1C28A

The crystal structure of a complment-1q family protein suggests an evolutionary link to tumor necrosis factor
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
134
structure length
125
Chain Sequence
MYRSAFSVGLETRVTVPNVPIRFTKIFYNQQNHYDGSTGKFYCNIPGLYYFSYHITVYMKDVKVSLFKKDKAVLFTYDQYQENVDQASGSVLLHLEVGDQVWLQVYYADNVNDSTFTGFLLYHDT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (30 KD ADIPOCYTE COMPLEMENT-RELATED PROTEIN PRECURSO
publication title The crystal structure of a complement-1q family protein suggests an evolutionary link to tumor necrosis factor.
pubmed doi rcsb
source organism Mus musculus
molecule tags Serum protein
total genus 24
structure length 125
sequence length 134
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1999-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00386 C1q C1q domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1c28A00
3MI8A 1U5YA 5KC6A 1OQEA 4J6GA 1PK6A 3TYJA 4MSVA 1I9RA 2HEWF 2WNVA 4HT1T 1ALYA 3QBQA 4E4DX 4E4SA 4TWTA 2HEVF 2RJKA 2O0OA 1D0GA 5KWRA 1OQDA 4QQ2A 2RJLA 3URFA 3V56A 5L36A 3LKJA 4KG8A 4KGQA 4MXWB 3AB0A 1XU1A 1TNFA 2KA3A 4QQPA 5CIRA 2JG8B 4OUSA 1JH5A 3QD6A 4MXVA 3TWIA 2JG9B 3K51A 2R32A 4QPYA 4DB5A 1IQAA 1C28A 2JG8C 4KGGA 3ALQA 2JG9C 1D4VB 2AZ5A 4RSUA 5HBAA 3K48A 4MXWA 2WNUC 3L9JT 1A8MA 2TUNA 4G3YC 4QQHA 2JG8A 1JTZX 3B94A 2JG9A 2ZPXA 1WCKA 4NN0A 2R30A 4QQLA 2QDNA 1KXGA 4N90A 2ZJCA 4D7YA 1U5ZA 1XU2A 2R6QA 1PK6C 4TSVA 2WNUB 2WNVC 1DG6A 2Q1MA 1S55A 2TNFA 5BNQA 4DOUA 2HEYF 4GIQA 1O91A 3FC0A 3IT8A 3ME2A 4OUMA 3B9IA 3B93A 5TSWA 4OULA 1C3HA 1KD7A 2RE9A 1RJ7A 1D2QA 2WNUA 4G4FA 5KC5A 1PK6B 1U5XA 1RJ8A 5L19A 2Q8OA 1OSGA 2WNVB 4QQOA 4F3JA 1TNRA 3WD5A 2E7AA 2QE3A 4EN0A 1GR3A 2Z5WA 1DU3D 2X29A 2OIIA
chains in the Genus database with same CATH superfamily
2WS93 5FCCA 5CZKA 4K20A 4PJYA 3ZO0B 3UT0A 1CIYA 1QXRA 3NO8A 4NPRA 1WKYA 3Q8BA 1JOJA 1Y9QA 3K77A 4MSVA 3ZFEB 4INDA 2JDKA 2RS13 4YW1A 5IFTA 1V9U1 4A6SA 2A7AA 2ZGOA 5JZGC 5FMOS 2K2SA 3FHAA 3HEIA 1HXS3 3VHRA 3ZFEC 5FWEA 1OBNA 4YW5A 1VE0A 3OBTA 2VMCA 3CQOA 5KWRA 2VNRA 2CGPA 3RFRA 1O7FA 2RS32 4RGGA 2UYBA 4N9HA 3U10A 4BIOA 1LR5A 1L7QA 2EIEA 4C0HA 2YDEA 3BUCA 3E5QA 4PF1A 1NT0A 4CUBA 1RUF1 4KG8A 4X8NA 1BK0A 3BPSA 2VUAA 2VY0A 3LDRA 3ILNA 1N3OA 3CZJA 4I3GA 1JYCA 2EIDA 3CJIC 4Q4Y2 5IVEA 1VBD1 4NHKA 3IM0A 2BNNA 2XBO2 3BOPA 4JGZC 3AZWA 1X50A 3IMMA 1JHNA 2BZDA 3M3OA 1WWYA 3ETPA 1IOAA 3NAPC 5FYHA 2DURA 5B2GB 1KEXA 2VZSA 1CN1A 1OLMA 1SMVA 4RSUA 2GC2A 1DYPA 4AAPA 1DIWA 5BY5A 5FXZA 1QJU3 1YI7A 3GZAA 3A22A 1RHI3 4B1LA 1OF3A 5JZGA 4UW5A 5IAXA 1OQ1A 2LALA 5FZDA 3N9LA 5B4XA 3GCWA 2BWAA 5C5TA 4TYSA 3ZYJB 5LRSA 3TN93 4NIAA 4M01A 4A6OA 5BUVA 2BYVE 4LBQA 2HWC1 3BCWA 5FYVA 2LROA 3WCSA 5LW9A 4QQLA 5KHGA 4LKEA 1UY1A 2PQQA 1SFYA 2ZEYA 3AKRA 3PTYA 5FP9A 3X29B 3H3ZA 3VL8A 3HBZA 4N7IA 1ZX5A 1JW6A 2A6VA 3USUA 2BFUS 2D93A 4ARXA 5JLVA 1H6YA 1WD4A 3CJIA 5IHRA 2OPKA 2BDRA 4RGKA 4BE3A 1EAH1 2CDPA 4XF4A 4AGRA 2P6HA 3OGJA 3M1HA 4OMCA 4JGZA 2CV6A 4IV1B 3KWVA 4LBOA 1GFF2 1RGSA 1UIJA 4IL7A 2CNAA 4KH9A 4TLGA 3B9IA 3NAPA 2OW4A 4LNVA 5FP8A 5FZCA 2YGLA 3ZXKA 1BMV1 4MADA 4R52A 4DPNA 5A6XA 1Y9GA 1VMFA 4QD2A 4LITA 1V00A 3E5UA 1RUH1 2XL9A 4AHWA 5C8CB 1O3QA 1ND3B 1FI2A 1PK6B 5FPAA 2B45X 5L19A 1LRHA 2WNVB 1XE8A 4QHZA 2WFF2 1ND3C 2GU9A 2VTXJ 3MBWA 4V1PA 3TAYA 3WD5A 2Y34A 5HI0A 1MEC3 2FMDA 2VZOA 3DEMA 2QE3A 1RVF2 3PJYA 4QX8A 5CU1A 2HH9A 2YPJA 2BGPA 5F32A 3WDVA 2WKKA 2G9FA 3J9SA 3FMGA 1JYWA 1BZWA 1NCRB 1U5YA 1VBA2 4QXHA 4GULA 2IVJA 5C3PA 1W6PB 1YFUA 2R041 5DZEA 1XXNA 2WUHA 1ZRRA 1PGW2 4CP9A 5BNPB 1N47A 3HVDA 2WWUA 3WNNA 2CAUA 2V73A 4TWTA 2GNMA 2ZX2A 4WVMA 1S0EA 1ENRA 5FPBA 3RNSA 2WS92 3VZJA 1IZ3A 4IQPA 4YGCA 4ZY9A 3U37A 5BNPC 2O0OA 3NJXA 4D7SA 3PIJA 5JOZA 5DQ0A 5FYCA 3S5AA 4XPVA 1AR61 1OPOA 2ADDA 2UU8A 2V5DA 3T1LA 1RUJ3 2ENRA 2VQ0A 1EY2A 2GNDA 4FSJA 2DU0A 2JENA 2RS12 4V2VA 4N9IA 3MIHA 1CAVB 2AH2A 2VECA 2IXJA 2NYYA 2Y64A 3AMNA 1HXS2 3INAA 1O6UA 3J8F1 4K3UA 1O3TA 5FY0A 5FWJA 2RMU3 1W3VA 3ZN6A 5IVBA 3WW2A 1MQTB 3B3QE 3ZXDA 2PHFA 2HWD1 1D4M3 2X09A 4R9CA 4QDRA 1Y43B 4BXSV 3WINE 1JZ8A 5JR2A 2ZHNA 1OVSA 4W6XA 1YFWA 3WCRA 4AEDB 1BBT3 1OFNA 1TMF1 5HCFA 1N1TA 4LORA 3LA7A 3JCIA 2JJ6A 3V0BA 3LPFA 3FLRA 3DYOA 3MPBA 2YFUA 4MXWA 4M3CA 1LAJA 3O0VA 3RDIA 1J3QA 1W6PA 2J1UA 3IBMA 5FO7B 1LHUA 1PNGA 4NRMA 1A8MA 3LGRA 3MEPA 5FLIA 1HX6A 2D3SA 2TUNA 3KF3A 3OD4A 2WZR3 3MLJA 5FP7A 5BNPA 4YFWA 3PLQA 4A7KA 3BPZA 1PIV1 4COZA 3VBOB 1DQ0A 1GU3A 4YYOA 2XVGA 5K0UB 3T2OA 4JCKA 3VB9A 2CGNA 1DGWA 3THDA 1H2KA 1RHI2 4XF0A 1XC6A 3K4DA 2FDHA 4OFGA 5K0UC 1SLTA 4KMQA 1DBNA 1QJX3 3I59A 4FPLA 2VOKA 5IVYA 2R6QA 4M00A 2WNUB 2IXKA 2A1XA 2VQTA 5H9PA 2GP5A 3TN92 1A6CA 4S2GA 4XMAA 3VHPA 2VVFA 1W8UA 4CUGA 3BKZA 1I5PA 1H8TB 2HWF1 2VZRA 1W8FA 1RUI1 4QDSA 4P9YA 4QX7A 4RR3B 4X8PA 5BNQA 2PYTA 2J1RA 5GKAC 3ME2A 5IVJA 3AP9A 1KRIA 5FO8B 3B69A 1FNZA 5FTTC 4RR3C 4XQDA 1B35C 1R1A3 3VBHB 4A45A 4YFZA 1JZ6A 1LOGA 1ZNPA 5I0UA 3TNPB 3WV6A 3S57A 1OA3A 5C33A 4ASMB 4CDQB 1YQ5A 2JDAA 4NPLA 1MZ5A 3NL1A 1Z0HA 2DVFA 5H9RA 1TME2 2QQIA 4X6RB 4DO0A 3VDDC 2AR6A 4AFMA 1OI6A 3ZXLA 1JHJA 1DQ6A 4LKDA 2ZGKA 4OQ9A 4WBBA 1HV0A 2B4KA 5F5CA 2A3XA 2H0BA 2W1UA 2VMHA 3ZYIB 4CYDA 2RV9A 5GLUA 2FDIA 4MGIE 1STMA 3WF2A 4FPHA 1VRBA 3SH5A 1P8JA 3FN9A 3LIGA 4GB33 4FFFA 5FUNA 4LBMA 1UXZA 1LOEA 2XJRA 3SNMA 4YZ5A 5LA2A 5A7PA 1MEC2 3VL9A 1GP4A 3D6EA 4Y20A 5HCHA 2DBIA 5IVFA 3RWNA 3CJXA 3ENRA 2WQZC 5DXDA 3RMYA 4E4SA 2NN8A 4FFGA 2EIGA 5CFDC 2WDBA 4XVHA 5E16A 1PO21 1UZYA 3SKJE 2WWJA 5C7GA 2BBVA 2IFWA 1FV2A 3Q8CA 4RR3A 1AYM1 1B35A 1OHFA 3QACA 2C4XA 2VULA 3P3PA 3AKTA 5LK7B 1UYZA 5A7NA 4CUAA 2EALA 3NWKA 1QOTA 3EJKA 1SDDB 1NY72 1W6QB 4XYXA 2IVIB 2VJXA 3DUIA 2ARAA 4IEUA 4SLIA 1WZXA 2LTNA 3T09A 3A0KA 1RUC1 2WT2A 3VDDA 4AZZA 3F2ZA 1X82A 2ZAHA 3WNLA 4XDPA 1MS5A 3ZVXA 1J1TA 1GNZA 4LO4B 4L8QA 1LCLA 4M0HA 1X9PA 1W0NA 4JAAA 2ZEZA 3ITQA 1W9YA 1XQNA 3SISA 1ASJ1 2MEV1 3MLKA 4AQ6A 2RMU2 2WIIB 4P08A 2ADEA 5T50A 2VW2A 2W68A 1POV1 1SBFA 2MHFA 2WJSA 3U1XA 4N53B 1JZ5A 2VTXA 3WW4A 3MDPA 2D6LX 1FX5A 1VP6A 4UFLA 2J22A 2UY9A 4XDOA 4EWAA 5CFDA 1PZ8A 5A7WB 4WVVA 1Z7S3 3POIA 4MGSA 3B5LB 4YVWB 5LBCA 3VHOA 5A3UA 4ET7A 3D8CA 1W04A 2R30A 5AVAA 5LK5A 4QPIB 3VV1A 4IE0A 5K7PA 2WAAA 4GD4A 2WZR2 4LO7A 3N7MA 1XJAA 3I3QA 4QPIC 4KWJA 3AVRA 3P6BA 4FP3A 4L0PA 2AREA 3IDCB 1F31A 1VBE1 4Y5SA 2Q1MA 4Y1UA 1W6QA 3SKVA 4XC9A 1X8MA 3MFAA 3THCA 4UW6A 4PIZA 4XUQA 4WVWA 5F39A 1QJX2 1AX1A 1QIQA 4UF0B 2Q30A 4I02A 3B93A 2XHNA 3LWCA 2DCJA 4OULA 5I8TA 2W91A 4HK8A 4N7UA 4MG2A 2HLEA 2N7GA 2RM21 1YIPA 1ZVFA 1SPPA 3WW3A 2WABA 2FBEA 4XZUG 4ZZ5A 4TN7A 2YB7A 5GLVA 4J25A 5FZ9A 2XQRA 2DBNA 4QQOA 1G9BA 2JB8A 1F4HA 2D43A 5F2WA 4AHYA 2YC0A 3VBSB 2RG4A 4XAEA 3W5NA 4L97A 1C4RA 3VD9A 3SHRA 1REDA 3A4UA 4IEYA 2DTWA 3VBSC 3JD73 2HBUA 5FYIA 3AJZA 4XEZA 3PUAA 1GZTA 1XE0A 4Q4V2 1W06A 4JC1A 3AX4A 2J1EA 2VOXA 2VUCA 2XLGA 1JXNA 1I9RA 3N9OA 1CZSA 3Q8FA 1R091 4P9IA 3THPA 1LOFC 2EAAA 3ACLA 3JQXA 5AVPA 2IUWA 2Y8KA 2ERFA 1UOBA 1URXA 2GP3A 1B09A 4PLMA 4CCJA 4CSWA 1VRH1 3ZFFB 1J3PA 2GN3A 3VD3A 2AENA 3LQCA 4O61A 4YVSB 2RDSA 3MIDA 2PTMA 3I7DA 3NJVA 3O1UA 3OD0A 5DAQA 1NZIA 2W1WA 2XJPA 1CZVA 3OY8A 4A3ZA 4CZSA 3WR0A 1DQ2A 3T08A 4COVA 5FUPA 3EYPA 5FZ7A 2FD8A 4COYA 1Q5OA 1LHNA 3DF0A 5DDJ3 1GQHA 2RS51 2QQJA 3VDCA 1BK1A 5CIRA 3ZYHA 1ZRIA 2ZZQA 4IV3B 4OHVA 4NJ4A 4IUGA 3K51A 3FLTA 1AYN3 2UURA 2ZHKA 2Q0AA 4GALA 1W9FA 1IQAA 1DGLA 2LW8A 3RYPA 1FNYA 3VBSA 4Q8KA 1RUG3 1UY4A 3ALQA 2WQ4A 5A33A 5BNNB 1NOVA 3F95A 2D6PA 2B9VA 4XCBA 1W8NA 3VUOA 4OQ8A 4HKOA 3N7KA 1ZZCA 2ZGRA 3WDXA 3ETQA 3LB9A 1PMHX 5EJZB 4LK7A 4D3WA 5HCBA 1FT9A 1U12A 1LOFA 3VGIA 2ZMNA 1PO11 3DPRB 4JHZA 5ERLA 4FCAA 1MS9A 4D94A 1QXPA 2PN5A 1HJGA 3K75B 3AKQA 2I07B 1SLIA 2JG9A 4BCUA 4CU7A 3BALA 2Y6FA 4AR2A 3T0DA 4Y22B 4XUPA 2VH9A 4LBKA 4EN7B 4MHUA 4LXLA 4JHTA 3M2MA 4S2FA 1VBB1 1GLHA 2DTYA 3OYWA 4O65A 2ZOEB 1Z7S2 4GMP3 5JI9A 1JS9A 4ISRA 4XZPA 3S7IA 4LK6A 1RUD3 1LOBA 2XGXA 5FOBB 4Q0QA 3M3EA 3ZXJA 1Q8QA 2XDVA 3JBG3 1UU6A 2Y6LA 5DPNA 5KHIA 2VC9A 4IE4A 2WAOA 2PMWB 1ODNA 3ZLIA 1W6OB 1W2OA 1DLLA 2F4LA 2R49A 1YEWA 1JYIA 1AXZA 4QKNA 4A7YA 4HXCA 4RD7A 5K4LA 1YC61 2PLV1 4YGDA 1YQ8A 2XKOA 3ABZA 3PUHA 4BOWA 3PUSA 4PDWC 4QU2A 5FYZA 2O8QA 5ABJB 4Z92B 2BQPA 2P2KA 4Q29A 2ATFA 3MPPG 2FCUA 1XNKA 2X5IC 5C9AC 3PJQA 4FP2A 5ABJC 3VD7A 2ZBJA 2VCMA 4AW7A 1R083 4XJ9A 1ZZ8A 1F2NA 1DU3D 3H9AA 3BN6A 2DV9A 1UO9A 3CEWA 4HVQA 5KC6A 4HVRA 4LR4A 3SEPA 1FOD3 3WG1A 3AP4A 1MZEA 3KV6A 4Q4X3 3ACHA 4HETA 4LJHA 4MGYE 5ISLA 2PA7A 3WQ0A 2QDRA 3SCHA 3V0AA 4H14A 5IYYA 1W39A 3DKQA 1OH4A 3VKNA 1AJKA 1V9U3 3N7LA 1RYYA 3T2TA 2C9KA 4DINB 1YFXA 2B46X 3JD72 4FOYA 1PX3A 1UAIA 2RDNA 2RJKA 4HL0A 4NAOA 4I3PA 4FQ4A 1XB9A 3AZYA 4L9BA 5KHHA 2L9LA 3WQ7A 2J7MA 3H3LA 1SFPA 2WLPA 1LU1A 4LHLA 2RJLA 4XDQA 1AL21 1UY2A 5ANNA 3VZNA 5CG9A 1QJY3 4N43C 4AQTA 4DS0A 2R071 1AR91 3DN7A 2LUWA 4PDWA 4ATEA 4IXLA 2A6ZA 4KBBA 3LFMA 1J59A 2D3PA 1WD3A 3OJBA 2X5IA 2V72A 4B8EA 5C9AA 2XUEA 5ABJA 1XOYA 1Q8OA 2ARXA 1KJRA 1OXCA 3AYAA 3Q8EA 1JH5A 1E5HA 2P37A 2XVKA 5GLWA 2J1VA 1RL3A 2XL7A 3LDBA 4FBFA 4LT5A 4Q4W1 1VB4A 3KT7A 3MF6A 1TG7A 1WA6X 3MW4A 4K9SA 4YW2A 1FAYA 1NAEA 4HLTA 5DDJ2 1IGOA 4OHXA 1XNTA 4QHBA 3O1TA 1O5UA 4B7KA 4FOVA 4Q4Y3 2YPDA 4Q8LA 4O9GA 1W8ZA 1UPSA 1GUIA 3IIAA 1AYN2 1WMEA 4IEQA 3N36A 1AR81 1S2BA 2PHLA 4JKLA 3KT4A 3C7HA 2Y38A 2DVAA 1RUG2 4PLOA 2ZGMA 1OLME 2ZPXA 2VR4A 4AAXA 5M0TA 2BGCA 5DAPA 3FE5A 1COV3 2QQOA 2YU1A 2ZAAA 1YXWA 3NNGA 3KV9A 5CADA 3ATGA 3KSCA 3ROUA 4N43A 1CPMA 3GXUA 5FZMA 4BM8A 5J48A 3LCPA 3ZMNA 2AEYA 3U07A 2WSUA 5JXHA 2W0XA 4XQWA 3KV4A 1LOAA 1J1LA 2DVDA 4IEWA 3ZSMA 3UGFA 3E6DA 4XIOA 4RYDA 1S0DA 1SLAA 2XWJB 1FPN3 4I0BA 3G6JB 3BI3A 4WM8B 5KR7A 3OGSA 4AOCA 4CP0A 3FUQA 4P9XA 4CU6A 1YO8A 4YG3A 1W03A 4HOOA 3LEIA 5FMBA 1WUVA 4WM8C 4ZU5A 5FPZA 1RUD2 4FPCA 3AP5A 3KF5A 3NQHA 4XILA 1UF2C 2XLFA 1HV1A 4QPWA 1UY3A 4CCCA 2VZ3A 1ZYBA 4LEJA 1FATA 1UD1A 5GLZA 5JWPA 4IGQA 2ORZA 3GBGA 2VAUA 1ZA7A 3VKFC 5C5UA 2G4IA 4HN1A 1UYXA 5G05L 1UZWA 2LS6A 3D0SA 3C7EA 2D6NA 3ZFGB 2FZ2A 3WG3A 1OQEA 4HVOA 2B8MA 4RA0A 1T6BX 5FXVA 1QJZA 5LCWL 2GMPA 4NPMA 5HCAA 3T0BA 1R082 4MOAA 5CYYA 1UKRA 3WSOA 1EV13 2UWCA 3ZFGC 1HN1A 4DUVA 4HPKA 4JDOA 1QH7A 4XABA 1SLLA 2VM9A 3R4DB 1AXKA 2KD7A 1FOD2 1YWKA 1KQRA 2WYSA 1VBA3 3DV8A 2JIGA 3NRUA 4QB1A 3SMHA 3VBUB 4Q4X2 4Y4RA 5JIUA 1VAMA 2A73B 1OQDA 4XAAA 3CF6E 1N1YA 4R9BA 3VBUC 3V56A 1V9U2 1DFQA 3EBRA 5EJ3A 1OPMA 5FZOA 2WZ8A 2VMFA 2G9GA 1JU4A 5A6YA 2J42A 4I0AA 1V6NA 3K4AA 4WVZA 1UZVA 2BOIA 4YW7A 4XUNA 3WQ1A 3HN3A 5JZGB 3MO4A 3I3DA 5GZCA 1CX4A 1LJ7A 1PVXA 2W92A 4QWNA 1QJY2 4FPYA 4JDMA 4SBVA 4YGBA 2KM2A 2WZEA 3ZN5A 5AFBA 1DQ5A 2JDNA 1AR71 1K12A 3CDZB 3ZXEA 5JAXA 1Y7BA 4LBQB 3PHMA 4QX2A 3OB8A 1YCIA 4GJZA 1JZ3A 3P5BA 5EIYB 1D4VB 2E7QA 4R9AA 2AUYA 4Y1VA 2NZ9A 5FJKA 2UWAA 5JSRA 1REEA 3B00A 5DUVA 5HXVA 3LE0A 3ZFGA 5FPXA 3O1RA 1SCSA 3USUB 3MGUA 1I6XA 2F17A 1DZQA 3CJIB 5CVRA 3ZIXA 2P34A 1HRV1 1H9PA 2D6OX 3I3BA 1M06G 1NXD1 4JGZB 4NHMA 4PCRA 1ZBA3 1AVBA 4YM1A 3U4XA 1QNYA 3ZMOA 2O8OA 5LEJA 4FPFA 4M3CE 2HWB1 3NAPB 2AC1A 1T2XA 1Z78A 4FPKA 4HZFA 4NWVA 4KNCA 3VBUA 4NRPA 4BWOA 1W9SA 4NOTA 3C2UA 5EZWA 4TSVA 3IAQA 4AI1A 1UW8A 2ARCA 2P6CA 3WP4A 2QFEA 5IVVA 1NCQC 2D44A 2WWSA 3PIGA 1COV2 3O1MA 2YU2A 1QY4A 4XUTA 2VNVA 4QXKA 1AJOA 3E6BA 2HEYF 2WQ8A 1VMJA 3VKOA 1UCXA 3D5OA 5EV7A 1PX4A 4Q27A 4QB6A 1US3A 3HR9A 1H9WA 1POQA 1PGL2 5TSWA 2RS31 3PVNA 5D2AA 4NIHA 5FPVA 5EJ1B 1LTEA 4BMEA 1RJ7A 1YNAA 2H6BA 1UXXX 4ONUA 2VZUA 1FPN2 4A3XA 2WYFA 3O1VA 1WCQA 3M70A 4L2NA 3PNAA 4CP9B 1X33A 3N35A 5C70A 1S0BA 5IVCA 1UMIA 2PAKA 1BVVA 3GALA 2VPVA 4F3JA 1V70A 2Y6HA 3OPZA 4JTNA 5E89A 2VUDA 1QGLA 5EPAA 4WVMB 4CU8A 1CZTA 5BNOA 4HKLA 2XBO1 1DF0A 3UV9A 4L92A 4Q0UA 5C3OA 2CYFA 3KCYA 3OCPA 3OOXA 4Q2FA 1RIRA 1RMU3 2ZGNA 1QHDA 3JUUA 1LESA 1TME3 2XHKA 4K8RB 3K3NA 2R061 2GC1A 1NCQA 3O1PA 1UNBA 3P1IA 2GMEA 4QM9A 1YQ2A 5AC93 2NPIA 3IDBB 1JMUB 4GH4A 3ZN6B 4BZ4A 2ZGSA 1US2A 1GYKA 1FV3A 1WCUA 5FJHA 4XACA 3W58A 3BU0A 3R05A 1UQXA 1ONAA 4PQ9A 1GZ9A 3POEA 1D7PM 1OUSA 4IEOA 1BEV1 4WV8A 1EV12 2DVGA 3I2HA 3O14A 2D40A 1F8VA 4E8DA 2ZGTA 3V0BB 1K5MC 3D82A 4MXWB 3UL2A 3O1SA 1IG0A 2XOMA 4M3CB 1JYNA 2JD4A 1W28A 3KVAA 2XPJA 2MPFA 3N9NA 1L7LA 4Y3OA 4AI2A 2W95A 4EV0A 1UMHA 1ZBE1 4XW3A 3K4ZA 4CEWB 3AFKA 4LA2A 4CCMA 2PELA 3AZZA 2QQLA 3I3EA 4MGZE 3OSDA 4O7XA 1S0CA 1ENSA 4Y5TA 2BJSA 5A32A 3H42B 3H1MA 3SEEA 4CEWC 3CL1A 1XYPA 1Y3TA 2ILMA 2CAVA 1H4HA 2UWBA 2W47A 3K3OA 1POV3 2VCAA 1Y9MA 4ITCA 2HWD2 1D0HA 1GV9A 3I59B 3PU8A 1ST8A 5L7OC 2D5HA 3E1F1 1I1EA 2BNOA 4XIKA 1C8M1 5DN2A 5JXGA 3LF7A 2FMYA 4CPBD 2JG8A 2WFF1 1WBFA 1HQNA 3POWA 1VJ2A 3WDTA 4D8MA 2P3YA 4OHWA 2OS2A 5HPOA 3U11A 2CHHA 4U36A 3T0AA 1JZ2A 5FZ6A 1RVF1 5FZ3A 4RHV1 1AX2A 4P02B 4Z1VA 4NAMA 3EQEA 2QDNA 4A7ZA 4AVAA 2SLIA 1LHWA 4ZU4A 2Y26A 4YG0A 1K5MA 1NLSA 4D7YA 3M8LA 1OURA 4DMIA 4YZ2A 5DUXA 1OC1A 3VN4A 1Q3EA 3C7GA 1W6NB 3OUHA 1VBE3 1ZBA2 3B01A 1OH3A 1C1FA 4JZRA 4OMDA 1JU3A 1Q8SA 4QDQA 4LIUA 1H2MA 1XNCA 5FP3A 5H9QA 1H2LA 4QHOA 3VBFC 4QU1A 2WS91 2VU9A 2WN3A 4GIQA 5F3GA 2QQUA 2BW8A 3FC0A 4CCKA 4DRRA 2Z79A 4OHZA 3WQBA 3WUCA 1IQDC 1UL9A 4CEWA 5LY1A 3TEWA 2RS11 4P9LA 2FDJA 1U5IA 3T30A 1KS4A 2WNOA 3U75A 1V6JA 1RUI2 4D69A 3UK9A 2VG9A 5IUQA 5L7OA 1HXS1 2ZABA 4BYYA 1NLRA 3IPVA 2ES3A 3J26N 1OSGA 4Y20B 3AXEA 1GOGA 5LB6A 2VVEA 5LATA 3A21A 3M4FA 2CWSA 2E7AA 2PHXA 4H7LA 4Q26A 5FDBA 5E8AA 1JYXA 5J09A 4AFCA 3O7OA 2HKXA 1B35B 2H6CA 4AFDA 5FYUA 3BTZA 1FMD3 1DYOA 2X05A 3ILFA 1CAXB 3ORJA 3H50A 3E6CC 2DWRA 4CCNA 2QBXA 4ZXEA 2ZA9A 4QGMA 4BQXA 3NJZA 3HT1A 1OOPB 2Q1FA 2X53S 3KGZA 4QT6A 1SLBA 5EP9A 2PHDA 3VDDB 4LA3A 1RMU2 1PZ9A 3GGLA 2CSGA 3VBFA 2GH2A 2DF7A 5C3SA 1W6NA 5A7OA 2D6MA 4AFAA 1OOPC 2G1MA 3FX3A 4Q0SA 4Y26A 1CONA 1NE4A 3ZXFA 3AVSA 4UFKA 3I2DA 4Q4V3 1QJU1 5FOJB 2DCTA 1TQ5A 2FDFA 3L2HA 2XLAA 5GM0A 3WDUA 1RHI1 3KLSA 5AC92 2Y0OA 4M0NA 5T5OA 2R1BA 2OKXA 1G9CA 2NP0A 2XJTA 1GP6A 3KGLA 5FZ1A 1PO22 3LEGA 2XJUA 3HNYM 5FBZA 1LHVA 1XU1A 4YW3A 3ZOIA 4FTBA 1NQDA 4GMP0 1R64A 5CFDB 1APNA 4A4AA 1ENXA 4MXVA 4PBPA 2XG3A 2CWMA 1UOFA 1PZ7A 1QQP3 4IEZA 4JQRA 1IKQA 4MLOA 1UY0A 3ACIA 1XYOA 4B4PA 1JZ4A 3Q8AA 4CEYB 4S2DA 3AXDA 3DL3A 5FZBA 3WOGA 4AK3A 2ZX0A 1VALA 2IXLA 3JB8A 4CEYC 3OUJA 1CAXA 4K1YA 1VBC3 3I2FA 3OGRA 2EXHA 4YGEA 4QXBA 3ZXGA 4Y1XA 1ASJ2 2XMLA 3ECQA 4CDXB 1OOPA 2VNGA 5FREA 2JDPA 3VKMA 2DFCA 4FAGA 3FUOA 4XF9A 4Q0PA 4YARA 2FZ1A 4CDXC 4XJAA 3JQWA 2OQ7A 1SEFA 3IDEA 3KM5A 4IEXA 5JPMB 4YZ1A 4B1MA 5I0DA 3AM2A 2A75A 1H4GA 1XU2A 1SPPB 5F3CA 4W6YA 1U0AA 1MEC1 4NWWA 4BQ5A 4AVSA 4V2WA 2TNFA 4PI2A 3J7MA 4C8DA 3FL7A 4AI8A 2EAKA 4Q1PA 3OBAA 3RWKX 2A6XA 1JBCA 3KCCA 1HN0A 2GC0A 3I2IA 3NNJA 3B9CA 2EA7A 4P9WA 5JVVA 5ACA3 3ZDVA 1ULFA 3NKGA 4OI4A 3RRDA 4C1XA 1VBE2 3HBKA 1KD7A 1MVEA 1WMDA 3BODA 2IXIA 2Z69A 4FTSA 4XTMA 4CEYA 2CGOA 4WZFA 1QOSA 5CEHA 1NY71 1UKGA 4BB3A 1DLCA 2HWE3 3NNMA 3ZYPA 4HFSA 2JKXA 4QPGC 4DZGA 2I45A 3OPWA 4NIIA 4XFIA 3RI9A 3WLUA 4C90A 1RUJ1 2DUPA 2ET1A 3R0RA 4GKYA 1LOCA 3D0JA 1NXMA 3SH3A 5A1FA 4XFFA 5CKMA 4OZXA 1BCXA 3HNBM 1JZ7A 4CDXA 3WG2A 5F9TA 1SLCA 2WN2A 3KV5A 3WNKA 3CZUA 2ID4A 2RMU1 4LQRA 2Y6JA 2E53A 4JVAA 4KWLA 3WEZA 3OY8B 4YM3A 3SQOA 1UWWA 1D4M1 4YPJA 4RFRB 5B4NA 4PHZA 5BYNA 1ZA4A 3IMNA 1BBT1 2ZXQA 4LHSA 2G9ZA 3U78A 3G7DA 4MVTA 2HEVF 4ZHNA 4QX5A 3RJRA 1FMD2 5FV3A 5FY8A 2IC1A 5F6LB 1NYWA 5A3PA 4I2OA 1LNSA 2VO5A 3HQRA 5FIXA 1GBGA 4BXFA 1PM4A 4DXSA 5FYSA 1BJQA 1EYBA 1G9DA 3W9AA 5A33B 3HIFA 4QKDA 2C26A 2W1SA 5FYTA 4MV2A 1SBEA 3B02A 3WF1A 2WZR1 2VMIA 1TEIA 4IEPA 4OLLA 1A8DA 1UOGA 1JI6A 2P5BA 2QCSB 3A0NA 4QPGA 5KXBA 1X36A 1VR3A 3MIGA 5LY2A 4IDZA 4MH0E 3GJAA 4CE8A 1VPHA 3JB4C 5K9YA 2BWCA 4XFHA 4XFAA 1DZRA 2JG9B 3RI8A 4JGYC 2ZGPA 4LBQD 3BTXA 1YLLA 2RHPA 5FZ0A 5FBJA 1QJX1 1RITA 2AGSA 4JQTA 4YLZA 2QQVA 2OZJA 3ASIA 5IK5A 2JG9C 3RZMA 1GOFA 3ZPOA 3PVBB 1GMMA 2ZGUA 1IS6A 5EQUA 4OI0A 1QOOA 2PHWA 3OYWB 4UXAA 1ENQA 3WX5A 5FMDA 5L9RA 1QQP2 3AZXA 1UYPA 2JEMA 1G9AA 5GZFA 3CMGA 4QQHA 5HV0A 2OYZA 1R1A1 5F6KA 1KFUL 4I01A 4LO8A 4R8HA 2IZWA 4IGPA 5DAVA 5ANQA 3UGHA 2D7FA 4Q1RA 4QX3A 3UETA 1WLDA 3WG4A 5GZGA 5I0RA 4DIQA 4XCAA 2WC2A 4XFBA 3WNXA 1QDOA 4OHYA 3I8TA 1VBC2 3D4KA 3ES4A 4QMAA 5F5AA 4BIFA 3POYA 1OD5A 1NA1C 4L99A 5T5PA 3VBRC 1HKDA 4Q5OA 1GNHA 2ZX4A 1K42A 1OKOA 2JDMA 2BERA 1YHFA 2YMZA 5LA0A 1GKBA 3H7YA 3WT3A 2Q1ZB 2JWPA 1ND2B 3ZN4A 1IPKA 4JGYA 4GB31 5CFCB 4H3WA 3AYCA 4AE2A 4Y33A 4OUMA 2NQYA 3E97A 2XR4A 1CJPA 2B9UA 2YFZA 4IE7A 1ND2C 2HBTA 2HJIA 1C3HA 4XETA 4CCOA 5SV8A 5CFCC 3RZHA 4LHKA 1KITA 4K1ZA 3RZZA 4HMZA 4NRQA 3P3NA 5D21A 3BVCA 5CISA 4EYUA 1A78A 2VBDA 3HNMA 4YWAA 2NMNA 4DXRA 3V0AB 1S0IA 3LEKA 1MS0A 2Y0IA 4BK5A 1NQJA 4GA9A 4META 5ACA2 5D8AA 5JXJA 4NIGA 4MGTA 2PLV2 1Q8VA 1EP0A 3WP5A 3BIWE 2D6KA 5GZEA 4F83A 1I5ZA 2VNOA 3H8OA 3ZIWA 1CAWA 1F35A 2W39A 4XFGA 1G9FA 3W21A 4BDVB 2HWE2 4CDWC 1S2KA 3GHNA 4HK9A 3OPTA 1NA1A 1W2UA 2RR13 2P1BA 1ULPA 2XJQA 4LMFA 3WVJA 2BPA2 4DRVA 2JXAA 4EN9B 3TYJA 3VBRA 1E57A 4PDWB 1ZM1A 1UX7A 5EFUA 4AXOA 4CUCA 4I30A 2VCCA 4UI9L 2X5IB 1OD3A 5C9AB 2KR2A 1QKQA 3WF4A 3CO2A 2CTVA 3IWZA 3ZDSA 4FVVA 3V65A 1O5LA 3RZGA 1Q8PA 2YUEA 1UN1A 2B42B 3NV2A 1O8PA 4ZPIA 5FMOL 3T3YA 3USSA 5CG8A 2BP6A 2ZHLA 1ND2A 3ZKUA 4NIDA 4LBJA 5CFCA 1PVC3 4PIXA 3ZR5A 1ZZ9A 4AG4A 2VXRA 4F7ZA 1W05A 1EPZA 3C7FA 4P14A 2YXSA 4YW6A 4URAA 3POBA 3BIEA 1Z7S1 3IZOA 4CRQA 2V4VA 3DXTA 2R7EB 3H3UA 3LOIA 4XBLA 2K46A 2KA3A 2GAUA 1QJFA 3POFA 5FZAA 2KXLA 1AL22 4OUSA 3TBDA 4BQYA 1GP5A 1JUIA 3LA2A 3QD6A 1IS5A 5IFPA 1XNAA 2C24A 3ES1A 1O3SA 5EWSA 2R072 1DDLA 3N9MA 4QKFA 1UU5A 2JE7A 5FYBA 4CDWA 4KGGA 5IJRA 1V6MA 4J1XA 2ZMKA 5J96B 4N43B 4Y5Z0 5BXXA 2P4EA 5HBAA 5DMYA 3IIIA 1RB8G 1TVGA 2LM3A 2VUJA 1JYTA 4NE9A 3IB3A 4XURA 2ZGLA 2V09A 1AXYA 1F5FA 1RUF3 5DG1A 4RFT0 4CTEA 3MICA 1AX0A 3TB0A 3HWJA 3AKSA 5C3QA 4DFSA 1W2TA 3LIHA 1PMIA 4CDUC 4LIVA 2VZQA 1X9TA 1VBD3 3HPNA 4XBNA 1YI9A 1KXGA 1NX9A 1QH6A 4OUEA 2C9AA 5JXIA 4N90A 4BPZA 1LKNA 2ZJCA 2XJSA 4AEKA 1DGRA 4K8FA 3NSTA 3C8XA 2Y33A 2ET7A 4OVEA 4ATFA 4HN0A 5FYMA 2BBAA 1GWKA 3MIBA 3VZOA 1W0PA 2BFUL 4RL7A 4P9GA 1ODMA 3JD71 1HRI1 3WP3A 3U0ZA 1EUTA 5CB7A 5A3LA 3CBNA 2PHRA 1Y4WA 4G9SB 2UYAA 2R0HA 4E8CA 2WO2A 3SC7X 4BQ2A 3T4HB 3L2YA 3BTAA 2XVLA 2FDKA 5FRAA 3TNQA 3I4IA 4KG0A 3O1OA 2HWC3 4LUMA 4LUKA 4XBQA 4YRDA 2ZKLA 3RQ0A 3IAPA 4PBOA 1YFYA 1LECA 5IK7A 2BTVC 2NLRA 2GNBA 4XUOA 3AMQA 2VCBA 4HPKB 2UY8A 5JOYA 5CNAA 2P3KA 2YBPA 1S0FA 2WFPA 5FY7A 1DQ4A 3PUQA 1QWRA 2CDOA 1OFSA 5FP4A 5FY1A 4FOWA 1EAH3 2WA3A 4CDUA 3RZJA 1J83A 3LOBA 3FZ3A 5J98B 1ZZ7A 5DDJ1 2F4PA 3RYKA 3MW2A 3UJQA 5FZOB 4J6GA 2R063 3RYRA 1RUOA 4AI3A 3LDKA 2QQKA 1LODA 1ZZ6A 2AACA 4BHPA 2JE8A 1AYN1 3C7OA 4LOSA 1RUH3 1AF9A 1GZCA 2PXJA 4DNYA 3K46A 1UU4A 1RUG1 3U14A 1F9KA 1KS5A 2RR12 4EN6B 5F3IA 1GQPA 2CY6A 1D0GA 2W08A 2Y60A 3I2JA 3J7HA 3WW1A 3MLLA 3WNMA 2QTWB 1G86A 4MYEA 2BU9A 1JOBA 4HONA 2QQMA 2SBAA 2FDGA 1UZZA 1OLQA 5EXOA 2OZ6A 4AVTA 3N9PA 3AB0A 4CP2A 4UAPA 4FT8A 3ZYFA 3AK0A 4FQZA 4DUXA 3I2GA 2R043 4K7JA 1MZ6A 5E6HA 1SDWA 1PVC2 4FXGB 4LULA 3TEZA 2R32A 5L9BA 3I2KA 3OGGA 4GMP1 2VW1A 4UFJA 3ZYGA 1BLZA 2D98A 3H0OA 4XE9A 1NUKA 1RUD1 2AZ5A 1MS8A 3FBMA 5FPLA 1AR63 2C6SA 3FLPA 3K48A 3AP6A 1OUXA 2GH8A 2W3JA 2Q4SA 1LEDA 3JBG1 3ZR6A 3POGA 1W0OA 2XUMA 4GKXA 5LBEA 5JOXA 1GWLA 5C71A 1SFNA 5LBBA 4BLIA 4G3YC 1VAVA 2E7TA 2VW0A 3J8F3 3AYEA 1ZRFA 3WDWA 4F8AA 4W6WA 3NNLA 4EZHA 4YZ3A 2HWD3 2X10A 5CKNA 4H55A 1CJDA 2PQSA 2HYKA 3QCWA 3S6PA 2J1SA 5JCTA 1WLTA 5KHJA 1RUE1 1RUF2 1TMF3 2P17A 2YY1A 1LULA 4BISA 1I3HA 4OI1A 1HRV2 4KL1A 4TLFA 3OBZA 4EWEA 1R081 2XONA 4PLNA 3GHMA 2CU5A 2DU1A 1DYKA 1VBD2 2J1TA 1DGWX 2YGMA 1SG3A 4BK4A 4DOUA 1AZDA 1FOD1 3A7QA 5BNOB 1MS3A 4Q4X1 3NJYA 2EXKA 3NNFA 1PHMA 4U2AA 1HB4A 1JN2P 1PIV3 4QX1A 5BNOC 5J3UA 1OKQA 1RXFA 1J58A 4HKWA 4XXAA 5G04L 3VDBA 4GWNA 4XMIA 3KCXA 4OZOA 5DABA 4K21A 1KDMA 3DYMA 1W9WA 4LO5B 4EJRA 1FXZA 2D3RA 2WO7A 2NMOA 1RJ8A 1NCQB 2BOJA 2DCYA 4NHLA 2C5DA 4GH4B 1TNRA 2I74A 3PMEA 4XQ4A 3KD4A 2IXHA 1QJY1 4FI9A 1OA2A 2HWC2 3O0WA 5T5JA 2Z5WA 2HWF3 2VBBA 4GH4C 1RUI3 3WXPA 5FY4A 3WNOA 2DCZA 4EN8B 5F37A 3EO6A 3H8RA 2G19A 3I97A 3LSEA 5A3TA 3J4UH 2FCTA 3KHCA 1W8TA 2X8KA 1WLWA 4HT1T 4IESA 5A3NA 1JYVA 1LENA 2JDHA 2GNTA 4E4DX 1EAH2 4QB2A 4NROA 4LE4A 4AI0A 4WZCA 5FZ8A 1LGCA 4ZXKA 4D0QA 1F4AA 4ARYA 2R062 5JSPA 2BVBA 4S2HA 1WGPA 1W3XA 4Q4Y1 4ZS2A 4B4QA 3BYWA 5F7UA 1BMV2 3RZKA 2QVSB 5A32B 4ZONA 1S4CA 5GJ6A 1IG3A 4XOGA 1RUH2 4Y24A 3LKJA 5F2SA 3RPQA 2VL4A 4BU2A 3ZFEA 1L3JA 2W52A 3QH7A 5JMCA 3EMRA 3PTRB 5FK8A 3JU9A 2EICA 1VLNA 2Z4FA 4AQ2A 1NG0A 1COV1 2XH6A 1BEV2 2JG8B 4KWKA 4CXWA 1IKPA 3W20A 2O1QA 3HQXA 3RGBA 4JX0A 4LLOA 4QAWA 5FK7A 2JG8C 1REFA 4JV4A 1PGL1 1HB3A 1PO23 5GALA 3SXWA 1LGNA 2R042 2EVXA 5FR3A 1N1VA 1AYM3 1K5MB 3NV1A 2WL1A 5FY9A 3TOJA 1ZBE2 1FPN1 1GWMA 2OT7A 4NHYA 4RS5B 2Q8DA 3CLPA 4UW4A 2VZVA 4OI2A 4TXWA 2OVUA 2ZKNA 1OLRA 4RS5C 4Z2AA 4YSFA 4XJUA 4IV1C 1RUC3 2WBKA 1XSQA 4J1WA 4AHXA 1AR62 3ELNA 4NO4A 4XJWA 1ULCA 4GXLA 4QKBA 3RS6A 4EE2A 2K9ZA 1C8M2 1GANA 4HBNA 3MHZA 2DUQA 5A6ZA 1H0BA 2OUJA 3WF3A 3ACFA 4AYUA 3DCQA 5C8CC 1ASJ3 3J8F2 2MEV3 3VKLA 1CX1A 1PK6C 4FPGA 4AQSA 1BYHA 1X7NA 4Q0VA 2JDUA 3QH6A 2YYOA 4N8MA 5BV6A 3IPVB 1ULOA 1DG6A 2V4AA 2WNVC 3AJYA 4YZ4A 1LB2A 2GDFA 2QJVA 4RHV2 1S55A 1D2SA 4KI5M 1O59A 4Z82A 1CR7A 1YQCA 1C57A 4AVVA 3OEAA 1NZCA 1QXJA 2A3WA 2VD7A 3ZSKA 2EF6A 2VQUA 1TMF2 3VD4A 1UPIA 2XQXA 1W6MB 4WM7B 5E1RA 1O4ZA 3SCGA 3WP6A 4CCLA 1PMJX 1NCRC 3GJBA 4FFHA 5A3MA 1EV11 2B39A 2RE9A 3WHTA 5JUVA 1CWPA 2VMDA 3PURA 4WM7C 2VTFA 1OMIA 1WLCA 3O0XA 1CQ9A 2H0VA 3UGGA 2BVVA 1VBA1 2Q8OA 2QQPA 2TBVA 5IT6A 4YM2A 1W99A 2JE9A 4RS5A 2BNMA 2Q8CA 1O4YA 5C4WB 4IV1A 3VBFB 1PIV2 1PGW1 4B3NA 4OYUA 4FPJA 3AMPA 4GWIA 5HXMA 5C4WC 1W8WA 5JIAA 3S5QA 1YRZA 4FXKB 2WSVA 1RUNA 2VMEA 5C8CA 1ND3A 1PK6A 3H1WA 3KZ4C 2VXJA 4ES9A 2QNKA 2WNVA 4CVUA 2RM23 2XXZA 3FHQA 5FQ0B 1MQTC 1PNFA 2HWF2 2C0ZA 4Y1ZA 5C6CA 5APAA 3MIFA 4A42A 1F5JA 1N3QA 2J1AA 4RGAA 2VOTA 4CCDA 2W46A 1G8WA 2ZMLA 4AEDC 1X8EA 3UESA 3T2QA 3QLQA 2VMGA 4QQ2A 1NCRA 1HQWA 4CCEA 4EZ4A 1HDKA 3IDAA 1W6MA 3O5SA 4WM7A 4DXTA 1GSLA 3PVOA 3UJOA 4DY3A 3DGTA 2F6BA 4P5YA 3ZSJA 1S0JA 4I09A 5A6QA 1V6LA 1ZBA1 4OCTA 2WRAA 5A7QA 2P3JA 2ORXA 1QJU2 1ACCA 3HOBA 3ST7A 4UT5A 1R093 3VBOC 5J1XA 2WT1A 4QPYA 3IN9A 5C4WA 1KGYA 3CU7A 1C28A 3UKNA 4HANA 1OVPA 3OBRA 1CAUB 1VRH3 1CAVA 3V64A 3T4VA 5FMCA 1CGPA 1GZWB 3H7JA 4D6QA 5A1LA 4B4RA 2Q5TA 2WNUC 4BQ1A 4GJYA 1ULDA 4ES8A 3LFIA 1MQTA 2BGOA 2ZEWA 5LA1A 5LWBA 3RG0A 2K0GA 1NE6A 1H8TC 2YBSA 4LBLA 3WUDA 3TEXA 5AFEA 4JRAA 4JRLA 1WW4A 1QMJA 5JR7B 5T55A 4AEJA 5FQ0A 4AEDA 2RS53 1G7YA 3TN91 4GWJA 1AYM2 1W9TA 1FYUA 2JDYA 2R1DA 3AC0A 3SH4A 3VBHC 1E5RA 3POSA 3R4UA 3OEBA 5DZGA 2ZS6B 1OF4A 3CIHA 3PU3A 4NVPA 5A80A 2EXIA 3HD8B 3PMSA 1IS4A 4Y4YA 4CDQC 2E26A 1MVQA 1V6KA 1RUC2 4BMBA 3EHKA 4EQVA 1EUUA 2DUOA 1E5SA 1RXGA 4LKFA 3GM8A 1RMU1 1XRUA 1CVNA 3VBOA 1JOPA 2VZ1A 3GYDA 5K0UA 1TME1 1V6OA 1PO13 3C3VA 5FPUA 2NM1A 2MEV2 2W2IA 3PL0A 2VVDA 5C8WA 1MZFA 3AL6A 5FLJA 5IWFA 5A7SA 1K3IA 2IXCA 4M3CF 5AC91 1TZOA 2QKDA 1YUDA 2WNUA 4G4FA 3Q9OA 1CAUA 2MNGA 4RQPB 2VBPA 3LPGA 1QDCA 2OPWA 1GZWA 3OUIA 5LZ6A 1VBB3 2YC4A 1H8TA 1ZREA 2ZX1A 1EPWA 5T5LA 4JKMA 3I49A 3AKPA 4RQPC 3CNAA 2ZEXA 2WZPP 5F5QA 5IK4A 1MACA 3MUY1 1PGSA 4KWUA 3H8UA 3VBHA 4BA6A 2ZX3A 4BH9A 4COWA 3KS7A 1GICA 2X29A 3M3QA 5JMOA 1YQ6A 2OIIA 1NLQA 3MV11 4CDQA 4D6RA 4D6SA 1J3RA 3CHXA 2W94A 1HJFA 1RUJ2 2WNEA 1AHSA 1M4WA 4NMIA 4TZDA 4XHBA 2WO3A 4ISQA 2PLV3 4B29A 2AYHA 3QBQA 4DEQA 5H9SA 4QPGB 4FPOB 3VD5A 2VQAA 5FO9B 3NV4A 2VOVA 4YW4A 4YG6A 2Z2SB 1LHOA 1ZZBA 4E2GA 5JSOA 1K45A 1RINA 1DP0A 3QOPA 2YC2A 2E6VA 4IE5A 1D4M2 1HW5A 2XJVA 1E5IA 4M4RA 3HJRA 4AGGA 2RM22 4E4HA 5DAWA 4JKKA 4P5HA 5L36A 4Z8BA 1O3RA 1BBT2 1VMHA 1W2NA 1CPNA 1SCRA 3AMHA 2ZCWA 4N53C 3THTA 4DXZA 3A23A 5GLTA 3VZMA 3J7LA 4UFMA 4MUVA 5FZIA 3EB7A 4UFIA 5HV4A 3K2OA 3ZSLA 4RQPA 2ZGQA 4GWMA 4FTEA 2WA4A 4YVWC 2C1FA 3HAGA 1H2NA 4QXCA 4CXXA 5J7MA 4ZU7A 4D7TA 1DQ1A 4AWDA 3DYPA 4FO9A 4QX0A 1ULGA 1UYYA 4H7MA 4MGKE 3DECA 3RJ2X 4ZKTB 1S1AA 1OT5A 1ULEA 4I0WB 5LRRA 4W65A 1VB2A 2E33A 5KXDA 5FUIA 2BUKA 2JDZA 3T2PA 1AL23 3GZTB 4HSJA 4XJ8A 1R092 5FLHA 3GBFA 3CKHA 1KDKA 2R073 1AR93 5FY5A 2ARBA 3SLIA 5FXWA 1C5IA 1SBDA 3MUZ1 3B94A 5I93A 4GZ9A 1VRH2 5CKQA 2JB4A 4CP1A 1C1LA 3LSDA 3NVCA 4JGYB 4NN0A 3D3AA 2ZACA 4XF3A 1QEXA 5BPXA 5FKCA 4R4XA 1W90A 4Q4W3 1XPWA 2RDRA 4UYBA 4X6QB 1WW6A 4N53A 2XKPA 1R1A2 4W8JA 3LA3A 1TE1B 3KT1A 4QGLA 2RS52 3ZYRA 3KQ4B 1JODA 4C0BA 4FOQA 2R16A 5A7WA 5J37A 1H30A 4BQ4A 2W9XA 4YVWA 1K5JA 2QZ2A 1KFXL 1HLCA 5T52A 3WNPA 5D8AB 1FMD1 4W4ZA 2FQPA 2PHTA 1HRI3 4LLFA 2A5ZA 3IT8A 1LU2A 1AR83 1NKGA 2O14A 3M7AA 4PI0A 1V6IA 1YIFA 2PAMA 3AYDA 4QPIA 4QM8A 4E4ZA 5A1AA 2DYCA 1CAWB 5D8AC 5L73A 4LHNA 3PDQA 5GZDA 1NA1B 2OUHA 4O9EA 4AHZA 5KC5A 5F8PA 2JIJA 5I0SA 3VBRB 4PF5A 2VZPA 4GB32 1QF3A 1PO12 4KQ7A 4AL9A 4MX3A 5FKBA 1QNWA 4ASKA 3JXSA 4AEMA 4Q4V1 5F5IA 3ZFFC 5FZLA 3DKWA 2JX9A 4YVSC 4UF0A 3MV01 4LO6B 4UW3A 2ZZJA 1H6XA 5T3NA 2B5HA 4BQ3A 3ZSEA 4KBZA 4KU7A 4GQ7A 5FFOC 1XE7A 1YJKA 2DCKA 1VBB2 2VOWA 2WLQA 1IHMA 1R1ZA 3OG2A 4C1WA 3LEMA 1W8HA 3BOWA 2YV8A 3BTYA 2GSYA 3NKTA 4A41A 3O12A 2JECA 1IS3A 4K6BA 5C3RA 3AP7A 1QQP1 3ON7A 4L11A 1PM7A 2P3IA 5IATA 5DAXA 4YNIA 4DQAA 3LAGA 5IAVA 2YZ4A 4IV3C 5FZGA 2Q8EA 4E2SA 3HT2A 4LPLA 3N7JA 3NW4A 4EROA 2WINB 4ORFA 2E63A 2TEPA 2A71A 2ZHMA 3AMMA 5BNNC 4CDWB 2PFWA 3BGAA 1VBC1 3NV3A 4LTAA 4YM0A 1SHWB 2EXJA 3RMXA 3IKWA 3LD8A 4P9JA 4CU9A 4R9DA 3FBYA 4JTOA 5EYYA 4KGQA 3FWEA 2D97A 5J36A 4NHXA 5IW0A 2A6WA 2WO1A 4P00B 4AVCA 4KU8A 5CAZA 3DPRC 3MYXA 1BKZA 2HYXA 4B7EA 2FCVA 4RN5A 4AFBA 3ZFFA 3TWIA 5LBFA 5FZ4A 5DZFA 4YVSA 4BJ0A 5EHDA 2W1QA 1H8VA 2YG0A 3PUIA 4UBGA 3VHNA 3WY6A 2E51A 4A2UA 4IETA 5DUWA 2GN7A 3AFGA 3HMYA 3DXUA 3BU7A 3GBWA 5KHKA 3TRSB 3WDYA 4MHRA 2BEOA 1GOHA 2OXBA 4E9KA 3H8XA 4IE6A 5FYYA 3UKTA 2YROA 1MR5A 3MW3A 3ZYBA 4Z07A 5ACA1 4IV3A 2QQNA 5JDBA 4GAZA 2Y6GA 1XYNA 4XFCA 4UWDA 3N9QA 3WZ1A 2W5FA 5BNNA 5A3WA 2LRPA 3I3MA 4MO3M 2HWE1 1RUE3 1AR92 3MFCA 1AR73 2R0FA 3OGVA 3GCXA 1DZTA 5I0TA 2EIBA 1ZRCA 2CL2A 3PVEA 5KXCA 3DPRA 2QQWA 4LE3A 4LOTA 3ZM8A 4CA9A 5CBLA 3APBA 3VZKA 4CPBA 3KVBA 1RTVA 2ETEA 4IGOA 2ZTNA 1IPSA 2VGDA 1J84A 3MZHA 4Q4W2 1H1AA 4Y22A 3FFQA 4CDUB 5FZEA 1O4TA 1QJEA 3AZVA 2RJ2A 1HRV3 2OA2A 1G6NA 3GZUC 3MIEA 3AL5A 5JPNB 4TTGA 3WHUA 4CXYA 1RC6A 1W2AX 4XHXA 3U4SA 5E88A 3J7NA 3I54A 2HWB3 4LBNA 3GF6A 5A70A 5K8SA 1U5XA 3NMBA 1HRI2 3LZZA 5LA9A 4Z2WA 2Z42A 1AR82 5EYXA 5I91A 3OF1A 3ZPYA 1Q56A 4FAHA 3RZLA 3R6SA 4E2QA 1SZBA 3S7EA 3SITA 1W6OA 3ZXAC 4EN0A 1AUYA 1GR3A 5LEKA 1LEMA 1VAKA 4BQWA 3HQUA 3TEYA 4XF1A 3MI8A 3JZVA 3B7MA 5FXXA 3ZKYA 3ZX7A 1V0AA 4MZUA 4FFIA 4UFHA 4C91A 1MS1A 2QZ3A 5KXEA 4UBHA 2BV4A 1HB2A 2RS33 4IERA 3UKVA 4ASLA 1DHKB 2IFRA 2HEWF 4BLJA 1ALYA 5DG2A 4HSLA 5CA6A 2V5YA 3I2OA 3POJA 1BHGA 4HG6B 1C8NA 1UZ0A 3M3IA 4XJZA 5I8YA 1GQGA 2A6YA 5LASA 2D5FA 5A3OA 1O8SA 3RSJA 1H1IA 2GMMA 4MGQA 5SV5A 1XNBA 2FHRA 2I2SA 4XTPA 4AF9A 5FZHA 3WF0A 1GNYA 1WBLA 2XBO3 4W50A 3URFA 2RDQA 1A34A 1ZRDA 1DCSA 1F15A 3FFZA 1N1SA 3BB6A 2DVBA 1SACA 5IK8A 4NR1A 1BQPA 3W5MA 1S0GA 1TNFA 3HN1A 2E9QA 2VZTA 1VIWB 4QQPA 1HQLA 2YHJA 1Q43A 1CIWA 5DUUA 1POV0 2JICA 3ILRA 4DB5A 3UYJA 1BVP1 2QUOA 5F3EA 5L9VA 1HB1A 2AEZA 4Y1YA 3UNPA 2IWGB 4DY5A 1UIKA 4M4PA 3W59A 3ACGA 3VZLA 1T6GC 2YBKA 1WCSA 4DEVA 3S0MA 3KB5A 1WCDJ 4ZZ8A 4K40A 1BEV3 1CESA 1UOJA 2PAEA 2GC3A 3L9JT 4PIYA 1H1MA 3VDAA 1BXHA 4IEVA 3S30A 1XSRA 5D1IA 1JTZX 2Y6KA 3MF9A 1MPXA 4AVBA 4UOJA 3RVHA 1WCKA 4ZS3A 5FZKA 3GDBA 1WW7A 1MS4A 2GALA 4H2AA 3FJSA 3R4SA 4XXPA 1CD3G 1ZBE3 2PHUA 3JBG2 4PQQA 2BRTA 4LKSA 2XB6C 3KQRA 1YYNA 1U5ZA 2JD9A 3GZEA 2A70A 3GNEA 4R4ZA 5KBFA 2WR9A 1WMXA 1UMZA 3EXUA 1A3KA 1IPJA 4AI9A 5L7OB 3M3CA 3E5XA 1UX6A 3N4MA 5FAXA 4DUWA 2GZWA 3FHIB 2E32A 1SQ4A 1C8M3 1RUE2 3H1YA 1AR72 1KJLA 2RR11 3T1MA 1AL0G 1LGBA 1O91A 4QGNA 4A44A 2WFF3 2DFBA 1XNDA 2JKBA 1WW5A 5I8SA 4AGVA 5JOWA 1L7RA 4EWDA 1RVF3 3N3HA 4NUBA 1JUHA 4RHV3 1D2QA 1N3PA 2OQ6A 4URTA 2XWBB 2VE1A 4PT6A 1W8OA 3KMHA 2WT0A 2W87A 5T54A 4E27A 2B7YA 1S2EA 4IW3A 3OTFA 2RVAA 2OX0A 1DGRN 1WMFA 4WM8A 1YJLA 4COUA 5JI7A 2E31A 4JDNA 1PVC1 5F1RA 1C5HA 1XBFA 3SCFA 1WA4A 3KHBA 3VLBB 1OA4A 5FZFA 2HWB2 1HIXA 2A3YA 1QU0A 4FPEA 2DDUA
chains in the Genus database with same CATH topology
2WS93 5FCCA 4K20A 4PJYA 3ZO0B 1QXRA 3NO8A 4NPRA 1JOJA 1Y9QA 4MSVA 3ZFEB 4INDA 2RS13 4YW1A 1V9U1 2A7AA 2ZGOA 5JZGC 5FMOS 2K2SA 3VHRA 1HXS3 3ZFEC 4YW5A 3OBTA 5KWRA 2VNRA 2CGPA 1O7FA 2RS32 4RGGA 2UYBA 4N9HA 3U10A 4BIOA 1LR5A 4C0HA 2YDEA 3E5QA 1RUF1 4KG8A 4X8NA 2VUAA 2VY0A 3ILNA 1N3OA 4I3GA 1JYCA 3CJIC 4Q4Y2 1VBD1 4NHKA 3IM0A 2BNNA 2XBO2 3BOPA 4JGZC 3AZWA 1X50A 1JHNA 3M3OA 1IOAA 3NAPC 2DURA 5B2GB 1CN1A 1SMVA 4RSUA 2GC2A 1DYPA 5BY5A 1DIWA 1QJU3 1YI7A 3GZAA 1RHI3 5JZGA 4UW5A 1OQ1A 2LALA 2BWAA 4TYSA 3ZYJB 5LRSA 3TN93 4M01A 5BUVA 2BYVE 4LBQA 2HWC1 3BCWA 3WCSA 4QQLA 5KHGA 2PQQA 1SFYA 3AKRA 3PTYA 3X29B 3H3ZA 3VL8A 3HBZA 4N7IA 1ZX5A 1JW6A 2A6VA 3USUA 2BFUS 2D93A 5JLVA 1WD4A 3CJIA 2OPKA 4BE3A 1EAH1 4XF4A 3OGJA 3M1HA 4JGZA 2CV6A 4IV1B 4LBOA 1GFF2 1RGSA 1UIJA 4IL7A 2CNAA 4KH9A 3B9IA 3NAPA 2OW4A 4LNVA 2YGLA 3ZXKA 1BMV1 4R52A 4DPNA 4QD2A 1V00A 3E5UA 1RUH1 2XL9A 4AHWA 5C8CB 1O3QA 1ND3B 1FI2A 1PK6B 2B45X 5L19A 1LRHA 2WNVB 1XE8A 2WFF2 1ND3C 2GU9A 4V1PA 3TAYA 3WD5A 5HI0A 1MEC3 2FMDA 2QE3A 1RVF2 3PJYA 5CU1A 2YPJA 3WDVA 2WKKA 2G9FA 3J9SA 3FMGA 1BZWA 1NCRB 1U5YA 1VBA2 4GULA 1W6PB 1YFUA 2R041 5DZEA 1XXNA 1ZRRA 1PGW2 5BNPB 1N47A 2CAUA 2V73A 4TWTA 2GNMA 2ZX2A 4WVMA 1S0EA 1ENRA 3RNSA 2WS92 3VZJA 1IZ3A 4IQPA 4YGCA 5BNPC 2O0OA 5JOZA 4D7SA 4XPVA 1AR61 1OPOA 2UU8A 3T1LA 1RUJ3 2ENRA 2VQ0A 1EY2A 2GNDA 4FSJA 2DU0A 2JENA 2RS12 4N9IA 3MIHA 1CAVB 2AH2A 2VECA 2IXJA 2NYYA 3AMNA 1HXS2 3INAA 3J8F1 4K3UA 1O3TA 2RMU3 3ZN6A 3WW2A 1MQTB 3B3QE 3ZXDA 2PHFA 2HWD1 1D4M3 4R9CA 1Y43B 3WINE 2ZHNA 4W6XA 1YFWA 3WCRA 4AEDB 1BBT3 1OFNA 1TMF1 5HCFA 1N1TA 3LA7A 3JCIA 2JJ6A 3V0BA 3FLRA 3MPBA 4MXWA 4M3CA 3O0VA 3RDIA 1J3QA 1W6PA 3IBMA 5FO7B 1LHUA 1PNGA 5FLIA 1A8MA 3LGRA 3MEPA 1HX6A 2D3SA 2TUNA 3OD4A 2WZR3 3MLJA 5BNPA 4YFWA 3PLQA 4A7KA 3BPZA 1PIV1 4COZA 3VBOB 1DQ0A 4YYOA 2XVGA 5K0UB 4JCKA 2CGNA 1DGWA 1H2KA 1RHI2 4XF0A 4OFGA 5K0UC 1SLTA 1DBNA 1QJX3 3I59A 4FPLA 2VOKA 2R6QA 4M00A 2WNUB 2IXKA 5H9PA 3TN92 1A6CA 4S2GA 4XMAA 3VHPA 2VVFA 1H8TB 2HWF1 5BNQA 1RUI1 4P9YA 4RR3B 4X8PA 2PYTA 5GKAC 3ME2A 3AP9A 1KRIA 5FO8B 3B69A 1FNZA 5FTTC 4RR3C 4XQDA 1B35C 1R1A3 3VBHB 4YFZA 1LOGA 1ZNPA 5I0UA 3TNPB 3WV6A 1OA3A 5C33A 4ASMB 4CDQB 1MZ5A 3NL1A 1Z0HA 2DVFA 5H9RA 1TME2 4X6RB 3VDDC 2AR6A 4AFMA 1OI6A 3ZXLA 1DQ6A 2ZGKA 4WBBA 1HV0A 2A3XA 2H0BA 2VMHA 3ZYIB 4CYDA 5GLUA 4MGIE 4FPHA 3SH5A 4GB33 4LBMA 1LOEA 2XJRA 3SNMA 4YZ5A 3VL9A 1MEC2 3D6EA 4Y20A 3RWNA 3CJXA 3ENRA 2WQZC 5DXDA 3RMYA 4E4SA 2NN8A 2EIGA 5CFDC 5E16A 1PO21 1UZYA 2BBVA 2IFWA 1FV2A 4RR3A 1AYM1 1B35A 1OHFA 3QACA 2VULA 3P3PA 3AKTA 5LK7B 2EALA 3NWKA 1QOTA 3EJKA 1NY72 1W6QB 4XYXA 4IEUA 4SLIA 3DUIA 2LTNA 3A0KA 1RUC1 2WT2A 3VDDA 1X82A 2ZAHA 3ZVXA 1MS5A 1J1TA 1GNZA 4LO4B 4L8QA 1LCLA 4M0HA 4JAAA 1XQNA 3SISA 1ASJ1 2MEV1 3MLKA 4AQ6A 2RMU2 2WIIB 5T50A 2VW2A 2WJSA 1POV1 1SBFA 2MHFA 2W68A 4N53B 3WW4A 3MDPA 2D6LX 1FX5A 1VP6A 2UY9A 4EWAA 5CFDA 1PZ8A 4WVVA 1Z7S3 3VHOA 3B5LB 4YVWB 3D8CA 5AVAA 2R30A 5LK5A 4QPIB 3VV1A 5K7PA 4LO7A 2WZR2 3N7MA 4QPIC 4KWJA 4FP3A 2AREA 3IDCB 1F31A 1VBE1 2Q1MA 4Y1UA 1W6QA 1X8MA 3MFAA 4UW6A 4PIZA 4WVWA 1QJX2 1AX1A 2Q30A 4I02A 3B93A 3LWCA 4OULA 2DCJA 5I8TA 4HK8A 4N7UA 2RM21 2N7GA 1YIPA 1ZVFA 3WW3A 2FBEA 5GLVA 4QQOA 1G9BA 2D43A 4AHYA 2YC0A 3VBSB 4L97A 1C4RA 3SHRA 1REDA 3A4UA 4IEYA 2DTWA 3VBSC 3JD73 3AJZA 4XEZA 4Q4V2 4JC1A 3AX4A 2VOXA 2XLGA 1JXNA 1I9RA 1R091 4P9IA 3THPA 1LOFC 2EAAA 3ACLA 3JQXA 5AVPA 2ERFA 1URXA 4PLMA 1B09A 1VRH1 3ZFFB 1J3PA 2GN3A 2AENA 4YVSB 3MIDA 2PTMA 3I7DA 3OD0A 2XJPA 3OY8A 4CZSA 3WR0A 1DQ2A 4COVA 4COYA 1Q5OA 1LHNA 3DF0A 5DDJ3 1GQHA 2RS51 1BK1A 5CIRA 2ZZQA 4IV3B 4OHVA 3K51A 3FLTA 1AYN3 2UURA 2ZHKA 2Q0AA 4GALA 1IQAA 1DGLA 3RYPA 1FNYA 3VBSA 4Q8KA 1RUG3 3ALQA 5A33A 2WQ4A 5BNNB 1NOVA 2D6PA 3VUOA 4HKOA 3N7KA 1ZZCA 2ZGRA 3WDXA 3ETQA 3LB9A 4D3WA 5HCBA 1FT9A 1U12A 1LOFA 3VGIA 2ZMNA 1PO11 3DPRB 4FCAA 1MS9A 4D94A 1QXPA 2PN5A 3AKQA 2I07B 1SLIA 2JG9A 4BCUA 3BALA 4Y22B 4EN7B 2VH9A 4LBKA 3M2MA 4S2FA 1VBB1 1GLHA 2DTYA 3OYWA 2ZOEB 1Z7S2 4GMP3 5JI9A 4ISRA 4XZPA 3S7IA 1RUD3 1LOBA 2XGXA 5FOBB 4Q0QA 3M3EA 3ZXJA 1Q8QA 3JBG3 1UU6A 5KHIA 1W6OB 1DLLA 2R49A 1JYIA 1AXZA 4A7YA 4RD7A 2PLV1 4YGDA 2XKOA 4BOWA 4PDWC 4QU2A 5ABJB 2O8QA 4Z92B 2BQPA 2P2KA 4Q29A 2ATFA 3MPPG 1XNKA 2X5IC 5C9AC 3PJQA 4FP2A 5ABJC 2ZBJA 4AW7A 1R083 4XJ9A 1ZZ8A 1F2NA 1DU3D 3H9AA 2DV9A 3CEWA 4HVQA 5KC6A 4HVRA 4LR4A 3WG1A 1FOD3 3AP4A 1MZEA 4Q4X3 4HETA 4MGYE 2PA7A 3WQ0A 2QDRA 3SCHA 3V0AA 4H14A 1W39A 3VKNA 1AJKA 1V9U3 3N7LA 3T2TA 4DINB 1YFXA 2B46X 3JD72 4FOYA 1UAIA 4HL0A 2RJKA 3WQ7A 4I3PA 4FQ4A 5KHHA 3AZYA 4L9BA 4FBFA 2WLPA 1LU1A 4LHLA 2RJLA 4XDQA 1AL21 3VZNA 1QJY3 4N43C 4AQTA 4DS0A 2R071 1AR91 3DN7A 2LUWA 4PDWA 4ATEA 4IXLA 2A6ZA 4KBBA 1J59A 2D3PA 1WD3A 3OJBA 2X5IA 4B8EA 5C9AA 5ABJA 1Q8OA 2ARXA 1KJRA 3AYAA 1JH5A 2P37A 5GLWA 2XVKA 1RL3A 2XL7A 4LT5A 4Q4W1 1VB4A 3KT7A 3MF6A 3MW4A 4K9SA 4YW2A 1FAYA 4HLTA 5DDJ2 1IGOA 4OHXA 4QHBA 1O5UA 4B7KA 4FOVA 4Q4Y3 4Q8LA 4O9GA 1UPSA 3IIAA 1AYN2 1WMEA 4IEQA 3N36A 1AR81 1S2BA 2PHLA 3KT4A 2Y38A 2DVAA 1RUG2 4PLOA 2ZGMA 2ZPXA 2BGCA 3FE5A 1COV3 2ZAAA 1YXWA 5CADA 3ATGA 3KSCA 3ROUA 4N43A 1CPMA 4BM8A 5J48A 3LCPA 3ZMNA 3U07A 2WSUA 2W0XA 4XQWA 1LOAA 1J1LA 2DVDA 4IEWA 3ZSMA 3E6DA 4XIOA 1S0DA 1SLAA 2XWJB 1FPN3 4I0BA 3G6JB 4WM8B 4CP0A 3FUQA 4P9XA 1YO8A 4YG3A 1WUVA 4WM8C 4ZU5A 5FPZA 1RUD2 4FPCA 3AP5A 4XILA 1UF2C 2XLFA 1HV1A 1ZYBA 4LEJA 1FATA 1UD1A 5GLZA 5JWPA 3GBGA 3VKFC 2G4IA 4HN1A 3D0SA 3ZFGB 2D6NA 2FZ2A 3WG3A 1OQEA 4HVOA 2B8MA 4RA0A 1QJZA 2GMPA 5HCAA 1R082 1UKRA 1EV13 2UWCA 3ZFGC 4HPKA 4JDOA 1QH7A 1SLLA 3R4DB 1AXKA 1FOD2 1YWKA 1KQRA 3SMHA 1VBA3 3DV8A 3VBUB 4Q4X2 5JIUA 1VAMA 2A73B 1OQDA 3CF6E 1N1YA 4R9BA 3VBUC 3V56A 1V9U2 1DFQA 3EBRA 5EJ3A 1OPMA 2G9GA 4I0AA 1V6NA 4WVZA 3WQ1A 5JZGB 5GZCA 1CX4A 1LJ7A 1PVXA 1QJY2 4FPYA 4JDMA 4SBVA 4YGBA 2KM2A 3ZN5A 5AFBA 1DQ5A 1AR71 3ZXEA 5JAXA 1Y7BA 4LBQB 3PHMA 1YCIA 1D4VB 2E7QA 4R9AA 2AUYA 4Y1VA 2NZ9A 2UWAA 5JSRA 1REEA 3B00A 5DUVA 5HXVA 3ZFGA 5FPXA 1SCSA 3USUB 3MGUA 1I6XA 1DZQA 3CJIB 5CVRA 3ZIXA 2P34A 1HRV1 1H9PA 2D6OX 1M06G 1NXD1 4JGZB 4NHMA 4PCRA 1ZBA3 1AVBA 4YM1A 3U4XA 1QNYA 3ZMOA 2O8OA 5LEJA 4FPFA 4M3CE 2HWB1 3NAPB 4HZFA 1Z78A 4FPKA 4NWVA 3VBUA 4BWOA 4KNCA 4NOTA 3C2UA 5EZWA 4TSVA 4AI1A 1UW8A 3WP4A 2QFEA 1NCQC 2D44A 2WWSA 1COV2 1QY4A 4QXKA 1AJOA 3E6BA 2HEYF 3VKOA 1UCXA 3D5OA 5EV7A 4Q27A 3HR9A 1H9WA 1PGL2 5TSWA 2RS31 3PVNA 1LTEA 4BMEA 1RJ7A 1YNAA 2H6BA 4ONUA 1FPN2 4A3XA 3M70A 4L2NA 3PNAA 1X33A 3N35A 1S0BA 2PAKA 1BVVA 3GALA 2VPVA 4F3JA 1V70A 3OPZA 4JTNA 5E89A 1QGLA 4WVMB 5BNOA 4HKLA 2XBO1 1DF0A 3UV9A 4L92A 4Q0UA 2CYFA 3KCYA 3OCPA 4Q2FA 1RIRA 1RMU3 2ZGNA 1QHDA 3JUUA 1LESA 1TME3 2XHKA 2R061 2GC1A 1NCQA 4QM9A 2GMEA 5AC93 2NPIA 3IDBB 4BZ4A 4GH4A 3ZN6B 2ZGSA 1GYKA 1FV3A 3W58A 3R05A 1ONAA 4PQ9A 1GZ9A 4IEOA 1BEV1 4WV8A 1EV12 2DVGA 3O14A 2D40A 1F8VA 2ZGTA 3V0BB 1K5MC 3D82A 4MXWB 3UL2A 4M3CB 2JD4A 2XPJA 2MPFA 4AI2A 4EV0A 1ZBE1 4XW3A 4CEWB 3AFKA 4LA2A 2PELA 3AZZA 4MGZE 1S0CA 1ENSA 5A32A 3H1MA 4CEWC 3CL1A 2UWBA 1XYPA 1Y3TA 2ILMA 1H4HA 2CAVA 1POV3 4ITCA 2HWD2 1D0HA 1GV9A 3I59B 1I1EA 5L7OC 2D5HA 2BNOA 4XIKA 1C8M1 2FMYA 2JG8A 2WFF1 1WBFA 1HQNA 3POWA 1VJ2A 3WDTA 4OHWA 3U11A 4U36A 1RVF1 4RHV1 1AX2A 4Z1VA 3EQEA 2QDNA 4A7ZA 4AVAA 2SLIA 1LHWA 4ZU4A 2Y26A 4YG0A 1K5MA 1NLSA 4D7YA 3M8LA 4DMIA 4YZ2A 5DUXA 3VN4A 1Q3EA 1W6NB 1VBE3 1ZBA2 3B01A 1C1FA 1Q8SA 1H2MA 1XNCA 5H9QA 1H2LA 3VBFC 2WS91 2VU9A 4GIQA 2BW8A 3FC0A 4DRRA 2Z79A 4OHZA 3WUCA 1UL9A 4CEWA 2RS11 4P9LA 1U5IA 4D69A 1KS4A 1V6JA 1RUI2 3UK9A 2VG9A 5IUQA 5L7OA 1HXS1 2ZABA 4BYYA 1NLRA 3IPVA 2ES3A 3J26N 1OSGA 4Y20B 3AXEA 2VVEA 3M4FA 2CWSA 2E7AA 2PHXA 4H7LA 4Q26A 5FDBA 5E8AA 5J09A 4AFCA 3O7OA 2HKXA 1B35B 2H6CA 4AFDA 1FMD3 3ILFA 1CAXB 3H50A 3E6CC 2DWRA 2ZA9A 4QGMA 3NJZA 3HT1A 1OOPB 2X53S 3KGZA 4QT6A 1SLBA 3VDDB 2PHDA 4LA3A 1RMU2 1PZ9A 3VBFA 2GH2A 2DF7A 1W6NA 2D6MA 4AFAA 1OOPC 3FX3A 4Q0SA 4Y26A 1CONA 1NE4A 3ZXFA 3I2DA 4Q4V3 1QJU1 5FOJB 2DCTA 1TQ5A 3L2HA 2XLAA 5GM0A 3WDUA 1RHI1 3KLSA 5AC92 2Y0OA 4M0NA 5T5OA 2R1BA 1G9CA 2NP0A 2XJTA 3KGLA 1PO22 2XJUA 5FBZA 1LHVA 1XU1A 4YW3A 4FTBA 1NQDA 4GMP0 5CFDB 1APNA 1ENXA 4MXVA 4PBPA 2XG3A 2CWMA 1PZ7A 1QQP3 4IEZA 4JQRA 1IKQA 4MLOA 4B4PA 1XYOA 4CEYB 4S2DA 3AXDA 3DL3A 3WOGA 4AK3A 2ZX0A 1VALA 2IXLA 3JB8A 4CEYC 4K1YA 1CAXA 1VBC3 2EXHA 4YGEA 3ZXGA 4Y1XA 1ASJ2 3ECQA 4CDXB 1OOPA 2VNGA 5FREA 3VKMA 2DFCA 4FAGA 3FUOA 4XF9A 4Q0PA 4YARA 2FZ1A 4CDXC 4XJAA 3JQWA 1SEFA 3IDEA 3KM5A 4IEXA 5JPMB 4YZ1A 3AM2A 2A75A 1H4GA 1XU2A 4W6YA 1U0AA 1MEC1 4NWWA 4AVSA 2TNFA 4AI8A 2EAKA 4Q1PA 2A6XA 1JBCA 3KCCA 2GC0A 3B9CA 2EA7A 4P9WA 5JVVA 5ACA3 1ULFA 3NKGA 4OI4A 3RRDA 4C1XA 1VBE2 1KD7A 1MVEA 1WMDA 3BODA 2IXIA 2Z69A 4FTSA 4XTMA 4CEYA 2CGOA 4WZFA 1QOSA 1NY71 1UKGA 2HWE3 3ZYPA 4HFSA 4QPGC 4DZGA 2I45A 4XFIA 3RI9A 3WLUA 4C90A 1RUJ1 2DUPA 2ET1A 3R0RA 4GKYA 1LOCA 3D0JA 1NXMA 3SH3A 4XFFA 4OZXA 1BCXA 4CDXA 3WG2A 5F9TA 1SLCA 2RMU1 2E53A 4JVAA 4KWLA 3OY8B 4YM3A 1D4M1 5BYNA 1ZA4A 3IMNA 1BBT1 4AVVA 3G7DA 4MVTA 2HEVF 4QX5A 3RJRA 1FMD2 2IC1A 5F6LB 1NYWA 4I2OA 1GBGA 1BJQA 1EYBA 1G9DA 3W9AA 5A33B 3HIFA 4MV2A 1SBEA 3B02A 2WZR1 2VMIA 1TEIA 4IEPA 4OLLA 1A8DA 5KXBA 2QCSB 3A0NA 4QPGA 1X36A 1VR3A 3MIGA 4MH0E 3JB4C 5K9YA 2BWCA 4XFHA 4XFAA 1DZRA 2JG9B 3RI8A 4JGYC 2ZGPA 4LBQD 1YLLA 2RHPA 1QJX1 1RITA 2AGSA 4YLZA 3ASIA 2OZJA 5IK5A 2JG9C 3PVBB 4OI0A 2ZGUA 1IS6A 1QOOA 2PHWA 3OYWB 4UXAA 1ENQA 3WX5A 1QQP2 3AZXA 2JEMA 1G9AA 5GZFA 4QQHA 2OYZA 1R1A1 5F6KA 1KFUL 4I01A 4LO8A 4R8HA 2IZWA 5GZGA 2D7FA 4Q1RA 3WG4A 1WLDA 5I0RA 2WC2A 4XFBA 3WNXA 1QDOA 4OHYA 3I8TA 1VBC2 3D4KA 3ES4A 4QMAA 4BIFA 3POYA 1OD5A 1NA1C 4L99A 5T5PA 3VBRC 1HKDA 1GNHA 2ZX4A 2YMZA 1YHFA 1GKBA 3H7YA 3WT3A 2Q1ZB 3ZN4A 1ND2B 1IPKA 4JGYA 4GB31 5CFCB 4H3WA 3AYCA 4AE2A 4OUMA 2NQYA 3E97A 1CJPA 2B9UA 4XETA 1ND2C 2HJIA 1C3HA 5SV8A 5CFCC 4LHKA 1KITA 4K1ZA 3RZZA 4HMZA 3P3NA 1A78A 2NMNA 3V0AB 1S0IA 1MS0A 2Y0IA 5ACA2 1NQJA 4GA9A 4META 5D8AA 2PLV2 1Q8VA 1EP0A 3WP5A 3BIWE 2D6KA 5GZEA 4F83A 1I5ZA 2VNOA 3ZIWA 1CAWA 2W39A 4XFGA 1G9FA 2HWE2 4CDWC 1S2KA 3GHNA 4HK9A 1NA1A 1W2UA 2RR13 2XJQA 2BPA2 3WVJA 4DRVA 2JXAA 4EN9B 3TYJA 3VBRA 1E57A 4PDWB 1ZM1A 5EFUA 4AXOA 4I30A 2X5IB 5C9AB 1QKQA 3CO2A 2CTVA 3IWZA 3ZDSA 4FVVA 3V65A 1O5LA 1Q8PA 2YUEA 1UN1A 2B42B 3NV2A 5FMOL 3USSA 5CG8A 2ZHLA 1ND2A 4LBJA 5CFCA 1PVC3 4PIXA 1ZZ9A 4AG4A 2VXRA 4F7ZA 1EPZA 4P14A 2YXSA 1Z7S1 4CRQA 3H3UA 3LOIA 4XBLA 2KA3A 2GAUA 2KXLA 1AL22 4OUSA 3TBDA 3LA2A 1JUIA 3QD6A 1IS5A 3ES1A 1O3SA 5EWSA 2R072 1DDLA 1UU5A 2JE7A 4CDWA 4KGGA 1V6MA 4J1XA 2ZMKA 5J96B 4N43B 4Y5Z0 5BXXA 5HBAA 1RB8G 2LM3A 2VUJA 2ZGLA 2V09A 1AXYA 1F5FA 1RUF3 5DG1A 4RFT0 4CTEA 3MICA 1AX0A 3TB0A 3HWJA 3AKSA 4DFSA 1PMIA 4CDUC 1VBD3 4XBNA 1YI9A 1KXGA 1QH6A 2C9AA 4N90A 4BPZA 1LKNA 2ZJCA 2XJSA 4AEKA 1DGRA 4K8FA 3NSTA 2ET7A 4OVEA 4ATFA 4HN0A 3MIBA 3VZOA 1W0PA 2BFUL 4RL7A 4P9GA 3JD71 1HRI1 3WP3A 3U0ZA 5CB7A 5A3LA 2PHRA 4G9SB 2UYAA 2R0HA 3L2YA 3BTAA 2XVLA 5FRAA 3TNQA 3I4IA 4KG0A 2HWC3 4LUMA 4LUKA 4XBQA 4YRDA 2ZKLA 3RQ0A 4PBOA 1YFYA 1LECA 5IK7A 2BTVC 2NLRA 2GNBA 3AMQA 4HPKB 2UY8A 5JOYA 5CNAA 2P3KA 1S0FA 2WFPA 1DQ4A 4CDUA 1QWRA 1OFSA 3LOBA 4FOWA 1EAH3 2WA3A 3FZ3A 5J98B 1ZZ7A 5DDJ1 2F4PA 3RYKA 3MW2A 3UJQA 4J6GA 2R063 3RYRA 1RUOA 4AI3A 1LODA 1ZZ6A 4BHPA 1AYN1 1RUH3 1AF9A 1GZCA 4DNYA 1UU4A 1RUG1 1F9KA 1KS5A 2RR12 4EN6B 2CY6A 2W08A 1D0GA 3WW1A 3MLLA 4MYEA 1G86A 2SBAA 1UZZA 1OLQA 5EXOA 2OZ6A 4AVTA 3AB0A 4CP2A 4FT8A 3AK0A 4FQZA 2R043 4K7JA 1MZ6A 1SDWA 1PVC2 4FXGB 4LULA 2R32A 3OGGA 4GMP1 2VW1A 3ZYGA 2D98A 3H0OA 4XE9A 3FBMA 1RUD1 2AZ5A 1MS8A 1AR63 3FLPA 3K48A 3AP6A 2GH8A 2Q4SA 1LEDA 3JBG1 1W0OA 2XUMA 4GKXA 5JOXA 1SFNA 4BLIA 4G3YC 1VAVA 2E7TA 2VW0A 3J8F3 3AYEA 1ZRFA 3WDWA 4F8AA 4W6WA 4YZ3A 2HWD3 4H55A 1CJDA 3QCWA 2HYKA 3S6PA 5KHJA 5JCTA 1WLTA 1RUE1 1RUF2 1TMF3 2P17A 2YY1A 1LULA 1I3HA 4OI1A 1HRV2 4KL1A 4TLFA 4EWEA 1R081 4PLNA 3GHMA 2DU1A 1DYKA 1VBD2 2YGMA 1DGWX 4DOUA 1AZDA 1FOD1 5BNOB 1MS3A 4Q4X1 2EXKA 1PHMA 4U2AA 1JN2P 1PIV3 5BNOC 5J3UA 1OKQA 1J58A 4HKWA 4XXAA 4GWNA 4XMIA 3KCXA 4K21A 1KDMA 4LO5B 4EJRA 1FXZA 2D3RA 2NMOA 1RJ8A 1NCQB 2DCYA 4NHLA 2C5DA 4GH4B 1TNRA 2I74A 3PMEA 4XQ4A 3KD4A 2IXHA 1QJY1 1OA2A 2HWC2 3O0WA 5T5JA 2Z5WA 2HWF3 4GH4C 1RUI3 3WXPA 2DCZA 4EN8B 3EO6A 3LSEA 3J4UH 2X8KA 4IESA 1WLWA 4HT1T 1LENA 2GNTA 4E4DX 1EAH2 4LE4A 4AI0A 4WZCA 1LGCA 4ZXKA 2R062 5JSPA 2BVBA 4S2HA 1WGPA 4Q4Y1 1BMV2 4B4QA 2QVSB 5A32B 5GJ6A 4XOGA 1RUH2 4Y24A 3LKJA 3RPQA 3ZFEA 1L3JA 2W52A 3QH7A 5JMCA 3JU9A 1VLNA 4AQ2A 1NG0A 1COV1 2XH6A 1BEV2 2JG8B 4KWKA 1IKPA 2O1QA 3HQXA 4LLOA 2JG8C 1REFA 4JV4A 1PGL1 1PO23 5GALA 3SXWA 1LGNA 2R042 2EVXA 1N1VA 1AYM3 1K5MB 3NV1A 2WL1A 3TOJA 1ZBE2 1FPN1 4RS5B 3CLPA 4UW4A 4OI2A 2OVUA 2ZKNA 1OLRA 4RS5C 4YSFA 4XJUA 4IV1C 1RUC3 4J1WA 4AHXA 1AR62 3ELNA 4NO4A 4XJWA 1ULCA 4GXLA 3RS6A 2K9ZA 1C8M2 1GANA 4HBNA 2DUQA 1H0BA 2OUJA 4AYUA 5C8CC 1ASJ3 3J8F2 2MEV3 3VKLA 1PK6C 4FPGA 4AQSA 1BYHA 1X7NA 4Q0VA 3QH6A 5BV6A 2YYOA 5L7OB 1LB2A 3IPVB 2WNVC 1DG6A 3AJYA 4YZ4A 2GDFA 2QJVA 4RHV2 1S55A 1D2SA 4Z82A 1CR7A 1C57A 1NZCA 1QXJA 2A3WA 3ZSKA 2EF6A 1TMF2 1UPIA 4WM7B 1W6MB 5E1RA 1O4ZA 3SCGA