1TMF2

Three-dimensional structure of theiler murine encephalomyelitis virus (bean strain)
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
267
structure length
267
Chain Sequence
b'DQNTEEMENLSDRVASDKAGNSATNTQSTVGRLCGYGKSHHGEHPASCADTATDKVLAAERYYTIDLASWTTSQEAFSHIRIPLPHVLAGEDGGVFGATLRRHYLCKTGWRVQVQCNASQFHAGSLLVFMAPEFYTGKGTKTGTMEPSDPFTMDTEWRSPQGAPTGYRYDSRTGFFATNHQNQWQWTVYPHQILNLRTNTTVDLEVPYVNVAPSSSWTQHANWTLVVAVLSPLQYATGSSPDVQITASLQPVNPVFNGLRHETVIAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THEILER'S MURINE ENCEPHALOMYELITIS VIRUS (SUBUNIT VP1)
molecule tags Virus
source organism Theiler's encephalomyelitis virus
publication title Three-dimensional structure of Theiler murine encephalomyelitis virus (BeAn strain).
pubmed doi rcsb
total genus 29
structure length 267
sequence length 267
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1992-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1tmf200
5CFDA 1RUG2 4CDWC 1PGL1 5C9AB 4CEYC 2HWB2 4QPGA 1BEV2 1ND3A 1VBE2 4CEWA 1ZBE2 5AC92 1FPN3 3VDDB 3VBHB 2R063 3VBSC 1C8M3 2XPJA 2BUKA 3FBMA 2RS32 1HRI1 4RR3A 1TMF2 1VBA3 2R062 2DF7A 1POV0 4PDWC 1POV3 4CDQC 3ZFEA 5BNNC 3JD72 1B35A 1H8TC 5BNNB 1CJDA 2BBVA 1R081 2RS52 1EAH2 1EAH3 1BBT2 1AYN1 2HWD2 1VBB2 3VBUA 3NAPC 3ZFGB 4GMP3 5ACA3 2WZR2 3VBRB 1ASJ2 1ND2A 1ZBA2 4IV1A 4Q4W2 1AL21 1AR81 2IZWA 1NCQC 1R083 2RMU1 2PLV2 4RS5A 2RM22 1NCRC 5A33B 1NOVA 1F2NA 1VRH1 4QPGB 1FPN2 1RVF2 1QJU2 1HXS3 5AC91 1RUE2 4CDUB 1MQTA 1AL0G 4GH4A 1QJY1 5DDJ1 3JBG3 4CDXA 5K0UC 1RB8G 5L7OC 1AYM3 2WS92 4CDWB 4JGYA 2WWSA 5CFCC 2HWF1 3JD71 2FZ1A 4AEDC 4RQPC 3VBHA 3TN91 1PO12 2X5IA 4GB32 1HXS1 3VDDC 4IV1B 4RR3B 4CEWB 5BNOA 1IHMA 2QQPA 1X36A 1AYN2 3J8F1 3ZFGA 1ASJ3 1ZBA3 4YVSC 5C4WC 4YVSB 5C4WB 5FOJB 1HX6A 1MEC3 3VBOB 1RUD1 3VBOC 1R1A1 2BPA2 1VRH2 1HRI3 4JGZC 1FMD3 1AR62 1NY72 1RUG3 3VBHC 1NA1B 1RUG1 4N43B 1NCRB 5CFCA 2HWF2 4CDXB 4CDUC 5ABJB 5ABJC 1HXS2 1PGW2 3JBG1 4GH4C 2RS13 1RHI3 1RUJ2 1AUYA 1RUF3 3J8F2 2GH8A 1K5MB 1SMVA 1RUH3 5J98B 4CEYB 1FOD1 1TME2 4Q4W3 1QQP1 4RS5C 1RMU1 4IV3A 2XBO2 4RHV3 4N53A 4YVWB 5ACA2 1COV1 4BCUA 1QQP3 2RR11 5JZGC 1R1A3 4IV1C 5JZGB 4Q4V3 1AYN3 5J96B 1BBT1 4GMP0 5BNPB 2RS11 2HWC1 5BNPC 1VBA1 1V9U2 4AEDA 3JD73 4RHV2 2R071 1H8TB 1M06G 1DDLA 4Q4W1 5C8CC 4JGYC 2PLV1 1VBE1 1X33A 2WS93 1RUC2 2BFUL 1AR71 2RS33 1HQNA 1QJY3 3JB8A 1MQTC 2HWB3 1PIV2 1V9U3 2WFF3 3VBFC 1NCRA 1AR92 1ND3C 2ZAHA 4CEYA 4Q4V2 1R082 2RS51 1FOD2 1TME1 3CJIA 4IV3B 1D4M1 3M8LA 1A6CA 2XBO1 3NAPA 4GB31 3J8F3 1AL23 5BNPA 1E57A 1ASJ1 1ZBA1 2RS12 4Q4X2 1AL22 5A33A 1H8TA 3CJIC 5BNNA 3ZFEC 1OHFA 5JZGA 4WM8A 4N53C 4RR3C 3VBFA 3IDEA 2GSYA 1AR93 1RHI2 1RUF1 1RUI3 3VBUB 3LOBA 4Z92B 4QPGC 2WFF1 1ZBE3 1PIV3 1QJX2 4CDUA 5K0UB 5CFDC 2R061 1RUI2 4QPIB 5C8CA 2ZZQA 1AYM2 2PLV3 2R041 4LLFA 1WCDJ 4SBVA 1BMV1 2HWC3 4JGZB 1MQTB 2RMU3 1R091 1PO22 1TMF1 5A32A 1CD3G 5GKAC 1FMD1 3ZXAC 4Q4X3 3VBFB 2HWD1 2X5IB 1VBC1 4IV3C 3VBOA 4GB33 2WZR1 1EAH1 4WM7A 1QQP2 1EV13 3ZFFB 2VQ0A 2WZR3 2RR12 2RMU2 1NG0A 1R093 4YVSA 5C4WA 1RUH2 1VB4A 1RUF2 5ABJA 2WLPA 1Z7S3 4Q4Y1 5BNOC 5C9AC 1VBD1 1NA1A 2RS53 4N43A 2WFF2 4RQPB 1D4M3 3VDDA 1RVF3 3ZFEB 1W39A 5DDJ3 1RVF1 1Z7S2 1RUE1 1AYM1 2R042 2RM23 4WM8B 1PGL2 4FTBA 4FSJA 4JGZA 4PDWB 1BMV2 4YVWA 1ZBE1 1R092 1PIV1 1VBD3 1K5MA 1VAKA 5L7OA 1VBE3 1HRV1 5FMOL 5K0UA 4CDXC 1FMD2 1VBB3 2RS31 1HRI2 5C8CB 1VBC2 3TN92 1COV2 4GMP1 1PO11 2HWE3 2MEV3 1NCQA 1MEC2 3ZFGC 1OOPA 2HWD3 1TMF3 1VBA2 1FOD3 4N53B 1F8VA 2X5IC 2MEV2 3VBSB 1VBB1 1OOPC 1RMU3 1C8M2 1PVC2 4RHV1 3TN93 5LK7B 1COV3 4RQPA 5FMOS 1VBC3 1QJX3 3VBRA 1R1A2 1AR82 1AR72 4CDQB 2HWB1 2XBO3 5L7OB 2RM21 1GFF2 1BEV1 1B35C 2Y26A 3HAGA 4PDWA 1AR61 1FPN1 1K5MC 1QJU1 5DDJ2 4AEDB 4RS5B 2TBVA 5AC93 1PGW1 4Q4Y3 3CJIB 4NWWA 3VBRC 1QJX1 1AR73 2WS91 1RUI1 3JB4C 4CDWA 1VRH3 1ND2C 1NCQB 1RMU2 1NA1C 4N43C 3VBUC 1PO21 3DPRC 1RUJ1 3DPRB 1RUD3 3ZFFC 4JGYB 1EV12 1PVC1 5ACA1 2HWE1 1BBT3 1PVC3 1POV1 4CDQA 5CFCB 3NAPB 1PO13 5BNOB 1RUD2 5D8AA 2HWC2 1HRV3 1RUC1 3VBSA 4YVWC 1QJY2 1RUH1 1ND3B 2HWF3 1OOPB 2R072 4Y5Z0 4CEWC 2R043 4QPIA 4FTSA 1NY71 1BEV3 1AR63 1AR91 1RUE3 3S6PA 1QJU3 5C9AA 1Z7S1 1B35B 5CFDB 1RUC3 2R073 4QPIC 2FZ2A 1HRV2 4Q4V1 1EV11 1QJZA 3JBG2 4WM7B 1AR83 4WM7C 5D8AC 1D4M2 5D8AB 2BFUS 4EJRA 1C8NA 2HWE2 4WM8C 1ND2B 4Y4YA 4RFT0 1RUJ3 4NWVA 1MEC1 1OPOA 5A32B 4Q4X1 4Q4Y2 2RR13 1PO23 1VBD2 3ZFFA 1TME3 2ZTNA 1RHI1 4FTEA 2MEV1 4GH4B 3DPRA 1C8M1 1VB2A 1V9U1
chains in the Genus database with same CATH superfamily
1BHGA 2XVLA 3WNKA 4BOWA 4KG8A 1RUG2 4H55A 4CCEA 1GV9A 2XG3A 4GJZA 3AMHA 4LORA 1ZZ9A 4CDWC 4AL9A 3CMGA 2DURA 1QOSA 1DQ4A 3ES4A 4QPGA 5IW0A 1ND3A 1W8ZA 1SDWA 3ZIXA 3ZSLA 1GWLA 4CUAA 4EWDA 1QEXA 3AL6A 3UGGA 3VBHB 3AP9A 5JPMB 1OKQA 3UESA 4CU9A 1C8M3 5IT6A 1S0EA 4FPJA 2H0BA 3WVJA 4DXSA 1WW7A 4N8MA 4RN5A 5CADA 4HXCA 4QX0A 3POGA 4AVTA 2WL1A 3EJKA 2VVEA 1B35A 5FKCA 2UY8A 4W6WA 4P5YA 1HQLA 5C3OA 3W20A 4P02B 4AOCA 4C1XA 2HBUA 2Y6HA 3S57A 4TTGA 4LBJA 2E7QA 1UD1A 3LDRA 1AYN1 4LBQB 2HWD2 1G7YA 3CL1A 3KCYA 4M4RA 5JCTA 3NAPC 3ZFGB 3UYJA 4MOAA 5BUVA 4Z2AA 1O3RA 2VG9A 2ES3A 3C7FA 1QH6A 1AL21 2IZWA 2LW8A 3BIWE 5L9VA 1HW5A 2PLV2 1X8EA 3WT3A 2RM22 2C24A 1NOVA 3A22A 1SPPB 3BPSA 4HPKA 5FBZA 1RGSA 1AF9A 5L7OB 1KQRA 3IPVA 5LA0A 1FPN2 5J1XA 4D94A 3FJSA 3B94A 4OUSA 1HXS3 1V6LA 5AC91 1QH7A 1D4VB 4CCDA 4GH4A 3AP5A 1UZWA 3JBG3 3T08A 5FPXA 5ANQA 2XH6A 5DZFA 5L7OC 3RS6A 3ZYBA 1ZX5A 4YLZA 3ZDVA 4GZ9A 4M3CF 1MVEA 3L9JT 2A3YA 4CDWB 2CNAA 4H14A 2D5FA 3LB9A 3FFZA 4XUPA 5GLTA 4MGQA 2WWSA 2BWCA 4AVVA 4XIOA 5FZBA 2FZ1A 3TRSB 3GBWA 4LO6B 4AFBA 1KFUL 1JW6A 2ZGOA 3TN91 4H3WA 3ZYIB 3RRDA 2X29A 3S7EA 1WBFA 3LA3A 3I8TA 4URTA 4IV1B 4E4ZA 1ULGA 4UFLA 4P9JA 4OUEA 4C0BA 5J7MA 4AEJA 4YW5A 4QMAA 2QNKA 3MFAA 3USUA 1QGLA 3AZZA 5FR3A 5FZ6A 3WW4A 2B42B 2DCKA 5C4WC 2Y64A 1QXRA 2EIDA 1O5LA 2VMFA 1W9WA 1HV0A 2XL9A 4FP3A 4YG3A 5FOJB 1HX6A 4AW7A 1FAYA 1R1ZA 3KV4A 2VZUA 2XR4A 2ID4A 5FYZA 1OT5A 2JB4A 3VBOC 4AYUA 2BPA2 4ES8A 3AFGA 4CP9A 2VVFA 1IGOA 1UOGA 4Y33A 3ZN4A 5GLWA 3O0XA 5LA2A 5IVJA 4NOTA 3HN1A 4XXPA 3WF1A 4Y1UA 1FMD3 1OLME 4XBQA 2YDEA 1SZBA 2QQMA 5FXVA 3OGVA 1RUG3 1EUTA 2TUNA 3KVBA 1W8TA 4V2VA 3KHCA 4OZOA 5LCWL 1V6IA 1GOHA 4XEZA 1NA1B 3MLLA 1MS3A 4N43B 3O1VA 1NYWA 4FOQA 1CZTA 4XJAA 2HWF2 4LA2A 2BVVA 4CDXB 4CDUC 4IEPA 3WDUA 1IS4A 1LHUA 1JYWA 1V70A 3ZXLA 3I2GA 3O12A 2V4VA 2P37A 4FFIA 4YZ3A 2RS13 4A6SA 3AMNA 4W6XA 4DMIA 1WCUA 2PAMA 4J1WA 2GH8A 1K5MB 5F3GA 5FREA 3T09A 1MZEA 3VDBA 2FCVA 5J98B 4CEYB 1FOD1 4LBLA 1QQP1 1GYKA 4QX5A 3QD6A 4RS5C 4IV3A 4MADA 4N53A 1Q43A 2BGPA 3OEAA 2RR11 3JXSA 3C7EA 2O8QA 2BNOA 5LRRA 4IW3A 4Q4V3 1E5IA 5IK8A 5A3WA 3VZMA 5J96B 1VPHA 3X29B 1BKZA 3SITA 5A6ZA 5IK7A 3AYEA 5K8SA 2HWC1 2PELA 1LEDA 2VUDA 3HPNA 5BNPC 5K7PA 1VBA1 2WZ8A 2B7YA 4LHKA 2JKBA 4Q8KA 4Q4W1 2YZ4A 4JGYC 1BLZA 1IG3A 4RSUA 1SBEA 1WCSA 3OPTA 5FP7A 3ETQA 3OOXA 1YFUA 4AQ2A 4C0HA 3AC0A 2BFUL 2RS33 1HQNA 3CEWA 4S2HA 1YFYA 5FY5A 4C1WA 3WG3A 3IN9A 2D98A 2X53S 1LOFC 3OCPA 1PIV2 3NJZA 1V9U3 4EZHA 2CGPA 3WF0A 2G4IA 5FTTC 3WF3A 3PU8A 1LOFA 4G3YC 2WAAA 1CAVB 4A7KA 1UY4A 4UW3A 2ZAHA 3KT7A 5HPOA 2XKPA 2RDSA 1FATA 3O5SA 1TME1 4R9DA 2MPFA 4IV3B 3U4SA 3LEMA 1I6XA 2SLIA 4CUGA 1LESA 3TOJA 4EN7B 3NAPA 1LHVA 4CP1A 1FV2A 1A8DA 3D6EA 1BK0A 4OHYA 3V56A 1QXPA 2VC9A 4GB31 5LBBA 2P3IA 3J8F3 1WMDA 3H7YA 5BNPA 2RDRA 4BQ2A 4O9EA 1W9FA 1YIPA 4BE3A 4DNYA 3OTFA 3D3AA 2OQ6A 4HKOA 5FMCA 3NV4A 1U5YA 3A4UA 1UIJA 4AWDA 5BNNA 1X82A 4QU2A 1W6OB 4XDPA 2A1XA 3LIHA 5EQUA 3ZFEC 4FI9A 5KC5A 1W9TA 2ERFA 4N53C 5EJ3A 4LXLA 4YGCA 5EFUA 3VKFC 1NQJA 4RR3C 4CCLA 1GKBA 1D2SA 4ZS2A 3CJXA 2O0OA 3K4DA 1RYYA 5FZ0A 3WW1A 1RUF1 4RFRB 1WD3A 1RIRA 2D7FA 3BGAA 3K75B 3FHQA 4QPGC 4IGQA 2QQLA 5C8WA 4A3ZA 4BQ1A 3MW4A 2VOWA 5FY7A 3RWKX 4Q26A 4CDUA 1AHSA 5DABA 1DGWX 2FDKA 3SH3A 4QPIB 3LSEA 2ZZQA 1ODMA 4LKSA 1AYM2 1C1LA 3V0BB 2MHFA 1SQ4A 2HEVF 4XIKA 3AMPA 2AYHA 1UZYA 2OT7A 1YI9A 2C4XA 3T0BA 2EXKA 1X8MA 5I8SA 5M0TA 4Q1PA 2WNVC 3WY6A 1QY4A 1CD3G 1WMEA 1IKQA 1H1AA 2ZX2A 4MH0E 1D0HA 4AI9A 3MZHA 2P34A 4M0HA 1W0PA 4KNCA 2IXIA 3NQHA 4OVEA 1OA4A 1PM4A 4Q4X3 3TNPB 3Q8AA 2X5IB 2VMGA 2R30A 5FO8B 5FMDA 3NJYA 3SXWA 1GP6A 5A7QA 1W0OA 2WJSA 4UBHA 1EAH1 4CUCA 4WM7A 3BTAA 2NLRA 2ZGUA 3ZFFB 1OLQA 4HK8A 2WZR3 3AJZA 4AE2A 1RXGA 2XHNA 2ZGLA 1YQ6A 2XDVA 1WGPA 4NVPA 2FDFA 1JU3A 4AHXA 5DPNA 3MPBA 4IE5A 4TXWA 4YGDA 1VB4A 3I2JA 1MPXA 5IAVA 1NLSA 5JIAA 1NLQA 2AREA 1JYNA 2VOXA 1Z7S3 1W8FA 4ZU7A 1BZWA 5BNOC 1VBD1 4XZUG 1ENXA 1YQ8A 3PNAA 1DCSA 1DHKB 2LM3A 1OQDA 3D0SA 4R4ZA 1D4M3 3VDDA 1VAVA 3BCWA 1IS5A 3Q8EA 3N35A 4P00B 3EMRA 3O1TA 3KCXA 5JXGA 3MIFA 5DDJ3 1RVF1 5A3NA 3B02A 1WD4A 4FTBA 1PGL2 1VP6A 1UW8A 2ZGRA 2BDRA 2WC2A 3SEPA 1GQPA 1DYPA 4PDWB 2O14A 4R8HA 4YVWA 1QF3A 2VOKA 5FPLA 2VTXJ 3LEIA 1LOGA 1TZOA 3SEEA 2G1MA 4LHSA 3N3HA 5L7OA 1VBE3 1CAWA 5FWEA 1UCXA 3PURA 2RS31 1SACA 4FPYA 4BK4A 1CZSA 1HRI2 4HOOA 5C8CB 3EYPA 4IERA 5LWBA 2D6LX 1W0NA 4META 2BYVE 1S4CA 1OH3A 2NP0A 4BA6A 2OPWA 1W8HA 5FZEA 4NJ4A 1W03A 4NHXA 4EYUA 4HVQA 3J7MA 5FQ0A 3HEIA 4NIHA 3ZFGC 4JC1A 4WVMA 5I0UA 3VZOA 3IPVB 1OOPA 2IUWA 2XJPA 2ZOEB 4LULA 2HWD3 2WT1A 5E89A 3KGZA 4A4AA 4XUQA 1TMF3 1VBA2 2B9UA 2GDFA 2QZ3A 1WMFA 5F1RA 5JSOA 1JOBA 1UPSA 1Q8SA 1WLDA 2RJ2A 2VZSA 1XSQA 5FMOS 4YM3A 3J4UH 1ULPA 1W2AX 3JQXA 3NW4A 1AZDA 3DEMA 2VJXA 3GCWA 5L9RA 2YB7A 3ZSEA 1RL3A 2ZMNA 1WCQA 2P17A 3DN7A 2HWB1 1V0AA 3ZSJA 1B35C 2GMEA 4PQQA 3ATGA 2XUEA 4MLOA 2Y38A 4BB3A 4FPEA 3WW2A 1NQDA 4BK5A 3VD9A 3QBQA 4HVRA 4BMEA 1SLLA 2WO1A 1IS3A 1ZZ8A 5DDJ2 3SH4A 1W8UA 1OPMA 2ZGTA 2QJVA 3FMGA 4PCRA 2HBTA 3B9IA 4PIYA 1FI2A 2HLEA 3PUQA 1NT0A 1QJX1 4Q29A 1ULCA 2ZGMA 1MZ6A 2IXJA 3D4KA 2ZEWA 4A2UA 4KWLA 4CDWA 2G19A 4FPCA 4BHPA 1W6OA 2VUCA 1LODA 1RMU2 1LOBA 3PVOA 5FOBB 3THTA 3MIEA 1RUJ1 4IDZA 3WZ1A 3WCRA 3DPRB 1DFQA 3U07A 4EQVA 4D7YA 3IDCB 1A78A 2ZGPA 3M3QA 2D6OX 2QQIA 2AZ5A 5IYYA 5J48A 2WKKA 1BBT3 4X6QB 1GSLA 3D8CA 3LEGA 5FZMA 3GZAA 1PVC3 3PVBB 3VD7A 2A71A 2P3JA 4OI2A 2FMDA 1UKGA 3VHNA 2CHHA 5FYYA 4CXWA 4L9BA 1D7PM 4HL0A 3BI3A 3RI9A 4K1ZA 3VD3A 2VTXA 3RZLA 5D8AA 4LJHA 1HRV3 3A21A 1UYXA 5FQ0B 2JDHA 1ND3B 1RINA 2HWF3 1DF0A 3I54A 3KQ4B 2JDAA 4N7UA 1GP5A 1F31A 3H1YA 4JV4A 4KU7A 5F3EA 1W2UA 2GH2A 2PHUA 4KGQA 4ZONA 3BU0A 2WQ4A 1YWKA 4LMFA 3KVAA 1KJLA 2R043 3FFQA 2VTFA 2YHJA 4WVVA 4ISRA 1HV1A 5FPUA 2AENA 3AKPA 2K2SA 5I0DA 2FBEA 3HNYM 4AQ6A 2G9FA 3S6PA 1A34A 1VAMA 3OGGA 4MGSA 4DFSA 1DG6A 1I3HA 1UWWA 5HV0A 4OUMA 3H42B 3MV01 4AI2A 1H0BA 1RUC3 2B9VA 2LS6A 2E32A 4XFCA 2AEZA 4MV2A 2FZ2A 3HR9A 3M3CA 5FYHA 4PHZA 5A3LA 1FX5A 1H6YA 3H7JA 3KMHA 4Y20A 1QJZA 2VZOA 3JBG2 4G9SB 1OXCA 4IEXA 5FO7B 3CQOA 4FPOB 1QJFA 1XXNA 4LO8A 1ZNPA 4LR4A 5L36A 3DXUA 3ZXFA 2V5DA 4Z82A 1C4RA 3FBYA 1Y43B 4FPFA 4RFT0 3W9AA 2YBPA 2ZMKA 5CB7A 4KGGA 4D7TA 5K4LA 4XQWA 3V0AA 1MEC1 3B01A 3IIIA 1JMUB 5FYTA 4JQTA 5A1AA 4MGTA 3FX3A 4HKWA 1DZTA 5EJZB 5J37A 4K6BA 4Q4X1 1JYXA 1PO23 4JRLA 2XJTA 1VBD2 2MNGA 4FFGA 5FZ4A 3TNQA 1W8NA 4DOUA 4CU6A 4GH4B 5JSPA 3O1SA 1MS1A 4M01A 5KHIA 1VB2A 1NXD1 3NO8A 1W2NA 1V9U1 3VL9A 2XJQA 5CIRA 2BVBA 4NO4A 2FHRA 4Q8LA 5F2WA 5GZFA 1GLHA 5GZCA 3J7LA 1CX1A 3RZMA 4CEYC 3ZYGA 4CU8A 2OA2A 1VBE2 3UETA 1CAUB 1ZBE2 1N47A 3A7QA 3LA7A 1FPN3 2R1DA 3NVCA 3BUCA 3OUJA 3ELNA 1MS5A 3SNMA 2ADEA 3H3LA 2YBKA 5EYYA 3OBZA 1UKRA 2BUKA 3FBMA 2OW4A 4AGVA 4HKLA 2DU0A 1HRI1 4Q0QA 3MUY1 1TMF2 1VBA3 4PDWC 1W2TA 1POV3 5DZGA 4HVOA 1H8TC 5BNNB 2WZEA 3AXDA 1OA2A 2QZ2A 3H1WA 1YLLA 5L9BA 1LU1A 1CVNA 5T5LA 3WUCA 3GYDA 4DUWA 1W2OA 4XURA 3OGSA 2ARXA 5FCCA 4JZRA 3H8RA 1XOYA 1W9SA 4CP2A 1ZVFA 2ZHLA 4K3UA 2WZR2 3NJXA 3VBRB 1ASJ2 1ND2A 1TNFA 1ZBA2 3ACFA 4IV1A 4EN6B 1HDKA 3A0NA 4P9LA 4Q4W2 4ZU5A 2ZCWA 1CIWA 1R083 3LIGA 4RS5A 4PJYA 4XAEA 5FZCA 5CBLA 5A33B 4P9WA 1AX0A 2VMCA 1VLNA 4IEZA 4QX2A 5H9SA 4BPZA 1VRH1 4AEKA 1WLWA 4Q27A 5D1IA 1H4GA 2EVXA 2ZA9A 1NX9A 1W6NA 4LHNA 4BU2A 3O1OA 3U10A 1RUE2 2D93A 2PHLA 4I01A 3OEBA 5DDJ1 1RB8G 1E5SA 2P3KA 2VY0A 4XJUA 4LLOA 4DXRA 3NNFA 5CG8A 2DUOA 2IXHA 3I3BA 4KI5M 5HBAA 2ZEYA 2WT0A 3H0OA 4QGNA 3INAA 5FWJA 1AYM3 1GOGA 2WS92 3PVEA 1LCLA 2OZJA 1UN1A 2I07B 3T2PA 3JD71 4D0QA 3ACHA 2XJVA 2CTVA 4XUTA 4W8JA 2ZGQA 2YFZA 5DUVA 4HLTA 4AEDC 4RQPC 3RZKA 5E16A 1LNSA 2VO5A 2WLQA 2Q1ZB 4GWNA 5FZ7A 2F4PA 1HXS1 2P6CA 3PL0A 2XLFA 4UI9L 4XFGA 3VDDC 2CU5A 3IDBB 4N90A 3O0VA 5BNOA 3AZYA 4OI0A 2GP3A 2QQPA 4XAAA 1AYN2 1DGWA 1YFXA 1HN1A 2FQPA 2VGDA 3GZTB 1H2MA 5CYYA 2F17A 1HLCA 1OFNA 3KZ4C 3OD0A 3HBZA 4MO3M 1ASJ3 1ZBA3 3MFCA 4QM8A 4TSVA 4AI1A 3HQXA 1U5ZA 4YVSB 3LPGA 5I0SA 2WQZC 4RGKA 1WW4A 1ZZCA 1N3QA 4X6RB 5A7OA 2Y34A 2YPJA 5GZGA 1A8MA 2WYFA 5CNAA 3JCIA 5FXWA 2P5BA 2AH2A 2K9ZA 2YPDA 1GZCA 2VW0A 4CCKA 3VKOA 1NKGA 1R1A1 2CY6A 2YG0A 3I2IA 5T54A 4NIIA 3OB8A 1PZ8A 3N9OA 2RJLA 3DKQA 3ALQA 4A41A 4JGZC 2C5DA 1ONAA 3KGLA 4RYDA 2D97A 5LW9A 1ZZ7A 3POSA 3KF3A 1H30A 1QNWA 1US3A 1UY3A 1XRUA 4QKDA 4B7KA 1PM7A 1G9AA 4A42A 4CE8A 3W5NA 3D5OA 1PK6A 2VAUA 3LEKA 2JDPA 4A7ZA 4AQTA 2Y6GA 4UFIA 5FUNA 2UYBA 4IEVA 5CFCA 4FPHA 3T4HB 4E2GA 2C1FA 1Y4WA 2FCUA 3BOWA 2PHDA 5FPBA 3EBRA 5ABJB 5JMOA 3MICA 2EALA 5JOWA 1N3OA 3LSDA 1W3XA 2FCTA 5IK5A 1DU3D 3UL2A 1TNRA 1TVGA 5LY1A 4PT6A 4GH4C 4GXLA 1RHI3 4BZ4A 4D6QA 1RUF3 1GZWB 1V00A 3J8F2 1LOEA 4NAMA 4OMCA 1IOAA 4X8NA 2HYXA 4YG0A 1RUH3 3I2OA 4Q4W3 1PZ7A 1DZRA 4R52A 2CL2A 2Y6KA 1XC6A 1DQ2A 3APBA 4LTAA 4Y1ZA 3CKHA 1R1A3 1X50A 3PUSA 1C3HA 2AR6A 2EF6A 5C7GA 1J83A 4LUMA 3I3MA 3PJYA 2VCCA 3VHOA 3BODA 4L11A 4DRRA 4WVMB 5A7SA 3RFRA 4Z2WA 5BNPB 4QQHA 4Y26A 2P3YA 4BLIA 3LKJA 2W1SA 1V9U2 2WA4A 1ULEA 2CV6A 4TZDA 2VH9A 2PHFA 3MW3A 3P6BA 2A73B 4P9IA 4DB5A 2R071 2ORZA 1M06G 1Q8PA 3WLUA 1PX4A 4C8DA 1UYPA 2UY9A 4WVWA 4NPLA 1RUC2 1W6PB 2RHPA 4HMZA 4OLLA 4SLIA 1AR71 4HN1A 4WV8A 5APAA 4AI3A 4BXFA 3DCQA 1EY2A 4I3GA 4EN9B 1QJY3 2Q30A 3JB8A 1MQTC 2ZPXA 3R4UA 4QPYA 2XVKA 4YM2A 2AUYA 1ENRA 3NWKA 4MXWA 1LHNA 1JZ6A 3RYKA 5FLJA 5F6LB 2O8OA 1PMHX 1NCRA 3MF9A 1AR92 1ND3C 1Q5OA 4W65A 1JBCA 1AXKA 4Q4V2 5FP3A 2BERA 2Z2SB 1XU2A 1NLRA 1UAIA 2VUJA 4AI8A 1FOD2 3WF2A 3I3QA 5FV3A 2Y0OA 1D4M1 4COYA 1A6CA 2GMPA 2I74A 2VNRA 5LY2A 3GHMA 3GDBA 3IMNA 5HCHA 3MW2A 4BYYA 4JAAA 3RNSA 4COVA 2GN7A 1H1MA 3HJRA 4BMBA 3T2TA 4KWJA 1ENQA 4OYUA 1KDMA 2RS12 2W46A 3AKQA 5DXDA 1ZA7A 5AFEA 1L7QA 1AL22 1ULDA 5FK8A 4FXKB 1GNYA 4GIQA 3QACA 2P6HA 2XQRA 2GNBA 3CJIC 4QX3A 5G05L 2XOMA 5JZGA 2WA3A 4XVHA 5KHGA 4FOYA 3VD5A 3U78A 3GNEA 3VBFA 1O8PA 5FY4A 2PA7A 5E1RA 4OHZA 3NNJA 1XE0A 4NIGA 3MO4A 4XF1A 4XMAA 1AR93 2GSYA 4Q0VA 5BYNA 5KHJA 4DQAA 1RUI3 3KB5A 5LEJA 2VMEA 5A80A 1QDOA 2WFF1 2YGMA 3DYMA 1HIXA 3AL5A 2R32A 1SCRA 5DUUA 2NPIA 4P9GA 3E1F1 3N9MA 4NPRA 5CFDC 4YZ4A 1RUI2 2R6QA 1L3JA 2WNOA 1MR5A 2P1BA 3CLPA 1EP0A 1PZ9A 5IJRA 3PUIA 3SCGA 4C90A 1PMIA 5C8CA 4MG2A 1PGSA 2A3XA 3GZEA 5SV8A 5ISLA 1V6OA 4CVUA 1URXA 3WNLA 4SBVA 4D6SA 1F9KA 4OHXA 4AFMA 2RMU3 1R091 4JKKA 1XBFA 1OSGA 2VQAA 1N1TA 3VZLA 1VRBA 3ZOIA 1GZTA 1FMD1 1OF4A 5HCAA 2A7AA 4HANA 2PHXA 3KS7A 4LKFA 4A44A 4LHLA 1VBC1 2D40A 1JS9A 2GNMA 3VBOA 2XVGA 3R05A 1PNFA 4WVZA 4D7SA 1G9DA 4Y1XA 1R093 1S2EA 4P9YA 2VOTA 2VZRA 4J6GA 2Y0IA 2CWMA 2IVIB 5C4WA 4OQ9A 1UNBA 1DQ0A 3WQ0A 2XQXA 3HMYA 5A3PA 1JXNA 5ABJA 3MIGA 5LK5A 3AYCA 4J25A 4KH9A 4RGGA 5FY8A 5C9AC 3RGBA 3ORJA 2HKXA 1Y3TA 4GKXA 5DG2A 2A3WA 5T50A 3RYPA 1XE8A 3TEXA 5CISA 3I2DA 1YYNA 2XWBB 2H6BA 2VU9A 2X10A 4IE0A 3DUIA 2BGOA 4M4PA 3UK9A 3IWZA 1AYM1 1C57A 2RM23 2JIGA 1OURA 1DQ1A 3ES1A 1VMHA 3LE0A 4QM9A 3GJAA 4XUNA 4FSJA 4L0PA 4W6YA 4AVCA 1OA3A 4GULA 3TBDA 2ZAAA 3HQUA 1XNCA 4B1MA 3TEYA 1VAKA 1OQEA 5EHDA 1HRV1 1KFXL 3MI8A 4V2WA 5CVRA 4GALA 3F2ZA 1S0CA 5LA1A 3VUOA 1RJ8A 2YC4A 5I93A 4N7IA 4I3PA 5H9QA 4PQ9A 4XDQA 2E26A 2PTMA 1K42A 3B5LB 2Z4FA 2NQYA 4YW2A 5IVFA 1PO11 4FCAA 2B4KA 2HWE3 2OS2A 5IVBA 1FYUA 1MEC2 2OPKA 4KBBA 4A7YA 4M3CE 4NN0A 5T52A 1JODA 1Y9QA 1O3QA 1RC6A 1JN2P 1GOFA 4ASKA 1O59A 5A70A 3OBTA 1SPPA 2DCZA 4FQ4A 4XZPA 2X5IC 1F8VA 3SKVA 1VBB1 5LK7B 1C8M2 4LBNA 4LEJA 4D3WA 1BVP1 4LO4B 3KF5A 5BXXA 4ES9A 1C1FA 4QDSA 1CONA 3ZKYA 3HT2A 5C3QA 5JDBA 1QJX3 4Q0PA 2ORXA 1W9YA 4XDOA 4AAXA 2YU2A 1PVXA 1EUUA 2BU9A 2WO7A 2ZXQA 1AR82 4YWAA 4URAA 1AR72 4CDQB 2YY1A 5JI9A 3O14A 2W68A 4E4DX 2V72A 4A3XA 4JHZA 5FJKA 1Y9MA 2R1BA 1YEWA 3N9NA 4GA9A 4YM0A 1KXGA 1RUNA 1K5MC 2AGSA 5F5IA 1O4YA 5LBEA 2YGLA 3ABZA 4AHYA 2WN2A 2TBVA 2BZDA 2VQTA 3I2HA 1PGW1 4FOVA 4LUKA 2Q8CA 5AC93 1L7LA 2J7MA 3CJIB 1G8WA 4IL7A 2YC2A 3VBRC 4B29A 3BTYA 1J84A 4NROA 4B3NA 3UNPA 3PTYA 4I30A 4UF0A 1WBLA 1NE4A 1XJAA 3K4ZA 5LZ6A 1F4HA 1CX4A 3Q9OA 4FT8A 3ZM8A 1NCQB 4B4PA 4DINB 2FDGA 2ZX1A 5F8PA 4AEMA 1NA1C 4IEYA 4N43C 1YIFA 3VBUC 4AVBA 3V64A 5EWSA 3JQWA 3ETPA 3JUUA 2JJ6A 5FBJA 2BRTA 1M4WA 3WDYA 2WUHA 1EV12 4NHLA 2JG9B 1I1EA 2D5HA 1W6MA 1F5FA 2W1QA 3EQEA 4AHWA 1K3IA 4CP9B 5ACA1 3TYJA 2DCTA 5A1FA 3FL7A 4DXZA 1K12A 1POV1 1LGBA 1Z78A 4IGOA 4ARXA 4CDQA 3PUHA 5CFCB 3TEWA 3UV9A 4GWIA 1TQ5A 3SISA 2GC0A 3R0RA 5JXJA 1RUD2 2HWC2 3PMEA 4R9BA 5DUWA 1LHWA 2QQWA 2VBPA 3P5BA 3VBSA 1RUH1 3POEA 4O7XA 4OFGA 3K3OA 4OULA 4RD7A 4AK3A 1OOPB 4LIUA 2W91A 3ZXEA 2E6VA 3ZLIA 1SLTA 2JICA 4ITCA 3G6JB 4Y5Z0 4CEWC 2GC3A 3PIJA 1GMMA 4XTPA 1GZWA 3MLJA 4IQPA 5GZEA 1NY71 1UXXX 2W5FA 1Q8VA 2QE3A 2WFPA 2PXJA 3LD8A 1RUE3 1UYYA 3POBA 4BM8A 4D6RA 2PHWA 2VVDA 1H6XA 1LEMA 1B35B 4KWUA 3MF6A 2Q8DA 4Z07A 5GZDA 4UFHA 3ZKUA 4CPBD 1GNHA 5GALA 3O0WA 2R073 3BVCA 2DUQA 2OIIA 4QPIC 4UFMA 3WX5A 5KHHA 4ZY9A 1CAXB 2V73A 4FAGA 1QWRA 1S0IA 4JCKA 3S0MA 2VZQA 5HCBA 4UFKA 1ODNA 3A0KA 4FO9A 1UF2C 2B8MA 3F95A 3WP5A 3DYOA 4HSJA 4LE3A 4XW3A 4XQ4A 4EJRA 5F7UA 5FY0A 3CIHA 2HWE2 4WM8C 2A6XA 3H1MA 4AZZA 4OMDA 1RUJ3 4F8AA 5CKQA 1J58A 4NWVA 4QKNA 4LBMA 4ASLA 1OPOA 4ATEA 2ET1A 4UF0B 3AYDA 1J1LA 3J26N 1QOOA 3POFA 4QQ2A 2ZTNA 5DN2A 1RHI1 4CCCA 4CZSA 2DVFA 2MEV1 1LGCA 2A6VA 2ZGKA 2Y8KA 3DPRA 1W99A 1HB4A 2HYKA 2ZZJA 2DVBA 1W8WA 3ECQA 3UKNA 4DXTA 2JG9A 2JDNA 2Z5WA 3B69A 1OVSA 4DUXA 1W6MB 1S0BA 2R16A 5F5QA 1DZQA 1NE6A 3E5QA 3FN9A 4P9XA 3VZNA 1PGL1 2DBIA 1I9RA 2QVSB 2ARBA 3AK0A 3IB3A 5C9AB 1WWYA 3VHPA 4GD4A 1GANA 2A6WA 4CEWA 2UWBA 2FD8A 3DECA 3OJBA 3VDDB 3K3NA 3ZPOA 1Q8QA 2Q0AA 2CSGA 4MGYE 3SQOA 1MS0A 3VZJA 4W4ZA 4Z8BA 2RS32 2DFBA 3CZJA 3CNAA 1J3QA 3OSDA 2A70A 2D3SA 2R062 2W92A 3HWJA 4IE7A 4KBZA 4XCBA 2JENA 4E2SA 1ULFA 1HJFA 1W04A 5FZHA 5FZLA 4AVAA 1J59A 1R64A 5FYSA 4B4RA 5A3TA 4L8QA 2LTNA 2WT2A 3RYRA 1G9CA 3RZGA 3GJBA 5GLUA 1K45A 4OI4A 5EJ1B 3NL1A 4QXBA 2VCBA 1LTEA 2ET7A 1EAH2 4E8DA 3BKZA 2A6ZA 1GNZA 2OVUA 2WSUA 4YW4A 3E97A 3AP7A 1ZA4A 2PQSA 3KQRA 2W94A 5ANNA 3VBUA 3IKWA 4AR2A 4JDNA 5A6YA 2X09A 2DBNA 4IXLA 5BPXA 3RI8A 3CO2A 1F4AA 4GMP3 2J1TA 4FFHA 4BQYA 2Z42A 4U36A 2CWSA 4YNIA 3FZ3A 4AG4A 1H2NA 2XXZA 1AR81 1XYPA 4S2GA 3SCFA 1GBGA 2QCSB 1S0JA 1T6BX 2RMU1 5HXVA 1LU2A 1NCRC 3WXPA 5C70A 4XABA 4AFCA 4S2DA 5L19A 1PMJX 1UPIA 1JZ3A 2PMWB 2VNGA 3MDPA 3BPZA 2W52A 2DVGA 1ACCA 1RVF2 3ZDSA 1E5RA 3IT8A 4LPLA 1MQTA 1AL0G 4AGRA 1QJY1 1SBFA 1QJEA 3NSTA 2Y6JA 4XFHA 5FYCA 2IFRA 2JXAA 4AFDA 4CDXA 4F3JA 5JLVA 2JDUA 3PJQA 2F4LA 5F5CA 4AQSA 4YZ1A 1C28A 3VB9A 5FZ1A 3OGRA 5IWFA 1H2KA 3VDCA 1JTZX 2C9AA 3RWNA 3N9LA 4HONA 4HT1T 3C7HA 4FAHA 4JDOA 4QXKA 1O6UA 4COWA 3AM2A 4INDA 1XSRA 3LCPA 4MXVA 5EPAA 1U0AA 3LWCA 3NV2A 5IAXA 2A75A 2UU8A 3K77A 4JQRA 1WLTA 5LBCA 4XMIA 2QKDA 3U75A 2OQ7A 2X5IA 4GB32 4XF9A 4Q0SA 4RR3B 3EXUA 1VE0A 4NHMA 3OUIA 2EA7A 2BV4A 5FRAA 3OPWA 2A5ZA 3WHTA 4MHUA 4YVSC 1NZCA 4QKFA 3AKRA 3FLPA 4DEVA 3OY8A 5JI7A 4F83A 2VNOA 4FBFA 2GALA 1CQ9A 5CU1A 5FZOB 5DZEA 1LR5A 1MEC3 2YROA 2XL7A 3SLIA 3VBOB 5GLVA 3J7NA 3OBRA 3S5AA 4LBOA 3H8XA 1XNBA 1AX1A 1O5UA 1GQHA 2RV9A 4U2AA 5IFTA 1HRI3 1W8OA 4MYEA 4CP0A 5EV7A 1G9BA 2W87A 4MGKE 4PLNA 4LOSA 3D82A 1YHFA 2QQUA 1AR62 5J36A 1DLCA 1GWKA 5DQ0A 3T30A 3P1IA 2JE8A 4CYDA 4YFZA 1US2A 2JE9A 4MGIE 4QX1A 5FYBA 3RZHA 3G7DA 3VBHC 2V4AA 3ZXKA 4P5HA 4Y20B 1CAVA 4ATFA 2KD7A 1JZ5A 2HJIA 1SHWB 3ACIA 1CIYA 5EYXA 3SH5A 3UT0A 4CUBA 4DY5A 2EAAA 3L2HA 1LAJA 1GQGA 1WW5A 2XWJB 5ABJC 1UU4A 2ILMA 3DKWA 1HXS2 3FHAA 2BOJA 2ENRA 2UURA 1RJ7A 3HN3A 4LKEA 3SKJE 3JBG1 4QXCA 2QBXA 1IZ3A 2QFEA 4QGLA 1KDKA 2K46A 1RUJ2 5F32A 1AUYA 3H8OA 5KXEA 3K4AA 2O1QA 2WRAA 1UY1A 2VXJA 3OUHA 3OG2A 1NZIA 2WAOA 5LRSA 2TNFA 1Y9GA 1H2LA 1RMU1 2XBO2 1UU6A 3AX4A 1COV1 3GBFA 4Y5SA 3RVHA 4BCUA 3MIHA 2V5YA 3LGRA 4XFIA 1IKPA 3N7JA 1WA6X 5BNQA 1UOFA 2ZGNA 1WW6A 3RDIA 1SEFA 1BBT1 1EPZA 1HB1A 4XCAA 3HT1A 1UY0A 1CAUA 2X8KA 1MZ5A 4IEOA 4JKLA 2XHKA 3N9PA 1LOCA 2OYZA 4MX3A 4AEDA 3JD73 4FPKA 3NV1A 3O1RA 4RHV2 1DDLA 4JTNA 3N36A 5C8CC 1PNGA 3L2YA 1QDCA 2LRPA 4JTOA 2VM9A 4BWOA 4QPWA 3WDWA 1VBE1 1X33A 3OY8B 1REFA 5IVYA 4YPJA 2YV8A 3N7LA 4KG0A 3VGIA 3NMBA 1ZZBA 2H6CA 3NNLA 2VR4A 2ZMLA 2Z79A 2VL4A 4ISQA 4BQ4A 2HWB3 3M7AA 3TWIA 1LENA 5IHRA 5H9PA 4HETA 1YI7A 3H3UA 1G9FA 5C5UA 1F5JA 1O91A 4KQ7A 4PI0A 5FZKA 2WZPP 3C7GA 1AXZA 5J3UA 3CJIA 5F6KA 1BYHA 2VW2A 3AKTA 2GMMA 1XYOA 2JG9C 2ARCA 2WBKA 3C3VA 3NV3A 2I2SA 4M3CA 5LB6A 2UWAA 5FLHA 1F15A 1LHOA 4E2QA 5FZAA 3ZYJB 2GP5A 2AC1A 1S2KA 2WO3A 5FYIA 2VNVA 2Q4SA 1AL23 1B09A 4ZPIA 3ZN6B 1E57A 3KT4A 1ASJ1 1ZBA1 1OD3A 2WDBA 5FK7A 2YYOA 4MVTA 2ADDA 3N7KA 2E53A 4NMIA 4Q4X2 1S2BA 1QIQA 1UX6A 4QQLA 4XJWA 3DGTA 1H8TA 5T3NA 2SBAA 3O1PA 3BIEA 4OZXA 4A45A 1OHFA 1JU4A 2VW1A 5H9RA 4WM8A 5FUIA 2J1UA 3BALA 1UL9A 3E5UA 2EXHA 4RL7A 2FDHA 2BP6A 2EICA 3H8UA 4UBGA 4FTEA 2VXRA 3VBUB 1W6QA 2I45A 1LULA 3ME2A 3Q8BA 2Q8OA 1RXFA 2VBBA 3JU9A 1S0GA 5F37A 1XNKA 1FXZA 1OBNA 3AMMA 4FP2A 4IESA 4JKMA 4KWKA 3KV5A 4LIVA 5B4XA 3WDXA 1JHJA 1QJX2 2ZHKA 4MUVA 5J09A 4DEQA 3J7HA 2XJUA 1REEA 2JD9A 2DYCA 2Y60A 2R041 1OLRA 3B93A 2PQQA 4FXGB 4AFAA 2QDRA 1VJ2A 3MIBA 5JOYA 5KBFA 4YGEA 2P4EA 2GAUA 2L9LA 4LNVA 5E88A 3FUOA 1BMV1 2A6YA 2ZJCA 5FPZA 3UGHA 4BQXA 4YZ5A 1MQTB 4ZHNA 1XQNA 1W05A 2Y6LA 4UT5A 1TMF1 5A32A 5GKAC 1LB2A 3AP6A 1SFNA 3GHNA 2PAEA 2BNNA 3ZXAC 1L7RA 4UWDA 2HWD1 3C8XA 5T5JA 1UMZA 4PBOA 3AXEA 4NRQA 3AKSA 2CDOA 4KMQA 4GWJA 3T0AA 2VQ0A 3RPQA 2D6PA 3ZXGA 5C71A 2NZ9A 1DBNA 2E31A 4F7ZA 4DY3A 3POWA 5JMCA 2X05A 2W39A 2IXKA 2IFWA 2WNUA 1RUH2 1H9PA 4XQDA 4BJ0A 5F2SA 5FLIA 4UYBA 1YUDA 2B45X 1RUF2 2NMOA 3JZVA 4Q4Y1 3WNMA 3ZYFA 4O65A 1OF3A 1RUOA 3LF7A 1NA1A 2RS53 2Q5TA 4N43A 3WSOA 2Q1MA 4FPGA 4XF4A 3LOIA 3U14A 4ZKTB 1JI6A 2VCMA 2YMZA 5JXHA 3P3PA 4OCTA 2FDJA 1PK6C 4ZZ5A 3S30A 1WKYA 1BVVA 2VZ1A 4AF9A 1RUE1 5FZ3A 1AVBA 1ENSA 3KT1A 3IIAA 3FLRA 5E8AA 4DUVA 2BGCA 3VV1A 4NHYA 3URFA 2PYTA 4IEUA 2DWRA 4B1LA 3WNPA 1DQ6A 2WIIB 3R4SA 2CAUA 1R092 3FWEA 1VBD3 3I59B 1K5MA 3O7OA 3VL8A 3WG4A 4I02A 5K0UA 1DYOA 1WUVA 2RDQA 1VBB3 4LBQD 5FKBA 3WNOA 4I0AA 3W21A 4DRVA 1VBC2 2JG8B 3TN92 2HEYF 2XLAA 2ZGSA 1COV2 1XNTA 1SFYA 4GMP1 4KL1A 2ZKLA 2JDKA 3WW3A 4YARA 1NCQA 3GZUC 4LITA 4I09A 5BY5A 1AX2A 2YFUA 5F3CA 2PAKA 5IVVA 4Y1VA 5EIYB 1BK1A 2BBAA 1JOJA 2JIJA 4N53B 2MEV2 2BTVC 1A3KA 2XKOA 4RHV1 3VBSB 3T0DA 1PVC2 3TN93 3RMYA 1SLIA 4XJ8A 4IE6A 3DV8A 4RQPA 1IPKA 4EE2A 1OKOA 3KM5A 2IC1A 3AB0A 3I3EA 3QH6A 3UJOA 3VBRA 4K7JA 2Z69A 3ZX7A 4Y3OA 5KXDA 4E8CA 2YC0A 2XJRA 4TLFA 1WMXA 1W90A 2XBO3 3QOPA 1GFF2 4CRQA 4EV0A 5I91A 1K5JA 3LDBA 3GCXA 3P3NA 4QWNA 2FMYA 3RZJA 4XC9A 3S5QA 3K2OA 1W28A 3ASIA 1FNYA 1QJU1 3D0JA 2WO2A 3THCA 4LT5A 2BW8A 1OI6A 3MPPG 4AEDB 3U1XA 4Q4Y3 2JDYA 4FQZA 1ALYA 2D3RA 3C2UA 4LKDA 4NWWA 2E7TA 2ZABA 1AR73 1BXHA 4CCOA 1GR3A 3T2QA 1I5ZA 1MACA 3ILNA 4P14A 2NM1A 1OVPA 2EIBA 3JB4C 2VCAA 1ZRFA 1ND2C 1U5IA 1DGLA 4B4QA 3WEZA 3IZOA 5FXXA 2QDNA 1O8SA 3HVDA 4CCNA 1U12A 3OYWB 3AVRA 1PO21 3AZVA 1LGNA 1LJ7A 3ZFFC 4JGYB 2WNUC 2Y6FA 1S1AA 3MLKA 5I0TA 1QU0A 1JZ2A 1Q8OA 5KC6A 1AJKA 5FY9A 4NE9A 4IGPA 1YNAA 3WOGA 5F5AA 4E4HA 1FV3A 1CN1A 2WABA 3MYXA 4ONUA 2JX9A 2LUWA 4QHOA 3USUB 5JXIA 1V6JA 1JH5A 1QJY2 4YG6A 3B9CA 4LK6A 1YQ5A 3I4IA 3WHUA 2R072 1IQDC 2EAKA 4H2AA 1UIKA 3LA2A 1EYBA 2EXJA 3AZWA 4EWEA 1O3SA 1FT9A 3NNMA 3WV6A 5A6QA 1UZ0A 5IVEA 1AJOA 4FTSA 4XTMA 2QQVA 1AR63 1AR91 1DLLA 4N9HA 2E9QA 4XBLA 2VULA 4PF5A 2Q8EA 5C9AA 5KXBA 1Z7S1 5I0RA 2FDIA 2RDNA 1CESA 3I2FA 3I2KA 4AVSA 4Q1RA 5FFOC 4Y1YA 4WZFA 3THPA 5JOXA 3ZSKA 1QKQA 1E5HA 2RVAA 3M3OA 2JB8A 3OD4A 4BH9A 3BYWA 3BTXA 3RMXA 3LQCA 3VLBB 3MBWA 4HZFA 4Q4V1 4XXAA 1HQWA 4DO0A 4CCMA 5AFBA 4WM7C 1D4M2 2J22A 4XOGA 2BFUS 1C8NA 2QQNA 3PVNA 1ND2B 3HNMA 2R49A 5AVAA 2W9XA 1O4TA 3R6SA 4S2FA 4GWMA 1MS8A 3KLSA 2UYAA 4BIOA 4HFSA 5CZKA 2XUMA 1G6NA 1DYKA 4MGZE 3RG0A 5B2GB 4XFAA 5A32B 5IVCA 3W5MA 2J1EA 2OUHA 3PIGA 4Q4Y2 3DXTA 2DVDA 2R0HA 1VALA 1TME3 3ZFFA 1SLBA 1UMHA 4WZCA 2DVAA 1IPSA 2DTYA 2VZ3A 3EB7A 3IAPA 3LFMA 4K20A 4NRPA 4JHTA 4TLGA 3I97A 4CPBA 1HN0A 2DCYA 2EIEA 5CFDA 2C6SA 4NAOA 4QD2A 4QGMA 1Q56A 3Q8FA 5A6XA 2OKXA 4AGGA 2F6BA 5A7WA 2HWB2 3N9QA 3QLQA 4QHZA 4OHWA 1STMA 1BEV2 5AC92 3LZZA 2YXSA 1ZYBA 3PMSA 1XYNA 2YU1A 4XE9A 1XE7A 5ERLA 2DFCA 3TAYA 2R063 3VBSC 2XPJA 5L73A 1OD5A 4NUBA 1MZFA 4YW6A 4RR3A 2XJSA 1U5XA 3WP3A 4NIAA 1SFPA 4OHVA 2DF7A 1POV0 4ZXEA 5I8YA 4NPMA 2R7EB 4CDQC 3ZFEA 5BNNC 3JD72 5FYVA 5FZGA 1CJDA 2BBVA 3PU3A 4QT6A 1XB9A 3LPFA 1R081 1CAWB 2RS52 5DAQA 1QXJA 3WNXA 3ILRA 5FZOA 2E33A 4QHBA 2OUJA 2ZBJA 3NNGA 4XFFA 1EAH3 5C5TA 1BBT2 3ZPYA 2DV9A 2EIGA 2QQKA 3I59A 3UKTA 3R4DB 1VBB2 3WP6A 3VHRA 3A23A 4R9AA 3ZIWA 2JECA 1F35A 2ARAA 5ACA3 2HH9A 4LA3A 1LECA 3PLQA 5CKMA 5FZIA 3SCHA 4E27A 4AHZA 5FZ8A 2CGNA 1I5PA 2ZEXA 4GJYA 2VUAA 4EROA 3V0AB 1NCQC 2AACA 3T1LA 3T4VA 5LA9A 1JUIA 2XB6C 5AVPA 4BLJA 1F2NA 3ILFA 4ZZ8A 2K0GA 2E51A 5A7WB 3M2MA 2VECA 3VKNA 4QPGB 4YGBA 4PLMA 4QQPA 4TN7A 1QJU2 1SBDA 1UMIA 3NKTA 5FZDA 3T3YA 1YQCA 2QTWB 4CDUB 5KXCA 5K0UC 3ZR5A 4K1YA 4XJZA 3I7DA 1OMIA 1CGPA 5DUXA 3IBMA 3S7IA 3FLTA 4R4XA 4WBBA 4V1PA 3O1UA 3WR0A 1UYZA 4JGYA 1JOPA 2W08A 3HD8B 5CFCC 2HWF1 5JOZA 5BV6A 4IUGA 1ZREA 5CAZA 2J1RA 3KV6A 3VBHA 1HB3A 4B7EA 4Q5OA 2DTWA 3UJQA 1OFSA 2VPVA 4M0NA 1PO12 2LALA 1PK6B 4YW7A 1KD7A 4CEWB 3PDQA 4ZS3A 1YQ2A 4QU1A 1IHMA 2J42A 2XLGA 4FVVA 1X36A 5C3RA 3MUZ1 3J8F1 1JZ4A 3NKGA 3ZFGA 1UZZA 3BTZA 3KV9A 3GBGA 3VN4A 2DUPA 3CF6E 5C4WB 3DL3A 2DU1A 3RZZA 4YFWA 5A7NA 1QMJA 1TEIA 3V65A 4XPVA 1S0FA 3ST7A 3AYAA 5JSRA 1SG3A 3USSA 1RUD1 5B4NA 1SLCA 3U11A 3AZXA 1VRH2 5IUQA 1JHNA 3OBAA 1VMFA 3I3DA 1SLAA 1XNAA 1LKNA 3GGLA 3OF1A 4COUA 1NY72 3UGFA 2GNDA 3J9SA 3PUAA 3ZMNA 3N7MA 1RUG1 1X7NA 1DIWA 2EXIA 3WNNA 1NCRB 3H9AA 3OPZA 4K21A 4RA0A 1VMJA 3WDVA 1H8VA 3FC0A 4MSVA 4Y4RA 3O1MA 1UOBA 4EN0A 3E5XA 5A3MA 2WQ8A 2OZ6A 4NRMA 3LDKA 5IATA 1JYVA 1PGW2 1OUSA 1J3PA 1UZVA 3ITQA 3MEPA 2WWUA 4W50A 3B7MA 2WINB 4IEQA 3W58A 3ZYHA 2JKXA 4TWTA 2ZEZA 2VZVA 4QX8A 3ZXDA 1ZRRA 1NAEA 1RTVA 5E6HA 1SMVA 2NYYA 1YXWA 1TME2 2W1WA 4EN8B 4GQ7A 2ETEA 1REDA 2TEPA 4RHV3 3CHXA 4A6OA 4YVWB 5ACA2 4YSFA 4R9CA 1QQP3 2B39A 5JZGC 4IV1C 4QQOA 3WDTA 2VZPA 3WINE 4C91A 5JZGB 5KHKA 3WUDA 5KR7A 4OQ8A 4BQ5A 1CZVA 1AYN3 2IXLA 1YFWA 3ROUA 3RSJA 1JZ8A 1MVQA 1SDDB 1WLCA 2WNEA 4GMP0 4QX7A 3QCWA 4IETA 2RS11 3ZN6A 4IEWA 2GNTA 4CXXA 2WSVA 2B46X 1EPWA 2YUEA 2W1UA 3WCSA 3I49A 3KHBA 1H8TB 4LE4A 5CG9A 1T6GC 5A3OA 5FIXA 2PLV1 3HQRA 3CU7A 1YCIA 4XBNA 3ZYRA 4COZA 4Y5TA 1IQAA 1YC61 2GC2A 2WS93 4HBNA 1MS9A 5DG1A 3K51A 1UOJA 3GXUA 4HG6B 3POYA 4K8FA 1HB2A 1N1SA 5FP4A 1OLMA 2P2KA 5FUPA 2PFWA 3E6DA 4K9SA 3OYWA 2D3PA 3QH7A 4N9IA 3W59A 1W6QB 2OX0A 4AAPA 3BOPA 3LFIA 4ZU4A 3GM8A 3WG1A 4BXSV 5LEKA 1OH4A 4FOWA 2WFF3 2GN3A 3VBFC 3ZMOA 4UAPA 2H0VA 2JEMA 2KM2A 4GKYA 4XF0A 1VR3A 5CKNA 4CEYA 1R082 2RS51 4YM1A 1GICA 1KS5A 4UW4A 4DIQA 1UO9A 3NJVA 4MHRA 3M8LA 4YW1A 5FY1A 2XBO1 1ZRIA 5SV5A 3TEZA 5EZWA 1UQXA 4EZ4A 3VD4A 3LAGA 5JAXA 3POIA 4B8EA 1DGRA 4HN0A 3VKLA 2JWPA 3EO6A 2RE9A 5IK4A 4E9KA 1D2QA 1QNYA 2D43A 2ZX3A 5A33A 3RJRA 3U4XA 5FYMA 2VMDA 5G04L 1MS4A 5FMBA 5HCFA 5JR7B 4DZGA 5D21A 4XF3A 4ET7A 1NUKA 4PI2A 1J3RA 4MXWB 4QB1A 1J1TA 1KGYA 3IDEA 4D69A 3FUQA 1CPNA 2UWCA 3SHRA 1RHI2 1S0DA 1APNA 4UW5A 5CEHA 2BNMA 5FPAA 3LOBA 4Z92B 1V6MA 2KA3A 2NN8A 3BN6A 1H4HA 3MGUA 1ZBE3 3ACGA 1P8JA 2B5HA 5JVVA 1NXMA 1PIV3 1W6NB 2WNUB 2ZS6B 2C26A 2VMHA 5K0UB 4CXYA 2R061 1PX3A 2Y33A 4JVAA 5JUVA 2Q1FA 4O61A 3E6BA 4ZXKA 4CA9A 2PLV3 3MHZA 5F9TA 4LLFA 3ZYPA 1WCDJ 3M4FA 3WG2A 2HWC3 4JGZB 1YRZA 3WD5A 1PO22 2WNVB 2XMLA 3THDA 4H7MA 3PHMA 4L2NA 2NMNA 4RGAA 2G9ZA 2G9GA 3T2OA 5FDBA 2C9KA 3IDAA 4L99A 1ULOA 3VBFB 1CAXA 4QDRA 2JE7A 1OQ1A 1O4ZA 3AFKA 2WWJA 3ACLA 4IV3C 4K40A 4TYSA 4Y22B 3MIDA 4GB33 2WZR1 1VIWB 5T5PA 4CCJA 1QQP2 2CAVA 1N3PA 4ARYA 5JIUA 1EV13 1OUXA 4PLOA 1N1VA 3H3ZA 2RR12 2RMU2 2VQUA 3WQBA 3HBKA 1NG0A 4L92A 4LQRA 2WN3A 5FO9B 4AXOA 4YVSA 2BEOA 2JG8A 1LOAA 3H50A 3IAQA 5GJ6A 4E4SA 5CA6A 4XFBA 1JYTA 1D0GA 3VZKA 2AEYA 4X8PA 1KRIA 2WLPA 1XPWA 3HNBM 2WYSA 4XETA 2KR2A 1N1YA 2JD4A 5D2AA 4Z1VA 1UX7A 2WFF2 1YO8A 4RQPB 1SCSA 2E7AA 4FPLA 2WR9A 4O9GA 3WQ7A 2R0FA 4BISA 2DDUA 1RVF3 3ZFEB 5JWPA 2VBDA 1W39A 2W47A 1Z7S2 5JR2A 4QAWA 2V09A 2R042 5F39A 4WM8B 3ZXJA 4CSWA 4JGZA 4XYXA 1BMV2 2ZX0A 1ZBE1 3EHKA 1IS6A 4K8RB 1PIV1 1W3VA 3PTRB 2GU9A 2QQOA 2W3JA 5FMOL 4CDXC 1FMD2 1GWMA 2KXLA 3BB6A 3AJYA 4CTEA 1PHMA 1WCKA 2ZHNA 3B3QE 5EP9A 4MZUA 1YJKA 4JX0A 4KU8A 4EWAA 3V0BA 3Q8CA 4Y22A 1GP4A 3E6CC 1DQ5A 4L97A 3ZR6A 4NIDA 1T2XA 3M3EA 1JUHA 4QB2A 3KSCA 4XHXA 1ZRDA 5C33A 1H9WA 2MEV3 2ZKNA 2IVJA 3AP4A 2GZWA 3ON7A 1CPMA 3IMMA 5FP8A 3U0ZA 2BQPA 3K46A 4UFJA 3TB0A 1JYIA 3HOBA 1WZXA 1IPJA 4M00A 2VE1A 1BJQA 5A7PA 1FOD3 2ATFA 5K9YA 1GUIA 1V6NA 2LROA 4UXAA 1OOPC 1RMU3 1YJLA 1KEXA 2VZTA 1COV3 2QUOA 4QXHA 1C5HA 4P08A 2J1AA 4QDQA 3N4MA 1VBC3 1UY2A 1O7FA 1LRHA 5KWRA 1HKDA 1HJGA 2VMIA 1R1A2 4J1XA 3UKVA 3VDAA 4ASMB 4Q0UA 3KCCA 2JDZA 5DAWA 3SC7X 1CR7A 2RM21 1KITA 4HSLA 1BEV1 1GU3A 4LBQA 3WF4A 4BQWA 2Y26A 1ZRCA 1FNZA 1W06A 2IXCA 1H1IA 2J1SA 3DYPA 3HAGA 1AR61 4PDWA 4YW3A 1FPN1 1V6KA 2GC1A 3CBNA 1KS4A 4PF1A 5DAVA 4I0BA 2PHRA 4BIFA 2PN5A 4RS5B 1UXZA 4D8MA 1S55A 1C5IA 5LASA 2BWAA 4JRAA 4PBPA 1Q3EA 4HPKB 2D44A 1BCXA 4YZ2A 4LK7A 4Q2FA 5DAXA 1POQA 2WS91 3K48A 2DCJA 4LO5B 3VKMA 3ZSMA 1RUI1 4XACA 4XILA 2N7GA 5DAPA 2IWGB 4BDVB 1G86A 5C3PA 4BQ3A 2ZACA 1VRH3 3RJ2X 4QB6A 4YRDA 5LATA 2W2IA 5DMYA 4UOJA 1WA4A 3DPRC 1RUD3 5F3IA 2C0ZA 1CWPA 4LOTA 4M3CB 1RITA 1TE1B 2YBSA 1PVC1 3AVSA 4LO7A 2HWE1 4G4FA 3NRUA 2D6KA 4GAZA 3HIFA 2HEWF 3NAPB 3GALA 1PO13 1ST8A 3M3IA 3U37A 3ZN5A 5BNOB 3SMHA 5HV4A 5FZFA 2OXBA 5GLZA 5I8TA 1OC1A 1RUC1 1XU1A 2D6NA 4YVWC 3ZVXA 1BQPA 5JPNB 1ZM1A 4Y24A 1UU5A 5GM0A 5EXOA 2D6MA 3M70A 4PIXA 5FPVA 4OI1A 3T1MA 2BOIA 3B00A 3CDZB 4QPIA 4DS0A 5A3UA 1GZ9A 5FJHA 1QHDA 4NR1A 5FP9A 2CYFA 1BEV3 3DF0A 5T55A 2RJKA 3WP4A 4IE4A 3BU7A 4AI0A 1AXYA 1QJU3 5T5OA 3FE5A 3MV11 5A1LA 2J1VA 3RQ0A 4LBKA 3C7OA 5TSWA 1DP0A 1DGRN 2E63A 2VD7A 2W0XA 2PHTA 3GF6A 4XHBA 5FZ9A 5CFDB 5IFPA 2JG8C 1TG7A 1XNDA 4YYOA 2W95A 5HXMA 2VOVA 1X9PA 1CJPA 4QKBA 1HRV2 2BJSA 5FAXA 1EV11 5FXZA 1JZ7A 2ZHMA 1JYCA 2JDMA 4WM7B 2RG4A 3M1HA 1AR83 3ENRA 5D8AC 3IM0A 4HK9A 2ZX4A 1Z0HA 2XONA 4FFFA 5D8AB 4DPNA 5LBFA 4Y4YA 2CDPA 4NHKA 4I0WB 5HI0A 1O3TA 3CZUA 4JDMA 1Y7BA 1KJRA 1IG0A 4PIZA 1QOTA 3AMQA 2XGXA 3POJA 2WNVA 4UW6A 4H7LA 3OGJA 3FHIB 2RR13 4I2OA 4XJ9A 3ZO0B 3KWVA 4XUOA 1X9TA 4ORFA 2QQJA 1W6PA 1ZZ6A 2CGOA 3WQ1A 5C3SA 5C6CA 1C8M1 5FYUA 4CU7A 3KD4A
chains in the Genus database with same CATH topology
2XVLA 4BOWA 4KG8A 1RUG2 4H55A 1GV9A 2XG3A 3AMHA 4CDWC 1ZZ9A 2DURA 1QOSA 1DQ4A 3ES4A 4QPGA 3ZIXA 1ND3A 3ZSLA 1SDWA 4EWDA 3VBHB 3AP9A 5JPMB 1OKQA 1C8M3 5IT6A 1S0EA 4FPJA 2H0BA 3WVJA 1WW7A 5CADA 4AVTA 2WL1A 3EJKA 2VVEA 1B35A 2UY8A 4W6WA 1HQLA 4C1XA 4LBJA 2E7QA 1UD1A 1AYN1 4LBQB 2HWD2 1G7YA 3CL1A 3KCYA 5JCTA 3NAPC 3ZFGB 5BUVA 1O3RA 2VG9A 2ES3A 1QH6A 1AL21 2IZWA 3BIWE 1HW5A 2PLV2 1X8EA 3WT3A 2RM22 1NOVA 4HPKA 5FBZA 1RGSA 1AF9A 1KQRA 3IPVA 1FPN2 4D94A 3FJSA 3B94A 4OUSA 1HXS3 1V6LA 5AC91 1QH7A 1D4VB 4GH4A 3AP5A 3JBG3 5FPXA 2XH6A 5DZFA 5L7OC 3RS6A 1ZX5A 4YLZA 4M3CF 1MVEA 3L9JT 2A3YA 4CDWB 2CNAA 4H14A 2D5FA 3LB9A 3FFZA 5GLTA 2WWSA 2BWCA 4AVVA 4XIOA 2FZ1A 3TRSB 3GBWA 4LO6B 4AFBA 1KFUL 1JW6A 2ZGOA 3TN91 4H3WA 3ZYIB 3RRDA 2X29A 3S7EA 1WBFA 3LA3A 3I8TA 4URTA 4IV1B 4E4ZA 1ULGA 4P9JA 4C0BA 5J7MA 4AEJA 4YW5A 4QMAA 2QNKA 3MFAA 3USUA 1QGLA 3AZZA 3WW4A 2B42B 2DCKA 5C4WC 1QXRA 1O5LA 1HV0A 2XL9A 4FP3A 4YG3A 5FOJB 1HX6A 4AW7A 1FAYA 1R1ZA 3VBOC 4AYUA 2BPA2 4ES8A 3AFGA 2VVFA 1IGOA 3ZN4A 5GLWA 3O0XA 4NOTA 3HN1A 4XXPA 4Y1UA 1FMD3 4XBQA 2YDEA 1RUG3 2TUNA 1V6IA 4XEZA 1NA1B 3MLLA 1MS3A 4N43B 1NYWA 4FOQA 4XJAA 2HWF2 4LA2A 2BVVA 4CDXB 4CDUC 4IEPA 3WDUA 1IS4A 1LHUA 1V70A 3ZXLA 3O12A 2P37A 4YZ3A 2RS13 3AMNA 4W6XA 4DMIA 2PAMA 4J1WA 2GH8A 1K5MB 5FREA 1MZEA 5J98B 4CEYB 1FOD1 4LBLA 1QQP1 1GYKA 4QX5A 3QD6A 4RS5C 4IV3A 4N53A 1Q43A 2RR11 2O8QA 2BNOA 5LRRA 4Q4V3 5IK8A 3VZMA 5J96B 3X29B 1BKZA 3SITA 5IK7A 3AYEA 5K8SA 2HWC1 2PELA 1LEDA 5BNPC 5K7PA 1VBA1 2B7YA 4LHKA 2JKBA 4Q8KA 4Q4W1 2YZ4A 4JGYC 4RSUA 1SBEA 1WCSA 3ETQA 4AQ2A 1YFUA 4C0HA 2BFUL 2RS33 1HQNA 3CEWA 4S2HA 1YFYA 4C1WA 3WG3A 3IN9A 2D98A 2X53S 1LOFC 3OCPA 1PIV2 3NJZA 1V9U3 2CGPA 2G4IA 5FTTC 1LOFA 4G3YC 1CAVB 4UW3A 2ZAHA 3KT7A 2XKPA 3O5SA 1FATA 1TME1 4R9DA 2MPFA 4IV3B 1I6XA 2SLIA 1LESA 3TOJA 4EN7B 3NAPA 1LHVA 4CP1A 1FV2A 1A8DA 3D6EA 3V56A 1QXPA 4GB31 2P3IA 3J8F3 1WMDA 3H7YA 5BNPA 4O9EA 1YIPA 4BE3A 4DNYA 3OTFA 4HKOA 3NV4A 1U5YA 3A4UA 1UIJA 4AWDA 5BNNA 1X82A 4QU2A 1W6OB 3ZFEC 5KC5A 2ERFA 4N53C 5EJ3A 4YGCA 5EFUA 3VKFC 1NQJA 4RR3C 1GKBA 1D2SA 3CJXA 2O0OA 3WW1A 1RUF1 1WD3A 1RIRA 2D7FA 4QPGC 5C8WA 4BQ1A 3MW4A 2VOWA 4Q26A 4CDUA 1AHSA 1DGWX 3SH3A 4QPIB 3LSEA 2ZZQA 3V0BB 1AYM2 1C1LA 2MHFA 1SQ4A 2HEVF 4XIKA 3AMPA 2AYHA 1UZYA 1YI9A 2EXKA 1X8MA 5I8SA 4Q1PA 2WNVC 3WY6A 1QY4A 1CD3G 1WMEA 1IKQA 1H1AA 2ZX2A 4MH0E 1D0HA 3MZHA 2P34A 4M0HA 1W0PA 4KNCA 2IXIA 4OVEA 1OA4A 4Q4X3 3TNPB 2X5IB 2VMGA 2R30A 5FO8B 3SXWA 1W0OA 2WJSA 4UBHA 1EAH1 4WM7A 3BTAA 2NLRA 2ZGUA 3ZFFB 1OLQA 4HK8A 2WZR3 3AJZA 4AE2A 2ZGLA 1WGPA 4NVPA 4AHXA 3MPBA 4YGDA 1VB4A 1NLSA 5JIAA 2AREA 2VOXA 1Z7S3 4ZU7A 1BZWA 5BNOC 1VBD1 1ENXA 3PNAA 1DHKB 3D0SA 2LM3A 1OQDA 4R4ZA 1D4M3 3VDDA 1VAVA 3BCWA 1IS5A 3N35A 3KCXA 3MIFA 5DDJ3 1RVF1 3B02A 1WD4A 4FTBA 1PGL2 1VP6A 1UW8A 2ZGRA 2WC2A 1DYPA 4PDWB 4R8HA 4YVWA 1QF3A 2VOKA 1LOGA 3N3HA 5L7OA 1VBE3 1CAWA 1UCXA 2RS31 1SACA 4FPYA 1HRI2 5C8CB 4IERA 2D6LX 4META 2BYVE 2NP0A 4BA6A 4HVQA 5FQ0A 3ZFGC 4JC1A 4WVMA 5I0UA 3VZOA 3IPVB 1OOPA 2XJPA 2ZOEB 4LULA 2HWD3 2WT1A 5E89A 3KGZA 1TMF3 1VBA2 2B9UA 2GDFA 2QZ3A 1WMFA 5F1RA 5JSOA 1UPSA 1Q8SA 1WLDA 5FMOS 4YM3A 3J4UH 3JQXA 3NW4A 1AZDA 3ZSEA 1RL3A 2ZMNA 2P17A 3DN7A 2HWB1 3ZSJA 1B35C 2GMEA 3ATGA 4MLOA 2Y38A 4FPEA 3WW2A 1NQDA 3QBQA 4HVRA 4BMEA 1SLLA 1IS3A 1ZZ8A 5DDJ2 3SH4A 1OPMA 2ZGTA 2QJVA 3FMGA 4PCRA 3B9IA 4PIYA 1FI2A 1QJX1 4Q29A 1ULCA 2ZGMA 1MZ6A 2IXJA 3D4KA 4A2UA 4KWLA 4CDWA 4FPCA 4BHPA 1W6OA 1LODA 1RMU2 1LOBA 3PVOA 5FOBB 3THTA 3MIEA 1RUJ1 3WZ1A 3WCRA 3DPRB 1DFQA 3U07A 4D7YA 3IDCB 1A78A 2ZGPA 3M3QA 2D6OX 2AZ5A 5J48A 2WKKA 1BBT3 4X6QB 1GSLA 3D8CA 3GZAA 1PVC3 3PVBB 2A71A 2P3JA 4OI2A 2FMDA 1UKGA 3VHNA 4L9BA 4HL0A 3RI9A 4K1ZA 5D8AA 1HRV3 5FQ0B 1ND3B 1RINA 2HWF3 1DF0A 3I54A 4N7UA 3H1YA 1F31A 4KU7A 4JV4A 1W2UA 2GH2A 2PHUA 4KGQA 2WQ4A 1YWKA 1KJLA 2R043 3FFQA 4WVVA 2YHJA 4ISRA 1HV1A 2AENA 3AKPA 2K2SA 2FBEA 4AQ6A 2G9FA 3S6PA 1VAMA 3OGGA 4DFSA 1DG6A 1I3HA 4OUMA 4AI2A 1H0BA 1RUC3 4XFCA 4MV2A 2FZ2A 3HR9A 3M3CA 5A3LA 1FX5A 3H7JA 3KMHA 4Y20A 1QJZA 3JBG2 4G9SB 4IEXA 5FO7B 4FPOB 1XXNA 4LO8A 1ZNPA 4LR4A 5L36A 3ZXFA 4Z82A 1C4RA 3FBYA 1Y43B 4FPFA 4RFT0 3W9AA 5CB7A 2ZMKA 4KGGA 4D7TA 3V0AA 4XQWA 1MEC1 3B01A 3FX3A 4HKWA 1DZTA 5J37A 4K6BA 4Q4X1 1PO23 4JRLA 2XJTA 1VBD2 2MNGA 3TNQA 4DOUA 4GH4B 5JSPA 1MS1A 4M01A 5KHIA 1VB2A 1NXD1 3NO8A 1V9U1 3VL9A 2XJQA 5CIRA 2BVBA 4NO4A 2FHRA 4Q8LA 5GZFA 5GZCA 1GLHA 4CEYC 3ZYGA 2OA2A 1VBE2 1CAUB 1ZBE2 1N47A 3LA7A 1FPN3 2R1DA 3NVCA 3ELNA 1MS5A 3SNMA 5EYYA 1UKRA 2BUKA 3FBMA 2OW4A 4AGVA 4HKLA 2DU0A 1HRI1 4Q0QA 1TMF2 1VBA3 4PDWC 1POV3 5DZGA 4HVOA 1H8TC 5BNNB 3AXDA 1OA2A 2QZ2A 3H1WA 1YLLA 1LU1A 1CVNA 5T5LA 3WUCA 3GYDA 2ARXA 5FCCA 4CP2A 1ZVFA 2ZHLA 4K3UA 2WZR2 3VBRB 1ASJ2 1ND2A 1TNFA 1ZBA2 4IV1A 4EN6B 1HDKA 3A0NA 4P9LA 4Q4W2 4ZU5A 2ZCWA 1CIWA 1R083 4RS5A 4PJYA 5CBLA 5A33B 4P9WA 1AX0A 4IEZA 1VLNA 5H9SA 4BPZA 1VRH1 4AEKA 1WLWA 4Q27A 5D1IA 1H4GA 2EVXA 2ZA9A 1W6NA 4LHNA 3U10A 1RUE2 2D93A 2PHLA 4I01A 5DDJ1 1RB8G 2VY0A 2P3KA 4XJUA 4LLOA 5CG8A 2DUOA 2IXHA 5HBAA 2WT0A 3H0OA 4QGNA 3INAA 1AYM3 2WS92 3PVEA 1LCLA 2OZJA 1UN1A 2I07B 3JD71 2XJVA 2CTVA 2ZGQA 5DUVA 4AEDC 4HLTA 4RQPC 5E16A 2WLQA 2Q1ZB 4GWNA 2F4PA 1HXS1 3VDDC 2XLFA 4XFGA 4N90A 3IDBB 3O0VA 5BNOA 3AZYA 4OI0A 2QQPA 1AYN2 1DGWA 1YFXA 2FQPA 2VGDA 3GZTB 1H2MA 3KZ4C 1HLCA 1OFNA 3OD0A 3HBZA 1ASJ3 1ZBA3 3MFCA 4QM8A 4TSVA 4AI1A 3HQXA 1U5ZA 4YVSB 5I0SA 2WQZC 1WW4A 1ZZCA 1N3QA 4X6RB 5GZGA 2YPJA 1A8MA 5CNAA 3JCIA 2AH2A 2K9ZA 1GZCA 2VW0A 3VKOA 1R1A1 2CY6A 5T54A 1PZ8A 2RJLA 3ALQA 4JGZC 2C5DA 1ONAA 3KGLA 2D97A 1ZZ7A 3POSA 1H30A 1QNWA 1XRUA 4B7KA 1PM7A 1G9AA 3D5OA 1PK6A 4A7ZA 4AQTA 5CFCA 2UYBA 4IEVA 4FPHA 4E2GA 2C1FA 3BOWA 2PHDA 3EBRA 5ABJB 3MICA 2EALA 5JOWA 1N3OA 3LSDA 5IK5A 1DU3D 3UL2A 1TNRA 4GH4C 4GXLA 1RHI3 4BZ4A 1RUF3 1GZWB 1V00A 3J8F2 1LOEA 4X8NA 1IOAA 4YG0A 1RUH3 4Q4W3 1PZ7A 1DZRA 4R52A 2CL2A 3APBA 1DQ2A 4LTAA 4Y1ZA 1R1A3 1X50A 1C3HA 2AR6A 2EF6A 4LUMA 3PJYA 3VHOA 3BODA 4L11A 4DRRA 4WVMB 4Z2WA 5BNPB 4QQHA 4Y26A 4BLIA 3LKJA 2WA4A 1V9U2 4TZDA 1ULEA 2CV6A 2VH9A 2PHFA 3MW3A 2A73B 4P9IA 4DB5A 2R071 1M06G 1Q8PA 3WLUA 2UY9A 4WVWA 1RUC2 1W6PB 2RHPA 4HMZA 4OLLA 4SLIA 1AR71 4HN1A 4WV8A 4EN9B 4AI3A 1EY2A 4I3GA 1QJY3 2Q30A 3JB8A 1MQTC 2ZPXA 3R4UA 4QPYA 2XVKA 4YM2A 2AUYA 1ENRA 3NWKA 4MXWA 1LHNA 3RYKA 5FLJA 5F6LB 2O8OA 1NCRA 3MF9A 1AR92 1ND3C 1Q5OA 4W65A 1JBCA 1AXKA 4Q4V2 2Z2SB 1XU2A 1NLRA 1UAIA 2VUJA 4AI8A 1FOD2 2Y0OA 1D4M1 4COYA 1A6CA 2GMPA 2I74A 2VNRA 3GHMA 3IMNA 3MW2A 4BYYA 4JAAA 3RNSA 4COVA 2GN7A 1H1MA 4BMBA 3T2TA 4KWJA 1ENQA 1KDMA 2RS12 3AKQA 5DXDA 5AFEA 1AL22 1ULDA 4FXKB 4GIQA 3QACA 2GNBA 3CJIC 5JZGA 2WA3A 5KHGA 4FOYA 3GNEA 3VBFA 2PA7A 5E1RA 4OHZA 4XF1A 4XMAA 1AR93 2GSYA 4Q0VA 5BYNA 5KHJA 4DQAA 1RUI3 3KB5A 5LEJA 1QDOA 2WFF1 2YGMA 1HIXA 2R32A 1SCRA 5DUUA 2NPIA 4P9GA 5CFDC 4NPRA 4YZ4A 1RUI2 2R6QA 1L3JA 1MR5A 3CLPA 3SCGA 1EP0A 1PZ9A 5C8CA 4C90A 1PMIA 1PGSA 2A3XA 5SV8A 1V6OA 1URXA 4SBVA 1F9KA 4OHXA 4AFMA 2RMU3 1R091 1OSGA 2VQAA 1N1TA 3VZLA 1FMD1 5HCAA 2A7AA 4HANA 2PHXA 3KS7A 4LHLA 1VBC1 2D40A 2GNMA 3VBOA 2XVGA 3R05A 1PNFA 4WVZA 4D7SA 1G9DA 4Y1XA 1R093 4P9YA 4J6GA 2Y0IA 2CWMA 5C4WA 1DQ0A 3WQ0A 3HMYA 1JXNA 5ABJA 3MIGA 5LK5A 3AYCA 4RGGA 4KH9A 5C9AC 2HKXA 1Y3TA 4GKXA 5DG2A 2A3WA 5T50A 3RYPA 1XE8A 3I2DA 1YYNA 2XWBB 2H6BA 2VU9A 3DUIA 3UK9A 3IWZA 1AYM1 1C57A 2RM23 1DQ1A 3ES1A 4FSJA 4QM9A 4W6YA 4AVCA 1OA3A 4GULA 3TBDA 2ZAAA 1XNCA 1VAKA 1OQEA 1HRV1 1KFXL 3MI8A 5CVRA 4GALA 1S0CA 3VUOA 1RJ8A 5I93A 4N7IA 4I3PA 5H9QA 4PQ9A 4XDQA 2PTMA 3B5LB 4YW2A 2NQYA 1PO11 4FCAA 2HWE3 1FYUA 1MEC2 2OPKA 4KBBA 4A7YA 4M3CE 4NN0A 5T52A 1Y9QA 1O3QA 1RC6A 1JN2P 1F8VA 3OBTA 2DCZA 4FQ4A 4XZPA 2X5IC 1VBB1 5LK7B 1C8M2 4LBNA 4LEJA 4D3WA 1BVP1 4LO4B 5BXXA 4ES9A 1C1FA 5JDBA 1CONA 3HT2A 1QJX3 4Q0PA 1PVXA 1AR82 1AR72 4CDQB 2YY1A 5JI9A 3O14A 2W68A 4E4DX 4A3XA 2R1BA 4GA9A 4YM0A 1KXGA 1RUNA 1K5MC 2AGSA 1O4YA 2YGLA 4AHYA 4LUKA 2TBVA 4FOVA 1PGW1 5AC93 3CJIB 4B29A 1G8WA 4IL7A 3VBRC 4B3NA 3PTYA 4I30A 1WBLA 1NE4A 1CX4A 3Q9OA 4FT8A 1NCQB 4B4PA 4DINB 2ZX1A 4AEMA 1NA1C 4IEYA 4N43C 1YIFA 3VBUC 4AVBA 3V64A 5EWSA 3JQWA 3JUUA 2JJ6A 3WDYA 1M4WA 4NHLA 1EV12 2JG9B 1I1EA 2D5HA 1W6MA 1F5FA 3EQEA 4AHWA 5ACA1 3TYJA 2DCTA 4DXZA 4OHYA 1POV1 1LGBA 1Z78A 4CDQA 5CFCB 3UV9A 1TQ5A 3SISA 2GC0A 3R0RA 1RUD2 2HWC2 3PMEA 4R9BA 5DUWA 1LHWA 3VBSA 1RUH1 4RD7A 4OULA 4OFGA 4AK3A 1OOPB 3ZXEA 2E6VA 1SLTA 2JICA 4ITCA 3G6JB 4Y5Z0 4CEWC 2GC3A 4XTPA 1GZWA 3MLJA 4IQPA 5GZEA 1NY71 1Q8VA 2QE3A 2WFPA 1RUE3 4BM8A 2PHWA 2VVDA 1LEMA 1B35B 3MF6A 4Z07A 5GZDA 1GNHA 5GALA 3O0WA 2R073 4QPIC 2DUQA 2OIIA 3WX5A 5KHHA 1CAXB 2V73A 4FAGA 1QWRA 1S0IA 4JCKA 3S0MA 5HCBA 3A0KA 4FO9A 1UF2C 2B8MA 3WP5A 4HSJA 4LE3A 4XW3A 4XQ4A 4EJRA 2HWE2 4WM8C 2A6XA 3H1MA 1RUJ3 4F8AA 1J58A 4NWVA 4LBMA 4ASLA 1OPOA 4ATEA 2ET1A 3AYDA 1J1LA 3J26N 1QOOA 4QQ2A 2ZTNA 1RHI1 4CZSA 2ZGKA 2DVFA 1LGCA 2A6VA 2MEV1 3DPRA 3ECQA 2ZZJA 2HYKA 4FTEA 2DVBA 3UKNA 2JG9A 2Z5WA 3B69A 1W6MB 1S0BA 2R16A 5F5QA 1DZQA 1NE6A 3E5QA 4P9XA 3VZNA 1PGL1 1I9RA 2QVSB 2ARBA 3AK0A 5C9AB 3VHPA 1GANA 2A6WA 4CEWA 2UWBA 3VDDB 3OJBA 1Q8QA 2Q0AA 4MGYE 1MS0A 3VZJA 4Z8BA 2RS32 2DFBA 3CNAA 1J3QA 2A70A 2D3SA 2R062 3HWJA 2JENA 4E2SA 1ULFA 1J59A 4AVAA 4B4RA 4L8QA 2LTNA 2WT2A 3RYRA 1G9CA 5GLUA 4OI4A 3NL1A 1LTEA 2ET7A 1EAH2 2A6ZA 1GNZA 2OVUA 2WSUA 4YW4A 3E97A 3AP7A 1ZA4A 3KQRA 3VBUA 3IKWA 4JDNA 4IXLA 5BPXA 3RI8A 3CO2A 4GMP3 2Z42A 4U36A 2CWSA 4YNIA 3FZ3A 4AG4A 1H2NA 1AR81 1XYPA 4S2GA 3SCFA 1GBGA 2RMU1 1S0JA 2QCSB 5HXVA 1LU2A 1NCRC 3WXPA 4AFCA 4S2DA 5L19A 1UPIA 2VNGA 3MDPA 3BPZA 2W52A 2DVGA 1RVF2 3ZDSA 3IT8A 1MQTA 1AL0G 4AGRA 1QJY1 1SBFA 3NSTA 4XFHA 4AFDA 4CDXA 4F3JA 2IFRA 2JXAA 5JLVA 4AQSA 3PJQA 4YZ1A 1C28A 1H2KA 1JTZX 2C9AA 3RWNA 4HT1T 4FAHA 4JDOA 4QXKA 4COWA 3AM2A 4INDA 3LCPA 4MXVA 1U0AA 3LWCA 3NV2A 2A75A 2UU8A 4JQRA 1WLTA 4XMIA 2QKDA 2X5IA 4GB32 4XF9A 4Q0SA 4RR3B 3EXUA 4NHMA 2EA7A 5FRAA 2A5ZA 3WHTA 4YVSC 1NZCA 3AKRA 3FLPA 3OY8A 5JI7A 4F83A 2VNOA 4FBFA 2GALA 1CQ9A 5CU1A 5DZEA 1LR5A 1MEC3 2YROA 2XL7A 3SLIA 3VBOB 5GLVA 3OBRA 4LBOA 1XNBA 1AX1A 1O5UA 1GQHA 4U2AA 1HRI3 4MYEA 4CP0A 5EV7A 1G9BA 4MGKE 4PLNA 3D82A 1YHFA 1AR62 5J36A 4CYDA 4YFZA 2JE9A 4MGIE 3G7DA 3VBHC 3ZXKA 4P5HA 4Y20B 1CAVA 4ATFA 2HJIA 5EYXA 3SH5A 4DY5A 2EAAA 3L2HA 1GQGA 1WW5A 2XWJB 5ABJC 1UU4A 2ILMA 3DKWA 1HXS2 2ENRA 2UURA 1RJ7A 3JBG1 1IZ3A 2QFEA 4QGLA 1KDKA 1RUJ2 1AUYA 5KXEA 2O1QA 5LRSA 2TNFA 1H2LA 1RMU1 2XBO2 3AX4A