1GLHA

Cation binding to a bacillus (1,3-1,4)-beta-glucanase. geometry, affinity and effect on protein stability
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
214
structure length
214
Chain Sequence
b'QTGGSFFEPFNSYNSGTWEKADGYSNGGVFNCTWRANNVNFTNDGKLKLGLTSSAYNKFDCAEYRSTNIYGYGLYEVSMKPAKNTGIVSSFFTYTGPAHGTQWDEIDIEFLGKDTTKVQFNYYTNGVGGHEKVISLGFDASKGFHTYAFDWQPGYIKWYVDGVLKHTATANIPSTPGKIMMNLWNGTGVDDWLGSYNGANPLYAEYDWVKYTSN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1,3-1,4-BETA-GLUCANASE
publication title Cation binding to a Bacillus (1,3-1,4)-beta-glucanase. Geometry, affinity and effect on protein stability
pubmed doi rcsb
source organism Synthetic construct
molecule tags Hydrolase
total genus 51
structure length 214
sequence length 214
ec nomenclature ec 3.2.1.73: Licheninase.
pdb deposition date 1994-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1glhA00
1GV9A 4PQ9A 3B00A 2ZGPA 2ZHMA 2CY6A 4U36A 4DFSA 3M2MA 3QCWA 5E8AA 2W68A 5GLTA 3SH4A 2ZAAA 4R9AA 3WVJA 3ZXFA 3O12A 1BXHA 2VUAA 3B01A 3FFZA 3QLQA 4Q2FA 3WCSA 1G7YA 1QU0A 4XIKA 1IS6A 1BKZA 2ZMNA 3ZYRA 2GN7A 1AXKA 2JE9A 1V6JA 2R49A 4OZXA 2EAKA 1MR5A 3AP9A 2FHRA 2WSVA 2UWBA 4DRRA 4YG0A 1RITA 4YFZA 1ULEA 4YW1A 2H0BA 3FLTA 1I3HA 3ENRA 4YZ2A 1LOFA 5IK5A 3OYWB 5IT6A 3OPZA 2VW1A 3POSA 1MVQA 1OFSA 5FRAA 4M3CF 3WDWA 4GWMA 2YMZA 5F5QA 1SLCA 1V6LA 1LOCA 1GZ9A 1YRZA 2AENA 2E7TA 2ZBJA 3M1HA 4XJAA 3T1MA 2P34A 4FVVA 4F83A 1RIRA 1FX5A 2GNTA 5JVVA 1C57A 1LOGA 1LOBA 1QDCA 1W6PA 2UURA 4C1XA 4XILA 1SBEA 1LTEA 2P3KA 2BQPA 1V6OA 2A6YA 3AYAA 2ARXA 3BOPA 3GNEA 4YZ4A 3DUIA 1TEIA 1YI7A 1VAVA 2GDFA 1QMJA 5SV8A 3FUQA 5KXEA 1D0HA 3WHUA 2GMEA 2OUJA 2EIGA 1MS0A 1B09A 1GYKA 2ZGUA 4RL7A 4FQZA 5HCBA 3ZSJA 5CB7A 1CPMA 4I30A 5GLZA 1UL9A 5IK8A 3V65A 2A75A 4YM2A 1Y7BA 2ZZJA 1KJRA 1SLBA 3A0KA 5EXOA 1LHVA 4LBQB 3SH3A 1N3PA 1HDKA 3O0VA 4FPJA 4P14A 5DUXA 1LU1A 3SISA 3C2UA 1W6MA 4PF5A 2CWSA 2CYFA 3TAYA 4Y1XA 3AZWA 1GSLA 1W6NA 3V0AA 4Q1PA 4FPYA 3WG2A 1W0PA 1OQ1A 1AX1A 1J1TA 4FPLA 5JMCA 2R16A 4D69A 4P9XA 1Q56A 4Q27A 2PHXA 5KXBA 3IPVA 4W65A 2YROA 1ZM1A 2PHTA 4XJ9A 1U0AA 2D3PA 1H9PA 3WZ1A 1HLCA 2DTWA 2GMPA 3ILNA 2JDZA 4BMBA 1VALA 2ZGSA 4XHBA 1DGLA 2EXIA 2P37A 3IKWA 1Q8QA 1SLTA 4AWDA 1KRIA 4LBQD 1DYPA 1F5FA 4YGDA 1BQPA 3WHTA 1A78A 3VKOA 1LEMA 1WW6A 1JXNA 3AP7A 3OBRA 3M3EA 5E88A 4XBLA 1G9DA 1Q8SA 1PZ8A 1MACA 1Q8OA 1W6OA 2ZKNA 1QF3A 2PHWA 1SBFA 1S0EA 1KDKA 2VU9A 4XBNA 1AJKA 5DG2A 4XZPA 4Y1UA 1MS4A 2ZGNA 3M3QA 1ULCA 4Q1RA 4AGGA 1BYHA 1ULDA 4K20A 2SBAA 2WT1A 5T5OA 2JKBA 2D43A 3RQ0A 2DVDA 3AXDA 4M01A 3ZSLA 1DQ6A 2ERFA 2EXJA 3B69A 2GN3A 3APBA 5LK5A 2A3XA 3AK0A 4AGRA 2HYKA 1DYKA 1N1SA 2UWAA 4LBLA 3ZXKA 2UU8A 2WLQA 1DLLA 1W0OA 4YW5A 4FQ4A 4PBOA 1ENSA 4XOGA 1V6MA 3N36A 1GICA 4R9DA 1WLCA 3PVNA 3WUCA 3ATGA 1F9KA 1G8WA 1G9AA 1V6KA 5F9TA 2ZABA 1IS4A 2DVFA 3NV4A 4PCRA 1LOFC 4XXAA 4NO4A 5T50A 5GJ6A 3OBTA 1JW6A 1ONAA 2ES3A 4GKXA 1V00A 4YW2A 1EPWA 2D3SA 5JOYA 1QNWA 1AX0A 3OGGA 2D6OX 4YM1A 1H9WA 1SFYA 2ZGLA 1CPNA 2D6NA 4K1YA 5CNAA 1CIWA 3WNXA 1KQRA 4WV8A 1ENRA 4WZFA 2VW0A 1D2SA 2DUQA 3VKLA 1C4RA 3AYCA 5IUQA 1QDOA 2AREA 2JE7A 4DPNA 1ULGA 1W6PB 3AX4A 4FPHA 5GALA 5GZEA 3KM5A 2ZGOA 5EWSA 2RHPA 1SCRA 4DS0A 1DZQA 3FUOA 3NWKA 3HN1A 4XJZA 4YW4A 4XTPA 1IKPA 1UPSA 2KM2A 4BOWA 1HKDA 1S0GA 4U2AA 1IKQA 3MEPA 3ZVXA 3WDXA 2B7YA 1LOEA 3JUUA 3R4SA 3T2TA 4YGEA 2JD4A 1QGLA 5DXDA 1OKQA 3B9CA 3FBYA 3VKMA 1MS1A 2WT2A 2ZHNA 3D5OA 3BIWE 4FOQA 4GA9A 4KBBA 3UK9A 4WVVA 2DVGA 1GZWA 4YM3A 2EXHA 1MZ6A 2A6ZA 3MW2A 4UW4A 4YW3A 5KXDA 1GBGA 3V0BA 2D7FA 2AR6A 3USUA 1GZCA 1WUVA 3AZYA 2DVBA 5DUWA 3AJYA 4XJUA 2P2KA 3W58A 3WDTA 2A5ZA 1MS5A 1DBNA 2D6KA 1W6MB 1Q8VA 2NMNA 4FPGA 1KITA 1MVEA 2ENRA 2P3JA 4BLIA 1W6NB 3V0AB 4P9YA 3O0WA 1HQLA 1CJPA 3UL2A 5KXCA 1Q8PA 2OUHA 1APNA 2R1BA 2W39A 1HQWA 4JCKA 4YLZA 3IPVB 1WD3A 4Y1VA 1LGCA 5T52A 3SLIA 3OJBA 3OY8A 5GLUA 4GALA 1WBLA 4Y24A 2A70A 3ZPYA 4XXPA 1G9BA 3LSDA 1FV2A 1QNYA 1UAIA 3R4UA 4YG3A 1LECA 1N1TA 5IK4A 5DUVA 3WG3A 4LBNA 2DURA 4MYEA 5H9SA 2E7QA 3AYEA 4BMEA 2NN8A 1SLLA 5T55A 1BJQA 4AYUA 1FYUA 4HANA 5GLWA 2YZ4A 2R0FA 1LGBA 2NMOA 1JYCA 4GWNA 4CRQA 2JECA 2D6PA 1LEDA 1W6OB 3WG1A 1NLSA 2TEPA 3DGTA 2VH9A 4ISQA 3FLRA 4XIOA 1A3KA 1AXZA 5T5PA 1WW5A 2WNEA 2GNBA 2R0HA 5CA6A 1H30A 2D6LX 2WT0A 3N7JA 4JC1A 1QOSA 5T54A 1QOTA 3HR9A 4M3CA 3N7LA 3N35A 1DQ1A 2ZA9A 4TYSA 5DZGA 4FOVA 1UN1A 1DQ5A 1LHUA 2DUPA 1GLHA 2VW2A 1WW4A 2CL2A 2NYYA 3H0OA 4LBMA 3ZSMA 4DQAA 3AZXA 5JDBA 1O4YA 4UW6A 5H9RA 2A6WA 1KJLA 5JOXA 1SLIA 2D44A 1RINA 2A71A 3Q9OA 1W6QA 3AJZA 3AP4A 2ZGKA 4BM8A 4XJWA 3SITA 5CAZA 1CQ9A 1QKQA 3D4KA 3N3HA 1URXA 1NXD1 4NOTA 3RG0A 3WLUA 3IM0A 4FPOB 3BTAA 4FPCA 3RRDA 3WDUA 3ZSKA 4M00A 1CN1A 1MS9A 4AVSA 2WJSA 4YGBA 2W08A 1AJOA 4XE9A 4Y20A 3SNMA 1CR7A 5T5LA 3L2YA 3AZZA 3POYA 1DQ0A 1UZYA 1UX6A 1DFQA 1O4ZA 2YV8A 5DZFA 1AXYA 2ZHLA 2WQZC 4FOYA 2V5YA 5JOZA 1GKBA 3ILFA 2C9AA 4Z8BA 2FMDA 3N7KA 1WBFA 3W59A 1CONA 5HCAA 2WKKA 1DHKB 4LBJA 3ILRA 1UMZA 1YXWA 1G86A 2Q5TA 3T1LA 1SACA 2DWRA 3NV2A 3WUDA 1X50A 4YG6A 2DV9A 4M3CE 3FLPA 2OVUA 4Y22A 3VUOA 2XG3A 4SLIA 5T5JA 4P9WA 2PELA 2NP0A 2AH2A 1R1ZA 5H9QA 4LBOA 1AVBA 3RMXA 5JOWA 4LBKA 1V6NA 1CESA 1YIFA 4WVWA 2I2SA 4XDQA 4DRVA 1N3OA 1G9FA 2C5DA 3MW3A 2CWMA 4FPFA 3AFKA 1GZWB 4PBPA 4Y1ZA 2ZMLA 5EYYA 1WCSA 5AVAA 2DU1A 4FPEA 2E53A 3V0BB 4ZKTB 1LOAA 2OW4A 2VY0A 4ATEA 3USUB 1LODA 2AGSA 3M3CA 4AVVA 1S0JA 1AX2A 4XHXA 4CZSA 3VKNA 5JLVA 1I1EA 3RSJA 1YO8A 1DQ4A 2R1DA 3U4XA 3IN9A 1LENA 3ZXEA 1JBCA 1SLAA 2ZGQA 3WCRA 3HMYA 1S0DA 1MS8A 4YM0A 1UZZA 4ZXKA 1IS3A 1KDMA 4K1ZA 4GKYA 1AF9A 4L8QA 5H9PA 4AGVA 1WW7A 4BQ1A 3ZXJA 2D3RA 2WSUA 3PMEA 1C1LA 4K21A 3RS6A 1FNZA 3BODA 1S0CA 3OY8B 1Z0HA 1DQ2A 4Q8KA 2DU0A 1PZ9A 1C1FA 1N1YA 1S0FA 4R9CA 4YFWA 3OYWA 1VLNA 2EALA 2EXKA 1FV3A 3NV3A 5IK7A 1BZWA 1S0BA 2UWCA 2A3YA 3O5SA 1LHOA 2GNMA 2XB6C 2ZMKA 3JU9A 4RA0A 4ATFA 5EYXA 3WOGA 4YZ1A 1LCLA 1MZ5A 1SCSA 4YZ5A 2CTVA 1JOJA 1AZDA 1LESA 4Y26A 1LJ7A 1VAMA 1YYNA 4ISRA 5HCFA 2JJ6A 1V6IA 4JRAA 5BYNA 3D6EA 1SBDA 2D6MA 2PHUA 1DIWA 1LGNA 2GNDA 4CTEA 4ITCA 3UJOA 2ZHKA 3O0XA 1GANA 4H55A 4XMAA 5DZEA 2G4IA 3LCPA 1A8DA 4FP2A 1MS3A 3RMYA 3V64A 1FATA 2GALA 3VV1A 5CBLA 1G9CA 4FP3A 1WD4A 3M3OA 1JYIA 4M3CB 3ZYPA 5E89A 2V73A 4GXLA 3MW4A 1WLDA 1Z78A 3A4UA 1N3QA 2NM1A 2P3IA 3LSEA 5GLVA 3WDYA 4C1WA 3B3QE 5L73A 5FREA 1PZ7A 3VKFC 2A6VA 4XYXA 1S1AA 4ASMB 5GZFA 1UKGA 2DYCA 3N7MA 4Q26A 1ZA4A 2YXSA 2ZGRA 4IQPA 2ARBA 1W6QB 1IS5A 2LALA 2DTYA 5GZDA 2PHFA 2ZACA 3POWA 4LBQA 1N1VA 2Z42A 4R9BA 2LTNA 2A6XA 4FOWA 5GZGA 5DG1A 3KQRA 2DVAA 3SH5A 1IOAA 2AYHA 5DUUA 1CVNA 4UW5A 1XQNA 1GNHA 3IMNA 1VIWB 4Y20B 1FNYA 4XTMA 3PJQA 4BPZA 1FAYA 3AYDA 4TZDA 4YZ3A 3WG4A 3PVEA 2E6VA 1GNZA 2EF6A 3ZXLA 4XBQA 4XMIA 1WLWA 3GALA 3WV6A 2DUOA 3AP6A 1JN2P 4FPKA 2SLIA 4UW3A 4Y1YA 5GZCA 2ZGTA 3NV1A 3UJQA 2NZ9A 3AXEA 1N47A 1LULA 3I4IA 3R05A 4AVTA 1JUIA 3AP5A 3A0NA 3PVOA 1QOOA 2PHRA 3INAA 1F31A 1S0IA 2A7AA 2W52A 3WDVA 2E51A 4Y22B 2A3WA 4YGCA 1LHNA 3MPPG 4Q8LA 4HL0A 1LU2A 1ENQA 2AUYA 2YY1A 3CNAA 5GM0A 1JHNA 1ULFA 2ZGMA 3ASIA 3I8TA 1LHWA 2CNAA 2VXRA 3AZVA 4XJ8A 3TB0A 4BLJA 2GMMA
chains in the Genus database with same CATH superfamily
5C8WA 1GV9A 2BFUL 4CDUB 4PQ9A 4W6WA 1U5XA 3AM2A 2UYAA 1PM4A 2R071 1OA4A 3D3AA 1V9U3 3FHAA 3NNMA 3SH4A 3VDCA 3WVJA 1P8JA 5F37A 3ZFFC 3QLQA 3WCSA 3J9SA 1IS6A 4GJZA 3LA7A 2AACA 4RR3C 2WINB 1OD3A 1SEFA 3ZYRA 5A6QA 2Q1MA 3SCHA 1JU3A 1R083 3WT3A 5E16A 4COWA 1XC6A 2EAKA 2JEMA 1HXS2 3WF2A 4AEDB 3I2HA 1EUUA 1RUJ3 1ULEA 4Q0QA 4YW1A 3WF0A 1AR91 4XFCA 3ENRA 4IV3C 5F6LB 1DG6A 1JYNA 5FOBB 5IK5A 4ZXEA 1GFF2 1QJX2 4CU7A 2OIIA 2VECA 2VW1A 3O1UA 3RJRA 2QQVA 3POSA 1ZBE1 1MVQA 1OFSA 4M3CF 4UAPA 4NIGA 1YC61 1RL3A 1AYN3 1BK1A 1NKGA 2YFUA 4YARA 1LOCA 1OLQA 5E6HA 1YRZA 1YWKA 3ZFGA 3EBRA 5HV0A 3S7IA 1I5PA 2P34A 3JQWA 3KCCA 3KZ4C 4XUNA 5LEJA 1UF2C 4B29A 4NRQA 3H42B 1J3QA 3TN91 1LOGA 2CU5A 3DF0A 2JG9A 4DIQA 2Q1FA 1EY2A 4QX3A 5JSOA 4FFFA 5DABA 3PUHA 5A70A 1LTEA 4HG6B 2P3KA 3I2KA 4IE0A 2BQPA 1UYZA 4OI1A 3NNGA 3AYAA 4UFKA 2L9LA 2VGDA 4AE2A 2JB8A 3T2OA 4LEJA 1YI7A 1VAVA 2GDFA 3CKHA 1QMJA 3JBG2 3EXUA 3FUQA 3CHXA 3UKVA 3RZKA 5C6CA 1EAH2 4CCLA 4BJ0A 1FPN3 1W0NA 1POV3 4UF0B 1B09A 3URFA 3CJXA 2GC3A 3ME2A 1BBT1 2WO2A 1GYKA 4HSLA 5A7WB 5AC93 4RL7A 4OUMA 5CB7A 4YYOA 3TWIA 2BGPA 5GLZA 1UL9A 3ZYJB 3JQXA 2A75A 4NMIA 5FY4A 3V65A 1AL22 1SLBA 2YG0A 1VRH1 4MXWB 2F17A 5LWBA 1AR71 3SH3A 1N3PA 4FPJA 1PIV3 3MHZA 3C2UA 3SISA 2CWSA 2CYFA 3VZOA 4CP1A 3AZWA 1W6NA 4Q1PA 4FCAA 2ET7A 4QU2A 4TWTA 3VBFC 1OQ1A 1Q56A 4DXRA 1HB2A 4WVMB 3PVBB 3KV5A 1JYXA 2WFF2 2XMLA 4FXGB 4GMP1 1ZZ6A 1AR63 3WZ1A 4RS5B 4X8NA 3U75A 1VALA 2ZGSA 2EXIA 4HKWA 3AL6A 1CAUB 4FTEA 3PUSA 4AQTA 3OEBA 3S7EA 2E33A 4KMQA 4XFGA 4YGDA 5FZMA 1OI6A 1BQPA 1S55A 2ID4A 1YI9A 2W1WA 1PK6A 5JIAA 4I3GA 4QX2A 3WHTA 4NAOA 2HWF3 5C3SA 3BUCA 1ZZ9A 5FO7B 3VBUA 1NLRA 1JZ2A 3N4MA 2ZKNA 2RDNA 3GBFA 1CX4A 1GUIA 1VE0A 4KU7A 4KNCA 3T0AA 1EYBA 1KDKA 4XBNA 4KG8A 4GZ9A 5LY2A 4NIDA 5FZ8A 4QM9A 1ZBA2 3RWKX 2ZGNA 4A6OA 4Q4X2 2DFCA 2WNVA 3J8F1 4K20A 4BQYA 3KV4A 5FTTC 5HXMA 5K4LA 3JZVA 4NAMA 3MV11 1TMF2 1KXGA 4HKLA 2ERFA 4XF3A 2VAUA 4X6QB 2GN3A 3H9AA 1W9YA 2VZVA 1DGRA 2WA3A 5A3LA 1YFXA 4JGYA 4CCDA 1JZ7A 5KBFA 2ZPXA 4XOGA 3DN7A 4QDQA 2VQ0A 3N36A 3NW4A 3IMMA 1WLCA 4R9DA 5ACA3 3PVNA 4CCNA 2YC2A 4AG4A 4ONUA 3VBSA 3ZMOA 3BCWA 2VOKA 1GR3A 2XLGA 3OBTA 1JW6A 4GB33 3VBHC 4UFLA 4FAHA 3LA3A 2D3SA 1DGWX 1IZ3A 5L19A 3A22A 1ND3C 1BK0A 1XJAA 4Q4Y2 5LB6A 5FXWA 4AFAA 3HAGA 1MEC3 4B1MA 5CU1A 2QQLA 3VBRB 3WEZA 3PUQA 4DPNA 2AREA 3Q8FA 4N53B 2JG9C 1W6PB 1H4HA 3AX4A 1ZZBA 4E4HA 5GZEA 2FDGA 5FY5A 5AVPA 5FPBA 1W9SA 2R7EB 1UYXA 4YW4A 4ZU4A 1UPSA 2F4PA 4H14A 2KM2A 2Y60A 4BOWA 5L7OA 4AR2A 5KHJA 3MEPA 1F35A 3GDBA 4GQ7A 3WDXA 2B7YA 3AC0A 3TEWA 3AL5A 3T2TA 1Y4WA 4CEWA 2JD4A 1QGLA 3OG2A 3VD4A 1OKQA 1UMHA 3B9CA 2HWB2 4EWDA 3J4UH 1WA4A 5FY1A 2WT2A 2ORXA 4GA9A 4KBBA 2IXKA 3UK9A 3ELNA 4WVVA 5FYHA 2YYOA 2EXHA 2PLV2 2VZUA 4OMDA 3WP6A 3OGVA 4JGZA 3W9AA 5JXJA 4YW7A 3ZDSA 3V0BA 2D7FA 3AB0A 2BPA2 2R072 1RVF1 3AZYA 5DUWA 4QM8A 4XJUA 1QXJA 3W58A 2W9XA 2A5ZA 3WDTA 1NCQB 4K40A 5FWJA 1DBNA 3PMSA 2WQ8A 1J59A 4FPGA 2E32A 1MZFA 3V0AB 3RI9A 3EJKA 3M3IA 1VBB1 4KU8A 1CIYA 2R1BA 1APNA 1TQ5A 1UY0A 5CKQA 2WDBA 2ZEZA 4K3UA 4CCCA 4JCKA 3IIIA 5JZGA 1X82A 1PMHX 3ST7A 3GJBA 4YRDA 3QH6A 1PMIA 2PAEA 1AR92 3OJBA 3OY8A 3JBG3 1HB1A 1F5JA 5F5CA 5FP8A 5FZ6A 1JZ5A 1VBA1 3GZAA 4DY5A 4XXPA 3ORJA 3R4UA 3ZXGA 5I0TA 3OSDA 4Y33A 3VD3A 4LBNA 4CUAA 2DURA 3PURA 4MYEA 5H9SA 1IGOA 3P6BA 4N9IA 1XU2A 1OC1A 4HBNA 1L7RA 1AL23 1NXMA 1V9U1 5K9YA 1PK6C 2NMOA 2R063 2G9FA 1X36A 3Q8BA 3TN92 1W39A 4C90A 3VBUC 3WG1A 1MQTA 3OUHA 4A7ZA 1AYM2 3FLRA 4IE5A 1R081 3ZKUA 5DAVA 2AC1A 2XOMA 5FCCA 1IPSA 4FFIA 2VM9A 2WNVC 3OD4A 3ON7A 5FYMA 5T54A 4M3CA 4BIFA 4ES9A 3E6CC 1DLCA 1EPZA 1Q3EA 2V09A 2VCBA 1UN1A 4AAXA 1VRBA 2QTWB 5FPLA 1HW5A 1QQP3 3LEIA 1RUD3 4QGNA 4BK5A 1H8VA 1BBT2 4PQQA 2XKPA 4UBGA 3SC7X 4P02B 3VHOA 3ZSMA 4CUGA 1AYN1 4UW6A 4TLFA 5K0UA 3WW4A 5JDBA 4FTBA 4C8DA 4JGYC 1W6QA 2Y34A 2WZ8A 3AP4A 3JD73 3OBAA 4LXLA 2G1MA 2NLRA 2CSGA 1QJY2 3K75B 5CAZA 1CQ9A 1H2KA 5HPOA 1QJEA 1XE0A 3H8XA 1QY4A 5FZEA 3RRDA 4FPCA 3BTAA 3WLUA 3ECQA 3VBSC 4C0HA 1BMV2 2VOTA 1MS9A 1GP5A 2WJSA 1JZ4A 4Y20A 4NHMA 5C3PA 2G19A 3AZZA 2JDAA 1UZYA 1DFQA 1H1IA 1NLQA 5DZFA 2BRTA 4UFHA 5LA1A 2V5YA 1Y9MA 4XDPA 2XVLA 3VLBB 3VB9A 2FMDA 5J37A 4JKKA 1GOFA 1WGPA 1CONA 1HRV3 4HFSA 1K42A 3KHCA 4WM8A 1FPN1 1DHKB 3ILRA 1JYTA 4DEVA 1GOGA 3ACIA 3OPWA 3PTYA 4LO6B 3CMGA 1PO11 1D0GA 2DWRA 4O9EA 4IEUA 5AC91 4YG6A 4JTOA 4M3CE 1OKOA 3P5BA 4LNVA 2J1EA 2OVUA 1JS9A 5DDJ2 3H7JA 1OMIA 2XG3A 3WNLA 3RNSA 3KT1A 3THCA 1UIKA 3ZXDA 1ND2A 2QNKA 5L7OC 3WP3A 2TUNA 3CJIA 5A7OA 2LUWA 1PIV1 1H8TA 4XVHA 4CEWC 1CESA 1VMFA 2WWJA 2I2SA 1LR5A 2IFRA 1N3OA 2C5DA 3HOBA 4KWKA 1FT9A 2CWMA 3HVDA 3MW3A 4KH9A 4L11A 4LHKA 3H1WA 5FZLA 3IDAA 3ZKYA 3K3NA 4MHRA 1GZWB 5EYYA 4QXBA 2VMCA 2DU1A 4JGZC 1B35B 1YIPA 1LOAA 2D93A 1GWMA 3J8F2 4QHOA 3USUB 2AGSA 1UW8A 2BUKA 4I0WB 4CZSA 4XHXA 4D3WA 3HEIA 3VKNA 1AR61 3KVAA 1YO8A 1DQ4A 1RUI2 3H7YA 3RSJA 2NQYA 4HPKB 3SCFA 4QPIA 4AEKA 4DNYA 3OCPA 1JBCA 2ZGQA 1PGL2 1RGSA 5FQ0A 4L92A 3N9PA 2QJVA 3NJZA 3S6PA 4DXSA 4COUA 1CZSA 5C71A 1REEA 5FMOL 3UV9A 2PYTA 1KDMA 4QPGA 1HJGA 4GKYA 5FFOC 5H9PA 4AQ6A 3ZXJA 4XAEA 3MZHA 4META 2HWF1 3LDBA 3PMEA 4K21A 4CEYB 5JZGC 4B3NA 1S0CA 4EWAA 3BI3A 4Q8KA 1Z0HA 2OKXA 4OI4A 1N1YA 4YFWA 1WMFA 1A8MA 2UWCA 3ACHA 4D8MA 5BNPA 3L9JT 2XB6C 3JU9A 2Q8DA 3MIDA 3NAPA 4YZ1A 2PLV3 1MZ5A 1SCSA 1X8MA 2X29A 4IL7A 4YZ5A 5FYZA 1HRI3 4DEQA 4P9GA 3ZPOA 4RFRB 2EAAA 1RHI3 1LJ7A 1VAMA 2D5FA 4ISRA 3ROUA 3VDAA 4LMFA 2FMYA 2EIBA 1OSGA 4KI5M 5BYNA 1WCDJ 2QZ3A 2D6MA 1LGNA 1MQTC 4D6RA 2P1BA 5CISA 4H55A 1PM7A 3LCPA 3M8LA 4LIUA 4AHZA 1G9CA 1FATA 1R64A 2GALA 3ZIXA 3TEYA 3ACLA 1WD4A 3O1RA 1JYIA 1HN1A 4QKNA 4GXLA 1H4GA 4XZUG 5A6ZA 3WINE 5A3NA 1O3TA 5BNNA 3A4UA 2FBEA 1N3QA 1NOVA 3WDYA 4GB31 5IFPA 1XB9A 5FREA 3KD4A 2A6VA 3WP4A 2GZWA 5GZFA 2DYCA 2C26A 3OUJA 5K0UC 1CX1A 1H6XA 2UY9A 1MEC1 1RVF2 3POWA 4DUWA 1OF3A 2HBUA 3SQOA 2QQWA 5GZGA 4MHUA 4CYDA 3PIGA 3WW2A 2DVAA 2B46X 1S4CA 4UW5A 5CADA 1XQNA 1ZX5A 1AYM3 4BPZA 1RC6A 1VBB2 3ZYGA 2JICA 1NUKA 3PVEA 4XF0A 2EF6A 1WLWA 2DUOA 2O8QA 4ES8A 3DYMA 5JR2A 1ASJ3 3BOWA 2SLIA 4Y1YA 5GZCA 1LNSA 3ZSEA 4BXSV 2ZGTA 1GNYA 1K5MA 1Q5OA 5LASA 3CIHA 4WM8C 1NCRA 2VZ3A 3T30A 1DZTA 3RFRA 1LULA 2QQKA 3HQXA 2QQUA 4AVTA 4IERA 3INAA 1RUF3 2BVBA 1F31A 4OHVA 5A33A 4AHWA 2XL9A 4Y22B 2A3WA 4YGCA 1K12A 1V9U2 1LU2A 3LIHA 1JZ3A 3NO8A 1ND2C 1POV0 1T2XA 1W8FA 2J1UA 4L0PA 1ZZ8A 3CJIC 4LK6A 3ASIA 5GM0A 5LATA 1H8TC 2QE3A 4NHKA 3H8RA 4XETA 3MF6A 4W6YA 2RDSA 2VXRA 3AZVA 4XJ8A 4J1WA 5I0RA 2GMMA 3U10A 4LORA 3B00A 4RD7A 1RUJ2 2YFZA 3LFMA 5LA2A 5FZDA 4DFSA 1QIQA 3JBG1 2W68A 3MBWA 5E8AA 3ZN5A 3ZXFA 3GCWA 1RB8G 1WLTA 3O12A 1EAH1 3LWCA 3LIGA 4QPIC 1M4WA 4LOSA 2XLAA 3SEEA 1AYN2 2ZMNA 5FP9A 5FIXA 2JE9A 1V6JA 2R49A 4Q29A 5BNOA 3S57A 2WQ4A 1MR5A 3FFQA 4QPGC 3LPGA 1AL21 3KCYA 1JI6A 4YFZA 2ZEWA 2H0BA 2XPJA 3CZUA 1YFWA 2DBIA 3H1MA 2ZKLA 4MVTA 2EIEA 4A4AA 5FWEA 5I8YA 4PDWA 4GWJA 5A7SA 4IE7A 2RJKA 1HB4A 1VBE3 3I3DA 5BNPC 1Z7S3 4P9LA 3M7AA 4CXXA 4YVWB 3NAPC 3PL0A 3TRSB 2FD8A 2AENA 2ZBJA 5I0DA 3M1HA 3NRUA 4XJAA 3T1MA 1QH7A 4FVVA 3BIEA 1RIRA 4M0NA 5JMOA 2GNTA 3KT7A 4L9BA 2YB7A 1RUI3 2HWD3 2RG4A 1FPN2 2WL1A 3GM8A 4B1LA 1QQP1 2GC2A 4OHXA 1GMMA 2H6BA 3K48A 2XVKA 3PU8A 4MX3A 2Z4FA 4XILA 1SBEA 4UBHA 1UZ0A 4LUKA 1CAVB 1RJ7A 2RR13 3GNEA 2OQ6A 1H1MA 4YZ4A 4XF9A 2QQPA 1TEIA 3UGFA 1PIV2 4YPJA 5SV8A 5KXEA 1D0HA 4ZS2A 4CCEA 4IEYA 5BNNC 3LAGA 2VVEA 4UFJA 4XQWA 5ANQA 4XCBA 3C7GA 3H3LA 3PIJA 4FQZA 3NKTA 1ZBA1 1ZRIA 1HN0A 4S2GA 1L7QA 3NL1A 4I30A 2IXJA 5T52A 2QQIA 3K4AA 3VBOB 2K2SA 3J7MA 4A45A 4AXOA 5IK8A 1Y7BA 2ZZJA 1KJRA 1SPPB 5KWRA 1AR62 4LKSA 1TMF1 1HRV1 1HDKA 1ZRFA 4CPBD 5JSPA 1LU1A 3B7MA 4DUVA 3QBQA 4PF5A 3UKNA 3TAYA 2RS13 4DINB 3ZYBA 4A7YA 5FK8A 1CAXB 5M0TA 3WG2A 2OS2A 4XW3A 4E4DX 1AX1A 1J1TA 3LPFA 3POFA 1XBFA 4FPLA 5D21A 5JUVA 2AZ5A 4QX7A 4CA9A 2YDEA 2CAVA 4E8CA 1X9PA 2HWF2 2PHXA 4PIYA 4WVZA 4W65A 1JUHA 2BERA 1XU1A 2D3PA 3VHPA 2G9GA 4YW6A 2VNVA 2DTWA 3J7LA 2GMPA 2RS53 1MZEA 2CAUA 4BIOA 4BMBA 4ET7A 3W5NA 3AVRA 3NJXA 4DZGA 1NA1B 1NCRC 5L9VA 1SLTA 5FXZA 1NE6A 1QH6A 1PMJX 3GBWA 4QMAA 2B45X 4WBBA 1HB3A 4LBQD 2PHDA 4G3YC 4EJRA 4NHLA 4Q4Y1 2ZX4A 2VOXA 1COV2 3VKOA 4PT6A 5FBZA 3VZKA 1H2NA 3OBRA 1XE7A 1GU3A 1G9DA 1MACA 2B5HA 2LROA 2JDPA 2VR4A 2UYBA 1CWPA 1CAWB 1QF3A 2WC2A 3EYPA 1U12A 4CP0A 4IV1A 1S0EA 4PJYA 1GZTA 2VU9A 4KGGA 3SHRA 1AJKA 5SV5A 3IAQA 4XZPA 4Y1UA 3M3QA 1ZNPA 4UOJA 4CDWA 1ULDA 4YVSA 5ACA2 2WT1A 5T5OA 2JKBA 3U11A 2D43A 5LBFA 4AI3A 1W04A 2W95A 5A7NA 4ARYA 1JOBA 2EXJA 5C9AB 3APBA 3G6JB 3B94A 3PU3A 2FDJA 2HYKA 3QOPA 1N1SA 2PLV1 2UY8A 4AQSA 2IFWA 4W4ZA 2UU8A 2WLQA 1DLLA 5KHHA 4CXYA 4AEJA 5BNOC 1PNGA 1O6UA 1MEC2 3A21A 5EPAA 1OD5A 1UO9A 3KVBA 1F9KA 1OQEA 2W2IA 1G8WA 2Q8CA 1PX4A 4XFHA 4H3WA 2ILMA 2YBPA 1S2KA 1Y9GA 2DVFA 2VBDA 4RHV3 3UKTA 4CP9A 4LIVA 3ES4A 3F95A 4NO4A 4PDWC 5GJ6A 2W3JA 3VBHA 4BQ3A 2BWAA 3NJVA 4PI2A 1V00A 2F6BA 1EPWA 3W20A 5FZOB 4ZU7A 5JOYA 1AX0A 3OGGA 2D6OX 5B4NA 3GHMA 4EZ4A 3B02A 3UETA 4BQ5A 2D6NA 2BNOA 4K1YA 5CNAA 3WNXA 2BNMA 2Y64A 2Q8EA 3VD7A 2VW0A 2WA4A 1D2SA 5C3QA 1C4RA 5A1LA 4OFGA 1QDOA 2DCZA 5A7PA 4FPHA 3MF9A 3KM5A 3MUY1 2WBKA 2ZGOA 1CD3G 1ND3A 5EWSA 2RHPA 1SCRA 4FI9A 4QKFA 4DS0A 3FUOA 4XJZA 3HN1A 4CCMA 4U2AA 3H50A 1IKQA 3D0JA 3A23A 3RWNA 4BYYA 3JUUA 3R4SA 5LK7B 3NVCA 3I2OA 4Y4YA 4HOOA 2LM3A 1CZVA 5HBAA 1OOPB 3FBYA 2BYVE 3VKMA 4Z2WA 1AYM1 2ZHNA 3D5OA 2WNUA 3BIWE 4FOQA 5FAXA 5FZ9A 2OYZA 4DB5A 5CFDB 3VD9A 3HNYM 4YM3A 1DDLA 1OQDA 2XJUA 1MZ6A 5CG9A 2N7GA 5KXDA 4UW4A 1GBGA 4NE9A 2JIJA 1GZCA 4LQRA 2DVBA 1OFNA 3NNJA 3CBNA 3AJYA 1MS5A 3SKJE 2QUOA 4E4SA 2D6KA 2FQPA 1W6MB 1W3XA 3AFGA 1BEV3 2NMNA 1AHSA 2D5HA 3ETQA 3IDCB 3PJYA 1KITA 1MVEA 3PTRB 3VDDA 5A6YA 1RUF1 1RXFA 1K5JA 1HQLA 1Q8PA 2OUHA 2W39A 1SDWA 4QGMA 3POBA 3ZYFA 3IPVB 1QJY1 1LGCA 2R062 2B42B 1XXNA 1VBD3 3FE5A 4Y24A 4YNIA 2A70A 3VL9A 1BMV1 4OLLA 1UAIA 1W2NA 2PQQA 5IK4A 1UU4A 5DUVA 1YQCA 1AUYA 5HI0A 3WY6A 4BQ4A 4RSUA 1BJQA 3N9NA 3D82A 3QH7A 4INDA 4AYUA 2IUWA 3Q8EA 1O3QA 5A7QA 1LGBA 3I2DA 2VVFA 1JYCA 3RZHA 4QHZA 2JECA 1QQP2 2Y6FA 4HK9A 4MZUA 1RUD2 4BQWA 1W6OB 4HVQA 1NLSA 2TEPA 3LZZA 4QU1A 4S2FA 1H1AA 3ZX7A 2VH9A 3ZOIA 1UZVA 4IV1C 2KA3A 1AXZA 5T5PA 5DDJ1 4E2QA 1WW5A 3JD72 2VTFA 2F4LA 1QJFA 1H30A 2C4XA 2VXJA 2D6LX 2WT0A 2ZS6B 3N7JA 5BUVA 4CDWC 4JC1A 1QOSA 4JDOA 2WZR3 4YVSC 5C8CA 3HR9A 5CFCB 3OD0A 3I49A 1DQ1A 2JWPA 3HJRA 3KB5A 4FOVA 5FOJB 4BHPA 2P17A 4N9HA 4P00B 3UESA 2WIIB 2C24A 4OULA 3I7DA 1GLHA 2VW2A 1WW4A 5ANNA 2NYYA 1O7FA 1VBE1 3Q8AA 1Z7S1 5F5AA 1KFXL 1W06A 1RUG2 1VMJA 3HT2A 5FPZA 3SNMA 5A3UA 4CDQB 2XH6A 2YBSA 1OA3A 5G05L 4Q0UA 1PO22 5IYYA 3AMQA 2Y26A 3QD6A 4AQ2A 1RINA 3FHIB 3Q9OA 3AJZA 4BM8A 1COV3 2XHKA 2FCTA 2VMDA 1OH3A 1HRV2 1WCKA 1RUI1 2HWD1 5FKCA 4Q4V3 3ZFEB 1PGL1 1C8M3 1XYNA 1QKQA 4PIZA 1NXD1 5IVFA 1W05A 1UYPA 2XQXA 4FPOB 3SXWA 3WDUA 4QB2A 2VTXJ 4Z2AA 4M00A 4IEOA 5TSWA 5CEHA 4QXCA 2W08A 3BN6A 4IXLA 4XE9A 1OBNA 3KS7A 2HEWF 3L2YA 1YQ2A 2QQNA 3POYA 1DQ0A 1YJKA 5C4WA 2ZTNA 2RR11 2YV8A 4IGOA 5JAXA 3D8CA 4Q0PA 4W8JA 3F2ZA 5FYBA 5JOZA 3KSCA 1GKBA 4B4PA 1UKRA 2C9AA 3BTXA 4BE3A 3N7KA 1OLMA 3W59A 5HCAA 4XURA 3P3NA 4D0QA 1G86A 3T1LA 1CAWA 1O8SA 4NWWA 5JXGA 1RJ8A 4QQHA 4MGIE 2DV9A 2V4VA 5F6KA 2RVAA 2XJPA 5D8AA 4GH4B 1YCIA 2I74A 4LBOA 1AVBA 4A3ZA 2OX0A 4RFT0 3RMXA 5G04L 2IWGB 5I0UA 4LBKA 4S2HA 3ZN4A 1TE1B 1YUDA 4XAAA 4XDQA 4DRVA 5EFUA 5FBJA 3O14A 3E5QA 2WNUC 3AFKA 2WO1A 1M06G 3CZJA 1UZWA 4LKFA 3HBKA 4PBPA 5AVAA 4CDUA 3K4ZA 2BOIA 3I3MA 4LJHA 4AL9A 2OW4A 2WAAA 4AVVA 3OBZA 4LE4A 2B39A 3K77A 4NUBA 3K3OA 4EQVA 3GCXA 1WKYA 1ZZ7A 4BQXA 4EN9B 1QJU3 2ZAHA 1S0DA 1MS8A 1F15A 3ITQA 2VNRA 3VDDC 2W1QA 4ZXKA 2HBTA 1IS3A 4HMZA 1OLME 1HRI2 2GAUA 4L8QA 2CDPA 4AEDA 4HXCA 2D3RA 4OHZA 2ZX3A 4IEWA 1U5IA 1WCUA 1RHI2 1NZCA 4IE6A 5FY9A 5FPXA 4Z1VA 1FNZA 2DCJA 2IXIA 1DQ2A 2Q30A 2TBVA 4LT5A 1C1FA 1S0FA 4H7MA 3GZTB 2EXKA 1YLLA 3C7HA 1FV3A 3BPZA 4UT5A 1S0BA 4ZS3A 5IK7A 2QBXA 1LHOA 4DO0A 1IQAA 2ZMKA 3CL1A 1SQ4A 4RA0A 1OA2A 1W2UA 3ZXAC 4ATFA 1O59A 2ADDA 2BW8A 2HWC3 1LCLA 3OF1A 3PNAA 4LITA 1ZREA 2YU2A 3ACFA 1JOJA 1G6NA 3IT8A 4Y26A 2WS92 5BY5A 3KLSA 2ZEXA 4XFFA 2ZEYA 5HV4A 4QPWA 3ZN6B 1PVC3 5CKMA 5HCFA 1LB2A 5D1IA 4XF1A 1W8UA 3LKJA 5FY8A 3L2HA 3DPRB 2GH2A 1DIWA 2GNDA 4S2DA 1RUH3 2JDYA 4CTEA 2XJTA 4TXWA 3UGHA 4HSJA 1UU5A 2O1QA 2ZHKA 5EV7A 1KEXA 3V64A 3VV1A 1MS3A 3LEGA 3NNLA 2VUDA 3LOIA 4NN0A 5CBLA 2ARCA 4FP3A 2QDNA 4UWDA 3M3OA 2YU1A 1RUC3 3ZMNA 4LLFA 4JVAA 2Z2SB 4XUTA 5C8CC 5E89A 4RHV1 3MW4A 1WLDA 2GSYA 2JG8B 4BK4A 4BU2A 1T6BX 4UF0A 3LEKA 2P3IA 2NM1A 2VCCA 3LSEA 4AZZA 4C1WA 1VPHA 5ISLA 3QACA 5L73A 4QDSA 3VKFC 1UOJA 5A7WA 4NRPA 1UKGA 2VL4A 5EJ1B 5JPNB 1RUJ1 1XE8A 5IWFA 3USSA 3T4VA 3X29B 4MGSA 4IQPA 3WF3A 4ZZ8A 1IS5A 1UU6A 3I59B 1ASJ2 4MXWA 4OZOA 2ZACA 4FSJA 1BVP1 4QHBA 2Z42A 3MYXA 4PLNA 4R9BA 3WR0A 1OPMA 2HYXA 3ZIWA 1JYVA 3WNMA 5F3CA 3DV8A 5JCTA 4BWOA 3SH5A 1IOAA 2AYHA 5A32B 5AFEA 1RUF2 4A3XA 1D7PM 3IMNA 4IGQA 2XQRA 4QPYA 3PJQA 5FLIA 1FAYA 2XLFA 4YZ3A 3WG4A 2RDRA 3ZYHA 4FT8A 4WVMA 5C4WC 4RQPB 3GALA 1ACCA 2VZPA 1JN2P 4UW3A 4G9SB 5F7UA 3MFCA 2YC4A 4RS5A 2XJSA 4ZONA 3UJQA 2W94A 4HVRA 3KGLA 4AFMA 3AXEA 1HIXA 5IVVA 1US2A 4UFMA 1CAUA 3AP5A 3C3VA 5LCWL 1RUG3 2FDFA 1S0IA 4N7IA 2W52A 2VQUA 3O7OA 1PO23 2BWCA 4LULA 2W92A 3RZZA 3LD8A 5D8AC 5IW0A 3R6SA 3WX5A 2GH8A 2X5IB 3HN3A 4QQPA 1YQ6A 4BDVB 1TNRA 4LHSA 4I02A 5B2GB 4R8HA 1KD7A 2AUYA 3RYRA 1POV1 5FZ4A 3ETPA 1ULFA 1BEV1 1W2AX 1OF4A 1EV12 2FDIA 5J48A 1QEXA 4AFBA 2OA2A 3DXTA 2CNAA 3J7NA 3HWJA 2XJVA 4ARXA 2VE1A 2VOVA 5KR7A 4CDUC 2ZHMA 4E4ZA 2CY6A 4BISA 2E7AA 2EVXA 2ATFA 2W47A 3M2MA 3FZ3A 4AW7A 5FKBA 3ZFFB 3ZFEA 4LR4A 3CF6E 4PF1A 3I2FA 3K51A 2GP5A 5IAXA 1W2TA 1G7YA 1QU0A 4RR3B 2EIDA 4XIKA 3H3ZA 1VBE2 1Z7S2 1BKZA 4Q5OA 3WF4A 4Z07A 1AXKA 1FOD3 4JTNA 4OZXA 1VBC3 4KBZA 3AP9A 3PDQA 4TSVA 4AEDC 2WSVA 4PHZA 4X8PA 4DRRA 2LS6A 4MSVA 3FJSA 3G7DA 4OQ9A 3P3PA 4IGPA 1OLRA 1OHFA 2HWD2 1I3HA 2LRPA 1W2OA 3GYDA 4IV3B 4YZ2A 4XPVA 3V56A 3OYWB 2VUJA 3H8UA 4FFGA 4A44A 5IT6A 3U0ZA 4J25A 5LBBA 2RDQA 2CHHA 4BZ4A 3C7EA 4NPRA 2YMZA 5F5QA 1SLCA 1V6LA 2RR12 2ZOEB 3NNFA 4JKMA 4FO9A 2YGLA 3MIBA 1GZ9A 4D7TA 5J7MA 2E7TA 2Y33A 4IW3A 2WZR1 4EYUA 1IPKA 4F83A 2PQSA 1WMXA 4AI1A 2VQTA 2Q8OA 4JAAA 3DKWA 2XONA 2J22A 3VBRA 1LOBA 2BP6A 4N53A 1W6PA 3CEWA 1HQNA 1YJLA 3MGUA 4J6GA 5FZIA 1GWLA 1VMHA 4FTSA 2CV6A 2RM22 5CFDC 4AI8A 5A3TA 3ABZA 1XNDA 1W3VA 2XJRA 1COV1 4LO4B 2JDMA 5CVRA 3CLPA 4Q4V1 1C8M1 3BPSA 3BTZA 3WHUA 4AEMA 2RS12 4COVA 2OUJA 2ZJCA 2EIGA 2J1SA 2LW8A 3IDEA 4OVEA 5LRRA 2ZGUA 1NT0A 4QX8A 5HCBA 3ZSJA 1ZA7A 4LUMA 2VBPA 4JQTA 5F3GA 2Y6HA 5ACA1 4CUCA 4YM2A 3RZGA 3POGA 2WS93 3A0KA 5EXOA 4B7KA 1LHVA 2JXAA 5FLHA 2J42A 1UOGA 3NJYA 4LBQB 4D6QA 2RS52 3O0VA 5DUXA 4P14A 1NCQA 4B4RA 3FL7A 3RYPA 5FDBA 3IIAA 4CP2A 4E27A 3BU0A 4Y1XA 2P5BA 3FWEA 5DPNA 1W8ZA 3V0AA 5F32A 1NAEA 3VBFB 2W5FA 4JHZA 5JMCA 3RDIA 1UY4A 3UNPA 4P9XA 4EE2A 5I0SA 1YFUA 4MH0E 2J7MA 4ASLA 2X05A 5FPUA 4XEZA 2VUCA 5FPVA 2VO5A 2W87A 3DYPA 3VDBA 2W1UA 5CIRA 1U0AA 1W8OA 1HLCA 5HCHA 2ETEA 3ILNA 2JDZA 2WABA 4RS5C 1DGLA 4BCUA 3LB9A 3IKWA 1SFPA 4E2SA 5FUPA 4N7UA 2XWJB 4CVUA 4QQLA 4P5YA 3S5AA 1ZBE3 4P5HA 4NIHA 1X9TA 4XABA 3WQ7A 1XYOA 1A78A 4PLOA 2JDHA 1WW6A 3AP7A 4KWUA 5E88A 3VZLA 5IVEA 4XBLA 1QJU1 1Q8SA 3E6BA 4V2WA 2BNNA 1UYYA 1L7LA 2PHWA 1SBFA 2E63A 2J1AA 4I3PA 2RV9A 2OQ7A 2XKOA 4AI0A 3B5LB 3KMHA 5JPMB 5DG2A 2HKXA 1HJFA 1MS4A 4AGGA 1OVSA 3VN4A 2SBAA 2B9UA 3RQ0A 2VQAA 4RHV2 4M01A 3ZSLA 1DQ6A 3ZFEC 4R4XA 4I01A 2A3XA 4HN1A 4Y5SA 1DYKA 2D97A 2HWC1 2YUEA 2UWAA 3J7HA 3M4FA 4DY3A 4IEPA 3ZXKA 5E1RA 3T0DA 1W0OA 2P4EA 4PBOA 3T08A 1ENSA 4IEQA 4CCKA 4I2OA 5FZFA 4K8RB 2VJXA 1PVC1 4XC9A 3WUCA 4TTGA 3ATGA 3OB8A 1G9AA 5LBEA 4AFCA 1OH4A 3NV4A 1AR73 1IS4A 4EWEA 4XXAA 1EV13 4CU6A 3LFIA 1OUSA 5T50A 3MIFA 1R093 4MG2A 2E31A 1NE4A 3MIEA 4YW2A 4ZZ5A 5KHIA 3TYJA 3T2PA 1QNWA 4A6SA 1I6XA 2BTVC 3ZFGB 1SFYA 2YPDA 3LOBA 1RUC1 2VG9A 2R061 2XWBB 3ZM8A 3OGSA 3THPA 4LA2A 2O0OA 2C0ZA 3LE0A 4GMP3 3VKLA 5C70A 3AYCA 1WZXA 2JG9B 2JE7A 2Y38A 3VBRC 1ULGA 5I8TA 4N53C 1C28A 3HIFA 3I3EA 2PTMA 4FFHA 1HX6A 1DZQA 2WLPA 3MFAA 2VZRA 5LZ6A 1EP0A 3I2GA 1Y3TA 1S0GA 1JU4A 1JYWA 4D94A 1J84A 1LOEA 2XUEA 3AKPA 2VVDA 5JI9A 3O1MA 3MV01 4YGEA 1BEV2 1RUD1 4OHYA 3RGBA 2DCYA 2DFBA 4QB6A 1K3IA 1XPWA 4ZPIA 1MS1A 3HQRA 4ORFA 2Y6LA 2WNOA 4M0HA 1GZWA 4Y5TA 3RYKA 3BB6A 3HT1A 3JD71 3KF3A 2A6ZA 5C5TA 4R52A 2G9ZA 3JXSA 1W28A 3TEZA 1GWKA 1B35A 4QX5A 3TOJA 2AR6A 3USUA 1WUVA 2RE9A 4IEXA 2V72A 5IVYA 4A2UA 1VBD2 2VMHA 3GHNA 1J1LA 3P1IA 3K4DA 2P2KA 4HPKA 4E2GA 4AVBA 3MICA 4LO8A 1NCQC 2JB4A 3NQHA 4WZCA 1Q8VA 5CKNA 2ENRA 1AR83 2P3JA 4BLIA 2IVJA 1W6NB 1RUG1 2GU9A 3KF5A 4P9YA 3UL2A 1CJPA 3WNNA 5KXCA 1E5HA 4GWIA 1PO21 1H2MA 2JDKA 2RM23 5DAPA 3HQUA 1W8WA 3U78A 3EB7A 1GQHA 4RN5A 4YLZA 4CEYA 1UCXA 1WD3A 1UPIA 2R6QA 2XBO3 4HK8A 4IE4A 4Q0VA 2RMU2 4Y1VA 2DF7A 2C1FA 4GALA 5GLUA 2BFUS 2B4KA 2JD9A 1UOBA 1FV2A 1QNYA 5A1FA 1UXXX 2X53S 1N1TA 2HLEA 3IB3A 4SBVA 2E7QA 4BMEA 2NN8A 4JDNA 1SLLA 1H6YA 4NIAA 2YC0A 2PN5A 2WZR2 4HANA 4LOTA 4QDRA 4XQDA 4QX0A 5GLWA 2ZX1A 1PK6B 2FDHA 5IATA 1FXZA 2R0FA 2XUMA 1D2QA 1X33A 2KD7A 4GWNA 4CRQA 3VBUB 2D6PA 3I3BA 4Q4W3 2GC0A 4QKBA 3MLKA 5FP7A 3DGTA 2FZ1A 1FOD1 4OUEA 5FZAA 3DKQA 3GZUC 4EN6B 1VBC1 3E97A 2GNBA 5CA6A 3LEMA 2WRAA 3IWZA 2WNVB 3BU7A 4Q4V2 1C8M2 5ABJB 1QOTA 3MO4A 1NQJA 2WZEA 3N7LA 3N35A 5DZGA 2ZA9A 5A3WA 4ASKA 2W1SA 5KHGA 3N9OA 1DQ5A 1LHUA 3SMHA 1YNAA 2J1VA 3H0OA 4LBMA 4QQ2A 2BGOA 4Z92B 3R4DB 2RS33 1W8HA 2V4AA 3HBZA 5CYYA 1F4HA 4GD4A 1W9WA 4EN8B 2A6WA 3BVCA 4JGYB 4LA3A 5CG8A 2ZGKA 4L2NA 3H8OA 4XFBA 3N3HA 4GAZA 4NOTA 1E5RA 1URXA 2MEV3 3WD5A 4UI9L 3GBGA 3IM0A 3VBSB 3ZSKA 1VP6A 4F8AA 1CN1A 4AVSA 5FYYA 1C3HA 3DEMA 5L36A 5B4XA 5J1XA 5IVCA 1CR7A 2DDUA 5T5LA 3RZMA 1HRI1 5I8SA 5FR3A 1QXRA 1VR3A 1AXYA 2ZHLA 2WQZC 1RHI1 1ZRRA 3JB8A 3MI8A 3OTFA 4FOYA 4E9KA 5BPXA 4NRMA 4B4QA 3KHBA 1WBFA 1XNKA 1UMZA 2PAMA 5FP4A 2Q5TA 2B8MA 2VOWA 1W9FA 2VMIA 4Y4RA 1D4M3 1T6GC 1X50A 3VZJA 3WUDA 4OUSA 3WF1A 2CGNA 4Y22A 4D6SA 2FDKA 1OVPA 4KGQA 2WS91 1TVGA 2WR9A 5T5JA 2NP0A 1SG3A 2AH2A 5L7OB 5H9QA 1PVXA 5FYCA 5JOWA 4CEWB 1QJU2 1V6NA 1YIFA 2O8OA 4WVWA 5FZKA 2YBKA 2BVVA 5FZCA 5F39A 3HD8B 3OUIA 1WCSA 4JGZB 4FPEA 1TME3 1MPXA 5LBCA 3V0BB 2H0VA 5FK7A 1B35C 4LHLA 3M3CA 1S0JA 1AX2A 2V5DA 4XFIA 3B9IA 5JLVA 2R1DA 3IN9A 3PUAA 4N8MA 3ZXEA 5EHDA 2FZ2A 1UZZA 1ZVFA 4JRLA 3S0MA 2MNGA 2HWC2 1WA6X 4XDOA 4K1ZA 5FXXA 1AF9A 1FI2A 3ZLIA 4AGVA 3T2QA 4BQ1A 4CXWA 3IBMA 1ASJ1 1S2BA 2X8KA 2WSUA 5JZGB 1C1LA 3RS6A 1PVC2 3EQEA 2HWE2 5T3NA 4KWJA 4CEYC 3OY8B 2WYFA 2DU0A 1KS4A 3POJA 3AMPA 3K2OA 2D40A 2ZCWA 4MXVA 4R9CA 3NV3A 1RUH2 4OCTA 1BZWA 4QB1A 1ALYA 2A3YA 3FC0A 3WNOA 2GNMA 1UIJA 1QXPA 5EYXA 2BGCA 3VHNA 3WOGA 4N90A 5FO8B 5J36A 3RPQA 4YVWA 1VJ2A 2IZWA 1QJZA 1LESA 1V70A 1RUC2 3KWVA 3WXPA 5DAXA 1O5UA 4YSFA 5FZ1A 3U14A 4ZHNA 2JJ6A 4JRAA 4OMCA 3WQBA 1SBDA 1MQTB 2CDOA 3C7OA 4HVOA 3T4HB 1K45A 4AK3A 4DMIA 1STMA 3VZMA 3O0XA 1PO13 2BU9A 4FXKB 4XFAA 1O3RA 1W99A 1UY2A 1CAVA 2VBBA 1A8DA 4WM7B 2ZX0A 2BJSA 1C8NA 5LW9A 3WQ1A 4K6BA 2WZPP 3IDBB 1RMU3 3FBMA 2RMU3 4M3CB 1DP0A 4CCJA 1GP6A 4H2AA 2VD7A 5I93A 1EV11 1YQ8A 2WAOA 4MO3M 1ZZCA 1W9TA 3ZDVA 4ZU5A 1UMIA 2E26A 1R091 2OPKA 5CZKA 3FX3A 5GLVA 3B3QE 3U1XA 1F8VA 4KL1A 1S1AA 4QKDA 4B7EA 4R4ZA 1RUE3 2A1XA 3HNBM 5JSRA 4Y3OA 5K0UB 2YXSA 2ZGRA 5K8SA 3VBOA 5FUIA 2VMGA 2ARBA 1W6QB 1SPPA 2LALA 2DTYA 2PXJA 2VZOA 1S2EA 1GP4A 2H6CA 2PHFA 3KQ4B 4RGAA 1N1VA 3VGIA 2LTNA 4A42A 2A6XA 2QZ2A 4FOWA 3MIGA 4J1XA 5DG1A 3HPNA 1LRHA 2K9ZA 4OYUA 4AI2A 4MGZE 1XOYA 2BEOA 1CVNA 1CAXA 1GNHA 1KGYA 2ZXQA 4Y20B 4XTMA 4TZDA 1PGW2 3AYDA 4URTA 1KFUL 4CUBA 1GNZA 3EO6A 2FCUA 1TG7A 3ZXLA 4XBQA 4XMIA 5F1RA 5LEKA 1VB4A 2XDVA 3AP6A 2DCTA 1JOPA 2VTXA 2ZX2A 4FPKA 5IJRA 2W0XA 1ST8A 3LF7A 3ACGA 3NV1A 4NHXA 2WWUA 4WM8B 5FJKA 1UY3A 2FCVA 3VHRA 5FUNA 1NA1A 3I4IA 1FMD2 1JUIA 3VZNA 3A0NA 3PVOA 1QOOA 3WDVA 2YHJA 5DAQA 4JKLA 4NROA 5JXHA 1LKNA 5IAVA 2PMWB 3MPPG 4O7XA 5F5IA 1XSQA 3KCXA 4F3JA 1ND2B 3ZR6A 1ENQA 3KT4A 5ABJA 3CJIB 3Q8CA 1H8TB 3M70A 2ZGMA 2R32A 3E1F1 2XR4A 1RUNA 5A3PA 1AR81 2YGMA 4MUVA 1FOD2 4CE8A 2RM21 1VBC2 3T09A 2J1RA 4BLJA 3J26N 3AVSA 1OPOA 2E9QA 2ZGPA 5FMCA 2XBO1 4JDMA 4U36A 1ZRDA 3QCWA 5GLTA 2ZAAA 1NY71 4R9AA 5FZBA 2RS11 3H1YA 4MGYE 3SEPA 1BXHA 2Z69A 4QPIB 1O91A 2VUAA 3B01A 3FFZA 2PHLA 4KWLA 3ES1A 4Q2FA 5DN2A 5FQ0B 2VPVA 1WMEA 4BXFA 1JZ6A 4FBFA 2R042 2GN7A 3AMNA 4QPGB 1JMUB 2FHRA 3CO2A 3GF6A 5FMDA 2UWBA 2ZZQA 4YG0A 3ZO0B 1RITA 1R1A2 1IPJA 2JE8A 3FLTA 4N43B 2ORZA 2RS51 3ZFGC 4DOUA 4E8DA 2EICA 3I54A 2OZJA 4Q4W1 1LOFA 4PLMA 4QXKA 2K0GA 5FXVA 3OPZA 4MADA 1LAJA 5BNPB 1VB2A 1DGRN 2Y0OA 3D0SA 3R0RA 5FRAA 1AL0G 3WDWA 4GWMA 5I91A 3TNQA 1UD1A 3NAPB 5FZOA 3O1VA 2VMFA 4O61A 4P9IA 4YVWC 2TNFA 1H0BA 5HXVA 1HXS3 4QAWA 1FX5A 5JVVA 1A6CA 1C57A 5KHKA 1NX9A 2AEZA 1QDCA 2UURA 2RS31 1H2LA 2XVGA 3VL8A 4AOCA 4C1XA 1QJX3 1IHMA 2VCMA 3MDPA 5A3MA 2GC1A 1V6OA 2A6YA 2ARXA 3BOPA 3MLLA 5IVBA 1HV0A 1XNAA 3E5XA 4GULA 2PAKA 4QXHA 4K8FA 2Z5WA 3DUIA 2I07B 4LTAA 2PA7A 4MGKE 2HWE3 2MEV1 4XUPA 3A7QA 4LKEA 2GMEA 4LLOA 5BNNB 1OOPA 1MS0A 1F4AA 5CFDA 1ENXA 3THTA 2VZSA 3RZJA 1GOHA 5LA9A 3WQ0A 1POQA 1CPMA 1BHGA 2Y6GA 1J83A 2AEYA 3VBOC 2QVSB 4HZFA 5LRSA 1JH5A 2DCKA 2OXBA 2RJ2A 4LPLA 1W6MA 1EAH3 1WMDA 1YHFA 5ERLA 4AVAA 1D4M1 1GSLA 3H3UA 4FPYA 2BBAA 3WW1A 1W0PA 1ZBE2 1US3A 5DQ0A 2R16A 4D69A 1C5HA 1Y43B 4Q27A 1J58A 3EHKA 5KXBA 3IPVA 1UNBA 1IG3A 4BB3A 5LY1A 2YROA 4GMP0 4L99A 1ZM1A 2OPWA 2PHTA 4HT1T 4XJ9A 3T3YA 4HKOA 3ZR5A 5IVJA 1W03A 1H9PA 2I45A 2VZTA 1K5MB 4XHBA 1NCRB 2P37A 1Q8QA 1XRUA 4GJYA 4I09A 4MGQA 1NA1C 4AWDA 3LDKA 5A33B 1RTVA 1KRIA 2JIGA 4H7LA 1TME1 1DYPA 1F5FA 4OI0A 1Q43A 4WM7A 5F3IA 1I5ZA 4FAGA 1LEMA 5FMOS 3KV6A 2WFF3 1JXNA 3M3EA 5ABJC 2J1TA 1PZ8A 4DUXA 4D7SA 3SCGA 1CZTA 1Q8OA 1W6OA 1UXZA 4HLTA 5FY7A 3AKRA 1VAKA 1RXGA 4BA6A 3C7FA 5F3EA 1RYYA 3N9QA 2QFEA 4KQ7A 3W21A 4CDXB 1UY1A 2QDRA 5EJ3A 4AHYA 1ULCA 4Q1RA 1BYHA 4M4PA 5CFCA 2C9KA 4IESA 2WUHA 2XXZA 5EQUA 2CGPA 1VRH2 2JKXA 2WN2A 2DVDA 2VZQA 3AXDA 1AR72 2ET1A 4IEVA 4IDZA 2P3YA 3B69A 4EROA 5C9AC 1HV1A 1R092 5LK5A 3AK0A 5C7GA 4AGRA 1FMD3 3C8XA 2QQMA 4LBLA 5D2AA 4CDQA 4EZHA 1DF0A 2ARAA 2A73B 1UX7A 4NHYA 2X09A 4YW5A 4FQ4A 3WSOA 5BNOB 1ZBA3 5BXXA 4Q4X3 1UWWA 1V6MA 1GICA 1VBD1 1YEWA 3NMBA 3S30A 1I9RA 1V6KA 2DBNA 5EJZB 4COYA 4X6RB 1TMF3 2ZABA 4PCRA 5F9TA 1LOFC 4PDWB 2JDNA 1QHDA 4GKXA 4LO5B 1ONAA 2ES3A 3GJAA 4BQ2A 4C0BA 3MPBA 2VNGA 2Z79A 2Q4SA 4YM1A 3I3QA 1H9WA 1NQDA 3K46A 5APAA 1CPNA 1NG0A 1X8EA 4UYBA 4RGGA 5AFBA 1RMU1 1CIWA 2RMU1 3IZOA 1KQRA 4WV8A 1ENRA 1SMVA 1V0AA 4WZFA 2DUQA 3EMRA 4CU8A 1QWRA 4NR1A 3TEXA 3I97A 4LKDA 5IUQA 2GP3A 4F7ZA 3T0BA 3DXUA 5FP3A 5GALA 2K46A 4OQ8A 1RUE1 2VMEA 2R043 1DGWA 5BNQA 3E5UA 4IETA 3NWKA 4GH4A 1WCQA 4XTPA 1IKPA 2VULA 1HKDA 3OPTA 3ZVXA 2BV4A 2WO7A 3U4SA 3CDZB 5J3UA 1R1A3 1W8TA 4Q4Y3 4LK7A 4QX1A 4RGKA 1UOFA 5DXDA 4L97A 1AR82 4CCOA 3UGGA 1OOPC 4AAPA 2EA7A 3PLQA 5FZGA 1DZRA 2DVGA 2Y6JA 3E6DA 4EN7B 3MW2A 4AFDA 4YW3A 1J3PA 2XBO2 3PUIA 3LQCA 1NY72 4O65A 5GKAC 4D7YA 4N43A 5C3RA 1NZIA 5F8PA 1XNBA 3U07A 3S5QA 1OURA 2HWB3 3NKGA 3O0WA 4O9GA 5FZ0A 3WNKA 3LGRA 4HETA 2HEYF 1SZBA 5FYVA 1HQWA 5JIUA 2P6CA 1O3SA 5A80A 3SLIA 1BCXA 2R073 2VNOA 4Q4W2 1ODNA 1U5ZA 1WBLA 2W91A 4XCAA 5A3OA 3ZPYA 2Y0IA 1G9BA 3LSDA 3RZLA 3B93A 4YG3A 4XF4A 1LECA 5FZ3A 4NVPA 3WG3A 1O5LA 5LA0A 2MPFA 3O1SA 3ALQA 3AYEA 3MIHA 1E5IA 1O4TA 5T55A 1FYUA 2OT7A 1UQXA 2QQJA 2RJLA 4MV2A 2YZ4A 4WM7C 4TLGA 1TZOA 3WP5A 4JV4A 3GXUA 3ZN6A 2XJQA 2YPJA 4MOAA 1ZRCA 1AR93 2W46A 1LEDA 2XHNA 4MGTA 2RS32 3DPRA 3FN9A 4ISQA 4PI0A 4IV1B 4XIOA 5C3OA 2D98A 2IC1A 1A3KA 1XNCA 5F2SA 3U37A 2WNEA 5L9BA 1L3JA 2R0HA 3O1OA 1U5YA 4CDWB 4YVSB 2BZDA 5CFCC 2MEV2 4TYSA 1XNTA 4HN0A 2JG8A 1GQGA 3TN93 3WNPA 1W90A 2DUPA 3THDA 2CL2A 4DQAA 1A34A 1IQDC 3AZXA 4EN0A 1O4YA 2B9VA 2JX9A 2Y8KA 3I2IA 4ZY9A 3BTYA 5A6XA 5H9RA 4CDQC 3O1PA 4JHTA 1KJLA 1GQPA 1SLIA 2D44A 3POEA 5JOXA 1HXS1 2A71A 3CQOA 3I59A 3N9MA 1REDA 4XJWA 1IG0A 1W8NA 3FHQA 4URAA 3SITA 3D4KA 5JXIA 3RG0A 4K9SA 1D4VB 1VBA2 4CP9B 1CJDA 4C91A 5A32A 4BH9A 1D4M2 1QJX1 4YGBA 1ODMA 3VBHB 1AJOA 5L9RA 1BBT3 4IEZA 1UX6A 1O4ZA 5K7PA 4PIXA 1XYPA 4RQPA 1E57A 2HWE1 2O14A 2VC9A 3ILFA 4UFIA 4Z8BA 1VRH3 3FMGA 1SDDB 3W5MA 1QJY3 2WKKA 4LBJA 5KC6A 1ZYBA 1RUH1 4QGLA 1YXWA 2CGOA 2MHFA 4HONA 1SACA 3NV2A 3BKZA 1PX3A 1ND3B 4CDXA 2C6SA 1R082 1TME2 5C5UA 3FLPA 3VD5A 3VUOA 4SLIA 3KGZA 2OZ6A 4GH4C 2PELA 2X5IA 2XGXA 4P9WA 1R1ZA 4QD2A 5C33A 2HJIA 1EUTA 5IFTA 1BVVA 5C9AA 4AF9A 1G9FA 2Y6KA 1X7NA 2R30A 3OOXA 4FPFA 2WNUB 4XACA 2QCSB 1NYWA 4M4RA 4NJ4A 4NPMA 2ZMLA 3OGRA 4Y1ZA 4LO7A 1PGSA 3BALA 3OEAA 2E53A 4ZKTB 5DDJ3 2VY0A 4ATEA 1LODA 2KXLA 2Q0AA 1I1EA 1TNFA 3U4XA 2ADEA 1XSRA 3CU7A 3ZFFA 1LENA 4N43C 3UYJA 2WO3A 1SLAA 4MLOA 3WCRA 3HMYA 4RR3A 4YM0A 4CSWA 3GGLA 5DAWA 3GZEA 3VDDB 2X10A 4JQRA 2XL7A 1KS5A 4NPLA 1DU3D 1WW7A 4RYDA 1DYOA 3RJ2X 4GIQA 5EP9A 1O8PA 2WFF1 3J8F3 3BODA 4AVCA 4IV3A 3PHMA 4W50A 1PZ9A 2VCAA 1WWYA 4B8EA 3OYWA 1VLNA 2EALA 3I2JA 5FMBA 3TBDA 4LE3A 3O5SA 5J96B 5AC92 1PO12 3TNPB 1PGW1 5J98B 4V2VA 4AHXA 2CTVA 1PHMA 3MUZ1 1AZDA 5FO9B 1SHWB 3RI8A 1RMU2 1SFNA 1OXCA 1YYNA 5FLJA 2IXHA 2JENA 5FZHA 4G4FA 1V6IA 3D6EA 4A41A 4K7JA 1JTZX 2PHUA 4OHWA 1FMD1 4CPBA 3DPRC 4ITCA 1RUE2 4QT6A 4Z82A 1PNFA 4YWAA 4P08A 3UJOA 2BOJA 1BLZA 1GANA 4QWNA 4XMAA 5DZEA 2G4IA 4NIIA 1REFA 1OT5A 4FP2A 2BDRA 3RMYA 3RVHA 3BYWA 4Q4X1 5EIYB 3NSTA 4IUGA 4NWVA 5BV6A 4OI2A 5FYUA 5C8CB 2HEVF 1C5IA 1Y9QA 5J09A 3ZYPA 1E5SA 2V73A 5FJHA 3ZYIB 1Z78A 3DECA 2JG8C 4A7KA 4UXAA 1PZ7A 2QQOA 1JODA 4XYXA 4ASMB 4QQOA 3IAPA 3N7MA 4Q26A 1JHJA 1ZA4A 4XUOA 1YFYA 2JDUA 1CGPA 4CU9A 5JR7B 5GZDA 5DMYA 1J3RA 2WYSA 4LBQA 4I0BA 3BGAA 1RUOA 3KQRA 4JX0A 4AI9A 4JZRA 5KC5A 3DL3A 5FY0A 3UT0A 2WN3A 5DUUA 5FYTA 1K5MC 1F2NA 4XQ4A 3VBFA 2R041 1VIWB 2WFPA 1FNYA 2PFWA 4LHNA 2QKDA 3AKTA 2VZ1A 3JCIA 4TN7A 2E6VA 5EZWA 3KV9A 5C4WB 5JI7A 3DCQA 4Y5Z0 1R1A1 3AKSA 3WV6A 4RQPC 1ULPA 1RVF3 3O1TA 3LDRA 3DYOA 2NZ9A 3LA2A 2BBVA 1ULOA 5JWPA 2NPIA 1N47A 3R05A 3AMMA 4Q0SA 5F2WA 4KG0A 5FPAA 3AMHA 2WWSA 4W6XA 2PHRA 3POIA 3WW3A 2A7AA 2IXLA 2E51A 5D8AB 4CDXC 1VBB3 3AKQA 5FYSA 1LHNA 2IVIB 5FZ7A 3HNMA 5FV3A 4DXTA 1DCSA 4Q8LA 5A1AA 3OGJA 4HL0A 2X5IC 2HH9A 4P9JA 3JB4C 2YY1A 4EV0A 1OUXA 3CNAA 4COZA 4DXZA 1JHNA 3I8TA 5FYIA 1VBA3 1JZ8A 2Q1ZB 1LHWA 5IHRA 2HWB1 3MLJA 3N9LA 2IXCA 2KR2A 4GB32 4XUQA 3SKVA 1YQ5A 2P6HA 4I0AA 3TB0A 2ZGLA 4V1PA
chains in the Genus database with same CATH topology
5C8WA 1GV9A 2BFUL 4CDUB 4PQ9A 4W6WA 1U5XA 3AM2A 2UYAA 2R071 3SH4A 1OA4A 3WVJA 1V9U3 3ZFFC 3QLQA 3WCSA 3J9SA 1IS6A 3LA7A 4RR3C 2WINB 1SEFA 3ZYRA 2Q1MA 3SCHA 1R083 3WT3A 5E16A 4COWA 2EAKA 2JEMA 1HXS2 4AEDB 1RUJ3 1ULEA 4Q0QA 4YW1A 1AR91 4XFCA 3ENRA 4IV3C 5F6LB 1DG6A 5FOBB 5IK5A 1GFF2 1QJX2 2OIIA 2VECA 2VW1A 3RJRA 3POSA 1ZBE1 1MVQA 1OFSA 4M3CF 1RL3A 1AYN3 1BK1A 4YARA 1LOCA 1OLQA 3ZFGA 1YRZA 1YWKA 3EBRA 3S7IA 2P34A 3JQWA 3KCCA 3KZ4C 5LEJA 1UF2C 4B29A 1J3QA 3TN91 1LOGA 3DF0A 2JG9A 5JSOA 1EY2A 1LTEA 2P3KA 2BQPA 4OI1A 3AYAA 2VGDA 4AE2A 4LEJA 1YI7A 1VAVA 2GDFA 1QMJA 3JBG2 3EXUA 3FUQA 3UKVA 5C6CA 1EAH2 1FPN3 1POV3 1B09A 3URFA 3CJXA 2GC3A 3ME2A 1BBT1 4HSLA 1GYKA 5AC93 4RL7A 4OUMA 5CB7A 4YYOA 3TWIA 5GLZA 1UL9A 3ZYJB 3JQXA 2A75A 3V65A 1AL22 1SLBA 4MXWB 1VRH1 1AR71 3SH3A 1N3PA 4FPJA 1PIV3 3SISA 3C2UA 2CWSA 2CYFA 3VZOA 4CP1A 3AZWA 1W6NA 4Q1PA 4FCAA 2ET7A 4QU2A 4TWTA 3VBFC 1OQ1A 1Q56A 4WVMB 3PVBB 2WFF2 4FXGB 4GMP1 1ZZ6A 1AR63 3WZ1A 4RS5B 4X8NA 1VALA 2ZGSA 2EXIA 4HKWA 1CAUB 4FTEA 4AQTA 3S7EA 4XFGA 4YGDA 1OI6A 1BQPA 1S55A 5JIAA 1YI9A 3WHTA 1PK6A 4I3GA 2HWF3 1ZZ9A 5FO7B 3VBUA 1NLRA 3N4MA 2ZKNA 3GBFA 1CX4A 4KU7A 4KNCA 1EYBA 1KDKA 4XBNA 4KG8A 4QM9A 1ZBA2 2ZGNA 4Q4X2 2DFCA 2WNVA 3J8F1 4K20A 5FTTC 3JZVA 1TMF2 1KXGA 4HKLA 2ERFA 4XF3A 4X6QB 2GN3A 3H9AA 1DGRA 2WA3A 5A3LA 1YFXA 4JGYA 5KBFA 2ZPXA 4XOGA 3DN7A 2VQ0A 3N36A 3NW4A 4R9DA 1WLCA 5ACA3 3PVNA 4AG4A 4ONUA 3VBSA 3ZMOA 3BCWA 2VOKA 1GR3A 2XLGA 3OBTA 1JW6A 4GB33 4FAHA 3LA3A 2D3SA 1DGWX 1IZ3A 5L19A 1ND3C 4Q4Y2 4AFAA 3HAGA 1MEC3 5CU1A 3VBRB 4DPNA 2AREA 4N53B 2JG9C 1W6PB 1H4HA 3AX4A 1ZZBA 5GZEA 5AVPA 4YW4A 4ZU4A 1UPSA 2F4PA 4H14A 2KM2A 4BOWA 5L7OA 5KHJA 3MEPA 3WDXA 4GQ7A 2B7YA 3T2TA 4CEWA 2JD4A 1QGLA 1OKQA 3B9CA 2HWB2 4EWDA 3J4UH 1WA4A 2WT2A 4GA9A 4KBBA 3UK9A 2IXKA 3ELNA 4WVVA 2YYOA 2EXHA 2PLV2 3WP6A 4JGZA 3W9AA 3ZDSA 3V0BA 2D7FA 3AB0A 2BPA2 2R072 1RVF1 3AZYA 5DUWA 4QM8A 4XJUA 1QXJA 3W58A 3WDTA 2A5ZA 1NCQB 4K40A 1DBNA 3PMSA 1J59A 4FPGA 1MZFA 3V0AB 3RI9A 3EJKA 3M3IA 1VBB1 4KU8A 2R1BA 1APNA 1TQ5A 4K3UA 4JCKA 5JZGA 1X82A 3ST7A 4YRDA 3QH6A 1PMIA 2PAEA 1AR92 3OJBA 3OY8A 3JBG3 1F5JA 1VBA1 3GZAA 4DY5A 4XXPA 3R4UA 3ZXGA 5I0TA 4LBNA 2DURA 4MYEA 5H9SA 1IGOA 4N9IA 1XU2A 4HBNA 1AL23 1NXMA 1V9U1 5K9YA 1PK6C 2NMOA 2R063 2G9FA 1X36A 3TN92 1W39A 4C90A 3VBUC 3WG1A 1MQTA 4A7ZA 1AYM2 3FLRA 1R081 5FCCA 2WNVC 3OD4A 5T54A 4BIFA 4M3CA 4ES9A 3E6CC 1EPZA 1Q3EA 2V09A 1UN1A 1HW5A 1QQP3 4QGNA 1RUD3 1H8VA 1BBT2 3ZSMA 2XKPA 4UBGA 3VHOA 5JDBA 1AYN1 4UW6A 4TLFA 5K0UA 3WW4A 4FTBA 4JGYC 1W6QA 3JD73 3AP4A 2NLRA 1QJY2 5CAZA 1CQ9A 1H2KA 1QY4A 3WLUA 3RRDA 4FPCA 3BTAA 3ECQA 3VBSC 4C0HA 1BMV2 1MS9A 2WJSA 4Y20A 4NHMA 3AZZA 1UZYA 1DFQA 1H1IA 5DZFA 2V5YA 2XVLA 3VLBB 2FMDA 5J37A 1WGPA 1CONA 1HRV3 4HFSA 4WM8A 1FPN1 1DHKB 3ILRA 3PTYA 4LO6B 4O9EA 1PO11 1D0GA 2DWRA 5AC91 4IEUA 4YG6A 4JTOA 4M3CE 4LNVA 2OVUA 5DDJ2 3H7JA 1OMIA 2XG3A 3RNSA 3KT1A 1UIKA 3ZXDA 1ND2A 2QNKA 5L7OC 3WP3A 2TUNA 3CJIA 2LUWA 1PIV1 1H8TA 4CEWC 1CESA 2I2SA 1LR5A 2IFRA 1N3OA 2C5DA 4CP2A 4KWKA 1FT9A 2CWMA 3MW3A 4KH9A 4L11A 4LHKA 3H1WA 1GZWB 5EYYA 2DU1A 4JGZC 1B35B 1YIPA 1LOAA 2D93A 3J8F2 3USUB 5LK7B 2AGSA 1UW8A 2BUKA 4I0WB 4CZSA 4XHXA 4D3WA 3VKNA 1AR61 3RSJA 1YO8A 1DQ4A 1RUI2 3H7YA 2NQYA 4HPKB 3SCFA 4QPIA 4AEKA 4DNYA 3OCPA 1JBCA 2ZGQA 1PGL2 1RGSA 5FQ0A 4L92A 2QJVA 3NJZA 3S6PA 4COUA 1REEA 5FMOL 3UV9A 2PYTA 1KDMA 4QPGA 4GKYA 5FFOC 5H9PA 4AQ6A 3ZXJA 3MZHA 4META 2HWF1 4K21A 3PMEA 4CEYB 5JZGC 4B3NA 1S0CA 4EWAA 4Q8KA 1Z0HA 4OI4A 1N1YA 4YFWA 1WMFA 1A8MA 2UWCA 5BNPA 3L9JT 2XB6C 3JU9A 3MIDA 3NAPA 4YZ1A 2PLV3 1MZ5A 1SCSA 1X8MA 2X29A 4IL7A 4YZ5A 1HRI3 4P9GA 2EAAA 1RHI3 1LJ7A 1VAMA 2D5FA 4ISRA 3ROUA 2FMYA 1OSGA 5BYNA 1WCDJ 2QZ3A 2D6MA 1LGNA 1MQTC 4H55A 1PM7A 3LCPA 3M8LA 1G9CA 4AHZA 1FATA 2GALA 3ZIXA 3ACLA 1WD4A 1JYIA 4GXLA 1H4GA 1O3TA 3WINE 5BNNA 3A4UA 2FBEA 1N3QA 1NOVA 3WDYA 4GB31 5FREA 3KD4A 2A6VA 3WP4A 2GZWA 5GZFA 2DYCA 5K0UC 2UY9A 1MEC1 1RVF2 3POWA 5GZGA 4CYDA 3WW2A 2DVAA 2B46X 4UW5A 5CADA 1XQNA 1ZX5A 1AYM3 4BPZA 1RC6A 1VBB2 3ZYGA 2JICA 3PVEA 4XF0A 2EF6A 1WLWA 2DUOA 2O8QA 4ES8A 1ASJ3 3BOWA 2SLIA 4Y1YA 5GZCA 3ZSEA 2ZGTA 1K5MA 1Q5OA 4WM8C 1NCRA 1DZTA 1LULA 3HQXA 4AVTA 4IERA 3INAA 1RUF3 2BVBA 1F31A 4OHVA 5A33A 4AHWA 2XL9A 4Y22B 2A3WA 4YGCA 1V9U2 1LU2A 3NO8A 1ND2C 1POV0 5GM0A 1ZZ8A 3CJIC 3ASIA 1H8TC 2QE3A 4NHKA 4XETA 3MF6A 4W6YA 2VXRA 3AZVA 4XJ8A 4J1WA 5I0RA 2GMMA 3U10A 4RD7A 3B00A 1RUJ2 4DFSA 3JBG1 2W68A 5E8AA 3ZXFA 3ZN5A 1RB8G 1WLTA 3O12A 1EAH1 3LWCA 4QPIC 1M4WA 2XLAA 1AYN2 2ZMNA 2JE9A 1V6JA 2R49A 4Q29A 5BNOA 2WQ4A 1MR5A 3FFQA 4QPGC 1AL21 3KCYA 4YFZA 2H0BA 2XPJA 1YFWA 3H1MA 2ZKLA 4MVTA 5I8YA 4PDWA 2RJKA 5BNPC 1VBE3 1Z7S3 4P9LA 3M7AA 4YVWB 3NAPC 3TRSB 2AENA 2ZBJA 3M1HA 4XJAA 3T1MA 1QH7A 4FVVA 1RIRA 4M0NA 2GNTA 3KT7A 4L9BA 1RUI3 2HWD3 2WL1A 1FPN2 1QQP1 2GC2A 4OHXA 2H6BA 3K48A 2XVKA 4XILA 4MX3A 1SBEA 4UBHA 4LUKA 1CAVB 1RJ7A 2RR13 3GNEA 1H1MA 4YZ4A 4XF9A 2QQPA 1TEIA 1PIV2 5SV8A 5KXEA 1D0HA 4IEYA 5BNNC 3LAGA 2VVEA 4XQWA 4S2GA 4FQZA 3NKTA 1ZBA1 3NL1A 4I30A 2IXJA 5IK8A 3VBOB 4AXOA 2K2SA 1Y7BA 2ZZJA 1KJRA 5KWRA 1AR62 1TMF1 1HRV1 1HDKA 1ZRFA 5JSPA 1LU1A 3B7MA 3QBQA 4PF5A 3UKNA 3TAYA 2RS13 4DINB 4A7YA 1CAXB 3WG2A 4XW3A 4E4DX 1AX1A 1J1TA 4FPLA 2AZ5A 2YDEA 2CAVA 2HWF2 2PHXA 4PIYA 4WVZA 4W65A 1JUHA 1XU1A 2D3PA 3VHPA 2G9GA 2DTWA 2GMPA 2RS53 1MZEA 2CAUA 4BIOA 4BMBA 4DZGA 1NA1B 1NCRC 1SLTA 1NE6A 1QH6A 3GBWA 4QMAA 2B45X 4WBBA 4LBQD 2PHDA 4G3YC 4EJRA 4NHLA 4Q4Y1 2ZX4A 2VOXA 1COV2 3VKOA 3VZKA 5FBZA 1H2NA 3OBRA 1XE7A 1G9DA 1MACA 2B5HA 2UYBA 1CAWB 1QF3A 2WC2A 1U12A 4CP0A 4IV1A 1S0EA 4PJYA 4KGGA 2VU9A 3SHRA 1AJKA 5SV5A 4XZPA 4Y1UA 3M3QA 1ZNPA 4CDWA 1ULDA 4YVSA 5ACA2 2WT1A 5T5OA 2JKBA 3U11A 2D43A 4AI3A 5C9AB 2EXJA 3APBA 3G6JB 3B94A 2HYKA 3QOPA 1N1SA 2PLV1 2UY8A 4AQSA 2IFWA 2UU8A 2WLQA 1DLLA 5KHHA 4AEJA 5BNOC 1PNGA 1MEC2 1OD5A 1F9KA 1OQEA 4E2SA 1G8WA 4XFHA 4H3WA 2ILMA 1S2KA 2DVFA 4RHV3 3UKTA 3ES4A 4NO4A 4PDWC 5GJ6A 3VBHA 2BWAA 1V00A 2F6BA 1EPWA 4ZU7A 5JOYA 1AX0A 3OGGA 2D6OX 3GHMA 3B02A 2D6NA 2BNOA 4K1YA 5CNAA 3WNXA 2BNMA 2VW0A 2WA4A 1D2SA 1C4RA 4OFGA 1QDOA 2DCZA 4FPHA 3MF9A 3KM5A 2ZGOA 1CD3G 1ND3A 5EWSA 2RHPA 1SCRA 4DS0A 3FUOA 4XJZA 3HN1A 4U2AA 3H50A 1IKQA 3D0JA 3RWNA 4BYYA 3JUUA 3R4SA 3NVCA 4Y4YA 2LM3A 5HBAA 1OOPB 3FBYA 2BYVE 3VKMA 4Z2WA 1AYM1 2ZHNA 3D5OA 2WNUA 3BIWE 4FOQA 5FAXA 2OYZA 4DB5A 5CFDB 4YM3A 1DDLA 1OQDA 2XJUA 1MZ6A 5CG9A 2N7GA 5KXDA 4UW4A 1GBGA 1GZCA 2DVBA 1OFNA 3AJYA 1MS5A 2QUOA 4E4SA 2D6KA 2FQPA 1W6MB 3AFGA 1BEV3 2NMNA 1AHSA 2D5HA 3ETQA 3IDCB 3PJYA 1KITA 1MVEA 3VDDA 1RUF1 1HQLA 1Q8PA 2OUHA 2W39A 1SDWA 4QGMA 3IPVB 1QJY1 1LGCA 2R062 2B42B 1XXNA 1VBD3 3FE5A 4Y24A 4YNIA 2A70A 3VL9A 1BMV1 4OLLA 1UAIA 2PQQA 5IK4A 1UU4A 5DUVA 1AUYA 5HI0A 3WY6A 4RSUA 1BJQA 3QH7A 3D82A 4AYUA 4INDA 1O3QA 1LGBA 3I2DA 2VVFA 1JYCA 2JECA 1QQP2 4MZUA 4HK9A 1RUD2 1W6OB 4HVQA 1NLSA 2TEPA 3LZZA 4S2FA 1H1AA 3ZX7A 2VH9A 4IV1C 2KA3A 1AXZA 5T5PA 5DDJ1 4E2QA 1WW5A 3JD72 1H30A 2D6LX 2WT0A 2ZS6B 3N7JA 5BUVA 4CDWC 4JC1A 1QOSA 4JDOA 2WZR3 4YVSC 5C8CA 3HR9A 5CFCB 3OD0A 1DQ1A 3KB5A 4FOVA 5FOJB 4BHPA 2P17A 4N9HA 2WIIB 4OULA 3I7DA 1GLHA 2VW2A 1WW4A 2NYYA 1O7FA 1VBE1 1Z7S1 1KFXL 3HT2A 1RUG2 5FPZA 4CDQB 2XH6A 1OA3A 4Q0UA 1PO22 3AMQA 2Y26A 3QD6A 4AQ2A 1RINA 3FHIB 3Q9OA 3AJZA 4BM8A 1COV3 2XHKA 1HRV2 1WCKA 1RUI1 2HWD1 3ZFEB 4Q4V3 1PGL1 1C8M3 1QKQA 1XYNA 4PIZA 1NXD1 4FPOB 3SXWA 3WDUA 4M00A 4IEOA 5TSWA 2W08A 3SNMA 4IXLA 4XE9A 3KS7A 3VBHC 2HEWF 3L2YA 3POYA 1DQ0A 1YJKA 5C4WA 2ZTNA 2RR11 2YV8A 5JAXA 3D8CA 4Q0PA 5JOZA 3KSCA 1GKBA 4B4PA 1UKRA 2C9AA 4BE3A 3N7KA 3W59A 5HCAA 3P3NA 1G86A 3T1LA 1CAWA 4NWWA 1RJ8A 4QQHA 4MGIE 2DV9A 5F6KA 2XJPA 5D8AA 4GH4B 1YCIA 2I74A 4LBOA 1AVBA 4RFT0 3RMXA 2IWGB 5I0UA 4LBKA 4S2H<