2HEWF

The x-ray crystal structure of murine ox40l
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
128
structure length
128
Chain Sequence
PPIQRLRGAVTRCEDGQLFISSYKNEYQTMEVQNNSVVIKCDGLYIIYLKGSFFQEVKIDLHFREDHNPISIPMLNDGRRIVFTVVASLAFKDKVYLTVNAPDTLCEHLQINDGELIVVQLTPGYCAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytokine
molecule keywords Tumor necrosis factor ligand superfamily member 4
publication title The Crystal Structure of the Costimulatory OX40-OX40L Complex.
pubmed doi rcsb
source organism Mus musculus
total genus 28
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2006-06-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2hewF00
3B9IA 4E4SA 3B93A 4QQLA 3IT8A 2JG9A 4DB5A 1RJ8A 5KC5A 1I9RA 2WNVA 2WNUC 5CIRA 2AZ5A 4QQOA 4F3JA 4D7YA 1C3HA 1S55A 4J6GA 1U5YA 3B94A 2JG9C 2ZJCA 4TWTA 1D2QA 4KGGA 2TNFA 5KC6A 5L19A 2WNVC 2E7AA 1OQDA 3L9JT 4QQHA 2QDNA 1TNRA 2R6QA 4N90A 1PK6A 2Z5WA 4QPYA 4QQPA 2HEWF 2JG8A 5TSWA 2O0OA 3LKJA 2TUNA 4OUMA 4MXWB 3K48A 4G4FA 1RJ7A 3TWIA 4E4DX 1JH5A 1U5ZA 1PK6C 2RE9A 2HEYF 1WCKA 4NN0A 5BNQA 2JG8C 2WNUB 1U5XA 4OULA 2R30A 1TNFA 3QD6A 2KA3A 2R32A 4MXVA 3MI8A 4EN0A 1ALYA 1PK6B 1GR3A 1OSGA 2JG9B 1IQAA 2RJKA 2JG8B 4RSUA 3URFA 2RJLA 2WNVB 1DG6A 2QE3A 2ZPXA 1D4VB 4G3YC 4OUSA 4GIQA 3ME2A 4KGQA 2X29A 3TYJA 4QQ2A 1DU3D 5L36A 4TSVA 1D0GA 5KWRA 1C28A 3FC0A 3WD5A 4MXWA 1KD7A 4KG8A 2HEVF 4DOUA 2Q1MA 5HBAA 3V56A 1O91A 1XU1A 1XU2A 3QBQA 1A8MA 1OQEA 2WNUA 4HT1T 1KXGA 3AB0A 3K51A 2OIIA 2Q8OA 4MSVA 3ALQA 1JTZX
chains in the Genus database with same CATH superfamily
1VBC3 4E4SA 1NG0A 2YFUA 3WDWA 3OGVA 3KS7A 5EJZB 2JG9A 4PJYA 1APNA 2Y6FA 3JD72 5HXVA 2W9XA 4BHPA 4Y22B 2P2KA 1B35B 5CIRA 4QQOA 3MFAA 1JOPA 5LATA 1UKGA 1W6NA 3WY6A 2XHKA 1W2NA 3LA3A 1LOFC 1JYXA 1W3VA 4MG2A 3LGRA 4PHZA 1SFNA 3R4SA 2JDMA 5I8TA 1YFUA 4XFFA 2JB8A 4IE5A 4J1WA 4FPCA 3ZKUA 3GNEA 2ZMKA 1QJY1 3HQXA 3WP6A 5JOWA 3C7FA 5L19A 1LODA 1U5IA 2Y6KA 5JZGB 4Y5SA 3M8LA 3MIHA 3NV1A 3HNBM 4MX3A 2VUAA 1LOBA 3KD4A 1XOYA 3R6SA 2B45X 2D5FA 5L7OA 4LMFA 2R6QA 3EBRA 3NNMA 5FAXA 1W28A 3D0JA 2X09A 4C91A 2J22A 2Q8DA 4NO4A 2CDPA 1X9TA 2BVBA 3OGRA 1C8M1 4D3WA 2JE9A 2YBKA 1VBB3 1CQ9A 1W6MA 1CAUA 4GA9A 4ATFA 2I2SA 1AZDA 2BZDA 1QOTA 1R081 2LS6A 2RE9A 2ZHMA 4JRLA 5J7MA 2VCBA 4JHTA 4XF1A 1E5RA 1UZ0A 5FQ0A 2ZACA 4NHLA 5A32B 4XBQA 2BUKA 4AEDB 3AM2A 1U0AA 4NAMA 2R041 4UAPA 3ZR6A 2PHDA 2I07B 2RS51 4XJ8A 2YZ4A 5FPVA 3WV6A 5A3TA 5F3GA 4NRPA 3HWJA 1GWMA 2EIEA 5ABJB 2GSYA 4UYBA 4MHUA 1H2LA 1NXMA 1GOHA 1PVC2 2JG9B 2KR2A 4LNVA 2W39A 2RJKA 1NAEA 2WL1A 2JD4A 1SBDA 4EQVA 2XONA 4R9BA 5T54A 2CNAA 3MHZA 1W6NB 1RGSA 1US3A 2GNMA 1FATA 2ZPXA 5FPLA 3J9SA 3THCA 5I0RA 3VBHB 1RVF3 3PTRB 3WLUA 5HPOA 1Y9MA 1SG3A 1STMA 3OEAA 4QPIC 2QKDA 2BGCA 5GALA 4Q27A 3ME2A 4LO8A 3EXUA 3WNKA 1OPMA 4AGGA 5CVRA 5E8AA 1WGPA 3RYRA 2VL4A 4A41A 1IOAA 1QJX3 4W65A 3OSDA 1F2NA 2P3IA 2WWJA 1ND3C 1RUE1 4CUGA 3IB3A 3HJRA 3AC0A 3WD5A 5CFCC 4KG8A 5JSPA 2WAOA 3BPSA 5H9RA 1VRH3 5C70A 1OVSA 4XACA 4AF9A 3VZMA 3ZN4A 3CJXA 4YGCA 1UIJA 2Q1MA 1X82A 1WLWA 4GAZA 3RDIA 3ECQA 1WLDA 2DCZA 5A7QA 3RGBA 2YB7A 4CP2A 2OX0A 1NY72 4PF1A 3VBFB 4ORFA 3FMGA 5FK7A 4FQZA 1BK1A 2Y6JA 5AC91 1UY0A 1S0GA 5AFBA 1JYCA 5AVPA 2ZGKA 1C4RA 1N3QA 2BV4A 3WNLA 1UNBA 2B42B 1YI9A 3SLIA 1SLBA 3GHNA 2ZGSA 1I9RA 2YPDA 4ZU4A 2WNUC 4Q4V2 4FPYA 5I0DA 3AKRA 2JDPA 3ABZA 2VH9A 2ZX2A 5JVVA 2RS32 3T2TA 4BXFA 1CJPA 2ETEA 4QU1A 4IEVA 4CDQA 5AVAA 4YZ1A 1VMJA 4MVTA 2VUCA 1CPMA 2WFF2 3VD7A 2WFF3 4LBQD 4Q5OA 5BV6A 2VMHA 3HVDA 2QQPA 2RMU2 3CHXA 3HQRA 4UOJA 3P1IA 2RMU3 5K0UA 3U0ZA 1ULPA 1KS5A 1H8TA 3PUHA 1PO11 3A4UA 3VDDA 3ROUA 3A23A 2ET7A 4HVQA 5C4WB 3MZHA 2RJ2A 4QDRA 3VDCA 2JIGA 3GJBA 4YW2A 2CWMA 2HEWF 1V6OA 3FUOA 3RG0A 2D3RA 4UFLA 2FCVA 3J7MA 4RS5C 2J1EA 5FOBB 2D6MA 3UGHA 3MV11 4XE9A 3CEWA 5LA2A 4A45A 4URAA 1XNAA 1V9U3 3K75B 1A6CA 1V6JA 2QQKA 4M00A 1VBA2 1RB8G 3AMPA 5GZDA 3ZOIA 5BNOC 5FZEA 1VBA3 5J36A 1VBB1 3OPWA 4I3PA 4O65A 1CIWA 1V70A 3FWEA 4HSJA 5FMCA 5FP7A 1ULDA 2XB6C 1Z7S2 5LBCA 2FZ2A 1N3OA 3Q8AA 2VQAA 5FRAA 3AXEA 4OULA 1US2A 4HANA 1TNFA 2D3SA 1X33A 1W9FA 4B4RA 2QCSB 4JDNA 4BM8A 1AYN1 1NA1A 3O5SA 2Q8CA 5ANQA 3WNMA 5B4NA 3J4UH 1K5JA 3MI8A 3WF2A 4UF0A 1UY2A 1JYNA 3VBOA 1YIFA 3L2HA 4CDWA 2QQVA 3DYPA 2ZHNA 1VJ2A 5FPUA 4IV1C 1IQAA 2QQIA 3AKPA 1H2NA 4BOWA 2K2SA 1UF2C 1DQ1A 2EF6A 4WZFA 2EXHA 4H7MA 4XOGA 1UX7A 4CDQB 1RUH2 3F95A 3KT1A 3IWZA 3J26N 1Z0HA 1RUH3 4AQTA 1SBEA 1CX1A 2VZRA 4IV3B 4META 4CCCA 4KGQA 2XOMA 5FZLA 5KHKA 4HN0A 2Y34A 4ARYA 4CUCA 5K8SA 1UCXA 1POQA 2VTFA 3FN9A 5K0UB 1M06G 4IEOA 4AAPA 3CBNA 5CAZA 1H8TB 2D44A 2VVEA 2HWD1 4Y5Z0 3VDDB 2YPJA 3ZYIB 2CL2A 2QZ2A 4MH0E 1TME3 4V2VA 3B3QE 2VZVA 3PVOA 2Y8KA 4AGRA 1CONA 5FYYA 4YPJA 4BA6A 4CTEA 1H1IA 3USSA 1Z78A 1O91A 4W6YA 5LCWL 1SCSA 1RUI2 3KF5A 1RUI3 3GHMA 3QBQA 1HXS2 3C7GA 1HXS3 5FLIA 3E97A 2R071 5LEKA 1ULGA 5A3MA 3HPNA 1NQDA 4NMIA 4RN5A 1DQ2A 2WQ8A 1RUG3 1MZEA 1YC61 1SPPB 4YW3A 1DDLA 3A0NA 4XIOA 4B4PA 4L2NA 1MS1A 1JTZX 1XB9A 3ALQA 3DF0A 3TNQA 3AK0A 4QQLA 4B7KA 1LB2A 1XNCA 4DB5A 3OBRA 2BPA2 1ZYBA 2ZGMA 5JMCA 3SNMA 1DYPA 2P5BA 1G7YA 1NA1B 4XFGA 2PLV1 3TB0A 2FDFA 3NV2A 4GALA 3T2OA 4XVHA 4ZXEA 1W8WA 1AL21 1C3HA 1YQ6A 2YMZA 3LE0A 1LOAA 1S2KA 4Q4W2 3IM0A 3VBOB 4CDWB 1CIYA 5FK8A 2PAEA 3ZR5A 2R062 2GH2A 2E51A 1V6KA 4DXTA 3I2GA 3GGLA 4YFZA 5FY0A 3DPRA 1GU3A 4ZY9A 1QJU3 3RQ0A 3VV1A 4CCMA 3PL0A 1W8NA 3OUIA 4LEJA 4Q4Y2 2XVKA 3VDAA 4Q4Y3 2G9GA 3S6PA 4QPWA 1REDA 2D43A 1EAH2 3FL7A 3WW4A 5C3RA 2B8MA 1PO23 1ULCA 5ACA3 2JD9A 2X5IC 5J3UA 1V00A 2W47A 1G9CA 4MGTA 1UU6A 1MS5A 4MGSA 4XFAA 1S0JA 1O4YA 3HD8B 2IXHA 4HPKA 1U12A 3AMQA 2N7GA 5DUVA 5FZ7A 1JU3A 3MDPA 2V09A 1ZM1A 4FQ4A 2RR13 2VMDA 1RHI2 5FPZA 2Y64A 5C8WA 2GZWA 3VGIA 1UMZA 4CE8A 1WLTA 1QMJA 4XF0A 4YGBA 5BNPA 2VOKA 1GMMA 5FIXA 1JXNA 3RJ2X 3O0WA 2DUQA 1W2AX 2R49A 1W06A 1O8PA 3VKOA 4OUEA 5CNAA 2XLGA 5DDJ3 2VQ0A 3M3QA 5A33A 2WN3A 2Y6GA 3ZYRA 5HI0A 3O12A 4HKOA 4FOVA 5GKAC 4P14A 1A78A 1UXXX 3MPBA 4MXVA 4Q0PA 1BVVA 1UYYA 5LASA 1MVQA 1OH3A 2C1FA 1PGW1 5C8CB 2ZAHA 2KD7A 1RMU2 1RMU3 2P6CA 4BQ4A 1CAWA 1QNYA 4AXOA 4AI9A 1HRI2 5E1RA 2W92A 3K3OA 3MIBA 3D82A 1EP0A 4NOTA 4LHKA 1Q3EA 2JJ6A 3FLRA 1RUC2 2WZR2 1PHMA 2X29A 3KT4A 1AR72 1RUC3 1SFYA 2WZR3 3BOPA 1KDMA 3DCQA 3OGJA 4N43A 5T3NA 2ARCA 1TG7A 1V6IA 5FXWA 3SHRA 2BVVA 2V73A 2JB4A 1UKRA 3TNPB 1QWRA 3UT0A 1NKGA 4LXLA 1ZA4A 4C8DA 2VQTA 3O1MA 1PIV3 1LEMA 4ONUA 3I3BA 4X8NA 3H8UA 3T4VA 3VKFC 3WNOA 1MEC1 2Y6HA 2P3KA 4GMP0 5E16A 3TRSB 3WQ0A 5CEHA 5JZGC 2PQQA 1WUVA 4Q26A 4HPKB 1KRIA 1OLQA 4AFMA 3IMNA 4NRMA 2V4VA 1Y7BA 1LR5A 2XKPA 2WT2A 2HWF3 2ZGQA 4DEVA 5BNPB 2PHTA 2Q8OA 2QQJA 4K8FA 1PM7A 1ODNA 2AZ5A 3E1F1 4LJHA 5GZCA 1FOD2 2W68A 3OOXA 2G9ZA 4WM8A 5A33B 3SCFA 5FJKA 2F17A 2Q5TA 4E8CA 4JQRA 1AR92 3B69A 2CGNA 4W50A 2VE1A 1XNBA 3MIGA 4F8AA 1HV1A 3VZKA 3GYDA 1O6UA 3RZKA 4A7ZA 4Q0UA 4P9IA 3VBSA 1U5YA 2PHFA 3NJYA 2JG9C 1HLCA 1IS4A 2TNFA 3H0OA 3NKTA 5KC6A 3N9MA 4XUPA 4JC1A 2IVJA 3BVCA 4K1YA 3N36A 2ID4A 3HT2A 2DCYA 1K42A 5L9RA 4CU9A 3NMBA 1UY3A 4N90A 3UKNA 2IXLA 5JR7B 1Y4WA 1FV3A 1RITA 2HWB2 4N43B 1EV11 4UBGA 4XZUG 5CA6A 2HWB3 2FDHA 2BU9A 2D6KA 2H0VA 2JG8A 2WLQA 1O59A 2DFBA 5F32A 5FZ9A 2HWC3 1IKPA 5A1AA 5L7OC 2HLEA 3GZUC 5BY5A 3AFGA 3IAPA 1R093 4XMIA 1EUUA 1BEV3 4DFSA 2ZABA 3KF3A 5T5LA 4ZONA 3RNSA 3SC7X 3LFMA 2VW1A 4YVWA 4WVZA 4KQ7A 5D8AA 5A7WB 3MYXA 4L92A 5FTTC 4V2WA 2R32A 1BLZA 1QXJA 1W90A 3IIIA 1BYHA 1RUJ1 3N7JA 5FZ6A 5DDJ1 4BCUA 4UF0B 2VAUA 1VRBA 1H6YA 1GR3A 2WIIB 4MGKE 4QKFA 1GFF2 4B29A 1T6GC 3I49A 4WM8B 1LEDA 5IK7A 4LBKA 2IC1A 3ZSJA 1OMIA 3CZJA 2WLPA 1F5FA 3I2KA 3I3EA 5DAVA 5GJ6A 4OI1A 2Z79A 5EZWA 4I09A 2JICA 5J09A 4XJZA 3Q8CA 3ZXAC 4EJRA 1GZ9A 2ZA9A 1OOPA 3MGUA 3K3NA 3O14A 4HN1A 4S2DA 3T08A 3VBSB 3S0MA 3LOBA 2UWAA 1OPOA 3MF9A 3TYJA 1QF3A 2DUOA 3I2IA 1D4M1 1DU3D 1T6BX 1ZA7A 3LEMA 1YQCA 1DIWA 5HXMA 4YNIA 3RS6A 1SLLA 3ZYFA 4L8QA 5FREA 4QXHA 2WZ8A 2IXCA 4M01A 1NUKA 1S1AA 2V5YA 4OHVA 4C90A 4BQXA 4D6QA 3IDEA 2EIDA 2W1UA 5C5UA 1JYIA 4A7YA 3K46A 5FZ3A 1O8SA 2L9LA 4XEZA 5DQ0A 3JBG3 3VZJA 1YEWA 5F2SA 1OQEA 2UYAA 2W5FA 3KV9A 3N7LA 5FZCA 2XJVA 4QMAA 4WM7A 1GWLA 1JI6A 3K51A 2OIIA 1ND2A 1J3QA 3O1SA 1BMV2 1VBD2 2AEZA 2YDEA 1IS6A 4N7IA 1GP5A 1IG3A 4U36A 3SH3A 2OYZA 3T1LA 1KFUL 2BP6A 3LEGA 3RZLA 5IVFA 1PZ9A 4O61A 3N4MA 3ZN6A 2K0GA 4MGYE 2P4EA 2E7QA 2WBKA 1QQP1 5FZGA 2D6NA 3WQ1A 4N8MA 1BZWA 5D8AB 3RSJA 3PVNA 1W9WA 2XQXA 4W4ZA 4YM1A 5T52A 3H3UA 2WC2A 4FFHA 1PMHX 1I5ZA 1DZTA 1WCQA 3GZAA 3LPFA 2ADEA 4P9LA 5EYYA 2P37A 4DUVA 1ZZ8A 1LCLA 1ZZCA 4D8MA 4RHV1 1PGL1 1MACA 1TMF1 2VZ1A 4P00B 1YWKA 1BQPA 2XJTA 4LA2A 1OOPB 4QKNA 1KS4A 1H30A 4XMAA 5FYHA 4JQTA 4I0BA 2VOVA 4AE2A 4AVSA 2OKXA 4BQYA 4CDQC 1PK6A 3WNXA 5LWBA 4LT5A 3I8TA 5FKCA 2WR9A 1UN1A 5FY4A 3AKSA 2AENA 2GMEA 1FX5A 1JOJA 1KFXL 1ZBE3 4AWDA 1B09A 4RQPA 3CLPA 3K48A 5FZFA 4BWOA 4K3UA 3E6CC 5A6YA 2ZGRA 5K0UC 3TWIA 3ZIXA 4UFKA 1H8TC 1AL0G 3GF6A 3BOWA 2DVAA 4IGQA 3SQOA 3VDDC 4DPNA 5F9TA 1O3RA 4Z07A 4BU2A 2HEYF 1WCKA 3Q8FA 1PNGA 4CXXA 1QU0A 4XETA 4KMQA 3PIJA 4AW7A 1RUNA 2Q1ZB 5A3NA 4N53A 3ZYJB 2F4LA 3OGGA 5LRRA 1DLLA 5HCFA 4YZ5A 1ND2B 3WG2A 1EUTA 2QTWB 4QB2A 2Y38A 1JYTA 4EN9B 5C3PA 4XFHA 4LE3A 1AHSA 3ZN6B 4P9WA 4QXKA 5BPXA 5K9YA 3P3NA 5A7PA 4P5YA 2D97A 2WS91 2GU9A 4DRVA 3ACIA 1N1VA 1BVP1 3MBWA 3V0BA 1K3IA 5JI7A 1G6NA 3PDQA 3BTAA 5EXOA 3N9NA 1NA1C 2C9AA 1SLCA 1OBNA 4NR1A 1MS0A 1ZBA1 2A7AA 2PFWA 4BIOA 4KBZA 3VBOC 4IXLA 4EWEA 4CDWC 4BB3A 2YU1A 5F6LB 1MZ5A 2EIGA 3A0KA 4HSLA 1C8M2 1P8JA 1ONAA 2CGOA 5GM0A 5KWRA 1XJAA 1B35A 4MOAA 3FC0A 5D2AA 2WNOA 5FXXA 2J1TA 1GNHA 5DUWA 1KGYA 3RI9A 5JR2A 4JRAA 3SKVA 1HRV1 1DYKA 2WAAA 3ITQA 4GB31 3AXDA 4QWNA 4ASLA 2MHFA 1UU5A 1JU4A 3KM5A 1G8WA 1GP6A 4DRRA 1AYM2 3VZNA 1RUF2 4GKYA 4CU6A 1AYM3 1SZBA 2RG4A 2VG9A 1RUF3 2J42A 4RQPB 5DAXA 5F3IA 2VMGA 5GZEA 1J84A 1YFYA 2GAUA 2RS52 4Y4RA 1S4CA 1R1A3 3RFRA 4FPHA 2ILMA 4AHYA 3ES4A 2A6YA 1D0HA 5IJRA 3U4SA 4IW3A 5B2GB 1W2UA 4JTOA 2QBXA 1AXKA 5L7OB 3THDA 3FX3A 3KT7A 4CYDA 4XIKA 4A3XA 1KQRA 4YG3A 1F9KA 3BTXA 2ZBJA 1UL9A 3K2OA 3TEWA 4EZ4A 4BQ2A 2QVSB 3CNAA 1UYZA 4JHZA 4WVWA 3J8F3 2ZOEB 2VNGA 1UIKA 1MZFA 1WMDA 2YGMA 3AYEA 3VZOA 5JWPA 1CAXB 3ATGA 1UXZA 1WMFA 4H3WA 5EHDA 3VL8A 2ZJCA 1RUE2 2EALA 5FUPA 5LBBA 5A32A 3V0BB 4NPRA 2WYFA 4AEDA 1FPN2 2E33A 2BEOA 3NVCA 3RPQA 4GULA 5CZKA 5AFEA 3ON7A 3T0BA 5CG8A 5C3QA 2YUEA 2Q30A 5A1LA 5F37A 1QIQA 4AHZA 3M70A 4XBLA 3JB8A 1XYOA 5M0TA 1TE1B 2EA7A 1UWWA 3JD73 3DPRC 4QKBA 5F5QA 5TSWA 4YZ4A 4A44A 1SACA 4MHRA 1GOGA 3PUIA 2XQRA 4Q4X2 1MS3A 5AC92 4YZ2A 4Q4X3 2QFEA 4XC9A 3HAGA 4IEYA 5FY5A 3T3YA 3FE5A 4YYOA 3OY8A 3VBHA 4QGNA 1U5ZA 3H3LA 4F83A 4KU7A 1OH4A 2R7EB 3CMGA 4HZFA 3KMHA 1W04A 4Y1ZA 5FZHA 1MS4A 2XVGA 2ES3A 1QGLA 3ZPOA 4XUQA 3WEZA 3CF6E 3SXWA 5CB7A 2OT7A 3AL5A 5C3SA 5KXCA 4LQRA 5F2WA 4YZ3A 4AVTA 4NPLA 4LTAA 4CRQA 4EN6B 5BNPC 3GBWA 1ENXA 3MW3A 5F1RA 1WBLA 4O9EA 3I2DA 2GNDA 2O14A 4LOSA 4JDOA 2UY9A 1RXGA 3CIHA 4C1XA 3WZ1A 1UPSA 3G6JB 4W6WA 2LUWA 3I3DA 3VBFA 4RFT0 4G3YC 4JKLA 3USUA 1QH7A 2XUMA 2LROA 1QJZA 2A3XA 3KCCA 4CSWA 5FY8A 1S0BA 4BDVB 1AR62 1SMVA 1AR63 2XBO1 4QX1A 1ZRIA 4E9KA 5I93A 4COZA 5FXZA 1H8VA 1W8HA 4BJ0A 2G19A 1ASJ2 4OI2A 1PGSA 1J1TA 1OT5A 1POV3 1ASJ3 2JDHA 2JX9A 3SCHA 1VE0A 1W9TA 4JKMA 1PVC3 3OPTA 1A34A 4N43C 3OYWA 1R1ZA 4LE4A 2NP0A 1GNZA 1BKZA 5A70A 4QB1A 1AYN2 2QNKA 2VBPA 2XGXA 4DNYA 3OY8B 3GDBA 1VPHA 4FOQA 1VR3A 2JDYA 2VM9A 3LDKA 3R05A 2RM22 4FXGB 5C3OA 1JBCA 5C4WA 2RM23 1S2BA 1Q8OA 4KWKA 5CU1A 1YXWA 2ORXA 1XC6A 2PAKA 3N7MA 1W3XA 3H50A 3IT8A 5FZOB 2ZGOA 4INDA 1NYWA 3Q9OA 4FPKA 3LWCA 4NAOA 4NUBA 1OFSA 3T4HB 3JU9A 5FZKA 5C7GA 1RUD1 1VBE1 2NQYA 1T2XA 4Q1PA 1G86A 4YVSA 4Y1VA 3TAYA 3WCSA 4U2AA 4WVMA 2EVXA 2ZEZA 4K1ZA 1UW8A 2A3YA 2I74A 1XYPA 3HMYA 2Z42A 3VHPA 4DY5A 1KITA 5CFDA 2VW2A 2J1VA 4WM8C 3OD0A 3E5UA 2OS2A 1JS9A 3ZFEA 2VQUA 2IXKA 4UI9L 3USUB 5JXHA 4L9BA 3ZXFA 1IS3A 1W6QA 1I6XA 5FZBA 3GJAA 4FFFA 3LDRA 5FP3A 3VBUB 1GZWB 1F4HA 4QXCA 2TEPA 1FT9A 1UU4A 2D93A 4QQPA 2F6BA 3VBSC 4O9GA 3WNNA 3UK9A 1DBNA 1NE6A 2R072 1DZRA 1VBC1 1YYNA 2Z69A 5DZGA 1GQGA 3JB4C 4FCAA 4Q4V3 2UU8A 5FWEA 4TTGA 4KWUA 2RS33 3OF1A 3UNPA 3ZVXA 2JDAA 4GQ7A 1HB4A 1NCRA 4XUTA 4TXWA 2R0FA 3KV5A 4IV3A 1IPSA 2OUJA 2HYXA 4OQ9A 2X8KA 2MEV2 2DWRA 3KSCA 3LDBA 3OYWB 1XE8A 3TOJA 2MEV3 2JG8C 2OW4A 3OPZA 3WX5A 5CYYA 1DGLA 4FPEA 2WFPA 1IHMA 1AL22 3DN7A 4B7EA 4JDMA 3C7EA 3QH6A 3JXSA 3FZ3A 1COV2 2YU2A 3I54A 4EN0A 4BIFA 2OUHA 3LA2A 4JGZA 4NIHA 4BQ5A 1AR82 2W46A 5IFPA 3H8XA 2XJSA 3VHRA 3BN6A 2BNNA 4XXPA 4R4ZA 3PMEA 1UOJA 1OF3A 2W91A 4GKXA 4YVSB 5FBZA 5KXBA 2DU0A 4D6RA 4YVWC 1RUOA 5D8AC 4WVMB 3BTZA 4UWDA 5LRSA 5FZ4A 1SPPA 2WABA 3D8CA 4DQAA 2W1QA 5LK7B 5CFDB 1V6MA 1Z7S3 1L7LA 3NRUA 4ZZ5A 1NOVA 4S2HA 3VKMA 1SFPA 3I3QA 3ZFEB 4LUKA 4EV0A 2ZEXA 4ZKTB 5FO9B 1W6QB 3IAQA 3UJQA 2PHLA 4Y1XA 3VKLA 3HR9A 3PJQA 4HVRA 1SEFA 3OTFA 4DY3A 4A4AA 1HN0A 5HV4A 4AG4A 1ODMA 1Y3TA 1E57A 1D2SA 3ACFA 3RRDA 4KG0A 2CU5A 1IQDC 2WN2A 5EWSA 4AQ2A 1A8MA 2GC3A 1JZ8A 4IERA 1XNDA 1XPWA 2BGPA 1O5LA 5LB6A 1NCRB 3ILFA 1GSLA 4L97A 3UV9A 1PGW2 2DDUA 2KM2A 2FDIA 5FZIA 3WQBA 1RVF1 1ZVFA 4IE7A 4OMCA 4EWDA 5C9AC 2E26A 2FHRA 3B93A 1ULOA 3IMMA 5FUIA 2PMWB 1WZXA 2GNBA 4Z92B 2A5ZA 4EWAA 2WNVA 2CYFA 4V1PA 4UXAA 5LW9A 1EPWA 1QJX1 3QLQA 2R1BA 4WM7C 2ZX0A 1DP0A 1OD3A 4JGZB 4UW3A 5A1FA 3OG2A 3O1UA 1HB1A 2W52A 2EAAA 4HL0A 3N9QA 1A3KA 3UKTA 3J7HA 4EN8B 1VRH1 5IAXA 2PA7A 1AX1A 5FZDA 5FOJB 3EMRA 4G9SB 1D2QA 3WF0A 2D3PA 3O1RA 2PHWA 2C6SA 4QHZA 3POGA 5JCTA 3V0AB 1J83A 1J1LA 1DQ6A 3H42B 3RYPA 3S7EA 2WZEA 4AEJA 4XILA 2PAMA 1LTEA 2JXAA 4M3CE 2ZHKA 1O4TA 1WW7A 1QHDA 4YLZA 4YW6A 5C8CA 3VBRB 4YM2A 2W0XA 1GYKA 4BMBA 3ZFGA 2IFRA 1GLHA 3AZXA 2XHNA 3GCXA 2WZPP 2GC0A 3NQHA 3KQ4B 4Q4W3 1JH5A 2Q8EA 1DHKB 1TQ5A 3AP5A 4DXZA 5J1XA 2DBNA 1PK6C 2A1XA 3H3ZA 4GH4A 4Y1YA 2R063 1LHUA 5D1IA 5A80A 5GLZA 4RL7A 5DUXA 5G04L 2FDKA 1MS9A 3QACA 3AP9A 5IT6A 4RQPC 5LBFA 3RZHA 1YUDA 4LIUA 1X36A 1EAH3 2WFF1 2HH9A 2BDRA 2JIJA 2BW8A 4CDUB 5FCCA 2A6ZA 2LRPA 2RMU1 1BBT2 3PTYA 4LHLA 1ALYA 1UOFA 1BBT3 3POFA 1GNYA 3HQUA 5DN2A 4I0WB 2EICA 2DBIA 2ZAAA 2XJUA 3CU7A 3POWA 1X9PA 4AR2A 2CTVA 2ZZQA 2WT0A 5CKQA 2WNVB 3ORJA 4R9DA 2J1UA 1BHGA 2Y60A 1UAIA 5IVVA 2J1AA 4N53C 3RZGA 1RHI3 2WYSA 1V0AA 1VMFA 2CHHA 3TN92 4ZS3A 3TN93 2BRTA 1WA4A 3LZZA 4UFIA 3U07A 4D69A 2XXZA 5A6QA 1VLNA 1V9U1 2VOTA 1VB2A 2DURA 4AQ6A 3B7MA 3P6BA 3WW1A 2VOXA 1VBA1 3PLQA 3BALA 4QU2A 3WNPA 3WP4A 1PMIA 1WW4A 3IKWA 4Q0SA 3UKVA 1XSRA 2VVDA 4S2FA 4ZXKA 1O4ZA 1GOFA 5FY1A 1FNZA 2AGSA 2RVAA 1OA2A 2Y0IA 3S7IA 3ZDVA 4B1MA 5FWJA 1E5IA 2BERA 2BWCA 3J7LA 2ZX4A 1NE4A 2QQOA 2XPJA 5JXGA 4HK8A 3AP6A 5FDBA 2VZ3A 1OQ1A 1YRZA 4FPGA 3ZFGB 1NZCA 3BIWE 5FPAA 2W1WA 3WXPA 3CO2A 2Y0OA 4W6XA 3SEPA 4E2QA 1HRI3 1W39A 1B35C 1TEIA 3GCWA 4QHOA 3BCWA 5FZMA 5JXIA 4GH4B 4M0NA 1EYBA 1LHWA 2B5HA 2ZXQA 4XPVA 3EB7A 1JHNA 1GICA 1AR73 2QZ3A 4M3CA 5A7OA 1RUH1 4AFCA 2RHPA 4EE2A 5FR3A 4BXSV 3HBZA 1CR7A 2VD7A 4JZRA 3T09A 4C0BA 2C24A 2ZGTA 4OMDA 4UW5A 4AEKA 4XDQA 1IS5A 1W8TA 2A6WA 1BJQA 1W99A 4IQPA 2BFUL 4COVA 2WO1A 1FI2A 5K7PA 3NKGA 1QJFA 3DUIA 4H14A 2ZKNA 3U75A 1IPKA 3NJXA 2W2IA 4Y3OA 4QX7A 4Q2FA 3S5QA 2DF7A 2O8OA 3LFIA 1TME1 2B7YA 4AFDA 1AXZA 4LIVA 5BNNA 3BUCA 4AQSA 2C0ZA 4IEXA 3U10A 3V65A 4TWTA 2IFWA 4E8DA 3AMNA 2VZTA 4FP2A 2WA3A 3FHQA 3MLLA 1RUI1 1BXHA 5A7WA 5IK5A 1CJDA 1HXS1 4OHXA 5JOYA 4XURA 4LLFA 2XJQA 4QPYA 1FOD3 1ZZ9A 1EPZA 1RUG1 3JQXA 1GZCA 2JDKA 3MUZ1 4P9JA 2V5DA 2GMPA 4M0HA 4XFBA 4XTPA 5L73A 3UYJA 4AZZA 2BOIA 2VXRA 4LHSA 2BOJA 4OI4A 4X6QB 5ERLA 4AEDC 1AR93 4DIQA 1FMD2 2WO3A 3ZLIA 4LKDA 1FMD3 1ND3A 4ES8A 1IZ3A 1NCQA 3MFCA 4R4XA 4XDOA 3SH5A 3H9AA 5ABJC 2C26A 3WUDA 3POIA 4AI3A 2PHRA 1DYOA 1GV9A 3DKWA 1QQP2 5JSRA 5JPNB 3C7OA 4OQ8A 1QNWA 1J58A 2EIBA 3M4FA 5FBJA 1YLLA 2NM1A 2D6OX 1JUIA 1U5XA 3RJRA 3T30A 4DO0A 4DMIA 1PNFA 1QJU1 2XJRA 1NQJA 3VBHC 4PQ9A 3KQRA 4Q4Y1 3BKZA 2CSGA 1UY1A 1W6PA 4M3CB 5FYBA 3ZXJA 5LA0A 1OD5A 2Z4FA 1SDWA 3NSTA 4RHV2 4XCBA 1F15A 4ASMB 2FD8A 1SQ4A 2XJPA 1PO21 5ACA1 2WSVA 1AJOA 4HK9A 5F3EA 2EXKA 5IWFA 5DUUA 2PYTA 4XHBA 5L9BA 2GH8A 3MF6A 3H1WA 3JCIA 5C5TA 5KHHA 2A75A 1A8DA 3IBMA 5FZ0A 3OBAA 4PQQA 5H9QA 3K77A 2RR11 5BNNB 2YC2A 4QX3A 1V6NA 2H6CA 4PIXA 4QQ2A 3WG1A 4LITA 2DUPA 4A6OA 3M3IA 1CN1A 4XF9A 3OUHA 4QT6A 5JDBA 1W8ZA 3VBFC 2RS12 4XDPA 2RS13 5FMOL 2GDFA 3ZPYA 2GC2A 3MO4A 2QQWA 4QPIB 3U4XA 1OUSA 2NPIA 4X8PA 1E5HA 2G4IA 1RYYA 2QDRA 1MQTA 2XG3A 4CEWA 3BYWA 4HKLA 2JE7A 4CDXA 4NHXA 2YYOA 1ND3B 3LF7A 4FFGA 5CFCB 1RMU1 1NCQB 2ZEWA 2K9ZA 4Z82A 1BCXA 1OVPA 2VR4A 1W0NA 2AREA 2WJSA 1N1SA 3N9OA 3OJBA 4M3CF 3AX4A 3FHIB 5JI9A 1HRI1 5LBEA 4MLOA 3HOBA 3B9IA 4FTSA 2WO2A 5DZFA 2UYBA 4CPBA 2GN3A 1H0BA 3AYAA 3DYMA 1RUC1 2WZR1 5FUNA 3MW4A 3NNLA 3DXTA 3ZYBA 1LHNA 4RR3A 1GQPA 1VP6A 1W8UA 1AX2A 1ZBA2 4QDQA 5A7SA 4AVCA 1W6PB 2ZX1A 4F3JA 1G9BA 1HKDA 5C4WC 1PIV1 3FFQA 1Q8QA 2YBSA 4J6GA 3VL9A 5J48A 1W2OA 4UFHA 3SKJE 1G9FA 2QQNA 3EO6A 4BLJA 3PVBB 2XUEA 3KLSA 2MPFA 5FZ8A 2B4KA 1YIPA 4NHMA 1WCUA 4CU7A 5JOZA 3ILRA 4YVSC 3W9AA 5LEJA 1UQXA 1VBD3 2XLAA 1L3JA 2HWF1 2Z5WA 2YFZA 4IETA 4JV4A 5E6HA 4ISRA 1MS8A 4BMEA 1PX4A 2BGOA 5CFDC 1M4WA 4P9XA 2OZ6A 2W87A 4Y4YA 5FO8B 3SH4A 3U1XA 1JMUB 3J7NA 4K21A 2UY8A 5DZEA 5FJHA 1OI6A 2UWBA 2HWE2 2B9VA 1JOBA 5EPAA 4BPZA 2HWE3 2V4AA 2DTWA 1MQTB 1Q8PA 4XJUA 4UBHA 4CEWB 3EYPA 5FYZA 4CCKA 4XAAA 4CDXB 1CZSA 4IGPA 1OC1A 1CPNA 4NIGA 1QDCA 4A3ZA 4KWJA 2ZS6B 1W6OB 1W8FA 2ARXA 2KA3A 4AL9A 1QH6A 3D3AA 1IG0A 1DF0A 1CVNA 1LHVA 5FY9A 3W20A 3WF4A 5I91A 3O1OA 4WBBA 2VXJA 1G9AA 1NCRC 1TVGA 3NNJA 4IV3C 3E5QA 4JKKA 5IYYA 4QPGA 2ZGNA 1EY2A 1DGWX 4CP9A 4D7SA 2FZ1A 4ZZ8A 4RR3B 2HWB1 4IEQA 5GLUA 4DUWA 4BQWA 1HQWA 2HYKA 2MNGA 5A3UA 2JEMA 4FP3A 3PVEA 2FDJA 3LEIA 4PDWA 2QUOA 1REEA 3WUCA 4GD4A 5IVJA 3ACGA 4OI0A 1NX9A 3O7OA 4RGAA 4JGZC 1CZTA 2JDUA 1ZZ6A 2HWC1 2DVBA 2JKBA 2VPVA 1C5HA 2W3JA 3H1MA 3NAPA 4IV1B 4Z1VA 3SMHA 5BUVA 4OZXA 4AI2A 1CZVA 5EJ1B 2B39A 3ACHA 1XNTA 2E6VA 2JWPA 1R091 3N35A 5GLTA 3WT3A 3VUOA 1H9WA 3O1PA 1BEV1 2BQPA 2X10A 3N7KA 1ACCA 2EXJA 2E32A 4IEUA 1QJY2 1JZ4A 1QJY3 2DVGA 4NIDA 4LBMA 4Z8BA 1JZ6A 1CAXA 3PHMA 2E53A 1DZQA 1PZ8A 2JKXA 2PXJA 3EQEA 3FLPA 5J98B 2RDQA 1KXGA 1H6XA 4IL7A 4JGYA 5APAA 3LAGA 4NROA 3UGGA 5DG1A 4YGDA 3VKNA 3I7DA 4XJWA 1C8M3 1REFA 3GBFA 3K4DA 1RJ8A 4PI2A 3B5LB 4OVEA 3ZM8A 1AJKA 4BQ3A 2XWBB 2LM3A 1R082 1C5IA 1R083 1UZWA 1UYPA 4QB6A 5F5IA 2E9QA 3ZN5A 4P08A 4TYSA 4OZOA 4QPGB 2ATFA 5EJ3A 2WWSA 2Q0AA 4Q1RA 4CP9B 4CP1A 3IIAA 2R042 2R043 2GP5A 2RS53 1HJFA 4XTMA 4CU8A 4PDWB 3THPA 2WNVC 1H2MA 3D5OA 3L9JT 3JBG1 3ZSKA 3ZYHA 5C71A 1W03A 2AACA 3NNFA 3OEBA 4OYUA 4TLGA 4SLIA 1TNRA 3NAPB 4MADA 5SV5A 4FPLA 1VMHA 1K5MA 4LBJA 1UOBA 5EV7A 4EROA 2UWCA 1BMV1 4YWAA 1OF4A 1LECA 1W9YA 3BPZA 3ZXGA 1K12A 3R4UA 2V72A 1QJEA 4E4DX 4LA3A 3NL1A 1JHJA 1MVEA 4AVAA 1HB2A 2VBDA 3OUJA 2VULA 3A7QA 4JX0A 5DAWA 1DFQA 1Y43B 5B4XA 5C8CC 4PIYA 1RUE3 1LOGA 3AYDA 1LHOA 4CVUA 1FPN3 5D21A 1H4GA 3ZFGC 1RUD2 1VBE2 1UMIA 1XSQA 2DYCA 4TN7A 4JGYB 4BK4A 3TBDA 4ITCA 3W21A 2JDNA 1F5JA 3O1VA 5K4LA 1Q5OA 4QKDA 4XUOA 4MGIE 4GH4C 4P02B 4DS0A 4HXCA 4WVVA 4AI1A 5L9VA 2VCAA 5IVBA 1LKNA 2YXSA 2VMFA 2WQZC 3PUQA 4CCOA 3HN1A 3JZVA 2DV9A 5AC93 1FNYA 1ZBE1 1K45A 5IVCA 3ETPA 2DVDA 3KVAA 2GMMA 5T5PA 1ZRCA 2XDVA 4LBQA 4YW7A 5FLJA 3T1MA 4YW4A 5KBFA 4H2AA 2DU1A 3C7HA 1WMXA 4XQDA 1OA4A 1VBC2 3B9CA 5FZOA 4BZ4A 3LSDA 4NRQA 4Y24A 2JENA 5L36A 5FYTA 1JW6A 3HIFA 4QAWA 4DINB 5J37A 4UFJA 2UURA 3SEEA 4XZPA 2FDGA 4S2GA 3GBGA 5JIAA 2OA2A 1LGBA 5T5JA 1XE7A 4AI8A 3PU8A 1N1TA 4CUBA 4XQWA 5F3CA 1SDDB 5JIUA 1K5MB 3A21A 3CDZB 4Y33A 1F31A 5HBAA 3IPVB 4XFIA 3QCWA 4DXRA 3M7AA 2ADDA 3M2MA 1WWYA 4D0QA 2Z2SB 2DCTA 2DFCA 4I02A 1GBGA 2FQPA 3N9PA 4CCJA 1HQNA 1PO12 3PIGA 5CKNA 1PO13 3K4AA 3HNYM 2EXIA 1Q43A 2YC4A 2AYHA 5IUQA 4JCKA 3WDXA 1JN2P 3KV6A 1W8OA 3AB0A 3ACLA 4I3GA 4XJ9A 1PM4A 3UL2A 4GWMA 3VBUA 1GZWA 3AZZA 4XYXA 2P3YA 2OPWA 5KHJA 2VZPA 1ULFA 3WR0A 2H0BA 2VMEA 4LLOA 3WSOA 2A71A 5LA9A 1NT0A 5H9PA 1X50A 1VBB2 3UJOA 3RZMA 4CXYA 3B00A 3NWKA 2VZQA 4LKFA 2ZMNA 5FYSA 4BQ1A 3AMMA 1PMJX 1SCRA 1GKBA 3WP3A 4IE4A 1LENA 4XBNA 4LULA 3M3OA 1AYN3 4KGGA 1QXRA 4AEMA 4K20A 3BTYA 1AYM1 4AI0A 2VGDA 1RUF1 4LBQB 4MZUA 4QX2A 3FJSA 1R1A1 1OURA 2JE8A 4Y1UA 4IEZA 2WO7A 3WW3A 4RYDA 1AXYA 1UPIA 5A6XA 2VZOA 2P34A 1MZ6A 1VAMA 2ZGLA 5CG9A 5BNNC 4NWWA 4HBNA 2WKKA 4GWIA 4HG6B 1DCSA 4YGEA 3I2OA 4M4RA 4N7UA 5A3OA 1JZ5A 1CX4A 1JYVA 3LCPA 4KNCA 3MV01 3RI8A 1RVF2 4LOTA 4ES9A 4B1LA 1H1AA 1QOOA 2E7TA 3AYCA 1DLCA 1OLME 3M1HA 2ZZJA 3E5XA 3JQWA 3LOIA 3MIFA 3RZJA 1O3QA 4NIAA 2YBPA 1W0OA 2HWD2 2VUDA 3J8F1 2HWD3 1UY4A 1QJX2 2R30A 1WD3A 5EYXA 1DQ4A 3QD6A 5DXDA 4KU8A 5FO7B 3ZX7A 1HX6A 3LB9A 3K4ZA 4YG0A 1W9SA 3L2YA 1NCQC 1FPN1 3T2QA 4Z2AA 1E5SA 1VRH2 3FHAA 4D6SA 2TBVA 3GXUA 2BYVE 4FVVA 1D7PM 4B3NA 3WVJA 2R073 4OFGA 4E2GA 3TEYA 4CP0A 2Y33A 3D0SA 5CKMA 2PTMA 4MUVA 3JD71 3FBYA 1D4VB 1W6MB 5IAVA 1CAUB 1V6LA 4FTEA 4NVPA 4NE9A 3VD3A 1YJLA 4CEYA 1UX6A 3HN3A 4Q4X1 4J1XA 1BK0A 3LIGA 3T0DA 3AKQA 2PLV2 5FQ0B 3KV4A 2PLV3 2QQLA 4PCRA 1C1LA 1VIWB 4IGOA 1UZVA 2PHXA 1AL23 5FP8A 5FFOC 3CL1A 4ZHNA 2XVLA 4RGGA 2X05A 1COV3 3LPGA 4QX0A 2P17A 3DECA 4LUMA 3SITA 2B46X 1AR83 2A6VA 4AVVA 2RDNA 1C57A 3MIEA 1ENQA 5LY1A 1S0FA 1XU1A 3POYA 2DCKA 4LR4A 1QEXA 1XE0A 3BB6A 2ARBA 2LALA 1I5PA 3IDBB 4PBPA 3WF3A 3DKQA 4BISA 1Y9QA 2AH2A 4EYUA 3V0AA 1JZ3A 2FCTA 4KI5M 1GUIA 1GZTA 3BI3A 5FZAA 5A6ZA 3DV8A 1MQTC 1ZX5A 4Y20A 3VBRA 2HBTA 4CEWC 2GALA 2BNMA 4J25A 1AR61 2LTNA 4CDXC 4B4QA 3GALA 2FMYA 4FSJA 1OOPC 2B9UA 3PNAA 4R9CA 1V9U2 5I0UA 1FXZA 1SLTA 1S0DA 4RD7A 4HVOA 2YY1A 3WINE 1S0EA 3S5AA 2VC9A 5G05L 1POV1 1OLMA 1ASJ1 1ENSA 3B94A 5F39A 4Y26A 4W8JA 4CCDA 3QH7A 1WLCA 2IUWA 4LO6B 2BWAA 1PVC1 2VECA 1CD3G 4HFSA 4IESA 1LOEA 5HCHA 4RR3C 1GQHA 2P6HA 4FI9A 4CEYB 4GMP3 4CDUA 4H55A 2QDNA 4YW5A 3ZXLA 3FFZA 4A42A 2DVFA 5BXXA 2BBAA 2C9KA 3WW2A 1QY4A 4FXKB 4BK5A 1ULEA 2RM21 2VNOA 2OXBA 3Q8EA 4B8EA 1YI7A 2D40A 3OD4A 4DZGA 3IZOA 2E31A 3O0VA 4LO4B 3I4IA 4K6BA 4G4FA 4Y5TA 1QOSA 4IUGA 1RJ7A 2D6PA 5IFTA 1ND2C 3NJVA 1UYXA 1H2KA 3H8OA 1POV0 5A3LA 4FBFA 2IZWA 1DQ5A 2OPKA 3AJYA 3RZZA 4D94A 3NV4A 2FMDA 5FLHA 2K46A 2RV9A 2PQSA 3GM8A 1W2TA 3POBA 1WCSA 4NN0A 4YFWA 3DGTA 4FT8A 5ANNA 1X8EA 5IVEA 1MEC2 2BNOA 1OXCA 4JTNA 3O1TA 1MEC3 2AR6A 1OLRA 4NWVA 4QX8A 4ZU7A 3NW4A 4YG6A 1NY71 2W1SA 1FYUA 5I8YA 1TME2 5F8PA 2JDZA 1ENRA 3MLJA 1W0PA 3ZFFA 1CGPA 4Y20B 5FYIA 3ZDSA 4CXWA 4LBOA 2GNTA 2RJLA 2OQ7A 2ZX3A 3INAA 3VN4A 4FAGA 5CADA 1Q8SA 2ZMLA 1Q56A 2IVIB 1RIRA 4MYEA 1H9PA 4AOCA 4MGZE 3CJIA 1HJGA 1JUHA 1RUG2 2A6XA 1RINA 4OUSA 2SBAA 4Q4V1 2RS31 4AHWA 4GIQA 3F2ZA 4ASKA 3U78A 4QPGC 1YJKA 4YM3A 1Q8VA 2WSUA 3UGFA 4GJYA 1HQLA 1G9DA 4TSVA 4BH9A 1DQ0A 1DGWA 3OB8A 4CCLA 3KVBA 2MEV1 2Y26A 3P5BA 1URXA 4PDWC 3ZXEA 3AL6A 1IPJA 2R16A 4OHWA 4ZS2A 3ZYPA 4MO3M 3NAPC 3GZEA 4LKSA 1S0CA 1MR5A 3W58A 1HW5A 1COV1 3H1YA 5A7NA 1RTVA 2IXIA 3APBA 4A6SA 1OA3A 1QJU2 1AR81 2D98A 2XL7A 1KDKA 1VALA 2E63A 2WNEA 4YRDA 1O5UA 4E2SA 1LNSA 1EV12 2VMCA 4FTBA 3PMSA 4ARXA 2A3WA 5DPNA 1EV13 1LOFA 1CESA 1OFNA 1XNKA 3E6DA 3NV3A 3RMYA 2RDSA 3ELNA 2ZGPA 4XAEA 5IATA 1PO22 3NNGA 5ACA2 3AP7A 2BFUS 3WDUA 4DEQA 1AX0A 3R0RA 4KBBA 4C1WA 2NLRA 1Z7S1 3S30A 1UZYA 2EAKA 1NLRA 5EIYB 3KCXA 3N3HA 2XL9A 1YFXA 4M4PA 1WMEA 3AZWA 3PU3A 2RR12 1AUYA 2NZ9A 4YM0A 5FV3A 2BBVA 4JGYC 1SHWB 1ZNPA 1ZRRA 3ZFFB 5A3PA 5LZ6A 5E88A 3BODA 1XYNA 2XMLA 2CAUA 2CY6A 3BGAA 3LSEA 4AGVA 4R9AA 3UESA 1J3PA 5H9SA 5CBLA 3ILNA 5FYMA 5JUVA 1RUJ2 2YGLA 5E89A 5DDJ2 1RUJ3 1WD4A 2WT1A 1OQDA 1RL3A 2Q1FA 3CJIB 3H7YA 4L99A 4YARA 2IWGB 5FYUA 2CAVA 3C8XA 3KHBA 3ES1A 2HKXA 3IN9A 2NYYA 3U37A 4GMP1 1IKQA 2YV8A 2H6BA 5A3WA 2OVUA 1L7RA 5FMDA 5JMOA 5JPMB 4TZDA 3ZMOA 4K8RB 5EP9A 3LIHA 4Q29A 2ARAA 1NZIA 2XKOA 4PT6A 2XWJB 3AP4A 2NN8A 3VZLA 4TLFA 2D5HA 3KCYA 1AVBA 1D4M2 3MICA 1D4M3 2Y6LA 5FKBA 2VCMA 5LY2A 3TEZA 4QM9A 4FOYA 3ST7A 3X29B 1K5MC 5F7UA 4KL1A 1NLQA 2DCJA 4D7TA 3VD4A 3DPRB 5SV8A 2G1MA 4X6RB 2ZKLA 2WRAA 4LPLA 4XXAA 3D6EA 3S57A 4LK7A 1H4HA 3M3CA 3CQOA 4RGKA 5CISA 2DTYA 2VCCA 1LRHA 1PIV2 4AYUA 1WW5A 1YQ2A 1JZ7A 4QPIA 3PURA 3W5MA 1ZRDA 1DGRA 4XW3A 4C0HA 2F4PA 3PUAA 4FPFA 3ETQA 4QGLA 3URFA 4N9HA 4OLLA 1N1YA 3FUQA 1HDKA 4GWNA 1HN1A 3WCRA 1X7NA 2QE3A 2QJVA 5CFCA 4IEPA 4P9GA 4CA9A 2HWF2 3ZYGA 1KJRA 4OHYA 2SLIA 1CAVA 4Q4W1 1YO8A 3VHOA 3RMXA 1QQP3 1R64A 2XLFA 2P1BA 1KEXA 5FMBA 1FAYA 3N9LA 2R061 5FMOS 4XHXA 3WDYA 4AFBA 2YG0A 4CCNA 4Q8KA 2AC1A 4NIIA 1LU2A 1C28A 2VOWA 3LA7A 3WG3A 1VAVA 1F4AA 1KD7A 4K7JA 4WZCA 1VAKA 2NMNA 4XJAA 3ZSLA 4ZPIA 3HT1A 4UT5A 3NO8A 1LGCA 2PN5A 1EAH1 4DOUA 1NXD1 1PGL2 3OBTA 4YSFA 3AJZA 3I59A 1TMF2 4JAAA 4RHV3 4EZHA 5GLVA 4OHZA 2IXJA 1TMF3 3SCGA 1BBT1 1YNAA 1KJLA 1XU2A 2C5DA 2ZCWA 1CAWB 1YQ8A 1YQ5A 5FYCA 2G9FA 2VUJA 2WNUA 4MV2A 4IEWA 1LGNA 5J96B 3WDTA 1ZRFA 4Q8LA 2CWSA 2ZHLA 4NHYA 5I8SA 4DXSA 1RHI1 3CZUA 3KWVA 4ATEA 3TN91 4I01A 2WDBA 5DMYA 1L7QA 1UOGA 2J1SA 3OCPA 1PX3A 1S2EA 4CCEA 2QQMA 4XQ4A 2A73B 2O1QA 1S0IA 3MEPA 3DEMA 1JYWA 2W95A 3VDBA 1O3TA 4HMZA 4D7YA 4IE0A 4I2OA 1CWPA 1GWKA 3DXUA 2HWC2 1NLSA 1UMHA 4URTA 4PLNA 1QKQA 3OBZA 3VBUC 2J7MA 4AAXA 2D6LX 2ZTNA 1JODA 4HETA 1OUXA 1R092 1HB3A 3O0XA 4I30A 4RS5A 4QX5A 1BEV2 4XFCA 2XR4A 1W6OA 3UETA 5HV0A 4Q0VA 4BLIA 1YCIA 2E7AA 4QQHA 4ZU5A 3THTA 1XQNA 1CAVB 3POEA 5BNOA 2WS92 4LKEA 1VB4A 2XH6A 2WS93 2ZEYA 3B01A 3KB5A 4AK3A 3AKTA 3D4KA 5JSOA 1LESA 2VVFA 1AR71 4GZ9A 2O0OA 3LEKA 3LKJA 2TUNA 3PUSA 4OUMA 5KHIA 5JLVA 3POJA 2D7FA 1ZBA3 3C2UA 5IK4A 1Y9GA 3EHKA 4K9SA 5I0SA 3WHUA 5DAQA 1HV0A 3I59B 2FCUA 3WOGA 3AZVA 2ORZA 2NMOA 3KHCA 2CV6A 4IV1A 4QD2A 3SISA 1DGRN 4YW1A 5FXVA 3MW2A 2WNUB 3EJKA 4QHBA 3AVRA 3W59A 4AVBA 1HRV2 4GB32 3ZXDA 2VY0A 1HRV3 4NHKA 2VW0A 4GB33 3T2PA 1OHFA 3DL3A 1J3RA 1H1MA 4P9YA 4AHXA 2O8QA 4O7XA 2JECA 4XABA 1AF9A 3BU0A 1XRUA 4FPJA 4KWLA 2Q4SA 2JG8B 5C9AA 3ZKYA 1F8VA 4QXBA 1FOD1 2VJXA 5DABA 3ZFEC 3JBG2 3KZ4C 3FLTA 3PJYA 2X53S 4ET7A 1FV2A 3R4DB 5JOXA 1SBFA 2AUYA 5LA1A 3I97A 1UO9A 1AR91 3ASIA 3JUUA 4N9IA 4XUNA 1PZ7A 2VTXA 1ST8A 3C3VA 1FMD1 3MPPG 3POSA 2QQUA 4RS5B 4PLOA 4KH9A 3BIEA 5FP4A 2YC0A 2ZGUA 4WV8A 4A7KA 5T50A 1D0GA 4HKWA 2W94A 3AMHA 5DG2A 3VHNA 1C8NA 4YVWB 2PHUA 4MXWA 1GANA 4OCTA 5BNOB 4L0PA 2KXLA 1LOCA 3RWKX 2HBUA 3E6BA 4CUAA 2J1RA 4CEYC 3ZSEA 1IGOA 2HJIA 4FAHA 3V56A 1WBFA 2OZJA 4COYA 3AZYA 2A70A 3GZTB 2GC1A 4GWJA 5F5AA 3AFKA 3U14A 3ZSMA 4P5HA 4LORA 2R0HA 2ENRA 5EFUA 4LK6A 3ZMNA 1XBFA 3VLBB 4LBLA 4DUXA 3KGLA 2OQ6A 2VTXJ 2YROA 4Z2WA 1O7FA 5KXEA 5I0TA 5T55A 3I3MA 4E4ZA 2GP3A 2VMIA 4MSVA 5C33A 3TEXA 1UD1A 3MUY1 5FPBA 3WDVA 5KHGA 4JVAA 2PELA 4A2UA 2VNVA 4XF4A 5KC5A 1ZBE2 2I45A 5T5OA 5HCAA 2W08A 4UW6A 5FP9A 5IHRA 4RA0A 4HOOA 4XF3A 3WF1A 2CDOA 3QOPA 5IK8A 3NJZA 3AVSA 3G7DA 3ZO0B 3W5NA 1S55A 4UFMA 5FY7A 1LU1A 1XXNA 4HLTA 2RS11 2ET1A 2X5IA 5DAPA 5FYVA 4R8HA 1MPXA 3KGZA 4LBNA 4NPMA 5C9AB 1LJ7A 3VBRC 1OKQA 4SBVA 3ZXKA 5GZGA 5LK5A 4FO9A 1ZZBA 3LQCA 4ISQA 2FBEA 3H8RA 4WM7B 3RYKA 4AFAA 4PI0A 2RDRA 5BYNA 2WA4A 1C1FA 4FOWA 3U11A 3WQ7A 4BYYA 3ZIWA 2P3JA 4K40A 4PIZA 5KXDA 1JZ2A 3OGSA 3M3EA 4COWA 4IE6A 4UW4A 5IVYA 3MLKA 5JAXA 4QM8A 1LULA 2VZUA 3H7JA 4MXWB 3T0AA 4E4HA 4F7ZA 2VO5A 4Q0QA 4CDUC 2BTVC 2C4XA 1WCDJ 3HBKA 2XBO2 4GJZA 2VBBA 3WP5A 2XBO3 1I3HA 2LW8A 4CZSA 3BU7A 4HONA 1J59A 2VU9A 2YHJA 1WW6A 1PVXA 3WG4A 5BNQA 3FBMA 1RC6A 4E27A 4XCAA 4PLMA 3VB9A 5FPXA 1I1EA 4Y22A 4R52A 5F5CA 4CPBD 3IDAA 1PK6B 3VD5A 1OSGA 3IPVA 2AEYA 4QGMA 4RFRB 5ISLA 1VBD1 5GLWA 4LO5B 4RSUA 1SLAA 3B02A 1TZOA 4I0AA 1DG6A 5IW0A 3RWNA 3IDCB 1ZZ7A 4PF5A 1F35A 1R1A2 4H7LA 3I2HA 1SLIA 2WUHA 2WWUA 3ENRA 1QDOA 3HNMA 3WHTA 2X5IB 3P3PA 4MGQA 5JZGA 3HEIA 4IDZA 4QDSA 1LAJA 4COUA 2VZSA 3ZFFC 4PBOA 2CGPA 1O3SA 4LHNA 4NJ4A 2HWE1 2BJSA 4FFIA 1N3PA 4FPOB 4EN7B 1RUD3 1VBE3 2R1DA 1RXFA 1WKYA 3I2FA 5FZ1A 4N53B 2WINB 5KR7A 3DYOA 1QXPA 1W05A 4BE3A 2HEVF 5C6CA 3CJIC 1N47A 1OKOA 3RVHA 5F6KA 2ERFA 2WQ4A 3A22A 1HIXA 1GP4A 3J8F2 3MIDA 3VD9A 1ZREA 1WA6X 2GN7A 3V64A 1X8MA 1YFWA 3CKHA 2VNRA 5EQUA 5JXJA 1YHFA 3Q8BA 4HT1T 4GXLA 3I2JA 1UZZA 5GZFA 5HCBA 3LD8A 4L11A 5ABJA 4LO7A
chains in the Genus database with same CATH topology
1VBC3 4E4SA 1NG0A 3WDWA 3VL9A 3KS7A 2JG9A 4PJYA 1APNA 3JD72 5HXVA 4BHPA 4Y22B 2P2KA 1B35B 5CIRA 4QQOA 3MFAA 1UKGA 1W6NA 3WY6A 2XHKA 3LA3A 1LOFC 3LGRA 1SFNA 3R4SA 5I8TA 1YFUA 4XFFA 4J1WA 4FPCA 3GNEA 2ZMKA 1QJY1 3HQXA 3WP6A 5JOWA 5L19A 1LODA 1U5IA 5JZGB 3M8LA 3MIHA 3NV1A 3R6SA 4MX3A 2VUAA 1LOBA 3KD4A 5L7OA 2B45X 2D5FA 2R6QA 3EBRA 5FAXA 3D0JA 4C91A 4NO4A 2BVBA 1C8M1 4D3WA 2JE9A 1VBB3 1CQ9A 1W6MA 1CAUA 4GA9A 4ATFA 2I2SA 1AZDA 1QOTA 1R081 2RE9A 2ZHMA 4JRLA 5J7MA 4XF1A 5FQ0A 2ZACA 4NHLA 5A32B 4XBQA 2BUKA 4AEDB 3AM2A 1U0AA 2R041 2PHDA 2I07B 2RS51 4XJ8A 2YZ4A 3WV6A 3HWJA 5ABJB 2GSYA 1H2LA 1NXMA 1PVC2 2JG9B 4LNVA 2W39A 2RJKA 2WL1A 2JD4A 1SBDA 4R9BA 5T54A 2CNAA 1W6NB 1RGSA 2ZPXA 2GNMA 1FATA 5I0RA 3J9SA 3VBHB 1RVF3 3WLUA 4QPIC 2QKDA 2BGCA 5GALA 4Q27A 3ME2A 4LO8A 3EXUA 1OPMA 4AGGA 5CVRA 5E8AA 1WGPA 3RYRA 1IOAA 1QJX3 4W65A 1F2NA 2P3IA 1ND3C 1RUE1 5JSPA 3WD5A 5CFCC 5KXEA 4KG8A 5H9RA 1VRH3 4AF9A 3VZMA 3ZN4A 3CJXA 4YGCA 1UIJA 2Q1MA 1X82A 1WLWA 3RDIA 3ECQA 1WLDA 2DCZA 4CP2A 1NY72 3VBFB 4ORFA 3FMGA 4FQZA 1BK1A 5AC91 1S0GA 5AFBA 1JYCA 5AVPA 2ZGKA 1C4RA 1N3QA 2B42B 1YI9A 3SLIA 1SLBA 3GHNA 2ZGSA 1I9RA 4ZU4A 2WNUC 4Q4V2 4FPYA 3AKRA 5JVVA 3T2TA 2VH9A 2ZX2A 2RS32 1CJPA 2ETEA 4IEVA 4CDQA 5AVAA 4YZ1A 4MVTA 1CPMA 2WFF2 2WFF3 4LBQD 5BV6A 2VMHA 2QQPA 2RMU2 2RMU3 5K0UA 3U0ZA 1KS5A 1H8TA 1PO11 3A4UA 3VDDA 3ROUA 4HVQA 2ET7A 5C4WB 3MZHA 4YW2A 2CWMA 2HEWF 1V6OA 3FUOA 3RG0A 2D3RA 4RS5C 5FOBB 2D6MA 4XE9A 3CEWA 1V9U3 1A6CA 1V6JA 4M00A 1VBA2 1RB8G 3AMPA 5BNOC 1VBA3 5J36A 1VBB1 4I3PA 1CIWA 1V70A 3FWEA 4HSJA 2FZ2A 1ULDA 2XB6C 1Z7S2 1N3OA 5FRAA 2VQAA 3AXEA 4OULA 4HANA 1TNFA 2D3SA 1X33A 4B4RA 2QCSB 4JDNA 4BM8A 1AYN1 1NA1A 3O5SA 3J4UH 3MI8A 3VBOA 1YIFA 3L2HA 4CDWA 2ZHNA 1VJ2A 4IV1C 1IQAA 3AKPA 1H2NA 4BOWA 2K2SA 1UF2C 1DQ1A 2EF6A 4WZFA 2EXHA 4H7MA 4XOGA 4CDQB 1RUH2 3KT1A 3IWZA 3J26N 1Z0HA 1RUH3 4AQTA 1SBEA 4META 4IV3B 4KGQA 5KHKA 4HN0A 5K8SA 1UCXA 1M06G 5K0UB 4IEOA 5CAZA 1H8TB 2D44A 2VVEA 2HWD1 4Y5Z0 3VDDB 2YPJA 3ZYIB 2CL2A 2QZ2A 4MH0E 1TME3 3B3QE 3PVOA 4AGRA 1CONA 4BA6A 4CTEA 1H1IA 3USSA 1Z78A 1O91A 4W6YA 1SCSA 1RUI2 1RUI3 3GHMA 3QBQA 1HXS2 1HXS3 5FLIA 3E97A 2R071 5LEKA 1ULGA 5A3MA 1NQDA 1DQ2A 4YW3A 1RUG3 1MZEA 1DDLA 3A0NA 4XIOA 4B4PA 4L2NA 1MS1A 1JTZX 3ALQA 3DF0A 3TNQA 3AK0A 4QQLA 4B7KA 1LB2A 1XNCA 4DB5A 3OBRA 2BPA2 1ZYBA 2ZGMA 5JMCA 3SNMA 1DYPA 3TB0A 1G7YA 1NA1B 4XFGA 2PLV1 3NV2A 4GALA 2YMZA 1AL21 1C3HA 4Q4W2 3VBOB 1LOAA 1S2KA 4CDWB 3IM0A 2PAEA 2R062 2GH2A 2E51A 1V6KA 4YFZA 3DPRA 1QJU3 3RQ0A 3VV1A 4LEJA 4Q4Y2 2XVKA 4Q4Y3 2G9GA 3S6PA 1REDA 2D43A 1EAH2 3WW4A 2B8MA 1PO23 1ULCA 5ACA3 5J3UA 2X5IC 1V00A 1G9CA 1UU6A 1MS5A 4XFAA 1S0JA 1O4YA 3HD8B 2IXHA 4HPKA 1U12A 3AMQA 2N7GA 5DUVA 3MDPA 2V09A 1ZM1A 4FQ4A 2RR13 1RHI2 5FPZA 5C8WA 2GZWA 3VGIA 1UMZA 1WLTA 1QMJA 4XF0A 4YGBA 5BNPA 2VOKA 1JXNA 3RJ2X 3O0WA 2DUQA 2R49A 3VKOA 5CNAA 2XLGA 5DDJ3 2VQ0A 3M3QA 5A33A 3ZYRA 5HI0A 3O12A 4HKOA 4FOVA 5GKAC 4P14A 1A78A 3MPBA 4MXVA 4Q0PA 1BVVA 1MVQA 2C1FA 1PGW1 5C8CB 2ZAHA 1RMU2 1RMU3 1CAWA 1QNYA 4AXOA 1HRI2 5E1RA 3MIBA 3D82A 1EP0A 4NOTA 4LHKA 1Q3EA 2JJ6A 3FLRA 1RUC2 2WZR2 1PHMA 2X29A 3KT4A 1AR72 1RUC3 1SFYA 2WZR3 3BOPA 1KDMA 3OGJA 4N43A 5T3NA 1V6IA 3SHRA 2BVVA 2V73A 1UKRA 3TNPB 1QWRA 1ZA4A 1PIV3 1LEMA 4ONUA 4X8NA 3VKFC 3H8UA 1MEC1 4GMP0 2P3KA 5E16A 3WQ0A 3TRSB 5JZGC 2PQQA 1WUVA 4Q26A 4HPKB 1KRIA 1OLQA 4AFMA 3IMNA 1Y7BA 1LR5A 2XKPA 2WT2A 2HWF3 2ZGQA 5BNPB 2PHTA 2Q8OA 4K8FA 1PM7A 2AZ5A 5GZCA 1FOD2 2W68A 4WM8A 5A33B 3SCFA 2Q5TA 4JQRA 1AR92 3B69A 2CGNA 1XNBA 3MIGA 4F8AA 1HV1A 3VZKA 3GYDA 4A7ZA 4Q0UA 4P9IA 3VBSA 1U5YA 2PHFA 2JG9C 1HLCA 1IS4A 2TNFA 3H0OA 3NKTA 5KC6A 4JC1A 4K1YA 3N36A 3HT2A 2DCYA 4N90A 3UKNA 2IXLA 5JR7B 1FV3A 1RITA 2HWB2 4N43B 1EV11 4UBGA 5CA6A 2HWB3 2D6KA 2H0VA 2JG8A 2WLQA 2DFBA 2HWC3 1IKPA 5L7OC 3GZUC 3AFGA 1R093 4XMIA 1BEV3 4DFSA 2ZABA 5T5LA 3RNSA 2VW1A 4YVWA 4WVZA 4KQ7A 5D8AA 3MYXA 4L92A 5FTTC 2R32A 1QXJA 4BYYA 4BCUA 1BYHA 1RUJ1 3N7JA 5DDJ1 2WIIB 4B29A 1GR3A 4MGKE 1GFF2 1T6GC 4WM8B 1LEDA 5IK7A 4LBKA 2IC1A 3ZSJA 1OMIA 2WLPA 1F5FA 5GJ6A 4OI1A 2Z79A 5EZWA 4I09A 2JICA 5J09A 4XJZA 3ZXAC 4EJRA 1GZ9A 2ZA9A 1OOPA 3MGUA 3O14A 4HN1A 4S2DA 3VBSB 3S0MA 3LOBA 2UWAA 1OPOA 3MF9A 3TYJA 1QF3A 2DUOA 1D4M1 1DU3D 1DIWA 4YNIA 3RS6A 1SLLA 4L8QA 5FREA 2IXCA 4M01A 1S1AA 2V5YA 4OHVA 4C90A 3IDEA 1JYIA 4A7YA 4XEZA 3JBG3 3VZJA 1OQEA 2UYAA 3N7LA 2XJVA 4QMAA 4WM7A 3K51A 2OIIA 1ND2A 1J3QA 1BMV2 1VBD2 2YDEA 4N7IA 1IS6A 4U36A 3SH3A 3T1LA 2OYZA 1KFUL 3N4MA 1PZ9A 3ZN6A 2K0GA 4MGYE 2E7QA 1QQP1 2D6NA 3WQ1A 1BZWA 5D8AB 3RSJA 3PVNA 4YM1A 5T52A 3H3UA 2WC2A 3GZAA 1I5ZA 1DZTA 4P9LA 5EYYA 2P37A 1ZZ8A 1LCLA 1ZZCA 4RHV1 1PGL1 1MACA 1TMF1 1YWKA 1BQPA 2XJTA 4LA2A 1OOPB 1KS4A 1H30A 4XMAA 4I0BA 2VOVA 4AE2A 4AVSA 4CDQC 1PK6A 3WNXA 4LT5A 3I8TA 1UN1A 3AKSA 2AENA 1FX5A 1JOJA 1KFXL 1ZBE3 2GMEA 4AWDA 1B09A 4RQPA 3CLPA 3K48A 4BWOA 4K3UA 3E6CC 5K0UC 2ZGRA 3TWIA 3ZIXA 1H8TC 1AL0G 3GF6A 3BOWA 2DVAA 3VDDC 4DPNA 5F9TA 1O3RA 4Z07A 2HEYF 1WCKA 1PNGA 1QU0A 4XETA 4AW7A 1RUNA 2Q1ZB 4N53A 3ZYJB 3OGGA 4YZ5A 5LRRA 1DLLA 5HCFA 1ND2B 3WG2A 2Y38A 4EN9B 4XFHA 4LE3A 1AHSA 3ZN6B 4P9WA 4QXKA 5BPXA 5K9YA 3P3NA 2D97A 2WS91 2GU9A 4DRVA 1N1VA 1BVP1 3V0BA 5JI7A 1G6NA 5EXOA 3BTAA 1NA1C 2C9AA 1SLCA 4NR1A 1MS0A 1ZBA1 2A7AA 2PFWA 4BIOA 3VBOC 4IXLA 4EWEA 4CDWC 5F6LB 1MZ5A 2EIGA 3A0KA 4HSLA 1C8M2 1ONAA 2CGOA 5GM0A 5KWRA 1B35A 3FC0A 1GNHA 5DUWA 3RI9A 4JRAA 1HRV1 1DYKA 4GB31 3AXDA 4ASLA 2MHFA 1UU5A 3KM5A 1G8WA 4DRRA 1AYM2 3VZNA 1RUF2 4GKYA 1AYM3 2VG9A 1RUF3 4RQPB 2VMGA 5GZEA 2RS52 1YFYA 2GAUA 1R1A3 4FPHA 2ILMA 4AHYA 3ES4A 2A6YA 1D0HA 5B2GB 1W2UA 4JTOA 1AXKA 3FX3A 3KT7A 4CYDA 4XIKA 4A3XA 1KQRA 4YG3A 1F9KA 2ZBJA 1UL9A 2QVSB 3CNAA 4WVWA 3J8F3 2ZOEB 2VNGA 1UIKA 1MZFA 1WMDA 2YGMA 3AYEA 3VZOA 5JWPA 1CAXB 3ATGA 1WMFA 4H3WA 3VL8A 3V0BB 2ZJCA 1RUE2 2EALA 5A32A 4NPRA 4AEDA 1FPN2 2BEOA 3NVCA 3RPQA 4GULA 5AFEA 5CG8A 2YUEA 2Q30A 4AHZA 3M70A 4XBLA 3JB8A 1XYOA 1TE1B 2EA7A 3JD73 3DPRC 5F5QA 5TSWA 4YZ4A 1SACA 4Q4X2 1MS3A 5AC92 4YZ2A 4Q4X3 2QFEA 3HAGA 4IEYA 3VBHA 3FE5A 4YYOA 3OY8A 4QGNA 1U5ZA 4F83A 4KU7A 4HZFA 3KMHA 4Y1ZA 1MS4A 2XVGA 2ES3A 1QGLA 3CF6E 3SXWA 5CB7A 4YZ3A 4AVTA 4LTAA 4CRQA 4EN6B 5BNPC 3GBWA 1ENXA 3MW3A 5F1RA 1WBLA 4O9EA 3I2DA 2GNDA 4JDOA 2UY9A 4C1XA 3WZ1A 1UPSA 3G6JB 4W6WA 2LUWA 3VBFA 4RFT0 4G3YC 3USUA 1QH7A 2XUMA 1QJZA 2A3XA 3KCCA 1AR62 1S0BA 1SMVA 1AR63 2XBO1 4E9KA 5I93A 4COZA 1H8VA 1ASJ2 4OI2A 1PGSA 1J1TA 1POV3 2JX9A 1ASJ3 3SCHA 1PVC3 4N43C 3OYWA 1R1ZA 4LE4A 2NP0A 1GNZA 1BKZA 1AYN2 2QNKA 2XGXA 4DNYA 3OY8B 4FOQA 1VR3A 3R05A 4FXGB 2RM22 1JBCA 5C4WA 2RM23 1S2BA 1Q8OA 4KWKA 5CU1A 1YXWA 2PAKA 3N7MA 3H50A 3IT8A 2ZGOA 4INDA 1NYWA 3Q9OA 4FPKA 3LWCA 1OFSA 3JU9A 1RUD1 1VBE1 2NQYA 4Q1PA 4YVSA 1G86A 4Y1VA 3TAYA 3WCSA 4U2AA 4WVMA 2EVXA 4K1ZA 1UW8A 2A3YA 2I74A 1XYPA 3HMYA 2Z42A 3VHPA 4DY5A 1KITA 5CFDA 2VW2A 4WM8C 3OD0A 3E5UA 3ZFEA 2IXKA 3USUB 4L9BA 3ZXFA 1IS3A 1W6QA 1I6XA 3VBUB 1GZWB 2TEPA 1FT9A 1UU4A 2D93A 4QQPA 2F6BA 3VBSC 4O9GA 3UK9A 1DBNA 1NE6A 2R072 1DZRA 1VBC1 1YYNA 2Z69A 5DZGA 1GQGA 3JB4C 4FCAA 4Q4V3 2UU8A 2RS33 3OF1A 3ZVXA 4GQ7A 1NCRA 2R0FA 4IV3A 2OUJA 2X8KA 2MEV2 2DWRA 3KSCA 3OYWB 1XE8A 3TOJA 2MEV3 2JG8C 2OW4A 3OPZA 3WX5A 1DGLA 4FPEA 2WFPA 1IHMA 1AL22 3DN7A 4B7EA 4JDMA 3QH6A 3FZ3A 1COV2 3I54A 4EN0A 4BIFA 2OUHA 3LA2A 4JGZA 1AR82 2XJSA 3VHRA 2BNNA 4XXPA 4R4ZA 3PMEA 4GKXA 4YVSB 5FBZA 5KXBA 2DU0A 1RUOA 4YVWC 5D8AC 4WVMB 5LRSA 3D8CA 4DQAA 5LK7B 5CFDB 1V6MA 1Z7S3 1NOVA 4S2HA 3VKMA 3ZFEB 4LUKA 4EV0A 4ZKTB 5FO9B 1W6QB 3UJQA 2PHLA 4Y1XA 3VKLA 3HR9A 3PJQA 4HVRA 1SEFA 3OTFA 4DY3A 4AG4A 1Y3TA 1E57A 1D2SA 3RRDA 4KG0A 5EWSA 4AQ2A 1A8MA 2GC3A 4IERA 1XNDA 1O5LA 1NCRB 3ILFA 1GSLA 4L97A 3UV9A 1PGW2 2KM2A 1RVF1 1ZVFA 4EWDA 5C9AC 2FHRA 3B93A 2GNBA 4Z92B 2A5ZA 4EWAA 2WNVA 2CYFA 4V1PA 4UXAA 1EPWA 1QJX1 3QLQA 2R1BA 4WM7C 2ZX0A 4JGZB 4UW3A 2W52A 2EAAA 4HL0A 1A3KA 3UKTA 4EN8B 1VRH1 2PA7A 1AX1A 5FOJB 4G9SB 1D2QA 2D3PA 2PHWA 5JCTA 3V0AB 1J1LA 1DQ6A 3S7EA 3RYPA 4AEJA 4XILA 2PAMA 1LTEA 2JXAA 4M3CE 2ZHKA 1O4TA 1WW7A 1QHDA 4YLZA 5C8CA 3VBRB 4YM2A 2W0XA 1GYKA 4BMBA 3ZFGA 2IFRA 1GLHA 3AZXA 2WZPP 2GC0A 4Q4W3 1JH5A 1DHKB 1TQ5A 3AP5A 4DXZA 1PK6C 4Y1YA 3H3ZA 4GH4A 5D1IA 2R063 1LHUA 5GLZA 4RL7A 5DUXA 1MS9A 3QACA 3AP9A 5IT6A 4RQPC 1YUDA 1X36A 1EAH3 2WFF1 4CDUB 2BW8A 5FCCA 2A6ZA 2RMU1 1BBT2 3PTYA 4LHLA 1ALYA 1BBT3 4I0WB 2ZAAA 3CU7A 2XJUA 3POWA 2CTVA 2ZZQA 2WT0A 2WNVB 4R9DA 1UAIA 4N53C 1RHI3 3TN92 3TN93 1WA4A 3LZZA 3U07A 4D69A 1VLNA 1V9U1 1VB2A 2DURA 4AQ6A 3B7MA 3WW1A 2VOXA 1VBA1 3PLQA 3BALA 4QU2A 3WP4A 1PMIA 1WW4A 3IKWA 4Q0SA 3UKVA 2VVDA 4S2FA 4ZXKA 1O4ZA 1FNZA 2AGSA 1OA2A 2Y0IA 3S7IA 2BWCA 2ZX4A 1NE4A 2XPJA 4HK8A 3AP6A 5FDBA 1OQ1A 1YRZA 4FPGA 3ZFGB 1NZCA 3BIWE 3WXPA 3CO2A 2Y0OA 4W6XA 4E2QA 1HRI3 1W39A 1B35C 1TEIA 3BCWA 4GH4B 4M0NA 1EYBA 1LHWA 2B5HA 4XPVA 1JHNA 1GICA 1AR73 2QZ3A 4M3CA 1RUH1 4AFCA 2RHPA 3HBZA 1CR7A 4C0BA 2ZGTA 4UW5A 4AEKA 4XDQA 1IS5A 2A6WA 4IQPA 1BJQA 4COVA 2BFUL 1FI2A 5K7PA 3NKGA 3DUIA 4H14A 2ZKNA 1IPKA 4Q2FA 2DF7A 2O8OA 1TME1 2B7YA 4AFDA 1AXZA 5BNNA 4AQSA 2C0ZA 4IEXA 3U10A 3V65A 4TWTA 2IFWA 3AMNA 4FP2A 2WA3A 3MLLA 1RUI1 1BXHA 5IK5A 1CJDA 1HXS1 4OHXA 5JOYA 4LLFA 2XJQA 4QPYA 1FOD3 1ZZ9A 1EPZA 1RUG1 3JQXA 1GZCA 4P9JA 2GMPA 4M0HA 4XFBA 4XTPA 5L73A 2VXRA 4OI4A 4X6QB 4AEDC 1AR93 1FMD2 1FMD3 1ND3A 4ES8A 1IZ3A 1NCQA 3MFCA 4R4XA 3SH5A 3H9AA 5ABJC 3WUDA 4AI3A 2PHRA 1GV9A 3DKWA 1QQP2 5JSRA 5JPNB 1QNWA 1J58A 3M4FA 1YLLA 2NM1A 2D6OX 1JUIA 1U5XA 3RJRA 4DMIA 1PNFA 1QJU1 2XJRA 1NQJA 3VBHC 4PQ9A 3KQRA 4Q4Y1 1W6PA 4M3CB 3ZXJA 1OD5A 1SDWA 3NSTA 4RHV2 4ASMB 1SQ4A 2XJPA 1PO21 5ACA1 2WSVA 1AJOA 4HK9A 2EXKA 5DUUA 2PYTA 4XHBA 2GH8A 3MF6A 3H1WA 3JCIA 5KHHA 2A75A 1A8DA 3IBMA 5H9QA 2RR11 5BNNB 1V6NA 2H6CA 4PIXA 4QQ2A 3WG1A 2DUPA 3M3IA 1CN1A 4XF9A 4QT6A 5JDBA 3VBFC 2RS12 2RS13 5FMOL 2GDFA 3ZPYA 2GC2A 4QPIB 3U4XA 4X8PA 2NPIA 2G4IA 2QDRA 1MQTA 2XG3A 4CEWA 4HKLA 2JE7A 4CDXA 2YYOA 1ND3B 5CFCB 1RMU1 1NCQB 2K9ZA 4Z82A 1BCXA 2WJSA 4M3CF 2AREA 3OJBA 1N1SA 3AX4A 3FHIB 5JI9A 1HRI1 4MLOA 3B9IA 4FTSA 5DZFA 2UYBA 2GN3A 1H0BA 3AYAA 1RUC1 2WZR1 3MW4A 1LHNA 4RR3A 1VP6A 1AX2A 1ZBA2 4F3JA 4AVCA 1W6PB 2ZX1A 1G9BA 1HKDA 5C4WC 1PIV1 3FFQA 1Q8QA 4J6GA 5J48A 1G9FA 3EO6A 4BLJA 3PVBB 3KLSA 2MPFA 1YIPA 4NHMA 5JOZA 3ILRA 4YVSC 3W9AA 5LEJA 1VBD3 2XLAA 1L3JA 2HWF1 2Z5WA 4IETA 4JV4A 4ISRA 1MS8A 4BMEA 5CFDC 1M4WA 4P9XA 2OZ6A 4Y4YA 5FO8B 3SH4A 4K21A 2UY8A 5DZEA 1OI6A 2UWBA 2HWE2 4BPZA 2HWE3 2DTWA 1MQTB 1Q8PA 4XJUA 4UBHA 4CEWB 4CDXB 1CPNA 1QDCA 4KWJA 2ZS6B 1W6OB 2ARXA 2KA3A 1QH6A 1DF0A 1LHVA 1CVNA 5I91A 4WBBA 1G9AA 1NCRC 4IV3C 3E5QA 4QPGA 2ZGNA 1EY2A 1DGWX 4D7SA 2FZ1A 4RR3B 2HWB1 4IEQA 5GLUA 5BY5A 1HQWA 2HYKA 2MNGA 2JEMA 4FP3A 3PVEA 4PDWA 2QUOA 1REEA 3WUCA 4OI0A 3O7OA 4RGAA 4JGZC 2JKBA 2VPVA 1ZZ6A 2HWC1 2DVBA 3NAPA 3H1MA 1C5HA 4N7UA 4IV1B 4Z1VA 3SMHA 5BUVA 4OZXA 4AI2A 2B39A 2E6VA 3N35A 3WT3A 1R091 5GLTA 3VUOA 1H9WA 1BEV1 2BQPA 3N7KA 2EXJA 4IEUA 1QJY2 1QJY3 2DVGA 4LBMA 4Z8BA 1CAXA 3PHMA 2E53A 1DZQA 1PZ8A 3EQEA 3FLPA 5J98B 1KXGA 4JGYA 4IL7A 3LAGA 5DG1A 4YGDA 3VKNA 3I7DA 4XJWA 1C8M3 1REFA 3GBFA 1RJ8A 3B5LB 4OVEA 1AJKA 2XWBB 2LM3A 1R082 1C5IA 1R083 2E9QA 3ZN5A 4TYSA 4QPGB 2ATFA 5EJ3A 2WWSA 2Q0AA 4Q1RA 4CP1A 3IIAA 2R042 2R043 2RS53 4XTMA 4PDWB 3THPA 2WNVC 1H2MA 3D5OA 3L9JT 3JBG1 3ZSKA 4SLIA 1TNRA 3NAPB 5SV5A 4FPLA 1K5MA 4LBJA 5EV7A 4EROA 2UWCA 1BMV1 1LECA 3BPZA 3ZXGA 3R4UA 4E4DX 4LA3A 3NL1A 1MVEA 4AVAA 2VULA 1DFQA 1Y43B 5C8CC 4PIYA 1RUE3 1LOGA 3AYDA 1LHOA 1FPN3 3ZFGC 1H4GA 1RUD2 1VBE2 2DYCA 4JGYB 3TBDA 4ITCA 1F5JA 1Q5OA 4MGIE 4GH4C 4DS0A 4WVVA 4AI1A 1LKNA 2YXSA 2WQZC 3HN1A 3JZVA 2DV9A 5AC93 1FNYA 1ZBE1 2DVDA 2GMMA 5T5PA 1ZRCA 4LBQA 5FLJA 3T1MA 4YW4A 5KBFA 2DU1A 4XQDA 1OA4A 1VBC2 3B9CA 4BZ4A 3LSDA 4Y24A 2JENA 5L36A 1JW6A 3HIFA 4DINB 5J37A 2UURA 4XZPA 4S2GA 3GBGA 5JIAA 2OA2A 1LGBA 5T5JA 1XE7A 4AI8A 1N1TA 4XQWA 5JIUA 1K5MB 1F31A 5HBAA 3IPVB 4XFIA 3QCWA 3M7AA 3M2MA 2Z2SB 2DCTA 2DFCA 4I02A 1GBGA 2FQPA 1HQNA 1PO12 1PO13 2EXIA 1Q43A 2AYHA 5IUQA 4JCKA 3WDXA 1JN2P 3AB0A 3ACLA 4I3GA 4XJ9A 3UL2A 4GWMA 3VBUA 1GZWA 3AZZA 4XYXA 5KHJA 1ULFA 3WR0A 2H0BA 4LLOA 2A71A 5H9PA 1X50A 1VBB2 3UJOA 3B00A 3NWKA 2ZMNA 4BQ1A 3AMMA 1SCRA 1GKBA 3WP3A 1LENA 4XBNA 4LULA 3M3OA 1AYN3 4KGGA 1QXRA 4AEMA 4K20A 1AYM1 4AI0A 2VGDA 1RUF1 4LBQB 4MZUA 3FJSA 1R1A1 4Y1UA 3WW3A 4IEZA 1AXYA 1UPIA 2P34A 1MZ6A 1VAMA 2ZGLA 5CG9A 5BNNC 4NWWA 4HBNA 2WKKA 4YGEA 1CX4A 3LCPA 4KNCA 3RI8A 1RVF2 4ES9A 1H1AA 1QOOA 2E7TA 3AYCA 3MIFA 5GZDA 3M1HA 2ZZJA 3E5XA 3JQWA 3LOIA 1O3QA 1W0OA 2HWD2 3J8F1 2HWD3 1QJX2 2R30A 1WD3A 5EYXA 1DQ4A 3QD6A 5DXDA 4KU8A 5FO7B 3ZX7A 1HX6A 3LB9A 4YG0A 5KXCA 3L2YA 5L7OB 1NCQC 1FPN1 1VRH2 2TBVA 2BYVE 4FVVA 4B3NA 3WVJA 2R073 4OFGA 4E2GA 4CP0A 3D0SA 2PTMA 4MUVA 3JD71 3FBYA 1D4VB 1W6MB 1CAUB 1V6LA 4FTEA 4NVPA 1YJLA 4CEYA 1UX6A 4Q4X1 4J1XA 3AKQA 2PLV2 5FQ0B 2PLV3 4PCRA 1C1LA 1VIWB 2PHXA 1AL23 5FFOC 3CL1A 2XVLA 4RGGA 1COV3 2P17A 4LUMA 3SITA 2B46X 1AR83 2A6VA 4AVVA 1C57A 3MIEA 1ENQA 1S0FA 1XU1A 3POYA 2DCKA 4LR4A 3BB6A 2ARBA 2LALA 4PBPA 3IDBB 1Y9QA 2AH2A 3V0AA 3DV8A 1MQTC 1ZX5A 4Y20A 3VBRA 4CEWC 2GALA 2BNMA 1AR61 2LTNA 4CDXC 4B4Q