1L7LA

Crystal structure of pseudomonas aeruginosa lectin 1 determined by single wavelength anomalous scattering phasing method
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
121
structure length
121
Chain Sequence
AWKGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHPDQGLICHDAFCGALVMKIGNSGTIPVNTGLFRWVAPNNVQGAITLIYNDVPGTYGNNSGSFSVNIGKDQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords PA-I galactophilic lectin
publication title Structure determination of P. aeruginosa lectin-1 using single wavelength anomalous scattering data from native crystals (P028)
pubmed rcsb
total genus 22
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2002-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07828 PA-IL PA-IL-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 1l7lA00
1W8TA 3F95A 5D21A 3ZYHA 1WZXA 4BQ2A 2LROA 1W8UA 3ZYBA 4BQ3A 1HN0A 4LJHA 4CP9B 4YW6A 4YW7A 1GWKA 1W8WA 1UOJA 1WMXA 2K46A 1GWLA 1W8ZA 4YWAA 1V0AA 2Q1FA 4LK6A 1W90A 1OH3A 2C24A 1L7LA 2VXJA 3UT0A 4CPBA 4A6SA 1W9FA 4CP9A 2O14A 4AL9A 2WYFA 3ZYFA 1GWMA 1OKOA 1WCUA 4LK7A 4CPBD 4LKDA 4BQ5A 2LRPA 4BQ4A 4LKEA 2KR2A 4LKFA 3ORJA 2JWPA
chains in the Genus database with same CATH superfamily
2VG9A 3T08A 2ZOEB 1KQRA 5FMCA 3WCRA 1UKGA 5IK7A 3T2PA 2VBDA 4AVVA 5FY9A 3OD4A 4J1WA 4CCMA 4AVCA 3ZXDA 3HNYM 2YGLA 5I0UA 2R16A 4W50A 2ERFA 4R4XA 3U75A 4PF5A 5KXEA 4RSUA 4Q4W3 4LBKA 1DIWA 1ULPA 3AFKA 4GWNA 3WXPA 3T1LA 1YFWA 3MV11 4QM9A 3RPQA 4OQ8A 3CJIB 4XUQA 3ZMNA 4B4QA 3NAPC 4CCLA 4FPEA 2MPFA 5JOYA 2Q4SA 3C7EA 5C3RA 3C8XA 3LPGA 1IG3A 1QH6A 1Z7S3 3N7LA 2XGXA 4RQPC 2CHHA 4OMDA 1LGBA 2R072 3HEIA 3U14A 4CXXA 5ANNA 1AR71 1C28A 4CDWB 4XDOA 1N1SA 4N53A 1US3A 1UY1A 4FPOB 4P00B 2YV8A 2ZZQA 1UMZA 1KDMA 3I3DA 2JDUA 4UFHA 4GULA 1AYM2 3KWVA 4WVMB 1FT9A 4EN8B 4XTPA 3CDZB 4I01A 1HV0A 4XFIA 1A3KA 1CIWA 3KV9A 1CAVA 2EXKA 5LA9A 2N7GA 4GXLA 3OY8B 1IZ3A 3MUZ1 5JR7B 3OGSA 4LO7A 1YI9A 2IXKA 2X5IC 1V6KA 4OUEA 3O1RA 4TLFA 4HANA 2VW2A 1JU4A 2WJSA 1RVF1 2OVUA 2WNVA 3M3QA 4HN1A 2CTVA 4GD4A 4LMFA 2WC2A 3HMYA 2AGSA 3RZKA 3ZFEB 5A70A 4YZ2A 5D8AA 5A1LA 4U36A 1LB2A 1JBCA 4LPLA 1MVQA 4NHYA 4XQWA 3OF1A 5EQUA 3ZSJA 3JBG1 1OVPA 3L2HA 1G9BA 3VBRA 1RUNA 2VUAA 2WQZC 1JYTA 2WKKA 1HB1A 4BHPA 4V2WA 4CDUB 2V09A 3KS7A 1BMV2 1LKNA 2HBTA 3PTRB 4H7LA 2OQ7A 4Z92B 2DWRA 3LSEA 2VNGA 1VBE2 1IQDC 2XJTA 1XXNA 1GZWA 3IDBB 3KF5A 4GWIA 2G19A 2JDMA 3CNAA 4TYSA 1ZX5A 4XJWA 2MEV1 5FZ9A 5JOZA 1JXNA 2D3RA 4GMP0 3WP3A 2E53A 1B35B 1JI6A 1GWKA 4J25A 4OYUA 1G8WA 2QTWB 1GBGA 3GCXA 1WBFA 2C9AA 4AAPA 2WWSA 3ZR5A 1PGW1 3VV1A 1WW5A 3AKSA 4MXWA 1E5RA 2J1VA 1RUI1 4RA0A 1PGL1 1PIV1 3PU3A 3T1MA 1OSGA 2Y6GA 1UAIA 5C8CA 2B4KA 3DPRB 1CX4A 4AZZA 3O1PA 1BK1A 1D2QA 3MFAA 4TWTA 5GZGA 3ACGA 1DYKA 1ONAA 5C4WC 3RJRA 4QB2A 3VBFA 1UL9A 4XE9A 1APNA 4CSWA 2YFUA 1SLTA 1PK6C 4LHLA 2R061 3D4KA 5A6ZA 2WA4A 3M3OA 3JQXA 3A0NA 5A80A 3ITQA 4A42A 3IMMA 5FP8A 4HZFA 2BDRA 4Z1VA 2HJIA 1QJX2 3AZVA 5T55A 1Q56A 4RHV2 5DG1A 3P6BA 1OH3A 1SFNA 2QQIA 2ZJCA 3H8RA 3GBFA 1ZRCA 1MZEA 1C3HA 4FFFA 4LBQA 1QH7A 2R49A 2BBVA 1W8FA 2RDQA 5FZOA 1DGWX 4A7YA 1FOD1 3GNEA 1JZ8A 1AYN2 1N1VA 1OKOA 1W6QB 2RJ2A 3OGJA 4LTAA 5E88A 5FO8B 4WM7B 2WDBA 3ETPA 2Y64A 1YQCA 4LBMA 5F5CA 2E7AA 5FZ4A 1RUD2 3J26N 2YC0A 4XETA 2VL4A 1D2SA 5A7QA 2Y8KA 4TN7A 1QQP2 4D69A 3K75B 3RFRA 3WW2A 4R9AA 1OC1A 5C3QA 5F8PA 3OD0A 1NZCA 4DB5A 1HRV3 2GDFA 3AMNA 2V4VA 2VZSA 2PLV3 1XE7A 3M3IA 1D0GA 1ZM1A 2ZX0A 3B93A 3NL1A 4HXCA 5FZ8A 4AQSA 1JZ2A 5AVPA 4Q29A 2I2SA 3UJQA 4QB1A 5EJ1B 1TNRA 1RGSA 1X36A 2EIEA 4FPHA 4LK7A 2VCCA 5SV8A 4AWDA 5A32A 1ZA7A 3RMYA 4BQ1A 4YVSA 4P5YA 1VAMA 1NOVA 3PNAA 2OA2A 4E8DA 2W94A 2LTNA 4EWDA 3GXUA 4IW3A 2WS91 5LEJA 3BKZA 1VMFA 1W28A 1ENXA 1IS6A 5CFDA 1DGLA 1VBC2 4D6RA 2WNEA 4JVAA 2Q8EA 4ES9A 2XHNA 4TLGA 5FXVA 3G7DA 5I8YA 1JYVA 5JWPA 2PA7A 5JIAA 5GALA 4IV1B 4AAXA 4BMEA 2VBBA 4LHNA 5B2GB 4ONUA 1WCUA 5FYVA 4WVZA 4AEDB 1RIRA 4UT5A 1IKPA 5E89A 3IPVB 2Z4FA 5IK5A 4JDMA 2OPWA 4MOAA 1LHVA 4OULA 5FYHA 3GBGA 5JXIA 3AZWA 4QGLA 3VUOA 1REEA 4Y20A 5KHGA 4A4AA 1F35A 4Q4V1 4QKBA 5LATA 4Q26A 1BKZA 1X50A 2FZ1A 3HT2A 2VVDA 2P37A 1AL0G 2R042 1CPMA 4HG6B 4QWNA 1RYYA 3MICA 5EYYA 5HCHA 3VBOA 4COUA 4UFMA 2ZXQA 4M3CB 5DZGA 2ENRA 2Y6KA 3ME2A 1LU2A 1U0AA 2VQAA 1VBA2 2JDKA 1W9FA 4JZRA 2O14A 4GB31 4JDNA 4XAAA 4RQPA 2Q1ZB 2I45A 2HH9A 3APBA 2DTYA 3VL9A 2RR12 2W52A 4AGVA 4QDSA 3NJVA 3UGHA 1ALYA 3IDAA 1JUHA 5CEHA 1YQ6A 4IV3B 1ASJ1 3I49A 3DPRA 3POWA 3H8XA 4XAEA 5K7PA 2G9GA 3WNXA 3ST7A 5FKBA 3P3PA 4RFT0 1AHSA 1LOEA 1NCRC 3POBA 3KCCA 5FP7A 4OCTA 3WF0A 1AR81 1LAJA 1O5LA 2PYTA 2WT0A 3B3QE 1W9YA 2HWC1 2XWBB 2XDVA 3ZSKA 1O4TA 3NNFA 5FBZA 3UT0A 2ADDA 1BEV2 1CZTA 2SLIA 3IAQA 3K48A 3T0AA 3C7HA 3DKWA 4MX3A 4OI1A 1MEC1 1SPPB 2J1EA 1OKQA 3I59B 3H0OA 3SCHA 4LORA 1R093 4LBQD 5I0DA 4XXPA 3CZUA 4A2UA 4QPGA 4UF0A 1BLZA 1WW4A 2OW4A 4KWLA 2AR6A 4ET7A 2KM2A 1G9CA 4QX1A 3T0DA 4EZHA 2E32A 3MPPG 3VDDC 4XIKA 3HBZA 3MLLA 1DP0A 4BISA 1RUF1 2DCKA 4UW3A 3MBWA 1Q5OA 1UOFA 1W6PB 3E97A 5CKNA 4WM7A 1DGWA 3ECQA 2R062 4MGKE 1KITA 2NN8A 3GHMA 4YM1A 3ZDSA 4EN6B 5KXDA 2RM21 2W2IA 3TBDA 5FLIA 5J37A 1V9U3 4EQVA 3N9OA 2ARXA 4HN0A 2ZACA 3MW4A 1UD1A 3MI8A 3HPNA 4MHUA 4QPIB 1QJY3 4DXTA 1OLMA 5F2SA 5A6QA 1XRUA 1LULA 1J3RA 1YQ5A 3QD6A 3IT8A 2VTXA 4FOQA 5FY0A 4ASLA 4KGGA 4MADA 2EICA 4SLIA 1BCXA 3KMHA 2YPJA 5DDJ2 1VJ2A 4PQQA 1DHKB 1EYBA 1W0NA 3AZXA 2Y34A 5K0UA 4W6WA 4CEWC 2BNOA 3JD71 1H9PA 2W3JA 4CVUA 3PHMA 4ISRA 1Q8SA 2YYOA 1RTVA 4NHXA 1ZRRA 2BPA2 3KVAA 1SLLA 5HCBA 4XFBA 2A5ZA 4XILA 1YO8A 1H2LA 1MS0A 5BNOC 1PK6A 4XF3A 2A1XA 1R1A3 3RYPA 3RYKA 3ES1A 1DCSA 5KHIA 2X29A 3VBHC 4IEXA 4HPKB 3RGBA 3I3EA 3RWKX 5BXXA 1HQNA 1UYZA 4GMP1 3W9AA 2HWB1 1FAYA 1AVBA 4AOCA 1W39A 2B7YA 1HN0A 1WA6X 3GF6A 5FPVA 3WX5A 4CP2A 3ACIA 1NLSA 2JEMA 4FAHA 3FL7A 3CJXA 4D6QA 1AL21 4RR3C 4CXYA 2VTFA 4JRLA 2JDZA 3K4ZA 4XBNA 3UK9A 4AK3A 3DKQA 5B4NA 2A3WA 2WS92 1DBNA 2HWD1 3I2FA 3LIHA 1XYPA 4QXHA 3WOGA 4OUMA 5IWFA 3WP5A 2WWJA 4LR4A 4YM3A 1STMA 1NZIA 5HI0A 4CU7A 3AP5A 1KRIA 3ZXAC 4YRDA 4Y1XA 1PNFA 5DAQA 3E6CC 5LRRA 3CO2A 1GUIA 4Q4X3 4M3CA 5EHDA 3LEIA 5IVYA 3O12A 2WFF1 5IT6A 4WZFA 3B5LB 3NNJA 1SBDA 2BU9A 1I1EA 1QJFA 5FDBA 1AF9A 4JKKA 1P8JA 4NPMA 2EVXA 2HWE3 2ORZA 1W6NB 2YY1A 1O3RA 5KC6A 2JG8C 1AXYA 4IEZA 1NCQC 1SLCA 3LIGA 3QH6A 1WMDA 1FPN3 3VD3A 4PDWB 3AVRA 4Q4V2 5LASA 2CGNA 4FPFA 4IV3A 1FYUA 2VW0A 4CCJA 2E9QA 3E5UA 1OA4A 5IVEA 4AI0A 3AXDA 4BQYA 1TME2 5CVRA 4ZU5A 4P9WA 4FTSA 5A3PA 4OHWA 5C7GA 2CNAA 2WNOA 1UX7A 3E5QA 1W2OA 4FCAA 4XMIA 1S0FA 2VMDA 1ZZBA 2W91A 4AEKA 4ASKA 4EZ4A 1PGSA 3B69A 4L97A 5BNPB 5CFCC 2ZHMA 3V65A 1J58A 2QQVA 1ASJ2 1HJGA 1JN2P 1W04A 1NY71 4IGPA 3S30A 3HQRA 1PZ8A 3WR0A 2PHUA 4BM8A 3UJOA 2ZMLA 4DMIA 4UFIA 2VXJA 3OB8A 1I6XA 4NRPA 5JI7A 3I2HA 4BQXA 5JOWA 2R073 3OUHA 4AL9A 2YBPA 4Q2FA 5BV6A 2HWC2 3FLTA 3AFGA 5LA1A 4FOYA 2AEZA 1HRV2 2EA7A 2QDRA 2W68A 3RDIA 3WW4A 2BUKA 4HBNA 5DUWA 2RS33 2XR4A 3VBUB 5LRSA 2PLV2 4K6BA 2P4EA 1H8TB 1SG3A 3FLPA 4ZS3A 1WKYA 1AJKA 1F5FA 4QU1A 4WVVA 1AYM3 3FBYA 1HRI3 2P6HA 5FZ3A 2VECA 3OSDA 1DQ2A 4NE9A 3ZXEA 5F7UA 3A0KA 2FMDA 3U10A 1C8M2 3THDA 5EP9A 1QEXA 2JDYA 5IJRA 2XXZA 4LIUA 5CNAA 5FWEA 2DURA 1RUF2 2Y0IA 1GR3A 3H7YA 3MF6A 3QH7A 1MS5A 1UYYA 1MQTB 3NVCA 2ZCWA 4Q0UA 4Y22A 4DIQA 1U5YA 4KQ7A 4RS5A 3AP7A 2OQ6A 1ZRDA 4URTA 1XYNA 5BYNA 2J7MA 2VBPA 1LOAA 2IWGB 2RM22 1LHNA 4DY5A 2XVKA 4KU7A 3THTA 2BERA 4XF1A 1R1ZA 1GQHA 1W2NA 4B1LA 1E5HA 2AENA 2XJUA 1YUDA 3ATGA 1W8OA 3KLSA 1RUC1 1ZZ9A 4BQ3A 3DL3A 3KSCA 1BQPA 4NRQA 5DUUA 2DU1A 2DVDA 4WBBA 3I3MA 4HFSA 4FOWA 5CYYA 1COV3 3AXEA 3ZXLA 5HBAA 1IS4A 5L7OA 4HPKA 5JLVA 5GZEA 4DEVA 1Q8VA 3AYAA 4ZY9A 4AEJA 2IXCA 1X7NA 3WF1A 1U5XA 3JCIA 3JU9A 4GA9A 4UWDA 1K5MA 2DUQA 3SXWA 4QPYA 2QQMA 3JD72 4N53C 4NMIA 2BGOA 5I8TA 1GFF2 2PHWA 2X09A 4UBGA 1LOFA 2CL2A 4YYOA 1HKDA 2VQTA 5T54A 3RG0A 5JPMB 5F5IA 3RWNA 3O1OA 1X8MA 3LDRA 2J42A 4Q0QA 1GANA 3FBMA 3QACA 2YB7A 4XW3A 2FBEA 2A6XA 2JG9B 3AM2A 2PHTA 2DTWA 1M4WA 1WUVA 1QXPA 2ZX4A 5IUQA 5T52A 5D1IA 4EN0A 1H8VA 5FZ7A 2RS52 5IVCA 5FP4A 3SITA 1O6UA 2Y6JA 2QUOA 3ZFFB 4CZSA 3WLUA 3WNOA 5C33A 2FMYA 2WNVC 1UMHA 4EN9B 1ZBA3 4XABA 2GC0A 3O1VA 1BXHA 5LWBA 5A33A 3HJRA 3IWZA 2E7TA 1OBNA 4PDWA 5D8AC 4HKWA 4CCCA 3AYDA 4N43B 5A7OA 4EYUA 3WW3A 3SH3A 1RINA 4XJAA 4R9DA 3K46A 5IVFA 1PVC1 4AI2A 3LOBA 2XUEA 5GLZA 1SZBA 4LE4A 3PUAA 5C9AB 1R092 4B1MA 1G86A 2Q8CA 1RUE1 3NSTA 3N7KA 1SBFA 2ZABA 4YFZA 5J1XA 5FAXA 4NIDA 3OYWB 4XFFA 3T09A 1DLLA 1VBB2 1T6GC 4AE2A 4AVSA 2J1TA 1JHJA 3ENRA 3PVEA 4LE3A 2AZ5A 5IK8A 1RB8G 4MSVA 1XYOA 2B46X 4R8HA 3OBTA 1V00A 2RV9A 3BODA 2X10A 4NPRA 4YG0A 3T4HB 4AFCA 4WM8A 5C8CC 2FQPA 1OOPB 3C7FA 3HVDA 1QOOA 3VDCA 4YGBA 1V9U2 4B8EA 4E2QA 3UL2A 3H8UA 4BK5A 2JKXA 5EZWA 4DXZA 1REFA 2WWUA 3WW1A 4BB3A 5D2AA 1H8TA 3CBNA 2GH2A 4RD7A 3ZSMA 1KFUL 3TN91 1OLRA 4K3UA 2E31A 4R9CA 1NG0A 3DXTA 4UFLA 2XKOA 5FZAA 1NY72 2P6CA 3E6BA 2P3YA 3R05A 3WHUA 2FDIA 1QJU1 4QDQA 5K9YA 2PHXA 5F5AA 2QDNA 4K21A 2FCUA 4LA2A 1OLME 3C7GA 1UPIA 1CPNA 2B8MA 2XLAA 3F95A 5DABA 1Q43A 2PFWA 3CKHA 3NJYA 4C1XA 5KHKA 3UESA 1ZBE1 3VKNA 3V64A 3FN9A 2WO2A 2ZGKA 1R1A2 4W8JA 4I0AA 3VZKA 5TSWA 4O9EA 4YGEA 5DN2A 3KF3A 1W3XA 5DAWA 4N9HA 1EAH1 4ZXKA 2QJVA 3POYA 2OS2A 3CJIC 1UIJA 4GWJA 2JXAA 1BBT1 5FY7A 4JHTA 2GZWA 3DN7A 4NO4A 5E6HA 1XQNA 3DGTA 3CHXA 4AFDA 3OTFA 2R043 3S7EA 4BU2A 5FMDA 1D4M2 1RVF3 1SLIA 1OVSA 2ZEXA 2VUJA 5F32A 4Q8KA 4CDWC 5LCWL 5LK5A 3WG2A 1W9SA 2QQPA 2HKXA 4BZ4A 4CCOA 1QU0A 3B00A 4XUTA 4W6YA 4DO0A 5JZGB 2BVBA 3S5AA 4QQLA 4PQ9A 4XJUA 3AMHA 4YVSC 5JR2A 1BJQA 2F4PA 4HVQA 1UU5A 3EYPA 1CONA 1NYWA 1V6NA 3JBG3 1ZVFA 1R081 3IKWA 4R9BA 2UYBA 1K5JA 2GMPA 2WSUA 4L9BA 5FPZA 5JIUA 2DCZA 3FE5A 5HCAA 4GQ7A 1RXGA 5F6KA 5FREA 5CFDC 1W05A 2VZVA 2VM9A 2CAUA 1MR5A 3NV3A 4LO4B 4CUAA 5ISLA 3O1MA 1FPN2 4JDOA 2VMGA 2BOJA 2MEV3 2W9XA 2YXSA 2DUPA 4DZGA 5A6YA 1A78A 1HDKA 5F37A 4PIXA 3OPWA 1AX1A 3N4MA 2D5FA 3KV4A 4EE2A 1HJFA 1BEV3 2VVFA 3EO6A 1DQ6A 1VP6A 4Z82A 1ULGA 3AJZA 2YG0A 1PIV3 3OGRA 4HT1T 2YBKA 4A7ZA 4CE8A 3MIFA 3SCGA 3BUCA 5FCCA 2VZUA 2BV4A 1FXZA 3BYWA 1JYXA 3E1F1 2R32A 2UYAA 1O8SA 1N3OA 2DU0A 2PXJA 3IM0A 4HK9A 4MXVA 4OHXA 4XCBA 3G6JB 3AMMA 4URAA 1YI7A 1AR91 1S0CA 3FX3A 3VBOC 3VKLA 5F2WA 4EWAA 4CCDA 5J48A 2R063 2ZTNA 2R1DA 4QX2A 1UY0A 1AZDA 3J9SA 3ZSLA 4PHZA 1POV1 1ND2B 1NE4A 1RUJ1 2P5BA 1MACA 1S4CA 2VZTA 2ET7A 4TSVA 3PL0A 1PM7A 1V6MA 3K4DA 4GH4B 1IOAA 4YFWA 2Q8DA 5AC91 4FTBA 3HQUA 3DXUA 1ZRIA 4RYDA 4ZZ5A 2RS32 4P08A 1YCIA 3W5MA 5FYBA 4OHYA 3DPRC 4CDXB 1LOCA 4YVWA 4QQPA 4RN5A 1FOD3 5KXCA 1X9PA 2AUYA 1HRI2 4AFBA 5BY5A 4DQAA 5BNNB 2ID4A 2VH9A 4J6GA 4Z2WA 2BGCA 5EJZB 4AW7A 5DDJ3 2VQ0A 4A44A 3GJBA 2CY6A 2HEVF 3ILRA 3PLQA 4OHVA 3Q8CA 3ZFGB 1UU6A 1YEWA 5FXZA 1YQ8A 3T4VA 1SLBA 4XUPA 3V0AA 3D0SA 2BQPA 4KH9A 4QX8A 5C8WA 2W46A 2FD8A 3RRDA 1OFSA 3O7OA 1I5ZA 3UNPA 3ZOIA 4MGZE 4QPGC 2BFUL 1YYNA 1KGYA 2Q1FA 4DS0A 3V0BB 3NNMA 3HBKA 1VRH1 4JC1A 3ON7A 1CWPA 3J8F1 5JXJA 4WM7C 4C8DA 3IZOA 1OF4A 3BIWE 2ARBA 3SMHA 3PJYA 3VKMA 2ZHNA 1OH4A 3J7NA 1RHI1 3CQOA 3PJQA 1COV2 1WCKA 4JGYB 5FZDA 3VBSB 5CAZA 2BVVA 3LA2A 3L9JT 1UZWA 4HL0A 1AX0A 3BOWA 5FMOS 1H9WA 4G4FA 1QOSA 5FPBA 4MG2A 5JMCA 1ULCA 2WS93 1PO11 3DUIA 5FR3A 1FMD2 4P5HA 4QU2A 1J1LA 1FI2A 1RUH1 2OYZA 1I3HA 3UGGA 2R1BA 3IDCB 2DCJA 3NNGA 3UYJA 3PVOA 5DZEA 3GZAA 3W5NA 3H3LA 1RMU1 1LECA 4CXWA 2CGOA 4RGKA 4Y26A 4XJZA 3N9MA 4NIIA 2GNBA 1UY2A 2QZ2A 3MGUA 4SBVA 5FYZA 1ZNPA 2PTMA 5ABJA 3HNMA 4YG6A 1XU1A 4LQRA 1Z0HA 4JRAA 5K0UC 5ACA1 4CU9A 2A70A 2QVSB 2LRPA 3D82A 4LO6B 1BBT2 3NAPB 4CEYB 1LESA 4QHBA 4E8CA 4COWA 4Q4V3 1CAXA 1DGRA 1DU3D 2NYYA 2VPVA 3S7IA 3U0ZA 4AI3A 3EHKA 1ULOA 5HV0A 1ZBA2 3ZIXA 4M4RA 1VBD1 1TME3 4R4ZA 5KWRA 3TNQA 4H14A 4N8MA 3V56A 3FUOA 3O1SA 2VNRA 4NWWA 5L19A 4P9GA 3BTXA 1G9FA 3RS6A 1JZ7A 4K1ZA 1JODA 3L2YA 1SACA 4D6SA 2Z5WA 2ZGUA 1HXS1 2VY0A 2NLRA 4Q4W1 1PMHX 4QQOA 2YFZA 2W92A 3KGZA 3VN4A 1ASJ3 1KXGA 4B4RA 2JE9A 3RYRA 1NE6A 2EXIA 4XOGA 4XCAA 1MS4A 3AL5A 3ORJA 2D6KA 4YG3A 4OFGA 5D21A 5T5OA 1QWRA 4DXRA 4C90A 1OUXA 4FPCA 5HCFA 2OUHA 4ATFA 2XVGA 2X5IB 1AR83 4YW7A 4NAOA 3NJXA 2GC3A 3AJYA 1H30A 2B45X 3O0VA 2HWC3 3ACLA 3CJIA 1OA2A 3ELNA 3GBWA 2D97A 2G1MA 3D3AA 1F4HA 2BNNA 2HWF1 5IHRA 5JDBA 1XNKA 2CAVA 3U78A 3VHPA 1MS3A 1FV3A 4LO5B 2WYFA 4L92A 1YIPA 3GZUC 5DAVA 4CDWA 3HNBM 1C8M3 4TZDA 3DV8A 3NV4A 2RMU1 1UWWA 1EV11 4IV3C 3AC0A 2BRTA 3URFA 5C3OA 3AYEA 1JYCA 1RUF3 1GZCA 1H1AA 3QOPA 4M00A 5GLUA 1UZZA 1AR92 4WVMA 2E7QA 3LA7A 4CDQB 1RITA 1ULDA 1O4ZA 4XFCA 3CF6E 3KHBA 1PMIA 1TMF1 4XUOA 5GZFA 3ASIA 2RM23 3EMRA 1HW5A 1NA1B 2GC2A 3PURA 3EBRA 3OY8A 1LTEA 3B9IA 4XF9A 2A3YA 1AR72 5FOBB 3NQHA 1WBLA 2K2SA 5FYIA 3PMSA 3OGGA 1JZ5A 5ERLA 5EWSA 2Y6HA 4QX5A 3KQRA 3WQ1A 1S0GA 1TQ5A 5E8AA 3LA3A 5FK8A 1ULEA 3CZJA 5FWJA 3ZFEA 4XZUG 3OGVA 2VCAA 1M06G 4LUKA 3BTYA 1JOBA 2YBSA 4IE6A 1XNTA 1DQ4A 3U4SA 3WVJA 4Y4YA 2IVIB 2J1UA 1SCRA 2QFEA 1LODA 1UY3A 3JD73 5FZHA 4CDUA 1W6OB 4IEWA 3VBSA 1GNHA 4GKXA 3BCWA 1Y3TA 3S57A 1W3VA 3F2ZA 2D93A 4QM8A 2R30A 3S6PA 2G9FA 2ZGMA 3MW3A 2TUNA 2H0BA 1RVF2 3D8CA 4I3GA 1QKQA 1U12A 3FC0A 1OUSA 1UNBA 2PQQA 3WZ1A 2LM3A 1OF3A 2W5FA 1B35A 2D98A 1MZ6A 2RS11 4FPJA 1Q3EA 2FDGA 1IS3A 4AQ6A 2RG4A 4LLOA 3ZYPA 1H4GA 3MHZA 4LNVA 3J8F2 3WF3A 4GMP3 2HWB3 2RS53 3JBG2 4LKFA 3X29B 2XMLA 4OVEA 4IEPA 4RS5C 5A7SA 4DUWA 2YPDA 2XONA 1W6MB 1YRZA 3VZLA 3WDWA 3LF7A 4QQ2A 2DBNA 3LSDA 3I97A 1AL23 5FUPA 1SHWB 4DY3A 1CZSA 1T2XA 2XLGA 3K51A 4AVTA 4CEYA 1ENQA 3BIEA 3PIGA 1NLQA 2HWD3 2MEV2 5GKAC 5A3LA 2EIGA 3ACFA 5F3CA 5J09A 1UY4A 1DYPA 2BNMA 3ZO0B 2HYKA 1RJ8A 2XBO1 2ZX1A 3OBRA 4HKOA 4MGIE 5A7WB 3WNPA 4COYA 3U4XA 4M4PA 1MS1A 1PGW2 3HOBA 4JTOA 3I7DA 3I4IA 2GNTA 3IMNA 5L7OC 4MGTA 2GNMA 4M0NA 1RUI2 2JDHA 2WFF3 4BJ0A 1PIV2 1PGL2 5FKCA 5IVVA 2VNOA 2B9UA 2GN3A 3UKNA 1IG0A 1UQXA 4NRMA 4GJZA 4UW4A 1K42A 3RJ2X 1YWKA 1K5MC 2WZR1 4HKLA 4E2SA 5GZCA 4NHKA 1C5IA 1VBB3 4QD2A 3VB9A 2Y60A 1LOFC 1W6QA 4MLOA 3WF2A 5FYMA 5FJKA 1GYKA 3POJA 3JB8A 5CKMA 2ILMA 1S2BA 4F7ZA 5LEKA 4YM2A 4XFAA 3H50A 1LJ7A 2OXBA 1UF2C 5A3OA 1CAUB 4RL7A 1L3JA 3HN1A 3WUCA 1UOBA 5A3WA 1BHGA 4E9KA 2OZ6A 4FPKA 5HXMA 1BZWA 1UIKA 3N3HA 5JI9A 2ZS6B 5DZFA 3M70A 2WNUB 1FOD2 4Y1VA 3ZYGA 1XU2A 3LCPA 1WCDJ 4I0WB 1R64A 3W20A 4A45A 4PDWC 2DVGA 4DUXA 3M3EA 2ZGLA 4YGDA 3ZSEA 4JV4A 5I0SA 4UFKA 4PLOA 2IXHA 3HQXA 4IUGA 1XNAA 4LLFA 1JTZX 2RDNA 3H8OA 1ENSA 1VAKA 2D6MA 1OQEA 3J7MA 3ZYJB 2JDAA 4KGQA 1NKGA 4IEUA 1JW6A 1WMFA 4DINB 2BEOA 2WUHA 4V1PA 2HWF2 4Q1PA 3SNMA 1NA1A 5LA0A 2WIIB 1GOHA 3ZMOA 2QZ3A 5FZCA 5FYYA 3VLBB 1YFXA 1OQDA 2LW8A 2W39A 2CWSA 4E4SA 3M8LA 1WW7A 5DAPA 1AUYA 4QXBA 3DF0A 3WCSA 3S5QA 3MIEA 4YZ5A 2VUDA 4IV1A 3LEGA 2DVBA 2XVLA 4OZXA 4JTNA 3Q8FA 3BPZA 4AEDA 3OOXA 4LO8A 1NCRB 4WM8C 3IPVA 3LE0A 5GLVA 1G9AA 1PO21 1D4M3 1TMF2 5L9VA 4FSJA 2HBUA 3C3VA 3PVBB 2JJ6A 3KT7A 1V6JA 2VOTA 3OPTA 3THCA 3WV6A 1W8HA 4OLLA 1H8TC 2ET1A 1UMIA 1W99A 2BTVC 2P17A 1Q8PA 1GP6A 1RUC3 1LR5A 3FWEA 4XHBA 5CZKA 1B09A 1SQ4A 3ZM8A 4AI9A 4P9JA 4Y24A 1ND3B 1UW8A 2BOIA 5F3GA 1LENA 2ZEYA 3IIAA 3VDDB 2CGPA 2XUMA 2WZEA 2O0OA 1XSQA 5APAA 2D6NA 5L9BA 3T3YA 3UGFA 3W58A 5LY2A 3ZVXA 1SCSA 4NPLA 5A3NA 4COZA 2YGMA 1FNZA 1LU1A 1W6MA 4CTEA 4OUSA 5C71A 3U11A 4Q0VA 1J3QA 2VMFA 1CZVA 1LCLA 3ZYRA 4HONA 2TNFA 1QNYA 3PUHA 1KJLA 2VULA 5FPXA 4XVHA 1C1FA 2JENA 4ITCA 4D7SA 2VVEA 2F6BA 4GB32 2RS12 2WQ8A 1GZTA 1TZOA 2ARAA 3PUQA 4UFJA 5FY8A 3JZVA 5GLWA 1J59A 3KD4A 3WNKA 1JS9A 3ZN6B 1SPPA 1L7RA 5LK7B 4QKNA 4XMAA 2O8QA 3I59A 4S2FA 5FPAA 3HAGA 3SISA 1JYNA 1WCQA 3Q9OA 2A7AA 2WABA 4XPVA 3ZYIB 3KV5A 3RZLA 2CDPA 4K8FA 1SBEA 1WA4A 3TEYA 4NWVA 1HB4A 3NKGA 2D5HA 3USSA 4CP1A 1AR82 5FPUA 1W6PA 5BNOB 1QJY1 4HSLA 5FZGA 1RXFA 2I07B 3A22A 1JH5A 1OI6A 3AB0A 1N1YA 4ARXA 4LUMA 1PVC3 4OHZA 1DQ0A 3R6SA 4O65A 3VBHB 1MEC2 2ZGQA 4QPIA 3B9CA 1RUE3 3LKJA 3ZFFC 3GZTB 1MPXA 2VMEA 2IFRA 4ORFA 2LALA 1NXD1 2DCTA 3H3ZA 2WNUA 3BB6A 4K9SA 4RR3B 4TTGA 3A4UA 4IE5A 4XQ4A 3WD5A 1PM4A 3FHAA 4QX0A 3RQ0A 1O3SA 3SEEA 3MDPA 1YJLA 3KT4A 4PI2A 1AR61 1QDOA 2CDOA 1UYXA 1RUG1 5BNQA 1OFNA 4QKFA 4RGAA 3IN9A 2Y38A 1WLCA 5I8SA 3WP6A 4DUVA 2ZMNA 4XDPA 2VTXJ 1JZ4A 1LHUA 4QT6A 4Q4Y1 4QGMA 5DXDA 4OQ9A 2FDKA 2Y6LA 1XSRA 4LOTA 3GJAA 3WSOA 1PX4A 3RZJA 3ZPOA 4AR2A 2JG8B 5FZIA 5H9SA 4BK4A 2VMHA 1NCQB 2HLEA 5C3SA 1QJU3 4HLTA 3ZKUA 3HWJA 3WHTA 5JAXA 3POSA 4MUVA 1YNAA 2GC1A 5FZ0A 2NP0A 3OJBA 2VCMA 1FMD3 3TB0A 4NR1A 1QXRA 2VNVA 2VUCA 4KG8A 4P9XA 4E4ZA 2WN2A 4Z07A 2W87A 3ZKYA 1RL3A 4YVWC 4LBLA 4META 4FI9A 5DUXA 1ZBE3 4I0BA 2ATFA 4HMZA 2G9ZA 5FOJB 1TG7A 1WMEA 1GOFA 4Q4X1 4PBPA 1W03A 3H1WA 2JE7A 3WT3A 1XPWA 3RZGA 2ADEA 4CP0A 2VMIA 1QDCA 2WZPP 1MZFA 2C4XA 2I74A 5LB6A 5CFCB 2CYFA 1J84A 2RDSA 4UXAA 1OLQA 2A6YA 3SH5A 4CUBA 2HWB2 1BBT3 1JMUB 2VJXA 1UX6A 2ZHKA 1ND3A 4F3JA 3AKQA 2XJQA 4XFGA 4KG0A 3B02A 3MIHA 1AL22 4O7XA 1PO22 1W6NA 1Z78A 1XNBA 1DGRN 2XQRA 5T50A 5AVAA 2R0HA 1O3QA 2HWD2 4K7JA 4UBHA 2WAOA 3IB3A 5IW0A 2WA3A 3T2QA 2P34A 3USUB 2XLFA 4H55A 4DOUA 2UY9A 4Q0PA 5LA2A 4BH9A 4BLIA 4CYDA 2Q30A 3H42B 1V6IA 3D6EA 2VXRA 3JUUA 2QE3A 5IVJA 2WFF2 3AVSA 1TE1B 1H1IA 4AFMA 2GNDA 2GAUA 2EAAA 5FK7A 2NMNA 1CJPA 2QQLA 2WO3A 3MLJA 4EWEA 1IS5A 5FYCA 3WDUA 2E6VA 1V70A 4S2HA 5BNPA 1DF0A 5FZBA 1SMVA 1S0EA 1Y9MA 4LEJA 3U1XA 1EP0A 2C5DA 1ODMA 5L36A 2ZBJA 4LA3A 3WQBA 5ABJC 2YC4A 1WD3A 2IXIA 2GMMA 1XOYA 1EUTA 1AYM1 4G3YC 2H6BA 3POGA 1RJ7A 5DMYA 1L7QA 3AZYA 1BYHA 5E16A 2D43A 3Q8AA 1QXJA 4Y1UA 3TOJA 2GALA 3VBUA 2E33A 1N3PA 3A7QA 1MS8A 3H3UA 3K3OA 1DFQA 4JX0A 2FZ2A 1GMMA 3TEWA 1AR93 4IQPA 2VOXA 3PU8A 5L73A 1ZZCA 2BP6A 3M3CA 4MVTA 4A3ZA 1WCSA 1DQ5A 2H6CA 2X05A 1FATA 4KL1A 2A75A 3J7HA 4IE0A 4XBLA 1POV3 3ACHA 4YPJA 4OZOA 3C7OA 4LKEA 1OD5A 4JAAA 1KEXA 5H9RA 1MQTA 1HIXA 4N9IA 3ZDVA 4J1XA 4BDVB 1AR73 4XUNA 3ALQA 3VDAA 5GZDA 3WDXA 4Y5TA 3PIJA 5J3UA 1EUUA 5J36A 4YM0A 1K12A 2UY8A 4AXOA 1CAVB 3VHRA 2PAMA 3MV01 4BPZA 5IAXA 1V0AA 4JGZB 5A1AA 4JKLA 1BMV1 3EXUA 4QPWA 3RZHA 3QBQA 4Z2AA 2XG3A 5J98B 2VOWA 1AX2A 4YARA 4LBJA 1H1MA 4C1WA 1GICA 4LITA 1VBE1 4A6SA 2WNVB 1POQA 4AGRA 3VD4A 4HOOA 3LB9A 5FFOC 1CVNA 4NVPA 1XBFA 3KHCA 4XACA 2OUJA 1XNDA 2WBKA 3AKTA 5C70A 1JYIA 3RMXA 5H9QA 3AK0A 4HVRA 2ZHLA 4GH4C 3JB4C 5FZMA 1HX6A 4PIYA 3VBRB 4BA6A 3ZXJA 1X33A 3MPBA 4GAZA 3UKTA 3N36A 4W4ZA 4CDXC 4MO3M 5FZ6A 3TNPB 1JYWA 2JIGA 5FO7B 4Q4Y2 1RUC2 4JQTA 3J8F3 4AFAA 3V0AB 3OCPA 2PELA 1GZWB 4A41A 5IVBA 4GJYA 1KFXL 1PNGA 2Q1MA 3N9NA 3ZYFA 1X82A 1LOGA 1YFYA 2JG9A 4FP3A 1S0DA 4S2GA 3WQ0A 5A3TA 2XJRA 4E2GA 1O4YA 4X6QB 3BPSA 4AQTA 2JD9A 2A6WA 2OIIA 1LGCA 2PHDA 3MLKA 2Z42A 4QXCA 4UAPA 3I2JA 5CG8A 2V73A 3AMQA 4MXWB 4Y1YA 3VZJA 3ZFFA 4CCNA 1RUH3 5C5TA 3AKRA 4PCRA 3LOIA 1QJX1 3NWKA 4N90A 2JX9A 3N7MA 4RHV1 2GP5A 4CCKA 5C8CB 4YW5A 4OI0A 2JB8A 4P9YA 1ZZ7A 4PI0A 4M3CE 3ZFEC 4MGQA 4QQHA 2AYHA 3IAPA 5FRAA 1GWLA 1OMIA 1RUI3 3BN6A 4N43A 3VBFB 1AYN1 4AVBA 1JHNA 3NV1A 4AI8A 3USUA 3WG3A 1H4HA 5ACA3 1GQPA 4CDUC 1RUD1 3VBSC 2L9LA 2KD7A 1QQP1 2QKDA 3ZPYA 3MF9A 5C9AA 3POIA 4MZUA 4XFHA 3AX4A 4MV2A 3BVCA 2YU2A 4D3WA 2Z69A 4L11A 4BMBA 3OYWA 2IUWA 1W2UA 1VBD3 4Y5Z0 2PAEA 4LKSA 2D6LX 5FZEA 4E27A 1B35C 2JKBA 4LBQB 5KR7A 1Y43B 4XIOA 5FZOB 1OXCA 1WWYA 1UZYA 5LBFA 2PQSA 1HLCA 4K20A 3R4UA 2EIDA 5FO9B 1H2MA 4COVA 3PTYA 2H0VA 1UOGA 1VR3A 2XJSA 1PVC2 3VGIA 3KCYA 4LULA 1OOPA 4FFHA 1HQLA 1HXS3 5I0TA 4DNYA 3R4SA 4QB6A 5AFEA 1PVXA 1W9WA 3KQ4B 5A7PA 1RUE2 2KA3A 4K8RB 4YW1A 4CEYC 3ILFA 1F2NA 2XHKA 5FZKA 4B4PA 1PX3A 2ZMKA 3KV6A 1GOGA 3I2IA 4HSJA 4BQ5A 2VC9A 5HXVA 4CUGA 3LAGA 1VBC1 2J1AA 1UN1A 4GALA 4P9LA 4QHOA 5FZLA 2WYSA 5A3UA 4YLZA 4YW6A 1W2TA 1QY4A 2HWF3 3M4FA 3RI8A 4QAWA 1LNSA 1SDWA 5A32B 4YVSB 5LBEA 2QQNA 3WY6A 2RHPA 3WDTA 3UV9A 1OD3A 2W1UA 2ZKLA 1FNYA 2XJPA 2RMU3 1EV13 4EROA 5JCTA 2WL1A 1W8NA 1JOJA 1W2AX 1UXZA 2PHRA 3TN92 1YXWA 4IE7A 5J96B 1F4AA 4JGZA 5CFDB 2QQOA 3DYPA 3CEWA 4I02A 2UWCA 3E6DA 2Z79A 4F83A 3CU7A 1QJU2 4MYEA 2R041 5T3NA 1TMF3 5CBLA 1EPZA 2IVJA 4KNCA 2LS6A 4CP9B 2IFWA 2VU9A 4LOSA 1W8WA 2ZX2A 2HEYF 2K0GA 1VBA1 1VRBA 5DPNA 2VGDA 4NJ4A 3WQ7A 3SHRA 1CN1A 1WLTA 2ZEWA 5KC5A 1CQ9A 5LBCA 4XJ9A 1ZBE2 3NNLA 2RR11 4RFRB 1UZ0A 1Y7BA 4H2AA 4Y20B 3SQOA 2YUEA 3DYOA 3M2MA 4XTMA 5FV3A 5JZGA 3B94A 1JZ3A 5F3EA 3H1YA 2WO7A 1YQ2A 1AXZA 5FJHA 4GIQA 4AYUA 2WINB 1VB4A 1EAH2 4C91A 3CL1A 3VBOB 5F9TA 5I91A 3PVNA 4LBOA 1JUIA 2ZPXA 1QGLA 4CCEA 3FHQA 1NA1C 3WUDA 1BEV1 1SFYA 3LDBA 1K45A 4RQPB 3P3NA 1X9TA 2AEYA 4TXWA 3KZ4C 3SCFA 3TYJA 3I2GA 3LZZA 4K40A 4QMAA 4EN7B 4V2VA 5JSOA 1UKRA 2F4LA 4XHXA 4ES8A 2RJKA 3AP6A 4S2DA 4C0BA 4C0HA 4IV1C 1F9KA 4GB33 2IZWA 2RS13 4AG4A 3S0MA 5LW9A 4JCKA 4FQZA 5FZ1A 4CPBA 5HV4A 4NUBA 4AEDC 4HETA 4XF4A 4A6OA 2BBAA 4YNIA 1R082 4XBQA 3AP4A 1LOBA 4Q5OA 5IAVA 2GSYA 5FYTA 1Q8OA 2XPJA 2JE8A 2D6OX 2UWAA 3H7JA 2Q5TA 1NX9A 4XYXA 3HIFA 3ZYBA 5FY1A 4B3NA 1Z7S1 4WVWA 3RVHA 2B42B 4BYYA 3AYCA 3D5OA 3GDBA 4MGYE 4FQ4A 2DV9A 2UURA 4Q0SA 2XBO3 3I3BA 2J1RA 4QPGB 4UF0B 4UOJA 2P3JA 2YZ4A 1H0BA 1DZRA 1XC6A 3U37A 1A6CA 1QNWA 2ARCA 4Z8BA 3NW4A 4CA9A 2VO5A 4QXKA 3POEA 1QJZA 1MEC3 1ND2A 1MS9A 2ORXA 3KVBA 3AZZA 1D7PM 1H2NA 2E51A 2FDJA 2LUWA 2WR9A 3OBAA 4GH4A 5C5UA 2ZKNA 2ZGPA 1NUKA 3FUQA 3N7JA 3TWIA 1JOPA 2WZR3 1GU3A 4KWKA 4MHRA 5DDJ1 5EIYB 3SC7X 2GH8A 4KWJA 4CDXA 2HEWF 5C3PA 3TEZA 5FTTC 5FLJA 2W1SA 4PF1A 4Y33A 4DEQA 1O3TA 1VALA 5IYYA 1LRHA 2W95A 4PJYA 3R4DB 2DF7A 3SKJE 5BNNA 2EALA 2JECA 3DYMA 2WZ8A 3OUIA 4IL7A 2BJSA 5FXWA 2XH6A 3ZR6A 2JB4A 2A6ZA 2YHJA 2BZDA 4JKMA 1RUJ2 3ZFGA 1W90A 1UYPA 4ARYA 2WFPA 2AACA 5AC92 2VCBA 3O14A 1C4RA 1W0PA 2BWCA 2Z2SB 3VZNA 2WT2A 4AEMA 3BALA 3E5XA 2VE1A 2C0ZA 3J4UH 3PMEA 2RDRA 3LFIA 2P3KA 5K0UB 4GZ9A 2AH2A 4FXGB 1CAWB 3V0BA 5C4WB 5LBBA 3WDYA 2D7FA 1REDA 5F5QA 2WRAA 5E1RA 5GM0A 1F31A 3LEKA 4BXSV 3SKVA 4UW5A 5GJ6A 1PK6B 4M01A 3LPFA 4ZS2A 3B7MA 1UOJA 4JGYA 5CISA 5FZFA 4XDQA 3VHOA 1N1TA 4BIOA 2ZEZA 4ISQA 2JDPA 5FIXA 3VD5A 5A6XA 2UWBA 4QPIC 4P9IA 5IK4A 4AI1A 4CP9A 4ZKTB 4B29A 1MVEA 2D6PA 1YC61 2OZJA 5CIRA 1OURA 4UI9L 3VKOA 5JSPA 1F8VA 1VRH2 2WNUC 2Q0AA 4AHWA 2RVAA 4QDRA 3GALA 3MIDA 1WLDA 4KBBA 1C57A 3H1MA 4YW3A 3AL6A 1S0JA 1RHI2 2FCVA 2NQYA 1ZA4A 4HK8A 4AQ2A 2VOKA 1PO23 3WG4A 1TME1 2ETEA 1IPKA 5DAXA 1V6OA 2ZGNA 1PO12 3NAPA 4LBNA 4KBZA 1RUH2 4IE4A 4XXAA 2VZOA 2GN7A 3LFMA 1RMU2 2B39A 2AC1A 3JXSA 3FJSA 4X6RB 4CPBD 1S0BA 5I0RA 5JSRA 3WP4A 3MO4A 4XQDA 1H2KA 4D8MA 2Y0OA 3BGAA 1QOTA 5IATA 5ACA2 4YW2A 2KXLA 4X8PA 2C1FA 3GCWA 1GNZA 5EJ3A 4ZPIA 4L2NA 1YIFA 4ZXEA 3CMGA 3KT1A 4Q1RA 3ZXFA 1O91A 3BOPA 1HRV1 1VIWB 2DVFA 2WT1A 2CU5A 3N35A 1NLRA 1QMJA 1VBD2 2PMWB 2WLPA 3LEMA 2PLV1 2X5IA 3RZZA 3J7LA 1UXXX 3M7AA 3VL8A 4D0QA 2J22A 1U5ZA 2BW8A 1ND3C 2FHRA 1C8M1 3MIGA 3N9QA 5G05L 3VZMA 1CX1A 3TAYA 1GP5A 1VPHA 1W8TA 1HXS2 3PUSA 4Q4W2 2OKXA 1RUOA 2WO1A 1WZXA 1E5SA 1W8UA 2VW1A 3Q8EA 1KDKA 2QQKA 3GZEA 4B7KA 4ZHNA 4FTEA 3MYXA 3O1TA 1W9TA 1W8ZA 2Y33A 5FQ0B 4Q8LA 2QQJA 1DLCA 4FPLA 1Z7S2 5A7NA 2QQUA 3C2UA 3GYDA 4NAMA 4PLMA 2F17A 4CDQA 4XC9A 4EJRA 4NN0A 1HN1A 4I2OA 2VZ3A 4IXLA 2BFUS 1CIYA 4XF0A 2OT7A 1KS4A 5H9PA 3RI9A 2VAUA 1ZRFA 5CADA 1VAVA 1E57A 1G6NA 2KR2A 4PBOA 4PIZA 4LT5A 4YGCA 5FMBA 5G04L 4Y22B 4O9GA 1O8PA 2EXHA 2PAKA 1Y9GA 1OHFA 3DCQA 1HB3A 4RS5B 5BNPC 2GU9A 3VD7A 3OG2A 2RMU2 3NJZA 1EV12 3THPA 4BIFA 4M3CF 1WD4A 1AJOA 1IPJA 2QCSB 3LDKA 4AF9A 5JXGA 3I2DA 3MIBA 4IEOA 1CAWA 2DBIA 2VR4A 4H3WA 4LHKA 2BWAA 5C4WA 3SEPA 5M0TA 1TEIA 2EIBA 2XB6C 3RSJA 2ZX3A 1IHMA 2MHFA 4FPGA 1AR63 3I8TA 1OQ1A 3HN3A 1RUG3 4NOTA 1GSLA 1W6OA 1JU3A 4FO9A 3VBUC 1LEDA 1N3QA 3ZN4A 3MFCA 5L7OB 2DFCA 2YDEA 4Q4Y3 1YHFA 1UZVA 2JWPA 2VMCA 3R0RA 4ZU7A 1UU4A 2RS51 2DCYA 2A3XA 2V5DA 1QIQA 1K5MB 1NT0A 1VE0A 3ES4A 4O61A 4E4HA 1ZZ6A 1LGNA 3Q8BA 1WMXA 1XE8A 5JPNB 5FLHA 3WNMA 1MQTC 4P02B 3WF4A 4A3XA 4N7IA 5LY1A 3OBZA 5CKQA 1EY2A 1XNCA 1N47A 2ZGSA 3MZHA 2NM1A 1G7YA 2WLQA 5DQ0A 2ZGOA 3K77A 2D3PA 1RC6A 3FFQA 3RNSA 5FUNA 1IKQA 2IXLA 4AHZA 4CU6A 2HYXA 4I30A 5K8SA 5JXHA 2ZGTA 4BQ4A 2D3SA 4UYBA 1DZQA 3KM5A 4ZZ8A 5KBFA 5F1RA 1R091 2ES3A 4HVOA 4W65A 5A7WA 4YZ1A 1CJDA 2XQXA 1S0IA 3EQEA 5B4XA 1BVP1 3LD8A 1QHDA 2V5YA 3WEZA 3EJKA 4CU8A 4AGGA 5A33B 2UU8A 1VBB1 4LXLA 4NHLA 2A73B 3UETA 4B7EA 1OT5A 3HD8B 4IGQA 1CR7A 1J1TA 4BQWA 2A6VA 4CEWB 1CD3G 3DECA 3T0BA 1YFUA 5FPLA 1WLWA 2W1WA 3QCWA 5GLTA 2G4IA 4R52A 5EPAA 5T5LA 4XURA 1FX5A 1V9U1 2SBAA 1GWMA 2CWMA 4IEVA 4L8QA 3T2OA 1VB2A 4M0HA 2PN5A 2XBO2 5IFTA 4LHSA 4DRVA 4YSFA 2J1SA 4GKYA 5SV5A 2BYVE 1LHOA 2D44A 3VKFC 2VOVA 2JG9C 4FVVA 3O5SA 1CAUA 2JD4A 3O0XA 4L99A 3M1HA 3AMPA 2CV6A 2D40A 2WN3A 2C9KA 1SLAA 2VZRA 2WZR2 4XJ8A 1JZ6A 5FY5A 3KB5A 3K2OA 1GNYA 3ZIWA 2W08A 2JICA 4WM8B 3P1IA 3CLPA 4NHMA 4CUCA 2ZAAA 4KU8A 2W1QA 1W0OA 1KD7A 3I2KA 2WSVA 3FFZA 1DZTA 1WGPA 1IQAA 3AP9A 4PT6A 5DG2A 5KHHA 3JQWA 2PHLA 4N43C 5JOXA 2JIJA 4CRQA 2C26A 1GZ9A 2QNKA 5AFBA 4IGOA 1A8MA 3ZX7A 5FQ0A 4PLNA 1S2EA 1XE0A 1R1A1 1GLHA 4BWOA 3ZYHA 1D4VB 1H6XA 1POV0 5F6LB 3WG1A 5C9AC 1GV9A 4LJHA 3OEAA 3HR9A 1YJKA 3K4AA 1UCXA 4XZPA 5FP3A 1PHMA 3TN93 4YWAA 4EV0A 2V72A 5JVVA 1ZYBA 4WV8A 2W47A 4AHYA 4OMCA 4BOWA 3H9AA 3GM8A 2TEPA 1I5PA 1D4M1 4FBFA 1F15A 5FP9A 5FUIA 1GKBA 1US2A 1NXMA 2GMEA 2YC2A 3IIIA 4X8NA 3W59A 2NMOA 3BU7A 2DYCA 3WNLA 1NCRA 1E5IA 2WQ4A 4BCUA 4BXFA 3FLRA 1O5UA 1OOPC 1Q8QA 3WINE 2Q8OA 2P2KA 1X8EA 1T6BX 1VMJA 5EXOA 3IDEA 5EYXA 5CG9A 2A71A 3B01A 3MEPA 2P3IA 3GHNA 2QQWA 2YU1A 2Y26A 3ZN5A 1ACCA 4JQRA 3WNNA 4RGGA 2B5HA 5KXBA 1A34A 2HWE1 3EB7A 1EAH3 3A21A 5ANQA 4BLJA 3OUJA 3OEBA 1VBE3 2C24A 3BI3A 1L7LA 1KS5A 2ZA9A 1FPN1 5FMOL 5A1FA 1ZREA 1DDLA 3LQCA 3VDDA 3NRUA 1FV2A 1F5JA 5FYUA 2QBXA 1D0HA 4I09A 3PDQA 2O1QA 1AXKA 3O1UA 5A3MA 1CESA 2FCTA 1UO9A 1ZZ8A 1ENRA 1IGOA 3OPZA 5CB7A 5BPXA 2EF6A 2YROA 4JGZC 1DQ1A 3I3QA 1ULFA 4IETA 2XL7A 4NIGA 3POFA 4UW6A 4D7YA 1R083 2V4AA 4OI4A 5L9RA 2FDFA 1NQJA 4MGSA 5CU1A 4LK6A 2WAAA 4Y4RA 2NZ9A 2VZQA 3AKPA 1DG6A 3ZN6A 4N7UA 4IEYA 1UPSA 3TEXA 3ETQA 3FZ3A 4DRRA 1GP4A 2R071 1PMJX 1VLNA 3ILNA 3N9LA 3SLIA 2TBVA 1QJX3 3PUIA 2DUOA 3HT1A 1QJEA 2XKPA 3BTAA 3NKTA 4RHV3 5T5JA 3VBRC 4CEWA 2X53S 2Y6FA 5C6CA 5BUVA 4FXKB 2NPIA 5JZGC 2ZZJA 2RS31 4XEZA 4MH0E 4E4DX 4G9SB 3SH4A 4IDZA 5FYSA 4BQ2A 3I2OA 1C1LA 1SDDB 2CSGA 4OI2A 1AYN3 5EFUA 1HRI1 3NO8A 1LEMA 5BNOA 2FDHA 4BE3A 1OPOA 3ZXKA 3VZOA 3N9PA 5T5PA 5IFPA 1RUD3 3DEMA 4IERA 1WW6A 4ZONA 1QQP3 3VBHA 4ASMB 1TNFA 1S1AA 1U5IA 1URXA 3UKVA 4JHZA 2VD7A 3KGLA 4K1YA 1EPWA 2E26A 1VMHA 4N53B 3BU0A 1SFPA 4U2AA 2DVAA 2O8OA 1RUJ3 4RR3A 4YVWB 4QKDA 2ZAHA 4Q27A 5AC93 4ZU4A 3IBMA 5EV7A 1PZ9A 2RE9A 1C5HA 1QJY2 3CIHA 4GWMA 1C8NA 1HQWA 3MW2A 2OX0A 2JDNA 3VBFC 1W06A 5HPOA 4IESA 5K4LA 3ZXGA 4IEQA 1O7FA 1HV1A 3LWCA 4I3PA 3VD9A 1OA3A 1NAEA 1SEFA 4P14A 5JUVA 3U07A 1COV1 4KMQA 3O0WA 4KWUA 3P5BA 1NQDA 4LIVA 2VQUA 2AREA 1OPMA 4D94A 2IXJA 4INDA 3ROUA 2DFBA 1FMD1 3FHIB 3ABZA 1LHWA 4H7MA 1VBC3 1Y4WA 1PZ7A 2GP3A 3INAA 2JG8A 3A23A 1QF3A 5DUVA 5FXXA 5LZ6A 1NCQA 1G9DA 1ND2C 3D0JA 3RZMA 5D8AB 2YMZA 3GGLA 4W6XA 4FFGA 4AHXA 2RJLA 4QX3A 1AR62 1GQGA 4NROA 1RUG2 4D7TA 1BVVA 2OPKA 4DFSA 1VRH3 2IC1A 4FOVA 2R0FA 4ATEA 2XJVA 4QX7A 1TVGA 2EXJA 3MUY1 4L0PA 5BNNC 1O59A 3NMBA 4Y5SA 5FBJA 1A8DA 1MZ5A 2K9ZA 1RHI3 1ODNA 2W0XA 3QLQA 4AVAA 5J7MA 4NIHA 3T30A 2P1BA 4YZ3A 1KJRA 3ZFGC 1ZBA1 4LKDA 1HB2A 5CFCA 4QGNA 1S2KA 2R7EB 4FPYA 3FMGA 3VHNA 5KHJA 1PO13 1XB9A 2B9VA 4Y3OA 3TRSB 3NV2A 1IPSA 1J3PA 1DYOA 1S55A 4FFIA 5ABJB 1VBA3 2DDUA 2LROA 3ZLIA 1XJAA 3LGRA 5F39A 4CDQC 4Y1ZA 2XWJB 2BGPA 4NIAA 4DPNA 2VZPA 1RMU3 2EAKA 4KI5M 4YW4A 2RR13 2K46A 4QHZA 1Y9QA 4Q4X2 4WZCA 3T2TA 5F3IA 2E63A 2PHFA 2R6QA 3I54A 3K3NA 3VDBA 2XL9A 3BTZA 1CAXB 2X8KA 3W21A 3KCXA 4YZ4A 3WDVA 5JMOA 1YLLA 2HWE2 5FY4A 2XOMA 4JGYC 2VZ1A 1I9RA 1ST8A 4FAGA 5CA6A 4FP2A 5I93A 1V6LA 1CGPA 1J83A 2MNGA 2C6SA 1H6YA 2ZGRA 4FT8A 4A7KA 4DXSA 1K3IA 4F8AA 1BK0A
chains in the Genus database with same CATH topology
1W8TA 3F95A 5D21A 3ZYHA 1WZXA 4BQ2A 2LROA 1W8UA 3ZYBA 4BQ3A 1HN0A 4LJHA 4CP9B 4YW6A 4YW7A 1GWKA 1W8WA 1UOJA 1WMXA 2K46A 1GWLA 1W8ZA 4YWAA 1V0AA 2Q1FA 4LK6A 1W90A 1OH3A 2C24A 1L7LA 2VXJA 3UT0A 4CPBA 4A6SA 1W9FA 4CP9A 2O14A 4AL9A 2WYFA 3ZYFA 1GWMA 1OKOA 1WCUA 4LK7A 4CPBD 4LKDA 4BQ5A 2LRPA 4BQ4A 4LKEA 2KR2A 4LKFA 3ORJA 2JWPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W8T A;  3F95 A;  5D21 A;  3ZYH A;  1WZX A;  4BQ2 A;  2LRO A;  1W8U A;  3ZYB A;  4BQ3 A;  1HN0 A;  4LJH A;  4CP9 B;  4YW6 A;  4YW7 A;  1GWK A;  1W8W A;  1UOJ A;  1WMX A;  2K46 A;  1GWL A;  1W8Z A;  4YWA A;  1V0A A;  2Q1F A;  4LK6 A;  1W90 A;  1OH3 A;  2C24 A;  1L7L A;  2VXJ A;  3UT0 A;  4CPB A;  4A6S A;  1W9F A;  4CP9 A;  2O14 A;  4AL9 A;  2WYF A;  3ZYF A;  1GWM A;  1OKO A;  1WCU A;  4LK7 A;  4CPB D;  4LKD A;  4BQ5 A;  2LRP A;  4BQ4 A;  4LKE A;  2KR2 A;  4LKF A;  3ORJ A;  2JWP A; 
#chains in the Genus database with same CATH topology
 2VG9 A;  3T08 A;  2ZOE B;  1KQR A;  5FMC A;  3WCR A;  1UKG A;  5IK7 A;  3T2P A;  2VBD A;  4AVV A;  5FY9 A;  3OD4 A;  4J1W A;  4CCM A;  4AVC A;  3ZXD A;  3HNY M;  2YGL A;  5I0U A;  2R16 A;  4W50 A;  2ERF A;  4R4X A;  3U75 A;  4PF5 A;  5KXE A;  4RSU A;  4Q4W 3;  4LBK A;  1DIW A;  1ULP A;  3AFK A;  4GWN A;  3WXP A;  3T1L A;  1YFW A;  3MV1 1;  4QM9 A;  3RPQ A;  4OQ8 A;  3CJI B;  4XUQ A;  3ZMN A;  4B4Q A;  3NAP C;  4CCL A;  4FPE A;  2MPF A;  5JOY A;  2Q4S A;  3C7E A;  5C3R A;  3C8X A;  3LPG A;  1IG3 A;  1QH6 A;  1Z7S 3;  3N7L A;  2XGX A;  4RQP C;  2CHH A;  4OMD A;  1LGB A;  2R07 2;  3HEI A;  3U14 A;  4CXX A;  5ANN A;  1AR7 1;  1C28 A;  4CDW B;  4XDO A;  1N1S A;  4N53 A;  1US3 A;  1UY1 A;  4FPO B;  4P00 B;  2YV8 A;  2ZZQ A;  1UMZ A;  1KDM A;  3I3D A;  2JDU A;  4UFH A;  4GUL A;  1AYM 2;  3KWV A;  4WVM B;  1FT9 A;  4EN8 B;  4XTP A;  3CDZ B;  4I01 A;  1HV0 A;  4XFI A;  1A3K A;  1CIW A;  3KV9 A;  1CAV A;  2EXK A;  5LA9 A;  2N7G A;  4GXL A;  3OY8 B;  1IZ3 A;  3MUZ 1;  5JR7 B;  3OGS A;  4LO7 A;  1YI9 A;  2IXK A;  2X5I C;  1V6K A;  4OUE A;  3O1R A;  4TLF A;  4HAN A;  2VW2 A;  1JU4 A;  2WJS A;  1RVF 1;  2OVU A;  2WNV A;  3M3Q A;  4HN1 A;  2CTV A;  4GD4 A;  4LMF A;  2WC2 A;  3HMY A;  2AGS A;  3RZK A;  3ZFE B;  5A70 A;  4YZ2 A;  5D8A A;  5A1L A;  4U36 A;  1LB2 A;  1JBC A;  4LPL A;  1MVQ A;  4NHY A;  4XQW A;  3OF1 A;  5EQU A;  3ZSJ A;  3JBG 1;  1OVP A;  3L2H A;  1G9B A;  3VBR A;  1RUN A;  2VUA A;  2WQZ C;  1JYT A;  2WKK A;  1HB1 A;  4BHP A;  4V2W A;  4CDU B;  2V09 A;  3KS7 A;  1BMV 2;  1LKN A;  2HBT A;  3PTR B;  4H7L A;  2OQ7 A;  4Z92 B;  2DWR A;  3LSE A;  2VNG A;  1VBE 2;  1IQD C;  2XJT A;  1XXN A;  1GZW A;  3IDB B;  3KF5 A;  4GWI A;  2G19 A;  2JDM A;  3CNA A;  4TYS A;  1ZX5 A;  4XJW A;  2MEV 1;  5FZ9 A;  5JOZ A;  1JXN A;  2D3R A;  4GMP 0;  3WP3 A;  2E53 A;  1B35 B;  1JI6 A;  1GWK A;  4J25 A;  4OYU A;  1G8W A;  2QTW B;  1GBG A;  3GCX A;  1WBF A;  2C9A A;  4AAP A;  2WWS A;  3ZR5 A;  1PGW 1;  3VV1 A;  1WW5 A;  3AKS A;  4MXW A;  1E5R A;  2J1V A;  1RUI 1;  4RA0 A;  1PGL 1;  1PIV 1;  3PU3 A;  3T1M A;  1OSG A;  2Y6G A;  1UAI A;  5C8C A;  2B4K A;  3DPR B;  1CX4 A;  4AZZ A;  3O1P A;  1BK1 A;  1D2Q A;  3MFA A;  4TWT A;  5GZG A;  3ACG A;  1DYK A;  1ONA A;  5C4W C;  3RJR A;  4QB2 A;  3VBF A;  1UL9 A;  4XE9 A;  1APN A;  4CSW A;  2YFU A;  1SLT A;  1PK6 C;  4LHL A;  2R06 1;  3D4K A;  5A6Z A;  2WA4 A;  3M3O A;  3JQX A;  3A0N A;  5A80 A;  3ITQ A;  4A42 A;  3IMM A;  5FP8 A;  4HZF A;  2BDR A;  4Z1V A;  2HJI A;  1QJX 2;  3AZV A;  5T55 A;  1Q56 A;  4RHV 2;  5DG1 A;  3P6B A;  1OH3 A;  1SFN A;  2QQI A;  2ZJC A;  3H8R A;  3GBF A;  1ZRC A;  1MZE A;  1C3H A;  4FFF A;  4LBQ A;  1QH7 A;  2R49 A;  2BBV A;  1W8F A;  2RDQ A;  5FZO A;  1DGW X;  4A7Y A;  1FOD 1;  3GNE A;  1JZ8 A;  1AYN 2;  1N1V A;  1OKO A;  1W6Q B;  2RJ2 A;  3OGJ A;  4LTA A;  5E88 A;  5FO8 B;  4WM7 B;  2WDB A;  3ETP A;  2Y64 A;  1YQC A;  4LBM A;  5F5C A;  2E7A A;  5FZ4 A;  1RUD 2;  3J26 N;  2YC0 A;  4XET A;  2VL4 A;  1D2S A;  5A7Q A;  2Y8K A;  4TN7 A;  1QQP 2;  4D69 A;  3K75 B;  3RFR A;  3WW2 A;  4R9A A;  1OC1 A;  5C3Q A;  5F8P A;  3OD0 A;  1NZC A;  4DB5 A;  1HRV 3;  2GDF A;  3AMN A;  2V4V A;  2VZS A;  2PLV 3;  1XE7 A;  3M3I A;  1D0G A;  1ZM1 A;  2ZX0 A;  3B93 A;  3NL1 A;  4HXC A;  5FZ8 A;  4AQS A;  1JZ2 A;  5AVP A;  4Q29 A;  2I2S A;  3UJQ A;  4QB1 A;  5EJ1 B;  1TNR A;  1RGS A;  1X36 A;  2EIE A;  4FPH A;  4LK7 A;  2VCC A;  5SV8 A;  4AWD A;  5A32 A;  1ZA7 A;  3RMY A;  4BQ1 A;  4YVS A;  4P5Y A;  1VAM A;  1NOV A;  3PNA A;  2OA2 A;  4E8D A;  2W94 A;  2LTN A;  4EWD A;  3GXU A;  4IW3 A;  2WS9 1;  5LEJ A;  3BKZ A;  1VMF A;  1W28 A;  1ENX A;  1IS6 A;  5CFD A;  1DGL A;  1VBC 2;  4D6R A;  2WNE A;  4JVA A;  2Q8E A;  4ES9 A;  2XHN A;  4TLG A;  5FXV A;  3G7D A;  5I8Y A;  1JYV A;  5JWP A;  2PA7 A;  5JIA A;  5GAL A;  4IV1 B;  4AAX A;  4BME A;  2VBB A;  4LHN A;  5B2G B;  4ONU A;  1WCU A;  5FYV A;  4WVZ A;  4AED B;  1RIR A;  4UT5 A;  1IKP A;  5E89 A;  3IPV B;  2Z4F A;  5IK5 A;  4JDM A;  2OPW A;  4MOA A;  1LHV A;  4OUL A;  5FYH A;  3GBG A;  5JXI A;  3AZW A;  4QGL A;  3VUO A;  1REE A;  4Y20 A;  5KHG A;  4A4A A;  1F35 A;  4Q4V 1;  4QKB A;  5LAT A;  4Q26 A;  1BKZ A;  1X50 A;  2FZ1 A;  3HT2 A;  2VVD A;  2P37 A;  1AL0 G;  2R04 2;  1CPM A;  4HG6 B;  4QWN A;  1RYY A;  3MIC A;  5EYY A;  5HCH A;  3VBO A;  4COU A;  4UFM A;  2ZXQ A;  4M3C B;  5DZG A;  2ENR A;  2Y6K A;  3ME2 A;  1LU2 A;  1U0A A;  2VQA A;  1VBA 2;  2JDK A;  1W9F A;  4JZR A;  2O14 A;  4GB3 1;  4JDN A;  4XAA A;  4RQP A;  2Q1Z B;  2I45 A;  2HH9 A;  3APB A;  2DTY A;  3VL9 A;  2RR1 2;  2W52 A;  4AGV A;  4QDS A;  3NJV A;  3UGH A;  1ALY A;  3IDA A;  1JUH A;  5CEH A;  1YQ6 A;  4IV3 B;  1ASJ 1;  3I49 A;  3DPR A;  3POW A;  3H8X A;  4XAE A;  5K7P A;  2G9G A;  3WNX A;  3ST7 A;  5FKB A;  3P3P A;  4RFT 0;  1AHS A;  1LOE A;  1NCR C;  3POB A;  3KCC A;  5FP7 A;  4OCT A;  3WF0 A;  1AR8 1;  1LAJ A;  1O5L A;  2PYT A;  2WT0 A;  3B3Q E;  1W9Y A;  2HWC 1;  2XWB B;  2XDV A;  3ZSK A;  1O4T A;  3NNF A;  5FBZ A;  3UT0 A;  2ADD A;  1BEV 2;  1CZT A;  2SLI A;  3IAQ A;  3K48 A;  3T0A A;  3C7H A;  3DKW A;  4MX3 A;  4OI1 A;  1MEC 1;  1SPP B;  2J1E A;  1OKQ A;  3I59 B;  3H0O A;  3SCH A;  4LOR A;  1R09 3;  4LBQ D;  5I0D A;  4XXP A;  3CZU A;  4A2U A;  4QPG A;  4UF0 A;  1BLZ A;  1WW4 A;  2OW4 A;  4KWL A;  2AR6 A;  4ET7 A;  2KM2 A;  1G9C A;  4QX1 A;  3T0D A;  4EZH A;  2E32 A;  3MPP G;  3VDD C;  4XIK A;  3HBZ A;  3MLL A;  1DP0 A;  4BIS A;  1RUF 1;  2DCK A;  4UW3 A;  3MBW A;  1Q5O A;  1UOF A;  1W6P B;  3E97 A;  5CKN A;  4WM7 A;  1DGW A;  3ECQ A;  2R06 2;  4MGK E;  1KIT A;  2NN8 A;  3GHM A;  4YM1 A;  3ZDS A;  4EN6 B;  5KXD A;  2RM2 1;  2W2I A;  3TBD A;  5FLI A;  5J37 A;  1V9U 3;  4EQV A;  3N9O A;  2ARX A;  4HN0 A;  2ZAC A;  3MW4 A;  1UD1 A;  3MI8 A;  3HPN A;  4MHU A;  4QPI B;  1QJY 3;  4DXT A;  1OLM A;  5F2S A;  5A6Q A;  1XRU A;  1LUL A;  1J3R A;  1YQ5 A;  3QD6 A;  3IT8 A;  2VTX A;  4FOQ A;  5FY0 A;  4ASL A;  4KGG A;  4MAD A;  2EIC A;  4SLI A;  1BCX A;  3KMH A;  2YPJ A;  5DDJ 2;  1VJ2 A;  4PQQ A;  1DHK B;  1EYB A;  1W0N A;  3AZX A;  2Y34 A;  5K0U A;  4W6W A;  4CEW C;  2BNO A;  3JD7 1;  1H9P A;  2W3J A;  4CVU A;  3PHM A;  4ISR A;  1Q8S A;  2YYO A;  1RTV A;  4NHX A;  1ZRR A;  2BPA 2;  3KVA A;  1SLL A;  5HCB A;  4XFB A;  2A5Z A;  4XIL A;  1YO8 A;  1H2L A;  1MS0 A;  5BNO C;  1PK6 A;  4XF3 A;  2A1X A;  1R1A 3;  3RYP A;  3RYK A;  3ES1 A;  1DCS A;  5KHI A;  2X29 A;  3VBH C;  4IEX A;  4HPK B;  3RGB A;  3I3E A;  3RWK X;  5BXX A;  1HQN A;  1UYZ A;  4GMP 1;  3W9A A;  2HWB 1;  1FAY A;  1AVB A;  4AOC A;  1W39 A;  2B7Y A;  1HN0 A;  1WA6 X;  3GF6 A;  5FPV A;  3WX5 A;  4CP2 A;  3ACI A;  1NLS A;  2JEM A;  4FAH A;  3FL7 A;  3CJX A;  4D6Q A;  1AL2 1;  4RR3 C;  4CXY A;  2VTF A;  4JRL A;  2JDZ A;  3K4Z A;  4XBN A;  3UK9 A;  4AK3 A;  3DKQ A;  5B4N A;  2A3W A;  2WS9 2;  1DBN A;  2HWD 1;  3I2F A;  3LIH A;  1XYP A;  4QXH A;  3WOG A;  4OUM A;  5IWF A;  3WP5 A;  2WWJ A;  4LR4 A;  4YM3 A;  1STM A;  1NZI A;  5HI0 A;  4CU7 A;  3AP5 A;  1KRI A;  3ZXA C;  4YRD A;  4Y1X A;  1PNF A;  5DAQ A;  3E6C C;  5LRR A;  3CO2 A;  1GUI A;  4Q4X 3;  4M3C A;  5EHD A;  3LEI A;  5IVY A;  3O12 A;  2WFF 1;  5IT6 A;  4WZF A;  3B5L B;  3NNJ A;  1SBD A;  2BU9 A;  1I1E A;  1QJF A;  5FDB A;  1AF9 A;  4JKK A;  1P8J A;  4NPM A;  2EVX A;  2HWE 3;  2ORZ A;  1W6N B;  2YY1 A;  1O3R A;  5KC6 A;  2JG8 C;  1AXY A;  4IEZ A;  1NCQ C;  1SLC A;  3LIG A;  3QH6 A;  1WMD A;  1FPN 3;  3VD3 A;  4PDW B;  3AVR A;  4Q4V 2;  5LAS A;  2CGN A;  4FPF A;  4IV3 A;  1FYU A;  2VW0 A;  4CCJ A;  2E9Q A;  3E5U A;  1OA4 A;  5IVE A;  4AI0 A;  3AXD A;  4BQY A;  1TME 2;  5CVR A;  4ZU5 A;  4P9W A;  4FTS A;  5A3P A;  4OHW A;  5C7G A;  2CNA A;  2WNO A;  1UX7 A;  3E5Q A;  1W2O A;  4FCA A;  4XMI A;  1S0F A;  2VMD A;  1ZZB A;  2W91 A;  4AEK A;  4ASK A;  4EZ4 A;  1PGS A;  3B69 A;  4L97 A;  5BNP B;  5CFC C;  2ZHM A;  3V65 A;  1J58 A;  2QQV A;  1ASJ 2;  1HJG A;  1JN2 P;  1W04 A;  1NY7 1;  4IGP A;  3S30 A;  3HQR A;  1PZ8 A;  3WR0 A;  2PHU A;  4BM8 A;  3UJO A;  2ZML A;  4DMI A;  4UFI A;  2VXJ A;  3OB8 A;  1I6X A;  4NRP A;  5JI7 A;  3I2H A;  4BQX A;  5JOW A;  2R07 3;  3OUH A;  4AL9 A;  2YBP A;  4Q2F A;  5BV6 A;  2HWC 2;  3FLT A;  3AFG A;  5LA1 A;  4FOY A;  2AEZ A;  1HRV 2;  2EA7 A;  2QDR A;  2W68 A;  3RDI A;  3WW4 A;  2BUK A;  4HBN A;  5DUW A;  2RS3 3;  2XR4 A;  3VBU B;  5LRS A;  2PLV 2;  4K6B A;  2P4E A;  1H8T B;  1SG3 A;  3FLP A;  4ZS3 A;  1WKY A;  1AJK A;  1F5F A;  4QU1 A;  4WVV A;  1AYM 3;  3FBY A;  1HRI 3;  2P6H A;  5FZ3 A;  2VEC A;  3OSD A;  1DQ2 A;  4NE9 A;  3ZXE A;  5F7U A;  3A0K A;  2FMD A;  3U10 A;  1C8M 2;  3THD A;  5EP9 A;  1QEX A;  2JDY A;  5IJR A;  2XXZ A;  4LIU A;  5CNA A;  5FWE A;  2DUR A;  1RUF 2;  2Y0I A;  1GR3 A;  3H7Y A;  3MF6 A;  3QH7 A;  1MS5 A;  1UYY A;  1MQT B;  3NVC A;  2ZCW A;  4Q0U A;  4Y22 A;  4DIQ A;  1U5Y A;  4KQ7 A;  4RS5 A;  3AP7 A;  2OQ6 A;  1ZRD A;  4URT A;  1XYN A;  5BYN A;  2J7M A;  2VBP A;  1LOA A;  2IWG B;  2RM2 2;  1LHN A;  4DY5 A;  2XVK A;  4KU7 A;  3THT A;  2BER A;  4XF1 A;  1R1Z A;  1GQH A;  1W2N A;  4B1L A;  1E5H A;  2AEN A;  2XJU A;  1YUD A;  3ATG A;  1W8O A;  3KLS A;  1RUC 1;  1ZZ9 A;  4BQ3 A;  3DL3 A;  3KSC A;  1BQP A;  4NRQ A;  5DUU A;  2DU1 A;  2DVD A;  4WBB A;  3I3M A;  4HFS A;  4FOW A;  5CYY A;  1COV 3;  3AXE A;  3ZXL A;  5HBA A;  1IS4 A;  5L7O A;  4HPK A;  5JLV A;  5GZE A;  4DEV A;  1Q8V A;  3AYA A;  4ZY9 A;  4AEJ A;  2IXC A;  1X7N A;  3WF1 A;  1U5X A;  3JCI A;  3JU9 A;  4GA9 A;  4UWD A;  1K5M A;  2DUQ A;  3SXW A;  4QPY A;  2QQM A;  3JD7 2;  4N53 C;  4NMI A;  2BGO A;  5I8T A;  1GFF 2;  2PHW A;  2X09 A;  4UBG A;  1LOF A;  2CL2 A;  4YYO A;  1HKD A;  2VQT A;  5T54 A;  3RG0 A;  5JPM B;  5F5I A;  3RWN A;  3O1O A;  1X8M A;  3LDR A;  2J42 A;  4Q0Q A;  1GAN A;  3FBM A;  3QAC A;  2YB7 A;  4XW3 A;  2FBE A;  2A6X A;  2JG9 B;  3AM2 A;  2PHT A;  2DTW A;  1M4W A;  1WUV A;  1QXP A;  2ZX4 A;  5IUQ A;  5T52 A;  5D1I A;  4EN0 A;  1H8V A;  5FZ7 A;  2RS5 2;  5IVC A;  5FP4 A;  3SIT A;  1O6U A;  2Y6J A;  2QUO A;  3ZFF B;  4CZS A;  3WLU A;  3WNO A;  5C33 A;  2FMY A;  2WNV C;  1UMH A;  4EN9 B;  1ZBA 3;  4XAB A;  2GC0 A;  3O1V A;  1BXH A;  5LWB A;  5A33 A;  3HJR A;  3IWZ A;  2E7T A;  1OBN A;  4PDW A;  5D8A C;  4HKW A;  4CCC A;  3AYD A;  4N43 B;  5A7O A;  4EYU A;  3WW3 A;  3SH3 A;  1RIN A;  4XJA A;  4R9D A;  3K46 A;  5IVF A;  1PVC 1;  4AI2 A;  3LOB A;  2XUE A;  5GLZ A;  1SZB A;  4LE4 A;  3PUA A;  5C9A B;  1R09 2;  4B1M A;  1G86 A;  2Q8C A;  1RUE 1;  3NST A;  3N7K A;  1SBF A;  2ZAB A;  4YFZ A;  5J1X A;  5FAX A;  4NID A;  3OYW B;  4XFF A;  3T09 A;  1DLL A;  1VBB 2;  1T6G C;  4AE2 A;  4AVS A;  2J1T A;  1JHJ A;  3ENR A;  3PVE A;  4LE3 A;  2AZ5 A;  5IK8 A;  1RB8 G;  4MSV A;  1XYO A;  2B46 X;  4R8H A;  3OBT A;  1V00 A;  2RV9 A;  3BOD A;  2X10 A;  4NPR A;  4YG0 A;  3T4H B;  4AFC A;  4WM8 A;  5C8C C;  2FQP A;  1OOP B;  3C7F A;  3HVD A;  1QOO A;  3VDC A;  4YGB A;  1V9U 2;  4B8E A;  4E2Q A;  3UL2 A;  3H8U A;  4BK5 A;  2JKX A;  5EZW A;  4DXZ A;  1REF A;  2WWU A;  3WW1 A;  4BB3 A;  5D2A A;  1H8T A;  3CBN A;  2GH2 A;  4RD7 A;  3ZSM A;  1KFU L;  3TN9 1;  1OLR A;  4K3U A;  2E31 A;  4R9C A;  1NG0 A;  3DXT A;  4UFL A;  2XKO A;  5FZA A;  1NY7 2;  2P6C A;  3E6B A;  2P3Y A;  3R05 A;  3WHU A;  2FDI A;  1QJU 1;  4QDQ A;  5K9Y A;  2PHX A;  5F5A A;  2QDN A;  4K21 A;  2FCU A;  4LA2 A;  1OLM E;  3C7G A;  1UPI A;  1CPN A;  2B8M A;  2XLA A;  3F95 A;  5DAB A;  1Q43 A;  2PFW A;  3CKH A;  3NJY A;  4C1X A;  5KHK A;  3UES A;  1ZBE 1;  3VKN A;  3V64 A;  3FN9 A;  2WO2 A;  2ZGK A;  1R1A 2;  4W8J A;  4I0A A;  3VZK A;  5TSW A;  4O9E A;  4YGE A;  5DN2 A;  3KF3 A;  1W3X A;  5DAW A;  4N9H A;  1EAH 1;  4ZXK A;  2QJV A;  3POY A;  2OS2 A;  3CJI C;  1UIJ A;  4GWJ A;  2JXA A;  1BBT 1;  5FY7 A;  4JHT A;  2GZW A;  3DN7 A;  4NO4 A;  5E6H A;  1XQN A;  3DGT A;  3CHX A;  4AFD A;  3OTF A;  2R04 3;  3S7E A;  4BU2 A;  5FMD A;  1D4M 2;  1RVF 3;  1SLI A;  1OVS A;  2ZEX A;  2VUJ A;  5F32 A;  4Q8K A;  4CDW C;  5LCW L;  5LK5 A;  3WG2 A;  1W9S A;  2QQP A;  2HKX A;  4BZ4 A;  4CCO A;  1QU0 A;  3B00 A;  4XUT A;  4W6Y A;  4DO0 A;  5JZG B;  2BVB A;  3S5A A;  4QQL A;  4PQ9 A;  4XJU A;  3AMH A;  4YVS C;  5JR2 A;  1BJQ A;  2F4P A;  4HVQ A;  1UU5 A;  3EYP A;  1CON A;  1NYW A;  1V6N A;  3JBG 3;  1ZVF A;  1R08 1;  3IKW A;  4R9B A;  2UYB A;  1K5J A;  2GMP A;  2WSU A;  4L9B A;  5FPZ A;  5JIU A;  2DCZ A;  3FE5 A;  5HCA A;  4GQ7 A;  1RXG A;  5F6K A;  5FRE A;  5CFD C;  1W05 A;  2VZV A;  2VM9 A;  2CAU A;  1MR5 A;  3NV3 A;  4LO4 B;  4CUA A;  5ISL A;  3O1M A;  1FPN 2;  4JDO A;  2VMG A;  2BOJ A;  2MEV 3;  2W9X A;  2YXS A;  2DUP A;  4DZG A;  5A6Y A;  1A78 A;  1HDK A;  5F37 A;  4PIX A;  3OPW A;  1AX1 A;  3N4M A;  2D5F A;  3KV4 A;  4EE2 A;  1HJF A;  1BEV 3;  2VVF A;  3EO6 A;  1DQ6 A;  1VP6 A;  4Z82 A;  1ULG A;  3AJZ A;  2YG0 A;  1PIV 3;  3OGR A;  4HT1 T;  2YBK A;  4A7Z A;  4CE8 A;  3MIF A;  3SCG A;  3BUC A;  5FCC A;  2VZU A;  2BV4 A;  1FXZ A;  3BYW A;  1JYX A;  3E1F 1;  2R32 A;  2UYA A;  1O8S A;  1N3O A;  2DU0 A;  2PXJ A;  3IM0 A;  4HK9 A;  4MXV A;  4OHX A;  4XCB A;  3G6J B;  3AMM A;  4URA A;  1YI7 A;  1AR9 1;  1S0C A;  3FX3 A;  3VBO C;  3VKL A;  5F2W A;  4EWA A;  4CCD A;  5J48 A;  2R06 3;  2ZTN A;  2R1D A;  4QX2 A;  1UY0 A;  1AZD A;  3J9S A;  3ZSL A;  4PHZ A;  1POV 1;  1ND2 B;  1NE4 A;  1RUJ 1;  2P5B A;  1MAC A;  1S4C A;  2VZT A;  2ET7 A;  4TSV A;  3PL0 A;  1PM7 A;  1V6M A;  3K4D A;  4GH4 B;  1IOA A;  4YFW A;  2Q8D A;  5AC9 1;  4FTB A;  3HQU A;  3DXU A;  1ZRI A;  4RYD A;  4ZZ5 A;  2RS3 2;  4P08 A;  1YCI A;  3W5M A;  5FYB A;  4OHY A;  3DPR C;  4CDX B;  1LOC A;  4YVW A;  4QQP A;  4RN5 A;  1FOD 3;  5KXC A;  1X9P A;  2AUY A;  1HRI 2;  4AFB A;  5BY5 A;  4DQA A;  5BNN B;  2ID4 A;  2VH9 A;  4J6G A;  4Z2W A;  2BGC A;  5EJZ B;  4AW7 A;  5DDJ 3;  2VQ0 A;  4A44 A;  3GJB A;  2CY6 A;  2HEV F;  3ILR A;  3PLQ A;  4OHV A;  3Q8C A;  3ZFG B;  1UU6 A;  1YEW A;  5FXZ A;  1YQ8 A;  3T4V A;  1SLB A;  4XUP A;  3V0A A;  3D0S A;  2BQP A;  4KH9 A;  4QX8 A;  5C8W A;  2W46 A;  2FD8 A;  3RRD A;  1OFS A;  3O7O A;  1I5Z A;  3UNP A;  3ZOI A;  4MGZ E;  4QPG C;  2BFU L;  1YYN A;  1KGY A;  2Q1F A;  4DS0 A;  3V0B B;  3NNM A;  3HBK A;  1VRH 1;  4JC1 A;  3ON7 A;  1CWP A;  3J8F 1;  5JXJ A;  4WM7 C;  4C8D A;  3IZO A;  1OF4 A;  3BIW E;  2ARB A;  3SMH A;  3PJY A;  3VKM A;  2ZHN A;  1OH4 A;  3J7N A;  1RHI 1;  3CQO A;  3PJQ A;  1COV 2;  1WCK A;  4JGY B;  5FZD A;  3VBS B;  5CAZ A;  2BVV A;  3LA2 A;  3L9J T;  1UZW A;  4HL0 A;  1AX0 A;  3BOW A;  5FMO S;  1H9W A;  4G4F A;  1QOS A;  5FPB A;  4MG2 A;  5JMC A;  1ULC A;  2WS9 3;  1PO1 1;  3DUI A;  5FR3 A;  1FMD 2;  4P5H A;  4QU2 A;  1J1L A;  1FI2 A;  1RUH 1;  2OYZ A;  1I3H A;  3UGG A;  2R1B A;  3IDC B;  2DCJ A;  3NNG A;  3UYJ A;  3PVO A;  5DZE A;  3GZA A;  3W5N A;  3H3L A;  1RMU 1;  1LEC A;  4CXW A;  2CGO A;  4RGK A;  4Y26 A;  4XJZ A;  3N9M A;  4NII A;  2GNB A;  1UY2 A;  2QZ2 A;  3MGU A;  4SBV A;  5FYZ A;  1ZNP A;  2PTM A;  5ABJ A;  3HNM A;  4YG6 A;  1XU1 A;  4LQR A;  1Z0H A;  4JRA A;  5K0U C;  5ACA 1;  4CU9 A;  2A70 A;  2QVS B;  2LRP A;  3D82 A;  4LO6 B;  1BBT 2;  3NAP B;  4CEY B;  1LES A;  4QHB A;  4E8C A;  4COW A;  4Q4V 3;  1CAX A;  1DGR A;  1DU3 D;  2NYY A;  2VPV A;  3S7I A;  3U0Z A;  4AI3 A;  3EHK A;  1ULO A;  5HV0 A;  1ZBA 2;  3ZIX A;  4M4R A;  1VBD 1;  1TME 3;  4R4Z A;  5KWR A;  3TNQ A;  4H14 A;  4N8M A;  3V56 A;  3FUO A;  3O1S A;  2VNR A;  4NWW A;  5L19 A;  4P9G A;  3BTX A;  1G9F A;  3RS6 A;  1JZ7 A;  4K1Z A;  1JOD A;  3L2Y A;  1SAC A;  4D6S A;  2Z5W A;  2ZGU A;  1HXS 1;  2VY0 A;  2NLR A;  4Q4W 1;  1PMH X;  4QQO A;  2YFZ A;  2W92 A;  3KGZ A;  3VN4 A;  1ASJ 3;  1KXG A;  4B4R A;  2JE9 A;  3RYR A;  1NE6 A;  2EXI A;  4XOG A;  4XCA A;  1MS4 A;  3AL5 A;  3ORJ A;  2D6K A;  4YG3 A;  4OFG A;  5D21 A;  5T5O A;  1QWR A;  4DXR A;  4C90 A;  1OUX A;  4FPC A;  5HCF A;  2OUH A;  4ATF A;  2XVG A;  2X5I B;  1AR8 3;  4YW7 A;  4NAO A;  3NJX A;  2GC3 A;  3AJY A;  1H30 A;  2B45 X;  3O0V A;  2HWC 3;  3ACL A;  3CJI A;  1OA2 A;  3ELN A;  3GBW A;  2D97 A;  2G1M A;  3D3A A;  1F4H A;  2BNN A;  2HWF 1;  5IHR A;  5JDB A;  1XNK A;  2CAV A;  3U78 A;  3VHP A;  1MS3 A;  1FV3 A;  4LO5 B;  2WYF A;  4L92 A;  1YIP A;  3GZU C;  5DAV A;  4CDW A;  3HNB M;  1C8M 3;  4TZD A;  3DV8 A;  3NV4 A;  2RMU 1;  1UWW A;  1EV1 1;  4IV3 C;  3AC0 A;  2BRT A;  3URF A;  5C3O A;  3AYE A;  1JYC A;  1RUF 3;  1GZC A;  1H1A A;  3QOP A;  4M00 A;  5GLU A;  1UZZ A;  1AR9 2;  4WVM A;  2E7Q A;  3LA7 A;  4CDQ B;  1RIT A;  1ULD A;  1O4Z A;  4XFC A;  3CF6 E;  3KHB A;  1PMI A;  1TMF 1;  4XUO A;  5GZF A;  3ASI A;  2RM2 3;  3EMR A;  1HW5 A;  1NA1 B;  2GC2 A;  3PUR A;  3EBR A;  3OY8 A;  1LTE A;  3B9I A;  4XF9 A;  2A3Y A;  1AR7 2;  5FOB B;  3NQH A;  1WBL A;  2K2S A;  5FYI A;  3PMS A;  3OGG A;  1JZ5 A;  5ERL A;  5EWS A;  2Y6H A;  4QX5 A;  3KQR A;  3WQ1 A;  1S0G A;  1TQ5 A;  5E8A A;  3LA3 A;  5FK8 A;  1ULE A;  3CZJ A;  5FWJ A;  3ZFE A;  4XZU G;  3OGV A;  2VCA A;  1M06 G;  4LUK A;  3BTY A;  1JOB A;  2YBS A;  4IE6 A;  1XNT A;  1DQ4 A;  3U4S A;  3WVJ A;  4Y4Y A;  2IVI B;  2J1U A;  1SCR A;  2QFE A;  1LOD A;  1UY3 A;  3JD7 3;  5FZH A;  4CDU A;  1W6O B;  4IEW A;  3VBS A;  1GNH A;  4GKX A;  3BCW A;  1Y3T A;  3S57 A;  1W3V A;  3F2Z A;  2D93 A;  4QM8 A;  2R30 A;  3S6P A;  2G9F A;  2ZGM A;  3MW3 A;  2TUN A;  2H0B A;  1RVF 2;  3D8C A;  4I3G A;  1QKQ A;  1U12 A;  3FC0 A;  1OUS A;  1UNB A;  2PQQ A;  3WZ1 A;  2LM3 A;  1OF3 A;  2W5F A;  1B35 A;  2D98 A;  1MZ6 A;  2RS1 1;  4FPJ A;  1Q3E A;  2FDG A;  1IS3 A;  4AQ6 A;  2RG4 A;  4LLO A;  3ZYP A;  1H4G A;  3MHZ A;  4LNV A;  3J8F 2;  3WF3 A;  4GMP 3;  2HWB 3;  2RS5 3;  3JBG 2;  4LKF A;  3X29 B;  2XML A;  4OVE A;  4IEP A;  4RS5 C;  5A7S A;  4DUW A;  2YPD A;  2XON A;  1W6M B;  1YRZ A;  3VZL A;  3WDW A;  3LF7 A;  4QQ2 A;  2DBN A;  3LSD A;  3I97 A;  1AL2 3;  5FUP A;  1SHW B;  4DY3 A;  1CZS A;  1T2X A;  2XLG A;  3K51 A;  4AVT A;  4CEY A;  1ENQ A;  3BIE A;  3PIG A;  1NLQ A;  2HWD 3;  2MEV 2;  5GKA C;  5A3L A;  2EIG A;  3ACF A;  5F3C A;  5J09 A;  1UY4 A;  1DYP A;  2BNM A;  3ZO0 B;  2HYK A;  1RJ8 A;  2XBO 1;  2ZX1 A;  3OBR A;  4HKO A;  4MGI E;  5A7W B;  3WNP A;  4COY A;  3U4X A;  4M4P A;  1MS1 A;  1PGW 2;  3HOB A;  4JTO A;  3I7D A;  3I4I A;  2GNT A;  3IMN A;  5L7O C;  4MGT A;  2GNM A;  4M0N A;  1RUI 2;  2JDH A;  2WFF 3;  4BJ0 A;  1PIV 2;  1PGL 2;  5FKC A;  5IVV A;  2VNO A;  2B9U A;  2GN3 A;  3UKN A;  1IG0 A;  1UQX A;  4NRM A;  4GJZ A;  4UW4 A;  1K42 A;  3RJ2 X;  1YWK A;  1K5M C;  2WZR 1;  4HKL A;  4E2S A;  5GZC A;  4NHK A;  1C5I A;  1VBB 3;  4QD2 A;  3VB9 A;  2Y60 A;  1LOF C;  1W6Q A;  4MLO A;  3WF2 A;  5FYM A;  5FJK A;  1GYK A;  3POJ A;  3JB8 A;  5CKM A;  2ILM A;  1S2B A;  4F7Z A;  5LEK A;  4YM2 A;  4XFA A;  3H50 A;  1LJ7 A;  2OXB A;  1UF2 C;  5A3O A;  1CAU B;  4RL7 A;  1L3J A;  3HN1 A;  3WUC A;  1UOB A;  5A3W A;  1BHG A;  4E9K A;  2OZ6 A;  4FPK A;  5HXM A;  1BZW A;  1UIK A;  3N3H A;  5JI9 A;  2ZS6 B;  5DZF A;  3M70 A;  2WNU B;  1FOD 2;  4Y1V A;  3ZYG A;  1XU2 A;  3LCP A;  1WCD J;  4I0W B;  1R64 A;  3W20 A;  4A45 A;  4PDW C;  2DVG A;  4DUX A;  3M3E A;  2ZGL A;  4YGD A;  3ZSE A;  4JV4 A;  5I0S A;  4UFK A;  4PLO A;  2IXH A;  3HQX A;  4IUG A;  1XNA A;  4LLF A;  1JTZ X;  2RDN A;  3H8O A;  1ENS A;  1VAK A;  2D6M A;  1OQE A;  3J7M A;  3ZYJ B;  2JDA A;  4KGQ A;  1NKG A;  4IEU A;  1JW6 A;  1WMF A;  4DIN B;  2BEO A;  2WUH A;  4V1P A;  2HWF 2;  4Q1P A;  3SNM A;  1NA1 A;  5LA0 A;  2WII B;  1GOH A;  3ZMO A;  2QZ3 A;  5FZC A;  5FYY A;  3VLB B;  1YFX A;  1OQD A;  2LW8 A;  2W39 A;  2CWS A;  4E4S A;  3M8L A;  1WW7 A;  5DAP A;  1AUY A;  4QXB A;  3DF0 A;  3WCS A;  3S5Q A;  3MIE A;  4YZ5 A;  2VUD A;  4IV1 A;  3LEG A;  2DVB A;  2XVL A;  4OZX A;  4JTN A;  3Q8F A;  3BPZ A;  4AED A;  3OOX A;  4LO8 A;  1NCR B;  4WM8 C;  3IPV A;  3LE0 A;  5GLV A;  1G9A A;  1PO2 1;  1D4M 3;  1TMF 2;  5L9V A;  4FSJ A;  2HBU A;  3C3V A;  3PVB B;  2JJ6 A;  3KT7 A;  1V6J A;  2VOT A;  3OPT A;  3THC A;  3WV6 A;  1W8H A;  4OLL A;  1H8T C;  2ET1 A;  1UMI A;  1W99 A;  2BTV C;  2P17 A;  1Q8P A;  1GP6 A;  1RUC 3;  1LR5 A;  3FWE A;  4XHB A;  5CZK A;  1B09 A;  1SQ4 A;  3ZM8 A;  4AI9 A;  4P9J A;  4Y24 A;  1ND3 B;  1UW8 A;  2BOI A;  5F3G A;  1LEN A;  2ZEY A;  3IIA A;  3VDD B;  2CGP A;  2XUM A;  2WZE A;  2O0O A;  1XSQ A;  5APA A;  2D6N A;  5L9B A;  3T3Y A;  3UGF A;  3W58 A;  5LY2 A;  3ZVX A;  1SCS A;  4NPL A;  5A3N A;  4COZ A;  2YGM A;  1FNZ A;  1LU1 A;  1W6M A;  4CTE A;  4OUS A;  5C71 A;  3U11 A;  4Q0V A;  1J3Q A;  2VMF A;  1CZV A;  1LCL A;  3ZYR A;  4HON A;  2TNF A;  1QNY A;  3PUH A;  1KJL A;  2VUL A;  5FPX A;  4XVH A;  1C1F A;  2JEN A;  4ITC A;  4D7S A;  2VVE A;  2F6B A;  4GB3 2;  2RS1 2;  2WQ8 A;  1GZT A;  1TZO A;  2ARA A;  3PUQ A;  4UFJ A;  5FY8 A;  3JZV A;  5GLW A;  1J59 A;  3KD4 A;  3WNK A;  1JS9 A;  3ZN6 B;  1SPP A;  1L7R A;  5LK7 B;  4QKN A;  4XMA A;  2O8Q A;  3I59 A;  4S2F A;  5FPA A;  3HAG A;  3SIS A;  1JYN A;  1WCQ A;  3Q9O A;  2A7A A;  2WAB A;  4XPV A;  3ZYI B;  3KV5 A;  3RZL A;  2CDP A;  4K8F A;  1SBE A;  1WA4 A;  3TEY A;  4NWV A;  1HB4 A;  3NKG A;  2D5H A;  3USS A;  4CP1 A;  1AR8 2;  5FPU A;  1W6P A;  5BNO B;  1QJY 1;  4HSL A;  5FZG A;  1RXF A;  2I07 B;  3A22 A;  1JH5 A;  1OI6 A;  3AB0 A;  1N1Y A;  4ARX A;  4LUM A;  1PVC 3;  4OHZ A;  1DQ0 A;  3R6S A;  4O65 A;  3VBH B;  1MEC 2;  2ZGQ A;  4QPI A;  3B9C A;  1RUE 3;  3LKJ A;  3ZFF C;  3GZT B;  1MPX A;  2VME A;  2IFR A;  4ORF A;  2LAL A;  1NXD 1;  2DCT A;  3H3Z A;  2WNU A;  3BB6 A;  4K9S A;  4RR3 B;  4TTG A;  3A4U A;  4IE5 A;  4XQ4 A;  3WD5 A;  1PM4 A;  3FHA A;  4QX0 A;  3RQ0 A;  1O3S A;  3SEE A;  3MDP A;  1YJL A;  3KT4 A;  4PI2 A;  1AR6 1;  1QDO A;  2CDO A;  1UYX A;  1RUG 1;  5BNQ A;  1OFN A;  4QKF A;  4RGA A;  3IN9 A;  2Y38 A;  1WLC A;  5I8S A;  3WP6 A;  4DUV A;  2ZMN A;  4XDP A;  2VTX J;  1JZ4 A;  1LHU A;  4QT6 A;  4Q4Y 1;  4QGM A;  5DXD A;  4OQ9 A;  2FDK A;  2Y6L A;  1XSR A;  4LOT A;  3GJA A;  3WSO A;  1PX4 A;  3RZJ A;  3ZPO A;  4AR2 A;  2JG8 B;  5FZI A;  5H9S A;  4BK4 A;  2VMH A;  1NCQ B;  2HLE A;  5C3S A;  1QJU 3;  4HLT A;  3ZKU A;  3HWJ A;  3WHT A;  5JAX A;  3POS A;  4MUV A;  1YNA A;  2GC1 A;  5FZ0 A;  2NP0 A;  3OJB A;  2VCM A;  1FMD 3;  3TB0 A;  4NR1 A;  1QXR A;  2VNV A;  2VUC A;  4KG8 A;  4P9X A;  4E4Z A;  2WN2 A;  4Z07 A;  2W87 A;  3ZKY A;  1RL3 A;  4YVW C;  4LBL A;  4MET A;  4FI9 A;  5DUX A;  1ZBE 3;  4I0B A;  2ATF A;  4HMZ A;  2G9Z A;  5FOJ B;  1TG7 A;  1WME A;  1GOF A;  4Q4X 1;  4PBP A;  1W03 A;  3H1W A;  2JE7 A;  3WT3 A;  1XPW A;  3RZG A;  2ADE A;  4CP0 A;  2VMI A;  1QDC A;  2WZP P;  1MZF A;  2C4X A;  2I74 A;  5LB6 A;  5CFC B;  2CYF A;  1J84 A;  2RDS A;  4UXA A;  1OLQ A;  2A6Y A;  3SH5 A;  4CUB A;  2HWB 2;  1BBT 3;  1JMU B;  2VJX A;  1UX6 A;  2ZHK A;  1ND3 A;  4F3J A;  3AKQ A;  2XJQ A;  4XFG A;  4KG0 A;  3B02 A;  3MIH A;  1AL2 2;  4O7X A;  1PO2 2;  1W6N A;  1Z78 A;  1XNB A;  1DGR N;  2XQR A;  5T50 A;  5AVA A;  2R0H A;  1O3Q A;  2HWD 2;  4K7J A;  4UBH A;  2WAO A;  3IB3 A;  5IW0 A;  2WA3 A;  3T2Q A;  2P34 A;  3USU B;  2XLF A;  4H55 A;  4DOU A;  2UY9 A;  4Q0P A;  5LA2 A;  4BH9 A;  4BLI A;  4CYD A;  2Q30 A;  3H42 B;  1V6I A;  3D6E A;  2VXR A;  3JUU A;  2QE3 A;  5IVJ A;  2WFF 2;  3AVS A;  1TE1 B;  1H1I A;  4AFM A;  2GND A;  2GAU A;  2EAA A;  5FK7 A;  2NMN A;  1CJP A;  2QQL A;  2WO3 A;  3MLJ A;  4EWE A;  1IS5 A;  5FYC A;  3WDU A;  2E6V A;  1V70 A;  4S2H A;  5BNP A;  1DF0 A;  5FZB A;  1SMV A;  1S0E A;  1Y9M A;  4LEJ A;  3U1X A;  1EP0 A;  2C5D A;  1ODM A;  5L36 A;  2ZBJ A;  4LA3 A;  3WQB A;  5ABJ C;  2YC4 A;  1WD3 A;  2IXI A;  2GMM A;  1XOY A;  1EUT A;  1AYM 1;  4G3Y C;  2H6B A;  3POG A;  1RJ7 A;  5DMY A;  1L7Q A;  3AZY A;  1BYH A;  5E16 A;  2D43 A;  3Q8A A;  1QXJ A;  4Y1U A;  3TOJ A;  2GAL A;  3VBU A;  2E33 A;  1N3P A;  3A7Q A;  1MS8 A;  3H3U A;  3K3O A;  1DFQ A;  4JX0 A;  2FZ2 A;  1GMM A;  3TEW A;  1AR9 3;  4IQP A;  2VOX A;  3PU8 A;  5L73 A;  1ZZC A;  2BP6 A;  3M3C A;  4MVT A;  4A3Z A;  1WCS A;  1DQ5 A;  2H6C A;  2X05 A;  1FAT A;  4KL1 A;  2A75 A;  3J7H A;  4IE0 A;  4XBL A;  1POV 3;  3ACH A;  4YPJ A;  4OZO A;  3C7O A;  4LKE A;  1OD5 A;  4JAA A;  1KEX A;  5H9R A;  1MQT A;  1HIX A;  4N9I A;  3ZDV A;  4J1X A;  4BDV B;  1AR7 3;  4XUN A;  3ALQ A;  3VDA A;  5GZD A;  3WDX A;  4Y5T A;  3PIJ A;  5J3U A;  1EUU A;  5J36 A;  4YM0 A;  1K12 A;  2UY8 A;  4AXO A;  1CAV B;  3VHR A;  2PAM A;  3MV0 1;  4BPZ A;  5IAX A;  1V0A A;  4JGZ B;  5A1A A;  4JKL A;  1BMV 1;  3EXU A;  4QPW A;  3RZH A;  3QBQ A;  4Z2A A;  2XG3 A;  5J98 B;  2VOW A;  1AX2 A;  4YAR A;  4LBJ A;  1H1M A;  4C1W A;  1GIC A;  4LIT A;  1VBE 1;  4A6S A;  2WNV B;  1POQ A;  4AGR A;  3VD4 A;  4HOO A;  3LB9 A;  5FFO C;  1CVN A;  4NVP A;  1XBF A;  3KHC A;  4XAC A;  2OUJ A;  1XND A;  2WBK A;  3AKT A;  5C70 A;  1JYI A;  3RMX A;  5H9Q A;  3AK0 A;  4HVR A;  2ZHL A;  4GH4 C;  3JB4 C;  5FZM A;  1HX6 A;  4PIY A;  3VBR B;  4BA6 A;  3ZXJ A;  1X33 A;  3MPB A;  4GAZ A;  3UKT A;  3N36 A;  4W4Z A;  4CDX C;  4MO3 M;  5FZ6 A;  3TNP B;  1JYW A;  2JIG A;  5FO7 B;  4Q4Y 2;  1RUC 2;  4JQT A;  3J8F 3;  4AFA A;  3V0A B;  3OCP A;  2PEL A;  1GZW B;  4A41 A;  5IVB A;  4GJY A;  1KFX L;  1PNG A;  2Q1M A;  3N9N A;  3ZYF A;  1X82 A;  1LOG A;  1YFY A;  2JG9 A;  4FP3 A;  1S0D A;  4S2G A;  3WQ0 A;  5A3T A;  2XJR A;  4E2G A;  1O4Y A;  4X6Q B;  3BPS A;  4AQT A;  2JD9 A;  2A6W A;  2OII A;  1LGC A;  2PHD A;  3MLK A;  2Z42 A;  4QXC A;  4UAP A;  3I2J A;  5CG8 A;  2V73 A;  3AMQ A;  4MXW B;  4Y1Y A;  3VZJ A;  3ZFF A;  4CCN A;  1RUH 3;  5C5T A;  3AKR A;  4PCR A;  3LOI A;  1QJX 1;  3NWK A;  4N90 A;  2JX9 A;  3N7M A;  4RHV 1;  2GP5 A;  4CCK A;  5C8C B;  4YW5 A;  4OI0 A;  2JB8 A;  4P9Y A;  1ZZ7 A;  4PI0 A;  4M3C E;  3ZFE C;  4MGQ A;  4QQH A;  2AYH A;  3IAP A;  5FRA A;  1GWL A;  1OMI A;  1RUI 3;  3BN6 A;  4N43 A;  3VBF B;  1AYN 1;  4AVB A;  1JHN A;  3NV1 A;  4AI8 A;  3USU A;  3WG3 A;  1H4H A;  5ACA 3;  1GQP A;  4CDU C;  1RUD 1;  3VBS C;  2L9L A;  2KD7 A;  1QQP 1;  2QKD A;  3ZPY A;  3MF9 A;  5C9A A;  3POI A;  4MZU A;  4XFH A;  3AX4 A;  4MV2 A;  3BVC A;  2YU2 A;  4D3W A;  2Z69 A;  4L11 A;  4BMB A;  3OYW A;  2IUW A;  1W2U A;  1VBD 3;  4Y5Z 0;  2PAE A;  4LKS A;  2D6L X;  5FZE A;  4E27 A;  1B35 C;  2JKB A;  4LBQ B;  5KR7 A;  1Y43 B;  4XIO A;  5FZO B;  1OXC A;  1WWY A;  1UZY A;  5LBF A;  2PQS A;  1HLC A;  4K20 A;  3R4U A;  2EID A;  5FO9 B;  1H2M A;  4COV A;  3PTY A;  2H0V A;  1UOG A;  1VR3 A;  2XJS A;  1PVC 2;  3VGI A;  3KCY A;  4LUL A;  1OOP A;  4FFH A;  1HQL A;  1HXS 3;  5I0T A;  4DNY A;  3R4S A;  4QB6 A;  5AFE A;  1PVX A;  1W9W A;  3KQ4 B;  5A7P A;  1RUE 2;  2KA3 A;  4K8R B;  4YW1 A;  4CEY C;  3ILF A;  1F2N A;  2XHK A;  5FZK A;  4B4P A;  1PX3 A;  2ZMK A;  3KV6 A;  1GOG A;  3I2I A;  4HSJ A;  4BQ5 A;  2VC9 A;  5HXV A;  4CUG A;  3LAG A;  1VBC 1;  2J1A A;  1UN1 A;  4GAL A;  4P9L A;  4QHO A;  5FZL A;  2WYS A;  5A3U A;  4YLZ A;  4YW6 A;  1W2T A;  1QY4 A;  2HWF 3;  3M4F A;  3RI8 A;  4QAW A;  1LNS A;  1SDW A;  5A32 B;  4YVS B;  5LBE A;  2QQN A;  3WY6 A;  2RHP A;  3WDT A;  3UV9 A;  1OD3 A;  2W1U A;  2ZKL A;  1FNY A;  2XJP A;  2RMU 3;  1EV1 3;  4ERO A;  5JCT A;  2WL1 A;  1W8N A;  1JOJ A;  1W2A X;  1UXZ A;  2PHR A;  3TN9 2;  1YXW A;  4IE7 A;  5J96 B;  1F4A A;  4JGZ A;  5CFD B;  2QQO A;  3DYP A;  3CEW A;  4I02 A;  2UWC A;  3E6D A;  2Z79 A;  4F83 A;  3CU7 A;  1QJU 2;  4MYE A;  2R04 1;  5T3N A;  1TMF 3;  5CBL A;  1EPZ A;  2IVJ A;  4KNC A;  2LS6 A;  4CP9 B;  2IFW A;  2VU9 A;  4LOS A;  1W8W A;  2ZX2 A;  2HEY F;  2K0G A;  1VBA 1;  1VRB A;  5DPN A;  2VGD A;  4NJ4 A;  3WQ7 A;  3SHR A;  1CN1 A;  1WLT A;  2ZEW A;  5KC5 A;  1CQ9 A;  5LBC A;  4XJ9 A;  1ZBE 2;  3NNL A;  2RR1 1;  4RFR B;  1UZ0 A;  1Y7B A;  4H2A A;  4Y20 B;  3SQO A;  2YUE A;  3DYO A;  3M2M A;  4XTM A;  5FV3 A;  5JZG A;  3B94 A;  1JZ3 A;  5F3E A;  3H1Y A;  2WO7 A;  1YQ2 A;  1AXZ A;  5FJH A;  4GIQ A;  4AYU A;  2WIN B;  1VB4 A;  1EAH 2;  4C91 A;  3CL1 A;  3VBO B;  5F9T A;  5I91 A;  3PVN A;  4LBO A;  1JUI A;  2ZPX A;  1QGL A;  4CCE A;  3FHQ A;  1NA1 C;  3WUD A;  1BEV 1;  1SFY A;  3LDB A;  1K45 A;  4RQP B;  3P3N A;  1X9T A;  2AEY A;  4TXW A;  3KZ4 C;  3SCF A;  3TYJ A;  3I2G A;  3LZZ A;  4K40 A;  4QMA A;  4EN7 B;  4V2V A;  5JSO A;  1UKR A;  2F4L A;  4XHX A;  4ES8 A;  2RJK A;  3AP6 A;  4S2D A;  4C0B A;  4C0H A;  4IV1 C;  1F9K A;  4GB3 3;  2IZW A;  2RS1 3;  4AG4 A;  3S0M A;  5LW9 A;  4JCK A;  4FQZ A;  5FZ1 A;  4CPB A;  5HV4 A;  4NUB A;  4AED C;  4HET A;  4XF4 A;  4A6O A;  2BBA A;  4YNI A;  1R08 2;  4XBQ A;  3AP4 A;  1LOB A;  4Q5O A;  5IAV A;  2GSY A;  5FYT A;  1Q8O A;  2XPJ A;  2JE8 A;  2D6O X;  2UWA A;  3H7J A;  2Q5T A;  1NX9 A;  4XYX A;  3HIF A;  3ZYB A;  5FY1 A;  4B3N A;  1Z7S 1;  4WVW A;  3RVH A;  2B42 B;  4BYY A;  3AYC A;  3D5O A;  3GDB A;  4MGY E;  4FQ4 A;  2DV9 A;  2UUR A;  4Q0S A;  2XBO 3;  3I3B A;  2J1R A;  4QPG B;  4UF0 B;  4UOJ A;  2P3J A;  2YZ4 A;  1H0B A;  1DZR A;  1XC6 A;  3U37 A;  1A6C A;  1QNW A;  2ARC A;  4Z8B A;  3NW4 A;  4CA9 A;  2VO5 A;  4QXK A;  3POE A;  1QJZ A;  1MEC 3;  1ND2 A;  1MS9 A;  2ORX A;  3KVB A;  3AZZ A;  1D7P M;  1H2N A;  2E51 A;  2FDJ A;  2LUW A;  2WR9 A;  3OBA A;  4GH4 A;  5C5U A;  2ZKN A;  2ZGP A;  1NUK A;  3FUQ A;  3N7J A;  3TWI A;  1JOP A;  2WZR 3;  1GU3 A;  4KWK A;  4MHR A;  5DDJ 1;  5EIY B;  3SC7 X;  2GH8 A;  4KWJ A;  4CDX A;  2HEW F;  5C3P A;  3TEZ A;  5FTT C;  5FLJ A;  2W1S A;  4PF1 A;  4Y33 A;  4DEQ A;  1O3T A;  1VAL A;  5IYY A;  1LRH A;  2W95 A;  4PJY A;  3R4D B;  2DF7 A;  3SKJ E;  5BNN A;  2EAL A;  2JEC A;  3DYM A;  2WZ8 A;  3OUI A;  4IL7 A;  2BJS A;  5FXW A;  2XH6 A;  3ZR6 A;  2JB4 A;  2A6Z A;  2YHJ A;  2BZD A;  4JKM A;  1RUJ 2;  3ZFG A;  1W90 A;  1UYP A;  4ARY A;  2WFP A;  2AAC A;  5AC9 2;  2VCB A;  3O14 A;  1C4R A;  1W0P A;  2BWC A;  2Z2S B;  3VZN A;  2WT2 A;  4AEM A;  3BAL A;  3E5X A;  2VE1 A;  2C0Z A;  3J4U H;  3PME A;  2RDR A;  3LFI A;  2P3K A;  5K0U B;  4GZ9 A;  2AH2 A;  4FXG B;  1CAW B;  3V0B A;  5C4W B;  5LBB A;  3WDY A;  2D7F A;  1RED A;  5F5Q A;  2WRA A;  5E1R A;  5GM0 A;  1F31 A;  3LEK A;  4BXS V;  3SKV A;  4UW5 A;  5GJ6 A;  1PK6 B;  4M01 A;  3LPF A;  4ZS2 A;  3B7M A;  1UOJ A;  4JGY A;  5CIS A;  5FZF A;  4XDQ A;  3VHO A;  1N1T A;  4BIO A;  2ZEZ A;  4ISQ A;  2JDP A;  5FIX A;  3VD5 A;  5A6X A;  2UWB A;  4QPI C;  4P9I A;  5IK4 A;  4AI1 A;  4CP9 A;  4ZKT B;  4B29 A;  1MVE A;  2D6P A;  1YC6 1;  2OZJ A;  5CIR A;  1OUR A;  4UI9 L;  3VKO A;  5JSP A;  1F8V A;  1VRH 2;  2WNU C;  2Q0A A;  4AHW A;  2RVA A;  4QDR A;  3GAL A;  3MID A;  1WLD A;  4KBB A;  1C57 A;  3H1M A;  4YW3 A;  3AL6 A;  1S0J A;  1RHI 2;  2FCV A;  2NQY A;  1ZA4 A;  4HK8 A;  4AQ2 A;  2VOK A;  1PO2 3;  3WG4 A;  1TME 1;  2ETE A;  1IPK A;  5DAX A;  1V6O A;  2ZGN A;  1PO1 2;  3NAP A;  4LBN A;  4KBZ A;  1RUH 2;  4IE4 A;  4XXA A;  2VZO A;  2GN7 A;  3LFM A;  1RMU 2;  2B39 A;  2AC1 A;  3JXS A;  3FJS A;  4X6R B;  4CPB D;  1S0B A;  5I0R A;  5JSR A;  3WP4 A;  3MO4 A;  4XQD A;  1H2K A;  4D8M A;  2Y0O A;  3BGA A;  1QOT A;  5IAT A;  5ACA 2;  4YW2 A;  2KXL A;  4X8P A;  2C1F A;  3GCW A;  1GNZ A;  5EJ3 A;  4ZPI A;  4L2N A;  1YIF A;  4ZXE A;  3CMG A;  3KT1 A;  4Q1R A;  3ZXF A;  1O91 A;  3BOP A;  1HRV 1;  1VIW B;  2DVF A;  2WT1 A;  2CU5 A;  3N35 A;  1NLR A;  1QMJ A;  1VBD 2;  2PMW B;  2WLP A;  3LEM A;  2PLV 1;  2X5I A;  3RZZ A;  3J7L A;  1UXX X;  3M7A A;  3VL8 A;  4D0Q A;  2J22 A;  1U5Z A;  2BW8 A;  1ND3 C;  2FHR A;  1C8M 1;  3MIG A;  3N9Q A;  5G05 L;  3VZM A;  1CX1 A;  3TAY A;  1GP5 A;  1VPH A;  1W8T A;  1HXS 2;  3PUS A;  4Q4W 2;  2OKX A;  1RUO A;  2WO1 A;  1WZX A;  1E5S A;  1W8U A;  2VW1 A;  3Q8E A;  1KDK A;  2QQK A;  3GZE A;  4B7K A;  4ZHN A;  4FTE A;  3MYX A;  3O1T A;  1W9T A;  1W8Z A;  2Y33 A;  5FQ0 B;  4Q8L A;  2QQJ A;  1DLC A;  4FPL A;  1Z7S 2;  5A7N A;  2QQU A;  3C2U A;  3GYD A;  4NAM A;  4PLM A;  2F17 A;  4CDQ A;  4XC9 A;  4EJR A;  4NN0 A;  1HN1 A;  4I2O A;  2VZ3 A;  4IXL A;  2BFU S;  1CIY A;  4XF0 A;  2OT7 A;  1KS4 A;  5H9P A;  3RI9 A;  2VAU A;  1ZRF A;  5CAD A;  1VAV A;  1E57 A;  1G6N A;  2KR2 A;  4PBO A;  4PIZ A;  4LT5 A;  4YGC A;  5FMB A;  5G04 L;  4Y22 B;  4O9G A;  1O8P A;  2EXH A;  2PAK A;  1Y9G A;  1OHF A;  3DCQ A;  1HB3 A;  4RS5 B;  5BNP C;  2GU9 A;  3VD7 A;  3OG2 A;  2RMU 2;  3NJZ A;  1EV1 2;  3THP A;  4BIF A;  4M3C F;  1WD4 A;  1AJO A;  1IPJ A;  2QCS B;  3LDK A;  4AF9 A;  5JXG A;  3I2D A;  3MIB A;  4IEO A;  1CAW A;  2DBI A;  2VR4 A;  4H3W A;  4LHK A;  2BWA A;  5C4W A;  3SEP A;  5M0T A;  1TEI A;  2EIB A;  2XB6 C;  3RSJ A;  2ZX3 A;  1IHM A;  2MHF A;  4FPG A;  1AR6 3;  3I8T A;  1OQ1 A;  3HN3 A;  1RUG 3;  4NOT A;  1GSL A;  1W6O A;  1JU3 A;  4FO9 A;  3VBU C;  1LED A;  1N3Q A;  3ZN4 A;  3MFC A;  5L7O B;  2DFC A;  2YDE A;  4Q4Y 3;  1YHF A;  1UZV A;  2JWP A;  2VMC A;  3R0R A;  4ZU7 A;  1UU4 A;  2RS5 1;  2DCY A;  2A3X A;  2V5D A;  1QIQ A;  1K5M B;  1NT0 A;  1VE0 A;  3ES4 A;  4O61 A;  4E4H A;  1ZZ6 A;  1LGN A;  3Q8B A;  1WMX A;  1XE8 A;  5JPN B;  5FLH A;  3WNM A;  1MQT C;  4P02 B;  3WF4 A;  4A3X A;  4N7I A;  5LY1 A;  3OBZ A;  5CKQ A;  1EY2 A;  1XNC A;  1N47 A;  2ZGS A;  3MZH A;  2NM1 A;  1G7Y A;  2WLQ A;  5DQ0 A;  2ZGO A;  3K77 A;  2D3P A;  1RC6 A;  3FFQ A;  3RNS A;  5FUN A;  1IKQ A;  2IXL A;  4AHZ A;  4CU6 A;  2HYX A;  4I30 A;  5K8S A;  5JXH A;  2ZGT A;  4BQ4 A;  2D3S A;  4UYB A;  1DZQ A;  3KM5 A;  4ZZ8 A;  5KBF A;  5F1R A;  1R09 1;  2ES3 A;  4HVO A;  4W65 A;  5A7W A;  4YZ1 A;  1CJD A;  2XQX A;  1S0I A;  3EQE A;  5B4X A;  1BVP 1;  3LD8 A;  1QHD A;  2V5Y A;  3WEZ A;  3EJK A;  4CU8 A;  4AGG A;  5A33 B;  2UU8 A;  1VBB 1;  4LXL A;  4NHL A;  2A73 B;  3UET A;  4B7E A;  1OT5 A;  3HD8 B;  4IGQ A;  1CR7 A;  1J1T A;  4BQW A;  2A6V A;  4CEW B;  1CD3 G;  3DEC A;  3T0B A;  1YFU A;  5FPL A;  1WLW A;  2W1W A;  3QCW A;  5GLT A;  2G4I A;  4R52 A;  5EPA A;  5T5L A;  4XUR A;  1FX5 A;  1V9U 1;  2SBA A;  1GWM A;  2CWM A;  4IEV A;  4L8Q A;  3T2O A;  1VB2 A;  4M0H A;  2PN5 A;  2XBO 2;  5IFT A;  4LHS A;  4DRV A;  4YSF A;  2J1S A;  4GKY A;  5SV5 A;  2BYV E;  1LHO A;  2D44 A;  3VKF C;  2VOV A;  2JG9 C;  4FVV A;  3O5S A;  1CAU A;  2JD4 A;  3O0X A;  4L99 A;  3M1H A;  3AMP A;  2CV6 A;  2D40 A;  2WN3 A;  2C9K A;  1SLA A;  2VZR A;  2WZR 2;  4XJ8 A;  1JZ6 A;  5FY5 A;  3KB5 A;  3K2O A;  1GNY A;  3ZIW A;  2W08 A;  2JIC A;  4WM8 B;  3P1I A;  3CLP A;  4NHM A;  4CUC A;  2ZAA A;  4KU8 A;  2W1Q A;  1W0O A;  1KD7 A;  3I2K A;  2WSV A;  3FFZ A;  1DZT A;  1WGP A;  1IQA A;  3AP9 A;  4PT6 A;  5DG2 A;  5KHH A;  3JQW A;  2PHL A;  4N43 C;  5JOX A;  2JIJ A;  4CRQ A;  2C26 A;  1GZ9 A;  2QNK A;  5AFB A;  4IGO A;  1A8M A;  3ZX7 A;  5FQ0 A;  4PLN A;  1S2E A;  1XE0 A;  1R1A 1;  1GLH A;  4BWO A;  3ZYH A;  1D4V B;  1H6X A;  1POV 0;  5F6L B;  3WG1 A;  5C9A C;  1GV9 A;  4LJH A;  3OEA A;  3HR9 A;  1YJK A;  3K4A A;  1UCX A;  4XZP A;  5FP3 A;  1PHM A;  3TN9 3;  4YWA A;  4EV0 A;  2V72 A;  5JVV A;  1ZYB A;  4WV8 A;  2W47 A;  4AHY A;  4OMC A;  4BOW A;  3H9A A;  3GM8 A;  2TEP A;  1I5P A;  1D4M 1;  4FBF A;  1F15 A;  5FP9 A;  5FUI A;  1GKB A;  1US2 A;  1NXM A;  2GME A;  2YC2 A;  3III A;  4X8N A;  3W59 A;  2NMO A;  3BU7 A;  2DYC A;  3WNL A;  1NCR A;  1E5I A;  2WQ4 A;  4BCU A;  4BXF A;  3FLR A;  1O5U A;  1OOP C;  1Q8Q A;  3WIN E;  2Q8O A;  2P2K A;  1X8E A;  1T6B X;  1VMJ A;  5EXO A;  3IDE A;  5EYX A;  5CG9 A;  2A71 A;  3B01 A;  3MEP A;  2P3I A;  3GHN A;  2QQW A;  2YU1 A;  2Y26 A;  3ZN5 A;  1ACC A;  4JQR A;  3WNN A;  4RGG A;  2B5H A;  5KXB A;  1A34 A;  2HWE 1;  3EB7 A;  1EAH 3;  3A21 A;  5ANQ A;  4BLJ A;  3OUJ A;  3OEB A;  1VBE 3;  2C24 A;  3BI3 A;  1L7L A;  1KS5 A;  2ZA9 A;  1FPN 1;  5FMO L;  5A1F A;  1ZRE A;  1DDL A;  3LQC A;  3VDD A;  3NRU A;  1FV2 A;  1F5J A;  5FYU A;  2QBX A;  1D0H A;  4I09 A;  3PDQ A;  2O1Q A;  1AXK A;  3O1U A;  5A3M A;  1CES A;  2FCT A;  1UO9 A;  1ZZ8 A;  1ENR A;  1IGO A;  3OPZ A;  5CB7 A;  5BPX A;  2EF6 A;  2YRO A;  4JGZ C;  1DQ1 A;  3I3Q A;  1ULF A;  4IET A;  2XL7 A;  4NIG A;  3POF A;  4UW6 A;  4D7Y A;  1R08 3;  2V4A A;  4OI4 A;  5L9R A;  2FDF A;  1NQJ A;  4MGS A;  5CU1 A;  4LK6 A;  2WAA A;  4Y4R A;  2NZ9 A;  2VZQ A;  3AKP A;  1DG6 A;  3ZN6 A;  4N7U A;  4IEY A;  1UPS A;  3TEX A;  3ETQ A;  3FZ3 A;  4DRR A;  1GP4 A;  2R07 1;  1PMJ X;  1VLN A;  3ILN A;  3N9L A;  3SLI A;  2TBV A;  1QJX 3;  3PUI A;  2DUO A;  3HT1 A;  1QJE A;  2XKP A;  3BTA A;  3NKT A;  4RHV 3;  5T5J A;  3VBR C;  4CEW A;  2X53 S;  2Y6F A;  5C6C A;  5BUV A;  4FXK B;  2NPI A;  5JZG C;  2ZZJ A;  2RS3 1;  4XEZ A;  4MH0 E;  4E4D X;  4G9S B;  3SH4 A;  4IDZ A;  5FYS A;  4BQ2 A;  3I2O A;  1C1L A;  1SDD B;  2CSG A;  4OI2 A;  1AYN 3;  5EFU A;  1HRI 1;  3NO8 A;  1LEM A;  5BNO A;  2FDH A;  4BE3 A;  1OPO A;  3ZXK A;  3VZO A;  3N9P A;  5T5P A;  5IFP A;  1RUD 3;  3DEM A;  4IER A;  1WW6 A;  4ZON A;  1QQP 3;  3VBH A;  4ASM B;  1TNF A;  1S1A A;  1U5I A;  1URX A;  3UKV A;  4JHZ A;  2VD7 A;  3KGL A;  4K1Y A;  1EPW A;  2E26 A;  1VMH A;  4N53 B;  3BU0 A;  1SFP A;  4U2A A;  2DVA A;  2O8O A;  1RUJ 3;  4RR3 A;  4YVW B;  4QKD A;  2ZAH A;  4Q27 A;  5AC9 3;  4ZU4 A;  3IBM A;  5EV7 A;  1PZ9 A;  2RE9 A;  1C5H A;  1QJY 2;  3CIH A;  4GWM A;  1C8N A;  1HQW A;  3MW2 A;  2OX0 A;  2JDN A;  3VBF C;  1W06 A;  5HPO A;  4IES A;  5K4L A;  3ZXG A;  4IEQ A;  1O7F A;  1HV1 A;  3LWC A;  4I3P A;  3VD9 A;  1OA3 A;  1NAE A;  1SEF A;  4P14 A;  5JUV A;  3U07 A;  1COV 1;  4KMQ A;  3O0W A;  4KWU A;  3P5B A;  1NQD A;  4LIV A;  2VQU A;  2ARE A;  1OPM A;  4D94 A;  2IXJ A;  4IND A;  3ROU A;  2DFB A;  1FMD 1;  3FHI B;  3ABZ A;  1LHW A;  4H7M A;  1VBC 3;  1Y4W A;  1PZ7 A;  2GP3 A;  3INA A;  2JG8 A;  3A23 A;  1QF3 A;  5DUV A;  5FXX A;  5LZ6 A;  1NCQ A;  1G9D A;  1ND2 C;  3D0J A;  3RZM A;  5D8A B;  2YMZ A;  3GGL A;  4W6X A;  4FFG A;  4AHX A;  2RJL A;  4QX3 A;  1AR6 2;  1GQG A;  4NRO A;  1RUG 2;  4D7T A;  1BVV A;  2OPK A;  4DFS A;  1VRH 3;  2IC1 A;  4FOV A;  2R0F A;  4ATE A;  2XJV A;  4QX7 A;  1TVG A;  2EXJ A;  3MUY 1;  4L0P A;  5BNN C;  1O59 A;  3NMB A;  4Y5S A;  5FBJ A;  1A8D A;  1MZ5 A;  2K9Z A;  1RHI 3;  1ODN A;  2W0X A;  3QLQ A;  4AVA A;  5J7M A;  4NIH A;  3T30 A;  2P1B A;  4YZ3 A;  1KJR A;  3ZFG C;  1ZBA 1;  4LKD A;  1HB2 A;  5CFC A;  4QGN A;  1S2K A;  2R7E B;  4FPY A;  3FMG A;  3VHN A;  5KHJ A;  1PO1 3;  1XB9 A;  2B9V A;  4Y3O A;  3TRS B;  3NV2 A;  1IPS A;  1J3P A;  1DYO A;  1S55 A;  4FFI A;  5ABJ B;  1VBA 3;  2DDU A;  2LRO A;  3ZLI A;  1XJA A;  3LGR A;  5F39 A;  4CDQ C;  4Y1Z A;  2XWJ B;  2BGP A;  4NIA A;  4DPN A;  2VZP A;  1RMU 3;  2EAK A;  4KI5 M;  4YW4 A;  2RR1 3;  2K46 A;  4QHZ A;  1Y9Q A;  4Q4X 2;  4WZC A;  3T2T A;  5F3I A;  2E63 A;  2PHF A;  2R6Q A;  3I54 A;  3K3N A;  3VDB A;  2XL9 A;  3BTZ A;  1CAX B;  2X8K A;  3W21 A;  3KCX A;  4YZ4 A;  3WDV A;  5JMO A;  1YLL A;  2HWE 2;  5FY4 A;  2XOM A;  4JGY C;  2VZ1 A;  1I9R A;  1ST8 A;  4FAG A;  5CA6 A;  4FP2 A;  5I93 A;  1V6L A;  1CGP A;  1J83 A;  2MNG A;  2C6S A;  1H6Y A;  2ZGR A;  4FT8 A;  4A7K A;  4DXS A;  1K3I A;  4F8A A;  1BK0 A; 
#chains in the Genus database with same CATH homology
 1W8T A;  3F95 A;  5D21 A;  3ZYH A;  1WZX A;  4BQ2 A;  2LRO A;  1W8U A;  3ZYB A;  4BQ3 A;  1HN0 A;  4LJH A;  4CP9 B;  4YW6 A;  4YW7 A;  1GWK A;  1W8W A;  1UOJ A;  1WMX A;  2K46 A;  1GWL A;  1W8Z A;  4YWA A;  1V0A A;  2Q1F A;  4LK6 A;  1W90 A;  1OH3 A;  2C24 A;  1L7L A;  2VXJ A;  3UT0 A;  4CPB A;  4A6S A;  1W9F A;  4CP9 A;  2O14 A;  4AL9 A;  2WYF A;  3ZYF A;  1GWM A;  1OKO A;  1WCU A;  4LK7 A;  4CPB D;  4LKD A;  4BQ5 A;  2LRP A;  4BQ4 A;  4LKE A;  2KR2 A;  4LKF A;  3ORJ A;  2JWP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...