2JG8B

Crystallographic structure of human c1q globular heads complexed to phosphatidyl-serine
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
133
structure length
133
Chain Sequence
ATQKIAFSATRTINVPLRRDQTIRFDHVITNMNNNYEPRSGKFTCKVPGLYYFTYHASSRGNLCVNLMRGRERAQKVVTFCDYAYNTFQVTTGGMVLKLEQGENVFLQATDKNSLLGMEGANSIFSGFLLFPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Complement C1q subcomponent subunit A
publication title C1Q Binds Phosphatidylserine and Likely Acts as a Multiligand-Bridging Molecule in Apoptotic Cell Recognition.
pubmed doi rcsb
molecule tags Immune system
total genus 29
structure length 133
sequence length 133
chains with identical sequence E
ec nomenclature
pdb deposition date 2007-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00386 C1q C1q domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2jg8B00
2KA3A 5TSWA 2JG8B 4HT1T 1I9RA 3IT8A 4KG8A 3V56A 1ALYA 2JG8C 4QQLA 2WNVA 3B94A 1O91A 2ZJCA 1GR3A 4TSVA 4DB5A 1TNRA 4QQOA 4G4FA 1TNFA 1D4VB 2RJKA 1OQEA 2HEVF 5KC6A 4N90A 2WNUA 5L36A 3AB0A 4QQHA 3QD6A 4QPYA 3MI8A 3B93A 1RJ7A 1KXGA 1PK6B 3WD5A 1PK6C 4QQPA 1U5YA 2O0OA 3QBQA 3K51A 4OULA 1U5XA 1U5ZA 4OUMA 4RSUA 2OIIA 4TWTA 2QDNA 2R32A 4MSVA 1DU3D 1DG6A 4MXWA 1OQDA 4F3JA 2JG8A 4NN0A 1D0GA 1C28A 3LKJA 3K48A 1IQAA 3FC0A 1C3HA 1RJ8A 4E4DX 2AZ5A 1JTZX 4MXVA 4OUSA 4KGGA 1JH5A 2TNFA 3ALQA 3B9IA 1OSGA 3ME2A 5L19A 2Z5WA 2QE3A 4D7YA 2JG9B 3URFA 4KGQA 2X29A 2JG9C 1PK6A 2TUNA 2WNUB 2WNUC 2R30A 5CIRA 5HBAA 2HEYF 2Q8OA 4E4SA 2HEWF 1S55A 2WNVB 1KD7A 4DOUA 2WNVC 4GIQA 2RE9A 5KWRA 5BNQA 1A8MA 1XU1A 1WCKA 2JG9A 2RJLA 3TWIA 4EN0A 2E7AA 1XU2A 2R6QA 3L9JT 1D2QA 2ZPXA 5KC5A 4J6GA 4MXWB 4QQ2A 3TYJA 4G3YC 2Q1MA
chains in the Genus database with same CATH superfamily
1ENQA 1VBC3 2DCTA 5JI9A 2W46A 1HJFA 1IG3A 2SLIA 2IFRA 1AR83 3N9QA 4Q29A 5DZEA 1REEA 1UY2A 2YC0A 4A7ZA 2QKDA 3ZSMA 5JR7B 3UK9A 2QQNA 4P9IA 3NKTA 5AC92 2DU1A 3X29B 4JKLA 5FMOL 1MEC3 1FV3A 3AZXA 5JZGB 1UY1A 2GN7A 1APNA 3UGHA 3VDCA 5KXEA 3T2QA 4FTEA 2K46A 3AFKA 5JSRA 1Q3EA 4Q8KA 5KXDA 3WCSA 5L36A 2BDRA 3MICA 3HBZA 2JIJA 3KT7A 3VUOA 1YQ8A 1ZBE1 3HQUA 5ABJA 3ZMOA 1S0BA 1EPZA 1YIPA 3RSJA 2PLV3 3J7HA 5F5IA 5DAPA 5IUQA 3WD5A 4PBPA 5IW0A 1BK1A 5T55A 3VZJA 3ZXJA 3P5BA 4KI5M 1RUG2 1CVNA 4BK4A 4YM2A 3OTFA 2ERFA 1RXFA 1MS9A 1W8UA 2R061 2R1BA 4XTPA 4Y1UA 1IKPA 2B4KA 5A33A 4COWA 3POIA 3D8CA 2PQQA 4FXKB 3LIGA 2VZ3A 1GZTA 2D98A 4NAOA 2BGOA 5FY0A 3VDDB 1Q8QA 1UO9A 3KMHA 1LOFA 3VBOB 1QDCA 1YFYA 1K5MC 2VQ0A 2VMDA 4LO6B 1WW6A 4ASLA 3LEIA 4LK7A 1WCDJ 2HWE1 2J1TA 1BBT1 2WQZC 3GJAA 3H1YA 5C4WC 2ZKLA 3MBWA 1CJPA 2WO1A 4CP9B 1PMHX 5DABA 4X6QB 2BU9A 3VHPA 1SDWA 5FPLA 2WQ8A 1RJ8A 4AYUA 1ASJ2 3N7LA 1AX0A 5FP7A 4XIKA 1YFWA 1W6NB 2VMGA 3HQRA 4WV8A 5IK4A 3QACA 4KBZA 3DPRB 2MEV3 4GJYA 2OPWA 4QX0A 4LO5B 5I0TA 2J1SA 5FJHA 1PIV3 1W0NA 2VBDA 2YY1A 1N1SA 4PJYA 1AXZA 5LK7B 2RMU1 3T09A 2JDZA 2PAEA 3KGZA 1QXPA 3JQWA 3WEZA 5I0SA 2VULA 2P3JA 4HOOA 3UETA 2ZGKA 4QHZA 1VIWB 2A1XA 1W2TA 2B46X 2BBVA 1QXJA 4META 3GZUC 5A3PA 4OVEA 2DFCA 4OFGA 1QGLA 2YZ4A 4KU8A 2QTWB 3MDPA 1UYPA 1JOJA 1ZZ6A 2RS31 2UYAA 4XFGA 2BBAA 1SLLA 4UBHA 2ZEWA 1L7RA 1K3IA 4NAMA 1SACA 1VBA2 2R073 1C8M1 5KHKA 4A3ZA 1YHFA 1L7QA 2XJPA 2QQLA 4OZOA 4K3UA 2XL9A 3AKRA 1DZQA 3Q8CA 5GZCA 2ZZJA 2XWJB 2WBKA 4IEUA 5ANNA 1RUI3 1SLTA 3AX4A 4ZU7A 2NMOA 2WO3A 3N9LA 2E51A 1QJU1 4L92A 2PQSA 2JENA 5C8CC 3IB3A 1L7LA 3LCPA 5H9PA 5A1LA 4B1LA 1J3PA 3SITA 3AJYA 4N53A 4C0HA 5BNNC 4CEWC 1VRH3 2W2IA 5LA1A 4CUCA 4EN7B 4RR3B 4C8DA 4X6RB 3I2OA 4LLOA 4RHV3 1D4VB 4AVCA 5C3RA 4XF4A 3J9SA 2I45A 4XUNA 4PDWA 1VMFA 5CFDA 1YQ2A 5FXVA 1D0HA 1FMD1 1H4GA 4QT6A 2LW8A 4JQRA 4HN0A 1KJLA 1MQTC 1PK6B 4NROA 2HWD2 3WHUA 4CP2A 5IVYA 4CCLA 1FPN2 1PO21 3OOXA 4Q8LA 3WQ0A 1C4RA 2JDMA 4FPEA 3NV4A 1OC1A 2ZGTA 1HDKA 2GC0A 3WOGA 3EO6A 1A34A 1V6OA 1PMIA 2O8QA 5FPBA 3THPA 3O0XA 3VL8A 4O9GA 3HR9A 1PVC1 3NQHA 4Y20B 4Z8BA 1UIJA 3P6BA 3VBFB 3KWVA 5FRAA 1DDLA 1G8WA 4FPOB 3MZHA 2G9GA 2P3YA 4D7SA 1L3JA 4HN1A 2PHDA 4A6SA 3WDWA 4F3JA 1JYIA 1RINA 4R9BA 3K2OA 4AQSA 1GKBA 3HPNA 2PN5A 1OUSA 4IERA 3JUUA 4HSJA 2I2SA 4WVMA 3VBHA 4LBKA 2KM2A 5J3UA 2BQPA 3LKJA 4RGGA 5CU1A 5HV4A 1AR72 3ILRA 2Y0OA 4BB3A 1MZFA 3U78A 4BOWA 4AG4A 1Y4WA 4BZ4A 5A7QA 3AYCA 1WA6X 3WHTA 3TOJA 1AR61 3T0BA 1X7NA 2AACA 3HIFA 3ALQA 4BHPA 4PIZA 4J25A 3T08A 2J1RA 4XF9A 2BVBA 4D7YA 3M2MA 4NR1A 2E63A 4GALA 2VCCA 4NRPA 1WD4A 1G9CA 3V0BB 2ZKNA 2DVFA 1B35C 1OKQA 3NVCA 3BTYA 2IWGB 3OPZA 4BWOA 4ET7A 3GZTB 4XDPA 3AP5A 1YRZA 1Q43A 3SLIA 2UWCA 4HETA 2NZ9A 3N7KA 4BMBA 5HBAA 3WF1A 4P02B 3BGAA 3RVHA 4AF9A 4JTOA 3KV9A 4QPGB 1GFF2 2VNVA 4MGZE 2GZWA 3ACFA 5E16A 5IT6A 1ZA7A 1O8SA 1W2UA 5KHGA 1SBEA 2Y33A 4TN7A 3MIGA 4A7KA 3VBRB 1J84A 2RS51 2FHRA 2LRPA 2LALA 2VL4A 4KH9A 3TEWA 3O1OA 2YUEA 1UXZA 3D0JA 3GBFA 2E7AA 3ZKUA 4AVBA 4ASMB 4QXCA 1D2QA 2YU1A 3DKQA 3MF6A 2C0ZA 5L7OC 4BMEA 2QQKA 4MXWB 4QQ2A 3ZFGB 3HBKA 3N9NA 3BTXA 1W04A 3K77A 3M4FA 4Q0QA 1HW5A 1X9TA 2XJQA 3NW4A 4CUAA 3S5AA 1OA3A 1R1A3 1O91A 1YNAA 4IEVA 3VBSA 3FLRA 2YG0A 4MVTA 5FZLA 2VZOA 2ZS6B 4CDXC 1JW6A 4XBLA 5HCAA 5FZ9A 4G4FA 1OOPC 5FMDA 1VR3A 2RDQA 4UW3A 1ONAA 2ZGUA 5FP4A 1LGCA 2NYYA 4YVSC 1OQEA 2XVGA 2WKKA 2FDIA 3WG3A 5C3PA 4RQPB 4AFCA 3CJIA 4YG0A 2XJSA 1HRV1 2QVSB 2XJTA 2DCKA 2JE9A 4PLMA 3K46A 5LK5A 3WP3A 1DQ1A 1WW4A 3AMPA 2EXIA 1R082 3E6CC 1RUJ2 4BQ1A 4Y22A 3NSTA 1JYXA 2VMHA 4UAPA 1SCRA 2CAUA 3QBQA 1R091 1VBD2 1CAWA 1GQPA 1DQ2A 2VH9A 1KQRA 2VY0A 2WWJA 1HQWA 1R1ZA 4QWNA 3VZNA 4ORFA 2WZPP 2Q8CA 1MPXA 4JV4A 3I3EA 4CEWB 4IV1C 4AFAA 1OI6A 4NHMA 5IK5A 1NCRB 5A7OA 2VW1A 1J83A 5D2AA 4CEYC 3TAYA 5FQ0A 4NOTA 1ENRA 2WSVA 4QU1A 1I5ZA 5F6KA 5HCFA 1OBNA 3ORJA 5A3LA 1W6QA 1LECA 3KB5A 3K75B 4WM7C 3WT3A 1VMHA 1D4M3 1NOVA 4Q1PA 2FDKA 3PMSA 2XJUA 2JG8A 3G7DA 5CVRA 4YGDA 2QBXA 4LIVA 1OD5A 2A3WA 1COV3 1UW8A 4JGZA 3OYWA 4CCKA 1GUIA 3OPTA 1CJDA 1BMV1 4B4RA 3F95A 3CKHA 3K3NA 5FZDA 2UYBA 4HXCA 3PVEA 1AHSA 1AR91 2VZRA 2Q30A 1LR5A 1OQ1A 1WZXA 1XYNA 2RHPA 2GMPA 4QX7A 2WL1A 3CL1A 3ELNA 2L9LA 4FO9A 1PHMA 3WNPA 4CE8A 3MLJA 2VBPA 3LGRA 1V6KA 1POV1 4WBBA 2AH2A 4YZ4A 5CEHA 4XOGA 2C24A 1C5IA 4FOVA 2XH6A 2D7FA 2WIIB 2JG9C 4CDQC 3FUQA 3ZSKA 5IVEA 2XXZA 4GJZA 3WDTA 3JBG3 3ZYGA 2X09A 1CIYA 2WNUC 2R30A 2JD9A 4CDUA 1QJX2 2CTVA 5C71A 4LEJA 2XMLA 5DAQA 5GJ6A 4CCJA 4D3WA 2O8OA 2XLGA 2VTXJ 1VBB3 2VMIA 1GOFA 2WNVB 3KS7A 2Y6KA 5J7MA 3HT1A 4I0AA 4JX0A 4YLZA 4XILA 4TLFA 5JIAA 1RMU3 1SLCA 3MYXA 4FPHA 3PVOA 4EJRA 1OF3A 4JVAA 4QU2A 4Y1XA 4X8PA 1WCKA 4JTNA 4QDRA 2PAKA 2VPVA 4AI2A 3HQXA 4ISQA 1PGW1 2XOMA 3BU0A 2BGPA 4BXFA 3JU9A 4LBLA 1REDA 1O3RA 1TZOA 5LB6A 2RS12 1BEV2 2EAAA 2X5IB 4G3YC 3THCA 2R16A 2PTMA 5JOWA 1ZZ9A 4BQWA 4LT5A 1I6XA 2XQXA 4XFHA 3FL7A 3NV1A 1I1EA 2R072 2DVGA 3VZMA 4GB32 1CESA 4EN8B 2W1QA 1AYM1 2VNRA 5F6LB 2BTVC 3IZOA 1YIFA 1QF3A 1LHNA 4JRAA 2X05A 1TME3 5JXGA 1G9DA 5D8AC 3S57A 2JB4A 1WMXA 1TNRA 1LU1A 4GH4C 4XUOA 1VE0A 3KCYA 5K4LA 1NCQA 1Y3TA 4H14A 1O7FA 1QQP2 2VU9A 4FOQA 1UZYA 4LBOA 2XLAA 3ST7A 4XXAA 3AVSA 4LA2A 1JZ5A 2XUMA 3ZYFA 3USUB 4CRQA 1OLMA 3U1XA 1H1MA 2OA2A 5I8YA 4XFCA 5ACA3 1FYUA 2QQPA 1KJRA 5J96B 4MGTA 2Z42A 1DIWA 2WAAA 1QJY3 5EJ1B 2BEOA 1IG0A 3AP7A 3N9OA 4S2HA 3ECQA 2EA7A 4UFMA 1OA4A 1TEIA 4R52A 3WX5A 4OUMA 1AYN1 5JMOA 4COYA 4JKKA 1DCSA 2CY6A 1OT5A 3U07A 3WLUA 3PUAA 4FPFA 4Y4RA 1HIXA 3I54A 2YU2A 2CGPA 2RDSA 1JOPA 3J8F2 3NV3A 3R4UA 4WM8B 1DGLA 3JD73 3VBUA 1OQDA 2BW8A 5LATA 4LUMA 2EVXA 4F8AA 4COVA 2B39A 4XBQA 2K2SA 2LUWA 1S2KA 1S0DA 1UOGA 3JXSA 3IDCB 4Q4X1 5F3GA 1GANA 5C3QA 4P9LA 1JXNA 4XHXA 3UNPA 4AFBA 5LW9A 1UL9A 3ZYJB 3JQXA 3M3CA 4YM3A 4CCMA 4JZRA 2AZ5A 4EZHA 4SLIA 5DUVA 1GMMA 1HX6A 3CMGA 3OF1A 5G04L 1SFPA 3DF0A 4SBVA 4MLOA 4JDMA 3SNMA 1W0OA 2A7AA 3BIEA 4PIXA 3VGIA 4LNVA 1SPPA 5FYMA 1C8NA 4AQ2A 4LKEA 3IMMA 2JDHA 4BU2A 1YXWA 1QOTA 2DUOA 1YI7A 4GAZA 4AEDC 4HONA 3H1MA 4OQ8A 1YJKA 4W8JA 4UI9L 1WA4A 4Q2FA 1AZDA 3U37A 3ZSEA 3I3QA 3MGUA 4DXTA 4PF1A 4H7LA 4Q27A 2OXBA 3BI3A 2HWF2 3H3LA 3QH6A 1FOD1 4Q4W2 5BNPA 2R043 3GM8A 1JOBA 4N8MA 4XMIA 1F15A 4A44A 1JZ3A 1LHVA 3NAPC 3BVCA 4BISA 3BYWA 3WF4A 4NUBA 1XSQA 4GIQA 4HK9A 4PI2A 3KGLA 2WWSA 3B5LB 4BJ0A 1A8MA 1B35A 4IV3B 2RJLA 3GGLA 4Q5OA 2JDYA 3PVNA 4EN0A 1YUDA 2JDNA 4QKFA 4BE3A 2PHXA 5GZEA 2XG3A 4CU8A 1N1TA 4D6SA 4OI4A 4YARA 5BXXA 1J59A 2ZGSA 2C9KA 1ZBE3 4I01A 1H30A 1XE7A 4YW3A 3D82A 5CFCB 3LDRA 1PX3A 4QPIA 2YBKA 5DDJ2 1RUH2 1HRI3 3POSA 3N7MA 3NO8A 3ZDSA 2GP3A 3WF2A 1RUC1 2V4VA 2YC4A 1JU4A 1NA1B 5E6HA 2ZJCA 2J1EA 2D6NA 5DN2A 1LNSA 1Q56A 1GR3A 4TTGA 2R063 4RS5B 2NQYA 2WZEA 1Q8PA 2W0XA 4AAPA 1Y7BA 2RM21 1TMF1 1A6CA 1XBFA 1ND3A 3PTRB 5JPNB 3LDKA 1N3PA 1W28A 2V72A 2JE7A 2A6XA 3GF6A 2HEVF 2DTYA 3E1F1 1DGRN 4N90A 2D6LX 5JCTA 1QH7A 2VUJA 1OLQA 1IPSA 3CO2A 1WMDA 3I59A 1CAVB 3ZO0B 3QD6A 1HB4A 2HWE3 2Y64A 4LKDA 3ZMNA 2XJRA 2W5FA 4MADA 4A4AA 5GZFA 1BYHA 3CDZB 1BBT3 1DLLA 2WFF1 3ZXEA 3AXEA 2YDEA 3LF7A 4PQQA 2LM3A 3UV9A 3N4MA 1W6OA 1WKYA 2DUPA 2BPA2 1AL21 4NHYA 2XL7A 3SH3A 2WO7A 4DY3A 5D8AB 3NJYA 1EUTA 3ILFA 4XURA 5LBBA 5JMCA 4B7EA 2RDNA 1ENXA 1DQ0A 4MSVA 3SQOA 1X36A 5C9AB 2VW0A 3D0SA 3CU7A 1UZVA 3NJZA 4P9JA 3LEGA 3ZPOA 4TXWA 2EIBA 2WAOA 3FFQA 4TLGA 2VCMA 3ENRA 4Y1ZA 3ZOIA 2UURA 3ZXAC 3VDDC 4XJAA 3VBOC 4N9IA 2RMU3 1UY0A 3WNOA 2FBEA 2DV9A 1RB8G 1XNAA 5FTTC 1H6YA 4NO4A 5I0RA 3GBWA 4YVWB 5AVPA 4IV1A 4AGRA 2VBBA 2WT0A 4AHYA 2RVAA 3H8XA 1F2NA 1W9TA 2A70A 4FTBA 1ND2A 2VE1A 4K40A 1C3HA 2FZ1A 1H2MA 2HWB1 4GULA 4JC1A 4WM7A 1Y9MA 3VV1A 1JYNA 3FJSA 2W87A 3AZWA 1YQ5A 4I3PA 1LOGA 1C8M3 3O1RA 2Z5WA 3LZZA 3MPBA 3TN92 3DPRC 3DL3A 1ULCA 2EXKA 4Z82A 4B1MA 1GZWB 1E5SA 4HPKA 4KGQA 2ZEZA 2ZMNA 1V9U3 4CU9A 2W95A 2W39A 3OB8A 3WW1A 5CIRA 1QJU3 3H9AA 2WZR2 3R05A 1UOJA 2VXJA 1FAYA 3ITQA 3T1MA 1DBNA 5A3OA 2BWAA 3TB0A 1SFYA 4YW2A 1JYCA 5FY8A 1OLRA 3ZYRA 5FYVA 4N7UA 4QM9A 5CAZA 1W2OA 2OS2A 1GP5A 4LOSA 2V5DA 1W05A 5A33B 4OHYA 4L99A 4QX8A 2JG9A 2GP5A 5FKCA 2UWAA 4RD7A 5CA6A 1J3QA 4FPJA 3KLSA 4QB2A 4R8HA 4YW4A 2XHKA 3UGFA 5L9BA 4JHTA 5AC91 2A5ZA 1KFXL 3VD9A 3S7IA 1FMD3 2XVLA 1LU2A 3LSDA 1BXHA 2HKXA 3WNLA 3OGRA 1BQPA 2VCBA 3EYPA 1LRHA 1OD3A 1PO23 2CYFA 2GH8A 2H6CA 2DCZA 4BQ2A 1XE0A 5F7UA 3AZYA 5T5OA 3W5NA 5F32A 5LEKA 1RTVA 1F8VA 4MG2A 1KS5A 5JR2A 4LJHA 5J37A 1YQCA 5F2WA 1QU0A 3BB6A 1AX2A 1PVC3 1QXRA 2WNOA 4IEZA 1UYYA 3MFCA 4LMFA 1Q8OA 1V6NA 3PL0A 4RR3C 5FZIA 5C5UA 5FMOS 2VVFA 3OGJA 3GJBA 4NHXA 3WV6A 3VDBA 1LOCA 1H1IA 4PIYA 2RR11 1WGPA 4GKXA 1JHJA 1Q8VA 2VVDA 1NY72 1OXCA 4W6YA 1TQ5A 4MGKE 1IS6A 2ARCA 1PK6C 3S30A 4LBJA 3CZUA 1O59A 2NPIA 1CD3G 4GH4A 2A6WA 3CIHA 1P8JA 4CU7A 1LKNA 1RUOA 4MHUA 1PNGA 5F3IA 2OIIA 4DQAA 1RVF1 1AR63 4CXWA 4F7ZA 2DCJA 4RGKA 2JD4A 3K4ZA 4MYEA 2A73B 4XETA 3VBFC 4Y5SA 1J58A 1ASJ1 3B9CA 4GMP1 3UKTA 2W1SA 1A78A 2FCTA 3I2JA 1RYYA 3DXTA 1X50A 2C4XA 3O0WA 1UN1A 5DQ0A 3KF3A 4FFHA 4LBMA 5LBFA 1EV12 1US3A 5FK8A 1G6NA 5A6QA 5KBFA 3WINE 2P3KA 3CHXA 3ZXGA 4EWAA 5BNOA 5LWBA 1O8PA 4YW6A 2YPJA 4W65A 3UL2A 1YO8A 5FPAA 3VHNA 1MS1A 3JD72 2YROA 1S0IA 2ETEA 1U0AA 4N53B 2RR12 1RHI3 4QXKA 4UFJA 2RS53 3T0AA 2XBO2 4DUWA 5FP9A 4YGEA 1QKQA 5DAWA 5LEJA 4CCNA 1GP6A 4P5HA 2X29A 2LS6A 2WS92 4PDWB 5T5PA 3LQCA 2ZMLA 1VBA1 3ZKYA 5FZ1A 2D3PA 2KXLA 2VCAA 1O3TA 2B8MA 4Y22B 5JPMB 1RVF2 3U0ZA 3O1TA 5J48A 5F1RA 3CJXA 3WQ7A 4JGYA 1UCXA 3LAGA 4W4ZA 2CGNA 5A70A 3ZIXA 3D3AA 1NUKA 4QPGC 5BV6A 4XF1A 2CL2A 2BOJA 5CKMA 5F2SA 5LRSA 3EQEA 4QKNA 2CDOA 4UF0B 3A0NA 3U75A 3KD4A 1PZ8A 3IM0A 4XZPA 3VBRC 2B9UA 3ZFEB 5FOBB 3VD4A 2A75A 4ES9A 5IVVA 1HRV3 4DUVA 5KC5A 2R042 1POV0 3JCIA 5IHRA 2FDFA 2XQRA 3WUCA 1PO12 1XNCA 4K8RB 3TRSB 2R0FA 1X33A 4FSJA 4MGIE 3ZFGC 1JZ7A 3WP6A 5F5QA 4HKWA 2W08A 1CQ9A 1ALYA 2WJSA 1TVGA 3J7LA 1DGRA 3B94A 1V00A 1R093 5FZ7A 4WVMB 3ACLA 3H1WA 3UGGA 3B00A 3SC7X 1EAH1 2Y34A 5FY9A 1UY4A 4TSVA 3CNAA 2HWD1 4INDA 1B09A 4K20A 3PU8A 4NPRA 4OYUA 5FZEA 4HVQA 1FPN1 4AEJA 1YYNA 2H0BA 1RUF2 3LEKA 2GH2A 3SHRA 2RJKA 1G9BA 1HRI2 4E2SA 4M0NA 3NWKA 1GNZA 2ZMKA 3VKNA 4XF0A 4HBNA 4ZXKA 1JZ8A 4RQPC 5FY7A 2BGCA 2ARXA 4HFSA 4YZ3A 3MLLA 2WA4A 2KR2A 4O61A 2VMCA 3UESA 3VD7A 1M4WA 3APBA 4HANA 1ENSA 1WWYA 3EHKA 1N47A 4LTAA 4Y33A 3SISA 2FCUA 3UJQA 3AM2A 4GWIA 4XFFA 4Q0UA 1OLME 3OD0A 1AR93 1VB4A 5ANQA 5I93A 4ZZ5A 5JZGA 4KNCA 1NCRC 4H7MA 3B01A 3E5XA 4CP0A 4BQ3A 3W5MA 2DWRA 2WN3A 1DLCA 1AR71 4QPWA 4BXSV 3PIGA 2HWC2 2CNAA 2QJVA 5FZAA 5KHJA 4R4ZA 1XB9A 5AFEA 1CAXA 1C1LA 1RUE2 1EAH2 1WMEA 5JOYA 3H3UA 1GZCA 1SHWB 5F8PA 4CPBA 1W06A 5GKAC 1Z7S2 2GNBA 3OUIA 5CBLA 3MLKA 2RJ2A 3I3BA 3P1IA 4TZDA 1CONA 3KSCA 1S2BA 2V5YA 3BOWA 5FZ4A 4URAA 4CP1A 4AQTA 3CLPA 1NQJA 3VDDA 1JODA 3K4DA 1QIQA 3VBOA 4NRQA 1O4YA 1W6PB 4CDWA 4W6WA 3HN3A 2W91A 4Z2AA 4QX2A 1DQ4A 2DDUA 3H42B 1H8TB 1KS4A 3SH4A 4UW5A 1UWWA 3CJIB 2EIDA 3OPWA 1QMJA 4KU7A 1Z78A 1CGPA 4BM8A 2ZHMA 4HZFA 1V6IA 3PUIA 1PVXA 1K12A 3MO4A 2DVAA 4ONUA 1AXKA 4QKBA 4MGSA 4XFAA 2OT7A 3GYDA 1MS4A 1NG0A 5CG9A 1AYM3 5DUUA 3WP5A 1W6NA 1CAWB 4AI3A 1UX7A 3M8LA 4XDOA 2N7GA 2Y6GA 4DOUA 2WNVC 5FREA 2GU9A 1ODNA 5FZBA 2DVDA 1I5PA 1DYPA 1XU1A 5FQ0B 5JIUA 1TG7A 4JHZA 2PELA 1UZWA 3TWIA 3RZJA 2Y26A 2R6QA 4YW1A 4AI9A 1VP6A 1W6QB 1CAUA 3OSDA 1Q5OA 1STMA 5T5LA 1CZVA 4NE9A 1E5IA 5EHDA 1UZZA 2P3IA 4P9GA 1QJEA 5BUVA 2JG8B 3IT8A 1JN2P 4PT6A 2X5IC 2VUDA 3IN9A 3Q8BA 1MACA 4XJWA 1AR81 2I07B 4Q4Y2 1FNZA 2QQJA 5JOXA 3VD5A 4Y24A 1SCSA 3AL6A 3OBZA 5LA9A 1W9SA 3MV01 4E2GA 1GOHA 4JGZB 3OYWB 3USSA 3ZFFB 1AYN3 2WABA 4S2DA 1R081 1RUJ1 5B2GB 3HJRA 1WW5A 1HN1A 2P1BA 3O12A 1VBD1 1OKOA 5JXHA 2QQIA 5K0UA 1PNFA 2AUYA 4IW3A 2ADDA 4CCCA 1W3VA 3FX3A 3PUQA 1J1TA 3JB4C 3POGA 4R9CA 4WVVA 5HI0A 1NLSA 3I49A 4IGOA 2WT1A 4XUTA 5A6YA 1SLAA 4BQ5A 5JXIA 1RJ7A 1JYVA 5FAXA 2D97A 2D43A 2OUHA 3AFGA 1G7YA 4N43A 3KQRA 4DRRA 3H7JA 4Q4X3 4CDUB 4LQRA 1X8MA 5C5TA 4XABA 5L9VA 1XSRA 1W0PA 2PHUA 3ETPA 1QOOA 1ZRCA 4RR3A 1FT9A 2D5FA 4O7XA 1N1YA 1ZBA2 2V4AA 5K7PA 1DG6A 2B45X 4GXLA 4CCEA 1VBC2 1HN0A 3J7NA 5A7PA 5IFPA 4IE6A 1BVVA 1ULEA 5KHIA 3NV2A 1AR82 3I7DA 3GHNA 1XNTA 3WNMA 5FIXA 2D3RA 1EP0A 5IK8A 5H9QA 4WM8C 3VZLA 1GWLA 1LHOA 5T54A 2ILMA 4P5YA 4XPVA 3LD8A 5A80A 3HNBM 1JZ4A 1LOBA 1QWRA 2VNGA 3POWA 3ZPYA 2Q0AA 3HOBA 3BOPA 3LIHA 4Q4V3 4CPBD 5IVJA 1MEC2 3I8TA 2IXCA 1LGBA 3OGGA 1FOD3 2C1FA 2CWMA 4UWDA 2F4PA 4ZY9A 4DEQA 4NPLA 4OI2A 2KD7A 3FC0A 4Y20A 2D3SA 3L2YA 1HKDA 5DUXA 5FZOA 1QJX1 3VZKA 2GNTA 4ATEA 5LCWL 4FXGB 4HK8A 1YWKA 1AJKA 4LKFA 1SG3A 1OSGA 1GQHA 1VBE3 2ZGNA 2PLV2 3ME2A 3WQ1A 4ZKTB 1NCQB 1WUVA 3WW3A 4B4PA 5B4XA 1H9WA 4XJ8A 1CX1A 2VNOA 5LY1A 3KHCA 4PLNA 3INAA 4Q0SA 1O5UA 2TUNA 3R6SA 1UU5A 2EALA 4P08A 4AL9A 3FZ3A 5CKNA 1ZNPA 4EE2A 4OI1A 1RHI2 3T3YA 1RUC3 4DRVA 3ZN5A 1HV1A 1LJ7A 1JS9A 1RXGA 5A6ZA 2RS11 1BEV1 4K8FA 4AAXA 1BVP1 4BPZA 4MOAA 2RM23 1TMF3 3U10A 1W8OA 3WCRA 3E6DA 1K5MA 2R071 2V73A 3RYKA 3M3EA 3ES1A 4GB31 2GNDA 3NMBA 4A42A 2VOVA 2E7TA 1S2EA 3FHIB 5DPNA 3V0BA 1XU2A 4IV3C 2ADEA 2W47A 2D44A 5A7SA 5C4WA 4NPMA 4XAAA 3VBUB 4KWJA 1VPHA 1QQP1 1ZRIA 5CFCC 3FLPA 1JU3A 5LBCA 5J1XA 4LOTA 3NNJA 3WP4A 2UWBA 1KDMA 3E6BA 2DUQA 3T2OA 1NA1C 2MEV2 2R0HA 1SBDA 2VZSA 2EF6A 3AP6A 4XVHA 3ZXDA 1LOAA 2UU8A 4YYOA 1PIV2 3IKWA 2ZX3A 1HXS3 3QLQA 4ZPIA 5I8TA 2OW4A 1EY2A 4NIDA 5I0DA 1RGSA 4RS5C 3WXPA 2YGLA 1SMVA 2FDGA 2XDVA 3WF3A 2Q8EA 3FBMA 1JYWA 3DUIA 1SPPB 3ZXKA 3HMYA 4XQ4A 4QHBA 1KITA 2ARAA 1GNHA 3AB0A 3P3NA 4E2QA 5EYXA 2VZQA 4M00A 2ZHKA 4L0PA 3LDBA 1MR5A 4BH9A 2QQVA 2P6HA 4I0BA 1W6MA 5JVVA 1S0JA 1S1AA 1K42A 2VTFA 2B42B 1U5YA 1GBGA 1KGYA 3J8F1 3LA2A 4OULA 5FR3A 2AEYA 4UFIA 1OH4A 4IGQA 5BNPB 4IEPA 1LESA 3GHMA 2W94A 2F4LA 2HYKA 2QDNA 1LOEA 3UJOA 2J7MA 1DF0A 4CTEA 4Y3OA 1MZEA 2DFBA 4KWKA 1RUI2 3WDVA 2ZACA 2DBNA 1JMUB 2E9QA 3A0KA 3C7FA 4AHZA 2YYOA 5C9AC 3LOBA 2HLEA 3C7OA 1N1VA 4XHBA 3ABZA 3V65A 1UU4A 1RUD3 5L73A 1OVSA 4CCOA 5C8CA 4LPLA 2BYVE 2YV8A 3KM5A 1VRH2 5EQUA 5FKBA 5FOJB 1W3XA 1G86A 1W8TA 1ZREA 4YVWC 2NLRA 5GLZA 4QPIB 2D6PA 4CEWA 4OHZA 5BNNA 1ZZ7A 4RHV2 3D6EA 3RWKX 1PGL2 1GQGA 1W2NA 4TYSA 3M7AA 2ZHLA 2WFPA 2Z4FA 1YC61 2IXHA 4UW6A 4AHXA 1PZ7A 3O5SA 5JAXA 5FY1A 5FJKA 3MW4A 3RMXA 2HWF1 3LPGA 3RPQA 1XYPA 4H2AA 1ND3B 4Q4W1 1JHNA 2QE3A 4OHXA 4COZA 2GMEA 2ARBA 1MQTA 2Z79A 1YQ6A 5AC93 5F3EA 5K8SA 3RDIA 2B5HA 1FV2A 3DKWA 4UFLA 1F4AA 4GMP0 3BALA 4Q26A 4IUGA 4N7IA 4A2UA 4DEVA 5ABJC 2ATFA 1LULA 4ARXA 4IEYA 2FMYA 1UX6A 2HEWF 2ZZQA 4LULA 3RG0A 4LR4A 1RIRA 2XGXA 1W6OB 3BPZA 1WMFA 2UY9A 3CQOA 3DXUA 3WZ1A 4AE2A 3OBTA 1RUH1 3ES4A 5DDJ1 3ZVXA 1MS5A 2RE9A 2EXJA 1RUG3 1XNBA 4V2VA 2XPJA 4BA6A 4QX5A 5LRRA 2A3YA 5JSOA 2WR9A 4LLFA 5KR7A 1SFNA 4ZHNA 5HV0A 1G9FA 5EJ3A 2DBIA 1UKRA 3H50A 4HVRA 3RYRA 4P9XA 1H4HA 3BODA 3KV5A 3V56A 4Y5TA 5FBJA 5EP9A 4QQLA 2WNVA 1R1A1 4QXHA 5I8SA 3VB9A 4WZFA 1WCUA 3OBAA 4RGAA 1KEXA 3VDAA 1XNDA 3THDA 2BOIA 2C6SA 2IXIA 4S2FA 4LO8A 4H55A 1BHGA 2ZEYA 3AMQA 3RZGA 1UMIA 2YXSA 4JRLA 4XFBA 3BN6A 4PQ9A 4FFIA 3MIDA 1T2XA 3LA7A 1QHDA 1DQ6A 2JDAA 1D7PM 4PBOA 1ASJ3 2FCVA 4OHWA 3ZXFA 5FMBA 4HPKB 4YW7A 1K45A 5ISLA 4HKOA 4P14A 3ZYPA 3J26N 3WG4A 3RNSA 1YCIA 4AZZA 4LHSA 2CAVA 3FMGA 2VQUA 4AOCA 3PIJA 4GWJA 1FNYA 3AVRA 2JEMA 2WDBA 4ZXEA 4P9YA 2QUOA 1NLRA 2VOTA 5E1RA 4GKYA 1SBFA 5FYCA 3FUOA 2J1UA 4QGLA 3RWNA 1GNYA 4WVZA 3VKLA 5L7OA 5FZ0A 4ATFA 5FXZA 3GXUA 2G1MA 4ARYA 1DZTA 2OKXA 1R1A2 4E4HA 4KMQA 1EUUA 3OGVA 1F5FA 5AVAA 2ZOEB 1REFA 1O6UA 1O3SA 2GC3A 5FPZA 1YJLA 2K9ZA 4ITCA 1JYTA 4IQPA 4IETA 2XKOA 3TN91 3WNXA 4CDXA 5C8WA 3B69A 1LB2A 2VO5A 2C5DA 1H0BA 1OOPA 1YFUA 3D5OA 1ZYBA 3OY8A 4LXLA 4CYDA 4MGQA 4YVSA 4S2GA 2WZR1 2VG9A 4YW5A 1OPOA 1JH5A 3VHRA 1CN1A 1MZ5A 4N53C 3FBYA 3OD4A 3HD8B 2H0VA 4WM8A 1JUHA 1IOAA 4BDVB 5L19A 5FP3A 5FPVA 3I97A 2ZX1A 5LBEA 3EJKA 5HPOA 2VOXA 4CVUA 3ZDVA 1V6MA 4AI8A 5EZWA 3RZZA 1MVQA 3LEMA 1E5HA 4M3CA 3JBG1 4UBGA 2E53A 4CU6A 3H3ZA 4M4PA 4PDWC 4P00B 4CZSA 4FI9A 4AWDA 5CFDC 4FPLA 4XC9A 1UPIA 1XRUA 3OJBA 1OA2A 1QH6A 3VZOA 3VKMA 1DGWX 1H6XA 2HEYF 4I2OA 4CEYA 1VBE2 1NLQA 2GAUA 4E27A 1H9PA 1VBB1 4WVWA 1W8WA 2RS33 2GC1A 1JZ6A 2GSYA 2HWD3 2VVEA 3AYDA 5A32A 2WLQA 1D4M2 3PDQA 1FPN3 3S5QA 1HLCA 3FHQA 2K0GA 4D7TA 3OEAA 5BNQA 1ZZBA 4FPYA 1JI6A 3AZVA 1CX4A 4I30A 2XJVA 4R9DA 3V0AA 1V0AA 3L9JT 4XACA 2BZDA 1COV2 1VAVA 2W52A 2ZGOA 4DUXA 2A6VA 5FLIA 5A1FA 3ZFEC 2QFEA 2VC9A 5IVBA 1IQDC 2VMEA 1NE6A 1NZCA 5EJZB 4EWEA 2PA7A 1V70A 4OMCA 4QD2A 4QX1A 5FP8A 1MS3A 5HXMA 2OQ6A 5BYNA 2NM1A 3KT1A 1LTEA 4RYDA 2G4IA 3ON7A 3ZR5A 2PMWB 4MH0E 4NIIA 5BNOB 3C8XA 4ZONA 1NY71 2DURA 2A6YA 2ORZA 4W6XA 4EROA 4DB5A 4A6OA 4Y5Z0 3ACGA 3AJZA 4QQOA 3A4UA 2MNGA 1YFXA 2XVKA 4K1ZA 2YFUA 3CZJA 1AR73 3JBG2 4LBQA 1RL3A 4UW4A 4CDQA 2X53S 1NQDA 3AK0A 5KC6A 1E57A 4XCBA 5IYYA 3IPVA 2WNUA 1NT0A 3IIIA 4FPCA 2D40A 3POJA 1DQ5A 3MW2A 4A7YA 5C6CA 5FYIA 5KXBA 1VBB2 3KF5A 2VZ1A 1HXS2 3N7JA 1NA1A 3HNYM 2VJXA 2GMMA 3LOIA 1VAMA 2IXKA 2P17A 3MW3A 3POEA 4NMIA 4DMIA 1RMU2 1QJY1 2A71A 4AQ6A 3SMHA 4YWAA 4LHLA 5JSPA 3HWJA 4C90A 1UQXA 3PLQA 4UT5A 4DIQA 4RA0A 4XJZA 1D2SA 5DAVA 3IDAA 2NN8A 5K9YA 4JGYB 5CADA 1EV11 3C7HA 4G9SB 4YSFA 1H2LA 2ZBJA 1VAKA 3ACIA 2BV4A 1QY4A 2QQWA 4O9EA 1C1FA 4B29A 4DO0A 4FTSA 4QDSA 2WWUA 4HMZA 1HV0A 1AX1A 1W2AX 5F5AA 4PF5A 4EV0A 1XPWA 3JD71 5GALA 2VECA 3E5QA 2FDJA 2OUJA 1FX5A 3H0OA 4QDQA 5CNAA 5LASA 3WDYA 3ZYHA 4FPGA 5FFOC 4BQYA 2X8KA 2ORXA 1TME2 2XHNA 2XBO1 1NXD1 1D0GA 4YGCA 4KWUA 3MF9A 4XQWA 1QNYA 4DNYA 5D8AA 3AKSA 4OUEA 1R64A 1IQAA 1HQLA 2WS91 3NNGA 3RMYA 1MZ6A 4K21A 2MPFA 5FYSA 2J1AA 2VUCA 2QQMA 1HB1A 3U14A 4F83A 5FZFA 3WQBA 1RUD2 3AMMA 3VBSC 2W68A 1IHMA 4K7JA 2DU0A 1DFQA 5ACA2 2VQAA 5FY5A 3KQ4B 3C3VA 4HSLA 3WR0A 1S0CA 1VALA 1OVPA 3NNMA 1QJY2 2AR6A 4R9AA 4XYXA 4QGMA 4YVWA 3URFA 1LEMA 1CZSA 1H8TC 3ZIWA 5GLVA 1SDDB 4L97A 4IEXA 3LFIA 4UFHA 3CJIC 1CR7A 4PCRA 4C1XA 2HJIA 1ACCA 5FPUA 3HNMA 1QDOA 1S0GA 5IJRA 2R041 2Q8OA 3KVAA 2AGSA 2E6VA 1PO11 4XFIA 4NRMA 2ZTNA 4RFRB 3ZN6A 4DFSA 4YFZA 1ZX5A 1BKZA 1R083 1RUJ3 1LCLA 2YBPA 1F9KA 1QJFA 2DCYA 2Y0IA 1NX9A 3S7EA 1VBD3 1KRIA 2ZX2A 1GZWA 2WO2A 4DZGA 3OEBA 1HQNA 3AP4A 4LKSA 5CG8A 2Z69A 3LA3A 1SLIA 1IPKA 2QCSB 3TEXA 1DYKA 4N9HA 2YGMA 1RUF1 5CB7A 4HG6B 5ERLA 1CAXB 3UKVA 3AKPA 4KG0A 5CFDB 4HT1T 5HXVA 1HRI1 4CUGA 1O4TA 4Q0VA 2JG8C 5LY2A 5FXWA 1ZA4A 3U4XA 5FZHA 5JUVA 3GCXA 3BU7A 2FZ2A 4JGZC 3ZFFC 2HBUA 4AFMA 2ES3A 4JQTA 4YM0A 4LE4A 2J1VA 3A22A 4JCKA 4AR2A 4AEDA 4CDWB 4LBQD 2VGDA 2ZGLA 1GLHA 5APAA 1GOGA 1K5JA 2SBAA 3I2HA 4QQHA 5JOZA 2BP6A 1W9FA 2OVUA 3BKZA 2VD7A 4I02A 1OUXA 2E31A 4M01A 2HWC1 3ZYIB 3ZX7A 4JDOA 1M06G 4QQPA 3I4IA 3SEEA 1XQNA 4LITA 2NMNA 3NAPA 1BZWA 4FFFA 2PHTA 4LO7A 2AENA 3VBHB 4CDUC 3PURA 3J4UH 4FBFA 1RUE1 3DECA 4LO4B 1QJX3 4E8CA 2QDRA 3I2FA 5H9SA 5E89A 4NJ4A 2QZ2A 3LB9A 2P6CA 1PX4A 1Z7S1 1ZBE2 3IBMA 4EN9B 5FYUA 5A7WA 2XLFA 3LE0A 5D1IA 1CZTA 2BNNA 4MV2A 4EWDA 4E9KA 3BPSA 4C91A 2H6BA 2WNEA 2WRAA 3Q8EA 4LBNA 1SQ4A 4IXLA 4MGYE 3VHOA 3M1HA 3AXDA 3OUHA 1CAUB 4BIOA 2R062 1XJAA 1DZRA 2P4EA 5FUPA 3WNKA 1WLTA 2IZWA 4M3CF 5IVCA 4AVAA 4NIHA 4IGPA 1GWKA 5DG2A 1I3HA 5KHHA 4OHVA 2ZGMA 1UU6A 2B9VA 3MUY1 1XNKA 3QH7A 3WW2A 2RS13 1S4CA 1BEV3 1OF4A 3I2DA 1X8EA 2BJSA 3OUJA 2X10A 4URTA 4XEZA 2Y6LA 3D4KA 1SLBA 2J42A 3C7GA 4ZZ8A 2TNFA 1T6BX 2HWE2 3O7OA 4GB33 3DCQA 2OX0A 2VOKA 2WC2A 5AFBA 1BBT2 3LSEA 4QB1A 2WINB 1POV3 3RZMA 3GZEA 3OBRA 1NCQC 5K0UB 1S0EA 2IFWA 5HCHA 1V9U1 3R4DB 4D6QA 1QQP3 2PXJA 2Q4SA 2BUKA 4QAWA 3UKNA 4FCAA 4BLIA 1UYZA 4MO3M 4QKDA 4N43B 1BK0A 5GLTA 4XQDA 4Z92B 1GICA 4BK5A 4QGNA 4E8DA 1S55A 4LHKA 3BTZA 4D69A 2DTWA 3VBSB 1OURA 2R49A 1H2KA 2RMU2 2VM9A 3VD3A 4Q4Y1 4AEMA 5LA0A 3I3MA 3E5UA 4IEQA 4BCUA 1RITA 1U12A 1OHFA 3N35A 4LE3A 5FDBA 5FZ6A 4NIAA 3PVBB 5FPXA 5DMYA 2ZGQA 1AF9A 4IE7A 3OGSA 3WSOA 1IS4A 1EYBA 4J6GA 4XE9A 4EN6B 2VZTA 5KXCA 2RS32 3GDBA 3MIFA 2Q8DA 4HL0A 3NRUA 2EXHA 3PHMA 3T1LA 1I9RA 1VLNA 2GDFA 3DYPA 3VBUC 4CP9A 1PM7A 2ET7A 4QHOA 3J8F3 2BNMA 4JAAA 1JZ2A 1C8M2 1PGSA 3OCPA 5CYYA 2VMFA 4Z1VA 1E5RA 4XCAA 3C2UA 3IDEA 2WUHA 4YRDA 4UF0A 2Y6FA 5IVFA 4LORA 4DPNA 2ZA9A 3A7QA 1V9U2 3DPRA 5FZOB 3ZFEA 2JIGA 1KDKA 2IXJA 3AZZA 3HAGA 2VZPA 1QJU2 4UXAA 4B8EA 1HB3A 1X82A 4UOJA 1U5IA 1W99A 3PUHA 1ZBA1 3M70A 4FAGA 3MI8A 3B93A 1ZZ8A 4AW7A 2HBTA 3N9MA 3SCFA 1VBC1 1H8VA 4FT8A 1WCQA 3SXWA 3KV4A 1UYXA 4UYBA 2BVVA 2O0OA 3AMHA 4O65A 2WLPA 4DY5A 3Q8AA 1POQA 3FE5A 3PNAA 3JZVA 2ZEXA 3HVDA 2W1WA 2WYFA 2PHFA 4RSUA 5FBZA 3Q8FA 5BNPC 3MFAA 2IUWA 3SH5A 3KZ4C 1MEC1 3IAQA 5D21A 2HWF3 1FMD2 1W9WA 2FMDA 3ZR6A 1MVEA 4Q4W3 3BCWA 4B3NA 2ZAAA 1K5MB 3ZYBA 1W8NA 5GLUA 3POFA 1PO22 3RRDA 5FLJA 5EPAA 3TNPB 4Y26A 5F3CA 3NNFA 3M3OA 4MX3A 4QXBA 4NN0A 5C4WB 2P34A 1IGOA 1UPSA 2PLV1 3PJQA 2Y8KA 1PZ9A 5L9RA 1OMIA 2PHRA 3VKOA 1FATA 4AXOA 1PVC2 1C28A 1UZ0A 2A6ZA 3H8UA 3P3PA 1W8ZA 2B7YA 3AC0A 1J1LA 2JX9A 1DP0A 4QPIC 5A3WA 4BQ4A 5IAXA 3ETQA 4RL7A 2EICA 3A23A 3FFZA 5IK7A 3V64A 4MXVA 1HJGA 5DDJ3 1RUH3 2IXLA 1CPMA 4KGGA 1CPNA 2R7EB 2TEPA 3OG2A 1RHI1 4FP3A 3IIAA 1ZZCA 2VUAA 4EZ4A 1UMZA 1WBFA 2YMZA 1ND3C 3AL5A 3KV6A 3LFMA 2CU5A 4QX3A 3IAPA 4CXYA 1PK6A 3RJRA 3NKGA 1WLCA 2VZVA 4KQ7A 1H1AA 3EMRA 3M3IA 3PU3A 4RFT0 1ULDA 4XBNA 1XE8A 1AR62 1W6MB 2PFWA 1OFNA 2CHHA 2VW2A 4M3CE 4XUQA 4DS0A 3N3HA 5C3SA 5GM0A 1W6PA 5A7NA 2CDPA 2VAUA 3HT2A 3VBFA 1SEFA 3ZLIA 1ZRDA 5FYTA 1O3QA 2BFUS 4MHRA 5IFTA 5A3MA 4NHKA 4NWVA 2UY8A 1H8TA 2QNKA 4GQ7A 1UNBA 2MEV1 3KVBA 3WDUA 1PIV1 1VMJA 3RFRA 4AVSA 4Q0PA 4MUVA 2AC1A 5T5JA 3RI8A 3AYEA 1W8FA 2D6MA 4HLTA 3QOPA 5JI7A 3TYJA 3I2GA 3POYA 3RJ2X 5KWRA 1JUIA 3BTAA 1F4HA 5FV3A 5A3UA 5C8CB 4K9SA 1UD1A 4LHNA 3U11A 2RS52 2Y6HA 4BIFA 5BNNB 1US2A 5JDBA 3IMNA 2NP0A 4YFWA 2O14A 1UAIA 2BFUL 4XJUA 4IEOA 1ND2C 5EIYB 2YPDA 4IE0A 2XB6C 4BYYA 4D0QA 5JLVA 1TNFA 3SEPA 3U4SA 3Q9OA 2JDPA 4AI1A 1LODA 1NAEA 1WCSA 5FYHA 5FO7B 1UF2C 3NNLA 3ZN4A 2I74A 4NHLA 1F31A 2D93A 5DZGA 3MIHA 3TNQA 5LZ6A 4XIOA 4QPYA 1MQTB 1URXA 4QM8A 3O1UA 2EAKA 3ASIA 1RUI1 1WW7A 1Y9GA 2CWSA 2ZABA 1XOYA 1AXYA 4LUKA 2MHFA 3O0VA 2WFF3 2CV6A 3TN93 2W9XA 3DYOA 4M0HA 5FLHA 3ZFFA 1CIWA 4QPGA 5C7GA 1ST8A 3T2TA 1W90A 1CWPA 2XWBB 3K51A 3RYPA 4XAEA 1QEXA 1AL23 3FWEA 3L2HA 3WVJA 1VRH1 2WN2A 1HRV2 2WZR3 3VBRA 4OLLA 2AREA 1T6GC 1XC6A 4GZ9A 3EBRA 3DYMA 4RHV1 4D94A 2D6KA 1WLWA 1RUNA 1PGL1 3NJXA 5FK7A 4A3XA 1ULGA 4MXWA 4YZ5A 1R092 3ZFGA 1N3OA 3DN7A 3E97A 4QB6A 4YG6A 4AGVA 5C33A 4I3GA 4FOWA 3GZAA 2D5HA 2QQUA 4A45A 1GV9A 2J22A 2VXRA 3AKTA 5CZKA 2FD8A 1YEWA 3RZKA 5I91A 3I3DA 1VRBA 3H7YA 3K48A 4H3WA 5IWFA 3VL9A 1PM4A 2R1DA 4E4DX 4R4XA 2GN3A 3THTA 4CSWA 4EYUA 2Y38A 1GP4A 1X9PA 5C70A 2HWB3 4V2WA 2XKPA 4YZ2A 5EXOA 5FZCA 4OI0A 1FXZA 4RQPA 5F37A 4PI0A 4YM1A 3DGTA 4XDQA 3TBDA 1IZ3A 1F5JA 5M0TA 2LROA 1VJ2A 5HCBA 3T4VA 1B35B 1AUYA 1IS5A 4WZCA 5J98B 3RI9A 2E33A 4L9BA 1BMV2 3IWZA 3ZM8A 5FWJA 1AR92 4L11A 5BY5A 3O1PA 3S6PA 4HKLA 4YZ1A 4CXXA 5BPXA 4J1WA 5J09A 2RG4A 4KWLA 4XUPA 5FZ3A 1DYOA 4E4SA 1NCRA 1ZRRA 3B7MA 5EFUA 2G19A 2WZ8A 2F17A 2IC1A 5EYYA 1W39A 5T3NA 2P37A 4KBBA 5FMCA 1LAJA 2RDRA 4GD4A 2XONA 3LWCA 3EXUA 3WY6A 4XTMA 1RC6A 4I0WB 4C0BA 5GLWA 4LK6A 5L7OB 3CF6E 1ZRFA 2OPKA 4NIGA 3G6JB 3WG2A 3GBGA 5JWPA 3H8OA 4OMDA 2O1QA 3NL1A 4AK3A 2Q5TA 2OZ6A 2KA3A 5TSWA 1LEDA 3I59B 1AVBA 1JBCA 2XR4A 5T50A 3K3OA 3GCWA 2BERA 1IKQA 5FO8B 5FY4A 4CDXB 2W3JA 1EV13 1PGW2 2WQ4A 2V09A 3WDXA 5BNOC 1OOPB 3SCGA 5F9TA 2P2KA 3OY8B 4XXPA 2WSUA 4YVSB 1NKGA 3O1SA 4ZU5A 4AFDA 4XF3A 3O1MA 3N36A 1A8DA 3VN4A 2E7QA 2C26A 5JXJA 4ZS2A 4FPKA 4U2AA 3MUZ1 1OPMA 2ZGRA 4RN5A 3WUDA 4U36A 4AVTA 4FQ4A 1BLZA 2DYCA 2RR13 1AYM2 2PHWA 1PMJX 1ULOA 1NE4A 2XBO3 1LOFC 2XUEA 3WNNA 3TEZA 4M3CB 4I09A 4HVOA 4K6BA 4DXSA 4ES8A 3SKVA 1AL0G 5FZ8A 2VQTA 4IV1B 2WA3A 2OZJA 2WS93 3UT0A 4Y4YA 4XMAA 4CEYB 5H9RA 3AYAA 2GALA 2JE8A 1ND2B 2OQ7A 1KFUL 2QZ3A 4W50A 5FYZA 3RQ0A 1S0FA 4JGYC 3ZSLA 1RVF3 4NWWA 2AEZA 5FZMA 2PYTA 3O14A 1DU3D 5A32B 3I2KA 3PUSA 4WM7B 4XJ9A 4IE4A 5EV7A 2Q1FA 4IL7A 3GNEA 1G9AA 2W92A 2JWPA 5LA2A 3H8RA 2VTXA 5FXXA 4L8QA 4ZU4A 4B7KA 2X5IA 4GMP3 3V0AB 4NVPA 2JKXA 3HEIA 1IPJA 5ABJB 2HH9A 1AYN2 4XW3A 2Y60A 1TE1B 3ATGA 1UMHA 1GZ9A 2RV9A 1IS3A 2ZX4A 4Q4V1 2GNMA 4D8MA 4B4QA 1ULFA 2F6BA 5CKQA 1OFSA 1SZBA 2Z2SB 5A3TA 1PO13 3AMNA 5IATA 2VR4A 5SV5A 3W59A 2JKBA 1GYKA 1LHUA 3MEPA 3R4SA 2JXAA 1O4ZA 4FVVA 4OUSA 1UKGA 4DINB 3MHZA 3B3QE 4UFKA 1UY3A 1H2NA 2ID4A 1Z0HA 1VBE1 1QNWA 1NYWA 2ET1A 4Q4X2 3USUA 4LBQB 4LIUA 2JG9B 4LA3A 4CDQB 4AHWA 2W1UA 2FDHA 1D4M1 3IDBB 3LPFA 4DXZA 3W9AA 1F35A 3IPVB 3MPPG 4OZXA 1RUF3 2WNUB 4EQVA 5F39A 2Y6JA 1A3KA 4X8NA 1VBA3 5E88A 4ZS3A 4C1WA 5B4NA 3CBNA 2DF7A 3FN9A 1COV1 2OYZA 3KHBA 3RS6A 3GALA 4BLJA 1WBLA 2YFZA 4YG3A 1KD7A 4YGBA 3B02A 2G9FA 3T2PA 3DEMA 5A1AA 2EIEA 1GWMA 3WG1A 2HYXA 5FUNA 5JZGC 2D6OX 4FOYA 4IDZA 1UOFA 3W21A 5A3NA 3F2ZA 2IVIB 4Q4V2 2ZPXA 3QCWA 2DVBA 3DV8A 1FOD2 2ZHNA 2JDUA 2G9ZA 4CA9A 3M3QA 1W9YA 2Q1ZB 1HB2A 4OCTA 2A3XA 3SCHA 2YHJA 3POBA 2HWC3 4KG8A 4XZUG 4Z07A 2JJ6A 2C9AA 3KT4A 4QMAA 1GU3A 5IAVA 1LHWA 2ZAHA 2P5BA 1V6JA 5FZGA 1N3QA 1RUE3 1EAH3 2TBVA 3ZXLA 4GH4B 4DXRA 1HXS1 4M4RA 3A21A 4AEKA 1BJQA 1UIKA 3ACHA 4COUA 1MS0A 4V1PA 1RMU1 3N9PA 3NJVA 1Z7S3 2BWCA 1AJOA 3O1VA 3S0MA 2JICA 1RUC2 4CDWC 2ZX0A 1OH3A 2VOWA 4AI0A 1YLLA 3I2IA 4Y1VA 5CISA 3RZLA 2CSGA 1KXGA 3WW4A 3VLBB 2YC2A 4YPJA 5E8AA 2RM22 4IESA 1TMF2 4JKMA 5G05L 4FQZA 4FP2A 4KL1A 2E26A 3PTYA 1WLDA 1U5XA 1U5ZA 4GWNA 3VBHC 1TME1 2EIGA 4TWTA 2R32A 3BIWE 4GWMA 2LTNA 3ZN6B 3ILNA 4IV3A 3T30A 2ZCWA 1UXXX 1W8HA 4CUBA 1Y9QA 1FI2A 2WFF2 2YBSA 5DAXA 3FLTA 1BCXA 5FYYA 3RZHA 1XXNA 5CFCA 5EWSA 1RUD1 2JECA 1QOSA 1AL22 1W03A 4K1YA 3ROUA 3SKJE 5ACA1 2YB7A 5J36A 3AKQA 2WYSA 5FCCA 1XYOA 2FQPA 3T0DA 2E32A 4YNIA 4AGGA 3JB8A 2VZUA 3PJYA 1MS8A 2ZGPA 4ISRA 5FWEA 3MIEA 3AP9A 3FHAA 3WF0A 1VB2A 3KCXA 5T52A 3W58A 5FZKA 4RS5A 5FYBA 1DHKB 3KCCA 5FUIA 1JTZX 5DUWA 4D6RA 2QQOA 3T4HB 5DG1A 3MIBA 2AYHA 4Q4Y3 4PHZA 3B9IA 4IE5A 1ULPA 4Z2WA 5I0UA 5GZDA 1QJZA 1NXMA 2IVJA 5SV8A 4PLOA 3MV11 4CCDA 5FO9B 1C5HA 1CAVA 1Y43B 1V6LA 3W20A 5F5CA 4AEDB 4P9WA 2PHLA 3J7MA 1YI9A 1NZIA 2CGOA 5DXDA 2PAMA 4ASKA 5K0UC 3ZSJA 3CEWA 2BNOA 4GA9A 4J1XA 1EPWA 2ZXQA 2HWB2 4L2NA 2BRTA 4A41A 3UYJA 5A6XA 5GZGA 3BUCA 4E4ZA 4Q1RA 1O5LA 5C3OA 3PMEA 1J3RA 4N43C 3NAPB 4AVVA 3K4AA 1LENA 2WT2A 4FAHA 1UOBA 3TEYA 5C9AA 2JB8A 1RUG1 3HN1A 1WD3A 2JDKA 4OQ9A 3VKFC 4BQXA 4FFGA 4JDNA 1Q8SA 1DGWA 2GC2A 4Y1YA 5A7WB 2ENRA 3R0RA 3EB7A 4MZUA 5DZFA 3RGBA 1LGNA 1ODMA 1ZBA3 1ZM1A 4IEWA 1C57A 1ZVFA 3C7EA 1GSLA 2Q1MA
chains in the Genus database with same CATH topology
1ENQA 1VBC3 2DCTA 5JI9A 2SLIA 2IFRA 1AR83 4Q29A 5DZEA 1REEA 2YC0A 4A7ZA 2QKDA 3ZSMA 5JR7B 3UK9A 4P9IA 3NKTA 5AC92 2DU1A 3X29B 5FMOL 1MEC3 1FV3A 3AZXA 5JZGB 2GN7A 5KXEA 1APNA 4FTEA 3AFKA 5JSRA 1Q3EA 4Q8KA 5KXDA 3WCSA 5L36A 3MICA 3HBZA 3KT7A 3VUOA 5ABJA 1ZBE1 3ZMOA 1S0BA 1EPZA 1YIPA 3RSJA 2PLV3 5IUQA 3WD5A 4PBPA 3ZXJA 1BK1A 5T55A 3VZJA 1RUG2 1CVNA 4YM2A 3OTFA 2ERFA 1MS9A 4XTPA 2R061 2R1BA 4Y1UA 1IKPA 5A33A 4COWA 3D8CA 2PQQA 4FXKB 2D98A 3VDDB 1Q8QA 3KMHA 3VBOB 1LOFA 1QDCA 1YFYA 1K5MC 2VQ0A 4LO6B 1WW6A 4ASLA 1WCDJ 2HWE1 1BBT1 2WQZC 3H1YA 5C4WC 2ZKLA 1CJPA 4X6QB 3VHPA 1SDWA 1RJ8A 4AYUA 1ASJ2 3N7LA 1AX0A 4XIKA 1YFWA 1W6NB 2VMGA 4WV8A 5IK4A 3QACA 3DPRB 2MEV3 4LO5B 5I0TA 1PIV3 2YY1A 1N1SA 4PJYA 1AXZA 5LK7B 2RMU1 5I0SA 2JDZA 2PAEA 3KGZA 1QXPA 3JQWA 2VULA 2P3JA 2ZGKA 1VIWB 2B46X 2BBVA 1QXJA 4META 3GZUC 4OVEA 2DFCA 4OFGA 1QGLA 2YZ4A 4KU8A 3MDPA 1JOJA 1ZZ6A 2RS31 2UYAA 4XFGA 1SLLA 4UBHA 1SACA 1VBA2 2R073 1C8M1 5KHKA 1YHFA 2XJPA 4K3UA 2XL9A 3AKRA 1DZQA 5GZCA 2ZZJA 2XWJB 4IEUA 1RUI3 1SLTA 3AX4A 4ZU7A 2NMOA 2E51A 1QJU1 4L92A 2JENA 5C8CC 3LCPA 5H9PA 1J3PA 3SITA 3AJYA 4N53A 4C0HA 5BNNC 4CEWC 1VRH3 4EN7B 4RR3B 4X6RB 4LLOA 4RHV3 1D4VB 4AVCA 4XF4A 3J9SA 2I45A 4PDWA 5CFDA 1D0HA 1FMD1 1H4GA 4QT6A 4Y22A 4JQRA 4HN0A 1KJLA 1MQTC 1PK6B 3WHUA 2HWD2 4CP2A 1FPN2 1PO21 4Q8LA 3WQ0A 1C4RA 4FPEA 3NV4A 2ZGTA 1HDKA 2GC0A 3WOGA 3EO6A 1V6OA 1PMIA 2O8QA 3THPA 3O0XA 3VL8A 4O9GA 3HR9A 1PVC1 4Y20B 4Z8BA 1UIJA 3VBFB 5FRAA 1DDLA 1G8WA 4FPOB 3MZHA 2G9GA 4D7SA 1L3JA 4HN1A 2PHDA 3WDWA 4F3JA 1JYIA 1RINA 4R9BA 4AQSA 1GKBA 2PN5A 4IERA 3JUUA 4HSJA 2I2SA 4WVMA 3VBHA 4LBKA 2KM2A 2BQPA 3LKJA 4RGGA 5CU1A 1AR72 3ILRA 2Y0OA 1MZFA 4BOWA 4AG4A 4BZ4A 3AYCA 3WHTA 3TOJA 1AR61 4BHPA 1X7NA 3HIFA 3ALQA 4PIZA 4XF9A 2BVBA 4D7YA 3M2MA 4NR1A 2E63A 4GALA 1WD4A 1G9CA 3V0BB 2ZKNA 2DVFA 1B35C 1OKQA 3NVCA 2IWGB 3OPZA 4BWOA 3GZTB 3AP5A 1YRZA 1Q43A 3SLIA 2UWCA 4HETA 2NZ9A 3N7KA 4BMBA 5HBAA 4AF9A 4JTOA 4QPGB 1GFF2 4MGZE 2GZWA 5E16A 5IT6A 1W2UA 5KHGA 1SBEA 3MIGA 4A7KA 3VBRB 2RS51 4KH9A 2FHRA 2LALA 2YUEA 3D0JA 3GBFA 2E7AA 4AVBA 4ASMB 1D2QA 3MF6A 5L7OC 2C0ZA 4BMEA 4MXWB 4QQ2A 3ZFGB 3M4FA 4Q0QA 1HW5A 2XJQA 3NW4A 1OA3A 1R1A3 1O91A 1YNAA 4IEVA 3VBSA 3FLRA 4MVTA 2ZS6B 4CDXC 1JW6A 4XBLA 5HCAA 4G4FA 1OOPC 1VR3A 4UW3A 1ONAA 2ZGUA 1LGCA 2NYYA 4YVSC 1OQEA 2XVGA 2WKKA 3WG3A 4RQPB 4AFCA 3CJIA 4YG0A 2XJSA 2XJTA 1HRV1 2QVSB 2DCKA 2JE9A 4PLMA 3WP3A 5LK5A 1DQ1A 1WW4A 3AMPA 2EXIA 1R082 3E6CC 1RUJ2 4BQ1A 3NSTA 2VMHA 1SCRA 2CAUA 3QBQA 1R091 1VBD2 1CAWA 2VH9A 1DQ2A 2VY0A 1KQRA 4OHZA 4TZDA 1HQWA 1R1ZA 4ORFA 2WZPP 4JV4A 4CEWB 4IV1C 4AFAA 1OI6A 4NHMA 5IK5A 1NCRB 2VW1A 4CEYC 3TAYA 5FQ0A 4NOTA 1ENRA 2WSVA 5HCFA 1I5ZA 5F6KA 5A3LA 1W6QA 1LECA 3KB5A 4WM7C 3WT3A 1D4M3 1NOVA 4Q1PA 3PMSA 2XJUA 2JG8A 3G7DA 5CVRA 4YGDA 1OD5A 2A3WA 1COV3 1UW8A 4JGZA 3OYWA 1CJDA 1BMV1 4B4RA 2UYBA 3PVEA 1AHSA 1AR91 2Q30A 1LR5A 1OQ1A 2RHPA 1XYNA 2GMPA 2WL1A 3CL1A 3ELNA 4FO9A 1PHMA 3MLJA 3LGRA 1V6KA 1POV1 4WBBA 2AH2A 4YZ4A 4XOGA 4FOVA 1C5IA 2XH6A 2D7FA 2WIIB 2JG9C 4CDQC 3FUQA 3ZSKA 3WDTA 3JBG3 3ZYGA 2WNUC 2R30A 4CDUA 1QJX2 2CTVA 4LEJA 4D3WA 5GJ6A 2O8OA 2XLGA 1VBB3 2VMIA 2WNVB 3KS7A 5J7MA 3HT1A 4I0AA 4YLZA 4XILA 4TLFA 5JIAA 1RMU3 1SLCA 3MYXA 4FPHA 3PVOA 4EJRA 4JVAA 4QU2A 4Y1XA 4X8PA 1WCKA 4JTNA 2PAKA 2VPVA 4AI2A 3HQXA 4ISQA 1PGW1 3JU9A 4LBLA 1REDA 1O3RA 2RS12 1BEV2 2EAAA 2X5IB 4G3YC 5JOWA 2R16A 2PTMA 1ZZ9A 4LT5A 1I6XA 4XFHA 3NV1A 1I1EA 2R072 2DVGA 3VZMA 4GB32 1CESA 4EN8B 1AYM1 2VNRA 5F6LB 2BTVC 4JRAA 1YIFA 1QF3A 1LHNA 1G9DA 1TME3 5D8AC 1TNRA 1LU1A 4GH4C 3KCYA 1NCQA 1Y3TA 4H14A 1O7FA 1QQP2 2VU9A 4FOQA 1UZYA 4LBOA 2XLAA 3ST7A 4XXAA 4LA2A 2XUMA 3USUB 4CRQA 1H1MA 2OA2A 5I8YA 4XFCA 5ACA3 1FYUA 2QQPA 1KJRA 5J96B 2Z42A 1DIWA 1QJY3 2BEOA 3AP7A 4S2HA 3ECQA 2EA7A 1OA4A 1TEIA 4R52A 3WX5A 4OUMA 1AYN1 4COYA 2CY6A 3U07A 3WLUA 4FPFA 1HIXA 3I54A 2CGPA 3J8F2 3NV3A 3R4UA 4WM8B 1DGLA 3JD73 3VBUA 1OQDA 2BW8A 4LUMA 2EVXA 4F8AA 4COVA 2B39A 4XBQA 2K2SA 2LUWA 1S2KA 1S0DA 3IDCB 4Q4X1 1GANA 4P9LA 1JXNA 4XHXA 4AFBA 1UL9A 3ZYJB 3JQXA 3M3CA 4YM3A 2AZ5A 5IK7A 4SLIA 5DUVA 1HX6A 3OF1A 3DF0A 4SBVA 4MLOA 4JDMA 3SNMA 1W0OA 2A7AA 4PIXA 3VGIA 4LNVA 1C8NA 4AQ2A 1YXWA 1QOTA 2DUOA 1YI7A 4AEDC 3H1MA 1YJKA 3ZSEA 1WA4A 4Q2FA 1AZDA 3MGUA 4H7LA 4Q27A 2HWF2 3QH6A 1FOD1 4Q4W2 5BNPA 2R043 4XMIA 1LHVA 3NAPC 4GIQA 4HK9A 3KGLA 2WWSA 3B5LB 1A8MA 1B35A 4IV3B 2RJLA 3PVNA 4EN0A 1YUDA 4BE3A 2PHXA 5GZEA 2XG3A 4YARA 1N1TA 4OI4A 5BXXA 1J59A 2ZGSA 1ZBE3 4I01A 1H30A 1XE7A 4YW3A 3D82A 5CFCB 4QPIA 5DDJ2 1RUH2 1HRI3 3POSA 3N7MA 3NO8A 3ZDSA 1RUC1 1NA1B 2ZJCA 2D6NA 1Q56A 1GR3A 2R063 4RS5B 2NQYA 1Q8PA 2W0XA 1Y7BA 2RM21 1TMF1 1A6CA 1ND3A 5JPNB 1N3PA 2JE7A 2A6XA 3GF6A 2HEVF 2DTYA 1DGRN 4N90A 2D6LX 5JCTA 1QH7A 2VUJA 1OLQA 3CO2A 1WMDA 3I59A 1CAVB 3ZO0B 3QD6A 2HWE3 3ZMNA 2XJRA 5GZFA 1BYHA 1BBT3 1DLLA 2WFF1 3ZXEA 3AXEA 2YDEA 2LM3A 3UV9A 3N4MA 1W6OA 2BPA2 2DUPA 1AL21 2XL7A 3SH3A 4DY3A 5D8AB 3ILFA 5JMCA 4B7EA 1ENXA 1DQ0A 4MSVA 1X36A 5C9AB 2VW0A 3D0SA 3CU7A 3NJZA 4P9JA 3FFQA 3ENRA 4Y1ZA 2UURA 3ZXAC 3VDDC 4XJAA 3VBOC 4N9IA 2RMU3 2FBEA 2DV9A 1RB8G 5FTTC 4NO4A 5I0RA 3GBWA 4YVWB 5AVPA 4IV1A 4AGRA 2WT0A 4AHYA 1F2NA 2A70A 4FTBA 1ND2A 4K40A 1C3HA 2FZ1A 1H2MA 2HWB1 4GULA 4JC1A 4WM7A 3VV1A 3FJSA 3AZWA 4I3PA 1LOGA 1C8M3 2Z5WA 3LZZA 3MPBA 3TN92 3DPRC 3DL3A 1ULCA 2EXKA 4Z82A 1GZWB 4HPKA 4KGQA 2ZMNA 1V9U3 2W39A 3WW1A 5CIRA 1QJU3 3H9AA 2WZR2 3R05A 5ABJB 3T1MA 1FAYA 1DBNA 2BWAA 3TB0A 1SFYA 4YW2A 1JYCA 1OLRA 3ZYRA 4N7UA 4QM9A 5CAZA 5A33B 4OHYA 4L99A 2JG9A 2UWAA 4RD7A 5CA6A 1J3QA 4FPJA 3KLSA 4R8HA 4YW4A 2XHKA 5AC91 2A5ZA 1KFXL 3S7IA 1FMD3 2XVLA 1LU2A 3LSDA 1BXHA 2HKXA 1BQPA 1LRHA 2CYFA 1PO23 2H6CA 2GH8A 2DCZA 3AZYA 5T5OA 5LEKA 1RTVA 1F8VA 1KS5A 5J37A 1QU0A 3BB6A 1AX2A 1PVC3 1QXRA 4IEZA 3MFCA 1Q8OA 1V6NA 4RR3C 5FMOS 2VVFA 3OGJA 3WV6A 1LOCA 1H1IA 4PIYA 2RR11 1WGPA 4GKXA 2VVDA 1Q8VA 1NY72 4W6YA 1TQ5A 4MGKE 1IS6A 1PK6C 3S30A 4LBJA 2NPIA 1CD3G 4GH4A 2A6WA 1RUOA 1LKNA 1PNGA 2OIIA 4DQAA 1RVF1 1AR63 4F7ZA 2DCJA 2JD4A 4MYEA 2A73B 4XETA 3VBFC 1J58A 1ASJ1 3B9CA 4GMP1 3UKTA 1A78A 5J3UA 3O0WA 1X50A 1UN1A 4LBMA 1EV12 1G6NA 5KBFA 3WINE 2P3KA 3ZXGA 4EWAA 5BNOA 2YPJA 4W65A 3UL2A 1YO8A 3VHNA 1MS1A 3JD72 2YROA 1S0IA 2ETEA 1U0AA 4N53B 2RR12 1RHI3 4QXKA 2RS53 2XBO2 4YGEA 1QKQA 5LEJA 4P5HA 2X29A 2WS92 4PDWB 5T5PA 2ZMLA 1VBA1 2D3PA 2KXLA 1O3TA 2B8MA 4Y22B 5JPMB 1RVF2 3U0ZA 5J48A 5F1RA 3CJXA 3WQ7A 4JGYA 1UCXA 3LAGA 2CGNA 3ZIXA 4QPGC 5BV6A 4XF1A 2CL2A 5LRSA 3EQEA 3A0NA 3KD4A 1PZ8A 3IM0A 4XZPA 3VBRC 2B9UA 3ZFEB 5FOBB 2A75A 4ES9A 1HRV3 5KC5A 2R042 1POV0 3JCIA 3WUCA 1PO12 1XNCA 3TRSB 4FSJA 2R0FA 1X33A 4MGIE 3ZFGC 3WP6A 5F5QA 4HKWA 2W08A 1CQ9A 1ALYA 2WJSA 1DGRA 3B94A 1V00A 1R093 4WVMB 3ACLA 3H1WA 3B00A 1EAH1 4TSVA 3CNAA 2HWD1 4INDA 1B09A 4K20A 4NPRA 4HVQA 1FPN1 4AEJA 1YYNA 2H0BA 1RUF2 2GH2A 3SHRA 2RJKA 1G9BA 1HRI2 4E2SA 4M0NA 3NWKA 1GNZA 2ZMKA 3VKNA 4XF0A 4HBNA 4ZXKA 4RQPC 2BGCA 2ARXA 4HFSA 4YZ3A 3MLLA 2WA4A 1M4WA 3APBA 4HANA 1ENSA 3EHKA 4LTAA 1N47A 3SISA 3UJQA 3AM2A 4XFFA 4Q0UA 3OD0A 1AR93 1VB4A 5I93A 5JZGA 4KNCA 1NCRC 4H7MA 3B01A 3E5XA 4CP0A 2DWRA 1AR71 2HWC2 2CNAA 2QJVA 5KHJA 4R4ZA 5AFEA 1CAXA 1C1LA 1RUE2 1EAH2 1WMEA 5JOYA 3H3UA 1GZCA 5GKAC 1Z7S2 2GNBA 5CBLA 3MLKA 1CONA 3KSCA 2V5YA 1S2BA 3BOWA 4CP1A 4AQTA 3CLPA 1NQJA 3VDDA 3VBOA 1O4YA 1W6PB 4CDWA 4W6WA 1DQ4A 1H8TB 1KS4A 3SH4A 4UW5A 3CJIB 1QMJA 4KU7A 1Z78A 1CGPA 4BM8A 2ZHMA 4HZFA 1V6IA 1PVXA 4ONUA 2DVAA 4XFAA 1AXKA 3GYDA 1MS4A 1NG0A 5CG9A 1AYM3 5DUUA 3WP5A 1W6NA 1CAWB 4AI3A 3M8LA 4DOUA 2N7GA 2WNVC 5FREA 2GU9A 2DVDA 1DYPA 1XU1A 5FQ0B 5JIUA 2PELA 3TWIA 2Y26A 2R6QA 4YW1A 1VP6A 1W6QB 1CAUA 1Q5OA 5T5LA 5BUVA 1UZZA 2P3IA 4P9GA 2JG8B 3IT8A 1JN2P 2OYZA 2X5IC 3IN9A 4XJWA 1MACA 1AR81 2I07B 4Q4Y2 1FNZA 5JOXA 4Y24A 1SCSA 4E2GA 4JGZB 3OYWB 3USSA 3ZFFB 1AYN3 4S2DA 1R081 1RUJ1 5B2GB 1WW5A 3O12A 1VBD1 5K0UA 1PNFA 2AUYA 3FX3A 1J1TA 3JB4C 5HI0A 4R9CA 4WVVA 1NLSA 2WT1A 1SLAA 1RJ7A 5FAXA 2D97A 2D43A 2OUHA 3AFGA 1G7YA 4N43A 3KQRA 4DRRA 3H7JA 4Q4X3 4CDUB 1X8MA 1W0PA 2PHUA 1ZRCA 1QOOA 4RR3A 1FT9A 2D5FA 1N1YA 1ZBA2 5K7PA 1DG6A 2B45X 4GXLA 1VBC2 1BVVA 1ULEA 5KHIA 3NV2A 1AR82 3I7DA 3GHNA 2D3RA 1EP0A 5IK8A 5H9QA 4WM8C 3VZLA 1LHOA 5T54A 2ILMA 4XPVA 1LOBA 1QWRA 2VNGA 3POWA 3ZPYA 2Q0AA 3BOPA 4Q4V3 1MEC2 3I8TA 2IXCA 1LGBA 3OGGA 1FOD3 2C1FA 2CWMA 2F4PA 4OI2A 3FC0A 4Y20A 2D3SA 3L2YA 1HKDA 5DUXA 1QJX1 3VZKA 2GNTA 4ATEA 4FXGB 4HK8A 1YWKA 1AJKA 1OSGA 1GQHA 1VBE3 2ZGNA 2PLV2 3ME2A 3WQ1A 4ZKTB 1NCQB 1WUVA 3WW3A 4B4PA 1H9WA 4XJ8A 2VNOA 4PLNA 3INAA 4Q0SA 1O5UA 2TUNA 3R6SA 1UU5A 2EALA 3FZ3A 1ZNPA 4OI1A 1RHI2 1RUC3 4DRVA 3ZN5A 1HV1A 1LJ7A 2RS11 1BEV1 4K8FA 1BVP1 4BPZA 2RM23 1TMF3 3U10A 3WCRA 3E6DA 1K5MA 2R071 2V73A 3RYKA 3M3EA 3ES1A 4GB31 2GNDA 2VOVA 2E7TA 3FHIB 3V0BA 1XU2A 4IV3C 2D44A 5C4WA 3VBUB 4KWJA 1QQP1 5CFCC 3FLPA 3WP4A 2UWBA 1KDMA 3E6BA 2DUQA 1NA1C 2MEV2 2R0HA 1SBDA 2EF6A 3AP6A 3ZXDA 1LOAA 2UU8A 4YYOA 1PIV2 3IKWA 2ZX3A 1HXS3 3QLQA 5I8TA 2OW4A 1EY2A 1RGSA 4RS5C 3WXPA 2YGLA 1SMVA 3FBMA 3DUIA 3ZXKA 3HMYA 4XQ4A 4QHBA 1KITA 1GNHA 3AB0A 3P3NA 4E2QA 5EYXA 4M00A 2ZHKA 4BH9A 1MR5A 4I0BA 1W6MA 5JVVA 1S0JA 1S1AA 3J8F1 2B42B 1U5YA 1GBGA 3LA2A 4OULA 5BNPB 4IEPA 1LESA 3GHMA 2HYKA 2QDNA 1LOEA 3UJOA 1DF0A 4CTEA 1MZEA 2DFBA 4KWKA 1RUI2 3WDVA 2ZACA 2E9QA 4AHZA 3A0KA 5C9AC 3LOBA 2YYOA 1N1VA 4XHBA 3V65A 1UU4A 1RUD3 5L73A 5C8CA 2BYVE 2YV8A 3KM5A 1VRH2 5FOJB 1G86A 1ZREA 4YVWC 2NLRA 5GLZA 4QPIB 2D6PA 4CEWA 5BNNA 1ZZ7A 4RHV2 3D6EA 1PGL2 1GQGA 4TYSA 3M7AA 2ZHLA 2WFPA 2IXHA 4AHXA 4UW6A 5JAXA 1PZ7A 3O5SA 3MW4A 3RMXA 2HWF1 3RPQA 1XYPA 4Q4W1 1ND3B 1JHNA 2QE3A 4OHXA 4COZA 2GMEA 2ARBA 1MQTA 2Z79A 5AC93 5K8SA 3RDIA 2B5HA 1FV2A 3DKWA 4GMP0 3BALA 4Q26A 4N7IA 4A2UA 5ABJC 2ATFA 1LULA 4IEYA 2FMYA 1UX6A 2HEWF 2ZZQA 4LULA 3RG0A 4LR4A 1RIRA 2XGXA 1W6OB 3BPZA 1WMFA 2UY9A 3WZ1A 4AE2A 3OBTA 1RUH1 3ES4A 5DDJ1 3ZVXA 1MS5A 2RE9A 2EXJA 1RUG3 1XNBA 2XPJA 4BA6A 4QX5A 5LRRA 2A3YA 5JSOA 4LLFA 1SFNA 1G9FA 5EJ3A 1UKRA 3H50A 4HVRA 3RYRA 4P9XA 1H4HA 3BODA 3V56A 4QQLA 2WNVA 1R1A1 5I8SA 4WZFA 4RGAA 1XNDA 2IXIA 4S2FA 4LO8A 4H55A 3AMQA 2YXSA 4JRLA 4XFBA 4PQ9A 3MIDA 3LA7A 1QHDA 1DQ6A 4PBOA 1ASJ3 4OHWA 3ZXFA 4HPKB 4HKOA 4P14A 3ZYPA 3J26N 3WG4A 3RNSA 1YCIA 2CAVA 3FMGA 1FNYA 2JEMA 4P9YA 2QUOA 1NLRA 5E1RA 4GKYA 1SBFA 3FUOA 4QGLA 3RWNA 3VKLA 4WVZA 5L7OA 4ATFA 1DZTA 1R1A2 1F5FA 5AVAA 2ZOEB 1REFA 1O3SA 2GC3A 5FPZA 1YJLA 2K9ZA 4ITCA 4IQPA 4IETA 2XKOA 3TN91 3WNXA 4CDXA 5C8WA 3B69A 1LB2A 2C5DA 1H0BA 1OOPA 1YFUA 3D5OA 1ZYBA 3OY8A 4CYDA 4YVSA 4S2GA 2WZR1 2VG9A 4YW5A 1OPOA 1JH5A 3VHRA 1CN1A 1MZ5A 4N53C 3FBYA 3OD4A 3HD8B 2H0VA 4WM8A 1JUHA 1IOAA 5L19A 2ZX1A 3EJKA 2VOXA 1V6MA 4AI8A 5EZWA 3RZZA 1MVQA 4M3CA 3JBG1 4UBGA 2E53A 3H3ZA 4PDWC 4CZSA 4AWDA 5CFDC 4FPLA 1UPIA 1XRUA 3OJBA 1OA2A 1QH6A 3VZOA 3VKMA 1DGWX 2HEYF 4I2OA 4CEYA 1VBE2 2GAUA 4E27A 1H9PA 1VBB1 4WVWA 2RS33 2GC1A 2GSYA 2HWD3 2VVEA 3AYDA 5A32A 2WLQA 1D4M2 1FPN3 1HLCA 4D7TA 2K0GA 5BNQA 1ZZBA 4FPYA 3AZVA 1CX4A 4I30A 2XJVA 4R9DA 3V0AA 3L9JT 1COV2 1VAVA 2W52A 2ZGOA 2A6VA 5FLIA 3ZFEC 2QFEA 1NE6A 1NZCA 4EWEA 2PA7A 1V70A 4QD2A 1MS3A 5BYNA 2NM1A 3KT1A 1LTEA 2G4IA 4MH0E 5BNOB 1NY71 2DURA 2A6YA 4W6XA 4EROA 4DB5A 4Y5Z0 3AJZA 4QQOA 3A4UA 2MNGA 1YFXA 2XVKA 4K1ZA 1AR73 3JBG2 4LBQA 1RL3A 4UW4A 4CDQA 2X53S 1NQDA 3AK0A 5KC6A 1E57A 3IPVA 2WNUA 4FPCA 2D40A 5C6CA 1DQ5A 3MW2A 4A7YA 5KXBA 1VBB2 1HXS2 3N7JA 1NA1A 2GMMA 3LOIA 1VAMA 2IXKA 2P17A 3MW3A 4DMIA 1RMU2 1QJY1 2A71A 4AQ6A 3SMHA 4LHLA 5JSPA 3HWJA 4C90A 3PLQA 4RA0A 4XJZA 1D2SA 5K9YA 2NN8A 4JGYB 5CADA 1EV11 4G9SB 4YSFA 1H2LA 2ZBJA 1VAKA 4O9EA 4B29A 1QY4A 1C1FA 4FTSA 4HMZA 1HV0A 1AX1A 4EV0A 4PF5A 3JD71 5GALA 2VECA 3E5QA 2OUJA 1FX5A 3H0OA 5CNAA 3WDYA 4FPGA 5FFOC 2X8KA 1TME2 2XBO1 1NXD1 1D0GA 4YGCA 3MF9A 4XQWA 1QNYA 4DNYA 5D8AA 3AKSA 1IQAA 1HQLA 2WS91 3RMYA 1MZ6A 4K21A 2MPFA 4F83A 1RUD2 3AMMA 3VBSC 2W68A 1IHMA 4K7JA 2DU0A 1DFQA 5ACA2 2VQAA 3C3VA 4HSLA 3WR0A 1S0CA 1VALA 3URFA 4XYXA 1QJY2 2AR6A 4R9AA 4YVWA 4QGMA 3VZNA 3ZIWA 1LEMA 1H8TC 5GLVA 4L97A 4IEXA 3CJIC 1CR7A 4PCRA 4C1XA 2HJIA 1QDOA 1S0GA 2R041 2Q8OA 2AGSA 2E6VA 1PO11 4XFIA 4DFSA 2ZTNA 4YFZA 3ZN6A 1ZX5A 1BKZA 1R083 1RUJ3 1LCLA 1F9KA 2DCYA 2Y0IA 3S7EA 1VBD3 1KRIA 2ZX2A 1GZWA 4DZGA 1HQNA 3AP4A 5CG8A 2Z69A 3LA3A 1SLIA 1IPKA 2QCSB 1DYKA 4N9HA 2YGMA 1RUF1 5CB7A 3UKVA 1CAXB 5CFDB 3AKPA 4KG0A 4HT1T 5HXVA 1HRI1 1O4TA 4Q0VA 2JG8C 1ZA4A 3U4XA 3BU7A 2FZ2A 4JGZC 3ZFFC 4AFMA 2ES3A 4YM0A 4LE4A 4JCKA 4AEDA 4CDWB 4LBQD 2VGDA 2ZGLA 1GLHA 2SBAA 5JOZA 4QQHA 2OVUA 4I02A 4M01A 2HWC1 3ZYIB 3ZX7A 4JDOA 1M06G 4QQPA 3I4IA 1XQNA 2NMNA 3NAPA 1BZWA 2PHTA 4LO7A 2AENA 3VBHB 4CDUC 3J4UH 4FBFA 1RUE1 4LO4B 1QJX3 2QDRA 5H9SA 5E89A 2QZ2A 3LB9A 1Z7S1 1ZBE2 3IBMA 4EN9B 2XLFA 5D1IA 4EWDA 4MV2A 2BNNA 4E9KA 4C91A 2H6BA 2WNEA 4LBNA 1SQ4A 4IXLA 4MGYE 3VHOA 3M1HA 3AXDA 1CAUB 4BIOA 2R062 1DZRA 1WLTA 2IZWA 4M3CF 4AVAA 5DG2A 1I3HA 5KHHA 4OHVA 2ZGMA 1UU6A 3QH7A 3WW2A 1XNKA 2RS13 1BEV3 3I2DA 1X8EA 4URTA 4XEZA 3D4KA 1SLBA 2TNFA 2HWE2 3O7OA 4GB33 2VOKA 2WC2A 5AFBA 1BBT2 3LSEA 2WINB 1POV3 3OBRA 1NCQC 5K0UB 1S0EA 2IFWA 1V9U1 3R4DB 1QQP3