1ZRRA

Residual dipolar coupling refinement of acireductone dioxygenase from klebsiella
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
179
structure length
179
Chain Sequence
SALTIFSVKDPQNSLWHSTNAEEIQQQLNAKGVRFERWQADRDLGAAPTAETVIAAYQHAIDKLVAEKGYQSWDVISLRADNPQKEALREKFLNEHTHGEDEVRFFVEGAGLFCLHIGDEVFQVLCEKNDLISVPAHTPHWFDMGSEPNFTAIRIFDNPEGWIAQFTGDDIASAYPRLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E-2/E-2' protein
publication title A refined model for the structure of acireductone dioxygenase from Klebsiella ATCC 8724 incorporating residual dipolar couplings
pubmed doi rcsb
source organism Klebsiella oxytoca
molecule tags Oxidoreductase
total genus 22
structure length 179
sequence length 179
ec nomenclature ec 1.13.11.53: Acireductone dioxygenase (Ni(2+)-requiring).
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03079 ARD ARD/ARD' family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1zrrA00
4QX5A 3EBRA 1JUHA 3U0ZA 2ET1A 2V09A 3E5QA 3SCHA 3SXWA 3MZHA 3H7JA 5I8TA 2EVXA 3FWEA 5FLIA 4Q0QA 5D1IA 4OLLA 2UYBA 1LR5A 1O7FA 5BUVA 3RDIA 1XE8A 4XFHA 4L11A 3D82A 2VECA 3TNQA 3DV8A 2XL9A 3I7DA 2BGCA 3EQEA 2K0GA 5CVRA 3E97A 2PAEA 1OMIA 3IDBB 2QDRA 4LA2A 3H3ZA 2GC3A 3ACLA 5I93A 4XFAA 3IBMA 2BYVE 1SFNA 3B02A 3H9AA 5I0RA 5LEJA 5E16A 3IDCB 3EJKA 4AXOA 1DZRA 4F7ZA 5JR7B 4RD7A 2CGPA 3UKVA 2IXJA 1FXZA 4XF3A 5FQ0B 3H1YA 3LWCA 3LOIA 1J3QA 2XLFA 4EWAA 2E9QA 4IEXA 2XLAA 4BYYA 5FPXA 1CAXB 2CV6A 3BCWA 3QOPA 3M3IA 3WW2A 2XKPA 4QMAA 3HIFA 3QACA 2B8MA 1I6XA 3UKNA 4AVBA 4ZU7A 1I5ZA 4LA3A 5FLHA 1O3SA 4IETA 4R8HA 2Q4SA 3NL1A 1ZRCA 4Q0VA 3H1WA 1ZZCA 2IXCA 4UBHA 4HLTA 4LUMA 1ZREA 1XRUA 3HT1A 2H6BA 4FAGA 2IC1A 2HKXA 5KHHA 2QCSB 1UD1A 1VP6A 3OTFA 1CAUB 2QJVA 1QY4A 1L3JA 4IEUA 4UBGA 3CF6E 2O8QA 4KWJA 4QGNA 4BHPA 4TLFA 2ET7A 4IEPA 1RTVA 3RPQA 1YHFA 3RYPA 4AQ6A 1J58A 4KU7A 1X82A 1TQ5A 4R52A 4HMZA 1YFXA 4I0AA 1OFNA 2Z2SB 3KMHA 4J1XA 4XF1A 5JSOA 2ZCWA 1V70A 5BV6A 1DGRA 1EP0A 3JZVA 2Y0OA 1CAWA 1Q43A 1RGSA 4HZFA 3PNAA 4ONUA 1RUOA 4Z82A 2XHKA 4MH0E 4MGIE 3U11A 1FI2A 4DINB 2XGXA 2B5HA 2OPKA 1H1IA 1J1LA 2HJIA 5BPXA 5LEKA 4MGYE 5K8SA 4IERA 1OI6A 3CO2A 3M70A 2XKOA 4IESA 2Q0AA 2ETEA 1GQHA 3FX3A 3FE5A 3DL3A 3NSTA 2WC2A 1CGPA 3H7YA 2UY9A 4XFIA 1Q3EA 4NVPA 4D7SA 3SCFA 1O5UA 2ATFA 5KHIA 4O9EA 4PIXA 4H7LA 4LUKA 5I8YA 4X6QB 4IEVA 3CLPA 4IEOA 4QGMA 1EYBA 1NZCA 2QVSB 3C3VA 2IXLA 1NE4A 3GYDA 1X8MA 1LB2A 3SMHA 2N7GA 5AVPA 3O14A 3HT2A 4AVAA 5J7MA 4Z07A 3OF1A 4QM9A 3S0MA 4MV2A 1PMIA 4PIZA 1J3PA 3MPBA 4YYOA 4IEYA 3GBFA 1VJ2A 4HBNA 4Q0SA 4UXAA 1YFUA 3E6CC 4L2NA 4JV4A 4XEZA 1O3QA 1CAVA 4I0BA 3D0JA 2OA2A 1Q5OA 4E2GA 3LA3A 2OYZA 1QXRA 4ORFA 4F8AA 4ZU5A 1DGWA 2PQQA 2GC1A 5FLJA 5HI0A 2BNNA 4MGZE 2H6CA 2O1QA 2D40A 3LAGA 3EO6A 4I2OA 5C8WA 4KU8A 4P9GA 2EA7A 1G6NA 1X7NA 2PHLA 1CAUA 5LRRA 5BY5A 1J3RA 2CAUA 3E6BA 3H1MA 2H0VA 4KWLA 1QWRA 3L2HA 2MNGA 3WW3A 1UCXA 4PIYA 1YLLA 2IXHA 3H50A 4MZUA 5E1RA 5F1RA 5KHGA 2BNOA 5CU1A 4XFBA 1WGPA 4AVCA 4WZCA 1FT9A 5I8SA 4E2SA 4A2UA 3I59A 3NW4A 2PAMA 4YRDA 5I0TA 3OGJA 3NVCA 3PLQA 4LTAA 2BNMA 1SEFA 4I09A 2F4PA 3ETQA 5BXXA 3CJXA 4XF4A 1H1MA 4MX3A 4HN0A 2ZKLA 4HVQA 3LA2A 3E5XA 1LRHA 4META 1ZZ9A 1UPIA 4MGKE 4JVAA 2OZ6A 3CEWA 3BALA 3SHRA 2PFWA 1YWKA 4I02A 1J59A 1ZZ7A 2Q1ZB 4KL1A 2PA7A 3D0SA 2P17A 4WVZA 5EFUA 3BPZA 3E5UA 3OCPA 1PM7A 1U12A 5J48A 3RNSA 2PYTA 4KWKA 4BH9A 1NE6A 3G7DA 4Q0PA 4XFCA 4D7TA 3H3UA 4YNIA 3U10A 1YFYA 5CADA 3KGZA 4PJYA 1UIJA 2OZJA 1EY2A 4OFGA 2QNKA 3WW4A 1ZVFA 5KHJA 4FT8A 1LKNA 2EAAA 4ZU4A 3RZZA 1RC6A 2IXIA 4EV0A 4WBBA 3ELNA 1OD5A 4FBFA 1ZZ6A 3DN7A 4JTOA 1RL3A 2DCTA 1WA4A 4YSFA 1CX4A 4LEJA 4HSJA 4MUVA 4CYDA 4FAHA 1GQGA 1DZTA 4J1WA 1SQ4A 3FHIB 1CAWB 4QM8A 3FFQA 5KBFA 1YFWA 4HN1A 5JSRA 1Y9QA 1O5LA 2Z69A 5FQ0A 1QXJA 4IEQA 4XF0A 1O3RA 2GZWA 2D5HA 2D93A 1CAXA 1ZZBA 4BIFA 1NXMA 5FDBA 3BB6A 5I0UA 2GU9A 4N9IA 3TNPB 2MPFA 3MYXA 3PVBB 3KCCA 1ZZ8A 3RYKA 2VQAA 4QGLA 1O4TA 3LA7A 3VHRA 1XE7A 1EPZA 2GH2A 4LLOA 4AQ2A 3ES1A 4XF9A 2GC2A 2PAKA 3SCGA 2IXKA 5T3NA 1IPJA 3USSA 3NKTA 3ST7A 3IIAA 3EHKA 2VPVA 5JCTA 4Q0UA 4I3PA 4QXKA 4HSLA 4X6RB 3KSCA 4K8FA 3RYRA 2B9UA 3UKTA 5FPZA 1Y3TA 4EWDA 1CAVB 3KGLA 2GAUA 1NYWA 2D5FA 2GC0A 2MHFA 3NJZA 1ZRRA 2FQPA 1RUNA 1ZRDA 5JAXA 1VR3A 4EROA 2XL7A 3N4MA 4IEWA 3FZ3A 3HQXA 1IPKA 4LULA 4XFFA 5J3UA 3I54A 3ES4A 3OD0A 4N9HA 5EZWA 4XETA 3ROUA 2KXLA 1UIKA 2C0ZA 1ZRFA 2PTMA 2XLGA 2CAVA 3E6DA 3WW1A 3FJSA 3LZZA 2WFPA 2I45A 5KHKA 4IEZA 1X8EA 3DKWA 4Q29A 1ZX5A 3BU7A 2UYAA 2K9ZA 2PHDA 1ZNPA 4XFGA 2UY8A 4B29A 3S7IA 3I59B 4YARA 5I0SA 3MDPA 2BEOA 5JSPA 4HVRA 5FCCA 3S7EA 4GULA 3R6SA 4I01A 5I91A 4HVOA 1WLTA 4JTNA 5LRSA 1O3TA 3ZDSA 1YUDA 1UW8A 5C6CA 2FMYA 4O9GA 4E2QA 2Q30A 4EWEA 1HW5A 3H8UA 3CL1A 3IWZA
chains in the Genus database with same CATH superfamily
1W9TA 3S57A 4G4FA 2W1UA 1NLQA 4N53A 2VVFA 2JE7A 1JUHA 2W1QA 4QPYA 3V64A 3VZLA 3CBNA 4CUBA 4D7YA 5SV5A 3PL0A 1HJFA 1GR3A 2ZX0A 3AMNA 1HJGA 1UPSA 3JBG1 2CNAA 1YRZA 1RYYA 1WW6A 2PHXA 2HEYF 4Q1RA 3DXTA 3MZHA 3ZLIA 1ZYBA 1REDA 2WUHA 5FYZA 2EVXA 4RQPC 5C5TA 2TUNA 2VMIA 5LA9A 4Q0QA 4OLLA 2UYBA 3Q9OA 5T54A 2ZGSA 1W3VA 4ZPIA 1YEWA 4HPKA 3VZOA 5DDJ2 4AWDA 1BJQA 2JDKA 2OVUA 1S0IA 1JYNA 4LO4B 5FRAA 5JR2A 3D82A 2VECA 3TNQA 3DV8A 4S2DA 1OPMA 3OGGA 3WDTA 3URFA 2VQTA 2Y6JA 2K0GA 5CVRA 3E97A 1OMIA 5FYYA 3ZFGB 2RDRA 5F9TA 3AXEA 3T0AA 4PQ9A 3JUUA 3AP5A 3GZUC 4HL0A 2D44A 2WAAA 1KGYA 4LA2A 5I93A 4PDWC 1FPN2 2MEV1 4Q4Y2 4LNVA 2Z42A 4OQ9A 3IDEA 1K5JA 3BTXA 2QQJA 4RGKA 3GDBA 3VD3A 2D3SA 4FPJA 4MHUA 3AL5A 5A6YA 4UFLA 1WLCA 2R073 1QJX2 4R9BA 4CA9A 1ST8A 2Q1FA 3AZYA 1W6MB 1TE1B 3X29B 1EAH1 4K21A 5BNOC 3ILNA 1H6YA 1TNFA 2ZAHA 5FQ0B 2R042 3WQ0A 4Z2AA 1IQDC 4L8QA 4S2FA 5DAWA 2E7TA 1L7LA 3C7FA 1HRI3 3NAPB 4EWAA 1NQDA 1SACA 1VBC1 4QHOA 1AR61 4M01A 4CSWA 3WW2A 1HRV1 4LBJA 3UKNA 2CL2A 2Y6KA 3VBOB 3ZYRA 3WDXA 3DEMA 3LKJA 1W9SA 3AVSA 3AX4A 5FYHA 3M7AA 2UWCA 3LDRA 5T5OA 4XJWA 5FUNA 2Z5WA 3WNNA 2Q4SA 3V0BB 5FWEA 3ZSLA 1ZZCA 1F31A 2IXCA 4UBHA 3KF3A 3ZFEB 2WA4A 3AVRA 2XH6A 3OBTA 4FI9A 2D6MA 3R05A 3S5AA 3HT1A 4V1PA 4B4QA 4NJ4A 4FAGA 3WF0A 1TMF2 2VUCA 3MW2A 1OLRA 4XTPA 3CHXA 4YZ1A 1VP6A 4K20A 1N3QA 1SFPA 3PTYA 4Q4X3 4XQDA 1XNCA 2DBIA 2QJVA 2ZGRA 2Y33A 1QY4A 1L3JA 2ZXQA 3GBGA 4UBGA 4W6XA 1SPPA 3POEA 2A3YA 3HVDA 4Y4RA 3QD6A 5TSWA 4KWJA 1X9TA 4TLFA 1QJEA 2DCKA 2GP3A 2VMDA 2PLV1 4CCJA 5GM0A 3VL8A 4IEPA 2Y6HA 3K77A 2WL1A 3VD7A 4FTEA 4DPNA 4PCRA 5DAQA 5BYNA 1UN1A 4NRPA 5IT6A 5JLVA 1WW5A 3ACIA 3RYPA 1N1YA 1WZXA 4Q5OA 4V2VA 5F5AA 4K1YA 4MHRA 1GV9A 4LKEA 3ZN5A 1TQ5A 1S4CA 5F3EA 1YFXA 5FYTA 3BTAA 2XBO3 3AZVA 1LENA 3MV11 1JODA 5LA2A 3WNLA 3D8CA 3VL9A 4AFBA 3GF6A 1DGRA 1MR5A 3MW3A 3SEPA 2X10A 1XQNA 1M06G 2Q8OA 2EIEA 1LULA 2XHNA 3J26N 2GDFA 2Y0OA 1BQPA 1CAWA 2YPJA 5K0UA 4CP1A 1DDLA 1D4M2 3I4IA 1RUH1 2Y6FA 5F39A 1RUOA 1Z7S3 1CIWA 1ULOA 4INDA 2WJSA 1PX3A 4MH0E 1VAKA 1FMD3 4OHVA 3NJVA 3J7NA 3O7OA 1PK6B 1PIV3 3KHBA 3U11A 2G9FA 1NCQC 4OMCA 2C5DA 3DPRC 2ZJCA 1PGL2 1RUI1 2V4VA 1DQ6A 2OPKA 1AYM2 4YGBA 1XSQA 3RZMA 4LBOA 5FUPA 4GQ7A 2W87A 3JXSA 4AFCA 2RR12 2ZACA 1UOJA 4CCLA 2RS32 1ULCA 3NSTA 5C3OA 2DVAA 3POBA 5IAVA 5F3CA 1NQJA 3PTRB 3LDBA 2UY9A 3JCIA 5HCHA 1Q3EA 4QQ2A 2ADEA 4IV1B 1O5UA 1VALA 2W94A 3PUQA 4FFFA 4LITA 3CMGA 4PIXA 4ATEA 1N47A 1OLMA 4B8EA 5BNNC 5I8YA 1JZ4A 1JI6A 4X6QB 4FTSA 2QQKA 4GALA 1RUG3 4XJ8A 3T2TA 1NZCA 2CU5A 4YVSB 2FDJA 3VBUB 1AYN1 4QX3A 1ASJ3 2QQLA 3OUJA 1NE4A 3GYDA 1LB2A 3ZYBA 2FBEA 5AC91 5J1XA 2DURA 4HFSA 2J1RA 1CD3G 3DXUA 5EYXA 5A3WA 4CP0A 5J7MA 3OF1A 3PDQA 3MLJA 2ERFA 4PBOA 4PIZA 1JTZX 4BQ4A 1RUF3 2ZGLA 1LGNA 2WN3A 2VCBA 4YVWA 3BIWE 2R1BA 4IEYA 1D2QA 3E6CC 4FO9A 1G8WA 3C2UA 4OHYA 1ZBA3 1EUTA 4JV4A 4CDUC 2XVGA 3ZOIA 5KXCA 1AZDA 5JXIA 4I0BA 2OA2A 2Q8DA 1QU0A 1PGW1 2V4AA 4XBLA 4E2GA 5CFCC 3A0KA 3LA3A 1ZM1A 3VHOA 2OYZA 1GUIA 3PURA 1LODA 4ZU5A 4YZ5A 1W03A 2Q1MA 2WO7A 2ZGNA 3SH5A 5GLUA 3UJOA 2G4IA 4EYUA 5K9YA 1WA6X 4MGZE 5FO7B 3T1MA 3WEZA 2H6CA 3WD5A 3AMPA 1GBGA 1QXPA 4FQ4A 4E4DX 4YG6A 1QHDA 1W8ZA 5GLTA 5L7OA 4KU8A 3KM5A 1E5HA 1DZQA 2BWCA 2P2KA 1R1A1 3HR9A 2RV9A 5IW0A 2E63A 3FLRA 4FPGA 3W59A 1H4HA 5DG2A 5FO8B 2YGMA 4I30A 5FOJB 1J3RA 3B9CA 1SCRA 5FJHA 1H2MA 1KQRA 3OUIA 3Q8FA 4JGYA 4O7XA 3LFIA 2ZMKA 1LOCA 1GNHA 1PO21 2W91A 2R061 2A6VA 4MXWB 1S2BA 1XNAA 3IPVB 2HEVF 3KV4A 1YQ5A 3LGRA 3OEBA 4QKBA 1SFYA 3SH3A 2VCCA 1CX1A 1VE0A 4DEVA 4MZUA 4KBBA 4Y24A 5E1RA 5EJZB 4CDWB 4QDSA 1U5IA 3KLSA 2DUQA 1W8UA 2PXJA 2VW0A 4AVCA 1SBDA 1C5IA 4A2UA 1G9BA 2TBVA 5FY1A 3SKVA 4XQ4A 1OVSA 4YRDA 3J8F1 4BK5A 3W20A 1WCDJ 2XUEA 3LSEA 3AFKA 3PLQA 1SEFA 4P9LA 2R7EB 1LOFA 2O8OA 3H42B 3ZO0B 3ZSMA 2AACA 1HX6A 2VXRA 3CJXA 1H1MA 2D6PA 4C8DA 4UW6A 4HKOA 1W6NB 2W47A 4FVVA 1UY3A 1JYVA 4MX3A 1YJKA 3GHNA 4GJYA 4HVQA 4MGTA 3LA2A 4AHWA 4YG3A 1NT0A 2RS11 4QB1A 2W46A 3B00A 4RA0A 3CEWA 1OH3A 3VKMA 3MIHA 1OOPA 1YWKA 1XU2A 5JMCA 1J59A 2Q1ZB 1CZTA 4KL1A 3K48A 3VBSC 2XJSA 2PA7A 2VUJA 4AI1A 3BOWA 1QJU3 4L99A 1BMV2 1RB8G 2VXJA 1FAYA 2BTVC 4YW7A 3OCPA 4LBLA 1PM7A 1IKQA 3VB9A 3OY8B 1AR92 2Q5TA 4GWMA 1RHI2 2VZPA 3RNSA 3J9SA 4KWKA 2XVLA 4BH9A 3G7DA 5CFDB 4Q0PA 4FSJA 4DEQA 4DXZA 3T4HB 4D7TA 2HWF3 4ISRA 2QE3A 1Q8QA 1YFYA 4K3UA 1V6JA 1GNYA 5T50A 4N43C 2HWD1 5FAXA 4M0NA 3AXDA 5KHJA 1JYWA 3VKNA 3MF6A 5A3PA 1HN1A 3O12A 4JDMA 1NA1C 1QNYA 3WV6A 1ZA7A 2IXIA 4P08A 1R091 4FPHA 1UL9A 4K7JA 1KDMA 2RG4A 1MQTB 4CCOA 5AFBA 1JOPA 3ZFGA 1AR73 2ZGQA 3OD4A 2VBPA 4L0PA 1HKDA 5C3SA 2DVDA 4RR3B 5FZBA 1VAMA 1S0JA 2D97A 1W2UA 4MUVA 1VB2A 1HXS1 2GMMA 1DZTA 3WZ1A 1DGRN 3ZXKA 4QQHA 1RUJ1 2VZQA 4XC9A 4YGDA 1NLSA 4O61A 1YFWA 4HN1A 4ASLA 1W6MA 4COYA 3BODA 3RZGA 2R072 2Z79A 1NY72 1O5LA 2Z69A 3ZKYA 4GAZA 5FQ0A 1QXJA 4IEQA 1UYYA 2W92A 4H2AA 4NMIA 1W3XA 1GICA 2D93A 3LFMA 2H0BA 2HWE1 1QOTA 2VZ1A 2ZABA 2NP0A 1UOBA 1NXD1 1WWYA 4XYXA 4AR2A 2GU9A 2RE9A 4HKLA 2JG8C 1HRI2 1S0BA 2WO2A 3TNPB 3VBOA 4AEJA 3VD5A 4BE3A 1XSRA 4IE7A 3PUHA 4TN7A 5EHDA 4E4ZA 3NWKA 2WQ8A 3D5OA 3LA7A 3V0BA 1X33A 5IWFA 3RZZA 2BPA2 4OYUA 2GH2A 2VE1A 2Y6GA 5GZEA 5DDJ3 2ZX3A 3LEMA 4XUNA 5LY2A 3ZFEA 3AMMA 3GZEA 1PMJX 2A71A 1J83A 1CIYA 1Q8SA 3T2QA 1OUSA 2ZEWA 3P3NA 1VLNA 4ZZ5A 1KFUL 2V73A 3IIAA 1URXA 2AC1A 3EHKA 3BPSA 1RUD1 5CBLA 1QEXA 3ZXJA 2EIBA 3Q8CA 4E9KA 5JCTA 2JENA 4LXLA 5EJ3A 3OBRA 2EXHA 1SLBA 5DUUA 5A7NA 1FPN3 4LORA 4WM7C 1ODNA 4LBNA 5FZFA 4Q4Y3 3UKTA 1HB3A 3L2YA 3MV01 2TNFA 1Y3TA 5LY1A 1F5FA 1QJX3 3DYMA 3WNOA 4LPLA 1WUVA 3BOPA 3VBRC 2D5FA 3ALQA 4QX2A 1UF2C 1V9U2 5FP9A 3AKRA 4AEDB 1K5MC 3GJBA 5LZ6A 5F3GA 1RUNA 2CYFA 3HWJA 4EJRA 4ZXKA 5JAXA 1VR3A 4XXAA 4LBKA 4EZHA 2XBO2 4FFGA 1KRIA 3PIGA 1B35C 1ENQA 1H8VA 1ALYA 3KD4A 5IVYA 1IPKA 2QBXA 2GP5A 4LULA 3DCQA 1JZ3A 3M3OA 4Y26A 1YIFA 4URTA 2BRTA 2LW8A 3HPNA 3MICA 4JDNA 3ROUA 4OQ8A 1PK6A 1L7QA 1UY2A 2YPDA 4CCKA 1AL0G 2QQUA 4GWNA 4SBVA 2V72A 2RM21 2RDQA 1VBB2 2CAVA 1NCRC 2J7MA 4IV3C 2HYXA 3RS6A 1XE0A 2WZEA 1UMZA 5C4WA 5LCWL 4PLMA 2J1UA 1NKGA 3MEPA 3BI3A 4XIOA 1D2SA 1QDCA 1ONAA 3WNMA 4IW3A 1T6GC 3M3CA 3BU7A 5JZGB 1KS5A 1C57A 2AYHA 5DAPA 1ZNPA 2ZGUA 3ZXFA 4YZ2A 2D3PA 4JKKA 4A4AA 4IV1A 5A7OA 4BXFA 4CDXC 4Q4V1 2Y60A 5F37A 3AP4A 5A6ZA 3ZR5A 4LKSA 5FXWA 1MVQA 2DV9A 3MDPA 4XE9A 5I0SA 1ND2B 3UK9A 1ULEA 2JE9A 4HVRA 4XIKA 4YVSA 3S7EA 3VBUA 3BIEA 2QFEA 4GULA 3JQWA 2VOXA 3POYA 5FBJA 1RUG2 1N1SA 4JTNA 2A70A 2WN2A 4YG0A 5LRSA 5D2AA 1MS5A 3ZDSA 2JX9A 3VUOA 5HXMA 2A5ZA 4K9SA 4HK8A 4WM8B 1JHNA 1S2KA 3VBHC 4JQRA 2FMYA 3DGTA 1W8OA 2Q8EA 5JXHA 1BEV1 4Y1VA 4N7IA 4E2QA 1TZOA 1IPSA 4DIQA 2A6YA 3IWZA 4LMFA 2LALA 1D4M3 3EBRA 3QCWA 3U0ZA 4XW3A 1RUC2 2V09A 4L9BA 4KH9A 4D3WA 3K3NA 4CEWB 1JUIA 1UAIA 4LR4A 1PVC1 3SCHA 1TG7A 3M4FA 2CHHA 3W9AA 2WIIB 1K45A 1G86A 3D3AA 3MLLA 1UY1A 3H7JA 4LO8A 5FYCA 1RMU1 1AYM3 3RMXA 5I8TA 4A41A 2DVGA 3I49A 4BXSV 2RR13 4E8DA 4IL7A 1S55A 1LR5A 1SDDB 1S2EA 2UU8A 5BUVA 4P9IA 1POV1 5IUQA 1XE8A 1H6XA 5FYVA 4L11A 1SHWB 2XL9A 1H0BA 5KWRA 2WNEA 3EQEA 4TSVA 1ACCA 4EN0A 3POJA 3R0RA 4N53C 1Q8VA 5CNAA 1XNDA 4AGGA 1MEC2 2C9KA 2QDRA 4PI0A 1SZBA 1VBE1 5FZMA 3IAQA 4MXWA 3IMMA 1FOD3 3H3ZA 2GC3A 1JZ7A 3N35A 1LU1A 4NIAA 4XFAA 1ULFA 1VBA1 4GXLA 2BYVE 4RGGA 4A7ZA 1SFNA 1F5JA 2ZHNA 1DYOA 4CDWA 2D6KA 3WDVA 1Q8PA 2FMDA 3J7LA 5JXGA 5JUVA 3H9AA 5I0RA 2V5YA 3AP9A 4CDQB 4DXSA 4FTBA 1DZRA 2W3JA 3WG4A 5F8PA 1COV2 4COWA 3ZXLA 5CKMA 3WP5A 2OIIA 4RD7A 4XMAA 2JG9B 3C7OA 2HWC1 2CSGA 3O1UA 1XYOA 1VBD1 3H1YA 3SISA 1W6NA 2XLFA 1AL21 2E9QA 4IEXA 4BYYA 5LBCA 5A3MA 5F6LB 1CAXB 3QOPA 3M3IA 3ZN4A 4ISQA 4QMAA 4ZU7A 1I6XA 5BNOB 1XC6A 3WF3A 1HV0A 1O3SA 1R081 2Y38A 3MIDA 3I3DA 2Q8CA 4UW5A 3TEZA 1GOGA 3LEGA 3NL1A 5FV3A 1ND3A 1GZ9A 3H1WA 1H4GA 1LOAA 4Q0VA 4XQWA 1C1LA 2HWB2 5CG9A 1XRUA 4CEYC 3ZYHA 1B09A 4L97A 3ZFFB 4A3ZA 5K4LA 4ASKA 5ACA1 2HKXA 4LBQB 3ZXEA 1XNKA 4EN8B 5A6XA 1QJU2 2DUPA 3OTFA 5CFDA 2P34A 2RMU1 4XHBA 5H9RA 2JDAA 4XCAA 4YW4A 4R9CA 4XHXA 4QGNA 3KF5A 3N9QA 4QPGB 1JZ8A 5C33A 5FZ4A 3KQ4B 4HOOA 3NV2A 1JZ2A 1G7YA 2L9LA 4H55A 2VL4A 5JPMB 3RPQA 3WNKA 4QWNA 5ISLA 5CYYA 1YHFA 3JD71 1DCSA 1J58A 4KU7A 1OQEA 4XABA 1MQTA 4YW6A 4JX0A 3JBG2 4HMZA 4R52A 5GKAC 4Z8BA 1S0FA 2Y8KA 4I0AA 1OFNA 1JH5A 3KMHA 4XF1A 4MOAA 3U37A 4BQYA 1UWWA 2ZCWA 3U78A 4ZHNA 3PMSA 4RR3A 1AR72 3T08A 5F7UA 1RIRA 4XOGA 5HCAA 3ON7A 5FZIA 5L9RA 1XJAA 4UW4A 1V6LA 1RGSA 2OW4A 4OULA 4Y5Z0 3PNAA 1H9WA 1DYPA 1F35A 1W8TA 2VNVA 1W90A 2XHKA 4AL9A 4MGIE 1CVNA 3NV4A 3BYWA 2RVAA 3M1HA 4XILA 2WNUC 4U36A 1OOPB 1F4AA 5CZKA 2EIGA 1U5ZA 5IYYA 2B5HA 2WNOA 4MGSA 1QJZA 5BPXA 5K8SA 1AR93 2A3WA 1RHI3 1A78A 2MEV2 3KCXA 3CO2A 3M70A 1QQP1 3Q8EA 4IESA 1RVF3 3SNMA 2Q0AA 3OYWB 4JHZA 1GQHA 1CZSA 3FX3A 4QXCA 2P6CA 5IJRA 3UJQA 3PVNA 4DFSA 1CGPA 1W39A 1ZBE1 4AEKA 2FHRA 1OKOA 3THCA 2BBVA 3SCFA 2ATFA 2DCYA 2WQ4A 2NN8A 4GMP1 4QQLA 3ZYPA 3N7JA 4NR1A 5K0UC 4O9EA 1EAH2 1O4ZA 4SLIA 4H7LA 2GALA 4W65A 4XUOA 4DXTA 2B45X 1H8TB 5C5UA 5IFTA 5FTTC 2QVSB 3C3VA 1UX6A 2IXLA 4B1MA 1TME1 1REEA 3APBA 2VNOA 4MADA 5LATA 4D0QA 3H8RA 2WSUA 1AR62 2WT1A 3BGAA 1STMA 3HT2A 5DZGA 4RHV2 4N90A 2P3JA 4COZA 5A70A 1TNRA 3S0MA 4QU1A 2KD7A 2P4EA 1J3PA 1QJFA 4NIIA 4YZ3A 3IKWA 3B7MA 3VD4A 1VJ2A 4A6SA 1YFUA 2VULA 3I3EA 4MVTA 1EV13 4L2NA 4J25A 2YBKA 1FATA 1JU4A 1MZ6A 3GCWA 5FBZA 3AKPA 4A6OA 3D0JA 4PF5A 1YQCA 2XUMA 4W6YA 4A42A 3WDWA 1NOVA 2W9XA 1QF3A 1W2NA 4KI5M 4AEDA 1OPOA 1JYCA 1BBT1 4QX1A 3ZN6B 4ORFA 4BJ0A 4XDPA 3B93A 5FY0A 1DGWA 4LO7A 2PQQA 4QX0A 5FLJA 5FY9A 1UMIA 4LK7A 5F6KA 1OF3A 1AXYA 5M0TA 2BERA 4ZS3A 2PLV2 4I2OA 4OHXA 2UWBA 5F5QA 2XJPA 4QD2A 5C8WA 5T55A 4YVWC 4P9GA 4WVMB 1GZWB 1HLCA 1DYKA 2ZGOA 4KMQA 4OUEA 1C4RA 2RS51 2VOKA 2WSVA 2PHLA 3NNMA 1CAUA 4BA6A 4BQ1A 3E6BA 1OVPA 3ENRA 3FLPA 1LEDA 1GOHA 1QWRA 4KWLA 1XNTA 1GU3A 2MNGA 4U2AA 5GALA 1PGSA 5HCFA 4XXPA 3LEKA 1BVVA 4XCBA 3LEIA 3H50A 3MIGA 4ES8A 5KHGA 5JZGA 1LU2A 5CU1A 2JKXA 3AYDA 2R0HA 2DCZA 3RMYA 1NX9A 3FMGA 1FT9A 3HN1A 2JXAA 5I8SA 2P3IA 2ZGMA 4E4HA 3TN91 1RUH2 5FZ8A 1F2NA 1V6OA 2P6HA 5I0TA 1P8JA 2RJKA 4CU6A 5I0DA 1ND2A 2F4PA 2ZHMA 3WCSA 3V0AB 3HNMA 1RUI2 2VGDA 4OVEA 5FP4A 2DUOA 1V9U3 4JGYC 2ORXA 5HXVA 4MLOA 3GJAA 3TBDA 4P02B 2G1MA 2ZKLA 1OA4A 1VMFA 4R9DA 2VCMA 4WM8A 2DU0A 3VBFA 1LRHA 3HNYM 4META 2UWAA 1POV0 1UPIA 3K4AA 5DQ0A 2WA3A 3SHRA 2OXBA 5FZCA 2P3KA 2PFWA 2JDHA 2R041 2X05A 3ZR6A 2R1DA 4K40A 3A23A 2YBPA 3GZAA 4XAEA 5FIXA 1LGCA 2QQPA 1UZ0A 3U14A 3WNPA 1UMHA 2E33A 2VD7A 3WF1A 4CEWA 2VBDA 1AYN2 2VMCA 4URAA 2RDSA 2W1SA 1BK1A 4YFWA 1LOFC 2WZR1 1D0GA 3IT8A 2PYTA 5AC92 1WD4A 1NE6A 2X5IB 1UZWA 1VMJA 5A3UA 1VBB3 2JDUA 2VUDA 4YWAA 2Y26A 1X9PA 3WP3A 3H0OA 1GANA 1UIJA 4E27A 4Y1YA 3WG3A 4S2HA 4QHBA 4XMIA 3M3QA 1TMF1 2VZSA 4QX8A 4Q4W1 5C4WB 3CKHA 1Q8OA 3K3OA 1W9FA 4LBMA 3BUCA 2VZUA 4CCDA 1V6KA 3B5LB 1PGW2 3WG1A 1RC6A 4NIGA 4P00B 4EV0A 5C3RA 3WXPA 5FYMA 3UGHA 4KWUA 4ZKTB 3ELNA 1OD5A 4GH4B 2TEPA 3K75B 4BDVB 1ZZ6A 3TWIA 3JB4C 1F9KA 3DN7A 2WKKA 1LCLA 3ORJA 5DZEA 4CCNA 1CX4A 1UYZA 2WO3A 3UGGA 4HSJA 4E4SA 5FWJA 2R30A 1G9CA 1FOD2 4IQPA 4J1WA 5JVVA 3S30A 3W21A 3I2JA 3ZXAC 4LLFA 2D7FA 3ILRA 4CDQA 1MS1A 3FHIB 5A6QA 2JWPA 4B1LA 1HQLA 4LHLA 4JAAA 1R1A2 4QM8A 4R4XA 4JHTA 4OHZA 4A7KA 4DS0A 3GNEA 2VVEA 1VAVA 4M4RA 4NPMA 1OF4A 3A4UA 2D3RA 2JG9A 3UETA 3D6EA 4FPKA 5JSRA 1O91A 5L36A 4YFZA 2OS2A 4LT5A 2UURA 4NAMA 4OUSA 1RUC3 4QKFA 1UZVA 1GSLA 2GZWA 1VRH1 2R062 1VIWB 4AI0A 1CAXA 1ZRIA 4RL7A 3ZFGC 2C4XA 4CZSA 1NXMA 1UY4A 3BB6A 1H30A 3LQCA 5BNOA 4N9IA 3VDBA 3AB0A 4JKLA 2NZ9A 2OUJA 1GWMA 1R1ZA 1ZZ8A 1LJ7A 2VQAA 4JGZB 1CQ9A 3GBWA 3VHRA 3MW4A 5CEHA 1EPZA 4DQAA 4NWVA 1PGL1 1H1AA 4AQ2A 1N1TA 2XVKA 1XBFA 2OUHA 3ES1A 3WY6A 3ZFFA 4BQWA 1Z0HA 3WNXA 1AR81 2PAKA 1JU3A 3CJIB 1WCSA 3JB8A 1OQ1A 4LBQA 5T3NA 4LJHA 1IPJA 1PZ8A 1UZZA 1LGBA 2JIJA 1GP4A 2PHUA 4QQPA 2ARCA 2RS31 1QH7A 1E5RA 3WDYA 2G9ZA 1MEC3 4W4ZA 1AUYA 2PHRA 4OUMA 3S6PA 2FZ2A 4LOSA 3NAPC 1I3HA 2VPVA 1FV3A 2Y64A 3BU0A 2YHJA 4I3PA 1W9YA 4JRAA 2ZGKA 4QXKA 3SEEA 3T1LA 4Q8KA 4NAOA 1I9RA 1QKQA 5LW9A 4QPGA 2B9UA 2RS12 3VBOC 3MIEA 3POWA 4M3CF 4NRQA 2WNVB 5FYBA 2RJLA 3DECA 4YM0A 5FPZA 3THTA 2W2IA 3SQOA 3TYJA 1S0DA 2YROA 4EWDA 2R0FA 1CAVB 1VPHA 1CZVA 4BM8A 1LHWA 2K46A 3OBZA 3ZFEC 1COV3 1YQ6A 4C91A 4XPVA 4UF0B 1XXNA 2ZX1A 3V65A 2E6VA 2VOVA 1QJY1 2FQPA 5CIRA 3HBZA 5JOYA 3N9NA 5FMOS 4Y5TA 1GLHA 2GSYA 2XL7A 4PI2A 3IM0A 2ZEXA 4IEWA 3ZMOA 5GLZA 2JJ6A 2HWD2 3HD8B 3HOBA 3LPFA 1RXGA 3UESA 2IZWA 5F2WA 3I54A 4GMP0 2B4KA 3OD0A 5EZWA 1FX5A 5J09A 1XOYA 2WFF1 5JMOA 4KGGA 1YQ8A 1MS0A 4S2GA 4COUA 4QKNA 3NJXA 2HWB3 2KXLA 4B4PA 1ZRFA 3TRSB 2ZHLA 1ND3B 4RN5A 2XLGA 3I3QA 3HN3A 2ZTNA 3WW1A 2AZ5A 3AYAA 3FJSA 3N7KA 1UNBA 3MI8A 3OOXA 4WZFA 4Y20B 5KHKA 1W8NA 3OYWA 1X8EA 4XJZA 4QAWA 4N7UA 1HXS2 2GNMA 1ZX5A 4CUGA 4Y1ZA 2K9ZA 1UKGA 1W6PB 4XFGA 1V00A 1RVF2 2WS93 4XTMA 2LTNA 1C8M1 1WCUA 3FLTA 3ZIXA 3I59B 3RZLA 3O0WA 3RG0A 1UYXA 5E89A 1LOEA 1U0AA 3RWNA 1H8TA 2BEOA 2JECA 5DXDA 5LK7B 3O1PA 5C9AB 3KVBA 1K3IA 2A6XA 1C28A 5GLVA 1PK6C 4I01A 4Y33A 4HVOA 2VZOA 3R4UA 4D6RA 2HWE2 1W05A 3JBG3 5APAA 2ZZQA 3GGLA 3NRUA 2HH9A 1IGOA 4LBQD 4P5HA 4LO6B 5IK5A 1RUE1 4O9GA 5HV4A 2AREA 2BFUL 1DF0A 2C6SA 4MXVA 3H8UA 1W2OA 2BZDA 1LHNA 3CL1A 2H6BA 1DGWX 3A0NA 4XUQA 3MGUA 4IV1C 2P37A 1EV12 4Q27A 5C3QA 5H9QA 2SLIA 3E5QA 4CXXA 4K1ZA 2EXKA 3S5QA 3ZN6A 4CXWA 3ACHA 1GFF2 3CZJA 4QKDA 2R32A 1GZCA 4UYBA 1RUD2 5D8AB 4YVSC 3VBUC 2JE8A 3OBAA 3GM8A 2CDPA 1PO12 2JDYA 4P14A 4BK4A 5FLIA 3WOGA 5D1IA 2MEV3 3NV1A 3RQ0A 3KV5A 1LNSA 1O7FA 5FZ9A 3AZWA 3RDIA 4WVMA 5DG1A 1GZWA 4XFHA 1S0EA 4M4PA 1NAEA 5FK7A 4PT6A 3USUB 3WF4A 3EB7A 4BZ4A 4ES9A 2WYSA 3NO8A 1RHI1 1XU1A 2I2SA 3AMHA 3I7DA 4DXRA 3TEWA 2BGCA 4NIDA 3V56A 1ENXA 5FZ6A 4DRVA 1EAH3 3W5NA 1KFXL 3POFA 4BB3A 2PAEA 3A7QA 1YI7A 4XAAA 2LROA 3T0DA 1X36A 1VBC3 4FOVA 4XJUA 1AR63 3IBMA 2ZEZA 3VDDB 4RHV3 1HRV3 4RFRB 2DVFA 1OT5A 4KBZA 3RGBA 1EUUA 3EJKA 4AXOA 5FP8A 4F7ZA 4GB32 5JR7B 1A8DA 4AI9A 1IKPA 5C8CC 4M00A 3UKVA 1MVEA 3V0AA 2IXJA 1FXZA 4AVVA 5JPNB 1G9FA 2XJRA 2LM3A 4AQSA 5FPXA 3BTZA 2XLAA 4BLIA 2VC9A 3BCWA 2F6BA 4AGVA 2WRAA 2XKPA 3ASIA 3HIFA 5A7PA 2B8MA 4FFHA 3AMQA 2YFZA 3DKQA 1DBNA 5FLHA 3O1OA 3VLBB 2R071 4IETA 1GNZA 4R8HA 1SBEA 4CDWC 2PLV3 3AFGA 3NNFA 4C1WA 1ZRCA 1S0CA 3O0XA 4Q4V2 1IS4A 4BIOA 2YB7A 4PHZA 3VZMA 4DO0A 5JIAA 5FPUA 4BU2A 2FZ1A 3AP7A 5KHHA 2QCSB 3FHQA 2GNTA 1HRI1 4QX7A 5FJKA 2XWBB 4R9AA 4YGCA 5BNPB 4QPIB 1WCQA 3ZX7A 5FZOB 4UFJA 1CAUB 2X5IA 5FPBA 3PUAA 3OGRA 4Q2FA 4CEYB 2XJTA 3W5MA 4ASMB 2NMOA 2VBBA 2R6QA 2X53S 4JQTA 4RS5B 3TB0A 4CCMA 3JQXA 1BLZA 2ES3A 1O59A 1BEV2 1X50A 3C8XA 3WVJA 5KXEA 3GHMA 3WP4A 3R4SA 3LSDA 1RTVA 4Z1VA 4H3WA 2BW8A 1XNBA 1RUH3 1KXGA 2QQWA 2XXZA 3NJYA 4COVA 5IK7A 1PVC2 1ENSA 1X82A 4Q4X1 4GH4A 3POIA 3NKGA 5GJ6A 3WLUA 4J1XA 3K51A 3A21A 3RJ2X 1RUI3 5GZDA 2ZPXA 2DFBA 2WINB 1RMU2 3L9JT 4LIVA 4MO3M 3UV9A 1H2NA 5CFDC 2BVVA 5A7WB 5GZGA 4B4RA 2GN3A 3B3QE 1DGLA 2IUWA 3T30A 3P5BA 3T4VA 4DY3A 3WX5A 4Y5SA 4HZFA 1F4HA 2BJSA 4ONUA 4QQOA 2B39A 1H2KA 3VBFB 3VDAA 4YW2A 2ARXA 4AVTA 4C90A 4K8RB 1YO8A 3AYEA 3RVHA 4XVHA 2XBO1 3U4SA 4AFMA 4UW3A 1RJ8A 1VBE2 2XGXA 1WD3A 5FY8A 1MQTC 5FK8A 1AYN3 2YYOA 1Y4WA 1OI6A 3KQRA 5AC93 1VBA2 5ABJC 4CPBA 5JI7A 2ETEA 2ZMLA 3KV6A 4RR3C 5C70A 4JGZA 2WC2A 4IE6A 2Z4FA 5EV7A 1AJOA 3GXUA 1Z7S1 3EXUA 1LOBA 3SKJE 3THPA 5IVCA 3LIGA 1FMD1 5A7SA 5KHIA 2JG8A 1PIV1 2HWC2 1OQDA 3CJIA 2ORZA 2WZ8A 3I3BA 4IEVA 3IZOA 1EYBA 1VBD2 4FPLA 4FPEA 1OHFA 1X8MA 1HDKA 3SMHA 4DNYA 2ZHKA 2N7GA 4RQPB 2CGNA 5T52A 4R4ZA 4AVAA 3ZYJB 1VRBA 3PIJA 4QM9A 4DMIA 1I1EA 4MV2A 2PHTA 2E53A 3MPBA 4YYOA 1R082 3T0BA 3OB8A 3I8TA 4HBNA 2WNVA 4Q0SA 5A1LA 4D6QA 1O3QA 1CAVA 1R1A3 1RUG1 3LOBA 2OPWA 4LHKA 5ACA2 1Q5OA 1JMUB 3C7HA 4YPJA 5B2GB 2EF6A 1CPMA 3ZVXA 1ASJ1 3BN6A 4UF0A 1RITA 2EXIA 3QH7A 4F8AA 1RINA 4BQXA 4IE0A 2RMU2 4PDWB 4Q26A 2BNNA 4GJZA 4LKFA 3M3EA 1J1TA 1PO23 2BDRA 2R063 1RUF1 2O1QA 4OCTA 5IAXA 5A3LA 4AI3A 4LE4A 1SLCA 3EO6A 4LOTA 2JB8A 5A1FA 2P3YA 1CR7A 1ZBA1 5ERLA 5CG8A 1MZ5A 1RUC1 5KC5A 2B42B 5IVBA 3QLQA 2W1WA 2EA7A 1G6NA 2J1VA 3B9IA 2W68A 4GIQA 4QU2A 4ARYA 5BY5A 2WYFA 2BVBA 3WT3A 3JD72 2CGOA 3J8F3 1D4VB 3EMRA 1B35A 2VMEA 2EICA 3CNAA 3G6JB 1KJRA 3L2HA 1SMVA 1JYIA 3DYOA 1VB4A 3WW3A 4AEDC 2JDNA 4FOQA 1ENRA 4Y20A 2WO1A 3MF9A 2YC0A 2ILMA 2JDZA 3ETPA 1YLLA 3NQHA 5KXDA 3O1SA 3N7MA 5F1RA 5FUIA 5A33B 4RYDA 2FDIA 4AEMA 1W6PA 4RGAA 1XPWA 4KNCA 3PUSA 4OZOA 1QDOA 4DRRA 1UOGA 1NCRA 4E2SA 1K12A 4HKWA 3AKTA 4B7EA 2RS13 3I59A 1HIXA 3NW4A 2AH2A 4MSVA 2WS92 3NVCA 2J1AA 2QQIA 2VG9A 2C9AA 3CU7A 3IAPA 4XDQA 4CPBD 2IVJA 2BNMA 2Y0IA 5C9AA 3ETQA 1IG3A 4NHKA 2XR4A 4BOWA 2NMNA 1HB2A 2WLPA 5BXXA 3I3MA 4NROA 1CESA 2D6OX 2GNBA 2ZA9A 3PU8A 3O1RA 3HNBM 3U75A 1QQP2 4HN0A 2E7AA 3RJRA 1O4YA 3VZNA 4FPOB 2KR2A 4IDZA 2YC2A 2CDOA 1ZBE2 4WVVA 3U07A 3HBKA 2OQ6A 4XBNA 5JZGC 1POQA 4P9XA 5J36A 1W99A 1CWPA 2HWD3 4W50A 4I02A 2AENA 1ZZ7A 3HAGA 4JRLA 4PLNA 2ENRA 3SH4A 1DQ2A 2VOTA 5A32A 3AJYA 3B69A 3MHZA 1LESA 3NNJA 2JDPA 4M3CE 5EFUA 2YGLA 4IXLA 2GMEA 2OT7A 1PZ9A 3POGA 1ND2C 3I2FA 1TME2 5CKNA 1R093 4AVBA 4JKMA 5D8AA 3KWVA 4AFDA 1IHMA 3INAA 1UOFA 4P5YA 1JYTA 1DQ4A 5T5LA 4D94A 4LO5B 1IOAA 3UNPA 3U1XA 3H3UA 4EN6B 4YNIA 5BNQA 3PHMA 2NPIA 4XUPA 3KS7A 2VNGA 1F15A 3KGZA 4FOWA 5CADA 2OZJA 4AHXA 2QKDA 4WM8C 1EY2A 4AVSA 2QNKA 1H9PA 1HXS3 4NOTA 4P9YA 4QT6A 2QDNA 3N7LA 1ZVFA 4K6BA 3PUIA 4Y1UA 3ZYIB 4IGQA 3USUA 2ZKNA 4Y1XA 1Z78A 4FT8A 4BMEA 1OA3A 1LKNA 1GP6A 2J1SA 1Q56A 4ZU4A 1DQ0A 1QJU1 3MUZ1 4AG4A 1NCQB 5K7PA 1LEMA 3DPRB 5FYUA 1CN1A 5DABA 5CA6A 1BBT2 1HB1A 4V2WA 1BKZA 5IVFA 4CEWC 1AX2A 1PM4A 5FPAA 4D8MA 3MPPG 2XOMA 2J42A 1APNA 3NV3A 5D21A 2EALA 2HWF1 4LIUA 4CP9B 1WCKA 2DCTA 3IN9A 1WA4A 2HWE3 1L7RA 2IWGB 3VDDA 3LD8A 3P3PA 2WWSA 5L19A 1LHOA 3RZKA 4FAHA 4UFKA 2IVIB 1VBC2 5IATA 1SQ4A 3AK0A 5F5IA 4Q8LA 4CCEA 5BNNB 1HRV2 3FFQA 1U5XA 2RS52 2W5FA 4W8JA 5F3IA 3THDA 1OC1A 5CISA 1GKBA 5T5JA 1NG0A 1Y9QA 1AR71 2PELA 2A73B 4GWJA 2ZBJA 4XF0A 2QZ3A 1O3RA 2D5HA 1ULDA 1ZZBA 4BIFA 1C3HA 3LIHA 1RUD3 5I0UA 2VH9A 2A6WA 2CY6A 2XJUA 1W2TA 1T6BX 1WMEA 4I0WB 3KCCA 1PO13 3RZHA 5EXOA 1JBCA 3RYKA 5FZAA 4L92A 1SCSA 1PVXA 2JB4A 1E57A 4CDUB 3VN4A 2FDKA 1O4TA 3TN92 2HBUA 4Y4YA 3OGSA 1W6OB 3UL2A 4CDQC 3B01A 4G9SB 3ZKUA 2ZX2A 4WVWA 2WLQA 3HQUA 5CFCB 2GC2A 3KT4A 2IXKA 3BVCA 2JG9C 3B94A 2ZEYA 5BNPA 4W6WA 2DVBA 3ACGA 3USSA 3VHNA 4QPIA 4XDOA 3ST7A 5FZOA 4CCCA 2VTXJ 5LBEA 1ULPA 4CEYA 1GMMA 1MZFA 3DUIA 4OMDA 4Q0UA 4HSLA 4RS5A 4K8FA 4AK3A 4BLJA 3AYCA 5A3TA 3Q8AA 4JDOA 4ARXA 3DF0A 2E7QA 5DDJ1 1JW6A 1DG6A 1AJKA 3RFRA 1E5SA 2O0OA 3H8XA 3OPTA 2JEMA 3RZJA 1GZTA 1NYWA 1SLLA 4GB33 2GC0A 4RHV1 4AW7A 2MHFA 2YFUA 3IMNA 3ZFFC 4JCKA 2WZR2 1EPWA 2J1TA 5B4XA 2HYKA 5L7OC 1ZRRA 2WDBA 1UU5A 5JDBA 1OA2A 2RM23 2BWAA 1AHSA 5JI9A 1US2A 2NYYA 1ZRDA 4KGQA 1KDKA 2A6ZA 5A7WA 1FPN1 3CDZB 5FZ1A 1I5PA 1UZYA 4Q4Y1 2BUKA 3AC0A 4CTEA 1J84A 4DUVA 3AZXA 3FUQA 5FP7A 2PN5A 5DAVA 4Q4W2 4QPGC 4XFFA 5J3UA 4Q1PA 4NO4A 3ZSKA 1QJX1 5DUWA 3N3HA 3I2OA 2BOIA 4XETA 4Q4V3 4AHYA 5HPOA 2QUOA 2VMGA 1BHGA 3LF7A 3M8LA 4HG6B 3VDCA 4IE4A 2JDMA 3E6DA 2IFRA 2ZGTA 4QXBA 3ZPYA 1Y43B 3KT1A 3WCRA 2WFPA 3P1IA 5FZKA 4I3GA 3PMEA 3DKWA 2WZPP 4AFAA 1MZEA 1W6QB 2R49A 1ZA4A 4Q29A 5JOWA 2UYAA 2WNUA 2EXJA 2PHDA 1W8HA 2UY8A 5FZ0A 5JOXA 5EJ1B 3S7IA 1WLDA 3VKFC 4YM1A 1MS4A 1BEV3 4XZUG 3NMBA 1FNZA 4KG8A 3VBSB 3KT7A 1QIQA 4X8PA 4OI0A 2HBTA 4RFT0 4QDRA 5JSPA 1UXXX 3KB5A 1O8PA 4HT1T 4NN0A 1OLME 1UYPA 1Y7BA 2YBSA 3ITQA 3R6SA 1VRH2 4F83A 1HB4A 5A7QA 1G9DA 1PVC3 1WLTA 2VW2A 2JICA 1OOPC 4RQPA 1O3TA 5F5CA 2E26A 2KM2A 2JKBA 5AVAA 4Z2WA 1WMXA 4GKYA 1RMU3 1UW8A 2WAOA 2VY0A 2ZAAA 1KS4A 4N43B 1QMJA 5LA0A 3QBQA 2IFWA 3FUOA 2Q30A 1H2LA 4EWEA 1HW5A 3ZIWA 5EIYB 1NA1B 2YDEA 1POV3 3J4UH 4BWOA 1OXCA 1KEXA 3EYPA 4QX5A 5FFOC 3WSOA 4J6GA 1AR82 1JN2P 2BQPA 2DYCA 2YV8A 2ET1A 2ZS6B 4LHNA 3VKLA 4BCUA 1HQWA 3J7HA 3R4DB 3MIBA 2W08A 1H8TC 1V0AA 1IS6A 4ZZ8A 3FHAA 3T3YA 1QH6A 2YC4A 4P9JA 4CP2A 5C3PA 4MG2A 3N9OA 4PDWA 3SXWA 2X09A 1UKRA 2D43A 1LAJA 1JOJA 1VBE3 3WHUA 1UX7A 5ANNA 3CZUA 3FWEA 1NZIA 3KHCA 1A3KA 3MO4A 5LBBA 4TTGA 1PNFA 1PO22 1VBA3 3UYJA 4NE9A 4PQQA 3MBWA 4DB5A 1SBFA 3ECQA 2WT0A 1D4M1 2C26A 5C71A 5FY7A 1IS3A 1XB9A 5FY4A 3QH6A 1OLQA 2BFUS 3PJYA 4AE2A 2HWC3 3AZZA 1RXFA 3IDBB 1OURA 4P9WA 1QJY2 3J8F2 4AYUA 5L9BA 1VBD3 2YMZA 1OH4A 3LB9A 3O5SA 1AYM1 4TYSA 2JG8B 1AL23 3ACLA 2RR11 1ULGA 3FL7A 2BGOA 5FZLA 2W95A 4YZ4A 5A33A 3CQOA 4CVUA 3B02A 4FQZA 3OSDA 3N36A 5FXXA 5FZEA 5E16A 1OKQA 5LEJA 1R083 1V6NA 3IDCB 4AAPA 2WWUA 4YW1A 2A75A 2WFF2 4IGOA 4UT5A 1AF9A 4XJ9A 3PU3A 3IB3A 2RHPA 3AKQA 4ET7A 2CGPA 5E88A 2XQXA 2PHWA 5IVVA 4HONA 1DLLA 3DYPA 2HLEA 4NWWA 2DCJA 1IG0A 1S0GA 4XF3A 5DUVA 2BGPA 4DZGA 5FREA 3LWCA 2LRPA 5ACA3 5HV0A 3LOIA 1LHVA 1J3QA 1FOD1 5LBFA 1NUKA 3N9MA 1W06A 2CV6A 3TEXA 3ZSEA 4DUWA 2RMU3 2G9GA 3ILFA 3QACA 4WM7B 3ZYGA 3O0VA 1I5ZA 2PMWB 5DZFA 4AI2A 5A32B 4LA3A 5C8CB 5CAZA 1DQ5A 4AI8A 5IFPA 2Y34A 2O14A 4EN9B 4EQVA 4NIHA 4G3YC 5LWBA 1C8M2 2BOJA 3FN9A 1DU3D 4HLTA 1WLWA 3VBRB 2AEZA 4LUMA 3VZKA 1ZREA 2I74A 4GD4A 4XZPA 4XURA 2IC1A 1K5MB 3HJRA 1YJLA 2XG3A 1UD1A 2QQOA 3JD73 4UI9L 2PQSA 5ANQA 4HETA 1TEIA 4BMBA 5IHRA 1YCIA 4IEUA 2DU1A 1R092 3CF6E 3MIFA 1FV2A 2O8QA 1B35B 4PBPA 1F8VA 2VMFA 4BHPA 1BCXA 3BTYA 1UY0A 2ET7A 2OX0A 5FMDA 2VQ0A 1RUE2 4E8CA 2CWMA 2FDHA 4CU9A 2X8KA 4Y22B 3WUDA 4AZZA 1DFQA 3ACFA 1U5YA 2XWJB 1NCQA 2RJ2A 2VAUA 3DPRA 3ME2A 4AQ6A 2EIDA 5B4NA 2GMPA 1RUJ2 1Y9MA 2J1EA 1NCRB 3HMYA 3I2GA 4IV3B 2W52A 3RWKX 3JU9A 3WG2A 1LHUA 5DN2A 1C1FA 5J98B 2K2SA 1XYNA 2Z2SB 4CUAA 5EYYA 5JSOA 1OFSA 4CP9A 4O65A 5KXBA 1V70A 1W9WA 2NQYA 4DUXA 2X5IC 5BV6A 3VD9A 1QQP3 1EP0A 4YW3A 2WQZC 2X29A 2YU2A 5LA1A 4IE5A 4XJAA 3ZPOA 4AQTA 3JZVA 2ADDA 4CDXB 1WMDA 5BNNA 1ZBE3 4ITCA 2YZ4A 1Q43A 2BU9A 3I97A 4FXKB 4DY5A 3C7EA 2VR4A 2D6NA 4Z82A 5C4WC 4GMP3 4GWIA 3IDAA 4B3NA 2OKXA 2BP6A 4EZ4A 5FR3A 3O1TA 4OZXA 1FI2A 5E8AA 1DP0A 2VU9A 4DINB 1DLCA 5FMBA 1MS9A 4A44A 3AM2A 1H1IA 1J1LA 3RI9A 2HJIA 4GH4C 5LEKA 1TME3 1W8WA 4FP2A 4MGYE 4IERA 4UAPA 4NRMA 1N1VA 1CJPA 2B9VA 2XKOA 3VBHB 1E5IA 4IUGA 3WDUA 1JYXA 2LUWA 2DDUA 3DL3A 3FE5A 4YM2A 4ZXEA 1W0OA 5GZCA 2VCAA 4CDUA 3H7YA 5FXVA 2HEWF 4LQRA 3LPGA 2QZ2A 4XFIA 3GCXA 2WBKA 1LTEA 4NVPA 1W6OA 4D7SA 4DOUA 5HBAA 5FZGA 5CFCA 4LUKA 5ABJB 3ZDVA 1QGLA 4CU7A 1XYPA 3CLPA 4IEOA 4QGMA 1BMV1 2BBAA 1D0HA 1PX4A 2F4LA 3SLIA 2VZVA 1LECA 1VMHA 1AR91 4NHMA 1BBT3 1YNAA 2ZGPA 5FO9B 5AVPA 1RVF1 3O14A 4CU8A 4Z07A 4AAXA 3N9PA 3VGIA 1PMIA 3RI8A 4CE8A 1NLRA 3AKSA 4BQ3A 2BV4A 3TEYA 2G19A 1AXKA 3GBFA 4UXAA 4D6SA 4JGZC 4UFHA 3O1VA 3M2MA 5GZFA 4M3CB 3NAPA 4XEZA 5L73A 1C5HA 2LS6A 4H7MA 4N53B 2XQRA 3WQ1A 1WW4A 2RS53 3OJBA 5FKCA 5IK4A 5LB6A 4NHLA 5CB7A 3FC0A 3HQRA 3CJIC 1QXRA 4BQ2A 1AVBA 3MFCA 2GC1A 2JD9A 5HI0A 5T5PA 1RJ7A 1AXZA 3MUY1 1WBLA 1SLTA 2RM22 4UOJA 1BK0A 2D40A 4NHXA 3LAGA 3OPZA 4A7YA 4WV8A 4XUTA 1W0PA 1EV11 5LK5A 4HPKB 5HCBA 2YY1A 5H9SA 5FMOL 5FPVA 2W39A 1K42A 5G05L 2GN7A 2QTWB 5JWPA 1CPNA 1BZWA 1DHKB 2WNVC 2XJQA 2NLRA 3TN93 1X7NA 4KQ7A 3VKOA 1HV1A 5LRRA 3T09A 1UO9A 1NY71 2CAUA 1CONA 1PO11 2NM1A 3H1MA 4IGPA 4Q4X2 5FZ3A 4YW5A 3ZYFA 2H0VA 4LE3A 2WT2A 1AX1A 5FPLA 2WABA 1T2XA 2VTXA 1UCXA 2F17A 4PIYA 2IXHA 1A6CA 3KCYA 2D6LX 1W6QA 2BNOA 1BYHA 3OG2A 4XFBA 3H3LA 3LDKA 1WGPA 4WZCA 4NHYA 2VQUA 2I07B 3W58A 5FMCA 3VBSA 1O6UA 2PAMA 3KVAA 1JZ5A 1UU6A 3OGJA 5DMYA 4QPWA 2R043 4LTAA 5A3NA 1JXNA 4I09A 3WQBA 5CKQA 4UFMA 5FKBA 5A3OA 3FBYA 4XF4A 4KG0A 3WQ7A 4F3JA 5IK8A 1FYUA 1ND3C 2VO5A 5J37A 4OI2A 2WZR3 5IVEA 5FOBB 2XB6C 4C1XA 2JD4A 2VM9A 1BVP1 3MLKA 3E5XA 4TXWA 4N43A 2ARAA 4GB31 4LK6A 1SLIA 4YGEA 2CTVA 5EQUA 4A3XA 4BISA 2VMHA 1ZZ9A 3OPWA 4MYEA 4MGKE 3K4ZA 1YC61 2OZ6A 2ZOEB 1V6MA 1Z7S2 3BALA 2A1XA 1NA1A 4JVAA 1FNYA 4JZRA 4LHSA 4AHZA 2YG0A 1TMF3 1A8MA 2ZMNA 1FMD2 4TLGA 4Q4W3 5F32A 1PIV2 1QOSA 1N3OA 2VZ3A 3ABZA 3D0SA 1C8NA 1KITA 2P17A 4WVZA 4BPZA 1WW7A 2FCTA 3BPZA 3UGFA 1ODMA 3E5UA 2R16A 5L9VA 1V9U1 3NNLA 1IZ3A 4NUBA 3O1MA 2CWSA 5C9AC 1U12A 4UWDA 2E51A 5J48A 3FBMA 3FFZA 2QQMA 3WHTA 1QNWA 3Q8BA 5G04L 3LCPA 2YUEA 2AUYA 2V5DA 4XFCA 3WF2A 1SPPB 1YYNA 3U10A 3I2DA 1QOOA 4PJYA 3GALA 5JIUA 2A7AA 1LOGA 4LKDA 4OFGA 3WW4A 2AEYA 2RDNA 2DF7A 3N9LA 2ZX4A 2ZZJA 4FPCA 3TOJA 1REFA 1GP5A 1UXZA 3LE0A 2DWRA 1JOBA 2EAAA 2VOWA 5E6HA 3P6BA 4FFIA 2FCVA 3WP6A 1TVGA 1GWKA 1JHJA 2WNUB 3AL6A 4FP3A 2XJVA 1ASJ2 2FCUA 2VJXA 2AGSA 5DPNA 5GLWA 4A45A 4AOCA 4EN7B 4WBBA 4FBFA 3ATGA 1VBB1 1VRH3 2WWJA 1OSGA 5D8AC 4C0HA 1RUF2 1RL3A 4JTOA 2PHFA 1UQXA 4LEJA 4YSFA 2VZTA 4OI1A 1AL22 4CYDA 1GQGA 4CUCA 1ZBA2 3MFAA 1JS9A 3VZJA 2E32A 2DTWA 4FCAA 5FXZA 1CAWB 5K0UB 4RSUA 5KBFA 4FPFA 5SV8A 4CXYA 3VHPA 4AF9A 1IS5A 1MACA 3IIIA 4FPYA 4FXGB 4OI4A 3CIHA 1AR83 2A3XA 4Y3OA 1PMHX 4FOYA 1R64A 3UT0A 3ZMNA 1O8SA 2RS33 1W04A 5FDBA 1OUXA 4WM7A 3ZM8A 5C8CA 1MS8A 2QQVA 1S1AA 2MPFA 3MYXA 2ARBA 1N3PA 3PVBB 4QXHA 1D7PM 4AGRA 3ZSJA 3VDDC 4HXCA 1MS3A 4QGLA 2SBAA 5JXJA 2EAKA 4B7KA 1XE7A 3PVOA 4PLOA 1PZ7A 2D98A 4NPRA 4LLOA 3VBRA 2OQ7A 1DIWA 1UU4A 4GZ9A 4C0BA 3IPVA 1W2AX 2ID4A 2XONA 4XF9A 5LASA 3PJQA 3SCGA 3T2OA 1K5MA 4BQ5A 1DQ1A 3GZTB 1Y9GA 2B46X 2FD8A 5JOZA 1WMFA 3NKTA 1GYKA 5FP3A 4UFIA 4XACA 1QJY3 1GQPA 1HN0A 4ATFA 4M0HA 2P1BA 1W0NA 1CJDA 4N8MA 4X6RB 1SG3A 3A22A 3KSCA 2P5BA 3OEAA 4GA9A 2Y6LA 4YVWB 3KZ4C 4GKXA 3RYRA 1SLAA 1IQAA 2C24A 2WR9A 4QHZA 4ZY9A 1YQ2A 4Y22A 1BXHA 3KV9A 1YIPA 2AR6A 2W0XA 5EWSA 2JIGA 1YI9A 3POSA 4QB6A 3KGLA 4HK9A 2GAUA 2WFF3 5DUXA 2C1FA 1KD7A 3I2IA 4IV3A 1GWLA 4PF1A 3RSJA 4H14A 5DAXA 1MEC1 3NJZA 2DBNA 2KA3A 3RRDA 3AP6A 2J22A 4CRQA 5BNPC 2XPJA 2DFCA 4QPIC 5FYIA 3J7MA 2YXSA 5EP9A 4EROA 1GOFA 1WKYA 5EPAA 3N4MA 3PVEA 5C7GA 1SDWA 4TWTA 3FZ3A 3WINE 3E1F1 1OD3A 4RS5C 2VTFA 5L7OB 3U4XA 5FY5A 1M4WA 3HQXA 4CDXA 1YXWA 2DTYA 1US3A 3I2KA 3OY8A 1PNGA 3ES4A 4JC1A 4N9HA 4TZDA 2FDGA 5FZHA 1C8M3 1HQNA 1JZ6A 1V6IA 1COV1 5KC6A 2GH8A 2B7YA 3K2OA 1AX0A 1UIKA 2C0ZA 1A34A 4JGYB 2PTMA 3T2PA 3ZXGA 3D4KA 2VUAA 5KR7A 5H9PA 4YLZA 3SC7X 4QB2A 2HWF2 5A1AA 3LZZA 3F95A 4MGQA 2I45A 5FYSA 2GNDA 3OUHA 3VBHA 4IEZA 1MPXA 2VNRA 5F2SA 5AFEA 3ZXDA 3WUCA 4ZONA 4D69A 3K4DA 5FZDA 3F2ZA 3NNGA 4B29A 5A80A 1RUE3 3I2HA 1KJLA 1G9AA 3BKZA 3SITA 1W28A 2VVDA 4YARA 3WR0A 2E31A 2HWB1 4OHWA 2QQNA 5ABJA 4QDQA 5J96B 3C7GA 4Z92B 3VBFC 4YM3A 2FDFA 4XBQA 3H8OA 5FCCA 2XDVA 5I91A 1RUJ3 2VW1A 2YU1A 3VV1A 5IVJA 1WBFA 3AJZA 1YUDA 3TAYA 3K46A 4HANA 4NPLA 2WS91 2XMLA 4ZS2A 5C6CA 4X8NA 3OGVA 1OBNA 5FZ7A 2VZRA 4EE2A 1W8FA 1PHMA 4M3CA 3HEIA
chains in the Genus database with same CATH topology
4G4FA 4N53A 2VVFA 2JE7A 1JUHA 4QPYA 3V64A 4D7YA 3VZLA 5SV5A 1GR3A 2ZX0A 3AMNA 1UPSA 3JBG1 2CNAA 1YRZA 1WW6A 2PHXA 2HEYF 4Q1RA 3MZHA 1ZYBA 1REDA 2EVXA 4RQPC 2TUNA 2VMIA 4Q0QA 4OLLA 2UYBA 3Q9OA 5T54A 2ZGSA 4HPKA 3VZOA 5DDJ2 4AWDA 1BJQA 2OVUA 1S0IA 4LO4B 5FRAA 3D82A 2VECA 3TNQA 3DV8A 4S2DA 1OPMA 3OGGA 3WDTA 3URFA 2K0GA 5CVRA 3E97A 1OMIA 3ZFGB 5F9TA 3AXEA 4PQ9A 3JUUA 3AP5A 3GZUC 4HL0A 2D44A 4LA2A 5I93A 4PDWC 1FPN2 2MEV1 4Q4Y2 4LNVA 2Z42A 3IDEA 2D3SA 4FPJA 1WLCA 2R073 1QJX2 4R9BA 3AZYA 1W6MB 1TE1B 3X29B 1EAH1 4K21A 5BNOC 3ILNA 1TNFA 2ZAHA 5FQ0B 2R042 3WQ0A 4L8QA 4S2FA 2E7TA 4EWAA 1HRI3 3NAPB 1NQDA 1SACA 1VBC1 1AR61 4M01A 3WW2A 1HRV1 4LBJA 3UKNA 2CL2A 3VBOB 3ZYRA 3WDXA 3LKJA 3AX4A 3M7AA 2UWCA 5T5OA 4XJWA 2Z5WA 2Q4SA 3V0BB 3ZSLA 1ZZCA 1F31A 2IXCA 4UBHA 3ZFEB 2WA4A 3OBTA 2XH6A 2D6MA 3R05A 3HT1A 4V1PA 4B4QA 4FAGA 1TMF2 3MW2A 1OLRA 4XTPA 4YZ1A 1VP6A 4K20A 1N3QA 3PTYA 4Q4X3 4XQDA 1XNCA 2QJVA 2ZGRA 3GBGA 1QY4A 1L3JA 4UBGA 4W6XA 2A3YA 3QD6A 5TSWA 4KWJA 4TLFA 2DCKA 2PLV1 5GM0A 3VL8A 4IEPA 2WL1A 4FTEA 4DPNA 4PCRA 5BYNA 1UN1A 5IT6A 5JLVA 1WW5A 3RYPA 1N1YA 4K1YA 3ZN5A 1GV9A 1TQ5A 1YFXA 3BTAA 2XBO3 3AZVA 1LENA 3D8CA 3VL9A 4AFBA 3GF6A 1DGRA 1MR5A 3MW3A 1M06G 1XQNA 2Q8OA 1LULA 3J26N 2GDFA 2Y0OA 1BQPA 1CAWA 2YPJA 5K0UA 4CP1A 1D4M2 3I4IA 1RUH1 1RUOA 1Z7S3 1CIWA 4INDA 2WJSA 4MH0E 1VAKA 1FMD3 4OHVA 3O7OA 3U11A 1PK6B 1PIV3 2G9FA 1NCQC 2C5DA 3DPRC 2ZJCA 1PGL2 1RUI1 1DQ6A 2OPKA 1AYM2 4YGBA 4LBOA 4GQ7A 4AFCA 2RR12 2ZACA 2RS32 1ULCA 3NSTA 2DVAA 1NQJA 2UY9A 3JCIA 1Q3EA 4QQ2A 4IV1B 1O5UA 1VALA 5BNNC 4ATEA 4PIXA 4B8EA 1N47A 5I8YA 4X6QB 4FTSA 4GALA 1RUG3 4XJ8A 3T2TA 1NZCA 4YVSB 3VBUB 1AYN1 1ASJ3 1NE4A 3GYDA 1LB2A 2FBEA 5AC91 2DURA 4HFSA 5EYXA 1CD3G 5J7MA 4CP0A 3OF1A 3MLJA 2ERFA 4PBOA 4PIZA 1JTZX 1RUF3 2ZGLA 1LGNA 4YVWA 3BIWE 2R1BA 4IEYA 1D2QA 3E6CC 4FO9A 1G8WA 3C2UA 4OHYA 1ZBA3 5KXCA 4JV4A 4CDUC 2XVGA 1AZDA 4I0BA 2OA2A 1QU0A 1PGW1 4XBLA 4E2GA 5CFCC 3A0KA 3LA3A 1ZM1A 3VHOA 2OYZA 1LODA 4ZU5A 4YZ5A 2ZGNA 2Q1MA 3SH5A 3UJOA 5GLUA 5K9YA 2G4IA 3T1MA 4MGZE 5FO7B 2H6CA 3WD5A 3AMPA 1GBGA 1QXPA 4FQ4A 4E4DX 4YG6A 1QHDA 5GLTA 5L7OA 4KU8A 3KM5A 1DZQA 2BWCA 2P2KA 1R1A1 3HR9A 2E63A 3FLRA 4FPGA 3W59A 1H4HA 5DG2A 5FO8B 2YGMA 4I30A 5FOJB 1J3RA 3B9CA 1SCRA 1H2MA 1KQRA 4JGYA 2ZMKA 1LOCA 1GNHA 1PO21 2R061 2A6VA 4MXWB 1S2BA 3IPVB 3LGRA 2HEVF 1SFYA 3SH3A 4MZUA 4KBBA 4Y24A 5E1RA 4CDWB 1U5IA 3KLSA 2DUQA 2VW0A 4AVCA 1SBDA 1C5IA 4A2UA 1G9BA 2TBVA 4XQ4A 4YRDA 3J8F1 1WCDJ 3LSEA 3AFKA 3PLQA 1SEFA 4P9LA 1LOFA 2O8OA 3ZO0B 3ZSMA 1HX6A 2VXRA 3CJXA 1H1MA 2D6PA 4UW6A 4HKOA 1W6NB 4FVVA 4MX3A 1YJKA 3GHNA 4HVQA 3LA2A 4AHWA 4YG3A 2RS11 3B00A 4RA0A 3CEWA 3VKMA 3MIHA 1OOPA 1YWKA 1XU2A 5JMCA 1J59A 2Q1ZB 4KL1A 3K48A 3VBSC 2XJSA 2PA7A 2VUJA 4AI1A 3BOWA 1QJU3 4L99A 1BMV2 1RB8G 1FAYA 2BTVC 3OCPA 4LBLA 1PM7A 1IKQA 3OY8B 1AR92 2Q5TA 4GWMA 1RHI2 3RNSA 3J9SA 4KWKA 2XVLA 4BH9A 3G7DA 5CFDB 4Q0PA 4FSJA 4DXZA 4D7TA 2HWF3 4ISRA 2QE3A 1Q8QA 1YFYA 4K3UA 1V6JA 5T50A 4N43C 2HWD1 5FAXA 4M0NA 3AXDA 5KHJA 3VKNA 3MF6A 3O12A 4JDMA 1NA1C 1QNYA 3WV6A 2IXIA 1R091 4FPHA 1UL9A 4K7JA 1KDMA 1MQTB 5AFBA 3ZFGA 1AR73 2ZGQA 3OD4A 1HKDA 2DVDA 4RR3B 1VAMA 1S0JA 2D97A 1W2UA 4MUVA 1VB2A 1HXS1 2GMMA 1DZTA 3WZ1A 1DGRN 3ZXKA 4QQHA 1RUJ1 4YGDA 1NLSA 1YFWA 4HN1A 4ASLA 1W6MA 4COYA 3BODA 2R072 2Z79A 1NY72 1O5LA 2Z69A 5FQ0A 1QXJA 4IEQA 1GICA 2D93A 2H0BA 2HWE1 1QOTA 2ZABA 2NP0A 1NXD1 4XYXA 2GU9A 2RE9A 4HKLA 2JG8C 1HRI2 1S0BA 3VBOA 3TNPB 4AEJA 4BE3A 4E4ZA 3NWKA 3D5OA 3LA7A 3V0BA 1X33A 2BPA2 2GH2A 5GZEA 3ZFEA 5DDJ3 2ZX3A 3AMMA 2A71A 1Q8SA 3P3NA 1VLNA 1KFUL 2V73A 3IIAA 1URXA 3EHKA 5CBLA 1RUD1 3ZXJA 4E9KA 5JCTA 2JENA 5EJ3A 3OBRA 2EXHA 1SLBA 5DUUA 1FPN3 4WM7C 4LBNA 4Q4Y3 3UKTA 3L2YA 2TNFA 1Y3TA 1F5FA 1QJX3 1WUVA 3BOPA 3VBRC 2D5FA 3ALQA 1UF2C 1V9U2 3AKRA 4AEDB 1K5MC 1RUNA 2CYFA 3HWJA 4EJRA 4ZXKA 5JAXA 1VR3A 4XXAA 4LBKA 2XBO2 1KRIA 1B35C 1ENQA 1H8VA 1ALYA 3KD4A 1IPKA 4LULA 3M3OA 4Y26A 1YIFA 4URTA 3MICA 4JDNA 3ROUA 1PK6A 1AL0G 4GWNA 4SBVA 2RM21 1VBB2 2CAVA 1NCRC 4IV3C 3RS6A 1UMZA 5C4WA 4PLMA 3MEPA 4XIOA 1D2SA 1QDCA 1ONAA 1T6GC 3M3CA 3BU7A 5JZGB 1KS5A 1C57A 2AYHA 1ZNPA 2ZGUA 3ZXFA 4YZ2A 2D3PA 4IV1A 4CDXC 4Q4V1 3AP4A 1MVQA 2DV9A 3MDPA 4XE9A 5I0SA 1ND2B 3UK9A 1ULEA 2JE9A 4HVRA 4XIKA 4YVSA 3S7EA 3VBUA 2QFEA 4GULA 3JQWA 2VOXA 3POYA 1RUG2 1N1SA 4JTNA 2A70A 4YG0A 5LRSA 1MS5A 3ZDSA 2JX9A 3VUOA 2A5ZA 4K9SA 4HK8A 4WM8B 1JHNA 1S2KA 3VBHC 4JQRA 2FMYA 3DGTA 1BEV1 4Y1VA 4N7IA 4E2QA 2A6YA 3IWZA 2LALA 1D4M3 3EBRA 3QCWA 3U0ZA 4XW3A 1RUC2 2V09A 4L9BA 4KH9A 4D3WA 4CEWB 1JUIA 1UAIA 4LR4A 1PVC1 3SCHA 3M4FA 3W9AA 2WIIB 1G86A 3MLLA 3H7JA 4LO8A 1RMU1 1AYM3 3RMXA 5I8TA 2DVGA 2RR13 4IL7A 1S55A 1LR5A 2UU8A 5BUVA 4P9IA 1POV1 5IUQA 1XE8A 4L11A 2XL9A 1H0BA 5KWRA 2WNEA 3EQEA 4TSVA 4EN0A 3R0RA 4N53C 1Q8VA 5CNAA 1XNDA 4AGGA 1MEC2 2QDRA 1VBE1 4MXWA 1FOD3 3H3ZA 2GC3A 3N35A 1LU1A 4XFAA 1ULFA 1VBA1 4GXLA 2BYVE 4RGGA 4A7ZA 1SFNA 1F5JA 2ZHNA 4CDWA 2D6KA 3WDVA 1Q8PA 2FMDA 3H9AA 5I0RA 2V5YA 3AP9A 4CDQB 4FTBA 1DZRA 3WG4A 1COV2 4COWA 3ZXLA 3WP5A 2OIIA 4RD7A 4XMAA 2JG9B 2HWC1 1XYOA 1VBD1 3H1YA 3SISA 1W6NA 2XLFA 1AL21 2E9QA 4IEXA 4BYYA 5A3MA 5F6LB 1CAXB 3QOPA 3M3IA 3ZN4A 4ISQA 4QMAA 4ZU7A 1I6XA 5BNOB 1HV0A 1O3SA 1R081 2Y38A 3MIDA 4UW5A 3NL1A 1ND3A 1GZ9A 3H1WA 1LOAA 1H4GA 4Q0VA 4XQWA 1C1LA 2HWB2 5CG9A 1XRUA 4CEYC 1B09A 4L97A 3ZFFB 5ACA1 2HKXA 4LBQB 3ZXEA 1XNKA 4EN8B 1QJU2 2DUPA 3OTFA 5CFDA 2P34A 2RMU1 4XHBA 5H9RA 4YW4A 4R9CA 4XHXA 4QGNA 4QPGB 5C33A 3NV2A 1G7YA 4H55A 5JPMB 3RPQA 1YHFA 3JD71 1J58A 4KU7A 1OQEA 1MQTA 4R52A 3JBG2 4HMZA 5GKAC 4Z8BA 1S0FA 4I0AA 1OFNA 1JH5A 3KMHA 4XF1A 2ZCWA 3PMSA 4RR3A 1AR72 1RIRA 4XOGA 5HCAA 4UW4A 1V6LA 1RGSA 2OW4A 4OULA 4Y5Z0 3PNAA 1H9WA 1DYPA 2XHKA 4MGIE 1CVNA 3NV4A 3M1HA 4XILA 2WNUC 4U36A 1OOPB 2EIGA 1U5ZA 2B5HA 1QJZA 5BPXA 5K8SA 1AR93 2A3WA 1RHI3 1A78A 2MEV2 3KCXA 3CO2A 3M70A 1QQP1 4IESA 1RVF3 3SNMA 2Q0AA 3OYWB 1GQHA 3FX3A 3UJQA 4DFSA 3PVNA 1CGPA 1W39A 1ZBE1 4AEKA 2FHRA 2BBVA 3SCFA 2ATFA 2DCYA 2WQ4A 2NN8A 4GMP1 4QQLA 3ZYPA 3N7JA 4NR1A 5K0UC 4O9EA 1EAH2 1O4ZA 4SLIA 4H7LA 2GALA 4W65A 2B45X 1H8TB 5FTTC 2QVSB 3C3VA 1UX6A 2IXLA 1TME1 1REEA 3APBA 2VNOA 2WSUA 1AR62 2WT1A 3HT2A 5DZGA 4RHV2 4N90A 2P3JA 4COZA 3S0MA 1TNRA 1J3PA 4YZ3A 3IKWA 3B7MA 1VJ2A 1YFUA 2VULA 4MVTA 1EV13 4L2NA 1FATA 1MZ6A 5FBZA 3AKPA 3D0JA 4PF5A 2XUMA 4W6YA 3WDWA 1NOVA 1QF3A 4AEDA 1OPOA 1JYCA 1BBT1 3ZN6B 4ORFA 3B93A 1DGWA 4LO7A 2PQQA 5FLJA 5F6KA 1AXYA 2PLV2 4I2OA 4OHXA 2UWBA 5F5QA 2XJPA 4QD2A 5C8WA 5T55A 4YVWC 4P9GA 4WVMB 1GZWB 1HLCA 1DYKA 2ZGOA 2VOKA 1C4RA 2RS51 2WSVA 2PHLA 1CAUA 4BA6A 4BQ1A 3E6BA 3ENRA 3FLPA 1LEDA 1QWRA 4KWLA 4U2AA 2MNGA 5GALA 1PGSA 5HCFA 4XXPA 1BVVA 3H50A 3MIGA 4ES8A 5KHGA 5JZGA 1LU2A 5CU1A 3AYDA 2R0HA 2DCZA 3RMYA 3FMGA 3HN1A 1FT9A 2JXAA 5I8SA 2P3IA 2ZGMA 3TN91 1RUH2 1F2NA 1V6OA 5I0TA 2RJKA 1ND2A 2F4PA 2ZHMA 3WCSA 3V0AB 1RUI2 2VGDA 4OVEA 2DUOA 1V9U3 4JGYC 5HXVA 4MLOA 3TBDA 2ZKLA 1OA4A 4R9DA 4WM8A 2DU0A 3VBFA 1LRHA 4META 2UWAA 1POV0 1UPIA 2WA3A 3SHRA 2P3KA 2PFWA 2R041 2R1DA 4K40A 3GZAA 2QQPA 1LGCA 4CEWA 1AYN2 1BK1A 4YFWA 1LOFC 2WZR1 1D0GA 3IT8A 2PYTA 5AC92 1WD4A 1NE6A 2X5IB 1VBB3 2Y26A 3WP3A 3H0OA 1GANA 1UIJA 4E27A 4Y1YA 3WG3A 4S2HA 4QHBA 4XMIA 3M3QA 1TMF1 4Q4W1 5C4WB 1Q8OA 4LBMA 1V6KA 3B5LB 1PGW2 3WG1A 1RC6A 4EV0A 3WXPA 4ZKTB 3ELNA 1OD5A 4GH4B 2TEPA 1ZZ6A 3TWIA 3JB4C 1F9KA 3DN7A 2WKKA 1LCLA 5DZEA 1CX4A 4HSJA 4E4SA 2R30A 1G9CA 1FOD2 4IQPA 4J1WA 5JVVA 3S30A 3ZXAC 4LLFA 2D7FA 3ILRA 4CDQA 1MS1A 3FHIB 1HQLA 4LHLA 4JAAA 1R1A2 4QM8A 4R4XA 4OHZA 4A7KA 4DS0A 3GNEA 2VVEA 1VAVA 3A4UA 2D3RA 2JG9A 3D6EA 4FPKA 5JSRA 1O91A 5L36A 4YFZA 4LT5A 2UURA 4OUSA 1RUC3 1GSLA 1VRH1 2GZWA 2R062 1VIWB 4AI0A 1CAXA 4RL7A 3ZFGC 4CZSA 1NXMA 3BB6A 1H30A 5BNOA 4N9IA 3AB0A 2NZ9A 2OUJA 1R1ZA 1ZZ8A 2VQAA 1LJ7A 4JGZB 1CQ9A 3GBWA 3VHRA 3MW4A 1EPZA 4DQAA 4NWVA 1PGL1 1H1AA 4AQ2A 1N1TA 2XVKA 2OUHA 3ES1A 3WY6A 3ZFFA 1Z0HA 3WNXA 1AR81 2PAKA 3CJIB 3JB8A 1WCSA 1OQ1A 4LBQA 5T3NA 1IPJA 1PZ8A 1UZZA 1LGBA 2PHUA 4QQPA 2RS31 1QH7A 3WDYA 1MEC3 1AUYA 2PHRA 4OUMA 3S6PA 2FZ2A 3NAPC 1I3HA 2VPVA 1FV3A 2YHJA 4I3PA 4JRAA 4QXKA 2ZGKA 3T1LA 4Q8KA 1I9RA 1QKQA 4QPGA 2B9UA 2RS12 3VBOC 3MIEA 3POWA 4M3CF 2WNVB 2RJLA 4YM0A 5FPZA 3THTA 3TYJA 1S0DA 2YROA 4EWDA 2R0FA 1CAVB 4BM8A 1LHWA 3ZFEC 1COV3 4C91A 4XPVA 1XXNA 2ZX1A 3V65A 2E6VA 2VOVA 1QJY1 2FQPA 5CIRA 3HBZA 5JOYA 5FMOS 1GLHA 2XL7A 3IM0A 4IEWA 3ZMOA 5GLZA 2JJ6A 2HWD2 3HD8B 2IZWA 3I54A 4GMP0 3OD0A 5EZWA 1FX5A 5J09A 2WFF1 4KGGA 1MS0A 4S2GA 4COUA 2HWB3 2KXLA 4B4PA 1ZRFA 3TRSB 2ZHLA 1ND3B 2XLGA 2ZTNA 3WW1A 2AZ5A 3AYAA 3FJSA 3N7KA 3MI8A 4WZFA 4Y20B 5KHKA 3OYWA 1X8EA 4XJZA 4N7UA 1HXS2 2GNMA 1ZX5A 4Y1ZA 2K9ZA 1UKGA 1W6PB 4XFGA 1V00A 1RVF2 2WS93 4XTMA 2LTNA 1C8M1 3FLTA 3ZIXA 3I59B 3O0WA 3RG0A 5E89A 1LOEA 1U0AA 3RWNA 1H8TA 2BEOA 2JECA 5DXDA 5LK7B 5C9AB 2A6XA 1C28A 5GLVA 1PK6C 4I01A 4HVOA 3R4UA 2HWE2 3JBG3 2ZZQA 1IGOA 4LBQD 4P5HA 4LO6B 5IK5A 1RUE1 4O9GA 2AREA 2BFUL 1DF0A 4MXVA 3H8UA 1LHNA 3CL1A 2H6BA 1DGWX 3A0NA 3MGUA 4IV1C 2P37A 1EV12 4Q27A 5H9QA 2SLIA 3E5QA 4K1ZA 2EXKA 3ZN6A 1GFF2 2R32A 1GZCA 5D8AB 1RUD2 4YVSC 3VBUC 1PO12 4P14A 5FLIA 3WOGA 5D1IA 2MEV3 3NV1A 3RQ0A 1O7FA 3AZWA 3RDIA 4WVMA 5DG1A 1GZWA 4XFHA 1S0EA 4BZ4A 3USUB 4ES9A 3NO8A 1RHI1 1XU1A 2I2SA 3AMHA 3I7DA 2BGCA 3V56A 1ENXA 4DRVA 1EAH3 1KFXL 2PAEA 1YI7A 1X36A 1VBC3 4FOVA 4XJUA 1AR63 3IBMA 3VDDB 4RHV3 1HRV3 2DVFA 3EJKA 4AXOA 4F7ZA 4GB32 5JR7B 1A8DA 1IKPA 5C8CC 4M00A 3UKVA 1MVEA 3V0AA 2IXJA 1FXZA 4AVVA 5JPNB 1G9FA 2XJRA 2LM3A 4AQSA 5FPXA 2XLAA 4BLIA 3BCWA 2F6BA 4AGVA 2XKPA 3ASIA 3HIFA 2B8MA 3AMQA 1DBNA 5FLHA 3VLBB 2R071 4IETA 1GNZA 4R8HA 1SBEA 4CDWC 2PLV3 3AFGA 4C1WA 1ZRCA 1S0CA 3O0XA 4Q4V2 1IS4A 4BIOA 3VZMA 5JIAA 2FZ1A 3AP7A 5KHHA 2QCSB 2GNTA 1HRI1 5BNPB 2XWBB 4R9AA 4YGCA 4QPIB 3ZX7A 1CAUB 2X5IA 4CEYB 4Q2FA 2XJTA 4ASMB 2NMOA 2X53S 2R6QA 4RS5B 3TB0A 3JQXA 2ES3A 1BEV2 1X50A 3WVJA 5KXEA 3GHMA 3WP4A 3R4SA 3LSDA 1RTVA 4Z1VA 4H3WA 2BW8A 1XNBA 1RUH3 1KXGA 4COVA 5IK7A 1PVC2 1ENSA 1X82A 4Q4X1 4GH4A 3NKGA 5GJ6A 3WLUA 4J1XA 3K51A 3RJ2X 4DNYA 1RUI3 5GZDA 2ZPXA 2DFBA 2WINB 1RMU2 3L9JT 3UV9A 1H2NA 5CFDC 2BVVA 5GZGA 4B4RA 2GN3A 3B3QE 1DGLA 4DY3A 3WX5A