1GLHA

Cation binding to a bacillus (1,3-1,4)-beta-glucanase. geometry, affinity and effect on protein stability
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
214
structure length
214
Chain Sequence
QTGGSFFEPFNSYNSGTWEKADGYSNGGVFNCTWRANNVNFTNDGKLKLGLTSSAYNKFDCAEYRSTNIYGYGLYEVSMKPAKNTGIVSSFFTYTGPAHGTQWDEIDIEFLGKDTTKVQFNYYTNGVGGHEKVISLGFDASKGFHTYAFDWQPGYIKWYVDGVLKHTATANIPSTPGKIMMNLWNGTGVDDWLGSYNGANPLYAEYDWVKYTSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1,3-1,4-BETA-GLUCANASE
publication title Cation binding to a Bacillus (1,3-1,4)-beta-glucanase. Geometry, affinity and effect on protein stability
pubmed doi rcsb
source organism Synthetic construct
molecule tags Hydrolase
total genus 51
structure length 214
sequence length 214
ec nomenclature ec 3.2.1.73: Licheninase.
pdb deposition date 1994-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1glhA00
4P9XA 2JD4A 1V6JA 3AP7A 2HYKA 1JXNA 3SH5A 4IQPA 1JHNA 2R16A 1V6KA 1QU0A 2CYFA 3N7KA 1C1FA 4H55A 2P3IA 3D4KA 1YIFA 3HN1A 1W6MB 4YGDA 1FX5A 1WW7A 1GZ9A 3OJBA 3OPZA 4Q2FA 2D6NA 1BYHA 1PZ8A 2LALA 2FMDA 1V00A 1F31A 1OFSA 4GKXA 2PHXA 3WUDA 2OVUA 3I8TA 3IPVB 2VH9A 3POWA 3R4SA 2DVAA 1KRIA 1GNHA 1AX2A 4DFSA 1DIWA 2A71A 1AXKA 3RMXA 2ZGRA 3ZXLA 1Q56A 2FHRA 1LHVA 3OY8B 4LBJA 1W6MA 1UZYA 3QLQA 1LESA 2GMMA 3JUUA 5DZFA 5JOWA 3D5OA 3ENRA 1N3QA 3ZXEA 3IMNA 1FATA 2B7YA 1VLNA 4LBMA 4ISRA 2EAKA 2GNBA 3ATGA 3RG0A 2NMNA 1BQPA 1O4ZA 2ERFA 3B3QE 4XJAA 3AJYA 1LTEA 2GALA 4DS0A 3U4XA 3WOGA 3USUA 2ZHLA 4CZSA 4C1XA 1QGLA 4WV8A 4Y22B 3ZXKA 3IN9A 5IK8A 1HDKA 3ILFA 1DQ6A 4K20A 1ULGA 2ZGMA 5EYXA 2ZGQA 4LBQD 4LBOA 2D7FA 2UWCA 1G8WA 2ZA9A 4FOQA 1MZ6A 3A0NA 4PQ9A 4UW3A 5JDBA 2C9AA 4GXLA 1W6PB 5DXDA 2A70A 3LCPA 4LBQB 3POSA 4I30A 2AGSA 2D44A 3M2MA 3SITA 3USUB 1V6MA 4XJWA 1G9AA 1LOAA 1FNYA 2R0FA 1CONA 2DU1A 1C57A 1VIWB 1SLIA 4OZXA 1VAMA 4K1YA 2DV9A 3VUOA 2A6XA 1CPNA 1H9WA 2DYCA 3FUQA 2OUHA 3NV2A 4Y1UA 1W6NB 1SCRA 4TZDA 3VKFC 1Y7BA 4WVVA 5JOXA 2ZGNA 1GLHA 1S0EA 1SLCA 2JECA 3APBA 4FOVA 1D2SA 1UPSA 1IS3A 1MS5A 1S0GA 2I2SA 2R0HA 3IKWA 4PF5A 1QKQA 5DG2A 3VKNA 4AYUA 1SBEA 3SLIA 4FPCA 1Z78A 4FVVA 2A3YA 2UWAA 3WG2A 4RA0A 4YZ3A 3WLUA 3ZYPA 1GZWA 1QF3A 2NP0A 2EXIA 3MW3A 1G9CA 3POYA 4DPNA 2WJSA 1JW6A 1LHWA 1SLTA 3VKOA 2ARXA 2E6VA 4YM0A 4ATFA 1LGBA 2E53A 1WW6A 4YW1A 5T55A 1X50A 3INAA 1W6OB 1I3HA 5H9SA 4Q8LA 3D6EA 1AXYA 4FQ4A 4XOGA 1WD3A 5F9TA 1JN2P 2W68A 1N47A 3FBYA 3O0WA 4R9DA 1YYNA 1LOBA 4LBNA 2VY0A 2ZGLA 1Q8VA 1A8DA 4XXAA 2DU0A 1LHUA 3B00A 1ZA4A 4Y24A 3WNXA 3LSDA 1MS1A 1PZ9A 3ILRA 5EYYA 1ULFA 3N35A 4DRVA 1U0AA 1LHNA 2YV8A 1YXWA 1LU1A 2W08A 5T5OA 1DQ5A 1CN1A 2ZHMA 3A0KA 4FPHA 3W58A 3N7MA 1QOSA 2R1DA 4NOTA 4Y1VA 2LTNA 5DUVA 3WDTA 4XJ8A 2WQZC 3WHTA 3VKLA 3PVNA 3AYCA 2VU9A 3WDYA 5DUWA 2P3JA 4R9AA 4BMEA 2EXKA 1ENQA 1IS6A 1WD4A 3AFKA 3BTAA 2C5DA 5GALA 1DGLA 3IM0A 2NN8A 4XIOA 1H9PA 4Q1RA 3V0BA 2DURA 3WZ1A 4PCRA 2ZBJA 1YI7A 3WG4A 4PBOA 3SH4A 1N1VA 1ULCA 4FPKA 2WNEA 1GNZA 2H0BA 4Y26A 1A78A 4FPEA 4R9CA 3ZYRA 1ONAA 4YFWA 3ZSJA 2CWMA 1AF9A 5T52A 1CVNA 2GNMA 3AYAA 4WVWA 1R1ZA 3MW2A 2WT0A 4K1ZA 1GZCA 2JDZA 5H9PA 1GANA 1S0DA 4GWNA 3M3QA 5E89A 1LOCA 3RS6A 4AWDA 1UZZA 4ATEA 1SLAA 2D3PA 4GA9A 1CESA 1AZDA 2NZ9A 2P34A 2AR6A 3GALA 3H0OA 4HANA 4F83A 3FFZA 1ENRA 4XE9A 2D3RA 1KJLA 2D43A 5H9RA 4YW3A 1BXHA 1WW5A 3IPVA 3WHUA 1LULA 3GNEA 1N3PA 1B09A 1SACA 2YY1A 4XHXA 3AZXA 2W52A 3OY8A 4WZFA 5KXCA 2RHPA 2DUPA 2GN7A 1LJ7A 3AZWA 5LK5A 2DWRA 4AGRA 5KXDA 2R49A 2D6MA 4JCKA 1DQ4A 1LODA 1W0OA 2EXHA 3NV3A 5T50A 2SLIA 2GN3A 4FPJA 3BIWE 3Q9OA 4M3CB 3AXEA 1JBCA 4AVVA 1QNWA 4XILA 3AZYA 3M1HA 1F9KA 3PJQA 3NWKA 4AVSA 1JYIA 1LOFA 5IUQA 4YZ4A 4Z8BA 1FNZA 4Y22A 2AENA 2A75A 4BLIA 4BOWA 1LGCA 1RINA 1MS0A 5BYNA 2DUOA 2A6YA 4GKYA 2WT2A 4BLJA 4GALA 3O0XA 2A5ZA 3CNAA 1QMJA 5EXOA 2E7QA 3RMYA 4D69A 2ENRA 1I1EA 1W6PA 3HMYA 1N1YA 2PHFA 4LBQA 1ENSA 1SLLA 4XYXA 1CPMA 3V64A 4AVTA 4CRQA 1HQLA 3PMEA 1FAYA 1UMZA 3AP4A 4XHBA 5HCFA 5T54A 3T1MA 1Q8SA 1VALA 3AJZA 2GMPA 1IKPA 3OYWB 4JC1A 1DBNA 1Q8QA 2ZGTA 5GZEA 5JMCA 4XJ9A 1NXD1 2GNTA 2WLQA 4BMBA 3V0AB 4YGBA 1ULEA 3R05A 1O4YA 3WV6A 5DG1A 3TAYA 3WG3A 2AUYA 3I4IA 1WLWA 2WSVA 4LBLA 1KDKA 1W6NA 3B9CA 4XBNA 1LECA 3SNMA 3ZSLA 3AP5A 3AYEA 1QOOA 3OYWA 4YM2A 1CQ9A 3N36A 1LU2A 1WLDA 1QDOA 3V65A 2ARBA 4BPZA 3FUOA 2D6LX 4P14A 4SLIA 5EWSA 5AVAA 5F5QA 4UW6A 1HLCA 4W65A 5IK5A 5GZDA 1DQ2A 4DRRA 4UW4A 5IK7A 1LEMA 3FLTA 3OBRA 4Y1YA 1WBFA 1GBGA 2ZABA 3AK0A 4JRAA 5GLVA 3ZVXA 2CTVA 2JE9A 3UK9A 2ZHNA 1GYKA 1V6IA 2SBAA 1LENA 1JUIA 1LHOA 2DVDA 1MR5A 5JLVA 1WLCA 2D3SA 4M3CE 1W6OA 3AX4A 4XDQA 1MVQA 1AXZA 1AVBA 1IKQA 1CJPA 1LEDA 1UN1A 2ZMNA 4XJZA 3WDUA 5GZGA 1SBFA 4Q1PA 2A3WA 3FLPA 1DZQA 1TEIA 3ASIA 3KM5A 1MS4A 4YM1A 1OQ1A 3NV1A 3ZSKA 5GLUA 4YZ1A 1MS8A 3QCWA 1YO8A 4YW2A 1IOAA 1GV9A 2ZKNA 2D6KA 1GICA 2W39A 4FQZA 5T5LA 5GJ6A 2EALA 1KITA 2JKBA 2KM2A 4R9BA 3PVOA 1GSLA 1S0BA 2GNDA 4YM3A 2ZGOA 4YW4A 3N7JA 1UL9A 2A7AA 1G9DA 2V5YA 1V6LA 5HCAA 3B01A 3MW4A 1D0HA 3LSEA 3N3HA 1BKZA 3RSJA 4PBPA 2ZHKA 3AXDA 3VKMA 2ZGPA 4XBLA 4YZ5A 1DLLA 2D6PA 1SCSA 2DVBA 2JJ6A 1WBLA 3AZVA 4XZPA 2GMEA 2V73A 4P9WA 5DZEA 5DUUA 5GLTA 3MPPG 4U2AA 2YMZA 4AGVA 4NO4A 2AH2A 1SLBA 3SH3A 1LGNA 3ZSMA 2AYHA 1Q8OA 4FP3A 2PHRA 2PHUA 3UJOA 1AX0A 1G9FA 4XTMA 4C1WA 1G9BA 3VV1A 5IT6A 1DQ0A 1AJKA 3DGTA 3ZPYA 1ULDA 1C1LA 4ASMB 1WW4A 4RL7A 5L73A 2A6WA 2GDFA 1V6OA 2ZGKA 1CIWA 3M3OA 3C2UA 4M00A 5DUXA 1Z0HA 2G4IA 2JE7A 3OGGA 3R4UA 2OW4A 4LBKA 4ITCA 1G86A 2YXSA 3UL2A 4U36A 2DVFA 1UKGA 1DFQA 1H30A 3DUIA 4FP2A 4FPGA 1S1AA 1URXA 3M3EA 4ISQA 2DTWA 5CAZA 5CA6A 1EPWA 3A4UA 3ILNA 3UJQA 4KBBA 1HQWA 2EXJA 1KDMA 4ZXKA 1CR7A 2Q5TA 4ZKTB 5T5JA 4P9YA 1LOFC 3WCSA 1S0CA 5GZFA 3M3CA 1RITA 1DQ1A 1LOGA 2UU8A 4FOYA 4YLZA 5CB7A 1S0FA 2WT1A 1APNA 4YGCA 5JOZA 4M3CA 4XBQA 2UURA 2ZMLA 5E8AA 1PZ7A 4Q26A 1DYPA 3B69A 2EF6A 1AJOA 2ZMKA 3MEPA 3L2YA 3JU9A 3O0VA 5CNAA 3AYDA 4YG3A 3W59A 2TEPA 5GLWA 3BOPA 4YG0A 2DTYA 3N7LA 4XIKA 4MYEA 4FPFA 5JOYA 2E51A 2XB6C 1QOTA 2Z42A 1F5FA 1UX6A 1KJRA 3FLRA 2DVGA 4BM8A 5SV8A 4YW5A 3OBTA 1J1TA 1V6NA 2E7TA 2UWBA 2CNAA 3RQ0A 1QNYA 1GZWB 1FV3A 2ZAAA 3WUCA 3WVJA 4AGGA 1XQNA 1NLSA 1WUVA 2OUJA 3AP6A 4M01A 1JOJA 2AREA 3V0AA 1WCSA 1ZM1A 1GKBA 2WKKA 5GM0A 3AP9A 1BZWA 2A6ZA 2VW0A 4Y20B 3RRDA 4YFZA 5DZGA 1LCLA 2P2KA 1QDCA 2P3KA 5GLZA 5E88A 1FYUA 2NYYA 5T5PA 2XG3A 4K21A 2WSUA 2PHTA 5H9QA 1N3OA 4UW5A 4FOWA 1YRZA 2VW2A 2A6VA 3AZZA 1FV2A 1SBDA 4GWMA 1DHKB 1LOEA 1SFYA 2VW1A 2NM1A 2VUAA 3PVEA 3T1LA 1KQRA 4CTEA 1C4RA 1A3KA 4Y20A 4YG6A 1W0PA 1N1TA 2P37A 2YZ4A 2ZZJA 5FREA 3WCRA 1W6QB 3KQRA 1BJQA 3ZXFA 4XJUA 4XXPA 1N1SA 3O5SA 2CWSA 5KXBA 3SISA 1HKDA 5FRAA 1S0IA 2D6OX 2ZACA 1IS5A 4HL0A 4FPYA 1MS3A 2YROA 5JVVA 4L8QA 4YZ2A 3T2TA 4XTPA 4YGEA 4FPOB 2NMOA 2A3XA 3HR9A 5KXEA 2PHWA 1MS9A 1MZ5A 1DYKA 3BODA 2ES3A 1AX1A 4FPLA 1OKQA 3WDVA 3WDXA 1W6QA 1RIRA 4XMAA 5GZCA 3O12A 1JYCA 5HCBA 1MACA 2BQPA 3NV4A 1S0JA 1VAVA 4DQAA 5CBLA 3V0BB 1G7YA 2VXRA 2CL2A 1UAIA 4TYSA 4XMIA 3WG1A 5IK4A 4Y1ZA 4Y1XA 3TB0A 1Q8PA 2ZGUA 4BQ1A 1IS4A 1MVEA 4M3CF 2DUQA 2EIGA 2ZGSA 4Q8KA 3ZXJA 4Q27A 2PELA 2R1BA 2CY6A 3WDWA
chains in the Genus database with same CATH superfamily
2RMU1 4P9XA 2JG9B 2QQJA 2JD4A 4AL9A 2BBVA 1REFA 1IHMA 5FY7A 5L9BA 1HN0A 3FZ3A 4OI2A 2BU9A 2JG8C 3DN7A 3N7KA 5G04L 5L7OB 1AL21 1RMU1 2RDRA 3HN1A 1YIFA 1VBA3 2CAVA 2EA7A 4AFAA 1FX5A 3OD0A 4ARXA 5A33B 1EV12 4PIZA 5A32A 4Q4V2 5ABJC 1BYHA 5DDJ2 4CXWA 3DV8A 2V09A 1D2QA 5JUVA 2VUCA 2JG9A 2P4EA 2ATFA 5FQ0A 4GKXA 1NZIA 2P17A 4N9HA 2OVUA 5FZ1A 2VH9A 3POWA 5F8PA 1KRIA 1GNHA 5L7OA 4ASKA 1Q56A 3OY8B 1GFF2 1WLTA 3JBG2 3VDDB 1PNGA 5A33A 2GMMA 1F5JA 5JOWA 2QNKA 3ZXEA 2YFUA 2BUKA 2F4PA 2P6CA 4LLOA 1XC6A 2C6SA 2WFF2 4RR3B 4DMIA 4EWDA 1GP5A 3ATGA 5CFDB 4JDMA 1O4ZA 3H8XA 5FZLA 3AJYA 4QB1A 3SKVA 4CZSA 2VNOA 1R092 1PGL1 3ZMOA 3WINE 3WR0A 4EROA 3WP4A 5FPLA 2VBPA 5C4WA 3VDDA 4XFGA 1HDKA 3ILFA 4IE0A 3VHPA 2RS52 5FPZA 3NJZA 2ZGQA 5KHIA 4HXCA 2BWCA 4LBOA 4NHYA 1G8WA 4AOCA 4HFSA 5A3LA 1RUG1 2C9AA 5CFDA 5B4XA 3TOJA 2A70A 5ANQA 4AAPA 3VZOA 3FC0A 1VPHA 4BDVB 4Q0QA 1G9AA 1FMD2 1V6MA 2OPKA 3USUB 2OX0A 1FNYA 2VZSA 1OOPB 5AC92 4D7TA 3MFCA 4NRMA 2YC0A 3HWJA 1Z7S2 3ME2A 4B4PA 4IEQA 1JUHA 3JD73 2DYCA 2A6XA 1H9WA 3FUQA 4URAA 5IVBA 2OUHA 3WNOA 2RR13 5C3RA 1W8WA 2XONA 5FXZA 5A3MA 4OHXA 4TZDA 4WVVA 4CCLA 5JOXA 2JECA 1HB4A 1HXS2 1SLCA 3LPGA 5FPAA 3ZSEA 4CPBD 1C5HA 5FYSA 1D4VB 1S0GA 3VBOC 4NWVA 1YJKA 1OOPA 5BXXA 4IERA 3FWEA 4P9GA 5DG2A 4AYUA 3UETA 2QKDA 5F3IA 3LDRA 1YIPA 2A3YA 4IW3A 3WG2A 5A3UA 1AR61 4YZ3A 2JDHA 1QF3A 2NP0A 1EAH1 1G9CA 2W91A 1ZYBA 2ZEXA 5FZ4A 5ACA3 2RS33 1AR72 2KR2A 1JW6A 4QDQA 1ZZ7A 1W06A 4EN7B 2ARXA 4YM0A 4ATFA 3LFIA 4XCAA 2VE1A 3BOWA 4NPRA 2CSGA 1EUTA 5T55A 3RPQA 3MV01 4OCTA 3INAA 1D4M1 1PMIA 5H9SA 5C8CB 5LEJA 4XUNA 5F2SA 2W68A 3MGUA 3RJRA 1BEV2 1FPN3 1L7RA 5L9RA 1Y9GA 1QJX2 1YYNA 1B35B 2HYXA 3NMBA 1RUOA 2XXZA 4ORFA 3ORJA 1DZTA 1MEC3 1R091 2ZGLA 1ZZCA 3VBUA 3VDCA 1A8DA 2XBO3 3T30A 1C3HA 4H7MA 1HRV2 4XF3A 5FFOC 4JX0A 3WNXA 4E8DA 1MS1A 3ILRA 5DMYA 3X29B 5KHKA 5JPMB 3B9IA 2YV8A 5FMBA 1K42A 3TNPB 3VD3A 2QQNA 3WSOA 2ZHMA 3WP6A 1QQP3 4FPHA 4RYDA 3RWKX 2MNGA 2R1DA 2RS13 3PURA 2LTNA 3UYJA 1KS5A 4BQ5A 2W1SA 4MHUA 4XJ8A 1VBB2 1SPPA 3Q8BA 3WHTA 1NYWA 1X82A 5J7MA 2RJ2A 2VU9A 1GOHA 5DUWA 2ZAHA 5AC91 4EWEA 3V56A 2WABA 1WD4A 4QHOA 1X36A 2C5DA 1VRH1 1VB4A 3U14A 3T08A 4XETA 5FY4A 3DEMA 1H9PA 4GB33 3V0BA 3WG4A 4PLOA 4QX3A 5LY2A 2L9LA 3OB8A 4HMZA 1ULCA 3GM8A 5IFTA 1CX1A 4CP0A 5BPXA 2WNEA 3WD5A 2HWC2 1STMA 1A78A 3PHMA 1WGPA 2JG8B 5K0UA 5J48A 3ZYRA 2QQOA 5JIAA 4Y3OA 4DY3A 1BCXA 4IEVA 2CWMA 2QBXA 4BQWA 3MIHA 1VBD1 1CVNA 2GNMA 4JKKA 4QXKA 4ZZ5A 1AR71 1R1ZA 4KU7A 3BTZA 1XU2A 3MW2A 4OHYA 2VMDA 2W9XA 2JDZA 5H9PA 3D8CA 1LOCA 1WCDJ 3H1YA 1ZVFA 1SZBA 3BPZA 5FPBA 4AWDA 3ES4A 1CESA 2XLAA 3NO8A 3OBAA 3TNQA 1JYXA 3WQ0A 4F83A 5IVFA 1O4TA 3H0OA 4CUBA 1S2EA 2GH8A 5D1IA 4CP1A 1BEV1 1UOJA 2QQWA 1QJX1 2ADEA 2GSYA 4WZFA 5FJKA 3KZ4C 2RHPA 1UXXX 2J1TA 5A3NA 5IYYA 2DWRA 4AGRA 1W05A 2R49A 3FHAA 4JCKA 1HRV1 1ODMA 1LODA 4TLGA 1PVXA 5AFBA 3WF2A 4M3CB 1O6UA 5A7SA 1JBCA 3B7MA 5FK7A 2W92A 1YFYA 4GH4B 2W3JA 1J3PA 3WEZA 4HT1T 4H3WA 3M1HA 3PJQA 4PLNA 5A3WA 1JYIA 5A1AA 5C70A 3ZXGA 4Y22A 5I8YA 1VBB1 1VBE3 2W87A 3C7HA 1CGPA 5FOBB 3I2DA 3OD4A 1AYM3 1MS0A 4AAXA 4B4RA 2VMGA 3CNAA 2C0ZA 2B4KA 4D69A 1UQXA 1PX4A 5D8AC 4CRQA 1L7QA 3GYDA 4MGYE 2PFWA 3HQXA 4XFHA 4C0HA 1OLQA 4QKDA 3AP4A 3T1MA 1UOBA 1YUDA 3BIEA 4P9IA 2JDMA 4XURA 1RUJ2 5C3QA 3T0BA 1IKPA 3UKTA 1ZREA 4N7UA 2QZ3A 5HBAA 1Q8QA 2ZGTA 5GZEA 3FE5A 3KVAA 3FX3A 3GZEA 2GNTA 4QDRA 2JWPA 2GP5A 2VZUA 2HWC1 1O4YA 3EJKA 3PDQA 5DG1A 3TAYA 1KDKA 1OMIA 2W94A 1O8SA 3B9CA 4LK7A 2XJQA 5I0UA 4QPIA 4E2QA 3CBNA 1NT0A 3HVDA 4DEVA 5L36A 4XF0A 1XNAA 1E5HA 3AYEA 4WM7C 3ZYBA 5FZ8A 1CQ9A 1LU2A 1QDOA 2H6BA 5C3PA 2O0OA 3K3NA 1AHSA 4DUWA 1VBA2 2PMWB 2JDUA 3RI8A 4QPGC 1NCQB 4SLIA 4CEYA 2D97A 5FPXA 1HX6A 4MV2A 4Z1VA 1I6XA 3BB6A 4UW4A 5LK7B 4FSJA 1LEMA 5IVYA 4XFFA 5FY5A 1GBGA 2ZABA 3AMQA 4BQ3A 2CTVA 5BNPC 2Q8EA 4BB3A 3S5QA 3GZTB 1GYKA 1V6IA 2VZOA 1JUIA 1YQ2A 2MEV3 1MR5A 1OF4A 1OURA 4MHRA 1YC61 1W6OA 3AX4A 3LEKA 4XDQA 3I59B 5E16A 3POEA 3ZDVA 1PK6A 1NUKA 2Y0OA 2ZMNA 4OHVA 4XJZA 5EFUA 5GZGA 2A3WA 3FLPA 1TMF1 1DZQA 5C6CA 5TSWA 2AEYA 4DINB 4YM1A 1A34A 4C91A 5AFEA 4XDOA 2Q4SA 5HI0A 4NMIA 1GUIA 1OQDA 3MHZA 3H3LA 1IPKA 1IOAA 2XR4A 3I59A 1GV9A 5JAXA 1K5JA 4L2NA 2HWD3 2D6KA 3WNKA 5F7UA 4FQZA 2EALA 2JKBA 1YI9A 2KM2A 2W2IA 2WWUA 4IDZA 4QHBA 2VQTA 2FCVA 2GNDA 3AFGA 4LHKA 3N7JA 1UL9A 4GJZA 5FUPA 3VL9A 1WWYA 3OUIA 2V5YA 4LEJA 3ACHA 5FYVA 3NL1A 1RUJ1 2VZVA 4B7EA 1AL23 4FT8A 3IIAA 1W8NA 1BVVA 1BKZA 4OLLA 1VJ2A 2LUWA 4JAAA 2FZ2A 2J42A 3VKMA 2WNVA 2ZGPA 3AKQA 4XBLA 1F4AA 3WQBA 4IXLA 3JD72 1DGRA 4Q4W3 4U2AA 5GLTA 5D21A 4XZUG 2HEWF 4NO4A 2RR12 1LGNA 3ZSMA 2JIGA 4FP3A 5C5UA 3WT3A 1G9FA 2DBIA 4XTMA 1O91A 2VC9A 4BXFA 3LOIA 1AJKA 3AVSA 1VBA1 2B9VA 1WW4A 1XNCA 4RL7A 2BYVE 4Q0PA 5L73A 3WNMA 4XC9A 2VNVA 4AQTA 3M3OA 3N4MA 2XJTA 4M00A 1RUI1 4KH9A 1Z0HA 4X8NA 5IAVA 1O3SA 4COVA 3R4UA 5LBEA 3LF7A 1G86A 3KHBA 5ACA2 1A6CA 2N7GA 2RS32 3W20A 5CFCB 5I93A 3DXTA 3DUIA 4FP2A 2B42B 2VECA 4O61A 1LNSA 4FAHA 3TEXA 4ISQA 2XJRA 4C8DA 2CV6A 3A4UA 1PO11 2RG4A 3ABZA 2B45X 2ORXA 4KBBA 1HQWA 4KWLA 1KDMA 2Q0AA 2Q5TA 4QXBA 1IPSA 1H1MA 1MQTB 1FPN2 1X7NA 3CKHA 2XWJB 4XQDA 5FYIA 5LB6A 3ZO0B 4IEPA 4FOYA 1RXGA 1NAEA 2Y6LA 5CIRA 1MEC2 3W21A 2R6QA 2HWF3 4KNCA 4XFAA 2XBO2 5J3UA 1IPJA 1ZRFA 3MYXA 1ND3B 2QDRA 3NRUA 5BNOB 3ZFGB 4YVSC 4LQRA 2LRPA 2BVVA 1AJOA 2XKOA 3L2YA 1KEXA 3ETPA 5FKCA 1PM4A 3PTYA 1MQTA 1H8TC 3BOPA 5FY8A 1QQP2 4QGLA 5FXWA 3MF9A 5GKAC 4ET7A 1BMV2 2RS12 2XVKA 3OEAA 4FPFA 3DYMA 4C90A 3ZFEC 1V9U3 3NJXA 4YARA 2E51A 4AVCA 2H0VA 4NIDA 5G05L 1F5FA 3FLRA 1ND3A 3O1VA 4A7KA 1AR63 3ZFGA 3N9MA 1J1TA 1EAH3 3I2FA 4GD4A 2JDAA 3KQ4B 1W90A 3JD71 2VBBA 2E7AA 3RQ0A 5F6KA 1GZWB 5JR7B 2ZAAA 4ZXEA 5I8SA 4GB32 2IXLA 3ZLIA 2BNMA 2OUJA 3AP6A 5KBFA 1PHMA 3H3UA 3ST7A 3MBWA 5I8TA 1JOJA 1ZM1A 2DF7A 1D4M3 1KXGA 2J1VA 3EQEA 4WM7B 1W9FA 5KC5A 3RRDA 5DZGA 3P3NA 1H2MA 5IVVA 3LB9A 3WW2A 2Y64A 4MX3A 4QQOA 3LIHA 1NG0A 5T5PA 1ACCA 1KFUL 2WSUA 4JGZB 2RJKA 4K21A 1REDA 2O8QA 3CO2A 4QPGB 5FYYA 1AL0G 3P6BA 1VRBA 5ACA1 5LA2A 1YRZA 4RQPB 2A6VA 3AZZA 1FV2A 3PUAA 4GWMA 4J1XA 2Q8DA 1LOEA 2YGMA 4KGGA 3H50A 4CDQC 5FYCA 1JZ2A 4QU2A 1UYZA 2VBDA 3PVEA 3T1LA 1C4RA 2BNOA 5BNPB 1A3KA 4YG6A 2ZEYA 1W0PA 1VE0A 3E6DA 2YUEA 2YZ4A 3WCRA 4QQ2A 2Z2SB 1W6QB 3KQRA 4JGZA 3CIHA 3SEPA 4XJUA 4XXPA 4YVWB 1HKDA 2JD9A 4EN8B 1F2NA 4RQPA 5JZGC 2BP6A 4XEZA 5JVVA 1MEC1 1ZRIA 1NQJA 1TVGA 4RFRB 1V70A 2Y6KA 2J1AA 3WNLA 4BQ4A 1UIKA 1RUF3 1VRH3 1AX1A 3HNBM 4Y5SA 1W6QA 5GZCA 3EMRA 3O12A 4AFDA 4AFMA 1BMV1 4BE3A 4AEDC 1G7YA 2CL2A 5IK4A 1VBE2 3A21A 3CJIB 4M3CF 3S5AA 1AYM2 2ZEWA 2ZGSA 1W28A 4MXWB 5K7PA 4D7SA 4Q27A 1Y9MA 2XDVA 2R1BA 1VBD3 2CY6A 2RDQA 3GZAA 3NNMA 4HK9A 5JI7A 4JVAA 2D93A 2IVJA 3J26N 4I09A 4A6OA 1T6GC 1UKRA 2JE8A 2R16A 4NN0A 1HN1A 1V6KA 1QU0A 4LE3A 4AHXA 4N43C 2AZ5A 2P3IA 3CJIA 1CIYA 1ZNPA 1L3JA 3D4KA 1YHFA 4Z82A 4YGDA 1WW7A 4LR4A 1WCQA 4CUCA 1GZ9A 3OPZA 4Q2FA 1WMEA 2D6NA 1PZ8A 4RS5C 4E9KA 1POQA 2JXAA 2PLV3 2HBTA 3JB4C 4UFJA 1V00A 4NIIA 3VD5A 5C7GA 1OFSA 2R043 3U07A 1TG7A 5J98B 3OGJA 4I3GA 1AX2A 3UKVA 1DIWA 1OBNA 2JX9A 3VHNA 2ZGRA 2FHRA 1LHVA 2VO5A 4BQ2A 5FZ6A 1DU3D 1PNFA 2OS2A 4NIHA 2YC2A 3D5OA 1KS4A 5IFPA 1FATA 3LA3A 4E4HA 2GNBA 5IHRA 1WMFA 1BQPA 2ERFA 3B3QE 1NKGA 4LJHA 2WUHA 1I9RA 1L7LA 2GALA 4XJAA 4DS0A 4IEXA 2DCYA 2ZHLA 2Y8KA 3WY6A 3WQ1A 5BNNC 1UMIA 2WQ8A 1DQ6A 2MEV2 1ULGA 1GWLA 2IVIB 2ZGMA 2CGNA 3BVCA 3EXUA 3P1IA 1ZRRA 2Q1MA 2QQUA 4GULA 4QKBA 3WDWA 5JMOA 5JXJA 1D0GA 1MZEA 1ALYA 4FOQA 1MZ6A 4DO0A 4UW3A 3QH7A 4B29A 5JDBA 4OI4A 3W5MA 1U5IA 1UXZA 1OC1A 4LBQB 4UBHA 3H8UA 5FAXA 3SITA 2I74A 1ZBA1 1LOAA 2XJSA 3VB9A 5FV3A 3VBSC 3ZN6B 1GNYA 1CONA 5K9YA 3BTYA 4B1LA 1ZBE1 1GWMA 2OQ6A 2OIIA 2YC4A 1AYM1 1SLIA 3I7DA 3ZFEB 1VAMA 4K1YA 4Y33A 2HWD2 3RZLA 2ZX1A 1SEFA 3ES1A 3PTRB 1XOYA 4Y1UA 4BCUA 5JPNB 1OSGA 1SCRA 3WNPA 4HVQA 5EQUA 3CLPA 3IDAA 2WN3A 3TEYA 3APBA 1EP0A 1AL22 1D2SA 2K9ZA 2VAUA 2I07B 5FCCA 3ZFFA 5EYXA 2R0HA 2GC3A 1QKQA 1UYPA 3M70A 4FPCA 5F5IA 4FVVA 2UWAA 3CJXA 3U75A 4AQ6A 4RA0A 1JZ6A 1GR3A 2EXIA 2JDPA 2E63A 4Q4W2 3DCQA 3L9JT 4KBZA 2QQPA 3LWCA 4FXGB 3POYA 1SHWB 2WJSA 1W8OA 1SLTA 2CHHA 3GJAA 4JGYB 3KB5A 2WAOA 2QVSB 2Q30A 2R063 4EV0A 3H8OA 1LGBA 2E53A 1WW6A 2OZ6A 4K3UA 4UFHA 4QMAA 4I0AA 2WZPP 1X50A 2VVDA 5JXGA 1W9SA 5FO7B 2VOXA 4CDWA 2PAMA 1R64A 1TMF3 2W0XA 3AL5A 1WD3A 5K4LA 5F9TA 5FYZA 1N47A 3MZHA 1NCRC 3O0WA 1O8PA 4R9DA 4LHSA 2C4XA 2W1QA 4G3YC 5C9AC 4JGYA 3M4FA 5F3EA 4FBFA 1R083 5ERLA 3C7FA 4H14A 2DU0A 4MGIE 2YYOA 3BI3A 3B00A 3KHCA 2CAUA 3LSDA 5JZGB 2WRAA 1ASJ1 2BJSA 4DRVA 1U0AA 5DABA 2DCKA 4JHTA 1LU1A 2E33A 4GMP1 1DQ5A 1FI2A 4N53B 5FYMA 3W58A 1QOSA 4NOTA 1NA1C 3WDTA 4ES8A 4QU1A 5HXMA 2FCTA 5EV7A 3RZZA 5LW9A 4Q29A 1CAVB 3Q8CA 3WF4A 5JSRA 2HWF2 3AYCA 3WDYA 4MH0E 4LOSA 4YSFA 1Q5OA 3MF6A 1SDDB 4WZCA 1U5YA 4BMEA 1ENQA 3AFKA 5HPOA 2HWD1 4HN1A 4CUAA 5FKBA 5GALA 1DGLA 3ON7A 3IM0A 2VZQA 4N53A 2WZR1 3AB0A 2QTWB 3WZ1A 4PCRA 3BCWA 5IJRA 4G4FA 1V9U2 1JZ4A 4A7ZA 4FPKA 5A6YA 1X33A 5KR7A 1RUI3 4FPEA 4AHZA 1AR62 2X09A 1EAH2 1K12A 4HSJA 1OF3A 4D3WA 4Q4W1 5FZOB 4HSLA 4OHWA 3E1F1 3AYAA 4WVWA 4RS5B 5EJ3A 1CD3G 2V5DA 4YPJA 3SXWA 2WT0A 1QH7A 1XJAA 4JRLA 3ZYJB 4CUGA 2WNUC 5FDBA 2IFWA 5F5CA 4GWIA 1GANA 2IFRA 4GWNA 3M3QA 1PO13 1UF2C 4LUMA 5EJ1B 3SCFA 1D4M2 4ATEA 2WDBA 2XWBB 4GA9A 3USSA 2V4AA 2DBNA 1TNFA 3N9OA 4Y5TA 2VMHA 3IBMA 2P34A 1MPXA 4WVZA 3FFZA 4QKFA 1ENRA 1QJFA 1YFWA 3J7NA 2BRTA 4A45A 2VG9A 1WW5A 1LULA 2XUMA 1B09A 1ZRDA 1SACA 4YRDA 1ODNA 4HN0A 3OY8A 4LXLA 4UFKA 5KXCA 4FTBA 1DYOA 4BWOA 3AZWA 4CVUA 2FMYA 4KMQA 5LEKA 2WC2A 1JZ7A 1W0OA 3NV3A 5T50A 1XE7A 2GN3A 3BIWE 3Q9OA 1QXRA 1YFUA 3ITQA 3NAPC 3I2OA 4RR3A 1QNWA 4XILA 4YNIA 3AZYA 3OUJA 3RYRA 2PTMA 3VDBA 3C8XA 2JIJA 1J58A 2BVBA 3OUHA 4CDXC 3NVCA 5FMOS 4YWAA 1K45A 1FNZA 4UF0B 1O3TA 2HWF1 4BOWA 1RINA 4LIUA 5F5AA 1GWKA 2A6YA 5FBJA 1EYBA 4A2UA 4GALA 3VBSB 1RUF2 4XUTA 1VRH2 3LPFA 3IDEA 3RMYA 4DXSA 2QQKA 1I1EA 3HMYA 4EJRA 2ZCWA 4CXXA 1N1YA 2G1MA 2PHFA 1ENSA 1SLLA 4XYXA 3T2OA 4A3ZA 1HQLA 1OXCA 1FAYA 4KWKA 5CVRA 3USUA 5HCFA 2JDKA 5EPAA 4BJ0A 3QH6A 2ZX4A 1JZ5A 3POFA 5E1RA 3JZVA 3OYWB 1DBNA 4M4PA 1OPOA 3VLBB 4CEWC 1V9U1 4J1WA 1NXD1 4K8RB 3I2IA 1U5ZA 1EUUA 3V0AB 2BDRA 3MUZ1 4XW3A 3WV6A 4COWA 2WSVA 5FJHA 4LBLA 1VBD2 4CYDA 3T0AA 3CU7A 2BFUL 4OVEA 4OFGA 4XBNA 4UYBA 4TSVA 3SNMA 3WP3A 2YG0A 4EZ4A 1QOOA 3OYWA 4Z2WA 4YM2A 3MLJA 4CU6A 2VOKA 1EY2A 1F4HA 1UY1A 2VZ3A 1X9TA 4K9SA 4D6RA 5LWBA 5EWSA 4P14A 3JQXA 5DN2A 5F5QA 1H2KA 5IK5A 4KWJA 3EBRA 4IV1C 1AYN1 3O14A 2PLV2 1S2KA 2BOIA 3ETQA 4CDUC 3AK0A 5EHDA 3OPWA 2YFZA 2R042 3ZVXA 1HJFA 2WBKA 2JE9A 1CAUB 1T2XA 2HWB1 3UK9A 3I97A 3CDZB 1NCRB 3HQRA 4BIFA 5IVCA 2DVDA 1LHOA 5JLVA 4UWDA 4M3CE 5C9AB 3LE0A 4MZUA 5LA0A 2IUWA 5C8CA 5LRRA 4FTEA 1MVQA 3WW1A 4DB5A 3GXUA 4QQPA 1AVBA 1CJPA 1P8JA 1PGW1 4QX7A 5EP9A 5B4NA 5CISA 4AI2A 1SBFA 4Q1PA 4R4XA 3JCIA 1B35A 2BW8A 1UY0A 4OZOA 4CXYA 5D2AA 4META 1KFXL 3NV1A 3ZSKA 1ST8A 3DYOA 4BK4A 4YZ1A 5F37A 1MS8A 1NA1B 4CCJA 2FDFA 1YO8A 3ZR6A 3ZIWA 3LZZA 4A42A 1BBT1 1RUF1 3DPRB 5DPNA 4BZ4A 5JCTA 1HV1A 4OI0A 2OZJA 3JXSA 1GSLA 3PVOA 3J7HA 3CMGA 2ZGOA 3HBKA 5LBFA 3H9AA 4HVRA 5A7QA 4EE2A 4IGOA 2HWE3 3ZX7A 3PNAA 3MIDA 4AK3A 1UZVA 1WA6X 3OPTA 4QGNA 3N3HA 1W9TA 2GC0A 1JHJA 1YLLA 1J1LA 2VMIA 3RSJA 2WN2A 3DPRA 3ALQA 1DLLA 1SCSA 2WFPA 5DZEA 2GMEA 4EYUA 1XE8A 4P9WA 1LB2A 5JZGA 3MPPG 5ABJB 4AGVA 4B8EA 3CF6E 1SLBA 1Q8OA 4AEKA 2BGPA 2PHRA 1H4HA 2PHUA 3IB3A 1H0BA 3S7IA 1WCUA 5CADA 3H1MA 3VV1A 1G9BA 5FPUA 1DQ0A 3ZPYA 5CKNA 2JG8A 4L11A 4IE5A 2WZ8A 4COZA 4LTAA 2GDFA 5FO8B 2ZGKA 4P02B 4O9GA 5ABJA 2PLV1 2UYBA 1GZTA 2UY8A 1CAWB 2P3YA 4ITCA 4RSUA 4W6YA 4AF9A 3TEWA 2R041 5HV4A 1QXPA 2XH6A 4DEQA 5L19A 1CWPA 4MADA 1XBFA 2R062 1S1AA 3LEIA 3VHRA 1ZRCA 2G9FA 2DFBA 2DTWA 5CAZA 1IZ3A 3T3YA 2KD7A 4Y4YA 5CYYA 2EXJA 3D0SA 5A6QA 5FR3A 4QQLA 5L9VA 3EB7A 1X8MA 4ZKTB 1TMF2 5T5JA 1LOFC 3WCSA 2ZOEB 3J7MA 1CAWA 1S0CA 2ZX3A 5DAVA 1ZBA3 3M3CA 5FP9A 4ZY9A 1RITA 3TN91 4CA9A 3SC7X 1LOGA 1W0NA 4HKLA 4YLZA 3ZOIA 1S0FA 1ZBE3 1R082 2WT1A 2JB8A 1APNA 4YGCA 1PO21 4M3CA 4QM8A 2JICA 2ZMLA 5E8AA 1PZ7A 4Q26A 2W5FA 4GH4A 4AVAA 2EF6A 3HQUA 5FZAA 1VR3A 3JU9A 1QIQA 5CNAA 3AYDA 2XMLA 3W59A 3RZKA 5GLWA 5FZ3A 4KQ7A 4YG0A 4SBVA 1F35A 4MYEA 4KG8A 5A1LA 3ACFA 3K4DA 5FMCA 3S57A 1WMXA 4K40A 1QOTA 2Z42A 5C8WA 1JH5A 4QT6A 2DVGA 2IXHA 5F39A 3VBOB 4BM8A 5FXVA 3BTXA 3RFRA 2VNGA 4CEWB 2UWBA 4LORA 1I5ZA 3IT8A 2DDUA 5CU1A 1FV3A 1PIV1 5FY0A 3WUCA 2KXLA 2WL1A 4CP2A 4XUOA 2JDNA 3HNYM 1NLSA 4O7XA 1DP0A 1UZWA 4I3PA 4M01A 2OT7A 4V2VA 4B4QA 5J37A 2J1UA 1LKNA 1PMHX 4NWWA 5LBBA 2AREA 1WCSA 4JTNA 1GKBA 2YDEA 1K5MC 5LCWL 2R7EB 2VD7A 2VW0A 4LA2A 3I3DA 2ETEA 4YFZA 5JI9A 1RUI2 2P2KA 4MGQA 4QX0A 3FFQA 1JI6A 1FYUA 3N9LA 5F2WA 4LMFA 1OUSA 3S30A 1J84A 1W3VA 4UW5A 5EZWA 1OI6A 2F4LA 3ZIXA 3VBFC 3I3BA 1SBDA 3C7OA 3POJA 1PM7A 2RDNA 4PDWC 3ZXAC 1SFYA 4CDUB 2R061 3LD8A 5A7OA 2VUAA 1KQRA 1ASJ3 1NCQA 1OA4A 1PO12 2J1SA 2Y38A 3BN6A 3BU7A 4X8PA 3MV11 3LDKA 1N1TA 1W9WA 4GMP3 2RV9A 4LKDA 3VZMA 1NZCA 1JU3A 4JHZA 3R4DB 1N1SA 1OLRA 3O5SA 5JSPA 1PX3A 2XUEA 2D6OX 1CAXB 1ZA7A 4HL0A 2X5IC 1MS3A 3B5LB 4L8QA 4YZ2A 1R081 4XTPA 3VZLA 3HR9A 5KXEA 2PHWA 3URFA 1MZ5A 1W39A 4MGSA 2GC2A 2HH9A 4FCAA 4Q4Y1 3PJYA 4K7JA 3WDXA 3CZUA 4JKLA 4CCKA 1OD5A 4QM9A 2WZR3 1XYNA 5C5TA 5FP3A 1JYCA 4DNYA 3ZR5A 3HIFA 2Z4FA 5CBLA 2K2SA 4TYSA 1POV3 1CZTA 3ZDSA 1GMMA 1W03A 3TB0A 3O1MA 1YQ6A 3PUQA 2VPVA 2C24A 5K8SA 1UY2A 4NR1A 3RZHA 2EIGA 1F8VA 4OHZA 4IE7A 3JQWA 1W2AX 2PELA 4A44A 4B1MA 3GBWA 4S2DA 3VBHC 4AFBA 4Q0SA 3KVBA 1D7PM 2X8KA 1SG3A 2ARAA 2C9KA 1QHDA 2HYKA 3FJSA 5FZEA 3WF3A 4ASLA 2WO7A 3S0MA 4IQPA 1JHNA 4PT6A 4R8HA 2CYFA 4XDPA 1C1FA 4H55A 2PYTA 4W6WA 1C5IA 1JU4A 1W6MB 2OQ7A 3OJBA 4HONA 4S2FA 4URTA 2C1FA 1RL3A 3U10A 2VOVA 2EICA 4OYUA 4OMCA 3H3ZA 3ZYHA 1F31A 2Y6FA 1RUH3 3MI8A 2ZEZA 1UY4A 1HB2A 2HLEA 4PHZA 5JXIA 3VBRC 1JZ8A 1RUD3 3IPVB 3R4SA 4DFSA 2A71A 3DKQA 4V2WA 1JYTA 5CZKA 3ZXLA 1QJZA 4LBJA 1COV1 1W6MA 3WW4A 5JSOA 1SDWA 1UZYA 2Q8CA 3QLQA 1LESA 1HV0A 3JUUA 4TN7A 5DZFA 5FYTA 3C7GA 1N3QA 3RZJA 2GAUA 4E8CA 2B7YA 3OG2A 2EAKA 2WO2A 2B39A 5CFCA 4IV3C 2FDHA 1LTEA 2XHNA 1JTZX 3WOGA 3KCXA 2VXJA 2WR9A 2XJPA 4C1XA 1QGLA 3MIEA 4WV8A 3IN9A 2PAEA 3VD4A 4QXCA 4IEWA 2A1XA 2D7FA 2UWCA 1UOFA 1VP6A 4P9JA 2J22A 2ZA9A 4RN5A 4WM8C 3NKTA 4PQ9A 4RHV3 5J09A 1W6PB 1XYOA 3R0RA 4IGQA 5DXDA 3LCPA 4CCNA 3KMHA 2ZTNA 5D8AB 1TQ5A 4XJWA 3BU0A 5IK8A 2QDNA 2R0FA 2EIEA 1W8HA 2DU1A 2WNOA 1VIWB 2OXBA 3OGSA 5BNOA 5F3GA 3KS7A 4OZXA 3Q8EA 4GZ9A 2DV9A 2O8OA 3T4HB 3VUOA 1CPNA 3I2KA 1XU1A 1AR91 3NV2A 2XL7A 1W6NB 3VKFC 1MZFA 2HWE2 1VB2A 5I0TA 5FZBA 2ZGNA 4FOVA 1WMDA 1H2LA 4QGMA 4AFCA 1IS3A 1MS5A 1X9PA 3SMHA 4C0BA 2Y6JA 4FAGA 1RUNA 2I2SA 3HEIA 3IKWA 4PF5A 5IVJA 1NE4A 3BKZA 2XL9A 4P5YA 3SLIA 4NPMA 1AYN3 1Z78A 5BNQA 1EPZA 2IXIA 2DFCA 4XF1A 1GZWA 1K5MB 3MPBA 3H1WA 4LNVA 3WLUA 4XVHA 3HN3A 2HWB3 4PLMA 3MO4A 1FXZA 3N9PA 4KU8A 1LHWA 3O1PA 3GJBA 1O7FA 4FO9A 1ND2C 4NIAA 1RVF1 2IZWA 3TRSB 4D94A 4WM7A 1QJY3 1YNAA 3PUIA 2WO1A 4CPBA 3PLQA 3DYPA 1AXYA 5LA1A 4QPGA 2BWAA 4F8AA 4P08A 4EN0A 1CZSA 3QOPA 3PMSA 5JWPA 1M4WA 2WWJA 1LOBA 1WCKA 1Q8VA 5BNPA 2B9UA 3J9SA 4PI2A 1ZA4A 5BV6A 4K8FA 1OLMA 1BBT3 2X5IB 3HD8B 4RGGA 4CP9B 3RZMA 2HEYF 2ORZA 3NNLA 1LHNA 2ZKLA 4MSVA 4NROA 4YVWA 3SKJE 3N9QA 3A0KA 1RUC1 1US3A 5DQ0A 3N7MA 1ZBA2 1JOBA 4Y1VA 2Y6HA 3J8F1 5DUVA 5FP4A 3O1TA 3UGHA 2WQZC 1ZBE2 3T0DA 1UW8A 4OQ9A 1QH6A 2P3JA 3I2HA 5IVEA 1HQNA 2IC1A 5F3CA 1VBC3 4KG0A 4S2GA 3UKNA 2YBSA 4XAEA 3WF0A 4L9BA 3ZKUA 1UNBA 2KA3A 2XGXA 4M4RA 5C71A 3KV5A 2D5FA 2HWE1 1YI7A 2ZBJA 3LGRA 3I3QA 4PBOA 1N1VA 3E6CC 3D0JA 4MXWA 3VD7A 2VOWA 1GNZA 2H0BA 4Y26A 4O9EA 1O3QA 1W2TA 4UAPA 4I2OA 2JG9C 1ONAA 4CE8A 4AEMA 2EVXA 1OKOA 1BK0A 1OD3A 4EZHA 2PAKA 1DCSA 1H8VA 5L7OC 4JV4A 4AG4A 2FBEA 3MDPA 2ILMA 3VBRB 1SMVA 2CDOA 1UZZA 2J1EA 3GDBA 1TME1 2MPFA 4L0PA 1AZDA 3O7OA 1YJLA 1O5LA 2AR6A 3GALA 4HANA 4Q4X1 5CG9A 3TN93 3B93A 3I3EA 4TWTA 2ZX2A 4XE9A 5H9RA 3RGBA 2GC1A 4PIYA 3CHXA 3NJVA 1ZZ6A 5C4WC 3VDDC 2YY1A 5I0SA 2W52A 2AEZA 5LK5A 5LRSA 4JZRA 1PO23 3NSTA 1ASJ2 2VVFA 2VCBA 1JYNA 2IXJA 2SLIA 1G6NA 4DZGA 3TBDA 5CG8A 1Y43B 5CFDC 5I0DA 4CCEA 2PHLA 2VZPA 4YVSB 1F9KA 3NWKA 4UFLA 3AKSA 1VMJA 2P1BA 2RJLA 3FBMA 4WM8B 1H2NA 4YZ4A 4Z8BA 2C26A 4NE9A 4PJYA 1H8TB 3SCGA 2AENA 2FZ1A 4QDSA 2A75A 4BLIA 3PIGA 4KL1A 5BYNA 2DUOA 4GKYA 2BNNA 2XJUA 3ZYIB 3MIGA 2ARCA 4LHNA 2A5ZA 2W95A 5EXOA 4MGTA 1NXMA 3BYWA 1PIV3 1SQ4A 2QQMA 4LBQA 4YVSA 2WZR2 3V64A 4AVTA 4EWAA 4XHBA 5T54A 1VALA 1OOPC 3ZN6A 1H8TA 4JC1A 2OKXA 5J1XA 4I0BA 3SQOA 3ROUA 3ZFEA 4LKEA 4YGBA 1NLQA 1ULEA 1RHI3 2WA4A 5FZHA 1WLWA 3POBA 2HEVF 4MGKE 2JKXA 5FOJB 5APAA 2XLFA 2ET7A 2GP3A 3M7AA 1LECA 1F15A 4HKOA 4XUPA 3ZSLA 3AP5A 5FP8A 4BYYA 1AR83 1UD1A 1TZOA 3N36A 1XXNA 5FZ7A 1Y9QA 3DF0A 3V65A 1LAJA 3NW4A 1RYYA 3UESA 4CDQB 5AVAA 1ND2B 4UW6A 1UYYA 4W65A 4P5HA 3RYPA 5GZDA 1W2UA 1DQ2A 1UZ0A 4Y5Z0 1BK1A 3FLTA 3WX5A 1WBFA 4FI9A 3M3IA 1RUH2 2ZX0A 4JRAA 5GLVA 3VBUC 2A73B 4BISA 2GU9A 1RUD2 1FOD1 2FCUA 2ZHNA 4LULA 3IIIA 4IL7A 2SBAA 4NIGA 4QB6A 4Q4Y3 2D3SA 3A23A 4CDQA 4Q0UA 5M0TA 4X6RB 4P9LA 1AXZA 1UN1A 4D6SA 1B35C 4RD7A 4OUEA 1J59A 1Q43A 1RJ8A 3ZMNA 5ANNA 3KM5A 3K48A 4LO8A 4NJ4A 3BGAA 4INDA 2RM21 1NY72 5GLUA 4IE4A 2B46X 1RXFA 2VOTA 4V1PA 5C3SA 3PIJA 3POIA 3VGIA 4AEDB 4H2AA 2R071 2O1QA 2YGLA 4IEOA 4NUBA 2YPDA 4YW2A 4AI1A 3IWZA 3AKTA 3T2QA 2W39A 4YYOA 5FLHA 5T5LA 5GJ6A 3VN4A 1KITA 4UOJA 4RHV2 1S0BA 4LKFA 4QWNA 4YM3A 1HB1A 4YW4A 2W1WA 1G9DA 1QJEA 2YHJA 1V6LA 4BU2A 1CAVA 3B01A 4A6SA 4Y4RA 1POV1 2PQQA 3CZJA 1D0HA 4BH9A 4AEDA 5K0UC 3TYJA 3GCWA 5EIYB 1CZVA 3P3PA 2ZHKA 4N43B 3KGZA 4PBPA 1QWRA 3WW3A 2D6PA 2JJ6A 3AZVA 3HPNA 4XZPA 1W3XA 4W6XA 5DUUA 5DAQA 4W50A 5FK8A 2AH2A 4W4ZA 5IATA 3PL0A 2AYHA 5FQ0B 2Z5WA 1UOGA 4AVBA 1AX0A 1COV3 4C1WA 4MUVA 1R1A1 5IT6A 1C1LA 2NPIA 5FXXA 4N43A 1RUE3 3KT7A 4GIQA 2AC1A 5FZCA 4K6BA 1AYN2 1CIWA 1YFXA 2DCZA 3HNMA 3O1UA 2Y0IA 5FZOA 3OGGA 3PU8A 3VZNA 4LBKA 4RS5A 1RUH1 2HWB2 3M8LA 3UL2A 3FMGA 4ARYA 2DVFA 1RUD1 5IW0A 5A70A 1H30A 3AL6A 2RDSA 2VULA 4E4DX 1BLZA 3K2OA 1URXA 4FFGA 4AEJA 1EPWA 5C4WB 2BPA2 1PGW2 1QJY2 3ILNA 2MHFA 1C8M1 5BNNB 3UJQA 4WVMB 4ZS3A 1DGRN 4ZXKA 4D0QA 1CR7A 3ZYGA 3AMMA 3SHRA 5FMDA 2XPJA 2BTVC 2VTXA 3AMNA 5GZFA 4LK6A 3LQCA 4LO6B 5BUVA 1GQGA 3T09A 1DQ1A 2UU8A 5CB7A 3K77A 1NY71 4UT5A 3ZPOA 1GP6A 1K3IA 1UY3A 2PQSA 5A6ZA 1QEXA 4XBQA 1BBT2 4GH4C 5BNNA 2D40A 1DYPA 4WVMA 1AR93 2ZMKA 3MEPA 3RYKA 1UU5A 2GH2A 3O0VA 4RHV1 4YG3A 2TEPA 1HRI1 2CGOA 1W2NA 2FDJA 3UNPA 2DTYA 3LFMA 4LOTA 2ZS6B 4UF0A 1ZZ8A 3E97A 5KC6A 2XB6C 4IEUA 1T6BX 1H4GA 4XFCA 2J1RA 1OH3A 1H1IA 3VBSA 5I0RA 3J4UH 3JB8A 1CJDA 5FY9A 5FPVA 4YW5A 3OBTA 1V6NA 2VMEA 5F6LB 1XNKA 1VBC2 1UWWA 2CNAA 3GF6A 3KV6A 4QPIC 1JYWA 4D6QA 3VDAA 2VCMA 2ZZQA 1PVC1 1QNYA 4IETA 1OVPA 1JMUB 3AC0A 4AGGA 4CCCA 1XQNA 2VJXA 3MIFA 1WUVA 1RVF3 3E5UA 2NQYA 1REEA 2RE9A 3V0AA 4CEYC 1S55A 2BGOA 2WKKA 3AP9A 2A6ZA 2UY9A 1OH4A 1CX4A 4LE4A 4Y20B 1H6XA 5A7WB 1I5PA 1QDCA 2P3KA 1DGWA 1EV11 4I0WB 4IESA 3S7EA 3SEEA 4Q4V1 4P00B 4COYA 2XG3A 5DDJ1 5H9QA 1N3OA 1X8EA 5DAXA 2CGPA 4FOWA 4NHKA 2VW2A 4YW7A 3K51A 1DHKB 5KHJA 1Y3TA 4MOAA 2XHKA 1NCQC 2VW1A 2NM1A 3VBUB 1PK6C 2NLRA 4KGQA 3BUCA 4Y20A 3JBG1 2V72A 1QJY1 5A7WA 3HBZA 3KT1A 4UI9L 1RUC3 3OBZA 1BJQA 3TN92 3ZXFA 1UU4A 4YW6A 2CWSA 3J8F3 1CAUA 2WFF1 2XJVA 1OPMA 3AMHA 2ZACA 4Z2AA 1NCRA 1QJU3 2EIBA 2NMOA 5C9AA 1PO22 1SPPB 2A3XA 2YBPA 1GOGA 1GQHA 3BODA 2RS51 2R30A 3IDCB 3IZOA 3KGLA 3HT1A 4XUQA 1H6YA 1OKQA 3DXUA 3MFAA 4FPLA 3WDVA 1YQ5A 1RIRA 3KLSA 4NHXA 4UBGA 1RJ7A 4XMAA 5A7NA 3U4SA 4HPKB 5HCBA 2BQPA 3DL3A 3UT0A 5IWFA 3U4XA 4DQAA 3DECA 3V0BB 2VXRA 3LEMA 4XMIA 1FMD1 3WG1A 4Y1ZA 4Y1XA 4DUXA 1NA1A 4DXZA 3THDA 1Q8PA 3NQHA 2WNVC 1IS4A 2DUQA 2VCAA 4XFBA 4Q8KA 4ZONA 1DLCA 3ZYFA 3ZXJA 4IUGA 2FDKA 1Z7S1 2D5HA 5K0UB 1VBC1 4NVPA 2QQVA 1PIV2 4HPKA 4L99A 1V6JA 2XLGA 3AP7A 2JB4A 4ZU5A 1JXNA 2LW8A 3SH5A 2D98A 1XSQA 4QB2A 1HXS1 2HJIA 1TME3 3H7JA 2E26A 2WNUB 4Q4X3 2VVEA 4ONUA 1RHI2 1Q3EA 3THCA 2VMCA 2PN5A 5CKMA 3THPA 2LALA 3C7EA 2FMDA 3ELNA 4LA3A 2PHXA 3WUDA 2Z79A 3KV9A 3I8TA 4GWJA 2DVAA 4D7YA 4UXAA 2VTFA 1BHGA 1AR82 1AXKA 2BZDA 3RMXA 3O1RA 3QD6A 5FZIA 5LA9A 3IMMA 2WNUA 2DCTA 1KGYA 3E6BA 4IEYA 2ZXQA 4AI9A 5JR2A 3ENRA 5HV0A 3IMNA 3KSCA 2ADDA 1VLNA 4LBMA 5CFCC 4ISRA 1TNRA 3RG0A 3NAPB 2NMNA 2PHDA 3R6SA 2QQLA 4XAAA 3H8RA 4LO4B 4R4ZA 1WZXA 4CDXB 1HW5A 4LUKA 1GOFA 3OGRA 1A8MA 4ZPIA 4GMP0 1GQPA 4Y22B 4E2SA 3AM2A 4K20A 5T3NA 4Q4Y2 1UX7A 3BALA 3MIBA 4LBQD 3C3VA 1MQTC 2WS93 1UYXA 3A0NA 4A41A 4GXLA 3NAPA 2Q8OA 4AW7A 3POSA 2OA2A 4I30A 2AGSA 2D44A 3M2MA 1AUYA 3LA2A 4OUSA 3RNSA 4DY5A 2W46A 4CDXA 1ND3C 5BNOC 2F6BA 3U11A 2ZJCA 4IEZA 3ZFGC 1C57A 4LKSA 2FDGA 4EN6B 1W04A 2DCJA 4J25A 4NHLA 4R52A 3T2PA 1XE0A 1POV0 2PA7A 3VZJA 2BBAA 2EAAA 4ZU4A 1Y7BA 4QPIB 3POGA 2G19A 3RZGA 4XACA 1GLHA 1OA2A 1UMHA 1S0EA 2F17A 4MLOA 1UPSA 2QFEA 2WQ4A 3NJYA 3VBOA 4OUMA 1RGSA 3VKNA 4QPWA 4CEWA 3N9NA 1SBEA 1RHI1 2OYZA 2OPWA 3OEBA 4CEYB 3ZYPA 2YBKA 3MW3A 4AZZA 3KCYA 2E32A 5B2GB 1XSRA 1FOD3 3H7YA 5FZ0A 1ZZBA 4IV1B 4DPNA 2YB7A 1JZ3A 1S4CA 2QJVA 3VKOA 4OMDA 4HETA 4XQWA 1COV2 1AR81 2E6VA 4FTSA 3K75B 3OSDA 3MLKA 2BFUS 1VAKA 2P5BA 2XQRA 4LPLA 4YW1A 3J7LA 4JGZC 3AMPA 1W6OB 1I3HA 1RUE2 5LBCA 4Q8LA 3D6EA 4RGAA 4XCBA 3KD4A 4FQ4A 4LLFA 1PK6B 1QXJA 4XOGA 2BEOA 5FYBA 4BHPA 5BY5A 1JN2P 2TUNA 4NRPA 3E5XA 4RQPC 4E27A 1IG3A 2QZ2A 3FBYA 3HOBA 4IV1A 2O14A 2RM23 3RVHA 5FZGA 4LBNA 3HT2A 1O3RA 3WQ7A 4CDUA 3IAQA 2VY0A 1H1AA 2R073 3WNNA 1IQAA 4XXAA 1UPIA 4DUVA 1LHUA 3WP5A 3SCHA 4Y24A 4A3XA 4COUA 1PZ9A 5EYYA 1ULFA 3N35A 4HOOA 3B94A 4QX8A 4YVWC 5LASA 3FN9A 1YXWA 3ACGA 2W08A 4QD2A 5T5OA 1CN1A 1DG6A 1GP4A 1J3QA 5F32A 1CAXA 2X10A 3A22A 4LITA 3KF3A 5FUIA 4DXTA 4N8MA 1U12A 4LT5A 2X53S 3HAGA 3EO6A 3VKLA 5FLIA 3PVNA 2LM3A 4BK5A 1OUXA 2LS6A 3KT4A 3NKGA 3GHNA 4AI0A 4R9AA 2G9GA 1YQ8A 1IS6A 2EXKA 3BTAA 4FFIA 4FFFA 4JQTA 2WNVB 1AR92 2RMU3 2VM9A 4HK8A 4PQQA 1QY4A 4LHLA 2NN8A 3K3OA 4XIOA 4MG2A 4Q1RA 1XNTA 2DURA 2VR4A 2BOJA 3CJIC 3O1SA 3SH4A 1R1A3 4CCMA 1RMU3 4AR2A 2Z69A 5A1FA 1IQDC 1KD7A 5JXHA 1J3RA 5DAWA 4R9CA 2VL4A 3KV4A 3WXPA 4QX5A 2WA3A 4YFWA 4Z92B 3ZSJA 1AF9A 1V0AA 5T52A 3GCXA 5J36A 4MXVA 3DKWA 4JQRA 4K1ZA 1RVF2 3UGFA 1GZCA 4TTGA 3AVRA 4F3JA 1OLME 1S0DA 5E89A 3RS6A 3UGGA 2B8MA 4L97A 1C8M3 5KHHA 1XPWA 1GU3A 1SLAA 2D3PA 2NZ9A 1RUE1 3FL7A 4TXWA 1RC6A 1NQDA 3H42B 2D3RA 1KJLA 1WA4A 2D43A 4YW3A 3TEZA 1BXHA 2HKXA 3IPVA 3WHUA 2R32A 1NX9A 1N3PA 3GNEA 4OI1A 3RJ2X 1ULPA 4XHXA 1O5UA 3AZXA 4HKWA 4J6GA 2DUPA 2GN7A 1LJ7A 3NNFA 5A3PA 4AHWA 4N90A 1UO9A 5KXDA 3HJRA 4GJYA 2D6MA 4XFIA 1E57A 1DQ4A 2EXHA 1OT5A 3ZN5A 1XNBA 4CU8A 4FPJA 2LROA 3VL8A 5CKQA 2P6HA 3AXEA 3Q8FA 4AVVA 1HRI3 3L2HA 1RUG3 1RUC2 3BPSA 1YEWA 2VZ1A 3P5BA 2X29A 5J96B 1RTVA 2TNFA 3J8F2 4AVSA 2WIIB 1LOFA 5IUQA 1UIJA 4CU7A 4HBNA 4L92A 5EJZB 1QJU2 3LAGA 3K4ZA 3Q8AA 5F1RA 1LGCA 5KHGA 5DAPA 2WT2A 4BLJA 4I01A 3O0XA 4XPVA 2YPJA 5SV5A 1QMJA 4NHMA 2E7QA 4BQXA 1PVC3 2ENRA 3UV9A 1W6PA 2VUDA 5C33A 2WZEA 1CPMA 1ULOA 5D8AA 2WYFA 4KWUA 3GBFA 3PMEA 2W47A 1UMZA 4ZS2A 4B3NA 1E5SA 1Q8SA 3ZFFC 3AJZA 2GMPA 2WAAA 4UFMA 3G7DA 1YWKA 2VQAA 2X05A 5JMCA 3TWIA 4XJ9A 3PUHA 2WLQA 3WF1A 4BMBA 1DGWX 4QKNA 3I2GA 3R05A 1EV13 5FY1A 4Q4V3 3GZUC 1ZZ9A 2AUYA 3I4IA 5DDJ3 3WG3A 2E31A 3S6PA 2XVGA 4N7IA 1W6NA 2TBVA 2QCSB 5FIXA 3U0ZA 5HCHA 1IG0A 2YU2A 4TLFA 2RR11 5LATA 3KF5A 4F7ZA 2HBUA 1JOPA 1WLDA 2K0GA 4S2HA 3JBG3 1TME2 3VBFB 4CDWC 3OOXA 4CCOA 2ARBA 4PDWB 4BPZA 4PF1A 3FUOA 2FDIA 2D6LX 4Q4X2 2VNRA 5FLJA 3RI9A 1HLCA 1K5MA 2VQUA 3NNGA 4DRRA 5IK7A 1C28A 1SFNA 5E6HA 2WFF3 3CL1A 4Q5OA 3RDIA 3OBRA 3U1XA 1NOVA 4Y1YA 4JGYC 4FXKB 2VQ0A 4O65A 1R093 2VZRA 2RS31 1HIXA 1W8UA 2JDYA 1LENA 3VBFA 2WLPA 4ES9A 4GQ7A 2RS53 1WLCA 4AQSA 4PDWA 5FYUA 4RGKA 5KWRA 3LOBA 3PU3A 1LEDA 1IKQA 1W8FA 3WDUA 1LRHA 2QUOA 4E4SA 1TEIA 3ASIA 4D8MA 5CEHA 1DDLA 1MS4A 1E5IA 1FMD3 4MVTA 1FPN1 1W8ZA 1OQ1A 4LO5B 4XQ4A 2QE3A 3ZXDA 5LY1A 2K46A 1QJU1 2B5HA 4CP9A 2X5IA 5AC93 3QCWA 1O59A 5A3OA 2XBO1 1Z7S3 2ZKNA 2AACA 5FP7A 1GICA 3I2JA 5I91A 3O1OA 4N53C 2G9ZA 2UYAA 1VMHA 2WS92 4Q0VA 4R9BA 4DIQA 2PXJA 4BQYA 2A7AA 4UFIA 3U37A 1QQP1 4FFHA 4XF9A 3VBHB 1HXS3 4ZU7A 5HCAA 2RS11 3MW4A 1W99A 3LSEA 3QBQA 2XVLA 4QPYA 4Z07A 1M06G 3AKRA 3VZKA 2BV4A 2Q1FA 3OF1A 3AXDA 4YZ5A 4PI0A 2DVBA 3ZXKA 2ZPXA 1WBLA 5FO9B 2V73A 2YMZA 4MGZE 3IDBB 3SH3A 1PMJX 1AR73 4E4ZA 2FD8A 3VBHA 2YU1A 4LIVA 4GB31 3UJOA 4N9IA 1SFPA 3VHOA 5JIUA 3LEGA 5FZFA 3DGTA 4ASMB 1ULDA 2XOMA 2IXKA 2WINB 3MICA 3U78A 2A6WA 2W1UA 1WKYA 1V6OA 5DUXA 4IE6A 1XB9A 3C2UA 1ZX5A 2G4IA 2JE7A 2XKPA 1BEV3 5FZDA 2OW4A 1QJX3 2J7MA 2YXSA 1OVSA 1FOD2 1OHFA 4U36A 1TE1B 5FBZA 1W2OA 2BGCA 1UKGA 3GGLA 4BIOA 1DFQA 2Y33A 1US2A 4QX1A 4IV3B 3VBRA 4EQVA 1NE6A 4M0NA 4FPGA 5LZ6A 3M3EA 1HRV3 4JDNA 4JKMA 4XABA 5CA6A 4RR3C 2XQXA 3OTFA 1J83A 5FMOL 2Y26A 3I49A 4OULA 4P9YA 4CSWA 3G6JB 4QHZA 3D82A 3ACIA 2RM22 4DOUA 3EHKA 1VBB3 4IV3A 1ENXA 4GAZA 2R072 4A4AA 2CDPA 5JOZA 3MLLA 4AE2A 5FYHA 1BVP1 4B7KA 2CU5A 2UURA 1C8NA 4ZZ8A 5C3OA 3B69A 3B02A 4NAMA 3CEWA 4EN9B 3THTA 2WS91 3I54A 1W8TA 2VUJA 4AXOA 4WM8A 4JDOA 1RB8G 3ACLA 3N7LA 1DF0A 4XIKA 3ECQA 3RWNA 3W5NA 3LIGA 4W8JA 2FQPA 3CQOA 4QQHA 5A3TA 2BERA 3GHMA 1Y4WA 5A6XA 3NNJA 5JOYA 1VBE1 3ZFFB 3MUY1 2HWC3 1UX6A 1KJRA 2IXCA 1OA3A 1PGSA 2VZTA 3ZM8A 5SV8A 1XNDA 1XRUA 2WYSA 2E7TA 3GBGA 5FWEA 4NAOA 2RVAA 2RMU2 4NPLA 4PIXA 5FTTC 3IAPA 2EIDA 3KCCA 3WVJA 4DXRA 3F95A 3FHQA 2GZWA 2WO3A 4KI5M 4G9SB 2QQIA 1R1A2 4HG6B 2JEMA 1RMU2 5GM0A 4QXHA 1JYVA 2IWGB 1BZWA 1DZRA 3KWVA 3LDBA 2ID4A 4HLTA 3FHIB 1LCLA 4X6QB 2V4VA 5E88A 3LKJA 5GLZA 1HJGA 2VCCA 2NYYA 4CDWB 3PVBB 2PHTA 1NLRA 4AQ2A 4AI8A 1OFNA 1W9YA 4CU9A 4BXSV 4MO3M 4BA6A 2Y6GA 1YQCA 3ZKYA 5C8CC 2VMFA 1FT9A 3K46A 5HXVA 4CTEA 2Y60A 1C8M2 1ND2A 4IGPA 2E9QA 3T4VA 2I45A 3AKPA 2P37A 1IGOA 2ZZJA 5FREA 3OCPA 2JENA 3A7QA 4JTOA 3QACA 5KXBA 4QAWA 4CCDA 3SISA 4M0HA 4ZHNA 1U5XA 1S0IA 3E5QA 5FRAA 1IS5A 1YCIA 5A7PA 4FPYA 5AVPA 4XF4A 4A7YA 2YROA 5FWJA 1PGL2 1VMFA 4E2GA 4HZFA 3T2TA 4I02A 4YGEA 1JS9A 4FPOB 5FZKA 4RFT0 3F2ZA 1E5RA 3W9AA 3ZN4A 1MS9A 4AHYA 3OGVA 2MEV1 1DYKA 2ES3A 5IAXA 1OQEA 4WBBA 4LO7A 3LA7A 1HRI2 1RUG2 3K4AA 5A80A 2VGDA 3VD9A 1JODA 1MACA 2WWSA 3EYPA 3NV4A 1S0JA 1UCXA 1VAVA 1RUJ3 3D3AA 3PUSA 1S2BA 1UU6A 1UAIA 5FUNA 2VTXJ 2Y34A 5FZ9A 2H6CA 4AI3A 2Q1ZB 4H7LA 2ZGUA 3DPRC 1MVEA 4QX2A 4NRQA 4BQ1A 5ISLA 1LR5A 5A32B 4HVOA 4OQ8A 1HB3A 5FZMA 1PVC2 3I3MA 2ET1A 1XYPA
chains in the Genus database with same CATH topology
2RMU1 4P9XA 2JG9B 2JD4A 2BBVA 1REFA 1IHMA 3FZ3A 4OI2A 2JG8C 3DN7A 3N7KA 5L7OB 1AL21 1RMU1 3HN1A 1YIFA 1VBA3 2CAVA 2EA7A 4AFAA 1FX5A 3OD0A 5A33B 1EV12 4PIZA 5A32A 4Q4V2 5ABJC 1BYHA 5DDJ2 3DV8A 2V09A 1D2QA 2JG9A 2ATFA 5FQ0A 4GKXA 2P17A 4N9HA 2OVUA 2VH9A 3POWA 1KRIA 1GNHA 5L7OA 1Q56A 3OY8B 1GFF2 1WLTA 3JBG2 3VDDB 1PNGA 5A33A 2GMMA 1F5JA 5JOWA 2QNKA 3ZXEA 2BUKA 2F4PA 4LLOA 4EWDA 2WFF2 4RR3B 4DMIA 3ATGA 5CFDB 4JDMA 1O4ZA 3AJYA 4CZSA 2VNOA 1R092 1PGL1 3ZMOA 3WINE 3WR0A 4EROA 3WP4A 5C4WA 3VDDA 4XFGA 1HDKA 3ILFA 3VHPA 5IK8A 2RS52 5FPZA 3NJZA 2ZGQA 5KHIA 2BWCA 4LBOA 1G8WA 4HFSA 5A3LA 1RUG1 2C9AA 5CFDA 3TOJA 2A70A 3VZOA 3FC0A 4Q0QA 1G9AA 1FMD2 1V6MA 2OPKA 3USUB 1FNYA 1OOPB 5AC92 4D7TA 3MFCA 2YC0A 3HWJA 1Z7S2 3ME2A 4B4PA 4IEQA 1JUHA 3JD73 2A6XA 2DYCA 1H9WA 3FUQA 2OUHA 2RR13 5A3MA 4TZDA 4OHXA 4WVVA 5JOXA 2JECA 1SLCA 1HXS2 3ZSEA 1C5HA 1D4VB 1S0GA 3VBOC 4NWVA 1YJKA 1OOPA 5BXXA 4IERA 3FWEA 4P9GA 5DG2A 4AYUA 2QKDA 1YIPA 2A3YA 3WG2A 1AR61 4YZ3A 1QF3A 2NP0A 1EAH1 1G9CA 1ZYBA 5ACA3 2RS33 1AR72 1JW6A 1ZZ7A 4EN7B 2ARXA 4YM0A 4ATFA 3BOWA 4NPRA 5T55A 3RPQA 3INAA 1D4M1 1PMIA 5H9SA 5C8CB 5LEJA 2W68A 3MGUA 3RJRA 1BEV2 1FPN3 1QJX2 1YYNA 1B35B 1RUOA 4ORFA 1DZTA 1MEC3 1R091 2ZGLA 1ZZCA 3VBUA 1A8DA 2XBO3 1C3HA 4H7MA 1HRV2 4XF3A 5FFOC 3WNXA 1MS1A 3ILRA 3X29B 5KHKA 5JPMB 3B9IA 2YV8A 3TNPB 2ZHMA 3WP6A 1QQP3 4FPHA 2MNGA 2R1DA 2RS13 2LTNA 1KS5A 4XJ8A 1VBB2 3WHTA 1NYWA 1X82A 5J7MA 2VU9A 5DUWA 2ZAHA 5AC91 4EWEA 3V56A 1WD4A 1X36A 2C5DA 1VRH1 1VB4A 4XETA 1H9PA 4GB33 3V0BA 3WG4A 4PLOA 4HMZA 1ULCA 4CP0A 5BPXA 2WNEA 3WD5A 2HWC2 3PHMA 1A78A 5J48A 1WGPA 2JG8B 5K0UA 3ZYRA 5JIAA 4DY3A 1BCXA 4IEVA 2CWMA 3MIHA 1VBD1 1CVNA 2GNMA 4QXKA 1AR71 1R1ZA 4KU7A 1XU2A 3MW2A 4OHYA 2JDZA 5H9PA 3D8CA 1LOCA 1WCDJ 3H1YA 1ZVFA 3BPZA 4AWDA 3ES4A 1CESA 2XLAA 3NO8A 3TNQA 3WQ0A 4F83A 1O4TA 3H0OA 2GH8A 5D1IA 4CP1A 1BEV1 1QJX1 2GSYA 4WZFA 3KZ4C 2RHPA 2DWRA 4AGRA 2R49A 4JCKA 1HRV1 1LODA 1PVXA 5AFBA 4M3CB 1JBCA 3B7MA 1YFYA 4GH4B 1J3PA 4HT1T 4H3WA 3M1HA 3PJQA 4PLNA 1JYIA 3ZXGA 4Y22A 5I8YA 1VBB1 1VBE3 1CGPA 5FOBB 3I2DA 3OD4A 1AYM3 1MS0A 4B4RA 2VMGA 3CNAA 2C0ZA 4D69A 5D8AC 4CRQA 4MGYE 3GYDA 2PFWA 3HQXA 4XFHA 4C0HA 1OLQA 3AP4A 3T1MA 1YUDA 4P9IA 1RUJ2 1IKPA 3UKTA 1ZREA 4N7UA 2QZ3A 5HBAA 1Q8QA 2ZGTA 5GZEA 3FE5A 3FX3A 2GNTA 3EJKA 2HWC1 1O4YA 5DG1A 3TAYA 1KDKA 1OMIA 5I0UA 3B9CA 2XJQA 4QPIA 4E2QA 5L36A 4XF0A 3AYEA 4WM7C 1CQ9A 1LU2A 1QDOA 2H6BA 2O0OA 1AHSA 1VBA2 3RI8A 4QPGC 1NCQB 4SLIA 4CEYA 2D97A 5FPXA 1HX6A 4MV2A 4Z1VA 1I6XA 3BB6A 4UW4A 5LK7B 4FSJA 1LEMA 4XFFA 1GBGA 2ZABA 3AMQA 2CTVA 5BNPC 3GZTB 1GYKA 1V6IA 1JUIA 2MEV3 1MR5A 5E16A 4XDQA 1W6OA 3AX4A 3I59B 1PK6A 2Y0OA 2ZMNA 4OHVA 4XJZA 5EFUA 5GZGA 2A3WA 3FLPA 1TMF1 1DZQA 5C6CA 5TSWA 4DINB 4YM1A 4C91A 5AFEA 2Q4SA 5HI0A 1OQDA 1IPKA 1IOAA 3I59A 5JAXA 1GV9A 4L2NA 2HWD3 2D6KA 4FQZA 2EALA 2JKBA 1YI9A 2KM2A 4QHBA 2GNDA 3AFGA 4LHKA 3N7JA 1UL9A 3VL9A 4LEJA 2V5YA 3NL1A 1RUJ1 4B7EA 1AL23 4FT8A 3IIAA 1BVVA 1BKZA 4OLLA 1VJ2A 2LUWA 4JAAA 2FZ2A 3VKMA 2WNVA 2ZGPA 3AKQA 4XBLA 4IXLA 3JD72 1DGRA 4Q4W3 4U2AA 5GLTA 2HEWF 4NO4A 2RR12 1LGNA 3ZSMA 4FP3A 3WT3A 1G9FA 4XTMA 1O91A 3LOIA 1AJKA 1VBA1 1WW4A 1XNCA 4RL7A 2BYVE 4Q0PA 5L73A 4AQTA 3M3OA 3N4MA 2XJTA 4M00A 1RUI1 4KH9A 1Z0HA 4X8NA 1O3SA 4COVA 3R4UA 1G86A 5ACA2 1A6CA 2N7GA 2RS32 5CFCB 5I93A 3DUIA 4FP2A 2B42B 2VECA 4FAHA 4ISQA 2XJRA 2CV6A 3A4UA 1PO11 2B45X 4KBBA 4KWLA 1HQWA 1KDMA 2Q0AA 2Q5TA 1H1MA 1MQTB 1FPN2 1X7NA 4XQDA 2XWJB 3ZO0B 4IEPA 4FOYA 5CIRA 1MEC2 2R6QA 2HWF3 4KNCA 4XFAA 2XBO2 5J3UA 1IPJA 1ZRFA 3MYXA 1ND3B 2QDRA 5BNOB 3ZFGB 4YVSC 2BVVA 1AJOA 2XKOA 3L2YA 3PTYA 1MQTA 1H8TC 3BOPA 1QQP2 4QGLA 3MF9A 5GKAC 1BMV2 2RS12 2XVKA 4FPFA 4C90A 3ZFEC 1V9U3 4YARA 2E51A 4AVCA 2H0VA 1F5FA 3FLRA 1ND3A 4A7KA 1AR63 3ZFGA 1J1TA 1EAH3 3JD71 2E7AA 3RQ0A 5F6KA 1GZWB 5JR7B 2ZAAA 5I8SA 4GB32 2IXLA 2BNMA 2OUJA 3AP6A 5KBFA 1PHMA 3H3UA 3ST7A 5I8TA 1JOJA 1ZM1A 2DF7A 1D4M3 1KXGA 3EQEA 4WM7B 5KC5A 3RRDA 5DZGA 3P3NA 1H2MA 3LB9A 3WW2A 4MX3A 4QQOA 1NG0A 5T5PA 1KFUL 4JGZB 2WSUA 4K21A 2RJKA 4QPGB 1REDA 2O8QA 3CO2A 1AL0G 5ACA1 1YRZA 4RQPB 2A6VA 3AZZA 1FV2A 4GWMA 4J1XA 1LOEA 2YGMA 4KGGA 3H50A 4CDQC 4QU2A 3PVEA 3T1LA 1C4RA 2BNOA 5BNPB 1A3KA 4YG6A 1W0PA 3E6DA 2YUEA 2YZ4A 3WCRA 4QQ2A 2Z2SB 1W6QB 3KQRA 4JGZA 4XJUA 4XXPA 4YVWB 1HKDA 4EN8B 1F2NA 4RQPA 5JZGC 5JVVA 4XEZA 1MEC1 1NQJA 1V70A 1UIKA 1RUF3 1VRH3 1AX1A 1W6QA 5GZCA 3O12A 4AFDA 4AFMA 1BMV1 4BE3A 4AEDC 1G7YA 2CL2A 5IK4A 1VBE2 3CJIB 4M3CF 1AYM2 2ZGSA 4MXWB 5K7PA 4D7SA 4Q27A 2R1BA 1VBD3 2CY6A 3GZAA 4HK9A 5JI7A 4JVAA 2D93A 3J26N 4I09A 1T6GC 1UKRA 4NN0A 2R16A 1V6KA 1QU0A 4LE3A 4AHXA 4N43C 2AZ5A 2P3IA 3CJIA 3D4KA 1ZNPA 1L3JA 4Z82A 1YHFA 4YGDA 1WW7A 4LR4A 1GZ9A 3OPZA 4Q2FA 1WMEA 2D6NA 1PZ8A 4RS5C 4E9KA 2JXAA 3JB4C 2PLV3 1V00A 1OFSA 2R043 3U07A 5J98B 3OGJA 4I3GA 1AX2A 3UKVA 1DIWA 2JX9A 3VHNA 2ZGRA 2FHRA 1LHVA 1DU3D 1PNFA 3D5OA 1KS4A 1FATA 3LA3A 2GNBA 1WMFA 1BQPA 2ERFA 3B3QE 4XJAA 4DS0A 3U4XA 1I9RA 2GALA 4IEXA 2DCYA 2ZHLA 3WY6A 3WQ1A 5BNNC 1DQ6A 2MEV2 1ULGA 2ZGMA 3EXUA 5EYXA 2CGNA 4GULA 1ZRRA 2Q1MA 3WDWA 1D0GA 1MZEA 1ALYA 4FOQA 1MZ6A 5JDBA 4UW3A 3QH7A 4B29A 4OI4A 1U5IA 4UBHA 4LBQB 3H8UA 5FAXA 3SITA 2I74A 1ZBA1 1LOAA 2XJSA 3VBSC 3ZN6B 1CONA 1ZBE1 2OIIA 1AYM1 1SLIA 3I7DA 3ZFEB 1VAMA 4K1YA 2HWD2 2ZX1A 1SEFA 3ES1A 4Y1UA 4BCUA 5JPNB 1OSGA 1SCRA 4HVQA 3CLPA 3APBA 1EP0A 1AL22 1D2SA 2K9ZA 5FCCA 2I07B 3ZFFA 2R0HA 2GC3A 1QKQA 3M70A 4FPCA 4FVVA 2UWAA 3CJXA 4AQ6A 4RA0A 1GR3A 2EXIA 4Q4W2 2E63A 3L9JT 2QQPA 3LWCA 4FXGB 3POYA 2WJSA 1SLTA 4JGYB 3KB5A 2QVSB 2Q30A 2R063 4EV0A 1LGBA 2E53A 1WW6A 2OZ6A 4K3UA 4QMAA 4I0AA 2WZPP 1X50A 2VVDA 5FO7B 2VOXA 4CDWA 2PAMA 1TMF3 2W0XA 1WD3A 5F9TA 1N47A 3MZHA 1NCRC 3O0WA 4R9DA 4G3YC 5C9AC 4JGYA 3M4FA 4FBFA 1R083 4H14A 2DU0A 4MGIE 2YYOA 3B00A 2CAUA 3LSDA 5JZGB 1ASJ1 4DRVA 1U0AA 2DCKA 1LU1A 4GMP1 1DQ5A 1FI2A 4N53B 3W58A 1QOSA 4NOTA 1NA1C 3WDTA 4ES8A 3RZZA 5EV7A 4Q29A 1CAVB 5JSRA 2HWF2 3AYCA 3WDYA 4MH0E 4YSFA 1Q5OA 3MF6A 4WZCA 1U5YA 4BMEA 1ENQA 3AFKA 2HWD1 4HN1A 5GALA 1DGLA 3IM0A 4N53A 2WZR1 3AB0A 3WZ1A 4PCRA 3BCWA 4G4FA 1V9U2 4A7ZA 4FPKA 1X33A 1RUI3 4FPEA 4AHZA 1AR62 1EAH2 4HSJA 4D3WA 4Q4W1 4HSLA 4OHWA 3AYAA 4WVWA 4RS5B 5EJ3A 1CD3G 3SXWA 2WT0A 1QH7A 4JRLA 3ZYJB 5FDBA 2WNUC 2IFWA 1GANA 2IFRA 4GWNA 3M3QA 1PO13 1UF2C 4LUMA 3SCFA 1D4M2 4ATEA 2XWBB 4GA9A 3USSA 1TNFA 2VMHA 3IBMA 2P34A 4WVZA 3FFZA 1ENRA 1YFWA 2VG9A 1WW5A 1LULA 2XUMA 1B09A 1ZRDA 1SACA 4YRDA 4HN0A 5KXCA 3OY8A 4FTBA 4BWOA 3AZWA 2FMYA 5LEKA 2WC2A 1W0OA 3NV3A 5T50A 1XE7A 2GN3A 3BIWE 3Q9OA 1QXRA 1YFUA 3NAPC 4RR3A 1QNWA 4XILA 4YNIA 3AZYA 3RYRA 2PTMA 4CDXC 1J58A 2BVBA 3NVCA 5FMOS 1FNZA 1O3TA 2HWF1 4BOWA 1RINA 2A6YA 1EYBA 4A2UA 4GALA 3VBSB 1RUF2 3RMYA 1VRH2 1I1EA 3IDEA 3HMYA 4EJRA 2ZCWA 1N1YA 2PHFA 1ENSA 1SLLA 4XYXA 1HQLA 5CVRA 1FAYA 4KWKA 3USUA 5HCFA 3QH6A 2ZX4A 5E1RA 3JZVA 3OYWB 1DBNA 1OPOA 3VLBB 4CEWC 1V9U1 4J1WA 1NXD1 1U5ZA 3V0AB 4XW3A 3WV6A 4COWA 2WSVA 4LBLA 1VBD2 4CYDA 3CU7A 2BFUL 4OVEA 4OFGA 4XBNA 4TSVA 3SNMA 3WP3A 1QOOA 3OYWA 4Z2WA 4YM2A 3MLJA 2VOKA 1EY2A 4K9SA 5EWSA 4P14A 3JQXA 5F5QA 1H2KA 5IK5A 4KWJA 3EBRA 4IV1C 1AYN1 3O14A 2PLV2 1S2KA 3ETQA 4CDUC 3AK0A 2R042 3ZVXA 2JE9A 1CAUB 2HWB1 3UK9A 1NCRB 4BIFA 2DVDA 1LHOA 5JLVA 4M3CE 5C9AB 4MZUA 5C8CA 5LRRA 4FTEA 1MVQA 3WW1A 4DB5A 4QQPA 1AVBA 1CJPA 1PGW1 4AI2A 1SBFA 4Q1PA 4R4XA 3JCIA 1B35A 2BW8A 4META 1KFXL 3NV1A 3ZSKA 4YZ1A 1MS8A 1NA1B 1YO8A 3ZIWA 3LZZA 1BBT1 1RUF1 3DPRB 4BZ4A 5JCTA 1HV1A 4OI0A 2OZJA 3PVOA 1GSLA 2ZGOA 3H9AA 4HVRA 2HWE3 3ZX7A 3PNAA 3MIDA 4AK3A 4QGNA 3N3HA 2GC0A 1YLLA 1J1LA 2VMIA 3RSJA 3DPRA 3ALQA 1DLLA 1SCSA 2WFPA 5DZEA 2GMEA 1XE8A 4P9WA 1LB2A 3MPPG 5ABJB 4AGVA 4B8EA 3CF6E 1SLBA 1Q8OA 4AEKA 2PHRA 1H4HA 2PHUA 1H0BA 3S7IA 5CADA 3H1MA