1GANA

Complex of toad ovary galectin with n-acetylgalactose
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
134
structure length
134
Chain Sequence
ASAGVAVTNLNLKPGHCVEIKGSIPPDCKGFAVNLGEDASNFLLHFNARFDLHGDVNKIVCNSKEADAWGSEQREGVFPFQQGAEVMVCFEYQTDKIIIKFSSGDQFSFPVRKVLPSIPFLSLEGLQFKSITTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags S-lectin
molecule keywords GALECTIN-1
publication title Soluble beta-galactosyl-binding lectin (galectin) from toad ovary: crystallographic studies of two protein-sugar complexes.
pubmed doi rcsb
total genus 28
structure length 134
sequence length 134
chains with identical sequence B
ec nomenclature
pdb deposition date 1996-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1ganA00
3M3EA 2P2KA 3AX4A 1IKQA 4MYEA 4BLIA 5IT6A 1HQWA 2OW4A 1MS1A 1YI7A 3M3OA 2W68A 4Q1RA 4BQ1A 2C9AA 3FLRA 1V6MA 2DUPA 1WW5A 5KXBA 4XIOA 1LJ7A 1GLHA 3UL2A 1Z0HA 2NYYA 3WV6A 3SLIA 4WZFA 4Y26A 1DQ0A 3V0BA 1C1LA 3AP9A 1HDKA 4XILA 3VKMA 4BLJA 1LOFC 4GKYA 4R9BA 2NM1A 3N35A 3ZPYA 2WQZC 1PZ7A 1KJRA 4XJAA 3VKLA 4PBOA 4BMEA 1DQ5A 2A7AA 1QOTA 1GSLA 1DBNA 2AGSA 1F31A 3AZYA 1HLCA 2AREA 4YW3A 4AGGA 5HCBA 1LGNA 3A0NA 5T50A 3WCRA 1GZ9A 2R0HA 3ZXLA 2E51A 3RMYA 1LODA 2P34A 4TZDA 2R1BA 3OBTA 1AVBA 2ZABA 3LSEA 3LSDA 5JLVA 3AYDA 2GNMA 4YW2A 4DFSA 2SLIA 1S0DA 2W08A 2GNDA 3I4IA 4GWMA 4FQ4A 4PQ9A 1CR7A 3VV1A 3ZXJA 1ENRA 2ZGRA 1A3KA 2ZMNA 2DYCA 2EALA 2UWCA 1G9CA 2PHRA 1DQ6A 2WT0A 1UN1A 3KM5A 4M3CF 4BOWA 4ITCA 4I30A 4R9CA 1RITA 3N36A 1AXKA 4YZ2A 4UW4A 1RIRA 1Z78A 1H9PA 3NV1A 1WW7A 4XXPA 5CNAA 1JBCA 2PELA 1DYPA 1LTEA 5H9RA 1G8WA 1JN2P 1LECA 1QDOA 1W6OA 2DV9A 1QNYA 2VY0A 1C1FA 1SLAA 1LGCA 1Q8SA 1LOCA 1V6JA 5T52A 1CPMA 5E88A 3KQRA 3AP7A 4YGBA 2OUHA 4XJUA 1I1EA 1MACA 3MW4A 4XMAA 3JU9A 2HYKA 4FVVA 2WJSA 3M2MA 4FPOB 4D69A 1BQPA 4PF5A 4CTEA 3A0KA 2D6OX 2VW2A 3V64A 4YGCA 3WZ1A 1JYIA 1UAIA 3TB0A 1C57A 1KJLA 3OGGA 2TEPA 4KBBA 3WDVA 3M1HA 1VIWB 2CY6A 3B3QE 4LBNA 5EYYA 1SLCA 1W6QB 4AYUA 3AYAA 4Y1VA 5DG2A 4YZ5A 1WW6A 1SLBA 4Z8BA 1JHNA 2P3IA 4XTMA 2D6NA 3Q9OA 3AXEA 2WSUA 4LBQA 2DVFA 1MS5A 1UZYA 3AFKA 3UK9A 1GV9A 3POYA 3AYCA 2A6WA 4Q1PA 4C1WA 2JKBA 4FPJA 1F5FA 2DUOA 1LOBA 2R16A 3N7JA 3SH5A 2PHTA 4YZ4A 5DZFA 5FREA 5CBLA 1AX2A 1W6MB 2GALA 3BOPA 2UURA 1N3PA 1KDKA 1V6NA 2VW1A 1NLSA 5T5OA 3WUCA 2A6YA 1SBEA 3D4KA 3L2YA 4XHBA 5H9QA 4NO4A 5HCFA 4YGDA 1IS4A 5EWSA 3WHUA 1CVNA 2D6MA 1I3HA 2YROA 2A6XA 2JECA 5EYXA 2D3PA 1DHKB 3AZVA 2ZMLA 2DU0A 3AP4A 5DUWA 1B09A 3HR9A 5DXDA 2JD4A 1Q8PA 1MVEA 4HL0A 5F9TA 5GZEA 4W65A 1GBGA 1AX1A 1Q8VA 1GYKA 1FV3A 1O4ZA 4FOVA 5JDBA 1GKBA 3O0WA 3H0OA 1MS9A 2A3YA 1WCSA 2DTYA 1DZQA 4GKXA 5IK7A 5SV8A 5JMCA 4FP2A 1LENA 3HMYA 1CQ9A 5GM0A 1OQ1A 3AJZA 4U2AA 4RA0A 1GNZA 3TAYA 2E7QA 5IUQA 3C2UA 1LOAA 4Y20A 5GZGA 4Y1ZA 2WNEA 2ZGNA 3IKWA 4F83A 3INAA 2A6VA 1APNA 4YM2A 3PJQA 3ZXFA 3NV4A 4GALA 2AUYA 1MS4A 5KXDA 1DGLA 1SLIA 2DURA 1S0BA 3D6EA 1OFSA 2ENRA 5CA6A 2G4IA 2ZAAA 2ZGKA 4YZ1A 3B01A 3PVNA 3R05A 2AYHA 4XMIA 1WLWA 4GWNA 4Q8LA 1S0IA 1IKPA 1HKDA 3N7LA 4Y22A 4DRRA 1O4YA 2ZHNA 3ILNA 1MZ5A 2EAKA 1V6KA 4XYXA 4UW3A 4NOTA 4DRVA 4YG0A 3V0AB 1IS3A 5GZCA 1S0FA 1LESA 3WCSA 5T5LA 2DVBA 4FOWA 4YZ3A 1VAMA 1G9FA 3WHTA 4GXLA 1SCRA 1W0PA 3BIWE 4DS0A 2GN7A 4XE9A 1D2SA 2XB6C 4YGEA 1LGBA 3OPZA 1N1SA 2A70A 4FP3A 3ZXKA 3BTAA 2ZA9A 2CYFA 2ZGLA 5IK8A 1UL9A 1GANA 3AZWA 4LBOA 1LEDA 1QMJA 3VKNA 3RMXA 5GLVA 2JE9A 3NV3A 2ARXA 1MS8A 1WLDA 1N3OA 2P3JA 3WVJA 1F9KA 5KXCA 4FPLA 1KITA 1S0JA 2EXKA 2VW0A 3FFZA 1LOEA 2BQPA 1AXYA 4LBQB 4DQAA 2YY1A 4HANA 2XG3A 3JUUA 1ONAA 3N7MA 3DUIA 1V6IA 1YO8A 2ZGUA 4Y1XA 3WOGA 2GNBA 3AP6A 4YLZA 4LBJA 2B7YA 2FMDA 2WT1A 4JC1A 4M00A 1SACA 1WD3A 3ILFA 1UKGA 4XTPA 1Q56A 1W6NA 2D3RA 2GMMA 4ZKTB 5IK5A 1DQ4A 2ZGTA 3SH4A 3POSA 4UW5A 2FHRA 2PHWA 2ZGSA 4AVVA 1IOAA 3OBRA 1YRZA 1W6PA 4XXAA 3AZZA 1RINA 2NMNA 1QDCA 3FUQA 4BM8A 3RQ0A 1IS5A 2RHPA 1FATA 1SFYA 5E8AA 1CPNA 2OVUA 4K20A 3UJQA 4FOQA 1GZWA 1R1ZA 2ARBA 5GLTA 1EPWA 3NWKA 1CIWA 2R0FA 3WG2A 2UWAA 5FRAA 4XBQA 1MVQA 4CZSA 4M3CE 3IMNA 4Y1YA 4P9YA 1ULGA 5GZFA 3MW3A 5H9PA 1AF9A 3U4XA 3VUOA 2LALA 1MS0A 1JOJA 2E53A 4IQPA 1GICA 1SBFA 3B00A 5GLUA 1FNYA 1Y7BA 2A3WA 2DU1A 4FOYA 2YMZA 4JCKA 4Y20B 4AVSA 4YFZA 5L73A 1C4RA 3AK0A 2AR6A 2AENA 5DUXA 2A5ZA 5DZGA 4YW4A 3USUA 3VKFC 4FPCA 4YG6A 2VXRA 2DWRA 3GNEA 4LBLA 1GNHA 1LULA 4AGVA 1V6OA 3ILRA 3IN9A 3N3HA 1KQRA 3LCPA 2VH9A 3V0BB 3O0XA 1YXWA 3BODA 4K1YA 5EXOA 1NXD1 2H0BA 3FUOA 1OKQA 2EXJA 2NN8A 4K21A 5DG1A 1LCLA 1G7YA 1JYCA 3APBA 2LTNA 3AXDA 1TEIA 1PZ9A 2DVGA 1KDMA 2ES3A 3R4UA 3AZXA 4Y22B 4YW1A 3OY8A 5JOYA 1LOFA 2ZKNA 3IM0A 1MZ6A 2Z42A 3B9CA 4UW6A 2GNTA 4P9XA 2W52A 2P3KA 4DPNA 1N1TA 4XIKA 3FBYA 1AJOA 3N7KA 2PHFA 3AJYA 2R1DA 1BKZA 1UPSA 4P14A 2D44A 4YG3A 5CAZA 1S0CA 1AZDA 1G86A 2YZ4A 4XBLA 1D0HA 2D6LX 2CL2A 2DUQA 2ZHLA 1YIFA 1ZM1A 3ZYRA 2D6PA 1H9WA 1VLNA 4AGRA 4YM1A 2ZGMA 4FPYA 2Q5TA 1CJPA 4WVVA 2JJ6A 1ZA4A 5GALA 4YM0A 2CWMA 1N1YA 4K1ZA 2JE7A 1S0GA 3OYWA 1A78A 1ULCA 3I8TA 4ATFA 4Q26A 3RSJA 4ASMB 1AXZA 1LU2A 1XQNA 4ISRA 3FLPA 1IS6A 1MS3A 2CWSA 1W6OB 4Q8KA 2PHXA 2EIGA 1W6MA 3O12A 5GLWA 5LK5A 1PZ8A 1G9DA 2ZHMA 1FX5A 1W6NB 1BXHA 1JW6A 1ULDA 2VU9A 2ZGPA 2GN3A 1FYUA 1ULFA 2A3XA 3B69A 4M3CA 4Y1UA 1WD4A 2R49A 3T1LA 4AWDA 1DIWA 1W6PB 2D3SA 2DVAA 2ZACA 4FPFA 1Q8QA 4U36A 5DUVA 3RRDA 3WDUA 3WDYA 1G9BA 3AP5A 3WDTA 1BYHA 3GALA 3O5SA 1U0AA 1ENQA 1SLTA 2GDFA 2OUJA 2WT2A 3WG3A 1GZWB 5JOZA 2A75A 2GMPA 5JOXA 2V73A 1WBLA 2ZZJA 1Q8OA 2D43A 2VUAA 3A4UA 4XDQA 5DUUA 3UJOA 3ATGA 5GJ6A 3WLUA 3ZXEA 4AVTA 4YM3A 1DQ2A 1FAYA 1URXA 3IPVA 5AVAA 3WDWA 1V00A 2NZ9A 5IK4A 1V6LA 2PHUA 3V65A 1LU1A 5H9SA 5JOWA 3QLQA 1QU0A 2DVDA 4XJ8A 4R9DA 4Y24A 4SLIA 3WNXA 4WV8A 1WLCA 1YYNA 3M3CA 4TYSA 1BZWA 1WW4A 4JRAA 4M01A 1SCSA 2C5DA 2WSVA 5GZDA 1VAVA 1HQLA 3USUB 1QOSA 4GA9A 1X50A 2ZMKA 4XHXA 1LEMA 4LBQD 4FPGA 1ENSA 3DGTA 3MPPG 4Q2FA 4BMBA 3POWA 2I2SA 3R4SA 3WDXA 4RL7A 1SBDA 2P37A 1FNZA 3AYEA 4XJWA 3ZYPA 2NMOA 1GZCA 4H55A 3RS6A 2E7TA 1H30A 4FPKA 5BYNA 2E6VA 1LHOA 3PVEA 3NV2A 1W0OA 4LBMA 2A71A 4PBPA 1FV2A 5E89A 3SISA 3V0AA 3ASIA 3ZSKA 3W58A 3OY8B 1G9AA 3WUDA 1SLLA 2UU8A 2AH2A 4FQZA 1LHVA 1N1VA 1DLLA 5F5QA 4YFWA 1QNWA 3SITA 2A6ZA 5GLZA 3ZSLA 5HCAA 1LHNA 2WKKA 1QKQA 5T5JA 4FPEA 2WLQA 3RG0A 1UX6A 1QF3A 2CTVA 2JDZA 4ZXKA 2ERFA 3ZVXA 2CNAA 1LOGA 1AX0A 2V5YA 4P9WA 2ZHKA 1WBFA 1ULEA 1CESA 3VKOA 1QOOA 2ZBJA 1A8DA 2SBAA 4XOGA 1DQ1A 2NP0A 1N3QA 2YXSA 4R9AA 4XBNA 2KM2A 3T2TA 1DYKA 1CN1A 2DTWA 1BJQA 3OYWB 4WVWA 5JVVA 3SH3A 1AJKA 1KRIA 3O0VA 4ISQA 1J1TA 1WUVA 1QGLA 2ZGOA 1DFQA 4L8QA 1MR5A 4Q27A 1UZZA 1UMZA 2EXIA 5CB7A 3PVOA 3PMEA 3QCWA 2W39A 4YW5A 5T55A 4M3CB 3MW2A 4XJ9A 3ZSJA 3M3QA 5DZEA 3WG4A 2YV8A 4CRQA 1S1AA 3MEPA 3CNAA 4OZXA 1S0EA 1N47A 2EF6A 3ENRA 4C1XA 3FLTA 1JUIA 3HN1A 2GMEA 1LHWA 1VALA 4XJZA 5T54A 5T5PA 3SNMA 1CONA 1W6QA 4PCRA 4ATEA 4BPZA 2UWBA 4XZPA 1LHUA 3W59A 2ZGQA 2D7FA 1JXNA 4LBKA 2D6KA 3IPVB 3WG1A 5KXEA 3ZSMA 4FPHA 3T1MA 3D5OA 2EXHA 3OJBA
chains in the Genus database with same CATH superfamily
1SZBA 1IKQA 5IT6A 1OA2A 1RXFA 4CUBA 4FXGB 4B3NA 4BQ1A 1BEV2 2PLV3 4JX0A 4WBBA 5AFBA 3RZZA 5ABJB 5M0TA 3FLRA 4XETA 4V2VA 2VCMA 1OUSA 1WW5A 1AR93 2XBO1 4XIOA 1TVGA 3MV01 2W2IA 2XWJB 1AHSA 2YG0A 4KWKA 4Y26A 4CDWB 5LA0A 1DDLA 4Q4X1 2JDAA 3UETA 2B5HA 3O1PA 3AP9A 2BGPA 3ETQA 1HDKA 4R8HA 4XILA 3VKMA 1DU3D 3LOBA 2DBIA 4NAOA 3V56A 5FPZA 4DIQA 1ND2A 1AR73 1X8EA 1QJX3 1QOTA 2ZX4A 3U37A 3VBUA 1RVF2 4W4ZA 3AZYA 4UF0B 5I0UA 2AREA 2PLV1 4AQ6A 4JKKA 5JSPA 4AGGA 3WCRA 3A0NA 1CGPA 3ETPA 3ZXLA 2DCTA 1OVPA 1AR91 1LODA 4TZDA 2R1BA 4HXCA 3U75A 1NE4A 2LROA 3HN3A 3RJ2X 4DZGA 1X82A 1AVBA 5A7OA 3VHRA 1KEXA 4LK7A 1EY2A 5BY5A 4DFSA 4QPIA 3KSCA 1H8TB 2W95A 1Q43A 1E5IA 4DXSA 5FTTC 5F3CA 2WUHA 2V4AA 1PIV1 2G1MA 4CU7A 1ENRA 1RTVA 3FFQA 5EHDA 2EALA 2ZEYA 3NAPB 2UWCA 4TSVA 4HPKA 4FFIA 4LOSA 4K7JA 3KM5A 1RUF3 1PK6B 5DN2A 2J42A 2BPA2 4YZ2A 2R042 3OB8A 4MVTA 1GZTA 5F8PA 5BNPC 4P5YA 3NV1A 4HN0A 4DMIA 1EV12 1JBCA 5EFUA 1LECA 1QDOA 1SPPA 1ZBE3 2DV9A 1W90A 4M4RA 4LA3A 3SCGA 4QWNA 3W5MA 1CPMA 1GP5A 5E88A 2VUJA 5LBFA 3Q8BA 3TN92 1JYVA 3AP7A 4A7KA 2RJKA 2BOJA 5ACA1 3PURA 1FOD2 5DAQA 3HBZA 4WVMA 3VBHC 1P8JA 4XFBA 3OUHA 3I3EA 4FPOB 1X8MA 1RUF1 1TNFA 4O9EA 3WW3A 1ND3A 3V64A 3S57A 3NNLA 4TLFA 1WMEA 3ZYJB 5C8CA 1JYIA 3KCCA 1S2EA 3K3NA 5LW9A 1C57A 4KBBA 2IXHA 4I3PA 4CU8A 1REFA 3M1HA 1VIWB 1ZBE1 3AKQA 2NLRA 1YQ2A 2EA7A 4AI8A 4CYDA 4IV3A 1QJY3 2OPKA 4IV1B 3OPWA 4AFDA 2GSYA 1WWYA 3Q9OA 4JDOA 1WCKA 4ZS3A 1UCXA 3VBOA 4S2HA 4P02B 1MS5A 3E6DA 3UKTA 1H4GA 3ZFEA 2IXLA 3NJXA 3UK9A 3CBNA 5AC93 2A6WA 3GCWA 2WWUA 2JKBA 4IGQA 1OLRA 4OYUA 4NRMA 2BBAA 3MIBA 1JZ6A 1W6MB 2GALA 2XGXA 1ST8A 4MHUA 3BU0A 3DXUA 2FMYA 2P17A 1CWPA 5C4WB 5LEKA 3L2YA 1SBEA 1CAXA 1RUI1 3ALQA 4XHBA 1FXZA 1UWWA 3OSDA 4JZRA 1FMD1 5A80A 4EWEA 3HQUA 1CVNA 2YROA 2JG8C 4KWLA 2XHKA 3WW2A 5DDJ3 3IIAA 2RS33 2DU0A 2ZMLA 4XDOA 5DUWA 1B09A 4QHBA 3VGIA 4ZHNA 2JD4A 1AYM1 1F15A 1MVEA 1Q8PA 5AC91 5F9TA 1PO11 2ZS6B 5FYVA 5GZEA 3RZKA 2WZR2 1NT0A 2VBBA 4HKOA 1GYKA 3BI3A 3O7OA 2DCZA 2HWB2 2K46A 1HRV3 1MS9A 2A3YA 5FYBA 3OEBA 5A7QA 1RB8G 4GKXA 3I2KA 5JMCA 3K77A 1CZTA 3HMYA 1CQ9A 5GM0A 3AJZA 4U2AA 5DABA 4RA0A 3TAYA 4CDXB 4CU9A 1KS4A 5F39A 2OA2A 2VQTA 2D5HA 4IEVA 1XNTA 1UO9A 5A3WA 1W8NA 1PGSA 2XONA 4A41A 2DCYA 1CJDA 2WNEA 5FP4A 1JYXA 4F83A 3INAA 4ZS2A 3OPTA 5FPBA 2RS31 4ZU5A 3ZXFA 4CEYB 2R073 3KV9A 1MS4A 1RUG2 4CCJA 1AR62 5KXDA 1DGLA 5J37A 1Z7S1 3POIA 1S0BA 1FPN3 2ENRA 3MIEA 5CA6A 2C4XA 2JB4A 2ZGKA 4IXLA 3B01A 5IAVA 3OBAA 4CUGA 1H2MA 2ADDA 4Q0UA 2YUEA 2VR4A 2JENA 4YNIA 2HYXA 3A22A 1ZX5A 3UESA 1OT5A 1V6KA 3C3VA 3LA2A 4NOTA 1M06G 4YG0A 4QX3A 2IUWA 1IS3A 5GZCA 5BNPA 1LESA 4NIDA 1CAWB 5A7WA 2ZPXA 1ZBA1 2WINB 3T0BA 2VMGA 2R071 4META 5J98B 5EV7A 4AI3A 5I93A 2B9UA 2HWF1 1G9FA 2VNVA 2W94A 4QB1A 4DS0A 4QPGA 2PXJA 4QQ2A 4Z1VA 1COV2 1C8M1 1N1SA 4S2FA 1ZRIA 3MIHA 2PAEA 3GBFA 1OURA 1PNFA 2HWD2 1UL9A 3PL0A 1O6UA 2VVDA 2GAUA 3HPNA 5D8AB 3VBHA 2RR11 4WM7C 3WQ7A 1YEWA 4AEDC 2GH8A 1W8OA 3BTXA 1ZYBA 3ZLIA 3MPBA 4UI9L 2ET1A 2OS2A 4CXWA 5KHKA 2KD7A 3EHKA 3H7YA 1LRHA 2EXKA 4IL7A 2VW0A 3FFZA 1PX3A 2BYVE 4QHZA 5IVEA 4LA2A 2VVFA 4TXWA 4RYDA 1V6IA 1YO8A 3VDDC 2ZGUA 5LEJA 3ZMOA 4P00B 4PLMA 4XUOA 1HJFA 3G6JB 5A3LA 3ILFA 1DGRA 2D3RA 3I3MA 2GMMA 5A32B 2BP6A 1JODA 5K0UB 1BK0A 5LY2A 2X05A 5CFDB 4LK6A 3MF6A 1O7FA 2Y60A 2GP5A 2VZQA 1QDCA 4CEWC 1UU4A 5K7PA 2J1UA 2YFZA 4RQPC 1IS5A 1X9PA 2RHPA 3M3IA 4FFGA 5KHJA 1XRUA 1CPNA 4IETA 4K20A 4PI2A 4AEMA 4FOQA 1VE0A 1GZWA 1R1ZA 4KWUA 5GLTA 4A6OA 1EPWA 1QXPA 4MADA 5FP3A 4D6QA 2BERA 3K4DA 3JBG1 5ANNA 1MVQA 4Y1YA 2FDGA 1ULGA 4DEQA 5FMOS 3IDBB 5ABJC 3O14A 1MS0A 3HWJA 4P9JA 4A7YA 5I0SA 2HEYF 3B00A 5GLUA 1S2KA 2A3WA 4K8FA 4E9KA 4QPYA 3W20A 1HXS1 4Y20B 4CDWC 2J1AA 4L0PA 2XBO2 2BFUS 1KS5A 1TMF3 1SQ4A 3S30A 5IATA 4EJRA 2C24A 1LULA 1V6OA 3N3HA 4Q4X2 2VGDA 3LCPA 4AF9A 1RUE3 3AM2A 1HV1A 1YWKA 4JTNA 1VBE1 2MPFA 2OX0A 3Q8FA 3RVHA 3H1MA 5DMYA 3O0XA 1PHMA 3IDCB 3NO8A 1NXD1 3HBKA 4DXZA 2EXJA 4A6SA 3PMSA 2OPWA 1VRH1 1LCLA 1G7YA 4LITA 1JYCA 1ND2B 2LTNA 3PUIA 4KH9A 2PLV2 4XABA 1EUUA 2DVGA 4MXWB 3I3QA 5LASA 1GOHA 3VHPA 1GWLA 4YW1A 1W0NA 5FZ8A 2XWBB 1LOFA 1AR92 1F4AA 4UW6A 1H8TC 2WZPP 2FDIA 1NZIA 4XEZA 4BHPA 2P4EA 1AJOA 5DAPA 4RS5B 5FWEA 3NNGA 3N7KA 3C7GA 3BPZA 1RMU3 2OZ6A 4JV4A 3NAPC 1ZRDA 1UPSA 5CAZA 3RZJA 1CIYA 4XBLA 3VZKA 1PVC3 2DUQA 1ZZBA 3USSA 3ZYRA 1VLNA 4OHZA 2ZX3A 4YM1A 5A7NA 2BUKA 1XSRA 1POV3 5C70A 4BH9A 2HWC3 5GALA 3ZN4A 5J96B 3SHRA 4HPKB 3AB0A 1N1YA 2JE7A 1S0GA 3VLBB 2BGOA 3FL7A 3T2QA 2BVVA 3KS7A 4NRPA 4D7SA 1A78A 2VPVA 2B8MA 4AEDA 4ATFA 4Q26A 4ASMB 1QJEA 1AXZA 3DYOA 1XQNA 4ISRA 3FLPA 1POV0 1IS6A 3ZN6A 1RMU1 1JZ8A 2CWSA 4HOOA 1HB3A 1PMIA 2P6CA 4Y5Z0 1U5XA 4OQ9A 1ZRCA 2EIGA 2YBPA 5GLWA 2QQUA 1OD3A 1PZ8A 4R4ZA 5A6ZA 1NLQA 2VU9A 1ULDA 1UQXA 1XXNA 3B69A 4M3CA 1FYUA 3VDDA 4AAXA 2R49A 1RUF2 4LIVA 3LEGA 1RUNA 2D3SA 2ZACA 1NUKA 1ZZCA 3WDYA 3WDUA 4COYA 2VOWA 3AP5A 2ORZA 3O5SA 3GALA 1NCQA 3NNMA 3OUIA 5C8CB 1ZBE2 5FP9A 4A2UA 4F7ZA 2A75A 1XYPA 5HXMA 3GDBA 2EIEA 1RC6A 4RQPA 5GJ6A 3U4SA 5FY9A 5A6QA 3HEIA 3IPVA 4UFIA 5AVAA 2NZ9A 3GZUC 1V6LA 2ILMA 4CCOA 3N9PA 1ZRRA 3D3AA 3KCYA 1U5IA 3ZFEB 3DKQA 1RL3A 3NMBA 1W05A 1WW4A 4JRAA 4PT6A 4ASKA 3BTZA 3H9AA 3ELNA 5ABJA 1UPIA 5GZDA 4ES9A 1GP4A 4NRQA 1QOSA 4PHZA 3USUB 5C9AC 2BVBA 3FZ3A 3U10A 1G6NA 4ES8A 2G9GA 1QHDA 1RUI2 4CDWA 1ENSA 1FMD2 2C9KA 1HV0A 2JICA 3MPPG 4Q2FA 4BMBA 1PVXA 1JZ4A 1CAXB 4XVHA 3WDXA 4OUEA 2X8KA 2P1BA 3HNYM 4RL7A 1H8VA 1QQP3 3RGBA 4JVAA 5CYYA 3Q8CA 4H55A 2X53S 2QDNA 5AC92 1PO12 3PVEA 3NV2A 1OF4A 1W0OA 2EIBA 3S0MA 1BBT3 4UF0A 2VOXA 5E89A 3ASIA 3SISA 3V0AA 1LAJA 3W58A 5F2SA 1G9AA 1OFNA 1OA3A 1SLLA 1SFPA 3CLPA 2UU8A 2AH2A 4FQZA 3SKVA 4URTA 4LLOA 4OI1A 4QKNA 2AEYA 1YNAA 5K4LA 4OI4A 5J36A 3O1UA 4DUWA 4JHTA 5IFTA 5I8SA 2WKKA 5FY5A 5DDJ2 1H8TA 2AC1A 2RS32 4IW3A 1UX6A 1QF3A 5KXCA 2VUDA 1Y3TA 1O91A 3TRSB 3ZIXA 5FZ1A 3IT8A 3ZYIB 4AVBA 2VNGA 1WKYA 1W2UA 3NAPA 2VZ1A 4MOAA 4XFAA 1YUDA 1XOYA 1A8DA 1PK6A 2YXSA 4XBNA 4PQQA 3H1WA 3T2TA 2IXKA 3OYWB 1VBC3 1BJQA 2BNOA 2VQAA 4LE3A 4WVWA 4CUCA 3PU3A 1AJKA 1XNDA 3O0VA 3VD5A 4KU8A 4G4FA 4BK4A 2XJUA 1R083 1WUVA 2ZXQA 3OOXA 3GHMA 1YFYA 3ES4A 4L8QA 4MGIE 3FE5A 1UMZA 4UOJA 2EXIA 4Q4W3 3SEPA 2ORXA 2R072 2JE8A 3LA7A 1UW8A 2HWF2 3ACLA 4YW5A 3TN91 5HV4A 4Q4V3 4C91A 2L9LA 3O1OA 3M3QA 1F8VA 2CU5A 2JDNA 3WG4A 5A1AA 1S1AA 3MEPA 4C0HA 3ZDVA 1S0EA 1NAEA 2EF6A 3AMPA 3ENRA 4MSVA 2DCJA 1PX4A 2MEV3 4B1LA 3HN1A 3TEZA 3WNKA 1KXGA 4OHYA 1XPWA 5T54A 3VBHB 4XZPA 4AFBA 1DGRN 2RS53 3PHMA 5FZGA 3WNPA 2Q0AA 2HLEA 1JXNA 2D6KA 3WG1A 4EE2A 3BIEA 1DG6A 4FPHA 3EMRA 3D5OA 1C3HA 2P2KA 3LQCA 1E5HA 2QVSB 1UYZA 5K0UC 3M3OA 2W68A 4Q1RA 4B4QA 5FY8A 3IAQA 4GJZA 4EN8B 2VOVA 4LR4A 1V6MA 4QT6A 3I2OA 4NAMA 4UFJA 5C4WA 1LJ7A 1Z0HA 3SLIA 3WF1A 3IMMA 5FQ0A 5C9AA 2ATFA 1GFF2 3V0BA 3KB5A 4BLJA 4NIIA 3DKWA 1HB4A 2ARAA 3MI8A 5LY1A 4AI9A 4JDMA 4HKLA 4XJAA 4D0QA 2QJVA 3KQ4B 1GSLA 2C26A 1GOGA 1W8TA 3WW4A 4KU7A 5HCBA 1LGNA 2WZR1 4BWOA 3JB4C 2JG8B 2XJRA 1GZ9A 1R1A3 1ZVFA 2R0HA 1H1MA 4WVZA 1W8HA 4Q0PA 3MIGA 4I0BA 3RMYA 2VXJA 4TWTA 4H7MA 4CDXA 1HXS2 1UMHA 3CKHA 3LSEA 3LSDA 1W9YA 5FPLA 5JLVA 1R093 3AYDA 4TLGA 4JGYB 1IPKA 1YQ8A 4B4PA 5LK7B 2W08A 5FBJA 4CCNA 3I4IA 2PAMA 4NMIA 1RJ7A 4PQ9A 3ZXJA 1QIQA 1VBE2 1RHI1 1ZZ6A 4M0HA 1UN1A 2ZZQA 4NHYA 4BOWA 2IVIB 1AR61 3ECQA 4QQLA 3T09A 2OXBA 4ITCA 4BDVB 4LXLA 4AOCA 1EP0A 2DF7A 3ZKUA 4IE6A 1HB1A 2F4LA 4UW4A 4LEJA 3WNMA 4MH0E 5CNAA 1DYPA 4OMDA 5FP7A 5H9RA 2MNGA 1W6OA 4RS5C 4AK3A 1C1FA 1SLAA 1AYN3 1LGCA 1Q8SA 4NPRA 1YQ6A 2R30A 4EQVA 1TMF2 4AHYA 5IAXA 1CAWA 3EJKA 2ZKLA 3K4AA 1PO23 3J4UH 4YGBA 2D40A 4QM8A 2VM9A 1UXZA 3KMHA 1UKRA 3T30A 1OOPB 4D69A 1BQPA 2QQJA 2QNKA 1J1LA 2LRPA 1UY1A 4PF5A 2D6OX 3EB7A 4NIGA 3KVBA 4DXRA 3P3PA 4YGCA 4DINB 4LHNA 3GGLA 5D8AA 1K3IA 1KJLA 1AR83 1GP6A 2EVXA 3B3QE 1UZVA 4KQ7A 5EYYA 1M4WA 1SLCA 1VMHA 1UYYA 1W6QB 4RR3C 3N9NA 1AYN1 4YZ5A 1NYWA 3DPRC 4IEOA 1SLBA 5EPAA 3UGFA 4QXBA 1J3QA 2V09A 1XNKA 2P3IA 4M4PA 4XTMA 4UBHA 2XVLA 4Y5SA 2XUEA 4LTAA 4WM7B 1YFWA 1F5JA 1RMU2 2VZRA 1UZYA 2VOTA 3AFKA 5G04L 1GV9A 2VZ3A 3AYCA 4Q1PA 4I01A 4N53C 1U5ZA 1PVC2 3JB8A 3SH5A 1LOBA 2R16A 3LWCA 2PHTA 4QX8A 5CBLA 2O8QA 4OUMA 1A6CA 2UURA 3VD7A 1W8ZA 2RM23 1V6NA 1AR81 1UY3A 4GB33 2VAUA 5K0UA 2HWC2 2VW1A 3VDDB 3I2GA 4Z2WA 4HSJA 3HNBM 5HCFA 4NO4A 4BE3A 1IS4A 2WA4A 3HD8B 3POGA 2D6MA 1I3HA 4IGPA 1WA4A 2JECA 3I2IA 1DHKB 3EXUA 5BNQA 2D5FA 1WLTA 4HL0A 3D8CA 3LFMA 4DY5A 1AX1A 2JG9C 4CEWB 1FV3A 2PHDA 4XQDA 3NRUA 5JDBA 1GKBA 2R063 1VBD3 3O0WA 4RQPB 3S7EA 3H0OA 2WFF1 3RZHA 5JUVA 4AHZA 4FTBA 5JXGA 5HBAA 2W5FA 2WZEA 4GB31 1LENA 4W6XA 3WP4A 2CGOA 4UWDA 1GNZA 1IG0A 1UZ0A 3A23A 5IUQA 4Y20A 4MGYE 2ZGNA 2RS13 1QH6A 1O8PA 4OCTA 2WQ8A 1UOBA 4Y5TA 2I45A 1F35A 2AUYA 1HW5A 1SLIA 1F2NA 3D6EA 1W9FA 5B4NA 4E4ZA 2G4IA 5FV3A 3UV9A 4YZ1A 3AL5A 1NKGA 3PVNA 5F7UA 4XMIA 5FXVA 4NROA 1S0IA 4A42A 1IKPA 5EJ1B 2YB7A 4E4HA 4MXWA 4P9GA 1L7RA 2RS11 4PI0A 3V0AB 1MEC3 4HT1T 4PDWB 5LRRA 2CGNA 1BVP1 3WCSA 2W1UA 4PLNA 2RDSA 5F3IA 5CKNA 1VAMA 4QQHA 4RS5A 4EN9B 5KHHA 1Y9GA 4QGLA 1W0PA 4FAGA 4OI0A 4HG6B 1LGBA 1YIPA 4DB5A 2A70A 5C5UA 4TN7A 3BTAA 2ZA9A 1WCUA 1JUHA 1UY4A 4CE8A 4XC9A 1JOPA 4QU2A 1QMJA 3PU8A 3VKNA 1TZOA 2W1SA 1AR71 2JE9A 4FAHA 2E33A 3NV3A 1QJX1 1RUD3 2PN5A 3ACGA 4IEXA 1UD1A 3IWZA 2GU9A 1ULPA 3WVJA 5I8TA 1MEC1 4FPLA 5HXVA 3UGHA 1S0JA 3SMHA 2JDHA 3I3BA 2BQPA 4QX7A 1H2NA 4JDNA 4LBQB 4O7XA 4DQAA 2LM3A 4E4DX 3S5QA 4RR3A 1A34A 2JDUA 4KNCA 2OYZA 4QDSA 1V0AA 3WOGA 5KHIA 3AP6A 4UT5A 2B7YA 2Q1ZB 4IERA 3LD8A 3WT3A 4M00A 4IGOA 2Q8CA 1WD3A 3H3UA 4NWVA 3LFIA 4XCBA 1UKGA 4LO8A 1Q56A 4XF9A 3ZR6A 3H8UA 4ZKTB 1DQ4A 2ZGTA 3NL1A 3POSA 4BZ4A 4P9IA 2B42B 1HX6A 2FHRA 4RSUA 4AVVA 3T4HB 5ANQA 3OBRA 4CXXA 4CU6A 1RINA 2Z4FA 1H2KA 3FUQA 1VBC2 5FZOA 1GU3A 4I02A 5FPXA 3AVRA 1SFYA 4FTEA 3SEEA 4FO9A 4OHVA 2OVUA 5JMOA 3UJQA 1R082 2QQKA 2ARBA 1ZNPA 4QDRA 3U0ZA 5FRAA 3QH6A 2JXAA 3ES1A 3CZUA 1MZFA 4M3CE 4P9YA 5F32A 5FK7A 3MLKA 5GZFA 4AI2A 2LALA 5FLHA 1ULOA 3THDA 1JOJA 2F6BA 1ALYA 5CZKA 4AI1A 2F4PA 4QGNA 1ZZ8A 5DAWA 4JCKA 4QU1A 4AQSA 4P9LA 3VL9A 4YFZA 1C4RA 2WRAA 2EICA 2WYSA 4HVRA 3USUA 3W21A 2RVAA 4KL1A 4BA6A 2VXRA 2DWRA 4LBLA 4BQ2A 3HOBA 2QKDA 2RS52 4NR1A 3IN9A 3H7JA 4EWAA 4Y3OA 1W06A 1UNBA 2BW8A 3ZXGA 5FQ0B 5C9AB 1OKOA 1QJY1 2VOKA 4QB6A 2BBVA 2VQ0A 5J09A 3V0BB 1SHWB 4QX0A 4XPVA 1LR5A 4FBFA 1XB9A 3FUOA 4HBNA 1YFUA 3AMMA 1UYPA 3AXDA 2VZVA 1XE8A 3ZOIA 4LT5A 2QUOA 5JXHA 3MYXA 1EAH3 4Z82A 1K5MC 1QH7A 1YHFA 3TNQA 2J1RA 2VTFA 5FO7B 4IDZA 2RDRA 3KF5A 5JOYA 3B9CA 4JGYC 3KV5A 4KMQA 2IWGB 3ZMNA 1N1TA 3OD4A 3U14A 3K4ZA 3FBYA 1GMMA 3Q8AA 3AJYA 2P3YA 2QE3A 1BKZA 5CADA 4YG3A 4P14A 5BUVA 2WO2A 4JQTA 1D0HA 4S2DA 3RJRA 2CL2A 4O65A 5T3NA 5DDJ1 3VN4A 4X8NA 1ZM1A 3JZVA 4OZOA 4QQPA 3O1RA 1RHI2 2CAUA 2BWAA 4NPLA 1LB2A 4WVVA 2JJ6A 4YM0A 1BCXA 2CWMA 4K1ZA 3VZOA 3VHOA 3K3OA 1HRV1 1XU2A 5FYZA 1C28A 3OYWA 2XLFA 1QEXA 2H6BA 2Y34A 1LU2A 3TEWA 1RUOA 1R092 4CPBA 5DQ0A 4UFMA 1W6OB 4QX2A 1OOPC 3WW1A 2PHXA 2ZCWA 1WCQA 3DV8A 3O12A 1US2A 2VULA 3GYDA 1G9DA 2ZJCA 2ZHMA 4EROA 5FYTA 2RDQA 4CCDA 3DL3A 4Y1UA 3C7FA 4L99A 3NW4A 1RUH3 4X8PA 3TEXA 3ZFGB 5J7MA 1DIWA 1FPN1 1W6PB 3CQOA 4FPFA 3UGGA 1G9BA 4OQ8A 4IUGA 2JDYA 4EZHA 2JWPA 3H1YA 4Q29A 3WQBA 3ZKYA 4DXTA 4E2QA 1VBB3 1BVVA 2PHLA 2WNOA 2WA3A 5IHRA 4JHZA 4ZZ8A 1AYN2 4UFHA 2VC9A 5FLIA 4DEVA 2D43A 2VUAA 4W6WA 3ATGA 1PO22 3WLUA 4AVTA 1IQDC 1FAYA 3GHNA 1V00A 2AEZA 1HJGA 3D0SA 1BK1A 2PHUA 1GWKA 1LU1A 3V65A 3GBWA 4R9DA 5FZAA 5DAXA 1OPOA 4QHOA 1YYNA 3KLSA 1BZWA 1K12A 4H7LA 4A3XA 2C5DA 2WSVA 4NUBA 1VAVA 3OF1A 1HQLA 4YW7A 4AHWA 1AR82 4BYYA 4IE0A 5JZGC 2Y6KA 4K6BA 1LEMA 5FZDA 1VBA3 3LDBA 4FPGA 4V1PA 4PF1A 2ID4A 3J8F3 3POWA 1Y9MA 1ZZ7A 4ARYA 3E97A 2Y0IA 3ZO0B 5HV0A 3QACA 4MZUA 2WR9A 3VBRB 1CZVA 3AYEA 1DZTA 2NMOA 1GZCA 4GQ7A 2Q8EA 4FPKA 5L19A 1STMA 1LHOA 1WGPA 2A1XA 3MICA 3POBA 4Y4RA 2WABA 1AUYA 2J1TA 4YVSC 5FPAA 4D7TA 1W8FA 4PBPA 1PMHX 5LA2A 2WFF2 3ZSKA 5A3NA 3Q8EA 2JG8A 3WUDA 1S2BA 3IAPA 4GB32 3RFRA 1LHVA 3MFCA 2Y6JA 5L9BA 1DLLA 4QXKA 3ZYFA 1K42A 4BQ3A 3OTFA 2RE9A 3SITA 5CU1A 5F3GA 3PIGA 5J3UA 5FJKA 4D7YA 1LHNA 4IEWA 3AKPA 4WZCA 2PA7A 1PGL2 2RG4A 1QKQA 4JGYA 3RG0A 4RGAA 2UYBA 3G7DA 2CTVA 4DY3A 4J1XA 2ERFA 1CAVB 4KGGA 3M4FA 4BK5A 4P9WA 4QX1A 3SC7X 1EYBA 5FJHA 1CESA 3ZYHA 1SDWA 5A3OA 2R062 1VBD2 3HNMA 3VBFC 4AXOA 4DO0A 1W99A 2YC0A 2ZBJA 2HBUA 2SBAA 1NOVA 2W1QA 2VJXA 4LPLA 5FO9B 4UFLA 1N3QA 4R9AA 4OUSA 2KM2A 1JZ7A 3K2OA 4OULA 4PDWC 1OPMA 5F6KA 1XNCA 1QXJA 5APAA 1KRIA 1XU1A 1NA1C 3WP6A 1RUJ3 1WMDA 4ISQA 2VMHA 2RS12 4ORFA 4E2SA 3O1VA 2ZGOA 1DFQA 2XKOA 1QJU3 2BNNA 2XJVA 4PJYA 5FUNA 1NQJA 3CJIB 3QCWA 3ZPOA 4GMP0 1GQHA 1X33A 1TMF1 2B9VA 2UYAA 2W39A 1RGSA 2VG9A 4IEZA 4NVPA 1Y4WA 3ZIWA 5CISA 2ZX0A 3BU7A 3PUHA 3MW2A 4XJ9A 1UXXX 1OOPA 3SCHA 1RUE1 3ZSJA 1V9U3 1OH3A 4HVOA 1NY71 2AACA 4M0NA 4C1XA 3OG2A 1X9TA 2G19A 1AR72 4NIAA 3GBGA 1I5ZA 2ZEZA 4MX3A 4NHKA 1QJX2 4INDA 1T6BX 4URAA 5BNNC 5T5PA 2FDHA 4BPZA 1W6QA 5BNOC 2UWBA 4ZU4A 2XJTA 1MEC2 5E6HA 2TUNA 4GULA 3W59A 4CUAA 5FO8B 2WZ8A 5FMDA 1HRI3 5FAXA 1GNYA 5KXEA 3ZSMA 3T1MA 4WM7A 4NN0A 2HEVF 4HK9A 4RR3B 2OW4A 3DPRB 2I74A 1MS1A 2GH2A 3M8LA 2C9AA 2LS6A 5JSOA 4HVQA 5G05L 2YYOA 1PVC1 1RUD2 3JQWA 3ORJA 4CA9A 3SQOA 1GLHA 4QX5A 3UL2A 2YHJA 4R4XA 1POV1 3K75B 4N53B 3WSOA 3NNFA 2HWC1 1NG0A 3H3ZA 5K8SA 4A4AA 2R6QA 2GC1A 5FZOB 4MGSA 1OLME 2XXZA 2NM1A 5IWFA 2XJSA 4QMAA 1PZ7A 1DQ5A 1TNRA 2A7AA 1DBNA 3S7IA 4CEWA 2Y26A 5ISLA 1F31A 1HLCA 1PMJX 1VPHA 5C3PA 1YLLA 5JWPA 1WMFA 1YCIA 5FPVA 3FMGA 3KV4A 2Q1MA 4LO5B 3QH7A 4YVSA 3RZLA 3OBTA 2VMEA 3MF9A 2JG9B 5JCTA 3HT1A 3THTA 1S0DA 3OGVA 1IPJA 4GD4A 5FKCA 4ZPIA 2VO5A 4COWA 1RUC3 1BEV3 2HKXA 1SG3A 4GWMA 4KBZA 4COVA 1RXGA 4F8AA 1CR7A 4GWJA 3OGJA 4PIYA 2ZGRA 2ZMNA 2DYCA 3CZJA 1QJY2 3PDQA 1G9CA 4G9SB 1DQ6A 2HWE3 5FZ3A 2CDPA 5J1XA 2P6HA 5FZ9A 2WNUC 2IVJA 4N9HA 5BV6A 2ARCA 4K8RB 1Z78A 1H9PA 4B8EA 2XHNA 3VBFA 1LTEA 3IIIA 1G8WA 1C8NA 1JN2P 2VY0A 5D21A 3NJVA 1E57A 5LZ6A 5T52A 1YQCA 1RVF3 3VDBA 4PDWA 5IVBA 3FJSA 3B93A 4HFSA 2GC3A 5HI0A 1NA1A 2OUHA 3THPA 4I09A 1MACA 1NQDA 3MW4A 5EQUA 3ZXAC 4J1WA 4XMAA 3MGUA 2BDRA 2HYKA 2VMIA 3JU9A 3KT4A 3MHZA 4B7EA 1K45A 4CTEA 3LZZA 5JSRA 3A0KA 4CP1A 1QQP1 1UAIA 1W39A 4ZXEA 3NKTA 3TB0A 2Y8KA 5JR2A 2TEPA 3WX5A 5I91A 4AAPA 4AYUA 4LBNA 4QGMA 4RD7A 4XQ4A 3AYAA 4CCMA 4Y1VA 1BBT1 1HRV2 1JHNA 4QKDA 5A70A 2MHFA 1JU4A 2VUCA 3AXEA 1MZEA 4LBQA 5E16A 5BNNA 5BNOA 1DCSA 5IVFA 2R043 4HZFA 3POYA 2ZEXA 5F3EA 2YBSA 2XDVA 4C1WA 1EV13 3JD73 3RDIA 2ETEA 3ABZA 2E32A 2JB8A 3I7DA 5FY0A 5LA9A 3N7JA 2DUOA 2PYTA 3ZFGC 3VZNA 4YRDA 2XH6A 4MGKE 1AX2A 4UXAA 5FYUA 3T0DA 2JD9A 1N3PA 4Q0VA 1W9SA 1O3SA 1GQPA 2DDUA 2VMFA 3PIJA 1NLSA 2IFWA 2BU9A 1FPN2 4JKLA 2Y38A 2A6YA 1FOD3 3LPGA 2X10A 1IG3A 4CPBD 3E5UA 2VZTA 4XAEA 5H9QA 5A6XA 4BQWA 3EQEA 1NCRC 3LEMA 2N7GA 5KWRA 1QY4A 2JDPA 3UKVA 3WP5A 2D3PA 2QCSB 1VBC1 5DXDA 3HR9A 4AI0A 5IFPA 1HQNA 3BOWA 2Y6HA 1R081 1GBGA 3ACFA 4W65A 1Q8VA 3TWIA 2QQLA 1O4ZA 2IZWA 4FOVA 5FLJA 4FTSA 1DF0A 4Q4W1 4CDUC 1NXMA 2DTYA 4XFIA 3OGRA 2OQ7A 5SV8A 3VHNA 1J83A 4FP2A 4BQYA 5IK7A 1J58A 2XKPA 1OQ1A 4Q4V1 3VD4A 3P6BA 2E7QA 4XUNA 1IHMA 4YWAA 3IKWA 1CZSA 4COUA 5F5IA 2A6VA 3B7MA 4WM8B 2MEV1 2XJQA 1D4M3 1US3A 3VBRC 2WO3A 2WN3A 1YJKA 3HAGA 3NV4A 4AEKA 3FWEA 3LB9A 2NQYA 1UOGA 3I3DA 2BZDA 4XF3A 2DURA 1O3RA 1O4TA 1OFSA 2RS51 4RFT0 3KWVA 2YPDA 3H42B 4QXHA 4ZZ5A 2AYHA 4I3GA 1WLWA 1XBFA 4Q8LA 2WN2A 3FHIB 3MFAA 2VBPA 4BXFA 3N7LA 1DYOA 4V2WA 1OLQA 3CDZB 4DRRA 4CP2A 1O4YA 2ZHNA 3ILNA 1MZ5A 4XYXA 5FZ4A 3WF0A 5CFCB 2VMDA 4NHMA 2FQPA 4XDPA 5D2AA 5E1RA 2HWB3 1D4M1 4NIHA 5C8WA 1E5SA 2X5IB 3RYRA 4FOWA 2XVKA 3I2FA 5FXXA 3NNJA 3WHTA 1SCRA 2J1VA 3BIWE 4N43C 4XE9A 5F5CA 1K5MB 4YGEA 1X36A 2XB6C 5FZ0A 2O0OA 4FP3A 1VRBA 1UF2C 2QQWA 4CDQC 5FPUA 3LEKA 2R7EB 5FZLA 1GANA 1LEDA 3F2ZA 5GLVA 4BXSV 1JZ2A 2ZTNA 4Q5OA 1T6GC 4MO3M 4I0AA 4UBGA 3VBSB 1X7NA 4GZ9A 1F9KA 4N7IA 4BIFA 1XE0A 1R1A1 3NJYA 4Y4YA 3CJIC 2E31A 3PUSA 1JTZX 2YY1A 2AZ5A 2XG3A 4HANA 3JUUA 3N7MA 5FZ7A 1BMV1 4E27A 4K3UA 3MIFA 4Y1XA 3E6CC 4W6YA 2GNBA 5FZEA 3H8RA 1R091 2FCTA 1W03A 3I59B 4OI2A 5LRSA 4JC1A 4UAPA 2CSGA 3ROUA 1RYYA 5IYYA 4XFCA 3H50A 3SH4A 4IEUA 4BISA 4X6QB 1RUE2 1W8UA 2PHWA 2ZGSA 3CF6E 2QQVA 2WQ4A 5FYHA 2E63A 3VZJA 4KGQA 1IOAA 4LNVA 3ZFGA 1NY72 1W6PA 4A7ZA 4XXAA 1UY0A 1UY2A 4G3YC 3MUZ1 1H4HA 4EN6B 1COV3 3AFGA 2YDEA 4BM8A 3RQ0A 5F37A 3UNPA 3KGLA 1GWMA 5E8AA 4MGTA 4OHXA 3J26N 2HWD3 3A7QA 4ARXA 2YPJA 3NWKA 2R0FA 1JI6A 3JQXA 2UWAA 1QJU2 3HJRA 1NCRA 4CP9B 4CZSA 2Y6LA 3IMNA 5LBBA 5JI7A 4CCCA 3MW3A 3U4XA 1AF9A 4QPIC 1OH4A 1PO21 3N4MA 1A8MA 2RJ2A 1GICA 4ZONA 5TSWA 5FYIA 2WWSA 1FNYA 4EYUA 2ZAHA 2IFRA 2VD7A 4IESA 5CKQA 3KHCA 2Z5WA 4JKMA 4AVSA 1VMJA 1OLMA 4IEPA 4OHWA 2AENA 5DUXA 5C33A 4YW4A 4QAWA 3VKFC 4I0WB 4D6SA 1KFUL 3GNEA 1T2XA 3O1SA 3AMNA 4MUVA 4EN0A 4LHLA 4RHV3 4AHXA 3IB3A 3ILRA 2D98A 4HLTA 1XJAA 1JS9A 3WINE 4LJHA 1VB2A 3VBRA 5JZGB 1YXWA 3PVBB 4K1YA 5EXOA 5FY4A 2H0BA 1OKQA 1REEA 1XYNA 3VDCA 4J25A 3APBA 4LOTA 1ASJ3 1TEIA 5DAVA 4FSJA 4UFKA 4Y22B 3RWKX 5CKMA 1B35C 4Y33A 2B4KA 3IM0A 2Z42A 4LO4B 2GNTA 1YFXA 1JU3A 1H2LA 4N8MA 3RI8A 2PQSA 2W52A 2RM21 4P9XA 3UKNA 1D0GA 4YVSB 4RHV1 4L97A 4DPNA 3S5AA 2CV6A 2BGCA 5A33B 1EUTA 2R1DA 1XNBA 3IZOA 2YU2A 2D44A 1OQDA 5IJRA 1AZDA 5KC5A 1H6YA 2YZ4A 4IV3C 1PGL1 1YJLA 1CAVA 2D6LX 3HVDA 1VMFA 5C3QA 2D93A 2W3JA 2XMLA 2XBO3 2FZ1A 4N43A 2D6PA 1H9WA 1W9WA 3CIHA 3VBOC 4AGRA 4COZA 1ASJ1 3RYKA 4LLFA 4YYOA 4FPYA 2Q5TA 1CJPA 4XURA 4Q4X3 1UOFA 4P08A 3ZYBA 2R061 1VBD1 3W9AA 1YQ5A 1U12A 4NHXA 2Y0OA 4XQWA 3AMQA 2Y6GA 1ULCA 3U11A 3VD3A 4BB3A 3RSJA 1MQTC 2CDOA 4NE9A 3PNAA 3P1IA 3VBFB 3WXPA 1MS3A 4RGGA 5IW0A 1RUC2 4Q8KA 3CJIA 5FMCA 2JX9A 2O14A 5LK5A 2WL1A 2Y6FA 4IEQA 1FX5A 1W6NB 1NA1B 2HEWF 2ZGPA 2GN3A 1ULFA 2HWE2 4H2AA 1XC6A 1WD4A 4J6GA 3EYPA 3MO4A 1CD3G 1NX9A 4AWDA 2JDMA 1W3VA 3IDEA 1O5UA 2DVAA 1QQP2 3RRDA 1Q8QA 3ZXDA 3BGAA 5F5AA 4PLOA 3MLLA 4XF4A 1PIV3 3BVCA 1SLTA 4KG0A 1XE7A 2GDFA 5JOZA 1BBT2 3E6BA 3MLJA 4AE2A 1O3QA 3AKSA 5DUUA 2D97A 3PTRB 1W2TA 4YM3A 3O1TA 1KD7A 1DQ2A 4XUTA 1URXA 2X29A 5CIRA 4DNYA 5FOJB 4KG8A 4Q4Y3 2K2SA 3LDRA 3QLQA 4AVCA 2DVDA 5BNNB 5CEHA 1JHJA 3MBWA 5BNOB 2H0VA 3DYMA 3CU7A 4SLIA 4Y24A 3WNXA 1CX1A 3DPRA 1WLCA 4TYSA 5C3OA 3M70A 2FZ2A 5A3MA 4M01A 4D3WA 3KD4A 2VZUA 4BU2A 3ME2A 1LKNA 2JKXA 3WNNA 2WYFA 4TTGA 3WQ1A 4GA9A 1X50A 3ZX7A 1UIJA 3J7MA 5ACA3 4Q0QA 4LBQD 4HETA 3HQRA 4HN1A 1RUD1 4N53A 1H1IA 3R4SA 1FT9A 5C3SA 4N7UA 1PNGA 2P37A 2Z2SB 1FNZA 4XJWA 4Q4Y1 3ZYPA 4LO6B 5BYNA 4F3JA 2VNOA 3GF6A 3JD72 1HB2A 4Q0SA 1K5JA 1AL0G 4LBMA 5KR7A 1SDDB 2A71A 2QQMA 4AZZA 3OCPA 5CVRA 1FV2A 5FOBB 4Q4W2 5FZ6A 2WWJA 4QPGC 3OY8B 4JRLA 3LIGA 2RMU3 4L92A 4HMZA 4Q4V2 4WM8C 4GH4B 4FT8A 5F5QA 4YFWA 2JG9A 3OBZA 5JR7B 4OVEA 4AL9A 2A6ZA 1B35A 5GLZA 3ZSLA 5FZFA 5I0DA 5A3TA 2MEV2 4FPEA 2WLQA 5AVPA 3EBRA 2FD8A 1BLZA 2WIIB 3BUCA 2TBVA 4ZXKA 2HH9A 2CNAA 4QXCA 3ZVXA 4H3WA 3KV6A 1UIKA 3R6SA 3BCWA 1WBFA 3U07A 5FY7A 3VKOA 2RDNA 5AFEA 1RUI3 1FMD3 4LIUA 2NP0A 1DQ1A 3WQ0A 4A3ZA 5CFCC 3T3YA 2RMU1 3POJA 1I9RA 4D94A 1UYXA 4AFAA 1CN1A 2IC1A 2VBDA 3KCXA 5L7OB 5JVVA 2X5IC 3SH3A 4RFRB 5CG9A 1AYM3 1V70A 1W2OA 2W87A 1FI2A 1PO13 1J1TA 3VB9A 1O3TA 1VJ2A 2C6SA 5FYSA 1UZZA 5FZMA 2QDRA 1D4M2 5FXZA 3U1XA 2WNUB 3DCQA 3LEIA 2WC2A 3AL6A 3PMEA 4HSLA 4IE5A 1MQTA 3BALA 4XW3A 4SBVA 4N9IA 2TNFA 4BQ5A 3W5NA 4Z07A 4QKFA 5KHGA 1JZ3A 2JEMA 1H0BA 3VBSC 3ZR5A 3GM8A 4OZXA 3CNAA 2YU1A 3CEWA 2IXIA 3FLTA 4PIXA 3VZMA 3K46A 3NJZA 2DFCA 3S6PA 3GZTB 1JZ5A 4XZUG 3C8XA 4D6RA 3SNMA 4PCRA 4ATEA 2W0XA 2ZOEB 1Z7S3 1EAH1 1LHUA 3H8OA 1R1A2 5FKBA 3KVAA 4BCUA 4EV0A 4LBKA 3GZAA 2WAAA 4JGZC 2B46X 3C7HA 1BMV2 1VAKA 5LWBA 1QXRA 3ZN5A 2QQPA 1TME3 3OJBA 3M3EA 3AX4A 4S2GA 2G9FA 1SEFA 4MYEA 4BLIA 5A6YA 1HQWA 2W47A 5FMOL 1YI7A 3WEZA 5EIYB 1O59A 2XLAA 1KFXL 5FR3A 4PIZA 2WNVB 3DEMA 5EJZB 4B7KA 1ZBA3 2DUPA 1IZ3A 1W3XA 3DECA 4XAAA 3ZFFB 5KXBA 1OBNA 2HWF3 4FI9A 4AR2A 3ITQA 2XPJA 2NYYA 4UYBA 3WV6A 4WZFA 1DQ0A 2BFUL 4L9BA 1C8M3 4N90A 5FZKA 1C1LA 4NWWA 3OEAA 2Q8DA 4IE7A 4QDQA 3RI9A 5C5TA 4CVUA 1LOFC 3P5BA 4E8CA 4ET7A 4GKYA 4R9BA 1TME1 1PGW1 5B4XA 3N35A 3ZPYA 2VZPA 3ZYGA 2WQZC 1W04A 1KJRA 2RR13 4HK8A 4BMEA 3VKLA 4PBOA 1O8SA 2FDJA 4CP0A 4BJ0A 4MLOA 2E7AA 3DXTA 3HIFA 3LA3A 4A45A 2AGSA 1JYWA 4YW3A 1NCRB 1OI6A 2QZ2A 1S4CA 4FFFA 4OLLA 5T50A 5FCCA 2E51A 4O61A 3ACIA 3AKTA 1W2AX 2KA3A 2P34A 3EO6A 3TOJA 2O8OA 2QQNA 1RUH1 2WO1A 1NLRA 2ZABA 1OC1A 3MV11 2RJLA 3I2JA 3SCFA 2GNMA 4YW2A 4CDUB 2SLIA 3CO2A 5C3RA 5HCHA 4WM8A 3POFA 1L3JA 2GNDA 1VBB1 4FQ4A 4HONA 3VV1A 3OGSA 2DBNA 1A3KA 3FC0A 2PHRA 2VTXJ 2WT0A 4XFHA 4DUVA 5KC6A 3RZGA 4M3CF 1ZA7A 3I54A 4QD2A 4I30A 4R9CA 1RITA 3N36A 1AXKA 2Z79A 2BNMA 2B39A 2VL4A 1RIRA 1CAUA 1WW7A 4XXPA 2XQRA 2PELA 1QNYA 3JBG3 3I2DA 1Y9QA 5CFCA 2PMWB 1LOCA 1V6JA 2CAVA 4LORA 5BXXA 4Z2AA 2RM22 2VECA 2JIGA 2X5IA 1W2NA 3KQRA 4RHV2 1WMXA 4XJUA 4YVWC 3WF3A 1I1EA 1AL23 5KBFA 1NCQC 2F17A 4RN5A 2VZSA 3FHAA 1I6XA 1VBA1 2C1FA 2WS93 4FVVA 1K5MA 3J8F1 2RV9A 3LE0A 2WJSA 3M2MA 1HXS3 3URFA 4RGKA 5BPXA 4ZU7A 2BJSA 2BEOA 3UYJA 1HIXA 2VW2A 3B5LB 3TNPB 2XR4A 5JXJA 3WZ1A 2H6CA 3PTYA 3UT0A 4CCEA 5FBZA 1ASJ2 3OGGA 1QJZA 3VBSA 3WDVA 4N43B 2CY6A 2W92A 5SV5A 3ST7A 3D82A 5DG2A 1GUIA 1WW6A 1VBE3 4Z8BA 2IXJA 1OVSA 3KT1A 4CDQB 2D6NA 5LCWL 4ASLA 4GMP3 2WSUA 5FYYA 1AL21 2DVFA 1IGOA 3WR0A 3C7OA 2Q1FA 5JAXA 1VRH3 2WS91 3MIDA 4P5HA 4FPJA 4JGZA 3I59A 1F5FA 3T0AA 5FWJA 4YZ4A 5FREA 2XQXA 1OSGA 5DZFA 3B94A 3BOPA 5JI9A 1KDKA 2V72A 3QD6A 1UX7A 1WZXA 5T5OA 3WUCA 3D4KA 5L9VA 4KWJA 1J3PA 4YGDA 1YI9A 3WY6A 2Q8OA 4BQXA 5EWSA 3WHUA 2A6XA 3QBQA 4GMP1 3AZVA 4R52A 4W50A 3BYWA 4OMCA 3AP4A 5EYXA 5EZWA 5LBEA 5LBCA 1RUJ1 5JIUA 5K9YA 1E5RA 3WD5A 1C5HA 2VCAA 4CP9A 3VBUB 3NQHA 5FY1A 4LMFA 2W9XA 1QJU1 3R4DB 3ACHA 1WCSA 1DZQA 3WNLA 2J1EA 3LGRA 4I2OA 3N9QA 3C2UA 2G9ZA 4LHSA 1LOAA 1Q5OA 5GZGA 1KGYA 2YGMA 4Y1ZA 1V9U1 1OA4A 2V4VA 1PIV2 1Q3EA 4QPIB 1APNA 1PK6C 2WBKA 3A21A 4YM2A 1XYOA 3PJQA 2XUMA 4AFCA 4L11A 4JAAA 2FDKA 1D7PM 4GALA 5A3PA 3WNOA 1L7QA 2DFBA 4EWDA 2B45X 3CL1A 5HPOA 3U78A 2PTMA 4Q4Y2 2CGPA 1HRI1 2ZAAA 5JZGA 4NPMA 3R05A 4CXYA 5IVYA 2BWCA 4GWNA 3J7HA 4GH4C 1U5YA 1HKDA 3THCA 4LKFA 1SPPB 4Y22A 4DRVA 2EAKA 4UW3A 2XLGA 3KZ4C 3LKJA 2PAKA 1S0FA 2PQQA 1DLCA 5ACA2 5T5LA 5C7GA 2DVBA 4L2NA 2BTVC 3DN7A 4YZ3A 5FYCA 3VL8A 4YARA 4O9GA 5JPNB 4LO7A 2OIIA 4GXLA 5A33A 4AW7A 4AG4A 2GN7A 2VMCA 4WVMB 1D2SA 3J9SA 5JXIA 4GJYA 3OPZA 1WA6X 1B35B 3ZXKA 3I97A 5IK8A 2ZGLA 2CYFA 4YVWA 4IV1C 1ND3B 3RWNA 4AEJA 3AZWA 1NZCA 1OXCA 2W1WA 4LBOA 3RMXA 5L7OC 2JDKA 3AVSA 5ERLA 2ADEA 3IBMA 2YBKA 3KHBA 1POQA 2ARXA 2GP3A 1MS8A 1WLDA 1N3OA 2P3JA 2RMU2 2LUWA 2I07B 4W8JA 1KITA 1VP6A 3FBMA 2QQIA 2YC2A 4IV3B 3ZM8A 5I8YA 5LA1A 4QM9A 3T4VA 1LOEA 2A73B 1AXYA 3VDAA 3NVCA 4AQTA 3VBOB 3BN6A 2BRTA 1ONAA 3RZMA 2PFWA 3DUIA 3LDKA 5C4WC 1J84A 2UY9A 3T2PA 3C7EA 1PM7A 4K40A 4LBJA 4YLZA 2FMDA 5FXWA 2WT1A 3IDAA 2OQ6A 5FUPA 1SACA 1RUC1 1BEV1 2O1QA 3OUJA 4XTPA 5JIAA 1W6NA 1MQTB 2QBXA 5IK5A 3MUY1 3M7AA 4LE4A 4UW5A 2XOMA 1ACCA 1DZRA 5A7SA 5F6LB 2QZ3A 2UY8A 1YRZA 3GCXA 3JXSA 3NSTA 4XF0A 2HWE1 1C5IA 3AZZA 2NMNA 3BPSA 3LF7A 3PLQA 2W91A 3FX3A 1O5LA 5C71A 5FMBA 2FBEA 2XVGA 1FATA 1AYM2 3CMGA 2Z69A 3JCIA 5D1IA 5LATA 4XCAA 2QQOA 1EAH2 4LUKA 1CIWA 3WG2A 1JYTA 4QKBA 3ZDSA 4CDXC 4XBQA 5FUIA 1GOFA 2VQUA 1UU6A 1RVF1 5H9PA 1ENXA 3VUOA 2R32A 3KGZA 4LQRA 4JTOA 2WNVC 2E53A 4CCLA 5FK8A 2LW8A 4IQPA 1SBFA 3SKJE 2OZJA 4CEYC 1Y7BA 3ZFFC 2DU1A 4FOYA 2YMZA 1BHGA 3VD9A 5L73A 4KI5M 3AK0A 2Q4SA 2AR6A 5DZGA 2A5ZA 3AMHA 4FPCA 1RJ8A 4YG6A 2Y33A 1I5PA 1GNHA 2V5DA 3J7NA 1Z7S2 3TN93 2BOIA 3RPQA 4E2GA 4AGVA 1IPSA 1GQGA 1KQRA 2VH9A 1LNSA 3T2OA 1HN1A 1TME2 1PGW2 3ZSEA 2WAOA 3BODA 5FZBA 1S55A 1SFNA 5DG1A 2NN8A 4K21A 3BB6A 2R041 3R0RA 4B29A 2K9ZA 3DYPA 2ZX1A 2CHHA 4X6RB 5C6CA 1QJFA 1PZ9A 1F4HA 2ES3A 1KDMA 3R4UA 1EV11 2HJIA 3JD71 3AZXA 3LOIA 1H6XA 2YFUA 3OY8A 4MGQA 3I49A 1ZBA2 3E5XA 5A1FA 5A1LA 2ZKNA 1HN0A 1MZ6A 3AKRA 5BNPB 4GH4A 5A7WB 2HBTA 4QPWA 5IVJA 1RUH2 2P3KA 4XIKA 5D8AC 4NHLA 5F1RA 1C8M2 2YC4A 4FFHA 5EP9A 2PHFA 1FOD1 4QPGB 1VR3A 2K0GA 5I0TA 1S0CA 1VBB2 5FYMA 2E9QA 5IVVA 1G86A 2OT7A 2WDBA 2RR12 2QFEA 2ZHLA 1YIFA 4D8MA 1OHFA 3E5QA 3QOPA 4AQ2A 1W28A 2W46A 2KXLA 5I0RA 1UMIA 5L9RA 1WCDJ 2ZGMA 1GR3A 1ZA4A 4XFFA 1SMVA 2C0ZA 4IV1A 1TG7A 2EIDA 2FCVA 1ODNA 5L7OA 3I8TA 3GJBA 3OD0A 2E26A 4HKWA 3RNSA 3B9IA 4MHRA 1CAUB 4K9SA 3HT2A 2WFPA 1QWRA 3F95A 3SXWA 1ZZ9A 5CFDC 1UU5A 5FIXA 2WNUA 2WZR3 3GZEA 1W6MA 3PJYA 1J59A 5FDBA 3DF0A 3WF2A 4C8DA 1TQ5A 1VBA2 4MG2A 1BXHA 1JW6A 3J8F2 4ZY9A 2A3XA 1PM4A 4LKDA 4LUMA 4GIQA 3L9JT 5LB6A 3T1LA 2J1SA 2BV4A 5FZHA 4LHKA 4U36A 5DUVA 3WDTA 1BYHA 1U0AA 1ENQA 5IVCA 2WLPA 1D2QA 4GWIA 2OUJA 2Q30A 2WT2A 1GZWB 3JBG2 3WG3A 4E4SA 2GMPA 5JOXA 3TEYA 5A7PA 1RHI3 1WBLA 2V73A 1Q8OA 2ZZJA 3A4UA 5EJ3A 2VNRA 4XDQA 3D0JA 3UJOA 1RUG3 3N9LA 1R64A 1AR63 3ZXEA 1ODMA 4E8DA 1AL22 3WDWA 3WF4A 2HWB1 5IK4A 2WS92 1XSQA 1L7LA 5H9SA 5JOWA 1OMIA 5B2GB 3B02A 1QU0A 4XJ8A 4AFMA 5F2WA 4WV8A 1DP0A 1XNAA 3M3CA 5JPMB 3TYJA 1SCSA 3ON7A 2P5BA 2WNVA 4JGZB 5A3UA 3MZHA 4GAZA 4OFGA 4CEYA 3ZFFA 1OF3A 3J7LA 2ZMKA 2VTXA 4XHXA 5FZIA 1JH5A 3BKZA 2OKXA 3N9OA 1JYNA 4YSFA 1ND2C 3DGTA 2I2SA 1J3RA 4LKSA 4MGZE 1RUG1 3BTYA 2KR2A 2VZOA 5FZCA 4YPJA 3VBUC 4DUXA 1SBDA 1W8WA 2ET7A 1VRH2 4H14A 1UZWA 3RS6A 2E7TA 1H30A 1RUJ2 1ZREA 2E6VA 4BIOA 1JOBA 1CX4A 3H8XA 3O1MA 3GJAA 3WP3A 2FDFA 2J22A 3GXUA 2QTWB 2VVEA 1N1VA 3CHXA 3E1F1 3N9MA 2XL7A 4ONUA 2WO7A 2GZWA 2Y64A 4BQ4A 3FN9A 3RYPA 1JMUB 2EAAA 3K51A 1QNWA 4EN7B 1V9U2 4A44A 4JQRA 4CCKA 5HCAA 4FXKB 1ZRFA 4CDUA 2IXCA 1D4VB 5T5JA 1COV1 4IEYA 2JDZA 4MXVA 5DPNA 3PUQA 1LOGA 2HWD1 2ZEWA 4YW6A 1AX0A 2V5YA 2ZHKA 5GKAC 3KT7A 1ULEA 2GC2A 3POEA 4XF1A 3I2HA 1QOOA 1HRI2 4XUPA 4XOGA 3KF3A 3X29B 4LKEA 1DYKA 3AC0A 2DTWA 1OUXA 1TE1B 4AEDB 4NJ4A 5L36A 3CJXA 4Z92B 3LPFA 1OD5A 1W9TA 1DGWA 3HQXA 1QGLA 3PUAA 4Q27A 3ZN6B 1MR5A 1H1AA 3P3NA 2GC0A 1UOJA 3T08A 5CB7A 4CSWA 4XFGA 5J48A 3PVOA 2WFF3 4AVAA 5FFOC 2X09A 4EZ4A 2J7MA 1IQAA 3LAGA 4QB2A 4XUQA 5CG8A 1ND3C 5A32A 4DOUA 5C8CC 5T55A 4MV2A 2VCBA 2NPIA 4M3CB 4C90A 5CFDA 2XL9A 3VZLA 4C0BA 5FP8A 5DZEA 4CRQA 2YV8A 4B4RA 2VE1A 1N47A 2YGLA 1OQEA 4YVWB 1JUIA 2XJPA 1NCQB 2VCCA 2ZX2A 4B1MA 2GMEA 1LHWA 1VALA 4IE4A 2FCUA 4XJZA 2JIJA 1CONA 1EPZA 1MPXA 4FCAA 4QQOA 3ZFEC 2DCKA 3K48A 3MDPA 3LIHA 1NE6A 3H3LA 2ZGQA 4XACA 1YC61 2D7FA 3TBDA 4CDQA 1DGWX 1REDA 1Y43B 3IPVB 3L2HA 3NKGA 4LULA 3FHQA 1VB4A 2EXHA
chains in the Genus database with same CATH topology
1IKQA 5IT6A 1OA2A 4FXGB 4B3NA 4BQ1A 1BEV2 2PLV3 4WBBA 5AFBA 5ABJB 3RZZA 1ZREA 3FLRA 4XETA 1WW5A 1AR93 2XBO1 4XIOA 2XWJB 1AHSA 4KWKA 4Y26A 4CDWB 1DDLA 4Q4X1 2B5HA 3AP9A 3ETQA 1HDKA 4R8HA 4XILA 3VKMA 1DU3D 3LOBA 3V56A 5FPZA 1ND2A 1AR73 1X8EA 1QJX3 1QOTA 2ZX4A 3VBUA 1RVF2 3AZYA 5I0UA 2AREA 2PLV1 4AQ6A 5JSPA 4AGGA 3WCRA 3A0NA 1CGPA 3ZXLA 2DCTA 1AR91 1LODA 4TZDA 2R1BA 1NE4A 3RJ2X 4DZGA 1X82A 1AVBA 3VHRA 1EY2A 5BY5A 4DFSA 4QPIA 3KSCA 1H8TB 1Q43A 5FTTC 1PIV1 1ENRA 1RTVA 3FFQA 2EALA 3NAPB 4TSVA 2UWCA 4HPKA 4K7JA 3KM5A 1RUF3 1PK6B 2BPA2 4YZ2A 2R042 4MVTA 5BNPC 3NV1A 4HN0A 4DMIA 1EV12 1JBCA 5EFUA 1LECA 1QDOA 1ZBE3 2DV9A 4LA3A 3SCGA 1CPMA 5E88A 2VUJA 3TN92 3AP7A 4A7KA 2RJKA 5ACA1 1FOD2 3HBZA 4WVMA 3VBHC 4XFBA 4FPOB 1X8MA 1RUF1 1TNFA 4O9EA 3WW3A 1ND3A 3V64A 4TLFA 5C8CA 1WMEA 3ZYJB 1JYIA 3KCCA 1C57A 4KBBA 2IXHA 4I3PA 1REFA 3M1HA 1VIWB 1ZBE1 3AKQA 2NLRA 2EA7A 4CYDA 4AI8A 4IV3A 1QJY3 2OPKA 4IV1B 4AFDA 2GSYA 3Q9OA 4JDOA 1WCKA 1UCXA 3VBOA 4S2HA 1MS5A 3E6DA 3UKTA 1H4GA 3ZFEA 2IXLA 3UK9A 5AC93 2A6WA 2JKBA 1OLRA 3MIBA 1W6MB 2GALA 2XGXA 2FMYA 2P17A 5C4WB 5LEKA 3L2YA 1SBEA 1CAXA 1RUI1 3ALQA 4XHBA 1FXZA 4EWEA 1FMD1 1CVNA 2YROA 2JG8C 4KWLA 2XHKA 3WW2A 5DDJ3 3IIAA 2RS33 2DU0A 2ZMLA 5DUWA 3VGIA 1B09A 4QHBA 2JD4A 1AYM1 1MVEA 1Q8PA 5AC91 5F9TA 1PO11 2ZS6B 5GZEA 2WZR2 4HKOA 1GYKA 3O7OA 2DCZA 2HWB2 1HRV3 1MS9A 2A3YA 1RB8G 4GKXA 5JMCA 3TAYA 3HMYA 1CQ9A 5GM0A 3AJZA 4U2AA 4RA0A 4CDXB 1KS4A 2OA2A 2D5HA 4IEVA 1PGSA 2DCYA 1CJDA 2WNEA 4F83A 3INAA 2RS31 4ZU5A 3ZXFA 4CEYB 2R073 1MS4A 1RUG2 1AR62 5KXDA 1DGLA 5J37A 1Z7S1 1S0BA 1FPN3 2ENRA 3MIEA 5CA6A 2ZGKA 4IXLA 3B01A 1H2MA 4Q0UA 2YUEA 2JENA 4YNIA 1ZX5A 1V6KA 3C3VA 3LA2A 4NOTA 1M06G 4YG0A 1IS3A 5GZCA 5BNPA 1LESA 1CAWB 2ZPXA 1ZBA1 2WINB 2VMGA 2R071 4META 5J98B 5EV7A 4AI3A 5I93A 2B9UA 2HWF1 1G9FA 4DS0A 4QPGA 4QQ2A 4Z1VA 1COV2 1C8M1 1N1SA 4S2FA 3MIHA 2PAEA 3GBFA 1PNFA 2HWD2 1UL9A 2VVDA 2GAUA 5D8AB 3VBHA 2RR11 4WM7C 3WQ7A 4AEDC 2GH8A 1ZYBA 3MPBA 2ET1A 5KHKA 3EHKA 3H7YA 1LRHA 2EXKA 4IL7A 2VW0A 3FFZA 2BYVE 4LA2A 2VVFA 1V6IA 1YO8A 3VDDC 2ZGUA 5LEJA 3ZMOA 4PLMA 3G6JB 5A3LA 3ILFA 1DGRA 2D3RA 2GMMA 5A32B 5K0UB 5CFDB 3MF6A 1O7FA 1QDCA 4CEWC 1UU4A 5K7PA 4RQPC 1IS5A 2RHPA 3M3IA 5KHJA 1XRUA 1CPNA 4IETA 4K20A 4AEMA 4FOQA 1GZWA 1R1ZA 5GLTA 1EPWA 1QXPA 3JBG1 1MVQA 4Y1YA 1ULGA 5FMOS 3IDBB 5ABJC 3O14A 1MS0A 3HWJA 4P9JA 4A7YA 5I0SA 2HEYF 3B00A 5GLUA 1S2KA 2A3WA 4K8FA 4E9KA 4QPYA 1HXS1 4Y20B 4CDWC 2XBO2 2BFUS 1KS5A 1TMF3 1SQ4A 3S30A 4EJRA 1LULA 1V6OA 3N3HA 4Q4X2 2VGDA 3LCPA 4AF9A 1RUE3 3AM2A 1HV1A 1YWKA 4JTNA 1VBE1 2MPFA 3H1MA 3O0XA 1PHMA 3IDCB 3NO8A 1NXD1 4DXZA 2EXJA 3PMSA 1VRH1 1LCLA 1G7YA 1JYCA 1ND2B 2LTNA 4KH9A 2PLV2 2DVGA 4MXWB 3VHPA 4YW1A 2XWBB 1LOFA 1AR92 4UW6A 1H8TC 2WZPP 4XEZA 4BHPA 1AJOA 4RS5B 3N7KA 3BPZA 1RMU3 2OZ6A 4JV4A 3NAPC 1ZRDA 1UPSA 5CAZA 4XBLA 3VZKA 1PVC3 2DUQA 1ZZBA 3USSA 3ZYRA 1VLNA 4OHZA 2ZX3A 4YM1A 2BUKA 1POV3 4BH9A 2HWC3 5GALA 3ZN4A 5J96B 3SHRA 4HPKB 3AB0A 1N1YA 2JE7A 1S0GA 3VLBB 2BVVA 3KS7A 4D7SA 1A78A 2VPVA 2B8MA 4AEDA 4ATFA 4Q26A 4ASMB 1AXZA 1XQNA 4ISRA 3FLPA 1POV0 1IS6A 3ZN6A 1RMU1 2CWSA 1PMIA 4Y5Z0 1U5XA 1ZRCA 2EIGA 5GLWA 1PZ8A 4R4ZA 2VU9A 1ULDA 1XXNA 3B69A 3VDDA 4M3CA 1FYUA 2R49A 1RUF2 1RUNA 2D3SA 2ZACA 1ZZCA 3WDYA 3WDUA 4COYA 2VOWA 3AP5A 3O5SA 3GALA 1NCQA 5C8CB 1ZBE2 4A2UA 4F7ZA 2A75A 1XYPA 1RC6A 4RQPA 5GJ6A 3IPVA 5AVAA 2NZ9A 3GZUC 1V6LA 2ILMA 1ZRRA 3KCYA 3ZFEB 1U5IA 1RL3A 1WW4A 4JRAA 3H9AA 3ELNA 5ABJA 1UPIA 5GZDA 4ES9A 5C9AC 3USUB 1QOSA 2BVBA 3FZ3A 3U10A 1G6NA 4ES8A 2G9GA 1QHDA 1RUI2 4CDWA 1ENSA 1FMD2 4Q2FA 1HV0A 2JICA 3MPPG 4BMBA 1PVXA 1CAXB 3WDXA 2X8KA 4RL7A 1H8VA 1QQP3 4JVAA 4H55A 2X53S 2QDNA 5AC92 1PO12 3PVEA 3NV2A 1W0OA 3S0MA 1BBT3 5E89A 2VOXA 3SISA 3ASIA 3V0AA 3W58A 1G9AA 1OFNA 1OA3A 1SLLA 3CLPA 2UU8A 2AH2A 4FQZA 4URTA 4LLOA 4OI1A 1YNAA 4OI4A 5J36A 5I8SA 2WKKA 5DDJ2 1H8TA 2RS32 1UX6A 1QF3A 1Y3TA 1O91A 3TRSB 3ZIXA 3IT8A 3ZYIB 4AVBA 2VNGA 1W2UA 3NAPA 4XFAA 1YUDA 1A8DA 1PK6A 2YXSA 4XBNA 3H1WA 3T2TA 2IXKA 3OYWB 1VBC3 1BJQA 2BNOA 2VQAA 4LE3A 4WVWA 1AJKA 1XNDA 3O0VA 4KU8A 4G4FA 2XJUA 1R083 1WUVA 3GHMA 1YFYA 3ES4A 4L8QA 4MGIE 3FE5A 1UMZA 2EXIA 4Q4W3 2R072 3LA7A 1UW8A 2HWF2 3ACLA 4YW5A 3TN91 4Q4V3 4C91A 3M3QA 1F8VA 3WG4A 1S1AA 3MEPA 4C0HA 1S0EA 2EF6A 3AMPA 3ENRA 4MSVA 2DCJA 2MEV3 3HN1A 1KXGA 4OHYA 5T54A 3VBHB 4XZPA 4AFBA 1DGRN 2RS53 3PHMA 2Q0AA 1JXNA 2D6KA 3WG1A 1DG6A 4FPHA 3D5OA 1C3HA 2P2KA 2QVSB 5K0UC 3M3OA 2W68A 4Q1RA 4B4QA 4EN8B 2VOVA 4LR4A 1V6MA 4QT6A 5C4WA 1LJ7A 1Z0HA 3SLIA 5FQ0A 5C9AA 2ATFA 1GFF2 3V0BA 3KB5A 4BLJA 3DKWA 3MI8A 4JDMA 4HKLA 4XJAA 2QJVA 1GSLA 3WW4A 4KU7A 5HCBA 1LGNA 2WZR1 4BWOA 3JB4C 2JG8B 2XJRA 1GZ9A 1R1A3 1ZVFA 2R0HA 1H1MA 4WVZA 4Q0PA 3MIGA 4I0BA 3RMYA 4TWTA 4H7MA 4CDXA 1HXS2 3LSEA 3LSDA 5JLVA 1R093 3AYDA 4JGYB 1IPKA 4B4PA 5LK7B 2W08A 3I4IA 2PAMA 4PQ9A 1RJ7A 3ZXJA 1VBE2 1RHI1 1ZZ6A 4M0HA 1UN1A 2ZZQA 4BOWA 1LB2A 3ECQA 1AR61 4QQLA 4ITCA 1EP0A 2DF7A 4UW4A 4LEJA 4MH0E 5CNAA 1DYPA 5H9RA 2MNGA 1W6OA 4RS5C 4AK3A 1C1FA 1SLAA 1AYN3 1LGCA 1Q8SA 4NPRA 2R30A 1TMF2 4AHYA 1CAWA 3EJKA 2ZKLA 1PO23 3J4UH 4YGBA 2D40A 4QM8A 3KMHA 1UKRA 1OOPB 4D69A 1BQPA 4PF5A 2QNKA 1J1LA 2D6OX 3P3PA 4YGCA 4DINB 4LHNA 5D8AA 1KJLA 1AR83 2EVXA 3B3QE 4KQ7A 5EYYA 1M4WA 1SLCA 1W6QB 4RR3C 1AYN1 4YZ5A 1NYWA 3DPRC 4IEOA 1SLBA 1J3QA 2V09A 1XNKA 2P3IA 4XTMA 4UBHA 2XVLA 4LTAA 4WM7B 1YFWA 1F5JA 1RMU2 1UZYA 3AFKA 1GV9A 3AYCA 4Q1PA 4I01A 4N53C 1U5ZA 1PVC2 3JB8A 3SH5A 1LOBA 2R16A 3LWCA 2PHTA 5CBLA 2O8QA 4OUMA 1A6CA 2UURA 2RM23 1V6NA 1AR81 4GB33 5K0UA 2HWC2 2VW1A 3VDDB 4Z2WA 4HSJA 5HCFA 4NO4A 4BE3A 1IS4A 2WA4A 3HD8B 2D6MA 1I3HA 1WA4A 2JECA 1DHKB 3EXUA 5BNQA 2D5FA 1WLTA 4HL0A 3D8CA 4DY5A 1AX1A 2JG9C 4CEWB 1FV3A 2PHDA 4XQDA 5JDBA 1GKBA 2R063 1VBD3 3O0WA 4RQPB 3S7EA 3H0OA 2WFF1 4AHZA 4FTBA 5HBAA 4GB31 1LENA 4W6XA 3WP4A 2CGOA 1GNZA 5IUQA 4Y20A 4MGYE 2ZGNA 2RS13 1QH6A 2I45A 2AUYA 1HW5A 1SLIA 1F2NA 3D6EA 4E4ZA 2G4IA 3UV9A 4YZ1A 3PVNA 4XMIA 1S0IA 1IKPA 4MXWA 4P9GA 2RS11 3V0AB 1MEC3 4HT1T 4PDWB 5LRRA 2CGNA 1BVP1 3WCSA 4PLNA 1VAMA 4QQHA 4RS5A 4EN9B 5KHHA 4QGLA 1W0PA 4FAGA 4OI0A 1LGBA 1YIPA 4DB5A 2A70A 3BTAA 2ZA9A 1JUHA 4QU2A 1QMJA 3VKNA 1AR71 2JE9A 4FAHA 3NV3A 1QJX1 1RUD3 2PN5A 4IEXA 1UD1A 3IWZA 2GU9A 3WVJA 5I8TA 5KXCA 1MEC1 4FPLA 5HXVA 1S0JA 3SMHA 2BQPA 1H2NA 4JDNA 4LBQB 4DQAA 2LM3A 4E4DX 4RR3A 4KNCA 2OYZA 5KHIA 3WOGA 3AP6A 2B7YA 2Q1ZB 4IERA 3WT3A 4M00A 1WD3A 3H3UA 4NWVA 4XF9A 1UKGA 4LO8A 1Q56A 4ZKTB 3H8UA 1DQ4A 2ZGTA 3NL1A 3POSA 4BZ4A 4P9IA 2B42B 1HX6A 2FHRA 4RSUA 4AVVA 3OBRA 1RINA 1H2KA 3FUQA 1VBC2 4I02A 5FPXA 1SFYA 4FTEA 4FO9A 4OHVA 2OVUA 3UJQA 1R082 2ARBA 1ZNPA 3U0ZA 5FRAA 3QH6A 2JXAA 3ES1A 1MZFA 4M3CE 4P9YA 5GZFA 3MLKA 4AI2A 2LALA 5FLHA 1JOJA 2F6BA 1ALYA 4AI1A 2F4PA 4QGNA 1ZZ8A 4AQSA 4JCKA 4P9LA 3VL9A 4YFZA 1C4RA 4HVRA 3USUA 4KL1A 4BA6A 2VXRA 2DWRA 4LBLA 2QKDA 2RS52 4NR1A 3IN9A 3H7JA 4EWAA 2BW8A 3ZXGA 5FQ0B 5C9AB 1QJY1 2VOKA 2BBVA 2VQ0A 5J09A 3V0BB 4XPVA 1LR5A 4FBFA 3FUOA 4HBNA 1YFUA 3AMMA 3AXDA 4LT5A 1XE8A 2QUOA 3MYXA 1EAH3 4Z82A 1K5MC 1QH7A 1YHFA 3TNQA 5FO7B 5JOYA 3B9CA 4JGYC 2IWGB 3ZMNA 1N1TA 3OD4A 3FBYA 3AJYA 2QE3A 1BKZA 5CADA 4YG3A 4P14A 5BUVA 1D0HA 4S2DA 3RJRA 2CL2A 5T3NA 5DDJ1 3VN4A 4X8NA 1ZM1A 3JZVA 4QQPA 1RHI2 2CAUA 2BWAA 4WVVA 2JJ6A 4YM0A 1BCXA 2CWMA 4K1ZA 3VZOA 3VHOA 1HRV1 1XU2A 1C28A 3OYWA 2XLFA 2H6BA 1LU2A 1RUOA 1R092 1W6OB 1OOPC 3WW1A 2PHXA 2ZCWA 3DV8A 3O12A 2VULA 3GYDA 1G9DA 2ZJCA 2ZHMA 4EROA 3DL3A 4Y1UA 4L99A 3NW4A 1RUH3 4X8PA 3ZFGB 5J7MA 1DIWA 1FPN1 1W6PB 4FPFA 1G9BA 4E2QA 3H1YA 4Q29A 1VBB3 1BVVA 2PHLA 2WA3A 1AYN2 5FLIA 2D43A 2VUAA 4W6WA 3ATGA 1PO22 3WLUA 4AVTA 1FAYA 3GHNA 1V00A 3D0SA 1BK1A 2PHUA 3V65A 1LU1A 3GBWA 4R9DA 1OPOA 1YYNA 3KLSA 1BZWA 4H7LA 4A3XA 2C5DA 2WSVA 1VAVA 3OF1A