1ZRRA

Residual dipolar coupling refinement of acireductone dioxygenase from klebsiella
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
179
structure length
179
Chain Sequence
SALTIFSVKDPQNSLWHSTNAEEIQQQLNAKGVRFERWQADRDLGAAPTAETVIAAYQHAIDKLVAEKGYQSWDVISLRADNPQKEALREKFLNEHTHGEDEVRFFVEGAGLFCLHIGDEVFQVLCEKNDLISVPAHTPHWFDMGSEPNFTAIRIFDNPEGWIAQFTGDDIASAYPRLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A refined model for the structure of acireductone dioxygenase from Klebsiella ATCC 8724 incorporating residual dipolar couplings
pubmed doi rcsb
source organism Klebsiella oxytoca
molecule tags Oxidoreductase
molecule keywords E-2/E-2' protein
total genus 22
structure length 179
sequence length 179
ec nomenclature ec 1.13.11.53: Acireductone dioxygenase (Ni(2+)-requiring).
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03079 ARD ARD/ARD' family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1zrrA00
3NSTA 3USSA 4YARA 1CX4A 2CGPA 1Q43A 2PTMA 1X8MA 2XLFA 4KWLA 4Q0VA 5E16A 1SEFA 3I59A 1YWKA 4N9IA 1J1LA 2WC2A 4DINB 2ATFA 5KHGA 3GBFA 4LTAA 2HJIA 3VHRA 4QM9A 5C8WA 4META 2ET1A 5FCCA 2BNNA 5HI0A 4EWDA 4XFGA 2D93A 3E97A 3PVBB 4EWAA 1EP0A 3H8UA 1V70A 4LULA 2F4PA 4LUKA 3H1MA 3H7JA 1DZTA 2UY8A 2GC2A 4XF1A 3BB6A 1VR3A 5I0UA 4A2UA 2PHLA 4QGMA 4EWEA 4XFHA 2PAMA 3H9AA 2N7GA 4IEUA 4YYOA 5C6CA 1YFWA 1Q5OA 2IXJA 3LA7A 4IEPA 4IEOA 2D40A 1NZCA 2C0ZA 4QGNA 3UKVA 2IXIA 3WW4A 1NE6A 1ZNPA 4AXOA 2FQPA 2GZWA 1YLLA 3RPQA 1GQGA 2OZ6A 3GYDA 3RYKA 4TLFA 5BXXA 3IBMA 4IEZA 1ZZ8A 4KU8A 2XLGA 2OZJA 4RD7A 1NXMA 5KHIA 1YFYA 2GC3A 1J59A 3I54A 3EQEA 2EA7A 3DN7A 2GAUA 4HN1A 4JTOA 5K8SA 4HVOA 2Z2SB 3KSCA 1YHFA 3SCFA 3WW2A 3HT1A 3EBRA 5I0TA 5FQ0B 3O14A 1DZRA 1LR5A 3TNPB 1O7FA 2XLAA 4Q0SA 4PIYA 4X6RB 3E6DA 4OLLA 3ROUA 3QACA 3CL1A 4LA2A 2QCSB 2GH2A 1CAVA 4XFFA 3E5UA 1IPKA 4MGKE 4I09A 3KGLA 1CAXA 4KWKA 3LAGA 4JV4A 5JAXA 3ES4A 2QJVA 3QOPA 1RL3A 2Y0OA 3E6CC 4ZU7A 2ET7A 2GU9A 3IIAA 4D7TA 5JR7B 2BGCA 3NKTA 1UD1A 3U11A 2D5FA 1QXRA 2PFWA 2IXHA 3FJSA 3NVCA 1J58A 1ZREA 4I01A 4XFBA 2H6CA 1XE7A 3ELNA 1ZX5A 4HLTA 3RYRA 4IEWA 2D5HA 4B29A 1LKNA 1GQHA 3IDBB 1EY2A 1YFXA 1J3PA 2KXLA 3FE5A 4IETA 3UKNA 3H3UA 3HT2A 2GC0A 3MYXA 4HMZA 5I8YA 1FI2A 1XRUA 2MPFA 1CAXB 4Q29A 5I91A 5BPXA 3MDPA 4XF4A 4F8AA 1VP6A 2IXKA 2K0GA 4MX3A 4X6QB 1TQ5A 4YSFA 4XETA 4IEQA 4FAGA 4HSLA 4P9GA 5FLIA 1UIKA 3SCHA 4XF9A 3IDCB 4YNIA 2XKOA 4IEVA 3SXWA 2B9UA 1CAVB 5EZWA 2DCTA 3KCCA 4MV2A 4EROA 4EV0A 2OPKA 2MNGA 4CYDA 2PQQA 1CGPA 5FQ0A 4XFIA 1DGRA 3KMHA 2FMYA 4KL1A 4L2NA 4H7LA 4ZU5A 3RZZA 1CAUB 2PAEA 3I7DA 2B8MA 4I02A 4J1WA 1Q3EA 3UKTA 1OI6A 4LUMA 3EJKA 4KU7A 4WZCA 3TNQA 2HKXA 3PLQA 1X7NA 5FLJA 4OFGA 5I93A 3RYPA 1O3QA 3IWZA 3H7YA 1H1IA 4MZUA 5I8SA 4E2QA 5T3NA 5KHHA 4PJYA 1RUNA 3NW4A 1ZZ7A 3H1WA 4I3PA 4Z82A 2IXLA 4L11A 2Q0AA 1WGPA 1FT9A 5LRSA 4K8FA 1I5ZA 4NVPA 4AQ6A 1ZRRA 1O3RA 3HQXA 3OTFA 4AQ2A 2H6BA 4R52A 4J1XA 1NYWA 2UY9A 4YRDA 3JZVA 2MHFA 2EVXA 3PNAA 4QMAA 1H1MA 2Z69A 1ZZCA 3S0MA 1EPZA 2Q4SA 5FPXA 4WVZA 1YUDA 4Z07A 3FX3A 3S7EA 2VQAA 1PMIA 3FZ3A 3ST7A 1ZZ9A 3BU7A 1Y9QA 5D1IA 4R8HA 4UBHA 2B5HA 2QVSB 5FLHA 4I0BA 1O3TA 1J3QA 1ZZBA 4XF0A 4GULA 4Q0UA 4XFCA 3D0SA 1QY4A 4HVQA 3LA3A 4LEJA 1O4TA 3LZZA 4JVAA 3ETQA 1ZRCA 4MGZE 1O5UA 1RC6A 2XL9A 3L2HA 3C3VA 1EYBA 2H0VA 3EHKA 4HBNA 4E2GA 3DV8A 4BH9A 2WFPA 4ZU4A 4MH0E 5CADA 3H3ZA 4UBGA 3SMHA 3OD0A 3CF6E 4LA3A 5CU1A 3RNSA 2EAAA 1O3SA 3CLPA 1DGWA 3I59B 5CVRA 4F7ZA 1OFNA 1UCXA 5JSPA 3H1YA 3OCPA 4HVRA 3HIFA 3EO6A 1CAWA 2OYZA 4IERA 3NJZA 1L3JA 3CO2A 4FBFA 3OF1A 3LA2A 3R6SA 4MGYE 3BALA 1SQ4A 3CJXA 1RUOA 4LLOA 5JSOA 2BNMA 2O1QA 1SFNA 1X82A 4BYYA 3BCWA 2P17A 4Q0PA 2UYBA 4I2OA 4D7SA 2BEOA 2PYTA 3U0ZA 5I0SA 2CAVA 1Y3TA 2XKPA 2XGXA 3DKWA 4E2SA 2IXCA 3ZDSA 5BUVA 5I0RA 2CAUA 5KHKA 3CEWA 1RTVA 4O9EA 5LEKA 4AVAA 1UPIA 2E9QA 2CV6A 1ZRDA 4QXKA 4HZFA 1OD5A 5LRRA 2O8QA 3S7IA 1LRHA 4XEZA 3B02A 4XF3A 5JSRA 2ETEA 4MGIE 5BY5A 1X8EA 3LOIA 1QWRA 3RDIA 3SCGA 1ZRFA 4UXAA 4O9GA 2PAKA 3M70A 1ZVFA 4KWJA 1QXJA 2K9ZA 2BNOA 2QDRA 1G6NA 4QGLA 2I45A 2V09A 4IEXA 3WW1A 3OGJA 1UW8A 3KGZA 2XHKA 3DL3A 2OA2A 3WW3A 3D82A 5J3UA 2PA7A 1ZZ6A 1JUHA 1IPJA 1HW5A 4HSJA 1PM7A 2GC1A 1OMIA 4FT8A 1NE4A 1O5LA 2Q30A 4AVCA 5I8TA 5J48A 5FDBA 1J3RA 1I6XA 3E6BA 3ACLA 3BPZA 3H50A 5AVPA 3MPBA 3N4MA 4XFAA 4BIFA 3MZHA 2PHDA 2XL7A 2IC1A 3NL1A 1UIJA 3E5XA 4N9HA 2ZCWA 5FPZA 4QM8A 4Q0QA 5BV6A 2ZKLA 4JTNA 4PIXA 4FAHA 5J7MA 3M3IA 3SHRA 4ONUA 4IESA 4ORFA 5LEJA 3D0JA 4I0AA 2VECA 1RGSA 2VPVA 4BHPA 1YFUA 5JCTA 1XE8A 3FWEA 2BYVE 1FXZA 2Q1ZB 2QNKA 4AVBA 1VJ2A 3E5QA 4HN0A 5EFUA 1CAWB 3G7DA 4PIZA 5KBFA 1CAUA 3ES1A 3U10A 3FHIB 4WBBA 3FFQA 4MUVA 1LB2A 1WLTA 5E1RA 4IEYA 1WA4A 5KHJA 2UYAA 1U12A 3LWCA 4QX5A 5F1RA
chains in the Genus database with same CATH superfamily
4JX0A 2R7EB 2W08A 4OHXA 1VLNA 4YG3A 5FZOB 5JWPA 1V0AA 1R083 3P5BA 4COVA 5LK7B 1JHNA 2PTMA 3FMGA 5FBZA 3U75A 3ZFEC 4DEVA 5BNPB 1TNFA 3QD6A 1Q8SA 4K1YA 1F5FA 5LA1A 1VRH3 3R05A 5FZ8A 1YWKA 1W9YA 4N9IA 5G05L 2JEMA 5FYVA 2HWE2 3ETPA 4ITCA 4DINB 1AX0A 2DCKA 3S5AA 1LAJA 2R043 2UWCA 2ZZQA 1F9KA 2HJIA 4COZA 4X8PA 2WS91 2VZOA 4CDQB 2RE9A 1PGW2 4HXCA 4JZRA 4JQRA 2K2SA 5K0UA 3U1XA 3ZYFA 1ACCA 1W6MA 4A41A 3V0AA 2JG8C 1PX4A 2D93A 3WINE 5L9RA 1G8WA 1LOBA 2D7FA 4M3CE 1EP0A 3H8UA 4LULA 4OCTA 1F31A 2QQLA 2IUWA 2WO7A 3H1MA 1QU0A 4Y5Z0 2BU9A 2WT0A 2ZEWA 2R072 2ZA9A 3VBSB 5ISLA 4AE2A 2J1VA 3UNPA 2J1EA 2ZOEB 1OF3A 1QGLA 1AR63 3B9IA 3ITQA 4Q4V1 1ULPA 2JDAA 5B4NA 1VRH1 1W8WA 2XWJB 3CU7A 3UGFA 3H9AA 2ZEYA 5A3NA 4IEUA 4Z92B 2HH9A 4RS5B 2R063 2JJ6A 3KWVA 3K4DA 4QXBA 1TME1 2EIGA 2Q5TA 4D0QA 3MIFA 1VBC2 5IAXA 3P3PA 3D3AA 2WKKA 5DXDA 4NWWA 1PGW1 1NZCA 3MEPA 5IVCA 4JGYC 1MZ6A 3GXUA 3MW2A 1XNTA 1R082 2GNTA 3A7QA 4L99A 1AR73 5EJZB 1Q8VA 2FQPA 4I0WB 3TEWA 1WBLA 5LWBA 5A7NA 5FXWA 1D2QA 4HPKA 2XONA 4QU2A 1C57A 3CKHA 3GYDA 2B46X 4TLFA 5C8CB 3I4IA 5BXXA 5HV4A 5JUVA 1H8VA 1ZZ8A 2VNOA 2O14A 1XYOA 4RA0A 5JDBA 5LA0A 1NQDA 1AR91 3B9CA 3IAPA 3EYPA 5DZFA 4YFWA 3OEAA 1PZ7A 1GZTA 3IZOA 4FSJA 1AHSA 4XJZA 4BJ0A 2EA7A 3DN7A 2GMPA 4D8MA 4AFCA 3HAGA 3C7HA 1HB3A 2Z2SB 4FP2A 4FPYA 1PIV2 4R9BA 2FZ1A 4WM7C 3T3YA 4NPLA 3AYCA 3ZFFB 1KDKA 2JG8B 1CZVA 1MEC1 2P3YA 1GP6A 3O14A 1W99A 5JOZA 4Y20B 1CX1A 4FPFA 4R9CA 1WCDJ 2XLAA 3AP6A 3E6DA 3I2JA 1ODNA 1WLDA 3LDRA 3N7LA 4W65A 5LBEA 1YQCA 3WHTA 1YQ6A 5FYBA 1FOD3 2VCMA 3M3CA 4CXWA 4LKEA 2WWSA 4MXVA 1N1TA 2A3WA 4MGKE 1UYZA 4FFHA 1DDLA 2ZABA 3AMNA 3HJRA 1B35C 1CAXA 5BNNC 4OHVA 5CAZA 1JZ4A 1OA4A 3E1F1 4LIUA 5GZDA 4QPGB 2VXRA 4N53B 4Z1VA 1FMD1 1NA1C 2DCZA 2YGLA 3K75B 1AR62 4AAPA 2J7MA 5IK8A 3POEA 1VAMA 2SLIA 2GU9A 1SLIA 2OUJA 5C3RA 4D7TA 2XH6A 1UD1A 3U11A 1FPN3 1S0GA 2Y26A 2MEV2 2IXHA 2OQ7A 1VBD3 1BMV2 3UK9A 3WQ1A 4YM2A 4LBQB 4FFFA 2VD7A 3RWNA 1OOPB 2H6CA 4XUTA 3ZXFA 1T6GC 4A45A 3ELNA 2ZGSA 1ZX5A 5EPAA 3VDDB 4IEWA 3GJBA 2JICA 1NZIA 2TBVA 3MFAA 4GJZA 3K77A 2D5HA 4R4XA 4B29A 2CDPA 2KR2A 4MYEA 3CDZB 3EMRA 3OPWA 2YG0A 1FV3A 1PK6C 1EY2A 4Q1RA 3POBA 1J3PA 1US3A 1EUTA 1ND3B 4E4HA 2QQKA 5JMOA 5HXVA 3FE5A 3UKNA 1S2KA 2BWCA 2HWB1 4EE2A 3MYXA 4ZXEA 4HMZA 5I8YA 1FI2A 1C5IA 5DDJ3 3M8LA 4Y4YA 1HXS3 2Y8KA 5GZGA 1SG3A 1PGL2 3JBG2 2DU1A 2XUMA 1G9DA 4YSFA 4XETA 1ENSA 4HSLA 5A3LA 1REDA 3LB9A 1RUH1 2Y34A 1N1SA 4IGOA 3IDCB 3SXWA 1F2NA 4LE3A 3TYJA 1ZA4A 2ID4A 4CU7A 2Y6LA 4MADA 2J42A 4MV2A 3PUHA 1GOGA 4EROA 2NQYA 3WDVA 1YQ5A 4OI4A 2RR11 4QWNA 3OYWA 4P9LA 3T08A 3FHQA 5A32B 4MLOA 2JB4A 1WCUA 1NA1B 3I2GA 5T5OA 2ZAHA 5IVJA 2QTWB 4JGZA 2R16A 3RZZA 3CBNA 5FZ1A 1CAUB 3I7DA 4BE3A 1L7LA 1H4GA 1WW6A 3ZSKA 3ZLIA 3JBG1 2VOVA 3KV9A 1SZBA 2Z5WA 5JI9A 1VPHA 2W87A 5T52A 3WDYA 2PXJA 2YY1A 4XHXA 4XABA 5DZEA 1XU2A 3O0XA 1YJLA 4XBLA 4BK4A 2CL2A 4DIQA 3RYPA 2WSUA 3IWZA 1DLLA 1AR93 3T09A 1H1IA 5T5LA 1SFYA 4XYXA 4YVWA 4Q4X1 5KHHA 4PJYA 4JKKA 2E53A 4YGBA 5JZGB 3WX5A 2YBPA 2A6VA 3H1WA 3MLKA 1LHWA 4EN0A 2RS13 4AFDA 5GJ6A 1JMUB 2B39A 4FPKA 2C26A 3CMGA 4CEWB 1GP4A 3A23A 4AI0A 2V72A 2VNRA 4OZXA 1AYM1 1FNZA 2Y60A 2VW1A 1W6OB 1S0DA 1FNYA 1W8OA 1W8ZA 1I5ZA 1QJY2 2F6BA 1UWWA 1O3RA 4M4PA 1G9FA 5FPBA 1ZYBA 3BKZA 3KB5A 4PLMA 1XQNA 1HV1A 2UY9A 1HB4A 4PI0A 1YQ8A 4RGAA 2MHFA 5T54A 1VBA2 1H1MA 5F5QA 3VN4A 3RMXA 3ZIWA 3S0MA 4AZZA 1Y9GA 1LOEA 1OURA 2X05A 5DAXA 3CHXA 2XJUA 3RZHA 3FX3A 4BIOA 2J22A 1WW5A 2BUKA 3VL9A 5B4XA 5EHDA 5CFDC 2XDVA 1CZTA 4BQYA 2A5ZA 2AYHA 2AGSA 1WZXA 1SLAA 2B5HA 3WG4A 1DLCA 1AYM2 3TB0A 1J3QA 2FMDA 5DZGA 3VKLA 1DHKB 4JHTA 1SBDA 2GALA 1IPSA 1HB2A 3GHMA 2YU2A 1OA3A 4E8DA 4YGDA 2A70A 2VOTA 4H14A 1TMF2 5A3OA 4ASLA 3ETQA 1W9FA 5JOYA 2X5IC 3C3VA 4NPMA 1V6NA 4RL7A 4AHYA 1JZ7A 1UU6A 4CUBA 4ZU4A 4Q8KA 3H8OA 2Q8EA 2EXIA 5CFCA 2VZ3A 5K9YA 3RWKX 5C8CA 2CGOA 3NWKA 3PUSA 5CADA 2AC1A 1ZBE2 2PHWA 3MF6A 5K4LA 3VZOA 1WD3A 1C1LA 1XB9A 1GMMA 4FPCA 4LBQD 4QQOA 1XYPA 3SMHA 3N3HA 1RUC2 3CF6E 4LA3A 3JQXA 2BBVA 4LHSA 1O3SA 2IWGB 3ECQA 3Q9OA 3I59B 1WUVA 4Z2AA 5HCBA 1DGRN 1NCQB 5CEHA 3O1MA 3S5QA 3N9MA 3WQ0A 4XXPA 3ZN6A 3MUY1 1QXPA 4HVRA 4P9JA 3EO6A 1CAWA 2OYZA 1X9PA 3ZR5A 2JKBA 4IERA 2HBTA 1NY72 4LBMA 1L3JA 5L73A 3MV11 4WVVA 2WS93 2SBAA 4A7ZA 2R041 3VZNA 3LA2A 3R6SA 2VZVA 5JPNB 1H8TA 3KVAA 3ABZA 4CPBD 3HR9A 3NQHA 3ZXJA 2WT2A 1C8M1 4KI5M 1N47A 3AP9A 2YMZA 1S0EA 1QJU3 2BNMA 3CJXA 1SBFA 4WM8C 5FAXA 3NMBA 3I3DA 3JUUA 1VRBA 5DAPA 1W05A 1POV1 2PYTA 2WFF3 4DQAA 5CKMA 4LO8A 4GMP1 5I0SA 1H2KA 5DUXA 2VE1A 2XKPA 1ST8A 3AVSA 1Q8PA 2RVAA 3BVCA 2IXCA 3ZDSA 2VY0A 2WYFA 3WDUA 4AFBA 5J09A 2V73A 3OEBA 5C3PA 4O9EA 3THPA 2V4VA 1LTEA 4CUCA 1WCQA 1UPIA 2E9QA 1OOPA 1BZWA 1Y7BA 5LRRA 1D0HA 1KJRA 5CKQA 1LRHA 2RS51 2ZGOA 4YVWB 5H9RA 2VUJA 2YGMA 1MZEA 1DQ2A 4AWDA 2ETEA 4MGIE 1VIWB 1SPPB 1LGCA 3JCIA 5FYHA 1PO22 5C3SA 3MFCA 1PM4A 1COV1 4A44A 1ZRFA 4BISA 2WZR2 3GZAA 1IS5A 2R042 2RDSA 2W95A 2PAKA 3AJYA 1MS4A 1ZVFA 4O9GA 3UJOA 3VLBB 4CP9A 1RUG1 4KWJA 5A1AA 2BNOA 2QDRA 1VMHA 4QGLA 2PMWB 3BIEA 1BCXA 3WW1A 4IEXA 1IGOA 3OGJA 4QPIA 4CCJA 3LEGA 4BQ1A 2XHKA 5C3QA 4U2AA 2AREA 3OUHA 4Y26A 4E8CA 5C5TA 1ZZ6A 1BYHA 1UYPA 5JIUA 3WQ7A 4IV1A 5C71A 3URFA 4ATFA 5FZIA 5K7PA 1N3PA 1RUC1 4UAPA 2VZRA 5IUQA 1QOTA 1FMD2 2P2KA 5CFCB 4PDWA 4IGPA 1MS8A 3SC7X 1I6XA 3IDAA 4H7MA 5FFOC 3IT8A 3E6BA 3H50A 3MPBA 1LHUA 3GZUC 4BIFA 3AP5A 3VBFC 3LF7A 3MZHA 4HT1T 2XL7A 5A6YA 2IC1A 3LDKA 2NZ9A 2GP5A 5IWFA 3AXDA 3X29B 3W20A 4AEDC 5EJ1B 4D69A 1UZ0A 4QPYA 1LOGA 4DXTA 1EV11 2VNGA 5J7MA 4ZKTB 2WN2A 3BGAA 2QQOA 5FYTA 4DXSA 3FFZA 1A3KA 5DN2A 4OMDA 4HETA 4NR1A 4AI2A 1JZ2A 3D0JA 1W9WA 1IZ3A 4TYSA 3JB4C 2VXJA 4ASMB 3ZFEA 1DQ1A 4DEQA 4YFZA 1H0BA 2VR4A 3LPGA 3LPFA 3N7MA 3LKJA 2VPVA 4U36A 2VMEA 3WEZA 4CDXC 4EN9B 2VMCA 4OZOA 1RUG2 1RXGA 4R9DA 1O59A 4QB6A 4AFMA 1Z7S3 3OG2A 3K4ZA 1D0GA 5E8AA 3WF4A 2Q1ZB 4FTEA 3PUIA 3Q8BA 4E4SA 1K3IA 4YZ3A 2DUQA 1GZ9A 1LEDA 1V6OA 1VJ2A 1X9TA 2HWD1 4PF1A 5BNOC 3AM2A 4YW5A 4IQPA 1VMFA 1GQPA 1NLQA 2W68A 4ISQA 4NAOA 2FDKA 3G7DA 2JECA 4PIZA 3MLJA 4YZ5A 1CAUA 3GBGA 3PUQA 1HRI3 4QX0A 4AFAA 3AKQA 5EWSA 3T2OA 3AKTA 4YW6A 3FFQA 5APAA 1TEIA 3Q8CA 1VE0A 4PDWB 3VBRA 1WA4A 4LJHA 2WNVB 1MS9A 2C24A 2LW8A 1S0IA 1NAEA 2XWBB 1SCRA 3LSEA 4N43B 1OFSA 4UF0A 4Q4V2 4AGRA 4CCMA 3OD4A 1K42A 4FI9A 1FMD3 5J1XA 1JI6A 1JZ8A 3NKGA 4ATEA 1JYNA 1LECA 1WW7A 3MIGA 4ZS2A 2ORXA 5FZDA 1X8MA 4HFSA 3KF3A 4OQ9A 1RVF2 2XLFA 1AUYA 3NAPA 5GKAC 4GMP0 1SEFA 3I59A 1ZM1A 3QLQA 4Q4W1 2C6SA 1J1LA 4WVWA 1R091 2ZGMA 3KQRA 4GWNA 2HEYF 1VBB3 1FPN2 4XILA 1CZSA 2W2IA 2YXSA 3T2QA 4LTAA 1R081 1PVC3 1RJ7A 2A6ZA 4ET7A 4Q4Y3 3I2DA 2YC4A 4QM9A 2W3JA 3WNOA 5F2SA 2XVLA 3MIBA 4NE9A 4OI2A 3KT4A 1AR61 5FOJB 1NCQA 2HWF1 4META 5LBFA 5I0DA 1DGWX 4URAA 1RUI3 2HWC1 4E9KA 4XFGA 3S57A 1U5IA 1WKYA 1H6XA 2V4AA 3AZWA 1AJOA 1GOFA 3PVBB 1V6MA 3JD71 2JIJA 2OKXA 3OJBA 1VRH2 1UQXA 2HBUA 2Y6HA 4M3CA 4Y22B 2GC2A 1HRV2 2DCJA 2HWE3 2RS53 3BB6A 3OPZA 3ZPYA 1PO11 4Y1YA 1PGL1 5FMBA 4BPZA 4MSVA 2PHLA 3USUB 3NNLA 2AACA 3THDA 1AX1A 4DRRA 5C4WB 2GDFA 4YZ4A 2LS6A 3T4VA 3ZMOA 1CWPA 3DUIA 2FCVA 4YVSC 3JXSA 4CU8A 3HVDA 2W92A 2N7GA 2NM1A 4YYOA 4CVUA 3BN6A 2F17A 5DQ0A 3DPRA 1S0BA 1VBB1 1Y43B 1YFWA 2IXJA 2VZSA 1IOAA 4IEPA 2XJPA 1POV3 5D8AA 4A6SA 3ZX7A 4D6RA 3LGRA 3T1LA 2A3YA 3AZZA 4Q4V3 4P02B 4XOGA 1GUIA 4FVVA 2W1WA 2D6NA 4I30A 2CGNA 4NRQA 3UKVA 4HK8A 4C1XA 2RJKA 3IIIA 4LBOA 2DYCA 1ZNPA 4AXOA 2GZWA 4FPGA 4DS0A 4BK5A 1KDMA 4OHYA 1DQ5A 3ZXGA 4GKXA 3RYKA 3W59A 1F15A 4UFJA 4V2WA 1QJX3 1VBB2 2R062 5ABJB 2AH2A 2DUPA 3ZXLA 5KHIA 2GC3A 1HQWA 2VQUA 1M06G 2WYSA 3SEPA 3I54A 2Q1MA 3EQEA 2Z42A 1QH7A 1YNAA 4GKYA 4JGZB 3J4UH 5A80A 1UOJA 5F8PA 1LNSA 5I0TA 2QQWA 2EXHA 1OHFA 1SDWA 2OT7A 3AYEA 1RJ8A 3WF0A 2WJSA 1UOFA 1FATA 4LKFA 3ACGA 2W9XA 3TNPB 3KHBA 4LBNA 5IVFA 5GLTA 2BFUL 2ZAAA 1ND2B 1S0FA 2RS12 3QACA 4OLLA 4LA2A 5ANQA 3T0AA 1MEC2 1UZZA 2QCSB 2ARXA 1NA1A 2ZGKA 1CAVA 1W2UA 3J7NA 3OOXA 3E5UA 2VBDA 4LK7A 3AVRA 4QXCA 3BIWE 4NJ4A 5DAWA 2JWPA 3VZJA 2VTFA 4KQ7A 3HNYM 2ORZA 5FPUA 3LAGA 3AMMA 2WDBA 4QKDA 5A7WA 5JAXA 4Y1XA 1RUF2 2PHUA 2EAKA 3QOPA 3SH5A 3N9NA 3WNPA 2P1BA 2GSYA 2ET7A 2RMU2 3GDBA 3AYDA 4CEWC 2IVJA 3B3QE 4INDA 4NN0A 4O7XA 2BGCA 2VW2A 5JR7B 3NKTA 3ENRA 2WZPP 2QBXA 4JHZA 1KS5A 1VBE2 3I3EA 3FC0A 3VZKA 5FZCA 1ENQA 3INAA 1QMJA 3FJSA 2LALA 2VG9A 2R30A 3FLTA 3NVCA 3OYWB 3O1OA 2XR4A 3HQUA 2Q8DA 1GV9A 4Q1PA 2E32A 1GOHA 3R0RA 3T4HB 2XJRA 5FOBB 3OY8A 5F3IA 4QX7A 1RVF1 1U0AA 2VMIA 4ES8A 3WD5A 1OUXA 3VUOA 2OUHA 1UXZA 2PLV3 5BNOA 1UY2A 4XC9A 5IK4A 5DUWA 3WNLA 3GGLA 3V0AB 1NCRC 4XTMA 2BTVC 4QDRA 1GWLA 3SH3A 3MPPG 4G4FA 4IDZA 2YU1A 2KXLA 4XVHA 2EALA 2P3KA 5E6HA 3MI8A 4H2AA 3WCRA 2EIBA 1BBT3 3W5MA 4GAZA 5A7SA 3MBWA 5C4WA 2I74A 4AI1A 4TLGA 4ZPIA 5ABJC 4JGYA 3ZFGC 1QJU1 5I91A 2VU9A 2YB7A 4XF4A 5L7OB 2UWAA 4JGZC 1Q8OA 4MX3A 1AZDA 2BP6A 3O5SA 2E51A 1TQ5A 4DO0A 3BU0A 2VCBA 2PHTA 3M3QA 4IEQA 5F6KA 4M3CB 3IKWA 4AI8A 1C1FA 1ASJ3 4TN7A 4KBZA 1UZWA 2BVBA 4RHV1 3ZM8A 1JYTA 1PMHX 2VCAA 4UYBA 2VO5A 3VHPA 4CP0A 2WINB 5IAVA 4NIAA 2VULA 3WSOA 5ACA2 4GQ7A 4QT6A 1TME3 2B9UA 3H8RA 2CYFA 1MEC3 3KZ4C 2DCTA 2JG9B 2MEV1 3KCCA 4ISRA 2L9LA 3ZVXA 2JDKA 2NLRA 2MNGA 3DF0A 1H4HA 2W5FA 1F4AA 1AX2A 5BNNB 2XB6C 5EYYA 4XFIA 3PHMA 3KMHA 2FMYA 1RUD3 4L2NA 2WS92 1HXS2 4YW3A 2W46A 1IS3A 4H7LA 2BDRA 4ZU5A 5A6QA 2X29A 1YIPA 2RMU3 2QKDA 2XHNA 3CJIB 3TEZA 5IW0A 1AL0G 3THTA 1F8VA 2HWE1 1QJZA 3RMYA 1W06A 1OC1A 4FTSA 1AXYA 4KU7A 4MGSA 4WZCA 2QQMA 3MW3A 1QNWA 2HKXA 5FP4A 1LHVA 1PZ9A 5FLJA 5FZAA 1JODA 4QQLA 2BBAA 2W1SA 2LM3A 4QD2A 3W21A 1SACA 3NW4A 3ZFFA 2J1UA 1BKZA 1JOBA 3OUIA 4LO6B 3LE0A 2Q0AA 4CU6A 1ND3C 3OPTA 5LBCA 5IVVA 1OPMA 2X5IA 3WG1A 5EJ3A 4K8FA 1S4CA 3QBQA 1LENA 3OY8B 2FCTA 4L97A 2D6LX 2YBSA 2PLV1 4NVPA 4XURA 1ZRRA 5FO7B 5GZEA 3ASIA 3GF6A 2H6BA 2HYXA 1AYN3 1V6JA 2QQVA 3ILNA 3PVOA 4HANA 4WM7B 1W04A 3RZKA 3PIJA 3PL0A 1DQ4A 1KS4A 2ZPXA 3VHNA 3LQCA 1QOSA 2RG4A 2WZR1 2Z4FA 3IMNA 3AKRA 3JZVA 3OUJA 1IQAA 1LHOA 1XJAA 2DTYA 2TEPA 5A6ZA 4Y5SA 4FFGA 3I2FA 4QU1A 5FPXA 1VB4A 4WVZA 3J8F2 1TME2 1E5IA 1RUJ3 4GB33 4Z07A 2XJTA 4R9AA 4E27A 2GMMA 1XNKA 2OS2A 1D4M2 4UFLA 2QQNA 1PMIA 2VQAA 2R0FA 4IV1B 5FZ9A 1ZZ9A 2RM22 3RVHA 2WO1A 1Y9QA 5D1IA 4AGGA 1ODMA 2WL1A 3KD4A 3AP7A 3ZYPA 4BXFA 1RUD2 2P5BA 4AOCA 1ZZBA 1O3TA 4GULA 3LEKA 3POWA 3B7MA 2YZ4A 5FYYA 1JS9A 2WNUA 1QY4A 3KT7A 2JDYA 2DVFA 5FR3A 1LGNA 2R071 5DMYA 2TUNA 4MGZE 4B4PA 4CTEA 3L2HA 1ZRCA 2D6MA 2H0VA 3EHKA 4HBNA 1A78A 2ZGQA 4BH9A 1C8M2 4E2GA 2WFPA 3BODA 4MH0E 2GNBA 2AEZA 1UU5A 1URXA 1XSRA 2A3XA 4QPWA 3POJA 5F5IA 3ATGA 4AEDB 3H0OA 4FXGB 5FZ4A 3OD0A 5L9VA 2C9AA 2VTXA 4RGGA 5CU1A 1UX7A 1HX6A 2C4XA 5FK7A 1OFNA 2G19A 1RUJ1 4GB31 1ND2A 1PVXA 3NJVA 2ARCA 2P6CA 4C90A 4QQ2A 4OUEA 4NHYA 1UZVA 4QB1A 4RR3C 1WLCA 3HIFA 2E7QA 3NJYA 4BM8A 5F3EA 2Z79A 3B69A 5AC91 1ZBA3 2G9ZA 3G6JB 1MVQA 1QJEA 1LU2A 4NOTA 1PMJX 1WMDA 3P1IA 3KCYA 5CNAA 1AYN2 2RMU1 4MGYE 3GM8A 4W6WA 2RS33 3VBHB 4XCBA 1HRI2 3VV1A 5FZHA 4BXSV 3RZJA 3AXEA 4GWMA 2O1QA 1GSLA 1DG6A 3BCWA 4I2OA 1UL9A 2BEOA 1Q56A 1S2EA 3U0ZA 5IHRA 2R0HA 1GNYA 4DB5A 1AR82 1BVP1 4SBVA 3NAPC 1HLCA 3USUA 2DDUA 2XGXA 4C0HA 4GWIA 2WNUC 5J96B 3PIGA 3KHCA 1UKRA 4CDQC 1EPWA 4IV1C 3ZXEA 4RFT0 5KHKA 1BMV1 1T6BX 2VZPA 3ZXDA 3WG2A 5LK5A 2IFWA 4DXRA 1O4YA 4GA9A 4PDWC 1SLLA 4Q27A 4FTBA 2A7AA 4HZFA 4RSUA 5ANNA 1LOFC 2O8QA 2XQXA 3S7IA 1UX6A 3RS6A 1YIFA 4N43C 4XEZA 3MW4A 5JSRA 2XPJA 4MO3M 2DV9A 1O91A 3TN91 1CIWA 4CCNA 3FLPA 3O12A 1QWRA 1UY0A 2IVIB 2FDHA 1VBD1 5BNPC 4UXAA 5A33A 1O8PA 2ZGUA 1W6PA 4ASKA 2EF6A 1W2AX 1OQ1A 4OHWA 5EXOA 2HWC3 4Q4Y2 1QXJA 4MHUA 1G6NA 4LOTA 1CPNA 3WP4A 4FO9A 4LMFA 4NIGA 2V09A 2BOJA 3T2PA 4IE6A 3IAQA 1UW8A 5HCAA 3ZFGA 1NLRA 1DU3D 1A34A 1W6MB 2OA2A 4LNVA 5J3UA 4YWAA 1OUSA 3PJQA 4Y22A 1JUHA 4BLIA 2YROA 4BQ4A 3BTZA 4BCUA 2CNAA 2GC1A 4GH4B 4N7UA 3RGBA 4AVCA 4WZFA 5FDBA 1YRZA 2RS52 5A33B 1NX9A 1DYPA 5IVYA 3BPZA 4Q4X2 3U37A 3M1HA 3TWIA 3HBKA 4AEDA 3WNMA 1RHI3 4V2VA 4XFAA 1LHNA 3O1UA 1JU3A 3VD7A 4KBBA 1ULCA 2ZEZA 2PHDA 3NL1A 3AL6A 1MVEA 1HJFA 2GNDA 3E5XA 4WVMB 2ZCWA 4QM8A 5BNPA 3I97A 1HDKA 3M3EA 2ZKLA 4IGQA 3APBA 4JTNA 4LHKA 1AF9A 1PNGA 2QZ2A 3NV2A 3N9OA 1TG7A 2BJSA 5F5CA 2VUAA 1X33A 1BK0A 1XU1A 1EUUA 1N1VA 2WWJA 4LXLA 1HN1A 4PF5A 4QX1A 2J1RA 4IESA 3NAPB 1W6QA 5DPNA 2BVVA 1YJKA 4I0AA 3VBRB 3WDXA 2DURA 3DXTA 1RGSA 4LT5A 4RS5C 3AZXA 3TRSB 4W6YA 3LEMA 4XUPA 5LATA 3UGHA 4IV3B 4BHPA 2JDNA 3B5LB 4LIVA 3FWEA 3UT0A 4Q26A 3DGTA 4AR2A 1REEA 1UU4A 2ZKNA 1YCIA 3K48A 4W50A 5JOXA 4BQWA 3ACFA 1NUKA 5FP7A 2QNKA 5GZCA 2RJ2A 4AVBA 3ZFEB 3N35A 4NROA 1BHGA 1GFF2 4QPIC 1QJX2 3ACIA 3M3OA 1V9U2 4YM3A 1Z78A 5EFUA 1XYNA 2W1UA 5IVBA 5KXDA 1CAWB 2QZ3A 5KXEA 4Q4W2 1YC61 3ZSJA 4DUXA 1A8MA 3ES1A 3U10A 4Y1UA 1RMU3 4UWDA 2WIIB 1A8DA 1JTZX 2ZTNA 4H55A 2WABA 4HK9A 5GALA 2XBO1 3FHIB 4MUVA 1LB2A 1S2BA 2RDQA 4RYDA 1H2NA 2BZDA 3IN9A 5FV3A 4FPEA 1LU1A 4D7YA 5J36A 1W28A 1CJPA 2CTVA 1RXFA 3OB8A 2I2SA 1U12A 1WD4A 1PHMA 5FZEA 5CB7A 2C5DA 1UMZA 3MIHA 5HPOA 3V56A 1OOPC 1H2MA 4GH4C 1BBT1 3USSA 3ZSMA 3N7JA 4YARA 2CGPA 1I9RA 3O7OA 3JB8A 3VL8A 3H8XA 3TEXA 4COUA 4AW7A 3ORJA 1CONA 4DZGA 1O4ZA 3EB7A 1Y9MA 3WT3A 3K3NA 5JLVA 4PCRA 1D7PM 2W1QA 1KFUL 2WC2A 5CZKA 1QOOA 2RS31 4NHKA 1JBCA 1V9U1 2A6YA 1VBE3 2O8OA 2VZTA 3R4SA 4JCKA 4F3JA 1PNFA 2YFUA 3N9PA 3VDAA 1JH5A 2VOXA 3C7GA 5FJHA 5FKCA 3VHRA 1KITA 5L9BA 5C8WA 5FPVA 4S2FA 4YG6A 2ET1A 5FP8A 5FCCA 2BNNA 4YZ1A 1ZBE1 3PU8A 4UW4A 2H0BA 1CESA 3FL7A 1YO8A 5A7OA 3PTRB 4D6SA 2WQZC 3E97A 4XBNA 1K45A 4QB2A 1PGSA 1GNHA 1V70A 1X50A 4Y5TA 3WDWA 4EWAA 1K5JA 3GCXA 4CDUB 4LUKA 2E7AA 3H7JA 3N7KA 4G3YC 2W47A 1GYKA 3ZKUA 3O1RA 4Y33A 4OQ8A 2BERA 3ZYBA 1JYWA 3KV5A 5T55A 4QPIB 2VQ0A 1CR7A 4PHZA 1STMA 2YYOA 4QGMA 4J6GA 2CU5A 3FUOA 1VBC3 2QDNA 4PBOA 1RMU2 2D97A 4JAAA 4LLFA 4DRVA 5A3UA 1YI9A 4XFHA 2PAMA 1AL21 4ZXKA 4K21A 1V6KA 2IFRA 1PO13 4YLZA 1ASJ2 1Q5OA 3HPNA 3LA7A 1AJKA 1DGLA 4K40A 5CFDA 4IEOA 1VAVA 5E88A 2D40A 1CN1A 5L7OC 4YM0A 3VDDA 3WXPA 3MGUA 4K1ZA 1S55A 4QGNA 4V1PA 1HRV3 1RYYA 2IXIA 2B7YA 4K8RB 4B4RA 4CDWB 4PQQA 1QJX1 2ZXQA 4P5YA 4LBQA 2YFZA 4BB3A 2YC2A 3RI8A 1GQGA 3RPQA 3ZN5A 1MQTA 2OZ6A 2BOIA 2FBEA 3OGVA 2XJQA 2JE8A 2YDEA 2YV8A 3IBMA 4B7EA 3GNEA 5TSWA 5F6LB 2E33A 4KU8A 4QQHA 1AR72 2OZJA 2P3JA 1OA2A 2D6PA 2XLGA 5JZGA 5F32A 1DF0A 1YFYA 3DPRC 1LULA 4QKBA 2WO2A 3TN92 3BPSA 5K8SA 4CEYC 2B45X 4YVSA 3MLLA 3KSCA 2VVEA 3QH7A 4FOWA 1YHFA 3SCFA 3WW2A 4RFRB 5DAQA 3EBRA 1DYKA 1FOD2 4LITA 5FQ0B 3O1SA 5FYSA 2ZHMA 5FY0A 4UFMA 2BW8A 2ZGTA 3QCWA 1MZ5A 1DZRA 1LR5A 1WCKA 4O65A 3AK0A 5F37A 5JMCA 5C9AA 1WMFA 4LO7A 4Q0SA 4X6RB 4PIYA 3ROUA 1W39A 3P3NA 4P9WA 2WNOA 2ZX3A 3KCXA 2D6KA 2RDNA 4FOQA 4JDMA 3WLUA 5FUNA 2GH2A 1JHJA 1PK6A 2D6OX 2P37A 2ZZJA 4XFFA 1IPKA 4GD4A 4GXLA 5LBBA 3ZPOA 5BNOB 3AYAA 3J7HA 2BGPA 2DWRA 5FTTC 1KFXL 3D6EA 5J37A 3ES4A 3S6PA 1RL3A 4XACA 5GZFA 2Y0OA 3VKOA 2XVGA 3IIAA 3KV4A 2VMGA 1MS0A 1MS1A 1QXRA 1XXNA 4XJAA 3VBOC 1OXCA 2OX0A 1R1A3 3ZSEA 4AG4A 5HCHA 4BQ2A 2OIIA 3HNMA 5C33A 2AENA 1V6IA 1UN1A 4I01A 1YQ2A 4XFBA 4Q4Y1 4AEJA 1XE7A 2PN5A 3HN3A 5A3PA 4KWUA 5GLZA 2J1AA 2Y33A 4DY5A 1LOFA 1OVSA 4D6QA 4JDNA 1DCSA 5F3GA 1G9AA 5SV5A 4AYUA 3T1MA 3N9LA 3RJRA 1W0NA 4JRLA 4XUNA 5DDJ2 5A3WA 1RUF3 1D4VB 4JRAA 4N53C 4A3XA 4F83A 4OVEA 1YFXA 3VBSA 5L36A 2VNVA 1R1A1 1TZOA 1ASJ1 2E26A 3CZUA 1IKQA 4IE7A 3H3UA 3HT2A 2HWB2 4LKSA 1XRUA 1UMIA 4N53A 3RFRA 5FZMA 1K12A 3DPRB 3TN93 2MPFA 1CPMA 3POFA 4OULA 4XTPA 5JXGA 4QAWA 4Q29A 2A75A 4XE9A 3TOJA 4CEWA 2E31A 4GWJA 1VP6A 1C8M3 2IXKA 5FP3A 4BDVB 4L92A 5DUUA 3PMEA 4FAGA 1TE1B 4YW2A 1H1AA 2Y38A 1E5HA 3R4DB 4P9GA 4BQXA 5IFTA 5FLIA 2ZGLA 5LASA 1UIKA 2XBO3 1DQ6A 1HQNA 2Y6JA 5GLVA 3VDBA 1OVPA 1WWYA 5CISA 1UPSA 1J84A 2XKOA 1G86A 4LBJA 3JBG3 1G7YA 4PT6A 4P5HA 2E63A 1PK6B 3R4UA 3SQOA 2D3RA 5FRAA 3ALQA 2ZGNA 4EV0A 2NMOA 2OPKA 5IK5A 1WA6X 4CYDA 2PQQA 1OF4A 4YW4A 4KG0A 2YC0A 2BGOA 4B7KA 4CDXA 1DGRA 1ULEA 2NMNA 5FZKA 5ABJA 1W8HA 4JQTA 2R6QA 2WAOA 1K5MC 4P9IA 3U07A 3ZR6A 1MQTC 1ULDA 2W0XA 4XDQA 3NRUA 4RQPC 3W58A 3NNFA 1QDCA 1ULFA 2WQ4A 3AFGA 4PLOA 4Y4RA 3UKTA 4AAXA 3WF3A 2ZMLA 4BMBA 3O1TA 3KVBA 4NIHA 1W9TA 3EJKA 3VBOB 4BQ5A 1OSGA 3O0VA 3POIA 3POGA 3WY6A 1CD3G 5ACA3 4OFGA 4JGYB 3H7YA 1SCSA 3ZYIB 3N9QA 4MZUA 3VZLA 5ERLA 4E2QA 1UZYA 3AX4A 3MHZA 5T3NA 5A32A 5FYIA 1V6LA 1E5RA 1N3OA 2P34A 2VVDA 4M3CF 5C5UA 1ZA7A 2D98A 3DYOA 1JYVA 1LEMA 2NN8A 4RS5A 1ZZ7A 4KNCA 5T50A 5F5AA 4I3PA 1UXXX 2DCYA 4Z82A 5C8CC 3HMYA 3WF1A 4IE4A 5CFDB 1BJQA 3NNMA 1L7QA 3WOGA 2W39A 3D8CA 4UFHA 3UGGA 5LW9A 2WFF1 1HRV1 5HBAA 5FY4A 1QNYA 2WNVA 2V5YA 1HKDA 1R64A 3QH6A 5EV7A 2QE3A 3WNXA 4AQ6A 3KM5A 3BTYA 3OTFA 3SEEA 2HWC2 3M2MA 4JKLA 1VBE1 2ZHKA 3DXUA 4J1XA 3I3BA 1NYWA 4R52A 4XQDA 4XQ4A 4YRDA 1W3XA 1AL23 2HWF2 3VDDC 5A1FA 3PNAA 5JIAA 2X5IB 1QJY3 2ADEA 1W2OA 4QHZA 1EPZA 4EQVA 2Q4SA 3GBWA 4IE0A 1AYM3 1YUDA 5IJRA 3CNAA 3S7EA 2E6VA 4FPOB 2VL4A 3FZ3A 4K3UA 5AFEA 3SISA 1BXHA 3ST7A 5ACA1 5CKNA 1ZBA1 3MIDA 1OQEA 2VC9A 2Y6GA 3B94A 2A1XA 3DCQA 2FHRA 4IV3A 4IXLA 4LE4A 4UBHA 1NXD1 5IVEA 5FLHA 3JD73 5KR7A 4I0BA 4XF0A 1HN0A 3I3MA 4K7JA 4Q4X3 4Q0UA 3T2TA 1GWMA 1POQA 4Y20A 3D0SA 4MOAA 3PMSA 3LA3A 1W9SA 2VMDA 3VD4A 4CCLA 1O4TA 3LZZA 4JVAA 4ZZ8A 1JXNA 4Y1VA 4MXWB 1O5UA 5FK8A 2XXZA 5E89A 5EYXA 1RUC3 1KQRA 3DV8A 4YG0A 3JU9A 4DNYA 4MXWA 2WR9A 1CQ9A 5G04L 1D4M1 2R061 1H8TC 3RJ2X 3AMQA 4XCAA 1NLSA 5FZ0A 1XNDA 3WQBA 2XMLA 2HYKA 1XNCA 1WBFA 1HIXA 2VAUA 3H3ZA 4UBGA 4CA9A 1I1EA 1IG3A 4B1LA 4A42A 2UURA 3RNSA 2EAAA 3AMHA 2JE7A 4N7IA 3CLPA 4RHV3 3ZMNA 4YW1A 1O6UA 2RJLA 4LBKA 1KRIA 3HEIA 1FV2A 4IUGA 2HWD2 3IM0A 2WLQA 3D5OA 5JSPA 3OCPA 4QX3A 4P08A 2JIGA 2WNEA 4OI1A 3GZTB 4FXKB 1SFPA 1JZ3A 1XBFA 1YI7A 2WN3A 2VZUA 5JR2A 1C4RA 3IB3A 4FBFA 3V64A 1PVC1 4L9BA 3PDQA 4XXAA 1W6QB 2WFF2 4NUBA 4YVWC 1W2TA 1W03A 4D3WA 1REFA 2CWMA 4FOYA 4QKFA 1SQ4A 5JVVA 1AL22 2HEVF 2HWF3 1RUOA 2RHPA 3IDEA 4LLOA 1TVGA 1W6PB 1X82A 1C5HA 5JPMB 1OLRA 2P17A 2B4KA 4L8QA 3ME2A 2ZHLA 4Q0PA 5JZGC 4D7SA 5B2GB 1AXZA 1I3HA 1RHI1 1J83A 1J1TA 1Y3TA 3DKWA 5I0RA 4YGEA 4YGCA 1QJU2 1ENXA 1XC6A 3GZEA 3RQ0A 3CEWA 1WW4A 2VOWA 1PO23 1UOGA 2G1MA 3B01A 3J26N 3MIEA 3JD72 4AVAA 5LEKA 1QDOA 1ZBA2 2CV6A 2R32A 4AI3A 1ZRDA 4GH4A 5DAVA 4QXKA 4AGVA 2X09A 1LJ7A 3ZN6B 4PI2A 1UOBA 2QQJA 1M4WA 3B02A 3UYJA 4P14A 1QF3A 4FPLA 5IT6A 2OPWA 1HRI1 2DBIA 5C70A 4WM8B 1X8EA 5KXCA 4L0PA 4AHZA 1B35A 3RDIA 3CQOA 2ARBA 3SCGA 1W90A 2WO3A 5GLUA 4WVMA 1W3VA 3WR0A 4MGQA 1L7RA 2YPJA 1DZQA 1AR83 2YBKA 1NT0A 5DABA 4OYUA 3VBFA 4Z8BA 1SMVA 1ENRA 1XOYA 3AC0A 1R092 3MO4A 4UT5A 2WSVA 2WUHA 1ONAA 3RZGA 4AVSA 1BEV1 4XJ9A 5HCFA 3OGGA 2UU8A 2WZR3 4GZ9A 2VUCA 4RHV2 2V5DA 3D82A 3H3LA 3I8TA 4TSVA 4A7KA 4HOOA 4XMAA 4XDOA 5F39A 1IPJA 3W5NA 1HW5A 2JENA 4CDQA 4HSJA 4E4DX 5C9AB 3ZXKA 1UAIA 1OMIA 4FT8A 1BEV3 2VH9A 3V65A 2EXKA 3T30A 1D2SA 1O5LA 2Q30A 3NV4A 3BOPA 1HB1A 3AJZA 4XAAA 3OBAA 3OGRA 5I8TA 1J3RA 5J48A 1OBNA 3ACLA 4CCKA 3AKSA 1KGYA 1OPOA 5AVPA 4N43A 4UF0B 2XOMA 4PLNA 3PTYA 3VD9A 1EV13 2ADDA 3NO8A 1AVBA 5FY8A 1OT5A 5D21A 1GZCA 1RITA 5FZ7A 3HBZA 3VBHC 2RV9A 1UIJA 5FZBA 4N9HA 5LA9A 4BU2A 4KG8A 4DFSA 1OLMA 2F4LA 5BV6A 1MPXA 1GBGA 1JYCA 1K5MA 1ULOA 4PIXA 1PO12 4WV8A 4FAHA 5FY1A 2ZGRA 3M3IA 4IL7A 4ONUA 1COV3 4ORFA 2ZX4A 2WNUB 4UW3A 4Y24A 2VBPA 2VECA 3GCWA 3VBUB 5L19A 3HQRA 3U4SA 2VGDA 2YPDA 2A6XA 4Y3OA 1EAH1 1GZWA 1NQJA 3VBUA 1AR71 3BUCA 1W6OA 1E57A 1YFUA 2WA4A 3OBTA 3LOBA 1W8FA 2BYVE 2AZ5A 1JOPA 1POV0 4RQPA 2G9GA 4LO5B 3L2YA 1FXZA 3HN1A 5FYMA 4MG2A 1QEXA 2BQPA 4FCAA 2Q1FA 2ZBJA 1KJLA 4KGGA 4XPVA 1FPN1 2WRAA 3TAYA 3M4FA 4HN0A 5FY9A 3K3OA 4CU9A 4WM8A 2ZJCA 1VMJA 3VBHA 4CP1A 2UWBA 4EYUA 5KBFA 4LQRA 4K9SA 1H30A 5FMOS 3AZVA 4NIDA 3A0NA 3GHNA 4DMIA 4HONA 4KMQA 1WLTA 4JC1A 5E1RA 5H9QA 4S2GA 1LOAA 3T0DA 4CDUA 5FZGA 1RUE1 1PX3A 3VZMA 1FOD1 1QH6A 4DXZA 4CP2A 1UNBA 1JUIA 2ZX0A 5F1RA 1U5XA 3RRDA 5CBLA 2JE9A 5FMDA 4CRQA 2VJXA 3NSTA 5DDJ1 3H42B 1CX4A 3UJQA 2VUDA 1Q43A 4ZS3A 1PZ8A 5FWEA 1IS4A 3ZSLA 5CA6A 4KWLA 1ULGA 1PVC2 3M7AA 4Q0VA 5E16A 4CPBA 1UY1A 1H9PA 2A73B 2R073 3I3QA 4AL9A 1UY3A 2NYYA 5IATA 2Q8CA 2ATFA 1DIWA 1O8SA 1RVF3 5KHGA 3GBFA 4A4AA 3LFIA 4W4ZA 5A3TA 5FWJA 4CCEA 4X8NA 5F9TA 2FDGA 4ZY9A 1COV2 1W6NB 3Q8FA 4RGKA 4SLIA 3K4AA 3ZFFC 4M01A 1UKGA 2VMFA 4IW3A 5HI0A 4EWDA 3TEYA 4I3GA 3C7OA 1GICA 2ZGPA 4M0HA 4JKMA 4CXYA 5DG2A 3VBFB 3B93A 5C7GA 4EN7B 4UW5A 2F4PA 1RMU1 1UYXA 1DZTA 2UY8A 3O0WA 3LD8A 1MS3A 2JX9A 1RUI2 4KH9A 3WVJA 4XF1A 4YZ2A 1GNZA 1B35B 2ARAA 3PVNA 1VR3A 2HWB3 4NHMA 1W2NA 2DU0A 5I0UA 4A6OA 4CEYA 4A2UA 4EZHA 1F5JA 3F2ZA 2BPA2 2GP3A 5FKBA 4WM7A 4NO4A 2P3IA 4R4ZA 4EWEA 4B4QA 1W8UA 4B8EA 4Y1ZA 4YW7A 1Z7S1 3ON7A 1APNA 4BMEA 1U5ZA 1YYNA 5C6CA 1MR5A 4AQTA 2DVDA 2W94A 2XBO2 5CG8A 4AK3A 1LGBA 1X36A 3HNBM 2GH8A 4GIQA 5AC92 4LOSA 4NRMA 2DVBA 1CIYA 2OW4A 3LSDA 1G9BA 3N36A 2C0ZA 4NPRA 3WW4A 1HJGA 1NE6A 4C8DA 4CCDA 5EQUA 2A6WA 5HV0A 5JXJA 1JN2P 1YLLA 4BQ3A 3OBRA 4QDQA 1SDDB 4XJ8A 5LY2A 3OSDA 4CSWA 3MV01 2P6HA 4QQPA 4FP3A 3P6BA 4IEZA 1NG0A 1RUE3 2D44A 2JG9C 1IG0A 2XVKA 4RD7A 2GN3A 1NXMA 2FCUA 3NJXA 5FXXA 4BLJA 3LIHA 4QX8A 5JXIA 2AR6A 3IPVB 1J59A 4HN1A 2GAUA 1RUF1 2WWUA 4JTOA 4HVOA 4BWOA 3I2OA 5LB6A 2LRPA 2QUOA 4TTGA 5L7OA 3BI3A 2CY6A 3HT1A 3WP6A 1NOVA 1JYIA 3LIGA 1QQP3 3LWCA 1GWKA 4XBQA 4AF9A 4CDXB 2MEV3 2YUEA 3GALA 3VBOA 4QPGA 2D3PA 4DPNA 5IFPA 2G4IA 2X10A 3V0BB 5LY1A 3PVEA 4HG6B 2JB8A 1O7FA 2ZMKA 5EP9A 4ZZ5A 3ZN4A 3CL1A 5JXHA 3WCSA 1YEWA 1WLWA 3Q8EA 4LR4A 2KA3A 1DFQA 5F7UA 2RM21 1YXWA 2VTXJ 2HLEA 4AVTA 1OLME 4I09A 3KGLA 5FO8B 4PBPA 2WZEA 4XIKA 1EAH3 2TNFA 4KWKA 2ERFA 2VW0A 4JV4A 2Y64A 1GP5A 1GKBA 1OKOA 4LO4B 2QJVA 4S2HA 1ALYA 5K0UC 4AVVA 1OKQA 1NCRA 3WP5A 2VM9A 3VHOA 4CE8A 4ZU7A 3E6CC 4A7YA 1KEXA 1R1ZA 3BOWA 2J1SA 2QFEA 4HL0A 2O0OA 3POYA 4DUWA 4W6XA 2D5FA 3PU3A 2PFWA 3C7EA 4OHZA 1NY71 3FBYA 1IQDC 5A7PA 1RIRA 1J58A 2PLV2 2C1FA 1ZREA 1QJFA 1RB8G 3JQWA 2IZWA 4QXHA 1OH4A 4URTA 4HLTA 3RYRA 3HD8B 4PQ9A 4FFIA 4TWTA 1B09A 1IS6A 3ZXAC 1QQP1 4QX2A 4CDWC 3PUAA 1GU3A 5FMOL 2ZACA 4QHOA 3THCA 3I49A 2WQ8A 3A22A 2X53S 1BBT2 1LKNA 1LESA 3AZYA 1GQHA 1V00A 1SBEA 3IDBB 1CJDA 2JDMA 1FYUA 4LPLA 1SLBA 4ARYA 1P8JA 2XG3A 4IETA 1RUE2 2XJVA 3FBMA 4ARXA 4Z2WA 2NP0A 2GC0A 5HXMA 5FUIA 2D3SA 5EIYB 5LZ6A 1R1A2 1FX5A 2PHRA 4XMIA 5JI7A 2Y6FA 4FQ4A 1CAXB 3UETA 3CZJA 2KD7A 2WA3A 3ZO0B 2ZMNA 5BPXA 3MDPA 3CJIC 5SV8A 4CZSA 4F8AA 5C3OA 2K0GA 2OQ6A 4UFKA 4X6QB 5LA2A 1XE0A 3I2HA 4ZHNA 3MUZ1 3VKFC 3VD5A 1QQP2 2EIDA 3OBZA 1CVNA 4S2DA 5KC6A 3DECA 3V0BA 4A3ZA 3F95A 2HEWF 4O61A 3SCHA 3O1VA 5FYUA 1AXKA 1HXS1 3I2IA 4MGTA 3K46A 3NNGA 4XF9A 2JG9A 2VZ1A 4YNIA 4IEVA 5H9SA 4UFIA 5A6XA 3WP3A 1CAVB 1AR92 5EZWA 1RINA 1WCSA 2XJSA 3FN9A 1JOJA 1HV0A 3S30A 3O1PA 2JDUA 1W6NA 4NAMA 5AVAA 5FREA 5KXBA 3IPVA 4OUSA 1EAH2 4ES9A 5A1LA 2W91A 1UYYA 1CGPA 5FQ0A 3ILFA 3W9AA 1C3HA 4KL1A 1QKQA 2JG8A 4NRPA 4OUMA 4TZDA 5FZFA 5K0UB 4H3WA 1G9CA 4YVSB 4B3NA 2PAEA 1Z0HA 2B8MA 4I02A 4J1WA 1Q3EA 2K46A 1OI6A 5D8AB 4LUMA 5F2WA 2DUOA 1KD7A 1I5PA 4CP9B 4CCCA 4CXXA 3TNQA 3POSA 3PLQA 3SKVA 1X7NA 2JXAA 3FUQA 2DBNA 4DOUA 1PIV3 5I93A 4LORA 2VBBA 1N1YA 1O3QA 1SPPA 2B42B 1DQ0A 4JDOA 3UL2A 5I8SA 4XZUG 1RUNA 4QPGC 2FZ2A 2AUYA 4UI9L 1C28A 3C8XA 4FQZA 5CIRA 5D2AA 2LUWA 3A21A 4DUVA 4DY3A 1A6CA 3KQ4B 1NCQC 2GMEA 2NPIA 2IXLA 4L11A 2VMHA 2WT1A 1MQTB 3DEMA 1TNRA 1OQDA 4M4RA 5FUPA 4BOWA 1WGPA 4CUGA 4RQPB 4XHBA 1FT9A 1MZFA 5LRSA 3VD3A 1W0OA 4CEYB 5H9PA 3VB9A 2ZS6B 1LCLA 1IHMA 3A4UA 3HQXA 5A7QA 1F4HA 5T5PA 4Q8LA 5FP9A 1XNBA 4AQ2A 4EN8B 3WNNA 4P9YA 4AI9A 1RUJ2 4GB32 1OD3A 3KLSA 1TMF3 1R093 2A71A 3U14A 5BYNA 5A7WB 2EVXA 1VBD2 2W52A 1KXGA 2DFCA 4QMAA 3VKMA 2Z69A 1ZZCA 2JDZA 3J7MA 1NCRB 4EN6B 1ND2C 3ZKYA 1GZWB 4AHXA 1LOCA 5FZLA 1UY4A 2J1TA 2E7TA 1ZBE3 4CCOA 4GALA 1WMEA 5FXVA 3BU7A 3VBRC 1RUH2 4XIOA 2WBKA 1OLQA 2EXJA 4R8HA 5FZ3A 2B9VA 2QVSB 4XJUA 3ZFGB 3J8F3 3SLIA 2QQUA 1TMF1 2Y6KA 3RG0A 4J25A 3KS7A 3DYPA 3MF9A 1F35A 2BWAA 1Y4WA 1EV12 1D4M3 3A0KA 4XFCA 4HVQA 5C9AC 3SH4A 2RM23 2EICA 4LEJA 1JYXA 3C2UA 3ZOIA 3GJAA 3DYMA 1RUD1 5D8AC 3AKPA 3VGIA 1RC6A 2XL9A 2FDIA 1BQPA 2AEYA 1EYBA 2RR13 3AP4A 3FLRA 3TBDA 2ZHNA 4COWA 5AFBA 3NNJA 2JDPA 5J98B 2XUEA 5FYCA 3WV6A 2R1DA 1AYN1 4XQWA 3L9JT 3J8F1 3NV1A 4G9SB 5KC5A 3WDTA 3EXUA 2PELA 5F3CA 1C8NA 1BK1A 1T2XA 3ZDVA 1UF2C 1MACA 2VQTA 2VVFA 3RI9A 2LTNA 4E4ZA 1DGWA 3D4KA 5IK7A 3UV9A 5CVRA 1US2A 5FPLA 4F7ZA 3K2OA 4TXWA 5FO9B 1W0PA 1MS5A 1UCXA 3H1YA 3PURA 4N90A 2DFBA 2RS32 4LKDA 1JZ6A 5FXZA 3U78A 2DTWA 3WG3A 4AEKA 4XUQA 2D43A 1Q8QA 1QJY1 2ZX1A 3NJZA 3CO2A 4LBLA 4COYA 5LCWL 4AHWA 1BLZA 1GLHA 3DKQA 3OF1A 2P4EA 4IE5A 1UMHA 4FPJA 3PJYA 1N3QA 4RR3A 5CYYA 4RN5A 4B1MA 3ZYJB 1ZRIA 3BALA 1OH3A 1PO21 5JSOA 1SFNA 5FZ6A 5A70A 4BYYA 2R49A 2EIEA 2JDHA 4P9XA 2UYBA 2ES3A 4EZ4A 4CDWA 2FD8A 4EJRA 4N8MA 1ND3A 2DF7A 1FAYA 2CAVA 3B00A 4NHLA 3U4XA 4UW6A 2DVAA 1XSQA 4GJYA 4FOVA 5FYZA 2G9FA 4E2SA 2HWD3 5T5JA 5BUVA 3AFKA 3KT1A 2BFUS 2BRTA 1VALA 1BVVA 2CAUA 4MVTA 2YHJA 2Q8OA 3WNKA 3ZYGA 1RUH3 3AB0A 1RTVA 3WUCA 3LCPA 3I2KA 1GR3A 1WMXA 1K5MB 1AR81 4FPHA 2WZ8A 2QQPA 1OD5A 4NWVA 3RSJA 5KWRA 1W8NA 3AMPA 4XF3A 4CDUC 1XNAA 5CFCC 3LDBA 1S1AA 4ZONA 3SKJE 1QIQA 4QDSA 2GNMA 4BZ4A 3LOIA 2PHFA 5FPAA 5BY5A 1H9WA 2WLPA 2RR12 2FDJA 1SHWB 4W8JA 1SLCA 5M0TA 3M70A 2JKXA 5FY7A 5BNQA 5IYYA 2ILMA 2JD9A 4P00B 1DP0A 2K9ZA 2ZEXA 4Q2FA 1H6YA 3RZLA 2I45A 5FBJA 4HKWA 1JZ5A 3ZYHA 3CJIA 1VBA3 5DG1A 3BTAA 3SNMA 4AEMA 3KGZA 3UESA 3DL3A 4UOJA 2WAAA 1QHDA 4YM1A 2JD4A 2PHXA 1LODA 3WW3A 5CG9A 4HKLA 2PA7A 5BNNA 4BA6A 2ENRA 4M00A 1S0JA 4LK6A 4K20A 5A3MA 3HOBA 1PM7A 2BV4A 3MICA 4YPJA 1NE4A 1VBC1 2VCCA 2KM2A 2LROA 4K6BA 1H2LA 3WF2A 4IV3C 4XJWA 1RUG3 1S0CA 3N4MA 1UO9A 2VZQA 4XW3A 3RZMA 1Z7S2 4GMP3 3AL5A 3LEIA 4OI0A 2PQSA 4C0BA 4NHXA 2RS11 4QKNA 2I07B 3J9SA 2CHHA 4C1WA 1VAKA 2CDOA 5FPZA 3FHAA 4Q0QA 2RDRA 4MHRA 4D94A 5FJKA 1HQLA 2FDFA 1RHI2 3WHUA 1IKPA 3KF5A 4HPKB 3NV3A 3SHRA 3WZ1A 1RUI1 3LFMA 1PIV1 5FY5A 5AC93 2CWSA 1E5SA 5FMCA 3BYWA 3IMMA 3ILRA 1W8TA 4RR3B 5LEJA 1XPWA 1BEV2 5FIXA 2CSGA 3KV6A 4C91A 3Q8AA 2C9KA 4CUAA 2WNVC 5FZOA 1DYOA 3VDCA 5JCTA 1V9U3 2X8KA 5GLWA 1XE8A 3VKNA 3J7LA 1NKGA 3ACHA 3OGSA 4HKOA 2ZX2A 4XUOA 2OXBA 3K51A 4Q4W3 2VOKA 3BTXA 1VBA1 3VBSC 2R1BA 3WUDA 2DVGA 3ZYRA 1JU4A 4LHNA 5JOWA 3E5QA 4QHBA 2Y0IA 2OVUA 5GM0A 5C4WC 4NIIA 1H8TB 3HWJA 2QQIA 3SITA 3T0BA 5DUVA 4OMCA 2GN7A 4AQSA 1U5YA 1DBNA 1SLTA 4Q5OA 4KGQA 3ZIXA 4NMIA 4WBBA 3VBUC 4XDPA 4XZPA 4IEYA 5KHJA 3CIHA 2XQRA 4XAEA 1VB2A 2UYAA 3C7FA 1JW6A 1GANA 4QX5A 4M0NA 4LHLA
chains in the Genus database with same CATH topology
2W08A 4OHXA 1VLNA 4YG3A 5JWPA 1R083 5LK7B 4COVA 1JHNA 2PTMA 3FMGA 5FBZA 3ZFEC 5BNPB 1TNFA 3QD6A 1Q8SA 4K1YA 1F5FA 1VRH3 3R05A 1YWKA 4N9IA 2JEMA 2HWE2 4ITCA 4DINB 1AX0A 2DCKA 2R043 2UWCA 2ZZQA 1F9KA 2HJIA 4COZA 4X8PA 2WS91 4CDQB 2RE9A 1PGW2 4JQRA 2K2SA 5K0UA 1W6MA 3V0AA 2JG8C 2D93A 3WINE 1G8WA 1LOBA 2D7FA 4M3CE 1EP0A 3H8UA 4LULA 1F31A 3H1MA 1QU0A 4Y5Z0 2WT0A 2R072 2ZA9A 3VBSB 4AE2A 2ZOEB 1QGLA 1AR63 3B9IA 4Q4V1 1VRH1 3CU7A 2XWJB 3H9AA 4IEUA 4Z92B 4RS5B 2R063 2JJ6A 1TME1 2EIGA 2Q5TA 3MIFA 1VBC2 3P3PA 5DXDA 2WKKA 4NWWA 1PGW1 1NZCA 3MEPA 4JGYC 1MZ6A 3MW2A 1R082 2GNTA 4L99A 1AR73 1Q8VA 2FQPA 4I0WB 1WBLA 1D2QA 4HPKA 4QU2A 1C57A 3GYDA 2B46X 4TLFA 5C8CB 3I4IA 5BXXA 1H8VA 1ZZ8A 2VNOA 4RA0A 1XYOA 5JDBA 1NQDA 1AR91 3B9CA 5DZFA 4YFWA 1PZ7A 4FSJA 1AHSA 4XJZA 2EA7A 3DN7A 2GMPA 4AFCA 3HAGA 2Z2SB 4FP2A 4FPYA 1PIV2 4R9BA 2FZ1A 4WM7C 3AYCA 3ZFFB 1KDKA 2JG8B 1MEC1 3O14A 5JOZA 4Y20B 4FPFA 4R9CA 1WCDJ 2XLAA 3AP6A 3E6DA 3N7LA 4W65A 1WLDA 3WHTA 1FOD3 3M3CA 2WWSA 4MXVA 1N1TA 2A3WA 4MGKE 1DDLA 2ZABA 3AMNA 1B35C 1CAXA 5BNNC 4OHVA 5CAZA 1OA4A 5GZDA 4QPGB 2VXRA 4N53B 4Z1VA 1FMD1 1NA1C 2DCZA 2YGLA 1AR62 5IK8A 1VAMA 2SLIA 2GU9A 1SLIA 2OUJA 4D7TA 2XH6A 1UD1A 3U11A 1FPN3 1S0GA 2Y26A 2MEV2 2IXHA 1VBD3 3UK9A 3WQ1A 4YM2A 4LBQB 3RWNA 1OOPB 2H6CA 3ZXFA 1T6GC 3ELNA 2ZGSA 1ZX5A 3VDDB 4IEWA 2JICA 2TBVA 3MFAA 4R4XA 2D5HA 4B29A 4MYEA 1FV3A 1PK6C 1EY2A 4Q1RA 1J3PA 1ND3B 5HXVA 3FE5A 3UKNA 1S2KA 2BWCA 2HWB1 3MYXA 4HMZA 5I8YA 1FI2A 1C5IA 5DDJ3 3M8LA 4Y4YA 1HXS3 5GZGA 1PGL2 3JBG2 2DU1A 2XUMA 1G9DA 4YSFA 4XETA 1ENSA 4HSLA 5A3LA 1REDA 3LB9A 1RUH1 1N1SA 3IDCB 3SXWA 1F2NA 4LE3A 3TYJA 1ZA4A 4MV2A 4EROA 2NQYA 3WDVA 4OI4A 2RR11 3OYWA 4P9LA 5A32B 4MLOA 1NA1B 5T5OA 2ZAHA 4JGZA 2R16A 3RZZA 1CAUB 3I7DA 4BE3A 1H4GA 1WW6A 3ZSKA 3JBG1 2VOVA 2Z5WA 5JI9A 5T52A 3WDYA 4XHXA 2YY1A 5DZEA 1XU2A 3O0XA 1YJLA 4XBLA 2CL2A 3RYPA 2WSUA 3IWZA 1DLLA 1AR93 1H1IA 5T5LA 1SFYA 4XYXA 4YVWA 4Q4X1 5KHHA 4PJYA 2E53A 4YGBA 5JZGB 3WX5A 2A6VA 3H1WA 3MLKA 1LHWA 4EN0A 2RS13 4AFDA 5GJ6A 2B39A 4FPKA 4CEWB 4AI0A 2VNRA 4OZXA 1AYM1 1FNZA 2VW1A 1W6OB 1S0DA 1FNYA 1I5ZA 1QJY2 2F6BA 1O3RA 1G9FA 1ZYBA 3KB5A 4PLMA 1XQNA 1HV1A 2UY9A 4RGAA 2MHFA 5T54A 1VBA2 1H1MA 5F5QA 3VN4A 3RMXA 3ZIWA 3S0MA 1LOEA 2XJUA 3FX3A 4BIOA 1WW5A 2BUKA 3VL9A 5CFDC 2A5ZA 2AYHA 2AGSA 1SLAA 2B5HA 3WG4A 1AYM2 3TB0A 1J3QA 2FMDA 5DZGA 3VKLA 1DHKB 1SBDA 2GALA 3GHMA 1OA3A 4YGDA 2A70A 4H14A 1TMF2 4ASLA 3ETQA 5JOYA 2X5IC 3C3VA 1V6NA 4RL7A 4AHYA 1UU6A 4Q8KA 4ZU4A 2EXIA 5CFCA 5K9YA 2CGOA 3NWKA 5CADA 1ZBE2 2PHWA 3MF6A 3VZOA 1WD3A 1C1LA 4FPCA 4LBQD 4QQOA 1XYPA 3SMHA 3N3HA 1RUC2 3CF6E 4LA3A 3JQXA 2BBVA 1O3SA 2IWGB 3ECQA 3Q9OA 3I59B 1WUVA 5HCBA 1DGRN 1NCQB 3WQ0A 4XXPA 3ZN6A 1QXPA 4HVRA 4P9JA 3EO6A 1CAWA 2OYZA 2JKBA 4IERA 1NY72 4LBMA 1L3JA 5L73A 4WVVA 2WS93 2SBAA 4A7ZA 2R041 3VZNA 3LA2A 3R6SA 5JPNB 1H8TA 3HR9A 3ZXJA 2WT2A 1C8M1 3AP9A 3CJXA 2YMZA 1N47A 1S0EA 1QJU3 2BNMA 1SBFA 4WM8C 5FAXA 3JUUA 1POV1 2PYTA 2WFF3 4DQAA 4LO8A 4GMP1 5I0SA 1H2KA 5DUXA 2XKPA 1Q8PA 2IXCA 3ZDSA 2VY0A 3WDUA 4AFBA 5J09A 2V73A 4O9EA 3THPA 1LTEA 1UPIA 2E9QA 1OOPA 1BZWA 1Y7BA 5LRRA 1D0HA 1KJRA 1LRHA 2RS51 2ZGOA 4YVWB 5H9RA 2VUJA 2YGMA 1MZEA 1DQ2A 4AWDA 2ETEA 4MGIE 1VIWB 3JCIA 1LGCA 1PO22 3MFCA 1COV1 1ZRFA 2WZR2 3GZAA 1IS5A 2R042 4O9GA 2PAKA 3AJYA 1MS4A 1ZVFA 3UJOA 3VLBB 1RUG1 4KWJA 2BNOA 2QDRA 4QGLA 1BCXA 3WW1A 4IEXA 1IGOA 3OGJA 4QPIA 4BQ1A 2XHKA 4U2AA 2AREA 4Y26A 1ZZ6A 1BYHA 5JIUA 3WQ7A 4IV1A 3URFA 4ATFA 5K7PA 1N3PA 1RUC1 5IUQA 1QOTA 1FMD2 2P2KA 5CFCB 4PDWA 1MS8A 1I6XA 4H7MA 5FFOC 3IT8A 3E6BA 3H50A 3MPBA 1LHUA 3GZUC 4BIFA 3AP5A 3VBFC 3MZHA 4HT1T 2XL7A 2IC1A 2NZ9A 3AXDA 3X29B 4AEDC 4D69A 4QPYA 1LOGA 1EV11 2VNGA 5J7MA 4ZKTB 3FFZA 1A3KA 4HETA 4NR1A 4AI2A 3D0JA 1IZ3A 4TYSA 3JB4C 4ASMB 4YFZA 3ZFEA 1DQ1A 1H0BA 3N7MA 3LKJA 2VPVA 4U36A 4CDXC 4EN9B 1RUG2 4R9DA 4AFMA 1Z7S3 1D0GA 5E8AA 2Q1ZB 4FTEA 4E4SA 4YZ3A 2DUQA 1GZ9A 1LEDA 1V6OA 1VJ2A 2HWD1 5BNOC 3AM2A 4YW5A 4IQPA 2W68A 4ISQA 3G7DA 2JECA 4PIZA 3MLJA 4YZ5A 1CAUA 3GBGA 1HRI3 4AFAA 3AKQA 5EWSA 3AKTA 3FFQA 1TEIA 4PDWB 3VBRA 1WA4A 2WNVB 1MS9A 1S0IA 2XWBB 3LSEA 1SCRA 4N43B 1OFSA 4AGRA 4Q4V2 3OD4A 1FMD3 3NKGA 4ATEA 1LECA 1WW7A 3MIGA 1X8MA 4HFSA 1RVF2 2XLFA 1AUYA 3NAPA 5GKAC 4GMP0 1SEFA 3I59A 1ZM1A 3QLQA 4Q4W1 1J1LA 4WVWA 1R091 2ZGMA 3KQRA 4GWNA 2HEYF 1VBB3 1FPN2 4XILA 2YXSA 4LTAA 1R081 1PVC3 1RJ7A 2A6ZA 4Q4Y3 3I2DA 4QM9A 2XVLA 3MIBA 4OI2A 3KT4A 1AR61 5FOJB 1NCQA 2HWF1 4META 1DGWX 1RUI3 2HWC1 4E9KA 4XFGA 1U5IA 3AZWA 1AJOA 3PVBB 1V6MA 3JD71 3OJBA 1VRH2 4M3CA 4Y22B 2GC2A 1HRV2 2DCJA 2HWE3 2RS53 3BB6A 3OPZA 3ZPYA 1PO11 4Y1YA 1PGL1 4BPZA 4MSVA 2PHLA 3USUB 1AX1A 4DRRA 5C4WB 2GDFA 4YZ4A 3ZMOA 3DUIA 4YVSC 2N7GA 2NM1A 4YYOA 3DPRA 1S0BA 1VBB1 1Y43B 1YFWA 2IXJA 5D8AA 1IOAA 4IEPA 2XJPA 1POV3 3ZX7A 3LGRA 3T1LA 2A3YA 3AZZA 4Q4V3 4XOGA 4FVVA 2D6NA 4I30A 2CGNA 3UKVA 4HK8A 4C1XA 2RJKA 4LBOA 2DYCA 1ZNPA 4AXOA 2GZWA 4FPGA 4DS0A 1KDMA 4OHYA 1DQ5A 3ZXGA 4GKXA 3RYKA 3W59A 1QJX3 1VBB2 2R062 5ABJB 2AH2A 2DUPA 3ZXLA 5KHIA 2GC3A 1HQWA 1M06G 3I54A 2Q1MA 3EQEA 2Z42A 1QH7A 1YNAA 4GKYA 4JGZB 3J4UH 5I0TA 2EXHA 1OHFA 1SDWA 3AYEA 1RJ8A 2WJSA 1FATA 3TNPB 4LBNA 5GLTA 2BFUL 2ZAAA 1ND2B 1S0FA 2RS12 3QACA 4OLLA 4LA2A 2ZGKA 1MEC2 1UZZA 2ARXA 1NA1A 2QCSB 1CAVA 1W2UA 4YM3A 3E5UA 3VZJA 3BIWE 4KQ7A 3LAGA 3AMMA 5JAXA 4Y1XA 1RUF2 2PHUA 2EAKA 3QOPA 3SH5A 2GSYA 2ET7A 2RMU2 3AYDA 4CEWC 3B3QE 4INDA 4NN0A 5JR7B 2BGCA 2VW2A 2WZPP 3NKTA 3ENRA 5C8CA 3VZKA 1KS5A 1VBE2 3FC0A 1ENQA 3INAA 1QMJA 3FJSA 2LALA 2VG9A 2R30A 3FLTA 3NVCA 3OYWB 1GV9A 4Q1PA 3R0RA 2XJRA 5FOBB 3OY8A 1RVF1 1U0AA 2VMIA 4ES8A 3WD5A 3VUOA 2OUHA 2PLV3 5BNOA 5IK4A 5DUWA 3V0AB 1NCRC 4XTMA 2BTVC 3SH3A 3MPPG 4G4FA 2KXLA 2EALA 2P3KA 3MI8A 3WCRA 1BBT3 5C4WA 5ABJC 2I74A 4AI1A 4JGYA 3ZFGC 1QJU1 5I91A 2VU9A 4XF4A 5L7OB 2UWAA 4JGZC 1Q8OA 4MX3A 1AZDA 3O5SA 2E51A 1TQ5A 3M3QA 2PHTA 4IEQA 5F6KA 4AI8A 4M3CB 3IKWA 1C1FA 1ASJ3 4RHV1 2BVBA 3VHPA 4CP0A 2WINB 2VULA 5ACA2 4GQ7A 4QT6A 1TME3 2B9UA 2CYFA 1MEC3 3KZ4C 2DCTA 2JG9B 2MEV1 3KCCA 4ISRA 3ZVXA 2NLRA 2MNGA 3DF0A 1H4HA 1AX2A 5BNNB 2XB6C 5EYYA 4XFIA 3PHMA 3KMHA 2FMYA 1RUD3 4L2NA 2WS92 1HXS2 4YW3A 1IS3A 4H7LA 4ZU5A 2X29A 1YIPA 2RMU3 2QKDA 3CJIB 1AL0G 3THTA 1F8VA 2HWE1 1QJZA 3RMYA 4FTSA 1AXYA 4KU7A 4WZCA 3MW3A 1QNWA 2HKXA 1LHVA 1PZ9A 5FLJA 4QQLA 2LM3A 4QD2A 1SACA 3NW4A 3ZFFA 1BKZA 4LO6B 2Q0AA 1ND3C 1OPMA 2X5IA 3WG1A 5EJ3A 4K8FA 3QBQA 1LENA 3OY8B 4L97A 2D6LX 2PLV1 4NVPA 1ZRRA 5FO7B 5GZEA 3ASIA 3GF6A 2H6BA 4DNYA 1AYN3 1V6JA 3ILNA 3PVOA 4HANA 4WM7B 1DQ4A 1KS4A 2ZPXA 3VHNA 1QOSA 2WZR1 3IMNA 3JZVA 3AKRA 1IQAA 1LHOA 2DTYA 2TEPA 5FPXA 1VB4A 4WVZA 3J8F2 1TME2 1RUJ3 4GB33 4Z07A 2XJTA 4R9AA 4E27A 2GMMA 1XNKA 1D4M2 2VQAA 1PMIA 4IV1B 2R0FA 1ZZ9A 2RM22 1Y9QA 5D1IA 4AGGA 2WL1A 3KD4A 3AP7A 3ZYPA 1RUD2 1O3TA 1ZZBA 4GULA 3POWA 3B7MA 2YZ4A 2WNUA 1QY4A 3KT7A 2DVFA 1LGNA 2R071 2TUNA 4MGZE 4B4PA 4CTEA 3L2HA 1ZRCA 2D6MA 2H0VA 3EHKA 4HBNA 1A78A 2ZGQA 4BH9A 1C8M2 4E2GA 2WFPA 3BODA 4MH0E 2GNBA 1UU5A 1URXA 2A3XA 3ATGA 4AEDB 3H0OA 4FXGB 3OD0A 2C9AA 4RGGA 5CU1A 1HX6A 1OFNA 1RUJ1 4GB31 1ND2A 1PVXA 4C90A 4QQ2A 4RR3C 1WLCA 3HIFA 2E7QA 4BM8A 2Z79A 3B69A 5AC91 1ZBA3 3G6JB 1MVQA 1LU2A 4NOTA 1WMDA 3KCYA 5CNAA 1AYN2 2RMU1 4MGYE 4W6WA 3VBHB 2RS33 1HRI2 3VV1A 3AXEA 4GWMA 1GSLA 2O1QA 1DG6A 3BCWA 4I2OA 1UL9A 2BEOA 1Q56A 3U0ZA 2R0HA 4DB5A 1AR82 1BVP1 4SBVA 3NAPC 1HLCA 3USUA 5J96B 2XGXA 4C0HA 2WNUC 1UKRA 4CDQC 1EPWA 4IV1C 3ZXEA 4RFT0 5KHKA 1BMV1 3ZXDA 3WG2A 5LK5A 2IFWA 1O4YA 4GA9A 4PDWC 1SLLA 4Q27A 4FTBA 2A7AA 4HZFA 4RSUA 3S7IA 1LOFC 2O8QA 1UX6A 3RS6A 1YIFA 4N43C 4XEZA 3MW4A 5JSRA 2XPJA 2DV9A 1O91A 3TN91 1CIWA 3FLPA 3O12A 1QWRA 1VBD1 5BNPC 4UXAA 5A33A 2ZGUA 1W6PA 2EF6A 1OQ1A 4OHWA 5EXOA 2HWC3 4Q4Y2 1QXJA 1G6NA 1CPNA 3WP4A 4FO9A 2V09A 1UW8A 3ZFGA 1NLRA 1DU3D 1W6MB 2OA2A 4LNVA 5J3UA 3PJQA 4Y22A 1JUHA 4BLIA 2YROA 4BCUA 2CNAA 2GC1A 4GH4B 4N7UA 4AVCA 4WZFA 5FDBA 1YRZA 2RS52 5A33B 1DYPA 3BPZA 4Q4X2 3M1HA 3TWIA 4AEDA 1RHI3 4XFAA 1LHNA 4KBBA 1ULCA 2PHDA 3NL1A 4WVMB 1MVEA 2GNDA 3E5XA 2ZCWA 4QM8A 5BNPA 1HDKA 3M3EA 2ZKLA 3APBA 4JTNA 4LHKA 1AF9A 1PNGA 2QZ2A 3NV2A 2VUAA 1X33A 1XU1A 1N1VA 4PF5A 4IESA 3NAPB 1W6QA 2BVVA 1YJKA 4I0AA 3VBRB 3WDXA 2DURA 1RGSA 4LT5A 4RS5C 3AZXA 3TRSB 4W6YA 4IV3B 4BHPA 3B5LB 3FWEA 4Q26A 3DGTA 1REEA 1UU4A 2ZKNA 1YCIA 3K48A 5JOXA 2QNKA 5GZCA 4AVBA 3ZFEB 3N35A 1GFF2 4QPIC 1QJX2 3M3OA 1V9U2 1Z78A 5EFUA 1XYNA 5KXDA 1CAWB 2QZ3A 5KXEA 4Q4W2 3ZSJA 1A8MA 3ES1A 3U10A 4Y1UA 1RMU3 2WIIB 1A8DA 1JTZX 2ZTNA 4H55A 4HK9A 5GALA 2XBO1 3FHIB 4MUVA 1LB2A 1S2BA 1H2NA 3IN9A 4FPEA 1LU1A 4D7YA 5J36A 1CJPA 2CTVA 2I2SA 1U12A 1WD4A 1PHMA 5CB7A 2C5DA 1UMZA 3MIHA 3V56A 1OOPC 1H2MA 4GH4C 1BBT1 3USSA 3ZSMA 3N7JA 4YARA 2CGPA 1I9RA 3O7OA 3JB8A 3VL8A 4COUA 4AW7A 1CONA 4DZGA 1O4ZA 3WT3A 5JLVA 4PCRA 1KFUL 2WC2A 1QOOA 2RS31 4NHKA 1JBCA 1V9U1 2A6YA 1VBE3 2O8OA 3R4SA 4JCKA 4F3JA 1PNFA 1JH5A 2VOXA 3VHRA 1KITA 5C8WA 4S2FA 4YG6A 2ET1A 5FCCA 2BNNA 4YZ1A 1ZBE1 4UW4A 2H0BA 1CESA 1YO8A 2WQZC 3E97A 4XBNA 3WDWA 4EWAA 1PGSA 1GNHA 1V70A 1X50A 4CDUB 4LUKA 2E7AA 3H7JA 3N7KA 4G3YC 1GYKA 5T55A 4QPIB 2VQ0A 1CR7A 2YYOA 4QGMA 4J6GA 3FUOA 1VBC3 2QDNA 4PBOA 1RMU2 2D97A 4JAAA 4LLFA 4DRVA 1YI9A 4XFHA 2PAMA 1AL21 4ZXKA 4K21A 1V6KA 2IFRA 1PO13 4YLZA 1ASJ2 1Q5OA 3LA7A 1AJKA 1DGLA 4K40A 5CFDA 4IEOA 1VAVA 5E88A 2D40A 1CN1A 5L7OC 4YM0A 3VDDA 3WXPA 3MGUA 4K1ZA 1S55A 4QGNA 4V1PA 1HRV3 2IXIA 2B7YA 4CDWB 4B4RA 1QJX1 4LBQA 3RI8A 1GQGA 3RPQA 3ZN5A 1MQTA 2OZ6A 2FBEA 2XJQA 2YDEA 2YV8A 3IBMA 4B7EA 3GNEA 5TSWA 5F6LB 4KU8A 4QQHA 2XLGA 1AR72 2P3JA 2D6PA 1OA2A 2OZJA 5JZGA 1DF0A 1YFYA 3DPRC 1LULA 3TN92 5K8SA 4CEYC 2B45X 4YVSA 3MLLA 3KSCA 2VVEA 3QH7A 4FOWA 1YHFA 3SCFA 3WW2A 3EBRA 1DYKA 1FOD2 5FQ0B 2ZHMA 2BW8A 2ZGTA 3QCWA 1MZ5A 1DZRA 1LR5A 1WCKA 5JMCA 3AK0A 5C9AA 1WMFA 4LO7A 4Q0SA 4X6RB 4PIYA 3ROUA 1W39A 3P3NA 4P9WA 2ZX3A 3KCXA 4FOQA 2D6KA 4JDMA 3WLUA 2GH2A 2D6OX 1PK6A 2P37A 2ZZJA 4XFFA 1IPKA 4GXLA 5BNOB 3AYAA 2DWRA 5FTTC 1KFXL 3D6EA 5J37A 3ES4A 3S6PA 1RL3A 5GZFA 2Y0OA 3VKOA 2XVGA 3IIAA 2VMGA 1MS0A 1MS1A 1QXRA 1XXNA 4XJAA 3VBOC 1R1A3 3ZSEA 4AG4A 2OIIA 5C33A 2AENA 1V6IA 1UN1A 4I01A 4XFBA 4AEJA 4Q4Y1 1XE7A 2PN5A