2LRPA

Solution structure, dynamics and binding studies of ctcbm11
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
172
structure length
172
Chain Sequence
MASAVGEKMLDDFEGVLNWGSYSGEGAKVSTKIVSGKTGNGMEVSYTGTTDGYWGTVYSLPDGDWSKWLKISFDIKSVDGSANEIRFMIAEKSINGVGDGEHWVYSITPDSSWKTIEIPFSSFRRRLDYQPPGQDMSGTLDLDNIDSIHFMYANNKSGKFVVDNIKLIGALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endoglucanase H
publication title Solution structure, dynamics and binding studies of a family 11 carbohydrate-binding module from Clostridium thermocellum (CtCBM11).
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Hydrolase
total genus 33
structure length 172
sequence length 172
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2012-04-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 2lrpA01
3ORJA 4BQ4A 4A6SA 4CPBD 1UOJA 4LKFA 1WZXA 2KR2A 4AL9A 4LK7A 4CP9B 4LKEA 2O14A 3ZYBA 1GWLA 5D21A 4YW7A 1W8UA 4CPBA 2Q1FA 4BQ5A 3UT0A 1W8ZA 2LRPA 2JWPA 4YW6A 1GWKA 4LK6A 1L7LA 2WYFA 1WMXA 1HN0A 2K46A 3ZYHA 1W90A 1OKOA 4CP9A 2LROA 1V0AA 3ZYFA 1W8WA 2VXJA 1W8TA 2C24A 1W9FA 4BQ2A 3F95A 1WCUA 4BQ3A 4LJHA 4YWAA 1GWMA 1OH3A 4LKDA
chains in the Genus database with same CATH superfamily
4JCKA 1PMHX 3ZFFB 3ZLIA 3OYWB 2W2IA 3N7MA 3MLKA 1N3OA 3LPGA 4A6OA 3USSA 4ET7A 1WZXA 1RUI3 5FZ1A 1YIFA 2YHJA 3SEEA 3ECQA 4AEDC 2JIGA 2HWC3 3BB6A 3W20A 2FMYA 4DINB 2WFF2 5A7WB 4META 1RC6A 3RZHA 2B46X 2YPDA 2YROA 3UT0A 3ZOIA 4NWWA 3I3MA 3ZMOA 3B5LB 4ATEA 1EYBA 2DTWA 1IZ3A 1JYNA 1RUG1 1O5LA 2NZ9A 2ZKNA 3BIEA 4FPLA 4UFIA 2VQ0A 1W8OA 3E5XA 3A7QA 1AX0A 2JDPA 2WZR3 1ALYA 3GM8A 3VBOB 4LR4A 2XPJA 1GWMA 2WFF1 2VZTA 5F3CA 1WCDJ 3LDKA 5IHRA 3UKNA 3EXUA 4XF4A 1R092 3A4UA 1J1TA 2ZS6B 3ST7A 1BQPA 1GQGA 1XPWA 2JJ6A 2R042 1H30A 2DURA 3HPNA 1SCRA 4COUA 3ILRA 3Q8CA 4TSVA 2OQ7A 3GBFA 3ZFGC 1HQLA 4FPOB 1ZBE3 1S2EA 1I6XA 2VW1A 1GWKA 1X9PA 4LTAA 1A8MA 3ZN4A 1R091 1UYXA 2WNVC 1TG7A 2QQVA 3OD4A 5J98B 5DPNA 3WD5A 3J26N 5G04L 2R041 4FPEA 5FMBA 5FLHA 2X5IB 3NNGA 4I0WB 1WMEA 3WCSA 4CDXC 3KLSA 5DMYA 1A6CA 3AMNA 4L2NA 3VBUA 4QU2A 2Y6FA 1WCKA 4Q1PA 1D7PM 1U5XA 4BIFA 1GLHA 1AR63 1Y43B 5FFOC 1GKBA 3FC0A 1W05A 1O3TA 2MEV3 4XBLA 1HDKA 2B9UA 2J22A 4B4QA 2I2SA 4CCCA 3I54A 1CJDA 2XVGA 4HKWA 4ARYA 3WLUA 2J1EA 4R8HA 1O8SA 2JDAA 2YU2A 3BOPA 1LOBA 4AVVA 2WINB 3AYAA 4AQTA 2ZGNA 3VZMA 1LOGA 2JB4A 2DUQA 2QBXA 4XJWA 3ZYIB 4A2UA 5LEJA 1OLQA 4K20A 5H9PA 4CUAA 5C4WB 1ZBA3 5C8CA 1SACA 5A7OA 5C3OA 4JGYB 5CG8A 5T54A 4Y4RA 4Z2AA 1XE8A 2ZGQA 4AQ2A 5CU1A 1UF2C 3MW4A 2V73A 1MZ6A 1ONAA 1VMJA 1GP5A 1LB2A 1OF4A 1W9YA 4AVCA 5A7PA 1XNKA 3S6PA 3ZYBA 3BCWA 5FBZA 3ES4A 2AH2A 4XYXA 1X82A 2CGOA 1PGL2 4XF9A 3WG4A 1JOJA 4NHXA 3OUIA 4XTMA 4HT1T 3I3QA 1HB2A 3ZXLA 2HEVF 5JAXA 4JRLA 3N9QA 3OF1A 3PJYA 4RD7A 1WW4A 2XXZA 4XJUA 2ERFA 2JDYA 1S0EA 2DVAA 1ASJ3 1MVEA 2K0GA 3R0RA 3VBRB 3HT2A 4AGVA 1PGL1 3HN1A 3ZMNA 2FD8A 1LHVA 4CVUA 1SBDA 4Q0VA 3RSJA 2G9ZA 2DV9A 4AL9A 3EHKA 1CX1A 5EV7A 1K5JA 4LQRA 1K5MB 1PGW2 2R30A 3ATGA 4O9EA 3LAGA 5LBFA 5IFTA 1C5HA 3MI8A 5FZFA 4CCDA 1ULDA 1GICA 1W9TA 2GMMA 5AC92 1LEMA 3URFA 2OZJA 1HLCA 2JDUA 2ZGPA 1ZRCA 5EXOA 2GDFA 2ZBJA 1R64A 3OOXA 3WW4A 2FBEA 4JDOA 1C1FA 2EXIA 3EQEA 4BLIA 4QPGA 2YBSA 1ZRRA 3UETA 4B1MA 5I0DA 1SFPA 4XUNA 1VAVA 3WG3A 3RZKA 5L36A 4YM1A 1AYN2 3DYMA 5SV8A 2EF6A 2QQIA 4XJ9A 2RDQA 5AC91 3GBGA 5DG2A 4WM8A 5F39A 3WT3A 1JZ6A 4GWIA 4IEUA 2XJRA 4ZXEA 1WUVA 1UIJA 2GZWA 4E8CA 3NV1A 2VZSA 1BJQA 5JSOA 3OGRA 4TWTA 1I1EA 3HIFA 1T6BX 4QWNA 2PAKA 2LUWA 2Y6JA 5A6QA 1TMF1 2VGDA 1CQ9A 2A6VA 2ADEA 3QACA 4GA9A 4OCTA 5BY5A 4OQ9A 2W5FA 2AEZA 4CP0A 4WVWA 3WP5A 1EP0A 3WW1A 1FOD3 5T3NA 1OD3A 2NPIA 2X8KA 3CMGA 1JW6A 5GZDA 5C70A 2ZEYA 4FVVA 1H2KA 1QJX2 1SPPA 2RMU2 3AP9A 5LA2A 1H4GA 1RUNA 4QX1A 3THCA 5FAXA 2BGOA 4Q4X2 3KD4A 3J9SA 4AE2A 3QOPA 4UWDA 2XJSA 3WQ0A 5F3GA 2RE9A 4INDA 4AEKA 5GZCA 5KHJA 5J09A 4GJZA 2VE1A 4IEOA 5IVFA 4GWJA 2F6BA 2GMPA 1KJLA 3SCFA 1QJX1 4EYUA 2RMU1 1NCRB 3OYWA 1NX9A 2GU9A 3AP6A 4Q4X1 1WD4A 3C8XA 3IBMA 2CDPA 3POEA 2QCSB 3VHPA 1OQ1A 1UKGA 5J37A 1V00A 5JOXA 2W0XA 2WO3A 5DAXA 1ODNA 1H8TC 1DQ0A 2D98A 4PI0A 3WHTA 4AFMA 2A6WA 1JODA 1TNFA 2WLQA 3D4KA 2B8MA 2DCTA 4XXAA 1G9CA 3RG0A 4BB3A 3RDIA 2VOXA 1ULCA 2UYAA 3ON7A 3DXUA 4KWLA 4Y1UA 4BXFA 1TME3 5EJ3A 3TEXA 3VV1A 5IVCA 5A3LA 1OUXA 2NYYA 1K42A 2DDUA 2J1VA 1IS3A 5FY1A 1JUIA 2YV8A 4PQ9A 3H1YA 4WVMB 3HBKA 5KHIA 3ZDSA 3E6CC 1JZ3A 2GNMA 1RUH3 5JOZA 3R4SA 1WKYA 4A3XA 3LEMA 1WWYA 1OPMA 2AEYA 1AYN3 4LEJA 3I2JA 4XQWA 4NIHA 2AENA 2HEYF 3EMRA 4AOCA 1DGLA 4P9XA 5A6YA 1G9AA 1D2SA 4XAAA 1PM4A 1YUDA 4JQTA 4QM8A 5HCFA 4H3WA 3S30A 3TAYA 4D6RA 3S57A 1HRV2 4EN7B 3KT1A 2PHLA 4N7IA 3KS7A 1OHFA 2RVAA 3RJRA 2X5IA 1YJLA 2K2SA 1MS3A 1O4TA 2ET1A 1WA4A 1PVXA 3D0SA 3FBMA 4P9JA 4CXXA 3WP6A 4GJYA 3KV4A 4QKDA 4L97A 1RMU2 5LA0A 3OTFA 1HRV1 4HKOA 4WVZA 4QMAA 4Y5SA 4KMQA 2BQPA 1KDMA 4JV4A 4DS0A 4F7ZA 3POGA 4A6SA 4FPJA 4K40A 4QHBA 4CCLA 1JU4A 4LO4B 1ODMA 1VE0A 3C7FA 4MVTA 3WG1A 4AGGA 2B42B 1V6MA 5FPZA 2W46A 4YGBA 1E5RA 4XUQA 5ANQA 5F32A 3WNOA 2PTMA 5C4WA 1ENQA 4PT6A 5LK7B 2WS93 4FOVA 5JOYA 1FMD1 1VIWB 3I7DA 3POBA 2RG4A 4RGAA 4B8EA 2PHXA 1BHGA 1UYZA 2JDNA 3I3BA 4G9SB 4L9BA 4RS5C 4OQ8A 4IGPA 3WP3A 2Y6GA 3HNYM 4DUWA 2GNBA 1EUUA 1OA2A 1R1A2 4XXPA 3FHQA 1QJU3 3C2UA 1YCIA 4LBNA 5T5OA 3ZFGA 3M1HA 2VCCA 2VXRA 1VBB2 1HV1A 2VMCA 2VBBA 2JEMA 2XOMA 1JMUB 1U5YA 3H7YA 3KV9A 2ZHMA 1GQPA 3KZ4C 3OPTA 4HSLA 5FJKA 1JHJA 2WNVA 1UYPA 2CAVA 4G3YC 3B7MA 4MLOA 4BPZA 3S5AA 4ZKTB 3O0WA 3LKJA 1H1MA 3AZWA 3NV4A 2PHUA 3PUQA 3VBRA 4E2GA 4GULA 5C33A 3MPBA 3E5QA 4MHRA 1PIV1 2PXJA 1VBB1 2RM22 1ZZBA 1K5MA 4JC1A 3K2OA 2NMNA 2QUOA 4ZHNA 4Z07A 2L9LA 1V9U1 5FO7B 1YO8A 3AFKA 1LOAA 1LENA 1YRZA 2WR9A 3AL6A 3NMBA 5B4NA 4E27A 2WRAA 4JKLA 3K51A 1AHSA 2GC0A 1NG0A 4KG0A 4KBBA 2WZPP 3NJVA 3MIHA 2QVSB 2F4LA 3ZSKA 3BTXA 1AR72 1YYNA 1W2NA 5DG1A 5FRAA 1RXGA 1VBC1 1QIQA 1W99A 1CIYA 4HZFA 5FYSA 4D6QA 5J96B 4LBKA 4URAA 4XF3A 4M0NA 1AX2A 4BJ0A 4BK4A 1XNTA 4G4FA 3KT7A 2D6OX 4FOYA 1C8M3 2ZEZA 1RMU3 3CQOA 5CAZA 2YMZA 1H9WA 2D6MA 1QJY3 1W3VA 5BNOB 4BQWA 5LY1A 3M4FA 2VD7A 5CFDC 3LD8A 2ZMKA 2ZAHA 2W91A 1W9FA 3LDRA 4XUOA 1EPWA 2ZCWA 1DZRA 2X29A 1CR7A 3WSOA 3RQ0A 4AQ6A 4FFIA 4XBQA 4KNCA 3DGTA 5GM0A 3UK9A 2LALA 5JZGB 4XTPA 1ZZ8A 4UXAA 3W9AA 5CA6A 4P5HA 4AQSA 4EN0A 1SQ4A 2HWB2 2BVVA 2PELA 1CWPA 3GZEA 5C3RA 2JDMA 1Y9MA 2PHTA 3VKOA 2R1DA 5CKQA 1KXGA 4ITCA 4YW4A 3D8CA 3KF3A 4AHWA 5HXMA 3N7LA 3BPSA 4QQHA 5ACA3 5LEKA 1G86A 4LO8A 3FJSA 1R1A3 4EV0A 1RUF2 1OQDA 4YPJA 2HWB1 3ALQA 4HOOA 5FO8B 3ORJA 1NCRA 2PYTA 1POV1 2SLIA 4GH4B 4BOWA 2QZ3A 3RRDA 4H14A 2VBDA 2JD4A 1RUJ3 1WLTA 3KCCA 4MUVA 1I5PA 2XVLA 4NPRA 4ZU4A 2OX0A 2F4PA 5ERLA 1NZIA 4K6BA 1CPNA 2C1FA 1X8EA 4OUEA 2OQ6A 5J7MA 1RUF1 1RB8G 4UFHA 1T2XA 4I2OA 1W2OA 1PO12 2WNOA 2CU5A 2VNRA 3RI9A 2RM23 3N9OA 1KEXA 3KM5A 1BEV2 3VHNA 2WNUB 4GQ7A 1DCSA 2Z79A 3VL8A 1O7FA 4PIZA 3AYDA 1DG6A 2ES3A 1UO9A 4WVMA 2QQLA 5FPUA 1AR91 1OH4A 1AR73 5JIUA 5BV6A 2WYSA 4A7ZA 2ZGRA 4AI3A 3DXTA 4P5YA 4KU7A 3RS6A 1HW5A 2HWF3 1IKQA 1N3PA 4GB32 2DUPA 4XCAA 2H6CA 3JD72 2WO2A 1YEWA 2J1AA 5FZ6A 1HKDA 1X36A 3M3QA 4OI4A 4FSJA 4LLFA 2QZ2A 2JG8C 2H6BA 1MR5A 3JQWA 2G1MA 4CCOA 5CG9A 3ILFA 1G9FA 3B02A 3MIGA 4GB31 2WT2A 3M3IA 5DDJ3 2XJUA 5LY2A 2VNGA 4CDQB 4EN8B 3MLLA 1EAH3 4P02B 4XFBA 1CGPA 3TRSB 1QF3A 3LE0A 1WA6X 4A3ZA 4RL7A 4IE6A 1LECA 1SLCA 2UYBA 3BTZA 2XBO2 3CHXA 3QCWA 3C7OA 1XE0A 5C5TA 1JXNA 4MHUA 5CBLA 2QFEA 1UXZA 4S2DA 4UOJA 5FP8A 3U78A 4CDWC 2ENRA 1S1AA 3LDBA 4CCMA 1CX4A 3H3UA 4AR2A 3O1VA 1AYM2 3AK0A 4W50A 4YGCA 2WC2A 3OSDA 4UYBA 4ISRA 4OI1A 3WQ1A 2ARAA 3LWCA 3WX5A 5APAA 5JSRA 1PO21 1NAEA 3GJAA 3LB9A 2R073 5FBJA 2A5ZA 1L7RA 4MZUA 4MGYE 3TB0A 3UJQA 1VMHA 1IS5A 1UZ0A 3DYPA 3GZUC 1WGPA 3Q8AA 5IVYA 3WZ1A 3AKRA 3GHMA 4NHYA 1RUE1 1KFXL 3EO6A 4MGQA 4QQ2A 3MLJA 1JTZX 3JXSA 1XC6A 2JE8A 2WN3A 3VBUB 1AYM1 3ZSEA 1PO13 3ZO0B 5J1XA 1UOGA 1ND2B 3A23A 4Q4W1 3H42B 1IPSA 1Q56A 1CAVB 1BEV3 3H9AA 2YBPA 3K4DA 1P8JA 4MXWB 3H0OA 4XILA 4YFWA 3H7JA 5ANNA 5JR2A 4OZOA 1XU2A 1NA1B 4HMZA 4AG4A 4CEYB 1F15A 4UT5A 2VC9A 2XONA 3WEZA 1BMV2 5JI9A 2ZHNA 1TEIA 4YRDA 3QH7A 3RFRA 5J48A 4FTBA 4DXTA 5EFUA 2ZMLA 2DVGA 3B94A 3V0AB 1N1YA 1RYYA 1AF9A 2WWSA 3AL5A 4QKNA 2FDJA 4EN6B 2JDKA 3ETQA 3HN3A 4NHKA 3UGHA 1O3SA 1BMV1 5FK8A 2WLPA 3JD73 2QDRA 4COYA 2FMDA 2MNGA 1DGWA 2PLV2 5LCWL 4RA0A 3MO4A 2B7YA 2ZX2A 1DGRA 3PLQA 2FCTA 4JX0A 4M4PA 5HCAA 4ISQA 5DN2A 3CBNA 2JKBA 1V6JA 2CSGA 3WDVA 3ZFEC 1K3IA 2ZMNA 5F6KA 4B4RA 3OBAA 5BNOA 5FQ0B 3NKGA 5FXXA 2P34A 4Q0SA 2PLV1 5DAPA 4BWOA 4NOTA 4M4RA 2XKPA 3BKZA 4JHZA 4Z1VA 2VTXJ 1F5JA 3I2KA 2HWC2 2XBO3 5K4LA 2A6XA 2E7AA 4Y1YA 3LIGA 3VBSC 1YC61 2JX9A 2H0VA 2YFZA 4Q0UA 2C5DA 1W03A 3AZYA 1VRBA 1F4AA 4OI2A 2IZWA 2YFUA 4COZA 1RUI1 3HNBM 3RNSA 4LMFA 2WZR2 2PAEA 3K46A 1IG3A 1J3PA 2HWC1 4D69A 1VP6A 5IK5A 1AL22 3RYRA 4YGEA 4Q1RA 5F6LB 1PK6C 4BM8A 2XL9A 1UOFA 3N9LA 5FYUA 2Q8DA 3T4VA 4NRMA 4TN7A 2VNVA 5EJZB 5L9RA 3PTYA 4PCRA 4BQYA 3P3PA 3R05A 5FYYA 4YW6A 5CADA 4GH4A 1Z7S3 2WZR1 1ZBE2 2WWUA 4N53B 1DP0A 2D43A 1LEDA 3AZXA 1OKOA 4LO6B 1A8DA 4Z92B 1O4YA 5A32B 3VLBB 2JD9A 2ZEWA 5HI0A 3WDUA 5ISLA 5AVAA 3MGUA 4NIDA 2WUHA 4GAZA 4Q0QA 5FV3A 4JQRA 5I8YA 5LBCA 2AZ5A 1QWRA 4CU8A 2YC0A 4V2WA 4BMEA 3U10A 1UOJA 4CCNA 2JG9C 4FQ4A 5ABJC 3G6JB 4BHPA 1UY3A 2Q1MA 4HN0A 3DUIA 5IVJA 1AR62 2WNUA 4AEMA 3TN93 1CPMA 4R9BA 3OGVA 3ILNA 4LBQD 2MEV2 2OVUA 2KXLA 2W87A 5L7OC 1UX6A 1TNRA 1BBT2 1J3QA 2VZPA 4E4ZA 2D6KA 1IQAA 1MQTB 4OFGA 1M4WA 5D8AC 4DQAA 4TLFA 1W2AX 1ZVFA 1TVGA 2BW8A 2EIEA 3CDZB 5CISA 1W6OB 3POJA 1YHFA 4HK9A 1BVVA 2MEV1 4M3CF 1MS0A 1ZBA2 2AUYA 4AI1A 1PMJX 3NSTA 3ZXGA 3JU9A 1W39A 1XOYA 1Z0HA 2BVBA 2DWRA 1FXZA 2V4VA 4OHVA 2WT1A 4DFSA 2RS33 3HR9A 4FAGA 4Y24A 1XE7A 2YY1A 4CDUB 2NN8A 4XF0A 2RJLA 4UAPA 2BNOA 3V65A 4Y33A 1DYKA 4OUMA 1OKQA 4XDPA 3KB5A 3ZDVA 4YVWB 1JZ8A 1LOCA 1VB4A 4BCUA 5K0UC 2K9ZA 3CJIB 4EZ4A 5IATA 1UY1A 4CEWC 4CDQA 3K4AA 3SXWA 2ZGOA 1E5HA 4XOGA 1LRHA 3VKLA 1MPXA 2YGMA 5GKAC 1TQ5A 1XJAA 3AXDA 1GR3A 3I8TA 3TNPB 2HLEA 1AL23 2WFPA 4I3GA 1ASJ2 1S4CA 4HETA 3U4XA 4FO9A 1U5ZA 4K9SA 5GLTA 2ZGSA 5DABA 1FATA 1ZNPA 2VCBA 3T0AA 1QKQA 5F2WA 2P5BA 4XZPA 2HKXA 3IZOA 3NNLA 1FYUA 1RIRA 5FYCA 3BI3A 3KF5A 4N8MA 4YG0A 1ZZ7A 3UNPA 3L2YA 1ASJ1 1OSGA 1JYTA 1YIPA 3O7OA 3VBFC 1RTVA 4I0BA 2SBAA 2WQ4A 3CL1A 4I0AA 4QPIB 2RS52 5FXVA 4Q4V3 1OURA 3MEPA 2VQAA 4HPKB 4PDWB 3ZVXA 2YC4A 2VVEA 3B00A 4JAAA 4LJHA 1LAJA 4RN5A 4ZZ8A 3LFMA 3N7KA 5DUWA 3TEWA 1NQJA 5A7NA 5C8WA 1ND2A 2GMEA 4B7EA 4YARA 1CAVA 5F1RA 4MXWA 1STMA 1H6YA 4ASKA 5BUVA 1W6QA 1NA1A 4CEYA 1BBT3 2VTXA 3DEMA 4AEDB 5FPXA 2B39A 2HBTA 4PIXA 2Y6KA 3DYOA 3B93A 3KWVA 3LQCA 3B01A 4PBOA 5I0TA 1GU3A 3V0AA 1GNYA 1OQEA 3LEKA 1UIKA 3ZXEA 4RR3C 1FOD2 4EWDA 2A6YA 5JI7A 3UKTA 3AJYA 4KI5M 3SISA 5M0TA 3H50A 4Y1XA 1S0DA 2YB7A 5BNPC 2DUOA 4IETA 4EROA 5B2GB 2EALA 4OUSA 1ZREA 5FYBA 1N47A 4A7YA 3N35A 4XQDA 1JYXA 3SLIA 1FOD1 5EHDA 2X05A 4L92A 3PURA 3POYA 4YG3A 1CAWB 3ZFGB 3M3OA 2FDIA 2VECA 4S2FA 2QQPA 3J7NA 4HLTA 2XG3A 5EQUA 4XAEA 5FQ0A 2BEOA 2WT0A 1QXRA 1OOPC 2W08A 4NAMA 1S2BA 5T5PA 1F8VA 1OBNA 2WNVB 1SBFA 3VBHC 1BVP1 2ZZJA 1PHMA 4I3PA 5JDBA 1LCLA 1BCXA 2ZKLA 1NLQA 3ZIWA 4NIGA 4CDXB 2J1UA 2ARCA 4UI9L 3OB8A 5C3PA 5FZMA 2VPVA 5DUVA 1ZX5A 3IDCB 3N9NA 4YNIA 2JB8A 3B3QE 2YUEA 4Q29A 4UW5A 1GP4A 2O8QA 2BZDA 1NCQC 1TME2 4WM7C 1ZZCA 5LRRA 1GOFA 2C26A 4IV1C 1PGSA 1ULEA 3J7HA 2VUAA 3POSA 4OMDA 4XMAA 2OA2A 3KGZA 3AC0A 1LGNA 3Q9OA 4P9WA 5TSWA 4C8DA 3N4MA 2RS53 2DVDA 4OI0A 4AFDA 1RUH2 4IERA 4AAPA 1AZDA 5A3OA 1PGW1 3H8XA 2VOWA 3BALA 3I2IA 2D6LX 5T5JA 1TME1 1SCSA 2Y64A 4P9IA 3PVEA 4UFJA 4UFLA 3AZZA 4N53A 5DUXA 3WW3A 2GNDA 2VCMA 5LA9A 4JKMA 4LK7A 2H0BA 1Q3EA 1Z78A 2LTNA 4GMP0 4K1YA 4LBMA 5T50A 5A32A 4IDZA 1RUH1 4ZU5A 3ZPOA 4BQXA 5FKCA 4LNVA 4KBZA 2W94A 3C3VA 3FUQA 1AYN1 1FAYA 1YXWA 3NNMA 1CJPA 3OY8A 2P37A 2GSYA 3PMEA 3D82A 1HX6A 1UU6A 2BU9A 1UY4A 4Z82A 3WNLA 2G9GA 4I30A 1Y4WA 1FNZA 5AFEA 3C7EA 2D3PA 1US3A 3GYDA 3MDPA 4MX3A 4X8PA 4EE2A 1LODA 2Q0AA 3T2OA 4YG6A 4BQ2A 2YDEA 4AHXA 2WDBA 2R1BA 4YM0A 1MQTA 4O61A 4EWAA 2J42A 4R9AA 4XEZA 1NY72 3BTYA 5IFPA 2IXCA 1DYOA 1REDA 1HRI2 5FPLA 4RYDA 3WDWA 3AX4A 1MACA 1W6OA 5FTTC 4LULA 2E26A 4R4XA 3NKTA 1B09A 2WZ8A 2Y0IA 2WS92 3WQ7A 1JH5A 4ZONA 2OXBA 1V6LA 4Q5OA 3POFA 1B35C 1PM7A 1GBGA 1NY71 1V0AA 4MGZE 4Y26A 3ZM8A 5KXEA 1G9BA 4CDUA 5DZGA 4BXSV 3OJBA 3MIBA 3ZSLA 4C0BA 5I91A 3Q8BA 2VH9A 4AEJA 4AI9A 3ACLA 4YVWA 2WS91 1QJU2 4IE5A 5FZ0A 2JDHA 2TBVA 3CJIA 3WNNA 4JDMA 1H8VA 4NAOA 2P4EA 5GZEA 5I8SA 1QNWA 1RHI3 1WBFA 4FXGB 4O7XA 5FP3A 3KGLA 1XXNA 1RL3A 2OZ6A 1UZYA 2FHRA 3ELNA 2AC1A 2WNEA 2ZOEB 4XFHA 4CUCA 1QJU1 3FHAA 3BN6A 4HKLA 1RINA 4LKSA 3UYJA 5K8SA 4YVSC 3VD4A 1MS4A 3O1MA 4XFGA 2XJVA 2VUCA 4S2HA 3SNMA 1SLIA 2CAUA 4IV3C 4UFKA 1V6OA 3AVSA 3CZUA 5FZKA 5KHHA 3ZPYA 4FQZA 3ME2A 4E4SA 2W3JA 5F2SA 3S7EA 4W6WA 5JCTA 1KRIA 5FR3A 4N43C 1RJ7A 1J1LA 3MHZA 3IB3A 4RSUA 4ZPIA 3R4DB 3BOWA 1SMVA 1GZWA 1SLAA 4QPIA 5JIAA 1UPSA 1JZ5A 1L3JA 1ND3C 1UXXX 2BWCA 4HPKA 4PDWA 2QQMA 1I5ZA 3WHUA 2N7GA 2EXHA 2VVFA 2WKKA 4IEYA 1FI2A 4QHOA 1UOBA 3VD3A 4LA2A 1C8M2 3TYJA 3AKPA 2IXHA 3T2QA 1EPZA 3TEYA 1QJY2 4CYDA 3ZXFA 1TMF3 2DVBA 2Q30A 3U75A 1DZTA 4NHMA 1NT0A 3E6DA 1D0GA 5BNNC 3PU3A 2WA3A 4AEDA 1YJKA 4XHBA 5GALA 4OHYA 1H8TB 4MGTA 3VDDC 3WG2A 4A4AA 3NWKA 2PAMA 1HRI3 1ZYBA 1OUSA 1C8M1 5JOWA 4AF9A 4ES8A 1YFWA 1RMU1 1VBD3 3N7JA 3SITA 5CZKA 2P2KA 3TOJA 1QJY1 1Y7BA 3CO2A 4FFGA 5DUUA 4EZHA 1XYOA 3AVRA 3PL0A 4QDRA 5IVVA 3ZN5A 1L7LA 1GOGA 3ASIA 1QH6A 1SZBA 4YYOA 2BDRA 2XGXA 2DBIA 1W90A 2DFCA 4IGOA 3VZKA 4DEVA 1A3KA 2PHDA 1OD5A 2IUWA 2YBKA 1BK1A 2Y26A 1QHDA 5ACA2 5A1AA 4YWAA 4UBGA 2CY6A 1CAWA 3M7AA 3I59B 2VOTA 4Y3OA 3OGGA 3PVOA 5IT6A 1WLDA 4UW3A 3V0BB 4LE4A 1JS9A 1O6UA 1RUJ2 1QJEA 2VVDA 4QQLA 4HL0A 2RS13 3JB8A 3GZAA 4FTEA 3RZGA 4NE9A 4XDQA 1QU0A 4BQ1A 2BRTA 5ACA1 4H55A 4C0HA 1R1A1 3WP4A 4CDXA 1JYVA 3BYWA 1POQA 2ZX3A 3D3AA 4QXKA 3W58A 5L19A 4AFCA 2CWMA 4GD4A 2EAAA 1W8WA 2A3XA 4LXLA 4ZS2A 3OBTA 2HBUA 1RUJ1 5C9AC 3RZMA 3P3NA 1NKGA 3F95A 4V1PA 1Y9GA 4P9LA 3VL9A 1C5IA 2R49A 4GWMA 3M8LA 3T3YA 3VD9A 4ONUA 2DCZA 4XIKA 5FZ8A 1LHOA 5DZFA 5FY0A 1QH7A 4IW3A 3T1LA 2RDRA 3MUZ1 5FMCA 1N3QA 3FUOA 2RM21 2V4AA 3FX3A 4HANA 4HXCA 4Q4Y2 4F3JA 3QBQA 3DPRC 4GXLA 2LRPA 1YQCA 2YYOA 4J25A 5FY7A 3THPA 1G9DA 2HWF2 2XJQA 2HWE2 4NPMA 4PHZA 4UF0B 3WDXA 5FPAA 4PLNA 1SG3A 2IFWA 3DCQA 3VDCA 2B5HA 3K48A 3LFIA 3O1PA 1BK0A 2BYVE 4NIAA 3PHMA 4RS5B 1XSQA 3GCXA 1AR71 5L9VA 3MIEA 3QLQA 1UL9A 3O0XA 4GKXA 5LATA 3SCGA 1DLCA 3MF6A 4ASLA 2B9VA 1UY0A 2HWF1 3VDAA 2X10A 1UD1A 4QPYA 3IT8A 5A3WA 4ZU7A 4CCJA 1MS5A 5DDJ2 3MPPG 4DXZA 5JXHA 5HV0A 2Q5TA 1OOPA 3H3LA 4QQPA 5CFCC 5FO9B 1K12A 4JZRA 1EAH2 4JGZC 4IUGA 1ZZ9A 3AZVA 3RJ2X 4QXBA 4XBNA 3WF2A 3H8OA 2JXAA 1COV2 4FCAA 5E8AA 1S55A 3THTA 2BBAA 1GOHA 3A21A 1QJFA 1WLWA 2DYCA 1SEFA 5C3SA 3I4IA 3MW2A 4KQ7A 2R063 5DDJ1 3DKWA 2GC1A 1ZA7A 4I01A 4KH9A 1RJ8A 3IAPA 5FP9A 3P6BA 5CIRA 1O4ZA 1QOOA 3ZYJB 4BMBA 4AW7A 1WLCA 2Q4SA 3D6EA 2FQPA 4K3UA 2R072 1UYYA 2D7FA 3JUUA 3AKQA 3IDEA 4QM9A 2VM9A 4Y4YA 4CPBA 2VZUA 5JMCA 3GDBA 4DPNA 2QKDA 2DCYA 4L11A 2Q8EA 2XUEA 1MS8A 1KS4A 3KSCA 3IDAA 1OLME 5K9YA 4DOUA 1J3RA 4AHZA 1QDCA 2VXJA 5DAVA 4M0HA 5CFDB 4J1XA 2R071 3ZR6A 3IMNA 3DL3A 4QT6A 1N1VA 5GLVA 2CGNA 2YXSA 3NJXA 3BUCA 1W2TA 4A44A 1UX7A 2YU1A 2PQQA 1Q8QA 1G8WA 1GSLA 1R083 3DF0A 3PDQA 1PO11 2IWGB 4LLOA 2VL4A 4WZFA 3ZN6B 4FBFA 5J36A 4GMP3 1ULGA 2CNAA 1BEV1 2EAKA 4Q4Y3 5DQ0A 3VKNA 2XL7A 5A3TA 2R7EB 3HJRA 1UMIA 2WSUA 4LUMA 3ETPA 5C7GA 4DUXA 4A42A 4MH0E 2HWE3 4HK8A 1DYPA 1SLLA 3I97A 4XETA 1HN0A 5FY5A 4DRVA 1XNAA 4IEXA 3CIHA 1QJZA 1W8TA 4DXSA 3KHCA 1V70A 2RR12 2XQXA 3W5MA 1O8PA 1MZ5A 3AYEA 4BK5A 5A3PA 5CKNA 4QB1A 4XABA 5T55A 3MBWA 3ZIXA 5IK8A 4QB6A 1BXHA 3ACIA 5A6XA 1FX5A 5FPVA 1SLBA 1IKPA 2AREA 2EICA 3JD71 2CGPA 2GC3A 2R6QA 3VBUC 1Q8SA 3WV6A 2IXJA 2QQJA 1F4HA 4I09A 1R1ZA 1CZTA 1COV3 3KCXA 1HJGA 1HQNA 2W1SA 1YWKA 2E63A 3MZHA 3AMHA 1H8TA 3VD7A 5D1IA 1CAUB 1UW8A 2JE7A 4AHYA 3I2FA 4AXOA 4CE8A 1S2KA 2B45X 2WJSA 5KXBA 5FUNA 2TUNA 5FZ3A 1GQHA 2KM2A 3FLRA 3N9PA 2GH8A 4NUBA 1IS4A 2C9KA 4DO0A 3PNAA 3JBG3 3USUB 4FT8A 5FZEA 4BQ4A 4AVSA 2X53S 4YZ3A 4Y1VA 3ZYRA 3LSDA 3P5BA 4DB5A 1O59A 2XBO1 3U0ZA 5C71A 3RYKA 5BNQA 3BTAA 5C8CC 1LR5A 5D21A 3UKVA 1W9SA 3UJOA 4RHV3 4IQPA 4MV2A 4ZXKA 1D4M2 4DY5A 3WNMA 4RFRB 3KT4A 1X50A 2PHRA 3I59A 3PIJA 2WABA 4LK6A 4NO4A 4L8QA 3B69A 4X8NA 4Z2WA 3GGLA 1Z7S2 2BGCA 3I2HA 5LBBA 2ET7A 1VR3A 4RQPC 3V0BA 5A7SA 4LA3A 1W6QB 2V5DA 2YC2A 1RUD3 3WVJA 3RZLA 4BZ4A 2I74A 2VJXA 1A34A 2JG8B 4E2QA 2P3YA 2Y60A 5K7PA 1W0NA 3KQ4B 3PMSA 2ZPXA 3J8F3 3MFCA 1OC1A 3KV6A 3HT1A 4R9DA 1NQDA 5LB6A 4AAXA 4BIOA 1MEC2 1ULPA 1XSRA 1Z7S1 2YPJA 3OEBA 4FPCA 4N7UA 4ORFA 3DV8A 2HH9A 1W3XA 3V64A 3O1TA 3INAA 3IIIA 3APBA 3OBRA 1FNYA 5FYZA 2Q1ZB 4Q27A 3TN92 3VZNA 4B29A 4NPLA 5BNNA 2A71A 2E33A 1H2NA 4QGNA 4MGIE 4W8JA 5FWEA 4D3WA 3VDDA 2VMGA 5E6HA 2ADDA 4NVPA 3VZJA 2RR13 1VB2A 2P6HA 1DHKB 1S0FA 3WQBA 4F83A 4JTOA 2C6SA 3OD0A 1TE1B 3H8RA 1VRH2 4P14A 4KWUA 3TN91 4CDWB 1DQ1A 1DU3D 1V6KA 2P3JA 4NRPA 4TXWA 3T30A 4QPGC 4UF0A 2WIIB 2QJVA 3AKTA 1YQ8A 1FPN3 4B4PA 4OHXA 5JSPA 1IS6A 5FZ4A 5EYYA 4FPFA 4JKKA 4RS5A 1CD3G 2BUKA 2RS32 4NR1A 2XQRA 5FZHA 1FT9A 1Y9QA 4WM8C 2G9FA 1X8MA 2RHPA 2QDNA 3KQRA 1YFUA 3TBDA 3TEZA 1DQ4A 4CP1A 2W68A 1ZRDA 3TNQA 3MV01 3I2OA 2OT7A 1ZM1A 5E88A 4HSJA 4UFMA 2RS31 4H2AA 1IQDC 5FP4A 2UWAA 5FPBA 5C5UA 3UL2A 1JZ7A 1KGYA 3PIGA 1AR83 2Y33A 4HFSA 3K4ZA 4W6XA 4WVVA 1BZWA 5IAXA 4IE0A 1GZCA 5AFBA 1W0PA 3L9JT 1YFYA 5F3IA 2HEWF 1S0JA 1OVPA 2DFBA 4P9GA 1NZCA 4CUBA 1D4M3 4XACA 4NMIA 3FWEA 3NAPC 5FY9A 5B4XA 4XDOA 1GV9A 1H1IA 2BERA 3IKWA 4O65A 5A80A 1AL21 1NE4A 3CJXA 1IGOA 4U2AA 1LGBA 1W6PB 2QTWB 2UU8A 1KJRA 3ACGA 4XVHA 2NM1A 3MV11 2QNKA 3ZFFC 3DN7A 5BPXA 4Q4V2 2W52A 2CL2A 3ZSJA 3PUSA 3IM0A 3UESA 2YZ4A 2B4KA 4NJ4A 1GMMA 2VCAA 1S0BA 3OY8B 1EV12 1V6NA 5GLWA 1MEC3 3FZ3A 3ZFEB 1ZBE1 5FZOB 5E89A 1OF3A 5A3NA 5HCHA 2QQUA 1O91A 4ATFA 2E6VA 3LCPA 3RI8A 2Z5WA 5I0UA 1W8UA 2BNMA 2V72A 2YG0A 4LORA 1PVC3 5CFDA 4Q4V1 4MADA 5A1FA 4FFFA 1G7YA 4E8DA 1CONA 1Y3TA 4P08A 3HAGA 3W21A 4I02A 4W6YA 1NUKA 5FJHA 3VBSB 2EA7A 3ZN6A 3IIAA 3VBOC 3CKHA 1VMFA 1XRUA 3IMMA 1AR61 1VRH3 3U11A 3H3ZA 4QXCA 1ZA4A 1GZTA 1HB4A 5JXIA 1QQP2 2UY9A 3SH4A 1WCSA 3WF1A 3FLPA 5FKBA 1S0GA 1QDOA 2JKXA 4N90A 1RXFA 1BBT1 2Z42A 2CYFA 2BNNA 2TEPA 1SFNA 5IK7A 1YI9A 5I0RA 2VOKA 3VKFC 3HMYA 4YW7A 1PK6B 1W28A 3JCIA 5EJ1B 2ZA9A 5F5IA 5HBAA 4AVAA 3E5UA 3AYCA 5D2AA 5JVVA 5BXXA 3NVCA 2IXKA 2E7TA 2BTVC 1UMZA 1JYCA 1O5UA 3HQRA 1ZBA1 4M3CB 2HWD3 2K46A 3I3EA 3FLTA 4MSVA 1LTEA 2X5IC 1DGRN 3HEIA 5T52A 5FZDA 4DUVA 4AVBA 5FMOL 1AXKA 2GN7A 1VBE3 3NQHA 2VQTA 2MHFA 2EIDA 4TLGA 4XMIA 1RUG2 3OGJA 1F35A 1CAUA 3LF7A 3N3HA 2HYKA 2ARBA 2RDNA 1SFYA 2E51A 4J1WA 4NRQA 4D94A 1FV2A 1ZRFA 2JG9B 5ABJB 5I93A 3LEGA 3NL1A 4JDNA 5FYVA 4YZ1A 3LIHA 1RVF3 1YI7A 3LEIA 4AK3A 1OFSA 3EYPA 4Q2FA 1C28A 3USUA 4GKYA 3HWJA 1W6MB 4MXVA 5EIYB 5L7OB 2XB6C 1NE6A 1LU1A 3JZVA 4PF1A 4NIIA 5C4WC 1APNA 3VHRA 1D2QA 4SBVA 5D8AB 3VUOA 1UQXA 4LIVA 1GZWB 3QH6A 2VZRA 2VMDA 3CF6E 1WW6A 4JGYC 2PFWA 3POIA 2WO1A 4M01A 1DQ5A 1ENSA 1EV13 4QGMA 2ZAAA 1DQ6A 1VBA3 3MFAA 3R4UA 1CVNA 1SLTA 2XLFA 3ENRA 1HXS3 2Y6HA 4YM3A 5A33B 1WW5A 5LBEA 2GH2A 1RGSA 4LHNA 4J6GA 1H0BA 1T6GC 2WL1A 3U1XA 2RS51 4K8RB 5AVPA 3T09A 4OULA 3NV2A 3T08A 1OXCA 2JG8A 1JN2P 4KGQA 4YW5A 4XCBA 4URTA 1U12A 2VZ1A 4Y1ZA 1JZ2A 5CB7A 3RYPA 3S7IA 2MPFA 3T2PA 3ZXJA 4FPYA 2HJIA 4YLZA 5K0UB 2VZVA 3VBRC 3IN9A 1QQP3 4CEWB 1EY2A 1VPHA 2DVFA 1DIWA 1UN1A 2VMFA 3BU0A 1ZZ6A 4LIUA 4LPLA 2VBPA 2GN3A 5FIXA 3K75B 3UGFA 4FP2A 1OA4A 1K5MC 3NW4A 2PMWB 1HB1A 3WR0A 1N1TA 2VU9A 3BU7A 4Y5TA 4CP9B 4QDSA 2VY0A 5F8PA 3SH5A 1RUC3 4YM2A 2VZOA 3T2TA 5FY8A 1J84A 1UAIA 5KWRA 3UGGA 3CZJA 3KMHA 3ZXDA 2QQWA 1W8ZA 2XH6A 3KVAA 4CDWA 2IXIA 2EVXA 3WF0A 4CTEA 1RITA 5FZLA 4XJAA 1UZVA 5EZWA 1HB3A 2A7AA 4W4ZA 1CZSA 2A73B 1AJOA 3GCWA 2V5YA 3VBFB 1AJKA 2FDKA 4YW2A 3HQXA 2QE3A 4B1LA 3M3CA 1CZVA 1QGLA 1RUG3 2ATFA 2KA3A 3OG2A 2VQUA 4LHSA 4CCEA 1PX4A 4NROA 3SCHA 3WNKA 4D7SA 4IEVA 2F17A 1GZ9A 3AB0A 4HVOA 4IEPA 5JMOA 3LSEA 2IVJA 2WFF3 2WQZC 2XHNA 1XYPA 2ZX0A 4RQPA 2D6NA 5FCCA 2LS6A 5LK5A 4QXHA 1YLLA 3IAQA 1QXJA 4XFCA 1RHI2 1X9TA 3WINE 2D3RA 4JVAA 2JWPA 2Q8CA 5FZ9A 1GFF2 1C1LA 1KS5A 3NRUA 1PMIA 2ZTNA 1C4RA 1F5FA 3IPVB 2XUMA 4K7JA 4YGDA 1GP6A 5KXCA 1MZFA 5FMDA 1EUTA 1OA3A 4XZUG 3BODA 3OPWA 2Z69A 4DIQA 4HVQA 1UY2A 3FFQA 3NNJA 1PNGA 2WSVA 2XJPA 1R093 1CAXB 4MG2A 4RR3B 1VLNA 4OZXA 1QOTA 1RHI1 4CU7A 1XB9A 3BVCA 2R043 3ZYPA 5DZEA 1HIXA 1CN1A 3AMPA 5FZBA 3S0MA 2RJ2A 5BNPB 1W6PA 3VN4A 4K21A 3WY6A 4FPKA 1NCRC 3GXUA 4XPVA 1CIWA 4XFIA 4CRQA 3ZSMA 3EBRA 1LGCA 2ZXQA 2XHKA 2P1BA 4FPGA 5E16A 4XUPA 4COVA 2BP6A 1WMFA 2XJTA 2VOVA 1BKZA 2TNFA 5FLIA 5FZOA 3ZFEA 1JZ4A 1K45A 5I0SA 1NYWA 2BFUL 2EIGA 2W39A 4XUTA 3THDA 4AI0A 4QX5A 1LOEA 4ASMB 1WD3A 1LESA 1OOPB 1YQ2A 4LE3A 4XJ8A 5L9BA 2LW8A 1TMF2 3NJYA 5GLZA 3FN9A 2IXLA 2OKXA 3SMHA 2DU0A 2C0ZA 2EIBA 1I3HA 4UBHA 5DAWA 3VBHB 3WUDA 5JPMB 1QNYA 2AR6A 4QGLA 3OBZA 3V56A 4AFBA 2GP3A 3VBSA 1DLLA 1S0IA 4MOAA 1VALA 3I2GA 3A0KA 2DU1A 4HVRA 5F5CA 5HPOA 1VBD2 4V2VA 4U36A 2CHHA 2P3KA 2CWSA 2W47A 2WAOA 4UW6A 2BJSA 5FZGA 2OUHA 3QD6A 3VGIA 2EXKA 4FOQA 5EP9A 3H8UA 3WDTA 5CKMA 4WV8A 1NCQB 4WM7B 2W92A 2Y0OA 4IE4A 2D93A 1XBFA 3PTRB 4IV1B 5GZGA 5HV4A 4P9YA 4XQ4A 1C8NA 2J7MA 2UURA 1PK6A 4C91A 5E1RA 1HRI1 1VBD1 3RVHA 3NV3A 4D0QA 2BPA2 1JYWA 3ZYGA 2OPWA 3NAPA 1OMIA 2DF7A 1DGWX 2J1SA 3AXEA 3LA3A 4M3CA 2OYZA 1PZ7A 2GALA 5J3UA 1ULOA 4AZZA 4QQOA 1DZQA 3E6BA 2DCJA 4LITA 1POV0 4E9KA 1U0AA 3G7DA 4WZCA 3U37A 1TZOA 3NJZA 1F2NA 2Q1FA 3ZFFA 1NLSA 2D5FA 1IOAA 1SDWA 2RS12 4IESA 4KG8A 4QPWA 4C1XA 5FOBB 1O3RA 1GUIA 1LHUA 2P17A 5LWBA 2AYHA 4X6RB 2KD7A 3AM2A 1AUYA 1F31A 1LJ7A 4KU8A 4A45A 5IYYA 2ZEXA 2JG9A 4OLLA 5ABJA 3MYXA 2D44A 5A7WA 3WF3A 4KL1A 5LRSA 2QQKA 4F8AA 3KVBA 1ULFA 3DKQA 3Q8EA 2RS11 2VG9A 1QEXA 1W6MA 5L7OA 2ZX1A 3FL7A 4QD2A 5JUVA 1HN1A 2XWBB 3C7GA 3JB4C 3O5SA 4GALA 2PHFA 4QKBA 5DAQA 1X7NA 3L2HA 5D8AA 1LHWA 3OPZA 4Q8LA 1J59A 4GIQA 1QY4A 3HNMA 5AC93 4LOTA 3VBOA 2JDZA 1HQWA 2Y38A 3B9IA 1C3HA 4HONA 5I8TA 4IXLA 4D6SA 5FDBA 3FMGA 3M3EA 5EPAA 5JXGA 2BWAA 5A33A 2WA4A 2A3YA 4LO7A 3J7MA 5A6ZA 1UPIA 2XWJB 4ZY9A 1UZWA 2PHWA 1ZRIA 2ILMA 1B35B 2VNOA 4OMCA 2VULA 4BQ3A 4JTNA 2E32A 2XVKA 4HG6B 4LOSA 3MW3A 5JR7B 2Y8KA 3K3OA 1NXD1 4LKFA 2Q8OA 3PVNA 4LBQB 1LULA 2BV4A 1REEA 4D7YA 5K0UA 2ARXA 1PNFA 2ZGUA 4CEWA 4YSFA 4UW4A 3O1SA 2OUJA 4BQ5A 2HYXA 2W1UA 4O9GA 2R16A 2PA7A 5F7UA 4C1WA 1M06G 3VKMA 1X33A 2E7QA 5IVBA 4CP9A 3T0DA 3MIDA 4H7LA 1QJX3 2RMU3 4FPHA 1FMD2 2GC2A 4NHLA 4YVSB 5H9SA 5FYTA 1KFUL 4A7KA 1U5IA 2PN5A 4R9CA 4Q4X3 3WF4A 2R062 3AJZA 3NNFA 3A0NA 4IV3B 1AX1A 3SEPA 2Z2SB 1H2LA 3ZR5A 2RJKA 4M00A 4XFAA 2X09A 4QX7A 2RDSA 4N43B 2JENA 1IPKA 3VBFA 1W6NB 4AVTA 2AACA 3A22A 5CEHA 1GNZA 3K77A 1ENXA 1UZZA 1HJFA 4JGYA 4PIYA 3RPQA 3SKJE 2R061 1ND3B 2Y34A 1CESA 4OHWA 2VO5A 5BNOC 3GBWA 5IJRA 4OHZA 2WYFA 4KWJA 2YGLA 5IVEA 1D0HA 1WBLA 5KHKA 4QDQA 4LHLA 2QQOA 1PIV2 2ZJCA 3T0BA 2J1RA 2O1QA 2VW2A 3AMQA 3CLPA 5FZIA 5LZ6A 5JZGC 5BNNB 3MF9A 4LBLA 1GANA 2XR4A 3IPVA 4MGKE 1UU4A 4OVEA 1IG0A 4PJYA 5FZ7A 4AI8A 3NO8A 4XURA 1V9U2 3VDDB 1W06A 3CU7A 1GWLA 4KWKA 4FTSA 1R082 2A75A 5IUQA 1NXMA 2G4IA 3B9CA 4MGSA 5KC6A 4NN0A 1CAXA 4E2SA 4RR3A 4YW1A 4B7KA 1BYHA 4Q0PA 3O0VA 1D4VB 1S0CA 3BPZA 3RZZA 3LOBA 3AP5A 1VBC2 2GNTA 5HCBA 3RMYA 5BNPA 2D3SA 1L7QA 1US2A 1ENRA 2VTFA 1E5SA 1DFQA 3KCYA 4GH4C 5A70A 1R081 3I2DA 1HRV3 4GMP1 4L99A 3BIWE 4Q4Y1 4N9IA 4K8FA 4BDVB 2NMOA 1V6IA 3S5QA 2ZABA 1UWWA 3MUY1 4HN1A 3WOGA 4LUKA 2HWE1 1I9RA 3ZXAC 1LKNA 2R32A 2WBKA 5FZAA 3SQOA 1LOFC 3W5NA 3PJQA 1KQRA 4QX2A 1E57A 5CYYA 1ST8A 3LOIA 1H2MA 4BE3A 3U4SA 3VBHA 5IK4A 3M2MA 3FFZA 4HBNA 2JECA 1OT5A 1W8HA 3OUHA 2WNUC 4OYUA 4XW3A 5A7QA 3X29B 1LU2A 5F37A 5FXWA 4QAWA 2VW0A 3O1OA 1Q8VA 1FMD3 4LT5A 2R0FA 2JICA 3ACFA 5F9TA 3OCPA 4FFHA 3O1RA 4IEZA 4QX0A 4E4HA 4YZ2A 5C9AB 2IC1A 3JQXA 4DRRA 1EAH1 2IFRA 1MS1A 5A1LA 2WQ8A 1NCQA 1PX3A 2A6ZA 2O8OA 3JBG2 4AWDA 4R4ZA 2JIJA 4WM7A 1COV1 1WMDA 2EXJA 4IV1A 2CV6A 2NQYA 4IE7A 3WNPA 4IEQA 1UKRA 1W04A 1VAKA 1IHMA 2D5HA 2WO7A 3ROUA 3WCRA 4RHV2 3ZKUA 1Q5OA 2FCVA 4P00B 2VMIA 4BA6A 3DPRB 3D5OA 3N36A 1VAMA 5FUIA 2VUJA 3JBG1 2UWBA 3FE5A 5FP7A 4COWA 4BH9A 1XNCA 4XF1A 4D7TA 3LZZA 1HV0A 1JOPA 1DBNA 1PIV3 2C9AA 4MYEA 1VBB3 2ORZA 3HOBA 3OGSA 4DY3A 1RUD2 2E53A 4RHV1 4Y20B 4IGQA 5CNAA 1LHNA 2P6CA 4CDQC 2WZEA 5IW0A 4DZGA 2KR2A 1V9U3 2OIIA 3ABZA 4LBOA 3J8F2 1W0OA 3O12A 4JHTA 2VZ3A 1REFA 4LBJA 1H6XA 4ZS3A 5F3EA 3PUHA 3U07A 3VDBA 2Z4FA 3TWIA 2LM3A 4PBPA 5SV5A 2BBVA 5CFCB 3PUIA 2J1TA 4Y22B 2NP0A 1QOSA 1AR92 2ZGKA 4FXKB 1RUD1 4JGZB 3O14A 4GZ9A 1OPOA 4DEQA 1VBC3 1URXA 1UU5A 2NLRA 3ZYFA 3EB7A 3J8F1 4JRAA 4CA9A 5FREA 1MZEA 5FXZA 4SLIA 1JU3A 4CP2A 2FDFA 1OH3A 4FI9A 3ZX7A 3LPFA 2VR4A 3HQUA 4YZ5A 3I3DA 1JBCA 3HD8B 3E97A 3CEWA 1OVSA 4B3NA 4E4DX 2O14A 5FYIA 4DXRA 5KC5A 1FPN2 3ACHA 4EJRA 1B35A 1QXPA 5FYMA 3VHOA 3KV5A 4YFZA 1Q8OA 1ND2C 2RR11 2W1QA 2ORXA 5EWSA 1KD7A 1UNBA 3GNEA 3ZXKA 3FBYA 4CU6A 4LHKA 1XQNA 4N9HA 4YZ4A 2JE9A 1NA1C 3POWA 4QKFA 2VMHA 3ITQA 4LBQA 4CEYC 4BYYA 3HBZA 1W8NA 3PU8A 3GHNA 3VZOA 3CNAA 3R6SA 1FPN1 3AFGA 4Q8KA 2UWCA 1SDDB 2A70A 2BOJA 5FLJA 1AXYA 3T4HB 5C6CA 1H1AA 5EYXA 3ES1A 5F5AA 4AGRA 3PVBB 1WW7A 1PZ8A 2AGSA 1AR82 2FDGA 1NOVA 1QMJA 2HWB3 2QQNA 1POV3 4YVSA 4R52A 4S2GA 4XC9A 4A41A 2XKOA 1XNDA 3J4UH 4IV3A 5GZFA 3O1UA 2CDOA 1PO22 1UCXA 1WCQA 3GZTB 4QX3A 3P1IA 1XNBA 5L73A 1BLZA 5T5LA 1RUOA 1VJ2A 4H7MA 1DDLA 1F9KA 4QB2A 4N43A 1RUE2 1RUF3 1AR81 1W6NA 5FWJA 2FZ1A 2XDVA 1JUHA 2E9QA 2ZHKA 4FOWA 3SC7X 4EQVA 4Q4W2 4BISA 2XLGA 1ND3A 2OS2A 5FMOS 3SH3A 1GNHA 1D4M1 2PQSA 2VAUA 4QU1A 3H1WA 4QX8A 4RFT0 2W9XA 1O3QA 2G19A 3WXPA 2VMEA 2GP5A 2O0OA 1MVQA 1E5IA 3VZLA 4DMIA 2I07B 1AR93 4DNYA 5JWPA 1JOBA 3PUAA 4KGGA 4XIOA 1PVC2 4EWEA 3UV9A 2ETEA 3IDBB 4ES9A 4TZDA 3T1MA 5G05L 2FZ2A 3AP4A 4XE9A 2C4XA 4RGGA 1FV3A 1KITA 1MEC1 1OLRA 3K3NA 4NWVA 5IAVA 4CSWA 1DF0A 3MICA 4X6QB 3SHRA 4AYUA 5H9QA 4BLJA 3I49A 1PZ9A 2OW4A 5LW9A 1PVC1 1N1SA 2ZGTA 4AI2A 3GF6A 4PF5A 5GLUA 3EJKA 2A1XA 4CZSA 3J7LA 3RMXA 1H4HA 4ARXA 3LA7A 2W1WA 1DQ2A 4GB33 2V09A 5C8CB 3VD5A 4N53C 5FK7A 5FYHA 1VRH1 4ZZ5A 2ZHLA 2FDHA 1Q43A 2DCKA 3WW2A 2WN2A 1NLRA 1LNSA 4Z8BA 2HWD2 4Q26A 1UMHA 2A3WA 1GYKA 1G6NA 2XLAA 2R0HA 5LASA 3DECA 3GALA 4RQPB 5HXVA 1AL0G 4YW3A 1VBE2 5A3MA 4CPBD 5KHGA 2WAAA 1SBEA 4IL7A 1W8FA 5C3QA 3E1F1 5GJ6A 4L0PA 4W65A 2Y6LA 1RUI2 2HWD1 1MS9A 4C90A 5A3UA 4RGKA 1MQTC 2P3IA 1J58A 3D0JA 5C9AA 3LA2A 1PO23 1RVF2 3RZJA 2ZACA 4TYSA 3GJBA 3U14A 1VBE1 2ID4A 2UY8A 2BGPA 2WWJA 1WMXA 4LO5B 5H9RA 4EN9B 5JPNB 5JZGA 1JYIA 2IVIB 3WNXA 1RUE3 2LROA 4AFAA 4CXYA 4QHZA 3VB9A 1J83A 1H9PA 1AYM3 1YQ5A 5FUPA 5FOJB 2D97A 4Q4W3 4Y5Z0 3SKVA 5KR7A 5BYNA 3OUJA 4CU9A 2I45A 2D40A 1RVF1 5LA1A 3DPRA 3OEAA 1XU1A 1ACCA 1JI6A 5IWFA 3RWKX 4CDUC 1VBA2 5FZCA 4CXWA 4QPGB 4LKEA 1HXS2 4D8MA 3F2ZA 4K1ZA 3RWNA 3WUCA 4CUGA 1W9WA 3H1MA 4YVWC 2RV9A 1IPJA 5FY4A 5KXDA 2ZX4A 4PLOA 2D6PA 4WBBA 5JXJA 3CJIC 4BU2A 3IWZA 2ZGLA 1A78A 4WM8B 3MIFA 4XFFA 4Y20A 3ZYHA 1EV11 1AVBA 1VBA1 2W95A 1YNAA 4PLMA 1YQ6A 1HXS1 4M3CE 5CVRA 3W59A 2ZZQA 4XJZA 1LOFA 5JLVA 5CFCA 1W2UA 4LKDA 4Y22A 3AP7A 4JGZA 2GAUA 3KHBA 2ZGMA 2OPKA 1C57A 4XHXA 5DXDA 3RGBA 1OFNA 3AMMA 1AXZA 3C7HA 3HVDA 3LGRA 3BGAA 2DTYA 2E31A 1JHNA 2VZQA 1RUC2 1SPPB 2VUDA 4FAHA 2XMLA 1YFXA 2CTVA 5KBFA 3M70A 1QQP1 2PLV3 5F5QA 2DBNA 3ZKYA 4QPIC 3NAPB 4GWNA 4TTGA 3N9MA 3Q8FA 1KDKA 4FP3A 4PDWC 1XYNA 3AKSA 4PI2A 2BOIA 4PQQA 3WDYA 2C24A 1OI6A 4CCKA 1WCUA 1OLMA 1SHWB 2BFUS 2FCUA 3FHIB 4IEWA 1RUC1 4MO3M 1Q8PA
chains in the Genus database with same CATH topology
3ORJA 4BQ4A 4A6SA 4CPBD 1UOJA 4LKFA 1WZXA 2KR2A 4AL9A 4LK7A 4CP9B 4LKEA 2O14A 3ZYBA 1GWLA 5D21A 4YW7A 1W8UA 4CPBA 2Q1FA 4BQ5A 3UT0A 1W8ZA 2LRPA 2JWPA 4YW6A 1GWKA 4LK6A 1L7LA 2WYFA 1WMXA 1HN0A 2K46A 3ZYHA 1W90A 1OKOA 4CP9A 2LROA 1V0AA 3ZYFA 1W8WA 2VXJA 1W8TA 2C24A 1W9FA 4BQ2A 3F95A 1WCUA 4BQ3A 4LJHA 4YWAA 1GWMA 1OH3A 4LKDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ORJ A;  4BQ4 A;  4A6S A;  4CPB D;  1UOJ A;  4LKF A;  1WZX A;  2KR2 A;  4AL9 A;  4LK7 A;  4CP9 B;  4LKE A;  2O14 A;  3ZYB A;  1GWL A;  5D21 A;  4YW7 A;  1W8U A;  4CPB A;  2Q1F A;  4BQ5 A;  3UT0 A;  1W8Z A;  2LRP A;  2JWP A;  4YW6 A;  1GWK A;  4LK6 A;  1L7L A;  2WYF A;  1WMX A;  1HN0 A;  2K46 A;  3ZYH A;  1W90 A;  1OKO A;  4CP9 A;  2LRO A;  1V0A A;  3ZYF A;  1W8W A;  2VXJ A;  1W8T A;  2C24 A;  1W9F A;  4BQ2 A;  3F95 A;  1WCU A;  4BQ3 A;  4LJH A;  4YWA A;  1GWM A;  1OH3 A;  4LKD A; 
#chains in the Genus database with same CATH topology
 4JCK A;  1PMH X;  3ZFF B;  3ZLI A;  3OYW B;  2W2I A;  3N7M A;  3MLK A;  1N3O A;  3LPG A;  4A6O A;  3USS A;  4ET7 A;  1WZX A;  1RUI 3;  5FZ1 A;  1YIF A;  2YHJ A;  3SEE A;  3ECQ A;  4AED C;  2JIG A;  2HWC 3;  3BB6 A;  3W20 A;  2FMY A;  4DIN B;  2WFF 2;  5A7W B;  4MET A;  1RC6 A;  3RZH A;  2B46 X;  2YPD A;  2YRO A;  3UT0 A;  3ZOI A;  4NWW A;  3I3M A;  3ZMO A;  3B5L B;  4ATE A;  1EYB A;  2DTW A;  1IZ3 A;  1JYN A;  1RUG 1;  1O5L A;  2NZ9 A;  2ZKN A;  3BIE A;  4FPL A;  4UFI A;  2VQ0 A;  1W8O A;  3E5X A;  3A7Q A;  1AX0 A;  2JDP A;  2WZR 3;  1ALY A;  3GM8 A;  3VBO B;  4LR4 A;  2XPJ A;  1GWM A;  2WFF 1;  2VZT A;  5F3C A;  1WCD J;  3LDK A;  5IHR A;  3UKN A;  3EXU A;  4XF4 A;  1R09 2;  3A4U A;  1J1T A;  2ZS6 B;  3ST7 A;  1BQP A;  1GQG A;  1XPW A;  2JJ6 A;  2R04 2;  1H30 A;  2DUR A;  3HPN A;  1SCR A;  4COU A;  3ILR A;  3Q8C A;  4TSV A;  2OQ7 A;  3GBF A;  3ZFG C;  1HQL A;  4FPO B;  1ZBE 3;  1S2E A;  1I6X A;  2VW1 A;  1GWK A;  1X9P A;  4LTA A;  1A8M A;  3ZN4 A;  1R09 1;  1UYX A;  2WNV C;  1TG7 A;  2QQV A;  3OD4 A;  5J98 B;  5DPN A;  3WD5 A;  3J26 N;  5G04 L;  2R04 1;  4FPE A;  5FMB A;  5FLH A;  2X5I B;  3NNG A;  4I0W B;  1WME A;  3WCS A;  4CDX C;  3KLS A;  5DMY A;  1A6C A;  3AMN A;  4L2N A;  3VBU A;  4QU2 A;  2Y6F A;  1WCK A;  4Q1P A;  1D7P M;  1U5X A;  4BIF A;  1GLH A;  1AR6 3;  1Y43 B;  5FFO C;  1GKB A;  3FC0 A;  1W05 A;  1O3T A;  2MEV 3;  4XBL A;  1HDK A;  2B9U A;  2J22 A;  4B4Q A;  2I2S A;  4CCC A;  3I54 A;  1CJD A;  2XVG A;  4HKW A;  4ARY A;  3WLU A;  2J1E A;  4R8H A;  1O8S A;  2JDA A;  2YU2 A;  3BOP A;  1LOB A;  4AVV A;  2WIN B;  3AYA A;  4AQT A;  2ZGN A;  3VZM A;  1LOG A;  2JB4 A;  2DUQ A;  2QBX A;  4XJW A;  3ZYI B;  4A2U A;  5LEJ A;  1OLQ A;  4K20 A;  5H9P A;  4CUA A;  5C4W B;  1ZBA 3;  5C8C A;  1SAC A;  5A7O A;  5C3O A;  4JGY B;  5CG8 A;  5T54 A;  4Y4R A;  4Z2A A;  1XE8 A;  2ZGQ A;  4AQ2 A;  5CU1 A;  1UF2 C;  3MW4 A;  2V73 A;  1MZ6 A;  1ONA A;  1VMJ A;  1GP5 A;  1LB2 A;  1OF4 A;  1W9Y A;  4AVC A;  5A7P A;  1XNK A;  3S6P A;  3ZYB A;  3BCW A;  5FBZ A;  3ES4 A;  2AH2 A;  4XYX A;  1X82 A;  2CGO A;  1PGL 2;  4XF9 A;  3WG4 A;  1JOJ A;  4NHX A;  3OUI A;  4XTM A;  4HT1 T;  3I3Q A;  1HB2 A;  3ZXL A;  2HEV F;  5JAX A;  4JRL A;  3N9Q A;  3OF1 A;  3PJY A;  4RD7 A;  1WW4 A;  2XXZ A;  4XJU A;  2ERF A;  2JDY A;  1S0E A;  2DVA A;  1ASJ 3;  1MVE A;  2K0G A;  3R0R A;  3VBR B;  3HT2 A;  4AGV A;  1PGL 1;  3HN1 A;  3ZMN A;  2FD8 A;  1LHV A;  4CVU A;  1SBD A;  4Q0V A;  3RSJ A;  2G9Z A;  2DV9 A;  4AL9 A;  3EHK A;  1CX1 A;  5EV7 A;  1K5J A;  4LQR A;  1K5M B;  1PGW 2;  2R30 A;  3ATG A;  4O9E A;  3LAG A;  5LBF A;  5IFT A;  1C5H A;  3MI8 A;  5FZF A;  4CCD A;  1ULD A;  1GIC A;  1W9T A;  2GMM A;  5AC9 2;  1LEM A;  3URF A;  2OZJ A;  1HLC A;  2JDU A;  2ZGP A;  1ZRC A;  5EXO A;  2GDF A;  2ZBJ A;  1R64 A;  3OOX A;  3WW4 A;  2FBE A;  4JDO A;  1C1F A;  2EXI A;  3EQE A;  4BLI A;  4QPG A;  2YBS A;  1ZRR A;  3UET A;  4B1M A;  5I0D A;  1SFP A;  4XUN A;  1VAV A;  3WG3 A;  3RZK A;  5L36 A;  4YM1 A;  1AYN 2;  3DYM A;  5SV8 A;  2EF6 A;  2QQI A;  4XJ9 A;  2RDQ A;  5AC9 1;  3GBG A;  5DG2 A;  4WM8 A;  5F39 A;  3WT3 A;  1JZ6 A;  4GWI A;  4IEU A;  2XJR A;  4ZXE A;  1WUV A;  1UIJ A;  2GZW A;  4E8C A;  3NV1 A;  2VZS A;  1BJQ A;  5JSO A;  3OGR A;  4TWT A;  1I1E A;  3HIF A;  1T6B X;  4QWN A;  2PAK A;  2LUW A;  2Y6J A;  5A6Q A;  1TMF 1;  2VGD A;  1CQ9 A;  2A6V A;  2ADE A;  3QAC A;  4GA9 A;  4OCT A;  5BY5 A;  4OQ9 A;  2W5F A;  2AEZ A;  4CP0 A;  4WVW A;  3WP5 A;  1EP0 A;  3WW1 A;  1FOD 3;  5T3N A;  1OD3 A;  2NPI A;  2X8K A;  3CMG A;  1JW6 A;  5GZD A;  5C70 A;  2ZEY A;  4FVV A;  1H2K A;  1QJX 2;  1SPP A;  2RMU 2;  3AP9 A;  5LA2 A;  1H4G A;  1RUN A;  4QX1 A;  3THC A;  5FAX A;  2BGO A;  4Q4X 2;  3KD4 A;  3J9S A;  4AE2 A;  3QOP A;  4UWD A;  2XJS A;  3WQ0 A;  5F3G A;  2RE9 A;  4IND A;  4AEK A;  5GZC A;  5KHJ A;  5J09 A;  4GJZ A;  2VE1 A;  4IEO A;  5IVF A;  4GWJ A;  2F6B A;  2GMP A;  1KJL A;  3SCF A;  1QJX 1;  4EYU A;  2RMU 1;  1NCR B;  3OYW A;  1NX9 A;  2GU9 A;  3AP6 A;  4Q4X 1;  1WD4 A;  3C8X A;  3IBM A;  2CDP A;  3POE A;  2QCS B;  3VHP A;  1OQ1 A;  1UKG A;  5J37 A;  1V00 A;  5JOX A;  2W0X A;  2WO3 A;  5DAX A;  1ODN A;  1H8T C;  1DQ0 A;  2D98 A;  4PI0 A;  3WHT A;  4AFM A;  2A6W A;  1JOD A;  1TNF A;  2WLQ A;  3D4K A;  2B8M A;  2DCT A;  4XXA A;  1G9C A;  3RG0 A;  4BB3 A;  3RDI A;  2VOX A;  1ULC A;  2UYA A;  3ON7 A;  3DXU A;  4KWL A;  4Y1U A;  4BXF A;  1TME 3;  5EJ3 A;  3TEX A;  3VV1 A;  5IVC A;  5A3L A;  1OUX A;  2NYY A;  1K42 A;  2DDU A;  2J1V A;  1IS3 A;  5FY1 A;  1JUI A;  2YV8 A;  4PQ9 A;  3H1Y A;  4WVM B;  3HBK A;  5KHI A;  3ZDS A;  3E6C C;  1JZ3 A;  2GNM A;  1RUH 3;  5JOZ A;  3R4S A;  1WKY A;  4A3X A;  3LEM A;  1WWY A;  1OPM A;  2AEY A;  1AYN 3;  4LEJ A;  3I2J A;  4XQW A;  4NIH A;  2AEN A;  2HEY F;  3EMR A;  4AOC A;  1DGL A;  4P9X A;  5A6Y A;  1G9A A;  1D2S A;  4XAA A;  1PM4 A;  1YUD A;  4JQT A;  4QM8 A;  5HCF A;  4H3W A;  3S30 A;  3TAY A;  4D6R A;  3S57 A;  1HRV 2;  4EN7 B;  3KT1 A;  2PHL A;  4N7I A;  3KS7 A;  1OHF A;  2RVA A;  3RJR A;  2X5I A;  1YJL A;  2K2S A;  1MS3 A;  1O4T A;  2ET1 A;  1WA4 A;  1PVX A;  3D0S A;  3FBM A;  4P9J A;  4CXX A;  3WP6 A;  4GJY A;  3KV4 A;  4QKD A;  4L97 A;  1RMU 2;  5LA0 A;  3OTF A;  1HRV 1;  4HKO A;  4WVZ A;  4QMA A;  4Y5S A;  4KMQ A;  2BQP A;  1KDM A;  4JV4 A;  4DS0 A;  4F7Z A;  3POG A;  4A6S A;  4FPJ A;  4K40 A;  4QHB A;  4CCL A;  1JU4 A;  4LO4 B;  1ODM A;  1VE0 A;  3C7F A;  4MVT A;  3WG1 A;  4AGG A;  2B42 B;  1V6M A;  5FPZ A;  2W46 A;  4YGB A;  1E5R A;  4XUQ A;  5ANQ A;  5F32 A;  3WNO A;  2PTM A;  5C4W A;  1ENQ A;  4PT6 A;  5LK7 B;  2WS9 3;  4FOV A;  5JOY A;  1FMD 1;  1VIW B;  3I7D A;  3POB A;  2RG4 A;  4RGA A;  4B8E A;  2PHX A;  1BHG A;  1UYZ A;  2JDN A;  3I3B A;  4G9S B;  4L9B A;  4RS5 C;  4OQ8 A;  4IGP A;  3WP3 A;  2Y6G A;  3HNY M;  4DUW A;  2GNB A;  1EUU A;  1OA2 A;  1R1A 2;  4XXP A;  3FHQ A;  1QJU 3;  3C2U A;  1YCI A;  4LBN A;  5T5O A;  3ZFG A;  3M1H A;  2VCC A;  2VXR A;  1VBB 2;  1HV1 A;  2VMC A;  2VBB A;  2JEM A;  2XOM A;  1JMU B;  1U5Y A;  3H7Y A;  3KV9 A;  2ZHM A;  1GQP A;  3KZ4 C;  3OPT A;  4HSL A;  5FJK A;  1JHJ A;  2WNV A;  1UYP A;  2CAV A;  4G3Y C;  3B7M A;  4MLO A;  4BPZ A;  3S5A A;  4ZKT B;  3O0W A;  3LKJ A;  1H1M A;  3AZW A;  3NV4 A;  2PHU A;  3PUQ A;  3VBR A;  4E2G A;  4GUL A;  5C33 A;  3MPB A;  3E5Q A;  4MHR A;  1PIV 1;  2PXJ A;  1VBB 1;  2RM2 2;  1ZZB A;  1K5M A;  4JC1 A;  3K2O A;  2NMN A;  2QUO A;  4ZHN A;  4Z07 A;  2L9L A;  1V9U 1;  5FO7 B;  1YO8 A;  3AFK A;  1LOA A;  1LEN A;  1YRZ A;  2WR9 A;  3AL6 A;  3NMB A;  5B4N A;  4E27 A;  2WRA A;  4JKL A;  3K51 A;  1AHS A;  2GC0 A;  1NG0 A;  4KG0 A;  4KBB A;  2WZP P;  3NJV A;  3MIH A;  2QVS B;  2F4L A;  3ZSK A;  3BTX A;  1AR7 2;  1YYN A;  1W2N A;  5DG1 A;  5FRA A;  1RXG A;  1VBC 1;  1QIQ A;  1W99 A;  1CIY A;  4HZF A;  5FYS A;  4D6Q A;  5J96 B;  4LBK A;  4URA A;  4XF3 A;  4M0N A;  1AX2 A;  4BJ0 A;  4BK4 A;  1XNT A;  4G4F A;  3KT7 A;  2D6O X;  4FOY A;  1C8M 3;  2ZEZ A;  1RMU 3;  3CQO A;  5CAZ A;  2YMZ A;  1H9W A;  2D6M A;  1QJY 3;  1W3V A;  5BNO B;  4BQW A;  5LY1 A;  3M4F A;  2VD7 A;  5CFD C;  3LD8 A;  2ZMK A;  2ZAH A;  2W91 A;  1W9F A;  3LDR A;  4XUO A;  1EPW A;  2ZCW A;  1DZR A;  2X29 A;  1CR7 A;  3WSO A;  3RQ0 A;  4AQ6 A;  4FFI A;  4XBQ A;  4KNC A;  3DGT A;  5GM0 A;  3UK9 A;  2LAL A;  5JZG B;  4XTP A;  1ZZ8 A;  4UXA A;  3W9A A;  5CA6 A;  4P5H A;  4AQS A;  4EN0 A;  1SQ4 A;  2HWB 2;  2BVV A;  2PEL A;  1CWP A;  3GZE A;  5C3R A;  2JDM A;  1Y9M A;  2PHT A;  3VKO A;  2R1D A;  5CKQ A;  1KXG A;  4ITC A;  4YW4 A;  3D8C A;  3KF3 A;  4AHW A;  5HXM A;  3N7L A;  3BPS A;  4QQH A;  5ACA 3;  5LEK A;  1G86 A;  4LO8 A;  3FJS A;  1R1A 3;  4EV0 A;  1RUF 2;  1OQD A;  4YPJ A;  2HWB 1;  3ALQ A;  4HOO A;  5FO8 B;  3ORJ A;  1NCR A;  2PYT A;  1POV 1;  2SLI A;  4GH4 B;  4BOW A;  2QZ3 A;  3RRD A;  4H14 A;  2VBD A;  2JD4 A;  1RUJ 3;  1WLT A;  3KCC A;  4MUV A;  1I5P A;  2XVL A;  4NPR A;  4ZU4 A;  2OX0 A;  2F4P A;  5ERL A;  1NZI A;  4K6B A;  1CPN A;  2C1F A;  1X8E A;  4OUE A;  2OQ6 A;  5J7M A;  1RUF 1;  1RB8 G;  4UFH A;  1T2X A;  4I2O A;  1W2O A;  1PO1 2;  2WNO A;  2CU5 A;  2VNR A;  3RI9 A;  2RM2 3;  3N9O A;  1KEX A;  3KM5 A;  1BEV 2;  3VHN A;  2WNU B;  4GQ7 A;  1DCS A;  2Z79 A;  3VL8 A;  1O7F A;  4PIZ A;  3AYD A;  1DG6 A;  2ES3 A;  1UO9 A;  4WVM A;  2QQL A;  5FPU A;  1AR9 1;  1OH4 A;  1AR7 3;  5JIU A;  5BV6 A;  2WYS A;  4A7Z A;  2ZGR A;  4AI3 A;  3DXT A;  4P5Y A;  4KU7 A;  3RS6 A;  1HW5 A;  2HWF 3;  1IKQ A;  1N3P A;  4GB3 2;  2DUP A;  4XCA A;  2H6C A;  3JD7 2;  2WO2 A;  1YEW A;  2J1A A;  5FZ6 A;  1HKD A;  1X36 A;  3M3Q A;  4OI4 A;  4FSJ A;  4LLF A;  2QZ2 A;  2JG8 C;  2H6B A;  1MR5 A;  3JQW A;  2G1M A;  4CCO A;  5CG9 A;  3ILF A;  1G9F A;  3B02 A;  3MIG A;  4GB3 1;  2WT2 A;  3M3I A;  5DDJ 3;  2XJU A;  5LY2 A;  2VNG A;  4CDQ B;  4EN8 B;  3MLL A;  1EAH 3;  4P02 B;  4XFB A;  1CGP A;  3TRS B;  1QF3 A;  3LE0 A;  1WA6 X;  4A3Z A;  4RL7 A;  4IE6 A;  1LEC A;  1SLC A;  2UYB A;  3BTZ A;  2XBO 2;  3CHX A;  3QCW A;  3C7O A;  1XE0 A;  5C5T A;  1JXN A;  4MHU A;  5CBL A;  2QFE A;  1UXZ A;  4S2D A;  4UOJ A;  5FP8 A;  3U78 A;  4CDW C;  2ENR A;  1S1A A;  3LDB A;  4CCM A;  1CX4 A;  3H3U A;  4AR2 A;  3O1V A;  1AYM 2;  3AK0 A;  4W50 A;  4YGC A;  2WC2 A;  3OSD A;  4UYB A;  4ISR A;  4OI1 A;  3WQ1 A;  2ARA A;  3LWC A;  3WX5 A;  5APA A;  5JSR A;  1PO2 1;  1NAE A;  3GJA A;  3LB9 A;  2R07 3;  5FBJ A;  2A5Z A;  1L7R A;  4MZU A;  4MGY E;  3TB0 A;  3UJQ A;  1VMH A;  1IS5 A;  1UZ0 A;  3DYP A;  3GZU C;  1WGP A;  3Q8A A;  5IVY A;  3WZ1 A;  3AKR A;  3GHM A;  4NHY A;  1RUE 1;  1KFX L;  3EO6 A;  4MGQ A;  4QQ2 A;  3MLJ A;  1JTZ X;  3JXS A;  1XC6 A;  2JE8 A;  2WN3 A;  3VBU B;  1AYM 1;  3ZSE A;  1PO1 3;  3ZO0 B;  5J1X A;  1UOG A;  1ND2 B;  3A23 A;  4Q4W 1;  3H42 B;  1IPS A;  1Q56 A;  1CAV B;  1BEV 3;  3H9A A;  2YBP A;  3K4D A;  1P8J A;  4MXW B;  3H0O A;  4XIL A;  4YFW A;  3H7J A;  5ANN A;  5JR2 A;  4OZO A;  1XU2 A;  1NA1 B;  4HMZ A;  4AG4 A;  4CEY B;  1F15 A;  4UT5 A;  2VC9 A;  2XON A;  3WEZ A;  1BMV 2;  5JI9 A;  2ZHN A;  1TEI A;  4YRD A;  3QH7 A;  3RFR A;  5J48 A;  4FTB A;  4DXT A;  5EFU A;  2ZML A;  2DVG A;  3B94 A;  3V0A B;  1N1Y A;  1RYY A;  1AF9 A;  2WWS A;  3AL5 A;  4QKN A;  2FDJ A;  4EN6 B;  2JDK A;  3ETQ A;  3HN3 A;  4NHK A;  3UGH A;  1O3S A;  1BMV 1;  5FK8 A;  2WLP A;  3JD7 3;  2QDR A;  4COY A;  2FMD A;  2MNG A;  1DGW A;  2PLV 2;  5LCW L;  4RA0 A;  3MO4 A;  2B7Y A;  2ZX2 A;  1DGR A;  3PLQ A;  2FCT A;  4JX0 A;  4M4P A;  5HCA A;  4ISQ A;  5DN2 A;  3CBN A;  2JKB A;  1V6J A;  2CSG A;  3WDV A;  3ZFE C;  1K3I A;  2ZMN A;  5F6K A;  4B4R A;  3OBA A;  5BNO A;  5FQ0 B;  3NKG A;  5FXX A;  2P34 A;  4Q0S A;  2PLV 1;  5DAP A;  4BWO A;  4NOT A;  4M4R A;  2XKP A;  3BKZ A;  4JHZ A;  4Z1V A;  2VTX J;  1F5J A;  3I2K A;  2HWC 2;  2XBO 3;  5K4L A;  2A6X A;  2E7A A;  4Y1Y A;  3LIG A;  3VBS C;  1YC6 1;  2JX9 A;  2H0V A;  2YFZ A;  4Q0U A;  2C5D A;  1W03 A;  3AZY A;  1VRB A;  1F4A A;  4OI2 A;  2IZW A;  2YFU A;  4COZ A;  1RUI 1;  3HNB M;  3RNS A;  4LMF A;  2WZR 2;  2PAE A;  3K46 A;  1IG3 A;  1J3P A;  2HWC 1;  4D69 A;  1VP6 A;  5IK5 A;  1AL2 2;  3RYR A;  4YGE A;  4Q1R A;  5F6L B;  1PK6 C;  4BM8 A;  2XL9 A;  1UOF A;  3N9L A;  5FYU A;  2Q8D A;  3T4V A;  4NRM A;  4TN7 A;  2VNV A;  5EJZ B;  5L9R A;  3PTY A;  4PCR A;  4BQY A;  3P3P A;  3R05 A;  5FYY A;  4YW6 A;  5CAD A;  4GH4 A;  1Z7S 3;  2WZR 1;  1ZBE 2;  2WWU A;  4N53 B;  1DP0 A;  2D43 A;  1LED A;  3AZX A;  1OKO A;  4LO6 B;  1A8D A;  4Z92 B;  1O4Y A;  5A32 B;  3VLB B;  2JD9 A;  2ZEW A;  5HI0 A;  3WDU A;  5ISL A;  5AVA A;  3MGU A;  4NID A;  2WUH A;  4GAZ A;  4Q0Q A;  5FV3 A;  4JQR A;  5I8Y A;  5LBC A;  2AZ5 A;  1QWR A;  4CU8 A;  2YC0 A;  4V2W A;  4BME A;  3U10 A;  1UOJ A;  4CCN A;  2JG9 C;  4FQ4 A;  5ABJ C;  3G6J B;  4BHP A;  1UY3 A;  2Q1M A;  4HN0 A;  3DUI A;  5IVJ A;  1AR6 2;  2WNU A;  4AEM A;  3TN9 3;  1CPM A;  4R9B A;  3OGV A;  3ILN A;  4LBQ D;  2MEV 2;  2OVU A;  2KXL A;  2W87 A;  5L7O C;  1UX6 A;  1TNR A;  1BBT 2;  1J3Q A;  2VZP A;  4E4Z A;  2D6K A;  1IQA A;  1MQT B;  4OFG A;  1M4W A;  5D8A C;  4DQA A;  4TLF A;  1W2A X;  1ZVF A;  1TVG A;  2BW8 A;  2EIE A;  3CDZ B;  5CIS A;  1W6O B;  3POJ A;  1YHF A;  4HK9 A;  1BVV A;  2MEV 1;  4M3C F;  1MS0 A;  1ZBA 2;  2AUY A;  4AI1 A;  1PMJ X;  3NST A;  3ZXG A;  3JU9 A;  1W39 A;  1XOY A;  1Z0H A;  2BVB A;  2DWR A;  1FXZ A;  2V4V A;  4OHV A;  2WT1 A;  4DFS A;  2RS3 3;  3HR9 A;  4FAG A;  4Y24 A;  1XE7 A;  2YY1 A;  4CDU B;  2NN8 A;  4XF0 A;  2RJL A;  4UAP A;  2BNO A;  3V65 A;  4Y33 A;  1DYK A;  4OUM A;  1OKQ A;  4XDP A;  3KB5 A;  3ZDV A;  4YVW B;  1JZ8 A;  1LOC A;  1VB4 A;  4BCU A;  5K0U C;  2K9Z A;  3CJI B;  4EZ4 A;  5IAT A;  1UY1 A;  4CEW C;  4CDQ A;  3K4A A;  3SXW A;  2ZGO A;  1E5H A;  4XOG A;  1LRH A;  3VKL A;  1MPX A;  2YGM A;  5GKA C;  1TQ5 A;  1XJA A;  3AXD A;  1GR3 A;  3I8T A;  3TNP B;  2HLE A;  1AL2 3;  2WFP A;  4I3G A;  1ASJ 2;  1S4C A;  4HET A;  3U4X A;  4FO9 A;  1U5Z A;  4K9S A;  5GLT A;  2ZGS A;  5DAB A;  1FAT A;  1ZNP A;  2VCB A;  3T0A A;  1QKQ A;  5F2W A;  2P5B A;  4XZP A;  2HKX A;  3IZO A;  3NNL A;  1FYU A;  1RIR A;  5FYC A;  3BI3 A;  3KF5 A;  4N8M A;  4YG0 A;  1ZZ7 A;  3UNP A;  3L2Y A;  1ASJ 1;  1OSG A;  1JYT A;  1YIP A;  3O7O A;  3VBF C;  1RTV A;  4I0B A;  2SBA A;  2WQ4 A;  3CL1 A;  4I0A A;  4QPI B;  2RS5 2;  5FXV A;  4Q4V 3;  1OUR A;  3MEP A;  2VQA A;  4HPK B;  4PDW B;  3ZVX A;  2YC4 A;  2VVE A;  3B00 A;  4JAA A;  4LJH A;  1LAJ A;  4RN5 A;  4ZZ8 A;  3LFM A;  3N7K A;  5DUW A;  3TEW A;  1NQJ A;  5A7N A;  5C8W A;  1ND2 A;  2GME A;  4B7E A;  4YAR A;  1CAV A;  5F1R A;  4MXW A;  1STM A;  1H6Y A;  4ASK A;  5BUV A;  1W6Q A;  1NA1 A;  4CEY A;  1BBT 3;  2VTX A;  3DEM A;  4AED B;  5FPX A;  2B39 A;  2HBT A;  4PIX A;  2Y6K A;  3DYO A;  3B93 A;  3KWV A;  3LQC A;  3B01 A;  4PBO A;  5I0T A;  1GU3 A;  3V0A A;  1GNY A;  1OQE A;  3LEK A;  1UIK A;  3ZXE A;  4RR3 C;  1FOD 2;  4EWD A;  2A6Y A;  5JI7 A;  3UKT A;  3AJY A;  4KI5 M;  3SIS A;  5M0T A;  3H50 A;  4Y1X A;  1S0D A;  2YB7 A;  5BNP C;  2DUO A;  4IET A;  4ERO A;  5B2G B;  2EAL A;  4OUS A;  1ZRE A;  5FYB A;  1N47 A;  4A7Y A;  3N35 A;  4XQD A;  1JYX A;  3SLI A;  1FOD 1;  5EHD A;  2X05 A;  4L92 A;  3PUR A;  3POY A;  4YG3 A;  1CAW B;  3ZFG B;  3M3O A;  2FDI A;  2VEC A;  4S2F A;  2QQP A;  3J7N A;  4HLT A;  2XG3 A;  5EQU A;  4XAE A;  5FQ0 A;  2BEO A;  2WT0 A;  1QXR A;  1OOP C;  2W08 A;  4NAM A;  1S2B A;  5T5P A;  1F8V A;  1OBN A;  2WNV B;  1SBF A;  3VBH C;  1BVP 1;  2ZZJ A;  1PHM A;  4I3P A;  5JDB A;  1LCL A;  1BCX A;  2ZKL A;  1NLQ A;  3ZIW A;  4NIG A;  4CDX B;  2J1U A;  2ARC A;  4UI9 L;  3OB8 A;  5C3P A;  5FZM A;  2VPV A;  5DUV A;  1ZX5 A;  3IDC B;  3N9N A;  4YNI A;  2JB8 A;  3B3Q E;  2YUE A;  4Q29 A;  4UW5 A;  1GP4 A;  2O8Q A;  2BZD A;  1NCQ C;  1TME 2;  4WM7 C;  1ZZC A;  5LRR A;  1GOF A;  2C26 A;  4IV1 C;  1PGS A;  1ULE A;  3J7H A;  2VUA A;  3POS A;  4OMD A;  4XMA A;  2OA2 A;  3KGZ A;  3AC0 A;  1LGN A;  3Q9O A;  4P9W A;  5TSW A;  4C8D A;  3N4M A;  2RS5 3;  2DVD A;  4OI0 A;  4AFD A;  1RUH 2;  4IER A;  4AAP A;  1AZD A;  5A3O A;  1PGW 1;  3H8X A;  2VOW A;  3BAL A;  3I2I A;  2D6L X;  5T5J A;  1TME 1;  1SCS A;  2Y64 A;  4P9I A;  3PVE A;  4UFJ A;  4UFL A;  3AZZ A;  4N53 A;  5DUX A;  3WW3 A;  2GND A;  2VCM A;  5LA9 A;  4JKM A;  4LK7 A;  2H0B A;  1Q3E A;  1Z78 A;  2LTN A;  4GMP 0;  4K1Y A;  4LBM A;  5T50 A;  5A32 A;  4IDZ A;  1RUH 1;  4ZU5 A;  3ZPO A;  4BQX A;  5FKC A;  4LNV A;  4KBZ A;  2W94 A;  3C3V A;  3FUQ A;  1AYN 1;  1FAY A;  1YXW A;  3NNM A;  1CJP A;  3OY8 A;  2P37 A;  2GSY A;  3PME A;  3D82 A;  1HX6 A;  1UU6 A;  2BU9 A;  1UY4 A;  4Z82 A;  3WNL A;  2G9G A;  4I30 A;  1Y4W A;  1FNZ A;  5AFE A;  3C7E A;  2D3P A;  1US3 A;  3GYD A;  3MDP A;  4MX3 A;  4X8P A;  4EE2 A;  1LOD A;  2Q0A A;  3T2O A;  4YG6 A;  4BQ2 A;  2YDE A;  4AHX A;  2WDB A;  2R1B A;  4YM0 A;  1MQT A;  4O61 A;  4EWA A;  2J42 A;  4R9A A;  4XEZ A;  1NY7 2;  3BTY A;  5IFP A;  2IXC A;  1DYO A;  1RED A;  1HRI 2;  5FPL A;  4RYD A;  3WDW A;  3AX4 A;  1MAC A;  1W6O A;  5FTT C;  4LUL A;  2E26 A;  4R4X A;  3NKT A;  1B09 A;  2WZ8 A;  2Y0I A;  2WS9 2;  3WQ7 A;  1JH5 A;  4ZON A;  2OXB A;  1V6L A;  4Q5O A;  3POF A;  1B35 C;  1PM7 A;  1GBG A;  1NY7 1;  1V0A A;  4MGZ E;  4Y26 A;  3ZM8 A;  5KXE A;  1G9B A;  4CDU A;  5DZG A;  4BXS V;  3OJB A;  3MIB A;  3ZSL A;  4C0B A;  5I91 A;  3Q8B A;  2VH9 A;  4AEJ A;  4AI9 A;  3ACL A;  4YVW A;  2WS9 1;  1QJU 2;  4IE5 A;  5FZ0 A;  2JDH A;  2TBV A;  3CJI A;  3WNN A;  4JDM A;  1H8V A;  4NAO A;  2P4E A;  5GZE A;  5I8S A;  1QNW A;  1RHI 3;  1WBF A;  4FXG B;  4O7X A;  5FP3 A;  3KGL A;  1XXN A;  1RL3 A;  2OZ6 A;  1UZY A;  2FHR A;  3ELN A;  2AC1 A;  2WNE A;  2ZOE B;  4XFH A;  4CUC A;  1QJU 1;  3FHA A;  3BN6 A;  4HKL A;  1RIN A;  4LKS A;  3UYJ A;  5K8S A;  4YVS C;  3VD4 A;  1MS4 A;  3O1M A;  4XFG A;  2XJV A;  2VUC A;  4S2H A;  3SNM A;  1SLI A;  2CAU A;  4IV3 C;  4UFK A;  1V6O A;  3AVS A;  3CZU A;  5FZK A;  5KHH A;  3ZPY A;  4FQZ A;  3ME2 A;  4E4S A;  2W3J A;  5F2S A;  3S7E A;  4W6W A;  5JCT A;  1KRI A;  5FR3 A;  4N43 C;  1RJ7 A;  1J1L A;  3MHZ A;  3IB3 A;  4RSU A;  4ZPI A;  3R4D B;  3BOW A;  1SMV A;  1GZW A;  1SLA A;  4QPI A;  5JIA A;  1UPS A;  1JZ5 A;  1L3J A;  1ND3 C;  1UXX X;  2BWC A;  4HPK A;  4PDW A;  2QQM A;  1I5Z A;  3WHU A;  2N7G A;  2EXH A;  2VVF A;  2WKK A;  4IEY A;  1FI2 A;  4QHO A;  1UOB A;  3VD3 A;  4LA2 A;  1C8M 2;  3TYJ A;  3AKP A;  2IXH A;  3T2Q A;  1EPZ A;  3TEY A;  1QJY 2;  4CYD A;  3ZXF A;  1TMF 3;  2DVB A;  2Q30 A;  3U75 A;  1DZT A;  4NHM A;  1NT0 A;  3E6D A;  1D0G A;  5BNN C;  3PU3 A;  2WA3 A;  4AED A;  1YJK A;  4XHB A;  5GAL A;  4OHY A;  1H8T B;  4MGT A;  3VDD C;  3WG2 A;  4A4A A;  3NWK A;  2PAM A;  1HRI 3;  1ZYB A;  1OUS A;  1C8M 1;  5JOW A;  4AF9 A;  4ES8 A;  1YFW A;  1RMU 1;  1VBD 3;  3N7J A;  3SIT A;  5CZK A;  2P2K A;  3TOJ A;  1QJY 1;  1Y7B A;  3CO2 A;  4FFG A;  5DUU A;  4EZH A;  1XYO A;  3AVR A;  3PL0 A;  4QDR A;  5IVV A;  3ZN5 A;  1L7L A;  1GOG A;  3ASI A;  1QH6 A;  1SZB A;  4YYO A;  2BDR A;  2XGX A;  2DBI A;  1W90 A;  2DFC A;  4IGO A;  3VZK A;  4DEV A;  1A3K A;  2PHD A;  1OD5 A;  2IUW A;  2YBK A;  1BK1 A;  2Y26 A;  1QHD A;  5ACA 2;  5A1A A;  4YWA A;  4UBG A;  2CY6 A;  1CAW A;  3M7A A;  3I59 B;  2VOT A;  4Y3O A;  3OGG A;  3PVO A;  5IT6 A;  1WLD A;  4UW3 A;  3V0B B;  4LE4 A;  1JS9 A;  1O6U A;  1RUJ 2;  1QJE A;  2VVD A;  4QQL A;  4HL0 A;  2RS1 3;  3JB8 A;  3GZA A;  4FTE A;  3RZG A;  4NE9 A;  4XDQ A;  1QU0 A;  4BQ1 A;  2BRT A;  5ACA 1;  4H55 A;  4C0H A;  1R1A 1;  3WP4 A;  4CDX A;  1JYV A;  3BYW A;  1POQ A;  2ZX3 A;  3D3A A;  4QXK A;  3W58 A;  5L19 A;  4AFC A;  2CWM A;  4GD4 A;  2EAA A;  1W8W A;  2A3X A;  4LXL A;  4ZS2 A;  3OBT A;  2HBU A;  1RUJ 1;  5C9A C;  3RZM A;  3P3N A;  1NKG A;  3F95 A;  4V1P A;  1Y9G A;  4P9L A;  3VL9 A;  1C5I A;  2R49 A;  4GWM A;  3M8L A;  3T3Y A;  3VD9 A;  4ONU A;  2DCZ A;  4XIK A;  5FZ8 A;  1LHO A;  5DZF A;  5FY0 A;  1QH7 A;  4IW3 A;  3T1L A;  2RDR A;  3MUZ 1;  5FMC A;  1N3Q A;  3FUO A;  2RM2 1;  2V4A A;  3FX3 A;  4HAN A;  4HXC A;  4Q4Y 2;  4F3J A;  3QBQ A;  3DPR C;  4GXL A;  2LRP A;  1YQC A;  2YYO A;  4J25 A;  5FY7 A;  3THP A;  1G9D A;  2HWF 2;  2XJQ A;  2HWE 2;  4NPM A;  4PHZ A;  4UF0 B;  3WDX A;  5FPA A;  4PLN A;  1SG3 A;  2IFW A;  3DCQ A;  3VDC A;  2B5H A;  3K48 A;  3LFI A;  3O1P A;  1BK0 A;  2BYV E;  4NIA A;  3PHM A;  4RS5 B;  1XSQ A;  3GCX A;  1AR7 1;  5L9V A;  3MIE A;  3QLQ A;  1UL9 A;  3O0X A;  4GKX A;  5LAT A;  3SCG A;  1DLC A;  3MF6 A;  4ASL A;  2B9V A;  1UY0 A;  2HWF 1;  3VDA A;  2X10 A;  1UD1 A;  4QPY A;  3IT8 A;  5A3W A;  4ZU7 A;  4CCJ A;  1MS5 A;  5DDJ 2;  3MPP G;  4DXZ A;  5JXH A;  5HV0 A;  2Q5T A;  1OOP A;  3H3L A;  4QQP A;  5CFC C;  5FO9 B;  1K12 A;  4JZR A;  1EAH 2;  4JGZ C;  4IUG A;  1ZZ9 A;  3AZV A;  3RJ2 X;  4QXB A;  4XBN A;  3WF2 A;  3H8O A;  2JXA A;  1COV 2;  4FCA A;  5E8A A;  1S55 A;  3THT A;  2BBA A;  1GOH A;  3A21 A;  1QJF A;  1WLW A;  2DYC A;  1SEF A;  5C3S A;  3I4I A;  3MW2 A;  4KQ7 A;  2R06 3;  5DDJ 1;  3DKW A;  2GC1 A;  1ZA7 A;  4I01 A;  4KH9 A;  1RJ8 A;  3IAP A;  5FP9 A;  3P6B A;  5CIR A;  1O4Z A;  1QOO A;  3ZYJ B;  4BMB A;  4AW7 A;  1WLC A;  2Q4S A;  3D6E A;  2FQP A;  4K3U A;  2R07 2;  1UYY A;  2D7F A;  3JUU A;  3AKQ A;  3IDE A;  4QM9 A;  2VM9 A;  4Y4Y A;  4CPB A;  2VZU A;  5JMC A;  3GDB A;  4DPN A;  2QKD A;  2DCY A;  4L11 A;  2Q8E A;  2XUE A;  1MS8 A;  1KS4 A;  3KSC A;  3IDA A;  1OLM E;  5K9Y A;  4DOU A;  1J3R A;  4AHZ A;  1QDC A;  2VXJ A;  5DAV A;  4M0H A;  5CFD B;  4J1X A;  2R07 1;  3ZR6 A;  3IMN A;  3DL3 A;  4QT6 A;  1N1V A;  5GLV A;  2CGN A;  2YXS A;  3NJX A;  3BUC A;  1W2T A;  4A44 A;  1UX7 A;  2YU1 A;  2PQQ A;  1Q8Q A;  1G8W A;  1GSL A;  1R08 3;  3DF0 A;  3PDQ A;  1PO1 1;  2IWG B;  4LLO A;  2VL4 A;  4WZF A;  3ZN6 B;  4FBF A;  5J36 A;  4GMP 3;  1ULG A;  2CNA A;  1BEV 1;  2EAK A;  4Q4Y 3;  5DQ0 A;  3VKN A;  2XL7 A;  5A3T A;  2R7E B;  3HJR A;  1UMI A;  2WSU A;  4LUM A;  3ETP A;  5C7G A;  4DUX A;  4A42 A;  4MH0 E;  2HWE 3;  4HK8 A;  1DYP A;  1SLL A;  3I97 A;  4XET A;  1HN0 A;  5FY5 A;  4DRV A;  1XNA A;  4IEX A;  3CIH A;  1QJZ A;  1W8T A;  4DXS A;  3KHC A;  1V70 A;  2RR1 2;  2XQX A;  3W5M A;  1O8P A;  1MZ5 A;  3AYE A;  4BK5 A;  5A3P A;  5CKN A;  4QB1 A;  4XAB A;  5T55 A;  3MBW A;  3ZIX A;  5IK8 A;  4QB6 A;  1BXH A;  3ACI A;  5A6X A;  1FX5 A;  5FPV A;  1SLB A;  1IKP A;  2ARE A;  2EIC A;  3JD7 1;  2CGP A;  2GC3 A;  2R6Q A;  3VBU C;  1Q8S A;  3WV6 A;  2IXJ A;  2QQJ A;  1F4H A;  4I09 A;  1R1Z A;  1CZT A;  1COV 3;  3KCX A;  1HJG A;  1HQN A;  2W1S A;  1YWK A;  2E63 A;  3MZH A;  3AMH A;  1H8T A;  3VD7 A;  5D1I A;  1CAU B;  1UW8 A;  2JE7 A;  4AHY A;  3I2F A;  4AXO A;  4CE8 A;  1S2K A;  2B45 X;  2WJS A;  5KXB A;  5FUN A;  2TUN A;  5FZ3 A;  1GQH A;  2KM2 A;  3FLR A;  3N9P A;  2GH8 A;  4NUB A;  1IS4 A;  2C9K A;  4DO0 A;  3PNA A;  3JBG 3;  3USU B;  4FT8 A;  5FZE A;  4BQ4 A;  4AVS A;  2X53 S;  4YZ3 A;  4Y1V A;  3ZYR A;  3LSD A;  3P5B A;  4DB5 A;  1O59 A;  2XBO 1;  3U0Z A;  5C71 A;  3RYK A;  5BNQ A;  3BTA A;  5C8C C;  1LR5 A;  5D21 A;  3UKV A;  1W9S A;  3UJO A;  4RHV 3;  4IQP A;  4MV2 A;  4ZXK A;  1D4M 2;  4DY5 A;  3WNM A;  4RFR B;  3KT4 A;  1X50 A;  2PHR A;  3I59 A;  3PIJ A;  2WAB A;  4LK6 A;  4NO4 A;  4L8Q A;  3B69 A;  4X8N A;  4Z2W A;  3GGL A;  1Z7S 2;  2BGC A;  3I2H A;  5LBB A;  2ET7 A;  1VR3 A;  4RQP C;  3V0B A;  5A7S A;  4LA3 A;  1W6Q B;  2V5D A;  2YC2 A;  1RUD 3;  3WVJ A;  3RZL A;  4BZ4 A;  2I74 A;  2VJX A;  1A34 A;  2JG8 B;  4E2Q A;  2P3Y A;  2Y60 A;  5K7P A;  1W0N A;  3KQ4 B;  3PMS A;  2ZPX A;  3J8F 3;  3MFC A;  1OC1 A;  3KV6 A;  3HT1 A;  4R9D A;  1NQD A;  5LB6 A;  4AAX A;  4BIO A;  1MEC 2;  1ULP A;  1XSR A;  1Z7S 1;  2YPJ A;  3OEB A;  4FPC A;  4N7U A;  4ORF A;  3DV8 A;  2HH9 A;  1W3X A;  3V64 A;  3O1T A;  3INA A;  3III A;  3APB A;  3OBR A;  1FNY A;  5FYZ A;  2Q1Z B;  4Q27 A;  3TN9 2;  3VZN A;  4B29 A;  4NPL A;  5BNN A;  2A71 A;  2E33 A;  1H2N A;  4QGN A;  4MGI E;  4W8J A;  5FWE A;  4D3W A;  3VDD A;  2VMG A;  5E6H A;  2ADD A;  4NVP A;  3VZJ A;  2RR1 3;  1VB2 A;  2P6H A;  1DHK B;  1S0F A;  3WQB A;  4F83 A;  4JTO A;  2C6S A;  3OD0 A;  1TE1 B;  3H8R A;  1VRH 2;  4P14 A;  4KWU A;  3TN9 1;  4CDW B;  1DQ1 A;  1DU3 D;  1V6K A;  2P3J A;  4NRP A;  4TXW A;  3T30 A;  4QPG C;  4UF0 A;  2WII B;  2QJV A;  3AKT A;  1YQ8 A;  1FPN 3;  4B4P A;  4OHX A;  5JSP A;  1IS6 A;  5FZ4 A;  5EYY A;  4FPF A;  4JKK A;  4RS5 A;  1CD3 G;  2BUK A;  2RS3 2;  4NR1 A;  2XQR A;  5FZH A;  1FT9 A;  1Y9Q A;  4WM8 C;  2G9F A;  1X8M A;  2RHP A;  2QDN A;  3KQR A;  1YFU A;  3TBD A;  3TEZ A;  1DQ4 A;  4CP1 A;  2W68 A;  1ZRD A;  3TNQ A;  3MV0 1;  3I2O A;  2OT7 A;  1ZM1 A;  5E88 A;  4HSJ A;  4UFM A;  2RS3 1;  4H2A A;  1IQD C;  5FP4 A;  2UWA A;  5FPB A;  5C5U A;  3UL2 A;  1JZ7 A;  1KGY A;  3PIG A;  1AR8 3;  2Y33 A;  4HFS A;  3K4Z A;  4W6X A;  4WVV A;  1BZW A;  5IAX A;  4IE0 A;  1GZC A;  5AFB A;  1W0P A;  3L9J T;  1YFY A;  5F3I A;  2HEW F;  1S0J A;  1OVP A;  2DFB A;  4P9G A;  1NZC A;  4CUB A;  1D4M 3;  4XAC A;  4NMI A;  3FWE A;  3NAP C;  5FY9 A;  5B4X A;  4XDO A;  1GV9 A;  1H1I A;  2BER A;  3IKW A;  4O65 A;  5A80 A;  1AL2 1;  1NE4 A;  3CJX A;  1IGO A;  4U2A A;  1LGB A;  1W6P B;  2QTW B;  2UU8 A;  1KJR A;  3ACG A;  4XVH A;  2NM1 A;  3MV1 1;  2QNK A;  3ZFF C;  3DN7 A;  5BPX A;  4Q4V 2;  2W52 A;  2CL2 A;  3ZSJ A;  3PUS A;  3IM0 A;  3UES A;  2YZ4 A;  2B4K A;  4NJ4 A;  1GMM A;  2VCA A;  1S0B A;  3OY8 B;  1EV1 2;  1V6N A;  5GLW A;  1MEC 3;  3FZ3 A;  3ZFE B;  1ZBE 1;  5FZO B;  5E89 A;  1OF3 A;  5A3N A;  5HCH A;  2QQU A;  1O91 A;  4ATF A;  2E6V A;  3LCP A;  3RI8 A;  2Z5W A;  5I0U A;  1W8U A;  2BNM A;  2V72 A;  2YG0 A;  4LOR A;  1PVC 3;  5CFD A;  4Q4V 1;  4MAD A;  5A1F A;  4FFF A;  1G7Y A;  4E8D A;  1CON A;  1Y3T A;  4P08 A;  3HAG A;  3W21 A;  4I02 A;  4W6Y A;  1NUK A;  5FJH A;  3VBS B;  2EA7 A;  3ZN6 A;  3IIA A;  3VBO C;  3CKH A;  1VMF A;  1XRU A;  3IMM A;  1AR6 1;  1VRH 3;  3U11 A;  3H3Z A;  4QXC A;  1ZA4 A;  1GZT A;  1HB4 A;  5JXI A;  1QQP 2;  2UY9 A;  3SH4 A;  1WCS A;  3WF1 A;  3FLP A;  5FKB A;  1S0G A;  1QDO A;  2JKX A;  4N90 A;  1RXF A;  1BBT 1;  2Z42 A;  2CYF A;  2BNN A;  2TEP A;  1SFN A;  5IK7 A;  1YI9 A;  5I0R A;  2VOK A;  3VKF C;  3HMY A;  4YW7 A;  1PK6 B;  1W28 A;  3JCI A;  5EJ1 B;  2ZA9 A;  5F5I A;  5HBA A;  4AVA A;  3E5U A;  3AYC A;  5D2A A;  5JVV A;  5BXX A;  3NVC A;  2IXK A;  2E7T A;  2BTV C;  1UMZ A;  1JYC A;  1O5U A;  3HQR A;  1ZBA 1;  4M3C B;  2HWD 3;  2K46 A;  3I3E A;  3FLT A;  4MSV A;  1LTE A;  2X5I C;  1DGR N;  3HEI A;  5T52 A;  5FZD A;  4DUV A;  4AVB A;  5FMO L;  1AXK A;  2GN7 A;  1VBE 3;  3NQH A;  2VQT A;  2MHF A;  2EID A;  4TLG A;  4XMI A;  1RUG 2;  3OGJ A;  1F35 A;  1CAU A;  3LF7 A;  3N3H A;  2HYK A;  2ARB A;  2RDN A;  1SFY A;  2E51 A;  4J1W A;  4NRQ A;  4D94 A;  1FV2 A;  1ZRF A;  2JG9 B;  5ABJ B;  5I93 A;  3LEG A;  3NL1 A;  4JDN A;  5FYV A;  4YZ1 A;  3LIH A;  1RVF 3;  1YI7 A;  3LEI A;  4AK3 A;  1OFS A;  3EYP A;  4Q2F A;  1C28 A;  3USU A;  4GKY A;  3HWJ A;  1W6M B;  4MXV A;  5EIY B;  5L7O B;  2XB6 C;  1NE6 A;  1LU1 A;  3JZV A;  4PF1 A;  4NII A;  5C4W C;  1APN A;  3VHR A;  1D2Q A;  4SBV A;  5D8A B;  3VUO A;  1UQX A;  4LIV A;  1GZW B;  3QH6 A;  2VZR A;  2VMD A;  3CF6 E;  1WW6 A;  4JGY C;  2PFW A;  3POI A;  2WO1 A;  4M01 A;  1DQ5 A;  1ENS A;  1EV1 3;  4QGM A;  2ZAA A;  1DQ6 A;  1VBA 3;  3MFA A;  3R4U A;  1CVN A;  1SLT A;  2XLF A;  3ENR A;  1HXS 3;  2Y6H A;  4YM3 A;  5A33 B;  1WW5 A;  5LBE A;  2GH2 A;  1RGS A;  4LHN A;  4J6G A;  1H0B A;  1T6G C;  2WL1 A;  3U1X A;  2RS5 1;  4K8R B;  5AVP A;  3T09 A;  4OUL A;  3NV2 A;  3T08 A;  1OXC A;  2JG8 A;  1JN2 P;  4KGQ A;  4YW5 A;  4XCB A;  4URT A;  1U12 A;  2VZ1 A;  4Y1Z A;  1JZ2 A;  5CB7 A;  3RYP A;  3S7I A;  2MPF A;  3T2P A;  3ZXJ A;  4FPY A;  2HJI A;  4YLZ A;  5K0U B;  2VZV A;  3VBR C;  3IN9 A;  1QQP 3;  4CEW B;  1EY2 A;  1VPH A;  2DVF A;  1DIW A;  1UN1 A;  2VMF A;  3BU0 A;  1ZZ6 A;  4LIU A;  4LPL A;  2VBP A;  2GN3 A;  5FIX A;  3K75 B;  3UGF A;  4FP2 A;  1OA4 A;  1K5M C;  3NW4 A;  2PMW B;  1HB1 A;  3WR0 A;  1N1T A;  2VU9 A;  3BU7 A;  4Y5T A;  4CP9 B;  4QDS A;  2VY0 A;  5F8P A;  3SH5 A;  1RUC 3;  4YM2 A;  2VZO A;  3T2T A;  5FY8 A;  1J84 A;  1UAI A;  5KWR A;  3UGG A;  3CZJ A;  3KMH A;  3ZXD A;  2QQW A;  1W8Z A;  2XH6 A;  3KVA A;  4CDW A;  2IXI A;  2EVX A;  3WF0 A;  4CTE A;  1RIT A;  5FZL A;  4XJA A;  1UZV A;  5EZW A;  1HB3 A;  2A7A A;  4W4Z A;  1CZS A;  2A73 B;  1AJO A;  3GCW A;  2V5Y A;  3VBF B;  1AJK A;  2FDK A;  4YW2 A;  3HQX A;  2QE3 A;  4B1L A;  3M3C A;  1CZV A;  1QGL A;  1RUG 3;  2ATF A;  2KA3 A;  3OG2 A;  2VQU A;  4LHS A;  4CCE A;  1PX4 A;  4NRO A;  3SCH A;  3WNK A;  4D7S A;  4IEV A;  2F17 A;  1GZ9 A;  3AB0 A;  4HVO A;  4IEP A;  5JMO A;  3LSE A;  2IVJ A;  2WFF 3;  2WQZ C;  2XHN A;  1XYP A;  2ZX0 A;  4RQP A;  2D6N A;  5FCC A;  2LS6 A;  5LK5 A;  4QXH A;  1YLL A;  3IAQ A;  1QXJ A;  4XFC A;  1RHI 2;  1X9T A;  3WIN E;  2D3R A;  4JVA A;  2JWP A;  2Q8C A;  5FZ9 A;  1GFF 2;  1C1L A;  1KS5 A;  3NRU A;  1PMI A;  2ZTN A;  1C4R A;  1F5F A;  3IPV B;  2XUM A;  4K7J A;  4YGD A;  1GP6 A;  5KXC A;  1MZF A;  5FMD A;  1EUT A;  1OA3 A;  4XZU G;  3BOD A;  3OPW A;  2Z69 A;  4DIQ A;  4HVQ A;  1UY2 A;  3FFQ A;  3NNJ A;  1PNG A;  2WSV A;  2XJP A;  1R09 3;  1CAX B;  4MG2 A;  4RR3 B;  1VLN A;  4OZX A;  1QOT A;  1RHI 1;  4CU7 A;  1XB9 A;  3BVC A;  2R04 3;  3ZYP A;  5DZE A;  1HIX A;  1CN1 A;  3AMP A;  5FZB A;  3S0M A;  2RJ2 A;  5BNP B;  1W6P A;  3VN4 A;  4K21 A;  3WY6 A;  4FPK A;  1NCR C;  3GXU A;  4XPV A;  1CIW A;  4XFI A;  4CRQ A;  3ZSM A;  3EBR A;  1LGC A;  2ZXQ A;  2XHK A;  2P1B A;  4FPG A;  5E16 A;  4XUP A;  4COV A;  2BP6 A;  1WMF A;  2XJT A;  2VOV A;  1BKZ A;  2TNF A;  5FLI A;  5FZO A;  3ZFE A;  1JZ4 A;  1K45 A;  5I0S A;  1NYW A;  2BFU L;  2EIG A;  2W39 A;  4XUT A;  3THD A;  4AI0 A;  4QX5 A;  1LOE A;  4ASM B;  1WD3 A;  1LES A;  1OOP B;  1YQ2 A;  4LE3 A;  4XJ8 A;  5L9B A;  2LW8 A;  1TMF 2;  3NJY A;  5GLZ A;  3FN9 A;  2IXL A;  2OKX A;  3SMH A;  2DU0 A;  2C0Z A;  2EIB A;  1I3H A;  4UBH A;  5DAW A;  3VBH B;  3WUD A;  5JPM B;  1QNY A;  2AR6 A;  4QGL A;  3OBZ A;  3V56 A;  4AFB A;  2GP3 A;  3VBS A;  1DLL A;  1S0I A;  4MOA A;  1VAL A;  3I2G A;  3A0K A;  2DU1 A;  4HVR A;  5F5C A;  5HPO A;  1VBD 2;  4V2V A;  4U36 A;  2CHH A;  2P3K A;  2CWS A;  2W47 A;  2WAO A;  4UW6 A;  2BJS A;  5FZG A;  2OUH A;  3QD6 A;  3VGI A;  2EXK A;  4FOQ A;  5EP9 A;  3H8U A;  3WDT A;  5CKM A;  4WV8 A;  1NCQ B;  4WM7 B;  2W92 A;  2Y0O A;  4IE4 A;  2D93 A;  1XBF A;  3PTR B;  4IV1 B;  5GZG A;  5HV4 A;  4P9Y A;  4XQ4 A;  1C8N A;  2J7M A;  2UUR A;  1PK6 A;  4C91 A;  5E1R A;  1HRI 1;  1VBD 1;  3RVH A;  3NV3 A;  4D0Q A;  2BPA 2;  1JYW A;  3ZYG A;  2OPW A;  3NAP A;  1OMI A;  2DF7 A;  1DGW X;  2J1S A;  3AXE A;  3LA3 A;  4M3C A;  2OYZ A;  1PZ7 A;  2GAL A;  5J3U A;  1ULO A;  4AZZ A;  4QQO A;  1DZQ A;  3E6B A;  2DCJ A;  4LIT A;  1POV 0;  4E9K A;  1U0A A;  3G7D A;  4WZC A;  3U37 A;  1TZO A;  3NJZ A;  1F2N A;  2Q1F A;  3ZFF A;  1NLS A;  2D5F A;  1IOA A;  1SDW A;  2RS1 2;  4IES A;  4KG8 A;  4QPW A;  4C1X A;  5FOB B;  1O3R A;  1GUI A;  1LHU A;  2P17 A;  5LWB A;  2AYH A;  4X6R B;  2KD7 A;  3AM2 A;  1AUY A;  1F31 A;  1LJ7 A;  4KU8 A;  4A45 A;  5IYY A;  2ZEX A;  2JG9 A;  4OLL A;  5ABJ A;  3MYX A;  2D44 A;  5A7W A;  3WF3 A;  4KL1 A;  5LRS A;  2QQK A;  4F8A A;  3KVB A;  1ULF A;  3DKQ A;  3Q8E A;  2RS1 1;  2VG9 A;  1QEX A;  1W6M A;  5L7O A;  2ZX1 A;  3FL7 A;  4QD2 A;  5JUV A;  1HN1 A;  2XWB B;  3C7G A;  3JB4 C;  3O5S A;  4GAL A;  2PHF A;  4QKB A;  5DAQ A;  1X7N A;  3L2H A;  5D8A A;  1LHW A;  3OPZ A;  4Q8L A;  1J59 A;  4GIQ A;  1QY4 A;  3HNM A;  5AC9 3;  4LOT A;  3VBO A;  2JDZ A;  1HQW A;  2Y38 A;  3B9I A;  1C3H A;  4HON A;  5I8T A;  4IXL A;  4D6S A;  5FDB A;  3FMG A;  3M3E A;  5EPA A;  5JXG A;  2BWA A;  5A33 A;  2WA4 A;  2A3Y A;  4LO7 A;  3J7M A;  5A6Z A;  1UPI A;  2XWJ B;  4ZY9 A;  1UZW A;  2PHW A;  1ZRI A;  2ILM A;  1B35 B;  2VNO A;  4OMC A;  2VUL A;  4BQ3 A;  4JTN A;  2E32 A;  2XVK A;  4HG6 B;  4LOS A;  3MW3 A;  5JR7 B;  2Y8K A;  3K3O A;  1NXD 1;  4LKF A;  2Q8O A;  3PVN A;  4LBQ B;  1LUL A;  2BV4 A;  1REE A;  4D7Y A;  5K0U A;  2ARX A;  1PNF A;  2ZGU A;  4CEW A;  4YSF A;  4UW4 A;  3O1S A;  2OUJ A;  4BQ5 A;  2HYX A;  2W1U A;  4O9G A;  2R16 A;  2PA7 A;  5F7U A;  4C1W A;  1M06 G;  3VKM A;  1X33 A;  2E7Q A;  5IVB A;  4CP9 A;  3T0D A;  3MID A;  4H7L A;  1QJX 3;  2RMU 3;  4FPH A;  1FMD 2;  2GC2 A;  4NHL A;  4YVS B;  5H9S A;  5FYT A;  1KFU L;  4A7K A;  1U5I A;  2PN5 A;  4R9C A;  4Q4X 3;  3WF4 A;  2R06 2;  3AJZ A;  3NNF A;  3A0N A;  4IV3 B;  1AX1 A;  3SEP A;  2Z2S B;  1H2L A;  3ZR5 A;  2RJK A;  4M00 A;  4XFA A;  2X09 A;  4QX7 A;  2RDS A;  4N43 B;  2JEN A;  1IPK A;  3VBF A;  1W6N B;  4AVT A;  2AAC A;  3A22 A;  5CEH A;  1GNZ A;  3K77 A;  1ENX A;  1UZZ A;  1HJF A;  4JGY A;  4PIY A;  3RPQ A;  3SKJ E;  2R06 1;  1ND3 B;  2Y34 A;  1CES A;  4OHW A;  2VO5 A;  5BNO C;  3GBW A;  5IJR A;  4OHZ A;  2WYF A;  4KWJ A;  2YGL A;  5IVE A;  1D0H A;  1WBL A;  5KHK A;  4QDQ A;  4LHL A;  2QQO A;  1PIV 2;  2ZJC A;  3T0B A;  2J1R A;  2O1Q A;  2VW2 A;  3AMQ A;  3CLP A;  5FZI A;  5LZ6 A;  5JZG C;  5BNN B;  3MF9 A;  4LBL A;  1GAN A;  2XR4 A;  3IPV A;  4MGK E;  1UU4 A;  4OVE A;  1IG0 A;  4PJY A;  5FZ7 A;  4AI8 A;  3NO8 A;  4XUR A;  1V9U 2;  3VDD B;  1W06 A;  3CU7 A;  1GWL A;  4KWK A;  4FTS A;  1R08 2;  2A75 A;  5IUQ A;  1NXM A;  2G4I A;  3B9C A;  4MGS A;  5KC6 A;  4NN0 A;  1CAX A;  4E2S A;  4RR3 A;  4YW1 A;  4B7K A;  1BYH A;  4Q0P A;  3O0V A;  1D4V B;  1S0C A;  3BPZ A;  3RZZ A;  3LOB A;  3AP5 A;  1VBC 2;  2GNT A;  5HCB A;  3RMY A;  5BNP A;  2D3S A;  1L7Q A;  1US2 A;  1ENR A;  2VTF A;  1E5S A;  1DFQ A;  3KCY A;  4GH4 C;  5A70 A;  1R08 1;  3I2D A;  1HRV 3;  4GMP 1;  4L99 A;  3BIW E;  4Q4Y 1;  4N9I A;  4K8F A;  4BDV B;  2NMO A;  1V6I A;  3S5Q A;  2ZAB A;  1UWW A;  3MUY 1;  4HN1 A;  3WOG A;  4LUK A;  2HWE 1;  1I9R A;  3ZXA C;  1LKN A;  2R32 A;  2WBK A;  5FZA A;  3SQO A;  1LOF C;  3W5N A;  3PJQ A;  1KQR A;  4QX2 A;  1E57 A;  5CYY A;  1ST8 A;  3LOI A;  1H2M A;  4BE3 A;  3U4S A;  3VBH A;  5IK4 A;  3M2M A;  3FFZ A;  4HBN A;  2JEC A;  1OT5 A;  1W8H A;  3OUH A;  2WNU C;  4OYU A;  4XW3 A;  5A7Q A;  3X29 B;  1LU2 A;  5F37 A;  5FXW A;  4QAW A;  2VW0 A;  3O1O A;  1Q8V A;  1FMD 3;  4LT5 A;  2R0F A;  2JIC A;  3ACF A;  5F9T A;  3OCP A;  4FFH A;  3O1R A;  4IEZ A;  4QX0 A;  4E4H A;  4YZ2 A;  5C9A B;  2IC1 A;  3JQX A;  4DRR A;  1EAH 1;  2IFR A;  1MS1 A;  5A1L A;  2WQ8 A;  1NCQ A;  1PX3 A;  2A6Z A;  2O8O A;  3JBG 2;  4AWD A;  4R4Z A;  2JIJ A;  4WM7 A;  1COV 1;  1WMD A;  2EXJ A;  4IV1 A;  2CV6 A;  2NQY A;  4IE7 A;  3WNP A;  4IEQ A;  1UKR A;  1W04 A;  1VAK A;  1IHM A;  2D5H A;  2WO7 A;  3ROU A;  3WCR A;  4RHV 2;  3ZKU A;  1Q5O A;  2FCV A;  4P00 B;  2VMI A;  4BA6 A;  3DPR B;  3D5O A;  3N36 A;  1VAM A;  5FUI A;  2VUJ A;  3JBG 1;  2UWB A;  3FE5 A;  5FP7 A;  4COW A;  4BH9 A;  1XNC A;  4XF1 A;  4D7T A;  3LZZ A;  1HV0 A;  1JOP A;  1DBN A;  1PIV 3;  2C9A A;  4MYE A;  1VBB 3;  2ORZ A;  3HOB A;  3OGS A;  4DY3 A;  1RUD 2;  2E53 A;  4RHV 1;  4Y20 B;  4IGQ A;  5CNA A;  1LHN A;  2P6C A;  4CDQ C;  2WZE A;  5IW0 A;  4DZG A;  2KR2 A;  1V9U 3;  2OII A;  3ABZ A;  4LBO A;  3J8F 2;  1W0O A;  3O12 A;  4JHT A;  2VZ3 A;  1REF A;  4LBJ A;  1H6X A;  4ZS3 A;  5F3E A;  3PUH A;  3U07 A;  3VDB A;  2Z4F A;  3TWI A;  2LM3 A;  4PBP A;  5SV5 A;  2BBV A;  5CFC B;  3PUI A;  2J1T A;  4Y22 B;  2NP0 A;  1QOS A;  1AR9 2;  2ZGK A;  4FXK B;  1RUD 1;  4JGZ B;  3O14 A;  4GZ9 A;  1OPO A;  4DEQ A;  1VBC 3;  1URX A;  1UU5 A;  2NLR A;  3ZYF A;  3EB7 A;  3J8F 1;  4JRA A;  4CA9 A;  5FRE A;  1MZE A;  5FXZ A;  4SLI A;  1JU3 A;  4CP2 A;  2FDF A;  1OH3 A;  4FI9 A;  3ZX7 A;  3LPF A;  2VR4 A;  3HQU A;  4YZ5 A;  3I3D A;  1JBC A;  3HD8 B;  3E97 A;  3CEW A;  1OVS A;  4B3N A;  4E4D X;  2O14 A;  5FYI A;  4DXR A;  5KC5 A;  1FPN 2;  3ACH A;  4EJR A;  1B35 A;  1QXP A;  5FYM A;  3VHO A;  3KV5 A;  4YFZ A;  1Q8O A;  1ND2 C;  2RR1 1;  2W1Q A;  2ORX A;  5EWS A;  1KD7 A;  1UNB A;  3GNE A;  3ZXK A;  3FBY A;  4CU6 A;  4LHK A;  1XQN A;  4N9H A;  4YZ4 A;  2JE9 A;  1NA1 C;  3POW A;  4QKF A;  2VMH A;  3ITQ A;  4LBQ A;  4CEY C;  4BYY A;  3HBZ A;  1W8N A;  3PU8 A;  3GHN A;  3VZO A;  3CNA A;  3R6S A;  1FPN 1;  3AFG A;  4Q8K A;  2UWC A;  1SDD B;  2A70 A;  2BOJ A;  5FLJ A;  1AXY A;  3T4H B;  5C6C A;  1H1A A;  5EYX A;  3ES1 A;  5F5A A;  4AGR A;  3PVB B;  1WW7 A;  1PZ8 A;  2AGS A;  1AR8 2;  2FDG A;  1NOV A;  1QMJ A;  2HWB 3;  2QQN A;  1POV 3;  4YVS A;  4R52 A;  4S2G A;  4XC9 A;  4A41 A;  2XKO A;  1XND A;  3J4U H;  4IV3 A;  5GZF A;  3O1U A;  2CDO A;  1PO2 2;  1UCX A;  1WCQ A;  3GZT B;  4QX3 A;  3P1I A;  1XNB A;  5L73 A;  1BLZ A;  5T5L A;  1RUO A;  1VJ2 A;  4H7M A;  1DDL A;  1F9K A;  4QB2 A;  4N43 A;  1RUE 2;  1RUF 3;  1AR8 1;  1W6N A;  5FWJ A;  2FZ1 A;  2XDV A;  1JUH A;  2E9Q A;  2ZHK A;  4FOW A;  3SC7 X;  4EQV A;  4Q4W 2;  4BIS A;  2XLG A;  1ND3 A;  2OS2 A;  5FMO S;  3SH3 A;  1GNH A;  1D4M 1;  2PQS A;  2VAU A;  4QU1 A;  3H1W A;  4QX8 A;  4RFT 0;  2W9X A;  1O3Q A;  2G19 A;  3WXP A;  2VME A;  2GP5 A;  2O0O A;  1MVQ A;  1E5I A;  3VZL A;  4DMI A;  2I07 B;  1AR9 3;  4DNY A;  5JWP A;  1JOB A;  3PUA A;  4KGG A;  4XIO A;  1PVC 2;  4EWE A;  3UV9 A;  2ETE A;  3IDB B;  4ES9 A;  4TZD A;  3T1M A;  5G05 L;  2FZ2 A;  3AP4 A;  4XE9 A;  2C4X A;  4RGG A;  1FV3 A;  1KIT A;  1MEC 1;  1OLR A;  3K3N A;  4NWV A;  5IAV A;  4CSW A;  1DF0 A;  3MIC A;  4X6Q B;  3SHR A;  4AYU A;  5H9Q A;  4BLJ A;  3I49 A;  1PZ9 A;  2OW4 A;  5LW9 A;  1PVC 1;  1N1S A;  2ZGT A;  4AI2 A;  3GF6 A;  4PF5 A;  5GLU A;  3EJK A;  2A1X A;  4CZS A;  3J7L A;  3RMX A;  1H4H A;  4ARX A;  3LA7 A;  2W1W A;  1DQ2 A;  4GB3 3;  2V09 A;  5C8C B;  3VD5 A;  4N53 C;  5FK7 A;  5FYH A;  1VRH 1;  4ZZ5 A;  2ZHL A;  2FDH A;  1Q43 A;  2DCK A;  3WW2 A;  2WN2 A;  1NLR A;  1LNS A;  4Z8B A;  2HWD 2;  4Q26 A;  1UMH A;  2A3W A;  1GYK A;  1G6N A;  2XLA A;  2R0H A;  5LAS A;  3DEC A;  3GAL A;  4RQP B;  5HXV A;  1AL0 G;  4YW3 A;  1VBE 2;  5A3M A;  4CPB D;  5KHG A;  2WAA A;  1SBE A;  4IL7 A;  1W8F A;  5C3Q A;  3E1F 1;  5GJ6 A;  4L0P A;  4W65 A;  2Y6L A;  1RUI 2;  2HWD 1;  1MS9 A;  4C90 A;  5A3U A;  4RGK A;  1MQT C;  2P3I A;  1J58 A;  3D0J A;  5C9A A;  3LA2 A;  1PO2 3;  1RVF 2;  3RZJ A;  2ZAC A;  4TYS A;  3GJB A;  3U14 A;  1VBE 1;  2ID4 A;  2UY8 A;  2BGP A;  2WWJ A;  1WMX A;  4LO5 B;  5H9R A;  4EN9 B;  5JPN B;  5JZG A;  1JYI A;  2IVI B;  3WNX A;  1RUE 3;  2LRO A;  4AFA A;  4CXY A;  4QHZ A;  3VB9 A;  1J83 A;  1H9P A;  1AYM 3;  1YQ5 A;  5FUP A;  5FOJ B;  2D97 A;  4Q4W 3;  4Y5Z 0;  3SKV A;  5KR7 A;  5BYN A;  3OUJ A;  4CU9 A;  2I45 A;  2D40 A;  1RVF 1;  5LA1 A;  3DPR A;  3OEA A;  1XU1 A;  1ACC A;  1JI6 A;  5IWF A;  3RWK X;  4CDU C;  1VBA 2;  5FZC A;  4CXW A;  4QPG B;  4LKE A;  1HXS 2;  4D8M A;  3F2Z A;  4K1Z A;  3RWN A;  3WUC A;  4CUG A;  1W9W A;  3H1M A;  4YVW C;  2RV9 A;  1IPJ A;  5FY4 A;  5KXD A;  2ZX4 A;  4PLO A;  2D6P A;  4WBB A;  5JXJ A;  3CJI C;  4BU2 A;  3IWZ A;  2ZGL A;  1A78 A;  4WM8 B;  3MIF A;  4XFF A;  4Y20 A;  3ZYH A;  1EV1 1;  1AVB A;  1VBA 1;  2W95 A;  1YNA A;  4PLM A;  1YQ6 A;  1HXS 1;  4M3C E;  5CVR A;  3W59 A;  2ZZQ A;  4XJZ A;  1LOF A;  5JLV A;  5CFC A;  1W2U A;  4LKD A;  4Y22 A;  3AP7 A;  4JGZ A;  2GAU A;  3KHB A;  2ZGM A;  2OPK A;  1C57 A;  4XHX A;  5DXD A;  3RGB A;  1OFN A;  3AMM A;  1AXZ A;  3C7H A;  3HVD A;  3LGR A;  3BGA A;  2DTY A;  2E31 A;  1JHN A;  2VZQ A;  1RUC 2;  1SPP B;  2VUD A;  4FAH A;  2XML A;  1YFX A;  2CTV A;  5KBF A;  3M70 A;  1QQP 1;  2PLV 3;  5F5Q A;  2DBN A;  3ZKY A;  4QPI C;  3NAP B;  4GWN A;  4TTG A;  3N9M A;  3Q8F A;  1KDK A;  4FP3 A;  4PDW C;  1XYN A;  3AKS A;  4PI2 A;  2BOI A;  4PQQ A;  3WDY A;  2C24 A;  1OI6 A;  4CCK A;  1WCU A;  1OLM A;  1SHW B;  2BFU S;  2FCU A;  3FHI B;  4IEW A;  1RUC 1;  4MO3 M;  1Q8P A; 
#chains in the Genus database with same CATH homology
 3ORJ A;  4BQ4 A;  4A6S A;  4CPB D;  1UOJ A;  4LKF A;  1WZX A;  2KR2 A;  4AL9 A;  4LK7 A;  4CP9 B;  4LKE A;  2O14 A;  3ZYB A;  1GWL A;  5D21 A;  4YW7 A;  1W8U A;  4CPB A;  2Q1F A;  4BQ5 A;  3UT0 A;  1W8Z A;  2LRP A;  2JWP A;  4YW6 A;  1GWK A;  4LK6 A;  1L7L A;  2WYF A;  1WMX A;  1HN0 A;  2K46 A;  3ZYH A;  1W90 A;  1OKO A;  4CP9 A;  2LRO A;  1V0A A;  3ZYF A;  1W8W A;  2VXJ A;  1W8T A;  2C24 A;  1W9F A;  4BQ2 A;  3F95 A;  1WCU A;  4BQ3 A;  4LJH A;  4YWA A;  1GWM A;  1OH3 A;  4LKD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...