2HEWF

The x-ray crystal structure of murine ox40l
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
128
structure length
128
Chain Sequence
PPIQRLRGAVTRCEDGQLFISSYKNEYQTMEVQNNSVVIKCDGLYIIYLKGSFFQEVKIDLHFREDHNPISIPMLNDGRRIVFTVVASLAFKDKVYLTVNAPDTLCEHLQINDGELIVVQLTPGYCAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tumor necrosis factor ligand superfamily member 4
publication title The Crystal Structure of the Costimulatory OX40-OX40L Complex.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cytokine
total genus 28
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2006-06-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2hewF00
1DG6A 3K51A 4QPYA 5KWRA 5TSWA 1O91A 4KGGA 2WNVA 4HT1T 4EN0A 2JG9A 4MXWA 4OUSA 3WD5A 1RJ8A 4DB5A 4DOUA 5HBAA 2WNVC 4J6GA 1JH5A 4F3JA 4QQPA 3AB0A 3ALQA 4TSVA 4G3YC 1U5XA 1OQDA 1A8MA 3IT8A 5L36A 2QE3A 4TWTA 4RSUA 3TYJA 2RJKA 1KXGA 2Z5WA 1DU3D 5KC5A 1TNRA 4QQ2A 1C3HA 1PK6A 4E4DX 3B93A 4MXWB 2KA3A 4OUMA 2OIIA 1D4VB 2X29A 3TWIA 2JG9C 2Q1MA 2WNUA 1C28A 5KC6A 1GR3A 1KD7A 1S55A 2WNUC 5BNQA 4MXVA 2R6QA 4OULA 1D2QA 3QD6A 2R30A 2HEWF 3K48A 1U5YA 2RJLA 1D0GA 2O0OA 4GIQA 2Q8OA 3QBQA 1XU2A 3B94A 4KGQA 2WNVB 3FC0A 4QQOA 3MI8A 1PK6C 2JG9B 1IQAA 1XU1A 5L19A 3ME2A 4E4SA 2JG8A 1JTZX 4QQHA 2JG8C 4D7YA 3L9JT 2ZJCA 2QDNA 5CIRA 3URFA 1TNFA 4G4FA 4NN0A 2HEVF 1PK6B 1I9RA 1U5ZA 1WCKA 2TNFA 2E7AA 2HEYF 3B9IA 4QQLA 2RE9A 3V56A 2ZPXA 1RJ7A 1OQEA 4MSVA 4KG8A 3LKJA 2TUNA 2AZ5A 2R32A 2JG8B 2WNUB 1ALYA 4N90A 1OSGA
chains in the Genus database with same CATH superfamily
3ZFFA 1H8TC 4IEXA 1JZ2A 3DGTA 4LE3A 4Q0UA 3I49A 2AEZA 2WAAA 2IZWA 1WA6X 4KGGA 3GZUC 4XF1A 3JU9A 3KQRA 1GYKA 4MXWA 4Y1VA 1Y9MA 2DVGA 4A6SA 1DGWA 5LRRA 4FPGA 2YROA 2X5IC 4QKNA 1JXNA 3NW4A 2JDPA 2PHRA 4K40A 4LHSA 5DXDA 5A6XA 2LALA 3ZFEB 4D94A 3CL1A 5H9SA 5FZ6A 5FPVA 1DYPA 3ELNA 4A4AA 5D8AC 4WBBA 5L36A 4DINB 3DYPA 5A3NA 5CG9A 2XQXA 4BK5A 1AR61 3ILRA 5FXXA 3WG2A 1K5JA 2E26A 3M3QA 1VBC2 4HSLA 1XC6A 3USUA 3Q8AA 4ZU4A 1Q56A 1N1YA 2I74A 4K9SA 2BPA2 3ECQA 1WLTA 3BODA 1H30A 3P3PA 4SLIA 4O61A 1PK6A 3PNAA 3LOBA 2J7MA 1LODA 1P8JA 1VLNA 3JB8A 4YFWA 1J3PA 1H8VA 2XLAA 1QJU3 3QLQA 3S7EA 4FVVA 5T54A 1JYIA 4E2GA 4YZ2A 5F39A 3VBFB 1MS8A 1BQPA 4A7YA 3WQ7A 1RITA 5HV4A 4OI2A 1HB2A 3J7LA 1G9DA 4NIGA 2VNGA 2KXLA 5FYCA 3CEWA 1HJFA 3SNMA 3BYWA 5H9RA 4AL9A 5BNOB 2GMEA 2WZEA 5FYIA 1PO22 3MIFA 3VDDC 4OULA 2AC1A 2VMIA 3SKJE 4GKYA 4IDZA 1QXPA 5CNAA 5FY0A 1CPMA 3N35A 2PQSA 1Q8QA 1W9YA 5KXBA 1Y9GA 4NVPA 1W0OA 5FYSA 3B94A 2ZGQA 4URAA 3W59A 2DWRA 1ZRFA 2D7FA 1ZX5A 2VMEA 3C7GA 1REEA 4AEJA 5FXVA 3ZN4A 2ATFA 4EWDA 2NLRA 3NAPB 1PX3A 3ETPA 4FXKB 2DF7A 1GWKA 1K3IA 4LORA 3WG4A 2RS52 1W8WA 2VAUA 2GAUA 3VB9A 3FJSA 4FPOB 4ZKTB 4MADA 5FOJB 2JG8C 1AR73 2B9VA 1WKYA 1PO11 2HWE1 2IVJA 2NYYA 1C1LA 5IT6A 3DEMA 2ZBJA 3MUY1 4MUVA 5KXDA 5JOWA 2ILMA 5LBCA 4QPGB 5HPOA 1R091 2H6CA 3MV01 2FDHA 1F4HA 2E51A 5DG1A 5ACA2 2ZAHA 1GZCA 1GKBA 2YFZA 4GB31 3VHNA 1HXS1 2DVAA 2QVSB 1XSRA 2QQKA 3IAQA 4N9IA 2RS32 1POQA 4FPCA 2GH2A 2RR11 3T2TA 3VKOA 4Q4W3 4V2WA 3W9AA 3ZFEC 3M8LA 5A7NA 1LNSA 2W95A 3CQOA 5C3OA 2UURA 1XE8A 2JJ6A 3ZX7A 4C1XA 5C7GA 3ZSJA 4CA9A 1SBEA 1FATA 2ID4A 5F5IA 2B42B 1ND3A 1YIPA 1JN2P 1XNTA 4GQ7A 5FFOC 5FP8A 1O91A 1JU4A 4K1ZA 3KVBA 2W1UA 1COV2 2EVXA 4LEJA 4LXLA 4N43B 1NA1B 1QQP1 4YW7A 3OGSA 1SCSA 2P6HA 5FZKA 4OUSA 5I0SA 5JXIA 1AYM2 2WWSA 1IKPA 5FKCA 1OOPA 4UI9L 5EWSA 2XKOA 1W8HA 1BBT3 2ES3A 1GP4A 3OYWA 1ZYBA 2VU9A 2ETEA 3QACA 1HJGA 1OQDA 4AQSA 3G6JB 4UF0A 1YQ8A 1VMFA 2IXIA 3KT4A 3X29B 4COWA 2WA4A 1NCRA 4LQRA 5B4NA 4GAZA 3VBOA 5BNOC 2R072 3FBMA 2Q30A 2MEV1 4JHTA 1K5MB 3OEAA 3MFAA 5FZHA 4H55A 5K0UA 3RWNA 4WVMA 3ZKUA 3WG1A 4XF0A 1PZ8A 2YFUA 1LU2A 5AC91 1XE7A 2B9UA 1NT0A 4Q29A 4LOSA 2D6NA 1QOSA 4C0BA 1RVF2 2QCSB 1DQ6A 4P00B 4BHPA 3AKSA 3ZYRA 1JS9A 4YW1A 3RGBA 3I2IA 4AQ2A 1HDKA 5CBLA 1C28A 1IS3A 2C0ZA 2N7GA 4QX2A 3NAPC 3LSEA 4V2VA 3IDAA 4XMAA 1CAXA 3RZLA 1CVNA 3RZMA 2UY8A 4EV0A 1FPN2 3WSOA 5FP4A 1D0HA 2BBAA 2LS6A 4Q4X3 5LEJA 4NIIA 2B4KA 2ORXA 5LK7B 1H2MA 3K48A 3KD4A 1U5YA 2Q5TA 1G9FA 3AJZA 1ZVFA 1FOD1 5FWEA 5FZMA 1WMDA 4GIQA 5KXEA 3S6PA 1XYNA 2WINB 5E8AA 3KF5A 3WQ0A 2MPFA 5FQ0A 2A6YA 1YC61 3NO8A 1GNYA 1QH7A 2WT1A 3HBZA 4K1YA 2PHWA 4RYDA 5FYUA 1TME3 2QQWA 3DL3A 2A6ZA 4B29A 2DURA 1AYN1 4GJZA 1MEC2 3SH3A 4LBKA 4ITCA 4NR1A 1NCQA 3IDBB 1UMIA 2XHKA 1ZNPA 1JTZX 2V73A 4LUKA 3CF6E 4JGYA 4YGCA 2Q8CA 3ROUA 1GZWB 5T5OA 2XUMA 4LBJA 3AYEA 4YW5A 3BPSA 2E53A 2YPDA 3U4XA 4LKEA 2B7YA 3V0BA 2RM22 4AFBA 1LOGA 4LOTA 5JSOA 1G9AA 1E5RA 4FOWA 5EJ1B 5A3LA 2FDIA 4NPRA 3KV4A 1SCRA 3CBNA 1JYTA 3P6BA 4JQTA 4P9XA 3GZTB 4O9EA 4KNCA 2RS53 4Z82A 2HWD3 1NZIA 5DAPA 2YBPA 3ACGA 3SHRA 3VBHC 4AI8A 4QX0A 3WEZA 2DU0A 1SDDB 3AYDA 3LKJA 4AGVA 3RZHA 5C8CA 1S2EA 1CQ9A 1H8TA 1STMA 3POSA 3T2QA 1AR82 3ON7A 2TEPA 3ZMOA 1RUG1 1J3QA 1KJRA 3NV2A 2VCMA 5IJRA 4TTGA 1NLSA 3JD73 1FV3A 4M3CB 1D4M1 3J8F2 5KWRA 4GH4B 5BNNB 3O1PA 1K5MC 2Z69A 4AFMA 3DKWA 5T5JA 3T1LA 3I3QA 2X5IA 2ZZJA 3KV5A 4DB5A 4W8JA 1X50A 1JZ3A 4Y4YA 1I1EA 4J6GA 4X6RB 1KRIA 4BQ4A 3LEKA 2PMWB 1U12A 2ZMLA 1VMHA 4LUMA 3SH5A 4C1WA 4LA3A 5FMOS 2HWB3 2R062 5DMYA 2ZGRA 4CXYA 5FPUA 4Q0SA 2KR2A 4UBHA 4CTEA 1SDWA 1TE1B 2NQYA 1I5ZA 4S2GA 5IVYA 5D2AA 1NX9A 4W6YA 3A0NA 1RMU3 4JKKA 4KWKA 4E4DX 5F32A 4CCJA 1LULA 1MZEA 3B3QE 4X8NA 1VAVA 5J96B 2NP0A 5CADA 3ES1A 3VL9A 2ZHLA 4Y1XA 5LBEA 4BYYA 1BK0A 2XVKA 3J7NA 5D1IA 1VBD1 2VW1A 3MIBA 3JCIA 2CNAA 4FPYA 5FRAA 3VDDA 1G8WA 1DYKA 5F3EA 2VVDA 2BGPA 5FLIA 1ZRRA 1RUJ1 4FOYA 3KCCA 1R64A 1W0NA 4XABA 3I2KA 1VBA2 3BU0A 2ZGKA 3N7LA 3ZLIA 2YDEA 2RMU2 4BB3A 2O1QA 2RVAA 4QT6A 2OS2A 3BKZA 1NLRA 3ZFFB 2W5FA 2VTXA 1LJ7A 1UZZA 5KHIA 1JZ6A 1UKGA 4PJYA 2WO7A 4QXHA 3AZWA 3I2HA 4J1XA 3M7AA 2ET1A 4WZCA 4QX7A 1MACA 5C3QA 4QQOA 4AFAA 5FZOA 1XU1A 2IXHA 2WNEA 3ZKYA 2W2IA 4E8DA 2W1QA 1WZXA 3CZJA 1CX4A 2RJ2A 1GOGA 2JG8A 2AENA 4I01A 4JGZC 5FJHA 5FUNA 1PHMA 2RS11 2XJQA 3ZYIB 1TMF1 3CDZB 2D3RA 4Z1VA 2W46A 3LPGA 3LFMA 1UYZA 3WOGA 5KHJA 1BVVA 1ULEA 2PHFA 5J7MA 3A22A 4CP9B 1IHMA 2DVBA 4YW3A 4YW2A 3USUB 3BVCA 3CJIA 4LNVA 5IAXA 4AW7A 2ZX3A 3IWZA 1O6UA 4TZDA 1AX1A 2CDPA 1PK6B 4FP3A 4GH4C 1QJX2 3M3CA 1U5ZA 1WCKA 1Z7S2 1AR93 2FZ1A 1KS5A 3CLPA 3WQBA 5K4LA 4R4ZA 1E5HA 4GXLA 1H2KA 4KU7A 1V6LA 4Y3OA 3WCRA 2ERFA 3S0MA 1RUE2 3N7JA 1H9WA 1RUI3 1UYPA 2P4EA 3KCXA 1LHOA 1OQ1A 4QXKA 3D0JA 2Y64A 3AYAA 2FCTA 1ZZ7A 1CAVB 1WW4A 5IUQA 4HKWA 2W3JA 4GZ9A 1ODMA 3UESA 4AFDA 2XVGA 2QFEA 1Q8SA 5FZLA 4RFT0 1NLQA 5FMBA 5FY4A 4IEQA 2HYKA 2D5HA 4QM9A 3H1WA 1GZTA 4QKFA 3K46A 5DDJ1 3ATGA 1ZA7A 2B5HA 4M0HA 2DYCA 2VPVA 2WDBA 2X53S 4IQPA 1ZZ8A 2YBSA 1XOYA 2GMMA 2V72A 4MZUA 1N1TA 3M4FA 4LBNA 5I91A 5BNOA 3U1XA 4JVAA 1ZRDA 4S2HA 1JHNA 4NHYA 4K3UA 5A7PA 1RUD2 2QQUA 4AQTA 5HI0A 4L92A 4CCLA 4CU8A 4ARXA 4RQPA 3WW2A 4RGGA 2PHLA 1H2LA 3ZVXA 4BLJA 4QB2A 2XJSA 2QDRA 1YFWA 1D7PM 4XJZA 5ANQA 4GMP1 2R042 4XUPA 2VUAA 2WO2A 2GSYA 2J1AA 2YC2A 4BQ5A 1YXWA 4NO4A 1H9PA 3I2GA 1AL0G 3OCPA 1OF4A 2JDZA 1POV1 4XFIA 5C3SA 3KV6A 2Q1FA 4R9AA 1QOTA 3IPVA 2X05A 5C5TA 5I0RA 2F4LA 3J4UH 4AAPA 4IEZA 4XIKA 5FBJA 2J1EA 3N7MA 3AMNA 2VZ3A 3SEEA 3IMNA 4I02A 2Q8OA 3B00A 1QJY1 1RUH1 2QQMA 4AI1A 3KWVA 1JYNA 4JRAA 2AACA 3N9LA 3GGLA 1GLHA 1R1A3 2E32A 1VRH3 4WVWA 4QXBA 1PK6C 4INDA 2EAAA 5A3OA 1GBGA 5IVBA 3ACFA 2C24A 2EIBA 1AJOA 3B5LB 2YGMA 3V0AB 2J1SA 3QOPA 3NV1A 1W90A 2DTYA 2VR4A 1UX6A 1HB4A 3OYWB 5A7OA 1TG7A 2WS91 3K4AA 2WZR1 4O7XA 4N9HA 2RMU3 3E5XA 4YZ1A 4UF0B 4RN5A 1C8M3 3W21A 4Q4V2 3VBSB 3C3VA 2F4PA 1NCRB 2ZEXA 3UGGA 1CN1A 3VBOB 4XYXA 2ZX4A 3AJYA 3L9JT 1S0JA 2QDNA 2PELA 1PMIA 1JUHA 2VZQA 4M3CE 5IVFA 2HWC1 3TEZA 1VE0A 3U11A 5K0UB 4AVAA 2QZ2A 5L9RA 5CZKA 3VBHA 2TNFA 4PQQA 1HRV2 2E7AA 4L9BA 4BWOA 2BWCA 3AKQA 3JBG1 4QQLA 2CL2A 1ENRA 3B02A 3AXEA 1AXKA 3CIHA 5FIXA 4DY5A 1QDCA 4I09A 4Y26A 5C70A 1ZBA1 4UOJA 3P5BA 4CYDA 3O7OA 4LJHA 1CAXB 4RFRB 4ZXEA 4AFCA 3LZZA 1C8M1 1UMHA 2CV6A 1K5MA 2VUCA 2PA7A 2VNOA 4FFFA 1OF3A 1W6NA 4AI2A 3KF3A 1EAH1 5CKNA 3OY8A 3K2OA 4XURA 2GZWA 3PVOA 4AGRA 1ND2A 1L3JA 2V5YA 4RD7A 4ZU5A 5FQ0B 4B1LA 4IE6A 5E1RA 5IW0A 5CU1A 4AGGA 5J36A 1RUOA 1OI6A 1UY3A 2GC1A 5FP3A 4MO3M 4RL7A 1DQ1A 4ZS3A 2DU1A 1NUKA 2YV8A 5J09A 3ABZA 5G04L 3H0OA 1HRI3 1ULDA 3MHZA 1JODA 2WSVA 4XZPA 4AHXA 4D3WA 1QXRA 1NCQB 3LE0A 2WQ4A 3PVBB 2ZGLA 4I0BA 3MIHA 4XJ9A 5EXOA 4OMDA 1QJEA 3VLBB 1G86A 1CONA 1MS9A 3UNPA 3PUAA 2ZA9A 3N9PA 1AZDA 4NAOA 4K21A 4CCKA 1V9U1 3V0BB 1W6OA 2A3YA 2UYBA 1KDMA 5FCCA 5C8WA 1YHFA 4LO5B 2QQLA 1RXFA 2FDFA 2O8OA 3MLKA 3ZSEA 4UT5A 4EN7B 3ILFA 2X09A 4MVTA 3E6DA 5IK7A 4NRPA 3M2MA 2VH9A 5A7WA 1GNHA 1FMD3 2Z4FA 3VKNA 1IPKA 2GN3A 4XC9A 3C7HA 1QJU2 2Y6JA 2GC2A 4ATFA 1WCDJ 4K8RB 4I0AA 5FJKA 1RXGA 1GZWA 4M3CF 4YGDA 4IE5A 2W08A 5C8CB 3WNNA 1DZQA 4ZZ8A 4NIDA 1H8TB 1PIV1 4PI0A 4K8FA 3VBSC 2E9QA 2HEWF 3AKTA 5DAQA 1VALA 4XDQA 4XMIA 2XLGA 5C9AA 3W5MA 3TBDA 3VBOC 4SBVA 3BPZA 3ACIA 3T1MA 1HB1A 2PYTA 4H14A 3U10A 3ZXKA 2UY9A 4FTEA 1RUF1 2VM9A 3FC0A 1U5IA 3HOBA 5T5LA 4B7EA 3HBKA 3ZYJB 4JGZA 4JHZA 3CNAA 1HX6A 1US2A 3RRDA 4A3XA 4B8EA 2ZAAA 5FREA 1BZWA 3ME2A 5FZ9A 3HR9A 4OQ9A 1A3KA 1WGPA 1AL23 2A1XA 3M70A 5A7QA 3V65A 4HONA 1NYWA 2JXAA 3FHAA 3THPA 1H0BA 3PTRB 2RR12 3UK9A 1HKDA 2VNRA 5CB7A 2QJVA 3AP7A 5IK4A 1VB4A 3HMYA 4ZY9A 4M3CA 2H0BA 4OMCA 4JC1A 1V6JA 4XJ8A 2ZEWA 1BMV1 1JZ8A 3OD0A 1VBB1 1GFF2 1ODNA 3URFA 1AR72 3K77A 1W3VA 2FCUA 3OUJA 1ONAA 2VGDA 3ZIWA 2DUPA 4KWLA 1GMMA 4AVCA 2ENRA 4YM2A 3B9IA 3RMYA 3TN91 5B2GB 1YRZA 2LTNA 3VBRC 3VHPA 3W20A 4YG0A 2JECA 5FY5A 3LDBA 4CU6A 2G9GA 4AVSA 4CCMA 1I5PA 1NAEA 1MS4A 5LY2A 1PVC1 2JEMA 3VDDB 3BN6A 3HT1A 4CZSA 1O8SA 4XHXA 5IVEA 3S57A 1NCQC 1ST8A 5FR3A 4DY3A 1AUYA 5GZEA 1ULGA 2HKXA 2GDFA 4LPLA 1DF0A 3C8XA 4XZUG 3EQEA 1E5SA 3OGJA 3E6CC 3PUIA 5KBFA 3ITQA 2JDUA 5E6HA 4AI9A 4QXCA 2P3JA 4H7LA 3E5UA 4L0PA 1J84A 3RDIA 1YUDA 1S0GA 5DZEA 3WINE 3AB0A 1W0PA 5FZOB 5LZ6A 4ZHNA 4OQ8A 5F5AA 1UY2A 4C90A 3NJXA 4MYEA 5EHDA 1S0DA 2ZOEB 1AR63 1BBT2 1CIWA 1UKRA 4IGOA 2HBTA 4UFMA 2P1BA 3VZKA 1QXJA 2OUJA 2VW2A 3WT3A 4AZZA 3MYXA 2Z5WA 3O1OA 4QU2A 3LA2A 4QX3A 2WLPA 3IDEA 3KGLA 3LA3A 4A7KA 4KL1A 2OX0A 1C3HA 2HLEA 2ZX1A 5EJZB 4MLOA 3CJIB 2IXLA 3PU3A 1NXD1 5A3WA 3RNSA 2XPJA 1LB2A 1OKQA 1CPNA 4FTSA 4ORFA 3WDWA 2CGNA 5APAA 3K4ZA 5GLVA 4E9KA 1HIXA 3K4DA 2VXRA 1QNYA 1SFNA 1GR3A 4DXZA 1BEV1 4CDUC 1EUTA 2ZGNA 4A41A 5IK5A 3OEBA 1DQ4A 5GLZA 1KEXA 1FNZA 2ET7A 2WNUC 2AEYA 3DF0A 5LBBA 5FPXA 4F8AA 3MICA 4YWAA 4IUGA 4MXVA 5GZDA 3NVCA 4CP9A 3O5SA 3FN9A 3WNKA 4QDRA 5IWFA 3ZDSA 2NM1A 5C5UA 4UW5A 2XMLA 5L7OA 5LWBA 2XGXA 2JX9A 3D0SA 3O1RA 3J26N 2ZZQA 4Q4X2 4XF3A 1BHGA 2VTFA 5A1LA 2A7AA 2XXZA 4LHLA 1APNA 1SBFA 3FLPA 3FFZA 4BXSV 3ZXDA 3TEYA 1PM7A 1SZBA 2IVIB 3DXTA 1OUSA 1LOFC 2YMZA 3IZOA 1TME2 5FK8A 1TEIA 2SLIA 2Y0OA 5FO7B 2NPIA 3GJAA 1PNGA 2WFF1 1GU3A 1CAVA 1PO13 4QDQA 2Y0IA 2HWE3 1NG0A 3H8XA 3I7DA 3UJQA 1C1FA 3OPWA 4ZU7A 1GNZA 3LEGA 4XDOA 1FXZA 4YG3A 4ASKA 3LDRA 4RQPB 5LY1A 1R093 5CFDB 1LR5A 3EO6A 3MUZ1 5JPNB 1WCQA 1CZVA 1I9RA 3APBA 3IAPA 3N9OA 4YARA 5AFEA 5JI9A 1XYOA 4RHV1 2HEYF 3POFA 4GB33 4P08A 4LTAA 1HXS3 1W8NA 1UW8A 2MNGA 2PLV1 3MW2A 1S0FA 5A7SA 2FDKA 2I2SA 1J58A 2AYHA 2RR13 3WNPA 3I3MA 1QOOA 4MSVA 3THDA 4F83A 2P3KA 1MS3A 2RDSA 3WW4A 2QQJA 1ALYA 2HWD2 4Z8BA 4FXGB 2ZX2A 3KVAA 5K7PA 3WP6A 3AMMA 3IPVB 3H42B 4LBQD 4D6QA 1DG6A 4LO7A 2VW0A 1RUC1 3WF0A 1A34A 3ZIXA 3AL5A 1HV1A 3AP5A 3WNMA 4CEYA 1J59A 2JICA 5FUIA 3ST7A 1QQP3 4BXFA 4COYA 3JD72 1DZRA 4CDQC 3GM8A 1UN1A 2BFUL 3CJIC 1OPMA 3EJKA 2ZCWA 4KU8A 2WNVC 3TEXA 3RMXA 4DFSA 4OHVA 4Y5Z0 4CP0A 1HQNA 3ETQA 3DUIA 4OHWA 3NRUA 5ERLA 4CPBD 3ZO0B 4AOCA 1W9FA 3R6SA 2A5ZA 1NY71 1WCSA 2VQAA 1PZ7A 1TQ5A 1H1AA 1C4RA 2D6OX 4P9WA 1DU3D 2MEV3 2ZEYA 4UW3A 4EROA 4PLNA 4HLTA 2UWBA 2CHHA 3GZAA 5FY8A 1NE4A 4MGIE 2HWB2 3GBWA 1W2TA 3KZ4C 4LMFA 3DCQA 5AC93 1NXMA 4PCRA 3VD7A 1US3A 1UY4A 3DECA 4LLFA 5EYYA 5JDBA 2W94A 4RR3A 4FAHA 2KA3A 2NMOA 3BCWA 1TZOA 4OUMA 3VBHB 1PGW1 3V0AA 2VTXJ 2PHDA 5LBFA 3RYPA 5FZIA 1RMU2 3O12A 1F5JA 3OUHA 4P5HA 2GH8A 1VPHA 3I97A 5IHRA 3VBSA 4HZFA 4RA0A 5T55A 1Z78A 3VHRA 1V00A 5GZCA 3UV9A 4EZHA 4TXWA 1XQNA 2I07B 2EIDA 1EY2A 2R49A 3ZPOA 4CU7A 2IUWA 4P9JA 4EWAA 2ARCA 4FPFA 1FOD3 3RYKA 1WMXA 3GNEA 4JCKA 2EIEA 4KBBA 3NJVA 4QGLA 5HCFA 2JE8A 5JPMB 1W6NB 2OPWA 3LIGA 1K45A 4OCTA 2I45A 4RQPC 4PF5A 3OY8B 4YM1A 4YNIA 4QU1A 5CFDC 1AYN3 3MPPG 1JYCA 1ND2B 1VBE1 4AQ6A 4BMBA 2UWAA 5F1RA 5FTTC 2GNTA 3FE5A 2WUHA 2WYSA 3HN1A 3RSJA 1VB2A 1RHI1 2D6MA 4COZA 1V6IA 4CRQA 5BV6A 2ZKNA 2CAVA 5FUPA 2WWUA 1Q8OA 4LO8A 3QH7A 3VKLA 4QQHA 1O3QA 1ULCA 1BYHA 3AM2A 3O14A 4HKOA 4JKLA 4NHLA 3OBZA 4XFCA 5A1AA 1LHUA 4Z92B 4XIOA 3AZXA 3DN7A 5FP7A 4MGTA 4XDPA 4LIVA 3WDVA 2XJVA 4QWNA 2NN8A 2XBO1 1W6OB 2HYXA 2XOMA 3BIWE 5A6YA 4UYBA 3VBRA 2WAOA 1QU0A 5A3PA 3IN9A 5CG8A 5F8PA 2QQPA 4EN6B 1UOGA 1V6MA 1ZBE1 1E5IA 2XDVA 5DDJ2 4Q0QA 5A7WB 2BUKA 1EP0A 1B09A 4EWEA 1Q8PA 4CCNA 2WO1A 1AR92 5K8SA 4MG2A 4BMEA 1PGSA 1OLQA 3ZFGC 3WVJA 1WLCA 3PUSA 4N90A 2BERA 1RUG3 3PIGA 4YRDA 2KD7A 4FAGA 2Y60A 1RUI2 1SG3A 5DZGA 4DUVA 5CFCC 1D4M3 1WUVA 4LLOA 1W39A 4A6OA 1MS5A 1AF9A 3R0RA 3MEPA 4F7ZA 2E33A 1W8FA 5C9AB 1DQ5A 1O59A 4MOAA 5LB6A 2W47A 1W3XA 2XL7A 5AVAA 2E6VA 5I0UA 3IKWA 1A8DA 2YC0A 4QHBA 1UZWA 1A6CA 4JGZB 2XKPA 1UD1A 1ZZCA 3KMHA 1VBC1 3VV1A 3VDAA 2DVFA 4IE7A 4AR2A 1YFUA 3OPTA 1MS1A 1R081 3S5AA 3WQ1A 2CAUA 2XJRA 5HCAA 4LO4B 3ES4A 1LEMA 1O3RA 4XUOA 3DKQA 2GP3A 1OC1A 1UIKA 3OGRA 5J1XA 4BIOA 1XNKA 1YYNA 3M1HA 3NKGA 2OT7A 3WF1A 4NROA 1CR7A 4XUNA 1Z0HA 5LK5A 3WV6A 3ZSMA 3MPBA 5EIYB 1KQRA 1FYUA 1QJY2 3B93A 3PL0A 1T6BX 5LCWL 5AVPA 5JAXA 5ABJC 4E2SA 2RG4A 4CDWC 4CDUA 4NRMA 3WLUA 1BCXA 2E63A 2JIJA 4XBLA 1LAJA 4XXPA 1ND2C 3A23A 3KV9A 1YCIA 2WNUA 1VBD3 1PO21 4XJAA 1W2OA 5G05L 4XAAA 5JCTA 2ZGMA 3Q8FA 1RUJ3 3N4MA 1IG3A 4L97A 3AMQA 4PLMA 3AL6A 4HVQA 2VULA 3MBWA 2VZPA 2VMHA 4HG6B 1O8PA 2WLQA 2K2SA 1JYWA 2RJLA 2D44A 3Q8CA 4Q8KA 4YM3A 1UPIA 2E7QA 3AZYA 4JRLA 1PVXA 1F8VA 3ZXEA 3UGFA 4I3PA 1W6PA 3MI8A 3N9NA 1LOFA 5FZFA 1KDKA 4FT8A 1J83A 4ET7A 5T3NA 4J1WA 2JDKA 1WA4A 1YQ6A 3JBG2 3T30A 1R1A2 1JOPA 1VRH2 2RS13 2WN3A 3HNMA 5A1FA 1TMF3 1IS5A 1UU4A 3OOXA 2CWSA 3SQOA 1F31A 4BQXA 4XHBA 1DGWX 4R8HA 2G19A 5FY1A 4HVOA 2OYZA 5EV7A 1C8M2 2P3IA 3A7QA 5ACA1 3I2DA 3H8UA 5JZGB 3POWA 3S7IA 3HNBM 2AGSA 5C9AC 2BU9A 2RS31 4UW4A 1KJLA 4XAEA 1UAIA 1IKQA 4PHZA 1MQTB 2JB4A 4XACA 3OBRA 1LOBA 1PZ9A 4JQRA 5E89A 4BQ3A 2FD8A 3IDCB 3LCPA 4IEYA 4OHZA 1QJFA 1OKOA 2Y34A 2ZS6B 3FMGA 2ZHKA 5HCBA 4DIQA 3VHOA 3ZR5A 1SLTA 4WM7C 4CDQA 3NMBA 4YVSB 3ACHA 2CTVA 1AYM1 2VCCA 1X9TA 4RS5A 5FBZA 3FX3A 3MIGA 2C26A 5L7OB 2WNVA 5LW9A 3O1UA 5DDJ3 1UNBA 4BA6A 1LENA 4M4PA 4DXSA 3RFRA 1O4ZA 5A80A 1CAWA 3AK0A 2J1UA 5HBAA 4FI9A 4URTA 1QIQA 2DFBA 5L73A 4BPZA 4FFGA 1S2KA 1X36A 3ALQA 4YGBA 1Q5OA 3O1MA 1A8MA 2OPKA 2X8KA 2VJXA 4PLOA 4ZXKA 2PN5A 3BOWA 3LFIA 4YZ4A 2R071 4XQ4A 4IEOA 3TYJA 2XB6C 1JMUB 2VQUA 4XFHA 1KFUL 1LOAA 2R1DA 3ZSKA 4EYUA 5JXHA 1GICA 1HRI2 3PLQA 2GC3A 4IEVA 3WF4A 3J7HA 1W9TA 3GALA 4MHRA 4YLZA 3WX5A 2BRTA 2E7TA 4L11A 3VDCA 4X6QB 1G7YA 1RVF1 3E5QA 4GMP3 3I54A 1WBLA 4CCEA 2QQOA 4UWDA 1YWKA 4CCCA 4IEWA 4IXLA 5FLHA 2HWF1 3POEA 1W28A 5JI7A 3GJBA 1REFA 4NAMA 1V6KA 1J3RA 1XXNA 1RUF2 2V4VA 3GXUA 4ES8A 4AVTA 1I3HA 4I0WB 1POV3 3I2FA 5KC6A 2XG3A 1FPN1 1NOVA 3T4HB 1FMD2 1DQ0A 4Q0PA 2F17A 4LBOA 1N1SA 2VZRA 3GBFA 2V5DA 2NZ9A 3HQRA 3N7KA 4CCDA 2R0FA 3GCWA 5BYNA 3WUCA 5LRSA 1QJY3 1RUH3 3HJRA 3U14A 4YVWB 5CFDA 3UT0A 4CEYB 2ZACA 1MEC1 3LF7A 4I30A 2VMGA 3ZM8A 2VY0A 4WVVA 4B4QA 2HH9A 4UFIA 3TOJA 2HJIA 5LA9A 3ZN5A 3GBGA 4B3NA 3I4IA 3T4VA 4GMP0 2YU2A 1S0IA 5F5CA 5IATA 1HN1A 1CIYA 5DAXA 1JBCA 4W65A 2DBNA 1QKQA 1IQDC 2XJUA 1MQTC 2WS93 4HFSA 2WZR3 1DBNA 1V6NA 3I2OA 2RM21 2R7EB 1UPSA 5E16A 4KH9A 4MH0E 4AEKA 3T2OA 1POV0 2W92A 1AL22 2ZHMA 4ZONA 1EV11 3UJOA 2B39A 2BGCA 5JLVA 2VMFA 4KQ7A 4ONUA 1DGRA 1SLBA 4JZRA 3SCHA 2ZJCA 1RB8G 1SEFA 2P6CA 2WNOA 2D98A 4L99A 5FAXA 2HWC3 4XQDA 4YVSC 5C3RA 4IERA 1Q8VA 4YG6A 3MZHA 1ZZBA 5SV5A 4N53A 5L7OC 3JBG3 1UZVA 4DQAA 4ATEA 2ZPXA 3HPNA 4RR3B 4DMIA 3IIAA 4FCAA 3ZFGA 1CZTA 4C91A 2OXBA 4Q8LA 1AR81 1XNCA 2XUEA 2W1WA 4LK7A 3WDTA 4CXWA 2PHXA 1PGL1 1ZBA3 2VO5A 2Y6KA 1XB9A 5JOXA 2BBVA 3KM5A 3D4KA 2YBKA 1HLCA 2CSGA 5CFCA 2W39A 3J8F1 4OVEA 2BNNA 5IVJA 5LA1A 2Y26A 4ARYA 4B4RA 4Y1ZA 4FQ4A 1W6MB 4AHYA 4UFKA 1ZZ9A 2OA2A 3A21A 1EAH3 5EYXA 2Q8EA 1PGL2 4FP2A 4R9DA 1DHKB 2OQ6A 5JIAA 1JYVA 1RUNA 4YGEA 5FYHA 2P34A 2Y6FA 3OD4A 3WD5A 2Y6HA 1VJ2A 4KBZA 3M3OA 1SLIA 4LBMA 3MIEA 2D97A 4QQPA 4D7SA 1I6XA 1Y3TA 5I0TA 1XYPA 2R061 1KS4A 1V70A 4HVRA 2QQIA 3H7YA 2PAKA 5LA2A 5JMOA 5CA6A 4FSJA 1BVP1 3OPZA 2QBXA 4AYUA 4MGSA 3C2UA 2YY1A 1V9U3 2DCYA 1AR62 4CVUA 1ZM1A 2PFWA 5KC5A 4LKSA 1LCLA 4OHXA 4WM8A 1Y4WA 1F35A 4Y1UA 2D6PA 4D6RA 1J1LA 4BLIA 5ABJA 3C7OA 4NMIA 3AVSA 4CDWA 4LIUA 4XQWA 3FL7A 2P37A 4YZ3A 4YVWC 4CEYC 4DEQA 5JIUA 5FMOL 3PJYA 3VBRB 3RZKA 2P2KA 1SBDA 1LECA 3VZJA 4FQZA 5IYYA 3H8OA 4LR4A 2XWBB 3WHUA 1VBA1 3ZYFA 4OI0A 5CISA 4PIYA 4E27A 3FLTA 5DUWA 4CXXA 4R52A 2VL4A 4CCOA 1XNDA 3RJRA 1PIV3 2VBPA 2WKKA 5FXWA 1OBNA 2GP5A 4ES9A 2C5DA 1ZZ6A 3KB5A 5M0TA 2BV4A 4YW6A 4Q0VA 1W2NA 1N3PA 5C3PA 3QBQA 1VIWB 1XU2A 1YLLA 1RUF3 2P3YA 4KWUA 2WT2A 2JE9A 5A32A 3GHNA 4RHV2 4C8DA 3H3LA 5IK8A 4EZ4A 1K42A 2VBDA 4RR3C 2CY6A 2BFUS 4D69A 4BH9A 5GZFA 5F37A 1LTEA 4LBLA 4B4PA 4FPLA 2WT0A 3PDQA 4I2OA 1YNAA 1OA2A 4D7YA 3PU8A 4I3GA 4NIAA 5KR7A 3UGHA 1QJX1 5F6KA 1Z7S1 3WP3A 1VBB3 3B69A 3OF1A 3FFQA 2Y6LA 1PO12 2QTWB 4FFIA 2HWE2 3SC7X 3RPQA 4XTMA 2EXIA 2X10A 4A42A 4Y22B 3TN93 2EXKA 4GKXA 4HPKA 4QX5A 1DGLA 1R092 2VE1A 4GD4A 5I8SA 1GQGA 5SV8A 5FZ1A 1XRUA 4CDUB 5DAVA 2WNUB 4GB32 1PVC3 1HXS2 4EN8B 4XEZA 5C4WA 2IC1A 2WYFA 4WM7A 4AHZA 4FPJA 2WL1A 5C6CA 5DZFA 4COVA 3H3UA 3I59B 1SLCA 4OYUA 4XE9A 4CDXC 5IFTA 2C1FA 4IGPA 3E6BA 4HETA 3WR0A 1YO8A 4D8MA 4GWIA 4OI4A 3SH4A 2RDRA 1OVPA 1OMIA 1JUIA 2WBKA 2JG9A 4FFHA 4DOUA 4KWJA 4A3ZA 4JV4A 5FO8B 2PAMA 3HQUA 2ZGOA 3FUOA 1QQP2 1W6PB 3JZVA 1CD3G 5DG2A 2WZ8A 1LHWA 5EFUA 1ZREA 1RUD1 5HXVA 1ASJ3 2AUYA 3VD9A 3OJBA 2XLFA 5LATA 1H2NA 3AC0A 4GALA 5FPAA 3LEIA 2EXJA 1VAMA 2GALA 3SCGA 3LEMA 1H6YA 2DCKA 1H6XA 2UU8A 4A2UA 1BK1A 5GLUA 2R041 3P3NA 3NV4A 1AX2A 1FAYA 4OZXA 2ADDA 1L7QA 3N36A 2GU9A 3B9CA 2JD4A 5J98B 1Y43B 2MEV2 3UYJA 1ENQA 3JB4C 4D0QA 4Q1RA 2Z42A 1RC6A 3LD8A 1LKNA 3T0DA 1CX1A 1V6OA 1REDA 4HL0A 4HBNA 1UIJA 5AC92 5A3TA 5F2WA 3PIJA 3WP4A 1MZ5A 4AAXA 4CU9A 2VOTA 4ZZ5A 3AX4A 1W2UA 1BEV3 4G9SB 3EYPA 4PDWB 2FDGA 2YG0A 1HQWA 1A78A 3S5QA 3WG3A 5FDBA 1KD7A 5J37A 1ULFA 2WFPA 1W99A 1ASJ1 3JQXA 5J3UA 4LT5A 3JUUA 1HV0A 4Q1PA 3KS7A 1IS4A 4LKDA 4QX8A 4DZGA 4Z2WA 2QQVA 4Q4Y1 3H1MA 3GDBA 4W6XA 4DXRA 3KHBA 3IIIA 4YW4A 2YC4A 3NWKA 4GWNA 2AREA 2VZSA 5JZGA 3H7JA 1UXZA 4FPHA 4CDQB 3RWKX 4RS5B 4KGQA 4YFZA 5JXGA 1FOD2 2LM3A 2WNVB 3C7FA 3EMRA 1VMJA 5DUUA 3WHTA 2WR9A 4M00A 3VD3A 1UF2C 1MQTA 1IPSA 3INAA 1G9BA 1CAWB 5JSRA 3BTYA 3WNXA 5FZCA 3DPRC 4K7JA 1L7LA 1OXCA 4A7ZA 4Q4V1 3M3IA 5BUVA 4WZFA 1AYN2 1WW7A 2BVVA 3WW3A 1GUIA 3MFCA 1NQJA 4PBOA 4IEUA 2D93A 2WFF3 2DTWA 2G1MA 1NKGA 2VNVA 3SEPA 1MS0A 5H9QA 3I8TA 1F9KA 1RGSA 3IBMA 1MVQA 4WV8A 4YVSA 5FZ8A 4FOQA 3SXWA 1T2XA 2J1RA 5FLJA 3VBUB 4LA2A 3ZDVA 2A71A 1HRV1 4AXOA 1YFXA 1SMVA 1TNFA 3AZZA 1DDLA 4JTNA 2DUOA 4N7UA 4IEPA 2VVFA 4FPKA 4RHV3 1DQ2A 2F6BA 5JSPA 2IFWA 2OQ7A 2PLV3 1YFYA 4Q5OA 1IG0A 5ISLA 3WDYA 5T50A 4AEDC 5FYYA 4KG8A 5DUXA 3Q8EA 1GP5A 2R32A 5BNPC 2VVEA 1OVSA 1CJPA 1RIRA 4CEWC 4Q26A 3GHMA 2EIGA 2Y38A 4QAWA 4DS0A 1R082 1YI9A 3WZ1A 1QNWA 1RUC3 3K51A 4JAAA 4IW3A 4Y20A 1OURA 2TBVA 1LGNA 1RUG2 5FZ4A 5I0DA 4AEMA 2BWAA 5GZGA 2DVDA 2BOIA 4AI3A 4UW6A 3CZUA 1DIWA 1QGLA 1D4M2 2VZUA 5HCHA 1UO9A 2DUQA 2RDNA 5KXCA 3FBYA 2XVLA 4HMZA 4O65A 2BW8A 4F3JA 1G6NA 4LBQA 2ARBA 3THCA 5FY9A 4XFFA 2VZ1A 4QKBA 2CGPA 2A6VA 4NHXA 3ZN6A 3LGRA 2DFCA 2ZGUA 3FWEA 1OLRA 5JOYA 4P9IA 4PDWC 3UKNA 1HQLA 2ZABA 3FZ3A 3JQWA 1W04A 4B1MA 3TAYA 3PJQA 5FO9B 1BKZA 2C4XA 5FZDA 2VOKA 4NHMA 4P9LA 3OGGA 4ZPIA 3R4DB 3BTZA 4YVWA 3IM0A 5FYZA 2XL9A 1N1VA 2L9LA 3NJYA 1WD4A 3TRSB 3T3YA 3RS6A 1O3TA 5F3IA 5DABA 4CPBA 1QJU1 4RS5C 2QKDA 2PXJA 4N53B 4NE9A 5BXXA 4PF1A 3TWIA 3VKMA 2CWMA 3WW1A 3VD4A 2JDYA 4K6BA 3HIFA 3K3NA 3ZFGB 1DLCA 5GLWA 3F95A 2VCAA 4HN1A 4XCAA 1C8NA 2VG9A 5EQUA 1VBD2 1QHDA 2R1BA 1D2QA 1UOJA 1W6QA 1XJAA 3QD6A 3T09A 3WY6A 5CFCB 3PURA 1JZ4A 3S30A 1RUJ2 4UBGA 1OFSA 2CDOA 4QHZA 4D6SA 1OHFA 2WQ8A 2C9KA 2RHPA 4K20A 4NRQA 5CYYA 3PUQA 3VBUC 4BDVB 4HXCA 1EPZA 2VUJA 5FMCA 5GJ6A 3E1F1 1VBE3 3B7MA 4OFGA 1IQAA 3PMEA 1WMFA 1OLME 5T52A 2AR6A 2WIIB 1RHI3 2W87A 4Q2FA 1JI6A 3FUQA 4XILA 4EJRA 4XBQA 1GANA 1AX0A 1UZYA 1OT5A 1SPPB 1LGBA 3ZMNA 2WQZC 4MV2A 2G9ZA 3RI9A 4DPNA 4XVHA 2RS12 1AR71 3LOIA 1TMF2 1W6MA 2OUHA 4QPIA 3RG0A 5BY5A 3HWJA 4DO0A 2XBO3 3IB3A 4Y4RA 1Q3EA 4S2FA 2C9AA 4WM8B 2DBIA 3U37A 4Q27A 3PUHA 4CUCA 5ABJB 3BI3A 4CDWB 4BK4A 4FTBA 4NPLA 1ZBE3 2FQPA 3L2HA 2GNMA 3OSDA 1QY4A 3KGZA 3VBFC 2OVUA 3LQCA 4W50A 3AXDA 2FBEA 2O8QA 3CU7A 3OTFA 2TUNA 4Y5SA 3O1VA 1AJKA 4Q4W1 5CEHA 3QCWA 5A6QA 5C71A 1OD5A 4CDXA 4XJWA 4TLFA 3NQHA 3H9AA 4XW3A 1UOBA 2VQ0A 2WSUA 5FYBA 4X8PA 4R4XA 3WXPA 2VZOA 2DCZA 2BEOA 1O5UA 2IFRA 1LEDA 3GZEA 3HN3A 1KFXL 2K9ZA 2JDNA 4QPWA 3VD5A 3MO4A 2BNOA 5LA0A 4EN0A 1MR5A 1W9SA 3LPFA 2QNKA 4Y24A 2RV9A 2ZX0A 1JH5A 1H1MA 1WCUA 2JDHA 2BP6A 1FV2A 1XNBA 4P9YA 1BBT1 2J1VA 4IV1B 5A32B 1F5FA 1W05A 1VBC3 2EICA 2HWF2 2EF6A 1JOBA 2GNBA 4N53C 4TYSA 5IVVA 2CU5A 3HD8B 4FO9A 4GWJA 1R083 3Q8BA 5FPBA 3P1IA 2A73B 5GLTA 5JVVA 2J1TA 2FHRA 4QB1A 4JDNA 5I93A 2ZEZA 5D21A 2YPJA 1AXYA 2Y8KA 4IESA 1WLDA 3BB6A 1MVEA 2G4IA 4L8QA 4LKFA 4M01A 4J25A 1O4TA 2Q0AA 1AVBA 4ISRA 5JXJA 5C33A 4NIHA 1UMZA 1UYYA 3BU7A 1W8TA 1CESA 1S2BA 1B35A 2FDJA 4QPGC 5FZBA 3VN4A 3THTA 4XXAA 3W5NA 3NNJA 2Z79A 4P9GA 4BCUA 1EUUA 2OIIA 1OFNA 3I3EA 4HPKB 4XTPA 5FZGA 1PO23 3EXUA 1S0BA 1JZ5A 4M4RA 1FX5A 2QQNA 3USSA 2WWJA 1E57A 3KCYA 3U07A 5IAVA 5BNQA 2XHNA 4HK9A 1F15A 5C4WB 4WM7B 5FZ0A 4Q4X1 3HT2A 4BOWA 4XF9A 2H6BA 1EV12 3BTAA 1IPJA 2P17A 1ULOA 3KQ4B 5L9BA 1WD3A 5ANNA 4N43C 2OW4A 4Y22A 3T2PA 2KM2A 1NA1C 3DPRA 3POGA 1RUH2 4WM8C 2JG9B 4HSJA 1OLMA 1TME1 2ZKLA 3J7MA 2W9XA 3NNGA 3RYRA 4AI0A 4AVBA 2H0VA 1PX4A 1VRBA 1CAUA 2VOVA 3VGIA 2E31A 4XUTA 3ZSLA 4OZOA 1CWPA 4IV3B 4XFGA 4HANA 3WDUA 2BOJA 1GSLA 5FY7A 4ASLA 2IXKA 4MX3A 4UAPA 4EE2A 1ZA4A 2R16A 1EPWA 3I59A 2WS92 2WZR2 2LUWA 2PQQA 4HK8A 2XH6A 5F2SA 1UCXA 3OG2A 2B45X 2W68A 2VZVA 2QUOA 4H2AA 4JKMA 4IETA 4S2DA 2D6LX 4P02B 3A4UA 5ACA3 1UOFA 5DPNA 5GKAC 5LASA 2DDUA 3D8CA 1PM4A 3OBTA 3CMGA 3T0AA 4M0NA 3D3AA 3H3ZA 2RS33 3IMMA 4IL7A 4YM0A 3ZXAC 4BQWA 1ZRCA 4AEDA 4WVZA 5D8AA 5A6ZA 2HWC2 4PBPA 3U75A 3ZYBA 2UYAA 2RS51 5BNPA 2HWD1 2JKXA 1SHWB 4CEWA 1LHNA 3ASIA 3PVEA 1PNFA 3H50A 5A33A 1W8ZA 2ZMNA 4IV1C 5IFPA 3BIEA 2A6XA 2D6KA 1CZSA 4EQVA 3Q9OA 4UFLA 1WW6A 3OB8A 1COV3 1YEWA 3GF6A 4XETA 1ZBA2 2B8MA 4BISA 3VL8A 4BQ1A 3HQXA 3BTXA 3JD71 4V1PA 1AYM3 5FWJA 1JU3A 1RL3A 3ILNA 1HB3A 1EYBA 4HKLA 2WC2A 4ISQA 1Y7BA 5JR7B 3UKTA 2VECA 3W58A 1YJLA 4QHOA 4A44A 2ARAA 4DEVA 4COUA 4PI2A 1H4GA 3BALA 2JB8A 3NSTA 1EAH2 2C6SA 1X33A 5DN2A 3EB7A 4IE0A 2Y6GA 1HN0A 5EZWA 3N3HA 4TN7A 5FPLA 4PDWA 5E88A 3ENRA 3AMHA 4MHUA 3IT8A 2VQTA 2ORZA 5F7UA 2R073 1C5HA 3FLRA 1UU5A 2GN7A 4PQ9A 3AZVA 2RJKA 1KXGA 3HVDA 3FHQA 3LIHA 2HWB1 1LU1A 4B7KA 3NKTA 3RJ2X 3C7EA 4BZ4A 1COV1 3HAGA 4NHKA 3AMPA 4YYOA 5C4WC 3U0ZA 1RVF3 4L2NA 2EXHA 2PAEA 4CP2A 3K3OA 1V9U2 4QMAA 1IOAA 3RZZA 4NOTA 1ACCA 1RMU1 2HWF3 4MXWB 2BDRA 1WBFA 1DP0A 1D4VB 1C5IA 5FPZA 2JG9C 2LRPA 1UZ0A 4GJYA 4BJ0A 5FOBB 1FPN3 1DLLA 2D43A 2XJTA 3AKRA 3AVRA 4AHWA 2VMDA 1JZ7A 1GP6A 4RGKA 5FZEA 4PIXA 1D2SA 2VZTA 4IV3C 2BVBA 4IGQA 4YPJA 1LESA 2K46A 2R30A 1GQPA 1MZFA 2J22A 3VBUA 1IZ3A 1LGCA 2O14A 3VZMA 1D0GA 2O0OA 3MF6A 4A45A 2A3XA 1FNYA 1PIV2 2J42A 2YGLA 1MEC3 3POYA 4IE4A 1GZ9A 4N7IA 4Y20B 3T0BA 3RQ0A 1X7NA 4AG4A 5BNNC 1GOFA 1H1IA 2OZJA 3MIDA 5F5QA 1KITA 1GQHA 3V64A 4FPEA 3ZFEA 3RZJA 4TLGA 1UL9A 1C57A 4P14A 3H8RA 4LITA 3WNLA 4LBQB 5EPAA 4C0HA 5HXMA 5FYVA 2RM23 4E2QA 2EAKA 2GNDA 2UWCA 4H7MA 3NV3A 3ZN6B 1M4WA 2A6WA 3WP5A 4NWWA 4LHNA 2WO3A 1EV13 1IGOA 1XSQA 2W91A 3KT7A 3ZYHA 4DUWA 2VBBA 4GA9A 2FCVA 2HBUA 4BQ2A 5AFBA 1G9CA 5A3MA 1HW5A 2FMDA 5T5PA 2V09A 4BE3A 5GM0A 4G4FA 2RDQA 3HEIA 4NN0A 4QX1A 4XBNA 4OLLA 4DRRA 5A3UA 3U78A 5LEKA 3VBFA 4LK6A 1BMV2 1H4HA 5F6LB 1VBB2 1AR91 1UU6A 1W06A 4AWDA 4BIFA 4QB6A 3O1SA 2LW8A 3CHXA 3O1TA 1LRHA 3EHKA 5FZ7A 1DZTA 4FBFA 1AR83 2A3WA 1F4AA 1FT9A 1S4CA 1UY0A 2ADEA 1S0EA 3TN92 2WABA 2IWGB 3TNQA 4XJUA 5DUVA 1DYOA 1RUI1 2LROA 2PHTA 4CUBA 4O9GA 2WJSA 3VZNA 1TVGA 3J8F3 4OHYA 4D7TA 3T08A 5F3GA 3MF9A 1PVC2 3LB9A 4QPYA 1W6QB 4ZS2A 2D3SA 1OH4A 4MGQA 1Q43A 3TEWA 1YJKA 2Q8DA 3ZFFC 2BQPA 1W9WA 4R9CA 1MPXA 3WF3A 4KG0A 3PVNA 4JX0A 1JHJA 3KSCA 2Q4SA 2VD7A 5BPXA 1RJ8A 4Y5TA 3VDBA 3N9MA 2DCTA 4LO6B 1RYYA 3NAPA 1GOHA 1OUXA 5JR2A 1SLAA 2BNMA 4TSVA 3SMHA 1LHVA 1PMJX 2R063 3SISA 3R4UA 3ZPYA 4RSUA 3RI8A 5HV0A 3VZLA 1PMHX 3FHIB 1WW5A 5FV3A 1K12A 3AP6A 3LA7A 4NUBA 4XF4A 5FYTA 4XCBA 3ACLA 2ZXQA 4DNYA 1AXZA 2JKBA 5J48A 1ASJ2 3R4SA 5L9VA 3LSDA 5FP9A 3ZXGA 3KHCA 2VCBA 3MLLA 1VR3A 4E8CA 4QPGA 4R9BA 4QPIB 4MGKE 4AE2A 1ND3B 1WMEA 4Q4Y2 2WZPP 5JZGC 1KGYA 4U2AA 3AFGA 1UX7A 1R1ZA 2W0XA 1X9PA 2WN2A 1WLWA 4HOOA 3OGVA 1Y9QA 4E4HA 1SFPA 4U36A 1OOPB 4CUAA 4NPMA 3H1YA 1VBA3 5CKMA 1X82A 1OH3A 2D40A 3LWCA 1SPPA 5KHHA 1OPOA 2D3PA 1ZRIA 2NMNA 1BEV2 2JD9A 3PTYA 2VXJA 3NNMA 3NL1A 4CDXB 4RGAA 3AKPA 2Z2SB 3BGAA 4QKDA 2XONA 4N43A 5F3CA 4BQYA 1NA1A 3CJXA 5FMDA 4WVMB 4QM8A 2JENA 5GALA 2JDMA 2WA3A 4NWVA 1UXXX 3NNLA 2BJSA 1CGPA 4N8MA 4KI5M 1R1A1 1VRH1 4BM8A 4XFBA 5L19A 1BLZA 3POJA 4FOVA 5CKQA 2ARXA 5KHKA 2ZMKA 3DYOA 3G7DA 2BZDA 2YB7A 1QF3A 3ORJA 2B46X 3WCSA 2ZGTA 2VOWA 1OA3A 2JIGA 3AP4A 2D5FA 1SQ4A 3WDXA 2K0GA 3OUIA 5JOZA 1L7RA 1YQCA 2RMU1 3K75B 2EA7A 5F9TA 4JDOA 5H9PA 1T6GC 1OA4A 3MDPA 2PTMA 1QJX3 1O7FA 1Z7S3 3QH6A 2WFF2 5CIRA 1VAKA 2IXCA 3SKVA 3I2JA 5DQ0A 5EJ3A 2CGOA 1ULPA 1OD3A 1XNAA 4CSWA 4CUGA 3POBA 3TNPB 2DV9A 1RUE3 5FK7A 2YXSA 3VKFC 1B35B 3I3DA 3F2ZA 2RE9A 4IV1A 3V56A 1NE6A 1RJ7A 3D82A 4OI1A 3WUDA 3VUOA 1OQEA 2QZ3A 3O0WA 1FI2A 2IXJA 2YHJA 1LOEA 3A0KA 3NNFA 4PIZA 2PLV2 3TB0A 3MV11 1SACA 4UFJA 3N9QA 3KT1A 3BOPA 4JGYB 2GMPA 1YIFA 4LULA 3R05A 4KMQA 3DV8A 1SLLA 4UXAA 3UL2A 1GV9A 1NQDA 2DCJA 2A75A 1RTVA 1N3QA 5FXZA 3RZGA 5TSWA 2FMYA 4Z07A 2AH2A 1GWMA 1O5LA 2YZ4A 3VZOA 4QPIC 4BU2A 1RUC2 4HT1T 4YSFA 1ND3C 1N47A 3JXSA 2MHFA 1S1AA 2BGOA 3MLJA 4UFHA 3OBAA 2W52A 3EBRA 2XQRA 5JMCA 2YYOA 1RUE1 4H3WA 2JE7A 4XUQA 2R0HA 3DPRB 1AHSA 4G3YC 1RUD3 1OOPC 1U5XA 2QE3A 4TWTA 1X8MA 1HRI1 1CAUB 2SBAA 4GWMA 5FYMA 2Q1ZB 2W1SA 2A70A 4NJ4A 1W2AX 4YZ5A 2ZGSA 1QDOA 3LDKA 4DRVA 5FZ3A 3B01A 2YUEA 3DXUA 1NCRC 2R043 3PMSA 3POIA 1TNRA 2G9FA 3MW4A 1NY72 2XJPA 4JDMA 4AF9A 4QQ2A 2FZ2A 2ZHNA 1JYXA 2EALA 1JW6A 3I3BA 3MGUA 5A70A 1W8UA 4CP1A 5K0UC 4GULA 2X5IB 3ZR6A 1CJDA 2BTVC 3AP9A 4ASMB 1WWYA 4XFAA 5I8YA 3M3EA 1FMD1 2X29A 3ZXFA 4AEDB 5D8AB 4E4ZA 4XOGA 1RINA 2Q1MA 2CYFA 3L2YA 5BNPB 4IV3A 1SFYA 4OUEA 5FZAA 5B4XA 1QH6A 1PGW2 4CE8A 4CEWB 1QEXA 1YQ2A 2BYVE 3KLSA 5A33B 1S55A 4LE4A 3UETA 3NJZA 1UYXA 2YU1A 1QWRA 1V0AA 2R6QA 3J9SA 1O3SA 2ZTNA 4LHKA 4Q4Y3 5IVCA 1YQ5A 4MGYE 4GH4A 5BNNA 1URXA 1UWWA 1W03A 2ZGPA 1O4YA 4HN0A 3D6EA 5CAZA 1X8EA 2XR4A 1LOCA 3AFKA 3U4SA 1GWLA 1J1TA 3ZYGA 1W8OA 4JTOA 2VMCA 4DXTA 2XWJB 1VP6A 2WRAA 1QJZA 5I8TA 1NZCA 4P5YA 2VUDA 3WNOA 5K9YA 1F2NA 1B35C 4XPVA 4Q4V3 1IS6A 3RVHA 5DAWA 3ZOIA 3D5OA 4E4SA 1AL21 1JOJA 2VOXA 1VBE2 3CKHA 4META 1BJQA 3HNYM 2JDAA 3O0XA 3O0VA 3SITA 4MGZE 2V4AA 1N3OA 1DCSA 1UQXA 1MZ6A 1RHI2 4Q4W2 1M06G 4JGYC 1XPWA 3SCFA 3ZXJA 1BXHA 2PHUA 3WF2A 1HRV3 5FKBA 1ENSA 2OKXA 5CVRA 1YI7A 5JWPA 4AK3A 2P5BA 1DFQA 3ZXLA 2HEVF 1DGRN 3SLIA 3BUCA 4QGMA 2XBO2 4Z2AA 4QD2A 3DYMA 4Y33A 3UKVA 3MW3A 3ZYPA 1S0CA 2Y33A 3E97A 2GC0A 3GCXA 2JWPA 3CO2A 3LAGA 1XE0A 4QDSA 4QGNA 4EN9B 5JUVA 2OZ6A 5KHGA 1UY1A 4AVVA 2AZ5A 2VC9A 1QMJA 1U0AA 1ZBE2 2JG8B 4DUXA 4PT6A 5EP9A 3GYDA 4W6WA 1ENXA 4W4ZA 4Y1YA 1OSGA 1XBFA 5C8CC 3AYCA 3PHMA
chains in the Genus database with same CATH topology
3ZFFA 1H8TC 4IEXA 3DGTA 4LE3A 4Q0UA 2IZWA 4KGGA 4XF1A 3GZUC 3JU9A 3KQRA 1GYKA 4MXWA 4Y1VA 2DVGA 1DGWA 5LRRA 4FPGA 2YROA 2X5IC 1JXNA 3NW4A 2PHRA 4K40A 5DXDA 2LALA 3ZFEB 4D94A 3CL1A 5H9SA 5L36A 1DYPA 3ELNA 5D8AC 4WBBA 4DINB 5CG9A 1AR61 3ILRA 3WG2A 3M3QA 1VBC2 4HSLA 3USUA 4ZU4A 1Q56A 1N1YA 2I74A 4K9SA 2BPA2 3ECQA 1WLTA 3BODA 1H30A 3P3PA 4SLIA 1PK6A 3PNAA 3LOBA 1LODA 1VLNA 3JB8A 4YFWA 1J3PA 1H8VA 2XLAA 1QJU3 3QLQA 3S7EA 4FVVA 5T54A 1JYIA 4E2GA 4YZ2A 3VBFB 1MS8A 1BQPA 4A7YA 3WQ7A 1RITA 4OI2A 1G9DA 2VNGA 2KXLA 3CEWA 3SNMA 5H9RA 5BNOB 2GMEA 1PO22 3MIFA 3VDDC 4OULA 2VMIA 4GKYA 5CNAA 1QXPA 1CPMA 3N35A 1Q8QA 5KXBA 4NVPA 1W0OA 3B94A 2ZGQA 3W59A 2DWRA 1ZRFA 2D7FA 1ZX5A 4AEJA 1REEA 3ZN4A 2ATFA 4EWDA 2NLRA 3NAPB 4FXKB 2DF7A 3WG4A 2RS52 2GAUA 3FJSA 4FPOB 4ZKTB 5FOJB 2JG8C 1AR73 1PO11 2HWE1 2NYYA 1C1LA 5IT6A 2ZBJA 4MUVA 5KXDA 5JOWA 2ILMA 4QPGB 1R091 2H6CA 2E51A 5DG1A 5ACA2 2ZAHA 1GZCA 1GKBA 4GB31 3VHNA 1HXS1 2DVAA 2QVSB 4N9IA 2RS32 3T2TA 4FPCA 2GH2A 2RR11 3VKOA 4Q4W3 3W9AA 3ZFEC 3M8LA 2UURA 1XE8A 2JJ6A 3ZX7A 4C1XA 3ZSJA 1SBEA 1FATA 2B42B 1ND3A 1YIPA 1JN2P 4GQ7A 5FFOC 1O91A 4K1ZA 4LEJA 4N43B 1COV2 2EVXA 1NA1B 1QQP1 5I0SA 1SCSA 4OUSA 1AYM2 2WWSA 1IKPA 1OOPA 5EWSA 2XKOA 1BBT3 2ES3A 3OYWA 1ZYBA 2VU9A 2ETEA 3QACA 1OQDA 4AQSA 3G6JB 2IXIA 3KT4A 3X29B 4COWA 2WA4A 1NCRA 3VBOA 5BNOC 2R072 3FBMA 2Q30A 2MEV1 1K5MB 3MFAA 4H55A 5K0UA 3RWNA 4WVMA 3WG1A 4XF0A 1PZ8A 1LU2A 5AC91 1XE7A 2B9UA 4Q29A 2D6NA 1QOSA 4C0BA 1RVF2 2QCSB 1DQ6A 4BHPA 3AKSA 3ZYRA 4YW1A 4AQ2A 1HDKA 5CBLA 1C28A 1IS3A 2C0ZA 2N7GA 3NAPC 3LSEA 4XMAA 1CAXA 1CVNA 2UY8A 4EV0A 1FPN2 1D0HA 4Q4X3 5LEJA 5LK7B 1H2MA 3K48A 3KD4A 1U5YA 2Q5TA 1G9FA 3AJZA 1ZVFA 1FOD1 1WMDA 4GIQA 5KXEA 3S6PA 1XYNA 2WINB 5E8AA 3WQ0A 2MPFA 5FQ0A 2A6YA 3NO8A 1QH7A 2WT1A 3HBZA 4K1YA 2PHWA 1TME3 3DL3A 2A6ZA 4B29A 2DURA 1AYN1 1MEC2 3SH3A 4LBKA 4ITCA 4NR1A 1NCQA 3IDBB 2XHKA 1ZNPA 1JTZX 2V73A 4LUKA 3CF6E 4JGYA 4YGCA 3ROUA 3E6CC 1GZWB 5T5OA 2XUMA 4LBJA 3AYEA 4YW5A 2E53A 3U4XA 2B7YA 3V0BA 2RM22 4AFBA 1LOGA 5JSOA 1G9AA 4FOWA 5A3LA 4NPRA 1SCRA 4P9XA 3GZTB 4O9EA 4KNCA 2RS53 4Z82A 2HWD3 4COVA 3SHRA 3VBHC 4AI8A 2DU0A 3AYDA 3LKJA 4AGVA 5C8CA 1CQ9A 1H8TA 3POSA 1AR82 2TEPA 3ZMOA 1RUG1 1KJRA 1J3QA 3NV2A 1NLSA 3JD73 1FV3A 4M3CB 1D4M1 3J8F2 5KWRA 4GH4B 5BNNB 1K5MC 2Z69A 4AFMA 3DKWA 5T5JA 3T1LA 2X5IA 2ZZJA 4DB5A 1X50A 4Y4YA 1I1EA 4J6GA 4X6RB 1KRIA 1U12A 2ZMLA 4LUMA 3SH5A 4C1WA 4LA3A 5FMOS 2HWB3 2R062 2ZGRA 4Q0SA 4UBHA 4CTEA 1SDWA 1TE1B 2NQYA 1I5ZA 4S2GA 4W6YA 3A0NA 1RMU3 4KWKA 4E4DX 1LULA 1MZEA 3B3QE 4X8NA 1VAVA 5J96B 2NP0A 5CADA 3ES1A 3VL9A 2ZHLA 4Y1XA 4BYYA 2XVKA 5D1IA 1VBD1 2VW1A 3MIBA 3JCIA 2CNAA 4FPYA 5FRAA 3VDDA 1G8WA 1DYKA 2VVDA 5FLIA 1ZRRA 1RUJ1 4FOYA 3KCCA 1VBA2 2ZGKA 3N7LA 2YDEA 2RMU2 2O1QA 4QT6A 1NLRA 3ZFFB 1LJ7A 1UZZA 5KHIA 1UKGA 4PJYA 3AZWA 4J1XA 3M7AA 2ET1A 4WZCA 1MACA 4QQOA 4AFAA 1XU1A 2IXHA 2WNEA 1CX4A 2JG8A 2AENA 4I01A 4JGZC 1PHMA 2RS11 2XJQA 3ZYIB 1TMF1 2D3RA 4Z1VA 3WOGA 5KHJA 1BVVA 1ULEA 2PHFA 5J7MA 1IHMA 2DVBA 4YW3A 4YW2A 3USUB 3CJIA 4LNVA 4AW7A 2ZX3A 3IWZA 4TZDA 1AX1A 4FP3A 1PK6B 4GH4C 1QJX2 3M3CA 1U5ZA 1WCKA 1Z7S2 1AR93 2FZ1A 1KS5A 3CLPA 4R4ZA 4GXLA 1H2KA 4KU7A 1V6LA 3WCRA 3S0MA 2ERFA 1RUE2 3N7JA 1H9WA 1RUI3 3KCXA 1LHOA 1OQ1A 4QXKA 3D0JA 3AYAA 1ZZ7A 1CAVB 1WW4A 5IUQA 4HKWA 4AFDA 2XVGA 2QFEA 1Q8SA 4RFT0 4IEQA 2HYKA 2D5HA 4QM9A 3H1WA 5DDJ1 3ATGA 2B5HA 4M0HA 2DYCA 2VPVA 2X53S 4IQPA 1ZZ8A 2GMMA 4MZUA 1N1TA 3M4FA 4LBNA 5I91A 5BNOA 4JVAA 1ZRDA 4S2HA 1JHNA 4K3UA 5HI0A 1RUD2 4AQTA 4L92A 4RQPA 3WW2A 4RGGA 2PHLA 1H2LA 3ZVXA 4BLJA 2XJSA 2QDRA 1YFWA 4XJZA 4GMP1 2R042 2VUAA 2GSYA 1YXWA 4NO4A 1H9PA 1AL0G 3OCPA 2JDZA 1POV1 4XFIA 4R9AA 1QOTA 3IPVA 5I0RA 3J4UH 4IEZA 4XIKA 3N7MA 3AMNA 3IMNA 4I02A 2Q8OA 3B00A 1QJY1 1RUH1 4AI1A 4JRAA 1GLHA 1R1A3 1VRH3 4WVWA 1PK6C 4INDA 2EAAA 1GBGA 1AJOA 3B5LB 2YGMA 3V0AB 3QOPA 3NV1A 2DTYA 1UX6A 3OYWB 2WS91 2WZR1 4N9HA 2RMU3 3E5XA 4YZ1A 1C8M3 4Q4V2 3VBSB 3C3VA 2F4PA 1NCRB 1CN1A 3VBOB 4XYXA 2ZX4A 3AJYA 3L9JT 1S0JA 2QDNA 2PELA 1PMIA 1JUHA 4M3CE 2HWC1 5K0UB 3U11A 4AVAA 2QZ2A 3VBHA 2TNFA 4BWOA 1HRV2 2E7AA 4L9BA 2BWCA 3AKQA 3JBG1 4QQLA 2CL2A 1ENRA 3B02A 3AXEA 1AXKA 4DY5A 1QDCA 4I09A 4Y26A 1ZBA1 4CYDA 3O7OA 1CAXB 4AFCA 3LZZA 1C8M1 2CV6A 1K5MA 2PA7A 2VNOA 1W6NA 4AI2A 1EAH1 3OY8A 2GZWA 3PVOA 4AGRA 1ND2A 1L3JA 2V5YA 4RD7A 4ZU5A 5FQ0B 5E1RA 5J36A 5CU1A 4AGGA 1RUOA 1OI6A 2GC1A 4RL7A 1DQ1A 2DU1A 2YV8A 5J09A 3H0OA 1HRI3 1ULDA 2WSVA 4XZPA 4AHXA 4D3WA 1QXRA 1NCQB 2WQ4A 3PVBB 2ZGLA 4I0BA 3MIHA 4XJ9A 5EXOA 3VLBB 1G86A 1CONA 1MS9A 2ZA9A 1AZDA 4K21A 1V9U1 3V0BB 1W6OA 2A3YA 2UYBA 1KDMA 5FCCA 5C8WA 1YHFA 4LO5B 2O8OA 3MLKA 3ZSEA 4EN7B 3ILFA 4MVTA 3E6DA 5IK7A 3M2MA 2VH9A 1GNHA 1FMD3 3VKNA 1IPKA 2GN3A 1QJU2 2GC2A 4ATFA 1WCDJ 4I0AA 1GZWA 4M3CF 4YGDA 2W08A 5C8CB 1DZQA 1H8TB 1PIV1 4K8FA 3VBSC 2E9QA 2HEWF 3AKTA 1VALA 4XDQA 4XMIA 2XLGA 5C9AA 3TBDA 3VBOC 4SBVA 3BPZA 3T1MA 2PYTA 4H14A 3U10A 3ZXKA 2UY9A 4FTEA 1RUF1 3FC0A 1U5IA 5T5LA 4B7EA 3ZYJB 4JGZA 3CNAA 1HX6A 4A3XA 3RRDA 4B8EA 2ZAAA 5FREA 1BZWA 3ME2A 3HR9A 1A3KA 1WGPA 1AL23 3M70A 3V65A 1NYWA 2JXAA 3THPA 1H0BA 2RR12 3UK9A 1HKDA 2VNRA 5CB7A 2QJVA 3AP7A 5IK4A 1VB4A 3HMYA 4M3CA 2H0BA 4JC1A 1V6JA 4XJ8A 1BMV1 3OD0A 1VBB1 1GFF2 3URFA 1AR72 1ONAA 2VGDA 3ZIWA 2DUPA 4KWLA 4AVCA 2ENRA 4YM2A 3B9IA 3RMYA 3TN91 5B2GB 1YRZA 2LTNA 3VBRC 3VHPA 4YG0A 2JECA 2G9GA 4AVSA 1MS4A 1PVC1 2JEMA 3VDDB 3HT1A 4CZSA 4XHXA 1NCQC 4DY3A 1AUYA 5GZEA 1ULGA 2HKXA 2GDFA 1DF0A 3EQEA 3OGJA 5KBFA 2P3JA 4H7LA 3E5UA 3RDIA 1YUDA 1S0GA 5DZEA 3WINE 3AB0A 1W0PA 4C90A 4MYEA 1S0DA 2ZOEB 1AR63 1BBT2 1CIWA 1UKRA 3VZKA 1QXJA 2OUJA 2VW2A 3WT3A 3MYXA 2Z5WA 4QU2A 3LA2A 2WLPA 3IDEA 3KGLA 3LA3A 4A7KA 4KL1A 1C3HA 2ZX1A 4MLOA 3CJIB 2IXLA 1NXD1 3RNSA 2XPJA 1LB2A 1OKQA 1CPNA 4FTSA 4ORFA 3WDWA 2CGNA 5GLVA 4E9KA 1HIXA 2VXRA 1QNYA 1SFNA 1GR3A 4DXZA 1BEV1 4CDUC 2ZGNA 5IK5A 1DQ4A 5GLZA 3DF0A 1FNZA 2ET7A 2WNUC 5FPXA 4F8AA 3MICA 4MXVA 5GZDA 3NVCA 3O5SA 3ZDSA 2NM1A 4UW5A 5L7OA 2XGXA 2JX9A 3D0SA 3J26N 2ZZQA 4Q4X2 4XF3A 2A7AA 4LHLA 1APNA 1SBFA 3FLPA 3FFZA 3ZXDA 1PM7A 1LOFC 2YMZA 1TME2 1TEIA 2SLIA 2Y0OA 5FO7B 2NPIA 1PNGA 2WFF1 1CAVA 1PO13 2Y0IA 2HWE3 1NG0A 3I7DA 3UJQA 1C1FA 4ZU7A 1GNZA 1FXZA 4YG3A 4RQPB 1R093 5CFDB 1LR5A 3EO6A 5JPNB 3APBA 1I9RA 4YARA 5AFEA 5JI9A 1XYOA 4RHV1 2HEYF 4GB33 4LTAA 1HXS3 2MNGA 1UW8A 2PLV1 3MW2A 1S0FA 1J58A 2AYHA 2I2SA 2RR13 1QOOA 4MSVA 4F83A 2P3KA 1MS3A 3WW4A 1ALYA 2HWD2 4Z8BA 4FXGB 2ZX2A 5K7PA 3WP6A 3AMMA 3IPVB 4LBQD 1DG6A 4LO7A 2VW0A 1RUC1 3ZIXA 3AP5A 1HV1A 4CEYA 1J59A 2JICA 3ST7A 1QQP3 4COYA 3JD72 1DZRA 4CDQC 1UN1A 2BFUL 3CJIC 1OPMA 3EJKA 2ZCWA 4KU8A 2WNVC 3RMXA 4DFSA 4OHVA 4Y5Z0 4CP0A 1HQNA 3ETQA 3DUIA 4OHWA 3ZO0B 3R6SA 2A5ZA 1NY71 1WCSA 2VQAA 1PZ7A 1TQ5A 1H1AA 1C4RA 2D6OX 4P9WA 1DU3D 2MEV3 4UW3A 4EROA 4PLNA 4HLTA 2UWBA 3GZAA 1NE4A 4MGIE 2HWB2 3GBWA 3KZ4C 5AC93 1NXMA 4PCRA 4LLFA 5EYYA 5JDBA 4RR3A 4FAHA 2KA3A 2NMOA 3BCWA 4OUMA 3VBHB 1PGW1 3V0AA 2PHDA 3RYPA 1RMU2 3O12A 1F5JA 4P5HA 2GH8A 3VBSA 4HZFA 4RA0A 5T55A 1Z78A 3VHRA 1V00A 5GZCA 3UV9A 1XQNA 2I07B 2R49A 1EY2A 4P9JA 4EWAA 4FPFA 1FOD3 3RYKA 4JCKA 3GNEA 4KBBA 4QGLA 5HCFA 5JPMB 1W6NB 4YM1A 2I45A 4RQPC 4PF5A 3OY8B 4YNIA 5CFDC 1AYN3 3MPPG 1JYCA 1ND2B 1VBE1 4AQ6A 4BMBA 2UWAA 5F1RA 5FTTC 2GNTA 3FE5A 3HN1A 3RSJA 1VB2A 1RHI1 2D6MA 4COZA 1V6IA 4CRQA 5BV6A 2ZKNA 2CAVA 1Q8OA 4LO8A 3QH7A 3VKLA 4QQHA 1O3QA 1ULCA 1BYHA 3AM2A 3O14A 4HKOA 4NHLA 4XFCA 4Z92B 1LHUA 4XIOA 3AZXA 3DN7A 3WDVA 2XJVA 2NN8A 2XBO1 1W6OB 3BIWE 3VBRA 1QU0A 3IN9A 5CG8A 2QQPA 4EN6B 1V6MA 1ZBE1 5DDJ2 4Q0QA 2BUKA 1EP0A 1B09A 4EWEA 1Q8PA 5K8SA 1AR92 4BMEA 1PGSA 1OLQA 3ZFGC 3WVJA 1WLCA 4N90A 1RUG3 4YRDA 4FAGA 1RUI2 5DZGA 5CFCC 1D4M3 1WUVA 4LLOA 1W39A 1MS5A 1AF9A 3R0RA 3MEPA 4F7ZA 5C9AB 1DQ5A 2XL7A 5AVAA 2E6VA 5I0UA 3IKWA 1A8DA 2YC0A 4QHBA 1A6CA 4JGZB 2XKPA 1UD1A 1ZZCA 3KMHA 1VBC1 3VV1A 2DVFA 1YFUA 1MS1A 1R081 2CAUA 2XJRA 5HCAA 4LO4B 3ES4A 1LEMA 1O3RA 1UIKA 4BIOA 1XNKA 1YYNA 3M1HA 3NKGA 1CR7A 5LK5A 1Z0HA 3WV6A 3ZSMA 3MPBA 1KQRA 1FYUA 1QJY2 3B93A 5AVPA 5JAXA 5ABJC 4E2SA 4CDWC 4CDUA 3WLUA 1BCXA 2E63A 4XBLA 4XXPA 1ND2C 1YCIA 2WNUA 1VBD3 1PO21 4XJAA 5JCTA 2ZGMA 1RUJ3 3N4MA 4L97A 3AMQA 4PLMA 4HVQA 2VULA 2VMHA 2WLQA 2K2SA 2RJLA 2D44A 4Q8KA 4YM3A 1UPIA 2E7QA 3AZYA 4JRLA 1PVXA 1F8VA 3ZXEA 4I3PA 1W6PA 3MI8A 1LOFA 1KDKA 4FT8A 5T3NA 4J1WA 1WA4A 3JBG2 1R1A2 1VRH2 2RS13 1TMF3 1IS5A 1UU4A 2CWSA 1F31A 4XHBA 1DGWX 4R8HA 4HVOA 2OYZA 5EV7A 1C8M2 2P3IA 5ACA1 3I2DA 3H8UA 5JZGB 3POWA 3S7IA 2AGSA 5C9AC 2RS31 4UW4A 1KJLA 1UAIA 1IKQA 1MQTB 3OBRA 1LOBA 1PZ9A 4JQRA 5E89A 3IDCB 3LCPA 4IEYA 4OHZA 2ZS6B 3FMGA 5HCBA 2ZHKA 3VHOA 1SLTA 4WM7C 4CDQA 4YVSB 2CTVA 1AYM1 4RS5A 5FBZA 3FX3A 3MIGA 5L7OB 2WNVA 5DDJ3 4BA6A 1LENA 1O4ZA 1CAWA 3AK0A 5HBAA 4URTA 2DFBA 5L73A 4BPZA 1S2KA 1X36A 3ALQA 4YGBA 1Q5OA 1A8MA 2OPKA 2X8KA 4PLOA 4ZXKA 2PN5A 3BOWA 4YZ4A 2R071 4XQ4A 4IEOA 3TYJA 2XB6C 4XFHA 1KFUL 1LOAA 2R1DA 3ZSKA 1GICA 1HRI2 3PLQA 2GC3A 4IEVA 3WX5A 3GALA 4YLZA 2E7TA 4L11A 4X6QB 1G7YA 1RVF1 3E5QA 4GMP3 3I54A 1WBLA 1YWKA 4IEWA 4IXLA 5FLHA 2HWF1 5JI7A 1REFA 1V6KA 1J3RA 1XXNA 1RUF2 4ES8A 4AVTA 1I3HA 4I0WB 1POV3 5KC6A 2XG3A 1FPN1 1NOVA 1FMD2 1DQ0A 4Q0PA 4LBOA 1N1SA 3GBFA 2NZ9A 3N7KA 2R0FA 5BYNA 3WUCA 5LRSA 1QJY3 1RUH3 4YVWB 5CFDA 4CEYB 2ZACA 1MEC1 4I30A 2VMGA 2VY0A 4WVVA 4B4QA 3TOJA 3ZN5A 5C33A 2HJIA 4B3NA 5JZGC 3GBGA 3I4IA 4GMP0 1S0IA 1JBCA 4W65A 1QKQA 4HFSA 2XJUA 1MQTC 2WS93 2WZR3 1DBNA 1V6NA 2RM21 1UPSA 5E16A 4KH9A 4MH0E 4AEKA 1POV0 1AL22 2ZHMA 1EV11 3UJOA 2B39A 2BGCA 5JLVA 4KQ7A 4ONUA 3SCHA 1DGRA 1SLBA 2ZJCA 1RB8G 1SEFA 4L99A 2D98A 5FAXA 2HWC3 4XQDA 4YVSC 4IERA 1Q8VA 4YG6A 3MZHA 1ZZBA 5SV5A 4N53A 5L7OC 3JBG3 4DQAA 4ATEA 2ZPXA 4RR3B 4DMIA 3IIAA 4FCAA 3ZFGA 4C91A 4Q8LA 1AR81 1XNCA 3WDTA 2PHXA 1ZBA3 5JOXA 2BBVA 3KM5A 3D4KA 1HLCA 5CFCA 2W39A 3J8F1 4OVEA 2BNNA 2Y26A 4Y1ZA 4FQ4A 1W6MB 4AHYA 1ZZ9A 2OA2A 1PGL2 1EAH3 5EYXA 4FP2A 4R9DA 1DHKB 5JIAA 1RUNA 4YGEA 2P34A 3OD4A 3WD5A 1VJ2A 3M3OA 1SLIA 4LBMA 3MIEA 2D97A 4QQPA 4D7SA 1I6XA 1Y3TA 5I0TA 1XYPA 2R061 1KS4A 1V70A 4HVRA 3H7YA 2PAKA 5CA6A 4FSJA 1BVP1 3OPZA 4AYUA 3C2UA 2YY1A 1V9U3 2DCYA 1AR62 1ZM1A 2PFWA 5KC5A 1LCLA 4OHXA 4WM8A 4Y1UA 2D6PA 5ABJA 1J1LA 4BLIA 4CDWA 4XQWA 4YVWC 2P37A 4YZ3A 4CEYC 5JIUA 5FMOL 3PJYA 3VBRB 2P2KA 1SBDA 1LECA 3VZJA 4FQZA 4LR4A 2XWBB 3WHUA 1VBA1 4OI0A 4PIYA 4E27A 3FLTA 5DUWA 4R52A 1XNDA 3RJRA 1PIV3 2WKKA 4ES9A 2C5DA 1ZZ6A 3KB5A 4Q0VA 1N3PA 3QBQA 1VIWB 1XU2A 1YLLA 1RUF3 2WT2A 2JE9A 5A32A 3GHNA 4RHV2 4RR3C 2CY6A 2BFUS 4D69A 4BH9A 5GZFA 1LTEA 4LBLA 4B4PA 4FPLA 2WT0A 4I2OA 1YNAA 1OA2A 4D7YA 4I3GA 1QJX1 5F6KA 1Z7S1 3WP3A 1VBB3 3B69A 3OF1A 3FFQA 1PO12 2HWE2 3RPQA 4XTMA 2EXIA 4Y22B 3TN93 2EXKA 4GKXA 4HPKA 4QX5A 1DGLA 1R092 5I8SA 1GQGA 5SV8A 1XRUA 4CDUB 2WNUB 4GB32 1PVC3 1HXS2 4EN8B 4XEZA 5C4WA 2IC1A 4WM7A 4AHZA 4FPJA 2WL1A 5C6CA 5DZFA 3H3UA 3I59B 1SLCA 4XE9A 4CDXC 2C1FA 3E6BA 4HETA 3WR0A 1YO8A 4OI4A 3SH4A 1OMIA 1JUIA 2JG9A 4DOUA 4KWJA 4JV4A 5FO8B 2PAMA 2ZGOA 3FUOA 1QQP2 1W6PB 3JZVA 1CD3G 5DG2A 1LHWA 5EFUA 1ZREA 1RUD1 5HXVA 1ASJ3 2AUYA 3OJBA 2XLFA 1H2NA 4GALA 2EXJA 1VAMA 2GALA 3SCGA 2DCKA 2UU8A 4A2UA 1BK1A 5GLUA 2R041 3P3NA 3NV4A 1AX2A 1FAYA 4OZXA 3N36A 2GU9A 3B9CA 2JD4A 5J98B 1Y43B 2MEV2 1ENQA 3JB4C 4Q1RA 2Z42A 1RC6A 1LKNA 1V6OA 1REDA 4HL0A 4HBNA 1UIJA 5AC92 3WP4A 1MZ5A 3AX4A 1W2UA 1BEV3 4G9SB 4PDWB 1HQWA 1A78A 3WG3A 5FDBA 1KD7A 5J37A 1ULFA 2WFPA 1ASJ1 3JQXA 5J3UA 4LT5A 3JUUA 1HV0A 4Q1PA 3KS7A 1IS4A 4DZGA 4Z2WA 4Q4Y1 3H1MA 4W6XA 4YW4A 3NWKA 4GWNA 2AREA 5JZGA 3H7JA 4FPHA 4CDQB 4RS5B 4KGQA 4YFZA 1FOD2 2LM3A 2WNVB 5DUUA 3WHTA 4M00A 1G9BA 1UF2C 1MQTA 3INAA 1CAWB 5JSRA 3WNXA 3DPRC 4K7JA 4A7ZA 4Q4V1 3M3IA 5BUVA 4WZFA 1AYN2 1WW7A 2BVVA 3WW3A 3MFCA 1NQJA 4PBOA 4IEUA 2D93A 2WFF3 2DTWA 1MS0A 5H9QA 3I8TA 1F9KA 1RGSA 3IBMA 1MVQA 4WV8A 4YVSA 3SXWA 4FOQA 3VBUB 5FLJA 4LA2A 2A71A 1HRV1 4AXOA 1YFXA 1SMVA 1TNFA 3AZZA 1DDLA 4JTNA 2DUOA 4N7UA 4IEPA 2VVFA 4FPKA 4RHV3 1DQ2A 2F6BA 5JSPA 2IFWA 2PLV3 1YFYA 3WDYA 5T50A 4AEDC 4KG8A 5DUXA 2R32A 5BNPC 2VVEA 1CJPA 1RIRA 4CEWC 4Q26A 3GHMA 2EIGA 2Y38A 4DS0A 1R082 1YI9A 3WZ1A 1QNWA 1RUC3 3K51A 4JAAA 4Y20A 2TBVA 1LGNA 1RUG2 4AEMA 2BWAA 5GZGA 2DVDA 4AI3A 4UW6A 1DIWA 1QGLA 1D4M2 2DUQA 5KXCA 3FBYA 2XVLA 4HMZA 2BW8A 4F3JA 1G6NA 4LBQA 2ARBA 2CGPA 4XFFA 2A6VA 3ZN6A 3LGRA 2DFCA 2ZGUA 3FWEA 1OLRA 5JOYA 4P9IA 4PDWC 3UKNA 1HQLA 2ZABA 3FZ3A 3JQWA 3TAYA 3PJQA 5FO9B 1BKZA 2VOKA 4NHMA 4P9LA 3OGGA 3R4DB 4YVWA 3IM0A 2XL9A 1N1VA 3TRSB 1WD4A 3RS6A 1O3TA 1QJU1 4RS5C 2QKDA 4N53B 5BXXA 3TWIA 3VKMA 3WW1A 2CWMA 4K6BA 3HIFA 3ZFGB 5GLWA 4HN1A 1C8NA 2VG9A 1VBD2 1QHDA 2R1BA 1D2QA 1W6QA 3QD6A 3WY6A 5CFCB 3S30A 1RUJ2 4UBGA 1OFSA 1OHFA 4K20A 2RHPA 3VBUC 1EPZA 2VUJA 5GJ6A 4OFGA 1VBE3 3B7MA 1IQAA 3PMEA 1WMFA 5T52A 2AR6A 2WIIB 1RHI3 4Q2FA 3FUQA 4XILA 4EJRA 4XBQA 1GANA 1AX0A 1UZYA 3ZMNA 1LGBA 2WQZC 4MV2A 3RI9A 4DPNA 2RS12 1AR71 3LOIA 1TMF2 1W6MA 2OUHA 4QPIA 3RG0A 5BY5A 3HWJA 2XBO3 1Q3EA 4S2FA 2C9AA 4WM8B 4Q27A 5ABJB 4CDWB 4FTBA 1ZBE3 2FQPA 3L2HA 2GNMA 1QY4A 3KGZA 3VBFC 2OVUA 3AXDA 2FBEA 2O8QA 3CU7A 3OTFA 2TUNA 1AJKA 4Q4W1 3QCWA 1OD5A 4CDXA 4XJWA 4TLFA 3H9AA 4XW3A