1VMHA

Crystal structure of an uncharacterized conserved protein yjbq/upf0047 family, ortholog yugu b.subtilis (ca_c0907) from clostridium acetobutylicum at 1.31 a resolution
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
129
structure length
129
Chain Sequence
VIEYSLKTSNDDQFIDITNLVKKAVDESGVSDGMAVVFCPHTTAGITINENADPDVTRDILVNLDKVFPKVGDYKHVEGNSHAHIKASLMGSSQQIIIENGKLKLGTWQGIYFTEFDGPRDRKVFVKII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized conserved protein YjbQ/UPF0047 family, ortho
publication title Crystal structure of Uncharacterized conserved protein YjbQ/UPF0047 family, ortholog yugU B.subtilis (15023806) from Clostridium acetobutylicum at 1.31 A resolution
rcsb
source organism Clostridium acetobutylicum
molecule tags Unknown function
total genus 36
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2004-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01894 UPF0047 Uncharacterised protein family UPF0047
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.460 Mainly Beta Sandwich Jelly Rolls YjbQ-like 1vmhA00
1XBFA 1VMFA 1VE0A 1VMHA 2CU5A 2P6HA 1VMJA 1VPHA 2P6CA
chains in the Genus database with same CATH superfamily
5A1LA 3I3QA 3NW4A 3T30A 5BNOB 2NQYA 5A7OA 2FBEA 5BNPA 2ETEA 4NO4A 3I2FA 4C1XA 4E8CA 2A75A 1YI9A 1OLQA 2GN3A 2UY8A 4FPJA 2VOKA 4Q1PA 4DXSA 3HVDA 2JDAA 4TXWA 4OYUA 4ES8A 2DBNA 2MNGA 3MBWA 2G19A 3J8F2 1S0DA 1RXFA 3ZSJA 1W2UA 2GNTA 5C3QA 4LKEA 3UYJA 2IVJA 2VL4A 1UAIA 5I0UA 1MZ6A 4YVWC 4AQTA 4O7XA 5KHIA 2PAKA 2DTYA 4MGZE 4YNIA 4XFCA 1LGBA 2CYFA 5JCTA 1FAYA 4QHOA 3WW3A 3VD7A 5IJRA 2GN7A 2B9VA 3WLUA 4YW6A 1YQ8A 4D7YA 1JOJA 1QJY1 3EHKA 3FWEA 4TLGA 1EUUA 2QCSB 1HJGA 4COUA 4YZ1A 5BNOA 1SLLA 2YROA 2RS52 3A4UA 1MZFA 3B7MA 4IE5A 4M0HA 4R9BA 3WUDA 2ZGTA 1NCQC 1UKGA 4P00B 1PO13 3H1WA 4AWDA 1RHI2 1RUE2 2RS11 3WNXA 3W5MA 4N7IA 5BNPC 4H2AA 3H42B 1EPWA 3K2OA 5EV7A 3SXWA 3PUHA 2HWD3 2YC0A 5IK4A 4HN0A 4XFIA 1J59A 5A1AA 2W2IA 2ARCA 1M4WA 5IVYA 1VBA3 3ZDSA 1OH4A 1R091 2J42A 5FY0A 1VRH2 2VVFA 3AFKA 3OPZA 1JH5A 4Y4RA 3V56A 1W9FA 4M4PA 4EROA 3K3NA 1OD5A 4XQWA 2CAVA 1CVNA 3AMMA 2PQQA 3L9JT 1X7NA 4Q4W1 1F35A 4QDQA 5KR7A 2E33A 3WF3A 3W5NA 4Q0VA 4MLOA 1UOFA 4OI1A 3UT0A 5FO8B 5IAXA 1UXXX 3JZVA 5JMOA 3NNGA 5JR7B 1MQTB 3POWA 2IFRA 4IXLA 3ZIXA 4AI2A 2ADEA 2Y6LA 3BGAA 4FOWA 1SCSA 3PMEA 1UXZA 2W0XA 3ZFEB 3GZTB 5BNOC 3A21A 3WOGA 1J1TA 3AJYA 5LATA 1RUC1 3ZN4A 2PQSA 5C3OA 3TEWA 4B29A 2ZGLA 3KVBA 1FXZA 4DY5A 3JU9A 5FWJA 2ZMKA 2X10A 4BYYA 1I5PA 5I8SA 2SLIA 1LODA 2EAAA 1GQHA 2VAUA 4K3UA 2VMCA 4LOTA 1IZ3A 1POQA 1WW7A 2HWE3 5FZEA 5IVFA 3CIHA 4YZ3A 1QJU3 4AEKA 4E8DA 3VLBB 5LY2A 1XU1A 2PLV2 2HWB2 2DVFA 2W9XA 4IGPA 4PT6A 3T0DA 4LITA 2FZ1A 1US2A 1VE0A 4YM0A 3IDCB 3TAYA 1D4M1 1PZ9A 4PF5A 2ZBJA 1LOGA 1YQ6A 4MX3A 5DZEA 1MQTA 2DU0A 1DU3D 4RHV3 4CA9A 2RDRA 1Z7S2 1UX6A 2W95A 3ZFEA 2WNVA 3I2OA 3FX3A 3LPFA 1BBT2 1Q8OA 5FYCA 4WVWA 1W6OB 3LEIA 4AFBA 3J8F3 1LHWA 1NXMA 3ZYHA 2IXKA 3IMNA 4WM7B 4M4RA 1WCQA 2WJSA 1EAH1 1TMF2 1ULCA 2Z5WA 3GGLA 2QDNA 1QKQA 1Y3TA 4CCLA 1BVP1 3U4SA 1JI6A 2ZPXA 5EFUA 2YDEA 3MIBA 3RZMA 2DCJA 1AL21 4GQ7A 2ZGQA 4Q26A 2RV9A 1YI7A 2R041 1OUXA 4Y33A 1GMMA 2DVBA 3B9IA 3O1VA 2BTVC 1HRI2 1HXS2 4MHUA 1FI2A 1KQRA 3C7GA 3KS7A 4XVHA 5EJZB 4JGYB 4Y26A 5H9PA 1S0GA 1CZTA 5A6XA 3PVOA 1DBNA 4FPEA 5JPMB 2RS53 1UY3A 5EYXA 1FT9A 3OOXA 4KG8A 5GZEA 4A6OA 1ZZCA 3KCXA 5FP3A 2QNKA 3H7JA 5C8WA 2FCTA 3KCCA 3ZXAC 2VVDA 1RHI3 2UWAA 5JIAA 4JDNA 4CU6A 3INAA 1W6OA 3KHBA 5FMBA 3M7AA 2YBSA 4CCEA 2ZX4A 4WM7A 3ZFEC 2WNVC 3MYXA 4LHLA 5A7QA 2Q8DA 4LO5B 5LA1A 1AR93 2GMMA 4YG6A 5F1RA 5HV0A 3ZSMA 5IUQA 1QIQA 3ACHA 3B93A 1TG7A 3D8CA 3HNBM 4ZS2A 5FYSA 5C5TA 1VBD2 1JUHA 2HYKA 3ACFA 1XNKA 3LKJA 3LA3A 4NHKA 4XURA 4AFMA 2P6CA 5JPNB 1F5JA 4FSJA 2P34A 3SC7X 3V0AB 1RINA 2J7MA 1FV2A 4XXPA 4JGYA 3NAPB 2BGCA 2NP0A 2WFF1 3N9LA 1OMIA 3UKTA 5FYTA 4CXYA 2KR2A 2Y6JA 4LE4A 1ZNPA 2WZPP 4XFAA 2CGOA 4Q4X3 4GD4A 2AZ5A 3D5OA 1U5XA 4K8FA 4S2GA 4NUBA 5HV4A 3ZLIA 3LF7A 3ZOIA 1U5ZA 4A4AA 1RB8G 3P3NA 3RZHA 1W8TA 4XILA 5A7WB 4CDUB 3CHXA 1E5RA 1V6MA 1OLMA 3BYWA 3JBG3 3KM5A 5FZ3A 5JR2A 4AYUA 3KQ4B 3KZ4C 4AHWA 1VPHA 2RDSA 3VDBA 4IE7A 5F8PA 3DKWA 1C28A 5A3OA 2D3SA 3OBTA 1YIPA 1DGRN 5G04L 3CJIB 4HPKB 4WM7C 4BIOA 2W46A 5DZGA 3WHTA 5A7SA 1AXZA 3WP4A 4FAGA 1SMVA 2G1MA 2HWB3 3V0AA 2XR4A 2JE8A 1RGSA 4OMDA 3VD5A 3WCRA 1COV2 1JW6A 1Q5OA 4AHZA 4IE0A 4EN8B 1ULDA 3GBFA 4P08A 2JD4A 2RDNA 2ZMLA 4JGYC 3RQ0A 1WCKA 4KQ7A 1QXJA 1Z7S3 5BNQA 4K21A 1DQ5A 3OJBA 1W90A 2JE7A 4KI5M 1X9PA 2YBKA 1BBT3 5E16A 4YWAA 1XOYA 1YFYA 5DAQA 1OQ1A 4ZZ5A 4JZRA 4C0HA 3H3LA 1YFUA 1PVC1 3LSDA 1LHOA 4RR3C 4C90A 1QNWA 4YM3A 1LULA 3OSDA 1IG3A 1TMF3 3NRUA 4EWEA 4OI0A 2R32A 2VM9A 2BZDA 1BXHA 3CJIA 5FPXA 1JYWA 4HANA 2J1RA 2XKPA 4BLJA 1IHMA 2DFBA 4A45A 2ARAA 2JICA 3I2IA 4M3CE 4AR2A 1A3KA 2RS31 2FMYA 5FPBA 5JI7A 1JYIA 1ZZ6A 2GU9A 2TUNA 3EXUA 3ZN5A 1HW5A 1M06G 1IKQA 1RL3A 4BK5A 1RUG2 1ODNA 3K4AA 1AVBA 1TME2 3RGBA 2X5IA 3POEA 2ATFA 2K2SA 1NUKA 1UWWA 1WBFA 1XNDA 2E63A 5EXOA 5F2WA 2QZ3A 1DQ0A 3H8RA 2VUCA 3ROUA 2ADDA 4J1XA 2EXJA 3BCWA 3OF1A 2QQPA 3BTXA 5FJHA 4ZPIA 3SH3A 1W6NB 4FTBA 3MIHA 1UIKA 4XJUA 1HB2A 1WCSA 1IPSA 4TLFA 3BTAA 1EV11 3NMBA 5C8CB 4E2SA 1L7QA 3HNMA 4YVSB 4PLNA 2B45X 5T54A 1W06A 4RFRB 4LIUA 2WL1A 2BW8A 3ZM8A 2VG9A 2VMDA 3CJIC 2D93A 1JOPA 3QH6A 2VVEA 5F5QA 3HWJA 1LU2A 3RI8A 3X29B 1AF9A 5A1FA 4X8NA 4FPCA 1QGLA 4YYOA 1OH3A 2PHTA 3HQUA 5FYHA 2ZKNA 3FLTA 1R1A1 4AGRA 1ASJ2 4XUOA 1SEFA 3E6CC 3IT8A 3BOPA 4PDWB 2X5IC 4M00A 3LA2A 4XYXA 5FYVA 2W08A 2QQLA 4XAAA 3VBFB 1REDA 4CEWB 4DQAA 2FCVA 1XNAA 1LTEA 1WKYA 3D3AA 5ISLA 3RG0A 1HIXA 4BWOA 3Q8AA 3VKOA 5C8CA 5JMCA 4Z2AA 1W8NA 1GKBA 3LEGA 4YVSA 3VN4A 1GFF2 1PK6B 2WO2A 4OZXA 4YFZA 3FUQA 4HFSA 2QQMA 1V70A 2ES3A 2XJPA 5CVRA 2ZX0A 3ACGA 4E4ZA 2IXIA 4IEQA 1UZ0A 4DXRA 1Y9MA 3N9NA 3FL7A 2VW0A 4CU9A 3D6EA 4Q27A 2OIIA 3NNLA 1O59A 3M3QA 3BU0A 2CHHA 3BVCA 4NWVA 4DINB 1COV3 1JHJA 2AACA 4RN5A 4LO6B 5K0UA 3TN92 4D8MA 2QQUA 1N3QA 4DOUA 3AZWA 1I5ZA 4XMIA 2X05A 2MEV1 5C9AB 4PDWA 3WP3A 2VZSA 5M0TA 4YLZA 1BK0A 3NV2A 4A44A 3L2YA 4CEWA 4OZOA 4OHXA 3VBFA 1XNBA 5GLUA 3WHUA 1RIRA 2A3XA 4YZ5A 3HNYM 3URFA 3WNKA 1L3JA 2JG9C 1QOOA 5DUVA 3OEBA 1G9BA 3F95A 2CGPA 1GZWB 1PK6A 1SLAA 1XYPA 2OT7A 1UZZA 3GALA 3P5BA 1MS4A 2OPKA 3BIEA 5C8CC 1Y43B 3IWZA 4MZUA 2R30A 4CCKA 3WDVA 2E9QA 4YVSC 5FLJA 2RHPA 1N1TA 4C91A 2D5HA 1SDDB 3CZUA 3QCWA 1I9RA 2XJQA 2YPJA 4OUMA 5JWPA 1ZRDA 1TME3 3NNFA 1AYN2 3S7IA 4FFIA 5E1RA 3LD8A 1O7FA 1URXA 2BBAA 5DAWA 5F2SA 3P6BA 1QY4A 4AI0A 5C9AA 2EXHA 5IAVA 2ID4A 2NMNA 1YQ5A 3LAGA 1V6LA 3OB8A 5K0UC 4F3JA 2YFZA 1H4HA 4UW4A 4AHXA 4L99A 5C71A 4RL7A 1GANA 2WYFA 3ES1A 3WT3A 1AJKA 2WRAA 1JS9A 1ENXA 4QX0A 1GR3A 3WNOA 1C5HA 4NE9A 5CU1A 4CEWC 3KSCA 3VBFC 1GZWA 5K9YA 5FYUA 2H6BA 4FP2A 1W2NA 2WZR3 1PGSA 2XJUA 4AXOA 1ALYA 5F32A 2YZ4A 2UWBA 3R6SA 4PBPA 1PK6C 4DUWA 3O14A 2VY0A 1GOHA 1JBCA 4ORFA 2UYBA 3LE0A 1AR62 3MF6A 3MV11 1IQAA 4I02A 1RUF2 2QDRA 2VUJA 3SEPA 1HX6A 2W3JA 4NJ4A 1QWRA 1OBNA 1RUI2 5FUNA 1POV1 1U5IA 4HVRA 2BFUS 2QKDA 3WDWA 2GMEA 2YPDA 4FBFA 5HCAA 1HRV1 4XJ9A 2WO3A 4Q29A 2E6VA 4BOWA 2HEYF 1LHVA 2I07B 1AX1A 2BP6A 5C9AC 4OHZA 5ANQA 4MADA 4PI2A 4UXAA 3MI8A 5JSPA 1C8NA 1SBFA 1VBC3 5TSWA 4Y5TA 5F3GA 3ZPYA 1WD4A 3FUOA 4XCBA 4ASMB 2IFWA 4WZFA 1KDMA 5EQUA 1PGL2 1R64A 1HB4A 4QKNA 2NN8A 2E26A 2UU8A 1JYVA 4XUPA 2GZWA 4KWLA 3TEXA 1AYM1 4Z82A 1BEV1 1VAVA 4FPYA 4B4PA 3C7HA 5LBCA 3PHMA 1ND3C 1OF4A 2J1UA 4IEZA 1QJFA 2P3IA 4FXKB 2UY9A 2CSGA 3WP5A 2P2KA 4MGTA 4CXWA 5F7UA 1PIV1 4IEUA 2OS2A 5IVJA 3TN93 5BNNB 1ND2B 2JXAA 2SBAA 1O3RA 3OY8B 1FMD3 4B8EA 5A80A 5C33A 3GF6A 2PTMA 2OPWA 4I0AA 4BIFA 3M2MA 4AI1A 1NLRA 1W8WA 1LGNA 1VIWB 1GOGA 5FMCA 5LASA 2ARXA 3K4ZA 3LEKA 2C24A 1Q8VA 1KJLA 1UX7A 3IIIA 3OD4A 4GA9A 3DUIA 4JC1A 3A7QA 3AK0A 3AM2A 2R071 1PO22 4JDMA 4FTEA 3RS6A 3VBOB 2HJIA 4PQQA 2CAUA 4QXHA 1YO8A 5LY1A 4TSVA 1J3PA 1QQP2 4AOCA 3WUCA 3THDA 2XJRA 3DL3A 3N9MA 1N47A 4O65A 3ZYFA 1YXWA 2P1BA 4GWIA 3VDAA 4QX3A 5SV5A 1HB1A 4HONA 2DF7A 2ORXA 4IERA 1Z0HA 4HL0A 5BNNA 1FNYA 1E5SA 1AYN3 1KGYA 5C70A 3WDYA 1MEC3 2XBO2 4UAPA 3RRDA 4BA6A 5KBFA 2BBVA 4D7TA 1OXCA 2RR11 1ACCA 5F3CA 4WBBA 3KLSA 4MSVA 4QGLA 1RJ7A 1J84A 1JHNA 4M01A 4QGMA 4N43B 2D44A 3DXTA 4K1YA 1Q8PA 2VQUA 5LA9A 2ENRA 4G3YC 5CYYA 4KWJA 3VBOA 5K4LA 4R52A 4XETA 1AJOA 5F6KA 3WX5A 2E7TA 2EAKA 3U37A 2VU9A 1EPZA 1MVEA 4Q8LA 5L36A 1J3QA 1UD1A 2QQIA 3BIWE 3OGGA 5EP9A 4EWAA 2ZEXA 4JHTA 2VOTA 4CCOA 5F39A 2HLEA 3ZSEA 3JD71 2VXRA 1ZBE1 1CZVA 1OF3A 4IEYA 1O91A 5APAA 4D94A 3NV3A 3C2UA 1RUF3 4Q0PA 5JSOA 1NY72 2RJLA 2RMU2 5KHKA 4JKKA 3ETQA 4W65A 5FZLA 1RUI3 1NG0A 2B7YA 3T4HB 2XUMA 2Q1ZB 1CR7A 5BNNC 2ZTNA 3IB3A 3LQCA 3N9PA 1WGPA 2R061 1SDWA 4I01A 5F5IA 4EN7B 1OKQA 1LJ7A 5A3TA 4TWTA 3C7FA 2GH2A 3G7DA 3LOBA 1H2MA 5JAXA 1JZ4A 1CAXB 3H7YA 4P14A 2LROA 2BGPA 3I2DA 1E5HA 3T09A 2HWD2 1TNFA 2RM21 4B7KA 5DUUA 1U0AA 1GSLA 3CZJA 3OGRA 3S5AA 2Q30A 4FP3A 3IIAA 1RUH2 2Y26A 4CU8A 1O4TA 3AZVA 3VBOC 1NZIA 3WV6A 1J3RA 4Z2WA 1VMJA 4IEPA 2VTFA 4QQOA 3FZ3A 1GWMA 4XF4A 4IV1A 3AKSA 2RE9A 3WR0A 2BRTA 5BYNA 2ZS6B 1RXGA 3KCYA 4QX5A 1UY2A 1KS5A 4UYBA 3ACIA 2W94A 1F9KA 3NJZA 4QM8A 4FFHA 1NCQB 2KA3A 2ZABA 4J1WA 3WG4A 1V9U3 5J98B 4A6SA 5AC91 4S2DA 2HWE1 2W87A 2P5BA 2QJVA 4KBBA 1QJU1 2BDRA 4RQPA 3HBZA 4J6GA 3RJRA 2DVGA 5J09A 4LK6A 3W59A 3I3EA 1AR82 3I2GA 4QKBA 4SLIA 1CAXA 4Z1VA 2JIGA 5FPAA 5F5CA 4RGKA 2Z2SB 4X6QB 3POSA 4KWKA 2KXLA 1SLIA 1JYCA 1UIJA 1AL0G 1YUDA 4QDRA 4DRRA 1Y9QA 1QQP3 1X8EA 1AX2A 1SBEA 1UQXA 1OPMA 2QQOA 2VZ3A 2ZHLA 3AYCA 3IM0A 4XUTA 5FKCA 2EA7A 5IK8A 2CTVA 2VNOA 5IVVA 1A8DA 4B4RA 3K3OA 1W9SA 4H7LA 4IV3B 1DYOA 1U5YA 2ZX2A 4NHLA 4P5HA 2XQRA 5IK7A 3J8F1 1FPN3 4K8RB 3O1MA 2VUAA 2XBO3 4QWNA 1QH7A 2VW1A 4C0BA 4E4SA 1NCQA 4IV1C 4IE4A 1W04A 3CO2A 4JTOA 3ZR6A 4RHV2 4URAA 5LCWL 2JJ6A 3AVSA 4HG6B 3PMSA 4R9DA 1JU4A 1UN1A 2D3RA 3OUIA 4XBQA 2FDJA 3M3EA 4W50A 5FKBA 1QOTA 1NE4A 4UW5A 2Y6KA 4ONUA 4NVPA 4N53B 4KU7A 4RQPC 1TVGA 4CUAA 1POV0 2HH9A 4WZCA 1LOAA 3DPRB 1DDLA 2WT0A 4QX8A 1DFQA 5CKNA 5FCCA 1TQ5A 2Y6FA 1UKRA 3LCPA 3ZDVA 4COWA 2WYSA 2Q8EA 2UYAA 5F6LB 3ZSKA 1ZA4A 4HK8A 1RMU1 4IV3A 4XUQA 4QGNA 2XKOA 3O5SA 2ZGPA 2YG0A 4JRLA 5H9SA 4I2OA 2F17A 1RUE1 2VMIA 1W3VA 1PHMA 1O6UA 4M3CF 2P4EA 5JXJA 1W8HA 2B46X 4WVVA 4QX1A 2YHJA 2RMU3 2PFWA 3OBRA 4L11A 2WO7A 5FZKA 2DTWA 2C9AA 3ATGA 3I59B 1JZ7A 2WNEA 5IT6A 1XXNA 4SBVA 1UO9A 1FOD3 1VRH1 2WC2A 3E6DA 4L9BA 4RGGA 3U07A 1ZRRA 1W6QB 1AZDA 2XLGA 4UBHA 3ZKUA 2WS91 4FT8A 2JX9A 4QAWA 1TE1B 3DF0A 5H9RA 3E97A 3WINE 4N53A 3VZNA 4H55A 1SQ4A 3RMYA 3DPRA 3SLIA 4XMAA 4P9WA 1AR92 1UY0A 2Y8KA 5FZHA 1OA2A 1RUH3 1W6PA 5FIXA 2YFUA 4TZDA 2KM2A 2D40A 5JSRA 1OD3A 2VTXA 2XWBB 1DLCA 1X36A 3VBRB 1H8TC 3O1PA 4CDWB 2VECA 4LJHA 5EIYB 3NSTA 1YJKA 2YC2A 4IV3C 4MO3M 4ZU4A 3D0JA 3TYJA 1G8WA 3HJRA 3BN6A 3I59A 2D43A 2KD7A 1RVF1 2LRPA 3MZHA 3AZYA 3KT4A 3OBZA 4NAMA 3N9QA 3AYDA 4YW3A 5C4WA 2A6XA 4Q4X2 1W6QA 1YWKA 3KD4A 2F4LA 5B4NA 4GH4C 4JCKA 4V2VA 2WNVB 2PLV1 1OLRA 4OLLA 4QU1A 1AR83 3I4IA 1MZEA 2B42B 2CGNA 3KV5A 4K9SA 2P3YA 2ZGNA 4AVVA 5IFPA 5FYBA 3AKPA 5EZWA 2R1DA 1QJX1 1SFNA 5DPNA 4FCAA 3POYA 3JBG2 1ZRCA 3SCHA 3F2ZA 3U0ZA 3C3VA 3V0BB 2D6OX 3KGZA 2WLPA 1ZYBA 3K51A 4N53C 5F9TA 3BKZA 2WUHA 2WWSA 3USUB 3PTRB 3DPRC 2WN2A 4YPJA 4A42A 1BQPA 1Z7S1 1R092 3LDKA 4IGQA 4Q1RA 4D7SA 3VBRA 4MVTA 4BQXA 4AEDA 4DEQA 3ME2A 4Q5OA 1UU4A 2Y0IA 5DAVA 4CDWA 4CU7A 4ZU7A 5FZFA 2V4AA 3MIFA 3AXEA 4GB32 1C8M3 4MHRA 1G6NA 3S57A 4GXLA 2Q8OA 4Q4W2 4QX2A 4L97A 4XJ8A 3VBHB 5JXHA 3AYEA 2DYCA 1TMF1 3BU7A 1IPJA 1DQ1A 4XF0A 1DG6A 2GSYA 5FQ0B 2D6LX 4FOQA 5JOYA 4DPNA 1JZ2A 1OHFA 3ZYRA 2BU9A 4OQ9A 2CWSA 4A41A 3HMYA 1G7YA 2DUOA 3K46A 4NIAA 1VBE2 3FMGA 1AX0A 4JKMA 4NPMA 1JXNA 2E32A 2A6ZA 4HKLA 4AVSA 1HRI1 1CJPA 4BQ5A 1HXS1 5FXWA 2B9UA 2NM1A 2AH2A 3V0BA 4R9AA 5HI0A 4WV8A 3SITA 4RFT0 1ZBA3 4XDQA 2R16A 4COZA 3UJOA 3USUA 5C4WC 2BWCA 3IDBB 2YV8A 3JB8A 4GJZA 2D97A 4LULA 3ETPA 4META 3R4SA 2A70A 3SH4A 3ZXKA 2WNOA 4Q4V3 4O9EA 3IMMA 3DGTA 2HBTA 3AVRA 5J1XA 1JOBA 1UPSA 1NLSA 1RUD3 2A1XA 2F4PA 3AKRA 3K77A 1K3IA 3PTYA 3VBRC 3VBHA 4AEDC 4CDWC 1XU2A 4HK9A 3QD6A 2LTNA 4CE8A 5FQ0A 3ZXJA 1VBD1 2OQ7A 1LOFA 2WBKA 3DV8A 3U1XA 3WZ1A 1EY2A 5IK5A 2D98A 4XF9A 5BY5A 2F6BA 5FY4A 2ZAHA 3UK9A 5KXEA 2IWGB 3N35A 2D7FA 4RR3B 1AR72 1AXYA 4PHZA 2YGMA 3GXUA 2YB7A 3ILNA 5FZIA 1V00A 3T4VA 4CDQC 1GQGA 3PURA 2VZUA 2W47A 1N1VA 2JDZA 1GLHA 3USSA 5GLZA 2E7AA 1OI6A 2NMOA 3MW2A 5IWFA 5J3UA 3WF4A 3PU8A 3ECQA 1DF0A 3KMHA 2HEWF 1EAH2 1XNTA 3AL6A 1GBGA 4LHKA 3VDCA 3MPBA 4HVOA 5FYZA 4Q4Y1 1P8JA 1E5IA 3N7KA 1W28A 2VCCA 4IESA 4V1PA 1YFXA 2N7GA 1KFXL 3GBWA 3UJQA 4ATEA 4CUBA 1WZXA 2YMZA 3GYDA 2FZ2A 1BMV1 3AP4A 4FAHA 5LZ6A 4XPVA 1CPMA 4NRQA 3MLKA 3VBHC 2VE1A 1ZVFA 3HT2A 3VUOA 4RR3A 4MH0E 1HKDA 4YSFA 4CEYB 4LKFA 3VGIA 3ZKYA 3EJKA 1LOFC 4ARXA 1UYPA 2LW8A 4GAZA 3A22A 4K6BA 1FV3A 1COV1 1PMHX 5FP9A 3U4XA 2BUKA 3RI9A 4AZZA 4BISA 1SCRA 3KB5A 4QPYA 3AKTA 1KDKA 2VNRA 2GC2A 2HKXA 4AL9A 3KV4A 1QJZA 3HEIA 5LRSA 2DUQA 4IW3A 2BOJA 3MFAA 1R093 5IVCA 2C6SA 1N3OA 1GZCA 1ODMA 2WO1A 5JXIA 4I09A 4GB33 1HN1A 4GMP1 2VQ0A 1XPWA 1XJAA 1OVPA 1UOJA 3GBGA 4Q4W3 5KC5A 4ZXEA 1VALA 3OPWA 2X5IB 5FPVA 3SKJE 1NXD1 3MGUA 5G05L 1CWPA 2WFF2 5EHDA 2I2SA 2XDVA 4TYSA 5J7MA 1YYNA 2A7AA 2VULA 1W8UA 2IXHA 1ZZBA 3H3ZA 4AVCA 2R49A 3FHIB 1SG3A 3H0OA 4CEYA 3ZXFA 1VBE3 2ZACA 2C5DA 1W03A 2CDPA 3AFGA 4AI9A 1RUG1 1WMXA 2QQNA 3O1TA 1TME1 1RUC3 4NIDA 3M3OA 5FOBB 4XOGA 1AUYA 3VDDC 3WQBA 2Z42A 4QXBA 4MGSA 2A6VA 5L9BA 4BQ2A 3DXUA 2PAEA 1V6JA 3ZO0B 5JIUA 1ST8A 1C3HA 2VXJA 1ULOA 1BCXA 4KH9A 5LRRA 3V64A 3MUY1 1NX9A 4HN1A 4V2WA 4EZ4A 5J37A 1SLCA 2J1AA 3QH7A 2ZX3A 1XSRA 4ZU5A 1W2TA 3S0MA 2FDKA 4OHWA 2YU2A 4QT6A 3CEWA 2EIBA 3ZXDA 1GU3A 1WLWA 1D4M3 4DRVA 1OOPB 4JVAA 3WW1A 4LBKA 3ACLA 4QB2A 2XPJA 2JG9B 3HQXA 4E2QA 3ZSLA 4BU2A 1AR73 4NHXA 2HWC1 2XVGA 1RITA 4AI3A 1DYPA 5KXCA 5CG9A 4XZPA 3J26N 4LTAA 5FY1A 4CEYC 3NJVA 3RZZA 1WMDA 5DG1A 1ASJ1 2WZR2 4E4DX 1CN1A 3O0VA 1EAH3 2GNBA 5GZFA 2AGSA 3PUIA 1X33A 3WDTA 3MLJA 1JU3A 1QF3A 1WW5A 4RD7A 5J36A 3B3QE 5FPLA 2OYZA 3UL2A 5FDBA 1DYKA 2R043 2VCMA 4B1LA 2QBXA 5FZ9A 2FD8A 1LOBA 1DZQA 1XB9A 2VQTA 5K0UB 4K20A 4KGGA 4BQWA 1AXKA 1GWKA 1F15A 3BALA 2JDUA 1FX5A 2PELA 1OOPA 3NV1A 1W99A 2WT1A 3U11A 3WG2A 3TEZA 1PGW2 3O1SA 1TZOA 2JG9A 2BFUL 3I7DA 1LEDA 1D2QA 3ZFFC 1O5UA 4XHBA 5FOJB 4NIHA 4M3CB 3WCSA 4N9IA 1VBC2 2BGOA 4C1WA 1GNZA 2BOIA 3ZX7A 3A0KA 4NRPA 2IXJA 2ZXQA 4UFMA 2VUDA 1H0BA 3I3DA 4QPGB 3PJQA 2A3YA 3EMRA 1XRUA 2PMWB 1RUJ1 2WKKA 3HOBA 1WA4A 3ZFGA 3CF6E 3N4MA 1MR5A 3LFMA 4ZKTB 4HSJA 4QQ2A 5CADA 4K7JA 5JOZA 5FMOS 4IGOA 3EB7A 4JDOA 4JV4A 5I0TA 1FMD2 4WM8B 3R4DB 1REEA 2WFF3 1XE0A 3L2HA 3R05A 3FJSA 5FYIA 3NO8A 1SACA 2A73B 4GWJA 4EJRA 2B8MA 2DCYA 4XQDA 2XJTA 4OQ8A 5CIRA 3PL0A 5LK5A 2TBVA 3O0WA 4BJ0A 1OOPC 3TWIA 2VOXA 4FPGA 4M3CA 2WNUA 3A0NA 4MGKE 4AI8A 4UOJA 5C7GA 5L19A 1HV1A 4NROA 1AYN1 1HLCA 1PNFA 3U14A 4CZSA 1TNRA 4LBMA 5DDJ2 3IN9A 3N7LA 1US3A 4QPGA 4XTPA 1V6NA 1ND3B 3ZYJB 4BDVB 3T08A 2BNNA 4NMIA 5CZKA 1ULGA 3O0XA 4JX0A 2BJSA 2ARBA 1ENRA 1XNCA 1ZRFA 1HJFA 1W3XA 1V6IA 1VMHA 2CDOA 4AFDA 4AE2A 5FWEA 1HB3A 2WQZC 3ZFGC 1MEC2 4FFGA 3VKMA 4CP1A 4WM8A 4O61A 5FZ8A 3WF0A 1WUVA 4YRDA 3FFQA 3KT1A 1WLCA 3M4FA 4DNYA 1OQEA 3TNPB 4CDXB 3SH5A 3CKHA 2WABA 4LLFA 2ZA9A 1KRIA 5D8AB 1W2AX 1O3QA 4A7ZA 2B4KA 1AR61 4JKLA 3RDIA 3WDUA 1NE6A 3DKQA 4CUCA 2CU5A 4IEXA 5GKAC 3VBUB 2VOWA 1ZZ7A 5A7PA 1PVC3 3H8XA 2WNUC 4WVMB 1RUI1 1ND3A 2WWUA 5FUPA 4FXGB 4INDA 1VR3A 5FUIA 1A34A 1QDOA 1DP0A 4IEWA 2GP3A 3JCIA 2ET7A 4LBQD 4QPGC 3NKTA 3JB4C 3UKNA 5A6QA 4FTSA 2RS33 3J7MA 3MIEA 1H2KA 1OQDA 5SV8A 3LA7A 4YW5A 4EV0A 2XMLA 5CB7A 4DMIA 1VBB1 1NAEA 2NYYA 2Y33A 2WT2A 5FXVA 4U36A 4L8QA 2A6YA 3RZLA 3NJYA 5CA6A 4OHVA 4CDXA 1REFA 1XBFA 1ZRIA 2LALA 4RSUA 5FXXA 5JZGA 4ES9A 4JAAA 1CX4A 4NR1A 4WM8C 5D8AA 4GMP0 3Q8FA 4CPBD 4EN0A 2O14A 3FC0A 3MO4A 2BNMA 1NKGA 2ZCWA 4KMQA 5CEHA 1R082 2HBUA 2G4IA 4G4FA 3M1HA 1F31A 3VBUA 1YQCA 1LKNA 2Q8CA 5LB6A 3D82A 4WVMA 4BB3A 3SQOA 4BQ4A 1S2KA 4QB1A 1EV13 1QMJA 2D3PA 2B39A 4FVVA 4NN0A 2JKBA 3B94A 4QQPA 1S0IA 5FK7A 4XW3A 5FZ6A 2O0OA 4W6YA 4P9XA 2AENA 2AYHA 1WW6A 1H1IA 4NHYA 4A7KA 4BQYA 3PVBB 3QLQA 4XBNA 5FP8A 1VB4A 1PO21 2WA4A 3CNAA 5CG8A 4UFIA 1IS6A 2IUWA 1VB2A 2LS6A 2Y0OA 3NWKA 2DVAA 2OUHA 3SMHA 2GALA 1CAVB 1V9U2 1S0EA 2VZ1A 2VZTA 4LBNA 4D69A 5C3RA 3VHPA 2DUPA 3PLQA 2E51A 4YZ2A 5FY7A 3WD5A 4AW7A 1H1AA 3WDXA 1JYXA 4P9LA 5FYYA 4BK4A 1IKPA 3KQRA 2JD9A 3HPNA 3RWNA 4CDXC 4QHZA 5JZGC 1HQNA 1LRHA 2EIDA 1SLTA 4RYDA 5D8AC 5J48A 2BV4A 2XBO1 5DDJ3 4COYA 2PHDA 1F4AA 4LMFA 4MGIE 5A33B 4FPFA 1VRBA 2J1EA 3H1YA 1S0BA 2R0FA 3LWCA 1A8MA 1KXGA 3PU3A 3VBUC 2X53S 1GV9A 4QXKA 1G9FA 3AZXA 4EN9B 3QBQA 5LBBA 4HETA 2ZGMA 2C26A 1EYBA 1K5MC 5DG2A 2XXZA 3KVAA 1FPN2 3RMXA 1KITA 2FDGA 1Q3EA 4PLOA 2IXLA 4Y3OA 2VW2A 4P9JA 2HWF2 3ZMOA 1LOCA 1CAVA 2VC9A 4XHXA 5AFEA 3S7EA 5LW9A 2JENA 2UURA 3NQHA 3OUJA 1GOFA 4UW6A 2PAMA 4YGEA 2D6MA 3D4KA 1O8SA 4AHYA 2GP5A 4Y1UA 1OKOA 4QU2A 3W21A 5ACA2 1YHFA 5CFCB 1ZA7A 3GJAA 4W6WA 2XVLA 4KGQA 4E27A 3BB6A 4QMAA 1K42A 2RMU1 2R072 5A33A 1LENA 3I2JA 3POFA 4FI9A 1D2SA 1YCIA 1LCLA 2WQ4A 2DDUA 3T3YA 5FV3A 5H9QA 1QXRA 4Y20B 2VOVA 5AVPA 4NAOA 1PO11 2ZGRA 2CL2A 4Q0QA 1I6XA 4Y24A 5K8SA 2XHKA 3FLPA 3KF3A 3BUCA 2AREA 1DQ2A 4IV1B 2W1UA 3V65A 4F8AA 4FPLA 5KHJA 3H8UA 2CY6A 2HWD1 2YU1A 3ON7A 3PDQA 3S30A 3VV1A 1IQDC 1OC1A 3OGSA 4IE6A 1G9AA 1GYKA 3EO6A 1PX4A 5E88A 5LK7B 3ZXLA 1VBA1 5CFDB 3TBDA 2WWJA 1DGWA 2B5HA 4A3ZA 5FO9B 1FOD2 5GALA 1QXPA 1UCXA 4LBJA 4RQPB 1LNSA 1HQWA 3AC0A 4LK7A 3M3CA 3LPGA 2GNMA 4LBLA 3I8TA 4YFWA 2W92A 5CFCA 3CMGA 4QB6A 1R083 4R4ZA 4UT5A 5T50A 2VMFA 2TEPA 3ZPOA 3VHOA 4OFGA 2ZOEB 3KWVA 4L2NA 5FLIA 5ABJB 2W5FA 1Q56A 3CBNA 1CAUB 3Q9OA 4YG0A 5I0RA 1N3PA 1SFPA 1C57A 4HT1T 4Y20A 5A3NA 1YEWA 3HBKA 3ZYIB 4DXTA 1DIWA 4KNCA 1RTVA 4MGYE 2V5YA 1AR81 1GQPA 3MICA 1U12A 1ZX5A 3OCPA 1YNAA 3A23A 2TNFA 3OGJA 1H30A 3M3IA 3JD72 3ITQA 2OXBA 3GDBA 3MEPA 3POBA 3QOPA 4R8HA 2VMGA 2EF6A 4MXWB 4QPWA 1F8VA 3JUUA 4Q2FA 5CFDA 3AMNA 4UFJA 3TOJA 1BKZA 2A5ZA 1H9WA 4MV2A 1S55A 1BYHA 1POV3 2PHFA 3PNAA 2RJKA 1UF2C 2YY1A 5ERLA 1GP4A 3OYWB 1HRV3 1WD3A 3ZN6B 1B35B 5EYYA 3EQEA 3GZUC 3MLLA 5A3PA 3M8LA 5IW0A 5A3MA 3K48A 3NJXA 3AP7A 3HN3A 1PZ8A 4PF1A 5ABJA 5KWRA 5CFCC 1DZRA 4A2UA 1CAUA 3LEMA 4PJYA 1ULEA 1H8TB 3FLRA 3PJYA 1UL9A 5LEJA 4RHV1 4RA0A 4UFLA 5LA0A 2IZWA 2FHRA 4E2GA 1AYM3 3POGA 2Y60A 1XSQA 3GNEA 4Q0SA 5AVAA 4AVBA 4PLMA 3THCA 4QD2A 2IC1A 4RS5A 1C8M2 3SCGA 4YZ4A 3T1LA 5HPOA 4MXWA 1MS8A 3SCFA 1WBLA 1CD3G 2HWF3 4GH4B 4YGCA 3U10A 1JTZX 1YQ2A 3WNLA 4XE9A 3AL5A 1GICA 3B02A 1F5FA 2BPA2 1WLDA 2W52A 2VZQA 5AC92 3KT7A 3OYWA 3UGHA 4DZGA 3ZN6A 4CP0A 1B35A 5CFDC 3E1F1 2BERA 4HMZA 5ANNA 5ACA3 2X8KA 3SEEA 5T5PA 3BPSA 4XIOA 2WN3A 4LKDA 3S6PA 1Q8SA 3CL1A 5CKMA 2R073 2G9FA 1W8ZA 1W6PB 3DEMA 1H8TA 1ZBA2 2PHRA 2RS51 3KF5A 4XJZA 5FBZA 1JYTA 1NOVA 1CAWB 1MS0A 3C8XA 4ZHNA 4NIIA 1UY4A 4B4QA 1LHUA 1CESA 2EXIA 1PM7A 2DFCA 5GLWA 1RHI1 4Q4V2 2O8OA 1GUIA 3TB0A 2OUJA 1LR5A 4PCRA 5GZDA 2VGDA 1RUD2 3ELNA 2VMHA 4LT5A 3W9AA 2XUEA 4GJYA 2OKXA 1AR91 4GH4A 2VPVA 5C5UA 4YGDA 4XIKA 1J83A 5FR3A 3NVCA 4RS5C 4B7EA 5C4WB 1JZ8A 1W39A 2RR13 2QZ2A 1UZYA 3ASIA 4XFHA 1WLTA 3P1IA 1JZ3A 3M70A 1UOGA 5DAPA 4YW4A 1W0PA 5I8TA 2ZHMA 3BTYA 1O4YA 2OW4A 1K5JA 1W9TA 2OA2A 3MW3A 1XQNA 4GWNA 3AB0A 1B35C 2WAAA 1S4CA 4EZHA 4W8JA 1XE7A 5AFBA 3NNMA 1CAWA 1A78A 5FMDA 3CDZB 4Z8BA 1JZ6A 2PXJA 1RJ8A 4DS0A 5FPUA 3BI3A 3ABZA 4Q4X1 4Q8KA 3POJA 5FTTC 4KG0A 3FHQA 4UFKA 4LORA 4AEDB 2FCUA 3VZKA 1RMU2 5GJ6A 4KL1A 3N36A 5B2GB 1OA4A 3DYMA 3JD73 1ZBE3 3OD0A 2GH8A 3JBG1 1UNBA 1ENQA 2WDBA 4I3PA 4CP2A 4BXFA 3UNPA 4DUXA 2Q1MA 3VKLA 1QJY2 2IVIB 4XDOA 2DV9A 4RGAA 4G9SB 2EVXA 4UFHA 3WQ7A 2FMDA 4PIXA 3N7JA 4CDQB 2HWB1 2E31A 2R063 2DWRA 2XJSA 1I3HA 1AHSA 2WS92 2QUOA 3G6JB 4GB31 2RS12 5GM0A 2ZZJA 4FQ4A 4MXVA 1S2EA 3AYAA 3ZVXA 2RM23 2VNVA 4XXAA 3OPTA 2QE3A 1H8VA 3AMHA 3T2PA 1LESA 3NV4A 4CCMA 1JN2P 4BE3A 4XBLA 2P3KA 4LXLA 1BBT1 1A6CA 4ITCA 4XDPA 2YC4A 1VBE1 3T1MA 3JQXA 3WNMA 3UESA 1IOAA 2O8QA 3Q8CA 4LOSA 3HIFA 3WXPA 4TTGA 1UOBA 4AGVA 4ZZ8A 4CCNA 1J58A 5A7NA 1JZ5A 3LDBA 3I97A 2JIJA 1RVF2 2XG3A 1OT5A 1WWYA 4CDQA 5AC93 4A7YA 2XLAA 3GCWA 4F83A 3VD4A 1W9YA 5IVEA 3UGFA 1EUTA 2ILMA 1Y9GA 3VZJA 4QKFA 3ZXEA 4LLOA 1V0AA 4JHZA 5BUVA 4AGGA 3RZJA 2JB4A 1W0OA 3GM8A 4UW3A 3AZZA 4QQHA 3VL9A 1OLME 1RUC2 2X29A 1QJX2 1IGOA 2MHFA 3K4DA 4Y1XA 5FAXA 2AR6A 1ZREA 2C0ZA 4FOYA 5JDBA 4I0WB 2HEVF 2A71A 2W39A 3AP6A 2Y64A 3OUHA 3APBA 3WW4A 1GWLA 5T3NA 4QQLA 4PI0A 1S2BA 1SFYA 3BOWA 1AR71 3WF1A 2ZKLA 4QM9A 3I2HA 4EQVA 4GKYA 2JDYA 3J7LA 5D1IA 3BODA 5FZDA 2C9KA 5BXXA 3RYKA 1DQ4A 1MPXA 4OCTA 1D4M2 3O1RA 1Q8QA 4YW1A 2BVBA 5K7PA 5FJKA 3WY6A 3BTZA 3RVHA 5HXMA 1DLLA 2QQJA 5FREA 3E6BA 1DHKB 4NOTA 2YGLA 1NZCA 3B69A 3WF2A 4A3XA 3N7MA 2JE9A 1N1YA 3T2QA 3VDDB 3FHAA 4YGBA 2VBDA 5JOWA 3WNPA 4D3WA 2DURA 2XOMA 1ULPA 2YYOA 4YG3A 3WQ1A 4Z92B 2DU1A 3KHCA 5JLVA 5KC6A 5A3LA 2HYXA 3E5QA 1X9TA 4IDZA 3RWKX 4OUEA 3TRSB 3MW4A 2XH6A 5GZGA 4IEVA 2ERFA 4ZY9A 1NYWA 4BPZA 1V6KA 1SZBA 2A3WA 1WMFA 2GNDA 1PNGA 1PX3A 1K12A 4IEOA 4ARYA 1RMU3 3CU7A 3PUQA 1AL22 2CV6A 2OQ6A 3NKGA 2D6KA 1SLBA 4GIQA 3DECA 4ASKA 1MQTC 1RUE3 2R042 4HZFA 5FZ1A 2V72A 1OFNA 3ZYPA 3ST7A 1IS5A 1KD7A 3IBMA 3OBAA 4H14A 2XGXA 1H9PA 3B00A 3ILRA 4QPIB 5BPXA 2DCKA 4LUKA 2W1WA 1QJY3 3GZAA 4UI9L 1H2NA 2D6PA 1L7LA 3MIDA 5F3EA 5A3UA 3I49A 3T2TA 3I3MA 5L9RA 1OPOA 3H9AA 1X8MA 1VRH3 1D4VB 2PHUA 1IG0A 4N9HA 3VDDA 3UGGA 3C7EA 4BQ1A 4PIZA 2WS93 5A6ZA 4URTA 1QDCA 2L9LA 2RS13 2GAUA 4NWWA 3VKNA 3PVNA 5A70A 4BMBA 4XUNA 1L7RA 1VP6A 2G9ZA 3AP5A 1XE8A 3W58A 3J4UH 4AEMA 3LDRA 4EWDA 4OHYA 4GWMA 4O9GA 1WW4A 1WCUA 3MIGA 3B9CA 3CLPA 3WP6A 3UETA 4BQ3A 1XC6A 1NT0A 2JKXA 2JECA 4HLTA 4CCCA 1UZVA 4DEVA 5DMYA 5DQ0A 4XJWA 2DBIA 3RNSA 1C5IA 1S1AA 5F3IA 4Q4Y2 4ZONA 5L73A 5FMOL 4DXZA 1IS4A 4QPIA 3R4UA 1RUOA 2R1BA 1KFUL 1FYUA 3IZOA 2JWPA 3ZFFB 2FDFA 1GP5A 3ZMNA 1VJ2A 1HQLA 2YXSA 1RVF3 1BMV2 4ZS3A 2WAOA 5D21A 4N7UA 2J1VA 4N90A 4K40A 4BXSV 5GLVA 1QHDA 4CCJA 2Q5TA 5DAXA 2K0GA 2V73A 4CXXA 2PLV3 2RJ2A 4NIGA 2K9ZA 4EN6B 1KJRA 1PVXA 2BQPA 2YBPA 3AX4A 1QJX3 1S0JA 3NAPA 5FP4A 3IPVB 1ZZ9A 4CYDA 4FQZA 2P37A 2W1QA 2E7QA 3TNQA 1PZ7A 3ALQA 4AVAA 5EJ1B 4DO0A 4LO4B 1RUNA 1X50A 1GZTA 1JYNA 3MFCA 2FQPA 1Z78A 2WZEA 1MS3A 1BK1A 5L7OB 5A7WA 4CDUA 4CTEA 5F37A 4Y22B 3ZFFA 4HBNA 3EBRA 2WZR1 3FE5A 4OVEA 1OUSA 4XAEA 5IFTA 2VBPA 3GCXA 4FPKA 1SBDA 1YJLA 2OVUA 3VBSB 4CVUA 1ULFA 4HPKA 4XFBA 4QPIC 4XACA 1D7PM 1UU5A 4L92A 3PIJA 3LIHA 3NL1A 2P6HA 5A32B 4AQ2A 3ZIWA 1YIFA 5LA2A 3J9SA 4ISQA 1IS3A 1HRI3 2PN5A 1OSGA 1HXS3 1V6OA 1UYYA 3IPVA 1PVC2 4LIVA 5JI9A 5KXBA 1X82A 4HKWA 1PGW1 3J7HA 2WR9A 1KS4A 2CWMA 3NAPC 4XF3A 4K1ZA 3ZFGB 3MDPA 2H6CA 1AL23 2RS32 2J22A 2Z79A 1DGRA 1VBC1 5L7OA 4I3GA 3OG2A 4LUMA 4X6RB 2XLFA 3U75A 3CQOA 4M0NA 1CJDA 4W6XA 2ET1A 2ORZA 5T55A 1SHWB 3VBSA 1O3TA 3RPQA 4UF0B 2AUYA 4EYUA 2I45A 4CDUC 4LNVA 1VBD3 2XHNA 3WG1A 3KGLA 1KEXA 2GC1A 1JUIA 1C1FA 5FZ7A 5A32A 1OA3A 4C8DA 3AKQA 2WNUB 5LBEA 4IQPA 5FZ4A 5GZCA 3C7OA 1NA1B 5I91A 2HWC2 1UYXA 1WMEA 3TN91 4P5YA 4HVQA 4P9GA 3LGRA 3H8OA 1FMD1 5EPAA 1T6BX 1HN0A 1G86A 4DB5A 1EV12 4JQRA 4ASLA 2Q4SA 3PUSA 4YARA 3VD9A 1QJEA 1NCRB 1DQ6A 2VH9A 4UBGA 4E9KA 2Q1FA 3FFZA 4Y4YA 1B09A 4Y1YA 4IL7A 4FPHA 3SNMA 4Q4Y3 4YW7A 4XEZA 2VQAA 1W6NA 4OUSA 4LR4A 4BZ4A 2QQWA 3GHNA 3P3PA 3LIGA 3PVEA 5E89A 4OI4A 3E5UA 1H2LA 3GJBA 1T2XA 5DDJ1 2EIEA 1J1LA 3MF9A 4UF0A 3PUAA 4U2AA 1NLQA 5FZBA 1R1A2 1H6XA 2JDNA 4PIYA 5L7OC 1GZ9A 4YW2A 5HCFA 5KHHA 3VB9A 2ZHNA 4HOOA 4QKDA 4DIQA 4UWDA 3MV01 3DN7A 1UU6A 4FPOB 1MZ5A 2V4VA 2VCBA 3T0BA 3VBSC 1TEIA 2NPIA 2VD7A 1NA1A 1FNZA 3RYPA 3THPA 2D5FA 2ZEZA 1UMZA 5FZ0A 5JVVA 1RC6A 1MEC1 3B5LB 1MS9A 2Y38A 2QVSB 4LA2A 2W68A 4Y5SA 2AC1A 3KV6A 3O12A 1NCRA 2O1QA 5E6HA 5IVBA 5DXDA 4CP9B 1YC61 1O3SA 1RUJ2 3OGVA 3U78A 5I0DA 1RYYA 3I2KA 3N3HA 4HXCA 3SKVA 3MUZ1 1FATA 2R0HA 5LBFA 4HKOA 1G9CA 3AXDA 4GKXA 4GMP3 4KBZA 1Q43A 3LFIA 4X8PA 1S0CA 2WLQA 5FO7B 3GHMA 5C3PA 1LOEA 4IETA 4FOVA 1W05A 5EJ3A 3OTFA 5CISA 4XQ4A 1MS1A 2MEV2 1GNHA 5JZGB 4PQ9A 4N8MA 2V09A 2VBBA 4WVZA 4B3NA 2LM3A 4AQ6A 2WQ8A 3Q8EA 2VO5A 3JXSA 1RUF1 4QHBA 3R0RA 3SHRA 3D0SA 3RJ2X 1RUG3 1ZZ8A 3J7NA 1W9WA 4DY3A 5IYYA 1CX1A 5I0SA 1PMIA 1NA1C 2BEOA 3RZGA 2E53A 4XCAA 1BJQA 4LHNA 4NPLA 2RDQA 1DCSA 1C1LA 1K5MB 2R6QA 2Y6GA 3KV9A 4CP9A 1HDKA 4COVA 4JTNA 4LA3A 5LEKA 2X09A 1W8FA 4AK3A 3WEZA 3RZKA 1R081 1D0GA 1NCRC 2K46A 4NRMA 2BWAA 4PDWC 1ENSA 2WIIB 4BCUA 5CAZA 1QH6A 3WG3A 4LKSA 2JDPA 1PGL1 4AAPA 3ILFA 5E8AA 2H0VA 3RYRA 5JXGA 2ZGUA 1UMIA 4XFFA 1S0FA 3UV9A 3VL8A 3AMQA 2GDFA 2JEMA 5FZOB 4GULA 2DVDA 4XABA 5DN2A 5C6CA 3TEYA 2WSUA 2ZX1A 4P9IA 3WQ0A 5FPZA 4CRQA 2HWC3 3I3BA 1DGWX 4ATFA 4I30A 2QTWB 2DCZA 2PA7A 3I54A 2R7EB 1V9U1 1F2NA 2NZ9A 5HCHA 1ASJ3 1K5MA 2OX0A 4LHSA 1QNYA 1BLZA 4LPLA 5IATA 5J96B 3VHRA 2MPFA 3VD3A 5JOXA 4OI2A 2VZOA 2XONA 5I93A 4JGZB 2VNGA 3OEAA 2C1FA 4ZXKA 1QOSA 1UPIA 1CONA 1K45A 4AVTA 3ORJA 4EE2A 2ZGKA 4AQSA 1QQP1 5FZMA 2ZGSA 2VCAA 4GALA 5FBJA 1VBB2 1R1A3 3UKVA 4XF1A 4DUVA 3VZOA 5A6YA 4IUGA 2XVKA 2JDMA 3QACA 1N1SA 2QQVA 5FZOA 1BHGA 1E57A 1W8OA 2PHLA 1CGPA 3B01A 1HRV2 5GLTA 5FY5A 4CCDA 2C4XA 1JODA 1VAKA 3S5QA 2VR4A 1FPN1 2ZAAA 3WW2A 1PM4A 2PHWA 1MVQA 2HWF1 2CNAA 2P17A 4AAXA 4AFAA 4MG2A 4JRAA 3H1MA 1CQ9A 5T52A 2LUWA 2Q0AA 2BNOA 4RS5B 2XL9A 4BLIA 2G9GA 2Z4FA 1AYM2 1RUJ3 1BEV2 1STMA 4JGZA 5DUXA 2BYVE 5ACA1 4LEJA 4MGQA 4Y1VA 3T0AA 5FLHA 3VZMA 4S2HA 1CPNA 3WVJA 5C3SA 1CZSA 1PIV2 2JDHA 2NLRA 3FBMA 1SPPB 4Y1ZA 2VZRA 2VZPA 3BPZA 3H50A 2BVVA 3W20A 2IXCA 1HV0A 3MHZA 4LO8A 2J1TA 2MEV3 2RG4A 1W6MB 3POIA 4TN7A 3VZLA 4H3WA 1LGCA 5EWSA 1LEMA 1BVVA 1GP6A 5CBLA 1ONAA 2FDIA 5FK8A 1VLNA 2XWJB 1XYOA 3IAQA 3LOIA 3O1UA 2XJVA 1NY71 2JG8B 2UWCA 2AEYA 4E4HA 3H3UA 1CIWA 3DYPA 1ND2A 4LE3A 3OY8A 2QFEA 3ZXGA 3CJXA 1FOD1 1YRZA 3DCQA 2V5DA 4AF9A 3O1OA 4XFGA 2ZEYA 1IPKA 4AFCA 2P3JA 4XC9A 3AJZA 4KWUA 3IDAA 4Y5Z0 4I0BA 4AG4A 3VHNA 2XL7A 1OURA 1LHNA 2ZMNA 4OMCA 2JB8A 3HAGA 5CNAA 1DGLA 4XZUG 1VMFA 2ZZQA 4D6QA 1SPPA 4BM8A 3LZZA 3THTA 4HSLA 2W1SA 1RUH1 3IAPA 4JGZC 5FZAA 1UZWA 2WFPA 2RVAA 2Y6HA 1CIYA 2W91A 2RR12 3IKWA 1QU0A 5JUVA 4S2FA 1W6MA 3NNJA 5FY9A 5T5JA 5T5OA 3IDEA 3AP9A 4BHPA 1MACA 1T6GC 4W4ZA 1W0NA 4Y22A 1WA6X 2JG8A 5KXDA 1OVSA 3RSJA 4F7ZA 1AR63 3SISA 5IHRA 1PMJX 4JQTA 2VZVA 1C4RA 1ZM1A 3ZYBA 2QQKA 4LBQB 1H4GA 4BMEA 2GMPA 1VAMA 3O7OA 2EICA 2JDKA 5FYMA 5I8YA 1O8PA 2PYTA 1ND2C 4GZ9A 3VKFC 2YUEA 4PBOA 4NHMA 5L9VA 5FY8A 1YLLA 3MPPG 1PO12 2XQXA 4J25A 3HR9A 4N43A 5FZCA 4DFSA 1UY1A 1ZBE2 3DYOA 4YVWB 1G9DA 1LAJA 2I74A 3EYPA 1O4ZA 5A3WA 2ZEWA 4YM2A 3ES4A 4BH9A 1EP0A 1VBB3 5D2AA 3ZYGA 2J1SA 2GC3A 3AMPA 1UYZA 4XJAA 1LU1A 1VBA2 1MS5A 5FFOC 4MUVA 4LQRA 2D6NA 1WCDJ 2R062 2VJXA 4OULA 4B1MA 5HBAA 4H7MA 3LB9A 2OZJA 2A6WA 2AEZA 1C8M1 2ZGOA 5HXVA 2DCTA 2H0BA 4D6SA 3LSEA 2EIGA 1LB2A 4FFFA 1O5LA 2RM22 4LBQA 2GC0A 1F4HA 1H1MA 4R9CA 5HCBA 4P02B 4QXCA 3ENRA 1APNA 1YFWA 4MOAA 2JG8C 2VTXJ 4XTMA 5KHGA 2WSVA 3RFRA 3E5XA 4CUGA 4CSWA 1JMUB 4R4XA 5F5AA 5CKQA 5FXZA 4Q0UA 5ABJC 1NQJA 2PHXA 3PIGA 1W2OA 1BEV3 1LECA 5BNPB 2WA3A 1NQDA 4ISRA 4KU8A 5DZFA 3HT1A 2XB6C 1Y4WA 2EXKA 4LO7A 1QEXA 2WZ8A 4QDSA 5DUWA 4YVWA 1PIV3 1UW8A 1UMHA 4NPRA 4CPBA 1PO23 3N9OA 3HN1A 1R1ZA 1I1EA 5FZGA 1ZBA1 3Q8BA 3K75B 2OZ6A 4N43C 5FP7A 4D6RA 5LWBA 3FN9A 1OFSA 4LBOA 3WSOA 4YM1A 3FBYA 5BV6A 2Z69A 3JQWA 1XYNA 3HD8B 2HWE2 1BZWA 4AEJA 4ET7A 1DZTA 4Q4V1 1QJU2 5FRAA 1H6YA 3HQRA 4P9YA 1D0HA 2ZJCA 3WNNA 4D0QA 2WINB 4MYEA 1GNYA 3T2OA 4L0PA 1RUD1 4Z07A 2Y34A 3ZR5A 5B4XA 1Y7BA 2ZHKA 5DABA 3GZEA 4QX7A 2VMEA 2EALA 5T5LA 2FDHA 4FO9A
chains in the Genus database with same CATH topology
1XBFA 1VMFA 1VE0A 1VMHA 2CU5A 2P6HA 1VMJA 1VPHA 2P6CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XBF A;  1VMF A;  1VE0 A;  1VMH A;  2CU5 A;  2P6H A;  1VMJ A;  1VPH A;  2P6C A; 
#chains in the Genus database with same CATH topology
 5A1L A;  3I3Q A;  3NW4 A;  3T30 A;  5BNO B;  2NQY A;  5A7O A;  2FBE A;  5BNP A;  2ETE A;  4NO4 A;  3I2F A;  4C1X A;  4E8C A;  2A75 A;  1YI9 A;  1OLQ A;  2GN3 A;  2UY8 A;  4FPJ A;  2VOK A;  4Q1P A;  4DXS A;  3HVD A;  2JDA A;  4TXW A;  4OYU A;  4ES8 A;  2DBN A;  2MNG A;  3MBW A;  2G19 A;  3J8F 2;  1S0D A;  1RXF A;  3ZSJ A;  1W2U A;  2GNT A;  5C3Q A;  4LKE A;  3UYJ A;  2IVJ A;  2VL4 A;  1UAI A;  5I0U A;  1MZ6 A;  4YVW C;  4AQT A;  4O7X A;  5KHI A;  2PAK A;  2DTY A;  4MGZ E;  4YNI A;  4XFC A;  1LGB A;  2CYF A;  5JCT A;  1FAY A;  4QHO A;  3WW3 A;  3VD7 A;  5IJR A;  2GN7 A;  2B9V A;  3WLU A;  4YW6 A;  1YQ8 A;  4D7Y A;  1JOJ A;  1QJY 1;  3EHK A;  3FWE A;  4TLG A;  1EUU A;  2QCS B;  1HJG A;  4COU A;  4YZ1 A;  5BNO A;  1SLL A;  2YRO A;  2RS5 2;  3A4U A;  1MZF A;  3B7M A;  4IE5 A;  4M0H A;  4R9B A;  3WUD A;  2ZGT A;  1NCQ C;  1UKG A;  4P00 B;  1PO1 3;  3H1W A;  4AWD A;  1RHI 2;  1RUE 2;  2RS1 1;  3WNX A;  3W5M A;  4N7I A;  5BNP C;  4H2A A;  3H42 B;  1EPW A;  3K2O A;  5EV7 A;  3SXW A;  3PUH A;  2HWD 3;  2YC0 A;  5IK4 A;  4HN0 A;  4XFI A;  1J59 A;  5A1A A;  2W2I A;  2ARC A;  1M4W A;  5IVY A;  1VBA 3;  3ZDS A;  1OH4 A;  1R09 1;  2J42 A;  5FY0 A;  1VRH 2;  2VVF A;  3AFK A;  3OPZ A;  1JH5 A;  4Y4R A;  3V56 A;  1W9F A;  4M4P A;  4ERO A;  3K3N A;  1OD5 A;  4XQW A;  2CAV A;  1CVN A;  3AMM A;  2PQQ A;  3L9J T;  1X7N A;  4Q4W 1;  1F35 A;  4QDQ A;  5KR7 A;  2E33 A;  3WF3 A;  3W5N A;  4Q0V A;  4MLO A;  1UOF A;  4OI1 A;  3UT0 A;  5FO8 B;  5IAX A;  1UXX X;  3JZV A;  5JMO A;  3NNG A;  5JR7 B;  1MQT B;  3POW A;  2IFR A;  4IXL A;  3ZIX A;  4AI2 A;  2ADE A;  2Y6L A;  3BGA A;  4FOW A;  1SCS A;  3PME A;  1UXZ A;  2W0X A;  3ZFE B;  3GZT B;  5BNO C;  3A21 A;  3WOG A;  1J1T A;  3AJY A;  5LAT A;  1RUC 1;  3ZN4 A;  2PQS A;  5C3O A;  3TEW A;  4B29 A;  2ZGL A;  3KVB A;  1FXZ A;  4DY5 A;  3JU9 A;  5FWJ A;  2ZMK A;  2X10 A;  4BYY A;  1I5P A;  5I8S A;  2SLI A;  1LOD A;  2EAA A;  1GQH A;  2VAU A;  4K3U A;  2VMC A;  4LOT A;  1IZ3 A;  1POQ A;  1WW7 A;  2HWE 3;  5FZE A;  5IVF A;  3CIH A;  4YZ3 A;  1QJU 3;  4AEK A;  4E8D A;  3VLB B;  5LY2 A;  1XU1 A;  2PLV 2;  2HWB 2;  2DVF A;  2W9X A;  4IGP A;  4PT6 A;  3T0D A;  4LIT A;  2FZ1 A;  1US2 A;  1VE0 A;  4YM0 A;  3IDC B;  3TAY A;  1D4M 1;  1PZ9 A;  4PF5 A;  2ZBJ A;  1LOG A;  1YQ6 A;  4MX3 A;  5DZE A;  1MQT A;  2DU0 A;  1DU3 D;  4RHV 3;  4CA9 A;  2RDR A;  1Z7S 2;  1UX6 A;  2W95 A;  3ZFE A;  2WNV A;  3I2O A;  3FX3 A;  3LPF A;  1BBT 2;  1Q8O A;  5FYC A;  4WVW A;  1W6O B;  3LEI A;  4AFB A;  3J8F 3;  1LHW A;  1NXM A;  3ZYH A;  2IXK A;  3IMN A;  4WM7 B;  4M4R A;  1WCQ A;  2WJS A;  1EAH 1;  1TMF 2;  1ULC A;  2Z5W A;  3GGL A;  2QDN A;  1QKQ A;  1Y3T A;  4CCL A;  1BVP 1;  3U4S A;  1JI6 A;  2ZPX A;  5EFU A;  2YDE A;  3MIB A;  3RZM A;  2DCJ A;  1AL2 1;  4GQ7 A;  2ZGQ A;  4Q26 A;  2RV9 A;  1YI7 A;  2R04 1;  1OUX A;  4Y33 A;  1GMM A;  2DVB A;  3B9I A;  3O1V A;  2BTV C;  1HRI 2;  1HXS 2;  4MHU A;  1FI2 A;  1KQR A;  3C7G A;  3KS7 A;  4XVH A;  5EJZ B;  4JGY B;  4Y26 A;  5H9P A;  1S0G A;  1CZT A;  5A6X A;  3PVO A;  1DBN A;  4FPE A;  5JPM B;  2RS5 3;  1UY3 A;  5EYX A;  1FT9 A;  3OOX A;  4KG8 A;  5GZE A;  4A6O A;  1ZZC A;  3KCX A;  5FP3 A;  2QNK A;  3H7J A;  5C8W A;  2FCT A;  3KCC A;  3ZXA C;  2VVD A;  1RHI 3;  2UWA A;  5JIA A;  4JDN A;  4CU6 A;  3INA A;  1W6O A;  3KHB A;  5FMB A;  3M7A A;  2YBS A;  4CCE A;  2ZX4 A;  4WM7 A;  3ZFE C;  2WNV C;  3MYX A;  4LHL A;  5A7Q A;  2Q8D A;  4LO5 B;  5LA1 A;  1AR9 3;  2GMM A;  4YG6 A;  5F1R A;  5HV0 A;  3ZSM A;  5IUQ A;  1QIQ A;  3ACH A;  3B93 A;  1TG7 A;  3D8C A;  3HNB M;  4ZS2 A;  5FYS A;  5C5T A;  1VBD 2;  1JUH A;  2HYK A;  3ACF A;  1XNK A;  3LKJ A;  3LA3 A;  4NHK A;  4XUR A;  4AFM A;  2P6C A;  5JPN B;  1F5J A;  4FSJ A;  2P34 A;  3SC7 X;  3V0A B;  1RIN A;  2J7M A;  1FV2 A;  4XXP A;  4JGY A;  3NAP B;  2BGC A;  2NP0 A;  2WFF 1;  3N9L A;  1OMI A;  3UKT A;  5FYT A;  4CXY A;  2KR2 A;  2Y6J A;  4LE4 A;  1ZNP A;  2WZP P;  4XFA A;  2CGO A;  4Q4X 3;  4GD4 A;  2AZ5 A;  3D5O A;  1U5X A;  4K8F A;  4S2G A;  4NUB A;  5HV4 A;  3ZLI A;  3LF7 A;  3ZOI A;  1U5Z A;  4A4A A;  1RB8 G;  3P3N A;  3RZH A;  1W8T A;  4XIL A;  5A7W B;  4CDU B;  3CHX A;  1E5R A;  1V6M A;  1OLM A;  3BYW A;  3JBG 3;  3KM5 A;  5FZ3 A;  5JR2 A;  4AYU A;  3KQ4 B;  3KZ4 C;  4AHW A;  1VPH A;  2RDS A;  3VDB A;  4IE7 A;  5F8P A;  3DKW A;  1C28 A;  5A3O A;  2D3S A;  3OBT A;  1YIP A;  1DGR N;  5G04 L;  3CJI B;  4HPK B;  4WM7 C;  4BIO A;  2W46 A;  5DZG A;  3WHT A;  5A7S A;  1AXZ A;  3WP4 A;  4FAG A;  1SMV A;  2G1M A;  2HWB 3;  3V0A A;  2XR4 A;  2JE8 A;  1RGS A;  4OMD A;  3VD5 A;  3WCR A;  1COV 2;  1JW6 A;  1Q5O A;  4AHZ A;  4IE0 A;  4EN8 B;  1ULD A;  3GBF A;  4P08 A;  2JD4 A;  2RDN A;  2ZML A;  4JGY C;  3RQ0 A;  1WCK A;  4KQ7 A;  1QXJ A;  1Z7S 3;  5BNQ A;  4K21 A;  1DQ5 A;  3OJB A;  1W90 A;  2JE7 A;  4KI5 M;  1X9P A;  2YBK A;  1BBT 3;  5E16 A;  4YWA A;  1XOY A;  1YFY A;  5DAQ A;  1OQ1 A;  4ZZ5 A;  4JZR A;  4C0H A;  3H3L A;  1YFU A;  1PVC 1;  3LSD A;  1LHO A;  4RR3 C;  4C90 A;  1QNW A;  4YM3 A;  1LUL A;  3OSD A;  1IG3 A;  1TMF 3;  3NRU A;  4EWE A;  4OI0 A;  2R32 A;  2VM9 A;  2BZD A;  1BXH A;  3CJI A;  5FPX A;  1JYW A;  4HAN A;  2J1R A;  2XKP A;  4BLJ A;  1IHM A;  2DFB A;  4A45 A;  2ARA A;  2JIC A;  3I2I A;  4M3C E;  4AR2 A;  1A3K A;  2RS3 1;  2FMY A;  5FPB A;  5JI7 A;  1JYI A;  1ZZ6 A;  2GU9 A;  2TUN A;  3EXU A;  3ZN5 A;  1HW5 A;  1M06 G;  1IKQ A;  1RL3 A;  4BK5 A;  1RUG 2;  1ODN A;  3K4A A;  1AVB A;  1TME 2;  3RGB A;  2X5I A;  3POE A;  2ATF A;  2K2S A;  1NUK A;  1UWW A;  1WBF A;  1XND A;  2E63 A;  5EXO A;  5F2W A;  2QZ3 A;  1DQ0 A;  3H8R A;  2VUC A;  3ROU A;  2ADD A;  4J1X A;  2EXJ A;  3BCW A;  3OF1 A;  2QQP A;  3BTX A;  5FJH A;  4ZPI A;  3SH3 A;  1W6N B;  4FTB A;  3MIH A;  1UIK A;  4XJU A;  1HB2 A;  1WCS A;  1IPS A;  4TLF A;  3BTA A;  1EV1 1;  3NMB A;  5C8C B;  4E2S A;  1L7Q A;  3HNM A;  4YVS B;  4PLN A;  2B45 X;  5T54 A;  1W06 A;  4RFR B;  4LIU A;  2WL1 A;  2BW8 A;  3ZM8 A;  2VG9 A;  2VMD A;  3CJI C;  2D93 A;  1JOP A;  3QH6 A;  2VVE A;  5F5Q A;  3HWJ A;  1LU2 A;  3RI8 A;  3X29 B;  1AF9 A;  5A1F A;  4X8N A;  4FPC A;  1QGL A;  4YYO A;  1OH3 A;  2PHT A;  3HQU A;  5FYH A;  2ZKN A;  3FLT A;  1R1A 1;  4AGR A;  1ASJ 2;  4XUO A;  1SEF A;  3E6C C;  3IT8 A;  3BOP A;  4PDW B;  2X5I C;  4M00 A;  3LA2 A;  4XYX A;  5FYV A;  2W08 A;  2QQL A;  4XAA A;  3VBF B;  1RED A;  4CEW B;  4DQA A;  2FCV A;  1XNA A;  1LTE A;  1WKY A;  3D3A A;  5ISL A;  3RG0 A;  1HIX A;  4BWO A;  3Q8A A;  3VKO A;  5C8C A;  5JMC A;  4Z2A A;  1W8N A;  1GKB A;  3LEG A;  4YVS A;  3VN4 A;  1GFF 2;  1PK6 B;  2WO2 A;  4OZX A;  4YFZ A;  3FUQ A;  4HFS A;  2QQM A;  1V70 A;  2ES3 A;  2XJP A;  5CVR A;  2ZX0 A;  3ACG A;  4E4Z A;  2IXI A;  4IEQ A;  1UZ0 A;  4DXR A;  1Y9M A;  3N9N A;  3FL7 A;  2VW0 A;  4CU9 A;  3D6E A;  4Q27 A;  2OII A;  3NNL A;  1O59 A;  3M3Q A;  3BU0 A;  2CHH A;  3BVC A;  4NWV A;  4DIN B;  1COV 3;  1JHJ A;  2AAC A;  4RN5 A;  4LO6 B;  5K0U A;  3TN9 2;  4D8M A;  2QQU A;  1N3Q A;  4DOU A;  3AZW A;  1I5Z A;  4XMI A;  2X05 A;  2MEV 1;  5C9A B;  4PDW A;  3WP3 A;  2VZS A;  5M0T A;  4YLZ A;  1BK0 A;  3NV2 A;  4A44 A;  3L2Y A;  4CEW A;  4OZO A;  4OHX A;  3VBF A;  1XNB A;  5GLU A;  3WHU A;  1RIR A;  2A3X A;  4YZ5 A;  3HNY M;  3URF A;  3WNK A;  1L3J A;  2JG9 C;  1QOO A;  5DUV A;  3OEB A;  1G9B A;  3F95 A;  2CGP A;  1GZW B;  1PK6 A;  1SLA A;  1XYP A;  2OT7 A;  1UZZ A;  3GAL A;  3P5B A;  1MS4 A;  2OPK A;  3BIE A;  5C8C C;  1Y43 B;  3IWZ A;  4MZU A;  2R30 A;  4CCK A;  3WDV A;  2E9Q A;  4YVS C;  5FLJ A;  2RHP A;  1N1T A;  4C91 A;  2D5H A;  1SDD B;  3CZU A;  3QCW A;  1I9R A;  2XJQ A;  2YPJ A;  4OUM A;  5JWP A;  1ZRD A;  1TME 3;  3NNF A;  1AYN 2;  3S7I A;  4FFI A;  5E1R A;  3LD8 A;  1O7F A;  1URX A;  2BBA A;  5DAW A;  5F2S A;  3P6B A;  1QY4 A;  4AI0 A;  5C9A A;  2EXH A;  5IAV A;  2ID4 A;  2NMN A;  1YQ5 A;  3LAG A;  1V6L A;  3OB8 A;  5K0U C;  4F3J A;  2YFZ A;  1H4H A;  4UW4 A;  4AHX A;  4L99 A;  5C71 A;  4RL7 A;  1GAN A;  2WYF A;  3ES1 A;  3WT3 A;  1AJK A;  2WRA A;  1JS9 A;  1ENX A;  4QX0 A;  1GR3 A;  3WNO A;  1C5H A;  4NE9 A;  5CU1 A;  4CEW C;  3KSC A;  3VBF C;  1GZW A;  5K9Y A;  5FYU A;  2H6B A;  4FP2 A;  1W2N A;  2WZR 3;  1PGS A;  2XJU A;  4AXO A;  1ALY A;  5F32 A;  2YZ4 A;  2UWB A;  3R6S A;  4PBP A;  1PK6 C;  4DUW A;  3O14 A;  2VY0 A;  1GOH A;  1JBC A;  4ORF A;  2UYB A;  3LE0 A;  1AR6 2;  3MF6 A;  3MV1 1;  1IQA A;  4I02 A;  1RUF 2;  2QDR A;  2VUJ A;  3SEP A;  1HX6 A;  2W3J A;  4NJ4 A;  1QWR A;  1OBN A;  1RUI 2;  5FUN A;  1POV 1;  1U5I A;  4HVR A;  2BFU S;  2QKD A;  3WDW A;  2GME A;  2YPD A;  4FBF A;  5HCA A;  1HRV 1;  4XJ9 A;  2WO3 A;  4Q29 A;  2E6V A;  4BOW A;  2HEY F;  1LHV A;  2I07 B;  1AX1 A;  2BP6 A;  5C9A C;  4OHZ A;  5ANQ A;  4MAD A;  4PI2 A;  4UXA A;  3MI8 A;  5JSP A;  1C8N A;  1SBF A;  1VBC 3;  5TSW A;  4Y5T A;  5F3G A;  3ZPY A;  1WD4 A;  3FUO A;  4XCB A;  4ASM B;  2IFW A;  4WZF A;  1KDM A;  5EQU A;  1PGL 2;  1R64 A;  1HB4 A;  4QKN A;  2NN8 A;  2E26 A;  2UU8 A;  1JYV A;  4XUP A;  2GZW A;  4KWL A;  3TEX A;  1AYM 1;  4Z82 A;  1BEV 1;  1VAV A;  4FPY A;  4B4P A;  3C7H A;  5LBC A;  3PHM A;  1ND3 C;  1OF4 A;  2J1U A;  4IEZ A;  1QJF A;  2P3I A;  4FXK B;  2UY9 A;  2CSG A;  3WP5 A;  2P2K A;  4MGT A;  4CXW A;  5F7U A;  1PIV 1;  4IEU A;  2OS2 A;  5IVJ A;  3TN9 3;  5BNN B;  1ND2 B;  2JXA A;  2SBA A;  1O3R A;  3OY8 B;  1FMD 3;  4B8E A;  5A80 A;  5C33 A;  3GF6 A;  2PTM A;  2OPW A;  4I0A A;  4BIF A;  3M2M A;  4AI1 A;  1NLR A;  1W8W A;  1LGN A;  1VIW B;  1GOG A;  5FMC A;  5LAS A;  2ARX A;  3K4Z A;  3LEK A;  2C24 A;  1Q8V A;  1KJL A;  1UX7 A;  3III A;  3OD4 A;  4GA9 A;  3DUI A;  4JC1 A;  3A7Q A;  3AK0 A;  3AM2 A;  2R07 1;  1PO2 2;  4JDM A;  4FTE A;  3RS6 A;  3VBO B;  2HJI A;  4PQQ A;  2CAU A;  4QXH A;  1YO8 A;  5LY1 A;  4TSV A;  1J3P A;  1QQP 2;  4AOC A;  3WUC A;  3THD A;  2XJR A;  3DL3 A;  3N9M A;  1N47 A;  4O65 A;  3ZYF A;  1YXW A;  2P1B A;  4GWI A;  3VDA A;  4QX3 A;  5SV5 A;  1HB1 A;  4HON A;  2DF7 A;  2ORX A;  4IER A;  1Z0H A;  4HL0 A;  5BNN A;  1FNY A;  1E5S A;  1AYN 3;  1KGY A;  5C70 A;  3WDY A;  1MEC 3;  2XBO 2;  4UAP A;  3RRD A;  4BA6 A;  5KBF A;  2BBV A;  4D7T A;  1OXC A;  2RR1 1;  1ACC A;  5F3C A;  4WBB A;  3KLS A;  4MSV A;  4QGL A;  1RJ7 A;  1J84 A;  1JHN A;  4M01 A;  4QGM A;  4N43 B;  2D44 A;  3DXT A;  4K1Y A;  1Q8P A;  2VQU A;  5LA9 A;  2ENR A;  4G3Y C;  5CYY A;  4KWJ A;  3VBO A;  5K4L A;  4R52 A;  4XET A;  1AJO A;  5F6K A;  3WX5 A;  2E7T A;  2EAK A;  3U37 A;  2VU9 A;  1EPZ A;  1MVE A;  4Q8L A;  5L36 A;  1J3Q A;  1UD1 A;  2QQI A;  3BIW E;  3OGG A;  5EP9 A;  4EWA A;  2ZEX A;  4JHT A;  2VOT A;  4CCO A;  5F39 A;  2HLE A;  3ZSE A;  3JD7 1;  2VXR A;  1ZBE 1;  1CZV A;  1OF3 A;  4IEY A;  1O91 A;  5APA A;  4D94 A;  3NV3 A;  3C2U A;  1RUF 3;  4Q0P A;  5JSO A;  1NY7 2;  2RJL A;  2RMU 2;  5KHK A;  4JKK A;  3ETQ A;  4W65 A;  5FZL A;  1RUI 3;  1NG0 A;  2B7Y A;  3T4H B;  2XUM A;  2Q1Z B;  1CR7 A;  5BNN C;  2ZTN A;  3IB3 A;  3LQC A;  3N9P A;  1WGP A;  2R06 1;  1SDW A;  4I01 A;  5F5I A;  4EN7 B;  1OKQ A;  1LJ7 A;  5A3T A;  4TWT A;  3C7F A;  2GH2 A;  3G7D A;  3LOB A;  1H2M A;  5JAX A;  1JZ4 A;  1CAX B;  3H7Y A;  4P14 A;  2LRO A;  2BGP A;  3I2D A;  1E5H A;  3T09 A;  2HWD 2;  1TNF A;  2RM2 1;  4B7K A;  5DUU A;  1U0A A;  1GSL A;  3CZJ A;  3OGR A;  3S5A A;  2Q30 A;  4FP3 A;  3IIA A;  1RUH 2;  2Y26 A;  4CU8 A;  1O4T A;  3AZV A;  3VBO C;  1NZI A;  3WV6 A;  1J3R A;  4Z2W A;  1VMJ A;  4IEP A;  2VTF A;  4QQO A;  3FZ3 A;  1GWM A;  4XF4 A;  4IV1 A;  3AKS A;  2RE9 A;  3WR0 A;  2BRT A;  5BYN A;  2ZS6 B;  1RXG A;  3KCY A;  4QX5 A;  1UY2 A;  1KS5 A;  4UYB A;  3ACI A;  2W94 A;  1F9K A;  3NJZ A;  4QM8 A;  4FFH A;  1NCQ B;  2KA3 A;  2ZAB A;  4J1W A;  3WG4 A;  1V9U 3;  5J98 B;  4A6S A;  5AC9 1;  4S2D A;  2HWE 1;  2W87 A;  2P5B A;  2QJV A;  4KBB A;  1QJU 1;  2BDR A;  4RQP A;  3HBZ A;  4J6G A;  3RJR A;  2DVG A;  5J09 A;  4LK6 A;  3W59 A;  3I3E A;  1AR8 2;  3I2G A;  4QKB A;  4SLI A;  1CAX A;  4Z1V A;  2JIG A;  5FPA A;  5F5C A;  4RGK A;  2Z2S B;  4X6Q B;  3POS A;  4KWK A;  2KXL A;  1SLI A;  1JYC A;  1UIJ A;  1AL0 G;  1YUD A;  4QDR A;  4DRR A;  1Y9Q A;  1QQP 3;  1X8E A;  1AX2 A;  1SBE A;  1UQX A;  1OPM A;  2QQO A;  2VZ3 A;  2ZHL A;  3AYC A;  3IM0 A;  4XUT A;  5FKC A;  2EA7 A;  5IK8 A;  2CTV A;  2VNO A;  5IVV A;  1A8D A;  4B4R A;  3K3O A;  1W9S A;  4H7L A;  4IV3 B;  1DYO A;  1U5Y A;  2ZX2 A;  4NHL A;  4P5H A;  2XQR A;  5IK7 A;  3J8F 1;  1FPN 3;  4K8R B;  3O1M A;  2VUA A;  2XBO 3;  4QWN A;  1QH7 A;  2VW1 A;  4C0B A;  4E4S A;  1NCQ A;  4IV1 C;  4IE4 A;  1W04 A;  3CO2 A;  4JTO A;  3ZR6 A;  4RHV 2;  4URA A;  5LCW L;  2JJ6 A;  3AVS A;  4HG6 B;  3PMS A;  4R9D A;  1JU4 A;  1UN1 A;  2D3R A;  3OUI A;  4XBQ A;  2FDJ A;  3M3E A;  4W50 A;  5FKB A;  1QOT A;  1NE4 A;  4UW5 A;  2Y6K A;  4ONU A;  4NVP A;  4N53 B;  4KU7 A;  4RQP C;  1TVG A;  4CUA A;  1POV 0;  2HH9 A;  4WZC A;  1LOA A;  3DPR B;  1DDL A;  2WT0 A;  4QX8 A;  1DFQ A;  5CKN A;  5FCC A;  1TQ5 A;  2Y6F A;  1UKR A;  3LCP A;  3ZDV A;  4COW A;  2WYS A;  2Q8E A;  2UYA A;  5F6L B;  3ZSK A;  1ZA4 A;  4HK8 A;  1RMU 1;  4IV3 A;  4XUQ A;  4QGN A;  2XKO A;  3O5S A;  2ZGP A;  2YG0 A;  4JRL A;  5H9S A;  4I2O A;  2F17 A;  1RUE 1;  2VMI A;  1W3V A;  1PHM A;  1O6U A;  4M3C F;  2P4E A;  5JXJ A;  1W8H A;  2B46 X;  4WVV A;  4QX1 A;  2YHJ A;  2RMU 3;  2PFW A;  3OBR A;  4L11 A;  2WO7 A;  5FZK A;  2DTW A;  2C9A A;  3ATG A;  3I59 B;  1JZ7 A;  2WNE A;  5IT6 A;  1XXN A;  4SBV A;  1UO9 A;  1FOD 3;  1VRH 1;  2WC2 A;  3E6D A;  4L9B A;  4RGG A;  3U07 A;  1ZRR A;  1W6Q B;  1AZD A;  2XLG A;  4UBH A;  3ZKU A;  2WS9 1;  4FT8 A;  2JX9 A;  4QAW A;  1TE1 B;  3DF0 A;  5H9R A;  3E97 A;  3WIN E;  4N53 A;  3VZN A;  4H55 A;  1SQ4 A;  3RMY A;  3DPR A;  3SLI A;  4XMA A;  4P9W A;  1AR9 2;  1UY0 A;  2Y8K A;  5FZH A;  1OA2 A;  1RUH 3;  1W6P A;  5FIX A;  2YFU A;  4TZD A;  2KM2 A;  2D40 A;  5JSR A;  1OD3 A;  2VTX A;  2XWB B;  1DLC A;  1X36 A;  3VBR B;  1H8T C;  3O1P A;  4CDW B;  2VEC A;  4LJH A;  5EIY B;  3NST A;  1YJK A;  2YC2 A;  4IV3 C;  4MO3 M;  4ZU4 A;  3D0J A;  3TYJ A;  1G8W A;  3HJR A;  3BN6 A;  3I59 A;  2D43 A;  2KD7 A;  1RVF 1;  2LRP A;  3MZH A;  3AZY A;  3KT4 A;  3OBZ A;  4NAM A;  3N9Q A;  3AYD A;  4YW3 A;  5C4W A;  2A6X A;  4Q4X 2;  1W6Q A;  1YWK A;  3KD4 A;  2F4L A;  5B4N A;  4GH4 C;  4JCK A;  4V2V A;  2WNV B;  2PLV 1;  1OLR A;  4OLL A;  4QU1 A;  1AR8 3;  3I4I A;  1MZE A;  2B42 B;  2CGN A;  3KV5 A;  4K9S A;  2P3Y A;  2ZGN A;  4AVV A;  5IFP A;  5FYB A;  3AKP A;  5EZW A;  2R1D A;  1QJX 1;  1SFN A;  5DPN A;  4FCA A;  3POY A;  3JBG 2;  1ZRC A;  3SCH A;  3F2Z A;  3U0Z A;  3C3V A;  3V0B B;  2D6O X;  3KGZ A;  2WLP A;  1ZYB A;  3K51 A;  4N53 C;  5F9T A;  3BKZ A;  2WUH A;  2WWS A;  3USU B;  3PTR B;  3DPR C;  2WN2 A;  4YPJ A;  4A42 A;  1BQP A;  1Z7S 1;  1R09 2;  3LDK A;  4IGQ A;  4Q1R A;  4D7S A;  3VBR A;  4MVT A;  4BQX A;  4AED A;  4DEQ A;  3ME2 A;  4Q5O A;  1UU4 A;  2Y0I A;  5DAV A;  4CDW A;  4CU7 A;  4ZU7 A;  5FZF A;  2V4A A;  3MIF A;  3AXE A;  4GB3 2;  1C8M 3;  4MHR A;  1G6N A;  3S57 A;  4GXL A;  2Q8O A;  4Q4W 2;  4QX2 A;  4L97 A;  4XJ8 A;  3VBH B;  5JXH A;  3AYE A;  2DYC A;  1TMF 1;  3BU7 A;  1IPJ A;  1DQ1 A;  4XF0 A;  1DG6 A;  2GSY A;  5FQ0 B;  2D6L X;  4FOQ A;  5JOY A;  4DPN A;  1JZ2 A;  1OHF A;  3ZYR A;  2BU9 A;  4OQ9 A;  2CWS A;  4A41 A;  3HMY A;  1G7Y A;  2DUO A;  3K46 A;  4NIA A;  1VBE 2;  3FMG A;  1AX0 A;  4JKM A;  4NPM A;  1JXN A;  2E32 A;  2A6Z A;  4HKL A;  4AVS A;  1HRI 1;  1CJP A;  4BQ5 A;  1HXS 1;  5FXW A;  2B9U A;  2NM1 A;  2AH2 A;  3V0B A;  4R9A A;  5HI0 A;  4WV8 A;  3SIT A;  4RFT 0;  1ZBA 3;  4XDQ A;  2R16 A;  4COZ A;  3UJO A;  3USU A;  5C4W C;  2BWC A;  3IDB B;  2YV8 A;  3JB8 A;  4GJZ A;  2D97 A;  4LUL A;  3ETP A;  4MET A;  3R4S A;  2A70 A;  3SH4 A;  3ZXK A;  2WNO A;  4Q4V 3;  4O9E A;  3IMM A;  3DGT A;  2HBT A;  3AVR A;  5J1X A;  1JOB A;  1UPS A;  1NLS A;  1RUD 3;  2A1X A;  2F4P A;  3AKR A;  3K77 A;  1K3I A;  3PTY A;  3VBR C;  3VBH A;  4AED C;  4CDW C;  1XU2 A;  4HK9 A;  3QD6 A;  2LTN A;  4CE8 A;  5FQ0 A;  3ZXJ A;  1VBD 1;  2OQ7 A;  1LOF A;  2WBK A;  3DV8 A;  3U1X A;  3WZ1 A;  1EY2 A;  5IK5 A;  2D98 A;  4XF9 A;  5BY5 A;  2F6B A;  5FY4 A;  2ZAH A;  3UK9 A;  5KXE A;  2IWG B;  3N35 A;  2D7F A;  4RR3 B;  1AR7 2;  1AXY A;  4PHZ A;  2YGM A;  3GXU A;  2YB7 A;  3ILN A;  5FZI A;  1V00 A;  3T4V A;  4CDQ C;  1GQG A;  3PUR A;  2VZU A;  2W47 A;  1N1V A;  2JDZ A;  1GLH A;  3USS A;  5GLZ A;  2E7A A;  1OI6 A;  2NMO A;  3MW2 A;  5IWF A;  5J3U A;  3WF4 A;  3PU8 A;  3ECQ A;  1DF0 A;  3KMH A;  2HEW F;  1EAH 2;  1XNT A;  3AL6 A;  1GBG A;  4LHK A;  3VDC A;  3MPB A;  4HVO A;  5FYZ A;  4Q4Y 1;  1P8J A;  1E5I A;  3N7K A;  1W28 A;  2VCC A;  4IES A;  4V1P A;  1YFX A;  2N7G A;  1KFX L;  3GBW A;  3UJQ A;  4ATE A;  4CUB A;  1WZX A;  2YMZ A;  3GYD A;  2FZ2 A;  1BMV 1;  3AP4 A;  4FAH A;  5LZ6 A;  4XPV A;  1CPM A;  4NRQ A;  3MLK A;  3VBH C;  2VE1 A;  1ZVF A;  3HT2 A;  3VUO A;  4RR3 A;  4MH0 E;  1HKD A;  4YSF A;  4CEY B;  4LKF A;  3VGI A;  3ZKY A;  3EJK A;  1LOF C;  4ARX A;  1UYP A;  2LW8 A;  4GAZ A;  3A22 A;  4K6B A;  1FV3 A;  1COV 1;  1PMH X;  5FP9 A;  3U4X A;  2BUK A;  3RI9 A;  4AZZ A;  4BIS A;  1SCR A;  3KB5 A;  4QPY A;  3AKT A;  1KDK A;  2VNR A;  2GC2 A;  2HKX A;  4AL9 A;  3KV4 A;  1QJZ A;  3HEI A;  5LRS A;  2DUQ A;  4IW3 A;  2BOJ A;  3MFA A;  1R09 3;  5IVC A;  2C6S A;  1N3O A;  1GZC A;  1ODM A;  2WO1 A;  5JXI A;  4I09 A;  4GB3 3;  1HN1 A;  4GMP 1;  2VQ0 A;  1XPW A;  1XJA A;  1OVP A;  1UOJ A;  3GBG A;  4Q4W 3;  5KC5 A;  4ZXE A;  1VAL A;  3OPW A;  2X5I B;  5FPV A;  3SKJ E;  1NXD 1;  3MGU A;  5G05 L;  1CWP A;  2WFF 2;  5EHD A;  2I2S A;  2XDV A;  4TYS A;  5J7M A;  1YYN A;  2A7A A;  2VUL A;  1W8U A;  2IXH A;  1ZZB A;  3H3Z A;  4AVC A;  2R49 A;  3FHI B;  1SG3 A;  3H0O A;  4CEY A;  3ZXF A;  1VBE 3;  2ZAC A;  2C5D A;  1W03 A;  2CDP A;  3AFG A;  4AI9 A;  1RUG 1;  1WMX A;  2QQN A;  3O1T A;  1TME 1;  1RUC 3;  4NID A;  3M3O A;  5FOB B;  4XOG A;  1AUY A;  3VDD C;  3WQB A;  2Z42 A;  4QXB A;  4MGS A;  2A6V A;  5L9B A;  4BQ2 A;  3DXU A;  2PAE A;  1V6J A;  3ZO0 B;  5JIU A;  1ST8 A;  1C3H A;  2VXJ A;  1ULO A;  1BCX A;  4KH9 A;  5LRR A;  3V64 A;  3MUY 1;  1NX9 A;  4HN1 A;  4V2W A;  4EZ4 A;  5J37 A;  1SLC A;  2J1A A;  3QH7 A;  2ZX3 A;  1XSR A;  4ZU5 A;  1W2T A;  3S0M A;  2FDK A;  4OHW A;  2YU2 A;  4QT6 A;  3CEW A;  2EIB A;  3ZXD A;  1GU3 A;  1WLW A;  1D4M 3;  4DRV A;  1OOP B;  4JVA A;  3WW1 A;  4LBK A;  3ACL A;  4QB2 A;  2XPJ A;  2JG9 B;  3HQX A;  4E2Q A;  3ZSL A;  4BU2 A;  1AR7 3;  4NHX A;  2HWC 1;  2XVG A;  1RIT A;  4AI3 A;  1DYP A;  5KXC A;  5CG9 A;  4XZP A;  3J26 N;  4LTA A;  5FY1 A;  4CEY C;  3NJV A;  3RZZ A;  1WMD A;  5DG1 A;  1ASJ 1;  2WZR 2;  4E4D X;  1CN1 A;  3O0V A;  1EAH 3;  2GNB A;  5GZF A;  2AGS A;  3PUI A;  1X33 A;  3WDT A;  3MLJ A;  1JU3 A;  1QF3 A;  1WW5 A;  4RD7 A;  5J36 A;  3B3Q E;  5FPL A;  2OYZ A;  3UL2 A;  5FDB A;  1DYK A;  2R04 3;  2VCM A;  4B1L A;  2QBX A;  5FZ9 A;  2FD8 A;  1LOB A;  1DZQ A;  1XB9 A;  2VQT A;  5K0U B;  4K20 A;  4KGG A;  4BQW A;  1AXK A;  1GWK A;  1F15 A;  3BAL A;  2JDU A;  1FX5 A;  2PEL A;  1OOP A;  3NV1 A;  1W99 A;  2WT1 A;  3U11 A;  3WG2 A;  3TEZ A;  1PGW 2;  3O1S A;  1TZO A;  2JG9 A;  2BFU L;  3I7D A;  1LED A;  1D2Q A;  3ZFF C;  1O5U A;  4XHB A;  5FOJ B;  4NIH A;  4M3C B;  3WCS A;  4N9I A;  1VBC 2;  2BGO A;  4C1W A;  1GNZ A;  2BOI A;  3ZX7 A;  3A0K A;  4NRP A;  2IXJ A;  2ZXQ A;  4UFM A;  2VUD A;  1H0B A;  3I3D A;  4QPG B;  3PJQ A;  2A3Y A;  3EMR A;  1XRU A;  2PMW B;  1RUJ 1;  2WKK A;  3HOB A;  1WA4 A;  3ZFG A;  3CF6 E;  3N4M A;  1MR5 A;  3LFM A;  4ZKT B;  4HSJ A;  4QQ2 A;  5CAD A;  4K7J A;  5JOZ A;  5FMO S;  4IGO A;  3EB7 A;  4JDO A;  4JV4 A;  5I0T A;  1FMD 2;  4WM8 B;  3R4D B;  1REE A;  2WFF 3;  1XE0 A;  3L2H A;  3R05 A;  3FJS A;  5FYI A;  3NO8 A;  1SAC A;  2A73 B;  4GWJ A;  4EJR A;  2B8M A;  2DCY A;  4XQD A;  2XJT A;  4OQ8 A;  5CIR A;  3PL0 A;  5LK5 A;  2TBV A;  3O0W A;  4BJ0 A;  1OOP C;  3TWI A;  2VOX A;  4FPG A;  4M3C A;  2WNU A;  3A0N A;  4MGK E;  4AI8 A;  4UOJ A;  5C7G A;  5L19 A;  1HV1 A;  4NRO A;  1AYN 1;  1HLC A;  1PNF A;  3U14 A;  4CZS A;  1TNR A;  4LBM A;  5DDJ 2;  3IN9 A;  3N7L A;  1US3 A;  4QPG A;  4XTP A;  1V6N A;  1ND3 B;  3ZYJ B;  4BDV B;  3T08 A;  2BNN A;  4NMI A;  5CZK A;  1ULG A;  3O0X A;  4JX0 A;  2BJS A;  2ARB A;  1ENR A;  1XNC A;  1ZRF A;  1HJF A;  1W3X A;  1V6I A;  1VMH A;  2CDO A;  4AFD A;  4AE2 A;  5FWE A;  1HB3 A;  2WQZ C;  3ZFG C;  1MEC 2;  4FFG A;  3VKM A;  4CP1 A;  4WM8 A;  4O61 A;  5FZ8 A;  3WF0 A;  1WUV A;  4YRD A;  3FFQ A;  3KT1 A;  1WLC A;  3M4F A;  4DNY A;  1OQE A;  3TNP B;  4CDX B;  3SH5 A;  3CKH A;  2WAB A;  4LLF A;  2ZA9 A;  1KRI A;  5D8A B;  1W2A X;  1O3Q A;  4A7Z A;  2B4K A;  1AR6 1;  4JKL A;  3RDI A;  3WDU A;  1NE6 A;  3DKQ A;  4CUC A;  2CU5 A;  4IEX A;  5GKA C;  3VBU B;  2VOW A;  1ZZ7 A;  5A7P A;  1PVC 3;  3H8X A;  2WNU C;  4WVM B;  1RUI 1;  1ND3 A;  2WWU A;  5FUP A;  4FXG B;  4IND A;  1VR3 A;  5FUI A;  1A34 A;  1QDO A;  1DP0 A;  4IEW A;  2GP3 A;  3JCI A;  2ET7 A;  4LBQ D;  4QPG C;  3NKT A;  3JB4 C;  3UKN A;  5A6Q A;  4FTS A;  2RS3 3;  3J7M A;  3MIE A;  1H2K A;  1OQD A;  5SV8 A;  3LA7 A;  4YW5 A;  4EV0 A;  2XML A;  5CB7 A;  4DMI A;  1VBB 1;  1NAE A;  2NYY A;  2Y33 A;  2WT2 A;  5FXV A;  4U36 A;  4L8Q A;  2A6Y A;  3RZL A;  3NJY A;  5CA6 A;  4OHV A;  4CDX A;  1REF A;  1XBF A;  1ZRI A;  2LAL A;  4RSU A;  5FXX A;  5JZG A;  4ES9 A;  4JAA A;  1CX4 A;  4NR1 A;  4WM8 C;  5D8A A;  4GMP 0;  3Q8F A;  4CPB D;  4EN0 A;  2O14 A;  3FC0 A;  3MO4 A;  2BNM A;  1NKG A;  2ZCW A;  4KMQ A;  5CEH A;  1R08 2;  2HBU A;  2G4I A;  4G4F A;  3M1H A;  1F31 A;  3VBU A;  1YQC A;  1LKN A;  2Q8C A;  5LB6 A;  3D82 A;  4WVM A;  4BB3 A;  3SQO A;  4BQ4 A;  1S2K A;  4QB1 A;  1EV1 3;  1QMJ A;  2D3P A;  2B39 A;  4FVV A;  4NN0 A;  2JKB A;  3B94 A;  4QQP A;  1S0I A;  5FK7 A;  4XW3 A;  5FZ6 A;  2O0O A;  4W6Y A;  4P9X A;  2AEN A;  2AYH A;  1WW6 A;  1H1I A;  4NHY A;  4A7K A;  4BQY A;  3PVB B;  3QLQ A;  4XBN A;  5FP8 A;  1VB4 A;  1PO2 1;  2WA4 A;  3CNA A;  5CG8 A;  4UFI A;  1IS6 A;  2IUW A;  1VB2 A;  2LS6 A;  2Y0O A;  3NWK A;  2DVA A;  2OUH A;  3SMH A;  2GAL A;  1CAV B;  1V9U 2;  1S0E A;  2VZ1 A;  2VZT A;  4LBN A;  4D69 A;  5C3R A;  3VHP A;  2DUP A;  3PLQ A;  2E51 A;  4YZ2 A;  5FY7 A;  3WD5 A;  4AW7 A;  1H1A A;  3WDX A;  1JYX A;  4P9L A;  5FYY A;  4BK4 A;  1IKP A;  3KQR A;  2JD9 A;  3HPN A;  3RWN A;  4CDX C;  4QHZ A;  5JZG C;  1HQN A;  1LRH A;  2EID A;  1SLT A;  4RYD A;  5D8A C;  5J48 A;  2BV4 A;  2XBO 1;  5DDJ 3;  4COY A;  2PHD A;  1F4A A;  4LMF A;  4MGI E;  5A33 B;  4FPF A;  1VRB A;  2J1E A;  3H1Y A;  1S0B A;  2R0F A;  3LWC A;  1A8M A;  1KXG A;  3PU3 A;  3VBU C;  2X53 S;  1GV9 A;  4QXK A;  1G9F A;  3AZX A;  4EN9 B;  3QBQ A;  5LBB A;  4HET A;  2ZGM A;  2C26 A;  1EYB A;  1K5M C;  5DG2 A;  2XXZ A;  3KVA A;  1FPN 2;  3RMX A;  1KIT A;  2FDG A;  1Q3E A;  4PLO A;  2IXL A;  4Y3O A;  2VW2 A;  4P9J A;  2HWF 2;  3ZMO A;  1LOC A;  1CAV A;  2VC9 A;  4XHX A;  5AFE A;  3S7E A;  5LW9 A;  2JEN A;  2UUR A;  3NQH A;  3OUJ A;  1GOF A;  4UW6 A;  2PAM A;  4YGE A;  2D6M A;  3D4K A;  1O8S A;  4AHY A;  2GP5 A;  4Y1U A;  1OKO A;  4QU2 A;  3W21 A;  5ACA 2;  1YHF A;  5CFC B;  1ZA7 A;  3GJA A;  4W6W A;  2XVL A;  4KGQ A;  4E27 A;  3BB6 A;  4QMA A;  1K42 A;  2RMU 1;  2R07 2;  5A33 A;  1LEN A;  3I2J A;  3POF A;  4FI9 A;  1D2S A;  1YCI A;  1LCL A;  2WQ4 A;  2DDU A;  3T3Y A;  5FV3 A;  5H9Q A;  1QXR A;  4Y20 B;  2VOV A;  5AVP A;  4NAO A;  1PO1 1;  2ZGR A;  2CL2 A;  4Q0Q A;  1I6X A;  4Y24 A;  5K8S A;  2XHK A;  3FLP A;  3KF3 A;  3BUC A;  2ARE A;  1DQ2 A;  4IV1 B;  2W1U A;  3V65 A;  4F8A A;  4FPL A;  5KHJ A;  3H8U A;  2CY6 A;  2HWD 1;  2YU1 A;  3ON7 A;  3PDQ A;  3S30 A;  3VV1 A;  1IQD C;  1OC1 A;  3OGS A;  4IE6 A;  1G9A A;  1GYK A;  3EO6 A;  1PX4 A;  5E88 A;  5LK7 B;  3ZXL A;  1VBA 1;  5CFD B;  3TBD A;  2WWJ A;  1DGW A;  2B5H A;  4A3Z A;  5FO9 B;  1FOD 2;  5GAL A;  1QXP A;  1UCX A;  4LBJ A;  4RQP B;  1LNS A;  1HQW A;  3AC0 A;  4LK7 A;  3M3C A;  3LPG A;  2GNM A;  4LBL A;  3I8T A;  4YFW A;  2W92 A;  5CFC A;  3CMG A;  4QB6 A;  1R08 3;  4R4Z A;  4UT5 A;  5T50 A;  2VMF A;  2TEP A;  3ZPO A;  3VHO A;  4OFG A;  2ZOE B;  3KWV A;  4L2N A;  5FLI A;  5ABJ B;  2W5F A;  1Q56 A;  3CBN A;  1CAU B;  3Q9O A;  4YG0 A;  5I0R A;  1N3P A;  1SFP A;  1C57 A;  4HT1 T;  4Y20 A;  5A3N A;  1YEW A;  3HBK A;  3ZYI B;  4DXT A;  1DIW A;  4KNC A;  1RTV A;  4MGY E;  2V5Y A;  1AR8 1;  1GQP A;  3MIC A;  1U12 A;  1ZX5 A;  3OCP A;  1YNA A;  3A23 A;  2TNF A;  3OGJ A;  1H30 A;  3M3I A;  3JD7 2;  3ITQ A;  2OXB A;  3GDB A;  3MEP A;  3POB A;  3QOP A;  4R8H A;  2VMG A;  2EF6 A;  4MXW B;  4QPW A;  1F8V A;  3JUU A;  4Q2F A;  5CFD A;  3AMN A;  4UFJ A;  3TOJ A;  1BKZ A;  2A5Z A;  1H9W A;  4MV2 A;  1S55 A;  1BYH A;  1POV 3;  2PHF A;  3PNA A;  2RJK A;  1UF2 C;  2YY1 A;  5ERL A;  1GP4 A;  3OYW B;  1HRV 3;  1WD3 A;  3ZN6 B;  1B35 B;  5EYY A;  3EQE A;  3GZU C;  3MLL A;  5A3P A;  3M8L A;  5IW0 A;  5A3M A;  3K48 A;  3NJX A;  3AP7 A;  3HN3 A;  1PZ8 A;  4PF1 A;  5ABJ A;  5KWR A;  5CFC C;  1DZR A;  4A2U A;  1CAU A;  3LEM A;  4PJY A;  1ULE A;  1H8T B;  3FLR A;  3PJY A;  1UL9 A;  5LEJ A;  4RHV 1;  4RA0 A;  4UFL A;  5LA0 A;  2IZW A;  2FHR A;  4E2G A;  1AYM 3;  3POG A;  2Y60 A;  1XSQ A;  3GNE A;  4Q0S A;  5AVA A;  4AVB A;  4PLM A;  3THC A;  4QD2 A;  2IC1 A;  4RS5 A;  1C8M 2;  3SCG A;  4YZ4 A;  3T1L A;  5HPO A;  4MXW A;  1MS8 A;  3SCF A;  1WBL A;  1CD3 G;  2HWF 3;  4GH4 B;  4YGC A;  3U10 A;  1JTZ X;  1YQ2 A;  3WNL A;  4XE9 A;  3AL5 A;  1GIC A;  3B02 A;  1F5F A;  2BPA 2;  1WLD A;  2W52 A;  2VZQ A;  5AC9 2;  3KT7 A;  3OYW A;  3UGH A;  4DZG A;  3ZN6 A;  4CP0 A;  1B35 A;  5CFD C;  3E1F 1;  2BER A;  4HMZ A;  5ANN A;  5ACA 3;  2X8K A;  3SEE A;  5T5P A;  3BPS A;  4XIO A;  2WN3 A;  4LKD A;  3S6P A;  1Q8S A;  3CL1 A;  5CKM A;  2R07 3;  2G9F A;  1W8Z A;  1W6P B;  3DEM A;  1H8T A;  1ZBA 2;  2PHR A;  2RS5 1;  3KF5 A;  4XJZ A;  5FBZ A;  1JYT A;  1NOV A;  1CAW B;  1MS0 A;  3C8X A;  4ZHN A;  4NII A;  1UY4 A;  4B4Q A;  1LHU A;  1CES A;  2EXI A;  1PM7 A;  2DFC A;  5GLW A;  1RHI 1;  4Q4V 2;  2O8O A;  1GUI A;  3TB0 A;  2OUJ A;  1LR5 A;  4PCR A;  5GZD A;  2VGD A;  1RUD 2;  3ELN A;  2VMH A;  4LT5 A;  3W9A A;  2XUE A;  4GJY A;  2OKX A;  1AR9 1;  4GH4 A;  2VPV A;  5C5U A;  4YGD A;  4XIK A;  1J83 A;  5FR3 A;  3NVC A;  4RS5 C;  4B7E A;  5C4W B;  1JZ8 A;  1W39 A;  2RR1 3;  2QZ2 A;  1UZY A;  3ASI A;  4XFH A;  1WLT A;  3P1I A;  1JZ3 A;  3M70 A;  1UOG A;  5DAP A;  4YW4 A;  1W0P A;  5I8T A;  2ZHM A;  3BTY A;  1O4Y A;  2OW4 A;  1K5J A;  1W9T A;  2OA2 A;  3MW3 A;  1XQN A;  4GWN A;  3AB0 A;  1B35 C;  2WAA A;  1S4C A;  4EZH A;  4W8J A;  1XE7 A;  5AFB A;  3NNM A;  1CAW A;  1A78 A;  5FMD A;  3CDZ B;  4Z8B A;  1JZ6 A;  2PXJ A;  1RJ8 A;  4DS0 A;  5FPU A;  3BI3 A;  3ABZ A;  4Q4X 1;  4Q8K A;  3POJ A;  5FTT C;  4KG0 A;  3FHQ A;  4UFK A;  4LOR A;  4AED B;  2FCU A;  3VZK A;  1RMU 2;  5GJ6 A;  4KL1 A;  3N36 A;  5B2G B;  1OA4 A;  3DYM A;  3JD7 3;  1ZBE 3;  3OD0 A;  2GH8 A;  3JBG 1;  1UNB A;  1ENQ A;  2WDB A;  4I3P A;  4CP2 A;  4BXF A;  3UNP A;  4DUX A;  2Q1M A;  3VKL A;  1QJY 2;  2IVI B;  4XDO A;  2DV9 A;  4RGA A;  4G9S B;  2EVX A;  4UFH A;  3WQ7 A;  2FMD A;  4PIX A;  3N7J A;  4CDQ B;  2HWB 1;  2E31 A;  2R06 3;  2DWR A;  2XJS A;  1I3H A;  1AHS A;  2WS9 2;  2QUO A;  3G6J B;  4GB3 1;  2RS1 2;  5GM0 A;  2ZZJ A;  4FQ4 A;  4MXV A;  1S2E A;  3AYA A;  3ZVX A;  2RM2 3;  2VNV A;  4XXA A;  3OPT A;  2QE3 A;  1H8V A;  3AMH A;  3T2P A;  1LES A;  3NV4 A;  4CCM A;  1JN2 P;  4BE3 A;  4XBL A;  2P3K A;  4LXL A;  1BBT 1;  1A6C A;  4ITC A;  4XDP A;  2YC4 A;  1VBE 1;  3T1M A;  3JQX A;  3WNM A;  3UES A;  1IOA A;  2O8Q A;  3Q8C A;  4LOS A;  3HIF A;  3WXP A;  4TTG A;  1UOB A;  4AGV A;  4ZZ8 A;  4CCN A;  1J58 A;  5A7N A;  1JZ5 A;  3LDB A;  3I97 A;  2JIJ A;  1RVF 2;  2XG3 A;  1OT5 A;  1WWY A;  4CDQ A;  5AC9 3;  4A7Y A;  2XLA A;  3GCW A;  4F83 A;  3VD4 A;  1W9Y A;  5IVE A;  3UGF A;  1EUT A;  2ILM A;  1Y9G A;  3VZJ A;  4QKF A;  3ZXE A;  4LLO A;  1V0A A;  4JHZ A;  5BUV A;  4AGG A;  3RZJ A;  2JB4 A;  1W0O A;  3GM8 A;  4UW3 A;  3AZZ A;  4QQH A;  3VL9 A;  1OLM E;  1RUC 2;  2X29 A;  1QJX 2;  1IGO A;  2MHF A;  3K4D A;  4Y1X A;  5FAX A;  2AR6 A;  1ZRE A;  2C0Z A;  4FOY A;  5JDB A;  4I0W B;  2HEV F;  2A71 A;  2W39 A;  3AP6 A;  2Y64 A;  3OUH A;  3APB A;  3WW4 A;  1GWL A;  5T3N A;  4QQL A;  4PI0 A;  1S2B A;  1SFY A;  3BOW A;  1AR7 1;  3WF1 A;  2ZKL A;  4QM9 A;  3I2H A;  4EQV A;  4GKY A;  2JDY A;  3J7L A;  5D1I A;  3BOD A;  5FZD A;  2C9K A;  5BXX A;  3RYK A;  1DQ4 A;  1MPX A;  4OCT A;  1D4M 2;  3O1R A;  1Q8Q A;  4YW1 A;  2BVB A;  5K7P A;  5FJK A;  3WY6 A;  3BTZ A;  3RVH A;  5HXM A;  1DLL A;  2QQJ A;  5FRE A;  3E6B A;  1DHK B;  4NOT A;  2YGL A;  1NZC A;  3B69 A;  3WF2 A;  4A3X A;  3N7M A;  2JE9 A;  1N1Y A;  3T2Q A;  3VDD B;  3FHA A;  4YGB A;  2VBD A;  5JOW A;  3WNP A;  4D3W A;  2DUR A;  2XOM A;  1ULP A;  2YYO A;  4YG3 A;  3WQ1 A;  4Z92 B;  2DU1 A;  3KHC A;  5JLV A;  5KC6 A;  5A3L A;  2HYX A;  3E5Q A;  1X9T A;  4IDZ A;  3RWK X;  4OUE A;  3TRS B;  3MW4 A;  2XH6 A;  5GZG A;  4IEV A;  2ERF A;  4ZY9 A;  1NYW A;  4BPZ A;  1V6K A;  1SZB A;  2A3W A;  1WMF A;  2GND A;  1PNG A;  1PX3 A;  1K12 A;  4IEO A;  4ARY A;  1RMU 3;  3CU7 A;  3PUQ A;  1AL2 2;  2CV6 A;  2OQ6 A;  3NKG A;  2D6K A;  1SLB A;  4GIQ A;  3DEC A;  4ASK A;  1MQT C;  1RUE 3;  2R04 2;  4HZF A;  5FZ1 A;  2V72 A;  1OFN A;  3ZYP A;  3ST7 A;  1IS5 A;  1KD7 A;  3IBM A;  3OBA A;  4H14 A;  2XGX A;  1H9P A;  3B00 A;  3ILR A;  4QPI B;  5BPX A;  2DCK A;  4LUK A;  2W1W A;  1QJY 3;  3GZA A;  4UI9 L;  1H2N A;  2D6P A;  1L7L A;  3MID A;  5F3E A;  5A3U A;  3I49 A;  3T2T A;  3I3M A;  5L9R A;  1OPO A;  3H9A A;  1X8M A;  1VRH 3;  1D4V B;  2PHU A;  1IG0 A;  4N9H A;  3VDD A;  3UGG A;  3C7E A;  4BQ1 A;  4PIZ A;  2WS9 3;  5A6Z A;  4URT A;  1QDC A;  2L9L A;  2RS1 3;  2GAU A;  4NWW A;  3VKN A;  3PVN A;  5A70 A;  4BMB A;  4XUN A;  1L7R A;  1VP6 A;  2G9Z A;  3AP5 A;  1XE8 A;  3W58 A;  3J4U H;  4AEM A;  3LDR A;  4EWD A;  4OHY A;  4GWM A;  4O9G A;  1WW4 A;  1WCU A;  3MIG A;  3B9C A;  3CLP A;  3WP6 A;  3UET A;  4BQ3 A;  1XC6 A;  1NT0 A;  2JKX A;  2JEC A;  4HLT A;  4CCC A;  1UZV A;  4DEV A;  5DMY A;  5DQ0 A;  4XJW A;  2DBI A;  3RNS A;  1C5I A;  1S1A A;  5F3I A;  4Q4Y 2;  4ZON A;  5L73 A;  5FMO L;  4DXZ A;  1IS4 A;  4QPI A;  3R4U A;  1RUO A;  2R1B A;  1KFU L;  1FYU A;  3IZO A;  2JWP A;  3ZFF B;  2FDF A;  1GP5 A;  3ZMN A;  1VJ2 A;  1HQL A;  2YXS A;  1RVF 3;  1BMV 2;  4ZS3 A;  2WAO A;  5D21 A;  4N7U A;  2J1V A;  4N90 A;  4K40 A;  4BXS V;  5GLV A;  1QHD A;  4CCJ A;  2Q5T A;  5DAX A;  2K0G A;  2V73 A;  4CXX A;  2PLV 3;  2RJ2 A;  4NIG A;  2K9Z A;  4EN6 B;  1KJR A;  1PVX A;  2BQP A;  2YBP A;  3AX4 A;  1QJX 3;  1S0J A;  3NAP A;  5FP4 A;  3IPV B;  1ZZ9 A;  4CYD A;  4FQZ A;  2P37 A;  2W1Q A;  2E7Q A;  3TNQ A;  1PZ7 A;  3ALQ A;  4AVA A;  5EJ1 B;  4DO0 A;  4LO4 B;  1RUN A;  1X50 A;  1GZT A;  1JYN A;  3MFC A;  2FQP A;  1Z78 A;  2WZE A;  1MS3 A;  1BK1 A;  5L7O B;  5A7W A;  4CDU A;  4CTE A;  5F37 A;  4Y22 B;  3ZFF A;  4HBN A;  3EBR A;  2WZR 1;  3FE5 A;  4OVE A;  1OUS A;  4XAE A;  5IFT A;  2VBP A;  3GCX A;  4FPK A;  1SBD A;  1YJL A;  2OVU A;  3VBS B;  4CVU A;  1ULF A;  4HPK A;  4XFB A;  4QPI C;  4XAC A;  1D7P M;  1UU5 A;  4L92 A;  3PIJ A;  3LIH A;  3NL1 A;  2P6H A;  5A32 B;  4AQ2 A;  3ZIW A;  1YIF A;  5LA2 A;  3J9S A;  4ISQ A;  1IS3 A;  1HRI 3;  2PN5 A;  1OSG A;  1HXS 3;  1V6O A;  1UYY A;  3IPV A;  1PVC 2;  4LIV A;  5JI9 A;  5KXB A;  1X82 A;  4HKW A;  1PGW 1;  3J7H A;  2WR9 A;  1KS4 A;  2CWM A;  3NAP C;  4XF3 A;  4K1Z A;  3ZFG B;  3MDP A;  2H6C A;  1AL2 3;  2RS3 2;  2J22 A;  2Z79 A;  1DGR A;  1VBC 1;  5L7O A;  4I3G A;  3OG2 A;  4LUM A;  4X6R B;  2XLF A;  3U75 A;  3CQO A;  4M0N A;  1CJD A;  4W6X A;  2ET1 A;  2ORZ A;  5T55 A;  1SHW B;  3VBS A;  1O3T A;  3RPQ A;  4UF0 B;  2AUY A;  4EYU A;  2I45 A;  4CDU C;  4LNV A;  1VBD 3;  2XHN A;  3WG1 A;  3KGL A;  1KEX A;  2GC1 A;  1JUI A;  1C1F A;  5FZ7 A;  5A32 A;  1OA3 A;  4C8D A;  3AKQ A;  2WNU B;  5LBE A;  4IQP A;  5FZ4 A;  5GZC A;  3C7O A;  1NA1 B;  5I91 A;  2HWC 2;  1UYX A;  1WME A;  3TN9 1;  4P5Y A;  4HVQ A;  4P9G A;  3LGR A;  3H8O A;  1FMD 1;  5EPA A;  1T6B X;  1HN0 A;  1G86 A;  4DB5 A;  1EV1 2;  4JQR A;  4ASL A;  2Q4S A;  3PUS A;  4YAR A;  3VD9 A;  1QJE A;  1NCR B;  1DQ6 A;  2VH9 A;  4UBG A;  4E9K A;  2Q1F A;  3FFZ A;  4Y4Y A;  1B09 A;  4Y1Y A;  4IL7 A;  4FPH A;  3SNM A;  4Q4Y 3;  4YW7 A;  4XEZ A;  2VQA A;  1W6N A;  4OUS A;  4LR4 A;  4BZ4 A;  2QQW A;  3GHN A;  3P3P A;  3LIG A;  3PVE A;  5E89 A;  4OI4 A;  3E5U A;  1H2L A;  3GJB A;  1T2X A;  5DDJ 1;  2EIE A;  1J1L A;  3MF9 A;  4UF0 A;  3PUA A;  4U2A A;  1NLQ A;  5FZB A;  1R1A 2;  1H6X A;  2JDN A;  4PIY A;  5L7O C;  1GZ9 A;  4YW2 A;  5HCF A;  5KHH A;  3VB9 A;  2ZHN A;  4HOO A;  4QKD A;  4DIQ A;  4UWD A;  3MV0 1;  3DN7 A;  1UU6 A;  4FPO B;  1MZ5 A;  2V4V A;  2VCB A;  3T0B A;  3VBS C;  1TEI A;  2NPI A;  2VD7 A;  1NA1 A;  1FNZ A;  3RYP A;  3THP A;  2D5F A;  2ZEZ A;  1UMZ A;  5FZ0 A;  5JVV A;  1RC6 A;  1MEC 1;  3B5L B;  1MS9 A;  2Y38 A;  2QVS B;  4LA2 A;  2W68 A;  4Y5S A;  2AC1 A;  3KV6 A;  3O12 A;  1NCR A;  2O1Q A;  5E6H A;  5IVB A;  5DXD A;  4CP9 B;  1YC6 1;  1O3S A;  1RUJ 2;  3OGV A;  3U78 A;  5I0D A;  1RYY A;  3I2K A;  3N3H A;  4HXC A;  3SKV A;  3MUZ 1;  1FAT A;  2R0H A;  5LBF A;  4HKO A;  1G9C A;  3AXD A;  4GKX A;  4GMP 3;  4KBZ A;  1Q43 A;  3LFI A;  4X8P A;  1S0C A;  2WLQ A;  5FO7 B;  3GHM A;  5C3P A;  1LOE A;  4IET A;  4FOV A;  1W05 A;  5EJ3 A;  3OTF A;  5CIS A;  4XQ4 A;  1MS1 A;  2MEV 2;  1GNH A;  5JZG B;  4PQ9 A;  4N8M A;  2V09 A;  2VBB A;  4WVZ A;  4B3N A;  2LM3 A;  4AQ6 A;  2WQ8 A;  3Q8E A;  2VO5 A;  3JXS A;  1RUF 1;  4QHB A;  3R0R A;  3SHR A;  3D0S A;  3RJ2 X;  1RUG 3;  1ZZ8 A;  3J7N A;  1W9W A;  4DY3 A;  5IYY A;  1CX1 A;  5I0S A;  1PMI A;  1NA1 C;  2BEO A;  3RZG A;  2E53 A;  4XCA A;  1BJQ A;  4LHN A;  4NPL A;  2RDQ A;  1DCS A;  1C1L A;  1K5M B;  2R6Q A;  2Y6G A;  3KV9 A;  4CP9 A;  1HDK A;  4COV A;  4JTN A;  4LA3 A;  5LEK A;  2X09 A;  1W8F A;  4AK3 A;  3WEZ A;  3RZK A;  1R08 1;  1D0G A;  1NCR C;  2K46 A;  4NRM A;  2BWA A;  4PDW C;  1ENS A;  2WII B;  4BCU A;  5CAZ A;  1QH6 A;  3WG3 A;  4LKS A;  2JDP A;  1PGL 1;  4AAP A;  3ILF A;  5E8A A;  2H0V A;  3RYR A;  5JXG A;  2ZGU A;  1UMI A;  4XFF A;  1S0F A;  3UV9 A;  3VL8 A;  3AMQ A;  2GDF A;  2JEM A;  5FZO B;  4GUL A;  2DVD A;  4XAB A;  5DN2 A;  5C6C A;  3TEY A;  2WSU A;  2ZX1 A;  4P9I A;  3WQ0 A;  5FPZ A;  4CRQ A;  2HWC 3;  3I3B A;  1DGW X;  4ATF A;  4I30 A;  2QTW B;  2DCZ A;  2PA7 A;  3I54 A;  2R7E B;  1V9U 1;  1F2N A;  2NZ9 A;  5HCH A;  1ASJ 3;  1K5M A;  2OX0 A;  4LHS A;  1QNY A;  1BLZ A;  4LPL A;  5IAT A;  5J96 B;  3VHR A;  2MPF A;  3VD3 A;  5JOX A;  4OI2 A;  2VZO A;  2XON A;  5I93 A;  4JGZ B;  2VNG A;  3OEA A;  2C1F A;  4ZXK A;  1QOS A;  1UPI A;  1CON A;  1K45 A;  4AVT A;  3ORJ A;  4EE2 A;  2ZGK A;  4AQS A;  1QQP 1;  5FZM A;  2ZGS A;  2VCA A;  4GAL A;  5FBJ A;  1VBB 2;  1R1A 3;  3UKV A;  4XF1 A;  4DUV A;  3VZO A;  5A6Y A;  4IUG A;  2XVK A;  2JDM A;  3QAC A;  1N1S A;  2QQV A;  5FZO A;  1BHG A;  1E57 A;  1W8O A;  2PHL A;  1CGP A;  3B01 A;  1HRV 2;  5GLT A;  5FY5 A;  4CCD A;  2C4X A;  1JOD A;  1VAK A;  3S5Q A;  2VR4 A;  1FPN 1;  2ZAA A;  3WW2 A;  1PM4 A;  2PHW A;  1MVQ A;  2HWF 1;  2CNA A;  2P17 A;  4AAX A;  4AFA A;  4MG2 A;  4JRA A;  3H1M A;  1CQ9 A;  5T52 A;  2LUW A;  2Q0A A;  2BNO A;  4RS5 B;  2XL9 A;  4BLI A;  2G9G A;  2Z4F A;  1AYM 2;  1RUJ 3;  1BEV 2;  1STM A;  4JGZ A;  5DUX A;  2BYV E;  5ACA 1;  4LEJ A;  4MGQ A;  4Y1V A;  3T0A A;  5FLH A;  3VZM A;  4S2H A;  1CPN A;  3WVJ A;  5C3S A;  1CZS A;  1PIV 2;  2JDH A;  2NLR A;  3FBM A;  1SPP B;  4Y1Z A;  2VZR A;  2VZP A;  3BPZ A;  3H50 A;  2BVV A;  3W20 A;  2IXC A;  1HV0 A;  3MHZ A;  4LO8 A;  2J1T A;  2MEV 3;  2RG4 A;  1W6M B;  3POI A;  4TN7 A;  3VZL A;  4H3W A;  1LGC A;  5EWS A;  1LEM A;  1BVV A;  1GP6 A;  5CBL A;  1ONA A;  2FDI A;  5FK8 A;  1VLN A;  2XWJ B;  1XYO A;  3IAQ A;  3LOI A;  3O1U A;  2XJV A;  1NY7 1;  2JG8 B;  2UWC A;  2AEY A;  4E4H A;  3H3U A;  1CIW A;  3DYP A;  1ND2 A;  4LE3 A;  3OY8 A;  2QFE A;  3ZXG A;  3CJX A;  1FOD 1;  1YRZ A;  3DCQ A;  2V5D A;  4AF9 A;  3O1O A;  4XFG A;  2ZEY A;  1IPK A;  4AFC A;  2P3J A;  4XC9 A;  3AJZ A;  4KWU A;  3IDA A;  4Y5Z 0;  4I0B A;  4AG4 A;  3VHN A;  2XL7 A;  1OUR A;  1LHN A;  2ZMN A;  4OMC A;  2JB8 A;  3HAG A;  5CNA A;  1DGL A;  4XZU G;  1VMF A;  2ZZQ A;  4D6Q A;  1SPP A;  4BM8 A;  3LZZ A;  3THT A;  4HSL A;  2W1S A;  1RUH 1;  3IAP A;  4JGZ C;  5FZA A;  1UZW A;  2WFP A;  2RVA A;  2Y6H A;  1CIY A;  2W91 A;  2RR1 2;  3IKW A;  1QU0 A;  5JUV A;  4S2F A;  1W6M A;  3NNJ A;  5FY9 A;  5T5J A;  5T5O A;  3IDE A;  3AP9 A;  4BHP A;  1MAC A;  1T6G C;  4W4Z A;  1W0N A;  4Y22 A;  1WA6 X;  2JG8 A;  5KXD A;  1OVS A;  3RSJ A;  4F7Z A;  1AR6 3;  3SIS A;  5IHR A;  1PMJ X;  4JQT A;  2VZV A;  1C4R A;  1ZM1 A;  3ZYB A;  2QQK A;  4LBQ B;  1H4G A;  4BME A;  2GMP A;  1VAM A;  3O7O A;  2EIC A;  2JDK A;  5FYM A;  5I8Y A;  1O8P A;  2PYT A;  1ND2 C;  4GZ9 A;  3VKF C;  2YUE A;  4PBO A;  4NHM A;  5L9V A;  5FY8 A;  1YLL A;  3MPP G;  1PO1 2;  2XQX A;  4J25 A;  3HR9 A;  4N43 A;  5FZC A;  4DFS A;  1UY1 A;  1ZBE 2;  3DYO A;  4YVW B;  1G9D A;  1LAJ A;  2I74 A;  3EYP A;  1O4Z A;  5A3W A;  2ZEW A;  4YM2 A;  3ES4 A;  4BH9 A;  1EP0 A;  1VBB 3;  5D2A A;  3ZYG A;  2J1S A;  2GC3 A;  3AMP A;  1UYZ A;  4XJA A;  1LU1 A;  1VBA 2;  1MS5 A;  5FFO C;  4MUV A;  4LQR A;  2D6N A;  1WCD J;  2R06 2;  2VJX A;  4OUL A;  4B1M A;  5HBA A;  4H7M A;  3LB9 A;  2OZJ A;  2A6W A;  2AEZ A;  1C8M 1;  2ZGO A;  5HXV A;  2DCT A;  2H0B A;  4D6S A;  3LSE A;  2EIG A;  1LB2 A;  4FFF A;  1O5L A;  2RM2 2;  4LBQ A;  2GC0 A;  1F4H A;  1H1M A;  4R9C A;  5HCB A;  4P02 B;  4QXC A;  3ENR A;  1APN A;  1YFW A;  4MOA A;  2JG8 C;  2VTX J;  4XTM A;  5KHG A;  2WSV A;  3RFR A;  3E5X A;  4CUG A;  4CSW A;  1JMU B;  4R4X A;  5F5A A;  5CKQ A;  5FXZ A;  4Q0U A;  5ABJ C;  1NQJ A;  2PHX A;  3PIG A;  1W2O A;  1BEV 3;  1LEC A;  5BNP B;  2WA3 A;  1NQD A;  4ISR A;  4KU8 A;  5DZF A;  3HT1 A;  2XB6 C;  1Y4W A;  2EXK A;  4LO7 A;  1QEX A;  2WZ8 A;  4QDS A;  5DUW A;  4YVW A;  1PIV 3;  1UW8 A;  1UMH A;  4NPR A;  4CPB A;  1PO2 3;  3N9O A;  3HN1 A;  1R1Z A;  1I1E A;  5FZG A;  1ZBA 1;  3Q8B A;  3K75 B;  2OZ6 A;  4N43 C;  5FP7 A;  4D6R A;  5LWB A;  3FN9 A;  1OFS A;  4LBO A;  3WSO A;  4YM1 A;  3FBY A;  5BV6 A;  2Z69 A;  3JQW A;  1XYN A;  3HD8 B;  2HWE 2;  1BZW A;  4AEJ A;  4ET7 A;  1DZT A;  4Q4V 1;  1QJU 2;  5FRA A;  1H6Y A;  3HQR A;  4P9Y A;  1D0H A;  2ZJC A;  3WNN A;  4D0Q A;  2WIN B;  4MYE A;  1GNY A;  3T2O A;  4L0P A;  1RUD 1;  4Z07 A;  2Y34 A;  3ZR5 A;  5B4X A;  1Y7B A;  2ZHK A;  5DAB A;  3GZE A;  4QX7 A;  2VME A;  2EAL A;  5T5L A;  2FDH A;  4FO9 A; 
#chains in the Genus database with same CATH homology
 1XBF A;  1VMF A;  1VE0 A;  1VMH A;  2CU5 A;  2P6H A;  1VMJ A;  1VPH A;  2P6C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...