3NV3A

Crystal structure of human galectin-9 c-terminal crd in complex with biantennary oligosaccharide
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
136
structure length
136
Chain Sequence
HPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNPRFDENAVVRNTQIDNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Sugar binding protein
molecule keywords Galectin 9 short isoform variant
publication title X-ray structures of human galectin-9 C-terminal domain in complexes with a biantennary oligosaccharide and sialyllactose
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 2010-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3nv3A00
1MS1A 2ZKNA 1W6OA 2E7QA 4XJZA 1A8DA 3FLPA 3PVOA 4Y20A 1H30A 2GNMA 1W6MB 2ZMLA 3MW3A 1CVNA 4XBLA 4XXPA 4YG6A 2A75A 1LOFC 2JJ6A 3SH4A 5DZEA 1JBCA 1F31A 4YGDA 5JOXA 2D3PA 1DQ1A 3LSDA 4BLIA 1GANA 1SBEA 3FUQA 1OQ1A 2A6YA 2NZ9A 3WNXA 2ARBA 1LU1A 2CNAA 3M3OA 1GLHA 3WG2A 4JC1A 3N35A 1YO8A 4XJWA 1SLCA 4PBPA 4AGRA 1LGBA 4Q8LA 5FRAA 3D6EA 4AVVA 1Z78A 1UPSA 4HANA 2ZGNA 4NOTA 3ZXLA 1WUVA 5DUWA 4D69A 2DTWA 1GBGA 1V6LA 2G4IA 1QGLA 4U2AA 2NM1A 4KBBA 1JXNA 2A6XA 2ZGTA 4M3CA 1G7YA 4Y1YA 1W6QB 1W6NB 4YW2A 5KXEA 1LOFA 2YMZA 4AGVA 2GALA 4GXLA 4XBQA 1LOGA 1UZZA 1C57A 5EXOA 3B3QE 5T5OA 4FQZA 2YXSA 4YW1A 2E53A 4Q1PA 4NO4A 2ZABA 1Y7BA 1CIWA 1C1LA 1KQRA 1U0AA 1XQNA 5GLVA 1YIFA 1BZWA 3B9CA 1AXKA 1LODA 4ATEA 3RMYA 2ZHNA 4XMIA 3I4IA 5CB7A 2A6WA 3OY8A 1JOJA 4YM0A 2NMNA 5E89A 2W52A 3RG0A 4MYEA 5JOZA 1LHOA 1QU0A 4XBNA 1LOAA 1WW6A 3MW4A 4ZKTB 1IS5A 1IS3A 3WDVA 1GSLA 1GZWB 1WLCA 3D4KA 3NWKA 5GZFA 4GALA 2ZHMA 1B09A 3ZSJA 4DQAA 2FHRA 2SLIA 1YRZA 4XJUA 2A3YA 2XB6C 5CBLA 1WLDA 2DVAA 1S0CA 4YGBA 1ULCA 2P37A 1ENRA 2W08A 3FLRA 1AVBA 3ZPYA 1GNZA 3USUA 4RL7A 3POSA 1LOEA 2YY1A 4GKYA 4P9YA 4LBOA 4R9CA 2AREA 4FP3A 5E88A 5IUQA 1EPWA 1PZ9A 2JKBA 3R4UA 3IMNA 1PZ8A 2GDFA 3RSJA 3ZXFA 2R1BA 1ULGA 5DUVA 3VKNA 2D6MA 3QCWA 2VH9A 2ZGUA 1F9KA 3LCPA 5GLZA 2R0HA 2D3SA 3ILNA 5GJ6A 2DYCA 1KDKA 1LU2A 1QOSA 4AYUA 2P3JA 1OKQA 2ZGKA 3B01A 3WCSA 2A71A 1JUIA 2Q5TA 2PHXA 2FMDA 4JRAA 5GALA 3WDTA 1AX2A 5GZDA 1AJKA 5IK5A 3L2YA 3AX4A 4YGCA 3CNAA 1UN1A 2DVDA 1N1YA 2LALA 3WG4A 3IM0A 1SLIA 4Q2FA 5DXDA 3FFZA 5GLWA 1LHNA 3M1HA 4W65A 2V73A 4P9WA 1YYNA 1W6PA 5JLVA 4YG3A 2V5YA 2D6PA 4FVVA 1MS8A 1CN1A 1ULFA 2D6KA 4LBQB 5DUXA 1FATA 1N3QA 1YI7A 4XJAA 4XMAA 1LENA 4Y22B 4FPEA 1C1FA 1IKPA 1ENQA 2A70A 3IPVA 4Y26A 3I8TA 1KJRA 3O0VA 4FOVA 4Y1UA 4Q27A 4XZPA 2NMOA 3AJZA 4FPOB 4XJ9A 2VW0A 3AJYA 3AP4A 1Q8SA 2JDZA 4BMBA 3AK0A 2ARXA 1MS9A 2OUHA 4YG0A 2JE7A 1AF9A 1ONAA 2BQPA 3PMEA 4C1XA 2P3KA 1JYCA 1QOOA 2HYKA 2ZA9A 3DGTA 1LTEA 1Q8VA 2CWMA 4LBKA 1NXD1 4XXAA 4DFSA 4FPGA 2ZACA 3UL2A 4M01A 1DYKA 1SACA 1SCSA 2DWRA 4PBOA 5GZEA 2NN8A 4PF5A 2R16A 4R9BA 4XTMA 2YROA 2OVUA 2R1DA 5L73A 3C2UA 2JE9A 2RHPA 1DYPA 2UWCA 1N1VA 2CL2A 3LSEA 1APNA 3OBTA 5IK8A 1UAIA 2AH2A 2H0BA 2UWAA 3IN9A 4LBQD 2DUOA 1DQ2A 3HMYA 4M00A 1FNZA 4P14A 3TAYA 4Q26A 3WUCA 3OBRA 3AXDA 2E6VA 2VW2A 1G9CA 1IKQA 3V64A 2ZGOA 2E51A 2P3IA 3INAA 4Q8KA 1LOCA 5HCAA 1BQPA 1MS3A 1SCRA 3A0KA 1GICA 2JD4A 3O0XA 3V0BB 5H9RA 4WVWA 4Z8BA 2A3WA 2DVGA 3ASIA 1AX1A 1CONA 2CYFA 3OJBA 4XIOA 4DS0A 1SLBA 3V0AA 2GN7A 2TEPA 2VXRA 1A3KA 1LEMA 1CJPA 5T55A 2EXHA 2WT2A 2ZMNA 4XDQA 1O4ZA 4CZSA 4BQ1A 5IT6A 1CR7A 1HQWA 1S1AA 1S0BA 1ENSA 3OYWB 3O12A 1VLNA 4XIKA 3SH3A 3N7JA 3ILRA 1YXWA 3WHUA 3AZVA 1S0GA 5GZGA 5JOWA 2VW1A 1V6IA 3SITA 3O5SA 1G9DA 5T5PA 1S0FA 3D5OA 1D2SA 3UK9A 2VUAA 1DZQA 4AVTA 4DRRA 2DUPA 3BIWE 2CY6A 4FOYA 1FYUA 1MACA 2VU9A 2LTNA 4OZXA 2WJSA 1IS6A 1W6OB 3ZSKA 4LBMA 4CRQA 4XOGA 1LHUA 4XHBA 4ITCA 4Y20B 4BLJA 4R9DA 2UURA 2A6VA 3N7MA 2ZAAA 1V6JA 2WQZC 3JUUA 1OFSA 2WLQA 1AX0A 1DQ5A 1GKBA 4XILA 2PHUA 1URXA 2EAKA 3SLIA 1QDOA 4ASMB 4YM2A 1HDKA 4K20A 1ZA4A 1DLLA 2GMEA 2D6OX 3DUIA 1MVEA 1GV9A 3M3EA 2C9AA 4FP2A 3WCRA 4M3CE 1DQ4A 2OW4A 4HL0A 3TB0A 1DFQA 3FLTA 5JDBA 4FPLA 4GWMA 1W6MA 3GNEA 1QNYA 1HLCA 3SNMA 4BM8A 3KQRA 4GWNA 3V65A 3U4XA 1CESA 3Q9OA 2AGSA 1Q8PA 2ZHKA 4UW3A 3H0OA 4XHXA 2DTYA 4BOWA 4K21A 4YM1A 3ZXKA 3WVJA 2CWSA 3AZZA 1HQLA 3AP7A 1CQ9A 5GM0A 4M3CB 1LGNA 2ZGMA 3N7KA 2DU0A 2ENRA 3R05A 3IKWA 5JMCA 1SBFA 4FPKA 1CPNA 3AXEA 3UJOA 1KITA 2ERFA 1WBLA 1AZDA 1NLSA 2EXJA 3ENRA 4AVSA 2EXKA 3APBA 3PVEA 3OPZA 1D0HA 1CPMA 1DQ0A 1Q8QA 2D7FA 5HCBA 1LULA 2D44A 4YW5A 1LOBA 1VAVA 1KJLA 4Y24A 1G9AA 1W6QA 1ZM1A 1W6NA 2WKKA 3W59A 1MS5A 4ISQA 2W68A 3A0NA 1N3OA 2R0FA 1LGCA 2D43A 1G86A 1HKDA 3WDXA 1G8WA 1LESA 2WSUA 3OY8B 2VY0A 3ZSLA 3ZVXA 3AFKA 3AYDA 3HR9A 3WUDA 1H9WA 4H55A 3B69A 1UX6A 4R9AA 2A6ZA 1IOAA 2SBAA 4ATFA 2GNBA 3FBYA 4YGEA 4P9XA 1N1SA 1H9PA 5LK5A 1RITA 5F9TA 1JN2P 4UW4A 3MW2A 1LEDA 2ZHLA 4YZ1A 2YZ4A 1QNWA 3WZ1A 1RIRA 1N47A 3AYAA 3FUOA 1WD4A 5T50A 1C4RA 3VKOA 1GZ9A 1R1ZA 1VAMA 2A3XA 1WW7A 3AP9A 4SLIA 2UU8A 3USUB 1G9BA 4UW6A 1LJ7A 5SV8A 2PHWA 2ZBJA 5T5JA 2EALA 5GLUA 4YZ3A 4C1WA 1F5FA 3NV1A 1SFYA 2EF6A 2ZGPA 1GZWA 3QLQA 2DV9A 1FV2A 1GNHA 2WNEA 4LBLA 5HCFA 3VKLA 3ZXEA 2AUYA 5GLTA 4YM3A 2D6LX 2ZMKA 3ILFA 2DU1A 4XE9A 4IQPA 4FOQA 4FPYA 4CTEA 3HN1A 3MPPG 4FQ4A 1DIWA 1Z0HA 4XJ8A 1QF3A 1O4YA 3T2TA 5EYYA 3AYCA 4FPCA 4GA9A 1UL9A 5T52A 1WBFA 4YFZA 1Q56A 3VV1A 4YFWA 1DQ6A 3WV6A 5IK7A 3SH5A 4M3CF 2GMPA 5AVAA 3O0WA 2KM2A 1JHNA 3OGGA 1ULEA 3NV4A 5H9PA 5BYNA 5KXCA 1FNYA 3W58A 1G9FA 3PVNA 1AXYA 1SBDA 1V00A 1FX5A 1W6PB 2AR6A 2GMMA 3ATGA 4K1YA 2AENA 4ISRA 4XYXA 3BODA 1W0PA 5DZGA 4L8QA 1WD3A 4I30A 4Q1RA 4DRVA 1QOTA 4JCKA 4YZ2A 4WV8A 1UKGA 3WHTA 3M2MA 1WW5A 1SLLA 3IPVB 1X50A 3RQ0A 5EWSA 1WW4A 3WDUA 4FOWA 1MVQA 2WT0A 1KRIA 1LHVA 1V6MA 2DUQA 4AWDA 3B00A 1ULDA 1FAYA 1DBNA 2D3RA 1S0DA 3VKMA 1V6KA 1J1TA 5H9QA 3N7LA 5H9SA 4LBQA 5DZFA 5EYXA 4Y1ZA 2GN3A 4WVVA 5GZCA 2PHRA 4Y22A 3RRDA 3WDYA 3AZYA 2P34A 3WLUA 3VKFC 3WDWA 1TEIA 2ZGRA 3R4SA 1V6OA 5DUUA 1JYIA 4K1ZA 1FV3A 4BPZA 5FREA 1N1TA 1IS4A 1GZCA 2DVBA 3ZYRA 3AYEA 5CNAA 2GNTA 3BOPA 1VIWB 3JU9A 5JOYA 1BYHA 2EIGA 1GYKA 4YZ5A 5CAZA 3VUOA 2PELA 1VALA 4ZXKA 1BXHA 2ZGSA 2ZGLA 2WSVA 1BKZA 1Q8OA 2C5DA 1UZYA 1WCSA 3WG3A 1I1EA 1QDCA 4DPNA 1RINA 2NP0A 4AGGA 2NYYA 3M3CA 2PHFA 2OUJA 2PHTA 1MS0A 3PJQA 4FPHA 3RMXA 1LCLA 5E8AA 4WZFA 3UJQA 1I3HA 3SISA 1MZ5A 4U36A 3BTAA 3AP5A 2GNDA 1MR5A 2P2KA 2YV8A 3ZSMA 4LBJA 3KM5A 2ZGQA 3V0AB 1PZ7A 4RA0A 3M3QA 1SLTA 1WLWA 2B7YA 1JW6A 4YLZA 1S0IA 3AZXA 5DG2A 1QMJA 1SLAA 3AZWA 3ZYPA 4XTPA 4Y1VA 3POWA 2AYHA 5KXDA 4TZDA 3A4UA 5CA6A 3V0BA 1UMZA 5IK4A 4PCRA 4TYSA 1BJQA 5DG1A 4FPJA 5JVVA 2DURA 1S0JA 2CTVA 4YW3A 1MZ6A 1S0EA 3GALA 4PQ9A 2UWBA 2WT1A 1AXZA 2E7TA 2Z42A 1W0OA 4F83A 4BMEA 3T1LA 5T5LA 1DGLA 1LECA 1V6NA 2W39A 4LBNA 4UW5A 3ZXJA 3MEPA 2XG3A 4Y1XA 1A78A 3T1MA 3AP6A 2R49A 3OYWA 2ZZJA 3WG1A 1MS4A 3POYA 3NV2A 2I2SA 3NV3A 2A7AA 1KDMA 4GKXA 4YW4A 3RS6A 2ES3A 2DVFA 4YZ4A 3N3HA 5KXBA 3WOGA 1AJOA 4FPFA 2D6NA 2A5ZA 1LHWA 1N3PA 2EXIA 3N36A 1QKQA 5F5QA 1DHKB 5T54A 2JECA
chains in the Genus database with same CATH superfamily
1MS1A 4FI9A 2HKXA 3SEEA 1A8DA 2JIGA 3OBZA 3PVOA 4Y20A 3B5LB 4BH9A 2GNMA 5A1LA 2IXJA 1CVNA 4KQ7A 2A75A 1LOFC 5A7OA 4FBFA 1VJ2A 3JBG1 1F31A 5DZEA 5EQUA 2GC1A 2VZVA 1VRBA 3DKWA 4UT5A 2D3PA 1ZNPA 4ORFA 1OQ1A 2R063 4RQPB 3ZIXA 1XNTA 1XU2A 4I09A 5KHGA 4CUAA 4QM9A 4JC1A 5FYIA 5BNOA 3BN6A 3K4ZA 1RJ7A 2WZR2 2Y26A 2BV4A 1VBE3 4N53B 2YC0A 4NHLA 3PHMA 5C4WB 2VMFA 1R092 3NNFA 3SQOA 4IV1C 4H14A 5FWEA 2ZGNA 1NZCA 2YGLA 4XDOA 2W9XA 3H8XA 1POV3 2G4IA 1H2LA 4R8HA 2NM1A 4U2AA 1W8ZA 4KBBA 2X05A 4M3CA 2OPWA 3W9AA 1G7YA 4Y1YA 3IMMA 1W6QB 4RFRB 1W6NB 3S0MA 3OEBA 4LQRA 3POIA 4GXLA 1JOBA 2QCSB 4XBQA 3MFCA 3RGBA 1LOGA 1NUKA 1UZZA 4H3WA 5KR7A 4GQ7A 4XF9A 3WW4A 1W2TA 3BTXA 4KU7A 4DO0A 3VBOC 3JQXA 5LZ6A 2HWD3 1KFUL 1AL23 1RUI1 5C8CC 4EWAA 3M7AA 1U0AA 1XQNA 5IVVA 1YIFA 3WNOA 1JI6A 2OPKA 4OI1A 2G9FA 2DCJA 5A80A 1PGW2 1OOPB 5I0RA 4HVOA 3LPGA 2NMNA 4JZRA 1ODNA 4FCAA 4COUA 2RJLA 1GU3A 2P6HA 1JZ6A 1FOD2 4MHRA 1LHOA 1PGL1 2OX0A 2WS91 1ND3C 1QU0A 4GJZA 2XXZA 1IS5A 4GIQA 4LUKA 5LRSA 4QDQA 1GZWB 3ALQA 4BISA 2ZHMA 1B09A 5FY9A 3SKJE 4DQAA 1PMJX 1O59A 4E8CA 1CIYA 5FZDA 1RHI1 1IPSA 4OI2A 3VBSA 4YGBA 4P9LA 1XNCA 1ULCA 1JZ7A 4CCNA 4D6RA 2W08A 1AVBA 1K3IA 2RM21 3SCHA 1KGYA 1NQDA 4P9YA 5JR7B 4R9CA 5F39A 3VZNA 3UNPA 4WVZA 4W4ZA 1IG0A 5A33B 3B02A 1AYN2 2CDOA 2XONA 3IMNA 4XW3A 2DDUA 1QXPA 1W8OA 5FQ0B 4HG6B 2ADDA 5DN2A 5EJ3A 1F9KA 2BOJA 5F6LB 3LB9A 4AE2A 4RHV2 1NA1B 4RD7A 4J1WA 3ILNA 1FI2A 4D7SA 5GJ6A 1LU2A 3RVHA 4AYUA 5ACA3 2RDNA 2RR11 1VBC3 3DYMA 2G9GA 3WINE 5JMOA 2PHXA 2FMDA 3LDBA 5FZGA 3LDRA 1HB1A 4IE6A 4CCOA 3AX4A 2XWJB 3CNAA 5JCTA 3CO2A 2Z2SB 1COV2 1JU4A 1OT5A 2HH9A 2WO3A 5DXDA 4CXXA 4Q0UA 4W65A 2V73A 3C7HA 1YYNA 1QJX1 1UXXX 1UYXA 2CSGA 4FVVA 4IGQA 5FZ1A 4AEMA 4LK6A 4AHYA 2RE9A 3ON7A 4IV3C 1VAKA 3PTRB 1W8NA 2UYBA 4LBQB 4QGNA 4XMAA 1YI7A 2JD9A 2EAAA 1CZTA 4Y26A 4CDUC 4DIQA 4E2SA 2HWB1 3K3NA 1ZBA2 5CFCC 1RUD1 4AG4A 3NVCA 5FPAA 2VW0A 5FAXA 1RUF1 2ZX0A 5FPVA 3VD9A 5KC6A 3N9OA 2BGCA 3C3VA 1HRV3 3MIGA 4YG0A 2W3JA 1IGOA 4BHPA 1K5MB 2WNUB 1ONAA 2BQPA 4C1XA 5BNPA 2BPA2 2YGMA 3VZMA 4EYUA 3E1F1 2ZA9A 4C0HA 4HVQA 2CWMA 2PYTA 1UXZA 2J1VA 2VXJA 4X6RB 4XZUG 4P9JA 3IDAA 3IIIA 3TYJA 1SACA 3R0RA 5GZEA 3ZFGC 4HSLA 5L73A 2RHPA 2UWCA 1ZZ8A 2QKDA 1N1VA 2Y6FA 5A7WB 1APNA 5IK8A 5JSRA 2P6CA 3I3DA 2EVXA 2VR4A 3HMYA 4CEWC 1FNZA 4Q26A 5FBZA 3MO4A 2WABA 4Q4X3 4QPGB 4NUBA 1SHWB 3USSA 5HV0A 1IKQA 1CZSA 2ZGOA 3LA7A 2E51A 2P3IA 4NIIA 1AR92 2R071 4Q8KA 5HCAA 1BQPA 1MS3A 4G3YC 1UYZA 4MXVA 4S2FA 1OC1A 2JD4A 4N9IA 4XVHA 1W8UA 3U75A 5M0TA 2BRTA 1XNBA 1CONA 2ZEXA 3FN9A 4QXBA 4DS0A 2TEPA 1S4CA 1US2A 1STMA 1O6UA 1A3KA 3B9IA 3VHNA 1CJPA 4NPLA 5FZHA 1OI6A 3UT0A 2IXCA 1O4ZA 4YNIA 3SEPA 4A6SA 5EIYB 1D7PM 1R082 2W2IA 1JTZX 2VNOA 5A6YA 1UY2A 3C8XA 1OLME 2B5HA 2PLV3 1ENSA 4MO3M 1PNGA 4UWDA 1TVGA 4BQ2A 4CCMA 4IV1A 2JG8C 2QNKA 1YXWA 3AZVA 3FJSA 5FIXA 2VW1A 5BV6A 1L7LA 1S2KA 3FC0A 3O5SA 4QU2A 4DXZA 1G9DA 4X8NA 4I3GA 2XWBB 4OULA 1MEC3 1D2SA 1WMEA 1H4HA 2RS31 1RUE1 1RXGA 3BIWE 3POBA 3T4VA 5K8SA 2RJ2A 5A1AA 1PVC2 2VU9A 2W0XA 2XJQA 3CEWA 3HIFA 4OZXA 4S2HA 1YNAA 5A3UA 4CRQA 4LBMA 1FXZA 1LHUA 2VOTA 3CLPA 4Y20B 3K4DA 1GNYA 1DGRA 2JDMA 5J3UA 4BQWA 3KCCA 4URAA 4YYOA 5C8CA 1WMXA 1RUH3 5FOBB 4O65A 1C5IA 1J1LA 1URXA 2WAAA 1HDKA 1DLLA 4KG8A 1XNAA 2QFEA 4AI1A 1WWYA 1G6NA 5FLHA 3ZN5A 3IIAA 2WZEA 4FPLA 4JGZA 5BNOB 3GNEA 4XCBA 1FPN3 3BCWA 3KQRA 3V65A 3VBHC 4CP9A 4WM7C 2XHKA 4ZONA 3ZKYA 3MIFA 1Q8PA 3LEGA 1UZVA 4XQWA 4XHXA 4BOWA 3BIEA 4K21A 4YM1A 5CFDB 5JXJA 1O3QA 4B8EA 4CDWC 3AP7A 3N9PA 5GM0A 4M3CB 2ZGMA 2DU0A 4CU9A 4ZHNA 5IVYA 3IKWA 4OCTA 4KWUA 2W5FA 2VL4A 4LOTA 2K9ZA 4OZOA 3J8F2 1VRH3 3ZN6A 1KXGA 1AZDA 2EXJA 4PLMA 3ZR5A 5L36A 4LTAA 3ENRA 4AVSA 1PX3A 4LHKA 2W1SA 3OPZA 1HX6A 1Q8QA 2D7FA 2VGDA 2HLEA 2PAKA 2D44A 4YW5A 3V56A 1LOBA 1K42A 4PIYA 2D98A 4KU8A 4Z82A 2RVAA 4EN8B 4Z2AA 2WKKA 4ES8A 2WA3A 3G6JB 3OBAA 2R0FA 1JZ8A 1HKDA 5DDJ3 2VTXA 4A4AA 2FDFA 4DUVA 3AYDA 2RS51 1UX6A 4R9AA 1L7RA 1TMF2 2SBAA 2XPJA 3K75B 1H9PA 3D0SA 1KFXL 4LO5B 3ZPOA 1A34A 1AYM2 1CAUA 2ADEA 3MW2A 1LEDA 3OUIA 4LE4A 2ZHLA 3VBSB 4GB32 4YZ1A 5FYMA 4IV3A 1B35C 1K45A 1RL3A 5KHJA 1ASJ1 1N47A 2RDRA 3RZMA 3OG2A 3IT8A 1PO12 1VBA2 3QD6A 5LCWL 2GC2A 4CDUA 5T5JA 3NV1A 3VKLA 4UF0B 1AR81 1FV2A 1XPWA 2HEWF 4YM3A 5L19A 1QJU3 2J1EA 3PUSA 3OB8A 2WWUA 2ZMKA 4IE7A 4AF9A 5LASA 1WKYA 2DU1A 2WBKA 3W20A 4YPJA 5IVJA 1RVF2 4XJ8A 1V0AA 1Z0HA 1QF3A 1UPIA 3PU8A 4Y5Z0 5LBFA 1O4YA 4KI5M 5EYYA 2P3YA 4GA9A 5FYCA 3J7HA 5FPZA 4CYDA 2R043 1QXRA 1JODA 1UCXA 5E1RA 4PDWC 1GZTA 1RMU1 5FKBA 1NX9A 2KM2A 1JHNA 2AC1A 1ULEA 3MGUA 3OGGA 2PTMA 4ZS2A 5H9PA 4E2GA 3W58A 4GMP0 1OA2A 2VZPA 4RGKA 3MIHA 2WNOA 2QQPA 3BODA 4D6SA 1W0PA 5DZGA 4Q1RA 2GP3A 4I30A 4DRVA 1K12A 3WF1A 4AEKA 5E6HA 1RUC2 1D4VB 2VZ1A 3KV9A 3M2MA 5FJKA 4I0AA 1RGSA 1WW5A 1SLLA 3JD72 5DAVA 1X50A 5T3NA 2NPIA 3EB7A 4I02A 3ZYFA 1WW4A 3WDUA 1CX1A 5BY5A 3LEKA 3LFMA 2Y38A 4OMCA 3DECA 1YHFA 5FZOA 3Q8BA 4IL7A 1POV0 2ILMA 3VDBA 5DZFA 1YIPA 4LA2A 2YHJA 2QQKA 1E57A 1R64A 4WVVA 3UKTA 2J1TA 5BNPB 5HBAA 5FP4A 1JH5A 5K0UB 3RRDA 3O1UA 2P34A 2WZR3 2LROA 3KSCA 4NPMA 5HCHA 4YWAA 1ZREA 1TEIA 2LUWA 1EAH1 4YVWC 4BPZA 3HPNA 2ZCWA 2RS12 4OQ9A 1E5SA 1R093 3VZLA 4QPGC 3AYEA 3T0DA 5IWFA 3FFQA 2GNTA 3X29B 1VIWB 2GC0A 3PIJA 4M4PA 4NRQA 3J7LA 3ETPA 1GYKA 2B9VA 3MBWA 4N43A 5FYZA 3TWIA 4D94A 3VUOA 3KHCA 3I2JA 5I8SA 2D97A 5JXHA 2JG8A 1BKZA 2CGPA 3LIGA 2X29A 5FZIA 2KD7A 4FFIA 5CU1A 5D8AB 1UU4A 1RINA 5IYYA 5LY1A 3M3CA 4QQ2A 4NIAA 4HBNA 1QWRA 1MS0A 3PJQA 2DCKA 4XFFA 4AZZA 2XQRA 3PJYA 2MEV1 2D40A 3UJQA 3SISA 2WNVC 4AAXA 1ZBE2 4MXWA 4U36A 1AR71 1XXNA 1PVXA 4B4RA 2YV8A 1PO21 4QGMA 4LBJA 4XDPA 2C0ZA 2HWE1 4JRLA 5JUVA 4OHVA 3TBDA 4RA0A 4E27A 3ZYGA 3M3QA 3W5NA 2DCYA 3A7QA 1JW6A 1QIQA 4YLZA 3GBFA 3AZWA 1FOD3 4AFCA 2WINB 4QPWA 2BJSA 3KT4A 3QBQA 2B9UA 2YFUA 1HQNA 4TWTA 3TN91 5CA6A 2WAOA 2BEOA 5IAXA 3ZIWA 3POJA 2VZUA 3VBHA 4Q0QA 2QQVA 1FMD1 3RZHA 4WM7A 3TNQA 3AKTA 1QXJA 4IV1B 1XYOA 4PQ9A 4A7ZA 2UWBA 1W8WA 3EBRA 2WT1A 1TZOA 3ES1A 3KB5A 3ORJA 2TBVA 3AM2A 4CDWA 2E7TA 1X9PA 4NRMA 1NLQA 2VCBA 1NY71 1AYN3 4HPKA 1LKNA 4IW3A 5FPLA 4UW5A 3ZXJA 1GOHA 3MEPA 5IW0A 3AKSA 1C28A 3IDBB 5FZEA 2KXLA 4RHV3 2G9ZA 1UWWA 3VBOB 5IVCA 1DU3D 5BNOC 4N7UA 5KXBA 5C8CB 4G9SB 1G9AA 4ZU7A 1AL0G 1VBE1 2ZZQA 2CV6A 5FYBA 1PX4A 2VOWA 4QX0A 4ET7A 4LKSA 1DHKB 4OHXA 2FDIA 2VC9A 1OLMA 4QMAA 2JXAA 4NROA 2VMIA 1ULOA 2E7QA 2YYOA 4XJZA 4XFHA 1COV3 1ZRIA 5F5AA 2Q8CA 3WY6A 4FTBA 4JGZB 2H0VA 3MW3A 2GU9A 2VULA 3KT7A 3SH4A 4NHXA 2VOVA 2LRPA 4A44A 4CP9B 2BDRA 3S5QA 5L7OC 4BLIA 2GP5A 3FUQA 3UYJA 2A6YA 2AEZA 1YUDA 3S6PA 1DLCA 3ZYHA 2HWD1 1LU1A 4CUBA 1YQ2A 2CNAA 2F17A 1AL21 1CX4A 1B35A 3M3OA 3WG2A 2E26A 2K46A 4CCEA 4IEUA 3I3EA 4SBVA 4XJWA 1XYNA 1ZBA3 2ZS6B 3I2FA 3PLQA 2Y6HA 3ZN6B 2WQ4A 4Q8LA 2XVGA 1H8TA 4WZCA 1RUH2 4ZY9A 4ES9A 1OF3A 3CJIC 1VB4A 2MNGA 1Z78A 4LO4B 1OD5A 1AR61 2HWF2 2YBPA 4PIXA 4NOTA 1BEV2 1WUVA 1GP6A 4CEYA 1JXNA 4HONA 5C8WA 1UZWA 3PURA 2YC4A 4MV2A 1LB2A 3I2IA 1EUTA 2VQTA 2PMWB 1Y9MA 2YMZA 4B7KA 2GALA 1W99A 4LLOA 4DXTA 3GBWA 4QX8A 1C57A 2QJVA 5EXOA 4IEWA 2W1QA 5T5OA 4COWA 2YXSA 2B42B 4YW1A 2E53A 4PDWA 2ZABA 3K48A 4LKDA 5FYUA 3FZ3A 1XYPA 2DBIA 3B9CA 1LODA 4ATEA 4XMIA 2R6QA 5BXXA 4IV3B 1NT0A 4JTOA 1JOJA 4O61A 5A6QA 3CBNA 4YM0A 3Q8CA 5E89A 1PGL2 3ZDSA 2DCZA 3N9NA 4AQ2A 2J1RA 1AR93 5JOZA 4HLTA 4CDUB 4XAEA 4DUXA 5ACA1 2TUNA 1IS3A 2QE3A 1GSLA 1WLCA 2Z79A 5GZFA 2SLIA 1YRZA 5KC5A 2A3YA 1YFXA 2XB6C 4X6QB 5CBLA 2F4PA 2ORXA 2P37A 4NIDA 2IVJA 3BALA 3FLRA 3M8LA 2P4EA 2YFZA 1UYPA 3USUA 1R083 4KG0A 3WF2A 4LBOA 2AREA 4TSVA 5KHIA 5IUQA 2JKBA 5FZCA 3ZXFA 1PZ8A 2GDFA 1EV12 5F37A 1WA6X 2R1BA 4ZU5A 4YVWA 2Q8DA 4GJYA 4Z07A 4W6WA 2E32A 3WP5A 5GLZA 5ERLA 1KS4A 2NLRA 3ZFGB 1R1A1 2D3SA 2RR12 3DL3A 2J1AA 2P3JA 1OKQA 2ZGKA 2B4KA 3B01A 5A32A 2A71A 4META 3AKPA 4QHOA 1PVC3 4JRAA 5GALA 3WDTA 1LAJA 5GZDA 1AJKA 4QKFA 5IK5A 5E16A 1UN1A 1HRV1 1QH6A 4ZXEA 1WLTA 1N1YA 2Y8KA 5CIRA 4UFHA 1GWMA 3IM0A 4DB5A 1SLIA 1TME2 2JDUA 1XBFA 3QH7A 4JKLA 4Q2FA 5FOJB 1Y9QA 4JKKA 1LHNA 3IZOA 4P9WA 1RUNA 2V5YA 2D6PA 2WNVA 1U5IA 2YC2A 4Q4W2 5FZOB 4OHYA 4H7MA 3ZXDA 1X33A 1KEXA 2ZEZA 1FATA 3K2OA 3LWCA 4HKOA 2R042 4HK8A 4AXOA 3IBMA 5A7SA 4LEJA 4MGTA 3LAGA 1KJRA 1ENXA 1LR5A 3KMHA 1NAEA 1O8SA 5FZ3A 2W92A 4NVPA 4QDRA 3UETA 3HWJA 4XZPA 3IWZA 3MIBA 4XJ9A 3NJVA 3RZLA 1RUF2 3AJYA 3AP4A 1Q8SA 4NR1A 5F2SA 3RWNA 4EZ4A 1JYNA 4KWLA 3VD3A 1AF9A 1V9U2 3PMEA 3GHMA 3NNJA 3T0BA 2JG8B 4QD2A 1WCKA 1CAWB 1QOOA 4D7TA 1RYYA 4COYA 4HOOA 1H0BA 1NLRA 1H8VA 2BFUL 3J8F3 5G05L 4TTGA 4LBKA 1W2NA 2BBAA 2BNOA 2Y34A 3KGLA 3E5UA 5L9BA 2VG9A 5FPUA 1MPXA 1OQDA 2I74A 2Y0IA 2ZACA 3KQ4B 4FXKB 4GMP3 4M01A 4MLOA 3UL2A 2NN8A 3VL9A 3TNPB 2RDQA 3O1RA 4I2OA 4F7ZA 2OVUA 3AMQA 4LA3A 1OA4A 3C2UA 3MUY1 4D6QA 2JE9A 1DYPA 3LSEA 4WM8A 1JYXA 2Q1MA 5EZWA 4LBQD 2C24A 2C26A 1DQ2A 4M00A 3ZOIA 4OUMA 4P14A 5FMBA 3THDA 4MH0E 3RI8A 3UV9A 1WCDJ 5FZ4A 3TOJA 2R072 1TMF3 3MFAA 3I2DA 2JDAA 5LBCA 1Y43B 5D2AA 1MEC1 3D0JA 2QVSB 3MLKA 1E5RA 1VMHA 1CZVA 1ST8A 4Z8BA 2A3WA 2DVGA 3ASIA 3VBHB 1AYM3 1AX1A 1FT9A 4WM7B 3OJBA 4IEXA 4GB33 2GN7A 2YBKA 5L7OA 1UMHA 2PAEA 4MSVA 4XFCA 1GWLA 1PO13 4NAMA 2BVBA 1VBA3 2WO2A 2YUEA 4CDWB 4Y4YA 2W1UA 4CZSA 4BQ1A 1SZBA 2W91A 3H3LA 3BU0A 1GQPA 1HQWA 1CR7A 4I0WB 3IAQA 3WNMA 2VOKA 3KWVA 1D2QA 5JI9A 4A6OA 3WF3A 3K3OA 4AI8A 4K8FA 2Y0OA 4BU2A 4XIKA 3DXUA 3CJIA 3N7JA 3PUQA 4HT1T 4XUNA 5GZGA 4JGZC 3ABZA 1RVF3 3LPFA 4PIZA 4QWNA 3RPQA 1FPN1 1UY4A 1S0FA 2RS32 5DPNA 2A73B 4Q29A 5T5PA 4AVTA 5EJ1B 5FZ8A 2FDKA 1FYUA 2ZEWA 5CZKA 4LIUA 5KBFA 2WJSA 1NE6A 3HJRA 2MPFA 2WWJA 4XOGA 2CGNA 4XHBA 2VVDA 5FUNA 3MF6A 5AVPA 4BLJA 2UURA 2XJVA 4EROA 1ACCA 3N7MA 2ZAAA 3IDEA 1V6JA 3JUUA 3T2OA 2WLQA 4ZZ8A 2PN5A 1AX0A 1DQ5A 3BI3A 2J22A 2K0GA 4H2AA 1RUC3 2GZWA 2GMEA 3H9AA 1GV9A 3JD73 1U12A 4FP2A 3WCRA 1B35B 3FLTA 4E9KA 5JDBA 5LBEA 4GWMA 5KHKA 3RJ2X 1RUOA 1T2XA 1US3A 3PIGA 1E5IA 4AFBA 1CESA 3A21A 3HEIA 5JSPA 4AHXA 2ZHKA 3H0OA 2DTYA 4N9HA 3ZXKA 5JAXA 2V4AA 4JGYA 3WVJA 2CWSA 3AZZA 1HQLA 5EPAA 1CQ9A 2JDPA 3VD7A 3I97A 3O1TA 3N4MA 2ENRA 3FHAA 4QQPA 4B4QA 1H2MA 3TRSB 2VZRA 3NW4A 4FPKA 1CPNA 3AXEA 1JZ4A 3P3NA 2RS13 1QEXA 1JYTA 3LD8A 3SCFA 1UY1A 3JZVA 3BKZA 3WQ1A 3MPBA 4NMIA 4K9SA 3FHIB 4CUCA 2VTFA 4PDWB 5J96B 1VAVA 3J4UH 1KJLA 4JQTA 3I2GA 1M4WA 1NQJA 3VD5A 5A3TA 4QDSA 3W59A 1MS5A 4ISQA 4RGAA 3RFRA 3H8RA 3DCQA 1N3OA 4RFT0 1LGCA 2D43A 1G86A 1HRI1 1DG6A 3K46A 5FFOC 2OIIA 3WDXA 1G8WA 1LESA 2WSUA 3ZSLA 2VY0A 3ZVXA 3T3YA 3HR9A 3WUDA 1H9WA 3H8UA 2IFWA 2VNVA 2GC3A 3LEMA 1ZBE3 2A6ZA 4UOJA 4O7XA 1VPHA 3DEMA 2GNBA 3S7IA 3FBYA 2VUDA 2Z5WA 3E6DA 4IEVA 2ORZA 3RJRA 1E5HA 4MGIE 1JN2P 1IQAA 1C8NA 4P02B 3AB0A 1ASJ2 3KVBA 1QNWA 3OTFA 2VMEA 3WP4A 3AYAA 1PGSA 4EJRA 3VHOA 1WD4A 1NZIA 1C4RA 2QZ3A 5T50A 3VKOA 4F3JA 2HWC2 1C5HA 1GZ9A 3AP9A 3J26N 4IEYA 4V1PA 3USUB 3NNMA 3ZSEA 5JR2A 5SV8A 4Y5SA 3W5MA 5GLUA 1AR82 1ZZ7A 2ZGPA 4RR3C 4EWDA 2R32A 2IXLA 5JPMB 5ISLA 3OPWA 4YVWB 1W90A 3KF5A 3GJAA 4BQXA 3FX3A 5J48A 4BE3A 3ZN4A 1SPPA 2VZSA 5FYVA 2BWAA 4FOQA 2IZWA 1X36A 4FPYA 4CTEA 3M3IA 3MPPG 2ZXQA 1MQTC 2ZX2A 5A32B 2JG9A 3T2TA 3WF0A 4FPCA 5HI0A 3H50A 4OHWA 4FT8A 1Q56A 4XEZA 3OUJA 3VV1A 1H6XA 3AVRA 5EV7A 3SH5A 2Q4SA 3CZUA 1OF4A 3O0WA 1EPZA 4EWEA 5KWRA 2IVIB 1W06A 3NV4A 1CAXA 2WZR1 4RN5A 1SBDA 1FX5A 2WNVB 3ATGA 1RXFA 2PHLA 3MV11 4ISRA 4L8QA 1RB8G 2XQXA 1QJY2 3HVDA 4JCKA 2FZ1A 3FBMA 4C90A 1UKGA 4E8DA 5J37A 3WHTA 4KWKA 3F95A 4HFSA 2HEYF 4N43C 3BPZA 5EWSA 2X5IC 3FMGA 1PHMA 5ABJA 3BB6A 3SXWA 1POQA 4CDQA 1MVQA 1V6MA 3S5AA 4UFJA 1DBNA 3OCPA 4IETA 4LK7A 3NMBA 3AL5A 3LDKA 3VKMA 1PIV1 3O1VA 5KHHA 5H9SA 2GN3A 2J7MA 5GZCA 4Y22A 3ZM8A 2F6BA 3P6BA 3WDYA 3AZYA 4Q4V1 3KF3A 3WLUA 2W95A 3WDWA 2ZGRA 1JYIA 4E4HA 1AHSA 3VBRA 1IS4A 2HWF3 2XKPA 3GYDA 2DVBA 1PGW1 4ONUA 4R4XA 1BEV3 3ZYJB 3BOPA 4BK5A 2EIGA 4QPIA 4FXGB 3ITQA 4LNVA 5CAZA 1D4M1 2J42A 1VALA 1O4TA 2ZGSA 2ZGLA 5A7PA 2O0OA 2C5DA 4GWJA 4PI2A 1UZYA 5FY8A 5FZMA 2Y6GA 5BNQA 1YFYA 4BIFA 2PHFA 4Q4Y1 4DY5A 2OUJA 2PHTA 1OBNA 3I2KA 4LPLA 4C8DA 4CCKA 2LW8A 2P17A 1W9SA 2VQUA 3CL1A 5AFEA 3N9LA 1W8FA 4HN1A 5E8AA 2XJPA 1MZEA 3UGGA 3BTAA 4CU8A 4IE4A 4AVCA 2W47A 4BB3A 1MR5A 1AYN1 2H6BA 3ZSMA 2D5FA 2GSYA 1J83A 3LEIA 4JDMA 1A8MA 3AMMA 1O3TA 5L7OB 2R30A 1WA4A 4URTA 1O8PA 1S0IA 4RHV1 4LKFA 1RUG1 5LBBA 4NAOA 1Z7S1 4XTPA 4M4RA 4Y1VA 4CVUA 3NQHA 5A3PA 3HNYM 2AYHA 2QQOA 4NPRA 3CMGA 3TEXA 1TG7A 3HAGA 4TYSA 5CKMA 5LK7B 1BMV1 3RZGA 5JVVA 5FP3A 3CJIB 1YFUA 1H2NA 3LFIA 1MZ6A 1AUYA 1PM7A 3GALA 1COV1 2ARAA 2XJUA 2XKOA 4TLFA 2XH6A 4BQ3A 4IEQA 3OEAA 2C4XA 1JS9A 1AXZA 2XBO1 2YB7A 1BHGA 2ZPXA 3POEA 4F83A 1UOFA 3CZJA 1VBB2 3CHXA 5T5LA 3T1LA 1C3HA 1V6NA 2UY8A 5A3WA 3WNKA 3T09A 1EV13 5JXGA 5FK8A 2J1SA 4Y1XA 3AP6A 2R49A 1VBD2 4R4ZA 1C8M1 3POYA 4LR4A 5DAWA 3D8CA 3NV3A 1HB2A 2A7AA 5FZ7A 4GKXA 3PNAA 3P1IA 2DVFA 2I07B 2RR13 4YZ4A 5HV4A 2WRAA 1ZBA1 1AJOA 3WOGA 2RMU1 1NCRC 4FPFA 5F3IA 3THCA 2WFF1 1DYOA 1H8TC 2IC1A 2W94A 5F5QA 4Y33A 2ET7A 3BU7A 5AC91 1YJLA 4MVTA 5FMOL 3TEWA 4CEYC 3GXUA 4YVSA 1XNKA 4A7KA 2Q0AA 1TME3 1H30A 1DGWX 2G1MA 2ZMLA 4XXPA 4XBLA 4COVA 2GH8A 4YG6A 2JJ6A 3OD0A 5C3SA 1JBCA 4BJ0A 1LRHA 3J7NA 4Q4W3 3U4SA 2KA3A 5JOXA 3LSDA 2XJRA 1GOGA 1GANA 4QX7A 4AI0A 2PAMA 2NZ9A 3WNXA 4JGYB 3KT1A 3T30A 2ARBA 4GULA 4L92A 2VD7A 1GLHA 5J09A 4RGGA 1H1AA 3N35A 5FY5A 4AW7A 3RYRA 1IHMA 5C6CA 4K6BA 4PBPA 3I49A 1OLQA 4JHZA 4LUMA 1RUF3 4S2DA 2V09A 1QJFA 3B93A 2VE1A 4L97A 5J36A 1AR62 5FLJA 1UPSA 3NSTA 3RZZA 5FMCA 3H7YA 4RR3A 1CAVA 4XF1A 4D69A 5DUWA 2BUKA 2DTWA 2VCCA 1V6LA 1V9U3 2UYAA 4DINB 5JZGA 2A6XA 1BBT1 5CVRA 3CDZB 1VR3A 3C7OA 4YW2A 2BERA 2P5BA 1OVSA 3U37A 1K5JA 1MQTA 4MADA 2FCVA 2WYFA 4A41A 5LA1A 1HB4A 3HBZA 1W04A 3B3QE 4KNCA 1M06G 1I9RA 3URFA 2JX9A 4AFDA 1Y4WA 4Q1PA 1R081 1Y7BA 3MDPA 2ETEA 1NCQA 3AMNA 3PTYA 1L3JA 2DFBA 2IUWA 3I3BA 2WC2A 4LHLA 1BZWA 2QQUA 1AXKA 4DOUA 2IXKA 3WNLA 4DZGA 4RS5C 2HYXA 4IGPA 3K4AA 3WP6A 3U10A 1U5YA 4CDXA 3GDBA 1RUJ1 3LE0A 4P9IA 1ZZBA 2R073 5A7NA 4LOSA 3WR0A 3OGSA 5IATA 1UOBA 2X5IA 4WVMA 1W2AX 4ZKTB 1WZXA 4Z92B 2E63A 2C1FA 3D4KA 4AI9A 1X8MA 4GALA 2Y6JA 4XJUA 2DCTA 5A7QA 5IAVA 1ENRA 3ZPYA 4COZA 4BCUA 1NG0A 2TNFA 3H7JA 4RL7A 3RYPA 2VO5A 2YY1A 1W9FA 3POSA 3J9SA 1UU5A 1CD3G 2JG9B 4GKYA 4UBHA 5FUIA 4CPBA 4FP3A 3RWKX 1PZ9A 3R4UA 2VZOA 3RSJA 2L9LA 1ULGA 2D6MA 1J84A 4DMIA 2VH9A 1J58A 2VZTA 2ZGUA 3B7MA 1R1A2 3LCPA 3SKVA 4FTSA 2VAUA 3DYOA 3MLLA 3VBUA 1CAXB 1PK6C 1X7NA 4R52A 4XQ4A 1RC6A 1KDKA 1HN1A 1QOSA 2RS33 4AVAA 1QQP1 1HXS2 3WCSA 5FYYA 3WD5A 4MGZE 4V2WA 4AFMA 1TNRA 2DVDA 4Y5TA 2UY9A 2LALA 2GAUA 4XCAA 3WG4A 4LO8A 3WW1A 2CHHA 4CDQB 5ABJB 5HXMA 5IVBA 2VECA 3FFZA 3VDDC 4MOAA 5K9YA 3DF0A 3ZYBA 2OT7A 1BVP1 1XNDA 3U14A 2WUHA 2LM3A 2OXBA 1ULFA 1YI9A 2D6KA 1OLRA 4RYDA 4XFGA 5DUXA 4GMP1 4NJ4A 4QB2A 3WF4A 4XJAA 4RSUA 3WQBA 4Y22B 4FPEA 2R061 1ENQA 2A70A 3D3AA 3IPVA 4JDOA 4QX2A 1ZZCA 4FOVA 4Y1UA 3LQCA 2BFUS 3GZUC 4WM8C 2G19A 4Q27A 1I5ZA 4B4PA 3AJZA 2VZ3A 3BYWA 2BNNA 2GH2A 4BMBA 2JDZA 5FY1A 3HOBA 3FWEA 3KZ4C 5DABA 1ZZ6A 1Q5OA 2XUMA 5J98B 3NJXA 3KVAA 3J7MA 5F8PA 2P3KA 1POV1 1OUSA 3CJXA 5APAA 1JYCA 2X09A 2DF7A 2HYKA 3DN7A 5C71A 1JZ3A 4NWWA 3JBG2 1S55A 3ZKUA 1NXD1 3ZMNA 4XXAA 4BDVB 3PDQA 2YU2A 1S2EA 4FPGA 4JV4A 4UI9L 4QQHA 4FAGA 3KLSA 3O14A 1DYKA 1SCSA 3UESA 3WQ0A 5F3GA 1CJDA 2HEVF 2R16A 3KV6A 4Q5OA 1PO11 3ZXGA 2R1DA 3L2HA 4C91A 3O1SA 2CL2A 4K7JA 2AH2A 2D93A 2H0BA 2ZJCA 1RJ8A 4YSFA 2VBBA 1NCRA 3TAYA 4W50A 3WUCA 4C0BA 3OBRA 3AXDA 2VUJA 1G9CA 2VW2A 4IEPA 4CXWA 1XB9A 3V64A 1BK0A 4NHKA 1EUUA 3N9MA 3ZMOA 1LOCA 1SCRA 3EMRA 3A0KA 5IHRA 5IFTA 1T6BX 4QX5A 4WVWA 2CGOA 3R6SA 3LIHA 4B3NA 1ZX5A 4UFMA 2VOXA 3DV8A 4XIOA 1ASJ3 4B29A 1PNFA 4HZFA 3O1OA 2QQWA 1LEMA 2PQQA 2EXHA 2CDPA 2HWC3 2WT2A 1RUI2 1PMHX 2VM9A 3Q8FA 3CKHA 4XDQA 3U07A 2O14A 5BUVA 1O3RA 5IT6A 4ZU4A 1S1AA 1S0BA 3ZFEC 1AR83 2PQSA 4LITA 4CE8A 1F4HA 3I59A 2WWSA 3SC7X 1ZRDA 5I93A 5F7UA 1CAUB 3O12A 1VLNA 2VMHA 1F5JA 5DMYA 3S57A 3VZJA 4DXRA 5B4XA 4F8AA 2B45X 2C6SA 4DEVA 5JOWA 2WYSA 4LLFA 3UKVA 1Y3TA 3OPTA 2WS92 3D5OA 4NHMA 3UK9A 4BWOA 2VUAA 1DZQA 1XC6A 4DRRA 3B94A 3OUHA 3GZTB 2WIIB 1H4GA 2A1XA 2CY6A 1VBC1 4GAZA 4HVRA 4CUGA 2XL9A 3MIEA 5FO8B 4HKLA 4YVSB 2FD8A 4JGYC 1RHI2 1Q3EA 3GCXA 1I6XA 5TSWA 2KR2A 4QQLA 1UX7A 4R9DA 4XC9A 1DZRA 1W8TA 2A6VA 4L0PA 3UGFA 2RM22 3VBFC 4FFFA 1IPKA 3S30A 5I0DA 1SDDB 2WQZC 1OFSA 3U11A 1Q43A 5CYYA 3T0AA 1L7QA 2V72A 2PHUA 4PF1A 4XILA 2RS11 3HQRA 1QDOA 1QJY3 2XR4A 4YM2A 5FDBA 2WZPP 4FTEA 5LEJA 1UMIA 3C7EA 2IFRA 2D6OX 3DUIA 1GQHA 4QQOA 2WNUA 3Q8AA 3PUIA 4RS5A 4QKDA 4HL0A 2B8MA 1DFQA 2VMGA 1W6MA 4NWVA 1YEWA 2JE8A 4AQSA 4BM8A 4GWNA 3EO6A 5LW9A 3Q9OA 5B4NA 4FSJA 4UW3A 5A6XA 4JAAA 4RR3B 1CAVB 1XJAA 3T2QA 1UU6A 1NOVA 3IDCB 5FO7B 5JZGB 4A3ZA 2Z69A 3E97A 1LGNA 2AACA 3N7KA 5F32A 1W3XA 5CISA 1OXCA 1ZBE1 1DF0A 2ZKLA 5JMCA 1SBFA 3AKRA 4MHUA 5JOYA 1VMFA 1QJX2 3UJOA 1KITA 1MQTB 2PXJA 3AL6A 1VE0A 1NLSA 1WBLA 2BTVC 5FY7A 5FXXA 4CCDA 3APBA 1D0HA 1DQ0A 5HCBA 4D8MA 1LULA 1GFF2 3WQ7A 4Y24A 3U0ZA 4X8PA 2B39A 4UAPA 1NCQB 3DPRC 1ZM1A 2HWB2 4XFIA 5LY2A 3IAPA 5C3QA 1PK6A 1RUD2 2FDJA 2W68A 1HRI2 2XLGA 1OVPA 4G4FA 2Y6LA 3CF6E 4OQ8A 3O1PA 4CA9A 1WMFA 2AEYA 3NAPC 4CP0A 2ID4A 4Q4X1 3NNLA 2OZJA 3AKQA 3CIHA 1U5XA 4LKEA 4QXHA 4XUPA 1X82A 2FDGA 3B69A 4N43B 1TQ5A 2X5IB 4WVMB 4ATFA 5DQ0A 1PO23 2JG9C 2X8KA 1N1SA 2XJTA 4P9XA 3I2HA 3GJBA 5FWJA 1ZRRA 5LK5A 3VDDA 1RITA 1F8VA 4QT6A 4BA6A 3WXPA 4M0HA 2YZ4A 2H6CA 2ARCA 1RIRA 3WZ1A 3FUOA 3HNMA 3POFA 2VMCA 1VAMA 2A3XA 2XMLA 3C7GA 1WW7A 2ZX4A 4BQ4A 5FTTC 1G9BA 1LJ7A 2VQAA 2PHWA 4MXWB 2E33A 2ZBJA 2BU9A 3AC0A 5FXWA 1GWKA 1QHDA 1YC61 1F5FA 4C1WA 1SFYA 5C9AC 5K7PA 2DV9A 2WNEA 5HCFA 4YRDA 3ZXEA 2D6LX 4AAPA 3KHBA 2PLV1 4OFGA 5IFPA 3MUZ1 3I7DA 3ILFA 4XE9A 4IQPA 3NKGA 4XFAA 3VBUB 5ABJC 2VVFA 4CDQC 4QB6A 3HN1A 1TE1B 3MIDA 4FQ4A 1DIWA 2VZQA 4IGOA 4AQ6A 1VBB3 1GOFA 3AYCA 1O5LA 1UL9A 5T52A 1WBFA 4YFZA 1J3RA 5FY4A 4YFWA 1VBD3 1Y9GA 3WV6A 5IK7A 5LA9A 3GGLA 2BYVE 2GMPA 3OSDA 4PLOA 2OA2A 5L9RA 5AVAA 4DNYA 4DY3A 4IEOA 2QQNA 4GD4A 5KXCA 2OZ6A 4PJYA 5BYNA 1OQEA 3H1WA 1AXYA 1V00A 2VMDA 4K1YA 4XYXA 5F6KA 1HJFA 2QQIA 1RUH1 2XL7A 4QHBA 1WD3A 2BOIA 4HPKB 5FYSA 3VBRC 5F3CA 2HWF1 1YQ6A 2AZ5A 1BEV1 5FZBA 5CFDA 2XOMA 3NJZA 3IPVB 1F4AA 4QPIC 1REFA 3ZFFA 4JQRA 4A3XA 2WT0A 1LHVA 3WSOA 4BQ5A 2D3RA 1FAYA 1PIV2 4EN0A 1S0DA 1RUE2 2JDNA 1V6KA 1J1TA 2PA7A 3VN4A 1HIXA 3BOWA 5EYXA 3VLBB 3HNBM 5LATA 1UOJA 3CQOA 4Q4V2 3ACGA 1HN0A 3VKFC 5JIUA 5C3OA 3R4SA 1OA3A 1AR63 3ZFEA 1VRH1 4QPYA 4XABA 3ZXAC 4P08A 3ZYRA 3JXSA 5HPOA 4A42A 3JU9A 2EIDA 4MGQA 1D4M2 1JHJA 1UY3A 4J6GA 2D5HA 3G7DA 1BXHA 1IQDC 4KMQA 1I1EA 4QAWA 4OUEA 1VP6A 4DPNA 1NCRB 4Q4Y2 3H1YA 1H8TB 1BK1A 2ZX1A 3JQWA 5FCCA 3RDIA 1W9WA 5LEKA 5DDJ1 4CEYB 5FP9A 4CU6A 4WZFA 1UF2C 3CU7A 1MZ5A 3AP5A 2BWCA 5CKNA 3VBFA 4UF0A 4CCCA 5FP7A 4GH4C 3KM5A 1ALYA 1EV11 4XQDA 3ST7A 2ZGQA 3A23A 1OMIA 1JU3A 3MLJA 3BVCA 3C7FA 2N7GA 1SLTA 1WLWA 1VMJA 1RUG2 2ZX3A 1SQ4A 3GZAA 2WQ8A 1QMJA 1SLAA 1Z7S2 4AL9A 3ZYPA 2E31A 3POWA 4BZ4A 3P3PA 5KXDA 3AMPA 4TLGA 4Q0SA 3V0BA 4TZDA 1UMZA 5FZLA 3I59B 1BMV2 4PCRA 1JZ5A 4PQQA 3LA3A 2B46X 1UQXA 3OD4A 4FPJA 2MHFA 5DG1A 1QJZA 4Z2WA 2DURA 1S0JA 4MX3A 5JPNB 5ANQA 4YVSC 1YQ5A 1QJU1 4YW3A 2HBTA 1S0EA 4INDA 2XBO2 3LF7A 1TME1 2OS2A 2RS52 1H1MA 2BGPA 3T08A 2Z42A 5FR3A 1GMMA 1EP0A 4BMEA 4MUVA 2FCUA 4Q4W1 1DGLA 3THPA 3PUAA 2W39A 4BXFA 5FMOS 5CADA 2BP6A 3E6BA 3EQEA 1OUXA 1OH4A 1WMDA 4NIHA 1C8M2 3T1MA 5BNNC 3OYWA 1ZRCA 2VNGA 3HQUA 3WG1A 1MS4A 1SFPA 1R1A3 2R041 4V2VA 4B7EA 2I2SA 4CCJA 3O1MA 3LA2A 2EIBA 2RMU2 3N3HA 3RYKA 2PHDA 5F2WA 2WFF2 1HXS3 1REEA 3DPRA 1BCXA 1LHWA 1N3PA 2JKXA 4LHNA 1QKQA 5FREA 5AC92 5C33A 2QQLA 3ILRA 5CEHA 4EE2A 5FLIA 4IEZA 4EV0A 2ZKNA 1W6OA 4RS5B 3NAPA 1V9U1 1XE0A 5JZGC 5CG9A 5K0UA 3FLPA 1XSRA 4I3PA 1W6MB 4QU1A 4IUGA 4WBBA 5A3MA 2QQJA 2JDKA 4OYUA 2LS6A 1U5ZA 1ND2C 4P00B 3OGJA 4YGDA 5HXVA 1DQ1A 1DGRN 2CAUA 3VDCA 5CKQA 1SBEA 1ZA7A 3QH6A 4N90A 1RMU2 1GP5A 1UW8A 3EHKA 3SHRA 4QX3A 4J25A 3NO8A 4AEDC 1YO8A 5FYTA 1NCQC 1SLCA 5D8AA 4AGRA 3RZKA 4NHYA 1LGBA 1XE8A 4XF4A 3ACHA 4OMDA 4YW7A 5FRAA 3D6EA 4AVVA 5C9AA 4HANA 1UOGA 3E6CC 3ETQA 3ZXLA 1R091 1SMVA 3NRUA 4KWJA 2C9KA 4CDXC 1GBGA 4E4SA 3KCXA 1QGLA 4AI3A 1BBT2 3WNNA 2ATFA 1P8JA 2ZGTA 1HV0A 4W6XA 3D82A 3WW3A 1ZRFA 4AHZA 5KXEA 1PK6B 1LOFA 2QBXA 3JBG3 4AGVA 1XRUA 1CGPA 1GQGA 3NJYA 1W9TA 4B1LA 3KS7A 4MGKE 1XOYA 3BTYA 2ZTNA 2X53S 4KBZA 3VHPA 4CXYA 4FQZA 3U1XA 2RV9A 1I5PA 4P5HA 4NO4A 5FV3A 1EY2A 1F2NA 1C1LA 1CIWA 1KQRA 4GZ9A 2WA4A 1ODMA 5GLVA 3VDDB 1EAH2 4QGLA 5LA0A 2XHNA 4HXCA 3RMYA 2ZHNA 3SCGA 2JWPA 3LZZA 1W3VA 3I4IA 5CB7A 1RUJ2 2A6WA 3OY8A 2Y60A 2W52A 3RG0A 3VBUC 4MYEA 3MZHA 4LXLA 2XUEA 1H2KA 1TNFA 1FOD1 4OVEA 1LOAA 1WW6A 3MHZA 3MW4A 4WM8B 4XBNA 5EJZB 4FO9A 1UIKA 5FXZA 3WDVA 2BGOA 4LO6B 2QDRA 2V5DA 3NL1A 3NWKA 3ACFA 4RQPC 3ZSJA 4EN7B 2FHRA 4A45A 4LT5A 4GWIA 2Z4FA 1WLDA 2DVAA 1S0CA 4HSJA 3VBOA 5LWBA 3H3ZA 4Y4RA 4L2NA 4A2UA 1RUI3 1DP0A 2MEV2 3WW2A 3TEZA 4S2GA 1GNZA 3GZEA 3PL0A 1QY4A 3EXUA 5I8YA 1LOEA 2XLFA 4N53C 4XUTA 1AR72 3BGAA 3K51A 4UYBA 5ANNA 4QXKA 3U78A 5E88A 1SFNA 1EPWA 2O8OA 5DAPA 5FK7A 5C4WC 1PO22 5A3LA 2HWE2 5FZ6A 5DUVA 3FHQA 4KGGA 3VKNA 5C7GA 3QCWA 2VBPA 2FBEA 2R0HA 4ASLA 3I2OA 4O9GA 1XSQA 3VZKA 4D7YA 3W21A 2DYCA 1QQP2 4QX1A 2WS93 4I0BA 1ND3A 3PMSA 2WO1A 3TN92 2WO7A 1JUIA 2Q5TA 4MG2A 1AX2A 4Z1VA 4TXWA 1NYWA 1FMD2 2JICA 3L2YA 3GM8A 3MF9A 4YGCA 1T6GC 1UYYA 1RHI3 1EYBA 5D1IA 4BQYA 3JCIA 4ZZ5A 1W2UA 3ZFFB 2IXHA 2WN3A 1DGWA 5EFUA 2RM23 4QKBA 5GLWA 3M1HA 5FYHA 3HT2A 2Q8OA 1W6PA 5JLVA 4YG3A 4CSWA 1NY72 1MS8A 1CN1A 4MGSA 4XUQA 1HJGA 3VDAA 5G04L 1OOPC 4GH4A 1HV1A 1N3QA 2QDNA 4FFGA 4ZS3A 2R062 1LENA 1UO9A 2W1WA 1C1FA 1IKPA 1IPJA 3I8TA 2Q8EA 4LIVA 3O0VA 4PLNA 5FZ9A 5FBJA 1W0NA 1W2OA 2OQ7A 3SMHA 3PU3A 2NMOA 4FPOB 1VBE2 4Y3OA 3ZFEB 2RG4A 4IERA 3ROUA 3HT1A 5DAXA 2ZAHA 3AK0A 4QHZA 2ARXA 3I3QA 1F15A 1MS9A 2OUHA 2JE7A 4P9GA 4PT6A 3HQXA 2WLPA 4ASKA 4W6YA 1SDWA 3KV5A 4EN6B 3DGTA 2IWGB 1LTEA 1Q8VA 1QJX3 2DFCA 4H7LA 2EICA 1ZVFA 1BVVA 5F5IA 5FZAA 4DFSA 3ZLIA 2VNRA 4PBOA 2BVVA 5K4LA 2DWRA 1NA1C 4AQTA 4PF5A 3I54A 5BNNA 4R9BA 2HWD2 4XTMA 2YROA 2HWC1 3DYPA 1AL22 5B2GB 3AMHA 4BK4A 4BYYA 2HWB3 1HB3A 1RUD3 3OBTA 1UAIA 3VBFB 2UWAA 3IN9A 4IE0A 5CFCA 1ULPA 2DUOA 1HRI3 5I0SA 3O7OA 1JZ2A 5FKCA 2EA7A 1QH7A 3TEYA 4UFKA 4NN0A 2E6VA 3VB9A 4IESA 2CU5A 4M0NA 5F5CA 5F1RA 3INAA 3MYXA 3OGVA 4OHZA 5C5UA 1AR91 3EYPA 2OYZA 3O0XA 1GICA 3V0BB 2WFPA 1W39A 2E7AA 5H9RA 2XLAA 5IVEA 3VD4A 2CYFA 3E5XA 3LGRA 4NIGA 1ND2A 1SLBA 3V0AA 1X9TA 1W03A 2VXRA 5LB6A 3ZFGA 4UFLA 4DUWA 4KL1A 2BW8A 3POGA 2ZMNA 4XETA 5T55A 3T4HB 5C5TA 5D21A 3ECQA 3VZOA 3AFGA 2CAVA 4I01A 4AEDA 3R4DB 4QXCA 1YJKA 5FUPA 1GR3A 3MI8A 4JHTA 2FZ2A 2F4LA 4XPVA 2VCMA 1QJY1 1REDA 4LE3A 4LJHA 4CEWA 1PM4A 3OYWB 2HBUA 5CG8A 1K5MC 2WNUC 3SH3A 1IZ3A 1UD1A 3N9QA 4O9EA 1BLZA 3GCWA 3ACLA 1S0GA 3WHUA 1J3PA 1V6IA 3SITA 2OQ6A 2FQPA 1IG3A 5I0TA 5FPBA 3KCYA 5ACA2 2DUPA 1VBC2 3DPRB 2O1QA 4FOYA 1MACA 3ACIA 3BPSA 4ZPIA 2LTNA 1WGPA 2WZ8A 1PVC1 1IS6A 1W6OB 2Q30A 3OOXA 3NAPB 3ZSKA 1X8EA 4AI2A 4ITCA 3ME2A 4LULA 3MICA 1SPPB 3LKJA 1W9YA 3A22A 3M4FA 3RZJA 1GKBA 4MZUA 3S7EA 3SLIA 2VUCA 2EAKA 2VBDA 4ASMB 1OSGA 4BXSV 4K20A 1ZA4A 1ZYBA 4LHSA 5I0UA 2OKXA 2NQYA 4XACA 5FXVA 1MVEA 3WP3A 3M3EA 2C9AA 4HKWA 5JWPA 4KGQA 2W87A 1DQ4A 2OW4A 4M3CE 3TB0A 1CAWA 4QM8A 5F3EA 3VL8A 2RDSA 1S2BA 4OUSA 4AOCA 1QNYA 1HLCA 1PIV3 3SNMA 2BZDA 1NKGA 3QOPA 3WT3A 4BIOA 3U4XA 1RUE3 2XVKA 3GHNA 2AGSA 2X10A 4AEJA 4L11A 5C9AB 5IVFA 3GF6A 2JB8A 2BNMA 5C3PA 1OPMA 4RQPA 1HRV2 1SG3A 3ZO0B 2XJSA 4Q4V3 3R05A 2YU1A 1W05A 2Y6KA 4P5YA 4IDZA 5GKAC 1O7FA 4HK9A 5J7MA 2BBVA 2PFWA 4L99A 4E4ZA 4YW6A 5JSOA 4N53A 2ERFA 3J8F1 4DXSA 2QQMA 5C4WA 3H8OA 2EXKA 3PVEA 1CPMA 5FY0A 2JENA 3VGIA 1D4M3 1H6YA 3M70A 1OD3A 2XVLA 2VVEA 1VB2A 1W6QA 2YDEA 1W6NA 3OGRA 2VPVA 3BTZA 4OI4A 4Q4Y3 3A0NA 1GP4A 1RTVA 3RI9A 3PVBB 4LMFA 3VBRB 4E4DX 2Y64A 4Q4X2 1O5UA 2QTWB 1YFWA 3OY8B 2E9QA 3AFKA 4ARXA 1O3SA 4QPIB 4H55A 4OLLA 4TN7A 1XE7A 4XF3A 2VTXJ 1UNBA 1IOAA 2WL1A 1JYVA 1OH3A 4DEQA 1TMF1 4YGEA 1VBB1 1UY0A 4NE9A 5F9TA 3K77A 4UW4A 4AHWA 1AYM1 1VBD1 3VHRA 1JMUB 2YG0A 1RUG3 4Q0VA 5LA2A 1OOPA 4GB31 1Z7S3 4Q0PA 2W46A 3H1MA 2Q1ZB 2ZEYA 3AVSA 1R1ZA 1OKOA 4XURA 1UZ0A 1JUHA 4SLIA 5EHDA 2UU8A 1VBA1 4OI0A 3JB8A 2ET1A 4UW6A 5BPXA 4N8MA 2EALA 1DZTA 4YZ3A 2IXIA 3QLQA 4E2QA 2EF6A 4LBLA 1GZWA 1GNHA 4AK3A 3P5BA 2AUYA 2PLV2 4LORA 5GLTA 2WR9A 5CFDC 2YPJA 5FZFA 4N7IA 3RNSA 2RJKA 4LO7A 1SEFA 2XBO3 3ZFFC 1UKRA 5L9VA 2RS53 3E5QA 3FL7A 3KGZA 1ND3B 2FDHA 3NNGA 1MEC2 1RVF1 3H3UA 4UFIA 5A1FA 3GBGA 2V4VA 3JB4C 4K8RB 5A33A 4ARYA 2DBNA 4XFBA 1CWPA 1C8M3 4W8JA 1DQ6A 4IXLA 1D0GA 1WCQA 3THTA 4M3CF 5FQ0A 2JIJA 3BUCA 4CP2A 2J1UA 1YQCA 4XAAA 1H1IA 1NA1A 2RMU3 5FZ0A 1FNYA 1G9FA 3UKNA 3PVNA 4EQVA 1W6PB 2WFF3 2AR6A 5EP9A 2GMMA 4JTNA 2AENA 2ZOEB 5AC93 2VJXA 4YARA 3LOBA 1XU1A 1QOTA 4GH4B 4JKMA 4YZ2A 3EJKA 5A3NA 4UXAA 4WV8A 1RUC1 1WCUA 4K40A 5FPXA 5JI7A 3LOIA 3RQ0A 3JD71 4CPBD 2YBSA 4FOWA 1KRIA 4AWDA 2DUQA 1FPN2 2EIEA 3B00A 1ULDA 1LNSA 4FAHA 5H9QA 1JOPA 4L9BA 2QZ2A 3ES4A 3N7LA 1F35A 3VBSC 4LBQA 2VCAA 1NXMA 1OFNA 3L9JT 4Y1ZA 2WDBA 2FMYA 1RMU3 2PHRA 5DAQA 1J59A 2JDHA 1NE4A 2Y33A 3FE5A 4IE5A 5FMDA 5LRRA 4D3WA 1UIJA 4A7YA 4CP1A 4HMZA 5DUUA 2JEMA 1V6OA 1VRH2 4K1ZA 1FV3A 3IB3A 1N1TA 4J1XA 1GZCA 4UBGA 5FJHA 1W28A 4EN9B 5CNAA 4PHZA 4XF0A 5BNNB 1KS5A 2VQ0A 1BYHA 2HJIA 1W8HA 1BBT3 1K5MA 1OPOA 4NRPA 1GUIA 4XUOA 3WX5A 4YZ5A 2PELA 4FFHA 4ZXKA 3OF1A 5A3OA 2K2SA 2YPDA 1V70A 2WSVA 1Q8OA 5CFCB 2Q1FA 1WCSA 4HETA 3WG3A 4QKNA 1ZZ9A 1QDCA 3WNPA 3NKTA 5IJRA 2NP0A 4AGGA 4AFAA 2NYYA 5J1XA 5FO9B 5C70A 5DDJ2 3ELNA 5I8TA 1OHFA 3HBKA 4FPHA 3RMXA 1LCLA 1I3HA 2JDYA 3HD8B 1DCSA 5A7WA 2GNDA 2P2KA 2P1BA 3DKQA 1EAH3 2R7EB 2XDVA 4QB1A 1A6CA 3Q8EA 3ZDVA 1ND2B 3V0AB 1PZ7A 1YQ8A 4QPGA 5A6ZA 2XGXA 1HW5A 1RUJ3 3H42B 2B7YA 4K3UA 5FZKA 5DG2A 3AZXA 3MV01 2WN2A 4EZHA 4JVAA 1J3QA 4JDNA 3T2PA 5C3RA 5A70A 4AEDB 3F2ZA 1HXS1 3HN3A 2QUOA 3A4UA 4HN0A 5IK4A 4CEWB 4D0QA 1BJQA 1YLLA 3DXTA 4MGYE 4PI0A 1QJU2 5BNPC 1KD7A 2CTVA 4CCLA 5K0UC 1QJEA 4JX0A 4CDXB 2MEV3 3ZYIB 5SV5A 1W0OA 3ZR6A 1AR73 1YCIA 1OURA 4KH9A 3I3MA 1LECA 4LBNA 1MZFA 2HWE3 4AR2A 5AFBA 2XG3A 1DDLA 1A78A 1PMIA 2ZZJA 3PUHA 1YWKA 1JYWA 3QACA 3UGHA 3NV2A 3ZX7A 1KDMA 2I45A 4YW4A 5JIAA 2FCTA 3RS6A 3WEZA 2ES3A 1QQP3 4AVBA 4CU7A 5I91A 5D8AC 3KV4A 3TN93 5FP8A 2O8QA 2JB4A 2D6NA 2A5ZA 2EXIA 3N36A 5T54A 3KD4A 4B1MA 1O91A 2JECA 5JXIA 1FMD3
chains in the Genus database with same CATH topology
1MS1A 2HKXA 1A8DA 4BH9A 3PVOA 4Y20A 3B5LB 2GNMA 2IXJA 1CVNA 4KQ7A 2A75A 1LOFC 4FBFA 1VJ2A 3JBG1 1F31A 5DZEA 2GC1A 3DKWA 2D3PA 1ZNPA 4ORFA 1OQ1A 2R063 4RQPB 3ZIXA 4I09A 1XU2A 5KHGA 4QM9A 4JC1A 5BNOA 1RJ7A 2WZR2 2Y26A 1VBE3 4N53B 2YC0A 4NHLA 3PHMA 5C4WB 1R092 4IV1C 4H14A 2ZGNA 1NZCA 2YGLA 1POV3 2G4IA 1H2LA 4R8HA 2NM1A 4U2AA 4KBBA 4M3CA 3W9AA 1G7YA 4Y1YA 1W6QB 1W6NB 3S0MA 4GXLA 2QCSB 4XBQA 3MFCA 1LOGA 1UZZA 4H3WA 4GQ7A 4XF9A 3WW4A 4KU7A 3VBOC 3JQXA 2HWD3 1KFUL 1AL23 1RUI1 5C8CC 4EWAA 3M7AA 1U0AA 1XQNA 1YIFA 2OPKA 4OI1A 2G9FA 2DCJA 1PGW2 1OOPB 5I0RA 4HVOA 2NMNA 4FCAA 4COUA 2RJLA 1PGL1 1FOD2 1LHOA 2WS91 1ND3C 1QU0A 4GIQA 1IS5A 4LUKA 5LRSA 1GZWB 3ALQA 2ZHMA 1B09A 4DQAA 1RHI1 3VBSA 4OI2A 4YGBA 4P9LA 1XNCA 1ULCA 2W08A 1AVBA 2RM21 3SCHA 5JR7B 1NQDA 4P9YA 3VZNA 4R9CA 4WVZA 5A33B 3B02A 1AYN2 3IMNA 4XW3A 1QXPA 5FQ0B 5EJ3A 5F6LB 1F9KA 3LB9A 4AE2A 4RHV2 1NA1B 4RD7A 4J1WA 3ILNA 1FI2A 4D7SA 5GJ6A 1LU2A 4AYUA 5ACA3 2RR11 1VBC3 2G9GA 3WINE 2PHXA 2FMDA 3AX4A 2XWJB 3CNAA 5JCTA 3CO2A 2Z2SB 1COV2 5DXDA 4Q0UA 4W65A 2V73A 1YYNA 1QJX1 4FVVA 4AHYA 4AEMA 2RE9A 4QGNA 4IV3C 1VAKA 4LBQB 2UYBA 4XMAA 1YI7A 2EAAA 4Y26A 4CDUC 4E2SA 2HWB1 1ZBA2 5CFCC 1RUD1 4AG4A 3NVCA 2VW0A 5FAXA 1RUF1 2ZX0A 5KC6A 2BGCA 3C3VA 1HRV3 3MIGA 4YG0A 1IGOA 4BHPA 1K5MB 2WNUB 1ONAA 2BQPA 4C1XA 5BNPA 2BPA2 2YGMA 3VZMA 2ZA9A 4C0HA 2CWMA 2PYTA 4X6RB 4P9JA 3TYJA 1SACA 3R0RA 5GZEA 3ZFGC 4HSLA 5L73A 2RHPA 2UWCA 1ZZ8A 2QKDA 1N1VA 1APNA 5IK8A 5JSRA 2EVXA 3HMYA 4CEWC 1FNZA 4Q26A 5FBZA 4Q4X3 4QPGB 3USSA 1IKQA 2ZGOA 3LA7A 2E51A 2P3IA 1AR92 2R071 4Q8KA 5HCAA 1BQPA 1MS3A 4G3YC 4MXVA 4S2FA 2JD4A 4N9IA 1XNBA 1CONA 4DS0A 2TEPA 1A3KA 3B9IA 3VHNA 1CJPA 1OI6A 2IXCA 1O4ZA 4YNIA 1R082 1JTZX 2VNOA 2B5HA 2PLV3 1ENSA 1PNGA 4IV1A 2JG8C 2QNKA 1YXWA 3AZVA 3FJSA 2VW1A 5BV6A 1S2KA 3FC0A 3O5SA 4QU2A 4DXZA 1G9DA 4X8NA 4I3GA 2XWBB 4OULA 1MEC3 1D2SA 1WMEA 1H4HA 2RS31 1RUE1 3BIWE 5K8SA 1PVC2 2VU9A 2W0XA 2XJQA 3CEWA 3HIFA 4OZXA 4S2HA 1YNAA 4CRQA 4LBMA 1FXZA 1LHUA 3CLPA 4Y20B 1DGRA 5J3UA 3KCCA 5C8CA 4YYOA 1RUH3 5FOBB 1C5IA 1J1LA 1URXA 1HDKA 1DLLA 4KG8A 2QFEA 4AI1A 1G6NA 5FLHA 3ZN5A 3IIAA 4FPLA 4JGZA 5BNOB 3GNEA 1FPN3 3BCWA 3KQRA 3V65A 3VBHC 4WM7C 2XHKA 3MIFA 1Q8PA 4XQWA 4XHXA 4BOWA 4K21A 4YM1A 5CFDB 1O3QA 4B8EA 4CDWC 3AP7A 5GM0A 4M3CB 2ZGMA 2DU0A 3IKWA 2K9ZA 3J8F2 1VRH3 3ZN6A 1KXGA 1AZDA 2EXJA 4PLMA 5L36A 4LTAA 3ENRA 4AVSA 4LHKA 3OPZA 1HX6A 1Q8QA 2D7FA 2VGDA 2PAKA 2D44A 4YW5A 3V56A 1LOBA 4PIYA 2D98A 4KU8A 4Z82A 4EN8B 2WKKA 4ES8A 2WA3A 3G6JB 2R0FA 1HKDA 5DDJ3 3AYDA 2RS51 1UX6A 4R9AA 1TMF2 2SBAA 2XPJA 1H9PA 3D0SA 1KFXL 4LO5B 1AYM2 1CAUA 3MW2A 4LE4A 1LEDA 2ZHLA 3VBSB 4GB32 4YZ1A 4IV3A 1B35C 1RL3A 5KHJA 1ASJ1 1N47A 3IT8A 1PO12 1VBA2 3QD6A 2GC2A 4CDUA 5T5JA 3NV1A 3VKLA 1AR81 1FV2A 2HEWF 4YM3A 5L19A 1QJU3 2ZMKA 4AF9A 2DU1A 1RVF2 4XJ8A 1Z0HA 1QF3A 1UPIA 4Y5Z0 1O4YA 5EYYA 4GA9A 5FPZA 4CYDA 2R043 1QXRA 1UCXA 5E1RA 4PDWC 1RMU1 2KM2A 1JHNA 3OGGA 1ULEA 3MGUA 5H9PA 2PTMA 4E2GA 3W58A 4GMP0 1OA2A 3MIHA 2QQPA 3BODA 1W0PA 5DZGA 4Q1RA 4I30A 4DRVA 4AEKA 1RUC2 1D4VB 3M2MA 4I0AA 1RGSA 1WW5A 1SLLA 3JD72 5T3NA 1X50A 2NPIA 4I02A 1WW4A 3WDUA 5BY5A 2Y38A 1YHFA 4IL7A 1POV0 2ILMA 5DZFA 1YIPA 4LA2A 2YHJA 1E57A 4WVVA 3UKTA 5BNPB 5HBAA 1JH5A 5K0UB 3RRDA 2P34A 2WZR3 3KSCA 1ZREA 1TEIA 2LUWA 1EAH1 4YVWC 4BPZA 2ZCWA 2RS12 3VZLA 1R093 4QPGC 3AYEA 3FFQA 2GNTA 3X29B 1VIWB 2GC0A 5JOYA 1GYKA 4N43A 4D94A 3TWIA 3VUOA 5I8SA 2D97A 2JG8A 1BKZA 2CGPA 2X29A 5CU1A 5D8AB 1UU4A 1RINA 3M3CA 4QQ2A 4HBNA 1QWRA 1MS0A 3PJQA 2DCKA 4XFFA 3PJYA 2MEV1 2D40A 3UJQA 3SISA 2WNVC 1ZBE2 4MXWA 4U36A 1AR71 1XXNA 1PVXA 4B4RA 2YV8A 1PO21 4QGMA 4LBJA 2C0ZA 2HWE1 4JRLA 4OHVA 3TBDA 4RA0A 4E27A 3ZYGA 3M3QA 2DCYA 1JW6A 4YLZA 3GBFA 3AZWA 1FOD3 4AFCA 2WINB 3KT4A 3QBQA 2B9UA 1HQNA 4TWTA 3TN91 5CA6A 2BEOA 3ZIWA 3VBHA 4Q0QA 1FMD1 4WM7A 3TNQA 3AKTA 1QXJA 4IV1B 1XYOA 4PQ9A 4A7ZA 2UWBA 3EBRA 2WT1A 3ES1A 3KB5A 2TBVA 3AM2A 4CDWA 2E7TA 1NY71 1AYN3 4HPKA 1LKNA 4UW5A 3ZXJA 3MEPA 3AKSA 1C28A 3IDBB 2KXLA 4RHV3 3VBOB 1DU3D 5BNOC 4N7UA 5KXBA 5C8CB 4G9SB 4ZU7A 1AL0G 1VBE1 2ZZQA 2CV6A 2VOWA 1DHKB 4OHXA 4QMAA 2JXAA 2VMIA 4XJZA 2E7QA 2YYOA 4XFHA 1COV3 3WY6A 4FTBA 4JGZB 2H0VA 3MW3A 2GU9A 2VULA 3KT7A 3SH4A 2VOVA 5L7OC 4BLIA 3FUQA 2A6YA 1YUDA 3S6PA 2HWD1 1LU1A 2CNAA 1AL21 1CX4A 1B35A 3M3OA 3WG2A 4IEUA 4SBVA 4XJWA 1XYNA 1ZBA3 2ZS6B 3PLQA 3ZN6B 2WQ4A 4Q8LA 2XVGA 1H8TA 4WZCA 1RUH2 4ES9A 3CJIC 1VB4A 2MNGA 1Z78A 4LO4B 1OD5A 1AR61 2HWF2 4PIXA 4NOTA 1BEV2 1WUVA 4CEYA 1JXNA 5C8WA 4MV2A 1LB2A 2YMZA 4B7KA 2GALA 4LLOA 3GBWA 1C57A 2QJVA 5EXOA 4IEWA 5T5OA 4COWA 2YXSA 2B42B 4YW1A 2E53A 4PDWA 2ZABA 3K48A 3FZ3A 1XYPA 3B9CA 1LODA 4ATEA 4XMIA 2R6QA 5BXXA 4IV3B 4JTOA 1JOJA 4YM0A 5E89A 1PGL2 3ZDSA 2DCZA 4AQ2A 1AR93 5JOZA 4HLTA 4CDUB 5ACA1 2TUNA 1IS3A 2QE3A 1GSLA 1WLCA 2Z79A 5GZFA 2SLIA 1YRZA 5KC5A 2A3YA 1YFXA 2XB6C 4X6QB 5CBLA 2F4PA 2P37A 3M8LA 3BALA 3FLRA 3USUA 1R083 4KG0A 4LBOA 2AREA 4TSVA 5KHIA 5IUQA 2JKBA 3ZXFA 1PZ8A 2GDFA 1EV12 2R1BA 4ZU5A 4YVWA 4Z07A 4W6WA 5GLZA 1KS4A 2NLRA 3ZFGB 1R1A1 2D3SA 2RR12 3DL3A 2P3JA 1OKQA 2ZGKA 3B01A 5A32A 2A71A 4META 3AKPA 1PVC3 4JRAA 5GALA 3WDTA 5GZDA 1AJKA 5IK5A 5E16A 1UN1A 1HRV1 1QH6A 1WLTA 1N1YA 5CIRA 3IM0A 4DB5A 1SLIA 1TME2 3QH7A 4Q2FA 1Y9QA 1LHNA 4P9WA 1RUNA 2V5YA 2D6PA 2WNVA 1U5IA 4Q4W2 4OHYA 4H7MA 3ZXDA 1X33A 1FATA 3LWCA 4HKOA 2R042 4HK8A 4AXOA 3IBMA 4LEJA 3LAGA 1KJRA 1ENXA 1LR5A 3KMHA 4NVPA 3HWJA 4XZPA 3IWZA 3MIBA 4XJ9A 1RUF2 3AJYA 3AP4A 1Q8SA 4NR1A 3RWNA 4KWLA 1AF9A 1V9U2 3PMEA 3GHMA 2JG8B 4QD2A 1WCKA 1CAWB 1QOOA 4D7TA 4COYA 1H0BA 1NLRA 1H8VA 2BFUL 3J8F3 4LBKA 2BNOA 3KGLA 3E5UA 2VG9A 2I74A 1OQDA 2Y0IA 2ZACA 4FXKB 4GMP3 4M01A 3UL2A 4MLOA 2NN8A 3VL9A 3TNPB 4I2OA 4F7ZA 2OVUA 3AMQA 4LA3A 1OA4A 3C2UA 2JE9A 1DYPA 3LSEA 4WM8A 2Q1MA 5EZWA 4LBQD 1DQ2A 4M00A 4OUMA 4P14A 4MH0E 3RI8A 3UV9A 1WCDJ 3TOJA 2R072 1TMF3 3MFAA 3I2DA 1Y43B 1MEC1 3D0JA 2QVSB 3MLKA 4Z8BA 2A3WA 2DVGA 3ASIA 3VBHB 1AYM3 1AX1A 1FT9A 4WM7B 3OJBA 4IEXA 4GB33 2GN7A 5L7OA 2PAEA 4MSVA 4XFCA 1PO13 2BVBA 1VBA3 2YUEA 4CDWB 4Y4YA 4CZSA 4BQ1A 4I0WB 1CR7A 1HQWA 2VOKA 1D2QA 5JI9A 4AI8A 4K8FA 2Y0OA 4XIKA 3CJIA 3N7JA 4HT1T 5GZGA 4JGZC 1RVF3 4PIZA 3RPQA 1FPN1 1S0FA 2RS32 5T5PA 5FOJB 2A73B 4Q29A 4AVTA 1FYUA 5KBFA 2WJSA 1NE6A 2MPFA 4XOGA 2CGNA 4XHBA 2VVDA 3MF6A 5AVPA 4BLJA 2UURA 2XJVA 4EROA 3N7MA 2ZAAA 3IDEA 1V6JA 3JUUA 2WLQA 2PN5A 1AX0A 1DQ5A 2K0GA 1RUC3 2GZWA 2GMEA 3H9AA 1GV9A 3JD73 1U12A 4FP2A 3WCRA 1B35B 3FLTA 4E9KA 5JDBA 5KHKA 4GWMA 3RJ2X 1RUOA 4AFBA 1CESA 5JSPA 4AHXA 2ZHKA 3H0OA 2DTYA 4N9HA 3ZXKA 5JAXA 4JGYA 3WVJA 2CWSA 3AZZA 1HQLA 1CQ9A 3N4MA 2ENRA 4QQPA 4B4QA 1H2MA 3TRSB 3NW4A 4FPKA 1CPNA 3AXEA 3P3NA 2RS13 3SCFA 3JZVA 3WQ1A 3MPBA 4K9SA 3FHIB 4PDWB 5J96B 1VAVA 3J4UH 1KJLA 1M4WA 1NQJA 3W59A 1MS5A 4ISQA 4RGAA 1N3OA 4RFT0 1LGCA 2D43A 1G86A 1HRI1 1DG6A 5FFOC 2OIIA 3WDXA 1G8WA 1LESA 2WSUA 3ZSLA 2VY0A 3ZVXA 3HR9A 3WUDA 1H9WA 3H8UA 2IFWA 2GC3A 1ZBE3 2A6ZA 3S7IA 2GNBA 3FBYA 3E6DA 2Z5WA 4IEVA 3RJRA 4MGIE 1JN2P 1IQAA 1C8NA 3AB0A 1ASJ2 1QNWA 3OTFA 3WP4A 3AYAA 1PGSA 4EJRA 3VHOA 1WD4A 5T50A 1C4RA 2QZ3A 3VKOA 4F3JA 3LOBA 2HWC2 1C5HA 1GZ9A 3AP9A 3J26N 4IEYA 4V1PA 3USUB 3ZSEA 5SV8A 5GLUA 1AR82 1ZZ7A 2ZGPA 4RR3C 4EWDA 2R32A 2IXLA 5JPMB 4YVWB 3FX3A 5J48A 4BE3A 3ZN4A 2BWAA 4FOQA 2IZWA 1X36A 4FPYA 4CTEA 3M3IA 3MPPG 1MQTC 2ZX2A 5A32B 2JG9A 3T2TA 4FPCA 5HI0A 3H50A 4OHWA 4FT8A 1Q56A 4XEZA 3VV1A 5EV7A 3SH5A 2Q4SA 3O0WA 1EPZA 4EWEA 5KWRA 3NV4A 1CAXA 2WZR1 1SBDA 1FX5A 2WNVB 3ATGA 2PHLA 4ISRA 4L8QA 1RB8G 1QJY2 4JCKA 2FZ1A 3FBMA 4C90A 1UKGA 5J37A 3WHTA 4KWKA 4HFSA 2HEYF 4N43C 3BPZA 5EWSA 2X5IC 3FMGA 1PHMA 5ABJA 3BB6A 3SXWA 4CDQA 1MVQA 1V6MA 3WP5A 1DBNA 3OCPA 4IETA 3VKMA 1PIV1 5KHHA 5H9SA 2GN3A 5GZCA 4Y22A 2F6BA 3WDYA 3AZYA 4Q4V1 3WLUA 3WDWA 2ZGRA 1JYIA 1AHSA 3VBRA 1IS4A 2HWF3 2XKPA 3GYDA 2DVBA 1PGW1 4ONUA