1C28A

The crystal structure of a complment-1q family protein suggests an evolutionary link to tumor necrosis factor
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
134
structure length
125
Chain Sequence
MYRSAFSVGLETRVTVPNVPIRFTKIFYNQQNHYDGSTGKFYCNIPGLYYFSYHITVYMKDVKVSLFKKDKAVLFTYDQYQENVDQASGSVLLHLEVGDQVWLQVYYADNVNDSTFTGFLLYHDT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of a complement-1q family protein suggests an evolutionary link to tumor necrosis factor.
pubmed doi rcsb
source organism Mus musculus
molecule tags Serum protein
molecule keywords PROTEIN (30 KD ADIPOCYTE COMPLEMENT-RELATED PROTEIN PRECURSO
total genus 24
structure length 125
sequence length 134
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1999-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00386 C1q C1q domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1c28A00
2R6QA 2WNUB 4QPYA 2HEWF 2R30A 1A8MA 5BNQA 2TNFA 2TUNA 5KWRA 3TWIA 3B93A 1JH5A 2WNUA 1PK6A 3QBQA 1C3HA 4MXWA 2JG8C 2X29A 4KG8A 3B94A 1D0GA 3TYJA 2QDNA 2JG9C 2JG9A 4DOUA 1I9RA 4NN0A 2OIIA 4G4FA 4F3JA 3ME2A 2HEVF 3ALQA 1O91A 1OQEA 1D4VB 1TNRA 2WNVC 1IQAA 4QQLA 2JG8A 3FC0A 1DG6A 3L9JT 4MXVA 2AZ5A 4QQHA 1RJ8A 4J6GA 4G3YC 2RJLA 2Q1MA 1KXGA 1RJ7A 2RJKA 2WNVB 4KGGA 4OULA 4QQPA 4DB5A 2HEYF 2E7AA 4MXWB 2Q8OA 5L36A 3V56A 1XU2A 2ZJCA 4GIQA 1U5XA 1OSGA 1JTZX 2O0OA 1GR3A 1TNFA 4TWTA 4E4DX 2R32A 3B9IA 1DU3D 2QE3A 3IT8A 5HBAA 1KD7A 3QD6A 4D7YA 4MSVA 3K48A 1C28A 1WCKA 5L19A 1PK6C 4EN0A 3URFA 1PK6B 3MI8A 3AB0A 5TSWA 2ZPXA 2JG9B 4QQOA 1U5YA 3LKJA 1S55A 4KGQA 1OQDA 1U5ZA 2WNVA 5CIRA 2WNUC 1ALYA 4TSVA 1XU1A 3WD5A 4E4SA 1D2QA 2Z5WA 4RSUA 4OUSA 4QQ2A 4N90A 3K51A 5KC5A 2JG8B 5KC6A 2KA3A 4HT1T 2RE9A 4OUMA
chains in the Genus database with same CATH superfamily
1Q8VA 4WVVA 5A1AA 1CAWB 4QPYA 2IXLA 4FOQA 1XNKA 4EWEA 4PLOA 1FV3A 3RGBA 5K9YA 5D8AB 1GWKA 1DLLA 4RGGA 5A7SA 3MW2A 1VLNA 3JXSA 5AVPA 3O12A 5KWRA 1ULDA 1HW5A 1TMF2 3S57A 2DVBA 2FDHA 4QU1A 3OPWA 4PJYA 4Q0UA 4QMAA 4BQXA 2VG9A 3KM5A 4BISA 1IG3A 5LZ6A 4SBVA 2VOKA 4JGZC 2GP5A 2K0GA 4OCTA 2D40A 1D0GA 4Q0SA 1DGLA 3TEXA 3USUB 1B35B 1RUD3 4LBMA 3AX4A 4FOVA 4BQ5A 1MPXA 1CGPA 1QDCA 1R1A1 1NE6A 1D4M1 4HSJA 4P9IA 4XAAA 3C8XA 2XWBB 1Y3TA 1YRZA 2JDMA 1H9PA 2GP3A 4YW2A 3VBRC 1ASJ1 2R1BA 5GLTA 1WMXA 3U75A 5KXBA 4ZU5A 2VAUA 3MYXA 4PT6A 3H7YA 1AXYA 1YFWA 2W87A 2WNVC 4QX2A 5CFDA 1UYYA 1L7QA 4I0WB 2UWAA 1RITA 1I5PA 3QH6A 4J6GA 5C9AA 1ZZ6A 2WFF1 3LFMA 4G3YC 4AVVA 1NT0A 4QT6A 2FDKA 1NE4A 2FBEA 1UQXA 1QH7A 2CL2A 2Q1ZB 4AK3A 4CUAA 4NIGA 1DYKA 1W90A 5DAVA 5EYYA 4YW7A 2A5ZA 5FUIA 1AYN2 3VBOB 4Q0VA 2XJPA 4RGAA 4CUCA 2JDYA 2VMEA 2QQOA 3HAGA 1ZBE2 2ZEXA 2D6NA 1V70A 2GC1A 5FYCA 4Q4V2 1QIQA 3SH3A 3EYPA 4JV4A 2DUOA 2HWF1 4ARXA 1ULOA 1W8WA 5F1RA 4XHXA 2D98A 2XKOA 3AP6A 2OKXA 2WSVA 3LZZA 4CSWA 3RMXA 1ENRA 2CDPA 2PXJA 2WZR1 4K6BA 4BMBA 5CISA 3NNJA 1HXS2 2W9XA 1QJU1 4LHNA 3CLPA 2YDEA 1ZRRA 1O3RA 2Y6JA 3QD6A 4BLIA 2ZX3A 2VULA 4QGLA 3GHMA 3RWNA 1GZCA 2WZ8A 5GM0A 4R4ZA 4GA9A 1BEV2 4NPRA 4XTMA 2BFUS 2VECA 2J1EA 3EHKA 3MPBA 4FBFA 1PX4A 1PK6C 1W2UA 1VBE3 2VBPA 4K8RB 5I0UA 2L9LA 1NKGA 1WA6X 4N8MA 5I8TA 3O1PA 2VMDA 2JG9B 3H1MA 1U5YA 1CWPA 1BQPA 1S55A 2EAKA 4KGQA 3OUJA 2NPIA 1X8MA 4RHV2 2WZR3 3LAGA 3RDIA 4CP9A 4BYYA 1UMIA 3AYCA 3M1HA 1C8M3 2X10A 3WQBA 4A4AA 4FO9A 1UKRA 1OT5A 4Y33A 3VHRA 4UI9L 4AHYA 2D6KA 1QOOA 1HV0A 4B29A 1XYOA 3O1OA 5C3OA 2GU9A 4Q1RA 4W65A 1MQTA 1BVP1 4WVMA 5FFOC 4GWMA 3WF2A 5JZGC 5JI9A 2ZGUA 5LATA 1W2AX 1QOTA 1ZRIA 1G9AA 3NAPA 3VD9A 4R9DA 4JQTA 3WG1A 1ZBA3 1PMJX 1W6QB 3HOBA 1RINA 5FP3A 1H8TB 1C57A 1MZ5A 1UZVA 5KR7A 2NMOA 4RHV1 5AC93 2JXAA 4J1XA 4QXCA 3EB7A 3AVSA 4EJRA 1ND2C 5AVAA 2LTNA 3KS7A 2RJ2A 3TNPB 4AEDB 5GZCA 2RS13 3ZDVA 4YZ1A 3DUIA 4W8JA 3ZYPA 2R063 4FI9A 4JGYC 4Q5OA 4WM8C 5I8SA 5FMDA 5IVCA 2OVUA 2GMEA 2OT7A 1OC1A 2YGLA 3JB8A 4I01A 4FXKB 2IWGB 2CDOA 3THPA 2JG9A 5EJ3A 2FDGA 4AR2A 2I07B 2WZPP 2AGSA 3BGAA 4BQ2A 3PUHA 1CJDA 3GXUA 1OMIA 1G9FA 2XHNA 3RI8A 5HV4A 3SNMA 2TEPA 4PQ9A 4G4FA 1NLSA 4UBHA 2ZZJA 1VJ2A 4XETA 2VNGA 5DG1A 3RS6A 4BDVB 4OHVA 5ACA3 3U4SA 2YUEA 2W52A 4QGNA 4EWDA 4HZFA 1RUE3 2P3IA 2RS52 3AP5A 2XKPA 4L2NA 4E4HA 4NIIA 4JRLA 3UGGA 3DV8A 5FQ0A 2R041 2FHRA 1RJ8A 3PURA 1Z78A 1HX6A 3KV9A 4QQHA 4Y22A 3WP3A 3WW1A 4CYDA 2O8QA 2UWBA 2UU8A 1IHMA 3NV1A 2VTXJ 2WKKA 4LO6B 5FY1A 1WBLA 1KITA 3H1WA 4QQPA 3LEIA 2DVFA 4HPKB 2H6BA 1SDWA 1VBB2 2JE9A 5HCHA 4IEVA 2ZAHA 4PQQA 1ST8A 1E5HA 5HXMA 4OI4A 4E4ZA 1RUC3 5IUQA 2W47A 2GMPA 2XBO1 4AAPA 2C5DA 1PIV2 3DCQA 1UPIA 5LBCA 2JKBA 2X53S 3WCSA 3ZSJA 5E88A 5A7OA 1QXPA 4E4DX 4A6OA 5F6LB 3ZYFA 4E8CA 1GOGA 3PTYA 2ZEYA 3PUQA 4XJWA 3UKTA 3VZNA 4AWDA 2UYAA 5BNNA 5C7GA 3G6JB 4RFT0 4M3CA 5C4WC 3VZKA 1U5IA 4X6RB 2AEZA 5I91A 3SH4A 3AZVA 1CZTA 2QQVA 4QD2A 1K5MB 1WLWA 3I3QA 2V5YA 4Q4W3 5L19A 1PNFA 4M3CB 4TXWA 4L9BA 3SEEA 4CXYA 2WSUA 4HN1A 2ZEWA 3ROUA 1SQ4A 2D93A 2WJSA 4KG0A 1YQCA 4Y20A 3AYAA 1NA1C 4Q4Y2 3VZLA 4EROA 3WQ0A 1WA4A 2IXCA 3P3PA 1QJY3 4Y1VA 4FAHA 1UZ0A 2A6ZA 3WG2A 1COV1 2TBVA 3KHBA 1LTEA 5CIRA 5F3CA 4AFMA 1UOBA 5FUPA 3MO4A 4P14A 4CDUC 1ND2B 5CA6A 1CESA 3MGUA 1POQA 4MV2A 4UF0B 3V0AA 2D6OX 3V65A 3WDWA 1WD3A 2P6CA 1QOSA 4GH4A 2AR6A 4EZ4A 4DUXA 3THCA 5JAXA 2VY0A 1LOGA 4A7ZA 3WZ1A 3I2HA 2QUOA 3T0BA 4UF0A 4LULA 1O5LA 3VBSA 1LOCA 2BOIA 1GNYA 3J7LA 3RZLA 1YFXA 2FQPA 5FY9A 4IE5A 4EN9B 3EQEA 1R093 3NRUA 2RR12 3K3OA 3BYWA 5T5JA 5JWPA 3CU7A 2A7AA 2BTVC 3I3DA 4LBOA 4NAMA 1F5JA 1GUIA 4LPLA 3E6CC 4B4RA 1JODA 5EZWA 1V0AA 2VZPA 2FZ2A 4WVWA 1LAJA 1PVC2 3HMYA 1RHI3 1N1VA 4GWJA 2D44A 2X5IA 3T2QA 3H0OA 3WF3A 1PGL2 3WF4A 1ZVFA 2JG9C 2OPKA 4XYXA 2VU9A 2E26A 4CU7A 2E51A 4IDZA 1WMEA 3RI9A 1CIWA 4BK4A 5DAPA 3VD5A 2EA7A 5A6YA 3MF6A 1PO23 1RUJ3 3IPVB 4B4PA 3AP9A 5JCTA 1J3RA 2YPJA 3LEGA 3FUQA 1Q8OA 1DGRA 5G05L 3S7EA 1GU3A 3BTZA 4E2QA 2B9VA 1SFPA 4XPVA 2QZ3A 3CZJA 1X8EA 1F35A 3U10A 2VPVA 1W8UA 4PIYA 2JENA 1OXCA 5C33A 5EJ1B 1DHKB 2E53A 2VZTA 3KGLA 1XNCA 4FFHA 4P5YA 3ZLIA 3OGRA 5I0SA 5JXGA 5DAQA 3U4XA 2HWD3 4ZXKA 2B9UA 1IG0A 3MICA 4IE6A 4OHXA 4FPLA 1QH6A 4O61A 1LR5A 1FNYA 2UURA 4CDQB 2RS11 3I54A 2HWE3 4ISRA 5F2SA 3LDBA 2Y60A 4L97A 4BQYA 4NR1A 3JZVA 4B1LA 5FOBB 3AC0A 4GB32 3C3VA 4ZPIA 3VBOA 2VUDA 4BPZA 2R32A 3WX5A 2WO2A 1NCQA 1UNBA 1XC6A 1NCQC 3H42B 4OZXA 2A6VA 1KDKA 2QE3A 3OBAA 5J7MA 5FLHA 3IT8A 5HV0A 5KHGA 1PGW1 5JSPA 1ULPA 5F3IA 4D7SA 2IFRA 5LRRA 3LSDA 4NHLA 4XJ8A 4HFSA 4RA0A 4XFFA 1TQ5A 2MHFA 2XOMA 3K77A 5C8CA 1NZCA 1GQGA 2JE8A 1UD1A 2HWF3 4AFBA 3POSA 2F17A 2CU5A 4RYDA 4XCAA 4FP2A 3PMSA 4RQPC 3AYEA 2R49A 3RWKX 2EICA 1XYPA 3CO2A 3V0AB 1G9DA 3NNFA 1W3VA 3GGLA 5ABJC 1B35C 1MS0A 4BMEA 5C3QA 4I09A 1GP5A 1H2MA 5T54A 3C7EA 4HVQA 2WNVA 4GAZA 3GBWA 3I2JA 1NZIA 3JBG1 2VVFA 4TSVA 1Y9GA 4CEYB 1FMD1 4E4SA 4RS5A 5EQUA 3JUUA 4QQ2A 5FZ6A 1LKNA 1GV9A 1GP4A 1EPWA 2ARBA 5A3LA 5F7UA 5KBFA 1W9SA 1V6JA 4BH9A 2VZOA 4YSFA 1YQ6A 1S2BA 2V09A 1O4YA 4FSJA 1GMMA 1V6MA 2WL1A 2ZABA 4Q0PA 1E5SA 2ILMA 4ONUA 1ZA4A 1S0EA 5IT6A 1RUH3 3DEMA 5A70A 1IKQA 2VQ0A 2OUHA 4DRRA 1A8MA 4P9LA 3AMHA 3J26N 5CADA 3AZWA 3H8OA 1R091 5KHJA 4UW4A 3WNPA 4RQPA 4CCKA 2D43A 3ZYGA 1POV1 3WCRA 4UAPA 3VGIA 3ILRA 4M0HA 3OCPA 2FMDA 4KH9A 3ZIXA 4SLIA 2XH6A 3DPRC 2WFF2 1UX7A 4JVAA 3M3EA 3N9QA 1LOAA 2RM22 2PMWB 2JE7A 5FLIA 1SLCA 3S7IA 5C3RA 1RUF3 3LEMA 3LA2A 3VBFB 3J9SA 5FUNA 3AZXA 4JTNA 2ORXA 1UIKA 4P9GA 4DXZA 1WGPA 4XIOA 5CG9A 2YFUA 4LA2A 4Y1YA 1GFF2 2DVDA 5FAXA 2DTYA 3IIIA 2V4AA 1DG6A 1A8DA 2OA2A 5LA9A 1QXJA 1VBB1 4QPIB 3OB8A 3S6PA 2VZUA 1UY1A 3MIFA 4LR4A 1WLDA 5JOXA 2BNMA 1SZBA 4EZHA 4DB5A 2R0FA 1RUF2 1MS4A 3K46A 1CIYA 1CAXA 4XDOA 4YLZA 1G6NA 4L0PA 2E7QA 4O7XA 2RHPA 1H1IA 2C24A 1UY3A 1W8NA 3PHMA 1HRV3 2J1TA 2W91A 3FE5A 1LOFA 3C7FA 4XUPA 2D7FA 2OS2A 5IVEA 1OA4A 5JPMB 2BWAA 5FPLA 2C9KA 3H3ZA 4Y1UA 3TAYA 1J58A 2NZ9A 2YB7A 3FMGA 1G9BA 1MS5A 4DNYA 4LBKA 2ZHNA 5HBAA 2BBAA 3NJVA 3VBHC 3J8F1 1CAWA 1WD4A 5GJ6A 4RR3A 2WLQA 1Y4WA 3EMRA 4IEOA 3VKMA 3GCWA 4EE2A 2A71A 3KLSA 4CU6A 3RYPA 4YZ4A 3TB0A 1YHFA 1XJAA 3ITQA 4IW3A 5FV3A 3ZR5A 3N9PA 4EN0A 3T2TA 2AACA 3LOIA 3ZXFA 1BVVA 1MZFA 1JYCA 4JDOA 2WBKA 4AQSA 1YNAA 4GMP0 3AXDA 5DZEA 1O3QA 2HLEA 4RL7A 3K4DA 1H9WA 3H1YA 3HJRA 3HN3A 3KF3A 4XJUA 3HT2A 2IZWA 1ULFA 1LOEA 1T2XA 2LALA 4YG6A 4AI0A 4QXKA 5A3TA 5I0DA 1D2QA 1UO9A 5DG2A 1IS5A 1WW5A 1YFYA 2RMU2 3ETPA 5A6XA 5A3NA 4BQ4A 4XF0A 4N43C 1PM7A 3GZEA 5FY5A 2HBUA 5L73A 1EY2A 2RR11 2WC2A 2HWF2 3ABZA 5CBLA 1LULA 4OUMA 5A6QA 2G1MA 5ERLA 2A6YA 5BNOA 2R30A 3BB6A 1XBFA 3N7KA 5FK8A 5ISLA 3N9LA 1UCXA 3GCXA 5I8YA 4FT8A 3PTRB 5DAWA 1YCIA 2RS51 4IEQA 5BNNC 4GB33 2DCJA 3VD7A 1AR73 2ZKLA 2AUYA 1XOYA 3W58A 1NQDA 1FPN2 1ZZBA 2QQJA 2OPWA 2R042 3TNQA 3AKTA 3ZXJA 3TEYA 3S0MA 2C6SA 1ULEA 1VMFA 5F5AA 4AVCA 4DOUA 5AFBA 3SISA 3ZPYA 1PX3A 3IAQA 5JZGA 1D7PM 4CDXA 1NUKA 2W39A 3ILNA 2FCTA 1W6OA 3MIDA 4LQRA 3J7HA 5FY4A 4AGRA 1K45A 3B69A 2WWUA 4NPMA 3O1RA 2EF6A 3MW4A 5FP8A 1OQEA 2WO1A 2WABA 3E6DA 2PHUA 5E6HA 5KHIA 4ASLA 5FPAA 1TMF1 1LCLA 2BNNA 5GLWA 4BQ3A 4MHUA 2VTFA 4IV1B 1KS4A 2R073 4Q4W1 4HN0A 3I2OA 5HCBA 1RUJ2 1UWWA 1PO22 1XXNA 1XE7A 4U36A 4GKYA 3MLLA 1E57A 4WM7C 3VKNA 3ZXDA 1UL9A 2QJVA 1SG3A 1V9U2 3IKWA 5CYYA 3TBDA 2YHJA 5JXHA 4Y26A 5LA2A 3VDDC 3ECQA 3VDDA 3OGVA 4CP9B 4QX5A 3CNAA 3WF0A 4YZ3A 2OXBA 5FLJA 4CPBD 4YNIA 2WDBA 2PLV3 1MZEA 1SLTA 4BZ4A 5LEKA 1RHI2 1CX1A 1POV0 2HYKA 1PVC3 1PGW2 1UXZA 2W95A 4QPIA 2YMZA 5DUUA 4S2HA 1EPZA 2ARAA 2P2KA 5F39A 3VKOA 2VM9A 3KQ4B 1STMA 2JECA 5J37A 5FBZA 2KR2A 4M0NA 2MNGA 5H9SA 4Q27A 2JB8A 1DCSA 4JC1A 1QQP3 3T08A 1AR83 3CJIC 3CJIA 3Q9OA 1WCKA 1JYTA 3ZYRA 1VE0A 4QPWA 3OG2A 4D3WA 4LUKA 5LCWL 2WS92 3ZFEC 1DGWX 3JBG2 2WRAA 4KNCA 3V0BB 1IPJA 1UY2A 3LE0A 1RHI1 3N7MA 4IEZA 1MEC2 2ZCWA 4X6QB 5ACA1 3SKVA 4KU7A 3AM2A 1SBFA 1HJFA 2BRTA 4PCRA 4W6YA 3USSA 4BQWA 3BN6A 1NXD1 1OH4A 2OUJA 3ZYJB 1V6IA 2H0BA 4UW6A 2ETEA 5DABA 3VBSB 3U37A 3WEZA 3I2GA 1JZ6A 2ENRA 2WN2A 3DXTA 1HXS1 3W9AA 4A2UA 2AC1A 3NAPB 3OF1A 3NJXA 1UYPA 1XNAA 3VBUB 1JYWA 3KHCA 5IYYA 5FPZA 1V6LA 2KA3A 2W1WA 2X09A 4AI3A 1WMDA 4CP0A 1BZWA 2EVXA 3PU3A 2RS31 3UGHA 4CP2A 4JKMA 1DDLA 4LBJA 4C0BA 3NJZA 3LDRA 2WS91 2Y6FA 4JAAA 3WOGA 2CNAA 2R7EB 3H3LA 2GN3A 2VMCA 3RYKA 3S5AA 2TNFA 1UYZA 1LGCA 3WNOA 1DZRA 4YGCA 1W6PA 3TWIA 1JH5A 5FXXA 1HDKA 3F95A 1PIV3 4S2GA 4E2GA 2B7YA 2VOTA 3ZVXA 1S0IA 4FFFA 3VUOA 4LBNA 4OQ9A 3SQOA 5JI7A 3M3OA 4N7UA 4P5HA 4DIQA 4QX1A 2XG3A 3B5LB 4YG0A 3PVNA 4P9YA 4XUTA 3VDAA 4GMP3 5GLZA 3HQXA 3UYJA 5LBFA 1GICA 1U0AA 4KBZA 4OVEA 1XE0A 3UESA 1WZXA 4W6XA 4YVSA 3VBUA 3DF0A 5IVJA 4E2SA 4IGQA 3WNXA 1OFNA 5T55A 3MIEA 3HBKA 3NVCA 4Q4X1 4UFIA 5LA1A 1REEA 4CDQC 1G7YA 3FC0A 4QM8A 5DUXA 4Z07A 4DY5A 4MXVA 3ZFEA 4IL7A 1PMIA 5FMOL 1CD3G 4CDUB 2A3YA 2Q1MA 1DGRN 2XLAA 5F9TA 2QNKA 3MBWA 3OBRA 1AR61 2P3KA 5FP9A 4QKBA 2VUAA 3UNPA 5CFDC 5C6CA 1FOD3 4JZRA 1FNZA 1SPPA 2BWCA 3HVDA 1UU6A 3FJSA 4XDPA 4AQ2A 3POIA 5FZFA 1PGL1 4LLOA 4D7TA 3WINE 2VOWA 1SACA 4K7JA 1WMFA 1WW7A 1W3XA 2D6PA 4RR3B 4TWTA 3WDVA 2LRPA 3WT3A 2QFEA 3NQHA 4FPCA 5APAA 3OOXA 1O6UA 3C7GA 3OBZA 3VDDB 4B7KA 1W04A 3U07A 3AVRA 2V73A 3IMMA 1OFSA 4LO5B 5FZKA 2XXZA 2K9ZA 1IOAA 3N36A 3POFA 5CZKA 3R0RA 4FPYA 5FP7A 1VMJA 1SLBA 1S0DA 2B42B 2Q1FA 3THTA 5LW9A 4DS0A 1GYKA 2VCAA 3B3QE 4PI2A 1C28A 3OBTA 4D6QA 1E5IA 3ZFFC 2WIIB 1X82A 3T09A 2LROA 1JZ2A 4K40A 2XJTA 3EO6A 4OYUA 1JBCA 5F2WA 2ZPXA 3THDA 3ZN5A 5ABJB 2ET1A 3ZSKA 3AYDA 3LKJA 4AEKA 3GNEA 1VAMA 4NAOA 2VMIA 4XMAA 5JR2A 1OQDA 3MF9A 5FYSA 1YUDA 1DQ1A 4LIUA 4Y5SA 4EV0A 4MGKE 1PHMA 4LK7A 3VKLA 3DKWA 1DYOA 1R1A3 1W06A 3DL3A 3DYOA 3W59A 3KCCA 4XBNA 2C26A 3UKVA 3DKQA 3MIGA 3ACFA 2J1AA 4DXTA 4Q29A 1XRUA 3AFGA 3KCYA 1H1AA 2JG8B 1WCDJ 1G86A 1BEV3 2J7MA 5I0RA 3ORJA 1LECA 5FZHA 5A6ZA 3O1UA 3AK0A 3HT1A 3O7OA 4YFWA 5IATA 1JXNA 2IVIB 3INAA 5A1FA 2WA3A 4NHYA 1JZ7A 1ZZ9A 1UU4A 2HJIA 1GBGA 1LU1A 1YQ5A 3D3AA 4NWVA 5FZ7A 5KXEA 5LBBA 1MQTC 3D4KA 4IEPA 3ZFFA 1RUC1 2MEV3 1ACCA 4N43B 3VBRB 1RUI2 4LHLA 1TME3 1NQJA 1HQWA 4AI8A 4OHZA 1QJFA 4FQ4A 2PFWA 1AHSA 2PN5A 1FT9A 3AP7A 3JD73 3LGRA 3NNGA 4OZOA 5H9QA 3RZHA 2QQWA 1ZRFA 4QKNA 3H8XA 5DDJ2 3JCIA 1JU4A 2Y0OA 5FY0A 4LO7A 4CXXA 4Z8BA 4NVPA 4D6SA 5GZFA 2DBIA 1JS9A 3BTXA 3I3EA 1PO21 4ZXEA 1FYUA 2DWRA 2QQMA 3E1F1 4CRQA 1C1FA 2JDPA 1GWMA 2BP6A 3LB9A 2BW8A 4CDXC 1W2NA 2VCMA 2LUWA 4QWNA 3VD3A 4GXLA 5FZDA 2ZGQA 2BGOA 3I97A 1D2SA 4Y4RA 1I1EA 3EBRA 2PHRA 4Q8KA 4NROA 4NMIA 4AI1A 4AI2A 3PVOA 2MPFA 1R64A 1GNHA 3KWVA 2B4KA 1QHDA 1RUD2 1W6NB 2Q8OA 1KFXL 2NM1A 3T1MA 2D5HA 3WY6A 3ZXKA 5LB6A 2K2SA 1MVQA 5FBJA 2Z79A 3P3NA 2GAUA 4JDNA 2VUCA 1K5MA 4JRAA 1NY72 5ANQA 2Y8KA 1TMF3 2YC0A 3GJAA 4I3GA 3IBMA 2NP0A 1ZREA 4XAEA 2G9ZA 5GZEA 3N9MA 3NKGA 3NJYA 5FWEA 4LE3A 1W2OA 4O9EA 3V0BA 4MYEA 5FO7B 3BALA 3GBGA 1D4M3 4YW3A 1ND3B 2ZTNA 4HKWA 4JGYB 2DTWA 5BNPA 4CA9A 2Y34A 4ZHNA 4ATFA 1FI2A 2B8MA 5C5TA 2Z2SB 2BFUL 4R9AA 4XQ4A 1K3IA 1REFA 2QCSB 4JKLA 3G7DA 1Z7S1 2XR4A 3GHNA 5FYZA 3PLQA 3VBFC 5CKMA 4CDWA 3U11A 4A3ZA 1TEIA 2WAAA 2RV9A 4AG4A 1UOFA 2B5HA 1J83A 3VKFC 3K3NA 1RUNA 4FP3A 3FFQA 1W03A 1EAH2 1F2NA 4MGIE 2HBTA 4PF1A 4ZZ8A 3E6BA 1S1AA 1XNDA 4W6WA 5C8WA 2EXHA 2GNDA 2CGOA 2VH9A 4CDUA 4GKXA 4MG2A 3CMGA 2G9FA 3I4IA 3PNAA 5J09A 1KGYA 2WQ8A 3SXWA 1K5MC 4LUMA 5J36A 2JDHA 3B93A 2Q8CA 1YYNA 4FPFA 1L3JA 1J1LA 1JUHA 4X8NA 4QX3A 1VAVA 2G4IA 2ZBJA 3IIAA 3CL1A 2XVGA 5L9RA 5FRAA 3AJZA 4S2DA 2XPJA 4NN0A 4FVVA 4YM1A 2W92A 3ZN6A 2BU9A 2RDRA 1NY71 3QLQA 2RS33 2OIIA 3M3QA 3JD71 3WNLA 4NIAA 1BKZA 5BPXA 2E31A 4R9BA 5LY2A 3ALQA 2VNRA 5EFUA 4NWWA 4MGSA 1SLLA 3MV11 2D5FA 4BJ0A 4DPNA 1TNRA 4J25A 4YW6A 1W6NA 3APBA 1N47A 3MLKA 1C8M1 1IZ3A 4QQLA 5F6KA 4D94A 1RUH1 2AZ5A 3UJOA 1FX5A 5D2AA 4Y24A 4YW1A 3MW3A 1JZ5A 2QKDA 4K21A 4UW5A 3VL8A 2CGPA 4OI0A 4LIVA 1LB2A 3BPZA 1KXGA 4HVRA 2FDJA 2VD7A 4UFMA 4XXAA 5FZGA 2P4EA 3NNLA 3N9NA 2FMYA 2CHHA 1MS1A 4HANA 4AQ6A 1J3QA 5A7WB 4AHZA 1VRH3 2A73B 1UY0A 1JHNA 1Q43A 3CQOA 3IZOA 4IQPA 2W1UA 4AVTA 1HKDA 3EJKA 2DDUA 4P9WA 3RYRA 2R1DA 4C8DA 1Y9MA 1AZDA 5C8CB 3I3MA 1H4HA 1KQRA 4OHYA 2J22A 1TNFA 3HIFA 5F5IA 5CKQA 3CZUA 3B9IA 4QX0A 1VB4A 1VR3A 3PMEA 1N3OA 5A7QA 4IERA 4DEVA 1L7RA 4R8HA 1HQLA 5FKCA 4CCJA 1R083 2QDRA 2W3JA 4B8EA 4CCLA 3W21A 2ZAAA 2W2IA 3WP4A 1UAIA 3O1VA 4LORA 5GLVA 1DQ2A 1JOBA 2BYVE 2MEV1 1N1YA 1H30A 4LHKA 2WT2A 4LBQA 3E5XA 1HRI1 4XFGA 3X29B 1CZSA 2GC0A 5ANNA 3ZFFB 1VBA2 3QH7A 4NHKA 3DN7A 2BDRA 1BK1A 4PDWB 2AEYA 2IFWA 3GALA 3R6SA 4BLJA 1OUXA 1RUE1 3MHZA 4NHXA 2WYSA 2ZHMA 1US3A 2YROA 5D8AC 4CCNA 1RVF2 2Y6LA 4QB1A 3NV4A 3HWJA 5G04L 3EXUA 4BXSV 2DUQA 2XQXA 3HBZA 3T4VA 2VO5A 2Z4FA 2IXJA 3K75B 4OUSA 3MFCA 1QJEA 4D6RA 3AKRA 5FZ8A 3HNMA 4NPLA 3CF6E 5IJRA 1GQPA 2DVAA 2P17A 4QDRA 3VHPA 4CEWB 3BIEA 2XGXA 3POYA 4URAA 1WLCA 5LY1A 4HT1T 5IVYA 5IW0A 2R061 4GQ7A 4AFDA 3POGA 4XURA 4XBQA 1QJY1 3VBRA 5FZ4A 4DXRA 1UX6A 2JDUA 4ES9A 1C1LA 1H6XA 3PDQA 2WA4A 3TN91 4K8FA 4QDSA 4AF9A 1RTVA 3KMHA 5K8SA 3RZZA 2Y6KA 1OH3A 2P6HA 1BYHA 2Y38A 2JG8C 2X29A 4IETA 1OQ1A 2YY1A 4X8PA 5KXCA 2BV4A 3ES1A 1H0BA 4CCMA 2D3PA 5EYXA 1GZWB 4LHSA 3GF6A 5DQ0A 5FYBA 1YFUA 4COUA 2UY8A 1VRBA 2VL4A 3Q8CA 3U14A 5JMOA 4FTEA 1AL22 5FYMA 1UU5A 4EN6B 2BVBA 3VZOA 3OSDA 4XQDA 4YVWC 3BOPA 4QPGA 4C90A 1TME1 2B46X 3PVBB 1EV12 2HWB2 1I3HA 1UZWA 4U2AA 1LHVA 1H2NA 1O91A 4QX7A 4FFGA 2V72A 4F83A 2X05A 1ENSA 2WWSA 3ZYBA 1TVGA 2DFBA 3RFRA 2NLRA 2R16A 4YRDA 3JB4C 3WV6A 2ES3A 4Q0QA 2XQRA 1GOFA 1PO11 3FFZA 4ZS2A 5BNPB 1OLMA 4CCOA 4N7IA 2UWCA 3GZUC 4BOWA 1OLRA 2RJLA 3KV4A 3WUCA 4CXWA 3KCXA 3FBYA 3AP4A 5JSOA 3A22A 2WNVB 4RFRB 2KXLA 4OULA 5DDJ3 2VUJA 2XJVA 5J98B 2VGDA 5D8AA 5DZFA 3SEPA 4GMP1 5DUVA 4JCKA 5BNNB 3I7DA 3JD72 4MXWB 4NUBA 2JEMA 1YO8A 1SCRA 2WNOA 3HD8B 4JQRA 1XU2A 4OMCA 4BIFA 3FHQA 5H9RA 1GOHA 2VQTA 1U5XA 1TME2 4YG3A 3VBUC 1RUI3 4AOCA 2XJUA 2MEV2 3R4SA 1IGOA 1XB9A 3WDTA 2XONA 3RQ0A 1PVC1 2O14A 4H14A 2RDSA 4CDXB 2ZGMA 3LIHA 1CAXB 3KZ4C 3I8TA 1MS8A 1OI6A 1PO12 4LITA 4MX3A 4A41A 1O3TA 4WM7A 2BOJA 4PHZA 1RMU3 4QU2A 5H9PA 5L9VA 1IPKA 4R52A 3AL6A 2IXHA 3K48A 1NCQB 3ACIA 3OYWA 5F5QA 3RMYA 3ZMNA 4IV3C 3UV9A 4QKDA 2VQUA 1VBD1 1SFNA 3WVJA 1GKBA 1CAVB 2HWE1 4PF5A 4CCEA 1XNTA 4KBBA 5FZ0A 4HSLA 2ZHKA 1M4WA 3OYWB 3ZXGA 1RL3A 1CAUA 5A3OA 3SCGA 1R1A2 4LJHA 2DUPA 2RVAA 1T6GC 5CU1A 4WVZA 5K7PA 2A70A 4MZUA 2Z42A 1A78A 1ALYA 2YBKA 4B3NA 4CU8A 1I5ZA 2V4VA 1COV2 3NW4A 1NLRA 2CAVA 3RPQA 2IXKA 2YC2A 5DPNA 4AFAA 3WSOA 4BA6A 5KC5A 5JIAA 2E32A 2Y6GA 5SV8A 5T5PA 3L2YA 1LU2A 2GC3A 3KV6A 5FMCA 3M3CA 1DQ4A 2GALA 1HB1A 1VBC2 4FPJA 4AE2A 1JW6A 2Y0IA 4XW3A 5F5CA 3QACA 4A44A 2RE9A 4YGBA 4P9XA 2R6QA 4WM8A 1O4TA 3P5BA 4XF1A 5GZGA 3LEKA 4Y1XA 4IUGA 5BXXA 1NCRA 4FAGA 5BUVA 1B35A 3POBA 1OLQA 1QNYA 1DYPA 1WCUA 3FN9A 3SC7X 3CKHA 3ZDSA 1X7NA 1C4RA 3KF5A 5EXOA 3VB9A 1Q56A 4Z2WA 1DZQA 4PIXA 1RUG3 4A6SA 1JYVA 3O1SA 3O5SA 3RZMA 3ZIWA 2N7GA 3AZYA 2H6CA 3NAPC 4RN5A 4E9KA 1ZYBA 4Y5Z0 5BNOC 1RMU1 4QPIC 3VHNA 3BKZA 2BUKA 3K4AA 1FOD2 4AGVA 4IEXA 1AX2A 2PHWA 4Q1PA 2EXJA 3KSCA 3D5OA 1RUOA 5JXJA 2H0VA 3PIGA 1IPSA 3N35A 4YVWA 1HN0A 5DMYA 4AW7A 1AR91 2QTWB 4XFBA 5JIUA 1X36A 2DCTA 4YGEA 3Q8EA 3ZFEB 2ZGRA 1JMUB 2E63A 3QCWA 5J48A 2HWC3 3TRSB 3VBFA 3BU0A 4P02B 1D4VB 1OA2A 2IVJA 1WCQA 5F3EA 3UJQA 1VBD2 4KU8A 4ATEA 3FHIB 4QXBA 4A3XA 4YVSB 2PTMA 5K4LA 4RR3C 2WUHA 3NV2A 3BI3A 4H7LA 2XBO3 2PAKA 2RJKA 5FCCA 4KGGA 3ZYIB 3RJRA 5C71A 3SMHA 3VD4A 4Q26A 4XJAA 4CU9A 4Z2AA 2VOXA 4XXPA 3D8CA 3B00A 1EV11 1O8SA 2HWB1 5GALA 3SITA 2A3WA 3B01A 1AVBA 2CY6A 3D0SA 2CV6A 2XLFA 5HPOA 1HB4A 2R0HA 3KVBA 1WCSA 4L8QA 2GNMA 2VMHA 3HN1A 1P8JA 5FYTA 2A75A 2FDFA 3HNBM 2C1FA 1OF4A 1RXFA 3LWCA 1DU3D 2PAMA 2WYFA 5KHKA 1EUTA 4TZDA 1N3QA 2WZEA 3WHTA 1ZZCA 4PI0A 5FZMA 1CX4A 1MEC1 3M70A 2Q8DA 1FPN1 3LPGA 3BU7A 4HONA 4CCDA 1GNZA 5FYUA 2XL7A 3FHAA 4J1WA 2Q5TA 3CHXA 3FBMA 1BXHA 3B02A 3MI8A 1Y43B 3UK9A 1B09A 1ODNA 1XSQA 2ZGOA 4LK6A 5FZOB 2X5IC 1N1TA 3ZOIA 5FXWA 3WW4A 4NIDA 4HK8A 1RIRA 3OGJA 2ZX2A 3ACLA 1OOPC 2VZSA 3A0NA 2CTVA 2GH2A 4ISQA 5FZ9A 5GLUA 5HI0A 1OD3A 3BOWA 3GM8A 3O0VA 1MEC3 1YJKA 2RDQA 3ATGA 4BQ1A 5CB7A 5DN2A 1BBT2 1Y9QA 5IFTA 3JBG3 1AR92 4N90A 3K51A 2WS93 4WZCA 4Z1VA 5FO9B 5KXDA 3MUZ1 3VZJA 5C8CC 3RZKA 5FPXA 1AYM2 3GJBA 2VE1A 3FZ3A 4Y1ZA 1W8FA 5GKAC 3RJ2X 3LPFA 1HJGA 1HRI3 2YV8A 5FZIA 1AR82 4YM3A 5BNPC 1WWYA 1QQP2 1AF9A 1GZ9A 2IXIA 2YBSA 4UT5A 4XVHA 4ZY9A 4CEWA 3PJQA 2EIGA 1OOPB 5FXZA 5IK8A 4CTEA 2ZMNA 4M4PA 5BNQA 3CJXA 5KHHA 2Q8EA 3IDBB 2ZA9A 2XJSA 4Q4V1 4EWAA 2XJRA 3HQRA 1LHWA 3POEA 3J4UH 3NL1A 3W5MA 3QBQA 1UPSA 5FPVA 4YVWB 4FCAA 5EPAA 3ZFGC 4EYUA 4BXFA 1JHJA 1O8PA 2DURA 5IK7A 3ZN4A 2PLV2 3JQWA 4COYA 4TN7A 4HKOA 3VDCA 1Z0HA 2EIEA 5L9BA 5K0UB 1SBEA 1RB8G 4Q2FA 1S0FA 2ZX0A 1DFQA 4N53A 3Q8BA 1GSLA 4OMDA 1ZBA1 1V9U3 2BNOA 3WG4A 3PU8A 4QB6A 2VW0A 3CJIB 1VB2A 2ZX1A 3H3UA 4ITCA 2ORZA 1YIFA 1FMD2 4Q4X2 2BQPA 3LFIA 2R072 4AGGA 1QEXA 1W28A 4YM2A 4AVAA 2HWD1 4HPKA 2WQZC 1DGWA 3LF7A 3T30A 3U1XA 1JYXA 5L7OA 1IQAA 1YI9A 1J1TA 2GC2A 1KRIA 4XFIA 1W8OA 2YYOA 4FPGA 1XSRA 2C0ZA 2VTXA 4TTGA 1AR62 1XE8A 2F6BA 3VBHB 2XDVA 3KT4A 4UFKA 4CUBA 3J8F3 1JOPA 2JJ6A 4LKSA 4AQTA 1S2EA 1ZM1A 2W1SA 3W20A 1QJX2 3WHUA 4D69A 1BMV2 1BK0A 2GZWA 2J42A 3AMNA 2JICA 4GIQA 2R043 4XUQA 1VBE1 2LW8A 2ZGSA 1BBT1 2YPDA 1FPN3 5A33B 1OSGA 2ZKNA 3OJBA 3KB5A 4I02A 5FXVA 1AR72 1GR3A 2BPA2 4AEMA 3IWZA 2R071 1K42A 2I45A 1PGSA 3IDAA 1O4ZA 2JKXA 3PUIA 4RD7A 2RDNA 3RZJA 4B1MA 1LEDA 2D97A 4LTAA 1CAVA 4ORFA 4LKFA 3SHRA 5T3NA 3KQRA 2D6MA 1SMVA 3GYDA 2AENA 1QGLA 1E5RA 1W9FA 4E8DA 2WT1A 4D8MA 1MACA 2D6LX 4E27A 4A7KA 5FP4A 5C3PA 2PHXA 4QHBA 5FJHA 3D6EA 1ASJ2 3O14A 4MOAA 4RQPB 1ND3C 4CP1A 4M01A 2JDZA 2RMU3 4TYSA 4AAXA 1HB2A 1OLME 5FIXA 4ET7A 1W6MB 3OPTA 3N7JA 4MUVA 3A7QA 3BTYA 1ENQA 5L7OC 1SLIA 4I0AA 2UY9A 1N3PA 2WNUC 4BHPA 4H3WA 1CAUB 4HK9A 1Z7S3 2X8KA 5FMOS 2ARCA 1W8ZA 3BTAA 3M7AA 3ZO0B 3ILFA 3OD0A 5ABJA 1CPMA 3F2ZA 4LO4B 2YG0A 3I59B 1ZRCA 1FXZA 4XOGA 4PLNA 5A80A 4DMIA 1LEMA 1QJU3 3VV1A 3VZMA 3ZMOA 2LS6A 3MFAA 4JDMA 2ZGLA 2A6WA 2BVVA 1APNA 1H4GA 1WLTA 4Y22B 4CEWC 2FZ1A 2CWSA 4YW5A 2XJQA 5LBEA 1KFUL 1ULGA 4ZS3A 1V6KA 2J1RA 5F8PA 4QM9A 1S0CA 3POJA 3OTFA 1AL0G 4GJYA 2A6XA 4DEQA 1HRV2 5C4WB 5JUVA 1QJX1 3ASIA 3UKNA 1PZ7A 1VBA1 4FPKA 4GJZA 3ELNA 4PDWC 2W08A 3N3HA 1IKPA 3N7LA 1LHUA 3NKTA 1UZZA 3OPZA 4V1PA 5E1RA 3WQ1A 4FTBA 4YWAA 1OURA 1DIWA 2W94A 4G9SB 3NWKA 2PELA 2HH9A 2K46A 3TN93 3MPPG 3M4FA 3N4MA 4XEZA 1DZTA 5FY8A 5FYVA 3H8UA 1YI7A 1F4HA 4LBQB 1RC6A 3USUA 1A34A 3I2KA 2B39A 5EIYB 2F4LA 3WDUA 1X33A 3MZHA 3AKPA 5F32A 1UOGA 2CSGA 2FCVA 3U78A 2PLV1 4N9HA 1BLZA 1NG0A 4MO3M 4YPJA 4QPGB 3TN92 3IPVA 3AXEA 5LRSA 1NOVA 3WNMA 5FZ1A 2BGCA 2VQAA 2JD9A 3U0ZA 3DYPA 2F4PA 2JDKA 1J3PA 4AEDA 4AEDC 2VZ1A 4OHWA 5FQ0B 3GBFA 2OX0A 5FPBA 1IS3A 5FDBA 3CIHA 2RM23 2WFF3 1H8TC 4QB2A 2O1QA 1UF2C 5C4WA 1F8VA 1C5HA 2WINB 1URXA 2EXKA 4I30A 5F37A 1OUSA 5FZCA 3ZSLA 3OY8A 1OPOA 3WLUA 3ZSMA 1W05A 4IE0A 4QKFA 3WUDA 2XWJB 1PIV1 4Y4YA 1RGSA 1RUH2 2UYBA 4BB3A 1QY4A 1YC61 3ZM8A 2FCUA 3BODA 3H50A 5C5UA 1F4AA 3IMNA 4NRQA 4Z92B 3FLPA 1QJU2 4MGZE 1WBFA 3IDEA 5DXDA 2VZVA 4YGDA 4PLMA 3SH5A 1GQHA 3WW3A 4LKEA 4QHZA 1Q3EA 4C0HA 2JIJA 3DECA 4IGOA 2SLIA 1JOJA 1W0OA 2OZ6A 1OHFA 2P37A 2WT0A 4XZUG 1TE1B 4AXOA 3JU9A 1Z7S2 2P3YA 1O7FA 4UWDA 5JZGB 4OUEA 1ODMA 2ZGKA 3FWEA 1LGBA 2XVKA 4KWKA 4DRVA 3POWA 1AYM1 1UKGA 4NJ4A 3WD5A 3WP6A 5A3UA 2Z5WA 3DPRA 3RSJA 3J7MA 2VJXA 5IAVA 1ASJ3 1SHWB 4LO8A 3WG3A 1SFYA 3ZXAC 5I93A 1ND2A 2Y6HA 1BJQA 4QHOA 1ONAA 4ZKTB 1XQNA 2E9QA 2EAAA 5C9AB 2HEWF 2OQ7A 3LA7A 1NA1A 1RUI1 3PUSA 4JX0A 5BY5A 3M2MA 2GMMA 1YIPA 3I2DA 5DAXA 3WQ7A 3KT7A 4LMFA 2DV9A 3FLRA 1YLLA 3H7JA 4LT5A 4HMZA 2O8OA 4CEYC 4WVMB 2EXIA 5CFCB 1C3HA 5IAXA 3MIBA 3MUY1 5A33A 5FPUA 1VAKA 4KG8A 1UN1A 2VNVA 2HWE2 5FZ3A 4GALA 4CPBA 4XTPA 5A7PA 2Y26A 1QJX3 1QU0A 5CNAA 1QXRA 1UY4A 3VL9A 2YZ4A 3LCPA 4UFJA 1Q8PA 1W6PB 3J8F2 3T4HB 2GSYA 4BM8A 2HWD2 3VHOA 5C3SA 1R081 4XBLA 1PMHX 1CPNA 1AR63 1ZBE1 4MGYE 4F3JA 5FOJB 2E7TA 4C1WA 4UW3A 3VBOC 2VCCA 1J59A 1O59A 2VCBA 4NOTA 3WDXA 4YYOA 5A32A 2ATFA 2JG8A 2BERA 4PIZA 1FMD3 1A6CA 1LESA 1YXWA 3M3IA 4Q4X3 1NXMA 5D21A 2DF7A 1UZYA 4KWUA 3S5QA 2CGNA 5E89A 4IESA 1O5UA 4UYBA 3BIWE 5CVRA 4IGPA 3AMMA 1LJ7A 2HEYF 2E7AA 3MEPA 1AL21 3I49A 5T5OA 2P34A 2J1VA 1ZZ7A 1F15A 4AZZA 4BIOA 5AFEA 1H8VA 3C7HA 3LA3A 3NV3A 2BGPA 5JLVA 3T0DA 1TZOA 1AXKA 1XPWA 4OFGA 1GANA 4LOTA 2YFZA 1UMHA 2X5IB 2J1SA 2KM2A 3LQCA 3WW2A 2DU0A 2NN8A 4CDQA 1BMV1 1AJKA 4LOSA 2Q4SA 2RR13 1R092 2BBVA 1H8TA 2XUEA 3BUCA 1Y7BA 3IAPA 4CVUA 3I2FA 3MLJA 3PVEA 5LA0A 1NCRC 4FQZA 3FL7A 2Q0AA 5JOZA 3E97A 1HRI2 1QF3A 1RVF1 2CWMA 4OI2A 4AVSA 1ULCA 2NMNA 2ZEZA 4N53C 2DFCA 2WNEA 3OGSA 4K3UA 2ADEA 2P3JA 3S30A 1AYM3 4BCUA 5D1IA 3OGGA 1PK6B 4LBQD 3URFA 1V6OA 2AH2A 2PHLA 1AR93 1CONA 2ZMLA 4WV8A 3O1TA 4UFHA 1QQP1 1OVPA 2D3SA 1BBT3 5IHRA 4OI1A 1XNBA 4MH0E 4URTA 2ID4A 4I0BA 3SLIA 1U5ZA 3AZZA 5FREA 3GDBA 2DU1A 2XHKA 5SV5A 2ADDA 5IFPA 5LK7B 2FD8A 4GULA 4QXHA 1QJY2 4FXGB 1MQTB 1XU1A 1X9TA 1W2TA 4Q4Y3 5FYIA 3RG0A 5JVVA 2OW4A 4JGZA 4DO0A 1CN1A 3IDCB 3ZR6A 2WFPA 4JHZA 4WM8B 3RRDA 4XZPA 4IXLA 4M00A 2ZOEB 5HXVA 3ZX7A 5KC6A 4Q4W2 4Y5TA 4TLFA 1JUIA 5FTTC 1X50A 3D82A 1OKQA 2B45X 4NRMA 1KJLA 2PQSA 4FFIA 2CYFA 4DY3A 2ARXA 4IEWA 2WNUB 4CCCA 2WAOA 4R9CA 1W8HA 1WW4A 1MVEA 2W1QA 4L92A 4NE9A 1HRV1 5FYYA 2VVEA 3A4UA 3HQUA 4XACA 5E8AA 4AHXA 4EN7B 1CVNA 5DUWA 2TUNA 5A3MA 5J96B 1YQ2A 1ZZ8A 1EP0A 1AX1A 1SPPB 2WWJA 1W0PA 4AEJA 1PK6A 3ZPOA 5K0UC 1VALA 2JDAA 2V5DA 2PHFA 4YZ5A 5JDBA 1DF0A 1QJZA 4HETA 4P08A 2EALA 2VZRA 4JGYA 2PAEA 1RUC2 1W6MA 4NO4A 3ZKYA 2JX9A 3B94A 4LNVA 4RGKA 4HKLA 4HL0A 1NA1B 2QDNA 1VBB3 1I9RA 3KT1A 4AFCA 5A32B 3OY8B 1MS3A 5LWBA 4L99A 3O1MA 4IE7A 3VDBA 1IQDC 1OBNA 4GD4A 4P9JA 4AYUA 3AKSA 5B2GB 4HXCA 1REDA 3IB3A 3WP5A 2XBO2 1QDOA 4COVA 2WR9A 5IK4A 2AREA 4XJZA 2VNOA 4YARA 5CAZA 3AJYA 3WF1A 4BK5A 4DFSA 1LOFC 1VBD3 4JGZB 1HN1A 4IEYA 1EYBA 2GH8A 2ZZQA 4FPEA 1AR81 2RS53 3I59A 4N9IA 1H1MA 2HWC2 4NHMA 1RUE2 1SLAA 3T0AA 1IS6A 2ERFA 4H7MA 3WNKA 1F9KA 4DXSA 1YEWA 2GNBA 4QPGC 3ZFGA 5ACA2 5JOWA 4LE4A 1NX9A 2WLPA 2DBNA 2YU2A 4FTSA 4TLGA 2NYYA 1F31A 5FZOA 4M3CE 1RJ7A 5J1XA 1W6QA 5IVBA 4ZONA 1MS9A 2WO7A 3I2IA 1GLHA 5LK5A 1POV3 3DYMA 2W5FA 2OZJA 3KV5A 4KQ7A 5CFDB 5L36A 4K20A 5FYHA 3VBSC 2ZGNA 3UGFA 4XCBA 1YWKA 1RUD1 4B7EA 3E5UA 3MDPA 2R062 2PYTA 1K12A 4LA3A 1DQ5A 1RUF1 2O0OA 1HV1A 2GDFA 1VP6A 1OVSA 1QKQA 1SEFA 1RUG2 2RS12 3OD4A 4XUOA 5B4XA 3TOJA 2ZHLA 2ZX4A 4XC9A 1J84A 5AC92 3A23A 4GB31 2PA7A 5BYNA 1FV2A 1R1ZA 1H2LA 4I2OA 2RM21 3VLBB 4DZGA 2YXSA 3QOPA 1ZBA2 4QAWA 4I3PA 4ARYA 3SKJE 2VR4A 1KJRA 1YQ8A 4NRPA 4R4XA 4A7YA 1PZ8A 2PHTA 1H2KA 5JSRA 2ZS6B 3FX3A 5EP9A 2VC9A 4GH4C 1GWLA 2ZMKA 1PNGA 5LEJA 1VBC3 4DINB 5A7NA 2OQ6A 2PHDA 4CDWC 3ZFGB 4XE9A 2JDNA 4IEUA 1WUVA 4EQVA 4LBLA 5IVVA 1COV3 1IS4A 4QDQA 4BU2A 3ZXEA 2VXRA 1C8M2 3R4DB 2ZGPA 3PUAA 3Q8AA 3Q8FA 3L2HA 2WZR2 3MV01 1G9CA 4RHV3 1W9WA 5AC91 3AKQA 2YC4A 3BCWA 3H9AA 5B4NA 3T3YA 4A42A 2A3XA 4RSUA 5C70A 2SBAA 1AR71 4F7ZA 1VBC1 4XFCA 4XF4A 4K9SA 4OLLA 3WXPA 4AHWA 1RUJ1 5L7OB 1VBE2 2VZQA 1TG7A 1DQ0A 1KS5A 1VMHA 1SDDB 1AXZA 1V9U1 1AUYA 1UIJA 4MGQA 1UMZA 3GZAA 5JPNB 1NAEA 1RMU2 3DXUA 4FOWA 4GZ9A 4LXLA 1ZA7A 1MR5A 1PO13 3OUIA 1HXS3 3T1LA 2VBBA 1QWRA 2EIBA 2Y64A 4PBOA 4ZZ5A 3BVCA 3ZN6B 2Z69A 4K1YA 1JI6A 1DBNA 1PZ9A 5FK7A 5K0UA 3V64A 4B4QA 1RYYA 4V2WA 1M06G 4MXWA 4XF9A 3C2UA 2G9GA 4Q4V3 4AI9A 2P5BA 1FOD1 1ZBE3 4WZFA 1I6XA 3ST7A 4BE3A 4O9GA 2ZXQA 3RNSA 1F5FA 1S0GA 3AMPA 3HEIA 2A1XA 4Y3OA 2ET7A 3TYJA 1AYN3 4FPHA 4XFAA 4N43A 3RZGA 1C8NA 2HWC1 3LOBA 1DQ6A 1RUG1 1W9YA 1G8WA 3D0JA 3PL0A 4GWNA 4C1XA 3CDZB 3ON7A 1JU3A 3WNNA 5EHDA 2HEVF 3K4ZA 2LM3A 2J1UA 1PVXA 1SBDA 3DPRB 4HVOA 1N1SA 4LKDA 2XL9A 1W39A 3ACHA 5I0TA 1EAH1 1W6OB 1L7LA 1HB3A 2G19A 1GP6A 4V2VA 5IK5A 4L11A 3L9JT 1ENXA 2KD7A 3R4UA 5CG8A 1S0JA 2D3RA 1EV13 2HWB3 4XHBA 5BV6A 3A0KA 4JHTA 4KWJA 2VXJA 5FZLA 4EN8B 2BJSA 3CEWA 5JR7B 1CZVA 3AL5A 1AL23 1OOPA 1GZTA 2AYHA 1AX0A 3A21A 4MHRA 2XVLA 2QQLA 4CUGA 3GZTB 1US2A 4WBBA 1S4CA 4A45A 3VBHA 4F8AA 1A3KA 4OQ8A 1VRH1 4MVTA 5F3GA 2YU1A 4ASMB 1JTZX 5FO8B 1OF3A 1VPHA 1WKYA 2HYXA 4WM7B 2VBDA 4H55A 4UBGA 4IE4A 2DCKA 1QNWA 1PM4A 3LIGA 1DLCA 4IV1C 4HG6B 5FZBA 5A1LA 2GN7A 1LHNA 4ES8A 3LD8A 4ZU7A 2IC1A 4UFLA 1LRHA 3ES4A 3O0XA 2WO3A 2Q30A 2W46A 4D7YA 3AMQA 5J3UA 1CR7A 4DUWA 1JN2P 1LENA 1VIWB 3RVHA 2JD4A 4LLFA 3ZYHA 1JYIA 3UL2A 4COZA 5FZEA 3UETA 3WDYA 3LSEA 1OPMA 2PQQA 2QVSB 5FY7A 2OYZA 5HCFA 1HQNA 1KEXA 4QQOA 4RS5B 4ZU4A 3SCHA 5FJKA 4AL9A 2VMGA 1D0HA 4KI5M 5DZGA 1QMJA 2VW2A 4YW4A 1RVF3 3FLTA 3UT0A 2QQNA 3I3BA 3LDKA 3VN4A 1W0NA 4Q8LA 1RXGA 2E33A 1EUUA 4C91A 5M0TA 1UOJA 4Y20B 4M3CF 1VBA3 2BZDA 4XJ9A 1LODA 4XABA 3JQXA 5JXIA 3IM0A 1ZRDA 1JZ3A 2JWPA 3NO8A 3P1IA 4HBNA 1W99A 2WN3A 1XYNA 4JKKA 1V6NA 1C5IA 1R082 3CBNA 4Q4Y1 3T2OA 2BEOA 2ZGTA 2FDIA 1GZWA 5JMCA 5JOYA 5FZAA 2DVGA 2XB6C 3KD4A 1UW8A 3O0WA 3AFKA 4GH4B 1AJOA 2RG4A 4QGMA 2WNUA 4DQAA 2DCYA 1W8TA 1S2KA 1JZ4A 2W68A 1BCXA 5CKNA 3J7NA 5FR3A 5HCAA 4BWOA 1LHOA 4NIHA 3ACGA 2JIGA 4YFZA 4MADA 4IV3B 4YVSC 1VRH2 5CFCC 4GWIA 1JZ8A 5DDJ1 1O3SA 2GNTA 5GZDA 3ZSEA 4Z82A 4W4ZA 3E5QA 4IV1A 4YM0A 1JYNA 2I74A 4KL1A 1AYN1 1NLQA 2QBXA 5EJZB 2IUWA 1U12A 3N9OA 4PBPA 4COWA 5C9AC 4RS5C 3DGTA 3NNMA 1CQ9A 3ME2A 5LASA 3WR0A 2CAUA 4O65A 2XUMA 4S2FA 2DCZA 3HR9A 2VOVA 3ETQA 2W0XA 3P6BA 4UOJA 1ZX5A 1V00A 4KMQA 4INDA 4MGTA 3C7OA 1OKOA 3KGZA 4XIKA 2YGMA 3SCFA 4W50A 5EV7A 4XMIA 4XUNA 4META 1DP0A 5A7WA 4P00B 5CEHA 3KVAA 1UYXA 2ZACA 4XFHA 1BHGA 1W9TA 3K2OA 4PDWA 1OA3A 3HNYM 1Q5OA 2JB4A 2RS32 3ENRA 1H6YA 2QZ2A 3M8LA 3ZXLA 1HIXA 2VZ3A 2DYCA 1BEV1 1SCSA 3NMBA 3OEBA 4QX8A 2VVDA 4JTOA 3V56A 3ZKUA 2ZJCA 3FUOA 4AVBA 5E16A 2HKXA 4YZ2A 5FWJA 1ZNPA 1T6BX 2P1BA 2WQ4A 1FAYA 2QQUA 1WW6A 2I2SA 4D0QA 4LEJA 1LGNA 3B9CA 4IV3A 4DUVA 5A3WA 1MZ6A 4K1ZA 2NQYA 2VMFA 2VW1A 4XQWA 1HLCA 5BNOB 1KD7A 2RMU1 2YBPA 4UXAA 4M4RA 4MSVA 2XMLA 1UXXX 5CFCA 4FPOB 5T50A 5FKBA 3TEWA 4CDWB 3MIHA 3PJYA 4CEYA 2XLGA 1EAH3 1X9PA 2Y33A 3AB0A 5TSWA 3TEZA 3W5NA 5A3PA 4MLOA 5T52A 4XILA 2QQKA 2C9AA 2EIDA 5FMBA 4CZSA 2QQPA 5IWFA 1OD5A 1YJLA 1CJPA 4HLTA 3OUHA 5T5LA 3R05A 4HOOA 4KWLA 4N53B 1ND3A 2E6VA 3OEAA 1KDMA 1K5JA 1LOBA 3BPSA 2QQIA 5IVFA 1FATA 1LNSA 1NCRB 4H2AA 3H8RA 1S0BA 3T2PA 1Q8SA 3HPNA 3B7MA 1Q8QA 4XF3A 4CE8A 3IN9A 1D4M2 3NSTA 4ASKA 1NYWA 4XDQA 5EWSA 4FOYA 2C4XA 3PIJA
chains in the Genus database with same CATH topology
1Q8VA 4WVVA 1CAWB 4QPYA 2IXLA 4FOQA 1XNKA 4EWEA 4PLOA 1FV3A 5K9YA 5D8AB 1DLLA 4RGGA 3MW2A 1VLNA 5AVPA 3O12A 5KWRA 1ULDA 1HW5A 1TMF2 2DVBA 4PJYA 4Q0UA 4QMAA 2VG9A 3KM5A 4SBVA 2VOKA 4JGZC 2K0GA 2D40A 1D0GA 4Q0SA 1DGLA 3USUB 1B35B 1RUD3 4LBMA 3AX4A 4FOVA 1CGPA 1QDCA 1R1A1 1NE6A 1D4M1 4HSJA 4P9IA 2XWBB 1Y3TA 1YRZA 3VBRC 1H9PA 4YW2A 1ASJ1 2R1BA 5GLTA 5KXBA 4ZU5A 3MYXA 3H7YA 1AXYA 1YFWA 2WNVC 5CFDA 4I0WB 2UWAA 1RITA 3QH6A 4J6GA 5C9AA 1ZZ6A 2WFF1 4G3YC 4AVVA 4QT6A 1NE4A 2FBEA 1QH7A 2CL2A 2Q1ZB 4AK3A 5EYYA 2A5ZA 1AYN2 3VBOB 4Q0VA 2XJPA 4RGAA 3HAGA 1ZBE2 2D6NA 1V70A 2GC1A 3SH3A 4Q4V2 4JV4A 2DUOA 2HWF1 5F1RA 4XHXA 2D98A 2XKOA 3AP6A 2WSVA 3LZZA 3RMXA 1ENRA 4BMBA 2WZR1 4K6BA 1HXS2 1QJU1 4LHNA 3CLPA 2YDEA 1ZRRA 1O3RA 3QD6A 4BLIA 2ZX3A 2VULA 4QGLA 3GHMA 3RWNA 1GZCA 5GM0A 4R4ZA 4GA9A 1BEV2 4NPRA 4XTMA 2BFUS 2VECA 3EHKA 3MPBA 4FBFA 1PK6C 1W2UA 1VBE3 5I0UA 5I8TA 2JG9B 3H1MA 1U5YA 1BQPA 1S55A 2EAKA 4KGQA 4RHV2 2NPIA 1X8MA 2WZR3 3LAGA 3RDIA 4BYYA 3AYCA 3M1HA 1C8M3 4FO9A 1UKRA 4AHYA 3VHRA 4B29A 2D6KA 1QOOA 1HV0A 1XYOA 2GU9A 4Q1RA 4W65A 1MQTA 1BVP1 4WVMA 5FFOC 4GWMA 5JZGC 5JI9A 2ZGUA 1QOTA 1G9AA 3NAPA 4R9DA 3WG1A 1ZBA3 1W6QB 1RINA 1H8TB 1C57A 1MZ5A 2NMOA 4RHV1 5AC93 2JXAA 4J1XA 4EJRA 1ND2C 5AVAA 2LTNA 3KS7A 3TNPB 4AEDB 5GZCA 2RS13 4YZ1A 3DUIA 3ZYPA 2R063 4JGYC 4WM8C 5I8SA 2OVUA 2GMEA 2YGLA 3JB8A 4I01A 4FXKB 2IWGB 3THPA 2JG9A 5EJ3A 2I07B 2WZPP 2AGSA 1CJDA 1OMIA 1G9FA 3RI8A 3SNMA 2TEPA 4PQ9A 4G4FA 1NLSA 4UBHA 2ZZJA 1VJ2A 4XETA 2VNGA 5DG1A 3RS6A 4OHVA 5ACA3 2YUEA 2W52A 4QGNA 4EWDA 4HZFA 1RUE3 2P3IA 2RS52 3AP5A 2XKPA 4L2NA 4JRLA 3DV8A 5FQ0A 2R041 2FHRA 1RJ8A 4QQHA 1Z78A 1HX6A 4Y22A 3WP3A 3WW1A 4CYDA 2O8QA 2UWBA 2UU8A 1IHMA 3NV1A 2WKKA 4LO6B 1WBLA 1KITA 3H1WA 4QQPA 2DVFA 4HPKB 2H6BA 1SDWA 1VBB2 2JE9A 4IEVA 2ZAHA 4OI4A 4E4ZA 1RUC3 5IUQA 2GMPA 2XBO1 2C5DA 1PIV2 1UPIA 3WCSA 2JKBA 2X53S 3ZSJA 5E88A 1QXPA 4E4DX 5F6LB 3PTYA 3UKTA 4XJWA 3VZNA 4AWDA 5BNNA 2UYAA 3G6JB 4RFT0 4M3CA 5C4WC 3VZKA 1U5IA 4X6RB 5I91A 3SH4A 3AZVA 4QD2A 1K5MB 1WLWA 2V5YA 4Q4W3 5L19A 1PNFA 4M3CB 4L9BA 2WSUA 4HN1A 1SQ4A 2D93A 2WJSA 4KG0A 4Y20A 3VZLA 3AYAA 1NA1C 4Q4Y2 4EROA 3WQ0A 1WA4A 2IXCA 3P3PA 1QJY3 4Y1VA 4FAHA 2A6ZA 3WG2A 1COV1 2TBVA 1LTEA 5CIRA 4AFMA 4P14A 4CDUC 1ND2B 5CA6A 1CESA 3MGUA 4MV2A 3V0AA 2D6OX 3V65A 3WDWA 1WD3A 1QOSA 4GH4A 2AR6A 5JAXA 2VY0A 1LOGA 4A7ZA 3WZ1A 2QUOA 4LULA 1O5LA 3VBSA 1LOCA 1YFXA 2FQPA 4EN9B 3EQEA 1R093 2RR12 5JWPA 5T5JA 3CU7A 2A7AA 2BTVC 4LBOA 1F5JA 3E6CC 4B4RA 5EZWA 2FZ2A 4WVWA 1PVC2 3HMYA 1RHI3 1N1VA 2D44A 2X5IA 3H0OA 1PGL2 1ZVFA 2JG9C 2OPKA 4XYXA 2VU9A 2E51A 1WMEA 3RI9A 1CIWA 2EA7A 3MF6A 1PO23 1RUJ3 3IPVB 4B4PA 3AP9A 5JCTA 1J3RA 2YPJA 3FUQA 1Q8OA 1DGRA 3S7EA 4E2QA 4XPVA 2QZ3A 1X8EA 3U10A 2VPVA 4PIYA 2JENA 5C33A 1DHKB 2E53A 3KGLA 1XNCA 5I0SA 3U4XA 2HWD3 4ZXKA 2B9UA 4OHXA 3MICA 4FPLA 1QH6A 1LR5A 1FNYA 2UURA 4CDQB 2RS11 3I54A 2HWE3 4ISRA 4L97A 5FOBB 4NR1A 3JZVA 3VBOA 4GB32 3C3VA 4BPZA 2R32A 3WX5A 1NCQA 4OZXA 1NCQC 2A6VA 1KDKA 2QE3A 5KHGA 5J7MA 5FLHA 3IT8A 1PGW1 5JSPA 4D7SA 2IFRA 5LRRA 3LSDA 4NHLA 4XJ8A 4HFSA 4RA0A 4XFFA 1TQ5A 2MHFA 5C8CA 1NZCA 1GQGA 1UD1A 2HWF3 4AFBA 3POSA 4FP2A 3PMSA 4RQPC 3AYEA 2R49A 3CO2A 1XYPA 3V0AB 1G9DA 5ABJC 1B35C 1MS0A 4BMEA 4I09A 1H2MA 5T54A 4HVQA 2WNVA 3GBWA 3JBG1 2VVFA 4TSVA 4CEYB 1FMD1 4E4SA 4RS5A 3JUUA 4QQ2A 1LKNA 1GV9A 1EPWA 2ARBA 5A3LA 5KBFA 1V6JA 4BH9A 4YSFA 1S2BA 2V09A 1O4YA 4FSJA 1V6MA 2WL1A 2ZABA 4Q0PA 2ILMA 4ONUA 1ZA4A 1S0EA 5IT6A 1RUH3 1IKQA 2VQ0A 2OUHA 4DRRA 1A8MA 4P9LA 3AMHA 3J26N 5CADA 3AZWA 1R091 5KHJA 4UW4A 4RQPA 2D43A 3ZYGA 1POV1 3WCRA 3VGIA 3ZIXA 3ILRA 4M0HA 3OCPA 2FMDA 4KH9A 4SLIA 2XH6A 3DPRC 2WFF2 4JVAA 3M3EA 1LOAA 2RM22 5FLIA 2JE7A 1SLCA 3S7IA 1RUF3 3LA2A 3VBFB 3J9SA 3AZXA 4JTNA 4P9GA 1UIKA 4DXZA 1WGPA 4XIOA 5CG9A 4LA2A 4Y1YA 1GFF2 2DVDA 5FAXA 2DTYA 1DG6A 1A8DA 2OA2A 1QXJA 1VBB1 4QPIB 3S6PA 3MIFA 4LR4A 1WLDA 5JOXA 2BNMA 4DB5A 2R0FA 1RUF2 1MS4A 1CAXA 4YLZA 1G6NA 2E7QA 2RHPA 1H1IA 3PHMA 1HRV3 3FE5A 1LOFA 5JPMB 2D7FA 1OA4A 2BWAA 3H3ZA 4Y1UA 3TAYA 1J58A 2NZ9A 3FMGA 1G9BA 1MS5A 4DNYA 4LBKA 2ZHNA 5HBAA 3VBHC 3J8F1 1CAWA 1WD4A 5GJ6A 4RR3A 2WLQA 3VKMA 4IEOA 2A71A 3KLSA 3RYPA 4YZ4A 3TB0A 1YHFA 4EN0A 3T2TA 3LOIA 3ZXFA 1BVVA 1MZFA 1JYCA 4JDOA 4AQSA 1YNAA 4GMP0 3AXDA 5DZEA 1O3QA 4RL7A 1H9WA 3H1YA 4XJUA 3HT2A 2IZWA 1ULFA 1LOEA 4AI0A 2LALA 4YG6A 4QXKA 1D2QA 5DG2A 1IS5A 1WW5A 1YFYA 2RMU2 4XF0A 4N43C 1PM7A 5L73A 1EY2A 2RR11 2WC2A 2HWF2 5CBLA 1LULA 4OUMA 2A6YA 5BNOA 2R30A 3BB6A 3N7KA 1UCXA 5I8YA 4FT8A 1YCIA 2RS51 4IEQA 5BNNC 4GB33 2DCJA 1AR73 2ZKLA 2AUYA 3W58A 1NQDA 1FPN2 1ZZBA 3TNQA 2R042 3ZXJA 3AKTA 3S0MA 1ULEA 4AVCA 4DOUA 5AFBA 3SISA 3ZPYA 5JZGA 4CDXA 3ILNA 2W39A 1W6OA 3MIDA 4AGRA 3B69A 2EF6A 3MW4A 1OQEA 3E6DA 2PHUA 5KHIA 4ASLA 1TMF1 1LCLA 2BNNA 5GLWA 4IV1B 1KS4A 2R073 4Q4W1 4HN0A 5HCBA 1RUJ2 1PO22 1XXNA 1XE7A 4U36A 4GKYA 3MLLA 1E57A 4WM7C 3VKNA 3ZXDA 1UL9A 2QJVA 1V9U2 3IKWA 3TBDA 2YHJA 4Y26A 3VDDC 3ECQA 3VDDA 4QX5A 3CNAA 4YZ3A 5FLJA 4YNIA 2PLV3 1MZEA 1SLTA 4BZ4A 5LEKA 1RHI2 1POV0 2HYKA 1PVC3 1PGW2 4QPIA 5DUUA 2YMZA 4S2HA 1EPZA 2P2KA 3VKOA 2JECA 5J37A 5FBZA 4M0NA 2MNGA 5H9SA 4Q27A 4JC1A 1QQP3 1AR83 3CJIC 3CJIA 3Q9OA 1WCKA 3ZYRA 4D3WA 4LUKA 2WS92 3ZFEC 1DGWX 3JBG2 4KNCA 3V0BB 1IPJA 5ACA1 1RHI1 3N7MA 4IEZA 1MEC2 2ZCWA 4X6QB 4KU7A 3AM2A 1SBFA 4W6YA 4PCRA 3USSA 1NXD1 2OUJA 3ZYJB 1V6IA 2H0BA 4UW6A 2ETEA 3VBSB 2ENRA 1HXS1 3W9AA 4A2UA 3NAPB 3OF1A 3VBUB 5FPZA 1V6LA 2KA3A 4AI3A 4CP0A 1WMDA 1BZWA 2EVXA 2RS31 4CP2A 1DDLA 4LBJA 4C0BA 3NJZA 2WS91 4JAAA 3WOGA 2CNAA 2GN3A 3RYKA 2TNFA 1LGCA 1DZRA 4YGCA 1W6PA 3TWIA 1JH5A 1HDKA 1PIV3 4S2GA 4E2GA 2B7YA 3ZVXA 1S0IA 3VUOA 4LBNA 5JI7A 3M3OA 4N7UA 4P5HA 2XG3A 3B5LB 4YG0A 3PVNA 4P9YA 4GMP3 5GLZA 3HQXA 1GICA 1U0AA 4OVEA 3VBUA 4W6XA 4YVSA 3DF0A 4E2SA 3WNXA 1OFNA 5T55A 3MIEA 3NVCA 4Q4X1 1REEA 4CDQC 1G7YA 3FC0A 4QM8A 5DUXA 4Z07A 4DY5A 4MXVA 3ZFEA 4IL7A 1PMIA 5FMOL 1CD3G 4CDUB 2A3YA 2Q1MA 1DGRN 2XLAA 5F9TA 2QNKA 3OBRA 1AR61 2P3KA 2VUAA 5CFDC 5C6CA 1FOD3 1FNZA 4AQ2A 2BWCA 1UU6A 3FJSA 1PGL1 4LLOA 4D7TA 3WINE 2VOWA 1SACA 4K7JA 1WMFA 1WW7A 2D6PA 4RR3B 4TWTA 3WDVA 1BMV2 3WT3A 2QFEA 4FPCA 3VDDB 4B7KA 3U07A 2V73A 1OFSA 4LO5B 2K9ZA 1IOAA 3N36A 3R0RA 4FPYA 1SLBA 1S0DA 2B42B 3THTA 4DS0A 1GYKA 3B3QE 1C28A 3OBTA 3ZFFC 2WIIB 1X82A 4K40A 2XJTA 3EO6A 1JBCA 3ZN5A 2ZPXA 5ABJB 2ET1A 3ZSKA 3AYDA 3LKJA 4AEKA 3GNEA 1VAMA 2VMIA 4XMAA 1OQDA 3MF9A 1YUDA 1DQ1A 4EV0A 4MGKE 1PHMA 3VKLA 3DKWA 1R1A3 3DL3A 3W59A 3KCCA 4XBNA 3UKVA 3MIGA 4Q29A 1XRUA 3AFGA 3KCYA 1H1AA 1WCDJ 2JG8B 1G86A 1BEV3 5I0RA 1LECA 3AK0A 3HT1A 3O7OA 4YFWA 1JXNA 3INAA 2WA3A 1ZZ9A 1UU4A 2HJIA 1GBGA 1LU1A 4NWVA 5KXEA 1MQTC 3D4KA 4IEPA 3ZFFA 1RUC1 2MEV3 4N43B 3VBRB 1RUI2 4LHLA 1TME3 1NQJA 1HQWA 4AI8A 4OHZA 4FQ4A 2PFWA 1AHSA 2PN5A 1FT9A 3AP7A 3JD73 3LGRA 5H9QA 1ZRFA 5DDJ2 3JCIA 2Y0OA 4LO7A 4Z8BA 4NVPA 5GZFA 1PO21 1FYUA 2DWRA 4CRQA 1C1FA 4CDXC 3LB9A 2BW8A 2LUWA 4GXLA 2ZGQA 1D2SA 1I1EA 3EBRA 2PHRA 4Q8KA 4AI1A 4AI2A 3PVOA 2MPFA 1GNHA 2Q8OA 1QHDA 1RUD2 1W6NB 3T1MA 1KFXL 2NM1A 2D5HA 3WY6A 3ZXKA 2K2SA 1MVQA 2Z79A 3P3NA 2GAUA 4JDNA 1K5MA 4JRAA 1NY72 1TMF3 2YC0A 4I3GA 2NP0A 3IBMA 1ZREA 5GZEA 3NKGA 4LE3A 4O9EA 3V0BA 4MYEA 5FO7B 3BALA 3GBGA 1D4M3 4YW3A 1ND3B 2ZTNA 4HKWA 4JGYB 2DTWA 5BNPA 4ATFA 1FI2A 2B8MA 2Z2SB 2BFUL 4R9AA 4XQ4A 1REFA 2QCSB 3VBFC 3G7DA 1Z7S1 3GHNA 3PLQA 4CDWA 3U11A 1TEIA 4AG4A 2B5HA 3VKFC 1RUNA 4FP3A 3FFQA 1EAH2 1F2NA 4MGIE 3E6BA 1S1AA 1XNDA 4W6WA 5C8WA 2EXHA 2GNDA 2CGOA 2VH9A 4CDUA 4GKXA 2G9FA 3I4IA 3PNAA 5J09A 3SXWA 1K5MC 4LUMA 5J36A 3B93A 1YYNA 4FPFA 1L3JA 1J1LA 1JUHA 4X8NA 1VAVA 2G4IA 2ZBJA 3IIAA 3CL1A 2XVGA 5FRAA 3AJZA 4S2DA 2XPJA 4NN0A 4FVVA 4YM1A 3ZN6A 1NY71 3QLQA 2RS33 2OIIA 3M3QA 3JD71 1BKZA 5BPXA 4R9BA 3ALQA 2VNRA 5EFUA 4NWWA 1SLLA 2D5FA 4DPNA 1TNRA 1W6NA 3APBA 1N47A 3MLKA 1C8M1 1IZ3A 4QQLA 5F6KA 4D94A 1RUH1 2AZ5A 3UJOA 1FX5A 4Y24A 4YW1A 3MW3A 2QKDA 4K21A 4UW5A 3VL8A 2CGPA 4OI0A 1LB2A 3BPZA 1KXGA 4HVRA 4XXAA 2FMYA 1MS1A 4HANA 4AQ6A 1J3QA 4AHZA 1VRH3 2A73B 4AVTA 1JHNA 1Q43A 4IQPA 1HKDA 3EJKA 4P9WA 3RYRA 2R1DA 5C8CB 1AZDA 1H4HA 1KQRA 4OHYA 1TNFA 3HIFA 3B9IA 1VB4A 1VR3A 3PMEA 1N3OA 4IERA 4R8HA 1HQLA 1R083 2QDRA 4B8EA 2ZAAA 3WP4A 1UAIA 5GLVA 1DQ2A 4LHKA 2BYVE 2MEV1 1N1YA 1H30A 2WT2A 4LBQA 3E5XA 1HRI1 4XFGA 3X29B 3ZFFB 2GC0A 1VBA2 3QH7A 4NHKA 3DN7A 1BK1A 4PDWB 3R6SA 2IFWA 3GALA 4BLJA 1RUE1 2ZHMA 2YROA 5D8AC 1RVF2 3NV4A 3HWJA 3EXUA 2DUQA 3HBZA 2IXJA 4OUSA 3MFCA 3AKRA 3CF6E 2DVAA 2P17A 3VHPA 4CEWB 2XGXA 3POYA 1WLCA 4HT1T 2R061 4GQ7A 4AFDA 4XBQA 1QJY1 3VBRA 1UX6A 4ES9A 1C1LA 2WA4A 3TN91 4K8FA 4AF9A 1RTVA 3KMHA 5K8SA 3RZZA 1BYHA 2Y38A 2JG8C 2X29A 4IETA 1OQ1A 2YY1A 4X8PA 5KXCA 3ES1A 1H0BA 2D3PA 5EYXA 1GZWB 3GF6A 1YFUA 4COUA 2UY8A 4FTEA 1AL22 1UU5A 4EN6B 2BVBA 3VZOA 4XQDA 4YVWC 3BOPA 4QPGA 4C90A 1TME1 2B46X 3PVBB 1EV12 2HWB2 1I3HA 4U2AA 1LHVA 1H2NA 1O91A 4F83A 1ENSA 2WWSA 2DFBA 2NLRA 2R16A 4YRDA 3JB4C 3WV6A 2ES3A 4Q0QA 1PO11 3FFZA 5BNPB 4N7IA 2UWCA 3GZUC 4BOWA 1OLRA 2RJLA 3WUCA 3KCXA 3FBYA 3AP4A 5JSOA 2WNVB 2KXLA 4OULA 5DDJ3 2VUJA 2XJVA 5J98B 2VGDA 5D8AA 5DZFA 4GMP1 5DUVA 4JCKA 5BNNB 3I7DA 3JD72 4MXWB 2JEMA 1YO8A 1SCRA 3HD8B 4JQRA 1XU2A 4BIFA 5H9RA 1U5XA 1TME2 4YG3A 3VBUC 1RUI3 2XJUA 2MEV2 3R4SA 1IGOA 3WDTA 3RQ0A 1PVC1 4H14A 4CDXB 2ZGMA 1CAXB 3KZ4C 3I8TA 1MS8A 1OI6A 1PO12 4MX3A 1O3TA 4WM7A 1RMU3 4QU2A 5H9PA 1IPKA 4R52A 2IXHA 3K48A 1NCQB 5F5QA 3OYWA 3RMYA 3ZMNA 4IV3C 3UV9A 3WVJA 1VBD1 1SFNA 1GKBA 1CAVB 2HWE1 4PF5A 4KBBA 4HSLA 2ZHKA 1M4WA 3OYWB 3ZXGA 1RL3A 1CAUA 3SCGA 1R1A2 2DUPA 1T6GC 5CU1A 4WVZA 5K7PA 2A70A 4MZUA 2Z42A 1A78A 1ALYA 4B3NA 1I5ZA 1COV2 3NW4A 1NLRA 2CAVA 3RPQA 2IXKA 4AFAA 4BA6A 5KC5A 5JIAA 5SV8A 5T5PA 3L2YA 1LU2A 2GC3A 3M3CA 1DQ4A 2GALA 1VBC2 4FPJA 4AE2A 1JW6A 2Y0IA 4XW3A 3QACA 2RE9A 4YGBA 4P9XA 2R6QA 4WM8A 1O4TA 4XF1A 5GZGA 4Y1XA 5BXXA 4FAGA 1NCRA 5BUVA 1B35A 1OLQA 1QNYA 1DYPA 3ZDSA 1X7NA 1C4RA 5EXOA 4Z2WA 1Q56A 1DZQA 4PIXA 1RUG3 3O5SA 3ZIWA 2N7GA 3AZYA 2H6CA 3NAPC 4E9KA 1ZYBA 4Y5Z0 5BNOC 1RMU1 4QPIC 3VHNA 2BUKA 1FOD2 4AGVA 4IEXA 1AX2A 2PHWA 4Q1PA 2EXJA 3KSCA 3D5OA 1RUOA 2H0VA 3N35A 4YVWA 4AW7A 1AR91 4XFBA 5JIUA 1X36A 2DCTA 4YGEA 3ZFEB 2ZGRA 3QCWA 2E63A 5J48A 2HWC3 3TRSB 3VBFA 1D4VB 1OA2A 3UJQA 1VBD2 4KU8A 4ATEA 3FHIB 4A3XA 4YVSB 2PTMA 4RR3C 3NV2A 4H7LA 2XBO3 2PAKA 2RJKA 5FCCA 4KGGA 3ZYIB 3RJRA 3SMHA 4Q26A 4XJAA 2VOXA 4XXPA 3D8CA 3B00A 1EV11 2HWB1 5GALA 3SITA 2A3WA 3D0SA 3B01A 1AVBA 2CY6A 2CV6A 2XLFA 2R0HA 1WCSA 4L8QA 2VMHA 2GNMA 3HN1A 2A75A 2C1FA 3LWCA 1DU3D 2PAMA 5KHKA 4TZDA 1N3QA 3WHTA 1ZZCA 1CX4A 1MEC1 3M70A 1FPN1 3BU7A 1GNZA 2XL7A 4J1WA 2Q5TA 3FBMA 1BXHA 3B02A 3MI8A 1Y43B 3UK9A 1B09A 2ZGOA 2X5IC 1N1TA 3WW4A 4HK8A 1RIRA 3OGJA 2ZX2A 3ACLA 1OOPC 4ISQA 3A0NA 2CTVA 2GH2A 5GLUA 5HI0A 3BOWA 3O0VA 1MEC3 1YJKA 3ATGA 4BQ1A 5CB7A 1BBT2 1Y9QA 3JBG3 1AR92 4N90A 3K51A 2WS93 4WZCA 4Z1VA 5FO9B 5KXDA 3VZJA 5C8CC 5FPXA 1AYM2 3FZ3A 4Y1ZA 5GKAC 3RJ2X 1HRI3 2YV8A 1AR82 4YM3A 5BNPC 1QQP2 1AF9A 1GZ9A 2IXIA 4CEWA 3PJQA 2EIGA 1OOPB 5IK8A 4CTEA 2ZMNA 5BNQA 3CJXA 5KHHA 3IDBB 2ZA9A 2XJSA 4Q4V1 4EWAA 2XJRA 1LHWA 3J4UH 3NL1A 3QBQA 1UPSA 4YVWB 4FCAA 3ZFGC 2DURA 5IK7A 3ZN4A 2PLV2 3JQWA 4COYA 4HKOA 1Z0HA 5K0UB 1SBEA 1RB8G 4Q2FA 1S0FA 2ZX0A 1DFQA 4N53A 1GSLA 3WG4A 1ZBA1 1V9U3 2BNOA 2VW0A 3CJIB 1VB2A 2ZX1A 3H3UA 4ITCA 4Q4X2 1YIFA 1FMD2 2BQPA 2R072 4AGGA 4YM2A 4AVAA 2HWD1 4HPKA 2WQZC 1DGWA 5L7OA 1IQAA 1YI9A 1J1TA 2GC2A 1KRIA 4XFIA 2YYOA 4FPGA 2C0ZA 1AR62 1XE8A 2F6BA 3VBHB 3KT4A 3J8F3 2JJ6A 4AQTA 1ZM1A 1QJX2 3WHUA 4D69A 2GZWA 3AMNA 2JICA 4GIQA 2R043 1VBE1 2ZGSA 1BBT1 5A33B 1FPN3 1OSGA 2ZKNA 3OJBA 3KB5A 4I02A 2BPA2 1AR72 1GR3A 4AEMA 3IWZA 2R071 2I45A 1PGSA 1O4ZA 4RD7A 1LEDA 2D97A 4LTAA 1CAVA 4ORFA 3SHRA 5T3NA 3KQRA 2D6MA 1SMVA 3GYDA 2AENA 1QGLA 2WT1A 1MACA 2D6LX 4E27A 4A7KA 2PHXA 4QHBA 3D6EA 1ASJ2 3O14A 4RQPB 1ND3C 4CP1A 4M01A 2JDZA 2RMU3 4TYSA 1W6MB 3N7JA 4MUVA 1ENQA 5L7OC 1SLIA 4I0AA 2UY9A 1N3PA 2WNUC 4BHPA 4H3WA 1CAUB 4HK9A 1Z7S3 2X8KA 5FMOS 3BTAA 3M7AA 3ZO0B 3ILFA 3OD0A 5ABJA 1CPMA 4LO4B 3I59B 1ZRCA 1FXZA 4XOGA 4PLNA 4DMIA 1LEMA 1QJU3 3VV1A 3VZMA 3ZMOA 3MFAA 4JDMA 2ZGLA 2A6WA 2BVVA 1APNA 1H4GA 1WLTA 4Y22B 4CEWC 2FZ1A 2CWSA 4YW5A 2XJQA 1KFUL 1ULGA 1V6KA 4QM9A 1S0CA 3OTFA 1AL0G 2A6XA 1HRV2 5C4WB 1QJX1 3ASIA 3UKNA 1PZ7A 1VBA1 4FPKA 3ELNA 4PDWC 2W08A 3N3HA 1IKPA 3N7LA 1LHUA 3NKTA 1UZZA 3OPZA 4V1PA 5E1RA 3WQ1A 4FTBA 1DIWA 4G9SB 3NWKA 2PELA 3TN93 3MPPG 3M4FA 3N4MA 4XEZA 1DZTA 3H8UA 1YI7A 4LBQB 3USUA 1RC6A 2B39A 3WDUA 1X33A 3MZHA 3AKPA 2PLV1 4N9HA 1NG0A 4QPGB 3TN92 3IPVA 3AXEA 5LRSA 1NOVA 2BGCA 2VQAA 3U0ZA 2F4PA 1J3PA 4AEDA 4AEDC 4OHWA 5FQ0B 3GBFA 1IS3A 5FDBA 2RM23 2WFF3 1H8TC 1UF2C 2O1QA 5C4WA 1F8VA 1C5HA 2WINB 1URXA 2EXKA 4I30A 3ZSLA 3OY8A 1OPOA 3WLUA 3ZSMA 3WUDA 2XWJB 1PIV1 4Y4YA 1RGSA 1RUH2 2UYBA 1QY4A 3H50A 3BODA 3IMNA 4Z92B 3FLPA 1QJU2 4MGZE 1WBFA 3IDEA 5DXDA 3WW3A 4YGDA 4PLMA 3SH5A 1GQHA 1Q3EA 4C0HA 2SLIA 1JOJA 1W0OA 2OZ6A 1OHFA 2P37A 2WT0A 4AXOA 1TE1B 3JU9A 1Z7S2 1O7FA 5JZGB 2ZGKA 3FWEA 1LGBA 2XVKA 4KWKA 4DRVA 3POWA 1AYM1 1UKGA 3WD5A 3WP6A 2Z5WA 3DPRA