2JG8B

Crystallographic structure of human c1q globular heads complexed to phosphatidyl-serine
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
133
structure length
133
Chain Sequence
ATQKIAFSATRTINVPLRRDQTIRFDHVITNMNNNYEPRSGKFTCKVPGLYYFTYHASSRGNLCVNLMRGRERAQKVVTFCDYAYNTFQVTTGGMVLKLEQGENVFLQATDKNSLLGMEGANSIFSGFLLFPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Complement C1q subcomponent subunit A
publication title C1Q Binds Phosphatidylserine and Likely Acts as a Multiligand-Bridging Molecule in Apoptotic Cell Recognition.
pubmed doi rcsb
molecule tags Immune system
total genus 29
structure length 133
sequence length 133
chains with identical sequence E
ec nomenclature
pdb deposition date 2007-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00386 C1q C1q domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2jg8B00
1RJ7A 1O91A 3ME2A 4F3JA 2OIIA 2WNUB 1D0GA 1DG6A 4RSUA 3V56A 5L36A 4E4DX 2O0OA 1C28A 2Q1MA 4QQ2A 4MXWA 5KWRA 1C3HA 4KGQA 1ALYA 2Q8OA 3URFA 1U5YA 3IT8A 5CIRA 2TNFA 1XU2A 2QDNA 3TYJA 1RJ8A 1D4VB 1PK6A 4OULA 4KGGA 1U5XA 1S55A 4E4SA 1KD7A 4KG8A 3B94A 1PK6C 3ALQA 4G3YC 4QPYA 1TNFA 2RJKA 2JG8A 2QE3A 2WNVB 3K48A 3QBQA 5KC6A 4MXVA 4TWTA 2RJLA 2HEYF 3K51A 5TSWA 2JG9B 5HBAA 2JG8C 2Z5WA 3MI8A 4MXWB 4QQPA 2WNUA 2R32A 2E7AA 3QD6A 4QQHA 4OUMA 4TSVA 2HEWF 3B93A 1PK6B 4DB5A 4D7YA 3WD5A 1GR3A 4J6GA 1DU3D 2KA3A 1IQAA 4N90A 4MSVA 3B9IA 2ZPXA 4OUSA 1TNRA 1KXGA 2ZJCA 1XU1A 1OSGA 4G4FA 2WNVA 4EN0A 1WCKA 1OQDA 4DOUA 4QQOA 2TUNA 2WNUC 2JG9A 1I9RA 1D2QA 5KC5A 2R30A 2WNVC 1A8MA 2AZ5A 1JTZX 2R6QA 4HT1T 1U5ZA 5L19A 1JH5A 2JG9C 3TWIA 5BNQA 2HEVF 4QQLA 3FC0A 2JG8B 3LKJA 3AB0A 4NN0A 4GIQA 2X29A 3L9JT 2RE9A 1OQEA
chains in the Genus database with same CATH superfamily
3QCWA 3N9PA 3T30A 4DIQA 4Z8BA 1BBT3 1C1FA 1MQTB 4JV4A 5T3NA 4QGLA 2WFF2 2WT2A 1BMV2 1EP0A 4XMIA 2B39A 2PHXA 3KMHA 3KD4A 3PJYA 4BIFA 4XTPA 4OFGA 4BM8A 4M01A 1XE7A 3WUCA 2ES3A 1N1SA 3GDBA 1ZZBA 1IOAA 1LNSA 3MYXA 4RR3C 1O3TA 2WO3A 4RS5A 1UXXX 2XL7A 4R4XA 4W6WA 4AE2A 5ISLA 2D7FA 1MS1A 3AYCA 3MO4A 4S2HA 1QJY1 2B4KA 5LA0A 5FZ7A 1JI6A 2UY9A 5FZ3A 1CZSA 3VBOB 2ZA9A 3AXDA 3LPFA 4RS5C 1W6NB 4EWDA 5B4NA 4LBQB 1SBFA 3P3PA 4LLOA 2A3YA 1E5SA 2WNVB 3P3NA 3IMMA 3ZXAC 4XXPA 5EQUA 3OYWA 1JXNA 2R49A 3DUIA 5FFOC 2XJPA 1D4M3 1WMXA 4AHYA 4ZZ5A 1AXYA 2Z5WA 2E9QA 4NPRA 4RR3B 2WWUA 1HRI2 4YM3A 1DYKA 3IAQA 1C8M3 2G9FA 3TN93 5K9YA 4YFWA 1W8ZA 1F9KA 4NHKA 1WW4A 1W99A 1CPMA 2YFZA 2PHTA 1RUE3 1GOGA 1Y7BA 3B93A 2VCAA 2OYZA 5LWBA 2YMZA 4RS5B 3RQ0A 3NJVA 1FXZA 3KVBA 5FZ0A 4DUXA 3LSEA 4NIHA 1GOHA 1O3QA 4GMP0 1POV0 2PLV2 2V73A 4FOVA 1DIWA 3I2IA 3T08A 1UX7A 4MGIE 1SLAA 1UL9A 1W04A 3AKQA 4LXLA 3ZFEB 2F6BA 3NWKA 1FMD3 4AWDA 4EN8B 2D40A 3NQHA 5DUWA 3AP7A 3PU8A 2RR11 4AHZA 3FWEA 4YG6A 1X33A 3LB9A 1GWMA 1D2SA 5GJ6A 2WIIB 1LOBA 1FI2A 1Q8OA 2W3JA 1AJKA 3RFRA 3HN1A 2VZOA 3D4KA 2YFUA 3DEMA 3CO2A 2ZGUA 4LO8A 4R52A 2MHFA 5GZFA 1OXCA 3M3CA 5A33B 1O59A 4ATFA 3MIDA 4M00A 2AZ5A 2P5BA 4ATEA 2P2KA 4P9LA 3FMGA 1IS6A 3USUB 2W1UA 5IVCA 3OBAA 5B4XA 1W28A 2CAUA 3NV1A 2VD7A 4QKNA 1AR92 1VBA1 3ETPA 4KWUA 1U5IA 1SPPA 2PHFA 2RJ2A 4HPKA 4Q4X2 4XJZA 4BISA 1WZXA 4GXLA 3AP4A 5IVYA 3TEWA 1AR71 4CYDA 3INAA 3VZLA 1QJY3 1R093 1UY1A 2B9UA 2C9AA 2EIGA 4DXTA 2XH6A 4Y22A 3H1MA 1LHWA 3ZFFA 5JOYA 4C1WA 4F3JA 1C8NA 3P6BA 1JHJA 5JOXA 5FLIA 1QF3A 1XNDA 3I7DA 4IEUA 1DLCA 3IM0A 3T1LA 2H6BA 4QM8A 3ZYJB 1CZVA 5CISA 3WUDA 2QNKA 4Z92B 1XU2A 2QQIA 1JW6A 1OH3A 2CY6A 3V65A 3ZO0B 4I0WB 5A6XA 2VUJA 1QIQA 1AHSA 3RPQA 3S30A 4K6BA 4J25A 4XFHA 2C0ZA 5DN2A 3TEXA 2VUAA 3TB0A 4JGZB 3JB4C 4FTBA 3U4SA 1GSLA 1H0BA 3H8OA 2BOJA 4KWKA 4P9YA 1UN1A 5FZEA 2CL2A 2HWC1 5KXCA 1BK0A 2J7MA 1SPPB 2ZKLA 4HFSA 4N53C 3MF9A 2X5IB 3CZUA 1Q8SA 1K5MA 3OGSA 4IUGA 3U4XA 4XDOA 4AAPA 5GZEA 1UYYA 2ZHNA 3K48A 5CA6A 1UW8A 4LIUA 4I2OA 4V2WA 2PHWA 5JIUA 2RS13 3LOIA 3BU7A 1P8JA 3MW3A 1V6NA 1DF0A 2HEYF 3DPRB 3UYJA 1CJDA 4LEJA 4QU1A 1WGPA 2D98A 2HWD3 2ZZQA 3ETQA 4DS0A 1ENSA 1RHI3 4YG0A 2W0XA 4L99A 3U14A 2WNOA 2GP5A 2RS32 2VTXJ 3WHTA 2WWJA 2BDRA 2UYAA 2HLEA 2MNGA 1LHOA 4BPZA 4XF9A 4Q8LA 4A6SA 2DBIA 4OQ9A 4C90A 1PIV2 2VUDA 4N53B 4HSJA 4KH9A 5A1LA 2Q30A 2WFF1 1BMV1 1GR3A 1GP4A 3O1RA 5F2SA 3NJYA 1W3VA 4BQ1A 4FAGA 3UL2A 3CQOA 2XHNA 3G6JB 3VBFA 3E97A 3M3QA 5FZAA 3SH3A 4IGQA 4P9WA 3CKHA 3B9IA 3GYDA 2FZ1A 4XXAA 1ULPA 1PO12 4EN7B 2Z69A 2Y6JA 1JOPA 2FDJA 1XE8A 2NLRA 4NRPA 2Y38A 3O1PA 3E6DA 1SMVA 5FPAA 2W87A 1SFYA 2ATFA 4B4RA 2VNOA 2XUEA 3ZXLA 5JXJA 1VMFA 1BLZA 1JZ8A 2R072 4E9KA 3KT4A 4IEZA 4RHV1 4ZONA 3WDYA 2ZGNA 3ZX7A 1A8MA 2XWBB 2IFWA 5FZ1A 2EIDA 1MEC3 2R062 2JDMA 3AZXA 1W6PB 1LGNA 3WP6A 1ULCA 2OPWA 2VMFA 1HRI1 3WG3A 4CCMA 1IPJA 2CWMA 3AB0A 3WV6A 3MLLA 3B5LB 1JZ3A 2X29A 2ENRA 2HWC3 2JICA 4IEVA 4Q1RA 3T0AA 2YPDA 1I1EA 3WW1A 4RFRB 2WLPA 2ZEYA 5D1IA 4MGKE 4TLGA 5FJKA 3L2HA 4K8RB 1JMUB 2IC1A 3W20A 2XQRA 1JYNA 3THDA 1SEFA 1C57A 2PLV1 2VW2A 2GN3A 4PBPA 2BFUL 2F17A 1RUH2 3V56A 4XDPA 4OI1A 5T50A 1B35A 4FO9A 3WNMA 1TE1B 1PMIA 1U5YA 1W6OB 2A1XA 4XFGA 1GMMA 2JXAA 3T3YA 3HR9A 5A3PA 4N43A 3K4AA 5JCTA 4C8DA 4ZPIA 4E8DA 3FUOA 3SH4A 4UFIA 1B35C 2A70A 4Z2WA 1J58A 1QKQA 2XVKA 4UI9L 3UGFA 1IG0A 4OULA 4XCBA 4E2SA 1LAJA 1FPN2 4UW3A 5FMBA 2PN5A 3UKTA 4FPJA 2F4LA 3VGIA 4N43C 2SLIA 3VB9A 5BNOA 3HQXA 4AVSA 1GZ9A 5EZWA 1Q3EA 2WFF3 3M3OA 4KG8A 4QGNA 1HB3A 1YQ8A 2BTVC 1H2MA 3ALQA 5K4LA 2QJVA 4N7UA 4UWDA 4YM0A 4YW3A 4V1PA 5FYCA 3U11A 2D6PA 1OPMA 1TNFA 1WD4A 4CUBA 1YIFA 1W03A 5BNOC 2JG8A 1WCQA 2JECA 1PGW2 2XJTA 3WEZA 1XJAA 1AR91 1LCLA 3M70A 4QT6A 4OUEA 4K21A 4YLZA 5KC6A 4CDWA 3O1TA 4Q4X1 2I07B 2IXHA 3AZZA 1N3QA 2JG8C 1QOTA 3I3BA 1GOFA 1W6QB 1W9FA 4GWJA 3AVSA 1B35B 1CD3G 3MI8A 5F5IA 2GMMA 1XYOA 5DG1A 2Q8CA 1ULDA 3BOWA 3NV4A 2OZJA 4CDWC 2IUWA 4AR2A 4HKOA 4N43B 5JLVA 3BTAA 5D21A 5BPXA 3RZJA 3VLBB 4D8MA 4RHV3 1YJLA 2XJUA 1FNZA 3PTYA 3POSA 2O14A 4LBLA 4D7SA 3SKVA 5HCHA 3VL8A 3J26N 4W6XA 4J1WA 2V4AA 3IPVA 4MHUA 2DFBA 2XHKA 5BNOB 2KA3A 5FZBA 3TEZA 3M2MA 3GCWA 1OKOA 4YM2A 3VKMA 5DPNA 1HRI3 1OD3A 4HETA 4NVPA 2VOTA 3CL1A 4NUBA 1RMU2 3WX5A 3O1OA 4AEDA 2Q1ZB 1UYXA 1TNRA 1NA1A 2W52A 5GLVA 5I8SA 5L73A 2EVXA 3KT7A 1HV0A 2VW1A 3LDRA 2YDEA 4CDWB 3PVOA 4AEDC 2GN7A 3O5SA 2PLV3 1G9CA 4UW5A 2WA3A 4DPNA 4QQOA 5KHIA 3JZVA 4ONUA 1F31A 1NA1C 1YQCA 5L7OA 3VBRA 4BHPA 4URTA 3APBA 1PMHX 3FZ3A 4Y1VA 5FO9B 2AH2A 3Q8BA 3ZYGA 4HKWA 2BGOA 2ZX2A 2VZQA 4HMZA 4XUTA 5L7OC 1OOPB 3VBRC 2W1SA 4PIYA 2DCTA 5FUIA 3IPVB 1W3XA 2OT7A 1VPHA 4D3WA 2RS31 3ACIA 3TN92 2VM9A 2XB6C 2WUHA 3FLTA 4Q4V3 1LOFA 1VR3A 3GGLA 1RXFA 4LKEA 4FTEA 1Q43A 4MOAA 5CU1A 1EUTA 4GB32 1PIV1 3KCYA 2VOVA 2VQ0A 2VCBA 4HVOA 1WMDA 1J1LA 1LOAA 1GFF2 5FYHA 5LBEA 5FMDA 1LOFC 3ZSMA 1XYNA 2QQOA 1AR93 1PNFA 2FCVA 1LHVA 2TEPA 1GICA 1LESA 2YB7A 3M1HA 3W9AA 1C28A 2Q1MA 1FATA 4HN0A 3O1UA 2Q8OA 1PO11 5GALA 3UJQA 3ZIWA 3MFCA 5FY4A 1W39A 2E32A 1AR82 2BWAA 4LK6A 1LOGA 1OHFA 5JSPA 2VVEA 4H7MA 4WZCA 2YROA 5E16A 4FPEA 2ZBJA 4NJ4A 3ZN6B 4DUWA 5C8CA 5JMOA 2DVBA 2AR6A 4XFAA 3LEKA 2BP6A 5LASA 1ZBA1 4LMFA 3E1F1 2R071 3CHXA 5E1RA 3U37A 4HK9A 4EN6B 1IS3A 5FQ0A 3AMMA 3J8F2 1Z7S2 4UFHA 4DRVA 4YZ4A 1JZ5A 2F4PA 2R061 3ZSLA 3AC0A 5K0UA 1UYPA 1LRHA 2XL9A 5J37A 2BVVA 2RG4A 5L9BA 3KCXA 4X6QB 4K8FA 1OVPA 3ZR6A 1ZA7A 3WDTA 5F7UA 3ON7A 1APNA 4LORA 3E6BA 5FY0A 5HI0A 5J3UA 3MHZA 5K0UC 1HB1A 5IFTA 3MUY1 1VAVA 1HW5A 2OVUA 1F2NA 3M8LA 4CDUA 2PAEA 1NCRA 2WNUA 4KWLA 3QD6A 1W9TA 3C3VA 3I4IA 2VAUA 2OXBA 3MIHA 5DABA 3P5BA 4JDMA 5BNPA 1QMJA 1RUH1 4CDUC 5L9VA 3FFZA 3BU0A 2EAAA 3WNPA 4BQ3A 4K7JA 4AEJA 2LW8A 4IE0A 4LKSA 4Z07A 3ECQA 5C71A 5EV7A 4PIXA 1CPNA 3O0XA 1JBCA 2LS6A 3LDBA 3N36A 1SZBA 1N1TA 2K2SA 5DDJ2 3LZZA 3WNOA 5FZLA 4FFHA 1FPN1 3RYPA 4ASKA 3PDQA 3MBWA 2Y34A 4QWNA 4NIDA 1W0PA 4CCLA 3CJXA 2AUYA 4A7ZA 4NWVA 2B42B 1KRIA 2ZGLA 5T5PA 2DYCA 1UZ0A 4LHSA 2NN8A 1J3PA 4IEYA 1KEXA 1PGW1 4YZ2A 1FX5A 4AVBA 3HPNA 1V6IA 1OFNA 2R0HA 3UESA 1E57A 1PO13 4YZ1A 5FPXA 3LD8A 2WAOA 1CQ9A 3ZYIB 2CGOA 5KHHA 4W50A 3NVCA 3OCPA 5GZGA 2DUQA 3KLSA 2VO5A 1H6XA 2E53A 3WDXA 4JC1A 2A73B 4AGRA 1VAKA 4XACA 1SHWB 2YGMA 4XFCA 4NIAA 2E63A 4CP0A 1ZBA3 2D43A 4XCAA 2XUMA 3MDPA 1EV13 2C26A 1ENXA 5FV3A 3AP5A 1PZ8A 1ULFA 2Y6LA 2ZS6B 4B29A 5ABJA 1NQJA 1ND3B 5J1XA 5JI7A 3FBMA 5CIRA 2VBDA 4BQYA 2WS92 3BYWA 2RS52 3LIHA 4CRQA 3K77A 5FKBA 3V0BB 2WKKA 3PVNA 4S2GA 5FBJA 5A3MA 5ABJC 3C2UA 1ONAA 4FFGA 3WG2A 4Z82A 2OUJA 1RMU1 2PHDA 4W6YA 1CAVA 1CIYA 4KGQA 2ET7A 5EPAA 3SXWA 3WDUA 5BUVA 3BTYA 2Z4FA 3AKRA 3IT8A 5DG2A 4Q4W3 2LROA 2Y33A 4RGAA 4O61A 4I0AA 1XQNA 2LM3A 3U0ZA 5LA1A 1D4VB 2DBNA 3I59A 4EWAA 2NP0A 4OZXA 1A8DA 4LE3A 1REEA 4CUAA 1RUH3 4ZXKA 2VMHA 4O65A 4QHOA 2WN2A 2PQSA 4FPKA 3ZKUA 1UKGA 1OQ1A 4UOJA 5T52A 2NM1A 3MW4A 1HXS2 3N3HA 1HKDA 3AFKA 1RUD2 1HIXA 2QUOA 1JYIA 4XAAA 1QDCA 1FYUA 3I2FA 1W9SA 2JDYA 4RGGA 2B46X 2D6KA 5F32A 5FP8A 1HJGA 4NPLA 4A41A 3DYPA 3DXTA 1AYM2 3J4UH 4P9JA 4GB31 1AL21 3AK0A 1MS8A 1UOFA 1CAVB 3GBWA 3MF6A 1W6MB 2E7AA 1W0OA 2QQLA 4AVTA 1UQXA 3N9OA 4XJWA 3OEBA 4FP2A 4COVA 3R4DB 5FREA 2GNBA 5A7SA 3I59B 1PM4A 4WM7A 5FYBA 2ILMA 1YUDA 2VMEA 3RWNA 4J6GA 4LBNA 2WABA 1IS4A 3DV8A 2WZR3 4Q4Y3 3BTZA 5A7QA 3KT1A 1FOD3 1QH7A 3H0OA 3WG4A 3PURA 3ZPOA 1AR81 2VMCA 3AJYA 1Z0HA 3K4DA 5LEKA 4WM7C 2DDUA 2VZVA 3MPBA 1W8UA 4LKDA 2ZPXA 4MADA 4PF1A 4Q2FA 3VDDA 1OUSA 3ZFGB 1DP0A 2RMU2 4YW4A 2BERA 5FYSA 4DQAA 1C4RA 3UV9A 4MLOA 4CDXA 3J8F1 1Z7S1 3VDDC 1KITA 1GQPA 5A6ZA 1ZX5A 2VNVA 1R1ZA 5CKMA 1DGWA 2XDVA 2Y8KA 4DOUA 1X82A 5IATA 5IJRA 4YZ3A 4BLJA 4AK3A 1VBD3 3WF4A 5CVRA 4IEPA 2IXCA 2R30A 1RTVA 4H14A 4L92A 4YW5A 3GBGA 3HBZA 1GZCA 1S0CA 4Q0SA 4AVVA 2D3PA 2JDHA 1U5ZA 1WMEA 3CJIC 5L19A 2QZ3A 1VBB2 1CIWA 3TWIA 1W9YA 2VZ1A 4HG6B 4CDQB 5C5UA 5J36A 4QB1A 3G7DA 4XW3A 1X8EA 2WZEA 4UT5A 5FUPA 3AM2A 1EPWA 3OGRA 4LHLA 1HRV2 3H8RA 1GKBA 4AI3A 5KXBA 3ZLIA 3FL7A 2ZAHA 3AYEA 2RE9A 1H2LA 3L9JT 1OA2A 3I3MA 1TVGA 5FWEA 4FCAA 3LA2A 1UZZA 4IEWA 4RSUA 5DXDA 5A32A 2JDUA 3UJOA 2LALA 5A3LA 3MIFA 4H2AA 3WF0A 5DDJ1 2XMLA 4PQQA 4HK8A 3CJIB 5KHKA 2FZ2A 1AL23 3PUAA 4GKYA 1IHMA 5T5JA 1RUF3 4Q26A 4AEMA 1WA4A 4O9GA 2VNRA 4C0HA 1NT0A 1ZVFA 3C8XA 2BRTA 2E26A 4GKXA 3O1SA 3H8XA 1S55A 5JMCA 2VZTA 3LOBA 3AZVA 1WCUA 3Q8CA 5C4WA 1MZ6A 1K42A 1OMIA 3E5XA 2VW0A 1QGLA 5C4WC 4BCUA 1OLRA 2VG9A 1QJZA 3SLIA 3KGLA 4CUGA 4IETA 4BQ5A 4Q8KA 1TME2 4QX3A 3B01A 4XABA 5GLZA 3RVHA 2XVGA 2ZX1A 5A32B 2JG9B 3FFQA 2V5DA 4G9SB 3WOGA 5JOZA 4WM8A 1MZFA 5FR3A 1YC61 2BJSA 4WVMA 5IVVA 4XPVA 3MIEA 4Q5OA 4FPGA 3K3NA 3BI3A 1D7PM 4QXKA 2ZMKA 1RL3A 2RS51 5FJHA 1W2OA 2WWSA 5IK8A 2VU9A 1UD1A 3OPZA 4UF0A 4WM8C 5J98B 3MLKA 4Q0QA 3TOJA 4QD2A 4GMP1 3WD5A 5LBCA 2XBO2 4PBOA 3R4SA 4AFDA 3V64A 4Y1ZA 4QXCA 1JUHA 1VLNA 1X9PA 1KFUL 1TMF2 5CFDA 4B4PA 3POBA 2QKDA 5CADA 5M0TA 3IN9A 3D82A 4EQVA 4P00B 3GZEA 1AYN3 4OYUA 4GULA 4XUNA 5CFDC 1CAWA 1ASJ2 1XU1A 4HL0A 5LA9A 1W8HA 4GJZA 1CAXA 2Q4SA 2DVAA 1WCKA 2X53S 3RMYA 1HXS1 4WM8B 5ACA2 3VHPA 1RUD1 3CBNA 3ROUA 3E5UA 1UO9A 4MG2A 1UU6A 4OMCA 4AQ6A 2OW4A 5A3WA 5KR7A 5AFBA 2D6MA 3DN7A 1MS9A 1MS0A 3KV9A 3OD4A 3ZN5A 1JTZX 3B69A 4AAXA 1L7QA 1AYM1 1CONA 2D6NA 4M3CA 1AX0A 2W08A 3B7MA 4Y4YA 1TG7A 2YUEA 1PO22 1OA4A 1VIWB 1NG0A 1S0FA 1CN1A 1PX4A 1DZTA 4CCNA 4R9CA 4QKDA 3ES1A 3O14A 3ZM8A 4AGVA 3K75B 1JHNA 5I8TA 3OYWB 3RMXA 2MPFA 2XKPA 1VRH2 3VZJA 2WN3A 4AQSA 1LKNA 4Z2AA 5FZOA 1G6NA 1O4TA 3KZ4C 5FZMA 3BPZA 2I74A 2EXJA 1PM7A 2FDHA 1ODNA 2ARCA 3I2HA 2G9ZA 3JD72 3LE0A 5JZGA 1BVVA 3C7FA 1PGSA 1ZZCA 1JUIA 2PTMA 2Y0IA 2ZHLA 5GKAC 4MV2A 4PHZA 4HXCA 4E4DX 5FYUA 3N7JA 3EXUA 1RINA 2RMU1 3MV11 3IKWA 5JZGC 4H55A 3I2GA 3H42B 4CZSA 3QH6A 3BCWA 4EZHA 5KHJA 3ZSEA 1X9TA 3KGZA 1BKZA 1UY4A 3H7JA 4CEWA 4FTSA 4E4SA 3I2JA 4D6RA 2SBAA 4JRLA 1F35A 1R64A 4JKLA 5FPVA 3B94A 3ELNA 1F8VA 2HWB2 3ACHA 3BVCA 4L8QA 2I2SA 5FOBB 2E6VA 4YGDA 3ZXFA 2WQZC 3H50A 2VQAA 5EJZB 3ZIXA 3VD5A 4IXLA 1VBB1 1ZRFA 2OA2A 1LHUA 4L11A 3ZFFC 2BNMA 5FZ8A 4JZRA 3SITA 5JZGB 1SBEA 3A0KA 4X6RB 1J59A 2P3JA 3D0SA 5FK8A 2BOIA 2GZWA 4AF9A 2O1QA 3V0AA 1D0HA 1HRV1 4FT8A 2R32A 4ASLA 3LQCA 5JSRA 2HH9A 5C3QA 2W92A 1RUD3 1K5JA 2DWRA 4NO4A 1I6XA 1UIJA 2DU1A 3RWKX 4EN9B 3HVDA 3TNQA 4MGTA 4HPKB 3OPWA 4BYYA 4GAZA 1COV2 3OEAA 4KU8A 1AYM3 2CGPA 3S0MA 2WDBA 3F2ZA 1H1MA 1VBE2 3OF1A 1J83A 3B00A 1YNAA 3CEWA 3JU9A 3KS7A 4PLNA 5DQ0A 4Y22B 2E51A 3RI8A 3ZFFB 5J48A 3I3DA 3BPSA 4MSVA 1NUKA 4NE9A 2RVAA 5DZGA 4MH0E 1UX6A 2EXIA 1K5MC 1GZWA 4DUVA 2GALA 3U75A 2QQVA 3VBFC 2RR13 4OHXA 2ZHMA 1H9PA 2DCJA 4MYEA 1S2BA 1KXGA 2D97A 2IVIB 4COZA 4YNIA 2VTXA 4PLMA 1C1LA 3KV4A 4IGPA 3VBSA 5SV8A 3PVEA 4D6SA 1NLQA 2HWF2 1MPXA 3VUOA 1ZNPA 1BQPA 2B8MA 5JIAA 3AXEA 1SLLA 2JDZA 4CUCA 1LULA 2XPJA 4I09A 3QLQA 3A0NA 5FY7A 1KJLA 1TME1 3VBSC 2K9ZA 2CAVA 5T54A 3VBUA 3OGVA 4UBHA 2A6VA 5JI9A 4F83A 3NV3A 1SDWA 1JH5A 1UAIA 1VBA3 1YJKA 1YRZA 4QDRA 1K5MB 5F3CA 1G9BA 4IE7A 2Y60A 1XNKA 3VBUC 3HT1A 3WQBA 2DFCA 1E5HA 1AR73 2GC1A 2RDQA 4DXRA 3RRDA 1RUNA 4LO5B 4EV0A 3FHAA 5JR2A 1GZWB 4IERA 4ZXEA 3WT3A 2FDFA 2XBO1 1UOGA 3CF6E 2G1MA 3ABZA 5FOJB 4KBZA 5JPNB 1H8TA 4Y5TA 3AX4A 4FPHA 5E8AA 4FPYA 3KHBA 1WD3A 1H1AA 4Y1YA 4BU2A 5IK5A 2WT1A 3ITQA 1D0GA 2Z2SB 3NSTA 3D0JA 1TMF1 1JZ7A 3VBSB 5I8YA 4DXSA 3A7QA 1OF4A 3GM8A 3H1WA 1T6GC 1H8TC 2J42A 2VNGA 2JENA 3URFA 3WP5A 5H9RA 5HCFA 2TNFA 5LK5A 4LOTA 1HRV3 4MHRA 1FNYA 1RUI2 1ASJ1 3VBUB 3KV6A 5FZ9A 1PMJX 1PK6A 3POGA 1DQ6A 5ACA1 2EALA 2EAKA 3NNLA 1DGWX 3LSDA 3GHNA 1YFUA 2B45X 3J7HA 5FAXA 3WQ7A 2X10A 4DXZA 5LK7B 1IKQA 1QHDA 1PK6C 4OI2A 2WO7A 2YBPA 3D6EA 4QPYA 3VD7A 4IV1A 1I5PA 3DGTA 1XPWA 3WNNA 4OQ8A 5FZHA 2XQXA 1LEMA 2OPKA 1PO21 3SH5A 2WA4A 3NW4A 4IV1C 4CCOA 3CDZB 3H8UA 3LGRA 5I0UA 1SQ4A 1S2KA 2OQ6A 3K3OA 3T4VA 1VRH1 2AC1A 3ZYHA 3GJAA 2VOWA 4GWMA 4NMIA 3VZMA 2FDIA 4WZFA 1ACCA 2QQNA 5DAWA 1YI7A 3ZN4A 1DYPA 5DMYA 2GU9A 2A3XA 4BQWA 3JD71 1UY2A 1Z78A 1SFNA 5A7WA 1US2A 4PF5A 1REFA 2R1BA 3W5NA 3H3LA 1PK6B 2VCCA 1XNCA 2ZEXA 1W8FA 5CYYA 2VGDA 4FOYA 1SACA 3OY8A 1DU3D 4Q0VA 3NKGA 2W46A 1IQAA 2DF7A 3GXUA 5EJ3A 1NY72 1QJEA 3HNBM 4AFMA 2JE7A 4J1XA 3LA7A 2VY0A 3T2OA 4C0BA 1NE4A 3KF5A 4IV1B 5J7MA 2LRPA 2UYBA 5ANNA 4SLIA 3VHOA 4OHZA 1WBFA 1I5ZA 2PELA 1Q8PA 1CZTA 5I0RA 2E31A 2J1EA 5AVAA 1AVBA 1C5IA 4MZUA 3MW2A 2HWB1 2EIEA 3OG2A 4P5HA 5FMOS 2PMWB 4MO3M 1DGRA 3WW4A 2PAKA 2OUHA 4H7LA 2V4VA 3S5QA 1YEWA 2BBVA 1G86A 1DQ5A 3OBRA 4XJUA 2Q8DA 5FK7A 5F1RA 2R042 5I0DA 1ZZ8A 4XJ9A 4YW2A 3ZSKA 4MGSA 2XOMA 2DCZA 1O3RA 2KR2A 4TLFA 2YHJA 5HCBA 2VZSA 1ASJ3 3NJXA 3KWVA 4KNCA 5A80A 3RJ2X 1LB2A 1ZZ6A 4YW1A 2FCTA 5LRRA 1ZBE2 2JG8B 4R9DA 4FI9A 5ACA3 3DYMA 3THCA 1AXZA 3AKTA 1WLCA 1OI6A 2AACA 5F3IA 2IXIA 1QQP2 2D5FA 4Q1PA 5FY5A 1WWYA 5A1AA 4HKLA 5A1FA 5FPBA 2PXJA 2UWCA 4CPBA 1OQEA 1COV1 2WL1A 2XWJB 1OFSA 3J7LA 4YRDA 3SNMA 5J09A 4PQ9A 1S0BA 1VBE1 1EYBA 1YCIA 2CNAA 2DTWA 3OD0A 4QPIA 3VKFC 4ZKTB 5FKCA 2W95A 1ZRIA 2WT0A 3OSDA 5DZFA 2QCSB 1O5UA 5FYVA 2WZ8A 4BQ4A 1YO8A 3D8CA 1GUIA 3ENRA 1A78A 2JB8A 4YG3A 2Z79A 4QPIC 4JDNA 2JE9A 3FX3A 4X8PA 1H6YA 4AW7A 1O5LA 1XNBA 2I45A 3TYJA 3IDBB 2GH2A 1OC1A 2HWF1 3JD73 2RM22 3FBYA 4NHYA 3WZ1A 1BJQA 1VBC2 3J9SA 4CSWA 2J1TA 1MVQA 4AEDB 5IHRA 5G05L 1DQ1A 4YPJA 1N3OA 1DBNA 3WINE 2WO1A 5C3OA 2CV6A 5DAPA 4B7KA 1NA1B 3RZHA 1ZZ9A 2VXRA 1HV1A 2P1BA 2VC9A 2GNMA 4P9XA 4LHNA 1E5IA 4YVSA 1GV9A 4JGYA 3RZMA 4A2UA 5ERLA 4FP3A 3QBQA 5FPUA 4Q4X3 4BK4A 3SHRA 5L7OB 2JD9A 3VBRB 5FZFA 2ZMLA 3OBZA 4XHXA 4YVSC 4OI0A 1CX1A 2XKOA 3O7OA 2R0FA 3N7MA 1CJPA 1FT9A 4JGYC 5K7PA 1ZRDA 4LUKA 2HWB3 1TQ5A 4K40A 3WCRA 5A3NA 1YQ6A 2D3SA 3ZYFA 4QX8A 2VVFA 3B9CA 3ZDVA 4UAPA 1GP5A 1X36A 3BTXA 3WQ0A 1L7LA 1WMFA 3JCIA 5FO7B 2E7TA 5C8CC 1LTEA 5FO8B 5CKNA 1VB2A 4YW6A 3VZOA 2A7AA 3GZTB 1IG3A 5CFCA 1W8WA 4NIGA 3VZNA 1DFQA 1QEXA 2O8OA 3AP9A 4UW6A 5JWPA 4FQZA 3WP3A 2DVFA 1PVC2 1RUI1 5GZCA 5JOWA 3LEGA 4CXYA 2VCMA 3BODA 5DUVA 3ZSJA 4MGZE 3BIEA 4LJHA 4COYA 5CFCC 3AZWA 1VB4A 5LA2A 4QB2A 4I3PA 2DCYA 2Y6HA 4FPOB 4IE5A 2ZXQA 4NROA 4W8JA 3WSOA 5DAVA 4HSLA 1GYKA 1AJOA 1JN2P 3AMQA 3RZKA 4ZU4A 1GWKA 4GZ9A 4LQRA 4R4ZA 4O9EA 1J84A 5FDBA 5I91A 4JTOA 2G4IA 2IVJA 2P3KA 5C8CB 5IYYA 4CCCA 5JSOA 1NCRC 2WNUC 5FYYA 4ZS2A 3RNSA 2VPVA 3RGBA 1D2QA 1VAMA 1NLRA 4EJRA 1JYVA 3AMHA 1QJFA 5FQ0B 5BNPC 1YXWA 5A7PA 2C1FA 2O8QA 1YHFA 2ERFA 3NAPA 4HT1T 3QACA 5GZDA 4AVAA 2DV9A 2RS33 1VE0A 2DCKA 3WDVA 4QQLA 1G9FA 4M3CF 5K0UB 2HWF3 3LKJA 3LPGA 3EB7A 3MPPG 4E4ZA 4LA2A 5H9SA 1HQNA 1PIV3 3NAPC 4IQPA 4AL9A 2C5DA 2IXKA 2X05A 3O1VA 1XSQA 4JQRA 4D0QA 3N9MA 1HLCA 2X8KA 1UIKA 3IIIA 5JVVA 5LZ6A 3HWJA 4PCRA 3P1IA 1C8M2 3HNMA 4CDUB 1IQDC 2XXZA 1NCRB 5GLUA 2WNUB 4XHBA 1YIPA 2PFWA 1NY71 2VJXA 3HMYA 1QJX2 4KU7A 4QHZA 1UY3A 2A5ZA 2IXJA 5L36A 3LEIA 1RUE2 1H2KA 2OQ7A 3WR0A 1JZ2A 3SCHA 4Y5Z0 5BNPB 1UNBA 1NXMA 2NYYA 2P3IA 1QH6A 3FJSA 3H1YA 2C9KA 4NRQA 4YVWA 4XE9A 4XF4A 1HQLA 3NNJA 1V0AA 1S0GA 5C5TA 3I2DA 1SCRA 2OKXA 1Q5OA 2ZX3A 3EYPA 2BGPA 1O8PA 4FOWA 4CU8A 1QU0A 1U5XA 2R073 3ORJA 2CTVA 3K4ZA 1VMJA 1FMD2 4WVVA 4YVWC 1UF2C 3W59A 3A22A 3FE5A 1KD7A 4IEXA 4YWAA 2YC4A 3NJZA 4PDWA 5KBFA 1LU1A 2R041 2ZGKA 2R063 1XXNA 3BIWE 1CAUA 1OT5A 4LBJA 1LR5A 3I54A 3KM5A 2VH9A 2C6SA 1KFXL 3LWCA 4Y24A 5IFPA 1RGSA 3D3AA 3FLRA 4PDWC 5FYZA 4XFFA 5JXHA 3VD9A 3VHNA 3POFA 1ZBE1 5AVPA 4CP9A 1UOBA 2NMOA 1H4HA 5FZIA 1IGOA 4BZ4A 2W94A 3T2PA 4TZDA 1V9U2 3PL0A 3PTRB 1QQP1 1KS5A 3OUIA 1IPKA 3OUJA 2WSVA 4QXHA 1YI9A 4Y1XA 5H9PA 4CU9A 5IW0A 4AEKA 3IBMA 3NV2A 4GH4A 1QJU2 3Q8EA 3AKPA 5AC92 5FLHA 1V70A 3LDKA 4YVWB 1N1VA 2HBTA 2VUCA 3S5AA 4I02A 2KD7A 4DY5A 3SQOA 2PA7A 1NCQA 3D5OA 5FY8A 5FZCA 4QX2A 3CU7A 5FWJA 4GH4C 3SKJE 3T0DA 1ENRA 3EBRA 3NO8A 1R092 1SDDB 2VULA 1MR5A 1PX3A 3UT0A 2CHHA 2GP3A 2Y6FA 2QFEA 4INDA 4RQPA 5ABJB 2E7QA 3ES4A 1NCQC 5HXMA 5K8SA 2AYHA 1Y9MA 4PDWB 1ULOA 1BHGA 2ZGPA 1H9WA 2V5YA 4N9HA 1FPN3 3M7AA 2BU9A 3ATGA 4RQPC 4LR4A 4IL7A 3MGUA 2RM21 4DFSA 3VHRA 1VBC1 3AVRA 5F6LB 4FXKB 1HQWA 2RHPA 2W1QA 3OUHA 3RDIA 3T2TA 2K46A 4DNYA 3VBHA 3FN9A 4KWJA 4H3WA 4NRMA 3WVJA 4P08A 4AI8A 1JYTA 2P6HA 2XLFA 1SCSA 4GH4B 3WY6A 3VBHC 2Y6KA 3A4UA 2GMPA 3ZYRA 4YYOA 4BJ0A 4JCKA 5GLWA 1GWLA 2GC2A 1ZYBA 3JB8A 2A75A 1BEV2 1Y9QA 4PIZA 1V6KA 5KXDA 1F4AA 4CCKA 4GWNA 3FHIB 4I0BA 2ORZA 4ISRA 4WVWA 5F3GA 5F39A 4EE2A 1PZ7A 4A3XA 2J1SA 2NMNA 5IVEA 4D6QA 2RS12 4IE4A 2BNNA 5A3TA 4P14A 4BDVB 3HOBA 5JR7B 2HWD2 2PHLA 3O0WA 5D8AA 1J1TA 1RHI2 1LENA 4L9BA 4COWA 4IV3A 1HJFA 3UNPA 4FPCA 1LHNA 5FY9A 2OIIA 4ISQA 2Y0OA 4QXBA 4XZUG 1PVC1 5D8AC 2Q5TA 1RUG2 1W8NA 1LGBA 2W5FA 4CDXC 1FAYA 1RMU3 5CG9A 4IV3C 1ZBE3 3CMGA 5KWRA 5LCWL 3IZOA 1C3HA 3Q9OA 3ZXJA 3GJBA 3U78A 3MZHA 4WM7B 4IESA 4E27A 2ZACA 3TNPB 3J7MA 4NHLA 1PGL2 3PMEA 4OHWA 3PNAA 3RSJA 2EA7A 2W2IA 5FZGA 4LK7A 2WYSA 3HT2A 4QGMA 2Y64A 3BKZA 4FPLA 4Y1UA 3VDCA 2WJSA 5LRSA 1H2NA 3DYOA 3OBTA 4WVZA 3NL1A 3VDDB 4LOSA 1K12A 1M4WA 2ZX4A 4Q0PA 1DCSA 4XVHA 5LATA 2RDNA 1NX9A 4CDXB 1IPSA 5D8AB 1JOBA 2ZGTA 4QX7A 2XONA 4IV3B 3CLPA 5ANQA 4AI2A 5BNNA 2EF6A 3POIA 4XMAA 5E6HA 3N9NA 2RJLA 2ZGQA 3K51A 5TSWA 5C8WA 4UFLA 4GB33 2ZEWA 4BOWA 1MEC2 2ZAAA 1AR62 5BNNC 1H1IA 1VP6A 4FFFA 3BUCA 4LULA 3AZYA 3BALA 2H6CA 1GNYA 1C8M1 1GQGA 1JOJA 4BQXA 2IWGB 2YY1A 3TN91 5HV0A 4QMAA 4BE3A 1LOEA 4AYUA 1QJX1 4FQ4A 1YWKA 1US3A 2QTWB 1S0EA 1N47A 2P4EA 1RUE1 2WNEA 3VKNA 1PZ9A 4HVQA 2ZGMA 4QX5A 1AR83 3DKWA 3CNAA 4LA3A 5A70A 1OLMA 1M06G 2GNTA 1NQDA 3L2YA 4XF3A 1YQ5A 5C3PA 3AMPA 1T2XA 4CCJA 2IXLA 2QQJA 3M3EA 4XTMA 5FP9A 2QBXA 3AL6A 1FMD1 1UCXA 4A7KA 2GMEA 4RD7A 4ITCA 2J1UA 3VBOA 3J8F3 1Z7S3 2ZMNA 1XE0A 2DVDA 1W6NA 2CU5A 2GSYA 4LBQA 5FMCA 3RYRA 1V00A 3IDEA 4N8MA 1R082 2D44A 2FHRA 2HWE2 2WNVA 1A3KA 2WS91 2YG0A 4LE4A 3S7IA 3AJZA 3T4HB 4UFMA 1SLTA 3VBOC 1PVC3 3SEPA 1QXRA 1S0JA 3DL3A 3H9AA 1DHKB 4BLIA 4EYUA 5E88A 1G8WA 2WC2A 5A7OA 3ZXEA 1POV1 5F9TA 2CSGA 2GC0A 2WNVC 4OMDA 3RG0A 5KC5A 2BYVE 3R0RA 5LY2A 3IWZA 2VMDA 4RR3A 5FUNA 5C4WB 2WYFA 3WNXA 5EYYA 1V9U1 4CPBD 4IDZA 2QVSB 3ACLA 3PUQA 4LO6B 2DTYA 5BNQA 4META 5AC91 1QJU1 1OPOA 2JDAA 2WINB 3R4UA 4U36A 3M3IA 4DEQA 1DGLA 2XJVA 3HNYM 2B5HA 3NRUA 2UY8A 1UU5A 5AFEA 1REDA 1YQ2A 3H3UA 4XC9A 4GA9A 1R091 2ZZJA 5EWSA 3U07A 4LT5A 1F5JA 3NNFA 4LHKA 4WVMB 2D93A 3ZFEA 1XSRA 5FIXA 4RHV2 5DZEA 5DDJ3 1F15A 4BMEA 2Q1FA 1VALA 1ZZ7A 4AGGA 3GZUC 4K1ZA 1W8TA 3FUQA 4UF0B 4DZGA 4I01A 2IFRA 5L9RA 3ZFEC 4UFKA 2QDNA 1WCSA 1QOSA 1POQA 4LBMA 3VV1A 4AZZA 1WW7A 3ZMNA 2YPJA 3SEEA 1RJ8A 5HXVA 1OLQA 5B2GB 5A33A 4UW4A 5CFDB 3ST7A 1QJX3 4M3CE 5JDBA 1ULEA 2YGLA 2FMYA 3USUA 1S2EA 3C7HA 2LTNA 4E4HA 2WQ8A 1BEV1 1CAWB 3MIGA 1NAEA 3HN3A 4LTAA 2V72A 4LPLA 1J3QA 1URXA 1CAXB 4HANA 4F7ZA 4I30A 2QQWA 2VMIA 2BGCA 2XJRA 3UKVA 1RUOA 1AUYA 3PLQA 4ORFA 4BXSV 1RXGA 4BA6A 3TRSB 4TYSA 3B3QE 2ZTNA 2RS11 1IKPA 1WUVA 4IEOA 1O4ZA 4XFBA 1BXHA 1RUJ2 2HWD1 3EJKA 4HOOA 4LO7A 4AFAA 2W39A 1RHI1 2WAAA 2WS93 3IIAA 2RS53 4M3CB 1Q8QA 1NE6A 4FXGB 3F95A 3HIFA 3SISA 1QY4A 1G9AA 4Q4V2 4M4PA 1RUG1 4GMP3 1POV3 4HONA 3GF6A 4IE6A 2BW8A 1NKGA 3OJBA 1AX1A 5SV5A 4CEWC 4DY3A 1V6OA 5FZOB 2BV4A 3USSA 1V9U3 2HBUA 5FPZA 1PGL1 1RB8G 4CXWA 4JGZA 4WV8A 1UPIA 5IK7A 5BY5A 3ILFA 3JBG2 1QJU3 3O12A 1L7RA 4K20A 4XETA 5AC93 2AGSA 4AHWA 4KL1A 1EAH2 5EYXA 4U2AA 3W58A 1MS5A 2X5IA 2WFPA 4JGZC 4JX0A 4S2FA 2V09A 4QX1A 4NIIA 1G7YA 1S1AA 1FV2A 5C3RA 1HXS3 2ARAA 2ID4A 4EN0A 4ARYA 4XOGA 4L0PA 2JB4A 2X5IC 2W9XA 4QPWA 4JDOA 4V2VA 1HN0A 4KBBA 1E5RA 3DPRA 4QAWA 4NHMA 4NPMA 1W2TA 2IZWA 3KQ4B 5FZDA 2ARXA 3OGGA 4CEWB 2WSUA 3S57A 3N7KA 3DXUA 2MEV2 2JKBA 1YLLA 1T6BX 2A6WA 5EFUA 4CA9A 4BB3A 4KMQA 5FBZA 3TEYA 1MEC1 3DPRC 1AR61 4L2NA 1GZTA 1SFPA 3SC7X 3AP6A 3BOPA 4K3UA 2OX0A 2RV9A 2ARBA 5FLJA 4MGYE 5EXOA 5A6QA 4TTGA 4N53A 4YARA 1JZ4A 2BPA2 1UWWA 4MX3A 4RFT0 1GBGA 2CWSA 4O7XA 1J3RA 1UZWA 2DURA 1UYZA 3MFAA 1VJ2A 4CCEA 4RL7A 4N7IA 1BEV3 3MUZ1 2VOXA 4JHTA 3V0AB 3ME2A 3ZR5A 3K2OA 4ZU5A 5JAXA 2YXSA 2EXHA 4BK5A 4Q0UA 1RITA 5A6YA 1K3IA 3EMRA 3I97A 2GC3A 5CB7A 3C7EA 5C7GA 2RMU3 3WP4A 3IDAA 1DZQA 4MXWA 4QQ2A 2FCUA 2DVGA 3MV01 2KM2A 2R1DA 2BNOA 5DUXA 4A6OA 2YU1A 1DLLA 5C6CA 1W05A 2UU8A 2ZHKA 1SBDA 3TAYA 3U10A 2XG3A 1MVEA 2NZ9A 2J1RA 1U12A 4HZFA 1R081 3VBFB 2R16A 2HWE1 3I2KA 3EHKA 4A4AA 5FZ4A 2QQKA 2DU0A 4YGBA 1RUG3 2WO2A 4GQ7A 1Y9GA 4B7EA 4XDQA 5IWFA 3TBDA 3ZMOA 3VN4A 1W6PA 1Y43B 4FBFA 4W4ZA 4JHZA 2VZRA 4Y20A 2WRAA 5FP7A 4JAAA 4YZ5A 4ES9A 1WW6A 3GBFA 3VKLA 5JUVA 1VBB3 4FAHA 2ETEA 5CBLA 1HDKA 2A71A 4AHXA 2PQQA 1F5FA 3POYA 4I3GA 5F5QA 3GHMA 3LFMA 4JQTA 4FSJA 1WLTA 4RN5A 4ZZ8A 1YFYA 3ZVXA 5HBAA 1C5HA 3DF0A 5F5AA 4NWWA 2YBKA 2QZ2A 4MXWB 2G9GA 3BB6A 5LBFA 4B4QA 1I3HA 3BN6A 1LECA 4EZ4A 2PYTA 4TSVA 5FYIA 5DAQA 5CKQA 2YZ4A 1GNZA 2P6CA 1CR7A 1ZBA2 2QQMA 2YYOA 5IUQA 1W6OA 1IS5A 1EV12 3N9LA 1OURA 1V6MA 4D7YA 1Y3TA 3WQ1A 4B8EA 2JDKA 2H0BA 2RDRA 3E6CC 1DYOA 5F3EA 2YBSA 1HX6A 1BYHA 2BZDA 3SCFA 3N9QA 1XB9A 1AR63 3KCCA 3WLUA 2FD8A 4OCTA 1R1A2 3CIHA 1H8TB 5LEJA 1QOOA 1W2UA 2VMGA 4Y20B 5CAZA 3RZZA 1O3SA 3WCSA 3GZAA 4K1YA 5T5OA 3T1MA 1QNYA 5G04L 4C91A 1JU4A 1YYNA 2OS2A 1XRUA 5GM0A 1QXJA 4Q4W2 1EPZA 3KSCA 3LF7A 3FHQA 1LOCA 1OKQA 2BWCA 2JX9A 5FTTC 2D6LX 3KHCA 3S6PA 4QDSA 2TUNA 4K9SA 5FMOL 4GD4A 1ND2A 3ZYPA 1UKRA 4ES8A 3N4MA 4A45A 1TME3 1OD5A 1DGRN 2W91A 4PI0A 5IVBA 3POEA 5LW9A 1JYXA 1W6QA 3MEPA 4OHYA 4TN7A 2Y26A 4XBQA 3JQXA 3U1XA 2VZPA 2R6QA 1ND2C 2YC0A 3IMNA 3A21A 3AKSA 4LO4B 1RUJ1 3WNKA 1ZA4A 2C4XA 2L9LA 1R083 2HEVF 4KQ7A 1Q8VA 2HWE3 3GNEA 3LEMA 1XC6A 3W21A 3ZXGA 5IAVA 2K0GA 1QNWA 1OBNA 2AREA 4A44A 1OA3A 5EJ1B 2YV8A 5F8PA 2VZUA 3AMNA 3KVAA 4Q4V1 4S2DA 3I3EA 2XBO3 5IT6A 1RIRA 2BFUS 2LUWA 1F4HA 1RUC2 1Y4WA 4ET7A 1TMF3 5A3OA 1DG6A 1H4GA 4CU7A 1UZYA 1UMIA 3PVBB 3KV5A 3JBG1 2ZGOA 5JXGA 2O0OA 1NOVA 1EAH1 3DCQA 5A7WB 3S7EA 4BXFA 1ND2B 4LBKA 4XUOA 2WZR2 4FOQA 4Q4Y2 4MUVA 3OOXA 5A7NA 1FOD2 3LAGA 3OY8B 5I0SA 2VOKA 2TBVA 3NMBA 2ZABA 2JDPA 4KI5M 4XBLA 4OI4A 4JKKA 3HAGA 2QQPA 3JUUA 4RYDA 1KGYA 3EO6A 3UK9A 1JYWA 1JS9A 1S0DA 2ZCWA 2A3WA 5JXIA 4DRRA 1MZEA 3AYAA 4M0HA 3WW2A 1MS3A 1OOPA 4Z1VA 1V6LA 2JKXA 2MEV1 3X29B 4TXWA 5FXXA 3VDAA 3OTFA 3WNLA 5BXXA 3I49A 2ZEZA 4JTNA 1PO23 2J22A 1GANA 3PHMA 2AENA 1AX2A 4IW3A 4CXXA 2YC2A 1XNAA 3THPA 1OOPC 1H30A 1VBD2 2QDRA 2D6OX 4TWTA 2GNDA 1VRBA 1ST8A 1VRH3 1W2NA 4FPFA 4GJYA 3IDCB 4BMBA 4BQ2A 4E8CA 5CEHA 3I3QA 1KQRA 4E2GA 1GNHA 1TZOA 4IGOA 4QB6A 1CVNA 1OF3A 1AZDA 2HYXA 5CZKA 5DAXA 4QQHA 2X09A 5FXZA 2JJ6A 1LODA 5LBBA 4AI9A 5CNAA 4XQWA 4YGCA 5EIYB 1GP6A 1ZM1A 2P37A 4LBQD 5IVFA 5IVJA 1DQ2A 1NZCA 3ZN6A 2A6YA 2B7YA 1SLBA 3JQWA 5FCCA 1RUJ3 2FMDA 2DUOA 4N90A 2UURA 4QX0A 1W9WA 1JYCA 1LJ7A 2C24A 2CGNA 2NPIA 4QPIB 1TEIA 3Q8FA 5DUUA 4JKMA 2A6ZA 4CP1A 4OUSA 2XLGA 3PUIA 2OZ6A 1AL22 2GDFA 2VECA 1DQ4A 1G9DA 1RUF2 4QU2A 1MACA 3C7GA 3EQEA 3WW3A 4NAMA 1MS4A 1FV3A 2HKXA 2WR9A 2CYFA 4YSFA 4QDQA 3JBG3 4Y3OA 1RVF2 1DDLA 3LCPA 4AI1A 4XQ4A 1EAH3 2CDOA 2E33A 5FZKA 2VTFA 1BBT2 4XIKA 1K45A 4MVTA 2WQ4A 3RJRA 4OHVA 4YVSB 4P02B 2FQPA 2VL4A 4R9AA 4JGYB 4N9IA 4OZOA 4URAA 3ILNA 1EUUA 4XF1A 3T2QA 4D7TA 1GLHA 1NZIA 1EV11 1S0IA 1PVXA 1COV3 2JDNA 2MEV3 4LBOA 4QQPA 1VBE3 5FY1A 1O91A 3HQRA 4CTEA 4AQ2A 1R1A1 1IZ3A 4LLFA 4GALA 3O1MA 3KQRA 1L3JA 4LITA 1LEDA 2VE1A 3N35A 1ALYA 4P9GA 3VD4A 4CP2A 1WLWA 4B3NA 3POWA 2J1AA 2KXLA 4AQTA 4R8HA 4LKFA 4PJYA 2BUKA 3KB5A 4Q4W1 4L97A 5CFCB 3C7OA 3ZDSA 1W90A 4XBNA 2BEOA 3FLPA 3NKTA 3ZKYA 4BH9A 4ZY9A 1B09A 3HQUA 2PAMA 1ENQA 3VZKA 3CZJA 1D4M2 2D5HA 1AYN2 3ACGA 4Q29A 2QQUA 3JXSA 3UGGA 3R6SA 4G3YC 5C9AA 5T5LA 2JIGA 1WLDA 3ZPYA 4X8NA 3PIJA 1LU2A 4XEZA 5FYTA 3LIGA 5BV6A 4Y4RA 2W68A 3I8TA 5FXVA 4CCDA 5C9AC 1ND3A 4XJ8A 2EXKA 5LY1A 1CESA 3DKQA 5H9QA 3UETA 1QDOA 4F8AA 1BZWA 2UWAA 4Q27A 4B1LA 3V0BA 4YW7A 4PT6A 1OVSA 5F6KA 2VQTA 3NAPB 1SLCA 4DEVA 4OUMA 4XYXA 1ND3C 5F5CA 3VD3A 1RUC1 5IK4A 3B02A 5HCAA 2HEWF 3Q8AA 3J7NA 3OB8A 4DO0A 1NYWA 3PU3A 4XJAA 1XNTA 2VXJA 4CE8A 1N1YA 2XJSA 3ACFA 4AOCA 1RYYA 1KDKA 1RUI3 1UZVA 2WZR1 2YU2A 4Q4Y1 4A7YA 4CVUA 1ODMA 5JPMB 1FOD1 4A42A 3M4FA 2W1WA 1JZ6A 1UOJA 3IAPA 2ZKNA 4Y33A 3BGAA 1UXZA 5C9AB 1W2AX 4LNVA 3RYKA 4KG0A 1XBFA 3POJA 2A6XA 4YM1A 1W06A 2BBAA 5E89A 2ZX0A 1A34A 1Q56A 2ZJCA 4Y5SA 3O0VA 3PUSA 5IAXA 4XQDA 4ASMB 3MICA 3VL9A 1OSGA 4G4FA 3WHUA 1OQDA 3R05A 1SG3A 4AVCA 4DINB 4QM9A 1R1A3 2EIBA 5FXWA 2FDGA 5C33A 2Z42A 3RZGA 2D3RA 5HV4A 1GU3A 1QJY2 5I0TA 1I9RA 1VBD1 2AEYA 2CDPA 2EICA 3PMSA 4XZPA 1X50A 4B1MA 4EROA 2JE8A 5FRAA 1W6MA 1X8MA 1O7FA 1DZRA 1BCXA 3N7LA 1QWRA 1W0NA 1WKYA 3HEIA 5FPLA 1KS4A 2JWPA 1CAUB 2NQYA 4IEQA 4XUQA 3OGJA 2W47A 2P17A 3HBKA 1O8SA 4NN0A 3DECA 5D2AA 1BK1A 2XR4A 1OUXA 3E5QA 3IB3A 4C1XA 2FBEA 1PHMA 2HYKA 4JVAA 4PI2A 4ZS3A 4CP9B 5FP4A 1XYPA 2AEZA 5FZ6A 4AI0A 1ULGA 4P9IA 5F37A 5I93A 1RJ7A 3PIGA 4NR1A 3OPTA 2FDKA 4UXAA 5T55A 4YGEA 5FP3A 3ZFGA 1ZRCA 3AYDA 3SMHA 4GWIA 2Q8EA 1JODA 1WBLA 4QKFA 4XAEA 1GQHA 1UMHA 3QOPA 3T09A 2N7GA 3VKOA 3ZYBA 3PUHA 3PJQA 1NCQB 4COUA 4WBBA 5FYMA 4OLLA 3WF1A 3VDBA 1S4CA 2VQUA 2WLQA 3ZFGC 4EWEA 1H8VA 2UWBA 4M4RA 1HB2A 4MGQA 1ZREA 3KF3A 1CX4A 2B9VA 5GLTA 2G19A 4RQPB 1NLSA 5KHGA 4ARXA 1HN1A 1RUF1 1RUC3 4KGGA 4CU6A 5C70A 2ZGRA 4XILA 1YFXA 4RA0A 1MZ5A 2GAUA 5EHDA 1XOYA 4BIOA 3HD8B 2RR12 3WDWA 5LB6A 1RVF1 4QPGA 2R043 3RI9A 1N3PA 1LGCA 3I2OA 2VBPA 2R7EB 2BQPA 1O4YA 2RJKA 3VBHB 4CDQA 2VZ3A 1BBT1 5CG8A 2QE3A 2Y6GA 5F2WA 4A3ZA 4QPGC 3WF2A 1CWPA 2DUPA 3ZOIA 4MXVA 3LFIA 1OH4A 2XLAA 4ZU7A 1QQP3 3UKNA 4CDQC 1NXD1 2ZGSA 5EP9A 2ADEA 2XJQA 4M0NA 4NHXA 3MIBA 4HN1A 3T0BA 4HBNA 5HPOA 1UU4A 2H0VA 4UFJA 1VBA2 1WW5A 4D69A 3RS6A 4YFZA 2RDSA 4UYBA 4D94A 4RGKA 2JD4A 1AR72 2JIJA 3NNMA 1UMZA 4AFCA 3CJIA 1KDMA 4DB5A 1STMA 2ORXA 4Y26A 2WBKA 4CEYA 2P3YA 3H3ZA 3SCGA 3ZXDA 4HVRA 4QPGB 2XVLA 3NNGA 2PHUA 1V6JA 2ADDA 2VBBA 3AFGA 2J1VA 2PHRA 3HJRA 4AFBA 3K46A 1RC6A 1WCDJ 2P34A 2XGXA 4NOTA 4XUPA 4CEYC 2VR4A 4XFIA 2RM23 1JU3A 3QH7A 1VBC3 1D4M1 1BVP1 1AYN1 1QXPA 4FVVA 4DMIA 3ILRA 3GCXA 1CGPA 2BVBA 2Q0AA 3GALA 5BYNA 5KXEA 1MQTA 4R9BA 4E2QA 4PLOA 4AXOA 3WG1A 1AF9A 4JRAA 4UBGA 1EY2A 5A3UA 2HWC2 1YFWA 3WXPA 1O6UA 2JG9A 1UPSA 1ZRRA 1PNGA 1MQTC 3MLJA 4QKBA 4XF0A 5APAA 1WA6X 2HJIA 4QHBA 1KJRA 1U0AA 4XIOA 1X7NA 2ZOEB 3THTA 1A6CA 1AXKA 2WZPP 1AL0G 1VMHA 4AG4A 3UGHA 1SLIA 4CEYB 2JG9C 4FFIA 3ZXKA 4OVEA 3A23A 4HLTA 3AL5A 3ASIA 4LIVA 4P5YA 5C3SA 3FC0A 2JEMA 5J96B 4ZHNA 4GIQA 1W8OA 4NAOA 4SBVA 5BNNB 3W5MA 4BWOA 4W65A 1RVF3 1OLME 3LA3A 2VVDA 3H7YA 1DQ0A 4LUMA 2GH8A 4XURA 3WF3A 2ET1A 1HB4A 3RZLA 1UY0A
chains in the Genus database with same CATH topology
3QCWA 4Z8BA 1BBT3 1C1FA 1MQTB 4JV4A 5T3NA 4QGLA 2WFF2 2WT2A 1BMV2 1EP0A 4XMIA 2B39A 2PHXA 3KMHA 3KD4A 3PJYA 4BIFA 4XTPA 4OFGA 4BM8A 4M01A 1XE7A 3WUCA 2ES3A 1N1SA 1ZZBA 1IOAA 3MYXA 1O3TA 4RR3C 4RS5A 2XL7A 4R4XA 4W6WA 4AE2A 2D7FA 1MS1A 3AYCA 4S2HA 1QJY1 2UY9A 3VBOB 2ZA9A 3AXDA 4RS5C 1W6NB 4EWDA 4LBQB 1SBFA 3P3PA 4LLOA 2A3YA 2WNVB 3P3NA 3ZXAC 4XXPA 3OYWA 1JXNA 2R49A 3DUIA 5FFOC 2XJPA 1D4M3 4AHYA 1AXYA 2Z5WA 2E9QA 4NPRA 4RR3B 1HRI2 4YM3A 1DYKA 1C8M3 2G9FA 3TN93 5K9YA 4YFWA 1F9KA 4NHKA 1WW4A 1CPMA 2PHTA 1RUE3 1Y7BA 3B93A 2OYZA 2YMZA 4RS5B 3RQ0A 1FXZA 3LSEA 1O3QA 4GMP0 1POV0 2PLV2 2V73A 4FOVA 1DIWA 4MGIE 1SLAA 1UL9A 3AKQA 3ZFEB 2F6BA 3NWKA 1FMD3 4AWDA 4EN8B 2D40A 5DUWA 3AP7A 2RR11 4AHZA 3FWEA 4YG6A 1X33A 3LB9A 1D2SA 5GJ6A 2WIIB 1LOBA 1FI2A 1Q8OA 1AJKA 3HN1A 3D4KA 3CO2A 2ZGUA 4LO8A 4R52A 2MHFA 5GZFA 5A33B 3M3CA 4ATFA 3MIDA 4M00A 2AZ5A 4ATEA 2P2KA 4P9LA 3FMGA 1IS6A 3USUB 2CAUA 3NV1A 1AR92 1VBA1 1U5IA 2PHFA 4Q4X2 4XJZA 4HPKA 4GXLA 3AP4A 1AR71 4CYDA 3INAA 3VZLA 1QJY3 1R093 2B9UA 2C9AA 2EIGA 2XH6A 4Y22A 3H1MA 1LHWA 3ZFFA 5JOYA 4C1WA 4F3JA 1C8NA 5JOXA 5FLIA 1QF3A 1XNDA 3I7DA 4IEUA 3IM0A 3T1LA 2H6BA 4QM8A 3ZYJB 3WUDA 2QNKA 4Z92B 1XU2A 1JW6A 2CY6A 3V65A 3ZO0B 4I0WB 2VUJA 1AHSA 3RPQA 3S30A 4K6BA 4XFHA 2C0ZA 2VUAA 3TB0A 4JGZB 3JB4C 4FTBA 1GSLA 1H0BA 4KWKA 4P9YA 1UN1A 2CL2A 2HWC1 5KXCA 4HFSA 2ZKLA 4N53C 3MF9A 2X5IB 1Q8SA 1K5MA 3U4XA 5GZEA 5CA6A 2ZHNA 3K48A 4I2OA 1UW8A 2PHWA 5JIUA 2RS13 3LOIA 3BU7A 3MW3A 1V6NA 1DF0A 2HEYF 3DPRB 1CJDA 4LEJA 1WGPA 2D98A 2HWD3 2ZZQA 3ETQA 4DS0A 1ENSA 1RHI3 4YG0A 2W0XA 4L99A 2RS32 3WHTA 2UYAA 2MNGA 1LHOA 4BPZA 4XF9A 4Q8LA 4C90A 1PIV2 4N53B 4HSJA 4KH9A 2Q30A 2WFF1 1BMV1 1GR3A 4BQ1A 4FAGA 3UL2A 3G6JB 3E97A 3M3QA 3SH3A 4P9WA 3GYDA 3B9IA 2FZ1A 4XXAA 4EN7B 1PO12 2Z69A 1XE8A 2NLRA 2Y38A 3E6DA 1SMVA 1SFYA 2ATFA 4B4RA 2VNOA 3ZXLA 2R072 4E9KA 3KT4A 4IEZA 4RHV1 3WDYA 2ZGNA 3ZX7A 1A8MA 2XWBB 2IFWA 1MEC3 2R062 3AZXA 1W6PB 1LGNA 3WP6A 1ULCA 1HRI1 3WG3A 1IPJA 2CWMA 3AB0A 3WV6A 3MLLA 3B5LB 2X29A 2ENRA 2HWC3 2JICA 4IEVA 4Q1RA 1I1EA 3WW1A 2WLPA 5D1IA 4MGKE 3L2HA 2IC1A 1SEFA 1C57A 2PLV1 2VW2A 2GN3A 4PBPA 2BFUL 1RUH2 3V56A 4OI1A 5T50A 1B35A 4FO9A 1TE1B 1PMIA 1U5YA 1W6OB 4XFGA 2JXAA 3HR9A 4N43A 5JCTA 3FUOA 3SH4A 1B35C 2A70A 4Z2WA 1J58A 1QKQA 2XVKA 4OULA 4E2SA 1FPN2 4UW3A 3UKTA 2PN5A 4FPJA 3VGIA 4N43C 2SLIA 5BNOA 3HQXA 4AVSA 1GZ9A 5EZWA 1Q3EA 2WFF3 3M3OA 4KG8A 4QGNA 2BTVC 1H2MA 3ALQA 2QJVA 4N7UA 4YM0A 4YW3A 4V1PA 3U11A 2D6PA 1OPMA 1TNFA 1WD4A 1YIFA 5BNOC 2JG8A 2JECA 1PGW2 2XJTA 1AR91 1LCLA 3M70A 4QT6A 5KC6A 4K21A 4YLZA 4CDWA 4Q4X1 2I07B 2IXHA 3AZZA 1N3QA 2JG8C 1QOTA 1W6QB 1B35B 1CD3G 3MI8A 2GMMA 1XYOA 5DG1A 1ULDA 3BOWA 3NV4A 2OZJA 4CDWC 4HKOA 4N43B 5JLVA 3BTAA 5BPXA 3VLBB 4RHV3 1YJLA 2XJUA 1FNZA 3PTYA 3POSA 4LBLA 4D7SA 3VL8A 3J26N 4W6XA 4J1WA 3IPVA 2DFBA 2XHKA 5BNOB 2KA3A 3M2MA 4YM2A 3VKMA 1HRI3 4HETA 4NVPA 3CL1A 3WX5A 1RMU2 4AEDA 2Q1ZB 1TNRA 1NA1A 2W52A 5GLVA 5I8SA 5L73A 2EVXA 3KT7A 1HV0A 2VW1A 4CDWB 2YDEA 3PVOA 4AEDC 2GN7A 3O5SA 2PLV3 1G9CA 4UW5A 2WA3A 4DPNA 4QQOA 5KHIA 3JZVA 4ONUA 1F31A 1NA1C 5L7OA 3VBRA 4BHPA 4URTA 3APBA 3FZ3A 4Y1VA 5FO9B 2AH2A 3ZYGA 4HKWA 2ZX2A 4HMZA 5L7OC 1OOPB 3VBRC 4PIYA 2DCTA 3IPVB 4D3WA 2RS31 2XB6C 3FLTA 4Q4V3 1LOFA 1VR3A 4FTEA 1Q43A 5CU1A 4GB32 1PIV1 3KCYA 2VOVA 2VQ0A 4HVOA 1WMDA 1LOAA 1J1LA 1GFF2 1LOFC 3ZSMA 1XYNA 1AR93 1PNFA 3M1HA 1LHVA 2TEPA 1GICA 1LESA 3W9AA 1C28A 2Q1MA 1FATA 4HN0A 2Q8OA 1PO11 5GALA 3UJQA 3ZIWA 3MFCA 1W39A 1AR82 2BWAA 1LOGA 1OHFA 5JSPA 2VVEA 4H7MA 4WZCA 2YROA 5E16A 4FPEA 2ZBJA 3ZN6B 5C8CA 2DVBA 2AR6A 4XFAA 1ZBA1 5E1RA 2R071 4EN6B 4HK9A 1IS3A 5FQ0A 3AMMA 3J8F2 1Z7S2 4DRVA 4YZ4A 2F4PA 2R061 3ZSLA 5K0UA 1LRHA 2XL9A 5J37A 2BVVA 3KCXA 4X6QB 4K8FA 3WDTA 1APNA 3E6BA 5HI0A 5J3UA 5K0UC 1VAVA 1HW5A 2OVUA 1F2NA 3M8LA 4CDUA 2PAEA 1NCRA 2WNUA 4KWLA 3QD6A 3C3VA 3I4IA 3MIHA 4JDMA 5BNPA 1QMJA 1RUH1 4CDUC 3FFZA 2EAAA 4K7JA 4AEJA 4Z07A 3ECQA 5EV7A 4PIXA 1CPNA 3O0XA 1JBCA 3N36A 1N1TA 2K2SA 5DDJ2 3LZZA 3RYPA 1FPN1 1W0PA 3CJXA 2AUYA 4A7ZA 4NWVA 2B42B 1KRIA 2ZGLA 5T5PA 2DYCA 2NN8A 1J3PA 4IEYA 1PGW1 4YZ2A 1FX5A 4AVBA 1V6IA 1OFNA 2R0HA 1E57A 1PO13 4YZ1A 5FPXA 1CQ9A 3ZYIB 2CGOA 5KHHA 3NVCA 3OCPA 5GZGA 2DUQA 3KLSA 3WDXA 2E53A 4AGRA 4JC1A 2A73B 1VAKA 4CP0A 2YGMA 4XFCA 2E63A 1ZBA3 2D43A 2XUMA 3MDPA 1EV13 1ENXA 3AP5A 1PZ8A 1ULFA 2ZS6B 4B29A 5ABJA 1NQJA 1ND3B 5JI7A 3FBMA 5CIRA 2WS92 4CRQA 2RS52 3V0BB 2WKKA 3PVNA 4S2GA 5A3MA 5ABJC 3C2UA 1ONAA 3WG2A 4Z82A 2OUJA 1RMU1 2PHDA 4W6YA 1CAVA 4KGQA 3SXWA 2ET7A 3WDUA 5BUVA 3IT8A 3AKRA 5DG2A 4Q4W3 4RGAA 4I0AA 1XQNA 2LM3A 3U0ZA 1D4VB 2NP0A 3I59A 4EWAA 4OZXA 1A8DA 4LE3A 1REEA 1RUH3 4ZXKA 2VMHA 4FPKA 1UKGA 1OQ1A 5T52A 2NM1A 3MW4A 1HXS2 3N3HA 1HKDA 3AFKA 1RUD2 1HIXA 2QUOA 1JYIA 1QDCA 1FYUA 4RGGA 2B46X 2D6KA 1AYM2 3J4UH 4P9JA 4GB31 1AL21 3AK0A 1MS8A 1CAVB 3GBWA 3MF6A 1W6MB 2E7AA 1W0OA 4AVTA 4XJWA 4FP2A 4COVA 3R4DB 5FREA 2GNBA 3I59B 4WM7A 2ILMA 1YUDA 3RWNA 4J6GA 4LBNA 1IS4A 3DV8A 2WZR3 4Q4Y3 3KT1A 1FOD3 1QH7A 3H0OA 3WG4A 1AR81 3AJYA 1Z0HA 5LEKA 4WM7C 3MPBA 2ZPXA 4Q2FA 3ZFGB 3VDDA 2RMU2 4YW4A 4DQAA 1C4RA 3UV9A 4MLOA 4CDXA 3J8F1 1Z7S1 3VDDC 1KITA 1ZX5A 4DOUA 1R1ZA 1DGWA 1X82A 4YZ3A 4BLJA 4AK3A 1VBD3 5CVRA 4IEPA 2IXCA 2R30A 1RTVA 4H14A 4L92A 4YW5A 3GBGA 3HBZA 1GZCA 1S0CA 4Q0SA 4AVVA 2D3PA 1U5ZA 1WMEA 3CJIC 5L19A 2QZ3A 1VBB2 1CIWA 3TWIA 4CDQB 5J36A 4XW3A 3G7DA 1X8EA 3AM2A 1EPWA 4LHLA 1HRV2 1GKBA 4AI3A 5KXBA 2ZAHA 3AYEA 2RE9A 1H2LA 3L9JT 1OA2A 4FCAA 3LA2A 1UZZA 4IEWA 4RSUA 5DXDA 5A32A 3UJOA 2LALA 5A3LA 3MIFA 5DDJ1 4HK8A 3CJIB 5KHKA 2FZ2A 1AL23 4GKYA 1IHMA 5T5JA 1RUF3 4Q26A 4AEMA 1WA4A 4O9GA 2VNRA 4C0HA 1ZVFA 4GKXA 1S55A 5JMCA 3LOBA 3AZVA 5C4WA 1MZ6A 1OMIA 3E5XA 2VW0A 1QGLA 5C4WC 4BCUA 1OLRA 2VG9A 1QJZA 3SLIA 3KGLA 4IETA 4Q8KA 1TME2 3B01A 5GLZA 2XVGA 2ZX1A 5A32B 2JG9B 3FFQA 3WOGA 4G9SB 5JOZA 4WM8A 1MZFA 4WVMA 4XPVA 3MIEA 4FPGA 4QXKA 1RL3A 2RS51 2WWSA 5IK8A 2VU9A 1UD1A 3OPZA 4WM8C 5J98B 3MLKA 4Q0QA 3TOJA 4QD2A 4GMP1 3WD5A 2XBO2 4PBOA 3R4SA 4AFDA 3V64A 4Y1ZA 1JUHA 1VLNA 1KFUL 1TMF2 5CFDA 4B4PA 5CADA 2QKDA 3IN9A 3D82A 1AYN3 4GULA 5CFDC 1CAWA 1ASJ2 1XU1A 4HL0A 1CAXA 2Q4SA 2DVAA 1WCKA 2X53S 3RMYA 1HXS1 4WM8B 5ACA2 3VHPA 1RUD1 3ROUA 3E5UA 1UU6A 4AQ6A 2OW4A 5AFBA 2D6MA 3DN7A 1MS9A 1MS0A 3OD4A 3ZN5A 1JTZX 3B69A 1AYM1 1CONA 2D6NA 4M3CA 1AX0A 2W08A 3B7MA 4Y4YA 2YUEA 1PO22 1OA4A 1VIWB 1NG0A 1S0FA 1CN1A 1DZTA 4R9CA 3ES1A 3O14A 4AGVA 1JHNA 5I8TA 3OYWB 3RMXA 2MPFA 2XKPA 1VRH2 3VZJA 4AQSA 1LKNA 1G6NA 1O4TA 3KZ4C 3BPZA 2I74A 2EXJA 1PM7A 3JD72 5JZGA 1BVVA 1PGSA 1ZZCA 1JUIA 2PTMA 2Y0IA 2ZHLA 5GKAC 4MV2A 4E4DX 3N7JA 3EXUA 1RINA 2RMU1 3IKWA 5JZGC 4H55A 4CZSA 3QH6A 3BCWA 5KHJA 3ZSEA 3KGZA 1BKZA 3H7JA 4CEWA 4FTSA 4E4SA 2SBAA 4JRLA 3B94A 3ELNA 1F8VA 2HWB2 4L8QA 2I2SA 5FOBB 2E6VA 4YGDA 3ZXFA 2WQZC 3H50A 2VQAA 3ZIXA 4IXLA 1VBB1 1ZRFA 2OA2A 1LHUA 4L11A 3ZFFC 2BNMA 3SITA 5JZGB 1SBEA 3A0KA 4X6RB 1J59A 2P3JA 3D0SA 2GZWA 4AF9A 3V0AA 2O1QA 1D0HA 1HRV1 4FT8A 2R32A 4ASLA 5JSRA 1RUD3 2DWRA 4NO4A 1I6XA 1UIJA 2DU1A 4EN9B 3TNQA 4HPKB 4BYYA 1COV2 4KU8A 1AYM3 2CGPA 3S0MA 1H1MA 1VBE2 3OF1A 3CEWA 3B00A 1YNAA 3JU9A 3KS7A 4PLNA 3VBFA 3RI8A 4Y22B 2E51A 3ZFFB 5J48A 4MSVA 5DZGA 4MH0E 1UX6A 2EXIA 1K5MC 1GZWA 2GALA 3VBFC 2RR13 4OHXA 2ZHMA 1H9PA 2DCJA 4MYEA 1S2BA 1KXGA 2D97A 4COZA 4YNIA 4PLMA 1C1LA 3VBSA 5SV8A 3PVEA 2HWF2 3VUOA 1ZNPA 1BQPA 2B8MA 5JIAA 3AXEA 1SLLA 2JDZA 2XPJA 1LULA 4I09A 3QLQA 3A0NA 1KJLA 1TME1 3VBSC 2K9ZA 2CAVA 5T54A 3VBUA 4UBHA 2A6VA 5JI9A 4F83A 3NV3A 1SDWA 1JH5A 1UAIA 1VBA3 1YJKA 1YRZA 1K5MB 1G9BA 1XNKA 3VBUC 3HT1A 2DFCA 1AR73 2GC1A 3RRDA 1RUNA 4LO5B 4EV0A 1GZWB 4IERA 3WT3A 2XBO1 3CF6E 5JPNB 5FOJB 1H8TA 5E8AA 3AX4A 4FPHA 4FPYA 1WD3A 1H1AA 4Y1YA 5IK5A 2WT1A 1D0GA 2Z2SB 3NSTA 3D0JA 1TMF1 3VBSB 5I8YA 3H1WA 1T6GC 1H8TC 2VNGA 2JENA 3URFA 3WP5A 5H9RA 5HCFA 2TNFA 5LK5A 1HRV3 1FNYA 1RUI2 1ASJ1 3VBUB 1PK6A 1DQ6A 5ACA1 2EALA 2EAKA 1DGWX 3LSDA 3GHNA 1YFUA 2B45X 3WQ7A 5FAXA 5LK7B 1IKQA 1QHDA 1PK6C 4OI2A 4QPYA 3D6EA 4IV1A 3DGTA 1LEMA 2OPKA 1PO21 3SH5A 2WA4A 3NW4A 4IV1C 3H8UA 3LGRA 5I0UA 1SQ4A 1S2KA 1VRH1 4GWMA 2VOWA 3VZMA 4WZFA 1YI7A 3ZN4A 1DYPA 2GU9A 2A3XA 3JD71 1Z78A 1SFNA 4PF5A 1REFA 2R1BA 1PK6B 1XNCA 2VGDA 4FOYA 1SACA 3OY8A 1DU3D 4Q0VA 3NKGA 1IQAA 2DF7A 5EJ3A 1NY72 4AFMA 2JE7A 4J1XA 3LA7A 2VY0A 4C0BA 1NE4A 4IV1B 5J7MA 2UYBA 4SLIA 3VHOA 4OHZA 1WBFA 1I5ZA 2PELA 1Q8PA 5I0RA 5AVAA 1AVBA 1C5IA 4MZUA 3MW2A 2HWB1 4P5HA 5FMOS 1DGRA 3WW4A 2PAKA 2OUHA 4H7LA 2BBVA 1G86A 1DQ5A 3OBRA 4XJUA 5F1RA 2R042 1ZZ8A 4XJ9A 4YW2A 3ZSKA 2DCZA 1O3RA 5HCBA 4TLFA 2YHJA 1ASJ3 4KNCA 3RJ2X 1LB2A 1ZZ6A 4YW1A 5LRRA 1ZBE2 2JG8B 4R9DA 5ACA3 1AXZA 3AKTA 1WLCA 1OI6A 2IXIA 1QQP2 2D5FA 4Q1PA 4HKLA 2UWCA 1OQEA 2WL1A 1COV1 2XWJB 1OFSA 4YRDA 3SNMA 5J09A 4PQ9A 1S0BA 1VBE1 1EYBA 1YCIA 2CNAA 2DTWA 3OD0A 4QPIA 3VKFC 4ZKTB 2WT0A 5DZFA 2QCSB 1O5UA 1YO8A 3D8CA 3ENRA 1A78A 4YG3A 2Z79A 4QPIC 4JDNA 2JE9A 3FX3A 4X8PA 4AW7A 1O5LA 1XNBA 2I45A 3TYJA 3IDBB 2GH2A 2HWF1 3JD73 2RM22 3FBYA 3WZ1A 1BJQA 1VBC2 3J9SA 1MVQA 4AEDB 1DQ1A 1N3OA 1DBNA 3WINE 2CV6A 4B7KA 1NA1B 1ZZ9A 2VXRA 1HV1A 4P9XA 2GNMA 4YVSA 4LHNA 1GV9A 4JGYA 4A2UA 4FP3A 3QBQA 4Q4X3 3SHRA 5L7OB 3VBRB 2ZMLA 4XHXA 4YVSC 4OI0A 2XKOA 3O7OA 2R0FA 3N7MA 1CJPA 1FT9A 4JGYC 5K7PA 1ZRDA 4LUKA 2HWB3 1TQ5A 4K40A 3WCRA 2D3SA 2VVFA 3B9CA 1X36A 3WQ0A 1WMFA 3JCIA 5FO7B 2E7TA 5C8CC 1LTEA 5FO8B 1VB2A 3VZOA 2A7AA 3GZTB 5CFCA 3VZNA 1DFQA 2O8OA 3AP9A 5JWPA 4UW6A 4FQZA 3WP3A 2DVFA 1PVC2 1RUI1 5GZCA 5JOWA 3ZSJA 3BODA 5DUVA 4MGZE 4COYA 5CFCC 3AZWA 1VB4A 4I3PA 2DCYA 4FPOB 4HSLA 1GYKA 1AJOA 1JN2P 3AMQA 4ZU4A 5FDBA 4R4ZA 4O9EA 5I91A 4JTOA 2G4IA 2P3KA 5C8CB 5JSOA 1NCRC 2WNUC 3RNSA 2VPVA 1D2QA 1VAMA 1NLRA 4EJRA 3AMHA 5FQ0B 5BNPC 1YXWA 2C1FA 2O8QA 1YHFA 2ERFA 3NAPA 4HT1T 3QACA 5GZDA 4AVAA 2DV9A 2RS33 2DCKA 3WDVA 4QQLA 1G9FA 4M3CF 5K0UB 2HWF3 3LKJA 3MPPG 4E4ZA 4LA2A 5H9SA 1HQNA 1PIV3 3NAPC 4IQPA 2C5DA 2IXKA 4JQRA 1HLCA 2X8KA 1UIKA 5JVVA 3HWJA 4PCRA 1C8M2 4CDUB 1NCRB 5GLUA 2WNUB 4XHBA 1YIPA 2PFWA 1NY71 3TN92 3HMYA 1QJX2 4KU7A 5L36A 2A5ZA 2IXJA 1RUE2 1H2KA 3WR0A 3SCHA 4Y5Z0 5BNPB 2NYYA 1NXMA 2P3IA 1QH6A 3FJSA 3H1YA 4YVWA 4XE9A 4XF4A 1HQLA 1S0GA 3I2DA 1SCRA 1Q5OA 2ZX3A 4FOWA 4DXZA 1QU0A 1U5XA 2R073 4WVVA 2CTVA 4YVWC 1FMD2 3W59A 1UF2C 3FE5A 1KD7A 4IEXA 3NJZA 4PDWA 5KBFA 1LU1A 2R041 2ZGKA 2R063 1XXNA 3BIWE 1CAUA 4LBJA 1LR5A 3I54A 3KM5A 2VH9A 1KFXL 3LWCA 4Y24A 1RGSA 3FLRA 4PDWC 4XFFA 3VHNA 1ZBE1 5AVPA 2NMOA 1H4HA 4BZ4A 1IGOA 4TZDA 1V9U2 1QQP1 1KS5A 1IPKA 2WSVA 4Y1XA 1YI9A 5H9PA 4AEKA 3IBMA 3NV2A 4GH4A 1QJU2 5AC92 3AKPA 5FLHA 1V70A 4YVWB 1N1VA 4I02A 4DY5A 2PA7A 1NCQA 3D5OA 3CU7A 4GH4C 1ENRA 3EBRA 3NO8A 1R092 2VULA 1MR5A 2QFEA 4INDA 4RQPA 5ABJB 2E7QA 3ES4A 1NCQC 5K8SA 2AYHA 4PDWB 2ZGPA 1H9WA 2V5YA 4N9HA 1FPN3 3M7AA 3ATGA 4RQPC 4LR4A 4IL7A 3MGUA 2RM21 3VHRA 1VBC1 5F6LB 4FXKB 1HQWA 2RHPA 3RDIA 3T2TA 4DNYA 3VBHA 4KWJA 4H3WA 3WVJA 4AI8A 2XLFA 1SCSA 4GH4B 3WY6A 3VBHC 3ZYRA 3A4UA 2GMPA 4YYOA 4JCKA 5GLWA 2GC2A 1ZYBA 3JB8A 2A75A 1BEV2 1Y9QA 4PIZA 1V6KA 5KXDA 4GWNA 3FHIB 4I0BA 4ISRA 4WVWA 1PZ7A 4A3XA 2NMNA 2RS12 2BNNA 4P14A 5JR7B 2HWD2 2PHLA 3O0WA 5D8AA 1J1TA 1RHI2 1LENA 4L9BA 4COWA 4IV3A 4FPCA 1LHNA 2OIIA 4ISQA 2Y0OA 4CDXC 1PVC1 5D8AC 2Q5TA 1RUG2 5CG9A 1LGBA 1FAYA 1RMU3 4IV3C 1ZBE3 5KWRA 1C3HA 3Q9OA 3ZXJA 3MZHA 4WM7B 4IESA 4E27A 2ZACA 3TNPB 4NHLA 1PGL2 3PMEA 4OHWA 3PNAA 3RSJA 2EA7A 4QGMA 3HT2A 4FPLA 4Y1UA 2WJSA 5LRSA 1H2NA 3OBTA 4WVZA 3VDDB 3NL1A 1M4WA 2ZX4A 4Q0PA 4CDXB 5D8AB 2ZGTA 4IV3B 3CLPA 4AI2A 5BNNA 2EF6A 4XMAA 2RJLA 2ZGQA 3K51A 5TSWA 5C8WA 4GB33 4BOWA 1MEC2 2ZAAA 1AR62 5BNNC 1H1IA 1VP6A 4LULA 3AZYA 3BALA 2H6CA 1C8M1 1GQGA 1JOJA 2IWGB 2YY1A 3TN91 4QMAA 4BE3A 1LOEA 4AYUA 1QJX1 4FQ4A 1YWKA 3VKNA 1S0EA 1N47A 2WNEA 1RUE1 1PZ9A 4HVQA 2ZGMA 4QX5A 1AR83 3DKWA 3CNAA 4LA3A 1M06G 2GNTA 1NQDA 3L2YA 4XF3A 3AMPA 2IXLA 3M3EA 4XTMA 1FMD1 1UCXA 4A7KA 2GMEA 4RD7A 4ITCA 3VBOA 4DFSA 3J8F3 1Z7S3 2ZMNA 2DVDA 1W6NA 2GSYA 3RYRA 4LBQA 1V00A 3IDEA 1R082 2D44A 2FHRA 2HWE2 2WNVA 1A3KA 2WS91 4LE4A 3S7IA 3AJZA 1SLTA 3VBOC 1PVC3 1QXRA 1S0JA 3DL3A 3H9AA 1DHKB 4BLIA 5E88A 1G8WA 2WC2A 3ZXEA 1POV1 5F9TA 2GC0A 2WNVC 3RG0A 5KC5A 2BYVE 3R0RA 3IWZA 4RR3A 5C4WB 3WNXA 5EYYA 1V9U1 2QVSB 3ACLA 4LO6B 2DTYA 5BNQA 4META 5AC91 1QJU1 1OPOA 2WINB 3R4UA 4U36A 3M3IA 1DGLA 2XJVA 2B5HA 2UY8A 1UU5A 5AFEA 1REDA 3H3UA 4GA9A 1R091 2ZZJA 5EWSA 3U07A 4LT5A 1F5JA 4LHKA 4WVMB 2D93A 3ZFEA 4RHV2 5DZEA 5DDJ3 4BMEA 1VALA 1ZZ7A 4AGGA 3GZUC 4K1ZA 4DZGA 3FUQA 4I01A 2IFRA 3ZFEC 2QDNA 1WCSA 1QOSA 4LBMA 3VV1A 1WW7A 3ZMNA 2YPJA 1RJ8A 5HXVA 1OLQA 5B2GB 5A33A 4UW4A 5CFDB 3ST7A 1QJX3 4M3CE 5JDBA 1ULEA 2YGLA 2FMYA 3USUA 2LTNA 1BEV1 1CAWB 3MIGA 4LTAA 1J3QA 1URXA 1CAXB 4HANA 4F7ZA 4I30A 2VMIA 1RUOA 2BGCA 2XJRA 3UKVA 1AUYA 3PLQA 4ORFA 4BA6A 3TRSB 4TYSA 3B3QE 2ZTNA 2RS11 1IKPA 1WUVA 4IEOA 1O4ZA 4XFBA 1BXHA 1RUJ2 2HWD1 3EJKA 4LO7A 4AFAA 2W39A 1RHI1 3IIAA 2WS93 2RS53 4M3CB 1Q8QA 1NE6A 4FXGB 3HIFA 3SISA 1QY4A 1G9AA 4Q4V2 1RUG1 4GMP3 1POV3 3GF6A 2BW8A 3OJBA 1AX1A 5SV5A 4CEWC 4DY3A 1V6OA 3USSA 1V9U3 5FPZA 1PGL1 1RB8G 4JGZA 4WV8A 1UPIA 5IK7A