2HEWF

The x-ray crystal structure of murine ox40l
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
128
structure length
128
Chain Sequence
b'PPIQRLRGAVTRCEDGQLFISSYKNEYQTMEVQNNSVVIKCDGLYIIYLKGSFFQEVKIDLHFREDHNPISIPMLNDGRRIVFTVVASLAFKDKVYLTVNAPDTLCEHLQINDGELIVVQLTPGYCAP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tumor necrosis factor ligand superfamily member 4
publication title The Crystal Structure of the Costimulatory OX40-OX40L Complex.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cytokine
total genus 28
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2006-06-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2hewF00
2TNFA 3FC0A 4D7YA 5KWRA 2R6QA 5L19A 1KXGA 4G4FA 2KA3A 4HT1T 3K51A 1DG6A 1D2QA 2JG8A 5KC6A 2E7AA 2ZPXA 5TSWA 2WNVB 2X29A 5HBAA 2JG8B 4OULA 2WNVC 3B94A 1PK6B 1DU3D 1PK6C 4N90A 4QPYA 4QQOA 4QQHA 4DB5A 4QQ2A 3QD6A 3TYJA 3IT8A 3MI8A 2JG9C 1IQAA 2RJKA 4E4DX 2HEVF 2O0OA 1WCKA 2WNVA 1OQEA 2WNUB 3WD5A 4KGGA 2WNUC 4OUSA 1PK6A 4MSVA 4MXWB 1RJ7A 4DOUA 1RJ8A 1XU1A 1TNFA 2R30A 4QQPA 2OIIA 1JH5A 1D4VB 1KD7A 2JG9A 3V56A 2ZJCA 4TSVA 1I9RA 4KG8A 2R32A 2JG9B 1S55A 5CIRA 3L9JT 5KC5A 2Z5WA 4RSUA 4E4SA 2WNUA 3TWIA 1U5YA 2AZ5A 4MXWA 5L36A 4MXVA 2RE9A 1O91A 2HEYF 1OSGA 4G3YC 3B93A 4OUMA 4F3JA 2TUNA 1D0GA 2QDNA 2Q8OA 1GR3A 3B9IA 1TNRA 1C3HA 1C28A 4GIQA 3URFA 1A8MA 4J6GA 1ALYA 2RJLA 3K48A 2Q1MA 3LKJA 4KGQA 5BNQA 4QQLA 2QE3A 3AB0A 1XU2A 4EN0A 3ALQA 4NN0A 2JG8C 4TWTA 1JTZX 3QBQA 1U5XA 2HEWF 1U5ZA 3ME2A 1OQDA
chains in the Genus database with same CATH superfamily
2PHRA 1RUC2 4G9SB 4QX0A 2R073 4YZ3A 4CUBA 1NY72 2WZR2 4OMCA 1GFF2 5JXJA 3LZZA 4PLOA 4GB31 2IVIB 5GLUA 3VHRA 2YGMA 1WLTA 4AEDB 4B8EA 5KC6A 4WM8A 3KF5A 4FTSA 2JDPA 5F2SA 1QHDA 1GWKA 1QJY1 2I74A 3AKPA 1JHNA 5JSRA 2ARXA 2D6MA 5FK7A 3BB6A 2EVXA 2DBIA 1UZWA 1PK6B 1ZA4A 3PIGA 3T0DA 5JIUA 2O14A 1RUJ1 1PK6C 5C3QA 4NUBA 1GQHA 2E32A 5EXOA 5FTTC 1UYYA 4XAAA 3MIFA 4QQ2A 4DY5A 4XCAA 1V0AA 2RM21 5H9PA 2VC9A 3HNYM 2Z69A 4CZSA 1UMHA 5CFDA 3WG1A 4LIVA 3AP6A 2YG0A 1J1LA 1LOFA 2E31A 3SHRA 2BERA 1QOSA 2OA2A 3VBHA 5JWPA 3ATGA 4CEWA 3O0WA 3LCPA 5FMDA 1GP4A 5GJ6A 3WD5A 1FT9A 2KR2A 2R071 2WR9A 4HK9A 1LB2A 3LA3A 3LPGA 5J1XA 1QQP3 5D2AA 1X7NA 2VNOA 4CCLA 5CZKA 4EQVA 1WA4A 4C8DA 1UOFA 2JICA 2ILMA 4LBKA 3H3ZA 2YGLA 5DMYA 4LO5B 2NM1A 2GN3A 2ZCWA 4QPGC 3POSA 5FMOS 1FMD3 1WW7A 2OZ6A 4DY3A 1HRI2 3E5UA 3GYDA 4MGIE 1WGPA 2YHJA 2NQYA 3V56A 2JWPA 5A6ZA 4LHLA 4UT5A 2Y60A 2JD4A 5L9RA 3NJVA 3Q9OA 4UI9L 5E16A 4META 1GICA 5BNNA 4YW3A 4XPVA 2WNUA 5IVCA 4L9BA 2RS32 1LEMA 5T52A 3BALA 2ZMNA 4UYBA 1F9KA 5DZGA 3RZJA 4IERA 4XE9A 2L9LA 4D7TA 3DF0A 5EWSA 2PA7A 1H8TB 1D4M3 5CADA 4IGOA 1H8TC 4QDQA 1ENSA 1H6YA 4HANA 1W6OA 1WCDJ 1KITA 2HWC2 3KWVA 4XC9A 3O7OA 3UT0A 3ACHA 2V4AA 1OXCA 2HYXA 2WAOA 2D6KA 4KG0A 1OQ1A 2JDAA 3SEEA 3W9AA 3WW3A 1GZWA 1QQP1 2H6CA 3AZYA 5K4LA 3UL2A 2ZMLA 3ZR5A 1V6NA 4QB1A 1XE8A 3VBUB 4NIIA 3RJRA 3T4VA 1GWMA 3VBUC 3I3BA 2YBKA 1MZEA 4HVRA 4ZZ8A 1FMD1 1W06A 3OPTA 1QXPA 5C9AB 1NX9A 5HCAA 3CL1A 1VMFA 3VZJA 3SC7X 4B7EA 3GJBA 1UWWA 2VGDA 1DLCA 4HXCA 4R4ZA 4CEYB 4Z07A 4DRVA 3OBRA 3WUCA 4CEYC 3C7OA 4KNCA 1W6QA 5EQUA 5I8SA 1OF3A 4YARA 2A71A 2ZGMA 3WP3A 3ILRA 4UFMA 1MEC3 3PUHA 4FOWA 3WSOA 4NAMA 4BDVB 2A3WA 1S0GA 2BV4A 5FZ8A 1QJY2 2IVJA 1D4M1 1YWKA 2E7TA 4ISQA 5JOXA 2Y6KA 1O5UA 2WINB 2D6PA 1AJKA 3ITQA 2C5DA 3B7MA 4WVWA 3V64A 1G9AA 4FPLA 2ET1A 4G4FA 1UXZA 4Y22A 3OJBA 5C8WA 3RI8A 3WLUA 4DXRA 2RM22 2GNMA 2Y6LA 3V65A 2F17A 1YFXA 4QKNA 3WHTA 5LZ6A 1UY3A 3WDUA 5HBAA 2XJQA 2IXHA 2QFEA 3AL6A 4BIOA 4LBQB 1GUIA 2C6SA 3OD0A 4LLFA 5JVVA 3E5QA 5FMCA 2RVAA 4Y1YA 3VBFA 3WDWA 2R072 5M0TA 2BP6A 5IW0A 4A3ZA 5A6YA 4FPCA 1UPSA 2P3YA 2VQUA 5BNPA 3BOPA 1MEC1 3WNLA 5IAXA 2AR6A 1ACCA 2JDZA 3BCWA 3DV8A 4JDMA 3S0MA 4FTBA 1PO23 1YEWA 3WW2A 4DIQA 5T5JA 3WG3A 2LS6A 2X8KA 1BLZA 3OBAA 4S2FA 4Z1VA 1CAWA 5F32A 3U75A 4BOWA 1GSLA 1HW5A 3LPFA 1A78A 1QIQA 2XDVA 3RQ0A 3LSEA 1RJ7A 3I59A 5DUWA 3VD7A 1TNFA 5CFCC 1V9U3 4AGRA 2DVAA 4HOOA 4RL7A 4J1XA 4Y26A 1HXS3 2DBNA 4IEYA 5FZHA 4COVA 1C1FA 3RWKX 3D8CA 4WM7B 3RZGA 2GNBA 1VIWB 2XB6C 4MH0E 3N36A 3GBWA 4WM7C 1W8WA 2WZ8A 4Q0UA 4IEZA 3FLTA 4FQZA 4E8DA 1QQP2 1YQ8A 2A75A 3ACGA 3TB0A 4JQTA 4O9EA 4Y4YA 5FZKA 3MIBA 4IW3A 4TZDA 5EYXA 2F4PA 2VPVA 4NIAA 3S5QA 4OVEA 4EWAA 1OKQA 1FMD2 5FOBB 1PO21 5F7UA 1G9CA 1SEFA 4CTEA 4UW5A 3ZYGA 2W5FA 2JX9A 2BQPA 5F5IA 3I2FA 3QH6A 5FO9B 3N7KA 1DIWA 1SBEA 1EYBA 2PAKA 4JV4A 4I0AA 2CAUA 4NJ4A 2YBPA 1EPWA 1V9U1 1DLLA 4TXWA 1HXS1 4FPEA 2ID4A 2WO3A 4CA9A 4P9IA 1D4M2 2UWCA 2ZHLA 3L2YA 1HB2A 1NLSA 4LTAA 3U07A 2OQ6A 1UF2C 4YM3A 2A5ZA 1V00A 5A3PA 3VZMA 3UYJA 4HVOA 4LO4B 1QWRA 4NIDA 2W3JA 2IXIA 1VLNA 2R16A 4EN7B 3N35A 4QGMA 1DGRN 2QDRA 5A3WA 2B9UA 1UZVA 2ZHNA 4WZFA 4DRRA 4QB2A 1D7PM 1NXMA 1OOPA 1GOHA 2PHLA 4AFAA 2V09A 2D6NA 4JCKA 1NAEA 4BQYA 3THPA 1HJFA 3JB8A 2E53A 1REFA 5H9QA 2QJVA 2R6QA 1G9FA 4Y5TA 3EYPA 3PURA 5C8CC 2D7FA 1DGWA 2Q8EA 1VRH3 1H1IA 1Y4WA 2QKDA 3R4UA 1Q8OA 4RFRB 5HXMA 3PL0A 4GWJA 4JKKA 1DFQA 1MEC2 2Y64A 4HKOA 2FMDA 4M0NA 4MGYE 5TSWA 3FFQA 1XYPA 2W1QA 1PZ8A 1VJ2A 1ZZBA 1NLRA 3A23A 4K8RB 4QXKA 4BQ3A 1ULOA 3POEA 4GQ7A 1ZRCA 1VR3A 5B4XA 5KR7A 2PHFA 4OMDA 4Q0SA 4MHUA 1CZSA 4CDQA 3ZXLA 3JBG3 5LK7B 4ITCA 1IPJA 3RGBA 2I45A 3WW4A 1Y9GA 4Q4X3 3D5OA 5FP8A 1POV0 3AP7A 4GALA 4ZPIA 3MV01 3V0AB 1RL3A 2NPIA 1YC61 3CIHA 4AHYA 3POYA 4K1ZA 4L8QA 3SMHA 3NKTA 4MGSA 1KGYA 3GZTB 3DGTA 1VRH1 3OYWA 4CEWB 2C4XA 2ZOEB 4U36A 1OC1A 4CEWC 3WNNA 1C8M3 2A6ZA 5GM0A 3ZVXA 2MNGA 1J3QA 2JG9A 4OQ8A 4HONA 1PO22 4ZXEA 4XDQA 5FY0A 2VOVA 4FBFA 4IGPA 2IXCA 1PZ7A 3KT1A 4DEQA 1Z7S3 3D0JA 5EP9A 1VP6A 5IVVA 1NE4A 3H1WA 1V9U2 3IDAA 3WW1A 3NRUA 3JBG1 5BNNB 5L36A 1HXS2 4NROA 5C3PA 4A42A 4CPBA 3OOXA 2D3PA 2IXKA 4W6XA 1W6NA 4Q4X1 2YY1A 3CHXA 2ZEYA 3N7JA 2ZX3A 4PLNA 2V5DA 2BU9A 1FX5A 2FZ1A 2W68A 4RQPB 4XMAA 4RQPC 2X5IC 1SQ4A 1GZCA 4R8HA 4Y5SA 1W6OB 1X8EA 3B9IA 4FCAA 4P9LA 5LATA 4XJ8A 2WIIB 3MPPG 1GWLA 1C8M1 1CAXA 3AKTA 2VY0A 1V6KA 3W5MA 4HPKB 1GZWB 2Y6FA 4EZHA 4J6GA 2RJ2A 3CBNA 5DUVA 4PI2A 2XG3A 2ZKLA 2X05A 3USUA 2R0FA 4UW6A 4CCKA 2ZXQA 1DQ1A 5GZDA 2NLRA 2AUYA 4SBVA 5LA0A 4LA2A 4RA0A 3B01A 4KWUA 1Z7S1 3IPVB 5FZ6A 2AEZA 1CX4A 2SLIA 1SFYA 3J7MA 3WDTA 2YC2A 1XNDA 3MFAA 5FZEA 1MPXA 4AG4A 3ETQA 5HCHA 2VXRA 4LKSA 2Y0IA 4JC1A 4XFCA 4HKLA 5FYBA 4QMAA 1OI6A 4CP1A 5GZCA 2ARBA 4EROA 5FZOA 2D5FA 5F8PA 2VCMA 1UZYA 2XLFA 4YZ5A 1GOFA 2JECA 1H30A 1M4WA 4YW2A 2A6XA 4NWWA 3PU8A 1UYPA 5GLWA 2BVVA 5FUNA 2BFUS 3VBSB 3BTAA 1XNCA 3VBSC 4AZZA 3T1MA 1UAIA 4UW4A 1CONA 1TEIA 4XXAA 4BM8A 2ZEXA 4NPMA 1GMMA 3MYXA 1GP5A 1VRH2 2W87A 2Z42A 1N1YA 4XACA 4LMFA 2JIJA 5DDJ2 3WP5A 4BIFA 3NQHA 2LRPA 4P9YA 2XKOA 4FXKB 4QHZA 1W04A 2BUKA 3AZWA 2B4KA 4COZA 2BBVA 3J9SA 4XF4A 5A1FA 4CE8A 3VDBA 1DBNA 2VQ0A 3OTFA 3RS6A 3VD4A 2BNNA 3OUHA 1W9WA 3UK9A 1PK6A 1PGSA 1V6OA 4X8NA 2OXBA 2XHNA 4MSVA 4MXWB 2Q5TA 2RV9A 3HR9A 2WN3A 3PMEA 4I0BA 1CAWB 4CRQA 3MFCA 3ZN6B 1VB2A 2BZDA 3H7YA 2OIIA 3JBG2 4LUKA 2ZEWA 1J84A 2EXHA 2ZZJA 3RYPA 4AOCA 4Q4X2 1RUNA 4Z2AA 1DQ5A 3E97A 3FLPA 2ERFA 5DG2A 4YLZA 1TZOA 2ZGKA 2E63A 4KG8A 4BXFA 3DKQA 1K12A 1UPIA 4LNVA 1STMA 3NJZA 2HBTA 4FO9A 4LBOA 1SLAA 3E6BA 1ZM1A 4WV8A 5LCWL 1LJ7A 5EFUA 3I2JA 3WNKA 5H9RA 2WRAA 1C8M2 1BJQA 1UD1A 2E7QA 1SACA 2V72A 5FPVA 3U78A 1PM4A 1GNHA 3CO2A 1OSGA 4QPGA 1JZ5A 1LGNA 4ES8A 5CKQA 1BZWA 4XFAA 2RDSA 4CU8A 1AR63 1D0GA 1BYHA 1F4AA 1RUE3 1UX7A 3T2QA 4BQ2A 2QQOA 3ILNA 2XQXA 2CV6A 3GF6A 2J1TA 1QOTA 1DQ0A 5A7QA 2YC4A 2DCYA 4XJUA 3WG2A 3A22A 4JGZB 5FBJA 2VVFA 4JGZC 1A8MA 2FCTA 3OG2A 1DYKA 4XTMA 3DL3A 5JUVA 4P9WA 1H8TA 1S0BA 2WA4A 2W47A 5FLHA 1JZ4A 4MG2A 4L92A 3ZDVA 3HVDA 5HCBA 3LQCA 3GZEA 5BNQA 3KCYA 4LBMA 3RYRA 2W9XA 3SLIA 3HNBM 3K4ZA 2K46A 3SH4A 1DGLA 2YZ4A 1BMV1 1BK1A 2XVKA 5ABJB 2D93A 2WBKA 5IJRA 3RDIA 4X6RB 3ZXFA 1LOGA 5ABJC 4XF3A 4C1XA 4BYYA 5FIXA 3VBUA 4W4ZA 4IEXA 1OVSA 2C24A 4ONUA 4PQQA 2TNFA 2A6VA 5KWRA 1WLWA 4W6WA 1Y9MA 4LJHA 1AR61 2D44A 2VBBA 2XLAA 1RUE1 3ZYHA 5CA6A 4AWDA 1OLME 1RYYA 4XAEA 3ZXAC 1V6JA 4IEPA 1DG6A 4LR4A 4UF0B 4ZS3A 4CEYA 4CCMA 2P6CA 4E4HA 2JE7A 4NHYA 2V5YA 3J8F3 3U0ZA 3MF9A 1RITA 3M8LA 1GZ9A 1JU3A 1VRBA 1RUH3 1H8VA 1UIJA 1YLLA 3A0KA 1DYOA 3ZFGC 5DAPA 2JEMA 3WCRA 2XL9A 1QU0A 4E9KA 5FLJA 4DUWA 3MIDA 3CLPA 2XLGA 4N90A 3T3YA 4AHZA 3C7FA 2D5HA 1CGPA 2BGPA 4XF9A 3VZOA 2TBVA 3BTXA 3N9OA 4OHXA 2A1XA 3FHAA 1XQNA 4QKBA 3AMHA 4L2NA 5FUPA 1VBC2 4BHPA 2F4LA 1JW6A 4P00B 5HCFA 3UGGA 2J1VA 3CDZB 5A7SA 4CDQB 1SLBA 2VMIA 4QX1A 1LAJA 2DVBA 2WNOA 4AR2A 4DXTA 3K3NA 1G86A 3VGIA 4IE0A 4LBQA 3WP4A 4BU2A 3FWEA 1SHWB 3FBMA 4RR3B 1ZVFA 5KXDA 4RR3C 1CD3G 3WXPA 3NNJA 3ASIA 2UWAA 2JDNA 1B35B 4HN0A 5JXGA 1CAUB 5EIYB 2QVSB 1V6MA 3J8F1 1B35C 5J3UA 1JZ7A 5ISLA 2FCVA 1G6NA 1NY71 5FP7A 1RUH1 3BUCA 2DUOA 2DVDA 3PHMA 1RB8G 5F5AA 2R32A 1S2BA 2JG9B 3WNPA 2JD9A 3ZPOA 4P02B 4RSUA 3UESA 1HDKA 2X10A 4W65A 4D3WA 4TYSA 2BVBA 1F8VA 2D6LX 1NE6A 4Z8BA 2J1AA 2WN2A 4HBNA 4CXYA 3MBWA 5CFCA 5AFEA 4FPOB 1WW6A 1Q5OA 2B45X 2GAUA 3KV4A 3M7AA 4XABA 4F3JA 1NUKA 4K20A 4LUMA 2GH8A 1NA1B 4XJ9A 3VZNA 4N43B 3I3DA 4WM7A 3NWKA 5K7PA 3AL5A 1XOYA 1NA1C 4UWDA 4FFGA 3IIIA 1UW8A 4N43C 4DUXA 2ZGTA 2QQIA 4GXLA 1GLHA 1BMV2 1LOAA 5JPMB 4LBJA 4GIQA 2GP3A 2MHFA 4NMIA 1EV13 1UY4A 3RMXA 5F3GA 1SCSA 1RUI3 2VL4A 2YUEA 1AYM3 2B7YA 3KS7A 3PUIA 4LOSA 5FPZA 4AFBA 4AEKA 1LESA 3NW4A 4EJRA 3D4KA 3OPZA 4FT8A 5IYYA 3LKJA 1AR62 1RUE2 2ET7A 5JZGB 3ENRA 1X50A 2D3SA 2B5HA 2YMZA 1O7FA 3KCCA 3N7MA 4AVSA 1KDKA 5JZGC 4FOYA 1QDCA 4XXPA 1L7QA 1F31A 2NMNA 1ST8A 1QF3A 1ZX5A 4XQDA 2K2SA 3KSCA 1SZBA 4XDOA 4Q0VA 3ZYRA 3T2PA 3EB7A 5GLZA 4Y1XA 3RZKA 3ZSMA 4IE5A 5ANQA 1HRV3 2VM9A 1IKQA 4I3GA 3VHPA 3KV9A 4RGKA 2DWRA 2I2SA 3ILFA 3VDCA 3WR0A 3MV11 3JD73 1PVXA 2OKXA 4AFMA 1QJFA 1LEDA 4R4XA 4C0BA 2PYTA 3FX3A 3ZIWA 5CG9A 2HH9A 3SCFA 2E26A 2B46X 1EV11 3VV1A 4CU9A 4CXWA 3MIEA 2YBSA 4LHNA 4DXZA 1RUI1 5IVBA 3THCA 1AYM1 4NAOA 3I3MA 3DXUA 3CZUA 3T4HB 1WD4A 4QX8A 5C8CA 1HKDA 3DYPA 3IZOA 3DCQA 3S7IA 1PX4A 2P3IA 3IMNA 2P6HA 5BUVA 1IG0A 1AXKA 3IDEA 5CKMA 4P5YA 4Q5OA 1S2EA 3PVEA 3S57A 2YU1A 3J8F2 2VVDA 5I0UA 1EAH3 4Q4V3 2VD7A 3KT4A 4XUOA 1RUH2 1XE7A 2ZA9A 2VMHA 1V6LA 3A7QA 1QKQA 1O3SA 3BODA 1HRV1 1GU3A 2O0OA 2DCKA 2DUQA 3WDYA 5C4WC 1W90A 3T2OA 5IVFA 3T2TA 1BQPA 2XONA 3GM8A 3RRDA 1ULDA 3JD71 1HQWA 4HMZA 3AKQA 2RR13 1X9PA 3H8RA 3H9AA 4C90A 4INDA 5LEJA 4B1MA 5K9YA 1W9TA 3ORJA 1K45A 4ZS2A 4TSVA 1O3QA 4DO0A 3RG0A 1CZTA 3O5SA 1LU1A 1VBB3 2B42B 2DUPA 2Z5WA 3U1XA 3O12A 2GMMA 5FPBA 2VZ1A 1O5LA 3P3NA 1Y7BA 1JYVA 2XWBB 3V0AA 4FFHA 3IDBB 5T50A 1N47A 1JXNA 4D7SA 1VB4A 1G9BA 2VW2A 2VZSA 5A1LA 2W92A 4XUTA 3VBOB 5F9TA 1C5HA 5FDBA 5FZ9A 4URTA 3VBOC 3T1LA 1EAH1 4Q4V1 4F83A 2BJSA 1DGWX 1DQ6A 1QH6A 3T0AA 3HT2A 4B1LA 4XQ4A 5B2GB 1HN0A 1SPPA 2HWD3 2A6YA 2BRTA 4QPGB 1GR3A 3SKJE 1YFWA 4GULA 2RR11 2RS53 2XBO3 3FE5A 5IATA 2P34A 1IGOA 2Y26A 5APAA 4Y20B 5FY8A 1VALA 4BE3A 5KXCA 1ODMA 2PFWA 5K0UB 3LA2A 1T6GC 1I5PA 5FLIA 4DNYA 3IN9A 1GOGA 3EHKA 5K0UC 4XFFA 1KJRA 4QGLA 2PAMA 5LY1A 1F15A 1C8NA 4I0WB 4PLMA 1VBB1 5LA1A 4RQPA 2X5IA 1C57A 2XUEA 1SLCA 3ALQA 1UY1A 2JG8C 2VZQA 5KBFA 1W6PB 3OGVA 3ZFFB 3VD3A 1WZXA 4AI3A 1JMUB 1U5XA 3ABZA 5EYYA 3ZFFC 1YRZA 4AI1A 4BQ1A 1UX6A 1EV12 1H6XA 5JMOA 1SMVA 5FYYA 1BKZA 3TN93 1RUI2 4HPKA 4CVUA 1AYM2 5JXHA 4GD4A 5FQ0B 4GMP3 1OQDA 4Z2WA 2CWSA 4L11A 4K40A 2HWD1 1AXZA 3VB9A 2H6BA 2UY9A 4OFGA 3CZJA 1W03A 4L99A 1LRHA 5T5PA 4RD7A 3JU9A 1VMHA 1UZ0A 2RS51 2XBO1 1MS1A 3KT7A 4XJZA 5FK8A 2DCJA 3IPVA 4Q29A 1VBE3 3WF1A 1WD3A 1JOBA 2G1MA 2X29A 2SBAA 1FPN3 4XUPA 3VKLA 1HRV2 3AX4A 4N7UA 1YQ6A 2GNTA 1GKBA 4N7IA 4R9AA 3W20A 3Q8BA 2NYYA 3JD72 3H1YA 2E6VA 2DYCA 3GGLA 2Y6GA 5FZAA 3WHUA 2PHWA 1IS4A 5JR7B 4M4RA 1SFNA 1WCSA 4BPZA 4XETA 5F5QA 4XIOA 3FFZA 4NRPA 3QACA 5D8AB 4YG3A 2ZZQA 3AXDA 4CP2A 4YZ1A 4GWIA 3TN91 5D8AC 5CKNA 2AYHA 1AHSA 2WC2A 4HG6B 3C8XA 3VBSA 4GMP1 2CWMA 3OSDA 5FO7B 1PVC3 4XMIA 3JUUA 1NQDA 2VMCA 3SKVA 3CEWA 2ZACA 4Y1VA 1A3KA 3N9QA 1UOJA 3FUOA 1OLMA 4NPLA 3RZHA 5BV6A 1ULCA 3THTA 3N9MA 3H8OA 1EAH2 1XYOA 4Q4V2 1GP6A 1VBE1 4KMQA 3TAYA 5FYHA 1FPN1 1W99A 1JYNA 5C5UA 2W0XA 3AYAA 5I8TA 2RDNA 1N3QA 3J4UH 1J59A 3AP9A 3L2HA 2W91A 5CNAA 5FZ4A 1YIPA 3HJRA 2JDHA 1LHOA 4FOQA 3UJQA 3WQ7A 2G19A 2RR12 5A80A 5LW9A 4PDWB 5J37A 2ZX1A 2VH9A 4H7LA 4MXWA 4C0HA 4PDWC 1ZREA 3ZMOA 2PHDA 3ZN6A 4FP2A 4F7ZA 2RG4A 5AC93 5CFCB 2PMWB 2ZX4A 3B93A 3AMNA 4R9CA 5ANNA 3W21A 3ZFGB 1W05A 3PNAA 2VE1A 1LECA 1PVC1 1VBB2 2ETEA 2GH2A 3POWA 4I30A 4IEUA 4JGYB 4Y3OA 5DG1A 4OHZA 1JZ8A 5DN2A 3CJIB 2CGOA 4JGYC 4O61A 4QHOA 3ZYIB 2A70A 4ARYA 1QJEA 3CJIC 3NKGA 5IVYA 5ERLA 1POQA 2BNOA 2WFF3 2V4VA 2XOMA 3RJ2X 4FPHA 5IFPA 1LGCA 4LKDA 4MYEA 1MR5A 3I7DA 1ALYA 1Z0HA 3NSTA 4K9SA 1R092 3PVBB 3GCWA 3FJSA 3K48A 5FYZA 3WQ1A 5IK4A 1ND3B 2D43A 3MW4A 1HV0A 2ZS6B 1ND3C 1ZNPA 1HN1A 2HWD2 2DV9A 4HKWA 1HQNA 2OZJA 2R49A 2XKPA 4OUEA 1URXA 3VKNA 1PMJX 5FOJB 4V1PA 3ZFEB 3N7LA 5E1RA 4NN0A 1Z78A 2RS52 1NCQC 2XBO2 1S4CA 3Q8FA 4JAAA 3ZFEC 4R52A 4XJAA 3ZX7A 3TEZA 3HPNA 2GC1A 1XRUA 2OQ7A 1DZQA 2VECA 3AM2A 4JGZA 5LASA 1ULPA 5AC91 5HPOA 5I0DA 3GHNA 3B00A 1GYKA 4Q27A 1W2OA 3I3QA 4A7ZA 1YJKA 5L19A 1MS8A 5T5LA 4Q4W3 3V0BA 1FXZA 5FMBA 3T30A 4QKFA 3LEIA 3ZN5A 1BVVA 4A7YA 2ZGNA 1W2TA 3KZ4C 1RC6A 2KD7A 2WFF1 5F5CA 3PTYA 4DFSA 3SH3A 1H2NA 2QQWA 5I91A 5ABJA 2XJPA 1UO9A 3TN92 2Z79A 2CU5A 2ZGPA 3LD8A 3O1UA 4RFT0 1MVQA 1YYNA 3G7DA 4BXSV 1MVEA 1ULEA 5F6LB 4BQXA 5KHJA 5DZFA 1AYN3 2GC0A 3AZXA 1NG0A 1JYCA 3ZYPA 4H14A 3GBFA 5T54A 3QOPA 1O4YA 3NO8A 4U2AA 5BYNA 1JOJA 1TE1B 5C8CB 4JX0A 5CYYA 3M70A 4UF0A 1AX2A 1IQAA 1PM7A 1ULFA 3N9LA 4WVZA 5JSPA 1VBE2 4AF9A 2JKXA 4JHTA 1JYIA 1YQ2A 1FPN2 2VNRA 3CNAA 4LOTA 3KQ4B 5DDJ3 3LOBA 3NNLA 2UYAA 5LK5A 3AK0A 5CU1A 3JQXA 3M3QA 4DMIA 4Q4W1 4YVWC 1AX1A 1P8JA 4YYOA 4DOUA 3WUDA 2CDOA 1K42A 1RJ8A 1XSQA 2VOWA 5A7PA 1OF4A 4MGQA 4AVCA 4F8AA 1IKPA 3M4FA 2VU9A 4XFIA 4A4AA 1RUOA 2EXJA 3CJXA 4DXSA 3AKSA 4YW6A 3GZUC 4IEOA 3ZIXA 1XPWA 1QJU3 2CSGA 1Y43B 2HJIA 3DXTA 1RMU3 2ZX0A 3OD4A 1CQ9A 1W8ZA 4J1WA 4AI9A 1PVC2 1R1ZA 3BOWA 3O0VA 4QDRA 4LXLA 1AYN1 1LOCA 3I2KA 5DXDA 3IKWA 1REDA 3I49A 2VMEA 1RGSA 2XJRA 4RR3A 2LALA 2H0VA 4EN8B 2EXIA 5KHIA 2HEYF 3H8UA 5DABA 1B35A 3H42B 4MOAA 4Y4RA 1CAUA 3MLKA 2WJSA 4H3WA 4K8FA 4NHLA 1YJLA 4Y1UA 4EN6B 3ZXEA 3LE0A 2JE8A 5DDJ1 5LWBA 4AVVA 3USSA 4QPIC 3AMQA 2Y8KA 1WW4A 5LBEA 2CGPA 2Q8OA 3C7HA 1LENA 5C3RA 1ZRDA 1WMXA 3ACFA 1SPPB 1PZ9A 1COV2 3PTRB 3H7JA 5FREA 1VAKA 2XHKA 1C28A 4GZ9A 1I5ZA 4PJYA 4Q1RA 5IT6A 2GSYA 4NWVA 2Q8CA 5JXIA 3P3PA 2BGOA 1ZZ7A 3PJQA 1ZRRA 4ORFA 3CMGA 5AC92 4WVMB 1XNAA 2XJSA 4HK8A 4JRLA 4XOGA 2OS2A 2K0GA 1DDLA 1RMU1 4XF0A 1R1A3 1ZZCA 1Y3TA 5A7NA 4FAGA 5LBBA 2BFUL 1US3A 2R063 2XQRA 2D3RA 5I0RA 5L7OB 1MQTB 1NA1A 2BEOA 4FPJA 4N43A 5L7OC 4K1YA 1MQTC 3M3EA 4UXAA 1VE0A 1HX6A 1F5JA 1YFYA 3POJA 4MO3M 2WFF2 1UKRA 3VKFC 3OUJA 2NP0A 2X5IB 2IZWA 2QBXA 3U4XA 3NVCA 1WWYA 1FATA 3ZO0B 2BOIA 2ZGUA 5F3EA 3HBZA 1HB4A 2X53S 5FZDA 4OLLA 2DFCA 4CCNA 3APBA 2XUMA 4D7YA 3OUIA 5J09A 3U10A 3DECA 3IWZA 2GP5A 4JHZA 2CYFA 3T0BA 3A0NA 3RWNA 1AZDA 5FXVA 5JZGA 3MLJA 3UGFA 3NMBA 5LBCA 3BN6A 3VL8A 2DCZA 3NV4A 1EPZA 1WMDA 4KQ7A 4I01A 4I02A 1R082 4YGDA 5FBZA 5CISA 5BPXA 1WBFA 3E6CC 1QY4A 1R1A1 4QU2A 1WLCA 1KEXA 4XIKA 1C5IA 4A2UA 4AHXA 4Q4W2 5KHGA 3VHOA 2R061 2P3JA 2ORXA 2QQUA 1A6CA 1AUYA 3OGSA 4JTOA 3I97A 5JPNB 2EALA 3C2UA 3JB4C 4GH4B 4RYDA 4V2VA 3D3AA 3B9CA 1PNGA 1OUSA 1PX3A 4GH4C 4QXHA 4KU8A 4AI2A 4CPBD 1ENRA 3ETPA 4RGGA 2RMU3 1ENQA 2WUHA 2VZ3A 5FZIA 4MGTA 3FL7A 2HEVF 2VQAA 3C7GA 4XYXA 4HZFA 2JJ6A 3T09A 1BBT3 1WCKA 4ATEA 2BWAA 2RDRA 5I93A 1M06G 5EJ1B 3SNMA 3NV1A 4QX2A 1VBC3 1AYN2 3BTZA 4UFKA 3MIGA 4I09A 4PT6A 2VULA 1YI9A 2A73B 1XU1A 1WW5A 2VMGA 1GNZA 3EJKA 3K46A 2VO5A 5C3SA 2J1UA 3KMHA 2Y38A 1OHFA 3O1VA 4P5HA 1UZZA 3SEPA 1PGW1 1LR5A 1U12A 4CU7A 5JR2A 2Q30A 2XL7A 2LTNA 1B09A 4HN1A 3POFA 1CWPA 2MPFA 2IWGB 4FP3A 4XJWA 3CU7A 2GALA 3IM0A 4NPRA 4CCEA 3H3UA 5C4WA 2K9ZA 5DAQA 5FZFA 3PIJA 4YFWA 4IV1C 1AVBA 2ZGOA 2I07B 3R6SA 2QQPA 4H7MA 1TG7A 1NQJA 1S0JA 1FYUA 2RMU1 4NO4A 1EUTA 4P9JA 3LWCA 4XTPA 4XHXA 4Y33A 1QJU2 4B4PA 3VN4A 3NV3A 1ASJ3 1E5RA 2DFBA 2W1WA 3BTYA 3N4MA 1RMU2 1BBT1 3U11A 4MHRA 3AYEA 3LDBA 3R0RA 4NOTA 2GMEA 3SCGA 2QDNA 3HIFA 1S1AA 1VBC1 2UU8A 4NRMA 3S6PA 4IE6A 3VHNA 4JRAA 1ND2B 3INAA 2HKXA 4YW5A 3RPQA 1BHGA 1Q8PA 1ND2C 2HBUA 1H4GA 4JTNA 4EWEA 3R4DB 1W0OA 3OY8A 4K3UA 1WLDA 3Q8CA 3VBOA 1XYNA 1CZVA 5EV7A 2JKBA 4O9GA 3VDDB 3TEYA 2P37A 3VDDC 3FHQA 3O1PA 1QMJA 1TME2 2BOJA 1JZ2A 1YNAA 1X33A 3D6EA 1O3RA 4CDWB 3TEXA 4B7KA 1MACA 4S2HA 1JUHA 3OGJA 4P9GA 4CDWC 3HQUA 1DZRA 2A3XA 1N1VA 3ZMNA 1PMHX 1H2LA 4Y20A 3LEKA 1X8MA 5F1RA 3ZSEA 2WO7A 5K0UA 1QXJA 5T3NA 1ASJ1 4P9XA 4XUNA 2FDGA 3B69A 2JDUA 4UBGA 1R1A2 2OX0A 4UFIA 4I3PA 1QEXA 3DPRB 3I2OA 2R062 5J36A 4FSJA 1KXGA 1EUUA 1AL23 3DPRC 3KGZA 4HT1T 1DP0A 4XFGA 3Q8EA 1JZ6A 1D2QA 1ONAA 2JG8A 3V0BB 3WVJA 1NZCA 4Y1ZA 4QT6A 5HV0A 4FOVA 2E7AA 1KDMA 1W6PA 3KCXA 3ZFFA 2G9ZA 4AVAA 1S0CA 1E5SA 4XVHA 4LBLA 3WY6A 3U37A 4AVTA 5FQ0A 2IUWA 5IK8A 3WT3A 4L97A 3ZN4A 3A4UA 1UCXA 1CX1A 1VAMA 2BTVC 2R1BA 5A3NA 5C71A 1SBDA 2ATFA 2QQVA 4OCTA 3FHIB 2IFRA 2P1BA 3AZZA 1PGW2 4IEQA 2WZEA 5LBFA 4IETA 4IUGA 1CPNA 5DQ0A 1Q8SA 5FZCA 4UFJA 3AFGA 4XUQA 1IQDC 4KL1A 1HIXA 2YPJA 3SH5A 2GC2A 2IXLA 1AL21 3NV2A 3OB8A 2XJVA 4CU6A 1H0BA 3CKHA 4X8PA 4NHKA 3LDKA 1FNZA 4OYUA 3HQRA 1W2NA 2W1SA 5IHRA 2RMU2 4YZ2A 5FAXA 1NT0A 4D94A 3IIAA 3RMYA 3LA7A 3I2DA 3JZVA 5D8AA 5F6KA 1BBT2 5I8YA 3U14A 5FZBA 4FFFA 4NIGA 2W52A 4E4SA 5FZGA 2FMYA 2VZTA 5DAWA 4OI0A 2P5BA 3S7EA 3TWIA 1OT5A 3HQXA 3RZZA 1CPMA 5D21A 3ZKYA 4DINB 2PLV3 3VBRB 1IZ3A 2CY6A 3GJAA 1LOBA 2ADDA 4MGKE 3VBRC 4COYA 5FJKA 1AR83 3K2OA 4E4ZA 1MS3A 4AI8A 4LA3A 4LE4A 2XVGA 3BIWE 5FV3A 4IE7A 3RNSA 2CTVA 3RYKA 3W5NA 4PBPA 1QNYA 1A8DA 5FYTA 2FHRA 2ZHMA 3AXEA 4B4QA 4OHYA 2E33A 3EBRA 3BKZA 3ZR6A 2ZTNA 1LHVA 2WFPA 5FWEA 4EWDA 2J7MA 4ZHNA 2RS13 2GC3A 3D0SA 4URAA 4A3XA 3S5AA 2IXJA 4PDWA 4GWMA 1IS6A 1NLQA 1Q8VA 3KVAA 4TTGA 2RJLA 4RS5B 3LIHA 4YW7A 1UY2A 2VBDA 3QCWA 1W8NA 5FYVA 4RS5C 5SV5A 1ASJ2 2ZABA 2VBPA 1HV1A 5BY5A 2HYKA 4PHZA 1W2AX 5SV8A 1XNBA 1OLRA 1UY0A 5FXXA 4YPJA 1YIFA 3I3EA 1W8UA 1MS5A 3TRSB 1CJDA 3MDPA 4K7JA 3H50A 3ZFGA 4CDUB 4Q0PA 2ZAHA 4JGYA 5JAXA 4CDUC 4TN7A 1O8SA 4QXBA 1H9PA 3CJIA 1TMF3 2PLV1 3BU7A 1E5HA 3LIGA 1UMZA 3UETA 1AR81 1J58A 4CUAA 3BI3A 5FXZA 4QB6A 2WKKA 5FJHA 4LITA 2FDHA 3H1MA 1KRIA 2FBEA 2O8OA 2QQMA 4PCRA 1HB1A 1ND3A 4LBQD 5FFOC 4ASKA 3VUOA 3A21A 4LK7A 3I2IA 3O1MA 1JS9A 1IG3A 1LTEA 2DU0A 3GNEA 3HNMA 4GJZA 4LK6A 5FZ7A 2E51A 3VD5A 4SLIA 3PVOA 1K5MB 5FZ3A 4N53B 4D8MA 1NCQA 3ZFEA 1U5IA 3RSJA 1K5MC 2RS11 2NMOA 4N53C 1H1AA 3ZSLA 2JB8A 3K75B 1UNBA 5A3MA 1OA4A 2LROA 5IK5A 4FQ4A 1UN1A 3RZMA 3IB3A 3NAPB 3B94A 5JOZA 4DEVA 3TBDA 3NAPC 2WT2A 4GJYA 4QQOA 4MLOA 3S30A 5AVPA 1AL22 1UU5A 3GALA 4HVQA 1T2XA 2BNMA 2ARAA 3H3LA 3KV6A 5JI9A 4QM8A 1TMF1 1WKYA 5DUXA 3WCSA 4YWAA 5JMCA 5LA2A 3JXSA 3RZLA 1H2MA 2RJKA 1UXXX 2KM2A 5JLVA 1OURA 4XDPA 5HXVA 3HAGA 4KGGA 4N9HA 3ZXJA 4PBOA 5G05L 1PHMA 4BK4A 4EYUA 1VBD3 3EXUA 4IV3B 2EA7A 2WO1A 1IS5A 4IV3C 5T5OA 3DYOA 2ZGSA 3LEGA 4IL7A 2DU1A 2DTWA 5FMOL 1C4RA 4M3CF 5FUIA 3VZLA 1KS4A 5BNOC 3PJYA 2Q1FA 1GBGA 2VW0A 1KS5A 3K4AA 2VZRA 3BYWA 4XBLA 5KXEA 4QKDA 4A41A 5KC5A 1FNYA 4AQSA 4ATFA 3I8TA 1OPOA 4YVWA 2OPWA 4A6OA 4MVTA 3OPWA 3SCHA 3KHBA 4YGBA 4ASLA 4XEZA 5E8AA 5C4WB 2VZOA 3LAGA 4HFSA 4A44A 2VNVA 3EQEA 3NNFA 4XZUG 5L9VA 4YVSC 2QQKA 2YU2A 4DUVA 2ZAAA 2AACA 2CL2A 4CP9B 1DCSA 1FOD3 1IPSA 3KD4A 1WBLA 1G7YA 2VUCA 3ON7A 4ZU7A 3J7LA 5FPXA 3O1SA 1I3HA 4LULA 5FCCA 2B9VA 5FYCA 2IC1A 5J98B 3C3VA 3KGLA 4M01A 1UOBA 5FPUA 1VBD1 2W39A 2Y6JA 1RVF3 2PLV2 1OFSA 4XBQA 2GNDA 3FMGA 2ZGRA 5J48A 3ACLA 3I2GA 4XF1A 1UQXA 5FO8B 5A3TA 1AR82 1S0IA 1AL0G 1AR93 2JENA 2NZ9A 5FYIA 4AVBA 3CQOA 4QM9A 4YW1A 1ZZ6A 3WX5A 3OY8B 4AEDC 2FDJA 1N3OA 1PO13 4FPKA 4QPIA 3AB0A 3OEBA 1BEV3 1SFPA 2YFUA 1R093 2BDRA 2PHUA 2Y6HA 4TWTA 4NR1A 1SLLA 1W8OA 1H1MA 4CCJA 2RS12 2VCAA 4BZ4A 1U0AA 1U5ZA 4C1WA 4XCBA 4ZKTB 3RI9A 3IAPA 1XSRA 2XPJA 2VJXA 1F2NA 1FOD1 3FC0A 4N9IA 2VW1A 4WVMA 4YGCA 1POV3 2WSUA 3HBKA 2YV8A 1OFNA 1N1TA 4Q26A 3LEMA 4WVVA 2W1UA 1PIV2 3MHZA 1PGL1 2J1RA 2UY8A 1AX0A 5F3IA 3M3OA 5L7OA 1KJLA 2WL1A 1MQTA 4FPFA 5G04L 1TMF2 1J3RA 1RVF1 2ZPXA 5C5TA 1RINA 4KI5M 4LHKA 1RXFA 2WNVB 4JQRA 2JG8B 3HEIA 1QJX3 3WOGA 1AR91 2ENRA 4OULA 1CIYA 2WNVC 3E5XA 1BK0A 4YNIA 2JDKA 2Z2SB 3BPZA 3GBGA 3ZYBA 4AQTA 2VZVA 1PO11 1XJAA 1W9SA 4PIXA 1FV3A 4IXLA 1BEV1 4JKMA 1ZA7A 1R091 4BWOA 4S2DA 3MI8A 5FZLA 2VTFA 5JOYA 1JODA 3J7HA 4AE2A 4E4DX 3E6DA 3MLLA 2CNAA 1DGRA 2WNEA 3P1IA 2C9AA 2DCTA 1POV1 3GCXA 1Y9QA 1MZ5A 5E6HA 3PU3A 4PF5A 1EP0A 3W58A 2BYVE 4LKEA 3EMRA 5CEHA 5GZFA 3SISA 2QQLA 5FPAA 1UMIA 4X6QB 4D6SA 1W9FA 3MW3A 2WS93 4HSLA 2R1DA 4GH4A 3B5LB 4YG6A 5FYUA 2ADEA 2MEV3 3VLBB 1QJX1 3DN7A 3POGA 3AMPA 3T08A 3AYDA 5A7WB 5C6CA 1Q8QA 3HWJA 1UU4A 3DEMA 3ECQA 5LA9A 4D6RA 1CJPA 2XJTA 2Q4SA 3IAQA 4M3CA 3C7EA 2E9QA 1VBD2 4LO8A 1CR7A 5C9AC 3HOBA 3WF3A 1QDOA 2RE9A 1NKGA 2D97A 5CAZA 4GB32 4QX3A 2FDFA 1F35A 3BPSA 3ZLIA 2PELA 5A3OA 5JOWA 2ZGLA 4IGQA 5IWFA 2TUNA 2WAAA 3FN9A 1RUG3 2Q8DA 4AAXA 2PTMA 4NVPA 1JOPA 4KWKA 3WP6A 3POIA 3P5BA 1CIWA 1MZ6A 4BQ4A 3AJYA 4YM2A 1RUJ2 1BVP1 4IV1A 5F3CA 1LHWA 3UKNA 2WS91 1W6MB 1C1LA 3TOJA 4TLFA 5JI7A 1AF9A 2FD8A 1X9TA 1UIKA 3GDBA 3ZXKA 2Q1MA 4AHWA 2MEV1 3I2HA 1COV3 1FOD2 1OA3A 2HWB3 3MGUA 3AVRA 3KLSA 4KGQA 2Y33A 5GZGA 1F4HA 2P17A 2VOXA 4KBBA 1CAVB 1PGL2 1WMEA 1VAVA 4YRDA 5DUUA 4FFIA 1NCRB 4OI1A 4ES9A 4CDXB 1IOAA 1NCRC 3LFMA 1RVF2 4CDXC 2W08A 1ND2A 4P14A 2LM3A 2R7EB 4RGAA 3P6BA 1AR92 3PUSA 1J83A 3AP4A 5FR3A 3SXWA 4LT5A 4CSWA 1SDWA 3AJZA 4YSFA 3H8XA 4ZONA 4UFHA 3VDDA 1RUG1 4K21A 3HMYA 1PO12 3GXUA 3M3IA 4DZGA 4BMEA 1BEV2 4BLIA 2FDIA 1ZRFA 1GNYA 1JYWA 2C1FA 5LEKA 4Q4Y3 4CDWA 3O1OA 3R05A 2ORZA 2VUJA 1ULGA 1NCQB 4H55A 4UFLA 1IS3A 3UJOA 1COV1 2HWB1 5IVJA 4D0QA 3OBTA 2OUHA 2AC1A 1LODA 4KU7A 4Q2FA 4HETA 5DZEA 3DPRA 1R083 1ZZ9A 3MF6A 1AXYA 1QNWA 3K4DA 3MEPA 5GZEA 4BK5A 4Q8KA 2BPA2 1Q3EA 4AFCA 4B3NA 3PMSA 3WNXA 4IE4A 4EE2A 2EIDA 2WT0A 3K3OA 2QNKA 3ZDSA 4D6QA 3HT1A 4LBNA 5A33A 2VUDA 4D69A 3X29B 5LB6A 2C26A 1QJX2 3FLRA 5EPAA 5A32B 4EN9B 4QGNA 5HV4A 1D0HA 3DYMA 1GV9A 1HB3A 5CBLA 4OUSA 4B4RA 4AQ6A 2YDEA 5C7GA 1IPKA 5C33A 4CYDA 2OPKA 3MW2A 3WQBA 5FKCA 2AGSA 4Q4Y1 1D4VB 4IESA 3IDCB 1KD7A 5LRRA 5FXWA 1QGLA 3UNPA 2G9FA 1KFXL 2JDYA 2VR4A 3HN1A 1ZBE3 2O8QA 1LULA 1LHUA 4M00A 4ZY9A 4ASMB 3FUQA 1S0EA 3O1RA 3WF2A 1V70A 4MX3A 1ODNA 1O3TA 4UAPA 2W95A 1SCRA 2F6BA 3TNQA 2PAEA 2QTWB 2VOTA 4I2OA 4KWLA 1U5YA 1R081 5J7MA 1LGBA 2V73A 5CVRA 3AYCA 3ZM8A 4QD2A 2WS92 1G8WA 3OBZA 4V2WA 1XC6A 4YVWB 4AGGA 2EXKA 4XZPA 4G3YC 2JIGA 3SQOA 2FQPA 2MEV2 4FI9A 1G9DA 4O65A 2TEPA 2EIBA 2Y34A 2QZ2A 4HSJA 5EJ3A 2VUAA 1I6XA 3FBYA 2DF7A 3N3HA 2VCCA 2WWJA 1OD5A 1W8FA 2XMLA 3U4SA 4W6YA 3ROUA 1LNSA 3WQ0A 4FAHA 3VBRA 2AENA 1W3XA 1JN2P 2ZBJA 4XFBA 1ZBE1 3OCPA 4XBNA 5FP4A 2WWSA 1LOEA 3LSDA 5A1AA 4MUVA 4AGVA 4NRQA 1SDDB 1RUG2 3OEAA 4QQLA 4KBZA 5FP9A 3IMMA 1XU2A 3WNOA 4EN0A 5GKAC 4LO7A 4WM8B 5KHKA 2CDPA 1W9YA 1YHFA 4WM8C 3FZ3A 5F39A 4ET7A 2D6OX 4QPIB 5FY5A 1K5JA 4M4PA 3WF0A 5A70A 3IBMA 5KHHA 1TME3 1ZZ8A 2GU9A 4BISA 1OH3A 3VD9A 4K6BA 3OGGA 4JZRA 4BMBA 2HWB2 4RS5A 5IFTA 2XGXA 2PHXA 4ARXA 1VBA3 4AK3A 4A45A 1YCIA 2OW4A 5GLVA 1MS9A 4B29A 2CHHA 4W8JA 5CFDB 1AJOA 3VL9A 2PN5A 1QJU1 2VVEA 5CFDC 1DQ2A 2BWCA 4CDUA 1AR73 1YXWA 1W39A 2ES3A 4QU1A 3M3CA 1LOFC 3VBHB 3VBHC 4FVVA 2VXJA 2WWUA 1GZTA 1RTVA 5C3OA 2N7GA 1OVPA 1JHJA 3ZXDA 1DU3D 4IDZA 3OF1A 2ZMKA 3GZAA 4ZXKA 4KWJA 4QPYA 4DB5A 4S2GA 3QD6A 3I54A 5GALA 3J7NA 3WV6A 4MZUA 2EF6A 4QXCA 1OMIA 2VNGA 4GKYA 4Q4Y2 4A6SA 1MZFA 4MGZE 3M2MA 1K5MA 4GMP0 4N53A 4RHV3 3KVBA 4BB3A 1TME1 1SLTA 4QX7A 5L9BA 4Q8LA 4R9BA 1YO8A 5T55A 5A6QA 2WNUB 5FYSA 5BNNC 4OQ9A 5K8SA 2WNUC 1VBA1 1NOVA 1XB9A 1TQ5A 2G4IA 3NAPA 2VMFA 2J42A 4PIZA 2UYBA 5FRAA 2ZKNA 4JDNA 1E57A 1HJGA 2CGNA 2JXAA 2QCSB 1Q56A 5FZ0A 3O0XA 2AH2A 2EAKA 3WEZA 1AR71 3MICA 4EZ4A 4ZU4A 1H9WA 3N9PA 3WDVA 3CF6E 1OLQA 2XJUA 3AFKA 3PUAA 4YGEA 2ZJCA 3KM5A 3PUQA 4XILA 3TNPB 5ACA3 1I9RA 2BBAA 1A34A 4NHMA 4LEJA 3UKVA 5CIRA 4CCOA 4YZ4A 3L9JT 4KH9A 4E27A 4YG0A 1ENXA 1GQGA 1YI7A 4CCDA 1VMJA 3D82A 3NL1A 5FPLA 2AZ5A 2YB7A 2XWJB 2HLEA 4C91A 4IV3A 1N1SA 1QH7A 1ZBA3 5L73A 2Q0AA 4M3CB 5F2WA 1S0DA 4RHV1 1ZYBA 2G9GA 1ZBE2 5EZWA 4CUCA 5BNOA 3BIEA 1LCLA 3KHCA 3NNMA 5JSOA 5I0SA 1W6QB 1YQ5A 4AYUA 3HN3A 5IK7A 1H2KA 3ST7A 1TNRA 1F5FA 2VMDA 1CN1A 2FCUA 3LFIA 2A3YA 3UGHA 1JZ3A 1DYPA 2CAVA 4WBBA 2A6WA 4AL9A 1H4HA 4ZU5A 4LIUA 3KF3A 1JBCA 1RUF3 3URFA 3UV9A 4XW3A 1FV2A 1O4TA 2HWF3 1EY2A 1QJZA 3F2ZA 4ISRA 2P2KA 4YVSA 5ACA1 4IV1B 2WYSA 4Y22B 5LY2A 2HWE3 4CP9A 3JCIA 5AFBA 4DQAA 2JDMA 1SG3A 3LGRA 1NZIA 4LE3A 2WSVA 3AMMA 1JTZX 3RFRA 1US2A 2EICA 2W46A 3NNGA 3TEWA 3GHMA 4RN5A 4JKLA 4QX5A 1K3IA 3O1TA 1QXRA 1ZBA1 3ZKUA 1L7RA 1L3JA 3B3QE 3VBFB 2ZX2A 5FY7A 2YXSA 5A7OA 2VAUA 3VBFC 3J26N 5FWJA 5KXBA 4HL0A 4JDOA 1ZRIA 1Q43A 1UOGA 4Q1PA 4AEDA 4E2GA 5BNPB 1X82A 4OHWA 4YW4A 2KA3A 5IAVA 1L7LA 5BNPC 1S2KA 2B8MA 3K51A 5CG8A 5LRSA 1UKGA 4E8CA 4QPWA 2VCBA 1XNTA 3LF7A 1RUF1 1UU6A 4FTEA 1NYWA 2LW8A 2P3KA 2HWF1 3ZSKA 3PDQA 5E89A 1JYTA 4WZCA 2A7AA 4YM0A 1WCQA 2DURA 3ZOIA 2YYOA 3ZSJA 3BU0A 3I59B 4Y5Z0 1DZTA 1VBA2 2HWE1 2LUWA 1PNFA 2D98A 3ACIA 4J25A 3H0OA 4XFHA 3TYJA 4NIHA 3B02A 3ZYFA 4AQ2A 3WF4A 3IT8A 5FZ1A 1APNA 1JI6A 3LB9A 1AR72 1HLCA 1RHI3 3NJYA 3LOIA 2AEYA 1HQLA 4QWNA 2GDFA 2ZGQA 1CVNA 2EIEA 5FYMA 4UBHA 4LHSA 4UOJA 4OI4A 3AVSA 1I1EA 4L0PA 5F37A 3QH7A 2WNVA 1GQPA 1OQEA 1S0FA 2D40A 1J1TA 5FKBA 2OT7A 4EV0A 5A33B 4JVAA 4DPNA 2DTYA 2R30A 1UYZA 2R043 4QQPA 1BCXA 4OZOA 3VDAA 5A3UA 2WT1A 4LQRA 1OUXA 1Z7S2 2EIGA 1OPMA 2DVGA 3KQRA 1BXHA 4M3CE 4RHV2 4ZZ5A 4Z92B 3QLQA 3ZXGA 3DUIA 4COUA 1DQ4A 3EO6A 3RVHA 3POBA 4DS0A 4PI0A 1YFUA 1J3PA 2H0BA 5IVEA 4AAPA 4P08A 4FPGA 3WG4A 2W94A 2FZ2A 1XXNA 1RHI1 2AREA 5ACA2 2WQ4A 1LHNA 1MS0A 4OZXA 1OH4A 2OVUA 3WZ1A 1QOOA 1RUD3 2QQJA 1R64A 1CESA 3ZYJB 1JU4A 3AP5A 5A7WA 1C3HA 3LDRA 2VQTA 5DPNA 2R041 1OOPB 5C9AA 2GN7A 5A3LA 1GANA 1O4ZA 4M0HA 3Q8AA 1OOPC 2XVLA 5BXXA 1ZBA2 2GMPA 4A7KA 4AEJA 2WABA 5EJZB 1RIRA 5AVAA 2J1SA 1RUC3 2R0HA 2Y0OA 2YFZA 2RDQA 1WUVA 2EAAA 2WZR3 3O14A 5CB7A 2QE3A 3AC0A 3KV5A 4BH9A 2BGCA 2WO2A 1OD3A 3QBQA 2QUOA 4MV2A 1RUF2 1VPHA 2J22A 1IHMA 2YPDA 2HWF2 3BGAA 3ME2A 3NJXA 4Q0QA 3MIHA 4GWNA 2VG9A 1W6MA 1NXD1 5H9SA 2GZWA 1YQCA 2VZUA 4IQPA 2X09A 2UWBA 4Y24A 5FY9A 4UW3A 1WA6X 1RUD1 2DVFA 2HWE2 2WQ8A 4PQ9A 4QHBA 1O8PA 1T6BX 2QZ3A 3THDA 4CDQC 1W0PA 2C9KA 4FXGB 4LO6B 1CAVA 4XURA 1V6IA 5DAVA 1NCRA 4CUGA 5GLTA 3W59A 4CDXA 2PQSA 4H2AA 4BQWA 3K77A 3MO4A 2ZHKA 1PIV3 2VZPA 2YROA 4BLJA 1SBFA 3F95A 4XQWA 3OYWB 2W2IA 1W28A 1RUC1 1DHKB 4R9DA 1W8HA 3VKMA 1OA2A 4LKFA 2WZR1 2WZPP 1W0NA 4NE9A 4QQHA 4LORA 2DDUA 1WCUA 4MADA 4PIYA 2C0ZA 1OBNA 4CXXA 2B39A 3VZKA 2Z4FA 5FY1A 2JG9C 3OGRA 3AZVA 4COWA 1KFUL 1HRI3 5A6XA 2WLQA 2VOKA 3ES4A 2ZEZA 5FY4A 2PXJA 1XE0A 3DKWA 1RXGA 1W3VA 3PLQA 5C70A 5HI0A 3I4IA 2XXZA 3BVCA 1JYXA 5J96B 5JCTA 4XHBA 1XNKA 2PHTA 3KB5A 2FDKA 1YUDA 2RS33 4IEWA 1UYXA 2JB4A 1W6NB 2ARCA 2IFWA 2WYFA 1JH5A 5JIAA 1RHI2 3MUZ1 4Z82A 1FI2A 4CCCA 4E2SA 4LPLA 2HWC3 1PIV1 1LKNA 1PMIA 4FPYA 1N3PA 4BQ5A 1S55A 2J1EA 2UURA 5A32A 1CAXB 1LU2A 2KXLA 5I0TA 2WA3A 2R042 3SITA 3JQWA 1W2UA 2NN8A 3M1HA 4MXVA 1SLIA 3USUB 1UL9A 4AFDA 3ELNA 2OUJA 1O91A 1MS4A 4NHXA 3WNMA 3N9NA 5D1IA 1HRI1 4OUMA 1DF0A 4YM1A 2BW8A 4BCUA 4TLGA 3MPBA 5BNOB 3ES1A 3WDXA 4AW7A 1OKOA 4HLTA 4OI2A 1JUIA 2XR4A 3MZHA 3MUY1 4GB33 2RS31 4QAWA 5B4NA 2YC0A 4N8MA 2WLPA 2OYZA 1O6UA 2RHPA 2Q1ZB 4CP0A 4QDSA 4LLOA 3PVNA 3VKOA 1REEA 2XH6A 4BA6A 1QJY3 2QQNA 4GA9A 5FP3A 4AI0A 2P4EA 1FAYA 5FZOB 4GAZA 2HWC1 1X36A 5IUQA 4IEVA 4O7XA 3ZPYA 1RUJ3 4E2QA 3AKRA 1RUD2 4GKXA 2WQZC 1W8TA 3WINE 1O59A 4YVSB 4PF1A 4BJ0A 1TVGA 2O1QA 3E1F1 4AXOA 2RM23 4OHVA 1XBFA 1E5IA 5JDBA 3G6JB 2WDBA 5FZMA 4W50A 2HEWF 2PQQA 5DAXA 3R4SA 2JE9A 3HD8B 4AEMA 4YFZA 1KQRA 2VTXJ 1D2SA 5E88A 3UKTA 5EHDA 1WMFA 2VTXA
chains in the Genus database with same CATH topology
2PHRA 1RUC2 4G9SB 2R073 4YZ3A 1NY72 2WZR2 1GFF2 3LZZA 4PLOA 4GB31 5GLUA 3VHRA 2YGMA 1WLTA 4AEDB 4B8EA 5KC6A 4WM8A 4FTSA 1QHDA 1QJY1 2I74A 3AKPA 5JSRA 1JHNA 2ARXA 2D6MA 3BB6A 2EVXA 1PK6B 1ZA4A 5JIUA 1RUJ1 1PK6C 1GQHA 5EXOA 5FTTC 3MIFA 4QQ2A 4DY5A 2RM21 5H9PA 2Z69A 4CZSA 5CFDA 3WG1A 3AP6A 1J1LA 1LOFA 3SHRA 1QOSA 2OA2A 3VBHA 5JWPA 3ATGA 4CEWA 3O0WA 3LCPA 5GJ6A 3WD5A 1FT9A 2R071 4HK9A 1LB2A 3LA3A 1QQP3 1X7NA 2VNOA 1WA4A 2JICA 2ILMA 4LBKA 3H3ZA 2YGLA 4LO5B 2NM1A 2GN3A 2ZCWA 4QPGC 3POSA 5FMOS 1FMD3 1WW7A 2OZ6A 4DY3A 1HRI2 3E5UA 3GYDA 4MGIE 1WGPA 2YHJA 2NQYA 3V56A 4LHLA 2JD4A 5E16A 3Q9OA 4META 1GICA 5BNNA 4YW3A 4XPVA 2WNUA 4L9BA 2RS32 1LEMA 5T52A 3BALA 2ZMNA 1F9KA 5DZGA 4IERA 4XE9A 4D7TA 3DF0A 5EWSA 2PA7A 1H8TB 1D4M3 5CADA 1H8TC 1ENSA 4HANA 1W6OA 1WCDJ 1KITA 2HWC2 3O7OA 3WW3A 3W9AA 2D6KA 4KG0A 1OQ1A 1GZWA 1QQP1 2H6CA 3AZYA 3UL2A 2ZMLA 1V6NA 1XE8A 3VBUB 3RJRA 3VBUC 4HVRA 1MZEA 1FMD1 1QXPA 5C9AB 5HCAA 3CL1A 3VZJA 4B7EA 2VGDA 4R4ZA 4CEYB 4Z07A 4DRVA 3OBRA 3WUCA 4CEYC 4KNCA 1W6QA 5I8SA 4YARA 2A71A 2ZGMA 3WP3A 3ILRA 1MEC3 4FOWA 2A3WA 1S0GA 1QJY2 1D4M1 1YWKA 2E7TA 4ISQA 5JOXA 1O5UA 2WINB 2D6PA 1AJKA 2C5DA 3B7MA 4WVWA 3V64A 1G9AA 4FPLA 2ET1A 4G4FA 4Y22A 3OJBA 5C8WA 3RI8A 3WLUA 2RM22 2GNMA 3V65A 1YFXA 3WHTA 3WDUA 5HBAA 2XJQA 2IXHA 2QFEA 4BIOA 4LBQB 4LLFA 5JVVA 3OD0A 3E5QA 3WDWA 4Y1YA 3VBFA 2R072 4FPCA 1UPSA 5BNPA 3BOPA 1MEC1 2AR6A 2JDZA 3BCWA 3DV8A 4JDMA 3S0MA 4FTBA 1PO23 3WW2A 5T5JA 3WG3A 2X8KA 4S2FA 4Z1VA 1CAWA 4BOWA 1GSLA 1HW5A 1A78A 3RQ0A 3LSEA 1RJ7A 3I59A 5DUWA 5CFCC 1TNFA 1V9U3 4AGRA 2DVAA 4RL7A 4J1XA 4Y26A 1HXS3 4IEYA 4COVA 1C1FA 3D8CA 4WM7B 2GNBA 1VIWB 2XB6C 4MH0E 3N36A 3GBWA 4WM7C 4Q0UA 4IEZA 3FLTA 4FQZA 1QQP2 2A75A 3TB0A 4O9EA 4Y4YA 3MIBA 4TZDA 5EYXA 2F4PA 2VPVA 4EWAA 4OVEA 1OKQA 1FMD2 5FOBB 1PO21 1G9CA 1SEFA 4CTEA 4UW5A 3ZYGA 2JX9A 2BQPA 3QH6A 5FO9B 3N7KA 1DIWA 1SBEA 1EYBA 2PAKA 4JV4A 4I0AA 2CAUA 1EPWA 1V9U1 1DLLA 1HXS1 4FPEA 4P9IA 1D4M2 2UWCA 2ZHLA 3L2YA 1NLSA 4LTAA 3U07A 4YM3A 1UF2C 2A5ZA 1V00A 3VZMA 4HVOA 4LO4B 1QWRA 2IXIA 1VLNA 2R16A 4EN7B 3N35A 4QGMA 1DGRN 2QDRA 2B9UA 2ZHNA 4WZFA 4DRRA 1NXMA 2PHLA 1OOPA 4AFAA 2V09A 2D6NA 4JCKA 3THPA 3JB8A 2E53A 1REFA 5H9QA 2QJVA 2R6QA 1G9FA 5C8CC 2D7FA 1DGWA 1VRH3 1H1IA 2QKDA 3R4UA 1Q8OA 1DFQA 1MEC2 4HKOA 2FMDA 4M0NA 4MGYE 5TSWA 3FFQA 1XYPA 1PZ8A 1VJ2A 1ZZBA 1NLRA 4QXKA 4GQ7A 1VR3A 2PHFA 4Q0SA 4CDQA 3ZXLA 3JBG3 5LK7B 4ITCA 1IPJA 2I45A 3WW4A 4Q4X3 3D5OA 1POV0 3AP7A 4GALA 3V0AB 1RL3A 2NPIA 4AHYA 3POYA 4K1ZA 4L8QA 3SMHA 3NKTA 3GZTB 3DGTA 1VRH1 3OYWA 4CEWB 2ZOEB 4U36A 4CEWC 1C8M3 2A6ZA 5GM0A 3ZVXA 2MNGA 1J3QA 2JG9A 1PO22 4FBFA 4XDQA 2VOVA 2IXCA 1PZ7A 3KT1A 1Z7S3 3D0JA 1VP6A 1NE4A 3H1WA 1V9U2 3WW1A 3JBG1 5BNNB 5L36A 1HXS2 2D3PA 2IXKA 4W6XA 1W6NA 4Q4X1 2YY1A 3N7JA 2ZX3A 4PLNA 1FX5A 2FZ1A 2W68A 4RQPB 4XMAA 4RQPC 2X5IC 1SQ4A 1GZCA 4R8HA 1W6OB 1X8EA 3B9IA 4FCAA 4P9LA 4XJ8A 2WIIB 3MPPG 1C8M1 1CAXA 3AKTA 2VY0A 1V6KA 4HPKB 1GZWB 4J6GA 5DUVA 2XG3A 2ZKLA 3USUA 2R0FA 4UW6A 1DQ1A 5GZDA 2NLRA 2AUYA 4SBVA 4LA2A 4RA0A 3B01A 1Z7S1 3IPVB 1CX4A 2SLIA 1SFYA 3WDTA 1XNDA 3MFAA 4AG4A 3ETQA 2VXRA 2Y0IA 4JC1A 4XFCA 4HKLA 4QMAA 1OI6A 4CP1A 5GZCA 2ARBA 4EROA 2D5FA 2XLFA 1UZYA 4YZ5A 2JECA 1H30A 1M4WA 4YW2A 2A6XA 4NWWA 5GLWA 2BVVA 2BFUS 3VBSB 3BTAA 1XNCA 3VBSC 3T1MA 1UAIA 4UW4A 1CONA 1TEIA 4XXAA 4BM8A 3MYXA 1VRH2 2Z42A 1N1YA 5DDJ2 3WP5A 4BIFA 4P9YA 2XKOA 4FXKB 2BUKA 3AZWA 4COZA 2BBVA 3J9SA 4XF4A 1DBNA 2VQ0A 3OTFA 3RS6A 2BNNA 3UK9A 1PK6A 1PGSA 1V6OA 4X8NA 4YFZA 4MSVA 4MXWB 2Q5TA 3HR9A 3PMEA 4I0BA 1CAWB 4CRQA 3MFCA 3ZN6B 1VB2A 3H7YA 2OIIA 3JBG2 4LUKA 2EXHA 2ZZJA 3RYPA 1RUNA 4Q4X2 1DQ5A 3E97A 3FLPA 2ERFA 5DG2A 4YLZA 2ZGKA 2E63A 4KG8A 1UPIA 4LNVA 3NJZA 4FO9A 4LBOA 1SLAA 3E6BA 1ZM1A 4WV8A 1LJ7A 5EFUA 5H9RA 1C8M2 1BJQA 1UD1A 2E7QA 1SACA 1GNHA 3CO2A 1OSGA 4QPGA 1LGNA 4ES8A 1BZWA 4XFAA 1AR63 1D0GA 1BYHA 1RUE3 3ILNA 2CV6A 3GF6A 1QOTA 1DQ0A 2DCYA 4XJUA 3WG2A 4JGZB 2VVFA 4JGZC 1A8MA 1DYKA 4XTMA 3DL3A 4P9WA 1H8TA 1S0BA 2WA4A 5FLHA 4L92A 5HCBA 5BNQA 3KCYA 4LBMA 3RYRA 3SLIA 3SH4A 1DGLA 2YZ4A 1BMV1 1BK1A 2XVKA 5ABJB 2D93A 3RDIA 4X6RB 3ZXFA 1LOGA 5ABJC 4XF3A 4C1XA 4BYYA 3VBUA 4IEXA 4ONUA 2TNFA 2A6VA 5KWRA 1WLWA 4W6WA 5CA6A 1AR61 2D44A 2XLAA 1RUE1 4AWDA 3ZXAC 1V6JA 4IEPA 1DG6A 4LR4A 4CEYA 2JE7A 2V5YA 3J8F3 3U0ZA 3MF9A 1RITA 3M8LA 1GZ9A 1RUH3 1H8VA 1UIJA 1YLLA 3A0KA 3ZFGC 2JEMA 3WCRA 2XL9A 1QU0A 4E9KA 5FLJA 3MIDA 3CLPA 2XLGA 4N90A 4AHZA 1CGPA 2D5HA 4XF9A 3VZOA 2TBVA 4OHXA 1XQNA 3AMHA 4L2NA 1VBC2 4BHPA 1JW6A 5HCFA 4CDQB 1SLBA 2VMIA 2DVBA 1G86A 3VGIA 4LBQA 3WP4A 3FWEA 4RR3B 3FBMA 1ZVFA 5KXDA 4RR3C 1CD3G 3WXPA 3ASIA 2UWAA 1B35B 4HN0A 1CAUB 2QVSB 1V6MA 3J8F1 1B35C 5J3UA 1G6NA 1NY71 1RUH1 2DUOA 2DVDA 3PHMA 1RB8G 2R32A 1S2BA 2JG9B 4RSUA 1HDKA 4W65A 4D3WA 4TYSA 2BVBA 1F8VA 2D6LX 1NE6A 4Z8BA 4HBNA 5CFCA 5AFEA 4FPOB 1WW6A 1Q5OA 2B45X 2GAUA 3M7AA 4F3JA 4K20A 4LUMA 2GH8A 1NA1B 4XJ9A 3VZNA 4N43B 4WM7A 3NWKA 5K7PA 1NA1C 4N43C 1UW8A 2ZGTA 4GXLA 1GLHA 1BMV2 1LOAA 5JPMB 4LBJA 4GIQA 2MHFA 1EV13 3RMXA 1SCSA 1RUI3 2YUEA 3KS7A 1AYM3 2B7YA 5FPZA 4AFBA 4AEKA 5JOWA 1LESA 3NW4A 4EJRA 3D4KA 3OPZA 4FT8A 3LKJA 1AR62 1RUE2 2ET7A 5JZGB 3ENRA 1X50A 2D3SA 2B5HA 2YMZA 1O7FA 3KCCA 3N7MA 4AVSA 1KDKA 5JZGC 4FOYA 1QDCA 4XXPA 1F31A 2NMNA 1QF3A 1ZX5A 4XQDA 2K2SA 3KSCA 3ZYRA 4Q0VA 4Y1XA 3ZSMA 1HRV3 1IKQA 4I3GA 3VHPA 2DWRA 2I2SA 3ILFA 3WR0A 3JD73 1PVXA 4AFMA 1LEDA 4R4XA 4C0BA 2PYTA 3FX3A 3ZIWA 5CG9A 3SCFA 2B46X 1EV11 3VV1A 3MIEA 4LHNA 4DXZA 1RUI1 1AYM1 1WD4A 5C8CA 1HKDA 3S7IA 2P3IA 3IMNA 5BUVA 1AXKA 3IDEA 3PVEA 3J8F2 2VVDA 5I0UA 1EAH3 4Q4V3 3KT4A 1RUH2 1XE7A 2ZA9A 2VMHA 1V6LA 1QKQA 1O3SA 3BODA 1HRV1 2O0OA 2DCKA 2DUQA 3WDYA 5C4WC 3T2TA 1BQPA 3RRDA 1ULDA 3JD71 1HQWA 4HMZA 3AKQA 2RR13 3H9AA 4C90A 4INDA 5LEJA 5K9YA 4TSVA 1O3QA 3RG0A 3O5SA 1LU1A 1VBB3 2B42B 2DUPA 2Z5WA 3O12A 2GMMA 3V0AA 1O5LA 3P3NA 1Y7BA 2XWBB 3IDBB 5T50A 1N47A 1JXNA 4D7SA 1VB4A 1G9BA 2VW2A 5F9TA 3VBOB 1C5HA 5FDBA 4URTA 3VBOC 3T1LA 1EAH1 4Q4V1 4F83A 1DGWX 1DQ6A 1QH6A 3HT2A 4XQ4A 5B2GB 2HWD3 2A6YA 4QPGB 1GR3A 1YFWA 4GULA 2RR11 2RS53 2XBO3 3FE5A 2P34A 1IGOA 2Y26A 5KXCA 4Y20B 1VALA 4BE3A 2PFWA 5K0UB 3LA2A 1T6GC 5FLIA 4DNYA 3IN9A 5K0UC 3EHKA 4XFFA 1KJRA 4QGLA 2PAMA 1C8NA 4I0WB 4PLMA 1VBB1 4RQPA 2X5IA 1C57A 1SLCA 3ALQA 2JG8C 5KBFA 1W6PB 3ZFFB 4AI3A 3ZFFC 1U5XA 4BQ1A 5EYYA 1YRZA 4AI1A 1UX6A 1EV12 1SMVA 1BKZA 3TN93 1RUI2 4HPKA 1AYM2 5FQ0B 4GMP3 1OQDA 4Z2WA 2CWSA 4L11A 4K40A 2HWD1 1AXZA 2H6BA 2UY9A 4OFGA 4L99A 1LRHA 5T5PA 4RD7A 3JU9A 2RS51 2XBO1 3KT7A 1MS1A 4XJZA 2DCJA 3IPVA 4Q29A 1VBE3 1WD3A 2X29A 2SBAA 1FPN3 3VKLA 1HRV2 3AX4A 4N7UA 4N7IA 2GNTA 1GKBA 4R9AA 2NYYA 3JD72 3H1YA 2E6VA 2DYCA 3WHUA 2PHWA 1IS4A 5JR7B 1SFNA 1WCSA 4BPZA 4XETA 5F5QA 4XIOA 3FFZA 3QACA 5D8AB 4YG3A 2ZZQA 3AXDA 4CP2A 4YZ1A 3TN91 5D8AC 2AYHA 1AHSA 2WC2A 3VBSA 4GMP1 2CWMA 5FO7B 1PVC3 4XMIA 3JUUA 1NQDA 3CEWA 2ZACA 4Y1VA 1A3KA 3FUOA 5BV6A 1ULCA 3THTA 1EAH2 1XYOA 4Q4V2 1VBE1 3TAYA 1FPN1 2W0XA 3AYAA 5I8TA 3J4UH 1N3QA 1J59A 3AP9A 3L2HA 5CNAA 1YIPA 1LHOA 4FOQA 3UJQA 3WQ7A 2RR12 4PDWB 5J37A 2ZX1A 2VH9A 4H7LA 4MXWA 4C0HA 4PDWC 1ZREA 3ZMOA 2PHDA 3ZN6A 4FP2A 4F7ZA 5AC93 5CFCB 2ZX4A 3B93A 3AMNA 4R9CA 3ZFGB 3PNAA 1LECA 1PVC1 1VBB2 2ETEA 2GH2A 3POWA 4I30A 4IEUA 4JGYB 5DG1A 4OHZA 1ZRCA 3CJIB 2CGOA 4JGYC 3ZYIB 2A70A 3CJIC 3NKGA 3RJ2X 2WFF3 2BNOA 4FPHA 1LGCA 4MYEA 1MR5A 3I7DA 1ALYA 1Z0HA 3NSTA 4K9SA 1R092 3PVBB 3WQ1A 3FJSA 3K48A 5IK4A 1ND3B 2D43A 3MW4A 1HV0A 2ZS6B 1ND3C 1ZNPA 2HWD2 4HKWA 2DV9A 1HQNA 2OZJA 2R49A 2XKPA 1URXA 3VKNA 5FOJB 4V1PA 3ZFEB 3N7LA 5E1RA 4NN0A 1Z78A 2RS52 1NCQC 2XBO2 4JAAA 3ZFEC 4R52A 4XJAA 3ZX7A 2GC1A 1XRUA 2VECA 1DZQA 3AM2A 4JGZA 5AC91 3GHNA 3B00A 1GYKA 4Q27A 4A7ZA 1YJKA 5L19A 1MS8A 5T5LA 4Q4W3 3V0BA 1FXZA 3ZN5A 1BVVA 4A7YA 2ZGNA 3KZ4C 1RC6A 2WFF1 3PTYA 4DFSA 3SH3A 1H2NA 5I91A 5ABJA 2XJPA 3TN92 2Z79A 2ZGPA 4RFT0 1MVQA 1YYNA 3G7DA 1MVEA 1ULEA 5F6LB 5KHJA 5DZFA 1AYN3 2GC0A 3AZXA 1NG0A 1JYCA 3ZYPA 4H14A 3GBFA 5T54A 3QOPA 1O4YA 3NO8A 4U2AA 5BYNA 1JOJA 1TE1B 5C8CB 3M70A 1AX2A 1IQAA 1PM7A 1ULFA 4WVZA 5JSPA 1VBE2 4AF9A 1JYIA 1FPN2 2VNRA 3CNAA 5DDJ3 3LOBA 2UYAA 5LK5A 3AK0A 5CU1A 3JQXA 3M3QA 4DMIA 4Q4W1 4YVWC 1AX1A 4YYOA 4DOUA 3WUDA 1RJ8A 2VOWA 4AVCA 4F8AA 1IKPA 3M4FA 2VU9A 4XFIA 1RUOA 2EXJA 3CJXA 3AKSA 3GZUC 4IEOA 3ZIXA 1QJU3 1Y43B 2HJIA 4J1WA 1RMU3 2ZX0A 3OD4A 1CQ9A 1PVC2 1R1ZA 3BOWA 3O0VA 1AYN1 1LOCA 5DXDA 3IKWA 1REDA 1RGSA 2XJRA 4RR3A 2LALA 2H0VA 4EN8B 2EXIA 5KHIA 2HEYF 3H8UA 1B35A 1CAUA 3MLKA 2WJSA 4H3WA 4K8FA 4NHLA 1YJLA 4Y1UA 4EN6B 3ZXEA 5DDJ1 4AVVA 3USSA 4QPIC 3AMQA 1WW4A 2CGPA 2Q8OA 1LENA 1ZRDA 1PZ9A 1COV2 3H7JA 5FREA 1VAKA 2XHKA 1C28A 4PJYA 1I5ZA 4Q1RA 5IT6A 2GSYA 4NWVA 3P3PA 1ZZ7A 3PJQA 1ZRRA 4ORFA 5AC92 4WVMB 2XJSA 4HK8A 4JRLA 4XOGA 1DDLA 2K0GA 1RMU1 4XF0A 1R1A3 1ZZCA 1Y3TA 4FAGA 2BFUL 2R063 2D3RA 5I0RA 5L7OB 1MQTB 1NA1A 2BEOA 4FPJA 4N43A 5L7OC 4K1YA 1MQTC 3M3EA 4UXAA 3VKFC 1HX6A 1F5JA 1YFYA 2WFF2 1UKRA 2NP0A 2X5IB 2IZWA 3U4XA 3NVCA 3ZO0B 1FATA 2ZGUA 3HBZA 2X53S 4OLLA 2DFCA 3APBA 2XUMA 4D7YA 5J09A 3U10A 3IWZA 2CYFA 3A0NA 3RWNA 1AZDA 5JZGA 3MLJA 3VL8A 2DCZA 3NV4A 1EPZA 1WMDA 4KQ7A 4I01A 4I02A 1R082 4YGDA 5FBZA 5BPXA 1WBFA 3E6CC 1QY4A 1R1A1 4QU2A 1WLCA 4XIKA 4A2UA 1C5IA 4AHXA 5KHGA 4Q4W2 3VHOA 2R061 2P3JA 1A6CA 1AUYA 4JTOA 5JPNB 2EALA 3C2UA 3JB4C 4GH4B 3B9CA 1PNGA 4AI2A 4GH4C 4KU8A 1ENRA 4RGGA 2RMU3 1ENQA 2HEVF 2VQAA 4XYXA 4HZFA 2JJ6A 1BBT3 1WCKA 4ATEA 2BWAA 1M06G 5I93A 3SNMA 3NV1A 1VBC3 1AYN2 3MIGA 4I09A 2VULA 1YI9A 2A73B 1XU1A 1WW5A 2VMGA 1GNZA 3EJKA 3KMHA 2Y38A 1OHFA 4P5HA 1UZZA 1PGW1 1LR5A 1U12A 2Q30A 2XL7A 2LTNA 1B09A 4HN1A 2MPFA 2IWGB 4FP3A 4XJWA 3CU7A 2GALA 3IM0A 4NPRA 3H3UA 5C4WA 2K9ZA 4YFWA 4IV1C 1AVBA 2ZGOA 2I07B 3R6SA 2QQPA 4H7MA 1NQJA 1S0JA 1FYUA 2RMU1 4NO4A 4P9JA 3LWCA 4XTPA 4XHXA 4C1WA 1QJU2 4B4PA 3VN4A 3NV3A 1ASJ3 2DFBA 3N4MA 1RMU2 1BBT1 3U11A 3AYEA 3R0RA 4NOTA 2GMEA 3SCGA 2QDNA 3HIFA 1S1AA 1VBC1 2UU8A 3S6PA 3VHNA 4JRAA 1ND2B 3INAA 2HKXA 4YW5A 3RPQA 1Q8PA 4JTNA 1ND2C 1H4GA 4EWEA 3R4DB 1W0OA 3OY8A 4K3UA 1WLDA 3VBOA 1XYNA 5EV7A 3VDDB 2JKBA 4O9GA 2P37A 3VDDC 1QMJA 1TME2 1YNAA 1X33A 3D6EA 1O3RA 4CDWB 4B7KA 1MACA 4S2HA 1JUHA 3OGJA 4P9GA 4CDWC 1DZRA 2A3XA 1N1VA 3ZMNA 1H2LA 4Y20A 5F1RA 1X8MA 3ZSEA 5T3NA 5K0UA 1QXJA 1ASJ1 4P9XA 3B69A 4UBGA 1R1A2 4I3PA 3DPRB 2R062 5J36A 4FSJA 1KXGA 1AL23 3DPRC 3KGZA 4HT1T 4XFGA 1D2QA 1ONAA 2JG8A 3V0BB 3WVJA 1NZCA 4Y1ZA 4QT6A 4FOVA 2E7AA 1KDMA 1W6PA 3KCXA 3ZFFA 4AVAA 1S0CA 4LBLA 3WY6A 4AVTA 5FQ0A 5IK8A 3WT3A 4L97A 3ZN4A 3A4UA 1UCXA 1VAMA 2BTVC 2R1BA 1SBDA 2ATFA 3FHIB 2IFRA 3AZZA 1PGW2 4IEQA 4IETA 1CPNA 1Q8SA 3AFGA 4KL1A 1HIXA 2YPJA 3SH5A 2GC2A 2IXLA 1AL21 3NV2A 2XJVA 1H0BA 4X8PA 4NHKA 1FNZA 2RMU2 4YZ2A 5FAXA 4D94A 3IIAA 3RMYA 3LA7A 3I2DA 3JZVA 5D8AA 5F6KA 1BBT2 5I8YA 2W52A 4E4SA 4OI0A 2FMYA 3S7EA 3TWIA 3HQXA 3RZZA 1CPMA 4DINB 2PLV3 3VBRB 1IZ3A 2CY6A 1LOBA 3VBRC 4MGKE 4COYA 1AR83 4E4ZA 1MS3A 4AI8A 4LA3A 4LE4A 2XVGA 3BIWE 3RNSA 2CTVA 3RYKA 4PBPA 1QNYA 1A8DA 2FHRA 2ZHMA 3AXEA 4B4QA 4OHYA 3EBRA 2ZTNA 1LHVA 2WFPA 4EWDA 2RS13 2GC3A 3D0SA 4A3XA 2IXJA 4PDWA 4GWMA 1IS6A 1Q8VA 2RJLA 4RS5B 3QCWA 5BY5A 4RS5C 5SV5A 1ASJ2 2ZABA 1HV1A 2HYKA 5SV8A 1XNBA 1OLRA 3TRSB 1YIFA 3ZFGA 1MS5A 1CJDA 3MDPA 4K7JA 3H50A 4CDUB 4Q0PA 2ZAHA 4JGYA 5JAXA 4CDUC 1H9PA 3CJIA 1TMF3 2PLV1 3BU7A 1UMZA 1AR81 1J58A 2WKKA 3H1MA 1KRIA 2FBEA 2O8OA 4PCRA 5FFOC 1ND3A 4LBQD 3VUOA 1LTEA 2DU0A 3GNEA 2E51A 4SLIA 3PVOA 1K5MB 4N53B 1NCQA 3ZFEA 1U5IA 3RSJA 1K5MC 2RS11 2NMOA 4N53C 1H1AA 3ZSLA 5A3MA 1OA4A 5IK5A 4FQ4A 1UN1A 3NAPB 3B94A 5JOZA 3TBDA 3NAPC 2WT2A 4QQOA 4MLOA 3S30A 5AVPA 1AL22 1UU5A 3GALA 4HVQA 2BNMA 5JI9A 4QM8A 1TMF1 5JMCA 5DUXA 3WCSA 1H2MA 2RJKA 2KM2A 5JLVA 5HXVA 3HAGA 4KGGA 4N9HA 3ZXJA 4PBOA 1PHMA 1VBD3 3EXUA 4IV3B 2EA7A 1IS5A 4IV3C 5T5OA 2ZGSA 4IL7A 2DU1A 2DTWA 5FMOL 1C4RA 4M3CF 3VZLA 1KS4A 5BNOC 3PJYA 1GBGA 2VW0A 1KS5A 4XBLA 5KXEA 5KC5A 1FNYA 4AQSA 4ATFA 3I8TA 1OPOA 4YVWA 4MVTA 4ASLA 3SCHA 4YGBA 4XEZA 5E8AA 5C4WB 3LAGA 4HFSA 3EQEA 4YVSC 2ZAAA 2CL2A 1FOD3 4ZU7A 3KD4A 1WBLA 1G7YA 5FPXA 1I3HA 4LULA 5FCCA 2IC1A 5J98B 3C3VA 3KGLA 4M01A 1VBD1 2W39A 1RVF3 2PLV2 1OFSA 4XBQA 2GNDA 3FMGA 2ZGRA 5J48A 3ACLA 5FO8B 4XF1A 1AR82 1S0IA 1AL0G 1AR93 2JENA 2NZ9A 4AVBA 4QM9A 4YW1A 1ZZ6A 3WX5A 3OY8B 4AEDC 1N3OA 1PO13 4FPKA 4QPIA 3AB0A 1BEV3 1R093 2PHUA 4TWTA 4NR1A 1SLLA 1H1MA 2RS12 4BZ4A 1U0AA 1U5ZA 4ZKTB 3RI9A 2XPJA 1F2NA 1FOD1 3FC0A 4N9IA 2VW1A 4WVMA 4YGCA 1POV3 2WSUA 2YV8A 1OFNA 1N1TA 4Q26A 4WVVA 1PIV2 1PGL1 2UY8A 1AX0A 3M3OA 5L7OA 1KJLA 2WL1A 1MQTA 4FPFA 1TMF2 1J3RA 1RVF1 2ZPXA 1RINA 4LHKA 2WNVB 4JQRA 2JG8B 1QJX3 3WOGA 1AR91 2ENRA 4OULA 4YNIA 2WNVC 3E5XA 2Z2SB 3BPZA 3GBGA 4AQTA 1PO11 4PIXA 1FV3A 4IXLA 1BEV1 1R091 4BWOA 4S2DA 3MI8A 5JOYA 4AE2A 4E4DX 3E6DA 3MLLA 2CNAA 1DGRA 2WNEA 2C9AA 2DCTA 1POV1 1Y9QA 1MZ5A 4PF5A 1EP0A 3W58A 2BYVE 5GZFA 3SISA 4X6QB 3MW3A 2WS93 4HSLA 2R1DA 4GH4A 3B5LB 4YG6A 2MEV3 3VLBB 1QJX1 3DN7A 3AMPA 3AYDA 5C6CA 1Q8QA 3HWJA 1UU4A 3ECQA 1CJPA 2XJTA 2Q4SA 4M3CA 5C9AC 4LO8A 2E9QA 1VBD2 1CR7A 1QDOA 2RE9A 2D97A 5CAZA 4GB32 2PELA 2ZGLA 2TUNA 1RUG3 2PTMA 4NVPA 4KWKA 3WP6A 1CIWA 1MZ6A<