3NV3A

Crystal structure of human galectin-9 c-terminal crd in complex with biantennary oligosaccharide
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
136
structure length
136
Chain Sequence
b'HPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNPRFDENAVVRNTQIDNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Galectin 9 short isoform variant
publication title X-ray structures of human galectin-9 C-terminal domain in complexes with a biantennary oligosaccharide and sialyllactose
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
total genus 31
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 2010-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3nv3A00
2W08A 1Q8OA 4YW2A 3ZXJA 1GSLA 4YGBA 3B69A 2ZHLA 2PHUA 1GZWB 3ENRA 3IPVB 3O0XA 5GZFA 1HQLA 4YM3A 4GWMA 1PZ9A 1SCRA 4P9XA 5JOZA 3V0AA 5GZDA 3OYWA 3POYA 5DZFA 2P3JA 2AYHA 3AXEA 2B7YA 1F9KA 3AP4A 4TYSA 4XTPA 5H9SA 2AUYA 1ULFA 2OUJA 3A0NA 3ZXKA 2PHTA 1QOSA 1UN1A 1VALA 4YG6A 2ZZJA 5CB7A 5SV8A 1NXD1 1GZCA 4AVVA 5L73A 3T1LA 3N3HA 2DTYA 2E53A 1MS3A 2AENA 3ILFA 1QKQA 3VKOA 5HCFA 3I4IA 4P14A 4Q1RA 3N7JA 4R9DA 3OBTA 1AF9A 2DUQA 5E88A 1HQWA 3L2YA 4M3CB 3AJYA 4YW1A 3UJOA 2A5ZA 2D3RA 3FUQA 4PCRA 3USUB 1SBDA 2R1DA 1G9CA 1KRIA 4LBJA 3MPPG 3RG0A 4LBLA 2PHFA 2R49A 5GLWA 3SLIA 1GBGA 2ZABA 4XXAA 1KJLA 2D6LX 3R4SA 1BXHA 1BJQA 4U2AA 2AREA 5T55A 2OW4A 5FRAA 1V6IA 1QOOA 1N1VA 2NYYA 2ZGNA 5T50A 3CNAA 1A78A 3AYCA 2D43A 3HMYA 1D0HA 1CPNA 3VKFC 2XB6C 2UWAA 1G9BA 2JKBA 4PBOA 3AP7A 1WLCA 1FV2A 2ZAAA 2DVDA 1WW7A 4XBLA 2AGSA 1CJPA 1ULEA 1AJOA 2BQPA 3FUOA 3NWKA 4P9YA 2ZGPA 4FQ4A 3R4UA 1X50A 5KXDA 1LU1A 1Z0HA 3WV6A 2ZKNA 3VV1A 2JDZA 2NMNA 3RSJA 1GZWA 3IPVA 1U0AA 3VKLA 4FPYA 1G7YA 1AXYA 4YW5A 4DFSA 2ZHNA 2GNBA 4YM1A 1BQPA 5GZEA 3OY8B 3PMEA 3RRDA 1V6MA 4FVVA 1J1TA 2D3SA 3AZYA 4FQZA 1G9FA 4Y20B 4AVTA 1RITA 4Y1YA 5DG2A 1LOGA 2XG3A 2VY0A 1MS5A 4BOWA 4YGEA 3QLQA 2TEPA 2ZMNA 4ATFA 4PF5A 1V6LA 4M3CA 1SBEA 2ENRA 4UW6A 3WG2A 3AYAA 1LHVA 3USUA 1DQ6A 3ZSMA 3WZ1A 2W68A 3V64A 3PVEA 4IQPA 2I2SA 2WSVA 1G9DA 4BM8A 1LOBA 3AP6A 2R0FA 4FP3A 3WDUA 2WT2A 3LSDA 1QNWA 2PELA 4DRRA 1DQ4A 4UW5A 2LALA 3ZSKA 1DFQA 3WCSA 4FPEA 1V6NA 1XQNA 2PHWA 2ZGLA 1DGLA 4BMEA 4XYXA 1SLCA 3JUUA 1EPWA 1KQRA 2W39A 1I1EA 1W6PB 1PZ7A 2WT1A 3AZXA 2AR6A 4R9AA 1N3QA 1H9PA 3D4KA 2A7AA 5DXDA 2ZGKA 2ZGRA 5EYYA 4JCKA 1DQ1A 2EXKA 2FMDA 5DZGA 3ZXEA 2DUPA 3WNXA 1LOCA 1DQ2A 1QF3A 1TEIA 4XMIA 3Q9OA 1GZ9A 1MVQA 2UU8A 1FNYA 2YROA 2E6VA 3OBRA 2OUHA 2JE9A 1QGLA 1CN1A 3O0VA 3FBYA 1O4ZA 2DVBA 3OY8A 5GM0A 2ZHKA 4DPNA 5DUXA 1BKZA 2EXIA 3SH3A 1O4YA 4DRVA 4Y20A 1N1TA 2VUAA 2PHRA 4WZFA 5JOWA 3ZYPA 1ULDA 5GLZA 2A6WA 2DVAA 2EF6A 5HCAA 2YV8A 1QDCA 4CRQA 1DYPA 5CA6A 1AXZA 2NMOA 4Y1XA 1ULCA 5GLUA 3WUCA 5KXBA 2ZBJA 2ZGTA 5IK7A 1QNYA 3IKWA 5IK8A 1S0IA 2P34A 4YM2A 3N36A 1S0JA 3RS6A 1GKBA 4BLJA 4M01A 1ZA4A 1G86A 1WBLA 5LK5A 4K1ZA 1CIWA 2A6XA 4NOTA 1IS4A 2JECA 4AGGA 4XOGA 2DV9A 3B9CA 3MW2A 2KM2A 3ZPYA 2UURA 1URXA 2EIGA 4YM0A 3WHUA 4LBQB 3ZSLA 4JRAA 4ITCA 1A3KA 1GNHA 4XE9A 4YZ2A 4DQAA 1UZYA 3DUIA 1HLCA 4ZXKA 1SLIA 1AVBA 1WLWA 4GXLA 1W6PA 1BZWA 2EXJA 1WW4A 1GANA 1MS9A 5GJ6A 3B3QE 5JOYA 4GA9A 4GKXA 2GDFA 3M3EA 4NO4A 4Q1PA 3NV1A 4H55A 1DIWA 4AYUA 4W65A 2GALA 3AYEA 3N35A 2A6ZA 2D6KA 1VIWB 5T5LA 2D6PA 4RL7A 1MS0A 4M3CF 5BYNA 1UAIA 3T1MA 1LHOA 3WG3A 3UJQA 3N7KA 1GLHA 3D6EA 5CNAA 1LHWA 5JOXA 3LCPA 3UL2A 2Z42A 1JOJA 2ZGUA 4I30A 4LBNA 5H9PA 4YW4A 1CPMA 2R16A 4PBPA 2ZGOA 1S0GA 3DGTA 4XZPA 3NV3A 4M3CE 5DUVA 2GN7A 4PQ9A 3PVNA 2YY1A 3VKNA 1OFSA 4KBBA 3ATGA 4Q2FA 1Q8QA 4XTMA 3LSEA 3WHTA 3O5SA 3M3QA 5DZEA 1IOAA 1AX1A 4XIKA 4WV8A 3SISA 2A71A 1H9WA 3SH5A 1HDKA 1RIRA 4HANA 2E7QA 4ISRA 2ZACA 4ATEA 1LGNA 4AVSA 4TZDA 1IS6A 2EXHA 5GALA 4YW3A 3R05A 4Y24A 2G4IA 4Y1ZA 2V5YA 4FPKA 4FPJA 4LBQA 1GYKA 5GLVA 2D44A 3MW4A 1B09A 3OPZA 3V65A 4CTEA 5F9TA 1FV3A 2ES3A 4YG0A 2WLQA 2UWCA 3VKMA 1ONAA 1W6MB 3APBA 1WUVA 2WT0A 1WD4A 3C2UA 4ISQA 3WDXA 3KQRA 3M3CA 1N3PA 5GZCA 1W6QB 3N7MA 5EWSA 3FLPA 4YFWA 1KDKA 1KITA 4P9WA 4XJ9A 4YLZA 4YZ4A 2ZGSA 3A0KA 1IKPA 4C1XA 2GN3A 2CNAA 1WCSA 1DBNA 3D5OA 3T2TA 1S0EA 3FLTA 1W6NB 5IT6A 1Y7BA 4XHBA 5H9QA 1V6KA 2R1BA 1MS4A 2VW1A 4Z8BA 1SLTA 1S0DA 2P3IA 5E89A 1D2SA 4F83A 1Z78A 1LOFA 1APNA 1JXNA 2A6VA 3AFKA 2Q5TA 4Y26A 1C57A 3FLRA 1SLBA 3GNEA 2D6NA 3AYDA 1MVEA 3POSA 4DS0A 4FPLA 4BMBA 2EAKA 1CQ9A 1IKQA 1HKDA 1MZ5A 3M2MA 1ENQA 1Q8PA 3AXDA 4LBMA 4RA0A 4L8QA 4YZ3A 1FYUA 1S0FA 2RHPA 3NV4A 4GWNA 1SLLA 2P3KA 1GICA 1CR7A 3AZVA 1G8WA 2A70A 1C1LA 3QCWA 2WJSA 1MACA 5IUQA 1UL9A 2W52A 1ENSA 4XHXA 2ARXA 3IM0A 2D7FA 4XJZA 1QOTA 5JDBA 4YG3A 2ZA9A 4UW3A 1S0CA 1FAYA 3POWA 1IS5A 4ZKTB 2ERFA 3U4XA 5EXOA 2DYCA 2ARBA 2CWSA 2ZHMA 1OKQA 3MEPA 4FPOB 5T52A 1KJRA 4XBNA 2VXRA 1F5FA 2DWRA 3INAA 1BYHA 1W6MA 2CWMA 4XJAA 4Y1VA 3ZYRA 5KXEA 1LHNA 1LULA 2E7TA 3H0OA 1LU2A 1Q8SA 3N7LA 4FPCA 5F5QA 3BOPA 5CAZA 1W6QA 2JD4A 5CBLA 1AXKA 1FX5A 2D6MA 1YXWA 5DG1A 3MW3A 5KXCA 1OQ1A 1N1SA 1UPSA 1W6NA 3WG1A 2OVUA 5JMCA 2VW0A 4BLIA 2NM1A 2DU1A 4M00A 1SACA 1YRZA 2NP0A 4XJUA 4XILA 3RMYA 1QMJA 3OJBA 5GZGA 3AP9A 2H0BA 5HCBA 1JHNA 2CY6A 5GLTA 1LHUA 2DUOA 1KDMA 2SLIA 2YZ4A 2V73A 4XDQA 1UZZA 1WW6A 4XBQA 3SITA 4AWDA 5FREA 2AH2A 3RQ0A 4Y22B 1G9AA 4K1YA 1WD3A 2ZMKA 4XXPA 1AJKA 5T5JA 3WOGA 3PVOA 2C9AA 1LOEA 2D3PA 1CONA 3KM5A 4R9BA 1N1YA 5DUWA 3ILNA 2GNTA 1FNZA 1SBFA 5AVAA 1SCSA 4FOWA 4FOYA 1V6JA 1MR5A 2A3WA 4JC1A 3W58A 1UX6A 3AX4A 1GV9A 2GNDA 1LEMA 1ENRA 2HYKA 2ZGMA 2VU9A 1LOFC 1LGBA 1YYNA 2CL2A 2UWBA 1JYIA 1WLDA 3BIWE 5EYXA 3ZXLA 4BPZA 2E51A 3AZWA 3V0BB 4WVWA 4Y1UA 1H30A 2VH9A 4YFZA 1CESA 1ULGA 2GMEA 3ZXFA 2EALA 3SH4A 1YO8A 1SFYA 1W6OB 3RMXA 2GMPA 3PJQA 3WDVA 4CZSA 2NN8A 5T54A 3WDTA 1LTEA 5T5OA 3HR9A 5T5PA 3HN1A 3M1HA 1FATA 5H9RA 4YZ1A 1DHKB 1JUIA 2WKKA 2GMMA 3WDYA 4FOVA 3WVJA 4LBKA 4WVVA 2YMZA 4MYEA 4Q8LA 1LJ7A 5IK5A 2R0HA 1LCLA 5JVVA 2LTNA 1JN2P 1N3OA 3B00A 2A3XA 3B01A 4XJWA 1ZM1A 2P2KA 3AK0A 1VLNA 4XMAA 3W59A 4GALA 1DQ0A 1LESA 2P37A 3O0WA 4OZXA 1GNZA 1JBCA 4FPFA 2FHRA 1CVNA 3FFZA 4FOQA 4Q26A 1YI7A 2CYFA 2YXSA 1DYKA 2DTWA 3AP5A 2WQZC 5IK4A 2SBAA 4Y22A 4XJ8A 2WNEA 2CTVA 4FP2A 3GALA 4YGCA 1I3HA 1AZDA 1LGCA 3IMNA 3IN9A 2C5DA 3ZVXA 2DVFA 4AGRA 4AGVA 2PHXA 1MS1A 1UMZA 1W0PA 3V0AB 3WCRA 1V00A 2A3YA 4R9CA 2ZGQA 3OYWB 4SLIA 2WSUA 3AZZA 1A8DA 2VW2A 1R1ZA 4HL0A 1LEDA 3ILRA 3SNMA 4FPGA 3AJZA 1LOAA 3ASIA 3OGGA 4Q27A 1QU0A 4YGDA 3A4UA 1Q56A 4U36A 1DZQA 2JJ6A 3NV2A 4LBQD 3TB0A 1AX0A 4BQ1A 1IS3A 4XIOA 1PZ8A 1MZ6A 4D69A 1UKGA 1S0BA 3V0BA 1VAMA 1VAVA 5DUUA 2DURA 1W0OA 3UK9A 1F31A 1RINA 4K20A 4GKYA 3O12A 1LECA 1QDOA 1W6OA 3WUDA 2A75A 2ZMLA 4UW4A 1JW6A 3WDWA 4ASMB 1LENA 2DU0A 3JU9A 2DVGA 1V6OA 3WG4A 4LBOA 4Q8KA 1DQ5A 1C1FA 1N47A 2NZ9A 1JYCA 5E8AA 2JE7A 4C1WA 5JLVA 3ZSJA 1MS8A 2D6OX 1LODA 1WW5A 2GNMA 4FPHA 4YZ5A 1AX2A 1S1AA 3WLUA 3BODA 4K21A 3M3OA 3BTAA 1SLAA 1YIFA 1Q8VA 3I8TA 1NLSA 1WBFA 3TAYA 2A6YA 3VUOA 1C4RA 1DLLA
chains in the Genus database with same CATH superfamily
1Q8OA 3ZXJA 1J84A 2PHDA 5A7SA 4YGBA 3E1F1 2O8OA 2H6BA 3NNFA 5IVJA 5J09A 3FWEA 1COV1 1QJFA 4RR3C 5FZLA 1GQGA 4A6SA 1X8EA 5JSOA 5JOZA 4YM3A 1SCRA 1NY72 4NWWA 5GZDA 3POYA 5FYTA 5DZFA 2RJKA 3AXEA 5FTTC 2B7YA 3ZXKA 4XTPA 3A0NA 1J58A 2JENA 4E27A 2PHTA 4K3UA 4A2UA 3LEMA 1NE4A 4AVVA 2VCCA 2WFF2 3B9IA 5K4LA 2E53A 4LITA 3VHPA 1MS3A 2AENA 2Y60A 3MIBA 2VNOA 1QKQA 1FMD2 4AHZA 4YW7A 1AF9A 2DUQA 4YW1A 1V9U2 5F3CA 2XUMA 2QVSB 2ZX4A 3I59A 3O1VA 2R1DA 2WC2A 1G9CA 3FZ3A 2IZWA 2LROA 4LKSA 2VO5A 2YB7A 3RG0A 1HJFA 1NCQA 2PHFA 3SLIA 1VB4A 5FIXA 5FZ6A 2WN3A 2WZR2 2X8KA 5FRAA 5T50A 2ETEA 1NXMA 2NYYA 1RUH3 2VNGA 1DLCA 3POGA 4B1MA 4CDQA 5J48A 1CPNA 4K9SA 3VKFC 4D94A 3X29B 2UWAA 5IYYA 4S2FA 5J96B 2OXBA 4NPRA 1W04A 3ZXGA 3WF2A 3AP7A 5FY1A 3VBOA 1WW7A 3UYJA 3S5AA 2BQPA 4IV1A 1XNAA 3PUHA 2JDHA 3H7YA 3JBG1 3GCXA 2C6SA 4BQ4A 1DZRA 3I3MA 2JDZA 3IB3A 1TMF3 2WO7A 3HIFA 4LKDA 4E8DA 4Q0SA 1CAUA 2OZ6A 2L9LA 4Q4X3 1XXNA 3ZYFA 1G7YA 4YVWB 5A1FA 3DXUA 4Q4W2 4CDWC 2AZ5A 4GQ7A 3UKTA 2GNBA 2YBPA 4XCBA 4TTGA 3KHBA 5GZEA 2WINB 2G1MA 1I5ZA 4IXLA 2BPA2 3RRDA 2VQUA 1VPHA 2VTXJ 1UW8A 3SQOA 1HXS2 4AVTA 1G9FA 4Q0PA 1LOGA 2VY0A 4CPBD 4BOWA 2HKXA 4IGOA 3TWIA 5C4WB 4YGEA 3CZUA 3EMRA 5AVPA 4PF5A 1V6LA 1QQP2 1YFXA 4IE7A 5IVVA 3ON7A 3ES1A 5LBBA 5I8SA 3AYAA 1LHVA 3ZSMA 3WZ1A 1KGYA 1NZIA 3EXUA 4A7KA 4OUMA 4IQPA 2I2SA 2Q0AA 4BM8A 4HVRA 3R4DB 2CGNA 2R0FA 3RJ2X 3T2OA 1L7LA 5ANNA 3ROUA 4LO6B 1DQ4A 3K77A 2KXLA 4PLNA 2QCSB 4DO0A 4FPEA 4WM7A 1BBT1 3MFCA 5CG8A 2PHWA 2RVAA 2W47A 1TG7A 2CU5A 3H7JA 4IV3C 3B7MA 1EPWA 3ZYIB 2DCJA 3OBAA 1PZ7A 4HKLA 5FKCA 1OD3A 4BQ3A 2ZGKA 3GM8A 3VHRA 1MZEA 2R042 4DEQA 4DXSA 4E4ZA 1W9TA 4Z92B 1XSQA 4H2AA 1QF3A 2XVLA 1GZ9A 1S2KA 5G04L 3AKRA 1QJY1 2WYFA 4PQQA 2X53S 5LATA 4CDUC 2VL4A 2FDJA 4MGSA 1VBA3 3OBRA 1GOFA 3R0RA 1NCQC 2X05A 1VBE2 1CN1A 3FC0A 2ZEXA 3N9MA 4HETA 4JQRA 5LY2A 3VBHA 3H3UA 3OY8A 3EQEA 5DUXA 2VOXA 5E16A 1POV0 2HBTA 1BKZA 4CDQC 3VBSB 2KR2A 4FTSA 2VUAA 3RI8A 1ULDA 1W2UA 2EF6A 3PUSA 2Q1ZB 4DOUA 1DYPA 4LPLA 2KA3A 2NMOA 4ZU4A 4AEDB 5CA6A 3WUCA 1WA4A 2ZBJA 2ZGTA 3VBOC 1ZBE1 2YGLA 5FY0A 5IK8A 2FD8A 5CFCC 1RGSA 4IV1C 1U5ZA 3MPBA 2XLGA 5FMBA 3VBRA 1RUNA 3N36A 4Y3OA 1GKBA 1TME1 1PGW1 2WUHA 4D6SA 1G86A 2QQKA 2WNUA 4K1ZA 4RN5A 1BEV2 1SDDB 1IS4A 2Y33A 2TNFA 4ARYA 4XOGA 4X8NA 5BY5A 1U5XA 2KM2A 2XOMA 3ZPYA 1W8NA 2UURA 1VR3A 3HQUA 4LBQB 3ZSLA 1OT5A 2VCMA 5A6ZA 3PNAA 1A3KA 1GNHA 4YZ2A 5K0UB 3H8XA 1H1MA 1X36A 4QX2A 1AVBA 2BU9A 1GU3A 4DY5A 1OPOA 3J8F2 2WIIB 3MLLA 4LULA 1GOHA 1AR71 1RUE1 1UIJA 1K3IA 1MS9A 1WW4A 3B3QE 1K5JA 3OTFA 4MUVA 4QDQA 5GJ6A 1D4M2 1H4HA 2HWC3 4GMP1 2FZ1A 1Z7S2 3VDDC 3NNMA 2C26A 1DZTA 3LIGA 4H55A 4AYUA 2VE1A 4W65A 3MV11 3WNOA 3L2HA 4A41A 1POV1 2IFWA 1XPWA 3AB0A 3N35A 1JUHA 2D6PA 4RL7A 3T30A 4M3CF 3ST7A 2JDKA 4ZS2A 4HSLA 3UJQA 2XJVA 4DUVA 4ZZ8A 1J83A 2PAEA 4P08A 3ZIXA 3PU3A 5H9PA 2R16A 4PBPA 5FZMA 1B35B 5C3PA 3GZEA 4XZPA 2MEV3 1PK6C 1GOGA 1HRI2 3GZAA 1HRV1 2VOWA 2Y6JA 3PVNA 3VKNA 1AR83 1OFSA 4I2OA 5F5CA 4CUBA 4Q2FA 4OULA 1HN0A 5DZEA 2H6CA 1K12A 5A32A 1JZ2A 3H8OA 3ZYHA 2JICA 4XFCA 4XIKA 2JG8B 2VQ0A 4WV8A 2OZJA 2BYVE 2AACA 3LEGA 4LOTA 4NIDA 4HANA 2E7QA 3N9NA 2ZACA 4ISRA 4TLFA 3ZR5A 2RS11 3KT7A 3SKVA 5GALA 3UKVA 2DCTA 2BNNA 2V5YA 4FPKA 4LMFA 5FZ1A 5GLVA 2D44A 3VBHC 3MW4A 2XL9A 2YUEA 1JI6A 4PDWB 5F9TA 1SQ4A 3IMMA 5FMOL 2WLQA 2R072 4MGZE 4CDXA 3EB7A 2OS2A 3J7MA 1OFNA 3CO2A 1KEXA 3QH6A 4AFMA 4HBNA 3GBGA 2IXJA 1FI2A 3K4DA 3KQRA 3M3CA 4W6WA 4M0NA 3IAPA 5FMOS 1W6QB 3N7MA 3FLPA 1KDKA 1DCSA 4XJ9A 1YUDA 4D3WA 2ZGSA 1IKPA 4NIIA 1ZZBA 1FMD3 2CNAA 3VBRC 2D97A 2V4VA 1S0EA 4PIYA 3FLTA 3CU7A 4E2QA 1V9U3 5ANQA 2BGOA 5FXWA 4QU1A 1WA6X 2R1BA 3USSA 3U0ZA 2VW1A 2RDSA 2ZS6B 1XE0A 2Z2SB 3T4VA 1Z78A 1LOFA 2ORZA 3E6DA 3J4UH 3OUIA 4RHV1 4CUCA 3BPZA 2BOIA 2QQJA 3GNEA 2WZR3 4L11A 1DG6A 3HBKA 3GCWA 2FCTA 1AHSA 3FBMA 3MLKA 3J26N 2EAKA 3UGGA 4FT8A 1MZ5A 4LBMA 4XUTA 3PU8A 1YEWA 3DPRB 1FYUA 3NV4A 5LRRA 4BQXA 5A7WB 5LY1A 3VHOA 1G8WA 3CBNA 2WJSA 4OUSA 3IDBB 2ZJCA 4KG0A 1A8MA 3Q8BA 2ARXA 4I0AA 2D7FA 2HWE1 2VBPA 2F6BA 4AI3A 4COYA 5JDBA 3S57A 3IDCB 1US2A 1XJAA 5EJ3A 5C33A 1OLRA 5EXOA 2R30A 2W91A 2ZHMA 5CKMA 4D7SA 4Q4W3 3RZMA 1KJRA 2J1UA 1ENXA 2VXRA 1F5FA 2DWRA 1BYHA 1W6MA 4QX3A 2X5IA 3ZYRA 1BLZA 1WCUA 3ZR6A 4COWA 5FR3A 2E7TA 4P9IA 4GB31 4EN0A 1Q8SA 4RR3B 4FPCA 3RNSA 5C70A 4LE3A 1HXS3 5CBLA 2IXKA 1AXKA 1FX5A 4OUEA 4Y5SA 5DG1A 3AKSA 1UOGA 3MW3A 1JOPA 5JI9A 3CIHA 1S55A 4N7UA 4QHOA 5FZAA 1UX7A 3O7OA 1UPSA 3HJRA 4YARA 1QQP3 3WG1A 3VD3A 5KR7A 1UXXX 4BLIA 1NYWA 2YPDA 5FK8A 4XILA 3OJBA 4Q4V2 3LDRA 3SCGA 4KI5M 2H0BA 4BXFA 4XETA 4AXOA 1STMA 4NHKA 4QPWA 1JHNA 3JB4C 2CY6A 4XC9A 2P5BA 4IE6A 1ZZ8A 1LHUA 2SLIA 4B7EA 1AYN1 4DY3A 3NL1A 1GFF2 1WW6A 3DECA 2XPJA 4BQ2A 4ZHNA 1JU3A 4CDXC 3RQ0A 2ARAA 2D98A 2RMU1 4Y22B 5A7QA 4K1YA 2FDFA 3OD4A 4IE4A 2CAUA 5I8TA 4XFIA 2C9AA 4B7KA 1UYXA 4AFAA 2C0ZA 1CONA 3KM5A 5FYMA 1TZOA 4CCEA 3TN91 4MGIE 5FCCA 3DEMA 5FBJA 5AVAA 4BB3A 4FTBA 2R043 3JQWA 4FOYA 5HV4A 2BBVA 3FL7A 2ZEZA 3DXTA 2PTMA 3MF9A 1R082 5CKQA 5FMCA 1R1A3 4EWAA 2QJVA 2GNDA 3TBDA 1PX3A 1ZBA2 3P3PA 4W6YA 1LEMA 1QXRA 3NNLA 3ECQA 3M3IA 5FYZA 2UY8A 1PVC1 4QPGA 1LOFC 4E4SA 2CL2A 2WA3A 3BIWE 4BPZA 4BIFA 4Y1UA 1H30A 2VH9A 3T4HB 1W2OA 2GMEA 2RDQA 2EALA 2RJ2A 3Q8AA 3SH4A 3ZXFA 1K42A 2LS6A 2HWF1 4B8EA 4IL7A 3OF1A 4CZSA 4LKEA 4LIVA 4XF1A 4QQHA 2GP3A 4CDWB 5A3NA 2WR9A 3HN1A 3M1HA 1T6BX 1CX1A 2GMMA 3WDYA 5FO7B 4LBKA 1NQDA 2YMZA 1ACCA 4Q8LA 5F6KA 1OKOA 3HD8B 3K4AA 1LCLA 4QX5A 1BMV2 3SHRA 1JN2P 3J7NA 2A3XA 3B01A 3EBRA 1ZM1A 3W59A 1VLNA 4UXAA 3ZXDA 4H7LA 3D8CA 4D6QA 1KFXL 1GNZA 1T2XA 4MXWA 4AK3A 1BEV3 4XVHA 2LUWA 1JBCA 2FHRA 1CVNA 4Q0VA 4J1WA 2ILMA 4FOQA 4CXYA 3LDKA 1EUTA 5APAA 1X82A 3DYMA 1DYKA 2DTWA 1PIV1 1SPPA 2WQZC 5IK4A 3A22A 3ZFGA 3I54A 1NAEA 2X5IC 1PM4A 4Q0QA 2WNEA 4FP2A 5FPAA 1R093 4KWUA 5FZ7A 2C5DA 3KF3A 1OVPA 3J8F3 4AGVA 2PHXA 1MS1A 1XYPA 3MLJA 4DINB 1D4M3 1UY3A 5I0DA 2FZ2A 1MQTA 1S2EA 1Z7S3 4HL0A 5IVYA 3JD73 2QDNA 5JR2A 1W99A 4FPGA 5FZCA 2CSGA 2GSYA 3KCYA 3T0DA 2XBO1 1BVVA 4RFRB 4Q27A 2XQRA 1QU0A 5DDJ2 3ZO0B 1UZ0A 2JJ6A 3HVDA 3TB0A 4BQ1A 2Y64A 3NKGA 4XIOA 2E9QA 5FZ9A 5L9RA 1MZ6A 1M06G 2EAAA 4LXLA 5DUUA 5C7GA 1NLRA 2DURA 3V0BA 4MGQA 3GHNA 2WZPP 1HB1A 1PO11 1RINA 1MEC1 1YHFA 1OA3A 4BK5A 2YFZA 1W6OA 5A33A 3CLPA 3I59B 2ZMLA 4YVSA 3OSDA 1UOJA 5E1RA 3A7QA 4ASMB 1NCQB 4K6BA 1RUC2 1HRI3 4CEWC 4Q8KA 5CFDA 3ZOIA 5CEHA 4QGNA 1Q3EA 1JYCA 3F95A 5JLVA 5EJ1B 4XFAA 4CDQB 3KB5A 3K48A 4H14A 1OF4A 2WFPA 1RC6A 3BU7A 2WS91 3P3NA 4AEKA 1JOBA 1JS9A 2WNVA 1F35A 1AX2A 2JG9A 1JYWA 1H6XA 1L7QA 4XQWA 4AEDC 2VQTA 3VBOB 2LM3A 5T3NA 2QQPA 1NLSA 3KZ4C 3TAYA 4CCLA 4IV1B 4DB5A 4QPGC 3VUOA 1OI6A 2W08A 3CJIA 5A7OA 5JXIA 4BJ0A 2WN2A 3HWJA 4QHZA 4H3WA 2R073 2W94A 5GZFA 4ARXA 2Y26A 4Z1VA 4HVQA 1CAUB 1HQLA 4GWMA 4PJYA 3MV01 1QJU1 2VZQA 1NCRA 3OYWA 3SEEA 4C90A 4EWDA 4X6RB 1VBC2 1CAVA 4WVMA 4B4RA 5F7UA 3M7AA 2Y6FA 3AP4A 2R32A 5H9SA 2R7EB 2AUYA 2OUJA 3MUZ1 4YG6A 1WZXA 3FFQA 1ZRRA 5CB7A 4HKWA 4KQ7A 1NXD1 2GH2A 2JEMA 4LHSA 2PHLA 4K40A 5FYBA 1AL21 1CZSA 5ABJA 1ZRCA 5FOBB 1OUXA 3VD5A 4Y33A 2G9FA 3W21A 2W9XA 4P14A 4QPIA 3N7JA 4R9DA 3VDDB 4ZS3A 5FZEA 2VVFA 5A6QA 3AJYA 2E26A 4PI0A 5FZDA 2YC0A 3UJOA 2A5ZA 2PAMA 1SBDA 3ZFGC 4NVPA 4LBJA 2VVEA 5J7MA 4FSJA 1DU3D 2O1QA 2R49A 5GLWA 1GBGA 5C8WA 4KU7A 3K4ZA 1KD7A 5FXXA 2ORXA 2AREA 3I3EA 2RM22 2ZGNA 1H8TA 2VQAA 3CNAA 2D43A 4WM7B 1RUF2 4IUGA 3WNNA 1MQTC 4NJ4A 1C8M1 2V72A 1SDWA 5FBZA 5ACA2 1PK6B 4QDSA 1WLCA 3QD6A 2IWGB 2VJXA 2WAAA 2ZAAA 5IJRA 3U1XA 3U11A 1ZNPA 5AFEA 3S7IA 3FUOA 4L9BA 4FQ4A 1EAH3 3R4UA 1PVXA 3RZHA 1LU1A 5FZFA 3I2GA 2EIEA 4PI2A 3U14A 4QHBA 3VZNA 5B2GB 4HG6B 1CGPA 3SKJE 2NMNA 4EQVA 2WABA 5IATA 4BCUA 1GWMA 3IPVA 5FK7A 2E33A 4FPYA 2Q8DA 3HEIA 1QIQA 2RS53 1PNGA 1OC1A 1H1AA 4QMAA 3ACIA 3VBFA 4YM1A 3W20A 3VBHB 1M4WA 1RUJ3 3AMMA 3OY8B 5CFDC 4DUXA 3BTXA 4FVVA 1J1TA 2WO2A 3AZYA 3N9LA 3W5NA 1T6GC 5DG2A 5JR7B 2XG3A 4MGYE 1QXPA 3S6PA 3ACFA 2WNVC 1XNCA 1W8ZA 1CAXA 1RHI2 3IZOA 2TEPA 2P4EA 2W1WA 3KF5A 4QU2A 1SBEA 4Q4V3 2ID4A 4KBZA 2QQLA 3WG2A 1UMHA 3VBRB 1NA1A 4NHXA 1AR61 2LW8A 3CJIC 2WSVA 4HOOA 1H8VA 2WT2A 4TSVA 1QNWA 4Q0UA 4TXWA 1RXGA 1O91A 4Y5Z0 1RUOA 1NCRC 1DFQA 3FHQA 3ZSKA 3GJBA 5LBCA 2PLV1 2UY9A 2H0VA 5I0TA 1S4CA 1V6NA 1XQNA 4QB2A 2K0GA 4A4AA 4KU8A 1DGLA 3LD8A 4B3NA 3C7EA 1SLCA 5LBFA 1KQRA 1OLQA 3QACA 3B94A 4W6XA 1A6CA 4YPJA 4B4PA 3AZXA 4R9AA 2EIBA 1R083 3D4KA 5I0UA 2A7AA 4N53A 5FXZA 2Y6KA 3CZJA 2WBKA 4UFJA 4AZZA 2E31A 3VZKA 1LOCA 4KL1A 5FYSA 2VGDA 1UNBA 1MVQA 2Y0IA 3U4SA 1PO21 4PIXA 1NE6A 1UMIA 2PYTA 4IETA 3VB9A 2JE9A 1OLMA 1QGLA 2Q8EA 1EV12 1QJEA 2DVBA 5GM0A 3N9OA 2ZHKA 4JVAA 4DPNA 3TRSB 4GAZA 3ZN6A 1Y4WA 3UT0A 3SH3A 4C0HA 3O1SA 1JZ7A 2PHRA 5JOWA 4FCAA 4INDA 3ZYPA 4GD4A 5JXGA 5HCAA 3LZZA 2JDMA 1QDCA 2W92A 4N43A 5KXBA 4OMDA 1F8VA 5IK7A 1D7PM 1QNYA 3JQXA 5FYCA 3ZN4A 2GU9A 4W50A 2DBNA 1VBD2 4UFHA 4MADA 1S0JA 1D2QA 4OFGA 3ZM8A 4BLJA 5A32B 4BQYA 1ZA4A 2GC1A 1WBLA 4B4QA 1UPIA 2VUDA 4AI9A 4EZHA 1EUUA 4JAAA 3VD4A 5JWPA 4M0HA 3BB6A 2ZZQA 5LA2A 2XDVA 4EN8B 1WCDJ 3WHUA 5BNQA 2P6CA 2YU2A 4LUMA 4S2DA 3BPSA 1AR91 3DUIA 1LKNA 2XL7A 4HT1T 1SLIA 2WYSA 1WLWA 3K75B 4ZXKA 4CDXB 1E5IA 1W6PA 2P6HA 5C5TA 4CCNA 2QQUA 4XUPA 4ES8A 4QM8A 2Q8OA 1WWYA 4BQ5A 2VTXA 3RGBA 3VZLA 3E5QA 4GA9A 4ASKA 5DDJ3 4AFCA 4P5YA 4NO4A 2AEZA 4Q1PA 4KWLA 1SMVA 4N7IA 5EZWA 5DPNA 2GALA 1SHWB 5A80A 1KXGA 4COZA 1NA1C 1KS5A 1WMXA 1GUIA 1W05A 2K46A 2A6ZA 3LPGA 3NRUA 5T5LA 3HQRA 2NLRA 3K3OA 1R1A1 2VECA 4QQOA 5FY9A 1O8PA 1UAIA 3C7HA 3T1MA 3N7KA 4JGYA 3ETPA 4JDNA 2Y34A 3D6EA 5CNAA 3DYOA 3LCPA 5AFBA 2ZGUA 1JOJA 4LBNA 1RUC3 4YW4A 1CPMA 3Q8EA 2EIDA 3HT2A 2ZGOA 5L7OA 1FT9A 2GN7A 4PQ9A 3K2OA 4KBBA 3ATGA 4XABA 2TBVA 3LSEA 3PUIA 4JRLA 3O5SA 3M3QA 4N53C 1IOAA 1O59A 5F8PA 4CXWA 3UV9A 1VRH1 2LRPA 4CUGA 3SISA 5FY5A 3SH5A 1JZ6A 2DBIA 5FZOA 2JDUA 2QFEA 2QTWB 4GH4A 3UNPA 2HEVF 4YW3A 3R05A 4Y24A 5FYYA 4NIGA 3RYKA 5F6LB 2W95A 4FPJA 2OPWA 5KHGA 2RS33 2XH6A 1VAKA 4R8HA 4COUA 1B09A 3NAPA 2JIGA 4QM9A 2GP5A 3AC0A 3V65A 4CP2A 2WO3A 3BTZA 2UWCA 1VBC3 1ONAA 1RUI2 1AYM2 1W6MB 2BP6A 2X5IB 3APBA 2XGXA 4YSFA 5I8YA 1WUVA 3WDXA 1WD4A 1W8OA 5F37A 1LB2A 2QQIA 4N43C 3WW3A 1COV2 2VMCA 1ODMA 4URTA 4YLZA 3GDBA 2BJSA 4C1XA 1JZ4A 5BXXA 1W9YA 3CL1A 3D5OA 2WQ8A 3WQ7A 4P9LA 3B5LB 5H9QA 1RUD1 1ASJ1 4MHRA 1O3TA 2J1TA 4OI2A 3DKQA 4Z8BA 1SLTA 4ZPIA 4BA6A 1S0DA 1RVF3 5FZBA 2Q8CA 5IFPA 3I2FA 3IDEA 5JZGA 4MOAA 2QQNA 1C57A 3FLRA 2W1SA 1PMHX 2GC3A 1YJLA 2D6NA 3ME2A 5FZ3A 3TYJA 3VZJA 4CUAA 2RM23 3POBA 4OI0A 1FOD1 1F4AA 1RUF3 1SEFA 3M2MA 4GMP0 4IEWA 2C9KA 3A21A 4L8QA 2RHPA 5BNNA 2VVDA 5ACA3 5AC91 1DGWX 3VDAA 4CEWB 2A70A 1UYZA 5LB6A 3QCWA 4A44A 2BW8A 3HT1A 1FPN3 1NZCA 4X6QB 1XBFA 4FFIA 2W52A 1ENSA 1NT0A 2W46A 4E4DX 2GZWA 2B42B 4XJZA 2PA7A 4WBBA 2XKPA 1BK1A 2VAUA 3BYWA 2XONA 2F4PA 4NHMA 5FDBA 1ZRFA 4UW3A 3UKNA 2FCVA 3POWA 4LHNA 2ERFA 3WEZA 3U4XA 2ARBA 2CWSA 2Z69A 4FPOB 4JGYC 1F2NA 4GZ9A 4COVA 4QPGB 4XBNA 3INAA 3SCFA 2CWMA 5F2SA 1EP0A 3NO8A 1LHNA 1PX4A 4XFHA 1U12A 5FLIA 2BRTA 3JBG2 3KT4A 1EYBA 1OSGA 3S5QA 5F5QA 4MGTA 2JD4A 4OHVA 2OQ7A 2GC0A 1UU6A 4HN0A 2VCAA 1QJZA 1RUG1 3MF6A 1RHI3 5KXCA 1Q43A 1N1SA 3GHMA 1VBB3 1W6NA 3SMHA 3S0MA 2NM1A 4LIUA 5FZ8A 4FXKB 1XNTA 1VRH2 1YRZA 4XF3A 4XJUA 3RMYA 3H8RA 3AP9A 4GH4C 3W9AA 4MXWB 1QHDA 5CU1A 3BIEA 3VD7A 4A6OA 2WZEA 4XEZA 4LORA 4XPVA 4CU6A 2VUCA 4O65A 1RMU1 4G4FA 5IVCA 1KDMA 3EJKA 3QOPA 4F8AA 2V73A 4XDQA 4ZU7A 4QKFA 1NLQA 1SPPB 3BN6A 3SITA 3ZFEA 2AH2A 3ZFGB 3VBUA 1G9AA 2R061 1O3SA 2E32A 2XLFA 2Q1FA 3BCWA 3D3AA 3WOGA 4C8DA 4QQPA 5G05L 5BNOA 5C6CA 4FFFA 2RR13 2HWD3 2VULA 4FOWA 3K51A 4WM7C 3KVAA 1MQTB 3DN7A 3ZFFA 1O4TA 3W58A 1BBT2 3BTYA 5FAXA 2ZX2A 2C4XA 3AX4A 4CPBA 4CCDA 1U5YA 4EROA 1R64A 4OLLA 2RV9A 4QX8A 1O3RA 1DGRA 1XRUA 4DXRA 1O5LA 2WWSA 1EV13 5EYXA 3TEZA 4GWIA 1CWPA 3RZZA 4JKMA 3V0BB 2BEOA 2YDEA 4WVWA 5B4NA 4YFZA 5IWFA 3NQHA 1CESA 4HPKA 3UGFA 2VM9A 3MDPA 4JQTA 1YO8A 1SFYA 1UWWA 1W6OB 2FBEA 2GMPA 2NN8A 3DCQA 4NRMA 4L2NA 1MPXA 1QJY2 2XHKA 5T5OA 3WQBA 4AHYA 2RS51 1YQCA 1JUIA 3GZTB 2YG0A 1JH5A 5CFDB 1RUJ1 1LJ7A 3I2HA 2VZRA 5JVVA 1VBD3 1N3OA 2B4KA 2P2KA 4XMAA 2J1EA 4HSJA 1DQ0A 1LESA 4EV0A 2WNVB 2JG9B 1BHGA 3LQCA 3RVHA 3FFZA 2YBKA 3AMQA 4Q26A 4QKDA 2WFF3 4NPMA 3POFA 1ZBE2 4EN9B 5I0SA 3ZMOA 4XJ8A 3CJIB 3WY6A 1W06A 3KV5A 5A3LA 2CTVA 3RZJA 5JSRA 4C91A 2XLAA 3ZDVA 1TME2 4FAHA 4LO8A 1PGW2 2WNUC 4P02B 5FZ4A 3O1RA 1W0PA 1UMZA 3AKTA 4Q4Y1 3C8XA 2Y0OA 4R9CA 1NCRB 1YIPA 3OYWB 4SLIA 1WLTA 3WCRA 3AZZA 1CAVB 2QBXA 4AFDA 2VW2A 2BZDA 1RUG2 1R1ZA 4NR1A 3ILRA 4BU2A 3ZSEA 1I6XA 1LOAA 4JX0A 4G3YC 5IVFA 3FHIB 3OGGA 1U5IA 2VZUA 3CHXA 1YQ6A 1ULPA 4LBQD 1K5MA 4D0QA 4NRQA 5FUNA 5IAVA 1AR72 1RUE2 1S0BA 3TN92 3UK9A 1SFNA 1W39A 1F31A 4GJYA 1V70A 4CE8A 4R4XA 2CHHA 1RMU2 4GKYA 5J36A 3O12A 1LECA 3ZFEC 2A75A 2CGPA 2HWB1 3LA7A 3R6SA 3VBUC 4QX0A 2Q4SA 3KS7A 5IFTA 1ND2A 1F4HA 3KWVA 2VNVA 3JU9A 3IBMA 3IIAA 2HBUA 2N7GA 1QJX1 4RQPA 2OA2A 5EJZB 1LODA 1J3QA 4AI0A 4OI1A 3EHKA 4FPHA 2E7AA 4LKFA 3ZFFC 1S1AA 3HNMA 3M3OA 1Y9MA 3BTAA 3I2DA 4EN7B 1SLAA 3O1TA 2O14A 3LPFA 1X9PA 2O8QA 4D6RA 2C24A 1XC6A 3AKPA 4AVBA 5I91A 1HRV2 3SC7X 1DLLA 2W3JA 5FKBA 3ACGA 1WKYA 1ZX5A 2BGCA 2ET1A 4PF1A 4LHLA 4YW2A 5KHKA 1GSLA 5LZ6A 1YQ8A 2ZHLA 1Y43B 1TQ5A 1GQHA 2FCUA 1HB3A 2PHUA 1YFUA 4MHUA 1W03A 3ENRA 3IPVB 4M4RA 3WP3A 1RUI3 4UF0A 1AYM3 5FPBA 1PZ9A 1DGWA 2FDKA 3C7FA 2P3JA 1GQPA 3OGSA 2RS12 3JCIA 3Q8FA 4N90A 2Y6GA 3VHNA 3T2PA 1ULFA 1LNSA 4CEYA 1QOSA 2VMEA 2VOVA 2ZZJA 3I2IA 4OI4A 5FQ0A 4OHYA 4NHLA 3J7LA 5L73A 3ZYGA 2MHFA 2OPKA 1CX4A 5DAVA 3VKOA 2YBSA 2OKXA 1CAXB 3I4IA 4Q1RA 5E88A 3WNMA 4HK9A 1HQWA 2WL1A 3L2YA 4R52A 2RG4A 1H2MA 4DXTA 1ZRDA 4YRDA 1NA1B 2JKXA 1RUH1 2JB4A 1KRIA 3MPPG 4JHZA 5FZHA 4BE3A 1W2TA 2VBDA 4K7JA 4C0BA 1MZFA 2ZABA 1KJLA 1BXHA 1W9FA 2OW4A 1QOOA 1V6IA 1N1VA 1VBE3 1NG0A 3AYCA 3H1MA 3HMYA 3Q8CA 5D2AA 4XAAA 1D0HA 3OOXA 4RHV2 2XB6C 1G9BA 4KWKA 4LO7A 4AW7A 2JKBA 1CAWA 1PM7A 4PBOA 4A45A 3LFMA 2K2SA 1TMF1 1FV2A 3A23A 3O14A 3GJAA 4W4ZA 5F39A 4Q4X1 1ULEA 3POEA 5C3OA 1RJ7A 3KT1A 1JU4A 3VBSA 2ZGPA 1K5MC 4N53B 1X50A 4I09A 4AAXA 2JDAA 1E57A 3AMPA 2ZPXA 3VV1A 1HX6A 5JAXA 2P17A 5B4XA 1GZWA 3D0SA 2VZVA 2NQYA 5EIYB 4MG2A 3I97A 1UY0A 3HN3A 3JBG3 3OBZA 1ND2C 2ZHNA 3HAGA 2HWE2 3WW2A 3DV8A 4JKLA 4MH0E 3GBWA 3PMEA 5HV0A 3GYDA 5FO9B 3WP4A 3ZN6B 1W2AX 1QEXA 3P5BA 4FQZA 2J42A 4I3PA 4DIQA 1MS5A 4N43B 4UWDA 3QLQA 2UYBA 3LIHA 2ZMNA 4GB32 2W1UA 5FP7A 4LJHA 4ATFA 5A3UA 3WNKA 4BIOA 2BWAA 4M3CA 4CU8A 2CV6A 1ALYA 4ZONA 3USUA 1DQ6A 5C71A 2W68A 4ORFA 1BVP1 3I3DA 3PVEA 1GP5A 4QXKA 5F5AA 3H42B 1G9DA 4UYBA 1VE0A 4XUQA 4FP3A 5FFOC 3WDUA 3KCXA 2PELA 4XACA 4ZXEA 3EYPA 5C5UA 4UW5A 1XNBA 1RVF1 2LALA 3KGZA 3IIIA 4M4PA 5F2WA 5FXVA 5HCHA 2ZGLA 4QAWA 1OOPA 4BMEA 4IERA 4D7TA 4CEYC 3T09A 5LASA 3JUUA 5LWBA 2W39A 4QKBA 1AYN2 1W6PB 4DUWA 2YC2A 2AR6A 3LAGA 5EP9A 1H9PA 3G7DA 3RYRA 1BBT3 1H4GA 2RMU2 4I3GA 1JZ3A 1VBA1 5DXDA 2ZGRA 5EYYA 4JCKA 4CU7A 5JPNB 1GP6A 1YFYA 2EXKA 5DZGA 3ZXEA 3PTRB 4QD2A 4A7ZA 3AL6A 3D82A 1FPN1 1VMHA 2W2IA 3MUY1 2D5HA 3H1YA 2YROA 1W90A 3WF0A 3VZOA 1ST8A 3B02A 3O1PA 2OUHA 3PURA 2C1FA 2XVKA 1CZVA 1AL0G 3E6BA 3FBYA 2GC2A 3O0VA 1TNRA 5A3OA 5JPMB 4JGYB 2JXAA 2P3YA 5A6XA 1QJY3 3NVCA 5K9YA 1O4YA 4DRVA 2JIJA 2UYAA 4Y20A 2OYZA 1N1TA 2VMHA 2QQWA 2VC9A 1PVC2 4WZFA 3WT3A 3WNPA 1I5PA 5GLZA 2DVAA 3HBZA 1JYNA 1YJKA 1F15A 2YV8A 2VNRA 3IT8A 1AXZA 1O5UA 2J1RA 5KHHA 2FDIA 1TMF2 3FMGA 1ND3A 3T2QA 1VJ2A 2XJTA 2HWF2 2P34A 4YM2A 5A7PA 2IVJA 2VR4A 2XWBB 5FP4A 3RS6A 4NIAA 1W8TA 4M01A 4AQ6A 1UOBA 1POQA 1UYYA 2B8MA 4Y4YA 5LK5A 1CIWA 3WX5A 5L36A 1XE7A 1OHFA 1JHJA 1ZBE3 4AGGA 5C3QA 1LR5A 5FZOB 2DV9A 4F7ZA 2FDGA 3MW2A 4GH4B 3VLBB 1URXA 1TME3 2EIGA 4YM0A 2YHJA 5IW0A 4JRAA 4ITCA 3ACLA 1E5SA 2JD9A 2J22A 3NAPB 2HWC1 2Z5WA 3VDCA 1RTVA 1XYOA 4O9EA 1L7RA 3ITQA 4FAGA 1PIV2 2OX0A 4QPYA 2EXJA 2XJUA 1GANA 5DMYA 4RS5A 3ZIWA 4GKXA 3M3EA 3CQOA 2QE3A 2AC1A 3H3LA 3NV1A 5DAPA 5BPXA 2PMWB 2RR11 4UI9L 2HWD1 1E5HA 1AR73 1RUE3 1IQDC 3TN93 3ZX7A 3T0AA 2ADDA 1UQXA 1VIWB 2PFWA 4GMP3 4E4HA 3CJXA 4XFBA 3ZYJB 1UY1A 2MEV1 3VN4A 3S30A 4E9KA 5FPUA 1GLHA 1YQ2A 3QH7A 2XBO2 2IVIB 1LHWA 1AR81 5JOXA 2Y38A 1P8JA 1OA2A 2FQPA 4GIQA 1POV3 2VMGA 4FFHA 3POIA 4J1XA 2VZOA 1V0AA 5FPVA 4NROA 1YWKA 1WMFA 4XF0A 4WM8A 2HJIA 3NSTA 3MZHA 1PGL1 1J3PA 1RXFA 1VRBA 2XHNA 4UT5A 1PO12 1MEC2 3MYXA 4YVSC 4BYYA 1IG0A 1O6UA 4IEVA 4XTMA 3WHTA 4EE2A 1OD5A 2DFBA 4JV4A 4V2VA 5FP3A 1E5RA 1AX1A 1VBA2 2CGOA 5DAXA 1TVGA 3TEXA 2EA7A 2G9GA 1HRV3 1NY71 3ACHA 1DGRN 1HDKA 3PIGA 5CKNA 4ATEA 1LGNA 1NUKA 2EXHA 4AOCA 2G4IA 4Y1ZA 3CDZB 4OMCA 2B46X 1GP4A 1GYKA 2JG9C 2WS92 5FYVA 2D5FA 3M4FA 4UFKA 4CTEA 1FV3A 1GWLA 2WFF1 3KQ4B 2ZX1A 5FOJB 2RS13 3POJA 1FMD1 5JI7A 4HK8A 1VB2A 3C2UA 4L97A 2YFUA 4XW3A 4GULA 4BDVB 2XR4A 2WNUB 2YU1A 1V9U1 4AI1A 5GZCA 2BBAA 2OT7A 3RFRA 2P1BA 5EWSA 1RJ8A 4P9WA 2ATFA 1ND3C 2GN3A 3ES4A 5LBEA 1QJU2 1DBNA 1OF3A 1PNFA 2XVGA 1OLME 1C3HA 1W6NB 2DF7A 5JIUA 1Y7BA 5JUVA 4FTEA 2WZR1 3WW1A 2ZKLA 4Z82A 1MS4A 3CF6E 4IEPA 2VOKA 5ABJC 4OZOA 5K7PA 2BERA 2P3IA 1F5JA 3BOWA 5HXMA 1AL22 5C8CA 4IEUA 1APNA 4XAEA 3AFKA 4CXXA 2Q5TA 4Y26A 4JDOA 1SLBA 4QPIC 3PMSA 3AYDA 1MVEA 1ZBA3 3POSA 4FPLA 2BNOA 3ZFEB 3VBUB 1HKDA 4RHV3 3O1UA 2HH9A 3AXDA 4YZ3A 3RPQA 3LA2A 3IDAA 1S0FA 3GZUC 2P3KA 1GICA 4S2GA 5DABA 4AI8A 5BNOB 4XQ4A 4QWNA 5DN2A 3AL5A 3ZN5A 3VD9A 1UL9A 2QKDA 4XHXA 4Q4W1 3AKQA 4LO5B 3IM0A 1IHMA 1H8TC 4NUBA 1Y9QA 4LK6A 3KMHA 4YG3A 4H7MA 1W9SA 2ZA9A 2IXCA 3ZFFB 1S0CA 1Q5OA 1FAYA 1REDA 1IS5A 4FI9A 3JB8A 4AR2A 3ALQA 4ZKTB 5FPXA 2DYCA 1C8M2 1OKQA 3PUAA 5LA9A 2R6QA 1HXS1 2TUNA 3OGJA 4X8PA 4NAOA 2Y6HA 2HWE3 4Y1VA 1AR82 4AL9A 1LULA 3H0OA 1RYYA 2DCYA 4HPKB 1QQP1 3N7LA 3U37A 4WM8C 3BOPA 5C9AA 3E6CC 5IVBA 3H3ZA 1YXWA 1CZTA 4QXCA 4HONA 5A7NA 4OQ8A 3PDQA 5HXVA 4QB1A 2RJLA 4GB33 3VBFC 2F17A 2OVUA 5JMCA 4Z2WA 2VW0A 1NKGA 4M00A 1SACA 3AFGA 3S7EA 2NP0A 2E63A 1QMJA 5JSPA 5HCBA 1CIYA 2B45X 2HEYF 2QUOA 1JYTA 3LFIA 2W5FA 5LK7B 5BNPA 1JYVA 2OIIA 4BQWA 2DUOA 4IV3A 4GJZA 3KV9A 4LA3A 1UZZA 2D93A 2BUKA 4XBQA 4AWDA 3ORJA 5FREA 2VXJA 3I7DA 4LNVA 1CD3G 3RJRA 5CISA 2QZ2A 4LR4A 1WD3A 2ZMKA 2R041 5DQ0A 1AR62 1OH4A 5GKAC 1AYN3 1LOEA 2XQXA 2D3PA 1SG3A 1C8NA 1N1YA 3H8UA 3ILNA 3MIHA 4QX7A 5DAQA 3LWCA 1FNZA 2RMU3 5DUWA 4CDUA 4LT5A 5J1XA 4CSWA 1SCSA 1V6JA 3C7OA 1VBE1 3LB9A 1MR5A 1ZA7A 2WQ4A 5FY8A 2PLV2 3T3YA 3AM2A 2VZPA 2F4LA 4QQ2A 2HYXA 1OVSA 4A7YA 1TNFA 2WLPA 4CP9A 1ENRA 3BVCA 2ZOEB 5C8CC 1K5MB 1LGBA 1XNKA 1BK0A 1YYNA 2UWBA 1JYIA 1WLDA 3FHAA 2IXIA 3I2JA 3ZXLA 3AZWA 1WGPA 3RDIA 1ULGA 5E6HA 3NJXA 2I74A 1QH6A 5A3WA 5I93A 4QDRA 4AQ2A 5JCTA 3H9AA 4CCKA 3OCPA 1JODA 3PJQA 3ZXAC 1PVC3 1ZYBA 5T54A 5CFCA 1LTEA 1ND2B 2BFUL 1PO22 3HR9A 5T5PA 4PIZA 1FATA 2IXHA 5H9RA 5FWJA 1DHKB 1BEV1 5IVEA 4FOVA 3OGVA 4GWJA 4WVVA 4MYEA 2ZAHA 3GXUA 2HWF3 1W28A 4RQPB 2VMDA 2LTNA 3B00A 4L92A 2BFUS 3AK0A 2P37A 1OQEA 3O0WA 4QT6A 4OZXA 1C5IA 1OURA 5KC6A 2BTVC 4G9SB 4LO4B 5CADA 1ZZ7A 1R091 4FBFA 3D0JA 1UXZA 1JZ5A 2CYFA 5L19A 3J8F1 2WO1A 3U07A 5J37A 1XB9A 3K3NA 2WA4A 1OXCA 2QZ3A 3ZKYA 1D4M1 3GALA 1I3HA 1Z7S1 3K46A 1AZDA 3JD71 4LHKA 5C9AC 3VDDA 1IZ3A 1ZZ9A 3IN9A 4UF0B 4LTAA 4K8RB 1PIV3 1UF2C 2JDPA 2WNOA 2A3YA 2ZGQA 4IE0A 5FV3A 5FZKA 4JTNA 3FX3A 4XQDA 4BXSV 4PHZA 2ZEYA 1WCQA 5LCWL 1W8WA 5LEKA 3RWKX 1HB4A 4CEYB 1UCXA 2J1AA 3AJZA 5FQ0B 1AR92 1J59A 3ASIA 1X9TA 2Q30A 3C7GA 3J9SA 4MZUA 4YNIA 4MVTA 1DYOA 1US3A 3THPA 1HIXA 1LAJA 3A4UA 3PVBB 4U36A 1DZQA 1W2NA 3NV2A 2A73B 4AAPA 5FZIA 4BH9A 1IS3A 3WR0A 1UKGA 1IQAA 5BNPC 2JB8A 1VAVA 5FP8A 3HNYM 1W0OA 3LEKA 2ZX0A 1HRI1 2XBO3 4HLTA 3N4MA 3E5UA 1PK6A 3C3VA 3ABZA 3LE0A 1QXJA 1QDOA 5A1LA 4UW4A 3WDWA 2Y6LA 2DU0A 3OEBA 2DVGA 3B93A 3WG4A 3OD0A 4META 1XE8A 4LBOA 3U78A 1PO13 1ZZ6A 1MEC3 1DQ5A 1C1FA 1R1A2 1W3XA 5FY7A 3KD4A 1HV1A 3RI9A 3ZSJA 2IXLA 3THCA 4DXZA 1KFUL 2VPVA 2XUEA 4O9GA 4KGQA 2D40A 5L7OC 3WLUA 3BODA 1CAWB 4K21A 1O7FA 4BZ4A 3LGRA 5F3IA 2R071 2B5HA 4IESA 4UFMA 1WBFA 4JGZA 4Z07A 2XJRA 2A6YA 1SZBA 3KVBA 1C4RA 5FY4A 4LBLA 2WDBA 3JXSA 2WS93 4MO3M 3B69A 4EWEA 1GZWB 3O0XA 1WMEA 4CCOA 2YPJA 4CYDA 4P9XA 3MFAA 3V0AA 3BKZA 3DYPA 3I3QA 4AFBA 1IPKA 4DEVA 3KSCA 2AYHA 1F9KA 5D8AA 4TYSA 3WF1A 5SV8A 1UN1A 1VALA 3NAPC 2Y8KA 1GZCA 3T1LA 1QJU3 3UETA 5IHRA 3N3HA 2DTYA 3WQ0A 3THTA 1HQNA 1QY4A 2XJSA 3ILFA 4MX3A 4IGPA 5HCFA 1UOFA 4EJRA 4I01A 3OBTA 1H0BA 2PQQA 1R092 2DFCA 4M3CB 1AL23 1LRHA 3LF7A 3OB8A 5A1AA 3U10A 2D3RA 2IC1A 3FUQA 4PCRA 3USUB 3VGIA 4AEJA 3VL8A 4AQSA 4URAA 4MLOA 5ERLA 1NQJA 5FPLA 4TLGA 3VL9A 1VMJA 2KD7A 4ZZ5A 2J1VA 4XXAA 1RUD2 3E97A 1RL3A 1ASJ2 2D6LX 3JD72 1BJQA 1XU2A 3R4SA 4LLOA 4RGGA 2ZCWA 4U2AA 4UOJA 5T55A 5A3PA 5F3EA 4E2GA 3NJZA 3BI3A 1A78A 1KS4A 5JZGC 1EAH1 3VDBA 1OOPB 1W8HA 3KGLA 4I0BA 4XDOA 3VZMA 2WWJA 1I9RA 1REFA 5A33B 2DVDA 3ETQA 4YVSB 4XBLA 2GH8A 2AGSA 1CJPA 1FOD2 1AJOA 2XJPA 1DP0A 3NWKA 2JE8A 4P9YA 4IDZA 3BALA 3NJVA 5BNNC 3FE5A 5KXDA 3TEWA 1Z0HA 2XKOA 1C8M3 1UY4A 4NN0A 3WV6A 2ZKNA 5AC92 2X10A 5IAXA 3RSJA 1U0AA 4DMIA 3VKLA 4KMQA 3MIGA 1G6NA 1AXYA 3V56A 4YW5A 4FFGA 2ARCA 4DFSA 4RD7A 2RE9A 1BQPA 2PN5A 4OHXA 4ES9A 3ZYBA 1V6MA 2VD7A 4CP1A 3ZPOA 4YWAA 4Q4V1 2VG9A 2D3SA 4NMIA 3DF0A 4Y20B 1JMUB 1RITA 1X7NA 3F2ZA 4XZUG 4Y1YA 2BWCA 4CCMA 3OUJA 5KBFA 4Y4RA 4XFGA 2IFRA 3OEAA 3FJSA 2RDRA 3O1MA 3LEIA 4NRPA 1UY2A 3NJYA 3G6JB 2ENRA 3WXPA 4UW6A 3EO6A 4JGZC 1ND3B 3IWZA 3T08A 1H2NA 4OCTA 4WVMB 2V09A 1QH7A 1XOYA 1X8MA 3V64A 4JZRA 4QGMA 3TEYA 5EQUA 4P9JA 2JDNA 1LOBA 3AP6A 3SXWA 4EZ4A 1JZ8A 1OBNA 3LSDA 4RSUA 4DRRA 5ABJB 4XF4A 4MGKE 1UO9A 2ZEWA 3I2KA 4BK4A 1AR63 3AMHA 5I0RA 3WCSA 2DCZA 3MICA 1R081 3AVSA 1XU1A 1W8FA 4BWOA 1PGSA 4QPIB 4QQLA 4UFLA 5D8AC 3TNQA 1O3QA 3MHZA 4AHWA 4TWTA 2FDHA 1ZBA1 4XYXA 3H50A 1S2BA 2ET7A 5M0TA 2J7MA 1I1EA 4OHWA 2Q1MA 2WT1A 4IEZA 1UD1A 2PLV3 1N3QA 1EY2A 4AVCA 2R062 3URFA 4RS5B 1DQ1A 1ZRIA 2AEYA 2FMDA 5BNOC 2DUPA 3WNXA 1DQ2A 1TEIA 4XMIA 3Q9OA 2UU8A 1FNYA 1H8TB 2E6VA 4HZFA 4YVWA 3ZDSA 4F3JA 3QBQA 1W3VA 3MIEA 4QXBA 3WNLA 4HFSA 4L99A 1O4ZA 4IEYA 1BMV1 5CZKA 3LDBA 1PO23 2EXIA 4RYDA 2EVXA 4YYOA 4I02A 1XNDA 4NE9A 4XFFA 4LUKA 2A6WA 3L9JT 1EAH2 5C4WA 4CRQA 4IGQA 4WM8B 3M8LA 4Y1XA 1ULCA 5GLUA 1D0GA 4QGLA 1PHMA 3IKWA 1VMFA 2W0XA 1C28A 1YCIA 1S0IA 5SV5A 4SBVA 4DNYA 3VBFB 1IPSA 4S2HA 2PXJA 3HNBM 2RS52 1COV3 3MBWA 3P1IA 5KHJA 2A6XA 1DF0A 4HVOA 4NOTA 2JECA 1RUJ2 2O0OA 3N9QA 2BVBA 3WD5A 3B9CA 1XSRA 4YW6A 3ZMNA 1XYNA 3ZKUA 2RDNA 4ET7A 4XE9A 2WRAA 4CU9A 2JX9A 4DQAA 1UZYA 5DDJ1 1HLCA 5EHDA 4A42A 2HLEA 3LA3A 2ZTNA 4GXLA 5D1IA 5LRSA 1BZWA 1RB8G 5FZ0A 5JOYA 1AR93 2I45A 4ONUA 4QB6A 1UU5A 1UIKA 2QQVA 2VUJA 2VZ1A 4JDMA 1H2LA 2GDFA 4XDPA 2VZSA 3UESA 1C5HA 4LQRA 1O8SA 1DIWA 1W0NA 3LOBA 2EICA 4A3ZA 4Q4Y2 3DL3A 4N9IA 1RUC1 2JWPA 3AYEA 2BOJA 2BV4A 4DZGA 2D6KA 5CVRA 2X29A 1MS0A 4CEWA 3BU0A 4FXGB 5BYNA 5FZGA 1LHOA 2OQ6A 3WG3A 1NX9A 2MNGA 4RGKA 1UU4A 4UBGA 3I2OA 5C8CB 3UL2A 2WWUA 2Z42A 4I30A 2W1QA 3GGLA 3H1WA 4B29A 1REEA 1L3JA 1S0GA 1W9WA 3DGTA 3HOBA 4IEXA 3NV3A 1QWRA 2VBBA 4M3CE 5DUVA 2FMYA 5FUIA 4AEDA 2VZTA 2YY1A 5FYHA 5K8SA 1YQ5A 3CMGA 4UAPA 1Q8QA 4XCAA 5F1RA 2HWB2 3WP6A 1K45A 3RZKA 4AVAA 4PLOA 2RS31 4P5HA 2A71A 1H9WA 3SEPA 1RIRA 3KV4A 4RQPC 1H1IA 2VMFA 4MXVA 4AVSA 1QJX2 1VBC1 3PLQA 1ZVFA 1SFPA 3PIJA 1IS6A 4YVWC 4AE2A 3HPNA 4TZDA 4NIHA 2B9VA 3LOIA 4LBQA 1VRH3 3OPZA 1GR3A 1GZTA 4JKKA 5K0UA 3UGHA 4BHPA 2BGPA 2XXZA 2ES3A 4Y5TA 4YG0A 3VKMA 4AQTA 4XUNA 1A34A 5CIRA 3O1OA 2WT0A 4ISQA 4ZU5A 3N9PA 3PUQA 5C9AB 5C4WC 5JMOA 1N3PA 1BCXA 3RZLA 4YFWA 3WW4A 1KITA 1OMIA 3A0KA 5CYYA 2K9ZA 2W87A 2B39A 1H2KA 1WCSA 4CA9A 3T2TA 2CDOA 1NOVA 1ODNA 5IT6A 5EPAA 4XHBA 1X33A 1HW5A 1IGOA 1V6KA 2RM21 4NWVA 5BUVA 4L0PA 4OQ9A 5E89A 1D2SA 1RUF1 1VP6A 4F83A 1YI9A 5C3SA 1JXNA 2A6VA 3I49A 5FWEA 5FO8B 5BNPB 1FXZA 1RUD3 1B35A 5ACA1 1ASJ3 3AMNA 4IV3B 5A3MA 1ZZCA 4IE5A 3CKHA 4LK7A 4DS0A 3U75A 3M70A 5FLJA 4EN6B 1PMIA 4BMBA 5KC5A 5A6YA 1CQ9A 1IKQA 4TN7A 4RA0A 1ENQA 1Q8PA 4GWNA 1OQDA 1ULOA 1RUH2 1SLLA 4KGGA 1CR7A 3AZVA 4CP0A 1C1LA 3ZLIA 1GMMA 1GWKA 1MACA 5IUQA 2JG8A 1FOD3 5JXJA 4CDUB 2YGMA 3PL0A 5HBAA 4NAMA 1QOTA 1AUYA 4AG4A 5AC93 2JDYA 2CAVA 2G9ZA 4WVZA 5L7OB 1Y3TA 5BV6A 1UYPA 1Y9GA 5T52A 3MEPA 4PDWA 1ZREA 5D21A 2IUWA 4CP9B 5L9BA 2QDRA 3VBSC 3CEWA 4XJAA 4Q4X2 4E2SA 5KXEA 3BUCA 5KHIA 4N8MA 4ASLA 1RHI1 2J1SA 1LU2A 1IG3A 2Z79A 4CVUA 2B9UA 1VBB1 4CCCA 3GBFA 1OUSA 5CAZA 1OH3A 1W6QA 2QNKA 4WZCA 3WQ1A 5LA0A 3ELNA 2D6MA 4D8MA 5DAWA 4PT6A 5CFCB 1WCKA 2NPIA 5A3TA 1OA4A 4V2WA 1J1LA 1OQ1A 3NNGA 4LEJA 3E5XA 2BNMA 2I07B 3SCHA 3THDA 4A3XA 3OPTA 2RS32 3KCCA 2DU1A 4I0WB 4MSVA 2PAKA 5FPZA 4AHXA 4QKNA 5CG9A 5GZGA 1RUG3 5C3RA 2WZ8A 3HQXA 4JHTA 4V1PA 5FJKA 3IAQA 4R4ZA 1J3RA 5FYIA 3NNJA 5F32A 3MO4A 4BISA 5KWRA 5GLTA 4EYUA 4KNCA 5K0UC 2YZ4A 5LEJA 2VZ3A 3NKTA 2ZXQA 4IEQA 3WP5A 3DPRA 4XXPA 1AJKA 2BVVA 3NW4A 5T5JA 2VOTA 3I3BA 3PVOA 5A7WA 4IW3A 1W8UA 1RMU3 3KV6A 3AVRA 4R9BA 5J3UA 4HKOA 3JZVA 4P00B 2GNTA 4N9HA 3RWNA 5JXHA 1HV0A 2MPFA 1SBFA 2R063 4HXCA 4LLFA 1HB2A 5JZGB 4J25A 1RVF2 1EV11 2A3WA 3PJYA 4ZY9A 2V4AA 1OOPC 3PHMA 1UX6A 4JC1A 4XF9A 2A1XA 3NMBA 5FP9A 1GV9A 3OPWA 1WMDA 1YLLA 5TSWA 2HYKA 2ZGMA 1D4VB 1H6YA 2VU9A 4HN1A 4NHYA 5BNNB 3RZGA 4Q29A 5EV7A 2E51A 1B35C 3W5MA 2DCKA 4LE4A 4RR3A 2QQOA 2WAOA 3KHCA 5FYUA 3RMXA 4OHZA 4W8JA 3WDVA 5A70A 1VBD1 3RYPA 1FPN2 2XJQA 3WDTA 1DDLA 4OVEA 4UBHA 4KG8A 5L9VA 4YZ1A 2WKKA 2ZX3A 4XURA 3WVJA 1GNYA 4FO9A 5FUPA 5IK5A 2JG8C 2R0HA 4AEMA 2ADEA 4KH9A 4XJWA 4YZ4A 5LA1A 3OUHA 4GALA 2GAUA 3MI8A 4KWJA 3MIDA 5FLHA 4FPFA 1OPMA 3BGAA 3LKJA 4O7XA 4IEOA 5F5IA 1YI7A 4PDWC 4JGZB 3FN9A 2YXSA 1JTZX 3AP5A 5FJHA 2VTFA 1EPZA 2SBAA 4JTOA 2YYOA 4Y22A 4YGCA 3MIFA 4AF9A 4AI2A 1LGCA 3IMNA 1VBB2 3ZVXA 2DVFA 4AGRA 4UFIA 3V0AB 2CDPA 1V00A 4HMZA 4MV2A 2WSUA 2XMLA 1A8DA 4B1LA 4QXHA 1CJDA 5D8AB 5J98B 1LEDA 3SNMA 3WF4A 4RGAA 5FMDA 3WSOA 2G19A 4CCJA 4Z2AA 2HWC2 3OGRA 4PLMA 2X09A 4Q4Y3 4YGDA 3TNPB 1Q56A 1TE1B 1AX0A 4OYUA 3GF6A 4XUOA 3T0BA 1PZ8A 2BDRA 2PQSA 1UKRA 4D69A 2V5DA 4O61A 4RS5C 1VAMA 4LA2A 3PTYA 4D7YA 3MGUA 4K20A 1IPJA 2Z4FA 4P9GA 1YC61 3WUDA 3P6BA 5F3GA 1PMJX 1UZWA 1JW6A 2RR12 4CDWA 1JYXA 2QQMA 3DPRC 2HWD2 3WF3A 1LENA 2VCBA 4QX1A 4RFT0 4K8FA 1V6OA 5HPOA 1HN1A 5ISLA 1HJGA 1N47A 2NZ9A 3WINE 5E8AA 1YNAA 2JE7A 3TOJA 2MEV2 4C1WA 4Q5OA 5EFUA 1MS8A 2HWB3 2VMIA 2D6OX 2GNMA 1WW5A 5LW9A 5JIAA 2YC4A 2XWJB 3DKWA 4YZ5A 4E8CA 2HEWF 4LOSA 5HI0A 1YIFA 1QJX3 1PGL2 1YFWA 1Q8VA 3I8TA 1RUI1 2DDUA 1AYM1 1UZVA 3J7HA 3OG2A 4J6GA 3KLSA 4NPLA
chains in the Genus database with same CATH topology
1Q8OA 3ZXJA 2PHDA 4YGBA 2O8OA 2H6BA 5J09A 3FWEA 1COV1 4RR3C 1GQGA 1X8EA 5JSOA 5JOZA 4YM3A 1SCRA 1NY72 4NWWA 5GZDA 3POYA 5DZFA 2RJKA 3AXEA 5FTTC 2B7YA 3ZXKA 4XTPA 3A0NA 1J58A 2JENA 4E27A 2PHTA 4K3UA 4A2UA 1NE4A 4AVVA 2WFF2 3B9IA 2E53A 3VHPA 1MS3A 2AENA 3MIBA 2VNOA 1QKQA 1FMD2 4AHZA 1AF9A 2DUQA 4YW1A 1V9U2 2XUMA 2QVSB 2ZX4A 3I59A 2R1DA 2WC2A 1G9CA 3FZ3A 2IZWA 3RG0A 1NCQA 2PHFA 3SLIA 1VB4A 2WZR2 2X8KA 5FRAA 5T50A 2ETEA 1NXMA 2NYYA 1RUH3 2VNGA 4CDQA 5J48A 1CPNA 4K9SA 3VKFC 4D94A 3X29B 2UWAA 4S2FA 5J96B 4NPRA 3ZXGA 3AP7A 3VBOA 1WW7A 2BQPA 4IV1A 3H7YA 3JBG1 1DZRA 2JDZA 1TMF3 3HIFA 4Q0SA 1CAUA 2OZ6A 4Q4X3 1XXNA 1G7YA 4YVWB 4Q4W2 4CDWC 2AZ5A 4GQ7A 3UKTA 2GNBA 5GZEA 2WINB 2BPA2 1I5ZA 4IXLA 3RRDA 1UW8A 1HXS2 4AVTA 1G9FA 4Q0PA 1LOGA 2VY0A 4BOWA 2HKXA 3TWIA 5C4WB 4YGEA 5AVPA 4PF5A 1V6LA 1QQP2 1YFXA 3ES1A 5I8SA 3AYAA 1LHVA 3ZSMA 3WZ1A 3EXUA 4A7KA 4OUMA 4IQPA 2I2SA 2Q0AA 4BM8A 4HVRA 3R4DB 2CGNA 2R0FA 3RJ2X 3ROUA 4LO6B 1DQ4A 2KXLA 4PLNA 2QCSB 4FPEA 4WM7A 1BBT1 3MFCA 5CG8A 2PHWA 3H7JA 4IV3C 3B7MA 1EPWA 3ZYIB 2DCJA 1PZ7A 4HKLA 2ZGKA 3VHRA 1MZEA 2R042 4E4ZA 4Z92B 1QF3A 2XVLA 1GZ9A 1S2KA 3AKRA 1QJY1 4CDUC 2X53S 1VBA3 3OBRA 3R0RA 1NCQC 1VBE2 1CN1A 3FC0A 4JQRA 4HETA 3VBHA 3H3UA 3OY8A 3EQEA 5DUXA 2VOXA 5E16A 1POV0 1BKZA 4CDQC 3VBSB 4FTSA 2VUAA 3RI8A 1ULDA 1W2UA 2EF6A 2Q1ZB 4DOUA 1DYPA 5CA6A 2KA3A 2NMOA 4ZU4A 4AEDB 3WUCA 1WA4A 2ZBJA 2ZGTA 3VBOC 1ZBE1 2YGLA 5IK8A 5CFCC 1RGSA 4IV1C 1U5ZA 3MPBA 2XLGA 3VBRA 1RUNA 3N36A 1GKBA 1TME1 1PGW1 1G86A 2WNUA 4K1ZA 1BEV2 1IS4A 2TNFA 4XOGA 4X8NA 5BY5A 1U5XA 2KM2A 3ZPYA 2UURA 1VR3A 4LBQB 3ZSLA 3PNAA 1A3KA 1GNHA 4YZ2A 5K0UB 1H1MA 1X36A 1AVBA 4DY5A 1OPOA 3J8F2 2WIIB 3MLLA 4LULA 1AR71 1RUE1 1UIJA 1MS9A 1WW4A 4MUVA 3B3QE 5GJ6A 3OTFA 3TN91 1D4M2 1H4HA 2HWC3 4GMP1 2FZ1A 1Z7S2 3VDDC 1DZTA 4H55A 4AYUA 4W65A 3L2HA 1POV1 2IFWA 3AB0A 3N35A 1JUHA 2D6PA 4RL7A 4M3CF 3ST7A 3UJQA 4HSLA 2XJVA 2PAEA 3ZIXA 5H9PA 2R16A 4PBPA 1B35B 4XZPA 2MEV3 1PK6C 3GZAA 1HRI2 1HRV1 2VOWA 3PVNA 3VKNA 1AR83 1OFSA 4I2OA 4Q2FA 4OULA 5DZEA 2H6CA 5A32A 2JICA 4XFCA 4XIKA 2JG8B 2VQ0A 4WV8A 2OZJA 2BYVE 4HANA 2E7QA 4ISRA 2ZACA 4TLFA 2RS11 3KT7A 5GALA 3UKVA 2DCTA 2BNNA 2V5YA 4FPKA 5GLVA 2D44A 3VBHC 3MW4A 2XL9A 2YUEA 4PDWB 5F9TA 1SQ4A 5FMOL 2WLQA 2R072 4MGZE 4CDXA 1OFNA 3CO2A 3QH6A 4AFMA 4HBNA 3GBGA 2IXJA 1FI2A 3KQRA 3M3CA 4W6WA 4M0NA 5FMOS 1W6QB 3N7MA 3FLPA 1KDKA 4XJ9A 1YUDA 4D3WA 2ZGSA 1IKPA 1ZZBA 1FMD3 2CNAA 3VBRC 2D97A 1S0EA 4PIYA 3FLTA 3CU7A 4E2QA 1V9U3 3U0ZA 2R1BA 3USSA 2VW1A 2ZS6B 2Z2SB 1Z78A 1LOFA 3E6DA 4RHV1 3J4UH 3BPZA 3GNEA 2WZR3 4L11A 1DG6A 1AHSA 3FBMA 3MLKA 3J26N 2EAKA 4FT8A 1MZ5A 4LBMA 3DPRB 1FYUA 3NV4A 5LRRA 3VHOA 1G8WA 2WJSA 4OUSA 3IDBB 2ZJCA 4KG0A 1A8MA 4I0AA 2ARXA 2D7FA 2HWE1 4COYA 2F6BA 4AI3A 5JDBA 3IDCB 5EJ3A 5C33A 1OLRA 5EXOA 2R30A 2ZHMA 4D7SA 4Q4W3 1KJRA 1ENXA 2VXRA 1F5FA 2DWRA 1BYHA 1W6MA 2X5IA 3ZYRA 4COWA 2E7TA 4P9IA 4GB31 4EN0A 1Q8SA 4RR3B 4FPCA 3RNSA 4LE3A 1HXS3 5CBLA 2IXKA 1AXKA 1FX5A 5DG1A 3AKSA 3MW3A 5JI9A 1S55A 4N7UA 3O7OA 1UPSA 4YARA 1QQP3 3WG1A 4BLIA 1NYWA 4XILA 3OJBA 4Q4V2 3SCGA 2H0BA 4XETA 4AXOA 4NHKA 1JHNA 3JB4C 2CY6A 1ZZ8A 1LHUA 2SLIA 4B7EA 1AYN1 4DY3A 3NL1A 1GFF2 1WW6A 2XPJA 4CDXC 3RQ0A 2D98A 2RMU1 4Y22B 4K1YA 3OD4A 2CAUA 5I8TA 4XFIA 2C9AA 4B7KA 4AFAA 2C0ZA 1CONA 3KM5A 4MGIE 5FCCA 5AVAA 4FTBA 2R043 3JQWA 4FOYA 2BBVA 2PTMA 3MF9A 1R082 1R1A3 4EWAA 2QJVA 2GNDA 3TBDA 1ZBA2 3P3PA 4W6YA 1LEMA 1QXRA 3ECQA 3M3IA 2UY8A 1PVC1 4QPGA 1LOFC 4E4SA 2CL2A 2WA3A 3BIWE 4BPZA 4BIFA 4Y1UA 1H30A 2VH9A 2GMEA 3ZXFA 2EALA 3SH4A 2HWF1 4B8EA 4IL7A 3OF1A 4CZSA 4XF1A 4CDWB 4QQHA 3HN1A 3M1HA 2GMMA 3WDYA 5FO7B 4LBKA 1NQDA 2YMZA 5F6KA 4Q8LA 3HD8B 4QX5A 1LCLA 1BMV2 3SHRA 1JN2P 2A3XA 3B01A 3EBRA 1ZM1A 3W59A 1VLNA 4UXAA 3ZXDA 4H7LA 3D8CA 1KFXL 1GNZA 4MXWA 4AK3A 1BEV3 2LUWA 1JBCA 2FHRA 1CVNA 4Q0VA 4J1WA 2ILMA 4FOQA 1X82A 1DYKA 2DTWA 1PIV1 2WQZC 5IK4A 3ZFGA 3I54A 2X5IC 4Q0QA 2WNEA 4FP2A 1R093 2C5DA 3J8F3 4AGVA 2PHXA 1MS1A 1XYPA 3MLJA 4DINB 1D4M3 2FZ2A 1MQTA 1Z7S3 4HL0A 3JD73 2QDNA 4FPGA 2GSYA 3KCYA 2XBO1 1BVVA 4Q27A 5DDJ2 1QU0A 3ZO0B 2JJ6A 3TB0A 4BQ1A 3NKGA 4XIOA 2E9QA 1MZ6A 1M06G 2EAAA 3V0BA 5DUUA 1NLRA 2DURA 3GHNA 2WZPP 1RINA 1PO11 1MEC1 1YHFA 1OA3A 1W6OA 5A33A 3CLPA 3I59B 2ZMLA 4YVSA 5E1RA 4ASMB 1NCQB 4K6BA 1RUC2 1HRI3 4CEWC 4Q8KA 5CFDA 4QGNA 1Q3EA 1JYCA 5JLVA 4XFAA 4CDQB 3KB5A 3K48A 4H14A 2WFPA 1RC6A 3BU7A 2WS91 3P3NA 4AEKA 2WNVA 1AX2A 2JG9A 4XQWA 4AEDC 3VBOB 2LM3A 5T3NA 2QQPA 1NLSA 3KZ4C 3TAYA 4IV1B 4DB5A 4QPGC 3VUOA 1OI6A 2W08A 3CJIA 3HWJA 4H3WA 2R073 5GZFA 4Z1VA 4HVQA 2Y26A 1CAUB 1HQLA 4GWMA 4PJYA 1QJU1 1NCRA 3OYWA 4C90A 4EWDA 4X6RB 1VBC2 1CAVA 4WVMA 4B4RA 3M7AA 3AP4A 2R32A 5H9SA 2AUYA 2OUJA 4YG6A 3FFQA 5CB7A 1ZRRA 4HKWA 4KQ7A 1NXD1 2GH2A 2JEMA 2PHLA 4K40A 5ABJA 1AL21 1ZRCA 5FOBB 2G9FA 4P14A 4QPIA 3N7JA 4R9DA 3VDDB 2VVFA 3AJYA 2YC0A 3UJOA 2A5ZA 2PAMA 1SBDA 3ZFGC 4NVPA 4LBJA 2VVEA 5J7MA 4FSJA 1DU3D 2O1QA 2R49A 5GLWA 1GBGA 5C8WA 4KU7A 1KD7A 2AREA 2RM22 2ZGNA 1H8TA 2VQAA 3CNAA 2D43A 4WM7B 1RUF2 1MQTC 1C8M1 1SDWA 5FBZA 5ACA2 1PK6B 1WLCA 3QD6A 2IWGB 2ZAAA 3U11A 1ZNPA 5AFEA 3S7IA 3FUOA 4L9BA 4FQ4A 1EAH3 3R4UA 1PVXA 1LU1A 3VZNA 1CGPA 4QHBA 5B2GB 2NMNA 4BCUA 3IPVA 4FPYA 2RS53 1PNGA 4QMAA 1H1AA 3VBFA 4YM1A 3VBHB 1M4WA 1RUJ3 3AMMA 3OY8B 5CFDC 4FVVA 1J1TA 3AZYA 1T6GC 5DG2A 5JR7B 2XG3A 4MGYE 1QXPA 3S6PA 2WNVC 1XNCA 1CAXA 1RHI2 2TEPA 4QU2A 1SBEA 4Q4V3 3WG2A 3VBRB 1NA1A 1AR61 3CJIC 2WSVA 1H8VA 2WT2A 4TSVA 1QNWA 4Q0UA 1O91A 4Y5Z0 1RUOA 1NCRC 1DFQA 3ZSKA 2PLV1 2UY9A 2H0VA 5I0TA 1V6NA 1XQNA 2K0GA 4KU8A 1DGLA 4B3NA 1SLCA 1KQRA 1OLQA 3QACA 3B94A 4W6XA 1A6CA 4B4PA 3AZXA 4R9AA 1R083 3D4KA 5I0UA 2A7AA 4N53A 3VZKA 1LOCA 4KL1A 2VGDA 1MVQA 2Y0IA 1PO21 4PIXA 1NE6A 2PYTA 4IETA 2JE9A 1QGLA 1EV12 2DVBA 5GM0A 2ZHKA 4JVAA 4DPNA 3TRSB 3ZN6A 3SH3A 4C0HA 2PHRA 5JOWA 4FCAA 4INDA 3ZYPA 5HCAA 3LZZA 1QDCA 4N43A 5KXBA 1F8VA 5IK7A 1QNYA 3JQXA 3ZN4A 2GU9A 1VBD2 1S0JA 1D2QA 4OFGA 4EWEA 4BLJA 5A32B 1ZA4A 2GC1A 1WBLA 4B4QA 1UPIA 4JAAA 5JWPA 4M0HA 3BB6A 2ZZQA 4EN8B 1WCDJ 3WHUA 5BNQA 4S2DA 4LUMA 1AR91 3DUIA 1LKNA 2XL7A 4HT1T 1SLIA 4ZXKA 1WLWA 4CDXB 1W6PA 4ES8A 4QM8A 2Q8OA 3VZLA 3E5QA 4GA9A 5DDJ3 4AFCA 4NO4A 4Q1PA 4KWLA 1SMVA 4N7IA 5EZWA 2GALA 1KXGA 4COZA 1NA1C 1KS5A 2A6ZA 5T5LA 2NLRA 1R1A1 2VECA 4QQOA 1UAIA 3T1MA 3N7KA 4JGYA 4JDNA 3D6EA 5CNAA 3LCPA 5AFBA 2ZGUA 1JOJA 4LBNA 1RUC3 4YW4A 1CPMA 3HT2A 2ZGOA 5L7OA 1FT9A 2GN7A 4PQ9A 4KBBA 3ATGA 2TBVA 3LSEA 4JRLA 3O5SA 3M3QA 4N53C 1IOAA 3UV9A 1VRH1 3SISA 3SH5A 2QFEA 4GH4A 2HEVF 4YW3A 3R05A 4Y24A 3RYKA 5F6LB 5KHGA 4FPJA 2RS33 2XH6A 1VAKA 4R8HA 4COUA 1B09A 3NAPA 4QM9A 3V65A 4CP2A 2UWCA 1VBC3 1ONAA 1RUI2 1AYM2 1W6MB 2X5IB 3APBA 4YSFA 2XGXA 5I8YA 1WUVA 3WDXA 1WD4A 1LB2A 4N43C 3WW3A 1COV2 4URTA 4YLZA 4C1XA 5BXXA 3CL1A 3D5OA 3WQ7A 4P9LA 3B5LB 5H9QA 1RUD1 1ASJ1 1O3TA 4OI2A 4Z8BA 1SLTA 4BA6A 1S0DA 1RVF3 3IDEA 5JZGA 1C57A 3FLRA 1YJLA 2D6NA 2GC3A 3ME2A 3TYJA 3VZJA 2RM23 4OI0A 1FOD1 1RUF3 1SEFA 3M2MA 4GMP0 4IEWA 4L8QA 2RHPA 5BNNA 2VVDA 5ACA3 5AC91 1DGWX 4CEWB 2A70A 3QCWA 2BW8A 3HT1A 1FPN3 1NZCA 4X6QB 2W52A 1ENSA 4E4DX 2GZWA 2B42B 4XJZA 2PA7A 4WBBA 2XKPA 1BK1A 2F4PA 4NHMA 5FDBA 1ZRFA 4UW3A 3UKNA 3POWA 4LHNA 2ERFA 3U4XA 2ARBA 2CWSA 2Z69A 4FPOB 4JGYC 1F2NA 4COVA 4QPGB 4XBNA 3INAA 3SCFA 2CWMA 1EP0A 3NO8A 1LHNA 4XFHA 1U12A 5FLIA 3JBG2 3KT4A 1EYBA 1OSGA 5F5QA 2JD4A 4OHVA 2GC0A 1UU6A 4HN0A 1QJZA 1RUG1 3MF6A 1RHI3 5KXCA 1Q43A 1N1SA 3GHMA 1VBB3 1W6NA 3SMHA 3S0MA 2NM1A 4FXKB 1VRH2 1YRZA 4XF3A 4XJUA 3RMYA 3AP9A 4GH4C 3W9AA 4MXWB 1QHDA 5CU1A 4XEZA 4XPVA 1RMU1 4G4FA 1KDMA 3EJKA 3QOPA 2V73A 4XDQA 4ZU7A 3SITA 3ZFEA 2AH2A 3ZFGB 3VBUA 1G9AA 2R061 1O3SA 2XLFA 3BCWA 3WOGA 4QQPA 5BNOA 5C6CA 2RR13 2HWD3 2VULA 4FOWA 3K51A 4WM7C 1MQTB 3DN7A 3ZFFA 1O4TA 3W58A 1BBT2 5FAXA 2ZX2A 3AX4A 4EROA 1U5YA 4OLLA 1O3RA 1DGRA 1XRUA 1O5LA