2HEWF

The x-ray crystal structure of murine ox40l
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
128
structure length
128
Chain Sequence
PPIQRLRGAVTRCEDGQLFISSYKNEYQTMEVQNNSVVIKCDGLYIIYLKGSFFQEVKIDLHFREDHNPISIPMLNDGRRIVFTVVASLAFKDKVYLTVNAPDTLCEHLQINDGELIVVQLTPGYCAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of the Costimulatory OX40-OX40L Complex.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cytokine
molecule keywords Tumor necrosis factor ligand superfamily member 4
total genus 28
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2006-06-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2hewF00
5L19A 4MXVA 2RJLA 2O0OA 1RJ8A 2RE9A 5CIRA 2Z5WA 1XU2A 2HEYF 1U5XA 3QBQA 1JH5A 4TWTA 4DB5A 2E7AA 3K48A 2JG8A 3K51A 4MSVA 4E4SA 3FC0A 5KWRA 5L36A 2JG8B 1ALYA 3ME2A 3L9JT 2R30A 3B9IA 3B93A 4QQ2A 2WNUB 2TNFA 4GIQA 1GR3A 4HT1T 5HBAA 2AZ5A 1WCKA 2JG8C 1D0GA 2X29A 2RJKA 2KA3A 4MXWB 2Q1MA 3B94A 4QQLA 4NN0A 4OUMA 4QQOA 2ZJCA 1RJ7A 4D7YA 3TYJA 1C3HA 1XU1A 4J6GA 1KD7A 4G4FA 1D4VB 1S55A 2HEWF 1OQDA 1TNFA 2WNUC 1DG6A 4EN0A 2JG9C 4E4DX 3V56A 1I9RA 3TWIA 1U5YA 4QQHA 2ZPXA 5KC5A 1OQEA 4QPYA 5KC6A 2WNUA 2WNVB 4QQPA 4DOUA 3AB0A 1OSGA 2QE3A 3QD6A 2JG9B 3MI8A 4OULA 3WD5A 4KG8A 4OUSA 2JG9A 1KXGA 4RSUA 2Q8OA 2WNVA 1PK6C 3IT8A 1JTZX 3LKJA 2OIIA 1C28A 1D2QA 2TUNA 2HEVF 1IQAA 2R32A 1A8MA 1DU3D 1O91A 4TSVA 4MXWA 1PK6B 1TNRA 4N90A 5BNQA 1U5ZA 2QDNA 4KGQA 2R6QA 3URFA 1PK6A 2WNVC 4G3YC 5TSWA 3ALQA 4F3JA 4KGGA
chains in the Genus database with same CATH superfamily
5L19A 4DQAA 4CCCA 4A2UA 5FLJA 1SFPA 3JD71 4AI3A 4N7UA 5C9AC 2JDNA 4H7MA 3WHUA 5A1AA 4XMAA 1LRHA 4DPNA 3ZMOA 1DYPA 3ECQA 2GMMA 2GMPA 3ZXAC 1JYIA 5DDJ1 1NCRB 4Q4X1 1SZBA 3E1F1 3ZXKA 3WUDA 1ENRA 5EYXA 1LOEA 1WMDA 2JE7A 1OUSA 2CHHA 2VMHA 1R1A1 1ZZ6A 5H9PA 4AEDA 2ZX3A 1KEXA 1ND3A 4IGPA 2W92A 5FMDA 1IPKA 4QKBA 2C9KA 5JDBA 2VGDA 3A21A 4YWAA 4HZFA 1CAXA 3HOBA 4AVCA 4M3CB 2TBVA 1C8M2 2JB8A 4PIXA 1MEC2 4XHBA 4EWDA 2DCYA 5L36A 3HPNA 4FFIA 5G04L 4QB1A 5J37A 3PUAA 2B8MA 2D44A 2WZPP 4ES9A 4XDQA 1HN1A 2AZ5A 3ZXLA 2JKBA 3KS7A 4M3CE 3RYRA 1NX9A 1NA1B 1QWRA 3DPRB 1FMD1 3IIAA 4DXZA 4Z2AA 4K7JA 4PLNA 3UGGA 4YW6A 3U14A 3C8XA 4YVSB 3LOBA 1YQCA 1YJLA 3PU8A 1RC6A 3U07A 1Q8PA 1RUH2 3ILRA 4QHOA 3WP5A 4HVQA 4QHBA 1H6YA 4ARXA 1J59A 2TEPA 4YG0A 5GKAC 4BLJA 4EWEA 3SISA 1NLQA 3O0VA 4BDVB 3I2OA 2J1RA 1QY4A 4YFWA 4EQVA 1FX5A 1FPN3 2D7FA 3I3EA 1AYN3 4OHWA 3VB9A 4CEYA 2ZKNA 2VOXA 4WVVA 4GA9A 5LY1A 3LFIA 4TN7A 5FZMA 1U5YA 5J7MA 4GB31 2CYFA 1VBD2 1OQEA 2VCMA 5C3SA 2RM23 2XBO3 3L2YA 4OZOA 5C8CC 2WNOA 5FZ1A 2WNVB 2JECA 3O5SA 2B42B 2VZPA 3OOXA 3KHBA 2XJPA 2A3XA 3LDKA 4RGAA 5FFOC 1Y3TA 2Q4SA 5D8AA 4XDOA 5FO8B 1AX0A 3ZKYA 3AK0A 4FBFA 5I8YA 3M3OA 4NO4A 2R042 2EAAA 3WUCA 1AHSA 5J48A 1HRV1 3FBMA 4B8EA 5AC91 2EAKA 4IGQA 1GYKA 3MIFA 2X5IC 4NHLA 2FBEA 2ZGLA 2JEMA 3WINE 4Z1VA 4RS5C 5JZGC 2BGPA 3I7DA 1C1LA 2MEV2 2VOKA 3OUHA 2XWBB 1DDLA 4Q2FA 3J7MA 4IEVA 2QDNA 3HN3A 1W8TA 1W28A 1REEA 2CAUA 1JYWA 1LR5A 3UT0A 1A3KA 1RUC1 4Q0VA 2DFCA 1V9U1 1ZBE3 2HWE1 4IEWA 2QQKA 1VBC3 2A5ZA 3MUZ1 3AYCA 3GJBA 5FLIA 3WDXA 3SKVA 3KQRA 3MIGA 3V0BA 1PGL2 1WMEA 1UKGA 2NLRA 3IDEA 5FZ4A 3TNPB 4B29A 4QM8A 1UPSA 4CU8A 4QXBA 4HBNA 3DL3A 2HEYF 2ENRA 1QGLA 4HFSA 4K8RB 4QWNA 1UZYA 1H4HA 4LXLA 5IJRA 2D43A 3WDTA 1ZREA 4XIKA 3ZXJA 1DGWX 5CISA 2VZOA 2E53A 3AYEA 1CN1A 3EJKA 1B09A 4Y4YA 1HW5A 1LODA 4FPFA 3WF2A 4AEDC 3LPGA 2KR2A 4YG3A 2ZAHA 3T0AA 1D0HA 1V70A 2YPDA 1UMHA 4TLGA 2FCTA 2YG0A 4EN7B 3IB3A 2WYSA 4AWDA 3NKTA 3WDYA 5GZEA 1US2A 2L9LA 3W9AA 3O1PA 1AX1A 2WFF2 4HLTA 4C91A 4J1WA 1QXPA 2Q5TA 2YB7A 4LHKA 2QQVA 4EN9B 3ME2A 4L97A 3W59A 1PMIA 1X8MA 1CONA 4O61A 5CFDA 1V9U3 1Z7S3 3BCWA 5A1FA 4AF9A 5JIUA 3AZWA 2AR6A 4P9LA 3VZMA 1VPHA 1YYNA 1C5IA 3A0NA 5DAXA 4Y5SA 4XBNA 4UW6A 5GJ6A 4DNYA 2Q8EA 3R4SA 1Q8OA 3EXUA 4PQ9A 5IYYA 3RZGA 3ZFEC 1SFYA 1ZZ8A 2UU8A 2ZAAA 3FUQA 3CJXA 4L0PA 4M4RA 4IEPA 3S5QA 5CFDC 3PJYA 4J6GA 4CCMA 1EV12 4CDUC 4LNVA 4PI0A 5I93A 1TNFA 3DXUA 1JZ2A 1W03A 4IV3A 2CDPA 3PUIA 4N43B 2OPKA 3IDCB 4PLOA 1Q8QA 5DUWA 4A6OA 2BBVA 3A4UA 3BALA 5FZ9A 5J09A 2ZPXA 5K0UC 5LEKA 2B9VA 3IWZA 2VNVA 1U5IA 1NUKA 2WZR2 4BK5A 5FY8A 3PHMA 1TME1 2XJSA 3VD7A 1EAH3 3ITQA 4XFIA 4Y1YA 2DUQA 3J9SA 5D8AC 5JAXA 1YWKA 1IS5A 4NIAA 3NVCA 1NOVA 3WT3A 3KVBA 3DV8A 3LEGA 1AX2A 3AP9A 4MVTA 3HMYA 1YLLA 3GXUA 2JD9A 1Q8SA 4FP3A 1ASJ3 3U37A 5IVYA 5BYNA 2VTXA 4XMIA 3MFAA 2VXJA 4MXWA 4UW4A 3MPPG 4V2WA 4NAMA 1VBB2 1U5ZA 5GLVA 2DURA 4IE0A 1K5JA 5FUNA 3BPSA 3NV2A 1US3A 4RR3B 2WT1A 4OI4A 1W3XA 1GZWA 4FO9A 3USUA 1B35A 1O6UA 4GH4B 1JZ7A 1BEV2 5AVPA 4JZRA 5J98B 1BJQA 1PGW1 5A32A 4X8NA 4YVSA 3D0JA 5EFUA 5FPUA 1N3QA 3VL8A 2ZGPA 1V6OA 1BCXA 1S0CA 3OF1A 1CAVB 3FE5A 2Y8KA 1LEDA 4Y22A 2LM3A 5LCWL 2EF6A 2Z79A 4BIFA 3I2DA 4JDNA 4IGOA 3AJZA 3CNAA 4Q4X2 2R0FA 5JPNB 2W52A 1S0GA 1CQ9A 2VW0A 1TVGA 1YCIA 4D7SA 5FCCA 3FZ3A 1PO12 4NUBA 5C7GA 1W3VA 4UBHA 4LBQD 5EJ3A 1YFWA 2QJVA 4FP2A 4AVVA 2LRPA 5FWJA 1S0IA 4QDQA 1WBLA 2UWAA 1IZ3A 2P3IA 1M06G 3POEA 3FC0A 5SV8A 5JXJA 1PVXA 4LKDA 1QMJA 2BFUS 3THPA 2RS52 4C1WA 3NAPC 1UN1A 4JDMA 2BW8A 2XQRA 2WQ4A 3L9JT 3WG1A 4URTA 1RVF3 1PX4A 2IXHA 4AR2A 4BMBA 1DZQA 2PAKA 5FZIA 2DVDA 1RUI3 4FPGA 4RR3C 1W6MA 1GR3A 3JZVA 4XUOA 2AEZA 5F3EA 4CP0A 5BNNA 4YM0A 4WM8C 2HWF2 1FV3A 3AP6A 2I74A 3WG4A 4A4AA 1W6PB 4CEYB 1PIV3 1PO23 1NCQB 3IIIA 4XEZA 4O9EA 4DUWA 1V6MA 3NNGA 2WZR3 3BIWE 3OBAA 1XPWA 5CFCB 3WP6A 1N1SA 3M3EA 4EE2A 2E26A 4CDUB 5JMCA 1XU1A 5FZ3A 5BY5A 3TN91 5AVAA 1JHNA 5ANQA 3E5UA 4IE6A 4W6WA 2PELA 1GOGA 1FMD3 2ZKLA 4YSFA 4L8QA 4UI9L 4MO3M 3VD5A 2CNAA 5FMOL 4E4ZA 4OZXA 4F7ZA 4OI1A 1K5MB 3I54A 4DMIA 1YJKA 1AR83 2X53S 3PU3A 2XHNA 4ISRA 3B01A 4IEYA 1OF4A 4GH4C 5DDJ2 5EYYA 1SLTA 1UAIA 5A7SA 1UF2C 2P17A 1JBCA 1FI2A 4K6BA 5FYSA 1XNCA 1REFA 1Z7S2 1WLDA 4LO4B 5ANNA 1LEMA 2VZQA 3HVDA 4IV3C 2WWJA 4QX5A 2BFUL 4RSUA 2RVAA 3NJVA 3T1MA 4A44A 3J7NA 3AZVA 3GHNA 2D6OX 4ZHNA 4ZY9A 4CDUA 1Z78A 2YROA 5C3PA 2CL2A 4ATEA 2VMGA 3KF3A 4XBQA 1SLIA 2GMEA 4CTEA 2YPJA 5I91A 1TMF3 5C9AA 1R093 3RG0A 3ZYJB 4XF4A 3WQ7A 1ZNPA 1UY2A 3K46A 1XSRA 2WYFA 4N90A 1QH7A 2XL9A 5JOWA 2GP5A 3KMHA 4CRQA 5L9BA 3DECA 1W6MB 4XUNA 1BK1A 5LRRA 1LHNA 3GZEA 2VOTA 1VBA1 5FYYA 3VBSC 4Q4Y3 3UYJA 5IK7A 3WNXA 1NCQC 1ULOA 1YRZA 1GZCA 1MQTB 1TME2 2WRAA 4Q29A 4YM2A 4BWOA 3J8F1 5IWFA 5CBLA 1HKDA 2RJLA 1TG7A 4OQ8A 3H1WA 2QZ3A 4CP1A 4BB3A 1J3RA 2VMFA 2Y26A 1IHMA 2NZ9A 1BK0A 1DLCA 4WV8A 3QH6A 2Y6KA 1R64A 1UXXX 1RUE2 1V6KA 3VBHB 4AQTA 5A7NA 2PAEA 3D82A 2NMNA 3SH4A 1K42A 1UY0A 1WCQA 3N36A 5DABA 1ZBA1 4YPJA 2VAUA 4O7XA 4QX7A 4XPVA 1PGW2 1YQ2A 2VBBA 3I2GA 4U2AA 5BNOA 2P6CA 4GD4A 2J42A 4W6YA 2MEV3 1BEV1 2FMDA 1AJOA 3K2OA 2EICA 5JVVA 3WQBA 2HWB2 1MQTA 3MYXA 5GZCA 3LFMA 2XJVA 1JN2P 5I0DA 4I0AA 4TLFA 4XJZA 5HBAA 3KWVA 2BEOA 2J1UA 1KFXL 1LULA 3HNYM 3NV4A 1HQWA 3Q8BA 3WCSA 3MDPA 1JW6A 4B4PA 5K0UB 1CJDA 3DYOA 1NLRA 2GN7A 2OVUA 3MLJA 3ZR5A 2WFF1 2QQIA 1NA1A 3RRDA 1CPMA 3POBA 4W50A 1GP4A 2OS2A 1QNYA 1YEWA 2D98A 4JTOA 5B4XA 3ZYIB 4ES8A 5JZGA 3H3ZA 4IE7A 3B9CA 1AF9A 3JU9A 1W6NB 2LTNA 2YU2A 3E97A 4CEWA 4N9IA 5FP8A 5EJ1B 2B46X 5FP4A 4IV1B 2KXLA 4AGGA 4B4QA 1H2MA 4C8DA 3PL0A 4CCNA 3NO8A 1AR73 3N9LA 1PVC2 1S0BA 5CKNA 3KD4A 3H7JA 4Y4RA 2RR13 1AXZA 1Q5OA 5E16A 3A22A 4QQPA 2W1WA 1EV11 1W8UA 5FXZA 1I3HA 2HWE2 4LMFA 1CESA 4FXKB 4NAOA 5FO7B 4LLFA 3SCGA 4F83A 5A7WB 1BYHA 4LO6B 1AZDA 3PURA 4BJ0A 1PGSA 4IUGA 5LY2A 1IS6A 1EYBA 3JCIA 2C1FA 1WD4A 3BIEA 4CU7A 1AVBA 1UZZA 3URFA 1A34A 1VBE3 4N43C 1JODA 2ZS6B 4BQWA 4HVOA 1AUYA 1N3OA 3LEIA 4JHTA 4GWJA 1A8MA 3MLKA 4XXPA 5FPZA 3SC7X 5GLUA 1D7PM 1WW6A 2Y0IA 2Q1ZB 4NIDA 3AZXA 3OPZA 4B7KA 3LSEA 4BXSV 1JYVA 3P3PA 3IBMA 5BNQA 3LEKA 4ZU7A 5BNNB 4IXLA 3OPWA 2K9ZA 4E8DA 4CCDA 1A8DA 1QF3A 1LOBA 3ZLIA 4OVEA 1N47A 2J22A 2CGOA 2VUAA 1DGWA 5GLWA 5TSWA 3VBFA 2H6CA 3UK9A 4LHLA 4WVWA 5FY7A 3N7LA 4OHVA 2RS32 1GNYA 4CDQB 3RJRA 1RUE1 2A6VA 1QJU3 3U78A 2RDSA 2VCCA 4RFT0 1B35B 1ASJ2 2BRTA 4JRAA 4ZU4A 1DYKA 2W47A 1ULGA 3FUOA 2HYXA 4GJYA 3K3OA 3TN93 3ZDSA 2YFZA 3BTYA 2A70A 2ZEXA 5C6CA 3C7OA 4CE8A 1OHFA 1NE6A 4XJ8A 3HIFA 5C5TA 2X05A 3NNJA 2AGSA 2VUJA 3A23A 3AL6A 3CMGA 2VNRA 1ZBE2 5FRAA 1HB1A 1XNTA 4YVSC 1XRUA 3RVHA 4KG0A 1JUIA 1CAWB 1SCRA 2YMZA 1UX6A 4CUGA 5FP7A 4DFSA 1BMV1 2ORXA 1CD3G 3O0WA 3LE0A 2F17A 4EWAA 4P00B 1BZWA 4Q4W2 2ZMKA 1RMU2 3I2FA 4XAAA 3LCPA 4Q0SA 4BMEA 1RVF1 1KQRA 1Y9GA 4Q4V1 3LQCA 4K8FA 4LKFA 4CDWC 3I3DA 5JOZA 1HXS2 2PXJA 3ES1A 1NQJA 2YUEA 1LCLA 2XL7A 1G8WA 2ZOEB 4LA3A 1UMIA 2QFEA 4P9XA 5K8SA 1JZ6A 5F39A 5A3TA 4XF0A 5EXOA 5F5CA 1JI6A 4UW3A 4FFFA 1ENXA 2P6HA 2R073 2BPA2 1OFSA 4JKKA 2DCJA 4C0HA 3FFZA 3PMEA 2YY1A 1KS4A 3BVCA 4K1YA 5I0SA 1RJ7A 5CG9A 2RDNA 1XXNA 4CP9A 2YU1A 4BZ4A 3ACGA 2JE9A 3ACIA 2VOVA 4FPYA 3SLIA 1UD1A 4ASMB 3T2OA 3JBG3 1UKRA 5HI0A 5FYMA 4KWKA 5A3UA 3DN7A 3MIHA 1V9U2 4PDWC 3FL7A 3S30A 2PA7A 3VZOA 4IW3A 2JG9C 3S7IA 3HNBM 4GB32 2VMEA 2BQPA 3N9QA 4GMP3 4GWNA 1W2OA 4XF3A 2Z4FA 1HQNA 3NJZA 1W0PA 1DQ6A 1RUG2 2WLQA 4FPOB 1AL23 3VDDB 2V4AA 1VALA 2MEV1 3LA2A 2RMU3 4CXXA 3MF6A 4LITA 2DCTA 1RUF2 1YQ8A 4MOAA 4R52A 4AHZA 3IKWA 4AFMA 4JQTA 4EROA 4HOOA 3W21A 4QPIC 3QD6A 3LD8A 4FAGA 5FZBA 1BBT1 1HRI1 1S4CA 1VBA2 2YBPA 3AFGA 3HNMA 3KV6A 3OY8A 3WD5A 1LGBA 4YM1A 2HWF1 3ATGA 4LIVA 4AFCA 3AKSA 3CF6E 1M4WA 1YQ5A 3WG2A 1CIYA 1XOYA 1KJRA 4QKNA 4FPHA 1H30A 1W99A 1MS0A 5A3WA 3ZN6A 4BE3A 1PIV2 1PO22 4RQPC 3OGRA 1RUOA 1STMA 5H9RA 3ST7A 1FMD2 5FO9B 3TEZA 4PHZA 3BTAA 5A3MA 3VZLA 1LOAA 2YZ4A 3KV5A 4GULA 4DEQA 1JYCA 5T5OA 1RUH3 1I6XA 4NOTA 3NJXA 4KWUA 4W65A 1OOPB 2BTVC 1T6GC 3RMXA 1LGNA 3VN4A 1V6JA 3WNLA 3N7KA 2D6NA 1O4TA 2JDKA 3Q8CA 4LO8A 4YLZA 1U12A 4ZS3A 1OPMA 4XFCA 3RGBA 2YHJA 3KCCA 3QACA 4F3JA 1AYN2 4YVWC 4OUEA 2BVVA 1E57A 5LATA 1UU4A 4GJZA 3ZPYA 5DUVA 1MACA 3NV1A 3QH7A 4MGZE 4CCOA 2O0OA 1D2SA 2Y6GA 3ASIA 5G05L 3POJA 3KT7A 1GZTA 4XFBA 4CPBD 1A6CA 2RHPA 3FLTA 2Y0OA 4YW4A 3VBRB 1I5PA 3BPZA 2XGXA 3C2UA 1K3IA 3IN9A 5B2GB 5F2SA 4IEZA 1AL21 1JH5A 1IPJA 1OLMA 1UZVA 4JGYB 4UAPA 2UWBA 3H7YA 4TWTA 4ZXEA 2GH8A 4HG6B 4HKLA 4XJAA 4IDZA 3K48A 3PIGA 4J25A 1DHKB 1L7LA 1LGCA 2CWSA 2HWD2 4MV2A 4N8MA 1JYTA 4MSVA 2W68A 1POV3 4RQPB 4FAHA 4XUQA 1IKQA 2XKOA 4CEYC 3O1TA 5IVFA 2G9FA 3FHIB 2UURA 3V0BB 1AR81 2BBAA 2AREA 1GSLA 4AEMA 2IXLA 1UWWA 2CGNA 4I0BA 2CV6A 5DAWA 1JZ3A 2PHWA 4L99A 4PBOA 2WNUB 2WKKA 3POFA 2WN3A 4YYOA 5JCTA 2UYBA 3J26N 1G9AA 5BNNC 1H2KA 1PZ8A 2RS51 2GAUA 3N4MA 5FZ6A 5ABJB 5IVBA 2EA7A 5CU1A 2ZABA 1OURA 3ZKUA 3B94A 4XYXA 3MICA 3ZYBA 2WZR1 4OHZA 3GBGA 4AVBA 1CZTA 3FLRA 3VKOA 4AI0A 2YC0A 5JI9A 3LOIA 1F15A 1PM4A 3WDVA 5FY0A 3VKNA 4H7LA 2W39A 3S7EA 1G6NA 3SH5A 4XFGA 3T3YA 4I01A 4AGRA 2QCSB 3LDRA 5A7WA 2D3SA 4SLIA 2QBXA 3BN6A 1L7RA 3VHOA 5A6QA 1G9CA 2Y38A 3I97A 2ADEA 1VMHA 2DUOA 4JGZA 5JOYA 2KM2A 5BNPC 5A3PA 4JQRA 3CO2A 2WQ8A 4QMAA 4GKXA 3P3NA 3NSTA 5KHGA 1UX7A 1XYNA 2RG4A 3O7OA 4DXSA 5C9AB 1K5MA 1ZZCA 3AP5A 5J1XA 2R16A 4PF1A 1LHOA 1O7FA 4ZZ5A 2JDAA 4Q5OA 1E5HA 4C90A 4OMCA 1UZ0A 5LA0A 5FP3A 1SHWB 1QJU1 2XVLA 3PIJA 4UFHA 1NZIA 2AH2A 3JQWA 5FK7A 1CGPA 1DGRN 3GALA 1VAVA 4XXAA 3N7JA 2WWSA 4QX8A 2GU9A 1HRV3 4BQ1A 4CDQA 2XPJA 1DQ2A 1FNZA 1H1IA 5D1IA 4BQ5A 2VBPA 2TUNA 2X8KA 2OQ6A 2WS91 4MGIE 4CVUA 1IQAA 1BKZA 5FDBA 1O91A 1FOD2 1S0DA 4QPIA 1GANA 2HWC2 4HN0A 5FIXA 3WG3A 1OLQA 3GHMA 2QZ2A 3ZFGB 3VBHA 2BOIA 3U10A 4QT6A 4DXTA 3ZM8A 4H14A 2HYKA 4LUKA 3N9PA 4YARA 2VW1A 2VQTA 1J3QA 2ZBJA 1VBE1 3HD8B 4UW5A 1F5FA 3GCXA 4G3YC 4BCUA 4KGGA 4RGKA 4LOTA 2Y6JA 3GNEA 1UOFA 1AL22 4EZHA 4Y1ZA 3J4UH 4AI9A 1IPSA 1WCDJ 3K75B 2Z5WA 3M70A 2E32A 1ASJ1 5A1LA 5C71A 2PQQA 1U5XA 1JYXA 3WNOA 5JLVA 4KNCA 3AZZA 4COYA 5FXWA 3MW4A 1ULCA 3RZMA 3MW3A 2ZZQA 2BV4A 2D40A 1MS3A 3H3LA 1Y43B 4N7IA 4DY3A 5ACA2 3ZFEB 4NPMA 1QJX3 1UIJA 4FTEA 2R49A 2Y6FA 1OD5A 1SBDA 1YIFA 4FPKA 3ILNA 4WBBA 1RGSA 1IQDC 1W6OA 1RHI2 3T2PA 3HR9A 3BYWA 3LGRA 4KU7A 1JHJA 5L7OA 2PTMA 3ETQA 5EQUA 1WBFA 4DUVA 1ALYA 4YVWB 4Z92B 1X82A 3FBYA 5ERLA 1YI9A 1UMZA 3DCQA 3TNQA 3WP3A 1C1FA 2VJXA 4RYDA 2BJSA 3BODA 4HPKA 3ACFA 3IMNA 4IE5A 1SFNA 3AM2A 3VBRA 3KM5A 5DMYA 3IAPA 2XMLA 1K5MC 5LBCA 4W6XA 4XURA 1DQ5A 4IV1C 1RUJ1 3WNKA 4MLOA 1UZWA 4JKLA 4AQ6A 1R1A3 1UU5A 3OD0A 4Q8LA 1LESA 1W2NA 1VBD1 1RUF1 4AAXA 2K0GA 4CCEA 1OVPA 1BEV3 4QD2A 4XUTA 2C9AA 1EY2A 1RMU3 3HQXA 4K40A 4Q4X3 5DDJ3 1ONAA 2VMIA 3UJOA 5CFCA 5FR3A 3OEAA 2VQ0A 3OY8B 3H8RA 4XQWA 4EN0A 2ZACA 1H2NA 1CX4A 5LBFA 2F4PA 1GWLA 1ENQA 2QQNA 5T5PA 1XE7A 1YFXA 4Y3OA 1RUH1 4DEVA 1N3PA 4CUAA 4JHZA 3UJQA 2R1DA 2V5DA 2RDQA 2WNUA 2OKXA 4A7YA 2E9QA 2VUDA 2B4KA 3AB0A 1OSGA 4EYUA 5I0TA 4JV4A 3M4FA 2BDRA 4V1PA 4OMDA 2VH9A 2IXCA 1NCRA 3N3HA 1S1AA 2SLIA 1S2BA 1T2XA 2Q8DA 4MGKE 1H8VA 3P6BA 3WLUA 2PLV3 4CP9B 3MUY1 2Y6HA 1PMJX 2B7YA 2V09A 2FDFA 1KDKA 3GJAA 2ORZA 1FNYA 1RVF2 4MUVA 1IG0A 3THCA 1MEC1 3W5NA 4WM8B 3VBUA 3JBG2 4RR3A 3NNFA 3MGUA 3MV01 1W8NA 2XLFA 5CNAA 2WBKA 2HWE3 1YC61 1TMF1 3EQEA 3AYAA 1HLCA 1RITA 1RUC3 2WT0A 1QJX2 1GNHA 3MLLA 1MVQA 5F6LB 3NAPB 4ARYA 4AYUA 4BYYA 1LAJA 4IQPA 4K21A 4WM7A 5FY9A 3PLQA 1H4GA 1W2TA 2VCAA 3M3IA 1RXFA 3WF1A 1GV9A 2AUYA 1CWPA 1CAWA 1U0AA 1COV3 2XUEA 4LBKA 3ACLA 4FQ4A 4CA9A 2GALA 4BQYA 3OBRA 1W9FA 2WO3A 1H9PA 4AAPA 2YGMA 1O3SA 3WXPA 1WLWA 1VP6A 1J3PA 2ETEA 4GAZA 4UOJA 4JVAA 4O9GA 4IL7A 1NT0A 1OKOA 3VV1A 5F1RA 5JSOA 1RUJ2 4YZ4A 3VBRC 4CEWC 3HQRA 2JIJA 1QJX1 1V6IA 2OYZA 4MGTA 4QHZA 3SCHA 1RUD2 3N7MA 5EJZB 5H9QA 1XYOA 3OGJA 1GUIA 3EYPA 5KXCA 2PHTA 1UY4A 3W20A 4RQPA 4QGLA 5FQ0A 1COV2 3T1LA 2AEYA 3J7LA 3Q9OA 5L7OC 3POGA 5C4WC 1F2NA 2QVSB 4IEOA 4LOSA 4XILA 3NRUA 5FYTA 4YW1A 4Q4Y2 2O14A 3CDZB 5T52A 1W04A 3UL2A 1D0GA 2VZ1A 3AJYA 2ES3A 3EBRA 4HVRA 2RJKA 5I8SA 5SV5A 2B39A 2XJQA 5KXDA 4ASLA 5LEJA 3PJQA 4AZZA 4YRDA 3PNAA 2XJUA 1YXWA 5HCAA 1SLCA 2E33A 2FZ2A 1DZTA 4D7YA 2AC1A 4COVA 1C3HA 4AFAA 1NKGA 2DDUA 3BB6A 1S0JA 5FV3A 4D6SA 4G4FA 4P9WA 3RFRA 5A7QA 1Y9MA 4INDA 2WS93 3T2TA 2EIDA 5A7OA 2ET1A 2IXIA 4Y20A 4AHYA 4AK3A 2MNGA 4X6QB 3ZXDA 1DYOA 1CZSA 1UOGA 5FZLA 5A70A 4GMP0 4XABA 4AQ2A 5KC5A 5FZEA 3BGAA 4QPWA 4KQ7A 2QKDA 3ZSLA 1OUXA 1GICA 3PVBB 2OA2A 2WO2A 3POWA 1DZRA 3VHPA 4NE9A 2UWCA 1VRBA 4CU9A 2EXIA 2IUWA 5DAVA 3RYPA 3RYKA 1BHGA 2WC2A 1FV2A 2VZ3A 4OUSA 4A45A 4ITCA 3VBSA 1H9WA 2EIBA 5FBJA 5JZGB 3MF9A 1LU1A 2JDHA 1MEC3 1NYWA 3OTFA 3OYWA 2B45X 4LBLA 2CTVA 1XE0A 4QM9A 1G9FA 5FBZA 1W90A 3SQOA 4FFHA 1MS5A 1VBC2 2AENA 2WAOA 4FXGB 2HEVF 1RUG3 2ZHKA 3NJYA 2RR11 3I2KA 3PUHA 4GH4A 1PK6B 1YQ6A 3HN1A 1QJU2 3DKWA 1W9SA 3G6JB 2W87A 5FPAA 4NWVA 1RHI1 3SEPA 1SEFA 2QQMA 4LBQB 1H8TC 1QEXA 4KGQA 2Q0AA 1VLNA 4KH9A 1YHFA 2IXJA 4QXCA 1OI6A 5FZGA 2VMDA 3R4DB 2LUWA 3ALQA 3UKVA 2DVAA 5DG1A 2WT2A 3ZN5A 3KGZA 1LHVA 1AXKA 5BV6A 3VDCA 1XQNA 4RL7A 1CJPA 2JIGA 2HBUA 3JQXA 3WQ0A 4XTPA 5K4LA 1VB2A 4WM7C 4LHSA 3H0OA 3HAGA 5F6KA 1PZ9A 2R0HA 3V0AA 1AR92 3MBWA 2OZ6A 3TEYA 3CJIA 4AEDB 1MR5A 4NIIA 5HV4A 2VVEA 2ZMLA 4XTMA 2HWB3 2UY8A 4LT5A 4NR1A 4JDOA 4DS0A 3CKHA 4JRLA 5A3LA 1UYPA 1TE1B 2G1MA 2JDZA 5C4WA 3ZFFC 3K4ZA 4BOWA 2K46A 1VBD3 3B7MA 1TZOA 3N9NA 3R4UA 3K51A 3ES4A 4LE4A 4PI2A 4QX1A 1RTVA 3T08A 3OCPA 3FMGA 3VDDA 2ZMNA 3P5BA 2DWRA 3UGHA 5C3RA 5C3QA 3ZYGA 4OYUA 4CPBA 4N43A 2LW8A 5H9SA 4BLIA 3VDAA 3WP4A 4XCAA 1FAYA 4Y5Z0 4P9JA 3UESA 3WW1A 1J84A 1MZFA 2R062 1NCRC 4M00A 1IS3A 1O5UA 4GIQA 3EB7A 1NXD1 2D6MA 3POYA 4I2OA 2I45A 2E7QA 2A7AA 4XQ4A 3VKFC 4ATFA 2VL4A 2KA3A 1P8JA 2YBKA 2Z42A 5IT6A 3MV11 1GNZA 2I2SA 1QOTA 2Y64A 4ISQA 2ERFA 4AL9A 5D21A 2W46A 5KR7A 1ZRFA 2ZX4A 2PYTA 2Z2SB 1IG3A 2O8OA 3I3BA 1H8TB 4WVMB 4UF0A 4CXYA 2PHUA 4META 3ZOIA 3B00A 1Q43A 2N7GA 4R8HA 5T5LA 2G19A 2ZXQA 1S55A 2DVGA 1OQDA 2HEWF 2V4VA 5FQ0B 4AFDA 4KMQA 4BU2A 2PHRA 4R4XA 3RJ2X 2W94A 1D4M1 4EN8B 1B35C 2D6PA 4RHV1 2VG9A 5D2AA 5LASA 3O1MA 2R043 1NA1C 3LSDA 1BVVA 2GC3A 1YUDA 1NZCA 2OUHA 4DO0A 1E5RA 1O5LA 3S0MA 1HRI3 4AVAA 3DEMA 4CDWB 4Z2WA 1R091 5FZOB 4DOUA 1JYNA 3OBTA 2A3YA 3AVSA 1I1EA 1OLME 3ZYPA 1W6NA 5A6XA 2P3JA 5DUUA 1G7YA 3VZJA 2VVDA 1FATA 2X09A 3SITA 4LK7A 4K1ZA 1G9BA 4Y1XA 2ZGTA 4AG4A 5JXGA 4OHYA 2BNMA 3U4XA 2FDGA 1OMIA 3OSDA 4YZ1A 2A6ZA 5K7PA 2Q30A 3JBG1 4JAAA 4XJUA 4BPZA 1OFNA 1PNFA 4NHYA 4FT8A 5A6ZA 1G9DA 1RB8G 4K9SA 4XJ9A 3KV4A 4HPKB 3R6SA 4XAEA 2O8QA 3ZXFA 2FDKA 2C6SA 1JU4A 3B3QE 2WABA 3DGTA 4G9SB 2UYAA 3VBOA 1SMVA 2GP3A 3H3UA 5LK7B 1RINA 2HKXA 2R071 3SXWA 3Q8EA 2Y6LA 3MPBA 1UYYA 4M01A 1VE0A 2BYVE 2JXAA 3EO6A 1ND3C 1XNBA 3ZIXA 5HXVA 2EVXA 2BZDA 2ZGMA 4E8CA 3QBQA 4LUMA 2VECA 4QXHA 2JD4A 1O59A 1V6LA 4Q4W3 3DF0A 2H0BA 4GB33 1X36A 4R9CA 3O1UA 3VBHC 5FAXA 2JX9A 2VVFA 1XNDA 1UO9A 2ZHLA 4Q0UA 5IVEA 3WSOA 1NY72 5APAA 2YYOA 3Q8FA 2VZSA 4X6RB 4D0QA 2IFWA 3C7HA 2G9GA 4OI2A 1FT9A 3KT1A 3UV9A 1PZ7A 2EIGA 3ZFEA 2RS53 2RV9A 2DUPA 1QJZA 5B4NA 1ZRIA 4QGNA 2WINB 1HDKA 1UIKA 4HMZA 4CUCA 1X50A 1MZEA 1IGOA 3HJRA 2ILMA 1YFUA 2VW2A 4D6QA 2C5DA 3F95A 3LEMA 5IATA 2J1SA 2RS33 2X29A 2XR4A 3FHAA 3LWCA 1CAVA 4M0NA 4P9GA 2JICA 4D6RA 1UXZA 1CPNA 4GALA 4FQZA 2EALA 3THTA 2DF7A 4H2AA 1BBT2 3CZUA 2VNOA 1JS9A 1POV1 2XLAA 4CEWB 5I0RA 1UOBA 2RMU2 4LA2A 4UWDA 2CY6A 4MG2A 4HN1A 3NNMA 1KD7A 2IVJA 4YW2A 3RZZA 4QDSA 1WUVA 4I0WB 3GYDA 3IAQA 5F32A 3V64A 3NKGA 3EMRA 4BA6A 4MHRA 4NVPA 4GZ9A 4E9KA 3CEWA 1DCSA 3ZFGA 2XDVA 3V56A 2FMYA 2XB6C 1RUD3 1W6PA 1QJEA 5FLHA 5IVVA 1XBFA 2PQSA 3RPQA 3HEIA 1L3JA 5FZAA 3RWKX 1CIWA 3T30A 5J96B 4LKSA 2ARAA 4AVTA 2RM22 2XBO2 2J1AA 2ZX0A 1CAUB 1ULEA 3AMPA 4LPLA 1YI7A 2DCKA 5E6HA 1ZX5A 3M1HA 3PUSA 4BXFA 4YW5A 1EV13 1QNWA 4UBGA 4CCJA 1D4M3 4XBLA 3OGSA 1YIPA 1FPN2 4NHMA 1ST8A 3HBKA 4KWJA 2E51A 2YV8A 1KS5A 4Q1RA 1QH6A 3KQ4B 4Y5TA 5I0UA 4M3CA 5FYHA 3TB0A 4Y26A 2XUMA 2Q8CA 5I8TA 1MZ5A 3ZSEA 3MHZA 1ACCA 1GQPA 1OLRA 1TME3 3HWJA 1QXRA 3K4DA 3LPFA 5F5IA 5HCBA 3S6PA 2W91A 1SACA 4Q4W1 1GWMA 4RS5A 2GC2A 3ENRA 1Q8VA 1VAKA 4DXRA 1FOD1 5DQ0A 3H8XA 3I59B 1JOPA 2HWF3 2A75A 3O1SA 2D5HA 4K20A 3BU0A 3J7HA 2OQ7A 1GP6A 1JZ8A 2ZTNA 4YM3A 3LIGA 1PVC1 1GOFA 2H0VA 2V73A 2D3RA 4IERA 2PLV2 5A33A 5F8PA 2VQUA 5CG8A 3R0RA 1ZRCA 3WW3A 5C8CA 2Y34A 1XU2A 4UFIA 3VBUC 1EPZA 2BNOA 1OOPA 1LB2A 2NN8A 3KT4A 4NWWA 2PHLA 3FLPA 4PLMA 1PGL1 1AR91 3OGVA 4UFLA 3AKPA 4XIOA 4XHXA 5FJHA 4FTSA 3D6EA 4PIYA 2XONA 1EAH2 1OBNA 1SDWA 2E7AA 3W5MA 4R4ZA 4DRRA 3ZXEA 5C3OA 1Q56A 4X8PA 1G86A 2BERA 2IVIB 4S2DA 3JB8A 4HSLA 1VRH1 3ZXGA 3LF7A 2DFBA 4N53A 5T3NA 1LKNA 4KWLA 4Y1UA 4FPEA 3ETPA 3UKTA 5A6YA 4DUXA 3RZJA 3KV9A 2RS12 4NRPA 4B4RA 3RZHA 5GZFA 2TNFA 4CSWA 2ZX1A 2RS11 4PIZA 1WCKA 2R041 4HSJA 5FPBA 1QOOA 5HCFA 1Z0HA 1SBEA 3PVOA 3H9AA 2VTXJ 4MXWB 5IK8A 4BM8A 1JMUB 4LBOA 1VRH2 2HBTA 2ZJCA 1ZZBA 3P1IA 3I4IA 1OH4A 3IPVA 2W0XA 1DQ0A 3T0BA 2G4IA 3KCYA 2VOWA 2BUKA 4KI5M 1N1YA 1NQDA 1CVNA 5LA2A 2JDPA 5EIYB 4LLOA 1H8TA 2BOJA 2LS6A 1H1AA 4I3PA 4WVMA 1SLBA 5D8AB 3WVJA 4JX0A 3PTYA 4QU1A 5F37A 2HWD1 2NP0A 1SLAA 5FPVA 1WW5A 2W9XA 1I9RA 2FCVA 2O1QA 1DIWA 3OJBA 2JKXA 5EHDA 5ABJA 5IVCA 1QQP2 1WLCA 1EUTA 4HONA 1REDA 3RNSA 5JPMB 2ZHNA 2RR12 1VBE2 3KSCA 5KXEA 2E31A 5C33A 3I8TA 1QIQA 2ZA9A 4NRMA 5FWEA 4FOWA 5KHHA 4NHXA 3SH3A 2YC2A 4GWIA 4Q1PA 5A80A 5FYVA 1KGYA 4OULA 3WNPA 1SBFA 3GBFA 3NW4A 2FDJA 3ZFGC 3OBZA 4CP2A 4YW7A 1KXGA 4GXLA 1QJY2 1V00A 2W1QA 2XVGA 1J83A 3AKQA 4CZSA 5BUVA 1C8NA 1W2AX 3IPVB 3M7AA 4QAWA 5E88A 1C28A 3U11A 4AOCA 1XNAA 1ZA7A 1LNSA 1RUNA 1ZZ7A 5F5AA 3THDA 4IETA 4JGYA 2HWB1 3AP7A 2VM9A 4KBZA 4MYEA 4OFGA 4M0HA 4IV1A 1UPIA 1PMHX 1RIRA 4XJWA 1QKQA 3CJIB 1OPOA 2ARBA 3KVAA 3PMSA 4Y33A 3V0AB 2P4EA 1WD3A 1AJKA 1FPN1 1QXJA 2IXKA 1DFQA 3AMQA 1PK6A 3L2HA 2NMOA 2BWAA 2XOMA 4FPCA 4HK8A 4XZUG 1PIV1 1PO21 5GZDA 5IFPA 4RGGA 2DCZA 2FCUA 3ZX7A 3DYPA 2R7EB 4ZKTB 1PNGA 4XACA 3POIA 5GLTA 1C5HA 3OGGA 1F35A 4W8JA 5CB7A 1HRI2 1KDMA 2VD7A 4IESA 4XVHA 3RI9A 2UY9A 3CLPA 3ON7A 3USSA 4PDWB 1X7NA 4A42A 1OA2A 2FDHA 2VBDA 5FZ8A 4P9IA 5CFDB 1RUG1 3C3VA 1HQLA 5FKBA 4A3ZA 5HCHA 1POQA 5DAPA 2IWGB 2XHKA 2FQPA 2EXKA 3I2IA 5FYBA 4ZZ8A 1UOJA 4NJ4A 1CAXB 1COV1 1GU3A 2QQUA 3LA7A 2E63A 2W1SA 3OB8A 4PF5A 4QKDA 4Y20B 2OX0A 5CEHA 3C7GA 5JIAA 4NPRA 4UXAA 1WWYA 3GZUC 1HJFA 3SMHA 1OQ1A 5C8WA 3H8OA 3DUIA 1UW8A 3UNPA 1VMFA 1EP0A 3WR0A 1CR7A 3IDAA 1WKYA 5HV0A 3VBOC 4A3XA 5LB6A 4JGZC 3VD9A 1AYM2 4RS5B 1S2KA 2BWCA 5L73A 3KB5A 2QQWA 4NPLA 3K77A 3SNMA 1L7QA 2GNTA 5M0TA 4QQLA 4DIQA 1TQ5A 4OUMA 4Y24A 1KJLA 1PO11 2GC1A 4FPLA 2IFRA 4K3UA 3HQUA 4TTGA 2V5YA 1Y7BA 3WF0A 1YO8A 3VZNA 2GC0A 2PLV1 2K2SA 3VBFC 1R083 3I3QA 4ASKA 3M8LA 2OUJA 2VQAA 1AR63 4QU2A 3WX5A 4B7EA 3GF6A 4YGEA 3OUJA 1PHMA 1W39A 4RD7A 1KFUL 1LOCA 1OKQA 5ABJC 1LTEA 2ZEZA 3TN92 2QQLA 5LZ6A 5FY4A 3KZ4C 3CL1A 5IAVA 2XXZA 3ILFA 3JB4C 3MZHA 1BVP1 4R9BA 1WZXA 2BNNA 2CDOA 2I07B 1KITA 1DQ4A 4E2GA 3JXSA 2JG9B 4Q4Y1 4BQ4A 1GWKA 3AMMA 4DZGA 1W8ZA 5FZFA 1OOPC 1HXS1 3VD3A 4AEJA 3CZJA 1UCXA 5JSRA 3E6CC 5LW9A 4XOGA 2ARCA 4B1LA 2WL1A 4GWMA 4N53B 1RMU1 2WNVA 1XE8A 2XQXA 4LQRA 4YZ3A 3VDDC 5F3CA 1AR72 5KXBA 2GDFA 4C1XA 4ZONA 1WLTA 3LKJA 2OIIA 1YFYA 1LOGA 2VZTA 3LAGA 3WV6A 4FTBA 4QX3A 1MS8A 1TMF2 4TYSA 2WN2A 2P3KA 3H1YA 1IOAA 2VTFA 5DAQA 2YDEA 3SHRA 4D94A 1DU3D 4QPGC 4QPGA 5F3IA 5DUXA 4ZXKA 2AACA 1F9KA 2ZGQA 1ZRRA 5K0UA 2G9ZA 3N9OA 3VGIA 1E5SA 5JI7A 3FHQA 1IS4A 2WJSA 3RDIA 4AQSA 2WNVC 4P5YA 3LZZA 4BQXA 1SG3A 1S0FA 1R092 4CUBA 1DGLA 5FY5A 4MXVA 1QQP3 1HIXA 4I3GA 3BKZA 2FHRA 2WDBA 3ZIWA 2HWD3 4QB2A 4C0BA 2A3WA 5BNOB 2ID4A 5FXXA 3ZSKA 4MGSA 2GZWA 5CIRA 2BU9A 2YBSA 3RQ0A 1S2EA 4FI9A 5GLZA 4Q0QA 4RHV2 2WZ8A 3WCRA 3KF5A 4P5HA 3MEPA 1BLZA 3D5OA 5DZGA 5JR2A 4ORFA 5IUQA 2VZUA 3D4KA 4AXOA 3FN9A 5KHKA 2GNDA 3NV3A 4LO7A 1O8PA 1GP5A 2C4XA 2XLGA 3ZFFA 1J1TA 4A7ZA 1F4AA 2KD7A 3ELNA 2YGLA 3K4AA 2DYCA 4P14A 2FZ1A 3WDUA 1W06A 1XNKA 2Z69A 4CCLA 3VD4A 1WMFA 3ROUA 1SPPB 4CDXB 2R072 5FMOS 3AX4A 5FP9A 3IZOA 2XH6A 4S2HA 2NPIA 1LOFA 1QDCA 2P34A 3AYDA 5LBBA 4AGVA 1F31A 1AYM1 3O12A 4AI1A 2VULA 3PVEA 4Q4V2 2J7MA 2VC9A 1NY71 3QOPA 1JOBA 1UY3A 4AE2A 3APBA 5ACA1 4YGDA 1UYXA 1RUI1 2CU5A 2VY0A 4Q26A 5T5JA 3T4HB 4TZDA 1XC6A 3NNLA 4NIHA 2XG3A 4Z07A 3T09A 5A3NA 5JXIA 1H6XA 1W05A 1W9YA 4N9HA 1C57A 1BMV2 2JWPA 1XSQA 4YW3A 4BIOA 4EJRA 1W8OA 1C8M3 2CWMA 4QPGB 1UY1A 1ZBE1 5CA6A 3O1RA 4HL0A 3K3NA 4COUA 5DPNA 2VPVA 3GBWA 3W58A 5FPLA 4MH0E 3C7FA 4LJHA 3DPRC 4BK4A 5LA1A 1RUF3 1AXYA 3CIHA 1DBNA 5CKQA 3RWNA 3VBOB 2DV9A 3WQ1A 1MS4A 4IE4A 3MFCA 3ZN4A 1POV0 1RUJ3 3RZKA 1MS9A 1MZ6A 1HB2A 1X8EA 5AC93 3U4SA 4HXCA 4XCBA 1ND2B 5JR7B 4QGMA 2PHDA 4E2SA 2EXJA 2H6BA 2E7TA 2ZGUA 3HT2A 3KCXA 1ZYBA 3H50A 4B1MA 2P37A 3B69A 3M2MA 3PUQA 5F2WA 4YGCA 2JJ6A 3GZAA 4KL1A 1UU6A 5FMCA 5LA9A 1ENSA 3D8CA 3UGFA 5L7OB 5JOXA 1PX3A 3VZKA 5DN2A 2JG9A 3ZPOA 5JXHA 5T54A 1LHUA 4CDXC 1XYPA 2J1EA 4IEUA 5AFBA 3FWEA 3ABZA 3BI3A 2FD8A 3WHTA 2W3JA 1BQPA 2YXSA 1ZM1A 3O0XA 2WQZC 2FDIA 3U75A 3ZFFB 2R063 5BNPA 5FOBB 1K45A 4QX2A 1JOJA 4JGYC 5FTTC 1V6NA 1ZZ9A 4HANA 1TNRA 2QTWB 4JGZB 4Y1VA 1E5IA 1ZRDA 4LIUA 1QJY1 1W8FA 2R061 2V72A 4L2NA 1D4M2 2WS92 4Y22B 3VKMA 1AR62 4LBNA 2R6QA 4S2FA 1CZVA 3RZLA 1NAEA 1EAH1 3M3CA 2VE1A 2JDUA 1GFF2 3SCFA 3SKJE 1ULPA 4NRQA 4CDQC 4UYBA 4EZ4A 1Y9QA 5E8AA 3VLBB 5JMOA 4AFBA 3E5QA 5FZ7A 2DBNA 4LE3A 1RJ8A 3A7QA 4BQ2A 5FY1A 1HB4A 2ZGOA 3I3MA 4YZ5A 5FZKA 2ZGKA 1JZ5A 3WF3A 4EV0A 2ZEWA 3CBNA 4PJYA 2QQJA 3VHRA 2ZCWA 1GQGA 2QUOA 2A6YA 2OW4A 5FZOA 3Q8AA 5A7PA 2WA3A 4Q0PA 1EPWA 1QDOA 3O14A 2WWUA 2CAVA 3FJSA 4XW3A 4CCKA 4DB5A 2PFWA 2D93A 2BP6A 2JG8A 3I2JA 1SDDB 2GNMA 5DXDA 2BGOA 2W5FA 5BPXA 1O3TA 5E89A 3RSJA 4HK9A 1I5ZA 2YFUA 3TEXA 1W0OA 4A41A 5FPXA 2D6KA 1W6QA 5CZKA 1O3RA 1AL0G 2WFPA 4IEXA 2E6VA 3WNMA 5FJKA 2HJIA 2PMWB 2ZGSA 4QDRA 4O65A 4ZS2A 1LJ7A 3VDBA 4QQ2A 1Z7S1 5AC92 3T2QA 1HRV2 3KHCA 3AC0A 1C8M1 2J1TA 2R1BA 3C7EA 4I02A 2JG8C 4BHPA 3BU7A 2WO7A 1W9WA 3JD73 1O3QA 3WOGA 3ZSJA 4XC9A 3BUCA 5CADA 1F8VA 2JE8A 1ZBA2 3SEEA 3JUUA 5CFCC 2MPFA 5CAZA 2ZHMA 4QQOA 1WW4A 1QOSA 1MVEA 1R1A2 1UL9A 5LRSA 2LALA 3OYWB 3AMHA 4D3WA 2C24A 4N53C 4QXKA 3CU7A 1W8HA 4PQQA 4LKEA 3ZYHA 1GZWB 3USUB 3S57A 1A78A 3OG2A 4GKYA 3PDQA 1GKBA 3WY6A 5IVJA 3MIEA 2RS13 3AP4A 3U1XA 3VKLA 2PHXA 1DP0A 2CGPA 1W6OB 3MO4A 4MHUA 1GQHA 1SPPA 4QB6A 4CU6A 5IFTA 1MPXA 2XWJB 4AW7A 2PN5A 1YNAA 3E5XA 4JKMA 5F5QA 5LBEA 3TWIA 4QQHA 5FOJB 3ACHA 4I30A 5IAXA 5GZGA 2RMU1 5EZWA 4H3WA 1GMMA 1J1LA 1VRH3 3B02A 3BTZA 3WW2A 3VBSB 1VBC1 4U36A 3PTRB 4XZPA 1VR3A 3MI8A 2XJTA 3CJIC 2ET7A 4AI8A 4NIGA 2DBIA 4HKOA 4E27A 4XQDA 4AEKA 2OT7A 2Q1FA 4CDXA 3WW4A 3H8UA 5KHIA 5CVRA 2WO1A 3NQHA 1RUI2 2SBAA 1SCSA 4FOVA 1ULDA 2IZWA 2XJRA 2A6XA 4S2GA 5K9YA 1ZVFA 4FOYA 1Y4WA 3NMBA 2CSGA 1WA4A 4XUPA 5GM0A 3PVNA 3G7DA 4Q27A 5C70A 4F8AA 2JDMA 1URXA 1VBB1 2DTWA 5T55A 4IV3B 4UFKA 4AHWA 4PDWA 1WCUA 3FX3A 3E6DA 3DKQA 3N9MA 3GZTB 2A71A 4CYDA 2VZRA 3TAYA 3ZDVA 3RMYA 3T4VA 4LEJA 2DVBA 3I2HA 5FK8A 1X9TA 3TRSB 1HB3A 3HT1A 2DTYA 2RM21 2XBO1 1QJFA 3GCWA 4LULA 3NWKA 4YFZA 5FYZA 1MQTC 2HWC3 3IDBB 1VJ2A 1LENA 1WCSA 4JCKA 4E4HA 2ZGNA 1TEIA 2RE9A 4XFFA 3TBDA 3DPRA 4FVVA 2WNEA 1JUHA 1LECA 2WSUA 1AYN1 5E1RA 4LBQA 3GDBA 4UT5A 4XF9A 2WUHA 5C4WB 2VMCA 2QQPA 1VMJA 5FZDA 1BXHA 1NE4A 2ZEYA 3MIBA 4ZU5A 4CDWA 1X9PA 4OI0A 2QDRA 3QCWA 4ZPIA 4EN6B 4R9AA 4E2QA 4YZ2A 4L9BA 4AHXA 1GZ9A 1UYZA 4DY5A 2GSYA 2X5IA 3EHKA 1OC1A 2OPWA 3DYMA 3ZYFA 1AR61 5EPAA 5ISLA 1R081 1HJGA 3LIHA 4E4SA 1RUE3 5KWRA 1BBT3 3AMNA 1RUD1 2R30A 4D8MA 1O4ZA 1PO13 2VUCA 3T0DA 4Q8KA 2GN3A 5HXMA 4HT1T 3LB9A 4IEQA 3ORJA 5GALA 1ODNA 1X33A 1GOHA 2XKPA 3IM0A 2QNKA 4GMP1 3TOJA 2WA4A 5FYCA 4D69A 2Q1MA 4HKWA 4QKFA 5BNPB 1LU2A 2DVFA 4MADA 4XDPA 5DZFA 3DXTA 2BVBA 1OT5A 1LOFC 1SQ4A 2WAAA 5F3GA 5F7UA 5JWPA 5KBFA 3TYJA 1C4RA 2D97A 1S0EA 3MW2A 3OEBA 2VU9A 4L11A 1GLHA 1DGRA 3BOWA 3VBFB 3O1OA 2RS31 2LROA 1SLLA 2YC4A 3VL9A 3LA3A 1D4VB 1UQXA 4M4PA 5IK4A 5JUVA 3TEWA 3M3QA 1V0AA 5J3UA 1DG6A 4AI2A 1ODMA 2D3PA 4OCTA 1QJY3 1KRIA 4A7KA 2A1XA 4D7TA 5FUIA 2JENA 3AL5A 5FREA 3ZMNA 1W8WA 5KHJA 2JB4A 4L92A 2PHFA 4QPYA 5KC6A 1DF0A 2WIIB 4Q4V3 5EWSA 1ND2C 1RL3A 3NL1A 4HETA 1HV0A 3ZO0B 4R9DA 2D5FA 1F4HA 4MGYE 1OF3A 4ONUA 4W4ZA 1XB9A 4Z82A 4COWA 1RHI3 3O1VA 1OA4A 3OPTA 1JZ4A 2VO5A 4KG8A 2VR4A 2QQOA 4H55A 2OXBA 4XETA 2Q8OA 2F6BA 2X5IB 5J36A 3POSA 1CX1A 2IC1A 3UKNA 3KGLA 4JTNA 4FFGA 4MX3A 1ND3B 1D2QA 1OXCA 2EIEA 2RDRA 2ATFA 3AXDA 5A3OA 3WEZA 5IHRA 4KBBA 5FXVA 2HLEA 4LO5B 4TSVA 3D3AA 1NXMA 1ND2A 2WFF3 5FMBA 4UFMA 2P1BA 3BOPA 5FYIA 3D0SA 5FYUA 2Y60A 3AVRA 5JSPA 2ADDA 3S5AA 2C26A 3FFQA 3ZVXA 4WM8A 3VBUB 3B5LB 4QX0A 4NROA 1OA3A 3OD4A 1N1TA 4YNIA 4YVWA 4LK6A 5CYYA 4OQ9A 4BQ3A 5A33B 2ZZJA 2EXHA 4CXWA 3KLSA 4NMIA 2B9UA 4JC1A 4TXWA 3NAPA 1W6QB 2X10A 3AFKA 3ZN6B 2A6WA 5LWBA 1APNA 2W08A 3LDBA 5FZCA 2PAMA 1W9TA 2WZEA 4YGBA 3GGLA 2D6LX 4MZUA 2P3YA 1RUC2 1W0NA 4SBVA 3WDWA 4I09A 4LR4A 3WF4A 3ZR6A 2J1VA 1T6BX 4KU8A 4PT6A 1EUUA 4DRVA 1UNBA 5ACA3 4LORA 3ZSMA 1NLSA 1FXZA 1XJAA 5DZEA 5C8CB 2NQYA 5BNOC 4FOQA 1AYM3 4GQ7A 1DLLA 2WSVA 3IMMA 1R1ZA 1H2LA 1K12A 2VXRA 1O4YA 1WA6X 2JG8B 3VUOA 3MIDA 3H1MA 5LK5A 4UFJA 3J8F3 4RHV3 4AVSA 5CKMA 1LHWA 1VAMA 3B9IA 3B93A 4V2VA 3GM8A 5FKCA 4PCRA 5T50A 3X29B 3I49A 1J58A 1VBA3 1IKPA 2HWC1 2XVKA 3AXEA 3I59A 4XF1A 4LBJA 1AR71 4XFAA 5EP9A 4P02B 1ZA4A 4J1XA 2DU1A 4COZA 2OZJA 1AR82 2NYYA 2MHFA 2W1UA 2GH2A 1VB4A 5HPOA 3INAA 4NN0A 5A32B 2WR9A 3UETA 4WVZA 1JU3A 1F5JA 4FCAA 5IW0A 2W95A 3VHNA 3BTXA 2RJ2A 1QQP1 1VBB3 3J8F2 1HX6A 1DQ1A 1NG0A 1PM7A 2WNUC 2ZGRA 5FZHA 1OH3A 3AZYA 3A0KA 1FYUA 4M3CF 4E4DX 4A6SA 5IK5A 4Z8BA 1Q3EA 2F4LA 1JXNA 5L9VA 4BISA 1CAUA 1RYYA 5BXXA 3WZ1A 4URAA 1HV1A 1HN0A 4LHNA 2P5BA 4NHKA 1AR93 2A73B 3CHXA 1WGPA 1WMXA 2ARXA 4XFHA 2VCBA 1MS1A 3WNNA 3CQOA 4LTAA 2GNBA 4RFRB 3AKRA 4OHXA 5AFEA 4FSJA 2QE3A 4PBPA 5C5UA 3QLQA 4LBMA 5DG2A 1WW7A 4ET7A 2C0ZA 3RS6A 2BGCA 1OD3A 1RXGA 2JDYA 3JD72 3V65A 1OVSA 1PK6C 1PVC3 2HH9A 1VIWB 1HXS3 1JTZX 3IT8A 2DU0A 1ZBA3 4UF0B 2P2KA 1H1MA 1W2UA 4MGQA 4RN5A 4XE9A 2VNGA 4BH9A 4DINB 1QHDA 4WM7B 4OLLA 4B3NA 1GBGA 2VZVA 3F2ZA 5FUPA 5FZ0A 1N1VA 1NCQA 1H0BA 2R32A 1FOD3 4WZFA 5F9TA 2W2IA 2NM1A 3HBZA 4P08A 2Y33A 3ZYRA 1R082 3AKTA 2ZX2A 4WZCA 1QU0A 3U0ZA 3RI8A 3N35A 5EV7A 2B5HA 4FPJA 5L9RA 3OUIA 3R05A 4P9YA 4QPIB 4RA0A 2WLPA 1ULFA 4YG6A 3H42B 2AYHA 3E6BA 1O8SA
chains in the Genus database with same CATH topology
5L19A 4DQAA 4A2UA 5FLJA 3JD71 4AI3A 5C9AC 4N7UA 4H7MA 3WHUA 4XMAA 1LRHA 4DPNA 3ZMOA 1DYPA 3ECQA 2GMMA 2GMPA 3ZXAC 1JYIA 5DDJ1 1NCRB 4Q4X1 3ZXKA 3WUDA 1ENRA 5EYXA 1LOEA 1WMDA 2JE7A 2VMHA 1R1A1 1ZZ6A 5H9PA 4AEDA 2ZX3A 1ND3A 1IPKA 5JDBA 2VGDA 4HZFA 1CAXA 4AVCA 4M3CB 2TBVA 1C8M2 4PIXA 1MEC2 4XHBA 4EWDA 2DCYA 5L36A 5J37A 2B8MA 2D44A 2WZPP 4ES9A 4XDQA 2AZ5A 3ZXLA 2JKBA 3KS7A 4M3CE 3RYRA 1NA1B 1QWRA 3DPRB 1FMD1 3IIAA 4DXZA 4K7JA 4PLNA 4YVSB 3LOBA 1YJLA 1RC6A 3U07A 1Q8PA 1RUH2 3ILRA 3WP5A 4HVQA 4QHBA 1J59A 2TEPA 4YG0A 5GKAC 4BLJA 4EWEA 3SISA 3O0VA 1QY4A 4YFWA 1FX5A 1FPN3 2D7FA 1AYN3 4OHWA 4CEYA 2ZKNA 2VOXA 4WVVA 4GA9A 1U5YA 5J7MA 4GB31 2CYFA 1VBD2 1OQEA 2RM23 2XBO3 3L2YA 5C8CC 2WNVB 2JECA 3O5SA 2B42B 2XJPA 2A3XA 4RGAA 5FFOC 1Y3TA 2Q4SA 5D8AA 5FO8B 1AX0A 3AK0A 4FBFA 5I8YA 3M3OA 4NO4A 2R042 2EAAA 3WUCA 1AHSA 5J48A 1HRV1 3FBMA 4B8EA 5AC91 2EAKA 1GYKA 3MIFA 2X5IC 4NHLA 2FBEA 2ZGLA 2JEMA 3WINE 4Z1VA 4RS5C 5JZGC 3I7DA 1C1LA 2MEV2 2VOKA 2XWBB 1DDLA 4Q2FA 4IEVA 2QDNA 1REEA 2CAUA 1LR5A 1A3KA 1RUC1 4Q0VA 2DFCA 1V9U1 1ZBE3 2HWE1 4IEWA 1VBC3 2A5ZA 3AYCA 5FLIA 3WDXA 3KQRA 3MIGA 3V0BA 1PGL2 1WMEA 1UKGA 2NLRA 3IDEA 4B29A 3TNPB 4QM8A 1UPSA 4HBNA 3DL3A 2HEYF 2ENRA 1QGLA 4HFSA 1UZYA 1H4HA 3WDTA 1ZREA 2D43A 4XIKA 3ZXJA 1DGWX 2E53A 3AYEA 1CN1A 3EJKA 1B09A 4Y4YA 1HW5A 1LODA 4FPFA 4AEDC 4YG3A 2ZAHA 1D0HA 1V70A 4EN7B 4AWDA 3NKTA 3WDYA 5GZEA 1AX1A 2WFF2 4HLTA 4C91A 4J1WA 1QXPA 2Q5TA 4LHKA 4EN9B 3ME2A 4L97A 3W59A 1PMIA 1X8MA 1CONA 5CFDA 1V9U3 1Z7S3 3BCWA 5JIUA 4AF9A 3AZWA 2AR6A 4P9LA 3VZMA 1YYNA 1C5IA 3A0NA 4XBNA 4UW6A 5GJ6A 4DNYA 3R4SA 1Q8OA 3EXUA 4PQ9A 3ZFEC 1SFYA 1ZZ8A 2UU8A 2ZAAA 3FUQA 3CJXA 4IEPA 5CFDC 3PJYA 4J6GA 1EV12 4CDUC 4LNVA 5I93A 1TNFA 4IV3A 4N43B 2OPKA 3IDCB 4PLOA 1Q8QA 5DUWA 2BBVA 3A4UA 3BALA 5J09A 2ZPXA 5K0UC 5LEKA 3IWZA 1U5IA 2WZR2 3PHMA 1TME1 2XJSA 1EAH3 4Y1YA 4XFIA 2DUQA 3J9SA 5D8AC 5JAXA 1YWKA 1IS5A 3NVCA 1NOVA 3WT3A 3DV8A 1AX2A 3AP9A 4MVTA 3HMYA 1YLLA 1Q8SA 4FP3A 1ASJ3 5BYNA 4XMIA 3MFAA 4MXWA 4UW4A 3MPPG 1VBB2 1U5ZA 5GLVA 2DURA 3NV2A 4RR3B 2WT1A 4OI4A 1GZWA 4FO9A 3USUA 1B35A 4GH4B 1BEV2 5AVPA 5J98B 1BJQA 1PGW1 5A32A 4X8NA 4YVSA 3D0JA 5EFUA 1N3QA 3VL8A 2ZGPA 1V6OA 1BCXA 1S0CA 3OF1A 1CAVB 3FE5A 4Y22A 1LEDA 2LM3A 2EF6A 2Z79A 4BIFA 3I2DA 4JDNA 3AJZA 3CNAA 4Q4X2 2R0FA 5JPNB 2W52A 1S0GA 1CQ9A 2VW0A 1YCIA 4D7SA 5FCCA 3FZ3A 1PO12 4UBHA 4LBQD 5EJ3A 1YFWA 2QJVA 4FP2A 4AVVA 1S0IA 1WBLA 2UWAA 1IZ3A 2P3IA 1M06G 3FC0A 5SV8A 1PVXA 1QMJA 2BFUS 3THPA 2RS52 4C1WA 3NAPC 1UN1A 4JDMA 2BW8A 3L9JT 2WQ4A 3WG1A 4BMBA 4URTA 1RVF3 2IXHA 1DZQA 2PAKA 2DVDA 1RUI3 4FPGA 4RR3C 1W6MA 1GR3A 3JZVA 4CP0A 5BNNA 4YM0A 4WM8C 2HWF2 1FV3A 3AP6A 2I74A 3WG4A 1W6PB 4CEYB 1PIV3 1PO23 1NCQB 4XEZA 4O9EA 1V6MA 2WZR3 3BIWE 5CFCB 3WP6A 1N1SA 3M3EA 5JMCA 4CDUB 1XU1A 5BY5A 3TN91 5AVAA 1JHNA 3E5UA 4W6WA 2PELA 1FMD3 2ZKLA 4YSFA 4L8QA 4E4ZA 2CNAA 5FMOL 4OZXA 4F7ZA 4OI1A 1K5MB 3I54A 4DMIA 1YJKA 1AR83 2X53S 4ISRA 3B01A 4IEYA 5DDJ2 4GH4C 5EYYA 1SLTA 1UAIA 1UF2C 1JBCA 1FI2A 2P17A 4K6BA 1XNCA 1REFA 1Z7S2 1WLDA 4LO4B 1LEMA 4IV3C 4QX5A 2BFUL 4RSUA 3T1MA 3AZVA 3GHNA 2D6OX 4CDUA 1Z78A 2YROA 2CL2A 4ATEA 2VMGA 4XBQA 1SLIA 2GMEA 4CTEA 2YPJA 5I91A 1TMF3 5C9AA 1R093 3RG0A 3ZYJB 4XF4A 3WQ7A 1ZNPA 4N90A 1QH7A 2XL9A 5JOWA 3KMHA 4CRQA 1W6MB 1BK1A 5LRRA 1LHNA 1VBA1 3VBSC 4Q4Y3 5IK7A 3WNXA 1NCQC 1YRZA 1GZCA 1MQTB 1TME2 4Q29A 4YM2A 4BWOA 5CBLA 3J8F1 1HKDA 2RJLA 3H1WA 2QZ3A 4CP1A 1J3RA 2Y26A 1IHMA 2NZ9A 4WV8A 3QH6A 1RUE2 1V6KA 3VBHB 4AQTA 2PAEA 3D82A 2NMNA 3SH4A 3N36A 1ZBA1 4XPVA 1PGW2 4U2AA 5BNOA 4W6YA 2MEV3 1BEV1 2FMDA 1AJOA 5JVVA 2HWB2 1MQTA 3MYXA 5GZCA 2XJVA 1JN2P 4I0AA 4TLFA 4XJZA 5HBAA 2BEOA 3WCSA 1KFXL 1LULA 3NV4A 4B4PA 1HQWA 5K0UB 3MDPA 1JW6A 1CJDA 1NLRA 2GN7A 2OVUA 3MLJA 2WFF1 3RRDA 1NA1A 1CPMA 1QNYA 2D98A 4JTOA 5JZGA 3ZYIB 4ES8A 3H3ZA 3B9CA 1AF9A 3JU9A 1W6NB 2LTNA 3E97A 4CEWA 4N9IA 2B46X 4IV1B 2KXLA 4AGGA 4B4QA 1H2MA 3NO8A 1AR73 1PVC2 1S0BA 3KD4A 3H7JA 2RR13 1AXZA 1Q5OA 5E16A 4QQPA 1EV11 1I3HA 2HWE2 1CESA 4FXKB 5FO7B 4LLFA 3SCGA 4F83A 1BYHA 4LO6B 1AZDA 1PGSA 1IS6A 1EYBA 3JCIA 2C1FA 1WD4A 1AVBA 1UZZA 1VBE3 4N43C 2ZS6B 4HVOA 1N3OA 1AUYA 1A8MA 3MLKA 4XXPA 5FPZA 5GLUA 1WW6A 2Y0IA 2Q1ZB 3AZXA 3OPZA 4B7KA 3LSEA 3P3PA 3IBMA 5BNQA 4ZU7A 5BNNB 4IXLA 2K9ZA 1A8DA 1QF3A 1LOBA 4OVEA 1N47A 2VUAA 2CGOA 3VBFA 1DGWA 5GLWA 5TSWA 2H6CA 3UK9A 4LHLA 4WVWA 3N7LA 4OHVA 2RS32 4CDQB 3RJRA 1RUE1 2A6VA 1QJU3 4RFT0 1B35B 1ASJ2 4JRAA 4ZU4A 1DYKA 1ULGA 3FUOA 3TN93 3ZDSA 2A70A 5C6CA 1OHFA 1NE6A 4XJ8A 3HIFA 2AGSA 2VUJA 2VNRA 1ZBE2 5FRAA 4YVSC 1XRUA 4KG0A 1JUIA 1CAWB 1SCRA 2YMZA 1UX6A 4DFSA 1BMV1 1CD3G 3O0WA 4EWAA 1BZWA 4Q4W2 2ZMKA 1RMU2 3LCPA 4Q0SA 4BMEA 1RVF1 1KQRA 4Q4V1 4K8FA 4CDWC 5JOZA 1HXS2 3ES1A 1NQJA 2YUEA 1LCLA 2XL7A 1G8WA 2ZOEB 4LA3A 2QFEA 4P9XA 5K8SA 4XF0A 5EXOA 4UW3A 1ENXA 2R073 2BPA2 1OFSA 2DCJA 4C0HA 3FFZA 3PMEA 2YY1A 1KS4A 4K1YA 5I0SA 5CG9A 1RJ7A 1XXNA 4BZ4A 2JE9A 4FPYA 2VOVA 3SLIA 1UD1A 4ASMB 3JBG3 1UKRA 5HI0A 4KWKA 3DN7A 3MIHA 1V9U2 4PDWC 3S30A 3VZOA 2PA7A 2JG9C 3S7IA 4GB32 2BQPA 4GMP3 4GWNA 4XF3A 1HQNA 3NJZA 1W0PA 1DQ6A 1RUG2 2WLQA 4FPOB 1AL23 3VDDB 1VALA 2MEV1 3LA2A 2RMU3 3MF6A 4R52A 2DCTA 1RUF2 4AHZA 3IKWA 4AFMA 4EROA 4QPIC 3QD6A 4FAGA 1BBT1 1HRI1 1VBA2 3AFGA 3OY8A 3WD5A 1LGBA 4YM1A 2HWF1 3ATGA 4AFCA 3AKSA 3CF6E 1M4WA 3WG2A 1KJRA 3ZN6A 4FPHA 1H30A 1MS0A 4BE3A 1PIV2 1PO22 4RQPC 1RUOA 5H9RA 3ST7A 5FO9B 1FMD2 3BTAA 5A3MA 1LOAA 2YZ4A 4GULA 1JYCA 5T5OA 1RUH3 1I6XA 4NOTA 4W65A 1OOPB 2BTVC 1T6GC 3RMXA 1LGNA 3VN4A 1V6JA 3N7KA 2D6NA 1O4TA 4YLZA 4LO8A 1U12A 1OPMA 4XFCA 4F3JA 2YHJA 3KCCA 3QACA 1AYN2 4YVWC 2BVVA 1E57A 1UU4A 3ZPYA 5DUVA 1MACA 3NV1A 3QH7A 4MGZE 2O0OA 1D2SA 3ASIA 3KT7A 4XFBA 1A6CA 2RHPA 3FLTA 2Y0OA 4YW4A 3VBRB 3BPZA 3C2UA 2XGXA 3IN9A 5B2GB 4IEZA 1AL21 1JH5A 1IPJA 4JGYB 2UWBA 3H7YA 4TWTA 2GH8A 4HKLA 4XJAA 3K48A 1DHKB 1LGCA 2CWSA 4MV2A 2HWD2 4MSVA 2W68A 1POV3 4RQPB 1IKQA 2XKOA 4CEYC 2G9FA 3FHIB 2UURA 3V0BB 1AR81 2AREA 1GSLA 4AEMA 2IXLA 2CGNA 4I0BA 2CV6A 2PHWA 4L99A 4PBOA 2WNUB 2WKKA 4YYOA 5JCTA 2UYBA 3J26N 1G9AA 5BNNC 1H2KA 1PZ8A 2RS51 2GAUA 3N4MA 5ABJB 2EA7A 5CU1A 2ZABA 3B94A 4XYXA 3MICA 2WZR1 4OHZA 3GBGA 4AVBA 3FLRA 3VKOA 4AI0A 2YC0A 5JI9A 3LOIA 3WDVA 3VKNA 4H7LA 2W39A 3S7EA 1G6NA 3SH5A 4XFGA 4I01A 4AGRA 2QCSB 2D3SA 4SLIA 3VHOA 1G9CA 2Y38A 4JGZA 2DUOA 5JOYA 2KM2A 5BNPC 4JQRA 3CO2A 4QMAA 4GKXA 3P3NA 3NSTA 5KHGA 5C9AB 1XYNA 3O7OA 1K5MA 1ZZCA 3AP5A 2R16A 1LHOA 1O7FA 4C90A 1QJU1 2XVLA 2AH2A 3JQWA 1CGPA 1DGRN 3GALA 1VAVA 4XXAA 3N7JA 2WWSA 2GU9A 1HRV3 4BQ1A 4CDQA 2XPJA 1DQ2A 1FNZA 1H1IA 5D1IA 5FDBA 2TUNA 2X8KA 2WS91 4MGIE 1IQAA 1BKZA 1O91A 1FOD2 1S0DA 4QPIA 1GANA 2HWC2 4HN0A 3WG3A 1OLQA 3GHMA 2QZ2A 3ZFGB 3VBHA 3U10A 4QT6A 4H14A 2HYKA 4LUKA 4YARA 2VW1A 1J3QA 2ZBJA 1VBE1 3HD8B 4UW5A 1F5FA 4G3YC 4BCUA 4KGGA 3GNEA 1AL22 4Y1ZA 3J4UH 1WCDJ 2Z5WA 3M70A 1ASJ1 2PQQA 1U5XA 5JLVA 4KNCA 3AZZA 4COYA 3MW4A 1ULCA 3MW3A 2ZZQA 2D40A 1MS3A 1Y43B 4N7IA 4DY3A 5ACA2 3ZFEB 1QJX3 1UIJA 4FTEA 2R49A 1OD5A 1SBDA 1YIFA 4FPKA 3ILNA 4WBBA 1RGSA 1W6OA 1RHI2 3HR9A 3LGRA 4KU7A 5L7OA 2PTMA 3ETQA 1WBFA 1ALYA 4YVWB 4Z92B 1X82A 3FBYA 1YI9A 1UMZA 3TNQA 3WP3A 1C1FA 3BODA 4HPKA 3IMNA 1SFNA 3AM2A 3VBRA 3KM5A 1K5MC 4W6XA 1DQ5A 4IV1C 1RUJ1 4MLOA 4AQ6A 1R1A3 1UU5A 3OD0A 4Q8LA 1LESA 1VBD1 1RUF1 2K0GA 1BEV3 4QD2A 2C9AA 1EY2A 1RMU3 3HQXA 4K40A 4Q4X3 5DDJ3 1ONAA 2VMIA 3UJOA 5CFCA 2VQ0A 3OY8B 4XQWA 4EN0A 2ZACA 1H2NA 1CX4A 2F4PA 1ENQA 5T5PA 1XE7A 1YFXA 1RUH1 1N3PA 3UJQA 2R1DA 4A7YA 2WNUA 2E9QA 3AB0A 1OSGA 5I0TA 4JV4A 3M4FA 4V1PA 2VH9A 2IXCA 1NCRA 3N3HA 1S1AA 2SLIA 1S2BA 4MGKE 1H8VA 3WLUA 2PLV3 2B7YA 2V09A 1KDKA 1FNYA 1RVF2 4MUVA 1MEC1 4WM8B 3VBUA 3JBG2 4RR3A 3MGUA 2XLFA 5CNAA 2HWE3 1TMF1 3EQEA 3AYAA 1HLCA 1RITA 1RUC3 2WT0A 1QJX2 1GNHA 3MLLA 1MVQA 5F6LB 3NAPB 4AYUA 4BYYA 4IQPA 4K21A 4WM7A 3PLQA 1H4GA 3M3IA 1GV9A 2AUYA 1CAWA 1U0AA 1COV3 4LBKA 3ACLA 4FQ4A 2GALA 3OBRA 1H9PA 2YGMA 1O3SA 3WXPA 1WLWA 1VP6A 1J3PA 2ETEA 4JVAA 4O9GA 4IL7A 3VV1A 5F1RA 5JSOA 1RUJ2 4YZ4A 3VBRC 4CEWC 1QJX1 1V6IA 2OYZA 3SCHA 1RUD2 3N7MA 5H9QA 1XYOA 3OGJA 5KXCA 2PHTA 4RQPA 4QGLA 5FQ0A 1COV2 3T1LA 3Q9OA 5L7OC 5C4WC 1F2NA 2QVSB 4IEOA 4XILA 4YW1A 4Q4Y2 5T52A 3UL2A 1D0GA 3AJYA 3EBRA 2ES3A 4HVRA 5I8SA 2RJKA 5SV5A 3WW2A 2B39A 2XJQA 5KXDA 4ASLA 5LEJA 3PJQA 4YRDA 3PNAA 2XJUA 1YXWA 5HCAA 1SLCA 2FZ2A 1DZTA 4D7YA 4COVA 1C3HA 4AFAA 3BB6A 1S0JA 4G4FA 4P9WA 4INDA 2WS93 3T2TA 2ET1A 2IXIA 4Y20A 4AHYA 4AK3A 2MNGA 4X6QB 3ZXDA 4GMP0 4AQ2A 5KC5A 4KQ7A 2QKDA 3ZSLA 1GICA 3PVBB 2OA2A 3POWA 1DZRA 3VHPA 2UWCA 2EXIA 3RYPA 3RYKA 2WC2A 1FV2A 4OUSA 4ITCA 3VBSA 1H9WA 5JZGB 3MF9A 1LU1A 3OTFA 1MEC3 1NYWA 3OYWA 4LBLA 2B45X 5FBZA 2CTVA 4QM9A 3VZLA 1G9FA 1MS5A 1VBC2 2AENA 4FXGB 2ZHKA 1RUG3 2HEVF 2RR11 4GH4A 1PK6B 3HN1A 1QJU2 3DKWA 3G6JB 4NWVA 1RHI1 1SEFA 4LBQB 1H8TC 4KGQA 2Q0AA 1VLNA 4KH9A 1YHFA 2IXJA 1OI6A 3UKVA 3R4DB 2LUWA 3ALQA 2DVAA 5DG1A 2WT2A 3ZN5A 3KGZA 1LHVA 1AXKA 5BV6A 1XQNA 4RL7A 1CJPA 3JQXA 3WQ0A 4XTPA 1VB2A 4WM7C 3H0OA 3HAGA 5F6KA 1PZ9A 2R0HA 3V0AA 1AR92 2OZ6A 3CJIA 4AEDB 1MR5A 2VVEA 2ZMLA 4XTMA 2HWB3 2UY8A 4LT5A 4NR1A 4JDOA 4DS0A 4JRLA 5A3LA 2JDZA 1TE1B 3ZFFC 5C4WA 4BOWA 3B7MA 1VBD3 4FAHA 4LE4A 3R4UA 3K51A 3ES4A 3VDDA 3W9AA 1RTVA 3OCPA 3FMGA 2ZMNA 2DWRA 3ZYGA 4N43A 5H9SA 4BLIA 3WP4A 1FAYA 4Y5Z0 4P9JA 3WW1A 1MZFA 2R062 1NCRC 4M00A 1IS3A 1O5UA 4GIQA 1NXD1 2D6MA 3POYA 4I2OA 2I45A 2E7QA 2A7AA 4XQ4A 3VKFC 4ATFA 2KA3A 2Z42A 5IT6A 1GNZA 2I2SA 1QOTA 4ISQA 2ERFA 1ZRFA 2ZX4A 2PYTA 2Z2SB 2O8OA 1H8TB 4WVMB 2PHUA 4META 3B00A 1Q43A 2N7GA 4R8HA 5T5LA 1S55A 2DVGA 1OQDA 2HEWF 4AFDA 5FQ0B 2PHRA 4R4XA 3RJ2X 1D4M1 4EN8B 1B35C 2D6PA 4RHV1 2VG9A 2R043 1NA1C 3LSDA 1BVVA 2GC3A 1YUDA 1NZCA 2OUHA 1O5LA 3S0MA 1HRI3 4AVAA 4CDWB 4Z2WA 1R091 4DOUA 3OBTA 2A3YA 1I1EA 3ZYPA 1W6NA 2P3JA 5DUUA 1G7YA 3VZJA 2VVDA 1FATA 3SITA 4K1ZA 1G9BA 4Y1XA 2ZGTA 4AG4A 4OHYA 2BNMA 3U4XA 1OMIA 4YZ1A 2A6ZA 5K7PA 2Q30A 3JBG1 4JAAA 4XJUA 4BPZA 1OFNA 1PNFA 4FT8A 1G9DA 1RB8G 4K9SA 4XJ9A 4HPKB 3R6SA 2O8QA 3ZXFA 3B3QE 3DGTA 4G9SB 2UYAA 3VBOA 1SMVA 3H3UA 5LK7B 1RINA 2HKXA 2R071 3SXWA 3MPBA 4M01A 2BYVE 2JXAA 3EO6A 1ND3C 1XNBA 3ZIXA 5HXVA 2EVXA 2ZGMA 3QBQA 4LUMA 2VECA 2JD4A 1V6LA 4Q4W3 3DF0A 2H0BA 4GB33 1X36A 4R9CA 3VBHC 5FAXA 2JX9A 2VVFA 1XNDA 2ZHLA 4Q0UA 1NY72 2YYOA 4X6RB 2IFWA 2G9GA 4OI2A 1FT9A 3KT1A 3UV9A 1PZ7A 2EIGA 3ZFEA 2RS53 2DUPA 1QJZA 4QGNA 2WINB 1HDKA 1UIKA 4HMZA 1X50A 1MZEA 1IGOA 2ILMA 1YFUA 2VW2A 2C5DA 2X29A 2RS33 3LWCA 4M0NA 1CAVA 4P9GA 2JICA 1CPNA 4GALA 4FQZA 2EALA 3THTA 2DF7A 1BBT2 2VNOA 2XLAA 1POV1 4CEWB 5I0RA 2RMU2 4LA2A 2CY6A 4HN1A 1KD7A 4YW2A 3RZZA 1WUVA 4I0WB 3GYDA 3V64A 3NKGA 4BA6A 4NVPA 4E9KA 3CEWA 3ZFGA 3V56A 2FMYA 2XB6C 1RUD3 1W6PA 5FLHA 3RPQA 1L3JA 1CIWA 5J96B 4AVTA 2RM22 2XBO2 2ZX0A 1CAUB 1ULEA 3AMPA 1YI7A 2DCKA 1ZX5A 3M1HA 4YW5A 1EV13 1QNWA 4UBGA 1D4M3 4XBLA 1YIPA 1FPN2 4NHMA 4KWJA 2E51A 2YV8A 1KS5A 4Q1RA 1QH6A 5I0UA 4M3CA 3TB0A 4Y26A 2XUMA 5I8TA 1MZ5A 3ZSEA 1OLRA 1TME3 3HWJA 5HCBA 1QXRA 3S6PA 1SACA 4Q4W1 4RS5A 2GC2A 3ENRA 1Q8VA 1VAKA 1FOD1 3I59B 2HWF3 2A75A 2D5HA 4K20A 2ZTNA 4YM3A 1PVC1 2H0VA 2V73A 2D3RA 4IERA 2PLV2 5A33A 5CG8A 3R0RA 1ZRCA 3WW3A 5C8CA 1XU2A 3VBUC 1EPZA 2BNOA 1OOPA 1LB2A 2NN8A 3KT4A 4NWWA 2PHLA 3FLPA 4PLMA 1PGL1 1AR91 4XHXA 4XIOA 3AKPA 4FTSA 3D6EA 4PIYA 1EAH2 1SDWA 2E7AA 4R4ZA 4DRRA 3ZXEA 1Q56A 4X8PA 1G86A 4S2DA 3JB8A 4HSLA 1VRH1 3ZXGA 2DFBA 4N53A 5T3NA 1LKNA 4KWLA 4Y1UA 4FPEA 3UKTA 2RS12 4B4RA 5GZFA 2TNFA 2ZX1A 2RS11 4PIZA 1WCKA 2R041 4HSJA 1QOOA 5HCFA 1Z0HA 1SBEA 3PVOA 3H9AA 5IK8A 4MXWB 4BM8A 4LBOA 1VRH2 2ZJCA 1ZZBA 3I4IA 3IPVA 2W0XA 1DQ0A 2G4IA 3KCYA 2VOWA 2BUKA 1N1YA 1NQDA 1CVNA 4LLOA 1H8TA 4WVMA 5D8AB 1H1AA 4I3PA 3WVJA 1SLBA 3PTYA 2NP0A 2HWD1 1SLAA 1WW5A 1I9RA 2O1QA 1DIWA 3OJBA 5ABJA 1QQP2 1WLCA 1REDA 3RNSA 5JPMB 2ZHNA 2RR12 1VBE2 3KSCA 5KXEA 5C33A 3I8TA 2ZA9A 4FOWA 5KHHA 3SH3A 4Q1PA 4OULA 1SBFA 3GBFA 3NW4A 3ZFGC 4CP2A 1KXGA 4GXLA 1QJY2 1V00A 2XVGA 3AKQA 4CZSA 5BUVA 1C8NA 3IPVB 3M7AA 5E88A 1C28A 3U11A 1RUNA 1ZZ7A 4IETA 4JGYA 2HWB1 3AP7A 4MYEA 4OFGA 4M0HA 4IV1A 1UPIA 1RIRA 4XJWA 1QKQA 3CJIB 1OPOA 2ARBA 3PMSA 3V0AB 1WD3A 1AJKA 1FPN1 1QXJA 3AMQA 2IXKA 1DFQA 1PK6A 3L2HA 2NMOA 2BWAA 4FPCA 4HK8A 1PIV1 1PO21 5GZDA 4RGGA 2DCZA 3ZX7A 4ZKTB 1PNGA 5GLTA 1C5HA 3OGGA 5CB7A 1HRI2 1KDMA 4IESA 3RI9A 2UY9A 3CLPA 3USSA 4PDWB 1X7NA 1OA2A 4P9IA 5CFDB 1RUG1 3C3VA 1HQLA 2IWGB 2XHKA 2FQPA 2EXKA 1CAXB 1COV1 3LA7A 2E63A 4Y20B 4PF5A 5JIAA 4NPRA 4UXAA 3GZUC 3SMHA 5C8WA 1OQ1A 3DUIA 1UW8A 1EP0A 3WR0A 1CR7A 3VBOC 4A3XA 4JGZC 1AYM2 4RS5B 1S2KA 2BWCA 5L73A 3KB5A 3SNMA 2GNTA 4QQLA 1TQ5A 4OUMA 4Y24A 1KJLA 1PO11 2GC1A 4FPLA 2IFRA 4K3UA 2V5YA 1Y7BA 1YO8A 3VZNA 2GC0A 2PLV1 2K2SA 3VBFC 1R083 3M8LA 2OUJA 2VQAA 1AR63 4QU2A 3WX5A 4B7EA 3GF6A 4YGEA 1PHMA 1W39A 4RD7A 1KFUL 1LOCA 1OKQA 5ABJC 1LTEA 3TN92 3KZ4C 3CL1A 3ILFA 3JB4C 3MZHA 1BVP1 4R9BA 2BNNA 2I07B 4E2GA 1KITA 1DQ4A 2JG9B 4Q4Y1 3AMMA 4DZGA 5JSRA 1OOPC 1HXS1 4AEJA 1UCXA 3E6CC 4XOGA 2WL1A 4GWMA 4N53B 1RMU1 2WNVA 1XE8A 4YZ3A 3VDDC 5KXBA 1AR72 2GDFA 4C1XA 1WLTA 3LKJA 2OIIA 1YFYA 1LOGA 3LAGA 3WV6A 4FTBA 1MS8A 1TMF2 4TYSA 3H1YA 2P3KA 1IOAA 3SHRA 4D94A