3DYOA 2VGDA 4LKSA 3P3PA 4URAA 1AR81 2DVGA 3M3CA 5FP4A 3MI8A 4LO5B 2OT7A 2WDBA 4XE9A 1IS3A 2WL1A 3K48A 4IV3B 1YXWA 3ACGA 4S2FA 3KVAA 1VB2A 1C8M2 1NZIA 4JRAA 5ANQA 2MNGA 5JZGB 2AR6A 3MV11 4CUGA 2QQPA 5FLJA 4KQ7A 1GZ9A 5AC93 3LOBA 4CU8A 4HONA 3PJQA 4NPLA 2C0ZA 1MVQA 4NO4A 3VD7A 3M8LA 4QM9A 2EVXA 4XF1A 1GNZA 3ORJA 1O3TA 4WM8A 1VJ2A 1ZBA3 5A3UA 4WVWA 1L7RA 1NCQB 2EXIA 4Z07A
chains in the Genus database with same CATH topology
5FZDA 2VD7A 5FYHA 3K2OA 1VRBA 4LIUA 3KVBA 4QWNA 5E6HA 5FP9A 2P5BA 5FYYA 4AI9A 5F2SA 5FZAA 4Y4RA 3PTRB 3KV6A 4IGOA 5FY5A 4Y33A 5FUPA 4NUBA 5FY0A 3ZPOA 5IVBA 4UF0A 5FZ0A 2PXJA 2OQ6A 3LD8A 5FZ8A 5FPUA 4LITA 5FYIA 3AL5A 3N9NA 2OS2A 4CCKA 5A7QA 3K3OA 4GJZA 4QXHA 5A80A 2Q8DA 5FYUA 5FZ1A 4IGPA 5FZOB 5F3IA 2YPDA 2YU1A 3OPTA 4V2VA 2YBPA 5F32A 5LW9A 5FZOA 5FPAA 5FP8A 5FYBA 5A7WB 5FYMA 3N9OA 4GAZA 4CCNA 5FZLA 4QXCA 4AAPA 3N9PA 3PUSA 3KV5A 5FZKA 4E4HA 3UYJA 5FJKA 5A3TA 4XDOA 2GP3A 5FXWA 3PUQA 5IVYA 5LY2A 5FY8A 5FPVA 5FP7A 4CCJA 3PDQA 5FYSA 5FZMA 4CCLA 4HOOA 4CSWA 5FWJA 3LDBA 5LWBA 4D6RA 4EZ4A 5F5IA 5A1FA 2GP5A 3N9MA 4BXFA 2XXZA 5A7OA 2YU2A 5A1LA 5LY1A 4Y3OA 4DO0A 4QXBA 5FZ6A 5FYVA 5FWEA 3KV9A 5ISLA 2YBKA 5FZ3A 5IWFA 4V2WA 4DIQA 3AVRA 5FYZA 5A7NA 4BU2A 4D6QA 5FXXA 2OX0A 4IGQA 4TN7A 5IVJA 5IVVA 5FZGA 5FUNA 5FZEA 5FZCA 3K3NA 5K4LA 5FZIA 5A7PA 5A7WA 4XDPA 5F39A 5F37A 5FPBA 5F3CA 5A3PA 5F2WA 3DXTA 4QX8A 5FV3A 5FXZA 5FPLA 5FBJA 3DXUA 3U4SA 5FZ4A 4BISA 5IVEA 2W2IA 4EYUA 2WWJA 3PU8A 5F5CA 5FY9A 4LIVA 5A3NA 3AL6A 5F5AA 5IVFA 5A3WA 5FP3A 2XUEA 5IW0A 4URAA 4CCMA 4GJYA 2OT7A 5FY1A 4QU1A 3KV4A 5FZBA 3PUAA 5A7SA 4EZHA 4UF0B 2XMLA 3KVAA 5CEHA 5FYTA 5ANQA 5FZ7A 5FZ9A 5IVCA 4C8DA 3PU3A 2OQ7A 5FJHA 4LXLA 5FZFA 3NJYA 3PURA 5KR7A 4CUGA 3N9QA 5FYCA 4HONA 5FY4A 5F3EA 5FY7A 2Q8EA 5FP4A 5FXVA 3OPWA 3N9LA 4GD4A 3AVSA 3RVHA 3U78A 4CCOA 2WWUA 4ASKA 2Q8CA 2XDVA 2YBSA 4D6SA 5F3GA 5FZHA 4QX7A 3ZLIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FZD A;  2VD7 A;  5FYH A;  3K2O A;  1VRB A;  4LIU A;  3KVB A;  4QWN A;  5E6H A;  5FP9 A;  2P5B A;  5FYY A;  4AI9 A;  5F2S A;  5FZA A;  4Y4R A;  3PTR B;  3KV6 A;  4IGO A;  5FY5 A;  4Y33 A;  5FUP A;  4NUB A;  5FY0 A;  3ZPO A;  5IVB A;  4UF0 A;  5FZ0 A;  2PXJ A;  2OQ6 A;  3LD8 A;  5FZ8 A;  5FPU A;  4LIT A;  5FYI A;  3AL5 A;  3N9N A;  2OS2 A;  4CCK A;  5A7Q A;  3K3O A;  4GJZ A;  4QXH A;  5A80 A;  2Q8D A;  5FYU A;  5FZ1 A;  4IGP A;  5FZO B;  5F3I A;  2YPD A;  2YU1 A;  3OPT A;  4V2V A;  2YBP A;  5F32 A;  5LW9 A;  5FZO A;  5FPA A;  5FP8 A;  5FYB A;  5A7W B;  5FYM A;  3N9O A;  4GAZ A;  4CCN A;  5FZL A;  4QXC A;  4AAP A;  3N9P A;  3PUS A;  3KV5 A;  5FZK A;  4E4H A;  3UYJ A;  5FJK A;  5A3T A;  4XDO A;  2GP3 A;  5FXW A;  3PUQ A;  5IVY A;  5LY2 A;  5FY8 A;  5FPV A;  5FP7 A;  4CCJ A;  3PDQ A;  5FYS A;  5FZM A;  4CCL A;  4HOO A;  4CSW A;  5FWJ A;  3LDB A;  5LWB A;  4D6R A;  4EZ4 A;  5F5I A;  5A1F A;  2GP5 A;  3N9M A;  4BXF A;  2XXZ A;  5A7O A;  2YU2 A;  5A1L A;  5LY1 A;  4Y3O A;  4DO0 A;  4QXB A;  5FZ6 A;  5FYV A;  5FWE A;  3KV9 A;  5ISL A;  2YBK A;  5FZ3 A;  5IWF A;  4V2W A;  4DIQ A;  3AVR A;  5FYZ A;  5A7N A;  4BU2 A;  4D6Q A;  5FXX A;  2OX0 A;  4IGQ A;  4TN7 A;  5IVJ A;  5IVV A;  5FZG A;  5FUN A;  5FZE A;  5FZC A;  3K3N A;  5K4L A;  5FZI A;  5A7P A;  5A7W A;  4XDP A;  5F39 A;  5F37 A;  5FPB A;  5F3C A;  5A3P A;  5F2W A;  3DXT A;  4QX8 A;  5FV3 A;  5FXZ A;  5FPL A;  5FBJ A;  3DXU A;  3U4S A;  5FZ4 A;  4BIS A;  5IVE A;  2W2I A;  4EYU A;  2WWJ A;  3PU8 A;  5F5C A;  5FY9 A;  4LIV A;  5A3N A;  3AL6 A;  5F5A A;  5IVF A;  5A3W A;  5FP3 A;  2XUE A;  5IW0 A;  4URA A;  4CCM A;  4GJY A;  2OT7 A;  5FY1 A;  4QU1 A;  3KV4 A;  5FZB A;  3PUA A;  5A7S A;  4EZH A;  4UF0 B;  2XML A;  3KVA A;  5CEH A;  5FYT A;  5ANQ A;  5FZ7 A;  5FZ9 A;  5IVC A;  4C8D A;  3PU3 A;  2OQ7 A;  5FJH A;  4LXL A;  5FZF A;  3NJY A;  3PUR A;  5KR7 A;  4CUG A;  3N9Q A;  5FYC A;  4HON A;  5FY4 A;  5F3E A;  5FY7 A;  2Q8E A;  5FP4 A;  5FXV A;  3OPW A;  3N9L A;  4GD4 A;  3AVS A;  3RVH A;  3U78 A;  4CCO A;  2WWU A;  4ASK A;  2Q8C A;  2XDV A;  2YBS A;  4D6S A;  5F3G A;  5FZH A;  4QX7 A;  3ZLI A; 
#chains in the Genus database with same CATH topology
 4LHK A;  1F15 A;  3DYP A;  4BMB A;  3C7O A;  3MLL A;  4LO8 A;  1A8D A;  4BDV B;  1EUT A;  5JAX A;  2ZZJ A;  1YQ6 A;  3O1O A;  1XC6 A;  2TNF A;  3ZFE A;  4N43 C;  2R30 A;  3WNP A;  5CAZ A;  4FPY A;  2XPJ A;  3PMS A;  2OYZ A;  3KHC A;  4IDZ A;  1QJU 1;  4M0N A;  3I2G A;  4Q4Y 3;  5IVB A;  3M3O A;  4OMC A;  1OF4 A;  4NMI A;  2DVA A;  2VE1 A;  2ZKL A;  1JN2 P;  4P9W A;  2V5D A;  1AL0 G;  4AI0 A;  1SLB A;  2E31 A;  2DUO A;  2WNU C;  1NAE A;  5A7Q A;  1S2E A;  1J84 A;  5A80 A;  1VBE 2;  2GNB A;  3C2U A;  2E63 A;  2Y26 A;  1SDD B;  4IEU A;  4QX1 A;  1J58 A;  3KF3 A;  5CFC A;  4CRQ A;  2O8Q A;  3H3L A;  5KBF A;  1AR8 3;  4WV8 A;  3WP5 A;  4LBL A;  3UJQ A;  1WLC A;  1WCK A;  2IC1 A;  1JTZ X;  2ENR A;  3T0B A;  3U4X A;  5DUU A;  4NHM A;  1AZD A;  3JCI A;  5DXD A;  2UWC A;  2XJS A;  2QUO A;  4E4H A;  1R09 1;  3ZIW A;  2WC2 A;  5AFB A;  4FOW A;  2W5F A;  4JQR A;  4WZC A;  4XJW A;  5FPV A;  5LAT A;  1GYK A;  3I59 A;  5J98 B;  4QQP A;  3ZXG A;  5GZD A;  4I02 A;  2B9U A;  1BVV A;  3FL7 A;  3PDQ A;  4DOU A;  1LKN A;  4B7E A;  1GNH A;  4NAO A;  5LBF A;  1O8P A;  3GYD A;  4UBG A;  5JR7 B;  5FUI A;  3EB7 A;  2KR2 A;  1QF3 A;  1LGC A;  4YW5 A;  2E26 A;  1C5H A;  5BPX A;  1HB3 A;  3E6C C;  4HT1 T;  1D0G A;  5FWE A;  4A41 A;  4XBQ A;  1BZW A;  2YBK A;  2ZGU A;  4QD2 A;  4AEK A;  2JDZ A;  4YRD A;  1AX2 A;  3RZH A;  5D21 A;  2JXA A;  3ZSE A;  4TN7 A;  1OUR A;  1GWM A;  3INA A;  1AR6 3;  3AP5 A;  4XUO A;  2X53 S;  2ZHL A;  5FQ0 B;  1ND2 C;  1RED A;  2RS1 2;  3D0J A;  4IL7 A;  4XJ9 A;  3SKJ E;  2JE9 A;  4GXL A;  1ZZ8 A;  4GMP 0;  1R1A 1;  4B1L A;  3W58 A;  4DRV A;  2A75 A;  4MGK E;  4COY A;  4N90 A;  1YRZ A;  5IUQ A;  1WWY A;  1HLC A;  1ODN A;  2ARE A;  2R0H A;  3POG A;  2IXH A;  3DXU A;  3TN9 2;  3VD4 A;  1GBG A;  2NLR A;  1DQ2 A;  5F5C A;  1JHN A;  4AQ6 A;  3PJY A;  3USU B;  2EID A;  3DKQ A;  1GZC A;  4N7U A;  4SBV A;  1W6O A;  1OQD A;  3E5Q A;  2DU0 A;  3NST A;  4XF0 A;  5D8A B;  5T54 A;  2VR4 A;  4XF9 A;  3TEX A;  4RYD A;  4XIO A;  4CDX C;  4NOT A;  2VAU A;  2UY8 A;  3MEP A;  1QIQ A;  3LA3 A;  4JTO A;  3O1M A;  1N47 A;  1UCX A;  2D6N A;  1KJL A;  1R09 3;  4Q0V A;  2RDS A;  2VM9 A;  1ZRF A;  4CDW A;  1Q8S A;  2DTY A;  5C4W C;  1S0C A;  1YNA A;  2CTV A;  2JIJ A;  5C9A C;  3B00 A;  3R6S A;  2ZAH A;  4LQR A;  3OPZ A;  2Q8E A;  3H0O A;  3M2M A;  3WF4 A;  2BRT A;  3FX3 A;  4F8A A;  4DXS A;  4CPB D;  4AWD A;  2JB4 A;  1JYI A;  5DPN A;  2BVV A;  3VZO A;  3O0X A;  1QH7 A;  1RYY A;  2IXL A;  2B8M A;  1UO9 A;  1MS0 A;  1KFU L;  4E2G A;  4QX7 A;  3K46 A;  4X8P A;  3J26 N;  3QH6 A;  4GH4 C;  1W8W A;  3BIW E;  5JI9 A;  2VZQ A;  2Z79 A;  4MGI E;  4Q4Y 2;  4QXK A;  2W46 A;  3ZO0 B;  4COV A;  4EN6 B;  4AGV A;  3NL1 A;  3S57 A;  1K5M C;  2G9G A;  3OOX A;  1ZX5 A;  4LLF A;  5FZA A;  2V4V A;  2X05 A;  3LEK A;  4Z82 A;  1A34 A;  4YZ4 A;  3CJI C;  2Y6K A;  4YGE A;  2WUH A;  1UAI A;  4NPR A;  4Q1P A;  1R1A 3;  3ITQ A;  1Y9Q A;  4DMI A;  3CL1 A;  3NJZ A;  3D0S A;  2UWA A;  2WQ4 A;  3LB9 A;  4IER A;  3B01 A;  1RUD 1;  4IEO A;  5GKA C;  3ACH A;  2Y60 A;  3U10 A;  4U2A A;  1FYU A;  4V1P A;  2XJQ A;  4TYS A;  5FZO B;  3BIE A;  1NT0 A;  4I09 A;  1TE1 B;  1UU4 A;  4GWM A;  1DQ6 A;  2JDN A;  2VMH A;  3KMH A;  4UFL A;  1OA2 A;  3VHO A;  3LDK A;  2W87 A;  3DPR A;  2QVS B;  2XKO A;  2YG0 A;  2YFZ A;  4LE3 A;  5FK7 A;  4H3W A;  2ERF A;  2QQI A;  3MW4 A;  4HL0 A;  1COV 3;  2EXJ A;  2VCA A;  1WD3 A;  1MZE A;  3IN9 A;  2DBN A;  3TEZ A;  1SMV A;  4XDO A;  1QDO A;  2BU9 A;  3HN3 A;  4CDU C;  3DV8 A;  1VMF A;  1DZR A;  1F4A A;  4KBZ A;  5J1X A;  4LBQ B;  4AFB A;  2JDY A;  5FO9 B;  3W21 A;  3FHI B;  2JDU A;  2K2S A;  4QKD A;  3C7H A;  2X09 A;  2IVI B;  4NPM A;  4HXC A;  3QLQ A;  1H8V A;  2WBK A;  4LA2 A;  5IVJ A;  4P9L A;  5APA A;  4PLO A;  2B39 A;  1VLN A;  1H8T A;  2RS3 2;  3MDP A;  4FO9 A;  3ZSK A;  1CIW A;  1SBE A;  3AFK A;  4B8E A;  2FQP A;  4DB5 A;  4D7T A;  5IAT A;  4LBM A;  3WOG A;  4LK6 A;  1XJA A;  1G6N A;  2DU1 A;  2IFW A;  2VCC A;  4G4F A;  1OOP C;  1RUC 3;  3ZN5 A;  1KJR A;  1YYN A;  4NAM A;  4XUN A;  3PIJ A;  4IEY A;  1KQR A;  4GKX A;  4HKW A;  5HCF A;  3ZYR A;  3NV3 A;  4LHL A;  4PDW C;  5DQ0 A;  3MYX A;  4XOG A;  3SLI A;  3GZA A;  2RM2 1;  1AR9 1;  1EV1 1;  4YFW A;  4I0A A;  1W6N A;  4QX8 A;  5FV3 A;  2HWC 3;  3LEI A;  2A6W A;  3GDB A;  3UGG A;  5I0U A;  1PVC 1;  1RUD 3;  3ETQ A;  4Q2F A;  3MIG A;  5KXC A;  1KIT A;  1XNB A;  5A3N A;  4OMD A;  3RZG A;  4TZD A;  1O59 A;  3HR9 A;  3S7E A;  1PK6 B;  1UY1 A;  4RQP B;  1MS3 A;  3ETP A;  2ID4 A;  1IG0 A;  1X8E A;  4EZH A;  4WM8 C;  2HWE 1;  5J36 A;  1LOF A;  1R08 2;  3AMP A;  4P14 A;  2E7T A;  1OUS A;  3DYM A;  4XBL A;  1IS4 A;  1RVF 3;  2ES3 A;  4LO6 B;  3FUQ A;  4AQT A;  1KGY A;  2OZ6 A;  3KQ4 B;  2TBV A;  4AXO A;  3N9Q A;  3B9I A;  5JZG A;  5LEK A;  2BV4 A;  5JIA A;  2YB7 A;  1HDK A;  1GP5 A;  2A6Y A;  3MW2 A;  3AXD A;  1UU6 A;  4FPO B;  4KMQ A;  4XET A;  2A5Z A;  2YC0 A;  2TEP A;  3WQ1 A;  3RVH A;  2NYY A;  5K0U A;  2WWU A;  1CAX A;  1I5Z A;  1PO2 3;  3JD7 1;  1C1L A;  3I2F A;  3UK9 A;  2AH2 A;  2VXJ A;  1ZZ7 A;  1GOH A;  4NIA A;  3T2T A;  4YVW A;  5K9Y A;  1SFY A;  5KXE A;  1YFU A;  1JI6 A;  4C1X A;  2BNM A;  2VNV A;  2PN5 A;  1A3K A;  2RR1 1;  3RI9 A;  4QWN A;  1VRH 1;  1NCQ A;  1ASJ 1;  1Q8P A;  1O6U A;  3KV6 A;  4K1Z A;  5DDJ 2;  4AYU A;  2LM3 A;  5CFC C;  1JYC A;  4N53 A;  4P00 B;  4ES8 A;  3CZJ A;  1O3S A;  4AI8 A;  3ILN A;  2DCY A;  2RM2 3;  2BNO A;  1AR9 3;  2D98 A;  3AKT A;  4GKY A;  4UW5 A;  1J3Q A;  4OFG A;  4LE4 A;  3WLU A;  4QQO A;  2R6Q A;  4Q8K A;  4N9H A;  1CX4 A;  1TNR A;  1PVC 3;  3ZYB A;  4NRQ A;  5EWS A;  1YEW A;  3NNF A;  3H1W A;  5ERL A;  2OKX A;  4EJR A;  4XUR A;  1ACC A;  2QQM A;  1COV 2;  4D69 A;  5JSO A;  2VMG A;  1BEV 3;  1H2L A;  2RG4 A;  4RN5 A;  5DN2 A;  3TWI A;  3U14 A;  1W2O A;  1RHI 2;  1C1F A;  5FYM A;  1GIC A;  4CXW A;  1UWW A;  4CCN A;  1EAH 1;  3KV5 A;  5FMO S;  2J1U A;  3UYJ A;  4XF3 A;  3POS A;  3WQ7 A;  1OLM E;  3T3Y A;  1UYZ A;  2JG9 B;  2ZPX A;  2PAE A;  4XUQ A;  2ZEX A;  1NE6 A;  4BHP A;  1OLR A;  2CU5 A;  4QX3 A;  1W9S A;  2WAB A;  2HJI A;  3IDE A;  4BCU A;  2VUJ A;  2D93 A;  1U0A A;  3N7M A;  2MPF A;  1AHS A;  1E5R A;  4CP9 A;  3UV9 A;  3O1V A;  5CIS A;  1RUC 2;  5A6Q A;  4MOA A;  2YHJ A;  1O5L A;  2O8O A;  1MZ5 A;  4Q0U A;  3SC7 X;  1VRH 3;  4D7Y A;  3WSO A;  3ZFF B;  3VGI A;  4A44 A;  3P6B A;  3VDD A;  3BU0 A;  5E89 A;  3KWV A;  5HI0 A;  2PAM A;  4BU2 A;  2VPV A;  2HWC 2;  2JG8 A;  2CWM A;  4UI9 L;  5FDB A;  1U5X A;  4JC1 A;  4OHV A;  5FZC A;  5EIY B;  3IZO A;  1LOD A;  3PUH A;  3VL9 A;  2WFP A;  3I2J A;  3BPS A;  3IAQ A;  3KT7 A;  1DGW A;  1NCR B;  1WCQ A;  5FR3 A;  5F2W A;  1QKQ A;  2I07 B;  3NWK A;  4EV0 A;  5FQ0 A;  4DS0 A;  2J1S A;  2DVB A;  2TUN A;  3WG1 A;  5A6Y A;  4Y26 A;  2AAC A;  4AQS A;  2WWJ A;  1M06 G;  4YLZ A;  2JE7 A;  2CSG A;  4JDM A;  4OI1 A;  2R1D A;  1MS8 A;  2ZGQ A;  3FFZ A;  3TYJ A;  1YUD A;  4MX3 A;  4XCB A;  4OQ9 A;  1RVF 2;  3MID A;  2CY6 A;  2EIG A;  4AVC A;  3USU A;  3RZK A;  3I3M A;  4FBF A;  4M01 A;  3NKG A;  1EAH 3;  1UMI A;  2ZGP A;  1JW6 A;  3VL8 A;  1F5J A;  2D44 A;  5FCC A;  3WW3 A;  5A3O A;  4Z92 B;  4MG2 A;  4QT6 A;  3AMQ A;  2RDQ A;  3V0A A;  4Y1Z A;  1PGW 1;  4Q29 A;  2VNG A;  5BNO A;  1PO2 2;  1PZ7 A;  4LBQ D;  2CWS A;  1HV0 A;  2EA7 A;  4JHZ A;  3ZR5 A;  3FE5 A;  4BQY A;  2XKP A;  5FXV A;  1UZY A;  1JOD A;  3FWE A;  3N36 A;  4ZZ5 A;  1JYW A;  3A7Q A;  3SH3 A;  2GMP A;  2XBO 1;  2D6P A;  3V56 A;  4ZKT B;  5ACA 2;  2F4P A;  3FLP A;  3FUO A;  2JDH A;  2YBS A;  2ZMN A;  3N7J A;  5T55 A;  2WJS A;  4OLL A;  3GBW A;  3VHR A;  4HMZ A;  3ZFG B;  3ZM8 A;  3NAP A;  4QPG B;  3WW1 A;  4DUV A;  1AR9 2;  1EP0 A;  5F2S A;  3CNA A;  4M3C F;  4ZU4 A;  4W65 A;  1F9K A;  1W04 A;  2Z42 A;  2R04 1;  2WZE A;  2JKX A;  1JYT A;  3AX4 A;  5L19 A;  3LD8 A;  4XIK A;  5G05 L;  3VN4 A;  3MF6 A;  4IES A;  5TSW A;  3DPR C;  3DUI A;  5L9V A;  1W0N A;  3KHB A;  2H6C A;  2V09 A;  2ADD A;  4GB3 2;  5DZE A;  3VBH B;  2W39 A;  3E97 A;  1BEV 2;  1S4C A;  1NUK A;  3RS6 A;  5F8P A;  4CP0 A;  5F5Q A;  4YZ2 A;  3SNM A;  4ASL A;  1RIT A;  4MAD A;  3LPF A;  3EO6 A;  3J7H A;  2DUQ A;  3CHX A;  3POJ A;  1Y43 B;  1Z7S 1;  3JUU A;  1ENX A;  4I2O A;  4DPN A;  5FZO A;  1VAM A;  3HT2 A;  5BNQ A;  1FAT A;  5LA0 A;  1LHW A;  4F83 A;  4D8M A;  1WUV A;  5H9S A;  4W50 A;  3VBR A;  1H9P A;  1FOD 1;  4AL9 A;  1UPS A;  1H8T C;  2XVK A;  3RDI A;  3RG0 A;  2XJU A;  4JRL A;  4GMP 3;  3WNL A;  2OUH A;  3NVC A;  2W08 A;  5T5L A;  3K77 A;  1B35 B;  2AYH A;  3MO4 A;  2VW0 A;  1NXM A;  1DYO A;  4I30 A;  3VKF C;  4AGR A;  4AGG A;  3NNM A;  4MUV A;  2WT2 A;  3WCS A;  1IS6 A;  1GFF 2;  2HKX A;  5A7O A;  1JS9 A;  3ZXD A;  2ARX A;  5CAD A;  2ZGS A;  2VY0 A;  4JDO A;  4IET A;  3HVD A;  5I0D A;  5L7O B;  5FAX A;  2E51 A;  1W39 A;  3EJK A;  3MFA A;  3OJB A;  5EYY A;  4AE2 A;  4EN9 B;  2WNU A;  5CU1 A;  1D4M 3;  4NRP A;  2Y0I A;  4PQQ A;  2J22 A;  1KEX A;  4FFI A;  5ABJ B;  1YFX A;  2A73 B;  4A42 A;  4CP2 A;  4YW6 A;  4EN0 A;  1LOF C;  5A32 A;  3N7L A;  1WLT A;  1E5I A;  1C8M 1;  5KHI A;  4R9C A;  4OUE A;  2CGO A;  3SCG A;  3V65 A;  4IV3 C;  4RS5 B;  1Y9M A;  3KF5 A;  4DEV A;  4DUX A;  3J4U H;  4E9K A;  3MPP G;  4QKF A;  3WHU A;  1VBB 3;  4N8M A;  5T5P A;  3SHR A;  5K7P A;  1GUI A;  1UXZ A;  5JZG C;  3VUO A;  1KFX L;  1LU2 A;  1Z7S 3;  2Y6J A;  2ZJC A;  3WNK A;  2XUE A;  1HRI 2;  5GZG A;  2BDR A;  2DV9 A;  2GC1 A;  3T0A A;  4JGY B;  3POB A;  5K0U C;  5M0T A;  5CEH A;  3SCH A;  1KD7 A;  2IXC A;  1F35 A;  1FOD 3;  1ULO A;  1CPM A;  2EXK A;  2VCB A;  3WP4 A;  4YVW C;  1OKQ A;  1R1Z A;  5BNN A;  3BTA A;  1X33 A;  1CX1 A;  4KU8 A;  3MIE A;  1E5S A;  4Y5S A;  5FYC A;  1NCQ C;  4Q5O A;  1BMV 2;  2UYA A;  1LGB A;  1KDK A;  4YZ5 A;  2XWB B;  4WM7 A;  4ZU5 A;  1H4H A;  5A1A A;  1W99 A;  4N53 C;  2RV9 A;  4OI2 A;  4HVO A;  3TNQ A;  4XDQ A;  4E4Z A;  1VBA 2;  5T5O A;  3AYA A;  1X7N A;  4KH9 A;  4IEQ A;  3LIG A;  1BK0 A;  4MO3 M;  5FYH A;  1N1V A;  2P3J A;  3VBF A;  4B4R A;  2YRO A;  2ZA9 A;  3GZU C;  5IK5 A;  1VBE 1;  2CAU A;  5GLZ A;  4IE7 A;  1UQX A;  1JZ5 A;  2VW2 A;  4GWJ A;  4QQH A;  2VC9 A;  2ZAB A;  2CHH A;  4QGN A;  4PJY A;  3RSJ A;  3S7I A;  5FZ0 A;  1XNC A;  4XUT A;  4XW3 A;  2W3J A;  5FPU A;  5E1R A;  1YJL A;  5DAX A;  4ASM B;  1C8M 3;  1JOJ A;  5CKQ A;  2GND A;  1LED A;  4H2A A;  1ST8 A;  1GWL A;  4LOT A;  2E33 A;  5FZ1 A;  2YYO A;  4XAA A;  5JIU A;  2C1F A;  2QQW A;  5F3I A;  3VDC A;  1V6L A;  2D40 A;  1K3I A;  5IAV A;  4LO7 A;  5F6L B;  3QOP A;  5FP8 A;  4UAP A;  3A0N A;  1WW4 A;  1LOE A;  4XUP A;  1GKB A;  1G9C A;  1GQG A;  4PLN A;  1HIX A;  3QH7 A;  5JI7 A;  3AKP A;  1PM4 A;  5EPA A;  3I49 A;  2FD8 A;  1RXG A;  1K5J A;  2C24 A;  5K8S A;  1UOJ A;  3OY8 B;  3ZMO A;  1C28 A;  5D2A A;  3VDD C;  2Q1M A;  4RHV 2;  1W2N A;  2JG9 A;  5FYS A;  2JG8 C;  3GCX A;  2WQZ C;  3VBU A;  4DXT A;  4EQV A;  2BNN A;  2RS1 1;  3V64 A;  1H6X A;  1W6M B;  4XBN A;  4YW1 A;  2YUE A;  5EYX A;  4NHX A;  4DQA A;  4LBN A;  4Q0S A;  4W4Z A;  4JKL A;  5DAW A;  1POV 0;  1WGP A;  1D4M 2;  3J7M A;  3LPG A;  5FZ3 A;  3D4K A;  3TN9 1;  4BIF A;  4V2W A;  3IPV B;  3K51 A;  1BXH A;  2X5I B;  1VBD 2;  2JIG A;  4AFM A;  1UY4 A;  4KWL A;  5GAL A;  4BJ0 A;  2XHN A;  3OEA A;  1K45 A;  2QQV A;  1WD4 A;  5JUV A;  4L9B A;  3RMY A;  5D8A C;  4XC9 A;  5I91 A;  3VD5 A;  1VBB 2;  1BK1 A;  3RZZ A;  1PO1 2;  4QDR A;  4QQ2 A;  5FXZ A;  1NCR A;  1H9W A;  2J1A A;  3THT A;  3OGR A;  3CKH A;  5FPX A;  3Q8F A;  2K0G A;  2A6V A;  2WNV A;  2NZ9 A;  3M3E A;  5BNO C;  1V6K A;  3WT3 A;  1BVP 1;  3WDU A;  3ZXE A;  4GIQ A;  4A3X A;  4I3G A;  4CDU A;  1F5F A;  1UNB A;  1ZRC A;  1URX A;  3KV4 A;  5EJ1 B;  3KSC A;  3POE A;  5DG2 A;  4JAA A;  4DEQ A;  3BPZ A;  3PUI A;  3T30 A;  2I45 A;  4BQ5 A;  1WCU A;  1CD3 G;  1GOG A;  1VAL A;  3M3Q A;  4FOV A;  4CEW B;  4Q4Y 1;  1Y7B A;  3ZYH A;  4LOS A;  1WBL A;  3OBA A;  5CG8 A;  1UIJ A;  2WA4 A;  1ZM1 A;  3OPW A;  3N9L A;  3WY6 A;  2P1B A;  4BPZ A;  2N7G A;  3AXE A;  3LCP A;  4XAC A;  5JOZ A;  1YFY A;  2RS1 3;  2Q8C A;  4K1Y A;  3VBS B;  3ZXJ A;  5L73 A;  5J3U A;  3VV1 A;  3ZYI B;  1TEI A;  3I2O A;  4XQW A;  1OH4 A;  2QQJ A;  3JBG 3;  3NJV A;  4P9Y A;  4PDW A;  3OUH A;  3X29 B;  1UZV A;  3ZSM A;  2E7Q A;  3OCP A;  3QD6 A;  3OUJ A;  1OA3 A;  2WII B;  5BV6 A;  3RJR A;  4XZU G;  3K4D A;  1TNF A;  1YQ5 A;  2ZML A;  4IGO A;  3DEC A;  4QPG A;  5FUP A;  5FY5 A;  1WW7 A;  3CJX A;  3NJX A;  4XFI A;  4KG8 A;  2C9K A;  2WNO A;  1A8M A;  1W0P A;  3J7N A;  2CV6 A;  1GR3 A;  3PIG A;  4K21 A;  1ZYB A;  3ABZ A;  2VZP A;  5H9R A;  1OI6 A;  2AEN A;  3VBR C;  5LRS A;  5L9B A;  1SEF A;  2ZZQ A;  3FC0 A;  3M1H A;  2Q8D A;  3HBK A;  3E6B A;  1OBN A;  5FIX A;  3USS A;  2YXS A;  1W0O A;  5A33 A;  1IQA A;  2GAL A;  4QPI B;  2R7E B;  1AX1 A;  1Y3T A;  2XL7 A;  1VB4 A;  3ALQ A;  4MV2 A;  4A6O A;  4V2V A;  2NPI A;  2CDO A;  2YBP A;  4UWD A;  5JMO A;  4IEZ A;  1U5Y A;  1I9R A;  2EIE A;  5KHK A;  2Y34 A;  1KDM A;  5FRE A;  3WDT A;  4OHW A;  2WYF A;  4XJA A;  5FJK A;  4R9D A;  2RS3 1;  5C3S A;  1W6P A;  4QPY A;  1AR6 1;  3H3U A;  5FXW A;  5LY2 A;  3HWJ A;  5FP7 A;  1GOF A;  4YYO A;  1RUJ 2;  1WA6 X;  2ZGL A;  4KWJ A;  5A70 A;  1DLL A;  3AFG A;  4Q27 A;  4D7S A;  1H6Y A;  4B7K A;  4CSW A;  1XOY A;  1V00 A;  2K9Z A;  2VUD A;  1CZS A;  2XUM A;  2XQR A;  2NN8 A;  4Y1Y A;  2F17 A;  5CKM A;  4EWE A;  2P6H A;  2VBP A;  2P3K A;  4KWU A;  4QXB A;  5I8T A;  3ELN A;  3BAL A;  1R64 A;  3WX5 A;  5FYV A;  5GZE A;  4BQ4 A;  1NE4 A;  3SCF A;  1LJ7 A;  4PIX A;  1SBD A;  5DUW A;  3TEY A;  5A7N A;  3ACF A;  2OX0 A;  1HRV 1;  4K7J A;  2QQN A;  1UZW A;  1WBF A;  2VJX A;  3PVE A;  4NE9 A;  4O7X A;  4OUS A;  5IHR A;  2XJV A;  1AL2 3;  5JOW A;  3LOI A;  1G9A A;  1MQT B;  3DXT A;  4HG6 B;  4XEZ A;  1KRI A;  3UGH A;  1R08 1;  1YIF A;  3WUD A;  2DVF A;  4FOQ A;  2VL4 A;  1DQ1 A;  5BNN C;  2R0F A;  3ZYF A;  4JGZ B;  2W2I A;  4NIG A;  1W03 A;  1G86 A;  4RFT 0;  1LNS A;  4NID A;  1G9F A;  1JMU B;  4RS5 A;  4R8H A;  3HQX A;  5T50 A;  4WM7 C;  1GNY A;  1SPP B;  4Z8B A;  1Q5O A;  1RMU 1;  5A3M A;  4FPC A;  2P3I A;  4QDS A;  2FZ1 A;  1GZW A;  2GMM A;  3GZT B;  1WCD J;  4NWW A;  5FOJ B;  1RL3 A;  2RS3 3;  2B7Y A;  3QAC A;  2Y6H A;  3Q8B A;  3WP6 A;  2P34 A;  2HEY F;  1QNW A;  3VBF C;  1AYN 1;  2Q4S A;  3J9S A;  1IG3 A;  2VBB A;  4I0W B;  1X9T A;  3SMH A;  1GAN A;  1BHG A;  4B29 A;  4F7Z A;  3MZH A;  2PTM A;  1HXS 1;  3GJA A;  3JBG 2;  1XNT A;  5DDJ 1;  1HB1 A;  3KD4 A;  5BNP A;  5KHG A;  4Y20 B;  4BQ2 A;  1PMJ X;  1US3 A;  2KD7 A;  2W1U A;  4D94 A;  1H1I A;  5FZH A;  4YG3 A;  4ZXE A;  3ZX7 A;  5G04 L;  1AXK A;  1XE7 A;  2VD7 A;  1RIN A;  4YGB A;  3W9A A;  4EE2 A;  4QX2 A;  1H2N A;  5JOX A;  3NO8 A;  2DCT A;  3O0W A;  2WFF 1;  1DGL A;  1OVP A;  1HRV 3;  3WNM A;  3Q8C A;  1HJF A;  4MXW B;  4XAB A;  1OXC A;  1COV 1;  4UF0 A;  3FHQ A;  3UKT A;  5FKB A;  4PCR A;  1R08 3;  1MPX A;  1RHI 1;  1LHN A;  4CYD A;  1QJX 2;  4HPK A;  2FMY A;  2PLV 3;  1ZZB A;  2F6B A;  4LHN A;  2WAO A;  2BPA 2;  3J8F 2;  2ZHM A;  2GC3 A;  4K40 A;  2DYC A;  1DDL A;  5C8W A;  2JG9 C;  2VOK A;  4CEY A;  2BFU S;  1GWK A;  1D4V B;  1RMU 3;  1Q56 A;  3I97 A;  3AZW A;  3CZU A;  3VBU C;  1STM A;  5D1I A;  5A7W B;  5GZF A;  4XJZ A;  1QU0 A;  1RUC 1;  4IE6 A;  4LMF A;  1IS5 A;  2WO7 A;  5FZK A;  1NQJ A;  2PAK A;  4YZ3 A;  3I2I A;  3FLT A;  5JPN B;  1AYN 3;  4GUL A;  5CNA A;  4Y4Y A;  2VZU A;  1SFN A;  4Q0P A;  2VZ1 A;  4ONU A;  2J1R A;  3G7D A;  1HXS 3;  1G9D A;  1PHM A;  2CNA A;  3EYP A;  5DDJ 3;  2HWC 1;  2Y33 A;  3ZFF C;  2PQQ A;  3HAG A;  4D6R A;  4XCA A;  3U1X A;  4A7Z A;  1SDW A;  4C90 A;  1LEC A;  3BI3 A;  1OA4 A;  3OG2 A;  4IEP A;  2XXZ A;  3RGB A;  1UY2 A;  3IM0 A;  5I0S A;  2WN2 A;  4YG0 A;  3M4F A;  3BOP A;  1SCS A;  1NCR C;  2Y6L A;  3HNY M;  2HYK A;  4OZX A;  4KI5 M;  3WNN A;  2WFF 3;  5IK8 A;  4MYE A;  1AL2 2;  2WNV C;  5KWR A;  1W6Q B;  4IXL A;  3RZJ A;  2VMD A;  2D6M A;  5IVV A;  1VAV A;  4Q26 A;  5E8A A;  3K3N A;  1CAU B;  3IPV A;  4FSJ A;  1RVF 1;  2GSY A;  1N1Y A;  1ULP A;  1O4Z A;  3RZL A;  3MIF A;  1RHI 3;  3ZN6 B;  1WCS A;  1UF2 C;  3LAG A;  5DUV A;  3UJO A;  1CIY A;  1DGW X;  2P2K A;  1ALY A;  3ZIX A;  5FBJ A;  1LEN A;  3K75 B;  2X29 A;  2VEC A;  2R06 2;  1MS5 A;  4A7Y A;  2DBI A;  4GWN A;  2DCJ A;  1PO2 1;  5GJ6 A;  5CG9 A;  4CPB A;  1AR7 2;  5FP3 A;  4XQD A;  1POV 1;  1C4R A;  4ARX A;  3ZSL A;  1W28 A;  4GJY A;  4UXA A;  4D0Q A;  2VUA A;  4NVP A;  2VUL A;  3LZZ A;  1CON A;  4QU1 A;  4CDQ B;  3UNP A;  1AJO A;  4I0B A;  5ACA 1;  4BH9 A;  1AVB A;  3JXS A;  3HPN A;  3U37 A;  3HT1 A;  2WNE A;  1IQD C;  3RPQ A;  3CQO A;  5KR7 A;  5SV5 A;  1N3Q A;  2NM1 A;  2B5H A;  3IMM A;  4LBK A;  4AVA A;  1BCX A;  1AXY A;  5LZ6 A;  4LBJ A;  3U0Z A;  2PHU A;  2A7A A;  2VZO A;  2ZS6 B;  1NXD 1;  4HBN A;  1SHW B;  2DDU A;  2RJ2 A;  3OUI A;  4XHX A;  3OGV A;  2PFW A;  1ZA7 A;  3P5B A;  4QPG C;  3WIN E;  4DXZ A;  1WMX A;  4ASK A;  1ONA A;  2XDV A;  5C8C A;  4Y1X A;  1HRV 2;  4HFS A;  4IV1 A;  3WW2 A;  3C3V A;  5JMC A;  2O14 A;  5EXO A;  2YFU A;  4GB3 1;  3CLP A;  3VBS A;  4BQ3 A;  2DFB A;  3GAL A;  3Q8A A;  4NR1 A;  1BEV 1;  4WVM A;  3KCY A;  1HN0 A;  4AI9 A;  1MS4 A;  3IWZ A;  1GZT A;  3FBM A;  4PBO A;  3URF A;  5IFP A;  1ZZ9 A;  2ZXQ A;  1QQP 2;  3MUZ 1;  4XFC A;  1JZ4 A;  1Q43 A;  1JZ6 A;  1W8Z A;  1W8H A;  4IV3 A;  4FTE A;  2MEV 3;  2PLV 2;  5JDB A;  2MHF A;  5KXD A;  4QMA A;  1ZZC A;  3HNM A;  4LIT A;  2C26 A;  4Q4X 2;  5FYI A;  3N9N A;  2OW4 A;  1DZQ A;  4YPJ A;  4DXR A;  2NMN A;  3LFI A;  1UY0 A;  2R32 A;  3AKR A;  1RMU 2;  2XGX A;  1UIK A;  1TQ5 A;  2VVF A;  4FP3 A;  1DP0 A;  4LTA A;  4HET A;  1POV 3;  1SLC A;  2YC2 A;  3UGF A;  4S2G A;  1YQ2 A;  4IQP A;  2LUW A;  4AEJ A;  4AI3 A;  1XE8 A;  2W95 A;  1AYN 2;  4M4R A;  2VMF A;  3BGA A;  5ACA 3;  3MW3 A;  1E57 A;  1X82 A;  2ZX0 A;  4QXC A;  2ZAA A;  1HXS 2;  1MS1 A;  1YWK A;  1SG3 A;  2OVU A;  2V73 A;  4BK4 A;  2C4X A;  4QB1 A;  4AVS A;  2ZX3 A;  1Z0H A;  4Q1R A;  5FY8 A;  1HB2 A;  4Q4V 2;  2JDP A;  3T08 A;  4I3P A;  3LQC A;  2WFF 2;  3O12 A;  4YM1 A;  1Z78 A;  1XSR A;  3THC A;  4GQ7 A;  1MZF A;  4Y3O A;  4GB3 3;  3SQO A;  1O91 A;  1RUF 2;  2FDJ A;  3NV4 A;  2QQO A;  3HOB A;  5FZ6 A;  5ABJ C;  1CVN A;  4KL1 A;  2IUW A;  5LA2 A;  3I3E A;  3VKN A;  4YGD A;  3RMX A;  1YLL A;  4TWT A;  1V6N A;  4NII A;  1RIR A;  3RYP A;  3WG3 A;  1TZO A;  1KS5 A;  5EQU A;  1OSG A;  1RUN A;  4GAL A;  4YM2 A;  5FZG A;  2YV8 A;  5FZE A;  4RS5 C;  4RGK A;  1LB2 A;  5FZI A;  4FPK A;  1UKG A;  1TMF 3;  4AF9 A;  1HRI 1;  2QFE A;  2WS9 3;  5F39 A;  5F3C A;  1VBC 3;  2VTX J;  4P5Y A;  1CQ9 A;  1C8N A;  1Y9G A;  4URT A;  5I0T A;  1OUX A;  3AMN A;  1OT5 A;  2UU8 A;  4OYU A;  2V4A A;  3PU8 A;  5C4W B;  5C9A B;  1O3Q A;  3VBO B;  3OGJ A;  1B09 A;  2ZX4 A;  3I3Q A;  1BMV 1;  3UET A;  2GN7 A;  4UW3 A;  1WKY A;  2ZOE B;  3DCQ A;  1W8N A;  1UYY A;  3OYW B;  4YW2 A;  3GGL A;  5A3W A;  3PVB B;  1NY7 2;  1SZB A;  2UY9 A;  5A6X A;  4ZHN A;  3ZXA C;  3POY A;  5BNP C;  3H8X A;  2PHW A;  4P02 B;  1XXN A;  1VBA 1;  4QKB A;  2H0V A;  4QQL A;  1SPP A;  4LUL A;  3MHZ A;  1DFQ A;  4FXK B;  1QXR A;  2I2S A;  3PU3 A;  2OQ7 A;  4GH4 B;  3VZL A;  1JOP A;  3NJY A;  4C8D A;  5HPO A;  3GM8 A;  4HAN A;  1XBF A;  4TLG A;  1LRH A;  4X6Q B;  2JD9 A;  4XFF A;  4XMA A;  4FAH A;  1K5M B;  4AG4 A;  4MVT A;  3WZ1 A;  2HWD 2;  4A3Z A;  1QY4 A;  2UYB A;  2VUC A;  3BVC A;  3CJI B;  1PMI A;  1ZBE 3;  2XH6 A;  2XVG A;  1BJQ A;  3ES4 A;  3PVN A;  5LB6 A;  2LRO A;  3TNP B;  3RYR A;  2Z4F A;  5F3G A;  1ZA4 A;  3MFC A;  1ZNP A;  3ZLI A;  3RWK X;  1VMH A;  3D3A A;  4HN1 A;  2MEV 2;  2P5B A;  3LA7 A;  4YM3 A;  5D8A A;  1XRU A;  4Y4R A;  4XTM A;  1NZC A;  1UOF A;  1NOV A;  1RUH 3;  1BYH A;  3O1U A;  1T6G C;  2Z5W A;  4JTN A;  2QDR A;  3AYE A;  1REF A;  1RJ7 A;  1VAK A;  4QB6 A;  3H7J A;  1HRI 3;  1ZRE A;  1OVS A;  1BBT 3;  4CEY C;  1G7Y A;  3PTY A;  4LOR A;  1SLT A;  4MXW A;  1LHO A;  4GMP 1;  2UWB A;  5A6Z A;  5C33 A;  2OS2 A;  4PIZ A;  3O1T A;  2PHR A;  3KB5 A;  4FFG A;  4TXW A;  1LAJ A;  3T0D A;  4XAE A;  2XHK A;  4JCK A;  3AC0 A;  2XJP A;  2R1B A;  4COZ A;  3O14 A;  4H7M A;  3BTZ A;  1HKD A;  2P17 A;  4RHV 1;  4QX0 A;  2D6O X;  3IAP A;  5F32 A;  1XSQ A;  1VBA 3;  2GME A;  4BWO A;  2VZ3 A;  4YW3 A;  1PNF A;  3N9P A;  4LR4 A;  2DCZ A;  2XG3 A;  3DKW A;  3S6P A;  2Z69 A;  1D4M 1;  2WA3 A;  5I0R A;  3PME A;  3C8X A;  3TBD A;  3FBY A;  2Y8K A;  4P5H A;  3U75 A;  4CCJ A;  3BOD A;  2PMW B;  1VBD 1;  3FJS A;  1H1M A;  2A6Z A;  3VHP A;  1HQW A;  1NA1 B;  4EZ4 A;  4BQ1 A;  5B4N A;  1ND3 B;  1S0D A;  1YI9 A;  4LNV A;  1BKZ A;  5J09 A;  2HWF 3;  1F8V A;  2GAU A;  3CMG A;  1POQ A;  3H50 A;  1XQN A;  2ZKN A;  4OUM A;  3O1P A;  3MGU A;  1VBB 1;  2XOM A;  1PO1 1;  1O7F A;  4B4Q A;  1TMF 2;  3RJ2 X;  1SQ4 A;  2WS9 2;  1JZ3 A;  3LF7 A;  1VBC 2;  3RYK A;  3KGZ A;  5AVA A;  4LT5 A;  4MHU A;  3R4S A;  1Q8V A;  1REE A;  2VMI A;  2VTF A;  3ZXL A;  2YDE A;  3ILR A;  2ZAC A;  5A7P A;  3F2Z A;  1UW8 A;  4FPJ A;  1O4T A;  3E1F 1;  5LK5 A;  3AP9 A;  1LGN A;  5A3P A;  4HSL A;  3AZV A;  4L8Q A;  2J1E A;  1PGL 2;  2E53 A;  4ZPI A;  4FFH A;  1HV1 A;  1D2S A;  1GQH A;  4FQ4 A;  4LBQ A;  4AEM A;  1C57 A;  4E4S A;  1A6C A;  4ZU7 A;  1FNY A;  1PMH X;  4YNI A;  4AW7 A;  3WDW A;  3J7L A;  3ZXF A;  3FN9 A;  4RHV 3;  2PYT A;  2V72 A;  3ZFE B;  4O9E A;  4JDN A;  4P08 A;  3ENR A;  5A7S A;  4PF5 A;  2BUK A;  1XB9 A;  5C8C C;  5FYT A;  3IB3 A;  2C6S A;  3O1R A;  3TN9 3;  4IV1 C;  2FDK A;  4CDQ A;  1OFN A;  1PZ8 A;  1W9F A;  2IZW A;  1ZBE 2;  3VBS C;  4L2N A;  1SLL A;  3WCR A;  1K12 A;  4ES9 A;  2YC4 A;  1S1A A;  4PLM A;  1H1A A;  4B3N A;  2J1T A;  1VBD 3;  4Y1U A;  4RA0 A;  5CFC B;  1GQP A;  3KT4 A;  3NW4 A;  2FDI A;  4Y1V A;  4RR3 B;  3E6D A;  3AVS A;  2W68 A;  2RS5 2;  5JSR A;  5LBC A;  4EN7 B;  1S0B A;  5EJ3 A;  3III A;  1RUH 2;  1PO1 3;  2WO3 A;  3AP7 A;  3ZYG A;  5FZD A;  5I93 A;  5JOY A;  1QJY 2;  1RUI 2;  3R4U A;  1E5H A;  5FFO C;  4LIU A;  1UYX A;  3KVB A;  3NMB A;  1NLS A;  3AJZ A;  4PQ9 A;  1BBT 2;  4LA3 A;  4A4A A;  4BYY A;  4IEV A;  1PK6 A;  4W6W A;  1CZT A;  4RQP A;  3I59 B;  1JYX A;  4IE0 A;  2WN3 A;  5FY0 A;  5DMY A;  2JJ6 A;  1LU1 A;  5HV0 A;  2OQ6 A;  4WVZ A;  2C9A A;  1CJP A;  3B5L B;  2WT0 A;  3HEI A;  4CCK A;  4GJZ A;  2R07 3;  1GP4 A;  2VG9 A;  5F1R A;  2FBE A;  2A3X A;  4RD7 A;  3JQW A;  2RMU 2;  1YQ8 A;  2DVD A;  2X8K A;  5JWP A;  3TRS B;  4JQT A;  2Y38 A;  2FDH A;  4MLO A;  2YPJ A;  1HW5 A;  3P1I A;  4L92 A;  4YSF A;  1RUJ 1;  2YU1 A;  4ZXK A;  2ZGO A;  4RGA A;  3N7K A;  4LEJ A;  5EV7 A;  4EWD A;  2D3R A;  2D97 A;  5LW9 A;  5FRA A;  5FYB A;  3FMG A;  2XLA A;  2Q1F A;  3AZY A;  4OVE A;  5FZL A;  2NP0 A;  2XL9 A;  2ZBJ A;  3PUS A;  4K20 A;  5CBL A;  2IXK A;  4ERO A;  1LR5 A;  3PUQ A;  4QHB A;  1W8U A;  2ARC A;  2HBT A;  2HWF 2;  2QKD A;  3OBR A;  4Y5Z 0;  1YQC A;  4M3C B;  1JU4 A;  3BN6 A;  5FZM A;  1W6O B;  1CZV A;  2VW1 A;  4AK3 A;  4XVH A;  2IVJ A;  4XTP A;  2VOV A;  5F5I A;  4ZY9 A;  3KQR A;  1FI2 A;  4G9S B;  2YU2 A;  4AI2 A;  2IXI A;  5C3P A;  5HV4 A;  5LY1 A;  3AZZ A;  3AP4 A;  4NHK A;  1WLW A;  4BIO A;  2ZX1 A;  3OBT A;  4P9J A;  2LRP A;  1DQ0 A;  1ZRD A;  5IWF A;  1MEC 1;  4CDW B;  4N9I A;  4C0H A;  4FP2 A;  4OHX A;  5FYZ A;  4D6Q A;  2ZHK A;  1PX4 A;  3BU7 A;  1QOO A;  5K4L A;  4LBO A;  1OH3 A;  1DGR A;  4PBP A;  3N35 A;  2DTW A;  1V6I A;  3MF9 A;  3BOW A;  3H8O A;  5JXG A;  3BUC A;  1DBN A;  4ZS2 A;  4UFK A;  3KGL A;  4BLJ A;  4ITC A;  4C0B A;  4MXV A;  3LSD A;  1GV9 A;  2VO5 A;  4CCD A;  1H2K A;  1SAC A;  4Q4W 3;  3U4S A;  3UKV A;  4B1M A;  4OI4 A;  1EUU A;  3U11 A;  2E7A A;  2A1X A;  3LSE A;  4S2H A;  4A2U A;  4NHY A;  2ZTN A;  2XJR A;  3CBN A;  4HKO A;  3SEE A;  1XPW A;  1RUJ 3;  5IVF A;  1DQ4 A;  4QKN A;  5JVV A;  1NKG A;  1W05 A;  3EXU A;  1I5P A;  3IDC B;  4GWI A;  3JBG 1;  4WVV A;  4YGC A;  5J7M A;  1D2Q A;  1T6B X;  4UFM A;  2NMO A;  5IK4 A;  4D3W A;  5IVC A;  2D5H A;  3POF A;  3T1L A;  3SEP A;  5FZF A;  1CWP A;  3ZFF A;  2VVE A;  4Z1V A;  3WNO A;  2RJK A;  2VQA A;  1NLQ A;  2LTN A;  5F3E A;  3TOJ A;  3ZVX A;  3IIA A;  5JPM B;  2EIB A;  3S5A A;  1RUO A;  2BJS A;  3H3Z A;  2Q1Z B;  1HJG A;  1XND A;  1FV3 A;  1S2B A;  2PHT A;  3A4U A;  4XXP A;  1GU3 A;  3U78 A;  4A6S A;  5I8Y A;  1W3X A;  5LA9 A;  1WZX A;  3H8U A;  3DPR B;  4L97 A;  4AI1 A;  4MH0 E;  2JEC A;  1JUI A;  2BGO A;  3M70 A;  4XPV A;  1QJX 1;  4R9A A;  3POI A;  1VRB A;  5FP9 A;  1AUY A;  1MEC 3;  3T09 A;  3DF0 A;  1BLZ A;  2P3Y A;  3KS7 A;  4ISQ A;  1EYB A;  1UZZ A;  3MLK A;  2GNT A;  2AEZ A;  4R9B A;  1WW5 A;  3CDZ B;  5C70 A;  2P4E A;  2WWS A;  2FCT A;  3J8F 1;  4E4D X;  2R07 2;  1MVE A;  2CAV A;  5CZK A;  1MR5 A;  3G6J B;  3NQH A;  4XXA A;  2W1S A;  1OPM A;  2XJT A;  2GH8 A;  3ZYJ B;  1JZ7 A;  2EAL A;  2GNM A;  5JSP A;  3AL5 A;  4Y22 B;  2AEY A;  1JHJ A;  3OEB A;  4HVQ A;  1H8T B;  2GH2 A;  1DIW A;  3FFQ A;  3GBF A;  2ZMK A;  1AXZ A;  5CFD B;  4S2D A;  3WQB A;  5J37 A;  1X36 A;  2GU9 A;  1UOB A;  1LEM A;  1LOB A;  2YPD A;  3PVO A;  3KM5 A;  1ODM A;  1PVX A;  5GM0 A;  2B46 X;  2CL2 A;  2VQU A;  1J83 A;  1JZ2 A;  3GJB A;  4CP1 A;  3L9J T;  4GAZ A;  3ZFG A;  1IZ3 A;  1S0J A;  3OGS A;  2HWB 1;  1ENR A;  4WZF A;  3MV0 1;  4YFZ A;  3EMR A;  5A3T A;  3WNX A;  4H14 A;  2D6K A;  2JIC A;  2GP3 A;  2ATF A;  2W94 A;  4HK9 A;  5J96 B;  2RHP A;  1AL2 1;  4JHT A;  2XON A;  1PX3 A;  3DN7 A;  1N3P A;  4W6X A;  4UT5 A;  5FWJ A;  5LWB A;  2B45 X;  4TSV A;  3MPB A;  4XYX A;  4QX5 A;  3AMH A;  3VBH A;  4M00 A;  3UL2 A;  5A1L A;  4NRM A;  3ZKY A;  1NA1 A;  5IJR A;  4F3J A;  1YIP A;  1ND3 A;  1QJX 3;  4AED B;  2ZGM A;  3A23 A;  2H6B A;  3THD A;  3C7F A;  1AF9 A;  4K8R B;  4ARY A;  1H0B A;  2VXR A;  4L99 A;  4DIQ A;  2R06 1;  1P8J A;  1GLH A;  2IFR A;  1G9B A;  2VBD A;  3J8F 3;  3LIH A;  5FUN A;  1LTE A;  2Y64 A;  1AR7 1;  1TME 3;  4J25 A;  4Q4W 2;  1Y4W A;  4XDP A;  4GA9 A;  1LUL A;  5CYY A;  1WMF A;  5F37 A;  1M4W A;  5LAS A;  5K0U B;  1CAX B;  1FPN 3;  1JH5 A;  2A3W A;  2ZGN A;  3IMN A;  1TVG A;  4IE4 A;  1MAC A;  4YVW B;  2W0X A;  1G8W A;  4CDQ C;  2O0O A;  2QE3 A;  1B35 A;  3A21 A;  3ZR6 A;  1SLA A;  3RWN A;  4LIV A;  1RUE 3;  2AZ5 A;  2Y0O A;  3EQE A;  1LHU A;  4DUW A;  3PNA A;  5LA1 A;  1OQE A;  4N53 B;  4SLI A;  4QGM A;  3D8C A;  3KZ4 C;  2UUR A;  3B93 A;  4LK7 A;  2BER A;  3BKZ A;  2HWB 3;  1V9U 3;  2E9Q A;  2PEL A;  4ISR A;  5H9P A;  5KXB A;  2KA3 A;  4LXL A;  5DAP A;  4Q0Q A;  1L3J A;  5FZ9 A;  4JKK A;  2JDK A;  1RUG 2;  1F2N A;  2DCK A;  5L7O A;  1OLM A;  1AYM 3;  2WRA A;  2PQS A;  3NV1 A;  2XWJ B;  4BXS V;  3OD4 A;  2CGP A;  3WF2 A;  2ARB A;  1PK6 C;  3B9C A;  3TAY A;  4RQP C;  5LRR A;  1QQP 1;  5DG1 A;  5ABJ A;  4CXY A;  4BK5 A;  4YVS B;  1MEC 2;  3EBR A;  4NN0 A;  3WXP A;  3I2K A;  4NJ4 A;  4I01 A;  2PLV 1;  4RR3 A;  4AFD A;  4O65 A;  1CN1 A;  5FO7 B;  2WO2 A;  4Q4X 1;  1UMH A;  2YZ4 A;  1RJ8 A;  1S2K A;  1K42 A;  2DUP A;  2NQY A;  2R06 3;  4FI9 A;  4W8J A;  1HN1 A;  3ASI A;  4MGQ A;  5DAB A;  1WA4 A;  2G1M A;  1AR6 2;  4Y33 A;  1AR7 3;  1BQP A;  1VIW B;  4KGQ A;  4NUB A;  4RGG A;  4CU6 A;  4JGY A;  1OHF A;  1FMD 2;  2WO1 A;  4IEW A;  4CP9 B;  4UYB A;  3B7M A;  2A71 A;  4FPL A;  1XYN A;  1ENQ A;  1X8M A;  4QM8 A;  4JVA A;  3M3I A;  4FAG A;  3LKJ A;  5LEJ A;  2Q0A A;  2VQT A;  1APN A;  1O4Y A;  2VZT A;  2WKK A;  3VDD B;  4Z2W A;  4Y5T A;  3JU9 A;  4Q4V 1;  1C5I A;  2JG8 B;  5HCH A;  4CUB A;  3OPT A;  2E6V A;  5FMO L;  1QMJ A;  3H1M A;  5FPA A;  4PF1 A;  5HCA A;  1L7L A;  3DGT A;  3RFR A;  5C3O A;  5C6C A;  5E88 A;  1QJU 3;  5AFE A;  4FTB A;  3HQU A;  4BA6 A;  1RUF 1;  2HEW F;  5IVY A;  3NKT A;  2YY1 A;  2YGL A;  2ZGK A;  3R05 A;  5DAV A;  3LGR A;  2ADE A;  2ILM A;  3B94 A;  2ET1 A;  1QQP 3;  3H7Y A;  4HOO A;  1V6M A;  4NHL A;  4YZ1 A;  4LHS A;  5IYY A;  4M3C A;  5BYN A;  1GMM A;  4QB2 A;  4FTS A;  4DRR A;  2EAK A;  5T52 A;  5FMC A;  4Q4X 3;  4J1X A;  5HBA A;  4C1W A;  4BB3 A;  1TME 2;  3KV9 A;  5ISL A;  5AC9 2;  3V0A B;  4LKE A;  5IFT A;  5BNO B;  1W8F A;  2QTW B;  1ENS A;  1FPN 2;  4X8N A;  1FXZ A;  3T1M A;  4OI0 A;  1JBC A;  3VBO C;  3H42 B;  1NY7 1;  1ZBA 2;  3AP6 A;  3CF6 E;  1XNA A;  1VE0 A;  2WLQ A;  3I2H A;  1NQD A;  1RUE 2;  3LEG A;  1U12 A;  3IDA A;  4AHZ A;  4LUK A;  3FHA A;  1UN1 A;  3IKW A;  5AVP A;  1ULC A;  3OY8 A;  3ZYP A;  3SH4 A;  1I3H A;  3CO2 A;  3F95 A;  3NAP B;  3QBQ A;  4QPW A;  2BW8 A;  1XE0 A;  1N1S A;  1RTV A;  3VDA A;  2PA7 A;  3AL6 A;  3VLB B;  1CR7 A;  4Q4V 3;  2HWB 2;  1V9U 2;  4IE5 A;  5GLW A;  4CZS A;  2HWD 1;  4CTE A;  1LOA A;  4CCM A;  1UYP A;  5FY1 A;  1W6M A;  1AYM 2;  1ZRI A;  1OLQ A;  3SIT A;  2BYV E;  3WDX A;  1SLI A;  3GZE A;  1J3R A;  5DAQ A;  1VR3 A;  3ZXK A;  1RUF 3;  4ORF A;  1J1L A;  1TG7 A;  3BB6 A;  3OSD A;  3MBW A;  2X5I A;  4YWA A;  2JKB A;  1WLD A;  4CVU A;  5C5T A;  1DF0 A;  2MEV 1;  2VVD A;  2PHX A;  1CAV B;  1AR8 2;  3IBM A;  5DUX A;  4IUG A;  2B9V A;  4FT8 A;  4FPH A;  4CCO A;  3WDV A;  4E2S A;  3W5N A;  3QCW A;  5SV8 A;  1OFS A;  3T2Q A;  5FZB A;  3E5X A;  2WZ8 A;  3OD0 A;  4XHB A;  3Q8E A;  2R16 A;  1AJK A;  1J1T A;  4M0H A;  3K2O A;  4M4P A;  3VBR B;  1ZZ6 A;  4BZ4 A;  3VB9 A;  1NG0 A;  2D6L X;  1CPN A;  4FPE A;  2EIC A;  3PTR B;  5J48 A;  1PNG A;  1QEX A;  4BOW A;  2FHR A;  3WF1 A;  3HD8 B;  2XB6 C;  1ULD A;  2EAA A;  1W8O A;  1U5I A;  4XMI A;  5E16 A;  1IKQ A;  3T2O A;  4B4P A;  4BM8 A;  2ETE A;  5HXM A;  2AC1 A;  2PXJ A;  1ULE A;  3FZ3 A;  5BY5 A;  2RVA A;  2VMC A;  1DCS A;  2VZS A;  4HSJ A;  1VP6 A;  1H2M A;  4CEW A;  4N43 B;  3MIH A;  4BQX A;  5LCW L;  4Y22 A;  3OGG A;  4OZO A;  2VCM A;  3ZDS A;  2AGS A;  4QDQ A;  4IGP A;  2W92 A;  5H9Q A;  2HWD 3;  5DZG A;  3ZFG C;  5C3Q A;  4EWA A;  1QJU 2;  3C7G A;  4ZON A;  2GZW A;  3JB8 A;  4HKL A;  1KXG A;  5CFD A;  2WNU B;  5F9T A;  2RDN A;  2CYF A;  3MIB A;  3MUY 1;  1IOA A;  1QWR A;  2A6X A;  5LK7 B;  1DGR N;  2Z2S B;  3VBH C;  3WD5 A;  3I7D A;  1PGS A;  5FO8 B;  2JDA A;  2JE8 A;  4PT6 A;  1NA1 C;  5A32 B;  4W6Y A;  3ZSJ A;  4DZG A;  1ND3 C;  3M7A A;  5HXV A;  5L36 A;  4J6G A;  1YFW A;  1A78 A;  1TMF 1;  3OF1 A;  2WS9 1;  1VBC 1;  4LPL A;  5HCB A;  3T2P A;  4BQW A;  4TTG A;  5FLH A;  2D5F A;  2GP5 A;  3N9M A;  2QZ2 A;  2W9X A;  4JX0 A;  1R09 2;  2WLP A;  3O7O A;  3ZKU A;  1EY2 A;  4DIN B;  5IT6 A;  5BNN B;  3EHK A;  2G19 A;  3D5O A;  1PGL 1;  2WSV A;  1UZ0 A;  1YC6 1;  1B35 C;  2WZR 1;  2DUR A;  4K9S A;  2FZ2 A;  3VZK A;  4AED A;  4QPI A;  4PI2 A;  4IGQ A;  3THP A;  1GSL A;  1UY3 A;  3WVJ A;  4CE8 A;  4E8D A;  1QJE A;  4WM7 B;  3ZOI A;  1QOT A;  2KM2 A;  4MSV A;  3VZM A;  2JDM A;  2PHL A;  4Y24 A;  1LOG A;  1LOC A;  3AB0 A;  5FMD A;  3ZFE C;  1DYK A;  3A22 A;  3WF0 A;  5KHH A;  1QOS A;  2ZX2 A;  3RQ0 A;  4CU9 A;  3S0M A;  4BIS A;  3AKQ A;  3SIS A;  2WIN B;  4AVT A;  1ND2 B;  3VBF B;  3ECQ A;  4MHR A;  1ZBE 1;  5L7O C;  2VQ0 A;  3BYW A;  4MGS A;  3ACL A;  5IW0 A;  1DYP A;  2WZP P;  3VZN A;  3GHM A;  1R1A 2;  2D7F A;  4XIL A;  4XJU A;  4CCC A;  3PUA A;  4HLT A;  4P9G A;  3V0B B;  2RS5 1;  1KS4 A;  4KNC A;  1Q8Q A;  4G3Y C;  5CIR A;  2QDN A;  4RR3 C;  3AJY A;  4FVV A;  1QDC A;  1RUH 1;  2LW8 A;  5FJH A;  5T5J A;  1N3O A;  1EV1 3;  1JYV A;  5JLV A;  4COU A;  1QJY 1;  1RUI 1;  2XQX A;  4CDX B;  3I3D A;  1ULG A;  2HEV F;  1BBT 1;  2YMZ A;  4QU2 A;  5CB7 A;  1FX5 A;  3ME2 A;  5FPZ A;  3AKS A;  4O61 A;  3S5Q A;  4BE3 A;  1OKO A;  2EF6 A;  2X10 A;  4GD4 A;  1S55 A;  5A3L A;  1JUH A;  3ILF A;  3KCX A;  1RXF A;  1HX6 A;  4JGY C;  1MQT A;  2YGM A;  2BBA A;  3WP3 A;  3AZX A;  4YM0 A;  1JU3 A;  1O8S A;  4AZZ A;  4YVS A;  2BOI A;  3GBG A;  4JGZ A;  4AFC A;  2HWE 3;  4DY5 A;  4DY3 A;  2WZR 3;  5JXH A;  1CJD A;  4MGZ E;  4QHO A;  3I54 A;  1N1T A;  2ZCW A;  3WV6 A;  2J1V A;  1XYP A;  2RMU 1;  3I8T A;  1S0E A;  2WR9 A;  3LWC A;  3SH5 A;  3VZJ A;  5C3R A;  3APB A;  2D43 A;  2GDF A;  4MGY E;  3VBU B;  5FZ8 A;  3JZV A;  4UFI A;  1F31 A;  1HB4 A;  4LJH A;  3K3O A;  4HVR A;  2CGN A;  5CA6 A;  3JD7 3;  1U5Z A;  1H30 A;  1RC6 A;  1W2A X;  5B4X A;  4AOC A;  1W90 A;  1SCR A;  1QNY A;  3DL3 A;  3NV2 A;  4H7L A;  2AUY A;  2Q5T A;  2RDR A;  4LO4 B;  2H0B A;  2L9L A;  3WR0 A;  3IT8 A;  1LES A;  2B42 B;  3TEW A;  3K4Z A;  3NNJ A;  1O5U A;  2RR1 3;  1CAW B;  2HWF 1;  1QXP A;  2JEM A;  4J1W A;  5KHJ A;  2J42 A;  2ZEY A;  4Y20 A;  1ASJ 3;  2P37 A;  2G9F A;  1LCL A;  2RS5 3;  4KU7 A;  2W1W A;  3POW A;  4FOY A;  2I74 A;  3MIC A;  4IEX A;  5GLV A;  4AAP A;  3ROU A;  4L11 A;  2BWC A;  1QGL A;  1S0I A;  1RUD 2;  1QJY 3;  1YI7 A;  1RUI 3;  2Y6G A;  3LDR A;  4JV4 A;  3BTX A;  2ZEW A;  3IDB B;  2WNV B;  1D0H A;  3VKL A;  1CGP A;  4PIY A;  1WW6 A;  5JXJ A;  1QXJ A;  1IPK A;  2P6C A;  4CDW C;  5C71 A;  4CDU B;  1OD3 A;  3D82 A;  3W59 A;  3O5S A;  1UU5 A;  1DHK B;  2QNK A;  3B3Q E;  1WMD A;  1UL9 A;  3KCC A;  3ZPY A;  3RI8 A;  2PHF A;  4O9G A;  3TB0 A;  3A0K A;  4A7K A;  3WG2 A;  3S30 A;  2ET7 A;  3C7E A;  4ATF A;  2RMU 3;  3WUC A;  5B2G B;  2XLG A;  4FXG B;  2DFC A;  3AVR A;  4UFH A;  4AAX A;  3NNG A;  2ZHN A;  4AHY A;  3H1Y A;  3H8R A;  3AYC A;  1FAY A;  3UKN A;  3L2H A;  3H9A A;  2BBV A;  5EJZ B;  3RRD A;  4OHZ A;  1OMI A;  3P3N A;  5A7W A;  2WAA A;  1YJK A;  1VPH A;  1JXN A;  2VNO A;  1OOP B;  4UW4 A;  4XFG A;  2Y6F A;  5LBE A;  3UES A;  1V6O A;  4M3C E;  1JZ8 A;  2ORX A;  4PDW B;  5IVE A;  3GHN A;  5FBZ A;  4U36 A;  5ANN A;  2X5I C;  2OZJ A;  1T2X A;  2HBU A;  4OQ8 A;  4XFA A;  1QHD A;  5IAX A;  2RM2 2;  3VKM A;  4YAR A;  1NX9 A;  1EV1 2;  2W52 A;  3CIH A;  3OBZ A;  2ZEZ A;  2OPW A;  4HK8 A;  1UXX X;  3ON7 A;  4C91 A;  5FZ7 A;  1PVC 2;  1WME A;  1OD5 A;  4MET A;  1IPJ A;  3VHN A;  2LS6 A;  1W6Q A;  2D3S A;  3KLS A;  4ET7 A;  2VME A;  5FY7 A;  4WM8 B;  4UBH A;  2G9Z A;  1CAU A;  1L7Q A;  1ZRR A;  5A33 B;  2JB8 A;  2HWE 2;  2HYX A;  4CXX A;  3ZN6 A;  1DZT A;  3WW4 A;  2R07 1;  2WZR 2;  1EPZ A;  3VD9 A;  1CAV A;  1DQ5 A;  1QJF A;  1J3P A;  2HH9 A;  1YHF A;  2FCU A;  3E5U A;  4D6S A;  3O1S A;  4JKM A;  4CCE A;  4JZR A;  2HLE A;  4IW3 A;  2BQP A;  1NLR A;  2W47 A;  1PIV 1;  2VZV A;  2BZD A;  4CEW C;  2JX9 A;  5E6H A;  1W6P B;  4OHY A;  5EFU A;  4AVB A;  4CUC A;  1OQ1 A;  4RFR B;  4CA9 A;  2QQU A;  2QZ3 A;  3Q9O A;  3JD7 2;  3HNB M;  4RSU A;  1FT9 A;  4E27 A;  5CFD C;  3BCW A;  5EP9 A;  4ZZ8 A;  3HMY A;  5C5U A;  3CEW A;  3HN1 A;  4QHZ A;  4R4Z A;  1X50 A;  3LEM A;  2BEO A;  5BUV A;  2RR1 2;  3I2D A;  3HBZ A;  2XBO 3;  4UW6 A;  1VRH 2;  3UT0 A;  1JYN A;  1ASJ 2;  2VOW A;  3R4D B;  1SBF A;  3HQR A;  4X6R B;  5FYU A;  4YW7 A;  2A70 A;  2FDF A;  3OTF A;  5C7G A;  4N43 A;  4L0P A;  1PM7 A;  1OF3 A;  3ACI A;  2FCV A;  2SBA A;  5CVR A;  1OC1 A;  4IND A;  4ZS3 A;  2BGC A;  4AQ2 A;  3B69 A;  2OUJ A;  4FCA A;  2GN3 A;  2O1Q A;  4P9X A;  3ST7 A;  2R04 3;  1US2 A;  1H4G A;  3ZDV A;  3RNS A;  2Q8O A;  3T4V A;  5F7U A;  1DG6 A;  3WQ0 A;  5IK7 A;  3WEZ A;  4AVV A;  4AED C;  4AHW A;  4QPI C;  3I4I A;  2XVL A;  4CCL A;  2RE9 A;  2W1Q A;  1YCI A;  5BXX A;  4LKF A;  4CU7 A;  4Q4W 1;  1EAH 2;  1UX6 A;  1PIV 3;  2DF7 A;  1GZW B;  2JEN A;  2B4K A;  3RZM A;  3NRU A;  2QBX A;  1XNK A;  3U07 A;  2IWG B;  2BVB A;  5GLU A;  1UKR A;  1VMJ A;  1LHV A;  4XFB A;  2ZGR A;  5T3N A;  1DLC A;  3I3B A;  4RL7 A;  5FXX A;  1SFP A;  4HZF A;  5CKN A;  2BGP A;  4NRO A;  1QH6 A;  1W9T A;  4AFA A;  3MLJ A;  5FMB A;  2ORZ A;  3GCW A;  5BNP B;  4DFS A;  5GZC A;  1UD1 A;  5FKC A;  3LE0 A;  3SXW A;  2FDG A;  5DZF A;  4LUM A;  5FPL A;  3R0R A;  4NWV A;  4XZP A;  1IHM A;  1W06 A;  5FZ4 A;  3VDB A;  4ATE A;  1UMZ A;  5FY9 A;  1RUG 1;  5FLI A;  2QQL A;  1J59 A;  2XR4 A;  5F6K A;  3JQX A;  1ND2 A;  5LBB A;  4K6B A;  5KC6 A;  2GC2 A;  4NIH A;  1IKP A;  2VH9 A;  2OA2 A;  2KXL A;  1I6X A;  3NNL A;  2J7M A;  4UF0 B;  1F4H A;  1XU1 A;  3LFM A;  2XML A;  1MQT C;  3PHM A;  3WDY A;  1ULF A;  2A3Y A;  2XLF A;  3VD3 A;  1HQL A;  3ZN4 A;  1Q3E A;  1FV2 A;  2W91 A;  4KBB A;  4EN8 B;  3V0B A;  4YVS C;  3ZMN A;  1W2U A;  1YO8 A;  3PUR A;  4JGZ C;  4K3U A;  4PHZ A;  4HPK B;  5FY4 A;  2QCS B;  3WG4 A;  1C3H A;  3BTY A;  1RGS A;  1DU3 D;  2DWR A;  1V70 A;  2ARA A;  2WYS A;  3OB8 A;  4QAW A;  4YG6 A;  2IXJ A;  3LA2 A;  4CDX A;  1RB8 G;  4OCT A;  2JD4 A;  2VNR A;  1X9P A;  2GC0 A;  4MZU A;  4CEY B;  1FMD 1;  1W2T A;  4YW4 A;  1S0G A;  1IPS A;  3SKV A;  1W9Y A;  1PGW 2;  1XYO A;  1FNZ A;  4XJ8 A;  5C4W A;  5C9A A;  1W3V A;  3VBO A;  3GF6 A;  5FYY A;  4P9I A;  4KG0 A;  4HN0 A;  1QJZ A;  1GP6 A;  3OYW A;  3ES1 A;  3AM2 A;  3PL0 A;  2LAL A;  2XBO 2;  3ZPO A;  3ATG A;  3HIF A;  5EZW A;  3AK0 A;  4CUA A;  2VZR A;  4DNY A;  1OPO A;  5I8S A;  2G4I A;  1W9W A;  4R4X A;  1NYW A;  4XQ4 A;  3AYD A;  4FPF A;  4LKD A;  4GH4 A;  1HQN A;  4K8F A;  1JOB A;  2JWP A;  2QQK A;  4UFJ A;  3GNE A;  2WQ8 A;  3HJR A;  5JR2 A;  4QXH A;  1K5M A;  4FPG A;  4BME A;  1RUG 3;  2BOJ A;  2VOX A;  1MS9 A;  2BFU L;  4E8C A;  5JCT A;  5FTT C;  2R04 2;  4Z2A A;  3CJI A;  3WF3 A;  1S0F A;  1VBE 3;  3D6E A;  1O3R A;  1CAW A;  5GLT A;  4N7I A;  2ZGT A;  3CU7 A;  3B02 A;  3N9O A;  3WHT A;  5FOB B;  2C5D A;  4A45 A;  2RJL A;  3AMM A;  4BLI A;  3T4H B;  4E2Q A;  3N3H A;  4R52 A;  1TME 1;  4COW A;  3DEM A;  5AC9 1;  1Q8O A;  3JB4 C;  2BP6 A;  2R49 A;  1Z7S 2;  5EHD A;  4TLF A;  3N4M A;  1PIV 2;  1V0A A;  1PZ9 A;  3W5M A;  1FPN 1;  3LDB A;  4KWK A;  2E32 A;  2BTV C;  2OPK A;  4WBB A;  4UOJ A;  5A1F A;  2WT1 A;  4Q8L A;  1FMD 3;  4XFH A;  4KGG A;  4BXF A;  1FOD 2;  1ZBA 1;  2Q30 A;  4FQZ A;  4DO0 A;  2VTX A;  1RUE 1;  4LLO A;  4XF4 A;  4H55 A;  4MGT A;  4FFF A;  3W20 A;  2VU9 A;  4GZ9 A;  5FK8 A;  3VKO A;  1I1E A;  4PI0 A;  1MZ6 A;  1XU2 A;  2SLI A;  2VOT A;  3L2Y A;  1W8T A;  2QJV A;  3K4A A;  4QGL A;  2K46 A;  1D7P M;  1W6N B;  1AX0 A;  1V9U 1;  2CDP A;  3NAP C;  5L9R A;  3FLR A;  1V6J A;  3PLQ A;  1UOG A;  5KC5 A;  2F4L A;  5FPB A;  4OUL A;  2WSU A;  4AR2 A;  2PHD A;  5C8C B;  1AYM 1;  2EXH A;  2V5Y A;  3GXU A;  3KT1 A;  4IV1 B;  1IGO A;  2OII A;  4AHX A;  4EYU A;  1OOP A;  2D3P A;  1CES A;  4WVM B;  2BWA A;  1EPW A;  5JXI A;  3O0V A;  2OXB A;  5F5A A;  2FMD A;  1UPI A;  1UX7 A;  1ZVF A;  3DYO A;  2VGD A;  4LKS A;  3P3P A;  4URA A;  1AR8 1;  2DVG A;  3M3C A;  5FP4 A;  3MI8 A;  4LO5 B;  2OT7 A;  2WDB A;  4XE9 A;  1IS3 A;  2WL1 A;  3K48 A;  4IV3 B;  1YXW A;  3ACG A;  4S2F A;  3KVA A;  1VB2 A;  1C8M 2;  1NZI A;  4JRA A;  5ANQ A;  2MNG A;  5JZG B;  2AR6 A;  3MV1 1;  4CUG A;  2QQP A;  5FLJ A;  4KQ7 A;  1GZ9 A;  5AC9 3;  3LOB A;  4CU8 A;  4HON A;  3PJQ A;  4NPL A;  2C0Z A;  1MVQ A;  4NO4 A;  3VD7 A;  3M8L A;  4QM9 A;  2EVX A;  4XF1 A;  1GNZ A;  3ORJ A;  1O3T A;  4WM8 A;  1VJ2 A;  1ZBA 3;  5A3U A;  4WVW A;  1L7R A;  1NCQ B;  2EXI A;  4Z07 A; 
#chains in the Genus database with same CATH homology
 5FZD A;  2VD7 A;  5FYH A;  3K2O A;  1VRB A;  4LIU A;  3KVB A;  4QWN A;  5E6H A;  5FP9 A;  2P5B A;  5FYY A;  4AI9 A;  5F2S A;  5FZA A;  4Y4R A;  3PTR B;  3KV6 A;  4IGO A;  5FY5 A;  4Y33 A;  5FUP A;  4NUB A;  5FY0 A;  3ZPO A;  5IVB A;  4UF0 A;  5FZ0 A;  2PXJ A;  2OQ6 A;  3LD8 A;  5FZ8 A;  5FPU A;  4LIT A;  5FYI A;  3AL5 A;  3N9N A;  2OS2 A;  4CCK A;  5A7Q A;  3K3O A;  4GJZ A;  4QXH A;  5A80 A;  2Q8D A;  5FYU A;  5FZ1 A;  4IGP A;  5FZO B;  5F3I A;  2YPD A;  2YU1 A;  3OPT A;  4V2V A;  2YBP A;  5F32 A;  5LW9 A;  5FZO A;  5FPA A;  5FP8 A;  5FYB A;  5A7W B;  5FYM A;  3N9O A;  4GAZ A;  4CCN A;  5FZL A;  4QXC A;  4AAP A;  3N9P A;  3PUS A;  3KV5 A;  5FZK A;  4E4H A;  3UYJ A;  5FJK A;  5A3T A;  4XDO A;  2GP3 A;  5FXW A;  3PUQ A;  5IVY A;  5LY2 A;  5FY8 A;  5FPV A;  5FP7 A;  4CCJ A;  3PDQ A;  5FYS A;  5FZM A;  4CCL A;  4HOO A;  4CSW A;  5FWJ A;  3LDB A;  5LWB A;  4D6R A;  4EZ4 A;  5F5I A;  5A1F A;  2GP5 A;  3N9M A;  4BXF A;  2XXZ A;  5A7O A;  2YU2 A;  5A1L A;  5LY1 A;  4Y3O A;  4DO0 A;  4QXB A;  5FZ6 A;  5FYV A;  5FWE A;  3KV9 A;  5ISL A;  2YBK A;  5FZ3 A;  5IWF A;  4V2W A;  4DIQ A;  3AVR A;  5FYZ A;  5A7N A;  4BU2 A;  4D6Q A;  5FXX A;  2OX0 A;  4IGQ A;  4TN7 A;  5IVJ A;  5IVV A;  5FZG A;  5FUN A;  5FZE A;  5FZC A;  3K3N A;  5K4L A;  5FZI A;  5A7P A;  5A7W A;  4XDP A;  5F39 A;  5F37 A;  5FPB A;  5F3C A;  5A3P A;  5F2W A;  3DXT A;  4QX8 A;  5FV3 A;  5FXZ A;  5FPL A;  5FBJ A;  3DXU A;  3U4S A;  5FZ4 A;  4BIS A;  5IVE A;  2W2I A;  4EYU A;  2WWJ A;  3PU8 A;  5F5C A;  5FY9 A;  4LIV A;  5A3N A;  3AL6 A;  5F5A A;  5IVF A;  5A3W A;  5FP3 A;  2XUE A;  5IW0 A;  4URA A;  4CCM A;  4GJY A;  2OT7 A;  5FY1 A;  4QU1 A;  3KV4 A;  5FZB A;  3PUA A;  5A7S A;  4EZH A;  4UF0 B;  2XML A;  3KVA A;  5CEH A;  5FYT A;  5ANQ A;  5FZ7 A;  5FZ9 A;  5IVC A;  4C8D A;  3PU3 A;  2OQ7 A;  5FJH A;  4LXL A;  5FZF A;  3NJY A;  3PUR A;  5KR7 A;  4CUG A;  3N9Q A;  5FYC A;  4HON A;  5FY4 A;  5F3E A;  5FY7 A;  2Q8E A;  5FP4 A;  5FXV A;  3OPW A;  3N9L A;  4GD4 A;  3AVS A;  3RVH A;  3U78 A;  4CCO A;  2WWU A;  4ASK A;  2Q8C A;  2XDV A;  2YBS A;  4D6S A;  5F3G A;  5FZH A;  4QX7 A;  3ZLI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...