1TMF2

Three-dimensional structure of theiler murine encephalomyelitis virus (bean strain)
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
267
structure length
267
Chain Sequence
DQNTEEMENLSDRVASDKAGNSATNTQSTVGRLCGYGKSHHGEHPASCADTATDKVLAAERYYTIDLASWTTSQEAFSHIRIPLPHVLAGEDGGVFGATLRRHYLCKTGWRVQVQCNASQFHAGSLLVFMAPEFYTGKGTKTGTMEPSDPFTMDTEWRSPQGAPTGYRYDSRTGFFATNHQNQWQWTVYPHQILNLRTNTTVDLEVPYVNVAPSSSWTQHANWTLVVAVLSPLQYATGSSPDVQITASLQPVNPVFNGLRHETVIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords THEILER'S MURINE ENCEPHALOMYELITIS VIRUS (SUBUNIT VP1)
publication title Three-dimensional structure of Theiler murine encephalomyelitis virus (BeAn strain).
pubmed doi rcsb
source organism Theiler's encephalomyelitis virus
total genus 29
structure length 267
sequence length 267
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1992-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1tmf200
4GH4A 4CDXC 4GH4B 2ZZQA 1NY72 4CDXB 2PLV3 1HRI3 2X5IA 1COV2 1PVC3 5J96B 4GB31 1Z7S1 5ACA1 3DPRC 1V9U1 5FMOS 3DPRA 3DPRB 1QQP3 4AEDC 4FTBA 3JD72 1ND3C 2RM22 4AEDA 1FOD3 5ABJC 4Q4V2 1PIV1 4AEDB 1VBC2 1ND3A 4FTEA 4JGZC 1ND3B 1AYM3 2BFUL 5ABJB 1RVF2 2RS32 1VRH2 4JGZB 2DF7A 5C4WC 1RUC3 1PGW1 5C4WA 5C4WB 5L7OC 1R1A2 5L7OA 1NA1C 1NY71 5L7OB 1PO23 2RS12 2WLPA 1EAH3 1NA1A 1NA1B 2RR13 1X36A 1ZBA1 2HWE2 4Q4Y3 2WZR3 1AYN3 1RUD2 5A33B 1OHFA 1AUYA 1DDLA 1CD3G 3NAPC 1OPOA 1AYN1 2HWC3 3J8F2 3NAPA 1W39A 3NAPB 3VBOC 1ZBE3 2HWC1 1B35C 3VBOA 3VBOB 3JD71 2HWD2 5BNPC 1RMU1 2RM21 1B35B 1QJY3 1QJU3 1VBC1 5BNPA 4Q4W2 5BNPB 1RVF1 1AR63 1R082 1VRH1 4PDWA 4CDWC 5FMOL 4YVWC 3TN92 4RQPA 4CDWA 2ZTNA 4YVWA 4QPIC 4Y5Z0 4CDWB 4YVWB 2FZ1A 1AL22 4GMP1 1POV1 1RUE3 1R1A1 4QPIA 5K0UA 4IV1C 4QPIB 1BEV2 2RS11 4IV1A 1TME2 5FOJB 3JB8A 2HWE1 4JGYA 4BCUA 1EV13 1RUD1 1VBE3 1X33A 1FMD1 2HWF1 1HRI2 1FPN3 1AR91 1EV11 2BFUS 2MEV3 1Z7S2 5ACA2 1VBD3 1PVC2 1D4M3 1HXS3 4WM8B 1MQTB 4N53C 1RUH3 1VBD1 4N53A 2HWD1 4RFT0 4N53B 3FBMA 4Q4W1 1RUF3 2GH8A 1QQP2 1ND2C 4RS5B 1R081 3TN91 1ND2A 1R091 1ND2B 4SBVA 5DDJ1 1AYM2 3ZFFC 2HWB3 5AC93 5LK7B 1PGW2 1BEV1 3IDEA 3ZFFB 1MEC1 1TME1 1RUC2 4CDXA 3VBUC 1ZBA2 3VDDC 2PLV1 3VBHC 3VBUB 1HRI1 2RR12 1NCQC 3VBFC 3VDDA 1PO13 3VDDB 3VBHB 1PVC1 4Q4Y2 2WZR2 1NCQB 1AYN2 3VBFB 4Q4X3 1PO11 4QPGC 2R043 2HWC2 2BPA2 4QPGB 3S6PA 2R063 1RMU2 1ZBE2 1QQP1 4CDQC 2R073 2R061 5ABJA 1RUJ3 1FOD1 4JGZA 1QJY2 1QJU2 4CDQB 5C8CC 4WM7C 1AYM1 1RHI3 2XPJA 4WM7A 5C8CB 1AR62 2RMU3 4WM7B 4N43C 1RUC1 1IHMA 2RMU1 4N43A 4N43B 1RUE2 1VBB3 1PO21 1ASJ3 1EAH1 3ZXAC 5A33A 4FSJA 1AR83 2RR11 2WS93 5CFDC 1FMD2 3ZFGC 2GSYA 2HWF2 4Q4Y1 2WZR1 1AR92 1EV12 1VBE2 5CFDB 3ZFGB 3HAGA 3M8LA 2MEV2 1VBD2 1COV3 1B35A 5J98B 1ZBE1 1HXS2 2ZAHA 4YVSC 1C8NA 1RUH2 4YVSA 4RR3C 4EJRA 4YVSB 5A32A 1QJU1 1C8M3 1QJY1 2RS53 5A32B 1A6CA 4RR3B 1QJX3 1R092 1QJZA 1AR61 1C8M1 2RS51 5DDJ2 2BBVA 2WFF3 1MEC2 5AC92 1RUE1 2HWB2 3VBRC 2WFF1 2RS33 3VBRA 4Y4YA 1VB4A 3VBRB 4GMP0 1NCRC 1POV0 1VBA3 4CEWC 1NCRA 2PLV2 1NCRB 4RHV3 1VBE1 1MQTC 4WM8C 4CEWA 4CEWB 4WM8A 1MQTA 3CJIC 1FPN1 4RHV1 1H8TC 1E57A 1PO12 2MEV1 1SMVA 1D4M1 3CJIB 1H8TA 5CFCC 1HXS1 1H8TB 1RUH1 5GKAC 2R042 4RS5C 5CFCB 4IV3B 4RS5A 3J8F3 2R062 1RUF1 1FOD2 2R072 1K5MC 3LOBA 3ZFFA 1K5MB 5AC91 1RHI2 2HWB1 5D8AC 2RMU2 3JBG3 4CDUC 1AR73 5D8AA 4CDUA 5D8AB 4CDUB 1BMV2 1PO22 2Y26A 4Z92B 1EAH2 1VBB2 1F2NA 3VBUA 1AL23 2XBO3 1RUG3 1PIV3 1RUI3 1ASJ2 3VBHA 1OOPC 1NCQA 3VBFA 1AR82 1RUG1 3ZFEB 1OOPA 1OOPB 5JZGC 4QPGA 4Q4X1 1PGL1 5JZGA 2R041 1F8VA 2X5IC 5JZGB 2VQ0A 4GB33 2X5IB 1TMF3 1Z7S3 5ACA3 4CDQA 1BBT3 1M06G 1V9U3 1WCDJ 2R071 1TMF1 1RUJ1 1HRV3 5C8CA 1BBT1 1C8M2 2RS52 1NOVA 1QJX2 1HRV1 1RHI1 4CEYC 4CEYA 4CEYB 2WFF2 1BMV1 1VBB1 1HX6A 1ASJ1 2WWSA 4NWWA 3VBSC 1AR81 5CFDA 1VBA2 3ZFGA 2WS91 3VBSA 1VB2A 3VBSB 3JB4C 1FPN2 1HQNA 4RHV2 4FTSA 1ZBA3 1D4M2 1COV1 4RR3A 4LLFA 1RUF2 1QJX1 3JD73 1RMU3 2RM23 4Q4V3 1VBC3 1VAKA 1RVF3 4Q4V1 1VRH3 4NWVA 4PDWC 5BNNC 3JBG2 4RQPC 2RS31 1AR72 5BNNA 4GMP3 4PDWB 5BNNB 1POV3 1R1A3 4RQPB 1VBA1 2QQPA 5K0UC 5C9AC 2RS13 2XBO2 1RUG2 1PIV2 1RUI2 5C9AA 5K0UB 3CJIA 5C9AB 2HWE3 4IV3C 4IV1B 4Q4X2 1RB8G 1PGL2 1RUD3 5CFCA 4IV3A 4JGYC 1GFF2 1FMD3 2HWF3 1AR93 4JGYB 2TBVA 2IZWA 4GB32 3J8F1 1TMF2 1RUJ2 2HWD3 1BBT2 1V9U2 1K5MA 2BUKA 4Q4W3 1HRV2 5BNOC 2FZ2A 1CJDA 1R083 5BNOA 3TN93 5BNOB 1R093 1AL0G 3JBG1 1NG0A 5DDJ3 1AR71 3ZFEC 1BEV3 1AL21 1MEC3 2XBO1 3ZFEA 1TME3 1RUI1 4GH4C 2WS92
chains in the Genus database with same CATH superfamily
1VJ2A 3KVBA 2HBTA 2Z79A 2VM9A 3BYWA 5T54A 3MFAA 5IK4A 4CDXC 2IXLA 2WL1A 2ZZQA 1IS5A 4IEPA 1UO9A 4DXRA 5FZ8A 1OH4A 1HB1A 5L73A 4AVVA 2W5FA 5EXOA 1ZRCA 2PLV3 1FNYA 1P8JA 3W9AA 2ZGQA 2LS6A 1XQNA 3K4AA 4YW6A 3T1LA 3G7DA 4IERA 4C1XA 5T52A 3BKZA 2VQUA 1NAEA 2ZABA 1OA3A 4LOSA 1OQEA 1VIWB 4A6OA 1QDOA 2ZS6B 5CIRA 1CPNA 1XNCA 3ZM8A 1X50A 3NW4A 3ZVXA 1QIQA 3WF1A 3TAYA 2W39A 5JVVA 1QQP3 2A71A 1O6UA 4ZS3A 1ND3C 4XJUA 1PGSA 2J1UA 5DQ0A 5T5JA 2ZMNA 5ABJC 4HVOA 4W6YA 1UPIA 4LBQA 3GZUC 1O91A 1JYNA 4OI4A 1RVF2 2NZ9A 1VRH2 4JGZB 2DF7A 4FFFA 2JD4A 5FO9B 4KU8A 2Y6HA 5A7WB 5C4WA 4NHYA 4CUCA 5C4WB 2IC1A 4RL7A 4YZ4A 3WNLA 3ELNA 4Q29A 4DY5A 3V0BA 4ARYA 3I3EA 1NA1C 1NY71 2D97A 3KCYA 1QMJA 1PO23 1SACA 4RYDA 5BPXA 1GWLA 1UY4A 1VPHA 4NRQA 3AKSA 4NOTA 2VOTA 2PHUA 1FX5A 4R9BA 2AR6A 1W04A 3J7NA 4A2UA 1DU3D 1WLDA 3EXUA 3OPWA 1RUD2 1WBFA 3ES4A 4TN7A 4OZXA 5CYYA 5A33B 2D3PA 4HANA 3AP4A 2YB7A 1I1EA 1XNDA 3J8F2 1V0AA 5LBFA 1WCKA 1MS5A 2D7FA 2R1BA 1LTEA 2UY9A 3WF2A 2HWC1 3WCRA 4CZSA 1MZ6A 1W6NA 2BGPA 4MXWA 2BGCA 2A6ZA 3JD71 3M1HA 4MV2A 5CB7A 4M00A 5EJZB 1B35B 4YW7A 1QJU3 5BNPA 5BNPB 2Z42A 3H7YA 5FZBA 1XSRA 2H6CA 3M2MA 1AR63 1MS4A 4IEVA 3ZYJB 5FMOL 3TN92 4CDWC 5KHIA 3QOPA 4XFAA 3S30A 1QXPA 2OUHA 4NE9A 4A6SA 4E4HA 5C3QA 4QKFA 2QE3A 4HBNA 3MIDA 3VDAA 5A6QA 4OVEA 3I2OA 1S2KA 5ANQA 3PUIA 3L2HA 3U1XA 1UYYA 3LGRA 5CG9A 3OPTA 1TME2 4I09A 4C90A 2WNVC 2QNKA 1GBGA 1ZA4A 3IAQA 4XMIA 1H9PA 2R30A 4AF9A 3IMMA 1PM7A 2PQSA 2VZ1A 1UY2A 2HWE1 1GOFA 2D6NA 2WR9A 4JGYA 4L99A 1OD3A 4EQVA 4EWAA 5IWFA 1S1AA 5E8AA 3FZ3A 2JICA 5FXZA 2RDRA 2CYFA 4YFZA 3AZXA 1VBD3 2Z5WA 5FO8B 1YQ2A 4GQ7A 3OEAA 4Q2FA 3ZSEA 5FP8A 4LBQD 3WD5A 1UNBA 5KHHA 4WVMA 1KFXL 4DUWA 1HQWA 3LD8A 1PZ8A 2CWMA 2XWBB 1UMZA 3BB6A 3EBRA 4Q4W1 4D7SA 1RUF3 2XLAA 2HBUA 2FHRA 2OKXA 2GH8A 5L9BA 2WSVA 3H8XA 1LCLA 1QQP2 1ND2C 3A22A 3HWJA 1R081 5LK5A 4QX2A 4LBOA 4AE2A 1XU1A 3VHPA 2HJIA 2ZOEB 4I02A 3WP4A 5KXCA 5JPMB 3SMHA 4W6WA 2W0XA 3ZFFC 1KEXA 1PVXA 3OGGA 1PGW2 4UFMA 4ET7A 3UKTA 3IDEA 1MEC1 2HH9A 4F8AA 3I97A 2LROA 3OYWA 4J25A 4HOOA 3VKNA 4CDXA 4BQWA 3HVDA 2IUWA 4N9HA 1GSLA 3HBKA 3PIGA 2CDPA 5BUVA 1ZBA2 2Y64A 3OJBA 1KQRA 4TSVA 2WNEA 4GIQA 3THPA 3A21A 2VU9A 1RITA 4GXLA 1GZCA 3FMGA 1VMHA 4FCAA 3VBUB 1HRI1 3H3LA 2B39A 3OGSA 3VDDA 5I8YA 4RGGA 3VDDB 1YXWA 4QMAA 3VBHB 5CKNA 5FYMA 1GP4A 3WDYA 3ZXDA 1DF0A 2YFZA 4YZ2A 1PX4A 4LQRA 4XUOA 2WRAA 5FYBA 3IDBB 1DQ2A 2AH2A 1Q8OA 2C4XA 2RDSA 2B4KA 4KU7A 4DPNA 2WSUA 3IM0A 2R6QA 3O7OA 3WUCA 1JYIA 3IAPA 1UZ0A 1HN1A 4B4QA 4XOGA 2XWJB 5FZKA 4CDQC 4A41A 2R073 1HIXA 1KJRA 4E27A 4F3JA 5ABJA 1OLRA 2VNOA 4OZOA 4NPMA 1GUIA 1QJU2 1YLLA 1K12A 1ENRA 4EN6B 5IT6A 2XPJA 3BTXA 1UYXA 3E1F1 4UW4A 1IZ3A 2RMU3 1ULEA 4ZPIA 3RDIA 2YUEA 4RN5A 2QQUA 4HFSA 4D6RA 3ZXKA 4N43C 1D2SA 1FATA 1QY4A 1RUC1 4JHZA 2VULA 3DXTA 3GHMA 5A3OA 1W6MB 2JWPA 1SLLA 1UU4A 3KT7A 1O3TA 1ONAA 1QJEA 3VN4A 5IVYA 4HONA 4LULA 3VB9A 1EAH1 4CA9A 4LBKA 3O1SA 2A75A 5FZIA 4CU7A 5F37A 3AZYA 4EROA 2SLIA 2RR11 3D8CA 3LFIA 4QAWA 2B8MA 2WS93 4PQ9A 5C8WA 4UAPA 3ZFGC 4IESA 4Q4Y1 2DUPA 2WZR1 4O9GA 1W0OA 4Y1UA 4AI9A 5CFDB 1S0GA 2DTYA 2K46A 4AVBA 1VMJA 2CDOA 2WFPA 4XJ8A 1ZA7A 4XBQA 4A3XA 1MPXA 5BY5A 5A3LA 1VBD2 2P5BA 4PI0A 3UL2A 3VDBA 4F83A 3GJBA 4X8PA 4YGBA 2XJRA 4TWTA 4C0BA 3KSCA 4B29A 4DUXA 4YVSA 4EJRA 1Y4WA 4YVSB 2R0FA 2F4LA 4XQDA 1N3QA 1QJY1 3WW3A 2A3WA 3USSA 4RR3B 1QJX3 1W6OA 1SBEA 2Y6JA 4RA0A 4BOWA 3POJA 1GQPA 2GMPA 1LOFA 2G4IA 5FZGA 5G04L 3P5BA 3EYPA 3K75B 2BBVA 1LODA 1NYWA 4PF1A 4DEQA 5JOWA 1YFWA 4LT5A 3TYJA 4CCKA 3NO8A 5FCCA 1RUE1 2VNVA 2VL4A 2EIEA 2JDPA 1C28A 3LA2A 3VBRC 1UIJA 1SLAA 2WFF1 2ZEWA 3OEBA 3RG0A 4CYDA 2WNVA 3IWZA 2FMDA 3N7MA 1NQJA 2PAEA 5C70A 1VB4A 3B01A 2P37A 3ST7A 2ZGRA 3J7HA 3QH6A 3D6EA 4XIKA 1W6QA 2WN3A 2OX0A 1YFYA 4QHZA 1ZZ7A 4WM8C 1IPSA 1ULPA 1AXZA 2Y60A 3OY8B 3NSTA 4E2SA 1FPN1 2WZEA 2W1QA 4Q0UA 1H8TC 4BISA 5JLVA 1CPMA 2MEV1 2Y6GA 2IXCA 1SMVA 1HXS1 1OPMA 1FI2A 1IQDC 3GBWA 1IG0A 3MDPA 4RS5C 4Y3OA 5FAXA 1H1AA 4AHWA 2QFEA 2Y0OA 3IB3A 2X05A 2P4EA 4ZU4A 4UF0A 4N9IA 2OPWA 3Q8FA 4UF0B 1BHGA 2VD7A 4CCJA 2ZACA 1EUUA 1FOD2 1XXNA 2NN8A 3LDBA 4IE4A 5L36A 3QBQA 2VZPA 3HMYA 4I3PA 4LIUA 2E26A 1K5MC 2R072 1CAWA 1CAWB 2GC2A 2MHFA 3MZHA 2CNAA 3ZFFA 2FD8A 3VZKA 2ZGMA 4LUKA 1YWKA 2W47A 1OF3A 2GNMA 1JTZX 5LWBA 1UIKA 2VVDA 3K48A 2RMU2 5D8AC 5LBCA 2QCSB 5I0TA 2Y6LA 1GU3A 4AWDA 4FI9A 3GCXA 5JWPA 3NNJA 4Z92B 1A34A 1V6LA 1WKYA 2ARCA 2J1EA 3PMEA 5HPOA 1WUVA 5IK7A 1O4ZA 1PIV3 1RUG3 3S57A 2JG9A 3NNGA 2HEYF 1OOPC 2VZOA 1TEIA 2D6LX 5E88A 2ZGUA 2HEVF 3KWVA 1JU3A 1QF3A 1OVPA 2VMCA 2J1VA 3K51A 3MIFA 3PUHA 5AVPA 3WW2A 5FPLA 4FAGA 2JDAA 4OI0A 1HN0A 2PA7A 5JZGC 4HN1A 4A7ZA 2XGXA 3KQRA 2JIGA 4H14A 4UWDA 2X5IC 2XHNA 4A45A 1PZ9A 2QZ2A 1C4RA 1S0IA 2P3IA 4IQPA 4LHLA 4W65A 5FY9A 1QDCA 3FWEA 2VY0A 1UYZA 4CDQA 1BBT3 1V9U3 3OUHA 4K1ZA 4OHXA 4AFBA 5GZGA 4LJHA 3DCQA 5EJ1B 1WCDJ 3BTAA 4H3WA 4BDVB 4CP1A 4XE9A 1EPWA 4GZ9A 3ATGA 3MGUA 4U2AA 5HCBA 4AEKA 4AQSA 3PJQA 3ASIA 5FY8A 3AMHA 1QJX2 3MLKA 4FVVA 4XACA 2XUEA 4CEYC 4BHPA 2NLRA 2XKPA 3DL3A 1OUXA 4E4SA 2VOKA 4GWJA 1FV3A 4XFCA 5FZ3A 1N3PA 2ZHMA 5FZ0A 4DS0A 1UOGA 4LKFA 4TYSA 2LRPA 4JDNA 3LAGA 2J7MA 5AFEA 3DN7A 2IXKA 5LA2A 3OBZA 1RGSA 3WY6A 2E63A 2WWSA 4FXGB 3VBSC 2Q8CA 3IT8A 1YO8A 4XYXA 1GOHA 1PX3A 3ZFGA 5KXBA 1IPKA 1DGWX 1VB2A 3DEMA 5A3WA 2OT7A 4K9SA 4QX0A 3ZXJA 1CX1A 1RYYA 1ZX5A 2IFRA 3C2UA 1DQ0A 2ADEA 3N9LA 1D2QA 2UU8A 4ATFA 3I8TA 2ZHKA 1NXD1 5JR7B 3M7AA 3QH7A 3O1PA 2NQYA 3HD8B 2XQXA 2G1MA 3IIIA 3RQ0A 4E2QA 2E33A 4PBPA 1LOCA 1UY0A 3IZOA 4XAEA 2XMLA 4LLFA 4LNVA 4AG4A 4CE8A 4IE5A 3CL1A 3PVNA 2GN3A 2PMWB 4MGIE 2QQKA 4RD7A 3O12A 4ITCA 1NXMA 1RMU3 4Q4V3 3CF6E 2A6WA 3FUOA 1VBC3 1VAKA 3ETPA 1CZVA 2QQNA 2A7AA 1O5LA 3UYJA 1RIRA 4HVRA 3JU9A 3VHRA 4J1XA 2OUJA 3ALQA 2ZMLA 5C5UA 5KBFA 4ASLA 2JX9A 1JYCA 4QWNA 5JCTA 2ILMA 3MIHA 3POBA 4GMP3 4Y1ZA 3ACHA 2WABA 4UW6A 1R1A3 3RGBA 3AL6A 2Z69A 4FFIA 4RQPB 1JW6A 3AXEA 3KZ4C 4YZ3A 5DAQA 5FYUA 2XJPA 5K0UC 4AQ2A 5FP7A 1LECA 1Y3TA 3OGVA 4OCTA 1GYKA 1PIV2 1RUG2 2B46X 5J1XA 5C9AA 2D40A 5C9AB 5JMCA 1DHKB 1LENA 3WG2A 4HXCA 1RXGA 2OVUA 4IV3C 2YYOA 4Q4X2 1TVGA 4FQZA 3ZIXA 3CKHA 2DV9A 3OBTA 1MZEA 3NV4A 4I01A 5LASA 2HWF3 5F5CA 5F32A 3WDVA 3UK9A 4I3GA 3UKVA 4R52A 1F31A 2YBKA 3K2OA 2D6PA 5IJRA 4EWDA 3LE0A 3J8F1 5LBEA 2XJQA 1RUJ2 4XXPA 5IVEA 2HWD3 3N9OA 1BBT2 4XBNA 1V9U2 1K5MA 2UY8A 4L97A 3NMBA 3WV6A 2W1SA 4D69A 3H3UA 4LHSA 2P6HA 2JE8A 2JXAA 5A1LA 4Q0QA 1XSQA 2WT1A 1D0HA 5BNOA 1WMXA 1J3RA 4EN0A 5FZ9A 1QGLA 3I2IA 1R093 5BNOB 1JOBA 2GNDA 3JBG1 1AHSA 2K2SA 3FFQA 3MLLA 2H0BA 4XUNA 3BODA 1MS8A 4OI2A 1KRIA 1DGWA 2D43A 5GZEA 2AZ5A 1Z78A 2VG9A 4BJ0A 1RUI1 4BK4A 1GNZA 4AQTA 2PAKA 4HT1T 2BDRA 3TEWA 3T1MA 2OZJA 2Q5TA 4XIOA 3UJQA 1H4HA 2WN2A 2IVIB 2R32A 1PM4A 2QKDA 3ETQA 1C3HA 1G9BA 2E51A 1O3QA 2VR4A 3SISA 2X5IA 4NMIA 3WXPA 4IE0A 1G9DA 3MF9A 3PLQA 2CL2A 2J1SA 4DOUA 1JHNA 2RG4A 5LW9A 2Z4FA 4QM8A 2E7AA 3VD9A 3NNFA 3I59A 2Q8EA 5C3PA 4NN0A 1JZ5A 1NE4A 5L9VA 4N8MA 2J1TA 2E9QA 5EHDA 5F5IA 4JRLA 3ACFA 2N7GA 3I3BA 4FPLA 4QX1A 1CIYA 4FTBA 3LPGA 1PMJX 5KHGA 4AEDA 1ZRIA 1XNKA 4Q4V2 4AEDB 1VBC2 4FTEA 4JGZC 2KXLA 2GC1A 1AYM3 2VNGA 4LMFA 4I0AA 1APNA 3ZN6B 2AGSA 2D5FA 2VTXA 4CCCA 5A1FA 1V70A 2OA2A 3FLTA 4Y26A 5C4WC 1R64A 4GWMA 4P9XA 4RGKA 1WGPA 2V5YA 1PGW1 4XETA 4TLFA 4D6SA 4AGGA 2RE9A 1R1A2 5JOZA 5FZCA 4LO4B 5T5OA 5L7OA 2QVSB 4FAHA 1UOJA 5L7OB 4QDSA 2WLPA 4AOCA 1N1YA 3SITA 2OQ7A 4M0NA 3AP9A 3H8UA 4HSJA 4QX7A 3VLBB 4EN8B 1CN1A 5JSOA 3POFA 1E5IA 1GZ9A 1X36A 1ZBA1 1REFA 1J1TA 4P9WA 1OLME 5LZ6A 5BV6A 3RVHA 3NV1A 3RZJA 5DMYA 4DXSA 1AYN3 5C33A 4NVPA 4LBLA 5H9PA 4DUVA 5A7PA 1UY3A 1CD3G 3NV3A 1OPOA 4AHYA 4M3CF 4G9SB 4Y22B 5TSWA 1I5ZA 1Y9GA 1HW5A 4R9CA 4XCBA 3NAPA 2EAAA 1C5HA 5I0UA 3NAPB 1F4AA 1UZWA 3PUAA 4LHKA 4NJ4A 3O1MA 3IPVA 1ZBE3 5FZ6A 2VECA 1B35C 1LOGA 4XFGA 5FYHA 5JAXA 2HWD2 5BNPC 4HZFA 1JXNA 2RM21 3T0BA 5A7SA 4NIGA 3QLQA 4DINB 4DNYA 4MLOA 1LRHA 3E6BA 4BQ4A 4PIYA 2GP3A 5FPVA 2W1WA 4W4ZA 2FCVA 2Y0IA 5A7QA 4EZ4A 5FQ0A 1CIWA 3J7LA 4YVWA 5HV0A 4Y5Z0 2W3JA 2A6XA 4YVWB 2VMHA 5FFOC 3GXUA 5CKMA 1POV1 3CEWA 4M3CE 4QPIA 5K0UA 4CCDA 4QPIB 1W2UA 1GNYA 2PHTA 2RS11 2VAUA 3IKWA 4IV1A 4QHBA 4YM0A 3ROUA 5LRSA 1AF9A 1QOOA 2D6MA 2W94A 1D4VB 5F8PA 3HIFA 5BXXA 2TEPA 3AMPA 3E5UA 1GLHA 3OF1A 3WDXA 3SCHA 4ZKTB 3PUSA 4QB2A 1IGOA 5C3RA 2BBAA 4XJAA 2OQ6A 2YY1A 2WO2A 2LTNA 2BVBA 3BIWE 4COYA 3C3VA 4GWNA 2PFWA 3DGTA 1Z7S2 3L2YA 4XDOA 5ACA2 1D4M3 2PYTA 3AB0A 3S0MA 1DLLA 2ZGKA 1MQTB 4P5YA 2VBDA 1BKZA 1ZZBA 4BH9A 1VBD1 5C6CA 4N53A 1BZWA 2MPFA 4P02B 4DZGA 1AX1A 4N53B 3S7IA 5EZWA 5L19A 4NRMA 4LA3A 2A5ZA 1D7PM 3CNAA 4FQ4A 3BIEA 1CWPA 1SDWA 3I3QA 5FZAA 3ZSMA 1U5IA 3VKLA 5IFTA 3LDRA 4HPKA 3I4IA 4MUVA 4Z1VA 5DUVA 3CBNA 3DYPA 5HI0A 2EXKA 2JG8A 3OGJA 2EAKA 1F35A 2DU1A 2JG8B 3A4UA 3O5SA 3RYKA 3WLUA 2VCMA 1S0DA 3SHRA 1AYM2 2AEYA 2DBIA 4E8DA 1J1LA 4AI3A 3KT4A 3AKTA 3K77A 5IAVA 1BEV1 1S0CA 1XB9A 5FMCA 5F6LB 5JOYA 1A78A 2V5DA 5FZEA 4LBJA 3SEEA 5KHKA 3WQ1A 2FDHA 3LEGA 3V56A 2VQAA 2CTVA 3BALA 4LHNA 3ZXFA 5FYVA 1GWMA 3VBUC 5FY7A 1T2XA 1SFNA 1W9TA 3VDDC 4LEJA 1MZ5A 2KM2A 3VBHC 5JPNB 5FP3A 2XH6A 1UCXA 1CONA 1PO13 5GZCA 3GNEA 1PVC1 1OFNA 1WCUA 1AYN2 1WW7A 1W9YA 4QXCA 2R043 5A3MA 3W5MA 2ZPXA 4AEMA 5DAVA 4QPGB 4FPHA 1MS9A 5JR2A 4DRRA 4LE3A 1ZBE2 2JECA 3UT0A 3ZX7A 2RJLA 2WO7A 2YFUA 3NNMA 4P5HA 1WW4A 2ES3A 4A3ZA 1FOD1 3J26N 4JGZA 4QB6A 3WQBA 1LNSA 2CGPA 4XF1A 2WNOA 2AENA 3LQCA 5A7WA 2QZ3A 4WM7A 3WP5A 1LU2A 1US2A 5C8CB 4WM7B 4S2FA 2JDYA 4I0BA 1SCSA 1T6GC 5SV5A 2WO3A 4R8HA 2VE1A 4OHZA 3IDAA 5F2SA 2RMU1 2JDKA 3ZXEA 1I6XA 1UWWA 1VBB3 2DVFA 2ETEA 2ET1A 2QQIA 3B69A 1ASJ3 3FLRA 2ZX2A 2BV4A 5HCHA 1CGPA 2D93A 2VMGA 5A33A 4PIZA 4OYUA 4YWAA 5CFDC 1FMD2 1YI7A 3RMYA 3ZKYA 2G9GA 1AR92 1UMHA 1UN1A 3PJYA 4LO6B 5JDBA 1GV9A 3WNPA 1QNWA 3RZKA 5JIUA 2VXJA 3ZDSA 1IS6A 3M8LA 3TEZA 1UAIA 5IK8A 3SLIA 1VRBA 2Q0AA 3I2JA 2ZCWA 4XCAA 4AAXA 4YM2A 1YIFA 1COV3 1PNGA 1B35A 1I9RA 2QQWA 4IGOA 4JAAA 2WWUA 2L9LA 2ZAHA 4YVSC 1ULFA 3B3QE 3WF0A 3WUDA 4CXXA 3KB5A 1MR5A 4RR3C 2A1XA 2PHLA 1W05A 3AVSA 2R16A 5A32A 3E5XA 4NAMA 2RS53 2VW0A 5A32B 3T3YA 1A6CA 3WX5A 3H8RA 1LOFC 3FLPA 3RMXA 1YJLA 3NJZA 4BQ2A 1W8OA 3FJSA 4FO9A 3H50A 5DDJ2 2D98A 4M01A 3DKQA 5A7NA 2P17A 5IUQA 4EE2A 4EV0A 5IFPA 3B9IA 1W0NA 5DZEA 5CADA 1OLQA 3MV01 5FXVA 3OSDA 2LW8A 2GDFA 5AVAA 2IVJA 2HYKA 2WBKA 4EYUA 3RJRA 2JENA 3LPFA 1H6XA 2RS33 2WQ4A 4W6XA 3WT3A 1V6KA 4YG3A 4XZPA 3D3AA 5B4XA 3THCA 3WCSA 1POV0 2I74A 4QDQA 1VBA3 3ABZA 4QQLA 2VUJA 5IAXA 3E6CC 2BU9A 3PL0A 1QWRA 1US3A 2PLV2 2XQRA 1W8UA 1V6OA 3A7QA 4IE7A 1O4YA 4OFGA 4XF4A 3CLPA 1VBE1 5FUNA 2J1RA 1ULOA 1UZVA 3ENRA 5FJKA 5HCFA 4XC9A 3NVCA 4LTAA 4Q1RA 1XBFA 1PO12 5ANNA 1IKPA 2EIDA 3CJIB 2J22A 3H8OA 1LAJA 3I2GA 4JHTA 4BZ4A 1CAXB 1RUH1 1ULDA 2ID4A 3LA3A 2BGOA 2R042 1PHMA 5GKAC 3WQ7A 4BPZA 3RZZA 3UJOA 4PI2A 4XF0A 2GAUA 5FYZA 4IL7A 4LK7A 3IIAA 2WA4A 5HXMA 2IXIA 1RXFA 1L7RA 1YEWA 1A3KA 1GP5A 4YG0A 4YARA 3CQOA 2UWBA 3E97A 1DQ1A 1LHVA 1N1VA 1B09A 4DXTA 2RJ2A 1ZZCA 3MIGA 5HBAA 1C5IA 2UYBA 5AC91 2HWB1 3K4ZA 4UFKA 4BXSV 5FZ1A 4JDMA 3SNMA 1JU4A 3JUUA 3WP3A 1AR73 2WAOA 2JB8A 2Y6KA 4YPJA 1EPZA 4IEOA 3H0OA 4Z07A 1PO22 3AJYA 2JDMA 5T3NA 1BMV2 4Q0SA 1VBB2 1F2NA 2JG9C 1AL23 4PQQA 3RYPA 1RJ8A 2XBO3 4R9AA 3VBUA 3CU7A 3LB9A 3N3HA 2HYXA 1ASJ2 3VBHA 5I0SA 3RI9A 1REEA 4YW2A 2XJVA 5BYNA 1RUG1 4IEZA 3ZFEB 4MGQA 1YIPA 2CGOA 3RI8A 5IYYA 3PVBB 2ZX1A 1CAUA 4Q4X1 1CAUB 2Y6FA 4C0HA 4OLLA 1OURA 1UQXA 1ZYBA 1AXKA 2W87A 2WZPP 3MF6A 4Q1PA 3AMQA 4UFHA 3K46A 5LA1A 1M06G 3MIEA 2WYFA 4B1LA 4HG6B 2LM3A 2YU1A 4DY3A 1OH3A 5LA0A 1RUJ1 1HRV3 4NAOA 4XILA 1BBT1 3EMRA 1FV2A 3ZO0B 2RS52 1DZRA 4ORFA 2YV8A 4D94A 1RHI1 2VC9A 5DN2A 1UU5A 1YC61 5IVJA 1AJOA 2DVAA 4CUAA 1OKQA 5JI9A 1W6MA 4DB5A 1OUSA 3INAA 3JQWA 1JS9A 4Q26A 3ECQA 3KVAA 1F9KA 1UMIA 2YPDA 3PDQA 3DKWA 4S2DA 1EP0A 2ZA9A 4B7EA 2FDIA 1NZCA 3I3MA 1H4GA 3WDWA 2QQVA 5JIAA 1L7LA 4KQ7A 3V64A 1QH6A 1OC1A 4AVTA 1LKNA 2V4AA 1JI6A 2WNUB 1AR81 5CFDA 4KWLA 1VBA2 4KG0A 2AREA 4FP3A 5DABA 4FPYA 4MGZE 4IGQA 3JB4C 1OF4A 1W9WA 5EYYA 2XB6C 2Y8KA 1QXRA 4JKMA 1W0PA 1S2EA 3VV1A 4BQ5A 1FYUA 1WMDA 3KF3A 4MHUA 1H0BA 2VUCA 1NQDA 3TWIA 2W52A 4X8NA 1V6MA 1OKOA 4RR3A 4ZU7A 3LCPA 3PTRB 3WNMA 1RUF2 4BXFA 4K8FA 1SLCA 3MLJA 1OQDA 2XJTA 3JD73 3KT1A 1Q8SA 3FX3A 4E2GA 4QB1A 5FY0A 3VZLA 2VTXJ 4YRDA 3SCGA 4JX0A 2W95A 1GZWB 2R0HA 4L11A 5J7MA 4Q4V1 4V1PA 1XC6A 4KI5M 2D6OX 2ZXQA 1AXYA 4XZUG 2QQJA 3ZMOA 2PHFA 1LULA 2GC3A 3AK0A 4RQPC 4EWEA 1GQHA 1AR72 1U12A 4ISQA 4PDWB 5FLJA 1RJ7A 3VZJA 3N7KA 2XL9A 3OY8A 2GU9A 3RSJA 2HLEA 1GR3A 4QX5A 5C9AC 4OQ8A 2XBO2 3AYAA 3MW3A 2F17A 2BOIA 2XDVA 4LORA 1QNYA 4DQAA 5J09A 4HETA 4NPRA 1V00A 4E9KA 2HWE3 1SZBA 2OS2A 1HV0A 3AYDA 5BNQA 2WQZC 4INDA 4AFMA 1GFF2 4KBBA 4OMCA 5A70A 4A7KA 4DO0A 2GH2A 3AKPA 3WHTA 1DCSA 5A7OA 1H9WA 3T0DA 3UGHA 2Q1MA 5DZGA 1QU0A 1W8FA 1GMMA 2XUMA 1HLCA 2Y38A 4IUGA 1PMIA 3SKJE 5T5LA 3AMMA 1J58A 5EJ3A 1DQ6A 3WF3A 5FZLA 4K40A 4YW4A 3WVJA 4C1WA 1UW8A 4E4ZA 4Q4W3 1HRV2 2QUOA 4OMDA 3ZLIA 5BNOC 2AEZA 5H9QA 1F5FA 4CVUA 1R083 2QQMA 2ENRA 1CVNA 2E6VA 3OOXA 4ES9A 4AAPA 4QKDA 2GN7A 4FPCA 1L7QA 1LHNA 1NG0A 2PHRA 3N9PA 1HB3A 5CZKA 3W58A 2C5DA 2QJVA 3EO6A 3RZMA 4G3YC 1WCSA 2XJUA 3VKFC 2DCYA 3VL8A 1MEC3 2Y33A 5HCAA 2BYVE 2DDUA 2WS92 3DXUA 2JKXA 5FUPA 5T55A 4KWKA 4GH4A 4P9LA 4QHOA 2VOVA 4WV8A 4Y1VA 4GH4B 1XRUA 3JCIA 3C7HA 1NY72 1WCQA 3B94A 3A0KA 4IETA 2Q8OA 4MZUA 4PJYA 1HRI3 5KHJA 3QD6A 3T2TA 3CDZB 4JCKA 4LITA 4AGRA 1H2KA 4H55A 1LOAA 3MHZA 3VZOA 3PIJA 2XONA 5C3SA 5CBLA 2RV9A 4GALA 2PQQA 3FHQA 3KV9A 4GB31 5M0TA 1FT9A 4CPBA 1Z7S1 5ACA1 2NMOA 1LGNA 2JE7A 1MVEA 2ZGOA 5FMOS 2F4PA 2ZGTA 2ZKNA 4QX8A 4AR2A 4AVAA 3DPRA 1XYOA 3KGLA 1XNBA 3FBYA 4IEQA 3DPRB 5GLTA 1VLNA 4B7KA 3ZSLA 4NO4A 1IS3A 3NQHA 1DYKA 4AEDC 4HKOA 3JD72 4GULA 5JSPA 4CCOA 4XUTA 4IW3A 3RJ2X 1H6YA 3GYDA 4AZZA 5J37A 2B5HA 3H1WA 4QDRA 4L8QA 3GZTB 5ERLA 5T5PA 4BU2A 2ZHLA 4K7JA 4KWJA 5FUIA 2B45X 5AFBA 4AL9A 2XLGA 3FN9A 1RUC3 5A80A 5FZHA 3U07A 4YLZA 3ZYRA 3CMGA 1LU1A 4XJWA 5L7OC 3N9NA 2X53S 4MADA 2ZMKA 1N47A 4QPYA 3HOBA 1NT0A 1IQAA 1LHWA 3AYEA 1EAH3 2PTMA 1G9FA 3I2HA 4XPVA 3FC0A 4AI0A 2RR13 1DYPA 1CX4A 3RZLA 3WOGA 2HWE2 3ZSKA 4Q4Y3 4D7YA 2WZR3 4XTPA 4DRVA 1PNFA 5G05L 1KD7A 1SQ4A 1H2LA 1O5UA 1DDLA 3GDBA 3NAPC 2VMIA 3O1VA 1AYN1 4LA2A 3TOJA 1W39A 4XQWA 3HQRA 3R6SA 1W28A 1G9CA 4P9JA 1BVP1 2E7QA 2RDNA 4G4FA 4XAAA 2VZSA 3VBOA 3O1TA 3VBOB 4QT6A 2FQPA 2AUYA 4C8DA 4UW5A 2R49A 3USUA 4S2HA 3USUB 1XOYA 1QJY3 4QKNA 4M3CB 4Q4W2 1UD1A 1GWKA 1UZYA 1HDKA 4XF9A 4YW3A 5FREA 4HL0A 3AP7A 4BMBA 1RVF1 1ZZ9A 2X8KA 4Z8BA 1R082 1VRH1 2JDNA 4Q8KA 4YVWC 4RQPA 2ZTNA 4QPIC 2FZ1A 1RUE3 1S0BA 3KMHA 3LIGA 1ENSA 2VVFA 2W68A 2CWSA 1OA2A 4IV1C 1ZRFA 1Q8PA 2DYCA 4Q27A 2WLQA 5GJ6A 5EP9A 4A7YA 5F3CA 4CPBD 5FYYA 3PVEA 1RTVA 2DCJA 3POWA 4MHRA 2KD7A 2DVBA 4CUBA 5FOJB 1UX6A 4K1YA 1EV13 1RUD1 4KGGA 5FJHA 1GOGA 3C7GA 1FMD1 2OZ6A 1S0JA 2H6BA 1HRI2 1FPN3 4GD4A 5FY5A 1AR91 2P6CA 3N4MA 2BFUS 2MEV3 2CAVA 3ACIA 3ZR6A 5EQUA 1HXS3 2Y34A 4WM8B 4N53C 5LY2A 1E5SA 4NPLA 4QQHA 1HQLA 1RC6A 5DZFA 1CR7A 3KF5A 1K3IA 2DURA 1JYVA 4JTNA 4RFT0 2DCTA 4BA6A 1WLCA 5LATA 3AMNA 4KBZA 2XG3A 1CQ9A 3FBMA 3TRSB 1H2MA 2IXJA 4XABA 4RS5B 4BMEA 2JG8C 2VBPA 3TN91 3UKNA 2IFWA 1OI6A 3B93A 4N7IA 4AHZA 4SBVA 4JQRA 2X29A 4JKLA 2G9ZA 3SH4A 4XDPA 3EHKA 5DDJ1 1ACCA 2BNMA 3RPQA 1BJQA 2YXSA 3B7MA 4BB3A 2WA3A 4OULA 3B9CA 2CSGA 1DQ4A 4ZU5A 3T2QA 1TME1 1SCRA 5A1AA 1RUC2 5J48A 1ULCA 3I49A 5D2AA 1N1SA 5HXVA 3O0WA 5FZDA 4Z82A 5EYXA 1Y43B 3VGIA 1UPSA 2VO5A 3SH3A 1N3OA 4I2OA 3S5AA 4BIFA 1TQ5A 1IG3A 2PLV1 4CU6A 4BM8A 1SDDB 3MFCA 2RR12 1OT5A 4XJ9A 4MYEA 2EALA 4JTOA 1DQ5A 3N9QA 3CZUA 3OBRA 4LO7A 3C7OA 2WZR2 4Q4Y2 1NCQB 3VBFB 5I0RA 3HQXA 1WW6A 4MVTA 4WVZA 1LR5A 3WF4A 1PO11 4BQYA 4QPGC 4CP2A 5KXDA 5GALA 1HB2A 3DYOA 4KGQA 2ZX0A 5LA9A 5J36A 1G6NA 1STMA 1SG3A 4UBHA 4JC1A 4I30A 4B1MA 2R063 4Y33A 3J4UH 4AEJA 1RMU2 1G9AA 1YCIA 4ZZ5A 2YU2A 1ZVFA 2VPVA 4SLIA 1QQP1 2V09A 4UOJA 3U10A 2GALA 2A6YA 4PLOA 4O61A 1QOSA 3SC7X 5C3OA 4NHMA 2CGNA 4UBGA 3ZN6A 4R4ZA 3WDTA 4BK5A 3Q8CA 5F5AA 4PF5A 1QJY2 1F15A 1W9FA 2C9KA 1RINA 3PNAA 4WM7C 4CSWA 3RWNA 5C8CC 2JDUA 3LEMA 3HNMA 1UZZA 1W2NA 3T0AA 3ZMNA 2IXHA 1PK6A 3HEIA 3KHBA 1PK6B 4GAZA 2V4VA 3HN1A 5FZFA 4AI1A 2I45A 3MUY1 4QQPA 4MG2A 3NJXA 1W6PB 4IE6A 2XVKA 1RUE2 3WNOA 5C7GA 5JXJA 1DBNA 3B00A 1DP0A 1PO21 2VUAA 2YBSA 5APAA 4WVWA 3ZXAC 3LSEA 3ZIWA 4FSJA 5F2WA 1S4CA 4RFRB 2WJSA 1C57A 2PXJA 1XE0A 2JIJA 1LEDA 4Y22A 2HWF2 2CY6A 1EV12 1SFYA 4JQTA 4YM1A 3HBZA 1D0GA 1J84A 3FHAA 3NNLA 2D3SA 4QQ2A 1NX9A 1Y9MA 2W1UA 4UT5A 5DUXA 3GHNA 3DECA 3AP5A 3HAGA 2MEV2 1DGRN 3V0AA 4Y24A 3V0AB 2VCBA 1O3RA 3D0JA 1HXS2 3GJAA 1C1FA 2P3JA 4MGYE 1A8DA 1I5PA 2ERFA 4QQOA 1DGLA 3FL7A 3NRUA 4XFIA 1QJU1 1C8M3 5K7PA 3G6JB 4XVHA 3AKQA 2YDEA 5CU1A 1XPWA 3ZOIA 4YFWA 1R092 1U5ZA 4MO3M 2IWGB 1LEMA 1QJZA 1AR61 3M3OA 2FDJA 2RS51 2YMZA 4J1WA 2QQLA 3RFRA 1HJGA 2XKOA 3HT1A 3FE5A 5A6ZA 1QHDA 2Q1FA 4D6QA 4ZS2A 3WNXA 2PHWA 3H1MA 2ARAA 3LSDA 1WW5A 1QEXA 4AI8A 5DAPA 3OD0A 4Y4YA 5ISLA 2NYYA 2BRTA 5JXIA 5FZ4A 1UXZA 2YBPA 1J83A 4HK8A 1NCRA 1ULGA 3P6BA 5KWRA 1NCRB 5HV4A 4RHV3 4ONUA 4CEWA 1QOTA 2UWAA 3V65A 4CEWB 4QXKA 2NPIA 1MQTA 2DFBA 2E32A 3CJIC 4H7LA 4EZHA 3KV5A 1E57A 3Q8AA 3VKMA 1JUIA 3VUOA 4P9YA 2VH9A 4TTGA 1UOBA 1VAVA 1SLIA 4B3NA 2WT0A 5CFCB 1HB4A 5DXDA 4IV3B 4MGTA 1WZXA 2P1BA 2G9FA 5F3IA 2FDFA 5E1RA 1H2NA 3J8F3 4QGNA 2R062 1RUF1 1UYPA 3S5QA 2A3YA 4AW7A 1J3PA 2YG0A 5DUUA 4COVA 3W20A 3C8XA 5JI7A 5IVFA 4P9IA 3D5OA 2OPKA 4Z2AA 1V6IA 2PAMA 5GLUA 5JXGA 3JBG3 3PVOA 5EFUA 4YM3A 3U4XA 1MS1A 2KA3A 1H1MA 2P2KA 3E6DA 4CDUA 4CXWA 5K4LA 1LHOA 4CDUB 1W8NA 4KH9A 2D6KA 2YGLA 2ZKLA 3T2OA 4XFFA 2VGDA 4ZXKA 3A0NA 3U4SA 1W3VA 2JE9A 2XR4A 4URTA 1Q3EA 1RUI3 1G8WA 3O0VA 3IBMA 5DG1A 5B4NA 1WMEA 3MBWA 5JUVA 3BU0A 4IEUA 2B9VA 4O65A 3AP6A 3ZYHA 2KR2A 1CAVA 5J3UA 1ODMA 1CAVB 2ARBA 4JDOA 4CTEA 3ZXLA 1AZDA 1TNFA 3POGA 4QPGA 3LIHA 1XU2A 3H42B 4UYBA 1GANA 1OSGA 2D3RA 2DTWA 4R9DA 3WG1A 5A6XA 3I54A 3NJYA 2I2SA 4QKBA 2NM1A 1SFPA 2VQ0A 1O3SA 1JOPA 1SHWB 3MPBA 3RYRA 2CAUA 5KC6A 1AX0A 2O14A 1TMF3 2B7YA 3MICA 3RZHA 2J42A 5FMDA 1RUNA 4NIAA 4KNCA 3VZMA 1URXA 2WC2A 3KV4A 3MEPA 5FKCA 2R071 1YFXA 2Z2SB 5SV8A 4XF3A 5C8CA 4TXWA 2ZEZA 1C8M2 1WA4A 2ORXA 1KS5A 3O14A 5FP4A 1HRV1 4QGLA 5FIXA 5L9RA 5K9YA 1VE0A 4X6QB 2JEMA 3AC0A 1JZ7A 3ZSJA 4MGSA 1VP6A 4Q5OA 3SQOA 5FTTC 2C26A 3ZYGA 3KM5A 5F7UA 1HX6A 4ARXA 3UNPA 4LBQB 1G86A 1W3XA 1NLRA 2WNUC 4KWUA 4NROA 2DU0A 1U5YA 2EIBA 2Q1ZB 1N1TA 1VAMA 3VD4A 4FPKA 1XE8A 2WS91 5GM0A 3BOPA 5H9SA 3MV11 2YZ4A 1HQNA 4RHV2 5F5QA 4GWIA 3V0BB 3M3IA 4FTSA 1ZBA3 1D4M2 4W8JA 1SLBA 5GLWA 3NKTA 3LOIA 5FP9A 1VR3A 1DYOA 2TUNA 5CNAA 1MS0A 1IS4A 2XHKA 4M4RA 5I8SA 3VL9A 4N90A 4NIIA 4CU9A 2CHHA 3NL1A 3SKVA 2YC4A 3BTYA 3BUCA 1X8MA 4XUQA 1H30A 5EIYB 4Y4RA 5H9RA 2XL7A 1K42A 3POYA 1QJX1 5LCWL 5CEHA 2ZGNA 5LEKA 2RM23 2EA7A 4AI2A 3ZPOA 4FP2A 1ZRRA 5K8SA 3JZVA 1GZTA 1W6NB 2EXHA 4MXWB 4YGDA 1OVSA 3RRDA 1JZ2A 4H2AA 2CU5A 4HLTA 1RUOA 3TB0A 3OUIA 4AFAA 3S7EA 3W59A 4B8EA 2VW2A 3GBFA 4PDWC 1YHFA 3UESA 4DIQA 2UYAA 3JBG2 1YYNA 4L2NA 3SH5A 4LXLA 2XOMA 3LF7A 3AFKA 3R4UA 5KR7A 5BNNA 4Y1XA 4C91A 5EPAA 2VJXA 5BNNB 1POV3 3AL5A 2ZX3A 5I0DA 1WLWA 2X09A 4GKXA 2QQPA 4AVCA 3AZWA 5B2GB 1Y9QA 2BZDA 1CZTA 2RS13 4BQXA 2DBNA 1MZFA 3LEKA 2UWCA 1RUI2 2BP6A 3BPZA 3N7LA 1MACA 5EV7A 4Z2WA 4CU8A 2O0OA 3CJIA 5FKBA 5C5TA 5IATA 3GZEA 2PHXA 1AJKA 1JUHA 1V6JA 1CAXA 2GNTA 4M4PA 4D8MA 1ZNPA 3BPSA 3WW4A 1PGL2 1TE1B 5CAZA 2VZ3A 4NUBA 1W8TA 2QQOA 1WA6X 4PBOA 3A23A 4FOYA 5F3EA 2NP0A 3AZVA 4JGYB 3I2FA 1LGBA 1PMHX 2ZJCA 4L9BA 3SCFA 5KC5A 1KJLA 1WD3A 3NWKA 4YGCA 2LUWA 1ALYA 3LDKA 1TMF2 1YI9A 3WINE 3I3DA 1SPPA 3PMSA 1SPPB 3OD4A 4ATEA 3RNSA 2ARXA 2BTVC 3QCWA 3T30A 5IVCA 4O9EA 4RSUA 2C6SA 1ZREA 4WVMB 4OI1A 5FLIA 1LGCA 2C1FA 1CJDA 4DEVA 4FT8A 2RHPA 2ZZJA 1MS3A 1SLTA 5E6HA 4AFDA 1O8PA 4BYYA 3BTZA 3VHOA 2D5HA 1NE6A 4QM9A 5FYIA 1TG7A 4E8CA 5FPXA 3RS6A 3AYCA 3EJKA 1LOEA 2VCAA 3H9AA 4DFSA 1BEV3 1W06A 2A73B 3BCWA 2H0VA 3ZFEA 5FRAA 1NLQA 3AZZA 5FY1A 2DCZA 1PIV1 4XHXA 4GH4C 1KGYA 1DG6A 4XW3A 4A4AA 4YNIA 2YROA 4CP0A 1O4TA 3VD3A 3MW4A 1YNAA 5CKQA 1IPJA 1UX7A 2VOWA 4K6BA 1DZTA 4YG6A 3RZGA 1CESA 3OYWB 3T09A 2VZUA 5IW0A 4CDXB 3WNNA 2VMEA 1WWYA 1NLSA 4A44A 4ZY9A 3Q9OA 3LEIA 1COV2 1PVC3 5J96B 2DWRA 2YPJA 1C1LA 3MI8A 1UY1A 4ES8A 4FBFA 2DVGA 4JVAA 3DPRC 1V9U1 3OCPA 3PHMA 4U36A 1G7YA 2RJKA 3KQ4B 4COZA 3B02A 3BVCA 4PIXA 5A3NA 5F6KA 3POIA 2WKKA 2PELA 4P9GA 5JMOA 4HN0A 3WZ1A 4KG8A 4ASKA 1NKGA 2RM22 1FOD3 4JKKA 3U14A 3R4DB 1ND3A 2C24A 3C7FA 1ND3B 1X8EA 2BFUL 1XJAA 5ABJB 3GALA 1H8VA 4MXVA 1HKDA 4BWOA 2RS32 4FPOB 2WIIB 4A42A 2ATFA 1W99A 4NIDA 2WNUA 1T6BX 2ADDA 3H1YA 1JBCA 4K3UA 4QU1A 3T4VA 3UETA 1WD4A 4PCRA 2Q30A 2VTFA 2Q4SA 1BCXA 3OGRA 4HK9A 1GQGA 3TEYA 2GP5A 2A6VA 4NHXA 2RS12 2BEOA 3EB7A 1NA1A 1NA1B 3PURA 5FZOA 5FZOB 3WSOA 1ENXA 2WQ8A 2YHJA 3HR9A 4XXAA 2V73A 5DAXA 5FBZA 5FWEA 3UV9A 2FMYA 1UF2C 4BIOA 4YYOA 4GA9A 2XLFA 1OHFA 3T4HB 4ZHNA 2Q8DA 1AUYA 3TEXA 3WR0A 1O8SA 3ILRA 1CJPA 3F2ZA 5JOXA 4PT6A 3VDCA 1U5XA 2HWC3 3N36A 2VNRA 2OIIA 4META 2HEWF 3KCXA 5LRRA 3VBOC 3MUZ1 3OB8A 4XFHA 1BQPA 1GKBA 2NMNA 4LE4A 1ENQA 4AK3A 1GZWA 1RMU1 3ZR5A 4LKSA 4AFCA 3VHNA 2BJSA 1VBC1 1E5RA 1ZZ6A 3VKOA 3LWCA 3THDA 1R1ZA 1UL9A 1L3JA 2VOXA 3POSA 2OXBA 3CZJA 3OTFA 4PDWA 2E53A 3KD4A 1WMFA 5FXWA 5LBBA 2XVGA 3P3PA 3ES1A 2WT2A 1W6OB 1KDKA 4ZXEA 4XURA 3URFA 4CDWA 5FLHA 4AHXA 4CDWB 4D3WA 1AL22 4GMP1 2VMFA 1R1A1 3ACLA 1AR62 1BEV2 1YQ8A 4P00B 2BVVA 4MH0E 4QXBA 3SEPA 4ASMB 1S0EA 1XE7A 5E89A 5FZMA 2WO1A 4FFGA 1YFUA 3JB8A 2WNVB 4FFHA 4BCUA 3PUQA 1VBE3 4FOWA 1ST8A 4UFLA 2C9AA 1X33A 3POEA 2WDBA 4FXKB 3DYMA 2HWF1 4FPEA 1JODA 1W6QB 3HNBM 1EV11 1LJ7A 2I07B 1PVC2 4F7ZA 4UW3A 4BLIA 2HKXA 1NUKA 3W5NA 1RUH3 4OQ9A 1I3HA 3UGFA 4OHWA 2AC1A 2HWD1 2WINB 3ITQA 3M70A 4KL1A 3U75A 4COUA 4EN9B 1JOJA 1OBNA 2XXZA 4CRQA 1TNRA 4HKWA 3OG2A 4L0PA 3J7MA 4N7UA 3ZN4A 4K8RB 4P14A 4NRPA 2BNOA 3T2PA 1ND2A 1R091 2DVDA 2EICA 1ND2B 2EF6A 4AQ6A 4BLJA 4O7XA 4B4PA 4D7TA 1GP6A 5AC93 2HWB3 4R4XA 5LK7B 5I93A 1XNAA 1JYXA 1GNHA 4ISRA 3D82A 2GNBA 3ZFFB 4TZDA 3ZYBA 3BOWA 2WUHA 3PU8A 4UFIA 2FDKA 4B4RA 5F9TA 5FPUA 5FYTA 1JHJA 3MPPG 4MOAA 3BI3A 5GZFA 1QKQA 2BOJA 2VZRA 3GM8A 3HJRA 3U11A 4YW1A 4WZCA 2ZAAA 2DFCA 4K21A 4COWA 1X82A 2BWAA 2BQPA 1NCQC 3VBFC 1REDA 1DFQA 2JG9B 1K45A 2CV6A 2JD9A 2GZWA 4LBMA 4Q4X3 1QJFA 2DCKA 2SBAA 4Y5SA 3KS7A 3ZYPA 2ZX4A 4CCEA 2ZBJA 2HWC2 2BPA2 1X9TA 3W21A 3WEZA 2VMDA 3S6PA 5A3TA 2K9ZA 1W8HA 2TNFA 4QGMA 4QU2A 5FZ7A 3ZKUA 3THTA 4JV4A 4I0WB 1W8WA 3DF0A 4Y1YA 5DUWA 5FMBA 3WG3A 2FBEA 1ZM1A 2R061 4DXZA 1KITA 1RUJ3 4LUMA 5F3GA 2VXRA 5CISA 3IMNA 2O8QA 4XMAA 5FPZA 4CDQB 5LY1A 1PK6C 1QXJA 1PZ7A 5FK8A 1AYM1 4D0QA 1RHI3 1OLMA 4GKYA 1O7FA 4JZRA 3ZXGA 3JQXA 4XEZA 3VD5A 3KCCA 3O1RA 5FK7A 1EYBA 3Q8EA 1IOAA 2K0GA 3K3NA 2EXIA 2QTWB 3N35A 4P08A 1IHMA 4GJYA 4N43A 5LB6A 4URAA 3GGLA 4N43B 4HVQA 4Y20A 4Y20B 4OUMA 5KXEA 4ZONA 2LALA 3I7DA 1X7NA 4Y5TA 2YGMA 1SEFA 3NV2A 1AR83 4QPWA 1YQ5A 2JB4A 3MW2A 3RWKX 1O59A 3LKJA 4XJZA 2GSYA 4J6GA 1F4HA 4MGKE 1VBE2 2W91A 3FFZA 4PHZA 3ZFGB 1KS4A 3O0XA 3SXWA 2BNNA 4V2VA 1W90A 1Y7BA 2QDRA 1FNZA 3PU3A 5A3PA 4CCMA 1Q43A 4LKDA 4TLGA 3APBA 1ZBE1 3ILNA 2DUQA 5I8TA 3OBAA 1VALA 3J9SA 4IGPA 4M3CA 1C8NA 1OMIA 1RUH2 2XJSA 5EWSA 2QBXA 2VW1A 4IEXA 3ZYFA 1JZ6A 1S55A 2WYSA 4HMZA 5DPNA 2XVLA 3B5LB 5E16A 5IHRA 1XNTA 3KGZA 3CO2A 3R0RA 1C8M1 3U78A 2PHDA 2JJ6A 5FOBB 1XYNA 3N7JA 2WFF3 2D44A 4IDZA 1MEC2 5AC92 1W8ZA 2HWB2 5D1IA 1OQ1A 1LHUA 1AX2A 5IVBA 3AVRA 4CXYA 3VBRA 3ZYIB 2AYHA 3JXSA 1RL3A 3M3CA 4GMP0 4XHBA 3VBRB 1NCRC 4AGVA 3KHCA 1FAYA 1UU6A 1W03A 2QDNA 2F6BA 1DGRA 5FBJA 4CEWC 3MYXA 1DLCA 2FCTA 1MQTC 2ET7A 1UOFA 2P3KA 2OW4A 3ACGA 3I2KA 4H7MA 4Q0PA 4WM8A 4RHV1 3L9JT 2A70A 5LEJA 1BK0A 3H3ZA 2V72A 3C7EA 1D4M1 1H8TA 2B42B 3BGAA 4OHVA 4BQ3A 5CFCC 1H8TB 1SBFA 3WHUA 4W50A 4XTMA 1HV1A 1A8MA 2X10A 4LO5B 4RS5A 2G19A 2RVAA 5J98B 4AYUA 1YRZA 3NKGA 3GF6A 3D0SA 1U0AA 2BWCA 5F1RA 5FR3A 5JXHA 2ZHNA 1JH5A 2EIGA 3GCWA 5DAWA 5FV3A 3AKRA 2YC2A 1K5MB 3N9MA 4JRAA 3ZN5A 3LOBA 1FXZA 4E4DX 4YZ5A 1CZSA 1RHI2 4FPGA 3EQEA 1X9PA 2GC0A 2VBBA 4FPJA 4BE3A 4CDUC 1H1IA 4LOTA 4NHLA 1JZ8A 1JN2P 1UKGA 5D8AA 5A3UA 4X6RB 5D8AB 2VUDA 4LLOA 4XDQA 3R4SA 3P3NA 4Q8LA 2Y26A 1EAH2 3LZZA 4AVSA 1ZRDA 1MVQA 3T08A 2JKBA 4M0HA 1V6NA 4QD2A 1BYHA 1NCQA 4XBLA 3VBFA 1AR82 2BERA 1OOPA 2O1QA 1JZ4A 2MNGA 1OOPB 3ORJA 4FOVA 1KXGA 4NR1A 3GBGA 1DZQA 1PGL1 5JZGA 2JDZA 1BLZA 2R041 3K3OA 3PTYA 5JZGB 1F8VA 1F5JA 5GLVA 4FPFA 1SBDA 4GB33 4FOQA 2E31A 2X5IB 2VVEA 1LB2A 5FY4A 1LESA 1Z0HA 1Z7S3 3E5QA 1E5HA 3GZAA 4LK6A 2AACA 4PLMA 2OYZA 3ZDVA 1HJFA 5ACA3 4V2WA 1QH7A 1TZOA 3LFMA 4XFBA 1TMF1 4LPLA 5CG8A 1DIWA 3HNYM 2W46A 5D21A 1EUTA 3ZPYA 3O1UA 1AVBA 3I59B 3AM2A 4BQ1A 4WVVA 3UGGA 2W08A 3KLSA 5CA6A 1NOVA 3I2DA 5A6YA 4LBNA 4YSFA 3CHXA 3AFGA 1ZZ8A 3M3EA 1W6PA 1W2AX 4CEYA 4CEYB 1W9SA 5T50A 4IEYA 1Q5OA 2WFF2 3TBDA 1BMV1 1OA4A 4RGAA 2EXJA 1UKRA 1VBB1 2P3YA 2GMEA 5GLZA 1KDMA 4NIHA 4YW5A 3ILFA 2ZGPA 1ASJ1 2UURA 2FCUA 3HPNA 3MIBA 4NWWA 3TNPB 4UXAA 4CP9A 3M4FA 2W92A 4CP9B 5IVVA 3AXDA 1K5JA 3VBSA 1YQCA 3HN3A 3ME2A 3VBSB 3CJXA 4UFJA 1FPN2 1NZIA 3WP6A 5FYCA 4YZ1A 3OPZA 4QX3A 2VZVA 1M4WA 1BXHA 4Q0VA 2B9UA 2VQTA 5I91A 1W2OA 2JDHA 1Q56A 1Q8VA 1COV1 1OFSA 3D4KA 3FUQA 3HT2A 5FXXA 2WWJA 2WAAA 4LO8A 3WW1A 4EN7B 4OUSA 2E7TA 4QXHA 4LR4A 1LOBA 4IEWA 4UI9L 2BW8A 2PN5A 3IN9A 1VMFA 1OD5A 3Q8BA 1WBLA 4YGEA 3BU7A 5FYSA 1YQ6A 1JMUB 3IPVB 4AXOA 1UXXX 4L92A 4CCNA 2C0ZA 1J59A 3TNQA 1S2BA 1J3QA 3AX4A 1RVF3 2W9XA 1S0FA 1VRH3 4MX3A 2J1AA 3HQUA 4GJZA 1JYTA 4NWVA 1BK1A 5BNNC 3OUJA 1YJKA 4ZZ8A 2RS31 4S2GA 2VZQA 2FDGA 1YUDA 3R05A 1BVVA 3BN6A 1OXCA 4PLNA 5FQ0B 5GZDA 3U37A 1VBA1 3WQ0A 5IK5A 2DUOA 4OHYA 2A3XA 5FWJA 1GICA 4NHKA 2ZEXA 2EVXA 5K0UB 3WNKA 2YC0A 4HSLA 2ZEYA 1XYPA 3CIHA 4IV1B 1KFUL 3IDCB 3ON7A 1RB8G 2ORZA 1RUD3 1Q8QA 5CFCA 4IV3A 4JGYC 3WG4A 3DUIA 3M3QA 1FMD3 1POQA 4WZFA 3F95A 3KV6A 4CCLA 1ODNA 3AJZA 1EY2A 1AR93 4XQ4A 1JZ3A 4CUGA 1WLTA 3LA7A 4DMIA 2O8OA 3FHIB 3U0ZA 2TBVA 5DG2A 2W2IA 2IZWA 4GB32 5FPBA 3MO4A 3X29B 1W2TA 2BUKA 2ZGLA 1JYWA 2VZTA 3QACA 2R1DA 4KMQA 4XUPA 2VCCA 5F39A 5FPAA 2FZ2A 3H7JA 3NJVA 3TN93 2WZ8A 5CVRA 4IXLA 1AL0G 2P34A 3DV8A 5FDBA 4HPKB 4MSVA 1AR71 2GMMA 2RDQA 5DDJ3 3O1OA 4LKEA 4OUEA 3WDUA 5JSRA 3ZFEC 1IKQA 3K4DA 4LIVA 4HKLA 3VD7A 1AL21 4K20A 2XBO1 4WBBA 5FO7B 1TME3 2R7EB 3P1IA 3VZNA 5C71A 2ZGSA
chains in the Genus database with same CATH topology
1VJ2A 2Z79A 5T54A 3MFAA 5IK4A 4CDXC 2IXLA 2WL1A 2ZZQA 1IS5A 4IEPA 5L73A 4AVVA 5EXOA 1ZRCA 2PLV3 1FNYA 3W9AA 2ZGQA 1XQNA 3T1LA 3G7DA 4IERA 4C1XA 5T52A 2ZABA 1OA3A 1OQEA 1VIWB 1QDOA 2ZS6B 5CIRA 1CPNA 1XNCA 1X50A 3NW4A 3ZVXA 3TAYA 2W39A 5JVVA 1QQP3 2A71A 1ND3C 4XJUA 1PGSA 5T5JA 5ABJC 2ZMNA 4HVOA 4W6YA 1UPIA 4LBQA 3GZUC 1O91A 4OI4A 1RVF2 2NZ9A 1VRH2 4JGZB 2DF7A 2JD4A 5FO9B 4KU8A 5C4WA 5C4WB 2IC1A 4RL7A 4YZ4A 3ELNA 4Q29A 4DY5A 3V0BA 1NA1C 1NY71 2D97A 3KCYA 1QMJA 1PO23 1SACA 5BPXA 3AKSA 4NOTA 2PHUA 1FX5A 4R9BA 2AR6A 4A2UA 1DU3D 1WLDA 3EXUA 1RUD2 1WBFA 3ES4A 5A33B 4OZXA 2D3PA 4HANA 3AP4A 1I1EA 1XNDA 3J8F2 1WCKA 1MS5A 2D7FA 2R1BA 1LTEA 2UY9A 2HWC1 3WCRA 4CZSA 1MZ6A 1W6NA 4MXWA 2BGCA 2A6ZA 3JD71 3M1HA 4MV2A 5CB7A 4M00A 1B35B 1QJU3 5BNPA 5BNPB 2Z42A 3H7YA 2H6CA 3M2MA 1AR63 1MS4A 4IEVA 3ZYJB 5FMOL 3TN92 4CDWC 5KHIA 3QOPA 4XFAA 3S30A 1QXPA 2OUHA 2QE3A 4HBNA 3MIDA 4OVEA 1S2KA 3L2HA 3LGRA 5CG9A 1TME2 4I09A 4C90A 2WNVC 2QNKA 1GBGA 1ZA4A 4AF9A 4XMIA 1H9PA 2R30A 1PM7A 2HWE1 2D6NA 4JGYA 4L99A 4EWAA 1S1AA 5E8AA 3FZ3A 2JICA 4YFZA 2CYFA 3AZXA 1VBD3 2Z5WA 5FO8B 4GQ7A 4Q2FA 3ZSEA 4LBQD 3WD5A 5KHHA 4WVMA 1KFXL 1HQWA 1PZ8A 2CWMA 2XWBB 1UMZA 3BB6A 3EBRA 4Q4W1 4D7SA 1RUF3 2XLAA 2FHRA 2GH8A 2WSVA 1LCLA 1QQP2 1ND2C 3HWJA 1R081 5LK5A 4LBOA 4AE2A 1XU1A 3VHPA 2HJIA 2ZOEB 4I02A 3WP4A 5KXCA 5JPMB 3SMHA 4W6WA 2W0XA 3ZFFC 1PVXA 3OGGA 1PGW2 3UKTA 3IDEA 1MEC1 4F8AA 3OYWA 3VKNA 4CDXA 4N9HA 1GSLA 5BUVA 1ZBA2 3OJBA 1KQRA 4TSVA 2WNEA 4GIQA 3THPA 4GXLA 2VU9A 1RITA 1GZCA 3FMGA 4FCAA 3VBUB 1HRI1 2B39A 3VDDA 5I8YA 4RGGA 3VDDB 1YXWA 4QMAA 3VBHB 3WDYA 3ZXDA 1DF0A 4YZ2A 3IDBB 1DQ2A 2AH2A 1Q8OA 4KU7A 4DPNA 2WSUA 3IM0A 2R6QA 3O7OA 3WUCA 1JYIA 4B4QA 4XOGA 2XWJB 4CDQC 4E27A 4F3JA 2R073 1HIXA 1KJRA 5ABJA 1OLRA 2VNOA 1QJU2 1YLLA 1ENRA 4EN6B 5IT6A 2XPJA 4UW4A 1IZ3A 2RMU3 1ULEA 3RDIA 5GZGA 2YUEA 1AR62 4HFSA 3ZXKA 4N43C 1D2SA 1FATA 1QY4A 1RUC1 2VULA 3GHMA 1W6MB 1SLLA 1UU4A 3KT7A 1O3TA 1ONAA 3VN4A 4LULA 1EAH1 4LBKA 2A75A 3AZYA 4EROA 2SLIA 2RR11 3D8CA 5C8WA 2B8MA 2WS93 4PQ9A 3ZFGC 4IESA 4Q4Y1 2DUPA 2WZR1 4O9GA 1W0OA 4Y1UA 5CFDB 1S0GA 2DTYA 4AVBA 2WFPA 4XJ8A 4XBQA 4A3XA 5BY5A 5A3LA 1VBD2 3UL2A 4F83A 4X8PA 4YGBA 2XJRA 4TWTA 4C0BA 3KSCA 4B29A 4YVSA 4EJRA 4YVSB 2R0FA 4XQDA 1N3QA 1QJY1 3WW3A 2A3WA 3USSA 4RR3B 1QJX3 1W6OA 1SBEA 4RA0A 4BOWA 2GMPA 1LOFA 2G4IA 2BBVA 1LODA 1NYWA 5JOWA 1YFWA 4LT5A 3TYJA 3NO8A 5FCCA 1RUE1 1C28A 3LA2A 3VBRC 1UIJA 1SLAA 2WFF1 3RG0A 4CYDA 2WNVA 3IWZA 2FMDA 3N7MA 1NQJA 2PAEA 1VB4A 3B01A 2P37A 3ST7A 2ZGRA 3QH6A 3D6EA 4XIKA 1W6QA 1YFYA 1ZZ7A 4WM8C 1AXZA 3OY8B 3NSTA 4E2SA 1FPN1 5JLVA 4Q0UA 1H8TC 1CPMA 2MEV1 2IXCA 1SMVA 1HXS1 1OPMA 1FI2A 3GBWA 4AHWA 3MDPA 4RS5C 5FAXA 1H1AA 2QFEA 2Y0OA 4ZU4A 4N9IA 2ZACA 1FOD2 1XXNA 2NN8A 5L36A 3QBQA 3HMYA 4I3PA 2R072 1K5MC 1CAWA 1CAWB 2GC2A 2MHFA 3MZHA 2CNAA 3ZFFA 3VZKA 2ZGMA 4LUKA 1YWKA 2GNMA 1JTZX 1UIKA 2VVDA 3K48A 2RMU2 5D8AC 2QCSB 5I0TA 4AWDA 5JWPA 4Z92B 1V6LA 3PMEA 5IK7A 1WUVA 1O4ZA 1PIV3 1RUG3 2JG9A 2HEYF 1OOPC 1TEIA 2D6LX 5E88A 2ZGUA 2HEVF 3MIFA 5AVPA 1QF3A 3K51A 4FAGA 3WW2A 4OI0A 2PA7A 5JZGC 4HN1A 4A7ZA 2XGXA 3KQRA 4H14A 2X5IC 1PZ9A 2QZ2A 1C4RA 1S0IA 2P3IA 4IQPA 4LHLA 4W65A 1QDCA 3FWEA 2VY0A 4CDQA 1BBT3 1V9U3 4K1ZA 4OHXA 4AFBA 1WCDJ 3BTAA 4H3WA 4CP1A 4XE9A 1EPWA 4U2AA 3ATGA 3MGUA 5HCBA 4AEKA 4AQSA 3PJQA 3ASIA 3AMHA 1QJX2 3MLKA 4FVVA 4CEYC 4BHPA 2NLRA 2XKPA 3DL3A 4E4SA 2VOKA 1FV3A 4XFCA 1N3PA 2ZHMA 4DS0A 4TYSA 4JDNA 3LAGA 5AFEA 3DN7A 2IXKA 1RGSA 3WY6A 2E63A 2WWSA 4FXGB 3VBSC 3IT8A 1YO8A 4XYXA 3ZFGA 5KXBA 1IPKA 1DGWX 1VB2A 4K9SA 3ZXJA 1ZX5A 2IFRA 3C2UA 1DQ0A 1D2QA 2UU8A 4ATFA 3I8TA 2ZHKA 1NXD1 5JR7B 3M7AA 3QH7A 2NQYA 3HD8B 3RQ0A 4E2QA 4PBPA 1LOCA 4AG4A 4LNVA 4LLFA 3CL1A 3PVNA 2GN3A 4MGIE 4RD7A 3O12A 4ITCA 1NXMA 1RMU3 4Q4V3 3CF6E 2A6WA 3FUOA 1VBC3 1VAKA 2A7AA 1O5LA 1RIRA 4HVRA 3JU9A 3VHRA 4J1XA 2OUJA 3ALQA 2ZMLA 5KBFA 4ASLA 2JX9A 1JYCA 5JCTA 2ILMA 3MIHA 4GMP3 4Y1ZA 4UW6A 1R1A3 2Z69A 4RQPB 4YZ3A 1JW6A 3AXEA 3KZ4C 2XJPA 5K0UC 4AQ2A 1LECA 1Y3TA 1GYKA 1PIV2 1RUG2 2B46X 5C9AA 2D40A 5C9AB 5JMCA 1DHKB 1LENA 3WG2A 2OVUA 4IV3C 2YYOA 4Q4X2 4FQZA 3ZIXA 2DV9A 3OBTA 1MZEA 3NV4A 4I01A 2HWF3 3WDVA 3UK9A 4I3GA 3UKVA 4R52A 1F31A 2D6PA 4EWDA 3J8F1 2XJQA 1RUJ2 4XXPA 2HWD3 4XBNA 1BBT2 1V9U2 1K5MA 2UY8A 4L97A 3WV6A 4D69A 3H3UA 2JXAA 4Q0QA 2WT1A 1D0HA 5BNOA 4EN0A 1J3RA 1QGLA 5BNOB 1R093 2GNDA 3JBG1 1AHSA 2K2SA 3FFQA 3MLLA 2H0BA 3BODA 1MS8A 4OI2A 1KRIA 1DGWA 2D43A 5GZEA 2AZ5A 1Z78A 2VG9A 1RUI1 1GNZA 4AQTA 2PAKA 4HT1T 3T1MA 2OZJA 2Q5TA 4XIOA 3UJQA 1H4HA 2R32A 2QKDA 3ETQA 1C3HA 1G9BA 2E51A 1O3QA 3SISA 2X5IA 1G9DA 3WXPA 3MF9A 3PLQA 2CL2A 4DOUA 1JHNA 4QM8A 2E7AA 3I59A 4NN0A 1NE4A 2E9QA 4JRLA 2N7GA 4FPLA 4FTBA 5KHGA 4AEDA 1XNKA 4Q4V2 4AEDB 1VBC2 4FTEA 4JGZC 2KXLA 2GC1A 1AYM3 2VNGA 4I0AA 1APNA 3ZN6B 2AGSA 2D5FA 1V70A 2OA2A 3FLTA 4Y26A 5C4WC 4GWMA 4P9XA 1WGPA 2V5YA 1PGW1 4XETA 4TLFA 4AGGA 2RE9A 1R1A2 5JOZA 4LO4B 5T5OA 5L7OA 2QVSB 4FAHA 5L7OB 2WLPA 1N1YA 3SITA 4M0NA 3AP9A 3H8UA 4HSJA 3VLBB 4EN8B 1CN1A 5JSOA 4P9WA 1GZ9A 1X36A 1ZBA1 1REFA 1J1TA 5BV6A 3NV1A 1AYN3 5C33A 4NVPA 4LBLA 5H9PA 1CD3G 3NV3A 1OPOA 4AHYA 4M3CF 4G9SB 4Y22B 5TSWA 1I5ZA 1HW5A 4R9CA 3NAPA 2EAAA 1C5HA 5I0UA 3NAPB 4LHKA 3IPVA 1ZBE3 2VECA 1B35C 1LOGA 4XFGA 5JAXA 2HWD2 5BNPC 4HZFA 1JXNA 2RM21 3QLQA 4DINB 4DNYA 4MLOA 1LRHA 3E6BA 4PIYA 2Y0IA 5FQ0A 1CIWA 4YVWA 4Y5Z0 2A6XA 4YVWB 2VMHA 5FFOC 1POV1 3CEWA 4M3CE 4QPIA 5K0UA 4QPIB 1W2UA 2PHTA 2RS11 4QHBA 3IKWA 4IV1A 4YM0A 3ROUA 5LRSA 1AF9A 1QOOA 2D6MA 1D4VB 3HIFA 5BXXA 2TEPA 3AMPA 3E5UA 1GLHA 3OF1A 3WDXA 3SCHA 4ZKTB 1IGOA 4XJAA 4COYA 2YY1A 3BIWE 2LTNA 2BVBA 3C3VA 4GWNA 2PFWA 3DGTA 1Z7S2 3L2YA 5ACA2 1D4M3 2PYTA 3AB0A 3S0MA 1DLLA 2ZGKA 1MQTB 1BKZA 1ZZBA 4BH9A 1VBD1 5C6CA 4N53A 1BZWA 2MPFA 4DZGA 1AX1A 4N53B 3S7IA 5EZWA 5L19A 4LA3A 2A5ZA 3CNAA 4FQ4A 1SDWA 3ZSMA 1U5IA 3VKLA 4HPKA 3I4IA 4MUVA 4Z1VA 5DUVA 5HI0A 2EXKA 2JG8A 3OGJA 2EAKA 2DU1A 2JG8B 3A4UA 3O5SA 3RYKA 3WLUA 3SHRA 1S0DA 1AYM2 1J1LA 4AI3A 3KT4A 3AKTA 1BEV1 1S0CA 5JOYA 5F6LB 1A78A 4LBJA 5KHKA 3WQ1A 3V56A 2VQAA 2CTVA 3BALA 4LHNA 3ZXFA 3VBUC 1SFNA 3VDDC 4LEJA 1MZ5A 2KM2A 3VBHC 5JPNB 2XH6A 1UCXA 1CONA 1PO13 5GZCA 3GNEA 1PVC1 1OFNA 1AYN2 1WW7A 2R043 5A3MA 2ZPXA 4AEMA 4QPGB 4FPHA 1MS9A 4DRRA 4LE3A 1ZBE2 2JECA 3ZX7A 2RJLA 4P5HA 1WW4A 2ES3A 1FOD1 3J26N 4JGZA 2CGPA 4XF1A 2AENA 2QZ3A 4WM7A 3WP5A 1LU2A 5C8CB 4WM7B 4S2FA 4I0BA 1SCSA 1T6GC 5SV5A 4R8HA 4OHZA 2RMU1 3ZXEA 1I6XA 1VBB3 2DVFA 2ETEA 2ET1A 3B69A 1ASJ3 3FLRA 2ZX2A 1CGPA 2D93A 2VMGA 5A33A 4PIZA 5CFDC 1FMD2 1YI7A 3RMYA 2G9GA 1AR92 5JDBA 1UN1A 3PJYA 4LO6B 1GV9A 1QNWA 5JIUA 3ZDSA 1IS6A 3M8LA 5IK8A 1UAIA 3SLIA 2Q0AA 2ZCWA 4YM2A 1YIFA 1COV3 1PNGA 1B35A 1I9RA 5J98B 4JAAA 2ZAHA 4YVSC 1ULFA 3B3QE 3WUDA 3KB5A 1MR5A 4RR3C 2PHLA 2R16A 5A32A 3E5XA 3WX5A 2RS53 2VW0A 5A32B 1A6CA 1LOFC 3FLPA 3RMXA 1YJLA 3NJZA 3FJSA 5DDJ2 4FO9A 3H50A 2D98A 4M01A 2P17A 5IUQA 4EV0A 3B9IA 5DZEA 5CADA 1OLQA 2GDFA 5AVAA 2HYKA 3RJRA 2JENA 2RS33 2WQ4A 4W6XA 3WT3A 1V6KA 4YG3A 4XZPA 3WCSA 1POV0 2I74A 1VBA3 4QQLA 2VUJA 3E6CC 1QWRA 2PLV2 3VKFC 4OFGA 1V6OA 4XF4A 1O4YA 3CLPA 1VBE1 3ENRA 5HCFA 3NVCA 4LTAA 4Q1RA 1PO12 1IKPA 3CJIB 4BZ4A 1CAXB 1RUH1 1ULDA 3LA3A 5GKAC 2R042 1PHMA 4BPZA 3WQ7A 3RZZA 3UJOA 4XF0A 2GAUA 4IL7A 3IIAA 2WA4A 2IXIA 1A3KA 4YG0A 4YARA 2UWBA 3E97A 1DQ1A 1LHVA 1N1VA 1B09A 1ZZCA 3MIGA 5HBAA 1C5IA 2UYBA 5AC91 2HWB1 3SNMA 4JDMA 3JUUA 3WP3A 1AR73 1EPZA 4IEOA 3H0OA 4Z07A 1PO22 3AJYA 5T3NA 1BMV2 4Q0SA 1VBB2 1F2NA 2JG9C 1AL23 3RYPA 3VBUA 1RJ8A 2XBO3 4R9AA 3CU7A 3LB9A 3N3HA 1ASJ2 3VBHA 5I0SA 3RI9A 1REEA 4YW2A 2XJVA 5BYNA 1RUG1 4IEZA 3ZFEB 1YIPA 2CGOA 3RI8A 3PVBB 2ZX1A 1CAUA 4Q4X1 1CAUB 4C0HA 4OLLA 1ZYBA 1AXKA 2WZPP 3MF6A 4Q1PA 3AMQA 1M06G 3MIEA 4DY3A 2LM3A 1RUJ1 1HRV3 4XILA 1BBT1 1FV2A 3ZO0B 2RS52 1DZRA 4ORFA 2YV8A 4D94A 1RHI1 1UU5A 1AJOA 2DVAA 1OKQA 5JI9A 1W6MA 4DB5A 3INAA 3JQWA 4Q26A 3ECQA 1F9KA 3DKWA 4S2DA 1EP0A 2ZA9A 4B7EA 1NZCA 1H4GA 3WDWA 5JIAA 4KQ7A 4AVTA 3V64A 1QH6A 1LKNA 2WNUB 1AR81 5CFDA 4KWLA 1VBA2 4KG0A 2AREA 4FP3A 4FPYA 4MGZE 3JB4C 5EYYA 2XB6C 1QXRA 1W0PA 3VV1A 1FYUA 1WMDA 1H0BA 1NQDA 3TWIA 2W52A 4X8NA 1V6MA 4RR3A 4ZU7A 3LCPA 1RUF2 4K8FA 1SLCA 3MLJA 1OQDA 2XJTA 3JD73 3KT1A 1Q8SA 3FX3A 4E2GA 3VZLA 4YRDA 3SCGA 5J7MA 1GZWB 2R0HA 4L11A 4Q4V1 4V1PA 2D6OX 1AXYA 3ZMOA 2PHFA 1LULA 2GC3A 3AK0A 4RQPC 4EWEA 1GQHA 1AR72 1U12A 4ISQA 4PDWB 5FLJA 1RJ7A 3VZJA 3N7KA 2XL9A 3OY8A 2GU9A 3RSJA 1GR3A 4QX5A 5C9AC 2XBO2 3AYAA 3MW3A 1QNYA 4DQAA 5J09A 4HETA 4NPRA 1V00A 4E9KA 2HWE3 5BNQA 1HV0A 3AYDA 2WQZC 4INDA 4AFMA 1GFF2 4KBBA 4A7KA 2GH2A 3AKPA 3WHTA 1H9WA 2Q1MA 5DZGA 1QU0A 2XUMA 1HLCA 2Y38A 1PMIA 5T5LA 3AMMA 1J58A 5EJ3A 1DQ6A 4K40A 4YW4A 3WVJA 4C1WA 1UW8A 4E4ZA 4Q4W3 1HRV2 2QUOA 5BNOC 5H9QA 1F5FA 1R083 2ENRA 1CVNA 2E6VA 4ES9A 2GN7A 4FPCA 1LHNA 1NG0A 2PHRA 3W58A 2C5DA 2QJVA 3EO6A 4G3YC 1WCSA 2XJUA 2DCYA 3VL8A 1MEC3 5HCAA 2BYVE 2WS92 5T55A 4KWKA 4GH4A 4P9LA 2VOVA 4WV8A 4Y1VA 4GH4B 1XRUA 3JCIA 1NY72 3B94A 3A0KA 4IETA 2Q8OA 4MZUA 4PJYA 1HRI3 5KHJA 3QD6A 3T2TA 4JCKA 4AGRA 1H2KA 4H55A 1LOAA 3VZOA 5CBLA 4GALA 4GB31 2PQQA 1FT9A 1Z7S1 5ACA1 2NMOA 1LGNA 2JE7A 1MVEA 2ZGOA 5FMOS 2F4PA 2ZGTA 2ZKNA 4AVAA 3DPRA 1XYOA 3KGLA 1XNBA 3FBYA 4IEQA 3DPRB 5GLTA 1VLNA 4B7KA 3ZSLA 4NO4A 1IS3A 1DYKA 4AEDC 4HKOA 3JD72 4GULA 5JSPA 3RJ2X 3GYDA 5J37A 2B5HA 3H1WA 4L8QA 3GZTB 5T5PA 2ZHLA 4K7JA 4KWJA 2B45X 5AFBA 2XLGA 1RUC3 3U07A 4YLZA 3ZYRA 1LU1A 4XJWA 5L7OC 2X53S 2ZMKA 1N47A 4QPYA 3AYEA 1IQAA 1LHWA 1EAH3 2PTMA 1G9FA 4XPVA 3FC0A 4AI0A 2RR13 1DYPA 1CX4A 3WOGA 2HWE2 3ZSKA 4Q4Y3 4D7YA 2WZR3 4XTPA 4DRVA 1PNFA 1KD7A 1SQ4A 1H2LA 1O5UA 1DDLA 3NAPC 2VMIA 1AYN1 4LA2A 3TOJA 1W39A 4XQWA 3R6SA 1G9CA 4P9JA 1BVP1 2E7QA 4G4FA 3VBOA 3VBOB 4QT6A 2FQPA 2AUYA 4UW5A 2R49A 3USUA 4S2HA 3USUB 1QJY3 4M3CB 4Q4W2 1UD1A 4XF9A 1UZYA 1HDKA 4YW3A 5FREA 4HL0A 3AP7A 4BMBA 1RVF1 1ZZ9A 2X8KA 4Z8BA 1R082 1VRH1 4Q8KA 4YVWC 4RQPA 2ZTNA 4QPIC 2FZ1A 1RUE3 1S0BA 3KMHA 1ENSA 2VVFA 2W68A 2CWSA 1OA2A 4IV1C 1ZRFA 1Q8PA 2DYCA 4Q27A 2WLQA 5GJ6A 4A7YA 3PVEA 1RTVA 2DCJA 3POWA 5FOJB 2DVBA 1UX6A 4K1YA 1EV13 1RUD1 4KGGA 1FMD1 2OZ6A 1S0JA 2H6BA 1HRI2 1FPN3 1AR91 3N4MA 2BFUS 2MEV3 2CAVA 1HXS3 4WM8B 4N53C 4QQHA 1HQLA 1RC6A 5DZFA 1CR7A 2DURA 4JTNA 4RFT0 2DCTA 4BA6A 1WLCA 3AMNA 2XG3A 1CQ9A 3FBMA 3TRSB 1H2MA 2IXJA 4RS5B 4BMEA 2JG8C 3TN91 3UKNA 2IFWA 1OI6A 3B93A 4N7IA 4AHZA 4SBVA 4JQRA 2X29A 3SH4A 5DDJ1 3EHKA 2BNMA 3RPQA 1BJQA