1TMF2

Three-dimensional structure of theiler murine encephalomyelitis virus (bean strain)
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
267
structure length
267
Chain Sequence
DQNTEEMENLSDRVASDKAGNSATNTQSTVGRLCGYGKSHHGEHPASCADTATDKVLAAERYYTIDLASWTTSQEAFSHIRIPLPHVLAGEDGGVFGATLRRHYLCKTGWRVQVQCNASQFHAGSLLVFMAPEFYTGKGTKTGTMEPSDPFTMDTEWRSPQGAPTGYRYDSRTGFFATNHQNQWQWTVYPHQILNLRTNTTVDLEVPYVNVAPSSSWTQHANWTLVVAVLSPLQYATGSSPDVQITASLQPVNPVFNGLRHETVIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure of Theiler murine encephalomyelitis virus (BeAn strain).
pubmed doi rcsb
source organism Theiler's encephalomyelitis virus
molecule tags Virus
molecule keywords THEILER'S MURINE ENCEPHALOMYELITIS VIRUS (SUBUNIT VP1)
total genus 29
structure length 267
sequence length 267
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1992-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1tmf200
5ABJB 2HWD2 2RS13 2WZR3 4N43A 4CEYC 3VDDA 5BNOB 4IV1B 5ACA1 1PIV3 4WM8A 1HRI3 1PVC2 2RS52 4CDUB 4QPIA 1BEV3 1RB8G 1VBD2 1B35C 1BEV1 5ABJA 5DDJ1 5L7OC 2HWC3 4RR3C 4N43C 4CEYA 1FPN2 5C8CA 1VBD3 2RS11 2Y26A 3CJIA 1AR91 1RUD1 5BNPC 4GMP0 4YVWB 5FMOL 2HWB2 1D4M2 1QJX1 4CDWC 1ZBA2 4Q4X1 2BUKA 2FZ2A 1V9U3 4CEYB 1AR83 2XBO1 1X36A 1RUJ1 5C4WB 3JB4C 5C8CC 4LLFA 1EAH3 1VBE3 4Q4V1 2R071 1TME2 2MEV3 4RR3A 5FMOS 1HRI2 1VBC2 4RQPB 5L7OA 1RUE1 3VBOC 4FTSA 4WM7C 4QPIC 4RHV1 3NAPB 4WM7A 1R1A3 4GB32 4YVSC 2R072 4Q4V3 4RFT0 1RMU2 5C4WA 3VBUA 1PVC1 4WM8C 1RUF2 2BFUL 1PO22 5GKAC 3J8F1 1BBT2 4RR3B 2XBO3 1VBA3 4RQPA 1AR81 5JZGC 1RUG1 4JGYA 5K0UA 4QPGB 1COV1 4WM7B 2BPA2 5AC91 4NWVA 1PGL2 1QJX3 1B35B 2RS12 1PO23 1TMF2 1AR93 1R091 4IV3B 1IHMA 1NCQA 1ZBA1 1QJU3 1ZBE1 3VBHC 1R083 2HWB1 5K0UB 4QPGA 1OOPC 2HWC1 2FZ1A 2ZZQA 1FOD3 1EV12 1AR63 1RUC1 4NWWA 5D8AC 1EV13 4FTEA 1HXS2 5A32A 1ZBE2 3VBOB 1NG0A 2RMU3 4IV3A 3NAPC 1HRI1 1ND2C 1PIV1 4Q4V2 1TMF3 5BNNC 3LOBA 1OOPB 3ZXAC 4RHV2 4BCUA 1RVF1 2RR13 2R061 2RM23 5ABJC 1ASJ3 4Q4W2 4IV3C 1HRV3 2TBVA 1BBT3 1RUI3 5J96B 3ZFGC 2WFF2 1HX6A 3DPRB 2RR11 2RS33 1RUE2 2PLV1 3VBHA 1BEV2 1K5MC 1VBC3 1TMF1 4EJRA 2RMU1 1RUF3 5CFCA 2R041 4Y4YA 1RMU3 3DPRA 5BNPB 1RUC2 1AR82 4YVWC 1EV11 1RUC3 4IV1C 1HXS1 1POV0 3VBHB 1MEC1 1R081 1H8TA 1VRH2 1BMV2 1MQTB 2HWC2 4RS5C 2R062 2WFF3 1AR92 1FMD3 2HWF1 5C8CB 1PO12 1QJY3 1H8TB 1HXS3 4PDWC 3J8F3 3S6PA 4GB31 1AL22 3CJIB 1ND2A 1PVC3 1NA1A 4YVWA 1RMU1 1RUF1 4CDQC 1AR71 2HWD1 4RS5B 1HQNA 5C9AC 3ZFEB 1K5MA 2MEV1 5D8AA 2RS51 1EAH1 2VQ0A 4Q4W1 3TN93 2RS31 5DDJ2 1RUJ3 1ASJ2 1W39A 2RM22 4CEWB 1V9U1 1VBA2 3NAPA 1R082 1GFF2 4Q4X3 3VBFC 3VBSB 3TN92 3ZFEA 1FMD2 2RM21 3IDEA 5D8AB 1VB2A 1RVF3 1RUG2 1RUD2 2ZAHA 1V9U2 3FBMA 5K0UC 1M06G 4CEWA 1BMV1 4N53A 3VBUC 1ND3B 4JGYB 2R042 3ZFFA 3HAGA 3ZFGA 5BNNB 3VBRC 1VBE2 5DDJ3 1AL0G 3VBSA 2WS93 5C9AB 1B35A 1VBB2 1PO11 1QJU2 1MQTC 2IZWA 1AL21 1TME1 2BBVA 5ACA3 1VBB1 3JBG2 1ZBA3 3ZFFB 1AYN2 2WWSA 3ZFGB 5BNNA 1A6CA 1NCQC 2X5IA 1PO21 1POV1 4YVSA 3JBG1 5AC93 1RUH2 3VBSC 3VBRA 1RUG3 4CDXB 1RVF2 4JGYC 1QQP3 1OOPA 5BNPA 5FOJB 2X5IB 5AC92 1D4M3 1AR72 1NCRC 4Q4W3 3TN91 2RS53 4YVSB 1RHI1 1CD3G 2XPJA 1R1A1 1Z7S1 4JGZA 4GMP1 3VBRB 4RHV3 1NY71 1RUE3 1FPN3 2HWD3 4GH4C 4CDXA 3M8LA 2RS32 4Y5Z0 3VDDC 1RHI2 1RUH3 1NCRA 4FSJA 1ND3C 1QJY1 1QQP1 1AYM2 1FMD1 1QJZA 4IV1A 4WM8B 3JD71 4AEDB 3JBG3 4CDQA 5CFCB 5BNOC 1QJY2 1RUD3 1NCRB 1VBD1 3ZFFC 4PDWA 1OHFA 3JB8A 1WCDJ 1VBB3 2GH8A 4N53C 1AR62 4AEDA 5J98B 4CDQB 2MEV2 1TME3 1AYM3 1AL23 1VB4A 2WZR2 1PO13 4CDUC 1MQTA 2HWF2 3VBFA 2WS91 1H8TC 4PDWB 1NOVA 3CJIC 2GSYA 1C8M3 2X5IC 1Z7S2 2RMU2 2WZR1 2PLV3 4CEWC 1NY72 1ND2B 5A33A 1NA1B 4Q4Y1 1R092 4Z92B 3VBFB 1CJDA 5L7OB 1RUI1 3ZFEC 4RS5A 1MEC2 2DF7A 1VRH1 4Q4Y2 3JD72 1ASJ1 1K5MB 2R063 4Q4Y3 3VBUB 1RUI2 5A33B 5CFDC 5CFDA 2HWE2 3DPRC 1C8M1 2WLPA 1PIV2 1AR73 1AYN1 5ACA2 1AYM1 2HWE1 1C8M2 1NA1C 5CFDB 1AR61 4GB33 5LK7B 1FOD1 1F8VA 4RQPC 4N53B 5JZGA 1NCQB 4SBVA 2HWF3 1ND3A 2HWB3 1QJU1 1ZBE3 2WS92 2WFF1 2QQPA 1R093 1EAH2 5C9AA 1VAKA 1FOD2 1PGW2 2PLV2 5A32B 2ZTNA 2BFUS 3VBOA 4JGZC 5JZGB 3JD73 1COV3 4QPGC 1PGL1 1VBA1 1PGW1 1MEC3 2HWE3 1RUH1 2R043 1F2NA 1E57A 1AYN3 4GH4A 4CDXC 1X33A 1FPN1 4CDWA 4GMP3 1Z7S3 1C8NA 1VBC1 1RHI3 1DDLA 4FTBA 2R073 4AEDC 1VBE1 1HRV2 1R1A2 4Q4X2 1D4M1 1QJX2 5C4WC 2RR12 1VRH3 4GH4B 4N43B 4JGZB 3VDDB 5BNOA 1RUJ2 4CDWB 5CFCC 3J8F2 1BBT1 1SMVA 2XBO2 1HRV1 1OPOA 4CDUA 4QPIB 1AUYA 1POV3 1QQP2 1COV2
chains in the Genus database with same CATH superfamily
1NYWA 3CKHA 2VMEA 4LO7A 1FI2A 5ABJB 4K7JA 1WCUA 3LCPA 2RS13 2WZR3 4BQ2A 5J48A 1KGYA 2W08A 2VBBA 2NZ9A 4NOTA 5FZGA 4CEYC 4MZUA 2Y0IA 4M3CB 4AI9A 1LHNA 5T50A 5ACA1 1AXZA 4CUGA 4WM8A 4BISA 2ZACA 4TZDA 3FFZA 3ZIXA 3RSJA 3O1VA 1GOFA 1BEV3 5FLIA 1XNDA 1SLCA 1JYVA 4BU2A 2YROA 4MHUA 1JU3A 4NHXA 5JR7B 4HKWA 3IAQA 4S2GA 1SLTA 3MZHA 3ZR6A 1BXHA 2B42B 3KZ4C 3O7OA 2PELA 1GZCA 4UW6A 3O1TA 5F8PA 4AHWA 4JC1A 3TBDA 4MGKE 2ZX2A 4AQSA 1JZ5A 3HNMA 3CJIA 1JHJA 2Z5WA 1H6XA 1I1EA 1ZZCA 4QX8A 1OH3A 3ZDVA 3C7FA 2AENA 1QJX1 2OPWA 4Z07A 3JXSA 4OUSA 3VHNA 3S57A 3HVDA 1UY2A 2X05A 5CG9A 5FZDA 1V9U3 3ZYBA 4GWNA 4LBMA 3SEPA 3AMPA 1FT9A 1QNYA 5FQ0B 3PJYA 3L9JT 2WRAA 3NNGA 5B4XA 3SMHA 5T5JA 1JYWA 5C4WB 1Q8QA 5JOWA 1O3QA 3UETA 1EAH3 2VBDA 5JUVA 2WC2A 1HRI2 4LULA 1OXCA 1IQAA 3AKPA 4RQPB 5L7OA 1H4HA 5LEKA 1LAJA 5T52A 3VBOC 3UYJA 3MYXA 4JZRA 1VMJA 2GMMA 3C7HA 2A75A 3FC0A 3NNMA 3PUSA 4QX0A 2VUJA 3ZIWA 4EWEA 4Q4V3 4NUBA 3BU0A 5CB7A 4C91A 4DXRA 3HNBM 5TSWA 2VO5A 5GKAC 5A7QA 2VNVA 2OUHA 2QCSB 1WLDA 2XBO3 3W20A 2DCKA 1VBA3 1AR81 2W5FA 3WP6A 3R0RA 2YBPA 4JGYA 4I3GA 2D6LX 3O14A 5E16A 5K0UA 4YW6A 1BHGA 2YXSA 5A6XA 5C71A 5FP8A 4NWVA 3WCSA 3BPSA 5KC6A 3N9OA 2VH9A 4LITA 2RS12 5F3GA 1W28A 1CX1A 1PO23 2MHFA 1TMF2 3DF0A 2RDNA 2DVGA 3POWA 2FD8A 3UGGA 5KXDA 4IUGA 4HFSA 4XDPA 2VQAA 2Y38A 4Y5TA 5FJKA 4PIZA 1W2NA 1W8OA 1RC6A 4M01A 5FBJA 3VBHC 1KQRA 3AP9A 1LRHA 5EZWA 5LK5A 2VMIA 3I2OA 1BJQA 2QTWB 1CIYA 1EV12 1O5LA 2ZZQA 5A1AA 1GZTA 3AK0A 4FTEA 4A7YA 4EN0A 1HXS2 1ZBE2 3W5NA 5FZKA 3WF2A 1FNZA 5J09A 4Q29A 4CCMA 3NAPC 4FO9A 4IEXA 4FPOB 1PIV1 5FZ9A 3LDRA 2VZPA 2VXJA 1DZQA 4E4DX 3R4DB 5BNNC 3AX4A 2ARCA 3ACLA 3J7LA 2AZ5A 2IFRA 3GXUA 4XOGA 1DZTA 4D7TA 1O8PA 4RHV2 3SXWA 3H3UA 4HANA 1AVBA 2B4KA 4O9GA 4RSUA 4W6WA 4YM3A 1JOJA 5JPMB 3PTYA 1ULGA 3VKLA 3ABZA 1ASJ3 2Y6HA 1PMHX 3B3QE 3NV1A 4L2NA 3O0VA 5JI9A 4IV3C 2TBVA 1NQJA 4FPYA 4XEZA 1IG3A 2V4VA 1SPPB 4D0QA 3O1OA 1ZZ7A 3I2GA 3BIWE 5CISA 2JDUA 2WFF2 3ACGA 4AL9A 1LEDA 2BDRA 4CU6A 3DPRB 2RR11 1G9CA 1ODMA 3T30A 4O65A 1NZIA 1UW8A 3JU9A 3MIBA 4O9EA 4AYUA 3ASIA 1XRUA 1NLQA 1ZVFA 2ZKNA 1NXMA 1BEV2 1J1LA 2WLQA 1XNAA 4EJRA 4KGQA 3BALA 1J84A 4XUNA 1IS3A 3HQUA 1LKNA 1LODA 4GKYA 1J83A 4AG4A 1CQ9A 5J7MA 1GZWB 4BK5A 3JQWA 1RMU3 2EIEA 2DU1A 4UBGA 2BWAA 4XABA 1AR82 5DZFA 3JZVA 4JKKA 4LKFA 1RUC3 4YW5A 5EIYB 4S2HA 2IVIB 1POV0 3HPNA 4XJ8A 1W6OB 2OW4A 3VV1A 1GR3A 2CTVA 4ZY9A 5IWFA 2A6XA 5T5LA 3SCHA 5APAA 3DEMA 1XYNA 3IZOA 5J3UA 1SFNA 5C6CA 2VOXA 2SLIA 4E2QA 4XUTA 5CG8A 4AEMA 4XJZA 4FOYA 4OQ9A 3E6DA 1KITA 1JU4A 3WNMA 5CZKA 3MW4A 1MQTB 1W2TA 1JZ2A 2P37A 2YGMA 4RS5C 5JMCA 3SH5A 3ZXEA 1UMZA 1N1TA 2PHXA 3OD4A 4H14A 5FK8A 2JJ6A 4K6BA 3UK9A 1FMD3 1OI6A 5FYZA 5C8CB 3BKZA 1PO12 4CRQA 2JE7A 4PDWC 3K48A 2DU0A 5LBCA 1H8VA 5GM0A 1ND2A 2QFEA 1NA1A 1VR3A 3APBA 3WX5A 5I0UA 4FBFA 4B8EA 5JSRA 2GC1A 4QDRA 4JRAA 4CDQC 4YG6A 4YZ2A 3KB5A 2RJLA 5A3MA 1QEXA 4CXWA 2P17A 2VQUA 3AZXA 1PVXA 2WT0A 1YUDA 4FT8A 1W8UA 4BWOA 5C9AC 1KDKA 2J1SA 1RUOA 3POJA 3N7MA 1STMA 2JB4A 3QH7A 4QHZA 1K5MA 2ZX4A 4K3UA 1CZTA 3UJOA 1EAH1 1HKDA 3M3CA 4AVAA 4LT5A 3TB0A 3ZYIB 1AHSA 2E7TA 2GN7A 3POEA 3IDCB 4META 1EYBA 3ALQA 3C8XA 1V9U1 4XYXA 3MIHA 3NAPA 4AXOA 3VD7A 3M3OA 3VBSB 3AC0A 3RRDA 3WW1A 2D3RA 2Z2SB 4Q8LA 4DRVA 5FYUA 1J3PA 4A7ZA 5J1XA 1VB2A 1CAXA 1UIKA 1W03A 2AREA 4LPLA 3FBMA 3KV5A 3WQ0A 5K0UC 2WJSA 3PVBB 5KR7A 3N7LA 2YFZA 2NLRA 2C1FA 4QM9A 2PHRA 4AAPA 1S0JA 1UOFA 4LBJA 4R4XA 2GDFA 2OKXA 3ZFFA 5T3NA 4AHXA 2V72A 4LUMA 3USUA 3HN3A 3S30A 5AFEA 3P6BA 3R05A 2WS93 3D6EA 3ZYJB 3VL8A 5C3SA 1XNKA 2W46A 5FIXA 5K0UB 3UKNA 1C28A 3N9PA 2CGPA 3PUIA 1TNRA 3M3IA 1XNTA 3V0BA 2XUEA 1A8MA 1TME1 3GHMA 3H0OA 3VZLA 3ZSLA 3KT4A 3RJRA 2QZ2A 4LBKA 5F2SA 2P3YA 3T0AA 1UZ0A 1DQ1A 3JBG2 4NIDA 1PNGA 4IEUA 3USUB 2V73A 5A3LA 1NCQC 3B00A 5DPNA 5EXOA 3WQ7A 4AI8A 2FDGA 1PZ7A 4PIYA 5FXXA 1OFSA 3I54A 1PO21 1BYHA 1QIQA 3S7EA 5JOXA 5FDBA 4Q0UA 2YPJA 1S55A 5IVBA 2NN8A 4RGKA 2VTXA 2YU2A 4DO0A 5FZ6A 2HEWF 3KT7A 1UL9A 4QB2A 2D3SA 3ZOIA 2J1UA 5AC92 3PJQA 1Q5OA 1NCRC 2AR6A 4FQZA 4Q4W3 1F9KA 4NROA 2RS53 3VHRA 4MV2A 3ZN6B 1X9PA 2Y8KA 4ZS2A 3T4HB 3VBRB 3B93A 2NQYA 4K40A 1WUVA 3OD0A 4PLOA 3DN7A 3AZYA 2XG3A 4XFGA 2XJQA 2YC0A 5LATA 2RJKA 4D6QA 3JCIA 3PDQA 1RHI2 3WF3A 1HDKA 1UAIA 1RUH3 3FUQA 4E9KA 5HCHA 4R4ZA 1HB4A 2GNMA 3FBYA 4BLIA 3Q8AA 3RZGA 3NO8A 3CBNA 1JZ6A 1QJY1 1H1IA 3IN9A 4QX3A 1QQP1 1TVGA 1IOAA 3DGTA 3N9NA 4IE5A 2HEVF 4O7XA 3A7QA 1QJZA 1NQDA 3ES4A 4AGRA 3JD71 3MFAA 1V6KA 2D6PA 4OI4A 3NV4A 3VZKA 4XHXA 4CDQA 4BLJA 5CFCB 4XJWA 4UFIA 2XL9A 3WT3A 5JXJA 2PQSA 4DUVA 4KGGA 2DV9A 2X8KA 3MBWA 3ZXFA 1R64A 2Z79A 3IPVB 3O1UA 1VE0A 3NKTA 4QMAA 2P6CA 3E6BA 3JB8A 4JDOA 3WY6A 4HN0A 1GU3A 1VAMA 2CWMA 1VBB3 4CYDA 2WNVA 2WZPP 2ET1A 2WNUC 3IKWA 4NJ4A 4HVQA 5DUUA 4QM8A 1H2MA 3EHKA 1LOAA 2BEOA 2DVFA 3WNKA 4LA2A 1VB4A 2X29A 2WZR2 4BB3A 2HWF2 1LCLA 5AFBA 1Q8OA 5FY1A 2GU9A 4XQ4A 1DBNA 5KHGA 2ZZJA 1NAEA 3MF9A 4PDWB 4PLNA 2OUJA 1CAVB 4M0NA 1C8M3 1GOHA 2RMU2 4OHYA 1RYYA 1XYPA 1DQ2A 3R4SA 5FLHA 4AVSA 3SEEA 2PLV3 5FMDA 3ZXDA 1NY72 5A33A 1JZ3A 1NA1B 1JYIA 2BNOA 2WR9A 4Q4Y1 5GALA 5FV3A 5F5IA 4JV4A 3PHMA 5CKQA 4Y5SA 4ZZ8A 4RS5A 2PHLA 1MEC2 4IE6A 1DGWX 2W1SA 4XQDA 3Q8CA 2QNKA 4CCDA 5FPAA 2R0HA 4YRDA 5LY2A 1D2QA 3DUIA 1VRH1 3KQ4B 3OOXA 4BQ4A 1K5MB 2DCJA 4XJ9A 2R063 3CDZB 4YNIA 2YMZA 4DXZA 3NVCA 3VBUB 5A33B 5I8TA 1F15A 2VMHA 2Q4SA 4QHBA 2Q8EA 4XXPA 2LW8A 3FLPA 4GWIA 3ORJA 4KWLA 2J1TA 3CZJA 3POGA 3S7IA 4Y1ZA 3O1PA 2WZEA 1UZVA 3GBFA 2WLPA 2VNRA 1WGPA 1PIV2 3HQXA 3T1LA 1JW6A 1AR73 5F2WA 2AEYA 1HJGA 3FE5A 4XILA 3E5XA 4XMIA 3VHOA 5CU1A 5KWRA 1I3HA 4L11A 2Q30A 2ORZA 3G7DA 1JODA 3J7MA 3OBTA 2NM1A 1I5ZA 1FOD1 4RYDA 1F8VA 4RQPC 4N53B 4DB5A 1ENQA 3WP3A 3E5UA 4BQ5A 1Y4WA 1Z0HA 1QJU1 1UF2C 1WBFA 1O8SA 2A3XA 5F5QA 4BK4A 5G05L 2WFF1 2VE1A 5IHRA 2QQPA 1IPJA 3WNPA 4DEQA 3ZSJA 1CAUA 5T5OA 4ITCA 3ZYRA 1ULOA 5C7GA 3K3OA 4HSLA 5F39A 4KWUA 4HK8A 3UJQA 3TOJA 2ZTNA 2BFUS 2AUYA 4JGZC 4UI9L 3ES1A 3CNAA 3PUQA 1XJAA 4K9SA 3JD73 3H1MA 4TWTA 3PU3A 4Y4RA 3C3VA 5DXDA 3POIA 4GJYA 3NNLA 5HCBA 5FMCA 4V1PA 2YFUA 1PGW1 1MEC3 1UXZA 2C0ZA 1L7QA 3D0SA 3J7HA 3UKVA 5HI0A 2IXLA 1IPKA 1BK0A 3POYA 4OUEA 4TSVA 5DAXA 4I0WB 5GLUA 3ZX7A 5FBZA 4DUXA 4YW4A 5DAQA 1F2NA 4XAAA 1DGRN 1UO9A 2DYCA 4LKEA 4OFGA 4XXAA 1XXNA 1X33A 3OG2A 4GXLA 1FPN1 1W6MA 1XE0A 3OEAA 1S2EA 1K3IA 4P00B 1UYXA 4CDWA 1UYZA 1WW6A 2C9AA 4DXTA 1JMUB 1GWKA 2W2IA 4ZU7A 2Q8CA 1VBE1 2QBXA 2YG0A 4PT6A 2G9ZA 3AMHA 3B5LB 3VB9A 1D4M1 4D6SA 2R6QA 2ZX3A 2GC2A 2ENRA 2AGSA 3VHPA 3ZN6A 4LR4A 3CLPA 1UWWA 1V6LA 5LA9A 3LKJA 4S2DA 4Y22B 3RMYA 1BBT1 2DUPA 3J8F2 3WDYA 1SFPA 3RDIA 3EXUA 2IXIA 1FXZA 1YHFA 2VZTA 5LW9A 5JOYA 3DECA 3BI3A 4U36A 2QQMA 1IZ3A 2PFWA 1LJ7A 1YLLA 2XONA 2XQRA 2JWPA 2JE9A 3DYPA 3POBA 4GD4A 4UXAA 2ZHNA 5FYSA 3TRSB 4Y26A 1LOEA 3K51A 2IC1A 3NJXA 2JD9A 5IK7A 4CCLA 5IFPA 2G9FA 4FFIA 5A6ZA 5I93A 2BTVC 2YGLA 1URXA 2B9VA 2CDOA 2VGDA 2VOKA 5IVYA 3VDDA 1HRI3 3POFA 5F5AA 2W92A 3MHZA 1PVC2 2P3IA 3KVAA 5GZDA 3T09A 4CDUB 2UY9A 3BODA 1RB8G 1YI9A 2BV4A 2GP5A 4LO4B 2XUMA 2EF6A 2OYZA 4LJHA 1SLBA 4NPRA 2FCVA 4LBLA 4N43C 4QD2A 2IWGB 4ZKTB 2JX9A 3U4XA 4CCCA 2B7YA 2J22A 3ACFA 4N8MA 2Y26A 4GWMA 3ZMNA 1AR91 5FZLA 3THTA 1OVSA 1RINA 1RXFA 5BNPC 2R49A 4YVWB 2O1QA 5FMOL 4A2UA 2WZ8A 2HWB2 4I02A 1SZBA 1HN1A 1ZBA2 2XJRA 4ARXA 2Z4FA 4QPWA 1C3HA 1DQ4A 2RVAA 4CEYB 1HN0A 5KHJA 2VZ1A 4P9LA 4XUQA 5D1IA 4BIFA 4NPMA 3IDAA 1CIWA 4GULA 5HCFA 4H55A 4FAGA 3BTXA 2QQKA 2DWRA 2R32A 1JUHA 2WUHA 5FXZA 4UW3A 3JB4C 5C8CC 2A6WA 5H9SA 1KD7A 4I3PA 5BXXA 1TME2 2MEV3 2E53A 4HK9A 4D3WA 1ZRFA 1GSLA 2Y60A 4JAAA 2QKDA 4ZXKA 2VNOA 4C1WA 5JR2A 2BWCA 1RUE1 4ZONA 4GAZA 5HBAA 3NAPB 4N90A 4DY5A 1TQ5A 3EB7A 4E8CA 1G9FA 4GB32 3BTZA 1N1YA 4YVSC 4P08A 4PI2A 2R072 4OI2A 1RMU2 5JXHA 5C4WA 2WA3A 3VBUA 1RUF2 1VMHA 1PO22 5IATA 1BBT2 3J8F1 1U5ZA 4RR3B 1O6UA 1GICA 1DQ0A 1QDOA 1OUXA 3WF4A 4B4RA 5FXWA 3VN4A 5JZGC 3MUY1 3I7DA 3KV6A 2VVFA 2DBIA 3PVEA 4QKDA 5AC91 1PGL2 1UU6A 5F3IA 3W9AA 3VL9A 4LHKA 3LIGA 3V0BB 3OY8B 1SEFA 1V6JA 3IM0A 3NNFA 1JH5A 1AR93 1YQ6A 4MSVA 2ZGMA 4X6RB 3UGHA 4IV3B 3IIAA 4C8DA 1IHMA 1XSRA 3M70A 4COVA 3I3BA 5A3PA 1ZBE1 1HIXA 4A6OA 4CU9A 4ASMB 2HWC1 4G4FA 5LBFA 3W5MA 4KG0A 5D2AA 3ZXGA 1FOD3 1GBGA 4IGPA 2VUCA 1AR63 1RUC1 5D8AC 2XJTA 5A7WA 1MACA 5JWPA 1OMIA 5A32A 3WOGA 1WCQA 2WT2A 4IV3A 1WMXA 1MS8A 1HRI1 4XJAA 4WZCA 5L36A 1Q3EA 4Q4V2 1HV1A 3A0KA 4YARA 3LOBA 1AX0A 3EJKA 5CEHA 3RZZA 4XZUG 4I09A 4YG0A 1IGOA 2GC3A 3QCWA 3CQOA 2HYKA 2MNGA 4BCUA 5IAXA 4XF9A 2RR13 1JYXA 2R061 2RM23 4OZOA 5KXCA 2FDFA 1UNBA 1PK6C 1XU2A 2D7FA 4Q4W2 2V4AA 2V5YA 5IJRA 1QNWA 5K9YA 4XF0A 1UY3A 3AZWA 3ZYHA 1BBT3 3AKTA 4JCKA 3VZMA 3ILNA 4B3NA 3DYOA 3Q9OA 3PIJA 1S0IA 2LM3A 3IT8A 4ATFA 3BIEA 4RL7A 1HX6A 1DGWA 2DVBA 2RS33 2JE8A 4IEVA 4ES9A 2ZGUA 3IWZA 4XF3A 1RUE2 4BMEA 1YQ5A 5I0DA 2QZ3A 3FJSA 1AZDA 1YFYA 2H0BA 3FX3A 3NSTA 4MOAA 4MXWA 4SLIA 3VBHA 1K5MC 1VBC3 4PLMA 2UU8A 2V5DA 2ZEZA 3NW4A 5FZEA 3M4FA 4EROA 5FR3A 1JYCA 2D43A 1FV2A 3ZXKA 3OUJA 5FPVA 1U12A 2RMU1 3IB3A 2XDVA 4KG8A 5BPXA 1RUF3 2X10A 4XJUA 5CIRA 5JLVA 5FPZA 2R30A 1H1AA 4Y4YA 1JHNA 3DPRA 5H9PA 3ACHA 3WINE 5IVJA 1IS6A 3B9CA 4A4AA 3T4VA 2DTYA 1MPXA 4W6YA 1HXS1 4LO6B 1MEC1 2MPFA 1SG3A 3ELNA 2VZRA 3AXEA 1R081 3WW4A 1UKRA 1UX6A 1VRH2 2E32A 4XDOA 4NMIA 3FWEA 4KU8A 1EPWA 3TEXA 4AFBA 1G8WA 5EP9A 1W3XA 2AEZA 4M4PA 4Q2FA 2HWC2 5DAVA 4XF4A 1X8MA 2YHJA 2ZEXA 3O1MA 2B46X 4EV0A 1PK6A 1CAVA 1BVVA 3ACIA 2PHUA 2YPDA 2ZA9A 4GKXA 5AVAA 2JXAA 3VKFC 1H8TB 5CADA 1OA4A 1AL22 3B01A 2O8OA 2QE3A 2VULA 2ATFA 1QJEA 2WQZC 2BGOA 2E33A 3I3EA 1D7PM 1I9RA 3SNMA 4XDQA 4E8DA 1V00A 2R16A 3AMQA 5FUPA 3GJBA 1AR71 2HWD1 2ZGOA 1PMIA 4KBBA 4KNCA 1XNCA 3URFA 5FY7A 5LBBA 4LBNA 2D40A 2WNUB 1PM7A 1OQ1A 3HBZA 1LEMA 2RS51 3K4AA 2VQ0A 3I2KA 4Q4W1 2ZKLA 5EPAA 1CAXB 3ZXLA 4DEVA 1JZ4A 1Q8SA 3T0BA 1Y9GA 5DDJ2 2WA4A 1ASJ2 2ZX1A 1UN1A 1W39A 1K45A 4FOVA 5B2GB 5FPUA 4IEOA 2QQVA 4IE0A 3S5AA 3T3YA 4M3CE 2GMPA 2ZGNA 4XFCA 4ZPIA 3ZSEA 1ODNA 3TN92 1FMD2 5A3UA 3IDEA 3ILFA 1QJFA 5KXEA 4ET7A 5FY8A 5L9BA 2DBNA 3LDBA 4NR1A 4PBPA 3I3MA 3WG4A 2QQJA 4BQ3A 4N53A 2DDUA 2QDRA 2W94A 4IERA 3VBUC 1AXYA 3R6SA 1RXGA 5JCTA 2F4PA 2ZMLA 2XR4A 5BNNB 4TLGA 3VBSA 1VBE2 2OXBA 1AL0G 4AFAA 4CA9A 5C9AB 4QDSA 3T0DA 1B35A 4L97A 1H30A 1PO11 1WLWA 3TAYA 5LA0A 1GUIA 5EHDA 3GCWA 5FZ8A 5T5PA 2JDKA 4IEYA 4LNVA 2W1UA 4GJZA 2YC2A 3NJVA 3CF6E 3OGJA 1VMFA 5ACA3 1VBB1 4NHYA 5K4LA 5JPNB 1EY2A 1G9BA 1ZBA3 3KGLA 3WNNA 1C5HA 5EQUA 1W8FA 2WWSA 2YUEA 2KM2A 3LAGA 3AL5A 3ZFGB 3V64A 4MUVA 3LPFA 1DGRA 3OYWA 1W05A 1WCSA 3N9LA 4XZPA 1W0NA 4OHWA 1W6MB 4LOTA 1QU0A 3VBRA 1DCSA 1RJ7A 1OT5A 5JIUA 1EP0A 1YIFA 1RUG3 4LIVA 2R0FA 1PNFA 4FPHA 3ZYFA 4CDXB 4URAA 2F17A 2K2SA 2CY6A 1OOPA 4JX0A 5FOJB 3GALA 1I5PA 3ZSMA 1S0DA 4HPKB 5FMBA 3MLKA 1AR72 4XTMA 3WG1A 1L3JA 2PMWB 1RHI1 1UKGA 1AJKA 4R52A 2D6MA 1JI6A 1EUUA 2C4XA 3PTRB 4GMP1 4D6RA 2A6VA 1JTZX 4FI9A 2VOVA 1W2UA 3J7NA 4CU7A 2HWD3 3H3ZA 4IEWA 4MGYE 4CDXA 3M3EA 2JIJA 4YGBA 4C0BA 4TYSA 2ZOEB 3VDDC 1YQCA 3GBGA 2ZGSA 2VW1A 2GNTA 2VOWA 1YI7A 3AXDA 5C3OA 5K8SA 1TE1B 1H1MA 2J42A 1FMD1 1H2NA 1HB2A 2HH9A 2W3JA 4KI5M 4UOJA 5T55A 2WNVB 4W4ZA 4AW7A 4IEZA 3WEZA 2UWBA 2WYSA 3GF6A 2W47A 5HPOA 5F32A 3I2FA 4WVWA 2H0VA 3DKQA 1RUD3 3K4ZA 3RZKA 1NCRB 2C26A 2IVJA 1Z78A 1LOCA 1VBD1 2D98A 4LLOA 4B7EA 3ZFFC 1OHFA 1SBEA 1WA6X 4RFRB 1LENA 3HR9A 4GQ7A 1RJ8A 2BGCA 3HMYA 4AEJA 1C1FA 5KC5A 4P14A 4MG2A 3OSDA 5F9TA 2CDPA 4DNYA 2Q1ZB 5LEJA 1MZ6A 3EMRA 2MEV2 1TME3 1AYM3 4IL7A 1GQHA 2W9XA 4ZU5A 5C3RA 2WO1A 1FATA 3OCPA 1PO13 3IBMA 3RZLA 1UPIA 2ZAAA 2WS91 2QDNA 3TEWA 1LB2A 1UOGA 4COZA 3U14A 1O4YA 4I30A 3CJIC 4AVTA 1GNHA 3LA3A 3SH4A 5HV4A 1IKQA 1YQ8A 2X5IC 4QAWA 4LBQD 2VCAA 5IYYA 1S0CA 5KBFA 4BOWA 4AAXA 4CEWC 3RZJA 1HQLA 1RUNA 3NMBA 1G86A 3ATGA 2OS2A 1UY4A 4CCNA 1GKBA 1OA3A 2ZGPA 4H3WA 4Z92B 5C70A 3I59A 3GBWA 4R8HA 3AP7A 3KCXA 4JTNA 5JDBA 1VP6A 4K1YA 5A7OA 1KJRA 3LD8A 2Y6GA 2TEPA 3GZTB 3WDTA 2DF7A 3WHTA 1K42A 3M1HA 3JD72 5EJ3A 5BYNA 3VZJA 4LOSA 5DAPA 1BVP1 5T54A 4NIAA 4COYA 1UZYA 3O1SA 3MUZ1 3ON7A 2ZPXA 4Y24A 3BU7A 4KWJA 5IAVA 4CU8A 5IVFA 3N4MA 2CV6A 4QXKA 5FYTA 2P3JA 2WQ8A 1CZSA 2ZEWA 3OPTA 3D0JA 1L7LA 1SBDA 1OH4A 4FOQA 4NE9A 4WVMB 1OSGA 1DGLA 4XTPA 2B39A 4XUOA 4QXCA 1W8WA 1ZZ6A 2VNGA 4YM2A 2EAKA 3QH6A 5FKBA 4AOCA 1AYN1 3PVOA 3I97A 4Z2AA 4BQYA 2F6BA 3CO2A 3U10A 5DMYA 1G9AA 1AR61 2ORXA 5FYBA 5LK7B 1JXNA 2K46A 2WO7A 3WNXA 1ONAA 4SBVA 3HN1A 1W8NA 1ND3A 1NT0A 4QX2A 2IXHA 1ZBE3 3UESA 1O91A 3S0MA 4EN6B 5KHIA 3UL2A 1QWRA 1VAKA 1OURA 3BOWA 5EJZB 2RDRA 4OZXA 2ZGKA 2XJSA 3WDUA 1N1VA 2ADDA 3ZR5A 5I91A 5FREA 1F31A 1PGW2 1PX4A 5A32B 3HD8B 4JDNA 4OHZA 2BNNA 1LECA 3RWKX 1O4TA 4EN8B 2OPKA 3GZUC 1Q8VA 3ZDSA 4BYYA 3BGAA 1YCIA 1WMFA 3FLTA 3GDBA 4XBNA 3AKQA 4ISQA 4E27A 1LU1A 4LK6A 1VBA1 4FPFA 4A3XA 3M3QA 4OULA 4PCRA 5DZGA 3VKMA 2YZ4A 5FLJA 5CA6A 1KFUL 3TWIA 1S0GA 3LOIA 3ZLIA 5IVCA 3MF6A 2HWE3 2CNAA 3ZVXA 1LHVA 4NPLA 4NVPA 2JICA 4Y1XA 2V09A 1E57A 2H6BA 1AYN3 4GH4A 4DOUA 1ULEA 3CJXA 5FZHA 2JDZA 5FZBA 4OLLA 2NP0A 1Z7S3 5C3QA 1WKYA 3GJAA 2E7QA 1VBC1 1V0AA 1DDLA 1TZOA 3WP4A 4EN7B 4FTBA 3FUOA 5L73A 2B8MA 3ME2A 1NX9A 2XJUA 4G3YC 4LBQA 3MGUA 1NZCA 2QVSB 3DXTA 2VD7A 1W6NA 2J7MA 2WYFA 4XMAA 4N43B 2EIBA 1W8TA 1LULA 4CDWB 5BNOA 5CFCC 3P3PA 4MO3M 1GNYA 1SMVA 2XBO2 2ZABA 2JD4A 3SQOA 3KT1A 5M0TA 1HB3A 4LHSA 1ULFA 1ACCA 2A71A 1POV3 1KEXA 1COV2 1QQP2 2XVLA 3M7AA 1FAYA 1W06A 4LBQB 3WLUA 3WV6A 5FZCA 2FDHA 1XNBA 2HWD2 2L9LA 3WR0A 4F3JA 3I3DA 5GLWA 1W6OA 3NJZA 1OF4A 2BZDA 3FFQA 2KXLA 5A1FA 4N43A 1SDDB 4GZ9A 4IV1B 1PIV3 4TTGA 1XSQA 2RS52 4U2AA 3X29B 5KXBA 2X53S 1NLRA 2VXRA 2JDAA 3AJZA 1X8EA 3PIGA 1B35C 4IDZA 1W99A 3CZUA 1BEV1 5ABJA 5FO8B 3EQEA 3WDVA 5DDJ1 2E7AA 2JEMA 3H50A 5FKCA 1OKQA 4UFLA 4Q5OA 5DZEA 4AI1A 2HWC3 1VLNA 4RR3C 4HVOA 1FPN2 5F6LB 4OYUA 3DV8A 1K12A 2JENA 1ZRIA 2VZQA 4OHXA 5FP9A 3WF1A 5C8CA 1VBD3 1F4HA 3AP6A 3JQXA 3VDBA 2WN2A 1DHKB 3WZ1A 4Q0SA 3KVBA 1UMIA 2A6YA 2HBUA 4GA9A 4Q26A 2ZMNA 3ZXJA 2VMDA 5FWJA 1D4M2 4QQHA 4BPZA 4Q4X1 2VZOA 5ISLA 1SLLA 1MVEA 1UYYA 1WW7A 1ULDA 2UWAA 2FZ2A 2CGOA 1QF3A 2XLAA 1AR83 4MX3A 2D5FA 4A41A 4OVEA 1S0BA 1X36A 3AZZA 2G1MA 1RUJ1 4C90A 3SISA 3ZKUA 3BB6A 4XW3A 5AVPA 2JDPA 4BQXA 1LNSA 2JG8B 1QXJA 3UKTA 1F5JA 4LLFA 1MZEA 1VBE3 3OTFA 2R071 1F5FA 4FQ4A 2PHWA 3USSA 2OQ7A 3OGRA 3D82A 4Z82A 4AI0A 1VBC2 5FZAA 2F4LA 2CYFA 1OF3A 4NN0A 4BXFA 2RDQA 2PQQA 2Z42A 1VIWB 4QDQA 4RHV1 5BNQA 4LE3A 2VOTA 1PM4A 1T2XA 1R1A3 3WW2A 5A3NA 5GZCA 5KHKA 4EQVA 5C5UA 2ES3A 2VPVA 4W8JA 1D0HA 1ENXA 5BUVA 2I74A 3EYPA 5HCAA 1W9TA 5K7PA 2BFUL 1H4GA 1W0OA 2J1VA 2QJVA 4IGOA 4ZS3A 5IT6A 4XCBA 1RUG1 2JKXA 2BVVA 2EXKA 2VMCA 1LR5A 1YFUA 3NJYA 2ZCWA 4FPGA 1COV1 1MS3A 1FX5A 3QD6A 4LE4A 3JUUA 3PMSA 4HLTA 5FZ3A 1QJX3 1XBFA 3LWCA 1B35B 1U5XA 1RGSA 3ZKYA 5FPXA 2XQXA 4AGVA 2A73B 4PQ9A 2VVEA 2G4IA 1D2SA 5FZMA 3OGSA 2ZX0A 4LO8A 4P5YA 1R091 1W9FA 3DKWA 1SFYA 1ZBA1 2ET7A 1QJU3 2YY1A 1OOPC 2FZ1A 1HV0A 1BKZA 3VD9A 1US2A 4YFZA 3MDPA 3I2DA 1GP5A 4JKLA 2VZSA 3ZM8A 1EV13 4LIUA 5DUXA 2PA7A 2DCTA 4Q8KA 1UPSA 2WO3A 2WQ4A 4OMDA 3D3AA 1NG0A 5A3OA 3SITA 4F7ZA 2Y6LA 2ZGTA 1UY1A 3KV4A 1ND2C 3VZOA 1DZRA 3OBRA 4Y20B 1TMF3 1W9YA 4BE3A 5GZEA 3OGVA 1OOPB 2A7AA 1GZ9A 4F8AA 1DG6A 3P5BA 4NRQA 4P9WA 3NNJA 5EWSA 5FAXA 2W91A 1H6YA 5A7WB 3PU8A 3WW3A 1RVF1 2QQOA 5E8AA 5A70A 2ZEYA 1VJ2A 3PURA 2A3YA 4PF1A 3T1MA 1CAWB 5F1RA 1LESA 3OGGA 3ILRA 2GP3A 4N7UA 5DN2A 1U5YA 3HT1A 1V70A 4FCAA 3THDA 4LO5B 4AHZA 3VD4A 5HXVA 2RG4A 4PJYA 3ZFGC 1GZWA 3AYAA 2GN3A 3J26N 4Z1VA 1SLAA 3LA2A 5LBEA 1SLIA 1WW5A 2VW2A 1A3KA 2GH2A 5GLZA 3RGBA 1CWPA 3RG0A 3W21A 4B1MA 3ZN4A 1REEA 2DFCA 2PLV1 4AQTA 1PZ9A 1TMF1 1G9DA 4IESA 3RI8A 3AZVA 2ILMA 2OVUA 4BZ4A 3MFCA 4J6GA 5A1LA 3H42B 4BIOA 2LRPA 1CJPA 1KJLA 1Y9QA 1W6QB 4FP2A 2R041 4J1XA 4L0PA 5JSPA 4Y3OA 5BNPB 1RUC2 1SDWA 1YXWA 1QOOA 3INAA 4RGGA 4YVWC 1EV11 2TUNA 3ZO0B 3KF5A 3ZYGA 4IV1C 2W1WA 1F35A 1OVPA 1X7NA 1JOBA 2JG9B 2RV9A 5LA2A 3VBHB 1WLTA 1OUSA 1PK6B 5EFUA 5FY0A 2BU9A 1XE8A 1YC61 1B09A 1WD4A 2VUAA 5DG1A 3IDBB 3GYDA 4INDA 5EYYA 1OQDA 1W6QA 2CGNA 4KBZA 1E5SA 1KS5A 2DCZA 4FFGA 3U37A 3O5SA 5LRSA 1BMV2 4YSFA 1GWLA 3KM5A 2R062 3P3NA 2VAUA 2WFF3 4C1XA 3CIHA 1NKGA 1ZZ9A 4N9IA 4FVVA 1AR92 3T08A 2LS6A 2WNVC 1QH7A 4MGZE 1QDCA 1UU4A 1ZREA 1C1LA 1H0BA 1HXS3 1QJY3 2VL4A 3HJRA 4R9DA 4PBOA 5KHHA 4E4SA 5HXMA 1PVC3 4YPJA 4YZ1A 4LMFA 1HQWA 4YGCA 3H3LA 4ORFA 4QX7A 4A3ZA 2W39A 3BCWA 4HETA 4AK3A 2QQUA 2XXZA 2XKOA 3HWJA 3KS7A 3I4IA 2VMGA 4CXXA 4RS5B 2J1RA 2E26A 4FFHA 3FLRA 2DFBA 3L2YA 1CONA 1QMJA 2VVDA 2XL7A 4LKSA 3VDCA 3ZFEB 5JXGA 1QY4A 4KMQA 3TN93 4JHZA 4DZGA 4P9XA 2RJ2A 4XIOA 2RS31 3CMGA 3WQ1A 1RUJ3 1U5IA 3MO4A 4CEWB 4DY3A 1E5HA 2XMLA 2VZUA 1VBA2 5C5TA 3WDXA 1PMJX 2W52A 1R082 1GFF2 5DAWA 3V56A 4DINB 2VM9A 4OQ8A 3WVJA 4DRRA 3MEPA 2ERFA 2RM21 3CEWA 3FMGA 5D8AB 5I0TA 1RVF3 1RUD2 2ZAHA 3A22A 4OCTA 2BW8A 1M06G 2JDYA 4WVVA 4CEWA 5IW0A 2O8QA 4WBBA 2Q8DA 1LGNA 3Q8EA 4JGYB 2R042 4HVRA 2BOJA 3E1F1 3HAGA 4NIHA 3IAPA 1UY0A 3AB0A 3U4SA 1QH6A 1VBB2 3CHXA 2DVDA 2QQLA 4CCOA 1MQTC 2VG9A 2IZWA 1Q56A 1IPSA 1TNFA 2BJSA 1AL21 3H7JA 3POSA 4J1WA 5FXVA 2PHTA 2XOMA 5DG2A 5JMOA 3AM2A 1U0AA 2GC0A 3ST7A 2P1BA 2BBVA 3HBKA 4ONUA 3U78A 1G6NA 4Q0PA 1NXD1 2ARXA 3GM8A 3I2HA 1SCSA 5FY9A 1ZZ8A 1CN1A 2CAUA 2ZHKA 3HEIA 4IETA 4HPKA 3RYPA 4AFCA 4FAHA 4LORA 4BM8A 4E4ZA 4AF9A 3HNYM 3PUAA 5A6QA 4P5HA 1DYOA 3G6JB 3KCYA 3KSCA 1CR7A 2ZXQA 1RUH2 2FDKA 4D7SA 3W59A 4XFIA 2FMDA 2GAUA 3B69A 3SCGA 1KRIA 4CXYA 1WMEA 2DUQA 1QQP3 4JRLA 4M4RA 1LOGA 1QOSA 2O0OA 5LWBA 3TYJA 3I3QA 2R1DA 3N36A 2GALA 4V2WA 4CP0A 1CAWA 4YVSB 1NE6A 1WD3A 1KDMA 2BQPA 1UZWA 1R1A1 1H9WA 1Z7S1 4JGZA 1R1ZA 4RHV3 2VTXJ 1NY71 1RUE3 5C33A 4XETA 3HQRA 2UYAA 4L99A 3T2TA 3M8LA 2RS32 4UF0B 3MLJA 4CP2A 1ENSA 1QGLA 3OJBA 2HLEA 4JKMA 5CYYA 5FK7A 4EWAA 3O1RA 4V2VA 4FSJA 4DXSA 2G19A 2YU1A 5F7UA 1RTVA 2BP6A 1T6GC 4H2AA 4M3CA 5A3WA 2XB6C 4CTEA 2KA3A 4LKDA 4UF0A 3GCXA 3JBG3 2VR4A 4AEDB 5A6YA 2JDNA 5BNOC 1CGPA 1N47A 3DL3A 5FY5A 4J25A 2HEYF 2Y64A 1LOFC 1BLZA 4CCJA 1OLME 2CU5A 5LB6A 1JZ8A 2BRTA 3DXUA 3BYWA 1XQNA 4PDWA 2CHHA 2I07B 3LEMA 5I0RA 3RVHA 2PTMA 1GMMA 4ZXEA 4N53C 3D8CA 4YW2A 1O59A 1ZA7A 3NRUA 5DABA 4AFMA 2G9GA 2XWBB 4AI2A 4AEDA 1TEIA 3LFMA 2E31A 2HKXA 4CP9B 3PNAA 1P8JA 4AVBA 1KXGA 4FOWA 1XC6A 2HBTA 3VBFA 5GZGA 3IPVA 2Q1FA 1NOVA 4B1LA 2GNDA 3WD5A 3H7YA 2VQTA 3KHBA 2GSYA 3VKNA 4Q1RA 3O0WA 1ENRA 2VZVA 4NHMA 5DUWA 2OZJA 1W2OA 1OLMA 2D6NA 2GZWA 1ND2B 2XJPA 1Y3TA 4YFWA 3VUOA 1OA2A 2XLGA 1YO8A 1FV3A 1L7RA 2VUDA 3NV3A 1R092 3LSDA 4CPBA 4ARYA 4I01A 2YYOA 3VBFB 3WP5A 1CJDA 3ZFEC 1UXXX 4LXLA 4D7YA 4WVMA 4MH0E 1GP6A 5CAZA 3WXPA 3THCA 4D69A 3VDAA 1YQ2A 2BNMA 4X8NA 4PHZA 1ASJ1 3FZ3A 3LFIA 1H9PA 1RUI2 1Y9MA 2B9UA 2P34A 5CFDC 3MPBA 4EZHA 3C2UA 4OHVA 4QQPA 5FYYA 4XUPA 2QQNA 3BN6A 3DPRC 4EN9B 2HJIA 4UFHA 2XLFA 4L8QA 4MLOA 5FPLA 3RNSA 1RITA 4HN1A 4QU2A 1ALYA 1W6PA 1N3OA 2X09A 4LBOA 4S2FA 4Q1PA 5FYVA 3VLBB 1OFNA 4Q0QA 1MS4A 4D8MA 3OY8A 2HWE1 1C8M2 1REFA 1OC1A 2Q0AA 3AKSA 5CFDB 2UY8A 2C24A 2RHPA 1VPHA 3HT2A 2FCTA 1US3A 4TXWA 4JVAA 2VECA 5SV8A 5JZGA 2HWF3 3K75B 2VCBA 3MV11 1W6PB 3VGIA 4JDMA 3OB8A 2AACA 1RL3A 5C9AA 2E63A 3PUHA 3IIIA 2PAKA 2XWJB 1MS5A 1UIJA 5ANQA 3SHRA 2N7GA 4AQ6A 1SBFA 3OEBA 2FDIA 3KMHA 3WF0A 2P2KA 2PLV2 3T2OA 1A34A 2VCMA 4DIQA 4NIGA 4AFDA 4COWA 5E6HA 4EYUA 5F5CA 2SBAA 3A23A 4MGSA 1NE4A 1PGL1 2C6SA 3H9AA 4L9BA 1JN2P 4YWAA 5IK4A 1IS4A 3ZPOA 4AE2A 2NMNA 1FNYA 2A3WA 2BBAA 4O61A 4NHKA 2WSUA 2PN5A 3AP4A 5IUQA 1G7YA 1LHUA 2NPIA 4HONA 2LUWA 1MS9A 3K3NA 4HSJA 5FYIA 1J1TA 1DIWA 4MVTA 2EAAA 1UYPA 2FDJA 4CCEA 3KWVA 1UOBA 2WN3A 4XCAA 3AMMA 1RHI3 3OBZA 4JQRA 4AR2A 2I2SA 5B4NA 4KWKA 5I8SA 2E51A 1JBCA 2IXCA 1QJX2 3ZPYA 2B5HA 5G04L 4MXWB 4MGIE 2RR12 1VRH3 2PHDA 3WQBA 3C7EA 1LGBA 1EUTA 2EIGA 3SKVA 1AF9A 1HRV1 4R9CA 4E4HA 4LEJA 1GLHA 4IEQA 4CDUA 3B9IA 3AVSA 4QPIB 5FZFA 1XOYA 4OI0A 2WFPA 1WZXA 5CBLA 2D44A 3RZHA 2CL2A 1DLCA 3AYDA 4XFFA 4OI1A 3UV9A 3A21A 4NHLA 4UT5A 1JYNA 3L2HA 4QKBA 2OIIA 2EXHA 3GGLA 2D3PA 4OMCA 2E6VA 1ZNPA 1POQA 2Y6FA 3MIFA 5A7PA 3DCQA 5BNOB 3KV9A 4DS0A 4ZHNA 1PGSA 3J4UH 4XIKA 2Q8OA 5CKNA 4PF5A 4QPIA 4CVUA 3LDKA 1VBD2 4HL0A 4AVCA 1GWMA 3OPZA 3SCFA 4HG6B 4Q0VA 5FZOB 1QXPA 1LGCA 5EJ1B 3CL1A 1QOTA 2PHFA 5L7OC 3QBQA 1O4ZA 5DUVA 5SV5A 5LA1A 4CEYA 3WG2A 1A78A 4FP3A 4Z8BA 1ZM1A 2RS11 1V6MA 1XU1A 3O0XA 1RUD1 2PYTA 2JG8A 2NMOA 4GMP0 4XFHA 4M00A 1UMHA 2Y34A 2BYVE 5FZOA 4B7KA 3ZMOA 4BH9A 4ES8A 3V0AB 4CDWC 4AEKA 1XB9A 4K1ZA 5I8YA 2BUKA 3PL0A 5A7NA 4MHRA 1CESA 4X6QB 1HJFA 2XVGA 2ZS6B 1DYPA 1OPMA 4NIIA 3VD5A 1SACA 2WNUA 4P9YA 2XBO1 1ULPA 1W04A 3KGZA 3RFRA 5E88A 1JS9A 2P3KA 4M0HA 3SKJE 3KD4A 1DQ6A 3TEZA 3MLLA 2WO2A 4Q4V1 4RR3A 3B02A 5FMOS 1H2LA 4I0BA 3V0AA 2ARBA 3LIHA 1C5IA 1PHMA 1V6IA 5FUIA 4CSWA 3ETPA 4FTSA 1IKPA 4QPIC 3KF3A 4QX5A 4WM7C 1H2KA 4WM7A 3GNEA 3ZYPA 5FP3A 4QU1A 3LZZA 2XH6A 4P9GA 5J37A 2YBKA 1OD5A 4RFT0 4RN5A 2KR2A 4B4PA 2EA7A 1PVC1 4KL1A 4WM8C 3HIFA 1X50A 5IK8A 1KS4A 3MV01 5FUNA 3CU7A 3KLSA 5A3TA 2LALA 4RQPA 4YZ3A 3WUCA 3MIDA 1JOPA 2ZMKA 4N7IA 4YW3A 4CPBD 5JOZA 4QPGB 5FRAA 4IE7A 1W8HA 4WM7B 2BPA2 1GANA 2LTNA 3AFKA 1YIPA 5FP4A 2ZGRA 1UD1A 4EE2A 1OD3A 1Q43A 1XYOA 2JG8C 4XBQA 5E1RA 4BJ0A 2AH2A 3A0NA 1J3QA 3NL1A 2ZBJA 1NCQA 1YJLA 1DP0A 2R7EB 3AJYA 3B94A 3FHQA 3N7JA 1R083 1W2AX 2FQPA 2EIDA 2HWB1 3F95A 4IXLA 4QPGA 4Y20A 3TNQA 3WCRA 5FOBB 5GLVA 5GJ6A 5BV6A 3R4UA 1CPNA 4NWWA 4AWDA 2JIGA 4Q27A 2Z69A 3V65A 4NO4A 2OQ6A 4BQ1A 4BXSV 3UNPA 2YB7A 2DTWA 1KFXL 3LA7A 2P6HA 5CVRA 3ROUA 4QPYA 3VBOB 4E2SA 2RMU3 4I2OA 1AXKA 3ENRA 2IUWA 1ZA4A 2DCYA 3N35A 1QKQA 3LGRA 4QGLA 4XC9A 5EYXA 1WLCA 2YBSA 5LY1A 2WBKA 5FO7B 1S0FA 4QB1A 3ZXAC 5A7SA 3VD3A 5JVVA 4BA6A 5L19A 4FPLA 2UYBA 1W8ZA 3AFGA 5C8WA 1I6XA 4YW1A 4AVVA 2JG9C 4HT1T 4CUAA 5ABJC 4R9AA 5FZ7A 3WHUA 4AGGA 1VRBA 1DU3D 1HRV3 2JECA 3H8OA 4Z2WA 1RUI3 4DUWA 5J96B 2XGXA 4LTAA 3E97A 5FYHA 4QWNA 2VCCA 5FWEA 2UURA 4FFFA 4MGTA 2W95A 4HKLA 1LHOA 3FHIB 4ZU4A 2D6OX 4AQ2A 4FPKA 3D4KA 3RYRA 4YZ4A 3I49A 1ZZBA 3WDWA 2YC4A 3KCCA 1O3TA 5D21A 4MADA 1GV9A 1YNAA 1GP4A 3NQHA 2VBPA 3D5OA 5CFCA 4XACA 4RGAA 2E9QA 4LUKA 4NRPA 2K0GA 2WIIB 2ZHLA 3LEGA 4WVZA 1J59A 1JYTA 3ITQA 4P9JA 3A4UA 2IXKA 4FXGB 4QQOA 3K46A 3U1XA 4UW5A 2JDHA 4ASKA 4XQWA 1H8TA 5LZ6A 2QQIA 1OKOA 4YM1A 5L9RA 5LCWL 4X8PA 3T2PA 3RI9A 1Y7BA 1ZYBA 3I2JA 2FBEA 2OZ6A 3OUHA 1IG0A 2ID4A 2JG9A 3S5QA 1DQ5A 1CVNA 2ARAA 3O12A 2CWSA 2HWF1 4LHNA 4FPJA 4CE8A 4JQTA 3I8TA 3S6PA 5I0SA 3J8F3 4GB31 3LEKA 3CJIB 1ZRCA 4QQ2A 5IVEA 2J1AA 4XURA 3EBRA 4YVWA 1RMU1 5FZIA 3FN9A 1RUF1 1V6NA 3AP5A 3B7MA 3RMXA 4BMBA 2WNEA 3THPA 2BGPA 2B45X 2W0XA 2R1BA 4N9HA 4UYBA 1HQNA 3H1YA 1WBLA 4YW7A 4JTOA 4P02B 2VTFA 4LA3A 3MPPG 4EWDA 1AJOA 1ZX5A 2MEV1 5D8AA 1YYNA 4NAMA 3RS6A 2XKPA 2BOIA 3RJ2X 3AKRA 3WUDA 1VALA 1W9WA 1QHDA 3WSOA 2RM22 1MS1A 2BVBA 1DFQA 3PMEA 2D97A 3AYCA 3LE0A 2ZHMA 5GLTA 2Y33A 1OBNA 3OPWA 4UFJA 4W50A 1X9TA 3SH3A 3BOPA 3VBFC 4Q4X3 3MIGA 4CUCA 3ZFEA 1OQEA 2CSGA 2DVAA 2OX0A 1NUKA 2NYYA 1JUIA 1RUG2 2W87A 4A7KA 4KQ7A 2WINB 1V9U2 3EO6A 2K9ZA 1W0PA 1N3PA 4HOOA 2EICA 3OUIA 1S2KA 1BMV1 4KH9A 1W9SA 4W65A 1WCKA 1ND3B 3J9SA 4QXHA 2XJVA 4MYEA 4XHBA 3E5QA 4QKFA 3U07A 3ZFGA 1YJKA 3VBRC 5DDJ3 3I2IA 3LEIA 3E6CC 2GMEA 1QJU2 1BK1A 5HV0A 3T2QA 1UU5A 2VJXA 1AX2A 4FPEA 1HLCA 3LF7A 3OBAA 2O14A 5C3PA 1XPWA 4LK7A 5CKMA 4XAEA 3RZMA 1LHWA 4GWJA 4A44A 4IE4A 1ZRRA 4DMIA 2RDSA 2W1QA 4B29A 3AVRA 4URTA 3ZFFB 4EZ4A 1DLLA 3RYKA 1AYN2 5BNNA 1LTEA 4F83A 1A6CA 5GZFA 2X5IA 2ADEA 4XPVA 2CAVA 1O5UA 3C7OA 4HBNA 2Q1MA 3H8XA 1POV1 3WNOA 2JDMA 3PLQA 4LQRA 4YVSA 3UGFA 3JBG1 3HOBA 4YLZA 5FYMA 1OLRA 1WA4A 4RA0A 5AC93 3SC7X 1T6BX 2FHRA 2AYHA 1UCXA 3VBSC 1HW5A 3BVCA 3F2ZA 4ZZ5A 4ATEA 1S0EA 3Q8BA 3RPQA 1O7FA 1RVF2 3N3HA 4JGYC 4I0AA 3Q8FA 4D94A 1UOJA 2EXJA 2X5IB 4IEPA 1D4M3 4RD7A 4QXBA 4TN7A 4WV8A 2YV8A 2JKBA 3OYWB 1MR5A 4XFAA 4UFKA 2A6ZA 2Y0OA 4Y1UA 3RWNA 3TN91 4CUBA 5J36A 5FCCA 4CCKA 1W6NB 4QHOA 1Y43B 3GZEA 1CD3G 2XPJA 2HYXA 4XFBA 4UFMA 3N9QA 5IFTA 3W58A 4Y22A 1VAVA 2D6KA 4P9IA 4FPCA 3NV2A 1FPN3 4Y1VA 2D93A 4GH4C 3NWKA 4PQQA 1V6OA 2P5BA 3U11A 3ECQA 4Y5Z0 1IS5A 4KU7A 4CZSA 1ST8A 2A1XA 4QT6A 4UWDA 4YG3A 4HMZA 2P4EA 5L9VA 1NCRA 2J1EA 5EV7A 4AZZA 1ND3C 4K20A 1F4AA 1AYM2 3LSEA 3LQCA 1CX4A 5F3EA 4YGEA 4R9BA 4IV1A 5CNAA 4WM8B 2KD7A 1C57A 4G9SB 4GIQA 3MW2A 1E5RA 1GYKA 5LRRA 4YZ5A 4YYOA 1WMDA 2ZGQA 1DF0A 2JB8A 1SHWB 3KHCA 1QJY2 5JAXA 4CP9A 2BERA 3TEYA 4IW3A 1O3RA 1NLSA 1K5JA 4XBLA 1BQPA 3K2OA 4ASLA 1XE7A 5E89A 3N9MA 1GOGA 1J58A 2W68A 5FP7A 1MVQA 4YM0A 1ZRDA 5JSOA 1WCDJ 4COUA 1C4RA 2PAMA 3K77A 2GH8A 4W6XA 1CPMA 2DURA 2RE9A 2OT7A 4JHTA 2WDBA 4XVHA 3ZN5A 4A45A 1AR62 5J98B 4CDQB 5FFOC 3U75A 2Q5TA 1AL23 1LU2A 2D5HA 1MS0A 4CDUC 1MQTA 1RIRA 2WNOA 5F3CA 3I59B 3KQRA 2IXJA 2VC9A 4H7MA 3OF1A 2WL1A 4XE9A 2DUOA 4K8FA 5DQ0A 4DQAA 3H8RA 1H8TC 2Y6JA 5ERLA 1Z7S2 1EPZA 1J3RA 1D0GA 3GHNA 4HZFA 5FY4A 2WZR1 5FQ0A 4QGMA 4Y33A 1MZ5A 4FXKB 2WT1A 1YRZA 2VW0A 4A6SA 5FTTC 1OLQA 1N1SA 3TNPB 1PX3A 2WKKA 1WWYA 4PIXA 3BPZA 5BY5A 2OA2A 4TLFA 1RUI1 5ANNA 5L7OB 3BTAA 5FJHA 1GQGA 1YWKA 2A70A 3K4DA 2A5ZA 4BQWA 1ULCA 3AL6A 4Q4Y2 2EVXA 3LPGA 5IVVA 2XVKA 3ETQA 3FL7A 1X82A 2ZJCA 1IQDC 4Q4Y3 4XF1A 4CP1A 2PAEA 5JXIA 1N3QA 5CFDA 4MGQA 3WNLA 1UZZA 1FYUA 4QB6A 5IK5A 1WW4A 3BTYA 4M3CF 3C7GA 4BHPA 2HWE2 1S2BA 2QQWA 1C8M1 4C0HA 3MI8A 1D4VB 1S1AA 1APNA 4MXVA 3UT0A 4NAOA 1JZ7A 2TNFA 2VY0A 2I45A 1M4WA 5ACA2 1A8DA 1AX1A 1AYM1 5LASA 2WAOA 1NA1C 3AMNA 4GB33 5FZ1A 1YFWA 1E5IA 5FZ0A 1SCRA 1REDA 1NCQB 4IGQA 2HWB3 2C9KA 5A80A 4DPNA 2WS92 3QACA 2EALA 2GNBA 4LHLA 5JI7A 4B4QA 1R093 1EAH2 5H9QA 3WG3A 4UW4A 2WWJA 3MW3A 4E2GA 1FOD2 3VZNA 1LOBA 4GALA 3MICA 1S4CA 4HKOA 3MIEA 4DFSA 3VBOA 3RQ0A 2WWUA 3H1WA 5JZGB 4IQPA 1COV3 4AI3A 1QXRA 2UWCA 1PZ8A 4QPGC 1CZVA 4WZFA 1MZFA 3VKOA 2LROA 2XHNA 3U0ZA 1DYKA 1UQXA 4NRMA 1SQ4A 5F6KA 2VMFA 4A42A 1BZWA 1CAUB 1W90A 3IMNA 1YEWA 4QQLA 3ZSKA 1TG7A 3PVNA 1RUH1 4ISRA 4AHYA 1LOFA 2YDEA 3NKGA 4HXCA 1GNZA 2R043 5JIAA 4UBHA 1UX7A 4OUMA 4CDXC 3FHAA 2WABA 4UAPA 3N7KA 3QOPA 5FPBA 4K21A 3BUCA 1GQPA 2Y6KA 4BDVB 2ETEA 4GMP3 1SPPA 1C8NA 5H9RA 4L92A 3GZAA 2C5DA 2WAAA 2WSVA 1BCXA 2R073 2H6CA 2ZGLA 4K8RB 2AC1A 3AYEA 4AEDC 5F37A 3QLQA 2FMYA 2QUOA 1HRV2 1R1A2 1HB1A 2FCUA 4Q4X2 1W3VA 3SLIA 4Y1YA 2IFWA 4PI0A 5C4WC 2VZ3A 4GH4B 5FO9B 4QX1A 4JGZB 5FZ4A 3M2MA 1Q8PA 3VDDB 1RUJ2 2EXIA 4YGDA 2PXJA 2VU9A 1O3SA 3P1IA 3LB9A 1OPOA 5FYCA 1YFXA 2XHKA 3DYMA 1AUYA 4H7LA 5BNPA 4QKNA 3IMMA 3H8UA 4QGNA
chains in the Genus database with same CATH topology
1NYWA 4LO7A 1FI2A 5ABJB 4K7JA 3LCPA 2RS13 2WZR3 5J48A 2W08A 2NZ9A 4NOTA 4CEYC 4MZUA 2Y0IA 4M3CB 1LHNA 5T50A 5ACA1 1AXZA 4WM8A 2ZACA 4TZDA 3FFZA 3ZIXA 3RSJA 1BEV3 5FLIA 1XNDA 1SLCA 2YROA 5JR7B 4HKWA 4S2GA 3MZHA 1SLTA 1BXHA 2B42B 3KZ4C 3O7OA 2PELA 1GZCA 4UW6A 4AHWA 4JC1A 3TBDA 4MGKE 2ZX2A 4AQSA 3CJIA 2Z5WA 1I1EA 1ZZCA 2AENA 1QJX1 4Z07A 3VHNA 4OUSA 5CG9A 1V9U3 4GWNA 4LBMA 3AMPA 1FT9A 1QNYA 5FQ0B 3PJYA 3L9JT 3SMHA 5T5JA 5C4WB 1Q8QA 5JOWA 1O3QA 1EAH3 2WC2A 1HRI2 4LULA 3AKPA 1IQAA 4RQPB 5L7OA 1H4HA 5LEKA 5T52A 3VBOC 3MYXA 2GMMA 2A75A 3FC0A 2VUJA 3ZIWA 4EWEA 4Q4V3 5CB7A 4C91A 5TSWA 5GKAC 2OUHA 2QCSB 1WLDA 2XBO3 2DCKA 1VBA3 1AR81 3WP6A 3R0RA 4JGYA 4I3GA 2D6LX 3O14A 5E16A 5K0UA 2YXSA 4NWVA 3WCSA 5KC6A 2VH9A 2RS12 1PO23 2MHFA 1TMF2 3DF0A 2DVGA 3POWA 5KXDA 4HFSA 2VQAA 2Y38A 4PIZA 1RC6A 4M01A 3VBHC 1KQRA 3AP9A 1LRHA 5EZWA 5LK5A 2VMIA 1BJQA 2ZZQA 1EV12 1O5LA 3AK0A 4FTEA 4A7YA 4EN0A 1HXS2 1ZBE2 1FNZA 5J09A 4Q29A 3NAPC 4FO9A 4IEXA 4FPOB 1PIV1 1DZQA 4E4DX 3R4DB 5BNNC 3AX4A 3ACLA 2AZ5A 2IFRA 4XOGA 1DZTA 4D7TA 4RHV2 3SXWA 3H3UA 4HANA 1AVBA 4O9GA 4RSUA 4W6WA 4YM3A 5JPMB 1JOJA 3PTYA 1ULGA 3VKLA 1ASJ3 3B3QE 3NV1A 4L2NA 3O0VA 5JI9A 4IV3C 2TBVA 1NQJA 4FPYA 4XEZA 1ZZ7A 3BIWE 2WFF2 1LEDA 3DPRB 2RR11 1G9CA 1UW8A 3JU9A 3MIBA 4O9EA 4AYUA 3ASIA 1XRUA 1ZVFA 2ZKNA 1NXMA 1BEV2 1J1LA 2WLQA 4EJRA 4KGQA 3BALA 1IS3A 1LKNA 1LODA 4GKYA 4AG4A 5J7MA 1CQ9A 1GZWB 3JQWA 1RMU3 2DU1A 4UBGA 2BWAA 1AR82 5DZFA 3JZVA 1RUC3 4YW5A 4S2HA 1POV0 4XJ8A 1W6OB 2OW4A 3VV1A 1GR3A 2CTVA 2A6XA 5T5LA 3SCHA 1XYNA 5J3UA 1SFNA 5C6CA 2VOXA 2SLIA 4E2QA 5CG8A 4AEMA 4XJZA 4FOYA 3E6DA 1KITA 3MW4A 1MQTB 2P37A 2YGMA 4RS5C 5JMCA 3SH5A 3ZXEA 1UMZA 1N1TA 2PHXA 3OD4A 4H14A 3UK9A 2JJ6A 4K6BA 1FMD3 1OI6A 5C8CB 1PO12 4CRQA 2JE7A 4PDWC 3K48A 2DU0A 1H8VA 5GM0A 1ND2A 2QFEA 1NA1A 1VR3A 3APBA 3WX5A 5I0UA 4FBFA 4B8EA 5JSRA 2GC1A 4JRAA 4CDQC 4YG6A 4YZ2A 3KB5A 2RJLA 5A3MA 2P17A 3AZXA 4FT8A 1PVXA 2WT0A 1YUDA 4BWOA 5FOBB 5C9AC 1RUOA 1KDKA 3N7MA 3QH7A 2ZX4A 1K5MA 4K3UA 3UJOA 1EAH1 1HKDA 3M3CA 4AVAA 4LT5A 3TB0A 3ZYIB 1AHSA 2E7TA 2GN7A 4META 3IDCB 1EYBA 3ALQA 1V9U1 4XYXA 3MIHA 3NAPA 4AXOA 3M3OA 3VBSB 3RRDA 3WW1A 2D3RA 2Z2SB 4Q8LA 4DRVA 1J3PA 4A7ZA 1VB2A 1CAXA 1UIKA 2AREA 3FBMA 3WQ0A 5K0UC 2WJSA 3PVBB 3N7LA 2NLRA 2C1FA 4QM9A 2PHRA 1S0JA 4LBJA 4AHXA 4R4XA 2GDFA 3ZFFA 5T3NA 4LUMA 3USUA 3S30A 5AFEA 3R05A 2WS93 3D6EA 3ZYJB 3VL8A 1XNKA 2CGPA 3UKNA 1C28A 1TNRA 3M3IA 3V0BA 1A8MA 1TME1 3GHMA 3H0OA 3VZLA 3ZSLA 3KT4A 3RJRA 2QZ2A 4LBKA 1DQ1A 3JBG2 1PNGA 4IEUA 3USUB 2V73A 5A3LA 1NCQC 3B00A 3WQ7A 5EXOA 4AI8A 1PZ7A 4PIYA 1OFSA 3I54A 1PO21 1BYHA 3S7EA 5JOXA 5FDBA 4Q0UA 2YPJA 1S55A 2NN8A 2HEWF 3KT7A 1UL9A 2D3SA 5AC92 3PJQA 1Q5OA 1NCRC 2AR6A 4FQZA 4Q4W3 1F9KA 2RS53 3VHRA 4MV2A 3ZN6B 3VBRB 3B93A 2NQYA 4K40A 1WUVA 3OD0A 4PLOA 3DN7A 3AZYA 2XG3A 4XFGA 2XJQA 2YC0A 2RJKA 3JCIA 1RHI2 1HDKA 1UAIA 1RUH3 3FUQA 4E9KA 4R4ZA 3FBYA 2GNMA 4BLIA 3NO8A 1QJY1 1H1IA 3IN9A 1QQP1 1IOAA 3DGTA 2HEVF 3ES4A 1QJZA 1NQDA 4AGRA 3JD71 3MFAA 1V6KA 2D6PA 4OI4A 3NV4A 3VZKA 4XHXA 4CDQA 4BLJA 5CFCB 4XJWA 2XL9A 3WT3A 4KGGA 2DV9A 2X8KA 3ZXFA 2Z79A 3IPVB 3NKTA 4QMAA 3E6BA 3JB8A 4JDOA 3WY6A 4HN0A 1VAMA 2CWMA 1VBB3 4CYDA 2WNVA 2WZPP 2ET1A 2WNUC 3IKWA 4HVQA 5DUUA 4QM8A 1H2MA 3EHKA 1LOAA 2BEOA 2DVFA 4LA2A 1VB4A 2X29A 2WZR2 2HWF2 1LCLA 5AFBA 1Q8OA 2GU9A 4XQ4A 1DBNA 5KHGA 2ZZJA 3MF9A 4PDWB 4PLNA 2OUJA 1CAVB 4M0NA 1C8M3 2RMU2 4OHYA 1XYPA 1DQ2A 3R4SA 5FLHA 4AVSA 2PLV3 3ZXDA 1NY72 5A33A 1NA1B 1JYIA 2BNOA 4Q4Y1 5GALA 4JV4A 3PHMA 4RS5A 2PHLA 1MEC2 1DGWX 4XQDA 2QNKA 2R0HA 4YRDA 1D2QA 3DUIA 1VRH1 1K5MB 2DCJA 4XJ9A 2R063 4YNIA 2YMZA 4DXZA 3NVCA 3VBUB 5A33B 5I8TA 2VMHA 2Q4SA 4QHBA 4XXPA 3FLPA 4KWLA 3S7IA 4Y1ZA 3GBFA 2WLPA 2VNRA 1PIV2 1WGPA 3HQXA 3T1LA 1JW6A 1AR73 3FE5A 4XILA 3E5XA 4XMIA 3VHOA 5CU1A 5KWRA 1I3HA 4L11A 2Q30A 3G7DA 3OBTA 2NM1A 1I5ZA 1FOD1 1F8VA 4RQPC 4N53B 4DB5A 1ENQA 3WP3A 3E5UA 1Z0HA 1QJU1 1UF2C 1WBFA 2A3XA 5F5QA 2WFF1 2QQPA 1IPJA 3ZSJA 1CAUA 5T5OA 4ITCA 3ZYRA 4HSLA 4HK8A 3UJQA 3TOJA 2ZTNA 2BFUS 2AUYA 4JGZC 3ES1A 3CNAA 4K9SA 3JD73 3H1MA 4TWTA 3C3VA 5DXDA 5HCBA 4V1PA 1PGW1 1MEC3 2C0ZA 3D0SA 3UKVA 5HI0A 1IPKA 2IXLA 3POYA 4TSVA 4I0WB 5GLUA 3ZX7A 5FBZA 4YW4A 1F2NA 1DGRN 2DYCA 4OFGA 4XXAA 1XXNA 1X33A 4GXLA 1FPN1 1W6MA 4CDWA 1WW6A 2C9AA 4ZU7A 1VBE1 3AMHA 3B5LB 1D4M1 2R6QA 2ZX3A 2GC2A 2ENRA 2AGSA 3VHPA 3ZN6A 4LR4A 3CLPA 1V6LA 3LKJA 4S2DA 4Y22B 3RMYA 1BBT1 2DUPA 3J8F2 3WDYA 3RDIA 3EXUA 2IXIA 1FXZA 1YHFA 5JOYA 4U36A 1IZ3A 2PFWA 1LJ7A 1YLLA 4UXAA 2JE9A 2ZHNA 3TRSB 4Y26A 1LOEA 3K51A 2IC1A 5IK7A 2G9FA 5I93A 2BTVC 2YGLA 1URXA 2VGDA 3VDDA 2VOKA 1HRI3 1PVC2 2P3IA 5GZDA 4CDUB 2UY9A 3BODA 1RB8G 1YI9A 4LO4B 2XUMA 2EF6A 2OYZA 1SLBA 4NPRA 4LBLA 4N43C 4QD2A 2IWGB 4ZKTB 2JX9A 3U4XA 2B7YA 2Y26A 4GWMA 3ZMNA 1AR91 3THTA 1RINA 5BNPC 2R49A 4YVWB 2O1QA 5FMOL 4A2UA 2HWB2 4I02A 1ZBA2 2XJRA 1C3HA 1DQ4A 4CEYB 5KHJA 4P9LA 5D1IA 4BIFA 1CIWA 4GULA 5HCFA 4H55A 4FAGA 2DWRA 2R32A 1JUHA 4UW3A 3JB4C 5C8CC 2A6WA 5H9SA 1KD7A 4I3PA 5BXXA 1TME2 2MEV3 2E53A 4HK9A 4D3WA 1ZRFA 1GSLA 4JAAA 4ZXKA 2QKDA 4C1WA 2VNOA 2BWCA 1RUE1 5HBAA 3NAPB 4N90A 4DY5A 1TQ5A 1G9FA 4GB32 1N1YA 4YVSC 2R072 4OI2A 1RMU2 5C4WA 2WA3A 3VBUA 1RUF2 1PO22 1BBT2 3J8F1 1U5ZA 4RR3B 1GICA 1DQ0A 1QDOA 5JZGC 4B4RA 3VN4A 3I7DA 2VVFA 3PVEA 5AC91 1PGL2 1UU6A 3W9AA 3VL9A 4LHKA 3V0BB 3OY8B 1SEFA 1V6JA 3IM0A 1JH5A 1AR93 4MSVA 4X6RB 2ZGMA 4IV3B 3IIAA 1IHMA 3M70A 4COVA 1ZBE1 1HIXA 4ASMB 2HWC1 4G4FA 4KG0A 3ZXGA 1FOD3 1GBGA 1AR63 1RUC1 5D8AC 2XJTA 1MACA 5JWPA 1OMIA 5A32A 3WOGA 2WT2A 4IV3A 1MS8A 1HRI1 4XJAA 4WZCA 5L36A 1Q3EA 4Q4V2 1HV1A 3A0KA 4YARA 3LOBA 1AX0A 3EJKA 3RZZA 4I09A 4YG0A 1IGOA 2GC3A 3QCWA 2HYKA 2MNGA 4BCUA 4XF9A 2RR13 2R061 2RM23 5KXCA 2D7FA 1PK6C 1XU2A 4Q4W2 2V5YA 5K9YA 1QNWA 4XF0A 3AZWA 1BBT3 3AKTA 4JCKA 3VZMA 3ILNA 3Q9OA 4ATFA 1S0IA 2LM3A 3IT8A 4RL7A 1HX6A 1DGWA 2DVBA 2RS33 4IEVA 4ES9A 2ZGUA 3IWZA 4XF3A 1RUE2 4BMEA 2QZ3A 3FJSA 1AZDA 1YFYA 2H0BA 3FX3A 3NSTA 4MXWA 4SLIA 3VBHA 1K5MC 1VBC3 4PLMA 2UU8A 3NW4A 3M4FA 4EROA 1JYCA 2D43A 1FV2A 3ZXKA 1U12A 2RMU1 4KG8A 5JLVA 5BPXA 1RUF3 5CIRA 4XJUA 5FPZA 2R30A 1H1AA 4Y4YA 1JHNA 3DPRA 5H9PA 3WINE 1IS6A 3B9CA 2DTYA 4W6YA 1HXS1 4LO6B 1MEC1 2MPFA 3ELNA 3AXEA 1R081 3WW4A 1UKRA 1UX6A 1VRH2 3FWEA 4KU8A 1EPWA 4AFBA 1G8WA 4Q2FA 2HWC2 4XF4A 1X8MA 2YHJA 2B46X 4EV0A 1PK6A 1CAVA 1BVVA 2PHUA 2ZA9A 4GKXA 5AVAA 2JXAA 3VKFC 1H8TB 5CADA 1OA4A 1AL22 3B01A 2O8OA 2QE3A 2VULA 2ATFA 2WQZC 1I9RA 3SNMA 4XDQA 1V00A 2R16A 3AMQA 1AR71 2HWD1 2ZGOA 1PMIA 4KBBA 4KNCA 1XNCA 3URFA 4LBNA 2D40A 2WNUB 1PM7A 1OQ1A 3HBZA 1LEMA 2RS51 2VQ0A 4Q4W1 2ZKLA 3ZXLA 1CAXB 1Q8SA 5DDJ2 2ZX1A 1ASJ2 2WA4A 1UN1A 1W39A 4FOVA 5B2GB 4IEOA 4M3CE 2GMPA 2ZGNA 4XFCA 3ZSEA 3TN92 1FMD2 3IDEA 3ILFA 5KXEA 4NR1A 4PBPA 3WG4A 4N53A 2QDRA 4IERA 3VBUC 1AXYA 3R6SA 5JCTA 2F4PA 2ZMLA 5BNNB 3VBSA 1VBE2 4AFAA 1AL0G 5C9AB 1B35A 4L97A 1H30A 1PO11 1WLWA 3TAYA 5T5PA 4IEYA 4LNVA 3CF6E 3OGJA 5ACA3 1VBB1 5JPNB 1G9BA 1EY2A 1ZBA3 3KGLA 1C5HA 2WWSA 2YUEA 2KM2A 3LAGA 3ZFGB 3V64A 4MUVA 1DGRA 3OYWA 1WCSA 4XZPA 4OHWA 1W6MB 1QU0A 3VBRA 1RJ7A 5JIUA 1EP0A 1YIFA 1RUG3 4CDXB 2R0FA 1PNFA 4FPHA 2CY6A 1OOPA 2K2SA 5FOJB 3GALA 3ZSMA 1S0DA 4HPKB 3MLKA 1AR72 4XTMA 3WG1A 1L3JA 1RHI1 1UKGA 1AJKA 4R52A 2D6MA 4GMP1 2A6VA 1JTZX 2VOVA 1W2UA 2HWD3 3H3ZA 4IEWA 4MGYE 4CDXA 3M3EA 4YGBA 4C0BA 4TYSA 2ZOEB 3VDDC 3GBGA 2ZGSA 2VW1A 2GNTA 2VOWA 1YI7A 3AXDA 5K8SA 1TE1B 1H1MA 1FMD1 1H2NA 5T55A 2WNVB 4AW7A 4IEZA 2UWBA 3GF6A 4WVWA 2H0VA 1RUD3 1NCRB 1Z78A 1LOCA 1VBD1 2D98A 4LLOA 4B7EA 3ZFFC 1OHFA 1SBEA 1LENA 3HR9A 4GQ7A 1RJ8A 2BGCA 3HMYA 4AEJA 1C1FA 5KC5A 4P14A 5F9TA 4DNYA 2Q1ZB 5LEJA 1MZ6A 1TME3 2MEV2 1AYM3 4IL7A 1GQHA 4ZU5A 1FATA 3OCPA 1PO13 3IBMA 1UPIA 2ZAAA 2WS91 2QDNA 1LB2A 4COZA 1O4YA 4I30A 3CJIC 4AVTA 1GNHA 3LA3A 3SH4A 1IKQA 2X5IC 5KBFA 4LBQD 1S0CA 4BOWA 4CEWC 1HQLA 1RUNA 1G86A 3ATGA 1GKBA 1OA3A 2ZGPA 4H3WA 4Z92B 3I59A 3GBWA 4R8HA 3AP7A 3KCXA 4JTNA 5JDBA 1VP6A 4K1YA 1KJRA 2TEPA 3GZTB 3WDTA 2DF7A 3WHTA 3M1HA 3JD72 5EJ3A 5BYNA 3VZJA 1BVP1 5T54A 4COYA 1UZYA 2ZPXA 4Y24A 3BU7A 4KWJA 3N4MA 2CV6A 4QXKA 2P3JA 3D0JA 1SBDA 4FOQA 4WVMB 4XTPA 1OSGA 1DGLA 2B39A 1ZZ6A 2VNGA 4YM2A 2EAKA 3QH6A 1AYN1 3PVOA 2F6BA 3CO2A 3U10A 1G9AA 1AR61 5LK7B 1JXNA 3WNXA 1ONAA 4SBVA 3HN1A 1ND3A 2IXHA 1ZBE3 1O91A 3S0MA 4EN6B 5KHIA 3UL2A 1QWRA 1VAKA 3BOWA 4OZXA 2ZGKA 2XJSA 3WDUA 1N1VA 5I91A 5FREA 1F31A 1PGW2 5A32B 3HD8B 4JDNA 4OHZA 2BNNA 1LECA 1O4TA 4EN8B 2OPKA 3GZUC 1Q8VA 3ZDSA 4BYYA 1YCIA 1WMFA 3FLTA 4XBNA 3AKQA 4ISQA 4E27A 1LU1A 1VBA1 4FPFA 4A3XA 3M3QA 4OULA 4PCRA 5DZGA 3VKMA 2YZ4A 5FLJA 5CA6A 1KFUL 3TWIA 1S0GA 3LOIA 3MF6A 2HWE3 2CNAA 3ZVXA 1LHVA 4NVPA 2JICA 4Y1XA 2V09A 1E57A 1AYN3 2H6BA 4GH4A 4DOUA 1ULEA 3CJXA 2JDZA 4OLLA 2NP0A 1Z7S3 2E7QA 1VBC1 1DDLA 3WP4A 4EN7B 4FTBA 3FUOA 5L73A 2B8MA 3ME2A 2XJUA 4G3YC 4LBQA 3MGUA 1NZCA 2QVSB 1W6NA 4XMAA 4N43B 5BNOA 1LULA 4CDWB 5CFCC 3P3PA 1SMVA 2ZABA 2XBO2 2JD4A 3KT1A 1ULFA 2A71A 1POV3 1QQP2 1COV2 2XVLA 3M7AA 1FAYA 3WLUA 4LBQB 3WV6A 1XNBA 2HWD2 3WR0A 4F3JA 5GLWA 1W6OA 3NJZA 3FFQA 2KXLA 4N43A 4IV1B 1PIV3 2RS52 4U2AA 3X29B 5KXBA 2X53S 1NLRA 2VXRA 3AJZA 1X8EA 1B35C 1BEV1 5ABJA 5FO8B 3EQEA 3WDVA 5DDJ1 2E7AA 2JEMA 3H50A 1OKQA 5DZEA 4AI1A 2HWC3 1VLNA 4RR3C 4HVOA 1FPN2 5F6LB 3DV8A 2JENA 4OHXA 5C8CA 1VBD3 3AP6A 3JQXA 1DHKB 3WZ1A 4Q0SA 2A6YA 4GA9A 4Q26A 2ZMNA 3ZXJA 1D4M2 4QQHA 4BPZA 4Q4X1 2FZ2A 1SLLA 1MVEA 1WW7A 1ULDA 2UWAA 2CGOA 1QF3A 2XLAA 1AR83 4MX3A 2D5FA 4OVEA 1S0BA 1X36A 3AZZA 1RUJ1 4C90A 3SISA 3BB6A 4XW3A 5AVPA 2JG8B 1QXJA 3UKTA 1F5JA 4LLFA 1MZEA 1VBE3 3OTFA 2R071 1F5FA 4FQ4A 2PHWA 3USSA 3D82A 4Z82A 4AI0A 1VBC2 2CYFA 4NN0A 2PQQA 2Z42A 1VIWB 4RHV1 5BNQA 5GZCA 4LE3A 3WW2A 1R1A3 5KHKA 2ES3A 2VPVA 1D0HA 1ENXA 5BUVA 2I74A 5HCAA 5K7PA 2BFUL 1H4GA 1W0OA 2QJVA 5IT6A 1RUG1 2BVVA 2EXKA 4FPGA 1LR5A 1YFUA 2ZCWA 1COV1 1MS3A 1FX5A 3QD6A 4LE4A 3JUUA 3PMSA 4HLTA 1QJX3 3LWCA 1B35B 1U5XA 1RGSA 5FPXA 4AGVA 2A73B 4PQ9A 2VVEA 2G4IA 1D2SA 2ZX0A 4LO8A 1R091 3DKWA 1SFYA 1ZBA1 2ET7A 1QJU3 2YY1A 1OOPC 2FZ1A 1HV0A 1BKZA 4YFZA 3MDPA 3I2DA 1EV13 5DUXA 2PA7A 2DCTA 4Q8KA 1UPSA 4F7ZA 2WQ4A 3SITA 1NG0A 2ZGTA 3VZOA 1ND2C 1DZRA 3OBRA 4Y20B 1TMF3 4BE3A 5GZEA 1OOPB 2A7AA 1GZ9A 4F8AA 1DG6A 4P9WA 5EWSA 5FAXA 3WW3A 1RVF1 5E8AA 1VJ2A 2A3YA 3T1MA 1CAWB 5F1RA 1LESA 3OGGA 3ILRA 4N7UA 1U5YA 3HT1A 1V70A 4FCAA 4LO5B 4AHZA 5HXVA 4PJYA 3ZFGC 1GZWA 3AYAA 2GN3A 3J26N 4Z1VA 1SLAA 3LA2A 1SLIA 1WW5A