1GANA

Complex of toad ovary galectin with n-acetylgalactose
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
134
structure length
134
Chain Sequence
ASAGVAVTNLNLKPGHCVEIKGSIPPDCKGFAVNLGEDASNFLLHFNARFDLHGDVNKIVCNSKEADAWGSEQREGVFPFQQGAEVMVCFEYQTDKIIIKFSSGDQFSFPVRKVLPSIPFLSLEGLQFKSITTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Soluble beta-galactosyl-binding lectin (galectin) from toad ovary: crystallographic studies of two protein-sugar complexes.
pubmed doi rcsb
molecule tags S-lectin
molecule keywords GALECTIN-1
total genus 28
structure length 134
sequence length 134
chains with identical sequence B
ec nomenclature
pdb deposition date 1996-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1ganA00
1DQ6A 1ZA4A 1W6MB 2ZGKA 3AP7A 3NV4A 4M3CF 4LBMA 3IMNA 4W65A 5DG1A 4ATEA 1LULA 2ERFA 2NM1A 2ZGSA 1APNA 1J1TA 2ZHNA 3A0KA 1XQNA 4DRRA 1SCRA 3N3HA 1UL9A 2CL2A 5HCFA 3VUOA 2WNEA 3WHUA 4LBQB 2GMMA 2UWCA 3M3EA 3T1MA 1LOEA 4FOVA 2ZGQA 1PZ9A 1Q8VA 2A6VA 3WOGA 4YZ4A 4BM8A 1F5FA 1SBDA 1Z0HA 3AP4A 5JDBA 1AF9A 1JHNA 1ONAA 1ULFA 2ZGLA 1W6NA 1SBFA 4AWDA 2DVDA 1SACA 4Y1ZA 2ZBJA 1C57A 2WT1A 2ZGMA 5T54A 4K1ZA 4XMAA 4LBOA 3SISA 3BOPA 3O0VA 4XJAA 1ENQA 3PVOA 4YZ3A 5KXCA 2ZGRA 2ZZJA 1BXHA 4PBPA 3OY8B 1KDKA 4Y1UA 3LSEA 3O0XA 5GLWA 1S1AA 4ZXKA 4UW6A 4SLIA 3VKLA 2A3YA 5F9TA 3AYCA 2AUYA 2PELA 4GA9A 3WNXA 1N3OA 2ZMNA 5CA6A 2VUAA 1C4RA 2D6KA 5GLZA 3T2TA 1URXA 3VKNA 4XBQA 3HR9A 1LECA 1IS3A 1MS5A 1W6QB 3D6EA 3BTAA 1YIFA 3IN9A 4YGDA 3VV1A 4AVVA 2YROA 1LOFC 4YM2A 1ULDA 2ZHMA 1YXWA 3PVNA 2ZGUA 2PHRA 3AP6A 3IKWA 3PJQA 4GALA 2DVBA 3IM0A 5T52A 4GXLA 2Z42A 1JYIA 1CPNA 4R9DA 1UZZA 4Y20A 3ASIA 5T5LA 3PVEA 3FBYA 1LENA 2EXIA 4NO4A 3RMYA 3WVJA 3M3OA 1Y7BA 2PHUA 5T5JA 3N7LA 2P34A 2PHFA 2DU1A 1ENSA 4Q27A 1AVBA 4RL7A 5GZGA 3V0BB 1BYHA 1HQLA 4Y26A 1W6QA 1MVEA 1QNWA 2WQZC 3AZZA 4R9AA 1UZYA 1LOBA 1W6MA 2AGSA 2KM2A 5E88A 5GLTA 1BQPA 1KDMA 4AVSA 3MW2A 1GBGA 4FPLA 4M3CB 1S0FA 3B69A 1VIWB 3VKFC 1LOAA 1MS3A 1BZWA 5GZFA 1DGLA 1G8WA 3WLUA 4FOYA 1CVNA 4C1WA 4FVVA 3R05A 4DS0A 2SLIA 1W6OB 2D6OX 1FYUA 3WG2A 1PZ8A 2D3RA 3AJYA 2JE9A 1HLCA 2CNAA 3AXEA 4P14A 1DQ1A 1N3PA 4P9XA 5IK8A 1CONA 1VLNA 2A6XA 1IKQA 1G9BA 5GZEA 1YRZA 4I30A 2ZHLA 1V6IA 5KXBA 2P37A 1SBEA 3AYEA 1O4YA 5IT6A 5JOWA 3AP9A 4XXPA 3U4XA 1LHWA 1GNHA 1H9WA 1LGBA 1SLTA 3ENRA 5CBLA 1C1LA 4YW2A 1LGNA 3C2UA 1V6MA 1TEIA 5KXDA 1V00A 2PHXA 1Z78A 4FPJA 2Q5TA 4FOWA 5JVVA 1YI7A 2JKBA 3V0AA 1I3HA 3Q9OA 2UWBA 4L8QA 1F31A 4DRVA 3OGGA 4XE9A 1FATA 2JDZA 5E8AA 1OKQA 3B01A 2GDFA 2PHTA 3WDTA 2ZGPA 5JOXA 3WUCA 2YZ4A 4YFZA 4XZPA 1D0HA 2A3XA 2NP0A 1LHVA 1ULEA 2R0FA 1IS6A 3ZXJA 2JE7A 1C1FA 1ZM1A 4YZ1A 2EXJA 2R1DA 3I8TA 1MS0A 1GKBA 2DTWA 4Q1PA 3SH4A 4FPFA 4YGBA 4GKYA 1KRIA 1GV9A 4PBOA 2GALA 2D7FA 2DV9A 4YG6A 5T5OA 2G4IA 1Q8OA 3V0AB 2XG3A 4UW3A 1DHKB 3UJOA 2GNTA 2D6PA 3FUQA 3OYWB 2VW1A 3WDYA 2FMDA 2GNBA 1QMJA 2A6YA 4BMBA 2AREA 2D3SA 4FPOB 4XJ9A 1N3QA 1W6NB 4DPNA 3WDXA 1N1VA 4D69A 1LU2A 4LBQD 4K21A 1CN1A 1N1SA 3RRDA 4XOGA 3L2YA 1SCSA 2DUPA 3JU9A 4JC1A 1MS8A 2E51A 1WW6A 4R9CA 3KM5A 1B09A 1FV2A 2ZA9A 4GWNA 4Y22A 5DUUA 5H9SA 2YV8A 2GN7A 3AXDA 1R1ZA 3GALA 4CRQA 4XILA 3WG4A 2D6LX 4MYEA 5JMCA 5GZDA 2EALA 4IQPA 3W58A 3MW4A 1LHUA 2W39A 3OJBA 1LOCA 4M3CA 5HCBA 1V6JA 1JXNA 4XHBA 2CY6A 5IK4A 1LHOA 4FQ4A 4Q1RA 3RMXA 1WUVA 3PMEA 4BOWA 5EYYA 1KJLA 1ENRA 2A3WA 3DUIA 1LTEA 1A78A 3T1LA 1G9AA 2D6MA 4WZFA 3AYDA 4CZSA 4DQAA 1ULCA 2ZGTA 2D43A 1Q8PA 3D5OA 2EXHA 2H0BA 4P9WA 1AJOA 3USUB 1NXD1 4HL0A 2CWSA 1WD3A 3ZYRA 1DZQA 3VKOA 2CWMA 1EPWA 1G9DA 1GANA 1A3KA 3LCPA 2ARXA 2V5YA 4YZ5A 5SV8A 1QOTA 1W0OA 1DIWA 2UURA 4YW3A 4FQZA 3V64A 3WCRA 3N7KA 1CESA 3D4KA 3HMYA 4JRAA 4XYXA 5DZFA 4ZKTB 5KXEA 3N7MA 3ZPYA 3M3CA 2GNDA 2ZMKA 1VAVA 1S0DA 2W08A 2YMZA 4M01A 4YG0A 3RQ0A 5DG2A 2R1BA 1BKZA 3AX4A 1BJQA 1PZ7A 4Q26A 4ASMB 2ZACA 1SLIA 1V6OA 4WV8A 4Y24A 2GNMA 1G7YA 3WUDA 4YFWA 2SBAA 4FOQA 3RS6A 3ZXKA 3AJZA 4TZDA 1KITA 3RG0A 1LGCA 3AYAA 3HN1A 1IS4A 1ULGA 2A7AA 4GKXA 1WBFA 2VU9A 2E7QA 4YM3A 1UPSA 1WW5A 5L73A 3ZSJA 1MS4A 5E89A 2V73A 2FHRA 1IKPA 1MS9A 3SNMA 1G9FA 3FLTA 2DUOA 4JCKA 3RSJA 2ZMLA 2P3IA 2VY0A 1S0BA 1GZ9A 4YM0A 2LTNA 3B00A 4BQ1A 3N35A 1GZCA 1SLCA 1Q8QA 3SLIA 4UW4A 1RITA 2OUHA 5T55A 1A8DA 2W68A 2P3JA 1JYCA 2WT0A 4FP3A 3V0BA 2W52A 4Y22B 1WW7A 2C5DA 3VKMA 4FPCA 2ZABA 1I1EA 4Q8KA 3NV1A 1N1TA 1MR5A 4OZXA 4AVTA 2PHWA 3QCWA 4AGGA 5LK5A 2NN8A 3R4UA 1OQ1A 3LSDA 2WJSA 1FX5A 5GJ6A 5IK5A 3AK0A 3ZSKA 1JBCA 4XJUA 3ILRA 2NMOA 2UU8A 3ZSMA 4YZ2A 3W59A 2NMNA 1AXYA 3OYWA 4XIOA 4WVVA 5AVAA 1FNYA 2ENRA 3OBRA 3MEPA 4XJZA 2DWRA 2P3KA 3GNEA 2OW4A 2D3PA 1RINA 4HANA 4AGRA 1RIRA 2GN3A 2EAKA 1JN2P 1AZDA 1FNZA 2E6VA 3FLRA 3M2MA 4AGVA 3M1HA 5H9RA 1DQ0A 2ZGOA 1WCSA 3M3QA 2E7TA 2DUQA 2JECA 2C9AA 1SLAA 3FLPA 4TYSA 4LBJA 1FV3A 4YW1A 3USUA 5DZEA 1W0PA 1LODA 2UWAA 1SLLA 1H30A 4LBLA 3R4SA 3WCSA 1HDKA 1MACA 4R9BA 5T5PA 1LJ7A 2DURA 2D44A 1S0EA 1UKGA 3AZYA 1O4ZA 4Z8BA 1QKQA 3I4IA 2NZ9A 4FPEA 1LOGA 3NWKA 1LESA 3O12A 1DYKA 1WLDA 1CQ9A 3INAA 5CB7A 1UMZA 4Y20B 1QU0A 4CTEA 3KQRA 3OPZA 3ILFA 3SH5A 1LCLA 2GMEA 2B7YA 1Q8SA 2AENA 1KQRA 1DBNA 4XXAA 5CAZA 5JOZA 3UL2A 2XB6C 3WZ1A 1AXKA 1QOOA 3WDUA 3QLQA 4ATFA 3N36A 2A6WA 1WLWA 2AYHA 3UJQA 1V6KA 1VAMA 2ZKNA 5CNAA 4U2AA 4YW5A 1AJKA 1WLCA 2CTVA 4Q8LA 2R16A 4KBBA 4RA0A 4UW5A 3SH3A 1JOJA 4FPKA 4XTPA 5GZCA 4GWMA 1CIWA 1YO8A 1QNYA 2DVGA 4LBQA 3UK9A 3MPPG 1JW6A 1YYNA 2D6NA 5FREA 2R49A 5IK7A 5GLVA 2ZHKA 1MZ6A 2WSVA 5DUWA 1H9PA 1GSLA 2DVAA 4YW4A 2AR6A 3ZSLA 3APBA 1W6OA 4YLZA 3DGTA 5IUQA 1IS5A 2A5ZA 1UAIA 4Y1XA 1QGLA 2TEPA 2WT2A 3AP5A 2DU0A 4XJWA 2EXKA 4XBNA 4ITCA 1GYKA 5EYXA 1NLSA 3ZXLA 2CYFA 1N47A 4Y1VA 3FUOA 2EF6A 4XDQA 4BMEA 1KJRA 4P9YA 4YM1A 5H9QA 3IPVA 3AZVA 3TAYA 1SLBA 4M3CE 2A70A 3A4UA 2WKKA 4ISQA 2AH2A 2WSUA 1VALA 2JJ6A 4K1YA 5DUXA 1OFSA 2RHPA 5DUVA 4LBNA 3NV3A 1DQ4A 1D2SA 1DYPA 1QDOA 4YGEA 1W6PB 2OUJA 5EWSA 5F5QA 3H0OA 4BLIA 2YY1A 5JLVA 1IOAA 3AFKA 1HQWA 2WLQA 3ZXEA 3MW3A 1UX6A 4FP2A 4BPZA 2VW0A 2DTYA 1AX1A 2VW2A 3POYA 4Q2FA 1S0IA 4YG3A 4Y1YA 1GLHA 5DXDA 2A71A 3ZXFA 3AZWA 2NYYA 3CNAA 2BQPA 2P2KA 4XBLA 1LOFA 3B9CA 1DLLA 5JOYA 5H9PA 2R0HA 4XTMA 2E53A 4U36A 1X50A 3WHTA 3ZYPA 1AX0A 3BIWE 1WD4A 4M00A 2ARBA 1Q56A 1GZWB 4WVWA 4ISRA 1CPMA 1V6LA 2VH9A 1GICA 2YXSA 5BYNA 4FPGA 1W6PA 3AZXA 1MZ5A 1JUIA 1MS1A 2ZGNA 5GLUA 2GMPA 2JD4A 1AX2A 4XMIA 4PCRA 3WDVA 1F9KA 3OY8A 4FPHA 1S0GA 1DQ2A 5DZGA 4DFSA 3IPVB 5T50A 1WBLA 3OBTA 3JUUA 1S0JA 2I2SA 1CR7A 4BLJA 2A6ZA 4K20A 1MVQA 4F83A 3FFZA 1LHNA 1LU1A 1SFYA 3ILNA 3N7JA 4NOTA 2DVFA 2EIGA 4YGCA 3O0WA 4XIKA 1GZWA 4XHXA 2A75A 1G86A 2ES3A 1QF3A 3NV2A 3POSA 5GM0A 2VXRA 1UN1A 5HCAA 3POWA 1HKDA 2LALA 4FPYA 3WDWA 4PF5A 1CJPA 1AXZA 1DQ5A 3A0NA 3ATGA 3B3QE 1QDCA 2OVUA 1V6NA 3WG3A 1N1YA 1U0AA 1FAYA 1LEMA 1S0CA 1WW4A 3BODA 4H55A 5GALA 3ZVXA 4C1XA 1DFQA 3TB0A 3O5SA 4XJ8A 1LEDA 3SITA 4LBKA 1G9CA 5FRAA 5EXOA 3WG1A 3WV6A 4PQ9A 1QOSA 2HYKA 3V65A 2DYCA 1GNZA 4AYUA 2ZAAA
chains in the Genus database with same CATH superfamily
1Y3TA 1E57A 3NV4A 4AEJA 4YVSB 4OUSA 4C8DA 1ZZ6A 4A2UA 3BCWA 2ZGSA 1COV3 5FP7A 1J59A 2ZHNA 3A0KA 2OA2A 5A7NA 3N3HA 3WF1A 3I3MA 2WNEA 3WHUA 2VUCA 4IESA 2GMMA 1K5MC 1PVC2 2HWC2 2OQ7A 2ADDA 2HWF3 3T1MA 1VE0A 4FOVA 2ZGQA 1Q8VA 1DZTA 4BDVB 4AHZA 1WZXA 5KC5A 2ZX4A 4YZ4A 4BM8A 1SBDA 3NNJA 1RUF1 3O1UA 1SBFA 3WQ1A 4NAMA 5J37A 4AEDB 2DVDA 3GJBA 3N9LA 4W4ZA 5LEKA 1O3QA 1C57A 2PXJA 1GMMA 4K1ZA 3EO6A 3O0VA 5IAVA 1VBD2 2WO7A 4YZ3A 1OH4A 2PAKA 2ZZJA 5CKMA 1BXHA 4AOCA 5I93A 4Y1UA 5HV4A 5GLWA 1XSQA 2AUYA 1ZZ7A 1RUF3 3J7NA 1O3RA 4DUWA 2D40A 4GB33 5A3NA 3KHBA 1N3OA 4YNIA 5C4WC 2OZ6A 3PIGA 4HK9A 1YUDA 5GLZA 1RTVA 3BTAA 1MS5A 4HPKA 3VV1A 4S2DA 1XNTA 5FZFA 5FP4A 1GOFA 3IIIA 3MIBA 1RXGA 2BYVE 1GUIA 3IKWA 3PJQA 4GALA 4EN6B 3IM0A 4CCLA 5LBBA 5T52A 3HWJA 4MZUA 1OH3A 5DAXA 4R9DA 1JYIA 1RUC2 1R083 4B4PA 3VHNA 1JZ2A 1VR3A 3FBYA 3WVJA 1S4CA 1OF4A 5A3LA 3KGLA 2PHUA 3RZKA 1SDWA 1VB2A 2PHFA 1J84A 4WVZA 2DU1A 5FK8A 5FO9B 1DDLA 1LAJA 2AEZA 2Q1ZB 4NIAA 1HQLA 4Y26A 1LKNA 1W6QA 2W2IA 1UY2A 3BN6A 3LGRA 4QXCA 2QQOA 2ID4A 4KWJA 2WQZC 1FPN1 3AZZA 4R9AA 1UZYA 1LOBA 2AGSA 1XJAA 4CP9A 4AK3A 1I6XA 2ZEWA 3IDAA 4AVSA 3WNLA 1GBGA 3SC7X 3OGSA 4IEVA 1AL22 3PNAA 1C8NA 1X82A 5GZFA 5FYSA 4C1WA 4UAPA 4DS0A 4B3NA 1UXZA 4MXWA 1W6OB 2D6OX 3K75B 1RUNA 3GDBA 4CEYB 5C4WB 5JXJA 3M70A 2D3RA 1C8M2 2HWE2 3AJYA 4TSVA 2JE9A 1SZBA 4KGQA 4P9XA 4XETA 3NAPB 4FFIA 1H4HA 3VBUB 2ZHLA 1SBEA 2RJKA 4Y5SA 5FDBA 5IT6A 1RUE2 1ZBA3 3AP9A 4PHZA 4TLGA 5DDJ1 3U4XA 4LJHA 4LIUA 1LHWA 1GNHA 1H9WA 2XR4A 5F3IA 5M0TA 5CBLA 3S6PA 3I2FA 3C2UA 3M4FA 1TEIA 4ZZ8A 4QX0A 2JENA 5ERLA 3LEMA 4I09A 1YJLA 4FOWA 2WWJA 4MH0E 4QX1A 1CZVA 3E6CC 3I2OA 3WR0A 3UGGA 2UWBA 4NHYA 2QQPA 2WYSA 3OGGA 1QJX1 4LTAA 1OPOA 3URFA 5LATA 3B93A 2JDZA 4AAPA 5E8AA 5F2WA 1YFWA 2W5FA 3K2OA 1R1A2 2PHTA 1GOHA 2WINB 4GMP3 3WUCA 2E26A 1CAWA 4XZPA 3MLLA 2A3XA 2VECA 3NKGA 4XAAA 4YFZA 2WFF1 2OQ6A 4EN9B 2XLFA 3B5LB 1C1FA 1OBNA 4JGYB 3I8TA 3JBG3 5JR2A 3SH4A 4AI2A 4XF4A 5FUIA 2KXLA 3NMBA 2G4IA 4CP0A 4AR2A 5J09A 4HBNA 1HV0A 4Y4YA 3UJOA 2C1FA 1ZRFA 4JVAA 2FMDA 2GNBA 3ST7A 1NLQA 1ND3C 3H8OA 3UKVA 1QY4A 1LU2A 4OCTA 3POEA 1AYM2 3FL7A 5I8YA 4Q4V1 1W9SA 2OPKA 3JU9A 4LK7A 5FXWA 1QJU3 3MLJA 3PUHA 1WW6A 4ZHNA 2IXCA 4AI9A 2QZ2A 3KT7A 4CRQA 1O8SA 2CU5A 5BNQA 5FXVA 1GP4A 1NCQA 1AR91 1OLQA 1GP6A 4MYEA 1BVP1 1ZZCA 1YQ2A 4N53A 5FYIA 5IVFA 5JMCA 3MW4A 5IVJA 2PLV1 5DN2A 3DYPA 4BHPA 1KS4A 4BIOA 5FWJA 2XVGA 4NRQA 1V6JA 1JXNA 3HQUA 2I45A 2WIIB 5B4XA 4Q1RA 4KWKA 4WM7A 4XW3A 3RMXA 1RMU2 5F5IA 1MZEA 2LM3A 3O1PA 2A3WA 1G9AA 2D6MA 4WZFA 2HBTA 4AFBA 1E5HA 4D7YA 3USSA 4QXHA 3CEWA 1O7FA 4RR3A 3A22A 4HMZA 3RJ2X 3TN93 5FPXA 4Y5Z0 3ZXAC 1WD3A 4QQOA 5FMCA 2BUKA 4Q4W2 1EPWA 1XYNA 2GC1A 1K42A 3LCPA 5C7GA 2K46A 2UURA 4WM8A 3WP6A 4UBGA 2VBBA 3I3DA 4ZKTB 5TSWA 3WCRA 3WF3A 4JRAA 4XYXA 4B4QA 2H6BA 3MUZ1 1W06A 2WZPP 4QPIA 1VAVA 2BVVA 1S0DA 1YFXA 3NSTA 4YG0A 3ZPOA 1UOFA 2LW8A 2VG9A 4K8RB 5DG2A 2PTMA 2VTFA 4KU8A 3RQ0A 4AG4A 3AX4A 1PZ7A 4Q26A 4QX3A 5FPBA 3T4HB 2J42A 2ZACA 3TNQA 5ABJC 3S57A 4RQPC 5ABJA 4WV8A 5LWBA 4B7KA 2QQJA 3CU7A 3THDA 3WUDA 4YFWA 5IAXA 1W2NA 1W39A 4MHRA 3RS6A 3ZXKA 3ITQA 1M06G 4X6RB 5IW0A 2V09A 3RG0A 1LGCA 1CD3G 2A7AA 4ARYA 1KFXL 3ZFFB 1WBFA 2YHJA 3AM2A 3MGUA 3T2PA 4L2NA 3QH7A 1O91A 3A21A 5L73A 3WEZA 3LFIA 3ZSJA 5CFDB 4IE6A 4IEQA 3FLTA 4XEZA 1NUKA 1XU1A 2R7EB 2P3IA 2VY0A 3RSJA 1GZ9A 4YM0A 5FOJB 3ACGA 1R082 3HEIA 2X10A 4PI0A 1UD1A 4FSJA 3SLIA 1FOD1 5BPXA 1RUI2 1HRI3 1OQDA 2WN3A 2ZJCA 2QTWB 4I3PA 4RYDA 3KHCA 1JYCA 2WT0A 1F5JA 4COWA 1KGYA 2HEWF 2WQ8A 1PIV3 5A70A 1ZRCA 4LOTA 1H8TA 1RUG1 2XLGA 4DIQA 2HH9A 4MGQA 1ULPA 3RNSA 3NV1A 4WM7C 1MR5A 4OZXA 4AI3A 1W9YA 2D98A 2PHWA 2XJQA 2E31A 2VZOA 5BNOB 2ADEA 3LSDA 5C5UA 3H7JA 5LA1A 3MO4A 3ZSKA 2UY9A 3ALQA 4JGZB 2XQRA 5BY5A 1ALYA 3FE5A 4N53C 2UU8A 4YWAA 1EUTA 2VMDA 1NCQC 1DG6A 2R043 4AVBA 1XNCA 5AVAA 1MEC3 3KT4A 4XJZA 2JG8B 2P3KA 3ZFGC 4AXOA 1RIRA 2Y6KA 1AZDA 3NO8A 3VD4A 3J8F2 4FT8A 4LUKA 5F5CA 5FPUA 1JH5A 5H9RA 1DQ0A 1IPSA 1WCSA 2VCCA 2A73B 5I8TA 2C9AA 4CPBA 3WD5A 1BEV2 4YYOA 2VQ0A 1RUI1 4UFLA 5FUNA 3LOBA 2MHFA 1ND3A 1RL3A 2GH2A 5DZEA 3DXUA 4ES9A 1W0PA 1ZZBA 2XJTA 3O1RA 5JAXA 3OD0A 3RYKA 1HDKA 2C4XA 2FDIA 2B42B 4R9BA 5T5PA 1OVPA 2JDKA 1QJFA 4CU8A 2X8KA 1S2EA 3VDDB 2VCAA 1NXMA 5A6YA 2WZ8A 1W8FA 2C26A 3IDEA 4XZUG 4BIFA 3JD71 4COVA 3LZZA 4AQ2A 5C3QA 2BNMA 3OEAA 1OOPC 4KU7A 4Q29A 3THTA 1AYN1 4AE2A 4Y20B 2QBXA 4CTEA 1GU3A 4L99A 3U37A 4HN0A 2VOWA 2Y6GA 4NROA 1Q8SA 2WS93 1KQRA 4FBFA 3POJA 3CHXA 2BEOA 4Q4X1 1RUD1 3BTXA 3NL1A 3WDUA 1QOOA 3DYMA 1XOYA 3ZN5A 5KHIA 4W8JA 3D0JA 1ODMA 1W9FA 3O1TA 4QX8A 3MLKA 1GWMA 2AYHA 3UJQA 3UKTA 5CNAA 4SBVA 3WQBA 1PM7A 4CU6A 1UYXA 3BKZA 2GC0A 2JWPA 2Y26A 3SH3A 2VGDA 4FPKA 2RS51 4ET7A 1H1IA 1CIWA 2HWB2 1RMU3 5B2GB 1OF3A 3FHAA 4XFCA 4I0WB 1D4VB 5IK7A 3LAGA 2ZHKA 2WSVA 5BNPB 5DUWA 4LO5B 2YUEA 2DVAA 5DQ0A 3WNMA 1QJEA 4YPJA 1K45A 2RDSA 1W6OA 2V4VA 3APBA 3SXWA 3DGTA 3RVHA 4LNVA 1AR63 1UIJA 5JI7A 1UAIA 2IWGB 3FFQA 1QGLA 3BALA 4Y1XA 3WNPA 2OX0A 2P6HA 3LPFA 2WT2A 4A6SA 3NJXA 1W03A 2FQPA 1O6UA 4YW7A 3E97A 2CV6A 1GYKA 3NJYA 1N47A 2PQSA 3SCGA 4HXCA 1ZRRA 2EF6A 2ZX3A 1AR81 4BMEA 2VULA 3MV11 4MHUA 3MFAA 3IPVA 4GMP0 5A3MA 3OTFA 5A6ZA 4OI0A 2MEV3 2WSUA 3PJYA 2R32A 1OPMA 4BB3A 1RJ8A 3KWVA 1AR92 1TNFA 4HZFA 1QDOA 3EBRA 1UNBA 5EWSA 2Y8KA 2YY1A 3O1OA 3ZXEA 3MW3A 4CP1A 2ZTNA 4QB6A 3VBFB 4EWDA 1AX1A 1XNDA 2VW2A 1UYZA 1ZZ8A 2WR9A 3POYA 1W8OA 4Q2FA 2YPJA 5IATA 5JUVA 2K2SA 5KBFA 1VBC2 1X33A 3BOWA 3JBG2 4LEJA 1AL21 2A71A 2BV4A 2JKXA 2MEV1 2Z2SB 4B7EA 3B9CA 1DLLA 5H9PA 3UGFA 1SFPA 3ZMOA 1R081 2VZ1A 4U36A 3ZYPA 3BIWE 1WD4A 3T30A 4S2FA 5HXVA 1VPHA 1Q56A 4YVWA 5C4WA 3DYOA 2RV9A 1V6LA 3HD8B 4CP2A 3SEPA 1X8EA 4JTNA 1W6PA 1MZ5A 2JD4A 3WDVA 1H2KA 1BK0A 1S0GA 1DQ2A 1RC6A 3JCIA 2HWB3 3IPVB 1FI2A 3PLQA 5T50A 3WW2A 1PX3A 3KSCA 3WP5A 2WNVA 4DXSA 1MVQA 2QZ3A 3RJRA 1WKYA 3N9QA 3FFZA 1LU1A 2JXAA 4UYBA 1NA1B 3AKTA 2DVFA 1DLCA 2KD7A 4UF0B 4IXLA 4EZ4A 1QJX2 2VQAA 4XHXA 1OMIA 1O8PA 3NQHA 4QU2A 2ES3A 3S5QA 3FWEA 1QJU2 1JU4A 3U10A 2VXRA 1JI6A 4N9IA 1HKDA 1K5MA 2LALA 2XOMA 2WO1A 1NY71 3U1XA 5C71A 4FTSA 4GD4A 3I97A 1TZOA 1PO21 3LDKA 3A0NA 3ATGA 5FKBA 1YQCA 3WG3A 4BU2A 2XHKA 3O7OA 1U0AA 5GALA 2XLAA 4S2HA 2J1VA 3ZVXA 4CUAA 5FZ1A 2HEVF 4MXWB 2BJSA 4XF0A 1BVVA 1OLMA 2GC3A 4GIQA 1POV3 2WA4A 5C3RA 2VNVA 2DBIA 1OI6A 1C8M1 2HWE1 2HYKA 2QQIA 3FMGA 4IEOA 4PQ9A 2EA7A 5FBZA 4CDWC 4UF0A 4CP9B 1EUUA 5FLIA 3HOBA 4XVHA 1ZA4A 3AP7A 5DG1A 4W65A 4ATEA 5A80A 2B46X 1K5MB 2NM1A 1WMDA 3Q8CA 4JZRA 4N9HA 5IJRA 3KVBA 4R8HA 3ZYJB 1DCSA 1XQNA 4AFMA 1VBA3 3OGVA 1UL9A 1ZBE2 3KV9A 5HCFA 3VLBB 4LLFA 2UWCA 1D7PM 4Q4W3 1HB1A 2IXJA 1PNFA 2FDKA 3WOGA 2WWUA 5LCWL 1RYYA 4PIYA 4XURA 1Z0HA 3JQWA 3AMPA 3AP4A 5JDBA 2V5DA 4NVPA 5AFEA 1W6NA 4AWDA 1BLZA 2VUJA 4I01A 3VBHC 4HPKB 1SMVA 2VM9A 4S2GA 4OHZA 2BWAA 1T2XA 2WT1A 1NQDA 2ZGMA 4XMAA 4LBOA 5T54A 3SISA 3CLPA 1B35A 4XJAA 5JSOA 3PVOA 4UFIA 5D1IA 3ZYGA 5JPNB 2ZGRA 4LR4A 2QNKA 2XGXA 4XUTA 3OY8B 3O0XA 4ZXKA 4UW6A 3K3NA 5LY2A 3AYCA 5A32A 2P17A 1BK1A 4Z1VA 1JZ5A 2YFZA 5FAXA 5DAVA 2E32A 1TVGA 5FZ6A 3S30A 3LOIA 2D6KA 1HB4A 1URXA 4ZU4A 1JMUB 4XBQA 2RS12 3TAYA 2WLPA 3D6EA 4YGDA 1ZRDA 2JEMA 4AEDA 1C5HA 1LOFC 4YM2A 2ZHMA 3MIEA 2ZGUA 2PHRA 3OSDA 1H1MA 4JDNA 4CE8A 3BU7A 1OD5A 2DVBA 4MUVA 4JGYC 2ZX2A 3J8F3 5IFPA 2O14A 1UZZA 3VBRA 3HJRA 4Y20A 3ASIA 5T5LA 4LKEA 3CJIB 4QX7A 3RMYA 4NJ4A 2X05A 2Y6LA 1Y7BA 4Q0QA 5T5JA 3N7LA 4KBZA 3PTRB 4LOSA 1OA3A 2ATFA 1JS9A 3E5QA 2JIGA 2YU1A 3CJIC 4Q27A 1AVBA 4XPVA 2JDNA 4N43A 2RS11 2Q8CA 4CXYA 1Z7S1 2QJVA 4QQ2A 3LEGA 5IVCA 2JG9B 2BGOA 3JQXA 1PK6A 1W6MA 2OS2A 3TN91 2VVEA 3PTYA 4LQRA 2Q8EA 1CAUA 3MW2A 4M3CB 4PDWB 3MZHA 1JZ6A 2YC0A 1VIWB 4R4XA 3ZYBA 1MS3A 1BZWA 3B02A 1DGLA 1YNAA 3LKJA 4FOYA 1CVNA 4RD7A 3WLUA 3ZFFA 5AC93 2SLIA 2R042 2VOKA 3ABZA 5F39A 3KQ4B 3THPA 3ZX7A 1TE1B 5C8CB 2QQKA 5FZ9A 3HNMA 1Y9QA 1PZ8A 5D8AC 1RUH2 4EJRA 4EN7B 5F3CA 1VAKA 3AXEA 1Q3EA 3VD9A 2G9GA 4XFIA 1RUJ3 1ND3B 1CONA 4YARA 1BBT3 4A4AA 1HJFA 2VMGA 4IERA 1UZVA 1V6IA 2YBKA 4A42A 4LA2A 5KXBA 4NPMA 4GULA 1O4YA 1EP0A 3S7IA 5K0UB 4OHYA 4XXPA 4AI1A 1SLTA 1LGBA 1SQ4A 1C1LA 2E63A 1U5YA 4LIVA 1OA2A 3VBHB 2ZEZA 2GZWA 4FI9A 2BW8A 1H8TB 2LUWA 1US3A 2O8OA 2Q5TA 3NNLA 4MGTA 2W91A 2IVIB 2BP6A 4QT6A 2O1QA 4E9KA 3Q9OA 4RHV2 5IVEA 1ZRIA 2QQWA 4Q4X3 1UX7A 4MSVA 5FPAA 3KV4A 2GDFA 3WDTA 3FX3A 5CFCB 1PGW2 4QXKA 2J1SA 2NP0A 3WT3A 1HRV1 1X8MA 2R0FA 3ZXJA 4AHYA 1RUE1 4UT5A 1W90A 5IWFA 5FLJA 3TRSB 4Q1PA 5CFCC 5JIUA 5L9RA 5I8SA 1GV9A 1HRI2 1S2KA 3RZGA 2GALA 3BPSA 4LE4A 2DV9A 4BYYA 4XDOA 1CAXB 4Q0VA 4UW3A 2JDAA 1HJGA 2RM22 3FUQA 2WNVB 2VW1A 4NR1A 1QMJA 4IEXA 3MIHA 3WSOA 3FC0A 2D3SA 5BNPA 2QQNA 1O5LA 4AQTA 3ZN6A 2YFUA 4CUBA 2R062 3WDXA 4D69A 3ETQA 4DPNA 2DFBA 2VUDA 3ZDSA 1N1SA 5GKAC 4E27A 3W20A 4QD2A 5A3PA 1W05A 2R041 3P5BA 1H0BA 1LNSA 3HPNA 1V70A 4HN1A 4JHZA 3K77A 4CCEA 1Z7S3 3U0ZA 4BK4A 3KM5A 1TMF3 5A6QA 2FDHA 1ASJ2 1PO22 1TQ5A 1W8NA 2VMFA 2GN7A 2YV8A 1R1ZA 3GALA 2W94A 5C8CA 3WG4A 2D6LX 1F4AA 2EALA 1XNBA 2MNGA 3D3AA 5E16A 3WNKA 3LDRA 1RUC1 3C8XA 4LO7A 1TG7A 2J1TA 3OJBA 4LKSA 1CAUB 1QH7A 4M3CA 3BUCA 4CUGA 1EV11 5EHDA 1JYTA 4GQ7A 1O4TA 5IK4A 2RS53 3AKQA 3H3UA 2CDPA 2HBUA 5K0UA 3UKNA 3MIGA 1WUVA 2XBO2 5D2AA 2DDUA 5KHKA 5EYYA 2QDRA 1OLME 3GBGA 2MEV2 4IE4A 1WLTA 3T1LA 4D6SA 2VTXA 5FOBB 4QGLA 5BNNB 1BBT1 2VXJA 4XFFA 1RJ7A 1ULCA 2D43A 5HBAA 5FZOA 3HNYM 2EXHA 2Q4SA 3HBZA 1XBFA 4LXLA 4CDQA 4HL0A 2VMHA 1RGSA 3RZMA 1PVC3 1DZQA 4QDSA 3VKOA 3ZYRA 4BQ4A 2DFCA 3CF6E 2FD8A 4XF3A 3U4SA 3UT0A 4EN8B 2V5YA 1J83A 4A3XA 5SV8A 3WW3A 4YW3A 4NMIA 1NE4A 3S7EA 3V64A 4KH9A 5FQ0A 1CESA 4QPGC 3OF1A 2WDBA 1PO11 1JZ8A 2X53S 2BPA2 3GBFA 2B39A 1I5ZA 2BWCA 2W08A 2BGCA 2YMZA 5FZ3A 4M01A 3UYJA 3KCXA 5L9BA 1BKZA 3G7DA 1BJQA 2YBSA 4K8FA 4NAOA 4XQWA 4FAHA 1V6OA 1QH6A 1RMU1 2XMLA 5C3SA 2XONA 4M0NA 5DAWA 3FN9A 1G7YA 4FOQA 2DCZA 1OC1A 2W47A 1VBB1 4TZDA 1KITA 5FY5A 3ZM8A 2CHHA 1RHI1 3LQCA 3ACIA 1IS4A 1ULGA 3SKJE 1C3HA 1RXFA 4CEWA 5FPZA 1W2AX 4A7KA 1K3IA 2E7QA 1LR5A 1UPSA 3EHKA 1YEWA 4COUA 3AKRA 1OURA 1WMFA 2XJSA 1R093 4QB2A 3SNMA 4KI5M 1G9FA 1UCXA 4V1PA 2VTXJ 1HN0A 2VZ3A 2ZMLA 3SCFA 3ZFEA 4BWOA 3LDBA 4BQ1A 3N35A 4PQQA 3VBOA 1J58A 3R6SA 3BGAA 4PLNA 3I54A 4K7JA 3TWIA 5T55A 1A8DA 2W68A 2P3JA 2VVFA 4P5YA 2W1SA 4FP3A 4D6RA 1RHI2 2W52A 4JQTA 4COYA 3RGBA 1NZIA 1IG3A 1LRHA 3PVBB 1W2UA 1SFNA 2JG8C 4CDWB 1WGPA 1FMD3 1CZTA 2NN8A 3R4UA 2JIJA 1JU3A 1OQ1A 3WY6A 1EAH3 1NY72 5GJ6A 4N8MA 1NCQB 3VL9A 5FYZA 4AAXA 2L9LA 1JBCA 4XJUA 3ILRA 4QDQA 2WQ4A 2FCUA 4UBHA 4UXAA 4YZ2A 1AXYA 2JG9A 2ZKLA 3RYPA 4IUGA 4NPLA 4CDXB 1TNRA 4D0QA 1NZCA 2BBAA 3A7QA 5LY1A 4C0BA 3PL0A 4K3UA 2XBO1 1O3TA 3LIGA 3MEPA 2LS6A 3CBNA 3E6BA 1NCRC 5LZ6A 2HWF2 2W95A 3VHPA 1QIQA 3BIEA 1HXS3 3H3ZA 2HWD2 2VMEA 3FLRA 3RFRA 5DABA 5G05L 2ZGOA 3M3QA 3OUJA 4TYSA 2DUQA 5DPNA 1SLAA 1C8M3 2HWE3 4YW1A 3IMMA 4LHNA 4TWTA 2EVXA 3NAPA 2ORZA 3V56A 2ZZQA 3K51A 1MACA 2FCVA 2ARCA 2WBKA 1VBE2 4OMDA 3PUSA 4CDUB 4NHLA 2DURA 1OUXA 1UKGA 2XKOA 5C6CA 3I4IA 2XWBB 4XFGA 5LRSA 4FPEA 3OBZA 3DKQA 4URAA 1NT0A 3NWKA 3O12A 5BNOC 4XABA 5AFBA 3INAA 1W04A 3OD4A 3FJSA 1UMZA 4RS5B 3J8F1 3TEZA 1O59A 3KQRA 5BNNA 5JZGA 1LCLA 2W1QA 1QJU1 1XSRA 1YQ8A 2GMEA 4AVCA 4CXWA 5FJHA 4Z92B 5JOZA 1MEC1 1HN1A 4XCBA 2PYTA 4LKFA 3QLQA 3I59A 1RUJ2 2CAUA 1YQ5A 1WLWA 3TOJA 1V6KA 2V72A 5EJ3A 3CKHA 3DCQA 4U2AA 1VBE1 3VDCA 4HK8A 1AJKA 1WLCA 2C9KA 4NWVA 3MV01 4OHXA 2Y33A 1JOJA 3AVRA 3JD72 2EICA 5GZCA 4L9BA 1HW5A 1QEXA 1YO8A 2VZTA 4LBQA 3ZYFA 1U12A 4NIIA 5FREA 1L7QA 5HPOA 1MZ6A 4G9SB 1H2NA 1H9PA 4YW4A 4CEYA 2ORXA 2AR6A 4GH4A 4D8MA 1HQNA 2R073 4H3WA 1Q43A 1IS5A 1WCKA 3LFMA 1NA1C 3RZLA 3VGIA 2DU0A 1W9WA 1JZ4A 2EXKA 2XJPA 5FPLA 3GHMA 3LA3A 5JSPA 2Q30A 3JZVA 4E4HA 5C5TA 4L97A 2JICA 4ONUA 4YVSA 3I2KA 1ZZ9A 1QJY3 3FUOA 1W8ZA 4KQ7A 1KJRA 1RUD3 4P9YA 5J1XA 3AZVA 3I59B 4XAEA 4RHV1 4M3CE 3ZSEA 4A44A 2WKKA 3DPRA 1XE0A 4K1YA 2JJ6A 1RVF3 5I0DA 4LBNA 1VBE3 5CKQA 1DQ4A 3FZ3A 4Q4V2 5FY0A 1DYPA 4ASLA 4YGEA 1W6PB 1HV1A 2VR4A 3H0OA 3WF4A 3IDCB 1IPJA 3G6JB 2VOXA 1IOAA 3AFKA 2WLQA 3H3LA 3WF0A 4FP2A 5JLVA 1PNGA 2Y0IA 4BPZA 4ES8A 1I5PA 1FXZA 1XC6A 2VCBA 4YG3A 1YFYA 4OZOA 4Y1YA 1ND2C 2VE1A 1TME1 4RHV3 2FBEA 2P2KA 4XBLA 5CVRA 4GH4B 4J25A 3HN3A 5FY1A 2XKPA 2X29A 2R0HA 5JPMB 2E53A 5C9AB 2F4LA 3C3VA 2VOTA 4WVWA 2WFF3 1CPMA 3KD4A 4DY5A 1W8WA 5A3TA 5J36A 5I0TA 1MZFA 1QXJA 2XDVA 1JUIA 1MS1A 4DEVA 3ZLIA 3WQ7A 4XMIA 1BEV1 1FT9A 2P6CA 3KF3A 3P1IA 5CIRA 1AR83 3OY8A 4FPHA 2BFUL 2VZRA 4AFCA 4DFSA 4I0BA 3I2HA 3JUUA 1SPPB 1YJKA 3QACA 4K20A 1TME2 2X5IB 3ZXDA 1SFYA 3MIFA 1OA4A 4NOTA 2EIGA 4YGCA 1T6GC 2WO3A 1QWRA 2PA7A 4FO9A 3WXPA 5LB6A 1CIYA 3T0DA 1GZWA 5DDJ2 2A75A 3I3EA 2Z79A 2WNUA 1BMV1 1UU6A 3POSA 4NUBA 4JDMA 3JBG1 2PLV3 1UN1A 1H8VA 3POFA 3POWA 4FPYA 4YRDA 4UI9L 1TMF2 2FMYA 3WDWA 4EE2A 2YPDA 5JMOA 1Q5OA 2RS52 4L11A 4LITA 4XF1A 3RZZA 4CEWB 3T08A 4HLTA 5FWEA 2XHNA 5EZWA 5FZDA 2R071 4KG8A 5FPVA 1VMFA 1S0CA 3BODA 4H55A 2WN2A 5LBFA 4C1XA 4KG0A 3TB0A 4FXKB 4Q4V3 3O5SA 4XJ8A 4CCMA 3SITA 4LBKA 1G9CA 3NNMA 4Q4W1 5JI9A 2ARAA 5FK7A 4CU7A 1QOSA 3V65A 2J1RA 2AEYA 2DYCA 4AYUA 3BTYA 5FJKA 3U78A 1W99A 4M3CF 4IGPA 2F6BA 2ZGKA 4IV1C 3NJVA 3IMNA 4MVTA 3KLSA 5FZEA 1LULA 2ZEYA 4LHKA 2ERFA 3WNNA 1APNA 1J1TA 2W87A 4C90A 4CDXA 4LULA 4TN7A 1DGWA 4J1WA 5IYYA 1SCRA 1AR62 1CZSA 4NWWA 1PM4A 5A32B 4LBQB 1UOGA 4WVMB 4DB5A 3M3EA 5A3WA 1HB2A 4JGZA 4QGNA 1LOEA 4OI2A 2J1AA 1PZ9A 4QKNA 2WFF2 1WCUA 4R4ZA 3FHIB 2BZDA 4IV3C 3ZXGA 1AF9A 1JHNA 2ZGLA 3HAGA 5C9AC 3AMHA 1AHSA 3IDBB 2Y38A 2ZX1A 5FR3A 4Y1ZA 2RJ2A 2ZBJA 1PGSA 4IEYA 4QQHA 2W0XA 4DXRA 1ENQA 1PIV1 3HQXA 4P9LA 1KD7A 4KWUA 4KMQA 4P5HA 1BCXA 4PBPA 4AHXA 3LSEA 4K40A 1S1AA 3NRUA 4HKWA 4SLIA 4CCCA 2A3YA 1D4M2 4DNYA 1E5IA 5F9TA 4XUPA 1DP0A 2PELA 1ULOA 3T09A 3WNXA 1W8HA 3NKTA 3PU3A 2XJVA 4N53B 3E5XA 3SHRA 2ZMNA 5J98B 4BXSV 3OGJA 3WW4A 2VUAA 1C4RA 4AEMA 4BK5A 5CA6A 2YG0A 2EIEA 4OLLA 3VDDA 5HCHA 1E5SA 1NQJA 3IN9A 1YIFA 4AQSA 2YROA 3LB9A 1LB2A 2VBDA 1UY1A 1XE7A 3AMMA 2RR13 3OOXA 1ULDA 2IFRA 3KMHA 1GWLA 1AR61 1YXWA 3PVNA 4LA3A 4UFKA 4XUNA 1UMIA 4B1LA 5FY7A 4BCUA 3SQOA 4G3YC 4GXLA 2Z42A 1GOGA 3B7MA 3VBFA 2ETEA 4DY3A 2QQVA 4O7XA 3ORJA 2HKXA 5BV6A 2WO2A 2ZEXA 2WA3A 2P34A 3VBSA 3ZYIB 4META 4OHWA 2IXKA 4RL7A 1KEXA 1BYHA 2P3YA 5FQ0B 5C3PA 1QNWA 3MI8A 4ZU7A 3W5NA 5CG9A 2KM2A 3KCYA 5GLTA 1BQPA 2R6QA 3AKSA 1WWYA 2O8QA 2RDQA 1KDMA 3OUIA 4FPLA 5KWRA 4E4SA 2N7GA 1MPXA 5LEJA 3ZN4A 4DZGA 3GXUA 4UFHA 4CA9A 1H4GA 2VZQA 3SKVA 4FVVA 2J22A 3R05A 5FXZA 2X5IA 4O61A 2KA3A 5J48A 1WA4A 1CWPA 1EYBA 1FYUA 2XXZA 2BOJA 5T3NA 4OQ9A 1PHMA 2WZR2 4RQPB 3ZIXA 4LHLA 4ZS3A 1HLCA 2RR11 4P14A 2GP3A 2ZAHA 3CO2A 1BHGA 1DQ1A 3VBSC 4OI4A 2QDNA 2A6XA 3Q8EA 4W50A 5ANNA 5FY4A 5IVVA 5FMOL 3T4VA 1G9BA 1XYOA 2IFWA 2YGLA 4HSJA 4I30A 4J6GA 4LO8A 3VBFC 3B94A 1K5JA 3AL6A 5JOWA 1OQEA 4PDWA 4AZZA 1PVC1 1NLRA 3GZAA 4PT6A 1BEV3 5FCCA 4YW2A 3QD6A 4BQ2A 5CFDC 4MV2A 1V00A 4ZZ5A 4MX3A 4BJ0A 4FPJA 3DF0A 5JVVA 1M4WA 1GQPA 2PQQA 2JKBA 3V0AA 4P00B 1VBC3 4L8QA 3LD8A 1R091 4MOAA 4JKKA 4XE9A 1GR3A 3THCA 3E1F1 1UU5A 1T6BX 2YU2A 2GH8A 2VAUA 1VRH3 3FBMA 3B01A 1PO13 2ZGPA 1PMHX 2G19A 3NJZA 4Q0PA 5JOXA 1CGPA 1D0HA 3VZLA 1UYYA 4JHTA 1ULEA 5ABJB 2OPWA 4AHWA 4WBBA 3N4MA 4UFMA 2EXJA 2CGNA 2ZXQA 2DTWA 4N90A 5C3OA 4FPFA 2HWF1 1V0AA 2K0GA 4YGBA 1JYNA 1F8VA 3I2GA 4PBOA 4NHMA 1UY0A 2D7FA 1RUD2 4M4PA 1COV1 4YG6A 5T5OA 4JAAA 4XQ4A 1D2QA 1ACCA 3O1VA 1DHKB 3W21A 5EJ1B 4A7ZA 3Q8FA 2VNOA 1QQP3 2D6PA 3WDYA 2ZPXA 1F35A 2QFEA 2A6YA 4E4ZA 4IV3A 1OVSA 4XJ9A 3UESA 1N3QA 4HG6B 4ZPIA 1ENXA 2R072 4K21A 1IQAA 1CN1A 1W9TA 4RGGA 5K8SA 4XOGA 3ECQA 3W5MA 3A23A 4JC1A 4BH9A 4XQDA 1MS8A 4R9CA 1W8UA 2ZA9A 4Y22A 5DUUA 5H9SA 4AW7A 4OFGA 1MQTA 2BOIA 3AXDA 3KV5A 1GZTA 5IFTA 4XILA 4D94A 5E1RA 1QJX3 5AVPA 4O65A 5GZDA 3W58A 2WNUB 4NIGA 1LHUA 2W39A 4CXXA 5HCBA 4L92A 5A3OA 1STMA 2XPJA 3MYXA 4XHBA 2E33A 2HEYF 1A8MA 4JX0A 1DGWX 3N9MA 2H6CA 2GC2A 3O14A 3PMEA 2RG4A 2IVJA 4M0HA 4FTEA 2VPVA 3U14A 1S2BA 3DUIA 4QHOA 4FAGA 2XJUA 2VZVA 5HV0A 3OEBA 3TYJA 2P4EA 5FZCA 3KGZA 5F5AA 3U07A 3GGLA 1U5ZA 4QHBA 1CX1A 2H0BA 4P9WA 3O1MA 2EAAA 3J9SA 4GJYA 4EWEA 2OKXA 2JDYA 1NXD1 2CWSA 3QOPA 4LUMA 5SV5A 4ZS2A 2CWMA 5DMYA 1ZX5A 1O3SA 1GANA 1A3KA 5LW9A 4CDUA 1ZYBA 3QBQA 4NHKA 1QOTA 1W0OA 2VNRA 1DIWA 2DF7A 5FFOC 3VD7A 3HMYA 5KXEA 5DZFA 4IE5A 3M3IA 1ASJ1 4I3GA 4LO6B 3N7MA 2RR12 4H7LA 3ZPYA 5F37A 3M3CA 3C7FA 3L9JT 1VBD1 4RS5A 2XL7A 2HJIA 4DXZA 3VBUC 2W1UA 4CCKA 3JXSA 2F17A 1XXNA 1AYN2 2MPFA 1KS5A 5KHGA 3C7OA 2XL9A 1A6CA 1YLLA 1POV1 3WP3A 1OD3A 1SDDB 2BVBA 5F32A 3TEXA 3M7AA 3VBUA 1H1AA 4RS5C 3AFGA 5A7PA 5K7PA 4LKDA 5FZ0A 4OHVA 2F4PA 5F3GA 3AYAA 3CIHA 3MIDA 1ND2A 2B9UA 3AL5A 5FYTA 1OT5A 5FZIA 4YM3A 1UO9A 1ZBE3 1Y4WA 1P8JA 1MS4A 1JODA 2FHRA 1W3XA 3AB0A 4CDUC 2D5FA 2VNGA 3MUY1 4Y4RA 2PFWA 4JCKA 1SG3A 3K4AA 2BRTA 1QHDA 2LTNA 3B00A 1GZCA 1NG0A 3DPRC 1Q8QA 1GQGA 2RMU1 3P6BA 4LLOA 1L7LA 2Z5WA 3VZJA 4UW4A 2D97A 2UYBA 3U75A 3LIHA 4HOOA 5A1FA 5JSRA 4YW6A 3BTZA 2XJRA 4YVSC 3WINE 4Y22B 1WW7A 1ZA7A 1JZ7A 3LA7A 3WP4A 3CMGA 2C5DA 3VKMA 3ES4A 2ZABA 2W92A 1RUJ1 4FPCA 4GJZA 3VZMA 3WF2A 4Q8KA 1POV0 3HQRA 4AVTA 2Q1FA 4QPWA 1ODNA 1VBA1 5LK5A 4AGGA 3J26N 2TNFA 1AR82 1FX5A 1NA1A 2C24A 3CL1A 1IZ3A 4MGKE 5IK5A 1UOBA 2PN5A 4QXBA 1UOJA 1XE8A 3UGHA 5KHHA 1YWKA 3WQ0A 3AMNA 4IV3B 1PK6B 2NMNA 1DYOA 2ZOEB 5FMBA 3OYWA 4XIOA 4RGAA 4AI0A 4WVVA 1MQTC 1YHFA 1UKRA 1D0GA 5FYHA 2HLEA 3GNEA 2OW4A 4HANA 1RINA 4XDPA 2GN3A 4RN5A 1JN2P 1OFNA 1FNZA 1OLRA 3Q8BA 1QJZA 4ZY9A 4GWJA 2PLV2 3SCHA 3RWKX 2IXLA 3M1HA 4AGVA 3J4UH 2E7TA 2JECA 5FXXA 3FLPA 5L9VA 4LBJA 1JTZX 2RMU2 2HWB1 3JB8A 1RUF2 3USUA 5I0SA 2W3JA 1WMXA 3ZYHA 3ZR6A 1O5UA 4LBLA 2OXBA 3GZTB 3R4SA 4WM8B 3WCSA 4BQWA 1TME3 3PHMA 5JZGC 2HWC1 5HXMA 5CYYA 3L2HA 3U11A 3J7LA 4LORA 1QKQA 3MHZA 4Z8BA 3KZ4C 2CSGA 1D4M3 5BNOA 2Q1MA 2BBVA 1PO12 4MGSA 2VCMA 1LESA 2Y60A 4WZCA 5EPAA 1VMHA 1CQ9A 2PHDA 5CB7A 3TBDA 4I2OA 1CJDA 3OPZA 3SH5A 4B29A 2B5HA 1F15A 4QKDA 4PI2A 3GZEA 2AENA 2TUNA 2WRAA 2XUEA 5CAZA 4XC9A 4QKFA 2XB6C 5D8AB 2PMWB 2XBO3 5F3EA 4BQYA 2DCTA 5J96B 4ATFA 3N36A 4XFAA 2A6WA 3ZFEB 4HETA 4QDRA 2WL1A 4JKMA 4LT5A 1YCIA 4Y3OA 3E6DA 4GZ9A 3S5AA 3AKPA 4YW5A 3O1SA 5FYCA 2WFPA 4RA0A 4KBBA 5CFDA 5B4NA 4QPYA 1NOVA 2XVKA 3EXUA 4P02B 4PDWC 4GWMA 2GU9A 2OT7A 3IT8A 4Z07A 1AL23 1QNYA 3UK9A 1UMHA 4BA6A 3MPPG 3VDBA 2WABA 4QB1A 2R49A 1IG0A 4K9SA 2JG9C 4E2SA 5FP3A 4IEPA 1Z7S2 1J3RA 3VD3A 4QX5A 3BB6A 1OUSA 5A7SA 2WWSA 5IUQA 3ZO0B 1HX6A 2R063 2QQLA 2A5ZA 2YC4A 5FYYA 2TEPA 1R092 2X5IC 1PVXA 2VC9A 3H8UA 4GB32 4XJWA 5A7WB 4AEKA 5HI0A 3MFCA 4V2VA 4XBNA 4IEWA 2OZJA 3GHNA 3N9OA 3R0RA 4MGYE 1F2NA 2I74A 2WC2A 2IC1A 3KF5A 5EYXA 3ZXLA 3WNOA 2CYFA 4QPIB 4P9GA 1U5IA 1UF2C 3D8CA 4AFDA 5APAA 1MQTB 1SLBA 1FOD3 4ISQA 3A4UA 5DUXA 3LF7A 1VBD3 3VBOC 3OG2A 5JWPA 4P9JA 2RHPA 1XPWA 5LRRA 2A1XA 4A45A 3ZFEC 3NV3A 5JIAA 4KGGA 5FIXA 4JQRA 4Y5TA 2IUWA 3C7EA 2OUJA 2ZS6B 3GCWA 4BISA 3OBAA 4QMAA 1J3QA 3VHOA 1R1A3 1IQDC 4XCAA 1HQWA 5EV7A 1UX6A 4AF9A 2VW0A 2WZR1 2DTYA 5FO8B 1JYVA 1S0IA 3POIA 2TBVA 3DECA 2H0VA 4E2QA 5AC92 3ZXFA 4IGOA 5DXDA 3AZWA 1PMJX 4I02A 4IE7A 3CNAA 5FZOB 4O9GA 3ACFA 1CAXA 1NAEA 4J1XA 2ZX0A 4QX2A 5C8WA 4W6WA 2LROA 3VDDC 1SHWB 1V9U3 1AX0A 1QQP2 3CZJA 5FY8A 2ARBA 1UQXA 1GZWB 4Z2AA 3LWCA 2W1WA 3K4ZA 3K4DA 5LA2A 2VH9A 1GICA 2VO5A 5EIYB 1UZWA 3AZXA 2Y34A 4RFT0 5FP9A 5GLUA 3PIJA 2GMPA 2WZR3 1AX2A 4NRMA 4PCRA 5IVBA 3H1MA 5J7MA 3GZUC 4D7TA 1WBLA 2JDUA 3OBTA 4QPGA 1EV12 4HKOA 2A6ZA 4HVQA 2CDOA 1C28A 4AFAA 1VBC1 3GBWA 3CQOA 1LHNA 3IAQA 3ILNA 3N7JA 5K9YA 4LMFA 2RJLA 1G6NA 3PUQA 1H2LA 3O0WA 1CAVA 1FMD1 4XACA 2DCJA 3VBSB 5C9AA 5CKNA 2ET1A 3KVAA 4KWLA 4E4DX 2D5HA 4FXGB 3DKWA 3NV2A 4PF1A 5AC91 3Q8AA 1OSGA 5GM0A 5HCAA 4JGZC 1DU3D 4EN0A 5FTTC 4N43B 5FV3A 1U5XA 1Y43B 1CJPA 1DQ5A 4CDXC 3VHRA 1CX4A 1MEC2 4ASKA 3IAPA 3B3QE 5K0UC 1SEFA 5C33A 1QDCA 2R061 5E6HA 4W6XA 1V6NA 5CEHA 1R64A 1N1YA 4IV1A 4EZHA 1HIXA 5F6LB 3KB5A 3LE0A 3OCPA 1EPZA 4BQXA 3BU0A 1AYN3 2RM21 2WZEA 3BYWA 3IWZA 4V2WA 1XNAA 5EXOA 5FRAA 3WG1A 3WV6A 1NE6A 3IBMA 4NHXA 2J1UA 1GNZA 4LE3A 1CAVB 1UIKA 2ZAAA 1ZVFA 4Q4Y2 5C8CC 3B9IA 2D93A 1DQ6A 1RHI3 1W6MB 3H50A 3MICA 4P9IA 4LBMA 3DEMA 3I2DA 4LO4B 1JOBA 2P1BA 4TLFA 2XUMA 5FZKA 4DRRA 1VRH2 4HONA 4QQPA 2CL2A 2HYXA 3VUOA 5CU1A 3PURA 4URTA 2Y0OA 1X9PA 2YYOA 2A6VA 2WNUC 1REFA 3ACLA 3PUAA 4H14A 2EIDA 3GJAA 4M4RA 5BNPC 1F5FA 4P08A 4NIDA 2GSYA 1ONAA 1ULFA 3ZN6B 2YB7A 3HBKA 1SACA 2VZUA 2RS31 1DF0A 5LA9A 3BOPA 4COZA 1AR73 2XWJB 2YGMA 2WAOA 5KXCA 1V9U1 4I0AA 1AL0G 5KC6A 4ASMB 1KDKA 3VKLA 4C0HA 2LRPA 1YC61 4E8DA 2Y64A 4GA9A 3GCXA 3GF6A 1TMF1 4X6QB 5ISLA 4CU9A 3H8XA 2ET7A 3T2TA 1KXGA 2G1MA 2E9QA 2JD9A 1NX9A 3K46A 4NN0A 3VKNA 4CDQB 2BERA 3I3BA 4INDA 3HR9A 1LECA 1IS3A 1W6QB 3ZOIA 4AVVA 2BU9A 2BTVC 5FLHA 4MADA 2FCTA 2IXIA 4HFSA 3TN92 5A3UA 3LPGA 3AP6A 4A3ZA 2FDGA 1PIV2 4K6BA 2VMCA 1HXS2 4C91A 5D21A 1Y9GA 1CPNA 2C6SA 4IW3A 1JZ3A 4QM9A 3PVEA 4Q0UA 1LENA 1RUI3 2EXIA 3POGA 4NO4A 3M3OA 1J1LA 4OUEA 2FDJA 1ENSA 5D8AA 3V0BB 5GZGA 5LBCA 2ZCWA 4O9EA 1MVEA 2AACA 3H1WA 3H42B 4OUMA 1VBB2 5E88A 4CUCA 4FCAA 3HT2A 2B45X 3SEEA 3JD73 2WAAA 1S0FA 3B69A 3VKFC 1EAH2 1LOAA 4LPLA 3UV9A 1G8WA 1HXS1 1PK6C 2VL4A 2P5BA 1H6XA 4JRLA 3D82A 5K4LA 3RZHA 2PAMA 1GQHA 3WG2A 1ASJ3 2K9ZA 4GH4C 2CNAA 4N7IA 2Q8DA 1N3PA 5IK8A 4CEYC 3QH6A 1FOD2 1VLNA 2J1EA 1IKQA 4GWIA 4BE3A 5GZEA 1YRZA 3P3PA 1FPN2 2P37A 3AYEA 5FBJA 1RVF2 3VBRC 4A7YA 4BXFA 4X8NA 5L36A 1JOPA 2VQTA 4JGYA 1PGL1 4QKBA 3ENRA 1EAH1 1LGNA 1QJY2 1V6MA 4JKLA 5KXDA 5DDJ3 1K12A 2PHXA 2VZPA 1Z78A 3IIAA 5J3UA 4XUOA 1NYWA 1XU2A 4DEQA 1YI7A 2X09A 1AR71 1I3HA 3C7HA 4QWNA 2AC1A 4DRVA 1REDA 1F31A 1ST8A 2RS33 4CCJA 1PMIA 5F6KA 1FATA 1ZBE1 3IZOA 1OKQA 5FP8A 3ACHA 5CG8A 2YZ4A 5BNNC 3UETA 3UNPA 4IDZA 1LHVA 4CPBD 3F2ZA 4F3JA 1IS6A 1W0NA 2JE7A 4PLMA 4DINB 1I9RA 2JB4A 2JX9A 1ZM1A 4YZ1A 2R1DA 4JV4A 3X29B 1MS0A 1GKBA 2WYFA 5JXHA 1L7RA 1B35C 4MGZE 3RWNA 4GKYA 1QJY1 1KRIA 1S55A 5I0UA 3DN7A 4IEUA 2W46A 1Q8OA 3ROUA 3V0AB 2XG3A 4MGIE 2GNTA 2UY8A 2JB8A 4QAWA 3OYWB 3ZDVA 3CZUA 1VRBA 1XYPA 5IVYA 1EY2A 4HVOA 2FZ1A 4BMBA 2AREA 4FPOB 3NAPC 3P3NA 1H6YA 1W6NB 4FFFA 1N1VA 1DZRA 4LBQD 1W8TA 2R30A 2V4AA 4B4RA 3RRDA 4DXTA 3VB9A 3E5UA 5EFUA 3M8LA 4QHZA 4D7SA 3L2YA 1SCSA 4PIXA 4X8PA 3NVCA 1B35B 2DUPA 3OB8A 2VVDA 2YDEA 1NCRA 1DGRA 2E51A 1RUG2 5LASA 3I7DA 3HVDA 1B09A 4FTBA 1FV2A 4GWNA 5FZHA 1YFUA 2Y6FA 1PX4A 3HIFA 1VBA2 2QQUA 4NRPA 4OVEA 2VZSA 4XF9A 2WUHA 2B4KA 4ZU5A 3VBOB 4IQPA 5FO7B 1HRV2 4TXWA 5ACA2 4GB31 1LOCA 2RDNA 2JDMA 2BGPA 2RDRA 4CCNA 4PJYA 4Z82A 2BNOA 1OKOA 2ILMA 2QUOA 3LEKA 2CY6A 4B1MA 4CCOA 1LHOA 4R52A 4FQ4A 4QM8A 2JG8A 2VMIA 1X36A 2PHLA 4BOWA 1KJLA 4DUXA 1ENRA 1GP5A 1LTEA 1A78A 3KS7A 3AYDA 3LEIA 1AR93 3PUIA 4CZSA 4DQAA 1A34A 2ZGTA 5FMOS 4EV0A 1QXPA 2RE9A 4H7MA 1Q8PA 3D5OA 1QXRA 4LHSA 4ZONA 1AJOA 3USUB 3PDQA 1WMEA 5CADA 5EQUA 1VB4A 4PLOA 3EB7A 5KHJA 4F8AA 3CJXA 3LA2A 5JXGA 4EYUA 1G9DA 2VBPA 2ARXA 3SMHA 4CCDA 4YZ5A 1H2MA 2QVSB 3I49A 3VL8A 4AQ6A 3BI3A 2WNVC 2JE8A 4FQZA 1VJ2A 3N7KA 3D4KA 4DO0A 1RUH1 2Y6HA 3DL3A 2XVLA 4CEWC 4GMP1 4D6QA 5L7OA 2GNDA 2ZMKA 2HWC3 1RVF1 4HT1T 4EROA 2BDRA 5A33B 4H2AA 3POBA 3BVCA 2R1BA 1ZREA 5A6XA 4YVWC 1OXCA 4BZ4A 2Q0AA 1D4M1 1SLIA 2VD7A 4CVUA 1R1A1 4Y24A 2GNMA 3ZR5A 1US2A 2XH6A 5FZLA 2SBAA 1EV13 2QKDA 4D3WA 1GNYA 5F1RA 3AJZA 1F4HA 1UU4A 4N7UA 4CYDA 3HN1A 3NNGA 1JHJA 5FMDA 1IPKA 4GKXA 4KL1A 2NLRA 3ES1A 2VU9A 3MDPA 1WW5A 3T2QA 1RUOA 4MG2A 5E89A 2V73A 1IKPA 1MS9A 5JZGB 2Z69A 2DUOA 4AL9A 3N9PA 2E7AA 4IV1B 1HRV3 1S0BA 3D0SA 1RUE3 1ZBA2 4A6OA 4CDQC 2AZ5A 1SLCA 4Q4Y1 5A1LA 5A1AA 5I91A 3TNPB 2B9VA 1RUH3 4DOUA 1YI9A 1RITA 5G04L 2OUHA 3V0BA 1ND2B 5IHRA 1FPN3 1WCQA 4OMCA 4B8EA 4ORFA 4W6YA 3F95A 4RFRB 1I1EA 4RGKA 1N1TA 4JTOA 4JDOA 5F7UA 3VZOA 3QCWA 4E8CA 5JXIA 3ELNA 1AYM1 2WJSA 1XNKA 5JCTA 1VMJA 1GWKA 1IHMA 1NKGA 2QQMA 1X9TA 3AK0A 1YQ6A 3N9NA 2C0ZA 5DAPA 4AI8A 1ZNPA 1UWWA 3JB4C 2NMOA 3AVSA 3PU8A 3W59A 3ZSMA 1C5IA 2OYZA 5BXXA 1JYXA 4NIHA 3R4DB 3GYDA 3KT1A 1FNYA 2ENRA 3OBRA 5FZGA 4WM7B 2DWRA 4A41A 4IEZA 2D3PA 5EJZB 1V9U2 3J7HA 3T0BA 3T2OA 2EAKA 3OPTA 4AGRA 5C70A 5KR7A 2E6VA 4OQ8A 4OI1A 1ZBA1 4QGMA 5ACA1 4XUQA 3M2MA 1RUC3 5FYBA 3C7GA 5A33A 2G9ZA 3MPBA 1FV3A 4MXVA 3K48A 1RB8G 5FZBA 5FYUA 1OHFA 2QCSB 4NPRA 2DCYA 3W9AA 5BUVA 5FYVA 3AMQA 1LODA 2UWAA 2Q8OA 1SLLA 1H30A 2CGOA 1AR72 3NW4A 5FY9A 1E5RA 3CDZB 1LJ7A 5FZ7A 2RS13 4UOJA 2D44A 1S0EA 3AZYA 5L19A 2XQXA 5LA0A 2GP5A 1JUHA 1O4ZA 1OOPA 2NZ9A 3ZFGB 4AVAA 2FZ2A 2O0OA 3J7MA 3KV6A 2GAUA 1LOGA 5CFCA 1DYKA 4IGQA 1WLDA 3EMRA 3OGRA 2IZWA 2BNNA 1QU0A 3AC0A 3NNFA 3ILFA 2NPIA 1VP6A 1KFUL 2KR2A 1UY4A 1HB3A 2B7YA 5FZ8A 2YC2A 4BQ3A 1AUYA 3H7YA 2OIIA 1DBNA 4XXAA 2G9FA 3UL2A 3WZ1A 1AXKA 3VD5A 3ZKYA 4EQVA 2PAEA 1JYWA 1UY3A 4QU1A 3T3YA 2RM23 2VQUA 1VAMA 2ZKNA 4HSLA 2EIBA 4F7ZA 1W2OA 5ACA3 2CTVA 1REEA 2Z4FA 4Q8LA 2R16A 4UW5A 4HVRA 3I3QA 3EQEA 1YIPA 3EJKA 2BFUS 4XTPA 3RI9A 2VOVA 3ZFGA 4MO3M 4Q4Y3 3WX5A 2DVGA 3DPRB 1JW6A 3H8RA 1YYNA 2D6NA 2DBNA 5GLVA 2VJXA 1GSLA 1RUG3 3H1YA 3K3OA 3ZSLA 1PGW1 4YLZA 2FDFA 1UW8A 2CGPA 5CZKA 2Y6JA 1XRUA 4KNCA 3EYPA 1AYM3 2JDHA 5L7OC 3DXTA 1VRH1 2JDPA 1BBT2 5EP9A 4MLOA 3AP5A 3ZFFC 3ZMNA 4OYUA 3DV8A 3RPQA 4CSWA 4ITCA 2B8MA 5FZ4A 2UYAA 2YBPA 3PMSA 3ETPA 1H8TC 4NE9A 5L7OB 1NLSA 1IGOA 3H9AA 4Y1VA 3RI8A 4FFHA 3RDIA 4DUVA 4XDQA 4RSUA 4YM1A 5H9QA 4G4FA 1DGRN 2WS91 1SPPA 3VZKA 2A70A 2AH2A 4N43C 1VALA 5FYMA 5A7QA 4DMIA 1OFSA 1QQP1 1W3VA 3CJIA 5DUVA 5CISA 1UXXX 2I07B 1D2SA 3KCCA 4HKLA 4Y33A 2J7MA 4PIZA 4L0PA 1L3JA 5F5QA 3T0AA 4BLIA 1CAWB 3TEWA 5A7WA 3MF6A 5DAQA 3FHQA 4IL7A 3OPWA 1BMV2 3HT1A 1W2TA 2RS32 1GLHA 5FZMA 1X7NA 2NYYA 1COV2 1GFF2 2BQPA 3RYRA 4XFBA 1VBB3 2CAVA 3I2JA 1LOFA 3VZNA 5FKCA 4BQ5A 4E2GA 1PO23 5FUPA 4AEDC 4Q0SA 4Z2WA 5JOYA 3WW1A 4XTMA 1POQA 4IE0A 4RQPA 1X50A 5F8PA 3WHTA 4M00A 3MBWA 5LK7B 4XFHA 4ISRA 2DCKA 3TEYA 2HWD1 5FZAA 4LK6A 3GM8A 3ZIWA 2YXSA 1UZ0A 5I0RA 5BYNA 4FPGA 1XB9A 3S0MA 2ZGNA 1WCDJ 4QPIC 1HRI1 1F9KA 2RMU3 5DZGA 3OUHA 1S0JA 2I2SA 1CR7A 2W9XA 3I2IA 1UYPA 4WM8C 3ZKUA 4BLJA 3RZJA 4F83A 1NCRB 3VBRB 3MF9A 5A7OA 4UFJA 3VBHA 4FFGA 1UPIA 4ZXEA 4ARXA 3BPZA 4EWAA 4XIKA 1Y9MA 4WVMA 4YVWB 4RR3C 4YSFA 4TTGA 1G86A 1PGL2 2IXHA 1QF3A 3ON7A 4IETA 5ANQA 4GAZA 1WA6X 1OOPB 4PF5A 2WS92 1W28A 4Q4X2 1AXZA 4QPGB 2RVAA 2WNOA 2OVUA 1J3PA 3HNBM 3ME2A 1FAYA 1LEMA 1WW4A 5F2SA 2HWD3 1DFQA 2QE3A 3VN4A 2NQYA 1LEDA 4CDWA 1FMD2 5JR7B 4RR3B 5LBEA 3IB3A 4Q5OA 4QQLA 4OULA 3VDAA 4UWDA
chains in the Genus database with same CATH topology
1Y3TA 1E57A 3NV4A 4AEJA 4YVSB 4OUSA 1ZZ6A 4A2UA 3BCWA 2ZGSA 1COV3 1J59A 2ZHNA 3A0KA 2OA2A 3N3HA 2WNEA 3WHUA 4IESA 2GMMA 1K5MC 1PVC2 2HWC2 3T1MA 2HWF3 4FOVA 2ZGQA 1Q8VA 1DZTA 4AHZA 5KC5A 2ZX4A 4YZ4A 4BM8A 1SBDA 1RUF1 1SBFA 3WQ1A 5J37A 4AEDB 2DVDA 5LEKA 1O3QA 1C57A 4K1ZA 3EO6A 3O0VA 1VBD2 4YZ3A 2PAKA 2ZZJA 1BXHA 5I93A 4Y1UA 5GLWA 2AUYA 1ZZ7A 1RUF3 1O3RA 2D40A 4GB33 1N3OA 4YNIA 5C4WC 2OZ6A 4HK9A 5GLZA 1YUDA 1RTVA 3BTAA 1MS5A 4HPKA 3VV1A 4S2DA 3MIBA 2BYVE 3IKWA 3PJQA 4GALA 4EN6B 3IM0A 5T52A 3HWJA 4MZUA 1JYIA 4R9DA 1RUC2 1R083 4B4PA 3VHNA 1VR3A 3FBYA 3WVJA 5A3LA 3KGLA 2PHUA 1SDWA 1VB2A 2PHFA 4WVZA 2DU1A 5FO9B 1DDLA 2Q1ZB 1HQLA 4Y26A 1LKNA 1W6QA 3LGRA 4KWJA 2WQZC 1FPN1 3AZZA 4R9AA 1UZYA 1LOBA 2AGSA 4AK3A 1I6XA 4AVSA 1GBGA 4IEVA 1AL22 3PNAA 1C8NA 1X82A 5GZFA 4C1WA 4DS0A 4B3NA 4MXWA 1W6OB 2D6OX 1RUNA 5C4WB 4CEYB 3M70A 2D3RA 1C8M2 2HWE2 3AJYA 4TSVA 2JE9A 4KGQA 4P9XA 4XETA 3NAPB 1H4HA 3VBUB 2ZHLA 1SBEA 2RJKA 5FDBA 5IT6A 1RUE2 1ZBA3 3AP9A 5DDJ1 3U4XA 1LHWA 1GNHA 1H9WA 5CBLA 3S6PA 3C2UA 3M4FA 1TEIA 2JENA 4I09A 1YJLA 4FOWA 4MH0E 3E6CC 3WR0A 2UWBA 2QQPA 3OGGA 1QJX1 4LTAA 1OPOA 3URFA 3B93A 2JDZA 5E8AA 1YFWA 4GMP3 1R1A2 2PHTA 2WINB 3WUCA 4YFZA 1CAWA 4XZPA 3MLLA 2A3XA 2VECA 3NKGA 2WFF1 2XLFA 3B5LB 1C1FA 4JGYB 3I8TA 3JBG3 3SH4A 4AI2A 4XF4A 2KXLA 2G4IA 4CP0A 5J09A 4HBNA 1HV0A 4Y4YA 3UJOA 2C1FA 1ZRFA 4JVAA 2FMDA 2GNBA 3ST7A 1ND3C 3UKVA 1QY4A 1LU2A 1AYM2 5I8YA 4Q4V1 2OPKA 3JU9A 1QJU3 3MLJA 1WW6A 2IXCA 2QZ2A 3KT7A 4CRQA 5BNQA 1NCQA 1AR91 1OLQA 4MYEA 5JMCA 1BVP1 1ZZCA 4N53A 3MW4A 2PLV1 4BHPA 4BIOA 1KS4A 2XVGA 1V6JA 1JXNA 2I45A 2WIIB 4Q1RA 4KWKA 4WM7A 4XW3A 3RMXA 1RMU2 1MZEA 2LM3A 2A3WA 1G9AA 2D6MA 4WZFA 4AFBA 4D7YA 3USSA 3CEWA 1O7FA 4RR3A 3RJ2X 4HMZA 3TN93 5FPXA 4Y5Z0 3ZXAC 1WD3A 4QQOA 2BUKA 4Q4W2 1EPWA 1XYNA 2GC1A 3LCPA 2UURA 4WM8A 3WP6A 4UBGA 4ZKTB 5TSWA 3WCRA 4JRAA 4XYXA 4B4QA 2H6BA 2WZPP 4QPIA 1VAVA 2BVVA 1S0DA 1YFXA 3NSTA 4YG0A 3RQ0A 2VG9A 4AG4A 5DG2A 2PTMA 4KU8A 3AX4A 1PZ7A 4Q26A 5ABJC 2ZACA 3TNQA 4RQPC 5ABJA 4WV8A 4B7KA 3CU7A 3WUDA 4YFWA 1W39A 3RS6A 3ZXKA 1M06G 4X6RB 2V09A 3RG0A 1LGCA 1CD3G 2A7AA 1KFXL 3ZFFB 1WBFA 2YHJA 3AM2A 3MGUA 4L2NA 3QH7A 1O91A 5L73A 3ZSJA 5CFDB 4IEQA 3FLTA 4XEZA 3RSJA 1XU1A 2P3IA 2VY0A 1GZ9A 4YM0A 5FOJB 1R082 1UD1A 4FSJA 3SLIA 1FOD1 5BPXA 1RUI2 1HRI3 1OQDA 2ZJCA 4I3PA 1JYCA 2WT0A 1F5JA 4COWA 2HEWF 1ZRCA 1PIV3 1H8TA 1RUG1 2XLGA 3RNSA 3NV1A 4WM7C 1MR5A 4OZXA 4AI3A 2D98A 2PHWA 2XJQA 5BNOB 3LSDA 3H7JA 3ZSKA 2UY9A 3ALQA 4JGZB 5BY5A 1ALYA 3FE5A 4N53C 2UU8A 1NCQC 1DG6A 2R043 4AVBA 1XNCA 5AVAA 1MEC3 3KT4A 4XJZA 2JG8B 2P3KA 3ZFGC 4AXOA 1RIRA 1AZDA 3NO8A 3J8F2 4FT8A 4LUKA 1JH5A 5H9RA 1DQ0A 1WCSA 5I8TA 2A73B 2C9AA 3WD5A 1BEV2 4YYOA 2VQ0A 1RUI1 3LOBA 2MHFA 1ND3A 1RL3A 2GH2A 5DZEA 4ES9A 1W0PA 1ZZBA 2XJTA 5JAXA 3OD0A 3RYKA 1HDKA 2B42B 4R9BA 5T5PA 2X8KA 3VDDB 1NXMA 3IDEA 4BIFA 3JD71 4COVA 3LZZA 4AQ2A 2BNMA 1OOPC 4KU7A 4Q29A 3THTA 1AYN1 4AE2A 4Y20B 4CTEA 4L99A 4HN0A 2VOWA 1Q8SA 2WS93 1KQRA 4FBFA 4Q4X1 2BEOA 1RUD1 3NL1A 3WDUA 1QOOA 3ZN5A 5KHIA 3D0JA 3UKTA 3MLKA 2AYHA 3UJQA 5CNAA 4SBVA 1PM7A 2GC0A 2Y26A 3SH3A 2VGDA 4FPKA 2RS51 1H1IA 1CIWA 2HWB2 1RMU3 5B2GB 4XFCA 4I0WB 1D4VB 5IK7A 3LAGA 2ZHKA 2WSVA 5BNPB 5DUWA 4LO5B 2YUEA 2DVAA 3APBA 1W6OA 3SXWA 3DGTA 4LNVA 1AR63 1UIJA 5JI7A 1UAIA 2IWGB 3FFQA 1QGLA 3BALA 4Y1XA 2WT2A 2FQPA 3E97A 2CV6A 1GYKA 1N47A 3SCGA 1ZRRA 2EF6A 2ZX3A 1AR81 4BMEA 2VULA 3MFAA 3IPVA 4GMP0 5A3MA 3OTFA 4OI0A 2MEV3 2WSUA 3PJYA 2R32A 1OPMA 1RJ8A 1AR92 1TNFA 4HZFA 1QDOA 3EBRA 5EWSA 2YY1A 3ZXEA 3MW3A 4CP1A 2ZTNA 3VBFB 4EWDA 1AX1A 1XNDA 2VW2A 1ZZ8A 3POYA 4Q2FA 2YPJA 2K2SA 5KBFA 1VBC2 1X33A 3BOWA 3JBG2 4LEJA 1AL21 2A71A 2MEV1 2Z2SB 4B7EA 3B9CA 1DLLA 5H9PA 3ZMOA 1R081 4U36A 3ZYPA 3BIWE 1WD4A 4S2FA 5HXVA 1Q56A 4YVWA 5C4WA 1V6LA 3HD8B 4CP2A 1X8EA 4JTNA 1W6PA 1MZ5A 2JD4A 3WDVA 1H2KA 1S0GA 3WW2A 1DQ2A 1RC6A 3JCIA 2HWB3 3IPVB 1FI2A 3PLQA 5T50A 3KSCA 3WP5A 2WNVA 1MVQA 2QZ3A 3RJRA 3FFZA 1LU1A 2JXAA 1NA1B 3AKTA 2DVFA 4IXLA 1QJX2 2VQAA 4XHXA 1OMIA 4QU2A 2ES3A 3FWEA 1QJU2 3U10A 2VXRA 4N9IA 1HKDA 1K5MA 2LALA 1NY71 4FTSA 1PO21 3A0NA 3ATGA 3WG3A 2XHKA 3O7OA 1U0AA 5GALA 2XLAA 4S2HA 3ZVXA 2HEVF 4MXWB 4XF0A 1BVVA 2GC3A 4GIQA 1POV3 2WA4A 1OI6A 1C8M1 2HWE1 2HYKA 3FMGA 4IEOA 4PQ9A 5FBZA 2EA7A 4CDWC 5FLIA 1ZA4A 3AP7A 5DG1A 4W65A 4ATEA 2B46X 1K5MB 2NM1A 1WMDA 4N9HA 3SHRA 3ZYJB 4R8HA 4AFMA 1XQNA 1VBA3 1UL9A 1ZBE2 3VLBB 5HCFA 4LLFA 2UWCA 4Q4W3 2IXJA 1PNFA 3WOGA 4PIYA 1Z0HA 3JQWA 3AMPA 3AP4A 5JDBA 5AFEA 4NVPA 1W6NA 4AWDA 2VUJA 4I01A 3VBHC 4HPKB 1SMVA 4OHZA 4S2GA 2BWAA 2WT1A 2ZGMA 1NQDA 5T54A 4XMAA 4LBOA 3SISA 3CLPA 1B35A 4XJAA 5JSOA 3PVOA 5D1IA 3ZYGA 5JPNB 2ZGRA 4LR4A 2QNKA 2XGXA 3OY8B 3O0XA 4ZXKA 4UW6A 3AYCA 5A32A 2P17A 1BK1A 4Z1VA 5FAXA 3S30A 3LOIA 2D6KA 1URXA 4ZU4A 4XBQA 2RS12 3TAYA 2WLPA 3D6EA 4YGDA 1ZRDA 2JEMA 4AEDA 1C5HA 1LOFC 4YM2A 2ZHMA 3MIEA 2ZGUA 2PHRA 1H1MA 4JDNA 3BU7A 1OD5A 2DVBA 4MUVA 4JGYC 2ZX2A 3J8F3 1UZZA 3VBRA 4Y20A 3ASIA 5T5LA 3CJIB 3RMYA 1Y7BA 4Q0QA 5T5JA 3N7LA 1OA3A 2ATFA 3E5QA 4Q27A 3CJIC 4XPVA 1AVBA 4N43A 2RS11 1Z7S1 2QJVA 4QQ2A 2JG9B 3JQXA 1PK6A 1W6MA 3TN91 2VVEA 3PTYA 1CAUA 3MW2A 4M3CB 4PDWB 3MZHA 2YC0A 1VIWB 4R4XA 1MS3A 1BZWA 3B02A 1DGLA 1YNAA 3LKJA 4FOYA 1CVNA 4RD7A 3WLUA 3ZFFA 5AC93 2SLIA 2R042 2VOKA 3THPA 5C8CB 3ZX7A 1TE1B 1Y9QA 1PZ8A 5D8AC 1RUH2 4EJRA 4EN7B 1VAKA 3AXEA 1Q3EA 2G9GA 4XFIA 1RUJ3 1ND3B 1CONA 4YARA 1BBT3 2VMGA 4IERA 1V6IA 5KXBA 4LA2A 4GULA 1O4YA 1EP0A 3S7IA 5K0UB 4OHYA 4XXPA 4AI1A 1SLTA 1LGBA 1SQ4A 1C1LA 2E63A 1U5YA 1OA2A 3VBHB 2GZWA 2BW8A 1H8TB 2LUWA 2O8OA 2Q5TA 4QT6A 2O1QA 4E9KA 3Q9OA 4RHV2 4Q4X3 4MSVA 2GDFA 3WDTA 3FX3A 5CFCB 1PGW2 4QXKA 2NP0A 3WT3A 1HRV1 1X8MA 2R0FA 3ZXJA 4AHYA 1RUE1 5FLJA 3TRSB 4Q1PA 5CFCC 5JIUA 5I8SA 1GV9A 1HRI2 1S2KA 2GALA 4LE4A 2DV9A 4BYYA 1CAXB 4Q0VA 4UW3A 2RM22 3FUQA 2WNVB 2VW1A 4NR1A 1QMJA 4IEXA 3MIHA 3FC0A 2D3SA 5BNPA 1O5LA 4AQTA 3ZN6A 2R062 3WDXA 4D69A 3ETQA 4DPNA 2DFBA 3ZDSA 1N1SA 5GKAC 4E27A 4QD2A 2R041 1H0BA 1V70A 4HN1A 1Z7S3 3KM5A 1TMF3 1ASJ2 1PO22 1TQ5A 2YV8A 2GN7A 1R1ZA 3GALA 5C8CA 3WG4A 2D6LX 2EALA 1XNBA 2MNGA 5E16A 1RUC1 4LO7A 3OJBA 1CAUB 1QH7A 4M3CA 1EV11 4GQ7A 1O4TA 5IK4A 2RS53 3AKQA 3H3UA 3UKNA 5K0UA 3MIGA 1WUVA 2XBO2 5KHKA 5EYYA 2QDRA 3GBGA 2MEV2 1WLTA 3T1LA 5FOBB 4QGLA 5BNNB 1BBT1 4XFFA 1RJ7A 1ULCA 2D43A 5HBAA 2EXHA 2Q4SA 3HBZA 4CDQA 4HL0A 2VMHA 1RGSA 1PVC3 1DZQA 3VKOA 3ZYRA 2DFCA 3CF6E 4XF3A 4EN8B 2V5YA 4A3XA 5SV8A 3WW3A 4YW3A 1NE4A 3S7EA 3V64A 4KH9A 5FQ0A 1CESA 4QPGC 3OF1A 1PO11 2X53S 2BPA2 3GBFA 2B39A 1I5ZA 2BWCA 2W08A 2BGCA 2YMZA 4M01A 3KCXA 1BKZA 3G7DA 1BJQA 4K8FA 4XQWA 4FAHA 1V6OA 1QH6A 1RMU1 4M0NA 1G7YA 4FOQA 2DCZA 1VBB1 4TZDA 1KITA 1RHI1 1IS4A 1ULGA 1C3HA 4CEWA 5FPZA 4A7KA 2E7QA 1LR5A 1UPSA 3EHKA 4COUA 3AKRA 1WMFA 2XJSA 1R093 3SNMA 1G9FA 1UCXA 4V1PA 2ZMLA 3SCFA 3ZFEA 4BWOA 4BQ1A 3N35A 3VBOA 1J58A 3R6SA 4PLNA 3I54A 4K7JA 3TWIA 5T55A 1A8DA 2W68A 2P3JA 2VVFA 4FP3A 1RHI2 2W52A 4COYA 1LRHA 3PVBB 1W2UA 1SFNA 2JG8C 4CDWB 1WGPA 1FMD3 2NN8A 3R4UA 1OQ1A 3WY6A 1EAH3 1NY72 5GJ6A 1NCQB 3VL9A 1JBCA 4XJUA 3ILRA 4UBHA 2WQ4A 4UXAA 4YZ2A 1AXYA 2JG9A 2ZKLA 3RYPA 4CDXB 1TNRA 1NZCA 4C0BA 4K3UA 2XBO1 1O3TA 3MEPA 3E6BA 1NCRC 2HWF2 3VHPA 1HXS3 3H3ZA 2HWD2 3FLRA 2ZGOA 3M3QA 4TYSA 2DUQA 1SLAA 1C8M3 2HWE3 4YW1A 4LHNA 4TWTA 2EVXA 3NAPA 3V56A 2ZZQA 3K51A 1MACA 1VBE2 4CDUB 4NHLA 2DURA 1UKGA 2XKOA 5C6CA 3I4IA 2XWBB 4XFGA 5LRSA 4FPEA 3NWKA 3O12A 5BNOC 5AFBA 3INAA 3OD4A 3FJSA 1UMZA 4RS5B 3J8F1 3KQRA 5BNNA 5JZGA 1LCLA 1QJU1 2GMEA 4AVCA 4Z92B 5JOZA 1MEC1 2PYTA 3QLQA 3I59A 1RUJ2 2CAUA 1WLWA 3TOJA 1V6KA 5EJ3A 4U2AA 1VBE1 4HK8A 1AJKA 1WLCA 4NWVA 4OHXA 1JOJA 3JD72 5GZCA 4L9BA 1HW5A 1YO8A 4LBQA 1U12A 5FREA 1MZ6A 4G9SB 1H2NA 1H9PA 4YW4A 4CEYA 2AR6A 4GH4A 1HQNA