1TMF2

Three-dimensional structure of theiler murine encephalomyelitis virus (bean strain)
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
267
structure length
267
Chain Sequence
b'DQNTEEMENLSDRVASDKAGNSATNTQSTVGRLCGYGKSHHGEHPASCADTATDKVLAAERYYTIDLASWTTSQEAFSHIRIPLPHVLAGEDGGVFGATLRRHYLCKTGWRVQVQCNASQFHAGSLLVFMAPEFYTGKGTKTGTMEPSDPFTMDTEWRSPQGAPTGYRYDSRTGFFATNHQNQWQWTVYPHQILNLRTNTTVDLEVPYVNVAPSSSWTQHANWTLVVAVLSPLQYATGSSPDVQITASLQPVNPVFNGLRHETVIAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THEILER'S MURINE ENCEPHALOMYELITIS VIRUS (SUBUNIT VP1)
publication title Three-dimensional structure of Theiler murine encephalomyelitis virus (BeAn strain).
pubmed doi rcsb
source organism Theiler's encephalomyelitis virus
molecule tags Virus
total genus 29
structure length 267
sequence length 267
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1992-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1tmf200
1VB4A 1WCDJ 1RUG3 4GMP1 4CEYC 3J8F3 1MEC2 1AR62 1RVF2 4JGYC 5GKAC 4CDXA 4RHV2 4EJRA 2RS11 3VBHB 1NOVA 2X5IA 2WS91 4PDWC 1QQP2 1VBD1 2R062 1VBA1 1R092 5C9AA 1VRH1 1RUI3 1NCQB 3VBSB 4Q4Y1 4JGZA 5K0UB 1MQTA 4RR3B 5L7OC 2RS53 1RUH2 4CDUA 1CD3G 1FOD3 5ACA3 3JBG2 3TN91 4CDWA 4CDXC 3VBRA 2WZR3 4YVWB 2XPJA 2X5IC 1VBC2 5D8AA 5C4WA 1Z7S2 2R072 1AL0G 4Q4W1 5C9AC 2R042 1RHI2 1AR71 3NAPA 5BNOA 2HWB1 1OOPA 3M8LA 1V9U1 5AC92 2BFUL 4JGZC 4SBVA 1MQTC 2RS13 4GMP0 1PO12 4QPGB 1Z7S3 1NY71 1FMD2 2R073 2WS93 4CDUC 1VBB2 3VBOB 1R082 1PGL2 1AYM2 1RUJ2 1NCRB 4CDWC 1C8M2 1HRV2 1VRH3 3VBRC 4Y5Z0 5AC93 1AR82 5CFDB 1A6CA 4GH4B 1AL22 1QJZA 4Q4Y3 1AUYA 1VB2A 1CJDA 1QJX2 1QJY2 5D8AC 5C4WC 4NWWA 1AR61 1MEC1 1AYM3 1FPN2 1NA1B 4RHV1 1C8M3 3NAPC 5BNOC 3VBHA 1OOPC 1AR83 1QJU3 1GFF2 1QQP1 2R061 1R091 1QJY3 2DF7A 4Q4V2 1R1A2 5JZGB 1FOD1 1FPN3 1RMU2 5ABJC 1K5MB 4Q4W3 2WWSA 1NCQA 2WZR1 3VBSA 4CEWC 5K0UA 1AR73 4RR3A 1HRI2 4N53B 2TBVA 2IZWA 1POV1 3VBFA 4CDQB 4WM7B 1RMU3 3ZFGB 5J98B 3JBG1 1RUD2 5BNPB 2WFF2 1PO22 2PLV2 4YVWA 3VBHC 4RQPB 3ZFEB 1VBC1 3JD73 1Z7S1 2R071 1M06G 1C8NA 2RR12 2R041 1RHI1 2QQPA 1ASJ2 2Y26A 1PO23 1AR63 1MEC3 1RVF3 2HWF2 1NCQC 5AC91 3VBSC 1RUC2 2HWC2 3DPRB 1PIV2 4RHV3 4RR3C 5A32B 1PO11 4QPGA 1FMD1 4GB32 4N43A 1QQP3 4Z92B 1VBB1 4JGYB 3VBOA 2R063 3VBFC 5DDJ2 1PGL1 1AYM1 1R093 1RUJ1 1RUF2 1HQNA 1C8M1 1NCRA 1HRV1 4BCUA 1AR81 1RUC3 5CFDA 1QJU1 4YVWC 1EAH2 1AL21 4GH4A 2BBVA 1AR92 1BBT2 1H8TA 1QJX1 1QJY1 3VDDB 1RUH3 4RS5A 1FPN1 2GH8A 1NA1A 3IDEA 1POV3 2ZZQA 3JBG3 1EAH3 5J96B 1BEV2 5CFCB 4QPGC 4Y4YA 1R1A1 4N43C 5JZGA 1VBC3 1RMU1 3VBOC 2BPA2 2XBO2 1K5MA 1PVC2 1NCRC 2R043 1RHI3 4QPIB 5FMOS 5BNNB 5CFDC 1HRI1 5C8CB 4GH4C 1VBA2 4N53A 3ZFFB 1TME2 3JD71 4IV1B 1H8TC 4YVSB 4CDQA 3FBMA 1PO13 4WM7A 3ZFGA 1EV12 4RS5C 1FMD3 1PGW2 1RUD1 1NA1C 1W39A 1VBB3 2XBO3 1R083 2WFF1 1PO21 1RVF1 1RUJ3 4RQPA 2RMU2 3ZFEA 1HRV3 2MEV2 1AL23 1AYN2 2RR11 5JZGC 1QJX3 1ASJ1 3TN92 2HWE2 1RUE2 1ZBA2 1K5MC 2HWF1 2ZAHA 1D4M2 1RUC1 2HWC1 3DPRA 4AEDB 2GSYA 5A32A 4N53C 1RB8G 4GB31 2MEV3 3VBUB 1HXS2 4JGYA 4WM8B 1TMF2 1DDLA 1RUH1 4IV3B 3JB8A 1VBE2 4WM7C 2RM22 1B35B 1RUF1 2HWB2 3ZFGC 4Q4V3 1R1A3 2HWD2 1V9U2 1EAH1 4Q4X2 1SMVA 3CJIB 2VQ0A 4RQPC 1AR91 1BBT1 1RUG2 1ND3B 3ZFEC 3J8F2 5A33B 4RFT0 5ABJB 1HRI3 2WLPA 3VDDA 1OHFA 1ZBE2 4CEWB 2HWD3 5LK7B 1ND2B 1RUD3 3DPRC 2BFUS 2WFF3 1IHMA 2PLV3 1BEV1 5CFCA 4CEYB 5K0UC 1NG0A 2RS32 1ZBE3 1RUI2 1COV2 2XBO1 1R081 1PVC1 2RR13 2FZ1A 1BMV2 1ASJ3 4QPIA 5BNNA 2RS52 5C8CA 4FTEA 4PDWB 2HWF3 1TME1 3ZFFA 2HWC3 4IV1A 1PIV3 1FOD2 5ACA2 4YVSA 2RS33 1X33A 3VDDC 1EV11 1PGW1 4GB33 1COV3 2WZR2 5DDJ3 1RUF3 2RMU1 5L7OB 2MEV1 3VBFB 5CFCC 1AYN1 1AR93 1BBT3 2FZ2A 1OPOA 2HWE1 1RUE1 4Q4V1 1POV0 1ZBA1 1D4M1 4CDXB 2RS12 4QPIC 4AEDA 5BNNC 4NWVA 4LLFA 5C8CC 2X5IB 2WS92 3ZFFC 1VAKA 3VBUA 1VBD2 1HXS1 4IV1C 1F8VA 4GMP3 1TMF1 4WM8A 4IV3A 1VBE1 4YVSC 1BEV3 2RM21 1B35A 5C9AB 1VRH2 2HWD1 3LOBA 1E57A 3JB4C 4Q4X1 3CJIA 1RUG1 5BNPA 4JGZB 1PVC3 4Q4Y2 4N43B 1ND3A 2PLV1 1MQTB 3J8F1 1VBD3 2ZTNA 5A33A 5ABJA 1VBA3 4CDUB 1TME3 1ZBE1 4CEWA 1QJU2 1EV13 4CDWB 1ND2A 3VBRB 1H8TB 1HX6A 4AEDC 2BUKA 1PIV1 2RMU3 4FTSA 3VBUC 4CEYA 4RS5B 5D8AB 5C4WB 2RS31 4WM8C 4IV3C 1RUI1 1COV1 4Q4W2 4FSJA 1B35C 1AYN3 1BMV1 5DDJ1 3NAPB 4CDQC 3TN93 1AR72 1OOPB 1X36A 1RUE3 2HWE3 2RS51 5BNOB 1ZBA3 3CJIC 1D4M3 4PDWA 5BNPC 1F2NA 1ND3C 3ZXAC 5ACA1 1NY72 1HXS3 1TMF3 4FTBA 1VBE3 3S6PA 2RM23 2HWB3 5FMOL 1ND2C 1V9U3 3JD72 5FOJB 3HAGA 5L7OA 4Q4X3
chains in the Genus database with same CATH superfamily
1Q5OA 2DUOA 1GP4A 1RUG3 1WCDJ 4W6XA 2AUYA 2BOIA 5GLWA 4CUGA 4IGPA 4AI8A 2HH9A 1US2A 2WNEA 2KM2A 3H50A 4CDXA 3CLPA 3ZIXA 4AEKA 5A3WA 5FZGA 1YI7A 1W06A 2WRAA 2X5IA 3PLQA 2JDKA 3TNPB 1OH4A 4V1PA 4PDWC 1QQP2 4QQPA 4CP9B 4DNYA 5C3RA 2R062 2E63A 3W5NA 2QBXA 4ATEA 4BQ2A 3RZHA 5JXIA 3ZYJB 4XQWA 1FNZA 1FX5A 1VRH1 3N7MA 5I0TA 2D43A 3CJXA 1J3QA 2VZUA 2W1QA 1PX3A 5HI0A 2V5DA 4OULA 4DUWA 3SKVA 1OA4A 3KGZA 3TYJA 4W6YA 4I3PA 1EUUA 3ZR6A 4WVWA 5L7OC 4AFBA 4FP3A 3HOBA 2B4KA 5FQ0B 4AEJA 2JICA 4M3CB 5FZ1A 4YPJA 1LHWA 1D2QA 2KA3A 3APBA 4YW3A 1QXRA 2P5BA 2PHTA 3MO4A 4V2VA 5T5JA 3OUJA 4D6QA 4JHZA 1O3SA 3JBG2 3TN91 2W08A 4A7ZA 2JDZA 3O1UA 2A3YA 1GSLA 2WNUC 2X09A 1ULPA 1UPIA 2I45A 4FAHA 2ZHNA 5JOYA 4QMAA 4B8EA 2VOVA 5LY2A 5DZGA 4AVBA 1IG0A 1ULFA 2XLGA 2HJIA 2ORZA 2WQZC 1GLHA 3HBKA 1Z7S2 4P9WA 2Y6JA 4QKDA 3UKTA 1ZRCA 3SNMA 5BY5A 1UZ0A 3NV1A 4XQ4A 4CXWA 4CCMA 5LBFA 1NX9A 2ZHKA 4Y1VA 2VE1A 3WW4A 5BNOA 5J09A 5J48A 4JQTA 3RZLA 3T3YA 1U5XA 3J7MA 4LBKA 3THTA 3WQBA 4BB3A 4D7YA 3U14A 2WT2A 3L2HA 1S0DA 3H9AA 2BNOA 3F95A 5KHJA 5FY5A 1OKQA 1YQ2A 2VQAA 4NRPA 2C6SA 1RIRA 3A0NA 2ID4A 4MGSA 5HV0A 3LDBA 1BQPA 1QOTA 3ACHA 2W3JA 4JDOA 5IAVA 3SCHA 4AHZA 5A3MA 3C2UA 5JUVA 3Q8BA 4HT1T 4MGIE 4NROA 1EPWA 1C8M2 3AMQA 1VRH3 4QXKA 2IFRA 4NIHA 4Y5Z0 5CFDB 4GD4A 1UQXA 3BTYA 2G9GA 3NJZA 4XEZA 3I3EA 1CAXA 1OI6A 3WDYA 1YFYA 1AUYA 1LENA 1VB2A 1QJX2 5C4WC 1Y3TA 4Y1XA 3B3QE 1OA3A 2WABA 4D69A 2UURA 2BV4A 3V0AB 1AR61 3UGGA 1AYM3 2PHFA 4Y4RA 3WF2A 3WP3A 5BNQA 3FE5A 2YU1A 3VBHA 2QQVA 4WVMA 3C7FA 4C1WA 4A4AA 1AR83 3VKMA 3BOPA 4XUQA 1GFF2 3C7EA 1C28A 1X7NA 4RN5A 1YRZA 2HBUA 4AVVA 4KI5M 1HN1A 1REDA 1QMJA 4AHYA 4XF0A 3WT3A 1LOFC 1R1A2 2B46X 4LIUA 5F3EA 1HB4A 3UGFA 2J1EA 4XCBA 5DG1A 1RMU2 3T2PA 2A5ZA 5FYIA 4BIOA 3T09A 1SBDA 2XKOA 1CAVA 4L99A 2WA3A 5C3OA 1IS4A 1NCQA 2HEVF 4TLFA 1LHNA 3OGRA 3VBSA 2GP5A 4FQZA 3NV3A 3B5LB 1HRI2 3GZEA 4GJZA 5DAQA 1JHJA 1GV9A 1W8FA 2BU9A 3HNYM 2WO3A 3SHRA 4BPZA 3WDUA 2BP6A 3Q8FA 3VBFA 1NT0A 4X6QB 1WW6A 2XL7A 1YC61 1O4ZA 5B2GB 4PJYA 1FNYA 1GP6A 4HANA 5BNPB 4DIQA 2Z79A 1F4HA 4BZ4A 2XR4A 1XOYA 3T30A 4DZGA 2D5HA 1ENRA 4AYUA 2KXLA 4FPHA 4KWJA 3LE0A 4LORA 3FLRA 3ASIA 2Y6GA 2R071 1GWMA 1Q8SA 1XNBA 1YXWA 3IM0A 4XBQA 2D93A 5EJ3A 3I59A 5FMDA 4E2SA 1M06G 4P9YA 4QDRA 4Z07A 3H3UA 3NNLA 4PT6A 1RHI1 2WSVA 2Y38A 4DRRA 2Y26A 3LD8A 2WL1A 4KNCA 3I3QA 1JXNA 3VD9A 2HWF2 1AR63 1RVF3 2UU8A 3JXSA 5AC91 2HWC2 4NVPA 1JU3A 1PIV2 3J7HA 4I30A 1MS9A 3H8RA 5A32B 2I74A 1PO11 1W28A 3PTYA 1RGSA 1W0NA 3LDRA 2CGNA 1CPNA 4PI0A 2DVFA 2PHXA 1SPPA 3TNQA 1VBB1 4JGYB 4XDOA 3VBOA 1CIWA 1DQ1A 1BLZA 2VNVA 2XUEA 1S0GA 3N7JA 5FY1A 2D7FA 1HRV1 1XNCA 4Q27A 1C5IA 4JV4A 5FZ8A 1MR5A 4FOYA 3B7MA 3T2TA 2WYFA 1N1YA 1EAH2 5JXHA 2AZ5A 4GH4A 2BW8A 3C8XA 3K51A 3PVOA 4NRQA 3HN3A 4QX7A 2Y0OA 4WBBA 4BMEA 2JENA 2QQIA 4F3JA 1QJY1 2G9FA 2OXBA 5B4XA 1UMZA 4BQ4A 4NIDA 4WZCA 4MYEA 2O1QA 4LITA 2D97A 1NA1A 2ZGQA 1DQ0A 3IDEA 3M4FA 5IFTA 1H9WA 4C90A 2ZEWA 1HQWA 2FDHA 4S2FA 2CWSA 3ZDVA 3HBZA 4W65A 3WF3A 5FP3A 4ZY9A 2DU1A 1LOCA 2A6XA 2AH2A 5CFCB 3N7KA 2PELA 4ASLA 1XNAA 3H3LA 1MS8A 1S4CA 3USSA 4AFDA 1JZ7A 5JZGA 2NMNA 1DQ2A 3PJQA 4M3CF 5GZFA 5H9PA 3KMHA 5EYYA 1UY4A 3T4VA 1LU1A 2J1AA 2XBO2 2ZKLA 5BUVA 1H2KA 3B00A 1PVC2 3SEEA 2VOXA 1C1LA 1NCRC 1YQCA 5FY4A 1GOGA 1JH5A 1RHI3 4I01A 5FMOS 1JYCA 1KQRA 2PQSA 3B93A 4UT5A 5GLTA 5JSPA 4KMQA 4P14A 4Q0UA 4NAMA 1E5HA 5A7PA 2B9UA 5J1XA 4IE6A 1VAMA 3N35A 1PMJX 2RV9A 3FHIB 1C1FA 1PO13 2JE8A 1PHMA 5GZEA 2UY8A 3UYJA 3CO2A 1PGW2 3FHQA 4OHWA 4O61A 3KT1A 1W39A 2D98A 1VBB3 3J7NA 4I09A 1R083 2DTYA 4HXCA 4R9DA 1D7PM 4P9GA 2J1RA 3GCXA 4RQPA 1R64A 1FAYA 1XNKA 1YFXA 3PTRB 1HRV3 2K46A 4QX5A 1VIWB 2MEV2 3KV9A 2BDRA 3V0BB 2YXSA 1D0HA 2VMCA 4K7JA 4QGMA 3DYOA 1AYN2 2PAKA 2ZJCA 3TBDA 3WF4A 4WZFA 4MGYE 3TN92 3OYWA 2HWE2 1RUE2 1PX4A 4MV2A 5FYBA 5T55A 1V6MA 1W6OA 3TB0A 2VQTA 1D4M2 1Q3EA 2VBPA 2ZAHA 3EMRA 3H1WA 4FQ4A 1W6NB 2EA7A 2Z4FA 3DPRA 2GC2A 4YW7A 4YYOA 2DYCA 4IUGA 1W9TA 3NV4A 3SITA 3VBUB 3JZVA 3WHTA 4MXWA 5FIXA 4XTMA 5DUUA 4UFLA 5DUWA 4Q8KA 3CHXA 1TMF2 3ZKYA 1RUH1 2WINB 4IV3B 4NHLA 3PJYA 3JB8A 4NUBA 1VBE2 2C9KA 1UIJA 4WM7C 3O1RA 1B35B 3ZFGC 3E5UA 2VCAA 4Q4V3 5J7MA 2ZOEB 3KHBA 4IL7A 1SLAA 2RDRA 1D4VB 1JS9A 1LNSA 1O3QA 3MUZ1 3HN1A 1DZQA 4P00B 3A4UA 1O8SA 2VQ0A 4LK6A 1BBT1 1KFXL 4S2HA 3ZFEC 1GQHA 3AFKA 4PIYA 5F5AA 2PHWA 5G04L 4B1LA 4N9HA 2ZPXA 2E26A 4OFGA 1WWYA 3AZVA 4P5HA 3VDDA 1JYWA 1O4YA 3ZM8A 1W2NA 1OHFA 2VOKA 2YC4A 1S2EA 3KT4A 4OMCA 4CEWB 2RVAA 3V64A 1NXMA 5E1RA 4CU7A 2A7AA 5C3SA 4IERA 1UX7A 5T5LA 5A1LA 4HLTA 2OVUA 3FMGA 3A23A 4ARYA 2BFUS 4HOOA 4EE2A 1BEV1 5CA6A 4LNVA 4CCLA 3DECA 4D8MA 1J1TA 3EYPA 5FXWA 1ZBE3 2P3IA 4YW2A 4MX3A 4EN6B 3K75B 1LGBA 3BTXA 4XFFA 2FDKA 1BMV2 1JYTA 2SLIA 3CEWA 4QPIA 2G1MA 1WA4A 3NSTA 4QQHA 5EZWA 3SKJE 5C8CA 1A8MA 3ZPYA 2VY0A 1JZ3A 4FTEA 4PDWB 4BOWA 3ZFFA 1TME1 4KGGA 4XJWA 2BJSA 3EQEA 2QQKA 2CGOA 1KD7A 2DCZA 3VLBB 5KXDA 3HNBM 5JPMB 1UMHA 5ACA2 4XFCA 1YJKA 4AI1A 5LRRA 4BM8A 4HPKB 1IPJA 5ANNA 1VR3A 5EYXA 1F15A 3WLUA 5LW9A 3POBA 1G9DA 5LK5A 5IW0A 3RI9A 3ZO0B 2RMU1 1AX2A 2GU9A 4YFWA 1O5LA 1IGOA 3ZSMA 5L7OB 2Q4SA 4LO7A 2JG8A 3ITQA 3HJRA 4Q0PA 3WX5A 1UMIA 1OT5A 3OJBA 4CCCA 2IWGB 1DF0A 3POIA 3MV11 4J25A 4YW1A 1BBT3 1OD5A 2AEZA 2FZ2A 2DFBA 4LBQA 5FBZA 5FCCA 2GC3A 2W1UA 1V6NA 4K40A 1CZTA 4RGGA 3P1IA 4Z1VA 3WVJA 2WJSA 1DLLA 5FRAA 2VUDA 1JW6A 4OLLA 5M0TA 2WNUB 4K20A 4QQLA 3MF9A 3HD8B 2QNKA 4P5YA 5BNNC 4JKLA 3FLPA 5KC5A 2XJVA 5FY9A 3LDKA 4AHWA 1REFA 3T1LA 4N7IA 5FAXA 4WM8A 5IUQA 3D0JA 3GDBA 1WZXA 5K9YA 1PK6A 5IK8A 3PVNA 2VAUA 1BEV3 5KXEA 2GMPA 3K48A 3ZOIA 2FMDA 1H2MA 1C57A 4W6WA 3LCPA 2HWD1 3VHNA 4AGRA 3HEIA 2V4VA 1GQGA 1E57A 1RC6A 4BLIA 4Q4X1 3O0VA 2VW1A 3P6BA 1CIYA 3I8TA 4HVQA 3AXEA 5IT6A 4Q4Y2 2OA2A 1J3RA 2YBKA 4CE8A 2PLV1 1A8DA 3D8CA 3J8F1 1N3PA 1RJ8A 2XH6A 2ZEZA 5LA2A 3ZXEA 1D0GA 2DCYA 3POYA 1ENQA 1TME3 3WOGA 3UK9A 2PHRA 2B45X 2K2SA 2IVJA 1A34A 1H2LA 2D3RA 3GBFA 4HKLA 4AOCA 2YFUA 4BHPA 5IVJA 4RD7A 5F2WA 1A3KA 2BNMA 2OT7A 1SFYA 2Z5WA 4JVAA 4UBGA 1MS4A 5FZ0A 3O1MA 2OUHA 2EXJA 2IXIA 2RMU3 3MUY1 4CEYA 5C4WB 2RS31 3GZTB 5FK8A 3UNPA 1RL3A 2VM9A 1RUI1 1AVBA 1COV1 5EWSA 5LEJA 2W5FA 1AXKA 2IFWA 1GNYA 4HSLA 2VZVA 5IYYA 5DDJ1 3S7EA 1AR72 2IXJA 1X36A 2RS51 5IVVA 4IEXA 4LJHA 1VRBA 4QGLA 4DUVA 5BNPC 1F2NA 3HIFA 3I2HA 3KV4A 5CZKA 1N1SA 5GLVA 3ZXAC 4CPBA 2ENRA 2QVSB 5FZ7A 3ZPOA 4DEVA 4CCOA 1GR3A 3A7QA 2WT1A 1S0BA 1Y7BA 2VCBA 4DS0A 4LKDA 5C5UA 2Q8OA 4UXAA 2VCMA 2EF6A 2D6LX 1RXFA 2Y33A 2YV8A 5HXVA 4Z2AA 1ND2C 4CZSA 1V9U3 4OZXA 1BK0A 1QOOA 2CYFA 3MGUA 5FOBB 2WFPA 4Q4X3 1OQEA 4MHRA 1RXGA 2IVIB 1VB4A 1OVPA 5SV5A 2D6OX 5IVBA 3J8F3 5FR3A 1XU1A 4LULA 1PZ8A 4LHLA 3H1YA 4JGYC 1XNDA 2G19A 1O3TA 3N9LA 2EICA 4RHV2 3W58A 3MEPA 3N4MA 4HMZA 2ERFA 1KDKA 1QGLA 5A7NA 4NPMA 1VBD1 4PF1A 4HK9A 5DN2A 2IXCA 4JTNA 4DXSA 3VD4A 4Z2WA 2R7EB 4RGAA 2W92A 5DAWA 5FZ6A 2RDSA 5C9AA 2VOWA 2WSUA 4FOVA 4I0BA 4C1XA 5KXCA 2WAOA 2FDGA 1XE8A 1RUI3 4EZ4A 4LHKA 2JB4A 1YHFA 4LUMA 4JGZA 4DEQA 5DG2A 3ACLA 5F39A 4NRMA 5FZFA 2A6YA 2RS53 2ZA9A 1RUH2 2JEMA 4FPLA 3CBNA 2OW4A 3PNAA 4KWLA 4CDUA 2GALA 2JIGA 4XW3A 4OI1A 1CD3G 2J42A 1LESA 2D6PA 4K6BA 4XJZA 1ULGA 2ZX0A 4JAAA 3RQ0A 1DZTA 4AI9A 3GM8A 3VD5A 2J1UA 1Y9GA 5KHHA 3VBRA 2WZR3 1UZYA 1WW7A 5KWRA 1SLBA 5LY1A 1K42A 4IE5A 2QDNA 3P3PA 4H3WA 4NHKA 5LCWL 3FFZA 1VBC2 1VMHA 2W1SA 4XTPA 5CIRA 1O4TA 4IE0A 2D6NA 3UV9A 4CCEA 4YZ3A 3BN6A 3PUAA 4UF0B 2XJTA 3MIEA 4Q4W1 4O65A 3I3MA 1J59A 3UL2A 3MPBA 1OH3A 2R042 2L9LA 1OVSA 3AXDA 1H6XA 3DL3A 2HWB1 4INDA 4QX8A 1VE0A 2RJKA 2F4LA 1G6NA 2JDPA 2GH2A 3LAGA 4Q29A 3RPQA 1IS6A 2F17A 4AZZA 1MQTC 4GMP0 3S5QA 1OC1A 4NJ4A 1YI9A 3BU0A 1Z7S3 1NY71 5EFUA 5LATA 3RI8A 2XL9A 3NMBA 3NVCA 2DBNA 4FO9A 5ISLA 3JU9A 5C3QA 1GICA 5FYUA 4CVUA 1P8JA 4XETA 1J58A 4HKWA 1NCRB 4CDWC 3FC0A 4XFGA 5GZDA 1NZCA 3LWCA 5BV6A 4BQ1A 5EJ1B 5FYYA 1SDDB 1IOAA 3IIIA 3RZGA 2X53S 4FPKA 3KV5A 4XUPA 3NKGA 4IEUA 3S7IA 5FP4A 5D8AC 2NM1A 1UD1A 3NJYA 3U4SA 3D82A 5LA1A 4NMIA 3AYAA 4LQRA 3E5QA 3PUHA 1W99A 1MEC1 2EAAA 3OUIA 2FMYA 1FPN2 4BJ0A 3ZYBA 2Q1ZB 5FREA 5IJRA 3ZXLA 4XYXA 1C8M3 3NAPC 1OOPC 5DQ0A 5T5PA 1C3HA 4M0HA 2OPWA 4W8JA 1H8VA 1WLTA 1O8PA 4CP9A 4URAA 2SBAA 4E4HA 1OFSA 1XC6A 4A2UA 4CU9A 1R091 4Y20B 1VP6A 2Y8KA 5FLJA 1S0JA 4YM0A 5HCBA 4YG3A 4ZPIA 2WQ4A 3WUCA 1W3VA 1YCIA 1B09A 3URFA 1UN1A 3MLJA 4Q4W3 1NQJA 2WC2A 4UYBA 3UT0A 3AL5A 4CEWC 4L0PA 2YGLA 3VGIA 3V65A 3IN9A 2UWBA 4XJ9A 1GNZA 4YGBA 4OUEA 3MHZA 3U78A 1K5JA 5FQ0A 2ILMA 3R4DB 4M3CA 3IDAA 5JVVA 4OUSA 4D7SA 2X05A 4WM7B 1RMU3 3ZFGB 1HDKA 3MW3A 4CP1A 2IUWA 2XKPA 1RUD2 4C0HA 1MZEA 5IVYA 2KR2A 1XYPA 2P17A 2WFF2 1PO22 2J22A 2PLV2 1QXPA 3O5SA 1RTVA 2BTVC 1MVQA 4EV0A 3VZMA 1TNFA 4JZRA 4DXZA 3ZFEB 3AJYA 4N7UA 3WF0A 2VZSA 1TQ5A 3D6EA 3PIGA 4FP2A 4OMDA 2ZABA 4JRAA 5FZOB 4S2GA 4E8CA 1QU0A 2QQPA 2YYOA 1XU2A 4Q1PA 2WWUA 3ZVXA 4E9KA 5KR7A 1OF4A 1QEXA 5E89A 5DPNA 4LBQD 4QD2A 1MEC3 3SXWA 1S1AA 4N90A 5GLZA 1GBGA 1RUC2 2P3KA 2WUHA 4EWEA 1GU3A 4YLZA 2HBTA 4AHXA 3J26N 4FFIA 4RR3C 1ONAA 3H8UA 3N9PA 2V72A 1FMD1 4GB32 4N43A 1W9SA 1F9KA 1XXNA 2WIIB 4LKFA 4Z92B 4YW6A 5A7OA 3QACA 3ACFA 5DDJ2 1PGL1 1AYM1 1R093 1CWPA 1RUJ1 2WN3A 3FLTA 2P1BA 4YSFA 3ECQA 2V09A 1HQNA 5C8WA 3ZN5A 2VZ3A 2PAEA 1AR81 1CVNA 2FQPA 5FPLA 4JDNA 3EXUA 2ARAA 4MGQA 4YVWC 5FXVA 1AL21 2VD7A 1AR92 1I5ZA 5FZ9A 1H8TA 3P3NA 1UWWA 4LUKA 3KV6A 4FPYA 1ZRIA 4AFCA 4BK5A 5K8SA 3WDXA 4LOSA 4XDQA 3OPZA 4EWDA 4QKBA 4IDZA 3ZSKA 4YNIA 3V0AA 4RS5A 3M3QA 3GHNA 2DVDA 2VXJA 1LEMA 4A42A 3D4KA 4K1ZA 4BU2A 2YROA 4HK8A 3BI3A 4P9XA 3HNMA 3OF1A 1CX1A 2D3PA 1OXCA 3GXUA 1EAH3 4A44A 1CAWB 1BVP1 2AEYA 2C1FA 4QPGC 5J36A 4Y4YA 1ODNA 3BVCA 3POFA 2VG9A 3AK0A 3VKNA 4DXTA 3FJSA 1TG7A 1WCUA 1HJGA 2WZPP 1AJKA 1JOPA 5F37A 1UL9A 5BNNB 5IAXA 1IPKA 4PBPA 1OBNA 1W0PA 2ZZJA 1DQ5A 1SDWA 4AAPA 3AYCA 1W8OA 3I3DA 4XHBA 3CNAA 5HCFA 1WLDA 1LKNA 3FBMA 3WDTA 1BVVA 4E4ZA 5T3NA 1OLRA 1FMD3 2RDQA 5A80A 2XHNA 1LU2A 2XBO3 4UOJA 3KGLA 3O7OA 1GZCA 1RVF1 4P08A 2D6MA 4OHXA 3I54A 1RUJ3 2VMDA 1H9PA 1ALYA 2Q8EA 3MF6A 3AX4A 3U1XA 4C91A 4QAWA 1UYYA 1UF2C 2QUOA 3FL7A 4MZUA 4H7MA 1AL23 3WG4A 3QLQA 1LHOA 1W8ZA 3AVRA 4OQ9A 1ZZ8A 2RR11 1UW8A 1ASJ1 3E1F1 2ZX4A 3ZXFA 1WMFA 1QDCA 4ZKTB 3JCIA 5H9SA 3LSEA 1K5MC 4EZHA 2PHDA 2ADDA 2JD4A 5HBAA 1KRIA 1WUVA 3VZKA 4KG0A 2CTVA 3OBZA 5A32A 3LIHA 1APNA 3ON7A 4N53C 4S2DA 1RB8G 2MEV3 3AKQA 4IEPA 3RSJA 2C24A 2VUJA 4ASKA 1SLIA 1HXS2 4JGYA 4ES8A 4AVSA 1DDLA 3TEXA 2ARBA 2E7QA 3LSDA 2GNTA 3LGRA 4QXBA 2RM22 2PN5A 3TOJA 1RUF1 2HWB2 3I2IA 4D7TA 4EN8B 2ZX2A 4R9AA 2VBBA 4MLOA 3RYKA 1UX6A 5DUVA 2IXKA 1HLCA 3CU7A 3VUOA 2LTNA 4QXHA 1RUG2 4CSWA 4WV8A 1U5YA 4O9EA 1DYOA 1DZRA 1GNHA 2XJPA 3PMSA 3ZXDA 2WLPA 1GOFA 1S0EA 4IEVA 4Z82A 3UJOA 5T5OA 2PAMA 2XJSA 3WZ1A 1ODMA 5FDBA 2YUEA 4LBLA 3SISA 4XFAA 1YEWA 2BERA 5LK7B 4XCAA 4QPYA 1ND2B 2JG9C 4JDMA 3Q8EA 1LOBA 2XGXA 3AKRA 5FMCA 2VXRA 2QFEA 2ET7A 2DV9A 3SMHA 4XF1A 1MS1A 2VQUA 4L2NA 4M00A 4O7XA 2YGMA 4AE2A 5L19A 4OHZA 5CFCA 4TZDA 2FD8A 3FFQA 3KM5A 4HETA 3ATGA 3GJAA 1NG0A 2WKKA 3LZZA 3SQOA 2Y64A 3KCXA 1S55A 2HEYF 3N9OA 3OY8B 5APAA 5F1RA 1JZ2A 2YDEA 2I2SA 4NOTA 5LA0A 1R081 5F9TA 4KBBA 2RR13 5JIAA 3O1SA 3ZLIA 1ASJ3 1F35A 2DCKA 2WZEA 3E6DA 3LIGA 3TEYA 3ROUA 3BALA 3LEKA 2CWMA 2ARCA 2D40A 4BQWA 4YW4A 1GZWB 3WNLA 5EXOA 5A1AA 1XBFA 2ZBJA 1AXZA 1OFNA 3FUOA 1YWKA 1QJFA 2GAUA 1IG3A 3POSA 1QH6A 1EV11 1IKPA 1LR5A 2J1SA 1JYVA 1OSGA 3AP5A 3RVHA 1I5PA 5FPUA 3NJXA 1WKYA 3SCFA 2OPKA 1AZDA 4M4PA 3VN4A 3NW4A 4AR2A 1ZRFA 1Q56A 1RUF3 4LTAA 3ZSJA 3GCWA 4UWDA 1CZSA 4CXXA 4UW6A 4IEOA 1OURA 1LECA 3VBFB 3GYDA 3VZNA 3V0BA 4MVTA 2A3XA 4J6GA 2WNVC 1KGYA 5FMBA 3TEZA 4Q0VA 4Q4V1 3AC0A 5FO8B 1ZBA1 4BMBA 3MIHA 5BYNA 1NUKA 4IEYA 2QTWB 4ZZ8A 3KZ4C 3ZYGA 1Y4WA 2PHUA 3OPWA 1NQDA 1W6NA 4RYDA 5F5IA 2YBPA 5IVCA 1DGWX 1LODA 3RG0A 1QWRA 1DGWA 1W2UA 2CAUA 4LLFA 2BVVA 3C7GA 4NWVA 5FP7A 3WXPA 4XF9A 2VZQA 3VBUA 4U36A 4IV1C 2GDFA 2JXAA 4GMP3 5H9QA 3A21A 4IV3A 4YVSC 3VDAA 4FT8A 1B35A 2P3YA 2VNGA 1VRH2 1GMMA 3J4UH 5A3NA 2VUAA 3LOBA 3GHMA 4QQOA 1Q8VA 5LWBA 4QQ2A 4NN0A 5DZEA 2ADEA 4HBNA 5FWEA 4MGTA 2UWCA 4FAGA 1UY1A 1MQTB 2RJ2A 1ACCA 2ZTNA 5AFEA 2XHKA 3OG2A 4XXAA 2QE3A 1VBA3 1YYNA 5A7WA 1SQ4A 3AP7A 2LM3A 1ZBE1 2IC1A 2RDNA 5FTTC 1CX4A 4CEWA 1DQ6A 2ZEXA 4DUXA 1W9WA 5FO9B 3AP4A 3KQ4B 1MS0A 1PM4A 1EV13 2I07B 1UAIA 4CDWB 4A6SA 1UZVA 2CY6A 2BEOA 3MIFA 3ME2A 4X8NA 1LJ7A 2P34A 1HX6A 1H1IA 2NN8A 2QQMA 4AEDC 1CONA 1X9TA 3WSOA 1UPSA 4DB5A 3A22A 4AVCA 1ZREA 5JI7A 4NIIA 1Y9QA 3LA2A 5D8AB 4FTSA 3KF5A 5KHIA 3AVSA 4GAZA 2NPIA 5AVAA 1JZ4A 1UZZA 4FSJA 4YZ2A 3WF1A 4ET7A 3NAPB 4QGNA 5FYSA 4CU8A 1OOPB 2Z42A 4A41A 1OF3A 2XG3A 1ZBA3 3CJIC 2XVGA 3LPGA 4PDWA 2VMFA 3A0KA 4R4ZA 1ND3C 4ZU4A 2LS6A 4HN1A 3ZYFA 2PXJA 2XMLA 3D0SA 4KG8A 5G05L 2YPDA 1JOBA 2VR4A 4AVTA 2DU0A 1IPSA 3KS7A 4FPJA 4TYSA 4HPKA 4YM3A 2BGPA 4AI3A 4EYUA 2YY1A 1W0OA 1OLQA 2VU9A 2ZXQA 3WCRA 3U4XA 2RE9A 4XAAA 2K9ZA 4YZ5A 2OQ6A 2RG4A 4JRLA 1JN2P 4MGZE 2LW8A 5J37A 1HN0A 3IPVB 3JQXA 4M01A 3ZMNA 5KHGA 5L7OA 3M1HA 4Y3OA 1W8UA 4ZU5A 1XSRA 3LFMA 4PQ9A 5K7PA 5CBLA 1M4WA 2NYYA 3QOPA 4CUAA 1AR62 1RVF2 1JMUB 4H55A 4YW5A 4BE3A 1H0BA 5GKAC 2B39A 2WNUA 4QX2A 4AQTA 3VB9A 3UKVA 2RS11 2TNFA 4UFMA 4EJRA 1W6MB 4GKYA 4OVEA 3ZYIB 5JIUA 2WS91 4AK3A 5JSOA 3WCSA 4A7YA 1SLLA 1XE0A 2YC0A 4PF5A 1S0CA 2P6HA 4TLGA 1UKRA 3ZMOA 4AL9A 1ULEA 1LGNA 2YPJA 4NHXA 4PHZA 4LE3A 3K3NA 4I0WB 5JAXA 2W46A 1IQAA 3QH6A 1L7RA 3UESA 5CKMA 4LR4A 2FCTA 3OD0A 2X8KA 3BKZA 2VUCA 3QH7A 2IXHA 4IEQA 5K0UB 4RR3B 4H7LA 1GOHA 4JC1A 2JJ6A 2N7GA 4TXWA 1Y9MA 2XB6C 1YQ5A 3CZJA 3MI8A 5JLVA 1NKGA 1HB2A 1V70A 4KGQA 2MPFA 3NO8A 4CRQA 5EHDA 2R30A 3WNXA 1DYPA 1FOD3 1W6QA 2O0OA 4I3GA 2BGOA 2VULA 2WZ8A 4CDXC 4E2GA 5JMOA 5L36A 3BUCA 4YVWB 2A3WA 1DBNA 2VH9A 3P5BA 2V73A 4DY3A 2X5IC 2Y0IA 5KC6A 3AYEA 3ZSEA 3K2OA 4UAPA 1TE1B 5E16A 3T0BA 2C9AA 5C4WA 2JDYA 5F6LB 2R072 1AL0G 4Y22B 2H6BA 4LHSA 5BPXA 2XXZA 1BYHA 3ZKUA 2ZGTA 3MW2A 4SLIA 4XJUA 4ZS2A 2QQLA 3ES1A 5CFDA 4FXKB 1RHI2 4JKMA 4QPWA 4AQSA 4B1MA 1XNTA 4AFMA 2ZX3A 3SEPA 4UFKA 1V9U1 4LOTA 3WEZA 3OEAA 5AC92 3RYRA 1AF9A 4AEMA 1GQPA 1NZIA 2JECA 4AI0A 1BXHA 1N47A 2RS13 1PO12 4QPGB 4UI9L 3MW4A 2XONA 4J1WA 1LOFA 1CAUB 2WS93 3OUHA 4HVOA 3WNPA 3K3OA 1VBB2 2Y6HA 3PL0A 2A73B 1R082 5LEKA 2UWAA 2HKXA 2W94A 3B02A 3ILNA 1JZ5A 3NQHA 2WBKA 2ZGSA 2BQPA 5A7QA 1WA6X 3NWKA 1NAEA 1UXXX 1XE7A 5C6CA 1HRV2 4LT5A 5A3PA 1JYNA 4Y1YA 1A6CA 1XYNA 4IEZA 2EIGA 5H9RA 3CF6E 2OZJA 5T50A 5HPOA 4W4ZA 1QJY2 2F6BA 3B69A 1ST8A 3EBRA 2X29A 2VZTA 4LK7A 4NWWA 3NNFA 2WYSA 1H1AA 2E33A 2J1VA 1X8EA 1DCSA 2YFZA 1ZM1A 2QQNA 5FYZA 5BNOC 3LEMA 2R1BA 1W03A 2JG8B 4IE7A 1QJU3 1QQP1 4XHXA 4E4SA 2VVEA 1BZWA 3AJZA 4LMFA 4GWIA 2R061 4NO4A 4XVHA 5D21A 3WW2A 2J7MA 3O1TA 3TRSB 2DF7A 4Q4V2 3KSCA 4K21A 3WDWA 1U0AA 3RWKX 1FPN3 1I3HA 3RZKA 4XILA 4YFZA 1K5MB 5JSRA 2WR9A 4XMIA 2BRTA 1J3PA 2WZR1 5KHKA 1DGRA 1WLWA 1LTEA 4XC9A 5TSWA 2XJUA 3NL1A 2XOMA 3WHUA 4N53B 2FDIA 1Q8PA 4XF4A 4M4RA 2JE7A 2IZWA 1OMIA 1LEDA 3T0DA 2YHJA 3WNNA 3BIEA 1BKZA 3ZYHA 1WGPA 4CDQB 4ZONA 2OUJA 3DUIA 4DQAA 3Q8AA 5J98B 3JBG1 4QB1A 5I91A 5JOWA 1SACA 4LBNA 1QXJA 2VMHA 1W9FA 4AW7A 3VBHC 3MBWA 1V6KA 1UOJA 5T54A 4DPNA 1YQ6A 4P9LA 4X6RB 3S5AA 1STMA 4YG6A 1CJPA 3JD73 4H2AA 1V6OA 1Z7S1 1S2KA 3VKOA 2DCTA 1UYPA 2JKXA 4GALA 4DRVA 5FBJA 2Y60A 4FPEA 4FXGB 1AJOA 4KU7A 4XBLA 5CU1A 3ZSLA 1SHWB 1C8NA 2NLRA 2ORXA 5LASA 1UYXA 4D6RA 3C3VA 3OPTA 4Y5TA 5CYYA 1RINA 4RGKA 3SLIA 3ILFA 4B4PA 2FCUA 1E5RA 1PO23 2JG9B 4QB2A 3THPA 1NCQC 3VBSC 4IGQA 2AR6A 5I8TA 1ZA4A 3B94A 3M3CA 3I4IA 3T2OA 3GBWA 3T2QA 4AQ2A 2ARXA 2HEWF 4B7KA 1DQ4A 1SBFA 1OA2A 1QQP3 3DCQA 2W9XA 3RGBA 4KBZA 2R063 4F8AA 3VBFC 5F2SA 4Q8LA 1W9YA 1OKOA 3GGLA 3WV6A 3KF3A 1C8M1 1NCRA 3DYMA 5C7GA 4G9SB 5IK4A 1G7YA 2O8OA 1RUC3 4BCUA 4B4QA 2P3JA 4E27A 1PZ9A 3C7HA 4I02A 4A6OA 5IFPA 1G9FA 3POGA 1BBT2 2AACA 1QJX1 2E6VA 1W2OA 3OCPA 3IDCB 1CESA 3FZ3A 5A6QA 5JXJA 5JR7B 1JUHA 2B9VA 2VNRA 3H7YA 4EN9B 1JHNA 4AI2A 5LZ6A 4CUCA 1POQA 4CYDA 1LRHA 4LBOA 1G8WA 1HJFA 1QNWA 2ZGNA 3PVEA 4Z8BA 4Y1UA 2GP3A 3JBG3 3VD3A 3GNEA 4LEJA 5L9BA 4FFHA 2DBIA 3IKWA 1DGRN 2VZ1A 1V00A 5DAVA 4R52A 1BEV2 4Y20A 3WR0A 3HQRA 1KJLA 3WDVA 2X10A 2LRPA 1R1A1 2WNVB 4QU2A 3W20A 3RZMA 4LLOA 1RMU1 3AMHA 3VBOC 1QNYA 1W8TA 3TEWA 5EIYB 3K4ZA 1OD3A 1ENXA 1U5ZA 2V4AA 1HKDA 5I8YA 4YARA 4KU8A 3CKHA 4FOQA 5J3UA 2MHFA 3HMYA 3USUB 1HRI1 5FWJA 1SLTA 1X8MA 2ES3A 4GH4C 1LGCA 1J83A 3PURA 3N3HA 1TME2 5IVEA 4IV1B 1ZZ6A 4YWAA 3HPNA 4L97A 3SCGA 5IATA 4YVSB 1I6XA 4XFBA 1V0AA 4WM7A 4PQQA 5FP8A 5LBCA 3MFCA 3ZFGA 3MV01 4RA0A 1PZ7A 1NA1C 3INAA 4AQ6A 3RFRA 4ITCA 5SV8A 2ZHMA 2VGDA 3HVDA 4LIVA 5A6ZA 2RMU2 3VDBA 3I2DA 3AMPA 3OGVA 3ZFEA 2HYKA 3FUQA 2XQRA 3POJA 4M3CE 3BODA 5FYCA 1W8HA 3FHAA 2UYBA 3JUUA 1MACA 4N9IA 5JCTA 3EB7A 5FZOA 4AXOA 1QDOA 5JZGC 2VBDA 4Q1RA 1YQ8A 1QJX3 4XZPA 1W3XA 4M0NA 1BJQA 1EP0A 3IMNA 2WDBA 5LB6A 1LULA 2HWF1 2RJLA 2PTMA 5E88A 2HWC1 2VMIA 4MXVA 5F7UA 2BNNA 3AKSA 3DXTA 1L7QA 3WQ0A 1F4AA 4K9SA 4AEDB 5F3GA 5FZKA 3D5OA 3WINE 1KS5A 2DUPA 3N9QA 4YGEA 2CV6A 1UU6A 5FUPA 3VHOA 4OQ8A 3RMYA 1E5IA 1AHSA 2V5YA 1R1A3 1WBLA 3AMNA 3ZN4A 2HWD2 1H30A 1TVGA 1V9U2 2DVBA 1YUDA 5FZEA 5FY7A 4D94A 1ZZ7A 1EAH1 1SCRA 2W2IA 2G9ZA 3CQOA 2FBEA 4Q4X2 3CJIB 4Y24A 3U07A 4RQPC 2BWAA 1ND3B 1RITA 4TN7A 5GJ6A 3I97A 1URXA 2QKDA 4BQ3A 2OZ6A 3J8F2 3K4DA 3WG3A 5A33B 2R49A 2ZACA 3IBMA 2ZEYA 3QBQA 5ABJB 1HRI3 4COYA 4BDVB 2HYXA 2GNMA 4CCJA 4CUBA 5AFBA 1C4RA 2Q1FA 1EYBA 3KHCA 2E7TA 1JI6A 1QIQA 1WW4A 4ASMB 2EVXA 3ZN6B 2FDJA 1NXD1 3DPRC 1X50A 3W59A 5B4NA 3ZIWA 4AVAA 4B29A 1CAWA 1T2XA 3OBTA 1SCSA 3PUIA 4U2AA 3ILRA 5I0SA 5C5TA 3CMGA 5K0UC 2RS32 4JX0A 3W9AA 5I93A 3RZJA 2VVFA 1W6PB 2XUMA 3R6SA 3H8XA 1RUI2 1COV2 2XBO1 1PM7A 3MFAA 3O0WA 4JKKA 1SLCA 4A3XA 1PVC1 4UBHA 4OHVA 5FPXA 3I2OA 4XPVA 5E8AA 5FZLA 4UW4A 2A1XA 3VZJA 5BNNA 2RS52 4UFJA 3R4SA 2P6CA 3MPPG 2HWF3 2XDVA 4NPLA 4CU6A 2HWC3 2JDNA 4AG4A 1UIKA 1PIV3 2AYHA 2QDRA 1S0IA 2NZ9A 3ALQA 4IGOA 4DFSA 3I7DA 3AMMA 1X33A 3VDDC 3LF7A 1PGW1 1YO8A 2R6QA 4C0BA 2WZR2 5FZDA 5A6XA 3EHKA 1FV3A 3OGGA 1XRUA 5DMYA 3LKJA 4XMAA 1KS4A 2NQYA 2DFCA 2VC9A 2WWJA 4LA2A 2MEV1 2Y6KA 2EXKA 3E5XA 1SEFA 3H3ZA 3SH3A 1AYN1 1T6BX 1WBFA 5FXZA 2ZKNA 4X8PA 4HSJA 4BQXA 4P02B 4LHNA 4XDPA 2HWE1 1L7LA 1OUXA 1RUE1 1ZZCA 2ET1A 1POV0 4AGGA 2FCVA 1D4M1 2Y6FA 4FCAA 1UNBA 2WT0A 4CDXB 3O1OA 5FFOC 1N3QA 3LQCA 4QPIC 4DOUA 2QQJA 2TEPA 2W0XA 2A70A 2X5IB 5C8CC 4MO3M 5A70A 3ZFFC 1VBD2 5F5CA 2W87A 3S30A 1TMF1 1VBE1 3M3EA 1NYWA 3LB9A 4QHBA 4XURA 5CB7A 2Z2SB 4HN0A 3SC7X 4BWOA 3I2GA 4CXYA 3DEMA 3BGAA 3RZZA 1JTZX 5KBFA 2O14A 3OBAA 4MGKE 2JDAA 4KL1A 1DFQA 4CPBD 2Q5TA 3DXUA 4NAOA 5CG8A 1JYIA 5BNPA 2CGPA 1PVC3 1J1LA 4CA9A 4N43B 1JZ8A 2QJVA 2A6VA 4BA6A 5CAZA 3GALA 2PQQA 4BQ5A 2JG8C 4BISA 3DF0A 3MZHA 4A3ZA 2C26A 2JWPA 3AFGA 4G4FA 5E6HA 4LKSA 3VL9A 3BPZA 5JWPA 2JDUA 3JQWA 1KITA 5GALA 1E5SA 2D6KA 1ND2A 4GWMA 2YMZA 4EN7B 3GBGA 1H8TB 2JX9A 3POWA 3K77A 3M2MA 2D44A 1PGSA 2JKBA 4QU1A 1HQLA 4FVVA 4RS5B 3H7JA 4WM8C 3NNGA 5EP9A 3U75A 2CNAA 3OY8A 4LXLA 1PK6C 5EV7A 3AZYA 4Q4W2 2QQWA 3PIJA 5DAXA 3M3OA 1AYN3 3ZYRA 2YG0A 2VW0A 3R0RA 4GKXA 1BMV1 1XYOA 5FPZA 3N9MA 4CDQC 3TN93 5BNOB 1YIPA 2HWE3 1RUE3 2BVBA 1N1VA 2P2KA 2ZAAA 1VAVA 4A7KA 2GNBA 3NJVA 1AX1A 5FYVA 1D4M3 2ZCWA 4I0AA 1GZWA 3MYXA 5DUXA 2JB8A 1YFUA 4QDQA 5ACA1 5C3PA 3KQRA 2VMEA 4GIQA 1OUSA 1NY72 3B9IA 2VW2A 3PHMA 4LO8A 1N1TA 4PIZA 1EUTA 3AB0A 1W2AX 4P9IA 4ZXKA 1TMF3 4FTBA 2JE9A 3ZX7A 2W1WA 1VBE3 4URTA 3S6PA 5CG9A 1VMJA 1CPMA 5FMOL 5ANQA 1UY0A 2MNGA 1GKBA 2OIIA 4P9JA 4FBFA 5FOJB 4UW5A 3MIGA 4D0QA 4F83A 4WVVA 1CAXB 3RRDA 3PUQA 3EO6A 4GMP1 4CP0A 3BOWA 3OEBA 4CEYC 2OX0A 4COZA 5FO7B 4OI2A 1JODA 1W04A 3VZOA 3KWVA 4FFGA 4Q5OA 3IT8A 3WQ1A 5IHRA 5BXXA 1WW5A 4QM9A 4AGVA 3CIHA 1MEC2 3THDA 2W91A 2ZGRA 1O5UA 1RYYA 4XE9A 3UJQA 2GZWA 1KFUL 3POEA 5FPBA 3NKTA 3H0OA 3VBHB 5I0DA 4WVMB 3LFIA 5FZ3A 1TZOA 1WMXA 1NOVA 1FV2A 2C0ZA 2VVDA 2WA4A 1K12A 3IWZA 3FN9A 3QD6A 1UXZA 5IK5A 4RFRB 4B3NA 5A3UA 2WO2A 1VBA1 1AXYA 1IS5A 1JBCA 1H6YA 1R092 2W95A 4UW3A 3WP6A 1FYUA 2CSGA 4OHYA 2BWCA 1DIWA 1GZTA 5DAPA 1ZVFA 5GLUA 3ZYPA 2QQOA 2YB7A 4AWDA 2Q30A 1TNRA 1CAVB 3FWEA 3RWNA 1NCQB 3VBSB 4XUOA 4Q4Y1 4HL0A 3N36A 1LHVA 4XOGA 5FYHA 4EWAA 1MQTA 5LBBA 1HB1A 1ZRRA 2Q8DA 2EALA 5L9RA 3RDIA 2EIDA 3VHPA 2VTFA 1QOSA 4BH9A 4NIAA 2B42B 4E8DA 5GZGA 5JOZA 3I49A 2A71A 1ENSA 5ACA3 4PLNA 5CNAA 2R0FA 4AAXA 5L73A 4QKNA 3ZXKA 1G9AA 2PYTA 4CDWA 1AX0A 1X9PA 2R32A 5JDBA 2NP0A 3LPFA 3BYWA 2XPJA 1IQDC 3UGHA 1CZVA 3K4AA 3DV8A 4XQDA 2BOJA 2CHHA 3IDBB 3PVBB 1N3OA 1KEXA 1CN1A 2D5FA 1L3JA 2XLFA 2Y6LA 5D8AA 3AYDA 4QXCA 4NE9A 1J84A 3ES4A 1UOFA 3I59B 4E4DX 3ZXJA 1VMFA 5C9AC 5HCHA 3R05A 3O1PA 3BCWA 1YLLA 1DG6A 3M70A 4W50A 3ABZA 1AR71 3NAPA 3O14A 3E6CC 1OOPA 4YGCA 1G86A 4N8MA 1UO9A 3S0MA 3AKPA 3RJRA 3BIWE 3M8LA 4ARXA 1GP5A 4D6SA 1LOEA 2BFUL 4JGZC 5FUNA 1W8NA 4ZU7A 3J9SA 3MDPA 2DTWA 4SBVA 1BK1A 5FZ4A 4B7EA 1F5JA 3LEIA 3BU7A 4B4RA 4FOWA 4LA3A 3OSDA 1FMD2 2R073 4CDUC 1SPPB 1DU3D 4L9BA 2FDFA 5FLHA 2QZ2A 1ZRDA 3VBOB 2WO7A 1SG3A 1PGL2 1AYM2 1RUJ2 1V6JA 2ZGOA 3RNSA 1ZZ9A 4ES9A 4DMIA 3KB5A 4QM8A 4D3WA 3VBRC 5AC93 1AR82 1JUIA 4IQPA 3IPVA 4COVA 4GH4B 2DVGA 1AL22 1GUIA 1HW5A 1RUOA 1DP0A 1QF3A 1QJZA 2ZMKA 4DO0A 1RUNA 1NLQA 2DDUA 4Q4Y3 4ONUA 4HG6B 1CJDA 4XXPA 1YFWA 4CCKA 3O1VA 4MG2A 1UU5A 2ZMLA 3LOIA 5D2AA 1VLNA 4GWJA 2WNOA 4Q0QA 3ETQA 4LBJA 4CCNA 1LAJA 1NA1B 4FPOB 1O3RA 4QX3A 1FT9A 1XSQA 3AKTA 4RHV1 2ZGMA 1PNGA 1W6MA 3GZAA 3Q8CA 3ELNA 4PI2A 5FV3A 1UKGA 2FHRA 1MPXA 4GWNA 4ORFA 4AFAA 4OZOA 5JI9A 3TWIA 4XABA 2VNOA 5LRSA 2XLAA 3HT1A 1QJY3 1QHDA 3KD4A 4R4XA 1W05A 2CL2A 4V2WA 3ETPA 5I0UA 2AREA 5JZGB 1FOD1 4LO5B 4YG0A 4MADA 2HLEA 2H0VA 5ABJC 4J1XA 1ZZBA 2OQ7A 5CEHA 5HV4A 3ZDSA 3WW1A 2Y34A 2WWSA 4AF9A 2ZX1A 2YU2A 2GC1A 4K8RB 1UOBA 2YZ4A 4L92A 5CVRA 5K0UA 5JOXA 1AR73 1YJLA 4RR3A 5HCAA 4NHYA 3R4UA 2TBVA 3KT7A 4BK4A 1NE4A 2R1DA 1EPZA 3D3AA 5F32A 3NRUA 1LB2A 3ACGA 1POV1 1W8WA 2GC0A 2ZHLA 3X29B 3MIBA 1V6LA 5FZMA 5F3CA 4TSVA 4HZFA 3CL1A 2EIBA 4O9GA 4XIOA 5C33A 2AENA 2QZ3A 2EIEA 4R9BA 4I2OA 4YVWA 4QHOA 4IW3A 1MZ6A 4ZS3A 4CCDA 4RQPB 4XUNA 3VV1A 1F31A 5FLIA 5A7WB 2BYVE 3CZUA 1IS3A 1VBC1 2A75A 4Y33A 2DWRA 4Y22A 3VZLA 1YNAA 1NE6A 1O91A 2RR12 4KWKA 5JR2A 2R041 3OYWB 4OYUA 1ASJ2 1GWLA 2IXLA 1ZNPA 1XB9A 1W6OB 3DKWA 3VD7A 4ATFA 3MLLA 1OQDA 1Q8QA 3DPRB 3VDCA 3W5MA 1IKQA 1MS5A 4RHV3 5FKBA 4QPGA 5A3LA 2P37A 4MXWB 1CAUA 1H2NA 1UYZA 1Y43B 2K0GA 3OB8A 3AP9A 3WY6A 3KCYA 3VKLA 4BXFA 3KCCA 3KVAA 1RUF2 1F5FA 3WNKA 3ORJA 1MZFA 5DZFA 3PU3A 1C5HA 2YBSA 4OCTA 1QY4A 5FY8A 3WQ7A 4FFFA 1QJU1 5I8SA 2WAAA 1DHKB 2DVAA 3RJ2X 4QHZA 5IK7A 3AZWA 5A7SA 2BBVA 3BTZA 2CU5A 2PMWB 2H0BA 3VHRA 1KJRA 3VDDB 5FZAA 1SFNA 1RUH3 2Q0AA 5F3IA 1VJ2A 1FPN1 4DY5A 2GH8A 4K1YA 3IMMA 4HVRA 3MLKA 2R16A 2GN3A 3H1MA 2CAVA 1POV3 2ZZQA 2ZGUA 1GWKA 2A6WA 4QWNA 5A1FA 4MSVA 5J96B 4Y1ZA 2LROA 4JQRA 3OOXA 5GZCA 1JZ6A 2XQXA 4DINB 2VECA 3O12A 2B8MA 4YGDA 3H42B 4LBMA 5K4LA 3T0AA 4GQ7A 4YRDA 4EROA 2YC2A 4N43C 2EXHA 3ENRA 1HIXA 1VBC3 2J1TA 2DUQA 4XAEA 2BPA2 5KXBA 4LKEA 4K3UA 1K3IA 1K5MA 3WG1A 4XIKA 5DXDA 2W47A 2VZOA 1PMIA 2AC1A 4HFSA 2RHPA 1H1MA 1KXGA 4K8FA 5F6KA 2R043 1CR7A 4MOAA 1GZ9A 1MS3A 4QPIB 4QT6A 3WUDA 1XQNA 5C8CB 5CFDC 4N53A 1VBA2 5IVFA 3ZFFB 3JD71 5FP9A 3U0ZA 4ZHNA 1H8TC 1BCXA 3EJKA 4MHUA 5CADA 2PA7A 3V56A 1O6UA 2WO1A 4COUA 4NHMA 5DABA 1WMDA 4CDQA 2XWBB 1EV12 4L11A 4RS5C 1A78A 1Q43A 1O59A 1RUD1 2W39A 5FK7A 4TTGA 2WLQA 2WFF1 1PO21 5EQUA 4KH9A 2VCCA 3PU8A 1OPMA 1XPWA 4EQVA 1DLCA 3DGTA 1CGPA 4Q2FA 4R9CA 3IB3A 3FX3A 2G4IA 3FBYA 1O7FA 3LA7A 1QH7A 4L8QA 1W6QB 2OYZA 3Q9OA 4FPCA 4LBQB 1Z78A 1ZA7A 5A6YA 3MIDA 4JTOA 4XZUG 3BPSA 3WP5A 4H14A 1Q8OA 1ZBA2 2JG9A 3RMXA 1RUC1 3KVBA 5FUIA 1WCQA 2Q8CA 1SBEA 1NLRA 3U11A 2GSYA 2ATFA 5A3OA 3T08A 2XJRA 4GB31 1S2BA 1LCLA 5GM0A 1I9RA 1WD3A 2ETEA 2JDMA 3LA3A 3PDQA 4WM8B 4YM1A 5D1IA 1PK6B 5FJKA 3E97A 5FXXA 3B9CA 1UZWA 3HQXA 4GZ9A 1PMHX 1WLCA 4LO4B 4META 4EN0A 2AGSA 2JDHA 4A45A 3HT2A 5HXMA 4HONA 1SMVA 2GNDA 2XJQA 4BQYA 1G9CA 1AR91 1JYXA 3AP6A 3L9JT 4XJ8A 5JPNB 4PBOA 2H6CA 4MH0E 5FYMA 4QX0A 4RFT0 5FYTA 2W68A 4PIXA 5JMCA 2E9QA 4Y5SA 4CTEA 4XFHA 4HKOA 1ZBE2 4FI9A 2D3SA 2R0HA 3N9NA 4LE4A 4WVZA 4UF0A 2HWD3 5FY0A 4IETA 5FZCA 1FXZA 4ISQA 2ZGKA 1RUD3 3HWJA 2ZGLA 2P4EA 4ZXEA 4G3YC 2BBAA 2C4XA 4RSUA 3F2ZA 3IIAA 2WFF3 2Q1MA 1IHMA 1UY3A 2PLV3 3WG2A 3DYPA 1W2TA 3G6JB 1HB3A 1T6GC 2TUNA 2A6ZA 1ZX5A 2W52A 2XVLA 3PUSA 4GULA 4XJAA 4CEYB 2WNVA 4TWTA 4YZ1A 5T52A 3ACIA 3S57A 1WCSA 2JIJA 3OTFA 1RJ7A 1UU4A 4F7ZA 3BB6A 3WD5A 3L2YA 4GA9A 4BYYA 1ULCA 5FJHA 5FZHA 2FZ1A 2VZPA 1IZ3A 4C8DA 2B5HA 4YM2A 3USUA 2OKXA 5I0RA 1ULOA 2F4PA 4YZ4A 4COWA 3GF6A 4GXLA 2LUWA 1G9BA 2PFWA 4IV1A 5CISA 3IAPA 3SH5A 1FOD2 1K45A 1H4GA 4YVSA 3OBRA 2RS33 1Z0HA 4IEWA 1UCXA 4GB33 5CKQA 5F5QA 1COV3 1YIFA 3NNMA 3J7LA 1GYKA 4BXSV 1UOGA 4ZZ5A 5DDJ3 5AVPA 1S0FA 4BLJA 5C71A 2QCSB 2DCJA 4RL7A 4XUTA 1ZYBA 4NPRA 2VOTA 1H4HA 3I3BA 3K46A 4MUVA 3T4HB 2DURA 4OI0A 4QB6A 1OLME 3PMEA 5CFCC 1NLSA 3DKQA 5EJZB 1I1EA 1AR93 5F8PA 1OPOA 4NIGA 4JHTA 3M3IA 5C70A 2VMGA 1DYKA 3CDZB 3H8OA 4DXRA 3WP4A 3UETA 5L9VA 3SH4A 3U10A 2BZDA 3AZZA 4Q26A 5CKNA 1HV1A 2UYAA 4XFIA 1LHUA 2RS12 1ULDA 2PHLA 4AEDA 2O8QA 3AL6A 2XVKA 3ZR5A 2WS92 1REEA 1FI2A 2CDPA 1VAKA 5FPVA 2UY9A 5LA9A 3O0XA 3OD4A 1HXS1 1LOAA 2BGCA 3U37A 1F8VA 3OGJA 3T1MA 3WNOA 3WNMA 4CP2A 4GJYA 4E2QA 2RM21 1FATA 1WMEA 4FPFA 5C9AB 1U12A 2KD7A 3LEGA 2E7AA 3IAQA 1OLMA 4Q0SA 3ZXGA 3OGSA 4ISRA 3JB4C 4OI4A 1JU4A 2EAKA 2NMOA 5EPAA 3CJIA 1RUG1 2C5DA 1QKQA 4JGZB 4UFHA 3VKFC 2E53A 1ND3A 1US3A 4KQ7A 1VBD3 2EXIA 1VALA 3IZOA 4JCKA 4R8HA 5FZIA 5A33A 5ABJA 4Y26A 3DN7A 2VJXA 4CDUB 4NR1A 2OS2A 3W21A 2ZGPA 2LALA 2WN2A 1TEIA 4UFIA 1V6IA 2VTXJ 5FPAA 3THCA 1MZ5A 3WW3A 1KDMA 1MVEA 1QJU2 3E6BA 4PLOA 2E51A 3I2KA 2VO5A 3VBRB 3AZXA 1XJAA 2E31A 3KLSA 3ZN6A 1LOGA 1UY2A 3NNJA 2ZS6B 4BIFA 3BTAA 2BUKA 1PIV1 3B01A 3VBUC 1PVXA 2VTXA 3TAYA 3I2FA 4IE4A 5A3TA 2WQ8A 3NV2A 3GZUC 1W6PA 2XWJB 3N7LA 4IV3C 2ZMNA 5LBEA 2E32A 4QDSA 1R1ZA 1B35C 4LPLA 1SZBA 3AM2A 1BHGA 4KWUA 2QQUA 2VL4A 1WCKA 1HV0A 4IESA 1GANA 2Z69A 1CQ9A 1EY2A 2VPVA 1JOJA 5ERLA 3I2JA 4QX1A 4PLMA 2GN7A 3RYPA 3G7DA 5FZBA 3RS6A 5FKCA 1WD4A 3UKNA 2GMEA 1PNFA 4LO6B 1OQ1A 1DGLA 4XACA 3VL8A 1HXS3 1X82A 5IWFA 1U5IA 1SFPA 4QKFA 2JD9A 4XF3A 3ST7A 1VPHA 2GMMA 2RM23 2HWB3 4PCRA 3HQUA 2CDOA 1D2SA 1QJEA 3M7AA 3C7OA 2VZRA 3JD72 3GJBA 3QCWA 4IXLA 3HAGA 2B7YA 3HR9A 3MICA 4XBNA 5JXGA 4OUMA 1W90A 4FPGA
chains in the Genus database with same CATH topology
1Q5OA 2DUOA 1WCDJ 1RUG3 4W6XA 2AUYA 5GLWA 4AI8A 2WNEA 2KM2A 3H50A 4CDXA 3CLPA 3ZIXA 4AEKA 1YI7A 2X5IA 3PLQA 3TNPB 4V1PA 4PDWC 1QQP2 4QQPA 4DNYA 2R062 2E63A 3ZYJB 4XQWA 1FNZA 1FX5A 1VRH1 3N7MA 5I0TA 2D43A 3CJXA 1J3QA 5HI0A 4OULA 1OA4A 3KGZA 3TYJA 4W6YA 4I3PA 4WVWA 5L7OC 4AFBA 4FP3A 5FQ0B 4AEJA 2JICA 4M3CB 1LHWA 1D2QA 2KA3A 3APBA 4YW3A 1QXRA 2PHTA 1O3SA 5T5JA 3JBG2 3TN91 2W08A 4A7ZA 2JDZA 2A3YA 1GSLA 2WNUC 1UPIA 4FAHA 2I45A 2ZHNA 5JOYA 4QMAA 4B8EA 2VOVA 4AVBA 5DZGA 1ULFA 2XLGA 2HJIA 2WQZC 1GLHA 1Z7S2 4P9WA 1ZRCA 3UKTA 3SNMA 5BY5A 3NV1A 4XQ4A 4Y1VA 2ZHKA 5BNOA 5J09A 3WW4A 5J48A 1U5XA 3THTA 4LBKA 4D7YA 2WT2A 3L2HA 1S0DA 3H9AA 2BNOA 5KHJA 1OKQA 2VQAA 1RIRA 3A0NA 1BQPA 1QOTA 4JDOA 3SCHA 4AHZA 5A3MA 3C2UA 4MGIE 4HT1T 1EPWA 1C8M2 3AMQA 1VRH3 4QXKA 2IFRA 4Y5Z0 5CFDB 2G9GA 3NJZA 4XEZA 1CAXA 1OI6A 3WDYA 1YFYA 1AUYA 1LENA 1VB2A 1QJX2 5C4WC 1Y3TA 4Y1XA 3B3QE 1OA3A 4D69A 2UURA 3V0AB 1AR61 1AYM3 2PHFA 3WP3A 5BNQA 3FE5A 3VBHA 4WVMA 4C1WA 1AR83 3VKMA 3BOPA 1GFF2 1C28A 1X7NA 1YRZA 4AVVA 1REDA 1QMJA 4AHYA 4XF0A 3WT3A 1LOFC 1R1A2 2B46X 5DG1A 1RMU2 2A5ZA 4BIOA 1SBDA 2XKOA 1CAVA 4L99A 2WA3A 1IS4A 1NCQA 2HEVF 4TLFA 1LHNA 3VBSA 4FQZA 3NV3A 3B5LB 1HRI2 1GV9A 3SHRA 4BPZA 3WDUA 3VBFA 4X6QB 1WW6A 2XL7A 1O4ZA 5B2GB 4PJYA 1FNYA 4HANA 5BNPB 2Z79A 4BZ4A 4DZGA 2D5HA 1ENRA 4AYUA 2KXLA 4FPHA 4KWJA 3FLRA 3ASIA 2R071 1XNBA 1Q8SA 1YXWA 3IM0A 4XBQA 2D93A 5EJ3A 3I59A 4E2SA 1M06G 4P9YA 4Z07A 3H3UA 1RHI1 2WSVA 2Y38A 4DRRA 2Y26A 2WL1A 4KNCA 1JXNA 1AR63 2HWF2 2UU8A 1RVF3 5AC91 2HWC2 4NVPA 1PIV2 4I30A 1MS9A 5A32B 2I74A 1PO11 3PTYA 1RGSA 2CGNA 1CPNA 2DVFA 2PHXA 3TNQA 1VBB1 4JGYB 3VBOA 1CIWA 1DQ1A 1S0GA 3N7JA 2D7FA 1HRV1 1XNCA 4Q27A 1C5IA 4JV4A 1MR5A 4FOYA 3B7MA 3T2TA 1N1YA 1EAH2 2AZ5A 4GH4A 2BW8A 3K51A 3PVOA 2Y0OA 4WBBA 4BMEA 2JENA 4F3JA 1QJY1 2G9FA 1UMZA 4WZCA 4MYEA 2O1QA 2D97A 1NA1A 2ZGQA 1DQ0A 3IDEA 3M4FA 1H9WA 4C90A 1HQWA 4S2FA 2CWSA 3HBZA 4W65A 2DU1A 1LOCA 2A6XA 2AH2A 5CFCB 3N7KA 2PELA 4ASLA 1MS8A 3USSA 4AFDA 5JZGA 2NMNA 1DQ2A 3PJQA 4M3CF 5GZFA 5H9PA 3KMHA 5EYYA 1LU1A 2XBO2 2ZKLA 5BUVA 1H2KA 3B00A 1PVC2 2VOXA 1C1LA 1NCRC 1JH5A 1RHI3 4I01A 5FMOS 1JYCA 1KQRA 5GLTA 3B93A 5JSPA 4P14A 4Q0UA 2B9UA 1VAMA 3N35A 3FHIB 1C1FA 1PO13 1PHMA 5GZEA 2UY8A 3CO2A 1PGW2 4OHWA 3KT1A 1W39A 2D98A 1VBB3 4I09A 1R083 2DTYA 4R9DA 4P9GA 4RQPA 1FAYA 1XNKA 1YFXA 1HRV3 4QX5A 1VIWB 2MEV2 3V0BB 2YXSA 1D0HA 4K7JA 4QGMA 1AYN2 2PAKA 2ZJCA 3TBDA 4WZFA 4MGYE 3TN92 3OYWA 2HWE2 1RUE2 4MV2A 5T55A 1V6MA 1W6OA 3TB0A 2ZAHA 1D4M2 1Q3EA 3H1WA 4FQ4A 1W6NB 2EA7A 3DPRA 2GC2A 4YYOA 2DYCA 3NV4A 3SITA 3VBUB 3JZVA 3WHTA 4MXWA 4XTMA 5DUUA 5DUWA 4Q8KA 1TMF2 1RUH1 2WINB 4IV3B 4NHLA 3PJYA 3JB8A 1VBE2 1UIJA 4WM7C 1B35B 3ZFGC 3E5UA 4Q4V3 5J7MA 2ZOEB 4IL7A 1SLAA 1O3QA 1D4VB 3HN1A 1DZQA 3A4UA 2VQ0A 1BBT1 1KFXL 4S2HA 3ZFEC 1GQHA 3AFKA 4PIYA 2PHWA 4N9HA 2ZPXA 4OFGA 3AZVA 4P5HA 3VDDA 1O4YA 1OHFA 2VOKA 3KT4A 4CEWB 3V64A 1NXMA 5E1RA 2A7AA 4IERA 5T5LA 4HLTA 2OVUA 3FMGA 2BFUS 1BEV1 5CA6A 4LNVA 1J1TA 1ZBE3 2P3IA 4YW2A 4MX3A 4EN6B 1BMV2 1LGBA 4XFFA 2SLIA 3CEWA 4QPIA 3NSTA 1WA4A 4QQHA 5EZWA 5C8CA 1A8MA 3ZPYA 2VY0A 4FTEA 4PDWB 4BOWA 3ZFFA 1TME1 4KGGA 4XJWA 3EQEA 2CGOA 1KD7A 2DCZA 3VLBB 5KXDA 5JPMB 5ACA2 4XFCA 1YJKA 4AI1A 5LRRA 4BM8A 4HPKB 1IPJA 5EYXA 1VR3A 3WLUA 1G9DA 5LK5A 3RI9A 3ZO0B 2RMU1 1AX2A 2GU9A 4YFWA 1O5LA 1IGOA 3ZSMA 5L7OB 2Q4SA 4LO7A 2JG8A 3WX5A 4Q0PA 3OJBA 2IWGB 1DF0A 4YW1A 1BBT3 1OD5A 2FZ2A 2DFBA 4LBQA 5FBZA 5FCCA 2GC3A 1V6NA 4K40A 4Z1VA 4RGGA 3WVJA 2WJSA 1DLLA 5FRAA 1JW6A 4OLLA 2WNUB 4K20A 4QQLA 3MF9A 3HD8B 2QNKA 5BNNC 3FLPA 2XJVA 4AHWA 1REFA 3T1LA 4N7IA 5FAXA 4WM8A 5IUQA 3D0JA 5K9YA 1PK6A 5IK8A 3PVNA 1BEV3 5KXEA 2GMPA 3K48A 2FMDA 1H2MA 1C57A 4W6WA 3LCPA 2HWD1 3VHNA 4AGRA 1GQGA 1E57A 1RC6A 4BLIA 4Q4X1 3O0VA 2VW1A 3I8TA 4HVQA 3AXEA 5IT6A 4Q4Y2 2OA2A 1J3RA 2PLV1 1A8DA 3D8CA 3J8F1 1N3PA 1RJ8A 2XH6A 3ZXEA 1D0GA 2DCYA 3POYA 1ENQA 1TME3 3WOGA 3UK9A 2PHRA 2B45X 2K2SA 1H2LA 2D3RA 3GBFA 4HKLA 4BHPA 4RD7A 1A3KA 2BNMA 1SFYA 2Z5WA 4JVAA 4UBGA 1MS4A 2OUHA 2EXJA 2IXIA 2RMU3 4CEYA 5C4WB 2RS31 3GZTB 1RL3A 1RUI1 1AVBA 1COV1 5EWSA 5LEJA 1AXKA 2IFWA 4HSLA 5DDJ1 3S7EA 1AR72 2IXJA 1X36A 2RS51 4IEXA 4QGLA 5BNPC 1F2NA 3HIFA 1N1SA 5GLVA 3ZXAC 2ENRA 2QVSB 1GR3A 2WT1A 1S0BA 1Y7BA 4DS0A 2Q8OA 4UXAA 2EF6A 2D6LX 5HXVA 2YV8A 1ND2C 4CZSA 1V9U3 4OZXA 1QOOA 2CYFA 3MGUA 5FOBB 2WFPA 4Q4X3 1OQEA 1VB4A 5SV5A 2D6OX 3J8F3 1XU1A 4LULA 1PZ8A 4LHLA 3H1YA 4JGYC 1XNDA 1O3TA 3W58A 4RHV2 3MEPA 3N4MA 4HMZA 2ERFA 1KDKA 1QGLA 1VBD1 4HK9A 2IXCA 4JTNA 4Z2WA 4RGAA 5C9AA 2VOWA 2WSUA 4FOVA 4I0BA 4C1XA 5KXCA 1XE8A 1RUI3 4LHKA 1YHFA 4LUMA 4JGZA 5DG2A 3ACLA 2A6YA 2RS53 2ZA9A 1RUH2 2JEMA 4FPLA 2OW4A 3PNAA 4KWLA 4CDUA 2GALA 4OI1A 4XW3A 1CD3G 1LESA 2D6PA 4K6BA 4XJZA 1ULGA 2ZX0A 4JAAA 3RQ0A 1DZTA 5KHHA 3VBRA 2WZR3 1UZYA 1WW7A 5KWRA 1SLBA 2QDNA 3P3PA 4H3WA 4NHKA 3FFZA 1VBC2 4XTPA 5CIRA 1O4TA 2D6NA 3UV9A 4YZ3A 2XJTA 3MIEA 4Q4W1 1J59A 3UL2A 3MPBA 2R042 3DL3A 3AXDA 2HWB1 4INDA 2RJKA 1G6NA 2GH2A 3LAGA 4Q29A 3RPQA 1IS6A 1MQTC 4GMP0 1YI9A 1Z7S3 1NY71 5EFUA 3RI8A 2XL9A 3NVCA 4FO9A 3JU9A 1GICA 4XETA 1J58A 4HKWA 1NCRB 4CDWC 3FC0A 4XFGA 5GZDA 1NZCA 3LWCA 5BV6A 4BQ1A 1IOAA 2X53S 4FPKA 3NKGA 4IEUA 3S7IA 5D8AC 2NM1A 1UD1A 3D82A 3AYAA 3E5QA 1MEC1 2EAAA 2FMYA 1FPN2 2Q1ZB 5FREA 3ZXLA 4XYXA 1C8M3 3NAPC 1OOPC 5T5PA 1C3HA 4M0HA 1H8VA 1WLTA 2SBAA 1OFSA 4A2UA 1R091 4Y20B 1VP6A 5FLJA 1S0JA 4YM0A 5HCBA 4YG3A 2WQ4A 3WUCA 1YCIA 1B09A 3URFA 1UN1A 3MLJA 4Q4W3 1NQJA 2WC2A 4CEWC 2YGLA 3VGIA 3V65A 3IN9A 2UWBA 4XJ9A 1GNZA 4YGBA 5FQ0A 2ILMA 3R4DB 4M3CA 5JVVA 4OUSA 4D7SA 4WM7B 1RMU3 3ZFGB 1HDKA 3MW3A 4CP1A 2XKPA 1RUD2 4C0HA 1MZEA 1XYPA 2P17A 2WFF2 1PO22 2PLV2 1QXPA 3O5SA 1RTVA 2BTVC 1MVQA 4EV0A 3VZMA 1TNFA 4DXZA 3ZFEB 3AJYA 4N7UA 1TQ5A 3D6EA 4FP2A 2ZABA 4JRAA 4S2GA 1QU0A 2QQPA 2YYOA 1XU2A 4Q1PA 3ZVXA 4E9KA 5E89A 4LBQD 4QD2A 1MEC3 3SXWA 1S1AA 4N90A 5GLZA 1GBGA 1RUC2 2P3KA 4EWEA 4YLZA 4AHXA 3J26N 4RR3C 1ONAA 3H8UA 1FMD1 4GB32 4N43A 1F9KA 2WIIB 1XXNA 4Z92B 3QACA 5DDJ2 1PGL1 1AYM1 1R093 1RUJ1 3FLTA 4YSFA 3ECQA 2V09A 1HQNA 5C8WA 3ZN5A 2PAEA 1AR81 1CVNA 2FQPA 5CFDA 4JDNA 3EXUA 4YVWC 1AL21 1AR92 1I5ZA 1H8TA 3P3NA 4LUKA 4AFCA 5K8SA 4FPYA 3WDXA 4XDQA 3OPZA 4EWDA 3ZSKA 4YNIA 3V0AA 4RS5A 3M3QA 3GHNA 2DVDA 1LEMA 3D4KA 4K1ZA 2YROA 4HK8A 4P9XA 3OF1A 2D3PA 1EAH3 1CAWB 1BVP1 2C1FA 4QPGC 5J36A 4Y4YA 2VG9A 3AK0A 3VKNA 3FJSA 2WZPP 1AJKA 1UL9A 5BNNB 1IPKA 4PBPA 1W0PA 2ZZJA 1DQ5A 1SDWA 3AYCA 4XHBA 3CNAA 5HCFA 1WLDA 1LKNA 3FBMA 3WDTA 1BVVA 4E4ZA 5T3NA 1OLRA 1FMD3 1LU2A 2XBO3 3KGLA 3O7OA 1GZCA 1RVF1 2D6MA 4OHXA 3I54A 1RUJ3 1H9PA 1ALYA 3MF6A 3AX4A 4C91A 1UF2C 2QUOA 4MZUA 4H7MA 1AL23 3WG4A 3QLQA 1LHOA 1ZZ8A 2RR11 1UW8A 1ASJ1 2ZX4A 3ZXFA 1WMFA 1QDCA 4ZKTB 3JCIA 5H9SA 3LSEA 1K5MC 2PHDA 2JD4A 5HBAA 1KRIA 1WUVA 3VZKA 4KG0A 2CTVA 5A32A 1APNA 4N53C 4S2DA 1RB8G 2MEV3 3AKQA 4IEPA 3RSJA 2VUJA 4ES8A 1SLIA 1HXS2 4JGYA 4AVSA 1DDLA 3TOJA 2ARBA 2E7QA 3LSDA 2GNTA 3LGRA 2RM22 2PN5A 4EN8B 1RUF1 2HWB2 4D7TA 2ZX2A 4R9AA 4MLOA 3RYKA 1UX6A 5DUVA 2IXKA 1HLCA 3CU7A 3VUOA 2LTNA 1RUG2 4WV8A 1U5YA 4O9EA 1GNHA 1DZRA 2XJPA 3PMSA 3ZXDA 2WLPA 1S0EA 4IEVA 4Z82A 3UJOA 5T5OA 2PAMA 2XJSA 3WZ1A 5FDBA 2YUEA 4LBLA 3SISA 4XFAA 5LK7B 4QPYA 1ND2B 2JG9C 4JDMA 1LOBA 2XGXA 3AKRA 2VXRA 2QFEA 2ET7A 2DV9A 3SMHA 4XF1A 1MS1A 4L2NA 4M00A 4AE2A 5L19A 2YGMA 4TZDA 4OHZA 5CFCA 3FFQA 3KM5A 4HETA 3ATGA 1NG0A 2WKKA 3LZZA 3KCXA 1S55A 2HEYF 5F1RA 3OY8B 2YDEA 2I2SA 4NOTA 1R081 5F9TA 4KBBA 2RR13 5JIAA 1ASJ3 2DCKA 3E6DA 3ROUA 3BALA 2CWMA 2D40A 4YW4A 1GZWB 5EXOA 2ZBJA 1AXZA 1OFNA 3FUOA 1YWKA 2GAUA 3POSA 1QH6A 1EV11 1IKPA 1LR5A 1OSGA 3AP5A 3SCFA 2OPKA 1AZDA 3VN4A 1ZRFA 3NW4A 1Q56A 1RUF3 4LTAA 3ZSJA 4UW6A 4IEOA 3VZNA 1LECA 3VBFB 3GYDA 3V0BA 4MVTA 2A3XA 4J6GA 2WNVC 4Q0VA 4Q4V1 5FO8B 1ZBA1 4BMBA 3MIHA 5BYNA 4IEYA 3KZ4C 3ZYGA 2PHUA 1NQDA 1W6NA 1DGWX 1LODA 3RG0A 1QWRA 1DGWA 1W2UA 2CAUA 4LLFA 2BVVA 4NWVA 3WXPA 4XF9A 3VBUA 4U36A 4IV1C 2GDFA 2JXAA 4GMP3 5H9QA 4IV3A 4YVSC 4FT8A 1B35A 2VNGA 1VRH2 3J4UH 2VUAA 3LOBA 3GHMA 4QQOA 1Q8VA 4QQ2A 4NN0A 5DZEA 4HBNA 2UWCA 4FAGA 1MQTB 2ZTNA 5AFEA 2XHKA 4XXAA 2QE3A 1VBA3 1YYNA 1SQ4A 3AP7A 2LM3A 1ZBE1 2IC1A 5FTTC 1CX4A 4CEWA 1DQ6A 5FO9B 3AP4A 1MS0A 2I07B 1EV13 4CDWB 1UAIA 2CY6A 2BEOA 3MIFA 3ME2A 4X8NA 1LJ7A 2P34A 1HX6A 1H1IA 2NN8A 4AEDC 1CONA 1UPSA 4DB5A 4FTSA 4AVCA 1ZREA 5JI7A 1Y9QA 3LA2A 5D8AB 5KHIA 2NPIA 5AVAA 1UZZA 4FSJA 4YZ2A 3NAPB 4QGNA 1OOPB 2Z42A 2XG3A 1ZBA3 3CJIC 2XVGA 4PDWA 3A0KA 4R4ZA 1ND3C 4ZU4A 4HN1A 3D0SA 4KG8A 4AVTA 2DU0A 3KS7A 4FPJA 4TYSA 4YM3A 4HPKA 4AI3A 2YY1A 1W0OA 1OLQA 2VU9A 3WCRA 3U4XA 2RE9A 2K9ZA 4YZ5A 4JRLA 1JN2P 4MGZE 5J37A 3IPVB 3JQXA 4M01A 3ZMNA 5KHGA 5L7OA 3M1HA 4ZU5A 4PQ9A 5K7PA 5CBLA 1M4WA 2NYYA 3QOPA 1AR62 1RVF2 4H55A 4BE3A 4YW5A 1H0BA 5GKAC 2B39A 2WNUA 4AQTA 4EJRA 3UKVA 2RS11 2TNFA 1W6MB 4GKYA 4OVEA 3ZYIB 5JIUA 2WS91 4AK3A 5JSOA 3WCSA 4A7YA 1SLLA 2YC0A 4PF5A 1S0CA 3ZMOA 1UKRA 1ULEA 1LGNA 2YPJA 4LE3A 4I0WB 5JAXA 1IQAA 3QH6A 4LR4A 3OD0A 2X8KA 3QH7A 2IXHA 4IEQA 5K0UB 4RR3B 4H7LA 4JC1A 2JJ6A 2N7GA 2XB6C 5JLVA 3MI8A 1V70A 4KGQA 2MPFA 3NO8A 4CRQA 2R30A 3WNXA 1DYPA 1FOD3 1W6QA 2O0OA 4I3GA 2VULA 4CDXC 4E2GA 5L36A 4YVWB 2A3WA 1DBNA 2VH9A 4DY3A 2V73A 2X5IC 2Y0IA 5KC6A 3AYEA 3ZSEA 1TE1B 5E16A 2C9AA 5C4WA 5F6LB 2R072 1AL0G 4Y22B 2H6BA 5BPXA 1BYHA 2ZGTA 3MW2A 4SLIA 4XJUA 3ES1A 4FXKB 1RHI2 4AQSA 4AFMA 2ZX3A 1V9U1 5AC92 3RYRA 1AF9A 4AEMA 2JECA 4AI0A 1BXHA 1N47A 2RS13 1PO12 4QPGB 3MW4A 4J1WA 1LOFA 1CAUB 2WS93 4HVOA 5LEKA 1VBB2 2A73B 1R082 2UWAA 2HKXA 3B02A 3ILNA 2ZGSA 2BQPA 3NWKA 1XE7A 5C6CA 1HRV2 4LT5A 4Y1YA 1A6CA 1XYNA 4IEZA 2EIGA 5H9RA 3CF6E 2OZJA 5T50A 1QJY2 2F6BA 3B69A 3EBRA 2X29A 4NWWA 1H1AA 1X8EA 1ZM1A 5BNOC 2R1BA 2JG8B 1QJU3 1QQP1 4XHXA 4E4SA 2VVEA 1BZWA 3AJZA 2R061 4NO4A 3WW2A 3TRSB 2DF7A 4Q4V2 3KSCA 4K21A 3WDWA 1U0AA 1FPN3 1I3HA 4XILA 4YFZA 1K5MB 5JSRA 4XMIA 1J3PA 2WZR1 5KHKA 1DGRA 1WLWA 1LTEA 5TSWA 2XJUA 3NL1A 3WHUA 4N53B 1Q8PA 4XF4A 2JE7A 2IZWA 1OMIA 1LEDA 2YHJA 1BKZA 1WGPA 4CDQB 2OUJA 3DUIA 4DQAA 5J98B 3JBG1 5I91A 5JOWA 1SACA 4LBNA 1QXJA 2VMHA 4AW7A 3VBHC 1V6KA 5T54A 4DPNA 4P9LA 4X6RB 4YG6A 1CJPA 3JD73 1V6OA 1Z7S1 1S2KA 3VKOA 2DCTA 4GALA 4DRVA 4FPEA 5CU1A 4FXGB 1AJOA 4KU7A 4XBLA 3ZSLA 1C8NA 2NLRA 3C3VA 1RINA 3SLIA 3ILFA 4B4PA 3THPA 1PO23 2JG9B 1NCQC 3VBSC 2AR6A 5I8TA 1ZA4A 3B94A 3M3CA 3I4IA 3GBWA 4AQ2A 2ARXA 2HEWF 4B7KA 1DQ4A 1SBFA 1OA2A 1QQP3 2R063 4F8AA 3VBFC 4Q8LA 3WV6A