2LRPA

Solution structure, dynamics and binding studies of ctcbm11
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
172
structure length
172
Chain Sequence
MASAVGEKMLDDFEGVLNWGSYSGEGAKVSTKIVSGKTGNGMEVSYTGTTDGYWGTVYSLPDGDWSKWLKISFDIKSVDGSANEIRFMIAEKSINGVGDGEHWVYSITPDSSWKTIEIPFSSFRRRLDYQPPGQDMSGTLDLDNIDSIHFMYANNKSGKFVVDNIKLIGALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Endoglucanase H
publication title Solution structure, dynamics and binding studies of a family 11 carbohydrate-binding module from Clostridium thermocellum (CtCBM11).
pubmed doi rcsb
source organism Clostridium thermocellum
total genus 33
structure length 172
sequence length 172
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2012-04-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 2lrpA01
3ORJA 1W8TA 2LROA 1WCUA 1W9FA 1UOJA 4AL9A 3F95A 3UT0A 4YW7A 4YW6A 4LKFA 1W8UA 2K46A 2WYFA 4CPBD 1HN0A 4LK6A 4LKDA 3ZYBA 4YWAA 1OKOA 1L7LA 4LJHA 1V0AA 4CP9B 1WZXA 4BQ2A 1OH3A 1W90A 1GWMA 1GWKA 1W8ZA 5D21A 3ZYHA 4BQ5A 2Q1FA 4BQ4A 2O14A 2KR2A 1WMXA 4CPBA 4A6SA 4BQ3A 1GWLA 4CP9A 2VXJA 1W8WA 2C24A 4LK7A 2LRPA 2JWPA 3ZYFA 4LKEA
chains in the Genus database with same CATH superfamily
2GNBA 1QJY1 4DS0A 3AX4A 4JAAA 2Y38A 5JDBA 3KV6A 4NIHA 1YYNA 4J1WA 4HONA 3PVNA 4A41A 1ZA7A 4KWJA 2YBPA 3OGVA 3ASIA 3E97A 1B35A 5AVAA 1ODNA 2IXCA 3MF9A 3NNGA 1MS9A 4WV8A 2G1MA 5FY0A 3H7YA 3T30A 4W65A 2JENA 2WZR1 4CDXB 1W99A 5J96B 2VW2A 2X5IC 4G4FA 3THCA 3I2HA 5D1IA 4BJ0A 3KHBA 1GU3A 5IAVA 4BB3A 3OYWA 5DAPA 1LOBA 1OC1A 5DAXA 1DQ6A 4MZUA 3O0XA 4LA2A 1JHJA 4CUAA 1VPHA 3JQXA 4S2GA 2OQ7A 1AXKA 1JH5A 2WA4A 1Z7S1 5AVPA 5EJZB 5A32B 2ET1A 2VNOA 3LIHA 4FPCA 2PAEA 4GXLA 5FPLA 1OA4A 3DF0A 1POQA 1GZWA 1EUTA 1X8EA 3CLPA 4OZXA 4MXVA 4WM7C 2YFZA 3ES1A 3MF6A 4GMP3 4CCCA 3AP7A 1F9KA 1MZ6A 2IVJA 2WWUA 2ENRA 3RRDA 4QM9A 1R1A1 1AXYA 4BK4A 2JECA 2R1DA 2Y6KA 5KHIA 1EV12 4NHLA 3RZKA 4Y5Z0 4Z82A 5A1AA 5FWEA 3RI9A 3AXDA 2Y6JA 2VY0A 1S0JA 3J26N 2VU9A 5F5AA 5C4WA 4PI0A 5EYXA 1ULCA 1DQ5A 1LEMA 4IXLA 1T6BX 5FZBA 4XJWA 3LOBA 4E27A 3ZN4A 1YQ8A 1ZVFA 2WN3A 3WDTA 3OTFA 4HETA 4R52A 4K1ZA 4FPKA 1QJZA 4NRPA 2RJLA 3HWJA 1OPMA 2XXZA 4AG4A 5C3SA 3S57A 1J3RA 1YI7A 2DCYA 1RUE1 1S55A 5HPOA 2EF6A 2P3JA 2ZGMA 5JPNB 4Q4W2 3D4KA 4XJAA 1PVC1 3LPGA 2XJTA 1GZCA 1NCQA 2N7GA 4U2AA 4P14A 3I3MA 2G19A 4N53B 4UXAA 1WCUA 2D3SA 1IPJA 4GH4A 4K1YA 1JZ3A 1AR62 4QXKA 4CDXC 3SHRA 1W05A 5E89A 2A3XA 2QJVA 4WVMA 3ZX7A 1O5LA 2JDAA 5FOBB 2ZMLA 4PIZA 2GC3A 1VAKA 3VZNA 1N1YA 4TN7A 2UU8A 3N36A 4QKFA 3UKVA 1DDLA 1JODA 2IVIB 2PHUA 4PDWC 4CCMA 3O0WA 3E5XA 3VZKA 1Q5OA 2JICA 4LO5B 4QPWA 1FMD2 3AL6A 3CL1A 4JZRA 5BNPB 1BBT1 1G86A 1OD3A 2HEWF 1LU2A 4XJ9A 3O5SA 3POFA 1TME1 2VC9A 4IEPA 1US2A 2AR6A 4FVVA 3ATGA 3VBRB 3VZJA 1UPSA 2P2KA 1DZTA 1LHVA 2GSYA 3OPZA 2ZKLA 3BTXA 3GGLA 1LENA 1TE1B 1OQDA 2OXBA 4OMCA 5K8SA 2EIEA 2XBO3 1RUF1 4Y1UA 1RUH3 4EN6B 1EUUA 3RZZA 4JC1A 1OVPA 1DBNA 4OI1A 1NE4A 3KQRA 1O91A 4YGCA 4R9CA 1GOGA 3AYEA 4R4XA 1HRI2 4M3CB 4QB1A 5GLZA 5F3CA 3HNBM 4BA6A 2UWAA 1C8M1 5GM0A 4JKLA 3IDAA 1OUSA 1UO9A 4A6SA 4A2UA 2IXLA 5FOJB 1RITA 2VZ1A 3AP9A 4K9SA 4RFRB 4L8QA 1JYVA 2VMEA 5FYMA 3ZYIB 4LKEA 4W50A 1JUHA 4NE9A 3WP3A 4AFDA 1CAVB 3PVEA 4NVPA 5A7WA 1GQPA 5IATA 3OUHA 2K0GA 4HSLA 1UZVA 3SCHA 1KS5A 4QAWA 5F7UA 5J37A 5ACA3 4QXCA 1EPWA 5FZAA 1FOD2 1NG0A 3LDKA 3MIHA 1G9DA 1XNDA 4IW3A 4AFAA 4B4QA 5FLHA 2YGMA 2R6QA 4HOOA 1RUJ3 2IXHA 1S0CA 2BRTA 2NLRA 3NWKA 2JX9A 3VBUA 2BGPA 5A3MA 2UURA 3WHUA 1N3OA 2O1QA 2QQPA 2LW8A 4RN5A 4AGRA 4QXBA 5JCTA 1KJRA 3S7IA 2DVDA 2F17A 1UAIA 4XQWA 4Y1VA 4MADA 5K0UA 5FZHA 5A1FA 1RVF2 3Q8AA 3TYJA 1XC6A 3WF1A 3H1YA 4QB6A 2Y0OA 3IAPA 4PJYA 3ST7A 1HV1A 3NVCA 4UAPA 4JGZB 5A7PA 3PVOA 5IVBA 2VH9A 2ZEWA 2WL1A 5F3IA 1E5SA 5JI9A 1BK1A 4ARYA 1OKOA 3UKTA 3POGA 5CYYA 4IESA 1J58A 1X9TA 1JYIA 1OH4A 3W5NA 3WD5A 1HXS1 4XDPA 1I3HA 3LQCA 2FDJA 5I8YA 4K21A 1UU6A 1VMHA 3I2OA 3UGGA 1LAJA 1YQ2A 1NCQB 2VOWA 1Y4WA 1OLMA 4TLFA 3LDBA 3ZFFC 5IAXA 1AZDA 1PO21 4AZZA 2ZGUA 3M8LA 4QX7A 4B8EA 5LASA 3LB9A 1K3IA 1BMV1 3WQ1A 2WFF1 3WNOA 2HH9A 3ZKYA 3MDPA 4C1XA 2VULA 2W47A 1QQP1 2XH6A 2LROA 5A3UA 1CQ9A 2JE7A 1LHUA 1R081 5F9TA 4ATFA 4YNIA 3I49A 4CCKA 1WW6A 3VUOA 4GKXA 2J1VA 4YW7A 2IWGB 4XVHA 3POIA 3M3QA 4OQ9A 1HB4A 2XLGA 4AF9A 1XU2A 1X9PA 4EZHA 4B1LA 2Q1ZB 5FQ0A 3H8XA 2XJSA 3S0MA 3A0KA 3OSDA 3I2JA 5L73A 4CEYB 2BDRA 3GBWA 1QJU1 1KJLA 2JG8B 2YG0A 3ZXAC 3LOIA 2QQOA 1ALYA 4FOVA 3BUCA 1SBDA 1W3VA 2IXKA 2GP5A 4OI2A 5BNQA 2ZEYA 2R1BA 4HSJA 1U5ZA 4Z2WA 3ACLA 4XIOA 1WW5A 4QPGC 2GALA 3IMNA 3VBSB 1NQJA 4BXFA 2FCVA 1UX7A 2VZRA 3UETA 1UYYA 4IL7A 1GNYA 1MEC1 4FFHA 2JD4A 2WNVB 2ZPXA 1OLME 4XTPA 1S2EA 2NN8A 3MHZA 2XDVA 5T50A 2RR13 1GLHA 5HI0A 5LZ6A 3BCWA 2A3WA 5F39A 5T5LA 3T3YA 1YO8A 1MVEA 5LK7B 5B4XA 4KWUA 1XPWA 4LBJA 1CWPA 2AREA 4RHV3 2C9KA 1OUXA 3CEWA 5FZ0A 4LBKA 5FY1A 5D2AA 3BTYA 1ENQA 4LLOA 1PM7A 3VDCA 2H6CA 4JGZC 3L2HA 4XJZA 5EPAA 5FRAA 4GMP0 5A3LA 1AR63 1UN1A 1AYM1 2W5FA 1C28A 1F35A 3LWCA 4A6OA 1JXNA 2G9FA 4A7ZA 4ZZ8A 1X36A 3UV9A 4GB31 4FPJA 4QPYA 3H8OA 2NM1A 4OHVA 5C7GA 2Z42A 3IKWA 5KC5A 3ZXEA 2WNOA 1IQAA 5CKMA 1NCRB 2R073 3S6PA 2HWE1 4WM8B 2HWC3 4EE2A 1ASJ2 3ZXLA 4O9GA 1BZWA 1R64A 2P6HA 4PHZA 2Y6LA 5CKQA 2R49A 5BUVA 2A71A 1GICA 1ULPA 3M7AA 4YSFA 2YGLA 3MLLA 5CG8A 4AVBA 1MS8A 3E6BA 1QJFA 5DUVA 1OPOA 5A80A 1HN1A 1SCSA 2A5ZA 5GLWA 2PHFA 1CN1A 4BIOA 1J1TA 2WLPA 2EAAA 3OBTA 3THTA 3BU7A 1BCXA 1VBE2 1CAXA 4AI1A 5JMOA 3B94A 1PNGA 3C7GA 3QCWA 3D3AA 3LPFA 5EFUA 5H9QA 4CEYC 4MGSA 1ENSA 1ZZCA 1ND3B 2ZACA 3I54A 5JLVA 2JG8C 4AI0A 1HRI3 4DINB 3SCFA 4CP0A 2AC1A 3KB5A 1NKGA 3C3VA 5FZOB 4AI9A 2VZUA 3HNYM 4PLNA 4F7ZA 1QNYA 2XLFA 1NT0A 3I7DA 3KLSA 4ONUA 5DAQA 4CDUB 4MV2A 1DGRA 4OHXA 1W2TA 5FZ3A 1L3JA 1QJY2 5FYYA 3RZGA 2B45X 3POBA 2WNVC 4AVCA 2WC2A 4HL0A 2WA3A 5LK5A 3T2TA 4Y4YA 3USUB 1RUNA 4LULA 4XJUA 1KFXL 5E6HA 4BM8A 1XOYA 5GLVA 4AEMA 4MHRA 2OKXA 3MLJA 1FOD3 1LHNA 2WS93 4AI3A 3ZM8A 2D3RA 1OOPB 3JD71 1Y9QA 3H50A 4LBQA 2GC1A 3BKZA 3JBG1 4QX3A 5FPZA 1GFF2 4ASLA 3LEMA 1R093 4D8MA 4KU8A 1NAEA 4CEWB 2KD7A 1WA6X 1X33A 4PF5A 4Q0VA 1FATA 4MGIE 2RS33 4NR1A 1H8TA 4URTA 2PN5A 1V6MA 4MGKE 3ZYRA 4E4HA 3K2OA 4AVSA 1FI2A 4A3ZA 2EA7A 1RVF3 1TMF2 2WWJA 3R4DB 2Q8DA 4XHBA 3J8F1 2R041 1O3TA 1NZCA 1AHSA 3GJAA 4GIQA 1NCRC 4XUTA 1MS5A 4WM8C 3IN9A 4UW5A 3ZSJA 1UW8A 4N43C 3AFGA 4FP2A 2BEOA 2NP0A 5CFDA 4NIAA 4HG6B 2AEYA 2VQTA 5LBEA 3KZ4C 4BHPA 1M06G 1KQRA 2J22A 2VUCA 5K9YA 1FXZA 2QQUA 1R1A2 5JIAA 4LHLA 2BWCA 1H2LA 5E8AA 3RJ2X 4XAAA 1IKQA 2CAVA 2WT2A 3RNSA 2BGCA 2O8QA 2TNFA 5KHKA 3I3EA 1LGBA 3A4UA 4HLTA 1TQ5A 3OEBA 5FP7A 2VNVA 3WUCA 3PU8A 2C5DA 3RWKX 2JIJA 4QGMA 2C24A 4KG0A 1CZTA 4Z8BA 3TN91 3UK9A 4CTEA 2E7TA 1WCKA 2B7YA 2ZMKA 4LIVA 3U4SA 2ZGKA 3OGRA 5F1RA 5J09A 1UZZA 3O0VA 4ARXA 4G9SB 1LB2A 4FI9A 4XBNA 2X09A 4V2VA 1C3HA 3KCXA 3E6CC 2ES3A 4IEQA 4YM3A 1UIJA 4IERA 3WW1A 4IEYA 1IZ3A 1ZBE2 1H8VA 1XB9A 2JDUA 3J7HA 1NY71 1RUE2 2GN7A 3NAPA 3VBOC 1VBC1 1CZSA 3DKQA 3OD0A 3P3PA 3KGZA 2GMMA 3ETQA 2JB4A 1CR7A 4DNYA 1PVC2 3NW4A 1ULEA 1UX6A 5GALA 1Q56A 1HIXA 1OOPC 5KHGA 4YVWB 4YZ5A 5DPNA 2I74A 2BWAA 3B7MA 3ZFEB 4WBBA 4COWA 3VKFC 1UU4A 3N7MA 1W8HA 5HV4A 2VCCA 3ACFA 4AW7A 1G9AA 1MPXA 1QDOA 2W91A 3N9QA 2OX0A 4FOWA 2Q4SA 4GA9A 3UJOA 2QZ2A 4XCAA 2RS11 4XEZA 5C33A 2ZGPA 4N90A 4FBFA 3O1MA 1VAMA 3EMRA 5JAXA 3ZSMA 1OQ1A 4TYSA 1W8UA 2ZBJA 1SLAA 1BBT2 3AJZA 1SPPA 2VG9A 3CIHA 2ZJCA 4OMDA 4A45A 1RUC1 2JDPA 2ZGQA 3VKLA 1IS3A 1TME2 2QQNA 4D0QA 4DMIA 4QQHA 1D0GA 3N7KA 1H30A 4HKWA 4Y22B 1LESA 2PFWA 4NUBA 1KS4A 4LBQB 4RL7A 1PM4A 2VMIA 5FMOS 1RUF2 1XBFA 2C9AA 1EY2A 2DCTA 4RSUA 5BV6A 4IGQA 2R30A 3RSJA 3QH7A 4LBMA 4HK8A 1DLLA 1IKPA 1RMU1 4B7EA 1XU1A 4ZONA 3VD4A 1GYKA 1YFYA 3ALQA 3OOXA 1C8M2 5J3UA 4CE8A 3TEZA 1OD5A 3VB9A 1L7RA 2NYYA 4UYBA 4YGEA 3AB0A 5ERLA 5FUNA 2HWB3 3FMGA 1V0AA 3N9MA 2X5IA 1ONAA 5CAZA 2RHPA 2VECA 4AE2A 4BQ4A 4IGPA 4ASKA 2GZWA 4LIUA 4PBOA 3AZWA 1ENRA 4FT8A 1JTZX 4S2HA 1STMA 1LJ7A 3G6JB 1H0BA 1LRHA 5EWSA 4Q4V1 3WV6A 3O1TA 3N7JA 1YFWA 2D6LX 5BXXA 4MYEA 4DXZA 2WNUB 3KD4A 5EQUA 1ZBA1 2PHDA 4PIXA 2WQZC 5BNNC 4ISRA 4YVWC 3S30A 5JZGB 1JZ7A 1TNFA 1W2AX 2JDYA 1RUI1 2NMNA 1ZZBA 4WM7A 4L92A 3I2KA 3ZFEC 3AMNA 5FZLA 2AUYA 4IE4A 3W20A 2XL9A 3BPZA 4XBLA 4IEVA 4ZU4A 2DV9A 2YZ4A 1S0GA 3USSA 1CZVA 2VCAA 2CTVA 3M3EA 3UL2A 3C7EA 2YPDA 4H7MA 1X8MA 1YQ5A 3C7FA 3AKPA 3VBHB 2CGPA 4Q26A 4Q4Y3 2YUEA 1QIQA 2MEV1 3SCGA 1D4M1 1DGRN 3ABZA 2IC1A 3OGJA 3I3DA 2VUDA 3Q8EA 3PU3A 3KS7A 4YZ2A 2XUEA 1IG3A 3MIEA 1CIYA 2LS6A 4NAMA 4CPBD 1SZBA 2ZZQA 4DXTA 4OVEA 3OPWA 5I93A 1PO22 1TMF3 4Q4X3 1KDMA 5KXEA 1VBB1 4XFAA 3WG1A 3IAQA 1BMV2 2WFF2 1LOCA 1W90A 1W04A 5JVVA 2LM3A 3B00A 2Q1FA 5CZKA 1YRZA 1QQP2 1ND2C 2GNTA 2XGXA 3PURA 1H4GA 1R082 2Y6GA 4L2NA 5A7NA 2OZ6A 3WHTA 1OLRA 1RUG1 5LEKA 1RUOA 3GHMA 4JGYB 4BXSV 4QKBA 5I0TA 3CKHA 1UYXA 3DKWA 5DUUA 2ZS6B 4CDXA 4ES8A 1XNKA 2WDBA 2RG4A 1WGPA 1EAH1 1AYN1 2YBSA 4XUQA 1QJU2 4YM0A 5C9AC 2GN3A 3FFZA 4PDWA 4DEVA 1ULDA 2VOTA 4I02A 4GWMA 4R9AA 2VMFA 3FUQA 5A32A 5GZGA 5EJ1B 2R063 3VHOA 4XCBA 5J48A 3UGHA 2WNUC 4BK5A 2W2IA 1AR83 1XSRA 1URXA 2RM21 5JZGC 3RZHA 1C5HA 5FO8B 1MEC2 3FHAA 4B4RA 3NJZA 5KXBA 1Y3TA 1UY3A 1O3SA 1OLQA 1EPZA 1POV3 1H4HA 1YJKA 1ZBE3 4P9WA 4RGGA 5FREA 3HVDA 3M2MA 2PMWB 3PTRB 2OZJA 2X5IB 4X8NA 2ARBA 1J59A 2Q5TA 2PXJA 1PO11 3BALA 1CJDA 3LFIA 4K3UA 4UFLA 3KF3A 2VXRA 1AYM2 2V73A 4JHZA 5SV5A 3TNQA 4IV3B 3VD3A 4HN1A 1PGSA 1QY4A 2O8OA 3VN4A 5FZIA 3QH6A 4GB32 5FK8A 1O5UA 1CAWB 2WRAA 3EQEA 4LQRA 1UIKA 1Q8OA 4K6BA 5ANQA 2IZWA 1HV0A 2HWE2 4FCAA 1L7QA 4GAZA 2KM2A 4WM7B 2ZAAA 4RQPC 2VZTA 4A4AA 2JKXA 3VKMA 3SH3A 2DTYA 1UZ0A 2DUPA 1W39A 2E33A 2NMOA 3D8CA 3HJRA 3V65A 3BTAA 4YLZA 5A3TA 4JGYC 2ZHKA 5A6XA 4OI4A 2JB8A 2DURA 1OSGA 2BBAA 1KEXA 2PA7A 1AR73 2D40A 2P6CA 5F5IA 4QU1A 2XWBB 4QQ2A 2Q8OA 2HWD3 1U0AA 4YARA 4LO6B 4MH0E 1Q8PA 2ARCA 3K75B 4HKLA 2H0BA 3ZR6A 5K4LA 3D6EA 4BE3A 4RR3C 4X8PA 1GNZA 2Y33A 4L0PA 4YFZA 4DXSA 4XFFA 4KWKA 1NLRA 1W6NB 4RFT0 4TLGA 5AC93 4DRVA 3ZSLA 2VNRA 2GC2A 5LWBA 5LCWL 4QQOA 1OFNA 4YW6A 3S5QA 5F5CA 2VMDA 4ZZ5A 2GAUA 3N9LA 5FY4A 5FY7A 3UNPA 2R32A 1UF2C 3VBRA 3RFRA 2QE3A 2VBDA 3DYOA 4Q0PA 1OKQA 3ZFFA 2LTNA 4XXAA 2ERFA 3ZDVA 5JSPA 2EVXA 2VMGA 3KV4A 4AOCA 5LW9A 1N3PA 5J98B 2BVBA 2BNOA 2IFWA 2A6VA 2KXLA 2O14A 3BOPA 3MIBA 4R9BA 4XF4A 5EHDA 5FYUA 3WOGA 4BQ3A 1JZ6A 3JD72 1WWYA 3JZVA 3V0AB 3JBG2 4M3CA 4SLIA 3I3QA 2XL7A 5FZDA 4KL1A 1AL23 4NN0A 1COV2 3P3NA 3SEPA 4P9YA 1CD3G 2LUWA 4M3CF 1RHI2 4IV3C 4PDWB 4EN7B 1ZRDA 1J84A 3R0RA 5DZEA 5APAA 3FFQA 3WW3A 5LEJA 1ODMA 3HNMA 4UT5A 3QLQA 1CAVA 1S0IA 5IK7A 3J8F2 2R042 1PX3A 5JI7A 3GF6A 2MNGA 2BBVA 1V6JA 4NRMA 4Y1XA 2JEMA 1DGWA 1H1IA 2UYBA 2RDRA 1LOFC 4Y1YA 4KGGA 4UF0A 1SFNA 4XFBA 5LA2A 2OQ6A 2V5DA 2ZXQA 3DUIA 4FP3A 4LXLA 4J6GA 3MZHA 3B93A 4QPGA 4FFIA 3FE5A 2QDNA 2VZPA 2LRPA 2XR4A 2X8KA 4YGBA 4YVSB 2W9XA 5FTTC 2DVFA 3SISA 1GP4A 1GQHA 3PHMA 3SMHA 2OIIA 3MV01 2E32A 5CKNA 1RTVA 1PO23 2C6SA 2VO5A 3WNLA 3K77A 4UFMA 1WCDJ 2E51A 4AVTA 1G8WA 5A6ZA 3LGRA 4BLJA 1S2KA 1QJX1 4M3CE 4C8DA 2WSUA 3KT7A 2HWF3 3ZIXA 5IK8A 3Q8BA 4C0BA 3TN92 4QGNA 2BFUS 4JGZA 4NRQA 3FLRA 1MZFA 1SG3A 1FX5A 3V64A 3BODA 3PUIA 1VMFA 4NOTA 4YG0A 3M4FA 2ZGNA 4S2FA 5DG1A 2BU9A 4QDQA 2W52A 2WAOA 3N35A 5EZWA 3VL8A 1QJU3 4LMFA 1NY72 2J1AA 1VBC2 3R05A 3WP6A 2EICA 4MXWA 2GNMA 2BTVC 1RJ8A 3O1SA 1UMHA 3FJSA 1ZZ7A 3A0NA 1S0EA 2P17A 4E8DA 3PMEA 2Q8EA 5JOXA 2FDKA 5GZFA 2VOXA 4D69A 4LT5A 3OUIA 4PLMA 1MEC3 4NHKA 2IXJA 3PIGA 3N3HA 4ZY9A 4XACA 2RS53 3HD8B 1OHFA 5CU1A 3WG3A 4KH9A 3SKVA 3VL9A 1XQNA 1XJAA 2RS12 2VE1A 5BPXA 4AFMA 5T52A 3EO6A 5T5PA 1VBA1 3HT2A 4LUKA 2FCUA 5FYIA 3Q9OA 4CEYA 2C1FA 1JU4A 2JDMA 4L9BA 5FYSA 2RE9A 3GBGA 4XURA 4A42A 2XHKA 2JG8A 3QBQA 4Y1ZA 4YZ4A 5DDJ1 1UKGA 4HPKA 1DYPA 5A1LA 4IE6A 1RUC2 1E5HA 3PUAA 5G05L 4BQYA 3ZXFA 1F8VA 2NPIA 3ZFFB 5LBCA 1V9U1 3H3LA 4CCJA 2XQXA 3PUQA 2TBVA 1VBD3 3VBSA 1HRV2 4ITCA 5F5QA 4FPFA 2W1SA 3WF2A 4YVSC 4MOAA 3DL3A 4XUPA 1BLZA 1A3KA 2WNVA 1DIWA 2RMU1 4JHTA 5FLIA 5JR2A 4LA3A 1ZZ6A 4YW2A 1ZRFA 2WYSA 2XOMA 5DABA 1RMU2 1HW5A 3I3BA 4NO4A 2R7EB 4C91A 1C1FA 3HAGA 3QOPA 2Q1MA 4CCLA 4Q29A 2BZDA 4E4DX 1DZRA 1W8TA 3AMMA 3HR9A 3JB4C 2QFEA 3NQHA 4N9HA 2XJPA 2LALA 4D6SA 1POV0 2PHXA 4LK6A 4UF0B 4HFSA 4HKOA 3ETPA 3KV9A 2WR9A 3NKTA 3OY8A 1OVSA 3WT3A 2QTWB 4QPGB 2B8MA 4Q4V2 3PMSA 3GM8A 1E5RA 4XF9A 5HCBA 3ZN5A 4BQ5A 1NCRA 2VMHA 3UKNA 4WM8A 4LR4A 2Z4FA 2XQRA 4IEOA 5L9VA 4CDQB 4N43A 2FQPA 1UU5A 1V6OA 3OUJA 2AZ5A 3WNPA 3ZDSA 2PTMA 4N8MA 1EP0A 3ELNA 1RUI2 4CXXA 2V09A 1JZ4A 2XWJB 3OF1A 1EYBA 1T2XA 3LF7A 4LHNA 4URAA 5IT6A 5FP3A 2DU0A 4Y20B 1W9SA 2PLV2 3KQ4B 4SBVA 4OQ8A 3D0JA 4I2OA 2ADEA 2W39A 3K4DA 3JD73 1ND3A 2CDPA 3WSOA 3FLTA 3LA3A 2A70A 2A6WA 1JW6A 1QMJA 5FZOA 3DPRB 1COV3 1D4M2 3E1F1 5FYBA 2W87A 3WX5A 1HKDA 2BOJA 5JMCA 3WF4A 1RHI3 1GZTA 2YHJA 3U10A 4AHXA 4YW5A 2NZ9A 2VTXJ 4CDUA 2EXJA 4MXWB 4R8HA 1S0DA 1CGPA 4ATEA 1DGWX 5IVEA 3T2QA 5C3RA 1VBB2 3CJXA 4FTSA 4GMP1 3USUA 4YW3A 1C57A 5GLUA 3NL1A 3S7EA 3VBOA 4EV0A 1UYPA 3AZXA 2ZGSA 3KGLA 1ULGA 4N9IA 5FPXA 4FPOB 3KM5A 2XKOA 4C0HA 2ILMA 4DQAA 3O1RA 1RUG2 1OOPA 4Y5TA 4AQSA 4D3WA 5BYNA 3WDWA 2QVSB 2VJXA 3ZXKA 3DECA 1QH6A 3NV4A 4O7XA 1G6NA 4QX8A 4R9DA 4TXWA 4LO4B 2W92A 1EV13 4JKMA 4NIIA 1A34A 4CEWA 4CPBA 1IQDC 1UCXA 4OYUA 2JG9B 4XDQA 4HPKB 4I0WB 1DQ1A 4XOGA 1IGOA 2YU2A 1EAH2 1AYN2 1JU3A 5FZMA 4F83A 5EYYA 3VLBB 4DO0A 3N9NA 5GLTA 2AYHA 5T54A 2Z5WA 1O6UA 2XUMA 3K4AA 5DN2A 2QQWA 4QKDA 5C71A 4XDOA 3K4ZA 1F4HA 2YV8A 5L9BA 1C5IA 2ARAA 4CDQC 1N1VA 5IHRA 2RM22 1OURA 3AZYA 2WUHA 2I07B 1YC61 2VQAA 1WCQA 1XXNA 3DGTA 4AGVA 3RS6A 4M0HA 4GULA 1K45A 1OH3A 4MGQA 4AAPA 4GQ7A 3AXEA 2DWRA 4GKYA 4DRRA 4Q4W3 2GH8A 5I0SA 2FDIA 4WVZA 2YXSA 1YIPA 1VBC3 5BNPA 5ABJC 3OD4A 1QOOA 3JB8A 2FMYA 3I8TA 2CAUA 3KVAA 2GMPA 4MO3M 3I2IA 3I97A 3LIGA 4P9GA 1PO12 3ORJA 3THPA 1F2NA 5CNAA 2AH2A 5I91A 3AKQA 3TEWA 3OY8B 1YIFA 3K48A 3LE0A 1YFXA 3DPRC 4IEWA 3ILNA 4U36A 2W08A 2J1RA 3CBNA 3WG2A 4KMQA 3FC0A 5JXHA 1WLDA 1FMD3 2D7FA 1SMVA 1WMDA 2DFCA 4N43B 1X50A 3C7HA 3T1MA 4E8CA 3VGIA 5CFCC 2GDFA 2VMCA 1JOPA 5T5JA 5A3NA 5C8CB 1WMXA 4QWNA 5F32A 1Q43A 1NXD1 1RUC3 1S4CA 1RGSA 1YUDA 4QDRA 3BOWA 4D6QA 1YQ6A 1BQPA 3LSDA 5HCHA 4JV4A 4FAGA 1XYNA 1GR3A 1W8OA 4H2AA 4YVWA 5BNOC 2PELA 1UKRA 3AYCA 1ZRCA 1ACCA 4PLOA 4MHUA 1D2SA 1HRV3 3GZUC 3BU0A 3ZFEA 1O8SA 4XC9A 1VMJA 1UOBA 2JE8A 2WQ8A 4FFFA 4K40A 4YW4A 2JG9C 4EN8B 1W6QA 1WKYA 3BTZA 2P3KA 4GJYA 5DAVA 3ZN6B 4D6RA 1JHNA 1JOJA 4KG8A 4HXCA 2BFUL 1RMU3 1LGCA 1WZXA 4XQDA 1Q8QA 4DXRA 2W46A 4XABA 5IJRA 4COYA 3MIGA 1UYZA 1YJLA 4JKKA 3FX3A 3LA7A 1Y43B 1K42A 2QQMA 2UYAA 5FK7A 2FMDA 1WW7A 1SACA 3KSCA 3T0AA 3VBOB 2A75A 5B2GB 5BY5A 1ZZ8A 2F4LA 4ZXEA 2JXAA 5A7OA 2VBPA 3WQ7A 4Y22A 4BDVB 1OI6A 4IE5A 3WW4A 1LECA 2Q0AA 4B1MA 4Q4V3 2C0ZA 2D6OX 2WZR2 1VE0A 3MW4A 1JYXA 4IV1B 1MS3A 3MICA 2VZ3A 4FPLA 4PIYA 1W8FA 1BXHA 2MPFA 1YEWA 2ZHNA 4RS5B 4WVVA 3B01A 3AMQA 3IDBB 3POEA 3THDA 1XNTA 3NO8A 4IE7A 5AFEA 5FZ6A 1Z7S2 2WQ4A 2OUJA 2C4XA 4LO8A 3RMXA 3TWIA 1K12A 3ZVXA 2RDQA 2PLV3 1JZ5A 4CXYA 4XMIA 4HVRA 4K8FA 3TB0A 1US3A 2DTWA 2RVAA 4RYDA 5H9SA 2HYXA 4HZFA 4W6WA 5JR7B 5FWJA 5C9AA 4MG2A 4AVAA 3CU7A 4IQPA 4RA0A 4CSWA 3CJIC 3VHPA 3FWEA 5C8CC 1W9WA 3DEMA 3VV1A 1LHOA 4QT6A 4H14A 2UWCA 3INAA 1QHDA 4PQQA 2DVGA 4CCEA 2HBUA 2WNUA 3P5BA 4GZ9A 3RWNA 4C90A 3IT8A 4LOSA 3T09A 4AHYA 2YC4A 1VIWB 3ACGA 4QM8A 5JZGA 5FZFA 2YBKA 1GWKA 4W8JA 1WA4A 3L2YA 3WLUA 2ZX0A 5JOZA 1SLBA 1HX6A 1GANA 2DCKA 3H3ZA 4Q0SA 1LU1A 1ZYBA 3OBZA 2CU5A 4CA9A 2D6MA 2OA2A 1DQ0A 1QJX2 2DF7A 2VVEA 3ZMNA 4YM1A 1S2BA 1CPMA 4M4RA 4A7YA 1FV2A 3VBHA 1UY2A 4KNCA 1I6XA 3B9IA 5M0TA 4CDWC 4HK9A 4ZS3A 4XFGA 3ZYPA 2G9GA 4COVA 5SV8A 4XE9A 2GP3A 2GMEA 2BOIA 5DXDA 1D7PM 4FQZA 3P1IA 1AYN3 3PDQA 4QX2A 4XPVA 5I8TA 2Q30A 4TZDA 3LSEA 5BNNB 1QOTA 4NWVA 5FR3A 2XB6C 3HN1A 3FHQA 1O3QA 1NA1B 4OFGA 1O4ZA 3DXTA 4BU2A 4E4ZA 3GCWA 1J3QA 2WO1A 4H3WA 3DYPA 2RR11 2Y6FA 4IV1C 4LHSA 4XW3A 1XRUA 4BYYA 1W28A 1G9CA 1W6QB 3TNPB 3GZTB 4XMAA 3RYPA 1HJFA 1VAVA 3J4UH 4RHV1 4JGYA 4RS5C 2EALA 3UT0A 1DG6A 1WUVA 2IUWA 1HQLA 3NV2A 4YPJA 4CCDA 3IBMA 3LA2A 1U5YA 3AVSA 4OLLA 3E6DA 2C26A 2Y8KA 1AR61 2JDHA 2SLIA 2AEZA 1VBA2 2B39A 2ZX4A 3NV1A 4FOQA 4OCTA 5E1RA 3SH5A 5A3OA 4RR3A 3AK0A 3KV5A 4NIDA 1OMIA 1AL0G 3H0OA 2RDSA 2RV9A 2ARXA 3OPTA 4LK7A 4P00B 3M3IA 1CAUA 4K8RB 3R6SA 4H7LA 1W6MA 1V9U2 2R071 4HVOA 2HWC1 1UOGA 5L36A 1Y9MA 3MI8A 1PGW1 4QD2A 3EB7A 1Q3EA 1W8NA 2VUJA 3NRUA 4R4ZA 1V6IA 3T4HB 4FTBA 1ASJ3 3BB6A 1LGNA 5F3EA 2RMU2 3FHIB 4V2WA 5KHHA 1ND2B 5JXIA 2XHNA 1UY1A 5LATA 1X7NA 4I09A 2DU1A 4YWAA 1V70A 3AZVA 5DZFA 4PI2A 1CJPA 1VLNA 5T55A 5A7SA 1DFQA 2E53A 4D94A 1H9PA 4QU2A 3KHCA 2FDHA 3IPVB 4BQ2A 3WCSA 2YC0A 3POSA 1VBE3 2VW1A 5FXVA 2JDZA 1C8NA 2ATFA 4AHZA 1PMIA 2P3YA 1N47A 2TEPA 1PMJX 5C9AB 4IV3A 2Q8CA 3IB3A 3ZYFA 5C70A 4XILA 3NNJA 2K2SA 5FY9A 3GCXA 1KDKA 3JU9A 5FV3A 3AL5A 5JPMB 1BKZA 3JUUA 1CAWA 4INDA 4COUA 5C5UA 4GWIA 4CRQA 4XBQA 1K5MB 1SBFA 3OEAA 1OF3A 3VKOA 2YY1A 1NA1C 3K3OA 4QMAA 3LEGA 2WO7A 1WLCA 3OGGA 1QJY3 3WP5A 3VDBA 4XETA 2DUQA 1UMIA 2R0FA 1ZNPA 3NNLA 4CYDA 1J83A 3O12A 3TAYA 4LKSA 2WS91 4HVQA 4XHXA 4MX3A 3POWA 3RG0A 4Y33A 4Y5SA 2VD7A 4PCRA 2EIBA 3ZFGB 4P08A 3U11A 4A44A 5L7OC 5DMYA 1R091 3R4UA 5F37A 5FY8A 4W4ZA 4OHYA 1OBNA 1N1SA 3SKJE 3TEYA 5HCFA 1FT9A 1H2MA 2WZR3 1J1LA 2V4VA 3CZUA 5FP8A 3Q8FA 5FUIA 4IGOA 2RS31 2XLAA 1WMEA 2CNAA 2HLEA 1HXS2 1RUD1 5A70A 1RVF1 1W6NA 1AR91 2XKPA 2CWSA 1RXGA 2XJVA 4AHWA 5I0UA 2ZEXA 4I0BA 4YZ3A 1JUIA 3E5UA 4FSJA 4OI0A 1IG0A 1VB4A 1KXGA 3KCCA 4N7IA 3SH4A 3K46A 4RQPB 1Z7S3 4FAHA 4AEDB 1RC6A 4DB5A 1O3RA 1Y9GA 2DFBA 3LDRA 4BOWA 5J36A 3CF6E 1UY4A 2GU9A 2JDNA 3C7OA 2JDKA 3DN7A 2ZX3A 4AAXA 3WDUA 1I5PA 4JTOA 2K9ZA 3MW2A 2I2SA 5A6YA 3GBFA 4PT6A 4UOJA 2BPA2 4D7SA 1UOJA 5FP4A 3RVHA 3B5LB 2ETEA 1R1A3 1J3PA 4AL9A 2ZCWA 2WBKA 3WNMA 3V0AA 1Z0HA 4LOTA 3GZEA 3VDDC 4A7KA 3I4IA 1HN0A 4RR3B 3TRSB 3KVBA 4Q1PA 2PQQA 1YFUA 2ADDA 3NNMA 5LB6A 3HPNA 1CAUB 1W8ZA 4LBLA 1W03A 1W6MB 4EROA 4QQPA 2VBBA 3IMMA 3TOJA 1K5MC 1BJQA 1KD7A 1MS4A 2ORZA 3CMGA 4LO7A 4OHZA 4AQTA 5F6KA 1N3QA 3EBRA 1VRBA 4CU8A 1YWKA 1REEA 3FBYA 3O1PA 2P4EA 4Q0UA 3GHNA 4BMEA 4AQ6A 1WD4A 4HMZA 1RUE3 3VZOA 2VAUA 5HXMA 2Y34A 2ZKNA 4YVSA 2RJ2A 3FL7A 3ZFGC 1PVC3 3I2GA 2YYOA 5F6LB 1L7LA 1DQ4A 4DPNA 1NE6A 5DG2A 4DY3A 4W6XA 1PGL1 2BNMA 2WSVA 2ZABA 4Y4RA 4F8AA 3B02A 2WO2A 1BEV1 1GOHA 1VRH1 2WKKA 4ZU7A 4B29A 4L99A 1NYWA 1QJEA 2A6ZA 3OBRA 5D8AB 3RZLA 4NWWA 1GNHA 4JQRA 4UWDA 5FJHA 1DZQA 3ZLIA 2A73B 3ZOIA 1YI9A 3AKRA 4KI5M 1D0HA 4ZXKA 2WO3A 3ROUA 3X29B 1NQDA 1ZRIA 3DV8A 2CSGA 3MUY1 3I2DA 1IOAA 2XJRA 5EJ3A 2FD8A 2PQSA 1AJOA 1BBT3 2CYFA 4AEDC 4O9EA 1E5IA 3OB8A 3BN6A 1NOVA 4GWNA 4CU9A 4IETA 4O65A 1TME3 2Y0IA 4UBHA 3GNEA 5I0DA 5FMBA 1Q8VA 3L9JT 3LKJA 3WF0A 5HCAA 2EXIA 5FYVA 2WZEA 2YU1A 1IS5A 1LOAA 1PVXA 4BZ4A 1SCRA 1RUF3 3ECQA 1W0PA 3W59A 2GNDA 1XYPA 1H2NA 4JCKA 2A6XA 1YQCA 2RMU3 3H1MA 1A8MA 1OFSA 1NLQA 1O8PA 4W6YA 1C8M3 2HWB1 3WZ1A 2BNNA 2MHFA 1PK6C 3F95A 1YLLA 4RD7A 2PAMA 1HDKA 1ULFA 1CX1A 1H6XA 4UI9L 3BYWA 4IEUA 4MLOA 4NHYA 2VUAA 2ID4A 3J7NA 3WF3A 5CBLA 1ZRRA 4JDMA 4ORFA 1A78A 4EN0A 5IFPA 3WDXA 2JKBA 2YB7A 4HANA 1XYOA 3NNFA 5EP9A 3SQOA 3GDBA 1QWRA 1HQNA 3V0BB 5GZCA 1K5JA 2P5BA 3ZXJA 1H6YA 5LBBA 5I0RA 4HN0A 4XIKA 2DVAA 3SNMA 4QX5A 1PIV1 3MLKA 3CDZB 2VCBA 4AYUA 2X05A 3E5QA 5D8AC 2ZGRA 4EWEA 2WYFA 3PLQA 4E2GA 5FPAA 1AX1A 4E4SA 3UJQA 2WT1A 3APBA 2ZA9A 2HYKA 3F2ZA 1GQGA 2EIGA 5KWRA 4P02B 1H9WA 4Q4Y1 4QPIB 1OF4A 5D21A 1W2UA 2D43A 2RJKA 1IHMA 2DUOA 3A21A 3MPBA 2PHLA 5IVJA 5IVYA 1C1LA 3LAGA 3FN9A 1V6NA 2BERA 5FJKA 4DOUA 2UY9A 2XJUA 5CA6A 3N9OA 4OUSA 4RGAA 5FMOL 1HXS3 3B69A 3UESA 4DUVA 1DYKA 5C8WA 1TMF1 4Q4X1 3D82A 3VHNA 4CDQA 2QKDA 4JX0A 2B46X 2VVFA 4ZU5A 4BMBA 1MQTC 1MVQA 2VPVA 4GWJA 2BUKA 3RYRA 2WT0A 2WFF3 2OW4A 4ISQA 1SDDB 1KGYA 3JQWA 3ON7A 4I3PA 4Q2FA 3G7DA 3BIEA 2D5HA 1QQP3 2VZOA 1DYOA 5FBJA 3CNAA 2VQUA 5FPVA 1R083 4AR2A 4F3JA 3U0ZA 4Y20A 1REDA 1GUIA 3WNKA 5H9PA 2FHRA 3ZKUA 4CU7A 5KXDA 4ZHNA 5ABJA 4NROA 1GP5A 4YFWA 3J7LA 3U78A 1PHMA 1SDWA 1HLCA 1FPN1 2QQLA 1UWWA 1F4AA 1SBEA 4JRLA 4COZA 3DPRA 4B7KA 1GV9A 1LOEA 1CIWA 1O59A 2VOKA 3MFCA 2R061 5CB7A 1CVNA 3AP4A 3SC7X 1AR81 3VBFC 1OT5A 2AGSA 2QBXA 2V5YA 3MGUA 1XE0A 3A22A 4UFKA 4LE4A 4LKDA 3RDIA 1XNCA 5CFCA 5CG9A 2VGDA 4X6QB 2QQKA 2WWSA 2XMLA 5FLJA 1YXWA 5FYZA 4UFHA 2RR12 5FZ8A 4LNVA 3AP5A 4YG6A 1POV1 1ZBE1 2QDRA 5EXOA 2E26A 3IM0A 4AQ2A 4DZGA 4RHV2 2VL4A 3ME2A 4I30A 5BNOA 3R4SA 4Z2AA 3H8UA 1WCSA 2B9VA 2JWPA 3H9AA 5A33B 5IYYA 1JYNA 3NJXA 5T3NA 3T2PA 3U07A 3WG4A 5KXCA 2JD9A 4QPIC 1S0FA 2JG9A 3GYDA 4CCNA 4DEQA 2PAKA 2D6KA 5E16A 5EV7A 1IS6A 5EIYB 2OUHA 3M1HA 5FPUA 1AYM3 1AJKA 2D6PA 3LEKA 3TEXA 4KGQA 3BGAA 1CX4A 4GB33 4CU6A 3VHRA 5JWPA 5IVCA 5CVRA 2R072 2HWC2 3ILRA 4QX0A 4XFIA 2W1QA 1PGW2 5JXJA 3WVJA 1V6KA 2B4KA 2HWE3 2UY8A 4NAOA 1JZ8A 4LTAA 4JQTA 5KR7A 2YMZA 4CP2A 5A6QA 4Y24A 3ZMOA 4XUOA 1JBCA 3WXPA 5LA1A 2FDFA 1V00A 3B9CA 2X53S 1M4WA 1RYYA 2EXHA 2WN2A 3KCYA 1B35B 4LEJA 1AR71 3BVCA 1F31A 1FNYA 2HWD1 4LKFA 5AFBA 4HBNA 1SLTA 5FMCA 3AFKA 3ZIWA 3J9SA 4LBOA 4QB2A 1I5ZA 2ET7A 3NMBA 3KT4A 2P37A 3CHXA 3VKNA 3RZMA 1TVGA 1SQ4A 2WJSA 1QDCA 3OYWB 4NPLA 4CP1A 5AC91 4AXOA 1F5FA 3M3OA 1G9BA 5LRRA 4NHMA 1KRIA 4YZ1A 4FPHA 5FXZA 4QGLA 3URFA 1OA2A 1RINA 3NSTA 1ZBA2 1R1ZA 2AACA 1AVBA 4K7JA 5A7QA 3U75A 3TBDA 4FO9A 2XPJA 3P6BA 2RDNA 4BPZA 2ZEZA 1GZWB 1PZ9A 5FPBA 5C8CA 1AXZA 3CJIA 3U1XA 4AK3A 5J7MA 4P5YA 2ZMNA 1NLSA 4YM2A 3HEIA 2WS92 1GZ9A 3FUOA 3H42B 1LOGA 4XYXA 4M00A 3RI8A 5ABJB 4AEJA 3H3UA 3ITQA 1UL9A 3AJYA 3BIWE 3RQ0A 3A23A 2BP6A 3M3CA 3MO4A 1R092 1LR5A 1AL21 4N53C 3O14A 3V56A 5IFTA 2Z79A 3JBG3 3PIJA 3ZPYA 4JDNA 4XZUG 4QX1A 1VB2A 1GBGA 2MEV2 3ACHA 5FZKA 2RS32 3ZN6A 5FUPA 4FFGA 1UXZA 1X82A 5C4WB 1RUD2 5T5OA 3H7JA 3IDCB 2VTFA 1QNWA 1AR92 4S2DA 3VD9A 1DF0A 1SLCA 3BI3A 2ZZJA 1GKBA 5CFCB 3W5MA 3SXWA 2GC0A 3J8F3 2R043 3EYPA 4MGZE 5FZ4A 3W58A 4CDWA 1HB2A 5BNPC 5FO9B 4IE0A 3WCRA 2KA3A 3O1VA 1CPNA 1D4VB 3RJRA 5I8SA 3VBRC 3ZPOA 5BNOB 2FDGA 4P9XA 1B35C 2NQYA 5CISA 4IV1A 2WZPP 3KMHA 4GH4B 4E2QA 1JMUB 4LE3A 2D3PA 3K3NA 1HB3A 2QZ3A 1DU3D 5FYCA 4WVMB 1Y7BA 3OBAA 4JTNA 2HWF1 4RS5A 4YGDA 5FZ1A 5LA9A 1JOBA 5IWFA 3RMYA 1GMMA 2H6BA 3IZOA 1W9FA 3KT1A 5F3GA 2ZTNA 5IUQA 1ZZ9A 4BISA 5LA0A 4AWDA 2FZ2A 3TN93 2BYVE 5GZEA 2VW0A 3QACA 4UW4A 1SFPA 3H8RA 3W9AA 5FZ7A 3WW2A 2W1UA 2ZX2A 1JI6A 1LODA 4LJHA 4N7UA 3SITA 2QQVA 1GWMA 5FO7B 2G9ZA 2P3IA 2XG3A 1IPKA 3I59A 2O0OA 3LCPA 3PUHA 3WR0A 3WQ0A 4V1PA 1S0BA 2VZQA 5KC6A 3C8XA 4ET7A 3HBKA 5K7PA 3JXSA 4TTGA 2OPKA 1GOFA 4DFSA 5IW0A 3JCIA 2DBNA 2YPJA 5LY1A 1TNRA 2ZX1A 1PGL2 4AI8A 4MGTA 2RS51 3MW3A 4OULA 1TZOA 1BEV2 1UQXA 4KWLA 1SEFA 1QEXA 1VRH2 4EJRA 3K51A 4XZPA 3EJKA 5FCCA 5JUVA 2CDOA 3LZZA 3OJBA 5C4WC 5KBFA 2RS13 1B09A 1RL3A 4P5HA 1WBLA 3DXUA 5H9RA 1W3XA 1XSQA 2ZHLA 5ANNA 3MIDA 3ZYHA 4WZFA 1LNSA 1WW4A 2PHWA 3B3QE 3SLIA 2PHTA 4LORA 5A7WB 5HV0A 1C4RA 1REFA 3CJIB 4CP9A 3CO2A 2Z2SB 1F15A 1A6CA 2DDUA 2VTXA 5FXXA 2W0XA 2VQ0A 4XTMA 2ZHMA 4UFIA 2XBO1 1VBD1 2J1SA 4B3NA 1RUH1 4Q1RA 3PUSA 3GALA 3DCQA 5BNNA 2R16A 3ZXDA 4EQVA 1LHWA 2V72A 1NA1A 4Z07A 2W95A 1NCQC 1O7FA 4H55A 1UMZA 1LULA 4XJ8A 5JOWA 3VBUB 4GH4C 4B4PA 2D5FA 4BLIA 2BJSA 3AMPA 4DIQA 3WNXA 1APNA 1VALA 1ZM1A 2OT7A 2HKXA 2AENA 2YDEA 2QQIA 4AVVA 2ZOEB 2QQJA 4WVWA 5K0UB 3ZSEA 5CIRA 4FXKB 1BK0A 1HJGA 5L7OA 5FXWA 2HWB2 1AUYA 2A1XA 4GALA 1GWLA 2W94A 4XAEA 5C5TA 2BV4A 2EAKA 4CDWB 3WP4A 4PBPA 5LBFA 5ACA1 1U12A 5FZEA 1LKNA 1VJ2A 2X29A 4LUMA 2YC2A 3MV11 2E6VA 3POJA 5G04L 3EXUA 4AEKA 4EYUA 3HT1A 1HB1A 1RUJ1 2A3YA 1UD1A 4J1XA 4XUNA 5LY2A 4D7YA 4DUWA 3HQXA 2D6NA 3SEEA 2OPWA 4QQLA 4YG3A 4Z1VA 1W06A 2VOVA 3N7LA 4JRAA 5JOYA 1MS0A 3VBSC 1ZBA3 1ND2A 2D93A 1AX0A 1TEIA 3WY6A 5C6CA 3ZYGA 2VNGA 2XJQA 3GXUA 1QXRA 1DCSA 1RUI3 5FAXA 3T1LA 4BH9A 4CXWA 1VP6A 4LLFA 1PIV2 4CUBA 2FZ1A 2CGNA 4EWDA 2E63A 1QF3A 1QXJA 3IPVA 4ASMB 2VM9A 1SHWB 1BYHA 3ZSKA 4I0AA 2BVVA 2V4AA 3VDDA 4Q0QA 5FQ0B 3NV3A 4Q4Y2 1AX2A 3HIFA 1I9RA 3CZJA 1WBFA 1COV1 4I01A 3IWZA 4NJ4A 1RXFA 3LD8A 2F4PA 4YW1A 1RHI1 3I59B 4OZOA 4YRDA 2MEV3 1D4M3 3POYA 2WABA 4CUCA 4KBZA 3AKSA 5GZDA 1K5MA 3M70A 1RUD3 4WZCA 3AVRA 3ES4A 4IEXA 1CONA 4Q4X2 1PNFA 1AR93 3EHKA 3KF5A 3WDVA 4MUVA 1OXCA 2X10A 3VBUC 1OA3A 2CV6A 4FPGA 5FYTA 4IEZA 4NHXA 1SLIA 1VBB3 1W6OA 5CEHA 1I1EA 2J1EA 2W1WA 3PVBB 3HMYA 1OQEA 1W2OA 3J7MA 4M01A 2VZSA 1BVP1 2CWMA 1T6GC 3T0BA 1WLWA 3ZFGA 5FFOC 3MBWA 5K0UC 1RUG3 1QH7A 1EV11 1JZ2A 3MYXA 4LHKA 4MVTA 2JE9A 2Y60A 1N1TA 3ZYBA 4DUXA 5A3PA 3O1UA 2DCJA 3HQUA 3AKTA 1ZX5A 4META 1FPN2 4CP9B 2BQPA 3WEZA 1MACA 1EAH3 1ND3C 4QHZA 5IVVA 2Y64A 3AM2A 3W21A 1U5XA 2R062 2VXJA 1AR82 4FXGB 1PZ7A 2FCTA 4OUEA 1JN2P 1UY0A 4RQPA 5DUXA 4AEDA 4X6RB 1RJ7A 1TG7A 2J42A 4CDUC 1W9YA 2I45A 3OGSA 1QKQA 1YHFA 2RM23 3T08A 4L97A 5F2WA 3MUZ1 4Q4W1 1W0OA 1P8JA 4Q27A 2F6BA 5FIXA 5FY5A 1O4YA 4JDOA 3ZR5A 1IPSA 5L7OB 3AMHA 2WAAA 1AF9A 3UYJA 1VR3A 1W6PA 5C3PA 4ZPIA 2B9UA 1DLCA 1H1MA 2D98A 1CAXB 2HEYF 2L9LA 2JIGA 3HBZA 5DDJ2 1WMFA 4CZSA 2TUNA 3AC0A 4AFCA 5GJ6A 4GD4A 3U4XA 1PO13 3WDYA 4CEWC 1QXPA 5A3WA 4AGGA 5DAWA 4KU7A 2P1BA 1Q8SA 4D7TA 4XF3A 5JXGA 1PK6A 4P9JA 1BEV3 1YCIA 1DP0A 4PF1A 1VRH3 2WIIB 1FMD1 1HQWA 5LRSA 2VZVA 4AI2A 3OCPA 2HBTA 4CUGA 3WUDA 4ZKTB 2K46A 3T2OA 4PQ9A 2PYTA 4EWAA 3D0SA 1KFUL 4FTEA 2CGOA 3VDAA 1XNAA 2OS2A 1BVVA 1NX9A 4Y3OA 4Y26A 5IK5A 1Z78A 2W3JA 2CHHA 3ENRA 1HRV1 2DYCA 2XVGA 3VDDB 1AR72 1ZREA 1HRI1 2BW8A 2HWD2 5FDBA 1UXXX 1JYCA 2XVKA 3UGFA 5FZCA 3IIIA 3D5OA 4LPLA 3N4MA 5D8AA 2H0VA 5HBAA 1PMHX 1FNZA 1GSLA 2YFUA 3IIAA 1SFYA 3PJQA 1H8TB 4Q5OA 4DY5A 5AC92 2VR4A 4ES9A 4OHWA 5DQ0A 5E88A 2E7QA 4E2SA 3OG2A 5FKCA 3AP6A 2IXIA 4NMIA 1LOFA 3RPQA 3VZMA 3HN3A 1W0NA 3ZYJB 1DGLA 1W6OB 1MZEA 2JJ6A 1FOD1 5CFDB 4XXPA 4BQWA 5CADA 2EIDA 5JIUA 4GJZA 3T4VA 4CCOA 3HOBA 2E31A 4UW6A 3WINE 1MQTA 2DBIA 1XNBA 1W2NA 3FLPA 4E9KA 5IK4A 1AL22 2WZ8A 3PL0A 3AYDA 4FPYA 4M0NA 5L9RA 2Y6HA 2CL2A 4HT1T 2W68A 2UWBA 2QCSB 2YROA 4NPRA 1PIV3 1QU0A 4UBGA 1ENXA 2PLV1 2E9QA 5FYHA 2J1UA 4EN9B 1WD3A 2KR2A 3WNNA 3QD6A 1H1AA 4O61A 3O1OA 4EZ4A 3VZLA 1G7YA 1FV3A 2CY6A 4IUGA 1PZ8A 3LEIA 2WNEA 5FKBA 3U37A 3ZO0B 1JYTA 3VBFA 1A8DA 2PHRA 3NAPB 2DCZA 1DHKB 1ZA4A 3DYMA 5J1XA 1G9FA 4TSVA 2G4IA 1W6PB 3BPSA 4QHOA 3T0DA 3V0BA 3NKGA 3AYAA 4A3XA 4MGYE 5C3QA 1QOSA 2WINB 4RGKA 1IS4A 4XF0A 3ACIA 3AZZA 5JSOA 4K20A 3H1WA 4Z92B 2HWF2 4AFBA 2DVBA 2XONA 4BQXA 1PK6B 1PX4A 2P34A 3MFAA 1H8TC 1RIRA 1QJX3 1XE8A 3FBMA 4J25A 4QXHA 3ZXGA 2J1TA 1W8WA 4XFHA 1KITA 4NPMA 4BCUA 4QKNA 3O7OA 2BGOA 3PJYA 4QPIA 3RYKA 3A7QA 2B5HA 5ISLA 2ZGLA 3MIFA 1FYUA 1SPPB 4XQ4A 5GKAC 3NJVA 4P9LA 3VD5A 2SBAA 1FPN3 4XF1A 5CFDC 1MR5A 5IVFA 2EXKA 2J7MA 1RB8G 1S1AA 1O4TA 4KBBA 3RZJA 1JS9A 5B4NA 4Q8KA 1MZ5A 1YNAA 3VD7A 1UPIA 3MPPG 1UNBA 1CESA 2ZGOA 1D2QA 1NUKA 2Y26A 1UZWA 4QDSA 2RS52 3C2UA 4FOYA 5F8PA 1NZIA 3MEPA 5FP9A 1ST8A 1LTEA 3ILFA 3PNAA 2E7AA 4LBNA 1MS1A 4TWTA 5FZGA 3S5AA 3RGBA 3N9PA 1VBA3 2WLQA 2B42B 1FAYA 4CVUA 1ULOA 4P9IA 4UW3A 2HEVF 3VBHC 5KHJA 1GP6A 5DDJ3 4I3GA 1WLTA 2OYZA 3PTYA 5DZGA 2D97A 2HJIA 4IDZA 3Q8CA 3U14A 5L19A 3LFMA 1U5IA 2VCMA 2XBO2 1VBD2 3NAPC 1RUH2 1UOFA 3HQRA 4XFCA 1V9U3 1V6LA 2ZGTA 5FZ9A 5TSWA 3WQBA 4C1WA 1ASJ1 4NIGA 1DQ2A 1H2KA 1MQTB 2QUOA 1JYWA 1QGLA 1SLLA 2WFPA 2XVLA 5DUWA 4L11A 4KQ7A 2GH2A 3GJBA 1BHGA 4M4PA 2QNKA 3CQOA 2ORXA 3KWVA 4FPEA 4FQ4A 5A33A 1NXMA 4G3YC 4YYOA 4UFJA 2FBEA 1VBE1 4Q8LA 4N53A 2Z69A 2A7AA 2A6YA 5JSRA 4JVAA 1LCLA 2R0HA 3FZ3A 4ZS2A 5ACA2 5FMDA 4BIFA 4OUMA 3IDEA 4QHBA 1E57A 4BQ1A 5FBZA 4LITA 5HXVA 4LBQD 1F5JA 2IFRA 3I2FA 2VVDA 5F2SA 3VBFB 4MSVA 5C3OA 2OVUA 2D44A 1RUJ2 1W9TA 4BWOA 2ZAHA 1LEDA 3GZAA 3NJYA 1XE7A 1UZYA
chains in the Genus database with same CATH topology
3ORJA 1W8TA 2LROA 1WCUA 1W9FA 1UOJA 4AL9A 3F95A 3UT0A 4YW7A 4YW6A 4LKFA 1W8UA 2K46A 2WYFA 4CPBD 1HN0A 4LK6A 4LKDA 3ZYBA 4YWAA 1OKOA 1L7LA 4LJHA 1V0AA 4CP9B 1WZXA 4BQ2A 1OH3A 1W90A 1GWMA 1GWKA 1W8ZA 5D21A 3ZYHA 4BQ5A 2Q1FA 4BQ4A 2O14A 2KR2A 1WMXA 4CPBA 4A6SA 4BQ3A 1GWLA 4CP9A 2VXJA 1W8WA 2C24A 4LK7A 2LRPA 2JWPA 3ZYFA 4LKEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ORJ A;  1W8T A;  2LRO A;  1WCU A;  1W9F A;  1UOJ A;  4AL9 A;  3F95 A;  3UT0 A;  4YW7 A;  4YW6 A;  4LKF A;  1W8U A;  2K46 A;  2WYF A;  4CPB D;  1HN0 A;  4LK6 A;  4LKD A;  3ZYB A;  4YWA A;  1OKO A;  1L7L A;  4LJH A;  1V0A A;  4CP9 B;  1WZX A;  4BQ2 A;  1OH3 A;  1W90 A;  1GWM A;  1GWK A;  1W8Z A;  5D21 A;  3ZYH A;  4BQ5 A;  2Q1F A;  4BQ4 A;  2O14 A;  2KR2 A;  1WMX A;  4CPB A;  4A6S A;  4BQ3 A;  1GWL A;  4CP9 A;  2VXJ A;  1W8W A;  2C24 A;  4LK7 A;  2LRP A;  2JWP A;  3ZYF A;  4LKE A; 
#chains in the Genus database with same CATH topology
 2GNB A;  1QJY 1;  4DS0 A;  3AX4 A;  4JAA A;  2Y38 A;  5JDB A;  3KV6 A;  4NIH A;  1YYN A;  4J1W A;  4HON A;  3PVN A;  4A41 A;  1ZA7 A;  4KWJ A;  2YBP A;  3OGV A;  3ASI A;  3E97 A;  1B35 A;  5AVA A;  1ODN A;  2IXC A;  3MF9 A;  3NNG A;  1MS9 A;  4WV8 A;  2G1M A;  5FY0 A;  3H7Y A;  3T30 A;  4W65 A;  2JEN A;  2WZR 1;  4CDX B;  1W99 A;  5J96 B;  2VW2 A;  2X5I C;  4G4F A;  3THC A;  3I2H A;  5D1I A;  4BJ0 A;  3KHB A;  1GU3 A;  5IAV A;  4BB3 A;  3OYW A;  5DAP A;  1LOB A;  1OC1 A;  5DAX A;  1DQ6 A;  4MZU A;  3O0X A;  4LA2 A;  1JHJ A;  4CUA A;  1VPH A;  3JQX A;  4S2G A;  2OQ7 A;  1AXK A;  1JH5 A;  2WA4 A;  1Z7S 1;  5AVP A;  5EJZ B;  5A32 B;  2ET1 A;  2VNO A;  3LIH A;  4FPC A;  2PAE A;  4GXL A;  5FPL A;  1OA4 A;  3DF0 A;  1POQ A;  1GZW A;  1EUT A;  1X8E A;  3CLP A;  4OZX A;  4MXV A;  4WM7 C;  2YFZ A;  3ES1 A;  3MF6 A;  4GMP 3;  4CCC A;  3AP7 A;  1F9K A;  1MZ6 A;  2IVJ A;  2WWU A;  2ENR A;  3RRD A;  4QM9 A;  1R1A 1;  1AXY A;  4BK4 A;  2JEC A;  2R1D A;  2Y6K A;  5KHI A;  1EV1 2;  4NHL A;  3RZK A;  4Y5Z 0;  4Z82 A;  5A1A A;  5FWE A;  3RI9 A;  3AXD A;  2Y6J A;  2VY0 A;  1S0J A;  3J26 N;  2VU9 A;  5F5A A;  5C4W A;  4PI0 A;  5EYX A;  1ULC A;  1DQ5 A;  1LEM A;  4IXL A;  1T6B X;  5FZB A;  4XJW A;  3LOB A;  4E27 A;  3ZN4 A;  1YQ8 A;  1ZVF A;  2WN3 A;  3WDT A;  3OTF A;  4HET A;  4R52 A;  4K1Z A;  4FPK A;  1QJZ A;  4NRP A;  2RJL A;  3HWJ A;  1OPM A;  2XXZ A;  4AG4 A;  5C3S A;  3S57 A;  1J3R A;  1YI7 A;  2DCY A;  1RUE 1;  1S55 A;  5HPO A;  2EF6 A;  2P3J A;  2ZGM A;  5JPN B;  4Q4W 2;  3D4K A;  4XJA A;  1PVC 1;  3LPG A;  2XJT A;  1GZC A;  1NCQ A;  2N7G A;  4U2A A;  4P14 A;  3I3M A;  2G19 A;  4N53 B;  4UXA A;  1WCU A;  2D3S A;  1IPJ A;  4GH4 A;  4K1Y A;  1JZ3 A;  1AR6 2;  4QXK A;  4CDX C;  3SHR A;  1W05 A;  5E89 A;  2A3X A;  2QJV A;  4WVM A;  3ZX7 A;  1O5L A;  2JDA A;  5FOB B;  2ZML A;  4PIZ A;  2GC3 A;  1VAK A;  3VZN A;  1N1Y A;  4TN7 A;  2UU8 A;  3N36 A;  4QKF A;  3UKV A;  1DDL A;  1JOD A;  2IVI B;  2PHU A;  4PDW C;  4CCM A;  3O0W A;  3E5X A;  3VZK A;  1Q5O A;  2JIC A;  4LO5 B;  4QPW A;  1FMD 2;  3AL6 A;  3CL1 A;  4JZR A;  5BNP B;  1BBT 1;  1G86 A;  1OD3 A;  2HEW F;  1LU2 A;  4XJ9 A;  3O5S A;  3POF A;  1TME 1;  2VC9 A;  4IEP A;  1US2 A;  2AR6 A;  4FVV A;  3ATG A;  3VBR B;  3VZJ A;  1UPS A;  2P2K A;  1DZT A;  1LHV A;  2GSY A;  3OPZ A;  2ZKL A;  3BTX A;  3GGL A;  1LEN A;  1TE1 B;  1OQD A;  2OXB A;  4OMC A;  5K8S A;  2EIE A;  2XBO 3;  1RUF 1;  4Y1U A;  1RUH 3;  4EN6 B;  1EUU A;  3RZZ A;  4JC1 A;  1OVP A;  1DBN A;  4OI1 A;  1NE4 A;  3KQR A;  1O91 A;  4YGC A;  4R9C A;  1GOG A;  3AYE A;  4R4X A;  1HRI 2;  4M3C B;  4QB1 A;  5GLZ A;  5F3C A;  3HNB M;  4BA6 A;  2UWA A;  1C8M 1;  5GM0 A;  4JKL A;  3IDA A;  1OUS A;  1UO9 A;  4A6S A;  4A2U A;  2IXL A;  5FOJ B;  1RIT A;  2VZ1 A;  3AP9 A;  4K9S A;  4RFR B;  4L8Q A;  1JYV A;  2VME A;  5FYM A;  3ZYI B;  4LKE A;  4W50 A;  1JUH A;  4NE9 A;  3WP3 A;  4AFD A;  1CAV B;  3PVE A;  4NVP A;  5A7W A;  1GQP A;  5IAT A;  3OUH A;  2K0G A;  4HSL A;  1UZV A;  3SCH A;  1KS5 A;  4QAW A;  5F7U A;  5J37 A;  5ACA 3;  4QXC A;  1EPW A;  5FZA A;  1FOD 2;  1NG0 A;  3LDK A;  3MIH A;  1G9D A;  1XND A;  4IW3 A;  4AFA A;  4B4Q A;  5FLH A;  2YGM A;  2R6Q A;  4HOO A;  1RUJ 3;  2IXH A;  1S0C A;  2BRT A;  2NLR A;  3NWK A;  2JX9 A;  3VBU A;  2BGP A;  5A3M A;  2UUR A;  3WHU A;  1N3O A;  2O1Q A;  2QQP A;  2LW8 A;  4RN5 A;  4AGR A;  4QXB A;  5JCT A;  1KJR A;  3S7I A;  2DVD A;  2F17 A;  1UAI A;  4XQW A;  4Y1V A;  4MAD A;  5K0U A;  5FZH A;  5A1F A;  1RVF 2;  3Q8A A;  3TYJ A;  1XC6 A;  3WF1 A;  3H1Y A;  4QB6 A;  2Y0O A;  3IAP A;  4PJY A;  3ST7 A;  1HV1 A;  3NVC A;  4UAP A;  4JGZ B;  5A7P A;  3PVO A;  5IVB A;  2VH9 A;  2ZEW A;  2WL1 A;  5F3I A;  1E5S A;  5JI9 A;  1BK1 A;  4ARY A;  1OKO A;  3UKT A;  3POG A;  5CYY A;  4IES A;  1J58 A;  1X9T A;  1JYI A;  1OH4 A;  3W5N A;  3WD5 A;  1HXS 1;  4XDP A;  1I3H A;  3LQC A;  2FDJ A;  5I8Y A;  4K21 A;  1UU6 A;  1VMH A;  3I2O A;  3UGG A;  1LAJ A;  1YQ2 A;  1NCQ B;  2VOW A;  1Y4W A;  1OLM A;  4TLF A;  3LDB A;  3ZFF C;  5IAX A;  1AZD A;  1PO2 1;  4AZZ A;  2ZGU A;  3M8L A;  4QX7 A;  4B8E A;  5LAS A;  3LB9 A;  1K3I A;  1BMV 1;  3WQ1 A;  2WFF 1;  3WNO A;  2HH9 A;  3ZKY A;  3MDP A;  4C1X A;  2VUL A;  2W47 A;  1QQP 1;  2XH6 A;  2LRO A;  5A3U A;  1CQ9 A;  2JE7 A;  1LHU A;  1R08 1;  5F9T A;  4ATF A;  4YNI A;  3I49 A;  4CCK A;  1WW6 A;  3VUO A;  4GKX A;  2J1V A;  4YW7 A;  2IWG B;  4XVH A;  3POI A;  3M3Q A;  4OQ9 A;  1HB4 A;  2XLG A;  4AF9 A;  1XU2 A;  1X9P A;  4EZH A;  4B1L A;  2Q1Z B;  5FQ0 A;  3H8X A;  2XJS A;  3S0M A;  3A0K A;  3OSD A;  3I2J A;  5L73 A;  4CEY B;  2BDR A;  3GBW A;  1QJU 1;  1KJL A;  2JG8 B;  2YG0 A;  3ZXA C;  3LOI A;  2QQO A;  1ALY A;  4FOV A;  3BUC A;  1SBD A;  1W3V A;  2IXK A;  2GP5 A;  4OI2 A;  5BNQ A;  2ZEY A;  2R1B A;  4HSJ A;  1U5Z A;  4Z2W A;  3ACL A;  4XIO A;  1WW5 A;  4QPG C;  2GAL A;  3IMN A;  3VBS B;  1NQJ A;  4BXF A;  2FCV A;  1UX7 A;  2VZR A;  3UET A;  1UYY A;  4IL7 A;  1GNY A;  1MEC 1;  4FFH A;  2JD4 A;  2WNV B;  2ZPX A;  1OLM E;  4XTP A;  1S2E A;  2NN8 A;  3MHZ A;  2XDV A;  5T50 A;  2RR1 3;  1GLH A;  5HI0 A;  5LZ6 A;  3BCW A;  2A3W A;  5F39 A;  5T5L A;  3T3Y A;  1YO8 A;  1MVE A;  5LK7 B;  5B4X A;  4KWU A;  1XPW A;  4LBJ A;  1CWP A;  2ARE A;  4RHV 3;  2C9K A;  1OUX A;  3CEW A;  5FZ0 A;  4LBK A;  5FY1 A;  5D2A A;  3BTY A;  1ENQ A;  4LLO A;  1PM7 A;  3VDC A;  2H6C A;  4JGZ C;  3L2H A;  4XJZ A;  5EPA A;  5FRA A;  4GMP 0;  5A3L A;  1AR6 3;  1UN1 A;  1AYM 1;  2W5F A;  1C28 A;  1F35 A;  3LWC A;  4A6O A;  1JXN A;  2G9F A;  4A7Z A;  4ZZ8 A;  1X36 A;  3UV9 A;  4GB3 1;  4FPJ A;  4QPY A;  3H8O A;  2NM1 A;  4OHV A;  5C7G A;  2Z42 A;  3IKW A;  5KC5 A;  3ZXE A;  2WNO A;  1IQA A;  5CKM A;  1NCR B;  2R07 3;  3S6P A;  2HWE 1;  4WM8 B;  2HWC 3;  4EE2 A;  1ASJ 2;  3ZXL A;  4O9G A;  1BZW A;  1R64 A;  2P6H A;  4PHZ A;  2Y6L A;  5CKQ A;  2R49 A;  5BUV A;  2A71 A;  1GIC A;  1ULP A;  3M7A A;  4YSF A;  2YGL A;  3MLL A;  5CG8 A;  4AVB A;  1MS8 A;  3E6B A;  1QJF A;  5DUV A;  1OPO A;  5A80 A;  1HN1 A;  1SCS A;  2A5Z A;  5GLW A;  2PHF A;  1CN1 A;  4BIO A;  1J1T A;  2WLP A;  2EAA A;  3OBT A;  3THT A;  3BU7 A;  1BCX A;  1VBE 2;  1CAX A;  4AI1 A;  5JMO A;  3B94 A;  1PNG A;  3C7G A;  3QCW A;  3D3A A;  3LPF A;  5EFU A;  5H9Q A;  4CEY C;  4MGS A;  1ENS A;  1ZZC A;  1ND3 B;  2ZAC A;  3I54 A;  5JLV A;  2JG8 C;  4AI0 A;  1HRI 3;  4DIN B;  3SCF A;  4CP0 A;  2AC1 A;  3KB5 A;  1NKG A;  3C3V A;  5FZO B;  4AI9 A;  2VZU A;  3HNY M;  4PLN A;  4F7Z A;  1QNY A;  2XLF A;  1NT0 A;  3I7D A;  3KLS A;  4ONU A;  5DAQ A;  4CDU B;  4MV2 A;  1DGR A;  4OHX A;  1W2T A;  5FZ3 A;  1L3J A;  1QJY 2;  5FYY A;  3RZG A;  2B45 X;  3POB A;  2WNV C;  4AVC A;  2WC2 A;  4HL0 A;  2WA3 A;  5LK5 A;  3T2T A;  4Y4Y A;  3USU B;  1RUN A;  4LUL A;  4XJU A;  1KFX L;  5E6H A;  4BM8 A;  1XOY A;  5GLV A;  4AEM A;  4MHR A;  2OKX A;  3MLJ A;  1FOD 3;  1LHN A;  2WS9 3;  4AI3 A;  3ZM8 A;  2D3R A;  1OOP B;  3JD7 1;  1Y9Q A;  3H50 A;  4LBQ A;  2GC1 A;  3BKZ A;  3JBG 1;  4QX3 A;  5FPZ A;  1GFF 2;  4ASL A;  3LEM A;  1R09 3;  4D8M A;  4KU8 A;  1NAE A;  4CEW B;  2KD7 A;  1WA6 X;  1X33 A;  4PF5 A;  4Q0V A;  1FAT A;  4MGI E;  2RS3 3;  4NR1 A;  1H8T A;  4URT A;  2PN5 A;  1V6M A;  4MGK E;  3ZYR A;  4E4H A;  3K2O A;  4AVS A;  1FI2 A;  4A3Z A;  2EA7 A;  1RVF 3;  1TMF 2;  2WWJ A;  3R4D B;  2Q8D A;  4XHB A;  3J8F 1;  2R04 1;  1O3T A;  1NZC A;  1AHS A;  3GJA A;  4GIQ A;  1NCR C;  4XUT A;  1MS5 A;  4WM8 C;  3IN9 A;  4UW5 A;  3ZSJ A;  1UW8 A;  4N43 C;  3AFG A;  4FP2 A;  2BEO A;  2NP0 A;  5CFD A;  4NIA A;  4HG6 B;  2AEY A;  2VQT A;  5LBE A;  3KZ4 C;  4BHP A;  1M06 G;  1KQR A;  2J22 A;  2VUC A;  5K9Y A;  1FXZ A;  2QQU A;  1R1A 2;  5JIA A;  4LHL A;  2BWC A;  1H2L A;  5E8A A;  3RJ2 X;  4XAA A;  1IKQ A;  2CAV A;  2WT2 A;  3RNS A;  2BGC A;  2O8Q A;  2TNF A;  5KHK A;  3I3E A;  1LGB A;  3A4U A;  4HLT A;  1TQ5 A;  3OEB A;  5FP7 A;  2VNV A;  3WUC A;  3PU8 A;  2C5D A;  3RWK X;  2JIJ A;  4QGM A;  2C24 A;  4KG0 A;  1CZT A;  4Z8B A;  3TN9 1;  3UK9 A;  4CTE A;  2E7T A;  1WCK A;  2B7Y A;  2ZMK A;  4LIV A;  3U4S A;  2ZGK A;  3OGR A;  5F1R A;  5J09 A;  1UZZ A;  3O0V A;  4ARX A;  4G9S B;  1LB2 A;  4FI9 A;  4XBN A;  2X09 A;  4V2V A;  1C3H A;  3KCX A;  3E6C C;  2ES3 A;  4IEQ A;  4YM3 A;  1UIJ A;  4IER A;  3WW1 A;  4IEY A;  1IZ3 A;  1ZBE 2;  1H8V A;  1XB9 A;  2JDU A;  3J7H A;  1NY7 1;  1RUE 2;  2GN7 A;  3NAP A;  3VBO C;  1VBC 1;  1CZS A;  3DKQ A;  3OD0 A;  3P3P A;  3KGZ A;  2GMM A;  3ETQ A;  2JB4 A;  1CR7 A;  4DNY A;  1PVC 2;  3NW4 A;  1ULE A;  1UX6 A;  5GAL A;  1Q56 A;  1HIX A;  1OOP C;  5KHG A;  4YVW B;  4YZ5 A;  5DPN A;  2I74 A;  2BWA A;  3B7M A;  3ZFE B;  4WBB A;  4COW A;  3VKF C;  1UU4 A;  3N7M A;  1W8H A;  5HV4 A;  2VCC A;  3ACF A;  4AW7 A;  1G9A A;  1MPX A;  1QDO A;  2W91 A;  3N9Q A;  2OX0 A;  4FOW A;  2Q4S A;  4GA9 A;  3UJO A;  2QZ2 A;  4XCA A;  2RS1 1;  4XEZ A;  5C33 A;  2ZGP A;  4N90 A;  4FBF A;  3O1M A;  1VAM A;  3EMR A;  5JAX A;  3ZSM A;  1OQ1 A;  4TYS A;  1W8U A;  2ZBJ A;  1SLA A;  1BBT 2;  3AJZ A;  1SPP A;  2VG9 A;  3CIH A;  2ZJC A;  4OMD A;  4A45 A;  1RUC 1;  2JDP A;  2ZGQ A;  3VKL A;  1IS3 A;  1TME 2;  2QQN A;  4D0Q A;  4DMI A;  4QQH A;  1D0G A;  3N7K A;  1H30 A;  4HKW A;  4Y22 B;  1LES A;  2PFW A;  4NUB A;  1KS4 A;  4LBQ B;  4RL7 A;  1PM4 A;  2VMI A;  5FMO S;  1RUF 2;  1XBF A;  2C9A A;  1EY2 A;  2DCT A;  4RSU A;  5BV6 A;  4IGQ A;  2R30 A;  3RSJ A;  3QH7 A;  4LBM A;  4HK8 A;  1DLL A;  1IKP A;  1RMU 1;  4B7E A;  1XU1 A;  4ZON A;  3VD4 A;  1GYK A;  1YFY A;  3ALQ A;  3OOX A;  1C8M 2;  5J3U A;  4CE8 A;  3TEZ A;  1OD5 A;  3VB9 A;  1L7R A;  2NYY A;  4UYB A;  4YGE A;  3AB0 A;  5ERL A;  5FUN A;  2HWB 3;  3FMG A;  1V0A A;  3N9M A;  2X5I A;  1ONA A;  5CAZ A;  2RHP A;  2VEC A;  4AE2 A;  4BQ4 A;  4IGP A;  4ASK A;  2GZW A;  4LIU A;  4PBO A;  3AZW A;  1ENR A;  4FT8 A;  1JTZ X;  4S2H A;  1STM A;  1LJ7 A;  3G6J B;  1H0B A;  1LRH A;  5EWS A;  4Q4V 1;  3WV6 A;  3O1T A;  3N7J A;  1YFW A;  2D6L X;  5BXX A;  4MYE A;  4DXZ A;  2WNU B;  3KD4 A;  5EQU A;  1ZBA 1;  2PHD A;  4PIX A;  2WQZ C;  5BNN C;  4ISR A;  4YVW C;  3S30 A;  5JZG B;  1JZ7 A;  1TNF A;  1W2A X;  2JDY A;  1RUI 1;  2NMN A;  1ZZB A;  4WM7 A;  4L92 A;  3I2K A;  3ZFE C;  3AMN A;  5FZL A;  2AUY A;  4IE4 A;  3W20 A;  2XL9 A;  3BPZ A;  4XBL A;  4IEV A;  4ZU4 A;  2DV9 A;  2YZ4 A;  1S0G A;  3USS A;  1CZV A;  2VCA A;  2CTV A;  3M3E A;  3UL2 A;  3C7E A;  2YPD A;  4H7M A;  1X8M A;  1YQ5 A;  3C7F A;  3AKP A;  3VBH B;  2CGP A;  4Q26 A;  4Q4Y 3;  2YUE A;  1QIQ A;  2MEV 1;  3SCG A;  1D4M 1;  1DGR N;  3ABZ A;  2IC1 A;  3OGJ A;  3I3D A;  2VUD A;  3Q8E A;  3PU3 A;  3KS7 A;  4YZ2 A;  2XUE A;  1IG3 A;  3MIE A;  1CIY A;  2LS6 A;  4NAM A;  4CPB D;  1SZB A;  2ZZQ A;  4DXT A;  4OVE A;  3OPW A;  5I93 A;  1PO2 2;  1TMF 3;  4Q4X 3;  1KDM A;  5KXE A;  1VBB 1;  4XFA A;  3WG1 A;  3IAQ A;  1BMV 2;  2WFF 2;  1LOC A;  1W90 A;  1W04 A;  5JVV A;  2LM3 A;  3B00 A;  2Q1F A;  5CZK A;  1YRZ A;  1QQP 2;  1ND2 C;  2GNT A;  2XGX A;  3PUR A;  1H4G A;  1R08 2;  2Y6G A;  4L2N A;  5A7N A;  2OZ6 A;  3WHT A;  1OLR A;  1RUG 1;  5LEK A;  1RUO A;  3GHM A;  4JGY B;  4BXS V;  4QKB A;  5I0T A;  3CKH A;  1UYX A;  3DKW A;  5DUU A;  2ZS6 B;  4CDX A;  4ES8 A;  1XNK A;  2WDB A;  2RG4 A;  1WGP A;  1EAH 1;  1AYN 1;  2YBS A;  4XUQ A;  1QJU 2;  4YM0 A;  5C9A C;  2GN3 A;  3FFZ A;  4PDW A;  4DEV A;  1ULD A;  2VOT A;  4I02 A;  4GWM A;  4R9A A;  2VMF A;  3FUQ A;  5A32 A;  5GZG A;  5EJ1 B;  2R06 3;  3VHO A;  4XCB A;  5J48 A;  3UGH A;  2WNU C;  4BK5 A;  2W2I A;  1AR8 3;  1XSR A;  1URX A;  2RM2 1;  5JZG C;  3RZH A;  1C5H A;  5FO8 B;  1MEC 2;  3FHA A;  4B4R A;  3NJZ A;  5KXB A;  1Y3T A;  1UY3 A;  1O3S A;  1OLQ A;  1EPZ A;  1POV 3;  1H4H A;  1YJK A;  1ZBE 3;  4P9W A;  4RGG A;  5FRE A;  3HVD A;  3M2M A;  2PMW B;  3PTR B;  2OZJ A;  2X5I B;  4X8N A;  2ARB A;  1J59 A;  2Q5T A;  2PXJ A;  1PO1 1;  3BAL A;  1CJD A;  3LFI A;  4K3U A;  4UFL A;  3KF3 A;  2VXR A;  1AYM 2;  2V73 A;  4JHZ A;  5SV5 A;  3TNQ A;  4IV3 B;  3VD3 A;  4HN1 A;  1PGS A;  1QY4 A;  2O8O A;  3VN4 A;  5FZI A;  3QH6 A;  4GB3 2;  5FK8 A;  1O5U A;  1CAW B;  2WRA A;  3EQE A;  4LQR A;  1UIK A;  1Q8O A;  4K6B A;  5ANQ A;  2IZW A;  1HV0 A;  2HWE 2;  4FCA A;  1L7Q A;  4GAZ A;  2KM2 A;  4WM7 B;  2ZAA A;  4RQP C;  2VZT A;  4A4A A;  2JKX A;  3VKM A;  3SH3 A;  2DTY A;  1UZ0 A;  2DUP A;  1W39 A;  2E33 A;  2NMO A;  3D8C A;  3HJR A;  3V65 A;  3BTA A;  4YLZ A;  5A3T A;  4JGY C;  2ZHK A;  5A6X A;  4OI4 A;  2JB8 A;  2DUR A;  1OSG A;  2BBA A;  1KEX A;  2PA7 A;  1AR7 3;  2D40 A;  2P6C A;  5F5I A;  4QU1 A;  2XWB B;  4QQ2 A;  2Q8O A;  2HWD 3;  1U0A A;  4YAR A;  4LO6 B;  4MH0 E;  1Q8P A;  2ARC A;  3K75 B;  4HKL A;  2H0B A;  3ZR6 A;  5K4L A;  3D6E A;  4BE3 A;  4RR3 C;  4X8P A;  1GNZ A;  2Y33 A;  4L0P A;  4YFZ A;  4DXS A;  4XFF A;  4KWK A;  1NLR A;  1W6N B;  4RFT 0;  4TLG A;  5AC9 3;  4DRV A;  3ZSL A;  2VNR A;  2GC2 A;  5LWB A;  5LCW L;  4QQO A;  1OFN A;  4YW6 A;  3S5Q A;  5F5C A;  2VMD A;  4ZZ5 A;  2GAU A;  3N9L A;  5FY4 A;  5FY7 A;  3UNP A;  2R32 A;  1UF2 C;  3VBR A;  3RFR A;  2QE3 A;  2VBD A;  3DYO A;  4Q0P A;  1OKQ A;  3ZFF A;  2LTN A;  4XXA A;  2ERF A;  3ZDV A;  5JSP A;  2EVX A;  2VMG A;  3KV4 A;  4AOC A;  5LW9 A;  1N3P A;  5J98 B;  2BVB A;  2BNO A;  2IFW A;  2A6V A;  2KXL A;  2O14 A;  3BOP A;  3MIB A;  4R9B A;  4XF4 A;  5EHD A;  5FYU A;  3WOG A;  4BQ3 A;  1JZ6 A;  3JD7 2;  1WWY A;  3JZV A;  3V0A B;  3JBG 2;  4M3C A;  4SLI A;  3I3Q A;  2XL7 A;  5FZD A;  4KL1 A;  1AL2 3;  4NN0 A;  1COV 2;  3P3N A;  3SEP A;  4P9Y A;  1CD3 G;  2LUW A;  4M3C F;  1RHI 2;  4IV3 C;  4PDW B;  4EN7 B;  1ZRD A;  1J84 A;  3R0R A;  5DZE A;  5APA A;  3FFQ A;  3WW3 A;  5LEJ A;  1ODM A;  3HNM A;  4UT5 A;  3QLQ A;  1CAV A;  1S0I A;  5IK7 A;  3J8F 2;  2R04 2;  1PX3 A;  5JI7 A;  3GF6 A;  2MNG A;  2BBV A;  1V6J A;  4NRM A;  4Y1X A;  2JEM A;  1DGW A;  1H1I A;  2UYB A;  2RDR A;  1LOF C;  4Y1Y A;  4KGG A;  4UF0 A;  1SFN A;  4XFB A;  5LA2 A;  2OQ6 A;  2V5D A;  2ZXQ A;  3DUI A;  4FP3 A;  4LXL A;  4J6G A;  3MZH A;  3B93 A;  4QPG A;  4FFI A;  3FE5 A;  2QDN A;  2VZP A;  2LRP A;  2XR4 A;  2X8K A;  4YGB A;  4YVS B;  2W9X A;  5FTT C;  2DVF A;  3SIS A;  1GP4 A;  1GQH A;  3PHM A;  3SMH A;  2OII A;  3MV0 1;  2E32 A;  5CKN A;  1RTV A;  1PO2 3;  2C6S A;  2VO5 A;  3WNL A;  3K77 A;  4UFM A;  1WCD J;  2E51 A;  4AVT A;  1G8W A;  5A6Z A;  3LGR A;  4BLJ A;  1S2K A;  1QJX 1;  4M3C E;  4C8D A;  2WSU A;  3KT7 A;  2HWF 3;  3ZIX A;  5IK8 A;  3Q8B A;  4C0B A;  3TN9 2;  4QGN A;  2BFU S;  4JGZ A;  4NRQ A;  3FLR A;  1MZF A;  1SG3 A;  1FX5 A;  3V64 A;  3BOD A;  3PUI A;  1VMF A;  4NOT A;  4YG0 A;  3M4F A;  2ZGN A;  4S2F A;  5DG1 A;  2BU9 A;  4QDQ A;  2W52 A;  2WAO A;  3N35 A;  5EZW A;  3VL8 A;  1QJU 3;  4LMF A;  1NY7 2;  2J1A A;  1VBC 2;  3R05 A;  3WP6 A;  2EIC A;  4MXW A;  2GNM A;  2BTV C;  1RJ8 A;  3O1S A;  1UMH A;  3FJS A;  1ZZ7 A;  3A0N A;  1S0E A;  2P17 A;  4E8D A;  3PME A;  2Q8E A;  5JOX A;  2FDK A;  5GZF A;  2VOX A;  4D69 A;  4LT5 A;  3OUI A;  4PLM A;  1MEC 3;  4NHK A;  2IXJ A;  3PIG A;  3N3H A;  4ZY9 A;  4XAC A;  2RS5 3;  3HD8 B;  1OHF A;  5CU1 A;  3WG3 A;  4KH9 A;  3SKV A;  3VL9 A;  1XQN A;  1XJA A;  2RS1 2;  2VE1 A;  5BPX A;  4AFM A;  5T52 A;  3EO6 A;  5T5P A;  1VBA 1;  3HT2 A;  4LUK A;  2FCU A;  5FYI A;  3Q9O A;  4CEY A;  2C1F A;  1JU4 A;  2JDM A;  4L9B A;  5FYS A;  2RE9 A;  3GBG A;  4XUR A;  4A42 A;  2XHK A;  2JG8 A;  3QBQ A;  4Y1Z A;  4YZ4 A;  5DDJ 1;  1UKG A;  4HPK A;  1DYP A;  5A1L A;  4IE6 A;  1RUC 2;  1E5H A;  3PUA A;  5G05 L;  4BQY A;  3ZXF A;  1F8V A;  2NPI A;  3ZFF B;  5LBC A;  1V9U 1;  3H3L A;  4CCJ A;  2XQX A;  3PUQ A;  2TBV A;  1VBD 3;  3VBS A;  1HRV 2;  4ITC A;  5F5Q A;  4FPF A;  2W1S A;  3WF2 A;  4YVS C;  4MOA A;  3DL3 A;  4XUP A;  1BLZ A;  1A3K A;  2WNV A;  1DIW A;  2RMU 1;  4JHT A;  5FLI A;  5JR2 A;  4LA3 A;  1ZZ6 A;  4YW2 A;  1ZRF A;  2WYS A;  2XOM A;  5DAB A;  1RMU 2;  1HW5 A;  3I3B A;  4NO4 A;  2R7E B;  4C91 A;  1C1F A;  3HAG A;  3QOP A;  2Q1M A;  4CCL A;  4Q29 A;  2BZD A;  4E4D X;  1DZR A;  1W8T A;  3AMM A;  3HR9 A;  3JB4 C;  2QFE A;  3NQH A;  4N9H A;  2XJP A;  2LAL A;  4D6S A;  1POV 0;  2PHX A;  4LK6 A;  4UF0 B;  4HFS A;  4HKO A;  3ETP A;  3KV9 A;  2WR9 A;  3NKT A;  3OY8 A;  1OVS A;  3WT3 A;  2QTW B;  4QPG B;  2B8M A;  4Q4V 2;  3PMS A;  3GM8 A;  1E5R A;  4XF9 A;  5HCB A;  3ZN5 A;  4BQ5 A;  1NCR A;  2VMH A;  3UKN A;  4WM8 A;  4LR4 A;  2Z4F A;  2XQR A;  4IEO A;  5L9V A;  4CDQ B;  4N43 A;  2FQP A;  1UU5 A;  1V6O A;  3OUJ A;  2AZ5 A;  3WNP A;  3ZDS A;  2PTM A;  4N8M A;  1EP0 A;  3ELN A;  1RUI 2;  4CXX A;  2V09 A;  1JZ4 A;  2XWJ B;  3OF1 A;  1EYB A;  1T2X A;  3LF7 A;  4LHN A;  4URA A;  5IT6 A;  5FP3 A;  2DU0 A;  4Y20 B;  1W9S A;  2PLV 2;  3KQ4 B;  4SBV A;  4OQ8 A;  3D0J A;  4I2O A;  2ADE A;  2W39 A;  3K4D A;  3JD7 3;  1ND3 A;  2CDP A;  3WSO A;  3FLT A;  3LA3 A;  2A70 A;  2A6W A;  1JW6 A;  1QMJ A;  5FZO A;  3DPR B;  1COV 3;  1D4M 2;  3E1F 1;  5FYB A;  2W87 A;  3WX5 A;  1HKD A;  2BOJ A;  5JMC A;  3WF4 A;  1RHI 3;  1GZT A;  2YHJ A;  3U10 A;  4AHX A;  4YW5 A;  2NZ9 A;  2VTX J;  4CDU A;  2EXJ A;  4MXW B;  4R8H A;  1S0D A;  1CGP A;  4ATE A;  1DGW X;  5IVE A;  3T2Q A;  5C3R A;  1VBB 2;  3CJX A;  4FTS A;  4GMP 1;  3USU A;  4YW3 A;  1C57 A;  5GLU A;  3NL1 A;  3S7E A;  3VBO A;  4EV0 A;  1UYP A;  3AZX A;  2ZGS A;  3KGL A;  1ULG A;  4N9I A;  5FPX A;  4FPO B;  3KM5 A;  2XKO A;  4C0H A;  2ILM A;  4DQA A;  3O1R A;  1RUG 2;  1OOP A;  4Y5T A;  4AQS A;  4D3W A;  5BYN A;  3WDW A;  2QVS B;  2VJX A;  3ZXK A;  3DEC A;  1QH6 A;  3NV4 A;  4O7X A;  1G6N A;  4QX8 A;  4R9D A;  4TXW A;  4LO4 B;  2W92 A;  1EV1 3;  4JKM A;  4NII A;  1A34 A;  4CEW A;  4CPB A;  1IQD C;  1UCX A;  4OYU A;  2JG9 B;  4XDQ A;  4HPK B;  4I0W B;  1DQ1 A;  4XOG A;  1IGO A;  2YU2 A;  1EAH 2;  1AYN 2;  1JU3 A;  5FZM A;  4F83 A;  5EYY A;  3VLB B;  4DO0 A;  3N9N A;  5GLT A;  2AYH A;  5T54 A;  2Z5W A;  1O6U A;  2XUM A;  3K4A A;  5DN2 A;  2QQW A;  4QKD A;  5C71 A;  4XDO A;  3K4Z A;  1F4H A;  2YV8 A;  5L9B A;  1C5I A;  2ARA A;  4CDQ C;  1N1V A;  5IHR A;  2RM2 2;  1OUR A;  3AZY A;  2WUH A;  2I07 B;  1YC6 1;  2VQA A;  1WCQ A;  1XXN A;  3DGT A;  4AGV A;  3RS6 A;  4M0H A;  4GUL A;  1K45 A;  1OH3 A;  4MGQ A;  4AAP A;  4GQ7 A;  3AXE A;  2DWR A;  4GKY A;  4DRR A;  4Q4W 3;  2GH8 A;  5I0S A;  2FDI A;  4WVZ A;  2YXS A;  1YIP A;  1VBC 3;  5BNP A;  5ABJ C;  3OD4 A;  1QOO A;  3JB8 A;  2FMY A;  3I8T A;  2CAU A;  3KVA A;  2GMP A;  4MO3 M;  3I2I A;  3I97 A;  3LIG A;  4P9G A;  1PO1 2;  3ORJ A;  3THP A;  1F2N A;  5CNA A;  2AH2 A;  5I91 A;  3AKQ A;  3TEW A;  3OY8 B;  1YIF A;  3K48 A;  3LE0 A;  1YFX A;  3DPR C;  4IEW A;  3ILN A;  4U36 A;  2W08 A;  2J1R A;  3CBN A;  3WG2 A;  4KMQ A;  3FC0 A;  5JXH A;  1WLD A;  1FMD 3;  2D7F A;  1SMV A;  1WMD A;  2DFC A;  4N43 B;  1X50 A;  3C7H A;  3T1M A;  4E8C A;  3VGI A;  5CFC C;  2GDF A;  2VMC A;  1JOP A;  5T5J A;  5A3N A;  5C8C B;  1WMX A;  4QWN A;  5F32 A;  1Q43 A;  1NXD 1;  1RUC 3;  1S4C A;  1RGS A;  1YUD A;  4QDR A;  3BOW A;  4D6Q A;  1YQ6 A;  1BQP A;  3LSD A;  5HCH A;  4JV4 A;  4FAG A;  1XYN A;  1GR3 A;  1W8O A;  4H2A A;  4YVW A;  5BNO C;  2PEL A;  1UKR A;  3AYC A;  1ZRC A;  1ACC A;  4PLO A;  4MHU A;  1D2S A;  1HRV 3;  3GZU C;  3BU0 A;  3ZFE A;  1O8S A;  4XC9 A;  1VMJ A;  1UOB A;  2JE8 A;  2WQ8 A;  4FFF A;  4K40 A;  4YW4 A;  2JG9 C;  4EN8 B;  1W6Q A;  1WKY A;  3BTZ A;  2P3K A;  4GJY A;  5DAV A;  3ZN6 B;  4D6R A;  1JHN A;  1JOJ A;  4KG8 A;  4HXC A;  2BFU L;  1RMU 3;  1LGC A;  1WZX A;  4XQD A;  1Q8Q A;  4DXR A;  2W46 A;  4XAB A;  5IJR A;  4COY A;  3MIG A;  1UYZ A;  1YJL A;  4JKK A;  3FX3 A;  3LA7 A;  1Y43 B;  1K42 A;  2QQM A;  2UYA A;  5FK7 A;  2FMD A;  1WW7 A;  1SAC A;  3KSC A;  3T0A A;  3VBO B;  2A75 A;  5B2G B;  5BY5 A;  1ZZ8 A;  2F4L A;  4ZXE A;  2JXA A;  5A7O A;  2VBP A;  3WQ7 A;  4Y22 A;  4BDV B;  1OI6 A;  4IE5 A;  3WW4 A;  1LEC A;  2Q0A A;  4B1M A;  4Q4V 3;  2C0Z A;  2D6O X;  2WZR 2;  1VE0 A;  3MW4 A;  1JYX A;  4IV1 B;  1MS3 A;  3MIC A;  2VZ3 A;  4FPL A;  4PIY A;  1W8F A;  1BXH A;  2MPF A;  1YEW A;  2ZHN A;  4RS5 B;  4WVV A;  3B01 A;  3AMQ A;  3IDB B;  3POE A;  3THD A;  1XNT A;  3NO8 A;  4IE7 A;  5AFE A;  5FZ6 A;  1Z7S 2;  2WQ4 A;  2OUJ A;  2C4X A;  4LO8 A;  3RMX A;  3TWI A;  1K12 A;  3ZVX A;  2RDQ A;  2PLV 3;  1JZ5 A;  4CXY A;  4XMI A;  4HVR A;  4K8F A;  3TB0 A;  1US3 A;  2DTW A;  2RVA A;  4RYD A;  5H9S A;  2HYX A;  4HZF A;  4W6W A;  5JR7 B;  5FWJ A;  5C9A A;  4MG2 A;  4AVA A;  3CU7 A;  4IQP A;  4RA0 A;  4CSW A;  3CJI C;  3VHP A;  3FWE A;  5C8C C;  1W9W A;  3DEM A;  3VV1 A;  1LHO A;  4QT6 A;  4H14 A;  2UWC A;  3INA A;  1QHD A;  4PQQ A;  2DVG A;  4CCE A;  2HBU A;  2WNU A;  3P5B A;  4GZ9 A;  3RWN A;  4C90 A;  3IT8 A;  4LOS A;  3T09 A;  4AHY A;  2YC4 A;  1VIW B;  3ACG A;  4QM8 A;  5JZG A;  5FZF A;  2YBK A;  1GWK A;  4W8J A;  1WA4 A;  3L2Y A;  3WLU A;  2ZX0 A;  5JOZ A;  1SLB A;  1HX6 A;  1GAN A;  2DCK A;  3H3Z A;  4Q0S A;  1LU1 A;  1ZYB A;  3OBZ A;  2CU5 A;  4CA9 A;  2D6M A;  2OA2 A;  1DQ0 A;  1QJX 2;  2DF7 A;  2VVE A;  3ZMN A;  4YM1 A;  1S2B A;  1CPM A;  4M4R A;  4A7Y A;  1FV2 A;  3VBH A;  1UY2 A;  4KNC A;  1I6X A;  3B9I A;  5M0T A;  4CDW C;  4HK9 A;  4ZS3 A;  4XFG A;  3ZYP A;  2G9G A;  4COV A;  5SV8 A;  4XE9 A;  2GP3 A;  2GME A;  2BOI A;  5DXD A;  1D7P M;  4FQZ A;  3P1I A;  1AYN 3;  3PDQ A;  4QX2 A;  4XPV A;  5I8T A;  2Q30 A;  4TZD A;  3LSE A;  5BNN B;  1QOT A;  4NWV A;  5FR3 A;  2XB6 C;  3HN1 A;  3FHQ A;  1O3Q A;  1NA1 B;  4OFG A;  1O4Z A;  3DXT A;  4BU2 A;  4E4Z A;  3GCW A;  1J3Q A;  2WO1 A;  4H3W A;  3DYP A;  2RR1 1;  2Y6F A;  4IV1 C;  4LHS A;  4XW3 A;  1XRU A;  4BYY A;  1W28 A;  1G9C A;  1W6Q B;  3TNP B;  3GZT B;  4XMA A;  3RYP A;  1HJF A;  1VAV A;  3J4U H;  4RHV 1;  4JGY A;  4RS5 C;  2EAL A;  3UT0 A;  1DG6 A;  1WUV A;  2IUW A;  1HQL A;  3NV2 A;  4YPJ A;  4CCD A;  3IBM A;  3LA2 A;  1U5Y A;  3AVS A;  4OLL A;  3E6D A;  2C26 A;  2Y8K A;  1AR6 1;  2JDH A;  2SLI A;  2AEZ A;  1VBA 2;  2B39 A;  2ZX4 A;  3NV1 A;  4FOQ A;  4OCT A;  5E1R A;  3SH5 A;  5A3O A;  4RR3 A;  3AK0 A;  3KV5 A;  4NID A;  1OMI A;  1AL0 G;  3H0O A;  2RDS A;  2RV9 A;  2ARX A;  3OPT A;  4LK7 A;  4P00 B;  3M3I A;  1CAU A;  4K8R B;  3R6S A;  4H7L A;  1W6M A;  1V9U 2;  2R07 1;  4HVO A;  2HWC 1;  1UOG A;  5L36 A;  1Y9M A;  3MI8 A;  1PGW 1;  4QD2 A;  3EB7 A;  1Q3E A;  1W8N A;  2VUJ A;  3NRU A;  4R4Z A;  1V6I A;  3T4H B;  4FTB A;  1ASJ 3;  3BB6 A;  1LGN A;  5F3E A;  2RMU 2;  3FHI B;  4V2W A;  5KHH A;  1ND2 B;  5JXI A;  2XHN A;  1UY1 A;  5LAT A;  1X7N A;  4I09 A;  2DU1 A;  4YWA A;  1V70 A;  3AZV A;  5DZF A;  4PI2 A;  1CJP A;  1VLN A;  5T55 A;  5A7S A;  1DFQ A;  2E53 A;  4D94 A;  1H9P A;  4QU2 A;  3KHC A;  2FDH A;  3IPV B;  4BQ2 A;  3WCS A;  2YC0 A;  3POS A;  1VBE 3;  2VW1 A;  5FXV A;  2JDZ A;  1C8N A;  2ATF A;  4AHZ A;  1PMI A;  2P3Y A;  1N47 A;  2TEP A;  1PMJ X;  5C9A B;  4IV3 A;  2Q8C A;  3IB3 A;  3ZYF A;  5C70 A;  4XIL A;  3NNJ A;  2K2S A;  5FY9 A;  3GCX A;  1KDK A;  3JU9 A;  5FV3 A;  3AL5 A;  5JPM B;  1BKZ A;  3JUU A;  1CAW A;  4IND A;  4COU A;  5C5U A;  4GWI A;  4CRQ A;  4XBQ A;  1K5M B;  1SBF A;  3OEA A;  1OF3 A;  3VKO A;  2YY1 A;  1NA1 C;  3K3O A;  4QMA A;  3LEG A;  2WO7 A;  1WLC A;  3OGG A;  1QJY 3;  3WP5 A;  3VDB A;  4XET A;  2DUQ A;  1UMI A;  2R0F A;  1ZNP A;  3NNL A;  4CYD A;  1J83 A;  3O12 A;  3TAY A;  4LKS A;  2WS9 1;  4HVQ A;  4XHX A;  4MX3 A;  3POW A;  3RG0 A;  4Y33 A;  4Y5S A;  2VD7 A;  4PCR A;  2EIB A;  3ZFG B;  4P08 A;  3U11 A;  4A44 A;  5L7O C;  5DMY A;  1R09 1;  3R4U A;  5F37 A;  5FY8 A;  4W4Z A;  4OHY A;  1OBN A;  1N1S A;  3SKJ E;  3TEY A;  5HCF A;  1FT9 A;  1H2M A;  2WZR 3;  1J1L A;  2V4V A;  3CZU A;  5FP8 A;  3Q8F A;  5FUI A;  4IGO A;  2RS3 1;  2XLA A;  1WME A;  2CNA A;  2HLE A;  1HXS 2;  1RUD 1;  5A70 A;  1RVF 1;  1W6N A;  1AR9 1;  2XKP A;  2CWS A;  1RXG A;  2XJV A;  4AHW A;  5I0U A;  2ZEX A;  4I0B A;  4YZ3 A;  1JUI A;  3E5U A;  4FSJ A;  4OI0 A;  1IG0 A;  1VB4 A;  1KXG A;  3KCC A;  4N7I A;  3SH4 A;  3K46 A;  4RQP B;  1Z7S 3;  4FAH A;  4AED B;  1RC6 A;  4DB5 A;  1O3R A;  1Y9G A;  2DFB A;  3LDR A;  4BOW A;  5J36 A;  3CF6 E;  1UY4 A;  2GU9 A;  2JDN A;  3C7O A;  2JDK A;  3DN7 A;  2ZX3 A;  4AAX A;  3WDU A;  1I5P A;  4JTO A;  2K9Z A;  3MW2 A;  2I2S A;  5A6Y A;  3GBF A;  4PT6 A;  4UOJ A;  2BPA 2;  4D7S A;  1UOJ A;  5FP4 A;  3RVH A;  3B5L B;  2ETE A;  1R1A 3;  1J3P A;  4AL9 A;  2ZCW A;  2WBK A;  3WNM A;  3V0A A;  1Z0H A;  4LOT A;  3GZE A;  3VDD C;  4A7K A;  3I4I A;  1HN0 A;  4RR3 B;  3TRS B;  3KVB A;  4Q1P A;  2PQQ A;  1YFU A;  2ADD A;  3NNM A;  5LB6 A;  3HPN A;  1CAU B;  1W8Z A;  4LBL A;  1W03 A;  1W6M B;  4ERO A;  4QQP A;  2VBB A;  3IMM A;  3TOJ A;  1K5M C;  1BJQ A;  1KD7 A;  1MS4 A;  2ORZ A;  3CMG A;  4LO7 A;  4OHZ A;  4AQT A;  5F6K A;  1N3Q A;  3EBR A;  1VRB A;  4CU8 A;  1YWK A;  1REE A;  3FBY A;  3O1P A;  2P4E A;  4Q0U A;  3GHN A;  4BME A;  4AQ6 A;  1WD4 A;  4HMZ A;  1RUE 3;  3VZO A;  2VAU A;  5HXM A;  2Y34 A;  2ZKN A;  4YVS A;  2RJ2 A;  3FL7 A;  3ZFG C;  1PVC 3;  3I2G A;  2YYO A;  5F6L B;  1L7L A;  1DQ4 A;  4DPN A;  1NE6 A;  5DG2 A;  4DY3 A;  4W6X A;  1PGL 1;  2BNM A;  2WSV A;  2ZAB A;  4Y4R A;  4F8A A;  3B02 A;  2WO2 A;  1BEV 1;  1GOH A;  1VRH 1;  2WKK A;  4ZU7 A;  4B29 A;  4L99 A;  1NYW A;  1QJE A;  2A6Z A;  3OBR A;  5D8A B;  3RZL A;  4NWW A;  1GNH A;  4JQR A;  4UWD A;  5FJH A;  1DZQ A;  3ZLI A;  2A73 B;  3ZOI A;  1YI9 A;  3AKR A;  4KI5 M;  1D0H A;  4ZXK A;  2WO3 A;  3ROU A;  3X29 B;  1NQD A;  1ZRI A;  3DV8 A;  2CSG A;  3MUY 1;  3I2D A;  1IOA A;  2XJR A;  5EJ3 A;  2FD8 A;  2PQS A;  1AJO A;  1BBT 3;  2CYF A;  4AED C;  4O9E A;  1E5I A;  3OB8 A;  3BN6 A;  1NOV A;  4GWN A;  4CU9 A;  4IET A;  4O65 A;  1TME 3;  2Y0I A;  4UBH A;  3GNE A;  5I0D A;  5FMB A;  1Q8V A;  3L9J T;  3LKJ A;  3WF0 A;  5HCA A;  2EXI A;  5FYV A;  2WZE A;  2YU1 A;  1IS5 A;  1LOA A;  1PVX A;  4BZ4 A;  1SCR A;  1RUF 3;  3ECQ A;  1W0P A;  3W59 A;  2GND A;  1XYP A;  1H2N A;  4JCK A;  2A6X A;  1YQC A;  2RMU 3;  3H1M A;  1A8M A;  1OFS A;  1NLQ A;  1O8P A;  4W6Y A;  1C8M 3;  2HWB 1;  3WZ1 A;  2BNN A;  2MHF A;  1PK6 C;  3F95 A;  1YLL A;  4RD7 A;  2PAM A;  1HDK A;  1ULF A;  1CX1 A;  1H6X A;  4UI9 L;  3BYW A;  4IEU A;  4MLO A;  4NHY A;  2VUA A;  2ID4 A;  3J7N A;  3WF3 A;  5CBL A;  1ZRR A;  4JDM A;  4ORF A;  1A78 A;  4EN0 A;  5IFP A;  3WDX A;  2JKB A;  2YB7 A;  4HAN A;  1XYO A;  3NNF A;  5EP9 A;  3SQO A;  3GDB A;  1QWR A;  1HQN A;  3V0B B;  5GZC A;  1K5J A;  2P5B A;  3ZXJ A;  1H6Y A;  5LBB A;  5I0R A;  4HN0 A;  4XIK A;  2DVA A;  3SNM A;  4QX5 A;  1PIV 1;  3MLK A;  3CDZ B;  2VCB A;  4AYU A;  2X05 A;  3E5Q A;  5D8A C;  2ZGR A;  4EWE A;  2WYF A;  3PLQ A;  4E2G A;  5FPA A;  1AX1 A;  4E4S A;  3UJQ A;  2WT1 A;  3APB A;  2ZA9 A;  2HYK A;  3F2Z A;  1GQG A;  2EIG A;  5KWR A;  4P02 B;  1H9W A;  4Q4Y 1;  4QPI B;  1OF4 A;  5D21 A;  1W2U A;  2D43 A;  2RJK A;  1IHM A;  2DUO A;  3A21 A;  3MPB A;  2PHL A;  5IVJ A;  5IVY A;  1C1L A;  3LAG A;  3FN9 A;  1V6N A;  2BER A;  5FJK A;  4DOU A;  2UY9 A;  2XJU A;  5CA6 A;  3N9O A;  4OUS A;  4RGA A;  5FMO L;  1HXS 3;  3B69 A;  3UES A;  4DUV A;  1DYK A;  5C8W A;  1TMF 1;  4Q4X 1;  3D82 A;  3VHN A;  4CDQ A;  2QKD A;  4JX0 A;  2B46 X;  2VVF A;  4ZU5 A;  4BMB A;  1MQT C;  1MVQ A;  2VPV A;  4GWJ A;  2BUK A;  3RYR A;  2WT0 A;  2WFF 3;  2OW4 A;  4ISQ A;  1SDD B;  1KGY A;  3JQW A;  3ON7 A;  4I3P A;  4Q2F A;  3G7D A;  3BIE A;  2D5H A;  1QQP 3;  2VZO A;  1DYO A;  5FBJ A;  3CNA A;  2VQU A;  5FPV A;  1R08 3;  4AR2 A;  4F3J A;  3U0Z A;  4Y20 A;  1RED A;  1GUI A;  3WNK A;  5H9P A;  2FHR A;  3ZKU A;  4CU7 A;  5KXD A;  4ZHN A;  5ABJ A;  4NRO A;  1GP5 A;  4YFW A;  3J7L A;  3U78 A;  1PHM A;  1SDW A;  1HLC A;  1FPN 1;  2QQL A;  1UWW A;  1F4A A;  1SBE A;  4JRL A;  4COZ A;  3DPR A;  4B7K A;  1GV9 A;  1LOE A;  1CIW A;  1O59 A;  2VOK A;  3MFC A;  2R06 1;  5CB7 A;  1CVN A;  3AP4 A;  3SC7 X;  1AR8 1;  3VBF C;  1OT5 A;  2AGS A;  2QBX A;  2V5Y A;  3MGU A;  1XE0 A;  3A22 A;  4UFK A;  4LE4 A;  4LKD A;  3RDI A;  1XNC A;  5CFC A;  5CG9 A;  2VGD A;  4X6Q B;  2QQK A;  2WWS A;  2XML A;  5FLJ A;  1YXW A;  5FYZ A;  4UFH A;  2RR1 2;  5FZ8 A;  4LNV A;  3AP5 A;  4YG6 A;  1POV 1;  1ZBE 1;  2QDR A;  5EXO A;  2E26 A;  3IM0 A;  4AQ2 A;  4DZG A;  4RHV 2;  2VL4 A;  3ME2 A;  4I30 A;  5BNO A;  3R4S A;  4Z2A A;  3H8U A;  1WCS A;  2B9V A;  2JWP A;  3H9A A;  5A33 B;  5IYY A;  1JYN A;  3NJX A;  5T3N A;  3T2P A;  3U07 A;  3WG4 A;  5KXC A;  2JD9 A;  4QPI C;  1S0F A;  2JG9 A;  3GYD A;  4CCN A;  4DEQ A;  2PAK A;  2D6K A;  5E16 A;  5EV7 A;  1IS6 A;  5EIY B;  2OUH A;  3M1H A;  5FPU A;  1AYM 3;  1AJK A;  2D6P A;  3LEK A;  3TEX A;  4KGQ A;  3BGA A;  1CX4 A;  4GB3 3;  4CU6 A;  3VHR A;  5JWP A;  5IVC A;  5CVR A;  2R07 2;  2HWC 2;  3ILR A;  4QX0 A;  4XFI A;  2W1Q A;  1PGW 2;  5JXJ A;  3WVJ A;  1V6K A;  2B4K A;  2HWE 3;  2UY8 A;  4NAO A;  1JZ8 A;  4LTA A;  4JQT A;  5KR7 A;  2YMZ A;  4CP2 A;  5A6Q A;  4Y24 A;  3ZMO A;  4XUO A;  1JBC A;  3WXP A;  5LA1 A;  2FDF A;  1V00 A;  3B9C A;  2X53 S;  1M4W A;  1RYY A;  2EXH A;  2WN2 A;  3KCY A;  1B35 B;  4LEJ A;  1AR7 1;  3BVC A;  1F31 A;  1FNY A;  2HWD 1;  4LKF A;  5AFB A;  4HBN A;  1SLT A;  5FMC A;  3AFK A;  3ZIW A;  3J9S A;  4LBO A;  4QB2 A;  1I5Z A;  2ET7 A;  3NMB A;  3KT4 A;  2P37 A;  3CHX A;  3VKN A;  3RZM A;  1TVG A;  1SQ4 A;  2WJS A;  1QDC A;  3OYW B;  4NPL A;  4CP1 A;  5AC9 1;  4AXO A;  1F5F A;  3M3O A;  1G9B A;  5LRR A;  4NHM A;  1KRI A;  4YZ1 A;  4FPH A;  5FXZ A;  4QGL A;  3URF A;  1OA2 A;  1RIN A;  3NST A;  1ZBA 2;  1R1Z A;  2AAC A;  1AVB A;  4K7J A;  5A7Q A;  3U75 A;  3TBD A;  4FO9 A;  2XPJ A;  3P6B A;  2RDN A;  4BPZ A;  2ZEZ A;  1GZW B;  1PZ9 A;  5FPB A;  5C8C A;  1AXZ A;  3CJI A;  3U1X A;  4AK3 A;  5J7M A;  4P5Y A;  2ZMN A;  1NLS A;  4YM2 A;  3HEI A;  2WS9 2;  1GZ9 A;  3FUO A;  3H42 B;  1LOG A;  4XYX A;  4M00 A;  3RI8 A;  5ABJ B;  4AEJ A;  3H3U A;  3ITQ A;  1UL9 A;  3AJY A;  3BIW E;  3RQ0 A;  3A23 A;  2BP6 A;  3M3C A;  3MO4 A;  1R09 2;  1LR5 A;  1AL2 1;  4N53 C;  3O14 A;  3V56 A;  5IFT A;  2Z79 A;  3JBG 3;  3PIJ A;  3ZPY A;  4JDN A;  4XZU G;  4QX1 A;  1VB2 A;  1GBG A;  2MEV 2;  3ACH A;  5FZK A;  2RS3 2;  3ZN6 A;  5FUP A;  4FFG A;  1UXZ A;  1X82 A;  5C4W B;  1RUD 2;  5T5O A;  3H7J A;  3IDC B;  2VTF A;  1QNW A;  1AR9 2;  4S2D A;  3VD9 A;  1DF0 A;  1SLC A;  3BI3 A;  2ZZJ A;  1GKB A;  5CFC B;  3W5M A;  3SXW A;  2GC0 A;  3J8F 3;  2R04 3;  3EYP A;  4MGZ E;  5FZ4 A;  3W58 A;  4CDW A;  1HB2 A;  5BNP C;  5FO9 B;  4IE0 A;  3WCR A;  2KA3 A;  3O1V A;  1CPN A;  1D4V B;  3RJR A;  5I8S A;  3VBR C;  3ZPO A;  5BNO B;  2FDG A;  4P9X A;  1B35 C;  2NQY A;  5CIS A;  4IV1 A;  2WZP P;  3KMH A;  4GH4 B;  4E2Q A;  1JMU B;  4LE3 A;  2D3P A;  3K3N A;  1HB3 A;  2QZ3 A;  1DU3 D;  5FYC A;  4WVM B;  1Y7B A;  3OBA A;  4JTN A;  2HWF 1;  4RS5 A;  4YGD A;  5FZ1 A;  5LA9 A;  1JOB A;  5IWF A;  3RMY A;  1GMM A;  2H6B A;  3IZO A;  1W9F A;  3KT1 A;  5F3G A;  2ZTN A;  5IUQ A;  1ZZ9 A;  4BIS A;  5LA0 A;  4AWD A;  2FZ2 A;  3TN9 3;  2BYV E;  5GZE A;  2VW0 A;  3QAC A;  4UW4 A;  1SFP A;  3H8R A;  3W9A A;  5FZ7 A;  3WW2 A;  2W1U A;  2ZX2 A;  1JI6 A;  1LOD A;  4LJH A;  4N7U A;  3SIT A;  2QQV A;  1GWM A;  5FO7 B;  2G9Z A;  2P3I A;  2XG3 A;  1IPK A;  3I59 A;  2O0O A;  3LCP A;  3PUH A;  3WR0 A;  3WQ0 A;  4V1P A;  1S0B A;  2VZQ A;  5KC6 A;  3C8X A;  4ET7 A;  3HBK A;  5K7P A;  3JXS A;  4TTG A;  2OPK A;  1GOF A;  4DFS A;  5IW0 A;  3JCI A;  2DBN A;  2YPJ A;  5LY1 A;  1TNR A;  2ZX1 A;  1PGL 2;  4AI8 A;  4MGT A;  2RS5 1;  3MW3 A;  4OUL A;  1TZO A;  1BEV 2;  1UQX A;  4KWL A;  1SEF A;  1QEX A;  1VRH 2;  4EJR A;  3K51 A;  4XZP A;  3EJK A;  5FCC A;  5JUV A;  2CDO A;  3LZZ A;  3OJB A;  5C4W C;  5KBF A;  2RS1 3;  1B09 A;  1RL3 A;  4P5H A;  1WBL A;  3DXU A;  5H9R A;  1W3X A;  1XSQ A;  2ZHL A;  5ANN A;  3MID A;  3ZYH A;  4WZF A;  1LNS A;  1WW4 A;  2PHW A;  3B3Q E;  3SLI A;  2PHT A;  4LOR A;  5A7W B;  5HV0 A;  1C4R A;  1REF A;  3CJI B;  4CP9 A;  3CO2 A;  2Z2S B;  1F15 A;  1A6C A;  2DDU A;  2VTX A;  5FXX A;  2W0X A;  2VQ0 A;  4XTM A;  2ZHM A;  4UFI A;  2XBO 1;  1VBD 1;  2J1S A;  4B3N A;  1RUH 1;  4Q1R A;  3PUS A;  3GAL A;  3DCQ A;  5BNN A;  2R16 A;  3ZXD A;  4EQV A;  1LHW A;  2V72 A;  1NA1 A;  4Z07 A;  2W95 A;  1NCQ C;  1O7F A;  4H55 A;  1UMZ A;  1LUL A;  4XJ8 A;  5JOW A;  3VBU B;  4GH4 C;  4B4P A;  2D5F A;  4BLI A;  2BJS A;  3AMP A;  4DIQ A;  3WNX A;  1APN A;  1VAL A;  1ZM1 A;  2OT7 A;  2HKX A;  2AEN A;  2YDE A;  2QQI A;  4AVV A;  2ZOE B;  2QQJ A;  4WVW A;  5K0U B;  3ZSE A;  5CIR A;  4FXK B;  1BK0 A;  1HJG A;  5L7O A;  5FXW A;  2HWB 2;  1AUY A;  2A1X A;  4GAL A;  1GWL A;  2W94 A;  4XAE A;  5C5T A;  2BV4 A;  2EAK A;  4CDW B;  3WP4 A;  4PBP A;  5LBF A;  5ACA 1;  1U12 A;  5FZE A;  1LKN A;  1VJ2 A;  2X29 A;  4LUM A;  2YC2 A;  3MV1 1;  2E6V A;  3POJ A;  5G04 L;  3EXU A;  4AEK A;  4EYU A;  3HT1 A;  1HB1 A;  1RUJ 1;  2A3Y A;  1UD1 A;  4J1X A;  4XUN A;  5LY2 A;  4D7Y A;  4DUW A;  3HQX A;  2D6N A;  3SEE A;  2OPW A;  4QQL A;  4YG3 A;  4Z1V A;  1W06 A;  2VOV A;  3N7L A;  4JRA A;  5JOY A;  1MS0 A;  3VBS C;  1ZBA 3;  1ND2 A;  2D93 A;  1AX0 A;  1TEI A;  3WY6 A;  5C6C A;  3ZYG A;  2VNG A;  2XJQ A;  3GXU A;  1QXR A;  1DCS A;  1RUI 3;  5FAX A;  3T1L A;  4BH9 A;  4CXW A;  1VP6 A;  4LLF A;  1PIV 2;  4CUB A;  2FZ1 A;  2CGN A;  4EWD A;  2E63 A;  1QF3 A;  1QXJ A;  3IPV A;  4ASM B;  2VM9 A;  1SHW B;  1BYH A;  3ZSK A;  4I0A A;  2BVV A;  2V4A A;  3VDD A;  4Q0Q A;  5FQ0 B;  3NV3 A;  4Q4Y 2;  1AX2 A;  3HIF A;  1I9R A;  3CZJ A;  1WBF A;  1COV 1;  4I01 A;  3IWZ A;  4NJ4 A;  1RXF A;  3LD8 A;  2F4P A;  4YW1 A;  1RHI 1;  3I59 B;  4OZO A;  4YRD A;  2MEV 3;  1D4M 3;  3POY A;  2WAB A;  4CUC A;  4KBZ A;  3AKS A;  5GZD A;  1K5M A;  3M70 A;  1RUD 3;  4WZC A;  3AVR A;  3ES4 A;  4IEX A;  1CON A;  4Q4X 2;  1PNF A;  1AR9 3;  3EHK A;  3KF5 A;  3WDV A;  4MUV A;  1OXC A;  2X10 A;  3VBU C;  1OA3 A;  2CV6 A;  4FPG A;  5FYT A;  4IEZ A;  4NHX A;  1SLI A;  1VBB 3;  1W6O A;  5CEH A;  1I1E A;  2J1E A;  2W1W A;  3PVB B;  3HMY A;  1OQE A;  1W2O A;  3J7M A;  4M01 A;  2VZS A;  1BVP 1;  2CWM A;  1T6G C;  3T0B A;  1WLW A;  3ZFG A;  5FFO C;  3MBW A;  5K0U C;  1RUG 3;  1QH7 A;  1EV1 1;  1JZ2 A;  3MYX A;  4LHK A;  4MVT A;  2JE9 A;  2Y60 A;  1N1T A;  3ZYB A;  4DUX A;  5A3P A;  3O1U A;  2DCJ A;  3HQU A;  3AKT A;  1ZX5 A;  4MET A;  1FPN 2;  4CP9 B;  2BQP A;  3WEZ A;  1MAC A;  1EAH 3;  1ND3 C;  4QHZ A;  5IVV A;  2Y64 A;  3AM2 A;  3W21 A;  1U5X A;  2R06 2;  2VXJ A;  1AR8 2;  4FXG B;  1PZ7 A;  2FCT A;  4OUE A;  1JN2 P;  1UY0 A;  4RQP A;  5DUX A;  4AED A;  4X6R B;  1RJ7 A;  1TG7 A;  2J42 A;  4CDU C;  1W9Y A;  2I45 A;  3OGS A;  1QKQ A;  1YHF A;  2RM2 3;  3T08 A;  4L97 A;  5F2W A;  3MUZ 1;  4Q4W 1;  1W0O A;  1P8J A;  4Q27 A;  2F6B A;  5FIX A;  5FY5 A;  1O4Y A;  4JDO A;  3ZR5 A;  1IPS A;  5L7O B;  3AMH A;  2WAA A;  1AF9 A;  3UYJ A;  1VR3 A;  1W6P A;  5C3P A;  4ZPI A;  2B9U A;  1DLC A;  1H1M A;  2D98 A;  1CAX B;  2HEY F;  2L9L A;  2JIG A;  3HBZ A;  5DDJ 2;  1WMF A;  4CZS A;  2TUN A;  3AC0 A;  4AFC A;  5GJ6 A;  4GD4 A;  3U4X A;  1PO1 3;  3WDY A;  4CEW C;  1QXP A;  5A3W A;  4AGG A;  5DAW A;  4KU7 A;  2P1B A;  1Q8S A;  4D7T A;  4XF3 A;  5JXG A;  1PK6 A;  4P9J A;  1BEV 3;  1YCI A;  1DP0 A;  4PF1 A;  1VRH 3;  2WII B;  1FMD 1;  1HQW A;  5LRS A;  2VZV A;  4AI2 A;  3OCP A;  2HBT A;  4CUG A;  3WUD A;  4ZKT B;  2K46 A;  3T2O A;  4PQ9 A;  2PYT A;  4EWA A;  3D0S A;  1KFU L;  4FTE A;  2CGO A;  3VDA A;  1XNA A;  2OS2 A;  1BVV A;  1NX9 A;  4Y3O A;  4Y26 A;  5IK5 A;  1Z78 A;  2W3J A;  2CHH A;  3ENR A;  1HRV 1;  2DYC A;  2XVG A;  3VDD B;  1AR7 2;  1ZRE A;  1HRI 1;  2BW8 A;  2HWD 2;  5FDB A;  1UXX X;  1JYC A;  2XVK A;  3UGF A;  5FZC A;  3III A;  3D5O A;  4LPL A;  3N4M A;  5D8A A;  2H0V A;  5HBA A;  1PMH X;  1FNZ A;  1GSL A;  2YFU A;  3IIA A;  1SFY A;  3PJQ A;  1H8T B;  4Q5O A;  4DY5 A;  5AC9 2;  2VR4 A;  4ES9 A;  4OHW A;  5DQ0 A;  5E88 A;  2E7Q A;  4E2S A;  3OG2 A;  5FKC A;  3AP6 A;  2IXI A;  4NMI A;  1LOF A;  3RPQ A;  3VZM A;  3HN3 A;  1W0N A;  3ZYJ B;  1DGL A;  1W6O B;  1MZE A;  2JJ6 A;  1FOD 1;  5CFD B;  4XXP A;  4BQW A;  5CAD A;  2EID A;  5JIU A;  4GJZ A;  3T4V A;  4CCO A;  3HOB A;  2E31 A;  4UW6 A;  3WIN E;  1MQT A;  2DBI A;  1XNB A;  1W2N A;  3FLP A;  4E9K A;  5IK4 A;  1AL2 2;  2WZ8 A;  3PL0 A;  3AYD A;  4FPY A;  4M0N A;  5L9R A;  2Y6H A;  2CL2 A;  4HT1 T;  2W68 A;  2UWB A;  2QCS B;  2YRO A;  4NPR A;  1PIV 3;  1QU0 A;  4UBG A;  1ENX A;  2PLV 1;  2E9Q A;  5FYH A;  2J1U A;  4EN9 B;  1WD3 A;  2KR2 A;  3WNN A;  3QD6 A;  1H1A A;  4O61 A;  3O1O A;  4EZ4 A;  3VZL A;  1G7Y A;  1FV3 A;  2CY6 A;  4IUG A;  1PZ8 A;  3LEI A;  2WNE A;  5FKB A;  3U37 A;  3ZO0 B;  1JYT A;  3VBF A;  1A8D A;  2PHR A;  3NAP B;  2DCZ A;  1DHK B;  1ZA4 A;  3DYM A;  5J1X A;  1G9F A;  4TSV A;  2G4I A;  1W6P B;  3BPS A;  4QHO A;  3T0D A;  3V0B A;  3NKG A;  3AYA A;  4A3X A;  4MGY E;  5C3Q A;  1QOS A;  2WIN B;  4RGK A;  1IS4 A;  4XF0 A;  3ACI A;  3AZZ A;  5JSO A;  4K20 A;  3H1W A;  4Z92 B;  2HWF 2;  4AFB A;  2DVB A;  2XON A;  4BQX A;  1PK6 B;  1PX4 A;  2P34 A;  3MFA A;  1H8T C;  1RIR A;  1QJX 3;  1XE8 A;  3FBM A;  4J25 A;  4QXH A;  3ZXG A;  2J1T A;  1W8W A;  4XFH A;  1KIT A;  4NPM A;  4BCU A;  4QKN A;  3O7O A;  2BGO A;  3PJY A;  4QPI A;  3RYK A;  3A7Q A;  2B5H A;  5ISL A;  2ZGL A;  3MIF A;  1FYU A;  1SPP B;  4XQ4 A;  5GKA C;  3NJV A;  4P9L A;  3VD5 A;  2SBA A;  1FPN 3;  4XF1 A;  5CFD C;  1MR5 A;  5IVF A;  2EXK A;  2J7M A;  1RB8 G;  1S1A A;  1O4T A;  4KBB A;  3RZJ A;  1JS9 A;  5B4N A;  4Q8K A;  1MZ5 A;  1YNA A;  3VD7 A;  1UPI A;  3MPP G;  1UNB A;  1CES A;  2ZGO A;  1D2Q A;  1NUK A;  2Y26 A;  1UZW A;  4QDS A;  2RS5 2;  3C2U A;  4FOY A;  5F8P A;  1NZI A;  3MEP A;  5FP9 A;  1ST8 A;  1LTE A;  3ILF A;  3PNA A;  2E7A A;  4LBN A;  1MS1 A;  4TWT A;  5FZG A;  3S5A A;  3RGB A;  3N9P A;  1VBA 3;  2WLQ A;  2B42 B;  1FAY A;  4CVU A;  1ULO A;  4P9I A;  4UW3 A;  2HEV F;  3VBH C;  5KHJ A;  1GP6 A;  5DDJ 3;  4I3G A;  1WLT A;  2OYZ A;  3PTY A;  5DZG A;  2D97 A;  2HJI A;  4IDZ A;  3Q8C A;  3U14 A;  5L19 A;  3LFM A;  1U5I A;  2VCM A;  2XBO 2;  1VBD 2;  3NAP C;  1RUH 2;  1UOF A;  3HQR A;  4XFC A;  1V9U 3;  1V6L A;  2ZGT A;  5FZ9 A;  5TSW A;  3WQB A;  4C1W A;  1ASJ 1;  4NIG A;  1DQ2 A;  1H2K A;  1MQT B;  2QUO A;  1JYW A;  1QGL A;  1SLL A;  2WFP A;  2XVL A;  5DUW A;  4L11 A;  4KQ7 A;  2GH2 A;  3GJB A;  1BHG A;  4M4P A;  2QNK A;  3CQO A;  2ORX A;  3KWV A;  4FPE A;  4FQ4 A;  5A33 A;  1NXM A;  4G3Y C;  4YYO A;  4UFJ A;  2FBE A;  1VBE 1;  4Q8L A;  4N53 A;  2Z69 A;  2A7A A;  2A6Y A;  5JSR A;  4JVA A;  1LCL A;  2R0H A;  3FZ3 A;  4ZS2 A;  5ACA 2;  5FMD A;  4BIF A;  4OUM A;  3IDE A;  4QHB A;  1E57 A;  4BQ1 A;  5FBZ A;  4LIT A;  5HXV A;  4LBQ D;  1F5J A;  2IFR A;  3I2F A;  2VVD A;  5F2S A;  3VBF B;  4MSV A;  5C3O A;  2OVU A;  2D44 A;  1RUJ 2;  1W9T A;  4BWO A;  2ZAH A;  1LED A;  3GZA A;  3NJY A;  1XE7 A;  1UZY A; 
#chains in the Genus database with same CATH homology
 3ORJ A;  1W8T A;  2LRO A;  1WCU A;  1W9F A;  1UOJ A;  4AL9 A;  3F95 A;  3UT0 A;  4YW7 A;  4YW6 A;  4LKF A;  1W8U A;  2K46 A;  2WYF A;  4CPB D;  1HN0 A;  4LK6 A;  4LKD A;  3ZYB A;  4YWA A;  1OKO A;  1L7L A;  4LJH A;  1V0A A;  4CP9 B;  1WZX A;  4BQ2 A;  1OH3 A;  1W90 A;  1GWM A;  1GWK A;  1W8Z A;  5D21 A;  3ZYH A;  4BQ5 A;  2Q1F A;  4BQ4 A;  2O14 A;  2KR2 A;  1WMX A;  4CPB A;  4A6S A;  4BQ3 A;  1GWL A;  4CP9 A;  2VXJ A;  1W8W A;  2C24 A;  4LK7 A;  2LRP A;  2JWP A;  3ZYF A;  4LKE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...