1ZRRA

Residual dipolar coupling refinement of acireductone dioxygenase from klebsiella
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
179
structure length
179
Chain Sequence
b'SALTIFSVKDPQNSLWHSTNAEEIQQQLNAKGVRFERWQADRDLGAAPTAETVIAAYQHAIDKLVAEKGYQSWDVISLRADNPQKEALREKFLNEHTHGEDEVRFFVEGAGLFCLHIGDEVFQVLCEKNDLISVPAHTPHWFDMGSEPNFTAIRIFDNPEGWIAQFTGDDIASAYPRLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E-2/E-2' protein
publication title A refined model for the structure of acireductone dioxygenase from Klebsiella ATCC 8724 incorporating residual dipolar couplings
pubmed doi rcsb
source organism Klebsiella oxytoca
molecule tags Oxidoreductase
total genus 22
structure length 179
sequence length 179
ec nomenclature ec 1.13.11.53: Acireductone dioxygenase (Ni(2+)-requiring).
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03079 ARD ARD/ARD' family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1zrrA00
1UPIA 4LUKA 4PIXA 1VP6A 4WBBA 4MGZE 4QM9A 4BYYA 4XFGA 5AVPA 2XL7A 2IXHA 5J48A 5I0RA 4O9EA 2XLGA 4D7SA 3G7DA 1O7FA 2OPKA 4Q0VA 3PVBB 2Q1ZB 3S7EA 1SFNA 3USSA 4LLOA 1WA4A 2EVXA 3UKNA 4FT8A 2N7GA 2GC0A 3RYPA 2MHFA 5F1RA 3EBRA 3B02A 1Q43A 4KWJA 3SCHA 2C0ZA 1RC6A 4F8AA 1CAXA 1DGRA 4HMZA 3ACLA 3LOIA 1X8MA 2B5HA 3FZ3A 2ET1A 3H50A 4IETA 3KMHA 5LRRA 4JTNA 3MPBA 1XE7A 3EHKA 3WW3A 4AVBA 5HI0A 3IDCB 3LA2A 3SMHA 4KL1A 5K8SA 1CGPA 1UCXA 1ZZ7A 1RUOA 1IPJA 3GYDA 3RNSA 3HIFA 4Z07A 3H7JA 5LEJA 1OFNA 4MH0E 4KU8A 4AQ2A 1J3PA 2ETEA 2OZ6A 4IEVA 2ET7A 4XF1A 1RUNA 3ELNA 2Y0OA 2VECA 2XL9A 5FPZA 2ZKLA 3WW1A 3KGLA 3KGZA 4QGMA 4XF9A 3LA7A 1LRHA 3E6CC 5KHKA 4R52A 5FDBA 1FI2A 4HSLA 2FQPA 3FE5A 3D82A 2D5FA 2Z69A 4D7TA 1VR3A 2B8MA 1ZNPA 1DZTA 3PLQA 4AQ6A 4Q0SA 3QOPA 1U12A 1O5UA 1ZRFA 3TNPB 4AVCA 4Q0PA 3LAGA 5J3UA 4B29A 1SQ4A 4A2UA 5BUVA 1NYWA 3FFQA 5FPXA 5JSOA 4N9IA 4ZU4A 3OD0A 2IC1A 3UKVA 3SHRA 5E1RA 4EROA 4E2QA 1CAWB 4HVOA 5BY5A 1RTVA 2MPFA 2HKXA 3FJSA 5FLIA 1NE6A 4QXKA 5I0SA 4YARA 4NVPA 2IXKA 1CAWA 4MGKE 2EA7A 1H1IA 2IXIA 4XFAA 2E9QA 4F7ZA 1X8EA 2DCTA 2OZJA 4QM8A 1FXZA 4K8FA 1LB2A 3OTFA 4UXAA 4J1WA 4MUVA 5FLJA 2CAUA 3O14A 2CGPA 4RD7A 5FQ0A 2IXLA 2UYAA 3IBMA 4HN1A 4ZU7A 2MNGA 3H3UA 1VJ2A 2D5HA 1J3RA 1UD1A 4HZFA 2D93A 2FMYA 2VPVA 1WLTA 4Z82A 1YHFA 1RGSA 4LA3A 3DN7A 4ONUA 2XLFA 3SXWA 3RDIA 2Z2SB 2PAEA 3EO6A 3C3VA 2Q30A 2GC3A 2UY8A 2XGXA 5FCCA 5LRSA 4AVAA 3GBFA 2QDRA 2CV6A 1J3QA 1YUDA 4L2NA 3U10A 2D40A 3SCGA 2B9UA 2IXCA 4UBHA 1G6NA 5JSRA 4LEJA 4XEZA 3MDPA 3NW4A 4FAGA 3FHIB 3S0MA 2UY9A 4META 3RYKA 4Q29A 1SEFA 1EY2A 4I02A 1O3QA 5I8SA 3FX3A 3CEWA 3CL1A 4PJYA 3FWEA 3SCFA 3LWCA 1ZX5A 1CX4A 4MV2A 1O3SA 4UBGA 4IESA 1UIJA 3ES1A 1ZZBA 4BIFA 4MX3A 1ZZCA 2PHLA 3OF1A 3N4MA 2BYVE 3QACA 1O3RA 2V09A 3H1MA 1ZZ6A 5D1IA 3I7DA 3KCCA 1YFUA 3HT2A 1OD5A 2PHDA 1IPKA 3JZVA 3CLPA 1ZRCA 4HVRA 2F4PA 2XHKA 4O9GA 3H3ZA 5JAXA 4XFIA 5KBFA 1Q3EA 4YRDA 1ZRRA 5T3NA 1QXRA 2PFWA 5JSPA 2PQQA 3BCWA 1V70A 4IEYA 2XKOA 1XE8A 4X6RB 4LULA 3E97A 3RPQA 3S7IA 4EV0A 3DKWA 3E6BA 3R6SA 4ORFA 2QNKA 2WC2A 4XF0A 2PA7A 2PTMA 4IEUA 3I54A 4IEPA 4IERA 2H6CA 1X82A 1PMIA 3PNAA 3H8UA 1QXJA 2CAVA 2P17A 1CAUB 4X6QB 2GU9A 5I93A 2BGCA 3ZDSA 3BU7A 5JCTA 5I91A 4I09A 1YLLA 2GAUA 5EFUA 4LTAA 2KXLA 4PIZA 4LA2A 1CAUA 1UW8A 1PM7A 2PYTA 4JVAA 1X7NA 1ZZ9A 2K9ZA 1O5LA 2BNNA 5CVRA 2O8QA 4MZUA 2H0VA 2GZWA 4AXOA 3BB6A 2QJVA 3E5XA 4XFFA 4HBNA 3WW4A 3IWZA 2ZCWA 4QMAA 4I0AA 4TLFA 1DGWA 3HT1A 4FAHA 4N9HA 1ZZ8A 1JUHA 1I6XA 3H9AA 4YYOA 1LKNA 2HJIA 1FT9A 3ES4A 4QX5A 4WVZA 4IEWA 4XFHA 4KWLA 3LA3A 3NKTA 4CYDA 1J59A 4JV4A 1ZVFA 4MGIE 1H1MA 3CJXA 1YFWA 2GH2A 4IEZA 3E5QA 1Y9QA 5EZWA 2ATFA 3ST7A 4DINB 3H7YA 1CAXB 4YNIA 1GQHA 5I0UA 2PAMA 5LEKA 3BPZA 4BHPA 3M3IA 2OA2A 1WGPA 4Q0QA 4P9GA 5I8YA 2BNMA 1NXMA 4XFCA 4XF3A 1RL3A 4OLLA 1HW5A 3CF6E 1YFXA 4QGLA 2Q4SA 1QWRA 1J58A 3NVCA 4EWDA 3HQXA 3I59B 1EPZA 3L2HA 3MYXA 5KHIA 3M70A 2OYZA 3RZZA 3D0SA 1GQGA 2QVSB 4EWEA 1XRUA 1CAVB 4HSJA 3IDBB 1OMIA 4R8HA 3EQEA 3UKTA 5CADA 3OGJA 3I59A 5I8TA 3NJZA 3LZZA 5JR7B 4FBFA 3OCPA 3VHRA 3RYRA 4GULA 5CU1A 2I45A 4IEOA 4IEQA 2UYBA 3DL3A 1CAVA 3IIAA 4XETA 3H1YA 3TNQA 5FLHA 2Q0AA 4BH9A 1UIKA 1O3TA 4KWKA 3E6DA 4KU7A 1LR5A 4XF4A 3MZHA 4YSFA 2BEOA 5C8WA 3H1WA 4IEXA 4LUMA 1OI6A 1DZRA 5KHHA 1QY4A 1ZRDA 1EYBA 4Q0UA 4WZCA 1J1LA 1L3JA 4EWAA 5I0TA 5E16A 3EJKA 4OFGA 5KHGA 2QCSB 5BV6A 2VQAA 2K0GA 3U11A 4HVQA 3U0ZA 1NZCA 4H7LA 3CO2A 2GC2A 2IXJA 3BALA 3NSTA 1TQ5A 4XFBA 1YFYA 3NL1A 5BPXA 1Q5OA 1O4TA 1NE4A 4ZU5A 2BNOA 3DV8A 2H6BA 3D0JA 4I0BA 4E2GA 4MGYE 5J7MA 3ETQA 4JTOA 2EAAA 2XKPA 4J1XA 2WFPA 4E2SA 4I2OA 2GC1A 3KSCA 1ZREA 1YWKA 3ROUA 4I3PA 4HLTA 5KHJA 3E5UA 2PAKA 5BXXA 4HN0A 5FQ0B 4PIYA 3WW2A 2XLAA 1Y3TA 4L11A 4QGNA 1I5ZA 1EP0A 2O1QA 4I01A 5C6CA
chains in the Genus database with same CATH superfamily
3NNJA 1RUE2 4NPLA 3T0BA 1UPIA 1DHKB 2XUEA 4FTSA 3LEIA 4K21A 1HRV2 4PIXA 4AI3A 4YW4A 1VP6A 5FZFA 3WF2A 3VD4A 5IVYA 3RMYA 2XL7A 1BZWA 4YW5A 1XNKA 1E5HA 2ZGOA 4JX0A 4K6BA 4MXWB 5I0RA 4HK8A 4O9EA 5JOZA 4Q4W3 1ZBA3 1BLZA 4UW3A 3OBAA 4CEWB 4D7SA 3T0DA 4DNYA 3PJYA 4PLNA 4Q0VA 4CU6A 2IFRA 2Q1ZB 3PUQA 5K9YA 1I9RA 4B8EA 2BDRA 3USSA 1QJX3 1R1ZA 3T2TA 1VBE3 4MXWA 1J84A 2SLIA 3J8F2 4HT1T 5FKCA 3UKNA 5F5QA 2N7GA 1V6LA 4PI0A 4P00B 2AZ5A 1KJRA 1TEIA 1XJAA 4XUTA 2WT0A 1EV12 5A1AA 4LBJA 2ZX1A 3EBRA 1RUG2 3QBQA 4AFAA 3RFRA 3VD3A 3VD5A 4Q4X3 3A23A 1RC6A 4BE3A 1G9DA 1MZFA 2C26A 5FY9A 3FLTA 4HMZA 5FZ1A 2G19A 3CMGA 1PVXA 2OVUA 1IZ3A 4R9BA 2JDPA 5A6QA 1YJKA 4S2GA 3WF1A 1DP0A 1DYOA 2ET1A 2BPA2 5C8CC 1K5MC 1XE7A 3WW3A 3OBTA 3WDVA 5HI0A 3TN93 4K1YA 3O5SA 1NA1A 1XYPA 1RB8G 1UCXA 4QPGB 1GZ9A 3RNSA 4AWDA 3H7JA 1OFNA 4CCLA 2YDEA 5DZEA 5FAXA 5FO7B 2XPJA 2XJVA 3SLIA 4L0PA 2GH8A 4AQ2A 1IKQA 3J7MA 4CU8A 1HQLA 3VBRC 4YFZA 2ET7A 4Y26A 3WDXA 5F32A 2Y0OA 2WFF3 2ZGRA 4M3CF 4D6QA 1N47A 4QPGA 1PIV2 5FPZA 1RUJ2 4NOTA 3KGLA 4MXVA 1VB2A 4N7IA 1LOFA 1UOJA 2VE1A 2OQ6A 4FFGA 4P5HA 4GALA 1XYOA 4CSWA 2DDUA 2ZABA 2JG8C 4QHZA 1W9TA 1UZZA 4BQ4A 1UL9A 1FI2A 4FFHA 4HSLA 5FR3A 2QFEA 5IAVA 2FQPA 4BLJA 1KXGA 4FI9A 1IQAA 1DZQA 2OIIA 2W0XA 1BQPA 2B45X 3IMNA 1VR3A 3PUHA 3VKMA 2KM2A 4YVWC 5JLVA 1DZTA 2DU0A 4A7YA 5FZIA 4AQ6A 2VZOA 3RZMA 2EALA 1PGW2 4CRQA 5G04L 4BM8A 1ZRFA 4HL0A 4IGOA 3AMPA 4AVCA 2Z5WA 3FN9A 2ZZJA 1WCDJ 2RDRA 4B29A 4A2UA 1DG6A 1RUI1 2PLV3 1JZ7A 1H6XA 1FYUA 3AMQA 3BOWA 3LEKA 3QH7A 2WS92 4N9IA 2YUEA 3ZKYA 3W59A 3U1XA 1OUSA 4OHWA 1SBFA 2WO1A 3N3HA 2HBUA 2QBXA 4XAEA 3D6EA 4AQTA 1VMFA 1O8SA 4PLOA 3KCYA 5FLIA 5A3NA 4LNVA 5D8AC 1KDMA 2YY1A 4OI2A 1VBB2 4QXKA 5F9TA 1R091 3IB3A 2D6OX 5J96B 4QX7A 5F5AA 1PO13 4MGKE 3WY6A 4XUOA 2EA7A 5T5PA 2E9QA 4PLMA 1TG7A 2GNMA 2OZJA 4QQLA 4XBLA 4XJUA 3Q8BA 4NN0A 5ACA3 2P37A 2GNTA 5G05L 5FZBA 1LB2A 3N35A 3WP6A 4J1WA 4BQWA 4LITA 5L36A 5FLJA 1YQ5A 2VMFA 2HWC3 4HONA 4P5YA 3SH3A 1CR7A 3O14A 5FZCA 4LK7A 1AR72 1AR63 1NLRA 1S2BA 5BNNB 1WMFA 3M4FA 3VB9A 3H3UA 2JIJA 1VJ2A 3EXUA 2WZPP 5BNPC 1J3RA 4HZFA 2ZAAA 1YEWA 1HQWA 1BYHA 2FMYA 2ZEZA 2ZGTA 4W4ZA 3DPRB 2WJSA 4X8NA 2K46A 2WWUA 3NQHA 1RGSA 4LA3A 4XDPA 5LBBA 3H8XA 1RITA 2JENA 1GFF2 3O1VA 3KV6A 1ULGA 4OCTA 2X29A 2RS11 2Y6JA 3MHZA 3S30A 3ZR5A 3LFIA 2PAEA 3H8OA 3C3VA 3DPRA 2OS2A 3NMBA 3Q8CA 2UY8A 4CCMA 1P8JA 1MPXA 3H3LA 2R041 2EF6A 1GV9A 1UZVA 2XJTA 5KWRA 1A6CA 1KFXL 2QDRA 1O8PA 4UOJA 2ZGPA 4Y33A 1YUDA 1LNSA 2PELA 2KA3A 1A8DA 1GNZA 2D40A 3UETA 1PO23 2IXCA 1ZA7A 4M4PA 4NPRA 1U0AA 1HDKA 3T0AA 4Q4V1 4IDZA 3L9JT 3WG4A 3WNKA 4LOSA 2QUOA 4YM0A 3VDDA 4LEJA 2JG9B 1RUF1 3IIIA 4XEZA 5EYYA 3JU9A 3VDCA 5A3MA 2Y6HA 4JDNA 1C8M3 5T54A 4ASKA 4M01A 2WQ8A 3RYKA 1RHI3 3K51A 4D94A 3SITA 3IM0A 3I3DA 2BBAA 1IS4A 2MEV1 3VD9A 1EY2A 4GH4A 1O3QA 4BA6A 1TE1B 1GU3A 3CJIB 3MFAA 3CEWA 3HJRA 5FP3A 2ADDA 4QAWA 1YXWA 1N1TA 1E5IA 5DUXA 2R071 1G9BA 3GF6A 2CGNA 3HWJA 2RVAA 4PJYA 3HN3A 2WUHA 2NQYA 4AEDC 5SV5A 2R7EB 2NLRA 1F15A 1V9U1 4DUWA 4BWOA 1POV1 4MG2A 1U5YA 2Y6GA 1Y4WA 2X10A 4HKWA 1UIJA 2A71A 1RJ8A 2HWB1 4XJAA 4DY3A 4XQDA 1VBA1 2ZX4A 1XE0A 3POFA 4KBBA 5F2WA 4BIFA 1HJGA 2VMHA 3MIHA 4CP1A 4TSVA 2PHLA 2AEZA 3N4MA 2LROA 1O3RA 2WWSA 5L19A 2F17A 3W5MA 1ZZ6A 2ZMNA 2P3IA 5D1IA 3KCCA 2WT1A 4URTA 1LHUA 1IPKA 2VXJA 2D43A 3GZUC 4KWUA 4TN7A 3CLPA 1WMXA 5DDJ1 2F4PA 3H3ZA 1DF0A 2DV9A 3N7MA 3POWA 3ZO0B 1W05A 1Q3EA 1ZRRA 1UYYA 5KC6A 3RWKX 4R9DA 1HRI2 4D6SA 1YNAA 1WMDA 2WT2A 3LDBA 1V70A 4EN9B 3AKQA 2FDJA 2FCTA 2FDHA 1NG0A 2WN2A 4Y24A 1W8UA 2RS53 1XOYA 2WNVB 3M8LA 4RHV1 4BU2A 1JUIA 3E97A 3RPQA 1JZ4A 2PHXA 2RJKA 2DCKA 2YGMA 3DKWA 3E6BA 4QQOA 4CCDA 4Y1ZA 3NKGA 4FO9A 1D4M3 2QNKA 2YBPA 2QZ3A 4S2HA 3I54A 4IEPA 4IERA 1NY72 2ARCA 3LIGA 1ND2A 2QQOA 4JKLA 2DBIA 3THPA 4QQHA 2WNVA 2BTVC 1GLHA 4ZS2A 1RUI2 1S4CA 4PDWB 1VBC1 1NT0A 2Q5TA 4LBKA 1QXJA 4Y20A 1XNDA 1CQ9A 2JE7A 2VR4A 4Q4Y3 5FY1A 2GMMA 3KQRA 3TBDA 4JAAA 2RMU1 2FDFA 3AB0A 5A1FA 2Z4FA 4Y3OA 4X6QB 3W5NA 5IK7A 4A3XA 5A7QA 2BGCA 4OULA 5FMDA 1RUH3 1RUC2 2A70A 3AFGA 2P6HA 3KS7A 3MLLA 3U37A 3WF4A 4EZHA 5CEHA 1E5SA 1YLLA 2GAUA 2VW2A 4LE4A 4LTAA 2W47A 1W6MB 2E51A 4PF5A 5EFUA 3V0AA 5A33B 1ND3A 1H8VA 2YC2A 4NIIA 2PYTA 3M1HA 4AQSA 1Y43B 4DZGA 2BOJA 5F3CA 3QH6A 1ENQA 3WDUA 2WIIB 1GUIA 3ZFEB 4MZUA 2VNRA 5F37A 1LAJA 3AVSA 2WNUB 3MO4A 3ZSKA 3MIDA 4AXOA 4FOWA 3ZYPA 2W52A 5IFTA 4P9XA 1HB3A 1RJ7A 1WD3A 4XFFA 3ZN4A 5EJ1B 5AC93 2WINB 1S1AA 5C7GA 3WW4A 2ARBA 3R05A 4Q1RA 4QMAA 1L7LA 3GBGA 2XJQA 2Y6FA 4I0AA 1CESA 4GKXA 3UJQA 3ZFEA 1JOJA 5JIUA 1JUHA 3AL6A 2AGSA 4YYOA 4BIOA 4XOGA 1FT9A 3U07A 4YGEA 4QX5A 5FJKA 1OOPB 1PNFA 2CGOA 2VOWA 1EUUA 2GN3A 1KS4A 1CJDA 4XFHA 2VBPA 3LA3A 1OLMA 4RFT0 4ZZ5A 1GICA 2WZ8A 3HMYA 4CYDA 4WM7C 2DTWA 2Y6KA 1C1FA 1UY0A 2RS12 4AI0A 2LW8A 1UWWA 2R1DA 4NO4A 2VZQA 4UFHA 3F2ZA 1DYPA 2J22A 2R042 5A3UA 5IUQA 2EXJA 4YLZA 3V56A 4AF9A 5LBCA 1GP6A 5FYTA 1ONAA 3H7YA 5JVVA 1CPMA 5FXWA 1JU4A 4I3GA 1Q8OA 3M3IA 5ERLA 2DVDA 1GOHA 1D7PM 5FZ9A 5K7PA 1ENSA 2AC1A 4KGGA 4Q4V2 2BNMA 3D3AA 4Z2WA 5IK8A 1SHWB 4QDSA 2ZGKA 3LSDA 1S0DA 2QQKA 2ERFA 1YFXA 3RG0A 3UGFA 4AEKA 2Q4SA 2ORXA 2JWPA 1AL23 3A21A 3ACHA 1TME2 4M4RA 3AP5A 2QQNA 5JWPA 3WG1A 3ZX7A 3ZXJA 1FOD3 4DIQA 3MYXA 2YV8A 2F6BA 2MEV3 1E5RA 4L97A 5F6LB 2WABA 2QVSB 4EWEA 1XRUA 2BU9A 3UKTA 3GM8A 3EQEA 5CADA 4IUGA 1Y9GA 3I2FA 3VHPA 2X53S 1OUXA 1UU5A 1WW4A 2EICA 2R073 3DCQA 4N7UA 3LZZA 1AZDA 1MQTC 2RM21 3QLQA 4GJYA 2BZDA 4TXWA 3OCPA 1KQRA 3RYRA 3U14A 4C0HA 1V9U2 4H3WA 5CU1A 4RR3B 1IS6A 4LHSA 2XOMA 3I2DA 5FK7A 4XXPA 2UYBA 3IIAA 3AYCA 3VBHB 4EQVA 2XUMA 1H4GA 2Y34A 4WZFA 5LB6A 2B42B 1KRIA 2A6VA 2HWB3 3ATGA 3MUY1 1LJ7A 1UMIA 4HXCA 4KNCA 1VBA2 3E6DA 4YM2A 5H9SA 4KU7A 1YRZA 3W21A 4GWMA 4GMP0 4XC9A 1TMF2 4DRRA 3MZHA 1ULFA 5C8WA 3VBHA 1LULA 3UV9A 1AF9A 1JZ8A 2P5BA 5KHHA 1HXS3 2J1AA 1GMMA 4OYUA 3PVOA 4N43B 4OUSA 1J1LA 1RUD2 2ADEA 1JS9A 3N9OA 2RDNA 4QX3A 1IHMA 5DDJ2 2XH6A 1JHJA 2WQ4A 3OGGA 1NA1C 5E16A 1QJU3 4WVVA 3C7GA 4QDQA 1FNYA 1RMU3 5DAQA 4L9BA 1NZCA 3NWKA 2UU8A 2DUQA 3PJQA 4NHKA 5FYSA 4RHV2 3BALA 1TQ5A 3NL1A 1MS3A 1Q8SA 4QQ2A 3L2YA 4O61A 1O4TA 4QPGC 2VJXA 2VCMA 1XPWA 3AC0A 3DV8A 1I5PA 1XYNA 5I0DA 2WA4A 4MGYE 1FNZA 3ZKUA 4XIOA 5A7WB 1LOFC 1VBC2 2EAAA 5EPAA 2WFPA 3KV4A 3LDRA 3TB0A 3WSOA 4BMBA 2QQMA 5HBAA 1OH4A 2GC1A 3BTXA 1YWKA 2RMU2 3ROUA 1WLWA 3KF3A 5L7OB 4J6GA 2DTYA 4M3CB 5A7WA 2DU1A 4CDXC 1SBDA 4LK6A 4Q4W1 1ZBA1 4QU2A 4LIUA 2VZRA 1EP0A 2O1QA 3LIHA 3N7JA 4LBQA 4LO4B 3WNNA 1V6IA 3ABZA 2WBKA 2QQLA 5DAVA 4A4AA 3I2GA 5L7OA 3NV3A 1QJX1 3THTA 4ATFA 4M3CA 4LUKA 1VBE1 4YVSB 3OD4A 2QZ2A 5C33A 3N36A 3MI8A 5FUIA 4CEYB 1LU1A 2FDGA 4WBBA 4QM9A 4XFGA 1QJEA 1VLNA 4JQRA 3MW3A 4CA9A 1N3PA 5JZGA 1EUTA 3UL2A 3IAPA 4UFKA 2D44A 3AYEA 2VQTA 2XLGA 2X5IA 4A41A 3Q8EA 1O7FA 4JGYA 3KHBA 2OPKA 4NHMA 5A3LA 4QHBA 1F5FA 2ZGMA 2GMPA 4HETA 3S7EA 4BMEA 2ZEXA 4LLOA 1HIXA 1TNFA 3T1MA 2VQ0A 3VBUA 1WA4A 4E4ZA 2HH9A 4FT8A 5FO8B 3U75A 1OBNA 2VOTA 2OKXA 4YM3A 3B9IA 4C1XA 3TN91 1JOBA 4UW6A 3WP5A 5F1RA 3BUCA 4KH9A 3VLBB 5IVJA 2VUAA 5EP9A 4OHZA 4BQXA 1W6NB 1UOGA 1Q43A 1QQP1 4GB31 4E8DA 4LXLA 3CNAA 1CAXA 1XNAA 3J7NA 1LECA 3ACLA 4ITCA 1NCQA 2ZPXA 2ZOEB 3ZSMA 4G9SB 3H50A 4IETA 2VC9A 3KMHA 4LOTA 4P02B 1SLAA 4AVBA 5A32B 3U4XA 1ST8A 3IDCB 3ZN6B 5FY8A 3SMHA 1QGLA 3I2IA 5K8SA 1S0EA 4XVHA 1ENRA 1D0HA 1RUOA 5LEJA 2O8OA 5GKAC 1I1EA 2GMEA 3CZUA 1VB4A 5E8AA 3I49A 3QCWA 2JDUA 2ZXQA 1W28A 1J3PA 2ETEA 1VAKA 2OZ6A 3RS6A 3J7LA 1RUNA 3V64A 4AVVA 1W8FA 3ZN6A 2ZA9A 1PVC3 5GLUA 3LEGA 5LATA 3VBFB 5HCAA 4XF9A 5FZEA 4FSJA 2W5FA 2WNOA 2WLQA 1OQ1A 3VZKA 1LRHA 5HCBA 3C7OA 2XJUA 1AJKA 1LTEA 4E27A 5KHKA 4V2VA 3VZNA 1U5IA 2PLV1 1U5ZA 1SCSA 1W06A 4M3CE 4NUBA 1VBD2 1LHNA 1SLIA 1KD7A 5A6ZA 2JD9A 2QQVA 2RM22 2VMGA 4OHVA 1HB4A 3T4HB 2D5FA 3VDDC 2V4VA 2RHPA 5GLTA 4GWNA 5IW0A 4P9JA 2LS6A 4OUMA 3QOPA 4XXAA 1OF4A 1U12A 5LCWL 1AR93 3C8XA 3WNMA 3VBSA 4Q0PA 4JRAA 2HLEA 5HXMA 4GH4C 4XYXA 1S2EA 5J3UA 1SQ4A 2P3YA 1PO11 3C2UA 3JBG2 4MLOA 1UKRA 5FXXA 4BISA 4ZU4A 3OD0A 1JXNA 1HN1A 5IAXA 3WUCA 5H9PA 4GQ7A 1CZSA 1W6QA 2QQUA 2G9ZA 2RDSA 3WINE 5ABJB 3WG3A 3WQ0A 2OPWA 4AFDA 5BY5A 4RQPB 5FY5A 1QKQA 2HWC1 3GJBA 2JDNA 2JKBA 3AZYA 2HWE3 5F3GA 2HKXA 3JCIA 2L9LA 3JXSA 5C3RA 2HYXA 5L9RA 3TRSB 1NE6A 1XNCA 2YPJA 2CNAA 5ABJA 4NVPA 5C3OA 4JDMA 4IV1A 4MO3M 5LASA 4XFAA 2IXIA 1X8EA 3LD8A 4J25A 1FXZA 1B35A 4NR1A 2VTXJ 3O1PA 4Y1YA 3OTFA 5CFDB 2VH9A 4N53C 4ZY9A 4MUVA 2CAUA 3RZGA 5IK4A 2XBO3 4FPCA 2CGPA 3OSDA 3KF5A 4RD7A 2OXBA 1UY2A 5DG1A 4G4FA 2P4EA 2VNGA 5FQ0A 4E9KA 4FPHA 4HN1A 1H2NA 2MNGA 4FOYA 4QXHA 4BCUA 1C1LA 1SACA 2D5HA 3MW2A 4MYEA 2ZGLA 2D93A 2V4AA 5LA1A 1COV3 4CDQB 4OI4A 4JKKA 1H8TA 1XU1A 3AM2A 4DB5A 2ZACA 3GCWA 4EN8B 1YHFA 5CFCB 3Q9OA 1V6OA 3O1MA 4Q4W2 1ZBA2 1PO21 1CZTA 1MS0A 5FRAA 2VZ1A 3AZZA 4QB2A 3T2OA 3H42B 2G1MA 3FLRA 4YG3A 4A45A 3BIWE 4ONUA 2CHHA 2XLFA 4ZXEA 4LIVA 1QHDA 3SNMA 1UZWA 3SXWA 5BNOB 1QJX2 4NHXA 3EO6A 3ZXFA 4AOCA 1H4HA 1ND2C 1VBE2 2DURA 2CYFA 2QKDA 2XGXA 5FCCA 1C8M1 2BWAA 5A3WA 4HANA 1LOCA 1RHI1 1JH5A 4GMP1 1QH6A 2HEWF 1PM4A 3GBFA 4X8PA 3ZYIB 4CEWA 5GZFA 1T6BX 1J3QA 1GYKA 3ZVXA 4CPBD 2G9FA 3T4VA 5BNOA 4COYA 2W1QA 5LY2A 2HEYF 3SCGA 1BK1A 2B9UA 4Q4X2 4QB1A 4B4QA 2V5YA 1CJPA 4AVTA 3LB9A 1JZ2A 4YW3A 3GDBA 1PZ9A 2FMDA 3GHNA 4EJRA 5A3TA 2J1EA 3W20A 1ND3C 4FAGA 4AE2A 2EXHA 3IT8A 4META 1W9YA 2CL2A 2NMNA 2CTVA 2VZ3A 3R4UA 4W6XA 1DQ6A 1SEFA 1SFPA 2CY6A 3TN92 4C1WA 1NQJA 2E31A 4MOAA 4O7XA 4GKYA 3POGA 4I02A 5FZAA 2BV4A 3WVJA 1KEXA 2D6LX 3MW4A 4FPKA 3O0WA 1QQP3 2A6WA 1RINA 4GB33 4AHXA 3LCPA 3KVBA 1REEA 4XUQA 3AP4A 5C3QA 3SCFA 2WFF2 3LWCA 3ZFEC 1QXPA 2FBEA 3ZXLA 3J26N 1ZX5A 1N1SA 1CX4A 2VM9A 4MV2A 1PX3A 2X09A 1MVEA 5FIXA 4XJ8A 1YCIA 2IUWA 2XJPA 1MEC1 4NWWA 3PIGA 1AL0G 3AXDA 2R0HA 3MLJA 4Q2FA 3ILRA 1QJY2 5L9BA 1QEXA 3ES1A 3JUUA 4Y4RA 3JB4C 4MX3A 3OUIA 4COZA 3PU8A 4GXLA 4YZ5A 2VZPA 4CCNA 3OJBA 2Q8OA 4XMAA 2RS51 2DWRA 2V09A 1S0JA 3I7DA 3VD7A 5A6YA 3HT2A 1OD5A 3ETPA 4UW4A 1D4M1 3FLPA 5A70A 2GP5A 3CIHA 2NPIA 1UYZA 1RUJ3 1BBT3 5DZFA 1LEDA 2E53A 5APAA 5B4NA 2XHKA 5JAXA 1ASJ1 2VBBA 2YU2A 2PLV2 5JOWA 5FPLA 2GNDA 1T2XA 2JJ6A 4XDQA 3AZXA 4Q4Y1 3SEEA 1YI9A 4UFLA 4NIAA 2ZHLA 3ZPOA 4CTEA 5GZEA 2DUOA 4G3YC 1GKBA 4X6RB 5FP9A 1LU2A 4EV0A 5FREA 1DIWA 1RUH1 3R6SA 4ORFA 3WUDA 4AI9A 5E89A 2WC2A 2PTMA 4ZKTB 5FZ8A 4CCOA 1X82A 1HX6A 1R081 3WHTA 4AZZA 1PO12 4LORA 3ZSLA 1SLBA 2P17A 2AENA 2VZTA 1X36A 1ZA4A 3AKTA 5FFOC 5ACA2 4UYBA 1W39A 4KQ7A 5JR2A 1HJFA 5I93A 3O1UA 2WZR3 1W6OB 4RA0A 5DQ0A 2HWC2 3ZDSA 5AC91 4LBMA 2BBVA 4FTBA 5F3IA 4ZHNA 4IL7A 5EWSA 5FZHA 1IG3A 4I09A 1K5JA 5FV3A 1AR62 2A6XA 3P6BA 3K46A 5EHDA 3OBZA 3GHMA 4LA2A 1W8WA 2D98A 1PM7A 4QX1A 1C8NA 3ZM8A 1VBB3 5IHRA 1W6OA 4JGZC 4DY5A 4ES8A 1GZTA 1NXD1 1OLRA 4W6YA 2XJSA 3IN9A 4Q1PA 3IMMA 2X8KA 2H0VA 4CDUB 2GZWA 4B3NA 3RZKA 2HWF1 4C8DA 4FPJA 5BNNA 4EN7B 2QJVA 2UWCA 3E5XA 4QX0A 5F2SA 5AVAA 1O59A 3FMGA 3ZYRA 5C4WB 4HBNA 4IE0A 4ARXA 3IWZA 1PMHX 3KM5A 2ZCWA 2W94A 3FL7A 3GZTB 2OW4A 4TLFA 3VBOC 4XQ4A 1ZZ8A 4CDUA 3LF7A 1NAEA 1CD3G 3H9AA 2DBNA 3AVRA 3ES4A 3GZEA 1MVQA 1EAH3 2ZX0A 2W95A 4BJ0A 5FP7A 1T6GC 4AFCA 1YQCA 2A73B 2WL1A 3P5BA 5FMCA 1PO22 1MZEA 2D97A 5IK5A 3RZHA 2V5DA 4GAZA 3VKFC 5K0UB 2YMZA 3B01A 3CJXA 5L9VA 4QWNA 4IEZA 4Z2AA 2GALA 1C8M2 4AFBA 1AL21 3M3EA 2OX0A 3PMSA 3SH5A 2FCUA 3NNMA 1RHI2 4ZONA 2JE9A 4CUGA 4DFSA 5C9AC 5J37A 4GMP3 2EIEA 1FOD1 4LR4A 4NAMA 3VZJA 4DINB 5CISA 4TTGA 1PK6B 2JD4A 1VMHA 1V6JA 2PAMA 2RS31 3AMNA 1FMD3 5K0UA 4DXTA 3V65A 2OA2A 1WGPA 4UT5A 4CDWB 3MLKA 2JG9A 4P9GA 4Q0QA 5F39A 5J1XA 3THCA 5LW9A 3MGUA 4WM8B 1Q8VA 2R30A 4EYUA 1NKGA 3ITQA 1PK6A 4XF3A 3AYAA 4QPIB 5L7OC 3OPWA 4QGLA 4B1LA 3ZR6A 1W2UA 1OPOA 3NVCA 3CJIA 4EWDA 5KHIA 2VUJA 3ZLIA 3BI3A 1F4AA 3ZYHA 2OYZA 1JN2P 4QPIA 1ZBE1 4NE9A 4K9SA 5FPAA 1UU6A 5JZGC 5DMYA 1K42A 1CAVB 1WUVA 2VMEA 3AJZA 3IDBB 4HSJA 4R8HA 1MS4A 4NIHA 4LLFA 1FX5A 5CIRA 3SEPA 3VZMA 2X5IC 5HV4A 3OGJA 2O14A 4JGYC 3NJZA 2IWGB 4DXSA 5JR7B 3GNEA 1TVGA 2VMCA 4FFFA 4DXRA 1DU3D 4AEJA 1HXS1 3I3BA 1JU3A 1OVSA 1CAVA 3VBUC 4XETA 4MVTA 1DQ5A 1MEC3 1UQXA 3TNQA 5FLHA 5JIAA 3TEXA 3AXEA 1O6UA 1QJU1 2C1FA 1W9WA 3KCXA 3I2OA 2RR13 1US2A 1UY4A 3NV4A 1RMU1 1SBEA 2R16A 4P9WA 3WHUA 4OQ8A 2JB8A 3H1WA 3DECA 3AKPA 3N7KA 2RS52 3OY8B 4IEXA 4PBOA 2CDPA 2XJRA 3EB7A 5HV0A 3BIEA 1SDWA 1NCQC 1D4M2 2TEPA 2DCZA 5A7PA 4H2AA 5KXBA 4AYUA 4BPZA 5CKNA 5FPBA 3KB5A 3S6PA 4ES9A 3V0BB 5CG8A 1L3JA 4QQPA 1RIRA 3OY8A 4CPBA 1UX7A 5I0TA 4CUBA 3AKRA 4CU9A 1ASJ3 3EJKA 3NJVA 4LMFA 4OFGA 1IPSA 4Q4Y2 4DRVA 3DGTA 5BV6A 3U11A 3BTAA 1X9TA 2PN5A 4H7LA 3V0BA 3TYJA 1DLLA 3NSTA 4GWIA 4NWVA 1K3IA 4ARYA 1RUH2 3KZ4C 1O4ZA 5BPXA 3ZIWA 2VQUA 5JMOA 4LBNA 4PDWA 1NE4A 4NPMA 4ZU5A 2XONA 1XC6A 1G9FA 3HR9A 4I0BA 5JXGA 1R64A 5FMOL 4CP2A 1WCKA 2J7MA 1R092 4YZ3A 1JYWA 1R083 1M06G 5C3SA 1CPNA 4E2SA 2JB4A 3KSCA 4GD4A 2WRAA 1WLCA 4D8MA 3AMHA 4I3PA 5JOXA 3HQUA 1DYKA 3KT7A 3AP9A 2JICA 2ZS6B 2W2IA 1W6MA 1A78A 5A33A 3LOBA 5AC92 4COUA 4YW6A 2JKXA 5C8CB 3GBWA 4QGNA 1I5ZA 5C6CA 4I01A 3UJOA 1FAYA 1LOAA 4F83A 3VBSC 1WCQA 2WNUA 4CDXA 5C70A 4D0QA 3JB8A 2X05A 3RVHA 3CQOA 2OT7A 3T09A 5FZ4A 3SC7X 5ANQA 3VBRB 1K12A 1OA2A 4DOUA 3NO8A 2BRTA 1C57A 2HWF3 1NQDA 4RS5C 1W2OA 5FZMA 4QDRA 3VN4A 1RXGA 2W1UA 5KXDA 3IDEA 1LHWA 1OOPA 1BVVA 3VBRA 4XIKA 4C91A 5A80A 3O1TA 3B5LB 4NIDA 4LQRA 4K8RB 1LESA 4AR2A 3ILNA 2EVXA 5ABJC 4YZ1A 3WP3A 3RMXA 4WVWA 3LEMA 1AR83 2LTNA 4IV1C 4N8MA 2WO3A 3EMRA 1FPN3 2LM3A 4YVWB 5EV7A 3G6JB 3RGBA 2MHFA 1DQ4A 3K4ZA 1B35C 1CVNA 1VAMA 2RDQA 2ZMLA 3B02A 3BGAA 4NRMA 3FBYA 5FY4A 2C0ZA 4F8AA 1XSQA 1AJOA 3NRUA 1DGRA 4CCKA 1RUF2 1OH3A 4A7ZA 3TEZA 2W87A 3WCSA 1AL22 3WX5A 2A7AA 3LOIA 1X8MA 4XURA 1OPMA 2I74A 4AW7A 1VIWB 1PVC1 4XBQA 1IKPA 5LRRA 5IVEA 3OGVA 3MPBA 2MEV2 5C5TA 2RS33 3CDZB 4B7EA 1AXZA 2WQZC 3I3EA 1H8TC 3LA2A 4KL1A 4LHNA 4MADA 4RN5A 1ZZ7A 4Y5Z0 3GYDA 3PUSA 1UMZA 3HIFA 4Z07A 4YM1A 3OEBA 2R072 1HV1A 3HN1A 1N3QA 5D8AB 5HXVA 4E4SA 4KG8A 5FWJA 2HWD3 1QH7A 3AZVA 1LOEA 1C4RA 2XL9A 4R9CA 1W0NA 2ZKLA 3WW1A 2ZHNA 1SLTA 3NNGA 1AR91 3KGZA 1V0AA 1OQDA 2HWB2 4CEWC 2E7AA 5BNOC 5LK7B 1F31A 2XVLA 1ZBE3 1HN0A 3D5OA 3E1F1 2ZAHA 1H2MA 4INDA 4MSVA 4P08A 2BQPA 4GWJA 4XCBA 4RR3A 1WW6A 1H0BA 4BQ5A 4HK9A 2W39A 5FDBA 1N1YA 4YW7A 4FPFA 3FE5A 3D82A 1KITA 4ATEA 1H9PA 1HXS2 2XWJB 2Z69A 1IQDC 5BNPB 3PLQA 1OA3A 2BWCA 4JKMA 2PMWB 4Q0SA 2FD8A 4F3JA 1VRH1 1QF3A 2HWE1 1BJQA 4A6OA 5FKBA 5IWFA 3O1SA 1MR5A 3TNPB 4U36A 4QXBA 1WW5A 3OG2A 1QJU2 3ZYGA 2E7TA 3LAGA 3PDQA 1GP5A 5FUNA 3SKJE 3WV6A 3ZYBA 5J09A 1RMU2 3FFQA 1OLQA 3KV5A 1S0IA 4N43A 1TMF3 2A6ZA 1Z7S1 2BW8A 2DFCA 2KD7A 2IC1A 3UKVA 4EROA 1BEV1 1ULCA 5BNQA 4E2QA 3JQXA 5DZGA 2B7YA 4GA9A 3MFCA 3ACFA 1CAWB 4HVOA 2D6MA 5DAWA 1RTVA 5GJ6A 5HCHA 2XBO1 2MPFA 2CWMA 1UXZA 4ISQA 1NZIA 1RUD3 4UI9L 1HV0A 4LHLA 4XZUG 1SPPB 1Q8PA 3O1RA 2A6YA 3J9SA 2IXKA 1DLCA 1KFUL 1CAWA 3WD5A 4DPNA 2WZEA 3TOJA 1UAIA 3SH4A 4YGBA 1COV1 3OEAA 3CHXA 4FQZA 1R1A1 2VCBA 4F7ZA 3DYPA 4R9AA 2DCTA 2Y60A 2C9KA 3ZYFA 2I07B 2NMOA 2YGLA 2YXSA 1SPPA 4H14A 4FVVA 4UXAA 2BP6A 5K4LA 4Y1XA 4DMIA 3RWNA 2IVJA 2VVFA 4KG0A 5FYBA 5FYZA 3POYA 3ZN5A 5FP8A 3T30A 4ASMB 2AREA 2IXLA 2R0FA 5CB7A 1BKZA 1M4WA 4A7KA 1DDLA 1MACA 3HPNA 3N9MA 5CYYA 5FYIA 2Y26A 4Z92B 1UD1A 1CX1A 5FZ3A 4QT6A 4BZ4A 3MBWA 2J42A 3FC0A 3T3YA 3WLUA 1WLTA 4AEDB 4Z82A 2OQ7A 1IGOA 2XB6C 1PGL1 1RVF3 5C5UA 4JHZA 4YVSA 3VZLA 4UF0B 3RZLA 1GNYA 1PNGA 4CUAA 2R49A 2R063 3B00A 1DQ1A 1W0OA 4CEYA 4DEVA 1GNHA 1WKYA 2VL4A 2WR9A 3CZJA 4I30A 4KI5M 2XVGA 3RDIA 3WT3A 2W3JA 4AEDA 2Q30A 1D2QA 3VL9A 1US3A 1AYM3 4H55A 3LDKA 3VKLA 4NMIA 5LRSA 4IQPA 2AYHA 1WBFA 5IJRA 3KHCA 1BMV1 1HB2A 2C4XA 1L7RA 2CV6A 3ZMOA 3NAPB 2TNFA 3ZFFB 2PHWA 4L2NA 5AFBA 1H9WA 4CE8A 2GN7A 4UBHA 4R4XA 1G6NA 3ME2A 3NNLA 3DF0A 5JSRA 1JTZX 2WLPA 3NAPA 5FXVA 2YFZA 3A22A 3APBA 3ZFFA 3MDPA 4EZ4A 3KVAA 4DQAA 1S55A 2VTXA 4E8CA 2E6VA 1W6NA 4Q29A 4UAPA 5JXJA 3BTZA 2ZKNA 4FTEA 2ZEWA 2XG3A 3Q8AA 4XTPA 1OHFA 4MGQA 3PTYA 3OOXA 1AYN3 4HG6B 2W68A 4XW3A 2FZ2A 5BNNC 4LE3A 2WN3A 4GZ9A 4MHUA 5F6KA 3TAYA 3ZSEA 5IT6A 4RYDA 3UNPA 1BCXA 2TBVA 3POBA 4QKNA 2YBSA 5DUUA 1Y9MA 3I4IA 1WCSA 3FWEA 3NV1A 5A32A 3DPRC 2OUJA 2D6KA 4OMCA 4JZRA 3H0OA 4QX2A 5FUPA 1PVC2 1W3XA 4EN6B 1Y7BA 4NAOA 1O3SA 3WZ1A 1OURA 2VNOA 1OA4A 1LGCA 1RUJ1 1BBT1 3MIFA 5J36A 4AG4A 3PL0A 3GALA 3VV1A 3HEIA 3JD73 1UO9A 2Y8KA 1UXXX 3B69A 3ILFA 3TWIA 1LENA 1SLCA 2P6CA 3WQBA 3WEZA 1CIYA 2HYKA 2I2SA 4MGSA 1WZXA 3VBFA 3R0RA 3URFA 3P1IA 3AKSA 2P2KA 3MPPG 1YC61 1YFUA 2AEYA 5E6HA 1C3HA 1AR92 4NROA 1UOFA 2CSGA 3P3NA 4QB6A 1PGW1 3K2OA 5GLVA 5K0UC 1ZRCA 4HVRA 3B9CA 2JECA 4XDOA 2JG9C 4GJZA 4L99A 4XFIA 4YRDA 5KBFA 3WOGA 1JYXA 5T3NA 5FMOS 2VVDA 2PFWA 5JSPA 4IEYA 1VBD3 2WS91 2XKOA 3O7OA 4AHYA 1JYVA 2A1XA 4LULA 4CCJA 4XE9A 2WZR1 4CZSA 2ZGSA 5M0TA 4IE6A 2HWE2 1VAVA 2B4KA 3CJIC 1VRH3 5KR7A 2PA7A 4IEUA 3ZFGB 1W2TA 2YPDA 1WA6X 5LA9A 5CA6A 1PMIA 3ZXGA 3KT1A 3PNAA 3LKJA 4QPIC 4WM7B 2P3KA 4YPJA 1VBB1 2WSVA 4JQTA 2ZGNA 3WQ7A 2VUCA 1V00A 1DGRN 1W0PA 1GP4A 2CAVA 2JDMA 2Y0IA 3BYWA 4RQPA 3VZOA 1AUYA 4CCCA 1Z7S3 3GCXA 1FATA 3ZFGA 3RJ2X 1BEV3 1UYXA 2FDIA 2JDAA 1XXNA 1Q56A 2NP0A 1OXCA 1G7YA 2XBO2 3BU7A 3GJAA 2OUHA 3POIA 5JCTA 4B4RA 5JXHA 4Y1UA 5FK8A 3KV9A 2KXLA 4PIZA 1X9PA 1AR71 4XTMA 2DVFA 2DVAA 2J1VA 3Q8FA 5A3OA 3POJA 3WDYA 3RJRA 1X50A 1QU0A 4JVAA 4XACA 1Q8QA 3GGLA 1JODA 1EAH1 1COV2 5CFDA 1O5LA 2BNNA 4UFIA 1SDDB 1GR3A 5CVRA 2O8QA 3KLSA 1R1A3 3VDBA 4JDOA 2VY0A 5DPNA 3PTRB 2YYOA 3INAA 3USUB 2SBAA 5FZGA 2QDNA 4WV8A 5ISLA 3ACIA 2JX9A 3AMMA 5DABA 1NCRB 3ENRA 5H9RA 1DGWA 2BGPA 1PZ8A 4IGPA 4N9HA 4YWAA 4CDQA 4XJWA 5CFCA 5C71A 1JHNA 1RUE3 4W65A 2WNVC 3O0XA 4PCRA 3USUA 1XB9A 2D3PA 1HRV3 1XSRA 5LY1A 3BODA 4AI2A 1MQTB 4LKSA 1JI6A 1FMD1 4IEWA 1NCRA 2ZX2A 4A42A 1PGL2 1OF3A 1OVPA 4KWLA 3WDWA 4B7KA 3NKTA 4Y22B 4Q8KA 2PHRA 4FOVA 3LGRA 4JV4A 3KT4A 2GNBA 4FXGB 5A7NA 1ZVFA 4PDWC 4MGIE 5IVBA 4ZU7A 2XDVA 1MQTA 1NLQA 3E5QA 4W8JA 2VVEA 1Y9QA 2VGDA 3AL5A 2ATFA 1G9CA 2LRPA 5EYXA 2VTFA 3ST7A 2D3SA 4L8QA 4ZXKA 1JYIA 4Y22A 1BMV2 4ASLA 2WAOA 2ZEYA 3J8F3 1GQHA 3TEYA 5I0UA 1G8WA 1S0CA 3BPZA 4LBOA 4BHPA 3MIBA 2D7FA 2WDBA 1UX6A 3BPSA 5FY0A 4AGRA 1EV13 1QQP2 1YJLA 2ILMA 4GB32 1ALYA 2VU9A 3UK9A 3WNOA 1RUG3 1NXMA 2PXJA 1BK0A 4XFCA 4PI2A 1NA1B 4OLLA 1HW5A 2JDYA 4AGGA 1W2NA 1D4VB 4HPKB 1W03A 2WNUC 2JXAA 2W08A 2E63A 4PQQA 4AAXA 3HQXA 2AUYA 4N90A 1EPZA 3L2HA 1G86A 4IV3B 4Q8LA 1YI7A 5FYHA 2QQJA 3M70A 2VZVA 5TSWA 5FZLA 3WG2A 3P3PA 4KBZA 3CU7A 2DVBA 2ZGQA 4HPKA 2RR11 2BOIA 4OMDA 1W3VA 2ZBJA 3WP4A 1QOTA 5KC5A 2XQXA 2WWJA 5I8TA 1ULEA 2D6PA 4IV3A 1OOPC 3J4UH 4IGQA 4XHXA 4JC1A 3VHRA 5KXCA 4GULA 1UN1A 3DEMA 2I45A 2W91A 4IEOA 4IEQA 3RI8A 1DCSA 3K77A 4FPEA 2VMDA 2ARXA 3DL3A 4YZ4A 4P14A 5BYNA 3OYWB 1OD3A 1PIV3 3N7LA 1BBT2 3IPVB 4P9YA 4XQWA 3H1YA 2AR6A 2JE8A 4BH9A 1UIKA 2QTWB 3C7FA 2BUKA 4CDXB 3ASIA 4KWKA 1LR5A 1W9FA 1APNA 1MS8A 1QJY3 4OVEA 1FV2A 2BEOA 5L73A 4M0HA 3OYWA 4LUMA 1HRI1 4K7JA 4NIGA 3IPVA 1SFYA 2B9VA 5DAXA 2A3WA 1F4HA 5A1LA 5CKMA 5D2AA 1DZRA 2AACA 3MF6A 5DXDA 5F8PA 3BTYA 1ZRDA 1EYBA 4Q0UA 1XU2A 3W9AA 1V6NA 1YQ8A 1NY71 4XJ9A 3A0NA 1URXA 3ZPYA 5KHGA 2QCSB 2VQAA 2K0GA 4QX8A 3U0ZA 5T50A 1PHMA 2JIGA 2WS93 3RSJA 4XPVA 4LBLA 4OHXA 4COWA 2ID4A 4XFBA 1YFYA 2WZR2 2K2SA 2V73A 2PHTA 4QKFA 4UWDA 1Q5OA 2VAUA 1RYYA 2H0BA 3PVEA 2BNOA 1RUC1 4D6RA 3PUIA 1QOOA 2H6BA 1ZRIA 2GDFA 5FJHA 3X29B 2YHJA 4BXSV 4D3WA 4E2GA 5LEKA 2CDOA 1QNWA 4V2WA 5J7MA 4J1XA 4AEMA 4FPYA 4IE4A 3WF0A 2E7QA 2E26A 5JOYA 1N1VA 4RR3C 1BXHA 4FPLA 4EN0A 1JMUB 3HOBA 4RGAA 4HLTA 5KHJA 1YQ6A 3VBHC 4B1MA 5BXXA 4HN0A 3O12A 5FZOB 4LT5A 5FZKA 4TYSA 3WW2A 3PU3A 4L11A 4DEQA 2WYSA 4XILA 1F5JA 5F7UA 1Z78A 1K45A 1AR73 2J1TA 3MEPA 3ZIXA 3CBNA 1W8NA 4RFRB 5F5IA 5FZOA 2P34A 1EAH2 5FYUA 5FYMA 5C4WA 1EPWA 3WCRA 4BQ3A 2O0OA 1AR81 3K3NA 4KMQA 4AI1A 5D21A 4MGZE 4BYYA 2C24A 4N43C 2VD7A 3POSA 5AVPA 3LFMA 3RZJA 2G4IA 1FPN1 2IXHA 3GZAA 4A3ZA 1U5XA 4CCEA 5IVCA 5J48A 2XR4A 3ALQA 3KQ4B 5GALA 3FUOA 1WCUA 4IE7A 2Y64A 1W6PB 4DXZA 1QNYA 3G7DA 3RRDA 2E32A 3T08A 5EIYB 2QE3A 4JHTA 2QQPA 1GWKA 3PVBB 1UF2C 1SFNA 5FZDA 4UW5A 1VE0A 3OB8A 3H8RA 2C6SA 2B39A 1XNBA 2J1RA 3IZOA 4UFMA 3I2JA 3T2QA 1W6PA 2CWSA 1FMD2 4TWTA 2GP3A 3ACGA 3VDDB 4YW2A 3VHNA 2GC0A 4NRPA 5DUVA 3R4DB 3RYPA 2Q1MA 5DN2A 2DVGA 4U2AA 5A6XA 1C28A 4KWJA 3SCHA 4P9LA 1V6MA 1ACCA 4OI0A 2VG9A 1AVBA 4I0WB 1SLLA 1W04A 5IFPA 4CU7A 2B46X 4GH4B 1ODMA 2VZSA 2HWD1 1QJFA 4CDWA 3S57A 5FOBB 2B5HA 5CKQA 3FZ3A 4YGDA 1NX9A 1TME1 2VNVA 3OBRA 4WM8A 3A7QA 3OGSA 3SISA 4CP0A 4BQYA 4D7YA 4JTNA 5A3PA 1CIWA 4PHZA 3EHKA 4A44A 3M3CA 3OPZA 3VKOA 2DYCA 1DBNA 3D8CA 1CGPA 1IPJA 5JDBA 4Q26A 4QPWA 4YVSC 1CWPA 4MH0E 1UY1A 4KU8A 1H30A 1GWMA 2R6QA 2DUPA 1MS1A 2HBTA 1WWYA 1CZVA 4OZXA 4RGGA 5T5LA 4CEYC 3S5QA 3K48A 4LPLA 4IEVA 4XF1A 2VULA 3CKHA 2RG4A 3ELNA 4FOQA 4YFWA 3IDAA 3LSEA 2VECA 3GXUA 5CBLA 2VO5A 5DAPA 1JW6A 1MEC2 1KGYA 3DUIA 4FFIA 4LBQD 3ZOIA 1ULOA 1QDCA 2ES3A 4HFSA 1GZWB 1LGBA 4QGMA 5EXOA 1W2AX 3NNFA 4H7MA 3ZXAC 3LA7A 4YGCA 2WYFA 3ZDVA 2WO7A 3E6CC 3BVCA 3WNLA 4Y1VA 2RR12 4N53B 4R52A 4ZPIA 1WBLA 1L7QA 5CNAA 3RQ0A 4TZDA 2YFUA 3N9PA 1TMF1 2F4LA 3WNPA 3ZSJA 4XAAA 3MICA 3WQ1A 1GZWA 2J1SA 1QMJA 4AVSA 1BVP1 4BK4A 3NAPC 4D7TA 3OUHA 2DF7A 2B8MA 4L92A 2A3XA 1ZNPA 4JRLA 4XMIA 4PT6A 3ZFFC 4N53A 1OKQA 2W1SA 3LE0A 3MIEA 1O5UA 4YG0A 3OGRA 3VDAA 4YZ2A 4LO6B 1RUD1 1ASJ2 4C0BA 3K4AA 5F5CA 3M3OA 5BUVA 1NYWA 2UURA 1ENXA 2UWAA 4QXCA 4LO8A 3WNXA 1UY3A 3N9QA 1G9AA 5FPXA 2WNEA 4LKFA 5JSOA 1F9KA 5FTTC 4Q27A 1HRI3 1ND2B 5IVFA 5FYYA 3SHRA 5E1RA 4BLIA 3PHMA 4XJZA 4YG6A 3N9NA 2VW1A 1QIQA 5FY7A 4AFMA 5EJZB 4Y20B 1JZ6A 2VOVA 3THDA 2YROA 2BFUL 1WLDA 2NYYA 1GOGA 1WD4A 1ZYBA 3DYMA 1H2KA 4AHWA 1MS9A 1R082 3FJSA 3M2MA 1IG0A 2ORZA 1DQ0A 1C5HA 4NJ4A 4WVMB 5I0SA 4MGTA 1W8TA 4YARA 4CXXA 2XWBB 3AZWA 1YQ2A 2VCCA 1RUI3 5JPMB 1V6KA 4IW3A 1LOBA 1H1IA 2LALA 1XQNA 3S5AA 3VBFC 3V0AB 1E57A 2Z79A 5GZCA 4QM8A 1ND3B 1RVF1 4LO5B 1LGNA 4NHLA 4WVMA 1ULPA 4BQ2A 4Z1VA 1AXKA 1LODA 4K8FA 4BOWA 1K5MB 1RUC3 2R061 2R32A 2W46A 2EIDA 1W8ZA 2DFBA 3NJYA 4HOOA 4S2FA 2ZZQA 1S2KA 1JYTA 2WKKA 3ZXKA 2A5ZA 2UYAA 2XQRA 3IBMA 1AYM1 1OQEA 1OKOA 1PGSA 1R093 5CZKA 4YW1A 5FXZA 1F2NA 3T2PA 1A34A 1C5IA 5C8CA 4Y5SA 1K5MA 3D4KA 1W9SA 1IS3A 3U78A 2HWF2 1SG3A 2FCVA 2VPVA 4NRQA 2R1BA 5JXIA 4XCAA 5B2GB 5LBEA 1VMJA 2JDKA 3BOPA 2ARAA 3QD6A 1LCLA 3DN7A 2TUNA 1ODNA 4AI8A 5CAZA 4CUCA 3RI9A 4RGKA 1YIPA 1CONA 2Z2SB 5CG9A 4XABA 4Z8BA 2Q8DA 3U4SA 2JG8B 2GC3A 2FZ1A 2CU5A 3HNYM 1NLSA 4LKEA 3AP6A 1AR82 5GZGA 2YBKA 4A6SA 4AVAA 3AFKA 4RQPC 1FPN2 3I2HA 1HB1A 2D6NA 3B93A 1AYN1 3ZFGC 3VKNA 3U10A 1YYNA 1O4YA 2JG8A 1OSGA 1SZBA 2RJ2A 2RJLA 2W1WA 5FPVA 3ZMNA 1RXFA 3DXTA 1JZ5A 2RS13 4D69A 4YVWA 1N3OA 5FBZA 1LOGA 3NW4A 4AGVA 4MHRA 3TEWA 1FOD2 2ZGUA 1ZM1A 1AX1A 2R043 2UY9A 3FHIB 3S0MA 4QKDA 1UNBA 2RS32 4R4ZA 5CFDC 2ZHMA 5J98B 1F35A 5GZDA 2BJSA 2JDHA 3JD71 1POQA 2DCYA 3B7MA 5I8SA 3R4SA 3FX3A 1W99A 1JOPA 3O0VA 2QQIA 3CL1A 4Q4V3 4W6WA 5F3EA 4PBPA 1GZCA 2HWD2 2C5DA 1O91A 1HLCA 4CDQC 3F95A 1QOSA 1RUF3 2PHUA 4EE2A 5CFCC 4ZS3A 1TME3 5FMBA 2UWBA 3J7HA 4M00A 4TLGA 4UBGA 4K20A 4K40A 4FPOB 4IESA 5D8AA 1ZBE2 5IATA 5LWBA 1NCRC 3HQRA 5T52A 3WDTA 4AHZA 4XUPA 1W8HA 5FZ7A 2PHFA 1ZZBA 4UFJA 4BDVB 4DO0A 3FBMA 1W90A 1ZZCA 5HPOA 1LEMA 1B09A 3O1OA 1VBD1 1FV3A 2YG0A 3OF1A 4ET7A 2BYVE 3QACA 4AAPA 1S0BA 1XNTA 3H1MA 4BB3A 4LHKA 4JGZB 3NJXA 4AK3A 1V9U3 2Z42A 2PHDA 3BU0A 1POV3 3B3QE 3JZVA 3PVNA 5FOJB 5IVVA 4Y4YA 4COVA 2BGOA 2NZ9A 3LQCA 4DUXA 3I2KA 1HKDA 3EYPA 4O9GA 1ULDA 3I3MA 1AX2A 1UZYA 1VBA3 4ISRA 4JGZA 4Q5OA 3VGIA 4IXLA 5BNPA 3OPTA 1QXRA 2EXIA 3N9LA 2PQQA 3BCWA 3JBG1 2BVBA 2Y38A 3VBOB 5FO9B 1XE8A 1XBFA 1GANA 2XXZA 4CP9B 3WF3A 1GQPA 3S7IA 1CN1A 1TZOA 4FPGA 2Q8CA 3UESA 1QDOA 5T5OA 1UZ0A 1DQ2A 1OLME 1W8OA 4XF0A 3VHOA 2H6CA 3VBOA 2VW0A 5DDJ3 4CP9A 3ECQA 3KWVA 5DUWA 3H8UA 2KR2A 2E33A 5C3PA 5FBJA 1UKGA 1LHVA 1X33A 2LUWA 1JYCA 3KD4A 3K3OA 3MV11 4K3UA 5GM0A 2XHNA 3K4DA 1DGLA 1CAUB 2JDZA 2YU1A 2D3RA 2GU9A 3FFZA 4IV3C 4RHV3 5EJ3A 1JBCA 5C9AB 1H2LA 5LK5A 2EIBA 4OHYA 5I91A 1KS5A 1AXYA 1MS5A 3HBKA 4QU1A 1CAUA 1RUE1 1UW8A 3HBZA 2VOXA 5C9AA 1X7NA 3M7AA 1HRV1 1VBC3 1ZZ9A 2K9ZA 4IE5A 4E4HA 4SLIA 4LBQB 4OUEA 2RMU3 3WR0A 5A7OA 1UPSA 1RVF2 5JI9A 4KGQA 3A0KA 1GBGA 3LPGA 4FCAA 3BB6A 1VPHA 4SBVA 1VRBA 2R062 2VMIA 3DYOA 1OT5A 1PMJX 2J1UA 2YC0A 4LJHA 1HQNA 5JZGB 3HT1A 3W58A 3C7EA 4FAHA 4PQ9A 3B94A 2VBDA 3HNBM 1AYM2 1I6XA 3ZYJB 1AHSA 5GLZA 2X5IB 1LKNA 3HVDA 4XZPA 4UF0A 2HJIA 4JGYB 3AK0A 3J8F1 3DKQA 3HNMA 4WVZA 5FYCA 4FXKB 3IAQA 2A3YA 3SQOA 1YIFA 2EXKA 2GSYA 3LPFA 3VUOA 1EV11 2IZWA 3VBUB 3AP7A 4OQ9A 1J59A 1RUG1 4Q4X1 1A3KA 1H1MA 4DS0A 1YFWA 2GH2A 1A8MA 2NM1A 3AYDA 1UYPA 5EZWA 2WO2A 2ZTNA 4PF1A 3VL8A 3A4UA 4HKLA 3MIGA 1GWLA 2FDKA 1CAXB 4YNIA 5KXEA 5AFEA 3FHAA 2YB7A 5LBFA 3HD8B 4RL7A 1AYN2 5JUVA 1TNRA 4QPYA 1NCQB 3ORJA 4ZZ8A 3PURA 1DGWX 1REDA 2WAAA 5JI7A 4CXYA 1WW7A 3BN6A 5FZ0A 5I8YA 4S2DA 2RE9A 3AX4A 5H9QA 2VUDA 1PZ7A 2ZJCA 3MF9A 4B4PA 3I3QA 1RL3A 4W50A 2P1BA 5FP4A 3ZXEA 3CF6E 4CDUC 1QWRA 2WFF1 1J58A 3MV01 1SCRA 2IFWA 5DG2A 3UYJA 3SKVA 1PIV1 3I59B 2C9AA 4M0NA 5ANNA 5C4WC 1H6YA 2W92A 5FPUA 4K1ZA 1UU4A 4QHOA 4CXWA 3JD72 3PUAA 3RZZA 4P9IA 3D0SA 1GQGA 2WA3A 1F8VA 4XHBA 1QJY1 1OMIA 1PX4A 2NN8A 4OI1A 2WSUA 4OZOA 1IS5A 2YZ4A 4AL9A 5T5JA 2Q1FA 3I59A 4BQ1A 1UOBA 4O65A 1LHOA 4FBFA 3HAGA 1SMVA 4C90A 5HCFA 2XVKA 1VALA 1J1TA 3K75B 2AH2A 4LKDA 4V1PA 2QQWA 4FQ4A 1S0FA 2Q0AA 5JMCA 2EAKA 5EQUA 1O3TA 2ZMKA 2YC4A 3POEA 1DFQA 1MZ5A 1NUKA 2BFUS 2ZHKA 1H1AA 3JQWA 4FP3A 4LO7A 2VCAA 4XF4A 1GSLA 4YSFA 5LA0A 1WMEA 2V72A 4XUNA 3VBSB 2FHRA 2BVVA 2VZUA 1PK6C 2RM23 1GOFA 1OFSA 2P3JA 2W9XA 3T1LA 1KDKA 3PIJA 1OI6A 3WXPA 4CDWC 1QY4A 5IYYA 1QJZA 1VRH2 4WZCA 5LA2A 4WM8C 5A7SA 5GLWA 4NHYA 2JEMA 1YO8A 2RV9A 3C7HA 3I8TA 4RS5B 4EWAA 1W6QB 3PMEA 2ZX3A 1OC1A 4GIQA 1UMHA 5FYVA 4QKBA 5E88A 3UGHA 1REFA 4HVQA 1JZ3A 3DXUA 3M3QA 1Z7S2 3BKZA 1STMA 3ZXDA 3JBG3 1AX0A 3CO2A 1BEV2 2GC2A 2IXJA 2VOKA 4RS5A 3UGGA 4HKOA 5ACA1 1Z0HA 5JPNB 1MZ6A 4FP2A 4WM7A 5B4XA 4BK5A 2PQSA 4IV1B 5SV8A 2BERA 3NV2A 4E4DX 4DUVA 3D0JA 2XMLA 3FUQA 4QD2A 2ENRA 1AR61 1D2SA 5FWEA 4Y5TA 1NOVA 4CVUA 3ETQA 1B35B 5T55A 4JTOA 2XKPA 4I2OA 1KJLA 3OUJA 1BHGA 1POV0 3I97A 3IKWA 2Y6LA 1ZREA 3UT0A 1I3HA 1R1A2 2Y33A 3FHQA 2Q8EA 4RSUA 1JYNA 3E5UA 1IOAA 2EIGA 2PAKA 2IVIB 2G9GA 3MUZ1 1D0GA 2VXRA 3ON7A 4XBNA 2HEVF 5FQ0B 4BXFA 4URAA 4PIYA 5LZ6A 5FZ6A 4JCKA 3AJYA 2XLAA 2A75A 1Y3TA 2DCJA 1J83A 1S0GA 1H8TB
chains in the Genus database with same CATH topology
1RUE2 1UPIA 1DHKB 4FTSA 4K21A 1HRV2 4PIXA 4AI3A 4YW4A 1VP6A 3RMYA 2XL7A 1BZWA 4YW5A 1XNKA 2ZGOA 4K6BA 4MXWB 5I0RA 4HK8A 4O9EA 5JOZA 4Q4W3 1ZBA3 4UW3A 4CEWB 4D7SA 4DNYA 3PJYA 4PLNA 4Q0VA 2IFRA 2Q1ZB 5K9YA 1I9RA 4B8EA 3USSA 1QJX3 1R1ZA 3T2TA 1VBE3 4MXWA 2SLIA 3J8F2 4HT1T 3UKNA 5F5QA 2N7GA 1V6LA 2AZ5A 1KJRA 1TEIA 2WT0A 1EV12 4LBJA 2ZX1A 3EBRA 1RUG2 3QBQA 4AFAA 4Q4X3 1RC6A 4BE3A 1G9DA 1MZFA 3FLTA 4HMZA 1PVXA 2OVUA 1IZ3A 4R9BA 1YJKA 4S2GA 2ET1A 2BPA2 5C8CC 1K5MC 1XE7A 3WW3A 3OBTA 3WDVA 5HI0A 3TN93 4K1YA 3O5SA 1NA1A 1XYPA 1RB8G 1UCXA 4QPGB 1GZ9A 3RNSA 4AWDA 3H7JA 1OFNA 2YDEA 5DZEA 5FAXA 5FO7B 2XPJA 2XJVA 3SLIA 4AQ2A 2GH8A 1IKQA 1HQLA 3VBRC 4YFZA 2ET7A 4Y26A 3WDXA 2Y0OA 2WFF3 2ZGRA 4M3CF 1N47A 4QPGA 1PIV2 5FPZA 1RUJ2 4NOTA 3KGLA 4MXVA 1VB2A 4N7IA 1LOFA 4P5HA 4GALA 1XYOA 2ZABA 2JG8C 1UZZA 1UL9A 1FI2A 4HSLA 2QFEA 2FQPA 4BLJA 1KXGA 1IQAA 1DZQA 2W0XA 2OIIA 1BQPA 2B45X 3IMNA 1VR3A 3VKMA 4CDXA 2KM2A 4YVWC 5JLVA 1DZTA 2DU0A 4A7YA 4AQ6A 2EALA 1PGW2 4CRQA 4BM8A 1ZRFA 4HL0A 4AVCA 3AMPA 2Z5WA 2ZZJA 1WCDJ 4B29A 4A2UA 1DG6A 1RUI1 2PLV3 1FYUA 3AMQA 3BOWA 3QH7A 2WS92 4N9IA 2YUEA 3W59A 4OHWA 1SBFA 3N3HA 3D6EA 4AQTA 4PLOA 3KCYA 5FLIA 4LNVA 5D8AC 1KDMA 2YY1A 4OI2A 1VBB2 4QXKA 5F9TA 1R091 2D6OX 5J96B 1PO13 4MGKE 3WY6A 2EA7A 5T5PA 2E9QA 4PLMA 2OZJA 2GNMA 4QQLA 4XBLA 4XJUA 5ACA3 4NN0A 2P37A 2GNTA 1LB2A 3N35A 3WP6A 4J1WA 5L36A 5FLJA 3SH3A 2HWC3 1CR7A 3O14A 1AR72 1AR63 1NLRA 1S2BA 5BNNB 1WMFA 3M4FA 3H3UA 1VJ2A 3EXUA 2WZPP 5BNPC 1J3RA 4HZFA 2ZAAA 1HQWA 1BYHA 2FMYA 2ZGTA 3DPRB 2WJSA 4X8NA 1RGSA 4LA3A 1RITA 2JENA 1GFF2 1ULGA 2X29A 2RS11 3S30A 2PAEA 3C3VA 3DPRA 2UY8A 2R041 2EF6A 1GV9A 2XJTA 5KWRA 1A6CA 1KFXL 2QDRA 2ZGPA 1YUDA 2PELA 2KA3A 1A8DA 1GNZA 2D40A 1PO23 2IXCA 4NPRA 1U0AA 1HDKA 4Q4V1 3L9JT 3WG4A 2QUOA 4YM0A 3VDDA 4LEJA 2JG9B 1RUF1 4XEZA 5EYYA 5A3MA 3JU9A 4JDNA 1C8M3 5T54A 4M01A 3RYKA 1RHI3 3K51A 4D94A 3SITA 3IM0A 1IS4A 2MEV1 1EY2A 4GH4A 1O3QA 4BA6A 1TE1B 3CJIB 3MFAA 3CEWA 1YXWA 1N1TA 5DUXA 2R071 1G9BA 3GF6A 2CGNA 3HWJA 4PJYA 2NQYA 4AEDC 5SV5A 2NLRA 1V9U1 4BWOA 1POV1 1U5YA 4HKWA 1UIJA 2A71A 1RJ8A 2HWB1 4XJAA 4DY3A 4XQDA 1VBA1 2ZX4A 4BIFA 4KBBA 4CP1A 2VMHA 3MIHA 4TSVA 2PHLA 3N4MA 1O3RA 2WWSA 5L19A 1ZZ6A 2ZMNA 2P3IA 5D1IA 3KCCA 2WT1A 4URTA 1LHUA 1IPKA 2D43A 3GZUC 3CLPA 5DDJ1 2F4PA 3H3ZA 1DF0A 2DV9A 3N7MA 3POWA 3ZO0B 1Q3EA 1ZRRA 5KC6A 4R9DA 1HRI2 1YNAA 1WMDA 2WT2A 4EN9B 1V70A 3AKQA 1NG0A 4Y24A 3M8LA 2RS53 4RHV1 2WNVB 1JUIA 3E97A 3RPQA 2PHXA 2RJKA 2DCKA 2YGMA 3DKWA 3E6BA 4QQOA 4Y1ZA 3NKGA 4FO9A 1D4M3 2QNKA 2QZ3A 4S2HA 3I54A 4IEPA 4IERA 1NY72 1ND2A 3THPA 4QQHA 2WNVA 2BTVC 1GLHA 1RUI2 4PDWB 1VBC1 2Q5TA 4LBKA 1QXJA 4Y20A 1XNDA 1CQ9A 2JE7A 4Q4Y3 3TBDA 2GMMA 3KQRA 4JAAA 2RMU1 3AB0A 4X6QB 5IK7A 4A3XA 2BGCA 4OULA 1S0GA 1RUH3 1RUC2 2A70A 3AFGA 3MLLA 3KS7A 1YLLA 2GAUA 2VW2A 4PF5A 4LE4A 4LTAA 5EFUA 1W6MB 2E51A 3V0AA 5A33B 1ND3A 1H8VA 2PYTA 3M1HA 4AQSA 1Y43B 4DZGA 3QH6A 1ENQA 3WDUA 2WIIB 3ZFEB 4MZUA 2VNRA 2WNUB 3ZSKA 3MIDA 4AXOA 4FOWA 3ZYPA 2W52A 4P9XA 3ZN4A 1RJ7A 1WD3A 4XFFA 5AC93 2WINB 1S1AA 3WW4A 2ARBA 3R05A 4Q1RA 4QMAA 3GBGA 2XJQA 4I0AA 1CESA 4GKXA 3UJQA 3ZFEA 1JOJA 5JIUA 1JUHA 2AGSA 4YYOA 4BIOA 4XOGA 1FT9A 3U07A 4YGEA 4QX5A 1OOPB 1PNFA 2CGOA 2VOWA 1KS4A 2GN3A 1CJDA 4XFHA 3LA3A 4RFT0 1GICA 3HMYA 4CYDA 4WM7C 2DTWA 1C1FA 4AI0A 2RS12 2R1DA 4NO4A 1DYPA 2R042 5IUQA 2EXJA 4YLZA 3V56A 4AF9A 1ONAA 3H7YA 5JVVA 1CPMA 4I3GA 1Q8OA 3M3IA 2DVDA 5K7PA 1ENSA 4KGGA 4Q4V2 2BNMA 4Z2WA 5IK8A 2ZGKA 3LSDA 1S0DA 2ERFA 1YFXA 3RG0A 4AI2A 4AEKA 2Q4SA 1AL23 1TME2 3AP5A 5JWPA 3WG1A 3ZX7A 3ZXJA 1FOD3 3MYXA 2YV8A 2F6BA 2MEV3 4L97A 5F6LB 2QVSB 4EWEA 1XRUA 3UKTA 5CADA 3EQEA 3VHPA 2X53S 1UU5A 1WW4A 2R073 4N7UA 3LZZA 1AZDA 1MQTC 2RM21 3QLQA 4C0HA 3OCPA 1KQRA 3RYRA 1V9U2 4H3WA 5CU1A 4RR3B 1IS6A 3I2DA 4XXPA 2UYBA 3IIAA 3AYCA 3VBHB 2XUMA 1H4GA 4WZFA 2B42B 1KRIA 2A6VA 2HWB3 3ATGA 4KNCA 1LJ7A 1VBA2 3E6DA 4YM2A 5H9SA 4KU7A 1YRZA 4GWMA 4GMP0 4DRRA 1TMF2 3MZHA 1ULFA 5C8WA 3VBHA 1LULA 3UV9A 1AF9A 5KHHA 1HXS3 3PVOA 4N43B 4OUSA 1J1LA 1RUD2 1IHMA 5DDJ2 2XH6A 3OGGA 2WQ4A 5E16A 1NA1C 1QJU3 4WVVA 1FNYA 1RMU3 4L9BA 1NZCA 3NWKA 2UU8A 2DUQA 3PJQA 4NHKA 4RHV2 3BALA 1TQ5A 3NL1A 1MS3A 1Q8SA 4QQ2A 3L2YA 1O4TA 4QPGC 3DV8A 1XYNA 2WA4A 4MGYE 1FNZA 4XIOA 1LOFC 1VBC2 2EAAA 5HBAA 2WFPA 3TB0A 4BMBA 2GC1A 1YWKA 2RMU2 3ROUA 1WLWA 5L7OB 4J6GA 2DTYA 4M3CB 2DU1A 4CDXC 1SBDA 4Q4W1 1ZBA1 4QU2A 1EP0A 2O1QA 3N7JA 4LO4B 4LBQA 1V6IA 5L7OA 3NV3A 1QJX1 3THTA 4ATFA 4M3CA 4LUKA 1VBE1 4YVSB 3OD4A 2QZ2A 5C33A 3N36A 3MI8A 4CEYB 1LU1A 4WBBA 4QM9A 4XFGA 1VLNA 4JQRA 3MW3A 5JZGA 1N3PA 3UL2A 2D44A 3AYEA 2XLGA 2X5IA 1O7FA 4JGYA 2OPKA 4NHMA 5A3LA 4QHBA 1F5FA 2ZGMA 2GMPA 4HETA 3S7EA 4BMEA 4LLOA 1HIXA 1TNFA 3T1MA 2VQ0A 3VBUA 1WA4A 4E4ZA 4FT8A 5FO8B 4YM3A 3B9IA 4C1XA 3TN91 4UW6A 3WP5A 5F1RA 4KH9A 3VLBB 2VUAA 4OHZA 1W6NB 1Q43A 1QQP1 4GB31 3CNAA 1CAXA 1LECA 3ACLA 4ITCA 1NCQA 2ZPXA 2ZOEB 3ZSMA 4G9SB 3H50A 4IETA 3KMHA 1SLAA 4AVBA 5A32B 3U4XA 3IDCB 3ZN6B 3SMHA 1QGLA 5K8SA 1RUOA 1S0EA 1ENRA 1D0HA 5LEJA 2O8OA 5GKAC 1I1EA 2GMEA 1VB4A 5E8AA 3QCWA 1J3PA 2ETEA 1VAKA 2OZ6A 3RS6A 1RUNA 3V64A 3ZN6A 2ZA9A 1PVC3 5GLUA 3VBFB 4FSJA 5HCAA 4XF9A 2WLQA 1OQ1A 3VZKA 1LRHA 5HCBA 2XJUA 1AJKA 1LTEA 4E27A 5KHKA 3VZNA 1U5IA 2PLV1 1U5ZA 1SCSA 4M3CE 1VBD2 1LHNA 1SLIA 1KD7A 2RM22 2VMGA 4OHVA 2D5FA 3VDDC 2RHPA 5GLTA 4GWNA 4P9JA 4OUMA 3QOPA 4XXAA 1U12A 1AR93 3VBSA 4Q0PA 4JRAA 4GH4C 4XYXA 5J3UA 1SQ4A 1PO11 3C2UA 3JBG2 4MLOA 1UKRA 4ZU4A 3OD0A 1JXNA 3WUCA 5H9PA 4GQ7A 1W6QA 5ABJB 3WINE 3WG3A 3WQ0A 4AFDA 5BY5A 4RQPB 1QKQA 2HWC1 2JKBA 3AZYA 2HWE3 2HKXA 3JCIA 3TRSB 1NE6A 1XNCA 2YPJA 2CNAA 5ABJA 4NVPA 4JDMA 4IV1A 4XFAA 2IXIA 1X8EA 1FXZA 1B35A 4NR1A 4Y1YA 3OTFA 5CFDB 2VH9A 4N53C 4MUVA 2CAUA 5IK4A 2XBO3 4FPCA 2CGPA 4RD7A 5DG1A 4G4FA 2VNGA 5FQ0A 4E9KA 4FPHA 4HN1A 1H2NA 2MNGA 4FOYA 4BCUA 1C1LA 1SACA 2D5HA 3MW2A 4MYEA 2ZGLA 2D93A 1COV3 4CDQB 4OI4A 1H8TA 1XU1A 3AM2A 4DB5A 2ZACA 4EN8B 5CFCB 1YHFA 3Q9OA 1V6OA 4Q4W2 1ZBA2 1PO21 1MS0A 5FRAA 3AZZA 3FLRA 4YG3A 3BIWE 4ONUA 5BNOB 2XLFA 1QHDA 3SNMA 3SXWA 1QJX2 3ZXFA 3EO6A 1H4HA 1ND2C 1VBE2 2DURA 2QKDA 2CYFA 2XGXA 5FCCA 1C8M1 2BWAA 4HANA 1LOCA 1RHI1 1JH5A 4GMP1 1QH6A 2HEWF 4X8PA 3GBFA 3ZYIB 4CEWA 5IK5A 5GZFA 3ZVXA 1J3QA 1GYKA 2G9FA 5BNOA 4COYA 2HEYF 3SCGA 1BK1A 2B9UA 4Q4X2 4B4QA 2V5YA 1CJPA 4AVTA 3LB9A 4YW3A 1PZ9A 2FMDA 3GHNA 4EJRA 1ND3C 4FAGA 2EXHA 3IT8A 4META 2CL2A 2NMNA 3R4UA 2CTVA 4W6XA 1DQ6A 1SEFA 3TN92 2CY6A 4C1WA 1NQJA 4GKYA 4I02A 3WVJA 2D6LX 3MW4A 4FPKA 3O0WA 1QQP3 2A6WA 1RINA 4GB33 4AHXA 3LCPA 1REEA 3AP4A 3SCFA 2WFF2 3LWCA 3ZFEC 1QXPA 2FBEA 3ZXLA 3J26N 1ZX5A 1N1SA 1CX4A 4MV2A 1MVEA 4XJ8A 1YCIA 2XJPA 1MEC1 4NWWA 1AL0G 3AXDA 2R0HA 3MLJA 4Q2FA 3ILRA 1QJY2 3ES1A 3JUUA 3JB4C 4MX3A 4COZA 4GXLA 4YZ5A 3OJBA 2Q8OA 4XMAA 2RS51 2DWRA 2V09A 1S0JA 3I7DA 3HT2A 1OD5A 4UW4A 1D4M1 3FLPA 2NPIA 1RUJ3 1BBT3 5DZFA 1LEDA 2E53A 2XHKA 5JAXA 1ASJ1 2PLV2 5JOWA 2GNDA 2JJ6A 4XDQA 3AZXA 4Q4Y1 1YI9A 2ZHLA 4CTEA 5GZEA 2DUOA 4G3YC 1GKBA 4X6RB 1LU2A 4EV0A 5FREA 1DIWA 1RUH1 3R6SA 4ORFA 3WUDA 5E89A 2WC2A 2PTMA 4ZKTB 1X82A 1HX6A 1R081 3WHTA 1PO12 3ZSLA 1SLBA 2P17A 2AENA 1X36A 1ZA4A 3AKTA 5FFOC 5ACA2 1W39A 4KQ7A 5I93A 2WZR3 1W6OB 4RA0A 5AC91 2HWC2 3ZDSA 2BBVA 4LBMA 4FTBA 4IL7A 5EWSA 4I09A 1AR62 2A6XA 4LA2A 3GHMA 2D98A 1PM7A 1C8NA 1VBB3 1W6OA 4JGZC 4DY5A 4ES8A 1NXD1 1OLRA 4W6YA 2XJSA 3IN9A 4Q1PA 2X8KA 2H0VA 4CDUB 2GZWA 4B3NA 2HWF1 4FPJA 5BNNA 4EN7B 2QJVA 2UWCA 3E5XA 5AVAA 3ZYRA 5C4WB 3FMGA 4HBNA 3IWZA 3KM5A 2ZCWA 3GZTB 2OW4A 4TLFA 3VBOC 4XQ4A 1ZZ8A 4CDUA 1CD3G 3H9AA 3ES4A 1MVQA 1EAH3 2ZX0A 1T6GC 4AFCA 2A73B 2WL1A 1PO22 1MZEA 2D97A 3VKFC 5K0UB 2YMZA 3B01A 3CJXA 4IEZA 2GALA 1C8M2 4AFBA 1AL21 3M3EA 3PMSA 3SH5A 4DFSA 1RHI2 5C9AC 2JE9A 5J37A 4GMP3 4LR4A 1FOD1 3VZJA 4DINB 1PK6B 2JD4A 2RS31 1V6JA 2PAMA 3AMNA 5K0UA 1FMD3 5LEKA 3V65A 2OA2A 1WGPA 4CDWB 3MLKA 2JG9A 4P9GA 4Q0QA 3MGUA 4WM8B 1Q8VA 2R30A 1PK6A 4XF3A 3AYAA 4QPIB 5L7OC 4QGLA 1W2UA 1OPOA 3NVCA 3CJIA 4EWDA 5KHIA 2VUJA 2OYZA 1JN2P 4QPIA 1ZBE1 5JZGC 4K9SA 1UU6A 1CAVB 1WUVA 3AJZA 3IDBB 4HSJA 4R8HA 1MS4A 4LLFA 1FX5A 5CIRA 3VZMA 2X5IC 3OGJA 4JGYC 3NJZA 2IWGB 5JR7B 3GNEA 1DU3D 4AEJA 1HXS1 1CAVA 3VBUC 4XETA 4MVTA 1DQ5A 1MEC3 3TNQA 5FLHA 5JIAA 3AXEA 1QJU1 2C1FA 3KCXA 2RR13 3NV4A 1RMU1 1SBEA 4P9WA 3WHUA 3H1WA 3N7KA 3AKPA 3OY8B 2RS52 4IEXA 4PBOA 2XJRA 1SDWA 1NCQC 1D4M2 2TEPA 2DCZA 5KXBA 4AYUA 4BPZA 3KB5A 3S6PA 4ES9A 3V0BB 5CG8A 1L3JA 4QQPA 1RIRA 3OY8A 5I0TA 3AKRA 1ASJ3 3EJKA 4OFGA 4Q4Y2 4DRVA 3DGTA 5BV6A 3U11A 3BTAA 2PN5A 4H7LA 3V0BA 3TYJA 1DLLA 3NSTA 4NWVA 1RUH2 3KZ4C 1O4ZA 5BPXA 3ZIWA 4LBNA 4PDWA 1NE4A 4ZU5A 1G9FA 3HR9A 4I0BA 5FMOL 4CP2A 1WCKA 1R092 4YZ3A 1M06G 1R083 1CPNA 4E2SA 3KSCA 1WLCA 3AMHA 4I3PA 5JOXA 1DYKA 3KT7A 3AP9A 2JICA 2ZS6B 1W6MA 1A78A 5A33A 3LOBA 5AC92 4COUA 5C8CB 3GBWA 4QGNA 1I5ZA 5C6CA 4I01A 3UJOA 1FAYA 1LOAA 4F83A 3VBSC 2WNUA 3JB8A 3VBRB 4DOUA 1OA2A 3NO8A 1C57A 2HWF3 1NQDA 4RS5C 3VN4A 5KXDA 3IDEA 1LHWA 1OOPA 1BVVA 3VBRA 4XIKA 4C91A 3B5LB 1LESA 3ILNA 2EVXA 5ABJC 4YZ1A 3WP3A 3RMXA 4WVWA 1AR83 2LTNA 4IV1C 1FPN3 2LM3A 4YVWB 5EV7A 3G6JB 2MHFA 1DQ4A 1B35C 1CVNA 1VAMA 2ZMLA 3B02A 3FBYA 2C0ZA 4F8AA 1AJOA 1DGRA 1RUF2 4A7ZA 3WCSA 3WX5A 1AL22 2A7AA 3LOIA 1X8MA 1OPMA 2I74A 4AW7A 1VIWB 1PVC1 4XBQA 1IKPA 5LRRA 3MPBA 2MEV2 2RS33 4B7EA 1AXZA 2WQZC 3LA2A 1H8TC 4LHNA 4KL1A 4Y5Z0 1ZZ7A 3GYDA 1UMZA 3HIFA 4Z07A 4YM1A 2R072 1HV1A 3HN1A 1N3QA 5D8AB 5HXVA 4E4SA 4KG8A 2HWD3 1QH7A 3AZVA 1LOEA 1C4RA 2XL9A 4R9CA 2ZKLA 3WW1A 2ZHNA 1SLTA 1AR91 3KGZA 4CEWC 1OQDA 2HWB2 2E7AA 5BNOC 5LK7B 1F31A 2XVLA 1ZBE3 4INDA 3D5OA 4MSVA 2ZAHA 1H2MA 2BQPA 4RR3A 1WW6A 1H0BA 4HK9A 2W39A 5FDBA 1N1YA 4FPFA 3FE5A 3D82A 1KITA 4ATEA 2XWJB 1H9PA 1HXS2 2Z69A 5BNPB 3PLQA 1OA3A 2BWCA 4Q0SA 4F3JA 1VRH1 1QF3A 2HWE1 1BJQA 1MR5A 3TNPB 4U36A 1WW5A 3ZYGA 1QJU2 2E7TA 3LAGA 5J09A 3WV6A 1RMU2 3FFQA 1OLQA 1S0IA 4N43A 1TMF3 2A6ZA 1Z7S1 2BW8A 2DFCA 2IC1A 3UKVA 4EROA 1BEV1 1ULCA 5BNQA 4E2QA 3JQXA 5DZGA 2B7YA 4GA9A 3MFCA 1CAWB 4HVOA 2D6MA 5GJ6A 1RTVA 2XBO1 2MPFA 2CWMA 4ISQA 1RUD3 1HV0A 4LHLA 1Q8PA 2A6YA 3J9SA 2IXKA 1KFUL 1CAWA 3WD5A 4DPNA 3TOJA 1UAIA 3SH4A 4YGBA 1COV1 4FQZA 1R1A1