1ZRRA

Residual dipolar coupling refinement of acireductone dioxygenase from klebsiella
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
179
structure length
179
Chain Sequence
SALTIFSVKDPQNSLWHSTNAEEIQQQLNAKGVRFERWQADRDLGAAPTAETVIAAYQHAIDKLVAEKGYQSWDVISLRADNPQKEALREKFLNEHTHGEDEVRFFVEGAGLFCLHIGDEVFQVLCEKNDLISVPAHTPHWFDMGSEPNFTAIRIFDNPEGWIAQFTGDDIASAYPRLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E-2/E-2' protein
publication title A refined model for the structure of acireductone dioxygenase from Klebsiella ATCC 8724 incorporating residual dipolar couplings
pubmed doi rcsb
source organism Klebsiella oxytoca
molecule tags Oxidoreductase
total genus 22
structure length 179
sequence length 179
ec nomenclature ec 1.13.11.53: Acireductone dioxygenase (Ni(2+)-requiring).
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03079 ARD ARD/ARD' family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1zrrA00
1L3JA 5FDBA 5J3UA 4Q0VA 2DCTA 2Q30A 2H6CA 1EP0A 3ST7A 1CAVA 3EO6A 5E1RA 4ORFA 1ZZ6A 1YHFA 3ZDSA 1ZZ9A 2QNKA 4META 5BY5A 1NXMA 3H50A 1I5ZA 5I8SA 1SFNA 4JTNA 2BEOA 1RC6A 1O3SA 4JVAA 3MZHA 2OZJA 1WA4A 1NYWA 3KSCA 4JTOA 4IESA 2GU9A 2IXCA 3FWEA 4KWKA 4Q0UA 5I8YA 3IDCB 1J3QA 1OMIA 5JAXA 2C0ZA 2GAUA 3FJSA 1LRHA 1J58A 4L11A 1YFWA 4AQ2A 1O3RA 4TLFA 3H8UA 1QY4A 2P17A 4ONUA 2UYAA 4YNIA 5LRSA 1ZZ7A 4FBFA 2Z2SB 3UKTA 4Z07A 4XF3A 1J1LA 2B8MA 3WW3A 4AQ6A 4YARA 1RUNA 4PIYA 2V09A 4MX3A 5C8WA 4WBBA 1TQ5A 1RUOA 4IEPA 2Q1ZB 4HN0A 2CAUA 4R8HA 4O9EA 2EVXA 2F4PA 3ES1A 1CX4A 2B5HA 5E16A 2CGPA 2BNMA 4EWDA 2PHLA 1LB2A 4MGIE 2D40A 1YLLA 5LRRA 3E6DA 3ETQA 4AVCA 4HBNA 4QMAA 1O7FA 4BIFA 2IXLA 4BH9A 2XKPA 4QGNA 5AVPA 3PNAA 4E2QA 3E6CC 5I0UA 4XEZA 1ZX5A 3D82A 3IIAA 3LAGA 4N9IA 3WW4A 3OD0A 1VJ2A 2MPFA 4DINB 4IEUA 1U12A 3RYKA 2CAVA 3E97A 4I02A 3CJXA 2PFWA 1PMIA 4A2UA 2UY9A 2XLFA 1H1IA 4F7ZA 1DZRA 3H7JA 3SHRA 4HVRA 3NSTA 5KBFA 2WC2A 4YSFA 2VPVA 1ZNPA 4X6RB 3RYPA 3TNPB 1UW8A 3LOIA 4KWLA 3SMHA 3B02A 4BHPA 5D1IA 2OZ6A 5FLJA 3U10A 3H7YA 2UY8A 4LUMA 3QACA 5KHIA 4CYDA 2XGXA 2E9QA 2MHFA 3GYDA 2FQPA 5KHHA 1NZCA 2XHKA 2XL7A 1RGSA 1FI2A 1O5LA 4XF0A 5BUVA 3FX3A 2IXHA 3ROUA 4UBGA 3E6BA 5KHGA 4LTAA 1YUDA 3RDIA 1DZTA 3H1MA 3H3ZA 4HVOA 2BGCA 5I0RA 4UXAA 2ET1A 3ELNA 3O14A 4HZFA 3S7EA 4R52A 4IEVA 3I54A 5JSOA 1YWKA 4EWEA 1QXRA 1WLTA 3D0JA 5J7MA 4MUVA 2H6BA 1CAWA 2PQQA 2O8QA 4K8FA 4EWAA 4N9HA 5T3NA 4D7SA 1G6NA 4MH0E 4HN1A 1CAUA 3LA3A 4KL1A 1JUHA 1HW5A 2BNNA 2QDRA 2D5FA 4EV0A 2Q0AA 1ZZCA 4ZU5A 5KHJA 4LEJA 4FAGA 5I8TA 3DKWA 4Z82A 1GQGA 3U0ZA 4I3PA 1O3TA 1SEFA 3UKVA 1QXJA 5C6CA 5LEJA 1Q5OA 4B29A 2GC1A 2PAKA 5FPXA 4XF1A 3NKTA 3RZZA 1UD1A 1J3PA 3E5QA 3L2HA 4I0BA 4JV4A 1CAVB 4HMZA 2ZCWA 4RD7A 1DGWA 2I45A 2QCSB 4QXKA 1I6XA 4XFAA 4MZUA 2IXJA 2N7GA 4IERA 4J1XA 3G7DA 3IWZA 3HIFA 2XLAA 4I09A 3OTFA 1XE8A 1ZRDA 4WZCA 3BCWA 1ZVFA 2ETEA 3DL3A 1O4TA 1EPZA 3HT2A 3N4MA 3CLPA 4FT8A 4XF4A 1IPKA 3PVBB 3R6SA 1PM7A 3FFQA 3UKNA 3LZZA 3PLQA 3D0SA 1NE6A 1YFXA 2GZWA 3KMHA 5I0TA 5K8SA 4AVAA 3H1YA 4PJYA 2UYBA 2BYVE 4OLLA 5EZWA 2ATFA 3HT1A 3M3IA 3GBFA 2VQAA 4HSJA 4XETA 2OYZA 1LKNA 3OGJA 5I0SA 4J1WA 1XE7A 4XFIA 1H1MA 3ACLA 2K9ZA 1OD5A 3CO2A 1QWRA 4IEXA 1VR3A 3FHIB 3RNSA 2PAMA 4KU8A 4E2GA 4MGKE 2PHDA 4YYOA 5FCCA 3ES4A 2IXIA 3IDBB 4MGYE 2B9UA 4IEYA 5BV6A 4HVQA 3VHRA 1ZRRA 4BYYA 2XLGA 2PAEA 2IC1A 3H1WA 3H9AA 2QJVA 4XFBA 4GULA 1ZREA 4AVBA 2CV6A 4YRDA 4I0AA 3CEWA 2D93A 4Q0QA 2XKOA 3WW1A 3FZ3A 3H3UA 5FLIA 4QM9A 4QGMA 4PIXA 1Y3TA 3OCPA 5JR7B 3NW4A 1UIJA 2WFPA 2ET7A 3NVCA 3NL1A 4D7TA 4ZU7A 1SQ4A 4LA2A 2OA2A 4E2SA 1UPIA 3TNQA 4ZU4A 3S7IA 5LEKA 3DV8A 3EJKA 3E5UA 4IETA 5JSPA 1ZRFA 3MDPA 3I7DA 4FAHA 2PYTA 1J59A 1UIKA 2K0GA 3M70A 5CVRA 1OFNA 1ZZ8A 4EROA 1IPJA 1GQHA 4IEWA 5JCTA 4QGLA 2IXKA 3EQEA 3CF6E 1LR5A 1CAXA 1Q3EA 4P9GA 5J48A 1EYBA 1CGPA 3USSA 4HSLA 5I93A 3IBMA 4AXOA 4MV2A 1CAWB 3BPZA 3NJZA 2H0VA 1XRUA 2EAAA 2D5HA 4WVZA 1CAUB 2FMYA 2VECA 4XFHA 4L2NA 3I59A 2PA7A 3RPQA 4QM8A 5F1RA 5KHKA 5EFUA 1YFUA 1DGRA 3EHKA 2HJIA 4LUKA 4LULA 4XFGA 4I2OA 5JSRA 3SCGA 2Z69A 1FXZA 4XF9A 4IEQA 1ZRCA 2GC0A 2GH2A 3SCHA 4H7LA 1V70A 3KGLA 2Y0OA 1O5UA 3HQXA 3DN7A 3U11A 1CAXB 5FQ0A 1Y9QA 3EBRA 3KCCA 1OI6A 4LLOA 2GC3A 4I01A 2OPKA 3KGZA 5CU1A 2KXLA 1Q43A 4Q0PA 2QVSB 1UCXA 1EY2A 4MGZE 4X6QB 2MNGA 3I59B 4LA3A 3QOPA 2ZKLA 3BU7A 2O1QA 3BALA 5HI0A 1X8EA 3MYXA 3C3VA 1VP6A 4XFFA 4Q29A 4XFCA 4IEOA 1O3QA 1RTVA 1ZZBA 4F8AA 3JZVA 4IEZA 3FE5A 3RYRA 3MPBA 1NE4A 3OF1A 5I91A 4O9GA 2BNOA 4NVPA 5FQ0B 3BB6A 3LA7A 3E5XA 5FPZA 4UBHA 4KWJA 5CADA 4QX5A 3CL1A 3LA2A 4HLTA 4PIZA 3S0MA 3LWCA 1RL3A 1X8MA 2PTMA 1YFYA 4KU7A 4OFGA 3WW2A 1J3RA 1FT9A 4Q0SA 2EA7A 2Q4SA 5BPXA 5FLHA 1WGPA 2GC2A 5BXXA 1X82A 2HKXA 2XL9A 3SCFA 3SXWA 1X7NA
chains in the Genus database with same CATH superfamily
4Y4YA 4JDOA 4PDWA 4RHV3 3WDTA 4D6RA 3ZSLA 2LW8A 4Q0VA 3HBKA 3VBSB 1N1VA 2WO7A 5LBCA 3VBRB 2JDZA 4N8MA 4Q4X2 4QPIA 5HXVA 5DZGA 4A4AA 4Z92B 5E1RA 5LATA 4KGGA 3ZXLA 4ZS3A 2BBAA 4CP9A 1YHFA 3APBA 4QXHA 4ET7A 1FV2A 5FP7A 2JG9C 2IFWA 2QNKA 5C8CA 1FOD3 5BY5A 2ZAHA 5JOXA 1I5ZA 3HJRA 2X8KA 1AYN3 1Q8OA 1LEDA 3PVNA 3AKTA 4Q4W1 4A7YA 3ZYJB 2QQKA 4YW4A 1RUJ1 1MS3A 2OZJA 2QQWA 2VM9A 2WLPA 3KSCA 2H0BA 3QLQA 4GMP0 1ENXA 3ZDVA 4BE3A 4Q0UA 1ZM1A 3K48A 3IDCB 3MIDA 3KT7A 1OMIA 5GJ6A 5DUVA 5CFDA 2J42A 2AGSA 3RQ0A 4TYSA 2EAKA 5JI7A 1OLMA 5FXVA 1ULGA 1DU3D 1YYNA 3N7LA 1O3RA 4MHRA 2BVBA 4YZ1A 3H8UA 1M4WA 3NJXA 4ONUA 4YNIA 3J7HA 4DXZA 2VMGA 2LTNA 3MIBA 3OBZA 2R1BA 3GF6A 2VCMA 2ZHNA 4UW6A 1RITA 2G9FA 5FZOA 2V73A 1J1LA 2B8MA 4YARA 4AQ6A 1KQRA 3T2OA 5B4NA 2V09A 4MX3A 5FUIA 3VD9A 1OOPB 3I3EA 2GNBA 1JI6A 2QFEA 4EN9B 2JDMA 1XNAA 4E9KA 4QXCA 3KHCA 3ZXDA 1EV11 2WFF3 4MO3M 3INAA 4A41A 2JKBA 3HAGA 5C9AA 4FTSA 1KFUL 1EAH3 1PO22 2F4PA 4CXYA 4IE0A 3ES1A 1V6NA 1CX4A 3AZVA 2XB6C 4DRRA 5A33B 3WG2A 4COZA 2CGPA 2EIEA 4FPEA 1QJU3 3CKHA 2XXZA 2PHLA 2GNMA 2D40A 3TOJA 4BLJA 3B3QE 1VRH2 1KS5A 4CU9A 1B35B 1XNTA 1UXXX 3E6DA 5FV3A 3WOGA 3AL5A 3WP3A 4BQ5A 4JC1A 3NAPC 4CDQB 2WT2A 2DURA 3M2MA 4JAAA 2XKPA 1C3HA 4YVWA 1H2MA 1MS1A 2ENRA 3JB4C 1Z0HA 2HWD2 3NMBA 5A32B 2X5IB 5IHRA 2QQNA 3D82A 1ZA4A 1YQ2A 1AVBA 2E31A 4P5YA 5GALA 3WW4A 4Q4X3 5G04L 2MPFA 3CJIA 1H9PA 4NIAA 3WXPA 1W8NA 4MADA 4DINB 1JZ3A 1YCIA 4XUQA 3CDZB 2FDIA 1H6XA 4K21A 3RYKA 4ZXKA 2Y38A 5A70A 1OH3A 4DZGA 3JBG2 5FY9A 5CB7A 1DZRA 4AI0A 1OLRA 1W39A 4XILA 4D6QA 4I0WB 2WC2A 5K0UB 5HBAA 1Z7S2 4PF5A 4MXWA 4DMIA 4YW6A 4KWLA 4C90A 1HRI1 5FYZA 1JZ7A 5CISA 4E27A 4BHPA 2CGOA 3M3OA 4CCCA 3ZXEA 1DP0A 1F4AA 1RIRA 2ZEYA 4IE5A 4Y3OA 3PDQA 5D2AA 1FV3A 2XGXA 1JTZX 3BN6A 2E9QA 4LHLA 5FYCA 1LHWA 5AFBA 3I4IA 3U37A 1E5IA 1MZEA 4FVVA 4K1ZA 5KHHA 2QDNA 2XHKA 2Y6JA 4ZY9A 1JZ6A 4IDZA 4BMEA 4IV1B 3H8OA 2VZTA 3AYDA 2CWMA 2P3JA 4CP1A 2ZGNA 4AEDA 5ACA2 1J84A 1N47A 5KHGA 4LTAA 3VZKA 3RDIA 1COV2 1BXHA 1MEC1 2QZ2A 2VQ0A 3H3ZA 4Q4Y2 1RUH1 2VOTA 4CCMA 1RUF3 2RHPA 3OEBA 1WW6A 2VNOA 2UWBA 2NMOA 3ELNA 3I3QA 3O14A 1KGYA 3SISA 4R52A 3JUUA 1PO23 3ITQA 5JSOA 5GKAC 4GAZA 1SG3A 1E5SA 1NCRC 2R16A 3PTYA 3Q8BA 1UMZA 4DUXA 2VOVA 1WLTA 1AZDA 4QX1A 5FY8A 4HKWA 4OULA 4ARYA 1SFPA 3GBGA 2Y34A 5FJHA 4XCAA 4LE4A 4BQWA 2H6BA 1CAWA 3USUA 1JW6A 2PQQA 1VRH3 2D6PA 4K8FA 1XBFA 3POYA 1LGNA 2VQUA 1LESA 2W39A 4AEJA 3DCQA 4D7SA 3J7MA 3FLRA 3AP7A 4K40A 4HETA 2A75A 2OUHA 2WIIB 4OHYA 4S2DA 4HKOA 2Z5WA 3VDDC 2VNGA 2QKDA 1VRBA 1ZZCA 2HWD3 4AI9A 5KHJA 4JGZC 5JIAA 3DKWA 1DQ2A 2AYHA 4HPKA 3RSJA 4FAGA 5I8TA 1LECA 2R0FA 5C5UA 4I3PA 5EWSA 3UKVA 1QXJA 2GP5A 5ABJA 5C6CA 3VDAA 3IPVB 5L19A 2VAUA 4JGYC 3KS7A 4HL0A 3UNPA 2NPIA 1NG0A 2YFUA 3JBG3 2ADDA 1W9TA 3UGHA 5ANNA 3E5QA 5F6LB 4JZRA 3L2HA 4JRAA 5HXMA 1W8WA 3IT8A 1XU1A 4P9WA 3ZR6A 2ZZQA 4LKEA 1Z7S3 2QCSB 1I6XA 1OPMA 2WZEA 3GCWA 2V5YA 5A3LA 2PELA 1REFA 1W6OB 4XFAA 5L7OC 3S30A 2OQ6A 2IXJA 5JDBA 5FO8B 1AX2A 2PHRA 3HIFA 1FMD1 4BOWA 4L97A 1MPXA 1REDA 1RXGA 1X33A 2DU0A 2XLAA 4I09A 2VZSA 4NWWA 2RJ2A 2RV9A 4NHMA 1HB3A 3VBRC 5AFEA 1TEIA 1JZ8A 2VC9A 1IHMA 4XXPA 1MR5A 4ES9A 1D4M2 2HWB1 4F3JA 3SH3A 5D8AA 4B1MA 5ACA3 2W1WA 2YUEA 4XF4A 2RR12 1REEA 3PVBB 1UAIA 3R6SA 1PM7A 1COV3 3LDBA 3V65A 4ASKA 1W6PA 3V64A 3LZZA 4Q4Y3 4AI3A 3M3EA 2KA3A 4QDSA 1WBFA 1LODA 1W2TA 3D0SA 5FZDA 3KMHA 1JHNA 1BMV2 4ZZ8A 1OKOA 3ZFGC 4DOUA 4KWUA 3H1YA 4N53B 3WVJA 3ZSEA 4AVAA 3LEIA 4Y4RA 3VHNA 5CKNA 1QKQA 3OUHA 4OLLA 1CVNA 2RDRA 3IDAA 3HT1A 1AJKA 1H8TC 2G9ZA 3M3IA 1QJX2 4XETA 1HB4A 5AC92 3OD4A 1Y4WA 1SPPA 2OS2A 2QQOA 3A0KA 3B69A 4YZ5A 4RR3B 5F6KA 2NLRA 5L9VA 2JE7A 3ACLA 3AKSA 3O0WA 5A7PA 2BFUS 2V5DA 5DDJ2 3OGVA 3CO2A 3RWNA 1VR3A 3OB8A 3O1OA 5A6ZA 1SHWB 4RGGA 1ULDA 2PHDA 3NV3A 4MGKE 4OVEA 2QQLA 3LE0A 4LT5A 5IK4A 3UGFA 2Y8KA 4CCNA 2RS11 4DUWA 3ZFEB 1H2LA 2I2SA 4BXFA 4XJUA 1PZ8A 5FP4A 2RDQA 3D3AA 1IKQA 1Y7BA 2VOKA 1FPN1 1VBE1 4CDXC 4BYYA 2OQ7A 4RFT0 5C3OA 3LPFA 2UWAA 4PI0A 1XNCA 5DAWA 2BP6A 2VZRA 3I3DA 1WWYA 1CPNA 1UO9A 5F37A 1GOHA 2AREA 2QJVA 4M3CA 4IQPA 4LHKA 1ZREA 2RE9A 4PI2A 4OUMA 1W8HA 3HNMA 2J1EA 2JXAA 3TB0A 2Y60A 1YJLA 4FP3A 3WQ1A 3CEWA 3LKJA 4UW3A 3LDRA 3PTRB 5JXHA 2XKOA 3CBNA 2ZGQA 4EN0A 1Q8VA 1VBA1 2X5IC 4QU1A 4Y20A 2EALA 1RUG2 3ZN4A 2F4LA 4IV3B 1M06G 4P00B 1W2NA 1W2AX 2FCUA 5FLIA 3ZKUA 4AI1A 4CEYA 1VB2A 1POV1 2PLV1 4P9XA 4QGMA 3SC7X 1D4M3 4PIXA 5DAXA 5BNOB 1JYCA 3ETPA 4OI1A 1NCQA 1RUI2 4JHZA 5JZGB 3VBFA 3NW4A 2WFPA 2ZTNA 1CPMA 4RS5B 3RS6A 2TEPA 2LROA 4D7TA 3D5OA 3BTYA 1V9U2 4LA2A 1AR71 2OA2A 4E2SA 2B45X 3WG3A 4LBQB 1BJQA 3DV8A 5A3NA 3E5UA 2XJVA 1WW7A 1SBDA 2TBVA 3MDPA 5FMOS 4BU2A 4SLIA 1NA1B 4PLMA 5IUQA 4COUA 3BI3A 4QT6A 4LITA 5K4LA 3I2GA 3KWVA 3IAQA 4P9JA 4C1WA 1J59A 5DAQA 4HG6B 4AOCA 1QJX3 1ZZ8A 2R071 3VBOB 4EROA 4CEWB 5IVJA 1RUE2 4JQRA 1GZWB 4QGLA 3ZPOA 5AC93 5FPUA 3TBDA 4QHBA 4QQHA 1BQPA 3KZ4C 3AMHA 4IV1C 3TN91 1Q3EA 1CWPA 4ARXA 5DZEA 5FZGA 1CGPA 1AHSA 2WNUA 3R4UA 3USSA 3GZAA 5DDJ3 5HCBA 1SFYA 3IBMA 4AXOA 4DB5A 2Q8OA 3BPZA 4C8DA 3RG0A 2VMCA 4W6XA 4LORA 3LD8A 4B4PA 2H0VA 5H9PA 1XRUA 4EZHA 5F2SA 1K5MB 5F3EA 2NMNA 5FMDA 5J09A 4UI9L 3BIWE 3K75B 1MVEA 4A7KA 1WCSA 3RPQA 4AFDA 3MIHA 5F1RA 1CIWA 5EFUA 4RGKA 1DGRA 2BFUL 1JODA 3FN9A 3PHMA 3J7LA 3EHKA 4RGAA 1AR92 4JX0A 1U5IA 4LUKA 1V00A 5CAZA 2VULA 5JSRA 1WUVA 3SCGA 4LOTA 4QDQA 1JOPA 1OD3A 2OUJA 4IEQA 4AI8A 1RUD1 2JE9A 3O7OA 4XABA 1ZRCA 1UXZA 2GH2A 5GLUA 3SCHA 1ZBA2 3WNKA 1OURA 3I2IA 2Y0OA 3A21A 1OF3A 3SEPA 4ITCA 4I3GA 2W95A 1CESA 5E6HA 2HLEA 4CDWA 1XSRA 1NKGA 1XSQA 1CAXB 4HFSA 3IZOA 5IWFA 4XUOA 4LLOA 4I01A 4YFWA 2XJPA 5FYYA 4URAA 1GWKA 4D3WA 2QE3A 1RUI3 4YG3A 1A8MA 1NQJA 2D43A 5FZ4A 4AL9A 4BIOA 4YM0A 5FXXA 5FK7A 3I59B 1V9U3 1ND2A 3T2TA 1WLWA 3DGTA 2VE1A 3GXUA 2E6VA 2BGPA 1VALA 3M7AA 2W52A 4LIVA 5E88A 3FLTA 4QB1A 4Y1XA 1R092 4ISRA 3B01A 4CE8A 3MLJA 4BM8A 1UL9A 1A78A 1W90A 3ZFFC 1ZZBA 2LUWA 4IEZA 1RUE3 3NKGA 5SV5A 4XJ9A 4NPRA 1XC6A 3FE5A 3RYRA 2A6ZA 1X9PA 4LK6A 4XIKA 3Q8AA 2DVBA 3WF2A 3TAYA 2RS32 1GP4A 5DABA 3AP9A 2W1SA 2ZX1A 4Q1PA 3R4SA 4FQZA 2VMHA 4LBMA 4UBHA 1W04A 1ZRIA 4KWJA 2VMEA 4QX5A 5FKBA 3ZXAC 1B09A 1QJEA 3CL1A 4QPGB 4HKLA 5C3SA 3U4XA 1SBFA 2QTWB 4LBQD 3MW4A 4UF0A 3VL8A 4Y22A 3VBHC 1N3QA 4TZDA 1SDDB 5FP9A 2ZABA 5FBJA 4QHOA 4C0HA 2VVEA 3ZIWA 5FZMA 1FT9A 1GNYA 4XJWA 2GSYA 4V2VA 1RVF1 4YVSC 2YU2A 5FLHA 1WGPA 2A3WA 4CUGA 1F15A 4Q4V2 1LNSA 1V6KA 2L9LA 4RQPB 4C91A 1AR93 1CONA 1PNFA 3T3YA 4BDVB 4CP0A 5BXXA 4AGVA 3T0DA 1X82A 1QHDA 2HKXA 5CYYA 3LEKA 2WO2A 4LR4A 3U10A 1JYIA 1L3JA 3NJVA 4N43C 1A6CA 4RR3C 5J3UA 3A4UA 4A7ZA 4A45A 5FO7B 4PHZA 2YGMA 2WKKA 2JIJA 5DMYA 1AR61 2W91A 1CAVA 2ZEZA 4JKKA 1O6UA 1IQAA 2BWAA 4GWJA 4ORFA 1HN1A 3THDA 3GNEA 1SDWA 1LEMA 4CXXA 1ULPA 2C1FA 2ZGLA 3IIIA 1PMJX 2ZZJA 5FZEA 1PX3A 5FPVA 1OA4A 1PNGA 3H50A 5H9SA 5I8SA 4XW3A 3WNPA 4KI5M 2BEOA 4V2WA 1RC6A 3X29B 4R4ZA 4URTA 4FPLA 4XJAA 1UMIA 4MG2A 1WA4A 2TNFA 3NWKA 4IESA 4IW3A 4XDPA 2IXCA 2RS52 3ENRA 3EMRA 3FWEA 4NOTA 4Y24A 3TWIA 1OH4A 5BNNB 4LNVA 5L9BA 1AUYA 3WT3A 2J1TA 2FDFA 3IMNA 1OA2A 3H3LA 2A6XA 2JDHA 1J58A 1R093 1K5JA 4L11A 4AQ2A 3GBWA 3MV01 3MIGA 3FLPA 2VNRA 4CU8A 4GIQA 4LO4B 2UYAA 4KNCA 2ZGOA 4EN7B 5LRSA 1ZZ7A 2Q8CA 1PGL1 4XF3A 3ASIA 3WW3A 4AHZA 2RS33 1RUNA 2PXJA 4BK5A 5BNOC 4PQQA 2VW0A 1RMU1 1TQ5A 2HWC1 4IEPA 1NZIA 3T0BA 3VD3A 5JZGC 3CMGA 2Q1ZB 2GN3A 4HN0A 2CAUA 4WVMB 5FPAA 2WSVA 4LKDA 4CDUA 2VZUA 2WL1A 2EVXA 2WBKA 4DRVA 1VPHA 2VY0A 4YG6A 2BWCA 1OC1A 2DCZA 4EWDA 1VBD2 1NT0A 3KVAA 2EXHA 1LB2A 3T08A 1JYXA 1NLRA 1NA1C 1TME1 1A8DA 5DZFA 3RWKX 4Q4V3 2V72A 2VO5A 4NWVA 2VUCA 2JG9A 3I2HA 3VBOC 4QMAA 1DYKA 4CCDA 4CEWC 5IFTA 4BIFA 2Z4FA 1QDOA 3N9MA 2XJUA 2OT7A 4XDQA 4Y5SA 3BU0A 1ULCA 5F32A 2QQPA 2WS92 2K2SA 2XJTA 2YPDA 1RHI2 2ZGUA 4XEZA 3ZFFA 4BQ4A 4K3UA 3O1MA 1YIPA 4BZ4A 3N3HA 4DS0A 1JZ5A 3PMEA 1Y9MA 4P14A 2NP0A 2K46A 1F31A 2RS12 5FWJA 3AB0A 1W9WA 1HIXA 3OSDA 1S0CA 1K5MC 1A34A 2DF7A 2PFWA 1PMIA 4A2UA 4GQ7A 5C9AB 2OPWA 1LOEA 2DVDA 2YPJA 3WZ1A 3UJQA 1FPN2 4E4SA 4F7ZA 5K7PA 1QDCA 3H7JA 4HVRA 2WLQA 2WNOA 3KF3A 2ZA9A 4FPYA 5JXJA 4X6RB 2R7EB 1UW8A 2ZGKA 4QX7A 3OPWA 3B02A 2RS53 3L9JT 4OZOA 5D1IA 1SCSA 2OW4A 5T52A 2FDJA 3BPSA 1R64A 3QACA 3HQUA 4LUMA 4CYDA 5KHIA 3CHXA 5IAVA 2HEVF 2MHFA 1VMHA 3KQRA 4YVWB 1VLNA 5BNPB 1LU1A 1MZFA 3WINE 2DCJA 1S4CA 3B93A 3EYPA 3N7JA 3FX3A 4S2HA 5IVCA 3ZYRA 1CN1A 1HQWA 3NNLA 4IUGA 4L9BA 2Y6GA 3AX4A 1BZWA 4UBGA 5F5AA 1F2NA 2C5DA 1OQEA 4NIDA 2VBPA 1JZ4A 4COYA 1W6QB 3GM8A 1ASJ1 3IKWA 5F5IA 3QH7A 4HVOA 5FK8A 4H2AA 1ULOA 1WCQA 1POQA 1BVVA 1UZVA 3AMNA 2Q8DA 3WDXA 5JOWA 1WMDA 3WDYA 3NAPA 3GALA 4WVWA 3C7EA 4NPLA 3J8F2 4COVA 4E4ZA 5JOYA 5DUWA 3O0XA 4AGRA 2A3YA 4QU2A 2BRTA 2D3PA 2FZ2A 2QUOA 4GJZA 4WM8B 1UY1A 1C28A 1GKBA 1WD4A 1O8SA 1F8VA 1VBD3 4AGGA 4R9DA 4MGSA 3Q8EA 5FZ8A 3LPGA 5KC5A 3J9SA 5LCWL 1D2QA 5DAPA 4FO9A 2O8QA 4EN6B 5FMBA 3HN3A 4N9HA 5T3NA 4CUCA 4ATFA 1GP5A 2R072 4W50A 2DDUA 1G6NA 4BXSV 1CAUA 1S1AA 3LA3A 3ZX7A 3MW2A 1JUHA 1W06A 3GGLA 3AC0A 4LOSA 3B7MA 1W8OA 2QDRA 3EB7A 4HT1T 4EV0A 2WS93 1D0HA 2RMU1 1RHI3 4AEDB 3BKZA 2WAOA 1D4VB 1PZ9A 5A6QA 1TMF2 1GQGA 5FZIA 3JQWA 3MIEA 1F5FA 2CWSA 4FFIA 1IS3A 2RS13 5LEJA 1PO11 1W9YA 2GC1A 2PAKA 3S6PA 5DG1A 1GOFA 4INDA 5DXDA 4FTBA 3NKTA 4LXLA 1FPN3 2XMLA 1J3PA 4K6BA 3RZHA 5LBEA 3ME2A 4JV4A 4QX2A 1UOFA 2LALA 4NIGA 4OCTA 4RD7A 3IN9A 4RQPC 2I45A 2OIIA 4NHKA 5GLZA 1HRV1 2W94A 1BYHA 2HH9A 4XZPA 3AZZA 1RUF2 5IK5A 1VMJA 4NJ4A 4ZONA 1PVC2 3KV4A 2W1QA 3KLSA 3O0VA 2JX9A 4IERA 2VZ1A 5EQUA 5FMCA 4KQ7A 1AXZA 3IWZA 3OUIA 1IKPA 1VB4A 3AKPA 4H3WA 3T1LA 1GP6A 1LENA 1KEXA 1PIV2 2VW1A 1WLCA 2P37A 4NPMA 2FDHA 1NCRA 1HXS2 5FUPA 2C24A 1OFSA 4WZCA 1ZVFA 3BCWA 3DYPA 2BTVC 5EHDA 3Q9OA 2DWRA 2VU9A 3N4MA 3CLPA 1LOFC 4FT8A 4YFZA 1IPKA 1HB2A 4LO5B 4QWNA 1A3KA 2KM2A 2LM3A 2XG3A 4XXAA 3WNNA 1UMHA 5ABJB 2DYCA 3S57A 4D6SA 1VAVA 1XOYA 3PLQA 5FPBA 3I3BA 1UZYA 1WCUA 5JPNB 1V6MA 3WDVA 3J8F3 5I0TA 1S2BA 4G3YC 5A1LA 1ULEA 5K8SA 3N7MA 3URFA 2J1AA 3VDDA 3I3MA 2BYVE 2D3SA 2WSUA 2W46A 4IXLA 5EZWA 2VMIA 4NR1A 4JDNA 2ATFA 3DYOA 2DUQA 4JGZA 1UX6A 2PHXA 2Y26A 2VQAA 4LKFA 3ZOIA 2XONA 1LKNA 2WQ4A 2JG8B 2R073 4Y5TA 1ND3B 4OMCA 4JGYA 4KG0A 4XFIA 1LOCA 5JVVA 3OYWA 1OD5A 2JD4A 3DPRB 3FBMA 1QWRA 2ZEXA 1D7PM 3FHIB 4LBJA 3RNSA 4UOJA 5C3RA 2BBVA 2UURA 3V0AB 2AEYA 4XURA 4XACA 1S0DA 5A7WB 2XBO2 4MGYE 1TMF3 2B9UA 2ZKNA 4HVQA 1AL21 5JAXA 3VHRA 1GSLA 2BDRA 3B5LB 3M4FA 4YWAA 1QOOA 4AW7A 2VD7A 4CXWA 4YM2A 3HVDA 5DAVA 2VBBA 3I8TA 2A1XA 3PUHA 1BEV2 2W3JA 1UYZA 4Q26A 5FBZA 4CU7A 4DUVA 1WW5A 4XJZA 2WA3A 3VBSA 2XLGA 5LA9A 4QKDA 2V4AA 3PUSA 3GZTB 3VBRA 2IC1A 1RUC1 2B9VA 1XB9A 3ATGA 1TZOA 3H9AA 4LQRA 4XFBA 3Q8FA 4CUBA 4EJRA 2WNVB 2VMFA 1PZ7A 2RM22 1KJRA 2WWSA 1WMEA 2CV6A 3ILNA 5LZ6A 3HEIA 5JWPA 1PVC3 4GKYA 4PQ9A 2C6SA 1KDMA 4Q0QA 2ZHMA 1N1SA 3WF1A 1O4YA 3POJA 1PIV3 2JEMA 3N9NA 3ZFGA 1R081 2XJRA 3FZ3A 3J7NA 5LY2A 1XYNA 4BJ0A 5CFCC 1DCSA 1HXS3 1D2SA 3ZR5A 5KXDA 3A0NA 1ENRA 2WAAA 3CQOA 4GWNA 4M3CF 4QM9A 4CCLA 2A5ZA 4HOOA 1H8TA 2HWE1 4UFJA 2HWF1 4GJYA 4C1XA 4J6GA 3I2FA 2CGNA 4PF1A 4XUTA 5JR7B 1JYTA 4KH9A 5IAXA 1AYM2 5DUUA 3FUQA 3NL1A 1OBNA 1UNBA 3JD71 3PJYA 5CIRA 3RMYA 3N9OA 1SQ4A 3SNMA 5LBFA 3SH5A 1C8M1 1UPIA 2VZOA 2XWJB 3VBSC 1JS9A 4PBPA 2P5BA 2Y6LA 3ECQA 1IQDC 3CZJA 3EJKA 4BQYA 3LOBA 1JU3A 3FBYA 3VLBB 5J1XA 1PHMA 1ZRFA 4D94A 4GB31 4Y33A 3ZSJA 1UOBA 2PYTA 4LBNA 2P6CA 3GCXA 1OHFA 4I30A 2K0GA 5C3PA 5FZKA 2Q5TA 1GQHA 4RSUA 5JCTA 4AHXA 4MGTA 2CHHA 2MEV1 1S0BA 2VR4A 2YC2A 4AZZA 4CDXA 2IXKA 3S5QA 5BNPC 5KR7A 4GMP1 2WT1A 1W6MB 5LBBA 4P9GA 3M1HA 3UETA 1EYBA 1PK6B 3VZOA 5JI9A 3RGBA 1LHUA 3BVCA 5FXZA 1RMU2 2D3RA 3K2OA 4DXRA 2WN3A 1NCQB 1JU4A 1KDKA 5FZAA 2WDBA 3P3NA 2XBO3 3VKOA 4WVZA 3VBUB 2Q8EA 3BUCA 3L2YA 2VECA 1QIQA 1GUIA 4XFHA 3ZXFA 1JZ2A 1BEV3 5FY1A 1GNZA 1UZZA 5KHKA 4WM8C 5A32A 4XAEA 2X5IA 3MW3A 1YQ5A 1QJY2 2WWUA 5CZKA 5FZHA 3VHOA 4LULA 1TME2 4I2OA 1Q8SA 2W9XA 2Z69A 2HEWF 2J1UA 1FXZA 1QMJA 3AXDA 2YDEA 1UX7A 3NNMA 2RM23 4K8RB 5A7OA 2XWBB 3UJOA 2EXIA 3K4AA 3T2PA 2VGDA 5L73A 3ZMOA 4XTMA 2R062 5JMOA 2OX0A 3KGLA 2G4IA 1ZA7A 3N7KA 3O1PA 1AR82 1HKDA 1O5UA 3GJAA 1W6NA 1BBT2 4H14A 3T09A 3WLUA 1Y9QA 2VVDA 4OHXA 1DHKB 2WNUB 4IGOA 2GC3A 3EXUA 1K12A 2WUHA 3R4DB 1YQ6A 1UF2C 2WZR1 4WM7B 1G9FA 1R1ZA 1GZTA 2ORXA 4IGPA 4LBKA 4RHV1 1UCXA 2FD8A 4X6QB 1AYM3 3RVHA 5LB6A 1GQPA 2YB7A 4OHZA 4IV1A 2F6BA 1WMFA 2ZGPA 2DUPA 3LFIA 3P6BA 3SEEA 2WZPP 4FPHA 5GLVA 3W21A 1OOPC 2WQZC 2O1QA 1DFQA 3BALA 1VE0A 4QQOA 2WA4A 1NQDA 5HI0A 1X8EA 3MYXA 1FOD1 4OI0A 1VP6A 4XFFA 1PM4A 4XFCA 3ZMNA 3RZJA 1AYN1 4UT5A 4DFSA 1U5XA 5FYSA 3JQXA 3HD8B 3WY6A 5IK8A 1RB8G 4SBVA 3JZVA 3C2UA 4UFMA 3I49A 2W1UA 5HV0A 3N35A 1VIWB 1N1YA 4QQPA 3OF1A 3WNMA 5GZCA 5I91A 2XR4A 3K3OA 2QQVA 5CKMA 1R1A1 2XQXA 1B35C 4ISQA 3BTXA 2VOWA 5FPZA 2BUKA 2VCAA 2QBXA 2ARAA 4IE6A 1IOAA 4LHSA 3ZYHA 4AR2A 1FYUA 3LA2A 1RMU3 3I2KA 4HLTA 2WQ8A 5ANQA 3SH4A 4CDQC 5EIYB 5IVVA 3LWCA 1W28A 1RL3A 1FATA 5L7OA 2PTMA 2ZX3A 5FY0A 1YFYA 4GD4A 1QJFA 1UYPA 4Q0SA 1YEWA 5CG9A 4LLFA 3POFA 4KG8A 1OUSA 3VZNA 4MLOA 2VTFA 4CRQA 1ND2B 1YRZA 2VQTA 3W5MA 3ZIXA 5JOZA 2GC2A 2D6LX 2P4EA 1QJY3 4QKNA 4FPKA 2GP3A 4CCOA 4DNYA 2ZGSA 4XDOA 1TME3 1G86A 3AP4A 5HCFA 2WFF1 3ACGA 1WMXA 3OBRA 4D8MA 1H2KA 4E8CA 1GBGA 1ZBE1 3CNAA 4K9SA 3IPVA 2JG8C 5IVYA 4NUBA 4Q4W2 3TRSB 4AF9A 1DGWX 1ND3C 3NV1A 2VTXA 2DCTA 1SLLA 2R063 2ZGRA 1RUJ2 2RJKA 2Y6FA 3DPRC 3HQRA 3O5SA 1QJU1 5K0UC 1QU0A 1AR83 2B46X 3C8XA 3MPPG 1EP0A 3B94A 3ST7A 3VDCA 3EO6A 2CNAA 1BBT3 3MICA 3ACHA 3ZN6A 1W8UA 5EJ3A 1W6OA 4MVTA 1APNA 3ACFA 3WDWA 1QF3A 5F3CA 2KD7A 1PMHX 4UF0B 2JD9A 4Y22B 5FZBA 4JTNA 4YM1A 2A7AA 3AMQA 1O3SA 3LDKA 4A6OA 3AZYA 3PUIA 4JVAA 1QGLA 1NYWA 2QZ3A 4BK4A 5B4XA 2ZMLA 4QD2A 2GU9A 2WZ8A 4Q4X1 2VZPA 3SQOA 3KQ4B 2WNVC 4NAOA 5FP3A 4XMAA 3BOWA 1UY0A 4JKMA 1O4ZA 1YXWA 1EV12 1YQCA 4QX3A 2GAUA 3FJSA 5LW9A 4AFCA 4IE7A 1S0GA 4FOVA 3VBHA 2JDPA 2P17A 5FUNA 3T30A 5IVEA 5GZEA 3KV5A 3JU9A 4GWMA 4LHNA 2VXRA 2Z2SB 4BB3A 4FBFA 2XVKA 4Z07A 2PHTA 3UKTA 4JRLA 2JWPA 2Q1MA 5J96B 4YVSA 1Q56A 1SLCA 4F83A 1WD3A 4WBBA 5FY7A 4Q8LA 1RUOA 3THTA 2V4VA 3CIHA 4QX0A 4AK3A 3PMSA 4N7IA 3F2ZA 4CPBA 4O9EA 3KV6A 5A3MA 4QKFA 3VD4A 4J25A 2O0OA 1KFXL 4N43A 4RR3A 3N36A 3RZGA 5A7QA 3P1IA 2BNMA 4UFLA 5F5QA 5KC6A 5FZ0A 3K51A 4MGIE 3VN4A 2CY6A 3W5NA 3KF5A 3BODA 3R0RA 5LRRA 1DGRN 1US2A 3ETQA 3ZYFA 3KCYA 3N9QA 5FZFA 1MQTB 3C7FA 4HK9A 4NN0A 2IXLA 3C7GA 3SLIA 3UV9A 4QGNA 4BH9A 1EPWA 4Q4W3 5AVPA 2UWCA 1BLZA 1NLQA 1JYVA 1SACA 2G1MA 2R32A 1PK6C 5I0UA 1RUJ3 1HRI2 4M0NA 1WW4A 2NQYA 3AYEA 3OD0A 3CU7A 2XDVA 5LWBA 1LOBA 1VRH1 4NHLA 4JDMA 1AL0G 2B7YA 5IJRA 3JCIA 3MUY1 2DVAA 1C1FA 4I02A 4E4HA 2WN2A 4W4ZA 3CJXA 3VBUC 5C33A 4O61A 5C4WB 2UY9A 4CDUB 4L8QA 2WO1A 1GLHA 2ILMA 1HN0A 3SHRA 2X05A 3NSTA 3AJYA 3WCRA 4YSFA 2HWD1 3AP6A 5JPMB 2JB4A 3TNPB 3RYPA 3BGAA 1PVXA 5E89A 1S0IA 3D6EA 3SMHA 1UY2A 2OZ6A 1SZBA 1MEC2 1W8TA 2GNTA 5FLJA 5FMOL 5BNOA 1UOJA 1RUH2 3H7YA 2UY8A 2ZX2A 1U5ZA 5JZGA 1ALYA 4ZHNA 1EV13 3ZYGA 1UKGA 4CVUA 1LHOA 3GYDA 2FQPA 3K3NA 1UOGA 4XCBA 4Q2FA 1FNYA 3ORJA 2XL7A 4N53C 3GHNA 1FI2A 1O5LA 5BUVA 4NE9A 4QPWA 1STMA 4N90A 1R082 1SBEA 3ROUA 1Z7S1 1TNRA 1O91A 3E6BA 4W65A 2D7FA 1YUDA 2VNVA 2DTWA 2B4KA 1NA1A 2PHFA 4Y1VA 1DZTA 2W0XA 4UFKA 4WM7C 2RVAA 1GMMA 2BGCA 5GZFA 5I0RA 3TEWA 3O1VA 4LKSA 3RJ2X 2ET1A 1QOTA 3VBOA 1BK0A 2ZMNA 4CEWA 1HV0A 3ZSKA 3ILFA 4OHWA 3S7EA 4GH4B 4EQVA 3UL2A 3I54A 3WQ0A 5CEHA 4YGEA 3FL7A 1YJKA 3OJBA 4BQ2A 4CCKA 3GJBA 1N1TA 2AZ5A 5ACA1 3PL0A 1KRIA 2YMZA 4QHZA 3WD5A 3WR0A 3ZFEC 5F7UA 2FBEA 5A3PA 5FWEA 4Q4Y1 1OVSA 1K5MA 4BQXA 4MH0E 3M3CA 1NY71 2BVVA 3PU8A 5FOJB 5IVBA 2IUWA 3V0BA 1H1AA 2DCKA 3I2OA 1LAJA 2DU1A 2D5FA 2VVFA 3LSDA 2Q0AA 3ILRA 2P34A 1VMFA 1C5HA 1HRI3 3POIA 1GU3A 3A22A 4Z82A 4Z2WA 5KXCA 5IFPA 3U0ZA 1W9FA 3ZKYA 5DPNA 4Q27A 3AVSA 1SEFA 2HEYF 5SV8A 3LIHA 1OLME 1Q5OA 1NUKA 3AYCA 4B29A 2GNDA 3V56A 1FMD2 2ARXA 1W0NA 4PDWB 2OKXA 3WHTA 1H6YA 2GMEA 1UD1A 3C7HA 1EUTA 4IV3C 5LY1A 4I0BA 4QPIB 1XQNA 2ZCWA 1DGWA 1VBC1 2HWB2 4DO0A 1AF9A 1L7QA 1I9RA 2YHJA 4CP9B 4Y1YA 3PU3A 1P8JA 1IGOA 4MZUA 1MEC3 4YG0A 3ZSMA 4RS5C 2E32A 3AMMA 4NAMA 5C8CB 5LK7B 1RUH3 2XH6A 1H30A 4NIHA 2W47A 2O8OA 1MS9A 4Q5OA 1HLCA 4X8NA 3HPNA 5C3QA 3B9CA 2AUYA 5JR2A 1XE8A 5FZ6A 1ZRDA 1QH6A 1YQ8A 1R083 1OLQA 2BGOA 3AJZA 1O4TA 4P5HA 1AJOA 1EPZA 2Y64A 1XYOA 2BERA 2D97A 2J7MA 2XQRA 4XVHA 5CFDB 2BJSA 3T4HB 3FFQA 1NLSA 3UKNA 5IK7A 3KHBA 3WHUA 1NX9A 4OUSA 1NE6A 1HV1A 1YFXA 2GZWA 2BV4A 2XJSA 3WG1A 5FJKA 3WQBA 2ZEWA 5CNAA 3JD73 1YI9A 2LS6A 3W20A 3SITA 1LU2A 1W99A 5HPOA 5FZOB 2ERFA 3AKQA 4UFIA 1IG0A 1D4M1 3KT1A 4BISA 5IATA 1YNAA 5GLTA 2YGLA 2YZ4A 2R0HA 2RR11 3GBFA 3ON7A 3ZXGA 2X53S 2OYZA 4K20A 4WV8A 4FP2A 2C4XA 4XHBA 1V6JA 1WCKA 3OGJA 3OPZA 2Z42A 1VBE2 1YI7A 2ZBJA 5FIXA 3WNLA 1Y9GA 3ZXKA 1LOAA 3GZEA 3OOXA 1BMV1 2FCVA 2W08A 2ZHLA 2ZX4A 1NCRB 2IFRA 5H9RA 5HCHA 4IEXA 2PAMA 1R1A2 1HJFA 3F95A 4RQPA 5FCCA 3LEGA 1Q8PA 2IVIB 2CDPA 3ES4A 1H2NA 1XXNA 1SLAA 3IDBB 1UY3A 2CSGA 1CQ9A 5BV6A 1QJX1 2FCTA 1TVGA 4QXBA 5A3WA 3RMXA 1MS0A 1ZRRA 4PLOA 1DG6A 1URXA 3KT4A 3NO8A 5I0DA 2YFZA 5JIUA 4KGQA 2JDNA 1FMD3 3QH6A 1ENQA 1VBA2 5A80A 2ZX0A 3MO4A 1E5HA 5DDJ1 1V0AA 4TLGA 5DQ0A 2EIBA 2PLV2 3CJIB 4U36A 4GULA 2DV9A 3TEXA 2HWB3 2NYYA 2WT0A 2X29A 4JGZB 1JMUB 1LOFA 3ZXJA 4YRDA 2XVLA 4W6YA 5EYYA 1MQTC 5G05L 2E51A 3AZWA 1ZBE2 1I1EA 2D93A 4XQWA 1LTEA 2FHRA 5FTTC 3RJRA 1AR72 1Y43B 2IZWA 3FHQA 3ZYPA 4M01A 4AYUA 4MXWB 5FP8A 2JICA 3UT0A 3JB8A 4FFFA 1VBB1 1RJ7A 2I07B 3WEZA 1US3A 2VZVA 3NNGA 1U5YA 1UKRA 4Q8KA 4LE3A 3RRDA 1Y3TA 1MS5A 2A6VA 5JMCA 4GKXA 4AEKA 4D0QA 2ORZA 5C4WC 1UIJA 1C8NA 1OVPA 2ET7A 3B9IA 5CA6A 4FFGA 3WX5A 2F17A 5FZ3A 3RFRA 3TN92 2FZ1A 4XHXA 1BVP1 1S55A 4H7MA 2WYSA 4YW5A 1RUG1 2C9KA 4FOQA 4A3ZA 4BMBA 1QOSA 4ASLA 5JSPA 4WZFA 5F9TA 3MLKA 3OBAA 3UK9A 5CG8A 4B4RA 4QB6A 3AFGA 4QPGC 1L7LA 4FAHA 3ZYIB 4CCJA 3PUQA 1W03A 1RUI1 3M70A 4WVMA 5CVRA 2ZGMA 1IPJA 1UU4A 4YGCA 4IEWA 5IW0A 2EIGA 2WO3A 4EN8B 1GV9A 1OF4A 3VKLA 2E7QA 2FDKA 1V9U1 1VBE3 4UWDA 4YZ3A 4YZ4A 1LR5A 3ZFGB 4UYBA 3WP5A 4B8EA 4DIQA 5J48A 3WF0A 4A3XA 1QNYA 4JQTA 4HSLA 2YU1A 1GICA 4IL7A 4ES8A 5I93A 5FAXA 1CAWB 1R1A3 3I2DA 4XQ4A 3USUB 3O1RA 2IVJA 2ZHKA 3NJZA 1H8TB 3HMYA 3MV11 1RUD2 2ARCA 3MUZ1 4WVVA 4BQ1A 1K42A 2EAAA 4Q1RA 4XTPA 3HNBM 1W9SA 1QQP1 2JB8A 4GH4C 1RUE1 2FMYA 4YZ2A 4L2NA 1TNFA 2PA7A 3VD7A 4QM8A 4E4DX 1X50A 2VCBA 2XVGA 4MOAA 4PLNA 1VBA3 3VZLA 4EZ4A 2O14A 5CFCA 1RXFA 2P3YA 2VCCA 1K3IA 3OY8A 4LMFA 4OMDA 4HPKB 1POV3 2PLV3 4XZUG 1HQNA 3O1SA 1IPSA 2ZOEB 1UYYA 2GMMA 2WINB 4KBZA 4XC9A 2GC0A 2C9AA 2BPA2 1ZBE3 1JHJA 1HB1A 3I2JA 4FPJA 5HCAA 1KD7A 1W3XA 3M3QA 5DN2A 5F2WA 3THPA 4CDXB 1AR73 1T6GC 2VZQA 3U4SA 2XPJA 3OEAA 5FQ0A 3KCCA 5BNNC 4QQLA 1AR91 3T1MA 2QQUA 2HYKA 2ZXQA 2OPKA 3KGZA 1LCLA 2JENA 2R1DA 3LB9A 2KXLA 5CU1A 1Q43A 4HXCA 4PDWC 1W8FA 4M0HA 1ZBA1 3P3PA 1EY2A 2RG4A 2MNGA 1RJ8A 4TTGA 3GZUC 5FREA 4K7JA 5BNPA 1IS5A 4XOGA 3TN93 4QPIC 3VKMA 1XYPA 4OQ8A 2ZKLA 1S0JA 3BU7A 1W6QA 5D8AB 4AQTA 5A3TA 4AVTA 5C8CC 3H42B 1W6PB 4FPCA 1F35A 1G9BA 3SKVA 1MS8A 4IEOA 4CCEA 3BTZA 1JOBA 1RTVA 3VV1A 3PVEA 1G7YA 4FXKB 2VJXA 4F8AA 4JKLA 4EE2A 5C5TA 3ZO0B 1ZYBA 3D8CA 1SMVA 1FX5A 2Q1FA 5GM0A 3MPBA 1XNDA 4X8PA 1RVF2 5TSWA 3FUOA 4RN5A 4WM8A 1W6NB 4XQDA 2JKXA 2BNOA 4NVPA 1IS4A 3BB6A 3LA7A 5CFDC 2PHUA 4M3CE 4OHVA 3PIJA 3OUJA 1R091 4AFBA 4GWIA 4CA9A 5FYMA 3MI8A 3S0MA 1RUD3 3PVOA 3A23A 1X8MA 3PJQA 1SPPB 4L0PA 5LK5A 3MGUA 1CIYA 2BOJA 1J3RA 3N9PA 2EA7A 2VBDA 1MZ5A 5T55A 4XYXA 5BPXA 1AR62 3VZJA 4NRPA 4FSJA 2ID4A 2RS31 5A1AA 3POWA 3BIEA 2JDUA 1DQ6A 3AM2A 2AEZA 3THCA 1POV0 2DBIA 3DEMA 3W59A 3U1XA 4CP2A 3JXSA 2XL9A 5F3GA 3KV9A 3OPTA 1G8WA 2R041 2VZ3A 4DXSA 1GNHA 5C9AC 3SXWA 3WV6A 3W9AA 2X10A 3P5BA 5BYNA 2EXKA 4YW2A 5GZGA 5J36A 5FDBA 1NY72 2A70A 4LO8A 5APAA 4YM3A 1BKZA 2JDKA 2Q30A 4AE2A 4AEMA 2W68A 3WUCA 4P9IA 3AFKA 1XPWA 2H6CA 1FAYA 4XE9A 4DY5A 4BPZA 4M3CB 4Q4V1 1OOPA 1NXD1 3E1F1 1ZZ6A 3IMMA 4RL7A 3ZDSA 1ZZ9A 1DDLA 4META 3ZN5A 2D6OX 2GMPA 1NXMA 4QAWA 2JIGA 3NNFA 1K45A 4TN7A 1SFNA 4YVWC 1DQ0A 1QJZA 1GWMA 5A33A 4BA6A 4NMIA 4W6WA 4ZKTB 3MZHA 1PGL2 4JTOA 4NHYA 4Y20B 5LA0A 4KWKA 3CJIC 2VG9A 1VBC2 4CEYB 5I8YA 5ERLA 1J3QA 4P02B 3T2QA 3KCXA 1B35A 1MACA 1DQ5A 4MXVA 2HWC2 4AHWA 3H0OA 5FZCA 3VL9A 4O7XA 3ZM8A 2JDYA 3WQ7A 5JXIA 1LULA 2JE8A 2C0ZA 4ZPIA 3VBFB 1LRHA 3WG4A 4CDQA 1YFWA 4TLFA 2KR2A 4P9LA 2G19A 1F5JA 3FMGA 1QY4A 1JOJA 2P1BA 1SLIA 3R05A 4HANA 4YW1A 1S0EA 1S0FA 2R6QA 3AXEA 4UAPA 2RDNA 1NOVA 5T54A 4FFHA 2GN7A 4FCAA 3NQHA 4RYDA 1RVF3 2BU9A 3Q8CA 2RS51 2FMDA 3AZXA 2YG0A 3MFCA 4PIYA 5C8WA 2DCYA 3ZN6B 5ISLA 3IAPA 1GFF2 1W0OA 2LRPA 2VUAA 1GWLA 1OSGA 4GA9A 3U78A 4FPOB 5D21A 3ZLIA 1DLLA 4R8HA 5A7SA 3GDBA 5T5LA 2YC0A 2JG8A 1ND3A 1W2UA 3DF0A 3DKQA 3WF4A 3VB9A 4P08A 4NO4A 1KITA 2B5HA 5E16A 5K0UA 3AKRA 3DPRA 4U2AA 2JDAA 1GR3A 5FYTA 4AEDC 1AR63 1UU5A 4FQ4A 5K9YA 2NZ9A 4DEQA 1YLLA 3MF9A 2Y6KA 2AR6A 2P3IA 4DY3A 5IVFA 3V0AA 5A7WA 2YC4A 3RZLA 1C57A 4AVCA 5L9RA 4HBNA 1O7FA 4QQ2A 2D6NA 1GOGA 1IS6A 3VBHB 1GANA 4FTEA 1I3HA 1DYOA 3PNAA 5FYIA 2WYFA 3AYAA 4E2QA 1JYWA 1OT5A 3U14A 3E6CC 3RZMA 1ZX5A 3DXUA 1SLTA 4MSVA 4KMQA 1VBD1 3IIAA 3BTAA 3LAGA 4N9IA 4YVSB 2WJSA 1VJ2A 2HYXA 5T50A 4Y5Z0 1S2KA 2WNVA 4XPVA 2JECA 4AVSA 1UZWA 2SBAA 4IEUA 4QB2A 1U12A 4XUPA 2CAVA 3E97A 3VZMA 5T5PA 2VW2A 3K46A 2XLFA 3IDEA 1H1IA 2CYFA 2TUNA 5FYHA 1Z78A 2YYOA 3OBTA 4N43B 5KBFA 2AENA 3T4VA 4CDWB 2WS91 2VPVA 1RHI1 1ZNPA 3LOIA 4EYUA 2YY1A 5T5OA 4Z1VA 1TG7A 5A3UA 1ASJ2 2DFBA 3I97A 1VBC3 1J1TA 5DUXA 5FFOC 5EJ1B 2HWC3 5A7NA 4AG4A 5ABJC 4CTEA 1OPOA 2D44A 4C0BA 2X09A 3DUIA 4UW4A 1OKQA 1HJGA 3LEMA 1NZCA 2VUDA 4MHUA 4RA0A 4LJHA 3RI8A 1RGSA 1UQXA 4XF0A 2CDOA 3POGA 3AVRA 4UFHA 1RYYA 2IXHA 3VGIA 4BCUA 1VBB2 4QX8A 1PGW1 2YV8A 1C5IA 4V1PA 2VXJA 5F3IA 1OA3A 1UN1A 2CTVA 3H1MA 3WSOA 3LSEA 1MZ6A 4HK8A 4UXAA 1EAH1 3HN1A 1LGCA 5JXGA 4HZFA 3IM0A 3QBQA 4ZXEA 1YIFA 4IEVA 1JBCA 1YWKA 4KBBA 4EWEA 1W6MA 1QXRA 4E8DA 2RMU2 1PK6A 1XJAA 2QQMA 2ZGTA 3D0JA 4B1LA 2E33A 5JUVA 1CJPA 1MVQA 2J1RA 5D8AC 5J7MA 4MUVA 2ARBA 2ZS6B 2DVFA 4XMIA 1LGBA 1UYXA 4OQ9A 4TXWA 3UESA 4EWAA 3LF7A 2RR13 1PO12 3WP4A 2GALA 1XNKA 3VBUA 4CZSA 5FZLA 3H8RA 4HN1A 5EV7A 1CR7A 4DXTA 4B7KA 1YO8A 3J8F1 1BHGA 1MS4A 4KL1A 4QKBA 1VAMA 1HW5A 2UU8A 4JHTA 5CBLA 5FZ1A 2BNNA 4K1YA 3QCWA 4ASMB 1X36A 3PURA 4OYUA 2XUMA 4PCRA 2VUJA 4ZU5A 5LASA 2DUOA 1HRV2 4LEJA 4AFMA 4Y1UA 4BWOA 1ONAA 3TEYA 1JH5A 4YLZA 5FY4A 2BOIA 3FC0A 5GLWA 1O3TA 2E63A 2ZACA 2PHWA 2AC1A 4LPLA 2J1SA 3WNXA 1QQP2 5FPXA 4MGQA 2AH2A 3K4DA 4XF1A 3UYJA 1DGLA 3WDUA 4A6SA 3O1TA 2DTYA 3RZZA 4N53A 3POSA 4FI9A 4YGDA 1CD3G 1CAVB 1H8VA 4HMZA 5JLVA 2B39A 2PMWB 4QXKA 4R4XA 3T0AA 4NROA 1ASJ3 4NHXA 1TMF1 2OVUA 1SLBA 2P2KA 5A6YA 4WM7A 2N7GA 4J1XA 1H0BA 3G7DA 1ODNA 4XBQA 1J83A 3NNJA 3ZPYA 4Y1ZA 4G4FA 1LHVA 3V0BB 4O65A 2Y6HA 1ULFA 1SCRA 2NN8A 3OTFA 1W3VA 2XHNA 1CJDA 4OZXA 4AQSA 5FO9B 5M0TA 2DFCA 5J98B 3AK0A 2R30A 3C7OA 1OQDA 4LBLA 4XUNA 2ETEA 3DL3A 3PIGA 4CPBD 1VBB3 2RJLA 2YBKA 3B00A 3HT2A 4OI4A 2IWGB 1GZ9A 1RUF1 1HX6A 1LJ7A 2YROA 2Z79A 2ZPXA 4IGQA 3FFZA 3ZFEA 5HV4A 1PVC1 3CZUA 5FRAA 1DZQA 1GYKA 2EXJA 4YW7A 1XNBA 1PO21 3VD5A 3MBWA 3WP6A 2VMDA 1PIV1 1V6IA 1N3PA 2A73B 2I74A 1RINA 4PJYA 3DECA 1HXS1 2UYBA 4CEYC 5BNQA 1TE1B 1X9TA 3ACIA 2RMU3 4Y26A 1RUG3 3OG2A 3ZYBA 4XIOA 2A71A 2VH9A 1NCQC 5FZ7A 1S2EA 2EF6A 4HSJA 1AL22 2ZMKA 3VBFC 4B3NA 2P6HA 2E26A 3MHZA 1OUXA 2WWJA 3NV2A 4L99A 2W92A 3OGRA 1PO13 2NM1A 3D4KA 4J1WA 5I0SA 1XE7A 1H1MA 3BOPA 5FXWA 2K9ZA 3LIGA 1AX0A 4ZZ5A 2YXSA 1DYPA 1RUC2 4IV3A 1QH7A 1QXPA 4RFRB 4XJ8A 5C71A 4KU8A 4XAAA 3HR9A 4E2GA 1KS4A 4YYOA 1V6LA 3ZVXA 5F39A 1HRV3 1W2OA 2IXIA 4FPFA 3AP5A 3ABZA 4R9AA 4B7EA 5A6XA 4IEYA 1NAEA 2QQJA 2D6MA 2JG9B 1UU6A 4L92A 1D0GA 4RS5A 5EP9A 5FKCA 1CZSA 5T5JA 3JBG1 5CKQA 4G9SB 4YW3A 1QQP3 3K4ZA 1HDKA 4AFAA 1C1LA 5EYXA 1T2XA 3M8LA 2EICA 2PAEA 4LBQA 3ZFFB 2WNUC 5FOBB 5FR3A 3H1WA 3KB5A 4S2FA 4R9CA 4M4PA 1DIWA 1N3OA 5LA2A 4AVBA 3MLLA 1DQ1A 2J22A 2HBUA 2HBTA 2HWE2 4R9BA 2E53A 2HWF2 1UWWA 5LA1A 2XBO1 2R042 4CUAA 3VUOA 2YBSA 4I0AA 5A1FA 1GZWA 3JD72 2VTXJ 4BLIA 1H9WA 3OGGA 2WABA 4CU6A 1BEV1 3LCPA 2D98A 1C8M2 2OXBA 4LBOA 4ZS2A 5FY5A 3WW1A 4AAXA 3DXTA 3WF3A 4JCKA 3H8XA 1KXGA 4GALA 3TEZA 5C70A 1QEXA 3H3UA 4PT6A 5IT6A 2J1VA 2VL4A 4GB32 1COV1 1T6BX 2RM21 3N9LA 3OCPA 5EPAA 5KXEA 1G9DA 3NRUA 3NVCA 1BK1A 2C26A 4DEVA 2MEV2 1UZ0A 3DYMA 4ZU7A 4XBNA 3ALQA 3IB3A 2DVGA 1Q8QA 1ST8A 1ZBA3 2ES3A 4NRMA 1QNWA 3TNQA 1W05A 4CDWC 2P3KA 4ZU4A 3S7IA 2PN5A 1DQ4A 2XOMA 2EIDA 1WCDJ 3O12A 5LEKA 3KD4A 4IETA 3J26N 4GZ9A 4COWA 4AI2A 1O59A 1OQ1A 3I7DA 1JXNA 1LHNA 3QD6A 2B42B 1DLCA 1UIKA 1XE0A 1OFNA 1AL23 5DG2A 1AYM1 3NAPB 3NV4A 3EQEA 3CF6E 5A3OA 1ND2C 1E57A 4ATEA 1CAXA 4B4QA 1AX1A 2VOXA 4P9YA 1LOGA 3MEPA 1CZVA 1RUC3 3FHAA 3TYJA 1C4RA 2G9GA 2BQPA 3A7QA 5E8AA 3RI9A 4MV2A 1G9CA 3VDBA 3AMPA 2YBPA 4M00A 3HBZA 2WNEA 1EUUA 3WCSA 3RZKA 1MQTA 2GDFA 2D5HA 3OGSA 4XBLA 5EXOA 2BW8A 1CAUB 3U75A 1JN2P 1V6OA 3I59A 5FYUA 1F9KA 3GHMA 4Z2AA 5IYYA 5FYBA 4IE4A 3HWJA 1IG3A 4FOYA 1YFUA 4AWDA 5L36A 1I5PA 3VHPA 3HOBA 5AVAA 3UGGA 2DBNA 2HJIA 1PGSA 4XFGA 3BYWA 2W2IA 1CX1A 1BCXA 1W0PA 5B2GB 4S2GA 2WZR2 4XF9A 5C7GA 1UY4A 2W87A 4LO7A 5F8PA 2HWE3 3POEA 2HWF3 3J4UH 4GXLA 4CSWA 2R043 4RHV2 5FPLA 5C4WA 4H7LA 2QQIA 4AVVA 5FYVA 1V70A 1WLDA 4M4RA 1FNZA 3HQXA 1C8M3 3DN7A 4LK7A 4N7UA 4QPYA 3U11A 3PUAA 3EBRA 5KWRA 3LQCA 1QJY1 4D7YA 1OI6A 3MIFA 3AL6A 2SLIA 4FPGA 1DBNA 3NJYA 1E5RA 4Z8BA 2R49A 1H4GA 4NRQA 1WKYA 1FOD2 2A6WA 4GB33 1L7RA 4A42A 4QPGA 1G9AA 2Y0IA 1AYN2 4DPNA 1DF0A 1ENSA 4LO6B 3SKJE 4Q0PA 1WZXA 4HONA 2QVSB 2XUEA 2R061 3POBA 4MGZE 1KJLA 1UPSA 2MEV3 4OI2A 2WRAA 1AR81 4LA3A 3HNYM 3QOPA 1F4HA 2E7TA 4GMP3 2D6KA 1BBT1 2XJQA 1WBLA 2PQSA 1PX4A 5CFCB 3OY8B 4PBOA 1VAKA 3MF6A 2BZDA 4FOWA 4UW5A 4YGBA 5EJZB 5KXBA 4FXGB 1WA6X 3C3VA 4Q29A 2ZAAA 3VKNA 5AC91 1O3QA 2WR9A 4BQ3A 4AHYA 1YC61 2RDSA 4MYEA 1CZTA 3S5AA 2JJ6A 4GH4A 1IZ3A 4YPJA 3KM5A 3WNOA 2W5FA 2A3XA 4QDRA 4W8JA 2E7AA 5H9QA 4DQAA 1AXYA 1NE4A 5GZDA 4NIIA 3VDDB 1ODMA 1H4HA 4O9GA 5FQ0B 1AXKA 2GH8A 2A6YA 4A44A 3E5XA 1PGW2 3MFAA 1HQLA 2CU5A 1U0AA 1O8PA 5CADA 4OUEA 3K77A 2WFF2 5F5CA 4PIZA 1EAH2 3WUDA 3W58A 5J37A 4LIUA 1W8ZA 2ADEA 4KU7A 1JUIA 4JGYB 4OFGA 3WW2A 2Y33A 3U07A 1QJU2 1GZCA 3OYWB 2Q4SA 3LFMA 4TSVA 3VKFC 4AAPA 1XU2A 1ACCA 5BNNA 3G6JB 5FZ9A 2AACA 3O1UA 4TWTA 5L7OB 2FDGA 4CDUC 1JYNA 2CL2A 2WZR3 3LGRA 4H55A 1X7NA 2ZJCA 3SCFA 1OXCA 4D69A 3KVBA
chains in the Genus database with same CATH topology
4Y4YA 4JDOA 4PDWA 4RHV3 3WDTA 3ZSLA 4Q0VA 3VBSB 1N1VA 3VBRB 2JDZA 4Q4X2 4QPIA 5HXVA 5DZGA 4Z92B 5E1RA 4KGGA 3ZXLA 1YHFA 3APBA 1FV2A 2JG9C 2IFWA 2QNKA 5C8CA 1FOD3 5BY5A 2ZAHA 5JOXA 1I5ZA 2X8KA 1AYN3 1Q8OA 1LEDA 3PVNA 3AKTA 4Q4W1 4A7YA 3ZYJB 4YW4A 1RUJ1 1MS3A 2OZJA 3KSCA 2WLPA 3QLQA 4GMP0 2H0BA 3ZFFC 4BE3A 1ENXA 4Q0UA 1ZM1A 3K48A 3IDCB 3MIDA 3KT7A 1OMIA 5GJ6A 5DUVA 5CFDA 2AGSA 3RQ0A 4TYSA 2EAKA 5JI7A 1ULGA 1DU3D 1YYNA 3N7LA 1O3RA 4YZ1A 2BVBA 3H8UA 1M4WA 4ONUA 4YNIA 4DXZA 2VMGA 2LTNA 3MIBA 2R1BA 3GF6A 2ZHNA 4UW6A 1RITA 2G9FA 2V73A 1J1LA 2B8MA 4YARA 4AQ6A 1KQRA 2V09A 4MX3A 1OOPB 2GNBA 2QFEA 4EN9B 4E9KA 3ZXDA 1EV11 2WFF3 5C9AA 3INAA 2JKBA 3HAGA 4FTSA 1KFUL 1EAH3 1PO22 2F4PA 3ES1A 1V6NA 1CX4A 3AZVA 2XB6C 4DRRA 5A33B 3WG2A 4COZA 2CGPA 4FPEA 1QJU3 2PHLA 2GNMA 2D40A 3TOJA 4BLJA 3B3QE 1VRH2 1KS5A 1B35B 3E6DA 3WOGA 3WP3A 4JC1A 3NAPC 4CDQB 2WT2A 2DURA 3M2MA 4JAAA 2XKPA 1C3HA 4YVWA 1H2MA 1MS1A 2ENRA 3JB4C 1Z0HA 2HWD2 5A32B 2X5IB 3D82A 1ZA4A 1AVBA 3WW4A 5GALA 4Q4X3 2MPFA 3CJIA 1H9PA 3WXPA 4DINB 1YCIA 3RYKA 4K21A 4ZXKA 2Y38A 4DZGA 3JBG2 5CB7A 1DZRA 4AI0A 1OLRA 1W39A 4XILA 4I0WB 2WC2A 5K0UB 5HBAA 1Z7S2 4PF5A 4MXWA 4DMIA 4KWLA 4C90A 1HRI1 4E27A 4BHPA 2CGOA 3M3OA 3ZXEA 1RIRA 1FV3A 2XGXA 1JTZX 2E9QA 4LHLA 1LHWA 5AFBA 3I4IA 1MZEA 4FVVA 4K1ZA 5KHHA 2QDNA 2XHKA 4BMEA 4IV1B 3AYDA 2CWMA 2P3JA 4CP1A 2ZGNA 4AEDA 5ACA2 5KHGA 1N47A 4LTAA 3VZKA 3RDIA 1COV2 1BXHA 1MEC1 2QZ2A 2VQ0A 3H3ZA 4Q4Y2 1RUH1 1RUF3 2RHPA 1WW6A 2VNOA 2UWBA 2NMOA 3ELNA 3O14A 3SISA 4R52A 3JUUA 1PO23 5JSOA 5GKAC 1NCRC 3PTYA 2R16A 1UMZA 2VOVA 1WLTA 1AZDA 4HKWA 4OULA 3GBGA 4LE4A 2H6BA 1CAWA 3USUA 1JW6A 2PQQA 1VRH3 2D6PA 4K8FA 3POYA 1LGNA 1LESA 2W39A 4AEJA 4D7SA 3FLRA 3AP7A 4K40A 4HETA 2A75A 2OUHA 2WIIB 4OHYA 4S2DA 4HKOA 2Z5WA 3VDDC 2VNGA 2QKDA 1ZZCA 2HWD3 5KHJA 4JGZC 5JIAA 3DKWA 1DQ2A 2AYHA 4HPKA 3RSJA 4FAGA 5I8TA 1LECA 2R0FA 4I3PA 5EWSA 3UKVA 1QXJA 5ABJA 5C6CA 3IPVB 5L19A 4JGYC 3KS7A 4HL0A 2NPIA 1NG0A 3JBG3 3E5QA 5F6LB 3L2HA 4JRAA 3IT8A 1XU1A 4P9WA 2ZZQA 1Z7S3 2QCSB 1I6XA 1OPMA 5A3LA 2V5YA 2PELA 1REFA 1W6OB 4XFAA 5L7OC 3S30A 2IXJA 5JDBA 5FO8B 1AX2A 2PHRA 3HIFA 1FMD1 4BOWA 4L97A 1REDA 2DU0A 4PBPA 1X33A 2XLAA 4I09A 3VBSC 4NWWA 4NHMA 3VBRC 5AFEA 1TEIA 1IHMA 4XXPA 1MR5A 4ES9A 1D4M2 2HWB1 4F3JA 3SH3A 5D8AA 5ACA3 2YUEA 4XF4A 2RR12 1REEA 3PVBB 1UAIA 3R6SA 1PM7A 1COV3 3V65A 1W6PA 3V64A 3LZZA 4Q4Y3 4AI3A 3M3EA 2KA3A 1WBFA 1LODA 3D0SA 3KMHA 1JHNA 1BMV2 3ZFGC 4DOUA 4AVAA 3H1YA 4N53B 3WVJA 3ZSEA 3VHNA 1QKQA 4OLLA 1CVNA 3HT1A 1AJKA 1H8TC 3M3IA 1QJX2 4XETA 5AC92 3OD4A 3A0KA 3B69A 4YZ5A 4RR3B 5F6KA 2NLRA 2JE7A 3ACLA 3AKSA 3O0WA 2BFUS 5DDJ2 3CO2A 3RWNA 1VR3A 4RGGA 1ULDA 2PHDA 3NV3A 4MGKE 4OVEA 4LT5A 5IK4A 2RS11 3ZFEB 1H2LA 2I2SA 4XJUA 1PZ8A 1IKQA 1Y7BA 2VOKA 1FPN1 1VBE1 4CDXC 4BYYA 4RFT0 2UWAA 1XNCA 1CPNA 2AREA 2QJVA 4M3CA 4IQPA 4LHKA 1ZREA 2RE9A 4OUMA 2JXAA 3TB0A 1YJLA 4FP3A 3WQ1A 3CEWA 3LKJA 4UW3A 2XKOA 2ZGQA 4EN0A 1Q8VA 1VBA1 2X5IC 4Y20A 2EALA 1RUG2 3ZN4A 4IV3B 1M06G 4CEYA 5FLIA 4AI1A 1VB2A 1POV1 2PLV1 4P9XA 4QGMA 1D4M3 4PIXA 5BNOB 1JYCA 4OI1A 1NCQA 1RUI2 5JZGB 3VBFA 3NW4A 2WFPA 2ZTNA 1CPMA 4RS5B 3RS6A 2TEPA 4D7TA 3D5OA 1V9U2 4LA2A 1AR71 2OA2A 4E2SA 2B45X 3WG3A 4LBQB 1BJQA 3DV8A 3E5UA 2XJVA 1WW7A 1SBDA 2TBVA 3MDPA 5FMOS 4SLIA 1NA1B 4PLMA 5IUQA 4COUA 4QT6A 4P9JA 4C1WA 1J59A 1QJX3 1ZZ8A 2R071 3VBOB 4EROA 4CEWB 1RUE2 4JQRA 1GZWB 4QGLA 5AC93 3TBDA 4QHBA 4QQHA 1BQPA 3KZ4C 3AMHA 4IV1C 3TN91 1Q3EA 5DZEA 1CGPA 1AHSA 2WNUA 3R4UA 3USSA 3GZAA 5DDJ3 5HCBA 1SFYA 3IBMA 4AXOA 4DB5A 2Q8OA 3BPZA 3RG0A 4W6XA 4B4PA 2H0VA 5H9PA 1XRUA 1K5MB 2NMNA 5J09A 3BIWE 1MVEA 4A7KA 1WCSA 3RPQA 4AFDA 3MIHA 5F1RA 1CIWA 5EFUA 1DGRA 2BFUL 3PHMA 3EHKA 4RGAA 1AR92 1U5IA 4LUKA 1V00A 5CAZA 2VULA 5JSRA 1WUVA 3SCGA 2OUJA 4IEQA 4AI8A 1RUD1 2JE9A 3O7OA 1ZRCA 2GH2A 5GLUA 3SCHA 1ZBA2 2Y0OA 4ITCA 4I3GA 1CESA 4CDWA 1CAXB 4HFSA 4LLOA 4I01A 4YFWA 2XJPA 4D3WA 2QE3A 1RUI3 4YG3A 1A8MA 1NQJA 2D43A 4BIOA 4YM0A 3I59B 1V9U3 1ND2A 3T2TA 1WLWA 3DGTA 2E6VA 3M7AA 1VALA 5E88A 2W52A 3FLTA 4Y1XA 1R092 4ISRA 3B01A 3MLJA 4BM8A 1UL9A 1A78A 1ZZBA 2LUWA 4IEZA 1RUE3 3NKGA 5SV5A 4XJ9A 4NPRA 3FE5A 3RYRA 2A6ZA 4XIKA 2DVBA 3TAYA 2RS32 3AP9A 2ZX1A 4Q1PA 3R4SA 4FQZA 2VMHA 4LBMA 4UBHA 4KWJA 4QX5A 3ZXAC 1B09A 3CL1A 4QPGB 4HKLA 3U4XA 1SBFA 4LBQD 3VL8A 3MW4A 4Y22A 3VBHC 1N3QA 4TZDA 2ZABA 4C0HA 2VVEA 3ZIWA 1FT9A 4XJWA 2GSYA 1RVF1 4YVSC 5FLHA 1WGPA 2A3WA 4Q4V2 1V6KA 4RQPB 4C91A 1AR93 1CONA 1PNFA 4CP0A 5BXXA 4AGVA 1X82A 1QHDA 2HKXA 4LR4A 3U10A 1JYIA 1L3JA 4N43C 1A6CA 4RR3C 5J3UA 3A4UA 4A7ZA 5FO7B 2YGMA 2WKKA 1AR61 1CAVA 1IQAA 2BWAA 4ORFA 3GNEA 1SDWA 1LEMA 2C1FA 2ZGLA 2ZZJA 5I8SA 1OA4A 1PNGA 3H50A 5H9SA 4XW3A 2BEOA 1RC6A 3X29B 4R4ZA 4URTA 4FPLA 4XJAA 1WA4A 2TNFA 3NWKA 4IESA 2IXCA 2RS52 3ENRA 3FWEA 4NOTA 4Y24A 3TWIA 5BNNB 4LNVA 1AUYA 3WT3A 3IMNA 1OA2A 2A6XA 1J58A 1R093 4L11A 4AQ2A 3GBWA 3MIGA 3FLPA 2VNRA 4GIQA 4LO4B 2UYAA 4KNCA 2ZGOA 4EN7B 5LRSA 1ZZ7A 1PGL1 4XF3A 3ASIA 3WW3A 4AHZA 2RS33 1RUNA 5BNOC 2VW0A 1RMU1 1TQ5A 2HWC1 4IEPA 5JZGC 2Q1ZB 2GN3A 4HN0A 2CAUA 4WVMB 2WSVA 4CDUA 2WL1A 2EVXA 4DRVA 2VY0A 4YG6A 2BWCA 2DCZA 4EWDA 1VBD2 2EXHA 1LB2A 1NLRA 1NA1C 1TME1 1A8DA 5DZFA 4Q4V3 4NWVA 2JG9A 3VBOC 4QMAA 1DYKA 4CEWC 4BIFA 1QDOA 2XJUA 4XDQA 1ULCA 2QQPA 2WS92 2K2SA 2XJTA 1RHI2 2ZGUA 4XEZA 3ZFFA 4K3UA 1YIPA 4BZ4A 3N3HA 4DS0A 3PMEA 4P14A 2NP0A 1F31A 2RS12 3AB0A 1HIXA 1S0CA 1K5MC 2DF7A 2PFWA 1PMIA 4A2UA 4GQ7A 5C9AB 3WZ1A 1LOEA 2DVDA 2YPJA 4E4SA 3UJQA 1FPN2 4F7ZA 5K7PA 1QDCA 3H7JA 4HVRA 2WLQA 2ZA9A 4FPYA 4X6RB 1UW8A 2ZGKA 3B02A 2RS53 3L9JT 5D1IA 1SCSA 2OW4A 5T52A 4LUMA 3QACA 5KHIA 4CYDA 2HEVF 2MHFA 3KQRA 4YVWB 1VLNA 5BNPB 1LU1A 1MZFA 3WINE 2DCJA 3B93A 3N7JA 3FX3A 4S2HA 3ZYRA 1CN1A 1HQWA 4L9BA 3AX4A 1BZWA 4UBGA 1F2NA 2C5DA 1OQEA 4COYA 1W6QB 3IKWA 1ASJ1 3QH7A 4HVOA 1BVVA 3WDXA 3AMNA 5JOWA 1WMDA 3WDYA 3NAPA 3GALA 4WVWA 4COVA 3J8F2 4E4ZA 5JOYA 5DUWA 3O0XA 4AGRA 2A3YA 4QU2A 2D3PA 2FZ2A 2QUOA 4WM8B 1C28A 1GKBA 1WD4A 1F8VA 1VBD3 4AGGA 4R9DA 5KC5A 3J9SA 1D2QA 4FO9A 2O8QA 4EN6B 4N9HA 5T3NA 4ATFA 2R072 1G6NA 1CAUA 1S1AA 3LA3A 3ZX7A 3MW2A 1JUHA 3B7MA 2QDRA 4HT1T 4EV0A 2WS93 1D0HA 2RMU1 1RHI3 4AEDB 1D4VB 1PZ9A 1TMF2 1GQGA 3JQWA 3MIEA 1F5FA 2CWSA 1IS3A 2RS13 5LEJA 1PO11 2GC1A 2PAKA 3S6PA 5DG1A 4INDA 5DXDA 4FTBA 3NKTA 1FPN3 1J3PA 4K6BA 3ME2A 4JV4A 2LALA 5GLZA 4RD7A 3IN9A 4RQPC 2I45A 2OIIA 4NHKA 1HRV1 1BYHA 4XZPA 3AZZA 1RUF2 5IK5A 1PVC2 3KLSA 3O0VA 2JX9A 4IERA 4KQ7A 1AXZA 3IWZA 4H3WA 1IKPA 1VB4A 3AKPA 3T1LA 1LENA 1PIV2 2VW1A 1WLCA 2P37A 1NCRA 1HXS2 1OFSA 4WZCA 1ZVFA 3BCWA 2BTVC 3Q9OA 2DWRA 2VU9A 3N4MA 3CLPA 1LOFC 4FT8A 4YFZA 1IPKA 4LO5B 1A3KA 2KM2A 2LM3A 2XG3A 4XXAA 5ABJB 2DYCA 1VAVA 3PLQA 1UZYA 5JPNB 1V6MA 3WDVA 3J8F3 5I0TA 1S2BA 4G3YC 5K8SA 1ULEA 3N7MA 3URFA 3VDDA 2BYVE 2D3SA 2WSUA 4IXLA 5EZWA 2VMIA 4NR1A 4JDNA 2ATFA 2DUQA 4JGZA 1UX6A 2PHXA 2Y26A 2VQAA 1LKNA 2WQ4A 2JG8B 2R073 1ND3B 4JGYA 4KG0A 4XFIA 1LOCA 5JVVA 3OYWA 1OD5A 2JD4A 3DPRB 3FBMA 1QWRA 4LBJA 3FHIB 3RNSA 2BBVA 2UURA 3V0AB 1S0DA 2XBO2 4MGYE 1TMF3 2B9UA 2ZKNA 4HVQA 1AL21 5L7OA 3VHRA 1GSLA 3B5LB 4AW7A 3M4FA 1QOOA 4YM2A 3I8TA 4Q26A 1BEV2 5FBZA 1WW5A 4XJZA 2WA3A 3VBSA 2XLGA 3GZTB 3VBRA 2IC1A 1RUC1 3ATGA 3H9AA 4XFBA 4EJRA 2WNVB 1PZ7A 2RM22 1KJRA 2WWSA 1WMEA 2CV6A 3ILNA 5JWPA 1PVC3 4GKYA 4PQ9A 1KDMA 4Q0QA 2ZHMA 1N1SA 1O4YA 1PIV3 2JEMA 3ZFGA 1R081 2XJRA 3FZ3A 1XYNA 5CFCC 1HXS3 1D2SA 5KXDA 3A0NA 1ENRA 4GWNA 4QM9A 4M3CF 2A5ZA 1H8TA 2HWE1 2HWF1 4C1XA 4J6GA 2CGNA 5JR7B 4KH9A 1AYM2 5DUUA 3FUQA 3NL1A 3JD71 3SNMA 3PJYA 5CIRA 3RMYA 1SQ4A 3SH5A 1C8M1 1UPIA 2XWJB 3ECQA 3EJKA 3LOBA 3FBYA 3VLBB 1PHMA 1ZRFA 4D94A 4GB31 3ZSJA 2PYTA 4LBNA 1OHFA 4I30A 2K0GA 2Q5TA 1GQHA 4RSUA 5JCTA 4AHXA 2MEV1 1S0BA 5BNPC 4CDXA 2IXKA 4GMP1 2WT1A 1W6MB 4P9GA 3M1HA 1EYBA 1PK6B 3VZOA 5JI9A 1LHUA 1RMU2 2D3RA 1NCQB 1KDKA 3P3NA 2XBO3 3VKOA 4WVZA 3VBUB 3L2YA 2VECA 4XFHA 3ZXFA 1BEV3 1GNZA 1UZZA 5KHKA 4WM8C 5A32A 2X5IA 3MW3A 1QJY2 3VHOA 4LULA 1TME2 4I2OA 1Q8SA 2Z69A 2HEWF 1FXZA 1QMJA 3AXDA 2YDEA 2RM23 2XWBB 3UJOA 2EXIA 2VGDA 5L73A 3ZMOA 4XTMA 2R062 3KGLA 2G4IA 3N7KA 1AR82 1HKDA 1O5UA 1W6NA 1BBT2 4H14A 3WLUA 1Y9QA 2VVDA 4OHXA 1DHKB 2WNUB 2GC3A 3EXUA 3R4DB 1UF2C 2WZR1 4WM7B 1G9FA 1R1ZA 4LBKA 4RHV1 1UCXA 4X6QB 1AYM3 4OHZA 4IV1A 2F6BA 1WMFA 2ZGPA 2DUPA 2WZPP 4FPHA 5GLVA 1OOPC 2WQZC 2O1QA 1DFQA 3BALA 4QQOA 2WA4A 1NQDA 5HI0A 1X8EA 3MYXA 1FOD1 4OI0A 1VP6A 4XFFA 4XFCA 3ZMNA 1AYN1 4DFSA 1U5XA 3JQXA 3HD8B 3WY6A 5IK8A 1RB8G 4SBVA 3JZVA 3C2UA 3N35A 1VIWB 1N1YA 4QQPA 3OF1A 5GZCA 5I91A 1R1A1 1B35C 4ISQA 2VOWA 5FPZA 2BUKA 1IOAA 1FYUA 3LA2A 1RMU3 4HLTA 3SH4A 4CDQC 3LWCA 1RL3A 1FATA 2PTMA 2ZX3A 1YFYA 4Q0SA 5CG9A 4LLFA 4KG8A 3VZNA 4MLOA 4CRQA 1ND2B 1YRZA 3ZIXA 5JOZA 2GC2A 2D6LX 1QJY3 4FPKA 4DNYA 2ZGSA 1TME3 1G86A 3AP4A 5HCFA 2WFF1 3OBRA 1H2KA 1GBGA 1ZBE1 3CNAA 4K9SA 3IPVA 2JG8C 3TRSB 4Q4W2 4AF9A 1DGWX 1ND3C 3NV1A 2DCTA 1SLLA 2R063 2ZGRA 1RUJ2 2RJKA 3DPRC 5K0UC 3O5SA 1QJU1 1QU0A 1AR83 2B46X 3MPPG 1EP0A 3B94A 3ST7A 3EO6A 2CNAA 1BBT3 3MICA 3ZN6A 5EJ3A 1W6OA 4MVTA 1APNA 3WDWA 1QF3A 4Y22B 4JTNA 4YM1A 2A7AA 3AMQA 1O3SA 3AZYA 4JVAA 1QGLA 1NYWA 2QZ3A 2ZMLA 4QD2A 2GU9A 4Q4X1 2WNVC 4XMAA 3BOWA 1O4ZA 1YXWA 1EV12 2GAUA 3FJSA 4AFCA 1S0GA 4FOVA 3VBHA 2P17A 5GZEA 3JU9A 4GWMA 4LHNA 2VXRA 2Z2SB 4FBFA 2XVKA 4Z07A 2PHTA 3UKTA 4JRLA 2Q1MA 5J96B 4YVSA 1Q56A 1SLCA 4F83A 1WD3A 4WBBA 4Q8LA 1RUOA 3THTA 4AK3A 3PMSA 4N7IA 4O9EA 5A3MA 2O0OA 1KFXL 4N43A 4RR3A 3N36A 2BNMA 5F5QA 5KC6A 3K51A 4MGIE 3VN4A 2CY6A 3BODA 3R0RA 5LRRA 1DGRN 3ETQA 3KCYA 1MQTB 4HK9A 4NN0A 2IXLA 3UV9A 3SLIA 4BH9A 4QGNA 1EPWA 4Q4W3 5AVPA 2UWCA 1SACA 2R32A 1PK6C 5I0UA 1RUJ3 1HRI2 4M0NA 1WW4A 2NQYA 3AYEA 3OD0A 3CU7A 1LOBA 1VRH1 4NHLA 4JDMA 1AL0G 2B7YA 3JCIA 2DVAA 1C1FA 4I02A 5C33A 3CJXA 3VBUC 5C4WB 2UY9A 4CDUB 4L8QA 1GLHA 2ILMA 3SHRA 3NSTA 3AJYA 3WCRA 4YSFA 2HWD1 3AP6A 5JPMB 3TNPB 3RYPA 1PVXA 5E89A 1S0IA 3D6EA 3SMHA 2OZ6A 2GNTA 1MEC2 5FLJA 5FMOL 5BNOA 1RUH2 3H7YA 2UY8A 2ZX2A 1U5ZA 5JZGA 1ALYA 1EV13 3ZYGA 1UKGA 1LHOA 3GYDA 2FQPA 4Q2FA 1FNYA 2XL7A 4N53C 3GHNA 1FI2A 1O5LA 5BUVA 4N90A 1R082 1SBEA 3ROUA 1Z7S1 1TNRA 1O91A 3E6BA 4W65A 2D7FA 1YUDA 2DTWA 1NA1A 2PHFA