4BISA

Jmjd2a complexed with 8-hydroxyquinoline-4-carboxylic acid
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
348
structure length
348
Chain Sequence
b'LNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LYSINE-SPECIFIC DEMETHYLASE 4A
publication title 5-Carboxy-8-hydroxyquinoline is a Broad Spectrum 2-Oxoglutarate Oxygenase Inhibitor which Causes Iron Translocation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 103
structure length 348
sequence length 348
chains with identical sequence B
ec nomenclature ec 1.14.11.-:
pdb deposition date 2013-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 4bisA01
5FPLA 5FYVA 4AI9A 5FXVA 5FUNA 4IGQA 5FZ1A 2OQ7A 2VD7A 5IWFA 3PUSA 4LITA 5F5AA 3PU8A 5FPBA 3N9OA 3UYJA 5IVVA 3PU3A 4DO0A 5IVJA 2P5BA 3DXUA 2YU2A 5A1FA 4AAPA 3N9QA 5FP4A 2PXJA 5FYIA 4BU2A 4QX8A 4CCNA 3OPWA 5A3WA 4IGPA 2OS2A 5A7PA 4GJZA 2YBSA 4CCJA 3N9LA 3ZPOA 5FZEA 3ZLIA 3KV9A 5A1LA 5FZCA 5FPUA 5LY2A 5LWBA 2YBPA 5FZIA 3KV6A 5FY4A 5FXWA 5A7OA 5FY0A 5A3TA 3N9PA 4D6SA 5IW0A 4QXBA 5A7NA 3AVSA 5F5CA 5ISLA 2WWJA 5FZHA 5F3EA 4C8DA 2OT7A 3DXTA 4BXFA 5FZMA 4CCLA 5FZ4A 2Q8EA 5FZ3A 5IVFA 5FZOB 3LDBA 3AVRA 5FWEA 5LY1A 2OX0A 3KVAA 3U78A 2W2IA 5FZAA 3K3NA 5LW9A 4Y33A 4QU1A 5FZ7A 5E6HA 4QXHA 5FBJA 4V2WA 4EZ4A 4DIQA 5A3PA 4CCOA 4QX7A 3PDQA 4UF0B 5FYYA 4ASKA 5FJHA 2XXZA 4HOOA 2YU1A 5FYHA 5FY5A 4LXLA 4LIVA 5A7WB 5F39A 5IVEA 5F2WA 2WWUA 5FYTA 5FY1A 5FV3A 2YBKA 3U4SA 4E4HA 5A80A 5FUPA 4QWNA 5FZ0A 4NUBA 4QXCA 5FWJA 2GP3A 5FP9A 5KR7A 5F32A 4EZHA 3KV5A 5FZDA 5F3IA 3LD8A 3KV4A 5FZLA 2Q8DA 2XMLA 5K4LA 5FZOA 4CCKA 5FYSA 5F37A 5ANQA 4Y3OA 5IVBA 4GJYA 3OPTA 5FPAA 5A7QA 4CCMA 3PUQA 4CUGA 5FZ8A 3KVBA 5FYMA 4CSWA 5F2SA 5F3GA 5FZ6A 5FYZA 5A7SA 4UF0A 5FJKA 4IGOA 3N9MA 5FP8A 3NJYA 5FXZA 4BISA 5A7WA 4D6RA 5FZ9A 5FZGA 4GAZA 4XDPA 5FZFA 5FXXA 5A3NA 4TN7A 4HONA 5FY8A 5FYUA 2Q8CA 5FP3A 5CEHA 4GD4A 5FYCA 5F3CA 3K2OA 1VRBA 3K3OA 2OQ6A 3AL6A 5FY9A 5IVCA 4URAA 2GP5A 3RVHA 4V2VA 3PURA 3AL5A 2YPDA 3PTRB 4D6QA 5FP7A 4XDOA 2XUEA 3PUAA 4LIUA 5FPVA 5FZKA 5IVYA 4Y4RA 5FZBA 4EYUA 5F5IA 5FY7A 2XDVA 5FYBA 3N9NA
chains in the Genus database with same CATH superfamily
4Q4X1 4WVMB 3IT8A 1P8JA 2CGOA 4XJZA 2WYFA 1UPIA 2BGPA 1PK6C 4LITA 3VHRA 4RHV1 1VBE1 2O14A 2R49A 2R6QA 1ZRCA 2UWAA 3C2UA 3PHMA 1ZZ8A 3PU3A 2VG9A 2VZSA 1JU4A 3VKMA 1F15A 4LORA 4IEQA 1XQNA 1IPJA 4WM7C 2WNVB 2WT1A 3MIHA 3ZDSA 1IS6A 3CZUA 4XJ9A 1Z7S2 2YROA 2OPWA 1OOPB 3VZJA 3RZKA 1Q8PA 1ZZCA 2L9LA 3AKSA 4NIAA 1GZCA 1H0BA 2WNOA 5JAXA 4MVTA 4Y20B 3ZDVA 5FPUA 5JR7B 4M4PA 4XF3A 3W5NA 1ZRDA 3V0AB 4WZFA 1F5FA 2HBUA 3TEZA 4Q4W1 1V70A 3OOXA 2W5FA 1NAEA 2ZGPA 4JKLA 5C9AB 4BLJA 3AVSA 3Q9OA 4FTSA 3DN7A 3N3HA 1NKGA 3AB0A 4C8DA 1YEWA 2QQIA 3NAPC 5AFBA 2DCKA 5DQ0A 4AQ6A 3PNAA 3O1TA 3MPBA 4XUTA 1SLTA 1SEFA 3WNOA 1NG0A 1QOTA 1S55A 3WDVA 2JD4A 3RGBA 4FQZA 4GMP3 1DU3D 1VBD1 4HN1A 2XWJB 2Y6HA 2ZGNA 4QU1A 5FO7B 4V2WA 1JOJA 4CDXB 1VAMA 2ZHKA 2VE1A 3WUDA 4BK4A 3OD0A 3GDBA 2WL1A 3TBDA 4GH4C 4B29A 5L7OB 1XE8A 5FYHA 2W9XA 4HANA 3UK9A 4BZ4A 2R072 5FYTA 2XJPA 1RUI3 4ONUA 1DIWA 2P2KA 3AKQA 1BCXA 4QXCA 4ORFA 4R9BA 1R1A1 4YVSC 1VALA 3NJXA 4MSVA 5F3IA 2Q8DA 4YGDA 2E7QA 2DVBA 4UFMA 4N53B 3ETQA 2OUHA 1IPSA 2IZWA 1W6NB 1UZYA 3AKRA 3CU7A 3W5MA 5HV4A 2PLV3 2JDYA 4NHKA 4X6RB 1V6IA 1A3KA 4BQ2A 4LT5A 1BZWA 4RS5B 3VKOA 3HAGA 4Q29A 3Q8BA 2CGPA 4FOQA 4Q8LA 1JYWA 4RA0A 1OMIA 4TXWA 5A3UA 1W2AX 2EXKA 3FN9A 3OGJA 1U5IA 2RS11 3NWKA 4BYYA 5FY8A 1OXCA 2D3RA 2R041 4LKEA 1VPHA 3H7JA 3RDIA 1CAUA 3HEIA 1WA6X 3PIGA 1YUDA 3NJVA 5DG2A 4XFAA 1MZFA 3PTRB 5H9RA 3USUA 1UOBA 4JZRA 4AQ2A 1V6NA 4K6BA 1OKQA 5CADA 4QPGC 4A44A 3WUCA 2XDVA 3RZHA 2ZA9A 1S0FA 1SLBA 5FQ0A 3ACLA 5T5OA 2FQPA 1PHMA 1MZ5A 3H1MA 3VBOB 2RR13 3RI8A 2BEOA 3JB8A 1K5JA 4JX0A 1K5MB 4MV2A 4YW7A 3KT4A 1O5LA 1SDWA 1CN1A 1H8VA 3R0RA 4YZ2A 4UI9L 1DYPA 4FPEA 3OBTA 2Y33A 4OHWA 5FP4A 4GKYA 5FYIA 2HWE3 5T5LA 5A3WA 1TMF2 3OBZA 2VBDA 5A7PA 3NNMA 3BIEA 3WP5A 1J59A 1LOGA 3HN1A 4C90A 2H6BA 4BWOA 1QDCA 4YFWA 5FO8B 3ZSEA 2ZHNA 4B1MA 1HN1A 2I2SA 4K7JA 1QOSA 1QJEA 2GH2A 4BMBA 1J3PA 1WW4A 3FHQA 4B4RA 2VMGA 1UMHA 4XFFA 2B39A 2X09A 3AX4A 1S2EA 1HX6A 3GBFA 3WNMA 2VW1A 4GKXA 5C4WA 4OQ9A 2P1BA 4YW5A 2C4XA 4XIOA 4MHRA 4I02A 3LDBA 4B7KA 5I91A 5L19A 3KVAA 4FTEA 2W2IA 5FZ7A 1CJPA 1VBB1 2GNDA 1OVSA 3BIWE 2WC2A 4KG0A 2FZ2A 1Q3EA 1SG3A 4NR1A 1NT0A 2CV6A 2BWAA 4UBGA 5GZCA 1QXRA 2VGDA 2UU8A 3JD73 5ABJC 1H4HA 1YQ2A 1O4YA 4ZXKA 4HMZA 1DQ6A 1RHI1 1YIPA 1C1FA 2K2SA 2R063 2EIBA 5A6QA 3N36A 3KLSA 3ATGA 4NPMA 3I7DA 3B94A 1OF4A 3HVDA 1B35C 4L97A 3POSA 2ATFA 4K3UA 1ST8A 2WFPA 3ZFGC 1F4HA 2CSGA 2DTYA 5FZLA 1XNKA 4ZY9A 1NQJA 4AI1A 3POGA 2RDQA 4FFHA 4CDQB 1GZWB 3NKGA 1PM7A 1AR93 3L9JT 3PIJA 1QF3A 2JE9A 1PX4A 1LJ7A 2B4KA 1BYHA 3Q8AA 1CX1A 1AL23 4Q4Y1 4JV4A 2RR12 1D0GA 2BV4A 2W1SA 1SPPA 3KM5A 1UAIA 5GLUA 2B9UA 5FYZA 1C8M1 4UF0A 3BPZA 1VB2A 3N9MA 2HWC3 4KG8A 3K4AA 3KZ4C 3LB9A 4Z82A 1ZRIA 4UAPA 1O3QA 4DNYA 3MHZA 3HPNA 1CGPA 4NO4A 4AF9A 1AJOA 2HWE2 1CJDA 3ECQA 2QFEA 1GICA 1ZM1A 2QJVA 3JB4C 4V2VA 2DURA 3ZXKA 3AL5A 2RM21 3USUB 3WDYA 4CEYC 2BTVC 2ES3A 2JIJA 3K4DA 4RGAA 3WDWA 1RUJ3 4XMIA 4KU8A 3NRUA 4B1LA 3S30A 5JZGB 1JZ8A 2TUNA 1XYOA 5FYVA 2WKKA 3LOBA 1RUE1 3H42B 2WUHA 2VD7A 2VQTA 1H1AA 1MQTB 3WD5A 3ZIWA 5KXBA 1E5HA 4EQVA 2YXSA 5C6CA 5CA6A 1NZCA 1W8NA 3N9OA 1IKPA 1H30A 4M0HA 3DEMA 3CDZB 3GBGA 4DO0A 2OYZA 2D40A 3KF3A 4JHTA 3VD3A 1LOCA 1JODA 1L7QA 1QGLA 4PDWC 4RR3C 4YM2A 3JU9A 4B7EA 4BOWA 3K75B 5K8SA 5BPXA 3WV6A 3N9QA 3O1VA 1J83A 1BBT1 2WR9A 1VBC3 1W90A 1UZVA 1RUF3 3JD72 5F1RA 5I8SA 3QLQA 4HZFA 4A41A 1U0AA 3CJXA 5A3LA 1ODMA 2QQPA 1Y43B 3KV9A 4N43B 4YGEA 2Q1FA 2MEV3 1FOD1 1RL3A 4LEJA 5FZIA 4CU8A 4Z1VA 3WF4A 1J1TA 3N9PA 4GXLA 5KXDA 2IXHA 4LKDA 3ILFA 1FMD2 4FPKA 4BMEA 2FMYA 5DAPA 1EY2A 1ZZ7A 2BNOA 2ENRA 1CAXA 5J98B 4X6QB 2Q0AA 2VVEA 3U75A 4QPIA 2QCSB 3CQOA 3HMYA 3U07A 4OI2A 3BALA 1AL22 1REFA 1UWWA 3NL1A 1JS9A 1DFQA 2H0BA 4GWIA 4OUEA 3U78A 2AUYA 4DZGA 2G9GA 1EPWA 1D2SA 2VTFA 2WT2A 3INAA 5A3PA 3LSEA 2XJRA 3ASIA 3OJBA 2IC1A 2HWB1 2QQMA 3OGVA 4JGZC 3UJQA 3WLUA 4BCUA 3THPA 4LBKA 2OUJA 4HOOA 5T5JA 4GB31 1NLRA 3WF2A 4QHZA 5JLVA 1I5ZA 1H6YA 4U2AA 2BBAA 3CL1A 4QQ2A 5FRAA 2B8MA 1CVNA 4XXAA 2XB6C 4DUVA 2YPJA 5DZGA 3WG1A 2R16A 3H50A 1TME1 2BVVA 3AMMA 4ES9A 1O8SA 1UPSA 1G7YA 5DUWA 1SQ4A 5T3NA 3LD8A 2XMLA 2YUEA 1UY0A 1NCRC 1XXNA 1RUJ2 4IEZA 3W59A 1I6XA 3AFGA 3I8TA 3ON7A 4JKKA 1EUTA 1GP4A 4CCKA 4K21A 1YWKA 2ZKLA 1UXZA 1VRH1 1W6MA 1YLLA 5SV5A 3B00A 3HQXA 4CSWA 3O1MA 3HQUA 4IESA 3LAGA 2KM2A 1ASJ3 1LHNA 1OSGA 2Y8KA 4QDSA 2JDMA 2ZGOA 1DP0A 4IGOA 2GC0A 4D6RA 1LRHA 5FZ9A 1RINA 3KT7A 4FOVA 4UW3A 2VZUA 1JBCA 4XQDA 5FZFA 2YB7A 1O7FA 2Q8CA 1QOOA 1US2A 2BRTA 3BCWA 2HJIA 2C9KA 4W6YA 3ZXGA 4EV0A 1VBC2 3OGSA 1K42A 5HXMA 3B9CA 1PO13 1RUF2 2VM9A 1X8MA 1PVC3 2FDKA 4W8JA 1CZSA 1F4AA 1SBFA 1CAWA 2WSUA 4CDXC 5BNPC 4GA9A 1DG6A 1HQNA 1OH4A 2DU1A 2QQVA 2XUEA 4DUXA 1GNZA 3IAQA 2MEV2 2ZEXA 4R8HA 2HWD3 1H2LA 2ZTNA 3GF6A 2A70A 4CDUA 5L7OC 2BWCA 3BU7A 4BLIA 3G6JB 1GV9A 2XQXA 5FUNA 2A5ZA 1OF3A 1PNFA 3O14A 4P9YA 5FMBA 1IS3A 4HG6B 4BIFA 3T2QA 1YO8A 3UESA 1S0GA 5JXGA 4CPBA 3PU8A 1JMUB 4HVRA 5T52A 3S5AA 3AP4A 1X50A 1MS3A 3HBZA 4S2HA 4XJ8A 3QACA 4CXWA 1BMV2 1SCSA 2AH2A 3JCIA 3U0ZA 2C6SA 3N7MA 1FPN3 2R0HA 1QHDA 3N4MA 1AYN3 1DGLA 4LBOA 4Y5Z0 1HW5A 3RYPA 4HETA 3EQEA 2YY1A 4KWJA 3ACIA 1UYZA 2AEYA 4RS5C 5JXIA 1GR3A 1K3IA 1ND3A 1MZEA 2A6VA 3B02A 4NPLA 3ZMOA 4A6OA 4CEWA 1ENXA 4MXWA 3ES1A 3J8F1 1Q8VA 5A1LA 1XE7A 1V6JA 3PMEA 5BNQA 2J22A 1MEC3 1NX9A 3OUIA 1Y9QA 3W58A 5LWBA 2JKXA 3KD4A 1S0CA 2JIGA 4E4ZA 2QVSB 3AZZA 2OA2A 5F5CA 3ZFEA 1WCKA 3I3QA 3MIBA 3RZGA 3SH5A 3BYWA 1DHKB 1UOFA 4P9JA 4Q4V3 3IIIA 4QPIB 3UKTA 2XBO3 2FDHA 4O9EA 4QX1A 1A8DA 4LNVA 4WVZA 2JB8A 1L3JA 1DDLA 3K46A 4OHYA 3O7OA 3CZJA 4M3CA 4AEMA 1B35A 1VBB2 1VAVA 4JKMA 2ZXQA 2ZGRA 4PT6A 4ZONA 5K0UA 4EJRA 5E6HA 1GUIA 3I3DA 3RWKX 4F83A 1Z7S1 3R05A 3ABZA 3LPFA 1MPXA 4CP0A 5JXHA 3DF0A 3VBOC 3EYPA 3PDQA 2W68A 3HT2A 1ZNPA 1J3QA 5FCCA 4QD2A 4PJYA 2D6OX 2YBKA 3MV11 3LEGA 4LO8A 4Q2FA 3N7KA 1PO12 5FZ0A 1PVC2 2WFF3 3H3ZA 4JVAA 4LTAA 2O1QA 2NN8A 1GMMA 5AC93 1UKRA 3O0VA 1W8FA 5FZDA 1KJRA 5LBBA 2A75A 2WS92 4ZU4A 2WZR3 2BGOA 3NKTA 1LECA 1EP0A 2VUJA 4CYDA 2E32A 2W1QA 3BPSA 4FXGB 4IEOA 5A3OA 1LOAA 1W6MB 3GZTB 4AHZA 1HB1A 3RZZA 4COYA 4GJYA 3AZWA 2OXBA 4AEDA 4CUGA 4JQTA 1R083 3H8UA 3UKNA 3ZO0B 4LUMA 3J9SA 1MS9A 4RQPA 4ZU7A 4HN0A 1IG0A 1WLTA 5FZGA 2BP6A 2W08A 1FPN2 2Y0IA 2Y26A 3ZFFA 1AYN2 3BN6A 2R071 2VMEA 4FI9A 2JB4A 1B09A 2RM22 2Y6JA 2E26A 1CAWB 5FMCA 3K51A 3TNQA 1M06G 3GYDA 4QQHA 1W6QA 1C57A 4DQAA 3KT1A 1SBDA 4R9AA 3S57A 4BJ0A 4CDUB 2X53S 1MEC2 5FBZA 4KNCA 1GZ9A 1R093 3C7EA 5JWPA 3HBKA 4ITCA 3VHPA 1N1VA 1G9FA 2HYXA 4KMQA 1PGL2 1EUUA 4LBNA 4O9GA 2XVKA 5IWFA 4ATEA 1DLLA 4Q4V2 5JMOA 1UU4A 2XBO2 2BOIA 4LBLA 4YZ1A 2PQQA 5FLIA 3IBMA 1W3XA 2P5BA 3UGHA 4LA2A 2PHTA 1XU2A 4B4PA 2N7GA 5ACA3 3WW2A 2BJSA 3RI9A 3T2PA 4KU7A 2DUPA 4WM8A 4K20A 3SMHA 1XSQA 3ZYIB 4E8DA 4GZ9A 3H0OA 1O59A 3PLQA 4RFT0 1ND3B 2D5HA 2WQ8A 2Q1ZB 3GHNA 3UNPA 2GNTA 4QKBA 2W1UA 3C7GA 5FZEA 1AR63 4PIYA 2NP0A 4P00B 1AVBA 1QIQA 3CIHA 1GKBA 2VZVA 4QM9A 5FXWA 4Z92B 1LKNA 1VBA3 5AC92 4WVMA 3VBRB 4LPLA 3ACFA 3M2MA 1DZQA 5IK4A 3VBHB 4AFDA 5G05L 3VDBA 1I1EA 1HV0A 2QE3A 3FJSA 2GSYA 2RMU3 3IIAA 2WZR2 2XH6A 4UOJA 4A4AA 1VJ2A 2G4IA 4LQRA 5I8YA 3M3CA 2BGCA 4CP1A 2K0GA 1W8TA 5JVVA 2BU9A 5K0UB 1JYTA 5CFCA 4GMP1 5DUUA 2WAAA 4EN8B 3FE5A 2JWPA 2WNVA 4RSUA 2WNUB 4LBMA 2PAMA 4CDWB 1HB2A 1WBFA 4DIQA 1R082 2D6PA 2VPVA 5LA0A 1TMF1 1C8NA 1OOPA 5LCWL 1U5YA 2WA3A 2WO1A 3X29B 3KQ4B 4LIVA 4MOAA 1W06A 1PGSA 1RUI1 4Y20A 3WY6A 5FV3A 1PMHX 4UWDA 4URTA 1UOJA 3D4KA 3GZUC 3V0AA 1ZBA3 2ET7A 3NV2A 5C9AA 2F6BA 5DMYA 3WEZA 5LK7B 2BZDA 3KV5A 1QXPA 5H9SA 3HIFA 3OB8A 1WLCA 2A6YA 3MW3A 2WJSA 1HB4A 3PJYA 5DABA 1SMVA 1D0HA 4YW3A 1RTVA 4HSJA 5CISA 2QQJA 2TEPA 4TLGA 3IMNA 5EIYB 2VECA 3VN4A 3A22A 3IDCB 3KSCA 2D93A 3AMHA 4AVVA 2XGXA 1J1LA 4M3CE 3WR0A 2PHUA 5JUVA 5FJKA 2XKOA 1N1YA 2VCMA 1AR83 1XC6A 1HXS2 4UT5A 1DCSA 1TE1B 2Q5TA 4XF1A 5ACA2 3HNMA 2AEZA 5FYCA 2OQ6A 5FY9A 1Q5OA 5T54A 2D98A 2X29A 3HT1A 5C3OA 3HD8B 5HBAA 5GKAC 4UFLA 5CFDA 4AYUA 1BKZA 2PTMA 4Y5TA 4N53A 3VBSB 2XVLA 2WO7A 1QJY3 2QTWB 2BBVA 3FHAA 2QUOA 2W3JA 4A7KA 3AXDA 3E97A 4R4ZA 4YWAA 2RR11 2GMEA 3WXPA 2OQ7A 3AP9A 3AXEA 4OHXA 3L2YA 3E5XA 1HIXA 3A7QA 3MIGA 4M00A 4HXCA 5E8AA 2ADEA 1OFNA 1Y9GA 1ZZ9A 3VBFB 2Y64A 3ME2A 2UYAA 4DRRA 3MUY1 4WBBA 1BXHA 4HK8A 3H9AA 2HWE1 1OFSA 1EYBA 4CZSA 1NE4A 4CCNA 5IK5A 5KHKA 2DF7A 2OS2A 1ZA4A 3SLIA 4NMIA 1SZBA 5FK7A 2FCTA 4D94A 4YW6A 4ZXEA 2WT0A 4DFSA 3PVEA 4LO6B 5DUXA 3ZKUA 1RYYA 1ZBA2 4NWVA 4WVWA 5C70A 1UYPA 1LB2A 1V00A 1PNGA 5A6ZA 4TZDA 1AXZA 3VBOA 1XOYA 1HRV3 5T50A 4DPNA 3AJYA 2MNGA 1YC61 4EWAA 5A33B 2OT7A 4C0BA 1K5MA 4IEVA 4QM8A 1LTEA 4NROA 2Y6GA 2ARXA 5FZMA 4CCLA 1ENSA 1REDA 1VMJA 5CFCB 5IVFA 3E6DA 5ERLA 4ASMB 1OUXA 1YQ5A 2JG9B 4H2AA 4JC1A 1TG7A 4P02B 5D2AA 5FIXA 2ETEA 2ZACA 4QB6A 1GQPA 3OY8A 3MGUA 4QXHA 1ZA7A 1WBLA 1G9AA 2WAOA 3JD71 3CNAA 4QX7A 3CLPA 2XXZA 3KMHA 3SEPA 5DPNA 4XTMA 4XW3A 1JZ2A 2IFWA 3P6BA 5A80A 2HLEA 1GNYA 2HEWF 1Q8QA 2PA7A 3PVNA 2FDGA 1SLIA 2A3WA 5FP9A 2P6HA 4DEVA 1COV3 1RMU3 4NRQA 4FQ4A 1FMD1 5BNNA 4PI2A 3N35A 2VULA 4IV1B 1IHMA 1W8ZA 4XBQA 1QJY2 2VXRA 1C3HA 3CHXA 2JG8B 2W39A 3QCWA 5EJZB 5ANQA 4AEKA 4HSLA 1AL21 4K8FA 4XACA 3E6CC 1NLSA 1Y7BA 2YC0A 3JBG2 4CCMA 2VR4A 1NA1A 4JTOA 1APNA 4F3JA 1EV13 2HWC1 3P5BA 5J09A 1QJU3 1UD1A 2PN5A 4DY5A 4P5HA 2ZX2A 2F17A 4GAZA 1W8UA 2A71A 4QPIC 1VE0A 4HFSA 1Q43A 4OZOA 4TN7A 4YGBA 5FYUA 3BKZA 3WSOA 1PIV3 3GZAA 4AI8A 1L7LA 5CNAA 1SFYA 4URAA 3WF3A 1WW6A 2DBIA 5CFDB 3AM2A 1XE0A 1D4M2 2HKXA 3LDKA 5FP7A 5IVYA 4A7ZA 1GZWA 4CDQA 5B2GB 1RUJ1 3POIA 1W99A 2VC9A 3T1MA 4ASLA 3I2FA 3AYEA 1H2MA 2GN7A 4E4SA 2LTNA 5FPLA 2ZGLA 2UYBA 3FLTA 5FZ1A 3O1OA 5H9QA 1DQ1A 1X82A 3UKVA 1KFUL 1GWKA 1ULFA 2WZEA 4CRQA 4COWA 1REEA 4N9HA 4OQ8A 3VKLA 4YW4A 3P3NA 2X10A 4ZKTB 2ZZQA 5JSPA 4IE4A 2EXIA 2BUKA 3PVOA 1OT5A 3Q8FA 2NZ9A 1CAVA 3ACHA 4LO4B 4XFBA 1UXXX 3W20A 4AAPA 1E5SA 1VBC1 4AGVA 2P3IA 1A34A 1Y3TA 1S0JA 1RUF1 4QX8A 4ATFA 3WNLA 3OPWA 4IGPA 3K48A 4BPZA 5IK8A 2OW4A 1YNAA 4MX3A 2C26A 4OFGA 2RS53 5EWSA 3ZPOA 4J6GA 5C3QA 2PHFA 2VY0A 5KXCA 2FD8A 1KITA 1SLLA 1BLZA 2MEV1 5A6YA 5CZKA 2E7TA 1WW5A 3LIHA 4PQQA 1MS5A 3SCGA 3BGAA 5JZGA 4GALA 5FY4A 3V0BB 1W6PA 3LWCA 2ZX3A 4XUNA 1BJQA 1RMU2 2X8KA 4XUPA 3VZLA 3VZMA 1AXKA 1MQTA 1QJZA 2BNMA 2ORXA 2CY6A 5F3EA 4TLFA 3WW3A 1JZ6A 5CG9A 3I2KA 2IFRA 3J4UH 5FZ4A 1JYVA 4META 2Q8EA 1TNRA 2A6ZA 1WMFA 2EALA 2G1MA 4PBOA 1A8MA 1BMV1 3AVRA 5FWEA 1V6MA 1ULCA 4DY3A 4CDUC 3T0AA 2QKDA 3OY8B 3LE0A 2RS33 1NZIA 4LO5B 3OBAA 5FBJA 3T2TA 2VMIA 3W9AA 4J1WA 5F6KA 1QJU2 1ENRA 1N1TA 4TWTA 1OHFA 1NCQB 2XUMA 2BPA2 2NM1A 1RUI2 1J84A 4N43A 4KGQA 4GQ7A 4MZUA 4RGGA 4NHLA 3FLRA 1PIV2 2HH9A 5FUPA 1LOEA 1OPOA 2GC2A 2JDZA 2EXJA 1UY1A 2ZKNA 2GP3A 4AVSA 1ZBE3 1RUC3 5BNNB 1Y9MA 3D8CA 3IDBB 4WVVA 3TB0A 2E6VA 3KV4A 4BDVB 4CPBD 3OTFA 2WA4A 2OIIA 3HNYM 1YFYA 2PLV2 4MXVA 4CEWC 1ND3C 5G04L 2AC1A 5F37A 2VAUA 2DTWA 2C5DA 4MO3M 3LEIA 3W21A 3SKVA 1NA1B 1R1ZA 1MACA 1LEMA 2VXJA 5FZ8A 2JKBA 1WLWA 3ZFEC 4I09A 1SBEA 1SCRA 4PLOA 4XETA 4CUCA 4LE3A 3WF1A 5FXZA 1DQ4A 4FPOB 1YFUA 5C8CB 4RHV3 1K12A 1OQDA 1UY4A 3ZSMA 4UXAA 1CR7A 1WUVA 2PAKA 1GNHA 2XKPA 4WZCA 5CG8A 4GD4A 5K0UC 3DV8A 1PO11 4LUKA 1PVC1 3VZNA 4FFGA 2B5HA 4JQRA 3VHOA 1J58A 1UQXA 2RS52 5FOBB 2WS91 2YGLA 1XNTA 2D6NA 4XDOA 4LIUA 4QKFA 1W9SA 4R4XA 1CPMA 3BTYA 3QOPA 2WO3A 1OQ1A 4NPRA 1W8WA 1YQ8A 5FY7A 3I97A 1RUG3 2VCAA 2DV9A 2ZEZA 2HWF3 3THTA 2J7MA 3WHTA 3PUSA 1UYXA 1HKDA 4Q4W3 2XPJA 5JOYA 5FPBA 4A3ZA 5IVVA 1QKQA 1X9PA 1G9DA 1N47A 3FUQA 5HI0A 5HXVA 1BVP1 1FPN1 1CAVB 4QU2A 1AYN1 3ILNA 5DZEA 5BXXA 3RPQA 2RS32 2XJUA 4JRAA 3L2HA 5H9PA 1SACA 2ET1A 4WV8A 3ZR6A 4OLLA 2TBVA 2E7AA 2OKXA 1NUKA 4AEDC 1ZYBA 4BQ4A 4AVAA 2A6XA 5CYYA 4AI3A 3WT3A 4XUOA 1C5IA 4CCJA 4RQPC 1UZZA 4NRMA 2A3XA 5F9TA 1MEC1 1UU5A 1KS5A 1W6PB 1PZ9A 3AZXA 2YBPA 3POFA 1EPZA 1ULEA 2XQRA 5A7OA 4MADA 3R4UA 3ZFFC 1ZBE2 1RUC2 1RJ8A 2CU5A 4BHPA 3KHCA 1S2BA 4Q0PA 1PGL1 2XLGA 5J37A 4AVCA 1RUD3 4F7ZA 3EB7A 4Q4V1 2VBPA 1N3QA 2XBO1 1UKGA 4HPKB 2Y38A 2K46A 3VDDB 2V5YA 1DGRN 3PTYA 3UT0A 5LY1A 1V6KA 1IQAA 1ZZ6A 3VBSC 4HBNA 3KQRA 4ZU5A 1CWPA 2XJTA 5FZAA 1KFXL 1IKQA 1OA2A 3I2IA 4N7IA 4BK5A 4EZ4A 4FTBA 3HR9A 2IXIA 3OG2A 4AW7A 1WLDA 2C0ZA 5C7GA 1GWMA 2DVAA 3H8RA 3AP7A 2R062 4Y4YA 5FJHA 3SH4A 1JYIA 2VVDA 3OF1A 5F39A 1HJGA 5IVEA 4MUVA 1C1LA 5FK8A 2VTXA 4GWMA 2WFF1 1EAH3 3J26N 2GMMA 1POV0 2RS13 5LA2A 5AC91 4XILA 3ZYJB 3GJAA 4MGTA 1RUH3 1JOPA 3QH7A 4WM8C 3THDA 5B4NA 1IZ3A 2WZR1 4YM3A 5L36A 1AR92 3WVJA 5JIAA 3WQ0A 4UW4A 4FPHA 3ZN5A 5EFUA 2ZX4A 2VUAA 1RUG2 3PMSA 5DAXA 1F8VA 4PQ9A 3GXUA 4QKNA 4QPWA 4BA6A 2HWF2 1AR73 2Y6LA 3ZYFA 3JXSA 5FPAA 5A7QA 1IPKA 1CX4A 1QNYA 2GC3A 3IWZA 2HWC2 1R081 2R7EB 1V0AA 1UIKA 3V64A 3D5OA 5IAVA 1YHFA 1ZVFA 2E9QA 4NIIA 1W2UA 5EYYA 4KI5M 2PYTA 3NV3A 1GWLA 5CFCC 1O4ZA 1I3HA 4YNIA 1CIWA 3KHBA 5F3CA 1T6GC 2UWBA 2WNVC 5D21A 1OC1A 1QH7A 1WGPA 2VTXJ 5JPNB 4CXYA 2DCYA 2EICA 1OUSA 3DPRB 1OOPC 3SQOA 1W0PA 4FPFA 4IEPA 5C3RA 3KWVA 2D6KA 2EIEA 3IN9A 4EN7B 1R091 4AHYA 1LNSA 2FCUA 3CBNA 4DOUA 4SLIA 1LHWA 3ORJA 4AI9A 3O1SA 5IAXA 1G8WA 1XPWA 5C9AC 1RUD2 4YW1A 1PMIA 1GBGA 3MW4A 4E2GA 2R0FA 4M0NA 5KBFA 5IVJA 4AQSA 1HXS1 4Y1YA 1CQ9A 2GALA 5IJRA 5HV0A 1KRIA 5ACA1 2W92A 4P9GA 2WLQA 1W39A 5M0TA 4QKDA 3UV9A 3I4IA 3NNLA 4PI0A 2YZ4A 3AYCA 1I5PA 5CVRA 4AQTA 1GP5A 2DVGA 5FLJA 1GSLA 2ORZA 5JCTA 1OLME 1V9U3 2VCBA 2V73A 4HLTA 1NXD1 3MIDA 4XQ4A 5FUIA 4FPYA 2QQUA 5GALA 4DUWA 4AVTA 3SKJE 3A4UA 1DGWA 4ZS2A 1EAH2 3J7MA 2DCZA 1W2OA 1KDMA 2WABA 3NNJA 4Z8BA 3ZSKA 3WQ1A 3OSDA 1RUH2 2QDRA 4FSJA 3SITA 1T2XA 2FZ1A 1PK6B 4DS0A 3WQBA 1HRI3 5E88A 1ND2B 2IWGB 2ZMKA 3K4ZA 4CCEA 2IXJA 4H7LA 2JDPA 5CFDC 3LGRA 5JIUA 1WW7A 2EXHA 4N53C 5LEKA 3VL9A 1JZ7A 2WN3A 1AR72 3RYRA 1TNFA 3FMGA 5JI9A 4OMDA 2XOMA 1YI9A 3I54A 1O5UA 1VMHA 2W46A 3C7HA 3ZOIA 5GLZA 4OMCA 3TWIA 4QXKA 3AYDA 4E4DX 3TN93 3U4XA 1K45A 4CCOA 2VUDA 5GZGA 1HV1A 1RC6A 2Y60A 1UNBA 3AKTA 2R32A 5CKMA 1WD4A 4QGNA 1MR5A 3HNBM 4CUBA 1NQDA 1GP6A 3E5UA 3JUUA 4LLOA 3U4SA 5JR2A 1SFNA 2WNEA 1ZBA1 2RDNA 2OZ6A 2AGSA 1PO23 3VBRA 4ZZ5A 4YRDA 4EWEA 3VBHA 3FL7A 5FWJA 1H6XA 1NE6A 1RUNA 4MG2A 1ULGA 3T1LA 3GCXA 2QQKA 2YYOA 3NAPB 5D8AB 4AWDA 1VP6A 3MF9A 1RXFA 1ACCA 1TZOA 1XNCA 2BFUL 2UWCA 3LFIA 1F9KA 1JI6A 1OBNA 4E27A 2WN2A 2Y6FA 5GLVA 1S4CA 1GOFA 2WNUA 4CDWA 1URXA 2AZ5A 1ASJ2 2XL7A 4X8NA 1RXGA 2I74A 5FYMA 3WP4A 1IGOA 2P34A 1H4GA 4QQLA 1MS1A 1YQ6A 1AR81 1K5MC 1GOHA 3ZXLA 4BISA 3POYA 3I59A 1OVPA 2VNOA 2RVAA 3GALA 1FATA 2A3YA 4LHSA 4A42A 4EN0A 3WCRA 3DYPA 1POQA 3D3AA 5IVCA 3ZYHA 1D4VB 1LU2A 4YVSB 1V9U2 4IV3A 2D44A 2VOVA 2WZ8A 2DYCA 3ITQA 2W94A 4LE4A 2HWD2 5KHIA 4AZZA 3EO6A 1QJY1 4B3NA 2YG0A 4XE9A 5LATA 1LHVA 4G4FA 5AVAA 3IKWA 3MW2A 3BOPA 1J3RA 4XXPA 5F5QA 5BV6A 3DUIA 5JI7A 4A45A 4JAAA 2Y0OA 1MVQA 3JBG1 4XUQA 3LA7A 2R1DA 2VZ1A 3N7LA 1HRI2 2HEVF 3NJZA 4C1XA 1LGNA 2VUCA 4LKFA 5D1IA 3OEAA 4HKLA 4J1XA 3MFCA 5BNNC 4FFIA 3UETA 4MH0E 2V5DA 2ZX0A 5FKCA 3GJBA 4GMP0 3TOJA 3RZJA 2JENA 3VBUA 4XJAA 2EIGA 4GULA 3TN92 3RZMA 4P08A 2JX9A 2D5FA 1W9YA 1YJKA 5GLWA 1NA1C 1GOGA 4AFAA 4DRVA 2RJ2A 3O5SA 4RN5A 4AFMA 1KD7A 3QD6A 3MV01 1UOGA 5A3MA 1D4M1 1MZ6A 2G9ZA 4QPGB 3VBSA 5BYNA 1ALYA 4QQOA 5FZCA 5I8TA 4ARXA 5L73A 1PO22 2O8QA 3B9IA 4JRLA 5EZWA 1LESA 2NPIA 1BK0A 2DCJA 4ET7A 5A3TA 3GM8A 2QQLA 4KWUA 4LBQB 5J7MA 4PLNA 1F5JA 5EXOA 3E1F1 1TME3 4N8MA 5DXDA 1H8TB 4N7UA 1AHSA 2WZPP 3VB9A 3KF5A 1IG3A 4S2FA 4CDQC 5FO9B 2WYSA 3VBFA 4KH9A 1UZ0A 4MGQA 4AK3A 1W9FA 1DZRA 1AYM3 1XYNA 5JSOA 1N1SA 1PX3A 2J1VA 2VZOA 3FWEA 4QB2A 2AR6A 1VRH3 3AMQA 1C5HA 1QQP3 4QGMA 4I0BA 1FV3A 1MS4A 4LOTA 2VZ3A 2EVXA 5DDJ3 4LXLA 2VOXA 4XHBA 2HBTA 5F2WA 5KHJA 2WFF2 4ZPIA 5FY1A 5EJ3A 3ZPYA 2CWSA 2P3KA 1JTZX 4DEQA 2XHKA 2D97A 4CA9A 1COV1 2PHDA 1RMU1 4KL1A 4LMFA 4D7TA 2CWMA 2VZPA 5A33A 4O61A 4YZ3A 3LQCA 1POV3 4PIXA 5A32A 1AF9A 2RDSA 2XLFA 3OGRA 3WNXA 2P3YA 2JG9A 5CAZA 4NHXA 1W3VA 5JZGC 1QJFA 4MGYE 4NRPA 5DZFA 4QX2A 2KA3A 1CIYA 3MI8A 3RRDA 1RVF3 1MQTC 2ERFA 1LGCA 1QJU1 3VHNA 5ABJB 1O4TA 2ZMNA 1E5RA 2ZMLA 5C33A 3I59B 2YFZA 4KGGA 2LS6A 3CMGA 4DMIA 2WIIB 2E53A 5A3NA 3TEWA 3ZXDA 1UIJA 1PIV1 3FBYA 4LHKA 4H14A 3AL6A 1W0NA 3PUIA 4IV3B 2FBEA 4NOTA 3AKPA 3RSJA 2Q4SA 3PURA 4I0AA 4NN0A 3ZFGB 1AXYA 2NLRA 5LBCA 3WW1A 4IV1A 3M3QA 4XAEA 3WCSA 1R092 3B7MA 4NIDA 2JG8A 2PLV1 3D0JA 2DVDA 1OI6A 3FC0A 4N43C 5KC5A 1RJ7A 5FMOS 3F95A 1DF0A 2ZABA 3T08A 1ULDA 4OULA 2P37A 5JOZA 1X33A 1LENA 4I3PA 5A6XA 2R1BA 4HVQA 4NE9A 4A3XA 3DXUA 4R52A 5IATA 2OPKA 2YU2A 3VBUB 2KD7A 3AP6A 5C3SA 5A1FA 4PLMA 3M7AA 4Y26A 2WBKA 2SLIA 4R9CA 2PXJA 4P9LA 1QQP2 2PHXA 4IE5A 4W4ZA 1W6OA 2QQNA 2ZAHA 3KCXA 2FCVA 4LKSA 1OKOA 4NHMA 4PCRA 1AR62 2ILMA 2RS51 4OYUA 4CEYB 1Z7S3 1W8OA 1KGYA 3EXUA 3WNNA 2BNNA 4COVA 1VBA2 3MLKA 3O12A 1CONA 5C5UA 2H6CA 2DBNA 4Q1RA 3BU0A 3OUHA 1JH5A 3KV6A 3VUOA 2RMU2 3I2OA 1UCXA 5C8WA 2EAKA 1L7RA 1FI2A 2YFUA 1UY3A 4NWWA 2IXLA 1YIFA 3OYWA 4U36A 2JE7A 3DPRC 5FZOB 2PHWA 4RR3B 2ZGQA 5FPXA 4G9SB 3H1WA 3LZZA 2BDRA 2RS31 3R6SA 4BQ1A 4LULA 4RGKA 4Y33A 3EHKA 1RVF2 4IDZA 3VL8A 2R30A 3WNKA 3C3VA 1PMJX 1HDKA 1ZRFA 3AMPA 3BTXA 1LOFA 5FYYA 3I49A 3IB3A 1ZREA 4XF4A 1UX6A 4FT8A 3OEBA 3D82A 1Q8OA 4TSVA 3V0BA 3FZ3A 5IFTA 3ETPA 2ZGSA 1MS8A 1E57A 3CF6E 4BM8A 3KGLA 5BUVA 2W87A 1ZBE1 1RUC1 1E5IA 4FCAA 4Y5SA 5LBEA 4EZHA 5A32B 5IT6A 1JYXA 3UGGA 2Y34A 4E9KA 1IS5A 3I3MA 1JUHA 3QH6A 4LA3A 3OUJA 3TAYA 5T5PA 2WQZC 1XU1A 1RITA 1CZVA 1HN0A 2QZ2A 3CO2A 4QQPA 2ZJCA 2D43A 3DKWA 4ARYA 4HVOA 1LHOA 3OPTA 5LASA 1CZTA 4UFKA 1JHNA 3GCWA 3N7JA 3ZMNA 3ZKYA 4LO7A 1AR82 4JGZB 5F2SA 4OHZA 2HYKA 5AVPA 1NCQA 3IPVB 4L9BA 1LEDA 5FREA 1QU0A 2R061 3LKJA 4FOYA 4AGRA 1MS0A 1ND2C 3OD4A 4JGYA 1Z78A 4Q0UA 2EF6A 3HWJA 5FXXA 5LA1A 4HONA 4X8PA 3MYXA 1FNZA 1BK1A 1D2QA 3K2OA 2YDEA 2GP5A 3ENRA 2VL4A 3M70A 4K40A 2VNGA 1U5ZA 4YVWA 1UL9A 4M4RA 2JICA 1XNAA 4DXSA 4YARA 2UURA 3CJIA 1AR91 1NCRB 2B46X 3HN3A 3MDPA 4FBFA 3T2OA 4Q0QA 4QDQA 4I0WB 4Y4RA 1RUG1 4UFIA 3J7LA 4L11A 2AENA 5DAWA 2VBBA 4H55A 2HWF1 3HOBA 3WOGA 1H2KA 4BE3A 5KHGA 1LULA 5EYXA 3A0NA 3WG4A 4IE0A 2X5IA 4QDRA 1I9RA 3U10A 3V65A 3FLPA 2RJKA 5APAA 3O1UA 1XRUA 4BQYA 3E6BA 3MLLA 5D8AC 3QBQA 2ZCWA 5C8CA 1TVGA 3KB5A 2VOTA 3MBWA 1DZTA 1SLCA 1S1AA 3B69A 4FPCA 1JZ4A 1FNYA 3KS7A 2XLAA 1ENQA 1W6OB 3M8LA 4IL7A 2XJQA 4DXZA 2QZ3A 5BNPB 4KBBA 2LRPA 1C28A 4S2GA 4HKWA 2HEYF 1GQGA 1TMF3 2A7AA 2DFCA 1F31A 4HK9A 3ZLIA 4B8EA 2YV8A 2G9FA 3V56A 1OA3A 1HRV2 4YSFA 3THCA 2RHPA 3ZYPA 2Z2SB 3J7HA 4ZZ8A 3DL3A 2ZHMA 5JMCA 2W0XA 4D6SA 2V4VA 5IW0A 3BI3A 3ST7A 4MGIE 1RUD1 4Q0VA 2WWJA 4RD7A 5DAQA 1DBNA 3DXTA 2CDPA 3OYWB 4K1YA 1G9BA 1SLAA 1JU3A 2JDAA 1XYPA 3MEPA 1LCLA 4QPYA 2EAAA 2ZEYA 1BHGA 2IUWA 4Z07A 1PZ8A 5SV8A 2E31A 3H8XA 1UX7A 1YRZA 1AX1A 3AMNA 4Q26A 4V1PA 4H7MA 3JQWA 5GZDA 1DQ5A 5LB6A 5FMDA 2W52A 4XOGA 4COZA 3WDTA 3S6PA 2CGNA 1QJX3 3NMBA 5A7WB 1UMZA 3F2ZA 5IUQA 3MFAA 5CBLA 4AE2A 2WWUA 4XBNA 1EAH1 1COV2 3PL0A 4LLFA 4NUBA 3WG2A 1A78A 2ZZJA 1AJKA 1RUH1 5DAVA 4Q5OA 1QDOA 2BFUS 2JDKA 2YHJA 5J36A 1BQPA 4HPKA 5K4LA 3T4HB 4XAAA 5JXJA 3VDDA 3AJZA 1AR71 4FP2A 3RQ0A 1WCDJ 3I2DA 1EV12 2E33A 3G7DA 4Q8KA 2LW8A 4QMAA 5LRSA 2JDHA 2YC2A 4N90A 2WWSA 4TYSA 5JOWA 5DG1A 3DYMA 5E16A 4UW6A 5A7SA 3B5LB 4P9WA 1GFF2 4Y1ZA 1OPMA 3AC0A 4JGYB 4MLOA 4XVHA 1H8TC 4W65A 3RMXA 1IQDC 4HL0A 3T30A 5BNOA 3I2JA 3ZSLA 3TRSB 1R64A 2Q30A 2FDFA 3IAPA 4YVWB 3RJ2X 3RVHA 3JZVA 4EN6B 4LBQD 3CJIB 1QY4A 3ZN6A 1JW6A 5FPVA 1S0BA 4AI2A 4OZXA 5FFOC 1STMA 3POEA 5F5IA 3DYOA 1V6LA 4YW2A 1BEV3 4LOSA 5FYBA 4AFBA 1XNBA 2ZHLA 4IERA 2F4LA 1JYNA 3VD9A 1WA4A 1GZTA 4GWNA 4IE6A 4LK7A 5EPAA 2IVIB 3VBRC 1ASJ1 2X5IB 3BTAA 4Q4X3 1HLCA 2OZJA 2EA7A 2VOKA 4KWLA 3VBHC 1RUOA 1UY2A 4NVPA 1KDKA 4IETA 1FYUA 2XVGA 5CIRA 3K77A 4MGZE 3PVBB 4QGLA 3WP6A 3T0BA 4F8AA 1VBE3 2IXKA 1OLMA 2FDJA 5EQUA 1RIRA 4XBLA 1AL0G 3DKQA 4D69A 4XPVA 5KXEA 5CU1A 1IOAA 2WLPA 4L99A 3ZXEA 2DFBA 4Z2AA 4FFFA 1DLCA 4I2OA 2WNUC 2TNFA 2J1EA 4CDWC 1FX5A 1YYNA 1V9U1 1JOBA 1WMDA 2A1XA 2C9AA 1WCSA 3ELNA 5LK5A 2GZWA 3APBA 1QJX2 2YC4A 3DPRA 2HWD1 3MICA 2UY9A 1O3SA 1FAYA 5J96B 1LODA 1NLQA 2D6MA 2P17A 3DCQA 1NXMA 4K9SA 4EN9B 5CKQA 4IEUA 3MIEA 3AK0A 5FMOL 2VO5A 4P5YA 4Y1VA 4BQ5A 5FY0A 2VU9A 3B01A 3NV4A 3KGZA 5A7NA 2WRAA 4XQWA 3VZOA 1HRI1 2VMCA 3WW4A 3OGGA 2RG4A 4IV3C 4UBHA 4BIOA 3TEXA 5C5TA 2ARAA 4D0QA 3D6EA 4GWJA 4R9DA 4BXFA 4YLZA 1O3TA 1FMD3 3USSA 4FPLA 5HCHA 2Z42A 5GLTA 1H2NA 1JHJA 4MGKE 1RB8G 1ULPA 1FV2A 1GANA 1UYYA 2LROA 5LW9A 3TN91 1VBD3 3H7YA 3ZN4A 4I30A 1ODNA 1NY72 4D7YA 2GNBA 4QAWA 5E1RA 4CTEA 2GNMA 3CEWA 2ZGUA 1UN1A 1PGW2 4CUAA 3ZXAC 2GDFA 1G6NA 1HQWA 4E4HA 1GLHA 2JEMA 3H1YA 1PO21 4JDMA 5J1XA 2VQAA 2KR2A 2YMZA 2XJSA 3VBUC 5F6LB 1YI7A 1CAUB 3LOIA 5GZFA 1O91A 1PK6A 1R1A3 1VMFA 1ND2A 1S0DA 2ZS6B 3PJQA 3S5QA 5GJ6A 2ARBA 3AZVA 4D7SA 4QX5A 1UMIA 1BEV2 1DGWX 5FYSA 4RL7A 5HCFA 5IHRA 5I0SA 4WM7A 2BYVE 4XEZA 1O3RA 4INDA 5FQ0B 3RG0A 1RGSA 1YFXA 4Q4X2 4XTPA 5LBFA 4N9IA 3P3PA 3ZYBA 1H9PA 3VLBB 1KQRA 2BQPA 3R4SA 3H3UA 4XFIA 5F3GA 1QMJA 1W2TA 4M01A 4RHV2 3HQRA 1VBE2 5FP8A 4IQPA 5BNOB 2W1WA 1KEXA 2BVBA 1AUYA 1OQEA 2D7FA 2I07B 2RV9A 2WINB 2XR4A 3AFKA 3DECA 4XDPA 3VBFC 2LM3A 4FXKB 1VRBA 4W50A 4M3CF 2CHHA 2JJ6A 2R043 3NV1A 4FAGA 1OLQA 3VDAA 2WDBA 2EIDA 4PHZA 3ZN6B 3NAPA 5D8AA 1C4RA 3WQ7A 4CE8A 3WG3A 1X8EA 4NAOA 5EHDA 1A6CA 1DQ2A 4XABA 3BTZA 4EYUA 1WD3A 1GYKA 3N9NA 3A0KA 4KBZA 2H0VA 4KWKA 1MVEA 4Q4W2 4Y1XA 4FP3A 3U14A 2CAVA 3IZOA 4FPJA 1SFPA 1X36A 4FO9A 4UFJA 2D3SA 2J1AA 1Z0HA 4HT1T 2XG3A 5LZ6A 2NYYA 2GC1A 2GMPA 2J1SA 1W04A 4GH4A 4MHUA 4FPGA 3SNMA 2VQUA 5C4WB 3M3OA 5K7PA 5J48A 3MF6A 4DXRA 2JG9C 2O8OA 1DYOA 4XF0A 3VD7A 1QNWA 2FDIA 1VBD2 2G19A 3SEEA 2B42B 4YVSA 2I45A 4BU2A 4Z2WA 2ID4A 4ES8A 4OI0A 4AL9A 3LEMA 3RNSA 2JXAA 3BUCA 5FLHA 1H1MA 1Y4WA 3NVCA 4OHVA 2B7YA 2PELA 3RJRA 2VMFA 2Z5WA 3S0MA 3MUZ1 3POWA 3KCYA 4A6SA 3LIGA 4DB5A 3VKNA 2W91A 1R1A2 3KCCA 3UGFA 3ZR5A 4Y1UA 4BQXA 1HQLA 4CCCA 4XJUA 1AZDA 4AEJA 3M4FA 2CL2A 3WDUA 4DINB 4CU7A 1JZ5A 2GN3A 3B93A 2B9VA 2W95A 3ZSJA 4IV1C 4ISQA 2P4EA 1CD3G 5FZ3A 3H3LA 2XL9A 1W8HA 4P14A 1AYM1 2JG8C 2VMHA 4L0PA 4QX0A 3URFA 4AXOA 4JCKA 3RZLA 1PM4A 1UZWA 2NMOA 4CU9A 3K3NA 3LDRA 4XJWA 1OH3A 3MPPG 1BVVA 1SPPB 2VCCA 1QQP1 1VBB3 2DCTA 2C1FA 4IEXA 4YG6A 3U11A 3SCFA 1AR61 5K9YA 5DDJ1 3WZ1A 4MYEA 4UF0B 1ZX5A 2J42A 4PIZA 4QPGA 4D8MA 4C1WA 5JSRA 1LR5A 1VBA1 2JDNA 4G3YC 2RS12 2GH8A 1RHI3 2VVFA 3SCHA 3POBA 2R042 2J1UA 2DWRA 2RMU1 2VNVA 2AACA 2Z79A 3ES4A 4YPJA 2D6LX 3IM0A 4LBQA 4ZHNA 1VIWB 5KWRA 1VB4A 4JDOA 1POV1 4OI4A 2ADDA 2V09A 1H8TA 1XJAA 3FFQA 1UU6A 3LA3A 4BXSV 3IDAA 3S7EA 4IUGA 4C91A 3T0DA 3H8OA 4Q0SA 4TTGA 4IXLA 4W6WA 3WDXA 4YFZA 2WS93 4WM7B 1KJLA 3NO8A 5CB7A 2ZEWA 2C24A 3FHIB 4XCBA 1LU1A 4NIGA 4Q4Y3 1RVF1 3KVBA 2Y6KA 5IYYA 1O6UA 1T6BX 1TEIA 2V72A 1VR3A 2A73B 4JTNA 2JECA 1C8M3 3U1XA 2QBXA 3LA2A 4RYDA 5I0UA 4OVEA 4LR4A 3OCPA 5E89A 4LHLA 3I2GA 4FOWA 4XURA 1JN2P 2VH9A 2VW2A 5JOXA 4PF5A 3ZYGA 2ZGTA 2WO2A 3NNGA 4YZ4A 2GAUA 1S2KA 5L9BA 4ZS3A 3AZYA 3RFRA 2RM23 5FKBA 2DVFA 4D6QA 5FZKA 1LOFC 3OPZA 1W03A 3ZYRA 4HKOA 5GZEA 1YCIA 4XFHA 2AYHA 2J1TA 5JDBA 4IGQA 1AX2A 5HCBA 3MLJA 3NQHA 1RUE3 4GH4B 1D7PM 5L9RA 4KQ7A 2QQWA 3WX5A 4A2UA 5ABJA 2ZAAA 4XFCA 3UYJA 1CAXB 5F7UA 2Z4FA 4QX3A 3A23A 1O8PA 1ULOA 3A21A 4BB3A 1W0OA 4OI1A 4AHWA 3WNPA 2FMDA 4YG3A 3FFZA 5KC6A 4K8RB 1N3PA 5KHHA 4XC9A 5FTTC 1BBT3 1QH6A 2ZX1A 3ZFGA 3MZHA 2PFWA 3FBMA 5LEJA 5C71A 4GJZA 2XJVA 2YBSA 1HB3A 1NCQC 3N9LA 4XFGA 1N3OA 2VQ0A 4CCDA 4D3WA 1RHI2 5FOJB 4XZUG 4JGYC 1U12A 2FHRA 2BERA 1XNDA 1FOD3 1WMXA 5EJ1B 3FX3A 4XMAA 5ANNA 3SC7X 4EROA 5L9VA 5J3UA 2K9ZA 1ONAA 4LHNA 5ISLA 3VKFC 5FZHA 2DU0A 1ZRRA 2E63A 3P1IA 3R4DB 4QT6A 4W6XA 4XIKA 4YVWC 1KS4A 3LSDA 2YGMA 3TYJA 3O0WA 3CJIC 1G9CA 3WHUA 5T55A 1YFWA 1VLNA 4O65A 4Y22A 5BY5A 4OUMA 4XYXA 3C7OA 3GZEA 4Q4Y2 1W9TA 3M3EA 1W05A 4PBPA 1DQ0A 2ZGKA 3ILRA 5IK7A 3WINE 3EBRA 2CTVA 5I0TA 1C8M2 2X5IC 3FUOA 4CEYA 5IFPA 2HWB3 1US3A 4AOCA 3ZIXA 4CP9A 3RS6A 2NQYA 4IEYA 3M3IA 4JDNA 1PZ7A 2VNRA 2SBAA 4AR2A 4GB33 5C8CC 3UL2A 1H1IA 4P9XA 2Q1MA 1HRV1 4L2NA 4XF9A 2NMNA 1LAJA 4UW5A 1G86A 1SHWB 2LALA 3BOWA 2ZGMA 1QXJA 2V4AA 3CKHA 4ISRA 5F32A 3BVCA 2A6WA 3T4VA 1FT9A 4LBJA 1Q56A 1X7NA 4E2SA 5FZOA 1WKYA 4P9IA 4PDWA 4RR3A 2DUQA 4XDQA 2IXCA 3GBWA 4Y3OA 5IVBA 3ZXJA 1F35A 1WMEA 2VW0A 1OURA 1JYCA 1RUE2 2XHNA 5HPOA 3M1HA 2DDUA 2JE8A 4EWDA 3HJRA 2O0OA 3LEKA 4IEWA 4CP2A 2VZQA 2MPFA 3ZX7A 2LUWA 5CKNA 1S0EA 1U5XA 2QNKA 1LHUA 2CDOA 1Q8SA 2BOJA 3I3EA 1JZ3A 5FP3A 2W47A 1HXS3 3T3YA 4UYBA 4NIHA 1BBT2 2P3JA 3POJA 1UF2C 1W9WA 5HCAA 5I0DA 1UO9A 2PQSA 2RDRA 2VZTA 4AGGA 4A7YA 4XCAA 2DUOA 3SISA 2YPDA 4L92A 1OD5A 3GHMA 1QEXA 3PUAA 4AHXA 4L8QA 4CEWB 4SBVA 4EE2A 5FZBA 3I2HA 3PUHA 4MXWB 3SXWA 3VGIA 1FOD2 4OCTA 1NYWA 2VJXA 1OD3A 4RFRB 4CVUA 5FDBA 1QWRA 4COUA 2WSVA 1EV11 1WZXA 1WWYA 3IDEA 4IW3A 5FXVA 2E51A 3VD4A 4YYOA 1KXGA 3SHRA 3ZFEB 4JGZA 2PHLA 5F5AA 5FR3A 5FPZA 3IPVA 1FXZA 4YG0A 4AI0A 3O1RA 3IMMA 2ZOEB 3C8XA 1M4WA 3VDDC 5B4XA 1LOBA 4H3WA 3RWNA 3UJOA 4M3CB 4I3GA 3GNEA 1B35B 2RJLA 1S0IA 4S2DA 2B45X 3VD5A 3ZXFA 2HWB2 3VZKA 2IVJA 1NCRA 1GQHA 2JD9A 4BQWA 4GB32 4YZ5A 3VV1A 2PMWB 1ZZBA 2XONA 1DGRA 2KXLA 5JPMB 3ZVXA 5BNOC 3Q8CA 2RE9A 3J8F3 3LPGA 2OVUA 4Q1PA 4K1ZA 5LY2A 4AFCA 1F2NA 4JHZA 2ZBJA 3SH3A 4OUSA 1TME2 1XB9A 1UW8A 2CNAA 1JXNA 4QXBA 2UY8A 5DUVA 4YGCA 5A70A 4QHOA 4GIQA 1PVXA 4B4QA 1AYM2 4Y22B 1WCUA 4IE7A 4NHYA 1H9WA 3OBRA 3BODA 4FVVA 5EP9A 3GGLA 2OX0A 3DGTA 1VRH2 1WCQA 3I3BA 4LK6A 3AYAA 4XHXA 5GM0A 1TQ5A 1SDDB 5A1AA 1V6OA 3Q8EA 4J25A 3BB6A 4AEDB 1YJLA 4UFHA 5DDJ2 4YM0A 2X05A 3S7IA 4C0HA 3ALQA 4CDXA 5BNPA 2D3PA 2MHFA 4QB1A 4AG4A 1QJX1 4ASKA 4CP9B 1LGBA 2PAEA 3TEYA 5FY5A 2YU1A 4RQPB 5I93A 3ACGA 3NW4A 5L7OA 1NOVA 3NSTA 3ROUA 3NNFA 4O7XA 3EJKA 3ZFFB 4NAMA 5DN2A 5C4WC 1JUIA 3TNPB 1IS4A 1XSRA 1GU3A 4QWNA 3T09A 1DYKA 5LA9A 1VAKA 5AFEA 3LF7A 5KR7A 2WQ4A 2P6CA 5F8PA 1W28A 4Q27A 1W6QB 2JDUA 3MIFA 4PDWB 4QHBA 2CAUA 3B3QE 3D0SA 2VOWA 3WP3A 4CU6A 1X9TA 4NJ4A 3VDCA 1W6NA 5EV7A 1YQCA 1W2NA 2ARCA 3EMRA 1OA4A 3WF0A 5FAXA 4PF1A 3PUQA 2QQOA 4FAHA 4DXTA 2J1RA 4Y24A 3JBG3 4RS5A 3AP5A 5FZ6A 2BW8A 4XZPA 4AVBA 2AREA 1CESA 5TSWA 3LFMA 3E5QA 1NY71 3NJYA 4MGSA 5I0RA 5A7WA 3LCPA 2QDNA 3J7NA 1OLRA 2F4PA 5C3PA 1PGW1 1XBFA 4BQ3A 5CEHA 5LRRA 2GU9A 2CYFA 2R073 3K3OA 3RYKA 2VZRA 2VMDA 4YM1A 3O1PA 4E8CA 4LJHA 3C7FA 4WM8B 4AAXA 2XWBB 4BH9A 4E2QA 2Z69A 1CPNA 1AX0A 3O0XA 2Q8OA 3ZM8A 1HJFA 2PHRA 2ZPXA 3MO4A 3U37A 3J8F2 1BEV1 1D4M3 3RMYA 4I01A 1YXWA 3JQXA 4CXXA
chains in the Genus database with same CATH topology
5FPLA 5FYVA 4AI9A 5FXVA 5FUNA 4IGQA 5FZ1A 2OQ7A 2VD7A 5IWFA 3PUSA 4LITA 5F5AA 3PU8A 5FPBA 3N9OA 3UYJA 5IVVA 3PU3A 4DO0A 5IVJA 2P5BA 3DXUA 2YU2A 5A1FA 4AAPA 3N9QA 5FP4A 2PXJA 5FYIA 4BU2A 4QX8A 4CCNA 3OPWA 5A3WA 4IGPA 2OS2A 5A7PA 4GJZA 2YBSA 4CCJA 3N9LA 3ZPOA 5FZEA 3ZLIA 3KV9A 5A1LA 5FZCA 5FPUA 5LY2A 5LWBA 2YBPA 5FZIA 3KV6A 5FY4A 5FXWA 5A7OA 5FY0A 5A3TA 3N9PA 4D6SA 5IW0A 4QXBA 5A7NA 3AVSA 5F5CA 5ISLA 2WWJA 5FZHA 5F3EA 4C8DA 2OT7A 3DXTA 4BXFA 5FZMA 4CCLA 5FZ4A 2Q8EA 5FZ3A 5IVFA 5FZOB 3LDBA 3AVRA 5FWEA 5LY1A 2OX0A 3KVAA 3U78A 2W2IA 5FZAA 3K3NA 5LW9A 4Y33A 4QU1A 5FZ7A 5E6HA 4QXHA 5FBJA 4V2WA 4EZ4A 4DIQA 5A3PA 4CCOA 4QX7A 3PDQA 4UF0B 5FYYA 4ASKA 5FJHA 2XXZA 4HOOA 2YU1A 5FYHA 5FY5A 4LXLA 4LIVA 5A7WB 5F39A 5IVEA 5F2WA 2WWUA 5FYTA 5FY1A 5FV3A 2YBKA 3U4SA 4E4HA 5A80A 5FUPA 4QWNA 5FZ0A 4NUBA 4QXCA 5FWJA 2GP3A 5FP9A 5KR7A 5F32A 4EZHA 3KV5A 5FZDA 5F3IA 3LD8A 3KV4A 5FZLA 2Q8DA 2XMLA 5K4LA 5FZOA 4CCKA 5FYSA 5F37A 5ANQA 4Y3OA 5IVBA 4GJYA 3OPTA 5FPAA 5A7QA 4CCMA 3PUQA 4CUGA 5FZ8A 3KVBA 5FYMA 4CSWA 5F2SA 5F3GA 5FZ6A 5FYZA 5A7SA 4UF0A 5FJKA 4IGOA 3N9MA 5FP8A 3NJYA 5FXZA 4BISA 5A7WA 4D6RA 5FZ9A 5FZGA 4GAZA 4XDPA 5FZFA 5FXXA 5A3NA 4TN7A 4HONA 5FY8A 5FYUA 2Q8CA 5FP3A 5CEHA 4GD4A 5FYCA 5F3CA 3K2OA 1VRBA 3K3OA 2OQ6A 3AL6A 5FY9A 5IVCA 4URAA 2GP5A 3RVHA 4V2VA 3PURA 3AL5A 2YPDA 3PTRB 4D6QA 5FP7A 4XDOA 2XUEA 3PUAA 4LIUA 5FPVA 5FZKA 5IVYA 4Y4RA 5FZBA 4EYUA 5F5IA 5FY7A 2XDVA 5FYBA 3N9NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FPL A;  5FYV A;  4AI9 A;  5FXV A;  5FUN A;  4IGQ A;  5FZ1 A;  2OQ7 A;  2VD7 A;  5IWF A;  3PUS A;  4LIT A;  5F5A A;  3PU8 A;  5FPB A;  3N9O A;  3UYJ A;  5IVV A;  3PU3 A;  4DO0 A;  5IVJ A;  2P5B A;  3DXU A;  2YU2 A;  5A1F A;  4AAP A;  3N9Q A;  5FP4 A;  2PXJ A;  5FYI A;  4BU2 A;  4QX8 A;  4CCN A;  3OPW A;  5A3W A;  4IGP A;  2OS2 A;  5A7P A;  4GJZ A;  2YBS A;  4CCJ A;  3N9L A;  3ZPO A;  5FZE A;  3ZLI A;  3KV9 A;  5A1L A;  5FZC A;  5FPU A;  5LY2 A;  5LWB A;  2YBP A;  5FZI A;  3KV6 A;  5FY4 A;  5FXW A;  5A7O A;  5FY0 A;  5A3T A;  3N9P A;  4D6S A;  5IW0 A;  4QXB A;  5A7N A;  3AVS A;  5F5C A;  5ISL A;  2WWJ A;  5FZH A;  5F3E A;  4C8D A;  2OT7 A;  3DXT A;  4BXF A;  5FZM A;  4CCL A;  5FZ4 A;  2Q8E A;  5FZ3 A;  5IVF A;  5FZO B;  3LDB A;  3AVR A;  5FWE A;  5LY1 A;  2OX0 A;  3KVA A;  3U78 A;  2W2I A;  5FZA A;  3K3N A;  5LW9 A;  4Y33 A;  4QU1 A;  5FZ7 A;  5E6H A;  4QXH A;  5FBJ A;  4V2W A;  4EZ4 A;  4DIQ A;  5A3P A;  4CCO A;  4QX7 A;  3PDQ A;  4UF0 B;  5FYY A;  4ASK A;  5FJH A;  2XXZ A;  4HOO A;  2YU1 A;  5FYH A;  5FY5 A;  4LXL A;  4LIV A;  5A7W B;  5F39 A;  5IVE A;  5F2W A;  2WWU A;  5FYT A;  5FY1 A;  5FV3 A;  2YBK A;  3U4S A;  4E4H A;  5A80 A;  5FUP A;  4QWN A;  5FZ0 A;  4NUB A;  4QXC A;  5FWJ A;  2GP3 A;  5FP9 A;  5KR7 A;  5F32 A;  4EZH A;  3KV5 A;  5FZD A;  5F3I A;  3LD8 A;  3KV4 A;  5FZL A;  2Q8D A;  2XML A;  5K4L A;  5FZO A;  4CCK A;  5FYS A;  5F37 A;  5ANQ A;  4Y3O A;  5IVB A;  4GJY A;  3OPT A;  5FPA A;  5A7Q A;  4CCM A;  3PUQ A;  4CUG A;  5FZ8 A;  3KVB A;  5FYM A;  4CSW A;  5F2S A;  5F3G A;  5FZ6 A;  5FYZ A;  5A7S A;  4UF0 A;  5FJK A;  4IGO A;  3N9M A;  5FP8 A;  3NJY A;  5FXZ A;  4BIS A;  5A7W A;  4D6R A;  5FZ9 A;  5FZG A;  4GAZ A;  4XDP A;  5FZF A;  5FXX A;  5A3N A;  4TN7 A;  4HON A;  5FY8 A;  5FYU A;  2Q8C A;  5FP3 A;  5CEH A;  4GD4 A;  5FYC A;  5F3C A;  3K2O A;  1VRB A;  3K3O A;  2OQ6 A;  3AL6 A;  5FY9 A;  5IVC A;  4URA A;  2GP5 A;  3RVH A;  4V2V A;  3PUR A;  3AL5 A;  2YPD A;  3PTR B;  4D6Q A;  5FP7 A;  4XDO A;  2XUE A;  3PUA A;  4LIU A;  5FPV A;  5FZK A;  5IVY A;  4Y4R A;  5FZB A;  4EYU A;  5F5I A;  5FY7 A;  2XDV A;  5FYB A;  3N9N A; 
#chains in the Genus database with same CATH topology
 4Q4X 1;  4WVM B;  3IT8 A;  1P8J A;  2CGO A;  4XJZ A;  2WYF A;  1UPI A;  2BGP A;  1PK6 C;  4LIT A;  3VHR A;  4RHV 1;  1VBE 1;  2O14 A;  2R49 A;  2R6Q A;  1ZRC A;  2UWA A;  3C2U A;  3PHM A;  1ZZ8 A;  3PU3 A;  2VG9 A;  2VZS A;  1JU4 A;  3VKM A;  1F15 A;  4LOR A;  4IEQ A;  1XQN A;  1IPJ A;  4WM7 C;  2WNV B;  2WT1 A;  3MIH A;  3ZDS A;  1IS6 A;  3CZU A;  4XJ9 A;  1Z7S 2;  2YRO A;  2OPW A;  1OOP B;  3VZJ A;  3RZK A;  1Q8P A;  1ZZC A;  2L9L A;  3AKS A;  4NIA A;  1GZC A;  1H0B A;  2WNO A;  5JAX A;  4MVT A;  4Y20 B;  3ZDV A;  5FPU A;  5JR7 B;  4M4P A;  4XF3 A;  3W5N A;  1ZRD A;  3V0A B;  4WZF A;  1F5F A;  2HBU A;  3TEZ A;  4Q4W 1;  1V70 A;  3OOX A;  2W5F A;  1NAE A;  2ZGP A;  4JKL A;  5C9A B;  4BLJ A;  3AVS A;  3Q9O A;  4FTS A;  3DN7 A;  3N3H A;  1NKG A;  3AB0 A;  4C8D A;  1YEW A;  2QQI A;  3NAP C;  5AFB A;  2DCK A;  5DQ0 A;  4AQ6 A;  3PNA A;  3O1T A;  3MPB A;  4XUT A;  1SLT A;  1SEF A;  3WNO A;  1NG0 A;  1QOT A;  1S55 A;  3WDV A;  2JD4 A;  3RGB A;  4FQZ A;  4GMP 3;  1DU3 D;  1VBD 1;  4HN1 A;  2XWJ B;  2Y6H A;  2ZGN A;  4QU1 A;  5FO7 B;  4V2W A;  1JOJ A;  4CDX B;  1VAM A;  2ZHK A;  2VE1 A;  3WUD A;  4BK4 A;  3OD0 A;  3GDB A;  2WL1 A;  3TBD A;  4GH4 C;  4B29 A;  5L7O B;  1XE8 A;  5FYH A;  2W9X A;  4HAN A;  3UK9 A;  4BZ4 A;  2R07 2;  5FYT A;  2XJP A;  1RUI 3;  4ONU A;  1DIW A;  2P2K A;  3AKQ A;  1BCX A;  4QXC A;  4ORF A;  4R9B A;  1R1A 1;  4YVS C;  1VAL A;  3NJX A;  4MSV A;  5F3I A;  2Q8D A;  4YGD A;  2E7Q A;  2DVB A;  4UFM A;  4N53 B;  3ETQ A;  2OUH A;  1IPS A;  2IZW A;  1W6N B;  1UZY A;  3AKR A;  3CU7 A;  3W5M A;  5HV4 A;  2PLV 3;  2JDY A;  4NHK A;  4X6R B;  1V6I A;  1A3K A;  4BQ2 A;  4LT5 A;  1BZW A;  4RS5 B;  3VKO A;  3HAG A;  4Q29 A;  3Q8B A;  2CGP A;  4FOQ A;  4Q8L A;  1JYW A;  4RA0 A;  1OMI A;  4TXW A;  5A3U A;  1W2A X;  2EXK A;  3FN9 A;  3OGJ A;  1U5I A;  2RS1 1;  3NWK A;  4BYY A;  5FY8 A;  1OXC A;  2D3R A;  2R04 1;  4LKE A;  1VPH A;  3H7J A;  3RDI A;  1CAU A;  3HEI A;  1WA6 X;  3PIG A;  1YUD A;  3NJV A;  5DG2 A;  4XFA A;  1MZF A;  3PTR B;  5H9R A;  3USU A;  1UOB A;  4JZR A;  4AQ2 A;  1V6N A;  4K6B A;  1OKQ A;  5CAD A;  4QPG C;  4A44 A;  3WUC A;  2XDV A;  3RZH A;  2ZA9 A;  1S0F A;  1SLB A;  5FQ0 A;  3ACL A;  5T5O A;  2FQP A;  1PHM A;  1MZ5 A;  3H1M A;  3VBO B;  2RR1 3;  3RI8 A;  2BEO A;  3JB8 A;  1K5J A;  4JX0 A;  1K5M B;  4MV2 A;  4YW7 A;  3KT4 A;  1O5L A;  1SDW A;  1CN1 A;  1H8V A;  3R0R A;  4YZ2 A;  4UI9 L;  1DYP A;  4FPE A;  3OBT A;  2Y33 A;  4OHW A;  5FP4 A;  4GKY A;  5FYI A;  2HWE 3;  5T5L A;  5A3W A;  1TMF 2;  3OBZ A;  2VBD A;  5A7P A;  3NNM A;  3BIE A;  3WP5 A;  1J59 A;  1LOG A;  3HN1 A;  4C90 A;  2H6B A;  4BWO A;  1QDC A;  4YFW A;  5FO8 B;  3ZSE A;  2ZHN A;  4B1M A;  1HN1 A;  2I2S A;  4K7J A;  1QOS A;  1QJE A;  2GH2 A;  4BMB A;  1J3P A;  1WW4 A;  3FHQ A;  4B4R A;  2VMG A;  1UMH A;  4XFF A;  2B39 A;  2X09 A;  3AX4 A;  1S2E A;  1HX6 A;  3GBF A;  3WNM A;  2VW1 A;  4GKX A;  5C4W A;  4OQ9 A;  2P1B A;  4YW5 A;  2C4X A;  4XIO A;  4MHR A;  4I02 A;  3LDB A;  4B7K A;  5I91 A;  5L19 A;  3KVA A;  4FTE A;  2W2I A;  5FZ7 A;  1CJP A;  1VBB 1;  2GND A;  1OVS A;  3BIW E;  2WC2 A;  4KG0 A;  2FZ2 A;  1Q3E A;  1SG3 A;  4NR1 A;  1NT0 A;  2CV6 A;  2BWA A;  4UBG A;  5GZC A;  1QXR A;  2VGD A;  2UU8 A;  3JD7 3;  5ABJ C;  1H4H A;  1YQ2 A;  1O4Y A;  4ZXK A;  4HMZ A;  1DQ6 A;  1RHI 1;  1YIP A;  1C1F A;  2K2S A;  2R06 3;  2EIB A;  5A6Q A;  3N36 A;  3KLS A;  3ATG A;  4NPM A;  3I7D A;  3B94 A;  1OF4 A;  3HVD A;  1B35 C;  4L97 A;  3POS A;  2ATF A;  4K3U A;  1ST8 A;  2WFP A;  3ZFG C;  1F4H A;  2CSG A;  2DTY A;  5FZL A;  1XNK A;  4ZY9 A;  1NQJ A;  4AI1 A;  3POG A;  2RDQ A;  4FFH A;  4CDQ B;  1GZW B;  3NKG A;  1PM7 A;  1AR9 3;  3L9J T;  3PIJ A;  1QF3 A;  2JE9 A;  1PX4 A;  1LJ7 A;  2B4K A;  1BYH A;  3Q8A A;  1CX1 A;  1AL2 3;  4Q4Y 1;  4JV4 A;  2RR1 2;  1D0G A;  2BV4 A;  2W1S A;  1SPP A;  3KM5 A;  1UAI A;  5GLU A;  2B9U A;  5FYZ A;  1C8M 1;  4UF0 A;  3BPZ A;  1VB2 A;  3N9M A;  2HWC 3;  4KG8 A;  3K4A A;  3KZ4 C;  3LB9 A;  4Z82 A;  1ZRI A;  4UAP A;  1O3Q A;  4DNY A;  3MHZ A;  3HPN A;  1CGP A;  4NO4 A;  4AF9 A;  1AJO A;  2HWE 2;  1CJD A;  3ECQ A;  2QFE A;  1GIC A;  1ZM1 A;  2QJV A;  3JB4 C;  4V2V A;  2DUR A;  3ZXK A;  3AL5 A;  2RM2 1;  3USU B;  3WDY A;  4CEY C;  2BTV C;  2ES3 A;  2JIJ A;  3K4D A;  4RGA A;  3WDW A;  1RUJ 3;  4XMI A;  4KU8 A;  3NRU A;  4B1L A;  3S30 A;  5JZG B;  1JZ8 A;  2TUN A;  1XYO A;  5FYV A;  2WKK A;  3LOB A;  1RUE 1;  3H42 B;  2WUH A;  2VD7 A;  2VQT A;  1H1A A;  1MQT B;  3WD5 A;  3ZIW A;  5KXB A;  1E5H A;  4EQV A;  2YXS A;  5C6C A;  5CA6 A;  1NZC A;  1W8N A;  3N9O A;  1IKP A;  1H30 A;  4M0H A;  3DEM A;  3CDZ B;  3GBG A;  4DO0 A;  2OYZ A;  2D40 A;  3KF3 A;  4JHT A;  3VD3 A;  1LOC A;  1JOD A;  1L7Q A;  1QGL A;  4PDW C;  4RR3 C;  4YM2 A;  3JU9 A;  4B7E A;  4BOW A;  3K75 B;  5K8S A;  5BPX A;  3WV6 A;  3N9Q A;  3O1V A;  1J83 A;  1BBT 1;  2WR9 A;  1VBC 3;  1W90 A;  1UZV A;  1RUF 3;  3JD7 2;  5F1R A;  5I8S A;  3QLQ A;  4HZF A;  4A41 A;  1U0A A;  3CJX A;  5A3L A;  1ODM A;  2QQP A;  1Y43 B;  3KV9 A;  4N43 B;  4YGE A;  2Q1F A;  2MEV 3;  1FOD 1;  1RL3 A;  4LEJ A;  5FZI A;  4CU8 A;  4Z1V A;  3WF4 A;  1J1T A;  3N9P A;  4GXL A;  5KXD A;  2IXH A;  4LKD A;  3ILF A;  1FMD 2;  4FPK A;  4BME A;  2FMY A;  5DAP A;  1EY2 A;  1ZZ7 A;  2BNO A;  2ENR A;  1CAX A;  5J98 B;  4X6Q B;  2Q0A A;  2VVE A;  3U75 A;  4QPI A;  2QCS B;  3CQO A;  3HMY A;  3U07 A;  4OI2 A;  3BAL A;  1AL2 2;  1REF A;  1UWW A;  3NL1 A;  1JS9 A;  1DFQ A;  2H0B A;  4GWI A;  4OUE A;  3U78 A;  2AUY A;  4DZG A;  2G9G A;  1EPW A;  1D2S A;  2VTF A;  2WT2 A;  3INA A;  5A3P A;  3LSE A;  2XJR A;  3ASI A;  3OJB A;  2IC1 A;  2HWB 1;  2QQM A;  3OGV A;  4JGZ C;  3UJQ A;  3WLU A;  4BCU A;  3THP A;  4LBK A;  2OUJ A;  4HOO A;  5T5J A;  4GB3 1;  1NLR A;  3WF2 A;  4QHZ A;  5JLV A;  1I5Z A;  1H6Y A;  4U2A A;  2BBA A;  3CL1 A;  4QQ2 A;  5FRA A;  2B8M A;  1CVN A;  4XXA A;  2XB6 C;  4DUV A;  2YPJ A;  5DZG A;  3WG1 A;  2R16 A;  3H50 A;  1TME 1;  2BVV A;  3AMM A;  4ES9 A;  1O8S A;  1UPS A;  1G7Y A;  5DUW A;  1SQ4 A;  5T3N A;  3LD8 A;  2XML A;  2YUE A;  1UY0 A;  1NCR C;  1XXN A;  1RUJ 2;  4IEZ A;  3W59 A;  1I6X A;  3AFG A;  3I8T A;  3ON7 A;  4JKK A;  1EUT A;  1GP4 A;  4CCK A;  4K21 A;  1YWK A;  2ZKL A;  1UXZ A;  1VRH 1;  1W6M A;  1YLL A;  5SV5 A;  3B00 A;  3HQX A;  4CSW A;  3O1M A;  3HQU A;  4IES A;  3LAG A;  2KM2 A;  1ASJ 3;  1LHN A;  1OSG A;  2Y8K A;  4QDS A;  2JDM A;  2ZGO A;  1DP0 A;  4IGO A;  2GC0 A;  4D6R A;  1LRH A;  5FZ9 A;  1RIN A;  3KT7 A;  4FOV A;  4UW3 A;  2VZU A;  1JBC A;  4XQD A;  5FZF A;  2YB7 A;  1O7F A;  2Q8C A;  1QOO A;  1US2 A;  2BRT A;  3BCW A;  2HJI A;  2C9K A;  4W6Y A;  3ZXG A;  4EV0 A;  1VBC 2;  3OGS A;  1K42 A;  5HXM A;  3B9C A;  1PO1 3;  1RUF 2;  2VM9 A;  1X8M A;  1PVC 3;  2FDK A;  4W8J A;  1CZS A;  1F4A A;  1SBF A;  1CAW A;  2WSU A;  4CDX C;  5BNP C;  4GA9 A;  1DG6 A;  1HQN A;  1OH4 A;  2DU1 A;  2QQV A;  2XUE A;  4DUX A;  1GNZ A;  3IAQ A;  2MEV 2;  2ZEX A;  4R8H A;  2HWD 3;  1H2L A;  2ZTN A;  3GF6 A;  2A70 A;  4CDU A;  5L7O C;  2BWC A;  3BU7 A;  4BLI A;  3G6J B;  1GV9 A;  2XQX A;  5FUN A;  2A5Z A;  1OF3 A;  1PNF A;  3O14 A;  4P9Y A;  5FMB A;  1IS3 A;  4HG6 B;  4BIF A;  3T2Q A;  1YO8 A;  3UES A;  1S0G A;  5JXG A;  4CPB A;  3PU8 A;  1JMU B;  4HVR A;  5T52 A;  3S5A A;  3AP4 A;  1X50 A;  1MS3 A;  3HBZ A;  4S2H A;  4XJ8 A;  3QAC A;  4CXW A;  1BMV 2;  1SCS A;  2AH2 A;  3JCI A;  3U0Z A;  2C6S A;  3N7M A;  1FPN 3;  2R0H A;  1QHD A;  3N4M A;  1AYN 3;  1DGL A;  4LBO A;  4Y5Z 0;  1HW5 A;  3RYP A;  4HET A;  3EQE A;  2YY1 A;  4KWJ A;  3ACI A;  1UYZ A;  2AEY A;  4RS5 C;  5JXI A;  1GR3 A;  1K3I A;  1ND3 A;  1MZE A;  2A6V A;  3B02 A;  4NPL A;  3ZMO A;  4A6O A;  4CEW A;  1ENX A;  4MXW A;  3ES1 A;  3J8F 1;  1Q8V A;  5A1L A;  1XE7 A;  1V6J A;  3PME A;  5BNQ A;  2J22 A;  1MEC 3;  1NX9 A;  3OUI A;  1Y9Q A;  3W58 A;  5LWB A;  2JKX A;  3KD4 A;  1S0C A;  2JIG A;  4E4Z A;  2QVS B;  3AZZ A;  2OA2 A;  5F5C A;  3ZFE A;  1WCK A;  3I3Q A;  3MIB A;  3RZG A;  3SH5 A;  3BYW A;  1DHK B;  1UOF A;  4P9J A;  4Q4V 3;  3III A;  4QPI B;  3UKT A;  2XBO 3;  2FDH A;  4O9E A;  4QX1 A;  1A8D A;  4LNV A;  4WVZ A;  2JB8 A;  1L3J A;  1DDL A;  3K46 A;  4OHY A;  3O7O A;  3CZJ A;  4M3C A;  4AEM A;  1B35 A;  1VBB 2;  1VAV A;  4JKM A;  2ZXQ A;  2ZGR A;  4PT6 A;  4ZON A;  5K0U A;  4EJR A;  5E6H A;  1GUI A;  3I3D A;  3RWK X;  4F83 A;  1Z7S 1;  3R05 A;  3ABZ A;  3LPF A;  1MPX A;  4CP0 A;  5JXH A;  3DF0 A;  3VBO C;  3EYP A;  3PDQ A;  2W68 A;  3HT2 A;  1ZNP A;  1J3Q A;  5FCC A;  4QD2 A;  4PJY A;  2D6O X;  2YBK A;  3MV1 1;  3LEG A;  4LO8 A;  4Q2F A;  3N7K A;  1PO1 2;  5FZ0 A;  1PVC 2;  2WFF 3;  3H3Z A;  4JVA A;  4LTA A;  2O1Q A;  2NN8 A;  1GMM A;  5AC9 3;  1UKR A;  3O0V A;  1W8F A;  5FZD A;  1KJR A;  5LBB A;  2A75 A;  2WS9 2;  4ZU4 A;  2WZR 3;  2BGO A;  3NKT A;  1LEC A;  1EP0 A;  2VUJ A;  4CYD A;  2E32 A;  2W1Q A;  3BPS A;  4FXG B;  4IEO A;  5A3O A;  1LOA A;  1W6M B;  3GZT B;  4AHZ A;  1HB1 A;  3RZZ A;  4COY A;  4GJY A;  3AZW A;  2OXB A;  4AED A;  4CUG A;  4JQT A;  1R08 3;  3H8U A;  3UKN A;  3ZO0 B;  4LUM A;  3J9S A;  1MS9 A;  4RQP A;  4ZU7 A;  4HN0 A;  1IG0 A;  1WLT A;  5FZG A;  2BP6 A;  2W08 A;  1FPN 2;  2Y0I A;  2Y26 A;  3ZFF A;  1AYN 2;  3BN6 A;  2R07 1;  2VME A;  4FI9 A;  2JB4 A;  1B09 A;  2RM2 2;  2Y6J A;  2E26 A;  1CAW B;  5FMC A;  3K51 A;  3TNQ A;  1M06 G;  3GYD A;  4QQH A;  1W6Q A;  1C57 A;  4DQA A;  3KT1 A;  1SBD A;  4R9A A;  3S57 A;  4BJ0 A;  4CDU B;  2X53 S;  1MEC 2;  5FBZ A;  4KNC A;  1GZ9 A;  1R09 3;  3C7E A;  5JWP A;  3HBK A;  4ITC A;  3VHP A;  1N1V A;  1G9F A;  2HYX A;  4KMQ A;  1PGL 2;  1EUU A;  4LBN A;  4O9G A;  2XVK A;  5IWF A;  4ATE A;  1DLL A;  4Q4V 2;  5JMO A;  1UU4 A;  2XBO 2;  2BOI A;  4LBL A;  4YZ1 A;  2PQQ A;  5FLI A;  3IBM A;  1W3X A;  2P5B A;  3UGH A;  4LA2 A;  2PHT A;  1XU2 A;  4B4P A;  2N7G A;  5ACA 3;  3WW2 A;  2BJS A;  3RI9 A;  3T2P A;  4KU7 A;  2DUP A;  4WM8 A;  4K20 A;  3SMH A;  1XSQ A;  3ZYI B;  4E8D A;  4GZ9 A;  3H0O A;  1O59 A;  3PLQ A;  4RFT 0;  1ND3 B;  2D5H A;  2WQ8 A;  2Q1Z B;  3GHN A;  3UNP A;  2GNT A;  4QKB A;  2W1U A;  3C7G A;  5FZE A;  1AR6 3;  4PIY A;  2NP0 A;  4P00 B;  1AVB A;  1QIQ A;  3CIH A;  1GKB A;  2VZV A;  4QM9 A;  5FXW A;  4Z92 B;  1LKN A;  1VBA 3;  5AC9 2;  4WVM A;  3VBR B;  4LPL A;  3ACF A;  3M2M A;  1DZQ A;  5IK4 A;  3VBH B;  4AFD A;  5G05 L;  3VDB A;  1I1E A;  1HV0 A;  2QE3 A;  3FJS A;  2GSY A;  2RMU 3;  3IIA A;  2WZR 2;  2XH6 A;  4UOJ A;  4A4A A;  1VJ2 A;  2G4I A;  4LQR A;  5I8Y A;  3M3C A;  2BGC A;  4CP1 A;  2K0G A;  1W8T A;  5JVV A;  2BU9 A;  5K0U B;  1JYT A;  5CFC A;  4GMP 1;  5DUU A;  2WAA A;  4EN8 B;  3FE5 A;  2JWP A;  2WNV A;  4RSU A;  2WNU B;  4LBM A;  2PAM A;  4CDW B;  1HB2 A;  1WBF A;  4DIQ A;  1R08 2;  2D6P A;  2VPV A;  5LA0 A;  1TMF 1;  1C8N A;  1OOP A;  5LCW L;  1U5Y A;  2WA3 A;  2WO1 A;  3X29 B;  3KQ4 B;  4LIV A;  4MOA A;  1W06 A;  1PGS A;  1RUI 1;  4Y20 A;  3WY6 A;  5FV3 A;  1PMH X;  4UWD A;  4URT A;  1UOJ A;  3D4K A;  3GZU C;  3V0A A;  1ZBA 3;  2ET7 A;  3NV2 A;  5C9A A;  2F6B A;  5DMY A;  3WEZ A;  5LK7 B;  2BZD A;  3KV5 A;  1QXP A;  5H9S A;  3HIF A;  3OB8 A;  1WLC A;  2A6Y A;  3MW3 A;  2WJS A;  1HB4 A;  3PJY A;  5DAB A;  1SMV A;  1D0H A;  4YW3 A;  1RTV A;  4HSJ A;  5CIS A;  2QQJ A;  2TEP A;  4TLG A;  3IMN A;  5EIY B;  2VEC A;  3VN4 A;  3A22 A;  3IDC B;  3KSC A;  2D93 A;  3AMH A;  4AVV A;  2XGX A;  1J1L A;  4M3C E;  3WR0 A;  2PHU A;  5JUV A;  5FJK A;  2XKO A;  1N1Y A;  2VCM A;  1AR8 3;  1XC6 A;  1HXS 2;  4UT5 A;  1DCS A;  1TE1 B;  2Q5T A;  4XF1 A;  5ACA 2;  3HNM A;  2AEZ A;  5FYC A;  2OQ6 A;  5FY9 A;  1Q5O A;  5T54 A;  2D98 A;  2X29 A;  3HT1 A;  5C3O A;  3HD8 B;  5HBA A;  5GKA C;  4UFL A;  5CFD A;  4AYU A;  1BKZ A;  2PTM A;  4Y5T A;  4N53 A;  3VBS B;  2XVL A;  2WO7 A;  1QJY 3;  2QTW B;  2BBV A;  3FHA A;  2QUO A;  2W3J A;  4A7K A;  3AXD A;  3E97 A;  4R4Z A;  4YWA A;  2RR1 1;  2GME A;  3WXP A;  2OQ7 A;  3AP9 A;  3AXE A;  4OHX A;  3L2Y A;  3E5X A;  1HIX A;  3A7Q A;  3MIG A;  4M00 A;  4HXC A;  5E8A A;  2ADE A;  1OFN A;  1Y9G A;  1ZZ9 A;  3VBF B;  2Y64 A;  3ME2 A;  2UYA A;  4DRR A;  3MUY 1;  4WBB A;  1BXH A;  4HK8 A;  3H9A A;  2HWE 1;  1OFS A;  1EYB A;  4CZS A;  1NE4 A;  4CCN A;  5IK5 A;  5KHK A;  2DF7 A;  2OS2 A;  1ZA4 A;  3SLI A;  4NMI A;  1SZB A;  5FK7 A;  2FCT A;  4D94 A;  4YW6 A;  4ZXE A;  2WT0 A;  4DFS A;  3PVE A;  4LO6 B;  5DUX A;  3ZKU A;  1RYY A;  1ZBA 2;  4NWV A;  4WVW A;  5C70 A;  1UYP A;  1LB2 A;  1V00 A;  1PNG A;  5A6Z A;  4TZD A;  1AXZ A;  3VBO A;  1XOY A;  1HRV 3;  5T50 A;  4DPN A;  3AJY A;  2MNG A;  1YC6 1;  4EWA A;  5A33 B;  2OT7 A;  4C0B A;  1K5M A;  4IEV A;  4QM8 A;  1LTE A;  4NRO A;  2Y6G A;  2ARX A;  5FZM A;  4CCL A;  1ENS A;  1RED A;  1VMJ A;  5CFC B;  5IVF A;  3E6D A;  5ERL A;  4ASM B;  1OUX A;  1YQ5 A;  2JG9 B;  4H2A A;  4JC1 A;  1TG7 A;  4P02 B;  5D2A A;  5FIX A;  2ETE A;  2ZAC A;  4QB6 A;  1GQP A;  3OY8 A;  3MGU A;  4QXH A;  1ZA7 A;  1WBL A;  1G9A A;  2WAO A;  3JD7 1;  3CNA A;  4QX7 A;  3CLP A;  2XXZ A;  3KMH A;  3SEP A;  5DPN A;  4XTM A;  4XW3 A;  1JZ2 A;  2IFW A;  3P6B A;  5A80 A;  2HLE A;  1GNY A;  2HEW F;  1Q8Q A;  2PA7 A;  3PVN A;  2FDG A;  1SLI A;  2A3W A;  5FP9 A;  2P6H A;  4DEV A;  1COV 3;  1RMU 3;  4NRQ A;  4FQ4 A;  1FMD 1;  5BNN A;  4PI2 A;  3N35 A;  2VUL A;  4IV1 B;  1IHM A;  1W8Z A;  4XBQ A;  1QJY 2;  2VXR A;  1C3H A;  3CHX A;  2JG8 B;  2W39 A;  3QCW A;  5EJZ B;  5ANQ A;  4AEK A;  4HSL A;  1AL2 1;  4K8F A;  4XAC A;  3E6C C;  1NLS A;  1Y7B A;  2YC0 A;  3JBG 2;  4CCM A;  2VR4 A;  1NA1 A;  4JTO A;  1APN A;  4F3J A;  1EV1 3;  2HWC 1;  3P5B A;  5J09 A;  1QJU 3;  1UD1 A;  2PN5 A;  4DY5 A;  4P5H A;  2ZX2 A;  2F17 A;  4GAZ A;  1W8U A;  2A71 A;  4QPI C;  1VE0 A;  4HFS A;  1Q43 A;  4OZO A;  4TN7 A;  4YGB A;  5FYU A;  3BKZ A;  3WSO A;  1PIV 3;  3GZA A;  4AI8 A;  1L7L A;  5CNA A;  1SFY A;  4URA A;  3WF3 A;  1WW6 A;  2DBI A;  5CFD B;  3AM2 A;  1XE0 A;  1D4M 2;  2HKX A;  3LDK A;  5FP7 A;  5IVY A;  4A7Z A;  1GZW A;  4CDQ A;  5B2G B;  1RUJ 1;  3POI A;  1W99 A;  2VC9 A;  3T1M A;  4ASL A;  3I2F A;  3AYE A;  1H2M A;  2GN7 A;  4E4S A;  2LTN A;  5FPL A;  2ZGL A;  2UYB A;  3FLT A;  5FZ1 A;  3O1O A;  5H9Q A;  1DQ1 A;  1X82 A;  3UKV A;  1KFU L;  1GWK A;  1ULF A;  2WZE A;  4CRQ A;  4COW A;  1REE A;  4N9H A;  4OQ8 A;  3VKL A;  4YW4 A;  3P3N A;  2X10 A;  4ZKT B;  2ZZQ A;  5JSP A;  4IE4 A;  2EXI A;  2BUK A;  3PVO A;  1OT5 A;  3Q8F A;  2NZ9 A;  1CAV A;  3ACH A;  4LO4 B;  4XFB A;  1UXX X;  3W20 A;  4AAP A;  1E5S A;  1VBC 1;  4AGV A;  2P3I A;  1A34 A;  1Y3T A;  1S0J A;  1RUF 1;  4QX8 A;  4ATF A;  3WNL A;  3OPW A;  4IGP A;  3K48 A;  4BPZ A;  5IK8 A;  2OW4 A;  1YNA A;  4MX3 A;  2C26 A;  4OFG A;  2RS5 3;  5EWS A;  3ZPO A;  4J6G A;  5C3Q A;  2PHF A;  2VY0 A;  5KXC A;  2FD8 A;  1KIT A;  1SLL A;  1BLZ A;  2MEV 1;  5A6Y A;  5CZK A;  2E7T A;  1WW5 A;  3LIH A;  4PQQ A;  1MS5 A;  3SCG A;  3BGA A;  5JZG A;  4GAL A;  5FY4 A;  3V0B B;  1W6P A;  3LWC A;  2ZX3 A;  4XUN A;  1BJQ A;  1RMU 2;  2X8K A;  4XUP A;  3VZL A;  3VZM A;  1AXK A;  1MQT A;  1QJZ A;  2BNM A;  2ORX A;  2CY6 A;  5F3E A;  4TLF A;  3WW3 A;  1JZ6 A;  5CG9 A;  3I2K A;  2IFR A;  3J4U H;  5FZ4 A;  1JYV A;  4MET A;  2Q8E A;  1TNR A;  2A6Z A;  1WMF A;  2EAL A;  2G1M A;  4PBO A;  1A8M A;  1BMV 1;  3AVR A;  5FWE A;  1V6M A;  1ULC A;  4DY3 A;  4CDU C;  3T0A A;  2QKD A;  3OY8 B;  3LE0 A;  2RS3 3;  1NZI A;  4LO5 B;  3OBA A;  5FBJ A;  3T2T A;  2VMI A;  3W9A A;  4J1W A;  5F6K A;  1QJU 2;  1ENR A;  1N1T A;  4TWT A;  1OHF A;  1NCQ B;  2XUM A;  2BPA 2;  2NM1 A;  1RUI 2;  1J84 A;  4N43 A;  4KGQ A;  4GQ7 A;  4MZU A;  4RGG A;  4NHL A;  3FLR A;  1PIV 2;  2HH9 A;  5FUP A;  1LOE A;  1OPO A;  2GC2 A;  2JDZ A;  2EXJ A;  1UY1 A;  2ZKN A;  2GP3 A;  4AVS A;  1ZBE 3;  1RUC 3;  5BNN B;  1Y9M A;  3D8C A;  3IDB B;  4WVV A;  3TB0 A;  2E6V A;  3KV4 A;  4BDV B;  4CPB D;  3OTF A;  2WA4 A;  2OII A;  3HNY M;  1YFY A;  2PLV 2;  4MXV A;  4CEW C;  1ND3 C;  5G04 L;  2AC1 A;  5F37 A;  2VAU A;  2DTW A;  2C5D A;  4MO3 M;  3LEI A;  3W21 A;  3SKV A;  1NA1 B;  1R1Z A;  1MAC A;  1LEM A;  2VXJ A;  5FZ8 A;  2JKB A;  1WLW A;  3ZFE C;  4I09 A;  1SBE A;  1SCR A;  4PLO A;  4XET A;  4CUC A;  4LE3 A;  3WF1 A;  5FXZ A;  1DQ4 A;  4FPO B;  1YFU A;  5C8C B;  4RHV 3;  1K12 A;  1OQD A;  1UY4 A;  3ZSM A;  4UXA A;  1CR7 A;  1WUV A;  2PAK A;  1GNH A;  2XKP A;  4WZC A;  5CG8 A;  4GD4 A;  5K0U C;  3DV8 A;  1PO1 1;  4LUK A;  1PVC 1;  3VZN A;  4FFG A;  2B5H A;  4JQR A;  3VHO A;  1J58 A;  1UQX A;  2RS5 2;  5FOB B;  2WS9 1;  2YGL A;  1XNT A;  2D6N A;  4XDO A;  4LIU A;  4QKF A;  1W9S A;  4R4X A;  1CPM A;  3BTY A;  3QOP A;  2WO3 A;  1OQ1 A;  4NPR A;  1W8W A;  1YQ8 A;  5FY7 A;  3I97 A;  1RUG 3;  2VCA A;  2DV9 A;  2ZEZ A;  2HWF 3;  3THT A;  2J7M A;  3WHT A;  3PUS A;  1UYX A;  1HKD A;  4Q4W 3;  2XPJ A;  5JOY A;  5FPB A;  4A3Z A;  5IVV A;  1QKQ A;  1X9P A;  1G9D A;  1N47 A;  3FUQ A;  5HI0 A;  5HXV A;  1BVP 1;  1FPN 1;  1CAV B;  4QU2 A;  1AYN 1;  3ILN A;  5DZE A;  5BXX A;  3RPQ A;  2RS3 2;  2XJU A;  4JRA A;  3L2H A;  5H9P A;  1SAC A;  2ET1 A;  4WV8 A;  3ZR6 A;  4OLL A;  2TBV A;  2E7A A;  2OKX A;  1NUK A;  4AED C;  1ZYB A;  4BQ4 A;  4AVA A;  2A6X A;  5CYY A;  4AI3 A;  3WT3 A;  4XUO A;  1C5I A;  4CCJ A;  4RQP C;  1UZZ A;  4NRM A;  2A3X A;  5F9T A;  1MEC 1;  1UU5 A;  1KS5 A;  1W6P B;  1PZ9 A;  3AZX A;  2YBP A;  3POF A;  1EPZ A;  1ULE A;  2XQR A;  5A7O A;  4MAD A;  3R4U A;  3ZFF C;  1ZBE 2;  1RUC 2;  1RJ8 A;  2CU5 A;  4BHP A;  3KHC A;  1S2B A;  4Q0P A;  1PGL 1;  2XLG A;  5J37 A;  4AVC A;  1RUD 3;  4F7Z A;  3EB7 A;  4Q4V 1;  2VBP A;  1N3Q A;  2XBO 1;  1UKG A;  4HPK B;  2Y38 A;  2K46 A;  3VDD B;  2V5Y A;  1DGR N;  3PTY A;  3UT0 A;  5LY1 A;  1V6K A;  1IQA A;  1ZZ6 A;  3VBS C;  4HBN A;  3KQR A;  4ZU5 A;  1CWP A;  2XJT A;  5FZA A;  1KFX L;  1IKQ A;  1OA2 A;  3I2I A;  4N7I A;  4BK5 A;  4EZ4 A;  4FTB A;  3HR9 A;  2IXI A;  3OG2 A;  4AW7 A;  1WLD A;  2C0Z A;  5C7G A;  1GWM A;  2DVA A;  3H8R A;  3AP7 A;  2R06 2;  4Y4Y A;  5FJH A;  3SH4 A;  1JYI A;  2VVD A;  3OF1 A;  5F39 A;  1HJG A;  5IVE A;  4MUV A;  1C1L A;  5FK8 A;  2VTX A;  4GWM A;  2WFF 1;  1EAH 3;  3J26 N;  2GMM A;  1POV 0;  2RS1 3;  5LA2 A;  5AC9 1;  4XIL A;  3ZYJ B;  3GJA A;  4MGT A;  1RUH 3;  1JOP A;  3QH7 A;  4WM8 C;  3THD A;  5B4N A;  1IZ3 A;  2WZR 1;  4YM3 A;  5L36 A;  1AR9 2;  3WVJ A;  5JIA A;  3WQ0 A;  4UW4 A;  4FPH A;  3ZN5 A;  5EFU A;  2ZX4 A;  2VUA A;  1RUG 2;  3PMS A;  5DAX A;  1F8V A;  4PQ9 A;  3GXU A;  4QKN A;  4QPW A;  4BA6 A;  2HWF 2;  1AR7 3;  2Y6L A;  3ZYF A;  3JXS A;  5FPA A;  5A7Q A;  1IPK A;  1CX4 A;  1QNY A;  2GC3 A;  3IWZ A;  2HWC 2;  1R08 1;  2R7E B;  1V0A A;  1UIK A;  3V64 A;  3D5O A;  5IAV A;  1YHF A;  1ZVF A;  2E9Q A;  4NII A;  1W2U A;  5EYY A;  4KI5 M;  2PYT A;  3NV3 A;  1GWL A;  5CFC C;  1O4Z A;  1I3H A;  4YNI A;  1CIW A;  3KHB A;  5F3C A;  1T6G C;  2UWB A;  2WNV C;  5D21 A;  1OC1 A;  1QH7 A;  1WGP A;  2VTX J;  5JPN B;  4CXY A;  2DCY A;  2EIC A;  1OUS A;  3DPR B;  1OOP C;  3SQO A;  1W0P A;  4FPF A;  4IEP A;  5C3R A;  3KWV A;  2D6K A;  2EIE A;  3IN9 A;  4EN7 B;  1R09 1;  4AHY A;  1LNS A;  2FCU A;  3CBN A;  4DOU A;  4SLI A;  1LHW A;  3ORJ A;  4AI9 A;  3O1S A;  5IAX A;  1G8W A;  1XPW A;  5C9A C;  1RUD 2;  4YW1 A;  1PMI A;  1GBG A;  3MW4 A;  4E2G A;  2R0F A;  4M0N A;  5KBF A;  5IVJ A;  4AQS A;  1HXS 1;  4Y1Y A;  1CQ9 A;  2GAL A;  5IJR A;  5HV0 A;  1KRI A;  5ACA 1;  2W92 A;  4P9G A;  2WLQ A;  1W39 A;  5M0T A;  4QKD A;  3UV9 A;  3I4I A;  3NNL A;  4PI0 A;  2YZ4 A;  3AYC A;  1I5P A;  5CVR A;  4AQT A;  1GP5 A;  2DVG A;  5FLJ A;  1GSL A;  2ORZ A;  5JCT A;  1OLM E;  1V9U 3;  2VCB A;  2V73 A;  4HLT A;  1NXD 1;  3MID A;  4XQ4 A;  5FUI A;  4FPY A;  2QQU A;  5GAL A;  4DUW A;  4AVT A;  3SKJ E;  3A4U A;  1DGW A;  4ZS2 A;  1EAH 2;  3J7M A;  2DCZ A;  1W2O A;  1KDM A;  2WAB A;  3NNJ A;  4Z8B A;  3ZSK A;  3WQ1 A;  3OSD A;  1RUH 2;  2QDR A;  4FSJ A;  3SIT A;  1T2X A;  2FZ1 A;  1PK6 B;  4DS0 A;  3WQB A;  1HRI 3;  5E88 A;  1ND2 B;  2IWG B;  2ZMK A;  3K4Z A;  4CCE A;  2IXJ A;  4H7L A;  2JDP A;  5CFD C;  3LGR A;  5JIU A;  1WW7 A;  2EXH A;  4N53 C;  5LEK A;  3VL9 A;  1JZ7 A;  2WN3 A;  1AR7 2;  3RYR A;  1TNF A;  3FMG A;  5JI9 A;  4OMD A;  2XOM A;  1YI9 A;  3I54 A;  1O5U A;  1VMH A;  2W46 A;  3C7H A;  3ZOI A;  5GLZ A;  4OMC A;  3TWI A;  4QXK A;  3AYD A;  4E4D X;  3TN9 3;  3U4X A;  1K45 A;  4CCO A;  2VUD A;  5GZG A;  1HV1 A;  1RC6 A;  2Y60 A;  1UNB A;  3AKT A;  2R32 A;  5CKM A;  1WD4 A;  4QGN A;  1MR5 A;  3HNB M;  4CUB A;  1NQD A;  1GP6 A;  3E5U A;  3JUU A;  4LLO A;  3U4S A;  5JR2 A;  1SFN A;  2WNE A;  1ZBA 1;  2RDN A;  2OZ6 A;  2AGS A;  1PO2 3;  3VBR A;  4ZZ5 A;  4YRD A;  4EWE A;  3VBH A;  3FL7 A;  5FWJ A;  1H6X A;  1NE6 A;  1RUN A;  4MG2 A;  1ULG A;  3T1L A;  3GCX A;  2QQK A;  2YYO A;  3NAP B;  5D8A B;  4AWD A;  1VP6 A;  3MF9 A;  1RXF A;  1ACC A;  1TZO A;  1XNC A;  2BFU L;  2UWC A;  3LFI A;  1F9K A;  1JI6 A;  1OBN A;  4E27 A;  2WN2 A;  2Y6F A;  5GLV A;  1S4C A;  1GOF A;  2WNU A;  4CDW A;  1URX A;  2AZ5 A;  1ASJ 2;  2XL7 A;  4X8N A;  1RXG A;  2I74 A;  5FYM A;  3WP4 A;  1IGO A;  2P34 A;  1H4G A;  4QQL A;  1MS1 A;  1YQ6 A;  1AR8 1;  1K5M C;  1GOH A;  3ZXL A;  4BIS A;  3POY A;  3I59 A;  1OVP A;  2VNO A;  2RVA A;  3GAL A;  1FAT A;  2A3Y A;  4LHS A;  4A42 A;  4EN0 A;  3WCR A;  3DYP A;  1POQ A;  3D3A A;  5IVC A;  3ZYH A;  1D4V B;  1LU2 A;  4YVS B;  1V9U 2;  4IV3 A;  2D44 A;  2VOV A;  2WZ8 A;  2DYC A;  3ITQ A;  2W94 A;  4LE4 A;  2HWD 2;  5KHI A;  4AZZ A;  3EO6 A;  1QJY 1;  4B3N A;  2YG0 A;  4XE9 A;  5LAT A;  1LHV A;  4G4F A;  5AVA A;  3IKW A;  3MW2 A;  3BOP A;  1J3R A;  4XXP A;  5F5Q A;  5BV6 A;  3DUI A;  5JI7 A;  4A45 A;  4JAA A;  2Y0O A;  1MVQ A;  3JBG 1;  4XUQ A;  3LA7 A;  2R1D A;  2VZ1 A;  3N7L A;  1HRI 2;  2HEV F;  3NJZ A;  4C1X A;  1LGN A;  2VUC A;  4LKF A;  5D1I A;  3OEA A;  4HKL A;  4J1X A;  3MFC A;  5BNN C;  4FFI A;  3UET A;  4MH0 E;  2V5D A;  2ZX0 A;  5FKC A;  3GJB A;  4GMP 0;  3TOJ A;  3RZJ A;  2JEN A;  3VBU A;  4XJA A;  2EIG A;  4GUL A;  3TN9 2;  3RZM A;  4P08 A;  2JX9 A;  2D5F A;  1W9Y A;  1YJK A;  5GLW A;  1NA1 C;  1GOG A;  4AFA A;  4DRV A;  2RJ2 A;  3O5S A;  4RN5 A;  4AFM A;  1KD7 A;  3QD6 A;  3MV0 1;  1UOG A;  5A3M A;  1D4M 1;  1MZ6 A;  2G9Z A;  4QPG B;  3VBS A;  5BYN A;  1ALY A;  4QQO A;  5FZC A;  5I8T A;  4ARX A;  5L73 A;  1PO2 2;  2O8Q A;  3B9I A;  4JRL A;  5EZW A;  1LES A;  2NPI A;  1BK0 A;  2DCJ A;  4ET7 A;  5A3T A;  3GM8 A;  2QQL A;  4KWU A;  4LBQ B;  5J7M A;  4PLN A;  1F5J A;  5EXO A;  3E1F 1;  1TME 3;  4N8M A;  5DXD A;  1H8T B;  4N7U A;  1AHS A;  2WZP P;  3VB9 A;  3KF5 A;  1IG3 A;  4S2F A;  4CDQ C;  5FO9 B;  2WYS A;  3VBF A;  4KH9 A;  1UZ0 A;  4MGQ A;  4AK3 A;  1W9F A;  1DZR A;  1AYM 3;  1XYN A;  5JSO A;  1N1S A;  1PX3 A;  2J1V A;  2VZO A;  3FWE A;  4QB2 A;  2AR6 A;  1VRH 3;  3AMQ A;  1C5H A;  1QQP 3;  4QGM A;  4I0B A;  1FV3 A;  1MS4 A;  4LOT A;  2VZ3 A;  2EVX A;  5DDJ 3;  4LXL A;  2VOX A;  4XHB A;  2HBT A;  5F2W A;  5KHJ A;  2WFF 2;  4ZPI A;  5FY1 A;  5EJ3 A;  3ZPY A;  2CWS A;  2P3K A;  1JTZ X;  4DEQ A;  2XHK A;  2D97 A;  4CA9 A;  1COV 1;  2PHD A;  1RMU 1;  4KL1 A;  4LMF A;  4D7T A;  2CWM A;  2VZP A;  5A33 A;  4O61 A;  4YZ3 A;  3LQC A;  1POV 3;  4PIX A;  5A32 A;  1AF9 A;  2RDS A;  2XLF A;  3OGR A;  3WNX A;  2P3Y A;  2JG9 A;  5CAZ A;  4NHX A;  1W3V A;  5JZG C;  1QJF A;  4MGY E;  4NRP A;  5DZF A;  4QX2 A;  2KA3 A;  1CIY A;  3MI8 A;  3RRD A;  1RVF 3;  1MQT C;  2ERF A;  1LGC A;  1QJU 1;  3VHN A;  5ABJ B;  1O4T A;  2ZMN A;  1E5R A;  2ZML A;  5C33 A;  3I59 B;  2YFZ A;  4KGG A;  2LS6 A;  3CMG A;  4DMI A;  2WII B;  2E53 A;  5A3N A;  3TEW A;  3ZXD A;  1UIJ A;  1PIV 1;  3FBY A;  4LHK A;  4H14 A;  3AL6 A;  1W0N A;  3PUI A;  4IV3 B;  2FBE A;  4NOT A;  3AKP A;  3RSJ A;  2Q4S A;  3PUR A;  4I0A A;  4NN0 A;  3ZFG B;  1AXY A;  2NLR A;  5LBC A;  3WW1 A;  4IV1 A;  3M3Q A;  4XAE A;  3WCS A;  1R09 2;  3B7M A;  4NID A;  2JG8 A;  2PLV 1;  3D0J A;  2DVD A;  1OI6 A;  3FC0 A;  4N43 C;  5KC5 A;  1RJ7 A;  5FMO S;  3F95 A;  1DF0 A;  2ZAB A;  3T08 A;  1ULD A;  4OUL A;  2P37 A;  5JOZ A;  1X33 A;  1LEN A;  4I3P A;  5A6X A;  2R1B A;  4HVQ A;  4NE9 A;  4A3X A;  3DXU A;  4R52 A;  5IAT A;  2OPK A;  2YU2 A;  3VBU B;  2KD7 A;  3AP6 A;  5C3S A;  5A1F A;  4PLM A;  3M7A A;  4Y26 A;  2WBK A;  2SLI A;  4R9C A;  2PXJ A;  4P9L A;  1QQP 2;  2PHX A;  4IE5 A;  4W4Z A;  1W6O A;  2QQN A;  2ZAH A;  3KCX A;  2FCV A;  4LKS A;  1OKO A;  4NHM A;  4PCR A;  1AR6 2;  2ILM A;  2RS5 1;  4OYU A;  4CEY B;  1Z7S 3;  1W8O A;  1KGY A;  3EXU A;  3WNN A;  2BNN A;  4COV A;  1VBA 2;  3MLK A;  3O12 A;  1CON A;  5C5U A;  2H6C A;  2DBN A;  4Q1R A;  3BU0 A;  3OUH A;  1JH5 A;  3KV6 A;  3VUO A;  2RMU 2;  3I2O A;  1UCX A;  5C8W A;  2EAK A;  1L7R A;  1FI2 A;  2YFU A;  1UY3 A;  4NWW A;  2IXL A;  1YIF A;  3OYW A;  4U36 A;  2JE7 A;  3DPR C;  5FZO B;  2PHW A;  4RR3 B;  2ZGQ A;  5FPX A;  4G9S B;  3H1W A;  3LZZ A;  2BDR A;  2RS3 1;  3R6S A;  4BQ1 A;  4LUL A;  4RGK A;  4Y33 A;  3EHK A;  1RVF 2;  4IDZ A;  3VL8 A;  2R30 A;  3WNK A;  3C3V A;  1PMJ X;  1HDK A;  1ZRF A;  3AMP A;  3BTX A;  1LOF A;  5FYY A;  3I49 A;  3IB3 A;  1ZRE A;  4XF4 A;  1UX6 A;  4FT8 A;  3OEB A;  3D82 A;  1Q8O A;  4TSV A;  3V0B A;  3FZ3 A;  5IFT A;  3ETP A;  2ZGS A;  1MS8 A;  1E57 A;  3CF6 E;  4BM8 A;  3KGL A;  5BUV A;  2W87 A;  1ZBE 1;  1RUC 1;  1E5I A;  4FCA A;  4Y5S A;  5LBE A;  4EZH A;  5A32 B;  5IT6 A;  1JYX A;  3UGG A;  2Y34 A;  4E9K A;  1IS5 A;  3I3M A;  1JUH A;  3QH6 A;  4LA3 A;  3OUJ A;  3TAY A;  5T5P A;  2WQZ C;  1XU1 A;  1RIT A;  1CZV A;  1HN0 A;  2QZ2 A;  3CO2 A;  4QQP A;  2ZJC A;  2D43 A;  3DKW A;  4ARY A;  4HVO A;  1LHO A;  3OPT A;  5LAS A;  1CZT A;  4UFK A;  1JHN A;  3GCW A;  3N7J A;  3ZMN A;  3ZKY A;  4LO7 A;  1AR8 2;  4JGZ B;  5F2S A;  4OHZ A;  2HYK A;  5AVP A;  1NCQ A;  3IPV B;  4L9B A;  1LED A;  5FRE A;  1QU0 A;  2R06 1;  3LKJ A;  4FOY A;  4AGR A;  1MS0 A;  1ND2 C;  3OD4 A;  4JGY A;  1Z78 A;  4Q0U A;  2EF6 A;  3HWJ A;  5FXX A;  5LA1 A;  4HON A;  4X8P A;  3MYX A;  1FNZ A;  1BK1 A;  1D2Q A;  3K2O A;  2YDE A;  2GP5 A;  3ENR A;  2VL4 A;  3M70 A;  4K40 A;  2VNG A;  1U5Z A;  4YVW A;  1UL9 A;  4M4R A;  2JIC A;  1XNA A;  4DXS A;  4YAR A;  2UUR A;  3CJI A;  1AR9 1;  1NCR B;  2B46 X;  3HN3 A;  3MDP A;  4FBF A;  3T2O A;  4Q0Q A;  4QDQ A;  4I0W B;  4Y4R A;  1RUG 1;  4UFI A;  3J7L A;  4L11 A;  2AEN A;  5DAW A;  2VBB A;  4H55 A;  2HWF 1;  3HOB A;  3WOG A;  1H2K A;  4BE3 A;  5KHG A;  1LUL A;  5EYX A;  3A0N A;  3WG4 A;  4IE0 A;  2X5I A;  4QDR A;  1I9R A;  3U10 A;  3V65 A;  3FLP A;  2RJK A;  5APA A;  3O1U A;  1XRU A;  4BQY A;  3E6B A;  3MLL A;  5D8A C;  3QBQ A;  2ZCW A;  5C8C A;  1TVG A;  3KB5 A;  2VOT A;  3MBW A;  1DZT A;  1SLC A;  1S1A A;  3B69 A;  4FPC A;  1JZ4 A;  1FNY A;  3KS7 A;  2XLA A;  1ENQ A;  1W6O B;  3M8L A;  4IL7 A;  2XJQ A;  4DXZ A;  2QZ3 A;  5BNP B;  4KBB A;  2LRP A;  1C28 A;  4S2G A;  4HKW A;  2HEY F;  1GQG A;  1TMF 3;  2A7A A;  2DFC A;  1F31 A;  4HK9 A;  3ZLI A;  4B8E A;  2YV8 A;  2G9F A;  3V56 A;  1OA3 A;  1HRV 2;  4YSF A;  3THC A;  2RHP A;  3ZYP A;  2Z2S B;  3J7H A;  4ZZ8 A;  3DL3 A;  2ZHM A;  5JMC A;  2W0X A;  4D6S A;  2V4V A;  5IW0 A;  3BI3 A;  3ST7 A;  4MGI E;  1RUD 1;  4Q0V A;  2WWJ A;  4RD7 A;  5DAQ A;  1DBN A;  3DXT A;  2CDP A;  3OYW B;  4K1Y A;  1G9B A;  1SLA A;  1JU3 A;  2JDA A;  1XYP A;  3MEP A;  1LCL A;  4QPY A;  2EAA A;  2ZEY A;  1BHG A;  2IUW A;  4Z07 A;  1PZ8 A;  5SV8 A;  2E31 A;  3H8X A;  1UX7 A;  1YRZ A;  1AX1 A;  3AMN A;  4Q26 A;  4V1P A;  4H7M A;  3JQW A;  5GZD A;  1DQ5 A;  5LB6 A;  5FMD A;  2W52 A;  4XOG A;  4COZ A;  3WDT A;  3S6P A;  2CGN A;  1QJX 3;  3NMB A;  5A7W B;  1UMZ A;  3F2Z A;  5IUQ A;  3MFA A;  5CBL A;  4AE2 A;  2WWU A;  4XBN A;  1EAH 1;  1COV 2;  3PL0 A;  4LLF A;  4NUB A;  3WG2 A;  1A78 A;  2ZZJ A;  1AJK A;  1RUH 1;  5DAV A;  4Q5O A;  1QDO A;  2BFU S;  2JDK A;  2YHJ A;  5J36 A;  1BQP A;  4HPK A;  5K4L A;  3T4H B;  4XAA A;  5JXJ A;  3VDD A;  3AJZ A;  1AR7 1;  4FP2 A;  3RQ0 A;  1WCD J;  3I2D A;  1EV1 2;  2E33 A;  3G7D A;  4Q8K A;  2LW8 A;  4QMA A;  5LRS A;  2JDH A;  2YC2 A;  4N90 A;  2WWS A;  4TYS A;  5JOW A;  5DG1 A;  3DYM A;  5E16 A;  4UW6 A;  5A7S A;  3B5L B;  4P9W A;  1GFF 2;  4Y1Z A;  1OPM A;  3AC0 A;  4JGY B;  4MLO A;  4XVH A;  1H8T C;  4W65 A;  3RMX A;  1IQD C;  4HL0 A;  3T30 A;  5BNO A;  3I2J A;  3ZSL A;  3TRS B;  1R64 A;  2Q30 A;  2FDF A;  3IAP A;  4YVW B;  3RJ2 X;  3RVH A;  3JZV A;  4EN6 B;  4LBQ D;  3CJI B;  1QY4 A;  3ZN6 A;  1JW6 A;  5FPV A;  1S0B A;  4AI2 A;  4OZX A;  5FFO C;  1STM A;  3POE A;  5F5I A;  3DYO A;  1V6L A;  4YW2 A;  1BEV 3;  4LOS A;  5FYB A;  4AFB A;  1XNB A;  2ZHL A;  4IER A;  2F4L A;  1JYN A;  3VD9 A;  1WA4 A;  1GZT A;  4GWN A;  4IE6 A;  4LK7 A;  5EPA A;  2IVI B;  3VBR C;  1ASJ 1;  2X5I B;  3BTA A;  4Q4X 3;  1HLC A;  2OZJ A;  2EA7 A;  2VOK A;  4KWL A;  3VBH C;  1RUO A;  1UY2 A;  4NVP A;  1KDK A;  4IET A;  1FYU A;  2XVG A;  5CIR A;  3K77 A;  4MGZ E;  3PVB B;  4QGL A;  3WP6 A;  3T0B A;  4F8A A;  1VBE 3;  2IXK A;  1OLM A;  2FDJ A;  5EQU A;  1RIR A;  4XBL A;  1AL0 G;  3DKQ A;  4D69 A;  4XPV A;  5KXE A;  5CU1 A;  1IOA A;  2WLP A;  4L99 A;  3ZXE A;  2DFB A;  4Z2A A;  4FFF A;  1DLC A;  4I2O A;  2WNU C;  2TNF A;  2J1E A;  4CDW C;  1FX5 A;  1YYN A;  1V9U 1;  1JOB A;  1WMD A;  2A1X A;  2C9A A;  1WCS A;  3ELN A;  5LK5 A;  2GZW A;  3APB A;  1QJX 2;  2YC4 A;  3DPR A;  2HWD 1;  3MIC A;  2UY9 A;  1O3S A;  1FAY A;  5J96 B;  1LOD A;  1NLQ A;  2D6M A;  2P17 A;  3DCQ A;  1NXM A;  4K9S A;  4EN9 B;  5CKQ A;  4IEU A;  3MIE A;  3AK0 A;  5FMO L;  2VO5 A;  4P5Y A;  4Y1V A;  4BQ5 A;  5FY0 A;  2VU9 A;  3B01 A;  3NV4 A;  3KGZ A;  5A7N A;  2WRA A;  4XQW A;  3VZO A;  1HRI 1;  2VMC A;  3WW4 A;  3OGG A;  2RG4 A;  4IV3 C;  4UBH A;  4BIO A;  3TEX A;  5C5T A;  2ARA A;  4D0Q A;  3D6E A;  4GWJ A;  4R9D A;  4BXF A;  4YLZ A;  1O3T A;  1FMD 3;  3USS A;  4FPL A;  5HCH A;  2Z42 A;  5GLT A;  1H2N A;  1JHJ A;  4MGK E;  1RB8 G;  1ULP A;  1FV2 A;  1GAN A;  1UYY A;  2LRO A;  5LW9 A;  3TN9 1;  1VBD 3;  3H7Y A;  3ZN4 A;  4I30 A;  1ODN A;  1NY7 2;  4D7Y A;  2GNB A;  4QAW A;  5E1R A;  4CTE A;  2GNM A;  3CEW A;  2ZGU A;  1UN1 A;  1PGW 2;  4CUA A;  3ZXA C;  2GDF A;  1G6N A;  1HQW A;  4E4H A;  1GLH A;  2JEM A;  3H1Y A;  1PO2 1;  4JDM A;  5J1X A;  2VQA A;  2KR2 A;  2YMZ A;  2XJS A;  3VBU C;  5F6L B;  1YI7 A;  1CAU B;  3LOI A;  5GZF A;  1O91 A;  1PK6 A;  1R1A 3;  1VMF A;  1ND2 A;  1S0D A;  2ZS6 B;  3PJQ A;  3S5Q A;  5GJ6 A;  2ARB A;  3AZV A;  4D7S A;  4QX5 A;  1UMI A;  1BEV 2;  1DGW X;  5FYS A;  4RL7 A;  5HCF A;  5IHR A;  5I0S A;  4WM7 A;  2BYV E;  4XEZ A;  1O3R A;  4IND A;  5FQ0 B;  3RG0 A;  1RGS A;  1YFX A;  4Q4X 2;  4XTP A;  5LBF A;  4N9I A;  3P3P A;  3ZYB A;  1H9P A;  3VLB B;  1KQR A;  2BQP A;  3R4S A;  3H3U A;  4XFI A;  5F3G A;  1QMJ A;  1W2T A;  4M01 A;  4RHV 2;  3HQR A;  1VBE 2;  5FP8 A;  4IQP A;  5BNO B;  2W1W A;  1KEX A;  2BVB A;  1AUY A;  1OQE A;  2D7F A;  2I07 B;  2RV9 A;  2WIN B;  2XR4 A;  3AFK A;  3DEC A;  4XDP A;  3VBF C;  2LM3 A;  4FXK B;  1VRB A;  4W50 A;  4M3C F;  2CHH A;  2JJ6 A;  2R04 3;  3NV1 A;  4FAG A;  1OLQ A;  3VDA A;  2WDB A;  2EID A;  4PHZ A;  3ZN6 B;  3NAP A;  5D8A A;  1C4R A;  3WQ7 A;  4CE8 A;  3WG3 A;  1X8E A;  4NAO A;  5EHD A;  1A6C A;  1DQ2 A;  4XAB A;  3BTZ A;  4EYU A;  1WD3 A;  1GYK A;  3N9N A;  3A0K A;  4KBZ A;  2H0V A;  4KWK A;  1MVE A;  4Q4W 2;  4Y1X A;  4FP3 A;  3U14 A;  2CAV A;  3IZO A;  4FPJ A;  1SFP A;  1X36 A;  4FO9 A;  4UFJ A;  2D3S A;  2J1A A;  1Z0H A;  4HT1 T;  2XG3 A;  5LZ6 A;  2NYY A;  2GC1 A;  2GMP A;  2J1S A;  1W04 A;  4GH4 A;  4MHU A;  4FPG A;  3SNM A;  2VQU A;  5C4W B;  3M3O A;  5K7P A;  5J48 A;  3MF6 A;  4DXR A;  2JG9 C;  2O8O A;  1DYO A;  4XF0 A;  3VD7 A;  1QNW A;  2FDI A;  1VBD 2;  2G19 A;  3SEE A;  2B42 B;  4YVS A;  2I45 A;  4BU2 A;  4Z2W A;  2ID4 A;  4ES8 A;  4OI0 A;  4AL9 A;  3LEM A;  3RNS A;  2JXA A;  3BUC A;  5FLH A;  1H1M A;  1Y4W A;  3NVC A;  4OHV A;  2B7Y A;  2PEL A;  3RJR A;  2VMF A;  2Z5W A;  3S0M A;  3MUZ 1;  3POW A;  3KCY A;  4A6S A;  3LIG A;  4DB5 A;  3VKN A;  2W91 A;  1R1A 2;  3KCC A;  3UGF A;  3ZR5 A;  4Y1U A;  4BQX A;  1HQL A;  4CCC A;  4XJU A;  1AZD A;  4AEJ A;  3M4F A;  2CL2 A;  3WDU A;  4DIN B;  4CU7 A;  1JZ5 A;  2GN3 A;  3B93 A;  2B9V A;  2W95 A;  3ZSJ A;  4IV1 C;  4ISQ A;  2P4E A;  1CD3 G;  5FZ3 A;  3H3L A;  2XL9 A;  1W8H A;  4P14 A;  1AYM 1;  2JG8 C;  2VMH A;  4L0P A;  4QX0 A;  3URF A;  4AXO A;  4JCK A;  3RZL A;  1PM4 A;  1UZW A;  2NMO A;  4CU9 A;  3K3N A;  3LDR A;  4XJW A;  1OH3 A;  3MPP G;  1BVV A;  1SPP B;  2VCC A;  1QQP 1;  1VBB 3;  2DCT A;  2C1F A;  4IEX A;  4YG6 A;  3U11 A;  3SCF A;  1AR6 1;  5K9Y A;  5DDJ 1;  3WZ1 A;  4MYE A;  4UF0 B;  1ZX5 A;  2J42 A;  4PIZ A;  4QPG A;  4D8M A;  4C1W A;  5JSR A;  1LR5 A;  1VBA 1;  2JDN A;  4G3Y C;  2RS1 2;  2GH8 A;  1RHI 3;  2VVF A;  3SCH A;  3POB A;  2R04 2;  2J1U A;  2DWR A;  2RMU 1;  2VNV A;  2AAC A;  2Z79 A;  3ES4 A;  4YPJ A;  2D6L X;  3IM0 A;  4LBQ A;  4ZHN A;  1VIW B;  5KWR A;  1VB4 A;  4JDO A;  1POV 1;  4OI4 A;  2ADD A;  2V09 A;  1H8T A;  1XJA A;  3FFQ A;  1UU6 A;  3LA3 A;  4BXS V;  3IDA A;  3S7E A;  4IUG A;  4C91 A;  3T0D A;  3H8O A;  4Q0S A;  4TTG A;  4IXL A;  4W6W A;  3WDX A;  4YFZ A;  2WS9 3;  4WM7 B;  1KJL A;  3NO8 A;  5CB7 A;  2ZEW A;  2C24 A;  3FHI B;  4XCB A;  1LU1 A;  4NIG A;  4Q4Y 3;  1RVF 1;  3KVB A;  2Y6K A;  5IYY A;  1O6U A;  1T6B X;  1TEI A;  2V72 A;  1VR3 A;  2A73 B;  4JTN A;  2JEC A;  1C8M 3;  3U1X A;  2QBX A;  3LA2 A;  4RYD A;  5I0U A;  4OVE A;  4LR4 A;  3OCP A;  5E89 A;  4LHL A;  3I2G A;  4FOW A;  4XUR A;  1JN2 P;  2VH9 A;  2VW2 A;  5JOX A;  4PF5 A;  3ZYG A;  2ZGT A;  2WO2 A;  3NNG A;  4YZ4 A;  2GAU A;  1S2K A;  5L9B A;  4ZS3 A;  3AZY A;  3RFR A;  2RM2 3;  5FKB A;  2DVF A;  4D6Q A;  5FZK A;  1LOF C;  3OPZ A;  1W03 A;  3ZYR A;  4HKO A;  5GZE A;  1YCI A;  4XFH A;  2AYH A;  2J1T A;  5JDB A;  4IGQ A;  1AX2 A;  5HCB A;  3MLJ A;  3NQH A;  1RUE 3;  4GH4 B;  1D7P M;  5L9R A;  4KQ7 A;  2QQW A;  3WX5 A;  4A2U A;  5ABJ A;  2ZAA A;  4XFC A;  3UYJ A;  1CAX B;  5F7U A;  2Z4F A;  4QX3 A;  3A23 A;  1O8P A;  1ULO A;  3A21 A;  4BB3 A;  1W0O A;  4OI1 A;  4AHW A;  3WNP A;  2FMD A;  4YG3 A;  3FFZ A;  5KC6 A;  4K8R B;  1N3P A;  5KHH A;  4XC9 A;  5FTT C;  1BBT 3;  1QH6 A;  2ZX1 A;  3ZFG A;  3MZH A;  2PFW A;  3FBM A;  5LEJ A;  5C71 A;  4GJZ A;  2XJV A;  2YBS A;  1HB3 A;  1NCQ C;  3N9L A;  4XFG A;  1N3O A;  2VQ0 A;  4CCD A;  4D3W A;  1RHI 2;  5FOJ B;  4XZU G;  4JGY C;  1U12 A;  2FHR A;  2BER A;  1XND A;  1FOD 3;  1WMX A;  5EJ1 B;  3FX3 A;  4XMA A;  5ANN A;  3SC7 X;  4ERO A;  5L9V A;  5J3U A;  2K9Z A;  1ONA A;  4LHN A;  5ISL A;  3VKF C;  5FZH A;  2DU0 A;  1ZRR A;  2E63 A;  3P1I A;  3R4D B;  4QT6 A;  4W6X A;  4XIK A;  4YVW C;  1KS4 A;  3LSD A;  2YGM A;  3TYJ A;  3O0W A;  3CJI C;  1G9C A;  3WHU A;  5T55 A;  1YFW A;  1VLN A;  4O65 A;  4Y22 A;  5BY5 A;  4OUM A;  4XYX A;  3C7O A;  3GZE A;  4Q4Y 2;  1W9T A;  3M3E A;  1W05 A;  4PBP A;  1DQ0 A;  2ZGK A;  3ILR A;  5IK7 A;  3WIN E;  3EBR A;  2CTV A;  5I0T A;  1C8M 2;  2X5I C;  3FUO A;  4CEY A;  5IFP A;  2HWB 3;  1US3 A;  4AOC A;  3ZIX A;  4CP9 A;  3RS6 A;  2NQY A;  4IEY A;  3M3I A;  4JDN A;  1PZ7 A;  2VNR A;  2SBA A;  4AR2 A;  4GB3 3;  5C8C C;  3UL2 A;  1H1I A;  4P9X A;  2Q1M A;  1HRV 1;  4L2N A;  4XF9 A;  2NMN A;  1LAJ A;  4UW5 A;  1G86 A;  1SHW B;  2LAL A;  3BOW A;  2ZGM A;  1QXJ A;  2V4A A;  3CKH A;  4ISR A;  5F32 A;  3BVC A;  2A6W A;  3T4V A;  1FT9 A;  4LBJ A;  1Q56 A;  1X7N A;  4E2S A;  5FZO A;  1WKY A;  4P9I A;  4PDW A;  4RR3 A;  2DUQ A;  4XDQ A;  2IXC A;  3GBW A;  4Y3O A;  5IVB A;  3ZXJ A;  1F35 A;  1WME A;  2VW0 A;  1OUR A;  1JYC A;  1RUE 2;  2XHN A;  5HPO A;  3M1H A;  2DDU A;  2JE8 A;  4EWD A;  3HJR A;  2O0O A;  3LEK A;  4IEW A;  4CP2 A;  2VZQ A;  2MPF A;  3ZX7 A;  2LUW A;  5CKN A;  1S0E A;  1U5X A;  2QNK A;  1LHU A;  2CDO A;  1Q8S A;  2BOJ A;  3I3E A;  1JZ3 A;  5FP3 A;  2W47 A;  1HXS 3;  3T3Y A;  4UYB A;  4NIH A;  1BBT 2;  2P3J A;  3POJ A;  1UF2 C;  1W9W A;  5HCA A;  5I0D A;  1UO9 A;  2PQS A;  2RDR A;  2VZT A;  4AGG A;  4A7Y A;  4XCA A;  2DUO A;  3SIS A;  2YPD A;  4L92 A;  1OD5 A;  3GHM A;  1QEX A;  3PUA A;  4AHX A;  4L8Q A;  4CEW B;  4SBV A;  4EE2 A;  5FZB A;  3I2H A;  3PUH A;  4MXW B;  3SXW A;  3VGI A;  1FOD 2;  4OCT A;  1NYW A;  2VJX A;  1OD3 A;  4RFR B;  4CVU A;  5FDB A;  1QWR A;  4COU A;  2WSV A;  1EV1 1;  1WZX A;  1WWY A;  3IDE A;  4IW3 A;  5FXV A;  2E51 A;  3VD4 A;  4YYO A;  1KXG A;  3SHR A;  3ZFE B;  4JGZ A;  2PHL A;  5F5A A;  5FR3 A;  5FPZ A;  3IPV A;  1FXZ A;  4YG0 A;  4AI0 A;  3O1R A;  3IMM A;  2ZOE B;  3C8X A;  1M4W A;  3VDD C;  5B4X A;  1LOB A;  4H3W A;  3RWN A;  3UJO A;  4M3C B;  4I3G A;  3GNE A;  1B35 B;  2RJL A;  1S0I A;  4S2D A;  2B45 X;  3VD5 A;  3ZXF A;  2HWB 2;  3VZK A;  2IVJ A;  1NCR A;  1GQH A;  2JD9 A;  4BQW A;  4GB3 2;  4YZ5 A;  3VV1 A;  2PMW B;  1ZZB A;  2XON A;  1DGR A;  2KXL A;  5JPM B;  3ZVX A;  5BNO C;  3Q8C A;  2RE9 A;  3J8F 3;  3LPG A;  2OVU A;  4Q1P A;  4K1Z A;  5LY2 A;  4AFC A;  1F2N A;  4JHZ A;  2ZBJ A;  3SH3 A;  4OUS A;  1TME 2;  1XB9 A;  1UW8 A;  2CNA A;  1JXN A;  4QXB A;  2UY8 A;  5DUV A;  4YGC A;  5A70 A;  4QHO A;  4GIQ A;  1PVX A;  4B4Q A;  1AYM 2;  4Y22 B;  1WCU A;  4IE7 A;  4NHY A;  1H9W A;  3OBR A;  3BOD A;  4FVV A;  5EP9 A;  3GGL A;  2OX0 A;  3DGT A;  1VRH 2;  1WCQ A;  3I3B A;  4LK6 A;  3AYA A;  4XHX A;  5GM0 A;  1TQ5 A;  1SDD B;  5A1A A;  1V6O A;  3Q8E A;  4J25 A;  3BB6 A;  4AED B;  1YJL A;  4UFH A;  5DDJ 2;  4YM0 A;  2X05 A;  3S7I A;  4C0H A;  3ALQ A;  4CDX A;  5BNP A;  2D3P A;  2MHF A;  4QB1 A;  4AG4 A;  1QJX 1;  4ASK A;  4CP9 B;  1LGB A;  2PAE A;  3TEY A;  5FY5 A;  2YU1 A;  4RQP B;  5I93 A;  3ACG A;  3NW4 A;  5L7O A;  1NOV A;  3NST A;  3ROU A;  3NNF A;  4O7X A;  3EJK A;  3ZFF B;  4NAM A;  5DN2 A;  5C4W C;  1JUI A;  3TNP B;  1IS4 A;  1XSR A;  1GU3 A;  4QWN A;  3T09 A;  1DYK A;  5LA9 A;  1VAK A;  5AFE A;  3LF7 A;  5KR7 A;  2WQ4 A;  2P6C A;  5F8P A;  1W28 A;  4Q27 A;  1W6Q B;  2JDU A;  3MIF A;  4PDW B;  4QHB A;  2CAU A;  3B3Q E;  3D0S A;  2VOW A;  3WP3 A;  4CU6 A;  1X9T A;  4NJ4 A;  3VDC A;  1W6N A;  5EV7 A;  1YQC A;  1W2N A;  2ARC A;  3EMR A;  1OA4 A;  3WF0 A;  5FAX A;  4PF1 A;  3PUQ A;  2QQO A;  4FAH A;  4DXT A;  2J1R A;  4Y24 A;  3JBG 3;  4RS5 A;  3AP5 A;  5FZ6 A;  2BW8 A;  4XZP A;  4AVB A;  2ARE A;  1CES A;  5TSW A;  3LFM A;  3E5Q A;  1NY7 1;  3NJY A;  4MGS A;  5I0R A;  5A7W A;  3LCP A;  2QDN A;  3J7N A;  1OLR A;  2F4P A;  5C3P A;  1PGW 1;  1XBF A;  4BQ3 A;  5CEH A;  5LRR A;  2GU9 A;  2CYF A;  2R07 3;  3K3O A;  3RYK A;  2VZR A;  2VMD A;  4YM1 A;  3O1P A;  4E8C A;  4LJH A;  3C7F A;  4WM8 B;  4AAX A;  2XWB B;  4BH9 A;  4E2Q A;  2Z69 A;  1CPN A;  1AX0 A;  3O0X A;  2Q8O A;  3ZM8 A;  1HJF A;  2PHR A;  2ZPX A;  3MO4 A;  3U37 A;  3J8F 2;  1BEV 1;  1D4M 3;  3RMY A;  4I01 A;  1YXW A;  3JQX A;  4CXX A; 
#chains in the Genus database with same CATH homology
 5FPL A;  5FYV A;  4AI9 A;  5FXV A;  5FUN A;  4IGQ A;  5FZ1 A;  2OQ7 A;  2VD7 A;  5IWF A;  3PUS A;  4LIT A;  5F5A A;  3PU8 A;  5FPB A;  3N9O A;  3UYJ A;  5IVV A;  3PU3 A;  4DO0 A;  5IVJ A;  2P5B A;  3DXU A;  2YU2 A;  5A1F A;  4AAP A;  3N9Q A;  5FP4 A;  2PXJ A;  5FYI A;  4BU2 A;  4QX8 A;  4CCN A;  3OPW A;  5A3W A;  4IGP A;  2OS2 A;  5A7P A;  4GJZ A;  2YBS A;  4CCJ A;  3N9L A;  3ZPO A;  5FZE A;  3ZLI A;  3KV9 A;  5A1L A;  5FZC A;  5FPU A;  5LY2 A;  5LWB A;  2YBP A;  5FZI A;  3KV6 A;  5FY4 A;  5FXW A;  5A7O A;  5FY0 A;  5A3T A;  3N9P A;  4D6S A;  5IW0 A;  4QXB A;  5A7N A;  3AVS A;  5F5C A;  5ISL A;  2WWJ A;  5FZH A;  5F3E A;  4C8D A;  2OT7 A;  3DXT A;  4BXF A;  5FZM A;  4CCL A;  5FZ4 A;  2Q8E A;  5FZ3 A;  5IVF A;  5FZO B;  3LDB A;  3AVR A;  5FWE A;  5LY1 A;  2OX0 A;  3KVA A;  3U78 A;  2W2I A;  5FZA A;  3K3N A;  5LW9 A;  4Y33 A;  4QU1 A;  5FZ7 A;  5E6H A;  4QXH A;  5FBJ A;  4V2W A;  4EZ4 A;  4DIQ A;  5A3P A;  4CCO A;  4QX7 A;  3PDQ A;  4UF0 B;  5FYY A;  4ASK A;  5FJH A;  2XXZ A;  4HOO A;  2YU1 A;  5FYH A;  5FY5 A;  4LXL A;  4LIV A;  5A7W B;  5F39 A;  5IVE A;  5F2W A;  2WWU A;  5FYT A;  5FY1 A;  5FV3 A;  2YBK A;  3U4S A;  4E4H A;  5A80 A;  5FUP A;  4QWN A;  5FZ0 A;  4NUB A;  4QXC A;  5FWJ A;  2GP3 A;  5FP9 A;  5KR7 A;  5F32 A;  4EZH A;  3KV5 A;  5FZD A;  5F3I A;  3LD8 A;  3KV4 A;  5FZL A;  2Q8D A;  2XML A;  5K4L A;  5FZO A;  4CCK A;  5FYS A;  5F37 A;  5ANQ A;  4Y3O A;  5IVB A;  4GJY A;  3OPT A;  5FPA A;  5A7Q A;  4CCM A;  3PUQ A;  4CUG A;  5FZ8 A;  3KVB A;  5FYM A;  4CSW A;  5F2S A;  5F3G A;  5FZ6 A;  5FYZ A;  5A7S A;  4UF0 A;  5FJK A;  4IGO A;  3N9M A;  5FP8 A;  3NJY A;  5FXZ A;  4BIS A;  5A7W A;  4D6R A;  5FZ9 A;  5FZG A;  4GAZ A;  4XDP A;  5FZF A;  5FXX A;  5A3N A;  4TN7 A;  4HON A;  5FY8 A;  5FYU A;  2Q8C A;  5FP3 A;  5CEH A;  4GD4 A;  5FYC A;  5F3C A;  3K2O A;  1VRB A;  3K3O A;  2OQ6 A;  3AL6 A;  5FY9 A;  5IVC A;  4URA A;  2GP5 A;  3RVH A;  4V2V A;  3PUR A;  3AL5 A;  2YPD A;  3PTR B;  4D6Q A;  5FP7 A;  4XDO A;  2XUE A;  3PUA A;  4LIU A;  5FPV A;  5FZK A;  5IVY A;  4Y4R A;  5FZB A;  4EYU A;  5F5I A;  5FY7 A;  2XDV A;  5FYB A;  3N9N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...