1VMHA

Crystal structure of an uncharacterized conserved protein yjbq/upf0047 family, ortholog yugu b.subtilis (ca_c0907) from clostridium acetobutylicum at 1.31 a resolution
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
129
structure length
129
Chain Sequence
VIEYSLKTSNDDQFIDITNLVKKAVDESGVSDGMAVVFCPHTTAGITINENADPDVTRDILVNLDKVFPKVGDYKHVEGNSHAHIKASLMGSSQQIIIENGKLKLGTWQGIYFTEFDGPRDRKVFVKII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized conserved protein YjbQ/UPF0047 family, ortho
publication title Crystal structure of Uncharacterized conserved protein YjbQ/UPF0047 family, ortholog yugU B.subtilis (15023806) from Clostridium acetobutylicum at 1.31 A resolution
rcsb
source organism Clostridium acetobutylicum
molecule tags Unknown function
total genus 36
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2004-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01894 UPF0047 Uncharacterised protein family UPF0047
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.460 Mainly Beta Sandwich Jelly Rolls YjbQ-like 1vmhA00
1VMFA 1VPHA 1XBFA 2P6CA 1VMHA 2P6HA 1VMJA 2CU5A 1VE0A
chains in the Genus database with same CATH superfamily
5CVRA 1SFYA 1JYNA 3FLPA 4Q2FA 3SHRA 1O91A 4LE4A 1GR3A 4UWDA 2BRTA 2R072 3OPZA 4YG3A 4AR2A 3PJQA 2WJSA 1UQXA 4Q1RA 2BFUS 4XXPA 1COV2 4X8NA 3MO4A 4CP9B 2JD9A 1FMD2 5SV8A 2HWB2 4CXWA 3VDCA 2VQUA 5J7MA 1AR83 4GWMA 3BTXA 1DBNA 1AR63 1KXGA 1US3A 5FMBA 1KFUL 1QHDA 1TZOA 1W8NA 3PNAA 2E53A 1G9CA 2EXIA 4I0AA 4IE4A 3NNMA 4MLOA 4PIZA 4A42A 1V6OA 2XJSA 1K5MA 5C9AA 3TRSB 4QXHA 3RYRA 2ZMLA 4XF4A 1W6NA 3T30A 4AHXA 5FO9B 2BBAA 4BK5A 4R4ZA 5F9TA 3ROUA 3RVHA 5J48A 4COWA 1QJU2 1GU3A 3ENRA 1XNCA 4QM9A 1XPWA 3ACLA 2NQYA 1AX2A 1POV1 4XJ9A 2CGOA 1IQDC 1IPJA 1OUXA 5FYVA 4HVQA 4ISRA 1HN1A 2ZAAA 5L7OC 4LBOA 4HOOA 2NMNA 3KV5A 3V0BA 4JKLA 3WW1A 5EQUA 1U5ZA 3CIHA 1KS5A 4LK7A 5F3CA 2LRPA 3CQOA 3AMMA 5CEHA 3Q8BA 3O1OA 3O1SA 1BVVA 2RM23 3HVDA 3LSDA 2VM9A 4LKFA 1QEXA 3ZXEA 3CO2A 3J8F2 4YG0A 1RUG1 2D6MA 4H3WA 3WINE 1W2AX 4YGBA 2QZ3A 4M0HA 5KHKA 3DCQA 4XFGA 4MHRA 4BQ1A 4YZ1A 4V2VA 4MGQA 5KHGA 1B35B 2WWUA 2JDHA 3AYAA 4QGNA 1YHFA 4LUKA 3B5LB 3N9PA 3OEAA 4XUNA 2P3IA 1GZCA 3A22A 4IE5A 3MW2A 1Y43B 5DUWA 1XSRA 2PAEA 4PHZA 3WD5A 5AVPA 3ZFFA 1R64A 3OTFA 1V6KA 1J3PA 3ZYBA 4BDVB 5K8SA 3VZOA 4GMP3 4OMCA 4O65A 2ZGSA 3B7MA 3VBSA 5KC6A 1VRBA 2W5FA 3NWKA 5FYHA 5F5QA 1PGL1 2RS13 4JGYB 4KWUA 4K7JA 2X29A 4YW6A 1VBB2 4UBHA 5FY1A 4JDMA 4AEMA 1VJ2A 1CPMA 1UOFA 2HWC2 3PLQA 5G05L 4D94A 2GC0A 2RG4A 2W52A 2WR9A 3WNMA 5A1LA 3T3YA 3LE0A 3VDDC 3POBA 3UGHA 1F8VA 1LU2A 2RR13 5CKQA 2QDNA 1GZTA 1VBE1 2R30A 1PM4A 3S30A 2WT2A 1C4RA 3G7DA 5FO7B 5JMOA 2XJUA 1FX5A 5L9RA 2H0VA 3OY8B 4XMIA 1XNKA 3FJSA 4XBQA 1O3SA 2XMLA 4PI0A 2VCCA 2Z4FA 4QQ2A 2C6SA 2EXKA 4KWKA 4MHUA 4Y4YA 1VMFA 4HONA 2RS31 4MXVA 3RS6A 1APNA 4A7ZA 2ARXA 2QQJA 3VGIA 1YQ2A 4QPGA 4BA6A 1D4M1 4R4XA 4QQHA 4LO5B 3MEPA 3ZMNA 3G6JB 1QF3A 2E7TA 4V2WA 3GBGA 1RHI2 2A3WA 4YLZA 1NZCA 1OA3A 1JZ4A 5DPNA 1G86A 2ENRA 2AACA 1UMZA 3VBRB 4CSWA 1VRH2 2HJIA 1RUJ1 4I0BA 2DCZA 5K0UC 4W8JA 4XJZA 2GP3A 3WDXA 5C3QA 1WW6A 2I45A 5EYYA 1AR72 3DV8A 3K4DA 1SLLA 1N47A 2KM2A 3GJAA 3U14A 5J96B 1DYOA 1RUF1 5IK8A 1LHUA 3HJRA 1HB2A 1Z78A 3E1F1 1UXXX 3WNOA 5C4WC 2YC0A 2YZ4A 4XHXA 1UWWA 3UKVA 4E4ZA 1HN0A 3E5UA 4M0NA 1LU1A 4AW7A 2A6ZA 4BQXA 3MZHA 2VZPA 1BMV1 4SBVA 1QJY2 5FP7A 3J7NA 4QKBA 3I3MA 1JODA 2A70A 2HWD1 3OPWA 3P5BA 4EN6B 1JU3A 1YFWA 4Y22A 2ZGLA 1BK1A 2BNNA 4XABA 2QQKA 1U5XA 2IXCA 5CKMA 4MZUA 5CFCC 1W6MB 2D3PA 4FFFA 1SACA 3CEWA 4JX0A 2GC3A 1BEV3 4A7KA 2WC2A 3ZYJB 1YNAA 3VD7A 2ZXQA 4IESA 3RZKA 1UOBA 3HD8B 1YO8A 2VOXA 4JGZB 1EV11 5CFDA 1SCRA 2KR2A 1W0PA 1OPMA 3RMYA 4N53B 3RG0A 4FXGB 3UK9A 4Q4V1 5HCHA 5HCAA 5C5TA 3ACIA 1WCDJ 5FMOL 3URFA 4KBBA 4FPHA 5FY0A 5GZDA 3S7IA 4YW5A 1S0CA 4Y24A 5GLZA 3AK0A 5JIUA 4F3JA 1QMJA 4W4ZA 4LE3A 5IVJA 3B3QE 5C8CB 5JOXA 4QQPA 1UY0A 4LO8A 3I2HA 1ZM1A 4HLTA 4YZ3A 3KQ4B 4HKOA 5JOYA 2XJTA 1W3VA 2VMHA 3C7OA 3PUAA 4RR3C 4AHWA 4EQVA 4WM8B 1JU4A 3T4VA 1AHSA 4IEWA 1UAIA 3ZVXA 2YV8A 3QCWA 4L97A 1WMEA 4R9DA 2QBXA 4CUGA 3AVRA 3FX3A 3R4DB 4Y20A 1TMF1 4DUVA 3SH3A 1SMVA 1ACCA 3D6EA 2GNBA 1O5LA 2CDOA 2Q5TA 2VNRA 2J22A 2WS93 2DV9A 3I4IA 2GDFA 4QX8A 5FTTC 3POYA 4AGRA 2AC1A 2VZSA 5C3RA 4Z1VA 1J1LA 1MZ5A 1PNGA 4GIQA 3CDZB 4FT8A 1OKQA 4BQYA 3MIBA 3WF3A 2CGPA 4XFCA 5FMCA 4Q4X3 1DCSA 1RITA 5T5PA 3S7EA 3I49A 1D2SA 3U10A 1UZYA 4HVOA 3MIGA 4CEYC 3IIIA 1RC6A 3B93A 3JBG1 1DQ0A 3K3OA 4WV8A 5FMOS 4LLFA 3RQ0A 1PIV3 1W2UA 2CDPA 5BNNA 3GJBA 3GZUC 3K4ZA 4XTMA 5JCTA 1LRHA 2VVDA 2IXHA 1RUC2 5F37A 2D97A 3NV4A 5FOJB 2QQLA 5F39A 4DXRA 3BI3A 5I0SA 4DRVA 1VB4A 2E6VA 2P34A 5C33A 4MXWA 4RHV3 5GJ6A 4R9CA 4AQ2A 1QJX1 4BM8A 3IMNA 3T08A 2FCVA 4IV3B 4LO7A 5FPZA 4CEWB 5IVCA 1ND3A 2ZKLA 5BYNA 1H1MA 4EE2A 1W06A 5FREA 2IC1A 2EF6A 5A3UA 4JV4A 4CPBD 1ZYBA 1X36A 2BDRA 4FSJA 1PGL2 4YWAA 5LA0A 1G6NA 3VZLA 2HWE1 2ZX1A 4BQ5A 2ZOEB 3QOPA 1E5RA 3JD73 3W59A 3MPBA 3I2KA 5G04L 2ZKNA 2RMU2 4LOSA 3CHXA 1RUE1 1AUYA 1GP4A 1K12A 3GALA 2QQVA 2VBBA 1J58A 3WNLA 2YPDA 4BZ4A 1VBE2 5FQ0A 3WQ7A 4P5HA 1RUI1 5FZ8A 5IVEA 1WMFA 4Q26A 3U75A 4AL9A 3KB5A 3WQ0A 4ZS2A 3POJA 2MEV3 1PZ9A 4MUVA 3D82A 2J7MA 4CDQB 4GH4A 1PK6C 1YIFA 3F2ZA 3M3IA 1RUD1 1RMU2 3HT2A 3LEGA 4HFSA 3T1MA 1WLCA 4LKSA 1X7NA 3I59A 3USUA 2J1VA 4CDXA 2WNUC 3JB8A 3KT7A 5ACA1 4XIOA 2JDZA 3WCSA 1OLRA 3U11A 1LHOA 3AYDA 3KCYA 4NHKA 4BB3A 4Q4W1 4OHYA 1UPIA 3ILRA 4GWNA 4LBKA 5LA1A 2XJPA 2LTNA 2Z79A 1YQ6A 3HNMA 2J1TA 4N43C 4TYSA 1UZZA 2D6LX 4NHLA 3VBFC 3ITQA 4Q4Y1 1FOD1 2LROA 5DABA 1MS8A 4NJ4A 1R1A3 5GLUA 4C0HA 4JC1A 4FAGA 4ZZ8A 5EPAA 3E6BA 3WUDA 1YUDA 4GZ9A 4XVHA 1RUF2 1MEC1 1NA1A 4QX1A 2XVLA 4BQ4A 1ULPA 4XACA 1YXWA 1HRI3 3DEMA 4LUMA 2A71A 4IQPA 5BXXA 3C3VA 3VHRA 1LEMA 2XVKA 3ATGA 5A6ZA 3LB9A 2PHFA 3H7JA 1EAH1 2HWD2 3S57A 2X5IB 1WLDA 5DDJ1 2K9ZA 3KGZA 3FMGA 3N9OA 3NSTA 3NW4A 4AEDA 2ZGUA 1YI7A 1PMJX 1W6QB 3WG2A 4INDA 3H8RA 3S5AA 1XE8A 4LNVA 5FJHA 1OKOA 2KA3A 1UY1A 2OKXA 3ZYFA 5J1XA 5EIYB 4FP3A 3WHTA 4BIOA 5JVVA 1ZBE1 3ZN4A 1LEDA 3F95A 3HBKA 3HT1A 5D2AA 1ZBA2 5JAXA 1WLTA 4GJZA 1AX0A 4NRPA 5GZEA 4I3PA 3H3LA 1NCRB 1ZREA 4JHTA 4YFWA 5FBZA 1IOAA 2VZTA 3FHAA 2FMYA 3ACHA 2K2SA 2BWCA 2ZEZA 4YVWB 2PMWB 1JYTA 4HKWA 4LA2A 4A6SA 3CJIA 3JZVA 3O7OA 1C8M1 3DL3A 1PHMA 2VNGA 3SH4A 4LA3A 3SEPA 2FDKA 3WZ1A 2BTVC 1N1VA 2DUOA 1ULDA 2DVFA 2L9LA 3OBZA 4KNCA 2Q8EA 3U07A 3WG1A 3JCIA 1EUTA 3RWKX 3M3OA 3T2QA 2A5ZA 1AYM1 2VUAA 2WYSA 4P02B 3ZR5A 1R1ZA 5FZIA 1O5UA 2EALA 5A3TA 3LA3A 2B9UA 4M3CF 4XBLA 3KD4A 4L9BA 1ZRCA 2VVFA 3R6SA 4UW5A 5EV7A 4QPIB 3WXPA 1S2BA 2C4XA 3LOBA 4AFBA 4AI8A 4D6QA 4Z07A 4UOJA 3ME2A 1PGSA 4LK6A 4NOTA 3FZ3A 4ES8A 1JYWA 3ES4A 3HN1A 1VBC3 2CTVA 1FAYA 3ZSEA 2PN5A 3UGFA 5LK7B 3NKTA 3TB0A 2WDBA 3KVAA 4PDWA 2QQOA 3C8XA 4GB31 5JZGB 4RQPB 5JXGA 1NLRA 2GNDA 2ZEWA 4HG6B 4L92A 4QB6A 4A7YA 3JBG2 1YWKA 3MHZA 4I09A 5DAQA 1W8TA 2GNMA 4F8AA 5I93A 1C28A 1RUH3 1ULGA 1W8UA 1FPN3 5D1IA 1OLME 2MNGA 5LBEA 4PF1A 3WLUA 5A33B 4WM7C 4N9HA 5AVAA 3AMNA 2VUCA 2XBO1 2CWSA 1QJX2 4OYUA 1I1EA 1UIJA 5J3UA 1KFXL 1QH7A 5CISA 4QHOA 4KWJA 4YYOA 2YPJA 3PMSA 2PHXA 4K20A 2DYCA 1UU6A 1H2LA 2ORZA 4EWAA 3RNSA 4B4QA 2W9XA 3D0JA 2JECA 4W6YA 4DUWA 5ABJA 5C7GA 5AC93 4A44A 2HWE2 4COYA 5IAVA 3RZLA 1W2TA 5CNAA 5FZLA 4XHBA 4QXKA 3DPRA 3ZYRA 1RJ7A 5BNOB 3PU8A 5HPOA 5M0TA 1OC1A 4PBPA 1Q3EA 5DZEA 3EJKA 1NCQB 3AKSA 1XNAA 4WVMA 1RUI2 3TBDA 1G8WA 1XYOA 3M1HA 1WGPA 5DAVA 5A7PA 2X53S 3AYEA 3MIDA 3OD0A 2FHRA 3JQWA 2O0OA 1LGNA 2LW8A 3GDBA 2JG9A 4GULA 4OZXA 1QKQA 3SNMA 3VUOA 2JE7A 4KBZA 1Q8SA 1DLLA 2AH2A 2A6XA 4MVTA 2WLPA 5E16A 4LBQB 1QXRA 4Y5Z0 2JIGA 1WA6X 2D5HA 4NWVA 2DFBA 5I8YA 5J36A 3MUZ1 5A3PA 1YCIA 4PT6A 1Q43A 3DYOA 3ZIXA 2QJVA 2JB4A 2OQ6A 4HSLA 5FZ0A 3U37A 5ACA2 2CSGA 4XMAA 1S0GA 4HT1T 3NL1A 4XETA 1H1AA 4Q4W2 2VGDA 3BTAA 1GKBA 3FHQA 4B4RA 1RVF2 2E63A 2VNOA 1UX6A 1OLQA 2ZA9A 1GOFA 2EIGA 5IAXA 1A3KA 1FV3A 1FOD2 1Y9GA 1W0OA 5B4XA 4CDXC 2GN3A 1MQTB 1UYXA 1Z7S2 2QCSB 4D8MA 1SEFA 3ZFEB 3WDVA 5BUVA 2NM1A 3O1RA 2WO7A 3LA2A 4BU2A 2PXJA 1AR93 1COV1 1RUG3 5JXJA 3T0AA 2HWB1 3FBMA 3GZTB 3GM8A 3WP4A 3HIFA 1C1FA 3I8TA 1EAH2 1AZDA 2R041 3I3EA 3RMXA 5L19A 5DDJ2 3C7HA 5IATA 1UMIA 3OUIA 5I91A 1HB4A 2AREA 2NP0A 3VD9A 3ZXKA 5A80A 2VCMA 3PL0A 3OJBA 5T5LA 1PO23 5F5IA 1JUIA 5FZDA 1Y9QA 5FZKA 3ZLIA 1H8TB 4DS0A 4QT6A 1ZBE2 2Y64A 5CYYA 5FLIA 4LJHA 4ATEA 4XF0A 4NHYA 3PJYA 4J6GA 1DG6A 2CNAA 5FLHA 2OX0A 1HJGA 4M3CB 2ZX0A 5CKNA 1GP6A 4KI5M 5FFOC 2Q0AA 2BGOA 2J1AA 3D4KA 2W0XA 1C8M2 4IEXA 4AFCA 2Q1FA 1SDDB 1WD4A 2NN8A 4I30A 5F3IA 1PVXA 2H6CA 2AUYA 3IB3A 3ZIWA 4CP1A 3H1YA 5CZKA 1CAUB 4OFGA 1CESA 4P9GA 1AYM2 1ASJ1 1SCSA 1VAKA 1XNTA 2XJRA 4KU7A 5BPXA 3FE5A 1L3JA 2G9FA 2BERA 3J8F1 4FOYA 2YU1A 1QY4A 4RGKA 3SKVA 2W39A 4MX3A 3ZFGC 3CJIC 4IEUA 2XUEA 4FTSA 3VZJA 2QQIA 3IAPA 5LWBA 2RS33 3K3NA 1SPPA 4CDWB 1VAVA 2RDQA 2BVBA 4XJUA 3O1TA 2VZ1A 1D4M3 5DAWA 4BQ3A 5DG2A 3IPVA 4YM1A 4BXFA 3MW4A 4AEKA 2R49A 1REFA 2R6QA 1GZ9A 2HWF1 4CDUA 4E9KA 1RUJ3 2NZ9A 4GB32 1DDLA 2AZ5A 1SBEA 2CYFA 4FQ4A 4JZRA 4Q1PA 1JZ5A 3DN7A 2WIIB 3H3ZA 3WDTA 4LBQD 5L7OB 4HPKA 3E97A 3CMGA 1R083 1AJKA 2VVEA 3OSDA 1S0FA 4AGGA 4BIFA 1JXNA 4CU8A 3WEZA 5FQ0B 1CAVB 3W5NA 3FFQA 1PO12 1W05A 2IVIB 3MGUA 2O8OA 2VNVA 4MSVA 1JMUB 5IVYA 2HWC1 4HN1A 4PDWC 3HPNA 4XDOA 2YXSA 3S5QA 1XOYA 2ES3A 4D3WA 2WFF3 2P37A 3AMPA 4A3XA 1OF3A 3THCA 3RJ2X 5FUIA 3B94A 4Y1VA 2Y8KA 3L2YA 2HWD3 2ZX2A 3LPGA 3POIA 4XW3A 5BNPC 3NV1A 1JH5A 1V9U2 4HANA 3WF2A 4WZFA 3M3EA 3FLTA 3WUCA 2VC9A 5FZAA 3T4HB 2BV4A 2Y6HA 2ET7A 2ZGPA 4ZS3A 5K0UA 3KHBA 3IDAA 1POV0 2VUDA 3UKNA 4AVAA 4FPJA 1IS3A 1EV13 3OCPA 4LMFA 3VZNA 2GN7A 4S2DA 3MIHA 4Q4V3 2DUQA 4K3UA 5CAZA 4NHMA 1GZWB 4FO9A 2XL7A 3WY6A 5C4WA 1VRH1 2XKPA 5ABJC 1BBT3 4YVSC 4P9IA 3GF6A 5D8AA 1DYKA 1UZ0A 3TOJA 3A7QA 2EVXA 3DPRC 1AR71 3POWA 3ZX7A 3RZZA 1C8NA 5HV0A 2EA7A 3VBUC 2JG8C 1W8FA 1OT5A 3H50A 5L73A 2V5DA 1CVNA 4C0BA 5CFCA 4MGZE 4NIDA 1URXA 2D44A 2PQQA 2D40A 1LTEA 1RIRA 4Y1UA 2RJLA 3UV9A 1TMF3 3KF5A 3IKWA 3ILFA 5F2SA 4Y1YA 5JPNB 1QJY1 1ZZBA 3B01A 3L9JT 3N7MA 4QHBA 4X6QB 5A32B 1GMMA 3ZDSA 5D21A 4IW3A 5EJZB 3OEBA 3OBAA 3ZKYA 5IHRA 4XF1A 5FZMA 5FZGA 3GBFA 3UKTA 4E2SA 4PF5A 2CHHA 1IQAA 3EYPA 4HKLA 1IPSA 1TG7A 2ARCA 3ZPOA 4ZXKA 2WO2A 1TE1B 4M4PA 4LKEA 2FD8A 1ZRRA 3PIJA 3MBWA 3ZXGA 4RR3A 2W68A 3QH6A 3H8UA 2ARAA 4UF0A 2R042 3P3PA 2WAAA 1A6CA 3DGTA 3SXWA 1DGRN 2OVUA 5AFBA 5J98B 1VBA1 3IWZA 1W6PA 1OUSA 1CAWB 1MS5A 5F5CA 3LIGA 4FVVA 3POGA 4EV0A 1M06G 5FY9A 5FDBA 1J59A 1LOCA 3B02A 4EWDA 4NWWA 2C26A 4QX2A 4IV1B 1ULFA 4YPJA 3FFZA 2QTWB 1UX7A 2MHFA 4FPOB 1SZBA 4MGKE 3EO6A 2ARBA 4DQAA 1I3HA 4F83A 3ZDVA 5FYSA 1QQP1 1GV9A 3N7JA 3OBRA 2DCKA 4CXXA 4Q0SA 3VKOA 1LOEA 1XYNA 4CEYA 1NXD1 2RDSA 3RYKA 5FZ7A 1OA2A 2WQ8A 1RUE3 1W8HA 2VE1A 5CADA 4URAA 2WNVC 2WZR3 3K75B 4H14A 4PLOA 4RS5C 3VHNA 3RZGA 3HNYM 3KF3A 1ASJ2 1ULOA 3AKRA 4P9WA 4ET7A 3TYJA 4DUXA 4B7KA 1LECA 1ZZ6A 2D6NA 5E88A 2GALA 2IXLA 3OPTA 2Y60A 4QHZA 4XZUG 1GOHA 4CE8A 4W50A 1D4VB 5GM0A 2VAUA 4OUEA 1RUD3 4MG2A 2IXJA 3I2DA 4XQDA 2ZPXA 4QDSA 4DMIA 2PAKA 2PYTA 1IS5A 4OLLA 1LULA 1RUC1 2WO1A 2X05A 2BOIA 2XGXA 3MLJA 3ZOIA 4AVBA 2BUKA 1LB2A 5LEKA 5FPXA 4RSUA 1MS0A 2HWF2 2YYOA 3EXUA 2PTMA 3N9MA 1ND2C 4QGLA 3SCFA 4AFMA 2VTXJ 2YMZA 5LY1A 5C9AB 1OOPC 2XLFA 1K5MB 2JKXA 4CCKA 3VBHB 3ZPYA 1W6NB 4W6WA 2W46A 4PJYA 4Q4Y3 4EWEA 3K2OA 3B00A 4ATFA 3WF4A 4ZPIA 3ECQA 2VZ3A 2VL4A 2R32A 1MEC3 3NAPC 1Q56A 4CDUC 2ZHKA 3NJXA 4LHSA 5FUPA 2RMU1 3J4UH 3RPQA 3ZSJA 1PK6A 5EYXA 5JR7B 4J25A 2W94A 4Z8BA 3PUIA 5FRAA 4BLIA 1NQJA 2ZGNA 5KR7A 3V0BB 2QDRA 2WNUA 4QX5A 4CCEA 4A3ZA 5FZ3A 1MVQA 5A7NA 3KVBA 4CPBA 5ERLA 4LPLA 4QAWA 1GQHA 5E1RA 4XF3A 3PVNA 4O9GA 1LOFA 1T2XA 3BVCA 1LHNA 1RMU1 2ZHLA 4OQ8A 2HYXA 3ACFA 4N43A 3VBFA 2R16A 3LPFA 2Q4SA 5F3GA 2VMCA 4AI1A 1U0AA 1GNYA 2G4IA 3M8LA 1JYIA 1FNZA 3AZWA 4UW3A 4XUOA 3VL8A 3ZR6A 3ZM8A 3VKNA 4YM0A 2WRAA 4AYUA 5DUUA 4QU2A 4GKYA 1S55A 3ZFFB 2BBVA 5FPLA 5FY5A 3KSCA 5FZEA 2E7AA 1H9PA 1W6OB 4D7TA 2VW2A 3JQXA 4IXLA 4LLOA 4LULA 4MGTA 1UY2A 4K6BA 3N7LA 2GZWA 1AYM3 3VBSB 5FZBA 1K45A 1OQ1A 1US2A 2YB7A 5FCCA 2XWBB 5D8AC 3AFKA 1J1TA 1DZQA 5A6YA 5C8CA 1L7RA 5FO8B 1MPXA 1OMIA 5GLWA 2DBIA 2ZGRA 4PIYA 4Q8KA 4HXCA 4XXAA 2PHWA 2JDMA 3WCRA 1RB8G 2FCUA 4IEQA 1UKRA 4IE0A 3ELNA 3N9LA 4NRQA 1CGPA 1NXMA 1YI9A 5H9PA 2VZVA 3LGRA 2EIBA 1W9SA 3DXUA 1WLWA 2I74A 3KWVA 3MI8A 4DY3A 1ZBA1 3BOWA 4AXOA 3O1PA 1S4CA 1SLTA 3W20A 1S2EA 5LBBA 4QPGB 3I2FA 4OHZA 2Y0OA 4CYDA 2BNOA 2VW1A 4KGQA 4BHPA 5KXBA 2Y6LA 1VBA2 2DTWA 5EZWA 2FDHA 3AJZA 2FDFA 1SFPA 4QX0A 1HQLA 5FLJA 1ZRFA 4EZHA 3WW2A 1LAJA 1O3RA 1JUHA 2PQSA 4JQRA 2XPJA 2XBO3 2Z5WA 3VKMA 1HRV1 2GC1A 1S0IA 5DXDA 4AVVA 4AQ6A 2DCYA 3FN9A 2DU1A 2IWGB 4XFAA 4FTBA 1VBD1 1Y4WA 5CBLA 2D43A 5FZ6A 1QQP2 4UXAA 3MV01 3SH5A 3ST7A 4FTEA 4BK4A 1AYN3 2B45X 4U36A 3TN92 1CJDA 2R1DA 4IDZA 2FZ1A 4OCTA 1SLIA 4J1XA 2ZX4A 3POFA 2ZBJA 1LKNA 1JI6A 2YC2A 1B35C 3RDIA 2QQUA 1PVC1 2EIDA 4Y22B 3M2MA 4HETA 3GCXA 4WM7A 3WG3A 4YRDA 1X33A 1XBFA 2D5FA 2D6KA 1DHKB 4B1LA 2WN2A 3EBRA 4CTEA 4ZKTB 4H7MA 4GQ7A 3VV1A 1VPHA 1WW7A 3ZO0B 1KRIA 3SCGA 2PHDA 3PUSA 5CFDB 1BQPA 1CPNA 4XAEA 2VBDA 1NYWA 4YFZA 5FYCA 1JOBA 3MFCA 1CIYA 3KHCA 5FPVA 3I3BA 2VR4A 3IAQA 3UETA 4UW6A 5JR2A 1QJFA 4IGQA 2CU5A 2OZJA 2R1BA 3OUJA 1BLZA 3AL6A 3J7HA 4QX7A 2VECA 2YC4A 1F15A 2BJSA 3E6DA 1HXS3 3KGLA 4QQLA 1G9AA 3IDCB 3WDYA 2VZRA 5C71A 3KT4A 1DQ1A 1AR81 3W5MA 2PLV1 2XWJB 1HLCA 1XYPA 3AMQA 1AR61 5F2WA 2R073 1H2NA 3LDKA 1R091 2X09A 3BGAA 4UBGA 1OQEA 3RRDA 4Y20B 1AVBA 3POSA 1COV3 2NMOA 3O12A 2HBUA 1FMD3 2G1MA 4ITCA 2HWB3 5FWEA 4BMBA 3CZJA 3TNQA 2JDUA 5F6KA 5E8AA 5TSWA 5I0TA 1CAXA 2E31A 1D7PM 4NIHA 5ANNA 3WNNA 4BQWA 5T3NA 4WVVA 4FPLA 2Y6KA 4OI1A 3ZN6A 1UZVA 5IVVA 3KV6A 1V6JA 2GP5A 4NHXA 3T09A 1JHNA 1UY3A 3VBRC 1YQ5A 2WL1A 3RZJA 2YBSA 3H0OA 5IJRA 2GH8A 5LZ6A 3I54A 1P8JA 4JQTA 2WT1A 5C6CA 1UMHA 2W2IA 2JDKA 2QUOA 2WFPA 1UYYA 4M01A 3KZ4C 1QJU3 3A0NA 4YZ2A 3SMHA 3BTZA 2ZABA 1MZFA 2FQPA 5BNNB 4ASLA 2LM3A 1CX4A 1IHMA 2ZGQA 4GKXA 3U4XA 2GMPA 1DGWA 2XJVA 1UW8A 1JBCA 3AP7A 3HAGA 3NMBA 4NIAA 1TME1 1S0DA 1AL22 1LOFC 1RVF1 1VB2A 3H7YA 3OOXA 3VLBB 3WQBA 2W1SA 5IFTA 2O8QA 1YRZA 2P3YA 3BOPA 4MXWB 4OVEA 4QKDA 1UCXA 3KV4A 5DAPA 4YW4A 1ZA7A 4YM2A 4D0QA 1Z7S1 2WWSA 1ND3B 5C5UA 3V0AA 1GSLA 2ZHNA 4XDQA 3IM0A 4ZU5A 2DVBA 3T2PA 3ZSLA 4LEJA 3AKTA 5DG1A 3J8F3 4YVWA 5H9RA 5C70A 3UNPA 2D3RA 1H6YA 3DYPA 3OF1A 4LHLA 4WVWA 2V4VA 4JGZC 2GAUA 1SDWA 2W95A 1H30A 2XDVA 4FI9A 3WX5A 4ES9A 4C91A 2VZQA 4N53C 3WNXA 4GMP1 1KJRA 4OI0A 2IUWA 1E5SA 3PURA 1OF4A 2GH2A 2XLGA 3PTYA 4ZXEA 4YZ5A 3ZXFA 1SBDA 4CCDA 3TEYA 5K7PA 1BK0A 4A45A 4RFT0 4AZZA 5A70A 2WSUA 5C8CC 3BPZA 4UFKA 3NJVA 5KXCA 2GU9A 4G3YC 4GH4B 4CCJA 4KL1A 3W21A 5CG9A 3V65A 1X50A 2OS2A 1F2NA 1JN2P 3Q8EA 4WM8C 3VZKA 3M7AA 5LRSA 2F4PA 3I59B 4YW2A 3USUB 4CDXB 3ASIA 2XQRA 1DQ2A 1VBB3 3TAYA 2WZ8A 3RI8A 3ZFGA 3NRUA 2HWC3 2W91A 5FXWA 5JZGA 1W9YA 1LGCA 2TBVA 2ZMKA 3PTRB 2D7FA 3TWIA 3BUCA 1HRV2 2LS6A 4MGYE 4JHZA 3R0RA 2A6YA 4GA9A 3EB7A 4KG8A 4AFAA 5C3PA 4LR4A 2E9QA 2XL9A 1VBD2 2BP6A 5FIXA 4FQZA 3CL1A 2ZAHA 3K4AA 4LBJA 1NA1B 4IE7A 4CP2A 4A6OA 1CZTA 4UAPA 4E4DX 4P5YA 3M4FA 3UYJA 1BJQA 3WW4A 1QNWA 5IVFA 4QPYA 1OD3A 3VKFC 4QM8A 1VIWB 4I01A 4HL0A 1FNYA 1RHI3 3Q8CA 2QZ2A 1PVC2 2P6HA 5GKAC 5A7WB 4COVA 3QACA 4AEDB 4HSJA 1VRH3 1YFYA 5FKBA 3SCHA 3O1UA 1QU0A 3AP9A 1YYNA 1XNDA 5JSOA 2WUHA 3SQOA 2J1RA 3I3QA 3LAGA 3ZKUA 5IVBA 1A78A 4XURA 4DXSA 2EAKA 1AR73 4CEWC 1N1TA 5KXDA 1TNFA 5BNOA 1Y3TA 1XE7A 5BNPA 3OGGA 1Y7BA 2R062 1DP0A 3MIEA 2RS52 1FXZA 2JDAA 3IBMA 5A7OA 5A3NA 1A8DA 1PO11 3LIHA 4LORA 3NO8A 5A6XA 4LKDA 2WQZC 3TEZA 1LGBA 1BHGA 1BEV1 5LBCA 2WSVA 1K42A 4CCCA 4XOGA 1QJY3 1ZZ7A 1WBLA 2Z2SB 3VBOB 4BCUA 2ZGOA 1V9U1 1RINA 2VMIA 5GZCA 5J09A 1W0NA 4B3NA 1AR82 3GHMA 3ZXAC 2RDNA 2TUNA 3FWEA 2PLV2 1D0HA 3AM2A 1AR62 4D6RA 3R4SA 5FZ9A 1R092 3TEWA 4YVSA 1Q5OA 5JLVA 1OBNA 1E5HA 2RHPA 3GXUA 3AXEA 4CDQC 3GCWA 2I07B 1FI2A 3VBUA 2R7EB 3MICA 2JG8A 5FAXA 4BJ0A 2Y33A 1GOGA 1O8SA 3IN9A 2XR4A 2VZUA 3KT1A 2GMEA 4OI4A 4S2FA 1MZEA 5FK7A 5FXXA 1F4AA 1V6IA 2Y6JA 4YW1A 4QB2A 1OD5A 4AE2A 2UYBA 3NNFA 4PDWB 4J1WA 1H9WA 1UXZA 5FR3A 2DUPA 2RJKA 1GFF2 1YFUA 2VMGA 1VLNA 3OYWA 2WS91 3ACGA 5FY4A 1XSQA 4GD4A 2A73B 4KQ7A 1POV3 4W65A 4AVSA 1YJLA 1ZRIA 2B7YA 1UIKA 2JXAA 3V56A 3HN3A 5FP8A 4UFLA 1TME2 2RM22 2ZZQA 5JIAA 4MH0E 2DTYA 1ULEA 2I2SA 2JE8A 2OW4A 3HBZA 5FUNA 4CVUA 3THTA 1AF9A 2P3KA 4PLNA 1KD7A 2WABA 1ONAA 3N36A 3UGGA 2QFEA 3VB9A 5DAXA 3PMEA 1W2NA 2GNTA 3C7EA 2Q1ZB 4AAPA 2XONA 2ZTNA 2ZEXA 2VULA 3ZYPA 5F5AA 5HXMA 1DU3D 4AQTA 4FAHA 1NLQA 1YQCA 2A6VA 2BOJA 1N1SA 4D6SA 1C1LA 1NT0A 3LEIA 3RI9A 1KJLA 4D7YA 1O4ZA 2XXZA 3OB8A 4AHZA 1BXHA 5J37A 3P3NA 1UL9A 4HMZA 3WNKA 3FUQA 3IZOA 1OVSA 3DPRB 4DY5A 4QDRA 2W3JA 2EAAA 5KHJA 1WCQA 4DIQA 1O4YA 1NCRC 2WYFA 4OI2A 4SLIA 5SV5A 4WVMB 1RUC3 4QXBA 4E8DA 3LA7A 1CR7A 2VD7A 1TQ5A 2VO5A 5T52A 2RS12 4E2GA 3AVSA 4YVWC 3O1MA 2AENA 2JG9B 2PHLA 1QOSA 2Z69A 2WNEA 3BODA 3JB4C 4BPZA 2Y6GA 2WNVA 1E57A 3A0KA 3GBWA 2ETEA 3LQCA 4N8MA 4RS5A 3EMRA 1GWLA 4WZCA 2OUHA 2ZGKA 1LENA 4Y26A 2RR12 1CZVA 3A4UA 1LR5A 4NN0A 3ES1A 3NNJA 1QH6A 1YC61 1KS4A 4OHXA 4AHYA 4XDPA 5F3EA 1SLCA 1IS4A 4XJAA 1EUUA 1HB3A 2RMU3 1OVPA 2UY9A 1WA4A 2VUJA 3CKHA 3FLRA 4P9XA 2ADEA 4QPIC 5K9YA 1Q8QA 3ZXJA 4NMIA 4XZPA 1UNBA 4P00B 1DF0A 4B29A 1VBE3 3M3QA 5A3MA 1ZVFA 1RXGA 4E4SA 2G19A 3O14A 2RDRA 1EPZA 4NVPA 4EROA 2ZGTA 1PMHX 3KQRA 2DVGA 2VH9A 4OUSA 2VPVA 4LBNA 5A1FA 4N90A 4JVAA 4NROA 5T54A 4NPRA 1DGRA 1ND2A 1XU2A 4LQRA 5EHDA 3USSA 4Z2AA 1XQNA 4RQPC 3VKLA 5JZGC 1OOPA 2OPWA 2C5DA 5A3WA 1RMU3 3H8OA 3BU7A 5HBAA 3I3DA 5FY7A 2RVAA 1FYUA 2VOKA 4R9BA 1D2QA 1Q8VA 2C24A 2OIIA 3K51A 1R1A1 4OZOA 2D6OX 5H9SA 4C90A 1IPKA 3NAPA 1AJOA 4Q29A 4QX3A 5FV3A 1I5PA 1I5ZA 4FPYA 3T1LA 5IK7A 2OPKA 3DYMA 1YFXA 1H8VA 5KHHA 4M00A 2YBPA 1NX9A 5EFUA 4CUCA 1T6GC 2OXBA 4QKNA 5C3OA 1QDOA 2XUMA 3V64A 2YUEA 3AYCA 1POQA 2Q1MA 3ZYGA 3OGVA 2ID4A 1RUF3 3DF0A 3N9QA 1RTVA 5JPMB 4HN0A 2JKBA 4XE9A 1W9WA 2K46A 3E6CC 4FFHA 1J84A 4XPVA 4QB1A 1BEV2 2HEWF 1NUKA 3AXDA 3D8CA 2GC2A 1DZRA 2HLEA 2G9GA 5BNOC 2A6WA 4AI2A 3THDA 2VBPA 3N35A 2YFZA 2ZGMA 3VD3A 1NCQC 3QD6A 2PHTA 1H2MA 5LA2A 4Z92B 5JWPA 4A4AA 5A1AA 3C2UA 2V09A 2VTFA 4QU1A 2ZZJA 1ZRDA 1WMXA 5DZFA 2UU8A 4GAZA 5LBFA 4BMEA 3AKQA 4ZU4A 5I8TA 4IUGA 1HV1A 4Y3OA 5FZOA 1QOTA 4Z2WA 1ZBA3 4R8HA 1AX1A 4TLGA 1JOJA 1RYYA 1F35A 2V4AA 3IPVB 2TEPA 2AR6A 2VW0A 3I2GA 4OULA 3UT0A 1SG3A 4PLMA 3D3AA 3DUIA 1NE6A 4XJ8A 2RE9A 4CP9A 3PHMA 1ZZ8A 2CAVA 1BYHA 2WINB 3SEEA 3VDDB 1QGLA 3B69A 4HPKB 4IL7A 2WS92 1HQWA 4LHKA 2JX9A 4FPEA 2JIJA 1MQTC 3VL9A 2SBAA 1E5IA 5T50A 1VBC1 4YG6A 3ZFEC 5I0RA 4JAAA 5CG8A 2HKXA 1K5JA 4PCRA 3VDBA 3HQRA 5KWRA 4ARYA 3U78A 1H0BA 2DCJA 2OQ7A 3RZHA 3OGJA 4Q4X2 3U4SA 1W39A 1GWMA 2VOVA 3SISA 4XUPA 1V6MA 2WA3A 3ILNA 3LF7A 5GLTA 5IUQA 1HV0A 2WN3A 4FXKB 2DBNA 1HJFA 5FMDA 5HXVA 5ANQA 1PIV2 1OLMA 1PVC3 1STMA 1A8MA 2IZWA 3KMHA 1FV2A 4XILA 2YFUA 5F6LB 1JS9A 4E4HA 3AZZA 5K0UB 1H4GA 5KC5A 4RHV2 3VD4A 3JBG3 1RXFA 5BY5A 4N7IA 1H8TC 4XQ4A 2NLRA 1W9TA 3S6PA 4RGAA 2MPFA 5IT6A 1UD1A 3IDEA 4Q0UA 1W8OA 2P4EA 2CY6A 4XCBA 3RYPA 4CCMA 2YY1A 2YGMA 2BEOA 5C4WB 5AC91 3LCPA 4OHWA 3UL2A 1WW4A 1S1AA 1PNFA 2XHKA 4L2NA 1QJX3 3JD72 3LFMA 5D8AB 2BPA2 3HOBA 1W3XA 1GP5A 2BWAA 2ZACA 2Q8CA 4PI2A 3O0XA 1MS4A 1GNHA 1NY72 3H1MA 1B35A 2VOWA 3AZVA 4F7ZA 2JICA 3RZMA 1HX6A 4H7LA 1O8PA 2PLV3 1LHVA 5CFCB 3D0SA 1NAEA 2F4LA 2HWE3 5T5OA 1JW6A 1GQPA 1R093 4UW4A 3TN91 4NAOA 1GUIA 5I0DA 2MEV2 5F8PA 1JYCA 3BYWA 4CDWC 1QWRA 3VBHA 5K4LA 4D69A 2YG0A 5FP4A 1CWPA 1RUI3 5C8WA 3DKQA 2OA2A 3A21A 3JUUA 4JGYA 5T55A 4R9AA 3LDBA 1O59A 3HQUA 1VALA 3KM5A 2XOMA 4TWTA 1MR5A 2Q30A 4FCAA 4YARA 4LO4B 3WF1A 2VXJA 4XUTA 2QKDA 1L7QA 5HCFA 4LITA 2Y26A 2XB6C 1C3HA 2W1QA 5E6HA 4LIUA 4FP2A 5FYTA 1NOVA 4RR3B 3AL5A 4FFIA 1JZ6A 1QJEA 4UF0B 1R1A2 5A7QA 1F4HA 2PAMA 5EP9A 4B8EA 5ACA3 1W28A 4IERA 3NV2A 3OY8A 4KH9A 3CNAA 4Q4W3 1W6PB 4NO4A 3FUOA 1RUNA 1PGW2 1TME3 4META 1HRI2 1OURA 1RVF3 5L9BA 4AOCA 4ZZ5A 2WT0A 5DMYA 1AR91 3LWCA 4GALA 4Z82A 3S0MA 5EJ3A 1GANA 3WDUA 1DGLA 4CCOA 1FOD3 3N3HA 3MF9A 3N7KA 3MUY1 4GXLA 3HQXA 1Z7S3 4EN7B 3J26N 1NG0A 4XQWA 2BGPA 4GWJA 2B8MA 3VBRA 1HIXA 4TXWA 4U2AA 3N4MA 4Y4RA 3MV11 2ZJCA 1LHWA 3ZN5A 4QKFA 5LK5A 3MYXA 1PO21 4CEYB 5I0UA 2P2KA 1EAH3 1GLHA 5DDJ3 1W6OA 4HBNA 5FKCA 5FPBA 3THPA 5LB6A 1WMDA 1O3QA 2Z42A 2HBTA 3HNBM 1SLBA 1TNRA 2XKOA 3RFRA 4XFIA 1G7YA 1KDMA 1WKYA 3AJYA 4O7XA 2PA7A 3T2OA 4BISA 5JOWA 4AGVA 5H9QA 2YDEA 1WCKA 1DQ5A 1U5YA 4E27A 1UO9A 4MADA 3IDBB 1JZ8A 1ZBE3 3MF6A 1F5FA 2QQNA 4CCLA 2XG3A 5LCWL 3ABZA 5GLVA 3VHOA 2P1BA 3TNPB 4AK3A 1G9FA 3UJOA 1W6MA 3J7LA 4AG4A 4AQSA 3WP3A 1AXYA 1OHFA 5FPUA 1AL21 3INAA 4IGPA 2Q8DA 4NPMA 4TTGA 5IW0A 2EIEA 5FPAA 4JGZA 1C8M3 2EXHA 3AX4A 1C57A 1DGWX 1SHWB 3SKJE 1MS3A 4N53A 1QDCA 2VMEA 2XH6A 1AL0G 1NLSA 1G9DA 3CU7A 2DU0A 1MZ6A 1VBC2 2D6PA 4TSVA 4FBFA 2KD7A 2P17A 4YNIA 5A7SA 4XCAA 1G9BA 1LODA 1ENXA 1PK6B 2Y0IA 1OXCA 2TNFA 4XYXA 3AKPA 1H6XA 1PMIA 4WM8A 1R081 4I0WB 2WNUB 1RUH2 1X8MA 2P5BA 4PQQA 5FK8A 1JYVA 4P9YA 1FPN2 4X8PA 4NE9A 4GB33 4HZFA 2C1FA 4OQ9A 2G9ZA 4UI9L 1BVP1 1PX3A 4XUQA 3KCXA 4UFIA 2WFF1 4IEYA 5T5JA 4AEJA 4N43B 1W9FA 2GSYA 2V5YA 2UY8A 4IV1C 4QXCA 3VBFB 1N3OA 4HVRA 2EICA 1OQDA 1TEIA 3OUHA 4MGSA 2J1SA 3APBA 3RSJA 4IEZA 1S0EA 4ASKA 1PO13 1XRUA 1UPSA 1B09A 3U1XA 3GYDA 1J3RA 4DINB 3RJRA 5AC92 2BU9A 5FZ1A 5FXVA 2H0BA 3ZYHA 4NIIA 5BV6A 4AI0A 3K46A 4K1ZA 4DOUA 1LESA 1V9U3 4RL7A 4ZY9A 1PZ7A 4WBBA 1VMJA 2DFCA 2WZEA 1WD3A 4DFSA 1WUVA 4XC9A 3IT8A 2ZEYA 1GWKA 2BGCA 2ZMNA 5IK5A 3BCWA 2DVAA 4YSFA 1BBT1 4BE3A 1QNYA 3AC0A 4K1YA 4KGGA 5FYUA 4L0PA 2OZ6A 4IV3A 5LA9A 3AP5A 3IMMA 4CEWA 3BIEA 2B42B 4FOWA 3OBTA 3KLSA 4DO0A 1GBGA 1CIWA 3AP6A 2CAUA 4K21A 5FZHA 5A3OA 3MDPA 2FZ2A 1MACA 2E26A 1ZA4A 4O9EA 5GZGA 1J83A 1IGOA 2BW8A 1QXJA 4P08A 4JKKA 1OH3A 1W8ZA 2FDJA 1LCLA 1UYZA 3NJZA 5C9AC 2R0FA 4MGIE 1K5MC 2R061 4N7UA 3VBHC 2E33A 3MPPG 2RS51 3WVJA 1GICA 1ENRA 3VHPA 1TVGA 1XU1A 2WNOA 2A3YA 4JGYC 4YM3A 5CA6A 4IEVA 3JU9A 4M3CE 4XF9A 4LIVA 5FP9A 2VMDA 5JUVA 2X8KA 4GMP0 1CZSA 4MYEA 4KMQA 4CDQA 5HCBA 3PVEA 1IG3A 2DDUA 4ISQA 1BCXA 4IEOA 1AR92 3WW3A 2DCTA 1RUG2 2DWRA 1RL3A 1IZ3A 1OPOA 1QJZA 1UYPA 2JE9A 3AFGA 4NR1A 2PHUA 4RFRB 1PM7A 1X9PA 3EHKA 5IFPA 1LJ7A 2BZDA 3H1WA 5JOZA 2WWJA 3E5XA 5DUXA 1XNBA 2PHRA 5AFEA 5C3SA 3FL7A 4NPLA 2Y6FA 3BTYA 2VXRA 1V70A 5FYMA 2E32A 5F32A 4FPCA 2VTXA 1PO22 1UF2C 2YBKA 3O0VA 5FWJA 1ENSA 2R043 4TN7A 4ORFA 4AI3A 3LZZA 4BXSV 5F1RA 5JI9A 4Y5TA 4B7EA 3SITA 1GQGA 2Q8OA 2OT7A 2P3JA 4PQ9A 5B2GB 1UU5A 4WM7B 5B4NA 2AYHA 4XFBA 5HI0A 1N1YA 4CXYA 3BU0A 3KCCA 1H4HA 1W90A 3H3UA 3Q9OA 3ZFFC 4XTPA 1XJAA 4GWIA 3NV3A 2X5IA 4IEPA 4Y1XA 1W04A 1XE0A 2UWCA 4JDOA 2RV9A 4RGGA 3ZSKA 5FYIA 2WZR1 1RGSA 3QBQA 1Q8OA 3WP6A 1DYPA 3VBSC 1NE4A 1JTZX 1OH4A 1W6QA 2E51A 2RM21 2Y34A 2CWMA 2QVSB 1ENQA 2XVGA 1BKZA 5FYZA 3TEXA 1Y9MA 4XFHA 5BNQA 3X29B 1VP6A 2CL2A 1D0GA 2RS32 4BH9A 1NCRA 2JJ6A 3BPSA 1D4M2 3DXTA 4FPFA 1ASJ3 1REEA 4AI9A 3WP5A 4COUA 2R0HA 1S0JA 4N9IA 4YZ4A 1NZIA 4Q0VA 2AEZA 2FMDA 3CF6E 3J7MA 3BALA 5IWFA 4QGMA 1UN1A 1RUJ2 5I8SA 1LNSA 3CJXA 1I6XA 2F6BA 2WBKA 2JEMA 3QLQA 4JTNA 2A7AA 3HWJA 4QPGC 2ZX3A 3T0DA 1R082 1F31A 5DQ0A 3NJYA 4XIKA 2QQMA 1IS6A 4OUMA 4CU9A 1CAXB 2RS11 2NYYA 3PVBB 4L99A 2HWF3 4Q0PA 3ZN6B 4JRLA 3N9NA 2B4KA 1V6NA 4QPIA 2O1QA 3FBYA 1JZ3A 4HK9A 3A23A 3KV9A 2WFF2 1ST8A 4LTAA 3WV6A 3LEMA 4DPNA 2KXLA 2EXJA 4FPKA 1V0AA 2RR11 1BMV2 2CGNA 2D93A 4XBNA 4I2OA 3WG4A 1CX1A 2VZOA 4K40A 1H1IA 3MLKA 5KHIA 5A7WA 2JENA 3I2JA 2GMMA 4AF9A 5APAA 1RUOA 4IGOA 2C0ZA 4RQPA 2VMFA 3BB6A 1GYKA 2D98A 1HQNA 2W47A 3BIWE 1VMHA 4UFMA 3LDRA 1OA4A 2JWPA 3ZMOA 4QD2A 4ONUA 1EV12 3ETPA 1C5HA 2FDIA 3H8XA 3NKGA 1MS9A 4EJRA 4Q4V2 3L2HA 5FZ4A 5FZCA 5A33A 5F7UA 3V0AB 1NKGA 1KGYA 3WF0A 1WBFA 3AZYA 2J1UA 2ILMA 2AGSA 4ZU7A 3I2OA 1BBT2 1SFNA 5LASA 4PBOA 5JXHA 4A41A 1YEWA 4ZONA 4COZA 1YLLA 3PUQA 3NQHA 1HW5A 5CFDC 3VBOA 1QIQA 4BYYA 2K0GA 2OYZA 1JZ2A 2ET1A 4OMDA 5A3LA 4JCKA 4W6XA 1IG0A 5JSRA 3VN4A 5HV4A 3O1VA 4S2GA 3I7DA 2WZPP 2C9AA 2VU9A 2VCBA 3SLIA 4IV3C 1TMF2 2IFWA 3ZXLA 2WKKA 1JHJA 1O6UA 2DURA 5FZFA 1HKDA 2W08A 1XXNA 1DZTA 1EY2A 4LBMA 4XJWA 1KQRA 3Q8AA 4QMAA 1NCQA 2VCAA 4IETA 2FDGA 3HR9A 2NPIA 3WHUA 3MIFA 4V1PA 4FOVA 3K77A 4A2UA 1PZ8A 4O61A 1S0BA 4BOWA 4KU8A 2WA4A 5GALA 4JKMA 4X6RB 3ZFGB 1EP0A 4IE6A 3CJIB 4DXTA 3AP4A 3R05A 2LUWA 4LBQA 2ZHMA 1ZX5A 2PFWA 1NQDA 3GZEA 3KS7A 1DLCA 2E7QA 3DECA 5L36A 5L9VA 3FC0A 1RJ8A 4TLFA 4Q8LA 3B9CA 3GHNA 1DFQA 4LXLA 1K3IA 4ZHNA 2V72A 3W9AA 2IXKA 1H2KA 3C7GA 1CJPA 2N7GA 1I9RA 2XHNA 3PUHA 3RGBA 2ORXA 4YGDA 2VQAA 5DZGA 2B46X 1MVEA 2X10A 3M70A 1MQTA 4DNYA 3OGSA 3NNGA 3ZFEA 3UJQA 1VBA3 1MS1A 2VQTA 5EWSA 5BNNC 4M4RA 4DEQA 1N3QA 1LOGA 2IXIA 2XQXA 3K48A 4DZGA 4FOQA 1EPWA 1ODNA 3ETQA 1F9KA 1O4TA 2A1XA 4CA9A 1AYN1 2UWBA 1CQ9A 1YJKA 4CUAA 3NNLA 1KDKA 3WNPA 2ATFA 1DQ6A 3T2TA 1RUE2 1ND3C 5BNPB 2DF7A 4MO3M 1CD3G 4WVZA 4UYBA 4I02A 2WZR2 2XLAA 3ORJA 1QQP3 4AVTA 1UU4A 1FATA 1V00A 1X9TA 3Q8FA 3TN93 1KITA 3LD8A 4Q4X1 3GNEA 3O5SA 4BQ2A 2WQ4A 3CBNA 2J1EA 1BZWA 1SBFA 1H8TA 1O7FA 2O14A 3MLLA 4XAAA 4AVCA 2YGLA 2X5IC 2YU2A 3C7FA 1LOBA 1RUD2 1OSGA 1CN1A 2ADDA 2J42A 1PIV1 4AWDA 2JDNA 4Q0QA 4P9JA 3WT3A 3UESA 1WW5A 3PU3A 4CZSA 4EN9B 1DIWA 1UKGA 4S2HA 2IFRA 5LRRA 3ZSMA 1QOOA 3LOIA 4G9SB 4M3CA 5GZFA 5KXEA 2PELA 4Y5SA 1KEXA 4YGCA 4YVSB 4RHV1 2ZCWA 2B39A 2F17A 3P1IA 2YHJA 4JDNA 2JDPA 3GZAA 3PIGA 3VDAA 4GH4C 1HXS1 5LY2A 1GNZA 3VBUB 5JXIA 4OHVA 2WLQA 1CAUA 1PX4A 1ZZ9A 2JG8B 1ULCA 2JDYA 3PDQA 4FPGA 4Q4Y2 5FJKA 5ABJB 4GJYA 1V6LA 1WCUA 1JOPA 3D5OA 4G4FA 2R071 4RA0A 1JZ7A 4PIXA 1MEC2 3JD71 5IK4A 4AAXA 2WO3A 2HEYF 3VZMA 4EN8B 4BWOA 4CDWA 4Y33A 1NY71 2BQPA 2V73A 4CP0A 4NIGA 3MW3A 4E8CA 1FMD1 3B9IA 1AXKA 1UOGA 3OYWB 5A6QA 4L11A 2C9KA 2ERFA 1VE0A 5CIRA 4NUBA 3PVOA 2SLIA 1W99A 4URTA 2HEVF 4EZ4A 4QQOA 1O3TA 1NA1C 2MEV1 3AMHA 4Q27A 4K8RB 4NRMA 3OG2A 4QDQA 4CU6A 5L7OA 4P14A 4LHNA 5FYYA 1F5JA 1QJU1 3OGRA 1S2KA 4RYDA 1JYXA 2CV6A 1CAVA 1VAMA 4LOTA 4MV2A 5FBJA 4YW3A 3FHIB 4FFGA 3WR0A 5JSPA 2UYAA 3E5QA 4AEDC 1YQ8A 2VG9A 3NVCA 5CB7A 1XC6A 3GGLA 3WDWA 2QNKA 5CU1A 4MOAA 1VR3A 4P9LA 2VJXA 2WAOA 2QQPA 3I97A 4AFDA 2IVJA 3ZXDA 1A34A 4H55A 1HDKA 4RD7A 3WOGA 3HMYA 1QXPA 4C1WA 3ON7A 1U5IA 4YW7A 3BN6A 3DKWA 1PGW1 1AL23 1HRI1 3AZXA 2VOTA 4D7SA 1FT9A 1WCSA 1IKQA 3O0WA 1L7LA 1REDA 3CZUA 2D3SA 1J3QA 1Q8PA 2QQWA 4QWNA 5FYBA 1SQ4A 4NAMA 5FP3A 1T6BX 4L8QA 3VBOC 2BVVA 5ISLA 4QPWA 4Y1ZA 2W87A 1UZWA 2B9VA 2WNVB 4RS5B 5E89A 1GZWA 1X82A 3M3CA 4K9SA 3BKZA 1ZNPA 4YGEA 2VY0A 5EXOA 1W03A 4XFFA 2W1WA 5DN2A 3WQ1A 1C5IA 3H9AA 2P6CA 3R4UA 3I2IA 4EN0A 4I3GA 1WZXA 3POEA 3VDDA 3J9SA 2XJQA 3IIAA 4H2AA 1W2OA 1LOAA 4E2QA 3LEKA 3JXSA 1W8WA 2OUJA 5FY8A 2LALA 4EYUA 4K8FA 5LATA 3W58A 1VBB1 3OD4A 5EJ1B 1DQ4A 1ALYA 4ARXA 4CRQA 5A32A 1ND2B 2Y38A 4LT5A 4KG0A 4JRAA 1CONA 1X8EA 1OOPB 1XB9A 1SPPB 2YROA 2ZS6B 5FXZA 2XBO2 4B1MA 1WWYA 1HB1A 2HH9A 4LBLA 2FBEA 2JD4A 3WSOA 4CUBA 1ZZCA 4C8DA 4XEZA 5FOBB 3ALQA 1U12A 4Q5OA 3VD5A 3MFAA 2QE3A 3NAPB 4CU7A 4KWLA 4CDUB 1UY4A 1AYN2 1HRV3 2A3XA 3P6BA 4R52A 4UT5A 5LEJA 3RWNA 2AEYA 1EYBA 4C1XA 4DRRA 2UURA 2BFUL 1VBD3 2UWAA 4DEVA 2B5HA 5JMCA 1RHI1 3T0BA 1CAWA 4DXZA 3EQEA 2H6BA 4RN5A 3U0ZA 2W92A 4B4PA 1OI6A 4UFHA 1OFSA 3LSEA 4CCNA 4ASMB 1UOJA 4IV1A 4UFJA 5LW9A 2BYVE 2JB8A 3LKJA 1M4WA 1AXZA 2DVDA 1Z0HA 2HYKA 3LFIA 1RUH1 4DB5A 2VQ0A 1FPN1 2W1UA 3ZYIB 2RJ2A 3CLPA 5DUVA 5KBFA 3H42B 1IKPA 3QH7A 1OFNA 2A75A 2BNMA 5JI7A 5IYYA 4HK8A 4JTOA 1ODMA 2JG9C 2FCTA 1N3PA 3AB0A 3HEIA 4LO6B 1SLAA 1YIPA 2R063 3SC7X 5FZOB 1HXS2 5JDBA 4TZDA 2RS53 4BLJA
chains in the Genus database with same CATH topology
1VMFA 1VPHA 1XBFA 2P6CA 1VMHA 2P6HA 1VMJA 2CU5A 1VE0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VMF A;  1VPH A;  1XBF A;  2P6C A;  1VMH A;  2P6H A;  1VMJ A;  2CU5 A;  1VE0 A; 
#chains in the Genus database with same CATH topology
 5CVR A;  1SFY A;  1JYN A;  3FLP A;  4Q2F A;  3SHR A;  1O91 A;  4LE4 A;  1GR3 A;  4UWD A;  2BRT A;  2R07 2;  3OPZ A;  4YG3 A;  4AR2 A;  3PJQ A;  2WJS A;  1UQX A;  4Q1R A;  2BFU S;  4XXP A;  1COV 2;  4X8N A;  3MO4 A;  4CP9 B;  2JD9 A;  1FMD 2;  5SV8 A;  2HWB 2;  4CXW A;  3VDC A;  2VQU A;  5J7M A;  1AR8 3;  4GWM A;  3BTX A;  1DBN A;  1AR6 3;  1KXG A;  1US3 A;  5FMB A;  1KFU L;  1QHD A;  1TZO A;  1W8N A;  3PNA A;  2E53 A;  1G9C A;  2EXI A;  4I0A A;  4IE4 A;  3NNM A;  4MLO A;  4PIZ A;  4A42 A;  1V6O A;  2XJS A;  1K5M A;  5C9A A;  3TRS B;  4QXH A;  3RYR A;  2ZML A;  4XF4 A;  1W6N A;  3T30 A;  4AHX A;  5FO9 B;  2BBA A;  4BK5 A;  4R4Z A;  5F9T A;  3ROU A;  3RVH A;  5J48 A;  4COW A;  1QJU 2;  1GU3 A;  3ENR A;  1XNC A;  4QM9 A;  1XPW A;  3ACL A;  2NQY A;  1AX2 A;  1POV 1;  4XJ9 A;  2CGO A;  1IQD C;  1IPJ A;  1OUX A;  5FYV A;  4HVQ A;  4ISR A;  1HN1 A;  2ZAA A;  5L7O C;  4LBO A;  4HOO A;  2NMN A;  3KV5 A;  3V0B A;  4JKL A;  3WW1 A;  5EQU A;  1U5Z A;  3CIH A;  1KS5 A;  4LK7 A;  5F3C A;  2LRP A;  3CQO A;  3AMM A;  5CEH A;  3Q8B A;  3O1O A;  3O1S A;  1BVV A;  2RM2 3;  3HVD A;  3LSD A;  2VM9 A;  4LKF A;  1QEX A;  3ZXE A;  3CO2 A;  3J8F 2;  4YG0 A;  1RUG 1;  2D6M A;  4H3W A;  3WIN E;  1W2A X;  4YGB A;  2QZ3 A;  4M0H A;  5KHK A;  3DCQ A;  4XFG A;  4MHR A;  4BQ1 A;  4YZ1 A;  4V2V A;  4MGQ A;  5KHG A;  1B35 B;  2WWU A;  2JDH A;  3AYA A;  4QGN A;  1YHF A;  4LUK A;  3B5L B;  3N9P A;  3OEA A;  4XUN A;  2P3I A;  1GZC A;  3A22 A;  4IE5 A;  3MW2 A;  1Y43 B;  5DUW A;  1XSR A;  2PAE A;  4PHZ A;  3WD5 A;  5AVP A;  3ZFF A;  1R64 A;  3OTF A;  1V6K A;  1J3P A;  3ZYB A;  4BDV B;  5K8S A;  3VZO A;  4GMP 3;  4OMC A;  4O65 A;  2ZGS A;  3B7M A;  3VBS A;  5KC6 A;  1VRB A;  2W5F A;  3NWK A;  5FYH A;  5F5Q A;  1PGL 1;  2RS1 3;  4JGY B;  4KWU A;  4K7J A;  2X29 A;  4YW6 A;  1VBB 2;  4UBH A;  5FY1 A;  4JDM A;  4AEM A;  1VJ2 A;  1CPM A;  1UOF A;  2HWC 2;  3PLQ A;  5G05 L;  4D94 A;  2GC0 A;  2RG4 A;  2W52 A;  2WR9 A;  3WNM A;  5A1L A;  3T3Y A;  3LE0 A;  3VDD C;  3POB A;  3UGH A;  1F8V A;  1LU2 A;  2RR1 3;  5CKQ A;  2QDN A;  1GZT A;  1VBE 1;  2R30 A;  1PM4 A;  3S30 A;  2WT2 A;  1C4R A;  3G7D A;  5FO7 B;  5JMO A;  2XJU A;  1FX5 A;  5L9R A;  2H0V A;  3OY8 B;  4XMI A;  1XNK A;  3FJS A;  4XBQ A;  1O3S A;  2XML A;  4PI0 A;  2VCC A;  2Z4F A;  4QQ2 A;  2C6S A;  2EXK A;  4KWK A;  4MHU A;  4Y4Y A;  1VMF A;  4HON A;  2RS3 1;  4MXV A;  3RS6 A;  1APN A;  4A7Z A;  2ARX A;  2QQJ A;  3VGI A;  1YQ2 A;  4QPG A;  4BA6 A;  1D4M 1;  4R4X A;  4QQH A;  4LO5 B;  3MEP A;  3ZMN A;  3G6J B;  1QF3 A;  2E7T A;  4V2W A;  3GBG A;  1RHI 2;  2A3W A;  4YLZ A;  1NZC A;  1OA3 A;  1JZ4 A;  5DPN A;  1G86 A;  2ENR A;  2AAC A;  1UMZ A;  3VBR B;  4CSW A;  1VRH 2;  2HJI A;  1RUJ 1;  4I0B A;  2DCZ A;  5K0U C;  4W8J A;  4XJZ A;  2GP3 A;  3WDX A;  5C3Q A;  1WW6 A;  2I45 A;  5EYY A;  1AR7 2;  3DV8 A;  3K4D A;  1SLL A;  1N47 A;  2KM2 A;  3GJA A;  3U14 A;  5J96 B;  1DYO A;  1RUF 1;  5IK8 A;  1LHU A;  3HJR A;  1HB2 A;  1Z78 A;  3E1F 1;  1UXX X;  3WNO A;  5C4W C;  2YC0 A;  2YZ4 A;  4XHX A;  1UWW A;  3UKV A;  4E4Z A;  1HN0 A;  3E5U A;  4M0N A;  1LU1 A;  4AW7 A;  2A6Z A;  4BQX A;  3MZH A;  2VZP A;  1BMV 1;  4SBV A;  1QJY 2;  5FP7 A;  3J7N A;  4QKB A;  3I3M A;  1JOD A;  2A70 A;  2HWD 1;  3OPW A;  3P5B A;  4EN6 B;  1JU3 A;  1YFW A;  4Y22 A;  2ZGL A;  1BK1 A;  2BNN A;  4XAB A;  2QQK A;  1U5X A;  2IXC A;  5CKM A;  4MZU A;  5CFC C;  1W6M B;  2D3P A;  4FFF A;  1SAC A;  3CEW A;  4JX0 A;  2GC3 A;  1BEV 3;  4A7K A;  2WC2 A;  3ZYJ B;  1YNA A;  3VD7 A;  2ZXQ A;  4IES A;  3RZK A;  1UOB A;  3HD8 B;  1YO8 A;  2VOX A;  4JGZ B;  1EV1 1;  5CFD A;  1SCR A;  2KR2 A;  1W0P A;  1OPM A;  3RMY A;  4N53 B;  3RG0 A;  4FXG B;  3UK9 A;  4Q4V 1;  5HCH A;  5HCA A;  5C5T A;  3ACI A;  1WCD J;  5FMO L;  3URF A;  4KBB A;  4FPH A;  5FY0 A;  5GZD A;  3S7I A;  4YW5 A;  1S0C A;  4Y24 A;  5GLZ A;  3AK0 A;  5JIU A;  4F3J A;  1QMJ A;  4W4Z A;  4LE3 A;  5IVJ A;  3B3Q E;  5C8C B;  5JOX A;  4QQP A;  1UY0 A;  4LO8 A;  3I2H A;  1ZM1 A;  4HLT A;  4YZ3 A;  3KQ4 B;  4HKO A;  5JOY A;  2XJT A;  1W3V A;  2VMH A;  3C7O A;  3PUA A;  4RR3 C;  4AHW A;  4EQV A;  4WM8 B;  1JU4 A;  3T4V A;  1AHS A;  4IEW A;  1UAI A;  3ZVX A;  2YV8 A;  3QCW A;  4L97 A;  1WME A;  4R9D A;  2QBX A;  4CUG A;  3AVR A;  3FX3 A;  3R4D B;  4Y20 A;  1TMF 1;  4DUV A;  3SH3 A;  1SMV A;  1ACC A;  3D6E A;  2GNB A;  1O5L A;  2CDO A;  2Q5T A;  2VNR A;  2J22 A;  2WS9 3;  2DV9 A;  3I4I A;  2GDF A;  4QX8 A;  5FTT C;  3POY A;  4AGR A;  2AC1 A;  2VZS A;  5C3R A;  4Z1V A;  1J1L A;  1MZ5 A;  1PNG A;  4GIQ A;  3CDZ B;  4FT8 A;  1OKQ A;  4BQY A;  3MIB A;  3WF3 A;  2CGP A;  4XFC A;  5FMC A;  4Q4X 3;  1DCS A;  1RIT A;  5T5P A;  3S7E A;  3I49 A;  1D2S A;  3U10 A;  1UZY A;  4HVO A;  3MIG A;  4CEY C;  3III A;  1RC6 A;  3B93 A;  3JBG 1;  1DQ0 A;  3K3O A;  4WV8 A;  5FMO S;  4LLF A;  3RQ0 A;  1PIV 3;  1W2U A;  2CDP A;  5BNN A;  3GJB A;  3GZU C;  3K4Z A;  4XTM A;  5JCT A;  1LRH A;  2VVD A;  2IXH A;  1RUC 2;  5F37 A;  2D97 A;  3NV4 A;  5FOJ B;  2QQL A;  5F39 A;  4DXR A;  3BI3 A;  5I0S A;  4DRV A;  1VB4 A;  2E6V A;  2P34 A;  5C33 A;  4MXW A;  4RHV 3;  5GJ6 A;  4R9C A;  4AQ2 A;  1QJX 1;  4BM8 A;  3IMN A;  3T08 A;  2FCV A;  4IV3 B;  4LO7 A;  5FPZ A;  4CEW B;  5IVC A;  1ND3 A;  2ZKL A;  5BYN A;  1H1M A;  4EE2 A;  1W06 A;  5FRE A;  2IC1 A;  2EF6 A;  5A3U A;  4JV4 A;  4CPB D;  1ZYB A;  1X36 A;  2BDR A;  4FSJ A;  1PGL 2;  4YWA A;  5LA0 A;  1G6N A;  3VZL A;  2HWE 1;  2ZX1 A;  4BQ5 A;  2ZOE B;  3QOP A;  1E5R A;  3JD7 3;  3W59 A;  3MPB A;  3I2K A;  5G04 L;  2ZKN A;  2RMU 2;  4LOS A;  3CHX A;  1RUE 1;  1AUY A;  1GP4 A;  1K12 A;  3GAL A;  2QQV A;  2VBB A;  1J58 A;  3WNL A;  2YPD A;  4BZ4 A;  1VBE 2;  5FQ0 A;  3WQ7 A;  4P5H A;  1RUI 1;  5FZ8 A;  5IVE A;  1WMF A;  4Q26 A;  3U75 A;  4AL9 A;  3KB5 A;  3WQ0 A;  4ZS2 A;  3POJ A;  2MEV 3;  1PZ9 A;  4MUV A;  3D82 A;  2J7M A;  4CDQ B;  4GH4 A;  1PK6 C;  1YIF A;  3F2Z A;  3M3I A;  1RUD 1;  1RMU 2;  3HT2 A;  3LEG A;  4HFS A;  3T1M A;  1WLC A;  4LKS A;  1X7N A;  3I59 A;  3USU A;  2J1V A;  4CDX A;  2WNU C;  3JB8 A;  3KT7 A;  5ACA 1;  4XIO A;  2JDZ A;  3WCS A;  1OLR A;  3U11 A;  1LHO A;  3AYD A;  3KCY A;  4NHK A;  4BB3 A;  4Q4W 1;  4OHY A;  1UPI A;  3ILR A;  4GWN A;  4LBK A;  5LA1 A;  2XJP A;  2LTN A;  2Z79 A;  1YQ6 A;  3HNM A;  2J1T A;  4N43 C;  4TYS A;  1UZZ A;  2D6L X;  4NHL A;  3VBF C;  3ITQ A;  4Q4Y 1;  1FOD 1;  2LRO A;  5DAB A;  1MS8 A;  4NJ4 A;  1R1A 3;  5GLU A;  4C0H A;  4JC1 A;  4FAG A;  4ZZ8 A;  5EPA A;  3E6B A;  3WUD A;  1YUD A;  4GZ9 A;  4XVH A;  1RUF 2;  1MEC 1;  1NA1 A;  4QX1 A;  2XVL A;  4BQ4 A;  1ULP A;  4XAC A;  1YXW A;  1HRI 3;  3DEM A;  4LUM A;  2A71 A;  4IQP A;  5BXX A;  3C3V A;  3VHR A;  1LEM A;  2XVK A;  3ATG A;  5A6Z A;  3LB9 A;  2PHF A;  3H7J A;  1EAH 1;  2HWD 2;  3S57 A;  2X5I B;  1WLD A;  5DDJ 1;  2K9Z A;  3KGZ A;  3FMG A;  3N9O A;  3NST A;  3NW4 A;  4AED A;  2ZGU A;  1YI7 A;  1PMJ X;  1W6Q B;  3WG2 A;  4IND A;  3H8R A;  3S5A A;  1XE8 A;  4LNV A;  5FJH A;  1OKO A;  2KA3 A;  1UY1 A;  2OKX A;  3ZYF A;  5J1X A;  5EIY B;  4FP3 A;  3WHT A;  4BIO A;  5JVV A;  1ZBE 1;  3ZN4 A;  1LED A;  3F95 A;  3HBK A;  3HT1 A;  5D2A A;  1ZBA 2;  5JAX A;  1WLT A;  4GJZ A;  1AX0 A;  4NRP A;  5GZE A;  4I3P A;  3H3L A;  1NCR B;  1ZRE A;  4JHT A;  4YFW A;  5FBZ A;  1IOA A;  2VZT A;  3FHA A;  2FMY A;  3ACH A;  2K2S A;  2BWC A;  2ZEZ A;  4YVW B;  2PMW B;  1JYT A;  4HKW A;  4LA2 A;  4A6S A;  3CJI A;  3JZV A;  3O7O A;  1C8M 1;  3DL3 A;  1PHM A;  2VNG A;  3SH4 A;  4LA3 A;  3SEP A;  2FDK A;  3WZ1 A;  2BTV C;  1N1V A;  2DUO A;  1ULD A;  2DVF A;  2L9L A;  3OBZ A;  4KNC A;  2Q8E A;  3U07 A;  3WG1 A;  3JCI A;  1EUT A;  3RWK X;  3M3O A;  3T2Q A;  2A5Z A;  1AYM 1;  2VUA A;  2WYS A;  4P02 B;  3ZR5 A;  1R1Z A;  5FZI A;  1O5U A;  2EAL A;  5A3T A;  3LA3 A;  2B9U A;  4M3C F;  4XBL A;  3KD4 A;  4L9B A;  1ZRC A;  2VVF A;  3R6S A;  4UW5 A;  5EV7 A;  4QPI B;  3WXP A;  1S2B A;  2C4X A;  3LOB A;  4AFB A;  4AI8 A;  4D6Q A;  4Z07 A;  4UOJ A;  3ME2 A;  1PGS A;  4LK6 A;  4NOT A;  3FZ3 A;  4ES8 A;  1JYW A;  3ES4 A;  3HN1 A;  1VBC 3;  2CTV A;  1FAY A;  3ZSE A;  2PN5 A;  3UGF A;  5LK7 B;  3NKT A;  3TB0 A;  2WDB A;  3KVA A;  4PDW A;  2QQO A;  3C8X A;  4GB3 1;  5JZG B;  4RQP B;  5JXG A;  1NLR A;  2GND A;  2ZEW A;  4HG6 B;  4L92 A;  4QB6 A;  4A7Y A;  3JBG 2;  1YWK A;  3MHZ A;  4I09 A;  5DAQ A;  1W8T A;  2GNM A;  4F8A A;  5I93 A;  1C28 A;  1RUH 3;  1ULG A;  1W8U A;  1FPN 3;  5D1I A;  1OLM E;  2MNG A;  5LBE A;  4PF1 A;  3WLU A;  5A33 B;  4WM7 C;  4N9H A;  5AVA A;  3AMN A;  2VUC A;  2XBO 1;  2CWS A;  1QJX 2;  4OYU A;  1I1E A;  1UIJ A;  5J3U A;  1KFX L;  1QH7 A;  5CIS A;  4QHO A;  4KWJ A;  4YYO A;  2YPJ A;  3PMS A;  2PHX A;  4K20 A;  2DYC A;  1UU6 A;  1H2L A;  2ORZ A;  4EWA A;  3RNS A;  4B4Q A;  2W9X A;  3D0J A;  2JEC A;  4W6Y A;  4DUW A;  5ABJ A;  5C7G A;  5AC9 3;  4A44 A;  2HWE 2;  4COY A;  5IAV A;  3RZL A;  1W2T A;  5CNA A;  5FZL A;  4XHB A;  4QXK A;  3DPR A;  3ZYR A;  1RJ7 A;  5BNO B;  3PU8 A;  5HPO A;  5M0T A;  1OC1 A;  4PBP A;  1Q3E A;  5DZE A;  3EJK A;  1NCQ B;  3AKS A;  1XNA A;  4WVM A;  1RUI 2;  3TBD A;  1G8W A;  1XYO A;  3M1H A;  1WGP A;  5DAV A;  5A7P A;  2X53 S;  3AYE A;  3MID A;  3OD0 A;  2FHR A;  3JQW A;  2O0O A;  1LGN A;  2LW8 A;  3GDB A;  2JG9 A;  4GUL A;  4OZX A;  1QKQ A;  3SNM A;  3VUO A;  2JE7 A;  4KBZ A;  1Q8S A;  1DLL A;  2AH2 A;  2A6X A;  4MVT A;  2WLP A;  5E16 A;  4LBQ B;  1QXR A;  4Y5Z 0;  2JIG A;  1WA6 X;  2D5H A;  4NWV A;  2DFB A;  5I8Y A;  5J36 A;  3MUZ 1;  5A3P A;  1YCI A;  4PT6 A;  1Q43 A;  3DYO A;  3ZIX A;  2QJV A;  2JB4 A;  2OQ6 A;  4HSL A;  5FZ0 A;  3U37 A;  5ACA 2;  2CSG A;  4XMA A;  1S0G A;  4HT1 T;  3NL1 A;  4XET A;  1H1A A;  4Q4W 2;  2VGD A;  3BTA A;  1GKB A;  3FHQ A;  4B4R A;  1RVF 2;  2E63 A;  2VNO A;  1UX6 A;  1OLQ A;  2ZA9 A;  1GOF A;  2EIG A;  5IAX A;  1A3K A;  1FV3 A;  1FOD 2;  1Y9G A;  1W0O A;  5B4X A;  4CDX C;  2GN3 A;  1MQT B;  1UYX A;  1Z7S 2;  2QCS B;  4D8M A;  1SEF A;  3ZFE B;  3WDV A;  5BUV A;  2NM1 A;  3O1R A;  2WO7 A;  3LA2 A;  4BU2 A;  2PXJ A;  1AR9 3;  1COV 1;  1RUG 3;  5JXJ A;  3T0A A;  2HWB 1;  3FBM A;  3GZT B;  3GM8 A;  3WP4 A;  3HIF A;  1C1F A;  3I8T A;  1EAH 2;  1AZD A;  2R04 1;  3I3E A;  3RMX A;  5L19 A;  5DDJ 2;  3C7H A;  5IAT A;  1UMI A;  3OUI A;  5I91 A;  1HB4 A;  2ARE A;  2NP0 A;  3VD9 A;  3ZXK A;  5A80 A;  2VCM A;  3PL0 A;  3OJB A;  5T5L A;  1PO2 3;  5F5I A;  1JUI A;  5FZD A;  1Y9Q A;  5FZK A;  3ZLI A;  1H8T B;  4DS0 A;  4QT6 A;  1ZBE 2;  2Y64 A;  5CYY A;  5FLI A;  4LJH A;  4ATE A;  4XF0 A;  4NHY A;  3PJY A;  4J6G A;  1DG6 A;  2CNA A;  5FLH A;  2OX0 A;  1HJG A;  4M3C B;  2ZX0 A;  5CKN A;  1GP6 A;  4KI5 M;  5FFO C;  2Q0A A;  2BGO A;  2J1A A;  3D4K A;  2W0X A;  1C8M 2;  4IEX A;  4AFC A;  2Q1F A;  1SDD B;  1WD4 A;  2NN8 A;  4I30 A;  5F3I A;  1PVX A;  2H6C A;  2AUY A;  3IB3 A;  3ZIW A;  4CP1 A;  3H1Y A;  5CZK A;  1CAU B;  4OFG A;  1CES A;  4P9G A;  1AYM 2;  1ASJ 1;  1SCS A;  1VAK A;  1XNT A;  2XJR A;  4KU7 A;  5BPX A;  3FE5 A;  1L3J A;  2G9F A;  2BER A;  3J8F 1;  4FOY A;  2YU1 A;  1QY4 A;  4RGK A;  3SKV A;  2W39 A;  4MX3 A;  3ZFG C;  3CJI C;  4IEU A;  2XUE A;  4FTS A;  3VZJ A;  2QQI A;  3IAP A;  5LWB A;  2RS3 3;  3K3N A;  1SPP A;  4CDW B;  1VAV A;  2RDQ A;  2BVB A;  4XJU A;  3O1T A;  2VZ1 A;  1D4M 3;  5DAW A;  4BQ3 A;  5DG2 A;  3IPV A;  4YM1 A;  4BXF A;  3MW4 A;  4AEK A;  2R49 A;  1REF A;  2R6Q A;  1GZ9 A;  2HWF 1;  4CDU A;  4E9K A;  1RUJ 3;  2NZ9 A;  4GB3 2;  1DDL A;  2AZ5 A;  1SBE A;  2CYF A;  4FQ4 A;  4JZR A;  4Q1P A;  1JZ5 A;  3DN7 A;  2WII B;  3H3Z A;  3WDT A;  4LBQ D;  5L7O B;  4HPK A;  3E97 A;  3CMG A;  1R08 3;  1AJK A;  2VVE A;  3OSD A;  1S0F A;  4AGG A;  4BIF A;  1JXN A;  4CU8 A;  3WEZ A;  5FQ0 B;  1CAV B;  3W5N A;  3FFQ A;  1PO1 2;  1W05 A;  2IVI B;  3MGU A;  2O8O A;  2VNV A;  4MSV A;  1JMU B;  5IVY A;  2HWC 1;  4HN1 A;  4PDW C;  3HPN A;  4XDO A;  2YXS A;  3S5Q A;  1XOY A;  2ES3 A;  4D3W A;  2WFF 3;  2P37 A;  3AMP A;  4A3X A;  1OF3 A;  3THC A;  3RJ2 X;  5FUI A;  3B94 A;  4Y1V A;  2Y8K A;  3L2Y A;  2HWD 3;  2ZX2 A;  3LPG A;  3POI A;  4XW3 A;  5BNP C;  3NV1 A;  1JH5 A;  1V9U 2;  4HAN A;  3WF2 A;  4WZF A;  3M3E A;  3FLT A;  3WUC A;  2VC9 A;  5FZA A;  3T4H B;  2BV4 A;  2Y6H A;  2ET7 A;  2ZGP A;  4ZS3 A;  5K0U A;  3KHB A;  3IDA A;  1POV 0;  2VUD A;  3UKN A;  4AVA A;  4FPJ A;  1IS3 A;  1EV1 3;  3OCP A;  4LMF A;  3VZN A;  2GN7 A;  4S2D A;  3MIH A;  4Q4V 3;  2DUQ A;  4K3U A;  5CAZ A;  4NHM A;  1GZW B;  4FO9 A;  2XL7 A;  3WY6 A;  5C4W A;  1VRH 1;  2XKP A;  5ABJ C;  1BBT 3;  4YVS C;  4P9I A;  3GF6 A;  5D8A A;  1DYK A;  1UZ0 A;  3TOJ A;  3A7Q A;  2EVX A;  3DPR C;  1AR7 1;  3POW A;  3ZX7 A;  3RZZ A;  1C8N A;  5HV0 A;  2EA7 A;  3VBU C;  2JG8 C;  1W8F A;  1OT5 A;  3H50 A;  5L73 A;  2V5D A;  1CVN A;  4C0B A;  5CFC A;  4MGZ E;  4NID A;  1URX A;  2D44 A;  2PQQ A;  2D40 A;  1LTE A;  1RIR A;  4Y1U A;  2RJL A;  3UV9 A;  1TMF 3;  3KF5 A;  3IKW A;  3ILF A;  5F2S A;  4Y1Y A;  5JPN B;  1QJY 1;  1ZZB A;  3B01 A;  3L9J T;  3N7M A;  4QHB A;  4X6Q B;  5A32 B;  1GMM A;  3ZDS A;  5D21 A;  4IW3 A;  5EJZ B;  3OEB A;  3OBA A;  3ZKY A;  5IHR A;  4XF1 A;  5FZM A;  5FZG A;  3GBF A;  3UKT A;  4E2S A;  4PF5 A;  2CHH A;  1IQA A;  3EYP A;  4HKL A;  1IPS A;  1TG7 A;  2ARC A;  3ZPO A;  4ZXK A;  2WO2 A;  1TE1 B;  4M4P A;  4LKE A;  2FD8 A;  1ZRR A;  3PIJ A;  3MBW A;  3ZXG A;  4RR3 A;  2W68 A;  3QH6 A;  3H8U A;  2ARA A;  4UF0 A;  2R04 2;  3P3P A;  2WAA A;  1A6C A;  3DGT A;  3SXW A;  1DGR N;  2OVU A;  5AFB A;  5J98 B;  1VBA 1;  3IWZ A;  1W6P A;  1OUS A;  1CAW B;  1MS5 A;  5F5C A;  3LIG A;  4FVV A;  3POG A;  4EV0 A;  1M06 G;  5FY9 A;  5FDB A;  1J59 A;  1LOC A;  3B02 A;  4EWD A;  4NWW A;  2C26 A;  4QX2 A;  4IV1 B;  1ULF A;  4YPJ A;  3FFZ A;  2QTW B;  1UX7 A;  2MHF A;  4FPO B;  1SZB A;  4MGK E;  3EO6 A;  2ARB A;  4DQA A;  1I3H A;  4F83 A;  3ZDV A;  5FYS A;  1QQP 1;  1GV9 A;  3N7J A;  3OBR A;  2DCK A;  4CXX A;  4Q0S A;  3VKO A;  1LOE A;  1XYN A;  4CEY A;  1NXD 1;  2RDS A;  3RYK A;  5FZ7 A;  1OA2 A;  2WQ8 A;  1RUE 3;  1W8H A;  2VE1 A;  5CAD A;  4URA A;  2WNV C;  2WZR 3;  3K75 B;  4H14 A;  4PLO A;  4RS5 C;  3VHN A;  3RZG A;  3HNY M;  3KF3 A;  1ASJ 2;  1ULO A;  3AKR A;  4P9W A;  4ET7 A;  3TYJ A;  4DUX A;  4B7K A;  1LEC A;  1ZZ6 A;  2D6N A;  5E88 A;  2GAL A;  2IXL A;  3OPT A;  2Y60 A;  4QHZ A;  4XZU G;  1GOH A;  4CE8 A;  4W50 A;  1D4V B;  5GM0 A;  2VAU A;  4OUE A;  1RUD 3;  4MG2 A;  2IXJ A;  3I2D A;  4XQD A;  2ZPX A;  4QDS A;  4DMI A;  2PAK A;  2PYT A;  1IS5 A;  4OLL A;  1LUL A;  1RUC 1;  2WO1 A;  2X05 A;  2BOI A;  2XGX A;  3MLJ A;  3ZOI A;  4AVB A;  2BUK A;  1LB2 A;  5LEK A;  5FPX A;  4RSU A;  1MS0 A;  2HWF 2;  2YYO A;  3EXU A;  2PTM A;  3N9M A;  1ND2 C;  4QGL A;  3SCF A;  4AFM A;  2VTX J;  2YMZ A;  5LY1 A;  5C9A B;  1OOP C;  2XLF A;  1K5M B;  2JKX A;  4CCK A;  3VBH B;  3ZPY A;  1W6N B;  4W6W A;  2W46 A;  4PJY A;  4Q4Y 3;  4EWE A;  3K2O A;  3B00 A;  4ATF A;  3WF4 A;  4ZPI A;  3ECQ A;  2VZ3 A;  2VL4 A;  2R32 A;  1MEC 3;  3NAP C;  1Q56 A;  4CDU C;  2ZHK A;  3NJX A;  4LHS A;  5FUP A;  2RMU 1;  3J4U H;  3RPQ A;  3ZSJ A;  1PK6 A;  5EYX A;  5JR7 B;  4J25 A;  2W94 A;  4Z8B A;  3PUI A;  5FRA A;  4BLI A;  1NQJ A;  2ZGN A;  5KR7 A;  3V0B B;  2QDR A;  2WNU A;  4QX5 A;  4CCE A;  4A3Z A;  5FZ3 A;  1MVQ A;  5A7N A;  3KVB A;  4CPB A;  5ERL A;  4LPL A;  4QAW A;  1GQH A;  5E1R A;  4XF3 A;  3PVN A;  4O9G A;  1LOF A;  1T2X A;  3BVC A;  1LHN A;  1RMU 1;  2ZHL A;  4OQ8 A;  2HYX A;  3ACF A;  4N43 A;  3VBF A;  2R16 A;  3LPF A;  2Q4S A;  5F3G A;  2VMC A;  4AI1 A;  1U0A A;  1GNY A;  2G4I A;  3M8L A;  1JYI A;  1FNZ A;  3AZW A;  4UW3 A;  4XUO A;  3VL8 A;  3ZR6 A;  3ZM8 A;  3VKN A;  4YM0 A;  2WRA A;  4AYU A;  5DUU A;  4QU2 A;  4GKY A;  1S55 A;  3ZFF B;  2BBV A;  5FPL A;  5FY5 A;  3KSC A;  5FZE A;  2E7A A;  1H9P A;  1W6O B;  4D7T A;  2VW2 A;  3JQX A;  4IXL A;  4LLO A;  4LUL A;  4MGT A;  1UY2 A;  4K6B A;  3N7L A;  2GZW A;  1AYM 3;  3VBS B;  5FZB A;  1K45 A;  1OQ1 A;  1US2 A;  2YB7 A;  5FCC A;  2XWB B;  5D8A C;  3AFK A;  1J1T A;  1DZQ A;  5A6Y A;  5C8C A;  1L7R A;  5FO8 B;  1MPX A;  1OMI A;  5GLW A;  2DBI A;  2ZGR A;  4PIY A;  4Q8K A;  4HXC A;  4XXA A;  2PHW A;  2JDM A;  3WCR A;  1RB8 G;  2FCU A;  4IEQ A;  1UKR A;  4IE0 A;  3ELN A;  3N9L A;  4NRQ A;  1CGP A;  1NXM A;  1YI9 A;  5H9P A;  2VZV A;  3LGR A;  2EIB A;  1W9S A;  3DXU A;  1WLW A;  2I74 A;  3KWV A;  3MI8 A;  4DY3 A;  1ZBA 1;  3BOW A;  4AXO A;  3O1P A;  1S4C A;  1SLT A;  3W20 A;  1S2E A;  5LBB A;  4QPG B;  3I2F A;  4OHZ A;  2Y0O A;  4CYD A;  2BNO A;  2VW1 A;  4KGQ A;  4BHP A;  5KXB A;  2Y6L A;  1VBA 2;  2DTW A;  5EZW A;  2FDH A;  3AJZ A;  2FDF A;  1SFP A;  4QX0 A;  1HQL A;  5FLJ A;  1ZRF A;  4EZH A;  3WW2 A;  1LAJ A;  1O3R A;  1JUH A;  2PQS A;  4JQR A;  2XPJ A;  2XBO 3;  2Z5W A;  3VKM A;  1HRV 1;  2GC1 A;  1S0I A;  5DXD A;  4AVV A;  4AQ6 A;  2DCY A;  3FN9 A;  2DU1 A;  2IWG B;  4XFA A;  4FTB A;  1VBD 1;  1Y4W A;  5CBL A;  2D43 A;  5FZ6 A;  1QQP 2;  4UXA A;  3MV0 1;  3SH5 A;  3ST7 A;  4FTE A;  4BK4 A;  1AYN 3;  2B45 X;  4U36 A;  3TN9 2;  1CJD A;  2R1D A;  4IDZ A;  2FZ1 A;  4OCT A;  1SLI A;  4J1X A;  2ZX4 A;  3POF A;  2ZBJ A;  1LKN A;  1JI6 A;  2YC2 A;  1B35 C;  3RDI A;  2QQU A;  1PVC 1;  2EID A;  4Y22 B;  3M2M A;  4HET A;  3GCX A;  4WM7 A;  3WG3 A;  4YRD A;  1X33 A;  1XBF A;  2D5F A;  2D6K A;  1DHK B;  4B1L A;  2WN2 A;  3EBR A;  4CTE A;  4ZKT B;  4H7M A;  4GQ7 A;  3VV1 A;  1VPH A;  1WW7 A;  3ZO0 B;  1KRI A;  3SCG A;  2PHD A;  3PUS A;  5CFD B;  1BQP A;  1CPN A;  4XAE A;  2VBD A;  1NYW A;  4YFZ A;  5FYC A;  1JOB A;  3MFC A;  1CIY A;  3KHC A;  5FPV A;  3I3B A;  2VR4 A;  3IAQ A;  3UET A;  4UW6 A;  5JR2 A;  1QJF A;  4IGQ A;  2CU5 A;  2OZJ A;  2R1B A;  3OUJ A;  1BLZ A;  3AL6 A;  3J7H A;  4QX7 A;  2VEC A;  2YC4 A;  1F15 A;  2BJS A;  3E6D A;  1HXS 3;  3KGL A;  4QQL A;  1G9A A;  3IDC B;  3WDY A;  2VZR A;  5C71 A;  3KT4 A;  1DQ1 A;  1AR8 1;  3W5M A;  2PLV 1;  2XWJ B;  1HLC A;  1XYP A;  3AMQ A;  1AR6 1;  5F2W A;  2R07 3;  1H2N A;  3LDK A;  1R09 1;  2X09 A;  3BGA A;  4UBG A;  1OQE A;  3RRD A;  4Y20 B;  1AVB A;  3POS A;  1COV 3;  2NMO A;  3O12 A;  2HBU A;  1FMD 3;  2G1M A;  4ITC A;  2HWB 3;  5FWE A;  4BMB A;  3CZJ A;  3TNQ A;  2JDU A;  5F6K A;  5E8A A;  5TSW A;  5I0T A;  1CAX A;  2E31 A;  1D7P M;  4NIH A;  5ANN A;  3WNN A;  4BQW A;  5T3N A;  4WVV A;  4FPL A;  2Y6K A;  4OI1 A;  3ZN6 A;  1UZV A;  5IVV A;  3KV6 A;  1V6J A;  2GP5 A;  4NHX A;  3T09 A;  1JHN A;  1UY3 A;  3VBR C;  1YQ5 A;  2WL1 A;  3RZJ A;  2YBS A;  3H0O A;  5IJR A;  2GH8 A;  5LZ6 A;  3I54 A;  1P8J A;  4JQT A;  2WT1 A;  5C6C A;  1UMH A;  2W2I A;  2JDK A;  2QUO A;  2WFP A;  1UYY A;  4M01 A;  3KZ4 C;  1QJU 3;  3A0N A;  4YZ2 A;  3SMH A;  3BTZ A;  2ZAB A;  1MZF A;  2FQP A;  5BNN B;  4ASL A;  2LM3 A;  1CX4 A;  1IHM A;  2ZGQ A;  4GKX A;  3U4X A;  2GMP A;  1DGW A;  2XJV A;  1UW8 A;  1JBC A;  3AP7 A;  3HAG A;  3NMB A;  4NIA A;  1TME 1;  1S0D A;  1AL2 2;  1LOF C;  1RVF 1;  1VB2 A;  3H7Y A;  3OOX A;  3VLB B;  3WQB A;  2W1S A;  5IFT A;  2O8Q A;  1YRZ A;  2P3Y A;  3BOP A;  4MXW B;  4OVE A;  4QKD A;  1UCX A;  3KV4 A;  5DAP A;  4YW4 A;  1ZA7 A;  4YM2 A;  4D0Q A;  1Z7S 1;  2WWS A;  1ND3 B;  5C5U A;  3V0A A;  1GSL A;  2ZHN A;  4XDQ A;  3IM0 A;  4ZU5 A;  2DVB A;  3T2P A;  3ZSL A;  4LEJ A;  3AKT A;  5DG1 A;  3J8F 3;  4YVW A;  5H9R A;  5C70 A;  3UNP A;  2D3R A;  1H6Y A;  3DYP A;  3OF1 A;  4LHL A;  4WVW A;  2V4V A;  4JGZ C;  2GAU A;  1SDW A;  2W95 A;  1H30 A;  2XDV A;  4FI9 A;  3WX5 A;  4ES9 A;  4C91 A;  2VZQ A;  4N53 C;  3WNX A;  4GMP 1;  1KJR A;  4OI0 A;  2IUW A;  1E5S A;  3PUR A;  1OF4 A;  2GH2 A;  2XLG A;  3PTY A;  4ZXE A;  4YZ5 A;  3ZXF A;  1SBD A;  4CCD A;  3TEY A;  5K7P A;  1BK0 A;  4A45 A;  4RFT 0;  4AZZ A;  5A70 A;  2WSU A;  5C8C C;  3BPZ A;  4UFK A;  3NJV A;  5KXC A;  2GU9 A;  4G3Y C;  4GH4 B;  4CCJ A;  4KL1 A;  3W21 A;  5CG9 A;  3V65 A;  1X50 A;  2OS2 A;  1F2N A;  1JN2 P;  3Q8E A;  4WM8 C;  3VZK A;  3M7A A;  5LRS A;  2F4P A;  3I59 B;  4YW2 A;  3USU B;  4CDX B;  3ASI A;  2XQR A;  1DQ2 A;  1VBB 3;  3TAY A;  2WZ8 A;  3RI8 A;  3ZFG A;  3NRU A;  2HWC 3;  2W91 A;  5FXW A;  5JZG A;  1W9Y A;  1LGC A;  2TBV A;  2ZMK A;  3PTR B;  2D7F A;  3TWI A;  3BUC A;  1HRV 2;  2LS6 A;  4MGY E;  4JHZ A;  3R0R A;  2A6Y A;  4GA9 A;  3EB7 A;  4KG8 A;  4AFA A;  5C3P A;  4LR4 A;  2E9Q A;  2XL9 A;  1VBD 2;  2BP6 A;  5FIX A;  4FQZ A;  3CL1 A;  2ZAH A;  3K4A A;  4LBJ A;  1NA1 B;  4IE7 A;  4CP2 A;  4A6O A;  1CZT A;  4UAP A;  4E4D X;  4P5Y A;  3M4F A;  3UYJ A;  1BJQ A;  3WW4 A;  1QNW A;  5IVF A;  4QPY A;  1OD3 A;  3VKF C;  4QM8 A;  1VIW B;  4I01 A;  4HL0 A;  1FNY A;  1RHI 3;  3Q8C A;  2QZ2 A;  1PVC 2;  2P6H A;  5GKA C;  5A7W B;  4COV A;  3QAC A;  4AED B;  4HSJ A;  1VRH 3;  1YFY A;  5FKB A;  3SCH A;  3O1U A;  1QU0 A;  3AP9 A;  1YYN A;  1XND A;  5JSO A;  2WUH A;  3SQO A;  2J1R A;  3I3Q A;  3LAG A;  3ZKU A;  5IVB A;  1A78 A;  4XUR A;  4DXS A;  2EAK A;  1AR7 3;  4CEW C;  1N1T A;  5KXD A;  1TNF A;  5BNO A;  1Y3T A;  1XE7 A;  5BNP A;  3OGG A;  1Y7B A;  2R06 2;  1DP0 A;  3MIE A;  2RS5 2;  1FXZ A;  2JDA A;  3IBM A;  5A7O A;  5A3N A;  1A8D A;  1PO1 1;  3LIH A;  4LOR A;  3NO8 A;  5A6X A;  4LKD A;  2WQZ C;  3TEZ A;  1LGB A;  1BHG A;  1BEV 1;  5LBC A;  2WSV A;  1K42 A;  4CCC A;  4XOG A;  1QJY 3;  1ZZ7 A;  1WBL A;  2Z2S B;  3VBO B;  4BCU A;  2ZGO A;  1V9U 1;  1RIN A;  2VMI A;  5GZC A;  5J09 A;  1W0N A;  4B3N A;  1AR8 2;  3GHM A;  3ZXA C;  2RDN A;  2TUN A;  3FWE A;  2PLV 2;  1D0H A;  3AM2 A;  1AR6 2;  4D6R A;  3R4S A;  5FZ9 A;  1R09 2;  3TEW A;  4YVS A;  1Q5O A;  5JLV A;  1OBN A;  1E5H A;  2RHP A;  3GXU A;  3AXE A;  4CDQ C;  3GCW A;  2I07 B;  1FI2 A;  3VBU A;  2R7E B;  3MIC A;  2JG8 A;  5FAX A;  4BJ0 A;  2Y33 A;  1GOG A;  1O8S A;  3IN9 A;  2XR4 A;  2VZU A;  3KT1 A;  2GME A;  4OI4 A;  4S2F A;  1MZE A;  5FK7 A;  5FXX A;  1F4A A;  1V6I A;  2Y6J A;  4YW1 A;  4QB2 A;  1OD5 A;  4AE2 A;  2UYB A;  3NNF A;  4PDW B;  4J1W A;  1H9W A;  1UXZ A;  5FR3 A;  2DUP A;  2RJK A;  1GFF 2;  1YFU A;  2VMG A;  1VLN A;  3OYW A;  2WS9 1;  3ACG A;  5FY4 A;  1XSQ A;  4GD4 A;  2A73 B;  4KQ7 A;  1POV 3;  4W65 A;  4AVS A;  1YJL A;  1ZRI A;  2B7Y A;  1UIK A;  2JXA A;  3V56 A;  3HN3 A;  5FP8 A;  4UFL A;  1TME 2;  2RM2 2;  2ZZQ A;  5JIA A;  4MH0 E;  2DTY A;  1ULE A;  2I2S A;  2JE8 A;  2OW4 A;  3HBZ A;  5FUN A;  4CVU A;  3THT A;  1AF9 A;  2P3K A;  4PLN A;  1KD7 A;  2WAB A;  1ONA A;  3N36 A;  3UGG A;  2QFE A;  3VB9 A;  5DAX A;  3PME A;  1W2N A;  2GNT A;  3C7E A;  2Q1Z B;  4AAP A;  2XON A;  2ZTN A;  2ZEX A;  2VUL A;  3ZYP A;  5F5A A;  5HXM A;  1DU3 D;  4AQT A;  4FAH A;  1NLQ A;  1YQC A;  2A6V A;  2BOJ A;  1N1S A;  4D6S A;  1C1L A;  1NT0 A;  3LEI A;  3RI9 A;  1KJL A;  4D7Y A;  1O4Z A;  2XXZ A;  3OB8 A;  4AHZ A;  1BXH A;  5J37 A;  3P3N A;  1UL9 A;  4HMZ A;  3WNK A;  3FUQ A;  3IZO A;  1OVS A;  3DPR B;  4DY5 A;  4QDR A;  2W3J A;  2EAA A;  5KHJ A;  1WCQ A;  4DIQ A;  1O4Y A;  1NCR C;  2WYF A;  4OI2 A;  4SLI A;  5SV5 A;  4WVM B;  1RUC 3;  4QXB A;  4E8D A;  3LA7 A;  1CR7 A;  2VD7 A;  1TQ5 A;  2VO5 A;  5T52 A;  2RS1 2;  4E2G A;  3AVS A;  4YVW C;  3O1M A;  2AEN A;  2JG9 B;  2PHL A;  1QOS A;  2Z69 A;  2WNE A;  3BOD A;  3JB4 C;  4BPZ A;  2Y6G A;  2WNV A;  1E57 A;  3A0K A;  3GBW A;  2ETE A;  3LQC A;  4N8M A;  4RS5 A;  3EMR A;  1GWL A;  4WZC A;  2OUH A;  2ZGK A;  1LEN A;  4Y26 A;  2RR1 2;  1CZV A;  3A4U A;  1LR5 A;  4NN0 A;  3ES1 A;  3NNJ A;  1QH6 A;  1YC6 1;  1KS4 A;  4OHX A;  4AHY A;  4XDP A;  5F3E A;  1SLC A;  1IS4 A;  4XJA A;  1EUU A;  1HB3 A;  2RMU 3;  1OVP A;  2UY9 A;  1WA4 A;  2VUJ A;  3CKH A;  3FLR A;  4P9X A;  2ADE A;  4QPI C;  5K9Y A;  1Q8Q A;  3ZXJ A;  4NMI A;  4XZP A;  1UNB A;  4P00 B;  1DF0 A;  4B29 A;  1VBE 3;  3M3Q A;  5A3M A;  1ZVF A;  1RXG A;  4E4S A;  2G19 A;  3O14 A;  2RDR A;  1EPZ A;  4NVP A;  4ERO A;  2ZGT A;  1PMH X;  3KQR A;  2DVG A;  2VH9 A;  4OUS A;  2VPV A;  4LBN A;  5A1F A;  4N90 A;  4JVA A;  4NRO A;  5T54 A;  4NPR A;  1DGR A;  1ND2 A;  1XU2 A;  4LQR A;  5EHD A;  3USS A;  4Z2A A;  1XQN A;  4RQP C;  3VKL A;  5JZG C;  1OOP A;  2OPW A;  2C5D A;  5A3W A;  1RMU 3;  3H8O A;  3BU7 A;  5HBA A;  3I3D A;  5FY7 A;  2RVA A;  1FYU A;  2VOK A;  4R9B A;  1D2Q A;  1Q8V A;  2C24 A;  2OII A;  3K51 A;  1R1A 1;  4OZO A;  2D6O X;  5H9S A;  4C90 A;  1IPK A;  3NAP A;  1AJO A;  4Q29 A;  4QX3 A;  5FV3 A;  1I5P A;  1I5Z A;  4FPY A;  3T1L A;  5IK7 A;  2OPK A;  3DYM A;  1YFX A;  1H8V A;  5KHH A;  4M00 A;  2YBP A;  1NX9 A;  5EFU A;  4CUC A;  1T6G C;  2OXB A;  4QKN A;  5C3O A;  1QDO A;  2XUM A;  3V64 A;  2YUE A;  3AYC A;  1POQ A;  2Q1M A;  3ZYG A;  3OGV A;  2ID4 A;  1RUF 3;  3DF0 A;  3N9Q A;  1RTV A;  5JPM B;  4HN0 A;  2JKB A;  4XE9 A;  1W9W A;  2K46 A;  3E6C C;  4FFH A;  1J84 A;  4XPV A;  4QB1 A;  1BEV 2;  2HEW F;  1NUK A;  3AXD A;  3D8C A;  2GC2 A;  1DZR A;  2HLE A;  2G9G A;  5BNO C;  2A6W A;  4AI2 A;  3THD A;  2VBP A;  3N35 A;  2YFZ A;  2ZGM A;  3VD3 A;  1NCQ C;  3QD6 A;  2PHT A;  1H2M A;  5LA2 A;  4Z92 B;  5JWP A;  4A4A A;  5A1A A;  3C2U A;  2V09 A;  2VTF A;  4QU1 A;  2ZZJ A;  1ZRD A;  1WMX A;  5DZF A;  2UU8 A;  4GAZ A;  5LBF A;  4BME A;  3AKQ A;  4ZU4 A;  5I8T A;  4IUG A;  1HV1 A;  4Y3O A;  5FZO A;  1QOT A;  4Z2W A;  1ZBA 3;  4R8H A;  1AX1 A;  4TLG A;  1JOJ A;  1RYY A;  1F35 A;  2V4A A;  3IPV B;  2TEP A;  2AR6 A;  2VW0 A;  3I2G A;  4OUL A;  3UT0 A;  1SG3 A;  4PLM A;  3D3A A;  3DUI A;  1NE6 A;  4XJ8 A;  2RE9 A;  4CP9 A;  3PHM A;  1ZZ8 A;  2CAV A;  1BYH A;  2WIN B;  3SEE A;  3VDD B;  1QGL A;  3B69 A;  4HPK B;  4IL7 A;  2WS9 2;  1HQW A;  4LHK A;  2JX9 A;  4FPE A;  2JIJ A;  1MQT C;  3VL9 A;  2SBA A;  1E5I A;  5T50 A;  1VBC 1;  4YG6 A;  3ZFE C;  5I0R A;  4JAA A;  5CG8 A;  2HKX A;  1K5J A;  4PCR A;  3VDB A;  3HQR A;  5KWR A;  4ARY A;  3U78 A;  1H0B A;  2DCJ A;  2OQ7 A;  3RZH A;  3OGJ A;  4Q4X 2;  3U4S A;  1W39 A;  1GWM A;  2VOV A;  3SIS A;  4XUP A;  1V6M A;  2WA3 A;  3ILN A;  3LF7 A;  5GLT A;  5IUQ A;  1HV0 A;  2WN3 A;  4FXK B;  2DBN A;  1HJF A;  5FMD A;  5HXV A;  5ANQ A;  1PIV 2;  1OLM A;  1PVC 3;  1STM A;  1A8M A;  2IZW A;  3KMH A;  1FV2 A;  4XIL A;  2YFU A;  5F6L B;  1JS9 A;  4E4H A;  3AZZ A;  5K0U B;  1H4G A;  5KC5 A;  4RHV 2;  3VD4 A;  3JBG 3;  1RXF A;  5BY5 A;  4N7I A;  1H8T C;  4XQ4 A;  2NLR A;  1W9T A;  3S6P A;  4RGA A;  2MPF A;  5IT6 A;  1UD1 A;  3IDE A;  4Q0U A;  1W8O A;  2P4E A;  2CY6 A;  4XCB A;  3RYP A;  4CCM A;  2YY1 A;  2YGM A;  2BEO A;  5C4W B;  5AC9 1;  3LCP A;  4OHW A;  3UL2 A;  1WW4 A;  1S1A A;  1PNF A;  2XHK A;  4L2N A;  1QJX 3;  3JD7 2;  3LFM A;  5D8A B;  2BPA 2;  3HOB A;  1W3X A;  1GP5 A;  2BWA A;  2ZAC A;  2Q8C A;  4PI2 A;  3O0X A;  1MS4 A;  1GNH A;  1NY7 2;  3H1M A;  1B35 A;  2VOW A;  3AZV A;  4F7Z A;  2JIC A;  3RZM A;  1HX6 A;  4H7L A;  1O8P A;  2PLV 3;  1LHV A;  5CFC B;  3D0S A;  1NAE A;  2F4L A;  2HWE 3;  5T5O A;  1JW6 A;  1GQP A;  1R09 3;  4UW4 A;  3TN9 1;  4NAO A;  1GUI A;  5I0D A;  2MEV 2;  5F8P A;  1JYC A;  3BYW A;  4CDW C;  1QWR A;  3VBH A;  5K4L A;  4D69 A;  2YG0 A;  5FP4 A;  1CWP A;  1RUI 3;  5C8W A;  3DKQ A;  2OA2 A;  3A21 A;  3JUU A;  4JGY A;  5T55 A;  4R9A A;  3LDB A;  1O59 A;  3HQU A;  1VAL A;  3KM5 A;  2XOM A;  4TWT A;  1MR5 A;  2Q30 A;  4FCA A;  4YAR A;  4LO4 B;  3WF1 A;  2VXJ A;  4XUT A;  2QKD A;  1L7Q A;  5HCF A;  4LIT A;  2Y26 A;  2XB6 C;  1C3H A;  2W1Q A;  5E6H A;  4LIU A;  4FP2 A;  5FYT A;  1NOV A;  4RR3 B;  3AL5 A;  4FFI A;  1JZ6 A;  1QJE A;  4UF0 B;  1R1A 2;  5A7Q A;  1F4H A;  2PAM A;  5EP9 A;  4B8E A;  5ACA 3;  1W28 A;  4IER A;  3NV2 A;  3OY8 A;  4KH9 A;  3CNA A;  4Q4W 3;  1W6P B;  4NO4 A;  3FUO A;  1RUN A;  1PGW 2;  1TME 3;  4MET A;  1HRI 2;  1OUR A;  1RVF 3;  5L9B A;  4AOC A;  4ZZ5 A;  2WT0 A;  5DMY A;  1AR9 1;  3LWC A;  4GAL A;  4Z82 A;  3S0M A;  5EJ3 A;  1GAN A;  3WDU A;  1DGL A;  4CCO A;  1FOD 3;  3N3H A;  3MF9 A;  3N7K A;  3MUY 1;  4GXL A;  3HQX A;  1Z7S 3;  4EN7 B;  3J26 N;  1NG0 A;  4XQW A;  2BGP A;  4GWJ A;  2B8M A;  3VBR A;  1HIX A;  4TXW A;  4U2A A;  3N4M A;  4Y4R A;  3MV1 1;  2ZJC A;  1LHW A;  3ZN5 A;  4QKF A;  5LK5 A;  3MYX A;  1PO2 1;  4CEY B;  5I0U A;  2P2K A;  1EAH 3;  1GLH A;  5DDJ 3;  1W6O A;  4HBN A;  5FKC A;  5FPB A;  3THP A;  5LB6 A;  1WMD A;  1O3Q A;  2Z42 A;  2HBT A;  3HNB M;  1SLB A;  1TNR A;  2XKO A;  3RFR A;  4XFI A;  1G7Y A;  1KDM A;  1WKY A;  3AJY A;  4O7X A;  2PA7 A;  3T2O A;  4BIS A;  5JOW A;  4AGV A;  5H9Q A;  2YDE A;  1WCK A;  1DQ5 A;  1U5Y A;  4E27 A;  1UO9 A;  4MAD A;  3IDB B;  1JZ8 A;  1ZBE 3;  3MF6 A;  1F5F A;  2QQN A;  4CCL A;  2XG3 A;  5LCW L;  3ABZ A;  5GLV A;  3VHO A;  2P1B A;  3TNP B;  4AK3 A;  1G9F A;  3UJO A;  1W6M A;  3J7L A;  4AG4 A;  4AQS A;  3WP3 A;  1AXY A;  1OHF A;  5FPU A;  1AL2 1;  3INA A;  4IGP A;  2Q8D A;  4NPM A;  4TTG A;  5IW0 A;  2EIE A;  5FPA A;  4JGZ A;  1C8M 3;  2EXH A;  3AX4 A;  1C57 A;  1DGW X;  1SHW B;  3SKJ E;  1MS3 A;  4N53 A;  1QDC A;  2VME A;  2XH6 A;  1AL0 G;  1NLS A;  1G9D A;  3CU7 A;  2DU0 A;  1MZ6 A;  1VBC 2;  2D6P A;  4TSV A;  4FBF A;  2KD7 A;  2P17 A;  4YNI A;  5A7S A;  4XCA A;  1G9B A;  1LOD A;  1ENX A;  1PK6 B;  2Y0I A;  1OXC A;  2TNF A;  4XYX A;  3AKP A;  1H6X A;  1PMI A;  4WM8 A;  1R08 1;  4I0W B;  2WNU B;  1RUH 2;  1X8M A;  2P5B A;  4PQQ A;  5FK8 A;  1JYV A;  4P9Y A;  1FPN 2;  4X8P A;  4NE9 A;  4GB3 3;  4HZF A;  2C1F A;  4OQ9 A;  2G9Z A;  4UI9 L;  1BVP 1;  1PX3 A;  4XUQ A;  3KCX A;  4UFI A;  2WFF 1;  4IEY A;  5T5J A;  4AEJ A;  4N43 B;  1W9F A;  2GSY A;  2V5Y A;  2UY8 A;  4IV1 C;  4QXC A;  3VBF B;  1N3O A;  4HVR A;  2EIC A;  1OQD A;  1TEI A;  3OUH A;  4MGS A;  2J1S A;  3APB A;  3RSJ A;  4IEZ A;  1S0E A;  4ASK A;  1PO1 3;  1XRU A;  1UPS A;  1B09 A;  3U1X A;  3GYD A;  1J3R A;  4DIN B;  3RJR A;  5AC9 2;  2BU9 A;  5FZ1 A;  5FXV A;  2H0B A;  3ZYH A;  4NII A;  5BV6 A;  4AI0 A;  3K46 A;  4K1Z A;  4DOU A;  1LES A;  1V9U 3;  4RL7 A;  4ZY9 A;  1PZ7 A;  4WBB A;  1VMJ A;  2DFC A;  2WZE A;  1WD3 A;  4DFS A;  1WUV A;  4XC9 A;  3IT8 A;  2ZEY A;  1GWK A;  2BGC A;  2ZMN A;  5IK5 A;  3BCW A;  2DVA A;  4YSF A;  1BBT 1;  4BE3 A;  1QNY A;  3AC0 A;  4K1Y A;  4KGG A;  5FYU A;  4L0P A;  2OZ6 A;  4IV3 A;  5LA9 A;  3AP5 A;  3IMM A;  4CEW A;  3BIE A;  2B42 B;  4FOW A;  3OBT A;  3KLS A;  4DO0 A;  1GBG A;  1CIW A;  3AP6 A;  2CAU A;  4K21 A;  5FZH A;  5A3O A;  3MDP A;  2FZ2 A;  1MAC A;  2E26 A;  1ZA4 A;  4O9E A;  5GZG A;  1J83 A;  1IGO A;  2BW8 A;  1QXJ A;  4P08 A;  4JKK A;  1OH3 A;  1W8Z A;  2FDJ A;  1LCL A;  1UYZ A;  3NJZ A;  5C9A C;  2R0F A;  4MGI E;  1K5M C;  2R06 1;  4N7U A;  3VBH C;  2E33 A;  3MPP G;  2RS5 1;  3WVJ A;  1GIC A;  1ENR A;  3VHP A;  1TVG A;  1XU1 A;  2WNO A;  2A3Y A;  4JGY C;  4YM3 A;  5CA6 A;  4IEV A;  3JU9 A;  4M3C E;  4XF9 A;  4LIV A;  5FP9 A;  2VMD A;  5JUV A;  2X8K A;  4GMP 0;  1CZS A;  4MYE A;  4KMQ A;  4CDQ A;  5HCB A;  3PVE A;  1IG3 A;  2DDU A;  4ISQ A;  1BCX A;  4IEO A;  1AR9 2;  3WW3 A;  2DCT A;  1RUG 2;  2DWR A;  1RL3 A;  1IZ3 A;  1OPO A;  1QJZ A;  1UYP A;  2JE9 A;  3AFG A;  4NR1 A;  2PHU A;  4RFR B;  1PM7 A;  1X9P A;  3EHK A;  5IFP A;  1LJ7 A;  2BZD A;  3H1W A;  5JOZ A;  2WWJ A;  3E5X A;  5DUX A;  1XNB A;  2PHR A;  5AFE A;  5C3S A;  3FL7 A;  4NPL A;  2Y6F A;  3BTY A;  2VXR A;  1V70 A;  5FYM A;  2E32 A;  5F32 A;  4FPC A;  2VTX A;  1PO2 2;  1UF2 C;  2YBK A;  3O0V A;  5FWJ A;  1ENS A;  2R04 3;  4TN7 A;  4ORF A;  4AI3 A;  3LZZ A;  4BXS V;  5F1R A;  5JI9 A;  4Y5T A;  4B7E A;  3SIT A;  1GQG A;  2Q8O A;  2OT7 A;  2P3J A;  4PQ9 A;  5B2G B;  1UU5 A;  4WM7 B;  5B4N A;  2AYH A;  4XFB A;  5HI0 A;  1N1Y A;  4CXY A;  3BU0 A;  3KCC A;  1H4H A;  1W90 A;  3H3U A;  3Q9O A;  3ZFF C;  4XTP A;  1XJA A;  4GWI A;  3NV3 A;  2X5I A;  4IEP A;  4Y1X A;  1W04 A;  1XE0 A;  2UWC A;  4JDO A;  2RV9 A;  4RGG A;  3ZSK A;  5FYI A;  2WZR 1;  1RGS A;  3QBQ A;  1Q8O A;  3WP6 A;  1DYP A;  3VBS C;  1NE4 A;  1JTZ X;  1OH4 A;  1W6Q A;  2E51 A;  2RM2 1;  2Y34 A;  2CWM A;  2QVS B;  1ENQ A;  2XVG A;  1BKZ A;  5FYZ A;  3TEX A;  1Y9M A;  4XFH A;  5BNQ A;  3X29 B;  1VP6 A;  2CL2 A;  1D0G A;  2RS3 2;  4BH9 A;  1NCR A;  2JJ6 A;  3BPS A;  1D4M 2;  3DXT A;  4FPF A;  1ASJ 3;  1REE A;  4AI9 A;  3WP5 A;  4COU A;  2R0H A;  1S0J A;  4N9I A;  4YZ4 A;  1NZI A;  4Q0V A;  2AEZ A;  2FMD A;  3CF6 E;  3J7M A;  3BAL A;  5IWF A;  4QGM A;  1UN1 A;  1RUJ 2;  5I8S A;  1LNS A;  3CJX A;  1I6X A;  2F6B A;  2WBK A;  2JEM A;  3QLQ A;  4JTN A;  2A7A A;  3HWJ A;  4QPG C;  2ZX3 A;  3T0D A;  1R08 2;  1F31 A;  5DQ0 A;  3NJY A;  4XIK A;  2QQM A;  1IS6 A;  4OUM A;  4CU9 A;  1CAX B;  2RS1 1;  2NYY A;  3PVB B;  4L99 A;  2HWF 3;  4Q0P A;  3ZN6 B;  4JRL A;  3N9N A;  2B4K A;  1V6N A;  4QPI A;  2O1Q A;  3FBY A;  1JZ3 A;  4HK9 A;  3A23 A;  3KV9 A;  2WFF 2;  1ST8 A;  4LTA A;  3WV6 A;  3LEM A;  4DPN A;  2KXL A;  2EXJ A;  4FPK A;  1V0A A;  2RR1 1;  1BMV 2;  2CGN A;  2D93 A;  4XBN A;  4I2O A;  3WG4 A;  1CX1 A;  2VZO A;  4K40 A;  1H1I A;  3MLK A;  5KHI A;  5A7W A;  2JEN A;  3I2J A;  2GMM A;  4AF9 A;  5APA A;  1RUO A;  4IGO A;  2C0Z A;  4RQP A;  2VMF A;  3BB6 A;  1GYK A;  2D98 A;  1HQN A;  2W47 A;  3BIW E;  1VMH A;  4UFM A;  3LDR A;  1OA4 A;  2JWP A;  3ZMO A;  4QD2 A;  4ONU A;  1EV1 2;  3ETP A;  1C5H A;  2FDI A;  3H8X A;  3NKG A;  1MS9 A;  4EJR A;  4Q4V 2;  3L2H A;  5FZ4 A;  5FZC A;  5A33 A;  5F7U A;  3V0A B;  1NKG A;  1KGY A;  3WF0 A;  1WBF A;  3AZY A;  2J1U A;  2ILM A;  2AGS A;  4ZU7 A;  3I2O A;  1BBT 2;  1SFN A;  5LAS A;  4PBO A;  5JXH A;  4A41 A;  1YEW A;  4ZON A;  4COZ A;  1YLL A;  3PUQ A;  3NQH A;  1HW5 A;  5CFD C;  3VBO A;  1QIQ A;  4BYY A;  2K0G A;  2OYZ A;  1JZ2 A;  2ET1 A;  4OMD A;  5A3L A;  4JCK A;  4W6X A;  1IG0 A;  5JSR A;  3VN4 A;  5HV4 A;  3O1V A;  4S2G A;  3I7D A;  2WZP P;  2C9A A;  2VU9 A;  2VCB A;  3SLI A;  4IV3 C;  1TMF 2;  2IFW A;  3ZXL A;  2WKK A;  1JHJ A;  1O6U A;  2DUR A;  5FZF A;  1HKD A;  2W08 A;  1XXN A;  1DZT A;  1EY2 A;  4LBM A;  4XJW A;  1KQR A;  3Q8A A;  4QMA A;  1NCQ A;  2VCA A;  4IET A;  2FDG A;  3HR9 A;  2NPI A;  3WHU A;  3MIF A;  4V1P A;  4FOV A;  3K77 A;  4A2U A;  1PZ8 A;  4O61 A;  1S0B A;  4BOW A;  4KU8 A;  2WA4 A;  5GAL A;  4JKM A;  4X6R B;  3ZFG B;  1EP0 A;  4IE6 A;  3CJI B;  4DXT A;  3AP4 A;  3R05 A;  2LUW A;  4LBQ A;  2ZHM A;  1ZX5 A;  2PFW A;  1NQD A;  3GZE A;  3KS7 A;  1DLC A;  2E7Q A;  3DEC A;  5L36 A;  5L9V A;  3FC0 A;  1RJ8 A;  4TLF A;  4Q8L A;  3B9C A;  3GHN A;  1DFQ A;  4LXL A;  1K3I A;  4ZHN A;  2V72 A;  3W9A A;  2IXK A;  1H2K A;  3C7G A;  1CJP A;  2N7G A;  1I9R A;  2XHN A;  3PUH A;  3RGB A;  2ORX A;  4YGD A;  2VQA A;  5DZG A;  2B46 X;  1MVE A;  2X10 A;  3M70 A;  1MQT A;  4DNY A;  3OGS A;  3NNG A;  3ZFE A;  3UJQ A;  1VBA 3;  1MS1 A;  2VQT A;  5EWS A;  5BNN C;  4M4R A;  4DEQ A;  1N3Q A;  1LOG A;  2IXI A;  2XQX A;  3K48 A;  4DZG A;  4FOQ A;  1EPW A;  1ODN A;  3ETQ A;  1F9K A;  1O4T A;  2A1X A;  4CA9 A;  1AYN 1;  2UWB A;  1CQ9 A;  1YJK A;  4CUA A;  3NNL A;  1KDK A;  3WNP A;  2ATF A;  1DQ6 A;  3T2T A;  1RUE 2;  1ND3 C;  5BNP B;  2DF7 A;  4MO3 M;  1CD3 G;  4WVZ A;  4UYB A;  4I02 A;  2WZR 2;  2XLA A;  3ORJ A;  1QQP 3;  4AVT A;  1UU4 A;  1FAT A;  1V00 A;  1X9T A;  3Q8F A;  3TN9 3;  1KIT A;  3LD8 A;  4Q4X 1;  3GNE A;  3O5S A;  4BQ2 A;  2WQ4 A;  3CBN A;  2J1E A;  1BZW A;  1SBF A;  1H8T A;  1O7F A;  2O14 A;  3MLL A;  4XAA A;  4AVC A;  2YGL A;  2X5I C;  2YU2 A;  3C7F A;  1LOB A;  1RUD 2;  1OSG A;  1CN1 A;  2ADD A;  2J42 A;  1PIV 1;  4AWD A;  2JDN A;  4Q0Q A;  4P9J A;  3WT3 A;  3UES A;  1WW5 A;  3PU3 A;  4CZS A;  4EN9 B;  1DIW A;  1UKG A;  4S2H A;  2IFR A;  5LRR A;  3ZSM A;  1QOO A;  3LOI A;  4G9S B;  4M3C A;  5GZF A;  5KXE A;  2PEL A;  4Y5S A;  1KEX A;  4YGC A;  4YVS B;  4RHV 1;  2ZCW A;  2B39 A;  2F17 A;  3P1I A;  2YHJ A;  4JDN A;  2JDP A;  3GZA A;  3PIG A;  3VDA A;  4GH4 C;  1HXS 1;  5LY2 A;  1GNZ A;  3VBU B;  5JXI A;  4OHV A;  2WLQ A;  1CAU A;  1PX4 A;  1ZZ9 A;  2JG8 B;  1ULC A;  2JDY A;  3PDQ A;  4FPG A;  4Q4Y 2;  5FJK A;  5ABJ B;  4GJY A;  1V6L A;  1WCU A;  1JOP A;  3D5O A;  4G4F A;  2R07 1;  4RA0 A;  1JZ7 A;  4PIX A;  1MEC 2;  3JD7 1;  5IK4 A;  4AAX A;  2WO3 A;  2HEY F;  3VZM A;  4EN8 B;  4BWO A;  4CDW A;  4Y33 A;  1NY7 1;  2BQP A;  2V73 A;  4CP0 A;  4NIG A;  3MW3 A;  4E8C A;  1FMD 1;  3B9I A;  1AXK A;  1UOG A;  3OYW B;  5A6Q A;  4L11 A;  2C9K A;  2ERF A;  1VE0 A;  5CIR A;  4NUB A;  3PVO A;  2SLI A;  1W99 A;  4URT A;  2HEV F;  4EZ4 A;  4QQO A;  1O3T A;  1NA1 C;  2MEV 1;  3AMH A;  4Q27 A;  4K8R B;  4NRM A;  3OG2 A;  4QDQ A;  4CU6 A;  5L7O A;  4P14 A;  4LHN A;  5FYY A;  1F5J A;  1QJU 1;  3OGR A;  1S2K A;  4RYD A;  1JYX A;  2CV6 A;  1CAV A;  1VAM A;  4LOT A;  4MV2 A;  5FBJ A;  4YW3 A;  3FHI B;  4FFG A;  3WR0 A;  5JSP A;  2UYA A;  3E5Q A;  4AED C;  1YQ8 A;  2VG9 A;  3NVC A;  5CB7 A;  1XC6 A;  3GGL A;  3WDW A;  2QNK A;  5CU1 A;  4MOA A;  1VR3 A;  4P9L A;  2VJX A;  2WAO A;  2QQP A;  3I97 A;  4AFD A;  2IVJ A;  3ZXD A;  1A34 A;  4H55 A;  1HDK A;  4RD7 A;  3WOG A;  3HMY A;  1QXP A;  4C1W A;  3ON7 A;  1U5I A;  4YW7 A;  3BN6 A;  3DKW A;  1PGW 1;  1AL2 3;  1HRI 1;  3AZX A;  2VOT A;  4D7S A;  1FT9 A;  1WCS A;  1IKQ A;  3O0W A;  1L7L A;  1RED A;  3CZU A;  2D3S A;  1J3Q A;  1Q8P A;  2QQW A;  4QWN A;  5FYB A;  1SQ4 A;  4NAM A;  5FP3 A;  1T6B X;  4L8Q A;  3VBO C;  2BVV A;  5ISL A;  4QPW A;  4Y1Z A;  2W87 A;  1UZW A;  2B9V A;  2WNV B;  4RS5 B;  5E89 A;  1GZW A;  1X82 A;  3M3C A;  4K9S A;  3BKZ A;  1ZNP A;  4YGE A;  2VY0 A;  5EXO A;  1W03 A;  4XFF A;  2W1W A;  5DN2 A;  3WQ1 A;  1C5I A;  3H9A A;  2P6C A;  3R4U A;  3I2I A;  4EN0 A;  4I3G A;  1WZX A;  3POE A;  3VDD A;  3J9S A;  2XJQ A;  3IIA A;  4H2A A;  1W2O A;  1LOA A;  4E2Q A;  3LEK A;  3JXS A;  1W8W A;  2OUJ A;  5FY8 A;  2LAL A;  4EYU A;  4K8F A;  5LAT A;  3W58 A;  1VBB 1;  3OD4 A;  5EJ1 B;  1DQ4 A;  1ALY A;  4ARX A;  4CRQ A;  5A32 A;  1ND2 B;  2Y38 A;  4LT5 A;  4KG0 A;  4JRA A;  1CON A;  1X8E A;  1OOP B;  1XB9 A;  1SPP B;  2YRO A;  2ZS6 B;  5FXZ A;  2XBO 2;  4B1M A;  1WWY A;  1HB1 A;  2HH9 A;  4LBL A;  2FBE A;  2JD4 A;  3WSO A;  4CUB A;  1ZZC A;  4C8D A;  4XEZ A;  5FOB B;  3ALQ A;  1U12 A;  4Q5O A;  3VD5 A;  3MFA A;  2QE3 A;  3NAP B;  4CU7 A;  4KWL A;  4CDU B;  1UY4 A;  1AYN 2;  1HRV 3;  2A3X A;  3P6B A;  4R52 A;  4UT5 A;  5LEJ A;  3RWN A;  2AEY A;  1EYB A;  4C1X A;  4DRR A;  2UUR A;  2BFU L;  1VBD 3;  2UWA A;  4DEV A;  2B5H A;  5JMC A;  1RHI 1;  3T0B A;  1CAW A;  4DXZ A;  3EQE A;  2H6B A;  4RN5 A;  3U0Z A;  2W92 A;  4B4P A;  1OI6 A;  4UFH A;  1OFS A;  3LSE A;  4CCN A;  4ASM B;  1UOJ A;  4IV1 A;  4UFJ A;  5LW9 A;  2BYV E;  2JB8 A;  3LKJ A;  1M4W A;  1AXZ A;  2DVD A;  1Z0H A;  2HYK A;  3LFI A;  1RUH 1;  4DB5 A;  2VQ0 A;  1FPN 1;  2W1U A;  3ZYI B;  2RJ2 A;  3CLP A;  5DUV A;  5KBF A;  3H42 B;  1IKP A;  3QH7 A;  1OFN A;  2A75 A;  2BNM A;  5JI7 A;  5IYY A;  4HK8 A;  4JTO A;  1ODM A;  2JG9 C;  2FCT A;  1N3P A;  3AB0 A;  3HEI A;  4LO6 B;  1SLA A;  1YIP A;  2R06 3;  3SC7 X;  5FZO B;  1HXS 2;  5JDB A;  4TZD A;  2RS5 3;  4BLJ A; 
#chains in the Genus database with same CATH homology
 1VMF A;  1VPH A;  1XBF A;  2P6C A;  1VMH A;  2P6H A;  1VMJ A;  2CU5 A;  1VE0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...