2LRPA

Solution structure, dynamics and binding studies of ctcbm11
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
172
structure length
172
Chain Sequence
MASAVGEKMLDDFEGVLNWGSYSGEGAKVSTKIVSGKTGNGMEVSYTGTTDGYWGTVYSLPDGDWSKWLKISFDIKSVDGSANEIRFMIAEKSINGVGDGEHWVYSITPDSSWKTIEIPFSSFRRRLDYQPPGQDMSGTLDLDNIDSIHFMYANNKSGKFVVDNIKLIGALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure, dynamics and binding studies of a family 11 carbohydrate-binding module from Clostridium thermocellum (CtCBM11).
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Hydrolase
molecule keywords Endoglucanase H
total genus 33
structure length 172
sequence length 172
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2012-04-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 2lrpA01
4YWAA 1W8WA 5D21A 1W9FA 1OH3A 4LK6A 1W8UA 2KR2A 3ZYHA 2WYFA 1W8ZA 4LJHA 1GWMA 4LKEA 4CP9B 4LKDA 1WZXA 2Q1FA 3ORJA 4A6SA 4YW7A 1UOJA 3UT0A 3ZYBA 2VXJA 1L7LA 1W8TA 1WCUA 1WMXA 4LK7A 4CPBD 2LROA 2LRPA 4BQ5A 3F95A 1V0AA 1OKOA 1GWKA 4AL9A 4CPBA 3ZYFA 4CP9A 2JWPA 1W90A 4YW6A 4BQ4A 4BQ3A 2O14A 1HN0A 1GWLA 4BQ2A 2K46A 2C24A 4LKFA
chains in the Genus database with same CATH superfamily
2DUQA 4N53C 5KXCA 4XJZA 1LHNA 4MGZE 2XLGA 1EY2A 5LASA 2VPVA 3VZMA 4O7XA 3S7IA 3DPRB 1A34A 4UXAA 5I0UA 4BE3A 4QKNA 4XPVA 1ZRRA 1T6BX 1DYKA 2PMWB 3EBRA 4RQPC 1L7QA 2GMPA 5AVAA 3JB8A 3NV2A 1W04A 1UZWA 2YG0A 3J7HA 4MVTA 4X8PA 5GZCA 5KHIA 2VOVA 5DQ0A 2VVEA 1V0AA 3E5UA 2WZR1 4N43C 1UCXA 3TNQA 3EHKA 2K2SA 1SLBA 2GP5A 2D6PA 5LZ6A 4NAMA 3K4ZA 2V72A 4IEVA 2GZWA 1MS9A 5F32A 2PHXA 4GQ7A 4UFMA 1UIKA 3KD4A 1W9FA 3OCPA 3N9QA 4FSJA 4IE0A 3UGFA 3EMRA 4XCBA 1W28A 1YQ6A 4OCTA 3POEA 2XR4A 1IS5A 2VZSA 3ZM8A 1N3QA 2ZX3A 5JMOA 1H2LA 1WW4A 1FI2A 2QCSB 5C3SA 1CR7A 2Y33A 4OHYA 1H8VA 4PIYA 4PCRA 4KBZA 3TAYA 5IK5A 2WZR3 1VRBA 2ZEWA 1TNRA 5CKQA 3VZNA 1XYNA 1OLMA 4RA0A 4EWAA 1LOFA 2W47A 4GH4B 2W87A 1GNYA 1W3VA 4CRQA 1S2BA 4XBNA 1ND2C 5FKCA 5JUVA 2R062 1DBNA 1K3IA 5F3EA 3T1LA 4LHLA 1MQTA 1YJKA 1C5IA 5DZGA 3WW2A 3ES1A 5CIRA 1QIQA 5A7OA 2WZPP 1UY3A 2KD7A 3I3QA 1H2NA 5LATA 3B69A 4HSJA 5T50A 4DXZA 2PQQA 1VBB2 1UZYA 4BQ1A 4ZS3A 4D6QA 5F5IA 4KGGA 1E5HA 3EXUA 5FK8A 4WVZA 3UGGA 2XWJB 1MQTC 2ZOEB 3F2ZA 4RSUA 4XQDA 1REFA 1W6OA 1NCQC 2GSYA 2H6BA 1GQPA 4CEWC 3POGA 4DRRA 1QXRA 1RIRA 4Q4Y2 1C28A 2BZDA 4LBQB 4AWDA 5D8AC 4QM8A 2R071 4Z92B 1NY72 1TNFA 2VQUA 4YGBA 2Z5WA 4OVEA 1RMU2 5J36A 2UY9A 2XGXA 4XDQA 1XU2A 3GZTB 4AQSA 1FV2A 1PNFA 3I2IA 3W21A 3WF1A 2VOKA 1ODMA 2E26A 1LOFC 1Z7S1 5IFPA 4NUBA 2W9XA 4XE9A 2WLPA 3GHMA 2VU9A 1NG0A 4CDUB 1W0PA 3MIEA 3B01A 4TLFA 3GJAA 2LTNA 1I3HA 3AYCA 1OMIA 3ST7A 2ZACA 3MIHA 3POIA 4WM8B 2JKBA 3HEIA 5FP8A 2DFCA 2EICA 4QM9A 1ZZ8A 1RUJ1 2VZVA 1D4VB 4UW6A 4JDOA 5EXOA 4P02B 5FUIA 1C5HA 3T4HB 1AYN3 3NNLA 3ZLIA 4XABA 1JYTA 2OT7A 2D43A 4RQPA 5LY1A 5IATA 4DEQA 4XOGA 5CA6A 3J26N 3SLIA 1RUG2 4FTBA 2W2IA 3WG4A 2D98A 4LULA 1FMD2 5FRAA 2BGOA 3KV4A 2W1QA 1XSQA 3SEPA 1JHJA 1UYYA 1MS5A 1QDCA 2R49A 2WINB 1DLLA 3R4SA 3ZFFB 1BBT3 2XQRA 2R041 4FQZA 4AI3A 1JOPA 2WNEA 4DFSA 4Z2WA 5FKBA 2BDRA 4QDRA 1AYN1 1J1LA 5SV8A 1KD7A 5ANQA 3RZMA 3ILRA 1RUG1 2YC2A 1AR92 3Q8FA 1GZTA 4Q1RA 5E6HA 1RUE3 1LEDA 2K46A 3LIHA 4IE5A 4P9IA 4UYBA 1S55A 5E88A 1T2XA 4DINB 1UPIA 1GQGA 2R073 5LB6A 1RUNA 1SCRA 4H7MA 3GNEA 5F37A 4XBLA 4Q4X3 4Q4V1 4AEDB 1ASJ2 1MVQA 2B7YA 2YV8A 3DXTA 1J83A 4ONUA 2HWE1 5GALA 3U4SA 4YVWB 1ENQA 3CL1A 5IJRA 1H6YA 1YFUA 2R7EB 2XJPA 3B9CA 4JGYB 3CKHA 1MZ5A 2EXIA 2PA7A 3ZYGA 1LOAA 1X33A 2PFWA 2IC1A 3IPVB 3B7MA 4ZONA 3ZSEA 1HXS2 3NV3A 1ZA7A 2V09A 3ELNA 4B1MA 3H7YA 4LBJA 3KT4A 1DZQA 2B8MA 3MO4A 4LO7A 4QX2A 4ZU5A 3W59A 4QXCA 4CXXA 2WFF1 4L9BA 4A42A 2ZGSA 3KVAA 3POFA 4HG6B 5IVJA 2WSVA 4GH4A 4HPKA 4S2HA 4WVMA 3N9PA 4BLIA 4IESA 1PNGA 1AR83 3DUIA 1W9WA 1D7PM 5FPLA 3AP7A 4FP2A 3WR0A 1UU4A 2R0HA 2ZKNA 2Y60A 5F3GA 3ZIXA 5IAVA 5FZIA 5C8CC 5GM0A 1YXWA 1ULCA 5FZKA 2CL2A 2ZGRA 4ATFA 1EPZA 3HWJA 3T2PA 1TME2 4XMIA 3VBSA 2E7AA 1DCSA 1JZ8A 3CF6E 2W5FA 1HXS1 1N1TA 3K48A 4LQRA 3WOGA 5CKNA 5FZ9A 2NP0A 1I5ZA 2YB7A 1VBB1 4G4FA 3AJYA 1VBA3 4WM7C 3SKJE 3WP3A 4AVVA 1AF9A 1X36A 3VN4A 3NAPB 4OUMA 1QJZA 3WF2A 1VBD2 1JH5A 1QQP1 3O1UA 5A7WB 4XDOA 4CU6A 2QQUA 3AZZA 5FAXA 2ZAHA 5JSPA 1WWYA 4CCJA 2HWF2 3HT2A 1Q8VA 1W06A 1W03A 2VH9A 1AYM2 4IEPA 2X05A 1BHGA 2XUEA 3ZMNA 1ZA4A 2DUOA 5DN2A 1LJ7A 2QQOA 3I7DA 1V6JA 5T55A 2P17A 2XUMA 3RSJA 2JG8A 3WCSA 4AE2A 3RZZA 2ZHNA 2J1RA 1UWWA 2ZHKA 5JOZA 4XJUA 1Q3EA 4FPKA 3FLTA 5FQ0A 2JDYA 1R081 1OLQA 2R042 3I49A 1PZ9A 1YI7A 2IFRA 1TVGA 2X8KA 4FP3A 5FYTA 2CGPA 4D94A 3WSOA 4MHUA 2AZ5A 5FO8B 4CUCA 2VUAA 4CE8A 4PLNA 2CDPA 1K5JA 2E6VA 1PO21 2MEV2 1POQA 1WA4A 2FQPA 2DFBA 5A80A 2P34A 2VW2A 2W1SA 3LE0A 3FFZA 4GKXA 2JIJA 1VJ2A 3ZXKA 4R9CA 4XXAA 4NPRA 1NCQA 1PZ8A 3VKFC 5B2GB 2P3IA 3GZEA 1SCSA 1UPSA 1YO8A 3C7GA 4S2FA 2UWCA 4HETA 1PGL2 1H4HA 1QU0A 4AHYA 1BBT1 2N7GA 1OPMA 1OF4A 2WO7A 1EV12 3AKTA 4P14A 1TE1B 2OA2A 3PIGA 5GJ6A 3AMPA 2QQLA 4XCAA 3MFAA 4E27A 5FJKA 4EWDA 5JXGA 2VMIA 4YVSA 1LGCA 5DUWA 5JCTA 2RR11 1ZZ6A 3C7OA 1NYWA 3OYWB 3H3ZA 5GLZA 2W46A 1E5SA 1QJEA 2DU0A 1ULFA 1UQXA 1H2MA 1LCLA 1QOOA 3D3AA 4FQ4A 5FXVA 1SHWB 3T0BA 3ZXLA 1Z7S2 3FHQA 2J1AA 4R4XA 2CGNA 3I2GA 3ZFFA 4ATEA 5JLVA 1KGYA 5A7QA 1PMIA 4EYUA 2KXLA 4NPLA 5JIAA 3KQRA 2JE9A 1NY71 4BOWA 2EIBA 3BALA 3O1PA 3N4MA 1WW6A 3ZIWA 4KH9A 1QH7A 3RYPA 4YW7A 5C71A 2O8QA 2X10A 2WWUA 4CUAA 1CAXA 5GLUA 1ZZ7A 4LK7A 2W91A 4A7KA 3AVSA 4V2WA 2HWC1 4TN7A 1M06G 3WDXA 1QDOA 4P00B 5IAXA 2PELA 1XNDA 1F35A 1IPSA 1NKGA 4G3YC 5F3CA 1UF2C 3VB9A 3ON7A 2GDFA 3JXSA 1WMDA 4XACA 1ZRCA 3S5QA 4AGGA 1KXGA 3U14A 2I74A 3NJXA 4IEZA 3WNOA 2R1BA 5DDJ2 5FP9A 2Z79A 4D7SA 1NA1B 1QNYA 2JDPA 4IEYA 2QKDA 2ZEXA 4FPLA 2RS51 2NN8A 5IHRA 3ZN6B 1UU5A 1PK6C 3FLPA 1DFQA 1MR5A 2H6CA 2R0FA 3N3HA 3WUDA 4Z1VA 3R05A 4OZOA 5HCFA 3NNMA 1ONAA 3POSA 3BIEA 2VC9A 1V6NA 3LQCA 3KMHA 2Y6HA 1IS3A 1QJY3 4CXYA 4OULA 1OT5A 2XVLA 5CISA 4QDSA 2Q8CA 1VBB3 4NRMA 4FOQA 4ZZ5A 2WIIB 5HPOA 1MS3A 4PIZA 4Y1XA 2E7TA 2V4AA 4RGKA 4YVWA 4LK6A 2VTFA 2VCBA 5FP3A 1MS1A 1Q8OA 1WCKA 1AX0A 1RUD1 1W8ZA 2ZGPA 1NZCA 2PTMA 2ZX4A 3GHNA 2W39A 5T5LA 1RXFA 3M3QA 4E2QA 1GOGA 5K9YA 3DGTA 2JG9B 2HWB3 1W8TA 1YQCA 1W9TA 3JB4C 3PMSA 3MZHA 1IG3A 3TB0A 3W58A 5FZ1A 1OVSA 2Q30A 2G4IA 1GP6A 2FDHA 1X9TA 2UWBA 4Q0SA 5KHJA 1NAEA 1QOSA 3POBA 2ETEA 2YDEA 3C8XA 5LBFA 1RUC3 3O0VA 4JVAA 5G05L 1YQ8A 1RUH2 2VNOA 3FUQA 2D40A 3IAPA 4U36A 4UFHA 3OPWA 4FFFA 3C3VA 4YM3A 1QY4A 4E2SA 3M70A 2XOMA 2HEWF 3DEMA 3LDRA 1HJFA 4AHXA 1PK6B 2R32A 3ENRA 2B46X 5BNPA 5BNQA 1NCRA 1C1FA 3RZHA 3LFIA 3OUJA 5EP9A 2LUWA 4JX0A 1TMF1 2C9AA 1NA1C 4K6BA 1PVC2 2RV9A 3AKRA 4DXTA 3E6DA 4QX8A 1K42A 1N47A 2PHRA 2Q4SA 1X50A 1SDWA 4YW3A 2UURA 5DDJ3 4INDA 3ZSKA 1YQ5A 1HQWA 3DKWA 5KR7A 4QB1A 2X29A 5I0SA 1UO9A 1XQNA 2W1WA 4D0QA 4DEVA 1QOTA 2ARBA 2BP6A 3FN9A 4LIVA 4PLOA 3LFMA 3WDYA 3OF1A 4M3CF 4ZPIA 4E9KA 1AL0G 4NMIA 2JKXA 4BMEA 5A70A 1K12A 1H8TA 3RI9A 4A44A 3ZFFC 2RDQA 4QWNA 5JMCA 4HL0A 1Y9GA 3BOPA 3M2MA 4Q4W1 4EZ4A 3GZAA 2ZJCA 1O8SA 1EUTA 3NMBA 4Y33A 4M00A 4C90A 1DQ2A 5LY2A 4YNIA 1CVNA 1CPMA 1S0FA 3MW2A 3ROUA 1WUVA 4YW6A 1NLRA 3HQXA 4CCOA 3KQ4B 4ORFA 4ET7A 4FPJA 4MYEA 1RUOA 2L9LA 3HN3A 2RMU2 3CIHA 1OUXA 2QQNA 3RJRA 3LF7A 4CDQC 3I59B 4CSWA 4R4ZA 1QQP3 1V6MA 1J58A 2HYKA 3IT8A 3U1XA 2QNKA 3HMYA 4FT8A 3URFA 3RZJA 4LE3A 4Y5Z0 3KCCA 3M3CA 4LBLA 2OYZA 4ISQA 2DVAA 4GXLA 1QJU1 2Y0IA 1VBE1 1O91A 2DWRA 4A3XA 2GNDA 3J8F2 3UJOA 5ABJC 2Q1ZB 1Y3TA 2WN2A 2DVGA 5AFBA 1SG3A 1XOYA 3A0KA 2QUOA 4BMBA 2BWCA 1IPKA 1QJFA 2LS6A 4P9WA 1GUIA 4Z82A 2Q8DA 1LOEA 4LBMA 4EQVA 4W4ZA 3U11A 5KXBA 2NPIA 1YI9A 1GFF2 4PDWA 4QD2A 3TWIA 1AR82 4DUVA 2P3KA 3PU8A 1NE6A 4PF5A 2Q1MA 1GZWA 1T6GC 3OBRA 5FO9B 5FZ3A 1LB2A 3IDBB 1PVXA 1OA2A 1B35C 1ZYBA 2D6NA 1SLIA 2JDMA 3WW4A 5HCHA 4MXWA 2PHUA 3DYPA 3MPPG 1XU1A 1ZREA 4U2AA 3LOBA 2R16A 2R30A 4GALA 5EHDA 4O65A 3LDBA 4CDXC 2IVIB 3AZVA 3SMHA 3UV9A 4FAGA 5A6XA 1B35B 2P2KA 1YFXA 3WHTA 3V0AA 4BA6A 3TN93 1ZVFA 2XKPA 4XJ9A 4Y20A 1ZRIA 4EN9B 1V9U1 4C1WA 2YMZA 3NAPC 3MBWA 1JOBA 5LBCA 2A7AA 1Y43B 4LHKA 1W05A 3AXEA 4RGAA 2HWF3 3ZYIB 1FYUA 2KM2A 4XQWA 3P1IA 2Z69A 1ND3C 3IAQA 1NLQA 1LRHA 2CGOA 4GJYA 4YRDA 4ASKA 1L3JA 3M1HA 4PQ9A 5FZOB 4N43A 3HR9A 5A33B 4JGZB 4QU1A 1OOPC 4GD4A 2WNVA 2AREA 4JQTA 5FZ0A 2BWAA 5J98B 4NO4A 1W6PB 2OZ6A 1E57A 3BODA 1HIXA 3ZVXA 3ZYBA 1HRI2 1NQDA 3AK0A 3HNYM 2OZJA 2CWSA 1COV2 1R1A3 4UW4A 1S0GA 2E63A 2DU1A 4FPYA 1HX6A 2BFUS 2XJVA 4LPLA 5JDBA 1BMV1 1XYPA 5K4LA 2XB6C 3HAGA 1SFYA 2BRTA 1KS4A 4KU8A 1AXKA 5BNPC 3VZKA 3NNJA 4AEDA 4ES9A 1C57A 2WLQA 4NRPA 5L9BA 5LCWL 3PJYA 1GP4A 3H3LA 4Q8LA 3NRUA 1FX5A 3K3OA 5BYNA 1H9WA 1CQ9A 1VLNA 1LU2A 2BUKA 2VMFA 1VBD1 4LE4A 3ASIA 5LA0A 3ECQA 5FOJB 3ME2A 3AM2A 3PLQA 2I45A 1W0NA 4K3UA 2XL7A 2GN7A 1FPN3 4Y5TA 4DS0A 2B45X 4QPIC 4FFGA 3KV5A 2MNGA 4CCMA 1IQDC 2ZHLA 3BTZA 4B29A 5JI9A 3NNFA 3KWVA 5IK7A 4JV4A 3SKVA 1V9U3 4YLZA 1GV9A 2QQIA 4EN8B 1KFXL 1WMEA 2XJUA 5D8AB 4AVCA 2VNVA 5FZ4A 2ADDA 3WNMA 1BKZA 1J84A 1BYHA 1WLTA 3T2TA 4AXOA 5ABJB 3M4FA 4KG8A 4QX3A 3S7EA 5ISLA 3FX3A 1UNBA 1DYPA 1WD4A 2WAAA 1HRV1 1W8UA 4AFBA 1Z0HA 3K75B 1PM4A 4XEZA 4RS5B 4OHVA 5FPXA 2A6ZA 1G9CA 1WCDJ 2BTVC 1QJU3 1LEMA 2FZ2A 2NMNA 3FFQA 4AZZA 4CU7A 2K9ZA 2Q8EA 4UFLA 4DB5A 1PK6A 3U10A 4JGZA 1WLWA 4W50A 5BNPB 2LROA 2IXIA 4RR3A 1YEWA 4GWMA 4BQXA 2CNAA 5I91A 5FY5A 3I2JA 1BEV2 3X29B 5FMOL 1UOBA 3AZXA 4Y22B 1Q43A 1SFNA 1AL22 5EWSA 4FI9A 2JDZA 1OA3A 2VGDA 2WABA 5CADA 2XBO1 4Q4V3 5SV5A 2Y6FA 4V2VA 2TNFA 4I3GA 5FZ8A 5ACA3 3WINE 1QMJA 3VDDB 5I8TA 5J3UA 3HD8B 4QX7A 4J6GA 4FTEA 4B7EA 1MVEA 4HVOA 4CUGA 4C0BA 3VDDA 2RDSA 1DQ0A 4P5YA 3LEGA 3U75A 3VBSC 3S5AA 1U5XA 3OPZA 4J1WA 1BMV2 5FP7A 3WG2A 1US3A 3MW3A 2ZKLA 3D4KA 5FPAA 1OKOA 4Q5OA 2PHDA 5C8CA 3O1RA 5HV4A 1MEC1 2DTYA 2VZ3A 2ZGUA 4HKOA 3O14A 5AVPA 1OLME 3CMGA 3ETPA 2BFUL 1RVF1 2HH9A 2DVBA 2FCVA 2HWD3 1N3PA 4PF1A 1NOVA 3CBNA 3KGLA 2FCTA 4IV3C 4QMAA 1QNWA 1ULEA 2W08A 4XAAA 2RS12 3MEPA 3R0RA 4UFKA 5IVCA 4HK9A 4KNCA 5G04L 5FYVA 1JZ2A 1RMU3 4M01A 4MHRA 4MXVA 4E4HA 1AR73 5A32A 2VQTA 2HYXA 4K21A 2ILMA 4XJAA 3W20A 1COV1 2PAMA 3VDDC 2PYTA 2FBEA 5GZFA 3KV9A 1V9U2 1HV0A 1VBC2 2RS33 3CO2A 4LBNA 1QHDA 3ZMOA 2HWD1 5JOYA 3ZFGB 4I0WB 3WQ0A 1CAWA 5C5TA 4I01A 1WBLA 3N35A 1RUF3 2VQ0A 4LTAA 4XUPA 3SITA 1WW7A 3MW4A 2YHJA 2GC1A 1AR62 3O12A 1FV3A 2JX9A 3JD71 3OOXA 4XZPA 3WW3A 4CEYC 5BNNA 1JYWA 2KR2A 1UIJA 4YG3A 5FZ7A 3ILNA 3A21A 3O1SA 2X5IB 4XQ4A 2RM23 4NHLA 1RL3A 4RHV2 2VY0A 3DCQA 1OBNA 1LOGA 1RHI3 3J9SA 5JR2A 1CWPA 4QHZA 1DZRA 3ZDVA 4F7ZA 5I0TA 3VL9A 4JKMA 1BVVA 3BUCA 2OS2A 1HKDA 1KS5A 2B9UA 2ZX2A 2YBKA 5FMCA 1R1ZA 2ARAA 2JDAA 3NSTA 3UKVA 4B4RA 1PM7A 3DPRA 1CIWA 4XUOA 5FMOS 1W2TA 4NHXA 4FFIA 3NJZA 4C0HA 5C8WA 1SEFA 4FXGB 1F31A 3OBTA 5A6ZA 3W5NA 4OZXA 4DY3A 3D5OA 5E16A 3NJVA 3ZPOA 2AEYA 1S0DA 4GMP3 4CCCA 1NA1A 2CSGA 2GN3A 2D3PA 5BNOB 2ZGQA 5KBFA 2NMOA 2Q1FA 3CLPA 2F17A 1DQ5A 1W39A 3ITQA 3ZOIA 4FPGA 4Q27A 3H7JA 2VW1A 3LA3A 3WP4A 4XFAA 2JDHA 5T5OA 5F9TA 1YHFA 3WX5A 4Q4W2 3D0JA 1AR72 4YM2A 3AJZA 4Q8KA 1W8WA 1IHMA 3RRDA 5F8PA 3ALQA 2R1DA 5F1RA 2Y6GA 3SH5A 4HVQA 1QXJA 1JN2P 5D2AA 5H9RA 4W6WA 1JBCA 3KM5A 3ACLA 1JW6A 5FUPA 2W68A 5KHHA 2QQWA 3S6PA 1J59A 4YZ4A 3AYEA 3V56A 2VNGA 4N7UA 2VBDA 1H4GA 5LK5A 4NHMA 2BGCA 4V1PA 4COUA 5L7OC 4M3CB 4JRLA 4CPBA 1CAVA 3ZYFA 4CP9A 3ZSLA 4QQOA 3PVOA 4LO8A 5F39A 2JD4A 4CP2A 5DUVA 4CU9A 3OUIA 5C4WC 2QQKA 2Y6JA 3LSDA 5ERLA 5HBAA 2WR9A 2I2SA 2XQXA 4LKFA 2A6VA 1ULGA 3EQEA 1S0IA 4E2GA 4PBPA 4IUGA 4YZ1A 4MGTA 1VAMA 2WYFA 5JSRA 4OUEA 3V64A 4DXRA 4FPOB 4Q0VA 4TYSA 1ENXA 1OF3A 1PVC1 1O8PA 1MZFA 4LBQA 3ZN6A 4A6OA 5FMDA 5DAXA 5F2WA 2C26A 3RNSA 1DGRA 2NQYA 1JUIA 1UX6A 2VM9A 3ACIA 3UL2A 1W8OA 2EVXA 3MLJA 5LA1A 1JMUB 3T2QA 1JYNA 1HN0A 5A6YA 4AI2A 2FZ1A 4AFDA 1GWLA 1FAYA 3HOBA 3RFRA 4GJZA 1UKRA 1RUD2 3SHRA 2ATFA 2VUJA 2WNVC 4XUTA 3JD73 1YQ2A 3AMNA 4GULA 4TSVA 3UESA 2YYOA 5JPMB 1UYZA 2PLV1 5J37A 2YZ4A 4FTSA 1CD3G 3I3EA 2TEPA 4YM0A 5C9AA 3DPRC 4HVRA 1D4M1 5DUUA 4JGYA 1LGBA 3AMQA 1URXA 2CY6A 4FCAA 1YJLA 3K4AA 2NM1A 3D0SA 1I5PA 5A7NA 3TBDA 3WF0A 2YC4A 3JBG3 2NYYA 3BU0A 1W0OA 2VZPA 2RJ2A 1EV13 1ND2B 2IXKA 1RUC1 3U07A 1R083 1YYNA 4XBQA 2DBNA 3ZXGA 1RUI1 4MSVA 3UYJA 5DAQA 1Y4WA 2VMEA 2VVFA 3ZFGA 1R093 5FYIA 2A3YA 2PN5A 2PLV3 4AEJA 4CCNA 1PIV3 3U4XA 3ABZA 3INAA 5A6QA 4IE6A 1WKYA 1VE0A 3USUA 4QPGC 3TEXA 3RZKA 2LALA 4H14A 1YUDA 1G9FA 1APNA 3BYWA 3JBG1 1JS9A 2A73B 4CA9A 1SBEA 4J25A 2XLFA 2E32A 2JXAA 3GGLA 4R9AA 4UBGA 5F5QA 1HXS3 4OI2A 5DAVA 3UGHA 1OC1A 1UZZA 2AACA 3JCIA 3BU7A 5L9RA 1ST8A 5FZAA 4EV0A 5LEJA 3ZDSA 1W8FA 2AR6A 2BU9A 2ZX0A 1D2QA 2ZABA 1UYPA 3A23A 1D0GA 3GF6A 2DCKA 4IERA 4LNVA 3SEEA 3ETQA 4QPYA 2PAEA 4BISA 1N1VA 2W52A 3J7NA 3LWCA 4LOSA 5F5CA 1JZ7A 3LGRA 5K7PA 3BTYA 1UX7A 1CJPA 2IXCA 2JG8B 1AR61 2GMEA 1DF0A 2B5HA 3KGZA 4IEUA 4CTEA 2ZZQA 3Q8BA 4OUSA 4QU2A 1OFSA 1WBFA 2JEMA 1VRH2 4P9LA 5FBZA 5E8AA 2GNBA 3BIWE 4AAXA 1I1EA 2WO2A 3CU7A 1BBT2 3AL6A 3NWKA 5FOBB 1LODA 1SBDA 2J1EA 3HBZA 1PGL1 1CX1A 3JD72 3RDIA 2JE8A 3D8CA 4D69A 2B9VA 4EROA 4FPHA 1BXHA 3ZXAC 4COYA 1AR93 2VE1A 1RUE2 2E31A 1JTZX 3AXDA 4N90A 4UF0A 1SPPA 4GWJA 3KS7A 1G9DA 2YPDA 4PBOA 3VBUB 2XMLA 2HWE3 1IQAA 1CAVB 1W6MB 1ZBA3 4JZRA 2C5DA 2XJSA 2W3JA 4MH0E 4CP9B 2MHFA 1UZ0A 2QQMA 2VJXA 2W1UA 3E6CC 1POV3 1X82A 2YU2A 4I0AA 1GLHA 1MEC2 4F3JA 1R082 4NJ4A 3V0BB 1EP0A 5CG8A 1LENA 1QWRA 3WF4A 4HZFA 4EN6B 1XB9A 1SFPA 4HN1A 1CAXB 1EAH1 2UYAA 4NPMA 3LA7A 4GAZA 1CX4A 4KG0A 2AEZA 3AFKA 1S0JA 5D21A 3A4UA 1CAUB 4YG0A 3ZYJB 5C7GA 4QDQA 2CWMA 4A7ZA 5L7OB 2VTXA 1VBA2 3PJQA 5AFEA 3M7AA 4LKEA 5FY9A 5KWRA 4EZHA 4LKDA 4YPJA 4P9JA 2YUEA 3AZYA 3ZXDA 3P5BA 1O4TA 5EJ3A 2RHPA 1KJRA 1SMVA 5JXJA 3KV6A 3KHCA 5FJHA 2RJKA 2VW0A 3B5LB 3FJSA 5C70A 3VKOA 1GWKA 1SLTA 1V6LA 1AYM1 5J7MA 1VAKA 2OIIA 2WL1A 2GC3A 3AVRA 5FY4A 3VHPA 2HWF1 1SPPB 4K8RB 3WF3A 4K7JA 4L99A 4HKLA 4XIOA 4HN0A 2RE9A 5H9QA 1MACA 3IZOA 3VBFA 3R6SA 3PHMA 1F5JA 4YFWA 1U5YA 3IIAA 3NV4A 3KVBA 4QGNA 3ZXEA 1OI6A 4YVWC 1DGRN 1GMMA 4LBKA 1YIPA 1G6NA 1GNHA 1UXXX 3GBGA 5CFCA 4MO3M 3UJQA 3W9AA 3T09A 4AEDC 5JZGC 4MGSA 5JSOA 4J1XA 4YZ2A 1W2AX 3CJXA 1ZX5A 1RYYA 5CBLA 4YFZA 5BNOA 1AYM3 1WMXA 2P3YA 2D5HA 3APBA 4QQLA 1GNZA 1PHMA 3OGSA 1HB3A 2BBAA 2VO5A 5FK7A 1UYXA 1NQJA 1WLCA 3PVBB 1QJY1 4UI9L 4TTGA 2BNMA 1HRV2 2FMYA 2B4KA 1PMJX 5C3RA 1BVP1 1S4CA 4RGGA 2YFUA 4RS5A 1JOJA 3ZFEA 5FYYA 2HWE2 3MIBA 3GBWA 1VR3A 1ZBA2 1EPWA 4PT6A 4Z2AA 1VMFA 3I54A 2WFF2 2OPKA 2DCJA 4W6XA 2QQPA 2Q8OA 5D1IA 5FZBA 4GMP1 3SH3A 2XVGA 1HB2A 4PJYA 5K0UA 4COZA 1BK0A 4RFT0 2O8OA 4HOOA 5LWBA 1NT0A 4P5HA 4RS5C 2J1UA 3ACGA 5I93A 4A41A 4Q4W3 2O0OA 2H0VA 2WBKA 1HDKA 2VNRA 2DUPA 2ZXQA 1Y7BA 3WEZA 4I30A 1K5MC 3FHIB 1HRI1 4E4DX 1GQHA 1VBA1 4ZU7A 4P9XA 5CFDA 1RINA 1UW8A 3NL1A 3OUHA 4UFIA 3H50A 4XTMA 3POYA 1ZBE3 5DZFA 1FMD1 1PO13 4IEXA 4Y5SA 3O5SA 3C7HA 5F2SA 1EAH2 1AR91 4FPFA 4MV2A 3GCXA 3OGGA 4DMIA 1AYN2 4KGQA 1H1MA 2GNMA 2DCZA 5FZDA 3HJRA 1OHFA 4L8QA 5IFTA 4WM8A 4JDNA 1SDDB 3VDBA 1JHNA 2WA4A 1NUKA 2XL9A 3DF0A 1RUJ2 2BW8A 4BZ4A 4CU8A 3P3PA 1O3QA 1XE7A 2XXZA 2F4PA 5IVYA 2WT1A 1SLLA 4O61A 4QAWA 3AKSA 4OQ9A 5HXMA 1F15A 4IV3B 5A3NA 1RUE1 3LD8A 3DKQA 3RJ2X 2QTWB 1W6NA 4BH9A 3RMXA 4SBVA 2WKKA 2PHTA 3WQ1A 2X5IA 3OTFA 4B4PA 1X8MA 4BK4A 3OEAA 3ZO0B 5FDBA 1VB2A 4LO5B 5BUVA 3TRSB 4JC1A 2IVJA 2DCTA 3IN9A 5M0TA 4LIUA 3WW1A 4F83A 5IVFA 5HI0A 2R072 2YY1A 4E4ZA 3SC7X 3ILFA 4RR3B 4AAPA 2VG9A 3VLBB 4C8DA 5H9SA 1G86A 2EXKA 4LO6B 2UY8A 1W6NB 4GKYA 1W90A 4BDVB 2VMHA 3IIIA 1JZ6A 4UWDA 4XF9A 3MV11 4DO0A 5C4WB 2WFF3 4GMP0 1O3RA 2VZRA 2FDFA 1NXD1 4B7KA 3JU9A 2GAUA 4DY5A 3H1YA 3CJIA 4O9GA 1RMU1 1S0CA 3OJBA 3MF9A 2WWSA 3DL3A 3HQUA 1AR81 3K3NA 1VBD3 2JB4A 4MADA 3ZSMA 1C8M2 4BQYA 2D6MA 1OQEA 4IEQA 1LU1A 4LLOA 1IG0A 3VUOA 2RMU1 4OI0A 1JZ5A 5CZKA 1LHVA 4CDXB 3THCA 3NNGA 1FOD2 5I8SA 3HQRA 3JBG2 1MZEA 1QF3A 4AEKA 4DPNA 1UL9A 4IE4A 5CVRA 2GH8A 3QBQA 4CDXA 2YROA 5CEHA 3SCFA 1RB8G 1VALA 1OURA 3N9OA 4YW2A 4ZXKA 3OY8A 1VBE2 3D82A 3Q8EA 4JDMA 3LA2A 2WRAA 5FZHA 3EO6A 4BIFA 4YZ3A 5IW0A 1R64A 3W5MA 2GP3A 4BU2A 5A7SA 2PHFA 3QACA 3VD9A 2Y34A 2FCUA 3FE5A 1R091 2WZ8A 3GDBA 4XHBA 4D6SA 1LTEA 5BY5A 3BKZA 4JAAA 3WP5A 2RMU3 4HKWA 1RUC2 1XYOA 3PTYA 4QPIB 2VBBA 1GP5A 3FLRA 4Q2FA 1W8NA 4M4PA 5DAPA 2ZEYA 1ZRDA 4AI0A 5A1AA 3MDPA 1XNTA 3PUQA 4L11A 1D4M2 4MUVA 1AVBA 3THPA 4ARXA 2BERA 2ZMNA 1VMHA 4COWA 3J8F3 4AW7A 3I2OA 1UY2A 2WQ8A 2WT0A 5J96B 3OSDA 3KB5A 5FWJA 4LBQD 4FBFA 1OKQA 1C1LA 1H2KA 1YIFA 1CONA 5FXZA 2JENA 1OQ1A 2ERFA 4IV3A 4LXLA 5CNAA 1H0BA 2Z42A 2WUHA 4NROA 2FMDA 5B4XA 1ENRA 3N9NA 1O59A 4D8MA 1VIWB 3JQXA 4HT1T 2HBTA 4WBBA 3C7EA 1V6OA 3RS6A 4MLOA 4OI1A 5EV7A 5IYYA 5GLTA 3VBHA 1AXZA 1W6PA 1OOPB 4QXBA 4XC9A 4R9BA 4XMAA 2VXRA 2VZUA 5DAWA 5FYSA 4GWIA 1A78A 1GKBA 1Q5OA 5H9PA 1GU3A 4CZSA 4EJRA 2DVDA 5A3OA 4H55A 3I4IA 3PTRB 4BHPA 4MGYE 5A1LA 1ND3B 4XUNA 4IGQA 3ZFGC 1SACA 1GANA 2KA3A 2X53S 2ZGMA 4DZGA 1RUH1 2VQAA 5I0DA 5CFDB 1IKPA 2AYHA 4I3PA 4KWLA 3T2OA 3VHOA 1HQNA 1JI6A 2BVBA 4XFIA 4RD7A 4LMFA 3RMYA 4UW5A 2JIGA 1BQPA 1Z7S3 1VBE3 4YW1A 3ZXJA 1WMFA 4WVMB 1CAUA 2R063 4BM8A 2AGSA 3UKTA 5KXEA 2C4XA 1CJDA 4W8JA 1FPN1 4E8DA 5K0UC 5LBEA 3THTA 3D6EA 3CJIB 4IDZA 3SCGA 4K9SA 3WY6A 3POJA 1O4YA 2ZPXA 2RS32 4NIIA 2J1VA 1Z78A 3B9IA 3I3DA 1JU4A 2C24A 2VULA 4HANA 4AVBA 4A2UA 2IXLA 4PDWB 2RS52 3AMHA 5APAA 5FYHA 1QGLA 1LAJA 2WNUC 5FUNA 5GKAC 1JZ3A 3BPZA 1IKQA 1CIYA 5DG1A 1UY0A 3HVDA 5FYUA 2VOXA 1W9SA 2P1BA 4P9GA 4AVSA 2ZZJA 5BNNB 1DDLA 1XE8A 5A3PA 3OBAA 1DQ1A 2XJRA 2YPJA 4N7IA 3FUOA 5EIYB 5JZGA 1MS8A 3PL0A 4XFFA 3WLUA 4QKFA 1FOD1 2CHHA 3J7LA 3TOJA 2OXBA 3K51A 4WVWA 5EQUA 1FPN2 5A3UA 4PI2A 2OPWA 2XPJA 4QPIA 1HRI3 5GLWA 1C8M1 2ET7A 3LEKA 1WA6X 3A22A 1HB4A 3VBHB 4AF9A 4BJ0A 4M4RA 4KL1A 3AX4A 2CAVA 1OPOA 1XNAA 1ZBE1 4QB6A 3ACHA 3JZVA 4Q0UA 2VCMA 4QT6A 5FY8A 1SLAA 1MS0A 1QEXA 2NLRA 2ZMLA 4FO9A 4AHWA 2E33A 4CDQA 1H1AA 3SISA 5JXHA 1VMJA 2WNVB 4MZUA 4M3CE 4R8HA 5FMBA 2IWGB 3H8RA 1OD3A 3O1OA 2LRPA 4RHV1 1EV11 1DLCA 3WNPA 4HSLA 3IKWA 1I6XA 4XVHA 1UY1A 2IUWA 2HWB2 5DUXA 5CFCB 4QHOA 3V65A 2VR4A 1FT9A 1Q56A 2A3XA 2BVVA 2E53A 3I3BA 1O6UA 1AXYA 5J09A 5BPXA 4NN0A 3H8XA 1YLLA 1ULDA 2RR12 2E7QA 4BPZA 1PO22 3AFGA 2CAUA 3OGJA 4NIHA 4M0HA 3SCHA 3VKLA 2TUNA 2Y64A 4XFGA 1JYIA 4NVPA 3O0WA 5JIUA 3T0AA 3B00A 4QXKA 4JRAA 1DGLA 1OLRA 1TMF3 4MXWB 4RN5A 2ID4A 4XF3A 5FZLA 3PVNA 5F7UA 1UZVA 1RTVA 3FC0A 3KCXA 4AL9A 2QZ2A 2JWPA 3MV01 3IMNA 3VHNA 3O7OA 4XF1A 4YGCA 4IE7A 4Q4X2 3VGIA 1EAH3 2G1MA 1AUYA 4X6QB 2UYBA 1JU3A 1WD3A 3MHZA 3VV1A 5ANNA 5A7PA 3I97A 4LBOA 4PLMA 1RUI3 2JDKA 3P3NA 1ENSA 1WGPA 1F5FA 2WQZC 3WZ1A 1QQP2 5E89A 2H0BA 2X5IC 5EJZB 3FL7A 1U5ZA 5FV3A 4L0PA 2RDRA 2EAKA 1DIWA 4FOVA 4TZDA 3U37A 2GH2A 2PHLA 3KLSA 1R1A1 5D8AA 5T52A 1S0EA 4NIAA 3DN7A 3BN6A 2WJSA 3KCYA 3LCPA 1UKGA 5HCAA 2BOJA 1TME1 4NAOA 1XJAA 4CEWA 1BZWA 1PX4A 4XFHA 4IETA 3RWNA 1RC6A 2P5BA 1QXPA 5J1XA 3AKQA 4UF0B 1X9PA 2OVUA 2P37A 5CB7A 1IS4A 1H9PA 1W3XA 1AL23 5IWFA 3IBMA 3MIGA 4OMDA 2P3JA 3ZYHA 3CZUA 1AZDA 1QKQA 2ZX1A 3LZZA 4XURA 2XLAA 1Q8SA 5T5JA 2A1XA 5AC91 4AG4A 4PQQA 3I3MA 2Y38A 2YFZA 2VXJA 5LA2A 3M3EA 2VZ1A 2HWC3 2WO1A 4XAEA 4BIOA 4QQHA 2WNUA 3T0DA 4ZKTB 1WCSA 5IVEA 2HJIA 5FQ0B 4BQ2A 1C8M3 2RR13 4UW3A 2VZOA 5T3NA 5JR7B 3O1MA 3LDKA 1SBFA 5FZCA 5C9AC 4AI9A 2IXHA 3R4UA 1G8WA 2IXJA 3TNPB 1F9KA 3OYWA 3S0MA 3CHXA 2JDUA 3GXUA 1RUF2 2OW4A 3WG1A 3LPFA 1IPJA 5FO7B 1KJLA 4FFHA 4JGZC 2Y6KA 4ZU4A 3ZFEC 5A7WA 3JUUA 5C8CB 4Y1ZA 1S2KA 4JTOA 2VUDA 5CU1A 3G7DA 5A3LA 2W92A 3NAPA 1W2UA 2A70A 2ZCWA 1LHWA 4UT5A 2RM22 4RHV3 1HJGA 1C4RA 4NE9A 1UOGA 2E51A 5C3OA 4I02A 3V0AB 3GZUC 4A4AA 4IGPA 4OHZA 2BOIA 2MPFA 3DYOA 1RITA 4EN0A 1DG6A 2EIEA 2ZEZA 3E5QA 3MGUA 1AR63 4QKDA 1CESA 3NVCA 4Y22A 2ZGLA 1A8MA 1DU3D 3RYKA 4ASMB 4Q4Y3 3DXUA 1CZVA 2ES3A 5FZEA 3OD0A 2QE3A 3NKTA 1W2OA 3O1TA 1Y9QA 4QGMA 2EXHA 2A6YA 3BB6A 1F2NA 3CEWA 3MYXA 3QD6A 4D6RA 3SNMA 1ZNPA 5L7OA 4LR4A 1N1SA 4XYXA 1V00A 4AVAA 1EYBA 3KF3A 4IQPA 3DV8A 1VP6A 1OXCA 4Q29A 2XONA 1D2SA 2Y8KA 4LUMA 1HQLA 3ZYRA 5KHKA 3AZWA 2ORZA 2GU9A 5GLVA 1U0AA 3K4DA 4OLLA 1Q8PA 1ZBA1 3DECA 1UXZA 5FY7A 5L36A 4M3CA 1W6QA 2WWJA 3ZSJA 4C1XA 3KT7A 4BXSV 1POV1 2YGMA 2D3RA 3IDEA 1HLCA 4Y1VA 3V0BA 3GJBA 4GIQA 3CNAA 4NWWA 3PUHA 3UT0A 1DYOA 3QCWA 4L97A 4JHTA 3HBKA 5DXDA 3K2OA 4Q1PA 1BK1A 3L9JT 3H3UA 4ZZ8A 4KU7A 3OBZA 4FAHA 3EJKA 4AGRA 5CAZA 4XTPA 2P4EA 1RUG3 4M0NA 1P8JA 1FMD3 1PO11 3OPTA 1MZ6A 3AP9A 2BEOA 3BVCA 1ND3A 5IUQA 3A0NA 1LOBA 1DHKB 1ZM1A 2BNNA 3PIJA 2WSUA 3QOPA 3N36A 5EFUA 1YRZA 1IS6A 2VTXJ 4Q0QA 5KXDA 1OOPA 4A45A 1OH4A 3LB9A 1LHUA 5A3MA 1RXGA 4CEYB 1BCXA 1UMHA 1TQ5A 1CGPA 4Q0PA 4XFBA 2QDRA 2R061 3VZJA 4A6SA 1NE4A 4CDUC 3OGVA 3ZYPA 4MX3A 1W99A 1UU6A 2VMCA 4MOAA 4OYUA 5BV6A 2W94A 4IEWA 5F5AA 1QJU2 5FCCA 2QFEA 2ORXA 4EWEA 1LR5A 3I2FA 4DIQA 1ASJ3 4ZXEA 2QVSB 4NIDA 3AL5A 1GOFA 1TEIA 1W6MA 1PZ7A 2AH2A 3OEBA 2VECA 4PIXA 2BJSA 4YWAA 2VCCA 5FP4A 2HEYF 4CUBA 3HNMA 2CTVA 2PQSA 1L7RA 3H8UA 3AYDA 3PDQA 3UNPA 3WT3A 5HV0A 2RS13 1HV1A 2WN3A 4LJHA 3MF6A 1MQTB 2CDOA 3H0OA 1O3SA 4HLTA 4NIGA 2QQVA 3IM0A 2JJ6A 4XXPA 4Y20B 3TEYA 1PGW2 2GALA 2BV4A 4I09A 2C1FA 1QJX1 3B93A 1H30A 4HXCA 3MIFA 5FYBA 4URTA 1LKNA 3S30A 4ASLA 4ARYA 2E9QA 1XC6A 5EZWA 2ENRA 3ZKUA 3CQOA 1V70A 4IW3A 5JOWA 5K8SA 5FXWA 1F8VA 5LA9A 2J1SA 2Y6LA 4BQWA 1XNKA 2VUCA 3B3QE 4Y26A 3WXPA 3KHBA 2R6QA 3J4UH 3ZFEB 1OSGA 2CU5A 2X09A 1ND2A 5DABA 3H1WA 4LOTA 3Q8AA 1HB1A 4YSFA 2IZWA 2WZR2 1S2EA 3MLLA 4IXLA 4HPKB 2C6SA 1JYVA 2ZGTA 4META 3BTAA 4CCEA 2ZTNA 5ABJA 2VZTA 3ACFA 2UU8A 4LHSA 2R043 5IVBA 1G9AA 3IB3A 2WNUB 4OI4A 3U0ZA 3WUCA 5IK4A 2ZS6B 5C9AB 1ZZBA 1N1YA 1WCQA 1VRH1 4KQ7A 4UOJA 3T1MA 4X8NA 1OD5A 2WDBA 3K77A 4BQ3A 1VAVA 2WT2A 3BGAA 4H3WA 1PGSA 1RUH3 3UKNA 4KWKA 4DUXA 4KWUA 3H9AA 2RVAA 1PO23 4HBNA 2HKXA 4B4QA 1MS4A 1Y9MA 5K0UB 3IDAA 1OH3A 1YC61 3I2HA 3Q8CA 5JVVA 1UMZA 1ZBE2 2DBIA 4CCLA 3WQBA 5C3QA 4JGYC 2LM3A 4WVVA 2QJVA 3FMGA 1GR3A 1UAIA 3KT1A 4R52A 4CDUA 1WCUA 3EB7A 3HT1A 3PUAA 5FFOC 4D7YA 3ZKYA 5KHGA 5KC5A 2QDNA 2AENA 4ZHNA 2WYSA 2XWBB 1RHI2 3VHRA 3A7QA 4Q26A 1KDMA 4N9IA 2D6LX 4AVTA 4LKSA 2ADEA 4DUWA 4LHNA 3B94A 3AP5A 3BPSA 1AR71 1W9YA 2D93A 4QGLA 3ATGA 3LKJA 5FY1A 2XVKA 4HONA 4K8FA 1UY4A 3H1MA 3N7LA 5JWPA 3VBRA 2V4VA 2VOTA 2BYVE 4YGDA 1O7FA 3M8LA 3RVHA 4MG2A 2RS31 4CDQB 4RL7A 1X7NA 3AB0A 1D0HA 4R9DA 3VL8A 4NHKA 4BXFA 4HFSA 4E8CA 4YM1A 1ALYA 4CP1A 4EE2A 1U5IA 2HBUA 2OKXA 4OFGA 2WS93 4GB31 5BXXA 1W8HA 3WVJA 4AFCA 1VRH3 2Y26A 4B1LA 2MEV3 3VBHC 1MEC3 4CYDA 5FYZA 4COVA 2JDNA 4S2GA 2YU1A 4AQ2A 5J48A 2JG9C 4Y3OA 3SH4A 1PIV1 4JQRA 2WZEA 1PX3A 2HWC2 3OG2A 1AX2A 3ZR5A 1LGNA 3AC0A 4A3ZA 5JXIA 3OY8B 4CCKA 2A3WA 3VKMA 4CPBD 4KI5M 4BQ5A 3PURA 2Z4FA 2GMMA 3N7JA 1O5LA 3BCWA 1W6OB 2XJQA 2B42B 1E5RA 2QQJA 4BLJA 2D6OX 3L2HA 4OMCA 4Y4RA 3PNAA 4ES8A 4MGKE 2XJTA 1LULA 1WLDA 2I07B 5T5PA 2A75A 2J7MA 2GC0A 4QPWA 5DMYA 2D6KA 1RUD3 3WQ7A 5C3PA 3FHAA 1RGSA 2NZ9A 3AKPA 2EAAA 5FZMA 2OQ6A 3LSEA 3FWEA 2ZGKA 4LITA 3M3OA 3WNKA 2J42A 4XJ8A 1VBC1 4XFCA 3VKNA 1AHSA 4W6YA 5LBBA 3F95A 5GZGA 5FYMA 4AK3A 2W0XA 3RI8A 2Z2SB 1QJX2 1FXZA 2WA3A 2W95A 3ZN4A 2J1TA 1V6IA 1JYCA 2WS91 4GB33 5CYYA 3GBFA 4P9YA 4MGQA 5EJ1B 4PI0A 3MI8A 3N7MA 2MEV1 4Y1UA 1HN1A 4O9EA 1FATA 1F4AA 2BNOA 2XHNA 4NWVA 4YW5A 1RVF2 3MUY1 3VDAA 3WDUA 5ACA1 1R092 1UOFA 2V5YA 4CVUA 5BNNC 1M4WA 2Q0AA 3ZPYA 5L19A 4G9SB 1B35A 1J1TA 2V73A 1C8NA 2YXSA 5FTTC 5LEKA 4N9HA 1W6QB 3UETA 2G9FA 3VBUC 3WDWA 1PGW1 3H8OA 1GOHA 1XNCA 4PDWC 5LRRA 3RGBA 4YG6A 4D3WA 2DV9A 4FVVA 4BB3A 4YVSC 4AYUA 4CEYA 2ET1A 1YCIA 3AP6A 5CKMA 2F6BA 5A32B 2GC2A 2J22A 1VB4A 3NKGA 3HNBM 4N43B 3IWZA 5A33A 2EA7A 1JZ4A 1AL21 4GA9A 4DRVA 1GICA 1XE0A 5IT6A 4LO4B 2A5ZA 1PVC3 2ZMKA 5FLHA 1KEXA 1J3PA 1PO12 1WZXA 2D5FA 5FPZA 3ORJA 1N3OA 4JHZA 3VBUA 3ZXFA 2JG8C 3AP4A 2A6WA 1OVPA 2WQ4A 4YW4A 5FLJA 5CFDC 2FDGA 2G9ZA 2K0GA 3GCWA 2BGPA 3HIFA 3WCRA 1POV0 4BQ4A 3FBMA 2EALA 3PUSA 4FOYA 1I9RA 1SZBA 2F4LA 3HPNA 2FDKA 1H1IA 1K5MB 2ZGNA 3GM8A 4TXWA 3RYRA 4AI1A 4QHBA 2AC1A 3PMEA 3WNXA 4CCDA 1OFNA 4XIKA 4LT5A 1ACCA 4AOCA 1JODA 3JQWA 1CN1A 1F4HA 4CXWA 1LECA 1U12A 2UWAA 3SQOA 2P6CA 5LRSA 3USSA 2A6XA 3N9MA 4Z07A 2XKOA 2FHRA 5FZOA 3UK9A 2HWD2 2ARXA 1IGOA 1STMA 3QLQA 1H8TB 3T30A 5F6LB 4XJWA 4IV1B 3BOWA 4WM7B 1RUJ3 3T3YA 1ASJ1 3NJYA 1KDKA 4L92A 1AJKA 4Q4V2 5HCBA 1S0BA 3E97A 1RVF3 3QH6A 4D7TA 5FIXA 3R4DB 4K1YA 2O1QA 4QKBA 1V6KA 2JICA 3WNLA 1XNBA 3EYPA 3LEMA 3LOIA 4WV8A 1XSRA 3VDCA 4X6RB 2RS11 2FDIA 4B3NA 4RR3C 3BTXA 3MICA 4ITCA 4UFJA 1IZ3A 4XILA 4XZUG 3ZR6A 4AFAA 5T54A 5JZGB 3TEZA 2YC0A 3VD3A 1FNYA 1BLZA 3TN92 4LEJA 1KQRA 1OUSA 1AX1A 1A3KA 3TN91 5CFCC 1O4ZA 4FXKB 2D7FA 1D4M3 3WP6A 4DQAA 1W2NA 1FOD3 2OUHA 4I2OA 3FBYA 4BK5A 4DOUA 4YYOA 2VOWA 2DTWA 1MPXA 5JI7A 3THDA 3VBOC 4Z8BA 4CEWB 1G7YA 4PHZA 1RUF1 2XG3A 4UAPA 3TEWA 3MUZ1 3VBOA 4JKKA 4S2DA 4HK8A 4C91A 1Q8QA 3M3IA 4LORA 1UMIA 2EXJA 4F8AA 2VD7A 4LUKA 2XBO2 1REDA 1DQ4A 1ZZCA 2JG9A 4SLIA 2RM21 4ZY9A 1G9BA 5IVVA 1BEV1 1TZOA 4QQPA 5C4WA 1JXNA 1QJY2 1UN1A 4AI8A 4RFRB 4CDWB 4Y4YA 2FDJA 5GZDA 4B8EA 4FOWA 1GBGA 1REEA 4LA3A 1GZCA 3H42B 2IFWA 2G9GA 1LOCA 1K45A 4KMQA 3VZLA 1HW5A 2DYCA 3PUIA 5AC92 4I0BA 2AUYA 3T4VA 2OQ7A 5FXXA 1NLSA 3O0XA 4AEMA 4JKLA 3WDTA 3ES4A 4N8MA 1NXMA 3HN1A 2DF7A 4FPCA 3ZX7A 2ZA9A 1ULOA 3VD7A 2YBSA 3PU3A 4CP0A 4Q4Y1 5EPAA 3NQHA 4K1ZA 1B09A 4QPGB 5JAXA 4OHWA 2HLEA 3DYMA 2JD9A 4XDPA 1X8EA 3RWKX 4TWTA 1S1AA 2QZ3A 2VCAA 2XHKA 1YFYA 4BYYA 2VVDA 5FPUA 2OX0A 5DG2A 5IK8A 1GYKA 2G19A 4RYDA 3J8F1 5A3TA 3QH7A 4E4SA 5B4NA 1XBFA 5FPBA 2ZHMA 2VAUA 4XETA 1A8DA 5FR3A 3CJIC 5L73A 3I2KA 5TSWA 2YGLA 3OB8A 5GZEA 4QQ2A 4AQTA 4UBHA 4XW3A 3POWA 1EUUA 2BPA2 4K20A 2RDNA 5FREA 2Y0OA 2ZGOA 2CV6A 1HRV3 2PHWA 4RQPB 4XF0A 3J7MA 4IGOA 4CDWC 5I8YA 5LK7B 1AJOA 2YBPA 5C6CA 3BI3A 3KF5A 4QX0A 5C5UA 4AGVA 2WS92 3LIGA 5BNOC 1COV3 1R1A2 2GNTA 2JECA 3OGRA 1ZZ9A 3N9LA 5DPNA 4AFMA 1CAWB 4YZ5A 4N53B 1BEV3 3E6BA 2JE7A 5LW9A 1IOAA 3TYJA 1JYXA 2V5DA 1C3HA 1A6CA 4H2AA 4QX1A 3KZ4C 3N7KA 3NO8A 3USUB 2P6HA 4AHZA 4URAA 5ACA2 3VBOB 5KC6A 4HMZA 2DVFA 4NRQA 3RQ0A 3AYAA 2XBO3 3VBFC 5EYYA 3MPBA 1J3RA 3G6JB 4QPGA 2XDVA 4KWJA 3I8TA 4YVSB 2EIDA 4NR1A 4Q4X1 5C33A 4Y1YA 4BWOA 4YGEA 1JUHA 4IV1A 1O5UA 2RS53 2HWB1 4IEOA 4JTNA 1CZTA 1UOJA 4K40A 1GSLA 2EIGA 4ISRA 2VZQA 3IDCB 5AC93 3B02A 3WNNA 3OD4A 1XRUA 1US2A 4NOTA 2JB8A 3CZJA 3LPGA 2D97A 3WHUA 2O14A 2ARCA 1LESA 4CDWA 4DNYA 4TLGA 4XF4A 5DZEA 2OUJA 1RJ8A 2WFPA 3NV1A 4WM8C 2TBVA 3MLKA 4QX5A 4WZCA 3KSCA 4OHXA 1KRIA 5FY0A 1E5IA 1QH6A 2PXJA 5CG9A 1K5MA 2WNOA 3GALA 4WM7A 4XUQA 1SQ4A 4ZS2A 1H8TC 2BBVA 1CZSA 1FNZA 1OA4A 2Q5TA 3LEIA 5EYXA 3I59A 4GZ9A 5E1RA 1KFUL 1VBC3 3T08A 5I0RA 1QJX3 5A1FA 1SLCA 1ULPA 1LHOA 3RG0A 3VD5A 2DURA 5FZ6A 2XH6A 2D3SA 2PAKA 3E5XA 4GB32 4H7LA 2DCYA 1NCRB 1YFWA 3Q9OA 5FWEA 4KBBA 3RZLA 3I2DA 1KITA 3AMMA 4MGIE 1TME3 1PIV2 1DGWX 3IMMA 1NCQB 5A3WA 3RZGA 4IL7A 3S57A 4Y24A 1NCRC 2HEVF 1LNSA 1ZRFA 1CPNA 1BJQA 1RJ7A 2EF6A 4YARA 1O3TA 1YNAA 1RUI2 4FPEA 3U78A 1J3QA 3C2UA 1ODNA 5FLIA 3VBSB 2WAOA 2VL4A 3LAGA 4XHXA 1DP0A 4N53A 5HXVA 1RHI1 2CYFA 2FD8A 1DZTA 2C9KA 3FZ3A 4LLFA 3C7FA 4WZFA 1GZWB 4AR2A 1TG7A 2ZBJA 3WG3A 1DQ6A 2C0ZA 4DXSA 4GH4C 3ZN5A 1XPWA 5F3IA 5DDJ1 2B39A 1GZ9A 1WW5A 4GWNA 3VBRB 2PLV2 4IV1C 5FZFA 3WDVA 2SBAA 5F6KA 3WD5A 3CDZB 2VMGA 4JCKA 2LW8A 5FYCA 2D44A 3MIDA 3WV6A 2VBPA 3NW4A 2RG4A 1H6XA 2RJLA 2WO3A 3RPQA 5JOXA 1GWMA 3VZOA 1NX9A 3SXWA 3IPVA 1NZIA 1YWKA 2ZAAA 2SLIA 4AQ6A 1VPHA 4W65A 4LA2A 4QB2A 5FBJA 2WC2A 3VD4A 4OQ8A 4A7YA 4L2NA 5L9VA 5JPNB 1L7LA 2QBXA 3K46A 2A71A 1UD1A 4P08A 4EN7B 3E1F1 3PVEA 5FPVA 3O1VA 3P6BA 1DGWA 1PMHX 4QXHA 3VBFB 3VBRC 1TMF2 5FZGA 2VMDA 3MFCA 2BQPA 1OQDA 1XXNA 4NHYA 3GYDA 3L2YA 4BCUA 2DDUA
chains in the Genus database with same CATH topology
4YWAA 1W8WA 5D21A 1W9FA 1OH3A 4LK6A 1W8UA 2KR2A 3ZYHA 2WYFA 1W8ZA 4LJHA 1GWMA 4LKEA 4CP9B 4LKDA 1WZXA 2Q1FA 3ORJA 4A6SA 4YW7A 1UOJA 3UT0A 3ZYBA 2VXJA 1L7LA 1W8TA 1WCUA 1WMXA 4LK7A 4CPBD 2LROA 2LRPA 4BQ5A 3F95A 1V0AA 1OKOA 1GWKA 4AL9A 4CPBA 3ZYFA 4CP9A 2JWPA 1W90A 4YW6A 4BQ4A 4BQ3A 2O14A 1HN0A 1GWLA 4BQ2A 2K46A 2C24A 4LKFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YWA A;  1W8W A;  5D21 A;  1W9F A;  1OH3 A;  4LK6 A;  1W8U A;  2KR2 A;  3ZYH A;  2WYF A;  1W8Z A;  4LJH A;  1GWM A;  4LKE A;  4CP9 B;  4LKD A;  1WZX A;  2Q1F A;  3ORJ A;  4A6S A;  4YW7 A;  1UOJ A;  3UT0 A;  3ZYB A;  2VXJ A;  1L7L A;  1W8T A;  1WCU A;  1WMX A;  4LK7 A;  4CPB D;  2LRO A;  2LRP A;  4BQ5 A;  3F95 A;  1V0A A;  1OKO A;  1GWK A;  4AL9 A;  4CPB A;  3ZYF A;  4CP9 A;  2JWP A;  1W90 A;  4YW6 A;  4BQ4 A;  4BQ3 A;  2O14 A;  1HN0 A;  1GWL A;  4BQ2 A;  2K46 A;  2C24 A;  4LKF A; 
#chains in the Genus database with same CATH topology
 2DUQ A;  4N53 C;  5KXC A;  4XJZ A;  1LHN A;  4MGZ E;  2XLG A;  1EY2 A;  5LAS A;  2VPV A;  3VZM A;  4O7X A;  3S7I A;  3DPR B;  1A34 A;  4UXA A;  5I0U A;  4BE3 A;  4QKN A;  4XPV A;  1ZRR A;  1T6B X;  1DYK A;  2PMW B;  3EBR A;  4RQP C;  1L7Q A;  2GMP A;  5AVA A;  3JB8 A;  3NV2 A;  1W04 A;  1UZW A;  2YG0 A;  3J7H A;  4MVT A;  4X8P A;  5GZC A;  5KHI A;  2VOV A;  5DQ0 A;  2VVE A;  1V0A A;  3E5U A;  2WZR 1;  4N43 C;  1UCX A;  3TNQ A;  3EHK A;  2K2S A;  1SLB A;  2GP5 A;  2D6P A;  5LZ6 A;  4NAM A;  3K4Z A;  2V72 A;  4IEV A;  2GZW A;  1MS9 A;  5F32 A;  2PHX A;  4GQ7 A;  4UFM A;  1UIK A;  3KD4 A;  1W9F A;  3OCP A;  3N9Q A;  4FSJ A;  4IE0 A;  3UGF A;  3EMR A;  4XCB A;  1W28 A;  1YQ6 A;  4OCT A;  3POE A;  2XR4 A;  1IS5 A;  2VZS A;  3ZM8 A;  1N3Q A;  2ZX3 A;  5JMO A;  1H2L A;  1WW4 A;  1FI2 A;  2QCS B;  5C3S A;  1CR7 A;  2Y33 A;  4OHY A;  1H8V A;  4PIY A;  4PCR A;  4KBZ A;  3TAY A;  5IK5 A;  2WZR 3;  1VRB A;  2ZEW A;  1TNR A;  5CKQ A;  3VZN A;  1XYN A;  1OLM A;  4RA0 A;  4EWA A;  1LOF A;  2W47 A;  4GH4 B;  2W87 A;  1GNY A;  1W3V A;  4CRQ A;  1S2B A;  4XBN A;  1ND2 C;  5FKC A;  5JUV A;  2R06 2;  1DBN A;  1K3I A;  5F3E A;  3T1L A;  4LHL A;  1MQT A;  1YJK A;  1C5I A;  5DZG A;  3WW2 A;  3ES1 A;  5CIR A;  1QIQ A;  5A7O A;  2WZP P;  1UY3 A;  2KD7 A;  3I3Q A;  1H2N A;  5LAT A;  3B69 A;  4HSJ A;  5T50 A;  4DXZ A;  2PQQ A;  1VBB 2;  1UZY A;  4BQ1 A;  4ZS3 A;  4D6Q A;  5F5I A;  4KGG A;  1E5H A;  3EXU A;  5FK8 A;  4WVZ A;  3UGG A;  2XWJ B;  1MQT C;  2ZOE B;  3F2Z A;  4RSU A;  4XQD A;  1REF A;  1W6O A;  1NCQ C;  2GSY A;  2H6B A;  1GQP A;  4CEW C;  3POG A;  4DRR A;  1QXR A;  1RIR A;  4Q4Y 2;  1C28 A;  2BZD A;  4LBQ B;  4AWD A;  5D8A C;  4QM8 A;  2R07 1;  4Z92 B;  1NY7 2;  1TNF A;  2VQU A;  4YGB A;  2Z5W A;  4OVE A;  1RMU 2;  5J36 A;  2UY9 A;  2XGX A;  4XDQ A;  1XU2 A;  3GZT B;  4AQS A;  1FV2 A;  1PNF A;  3I2I A;  3W21 A;  3WF1 A;  2VOK A;  1ODM A;  2E26 A;  1LOF C;  1Z7S 1;  5IFP A;  4NUB A;  2W9X A;  4XE9 A;  2WLP A;  3GHM A;  2VU9 A;  1NG0 A;  4CDU B;  1W0P A;  3MIE A;  3B01 A;  4TLF A;  3GJA A;  2LTN A;  1I3H A;  3AYC A;  1OMI A;  3ST7 A;  2ZAC A;  3MIH A;  3POI A;  4WM8 B;  2JKB A;  3HEI A;  5FP8 A;  2DFC A;  2EIC A;  4QM9 A;  1ZZ8 A;  1RUJ 1;  2VZV A;  1D4V B;  4UW6 A;  4JDO A;  5EXO A;  4P02 B;  5FUI A;  1C5H A;  3T4H B;  1AYN 3;  3NNL A;  3ZLI A;  4XAB A;  1JYT A;  2OT7 A;  2D43 A;  4RQP A;  5LY1 A;  5IAT A;  4DEQ A;  4XOG A;  5CA6 A;  3J26 N;  3SLI A;  1RUG 2;  4FTB A;  2W2I A;  3WG4 A;  2D98 A;  4LUL A;  1FMD 2;  5FRA A;  2BGO A;  3KV4 A;  2W1Q A;  1XSQ A;  3SEP A;  1JHJ A;  1UYY A;  1MS5 A;  1QDC A;  2R49 A;  2WIN B;  1DLL A;  3R4S A;  3ZFF B;  1BBT 3;  2XQR A;  2R04 1;  4FQZ A;  4AI3 A;  1JOP A;  2WNE A;  4DFS A;  4Z2W A;  5FKB A;  2BDR A;  4QDR A;  1AYN 1;  1J1L A;  5SV8 A;  1KD7 A;  5ANQ A;  3RZM A;  3ILR A;  1RUG 1;  2YC2 A;  1AR9 2;  3Q8F A;  1GZT A;  4Q1R A;  5E6H A;  1RUE 3;  1LED A;  2K46 A;  3LIH A;  4IE5 A;  4P9I A;  4UYB A;  1S55 A;  5E88 A;  1T2X A;  4DIN B;  1UPI A;  1GQG A;  2R07 3;  5LB6 A;  1RUN A;  1SCR A;  4H7M A;  3GNE A;  5F37 A;  4XBL A;  4Q4X 3;  4Q4V 1;  4AED B;  1ASJ 2;  1MVQ A;  2B7Y A;  2YV8 A;  3DXT A;  1J83 A;  4ONU A;  2HWE 1;  5GAL A;  3U4S A;  4YVW B;  1ENQ A;  3CL1 A;  5IJR A;  1H6Y A;  1YFU A;  2R7E B;  2XJP A;  3B9C A;  4JGY B;  3CKH A;  1MZ5 A;  2EXI A;  2PA7 A;  3ZYG A;  1LOA A;  1X33 A;  2PFW A;  2IC1 A;  3IPV B;  3B7M A;  4ZON A;  3ZSE A;  1HXS 2;  3NV3 A;  1ZA7 A;  2V09 A;  3ELN A;  4B1M A;  3H7Y A;  4LBJ A;  3KT4 A;  1DZQ A;  2B8M A;  3MO4 A;  4LO7 A;  4QX2 A;  4ZU5 A;  3W59 A;  4QXC A;  4CXX A;  2WFF 1;  4L9B A;  4A42 A;  2ZGS A;  3KVA A;  3POF A;  4HG6 B;  5IVJ A;  2WSV A;  4GH4 A;  4HPK A;  4S2H A;  4WVM A;  3N9P A;  4BLI A;  4IES A;  1PNG A;  1AR8 3;  3DUI A;  1W9W A;  1D7P M;  5FPL A;  3AP7 A;  4FP2 A;  3WR0 A;  1UU4 A;  2R0H A;  2ZKN A;  2Y60 A;  5F3G A;  3ZIX A;  5IAV A;  5FZI A;  5C8C C;  5GM0 A;  1YXW A;  1ULC A;  5FZK A;  2CL2 A;  2ZGR A;  4ATF A;  1EPZ A;  3HWJ A;  3T2P A;  1TME 2;  4XMI A;  3VBS A;  2E7A A;  1DCS A;  1JZ8 A;  3CF6 E;  2W5F A;  1HXS 1;  1N1T A;  3K48 A;  4LQR A;  3WOG A;  5CKN A;  5FZ9 A;  2NP0 A;  1I5Z A;  2YB7 A;  1VBB 1;  4G4F A;  3AJY A;  1VBA 3;  4WM7 C;  3SKJ E;  3WP3 A;  4AVV A;  1AF9 A;  1X36 A;  3VN4 A;  3NAP B;  4OUM A;  1QJZ A;  3WF2 A;  1VBD 2;  1JH5 A;  1QQP 1;  3O1U A;  5A7W B;  4XDO A;  4CU6 A;  2QQU A;  3AZZ A;  5FAX A;  2ZAH A;  5JSP A;  1WWY A;  4CCJ A;  2HWF 2;  3HT2 A;  1Q8V A;  1W06 A;  1W03 A;  2VH9 A;  1AYM 2;  4IEP A;  2X05 A;  1BHG A;  2XUE A;  3ZMN A;  1ZA4 A;  2DUO A;  5DN2 A;  1LJ7 A;  2QQO A;  3I7D A;  1V6J A;  5T55 A;  2P17 A;  2XUM A;  3RSJ A;  2JG8 A;  3WCS A;  4AE2 A;  3RZZ A;  2ZHN A;  2J1R A;  1UWW A;  2ZHK A;  5JOZ A;  4XJU A;  1Q3E A;  4FPK A;  3FLT A;  5FQ0 A;  2JDY A;  1R08 1;  1OLQ A;  2R04 2;  3I49 A;  1PZ9 A;  1YI7 A;  2IFR A;  1TVG A;  2X8K A;  4FP3 A;  5FYT A;  2CGP A;  4D94 A;  3WSO A;  4MHU A;  2AZ5 A;  5FO8 B;  4CUC A;  2VUA A;  4CE8 A;  4PLN A;  2CDP A;  1K5J A;  2E6V A;  1PO2 1;  2MEV 2;  1POQ A;  1WA4 A;  2FQP A;  2DFB A;  5A80 A;  2P34 A;  2VW2 A;  2W1S A;  3LE0 A;  3FFZ A;  4GKX A;  2JIJ A;  1VJ2 A;  3ZXK A;  4R9C A;  4XXA A;  4NPR A;  1NCQ A;  1PZ8 A;  3VKF C;  5B2G B;  2P3I A;  3GZE A;  1SCS A;  1UPS A;  1YO8 A;  3C7G A;  4S2F A;  2UWC A;  4HET A;  1PGL 2;  1H4H A;  1QU0 A;  4AHY A;  1BBT 1;  2N7G A;  1OPM A;  1OF4 A;  2WO7 A;  1EV1 2;  3AKT A;  4P14 A;  1TE1 B;  2OA2 A;  3PIG A;  5GJ6 A;  3AMP A;  2QQL A;  4XCA A;  3MFA A;  4E27 A;  5FJK A;  4EWD A;  5JXG A;  2VMI A;  4YVS A;  1LGC A;  5DUW A;  5JCT A;  2RR1 1;  1ZZ6 A;  3C7O A;  1NYW A;  3OYW B;  3H3Z A;  5GLZ A;  2W46 A;  1E5S A;  1QJE A;  2DU0 A;  1ULF A;  1UQX A;  1H2M A;  1LCL A;  1QOO A;  3D3A A;  4FQ4 A;  5FXV A;  1SHW B;  3T0B A;  3ZXL A;  1Z7S 2;  3FHQ A;  2J1A A;  4R4X A;  2CGN A;  3I2G A;  3ZFF A;  4ATE A;  5JLV A;  1KGY A;  5A7Q A;  1PMI A;  4EYU A;  2KXL A;  4NPL A;  5JIA A;  3KQR A;  2JE9 A;  1NY7 1;  4BOW A;  2EIB A;  3BAL A;  3O1P A;  3N4M A;  1WW6 A;  3ZIW A;  4KH9 A;  1QH7 A;  3RYP A;  4YW7 A;  5C71 A;  2O8Q A;  2X10 A;  2WWU A;  4CUA A;  1CAX A;  5GLU A;  1ZZ7 A;  4LK7 A;  2W91 A;  4A7K A;  3AVS A;  4V2W A;  2HWC 1;  4TN7 A;  1M06 G;  3WDX A;  1QDO A;  4P00 B;  5IAX A;  2PEL A;  1XND A;  1F35 A;  1IPS A;  1NKG A;  4G3Y C;  5F3C A;  1UF2 C;  3VB9 A;  3ON7 A;  2GDF A;  3JXS A;  1WMD A;  4XAC A;  1ZRC A;  3S5Q A;  4AGG A;  1KXG A;  3U14 A;  2I74 A;  3NJX A;  4IEZ A;  3WNO A;  2R1B A;  5DDJ 2;  5FP9 A;  2Z79 A;  4D7S A;  1NA1 B;  1QNY A;  2JDP A;  4IEY A;  2QKD A;  2ZEX A;  4FPL A;  2RS5 1;  2NN8 A;  5IHR A;  3ZN6 B;  1UU5 A;  1PK6 C;  3FLP A;  1DFQ A;  1MR5 A;  2H6C A;  2R0F A;  3N3H A;  3WUD A;  4Z1V A;  3R05 A;  4OZO A;  5HCF A;  3NNM A;  1ONA A;  3POS A;  3BIE A;  2VC9 A;  1V6N A;  3LQC A;  3KMH A;  2Y6H A;  1IS3 A;  1QJY 3;  4CXY A;  4OUL A;  1OT5 A;  2XVL A;  5CIS A;  4QDS A;  2Q8C A;  1VBB 3;  4NRM A;  4FOQ A;  4ZZ5 A;  2WII B;  5HPO A;  1MS3 A;  4PIZ A;  4Y1X A;  2E7T A;  2V4A A;  4RGK A;  4YVW A;  4LK6 A;  2VTF A;  2VCB A;  5FP3 A;  1MS1 A;  1Q8O A;  1WCK A;  1AX0 A;  1RUD 1;  1W8Z A;  2ZGP A;  1NZC A;  2PTM A;  2ZX4 A;  3GHN A;  2W39 A;  5T5L A;  1RXF A;  3M3Q A;  4E2Q A;  1GOG A;  5K9Y A;  3DGT A;  2JG9 B;  2HWB 3;  1W8T A;  1YQC A;  1W9T A;  3JB4 C;  3PMS A;  3MZH A;  1IG3 A;  3TB0 A;  3W58 A;  5FZ1 A;  1OVS A;  2Q30 A;  2G4I A;  1GP6 A;  2FDH A;  1X9T A;  2UWB A;  4Q0S A;  5KHJ A;  1NAE A;  1QOS A;  3POB A;  2ETE A;  2YDE A;  3C8X A;  5LBF A;  1RUC 3;  3O0V A;  4JVA A;  5G05 L;  1YQ8 A;  1RUH 2;  2VNO A;  3FUQ A;  2D40 A;  3IAP A;  4U36 A;  4UFH A;  3OPW A;  4FFF A;  3C3V A;  4YM3 A;  1QY4 A;  4E2S A;  3M70 A;  2XOM A;  2HEW F;  3DEM A;  3LDR A;  1HJF A;  4AHX A;  1PK6 B;  2R32 A;  3ENR A;  2B46 X;  5BNP A;  5BNQ A;  1NCR A;  1C1F A;  3RZH A;  3LFI A;  3OUJ A;  5EP9 A;  2LUW A;  4JX0 A;  1TMF 1;  2C9A A;  1NA1 C;  4K6B A;  1PVC 2;  2RV9 A;  3AKR A;  4DXT A;  3E6D A;  4QX8 A;  1K42 A;  1N47 A;  2PHR A;  2Q4S A;  1X50 A;  1SDW A;  4YW3 A;  2UUR A;  5DDJ 3;  4IND A;  3ZSK A;  1YQ5 A;  1HQW A;  3DKW A;  5KR7 A;  4QB1 A;  2X29 A;  5I0S A;  1UO9 A;  1XQN A;  2W1W A;  4D0Q A;  4DEV A;  1QOT A;  2ARB A;  2BP6 A;  3FN9 A;  4LIV A;  4PLO A;  3LFM A;  3WDY A;  3OF1 A;  4M3C F;  4ZPI A;  4E9K A;  1AL0 G;  4NMI A;  2JKX A;  4BME A;  5A70 A;  1K12 A;  1H8T A;  3RI9 A;  4A44 A;  3ZFF C;  2RDQ A;  4QWN A;  5JMC A;  4HL0 A;  1Y9G A;  3BOP A;  3M2M A;  4Q4W 1;  4EZ4 A;  3GZA A;  2ZJC A;  1O8S A;  1EUT A;  3NMB A;  4Y33 A;  4M00 A;  4C90 A;  1DQ2 A;  5LY2 A;  4YNI A;  1CVN A;  1CPM A;  1S0F A;  3MW2 A;  3ROU A;  1WUV A;  4YW6 A;  1NLR A;  3HQX A;  4CCO A;  3KQ4 B;  4ORF A;  4ET7 A;  4FPJ A;  4MYE A;  1RUO A;  2L9L A;  3HN3 A;  2RMU 2;  3CIH A;  1OUX A;  2QQN A;  3RJR A;  3LF7 A;  4CDQ C;  3I59 B;  4CSW A;  4R4Z A;  1QQP 3;  1V6M A;  1J58 A;  2HYK A;  3IT8 A;  3U1X A;  2QNK A;  3HMY A;  4FT8 A;  3URF A;  3RZJ A;  4LE3 A;  4Y5Z 0;  3KCC A;  3M3C A;  4LBL A;  2OYZ A;  4ISQ A;  2DVA A;  4GXL A;  1QJU 1;  2Y0I A;  1VBE 1;  1O91 A;  2DWR A;  4A3X A;  2GND A;  3J8F 2;  3UJO A;  5ABJ C;  2Q1Z B;  1Y3T A;  2WN2 A;  2DVG A;  5AFB A;  1SG3 A;  1XOY A;  3A0K A;  2QUO A;  4BMB A;  2BWC A;  1IPK A;  1QJF A;  2LS6 A;  4P9W A;  1GUI A;  4Z82 A;  2Q8D A;  1LOE A;  4LBM A;  4EQV A;  4W4Z A;  3U11 A;  5KXB A;  2NPI A;  1YI9 A;  1GFF 2;  4PDW A;  4QD2 A;  3TWI A;  1AR8 2;  4DUV A;  2P3K A;  3PU8 A;  1NE6 A;  4PF5 A;  2Q1M A;  1GZW A;  1T6G C;  3OBR A;  5FO9 B;  5FZ3 A;  1LB2 A;  3IDB B;  1PVX A;  1OA2 A;  1B35 C;  1ZYB A;  2D6N A;  1SLI A;  2JDM A;  3WW4 A;  5HCH A;  4MXW A;  2PHU A;  3DYP A;  3MPP G;  1XU1 A;  1ZRE A;  4U2A A;  3LOB A;  2R16 A;  2R30 A;  4GAL A;  5EHD A;  4O65 A;  3LDB A;  4CDX C;  2IVI B;  3AZV A;  3SMH A;  3UV9 A;  4FAG A;  5A6X A;  1B35 B;  2P2K A;  1YFX A;  3WHT A;  3V0A A;  4BA6 A;  3TN9 3;  1ZVF A;  2XKP A;  4XJ9 A;  4Y20 A;  1ZRI A;  4EN9 B;  1V9U 1;  4C1W A;  2YMZ A;  3NAP C;  3MBW A;  1JOB A;  5LBC A;  2A7A A;  1Y43 B;  4LHK A;  1W05 A;  3AXE A;  4RGA A;  2HWF 3;  3ZYI B;  1FYU A;  2KM2 A;  4XQW A;  3P1I A;  2Z69 A;  1ND3 C;  3IAQ A;  1NLQ A;  1LRH A;  2CGO A;  4GJY A;  4YRD A;  4ASK A;  1L3J A;  3M1H A;  4PQ9 A;  5FZO B;  4N43 A;  3HR9 A;  5A33 B;  4JGZ B;  4QU1 A;  1OOP C;  4GD4 A;  2WNV A;  2ARE A;  4JQT A;  5FZ0 A;  2BWA A;  5J98 B;  4NO4 A;  1W6P B;  2OZ6 A;  1E57 A;  3BOD A;  1HIX A;  3ZVX A;  3ZYB A;  1HRI 2;  1NQD A;  3AK0 A;  3HNY M;  2OZJ A;  2CWS A;  1COV 2;  1R1A 3;  4UW4 A;  1S0G A;  2E63 A;  2DU1 A;  4FPY A;  1HX6 A;  2BFU S;  2XJV A;  4LPL A;  5JDB A;  1BMV 1;  1XYP A;  5K4L A;  2XB6 C;  3HAG A;  1SFY A;  2BRT A;  1KS4 A;  4KU8 A;  1AXK A;  5BNP C;  3VZK A;  3NNJ A;  4AED A;  4ES9 A;  1C57 A;  2WLQ A;  4NRP A;  5L9B A;  5LCW L;  3PJY A;  1GP4 A;  3H3L A;  4Q8L A;  3NRU A;  1FX5 A;  3K3O A;  5BYN A;  1H9W A;  1CQ9 A;  1VLN A;  1LU2 A;  2BUK A;  2VMF A;  1VBD 1;  4LE4 A;  3ASI A;  5LA0 A;  3ECQ A;  5FOJ B;  3ME2 A;  3AM2 A;  3PLQ A;  2I45 A;  1W0N A;  4K3U A;  2XL7 A;  2GN7 A;  1FPN 3;  4Y5T A;  4DS0 A;  2B45 X;  4QPI C;  4FFG A;  3KV5 A;  2MNG A;  4CCM A;  1IQD C;  2ZHL A;  3BTZ A;  4B29 A;  5JI9 A;  3NNF A;  3KWV A;  5IK7 A;  4JV4 A;  3SKV A;  1V9U 3;  4YLZ A;  1GV9 A;  2QQI A;  4EN8 B;  1KFX L;  1WME A;  2XJU A;  5D8A B;  4AVC A;  2VNV A;  5FZ4 A;  2ADD A;  3WNM A;  1BKZ A;  1J84 A;  1BYH A;  1WLT A;  3T2T A;  4AXO A;  5ABJ B;  3M4F A;  4KG8 A;  4QX3 A;  3S7E A;  5ISL A;  3FX3 A;  1UNB A;  1DYP A;  1WD4 A;  2WAA A;  1HRV 1;  1W8U A;  4AFB A;  1Z0H A;  3K75 B;  1PM4 A;  4XEZ A;  4RS5 B;  4OHV A;  5FPX A;  2A6Z A;  1G9C A;  1WCD J;  2BTV C;  1QJU 3;  1LEM A;  2FZ2 A;  2NMN A;  3FFQ A;  4AZZ A;  4CU7 A;  2K9Z A;  2Q8E A;  4UFL A;  4DB5 A;  1PK6 A;  3U10 A;  4JGZ A;  1WLW A;  4W50 A;  5BNP B;  2LRO A;  2IXI A;  4RR3 A;  1YEW A;  4GWM A;  4BQX A;  2CNA A;  5I91 A;  5FY5 A;  3I2J A;  1BEV 2;  3X29 B;  5FMO L;  1UOB A;  3AZX A;  4Y22 B;  1Q43 A;  1SFN A;  1AL2 2;  5EWS A;  4FI9 A;  2JDZ A;  1OA3 A;  2VGD A;  2WAB A;  5CAD A;  2XBO 1;  4Q4V 3;  5SV5 A;  2Y6F A;  4V2V A;  2TNF A;  4I3G A;  5FZ8 A;  5ACA 3;  3WIN E;  1QMJ A;  3VDD B;  5I8T A;  5J3U A;  3HD8 B;  4QX7 A;  4J6G A;  4FTE A;  4B7E A;  1MVE A;  4HVO A;  4CUG A;  4C0B A;  3VDD A;  2RDS A;  1DQ0 A;  4P5Y A;  3LEG A;  3U75 A;  3VBS C;  3S5A A;  1U5X A;  3OPZ A;  4J1W A;  1BMV 2;  5FP7 A;  3WG2 A;  1US3 A;  3MW3 A;  2ZKL A;  3D4K A;  5FPA A;  1OKO A;  4Q5O A;  2PHD A;  5C8C A;  3O1R A;  5HV4 A;  1MEC 1;  2DTY A;  2VZ3 A;  2ZGU A;  4HKO A;  3O14 A;  5AVP A;  1OLM E;  3CMG A;  3ETP A;  2BFU L;  1RVF 1;  2HH9 A;  2DVB A;  2FCV A;  2HWD 3;  1N3P A;  4PF1 A;  1NOV A;  3CBN A;  3KGL A;  2FCT A;  4IV3 C;  4QMA A;  1QNW A;  1ULE A;  2W08 A;  4XAA A;  2RS1 2;  3MEP A;  3R0R A;  4UFK A;  5IVC A;  4HK9 A;  4KNC A;  5G04 L;  5FYV A;  1JZ2 A;  1RMU 3;  4M01 A;  4MHR A;  4MXV A;  4E4H A;  1AR7 3;  5A32 A;  2VQT A;  2HYX A;  4K21 A;  2ILM A;  4XJA A;  3W20 A;  1COV 1;  2PAM A;  3VDD C;  2PYT A;  2FBE A;  5GZF A;  3KV9 A;  1V9U 2;  1HV0 A;  1VBC 2;  2RS3 3;  3CO2 A;  4LBN A;  1QHD A;  3ZMO A;  2HWD 1;  5JOY A;  3ZFG B;  4I0W B;  3WQ0 A;  1CAW A;  5C5T A;  4I01 A;  1WBL A;  3N35 A;  1RUF 3;  2VQ0 A;  4LTA A;  4XUP A;  3SIT A;  1WW7 A;  3MW4 A;  2YHJ A;  2GC1 A;  1AR6 2;  3O12 A;  1FV3 A;  2JX9 A;  3JD7 1;  3OOX A;  4XZP A;  3WW3 A;  4CEY C;  5BNN A;  1JYW A;  2KR2 A;  1UIJ A;  4YG3 A;  5FZ7 A;  3ILN A;  3A21 A;  3O1S A;  2X5I B;  4XQ4 A;  2RM2 3;  4NHL A;  1RL3 A;  4RHV 2;  2VY0 A;  3DCQ A;  1OBN A;  1LOG A;  1RHI 3;  3J9S A;  5JR2 A;  1CWP A;  4QHZ A;  1DZR A;  3ZDV A;  4F7Z A;  5I0T A;  3VL9 A;  4JKM A;  1BVV A;  3BUC A;  2OS2 A;  1HKD A;  1KS5 A;  2B9U A;  2ZX2 A;  2YBK A;  5FMC A;  1R1Z A;  2ARA A;  2JDA A;  3NST A;  3UKV A;  4B4R A;  1PM7 A;  3DPR A;  1CIW A;  4XUO A;  5FMO S;  1W2T A;  4NHX A;  4FFI A;  3NJZ A;  4C0H A;  5C8W A;  1SEF A;  4FXG B;  1F31 A;  3OBT A;  5A6Z A;  3W5N A;  4OZX A;  4DY3 A;  3D5O A;  5E16 A;  3NJV A;  3ZPO A;  2AEY A;  1S0D A;  4GMP 3;  4CCC A;  1NA1 A;  2CSG A;  2GN3 A;  2D3P A;  5BNO B;  2ZGQ A;  5KBF A;  2NMO A;  2Q1F A;  3CLP A;  2F17 A;  1DQ5 A;  1W39 A;  3ITQ A;  3ZOI A;  4FPG A;  4Q27 A;  3H7J A;  2VW1 A;  3LA3 A;  3WP4 A;  4XFA A;  2JDH A;  5T5O A;  5F9T A;  1YHF A;  3WX5 A;  4Q4W 2;  3D0J A;  1AR7 2;  4YM2 A;  3AJZ A;  4Q8K A;  1W8W A;  1IHM A;  3RRD A;  5F8P A;  3ALQ A;  2R1D A;  5F1R A;  2Y6G A;  3SH5 A;  4HVQ A;  1QXJ A;  1JN2 P;  5D2A A;  5H9R A;  4W6W A;  1JBC A;  3KM5 A;  3ACL A;  1JW6 A;  5FUP A;  2W68 A;  5KHH A;  2QQW A;  3S6P A;  1J59 A;  4YZ4 A;  3AYE A;  3V56 A;  2VNG A;  4N7U A;  2VBD A;  1H4G A;  5LK5 A;  4NHM A;  2BGC A;  4V1P A;  4COU A;  5L7O C;  4M3C B;  4JRL A;  4CPB A;  1CAV A;  3ZYF A;  4CP9 A;  3ZSL A;  4QQO A;  3PVO A;  4LO8 A;  5F39 A;  2JD4 A;  4CP2 A;  5DUV A;  4CU9 A;  3OUI A;  5C4W C;  2QQK A;  2Y6J A;  3LSD A;  5ERL A;  5HBA A;  2WR9 A;  2I2S A;  2XQX A;  4LKF A;  2A6V A;  1ULG A;  3EQE A;  1S0I A;  4E2G A;  4PBP A;  4IUG A;  4YZ1 A;  4MGT A;  1VAM A;  2WYF A;  5JSR A;  4OUE A;  3V64 A;  4DXR A;  4FPO B;  4Q0V A;  4TYS A;  1ENX A;  1OF3 A;  1PVC 1;  1O8P A;  1MZF A;  4LBQ A;  3ZN6 A;  4A6O A;  5FMD A;  5DAX A;  5F2W A;  2C26 A;  3RNS A;  1DGR A;  2NQY A;  1JUI A;  1UX6 A;  2VM9 A;  3ACI A;  3UL2 A;  1W8O A;  2EVX A;  3MLJ A;  5LA1 A;  1JMU B;  3T2Q A;  1JYN A;  1HN0 A;  5A6Y A;  4AI2 A;  2FZ1 A;  4AFD A;  1GWL A;  1FAY A;  3HOB A;  3RFR A;  4GJZ A;  1UKR A;  1RUD 2;  3SHR A;  2ATF A;  2VUJ A;  2WNV C;  4XUT A;  3JD7 3;  1YQ2 A;  3AMN A;  4GUL A;  4TSV A;  3UES A;  2YYO A;  5JPM B;  1UYZ A;  2PLV 1;  5J37 A;  2YZ4 A;  4FTS A;  1CD3 G;  3I3E A;  2TEP A;  4YM0 A;  5C9A A;  3DPR C;  4HVR A;  1D4M 1;  5DUU A;  4JGY A;  1LGB A;  3AMQ A;  1URX A;  2CY6 A;  4FCA A;  1YJL A;  3K4A A;  2NM1 A;  3D0S A;  1I5P A;  5A7N A;  3TBD A;  3WF0 A;  2YC4 A;  3JBG 3;  2NYY A;  3BU0 A;  1W0O A;  2VZP A;  2RJ2 A;  1EV1 3;  1ND2 B;  2IXK A;  1RUC 1;  3U07 A;  1R08 3;  1YYN A;  4XBQ A;  2DBN A;  3ZXG A;  1RUI 1;  4MSV A;  3UYJ A;  5DAQ A;  1Y4W A;  2VME A;  2VVF A;  3ZFG A;  1R09 3;  5FYI A;  2A3Y A;  2PN5 A;  2PLV 3;  4AEJ A;  4CCN A;  1PIV 3;  3U4X A;  3ABZ A;  3INA A;  5A6Q A;  4IE6 A;  1WKY A;  1VE0 A;  3USU A;  4QPG C;  3TEX A;  3RZK A;  2LAL A;  4H14 A;  1YUD A;  1G9F A;  1APN A;  3BYW A;  3JBG 1;  1JS9 A;  2A73 B;  4CA9 A;  1SBE A;  4J25 A;  2XLF A;  2E32 A;  2JXA A;  3GGL A;  4R9A A;  4UBG A;  5F5Q A;  1HXS 3;  4OI2 A;  5DAV A;  3UGH A;  1OC1 A;  1UZZ A;  2AAC A;  3JCI A;  3BU7 A;  5L9R A;  1ST8 A;  5FZA A;  4EV0 A;  5LEJ A;  3ZDS A;  1W8F A;  2AR6 A;  2BU9 A;  2ZX0 A;  1D2Q A;  2ZAB A;  1UYP A;  3A23 A;  1D0G A;  3GF6 A;  2DCK A;  4IER A;  4LNV A;  3SEE A;  3ETQ A;  4QPY A;  2PAE A;  4BIS A;  1N1V A;  2W52 A;  3J7N A;  3LWC A;  4LOS A;  5F5C A;  1JZ7 A;  3LGR A;  5K7P A;  3BTY A;  1UX7 A;  1CJP A;  2IXC A;  2JG8 B;  1AR6 1;  2GME A;  1DF0 A;  2B5H A;  3KGZ A;  4IEU A;  4CTE A;  2ZZQ A;  3Q8B A;  4OUS A;  4QU2 A;  1OFS A;  1WBF A;  2JEM A;  1VRH 2;  4P9L A;  5FBZ A;  5E8A A;  2GNB A;  3BIW E;  4AAX A;  1I1E A;  2WO2 A;  3CU7 A;  1BBT 2;  3AL6 A;  3NWK A;  5FOB B;  1LOD A;  1SBD A;  2J1E A;  3HBZ A;  1PGL 1;  1CX1 A;  3JD7 2;  3RDI A;  2JE8 A;  3D8C A;  4D69 A;  2B9V A;  4ERO A;  4FPH A;  1BXH A;  3ZXA C;  4COY A;  1AR9 3;  2VE1 A;  1RUE 2;  2E31 A;  1JTZ X;  3AXD A;  4N90 A;  4UF0 A;  1SPP A;  4GWJ A;  3KS7 A;  1G9D A;  2YPD A;  4PBO A;  3VBU B;  2XML A;  2HWE 3;  1IQA A;  1CAV B;  1W6M B;  1ZBA 3;  4JZR A;  2C5D A;  2XJS A;  2W3J A;  4MH0 E;  4CP9 B;  2MHF A;  1UZ0 A;  2QQM A;  2VJX A;  2W1U A;  3E6C C;  1POV 3;  1X82 A;  2YU2 A;  4I0A A;  1GLH A;  1MEC 2;  4F3J A;  1R08 2;  4NJ4 A;  3V0B B;  1EP0 A;  5CG8 A;  1LEN A;  1QWR A;  3WF4 A;  4HZF A;  4EN6 B;  1XB9 A;  1SFP A;  4HN1 A;  1CAX B;  1EAH 1;  2UYA A;  4NPM A;  3LA7 A;  4GAZ A;  1CX4 A;  4KG0 A;  2AEZ A;  3AFK A;  1S0J A;  5D21 A;  3A4U A;  1CAU B;  4YG0 A;  3ZYJ B;  5C7G A;  4QDQ A;  2CWM A;  4A7Z A;  5L7O B;  2VTX A;  1VBA 2;  3PJQ A;  5AFE A;  3M7A A;  4LKE A;  5FY9 A;  5KWR A;  4EZH A;  4LKD A;  4YPJ A;  4P9J A;  2YUE A;  3AZY A;  3ZXD A;  3P5B A;  1O4T A;  5EJ3 A;  2RHP A;  1KJR A;  1SMV A;  5JXJ A;  3KV6 A;  3KHC A;  5FJH A;  2RJK A;  2VW0 A;  3B5L B;  3FJS A;  5C70 A;  3VKO A;  1GWK A;  1SLT A;  1V6L A;  1AYM 1;  5J7M A;  1VAK A;  2OII A;  2WL1 A;  2GC3 A;  3AVR A;  5FY4 A;  3VHP A;  2HWF 1;  1SPP B;  4K8R B;  3WF3 A;  4K7J A;  4L99 A;  4HKL A;  4XIO A;  4HN0 A;  2RE9 A;  5H9Q A;  1MAC A;  3IZO A;  3VBF A;  3R6S A;  3PHM A;  1F5J A;  4YFW A;  1U5Y A;  3IIA A;  3NV4 A;  3KVB A;  4QGN A;  3ZXE A;  1OI6 A;  4YVW C;  1DGR N;  1GMM A;  4LBK A;  1YIP A;  1G6N A;  1GNH A;  1UXX X;  3GBG A;  5CFC A;  4MO3 M;  3UJQ A;  3W9A A;  3T09 A;  4AED C;  5JZG C;  4MGS A;  5JSO A;  4J1X A;  4YZ2 A;  1W2A X;  3CJX A;  1ZX5 A;  1RYY A;  5CBL A;  4YFZ A;  5BNO A;  1AYM 3;  1WMX A;  2P3Y A;  2D5H A;  3APB A;  4QQL A;  1GNZ A;  1PHM A;  3OGS A;  1HB3 A;  2BBA A;  2VO5 A;  5FK7 A;  1UYX A;  1NQJ A;  1WLC A;  3PVB B;  1QJY 1;  4UI9 L;  4TTG A;  2BNM A;  1HRV 2;  2FMY A;  2B4K A;  1PMJ X;  5C3R A;  1BVP 1;  1S4C A;  4RGG A;  2YFU A;  4RS5 A;  1JOJ A;  3ZFE A;  5FYY A;  2HWE 2;  3MIB A;  3GBW A;  1VR3 A;  1ZBA 2;  1EPW A;  4PT6 A;  4Z2A A;  1VMF A;  3I54 A;  2WFF 2;  2OPK A;  2DCJ A;  4W6X A;  2QQP A;  2Q8O A;  5D1I A;  5FZB A;  4GMP 1;  3SH3 A;  2XVG A;  1HB2 A;  4PJY A;  5K0U A;  4COZ A;  1BK0 A;  4RFT 0;  2O8O A;  4HOO A;  5LWB A;  1NT0 A;  4P5H A;  4RS5 C;  2J1U A;  3ACG A;  5I93 A;  4A41 A;  4Q4W 3;  2O0O A;  2H0V A;  2WBK A;  1HDK A;  2VNR A;  2DUP A;  2ZXQ A;  1Y7B A;  3WEZ A;  4I30 A;  1K5M C;  3FHI B;  1HRI 1;  4E4D X;  1GQH A;  1VBA 1;  4ZU7 A;  4P9X A;  5CFD A;  1RIN A;  1UW8 A;  3NL1 A;  3OUH A;  4UFI A;  3H50 A;  4XTM A;  3POY A;  1ZBE 3;  5DZF A;  1FMD 1;  1PO1 3;  4IEX A;  4Y5S A;  3O5S A;  3C7H A;  5F2S A;  1EAH 2;  1AR9 1;  4FPF A;  4MV2 A;  3GCX A;  3OGG A;  4DMI A;  1AYN 2;  4KGQ A;  1H1M A;  2GNM A;  2DCZ A;  5FZD A;  3HJR A;  1OHF A;  4L8Q A;  5IFT A;  4WM8 A;  4JDN A;  1SDD B;  3VDB A;  1JHN A;  2WA4 A;  1NUK A;  2XL9 A;  3DF0 A;  1RUJ 2;  2BW8 A;  4BZ4 A;  4CU8 A;  3P3P A;  1O3Q A;  1XE7 A;  2XXZ A;  2F4P A;  5IVY A;  2WT1 A;  1SLL A;  4O61 A;  4QAW A;  3AKS A;  4OQ9 A;  5HXM A;  1F15 A;  4IV3 B;  5A3N A;  1RUE 1;  3LD8 A;  3DKQ A;  3RJ2 X;  2QTW B;  1W6N A;  4BH9 A;  3RMX A;  4SBV A;  2WKK A;  2PHT A;  3WQ1 A;  2X5I A;  3OTF A;  4B4P A;  1X8M A;  4BK4 A;  3OEA A;  3ZO0 B;  5FDB A;  1VB2 A;  4LO5 B;  5BUV A;  3TRS B;  4JC1 A;  2IVJ A;  2DCT A;  3IN9 A;  5M0T A;  4LIU A;  3WW1 A;  4F83 A;  5IVF A;  5HI0 A;  2R07 2;  2YY1 A;  4E4Z A;  3SC7 X;  3ILF A;  4RR3 B;  4AAP A;  2VG9 A;  3VLB B;  4C8D A;  5H9S A;  1G86 A;  2EXK A;  4LO6 B;  2UY8 A;  1W6N B;  4GKY A;  1W90 A;  4BDV B;  2VMH A;  3III A;  1JZ6 A;  4UWD A;  4XF9 A;  3MV1 1;  4DO0 A;  5C4W B;  2WFF 3;  4GMP 0;  1O3R A;  2VZR A;  2FDF A;  1NXD 1;  4B7K A;  3JU9 A;  2GAU A;  4DY5 A;  3H1Y A;  3CJI A;  4O9G A;  1RMU 1;  1S0C A;  3OJB A;  3MF9 A;  2WWS A;  3DL3 A;  3HQU A;  1AR8 1;  3K3N A;  1VBD 3;  2JB4 A;  4MAD A;  3ZSM A;  1C8M 2;  4BQY A;  2D6M A;  1OQE A;  4IEQ A;  1LU1 A;  4LLO A;  1IG0 A;  3VUO A;  2RMU 1;  4OI0 A;  1JZ5 A;  5CZK A;  1LHV A;  4CDX B;  3THC A;  3NNG A;  1FOD 2;  5I8S A;  3HQR A;  3JBG 2;  1MZE A;  1QF3 A;  4AEK A;  4DPN A;  1UL9 A;  4IE4 A;  5CVR A;  2GH8 A;  3QBQ A;  4CDX A;  2YRO A;  5CEH A;  3SCF A;  1RB8 G;  1VAL A;  1OUR A;  3N9O A;  4YW2 A;  4ZXK A;  3OY8 A;  1VBE 2;  3D82 A;  3Q8E A;  4JDM A;  3LA2 A;  2WRA A;  5FZH A;  3EO6 A;  4BIF A;  4YZ3 A;  5IW0 A;  1R64 A;  3W5M A;  2GP3 A;  4BU2 A;  5A7S A;  2PHF A;  3QAC A;  3VD9 A;  2Y34 A;  2FCU A;  3FE5 A;  1R09 1;  2WZ8 A;  3GDB A;  4XHB A;  4D6S A;  1LTE A;  5BY5 A;  3BKZ A;  4JAA A;  3WP5 A;  2RMU 3;  4HKW A;  1RUC 2;  1XYO A;  3PTY A;  4QPI B;  2VBB A;  1GP5 A;  3FLR A;  4Q2F A;  1W8N A;  4M4P A;  5DAP A;  2ZEY A;  1ZRD A;  4AI0 A;  5A1A A;  3MDP A;  1XNT A;  3PUQ A;  4L11 A;  1D4M 2;  4MUV A;  1AVB A;  3THP A;  4ARX A;  2BER A;  2ZMN A;  1VMH A;  4COW A;  3J8F 3;  4AW7 A;  3I2O A;  1UY2 A;  2WQ8 A;  2WT0 A;  5J96 B;  3OSD A;  3KB5 A;  5FWJ A;  4LBQ D;  4FBF A;  1OKQ A;  1C1L A;  1H2K A;  1YIF A;  1CON A;  5FXZ A;  2JEN A;  1OQ1 A;  2ERF A;  4IV3 A;  4LXL A;  5CNA A;  1H0B A;  2Z42 A;  2WUH A;  4NRO A;  2FMD A;  5B4X A;  1ENR A;  3N9N A;  1O59 A;  4D8M A;  1VIW B;  3JQX A;  4HT1 T;  2HBT A;  4WBB A;  3C7E A;  1V6O A;  3RS6 A;  4MLO A;  4OI1 A;  5EV7 A;  5IYY A;  5GLT A;  3VBH A;  1AXZ A;  1W6P A;  1OOP B;  4QXB A;  4XC9 A;  4R9B A;  4XMA A;  2VXR A;  2VZU A;  5DAW A;  5FYS A;  4GWI A;  1A78 A;  1GKB A;  1Q5O A;  5H9P A;  1GU3 A;  4CZS A;  4EJR A;  2DVD A;  5A3O A;  4H55 A;  3I4I A;  3PTR B;  4BHP A;  4MGY E;  5A1L A;  1ND3 B;  4XUN A;  4IGQ A;  3ZFG C;  1SAC A;  1GAN A;  2KA3 A;  2X53 S;  2ZGM A;  4DZG A;  1RUH 1;  2VQA A;  5I0D A;  5CFD B;  1IKP A;  2AYH A;  4I3P A;  4KWL A;  3T2O A;  3VHO A;  1HQN A;  1JI6 A;  2BVB A;  4XFI A;  4RD7 A;  4LMF A;  3RMY A;  4UW5 A;  2JIG A;  1BQP A;  1Z7S 3;  1VBE 3;  4YW1 A;  3ZXJ A;  1WMF A;  4WVM B;  1CAU A;  2R06 3;  4BM8 A;  2AGS A;  3UKT A;  5KXE A;  2C4X A;  1CJD A;  4W8J A;  1FPN 1;  4E8D A;  5K0U C;  5LBE A;  3THT A;  3D6E A;  3CJI B;  4IDZ A;  3SCG A;  4K9S A;  3WY6 A;  3POJ A;  1O4Y A;  2ZPX A;  2RS3 2;  4NII A;  2J1V A;  1Z78 A;  3B9I A;  3I3D A;  1JU4 A;  2C24 A;  2VUL A;  4HAN A;  4AVB A;  4A2U A;  2IXL A;  4PDW B;  2RS5 2;  3AMH A;  5APA A;  5FYH A;  1QGL A;  1LAJ A;  2WNU C;  5FUN A;  5GKA C;  1JZ3 A;  3BPZ A;  1IKQ A;  1CIY A;  5DG1 A;  1UY0 A;  3HVD A;  5FYU A;  2VOX A;  1W9S A;  2P1B A;  4P9G A;  4AVS A;  2ZZJ A;  5BNN B;  1DDL A;  1XE8 A;  5A3P A;  3OBA A;  1DQ1 A;  2XJR A;  2YPJ A;  4N7I A;  3FUO A;  5EIY B;  5JZG A;  1MS8 A;  3PL0 A;  4XFF A;  3WLU A;  4QKF A;  1FOD 1;  2CHH A;  3J7L A;  3TOJ A;  2OXB A;  3K51 A;  4WVW A;  5EQU A;  1FPN 2;  5A3U A;  4PI2 A;  2OPW A;  2XPJ A;  4QPI A;  1HRI 3;  5GLW A;  1C8M 1;  2ET7 A;  3LEK A;  1WA6 X;  3A22 A;  1HB4 A;  3VBH B;  4AF9 A;  4BJ0 A;  4M4R A;  4KL1 A;  3AX4 A;  2CAV A;  1OPO A;  1XNA A;  1ZBE 1;  4QB6 A;  3ACH A;  3JZV A;  4Q0U A;  2VCM A;  4QT6 A;  5FY8 A;  1SLA A;  1MS0 A;  1QEX A;  2NLR A;  2ZML A;  4FO9 A;  4AHW A;  2E33 A;  4CDQ A;  1H1A A;  3SIS A;  5JXH A;  1VMJ A;  2WNV B;  4MZU A;  4M3C E;  4R8H A;  5FMB A;  2IWG B;  3H8R A;  1OD3 A;  3O1O A;  2LRP A;  4RHV 1;  1EV1 1;  1DLC A;  3WNP A;  4HSL A;  3IKW A;  1I6X A;  4XVH A;  1UY1 A;  2IUW A;  2HWB 2;  5DUX A;  5CFC B;  4QHO A;  3V65 A;  2VR4 A;  1FT9 A;  1Q56 A;  2A3X A;  2BVV A;  2E53 A;  3I3B A;  1O6U A;  1AXY A;  5J09 A;  5BPX A;  4NN0 A;  3H8X A;  1YLL A;  1ULD A;  2RR1 2;  2E7Q A;  4BPZ A;  1PO2 2;  3AFG A;  2CAU A;  3OGJ A;  4NIH A;  4M0H A;  3SCH A;  3VKL A;  2TUN A;  2Y64 A;  4XFG A;  1JYI A;  4NVP A;  3O0W A;  5JIU A;  3T0A A;  3B00 A;  4QXK A;  4JRA A;  1DGL A;  1OLR A;  1TMF 3;  4MXW B;  4RN5 A;  2ID4 A;  4XF3 A;  5FZL A;  3PVN A;  5F7U A;  1UZV A;  1RTV A;  3FC0 A;  3KCX A;  4AL9 A;  2QZ2 A;  2JWP A;  3MV0 1;  3IMN A;  3VHN A;  3O7O A;  4XF1 A;  4YGC A;  4IE7 A;  4Q4X 2;  3VGI A;  1EAH 3;  2G1M A;  1AUY A;  4X6Q B;  2UYB A;  1JU3 A;  1WD3 A;  3MHZ A;  3VV1 A;  5ANN A;  5A7P A;  3I97 A;  4LBO A;  4PLM A;  1RUI 3;  2JDK A;  3P3N A;  1ENS A;  1WGP A;  1F5F A;  2WQZ C;  3WZ1 A;  1QQP 2;  5E89 A;  2H0B A;  2X5I C;  5EJZ B;  3FL7 A;  1U5Z A;  5FV3 A;  4L0P A;  2RDR A;  2EAK A;  1DIW A;  4FOV A;  4TZD A;  3U37 A;  2GH2 A;  2PHL A;  3KLS A;  1R1A 1;  5D8A A;  5T52 A;  1S0E A;  4NIA A;  3DN7 A;  3BN6 A;  2WJS A;  3KCY A;  3LCP A;  1UKG A;  5HCA A;  2BOJ A;  1TME 1;  4NAO A;  1XJA A;  4CEW A;  1BZW A;  1PX4 A;  4XFH A;  4IET A;  3RWN A;  1RC6 A;  2P5B A;  1QXP A;  5J1X A;  3AKQ A;  4UF0 B;  1X9P A;  2OVU A;  2P37 A;  5CB7 A;  1IS4 A;  1H9P A;  1W3X A;  1AL2 3;  5IWF A;  3IBM A;  3MIG A;  4OMD A;  2P3J A;  3ZYH A;  3CZU A;  1AZD A;  1QKQ A;  2ZX1 A;  3LZZ A;  4XUR A;  2XLA A;  1Q8S A;  5T5J A;  2A1X A;  5AC9 1;  4AG4 A;  4PQQ A;  3I3M A;  2Y38 A;  2YFZ A;  2VXJ A;  5LA2 A;  3M3E A;  2VZ1 A;  2HWC 3;  2WO1 A;  4XAE A;  4BIO A;  4QQH A;  2WNU A;  3T0D A;  4ZKT B;  1WCS A;  5IVE A;  2HJI A;  5FQ0 B;  4BQ2 A;  1C8M 3;  2RR1 3;  4UW3 A;  2VZO A;  5T3N A;  5JR7 B;  3O1M A;  3LDK A;  1SBF A;  5FZC A;  5C9A C;  4AI9 A;  2IXH A;  3R4U A;  1G8W A;  2IXJ A;  3TNP B;  1F9K A;  3OYW A;  3S0M A;  3CHX A;  2JDU A;  3GXU A;  1RUF 2;  2OW4 A;  3WG1 A;  3LPF A;  1IPJ A;  5FO7 B;  1KJL A;  4FFH A;  4JGZ C;  2Y6K A;  4ZU4 A;  3ZFE C;  5A7W A;  3JUU A;  5C8C B;  4Y1Z A;  1S2K A;  4JTO A;  2VUD A;  5CU1 A;  3G7D A;  5A3L A;  2W92 A;  3NAP A;  1W2U A;  2A70 A;  2ZCW A;  1LHW A;  4UT5 A;  2RM2 2;  4RHV 3;  1HJG A;  1C4R A;  4NE9 A;  1UOG A;  2E51 A;  5C3O A;  4I02 A;  3V0A B;  3GZU C;  4A4A A;  4IGP A;  4OHZ A;  2BOI A;  2MPF A;  3DYO A;  1RIT A;  4EN0 A;  1DG6 A;  2EIE A;  2ZEZ A;  3E5Q A;  3MGU A;  1AR6 3;  4QKD A;  1CES A;  3NVC A;  4Y22 A;  2ZGL A;  1A8M A;  1DU3 D;  3RYK A;  4ASM B;  4Q4Y 3;  3DXU A;  1CZV A;  2ES3 A;  5FZE A;  3OD0 A;  2QE3 A;  3NKT A;  1W2O A;  3O1T A;  1Y9Q A;  4QGM A;  2EXH A;  2A6Y A;  3BB6 A;  1F2N A;  3CEW A;  3MYX A;  3QD6 A;  4D6R A;  3SNM A;  1ZNP A;  5L7O A;  4LR4 A;  1N1S A;  4XYX A;  1V00 A;  4AVA A;  1EYB A;  3KF3 A;  4IQP A;  3DV8 A;  1VP6 A;  1OXC A;  4Q29 A;  2XON A;  1D2S A;  2Y8K A;  4LUM A;  1HQL A;  3ZYR A;  5KHK A;  3AZW A;  2ORZ A;  2GU9 A;  5GLV A;  1U0A A;  3K4D A;  4OLL A;  1Q8P A;  1ZBA 1;  3DEC A;  1UXZ A;  5FY7 A;  5L36 A;  4M3C A;  1W6Q A;  2WWJ A;  3ZSJ A;  4C1X A;  3KT7 A;  4BXS V;  1POV 1;  2YGM A;  2D3R A;  3IDE A;  1HLC A;  4Y1V A;  3V0B A;  3GJB A;  4GIQ A;  3CNA A;  4NWW A;  3PUH A;  3UT0 A;  1DYO A;  3QCW A;  4L97 A;  4JHT A;  3HBK A;  5DXD A;  3K2O A;  4Q1P A;  1BK1 A;  3L9J T;  3H3U A;  4ZZ8 A;  4KU7 A;  3OBZ A;  4FAH A;  3EJK A;  4AGR A;  5CAZ A;  4XTP A;  2P4E A;  1RUG 3;  4M0N A;  1P8J A;  1FMD 3;  1PO1 1;  3OPT A;  1MZ6 A;  3AP9 A;  2BEO A;  3BVC A;  1ND3 A;  5IUQ A;  3A0N A;  1LOB A;  1DHK B;  1ZM1 A;  2BNN A;  3PIJ A;  2WSU A;  3QOP A;  3N36 A;  5EFU A;  1YRZ A;  1IS6 A;  2VTX J;  4Q0Q A;  5KXD A;  1OOP A;  4A45 A;  1OH4 A;  3LB9 A;  1LHU A;  5A3M A;  1RXG A;  4CEY B;  1BCX A;  1UMH A;  1TQ5 A;  1CGP A;  4Q0P A;  4XFB A;  2QDR A;  2R06 1;  3VZJ A;  4A6S A;  1NE4 A;  4CDU C;  3OGV A;  3ZYP A;  4MX3 A;  1W99 A;  1UU6 A;  2VMC A;  4MOA A;  4OYU A;  5BV6 A;  2W94 A;  4IEW A;  5F5A A;  1QJU 2;  5FCC A;  2QFE A;  2ORX A;  4EWE A;  1LR5 A;  3I2F A;  4DIQ A;  1ASJ 3;  4ZXE A;  2QVS B;  4NID A;  3AL5 A;  1GOF A;  1TEI A;  1W6M A;  1PZ7 A;  2AH2 A;  3OEB A;  2VEC A;  4PIX A;  2BJS A;  4YWA A;  2VCC A;  5FP4 A;  2HEY F;  4CUB A;  3HNM A;  2CTV A;  2PQS A;  1L7R A;  3H8U A;  3AYD A;  3PDQ A;  3UNP A;  3WT3 A;  5HV0 A;  2RS1 3;  1HV1 A;  2WN3 A;  4LJH A;  3MF6 A;  1MQT B;  2CDO A;  3H0O A;  1O3S A;  4HLT A;  4NIG A;  2QQV A;  3IM0 A;  2JJ6 A;  4XXP A;  4Y20 B;  3TEY A;  1PGW 2;  2GAL A;  2BV4 A;  4I09 A;  2C1F A;  1QJX 1;  3B93 A;  1H30 A;  4HXC A;  3MIF A;  5FYB A;  4URT A;  1LKN A;  3S30 A;  4ASL A;  4ARY A;  2E9Q A;  1XC6 A;  5EZW A;  2ENR A;  3ZKU A;  3CQO A;  1V70 A;  4IW3 A;  5JOW A;  5K8S A;  5FXW A;  1F8V A;  5LA9 A;  2J1S A;  2Y6L A;  4BQW A;  1XNK A;  2VUC A;  3B3Q E;  4Y26 A;  3WXP A;  3KHB A;  2R6Q A;  3J4U H;  3ZFE B;  1OSG A;  2CU5 A;  2X09 A;  1ND2 A;  5DAB A;  3H1W A;  4LOT A;  3Q8A A;  1HB1 A;  4YSF A;  2IZW A;  2WZR 2;  1S2E A;  3MLL A;  4IXL A;  4HPK B;  2C6S A;  1JYV A;  2ZGT A;  4MET A;  3BTA A;  4CCE A;  2ZTN A;  5ABJ A;  2VZT A;  3ACF A;  2UU8 A;  4LHS A;  2R04 3;  5IVB A;  1G9A A;  3IB3 A;  2WNU B;  4OI4 A;  3U0Z A;  3WUC A;  5IK4 A;  2ZS6 B;  5C9A B;  1ZZB A;  1N1Y A;  1WCQ A;  1VRH 1;  4KQ7 A;  4UOJ A;  3T1M A;  4X8N A;  1OD5 A;  2WDB A;  3K77 A;  4BQ3 A;  1VAV A;  2WT2 A;  3BGA A;  4H3W A;  1PGS A;  1RUH 3;  3UKN A;  4KWK A;  4DUX A;  4KWU A;  3H9A A;  2RVA A;  1PO2 3;  4HBN A;  2HKX A;  4B4Q A;  1MS4 A;  1Y9M A;  5K0U B;  3IDA A;  1OH3 A;  1YC6 1;  3I2H A;  3Q8C A;  5JVV A;  1UMZ A;  1ZBE 2;  2DBI A;  4CCL A;  3WQB A;  5C3Q A;  4JGY C;  2LM3 A;  4WVV A;  2QJV A;  3FMG A;  1GR3 A;  1UAI A;  3KT1 A;  4R52 A;  4CDU A;  1WCU A;  3EB7 A;  3HT1 A;  3PUA A;  5FFO C;  4D7Y A;  3ZKY A;  5KHG A;  5KC5 A;  2QDN A;  2AEN A;  4ZHN A;  2WYS A;  2XWB B;  1RHI 2;  3VHR A;  3A7Q A;  4Q26 A;  1KDM A;  4N9I A;  2D6L X;  4AVT A;  4LKS A;  2ADE A;  4DUW A;  4LHN A;  3B94 A;  3AP5 A;  3BPS A;  1AR7 1;  1W9Y A;  2D93 A;  4QGL A;  3ATG A;  3LKJ A;  5FY1 A;  2XVK A;  4HON A;  4K8F A;  1UY4 A;  3H1M A;  3N7L A;  5JWP A;  3VBR A;  2V4V A;  2VOT A;  2BYV E;  4YGD A;  1O7F A;  3M8L A;  3RVH A;  4MG2 A;  2RS3 1;  4CDQ B;  4RL7 A;  1X7N A;  3AB0 A;  1D0H A;  4R9D A;  3VL8 A;  4NHK A;  4BXF A;  4HFS A;  4E8C A;  4YM1 A;  1ALY A;  4CP1 A;  4EE2 A;  1U5I A;  2HBU A;  2OKX A;  4OFG A;  2WS9 3;  4GB3 1;  5BXX A;  1W8H A;  3WVJ A;  4AFC A;  1VRH 3;  2Y26 A;  4B1L A;  2MEV 3;  3VBH C;  1MEC 3;  4CYD A;  5FYZ A;  4COV A;  2JDN A;  4S2G A;  2YU1 A;  4AQ2 A;  5J48 A;  2JG9 C;  4Y3O A;  3SH4 A;  1PIV 1;  4JQR A;  2WZE A;  1PX3 A;  2HWC 2;  3OG2 A;  1AX2 A;  3ZR5 A;  1LGN A;  3AC0 A;  4A3Z A;  5JXI A;  3OY8 B;  4CCK A;  2A3W A;  3VKM A;  4CPB D;  4KI5 M;  4BQ5 A;  3PUR A;  2Z4F A;  2GMM A;  3N7J A;  1O5L A;  3BCW A;  1W6O B;  2XJQ A;  2B42 B;  1E5R A;  2QQJ A;  4BLJ A;  2D6O X;  3L2H A;  4OMC A;  4Y4R A;  3PNA A;  4ES8 A;  4MGK E;  2XJT A;  1LUL A;  1WLD A;  2I07 B;  5T5P A;  2A75 A;  2J7M A;  2GC0 A;  4QPW A;  5DMY A;  2D6K A;  1RUD 3;  3WQ7 A;  5C3P A;  3FHA A;  1RGS A;  2NZ9 A;  3AKP A;  2EAA A;  5FZM A;  2OQ6 A;  3LSE A;  3FWE A;  2ZGK A;  4LIT A;  3M3O A;  3WNK A;  2J42 A;  4XJ8 A;  1VBC 1;  4XFC A;  3VKN A;  1AHS A;  4W6Y A;  5LBB A;  3F95 A;  5GZG A;  5FYM A;  4AK3 A;  2W0X A;  3RI8 A;  2Z2S B;  1QJX 2;  1FXZ A;  2WA3 A;  2W95 A;  3ZN4 A;  2J1T A;  1V6I A;  1JYC A;  2WS9 1;  4GB3 3;  5CYY A;  3GBF A;  4P9Y A;  4MGQ A;  5EJ1 B;  4PI0 A;  3MI8 A;  3N7M A;  2MEV 1;  4Y1U A;  1HN1 A;  4O9E A;  1FAT A;  1F4A A;  2BNO A;  2XHN A;  4NWV A;  4YW5 A;  1RVF 2;  3MUY 1;  3VDA A;  3WDU A;  5ACA 1;  1R09 2;  1UOF A;  2V5Y A;  4CVU A;  5BNN C;  1M4W A;  2Q0A A;  3ZPY A;  5L19 A;  4G9S B;  1B35 A;  1J1T A;  2V73 A;  1C8N A;  2YXS A;  5FTT C;  5LEK A;  4N9H A;  1W6Q B;  3UET A;  2G9F A;  3VBU C;  3WDW A;  1PGW 1;  3H8O A;  1GOH A;  1XNC A;  4PDW C;  5LRR A;  3RGB A;  4YG6 A;  4D3W A;  2DV9 A;  4FVV A;  4BB3 A;  4YVS C;  4AYU A;  4CEY A;  2ET1 A;  1YCI A;  3AP6 A;  5CKM A;  2F6B A;  5A32 B;  2GC2 A;  2J22 A;  1VB4 A;  3NKG A;  3HNB M;  4N43 B;  3IWZ A;  5A33 A;  2EA7 A;  1JZ4 A;  1AL2 1;  4GA9 A;  4DRV A;  1GIC A;  1XE0 A;  5IT6 A;  4LO4 B;  2A5Z A;  1PVC 3;  2ZMK A;  5FLH A;  1KEX A;  1J3P A;  1PO1 2;  1WZX A;  2D5F A;  5FPZ A;  3ORJ A;  1N3O A;  4JHZ A;  3VBU A;  3ZXF A;  2JG8 C;  3AP4 A;  2A6W A;  1OVP A;  2WQ4 A;  4YW4 A;  5FLJ A;  5CFD C;  2FDG A;  2G9Z A;  2K0G A;  3GCW A;  2BGP A;  3HIF A;  3WCR A;  1POV 0;  4BQ4 A;  3FBM A;  2EAL A;  3PUS A;  4FOY A;  1I9R A;  1SZB A;  2F4L A;  3HPN A;  2FDK A;  1H1I A;  1K5M B;  2ZGN A;  3GM8 A;  4TXW A;  3RYR A;  4AI1 A;  4QHB A;  2AC1 A;  3PME A;  3WNX A;  4CCD A;  1OFN A;  4XIK A;  4LT5 A;  1ACC A;  4AOC A;  1JOD A;  3JQW A;  1CN1 A;  1F4H A;  4CXW A;  1LEC A;  1U12 A;  2UWA A;  3SQO A;  2P6C A;  5LRS A;  3USS A;  2A6X A;  3N9M A;  4Z07 A;  2XKO A;  2FHR A;  5FZO A;  3UK9 A;  2HWD 2;  2ARX A;  1IGO A;  1STM A;  3QLQ A;  1H8T B;  3T30 A;  5F6L B;  4XJW A;  4IV1 B;  3BOW A;  4WM7 B;  1RUJ 3;  3T3Y A;  1ASJ 1;  3NJY A;  1KDK A;  4L92 A;  1AJK A;  4Q4V 2;  5HCB A;  1S0B A;  3E97 A;  1RVF 3;  3QH6 A;  4D7T A;  5FIX A;  3R4D B;  4K1Y A;  2O1Q A;  4QKB A;  1V6K A;  2JIC A;  3WNL A;  1XNB A;  3EYP A;  3LEM A;  3LOI A;  4WV8 A;  1XSR A;  3VDC A;  4X6R B;  2RS1 1;  2FDI A;  4B3N A;  4RR3 C;  3BTX A;  3MIC A;  4ITC A;  4UFJ A;  1IZ3 A;  4XIL A;  4XZU G;  3ZR6 A;  4AFA A;  5T54 A;  5JZG B;  3TEZ A;  2YC0 A;  3VD3 A;  1FNY A;  1BLZ A;  3TN9 2;  4LEJ A;  1KQR A;  1OUS A;  1AX1 A;  1A3K A;  3TN9 1;  5CFC C;  1O4Z A;  4FXK B;  2D7F A;  1D4M 3;  3WP6 A;  4DQA A;  1W2N A;  1FOD 3;  2OUH A;  4I2O A;  3FBY A;  4BK5 A;  4DOU A;  4YYO A;  2VOW A;  2DTW A;  1MPX A;  5JI7 A;  3THD A;  3VBO C;  4Z8B A;  4CEW B;  1G7Y A;  4PHZ A;  1RUF 1;  2XG3 A;  4UAP A;  3TEW A;  3MUZ 1;  3VBO A;  4JKK A;  4S2D A;  4HK8 A;  4C91 A;  1Q8Q A;  3M3I A;  4LOR A;  1UMI A;  2EXJ A;  4F8A A;  2VD7 A;  4LUK A;  2XBO 2;  1RED A;  1DQ4 A;  1ZZC A;  2JG9 A;  4SLI A;  2RM2 1;  4ZY9 A;  1G9B A;  5IVV A;  1BEV 1;  1TZO A;  4QQP A;  5C4W A;  1JXN A;  1QJY 2;  1UN1 A;  4AI8 A;  4RFR B;  4CDW B;  4Y4Y A;  2FDJ A;  5GZD A;  4B8E A;  4FOW A;  1GBG A;  1REE A;  4LA3 A;  1GZC A;  3H42 B;  2IFW A;  2G9G A;  1LOC A;  1K45 A;  4KMQ A;  3VZL A;  1HW5 A;  2DYC A;  3PUI A;  5AC9 2;  4I0B A;  2AUY A;  3T4V A;  2OQ7 A;  5FXX A;  1NLS A;  3O0X A;  4AEM A;  4JKL A;  3WDT A;  3ES4 A;  4N8M A;  1NXM A;  3HN1 A;  2DF7 A;  4FPC A;  3ZX7 A;  2ZA9 A;  1ULO A;  3VD7 A;  2YBS A;  3PU3 A;  4CP0 A;  4Q4Y 1;  5EPA A;  3NQH A;  4K1Z A;  1B09 A;  4QPG B;  5JAX A;  4OHW A;  2HLE A;  3DYM A;  2JD9 A;  4XDP A;  1X8E A;  3RWK X;  4TWT A;  1S1A A;  2QZ3 A;  2VCA A;  2XHK A;  1YFY A;  4BYY A;  2VVD A;  5FPU A;  2OX0 A;  5DG2 A;  5IK8 A;  1GYK A;  2G19 A;  4RYD A;  3J8F 1;  5A3T A;  3QH7 A;  4E4S A;  5B4N A;  1XBF A;  5FPB A;  2ZHM A;  2VAU A;  4XET A;  1A8D A;  5FR3 A;  3CJI C;  5L73 A;  3I2K A;  5TSW A;  2YGL A;  3OB8 A;  5GZE A;  4QQ2 A;  4AQT A;  4UBH A;  4XW3 A;  3POW A;  1EUU A;  2BPA 2;  4K20 A;  2RDN A;  5FRE A;  2Y0O A;  2ZGO A;  2CV6 A;  1HRV 3;  2PHW A;  4RQP B;  4XF0 A;  3J7M A;  4IGO A;  4CDW C;  5I8Y A;  5LK7 B;  1AJO A;  2YBP A;  5C6C A;  3BI3 A;  3KF5 A;  4QX0 A;  5C5U A;  4AGV A;  2WS9 2;  3LIG A;  5BNO C;  1COV 3;  1R1A 2;  2GNT A;  2JEC A;  3OGR A;  1ZZ9 A;  3N9L A;  5DPN A;  4AFM A;  1CAW B;  4YZ5 A;  4N53 B;  1BEV 3;  3E6B A;  2JE7 A;  5LW9 A;  1IOA A;  3TYJ A;  1JYX A;  2V5D A;  1C3H A;  1A6C A;  4H2A A;  4QX1 A;  3KZ4 C;  3N7K A;  3NO8 A;  3USU B;  2P6H A;  4AHZ A;  4URA A;  5ACA 2;  3VBO B;  5KC6 A;  4HMZ A;  2DVF A;  4NRQ A;  3RQ0 A;  3AYA A;  2XBO 3;  3VBF C;  5EYY A;  3MPB A;  1J3R A;  3G6J B;  4QPG A;  2XDV A;  4KWJ A;  3I8T A;  4YVS B;  2EID A;  4NR1 A;  4Q4X 1;  5C33 A;  4Y1Y A;  4BWO A;  4YGE A;  1JUH A;  4IV1 A;  1O5U A;  2RS5 3;  2HWB 1;  4IEO A;  4JTN A;  1CZT A;  1UOJ A;  4K40 A;  1GSL A;  2EIG A;  4ISR A;  2VZQ A;  3IDC B;  5AC9 3;  3B02 A;  3WNN A;  3OD4 A;  1XRU A;  1US2 A;  4NOT A;  2JB8 A;  3CZJ A;  3LPG A;  2D97 A;  3WHU A;  2O14 A;  2ARC A;  1LES A;  4CDW A;  4DNY A;  4TLG A;  4XF4 A;  5DZE A;  2OUJ A;  1RJ8 A;  2WFP A;  3NV1 A;  4WM8 C;  2TBV A;  3MLK A;  4QX5 A;  4WZC A;  3KSC A;  4OHX A;  1KRI A;  5FY0 A;  1E5I A;  1QH6 A;  2PXJ A;  5CG9 A;  1K5M A;  2WNO A;  3GAL A;  4WM7 A;  4XUQ A;  1SQ4 A;  4ZS2 A;  1H8T C;  2BBV A;  1CZS A;  1FNZ A;  1OA4 A;  2Q5T A;  3LEI A;  5EYX A;  3I59 A;  4GZ9 A;  5E1R A;  1KFU L;  1VBC 3;  3T08 A;  5I0R A;  1QJX 3;  5A1F A;  1SLC A;  1ULP A;  1LHO A;  3RG0 A;  3VD5 A;  2DUR A;  5FZ6 A;  2XH6 A;  2D3S A;  2PAK A;  3E5X A;  4GB3 2;  4H7L A;  2DCY A;  1NCR B;  1YFW A;  3Q9O A;  5FWE A;  4KBB A;  3RZL A;  3I2D A;  1KIT A;  3AMM A;  4MGI E;  1TME 3;  1PIV 2;  1DGW X;  3IMM A;  1NCQ B;  5A3W A;  3RZG A;  4IL7 A;  3S57 A;  4Y24 A;  1NCR C;  2HEV F;  1LNS A;  1ZRF A;  1CPN A;  1BJQ A;  1RJ7 A;  2EF6 A;  4YAR A;  1O3T A;  1YNA A;  1RUI 2;  4FPE A;  3U78 A;  1J3Q A;  3C2U A;  1ODN A;  5FLI A;  3VBS B;  2WAO A;  2VL4 A;  3LAG A;  4XHX A;  1DP0 A;  4N53 A;  5HXV A;  1RHI 1;  2CYF A;  2FD8 A;  1DZT A;  2C9K A;  3FZ3 A;  4LLF A;  3C7F A;  4WZF A;  1GZW B;  4AR2 A;  1TG7 A;  2ZBJ A;  3WG3 A;  1DQ6 A;  2C0Z A;  4DXS A;  4GH4 C;  3ZN5 A;  1XPW A;  5F3I A;  5DDJ 1;  2B39 A;  1GZ9 A;  1WW5 A;  4GWN A;  3VBR B;  2PLV 2;  4IV1 C;  5FZF A;  3WDV A;  2SBA A;  5F6K A;  3WD5 A;  3CDZ B;  2VMG A;  4JCK A;  2LW8 A;  5FYC A;  2D44 A;  3MID A;  3WV6 A;  2VBP A;  3NW4 A;  2RG4 A;  1H6X A;  2RJL A;  2WO3 A;  3RPQ A;  5JOX A;  1GWM A;  3VZO A;  1NX9 A;  3SXW A;  3IPV A;  1NZI A;  1YWK A;  2ZAA A;  2SLI A;  4AQ6 A;  1VPH A;  4W65 A;  4LA2 A;  4QB2 A;  5FBJ A;  2WC2 A;  3VD4 A;  4OQ8 A;  4A7Y A;  4L2N A;  5L9V A;  5JPN B;  1L7L A;  2QBX A;  3K46 A;  2A71 A;  1UD1 A;  4P08 A;  4EN7 B;  3E1F 1;  3PVE A;  5FPV A;  3O1V A;  3P6B A;  1DGW A;  1PMH X;  4QXH A;  3VBF B;  3VBR C;  1TMF 2;  5FZG A;  2VMD A;  3MFC A;  2BQP A;  1OQD A;  1XXN A;  4NHY A;  3GYD A;  3L2Y A;  4BCU A;  2DDU A; 
#chains in the Genus database with same CATH homology
 4YWA A;  1W8W A;  5D21 A;  1W9F A;  1OH3 A;  4LK6 A;  1W8U A;  2KR2 A;  3ZYH A;  2WYF A;  1W8Z A;  4LJH A;  1GWM A;  4LKE A;  4CP9 B;  4LKD A;  1WZX A;  2Q1F A;  3ORJ A;  4A6S A;  4YW7 A;  1UOJ A;  3UT0 A;  3ZYB A;  2VXJ A;  1L7L A;  1W8T A;  1WCU A;  1WMX A;  4LK7 A;  4CPB D;  2LRO A;  2LRP A;  4BQ5 A;  3F95 A;  1V0A A;  1OKO A;  1GWK A;  4AL9 A;  4CPB A;  3ZYF A;  4CP9 A;  2JWP A;  1W90 A;  4YW6 A;  4BQ4 A;  4BQ3 A;  2O14 A;  1HN0 A;  1GWL A;  4BQ2 A;  2K46 A;  2C24 A;  4LKF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...