2HEWF

The x-ray crystal structure of murine ox40l
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
128
structure length
128
Chain Sequence
PPIQRLRGAVTRCEDGQLFISSYKNEYQTMEVQNNSVVIKCDGLYIIYLKGSFFQEVKIDLHFREDHNPISIPMLNDGRRIVFTVVASLAFKDKVYLTVNAPDTLCEHLQINDGELIVVQLTPGYCAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tumor necrosis factor ligand superfamily member 4
publication title The Crystal Structure of the Costimulatory OX40-OX40L Complex.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cytokine
total genus 28
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2006-06-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2hewF00
2WNVA 2JG9A 1RJ7A 4RSUA 3IT8A 2TNFA 1OSGA 4NN0A 4QQPA 1GR3A 1C28A 4QQLA 2X29A 2E7AA 3LKJA 3URFA 3B94A 4G3YC 3MI8A 1JTZX 4J6GA 2O0OA 5KC5A 3TWIA 1XU1A 2QDNA 4DOUA 3WD5A 2WNVB 2JG9B 1A8MA 1U5ZA 1XU2A 4KGQA 4N90A 2RJKA 2KA3A 1C3HA 1WCKA 4QQ2A 1U5XA 3L9JT 2WNVC 2JG9C 2TUNA 3FC0A 4OUSA 3ME2A 4TWTA 4KGGA 1D4VB 3K51A 5CIRA 3QD6A 2JG8A 1DG6A 3B93A 1O91A 5TSWA 3V56A 2R32A 4OUMA 4MSVA 4OULA 4TSVA 2ZPXA 2AZ5A 4MXWA 2OIIA 2Q1MA 1IQAA 2WNUB 4HT1T 4QQHA 4DB5A 3ALQA 1PK6A 1ALYA 1U5YA 2JG8B 2HEVF 5L19A 4G4FA 1JH5A 1RJ8A 2Q8OA 2WNUC 1KXGA 2WNUA 2R6QA 4QQOA 5L36A 2JG8C 1S55A 2RE9A 4E4SA 3AB0A 3K48A 4D7YA 5BNQA 1OQEA 2HEWF 4KG8A 4MXWB 1TNRA 2Z5WA 4F3JA 2RJLA 5KWRA 1PK6B 4E4DX 1KD7A 5KC6A 1D2QA 1OQDA 1TNFA 5HBAA 1PK6C 3QBQA 4QPYA 2HEYF 4GIQA 1I9RA 1D0GA 2ZJCA 3TYJA 3B9IA 4EN0A 2QE3A 2R30A 1DU3D 4MXVA
chains in the Genus database with same CATH superfamily
2W94A 2YG0A 3GZUC 4L9BA 1W2TA 1MS8A 2ZX1A 5EJZB 4YFWA 2AR6A 1S0JA 3BIWE 1W05A 4S2HA 3VUOA 1K3IA 2VULA 4Y20B 5DG1A 5F5QA 4QHZA 5FZ0A 2ETEA 1V70A 1JBCA 1ULGA 3HJRA 3RI8A 3S7IA 3WV6A 5C3SA 5J09A 2VUJA 5FYHA 2RS11 5DXDA 2NPIA 4M00A 3FUQA 4N7IA 4DY5A 4Y3OA 1NLSA 1RHI2 3TN91 4Y1YA 1H4GA 2RS32 3MPBA 1LOFC 2J42A 1YQ2A 5C71A 3KQRA 4GZ9A 1Z78A 2BDRA 4GMP3 3PMEA 5FZ7A 4L97A 3K3OA 3BYWA 1PVC1 1D7PM 3HVDA 2TUNA 1VRH3 3OG2A 3TEZA 4IW3A 4AFCA 5JOZA 1BLZA 2PHTA 1D4VB 2QZ2A 2R0HA 2ZS6B 5B2GB 2WZ8A 1RUJ1 4BE3A 3N9OA 5A32A 1U0AA 5AC92 3E5QA 4TTGA 3UK9A 5IVJA 3NL1A 3H8UA 5LK7B 4Z07A 3I59B 3SCGA 4JZRA 1JXNA 2W91A 4DS0A 1Y9GA 2D5HA 3OGSA 4HSJA 1MZ6A 4BQWA 4IE6A 5FYBA 2Q8EA 1NLRA 1CAXA 3VZJA 1RUD2 1AXYA 4XYXA 5EHDA 4ORFA 3J7LA 4PF5A 3ACHA 1TVGA 2OIIA 2Q1MA 4HVOA 3TBDA 4RA0A 4CYDA 2ET1A 2YBPA 3D5OA 1VBC1 5M0TA 2E6VA 1ENSA 1DYKA 3POWA 1PZ8A 4AZZA 3RYRA 4IEZA 4Y26A 2DFCA 2E7QA 5KHKA 2W5FA 1TME2 2G9ZA 3QLQA 4KNCA 3UJQA 3G7DA 3CQOA 3JCIA 1SEFA 1PGL2 4XF0A 2ZGQA 5FO8B 2BP6A 2EAAA 1VJ2A 3NV1A 5FJHA 3ZXJA 1AYM2 3EYPA 4HMZA 3WNXA 3O1MA 2ZX0A 4JGYA 4CZSA 1QJU3 3LEIA 4NIGA 2V4AA 5AFBA 4FFFA 2EIEA 4MXWB 5I0RA 4I30A 3I97A 3WP3A 1QGLA 2SBAA 3L2HA 4PJYA 4AAXA 1KD7A 1REFA 1XNTA 4LK7A 4NHYA 5CKQA 1Q8SA 2YXSA 4QX2A 3T30A 3WNPA 3WF4A 5I0TA 4LEJA 4GWNA 4YM3A 3THTA 3H7JA 3HT1A 3AC0A 1EV11 2YROA 5LA9A 3APBA 1REDA 1YJKA 1YFWA 1GOFA 1EPWA 5HCAA 2CL2A 4XCBA 4HPKA 3LAGA 1WBFA 2VUCA 2UWBA 3I2IA 4QPGB 4XBLA 4XAAA 5K0UB 1HN0A 4NIAA 3H3LA 4M01A 3WINE 4GB31 3NNJA 3N7LA 2C0ZA 1XRUA 2QQUA 4QPGC 1W6MA 4RSUA 4XF9A 5JPMB 5L9RA 2CDOA 5K0UC 2JDMA 2PHUA 2RHPA 3MF6A 1OOPB 2CU5A 3ZIXA 4BYYA 1XXNA 2A6WA 2VH9A 1PMJX 1PM7A 1K5MA 2BRTA 3OGVA 1NLQA 3EJKA 1GOGA 1OOPC 3AFGA 3FLRA 1O3QA 1QJFA 5LRRA 1W8OA 4AK3A 3ZO0B 1D4M1 4JKLA 1CAUA 4BIOA 2YU1A 5DDJ3 1VB2A 4QKBA 4XXPA 4S2FA 1A3KA 1PO13 1CD3G 2WNVB 3O0XA 1M06G 1SLLA 3VKMA 3M1HA 2J1SA 4KMQA 1FOD3 2RM22 5HI0A 2EXIA 2WNVC 1Q8OA 4EE2A 1J59A 4GQ7A 2BYVE 5ACA1 3W5MA 3FZ3A 3ENRA 3ME2A 1ZNPA 1YO8A 4QDRA 4GMP1 1R1A1 4CEYA 4XUNA 5IFPA 2EXKA 1DCSA 5GZCA 1CONA 2I45A 5EQUA 3WEZA 3KT7A 2XQXA 1IHMA 2WSVA 3M3EA 2JG8A 2P3YA 2J1TA 3MUZ1 1W8WA 4LO7A 1C1FA 4BQYA 4RHV1 4ZPIA 3AMPA 2BJSA 2GC0A 3WNLA 4KU7A 2RDNA 1WWYA 4LBQD 3L2YA 3ZR6A 2WDBA 1RITA 5I91A 4OZXA 3VZKA 2PAMA 1H2NA 2ZPXA 2YBSA 3J8F1 2VOKA 1VBE2 3WXPA 2G9FA 3MF9A 3LF7A 2R0FA 3JQWA 4YRDA 1QXPA 3CO2A 5FQ0B 2RDSA 5HCBA 1DYPA 2CAUA 4L11A 1VLNA 1MS0A 4NPLA 1T2XA 2F4LA 2RV9A 1J3PA 1NXMA 3SH4A 3ITQA 1ND2B 1C1LA 2W1WA 2X8KA 1BBT3 2C9AA 4CP1A 1RMU1 4M3CF 5A7SA 1NG0A 1S55A 1ZRFA 1YIPA 4GKXA 4ASMB 2ZBJA 1ND2C 1TG7A 2ZEYA 4XE9A 5B4NA 5FZLA 3VDBA 2PHWA 4XQWA 1PIV2 2YYOA 1O4TA 2P6HA 5H9SA 1HB2A 1W6QB 1WD4A 3WP6A 4YG0A 4QM9A 3V0BA 1Y3TA 1K5JA 1PK6B 5A6YA 4DZGA 1HXS2 3LSEA 1KJLA 1ZM1A 2ZGSA 1Q8QA 1W8NA 2DTYA 1WA4A 1KJRA 1PK6C 2DVFA 2RS53 3QBQA 4SBVA 1I9RA 2FCVA 2FDGA 1H1MA 3AYAA 2DFBA 1AR93 1AR83 1NE6A 1YWKA 4XURA 4I02A 3IB3A 1ENXA 5I93A 5C8CA 5FZAA 3PTRB 1FX5A 2TEPA 2VQUA 1LHNA 2W46A 1VAKA 5CNAA 5BNOB 1RC6A 3CEWA 2PYTA 4Q8KA 2XL9A 1BKZA 4FFGA 4HL0A 5FXWA 2TNFA 2I07B 1UY3A 4Q4W2 4W4ZA 5BNOC 4BA6A 4GKYA 3TAYA 5CBLA 3WP4A 2HBTA 1Y4WA 2DVDA 4COUA 2LTNA 1H2KA 3LA7A 1E5RA 2ZHNA 5DAPA 4AL9A 2H0BA 3D6EA 1W2OA 1G6NA 2ZX3A 2WC2A 4KBZA 1UZYA 1W6NA 2OZJA 2HWF2 3AZWA 5A3MA 3I49A 1DGRA 2W47A 3VZLA 4OLLA 3BPZA 2OS2A 3CF6E 4OHZA 4NHLA 4UF0B 2BZDA 4BJ0A 4FXGB 1KDKA 4RGAA 1UPSA 2RS31 3ZFFA 4CCOA 5LEKA 5LY1A 3T0DA 1ZRIA 1LOCA 2W2IA 3RNSA 4AEMA 5DDJ1 4GH4B 5KXBA 5FTTC 4IV3B 4AVVA 4CTEA 1PO11 1W2AX 1OURA 1UYZA 4GH4C 4YNIA 4MHRA 1UL9A 2ZGUA 1MVEA 2E7TA 3OBTA 4IV3C 4JGZA 4UXAA 4QGMA 1X9TA 3DPRA 5CIRA 5IVBA 1ZBA1 3KSCA 5FY4A 2XDVA 2YB7A 3B3QE 5FWEA 2XKPA 5AC91 1ZRDA 1QJZA 3WQBA 3LA3A 2YZ4A 3ROUA 4DXZA 1U12A 3LCPA 3M2MA 1HJFA 5FZOB 2FDHA 1W8ZA 3SC7X 5JPNB 1VE0A 3KV6A 4C0BA 1ZYBA 3POYA 1AYN3 1OA3A 2V4VA 4Y5TA 4YGCA 2BVBA 1Q8PA 3A4UA 2IXJA 3R4UA 5C4WA 2AEZA 3FMGA 3HN1A 4A4AA 2WFF3 1AR72 5LW9A 3VB9A 1US3A 1XNBA 5JR2A 1A78A 4WVMA 4DFSA 1VPHA 4CRQA 4XPVA 2VTFA 5DAQA 1HRI3 1I6XA 4INDA 3VKNA 2VUDA 2XH6A 1AXKA 4NO4A 1R093 1VP6A 2OPWA 2E51A 2P6CA 5JI7A 5C5UA 2FCUA 1TME1 4A3ZA 2JD4A 3O1UA 3T09A 2RMU3 3V0AB 2B46X 1PGL1 4MADA 3HR9A 2RE9A 5IJRA 3RZZA 2UYAA 4XHXA 1R083 3KHCA 3J4UH 1OLME 4AF9A 3CLPA 5FXZA 3MDPA 1BVP1 4JDOA 4NR1A 3OPTA 4L8QA 3AMNA 4AVBA 5F3IA 2VNGA 5T3NA 2VAUA 1VB4A 4TXWA 4CE8A 3D82A 2PAKA 3I2OA 1GANA 1D2QA 1NQDA 3GZAA 3VV1A 2JDKA 1VBD2 2VCCA 5IWFA 3U0ZA 3RZMA 4BK4A 4MLOA 3BTZA 2Y33A 4Y20A 2G4IA 1HX6A 1C8M2 5IK7A 1R1ZA 4W65A 4BH9A 2PMWB 4LUMA 4XMAA 5A3OA 3JB4C 1J58A 4CCEA 3WQ0A 1HB1A 1RTVA 1OUXA 3WF0A 1LOBA 2RS51 3E5UA 5J36A 3KCYA 1FNZA 1UMIA 4LO4B 4AFBA 3O1RA 1LOFA 1OF4A 1WBLA 2AENA 4I3PA 4N8MA 1G9AA 1H9PA 1WD3A 1WCDJ 2IVJA 2W0XA 2KXLA 2AEYA 2K2SA 1AR91 2YC0A 2P1BA 2ZEXA 4XFCA 5A7WB 3ZSKA 4LULA 5DAXA 4COYA 4YWAA 3IAQA 2YPJA 3SHRA 3AXEA 2AC1A 1RUF3 2H6CA 2Y26A 3PIGA 4R8HA 5HPOA 1I1EA 4NN0A 4OI0A 2B4KA 5FY9A 1GNZA 5SV8A 1F15A 3VD7A 2GC3A 4IQPA 3BI3A 4FFIA 1YEWA 1W28A 2DCTA 1UOGA 4G9SB 5A80A 3KGZA 3PIJA 2BBAA 4BPZA 3VBSB 3FHQA 3IDCB 3LIGA 1GQGA 2W3JA 4B7KA 3HQXA 1ENQA 2O0OA 4P00B 3T4HB 3I59A 3KHBA 4CSWA 2DF7A 1POV0 4QMAA 5GLWA 3VBSC 3ZFGB 4B29A 1L7LA 1FI2A 4IEVA 3WG2A 5FYUA 2NMOA 1H1AA 3GF6A 3ZFGC 2YGMA 2RM21 1W39A 5LB6A 3IBMA 1LRHA 1W9FA 1NOVA 4OUSA 2A6XA 3WDWA 4A44A 4AVSA 5KHIA 1QDOA 2JE9A 4OMDA 2BNOA 1ZZBA 1T6BX 3MEPA 3QD6A 4COWA 2RS12 4XDPA 1EP0A 3SEEA 3HNMA 1PMHX 2BBVA 5F7UA 3OGGA 1CAWB 1W90A 4KWJA 4YG3A 3ZLIA 2VMCA 5CEHA 4B8EA 2ILMA 4AHZA 4CCKA 1Y7BA 3FLTA 2VQAA 4QDQA 3VKFC 2WL1A 1US2A 3AFKA 4Z2AA 1AHSA 4XUPA 5CFCB 1PVC2 5C8WA 1F4HA 5SV5A 2PQQA 1ZX5A 5J37A 2RDQA 4URAA 4BISA 5C6CA 4MXWA 2QNKA 5T5PA 2ZGMA 4DB5A 5EJ1B 4CU8A 4LO8A 2I2SA 5BY5A 2WA3A 5L19A 4AI0A 4AI2A 3NKTA 3C2UA 3C7GA 4CDWB 1GYKA 1P8JA 1Z0HA 5A3PA 3BUCA 1RINA 1TQ5A 2D98A 4HKOA 2JICA 4CUBA 4LHSA 3VDDB 4XETA 4IE0A 1BK1A 1H4HA 1LHOA 1GOHA 1BXHA 1HRI1 2PFWA 2RJ2A 1DYOA 3N3HA 3OYWB 4CDWC 4E4SA 3VD4A 3U1XA 2J1UA 4XFHA 2WIIB 3KF3A 5D8AB 3VDDC 3X29B 4D7YA 4F7ZA 5BNQA 1RUH3 1TE1B 2QCSB 2XLFA 3JD72 4IL7A 4CDUB 5DQ0A 2OXBA 2RMU1 4XW3A 3ZXKA 5CFCC 2Z5WA 1PIV1 4NUBA 4QPGA 5FR3A 5K8SA 5D8AC 5K0UA 4CDUC 2XL7A 5FP4A 5E6HA 1O8SA 3SXWA 3RWNA 1VBC2 4ONUA 4P14A 1Q3EA 3S6PA 5LRSA 4KBBA 3QOPA 1OOPA 4AI3A 1F8VA 3OPWA 1JZ2A 2BOIA 5BNNB 5JXGA 3Q8BA 4HSLA 4BMEA 5F6KA 1JZ6A 1L7RA 4JHZA 1QJEA 3DKWA 4Q4V3 5BNNC 2JKBA 3U14A 4AOCA 2GN7A 4DEQA 2IXCA 4XVHA 4YW7A 2WNVA 3HN3A 4YVWA 4FPOB 1VR3A 4X6RB 1CIYA 2ZMNA 4Q4W1 3J7NA 1GKBA 4N53A 5CG9A 5BUVA 3ILFA 3RMYA 3N9MA 1WCUA 5FZBA 4IE4A 2FCTA 4AGRA 1RUF1 1EV12 3GZEA 2UWCA 3OEAA 2CNAA 5IVEA 5KBFA 3QH7A 4IEUA 2W1QA 1NZCA 5FRAA 4Z92B 4XJWA 1JUHA 3GM8A 3ZXDA 2R16A 4FP3A 3UNPA 1IG0A 2C26A 3MYXA 3WG4A 4FXKB 2VUAA 4EWDA 3KVAA 4P9WA 4P9GA 2C1FA 1U5ZA 2VTXA 3MV11 1JZ4A 5CG8A 2KA3A 4LITA 2FBEA 2XHNA 1FYUA 1U5XA 1ZRCA 4GB32 1S2EA 1MS5A 2LUWA 1KQRA 4IEPA 2VOXA 2HWE3 3LSDA 4JVAA 4CUGA 5FP7A 4DRRA 4B7EA 5FKCA 5FYIA 1LGNA 2G9GA 4R9CA 4H2AA 2DU0A 3B02A 4NVPA 3TNQA 4XCAA 4M0NA 1K45A 5FQ0A 3H8XA 4XACA 4IEQA 3WNMA 1XE7A 2YGLA 4A7YA 3NWKA 2B9VA 3N36A 2OQ6A 2QQJA 4L92A 4Q29A 2JDNA 5CFDA 1TZOA 4ZKTB 1RXGA 4AXOA 4BDVB 1ND2A 4MX3A 2WN2A 4LHKA 2DYCA 3VHOA 4BQ1A 5JOXA 3PU3A 3PHMA 4B1MA 4Z8BA 4XQ4A 4QKNA 1DP0A 2R073 3O0WA 4OHWA 1V9U3 4XDQA 4CPBA 1O8PA 2IUWA 5C3OA 1HLCA 2D93A 1TEIA 1XNCA 2J1VA 3FN9A 1ULEA 2Q0AA 2OKXA 3JB8A 3WW4A 1AX0A 1PK6A 1AR71 3ZSLA 1AVBA 5FZ6A 1H6XA 1ZA4A 5JOWA 1YIFA 2XB6C 2E9QA 4FI9A 2VD7A 5CADA 4EROA 1VRH2 2ZABA 4XJZA 2WABA 4LORA 3THDA 2XJUA 4B3NA 2NMNA 4NIDA 4D6QA 3H1WA 4XOGA 5T52A 5E88A 1AF9A 1W06A 3WX5A 1EPZA 3T2PA 3BCWA 2HEWF 5FMOS 2ZEZA 1WMDA 2XUEA 1GICA 3HNYM 1W6OB 4AEDB 2Y0OA 4DPNA 1YNAA 2VMEA 3KCCA 5KWRA 1UU4A 3TEYA 5BNOA 4LE4A 4E4DX 4K3UA 3P6BA 3B9CA 5GZEA 5A7PA 4AEDC 5I8YA 2FHRA 5FPZA 2W9XA 1QJY3 4IE5A 2IFRA 1UU5A 3WHUA 1XYOA 2Y38A 4CP9B 4UW6A 3MUY1 4GIQA 4JDMA 3IZOA 1UY1A 1ZBE3 2KR2A 3ZPYA 3WVJA 2A73B 1GNHA 1C8M1 2OA2A 2R7EB 5HCHA 4V2VA 3CHXA 3MBWA 2GNTA 4CCDA 1OT5A 4YG6A 4K7JA 1LESA 3CIHA 2E63A 5G05L 1JN2P 4N9HA 1F4AA 4YW3A 2V09A 3BU7A 3IDAA 1FMD3 2GZWA 3MIEA 4NRMA 4YW2A 1REEA 2QJVA 3B01A 4UF0A 1DBNA 4WM8B 4IGPA 4BMBA 1VMFA 2RR13 3PJYA 3AP6A 1W0PA 4FTEA 1OFNA 2VZTA 1QJU2 4GH4A 4WM8C 5FAXA 2V72A 1HKDA 4IV3A 4UFHA 4RN5A 3RYKA 3WZ1A 3A0NA 2WYSA 2XVLA 4I0WB 4QQLA 4HKWA 2W1UA 4QX7A 1ND3B 3ES4A 4YZ2A 4YSFA 2ZXQA 3NO8A 4CDXB 2CYFA 3POIA 2W95A 1JTZX 2F6BA 3WW1A 5A1LA 5FLJA 3FX3A 3PL0A 5DN2A 1ND3C 2D40A 4PLOA 2VZSA 4QHBA 3AYDA 4CDXC 5DPNA 4CCNA 3NAPB 5FZOA 4K8RB 4IV1B 4MGYE 3H8RA 1C3HA 2D97A 2CY6A 4WV8A 5C9AB 5IK8A 1UXXX 3NAPC 4IV1C 5FKBA 4I01A 3VBRB 1U5IA 5A70A 3R6SA 5C9AC 1SG3A 1X36A 2XG3A 4QXCA 4TN7A 1B09A 4FFHA 2AREA 3VBRC 1EY2A 2Z69A 3NMBA 4IEWA 2LRPA 4K8FA 3ZXFA 2HWE1 2VOVA 4GULA 4LBQB 3WUCA 5C7GA 2ZGOA 2QQMA 1DHKB 1KITA 1SCRA 4DQAA 4XJ8A 4LTAA 1SLBA 2X05A 1UOJA 3O1PA 1GMMA 2EALA 3FBYA 3VN4A 1MZ5A 3V0AA 3IIAA 2R32A 5JXJA 2G19A 4LA3A 3RMXA 5DDJ2 3JBG3 3TB0A 3ZYPA 3VHNA 4DXTA 4EQVA 3JU9A 2W68A 4QKFA 5F5CA 1PO12 1VAMA 1QQP3 2WKKA 3R0RA 1W9SA 1BQPA 5F5IA 1GZTA 2OW4A 1CR7A 2GH8A 4NE9A 3HIFA 1C8NA 1JI6A 2WLQA 1FOD2 4BQXA 4C1WA 2R071 2E26A 2JDHA 1I5PA 1V9U1 1ZBA2 1V6NA 3MFAA 1ULOA 4LLFA 2R6QA 5DZEA 4PIZA 3ABZA 3ZMOA 2DCJA 3ZXEA 3KQ4B 4R52A 3H3UA 1XB9A 5CA6A 4CUCA 4Q0UA 1O3TA 1CZTA 3VBHB 1V6LA 5J48A 5JUVA 3DGTA 1OHFA 1ASJ3 3GGLA 4RQPB 4WM7B 1F5FA 3VBHC 4B4QA 2P34A 3JD71 1TNRA 4ARYA 4CUAA 2OX0A 4RQPC 4U36A 4WM7C 3N7MA 5A7WA 1CZVA 1PX3A 1ST8A 4WVWA 5J1XA 3LFIA 1Y9QA 1WLTA 2WZR3 1GUIA 1UYXA 2E32A 1IPJA 2O1QA 5FY0A 3C7EA 2JDAA 3VL8A 5I8TA 2P17A 2FMDA 3K46A 3EB7A 4QU2A 2WSUA 1D0GA 4LBKA 1KFUL 1JYWA 2VMGA 1DGWA 3K4ZA 4AQ6A 3AKPA 5HV4A 1RVF3 2XMLA 2WWJA 2W92A 3M3OA 4QB1A 4EN0A 2D6PA 3VBSA 2W08A 3CL1A 5FUPA 1ZVFA 4AR2A 1LGCA 3OBAA 5GZGA 3LQCA 1BBT2 5KXEA 1SLIA 4SLIA 3ZFGA 3U4XA 4P08A 4PLMA 1T6GC 4JDNA 2RG4A 4H7LA 4YGBA 2EXHA 4AE2A 4QT6A 4YM1A 2B45X 2X29A 1KEXA 4XMIA 1SBDA 1Y43B 4R4ZA 1CIWA 2RVAA 4Y1VA 4NPRA 1DLCA 1S0IA 1RGSA 2K9ZA 2BVVA 2DTWA 2Q30A 2HWB3 3SKVA 2RS52 2GC2A 4LK6A 3ZKYA 5K7PA 1FAYA 3BTXA 1CAWA 1VMHA 2GDFA 2BU9A 4COZA 2D6NA 3FHIB 2A6ZA 4XUQA 3T2OA 3USSA 5DAVA 3VHRA 3WD5A 4C91A 3SCFA 1AR92 1AR82 3EMRA 1NCQB 3KM5A 1XU2A 1IGOA 5FPUA 2RJKA 5JOYA 3HEIA 3PLQA 4JX0A 5FK7A 3IPVB 1NCQC 3T3YA 3ZDVA 1UYPA 4UW5A 1LULA 4R9AA 4P9JA 3VKOA 3VKLA 1GQHA 3K75B 1JODA 3PUAA 4XC9A 4BQ3A 4Z1VA 5CKNA 4CP2A 3OJBA 3W59A 4RFRB 1I5ZA 1BVVA 5CKMA 2WWSA 4MHUA 3K77A 4PI2A 2IXKA 4IEOA 2VW0A 2R063 4P5YA 4Q4Y3 3I4IA 4Q26A 4AI1A 4CDWA 3I2HA 3RZLA 2VCBA 3GDBA 4FPEA 2HBUA 3VDDA 4J1XA 3H1MA 5F2WA 3OYWA 3V56A 1NZIA 1WMEA 3W20A 3UKVA 3WF2A 5EXOA 3MICA 1D0HA 5IUQA 1RUC3 2AYHA 2BV4A 2QKDA 5D8AA 2HWD3 4YVSB 4CDUA 4JKMA 4MGQA 2W87A 4OYUA 4RD7A 2OYZA 3PVBB 3RS6A 2JB8A 2FDJA 4LKSA 4YVSC 4XZPA 1I3HA 1SHWB 3WCRA 3UKTA 2Q8OA 1COV3 1DQ6A 1FPN3 1UOFA 2C24A 3D8CA 3WP5A 5FOJB 1VRH1 4CCLA 3O12A 4L2NA 4NWVA 1QU0A 4PDWA 5FMCA 2GMPA 5BNNA 1LTEA 2GNDA 1FT9A 5FY7A 1GNYA 5FIXA 3T2TA 1LOAA 1QJX3 1UO9A 2NYYA 1OQEA 2D7FA 3AXDA 2D43A 5FY8A 3M70A 1H8VA 3NSTA 2WO7A 4A7KA 4M3CB 2RJLA 1UKGA 2Y6GA 3PNAA 4MGZE 4RYDA 2UU8A 4LMFA 3O1TA 3ETQA 1ASJ1 1JHJA 1GP4A 4CU9A 4ASLA 1AYN2 2GNMA 2YU2A 3PJQA 4EZHA 1BYHA 5LBCA 5C5TA 5IVYA 4I0BA 5C3QA 1W8UA 1C4RA 3BOPA 2G1MA 4L99A 3BVCA 2Q8DA 4ET7A 2IWGB 1XYNA 2F4PA 2WFF2 4FOQA 3M3CA 4NMIA 1L7QA 3LGRA 4OCTA 4BK5A 5JAXA 1Z7S3 3O14A 2JKXA 5A7NA 5LY2A 5FYMA 5IFTA 1HRI2 1XYPA 3AMHA 1XNAA 1R092 1WKYA 3AZZA 3DXTA 1SPPB 4JRAA 1JOBA 2WYFA 1XNKA 4LHNA 5F32A 2RMU2 3A7QA 3TWIA 1RVF1 3H8OA 4KI5M 2A3YA 2ZAAA 3WG3A 4W6WA 3SQOA 4K1YA 1R082 5J98B 4AFAA 1O5LA 1QJU1 2WJSA 4AEKA 4C90A 3PU8A 1PVXA 2IVIB 2XLGA 2P3IA 3ZXLA 2LROA 4XBQA 3BTYA 3C7OA 3OEBA 4AHXA 2VE1A 3ELNA 2V73A 3MI8A 2NN8A 4FT8A 4QPIA 2DURA 1Q56A 4QD2A 5KC5A 3DYPA 1RUOA 1S4CA 3ZMNA 3FWEA 3SISA 4ZZ8A 4Q27A 1Q8VA 1X82A 3QH6A 2XOMA 2JG9B 2AGSA 3WDXA 3JQXA 1E57A 5FYSA 1JYVA 2HWB1 2ZGPA 2ZA9A 4AEJA 1OA2A 4UAPA 2JG9C 5C3PA 2WQZC 3DYOA 1AXZA 1J3QA 1NAEA 1SFYA 2V5YA 1ZA7A 2WRAA 2WS93 3EO6A 5T54A 3VLBB 4YZ1A 1SFPA 4PI0A 1WLDA 1UAIA 4TLGA 5CAZA 4XF4A 1RUF2 5FXVA 3N9NA 3W5NA 2UY8A 1XNDA 4GJYA 2WO3A 4LHLA 4B4RA 1HB3A 1O59A 5A3LA 5KR7A 4CVUA 1J1TA 2E33A 2JD9A 3AVSA 3KD4A 4GALA 2IXIA 5FP9A 1EAH3 5FWJA 1XOYA 4PQ9A 5A6ZA 2DUOA 3K4AA 3NQHA 3RZKA 1SBFA 3V64A 1STMA 2ZGLA 3WF3A 4Q4Y1 2XHKA 2R061 4UW3A 2VBDA 5FDBA 2P4EA 5T55A 3MIFA 5FK8A 5DMYA 1W6OA 4AEDA 4UFKA 2WNUB 2VECA 2PAEA 2MPFA 5LA1A 2VOTA 1RUC1 1FOD1 4PBPA 3MZHA 2WNUC 1KXGA 5FYVA 5JR7B 3INAA 1YFUA 3UETA 4S2DA 3HQUA 1TMF3 4CP9A 3Q8AA 5LEJA 3KT4A 3I3MA 2UYBA 3VGIA 3RWKX 1SDWA 3PVEA 4AW7A 1MEC3 4FPJA 1XBFA 4OHVA 1COV1 3WDUA 1FPN1 5EPAA 3AL5A 5FJKA 2D44A 3A0KA 4QX8A 4K1ZA 4K21A 5FOBB 2ID4A 2JECA 4EN6B 4F3JA 1N1VA 3GALA 5FPXA 2A70A 5J7MA 3CKHA 1X9PA 5JZGB 1VBB3 2ARAA 1LHVA 3D4KA 3DXUA 3T1MA 4WM8A 4N9IA 4O9GA 4UWDA 4Y4YA 1W2UA 1N1TA 5JI9A 3OSDA 3PVNA 5JZGC 3T0BA 4QB2A 4L0PA 1X33A 3FUOA 1POV3 3E6DA 5A1FA 4EWEA 4PHZA 5GLUA 5A3NA 3U07A 2A7AA 1H2MA 1JOPA 1UZ0A 4MH0E 2BUKA 1JU4A 4OVEA 2XJQA 5EIYB 2DBIA 1ND3A 2Y6FA 4KWKA 4BQ2A 4CDXA 3ZN5A 2P37A 1Q43A 3I8TA 3AKTA 2ZCWA 3NVCA 3PTYA 4NRPA 1Z7S1 5DAWA 2JIGA 4H55A 2SLIA 4FPCA 4Q5OA 1BBT1 1QH7A 2VZUA 1WCSA 2DVGA 3OUIA 3N9PA 4IV1A 4NOTA 4UBHA 1AJKA 4LLOA 1HW5A 1NXD1 3RJ2X 4JAAA 3WOGA 1UZVA 1RUH2 3HT2A 5C9AA 1XE0A 3PURA 2B7YA 4ISRA 3UV9A 1V00A 3VBRA 1C28A 1E5IA 1IZ3A 5H9QA 2UY9A 1LEMA 1JYTA 4P9IA 3OD0A 4DEVA 4TLFA 5F1RA 2QQPA 4RGGA 3T1LA 5JIAA 3URFA 5FP3A 1OLMA 4HETA 4LBQA 4W50A 5JIUA 5FPVA 3DECA 4LR4A 4ITCA 3S7EA 4FQ4A 2WAAA 5EYYA 1AR81 4PT6A 1H6YA 2WQ4A 3N7KA 4PLNA 5FYYA 4BQ5A 3I3DA 4Q4V2 1OD3A 5FZKA 2PLV3 1AJOA 5GLZA 2F17A 1DFQA 3NV4A 3JXSA 2FMYA 1CAVB 5GZFA 2BOJA 4UOJA 3KWVA 2WS91 4FVVA 1UX7A 2HJIA 4C0HA 3AL6A 1DG6A 2ZX2A 2ATFA 2BERA 2Y64A 1O3RA 3BALA 4XFBA 1NUKA 4LPLA 1O4ZA 2QFEA 3GCXA 4OI4A 3VBHA 4AG4A 3HPNA 1IG3A 3AZXA 1CWPA 3VL9A 4JKKA 4DIQA 2QUOA 4RQPA 4YPJA 4WM7A 5KXDA 1UD1A 2D6LX 2XBO3 2EIBA 3LPFA 4C8DA 1EAH1 1NA1B 4E2SA 3ZR5A 2HWC3 1L3JA 5EV7A 2CWMA 3USUB 4OQ8A 1UWWA 3P3NA 1NA1C 5GZDA 4Y5Z0 1C5HA 2Y8KA 4IXLA 3VBOB 4NWWA 2HWE2 4AYUA 3WQ7A 3MIGA 4FOWA 4QQOA 4C1XA 4AQ2A 4X6QB 3TNPB 3O1OA 2BPA2 1UCXA 3VBOC 4HFSA 1A8DA 1YXWA 1RUI3 3WQ1A 1JYNA 3ZSEA 5IVCA 4XJ9A 4I0AA 3GYDA 3IDEA 1HQLA 3NNFA 1TMF1 3ZN6B 1RB8G 1PNFA 5JMCA 3N7JA 2IFWA 1MEC1 1B35B 5H9PA 3KS7A 1ULPA 1G86A 5I0UA 1QF3A 3POSA 4JHTA 1AYN1 2ET7A 3RSJA 2R072 1MACA 3AP4A 1B35C 1V9U2 4Q0VA 5FZEA 3PMSA 2BWAA 4MV2A 1W2NA 4LJHA 3H42B 4HZFA 4AVCA 2JIJA 4JQTA 3AP9A 1JHNA 2WFF1 3CDZB 2YC4A 1JYCA 1MPXA 1RUG3 1POV1 2R043 3LD8A 3LOIA 4Z2WA 1BMV1 4WVVA 4KWLA 2QE3A 1R091 2JEMA 1DU3D 1UY2A 2CTVA 1LU2A 1GSLA 2ES3A 3ACGA 3CMGA 4IEXA 4ZU5A 3CBNA 2VZ1A 3NJZA 3CZJA 3U11A 5BYNA 1NCQA 3AK0A 4HONA 1UY4A 2YFZA 1OSGA 1LAJA 1YLLA 1HRV3 2OZ6A 4Q1RA 4JRLA 3DKQA 2ZMKA 1WCQA 1R081 4XHBA 4FQZA 1AZDA 2ARBA 4YFZA 5FZ9A 3KV4A 4YGDA 1OC1A 4D8MA 4ZXKA 1GV9A 3POJA 4AFDA 5IHRA 1WA6X 2V5DA 4GJZA 5T5LA 3WG1A 2FDFA 4MGTA 2XJRA 4XTMA 3E1F1 4ZXEA 1QJY2 1NY71 4J6GA 1BZWA 1FNYA 1XU1A 2X10A 4HVRA 4Q4X3 5BPXA 4DOUA 4D69A 1ZBE2 4EN7B 5FZCA 1RUE3 3M3IA 4M4RA 2P5BA 1A8MA 2PQSA 3VBFB 3RZGA 5C3RA 2C9KA 1IPKA 5BXXA 4BQ4A 1KFXL 3J9SA 5G04L 3VBFC 2XVGA 1FMD2 1OMIA 2P3KA 4BXSV 5F37A 4AHWA 2WZEA 1XPWA 3I3QA 4YZ4A 4YVSA 2QDRA 4AVAA 5A33B 4LKEA 4JC1A 2RR12 4DO0A 3IIIA 4W6YA 2GP5A 3BN6A 5IYYA 3AYEA 2PLV1 5L73A 2LS6A 1W8TA 2XJVA 1AR63 4NPMA 4WZFA 4EV0A 2OQ7A 1JU3A 3NJVA 1PNGA 3M8LA 5FREA 2LM3A 1M4WA 3LDRA 1PZ9A 1WW6A 4DY3A 4QHOA 5ABJB 4OHYA 2Z2SB 2YMZA 3KZ4C 3WUDA 1W6PB 2WFPA 4NIHA 3T4VA 2QQLA 2ZHMA 3GBWA 5LZ6A 2P3JA 1GBGA 1IS4A 3MW3A 5ABJC 1JZ8A 3M4FA 2D3SA 4M3CA 4D0QA 2O8OA 5FFOC 1JOJA 3ZYRA 1ENRA 1QNWA 1OF3A 2I74A 3MPPG 4R4XA 2HEVF 2PN5A 3G6JB 1AL23 2XBO1 5LATA 3ZSMA 1ZRRA 4NROA 1PO23 2HWC1 2R1DA 2RDRA 3DL3A 3W21A 5HV0A 5FZMA 4MGKE 2CHHA 3NJYA 3TEXA 4UT5A 2KM2A 4QX5A 5CU1A 5FZ4A 2WO2A 4LT5A 4NIIA 5F8PA 1WLWA 3GBGA 5GLTA 4QGNA 3ACFA 4R9DA 4KG8A 5EZWA 4LUKA 3RYPA 1SPPA 3H50A 5KXCA 2BNMA 1RUI1 5BNPB 2ENRA 3BU0A 2Q4SA 3LDBA 2IZWA 4LQRA 4CU7A 1W6QA 1S2KA 5AFEA 3TN93 3UKNA 3JBG2 5BNPC 5FPBA 2EIGA 1QQP2 3TOJA 2GH2A 5F5AA 2BFUL 1XE8A 1MS3A 1IOAA 3H3ZA 2VQTA 3EQEA 5FP8A 1LB2A 3AX4A 2H0VA 4UW4A 5HXVA 1CJPA 2JE8A 5FCCA 2FD8A 2P2KA 1QNYA 2JXAA 2VPVA 3LE0A 3W9AA 3WNNA 4AWDA 1YQ6A 4ZS3A 4NAOA 3ACIA 1SFNA 3DCQA 1RUJ3 1QDCA 3AP7A 1RUG1 4UBGA 1PHMA 2JG9A 2VTXJ 1RJ7A 1DQ4A 3UESA 1H8TB 1LOEA 1V6JA 1ASJ2 3KGLA 3P1IA 2QQNA 3PUIA 4BB3A 1MQTB 5DUUA 2UWAA 2PELA 1RUH1 4NHKA 4ISQA 5FO9B 1H8TC 3NNLA 4CP0A 1MQTC 4FPFA 3P3PA 1HRV1 5CVRA 2PHXA 1SLAA 3SH5A 1S0EA 2LW8A 2WZR2 3CJIB 5I0DA 1S0BA 2C4XA 5F3GA 2XPJA 2HYKA 5ERLA 1WLCA 2VVDA 4QM8A 5FZ3A 3CJIC 2MEV3 5A3WA 3KV9A 4IESA 2WO1A 1RVF2 4N90A 2FZ1A 3PVOA 1VAVA 4Q4X1 4A41A 1GWKA 1WMFA 4CEWB 4Q4V1 1RUE1 2PTMA 5CB7A 2VMDA 2PHDA 2VR4A 4Q1PA 3K51A 3OGJA 3ZPOA 3NV3A 2VZ3A 2YC2A 3AZVA 4CEWC 2QQKA 1J1LA 2GAUA 1W3VA 1DGWX 3ZVXA 5E8AA 1ACCA 3OUJA 4OMCA 5GLVA 1UYYA 1GZCA 1WGPA 5FBZA 1YUDA 2D6OX 3HNBM 4IGQA 2VNRA 3WDVA 2O14A 3IAPA 4EN9B 1GQPA 4AI9A 4PIXA 3EBRA 5TSWA 5FYCA 2E31A 1YC61 4JQRA 1GU3A 5D21A 1DDLA 4EJRA 2HWB2 2QQWA 3POBA 3LPGA 5ANNA 2Q8CA 2QTWB 3O0VA 1IS6A 2AZ5A 3AMQA 2ZTNA 2HYXA 4LIUA 5GM0A 4TZDA 2VU9A 2NQYA 1IQAA 4WZCA 2R1BA 1H2LA 4HT1T 5JZGA 2R49A 5DG2A 1W8FA 2OUJA 4KU8A 3T0AA 3C8XA 1DQ5A 4FO9A 3FBMA 4XIKA 1QWRA 4R9BA 3LB9A 1LJ7A 4FPHA 1A34A 4GB33 1Q5OA 2ZZJA 5FZIA 1O3SA 4RS5B 4GWJA 2VQ0A 4XAEA 2PHLA 3TRSB 4UFJA 1LU1A 1S0CA 4HOOA 2AH2A 3Q8CA 4MOAA 4Q4Y2 4RS5C 2XWJB 1QKQA 1S0DA 2R062 4FP2A 5L7OB 2A1XA 5KHJA 2B39A 5HCFA 3DN7A 3Q9OA 3R4DB 1D4M3 1UF2C 5EJ3A 5LK5A 1UKRA 5E16A 2CGPA 5L7OC 2Q1FA 1OVPA 4LXLA 5HBAA 1RUC2 1F31A 2GN3A 1CX1A 1PGW2 2HEYF 2WT2A 2HWD2 5CYYA 1YJLA 1LEDA 1UIJA 1CVNA 4FSJA 2WT1A 4XXAA 3WCSA 2VL4A 1GP5A 2D6MA 3U78A 2XONA 3WY6A 2X5IB 1W04A 3A21A 5KHHA 5ACA3 2Y34A 1COV2 1FPN2 1O4YA 1D2SA 3E5XA 3OTFA 5FY1A 2JDUA 4HLTA 4JTOA 4CDQB 4QPWA 1R1A3 2R30A 2X5IC 4H7MA 4XQDA 3RRDA 4MXVA 2VBBA 1KRIA 1GZWB 4CDQC 1DQ2A 4PQQA 1QJX2 3ZFEB 4BZ4A 4B4PA 5LBBA 2YFUA 3H0OA 4A3XA 1ULFA 1GR3A 4QX3A 4BOWA 2J1EA 2WUHA 4RHV3 2DVAA 2YPDA 4J25A 1YQ8A 3IN9A 2AUYA 2VC9A 2WT0A 3ZFEC 2QBXA 4AAPA 4PBOA 2E7AA 1NCRB 3OY8B 1CAVA 2K0GA 3LKJA 5AVAA 3B94A 3WF1A 4AFMA 3THPA 3NW4A 3RQ0A 4M4PA 3MIHA 3J8F3 1NCRC 1QJY1 4ZONA 2ZGNA 1JW6A 1XSQA 1ZBE1 1OPOA 2XR4A 4F83A 1Z7S2 3B00A 4WBBA 3MW4A 3KLSA 2VZOA 5CZKA 3ZM8A 1IKQA 4ATEA 1CESA 3GJAA 3U37A 3S0MA 4BIFA 1PGSA 3O7OA 2GMMA 3MV01 3T08A 1N1SA 1UPIA 2ERFA 2D3PA 5FPAA 5JSRA 2YUEA 2JX9A 4X8NA 5ANQA 4TYSA 2MEV1 1FMD1 2WR9A 4KGGA 1RMU3 1NA1A 2OUHA 5L9BA 1K42A 2Y60A 4XDOA 1YHFA 1F2NA 2RR11 2WA4A 5C70A 4XFFA 3USUA 1W9YA 3OGRA 2W1SA 2XKOA 3SEPA 1BEV3 3VBOA 2Z79A 3J7HA 4QAWA 1RUNA 5D1IA 1KDMA 4DUWA 1DZQA 4XFIA 4Y22B 5D2AA 5FZFA 2W52A 3O1VA 3VZOA 2WAOA 2BEOA 3EXUA 3N35A 4IETA 2KD7A 4CU6A 1LR5A 1N3PA 1ULDA 1V0AA 2EA7A 4OUMA 4MSVA 2JDYA 2VZQA 4YW4A 5E89A 1OXCA 4EZ4A 3ZN6A 2DV9A 5FZHA 1UXZA 1UX6A 3HWJA 1VBA3 4K9SA 3TEWA 1BJQA 4META 1B35A 2GSYA 3UYJA 4F8AA 3AMMA 5A3UA 2J22A 3ZYIB 4EN8B 4GMP0 3AJYA 2WS92 1RJ8A 1DGRN 3NNMA 2YV8A 2DU1A 2VZVA 3BPSA 4LKFA 2QVSB 5T5JA 5HXMA 4COVA 3ASIA 4QX0A 1H1IA 4XZUG 2Q1ZB 2XJPA 5APAA 4HVQA 3OOXA 3OB8A 2FZ2A 5LA0A 2ZGTA 4D6SA 1OVSA 5K9YA 1OLQA 1LOGA 3VZMA 5CFCA 3GCWA 3I2JA 5LBFA 2DCKA 2DBNA 3ETPA 4A42A 1NQJA 4V1PA 4CXWA 1EAH2 1RIRA 2YY1A 2A3WA 4A45A 5L9VA 4ZS2A 1QY4A 1NYWA 1XJAA 1OA4A 2FDIA 3POEA 4MGIE 1OQDA 1TNFA 4GAZA 4XBNA 3POGA 1RHI3 3CNAA 1DLLA 2OPKA 1O6UA 3JBG1 3SLIA 2RS33 5EFUA 1SQ4A 4D6RA 4JV4A 1UQXA 1DZRA 1WUVA 1QQP1 4CCCA 3I2KA 1QOTA 3LA2A 4I2OA 3IMNA 3B9IA 1WZXA 2Z4FA 3KB5A 1CQ9A 4OZOA 3VBUB 4RR3B 4EWAA 1HN1A 2J1AA 3DV8A 1O5UA 1MS9A 4YVWB 2IXLA 4Q0SA 3NKGA 4CCMA 2O8QA 2VCMA 4RR3C 3VBUC 1TMF2 2IC1A 1PMIA 2ZKNA 1UIKA 3GHMA 3OBZA 4LBJA 4Y33A 4YVWC 4N53B 1E5HA 1ZBA3 1A6CA 3D0SA 3VBFA 1V6IA 1OQ1A 1MEC2 2VXJA 5AC93 1OKOA 2HKXA 4HBNA 4LNVA 1POQA 3KV5A 4N53C 1DQ1A 2ZGKA 1HQWA 1NX9A 3OUHA 4BLIA 1FV3A 2QQOA 2EIDA 1E5SA 1VRBA 1VBB2 5FMDA 5A33A 2YBKA 4LKDA 4XIOA 5A6XA 3O1SA 4J1WA 2BTVC 1RUD3 5JDBA 2WZR1 1KS4A 3GNEA 5FBJA 3DEMA 1BMV2 1NE4A 5IVFA 1JUIA 4JTNA 2VJXA 1CX4A 3BIEA 1MZFA 1W3XA 1DF0A 1CGPA 2WBKA 1GWLA 4GWIA 4QQ2A 4UFMA 5A7QA 1GZ9A 2VW1A 2WZPP 5IATA 3E97A 1S1AA 5ABJA 1AX1A 3PUSA 1W6PA 2GALA 1V6KA 3AKQA 3PUQA 4P02B 1TME3 4PCRA 1YCIA 4YW6A 3T2QA 1X8EA 1EUTA 3C7FA 3B7MA 1S0FA 1S0GA 4CCJA 4MUVA 2VVEA 1ZZ6A 4LBLA 5CFDB 2D6KA 5JXHA 1AYM3 1UMHA 3E6BA 1H30A 2Y6LA 2DWRA 1QOOA 3GBFA 1S2BA 5CFDC 1NY72 1W03A 1LODA 3R05A 4GA9A 4IEYA 3RJRA 1XQNA 3NRUA 3AYCA 1JMUB 4B1LA 3KF5A 1BEV1 4FCAA 4Q0PA 2AACA 5LWBA 2VMFA 5IK4A 5FUNA 5IT6A 4DNYA 4FPLA 2PHFA 5DZGA 4N43B 4A7ZA 4BWOA 3RZHA 2EXJA 1X50A 1AUYA 4XF3A 3J26N 3DUIA 4HKLA 1APNA 4HK8A 5BNPA 3ALQA 3GZTB 1ALYA 1R64A 3ILNA 4N43C 1YFYA 4GD4A 3UGHA 2J1RA 1V6MA 4G4FA 3I3BA 3LEKA 4UFIA 1H0BA 4FPGA 2CWSA 4IDZA 5F6LB 4LBOA 2PLV2 2ADDA 4QXKA 3IM0A 1VBA1 4XTPA 1BHGA 3JZVA 2Y6JA 1MS1A 2XXZA 2ZHLA 1UZWA 2DUQA 2JE7A 3LEGA 4HANA 3AB0A 4W8JA 3LWCA 4KL1A 4ARXA 4XUTA 4DINB 1NT0A 1SDDB 2JENA 3MFCA 2PXJA 3ECQA 4XJUA 1SZBA 3RVHA 4DRVA 3CJXA 4E2QA 3LFMA 4FAGA 4E4HA 2Y6HA 3N9QA 2OT7A 4E9KA 1W9TA 1CPMA 5H9RA 3S5AA 5LASA 1ODMA 3HOBA 4I09A 5KHGA 5FV3A 3ILRA 1F5JA 1GFF2 4YLZA 1YFXA 4X8PA 4Y4RA 3DF0A 1H8TA 4QWNA 1UW8A 4N7UA 3H9AA 1G8WA 1MQTA 2XBO2 1UN1A 2DUPA 2WNEA 1PGW1 5FZ8A 2OVUA 1F9KA 2HWD1 2HWC2 4HXCA 3MLKA 2NP0A 3BTAA 4KWUA 4ZU4A 3GHNA 4AI8A 2RM23 4AHYA 1RHI1 4H14A 4CXXA 2JDZA 2A3XA 2X53S 4ZHNA 1DQ0A 3WT3A 2A6VA 3CJIA 3ZDSA 3NJXA 5FMBA 4XFGA 4D7SA 5GJ6A 3IWZA 1MR5A 2QZ3A 4Y5SA 5FLHA 4KH9A 1RUI2 1WW4A 3IT8A 3QACA 1AL0G 2ZMLA 3LDKA 5IAXA 3SNMA 3HQRA 4Q0QA 2ZZQA 4RL7A 1QJX1 2EICA 3F2ZA 4QQPA 5FXXA 4MGSA 5ISLA 2YDEA 4CEWA 4ZU7A 3B5LB 3CZUA 2MNGA 1YYNA 5B4XA 4UI9L 3UL2A 1AX2A 1RXFA 4QB6A 1WMXA 3I3EA 4YGEA 5FYZA 3WDTA 5FYTA 2NLRA 5FLIA 3AM2A 1Y9MA 3BODA 5F9TA 3OCPA 1VBE3 4YM0A 5DUWA 3LZZA 5EWSA 1OH4A 4Q2FA 5JMOA 3D0JA 4M0HA 1C57A 3VHPA 1RUG2 1WCKA 2R042 1H9WA 1RUD1 3L9JT 5GALA 1JS9A 3RPQA 3UGGA 3NAPA 5T50A 3FC0A 3OBRA 5T5OA 4LIVA 4XABA 1IPSA 1HV1A 2A75A 4Y24A 5JCTA 1SACA 5CISA 2BWCA 3RG0A 3U75A 2DVBA 1ZZCA 1YI7A 2QQIA 3IDBB 4LO6B 2B8MA 4YZ3A 1HRV2 5DUXA 3RI9A 2XLAA 5LCWL 1PIV3 2BNNA 1W0NA 2HLEA 3S30A 3ZKUA 4PF1A 4FOVA 3ZYJB 1UNBA 3PUHA 2ZAHA 1AYM1 1N3QA 3K2OA 1HXS3 3ON7A 3I2FA 5IVVA 1OKQA 4RS5A 1QXRA 2K46A 5J96B 3C3VA 4P9LA 1N3OA 3LEMA 4OI2A 5A3TA 2VXRA 4QGLA 4Q4X2 5FZ1A 4DUXA 2MHFA 5FO7B 2DDUA 1RUE2 3SH3A 5A32B 5L7OA 3BB6A 3NV2A 3MLJA 2L9LA 1VIWB 1F35A 2WINB 3ZYGA 4D7TA 3R4SA 5F2SA 5JSOA 4O9EA 3EHKA 3AJZA 3BGAA 1OBNA 2C5DA 5L36A 1FATA 4CXYA 3ZXAC 1LNSA 3THCA 3VD3A 4XJAA 1W99A 1LCLA 2WNOA 1CAXB 2GNBA 4Q4W3 2XVKA 5BV6A 3ES1A 2X5IA 3K48A 4NHMA 4XILA 4HN0A 1AR62 2CAVA 3QCWA 1SMVA 4IERA 5JVVA 5F3EA 4LBMA 4CDQA 1OI6A 4QX1A 2LALA 2XQRA 3RFRA 4ES9A 5JLVA 5KC6A 2HWF3 4URTA 1OH3A 1ULCA 5FY5A 1GZWA 2ZX4A 4UYBA 4D3WA 2N7GA 4CPBD 5FZDA 3BKZA 3ZFEA 2HH9A 4QPYA 3AP5A 4EYUA 4FPKA 4OI1A 1CN1A 3KMHA 3S57A 3GXUA 2ZACA 5FPLA 4ZY9A 5FUIA 3ZXGA 2ARXA 4AQTA 1CPNA 3OY8A 1NCRA 4JGYB 3VD9A 2XUMA 3RZJA 2BQPA 5IW0A 1AL22 2TBVA 5IAVA 3W58A 2JJ6A 2B5HA 1PO22 4O61A 1CJDA 4I3GA 1SLTA 3NNGA 5EP9A 1J3RA 1X7NA 4JGYC 1MVQA 5AVPA 1G7YA 2D5FA 1LGBA 1W9WA 2EF6A 4K20A 4GWMA 3WDYA 4FTBA 2NZ9A 1UY0A 1JYXA 1FXZA 5GKAC 4Y1ZA 2VW2A 4FAHA 1HIXA 2W39A 4UFLA 3Q8EA 1JYIA 4IE7A 3ORJA 4HPKB 1VBB1 3MLLA 1ODNA 1GP6A 4G3YC 1IS5A 2GP3A 3WR0A 4E4ZA 3TN92 3IMMA 1UU6A 3ZYFA 4BM8A 3I2GA 3U4SA 5FZGA 4YW5A 3POFA 3UGFA 1AR73 4Y22A 4S2GA 1W6MB 4KGQA 2VVFA 2A71A 3I2DA 3ZN4A 3O5SA 2XGXA 4QXHA 1CZSA 5LBEA 4IGOA 1VBE1 4YZ5A 1DIWA 1K12A 5JWPA 1K5MB 1OPMA 1RUJ2 4MO3M 4OFGA 5DZFA 3SITA 2ZOEB 3ZX7A 1IKPA 3IPVA 1HDKA 1JZ3A 4DXSA 4NHXA 2ADEA 4KQ7A 1CAUB 1K5MC 3WW2A 2YHJA 4AQSA 3ST7A 2IXHA 4QDSA 1MS4A 2VM9A 4XEZA 2BGPA 4K6BA 4ATFA 1LENA 1SBEA 4RGKA 1HB4A 4E8CA 1BCXA 3FJSA 1O91A 2JWPA 3MO4A 5DUVA 1ZREA 1GWMA 4P5HA 4U2AA 2FQPA 1MZEA 2A6YA 2VBPA 4O7XA 2CV6A 3KVBA 4Z82A 3UT0A 1VBD3 5JXIA 4BCUA 3HD8B 3F95A 4NJ4A 2XJTA 5DABA 4E8DA 4DUVA 1ZZ9A 3SKJE 4MYEA 2E53A 4LOTA 1ONAA 4CEYB 2XWBB 3MGUA 1C8M3 1WW7A 1HXS1 1XSRA 4FPYA 4LBNA 2MEV2 1W0OA 3MW2A 4D94A 4QQHA 3I54A 4CEYC 2JG8B 1C5IA 1JH5A 4PDWB 3PDQA 3H1YA 3UJOA 4NAMA 4O65A 1QEXA 2JG8C 2Y6KA 4OHXA 2JB4A 3V65A 2A5ZA 4YARA 3A23A 4PDWC 4Y1XA 4BLJA 1RL3A 1J84A 1UOBA 2J7MA 1YQCA 2D3RA 4E27A 2H6BA 2VZRA 3OF1A 1G9BA 3VBUA 2DCZA 4RR3A 4BHPA 2NM1A 1PX4A 4A6OA 3KCXA 1RYYA 1KS5A 1PZ7A 2VZPA 3A22A 3FHAA 2Y0IA 3RDIA 3FE5A 1FV2A 1ZZ8A 1EUUA 4QU1A 3MIDA 1QIQA 2DCYA 3GJBA 1OLRA 2CDPA 2WN3A 2PHRA 1VALA 2Q5TA 5F3CA 1OFSA 2VNOA 3VZNA 4M3CE 2EVXA 2ZJCA 2HWF1 4OUEA 2ZKLA 3FFQA 1UZZA 2VCAA 1OUSA 4GXLA 4P9XA 4XFAA 1QOSA 4MZUA 4Q8LA 5A7OA 2B42B 2WQ8A 4IUGA 2BW8A 3VD5A 4LO5B 1UMZA 3U10A 1X8MA 3V0BB 4YYOA 4HK9A 1HV0A 3ZIWA 3WLUA 1DZTA 2BGOA 4MVTA 4QXBA 3FLPA 2CGOA 2RS13 3ZYHA 4AGVA 5JSPA 1JZ5A 3K4DA 2BFUS 3ZSJA 5I8SA 4BU2A 1BK0A 3BOWA 1SCSA 4FBFA 5A6QA 2Z42A 3KT1A 3FL7A 3WW3A 4QPIB 4YW1A 3SCHA 1D4M2 1HJGA 3WHTA 5C33A 5C8CB 3LOBA 4HN1A 2ORZA 1IS3A 4QPIC 1PM4A 3AZYA 5LA2A 1VMJA 1URXA 4P9YA 4PIYA 1PVC3 2QDNA 5I0SA 1SLCA 5A1AA 1NKGA 2ORXA 3P5BA 5C8CC 1J83A 3HAGA 1QMJA 3J7MA 4LE3A 3MHZA 2EAKA 3VDAA 2R041 4AVTA 5ACA2 2UURA 5J3UA 2CGNA 2QQVA 4K40A 2JDPA 3VDCA 1G9DA 1R1A2 2CSGA 4TWTA 4DXRA 3IKWA 4N43A 3RGBA 1OD5A 1W6NB 3HBKA 4QKDA 3CU7A 1ZZ7A 1DGLA 1QHDA 4Y1UA 3WNKA 3DYMA 3B69A 3JD73 3D3AA 1HQNA 1LHWA 1QXJA 3ATGA 4RHV2 4OQ9A 3ZFFB 3N4MA 2GMEA 3B93A 1IQDC 3K3NA 2VMIA 4BXFA 2ZHKA 2ZEWA 4XUOA 4FTSA 3AVRA 3ZOIA 3ZFFC 4LA2A 2VGDA 4OULA 1VBC3 3J8F2 4TSVA 1N1YA 4CA9A 3MIBA 4KG0A 4JGZB 4NRQA 3DPRB 5FMOL 3M3QA 4E2GA 1VBD1 3WSOA 1U5YA 3H7YA 4JGZC 5E1RA 3E6CC 3DPRC 4A2UA 4RFT0 1W8HA 2VNVA 4FOYA 2WNUA 4XF1A 3WNOA 2BGCA 3AKSA 1RMU2 4V2WA 4ZZ5A 2GU9A 3FFZA 1N47A 4YM2A 2ARCA 4W6XA 1GLHA 3C7HA 5C4WB 1BEV2 2X09A 4AGGA 3HMYA 5EYXA 3OD4A 1YRZA 4DMIA 2B9UA 1AR61 1YQ5A 4WVZA 2WWUA 3SMHA 3S5QA 5C4WC 1EV13 4WVMB 1JZ7A 3I7DA 2VO5A 4LOSA 4MG2A 4ASKA 3LIHA 3OPZA 1O7FA 1WW5A 3ZYBA 2GC1A 4A6SA 5IK5A 1EYBA 1V6OA 1YI9A 2VMHA 2VOWA 3TYJA 3HBZA 1VBA2 4H3WA 1XC6A 2FDKA 3AKRA 1KGYA 3M7AA 2C6SA 2ZGRA 4ES8A 2PA7A 1G9FA 1QH6A 2VG9A 1LHUA 3ACLA 2VY0A 1AL21 2XJSA 2WLPA 3N9LA 1LECA 3Q8FA 4HG6B 5F39A 1G9CA 1PO21 4JCKA 1LKNA 3JUUA 5K4LA
chains in the Genus database with same CATH topology
4L9BA 3GZUC 2ZX1A 1MS8A 4YFWA 2AR6A 1S0JA 3BIWE 4S2HA 3VUOA 2VULA 4Y20B 5DG1A 5F5QA 2ETEA 1V70A 1JBCA 1ULGA 3RI8A 3WV6A 3S7IA 5J09A 2VUJA 2RS11 5DXDA 2NPIA 4M00A 3FUQA 4N7IA 4DY5A 1NLSA 1RHI2 3TN91 4Y1YA 1H4GA 2RS32 3MPBA 1LOFC 3KQRA 1Z78A 4GMP3 3PMEA 4L97A 1PVC1 2TUNA 1VRH3 4AFCA 5JOZA 2PHTA 1D4VB 2QZ2A 2R0HA 2ZS6B 5B2GB 1RUJ1 4BE3A 5A32A 1U0AA 5AC92 3E5QA 3UK9A 3NL1A 3H8UA 5LK7B 4Z07A 3I59B 3SCGA 1JXNA 4DS0A 2D5HA 4HSJA 1MZ6A 1NLRA 1CAXA 3VZJA 1RUD2 1AXYA 4XYXA 4ORFA 4PF5A 2OIIA 2Q1MA 3TBDA 4HVOA 4RA0A 4CYDA 2ET1A 3D5OA 1VBC1 2E6VA 1ENSA 1DYKA 3POWA 1PZ8A 3RYRA 4IEZA 4Y26A 2DFCA 2E7QA 5KHKA 1TME2 3QLQA 4KNCA 3UJQA 3G7DA 3JCIA 1SEFA 1PGL2 4XF0A 2ZGQA 5FO8B 2EAAA 3NV1A 1VJ2A 3ZXJA 1AYM2 4HMZA 3WNXA 2ZX0A 4JGYA 4CZSA 1QJU3 5AFBA 4MXWB 5I0RA 4I30A 3WP3A 1QGLA 2SBAA 3L2HA 4PJYA 1KD7A 1REFA 1Q8SA 2YXSA 5I0TA 4LEJA 4GWNA 4YM3A 3THTA 3H7JA 3HT1A 1EV11 2YROA 3APBA 1REDA 1YJKA 1YFWA 5HCAA 1EPWA 2CL2A 4HPKA 3LAGA 1WBFA 2UWBA 4QPGB 4XBLA 5K0UB 4M01A 3WINE 4GB31 3N7LA 2C0ZA 1XRUA 4QPGC 4RSUA 1W6MA 4XF9A 5JPMB 3LOBA 5K0UC 2PHUA 2RHPA 3MF6A 1OOPB 3ZIXA 4BYYA 1XXNA 2A6WA 2VH9A 1PM7A 1K5MA 3EJKA 3AFGA 1OOPC 3FLRA 5LRRA 4AK3A 3ZO0B 1D4M1 1CAUA 4BIOA 5DDJ3 1VB2A 4XXPA 4S2FA 1A3KA 1PO13 1CD3G 2WNVB 3O0XA 1M06G 1SLLA 3VKMA 3M1HA 1FOD3 2RM22 5HI0A 2EXIA 2WNVC 1Q8OA 1J59A 4GQ7A 2BYVE 5ACA1 3FZ3A 3ENRA 3ME2A 1ZNPA 1YO8A 4GMP1 1R1A1 4CEYA 2EXKA 5GZCA 1CONA 2I45A 3KT7A 3M3EA 1IHMA 2WSVA 2JG8A 4LO7A 1C1FA 4RHV1 3AMPA 2GC0A 4KU7A 4LBQD 3L2YA 1RITA 5I91A 4OZXA 3VZKA 2PAMA 1H2NA 2ZPXA 3J8F1 2VOKA 1VBE2 3WXPA 2G9FA 3MF9A 2R0FA 3JQWA 4YRDA 1QXPA 3CO2A 5FQ0B 5HCBA 1DYPA 2CAUA 4L11A 1VLNA 1MS0A 1J3PA 1NXMA 3SH4A 1ND2B 1C1LA 2X8KA 1BBT3 2C9AA 4CP1A 1RMU1 4M3CF 1NG0A 1S55A 1ZRFA 1YIPA 4GKXA 4ASMB 2ZBJA 1ND2C 4XE9A 2PHWA 4XQWA 1PIV2 2YYOA 1O4TA 5H9SA 3WP6A 1W6QB 1WD4A 4YG0A 4QM9A 3V0BA 1Y3TA 1PK6B 4DZGA 1HXS2 3LSEA 1KJLA 1ZM1A 2ZGSA 1Q8QA 2DTYA 1WA4A 1KJRA 1PK6C 2DVFA 2RS53 3QBQA 4SBVA 1I9RA 1H1MA 3AYAA 2DFBA 1AR93 1AR83 1NE6A 1YWKA 4I02A 1ENXA 5I93A 5C8CA 1FX5A 2TEPA 1LHNA 1VAKA 5CNAA 5BNOB 1RC6A 3CEWA 2PYTA 4Q8KA 2XL9A 1BKZA 4HL0A 2TNFA 2I07B 4Q4W2 5BNOC 4BA6A 4GKYA 3TAYA 5CBLA 3WP4A 2DVDA 4COUA 2LTNA 1H2KA 3LA7A 2ZHNA 2H0BA 3D6EA 1G6NA 2ZX3A 2WC2A 1UZYA 1W6NA 2OZJA 2HWF2 3AZWA 5A3MA 1DGRA 3VZLA 4OLLA 3BPZA 3CF6E 4OHZA 4NHLA 4FXGB 1KDKA 4RGAA 1UPSA 2RS31 3ZFFA 5LEKA 1LOCA 3RNSA 4AEMA 5DDJ1 4GH4B 5KXBA 5FTTC 4IV3B 4AVVA 4CTEA 1PO11 4YNIA 4GH4C 1UL9A 2ZGUA 1MVEA 2E7TA 3OBTA 4IV3C 4JGZA 4UXAA 4QGMA 3DPRA 5CIRA 1ZBA1 3KSCA 3B3QE 2XKPA 5AC91 1ZRDA 1QJZA 3LA3A 2YZ4A 3ROUA 4DXZA 1U12A 3LCPA 3M2MA 5JPNB 4C0BA 1ZYBA 3POYA 1AYN3 1OA3A 4YGCA 2BVBA 1Q8PA 3A4UA 2IXJA 3R4UA 5C4WA 3FMGA 3HN1A 2WFF3 1AR72 1XNBA 1A78A 4WVMA 4DFSA 4CRQA 4XPVA 1HRI3 1I6XA 4INDA 3VKNA 2XH6A 1AXKA 4NO4A 1R093 1VP6A 5JI7A 2E51A 1TME1 2JD4A 2RMU3 3V0AB 2B46X 1PGL1 3HR9A 2RE9A 3RZZA 2UYAA 4XHXA 1R083 3J4UH 4AF9A 3CLPA 3MDPA 1BVP1 4JDOA 4NR1A 4L8QA 3AMNA 4AVBA 5T3NA 2VNGA 1VB4A 3D82A 2PAKA 1GANA 1D2QA 1NQDA 3GZAA 3VV1A 1VBD2 3U0ZA 4MLOA 4Y20A 2G4IA 1HX6A 1C8M2 5IK7A 1R1ZA 4W65A 4BH9A 4LUMA 4XMAA 3JB4C 1J58A 3WQ0A 1RTVA 1LOBA 2RS51 3E5UA 5J36A 3KCYA 1FNZA 4LO4B 4AFBA 1LOFA 1WBLA 4I3PA 2AENA 1G9AA 1H9PA 1WD3A 1WCDJ 2YC0A 2W0XA 2KXLA 3GHNA 2K2SA 1AR91 4XFCA 3ZSKA 4LULA 4COYA 2YPJA 3SHRA 3AXEA 2H6CA 1RUF3 2Y26A 4R8HA 1I1EA 4OI0A 4NN0A 5SV8A 1GNZA 2GC3A 4IQPA 2DCTA 4G9SB 3KGZA 4BPZA 3VBSB 3IDCB 1GQGA 4B7KA 3HQXA 1ENQA 2O0OA 3I59A 2DF7A 1POV0 4QMAA 5GLWA 3VBSC 3ZFGB 4B29A 1FI2A 4IEVA 3WG2A 2NMOA 1H1AA 3GF6A 3ZFGC 2YGMA 2RM21 1W39A 3IBMA 1LRHA 1NOVA 4OUSA 2A6XA 3WDWA 4AVSA 5KHIA 1QDOA 2JE9A 2BNOA 1ZZBA 3MEPA 3QD6A 4COWA 2RS12 2BBVA 1EP0A 3OGGA 1CAWB 4KWJA 4YG3A 4B8EA 2ILMA 4AHZA 1Y7BA 3FLTA 2VQAA 3VKFC 2WL1A 3AFKA 1AHSA 1PVC2 5C8WA 5SV5A 2PQQA 1ZX5A 5J37A 5C6CA 4MXWA 2QNKA 5T5PA 2ZGMA 4DB5A 4LO8A 2I2SA 5BY5A 2WA3A 5L19A 4AI0A 4AI2A 3NKTA 3C2UA 4CDWB 1GYKA 1Z0HA 1RINA 1TQ5A 2D98A 4HKOA 2JICA 3VDDB 4XETA 1BK1A 1H4HA 1LHOA 2PFWA 1BXHA 1HRI1 3N3HA 3OYWB 4CDWC 5CFCB 4E4SA 4XFHA 2WIIB 3X29B 5D8AB 3VDDC 4D7YA 4F7ZA 5BNQA 1G9BA 1RUH3 1TE1B 2QCSB 2XLFA 3JD72 4IL7A 4CDUB 5CFCC 2RMU1 3ZXKA 4XW3A 2Z5WA 1PIV1 4QPGA 5K8SA 5D8AC 5K0UA 4CDUC 2XL7A 3SXWA 3RWNA 1VBC2 4ONUA 4P14A 1Q3EA 3S6PA 5LRSA 4KBBA 3QOPA 1OOPA 4AI3A 1F8VA 5BNNB 4HSLA 4BMEA 5F6KA 3DKWA 4Q4V3 5BNNC 2JKBA 2GN7A 2IXCA 2WNVA 4YVWA 4FPOB 1VR3A 4X6RB 2ZMNA 4Q4W1 1GKBA 4N53A 5CG9A 5BUVA 3ILFA 3RMYA 4AGRA 1RUF1 1EV12 2UWCA 2CNAA 5KBFA 3QH7A 4IEUA 1NZCA 5FRAA 4Z92B 4XJWA 1JUHA 3ZXDA 2R16A 4FP3A 3MYXA 3WG4A 4FXKB 2VUAA 4EWDA 4P9WA 4P9GA 2C1FA 1U5ZA 5CG8A 2KA3A 2FBEA 1ZRCA 1FYUA 1U5XA 4GB32 1MS5A 2LUWA 1KQRA 4IEPA 2VOXA 2HWE3 3LSDA 4JVAA 4DRRA 4B7EA 1LGNA 2G9GA 4R9CA 4NVPA 2DU0A 3B02A 3TNQA 4M0NA 5FQ0A 4IEQA 1XE7A 2YGLA 4A7YA 3NWKA 3N36A 4L92A 4Q29A 5CFDA 4ZKTB 4AXOA 1ND2A 4MX3A 4LHKA 2DYCA 3VHOA 4BQ1A 5JOXA 3PHMA 4Z8BA 4XQ4A 2R073 3O0WA 4OHWA 1V9U3 4XDQA 1HLCA 2D93A 1TEIA 1XNCA 3WW4A 1ULEA 2Q0AA 3JB8A 3ZSLA 1AX0A 1PK6A 1AR71 1AVBA 1ZA4A 5JOWA 1YIFA 2XB6C 2E9QA 5CADA 4EROA 1VRH2 2ZABA 4XJZA 2XJUA 4B3NA 2NMNA 3H1WA 4XOGA 5T52A 5E88A 1AF9A 3WX5A 1EPZA 3BCWA 2HEWF 5FMOS 1WMDA 1GICA 4DPNA 1W6OB 4AEDB 2Y0OA 1YNAA 3KCCA 5KWRA 1UU4A 5BNOA 4LE4A 4E4DX 4K3UA 3B9CA 5GZEA 4AEDC 5I8YA 2FHRA 5FPZA 1QJY3 2IFRA 1UU5A 3WHUA 1XYOA 2Y38A 4UW6A 4GIQA 4JDMA 1ZBE3 3ZPYA 3WVJA 2A73B 1GNHA 1C8M1 2OA2A 2GNTA 4YG6A 4K7JA 1LESA 2E63A 1JN2P 4N9HA 4YW3A 2V09A 3BU7A 3MIEA 1FMD3 2GZWA 4YW2A 1REEA 2QJVA 3B01A 1DBNA 4WM8B 4BMBA 2RR13 3PJYA 3AP6A 1W0PA 4FTEA 1OFNA 1QJU2 4GH4A 4WM8C 5FAXA 4IV3A 1HKDA 3WZ1A 3RYKA 3A0NA 4I0WB 2XVLA 4QQLA 4HKWA 4YZ2A 1ND3B 3ES4A 4YSFA 3NO8A 4CDXB 2CYFA 3WW1A 1JTZX 2F6BA 5FLJA 3FX3A 1ND3C 2D40A 4PLOA 4QHBA 3AYDA 4CDXC 3NAPB 4IV1B 4MGYE 1C3HA 2D97A 2CY6A 4WV8A 5C9AB 5IK8A 3NAPC 4IV1C 3VBRB 4I01A 1U5IA 3R6SA 5C9AC 1X36A 2XG3A 1B09A 3VBRC 2AREA 1EY2A 2Z69A 4K8FA 4IEWA 3ZXFA 2HWE1 2VOVA 4GULA 4LBQB 3WUCA 2ZGOA 1DHKB 1KITA 1SCRA 4DQAA 4XJ8A 4LTAA 1SLBA 3FBYA 2EALA 3VN4A 3V0AA 1MZ5A 3IIAA 2R32A 3RMXA 4LA3A 3TB0A 5DDJ2 3JBG3 3ZYPA 3VHNA 3JU9A 2W68A 1PO12 1VAMA 1QQP3 2WKKA 3R0RA 1BQPA 2OW4A 1CR7A 2GH8A 3HIFA 1C8NA 2WLQA 1FOD2 4C1WA 2R071 1V9U1 1ZBA2 1V6NA 3MFAA 3ZXEA 4LLFA 2R6QA 5DZEA 4PIZA 3ZMOA 2DCJA 4R52A 3H3UA 5CA6A 4Q0UA 1O3TA 3VBHB 1V6LA 5J48A 3DGTA 1OHFA 1ASJ3 4RQPB 4WM7B 1F5FA 3VBHC 4B4QA 2P34A 3JD71 1TNRA 4RQPC 4U36A 4WM7C 3N7MA 4WVWA 1Y9QA 1WLTA 2WZR3 5I8TA 2O1QA 3VL8A 1IPJA 2P17A 2FMDA 4QU2A 2WSUA 1D0GA 4LBKA 1KFUL 2VMGA 1DGWA 4AQ6A 3AKPA 1RVF3 3M3OA 4EN0A 2D6PA 3VBSA 2W08A 3CL1A 1ZVFA 1LGCA 5GZGA 1BBT2 5KXEA 1SLIA 4SLIA 3ZFGA 3U4XA 4PLMA 1T6GC 4JDNA 4H7LA 4YGBA 2EXHA 4AE2A 4QT6A 4YM1A 2B45X 2X29A 4XMIA 1SBDA 1Y43B 4R4ZA 1CIWA 4Y1VA 4NPRA 1S0IA 1RGSA 2K9ZA 2BVVA 2DTWA 2Q30A 2HWB3 2RS52 2GC2A 5K7PA 1FAYA 1CAWA 2GDFA 4COZA 2D6NA 3FHIB 2A6ZA 3USSA 3VHRA 3WD5A 4C91A 3SCFA 1AR92 1AR82 3KM5A 1NCQB 1XU2A 1IGOA 2RJKA 5JOYA 3PLQA 3IPVB 1NCQC 4UW5A 1LULA 4R9AA 4P9JA 3VKOA 3VKLA 1GQHA 4Z1VA 4CP2A 3OJBA 3W59A 1I5ZA 1BVVA 2WWSA 4Q4Y3 5EZWA 4Q26A 2IXKA 4IEOA 2VW0A 2R063 4CDWA 4AI1A 3I4IA 4FPEA 3VDDA 4J1XA 3H1MA 3OYWA 3V56A 1WMEA 3UKVA 5EXOA 3MICA 1D0HA 5IUQA 1RUC3 2AYHA 2QKDA 5D8AA 2HWD3 4YVSB 4CDUA 4RD7A 2OYZA 3PVBB 3RS6A 4YVSC 4XZPA 1I3HA 3WCRA 3UKTA 2Q8OA 1COV3 1DQ6A 1FPN3 3D8CA 3WP5A 5FOJB 1VRH1 3O12A 4L2NA 4NWVA 1QU0A 4PDWA 2GMPA 5BNNA 1LTEA 2GNDA 1FT9A 3T2TA 1LOAA 1QJX3 2NYYA 1OQEA 2D7FA 3AXDA 2D43A 3M70A 1H8VA 3NSTA 4A7KA 4M3CB 2RJLA 1UKGA 3PNAA 4MGZE 2UU8A 3ETQA 1ASJ1 1AYN2 2GNMA 3PJQA 1BYHA 4I0BA 1C4RA 3BOPA 4L99A 2IWGB 1XYNA 2F4PA 2WFF2 4FOQA 3M3CA 1O3QA 3LGRA 5JAXA 1Z7S3 3O14A 1HRI2 1XYPA 3AMHA 1R092 3AZZA 4JRAA 1XNKA 4LHNA 2RMU2 3TWIA 1RVF1 2A3YA 2ZAAA 3WG3A 4W6WA 4K1YA 1R082 5J98B 4AFAA 1O5LA 1QJU1 2WJSA 4AEKA 4C90A 1PVXA 2XLGA 2P3IA 3ZXLA 4XBQA 4AHXA 3ELNA 2V73A 3MI8A 2NN8A 4FT8A 4QPIA 2DURA 1Q56A 4QD2A 5KC5A 1RUOA 3ZMNA 3FWEA 3SISA 4Q27A 1Q8VA 1X82A 3QH6A 2JG9B 2AGSA 3WDXA 3JQXA 1E57A 2HWB1 2ZGPA 2ZA9A 4AEJA 1OA2A 2JG9C 2WQZC 2WS93 2V5YA 1AXZA 1J3QA 1SFYA 5T54A 3EO6A 4YZ1A 1WLDA 1UAIA 5CAZA 4XF4A 1RUF2 2UY8A 1XNDA 4B4RA 4LHLA 5A3LA 1J1TA 3KD4A 4GALA 2IXIA 1EAH3 4PQ9A 2DUOA 1SBFA 3V64A 2ZGLA 4Q4Y1 2XHKA 2R061 4UW3A 5FDBA 5T55A 3MIFA 1W6OA 4AEDA 2WNUB 2VECA 2PAEA 2MPFA 1RUC1 1FOD1 4PBPA 3MZHA 2WNUC 1KXGA 5JR7B 3INAA 1YFUA 4S2DA 1TMF3 5LEJA 3KT4A 2UYBA 3VGIA 1SDWA 3PVEA 4AW7A 1MEC3 4FPJA 4OHVA 3WDUA 1COV1 1FPN1 2D44A 3A0KA 4K1ZA 4K21A 5FOBB 2JECA 4EN6B 4F3JA 1N1VA 3GALA 5FPXA 2A70A 5J7MA 5JZGB 1VBB3 3D4KA 1LHVA 3T1MA 4WM8A 4N9IA 4O9GA 4Y4YA 1W2UA 1N1TA 5JI9A 3PVNA 5JZGC 1X33A 3FUOA 1POV3 3E6DA 4EWEA 5GLUA 3U07A 2A7AA 1H2MA 4MH0E 2BUKA 4OVEA 2XJQA 1ND3A 4KWKA 4CDXA 3ZN5A 2P37A 1Q43A 3I8TA 3AKTA 2ZCWA 3NVCA 3PTYA 1Z7S1 4H55A 2SLIA 4FPCA 1BBT1 1QH7A 4IV1A 1WCSA 2DVGA 4NOTA 4UBHA 1AJKA 4LLOA 1HW5A 1NXD1 3RJ2X 4JAAA 3WOGA 1RUH2 3HT2A 5C9AA 2B7YA 4ISRA 3UV9A 1V00A 3VBRA 1C28A 5H9QA 1IZ3A 2UY9A 1LEMA 4P9IA 3OD0A 4TLFA 5F1RA 2QQPA 4RGGA 3T1LA 5JIAA 3URFA 4HETA 4LBQA 5JIUA 4LR4A 4ITCA 3S7EA 4FQ4A 5EYYA 1AR81 2WQ4A 3N7KA 4PLNA 4Q4V2 2PLV3 1AJOA 5GLZA 1DFQA 3NV4A 2FMYA 1CAVB 5GZFA 2WS91 4FVVA 2HJIA 4C0HA 1DG6A 2ZX2A 2ATFA 1O3RA 3BALA 4XFBA 1O4ZA 2QFEA 4OI4A 3VBHA 4AG4A 3AZXA 3VL9A 2QUOA 4RQPA 4WM7A 5KXDA 1UD1A 2D6LX 2XBO3 4E2SA 1EAH1 1NA1B 2HWC3 1L3JA 5EV7A 2CWMA 3USUB 3P3NA 1NA1C 5GZDA 4Y5Z0 1C5HA 4IXLA 3VBOB 4NWWA 2HWE2 4AYUA 3WQ7A 3MIGA 4FOWA 4QQOA 4C1XA 4AQ2A 4X6QB 3TNPB 2BPA2 1UCXA 3VBOC 4HFSA 1A8DA 1YXWA 1RUI3 3WQ1A 3ZSEA 4XJ9A 4I0AA 3GYDA 3IDEA 1HQLA 3ZN6B 1TMF1 1RB8G 1PNFA 5JMCA 3N7JA 2IFWA 1MEC1 1B35B 5H9PA 3KS7A 1G86A 5I0UA 1QF3A 3POSA 1AYN1 2ET7A 3RSJA 2R072 1MACA 3AP4A 1B35C 1V9U2 4Q0VA 3PMSA 2BWAA 4MV2A 4HZFA 4AVCA 3AP9A 1JHNA 2WFF1 1JYCA 1RUG3 1POV1 2R043 3LOIA 4Z2WA 1BMV1 4WVVA 4KWLA 2QE3A 1R091 2JEMA 1DU3D 2CTVA 1LU2A 1GSLA 2ES3A 4IEXA 4ZU5A 3U11A 5BYNA 3NJZA 1NCQA 3AK0A 1OSGA 1YLLA 1HRV3 2OZ6A 4Q1RA 4JRLA 2ZMKA 1R081 4XHBA 4FQZA 1AZDA 2ARBA 4YFZA 4YGDA 4ZXKA 1GV9A 4AFDA 5T5LA 3WG1A 2XJRA 4XTMA 1QJY2 1NY71 4J6GA 1BZWA 1FNYA 1XU1A 4HVRA 5BPXA 4Q4X3 4DOUA 4D69A 1ZBE2 4EN7B 1RUE3 3M3IA 1A8MA 3VBFB 1IPKA 5BXXA 1KFXL 3J9SA 3VBFC 2XVGA 1FMD2 1OMIA 2P3KA 4AHWA 4YZ4A 4YVSA 2QDRA 4AVAA 5A33B 4JC1A 2RR12 4W6YA 3AYEA 2PLV1 5L73A 2XJVA 1AR63 4WZFA 4EV0A 1PNGA 3M8LA 5FREA 2LM3A 1M4WA 1PZ9A 1WW6A 4DY3A 4OHYA 5ABJB 2Z2SB 2YMZA 3KZ4C 3WUDA 1W6PB 2WFPA 2ZHMA 3GBWA 2P3JA 1GBGA 1IS4A 3MW3A 5ABJC 3M4FA 2D3SA 4M3CA 2O8OA 5FFOC 1JOJA 3ZYRA 1ENRA 1QNWA 2I74A 3MPPG 4R4XA 2HEVF 2PN5A 3G6JB 1AL23 2XBO1 3ZSMA 1ZRRA 1PO23 2HWC1 2R1DA 3DL3A 4MGKE 5CU1A 2KM2A 4QX5A 4LT5A 1WLWA 3GBGA 5GLTA 4QGNA 4R9DA 4KG8A 3RYPA 4LUKA 3H50A 5KXCA 2BNMA 1RUI1 5BNPB 2ENRA 2Q4SA 2IZWA 1W6QA 1S2KA 5AFEA 3TN93 3UKNA 3JBG2 5BNPC 2EIGA 1QQP2 3TOJA 2GH2A 2BFUL 1XE8A 1MS3A 1IOAA 3H3ZA 3EQEA 1LB2A 3AX4A 2H0VA 4UW4A 5HXVA 1CJPA 5FCCA 2P2KA 1QNYA 2JXAA 2VPVA 3W9AA 4AWDA 1SFNA 1RUJ3 1QDCA 3AP7A 1RUG1 4UBGA 1PHMA 2JG9A 1RJ7A 1DQ4A 1H8TB 1LOEA 1V6JA 1ASJ2 3KGLA 1MQTB 5DUUA 2UWAA 2PELA 1RUH1 4NHKA 4ISQA 5FO9B 1H8TC 4CP0A 1MQTC 4FPFA 3P3PA 1HRV1 5CVRA 2PHXA 1SLAA 3SH5A 1S0EA 2WZR2 3CJIB 1S0BA 2XPJA 2HYKA 1WLCA 2VVDA 4QM8A 3CJIC 2MEV3 4IESA 4N90A 1RVF2 2FZ1A 3PVOA 1VAVA 4Q4X1 1WMFA 4CEWB 4Q4V1 1RUE1 2PTMA 5CB7A 2PHDA 4Q1PA 3K51A 3OGJA 3NV3A 3AZVA 4CEWC 1J1LA 2GAUA 1DGWX 3ZVXA 5E8AA 5GLVA 1GZCA 1WGPA 5FBZA 1YUDA 2D6OX 2VNRA 3WDVA 4EN9B 4PIXA 3EBRA 5TSWA 4JQRA 1DDLA 2HWB2 3O0VA 1IS6A 2AZ5A 3AMQA 2ZTNA 5GM0A 4TZDA 2VU9A 2NQYA 1IQAA 4WZCA 2R1BA 1H2LA 4HT1T 5JZGA 2R49A 5DG2A 2OUJA 4KU8A 1DQ5A 4FO9A 3FBMA 4XIKA 1QWRA 4R9BA 3LB9A 1LJ7A 4FPHA 4GB33 1Q5OA 2ZZJA 1O3SA 4RS5B 2VQ0A 2PHLA 3TRSB 1LU1A 1S0CA 2AH2A 4Q4Y2 4RS5C 2XWJB 1QKQA 1S0DA 2R062 4FP2A 5L7OB 5KHJA 2B39A 5HCFA 3DN7A 3Q9OA 3R4DB 1D4M3 1UF2C 5EJ3A 5LK5A 1UKRA 5E16A 2CGPA 5L7OC 5HBAA 1RUC2 1F31A 2GN3A 1PGW2 2HEYF 2WT2A 2HWD2 1YJLA 1LEDA 1UIJA 1CVNA 4FSJA 2WT1A 4XXAA 3WCSA 2D6MA 3WY6A 2X5IB 5KHHA 5ACA3 1COV2 1FPN2 1O4YA 1D2SA 3E5XA 3OTFA 4HLTA 4JTOA 4CDQB 1R1A3 2R30A 2X5IC 4H7MA 4XQDA 3RRDA 4MXVA 1KRIA 1GZWB 4CDQC 1DQ2A 3ZFEB 1QJX2 4BZ4A 4B4PA 4A3XA 3H0OA 1ULFA 1GR3A 4BOWA 4RHV3 2DVAA 3IN9A 2AUYA 2WT0A 3ZFEC 4PBOA 2E7AA 1NCRB 3OY8B 1CAVA 2K0GA 3LKJA 5AVAA 3B94A 4AFMA 3THPA 3NW4A 3RQ0A 3MIHA 3J8F3 1NCRC 1QJY1 2ZGNA 1JW6A 1ZBE1 1OPOA 4F83A 1Z7S2 3B00A 4WBBA 3MW4A 3KLSA 4ATEA 1IKQA 1CESA 3S0MA 4BIFA 1PGSA 3O7OA 2GMMA 1N1SA 1UPIA 2ERFA 2D3PA 5JSRA 2YUEA 2JX9A 4X8NA 4TYSA 2MEV1 1FMD1 4KGGA 1RMU3 1NA1A 2OUHA 1YHFA 1F2NA 2RR11 2WA4A 4XFFA 3USUA 2XKOA 1BEV3 3VBOA 2Z79A 1RUNA 5D1IA 1KDMA 1DZQA 4XFIA 4Y22B 2W52A 3VZOA 2BEOA 3EXUA 3N35A 4IETA 1LR5A 1N3PA 1ULDA 2EA7A 4OUMA 3VLBB 4MSVA 4YW4A 5E89A 3ZN6A 2DV9A 1UX6A 3HWJA 1VBA3 4K9SA 1BJQA 4META 1B35A 2GSYA 4F8AA 3AMMA 3ZYIB 4EN8B 4GMP0 3AJYA 2WS92 1RJ8A 1DGRN 2YV8A 2DU1A 2QVSB 5T5JA 4COVA 3ASIA 1H1IA 4HVQA 2Q1ZB 2XJPA 2FZ2A 2ZGTA 5K9YA 1OLQA 1LOGA 3VZMA 5CFCA 2DCKA 1NQJA 4V1PA 1EAH2 1RIRA 2YY1A 2A3WA 1QY4A 1NYWA 1OA4A 4MGIE 1OQDA 1TNFA 4XBNA 1RHI3 3CNAA 1DLLA 2OPKA