1GLHA

Cation binding to a bacillus (1,3-1,4)-beta-glucanase. geometry, affinity and effect on protein stability
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
214
structure length
214
Chain Sequence
QTGGSFFEPFNSYNSGTWEKADGYSNGGVFNCTWRANNVNFTNDGKLKLGLTSSAYNKFDCAEYRSTNIYGYGLYEVSMKPAKNTGIVSSFFTYTGPAHGTQWDEIDIEFLGKDTTKVQFNYYTNGVGGHEKVISLGFDASKGFHTYAFDWQPGYIKWYVDGVLKHTATANIPSTPGKIMMNLWNGTGVDDWLGSYNGANPLYAEYDWVKYTSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords 1,3-1,4-BETA-GLUCANASE
publication title Cation binding to a Bacillus (1,3-1,4)-beta-glucanase. Geometry, affinity and effect on protein stability
pubmed doi rcsb
source organism Synthetic construct
total genus 51
structure length 214
sequence length 214
ec nomenclature ec 3.2.1.73: Licheninase.
pdb deposition date 1994-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1glhA00
1ULCA 1S0IA 1Z0HA 2D44A 4XHXA 1CVNA 2CY6A 1MZ6A 1Q8OA 4XTMA 4XJ8A 2XB6C 2V73A 1W6MB 2LALA 1V6KA 2CL2A 3IKWA 1N1TA 3AX4A 1G86A 2GNTA 4GKYA 4OZXA 4Y1UA 4YG6A 5FREA 4LBKA 1C1LA 4BPZA 5IT6A 1G9AA 1G9FA 2YROA 1FAYA 1VAVA 1D2SA 2AUYA 3POWA 4Q1PA 5FRAA 5GZDA 4YM2A 1LCLA 1V6IA 3UL2A 1SCSA 3AJYA 4CRQA 5IUQA 2DVFA 3USUB 3RQ0A 2ZHNA 3B9CA 2DVBA 4YW2A 5GALA 1AXZA 5IK4A 1GV9A 2HYKA 2ZGMA 4DFSA 3AZVA 2ZGPA 3AZYA 4YM0A 2DURA 4Q1RA 1LJ7A 4XBQA 4FPFA 4FQ4A 3AJZA 1J1TA 3BTAA 5GZGA 1PZ8A 1LU1A 1Z78A 2C9AA 1UMZA 2PHFA 5T54A 1DQ6A 1GKBA 5LK5A 1D0HA 5DUXA 4M3CB 1BXHA 1WLWA 4GALA 2ZGNA 1MACA 2GN3A 4KBBA 2AREA 3MEPA 2PHRA 1LHUA 3OBRA 1LU2A 5L73A 3FFZA 3O0WA 2E51A 3ZSJA 1JW6A 3D5OA 1ULFA 3B3QE 1V00A 1EPWA 1UX6A 2UWBA 3WNXA 1DQ1A 2ZHLA 3O0XA 5JDBA 4XJUA 4AVSA 2D43A 1GANA 4FPGA 3A0KA 3AP9A 4K1ZA 4YLZA 1AJKA 1DLLA 3AYCA 3ZXKA 3FLTA 1A8DA 1N3OA 1AXKA 2DYCA 1LOCA 2JKBA 5IK8A 1HQLA 3V0AB 4AVTA 2GN7A 2W39A 2P34A 5GLVA 2ZGOA 4K20A 2A3YA 1KQRA 1QGLA 1VLNA 5T5JA 2R1DA 4YM3A 1VIWB 1QMJA 1CN1A 1WBFA 4AGGA 1GSLA 4JCKA 4JC1A 1S0GA 1RINA 3SLIA 1X50A 3HN1A 3WV6A 2B7YA 4FPCA 2EXHA 4LBQA 4BLJA 3AYEA 1IS4A 2UU8A 1BYHA 1QOSA 3WLUA 1IOAA 1AVBA 1W6OB 4M3CE 2YXSA 3V0BA 3KQRA 1WBLA 3PVNA 1JHNA 4XDQA 1GNZA 4XMAA 3VKMA 2ZHMA 1FV2A 3AZXA 4GXLA 1BZWA 4YG3A 3AP4A 3ILNA 3VKOA 1ZA4A 3BIWE 4Q26A 5IK5A 2DU1A 1WD3A 1WUVA 2D3PA 2ZMLA 1YO8A 3OBTA 4Y20A 2R16A 2EXIA 3FUQA 3AFKA 3M2MA 2ES3A 3H0OA 1UAIA 3Q9OA 1S0EA 2JE7A 2CYFA 3WDYA 1DZQA 3SH3A 4LBNA 2DUQA 2AGSA 2W68A 3ENRA 3NV3A 4TZDA 1CESA 4M00A 4FP3A 3AP7A 1LTEA 4XJ9A 1JUIA 3MW2A 4RA0A 3ZYPA 1DQ5A 2DV9A 4PBPA 5GJ6A 4U36A 1HDKA 1MS1A 2E7QA 2D3RA 4FOYA 4XILA 4XE9A 2OW4A 2RHPA 5DUVA 1QOOA 4PF5A 3SH4A 1W6QB 1LOBA 5DZFA 3O12A 1DQ0A 2P2KA 1JXNA 4XYXA 4YZ5A 2GALA 2NM1A 1SCRA 3M3OA 3N36A 3A4UA 1N3QA 4UW4A 5AVAA 5DUUA 1ENSA 2WKKA 2A75A 2DVDA 3GALA 4R9DA 3FUOA 5JLVA 1W0PA 4LBLA 3TAYA 1KJLA 3WG4A 3JUUA 1GICA 5GLTA 4YFWA 5GLZA 3SNMA 1G8WA 1LHWA 2GMEA 2D6MA 2JJ6A 2OUHA 2ZGTA 5DZGA 1LECA 2ZKNA 5E88A 5JOXA 1UN1A 4H55A 4NO4A 1S0CA 1W6NB 5DUWA 4XXAA 5GLUA 2D3SA 4FPKA 2KM2A 5T55A 1S0DA 5T5OA 2EF6A 3OYWB 1GZWB 4Y1XA 2A5ZA 2DVGA 2D6PA 2C5DA 5GZEA 1W6OA 1QDOA 2GDFA 1LULA 1Y7BA 2NMNA 2WSVA 3ZSLA 1KDMA 2ZACA 4YGDA 3SISA 2EALA 1LENA 3PJQA 3ZPYA 4Z8BA 1W6PA 1UZZA 2A6WA 1QNYA 3NWKA 5DXDA 4XJZA 3WOGA 2VW1A 1BQPA 1GBGA 3RG0A 4XIOA 1KDKA 5CB7A 1AF9A 3DGTA 3B00A 2ZBJA 2E53A 5EXOA 3ZXJA 1MVQA 4WV8A 3MW3A 4BQ1A 2D6LX 1SLBA 2D6NA 4FPYA 3TB0A 1B09A 1IS6A 4GA9A 4YZ4A 5KXEA 1HLCA 3N7JA 4AYUA 3AYAA 3WDWA 1Q8QA 1WLDA 1QF3A 1SACA 1DQ4A 1MS9A 4YZ3A 3AZWA 2OUJA 5JOYA 1Q8SA 3FLPA 2GNBA 5HCBA 4L8QA 4CZSA 1YIFA 1C1FA 2R1BA 2ZHKA 3N35A 3N7MA 4YW4A 3VUOA 2WNEA 2YV8A 2JE9A 5EYXA 4ZXKA 2PELA 3WG2A 3MPPG 4BMEA 4Y1ZA 2GMMA 1MR5A 1W6QA 1AX0A 1AX1A 1FV3A 3PMEA 4ZKTB 3SITA 3U4XA 2AENA 3IPVB 3WDTA 2PHXA 1PZ9A 4DS0A 4YM1A 2WQZC 3M3CA 4DQAA 1FNYA 2VU9A 4FPLA 2R0HA 3I8TA 3OY8B 4ISRA 1TEIA 2UWAA 4FOVA 1KRIA 1URXA 4GWMA 2D6OX 2SBAA 4XTPA 1I1EA 3LCPA 2ZGSA 5GZCA 2XG3A 1W6MA 1LOFA 4LBMA 2I2SA 2GNMA 4BM8A 3HR9A 2PHWA 4GKXA 5IK7A 1LGNA 2P3KA 2WJSA 4ATEA 2UWCA 4SLIA 4XJAA 1MS8A 2OVUA 2VH9A 4Y22B 4DPNA 5CA6A 3USUA 1FYUA 1GNHA 3IN9A 3AXDA 4D69A 1S0FA 1WW7A 4NOTA 3C2UA 3ILRA 2AR6A 5HCFA 4YZ2A 3W58A 2WT2A 5GLWA 1ENQA 2ZMKA 4XIKA 3WDUA 3FBYA 3NV2A 4YW5A 1F5FA 5F5QA 1YI7A 2ZMNA 3UJQA 1S0BA 1Q56A 3N7LA 1WW5A 2CWMA 5BYNA 4Y1YA 4YW3A 2W52A 3OPZA 2R49A 3INAA 4M3CA 1S0JA 4AGRA 1V6MA 1SLLA 4XMIA 2BQPA 4HANA 1LEMA 1ZM1A 1KJRA 1S1AA 1V6LA 4FOWA 4AGVA 1LHVA 2E6VA 4Q8LA 1Q8VA 5DZEA 4ISQA 5JVVA 2W08A 2DWRA 4UW3A 2P3IA 1IS5A 1ULEA 2A7AA 3ZYRA 1HQWA 4XOGA 5H9PA 4LBQD 4LBJA 1JYIA 4YZ1A 1O4ZA 1F31A 1YYNA 1WW6A 2PHTA 4LBOA 5SV8A 1G7YA 1ONAA 1LESA 4ATFA 3W59A 1N1VA 1IS3A 3BOPA 3LSEA 5H9QA 5T50A 3AP6A 1BJQA 2CNAA 2H0BA 4IQPA 4P9XA 2ARBA 1SBDA 3RS6A 3VV1A 2WLQA 5JOZA 3ZXLA 1FNZA 1MZ5A 3V0AA 4AVVA 1PZ7A 5H9SA 1RITA 2JD4A 3O5SA 3WDXA 4Q27A 1GYKA 2A6ZA 2EAKA 5CNAA 1V6JA 2CTVA 2ZGKA 3ZXFA 3AYDA 2EIGA 5HCAA 1JN2P 4YGBA 2FHRA 4WZFA 1V6NA 3ASIA 3WDVA 3SH5A 3ZXEA 1GZ9A 4Y26A 3MW4A 1CONA 1C4RA 1N1SA 2A3WA 4MYEA 1WCSA 1XQNA 3KM5A 4DRVA 4WVWA 1CIWA 4P14A 1MS3A 4Y24A 1FX5A 5DG1A 2Z42A 5GM0A 5T52A 4Q8KA 2P3JA 1NLSA 2ZGUA 4P9YA 2A70A 2EXJA 2WT1A 4XBNA 4Y22A 5T5PA 3WZ1A 3V64A 2WSUA 2FMDA 3V65A 2ZGRA 1G9BA 3AZZA 1A3KA 1DYPA 3AXEA 2DTYA 4K21A 2A6XA 5GZFA 1LODA 2ENRA 4LBQB 4ASMB 1ULDA 3RSJA 1N1YA 3IMNA 1DBNA 4XXPA 3PVEA 3WG3A 1CJPA 1SFYA 3R4SA 1UKGA 4PBOA 3UJOA 4Q2FA 3V0BB 1GLHA 3T1MA 1H9WA 1H30A 1LHOA 2VW2A 1AZDA 1N47A 1QOTA 4TYSA 1IKQA 4K1YA 5KXCA 3NV4A 3UK9A 1I3HA 4XBLA 1H9PA 4FOQA 4PQ9A 4BOWA 2ZA9A 2ZZJA 1LOEA 3DUIA 3ZSKA 1BKZA 1KITA 2GNDA 3A0NA 4R9CA 5CBLA 1WLCA 1LGCA 3D4KA 4Y20B 3WUDA 3CNAA 1GZCA 3ATGA 2DU0A 1CPMA 2ZABA 4FPOB 3N3HA 3VKFC 3M3QA 2A6VA 4C1WA 4AWDA 2DUOA 1DFQA 1CR7A 4F83A 2A3XA 1UZYA 1FATA 4UW5A 2NZ9A 4M01A 1JBCA 5T5LA 1WD4A 2AYHA 2NMOA 2R0FA 2VY0A 2JDZA 5F9TA 2PHUA 3RMYA 3ZSMA 2G4IA 3M3EA 3FLRA 3ILFA 5KXDA 1IKPA 4FPJA 3GNEA 3VKNA 4YFZA 3POYA 2DVAA 1OQ1A 1MS4A 2D6KA 4YG0A 5E89A 1CPNA 4HL0A 4XHBA 2E7TA 1W6NA 1DYKA 2TEPA 1QKQA 4FQZA 1DQ2A 1N3PA 5CAZA 2YZ4A 3PVOA 3APBA 2ZGLA 3IM0A 1G9DA 3OYWA 1C57A 1GZWA 4ITCA 3RRDA 1SLIA 3NV1A 4C1XA 3N7KA 4WVVA 1APNA 1VALA 1MS0A 1R1ZA 2VW0A 4CTEA 1A78A 2ZAAA 3R05A 1DGLA 3QLQA 4FVVA 1QNWA 1AJOA 2P37A 3WHTA 2V5YA 1AXYA 2GMPA 1UL9A 1LOFC 2A6YA 4XZPA 3LSDA 1LOGA 4M3CF 4DRRA 1YXWA 4YGEA 5E8AA 1LEDA 2NN8A 3B69A 4YW1A 3O0VA 2EXKA 1OKQA 3D6EA 3POSA 5EWSA 3T1LA 1CQ9A 1LGBA 3ZVXA 2YMZA 3AP5A 4RL7A 1QDCA 1OFSA 1U0AA 2D7FA 2SLIA 2NYYA 3B01A 1O4YA 4PCRA 1W6PB 3BODA 3L2YA 4P9WA 2CWSA 2AH2A 3WVJA 5KXBA 1SLTA 1MVEA 5EYYA 1SLCA 1G9CA 2YY1A 1DIWA 4UW6A 2VUAA 4JRAA 5JMCA 1W0OA 1Q8PA 2A71A 4BMBA 1JYCA 3VKLA 3WHUA 2Q5TA 4I30A 3WUCA 2DTWA 1AX2A 3T2TA 1VAMA 3HMYA 1WW4A 2WT0A 1JOJA 1HKDA 2NP0A 3R4UA 2UURA 1LHNA 4GWNA 1UPSA 3IPVA 2ERFA 1RIRA 1YRZA 3OGGA 4R9AA 3RMXA 5H9RA 2ARXA 3AK0A 3OY8A 4FP2A 1NXD1 4U2AA 4W65A 4Y1VA 4FPEA 3WCRA 1QU0A 1MS5A 1SBEA 3QCWA 3WG1A 2LTNA 4R9BA 2DUPA 4XJWA 5JOWA 2ZGQA 3OJBA 2VXRA 1DHKB 3JU9A 4FPHA 1ULGA 2JECA 3M1HA 4YGCA 5DG2A 1F9KA 1ENRA 3I4IA 4BLIA 1SLAA 1LOAA 1V6OA 1SBFA 3WCSA
chains in the Genus database with same CATH superfamily
1ULCA 2E26A 1Z0HA 1XNCA 1BVVA 2ORZA 4IETA 3VDBA 2AEZA 2QQIA 2WWSA 2FDIA 4B1MA 2RDNA 4OCTA 3NNJA 4JGZA 3WNNA 1JZ7A 4EZHA 3AX4A 2QQJA 2W47A 4GWJA 2GP3A 1RUG2 4E9KA 5D8AC 3ZDSA 4BPZA 5CEHA 1MQTB 1NE4A 1HRI3 2BP6A 1VAVA 4YVSA 3POWA 3PJYA 2VCMA 2D5FA 3UL2A 5BV6A 1SCSA 5EPAA 2DVFA 2IXJA 2R043 3RQ0A 3CZUA 4JDOA 1AXZA 2ZTNA 2HYKA 2IUWA 4QPGB 5BNNA 4DFSA 3QBQA 3RYPA 4BXFA 1ACCA 1MEC1 4YM0A 4CCOA 5C9AC 2Y6KA 3ES4A 3SKVA 3EB7A 3WR0A 4MGIE 3WEZA 2A73B 1UU4A 3AJZA 4HBNA 1H0BA 4LT5A 2HWE3 1U5IA 1UZWA 2PHFA 1DQ6A 2RS53 4WM7A 4TN7A 4CEYC 1H1MA 3M8LA 3ZFEA 3ZYFA 3LKJA 4K3UA 1ZBE3 1XNAA 3G7DA 2PHRA 1L7LA 2JKXA 1MEC2 4IEUA 5K0UA 3RYRA 4QX0A 3O0WA 5FZCA 3MBWA 3RZZA 1B35C 2UY9A 3D5OA 2B4KA 3J7MA 4BB3A 2RM23 3B3QE 2UWBA 1EPWA 1UX6A 4FBFA 1SQ4A 4PDWA 3I2GA 1MZFA 4GULA 4L99A 5FZFA 4XJUA 5JDBA 1GANA 5FY8A 4GMP3 1AYN2 3DL3A 3NNGA 4K1ZA 4YLZA 2J1RA 3FL7A 3NL1A 3NNMA 3THDA 5LEJA 2FBEA 5EJ1B 1DLLA 3S7EA 1O59A 3ZXKA 4XCAA 3SC7X 2DYCA 1UMHA 5IK8A 2VZOA 4KGQA 2A1XA 3MIBA 4EROA 2PN5A 1UNBA 1RXGA 4QX2A 5GLVA 5KHHA 4DXSA 4AEDA 1KQRA 4EWDA 2FQPA 3MUY1 4J1WA 1C28A 4LKEA 2XHKA 5FZKA 4O9GA 4MGQA 4E4DX 3UT0A 1XYPA 4NHYA 2ID4A 3SLIA 2WL1A 4NIAA 1TNRA 4FPCA 4ZONA 5JXHA 2HEVF 5DAQA 4A2UA 4BLJA 4EE2A 3O1OA 5LBFA 4AEMA 1AVBA 4XF3A 4MUVA 2HWB1 4XDPA 2YXSA 4ZS2A 2Y64A 2E63A 1Y9QA 4KQ7A 2PFWA 3HNYM 4K6BA 4XDQA 2WO1A 5C9AB 3NNLA 4XMAA 4OI2A 1W0NA 3AZXA 4GXLA 2JG8A 2YUEA 5CKMA 4LE3A 4JX0A 3E1F1 1JOPA 3CDZB 4AVAA 5IK5A 1WD3A 4I2OA 1WUVA 3C7OA 2X10A 2R16A 4ES8A 2HWB2 3AFKA 4LA3A 4XF4A 4OQ8A 4QPYA 4X8NA 5FP7A 3Q9OA 1S0EA 2JE7A 2CYFA 4DZGA 3NKGA 2BPA2 3I2DA 3HD8B 3D8CA 3L2HA 3ENRA 3USSA 1B35B 1SHWB 1CESA 2BGCA 4M00A 1BEV1 1O8SA 4FP3A 4XJ9A 3VZJA 3SEEA 3ZYPA 4Q0PA 1HV1A 2R041 4PBPA 5GJ6A 4Q4W1 4U36A 3WW1A 4AQTA 2QJVA 5A70A 4H2AA 4XILA 1AR81 2OW4A 2OXBA 2RHPA 3SHRA 2BWAA 2WS91 3IAPA 1POQA 1ZX5A 1QOOA 3LIHA 5FK7A 3SCFA 2VULA 5DZFA 3O12A 3E5QA 2B8MA 1XE8A 4V2VA 4GQ7A 2NM1A 3N36A 2LROA 4AXOA 1N3QA 1BEV2 1HJGA 5DUUA 4D8MA 3KZ4C 3FMGA 3GALA 1W0PA 2R042 2DFCA 4JGYA 2VZ3A 4Q4W2 4LBLA 1PVC1 2JIJA 2WYSA 3ZFFC 1GP4A 1AR82 5GLZA 3SNMA 1LHWA 5ACA3 2WS92 1E5HA 1QXPA 2D6MA 2JJ6A 5DZGA 5E88A 4CXXA 1L7RA 4NO4A 1NT0A 1OA2A 1ZA7A 4RQPC 4XXAA 4BU2A 1JZ8A 4NHXA 4FPKA 4AI1A 1FXZA 1L3JA 3FBMA 2E32A 4IW3A 1OKOA 5ANQA 4GH4A 1AUYA 1UWWA 1PVC2 4CP1A 1CX4A 4Q0VA 4GMP1 4D6RA 1W6OA 2WSVA 1DF0A 1JMUB 5JR2A 4CDXA 3P3PA 3BB6A 4EN0A 3N4MA 4KWJA 1LENA 4PLNA 3AVSA 4HFSA 5DDJ1 4Q0UA 1GU3A 3UKVA 5FYIA 2KR2A 2TBVA 3NWKA 2PQSA 2W5FA 5M0TA 2VW1A 3BOWA 3E6DA 4CP9A 2Y6HA 4XDOA 3DGTA 3B00A 5GKAC 1OA4A 4WV8A 3BPSA 3MW3A 3MYXA 4PIXA 4OHZA 4EN6B 3I3DA 1AR63 2JB8A 3OCPA 1VP6A 4V2WA 1B09A 1CAWA 4MGZE 4Z1VA 1OLME 2OS2A 3N7JA 5FUNA 4AYUA 5JSRA 5KR7A 1JZ6A 3NW4A 5L7OC 5DDJ2 2QQNA 2ZKLA 1O7FA 3AZWA 5A3PA 1PIV1 1HW5A 5JOYA 3FLPA 4P08A 1GOHA 5HCBA 5KWRA 5A33A 2VQ0A 4B29A 1PM7A 2ZHKA 4MHUA 4YW4A 2Q1MA 4NUBA 1AYM1 2C1FA 2WNEA 2Z5WA 3KV4A 5IVEA 1OD3A 4MHRA 5F6LB 2K2SA 4BMEA 4IL7A 5A3UA 5FO8B 4WM7C 4FAGA 2HYXA 2FDJA 1AX1A 1FV3A 1REEA 1PGL1 3ZYGA 2JXAA 1R1A1 3I3BA 3SITA 3U4XA 3VBSA 1PIV2 1RHI3 1C8M3 4DS0A 4Q29A 5K0UC 4YM1A 3MIFA 3ZFFB 5JAXA 5G05L 4KGGA 4DUWA 2VU9A 3WNMA 2R0HA 1YQ8A 2UWAA 2GZWA 2VXJA 1AYM2 1URXA 3EO6A 3T2OA 4JKMA 4GWMA 4HKOA 2VQTA 3LCPA 4PDWC 3OPTA 3RVHA 5F6KA 4Y5TA 5E6HA 4LBMA 3KQ4B 1QQP3 1PGL2 3ETQA 3KV6A 3OG2A 1U12A 5FPLA 1OA3A 1R1A2 3ABZA 3HR9A 4AHXA 2PHWA 5FZOA 4GKXA 2FDGA 5IK7A 4ATEA 1ND3A 4GAZA 1U5YA 1OPOA 1UXXX 3OTFA 4GZ9A 5CVRA 4XJAA 1DGWX 2QQLA 5I0TA 4K8RB 2IFWA 4FO9A 4Y22B 5EFUA 1VPHA 1VBD1 2W1SA 2W91A 3SMHA 3USUA 3IN9A 4AEJA 4N8MA 5CA6A 5LCWL 5ISLA 1NKGA 4FFGA 1WW7A 4EWEA 4AEDC 2VBBA 5FMOL 4CEWA 4ZPIA 1HJFA 1NQDA 1F5FA 2QDRA 3K4AA 4XURA 1CJDA 2JDNA 3VZOA 3MFCA 4DY5A 1YI7A 2ZMNA 5FZAA 1Q56A 4YVSB 1O91A 4A7YA 5BYNA 1VBD2 5K7PA 4K40A 3OPZA 2R49A 5EJ3A 4M3CA 4AGRA 4DO0A 5KHGA 2ZX1A 1SLLA 4ET7A 2BQPA 4HANA 3RFRA 3KVAA 3LPFA 4FOWA 2O8OA 5F2WA 5I8TA 3WT3A 1VB4A 1Q8VA 4XUOA 5DZEA 2W08A 2MEV1 2VM9A 1JH5A 4IE6A 4UW3A 3ZLIA 1XE0A 2RR11 2JG8C 4IEQA 1QJU1 4R8HA 5DQ0A 2A7AA 3NAPA 4LO7A 5H9PA 2XWJB 4QX8A 4XW3A 1YJKA 4WM7B 2N7GA 2PHTA 3ZFEB 3PNAA 1G7YA 1ONAA 3ZN5A 3U10A 2Z79A 1OT5A 3AMMA 2H0BA 3R0RA 4IQPA 3WP5A 5A6XA 5K0UB 3ZXLA 2MEV2 2W46A 3PTRB 2C24A 3SCGA 3V0AA 1QJU2 3QH6A 1W8ZA 3JXSA 2W0XA 2XGXA 1AR61 1ENXA 1BLZA 1TMF3 5KHKA 1W03A 3WDXA 3N9NA 5IVVA 4Q27A 4PDWB 4AFBA 1ODNA 3ZXFA 4LEJA 2CTVA 4X6QB 1A34A 2EIGA 2FMYA 3MV01 4YGBA 4P02B 3GDBA 2Y26A 2YPDA 5L9BA 3K48A 1GZ9A 4N9IA 2G1MA 1UOFA 4BQWA 2XVLA 1C4RA 1N1SA 3CKHA 1W2UA 2YC0A 4XUPA 5AFBA 1RUE3 4RHV3 1FX5A 5T52A 2Z42A 1AR62 2P3JA 3O1TA 1KS5A 2ZGUA 2OT7A 1DLCA 1JS9A 4AEDB 2BV4A 3WZ1A 4CCNA 2Q8EA 1CAVA 4URTA 1RHI1 3ZOIA 2WAOA 2XJUA 2R30A 3AXEA 2DTYA 3ZPOA 4JV4A 2A6XA 3R4DB 5BNPC 1X8EA 4Q4V3 3BVCA 4ASMB 3RSJA 4QKDA 3FZ3A 2PYTA 2VECA 4PBOA 5FZ4A 5A3WA 2VW2A 1AZDA 1NA1A 1N47A 1QOTA 1RHI2 4CDXC 4KNCA 5KXCA 3LFMA 2JG8B 3MLJA 3MZHA 2QVSB 4LUMA 1NLQA 2B9UA 4P5HA 3ZSKA 4E4HA 4CYDA 1YWKA 3A0NA 3K4DA 1BHGA 4GB33 3VD5A 3H3UA 3WNLA 1XNKA 2K46A 3F2ZA 1D2QA 2YFZA 2O8QA 1H2MA 4Q0QA 1UOBA 3M3QA 4PLMA 5FZGA 4QT6A 2VGDA 5A32B 3FHAA 4LJHA 3D0SA 5A7WA 2NZ9A 4M01A 4QB6A 5T5LA 2P1BA 2XQXA 2JDZA 2QQKA 2PHUA 1W8UA 1XU2A 3AMNA 2Y6LA 2JICA 4Y4YA 5CU1A 3RMYA 4C90A 2VZSA 4EN9B 4XABA 2D97A 5KXDA 1QXJA 1V0AA 2E7AA 1QWRA 3GNEA 3VKNA 5AC93 4TTGA 3S7IA 2DVAA 4NPLA 1IPJA 1DYKA 1WWYA 1QKQA 4FQZA 4W6XA 5JR7B 4DY3A 2OIIA 2L9LA 4FTEA 4AG4A 2YU1A 1C57A 2PAEA 1GZWA 4ITCA 3RRDA 3LF7A 4JGYB 3VBSC 1DDLA 2HWD3 3DV8A 4OYUA 5DAWA 3LA3A 1M06G 4NHMA 1R1ZA 3H8OA 1A78A 1H6YA 2V4AA 2ZAAA 2Q1ZB 4LULA 5FPVA 1VAKA 1HN0A 2VO5A 1NZIA 5JXJA 1EYBA 3IDCB 4JQRA 1R093 3HNBM 2DCYA 2GMPA 1UL9A 3IBMA 4HK9A 2IC1A 1TMF1 1LOGA 2BERA 5FXZA 3T2QA 1Y3TA 2VTFA 4FXKB 5E8AA 2JDHA 3B69A 1SFPA 4GH4B 3POGA 5FP9A 3N9QA 4LLOA 4EJRA 4CU7A 4JZRA 5EWSA 3T1LA 4NR1A 1Y9MA 2DFBA 2XLGA 4XF9A 4UFJA 2YMZA 3AP5A 4RS5A 4IGOA 4CDXB 2VZRA 2WABA 4QAWA 3H1YA 4EYUA 3MIHA 4QDSA 3MIDA 3RWNA 2VCAA 1R083 2AH2A 2K0GA 1ULOA 1TMF2 5DABA 4CEWC 5FO7B 3POBA 1BK1A 3GCXA 1G9CA 3VL8A 1ST8A 3AC0A 1D0GA 2R073 4XF1A 4CP9B 1W0OA 4Z2WA 4Z07A 4JVAA 1IHMA 3T4VA 1DGRA 3KGLA 4LOTA 3WHUA 2EICA 2DTWA 5J09A 1CAWB 3ROUA 3R4UA 3ZXAC 4UAPA 2X29A 3UKTA 1W99A 2RMU3 3WW2A 3RMXA 3AK0A 1C3HA 1UOJA 2JWPA 2VCCA 4Y5SA 5LWBA 3SCHA 5A33B 2ATFA 1NCRA 3NAPC 4FP2A 1NXD1 4NRQA 5F8PA 5JZGA 4URAA 4PF1A 4CVUA 4E27A 4C8DA 2FD8A 5IVYA 1QU0A 1MS5A 4ASKA 3WY6A 4AW7A 4DXRA 4R9BA 3OJBA 1XOYA 2VXRA 5A3OA 3VBSB 4AFDA 5BNOA 2JECA 3ORJA 3ZXGA 2Q30A 5LB6A 5EV7A 1LOAA 1SBFA 2E31A 2AC1A 4XEZA 3WCSA 5JOZA 1OQDA 4XHXA 4OHYA 4IE0A 4XTMA 3QH7A 4CCEA 2F4PA 2V73A 2O14A 2XB6C 3JD73 1O5UA 1ZYBA 3IKWA 3AKRA 5EZWA 4A6OA 4FI9A 4BZ4A 4GKYA 4NE9A 5FREA 1PGSA 3LE0A 4LBKA 5FZOB 1G9FA 2HEYF 5F7UA 5HV4A 1ND3B 2YROA 1D2SA 2AUYA 4Q1PA 3CJIA 4QGNA 4A4AA 3AJYA 3U1XA 1ULPA 5J1XA 4XVHA 3KF5A 3USUB 2ZHNA 5GALA 4DEQA 2ZOEB 3LB9A 4UFKA 3VBUA 5I0UA 2DF7A 4CDWC 3VHPA 1TE1B 3AZVA 4CDQA 5L19A 4CEWB 4Q1RA 4IERA 4AE2A 4FPFA 2O0OA 2H6BA 4KI5M 5AC92 1PZ8A 2C9AA 4Z82A 4CP2A 4IE7A 1GKBA 5LK5A 1OPMA 2X09A 4BE3A 4M3CB 2VMCA 4CUCA 2F4LA 2ZGNA 4KBBA 2YG0A 2AREA 4QQLA 1JUHA 1Q43A 1WCKA 4A44A 3I2IA 3OD4A 1NA1C 4QKFA 3ACIA 1KXGA 5FY5A 4COWA 2Q8CA 4QM9A 3NAPB 3ZSJA 2FZ1A 5IAXA 3WQBA 2ORXA 5BY5A 3U07A 4DB5A 1K3IA 2EAAA 2HJIA 2BW8A 3IB3A 2D43A 4BQYA 1QEXA 2P6CA 4XAAA 3A0KA 3AP9A 4IV3A 1AJKA 3TEZA 1KFXL 3RZMA 1OHFA 4CU6A 4N90A 5IVFA 3FLTA 5I0SA 2R071 3MI8A 1RYYA 1LOCA 3V0AB 1S55A 1HQLA 4QXKA 3C7GA 5LRRA 2W39A 2P34A 2VE1A 4HG6B 3KMHA 2A3YA 1QGLA 2R1DA 4YM3A 2XL9A 4DUXA 4E2SA 1GSLA 1YI9A 4JC1A 2PLV1 1S0GA 2VOXA 2R072 3WV6A 1SZBA 5FBZA 1HN1A 4XUNA 4QGMA 3S5AA 2QFEA 3VBRA 3B94A 1MQTC 4CUGA 1RUOA 1HIXA 5FLHA 1DCSA 1J1LA 1WBLA 1CAVB 3PVNA 4XAEA 3VZLA 4ASLA 4S2GA 3FWEA 2RMU2 4QPGC 1FV2A 3AMQA 4H7MA 2PLV2 4I01A 1YUDA 3ILNA 1CZTA 1JTZX 4CSWA 1E5IA 1HX6A 3KT1A 2EXIA 3FE5A 4WM8A 4L11A 2JDAA 1W06A 2R061 3VBFA 2VOKA 3AKPA 1NE6A 1DZQA 3WDYA 1NA1B 4LBNA 5I91A 4KG8A 1G6NA 2AGSA 4RS5C 4TZDA 1QXRA 2VVDA 2VZPA 4JQTA 3AP7A 2RS31 4RA0A 1DGWA 1W8NA 5FO9B 4AF9A 3NJVA 3ZMOA 2FDFA 1Y9GA 3NVCA 1MS1A 4A45A 4FOYA 2WNUA 2R062 2HWB3 3HBKA 2OQ7A 5SV5A 4PF5A 2AEYA 1W6QB 3SH4A 2P2KA 4XFFA 1JXNA 2VZTA 1ZRCA 2GALA 3KV9A 5A7WB 5HPOA 4COZA 2RDRA 3NJYA 2A75A 4TLFA 2XOMA 1CX1A 2HEWF 3WG4A 1GICA 2C4XA 1UYPA 4AQ2A 1G8WA 2RE9A 4YPJA 2GMEA 1IQDC 2OUHA 3HQXA 5JOXA 1UN1A 2HKXA 2VZ1A 3JB8A 3KSCA 3U11A 1UQXA 2D3SA 4N53A 4LA2A 2ARAA 4D3WA 1S0DA 1BEV3 3IIIA 1UO9A 4A6SA 1GZWB 3MGUA 4LO4B 3T0DA 2PTMA 2J7MA 2DVGA 1PX4A 2D6PA 4LORA 2GDFA 2NMNA 3RNSA 4Q4W3 2ZX0A 5C71A 2CAVA 4BYYA 4BWOA 1TG7A 5FAXA 3VHOA 1AR83 4FAHA 2VMGA 1KDMA 2WS93 3LEMA 1UZ0A 3P3NA 4HKWA 3BTYA 3OF1A 3H42B 2P4EA 2A6WA 5DXDA 1T2XA 4XJZA 3LA2A 1BQPA 1GBGA 1PO21 1W2NA 3LDBA 4XIOA 1RUD1 1CAXA 3RG0A 3VGIA 2ZEXA 5JI9A 5LZ6A 5CYYA 5EXOA 4P5YA 2E53A 4FSJA 4QXHA 1MVQA 3VLBB 4BQ1A 1PVC3 3CJIC 4FXGB 5ABJC 3OEBA 3BU0A 5EJZB 1UW8A 3ZFGA 2RDQA 4RS5B 2XKPA 3DXTA 4IEXA 3LAGA 3WDWA 4AI2A 1WLDA 1SACA 1DQ4A 4CDQC 1F8VA 4YZ3A 3OOXA 2OUJA 1S2KA 1Q8SA 1VRBA 2BOJA 2EVXA 2GC0A 2ILMA 1C5IA 1PO22 4AI8A 1RUD2 4L8QA 4CZSA 4QPIA 2KXLA 3NSTA 3N7MA 3N35A 1JU3A 2YBSA 5EYXA 5DAPA 4GJYA 5FTTC 1UD1A 4TXWA 5FZ7A 1AX0A 3T08A 3FJSA 4CCDA 3BIEA 2B42B 4UT5A 5LW9A 4MOAA 3C7EA 4FCAA 4DXTA 5IVCA 2AENA 2D98A 5DDJ3 1PZ9A 4F3JA 5FMBA 2ZX3A 3EHKA 4DQAA 4QX1A 5FYCA 4LE4A 4FPLA 4JTNA 4ARYA 1TEIA 5FFOC 2BTVC 3O7OA 4M0HA 4JAAA 1KRIA 4Q4Y3 2D6OX 2SBAA 1GQPA 4QWNA 4YYOA 3N9MA 1W6MA 4W6YA 1LOFA 1EY2A 4YVWA 1BCXA 5FY1A 4ORFA 2P17A 4MG2A 4NAMA 4BM8A 1COV1 1SFNA 4IV3C 5JPMB 1IZ3A 4J1XA 3TRSB 4IGQA 1LGNA 2P3KA 3LDRA 3OPWA 5BNOB 1PIV3 2XH6A 1AHSA 1VRH1 4SLIA 2OVUA 2VH9A 4I09A 2IXHA 3DYPA 1WKYA 1GNHA 1CGPA 3AXDA 1Y4WA 1OQEA 2WZEA 1AYM3 3C2UA 3ILRA 5A1AA 4YZ2A 1M4WA 1BMV1 3P5BA 3BUCA 1SPPA 4JHZA 4XIKA 1COV2 3U75A 3WDUA 3NV2A 4XFBA 4YW5A 1KGYA 1OOPA 2XVGA 1QJFA 2QQMA 2Y8KA 3B5LB 3RZLA 4PI0A 1R1A3 1RC6A 3UJQA 4A42A 1WW5A 1PVXA 2WINB 3LOIA 3POIA 3I49A 4IXLA 3CJIB 5FYBA 4Y1YA 5CFCA 1UF2C 4YW3A 2VUCA 2WO3A 4QPWA 3A22A 1YFWA 4J25A 3ZKYA 4X8PA 3O1RA 1KJRA 1V6LA 4E8DA 2XUMA 4CDQB 3PHMA 4OQ9A 4RSUA 1BMV2 5JVVA 1OI6A 2DWRA 2W92A 4QXCA 5C5TA 2VC9A 4IEOA 1IS5A 1ULEA 3GYDA 4R4XA 2VNRA 4YSFA 4IEYA 4OUEA 3WQ1A 4AZZA 4BA6A 4BCUA 5ABJA 2BVBA 3I2KA 3UGGA 1WW6A 4LBOA 4NAOA 1W2AX 4QU2A 4WM8C 1LESA 1VBD3 3R6SA 3W59A 4QMAA 3I3MA 1IS3A 3BOPA 4MADA 4LLFA 1FT9A 4QQOA 4N43A 5T50A 2C9KA 5A7OA 1CIYA 1SBDA 3RS6A 4QX5A 5C8CA 1PO11 2QZ3A 2ZEWA 1FNZA 2BNNA 1MZ5A 5LEKA 1JYXA 4XUQA 2G9GA 1RITA 4UFMA 2A6ZA 5CNAA 1V6JA 2ZGKA 3PURA 1D4M1 1JN2P 3GF6A 4IV3B 4META 5DN2A 3ON7A 1CZSA 3SH5A 4Y26A 1PO12 5A6ZA 1V9U1 5JWPA 1YNAA 5F3EA 4AHZA 4MYEA 4IUGA 1WCSA 4DRVA 2MEV3 4WVWA 4ARXA 1CIWA 2RR13 2WFF3 3OBZA 4P14A 5DG1A 1QJU3 2DCTA 4HN0A 1NLSA 4P9YA 2EXJA 3GZEA 4NPRA 5T5PA 4UXAA 1W04A 4XUTA 2Z2SB 4ZY9A 1D4M2 2ZGRA 3ELNA 3WP3A 1G9BA 4JTOA 4CCCA 1A3KA 4JGZC 3K51A 5AVPA 1P8JA 2XVKA 5E16A 1ULDA 2K9ZA 1N1YA 2C26A 1DBNA 5D21A 4N53C 1TQ5A 1CJPA 1S2EA 3NRUA 4Q4Y1 4YVSC 1OFNA 1UKGA 4BQ5A 3H9AA 3UJOA 3J9SA 4Q2FA 5J98B 1W8FA 5G04L 1LHOA 4D0QA 5A7SA 3BN6A 2WFPA 4LHSA 3ZYJB 1IKQA 1RUI3 5BNNC 1TNFA 5I0RA 4XBLA 1H9PA 4RN5A 5E1RA 3FC0A 2ZA9A 5FKCA 1ZRDA 1AL0G 3OB8A 5AFEA 1KFUL 3KHBA 1OLRA 4Q4Y2 1GOFA 4FT8A 3CNAA 1GZCA 2Y0OA 2HBUA 3GHNA 4WM8B 3WUDA 3MIGA 5FUPA 3ATGA 2DU0A 3I2FA 2IWGB 2BBAA 2LM3A 2WN2A 2ZABA 4RGKA 3VBFB 2VMHA 3GBWA 3H8UA 4XQDA 1ZZ7A 4HT1T 4LOSA 3ZFEC 4F83A 2JIGA 3ZFGC 1JZ5A 1FATA 4MZUA 4UW5A 1PM4A 2X5IA 1NYWA 4OI4A 3NJXA 1POV0 1WD4A 5C3PA 3THPA 2VY0A 2VJXA 5F9TA 3M3EA 4N9HA 3HNMA 1PMIA 4J6GA 2B46X 2VBPA 2WNUB 4FPJA 4B4RA 3Q8BA 1H6XA 3MLLA 3MPBA 3POYA 4YG0A 1MS4A 4W50A 5E89A 1CPNA 3KV5A 4QDQA 4XHBA 5J7MA 4I3PA 3J4UH 5A3TA 1W6NA 1Q5OA 1YQCA 3VDAA 4NVPA 3IM0A 4LMFA 4NWVA 1PNGA 3DPRA 2VL4A 2X8KA 4IGPA 5LATA 3N7KA 3HBZA 4NMIA 2B9VA 4CTEA 2VW0A 4Q0SA 2I74A 3QLQA 4JGZB 4TWTA 4COVA 2P37A 4W4ZA 3S30A 2OKXA 4AFAA 1LOFC 2A6YA 4N53B 4XZPA 3LSDA 1H8TA 4C0HA 2OYZA 1ALYA 4M3CF 1YXWA 2RJLA 4YGEA 1LEDA 5FPZA 4E4SA 1GQHA 2WQ4A 3WNOA 5C70A 5IFPA 2EXKA 1E5SA 2W1WA 2GSYA 1NAEA 1PGW1 2YFUA 3D6EA 3POSA 1XU1A 4NHKA 1SMVA 5BNNB 4XQ4A 3JQWA 4CE8A 3BCWA 1ZZBA 1OFSA 2SLIA 2V72A 2X05A 3VL9A 5A1LA 3MV11 1BBT1 1GQGA 4P9WA 1YQ5A 2WFF1 1LR5A 3WVJA 5BPXA 1SLTA 3AVRA 2VR4A 3TYJA 3B7MA 4UW6A 1O3QA 2VUAA 3QACA 3MIEA 5JMCA 1CAXB 3GXUA 1Q8PA 2A71A 3RWKX 4O7XA 5FOJB 1JYCA 3VKLA 3BGAA 1W3XA 4IEWA 5CFCC 1U5ZA 2MNGA 2QQPA 3ZFGB 3T0BA 3HMYA 1WW4A 3WXPA 5HCHA 1HKDA 4AAPA 1BBT2 3UNPA 2F17A 1RGSA 1ZZ6A 2RR12 2WFF2 3IPVA 1IG3A 5CISA 2CDOA 5H9RA 2ARXA 3BKZA 2VZQA 2VUDA 4EZ4A 4C91A 1F15A 5B4XA 4D7SA 4QPIB 1NCQA 5IJRA 4ZU5A 4CXYA 4TLGA 4HN1A 4U2AA 4W65A 3M3IA 4DOUA 4MX3A 1RUI1 2VG9A 2WIIB 3AKQA 4FPEA 3MO4A 4UOJA 3RGBA 4BHPA 4UI9L 3J7HA 3QCWA 2CSGA 4AK3A 1IGOA 4LUKA 3BTXA 2JEMA 4XJWA 3NJZA 4WBBA 3A23A 4CDUA 1QJEA 4N43C 1O4TA 2VTXJ 5C3RA 2P3YA 3E6BA 4WVMA 4I3GA 2YB7A 3RI8A 4BK5A 2ZZQA 1F9KA 1REFA 4JHTA 4M4RA 5LBBA 5HI0A 1XRUA 5C3SA 4JGYC 5FK8A 5FV3A 5TSWA 2D44A 4C0BA 3KCXA 1UYZA 1RUI2 2CY6A 4OUMA 1VR3A 5J48A 3THTA 5HBAA 5J96B 1ZVFA 4B4PA 1NY71 1W6MB 2LALA 1UY1A 1V6KA 2CL2A 2RDSA 3EXUA 4YVWB 4BJ0A 1W28A 3IIAA 3L9JT 4Y1UA 4OZXA 1G86A 4AVBA 2VD7A 3PUHA 2NP0A 1JYTA 2ZPXA 1VBA1 4HKLA 4UF0A 4OI0A 1FAYA 2QNKA 5CKNA 4YM2A 1JU4A 1LCLA 4GH4C 1QJZA 3HVDA 2XR4A 3VN4A 5IUQA 3GHMA 4RGGA 3VHNA 1H2LA 3POFA 3B9CA 5FUIA 5IK4A 1J84A 4YRDA 5C33A 1D7PM 1GV9A 1FPN1 4ZXEA 1NY72 4LXLA 4MXWA 2WZ8A 2ZGPA 1CZVA 3AZYA 1SPPB 5A7NA 3ZN6A 2DURA 4LKFA 1OOPB 2XL7A 2WZPP 4NWWA 3DCQA 4DXZA 5GZGA 5C3OA 3PTYA 2Q4SA 5CFCB 1UMZA 5A3LA 1QJY3 5DUXA 2YC2A 1WLWA 4W6WA 5JI7A 2Y6GA 1MACA 1FPN2 3OEAA 4XCBA 5FPXA 2GN3A 2BU9A 2VUJA 3MEPA 2XBO3 3BALA 1J3RA 5FZDA 4AI0A 1LHUA 4CPBD 3PUIA 3WF4A 1W8HA 1LU2A 4LK6A 5FP4A 3FFZA 3C7HA 5L73A 3LGRA 4EQVA 2LW8A 5A3NA 1WGPA 2VMDA 2VMEA 4MO3M 3KT7A 2UYAA 1TZOA 2E51A 4Q4X1 3PU8A 1JW6A 3WF3A 1V00A 5ABJB 4LHKA 3CHXA 4B8EA 4XPVA 3O0XA 3W21A 3AM2A 3J8F1 3KGZA 1LNSA 4CU8A 4N43B 4LHNA 2G19A 1UYYA 5KC6A 2PXJA 1X82A 4IESA 3KT4A 2WBKA 4KWKA 4MV2A 5C8CB 1AXKA 3AL5A 1SDWA 3VHRA 1K12A 2X5IC 2LUWA 1OH3A 4Q4X2 4AVTA 3PVBB 1QJX1 4IEVA 4K20A 3LIGA 5C6CA 5F3CA 1VLNA 4MLOA 5I8YA 2EIBA 5LRSA 3J8F2 1PNFA 4UYBA 1VIWB 1UIKA 1CN1A 1WBFA 4LO5B 1SDDB 4I02A 4JCKA 2VMIA 3NMBA 1RINA 5F5AA 1UOGA 3HN1A 1UU5A 4V1PA 2B7YA 1F35A 2EXHA 2Y0IA 2XWBB 3ZIWA 3AYEA 4KH9A 1IS4A 2UU8A 4O61A 4OHWA 2AACA 1ND3C 3BPZA 4HZFA 1W6OB 2E9QA 4M3CE 2PA7A 1MZEA 2BZDA 3V0BA 3DPRC 3HQUA 4QM8A 3RZHA 1JHNA 2R7EB 3FX3A 5FQ0A 3VKMA 2ZHMA 2VNOA 3LOBA 1BZWA 2JB4A 4YG3A 1EAH1 3OGRA 4Q26A 3WQ0A 2DU1A 3DYMA 2D3PA 1K5MA 1EP0A 1YO8A 2OA2A 3OBTA 4Y20A 3FUQA 3CLPA 2ES3A 3M2MA 4XF0A 3H0OA 1I5PA 1X8MA 2BNOA 1IPSA 1HB1A 2BDRA 2IXKA 3SH3A 1OURA 4OMDA 2BRTA 1GWLA 3K3NA 1EAH2 1BVP1 3PUQA 2PLV3 5C4WA 1JUIA 2QBXA 1K5JA 2HWC1 3VBHA 1DQ5A 1HXS3 2DV9A 2BOIA 5JUVA 3IWZA 3LQCA 3LZZA 2E7QA 2D3RA 4YW7A 4XE9A 5LASA 3HJRA 4OI1A 3PLQA 1LOBA 4Y4RA 1DQ0A 4YZ5A 3K75B 2RS13 4QHOA 3AL6A 3VDCA 2X5IB 2CV6A 3CF6E 3WP6A 1RUJ1 2WKKA 4PIZA 2DVDA 2HWC2 4TSVA 3B02A 3ME2A 3FUOA 1PMHX 4R9DA 1QJY1 5FZBA 5JLVA 3O1UA 5FCCA 3TAYA 4HVOA 3JUUA 2WWJA 1YFUA 2XBO1 1NCQC 1UY3A 2R063 2ZKNA 3GM8A 4I0WB 4PLOA 1PK6A 4DNYA 3RPQA 2W87A 1ZREA 1RJ8A 1R64A 1S0CA 1W6NB 2CHHA 2X53S 4LQRA 5D8AA 2WYFA 3H1MA 1RUJ2 3PU3A 3AKTA 4LK7A 5T55A 1ODMA 3S6PA 4CDUC 3HN3A 3IMMA 1QJY2 1ND2A 2EF6A 3PUAA 4AHWA 2RS33 1J3QA 1CD3G 3DPRB 1O5LA 1AR71 3ZPYA 4W8JA 1T6BX 1Y7BA 3FN9A 3ZSLA 2XBO2 3W9AA 5JXGA 3AMHA 5FYHA 1PX3A 4QB2A 5EP9A 2ZACA 3LWCA 4YGDA 4Z8BA 1T6GC 3FHIB 2VNGA 2XDVA 5FMCA 1UZZA 3WNPA 1NOVA 4D7TA 2Q0AA 3WOGA 4HONA 2VZVA 1KDKA 4MXVA 5CB7A 3UV9A 1AR72 2DBNA 2ZBJA 4CEYA 4OUSA 3AMPA 2MPFA 1SLBA 2D6NA 2LRPA 4FPYA 1IS6A 4GA9A 4L0PA 5JIAA 3ZR5A 2RVAA 1HLCA 5KXEA 2BFUL 1Q8QA 5EIYB 3GJAA 1QF3A 3C7FA 3VBOA 3I3EA 1MS9A 1W05A 1IQAA 1ASJ1 2V5DA 2OZJA 4ZZ5A 4QD2A 3NKTA 3GCWA 4HSLA 1J58A 4K8FA 1JYWA 1OUSA 2ZX4A 1EUTA 5FZ8A 3PDQA 3VUOA 4AI3A 4HSJA 1XBFA 3WG2A 2PELA 3T3YA 4CCJA 1V70A 3W5MA 5B2GB 1VBC3 2GMMA 3A21A 4OMCA 5FXVA 3D0JA 1AL21 3PMEA 4A41A 1XJAA 3IPVB 3KWVA 3WDTA 1ASJ2 1GMMA 3KB5A 3WX5A 2PHDA 3WF0A 5F3IA 1W9SA 3ACLA 2H0VA 3EJKA 3M3CA 3U0ZA 2R32A 2JDUA 4RD7A 5IHRA 3T0AA 2E33A 1NCQB 2EIEA 3I8TA 1PO23 2GC1A 4ISRA 2QZ2A 3O1MA 1RUD3 3CMGA 5A7PA 1UY0A 3P6BA 4XTPA 3PIJA 4XFIA 2ZGSA 5FZ3A 2XG3A 1I1EA 4DMIA 2XJQA 2I2SA 1AL22 5F5IA 5CFDA 3CEWA 4CDUB 4FFFA 1HXS1 2WRAA 4WVMB 1XC6A 3KS7A 2BUKA 2WJSA 2ZJCA 4RFT0 2UWCA 4LIVA 1RB8G 5F3GA 1WLTA 1U5XA 3PMSA 1RUF1 1O6UA 4BISA 4BH9A 5LY1A 3SQOA 4JDNA 2Z4FA 3PL0A 1XNDA 2RS11 4AI9A 4HMZA 3ECQA 4CUBA 3W58A 2J1VA 5FBJA 2ZMKA 5DPNA 3S57A 2Y38A 1VE0A 1HXS2 3E5UA 5F5QA 5LK7B 4UF0B 4Y33A 3ACGA 2PAKA 3LPGA 2FCVA 3TNPB 1J3PA 5K9YA 1RUF2 2W52A 3OBAA 4E2GA 4P9GA 3INAA 3N9LA 2ETEA 4MGYE 4R52A 4Y3OA 2LS6A 2RS12 4XMIA 1LEMA 1S1AA 2QQVA 4MXWB 4H3WA 3N9OA 3JBG1 4FFHA 1YQ2A 4I0BA 3ZN6B 2Y33A 4KL1A 3IT8A 4P9IA 4B7EA 1AR91 4XC9A 1COV3 2P3IA 2EA7A 1HQWA 3I97A 5D1IA 3VD4A 2PAMA 4LBQD 4QQPA 1WCDJ 3U4SA 1JYIA 1LRHA 1VRH3 5L9RA 4BQ4A 1F31A 1YYNA 5SV8A 3T2PA 5LA9A 1VBE1 4IEPA 1N1VA 4NIDA 3DKQA 3JBG2 4XZUG 3VV1A 1UMIA 2WLQA 4OHXA 1AR92 1ZNPA 2RS32 3LEIA 3POJA 4WVZA 1FOD3 4AVVA 5H9SA 1RMU3 3ITQA 5C4WC 1JOBA 5FWEA 2W94A 4NRPA 3VBHC 1OC1A 4LTAA 1O3SA 1Q3EA 3J26N 1NCRC 2EAKA 4DINB 1CAUA 5JZGC 1VBE2 1EV11 3AYDA 5HCAA 2ZCWA 1YC61 2J1UA 4HLTA 1V6NA 4GIQA 4RQPA 3WDVA 5FZ0A 3LDKA 4OZOA 3ZXEA 1WMXA 1YCIA 4CXWA 4A3ZA 5BNQA 1F2NA 1XQNA 2YHJA 3EYPA 1RUG1 3SKJE 1ZRIA 5BNOC 5DMYA 2WT1A 1JZ2A 1VBC1 2QQOA 2GH2A 4XBNA 4Y22A 4AOCA 3V64A 4CPBA 2WSUA 4LPLA 2FMDA 1EV12 1W9WA 3V65A 4MH0E 4XFAA 3B93A 3AZZA 3W5NA 5FZ9A 3T09A 2WC2A 3VZMA 4K21A 3H8XA 1PK6C 3OGJA 3GBFA 5GZFA 1KEXA 2MHFA 4DIQA 3RI9A 1PO13 5APAA 5ERLA 2J1TA 2VNVA 2Z69A 4SBVA 4K7JA 3R4SA 1SFYA 4Z2AA 2BNMA 4ZU7A 1ND2C 3TN91 1VBC2 5K8SA 2ZEYA 3V0BB 1RUNA 3T1MA 1RUC1 3MF6A 1H30A 5FY4A 3M4FA 4IDZA 3WP4A 2J42A 4TYSA 5FQ0B 3VBUC 3VD3A 5L7OA 3MUZ1 5FP8A 1D4M3 4CUAA 2XLFA 5FYMA 3UK9A 1I3HA 4PQ9A 4AQ6A 5JCTA 4BOWA 3RJ2X 4IV1A 1V9U3 2ET1A 2GNDA 2WA4A 5CBLA 3ETPA 1K5MB 1LGCA 3D4KA 4Y20B 3MF9A 2XLAA 4ZU4A 3WW3A 5C3QA 5L9VA 4Q5OA 3TN92 2YDEA 5FZLA 4AEKA 4FPOB 3A7QA 3LA7A 3N3HA 1RUC2 3VKFC 2VPVA 2A6VA 1XSQA 4C1WA 2H6CA 4AWDA 1DFQA 2A3XA 1AYN1 5FOBB 1OLMA 2OPWA 2XXZA 5C4WB 2NMOA 2R0FA 4ONUA 3MDPA 3VBOC 3VBHB 2ZXQA 5FZ6A 4KU7A 4S2HA 1OF4A 3TEXA 1W9YA 1NCRB 2G4IA 3ZSMA 3FLRA 5JZGB 3ACFA 3ILFA 1I6XA 2CDPA 4AL9A 1XNBA 3IAQA 4XACA 4YFZA 2XJVA 5JMOA 1OQ1A 2D6KA 3C8XA 3RZJA 1OSGA 1W39A 5FPAA 2E7TA 1VMHA 2TEPA 3HWJA 3KF3A 3KHCA 3PVOA 1ZZ8A 3APBA 2ZGLA 4KWLA 2Y34A 2WZR1 4LR4A 3OYWA 4UBHA 1G9DA 2B5HA 5HXVA 3ZDVA 1SLIA 4E4ZA 4C1XA 4WVVA 3JB4C 1VALA 1MS0A 1UIJA 1W8TA 1RVF1 3VD9A 1QY4A 3R05A 4M4PA 5J36A 4FVVA 1HB2A 1QNWA 1AJOA 1PK6B 2VQUA 3OD0A 4OFGA 4L92A 4LNVA 4DEVA 3O14A 1FOD1 2V5YA 3U78A 1RMU1 5D8AB 3OUJA 5CFDC 2WZR2 1VRH2 3ST7A 4D6SA 1ND2B 4AR2A 4D7YA 2YYOA 3VBRC 3O0VA 3DEMA 2IXLA 4JDMA 4Y5Z0 5FIXA 1H2NA 2W3JA 2ADDA 2ZEZA 3SXWA 2WDBA 1RVF2 3ZN4A 1CQ9A 3VBUB 1LGBA 3ZVXA 4EN8B 1NQJA 4RL7A 3DECA 5IWFA 3WNKA 2XUEA 1FOD2 2D7FA 1DGRN 2NYYA 1J83A 1O4YA 4HETA 4PCRA 3T4HB 1RMU2 5KXBA 2J1SA 1W3VA 4GJZA 1MVEA 1OLQA 1SLCA 2GAUA 4EN7B 3JCIA 1DIWA 3MFAA 1NZCA 5CZKA 4QKBA 2GU9A 4CEYB 4WZCA 2XQRA 2FZ2A 4LITA 5I0DA 5D2AA 4FTSA 1OH4A 3FFQA 3VBFC 4X6RB 4HVRA 1JZ4A 2ZX2A 1HV0A 2I07B 3GJBA 1JOJA 5A32A 2IFRA 1EPZA 5A1FA 3UETA 3VBOB 1LHNA 2AZ5A 1OVSA 1HRI1 1UPSA 3ACHA 3K4ZA 4UFIA 1RIRA 1YRZA 3OGGA 2XHNA 4R9AA 5LA1A 4NHLA 2CU5A 3IZOA 1POV3 3OY8A 1TME3 3UYJA 2BGOA 3RJRA 2W1UA 4GMP0 3WSOA 4O9EA 3RZGA 1Y43B 3I2JA 4HVQA 1C8NA 3ES1A 4Y1VA 5IATA 2WNUC 5FJHA 5FY0A 2QUOA 2LTNA 2VZUA 3I59A 5FZMA 4CU9A 1QIQA 3KD4A 5JOWA 2ZGQA 1HRI2 2WAAA 5LY2A 1BBT3 3O1VA 1DHKB 4FPHA 1ULGA 2HWE1 3JZVA 3T30A 2Y6FA 3I4IA 4BLIA 1SLAA 2RS51 1V6OA 5FDBA 3IDBB 2FCTA 1F4HA 1S0IA 1ZBE1 1CVNA 2GC2A 2VAUA 2CAUA 1MZ6A 1E57A 1KD7A 1Q8OA 4I0AA 1OVPA 4BDVB 4XETA 3LEKA 4XJ8A 1DU3D 4QXBA 4YNIA 5F5CA 5BNPA 4OHVA 1HB4A 1V9U2 1X9PA 4QGLA 5CFDB 1N1TA 5F32A 2GNTA 4YG6A 3PUSA 4K9SA 1C1LA 1YHFA 4RR3A 3VBRB 5IT6A 1G9AA 2HWE2 3VZNA 1X7NA 2RM21 2KA3A 1GFF2 2OPKA 2RS52 1V6IA 2WNVA 4ZS3A 5FRAA 2RG4A 5GZDA 4CCKA 4CRQA 1DP0A 1ZBE2 3ZYBA 2J1AA 4YW2A 2DVBA 5EHDA 1OUXA 5LBCA 5K4LA 2ZGMA 5IFTA 1FMD3 4A7KA 1O3RA 3ALQA 4XQWA 2WWUA 1TVGA 2Q1FA 5FMOS 3HT2A 5LBEA 4HPKA 1JZ3A 1LJ7A 4XBQA 4FQ4A 2WO2A 1JYVA 2YC4A 1J1TA 2RM22 3BTAA 3HOBA 4H7LA 1VB2A 1LU1A 1Z78A 1XB9A 5T54A 1GNYA 1D0HA 2W95A 1UY4A 2CGOA 1H2KA 3KCYA 1BXHA 1RUH3 1QH6A 4GALA 1GP5A 5B4NA 2HBTA 5A3MA 3OBRA 4OVEA 1OF3A 5FZ1A 4HOOA 4B3NA 2VOVA 1W8WA 5FYTA 1VBA3 2XJPA 4KBZA 4IV1C 5FXWA 3ZM8A 1L7QA 1ULFA 2VVFA 1DZTA 2YGMA 2ADEA 3HQRA 4QPIC 5IW0A 3WNXA 1DQ1A 2ZHLA 1WCUA 4NIGA 4D6QA 2C0ZA 3I54A 4AVSA 4FPGA 1UYXA 3V56A 5C7GA 3D82A 1FPN3 2QCSB 3BYWA 5FXXA 3AYCA 5IVJA 1UCXA 2VVEA 1A8DA 1N3OA 5CKQA 1EUUA 3Q8AA 5FR3A 2JKBA 1UY2A 2NLRA 2XPJA 5FYZA 2GN7A 3NO8A 2ZGOA 1E5RA 5FZEA 3IDEA 3IDAA 5T5JA 2RJ2A 4PHZA 5FY9A 1A6CA 1UX7A 4EWAA 4EV0A 4O65A 1CAUB 4XFGA 3KVBA 2B39A 5FJKA 1QMJA 3WD5A 4AGGA 3HEIA 2BJSA 3K77A 1X9TA 4RQPB 4D94A 4YVWC 4F7ZA 3CIHA 2HLEA 1X50A 2Y6JA 3AFGA 3BTZA 2YBPA 3CBNA 4LBQA 1POV1 2QE3A 1MPXA 1TME1 3VDDA 5C8WA 1ZRRA 1BYHA 1QOSA 3WLUA 1YJLA 1IOAA 3AKSA 4Q4X3 3I2OA 3KQRA 2XJSA 3F95A 2RV9A 2JDMA 1GNZA 3J8F3 2KD7A 1O3TA 1GWKA 1K45A 3AP4A 3VKOA 1ZA4A 4RGAA 1TME2 1OOPC 3BIWE 2Q8OA 4GD4A 3ZYIB 1PMJX 2ZMLA 2D93A 1PGW2 4BXSV 2ARCA 4LO6B 3DXUA 4QKNA 3WF2A 3ZYHA 1QJX3 5ACA1 1UAIA 5EQUA 4IEZA 4KWUA 4NJ4A 3P1IA 2W1QA 5FYSA 3WQ7A 3B9IA 2DDUA 4CCMA 5L7OB 2DUQA 5JPNB 3TEWA 2W68A 3NV3A 5BUVA 1WZXA 2B45X 3OGVA 1D4VB 3POEA 3VB9A 1JHJA 1LTEA 1I9RA 3MW2A 4IV1B 1FI2A 4GWIA 2QQUA 4OULA 3I3QA 1FMD1 1HDKA 5ACA2 1YEWA 5DUVA 1OBNA 3N9PA 1NUKA 4XYXA 4AAXA 3M3OA 1SCRA 3A4UA 1H1IA 4UW4A 5AVAA 5C8CC 1ENSA 1GR3A 1PHMA 4OLLA 5HV0A 1EAH3 4QDRA 1F5JA 3LD8A 1RUH1 3KLSA 3FHQA 1FMD2 1KJLA 5CIRA 2OQ6A 5GLTA 4YFWA 4G3YC 2HWF3 2TNFA 2ZGTA 1LECA 4LO8A 3RYKA 3H8RA 1K42A 5I93A 4H55A 3CL1A 4QX3A 2JDYA 2P5BA 5T3NA 3GZUC 5DUWA 3ZR6A 5GLUA 4RFRB 5FMDA 5KC5A 2D5HA 2KM2A 3BU7A 2JG9A 2VQAA 1VMJA 5T5OA 3OYWB 4Y1XA 2HWC3 5LA0A 1RUH2 1RXFA 2A5ZA 2XJTA 4H14A 2GP5A 3CO2A 5GZEA 2C5DA 4AFCA 1QDOA 5A6QA 1LULA 4MGKE 3D3AA 2YBKA 4CDWA 5F1RA 4AQSA 5L36A 3EBRA 2FDHA 5FY7A 3DYOA 2WQ8A 3SISA 1US2A 2EALA 3E97A 3PJQA 4AHYA 1WMDA 1US3A 2HH9A 1W6PA 1C8M1 2XKOA 3U37A 1VBA2 2BBVA 2JD9A 1QNYA 4INDA 4FTBA 4LKSA 4UWDA 2P6HA 4B1LA 3HAGA 1RUJ3 4RR3C 1AF9A 3HPNA 1HB3A 1JI6A 3ZXJA 5JSOA 2D6LX 2WNVC 2DCKA 1O8PA 2WA3A 3Q8FA 1YLLA 1QQP1 3M7AA 4N7IA 4YZ4A 4YW6A 3TB0A 1H4GA 1QHDA 4LIUA 3AYAA 1H4HA 1C8M2 1DG6A 2ZS6B 3QD6A 5C5UA 2NPIA 4E2QA 2F6BA 2CGNA 5CG8A 1GP6A 2GNBA 2IXCA 2WNOA 4QHZA 1YIFA 1C1FA 2R1BA 2BEOA 1BK0A 1Z7S3 1CWPA 1AR73 2YV8A 2JE9A 1S4CA 4ZXKA 5I8SA 2DCJA 2WO7A 3MPPG 2VOTA 2Q8DA 1QQP2 4KMQA 1HRV3 4Y1ZA 1MR5A 1W6QA 5F39A 4QQHA 1F4AA 4ZKTB 2PHXA 3HT1A 2WQZC 3ZXDA 1FNYA 4ZHNA 3OY8B 2YU2A 4COYA 1ZZ9A 3HIFA 4FOVA 1YIPA 1OXCA 3K2OA 2JDPA 3W20A 5GZCA 4NIIA 3I59B 1W90A 3CZJA 2GNMA 4COUA 4NPMA 5IYYA 1LB2A 3UGHA 4S2FA 1MQTA 1NLRA 2VOWA 1QJX2 2D40A 1ASJ3 3ZMNA 5J3UA 1MS8A 2IVJA 2QQWA 4L2NA 3VD7A 1NX9A 3Q8CA 4DPNA 5FYYA 1FYUA 3H50A 3RDIA 4JKLA 3GZAA 2QTWB 4D69A 1S0FA 3BI3A 2DCZA 4NOTA 3O1PA 2AR6A 4QPGA 5HCFA 4P9LA 2J1EA 2WT2A 5BNPB 3EQEA 2BVVA 1ENQA 3H7YA 4UBGA 5GLWA 3FBYA 3ZKUA 4PI2A 1AL23 5ANNA 1ZBA3 4RR3B 1H8TC 1IPKA 1S0BA 1W2TA 2PHLA 3N7LA 4LHLA 4YWAA 2QDNA 5FLIA 2CWMA 3UGFA 3VDDC 3O1SA 2WNVB 2HWF1 3CJXA 1VMFA 4A7ZA 1JODA 4AVCA 4QQ2A 5A6YA 1S0JA 1V6MA 3PIGA 4JRLA 1ZM1A 2PQQA 1JYNA 4B4QA 2FCUA 4AGVA 1LHVA 2E6VA 4Q8LA 3WW4A 2JENA 4ISQA 2JE8A 1OD5A 1RJ7A 4HPKB 4KG0A 5F2SA 1RUE1 4RHV1 4NROA 3ZYRA 4XOGA 4G4FA 3UKNA 4LBJA 2HWF2 3X29B 2IXIA 3H1WA 1RTVA 4YZ1A 1O4ZA 1X36A 1RUF3 5KHIA 4IE4A 4MGSA 3LSEA 5H9QA 3AP6A 2Y60A 1BJQA 1UU6A 2CNAA 4P9XA 1UZVA 2ARBA 4HK8A 3H3LA 4Q4V1 5KHJA 2UYBA 2XMLA 5IVBA 3EMRA 3OUIA 2GH8A 1RUE2 4RHV2 2BFUS 5FYUA 5JSPA 5CG9A 1PZ7A 4NN0A 1VBB3 1J59A 2O1QA 2XONA 2JD4A 3O5SA 1WA6X 3LEGA 1GYKA 3G6JB 4RYDA 5HXMA 3MHZA 2YPJA 3NNFA 2FHRA 4WZFA 5A80A 1YQ6A 2OX0A 3ASIA 4Q4V2 1A8MA 4JKKA 1H1AA 4HXCA 3MW4A 1IG0A 3JBG3 3DF0A 1CONA 3MLKA 2A3WA 4GB31 5KBFA 1NG0A 3KM5A 1AR93 4G9SB 1XYOA 1Z7S1 5GM0A 1MS3A 4Y24A 4Q8KA 1XYNA 2A70A 2VCBA 4XFHA 1HRV1 2J22A 2XJRA 1W8OA 2G9ZA 4BQ3A 4PQQA 5C9AA 3URFA 1VBE3 1STMA 4AFMA 1DYPA 4E8CA 1H8TB 1LODA 4CA9A 2ENRA 4LBQB 1DYOA 2IVIB 4GB32 3VDDB 3RZKA 3IMNA 1SEFA 3SEPA 3GZTB 1Z7S2 3PVEA 4XXPA 3S5QA 3UESA 3NQHA 3AB0A 3WG3A 2JG9C 1WA4A 4MGTA 5AC91 3TEYA 1HRV2 2R6QA 4BIFA 1GLHA 5FZIA 1H9WA 3QOPA 2FDKA 3ZO0B 2VMFA 1W2OA 3H7JA 2ZAHA 1EV13 4K1YA 4PJYA 1B35A 3NV4A 2IZWA 4UFHA 4FOQA 3DKWA 2ZZJA 1LOEA 3DUIA 4L9BA 4B7KA 1BKZA 1KITA 1UXZA 2HWD1 1SG3A 4R9CA 1WLCA 1X33A 2TUNA 4PIYA 5DAXA 1RUG3 5DAVA 5BXXA 4ES9A 3U14A 1CPMA 3CU7A 1W9FA 2VTXA 2DUOA 1R091 2RJKA 5FZHA 1CR7A 3GGLA 1UZYA 1ZBA1 2UY8A 1JBCA 2AYHA 3DN7A 3THCA 1H8VA 1WCQA 3S0MA 5IAVA 2HWD2 1WMFA 4KU8A 4BK4A 4YARA 1RL3A 4R4ZA 3OGSA 1IKPA 5FPUA 4S2DA 3TN93 5F37A 4CP0A 1R092 5A7QA 1QH7A 4HL0A 1RUC3 3J7LA 1R081 1ZBA2 2DBIA 2JDKA 1NXMA 2WLPA 4NIHA 1DQ2A 1N3PA 2YGLA 5CAZA 4BIOA 2YZ4A 1GWMA 2BGPA 3TOJA 5FWJA 3WF1A 1MEC3 4DUVA 1LAJA 5LA2A 3H3ZA 3J7NA 4M0NA 3GBGA 5J37A 3NV1A 1APNA 1UPIA 3Q8EA 1DGLA 4BQXA 5FLJA 1GOGA 1S2BA 3VZKA 1R082 1WMEA 3WINE 3WHTA 1AXYA 2RMU1 4CCLA 4MSVA 1AYN3 2BWCA 1VBB1 2JG9B 1UKRA 4DRRA 4YW1A 2NN8A 4P9JA 1OMIA 3TNQA 3ZSEA 1GZTA 1ZZCA 3C3VA 1XSRA 2ET7A 1OKQA 1LKNA 4QX7A 2W9XA 4CDWB 3JQXA 1QDCA 3I7DA 3OSDA 4QU1A 4UFLA 1U0AA 3B01A 4P00B 5FYVA 1W6PB 3BODA 3L2YA 2VBDA 2CWSA 2WN3A 1GUIA 3LFIA 4F8AA 1VBB2 4ZZ8A 5EYYA 3E6CC 2I45A 1C5HA 1XPWA 2YY1A 3KCCA 5FPBA 5CADA 2V4VA 4JRAA 2JX9A 2WZR3 1K5MC 1REDA 1XNTA 2C6SA 2OZ6A 4BMBA 1YFYA 1HQNA 2Q5TA 4I30A 3WUCA 4N7UA 1VJ2A 4BQ2A 4Z92B 3JD71 1AX2A 3T2TA 1DZRA 1RVF3 1VAMA 1XE7A 2WT0A 3K3OA 4XFCA 2GC3A 2W2IA 1ZRFA 3K46A 3TWIA 4NRMA 2G9FA 2UURA 4GWNA 2QKDA 3M70A 1W9TA 1KS4A 2ERFA 2BYVE 3CQOA 5FP3A 4LKDA 3ZFFA 4MVTA 2NQYA 1I5ZA 2PMWB 2WUHA 4FFIA 2CGPA 4IE5A 3ZX7A 3MICA 3WCRA 3JD72 2WR9A 1SBEA 3OUHA 3WG1A 5JXIA 1XXNA 3TBDA 2V09A 2DUPA 3ZIXA 3E5XA 1YFXA 5FKBA 4A3XA 4YGCA 3JU9A 4PT6A 3M1HA 5DG2A 5JIUA 4QHBA 1ENRA 3I2HA 4L97A 4ATFA 4QB1A 2EIDA
chains in the Genus database with same CATH topology
1ULCA 1Z0HA 1XNCA 1BVVA 4IETA 2WWSA 4JGZA 3AX4A 1RUG2 4E9KA 5D8AC 3ZDSA 4BPZA 1MQTB 1NE4A 1HRI3 1VAVA 4YVSA 3POWA 3PJYA 5BV6A 2D5FA 3UL2A 1SCSA 2DVFA 2IXJA 2R043 3RQ0A 4JDOA 1AXZA 2ZTNA 2HYKA 4QPGB 5BNNA 4DFSA 3QBQA 3RYPA 1MEC1 4YM0A 5C9AC 3ES4A 3WR0A 4MGIE 2A73B 1UU4A 3AJZA 4HBNA 1H0BA 4LT5A 2HWE3 1U5IA 2PHFA 1DQ6A 2RS53 4WM7A 4CEYC 1H1MA 3M8LA 3ZFEA 3LKJA 4K3UA 1ZBE3 3G7DA 2PHRA 1MEC2 4IEUA 5K0UA 3RYRA 3RZZA 3O0WA 1B35C 2UY9A 3D5OA 2RM23 3B3QE 2UWBA 1EPWA 1UX6A 4FBFA 1SQ4A 4PDWA 1MZFA 4GULA 4L99A 5JDBA 4XJUA 1GANA 4GMP3 1AYN2 3DL3A 4K1ZA 4YLZA 3NL1A 5LEJA 2FBEA 3S7EA 1DLLA 3ZXKA 2DYCA 5IK8A 4KGQA 3MIBA 4EROA 2PN5A 5GLVA 5KHHA 4AEDA 1KQRA 4EWDA 2FQPA 4J1WA 1C28A 2XHKA 4O9GA 4E4DX 1XYPA 3SLIA 2WL1A 1TNRA 4FPCA 2HEVF 4BLJA 4A2UA 4AEMA 1AVBA 4XF3A 4MUVA 2HWB1 2YXSA 2E63A 1Y9QA 4KQ7A 2PFWA 4K6BA 4XDQA 5C9AB 4XMAA 4OI2A 3AZXA 4GXLA 2JG8A 2YUEA 4LE3A 4AVAA 5IK5A 1WD3A 4I2OA 1WUVA 2R16A 4ES8A 2HWB2 3AFKA 4LA3A 4XF4A 4QPYA 4X8NA 3Q9OA 1S0EA 2JE7A 2CYFA 4DZGA 3NKGA 2BPA2 3I2DA 3HD8B 3D8CA 3L2HA 3ENRA 3USSA 1B35B 1CESA 2BGCA 4M00A 1BEV1 4FP3A 4XJ9A 3VZJA 3ZYPA 4Q0PA 1HV1A 2R041 4PBPA 5GJ6A 4Q4W1 4U36A 3WW1A 4AQTA 2QJVA 4XILA 1AR81 2OW4A 2RHPA 3SHRA 2BWAA 2WS91 1ZX5A 1QOOA 3SCFA 2VULA 5DZFA 3O12A 3E5QA 2B8MA 1XE8A 4GQ7A 2NM1A 3N36A 4AXOA 1N3QA 1BEV2 5DUUA 3KZ4C 3FMGA 3GALA 1W0PA 2R042 2DFCA 4JGYA 4Q4W2 4LBLA 1PVC1 3ZFFC 1AR82 5GLZA 3SNMA 1LHWA 5ACA3 2WS92 1QXPA 2D6MA 2JJ6A 5DZGA 5E88A 4NO4A 1OA2A 4RQPC 4XXAA 4FPKA 4AI1A 1FXZA 1L3JA 3FBMA 4GH4A 1AUYA 1PVC2 4CP1A 1CX4A 4Q0VA 4GMP1 1W6OA 2WSVA 1DF0A 4CDXA 3P3PA 3BB6A 4EN0A 3N4MA 4KWJA 1LENA 4PLNA 4HFSA 5DDJ1 4Q0UA 3UKVA 2TBVA 3NWKA 2VW1A 3BOWA 3E6DA 3DGTA 3B00A 5GKAC 1OA4A 4WV8A 3MW3A 3MYXA 4OHZA 4PIXA 4EN6B 1AR63 3OCPA 1VP6A 1B09A 1CAWA 4MGZE 4Z1VA 3N7JA 4AYUA 5JSRA 3NW4A 5L7OC 5DDJ2 2ZKLA 1O7FA 3AZWA 1PIV1 1HW5A 5JOYA 3FLPA 5HCBA 5KWRA 5A33A 2VQ0A 4B29A 1PM7A 2ZHKA 4YW4A 2Q1MA 1AYM1 2C1FA 2WNEA 2Z5WA 5F6LB 4BMEA 2K2SA 4IL7A 5FO8B 4WM7C 4FAGA 1AX1A 1FV3A 1REEA 1PGL1 3ZYGA 2JXAA 1R1A1 3SITA 3U4XA 3VBSA 1PIV2 1RHI3 1C8M3 4DS0A 4Q29A 5K0UC 4YM1A 3MIFA 3ZFFB 4KGGA 2VU9A 2R0HA 2UWAA 2GZWA 1AYM2 1URXA 3EO6A 4GWMA 4HKOA 3LCPA 4PDWC 5F6KA 4LBMA 1QQP3 1PGL2 3ETQA 1U12A 1OA3A 1R1A2 4AHXA 3HR9A 2PHWA 4GKXA 5IK7A 4ATEA 1ND3A 1U5YA 1OPOA 3OTFA 5CVRA 4XJAA 1DGWX 5I0TA 2IFWA 4FO9A 4Y22B 5EFUA 3SMHA 1VBD1 4AEJA 5CA6A 1O3QA 3USUA 3IN9A 4EWEA 1WW7A 4AEDC 5FMOL 4CEWA 1NQDA 2QDRA 1F5FA 1CJDA 3VZOA 3MFCA 4DY5A 1YI7A 2ZMNA 1Q56A 4YVSB 1O91A 4A7YA 5BYNA 1VBD2 5K7PA 4K40A 3OPZA 2R49A 5EJ3A 4M3CA 4AGRA 5KHGA 2ZX1A 1SLLA 2BQPA 4HANA 4FOWA 2O8OA 5I8TA 3WT3A 1VB4A 1Q8VA 5DZEA 2W08A 2MEV1 1JH5A 4UW3A 2RR11 2JG8C 4IEQA 1QJU1 4R8HA 2A7AA 3NAPA 4LO7A 5H9PA 2XWJB 4XW3A 1YJKA 4WM7B 2N7GA 2PHTA 3ZFEB 3PNAA 1G7YA 1ONAA 3ZN5A 3U10A 2Z79A 3R0RA 3AMMA 2H0BA 4IQPA 3WP5A 5K0UB 3ZXLA 2MEV2 3SCGA 3V0AA 1QJU2 3QH6A 2W0XA 2XGXA 1AR61 1ENXA 1TMF3 5KHKA 3WDXA 4Q27A 4PDWB 4AFBA 3ZXFA 4LEJA 2CTVA 4X6QB 2EIGA 2FMYA 4YGBA 2Y26A 3K48A 1GZ9A 4N9IA 2XVLA 1C4RA 1N1SA 1W2UA 2YC0A 5AFBA 1RUE3 4RHV3 1FX5A 5T52A 2Z42A 1AR62 2P3JA 1KS5A 2ZGUA 4AEDB 3WZ1A 1CAVA 4URTA 1RHI1 2XJUA 2R30A 3AXEA 2DTYA 4JV4A 2A6XA 3R4DB 5BNPC 1X8EA 4Q4V3 4ASMB 3RSJA 3FZ3A 2PYTA 2VECA 4PBOA 2VW2A 1AZDA 1NA1A 1N47A 1QOTA 1RHI2 4CDXC 4KNCA 5KXCA 3MLJA 2JG8B 3MZHA 2QVSB 4LUMA 2B9UA 4P5HA 3ZSKA 4CYDA 1YWKA 3A0NA 4GB33 3H3UA 1XNKA 1D2QA 2O8QA 1H2MA 4Q0QA 3M3QA 4PLMA 4QT6A 2VGDA 5A32B 3D0SA 2NZ9A 4M01A 5T5LA 2JDZA 3AMNA 2PHUA 1XU2A 2JICA 4Y4YA 5CU1A 3RMYA 4C90A 4EN9B 2D97A 5KXDA 1QXJA 2E7AA 5AC93 1QWRA 3GNEA 3VKNA 3S7IA 2DVAA 1IPJA 1DYKA 4W6XA 1QKQA 4FQZA 5JR7B 4DY3A 2OIIA 4FTEA 4AG4A 1C57A 2PAEA 1GZWA 4ITCA 3RRDA 3VBSC 4JGYB 2HWD3 3DV8A 3LA3A 1M06G 4NHMA 1R1ZA 1A78A 4LULA 2ZAAA 2Q1ZB 1VAKA 1EYBA 3IDCB 4JQRA 1R093 2DCYA 2GMPA 1UL9A 3IBMA 4HK9A 2IC1A 1TMF1 1LOGA 1Y3TA 4FXKB 5E8AA 3B69A 4GH4B 4EJRA 4LLOA 3T1LA 5EWSA 4NR1A 2DFBA 2XLGA 4XF9A 4CDXB 2YMZA 3AP5A 4RS5A 3H1YA 3MIHA 3MIDA 3RWNA 1R083 2AH2A 2K0GA 1TMF2 4CEWC 5FO7B 1BK1A 1G9CA 3VL8A 1D0GA 2R073 4XF1A 1W0OA 4Z2WA 4Z07A 4JVAA 1IHMA 1DGRA 3KGLA 3WHUA 2DTWA 5J09A 1CAWB 3ROUA 3R4UA 3ZXAC 2X29A 3UKTA 2RMU3 3WW2A 3RMXA 3AK0A 1C3HA 3SCHA 5A33B 2ATFA 1NCRA 3NAPC 4FP2A 1NXD1 5JZGA 4E27A 1QU0A 1MS5A 3WY6A 4AW7A 4R9BA 3OJBA 3VBSB 2VXRA 4AFDA 5BNOA 2JECA 3ZXGA 2Q30A 5EV7A 1LOAA 1SBFA 4XEZA 3WCSA 5JOZA 1OQDA 4XHXA 4OHYA 4XTMA 3QH7A 2F4PA 2V73A 2XB6C 3JD73 1O5UA 1ZYBA 3IKWA 3AKRA 5EZWA 4BZ4A 4GKYA 5FREA 1PGSA 4LBKA 1G9FA 2HEYF 1ND3B 2YROA 1D2SA 2AUYA 4Q1PA 3CJIA 4QGNA 3AJYA 3USUB 2ZHNA 5GALA 2ZOEB 3LB9A 3VBUA 5I0UA 2DF7A 4CDWC 3VHPA 1TE1B 3AZVA 4CDQA 5L19A 4CEWB 4Q1RA 4IERA 4AE2A 4FPFA 2O0OA 2H6BA 5AC92 1PZ8A 2C9AA 4Z82A 4CP2A 1GKBA 5LK5A 1OPMA 4BE3A 4M3CB 2ZGNA 4KBBA 4QQLA 2AREA 1JUHA 1Q43A 1WCKA 3OD4A 1NA1C 1KXGA 4COWA 4QM9A 3NAPB 3ZSJA 2FZ1A 5BY5A 3U07A 4DB5A 2EAAA 2HJIA 2BW8A 2D43A 3A0KA 3AP9A 4IV3A 1AJKA 1KFXL 1OHFA 4N90A 3FLTA 5I0SA 2R071 3MI8A 1LOCA 3V0AB 1S55A 1HQLA 4QXKA 5LRRA 2W39A 2P34A 3KMHA 2A3YA 1QGLA 2R1DA 4YM3A 2XL9A 4E2SA 1GSLA 1YI9A 4JC1A 2PLV1 1S0GA 2VOXA 2R072 3WV6A 5FBZA 4QGMA 2QFEA 3VBRA 3B94A 1MQTC 1RUOA 1HIXA 5FLHA 1J1LA 1WBLA 1CAVB 3PVNA 3VZLA 4ASLA 4S2GA 3FWEA 2RMU2 4QPGC 1FV2A 3AMQA 4H7MA 2PLV2 4I01A 1YUDA 3ILNA 1JTZX 1HX6A 3KT1A 2EXIA 3FE5A 4WM8A 4L11A 2R061 3VBFA 2VOKA 3AKPA 1NE6A 1DZQA 3WDYA 1NA1B 4LBNA 5I91A 4KG8A 1G6NA 2AGSA 4RS5C 4TZDA 1QXRA 2VVDA 3AP7A 2RS31 4RA0A 1DGWA 5FO9B 4AF9A 3ZMOA 3NVCA 1MS1A 4FOYA 2WNUA 2R062 2HWB3 5SV5A 4PF5A 3SH4A 1W6QB 2P2KA 4XFFA 1JXNA 1ZRCA 2GALA 4COZA 4TLFA 2A75A 2HEWF 3WG4A 1GICA 4AQ2A 1G8WA 2RE9A 2GMEA 2OUHA 3HQXA 5JOXA 1UN1A 2HKXA 3JB8A 3KSCA 3U11A 2D3SA 4N53A 4LA2A 4D3WA 1S0DA 1BEV3 1GZWB 3MGUA 4LO4B 2PTMA 3RNSA 2DVGA 2D6PA 2GDFA 2NMNA 4Q4W3 2ZX0A 2CAVA 4BYYA 4BWOA 5FAXA 3VHOA 1AR83 4FAHA 2VMGA 1KDMA 2WS93 3P3NA 4HKWA 3OF1A 2A6WA 5DXDA 4XJZA 3LA2A 1BQPA 1GBGA 1PO21 3RG0A 4XIOA 3VGIA 1RUD1 1CAXA 5JI9A 4FSJA 5EXOA 2E53A 1MVQA 3VLBB 4BQ1A 1PVC3 3CJIC 4FXGB 1UW8A 3ZFGA 4RS5B 2XKPA 4IEXA 3LAGA 3WDWA 4AI2A 1WLDA 1SACA 1DQ4A 4CDQC 1F8VA 4YZ3A 2OUJA 1S2KA 1Q8SA 2EVXA 2GC0A 2ILMA 1C5IA 1PO22 4AI8A 1RUD2 4L8QA 4CZSA 4QPIA 2KXLA 3NSTA 3N7MA 3N35A 5EYXA 5FTTC 1UD1A 1AX0A 3FJSA 2B42B 4FCAA 2AENA 2D98A 5DDJ3 1PZ9A 4F3JA 2ZX3A 3EHKA 4DQAA 4LE4A 4FPLA 4JTNA 1TEIA 5FFOC 2BTVC 3O7OA 4M0HA 4JAAA 1KRIA 4Q4Y3 2D6OX 2SBAA 4YYOA 1W6MA 4W6YA 1LOFA 1EY2A 4YVWA 1BCXA 4ORFA 2P17A 4BM8A 1COV1 1SFNA 4IV3C 5JPMB 1IZ3A 4J1XA 3TRSB 1LGNA 2P3KA 5BNOB 1PIV3 2XH6A 1AHSA 1VRH1 4SLIA 2OVUA 2VH9A 4I09A 2IXHA 1GNHA 1CGPA 3AXDA 1OQEA 1AYM3 3C2UA 3ILRA 4YZ2A 1M4WA 1BMV1 4XIKA 1COV2 3WDUA 3WW3A 3NV2A 4XFBA 4YW5A 1OOPA 1J59A 2XVGA 3B5LB 1R1A3 1RC6A 3UJQA 1WW5A 1PVXA 2WINB 3LOIA 4IXLA 3CJIB 4Y1YA 5CFCA 1UF2C 4YW3A 1YFWA 4X8PA 1KJRA 1V6LA 1BMV2 2XUMA 4CDQB 3PHMA 4RSUA 5JVVA 1OI6A 2DWRA 4IEOA 1IS5A 1ULEA 3GYDA 4R4XA 2VNRA 4YSFA 4IEYA 3WQ1A 4BA6A 4BCUA 5ABJA 2BVBA 1WW6A 4LBOA 4QU2A 4WM8C 3R6SA 1LESA 1VBD3 3W59A 4QMAA 1IS3A 3BOPA 4LLFA 1FT9A 4QQOA 4N43A 5T50A 1SBDA 3RS6A 4QX5A 5C8CA 1PO11 2QZ3A 1FNZA 2BNNA 1MZ5A 5LEKA 2G9GA 1RITA 2A6ZA 5CNAA 1V6JA 2ZGKA 1D4M1 1JN2P 3GF6A 4IV3B 4META 3SH5A 4Y26A 1PO12 5JWPA 1V9U1 1YNAA 4AHZA 4MYEA 4DRVA 1WCSA 2MEV3 4WVWA 1CIWA 2RR13 2WFF3 4P14A 5DG1A 1QJU3 2DCTA 4HN0A 1NLSA 4P9YA 2EXJA 4NPRA 5T5PA 4UXAA 2Z2SB 1D4M2 2ZGRA 3ELNA 3WP3A 1G9BA 4JTOA 1A3KA 4JGZC 3K51A 5AVPA 2XVKA 5E16A 1ULDA 2K9ZA 1N1YA 1DBNA 4N53C 1TQ5A 1CJPA 4Q4Y1 4YVSC 1OFNA 1UKGA 3H9AA 3UJOA 3J9SA 4Q2FA 5J98B 1LHOA 2WFPA 3ZYJB 1IKQA 1RUI3 5BNNC 1TNFA 5I0RA 4XBLA 1H9PA 5E1RA 3FC0A 2ZA9A 1ZRDA 1AL0G 5AFEA 1KFUL 1OLRA 4Q4Y2 3WUDA 4FT8A 3CNAA 1GZCA 2Y0OA 4WM8B