2JG8B

Crystallographic structure of human c1q globular heads complexed to phosphatidyl-serine
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
133
structure length
133
Chain Sequence
ATQKIAFSATRTINVPLRRDQTIRFDHVITNMNNNYEPRSGKFTCKVPGLYYFTYHASSRGNLCVNLMRGRERAQKVVTFCDYAYNTFQVTTGGMVLKLEQGENVFLQATDKNSLLGMEGANSIFSGFLLFPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Complement C1q subcomponent subunit A
publication title C1Q Binds Phosphatidylserine and Likely Acts as a Multiligand-Bridging Molecule in Apoptotic Cell Recognition.
pubmed doi rcsb
total genus 29
structure length 133
sequence length 133
chains with identical sequence E
ec nomenclature
pdb deposition date 2007-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00386 C1q C1q domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2jg8B00
3B93A 4KG8A 1U5ZA 2JG8A 4QPYA 5BNQA 1XU1A 2X29A 1RJ8A 3B94A 1DU3D 1KD7A 2R6QA 3FC0A 1S55A 1C28A 3V56A 2R30A 1GR3A 1ALYA 2ZPXA 4KGGA 1C3HA 4GIQA 1DG6A 1PK6C 2WNUA 2RJLA 2WNUC 3MI8A 3LKJA 1JH5A 4KGQA 2JG8C 1D0GA 5L36A 1OSGA 4MXWB 4QQOA 2QE3A 2OIIA 1TNFA 3AB0A 4TWTA 2RJKA 4MSVA 3TYJA 5KC5A 2QDNA 2AZ5A 4QQ2A 2ZJCA 1D4VB 2JG9B 2O0OA 2HEWF 4OULA 1XU2A 4DOUA 3WD5A 5HBAA 1O91A 2JG9A 2Q1MA 5KWRA 2TNFA 4G3YC 3QD6A 3B9IA 1RJ7A 2WNVB 4RSUA 4E4SA 1TNRA 2E7AA 2WNVA 3URFA 3K48A 1JTZX 4MXVA 4QQHA 3K51A 1PK6B 4N90A 1U5XA 1I9RA 4MXWA 4NN0A 2Q8OA 4HT1T 5TSWA 5KC6A 1WCKA 1IQAA 3ME2A 2TUNA 4QQPA 1A8MA 5L19A 3TWIA 4F3JA 4J6GA 4D7YA 4OUSA 2HEVF 2JG9C 3IT8A 1U5YA 4OUMA 2KA3A 4QQLA 4E4DX 1KXGA 2R32A 2RE9A 2Z5WA 4EN0A 3ALQA 4DB5A 3QBQA 1OQDA 3L9JT 4TSVA 2WNVC 5CIRA 2HEYF 1OQEA 1D2QA 4G4FA 2WNUB 1PK6A 2JG8B
chains in the Genus database with same CATH superfamily
3LDRA 3U4SA 2OUJA 4EQVA 4IV3B 5CVRA 3KHCA 4P08A 3I3BA 4MYEA 1EUUA 2BV4A 4LITA 3W5NA 4WM7B 4UW3A 2IXCA 5FY9A 2X5IB 4Q4V1 5BNPA 1RUF2 1WZXA 5IVVA 1QNYA 1GP5A 4CDXB 1MS5A 1W2NA 3HBZA 4Y1ZA 2GMMA 2QQWA 2VAUA 4XBQA 4NO4A 2WO2A 1JOPA 4IGPA 2G9GA 3A23A 2XKOA 2AYHA 1OLRA 2W3JA 4P00B 1ZBA3 1WCQA 3AFKA 3QCWA 2FZ1A 2B45X 1WCSA 2I07B 2VCMA 4TLFA 4UFJA 4FTBA 4PQ9A 1JW6A 2XUMA 4DMIA 4QKFA 4AEKA 4BQ3A 1HB3A 3NNLA 4ZKTB 5I0RA 5IVEA 1JUIA 5A6QA 3ABZA 4RFT0 4K1YA 3N4MA 4UW5A 3CQOA 3VZNA 2ZXQA 4XF1A 2DDUA 2DVGA 3N7LA 3T0AA 1Y3TA 3ZSKA 2WWJA 2Y6KA 3NNMA 4CP9B 1ZZ9A 3B5LB 2BYVE 4Q4W2 1MVQA 4QMAA 4W6WA 1KS4A 4OHWA 3MFCA 1PIV3 1VBD1 3SLIA 3AP9A 1JU3A 4MGIE 1UN1A 2R073 3IBMA 1CAVB 2VOXA 3MHZA 4CCDA 1BMV2 2W95A 4OMCA 2QTWB 2BNNA 5L7OA 2WT1A 2EIDA 2MEV2 4AL9A 4YW6A 1PO13 2XKPA 4N43A 4XF4A 5FBJA 1O8SA 4YVSB 1SBEA 2W5FA 4O9EA 4JGZA 3OUHA 2VCBA 2B9VA 3QOPA 5D1IA 3H3ZA 3O0XA 1M06G 2N7GA 4MLOA 2LROA 4WV8A 1HJFA 2WINB 4CU8A 1PMJX 3PDQA 1H2MA 1I3HA 4Q29A 4RR3A 4UFKA 3VZKA 5IVJA 4P14A 4M4PA 5F5AA 4MGZE 3MF9A 3OBTA 4QM9A 2GNDA 3I2GA 2CGPA 3I2OA 2HYKA 2LALA 5FY7A 3ZYRA 5IWFA 1DGWX 4DPNA 4JAAA 4QWNA 2XHKA 4QPIC 4Q4V2 3WLUA 4DUWA 1EUTA 2A75A 4K20A 3POEA 4DUVA 1QH7A 5EHDA 1PZ7A 3SH4A 4ZXEA 1JYIA 3RZHA 3ES1A 1UKRA 3B01A 4BPZA 2WWUA 1V9U1 1IQDC 5DZFA 4URTA 1FNYA 4QQLA 3O1SA 2ZA9A 1DZRA 2VXRA 2RE9A 4NHLA 1MS0A 3RRDA 3LE0A 4YVSA 5FMCA 4RS5A 2AGSA 2WO7A 2NN8A 4AQSA 4EN0A 1ZRDA 4TZDA 4E27A 4XOGA 4QX8A 2WSUA 2BRTA 2HWC1 4IETA 5FMDA 2QQMA 1A8DA 2Y6LA 4GWIA 1CAUB 2IUWA 4RHV2 4Y5SA 4A41A 1RVF1 1JMUB 5IFTA 1VRH1 5EP9A 3ZYGA 1RHI3 2R16A 4D6RA 5FO9B 2ZMNA 2FHRA 4YGDA 2CHHA 3I2DA 1JHJA 4AGRA 2DVBA 4A7ZA 5AC93 2R063 2VGDA 2WYFA 3TN93 3U07A 1XNBA 1JZ3A 4KQ7A 1NCQB 4BQ1A 4IERA 4QPYA 1S0IA 1W6QA 1VBD2 3D82A 3CF6E 3K4DA 1OA4A 3LOIA 4HVRA 1N1SA 3RWKX 1LOGA 1RJ8A 3RWNA 4BHPA 2VXJA 2FCVA 1DGRA 3RI9A 4EN6B 5JDBA 3NW4A 1KQRA 5C33A 4YGCA 2EVXA 2R0FA 3LAGA 1GZCA 3IN9A 1L7QA 2CDOA 4CZSA 1CAWB 2RG4A 1RMU3 2QBXA 1POV1 4CCNA 1WLDA 3DECA 2DUPA 2GN3A 1YUDA 2HWF1 4FPFA 5C4WC 4O65A 5FIXA 5LRRA 3FUQA 3FMGA 1TZOA 2P2KA 4GJZA 2VM9A 3AKQA 3W5MA 2W1QA 4UAPA 3BTZA 2LUWA 1PVC1 5FY4A 3S7IA 5J1XA 2OKXA 5JR2A 4IDZA 4JHTA 1REDA 2J1EA 2XDVA 2GNBA 5JVVA 1ZRCA 2VUJA 3AXDA 2MHFA 1HXS1 1AYM3 2CY6A 1GFF2 4JX0A 3FZ3A 3W58A 1WW5A 2D3PA 2C9AA 1R1ZA 1VALA 2D6MA 4Q4X3 4EWDA 2HWC2 2F17A 3HT2A 1JYNA 1Y4WA 1CAWA 4LE4A 3ZYIB 2VTFA 3MDPA 4NWVA 1VRH2 1GANA 1YQCA 1JZ7A 1VBA1 3ZFGB 1O4YA 2AC1A 1ZA4A 4G9SB 3BVCA 3RYRA 5F9TA 3P3NA 3R4DB 2RV9A 1H1MA 2W52A 4RGKA 3VDDA 3VKFC 3ZKUA 4KWKA 4QX0A 3A4UA 4N90A 3U78A 1YQ2A 4GMP1 2XLFA 5KBFA 1CN1A 1W9FA 2YU2A 5FP3A 4YVWB 1S0GA 1W2UA 4HKWA 3VBRC 1G7YA 4ASMB 3NJYA 4BIFA 1B35C 2Y38A 4ZZ5A 2ET7A 5JI7A 1UD1A 5EFUA 5JXJA 3ZN5A 3EBRA 4JHZA 1J58A 3PUSA 2FMDA 5KXDA 1AX0A 3OEAA 4D7YA 2Y6JA 2QQVA 4OUSA 5FXVA 3FLPA 3HQUA 1OUXA 2RJ2A 3VLBB 3FN9A 2R32A 3RNSA 3VBUB 1MS3A 3WY6A 2MPFA 4CTEA 2ZHKA 3WSOA 3WG4A 3ZPOA 2AENA 1W8WA 5D8AB 2JE8A 3L9JT 4JQTA 1UYXA 3WNKA 4HKLA 1K5MB 2B5HA 3ZFGA 4BQ2A 5L9BA 2CWMA 1W8TA 3JZVA 2BEOA 2A6YA 2EIBA 2HWF2 4XMIA 5CG8A 4OI2A 3RZMA 2WNUB 1PO23 4H3WA 3W20A 3APBA 1HN1A 5T5LA 1HN0A 2PHFA 4ZS2A 5FYHA 4LLFA 4HONA 4QAWA 3RI8A 2J1VA 2ZS6B 4CEYC 5A1LA 1WMFA 3H50A 2JEMA 3CIHA 4DO0A 2JDZA 2JG8A 1PVC2 2RMU1 3LDKA 2F6BA 1MS9A 1CQ9A 2E26A 4FOWA 1QOOA 2GMEA 2K2SA 3GZEA 3I3EA 4N7UA 3ECQA 5DN2A 2UWBA 1SLAA 2XR4A 5EWSA 3BU0A 1HXS2 3WW4A 3WX5A 1YFYA 4HSJA 1BJQA 1S55A 4QB1A 3VBUA 3TB0A 3MICA 5LEJA 2VUCA 5LEKA 1VBB1 3AL6A 1GR3A 2GAUA 3IKWA 3J7MA 3O1VA 1MZFA 4C91A 5D8AA 1XYPA 4KU8A 1EAH1 1K5MA 3ACLA 3J4UH 1BLZA 2P3JA 1DQ6A 1Z78A 2D44A 2WNUA 3CBNA 4FQ4A 4N53A 4XILA 2C5DA 2XUEA 1QJFA 1LTEA 1F9KA 2RDRA 2WS91 2EF6A 2R49A 4N9IA 3RJ2X 3IMMA 5CYYA 3ZIXA 1COV1 4CP0A 1LENA 4AFDA 3UNPA 3OYWA 1QJU1 2HWE3 4LO8A 5J09A 1FAYA 1GKBA 2UURA 2VOVA 1YFXA 2DVDA 3ILRA 3Q8BA 2ZABA 4BQ4A 3ZXEA 5K0UB 4XJ9A 4IEZA 4OHVA 2VO5A 3AP5A 3EJKA 2JG9B 2O0OA 2HEWF 2XBO3 4HK8A 3NNJA 3HQRA 3AYEA 1G9FA 3OOXA 3D6EA 3FX3A 3Q8AA 4AR2A 4CRQA 1JODA 5J7MA 1C1FA 1QHDA 1RUJ1 4QPGC 4XEZA 2WQ4A 5A32B 4OYUA 3WDWA 2W2IA 2YXSA 4AFMA 1HDKA 1RUH1 3D5OA 2XPJA 5ABJB 3JU9A 5FYZA 4L97A 3P1IA 4UI9L 3VBSB 4J1WA 2RM23 2NMOA 4Y1YA 4OI0A 1ZBA1 3LEMA 1UZVA 3SITA 1YC61 2V09A 5DMYA 5JWPA 1EPWA 2CL2A 3K48A 1LOFA 4IV1C 1UL9A 3RZJA 2VE1A 4M01A 1XXNA 3WF0A 1C57A 4AVCA 4YZ5A 5A80A 2W9XA 4D6QA 1VAKA 1DQ5A 4PCRA 5K0UA 1AR71 4D7SA 3I8TA 2JDAA 4IQPA 3ZXKA 2HEVF 5I0TA 2P1BA 2SLIA 2FCTA 3RJRA 3ZFFC 1JZ2A 1F35A 3K75B 2BU9A 4Q27A 1WD4A 3ZYBA 4E8DA 2VTXJ 4UFLA 4GALA 3ALQA 1EAH2 3PJYA 4DQAA 3DPRA 1DDLA 1JZ6A 1YQ8A 2EALA 3VBSA 3DF0A 3NVCA 1GYKA 1LU1A 3OGJA 1REEA 2RS11 4R9DA 5FZDA 4CSWA 2EXIA 4F83A 2BUKA 5FY1A 1W8UA 4LHKA 3RZKA 1KS5A 3EQEA 2VR4A 4COUA 4Y24A 4KI5M 3LA3A 2RS53 1NZCA 3G7DA 5FP9A 4JQRA 3LF7A 3VDAA 5FZMA 1COV2 3WP5A 1QJU2 2XLGA 2ZX1A 2P3IA 4AK3A 3MZHA 1CAXB 2VW2A 1UMHA 3NNGA 4E9KA 1VIWB 1ST8A 1D0HA 3LEIA 3V0AB 4XQWA 2BDRA 1XU1A 5EXOA 3C7EA 3F95A 2NQYA 2QZ3A 4AE2A 5DUVA 2VZTA 3OTFA 4IE6A 4J1XA 4B4QA 2RS33 4AHWA 1FV3A 4WVWA 1VJ2A 1ALYA 3HIFA 3Q8FA 4K8FA 5IVYA 2R043 2OUHA 4KNCA 4DINB 1CWPA 1ULPA 5F6LB 3SMHA 5C7GA 1K3IA 1ZBA2 1DG6A 2B9UA 3HNBM 4XYXA 2ZMLA 1HLCA 2DBIA 3VD9A 2J1UA 2Q1ZB 5T50A 3LKJA 4LORA 2VUDA 5GALA 1JZ4A 1OSGA 1UYYA 4ISRA 2ZGQA 4LK7A 4IV3C 1F31A 5DDJ1 4FOYA 5LK5A 2G9FA 3S57A 1CAXA 2QE3A 2CU5A 2DWRA 1TNFA 1RHI1 4NHYA 2EXHA 3ELNA 3HR9A 2E33A 3GJBA 3MV11 4WM7C 4YPJA 4DFSA 1UYPA 2X5IC 5KC5A 5LRSA 1KITA 2C1FA 2VMCA 1PX4A 3WCSA 3GZUC 3T4VA 5AC91 1FNZA 2R061 3TN91 4CDXC 2W46A 5FZKA 2GDFA 1SPPB 1OUSA 3BUCA 2NMNA 1BEV1 1AR93 1J3PA 2GC3A 1JS9A 2VVEA 4Y1UA 4AWDA 3LIGA 4LHNA 1PIV2 4C0BA 1ND3C 5JSOA 3NKTA 2K9ZA 3BCWA 1VBE3 4AXOA 5F7UA 2HJIA 4NPMA 1HB4A 2YC0A 3IDBB 5I8TA 4KWLA 3B9CA 5FYTA 1VBC3 2EIGA 2RS12 3G6JB 3LZZA 2DU0A 4K1ZA 2VPVA 3IB3A 4AI3A 5BNNA 2ZGLA 2WNVB 5G05L 1DGRN 2D6PA 3ZFEC 3PTYA 1PVXA 4GKXA 4K7JA 3T2TA 5FZ7A 5KHGA 1QEXA 5JR7B 4CEWA 1W0PA 2ID4A 2ZHMA 2XJVA 5LATA 3E6CC 4NWWA 1H30A 3T0BA 3VBFC 1V70A 3ZLIA 5JI9A 1SHWB 5C8WA 4LBNA 4EZ4A 1CIWA 4DEQA 1WA4A 3N9OA 2CAUA 3WDXA 1YNAA 2CTVA 5L19A 1WW4A 4HN1A 4F3JA 1RUE3 5A7OA 2GH2A 3ETQA 3PMSA 1SPPA 2OQ7A 3CJXA 1ZBE3 4J6GA 4K9SA 3WF1A 4IXLA 1POV0 1I5ZA 3RZZA 3CEWA 5A3UA 4RQPA 1XNKA 3RVHA 3H3LA 4GZ9A 4X6RB 1REFA 1S0EA 3K2OA 4CXXA 2PHXA 3ACHA 2FDFA 2VBDA 4ES8A 1AHSA 1AF9A 1AYM1 1OURA 1O6UA 4YM2A 5T54A 2VMDA 1TME3 2ES3A 1DF0A 5A3OA 3WDYA 4Q4X1 2IVJA 3A22A 4HBNA 5AFEA 5LA1A 1UXXX 3D4KA 4XUPA 5LB6A 5FPUA 1ODNA 4AI8A 4OQ9A 1ONAA 5LCWL 1C5HA 3MIGA 4KG8A 1RHI2 5JCTA 5B4XA 3GZTB 2W0XA 1AL0G 1RL3A 4XJWA 4A6OA 3AZYA 2O8QA 1XB9A 5JSPA 2CAVA 2VZRA 4XDQA 4CCOA 1YQ6A 1ZA7A 3O1TA 5AC92 2R062 4YW5A 3TN92 1LOCA 1VMJA 1SDWA 3OUIA 4BMBA 2A3WA 4JGYA 3J8F1 4SBVA 5H9PA 3WV6A 4C0HA 3ON7A 1GLHA 2IFWA 4Y1VA 2AR6A 2WAOA 1RUG1 2ATFA 4XCAA 2XXZA 3W59A 4F7ZA 4C1WA 2PHTA 1UMZA 3X29B 3WXPA 3CU7A 1GU3A 1OKOA 2SBAA 3ZSJA 2Z4FA 1DP0A 1LECA 5KXCA 3EXUA 1X82A 3J7HA 3TRSB 1LESA 5JLVA 1PK6C 4NRPA 3VZOA 5IHRA 3E5XA 2QZ2A 1OT5A 3KB5A 4LA2A 4A7KA 5ERLA 3PMEA 4IE4A 3PVEA 4DUXA 4MADA 3ZYPA 3BTXA 3WNNA 2UU8A 4OI4A 3U10A 4M3CA 1W6MB 3H9AA 4COWA 1CZVA 1W0OA 2D98A 3QACA 4YGBA 5FCCA 3MW3A 1NCQC 4MSVA 5A7PA 3VKLA 3WOGA 2AEYA 3J7NA 3TYJA 5C3SA 2HWD1 3IPVB 1V6NA 3IAQA 4UXAA 2EA7A 3LEKA 4QQ2A 4P9JA 1SMVA 2EAKA 3VBOB 1OFNA 1OMIA 3IIAA 1XPWA 4RGAA 2JDPA 1XRUA 2DBNA 3RS6A 3CJIB 3NAPB 3T2PA 5HBAA 5FMBA 5FLIA 2GMPA 1GOHA 2Y26A 1WBLA 2VVFA 5FZOA 1AYM2 3RPQA 2GU9A 3VBHB 3ZXJA 1GZTA 4I0WB 4R8HA 4LBQB 4CDQC 4LTAA 2WFF1 4Q4X2 4A44A 4EE2A 1W8FA 2YBKA 1TE1B 1W0NA 2E7AA 1BZWA 5L9VA 5DAVA 1EPZA 1CX4A 1I9RA 1H8TB 2Q8OA 3WDVA 5HCHA 1IS3A 2GC2A 1U5IA 1LAJA 3LIHA 3IPVA 5FTTC 3R4UA 4HETA 3TEXA 4CYDA 2P6HA 4ONUA 2I45A 1RC6A 1W3XA 4LJHA 4S2GA 3VD3A 2JB4A 1OFSA 5LWBA 2O14A 5K4LA 1PHMA 1YWKA 4ZXKA 4C90A 1H6XA 5FBZA 3OPTA 2XBO1 5I93A 2BNOA 4NPRA 3SH3A 2XVLA 2WNOA 1OA3A 5A7WA 2JDKA 2P3YA 3KD4A 2PELA 3AMHA 3ZMNA 4AQ2A 4L92A 4J25A 3SH5A 1SEFA 2WIIB 4FXKB 3ZFGC 3HNYM 4QGMA 2BBVA 1UIKA 2HH9A 3KCXA 3KQRA 1KFXL 5ACA3 4E2GA 1QJZA 5M0TA 1Z7S3 2ERFA 3KHBA 4Q4W1 5FWEA 2RM21 4YVWC 1PO22 3OD0A 4YRDA 1O3TA 2GZWA 3LSEA 1KEXA 5BNPB 3LPGA 1XSQA 4L11A 4I02A 2EICA 4I09A 5C9AB 1WMDA 3KVAA 4YFZA 1D4M3 1AX1A 5DUXA 4UBHA 1ENRA 1W8OA 2NM1A 5FY5A 5DAWA 4JC1A 1LR5A 2W39A 4UT5A 1Q8OA 4Q0UA 3WG2A 3FC0A 3QH7A 4LBJA 1E5IA 4LO6B 5E1RA 3W21A 1ULCA 1MQTA 1ZZ6A 4NPLA 2R30A 1OHFA 2JXAA 2WLPA 3M3CA 3PTRB 4QXKA 5IUQA 3VBUC 4EN7B 5ANQA 4QXBA 3DXTA 3GM8A 1C3HA 2WFF2 4ZU4A 5LA0A 1WLTA 2GP5A 1LGBA 1K5MC 1PNFA 4JKKA 5AFBA 1QXJA 2CDPA 4WVMA 4FPKA 2PLV3 2QDRA 3FLRA 4QDRA 2WNUC 1ZVFA 1DQ2A 3IM0A 1XE8A 1B09A 4W4ZA 4AAXA 3RMXA 4AW7A 2OQ6A 4FVVA 3L2YA 3LA7A 4A3XA 4CA9A 3M4FA 5C9AA 1JYCA 4WBBA 1XE0A 5F3GA 2RS51 1VP6A 2J22A 2Q8EA 2A71A 1G9BA 3T1LA 1LEDA 1ND2C 3H3UA 5L7OB 3MIBA 1R093 2QUOA 5IT6A 3VKMA 2HWE2 3KT4A 2WDBA 4XUOA 4K40A 2QQOA 4N43B 1ZRIA 2G9ZA 4F8AA 1BYHA 4EZHA 3NRUA 3N7MA 3VKNA 4JGZB 1W9WA 2XBO2 5F1RA 4RHV1 5DAQA 2WO3A 4QXCA 3ZVXA 5GJ6A 5DG1A 3DKQA 1WBFA 4RR3B 1G9AA 1O4TA 3VZLA 2XJQA 4XJ8A 5A3LA 5H9SA 4OMDA 4MGTA 3KCYA 1NG0A 1NX9A 2V72A 4I3GA 4QQHA 2ZGUA 2AH2A 3H7JA 1EP0A 4MHUA 4YZ1A 2RM22 1SCSA 4DRVA 4XABA 4NMIA 5TSWA 3N9NA 1EYBA 3LQCA 4NAOA 1FX5A 4XAAA 4XDOA 4DY3A 1TG7A 4AGGA 3ACGA 1HRV3 2C6SA 1Q8PA 2V4AA 2X10A 1S4CA 3FL7A 3HD8B 4PIYA 5K0UC 2UY9A 3T2QA 2JG9C 3JCIA 4X6QB 5G04L 2WZ8A 5GLWA 4GJYA 4RS5B 2KA3A 1C8M1 1W3VA 1KXGA 2CGOA 2GNTA 5EV7A 3BPZA 1K12A 1ZZBA 5T5PA 5FRAA 3O1UA 5FUPA 4LKDA 4R4XA 2IXJA 4QGNA 5FOBB 2NZ9A 2PQSA 1TMF1 1AR91 4YZ3A 5ABJC 2ZX0A 3J7LA 4BCUA 3MPPG 1S2EA 3VBSC 1VBE1 1UMIA 3JUUA 1OA2A 4L2NA 2Z2SB 4E8CA 3N9PA 4YM1A 3POIA 2D6NA 3OF1A 2VVDA 3I2FA 4FO9A 3TEYA 4IEVA 2RR13 4BA6A 1W6QB 3IDEA 3VHNA 2DCTA 5D21A 2ZAAA 3UJOA 2RS52 2GC0A 3POBA 4AI1A 4B7KA 1AR81 5A3TA 1UY3A 1MACA 1JZ5A 1PMIA 4ORFA 3ZKYA 2CYFA 4A42A 1MR5A 2P3KA 3JD73 4GB33 3O0WA 4CDUB 4P5HA 4AAPA 1ZZ7A 5FFOC 1RUE1 2QJVA 3I97A 3KLSA 1DQ0A 4YW7A 5DXDA 2ZGSA 1AUYA 2E7QA 4YG3A 5APAA 4O7XA 1K45A 2Y0IA 2P37A 5ISLA 5IK7A 3I49A 1WUVA 4TXWA 5GZFA 1H9PA 2IFRA 4LO4B 4LUKA 4UBGA 3VZJA 5J37A 2R042 2MNGA 3MI8A 5FKCA 1K42A 5FZ4A 3OBZA 3SKVA 3WDUA 3MEPA 2B42B 4XFCA 1JYWA 1RUI3 3THCA 1NE6A 2FDKA 3JQXA 3LD8A 4Y22A 4Z8BA 3VD5A 1DLCA 2B8MA 5F37A 1J84A 1AL23 1OVPA 1WCDJ 3NV4A 1ENSA 1V6KA 2AZ5A 2WZEA 2XQRA 3S6PA 2ZJCA 1CD3G 1JN2P 3UGHA 4P9LA 5GLZA 4CDUA 1C8M2 2ZGOA 4O9GA 1BVVA 3O7OA 3B69A 2AREA 2PHDA 1MEC3 3UKVA 2ZKLA 5A7QA 4W6YA 1TMF2 1AR92 4YFWA 4BWOA 4MO3M 1VBE2 3I7DA 1RJ7A 3VDDB 3RZLA 4AI0A 4Q4Y3 1SFPA 2QCSB 2PHWA 3BU7A 3EO6A 4NRQA 4GQ7A 1NA1A 3URFA 1UX6A 1YQ5A 3BALA 3I3QA 4UYBA 5BPXA 1RB8G 2FDIA 5JPNB 4MHRA 5B2GB 4AVAA 2F4PA 2DYCA 4P02B 4DXSA 3H1YA 2VZUA 1AR82 5JXGA 3H8OA 1A8MA 2Q0AA 4NJ4A 2D5HA 4FPGA 3TWIA 5FZEA 3VHOA 3R0RA 4R4ZA 2OYZA 2QQUA 4XURA 1GICA 4B3NA 4A4AA 1SLCA 1HV1A 1P8JA 2NYYA 4RD7A 1F2NA 2O1QA 1AYN3 5FYIA 1F15A 1RUE2 2XJTA 3CZUA 1EV13 1ZBE2 1WA6X 2ILMA 2WN2A 4K8RB 4EWEA 1RGSA 2ZMKA 3VUOA 4E4ZA 4OHZA 3AFGA 4BDVB 3WP6A 4E4HA 4INDA 4AHXA 4ET7A 4Z92B 4TSVA 4W6XA 1UIJA 2ZGNA 2Y33A 2WNVC 2V73A 1RUD3 5CIRA 1W03A 2ZX4A 4AEMA 4AVTA 1DHKB 1DZTA 1PGL1 2FCUA 3PVNA 3VHPA 1NUKA 2JG8B 1TME2 4FI9A 2Z79A 3KMHA 1GWKA 4IGQA 5IFPA 1UF2C 4LIVA 5C3PA 5F3CA 4BLJA 3BGAA 4LBOA 5F2SA 5A1AA 1ULGA 2WRAA 1UZWA 1JHNA 1W04A 2WWSA 3K77A 3UESA 4AFCA 2A1XA 1Q8QA 3H1MA 2VNVA 3LSDA 1PM4A 2QQKA 1STMA 1UWWA 1N3QA 3DYMA 3B94A 1DU3D 1Q8VA 3GHMA 3JB8A 4OCTA 4XF0A 1US3A 3ZO0B 4A45A 3AXEA 2VMGA 2ZKNA 3IZOA 1GZWA 1LU2A 4COZA 4WM8B 2QQPA 2E63A 4LT5A 4H2AA 2PAEA 4QXHA 1F5JA 5FZFA 3ZXGA 2XGXA 3GJAA 4PBOA 4PI2A 5F5CA 2Y0OA 1ZRFA 4YW3A 3EHKA 3ILFA 3P5BA 4N53B 4LEJA 5FPVA 4LBQD 4LNVA 1KFUL 2BW8A 3HT1A 3PURA 4A2UA 2VCCA 5H9QA 5KHHA 2ZZJA 5A3PA 2JDMA 3ES4A 1ASJ1 1ZRRA 4MGKE 4BQ5A 1NKGA 1AR61 1UY0A 4RA0A 3BN6A 2ZGTA 1Q56A 3OYWB 1S0BA 2XL9A 5H9RA 4CUAA 3MLJA 3POFA 4TLGA 1QJY3 5FWJA 3AB0A 3ZR6A 3LWCA 3MGUA 2WJSA 4BIOA 4CDWC 5C8CB 3TEZA 4Q1PA 3SCGA 3C2UA 5ACA1 3KGZA 3ZX7A 1MS8A 1Z7S1 1GQHA 2P17A 4IEXA 2JB8A 2X8KA 4OULA 2LRPA 4WM8A 2DCZA 3OD4A 1KJLA 5DZGA 3POGA 4UFHA 3VGIA 4IE0A 3I2IA 3T09A 3T08A 3TNQA 4W50A 4WZFA 2D40A 2WZR1 4FPLA 1OOPA 1G8WA 2VQUA 3Q8CA 1AX2A 1XE7A 1BBT1 3O0VA 5FYSA 4BQWA 4AHYA 4XHBA 3WR0A 4AVVA 3A0KA 3JQWA 1PGL2 3AC0A 4HXCA 2E32A 3FHQA 1NOVA 1PNGA 3BKZA 2BP6A 2D93A 1N47A 1CJPA 2IVIB 3BODA 4NN0A 5FKBA 4B29A 2VZQA 4RGGA 5C8CA 4AI9A 1IQAA 4Z07A 4BK5A 3NKGA 2UWCA 3AZXA 2TUNA 4QQPA 4XPVA 3TOJA 1TQ5A 3SISA 4D8MA 2A73B 4Q0QA 3SC7X 5IJRA 1NLRA 2DTWA 3VBOC 5DAXA 4C1XA 4EYUA 2YYOA 4Q1RA 3BPSA 1QXRA 4E4DX 1NE4A 3CJIC 1C5IA 2IXLA 3DPRB 3NAPC 3V64A 4CPBA 4AG4A 1OVSA 2Z5WA 1JOJA 2YROA 5GLVA 5F8PA 4LHLA 1R091 4NHMA 3VBHC 3U11A 2E51A 3GNEA 2XQXA 4LR4A 1AXZA 4NRMA 4OVEA 4S2DA 5T3NA 5FY8A 1QMJA 1AZDA 1JUHA 1MZ6A 1UZZA 1WGPA 2XONA 3WT3A 5KXEA 1OQEA 3VV1A 1X9TA 1DQ4A 5I8YA 1ASJ2 2D3SA 2PFWA 1R083 1L7RA 1DYOA 2VW1A 4ZZ8A 2OS2A 5I0DA 3NV3A 2VNOA 3EB7A 2Q30A 3SHRA 5JAXA 1AR62 2CWSA 3OCPA 1JZ8A 2PHLA 1QH6A 2V4VA 2JDHA 2VZOA 2TEPA 1H8TC 1U5ZA 2VNGA 2KR2A 2FDHA 1UU6A 3SXWA 5ACA2 2QFEA 1ACCA 3EMRA 2V5YA 3F2ZA 3THTA 4OLLA 1Z7S2 1D7PM 2D97A 4LXLA 5LK7B 4I01A 5FMOS 2GN7A 4NIAA 1VE0A 1LOEA 4GKYA 4DZGA 2FMYA 4XXAA 3H1WA 3T30A 1PIV1 1FMD3 1YLLA 4FFGA 2J1AA 2R071 3ZIWA 1D4M2 1OF3A 1C4RA 3JXSA 2WZR2 3PHMA 4PIXA 5C3OA 4YW4A 2JD9A 1L3JA 1BBT2 1PO11 3OB8A 3ENRA 5EJ3A 3C8XA 1QKQA 3SEPA 5FZHA 5C5TA 3DXUA 4L0PA 4XTPA 2BVVA 2YG0A 3OEBA 4M0NA 4XHXA 5LBFA 5CISA 5IK5A 5CNAA 2RJLA 1V6LA 4BJ0A 2PQQA 4QPWA 3O1RA 3AKTA 1D0GA 1RUOA 4AOCA 5L73A 1OD3A 5HV0A 1IPSA 2PLV2 4DEVA 4PF1A 3PIGA 4A6SA 4C8DA 5BNPC 4AFBA 4FOVA 1IKPA 2ZACA 3FBMA 2Y34A 4LQRA 5DAPA 5C9AC 4NVPA 3POSA 4A7YA 3C7FA 5IVFA 3BTAA 3AM2A 4JKMA 3ZSEA 5JOXA 3KV4A 1QQP3 1SACA 2FDGA 4UW4A 1XSRA 4N8MA 1J59A 1O91A 2VQAA 3E6DA 2YC2A 1PM7A 1R092 2GH8A 1KJRA 2Q1MA 4FPCA 4GWNA 1NXMA 4I30A 4IEWA 5BNNB 3VD4A 3JD71 4GB31 4RL7A 5FPAA 1ENQA 1MZEA 4CEWB 3C7OA 5FXXA 4GH4B 4E4SA 1QJX3 1N1YA 2H0VA 4KBZA 4Y1XA 3WW2A 2NLRA 3V0BA 2EXJA 1GSLA 4LPLA 4KG0A 5FZ1A 5AVAA 3WNLA 1UZYA 3KSCA 3KGLA 2VOWA 4HG6B 4ZPIA 1A34A 2JICA 3AKRA 4Y4YA 4Z82A 1OXCA 3T0DA 2H6CA 4CXWA 3M8LA 2VMHA 1VB4A 3GGLA 3WNXA 3S30A 4JTOA 4XJZA 5F5IA 3D3AA 3T1MA 1CIYA 3POYA 5L7OC 1XNTA 1UPSA 4RQPB 4R52A 2R072 5JXHA 2Q4SA 3FBYA 1SLIA 4Y20A 1HRV2 4N43C 2BNMA 1IPKA 4NAMA 1LHVA 4OZXA 4BB3A 4JGZC 2OX0A 4EN9B 1PO12 5A7NA 2WSVA 5EYYA 5FLHA 5FZAA 5EJZB 3AK0A 3AKPA 5CZKA 4TN7A 5A33A 4BLIA 4YGEA 4RR3C 1BCXA 4GH4A 1DGLA 4GA9A 1RMU1 4HN0A 3GZAA 4G4FA 4FCAA 4ZHNA 4DRRA 5EQUA 3GBFA 5E88A 1UU5A 2QKDA 4XBLA 5DABA 3B93A 4AQ6A 3KM5A 2Y8KA 1VMHA 1RITA 4XJAA 4Z2WA 1OI6A 1OKQA 1VLNA 3MLKA 4JRAA 2PAMA 4HVOA 3NQHA 1QU0A 4JGYB 4YM3A 2WO1A 2W08A 4AEDB 5JZGB 2A5ZA 1HIXA 2IZWA 5T52A 2H0BA 1V9U3 3O5SA 1A78A 3IAPA 1W6OB 4META 1W6PB 1ZZ8A 4YVSC 4RS5C 1TEIA 1IG0A 3NV1A 1VMFA 2UY8A 1C28A 4YSFA 4B7EA 3WNOA 4BISA 3ITQA 4MVTA 2B46X 2JIGA 1X50A 3FLTA 3JD72 4GB32 1FV2A 4GWMA 1RUC3 2Z69A 4HFSA 3U14A 1T6GC 1SCRA 1TVGA 2JJ6A 3B02A 4GIQA 5A1FA 1E5HA 1RVF3 1AYN1 4AGVA 4COYA 1VRH3 3U1XA 4MUVA 1S0JA 4K3UA 2XMLA 3MFAA 4UW6A 5FUIA 1PGW1 3GALA 4M3CB 3UV9A 3MF6A 3UK9A 1O3RA 3H7YA 3OPZA 1IS6A 1LJ7A 4Q0VA 5FZLA 1XOYA 4AEDA 3NJXA 5KR7A 1RUI2 5JZGA 1JYTA 2YPJA 3ROUA 1UCXA 3I59A 1LOAA 4S2FA 3U37A 1W6OA 1W6PA 4IEUA 5IAVA 3DL3A 1E5SA 2YDEA 4GMP0 3BI3A 1BK0A 1ZREA 1V6JA 2HLEA 5FZOB 2O8OA 2W92A 2XG3A 4SLIA 5A3WA 3RFRA 3WF2A 4CDUC 4D3WA 1OLQA 4NUBA 4EV0A 5IAXA 4PBPA 1A3KA 3SCHA 4N9HA 4FPEA 2X53S 4FXGB 3I2JA 1UYZA 1APNA 1MEC2 4IEYA 3QD6A 1WW7A 4OHXA 1RMU2 3LEGA 1POV3 4RSUA 3ZN6B 2EAAA 1W2AX 1QIQA 4XQDA 1ULFA 3LFMA 3ZDSA 4MV2A 2D6OX 5LY1A 1PO21 3WW1A 2YHJA 4FTSA 4LBMA 1IZ3A 4Q4Y2 4KMQA 4XIKA 3MUZ1 1PVC3 4CEYA 1WCKA 4DXTA 3RYKA 1F8VA 4FQZA 5JOYA 4NR1A 1KGYA 4PT6A 1V6MA 1H2KA 4NIDA 2DFBA 4L8QA 4JDMA 1SLTA 2A6WA 4UF0A 5GZDA 5FLJA 2QVSB 1MPXA 4QX5A 3U0ZA 5A7WB 4XETA 1KRIA 5FZ8A 1GQGA 1W28A 1AYN2 1SDDB 3WNMA 3O1OA 4QPGB 1EV12 1LGCA 1VBA3 3VDDC 3ZN6A 4AI2A 2FZ2A 1ZNPA 4DNYA 3FJSA 1PGW2 2X09A 3GBWA 3MPBA 2B7YA 4LMFA 4D0QA 5EIYB 3WHTA 5C3QA 1W9TA 1O5UA 1X7NA 3ZXAC 1RUD2 2OZ6A 2R7EB 1YHFA 5C3RA 2PAKA 1NCRB 5I91A 2XJRA 3I2HA 3MYXA 4QB6A 2PYTA 3TNPB 1FXZA 2HWE1 4UFIA 4GD4A 1H9WA 2OPKA 3KF3A 4QB2A 4NIIA 5EYXA 2Y6FA 1WMEA 2ZHNA 1SFNA 4KWUA 1MQTB 4CCLA 4LUMA 4BYYA 3C7HA 5FZIA 2YC4A 3M1HA 4FAHA 3BOWA 4LLOA 1O7FA 3ZFFB 4QPGA 3JBG3 4LE3A 4WVMB 4FBFA 2VOKA 1R64A 1S2KA 1YO8A 5GZCA 2ARXA 2JDYA 1HW5A 2ENRA 2G1MA 1LOBA 5E6HA 3U75A 2WLQA 5HXMA 3E5QA 1OPOA 2W1SA 5GZGA 1GOFA 1UAIA 3OGGA 4I3PA 4WVVA 2J42A 2JG8C 3FUOA 5FP7A 1NCRA 2VY0A 4R9AA 3WP3A 3HPNA 5CFCB 4TYSA 2RMU3 2HWB3 2PHUA 2W1WA 2XLAA 5JPMB 4Y26A 4HVQA 1NAEA 2P5BA 3GF6A 1JOBA 3KZ4C 4FFHA 4JTNA 4IUGA 4LKFA 1CPNA 1NQJA 4LO5B 4XFIA 1QJY2 4CCJA 5FPXA 5FQ0A 3M3QA 3MV01 4JKLA 1D4VB 3ZXFA 2A6VA 2XJPA 5CBLA 3N7JA 3E5UA 1UY2A 5F3EA 2VH9A 4L99A 5EPAA 1VBB3 4IEPA 4WM8C 3PUIA 5D8AC 3O12A 1SZBA 5GLTA 4BZ4A 4QDQA 3ZFFA 2OXBA 4H7LA 3WG1A 5FYBA 2YFUA 3S7EA 3IMNA 5T55A 3S0MA 4N53C 4ATEA 2J7MA 3B7MA 2VZSA 4BK4A 4QHOA 2IXHA 2BPA2 1TNRA 2CV6A 1W8HA 5IATA 4GAZA 4LIUA 2WS93 4PLMA 3MW2A 2BTVC 2ETEA 3ZR5A 4P9YA 4X8PA 5CFCA 3K46A 2J1RA 2TBVA 3LFIA 4KU7A 2E31A 4FP3A 4XF9A 1UOFA 5FP8A 3WUDA 4IL7A 1UOJA 1COV3 2BGOA 4DY5A 2C4XA 3MBWA 1UKGA 5FZBA 1RUNA 3WQ1A 1Y9MA 5C8CC 1PZ9A 4IGOA 2ORXA 4BM8A 2HKXA 2FDJA 5CA6A 4PHZA 3C7GA 3WUCA 3CO2A 4XTMA 5BYNA 3RYPA 3LOBA 2WA3A 2JDNA 1MVEA 3GDBA 1XNDA 2DURA 3IDAA 4U36A 2B39A 3MO4A 1RUJ3 3N36A 2E9QA 1GP4A 2VMEA 4BXSV 2KD7A 2AACA 2RS31 5DG2A 2D6LX 2WL1A 1I1EA 1QQP1 1FOD3 1YRZA 1RUH3 5FK7A 1GOGA 3H0OA 1ND3B 1V6IA 2R041 4LKEA 4DIQA 1NXD1 1G9DA 4P9XA 1CESA 1LOFC 1QY4A 2YU1A 2PXJA 2Y60A 3CKHA 3LGRA 4NROA 2ZGRA 5KHIA 3HWJA 3O1MA 1YJLA 3HVDA 4YWAA 4U2AA 5K8SA 3ETPA 3ZFEB 4CP1A 1HQNA 1R082 2ZGPA 3QH6A 1QJX1 4YARA 4IV3A 1BVP1 1AR73 3DYPA 1X33A 2E7TA 1T6BX 4XFFA 3A0NA 1GWLA 2VZ3A 3VBFB 2ZEXA 4HPKB 4M4RA 1LNSA 2WQZC 2VMIA 2J1SA 2X29A 2B4KA 4WM7A 5CKQA 3AJZA 3SKJE 3DEMA 2X5IA 2CGNA 4DXZA 3B00A 5CB7A 3ATGA 1GNYA 4XUTA 3USUA 1MS4A 1HQWA 3DPRC 4CDXA 2EXKA 3AVSA 4PLNA 5CG9A 1HRI3 5CU1A 1FMD2 3ZXLA 4CCEA 1J1LA 5F6KA 5JXIA 2ZPXA 1ND3A 3WQ0A 1CR7A 4OHYA 2RS13 3ILNA 1OLMA 1PZ8A 1VBC1 2ZGKA 3M3EA 2DVAA 5CFDB 4MH0E 3WEZA 5DPNA 1X8EA 4ARXA 3ZFEA 2VQTA 2BFUS 3HEIA 4NE9A 4Y22B 1WWYA 5DQ0A 4BXFA 2BBAA 2ARBA 3HN3A 2QQIA 2ZX3A 3LDBA 4MXWB 1H2LA 4CU7A 1QOTA 2XL7A 3VBFA 1XNAA 4HPKA 4TTGA 4LBKA 5FZCA 4MGSA 1BXHA 3ZMOA 4CP9A 1GNHA 1YIFA 2VTXA 2C24A 2KXLA 3PUHA 3BIEA 1BQPA 3S5QA 1ZBE1 1QOSA 1EY2A 2VQ0A 3PVBB 2RS32 4LHSA 4OUEA 2WYSA 2JE9A 1CAVA 1HJGA 1QQP2 2YZ4A 4PDWB 4WZCA 4Q0PA 1NYWA 2JDUA 3A7QA 4KH9A 2DUOA 2JECA 4FPOB 1HKDA 4LO7A 5FK8A 5CFDA 1NA1B 4M3CE 2PHRA 1LRHA 1TME1 3DKWA 3N9MA 3N9QA 1VB2A 4HLTA 2WT2A 4YM0A 1HV0A 3ACIA 3MLLA 1RUC1 3I4IA 2BZDA 4K21A 3BOPA 5BNOB 4QHBA 1F4HA 1ULDA 1VAVA 1IGOA 1W99A 4QKNA 4XFBA 1SBDA 1PK6B 5DDJ3 3T2OA 4ES9A 4V1PA 1U5XA 4MXWA 1POQA 1QJX2 3ZXDA 3GBGA 4PIZA 4PJYA 3OUJA 2OVUA 3DGTA 1H1AA 5FXWA 4CP2A 2LS6A 3LB9A 5BXXA 1HB2A 2IWGB 5ANNA 3AX4A 4AHZA 2K46A 4RN5A 1GMMA 2VBPA 3SNMA 1O59A 3BIWE 5CKNA 3INAA 1W05A 1BEV3 1H4GA 1U5YA 4UOJA 4E2QA 2P6CA 4OUMA 4XUNA 4PDWA 4FOQA 4URAA 1QXPA 4HOOA 5JIUA 1O4ZA 3IWZA 2YMZA 2YGLA 3M70A 3NMBA 1MZ5A 4Q0SA 5BNNC 3VN4A 3Q8EA 1VBC2 1N1VA 4Y3OA 2ZHLA 3D0JA 4CEWC 5JMCA 3FHIB 1CZSA 4NHXA 1CGPA 4GH4C 4P9WA 1D2QA 5BNOA 4K6BA 4CDQB 5JUVA 1CAUA 2GALA 1PK6A 1W9SA 2VZVA 2XVKA 3NV2A 3OBAA 4QX2A 1ZX5A 1QDCA 2VU9A 3PIJA 1DIWA 3QLQA 2ZBJA 3VB9A 1FPN3 1JYVA 2I2SA 1IPJA 1HB1A 3DCQA 5FZ9A 3M3IA 2YUEA 1L7LA 1UPIA 2DU1A 1UO9A 2DCKA 5FREA 5JIAA 3VDBA 4KBBA 5D2AA 5BNQA 5A6YA 2FBEA 5DZEA 1GZWB 1NCQA 3B3QE 2RDSA 3OJBA 5IVCA 4RQPC 2AUYA 1R1A3 2R6QA 2QQLA 2RDQA 5BY5A 2BFUL 2HYXA 3AYCA 5FDBA 2C0ZA 2DV9A 3V56A 4B1LA 1YI9A 4W8JA 1V9U2 4B4PA 4JDNA 3AVRA 2Y6GA 3PU8A 1E57A 5DUWA 5E89A 1US2A 3ZDVA 4DS0A 4CCMA 1LGNA 2ZOEB 1JXNA 4FP2A 3PU3A 4UWDA 1RUC2 1NQDA 5FYCA 4CDQA 2WN3A 1BK1A 2QQJA 1SLLA 3I54A 4QD2A 5FJKA 1RVF2 3AKSA 4YYOA 4HMZA 2QQNA 1IS4A 2WKKA 2BGPA 3ZSLA 3TBDA 5IK8A 1T2XA 4M0HA 4EROA 1DQ1A 3A21A 2BOIA 4IE7A 2OPWA 2RVAA 1SQ4A 3BB6A 1S0DA 1NLSA 3K4ZA 4I0BA 4JGYC 4PLOA 5FO8B 1UXZA 1KDKA 2Q8CA 2ZX2A 3ZSMA 4AEDC 5JMOA 5CEHA 5JZGC 2VG9A 3HNMA 3J8F3 2I74A 3OGVA 5J96B 2JE7A 1XU2A 4DOUA 3WD5A 2G19A 3CDZB 3NL1A 1RUG3 1AXKA 1OOPB 2YV8A 3WVJA 3J26N 3E6BA 4XJUA 5A6ZA 1RXFA 4O61A 2VZPA 2P34A 1W2OA 4CUCA 2J1TA 2TNFA 3RDIA 4Q5OA 1DFQA 3ORJA 4PI0A 2PA7A 4GXLA 5E8AA 1W9YA 5IW0A 3JBG1 4GULA 4QX3A 4IEQA 2YGMA 5LW9A 3RGBA 1WKYA 2HWD3 5FPBA 4CU6A 5J36A 3ME2A 2YPDA 5CKMA 4YVWA 1YFUA 1WCUA 2UYAA 3H8UA 2UYBA 4BU2A 4IE5A 3LPFA 4JDOA 1D4M1 2VZ1A 2HWB1 2XJSA 5HCBA 3DN7A 1QDOA 3JB4C 1UY4A 1UX7A 3C3VA 3GCWA 1LHWA 3N35A 5T5JA 3UGFA 1ND2B 5A3MA 1XBFA 3KVBA 4JCKA 3AMQA 5L9RA 1RTVA 5CADA 1C8NA 3OGSA 1H2NA 4XXPA 1FATA 4BE3A 1X9PA 2WFF3 3QBQA 3K3NA 1JI6A 5GM0A 5JSRA 4OQ8A 1SG3A 2NP0A 2ET1A 2ZEYA 3VL9A 1IS5A 4NHKA 4OI1A 5FOJB 3POWA 1J3QA 3J9SA 1LODA 1H0BA 3PVOA 1J3RA 4V2VA 4FT8A 4RYDA 1CZTA 2PLV1 4HK9A 5F3IA 4DXRA 4YZ2A 2VJXA 1O3QA 1VBA2 2WZPP 1RXGA 1V6OA 2IC1A 3MIDA 4XIOA 1J1TA 1RUF3 4IEOA 1DYKA 4ASLA 2R1DA 3CZJA 4CE8A 4I2OA 5FJHA 5HCFA 4FFIA 4NIGA 1OH4A 1VRBA 4Y33A 1C1LA 3R6SA 4BOWA 2ZZQA 4XBNA 1XYNA 3HOBA 1WLWA 3RMYA 4D6SA 3PLQA 1ND2A 5GZEA 3VKOA 3NO8A 4AZZA 2XHNA 4Q8LA 2PMWB 3Q9OA 1DZQA 3OY8B 1W8ZA 3RZGA 4HKOA 3MIFA 3N9LA 1LCLA 4CCCA 4Y5TA 5IVBA 2FQPA 5IK4A 1S2BA 5FZ3A 4AFAA 1OLME 1U0AA 5F5QA 2UWAA 3AL5A 3ZYFA 4JVAA 3BYWA 2D6KA 4QDSA 1BKZA 4XW3A 4Z1VA 2JENA 5A3NA 1RYYA 3OG2A 4V2WA 2DF7A 5FUNA 5E16A 1AJOA 2W94A 3HBKA 3I2KA 3JBG2 1FOD1 5FXZA 3U4XA 2R1BA 2ZGMA 4QHZA 1JH5A 3HJRA 5L36A 4Q4W3 3E97A 1NCRC 4YG0A 1RIRA 1WW6A 2HBUA 4QQOA 5SV5A 4H14A 2CSGA 1W39A 4E2SA 4QPIB 2ARCA 3MIHA 1LULA 3POJA 3USSA 2QDNA 2LTNA 2RMU2 1WMXA 1I6XA 2DCJA 2HWB2 1HRV1 2MEV3 2D43A 2HBTA 1G6NA 2RHPA 1YXWA 1GP6A 1MQTC 5LBBA 3VZMA 3FHAA 3OY8A 2F4LA 2WUHA 1UNBA 4QGLA 4B8EA 2JG9A 4YW1A 1CVNA 1U12A 3HQXA 5BUVA 1OF4A 5KWRA 1QGLA 1M4WA 1YYNA 3FWEA 5C71A 4CUGA 1VBB2 1Q43A 2G4IA 5A32A 1YCIA 5DUUA 4AEJA 3V0BB 5FYMA 1ZM1A 1HRI1 2E6VA 1UOBA 5FZ0A 1S0FA 1XYOA 1IG3A 3AP6A 1QJEA 1NLQA 4D94A 5ABJA 3OGRA 4LA3A 4FTEA 3VDCA 2XWJB 4Q4V3 3K51A 5LBCA 4JRLA 1NY71 2DVFA 2NPIA 5FP4A 3ZN4A 4AVBA 5CFCC 2VCAA 4QPIA 2WS92 1ZYBA 4FFFA 2RR11 3DUIA 5FZGA 1FT9A 1UY1A 2R0HA 5F32A 4XCBA 4AVSA 3CHXA 1UOGA 3AYAA 5HV4A 4Y20B 2BQPA 2VULA 2C26A 2H6BA 3ST7A 4KL1A 4ZY9A 3GXUA 3KT7A 1DLLA 1W6NB 1OC1A 4XVHA 4FAGA 1H1IA 4QX1A 4RHV3 5A33B 2BVBA 4YNIA 4Q26A 2W1UA 4P9GA 1UU4A 1JYXA 1RUJ2 1XNCA 2Z42A 4R9CA 1F5FA 1LB2A 1X8MA 3M3OA 2WAAA 4M3CF 2DTYA 5T5OA 2JX9A 4B1MA 1W2TA 1FOD2 1RUH2 2BWAA 1I5PA 3L2HA 5C6CA 5JOWA 3UYJA 2IXKA 3ACFA 2E53A 1SLBA 3DV8A 3MIEA 4LK6A 5C4WB 3UETA 1J83A 4N7IA 5IYYA 4QT6A 3UGGA 2BGCA 1H8VA 1VBD3 2ZEZA 4RFRB 2L9LA 1RUI1 3NWKA 2IXIA 4FSJA 1LHOA 3WZ1A 3PNAA 3LA2A 5LA9A 5I8SA 2FD8A 3KT1A 1AL21 4PQQA 4ZONA 4FPJA 4CVUA 2VW0A 3O14A 1VR3A 2YB7A 1GNZA 3TEWA 5J3UA 3D0SA 3IDCB 4I0AA 1AR72 4CUBA 2BWCA 3V0AA 1C8M3 1W6NA 4LBLA 5LBEA 3RSJA 1GUIA 2ARAA 4Q2FA 4R9BA 2BJSA 2ZEWA 3CMGA 4IW3A 4LOSA 3WW3A 3ZYHA 4D7TA 4ASKA 4UFMA 3SQOA 1SBFA 3I3MA 5FZ6A 5FMOL 1MEC1 3VHRA 1DBNA 2CNAA 4ITCA 1TMF3 4M00A 1UQXA 5KHJA 2W87A 1GQPA 1OH3A 4HL0A 1H4HA 2JIJA 2K0GA 5SV8A 1HRI2 5GLUA 5FR3A 2BERA 3SCFA 3M7AA 2VL4A 5EJ1B 5FYUA 5C4WA 4Q4Y1 2X05A 1PGSA 1V0AA 2OZJA 1YEWA 4KGQA 4ATFA 1NY72 4ARYA 3O1PA 2VUAA 1DYPA 1UW8A 3PUAA 4HSLA 1JU4A 4ISQA 3VBRB 2RR12 3R4SA 4QX7A 1K5JA 1N3OA 1NZIA 1Q5OA 2OA2A 4XUQA 2OIIA 1B35B 2P4EA 3KCCA 3R05A 4TWTA 1CX1A 1GZ9A 5B4NA 3I59B 3TAYA 1AR83 3WNPA 5CAZA 3H8RA 1GWMA 2Q1FA 3M2MA 4Q8KA 3KWVA 1FPN1 4EWAA 4JV4A 3IIIA 2EIEA 3DYOA 3PL0A 3WDTA 2VOTA 4EJRA 5J48A 2HWC3 1D2SA 4YLZA 5HPOA 1OD5A 1Q3EA 5HCAA 1SFYA 2WFPA 1EV11 3HN1A 3WQBA 4BQXA 1R1A1 2AEZA 2D3RA 4G3YC 3D8CA 3B9IA 4GWJA 2V5DA 2OW4A 1Y43B 4JZRA 2QNKA 4LKSA 5FPLA 2C9KA 5FO7B 2KM2A 3GCXA 3KV9A 1W90A 4XFAA 5F39A 4B4RA 1RUD1 4D69A 5CFDC 2W68A 3P3PA 1O5LA 1LHUA 1Q8SA 2WNVA 2XWBB 1JTZX 3AMPA 2WABA 1GBGA 1RINA 1LHNA 1VAMA 2WNEA 3AZWA 3K4AA 4KWJA 3VBRA 3GYDA 4MOAA 4YW2A 1YFWA 1B35A 3ZM8A 2Q5TA 3AZVA 2XB6C 1H6YA 3P6BA 4QU2A 1AL22 1FI2A 2VC9A 2BOJA 4H7MA 4QM8A 5DDJ2 3NNFA 1N3PA 2WC2A 3S5AA 4HANA 2OT7A 1O8PA 4UF0B 4XDPA 2Y64A 4CDWB 2A3XA 3VL8A 3IT8A 3RG0A 5FV3A 3RQ0A 1IOAA 5J98B 1AJKA 4L9BA 1YI7A 3N3HA 3H8XA 4XAEA 5FYYA 4PDWC 4HZFA 1NT0A 1BEV2 1X36A 3I3DA 3K3OA 2LM3A 3MUY1 4MZUA 2HWF3 5A6XA 3UKNA 4DB5A 4ZU7A 2RDNA 1OQDA 1F4AA 5FAXA 3WF3A 4XQ4A 2A70A 4AQTA 3PJQA 1NA1C 3AP7A 4XZPA 2GC1A 3W9AA 5AVPA 3ZOIA 4BH9A 2VBBA 5I0SA 5BNOC 4XF3A 1ZZCA 2DCYA 1S0CA 3UL2A 3OSDA 2DFCA 1XJAA 1OPMA 2WQ8A 2ZCWA 1YIPA 1HXS3 5EZWA 3FFZA 3ASIA 5HXVA 1QJY1 4Y4RA 2XVGA 3BTYA 2A6ZA 3EYPA 5C5UA 1FPN2 3NJVA 4MGQA 1YJKA 2XOMA 4CDWA 3WP4A 4OFGA 3WHUA 1Y9GA 3CL1A 3WCRA 5LA2A 1KD7A 1HQLA 2WR9A 4CU9A 4MGYE 3SEEA 5C70A 2YBPA 1XQNA 3ZPYA 4EN8B 2YBSA 3AZZA 2XH6A 5HI0A 3T4HB 1KDMA 1R1A2 2W91A 3VD7A 4QU1A 4KGGA 3WF4A 2XJUA 5JOZA 4LOTA 5LY2A 4AF9A 1WD3A 4GMP3 1CPMA 1QNWA 3N7KA 4QKBA 3UJQA 4CEYB 5FY0A 1Z0HA 2A3YA 2YFZA 3H42B 1HX6A 1OBNA 1DGWA 3WG3A 1XC6A 4IV1B 3AJYA 3MW4A 1PMHX 3HAGA 3AMMA 1A6CA 1IHMA 1QF3A 5LASA 1DCSA 3AMNA 3KF5A 4MX3A 4XZUG 4NOTA 1V00A 1VPHA 3HMYA 4QKDA 2ADDA 5FQ0B 3THDA 5KHKA 1ULOA 2RJKA 5FYVA 2VNRA 2D5FA 5GKAC 1W6MA 4LULA 3ZYJB 3GHNA 2W47A 2A7AA 4P9IA 1LKNA 4FPHA 5A7SA 2JKXA 1RUF1 4CPBD 4XE9A 3THPA 1BHGA 1CJDA 1LEMA 3CNAA 3NSTA 4P5YA 4CXYA 3VBOA 2PN5A 4BQYA 3J8F2 4XFHA 3WQ7A 1PX3A 2ZAHA 1QWRA 3CJIA 3NAPA 3OPWA 2Y6HA 3OBRA 1RUG2 4NIHA 2D7FA 5A70A 1O3SA 2JWPA 2PTMA 1E5RA 2GSYA 4W65A 1S1AA 3T3YA 3UKTA 1N1TA 4XFGA 3VBHA 5K9YA 4WVZA 4MG2A 1WLCA 1JBCA 3KV6A 4LBQA 3USUB 1G86A 1W06A 1ASJ3 4IV1A 3PUQA 1AR63 1R081 3KQ4B 4CCKA 4MXVA 3CLPA 3KS7A 2JD4A 4YZ4A 3AP4A 1Y7BA 2VD7A 5LZ6A 5FPZA 1UZ0A 4HT1T 1FYUA 4YG6A 5KC6A 5F2WA 1ODMA 4AYUA 2VECA 1H8TA 1GV9A 1ULEA 5BV6A 4COVA 1MS1A 2LW8A 4H55A 4A3ZA 1G9CA 4IESA 3LCPA 1AVBA 2GP3A 4PF5A 5K7PA 4XMAA 4X8NA 4ZS3A 4BMEA 1ENXA 1AXYA 1OQ1A 2HWD2 4FPYA 2DUQA 3V65A 1EAH3 2ADEA 1FMD1 4S2HA 1BMV1 4Z2AA 1OOPC 2ZTNA 2WZR3 4XC9A 2Q8DA 4OZOA 2JKBA 1CONA 2MEV1 2WT0A 3WINE 2WA4A 2VMFA 4XACA 1BBT3 2A6XA 4Y5Z0 2GNMA 4ZU5A 3AYDA 3E1F1 3UT0A 1Y9QA 2HEYF 3NJZA 3FFQA 2WBKA 5KXBA 3FE5A 5I0UA 3KV5A 2ORZA 1QJU3 1URXA 1W8NA 1IKQA 2YY1A
chains in the Genus database with same CATH topology
2OUJA 4IV3B 5CVRA 4MYEA 4WM7B 4UW3A 2IXCA 2X5IB 4Q4V1 5BNPA 1RUF2 1QNYA 4CDXB 1MS5A 3HBZA 4Y1ZA 2GMMA 4XBQA 4NO4A 2G9GA 2XKOA 2AYHA 1OLRA 1ZBA3 3AFKA 3QCWA 2FZ1A 2B45X 1WCSA 2I07B 4TLFA 4FTBA 4PQ9A 1JW6A 2XUMA 4DMIA 4AEKA 4ZKTB 5I0RA 1JUIA 4RFT0 4K1YA 3N4MA 4UW5A 3VZNA 4XF1A 2DVGA 3N7LA 1Y3TA 3ZSKA 1ZZ9A 3B5LB 2BYVE 4Q4W2 1MVQA 4QMAA 4W6WA 1KS4A 4OHWA 3MFCA 1PIV3 1VBD1 3SLIA 3AP9A 4MGIE 1UN1A 2R073 3IBMA 1CAVB 2VOXA 1BMV2 2BNNA 5L7OA 2WT1A 2MEV2 1PO13 2XKPA 4N43A 4XF4A 4YVSB 1SBEA 4O9EA 4JGZA 3QOPA 5D1IA 3H3ZA 3O0XA 1M06G 2N7GA 4MLOA 4WV8A 2WINB 1H2MA 1I3HA 4Q29A 4RR3A 3VZKA 4P14A 4MGZE 3MF9A 3OBTA 4QM9A 2GNDA 2CGPA 2HYKA 2LALA 3ZYRA 4DPNA 1DGWX 4JAAA 2XHKA 4QPIC 4Q4V2 3WLUA 2A75A 4K20A 1QH7A 1PZ7A 3SH4A 1JYIA 3ES1A 1UKRA 3B01A 4BPZA 1V9U1 5DZFA 4URTA 1FNYA 4QQLA 2ZA9A 1DZRA 2VXRA 2RE9A 4NHLA 1MS0A 3RRDA 4YVSA 1ZRDA 4RS5A 2AGSA 4AQSA 2NN8A 4EN0A 4TZDA 4E27A 4XOGA 2WSUA 2HWC1 4IETA 1A8DA 1CAUB 4RHV2 1RVF1 1VRH1 3ZYGA 1RHI3 2R16A 5FO9B 2ZMNA 2FHRA 4YGDA 3I2DA 4AGRA 2DVBA 4A7ZA 5AC93 2R063 2VGDA 3TN93 3U07A 1XNBA 4KQ7A 1NCQB 4BQ1A 4IERA 4QPYA 1S0IA 1W6QA 1VBD2 3D82A 3CF6E 1OA4A 3LOIA 4HVRA 1N1SA 1LOGA 1RJ8A 3RWNA 4BHPA 1DGRA 3RI9A 4EN6B 5JDBA 3NW4A 1KQRA 5C33A 4YGCA 2EVXA 2R0FA 3LAGA 1GZCA 3IN9A 4CZSA 1CAWB 1RMU3 1POV1 1WLDA 2DUPA 2GN3A 1YUDA 2HWF1 4FPFA 5C4WC 5LRRA 3FUQA 3FMGA 2P2KA 3AKQA 2LUWA 1PVC1 3S7IA 1REDA 2GNBA 5JVVA 1ZRCA 2VUJA 3AXDA 2MHFA 1HXS1 1AYM3 2CY6A 1GFF2 3FZ3A 3W58A 1WW5A 2D3PA 2C9AA 1R1ZA 1VALA 2D6MA 4Q4X3 4EWDA 2HWC2 3HT2A 1CAWA 4LE4A 3ZYIB 3MDPA 4NWVA 1VRH2 1GANA 1VBA1 3ZFGB 1O4YA 1ZA4A 3RYRA 4G9SB 5F9TA 3P3NA 3R4DB 3VDDA 1H1MA 2W52A 3VKFC 4KWKA 3A4UA 4N90A 4GMP1 2XLFA 5KBFA 1CN1A 4YVWB 1S0GA 1W2UA 4HKWA 3VBRC 1G7YA 4ASMB 4BIFA 1B35C 2Y38A 2ET7A 5JI7A 1UD1A 5EFUA 3ZN5A 3EBRA 1J58A 2FMDA 5KXDA 1AX0A 4D7YA 4OUSA 3FLPA 3VLBB 2R32A 3RNSA 3VBUB 1MS3A 3WY6A 2MPFA 4CTEA 2ZHKA 3WG4A 2AENA 5D8AB 3L9JT 4HKLA 1K5MB 2B5HA 3ZFGA 2CWMA 3JZVA 2BEOA 2A6YA 4XMIA 2HWF2 5CG8A 4OI2A 2WNUB 1PO23 4H3WA 3APBA 5T5LA 2PHFA 4LLFA 3RI8A 4CEYC 2ZS6B 1WMFA 3H50A 2JEMA 2JDZA 2JG8A 1PVC2 2RMU1 2F6BA 1MS9A 1CQ9A 4FOWA 1QOOA 2GMEA 2K2SA 4N7UA 3ECQA 2UWBA 1SLAA 5EWSA 1HXS2 3WW4A 3WX5A 1YFYA 4HSJA 1BJQA 1S55A 3VBUA 5LEJA 3TB0A 3MICA 5LEKA 1VBB1 1GR3A 2GAUA 3IKWA 1MZFA 4C91A 5D8AA 1XYPA 4KU8A 1EAH1 1K5MA 3ACLA 3J4UH 2P3JA 1DQ6A 1Z78A 2D44A 2WNUA 4N53A 4FQ4A 4XILA 2C5DA 1LTEA 1F9KA 2WS91 2EF6A 2R49A 4N9IA 3RJ2X 3ZIXA 1COV1 4CP0A 1LENA 4AFDA 3OYWA 1QJU1 2HWE3 4LO8A 5J09A 1FAYA 1GKBA 2UURA 2VOVA 1YFXA 2DVDA 3ILRA 2ZABA 3ZXEA 5K0UB 4XJ9A 4IEZA 4OHVA 3AP5A 3EJKA 2JG9B 2O0OA 2HEWF 2XBO3 4HK8A 3AYEA 1G9FA 3D6EA 3FX3A 4CRQA 5J7MA 1C1FA 1QHDA 1RUJ1 4QPGC 4XEZA 2WQ4A 5A32B 3WDWA 2YXSA 4AFMA 1HDKA 1RUH1 3D5OA 2XPJA 5ABJB 3JU9A 4L97A 3VBSB 4J1WA 2RM23 2NMOA 4Y1YA 4OI0A 1ZBA1 3SITA 2V09A 5JWPA 1EPWA 2CL2A 3K48A 1LOFA 4IV1C 1UL9A 4M01A 1XXNA 1C57A 4AVCA 4YZ5A 1VAKA 1DQ5A 4PCRA 5K0UA 1AR71 4D7SA 3I8TA 4IQPA 3ZXKA 2HEVF 5I0TA 2SLIA 3RJRA 3ZFFC 4Q27A 1WD4A 4GALA 3ALQA 1EAH2 3PJYA 4DQAA 3DPRA 1DDLA 2EALA 3VBSA 3DF0A 3NVCA 1GYKA 1LU1A 3OGJA 1REEA 2RS11 4R9DA 2EXIA 4F83A 2BUKA 4LHKA 1KS5A 3EQEA 4Y24A 3LA3A 2RS53 1NZCA 3G7DA 4JQRA 1COV2 3WP5A 1QJU2 2XLGA 2ZX1A 2P3IA 4AK3A 3MZHA 1CAXB 2VW2A 4E9KA 1VIWB 3V0AB 1D0HA 4XQWA 1XU1A 5EXOA 2NQYA 2QZ3A 4AE2A 5DUVA 3OTFA 4J1XA 4B4QA 2RS33 4AHWA 1FV3A 4WVWA 1VJ2A 1ALYA 3HIFA 4K8FA 2R043 2OUHA 4KNCA 4DINB 5F6LB 3SMHA 1ZBA2 1DG6A 2B9UA 4XYXA 2ZMLA 1HLCA 2Q1ZB 5T50A 3LKJA 5GALA 1OSGA 4ISRA 2ZGQA 4IV3C 1F31A 5DDJ1 4FOYA 5LK5A 2G9FA 1CAXA 2QE3A 2DWRA 1TNFA 1RHI1 2EXHA 3ELNA 3HR9A 4WM7C 4DFSA 5LRSA 5KC5A 2X5IC 1KITA 2C1FA 3WCSA 3GZUC 5AC91 1FNZA 2R061 3TN91 4CDXC 2GDFA 2NMNA 1BEV1 1AR93 1J3PA 2GC3A 2VVEA 4Y1UA 4C0BA 4AWDA 4LHNA 1PIV2 1ND3C 5JSOA 3NKTA 2K9ZA 3BCWA 1VBE3 4AXOA 2HJIA 3IDBB 2YC0A 5I8TA 4KWLA 3B9CA 1VBC3 2EIGA 2RS12 3G6JB 3LZZA 2DU0A 4K1ZA 2VPVA 4AI3A 5BNNA 2ZGLA 2WNVB 1DGRN 2D6PA 3ZFEC 3PTYA 1PVXA 4GKXA 4K7JA 3T2TA 5KHGA 5JR7B 4CEWA 1W0PA 2ZHMA 2XJVA 3E6CC 4NWWA 1H30A 3VBFC 1V70A 5JI9A 5C8WA 4LBNA 1CIWA 1WA4A 2CAUA 3WDXA 1YNAA 2CTVA 5L19A 1WW4A 4HN1A 4F3JA 1RUE3 2GH2A 3ETQA 3PMSA 4J6GA 3CJXA 1ZBE3 4K9SA 4IXLA 1POV0 1I5ZA 3RZZA 3CEWA 4RQPA 1XNKA 4X6RB 1REFA 1S0EA 2PHXA 1AHSA 1AF9A 1AYM1 4YM2A 5T54A 1TME3 2ES3A 1DF0A 3WDYA 4Q4X1 4HBNA 5AFEA 3D4KA 4AI8A 1ONAA 1C5HA 3MIGA 4KG8A 1RHI2 5JCTA 3GZTB 2W0XA 1AL0G 1RL3A 4XJWA 3AZYA 2O8QA 5JSPA 2CAVA 4XDQA 5AC92 2R062 4YW5A 3TN92 1LOCA 1SDWA 4BMBA 2A3WA 4JGYA 3J8F1 4SBVA 5H9PA 3WV6A 4C0HA 1GLHA 2IFWA 4Y1VA 2AR6A 3W59A 1RUG1 2ATFA 4F7ZA 4C1WA 2PHTA 1UMZA 3X29B 3WXPA 3CU7A 2SBAA 3ZSJA 1LECA 5KXCA 3EXUA 1X82A 3TRSB 1LESA 5JLVA 1PK6C 3VZOA 3E5XA 2QZ2A 3KB5A 4LA2A 4A7KA 3PMEA 3PVEA 3ZYPA 2UU8A 4OI4A 3U10A 4M3CA 1W6MB 3H9AA 4COWA 1W0OA 2D98A 3QACA 4YGBA 5FCCA 3MW3A 1NCQC 4MSVA 3VKLA 3WOGA 3TYJA 2HWD1 3IPVB 1V6NA 4UXAA 2EA7A 4QQ2A 4P9JA 1SMVA 2EAKA 3VBOB 1OFNA 1OMIA 3IIAA 4RGAA 1XRUA 3RS6A 3CJIB 3NAPB 5HBAA 5FLIA 2GMPA 2Y26A 1WBLA 2VVFA 3RPQA 1AYM2 2GU9A 3VBHB 3ZXJA 4I0WB 4R8HA 4LBQB 4CDQC 4LTAA 2WFF1 4Q4X2 1TE1B 2E7AA 1BZWA 1EPZA 1CX4A 1I9RA 1H8TB 2Q8OA 3WDVA 1IS3A 2GC2A 1U5IA 3IPVA 5FTTC 3R4UA 4HETA 4CYDA 4ONUA 2I45A 1RC6A 4S2GA 1OFSA 1PHMA 1YWKA 4ZXKA 4C90A 5FBZA 2XBO1 5I93A 2BNOA 4NPRA 3SH3A 2XVLA 1OA3A 3KD4A 3ZMNA 2PELA 3AMHA 4AQ2A 4L92A 3ZFGC 3SH5A 1SEFA 2WIIB 4FXKB 2BBVA 4QGMA 1UIKA 3KCXA 3KQRA 1KFXL 5ACA3 4E2GA 1QJZA 1Z7S3 2ERFA 4Q4W1 2RM21 4YVWC 1PO22 3OD0A 4YRDA 1O3TA 2GZWA 3LSEA 5BNPB 4L11A 4I02A 4I09A 5C9AB 1WMDA 4YFZA 1D4M3 1AX1A 5DUXA 4UBHA 1ENRA 2NM1A 4JC1A 1LR5A 2W39A 1Q8OA 4Q0UA 3WG2A 3FC0A 3QH7A 4LBJA 4LO6B 5E1RA 1ULCA 1MQTA 1ZZ6A 5IUQA 2R30A 1OHFA 2JXAA 2WLPA 3M3CA 4QXKA 3VBUC 4EN7B 1C3HA 2WFF2 4ZU4A 1WLTA 1LGBA 1K5MC 1PNFA 5AFBA 1QXJA 4WVMA 4FPKA 2PLV3 2QDRA 3FLRA 2WNUC 1ZVFA 1DQ2A 3IM0A 1XE8A 1B09A 3RMXA 4AW7A 4FVVA 3L2YA 3LA7A 4A3XA 3M4FA 5C9AA 1JYCA 4WBBA 2RS51 1VP6A 2A71A 1G9BA 3T1LA 1LEDA 1ND2C 3H3UA 5L7OB 3MIBA 1R093 2QUOA 5IT6A 3VKMA 2HWE2 3KT4A 4K40A 4N43B 4F8AA 1BYHA 3N7MA 3VKNA 4JGZB 2XBO2 5F1RA 4RHV1 3ZVXA 5GJ6A 5DG1A 1WBFA 4RR3B 1G9AA 1O4TA 3VZLA 2XJQA 4XJ8A 5A3LA 5H9SA 3KCYA 1NG0A 4I3GA 4QQHA 2ZGUA 2AH2A 3H7JA 1EP0A 4YZ1A 2RM22 1SCSA 4DRVA 5TSWA 1EYBA 1FX5A 4DY3A 4AGGA 1HRV3 1Q8PA 3HD8B 4PIYA 5K0UC 2UY9A 2JG9C 3JCIA 4X6QB 5GLWA 4RS5B 2KA3A 1C8M1 2CGOA 1KXGA 2GNTA 5EV7A 3BPZA 1ZZBA 5T5PA 5FRAA 4R4XA 2IXJA 4QGNA 5FOBB 2NZ9A 1TMF1 1AR91 4YZ3A 5ABJC 2ZX0A 4BCUA 3MPPG 3VBSC 1VBE1 3JUUA 1OA2A 4L2NA 2Z2SB 4YM1A 2D6NA 3OF1A 2VVDA 4FO9A 4IEVA 2RR13 4BA6A 1W6QB 3IDEA 3VHNA 2DCTA 3UJOA 2ZAAA 2RS52 2GC0A 4AI1A 4B7KA 1AR81 1MACA 1PMIA 4ORFA 2CYFA 1MR5A 2P3KA 3JD73 4GB33 3O0WA 4CDUB 4P5HA 1ZZ7A 5FFOC 1RUE1 2QJVA 3KLSA 1DQ0A 5DXDA 2ZGSA 1AUYA 2E7QA 4YG3A 2Y0IA 2P37A 5IK7A 1WUVA 5GZFA 1H9PA 2IFRA 4LO4B 4LUKA 4UBGA 3VZJA 5J37A 2R042 2MNGA 3MI8A 3WDUA 3MEPA 2B42B 4XFCA 1RUI3 1NE6A 3JQXA 4Z8BA 4Y22A 2B8MA 1AL23 1WCDJ 3NV4A 1ENSA 1V6KA 2AZ5A 3S6PA 2ZJCA 1CD3G 1JN2P 4P9LA 5GLZA 4CDUA 1C8M2 2ZGOA 4O9GA 1BVVA 3O7OA 3B69A 2AREA 2PHDA 1MEC3 3UKVA 2ZKLA 4W6YA 1TMF2 1AR92 4YFWA 4BWOA 1VBE2 3I7DA 1RJ7A 3VDDB 4AI0A 4Q4Y3 2QCSB 2PHWA 3BU7A 3EO6A 4GQ7A 1NA1A 3URFA 1UX6A 3BALA 5BPXA 1RB8G 5JPNB 5B2GB 4AVAA 2F4PA 2DYCA 3H1YA 1AR82 1A8MA 2Q0AA 2D5HA 4FPGA 3TWIA 3VHOA 3R0RA 4R4ZA 2OYZA 1GICA 4B3NA 1SLCA 1HV1A 2NYYA 4RD7A 1F2NA 2O1QA 1AYN3 1RUE2 2XJTA 1EV13 1ZBE2 2ILMA 4EWEA 1RGSA 2ZMKA 3VUOA 4E4ZA 4OHZA 3AFGA 3WP6A 4INDA 4AHXA 4Z92B 4TSVA 4W6XA 1UIJA 2ZGNA 2WNVC 2V73A 1RUD3 5CIRA 4AEMA 2ZX4A 4AVTA 1DHKB 1DZTA 1PGL1 3PVNA 3VHPA 2JG8B 1TME2 2Z79A 3KMHA 1UF2C 4BLJA 4LBOA 1ULGA 1JHNA 2WWSA 4AFCA 1Q8QA 3H1MA 3LSDA 1N3QA 3B94A 1DU3D 1Q8VA 3GHMA 3JB8A 4XF0A 3ZO0B 4ES8A 3AXEA 2VMGA 2ZKNA 2QQPA 1GZWA 1LU2A 4COZA 4WM8B 4LT5A 2E63A 2PAEA 1F5JA 3ZXGA 2XGXA 4PBOA 2Y0OA 4YW3A 3EHKA 3ILFA 4N53B 4LEJA 4LBQD 4LNVA 1KFUL 2BW8A 3HT1A 4A2UA 5H9QA 5KHHA 2ZZJA 3ES4A 1ASJ1 1ZRRA 4MGKE 4RA0A 1AR61 2ZGTA 1Q56A 3OYWB 1S0BA 2XL9A 5H9RA 3MLJA 1QJY3 3AB0A 3LWCA 3MGUA 2WJSA 4BIOA 4CDWC 5C8CB 4Q1PA 3SCGA 3C2UA 5ACA1 3KGZA 3ZX7A 1MS8A 1Z7S1 1GQHA 2P17A 4IEXA 2X8KA 4OULA 4WM8A 2DCZA 3OD4A 1KJLA 5DZGA 3VGIA 3TNQA 4WZFA 2D40A 2WZR1 4FPLA 1OOPA 1G8WA 1AX2A 1XE7A 1BBT1 3O0VA 4AHYA 4XHBA 3WR0A 4AVVA 3A0KA 3JQWA 1PGL2 1NOVA 1PNGA 2D93A 1N47A 1CJPA 3BODA 4NN0A 4B29A 4RGGA 5C8CA 1IQAA 4Z07A 3NKGA 2UWCA 3AZXA 2TUNA 4QQPA 4XPVA 3TOJA 1TQ5A 3SISA 2A73B 4Q0QA 1NLRA 2DTWA 3VBOC 4C1XA 2YYOA 4Q1RA 1QXRA 4E4DX 1NE4A 3CJIC 1C5IA 2IXLA 3DPRB 3NAPC 3V64A 4AG4A 2Z5WA 1JOJA 2YROA 5GLVA 4LHLA 1R091 4NHMA 3VBHC 3U11A 2E51A 3GNEA 4LR4A 1AXZA 4OVEA 4S2DA 5T3NA 1QMJA 1AZDA 1JUHA 1MZ6A 1UZZA 1WGPA 3WT3A 5KXEA 1OQEA 3VV1A 1DQ4A 1ASJ2 2D3SA 2PFWA 1R083 2VW1A 5JAXA 3NV3A 2VNOA 3SHRA 2Q30A 1AR62 2CWSA 3OCPA 2PHLA 1QH6A 2TEPA 1H8TC 1U5ZA 2VNGA 1UU6A 3SXWA 5ACA2 2QFEA 2V5YA 3THTA 4OLLA 1Z7S2 2D97A 5LK7B 4I01A 5FMOS 2GN7A 1LOEA 4GKYA 4DZGA 2FMYA 4XXAA 3H1WA 1PIV1 1FMD3 1YLLA 2R071 3ZIWA 1D4M2 1C4RA 3PHMA 2WZR2 4PIXA 4YW4A 1L3JA 1BBT2 1PO11 3ENRA 5EJ3A 1QKQA 4XTPA 2BVVA 4M0NA 4XHXA 5IK5A 5CNAA 2RJLA 1V6LA 2PQQA 3AKTA 1D0GA 1RUOA 5L73A 2PLV2 5BNPC 4AFBA 4FOVA 1IKPA 2ZACA 3FBMA 3U0ZA 5C9AC 4NVPA 3POSA 4A7YA 5JOXA 3BTAA 3AM2A 3ZSEA 1QQP3 1SACA 4UW4A 1J59A 1O91A 2VQAA 3E6DA 1PM7A 1R092 2GH8A 1KJRA 2Q1MA 4FPCA 4GWNA 1NXMA 4I30A 4IEWA 5BNNB 3JD71 4GB31 4RL7A 1ENQA 1MZEA 4CEWB 4E4SA 4GH4B 1QJX3 1N1YA 2H0VA 4Y1XA 3WW2A 2NLRA 3V0BA 2EXJA 1GSLA 4KG0A 5AVAA 1UZYA 3KSCA 3KGLA 2VOWA 2JICA 3AKRA 4Y4YA 4Z82A 2H6CA 3M8LA 2VMHA 1VB4A 3WNXA 3S30A 4JTOA 4XJZA 3T1MA 3POYA 5L7OC 1UPSA 4RQPB 4R52A 2R072 2Q4SA 3FBYA 1SLIA 4Y20A 1HRV2 4N43C 2BNMA 1IPKA 4OZXA 1LHVA 4JGZC 4EN9B 1PO12 2WSVA 5EYYA 5FLHA 3AK0A 3AKPA 5A33A 4BLIA 4YGEA 4RR3C 1BCXA 4GH4A 1DGLA 4GA9A 1RMU1 4HN0A 3GZAA 4G4FA 4FCAA 4DRRA 3GBFA 5E88A 1UU5A 2QKDA 4XBLA 4AQ6A 3B93A 3KM5A 1RITA 4XJAA 4Z2WA 1OI6A 1OKQA 1VLNA 3MLKA 4JRAA 2PAMA 4HVOA 1QU0A 4JGYB 4YM3A 2W08A 4AEDB 5JZGB 2A5ZA 1HIXA 2IZWA 5T52A 2H0BA 1V9U3 3O5SA 1A78A 1W6OB 4META 1W6PB 1ZZ8A 4YVSC 4RS5C 1TEIA 3NV1A 2UY8A 1C28A 4YSFA 4B7EA 4MVTA 2B46X 1X50A 3FLTA 3JD72 4GB32 1FV2A 4GWMA 1RUC3 2Z69A 4HFSA 1T6GC 1SCRA 2JJ6A 3B02A 4GIQA 1RVF3 1AYN1 4AGVA 4COYA 1VRH3 4MUVA 1S0JA 4K3UA 3MFAA 4UW6A 1PGW1 3GALA 4M3CB 3UV9A 3MF6A 3UK9A 1O3RA 3H7YA 3OPZA 1IS6A 1LJ7A 4Q0VA 4AEDA 1RUI2 5JZGA 2YPJA 3ROUA 1UCXA 3I59A 1LOAA 4S2FA 1W6OA 1W6PA 4IEUA 1ZREA 3DL3A 2YDEA 4GMP0 1V6JA 1ZRFA 2O8OA 2XG3A 4SLIA 4CDUC 4D3WA 1OLQA 4EV0A 4PBPA 1A3KA 3SCHA 4N9HA 4FPEA 2X53S 4FXGB 1APNA 1MEC2 4IEYA 3QD6A 1WW7A 4OHXA 1RMU2 1POV3 4RSUA 3ZN6B 2EAAA 4XQDA 1ULFA 3ZDSA 4MV2A 2D6OX 1PO21 3WW1A 2YHJA 4FTSA 4LBMA 1IZ3A 4Q4Y2 4XIKA 1PVC3 4CEYA 1WCKA 3RYKA 1F8VA 4FQZA 5JOYA 4NR1A 1V6MA 1H2KA 2DFBA 4L8QA 4JDMA 1SLTA 2A6WA 5GZDA 5FLJA 2QVSB 4QX5A 4XETA 1KRIA 1GQGA 1AYN2 4QPGB 1EV12 1LGCA 1VBA3 3VDDC 3ZN6A 4AI2A 2FZ2A 1ZNPA 4DNYA 3FJSA 1PGW2 3GBWA 3MPBA 2B7YA 3WHTA 1O5UA 1X7NA 3ZXAC 1RUD2 2OZ6A 1YHFA 2PAKA 1NCRB 5I91A 2XJRA 3MYXA 3TNPB 2PYTA 1FXZA 2HWE1 1H9WA 2OPKA 5EYXA 1WMEA 2ZHNA 1SFNA 1MQTB 4LUMA 4BYYA 3M1HA 4FAHA 3BOWA 4LLOA 1O7FA 3ZFFB 4QPGA 3JBG3 4LE3A 4WVMB 4FBFA 2VOKA 1S2KA 1YO8A 5GZCA 2ARXA 1HW5A 2ENRA 1LOBA 2WLQA 3E5QA 1OPOA 5GZGA 4I3PA 1UAIA 3OGGA 4WVVA 2JG8C 3FUOA 1NCRA 2VY0A 4R9AA 3WP3A 5CFCB 4TYSA 2RMU3 2HWB3 2PHUA 2XLAA 5JPMB 4Y26A 4HVQA 3KZ4C 4JTNA 3GF6A 4LO5B 5FQ0A 1CPNA 1NQJA 4XFIA 5FPXA 1QJY2 3M3QA 1D4VB 3ZXFA 2A6VA 2XJPA 5CBLA 3N7JA 3E5UA 2VH9A 4L99A 1VBB3 4IEPA 4WM8C 5D8AC 3O12A 5GLTA 4BZ4A 3ZFFA 4H7LA 3WG1A 3S7EA 3IMNA 5T55A 3S0MA 4N53C 4ATEA 3B7MA 2IXHA 2BPA2 1TNRA 2CV6A 2WS93 4PLMA 3MW2A 2BTVC 2ETEA 4P9YA 4X8PA 5CFCA 3USUA 4COUA 2TBVA 4KU7A 4XF9A 4FP3A 3WUDA 4IL7A 1COV3 4DY5A 1UKGA 1RUNA 3WQ1A 5C8CC 1PZ9A 4BM8A 2HKXA 5CA6A 3WUCA 3CO2A 4XTMA 5BYNA 3RYPA 2WA3A 1MVEA 1XNDA 2DURA 4U36A 2B39A 1RUJ3 3N36A 2E9QA 2RS31 5DG2A 2D6LX 2WL1A 1I1EA 1QQP1 1FOD3 1YRZA 1RUH3 3H0OA 1ND3B 1V6IA 2R041 1NXD1 1G9DA 4P9XA 1CESA 1LOFC 1QY4A 4I2OA 5KHIA 3LGRA 2ZGRA 3HWJA 1YJLA 4U2AA 5K8SA 3ZFEB 4CP1A 1HQNA 1R082 2ZGPA 3QH6A 1QJX1 4YARA 4IV3A 1BVP1 1AR73 1X33A 2E7TA 4XFFA 3A0NA 3VBFB 4HPKB 2WQZC 2VMIA 2X29A 4WM7A 3AJZA 2X5IA 2CGNA 4DXZA 3B00A 5CB7A 3ATGA 1MS4A 1HQWA 3DPRC 4CDXA 2EXKA 4PLNA 5CG9A 1HRI3 5CU1A 1FMD2 3ZXLA 1J1LA 5F6KA 2ZPXA 1ND3A 3WQ0A 1CR7A 4OHYA 2RS13 3ILNA 1PZ8A 1VBC1 2ZGKA 3M3EA 2DVAA 5CFDB 4MH0E 1X8EA 3ZFEA 2BFUS 4Y22B 2ARBA 2ZX3A 4MXWB 1H2LA 1QOTA 2XL7A 3VBFA 4HPKA 4LBKA 1BXHA 3ZMOA 1GNHA 1YIFA 2KXLA 1BQPA 1ZBE1 1QOSA 1EY2A 2VQ0A 3PVBB 2RS32 2JE9A 1CAVA 1QQP2 2YZ4A 4PDWB 4WZCA 4Q0PA 1NYWA 4KH9A 2DUOA 2JECA 4FPOB 1HKDA 4LO7A 5CFDA 1NA1B 4M3CE 2PHRA 1LRHA 1TME1 3DKWA 4HLTA 1VB2A 4YM0A 2WT2A 1HV0A 3MLLA 1RUC1 3I4IA 4K21A 5BNOB 3BOPA 4QHBA 1ULDA 3RMYA 1VAVA 1IGOA 4XFBA 1SBDA 1PK6B 5DDJ3 4ES9A 4V1PA 1U5XA 4MXWA 1QJX2 3ZXDA 3GBGA 4PIZA 4PJYA 2OVUA 3DGTA 1H1AA 4CP2A 3LB9A 5BXXA 2IWGB 3AX4A 4AHZA 3SNMA 3BIWE 3INAA 1BEV3 1H4GA 1U5YA 4E2QA 4OUMA 4PDWA 4FOQA 1QXPA 5JIUA 1O4ZA 3IWZA 2YMZA 2YGLA