1VMHA

Crystal structure of an uncharacterized conserved protein yjbq/upf0047 family, ortholog yugu b.subtilis (ca_c0907) from clostridium acetobutylicum at 1.31 a resolution
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
129
structure length
129
Chain Sequence
VIEYSLKTSNDDQFIDITNLVKKAVDESGVSDGMAVVFCPHTTAGITINENADPDVTRDILVNLDKVFPKVGDYKHVEGNSHAHIKASLMGSSQQIIIENGKLKLGTWQGIYFTEFDGPRDRKVFVKII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Uncharacterized conserved protein YjbQ/UPF0047 family, ortholog yugU B.subtilis (15023806) from Clostridium acetobutylicum at 1.31 A resolution
rcsb
source organism Clostridium acetobutylicum
molecule tags Unknown function
molecule keywords Uncharacterized conserved protein YjbQ/UPF0047 family, ortho
total genus 36
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2004-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01894 UPF0047 Uncharacterised protein family UPF0047
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.460 Mainly Beta Sandwich Jelly Rolls YjbQ-like 1vmhA00
1XBFA 1VMJA 2P6HA 2CU5A 1VE0A 2P6CA 1VMHA 1VPHA 1VMFA
chains in the Genus database with same CATH superfamily
5DDJ1 3OGJA 1OHFA 4R9AA 3TN91 5A32B 4KWKA 2K9ZA 2ARCA 3THDA 3D3AA 4KGGA 5DUWA 2GNDA 5F7UA 3Q8FA 4XHBA 4D69A 2C6SA 1AR72 3VZMA 4N9HA 2A6WA 3BB6A 3CKHA 3VGIA 2AUYA 3ZYJB 3M4FA 5CIRA 5A33A 1PZ8A 2YGLA 1BVVA 4UYBA 2HWB2 5FFOC 3OBAA 1COV3 1B35C 1UZZA 3VZLA 3ZO0B 4CDUB 3LA3A 4YGCA 1ND3C 3ZXFA 4BK5A 2WDBA 1WD3A 3NV2A 5EHDA 3R4DB 5FQ0B 4A6SA 1RUH3 5A6XA 1JYXA 1G9CA 3NAPA 1SLIA 3E6BA 4MV2A 5FKCA 1I1EA 3AP6A 2VOTA 4IETA 1KJLA 2EXKA 4OQ9A 3USSA 1QJZA 4DNYA 3KLSA 4AWDA 2O14A 4LKEA 3JU9A 5LWBA 5C4WA 4COUA 2X5IA 4AW7A 1AR81 1AF9A 3TEWA 3AL6A 4INDA 2IXHA 4GULA 5LW9A 1RUG1 1WZXA 1VRH2 4Y3OA 1ONAA 1DGWX 1ULDA 5L9VA 2DCTA 4JKLA 4BXSV 3WINE 2A75A 4CDWB 3MEPA 4XIKA 1DGWA 2A70A 1EV13 3T4HB 5FPUA 1D2QA 1OC1A 2JB4A 1HW5A 2AH2A 4HVQA 3AFKA 3RNSA 5FZAA 5KWRA 3DGTA 4XBNA 1OQ1A 5A7WA 4D8MA 5JXHA 1O5UA 3JBG2 3NNMA 1CAWB 1JZ7A 3LIHA 2VZQA 4LLFA 1H1AA 2ARAA 1BEV1 3CLPA 4IESA 4J1XA 1AR73 4QPYA 1HB4A 1PGL2 1W9WA 4R8HA 1W6PB 1S55A 3PVEA 4BPZA 3LA2A 3J8F1 4R4ZA 1GBGA 4XUTA 4MGYE 5JSRA 1W04A 3JQXA 4XVHA 5GLVA 1O3TA 2XMLA 5EP9A 1POV3 2VUCA 4PDWB 1LHOA 4XJZA 2Y6FA 2SLIA 3ZFGA 4B4QA 4D6QA 2NMOA 2B42B 2XUEA 3WP5A 4UFJA 1BZWA 1B35B 3CHXA 3HBZA 2ZMKA 5I0RA 4WM8C 1CPMA 2LALA 1QXJA 3ASIA 3ZXJA 3I2DA 5GZGA 5F3IA 4GB32 4AXOA 5JXJA 2LUWA 4WVZA 5L73A 5ACA3 1AZDA 1SLAA 4JC1A 4AQ2A 1W6OA 2TBVA 1QH6A 4E4HA 4QKFA 1ULCA 5FYVA 3I97A 4QPWA 2BW8A 1GSLA 2NZ9A 2ZEYA 1OD5A 2QKDA 1SLLA 1KGYA 3WNMA 4AEJA 4BYYA 4YZ1A 3BTXA 1R091 4FOWA 2P3JA 3DL3A 3GBWA 3AYAA 3LKJA 4QM8A 4WZCA 1AYM1 1QOTA 2HBTA 1N1YA 3RWKX 1RHI1 4IV1B 4AVTA 1UYPA 5AFEA 4XUNA 5C4WB 1VBA2 3H3LA 3KHCA 1QOSA 1PO22 1RXGA 5LK5A 2ORZA 1WGPA 1UYXA 2HBUA 1W06A 3H42B 4XJUA 3LEMA 4META 2VQTA 5FKBA 4LITA 3VBUB 1NXMA 1RGSA 2PYTA 3ILFA 1JHNA 5KHKA 2HKXA 4RHV3 3GDBA 3FC0A 4XFBA 3T1MA 4B8EA 2QQWA 5A7QA 1DF0A 2ZACA 4JQRA 4EZ4A 4CXYA 3WF2A 2EAKA 1HRI2 5FZ0A 5IK4A 2IWGB 2O1QA 2G4IA 3A0NA 5C8CA 2A3WA 4CP9A 4HPKB 1ZYBA 4OLLA 3P6BA 1PO23 1CIYA 2E51A 2NYYA 3RVHA 2Q1FA 2WC2A 1VRBA 5FMOL 1GU3A 4KG8A 1FOD2 3O1RA 5CFDC 3BPZA 4UFIA 3BIWE 3ZYBA 4JGZC 4ARXA 2QQVA 3ZXLA 3MGUA 2DFCA 3BN6A 5BUVA 5J7MA 1J59A 2BPA2 4Q4W1 3PUHA 4CPBD 4IL7A 5IWFA 1YRZA 3W21A 2WJSA 3DN7A 5DZFA 2WNUC 1H8TA 3RJRA 2FCTA 1V6NA 2L9LA 4OMCA 3USUA 1OLRA 4H7LA 1C1FA 2VQ0A 2ZHMA 1V6IA 4M3CE 3ROUA 4LBJA 4KL1A 4N53A 4QKDA 3UGGA 4QWNA 3I59A 3APBA 4SLIA 4Z1VA 5K7PA 1EAH3 2XJPA 3IDAA 1QQP2 5FLJA 3P5BA 4HSLA 2AACA 4DO0A 4FTEA 4E9KA 4LHKA 1VAKA 3DCQA 5CFCB 4CXXA 3CJXA 3R0RA 2P34A 2QCSB 4GMP1 2ILMA 4LO4B 2V09A 3WXPA 1MS8A 1YLLA 3FUOA 1QDCA 1QMJA 3ATGA 2D97A 1V70A 2VNOA 2DBNA 3WF4A 3DKWA 2C9KA 5EV7A 4FPGA 1LECA 3KS7A 4ATFA 2VCAA 4KWUA 2DWRA 3M7AA 5K0UB 1OA3A 3W59A 4CUBA 2B9UA 3QH7A 1RUJ2 2ZAHA 2ZJCA 4FFIA 4P00B 2WWJA 5IVEA 4BQ4A 2ZOEB 2A3YA 1Z7S1 3HMYA 3N7KA 3UJOA 2B46X 3M3EA 4IGOA 4LBMA 1Q43A 2BBVA 2WNEA 4FPFA 5A1FA 2HH9A 3U07A 3WLUA 4LK7A 3ZPYA 2HEWF 5A6ZA 4QDSA 3WDVA 3OUIA 4Q0QA 1O3RA 3AYCA 1H6XA 2J1RA 2QNKA 5JPMB 4DRVA 5DUVA 1NX9A 2RS53 2WT2A 3EMRA 3FBYA 3MW2A 1ASJ3 4I0WB 4CDQB 3HWJA 5FY1A 4HKOA 2VM9A 1OFNA 2B7YA 1VBC3 2BWAA 4MGIE 4PHZA 3N7LA 3CJIC 4QGLA 4R9CA 3VZKA 2PHUA 1HQLA 2CY6A 3MLJA 4RD7A 2QQUA 2VXJA 3SKVA 1YXWA 5FO9B 2RHPA 4DS0A 1CX1A 1HB3A 1JW6A 4QX7A 3WW4A 5CG8A 2V4AA 1J58A 4N53B 3ST7A 4PI2A 1C8M2 3INAA 5T55A 2A6YA 2Z42A 1QXPA 3CU7A 3GBFA 3WQ7A 1UU6A 4PIXA 5F5AA 1WCQA 4PLNA 4QHZA 2W1SA 3ES4A 1QU0A 3AZXA 3EXUA 3WY6A 1N3PA 4RHV2 4UOJA 4DUWA 1XJAA 1UOFA 1GQGA 2JJ6A 1MEC2 3OY8A 4YW6A 3ACIA 1S0JA 2EXJA 3U37A 2HWF2 5F8PA 2CTVA 2XOMA 2BJSA 1UQXA 3AL5A 1G9BA 1G8WA 3OGRA 4XAEA 1ZBE1 3WNKA 3O1UA 3CNAA 1LOBA 1QKQA 5IYYA 5JPNB 2UWAA 3VHOA 1DCSA 2R7EB 1PMJX 1SLCA 4IEUA 1MQTB 2EIEA 2O8QA 2PA7A 3HEIA 4XBLA 1NOVA 3DXUA 1Z78A 3UESA 1PHMA 4CPBA 2BBAA 2WQ4A 4CU7A 2FD8A 1VBB3 2KD7A 4KI5M 4W65A 4JV4A 2BGPA 4RQPA 1UOJA 2PLV3 3H3ZA 3NNGA 2CDOA 3HVDA 4NUBA 4A45A 4NAMA 3S0MA 3S5QA 5D8AB 4MUVA 4A7YA 1PVC3 5ACA2 1CAUA 2WYSA 4F8AA 4AI0A 3FN9A 3PURA 2Y6KA 1X36A 1OVSA 5LA2A 3HD8B 1NZIA 1WBLA 1DQ5A 4UW6A 3WP3A 2P6HA 3BUCA 3ECQA 1O7FA 2RS31 4HVOA 3VUOA 3ZXDA 4L8QA 2CV6A 2ZCWA 3GZTB 5BXXA 3AKSA 3ACLA 3ZMOA 5ABJA 5ISLA 3NMBA 3C7EA 1AL21 2RMU1 2JDMA 1ODNA 2IXIA 1FMD1 2BNNA 2H6BA 2YBSA 3J7MA 3WW1A 3MFAA 1R1ZA 2ADEA 3IDBB 5FZ7A 3TNPB 4I3PA 4FXGB 1ZVFA 2BEOA 1UF2C 2WL1A 3KT1A 2IXCA 1PK6B 3ACFA 1UZVA 3A0KA 4L9BA 2NMNA 3SCGA 1B09A 2OPKA 4NRPA 4DY5A 3IDCB 1NA1A 2VBBA 2JX9A 4UF0B 1DDLA 1AJKA 1VE0A 4MGSA 4BXFA 5JUVA 4HLTA 1SCRA 5FP9A 2CL2A 4Z92B 2WIIB 3I4IA 4Q4X1 3BODA 4FI9A 1TMF3 5FZOA 5FMCA 1W6NA 4Q4Y2 5APAA 1LGCA 2HWC2 1ZZ6A 3P3PA 5LBBA 4GKYA 2FMDA 1GOFA 1RVF1 3R4SA 5GZFA 2C4XA 1UX6A 4FVVA 4QXBA 3ZSMA 1EY2A 4NRQA 4LKFA 5F5CA 2VZ1A 1WW5A 1MQTA 5F3CA 1DGRN 3U11A 2D43A 3I2IA 2TUNA 2VG9A 2XHNA 3MLLA 3DPRA 4ZKTB 2RS52 4XETA 3IPVB 1O4TA 2X29A 4QXHA 3ZSLA 5FZHA 4I09A 2ID4A 4NPMA 4BQ5A 1H9WA 1RUH2 3CZUA 4JQTA 2WFF3 1OT5A 2QQIA 4NIGA 1AYN1 1BBT2 3KF5A 3MV11 4XACA 2QVSB 1COV2 1YCIA 5FZGA 2RVAA 4W6WA 2OQ6A 5IHRA 1BHGA 1PGW2 1YJLA 4YW4A 3GZUC 1KXGA 2NLRA 2A6XA 3ZDVA 2YC2A 4C1XA 3SHRA 5FZDA 2WLQA 3ETPA 3GHNA 2V5YA 4BCUA 2ZKLA 3PHMA 1AR91 4YW1A 3K2OA 1RUI2 1NCQA 1JZ6A 3N7JA 1CQ9A 1ULPA 2WYFA 3H8XA 5KHHA 4CU9A 1KFUL 3KV9A 1ACCA 2P2KA 5J96B 2ZGUA 5JDBA 1E5IA 1ULEA 3WCRA 3GXUA 5I91A 1XSRA 4QXCA 2O8OA 3H0OA 1NY71 2KR2A 2YV8A 3N4MA 4OYUA 1GNZA 5HXVA 1JU3A 3VDDA 1JHJA 1XE7A 3B69A 3RYPA 2OA2A 1K42A 2VBPA 1QOOA 1GKBA 2D5FA 5F6KA 2KXLA 1Y9QA 2J1UA 3UGHA 2WA3A 1VRH3 3W5NA 1LTEA 4CVUA 4XC9A 1NCRC 2KA3A 3OSDA 2IVIB 4W50A 2DTYA 4Y20A 4UFKA 3IPVA 2UU8A 2FDJA 1TME3 4HN1A 1LB2A 2RDSA 3AJYA 5CA6A 3RQ0A 1VIWB 4CEYC 2RDNA 4AG4A 2GMPA 4CU6A 1E5SA 5CAZA 5FAXA 1H2MA 2JE8A 3BOWA 3ACHA 5JR2A 1ZZ7A 4GWJA 5D21A 1WW7A 2PFWA 1JOBA 3AMMA 3MW3A 4QHOA 4UW3A 4FO9A 5GLTA 3RZMA 1GANA 4JRLA 4LXLA 2R071 3WP6A 3GJBA 1TEIA 3KQRA 4B29A 4YM1A 5B2GB 3C7GA 1CJDA 2Z79A 1QJEA 1QJFA 4IV3B 2PQSA 1IPSA 1VBA3 2WA4A 2JE7A 1H4GA 4XW3A 2A5ZA 5ERLA 1FT9A 3TAYA 2C26A 2WZEA 3WUCA 3FHIB 4OHWA 4BZ4A 3N9NA 2I2SA 4DEQA 3PL0A 2ZGRA 4CUAA 2VCMA 1XC6A 3FLTA 4IE4A 1ZBA1 2XLGA 3JD72 3IAPA 1KDMA 3KB5A 2VVEA 4RQPC 3SEPA 2JDHA 3LWCA 4O7XA 4XBQA 4L2NA 4LBQB 4MO3M 3TB0A 4BDVB 2JWPA 4K8FA 2GNTA 3B93A 2G9FA 4W6YA 3ZFGC 5JMCA 3TEZA 2UY8A 1NCRA 2ZZQA 4Y5Z0 4QKNA 3SKJE 1R081 5IVVA 2FCUA 3DEMA 2R30A 5FK8A 1US3A 5FPZA 4W6XA 4Z82A 1VBB2 1CN1A 5A1AA 3VHNA 4ONUA 1SLTA 1WMEA 1MVQA 2VH9A 5A7NA 3HNYM 3HAGA 5C3SA 5DUXA 1QXRA 1PVXA 4COYA 3NAPB 3SCFA 2A73B 4M01A 1DFQA 5FZFA 4AEDC 5KHGA 3T2QA 1SBEA 1VMFA 1HXS3 3UK9A 4B1MA 3RZKA 1SCSA 1A3KA 1GFF2 2PTMA 3KCXA 4GWIA 4QM9A 5E6HA 4ZU7A 4AAPA 1WMXA 3ZN6B 3E6DA 4Q0PA 4MXWA 2HWF3 1MEC3 1MVEA 4WVWA 4X8PA 2EIBA 3VBRB 4CP0A 1NE6A 1QJU3 1GNHA 3WX5A 1WCDJ 5C3PA 1XE8A 3NV3A 3I3EA 2FCVA 4GWMA 5FWJA 1X82A 3KVBA 4N43A 5BNPB 3MIGA 1LOFA 3W5MA 1W90A 1RUNA 5CG9A 2PHFA 3MUY1 1EV12 4FPLA 1FATA 3NJYA 2D6NA 1DGRA 1OVPA 3RZLA 1VBD3 4NVPA 4WBBA 1RUC2 2HWD2 1V6KA 4R52A 3WV6A 1UOBA 2OIIA 3MW4A 4WVMB 4MVTA 2VE1A 4COWA 3RMYA 5FYUA 3K4ZA 3OUJA 4XDOA 2R0HA 2DCJA 3HN3A 4IEZA 1SPPB 3VBUC 4XFIA 3H8OA 1DLCA 4RFRB 5KHJA 2GC2A 5T54A 5KHIA 2J1VA 4W8JA 1WWYA 1VMHA 2AYHA 3KV6A 1FYUA 2JEMA 4PDWA 2W92A 1JUIA 1WA6X 2VBDA 3A22A 5EXOA 4D0QA 2VVDA 4DXRA 5A6YA 3PJQA 2ZKNA 2HWB3 3L2YA 3POYA 2RM22 1Q8OA 5FIXA 5HCHA 4AVSA 3WT3A 1YEWA 4BWOA 4D6SA 2R062 1RUJ3 4JDOA 5BY5A 4A7ZA 1G7YA 3I2KA 3N9MA 1JYNA 3LA7A 1PO13 2Y38A 3DUIA 3BTAA 5BNNB 3K4AA 1H30A 5FZEA 2W1UA 2VGDA 3MBWA 3WSOA 1L3JA 2HWE2 3T3YA 1PK6C 1F2NA 4FT8A 3IBMA 1QJY1 3K3OA 2WUHA 4BQWA 3Q8AA 1Y7BA 1MZ6A 1F9KA 2XL9A 4XDQA 2KM2A 4OCTA 3ZIWA 3LEGA 3LFIA 3VDDC 3SEEA 2VJXA 4CEWC 4XAAA 2QQNA 1NZCA 2W39A 4LIVA 3VDDB 4FPHA 4OHXA 3Q9OA 2BGCA 5G04L 3GJAA 1FV2A 2ATFA 4K1ZA 4L99A 4BE3A 4E2SA 5JMOA 4LHNA 3RRDA 3TNQA 1EPWA 4URAA 4ZZ8A 4XJAA 1UZWA 2GU9A 5FP3A 4JCKA 1O8PA 5GLUA 4IUGA 2BFUL 2D3RA 4CRQA 3BI3A 4LULA 4UXAA 2XBO1 4FTSA 4O65A 1ULFA 4TYSA 3ZFEA 2ZX4A 2CSGA 4D7SA 4IGQA 1GZTA 1PIV1 2O0OA 4A44A 1PNGA 5IAVA 1V9U2 5IVYA 1RUE2 1PX4A 3SITA 3J4UH 5F32A 5LY2A 3EO6A 5AC93 1OH4A 2BVVA 1RUF3 3M3IA 3QCWA 4QX5A 1H2NA 2LROA 2ZEXA 4ZU4A 5A7PA 2W91A 2ZGPA 4P5HA 1F5JA 1UN1A 4UI9L 3RYRA 2H0VA 1AHSA 2VZOA 3I3BA 1HV1A 1LOGA 2JG8C 4QQLA 3T0BA 3VV1A 1FPN2 2WAOA 2CAUA 5JVVA 5SV8A 5T50A 2RR11 1EPZA 1S0EA 1JZ3A 4BB3A 1SDDB 1PGL1 3WG3A 1GP5A 2W94A 1Y4WA 2FDKA 2GN3A 3VHRA 3O0VA 5ANNA 2FDIA 3NAPC 3ABZA 5C8CB 2RS11 3S30A 2VZVA 3RGBA 5E1RA 3ZVXA 3O12A 5F9TA 2D6OX 4Y24A 4JVAA 2JDAA 2WN2A 2X09A 3MLKA 4NROA 1OOPC 2W0XA 3LSDA 3NJZA 3NNLA 1D4M1 4XF1A 1CJPA 3VBFA 4DIQA 4HSJA 2A71A 5CYYA 4ZXKA 3HT2A 2RJ2A 3ZYIB 2XJTA 4XFGA 1LCLA 3X29B 2QE3A 2Z4FA 3BCWA 4N8MA 1QJX1 4FCAA 3VD5A 3WDYA 4BK4A 4EN9B 1B35A 2OXBA 3ME2A 4LA2A 1QJX3 1ZX5A 1OSGA 3WDTA 4KNCA 1M4WA 4B7EA 4M0NA 5FJHA 5H9RA 4ZY9A 4DQAA 3PVBB 5DAPA 1SG3A 1IS3A 1NQDA 1D4M3 1REEA 2ZX2A 3KCYA 2W1WA 4URTA 2ETEA 2GP5A 3ZN5A 5FR3A 3FMGA 1A8DA 3I2FA 5FZ4A 1CGPA 1VB2A 2R042 1I6XA 1ODMA 2RS13 3H1WA 2D3PA 2C0ZA 3RDIA 2W08A 3AP7A 5BNNA 2N7GA 1NLRA 3OYWB 4YRDA 1WKYA 3IB3A 4CCOA 5JWPA 3POJA 3CBNA 2CWMA 4IEWA 5DN2A 1OXCA 5BPXA 4TTGA 1E5RA 5DG1A 4V1PA 3ZYHA 4DXTA 2RR13 3I49A 2VZUA 1WMFA 2XJUA 2WO7A 4AFMA 1UW8A 1UY3A 4YZ5A 2RE9A 1LGBA 2ZGTA 2BFUS 2F6BA 1RUF1 3VBSB 4D7YA 4DZGA 1LENA 4B4PA 5FOJB 1CONA 1V6LA 3K48A 4XFHA 5AC91 4YVWC 1LOAA 4Y1VA 5IAXA 5CADA 4B1LA 4FPCA 1WLWA 1REDA 4XEZA 3NWKA 2VTXJ 1PIV3 4GH4C 2D6KA 5AVPA 4Q8KA 1HX6A 1QDOA 3AP9A 3JXSA 2BVBA 5KC5A 4QQ2A 1GV9A 1S0CA 2VXRA 1MZEA 2P4EA 2XBO3 4LQRA 2Y6GA 1SMVA 2QZ2A 2Y0IA 4AEMA 4MXVA 1UIKA 4R4XA 1E57A 4CE8A 4A6OA 2I74A 3OBTA 1XNKA 1GWMA 4YVSA 1BCXA 2VMHA 4X6RB 4WM8A 1VAMA 4XQ4A 5FZKA 2AGSA 3AJZA 2LTNA 1GZWA 2W1QA 4HZFA 1SPPA 4OULA 3KGZA 4WM7A 1PZ7A 3PUIA 3O1VA 2XWJB 5T52A 2A1XA 2WWSA 3HBKA 3DPRC 4IEQA 4ZZ5A 3ZFFB 5IATA 1H8TB 2AR6A 2WAAA 3AKTA 5C3RA 1RITA 3OOXA 1QJY3 4NWWA 5HI0A 1A6CA 2YDEA 2DURA 3H8RA 5JZGC 1PMHX 4BMBA 2ERFA 4HFSA 4HONA 5KXCA 1MZFA 4NAOA 4CA9A 1GMMA 3MIDA 4V2VA 1LNSA 1GZ9A 3LOBA 3W58A 5GZCA 1BQPA 1LEMA 1PO11 5CVRA 5AFBA 5A80A 1PZ9A 1FXZA 2ZX1A 1SFNA 4GJZA 5IK7A 5F2WA 1DZQA 5FYSA 5GLWA 4FTBA 1OPMA 3DXTA 1RUJ1 3WW3A 5C9AB 3VZNA 2DUOA 2Q4SA 4HK9A 1AXYA 1YIFA 4M3CA 3RWNA 2EXHA 2AENA 4XFCA 1R1A2 4HBNA 4C0HA 1U5YA 2HWB1 3UKVA 2HYXA 2ZMLA 5FY8A 3OBZA 3A7QA 1BJQA 4CCCA 3TRSB 3VBHA 1XU2A 3MHZA 2VZRA 3OUHA 3WDWA 3BTZA 4L0PA 4XCAA 3ZKYA 3ZXEA 1GNYA 1J83A 2X53S 1HV0A 2GMEA 2R6QA 3CJIB 3RS6A 4F3JA 2OZ6A 3K46A 3QBQA 1AJOA 1O5LA 3ZFEC 1W6NB 3T4VA 5FYZA 3KSCA 2C5DA 4FFHA 1M06G 2XONA 1AR82 4LUKA 1W6OB 4RGKA 4P9WA 3O1MA 1RUG2 1APNA 1GOHA 4L92A 4YG6A 5FZIA 4Z2AA 5FMDA 1W8OA 2I07B 1KRIA 1VBD1 4IQPA 3OJBA 2WZR2 2QDRA 2R49A 1H0BA 3AMNA 3NW4A 4LORA 3AYEA 4JHTA 5DAXA 5A1LA 1K12A 2JIJA 1KDKA 3DPRB 2AEYA 5LA0A 3N9OA 5KBFA 5FREA 2VZTA 3GNEA 1QJU1 3N3HA 4K1YA 4PIZA 1E5HA 5FO7B 1IOAA 1MEC1 2VMFA 1BEV2 4O9GA 4PQ9A 3U1XA 3AFGA 2HWF1 3OEAA 3LE0A 5IUQA 3VKNA 4IV3A 4Y1YA 5LK7B 1SZBA 3KM5A 1GP6A 1ZM1A 1GQPA 2J1SA 2VVFA 1ZNPA 4FFGA 4AVAA 5FMOS 5A70A 1A78A 1UY0A 3J8F2 3MIFA 1ALYA 1HXS1 3H8UA 5J48A 1VBE2 4E8DA 1WCKA 2F17A 2VNRA 4LR4A 1F8VA 5IVFA 1TNFA 1LR5A 3ZKUA 1YUDA 5KXDA 1RMU2 3ZN4A 1W2NA 2QZ3A 2BTVC 5EYYA 1U12A 3WNLA 4XJ8A 4LO8A 4TSVA 4RS5A 4LBLA 2XR4A 2Z5WA 1WCSA 1R083 3TWIA 4HKWA 2VU9A 1W9YA 3T08A 4CDXB 3H7YA 4OI4A 3S5AA 1DQ4A 3KMHA 4XZPA 1T6BX 1S0GA 4QPIA 5C33A 3VL9A 4AVVA 1REFA 3EQEA 4MGKE 1EYBA 2CGPA 4JKKA 2WS92 1ZBA3 4CCEA 5LBEA 4I30A 4YGEA 3R6SA 1PMIA 1HJFA 4LBNA 5DQ0A 4AEKA 3AC0A 3H50A 2B4KA 2PHTA 4Q27A 4UBGA 4KWJA 4G9SB 1AYM2 1O4YA 2D5HA 1CAUB 2YGMA 2ZZJA 4Y4YA 3TN92 4KU7A 5CFCC 1DG6A 1VBA1 3ES1A 1C5HA 1Y9MA 2XLFA 4FOQA 4QQPA 3MDPA 4AOCA 5JOYA 5IVBA 4YSFA 1WMDA 1ENXA 2BU9A 2V72A 3BYWA 4W4ZA 2R073 3VD3A 1HB1A 4ATEA 3W20A 4L97A 1LHUA 2IUWA 4A3ZA 4HN0A 2G19A 1W39A 4B3NA 1DYPA 1C3HA 1ULOA 1NQJA 1LU2A 1W99A 4NIAA 3RG0A 1VLNA 3I3DA 3MV01 2BGOA 4DUVA 2D6PA 4PBPA 3ZPOA 3VBUA 3AMHA 4Q4X2 2K0GA 3VDAA 5IFTA 3RZJA 3ZMNA 1TME1 2ZX0A 1LOFC 5DPNA 3PIJA 3WOGA 1Q5OA 3LD8A 1I9RA 1S0BA 4Y5TA 4Q0VA 4GA9A 2VAUA 4QPGB 1JI6A 3LB9A 1DQ2A 2W3JA 3AKQA 3K51A 1UWWA 3QLQA 5ABJC 3ZFEB 1VRH1 3AXDA 3WW2A 3ZR6A 5FPXA 4XF0A 3N7MA 2GMMA 1UAIA 4FP2A 4CCKA 2YFUA 1RL3A 3E5UA 3DYOA 3VBSC 3WQBA 4XJ9A 2P5BA 4OZOA 5E88A 5FRAA 5L9BA 4XF9A 4QGMA 5CU1A 3O0XA 1S2EA 1STMA 4K7JA 1US2A 3SLIA 1ZZ8A 3MIEA 3VL8A 1BMV1 1XOYA 4H55A 3NV1A 4PDWC 2K46A 4K8RB 3ZYPA 1F5FA 1RUD2 3CF6E 4ASLA 1G6NA 3ZXAC 1WBFA 2F4LA 2JKBA 4YGDA 3CZJA 3IKWA 3SQOA 2BERA 2FZ1A 4PIYA 4OMDA 5AVAA 3THCA 5IK8A 5E8AA 3PDQA 4JX0A 5L19A 1AR93 2E53A 4DB5A 4C91A 5C71A 2WBKA 2WO1A 2OYZA 4UFLA 1TZOA 4AF9A 4MHUA 1I5ZA 1U5IA 2E7TA 1OI6A 3A23A 5E16A 3IT8A 3DV8A 3FUQA 1LKNA 4XDPA 4BQXA 4WZFA 1N47A 1OOPB 3VBFB 3QD6A 1AYN3 1PK6A 2OT7A 1C8NA 2V4VA 4FPOB 2AZ5A 1HN0A 2E32A 4ISRA 4HXCA 4QU2A 3V65A 1O3QA 2EA7A 2WFF1 2VW0A 2HJIA 2YBPA 4NE9A 2VC9A 1YC61 3JZVA 2GC0A 4AQ6A 5CKQA 3UL2A 3KT7A 5HBAA 4FQZA 3SISA 4QX1A 3VD7A 1YQCA 2A6ZA 3HQRA 1IS4A 3AZYA 3MICA 2ZHNA 3E5QA 2BNOA 1A8MA 4XABA 4QD2A 2DU1A 3ZLIA 1DU3D 1AR62 3T30A 3H1MA 2ARXA 4IE5A 4BA6A 4RR3A 1ND2B 1OUXA 4XFFA 1RVF3 3AVRA 4CDWC 1R092 4IEXA 2DUPA 3I54A 4CP9B 1X8MA 1FX5A 1ND2C 3B9CA 1OQDA 4EWDA 4P9YA 2WWUA 3ON7A 1TMF1 4Q4X3 1UY4A 3QACA 4Z07A 2XGXA 5FQ0A 4CDUC 1JYCA 2YU2A 4CEWB 1RINA 2ZGSA 4V2WA 4BHPA 1YYNA 1JMUB 1ZRFA 1NG0A 2E7AA 4PT6A 4WM7B 3THPA 2EF6A 1PX3A 1JOPA 1K5MC 4WM8B 5DAQA 4AR2A 1JS9A 1OBNA 3OG2A 1OUSA 2MHFA 1YJKA 3BOPA 5KXBA 2E31A 5FZ3A 2CAVA 2WNUB 5CB7A 1QGLA 1FMD3 1G86A 3CIHA 2GP3A 3FZ3A 2RMU3 1R64A 1AL23 3I8TA 3WR0A 2OUHA 4QU1A 1NCQC 5FY7A 1P8JA 1K3IA 5BNPA 2JDZA 3DKQA 1BYHA 3UYJA 2AREA 1OF4A 3POIA 4GZ9A 4D94A 3QOPA 3I3MA 1HIXA 2VR4A 2RS33 5CFDB 2DCKA 5JIUA 1TNRA 1YI9A 2J1AA 5LB6A 4NIDA 3U4SA 1OKQA 1UD1A 1VAVA 3V64A 5FPAA 3I2JA 1PVC1 3D0SA 3SH4A 4XE9A 1W8ZA 2VW2A 4HANA 4QPIC 1OOPA 3N9QA 3VN4A 2QQPA 1CWPA 2FHRA 3NKGA 1GP4A 4QPIB 2PLV1 5T5LA 5CKNA 3N35A 3W9AA 4BIOA 1VBB1 3Q8BA 4CDXA 1UX7A 3DF0A 4R9DA 4B4RA 1ND2A 4N7UA 2PN5A 2CNAA 1NA1B 5KC6A 2FDGA 1JN2P 2J22A 3M3QA 2PMWB 1NYWA 5DDJ2 3U14A 3GCWA 3WVJA 1CD3G 1OPOA 1RHI2 2W68A 4GAZA 3S6PA 2ZA9A 3IN9A 2E33A 5G05L 4IXLA 2ZX3A 1ZBE3 5D8AC 3IM0A 5L9RA 3CMGA 5FLHA 5A3WA 1KJRA 5A3MA 5C7GA 4OI2A 4Q0UA 3RJ2X 1DYKA 2JKXA 4YVWA 4ZONA 2IVJA 5LBCA 1Z0HA 1GLHA 2SBAA 2EAAA 3FL7A 2BOJA 3MIBA 5F5QA 2VCCA 5I8SA 5ABJB 3D5OA 1RC6A 3ZX7A 5L7OC 3IDEA 3PUAA 5T3NA 1IZ3A 3PVOA 3RZHA 4NO4A 3KZ4C 5FPBA 1O4ZA 3MI8A 3JB4C 4I02A 2MEV2 4LE3A 3ZSKA 2YPJA 5FZCA 4P14A 4UFMA 1BKZA 2Y6JA 2Q30A 2DCYA 4H7MA 4IDZA 4JGZA 1UZ0A 2VQUA 3O0WA 4RN5A 1O6UA 4P9XA 4EV0A 2JDKA 1UCXA 2XHKA 5GJ6A 4AVBA 3WNOA 1SEFA 4QPGC 1C5IA 2CGNA 2FBEA 3B01A 3DYMA 1BK0A 3O1TA 5KXEA 1VBC1 3BU0A 4Y5SA 4PCRA 1HB2A 5IJRA 4BJ0A 1ASJ1 4KBZA 2RS51 1SACA 3U0ZA 4GH4A 4Q8LA 2BQPA 2Q8DA 2UWCA 1NT0A 4HG6B 4KGQA 1ZA7A 3POGA 4MZUA 1N1TA 5HCAA 4P5YA 1KFXL 1MS9A 2C1FA 2WQZC 1IG3A 5BNOB 1V6OA 4MOAA 1Z7S3 1UMIA 1V00A 3LDKA 2ZS6B 4AEDB 4NPRA 3WCSA 4YVSC 1W6MA 2PHRA 3R05A 4QDQA 2OS2A 3E97A 1UPSA 4BIFA 5F3EA 4RA0A 5CNAA 1UOGA 2R32A 2PHDA 4WM7C 1XYNA 4DUXA 1ZZCA 1CAVB 4RQPB 4BQ3A 1VJ2A 1NLQA 1VMJA 4LHLA 3ZYRA 4NR1A 4N90A 2WSVA 5LRSA 1WD4A 2DVGA 2JD9A 3CO2A 4AI2A 4BM8A 4AZZA 5L7OA 5K4LA 5F6LB 4GMP3 4XTMA 3MIHA 2WRAA 3AP5A 1NCQB 4AHWA 2XH6A 3EBRA 4JAAA 2VECA 3T09A 3VB9A 1H8VA 2WFPA 1K5JA 1G9DA 2IZWA 1Z7S2 1GYKA 1FAYA 3ALQA 2UURA 3GZAA 4DPNA 4LMFA 4EN8B 2PAKA 1EAH1 2IFRA 3FFZA 1DGLA 4OHVA 4GJYA 2D93A 1W2AX 2WZ8A 3NNJA 5A32A 2VOXA 3HIFA 4MGQA 4QAWA 4A41A 3K75B 4KBBA 3A21A 2NN8A 5JOXA 5HCBA 5LRRA 1JU4A 1CX4A 4Q4W3 4S2FA 1UPIA 2G1MA 3CL1A 1FNYA 4NHMA 3VBRC 2UYBA 4M3CF 3M3OA 4PLMA 5C8WA 4IEPA 1IGOA 1XNDA 2J1EA 2IXKA 1N1SA 2JE9A 2PXJA 2WNOA 3BPSA 3GYDA 4QX8A 3RPQA 1W2TA 3N9PA 4K20A 3SMHA 1PO21 4O61A 3WD5A 2NPIA 1V0AA 4L11A 4XQWA 4YM2A 5JSPA 5JOWA 3AXEA 1YFYA 3MF6A 3OGGA 2W46A 3EJKA 4P9JA 3V56A 5DUUA 4CCLA 4D7TA 3JUUA 1YFXA 1DIWA 4CDQA 4AHYA 2HEVF 3KHBA 4RHV1 2D40A 2B39A 1QF3A 4JTNA 2BZDA 1L7LA 4YZ3A 4DFSA 2F4PA 1NKGA 3OB8A 2CWSA 2IXJA 4NIIA 3ILRA 4Y22A 3USUB 1SBDA 1J84A 2G9ZA 4LO7A 1SBFA 5FXWA 4CEYB 2GDFA 3UKNA 1LJ7A 3CQOA 4ET7A 1RHI3 1MS5A 5T5OA 1AYM3 1W05A 1JBCA 4S2GA 1G9AA 1I5PA 1LEDA 3MPBA 1R093 3WDXA 4PI0A 5FZMA 5IFPA 1HKDA 1DLLA 5CFDA 3VDCA 5CISA 1LRHA 3B00A 2W9XA 4UFHA 1QEXA 1XRUA 3LIGA 3RZGA 4OI0A 5EYXA 1DBNA 2C24A 4Y1ZA 3IIIA 4YG3A 4IE6A 5C9AA 2CYFA 3AKPA 3WQ1A 1UU4A 4OHYA 4Q26A 1DZRA 1N3OA 2YG0A 5ACA1 2JDUA 3WDUA 1DHKB 1PGSA 1MR5A 2G9GA 3KV4A 4BOWA 2PHXA 3NSTA 4EWEA 3E6CC 1O3SA 4N53C 4FAHA 3VBRA 4RS5C 3K3NA 3O7OA 1S2BA 5DAVA 4GXLA 2WZPP 4NJ4A 1UKGA 1XNAA 5EJ3A 1ZRRA 4H3WA 1SQ4A 3D4KA 1H2LA 1POV1 3TOJA 1ZREA 4YM0A 5FUIA 1H2KA 1HDKA 2YMZA 1IPKA 1C57A 4YW5A 1AL22 1Q56A 1W9FA 3GHMA 4OUSA 4ASKA 5A3NA 5D8AA 1YO8A 3J8F3 2YHJA 2WLPA 2Y8KA 2VUDA 1S0FA 2K2SA 4CDQC 2QQKA 4COZA 4UAPA 2HYKA 5FY0A 4EQVA 2JDPA 3ZSJA 1S4CA 5A33B 1AR71 3O14A 1TG7A 1T6GC 1BEV3 5DXDA 3ZYFA 1W03A 1UXXX 4QMAA 4ES8A 1XSQA 5F2SA 1OA4A 5LY1A 1QIQA 2QUOA 4EWAA 2FDHA 4MYEA 4AGVA 1YI7A 3AZVA 2JB8A 4C90A 3T0DA 2XPJA 3PTRB 1C1LA 1EV11 4MXWB 2GNMA 3UT0A 3FLPA 4TXWA 4CSWA 2XJVA 3ORJA 3D0JA 2Y0OA 4IV1C 2XDVA 2JXAA 3WQ0A 1WLTA 3UJQA 1RUG3 1RVF2 1L7RA 1TE1B 5FYIA 1JZ4A 1AR83 4KQ7A 1JYWA 3G6JB 2QQLA 3WF3A 2PQQA 3VBSA 1W8FA 3GZEA 2VCBA 1H4HA 3ENRA 3KD4A 5M0TA 2JICA 3NV4A 4UF0A 4YLZA 5LEJA 3I2HA 2CGOA 5FZOB 5LEKA 4JDNA 4MX3A 5F39A 1RUH1 3VZOA 4PJYA 4PLOA 5FLIA 4QQHA 1WLCA 2R1BA 1VB4A 4RS5B 1COV1 4YVSB 2DDUA 3CEWA 2Z69A 4G4FA 3N36A 2XXZA 1PGW1 4WV8A 1IS6A 3M3CA 3RZZA 3E1F1 3CDZB 1RJ7A 4P9LA 1F35A 1N1VA 2XUMA 1HRV2 4AHZA 4EYUA 2ZXQA 3F2ZA 4LLOA 2XVKA 1VR3A 5GZEA 2XQXA 1MS1A 2JG9B 4XMAA 1C28A 4HL0A 1W8NA 5FYHA 1O59A 5LBFA 5JAXA 1MPXA 5DABA 1ZRCA 1J1LA 2BOIA 5FPVA 4LHSA 4CZSA 3KCCA 3O5SA 3TN93 4XUPA 1LGNA 5DDJ3 5C8CC 5EJZB 2WT0A 1H1MA 1UU5A 4Y20B 3WHUA 1BVP1 4LIUA 4K6BA 3V0BA 1EUTA 1WW4A 5IVJA 5JOZA 1W3VA 5HPOA 4HVRA 4NHKA 4RR3C 2VMIA 4GB31 3WNPA 2WN3A 4XF4A 4DMIA 2JG9C 3KWVA 1W2UA 5JXIA 4E4SA 2OUJA 2Z2SB 2WO2A 2P3YA 1Y9GA 3H1YA 1ZZ9A 4AI9A 3UGFA 2P17A 1RIRA 5A3TA 1OLME 4XOGA 3FHAA 4IEOA 2Q8EA 2OKXA 2W52A 4B7KA 4D6RA 4YZ4A 1DQ6A 1BXHA 3PU3A 3WNNA 1W2OA 3HOBA 3VBOA 4LUMA 4XTPA 5C5UA 4RYDA 1QWRA 3MUZ1 2DF7A 5IW0A 2VUJA 2Y26A 5IK5A 5FMBA 1CESA 1V9U1 1XU1A 2HWD3 5F3GA 1NAEA 2RMU2 4Q4V1 2PELA 1WLDA 3TBDA 5HV0A 1C8M1 2VOKA 5FY5A 3B9IA 5BNOC 4QGNA 1U5XA 3IIAA 5JI7A 4D3WA 3THTA 5FUNA 2YYOA 5JCTA 3IAQA 1YNAA 3POFA 3ZSEA 4HPKA 4QHBA 5DAWA 5FP8A 4P9GA 4FPYA 2DVAA 2RR12 1SFPA 4NIHA 4GWNA 1XBFA 3AZWA 1RB8G 3MO4A 3SCHA 1XB9A 3AB0A 1NA1C 2VMDA 1KQRA 2E26A 3PIGA 4LA3A 1GR3A 1ZBE2 1HQNA 1JUHA 2LM3A 2WZR3 4AK3A 1RUC1 4Q4Y1 3ACGA 3T2TA 4COVA 2VY0A 2HWC1 4IGPA 5CBLA 3O1SA 1QY4A 1FNZA 4ZU5A 4YG0A 3FWEA 2DFBA 3J26N 5BV6A 2B5HA 2PAMA 2RV9A 3OY8B 1CAVA 2RG4A 5JSOA 2BV4A 4LJHA 4M4PA 4NN0A 3ZXGA 4K21A 4AFBA 5CKMA 5BNPC 1LHWA 4BISA 3WEZA 4ZPIA 3V0BB 1XNBA 1K5MB 1F15A 2VMCA 4FOVA 4XPVA 3WNXA 4GMP0 4LO6B 2XKOA 1W9TA 4YM3A 3SH5A 4E2QA 2ZGNA 4HETA 4AHXA 2WS91 3JD73 3S7IA 2RS32 1RMU3 5C3QA 4RGGA 1ULGA 5C4WC 1IPJA 3AX4A 4YFWA 2ADDA 2DYCA 4H2AA 2WQ8A 2B9VA 2DU0A 1UNBA 4PF1A 1GZCA 2RJLA 4LE4A 2A3XA 3B5LB 5JZGB 1XNTA 2BWCA 3LFMA 4GKXA 5K8SA 3POEA 1MS3A 1U5ZA 4FFFA 5LZ6A 4AE2A 1X33A 4Q2FA 2P3KA 2WABA 1HRV3 4OI1A 3NKTA 4JDMA 4NHLA 3VKFC 1XYPA 5FBJA 2IFWA 3LAGA 5J36A 3ILNA 4YVWB 1IS5A 1LOEA 1YFUA 3VLBB 2FQPA 4J1WA 4NMIA 4OHZA 3C7FA 4EROA 3SC7X 3KGLA 4AI1A 2HEYF 1UKRA 2XJSA 2ENRA 2CU5A 3LSEA 1MS0A 2D98A 2OVUA 3PMSA 4KMQA 4LKDA 2GH8A 2P3IA 5FBZA 5CZKA 2DTWA 1PM7A 4E2GA 1AR63 3H9AA 5I93A 4HMZA 3AMQA 5GKAC 3K77A 1S2KA 4N43B 3WF0A 1J3QA 2QQJA 4LO5B 4HT1T 4YNIA 1Q8SA 4QPGA 1Y43B 5FYBA 4K40A 5GZDA 1AYN2 3QH6A 5FP7A 2DV9A 3H7JA 1DQ0A 5FYTA 2ZAAA 2JD4A 4E27A 4K9SA 2RM21 3HPNA 3RFRA 1GQHA 2YC4A 2ZTNA 1BMV2 2CDPA 2YB7A 3NNFA 4DEVA 2R061 5J1XA 3JBG1 1JOJA 1CAXB 1D0HA 2ZEZA 2DVDA 1EUUA 5BNNC 1FPN1 4OQ8A 3BTYA 1DP0A 3VDBA 2YU1A 2VNGA 5I8TA 1GZWB 4CCNA 4FBFA 1X9TA 2YBKA 3PUSA 2JIGA 1VALA 2BRTA 2ZGKA 3PJYA 5DZEA 1GUIA 1IQAA 1RUI3 4AQSA 5A3LA 5FO8B 1WUVA 3GM8A 2HWE1 2JDNA 1RUD3 1UYZA 2R043 5LASA 3G7DA 3IMNA 3S57A 3ZR5A 1LHNA 1ZZBA 2WINB 3PTYA 4QXKA 2VNVA 2XG3A 1NY72 2Y33A 4S2HA 4GQ7A 3AK0A 2J42A 1UIJA 1LHVA 4XHXA 4YGBA 5KR7A 5JR7B 3BKZA 4YW2A 5EFUA 2P37A 2WFF2 2NP0A 1X9PA 2E9QA 1YQ5A 4Q29A 1Q3EA 1RTVA 4LTAA 1R082 4XF3A 1G9FA 2IXLA 2ZGQA 3EB7A 4J6GA 1JZ2A 1ZRIA 2P6CA 2DCZA 2OZJA 1T2XA 3D6EA 4PQQA 4A7KA 4BQYA 4C1WA 3VBOC 1JH5A 2C9AA 2XKPA 3ELNA 4CP1A 1AUYA 1SLBA 3FBMA 1S0DA 4BLIA 3FFQA 4MADA 3VBOB 2OW4A 4XFAA 4E8CA 2ES3A 1RUE1 1FI2A 3K4DA 2X05A 4CTEA 2Y60A 1FMD2 4I01A 3MZHA 5EIYB 4TWTA 3VHPA 1NCRB 1RYYA 2WSUA 3EHKA 2PAEA 3NRUA 1QNYA 1AX1A 4NHYA 1KEXA 4C0BA 2JG8A 1H6YA 3ZDSA 4E4DX 1JYTA 4YW7A 4ZS3A 4TZDA 5SV5A 1NUKA 4TLFA 3JQWA 2XVGA 1AXZA 1W6PA 3VZJA 5I8YA 1HRI1 3ZFGB 1DQ1A 2FDFA 1RUF2 5FUPA 3HT1A 4QX0A 5EQUA 2W2IA 4XUQA 3A4UA 1URXA 4P9IA 4GALA 5H9QA 5J98B 2QDNA 1F4AA 1VBE1 4HKLA 3FHQA 1FOD1 4XUOA 2GN7A 4QX3A 5FXZA 2TEPA 2VZPA 4DINB 2J7MA 1RJ8A 1CIWA 1F4HA 1GOGA 3OD0A 1ZBA2 4Q4W2 2DBIA 3ITQA 4LKSA 4CDWA 1HQWA 5C6CA 1OLMA 2YPDA 3J7LA 3Q8CA 4X8NA 3NJVA 1S1AA 5A7WB 3WP4A 4CP2A 3I59B 2GH2A 5FPLA 3ETQA 4XZUG 1JYIA 1A34A 4LOSA 5FTTC 2Q8OA 1PVC2 1YWKA 1W6QA 4OUEA 2WNVC 3SNMA 1W28A 1BBT1 2JDYA 1QQP1 1XYOA 3I2GA 4JGYC 4XJWA 4KH9A 4S2DA 5L36A 3O1OA 1R1A3 2VZSA 4NOTA 3P1IA 2P1BA 1UYYA 3OEBA 1YIPA 4PF5A 1X7NA 1CAXA 1K5MA 1OKOA 2BYVE 1HLCA 2Y6HA 3B3QE 4Y1XA 4JZRA 1W6MB 5DZGA 1BK1A 3RSJA 1W8HA 4BQ2A 2VUAA 2XLAA 3Q8EA 1YFWA 1AVBA 4CUCA 4GIQA 4ASMB 5JLVA 1OH3A 4YW3A 1QNWA 2H6CA 1MS4A 4CCDA 1PO12 2LS6A 2GAUA 5I0UA 3GBGA 4CDUA 1K45A 4QDRA 3R4UA 4AFCA 3UETA 2Q0AA 2RDRA 1W8TA 3HN1A 2YY1A 3C8XA 3HJRA 4AFDA 2CHHA 3PVNA 2R16A 2EIDA 1OFSA 2V73A 5LATA 2VMGA 1BLZA 5AC92 5E89A 2MEV1 4RFT0 2Y6LA 1W0OA 5FYMA 1ND3B 1OLQA 3RI8A 1TQ5A 3C7HA 4FPEA 5FZ1A 4Y1UA 1IKQA 4U36A 3OPTA 1Q8VA 5H9PA 3LEKA 4J25A 4R9BA 1KD7A 3WG1A 4WVVA 2VPVA 1VBC2 4AQTA 1UL9A 4QKBA 2Q1MA 4XILA 3OBRA 1RXFA 1JZ8A 3POSA 4JGYA 5CEHA 3KF3A 3V0AA 4KU8A 4Y26A 3I2OA 1CAWA 3VD9A 2MEV3 5BYNA 2QQOA 4RR3B 3UNPA 3BU7A 4CXWA 1CR7A 1QH7A 5I0SA 5FYYA 1GWKA 4BQ1A 4F7ZA 4MGTA 4XYXA 4DXSA 2AEZA 4EJRA 2I45A 2ZHLA 4AI8A 2XWBB 2V5DA 5FXVA 3LZZA 4CDXC 1H1IA 2ZABA 1ENSA 5FY4A 2ZBJA 3LCPA 4A2UA 3JB8A 2VULA 2QQMA 2VTFA 5FY9A 1OF3A 2JECA 2JENA 4CU8A 4RSUA 5D2AA 2DUQA 4N43C 5H9SA 5K0UA 4C8DA 3ZIXA 3ZM8A 1HXS2 2RS12 2OX0A 2GZWA 4KWLA 1QJY2 5FK7A 4Z2WA 2JG9A 2ZGLA 2E6VA 4IE7A 5FZ6A 4Y22B 1CZTA 1LESA 1J3PA 4EN7B 5F1RA 2GC3A 3D82A 1R1A1 3C7OA 2AC1A 4CCJA 5IVCA 2MNGA 1JZ5A 1QQP3 3ZFFC 1LULA 1EAH2 4XMIA 1BBT3 4I3GA 4OFGA 3J7NA 1XPWA 3POWA 2GALA 1L7QA 1YQ2A 5BNQA 5FJKA 2UY9A 2X5IB 5FZLA 3DECA 3LPGA 4M3CB 3P3NA 4QQOA 5A3OA 3H3UA 1PIV2 1QHDA 2A7AA 1H9PA 4E4ZA 2QBXA 4G3YC 4X6QB 2D6LX 4FPJA 1FOD3 4XURA 3J9SA 1VBE3 1NXD1 5A6QA 4XXPA 3VBHB 5J3UA 3C3VA 4FP3A 4NHXA 4JTOA 2UYAA 1TMF2 2W47A 3HNBM 1UMHA 3LDBA 1D2SA 3BALA 1RUOA 2ET7A 1CZVA 4SBVA 2E7QA 2Y34A 5A3PA 1OQEA 4M4RA 3UV9A 1EP0A 2MPFA 1HRI3 3OTFA 5FDBA 1UZYA 1S0IA 3MF9A 3AMPA 4LEJA 4NWVA 2ET1A 1XNCA 2VZ3A 2X8KA 4FXKB 1D4VB 4LK6A 2LW8A 3ZYGA 1J1TA 4IV3C 2VMEA 3PLQA 1UO9A 2VL4A 5BNOA 1IG0A 4JKMA 4K3UA 4JHZA 2OQ7A 1O91A 2ZEWA 3RYKA 2TNFA 4MGZE 2EIGA 4IW3A 5I0TA 2FZ2A 1RUE3 1AX0A 2X10A 5LA9A 5GALA 1H8TC 5FV3A 3PMEA 3B7MA 3M8LA 3VKOA 4CEWA 4CCMA 1Q8QA 3WHTA 3BGAA 4IEYA 4BU2A 4NRMA 3S7EA 4EN0A 4Z8BA 3PU8A 1D4M2 2UWBA 4RGAA 1YHFA 5DMYA 5JXGA 1D7PM 1XE0A 4I0BA 4CEYA 1CZSA 2WT1A 2BP6A 1LU1A 1MZ5A 3HQXA 5HCFA 1C4RA 2GNBA 3IMMA 2J1TA 3N9LA 1ZRDA 3MYXA 2WNVA 1W6QB 2YC0A 4OUMA 2Y64A 1AL0G 3FE5A 4I0AA 5B4XA 1XQNA 5K9YA 4LPLA 3VKMA 3PNAA 3EYPA 5HV4A 4GH4B 4FAGA 1Q8PA 1PM4A 3IWZA 2R1DA 3KV5A 3GALA 4I2OA 2EVXA 5CFCA 1AXKA 3VKLA 4EE2A 2YXSA 2ORXA 1O8SA 2R041 1RUD1 3KVAA 2HWE3 5EPAA 2BDRA 1AR92 3UKTA 3L2HA 2XVLA 4MLOA 5ANQA 2XB6C 1RUI1 5EZWA 5JZGA 4AI3A 3L9JT 4AGGA 1F31A 5FWEA 3DYPA 1ZA4A 1NE4A 1LAJA 1SFYA 1U0AA 2XQRA 4ORFA 3AYDA 5A7SA 5T5JA 5TSWA 1GWLA 3LOIA 4F83A 3KQ4B 4XCBA 1WA4A 2D44A 5FCCA 4AYUA 1FPN3 1SHWB 4DRRA 5FOBB 1IQDC 2ARBA 3JBG3 2R063 3LF7A 3NJXA 5A7OA 2VQAA 5C5TA 3VD4A 3OGSA 2ZHKA 1VPHA 4IEVA 2YUEA 2YZ4A 2RM23 2PHLA 4MSVA 4BLJA 4A42A 5JIAA 1ENRA 3NQHA 5C9AC 1UMZA 3OYWA 3E5XA 1NLSA 3POBA 1TVGA 2NM1A 4MHRA 4P02B 1X8EA 3CJIA 3URFA 5J37A 3T0AA 4LNVA 1ND3A 3U78A 2WKKA 4TN7A 3VBFC 4A3XA 1WCUA 2D3SA 2ZPXA 3AZZA 3VBHC 1VP6A 2D6MA 1OURA 5FXXA 4ES9A 3AM2A 4LBKA 2XBO2 3RI9A 1AR61 4MH0E 3HR9A 2X5IC 1ASJ2 1KS5A 3TEXA 3WG2A 4PBOA 4ZHNA 4CUGA 3WZ1A 4Q0SA 1VBD2 5DG2A 3OGVA 3PUQA 5GM0A 1WW6A 1YQ8A 2PHWA 1N3QA 1UY2A 4TLGA 3BIEA 4AAXA 4RL7A 2OPWA 3WUDA 2RDQA 3TYJA 4OZXA 5GLZA 5I0DA 3T2OA 3FX3A 4WVMA 1J3RA 1ST8A 5F5IA 3AP4A 1UY1A 3I3QA 3I7DA 3SH3A 4DOUA 1HRV1 1QJU2 3GGLA 3NO8A 2R072 4EZHA 5EWSA 1UXZA 4UW5A 4CYDA 4N7IA 4M00A 1W8UA 4FQ4A 4AFAA 4P08A 5D1IA 4AEDA 5FP4A 2D7FA 4ARYA 4Y33A 4FSJA 1D0GA 4QB2A 5K0UC 2A6VA 2DVBA 3JCIA 2W95A 2W87A 2ZGMA 4YARA 2LRPA 5F37A 4O9EA 3TEYA 2QTWB 4Y4RA 3AKRA 3U10A 1HN1A 1DYOA 2BNMA 4LBQA 1RMU1 5FYCA 4FOYA 5C70A 2EXIA 2WS93 2YFZA 3GF6A 3FLRA 3JD71 2E63A 1JXNA 3OF1A 4YYOA 4LT5A 3ZFFA 4AVCA 4YWAA 4A4AA 2XL7A 2VOWA 4ITCA 2YROA 4U2AA 3T1LA 4N9IA 3BVCA 1QJX2 3D8CA 4M0HA 2FMYA 2VO5A 4YZ2A 2GSYA 3FJSA 4QB1A 2GC1A 4GD4A 5A3UA 3LQCA 3GCXA 3MFCA 1CPNA 4IE0A 4IV1A 3HNMA 2PLV2 1OA2A 2VTXA 4ZS2A 2Q1ZB 3MPPG 3ZXKA 1YQ6A 1AX2A 1JTZX 4OVEA 3T2PA 4BH9A 4QB6A 1W3XA 2EICA 2Q8CA 1OD3A 4ISQA 4LBOA 3IZOA 3WG4A 2BUKA 3B94A 2HWC3 5EJ1B 4ZXEA 4Q4Y3 1RUC3 3B02A 1PNFA 1HJGA 2H0BA 2WZR1 3HQUA 4JGZB 4EN6B 3U4XA 4Q4V2 1LOCA 3RMXA 1KITA 1OMIA 3LGRA 1KS4A 1X50A 2NQYA 2WR9A 2JG8B 2VOVA 3J7HA 2XJRA 1ENQA 4IERA 3LPFA 1W9SA 2WO3A 4XXAA 4KG0A 1V6MA 1V6JA 4FPKA 4QX2A 5B4NA 3OCPA 4MG2A 2ZMNA 4Q5OA 4NPLA 4HK8A 5FZ8A 2XJQA 4UT5A 3AVSA 3SXWA 2EALA 5HXMA 4BMEA 1POQA 5LA1A 1C8M3 2DVFA 1MQTC 2B8MA 4Q4V3 1W8WA 2HWD1 3M70A 5IT6A 1JYVA 1FV3A 1GICA 1V9U3 4QT6A 4DY3A 5FZ9A 2R0FA 1LODA 3M2MA 1TME2 3O1PA 3F95A 4UBHA 4H14A 4LOTA 3ZOIA 4YPJA 4AL9A 4DXZA 5LCWL 2VW1A 1JODA 2B45X 4JRAA 4LBQD 4Q1PA 2ZGOA 1XXNA 3C2UA 2Q5TA 2WNUA 3NL1A 5C3OA 3LDRA 4XQDA 5J09A 2IC1A 1W0PA 1W0NA 3OD4A 2QFEA 2WNVB 4UWDA 3M1HA 4HOOA 5JI9A 1MACA 1Y3TA 2QJVA 2RJKA 1SDWA 4GB33 2VD7A 3U75A 4YFZA 4Q1RA 3KT4A 3LEIA 3OPWA 1DZTA 3OPZA 4JGYB 5FZBA 3V0AB 1CVNA 1POV0 4AGRA 5L7OB 5T5PA 4XIOA 3ZN6A 1I3HA 1IHMA 1IKPA 2HLEA 3NVCA 4UW4A 2W5FA 3WF1A
chains in the Genus database with same CATH topology
1XBFA 1VMJA 2P6HA 2CU5A 1VE0A 2P6CA 1VMHA 1VPHA 1VMFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XBF A;  1VMJ A;  2P6H A;  2CU5 A;  1VE0 A;  2P6C A;  1VMH A;  1VPH A;  1VMF A; 
#chains in the Genus database with same CATH topology
 5DDJ 1;  3OGJ A;  1OHF A;  4R9A A;  3TN9 1;  5A32 B;  4KWK A;  2K9Z A;  2ARC A;  3THD A;  3D3A A;  4KGG A;  5DUW A;  2GND A;  5F7U A;  3Q8F A;  4XHB A;  4D69 A;  2C6S A;  1AR7 2;  3VZM A;  4N9H A;  2A6W A;  3BB6 A;  3CKH A;  3VGI A;  2AUY A;  3ZYJ B;  3M4F A;  5CIR A;  5A33 A;  1PZ8 A;  2YGL A;  1BVV A;  4UYB A;  2HWB 2;  5FFO C;  3OBA A;  1COV 3;  1B35 C;  1UZZ A;  3VZL A;  3ZO0 B;  4CDU B;  3LA3 A;  4YGC A;  1ND3 C;  3ZXF A;  4BK5 A;  2WDB A;  1WD3 A;  3NV2 A;  5EHD A;  3R4D B;  5FQ0 B;  4A6S A;  1RUH 3;  5A6X A;  1JYX A;  1G9C A;  3NAP A;  1SLI A;  3E6B A;  4MV2 A;  5FKC A;  1I1E A;  3AP6 A;  2VOT A;  4IET A;  1KJL A;  2EXK A;  4OQ9 A;  3USS A;  1QJZ A;  4DNY A;  3KLS A;  4AWD A;  2O14 A;  4LKE A;  3JU9 A;  5LWB A;  5C4W A;  4COU A;  2X5I A;  4AW7 A;  1AR8 1;  1AF9 A;  3TEW A;  3AL6 A;  4IND A;  2IXH A;  4GUL A;  5LW9 A;  1RUG 1;  1WZX A;  1VRH 2;  4Y3O A;  1ONA A;  1DGW X;  1ULD A;  5L9V A;  2DCT A;  4JKL A;  4BXS V;  3WIN E;  2A75 A;  4CDW B;  3MEP A;  4XIK A;  1DGW A;  2A70 A;  1EV1 3;  3T4H B;  5FPU A;  1D2Q A;  1OC1 A;  2JB4 A;  1HW5 A;  2AH2 A;  4HVQ A;  3AFK A;  3RNS A;  5FZA A;  5KWR A;  3DGT A;  4XBN A;  1OQ1 A;  5A7W A;  4D8M A;  5JXH A;  1O5U A;  3JBG 2;  3NNM A;  1CAW B;  1JZ7 A;  3LIH A;  2VZQ A;  4LLF A;  1H1A A;  2ARA A;  1BEV 1;  3CLP A;  4IES A;  4J1X A;  1AR7 3;  4QPY A;  1HB4 A;  1PGL 2;  1W9W A;  4R8H A;  1W6P B;  1S55 A;  3PVE A;  4BPZ A;  3LA2 A;  3J8F 1;  4R4Z A;  1GBG A;  4XUT A;  4MGY E;  5JSR A;  1W04 A;  3JQX A;  4XVH A;  5GLV A;  1O3T A;  2XML A;  5EP9 A;  1POV 3;  2VUC A;  4PDW B;  1LHO A;  4XJZ A;  2Y6F A;  2SLI A;  3ZFG A;  4B4Q A;  4D6Q A;  2NMO A;  2B42 B;  2XUE A;  3WP5 A;  4UFJ A;  1BZW A;  1B35 B;  3CHX A;  3HBZ A;  2ZMK A;  5I0R A;  4WM8 C;  1CPM A;  2LAL A;  1QXJ A;  3ASI A;  3ZXJ A;  3I2D A;  5GZG A;  5F3I A;  4GB3 2;  4AXO A;  5JXJ A;  2LUW A;  4WVZ A;  5L73 A;  5ACA 3;  1AZD A;  1SLA A;  4JC1 A;  4AQ2 A;  1W6O A;  2TBV A;  1QH6 A;  4E4H A;  4QKF A;  1ULC A;  5FYV A;  3I97 A;  4QPW A;  2BW8 A;  1GSL A;  2NZ9 A;  2ZEY A;  1OD5 A;  2QKD A;  1SLL A;  1KGY A;  3WNM A;  4AEJ A;  4BYY A;  4YZ1 A;  3BTX A;  1R09 1;  4FOW A;  2P3J A;  3DL3 A;  3GBW A;  3AYA A;  3LKJ A;  4QM8 A;  4WZC A;  1AYM 1;  1QOT A;  2HBT A;  1N1Y A;  3RWK X;  1RHI 1;  4IV1 B;  4AVT A;  1UYP A;  5AFE A;  4XUN A;  5C4W B;  1VBA 2;  3H3L A;  3KHC A;  1QOS A;  1PO2 2;  1RXG A;  5LK5 A;  2ORZ A;  1WGP A;  1UYX A;  2HBU A;  1W06 A;  3H42 B;  4XJU A;  3LEM A;  4MET A;  2VQT A;  5FKB A;  4LIT A;  3VBU B;  1NXM A;  1RGS A;  2PYT A;  3ILF A;  1JHN A;  5KHK A;  2HKX A;  4RHV 3;  3GDB A;  3FC0 A;  4XFB A;  3T1M A;  4B8E A;  2QQW A;  5A7Q A;  1DF0 A;  2ZAC A;  4JQR A;  4EZ4 A;  4CXY A;  3WF2 A;  2EAK A;  1HRI 2;  5FZ0 A;  5IK4 A;  2IWG B;  2O1Q A;  2G4I A;  3A0N A;  5C8C A;  2A3W A;  4CP9 A;  4HPK B;  1ZYB A;  4OLL A;  3P6B A;  1PO2 3;  1CIY A;  2E51 A;  2NYY A;  3RVH A;  2Q1F A;  2WC2 A;  1VRB A;  5FMO L;  1GU3 A;  4KG8 A;  1FOD 2;  3O1R A;  5CFD C;  3BPZ A;  4UFI A;  3BIW E;  3ZYB A;  4JGZ C;  4ARX A;  2QQV A;  3ZXL A;  3MGU A;  2DFC A;  3BN6 A;  5BUV A;  5J7M A;  1J59 A;  2BPA 2;  4Q4W 1;  3PUH A;  4CPB D;  4IL7 A;  5IWF A;  1YRZ A;  3W21 A;  2WJS A;  3DN7 A;  5DZF A;  2WNU C;  1H8T A;  3RJR A;  2FCT A;  1V6N A;  2L9L A;  4OMC A;  3USU A;  1OLR A;  4H7L A;  1C1F A;  2VQ0 A;  2ZHM A;  1V6I A;  4M3C E;  3ROU A;  4LBJ A;  4KL1 A;  4N53 A;  4QKD A;  3UGG A;  4QWN A;  3I59 A;  3APB A;  4SLI A;  4Z1V A;  5K7P A;  1EAH 3;  2XJP A;  3IDA A;  1QQP 2;  5FLJ A;  3P5B A;  4HSL A;  2AAC A;  4DO0 A;  4FTE A;  4E9K A;  4LHK A;  1VAK A;  3DCQ A;  5CFC B;  4CXX A;  3CJX A;  3R0R A;  2P34 A;  2QCS B;  4GMP 1;  2ILM A;  4LO4 B;  2V09 A;  3WXP A;  1MS8 A;  1YLL A;  3FUO A;  1QDC A;  1QMJ A;  3ATG A;  2D97 A;  1V70 A;  2VNO A;  2DBN A;  3WF4 A;  3DKW A;  2C9K A;  5EV7 A;  4FPG A;  1LEC A;  3KS7 A;  4ATF A;  2VCA A;  4KWU A;  2DWR A;  3M7A A;  5K0U B;  1OA3 A;  3W59 A;  4CUB A;  2B9U A;  3QH7 A;  1RUJ 2;  2ZAH A;  2ZJC A;  4FFI A;  4P00 B;  2WWJ A;  5IVE A;  4BQ4 A;  2ZOE B;  2A3Y A;  1Z7S 1;  3HMY A;  3N7K A;  3UJO A;  2B46 X;  3M3E A;  4IGO A;  4LBM A;  1Q43 A;  2BBV A;  2WNE A;  4FPF A;  5A1F A;  2HH9 A;  3U07 A;  3WLU A;  4LK7 A;  3ZPY A;  2HEW F;  5A6Z A;  4QDS A;  3WDV A;  3OUI A;  4Q0Q A;  1O3R A;  3AYC A;  1H6X A;  2J1R A;  2QNK A;  5JPM B;  4DRV A;  5DUV A;  1NX9 A;  2RS5 3;  2WT2 A;  3EMR A;  3FBY A;  3MW2 A;  1ASJ 3;  4I0W B;  4CDQ B;  3HWJ A;  5FY1 A;  4HKO A;  2VM9 A;  1OFN A;  2B7Y A;  1VBC 3;  2BWA A;  4MGI E;  4PHZ A;  3N7L A;  3CJI C;  4QGL A;  4R9C A;  3VZK A;  2PHU A;  1HQL A;  2CY6 A;  3MLJ A;  4RD7 A;  2QQU A;  2VXJ A;  3SKV A;  1YXW A;  5FO9 B;  2RHP A;  4DS0 A;  1CX1 A;  1HB3 A;  1JW6 A;  4QX7 A;  3WW4 A;  5CG8 A;  2V4A A;  1J58 A;  4N53 B;  3ST7 A;  4PI2 A;  1C8M 2;  3INA A;  5T55 A;  2A6Y A;  2Z42 A;  1QXP A;  3CU7 A;  3GBF A;  3WQ7 A;  1UU6 A;  4PIX A;  5F5A A;  1WCQ A;  4PLN A;  4QHZ A;  2W1S A;  3ES4 A;  1QU0 A;  3AZX A;  3EXU A;  3WY6 A;  1N3P A;  4RHV 2;  4UOJ A;  4DUW A;  1XJA A;  1UOF A;  1GQG A;  2JJ6 A;  1MEC 2;  3OY8 A;  4YW6 A;  3ACI A;  1S0J A;  2EXJ A;  3U37 A;  2HWF 2;  5F8P A;  2CTV A;  2XOM A;  2BJS A;  1UQX A;  3AL5 A;  1G9B A;  1G8W A;  3OGR A;  4XAE A;  1ZBE 1;  3WNK A;  3O1U A;  3CNA A;  1LOB A;  1QKQ A;  5IYY A;  5JPN B;  2UWA A;  3VHO A;  1DCS A;  2R7E B;  1PMJ X;  1SLC A;  4IEU A;  1MQT B;  2EIE A;  2O8Q A;  2PA7 A;  3HEI A;  4XBL A;  1NOV A;  3DXU A;  1Z78 A;  3UES A;  1PHM A;  4CPB A;  2BBA A;  2WQ4 A;  4CU7 A;  2FD8 A;  1VBB 3;  2KD7 A;  4KI5 M;  4W65 A;  4JV4 A;  2BGP A;  4RQP A;  1UOJ A;  2PLV 3;  3H3Z A;  3NNG A;  2CDO A;  3HVD A;  4NUB A;  4A45 A;  4NAM A;  3S0M A;  3S5Q A;  5D8A B;  4MUV A;  4A7Y A;  1PVC 3;  5ACA 2;  1CAU A;  2WYS A;  4F8A A;  4AI0 A;  3FN9 A;  3PUR A;  2Y6K A;  1X36 A;  1OVS A;  5LA2 A;  3HD8 B;  1NZI A;  1WBL A;  1DQ5 A;  4UW6 A;  3WP3 A;  2P6H A;  3BUC A;  3ECQ A;  1O7F A;  2RS3 1;  4HVO A;  3VUO A;  3ZXD A;  4L8Q A;  2CV6 A;  2ZCW A;  3GZT B;  5BXX A;  3AKS A;  3ACL A;  3ZMO A;  5ABJ A;  5ISL A;  3NMB A;  3C7E A;  1AL2 1;  2RMU 1;  2JDM A;  1ODN A;  2IXI A;  1FMD 1;  2BNN A;  2H6B A;  2YBS A;  3J7M A;  3WW1 A;  3MFA A;  1R1Z A;  2ADE A;  3IDB B;  5FZ7 A;  3TNP B;  4I3P A;  4FXG B;  1ZVF A;  2BEO A;  1UF2 C;  2WL1 A;  3KT1 A;  2IXC A;  1PK6 B;  3ACF A;  1UZV A;  3A0K A;  4L9B A;  2NMN A;  3SCG A;  1B09 A;  2OPK A;  4NRP A;  4DY5 A;  3IDC B;  1NA1 A;  2VBB A;  2JX9 A;  4UF0 B;  1DDL A;  1AJK A;  1VE0 A;  4MGS A;  4BXF A;  5JUV A;  4HLT A;  1SCR A;  5FP9 A;  2CL2 A;  4Z92 B;  2WII B;  3I4I A;  4Q4X 1;  3BOD A;  4FI9 A;  1TMF 3;  5FZO A;  5FMC A;  1W6N A;  4Q4Y 2;  5APA A;  1LGC A;  2HWC 2;  1ZZ6 A;  3P3P A;  5LBB A;  4GKY A;  2FMD A;  1GOF A;  1RVF 1;  3R4S A;  5GZF A;  2C4X A;  1UX6 A;  4FVV A;  4QXB A;  3ZSM A;  1EY2 A;  4NRQ A;  4LKF A;  5F5C A;  2VZ1 A;  1WW5 A;  1MQT A;  5F3C A;  1DGR N;  3U11 A;  2D43 A;  3I2I A;  2TUN A;  2VG9 A;  2XHN A;  3MLL A;  3DPR A;  4ZKT B;  2RS5 2;  4XET A;  3IPV B;  1O4T A;  2X29 A;  4QXH A;  3ZSL A;  5FZH A;  4I09 A;  2ID4 A;  4NPM A;  4BQ5 A;  1H9W A;  1RUH 2;  3CZU A;  4JQT A;  2WFF 3;  1OT5 A;  2QQI A;  4NIG A;  1AYN 1;  1BBT 2;  3KF5 A;  3MV1 1;  4XAC A;  2QVS B;  1COV 2;  1YCI A;  5FZG A;  2RVA A;  4W6W A;  2OQ6 A;  5IHR A;  1BHG A;  1PGW 2;  1YJL A;  4YW4 A;  3GZU C;  1KXG A;  2NLR A;  2A6X A;  3ZDV A;  2YC2 A;  4C1X A;  3SHR A;  5FZD A;  2WLQ A;  3ETP A;  3GHN A;  2V5Y A;  4BCU A;  2ZKL A;  3PHM A;  1AR9 1;  4YW1 A;  3K2O A;  1RUI 2;  1NCQ A;  1JZ6 A;  3N7J A;  1CQ9 A;  1ULP A;  2WYF A;  3H8X A;  5KHH A;  4CU9 A;  1KFU L;  3KV9 A;  1ACC A;  2P2K A;  5J96 B;  2ZGU A;  5JDB A;  1E5I A;  1ULE A;  3WCR A;  3GXU A;  5I91 A;  1XSR A;  4QXC A;  2O8O A;  3H0O A;  1NY7 1;  2KR2 A;  2YV8 A;  3N4M A;  4OYU A;  1GNZ A;  5HXV A;  1JU3 A;  3VDD A;  1JHJ A;  1XE7 A;  3B69 A;  3RYP A;  2OA2 A;  1K42 A;  2VBP A;  1QOO A;  1GKB A;  2D5F A;  5F6K A;  2KXL A;  1Y9Q A;  2J1U A;  3UGH A;  2WA3 A;  1VRH 3;  3W5N A;  1LTE A;  4CVU A;  4XC9 A;  1NCR C;  2KA3 A;  3OSD A;  2IVI B;  4W50 A;  2DTY A;  4Y20 A;  4UFK A;  3IPV A;  2UU8 A;  2FDJ A;  1TME 3;  4HN1 A;  1LB2 A;  2RDS A;  3AJY A;  5CA6 A;  3RQ0 A;  1VIW B;  4CEY C;  2RDN A;  4AG4 A;  2GMP A;  4CU6 A;  1E5S A;  5CAZ A;  5FAX A;  1H2M A;  2JE8 A;  3BOW A;  3ACH A;  5JR2 A;  1ZZ7 A;  4GWJ A;  5D21 A;  1WW7 A;  2PFW A;  1JOB A;  3AMM A;  3MW3 A;  4QHO A;  4UW3 A;  4FO9 A;  5GLT A;  3RZM A;  1GAN A;  4JRL A;  4LXL A;  2R07 1;  3WP6 A;  3GJB A;  1TEI A;  3KQR A;  4B29 A;  4YM1 A;  5B2G B;  3C7G A;  1CJD A;  2Z79 A;  1QJE A;  1QJF A;  4IV3 B;  2PQS A;  1IPS A;  1VBA 3;  2WA4 A;  2JE7 A;  1H4G A;  4XW3 A;  2A5Z A;  5ERL A;  1FT9 A;  3TAY A;  2C26 A;  2WZE A;  3WUC A;  3FHI B;  4OHW A;  4BZ4 A;  3N9N A;  2I2S A;  4DEQ A;  3PL0 A;  2ZGR A;  4CUA A;  2VCM A;  1XC6 A;  3FLT A;  4IE4 A;  1ZBA 1;  2XLG A;  3JD7 2;  3IAP A;  1KDM A;  3KB5 A;  2VVE A;  4RQP C;  3SEP A;  2JDH A;  3LWC A;  4O7X A;  4XBQ A;  4L2N A;  4LBQ B;  4MO3 M;  3TB0 A;  4BDV B;  2JWP A;  4K8F A;  2GNT A;  3B93 A;  2G9F A;  4W6Y A;  3ZFG C;  5JMC A;  3TEZ A;  2UY8 A;  1NCR A;  2ZZQ A;  4Y5Z 0;  4QKN A;  3SKJ E;  1R08 1;  5IVV A;  2FCU A;  3DEM A;  2R30 A;  5FK8 A;  1US3 A;  5FPZ A;  4W6X A;  4Z82 A;  1VBB 2;  1CN1 A;  5A1A A;  3VHN A;  4ONU A;  1SLT A;  1WME A;  1MVQ A;  2VH9 A;  5A7N A;  3HNY M;  3HAG A;  5C3S A;  5DUX A;  1QXR A;  1PVX A;  4COY A;  3NAP B;  3SCF A;  2A73 B;  4M01 A;  1DFQ A;  5FZF A;  4AED C;  5KHG A;  3T2Q A;  1SBE A;  1VMF A;  1HXS 3;  3UK9 A;  4B1M A;  3RZK A;  1SCS A;  1A3K A;  1GFF 2;  2PTM A;  3KCX A;  4GWI A;  4QM9 A;  5E6H A;  4ZU7 A;  4AAP A;  1WMX A;  3ZN6 B;  3E6D A;  4Q0P A;  4MXW A;  2HWF 3;  1MEC 3;  1MVE A;  4WVW A;  4X8P A;  2EIB A;  3VBR B;  4CP0 A;  1NE6 A;  1QJU 3;  1GNH A;  3WX5 A;  1WCD J;  5C3P A;  1XE8 A;  3NV3 A;  3I3E A;  2FCV A;  4GWM A;  5FWJ A;  1X82 A;  3KVB A;  4N43 A;  5BNP B;  3MIG A;  1LOF A;  3W5M A;  1W90 A;  1RUN A;  5CG9 A;  2PHF A;  3MUY 1;  1EV1 2;  4FPL A;  1FAT A;  3NJY A;  2D6N A;  1DGR A;  1OVP A;  3RZL A;  1VBD 3;  4NVP A;  4WBB A;  1RUC 2;  2HWD 2;  1V6K A;  4R52 A;  3WV6 A;  1UOB A;  2OII A;  3MW4 A;  4WVM B;  4MVT A;  2VE1 A;  4COW A;  3RMY A;  5FYU A;  3K4Z A;  3OUJ A;  4XDO A;  2R0H A;  2DCJ A;  3HN3 A;  4IEZ A;  1SPP B;  3VBU C;  4XFI A;  3H8O A;  1DLC A;  4RFR B;  5KHJ A;  2GC2 A;  5T54 A;  5KHI A;  2J1V A;  4W8J A;  1WWY A;  1VMH A;  2AYH A;  3KV6 A;  1FYU A;  2JEM A;  4PDW A;  2W92 A;  1JUI A;  1WA6 X;  2VBD A;  3A22 A;  5EXO A;  4D0Q A;  2VVD A;  4DXR A;  5A6Y A;  3PJQ A;  2ZKN A;  2HWB 3;  3L2Y A;  3POY A;  2RM2 2;  1Q8O A;  5FIX A;  5HCH A;  4AVS A;  3WT3 A;  1YEW A;  4BWO A;  4D6S A;  2R06 2;  1RUJ 3;  4JDO A;  5BY5 A;  4A7Z A;  1G7Y A;  3I2K A;  3N9M A;  1JYN A;  3LA7 A;  1PO1 3;  2Y38 A;  3DUI A;  3BTA A;  5BNN B;  3K4A A;  1H30 A;  5FZE A;  2W1U A;  2VGD A;  3MBW A;  3WSO A;  1L3J A;  2HWE 2;  3T3Y A;  1PK6 C;  1F2N A;  4FT8 A;  3IBM A;  1QJY 1;  3K3O A;  2WUH A;  4BQW A;  3Q8A A;  1Y7B A;  1MZ6 A;  1F9K A;  2XL9 A;  4XDQ A;  2KM2 A;  4OCT A;  3ZIW A;  3LEG A;  3LFI A;  3VDD C;  3SEE A;  2VJX A;  4CEW C;  4XAA A;  2QQN A;  1NZC A;  2W39 A;  4LIV A;  3VDD B;  4FPH A;  4OHX A;  3Q9O A;  2BGC A;  5G04 L;  3GJA A;  1FV2 A;  2ATF A;  4K1Z A;  4L99 A;  4BE3 A;  4E2S A;  5JMO A;  4LHN A;  3RRD A;  3TNQ A;  1EPW A;  4URA A;  4ZZ8 A;  4XJA A;  1UZW A;  2GU9 A;  5FP3 A;  4JCK A;  1O8P A;  5GLU A;  4IUG A;  2BFU L;  2D3R A;  4CRQ A;  3BI3 A;  4LUL A;  4UXA A;  2XBO 1;  4FTS A;  4O65 A;  1ULF A;  4TYS A;  3ZFE A;  2ZX4 A;  2CSG A;  4D7S A;  4IGQ A;  1GZT A;  1PIV 1;  2O0O A;  4A44 A;  1PNG A;  5IAV A;  1V9U 2;  5IVY A;  1RUE 2;  1PX4 A;  3SIT A;  3J4U H;  5F32 A;  5LY2 A;  3EO6 A;  5AC9 3;  1OH4 A;  2BVV A;  1RUF 3;  3M3I A;  3QCW A;  4QX5 A;  1H2N A;  2LRO A;  2ZEX A;  4ZU4 A;  5A7P A;  2W91 A;  2ZGP A;  4P5H A;  1F5J A;  1UN1 A;  4UI9 L;  3RYR A;  2H0V A;  1AHS A;  2VZO A;  3I3B A;  1HV1 A;  1LOG A;  2JG8 C;  4QQL A;  3T0B A;  3VV1 A;  1FPN 2;  2WAO A;  2CAU A;  5JVV A;  5SV8 A;  5T50 A;  2RR1 1;  1EPZ A;  1S0E A;  1JZ3 A;  4BB3 A;  1SDD B;  1PGL 1;  3WG3 A;  1GP5 A;  2W94 A;  1Y4W A;  2FDK A;  2GN3 A;  3VHR A;  3O0V A;  5ANN A;  2FDI A;  3NAP C;  3ABZ A;  5C8C B;  2RS1 1;  3S30 A;  2VZV A;  3RGB A;  5E1R A;  3ZVX A;  3O12 A;  5F9T A;  2D6O X;  4Y24 A;  4JVA A;  2JDA A;  2WN2 A;  2X09 A;  3MLK A;  4NRO A;  1OOP C;  2W0X A;  3LSD A;  3NJZ A;  3NNL A;  1D4M 1;  4XF1 A;  1CJP A;  3VBF A;  4DIQ A;  4HSJ A;  2A71 A;  5CYY A;  4ZXK A;  3HT2 A;  2RJ2 A;  3ZYI B;  2XJT A;  4XFG A;  1LCL A;  3X29 B;  2QE3 A;  2Z4F A;  3BCW A;  4N8M A;  1QJX 1;  4FCA A;  3VD5 A;  3WDY A;  4BK4 A;  4EN9 B;  1B35 A;  2OXB A;  3ME2 A;  4LA2 A;  1QJX 3;  1ZX5 A;  1OSG A;  3WDT A;  4KNC A;  1M4W A;  4B7E A;  4M0N A;  5FJH A;  5H9R A;  4ZY9 A;  4DQA A;  3PVB B;  5DAP A;  1SG3 A;  1IS3 A;  1NQD A;  1D4M 3;  1REE A;  2ZX2 A;  3KCY A;  2W1W A;  4URT A;  2ETE A;  2GP5 A;  3ZN5 A;  5FR3 A;  3FMG A;  1A8D A;  3I2F A;  5FZ4 A;  1CGP A;  1VB2 A;  2R04 2;  1I6X A;  1ODM A;  2RS1 3;  3H1W A;  2D3P A;  2C0Z A;  3RDI A;  2W08 A;  3AP7 A;  5BNN A;  2N7G A;  1NLR A;  3OYW B;  4YRD A;  1WKY A;  3IB3 A;  4CCO A;  5JWP A;  3POJ A;  3CBN A;  2CWM A;  4IEW A;  5DN2 A;  1OXC A;  5BPX A;  4TTG A;  1E5R A;  5DG1 A;  4V1P A;  3ZYH A;  4DXT A;  2RR1 3;  3I49 A;  2VZU A;  1WMF A;  2XJU A;  2WO7 A;  4AFM A;  1UW8 A;  1UY3 A;  4YZ5 A;  2RE9 A;  1LGB A;  2ZGT A;  2BFU S;  2F6B A;  1RUF 1;  3VBS B;  4D7Y A;  4DZG A;  1LEN A;  4B4P A;  5FOJ B;  1CON A;  1V6L A;  3K48 A;  4XFH A;  5AC9 1;  4YVW C;  1LOA A;  4Y1V A;  5IAX A;  5CAD A;  4B1L A;  4FPC A;  1WLW A;  1RED A;  4XEZ A;  3NWK A;  2VTX J;  1PIV 3;  4GH4 C;  2D6K A;  5AVP A;  4Q8K A;  1HX6 A;  1QDO A;  3AP9 A;  3JXS A;  2BVB A;  5KC5 A;  4QQ2 A;  1GV9 A;  1S0C A;  2VXR A;  1MZE A;  2P4E A;  2XBO 3;  4LQR A;  2Y6G A;  1SMV A;  2QZ2 A;  2Y0I A;  4AEM A;  4MXV A;  1UIK A;  4R4X A;  1E57 A;  4CE8 A;  4A6O A;  2I74 A;  3OBT A;  1XNK A;  1GWM A;  4YVS A;  1BCX A;  2VMH A;  4X6R B;  4WM8 A;  1VAM A;  4XQ4 A;  5FZK A;  2AGS A;  3AJZ A;  2LTN A;  1GZW A;  2W1Q A;  4HZF A;  1SPP A;  4OUL A;  3KGZ A;  4WM7 A;  1PZ7 A;  3PUI A;  3O1V A;  2XWJ B;  5T52 A;  2A1X A;  2WWS A;  3HBK A;  3DPR C;  4IEQ A;  4ZZ5 A;  3ZFF B;  5IAT A;  1H8T B;  2AR6 A;  2WAA A;  3AKT A;  5C3R A;  1RIT A;  3OOX A;  1QJY 3;  4NWW A;  5HI0 A;  1A6C A;  2YDE A;  2DUR A;  3H8R A;  5JZG C;  1PMH X;  4BMB A;  2ERF A;  4HFS A;  4HON A;  5KXC A;  1MZF A;  4NAO A;  4CA9 A;  1GMM A;  3MID A;  4V2V A;  1LNS A;  1GZ9 A;  3LOB A;  3W58 A;  5GZC A;  1BQP A;  1LEM A;  1PO1 1;  5CVR A;  5AFB A;  5A80 A;  1PZ9 A;  1FXZ A;  2ZX1 A;  1SFN A;  4GJZ A;  5IK7 A;  5F2W A;  1DZQ A;  5FYS A;  5GLW A;  4FTB A;  1OPM A;  3DXT A;  1RUJ 1;  3WW3 A;  5C9A B;  3VZN A;  2DUO A;  2Q4S A;  4HK9 A;  1AXY A;  1YIF A;  4M3C A;  3RWN A;  2EXH A;  2AEN A;  4XFC A;  1R1A 2;  4HBN A;  4C0H A;  1U5Y A;  2HWB 1;  3UKV A;  2HYX A;  2ZML A;  5FY8 A;  3OBZ A;  3A7Q A;  1BJQ A;  4CCC A;  3TRS B;  3VBH A;  1XU2 A;  3MHZ A;  2VZR A;  3OUH A;  3WDW A;  3BTZ A;  4L0P A;  4XCA A;  3ZKY A;  3ZXE A;  1GNY A;  1J83 A;  2X53 S;  1HV0 A;  2GME A;  2R6Q A;  3CJI B;  3RS6 A;  4F3J A;  2OZ6 A;  3K46 A;  3QBQ A;  1AJO A;  1O5L A;  3ZFE C;  1W6N B;  3T4V A;  5FYZ A;  3KSC A;  2C5D A;  4FFH A;  1M06 G;  2XON A;  1AR8 2;  4LUK A;  1W6O B;  4RGK A;  4P9W A;  3O1M A;  1RUG 2;  1APN A;  1GOH A;  4L92 A;  4YG6 A;  5FZI A;  4Z2A A;  5FMD A;  1W8O A;  2I07 B;  1KRI A;  1VBD 1;  4IQP A;  3OJB A;  2WZR 2;  2QDR A;  2R49 A;  1H0B A;  3AMN A;  3NW4 A;  4LOR A;  3AYE A;  4JHT A;  5DAX A;  5A1L A;  1K12 A;  2JIJ A;  1KDK A;  3DPR B;  2AEY A;  5LA0 A;  3N9O A;  5KBF A;  5FRE A;  2VZT A;  3GNE A;  1QJU 1;  3N3H A;  4K1Y A;  4PIZ A;  1E5H A;  5FO7 B;  1IOA A;  1MEC 1;  2VMF A;  1BEV 2;  4O9G A;  4PQ9 A;  3U1X A;  3AFG A;  2HWF 1;  3OEA A;  3LE0 A;  5IUQ A;  3VKN A;  4IV3 A;  4Y1Y A;  5LK7 B;  1SZB A;  3KM5 A;  1GP6 A;  1ZM1 A;  1GQP A;  2J1S A;  2VVF A;  1ZNP A;  4FFG A;  4AVA A;  5FMO S;  5A70 A;  1A78 A;  1UY0 A;  3J8F 2;  3MIF A;  1ALY A;  1HXS 1;  3H8U A;  5J48 A;  1VBE 2;  4E8D A;  1WCK A;  2F17 A;  2VNR A;  4LR4 A;  1F8V A;  5IVF A;  1TNF A;  1LR5 A;  3ZKU A;  1YUD A;  5KXD A;  1RMU 2;  3ZN4 A;  1W2N A;  2QZ3 A;  2BTV C;  5EYY A;  1U12 A;  3WNL A;  4XJ8 A;  4LO8 A;  4TSV A;  4RS5 A;  4LBL A;  2XR4 A;  2Z5W A;  1WCS A;  1R08 3;  3TWI A;  4HKW A;  2VU9 A;  1W9Y A;  3T08 A;  4CDX B;  3H7Y A;  4OI4 A;  3S5A A;  1DQ4 A;  3KMH A;  4XZP A;  1T6B X;  1S0G A;  4QPI A;  5C33 A;  3VL9 A;  4AVV A;  1REF A;  3EQE A;  4MGK E;  1EYB A;  2CGP A;  4JKK A;  2WS9 2;  1ZBA 3;  4CCE A;  5LBE A;  4I30 A;  4YGE A;  3R6S A;  1PMI A;  1HJF A;  4LBN A;  5DQ0 A;  4AEK A;  3AC0 A;  3H50 A;  2B4K A;  2PHT A;  4Q27 A;  4UBG A;  4KWJ A;  4G9S B;  1AYM 2;  1O4Y A;  2D5H A;  1CAU B;  2YGM A;  2ZZJ A;  4Y4Y A;  3TN9 2;  4KU7 A;  5CFC C;  1DG6 A;  1VBA 1;  3ES1 A;  1C5H A;  1Y9M A;  2XLF A;  4FOQ A;  4QQP A;  3MDP A;  4AOC A;  5JOY A;  5IVB A;  4YSF A;  1WMD A;  1ENX A;  2BU9 A;  2V72 A;  3BYW A;  4W4Z A;  2R07 3;  3VD3 A;  1HB1 A;  4ATE A;  3W20 A;  4L97 A;  1LHU A;  2IUW A;  4A3Z A;  4HN0 A;  2G19 A;  1W39 A;  4B3N A;  1DYP A;  1C3H A;  1ULO A;  1NQJ A;  1LU2 A;  1W99 A;  4NIA A;  3RG0 A;  1VLN A;  3I3D A;  3MV0 1;  2BGO A;  4DUV A;  2D6P A;  4PBP A;  3ZPO A;  3VBU A;  3AMH A;  4Q4X 2;  2K0G A;  3VDA A;  5IFT A;  3RZJ A;  3ZMN A;  1TME 1;  2ZX0 A;  1LOF C;  5DPN A;  3PIJ A;  3WOG A;  1Q5O A;  3LD8 A;  1I9R A;  1S0B A;  4Y5T A;  4Q0V A;  4GA9 A;  2VAU A;  4QPG B;  1JI6 A;  3LB9 A;  1DQ2 A;  2W3J A;  3AKQ A;  3K51 A;  1UWW A;  3QLQ A;  5ABJ C;  3ZFE B;  1VRH 1;  3AXD A;  3WW2 A;  3ZR6 A;  5FPX A;  4XF0 A;  3N7M A;  2GMM A;  1UAI A;  4FP2 A;  4CCK A;  2YFU A;  1RL3 A;  3E5U A;  3DYO A;  3VBS C;  3WQB A;  4XJ9 A;  2P5B A;  4OZO A;  5E88 A;  5FRA A;  5L9B A;  4XF9 A;  4QGM A;  5CU1 A;  3O0X A;  1S2E A;  1STM A;  4K7J A;  1US2 A;  3SLI A;  1ZZ8 A;  3MIE A;  3VL8 A;  1BMV 1;  1XOY A;  4H55 A;  3NV1 A;  4PDW C;  2K46 A;  4K8R B;  3ZYP A;  1F5F A;  1RUD 2;  3CF6 E;  4ASL A;  1G6N A;  3ZXA C;  1WBF A;  2F4L A;  2JKB A;  4YGD A;  3CZJ A;  3IKW A;  3SQO A;  2BER A;  2FZ1 A;  4PIY A;  4OMD A;  5AVA A;  3THC A;  5IK8 A;  5E8A A;  3PDQ A;  4JX0 A;  5L19 A;  1AR9 3;  2E53 A;  4DB5 A;  4C91 A;  5C71 A;  2WBK A;  2WO1 A;  2OYZ A;  4UFL A;  1TZO A;  4AF9 A;  4MHU A;  1I5Z A;  1U5I A;  2E7T A;  1OI6 A;  3A23 A;  5E16 A;  3IT8 A;  3DV8 A;  3FUQ A;  1LKN A;  4XDP A;  4BQX A;  4WZF A;  1N47 A;  1OOP B;  3VBF B;  3QD6 A;  1AYN 3;  1PK6 A;  2OT7 A;  1C8N A;  2V4V A;  4FPO B;  2AZ5 A;  1HN0 A;  2E32 A;  4ISR A;  4HXC A;  4QU2 A;  3V65 A;  1O3Q A;  2EA7 A;  2WFF 1;  2VW0 A;  2HJI A;  2YBP A;  4NE9 A;  2VC9 A;  1YC6 1;  3JZV A;  2GC0 A;  4AQ6 A;  5CKQ A;  3UL2 A;  3KT7 A;  5HBA A;  4FQZ A;  3SIS A;  4QX1 A;  3VD7 A;  1YQC A;  2A6Z A;  3HQR A;  1IS4 A;  3AZY A;  3MIC A;  2ZHN A;  3E5Q A;  2BNO A;  1A8M A;  4XAB A;  4QD2 A;  2DU1 A;  3ZLI A;  1DU3 D;  1AR6 2;  3T30 A;  3H1M A;  2ARX A;  4IE5 A;  4BA6 A;  4RR3 A;  1ND2 B;  1OUX A;  4XFF A;  1RVF 3;  3AVR A;  4CDW C;  1R09 2;  4IEX A;  2DUP A;  3I54 A;  4CP9 B;  1X8M A;  1FX5 A;  1ND2 C;  3B9C A;  1OQD A;  4EWD A;  4P9Y A;  2WWU A;  3ON7 A;  1TMF 1;  4Q4X 3;  1UY4 A;  3QAC A;  4Z07 A;  2XGX A;  5FQ0 A;  4CDU C;  1JYC A;  2YU2 A;  4CEW B;  1RIN A;  2ZGS A;  4V2W A;  4BHP A;  1YYN A;  1JMU B;  1ZRF A;  1NG0 A;  2E7A A;  4PT6 A;  4WM7 B;  3THP A;  2EF6 A;  1PX3 A;  1JOP A;  1K5M C;  4WM8 B;  5DAQ A;  4AR2 A;  1JS9 A;  1OBN A;  3OG2 A;  1OUS A;  2MHF A;  1YJK A;  3BOP A;  5KXB A;  2E31 A;  5FZ3 A;  2CAV A;  2WNU B;  5CB7 A;  1QGL A;  1FMD 3;  1G86 A;  3CIH A;  2GP3 A;  3FZ3 A;  2RMU 3;  1R64 A;  1AL2 3;  3I8T A;  3WR0 A;  2OUH A;  4QU1 A;  1NCQ C;  5FY7 A;  1P8J A;  1K3I A;  5BNP A;  2JDZ A;  3DKQ A;  1BYH A;  3UYJ A;  2ARE A;  1OF4 A;  3POI A;  4GZ9 A;  4D94 A;  3QOP A;  3I3M A;  1HIX A;  2VR4 A;  2RS3 3;  5CFD B;  2DCK A;  5JIU A;  1TNR A;  1YI9 A;  2J1A A;  5LB6 A;  4NID A;  3U4S A;  1OKQ A;  1UD1 A;  1VAV A;  3V64 A;  5FPA A;  3I2J A;  1PVC 1;  3D0S A;  3SH4 A;  4XE9 A;  1W8Z A;  2VW2 A;  4HAN A;  4QPI C;  1OOP A;  3N9Q A;  3VN4 A;  2QQP A;  1CWP A;  2FHR A;  3NKG A;  1GP4 A;  4QPI B;  2PLV 1;  5T5L A;  5CKN A;  3N35 A;  3W9A A;  4BIO A;  1VBB 1;  3Q8B A;  4CDX A;  1UX7 A;  3DF0 A;  4R9D A;  4B4R A;  1ND2 A;  4N7U A;  2PN5 A;  2CNA A;  1NA1 B;  5KC6 A;  2FDG A;  1JN2 P;  2J22 A;  3M3Q A;  2PMW B;  1NYW A;  5DDJ 2;  3U14 A;  3GCW A;  3WVJ A;  1CD3 G;  1OPO A;  1RHI 2;  2W68 A;  4GAZ A;  3S6P A;  2ZA9 A;  3IN9 A;  2E33 A;  5G05 L;  4IXL A;  2ZX3 A;  1ZBE 3;  5D8A C;  3IM0 A;  5L9R A;  3CMG A;  5FLH A;  5A3W A;  1KJR A;  5A3M A;  5C7G A;  4OI2 A;  4Q0U A;  3RJ2 X;  1DYK A;  2JKX A;  4YVW A;  4ZON A;  2IVJ A;  5LBC A;  1Z0H A;  1GLH A;  2SBA A;  2EAA A;  3FL7 A;  2BOJ A;  3MIB A;  5F5Q A;  2VCC A;  5I8S A;  5ABJ B;  3D5O A;  1RC6 A;  3ZX7 A;  5L7O C;  3IDE A;  3PUA A;  5T3N A;  1IZ3 A;  3PVO A;  3RZH A;  4NO4 A;  3KZ4 C;  5FPB A;  1O4Z A;  3MI8 A;  3JB4 C;  4I02 A;  2MEV 2;  4LE3 A;  3ZSK A;  2YPJ A;  5FZC A;  4P14 A;  4UFM A;  1BKZ A;  2Y6J A;  2Q30 A;  2DCY A;  4H7M A;  4IDZ A;  4JGZ A;  1UZ0 A;  2VQU A;  3O0W A;  4RN5 A;  1O6U A;  4P9X A;  4EV0 A;  2JDK A;  1UCX A;  2XHK A;  5GJ6 A;  4AVB A;  3WNO A;  1SEF A;  4QPG C;  1C5I A;  2CGN A;  2FBE A;  3B01 A;  3DYM A;  1BK0 A;  3O1T A;  5KXE A;  1VBC 1;  3BU0 A;  4Y5S A;  4PCR A;  1HB2 A;  5IJR A;  4BJ0 A;  1ASJ 1;  4KBZ A;  2RS5 1;  1SAC A;  3U0Z A;  4GH4 A;  4Q8L A;  2BQP A;  2Q8D A;  2UWC A;  1NT0 A;  4HG6 B;  4KGQ A;  1ZA7 A;  3POG A;  4MZU A;  1N1T A;  5HCA A;  4P5Y A;  1KFX L;  1MS9 A;  2C1F A;  2WQZ C;  1IG3 A;  5BNO B;  1V6O A;  4MOA A;  1Z7S 3;  1UMI A;  1V00 A;  3LDK A;  2ZS6 B;  4AED B;  4NPR A;  3WCS A;  4YVS C;  1W6M A;  2PHR A;  3R05 A;  4QDQ A;  2OS2 A;  3E97 A;  1UPS A;  4BIF A;  5F3E A;  4RA0 A;  5CNA A;  1UOG A;  2R32 A;  2PHD A;  4WM7 C;  1XYN A;  4DUX A;  1ZZC A;  1CAV B;  4RQP B;  4BQ3 A;  1VJ2 A;  1NLQ A;  1VMJ A;  4LHL A;  3ZYR A;  4NR1 A;  4N90 A;  2WSV A;  5LRS A;  1WD4 A;  2DVG A;  2JD9 A;  3CO2 A;  4AI2 A;  4BM8 A;  4AZZ A;  5L7O A;  5K4L A;  5F6L B;  4GMP 3;  4XTM A;  3MIH A;  2WRA A;  3AP5 A;  1NCQ B;  4AHW A;  2XH6 A;  3EBR A;  4JAA A;  2VEC A;  3T09 A;  3VB9 A;  1H8V A;  2WFP A;  1K5J A;  1G9D A;  2IZW A;  1Z7S 2;  1GYK A;  1FAY A;  3ALQ A;  2UUR A;  3GZA A;  4DPN A;  4LMF A;  4EN8 B;  2PAK A;  1EAH 1;  2IFR A;  3FFZ A;  1DGL A;  4OHV A;  4GJY A;  2D93 A;  1W2A X;  2WZ8 A;  3NNJ A;  5A32 A;  2VOX A;  3HIF A;  4MGQ A;  4QAW A;  4A41 A;  3K75 B;  4KBB A;  3A21 A;  2NN8 A;  5JOX A;  5HCB A;  5LRR A;  1JU4 A;  1CX4 A;  4Q4W 3;  4S2F A;  1UPI A;  2G1M A;  3CL1 A;  1FNY A;  4NHM A;  3VBR C;  2UYB A;  4M3C F;  3M3O A;  4PLM A;  5C8W A;  4IEP A;  1IGO A;  1XND A;  2J1E A;  2IXK A;  1N1S A;  2JE9 A;  2PXJ A;  2WNO A;  3BPS A;  3GYD A;  4QX8 A;  3RPQ A;  1W2T A;  3N9P A;  4K20 A;  3SMH A;  1PO2 1;  4O61 A;  3WD5 A;  2NPI A;  1V0A A;  4L11 A;  4XQW A;  4YM2 A;  5JSP A;  5JOW A;  3AXE A;  1YFY A;  3MF6 A;  3OGG A;  2W46 A;  3EJK A;  4P9J A;  3V56 A;  5DUU A;  4CCL A;  4D7T A;  3JUU A;  1YFX A;  1DIW A;  4CDQ A;  4AHY A;  2HEV F;  3KHB A;  4RHV 1;  2D40 A;  2B39 A;  1QF3 A;  4JTN A;  2BZD A;  1L7L A;  4YZ3 A;  4DFS A;  2F4P A;  1NKG A;  3OB8 A;  2CWS A;  2IXJ A;  4NII A;  3ILR A;  4Y22 A;  3USU B;  1SBD A;  1J84 A;  2G9Z A;  4LO7 A;  1SBF A;  5FXW A;  4CEY B;  2GDF A;  3UKN A;  1LJ7 A;  3CQO A;  4ET7 A;  1RHI 3;  1MS5 A;  5T5O A;  1AYM 3;  1W05 A;  1JBC A;  4S2G A;  1G9A A;  1I5P A;  1LED A;  3MPB A;  1R09 3;  3WDX A;  4PI0 A;  5FZM A;  5IFP A;  1HKD A;  1DLL A;  5CFD A;  3VDC A;  5CIS A;  1LRH A;  3B00 A;  2W9X A;  4UFH A;  1QEX A;  1XRU A;  3LIG A;  3RZG A;  4OI0 A;  5EYX A;  1DBN A;  2C24 A;  4Y1Z A;  3III A;  4YG3 A;  4IE6 A;  5C9A A;  2CYF A;  3AKP A;  3WQ1 A;  1UU4 A;  4OHY A;  4Q26 A;  1DZR A;  1N3O A;  2YG0 A;  5ACA 1;  2JDU A;  3WDU A;  1DHK B;  1PGS A;  1MR5 A;  2G9G A;  3KV4 A;  4BOW A;  2PHX A;  3NST A;  4EWE A;  3E6C C;  1O3S A;  4N53 C;  4FAH A;  3VBR A;  4RS5 C;  3K3N A;  3O7O A;  1S2B A;  5DAV A;  4GXL A;  2WZP P;  4NJ4 A;  1UKG A;  1XNA A;  5EJ3 A;  1ZRR A;  4H3W A;  1SQ4 A;  3D4K A;  1H2L A;  1POV 1;  3TOJ A;  1ZRE A;  4YM0 A;  5FUI A;  1H2K A;  1HDK A;  2YMZ A;  1IPK A;  1C57 A;  4YW5 A;  1AL2 2;  1Q56 A;  1W9F A;  3GHM A;  4OUS A;  4ASK A;  5A3N A;  5D8A A;  1YO8 A;  3J8F 3;  2YHJ A;  2WLP A;  2Y8K A;  2VUD A;  1S0F A;  2K2S A;  4CDQ C;  2QQK A;  4COZ A;  4UAP A;  2HYK A;  5FY0 A;  4EQV A;  2JDP A;  3ZSJ A;  1S4C A;  5A33 B;  1AR7 1;  3O14 A;  1TG7 A;  1T6G C;  1BEV 3;  5DXD A;  3ZYF A;  1W03 A;  1UXX X;  4QMA A;  4ES8 A;  1XSQ A;  5F2S A;  1OA4 A;  5LY1 A;  1QIQ A;  2QUO A;  4EWA A;  2FDH A;  4MYE A;  4AGV A;  1YI7 A;  3AZV A;  2JB8 A;  4C90 A;  3T0D A;  2XPJ A;  3PTR B;  1C1L A;  1EV1 1;  4MXW B;  2GNM A;  3UT0 A;  3FLP A;  4TXW A;  4CSW A;  2XJV A;  3ORJ A;  3D0J A;  2Y0O A;  4IV1 C;  2XDV A;  2JXA A;  3WQ0 A;  1WLT A;  3UJQ A;  1RUG 3;  1RVF 2;  1L7R A;  1TE1 B;  5FYI A;  1JZ4 A;  1AR8 3;  4KQ7 A;  1JYW A;  3G6J B;  2QQL A;  3WF3 A;  2PQQ A;  3VBS A;  1W8F A;  3GZE A;  2VCB A;  1H4H A;  3ENR A;  3KD4 A;  5M0T A;  2JIC A;  3NV4 A;  4UF0 A;  4YLZ A;  5LEJ A;  3I2H A;  2CGO A;  5FZO B;  5LEK A;  4JDN A;  4MX3 A;  5F39 A;  1RUH 1;  3VZO A;  4PJY A;  4PLO A;  5FLI A;  4QQH A;  1WLC A;  2R1B A;  1VB4 A;  4RS5 B;  1COV 1;  4YVS B;  2DDU A;  3CEW A;  2Z69 A;  4G4F A;  3N36 A;  2XXZ A;  1PGW 1;  4WV8 A;  1IS6 A;  3M3C A;  3RZZ A;  3E1F 1;  3CDZ B;  1RJ7 A;  4P9L A;  1F35 A;  1N1V A;  2XUM A;  1HRV 2;  4AHZ A;  4EYU A;  2ZXQ A;  3F2Z A;  4LLO A;  2XVK A;  1VR3 A;  5GZE A;  2XQX A;  1MS1 A;  2JG9 B;  4XMA A;  1C28 A;  4HL0 A;  1W8N A;  5FYH A;  1O59 A;  5LBF A;  5JAX A;  1MPX A;  5DAB A;  1ZRC A;  1J1L A;  2BOI A;  5FPV A;  4LHS A;  4CZS A;  3KCC A;  3O5S A;  3TN9 3;  4XUP A;  1LGN A;  5DDJ 3;  5C8C C;  5EJZ B;  2WT0 A;  1H1M A;  1UU5 A;  4Y20 B;  3WHU A;  1BVP 1;  4LIU A;  4K6B A;  3V0B A;  1EUT A;  1WW4 A;  5IVJ A;  5JOZ A;  1W3V A;  5HPO A;  4HVR A;  4NHK A;  4RR3 C;  2VMI A;  4GB3 1;  3WNP A;  2WN3 A;  4XF4 A;  4DMI A;  2JG9 C;  3KWV A;  1W2U A;  5JXI A;  4E4S A;  2OUJ A;  2Z2S B;  2WO2 A;  2P3Y A;  1Y9G A;  3H1Y A;  1ZZ9 A;  4AI9 A;  3UGF A;  2P17 A;  1RIR A;  5A3T A;  1OLM E;  4XOG A;  3FHA A;  4IEO A;  2Q8E A;  2OKX A;  2W52 A;  4B7K A;  4D6R A;  4YZ4 A;  1DQ6 A;  1BXH A;  3PU3 A;  3WNN A;  1W2O A;  3HOB A;  3VBO A;  4LUM A;  4XTP A;  5C5U A;  4RYD A;  1QWR A;  3MUZ 1;  2DF7 A;  5IW0 A;  2VUJ A;  2Y26 A;  5IK5 A;  5FMB A;  1CES A;  1V9U 1;  1XU1 A;  2HWD 3;  5F3G A;  1NAE A;  2RMU 2;  4Q4V 1;  2PEL A;  1WLD A;  3TBD A;  5HV0 A;  1C8M 1;  2VOK A;  5FY5 A;  3B9I A;  5BNO C;  4QGN A;  1U5X A;  3IIA A;  5JI7 A;  4D3W A;  3THT A;  5FUN A;  2YYO A;  5JCT A;  3IAQ A;  1YNA A;  3POF A;  3ZSE A;  4HPK A;  4QHB A;  5DAW A;  5FP8 A;  4P9G A;  4FPY A;  2DVA A;  2RR1 2;  1SFP A;  4NIH A;  4GWN A;  1XBF A;  3AZW A;  1RB8 G;  3MO4 A;  3SCH A;  1XB9 A;  3AB0 A;  1NA1 C;  2VMD A;  1KQR A;  2E26 A;  3PIG A;  4LA3 A;  1GR3 A;  1ZBE 2;  1HQN A;  1JUH A;  2LM3 A;  2WZR 3;  4AK3 A;  1RUC 1;  4Q4Y 1;  3ACG A;  3T2T A;  4COV A;  2VY0 A;  2HWC 1;  4IGP A;  5CBL A;  3O1S A;  1QY4 A;  1FNZ A;  4ZU5 A;  4YG0 A;  3FWE A;  2DFB A;  3J26 N;  5BV6 A;  2B5H A;  2PAM A;  2RV9 A;  3OY8 B;  1CAV A;  2RG4 A;  5JSO A;  2BV4 A;  4LJH A;  4M4P A;  4NN0 A;  3ZXG A;  4K21 A;  4AFB A;  5CKM A;  5BNP C;  1LHW A;  4BIS A;  3WEZ A;  4ZPI A;  3V0B B;  1XNB A;  1K5M B;  1F15 A;  2VMC A;  4FOV A;  4XPV A;  3WNX A;  4GMP 0;  4LO6 B;  2XKO A;  1W9T A;  4YM3 A;  3SH5 A;  4E2Q A;  2ZGN A;  4HET A;  4AHX A;  2WS9 1;  3JD7 3;  3S7I A;  2RS3 2;  1RMU 3;  5C3Q A;  4RGG A;  1ULG A;  5C4W C;  1IPJ A;  3AX4 A;  4YFW A;  2ADD A;  2DYC A;  4H2A A;  2WQ8 A;  2B9V A;  2DU0 A;  1UNB A;  4PF1 A;  1GZC A;  2RJL A;  4LE4 A;  2A3X A;  3B5L B;  5JZG B;  1XNT A;  2BWC A;  3LFM A;  4GKX A;  5K8S A;  3POE A;  1MS3 A;  1U5Z A;  4FFF A;  5LZ6 A;  4AE2 A;  1X33 A;  4Q2F A;  2P3K A;  2WAB A;  1HRV 3;  4OI1 A;  3NKT A;  4JDM A;  4NHL A;  3VKF C;  1XYP A;  5FBJ A;  2IFW A;  3LAG A;  5J36 A;  3ILN A;  4YVW B;  1IS5 A;  1LOE A;  1YFU A;  3VLB B;  2FQP A;  4J1W A;  4NMI A;  4OHZ A;  3C7F A;  4ERO A;  3SC7 X;  3KGL A;  4AI1 A;  2HEY F;  1UKR A;  2XJS A;  2ENR A;  2CU5 A;  3LSE A;  1MS0 A;  2D98 A;  2OVU A;  3PMS A;  4KMQ A;  4LKD A;  2GH8 A;  2P3I A;  5FBZ A;  5CZK A;  2DTW A;  1PM7 A;  4E2G A;  1AR6 3;  3H9A A;  5I93 A;  4HMZ A;  3AMQ A;  5GKA C;  3K77 A;  1S2K A;  4N43 B;  3WF0 A;  1J3Q A;  2QQJ A;  4LO5 B;  4HT1 T;  4YNI A;  1Q8S A;  4QPG A;  1Y43 B;  5FYB A;  4K40 A;  5GZD A;  1AYN 2;  3QH6 A;  5FP7 A;  2DV9 A;  3H7J A;  1DQ0 A;  5FYT A;  2ZAA A;  2JD4 A;  4E27 A;  4K9S A;  2RM2 1;  3HPN A;  3RFR A;  1GQH A;  2YC4 A;  2ZTN A;  1BMV 2;  2CDP A;  2YB7 A;  3NNF A;  4DEV A;  2R06 1;  5J1X A;  3JBG 1;  1JOJ A;  1CAX B;  1D0H A;  2ZEZ A;  2DVD A;  1EUU A;  5BNN C;  1FPN 1;  4OQ8 A;  3BTY A;  1DP0 A;  3VDB A;  2YU1 A;  2VNG A;  5I8T A;  1GZW B;  4CCN A;  4FBF A;  1X9T A;  2YBK A;  3PUS A;  2JIG A;  1VAL A;  2BRT A;  2ZGK A;  3PJY A;  5DZE A;  1GUI A;  1IQA A;  1RUI 3;  4AQS A;  5A3L A;  5FO8 B;  1WUV A;  3GM8 A;  2HWE 1;  2JDN A;  1RUD 3;  1UYZ A;  2R04 3;  5LAS A;  3G7D A;  3IMN A;  3S57 A;  3ZR5 A;  1LHN A;  1ZZB A;  2WIN B;  3PTY A;  4QXK A;  2VNV A;  2XG3 A;  1NY7 2;  2Y33 A;  4S2H A;  4GQ7 A;  3AK0 A;  2J42 A;  1UIJ A;  1LHV A;  4XHX A;  4YGB A;  5KR7 A;  5JR7 B;  3BKZ A;  4YW2 A;  5EFU A;  2P37 A;  2WFF 2;  2NP0 A;  1X9P A;  2E9Q A;  1YQ5 A;  4Q29 A;  1Q3E A;  1RTV A;  4LTA A;  1R08 2;  4XF3 A;  1G9F A;  2IXL A;  2ZGQ A;  3EB7 A;  4J6G A;  1JZ2 A;  1ZRI A;  2P6C A;  2DCZ A;  2OZJ A;  1T2X A;  3D6E A;  4PQQ A;  4A7K A;  4BQY A;  4C1W A;  3VBO C;  1JH5 A;  2C9A A;  2XKP A;  3ELN A;  4CP1 A;  1AUY A;  1SLB A;  3FBM A;  1S0D A;  4BLI A;  3FFQ A;  4MAD A;  3VBO B;  2OW4 A;  4XFA A;  4E8C A;  2ES3 A;  1RUE 1;  1FI2 A;  3K4D A;  2X05 A;  4CTE A;  2Y60 A;  1FMD 2;  4I01 A;  3MZH A;  5EIY B;  4TWT A;  3VHP A;  1NCR B;  1RYY A;  2WSU A;  3EHK A;  2PAE A;  3NRU A;  1QNY A;  1AX1 A;  4NHY A;  1KEX A;  4C0B A;  2JG8 A;  1H6Y A;  3ZDS A;  4E4D X;  1JYT A;  4YW7 A;  4ZS3 A;  4TZD A;  5SV5 A;  1NUK A;  4TLF A;  3JQW A;  2XVG A;  1AXZ A;  1W6P A;  3VZJ A;  5I8Y A;  1HRI 1;  3ZFG B;  1DQ1 A;  2FDF A;  1RUF 2;  5FUP A;  3HT1 A;  4QX0 A;  5EQU A;  2W2I A;  4XUQ A;  3A4U A;  1URX A;  4P9I A;  4GAL A;  5H9Q A;  5J98 B;  2QDN A;  1F4A A;  1VBE 1;  4HKL A;  3FHQ A;  1FOD 1;  4XUO A;  2GN7 A;  4QX3 A;  5FXZ A;  2TEP A;  2VZP A;  4DIN B;  2J7M A;  1RJ8 A;  1CIW A;  1F4H A;  1GOG A;  3OD0 A;  1ZBA 2;  4Q4W 2;  2DBI A;  3ITQ A;  4LKS A;  4CDW A;  1HQW A;  5C6C A;  1OLM A;  2YPD A;  3J7L A;  3Q8C A;  4X8N A;  3NJV A;  1S1A A;  5A7W B;  3WP4 A;  4CP2 A;  3I59 B;  2GH2 A;  5FPL A;  3ETQ A;  4XZU G;  1JYI A;  1A34 A;  4LOS A;  5FTT C;  2Q8O A;  1PVC 2;  1YWK A;  1W6Q A;  4OUE A;  2WNV C;  3SNM A;  1W28 A;  1BBT 1;  2JDY A;  1QQP 1;  1XYO A;  3I2G A;  4JGY C;  4XJW A;  4KH9 A;  4S2D A;  5L36 A;  3O1O A;  1R1A 3;  2VZS A;  4NOT A;  3P1I A;  2P1B A;  1UYY A;  3OEB A;  1YIP A;  4PF5 A;  1X7N A;  1CAX A;  1K5M A;  1OKO A;  2BYV E;  1HLC A;  2Y6H A;  3B3Q E;  4Y1X A;  4JZR A;  1W6M B;  5DZG A;  1BK1 A;  3RSJ A;  1W8H A;  4BQ2 A;  2VUA A;  2XLA A;  3Q8E A;  1YFW A;  1AVB A;  4CUC A;  4GIQ A;  4ASM B;  5JLV A;  1OH3 A;  4YW3 A;  1QNW A;  2H6C A;  1MS4 A;  4CCD A;  1PO1 2;  2LS6 A;  2GAU A;  5I0U A;  3GBG A;  4CDU A;  1K45 A;  4QDR A;  3R4U A;  4AFC A;  3UET A;  2Q0A A;  2RDR A;  1W8T A;  3HN1 A;  2YY1 A;  3C8X A;  3HJR A;  4AFD A;  2CHH A;  3PVN A;  2R16 A;  2EID A;  1OFS A;  2V73 A;  5LAT A;  2VMG A;  1BLZ A;  5AC9 2;  5E89 A;  2MEV 1;  4RFT 0;  2Y6L A;  1W0O A;  5FYM A;  1ND3 B;  1OLQ A;  3RI8 A;  1TQ5 A;  3C7H A;  4FPE A;  5FZ1 A;  4Y1U A;  1IKQ A;  4U36 A;  3OPT A;  1Q8V A;  5H9P A;  3LEK A;  4J25 A;  4R9B A;  1KD7 A;  3WG1 A;  4WVV A;  2VPV A;  1VBC 2;  4AQT A;  1UL9 A;  4QKB A;  2Q1M A;  4XIL A;  3OBR A;  1RXF A;  1JZ8 A;  3POS A;  4JGY A;  5CEH A;  3KF3 A;  3V0A A;  4KU8 A;  4Y26 A;  3I2O A;  1CAW A;  3VD9 A;  2MEV 3;  5BYN A;  2QQO A;  4RR3 B;  3UNP A;  3BU7 A;  4CXW A;  1CR7 A;  1QH7 A;  5I0S A;  5FYY A;  1GWK A;  4BQ1 A;  4F7Z A;  4MGT A;  4XYX A;  4DXS A;  2AEZ A;  4EJR A;  2I45 A;  2ZHL A;  4AI8 A;  2XWB B;  2V5D A;  5FXV A;  3LZZ A;  4CDX C;  1H1I A;  2ZAB A;  1ENS A;  5FY4 A;  2ZBJ A;  3LCP A;  4A2U A;  3JB8 A;  2VUL A;  2QQM A;  2VTF A;  5FY9 A;  1OF3 A;  2JEC A;  2JEN A;  4CU8 A;  4RSU A;  5D2A A;  2DUQ A;  4N43 C;  5H9S A;  5K0U A;  4C8D A;  3ZIX A;  3ZM8 A;  1HXS 2;  2RS1 2;  2OX0 A;  2GZW A;  4KWL A;  1QJY 2;  5FK7 A;  4Z2W A;  2JG9 A;  2ZGL A;  2E6V A;  4IE7 A;  5FZ6 A;  4Y22 B;  1CZT A;  1LES A;  1J3P A;  4EN7 B;  5F1R A;  2GC3 A;  3D82 A;  1R1A 1;  3C7O A;  2AC1 A;  4CCJ A;  5IVC A;  2MNG A;  1JZ5 A;  1QQP 3;  3ZFF C;  1LUL A;  1EAH 2;  4XMI A;  1BBT 3;  4I3G A;  4OFG A;  3J7N A;  1XPW A;  3POW A;  2GAL A;  1L7Q A;  1YQ2 A;  5BNQ A;  5FJK A;  2UY9 A;  2X5I B;  5FZL A;  3DEC A;  3LPG A;  4M3C B;  3P3N A;  4QQO A;  5A3O A;  3H3U A;  1PIV 2;  1QHD A;  2A7A A;  1H9P A;  4E4Z A;  2QBX A;  4G3Y C;  4X6Q B;  2D6L X;  4FPJ A;  1FOD 3;  4XUR A;  3J9S A;  1VBE 3;  1NXD 1;  5A6Q A;  4XXP A;  3VBH B;  5J3U A;  3C3V A;  4FP3 A;  4NHX A;  4JTO A;  2UYA A;  1TMF 2;  2W47 A;  3HNB M;  1UMH A;  3LDB A;  1D2S A;  3BAL A;  1RUO A;  2ET7 A;  1CZV A;  4SBV A;  2E7Q A;  2Y34 A;  5A3P A;  1OQE A;  4M4R A;  3UV9 A;  1EP0 A;  2MPF A;  1HRI 3;  3OTF A;  5FDB A;  1UZY A;  1S0I A;  3MF9 A;  3AMP A;  4LEJ A;  4NWV A;  2ET1 A;  1XNC A;  2VZ3 A;  2X8K A;  4FXK B;  1D4V B;  4LK6 A;  2LW8 A;  3ZYG A;  1J1T A;  4IV3 C;  2VME A;  3PLQ A;  1UO9 A;  2VL4 A;  5BNO A;  1IG0 A;  4JKM A;  4K3U A;  4JHZ A;  2OQ7 A;  1O91 A;  2ZEW A;  3RYK A;  2TNF A;  4MGZ E;  2EIG A;  4IW3 A;  5I0T A;  2FZ2 A;  1RUE 3;  1AX0 A;  2X10 A;  5LA9 A;  5GAL A;  1H8T C;  5FV3 A;  3PME A;  3B7M A;  3M8L A;  3VKO A;  4CEW A;  4CCM A;  1Q8Q A;  3WHT A;  3BGA A;  4IEY A;  4BU2 A;  4NRM A;  3S7E A;  4EN0 A;  4Z8B A;  3PU8 A;  1D4M 2;  2UWB A;  4RGA A;  1YHF A;  5DMY A;  5JXG A;  1D7P M;  1XE0 A;  4I0B A;  4CEY A;  1CZS A;  2WT1 A;  2BP6 A;  1LU1 A;  1MZ5 A;  3HQX A;  5HCF A;  1C4R A;  2GNB A;  3IMM A;  2J1T A;  3N9L A;  1ZRD A;  3MYX A;  2WNV A;  1W6Q B;  2YC0 A;  4OUM A;  2Y64 A;  1AL0 G;  3FE5 A;  4I0A A;  5B4X A;  1XQN A;  5K9Y A;  4LPL A;  3VKM A;  3PNA A;  3EYP A;  5HV4 A;  4GH4 B;  4FAG A;  1Q8P A;  1PM4 A;  3IWZ A;  2R1D A;  3KV5 A;  3GAL A;  4I2O A;  2EVX A;  5CFC A;  1AXK A;  3VKL A;  4EE2 A;  2YXS A;  2ORX A;  1O8S A;  2R04 1;  1RUD 1;  3KVA A;  2HWE 3;  5EPA A;  2BDR A;  1AR9 2;  3UKT A;  3L2H A;  2XVL A;  4MLO A;  5ANQ A;  2XB6 C;  1RUI 1;  5EZW A;  5JZG A;  4AI3 A;  3L9J T;  4AGG A;  1F31 A;  5FWE A;  3DYP A;  1ZA4 A;  1NE4 A;  1LAJ A;  1SFY A;  1U0A A;  2XQR A;  4ORF A;  3AYD A;  5A7S A;  5T5J A;  5TSW A;  1GWL A;  3LOI A;  4F83 A;  3KQ4 B;  4XCB A;  1WA4 A;  2D44 A;  5FCC A;  4AYU A;  1FPN 3;  1SHW B;  4DRR A;  5FOB B;  1IQD C;  2ARB A;  3JBG 3;  2R06 3;  3LF7 A;  3NJX A;  5A7O A;  2VQA A;  5C5T A;  3VD4 A;  3OGS A;  2ZHK A;  1VPH A;  4IEV A;  2YUE A;  2YZ4 A;  2RM2 3;  2PHL A;  4MSV A;  4BLJ A;  4A42 A;  5JIA A;  1ENR A;  3NQH A;  5C9A C;  1UMZ A;  3OYW A;  3E5X A;  1NLS A;  3POB A;  1TVG A;  2NM1 A;  4MHR A;  4P02 B;  1X8E A;  3CJI A;  3URF A;  5J37 A;  3T0A A;  4LNV A;  1ND3 A;  3U78 A;  2WKK A;  4TN7 A;  3VBF C;  4A3X A;  1WCU A;  2D3S A;  2ZPX A;  3AZZ A;  3VBH C;  1VP6 A;  2D6M A;  1OUR A;  5FXX A;  4ES9 A;  3AM2 A;  4LBK A;  2XBO 2;  3RI9 A;  1AR6 1;  4MH0 E;  3HR9 A;  2X5I C;  1ASJ 2;  1KS5 A;  3TEX A;  3WG2 A;  4PBO A;  4ZHN A;  4CUG A;  3WZ1 A;  4Q0S A;  1VBD 2;  5DG2 A;  3OGV A;  3PUQ A;  5GM0 A;  1WW6 A;  1YQ8 A;  2PHW A;  1N3Q A;  1UY2 A;  4TLG A;  3BIE A;  4AAX A;  4RL7 A;  2OPW A;  3WUD A;  2RDQ A;  3TYJ A;  4OZX A;  5GLZ A;  5I0D A;  3T2O A;  3FX3 A;  4WVM A;  1J3R A;  1ST8 A;  5F5I A;  3AP4 A;  1UY1 A;  3I3Q A;  3I7D A;  3SH3 A;  4DOU A;  1HRV 1;  1QJU 2;  3GGL A;  3NO8 A;  2R07 2;  4EZH A;  5EWS A;  1UXZ A;  4UW5 A;  4CYD A;  4N7I A;  4M00 A;  1W8U A;  4FQ4 A;  4AFA A;  4P08 A;  5D1I A;  4AED A;  5FP4 A;  2D7F A;  4ARY A;  4Y33 A;  4FSJ A;  1D0G A;  4QB2 A;  5K0U C;  2A6V A;  2DVB A;  3JCI A;  2W95 A;  2W87 A;  2ZGM A;  4YAR A;  2LRP A;  5F37 A;  4O9E A;  3TEY A;  2QTW B;  4Y4R A;  3AKR A;  3U10 A;  1HN1 A;  1DYO A;  2BNM A;  4LBQ A;  1RMU 1;  5FYC A;  4FOY A;  5C70 A;  2EXI A;  2WS9 3;  2YFZ A;  3GF6 A;  3FLR A;  3JD7 1;  2E63 A;  1JXN A;  3OF1 A;  4YYO A;  4LT5 A;  3ZFF A;  4AVC A;  4YWA A;  4A4A A;  2XL7 A;  2VOW A;  4ITC A;  2YRO A;  4U2A A;  3T1L A;  4N9I A;  3BVC A;  1QJX 2;  3D8C A;  4M0H A;  2FMY A;  2VO5 A;  4YZ2 A;  2GSY A;  3FJS A;  4QB1 A;  2GC1 A;  4GD4 A;  5A3U A;  3LQC A;  3GCX A;  3MFC A;  1CPN A;  4IE0 A;  4IV1 A;  3HNM A;  2PLV 2;  1OA2 A;  2VTX A;  4ZS2 A;  2Q1Z B;  3MPP G;  3ZXK A;  1YQ6 A;  1AX2 A;  1JTZ X;  4OVE A;  3T2P A;  4BH9 A;  4QB6 A;  1W3X A;  2EIC A;  2Q8C A;  1OD3 A;  4ISQ A;  4LBO A;  3IZO A;  3WG4 A;  2BUK A;  3B94 A;  2HWC 3;  5EJ1 B;  4ZXE A;  4Q4Y 3;  1RUC 3;  3B02 A;  1PNF A;  1HJG A;  2H0B A;  2WZR 1;  3HQU A;  4JGZ B;  4EN6 B;  3U4X A;  4Q4V 2;  1LOC A;  3RMX A;  1KIT A;  1OMI A;  3LGR A;  1KS4 A;  1X50 A;  2NQY A;  2WR9 A;  2JG8 B;  2VOV A;  3J7H A;  2XJR A;  1ENQ A;  4IER A;  3LPF A;  1W9S A;  2WO3 A;  4XXA A;  4KG0 A;  1V6M A;  1V6J A;  4FPK A;  4QX2 A;  5B4N A;  3OCP A;  4MG2 A;  2ZMN A;  4Q5O A;  4NPL A;  4HK8 A;  5FZ8 A;  2XJQ A;  4UT5 A;  3AVS A;  3SXW A;  2EAL A;  5HXM A;  4BME A;  1POQ A;  5LA1 A;  1C8M 3;  2DVF A;  1MQT C;  2B8M A;  4Q4V 3;  1W8W A;  2HWD 1;  3M70 A;  5IT6 A;  1JYV A;  1FV3 A;  1GIC A;  1V9U 3;  4QT6 A;  4DY3 A;  5FZ9 A;  2R0F A;  1LOD A;  3M2M A;  1TME 2;  3O1P A;  3F95 A;  4UBH A;  4H14 A;  4LOT A;  3ZOI A;  4YPJ A;  4AL9 A;  4DXZ A;  5LCW L;  2VW1 A;  1JOD A;  2B45 X;  4JRA A;  4LBQ D;  4Q1P A;  2ZGO A;  1XXN A;  3C2U A;  2Q5T A;  2WNU A;  3NL1 A;  5C3O A;  3LDR A;  4XQD A;  5J09 A;  2IC1 A;  1W0P A;  1W0N A;  3OD4 A;  2QFE A;  2WNV B;  4UWD A;  3M1H A;  4HOO A;  5JI9 A;  1MAC A;  1Y3T A;  2QJV A;  2RJK A;  1SDW A;  4GB3 3;  2VD7 A;  3U75 A;  4YFZ A;  4Q1R A;  3KT4 A;  3LEI A;  3OPW A;  1DZT A;  3OPZ A;  4JGY B;  5FZB A;  3V0A B;  1CVN A;  1POV 0;  4AGR A;  5L7O B;  5T5P A;  4XIO A;  3ZN6 A;  1I3H A;  1IHM A;  1IKP A;  2HLE A;  3NVC A;  4UW4 A;  2W5F A;  3WF1 A; 
#chains in the Genus database with same CATH homology
 1XBF A;  1VMJ A;  2P6H A;  2CU5 A;  1VE0 A;  2P6C A;  1VMH A;  1VPH A;  1VMF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...