1VMHA

Crystal structure of an uncharacterized conserved protein yjbq/upf0047 family, ortholog yugu b.subtilis (ca_c0907) from clostridium acetobutylicum at 1.31 a resolution
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
129
structure length
129
Chain Sequence
VIEYSLKTSNDDQFIDITNLVKKAVDESGVSDGMAVVFCPHTTAGITINENADPDVTRDILVNLDKVFPKVGDYKHVEGNSHAHIKASLMGSSQQIIIENGKLKLGTWQGIYFTEFDGPRDRKVFVKII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Uncharacterized conserved protein YjbQ/UPF0047 family, ortho
publication title Crystal structure of Uncharacterized conserved protein YjbQ/UPF0047 family, ortholog yugU B.subtilis (15023806) from Clostridium acetobutylicum at 1.31 A resolution
rcsb
source organism Clostridium acetobutylicum
total genus 36
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2004-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01894 UPF0047 Uncharacterised protein family UPF0047
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.460 Mainly Beta Sandwich Jelly Rolls YjbQ-like 1vmhA00
1XBFA 2P6HA 2CU5A 1VMJA 1VPHA 1VE0A 2P6CA 1VMHA 1VMFA
chains in the Genus database with same CATH superfamily
3NVCA 5FPBA 4D7YA 5HV4A 4XJZA 1OD5A 2IFWA 2WT0A 5L9BA 2PA7A 3V0AB 3KCYA 2OW4A 5FZLA 3DXUA 4V2WA 2WQ8A 3EHKA 3THCA 4OHZA 1W8WA 1B35C 1KS4A 2QCSB 3B00A 3N9QA 2GH2A 4CCLA 4NPMA 5J48A 2BUKA 1BKZA 2VZRA 3OGVA 3VBSA 5A7NA 4EN7B 1REFA 3WX5A 1W8UA 1NXMA 1W2OA 2BGOA 2TBVA 1GZTA 3HNMA 3KVBA 4PDWC 1PNFA 4YW3A 3CQOA 1GNHA 1W9WA 3CJXA 1RUE1 1SBFA 1ZM1A 2HWC1 2JKXA 3NQHA 4Q4W2 1LOFA 1Q8OA 3IN9A 3H8XA 4QX7A 1LENA 3WG2A 2WO1A 2W39A 5A7QA 3C7OA 1VBB1 3DYMA 5EIYB 4K6BA 2CDOA 2FBEA 1LULA 3LSDA 5DN2A 2YROA 2C5DA 2PHLA 1H2MA 3VKNA 5KR7A 4GMP0 5K4LA 5LCWL 3T2TA 3ZFFC 1CJDA 1DLLA 2W0XA 5J7MA 4ISRA 4JAAA 3MYXA 2GNMA 2NN8A 4WM7B 4D7TA 1CR7A 2VNVA 1QJU2 3ZX7A 3WVJA 2G4IA 3ILNA 4XJ9A 1C1FA 1LOCA 5I93A 2WNOA 3EBRA 1O8PA 4MGQA 2HWE1 1QJEA 4FVVA 3LWCA 3C7HA 1RXFA 4DRRA 3P1IA 4IV3A 3KCXA 4RHV1 4F3JA 1XE7A 5IYYA 2CYFA 1XPWA 3N9NA 5GALA 4CXWA 2EA7A 2V72A 4NOTA 3VDAA 3WP6A 4SBVA 5KC5A 1XNBA 1JYNA 1O7FA 1EUUA 1V6MA 1D4VB 4GALA 5JSRA 1AUYA 4OI2A 3VKMA 2BU9A 4Z2AA 4KQ7A 1AR81 3SNMA 3ZSKA 1JH5A 4LBOA 3I2KA 5I0DA 1UPSA 2FZ2A 1WUVA 1GP6A 2BWAA 4KI5M 5LY1A 3DKWA 4AR2A 2BFUS 1F2NA 4B1LA 1RUF2 3NWKA 2VNRA 2P5BA 5CFDA 5HPOA 4MXVA 3M3EA 5IHRA 3DKQA 4LXLA 1ZREA 1MACA 1S0CA 3UJOA 2OQ6A 2KD7A 5KHHA 4JKMA 4AEMA 1AYN1 1H4HA 2BJSA 4CSWA 3IMMA 1DG6A 2AZ5A 4Q4X1 3ZN6A 2D98A 4Q8LA 4M0HA 1OUXA 1A78A 2B45X 3OYWB 1XRUA 1WW4A 3AFKA 4AQ2A 4Z92B 1QJY1 1HRI3 3E5QA 2ORZA 5C7GA 4YPJA 3BGAA 2ZKNA 3GGLA 2PHFA 3WZ1A 5A6YA 3AMNA 2A6WA 3KQ4B 4DY3A 1JZ6A 3ALQA 1UNBA 1ASJ2 5FYUA 5FXWA 1UCXA 4JHTA 4QHBA 4QQHA 3H1MA 2Q1MA 2JDYA 2ZGKA 3GZTB 2HBTA 1LU2A 5A3UA 1RHI3 1UYYA 3T2OA 2JDAA 1UPIA 5FP7A 3PJQA 4XZPA 3UNPA 1RITA 3B7MA 3IKWA 5AVPA 2E63A 1PM4A 2BTVC 1VP6A 3BPZA 3KF3A 3WF4A 2XQRA 1JZ2A 3PVEA 4WM8B 2RDRA 1DZQA 2ZOEB 5FQ0A 2VNOA 2R063 2VU9A 3HBZA 4P9XA 5GZCA 2KA3A 1XBFA 4PHZA 1KRIA 1JU4A 2Y6HA 3J7LA 1JYCA 3T09A 2IXIA 2OIIA 1US2A 3RYKA 5F39A 5CISA 2QQPA 1FAYA 1HLCA 1PIV3 4DEQA 2PAEA 4Y3OA 4AVBA 4GULA 3T08A 2L9LA 3AP5A 1ENRA 3UGHA 3WNKA 1SFNA 2D43A 2GMEA 3TEXA 4B29A 1ACCA 2VXJA 3OEAA 1DYKA 5EQUA 2AREA 3AZXA 2D6NA 2RHPA 5FYZA 4RS5C 2XVKA 5FLHA 5E88A 3BCWA 1LTEA 2DF7A 5JVVA 2HWB2 1K42A 1SACA 4LQRA 1W3XA 5IK7A 1XNDA 3P3PA 1UF2C 3OD4A 1Y9QA 1TMF2 3J8F2 3KZ4C 3JD72 4O61A 2BDRA 3N9LA 2R043 3ACHA 2A1XA 2FQPA 3KGZA 3ZDVA 1N1YA 3GNEA 4ZS2A 2PHDA 1GZCA 2X09A 3KV4A 3POIA 4Q0UA 3N7JA 3NV3A 1QKQA 3OTFA 1NZCA 4LUKA 4QPGC 4W4ZA 4CDUC 1G9FA 4WZFA 1HRV1 5LASA 3MIDA 3I4IA 5C4WA 1WBFA 3M8LA 4E4HA 5A6ZA 4IE0A 2ES3A 1ULDA 2D93A 2ZCWA 2Q8DA 4L92A 1HQLA 3VD7A 3TBDA 1QNWA 4M0NA 5FZDA 2O8OA 2NMNA 1SPPB 2VGDA 3BN6A 4HSJA 3TOJA 1D0HA 1LEDA 1CZVA 3T0DA 4YVSC 4EN0A 4XXPA 2Y26A 1LGNA 1W0OA 1AR93 1VBE1 3T0AA 1GQPA 1NCRA 3E5UA 4ES9A 4IE6A 3U11A 3I3QA 4KL1A 4LBJA 2ZEZA 3W21A 4A44A 2FDFA 2A3WA 1CVNA 3CIHA 3MIEA 1VBC2 3ZYFA 4XVHA 2RDQA 2XG3A 3SCGA 1VMFA 5D8AC 3CDZB 1RVF1 2Y6JA 3VBOA 4EV0A 4BQWA 3I2GA 3VDDB 3WG3A 1W2AX 1FPN2 1ND3B 4OVEA 1DGLA 4XZUG 3TYJA 3WNOA 2XBO3 4P5YA 5FY5A 3ETPA 2GNDA 1EAH2 2W46A 1E5RA 2ZAHA 4QB2A 5K7PA 1HXS2 4Y4RA 4GJZA 2ARXA 1LB2A 3POFA 4YVWB 3OB8A 5GLVA 1D2SA 2VVEA 5H9PA 4MX3A 1YLLA 1FOD2 2ZBJA 4M01A 1QJX3 2FMDA 3WOGA 1QQP3 1UMHA 2Y38A 4BDVB 5BNOB 3M2MA 3AMQA 1M06G 4IE7A 3VD5A 1ENXA 4MG2A 1RUH3 4AGGA 5IW0A 5BNNB 5J98B 4YM0A 2MEV2 1A3KA 1LNSA 1OA3A 1T6GC 3PUQA 4LKEA 3HPNA 4FFGA 4IERA 3VBSC 4LKDA 1C8M1 5ACA2 1W9FA 4KBZA 1OKOA 3POGA 5A7SA 1Q56A 1AR71 3D4KA 1G9AA 5T52A 5IJRA 1OPMA 1OXCA 1LOFC 4K7JA 4Q1RA 2HBUA 3R6SA 4JHZA 4Q26A 4LBQA 3ROUA 4LHLA 3BB6A 1P8JA 3IBMA 5FYMA 3IPVB 3D6EA 4YZ4A 2VH9A 2DWRA 2VOVA 4AEKA 1X9PA 5FJHA 1HN0A 2JD4A 4HG6B 1CAVB 1F4HA 2XHNA 3PURA 4QT6A 5C3SA 4Y5SA 3Q8BA 1UZVA 4CEWA 1KDMA 3VKFC 1A8MA 3DUIA 3VBFB 4JGYC 1IPSA 4UFIA 1F35A 4XFHA 4NO4A 2EF6A 2QDRA 3RQ0A 2QVSB 4CEYB 1WGPA 1VBD3 3DN7A 1RUJ1 4IV3C 2ZMLA 4H7MA 3POJA 1RMU2 4D3WA 3RZMA 1ZZ9A 2W68A 3I2IA 4CU7A 1NCQA 2VM9A 4HN1A 2YGMA 3WQ1A 1LAJA 5IUQA 1AL22 1OMIA 1PGW1 3B93A 3WNNA 4F8AA 1AR62 2JG9A 2LS6A 5DZGA 4YARA 3IWZA 4PF5A 1XNAA 2CWSA 4QPIA 1PK6B 1W99A 2YC0A 3DF0A 4Q0VA 4NHXA 2WT2A 5GKAC 3WNXA 5CFCB 1HJFA 5FXXA 5F8PA 5LBEA 5CFDC 2HWC3 1H1IA 1XNKA 4KBBA 3BU0A 1GQHA 4IUGA 4EYUA 3ZSLA 5FR3A 1HW5A 2VVFA 1N1SA 4I3PA 1K5MB 1VRH1 4TZDA 1U0AA 4IEYA 4LHSA 5EZWA 5FDBA 1WLDA 3GZUC 2A6ZA 2C9KA 3I3BA 5FRAA 3VHRA 2HWF1 1XU1A 2E26A 2WN3A 4NHMA 2RVAA 3WG4A 3WR0A 5F6LB 1YFXA 4JZRA 3AMHA 2BQPA 3RSJA 3TN92 2PFWA 1CONA 1UY2A 1C57A 1UO9A 3QBQA 3TB0A 5F3GA 1T6BX 1AX2A 4QPWA 1V6KA 1UZZA 2DU0A 2DVGA 3OBAA 1REEA 2HWD1 1SFYA 4N53A 2BV4A 1GANA 1OSGA 2JICA 4JGZA 2QTWB 4MUVA 1X8EA 2Q1ZB 1DFQA 2W47A 2X5IB 5C3RA 4P5HA 4KNCA 1KDKA 3ZIWA 4BISA 4QX5A 2BERA 1CAWA 2HWE3 3DYOA 3OUHA 1DQ1A 2JDMA 3FWEA 2BGPA 4FOYA 1OPOA 5GLTA 5EJ3A 4CDWA 1GNYA 2GSYA 2R16A 5APAA 5F3CA 3O1RA 3ZN4A 1HKDA 1LEMA 5FO7B 4XACA 4XETA 3MIHA 3E6CC 2WC2A 3OY8B 5FYTA 1RL3A 4YG3A 3RRDA 5FZ4A 4XJWA 4V1PA 1TG7A 2BNOA 1DGWA 3SXWA 1AR83 1V6NA 4HONA 3S30A 4KWUA 1OOPC 3VDBA 4P9IA 1ZRRA 5T5LA 4AVVA 3RVHA 3O7OA 1NA1A 2J1AA 4BQYA 5B4NA 3ECQA 1AXKA 2R6QA 1JMUB 1CPMA 2DFBA 3SHRA 4LO4B 5JR7B 5JOYA 3NAPC 2R1BA 2NP0A 1AYN3 1NAEA 2VECA 2YDEA 1Y9GA 4FOQA 1Z7S1 2E53A 2WNUA 2XVLA 4Q4X3 3EMRA 4Q8KA 2XJSA 3VUOA 2I45A 1MEC2 3IM0A 4BIOA 1V6OA 3PUSA 5FYSA 3SKVA 2CWMA 1QNYA 3LD8A 2WAOA 5IFPA 1UY1A 1PZ8A 2W92A 1ULOA 4HMZA 4JQRA 1LU1A 4TWTA 1FX5A 4AVCA 2HEVF 2ZGQA 3JBG3 3VBHA 4DQAA 2ZS6B 5M0TA 1S0DA 3TNQA 2HEYF 3OOXA 3U75A 2Q30A 2O8QA 4DUVA 4HK9A 5DAPA 3WUCA 3K46A 1H9WA 2VZPA 1CGPA 1UYXA 2NMOA 2PHTA 3S6PA 3OPWA 3VBUA 4AHXA 4Q1PA 5ANQA 1ULGA 2W5FA 3AP7A 4CP9A 2ZZQA 4XF1A 2ET7A 3ACIA 2WA3A 4DY5A 1GZWB 5JOXA 3KT7A 5A7PA 1QJZA 5EYYA 4CXYA 4NPRA 1IG3A 5CNAA 1ODMA 2C1FA 1I9RA 1W6NB 3EXUA 2IXLA 5LEJA 2ZX0A 3HQXA 4HSLA 3F2ZA 5HXVA 4DNYA 1JI6A 4LPLA 1S0IA 3DEMA 4EZHA 1PGL1 5C4WC 4XXAA 3LPGA 2VCMA 1LHNA 4GKYA 4O9GA 4Q4W1 1GYKA 4XFGA 4B4PA 3PTYA 3MIFA 2GNTA 3GXUA 1HV0A 2CGNA 1WCKA 4QHOA 5K0UB 3ZFFA 5DZEA 1D4M2 5DAWA 5JOZA 4P08A 2K9ZA 3AL5A 5LBFA 5BV6A 2XLAA 1MZ5A 1ZBA3 2AH2A 1VMJA 2BW8A 2DVAA 1Q8PA 2OVUA 2ZX4A 5F2SA 5FBJA 3RYPA 3APBA 1V70A 4PF1A 3LQCA 4WVMB 3S57A 1O3SA 1NQDA 2GC0A 2VZVA 3NJZA 5A33B 4BA6A 3AKSA 5FKBA 1J3QA 2EXHA 5CBLA 2VZ1A 4PLNA 5FLIA 3N35A 2PTMA 1DQ2A 2ZEYA 2RMU2 1BEV3 4NRMA 1MR5A 2ORXA 1FNYA 3KT1A 2KXLA 5KHGA 2AGSA 4QGLA 5A32B 4A2UA 2XONA 1DQ4A 1QDCA 1NLQA 1EV11 2O1QA 2D6PA 2QQIA 3LEMA 1FYUA 3OG2A 3H3ZA 1OFNA 3I2HA 3KCCA 4QU2A 3E5XA 3OUJA 3K51A 2WWJA 4Q4V2 2BOJA 5LA0A 3HJRA 5FY9A 1JYIA 3AMMA 2Z4FA 1YRZA 4RQPB 2H0VA 1OLME 2C24A 4CCNA 2E9QA 1S2EA 4L99A 5A3NA 4QKBA 1FATA 2J1VA 1PVC2 5FY4A 1MQTA 3AZVA 4GB32 1HRV3 3ZFGB 3IT8A 2VL4A 2YBKA 5FPLA 5FZMA 4HFSA 4M3CB 1QHDA 3ST7A 5IVBA 2OPKA 3PMEA 4MGKE 4A6OA 2R0FA 2PQQA 3GBWA 3MIGA 2PMWB 2RS32 4UBHA 4S2HA 2GNBA 2ZABA 4XFFA 5FTTC 2WO3A 4ZONA 1XJAA 1G8WA 5LK7B 3POEA 1R093 2Y60A 4H55A 3MPPG 4FPLA 1BBT3 1RJ8A 2W94A 4NVPA 2VCCA 3OGGA 3FLPA 4D6SA 3VD4A 4CU6A 1VBE3 3HMYA 4PLMA 4XFAA 2BPA2 4OI1A 1HB1A 4CDQB 3NNJA 4LO7A 1ASJ1 4N8MA 4AQTA 2A5ZA 4AHYA 4LIVA 2LRPA 1E5HA 1C28A 1JYXA 2IWGB 1ULFA 4AI9A 3GJBA 1RVF3 4XF0A 3BPSA 3N9OA 3FJSA 2A6XA 3LOIA 5FZ8A 3NJXA 5A3PA 4NPLA 2EIEA 4OHWA 3I59B 4KU7A 4XDPA 4RR3B 5E6HA 3ZR5A 4CCKA 3LB9A 3SLIA 4CEWC 2VJXA 1FMD2 3CLPA 2W87A 2PN5A 3C8XA 4RGAA 2QNKA 4JX0A 4AAPA 2IXCA 5JZGB 1BK1A 4JCKA 5CADA 4AQSA 1HIXA 5C8WA 5FZ1A 4AW7A 1ST8A 5CIRA 2YHJA 5JMOA 5J36A 4GH4B 2VUDA 5F5QA 2FDKA 2VCAA 3O14A 3ZYRA 1CIWA 1V0AA 4FOWA 3LPFA 4GD4A 3KGLA 4PT6A 3CJIB 4QPIC 1C8M3 1KJRA 2HJIA 1O59A 4XOGA 3V0AA 4Q27A 3MGUA 2ATFA 4CCJA 2VOTA 2ARAA 1RUNA 1J58A 2Y6FA 1IPJA 3Q8FA 4WVVA 1R64A 4I3GA 2UY9A 2D5HA 1DHKB 2HWB1 4FOVA 2R30A 3RGBA 3WUDA 2ZHNA 5FWJA 1RUG1 4XABA 2YC2A 2IXKA 4IGPA 1TMF1 4QPGA 2EXJA 3ZXJA 3RI8A 1AJKA 4BXSV 1IGOA 5FZ0A 3JD71 4LITA 5HXMA 1SLLA 2JDNA 2EAKA 4QX1A 4N53C 4XTMA 4JGZC 1XNCA 3S0MA 5SV5A 1Q8VA 2G9FA 3LDKA 4M4PA 3KHCA 4K20A 5FP9A 2V73A 4PBPA 3FL7A 1A34A 1H6XA 3QACA 1PO22 3OGSA 1VR3A 5FZAA 1C8NA 4LK6A 1W6PB 1W8FA 4Q29A 3WNLA 2XR4A 1RUJ3 5DAXA 5DMYA 1JYVA 3TWIA 2HKXA 2P34A 1OI6A 3FHIB 3K3NA 4R9CA 1ENSA 2VMFA 1JUHA 4WM7A 1MS0A 1OD3A 2W1UA 1Q8QA 3POWA 1H0BA 4QU1A 3JU9A 3URFA 4CDXC 4D7SA 5IVVA 5FPAA 1CAUB 1TQ5A 5DABA 2V09A 3WDXA 4FQZA 2VZQA 1MS9A 1LODA 2D6KA 5A3LA 3GCWA 1S1AA 4IW3A 4JV4A 5DAQA 4CYDA 1K12A 1TME1 1OC1A 2DCYA 3F95A 4E4DX 4XILA 3WP4A 1NA1C 2ZGRA 4NAMA 2GDFA 4C8DA 1RUI3 2JDZA 2VQUA 4LBLA 4WBBA 5BNPB 2OPWA 1Y43B 4BQ2A 2I2SA 5L73A 2Y6GA 1JOJA 1NLSA 2ZX3A 3LDRA 3PL0A 1VBC1 2GP5A 3MW2A 4P00B 4AL9A 1U5XA 2HWF3 5FZCA 5LB6A 3VL8A 1MZ6A 4CCEA 1IHMA 2C4XA 2D97A 4HZFA 4URAA 1GR3A 1COV1 4ZZ5A 4OCTA 1C5HA 2XLFA 5FZKA 4PIXA 3LEKA 1W90A 4XUPA 5FYHA 2JDKA 3VZNA 1A8DA 4GKXA 2XVGA 1H8TB 2DBIA 1ZNPA 2WSUA 1EAH1 1R1A2 2E7TA 3C7EA 3UK9A 3VBHC 2HWD3 3FE5A 5C8CB 1HXS1 5AC93 2X8KA 3OYWA 2RR13 4FI9A 4A45A 1GUIA 5FO8B 3ZPYA 4EJRA 3KS7A 4JTNA 3VBUC 1FOD1 4U36A 4V2VA 4COWA 3LIGA 4I09A 4Y33A 3PDQA 1GBGA 1OURA 1F15A 2A3XA 3A23A 3BVCA 3CL1A 2F6BA 3NNMA 5FP4A 3MEPA 5CKNA 3BKZA 3WCRA 1NUKA 5B2GB 4UT5A 4RS5B 1CX4A 1DYPA 5J3UA 3LFMA 2RG4A 5C70A 3ZDSA 2R071 1O3TA 1JYWA 4LKFA 2VW1A 3J7MA 4NRQA 3V56A 4BMEA 2ADEA 2B39A 4IGOA 3R4SA 1DGRN 4KU8A 3FHQA 3HT2A 2WZ8A 1VAMA 5J96B 1X7NA 1H2LA 2VZ3A 3AVSA 3NV4A 1V6JA 4FXKB 4WM8A 5DDJ2 3RWKX 1Z7S3 4JGYA 4AI8A 5L9VA 5IVFA 3O1SA 4JDMA 4L8QA 4QXCA 3HVDA 4N43B 3MW4A 2VD7A 5L7OB 1DBNA 2J7MA 1ZZ8A 4X6QB 2DCKA 2P1BA 5H9SA 1F5FA 1WMXA 3OUIA 4EN6B 5LZ6A 5HCFA 2GALA 1OF3A 1MS1A 1UOJA 1YFWA 1GQGA 4XUTA 3ZPOA 1RHI2 1BZWA 4WZCA 1RMU1 1MVEA 1NG0A 4DFSA 2WINB 1XE8A 2WS92 3RMXA 3WG1A 1VMHA 5ERLA 2ZA9A 1E5IA 2YYOA 1G9DA 1AL21 2A70A 2JB8A 2NZ9A 3E6DA 1VB2A 1YJLA 4KGGA 1Z0HA 2Y64A 5JXJA 3UKVA 1JYTA 2R062 4IGQA 4CUBA 2ZACA 2VUAA 3V65A 3WCSA 3RI9A 5JR2A 1MQTC 4FPEA 2VG9A 4R4XA 2GN7A 2D3SA 4MXWB 3VB9A 4Q4W3 1PIV2 1V6IA 3WD5A 1C5IA 2TEPA 2XJQA 1PX3A 2YZ4A 3VGIA 3B9CA 1RUC2 2RS52 4Z1VA 4AEDB 5FBZA 4CUGA 1L3JA 4EZ4A 5I91A 1W0PA 4OLLA 2W1SA 3TN91 5C5UA 2AACA 1MVQA 3C7FA 4E4ZA 2BVBA 1C1LA 1FXZA 4NN0A 4K21A 1HV1A 3LDBA 1W6MB 1H9PA 4PQ9A 4R4ZA 4BLJA 3B02A 1U12A 1SPPA 4M00A 4UF0B 1CJPA 4L9BA 2C26A 3MFAA 2NQYA 3CZJA 5BUVA 2VUJA 4XIOA 3WNMA 1UL9A 1XYNA 4XAEA 4SLIA 1OLMA 3AYAA 3DPRB 4HKOA 4ASMB 4MLOA 2P6CA 1EV13 3I3DA 5JDBA 1OOPA 4PCRA 4XYXA 1IQAA 1VIWB 3FBYA 4QWNA 2E7QA 1EPWA 1KITA 2WAAA 3MLKA 4W50A 3O1UA 4FQ4A 4RGGA 1Q43A 3NAPA 4W6WA 4XJUA 4EN9B 3WDVA 1QJFA 3LSEA 1XQNA 3HQUA 3M7AA 2HYXA 4QKNA 4MHRA 4UW3A 4BQ4A 3MHZA 5JSOA 1XB9A 3GBGA 3D5OA 1GICA 4CP1A 4P02B 1O4TA 3ACLA 2LTNA 3EB7A 1ZVFA 2WNVB 5JXGA 3MBWA 4TYSA 1OT5A 5FZ7A 2JE7A 2OZJA 3I2FA 3LEGA 4YVWA 4LBQD 2W3JA 4A4AA 4I2OA 2YY1A 3HIFA 1MEC1 1AR92 4YW4A 3TNPB 1NT0A 4AI3A 2FZ1A 3HN1A 1RJ7A 2CSGA 2XLGA 4W8JA 3FUQA 5DG1A 3SEEA 1UWWA 3VD3A 2P17A 3KD4A 2VULA 3HT1A 5BNNA 1VRBA 5T55A 2G1MA 1A6CA 3Q8AA 3GM8A 2FDJA 1UOGA 1ASJ3 4CUCA 1S2BA 3I7DA 2YFUA 4WVZA 5CEHA 4QHZA 3T3YA 4EQVA 1YJKA 2LM3A 1J84A 3WQBA 1TVGA 1JODA 3UGFA 2UWBA 5IVEA 4A42A 3RZHA 5DUUA 4LO8A 2LALA 1UKGA 2VNGA 4IV1B 2DDUA 4XIKA 1LOAA 3THDA 3E1F1 5A1LA 1F9KA 1CAVA 4DEVA 1VB4A 3IB3A 1SHWB 1QQP2 4H2AA 3M3CA 3OPZA 3PNAA 3BTAA 3KF5A 4WM7C 4WVWA 3U4SA 4QXBA 1IOAA 4Q2FA 2ZJCA 5JPNB 1V00A 3H1YA 1V6LA 4QDQA 4CEYA 2A6YA 3N7MA 4Q4Y2 2QDNA 4G4FA 3SH3A 5GLWA 1QXRA 1WW6A 2QQWA 1OH4A 4B7EA 1Q5OA 1YIPA 4UFHA 3AXDA 1XE0A 1RC6A 4C0BA 2JECA 2HH9A 5EFUA 3FUOA 1ZRDA 3AZZA 1CIYA 2GU9A 1UIKA 2WDBA 3H42B 1UOFA 1LGBA 1SFPA 2XHKA 4K40A 2DUOA 1OFSA 2PAMA 4ARXA 1JZ5A 1ND2B 1ZZBA 2XMLA 2RMU1 2VMHA 4LE4A 1GNZA 3RZJA 4GWIA 1CPNA 2HWB3 5DZFA 4CP2A 5HCAA 2YMZA 3SCHA 5CFCA 3M3IA 5ISLA 1RUG3 2RM21 1W2UA 5FQ0B 3KV9A 3LAGA 3JXSA 1K5MA 3GYDA 4FTSA 3ZYHA 1ZBE2 1XSRA 4CPBD 3JD73 3OSDA 1PO13 3C2UA 1MS8A 2UURA 1J1LA 3I2DA 2G19A 3UKNA 3O1OA 4DINB 2R0HA 5E89A 3FBMA 2ENRA 5I0UA 3S5AA 4UW4A 4O7XA 4YZ3A 5FXZA 5KHJA 1VBD2 3FC0A 4AYUA 1PVC1 1HN1A 2PHRA 3V0BB 5FMBA 2K46A 3ASIA 4FO9A 4XURA 5JI7A 2H0BA 4E27A 1B09A 1WW7A 3O0XA 2VY0A 2X5IA 3PVBB 2B5HA 4RD7A 3EYPA 3BIWE 4YW1A 2KR2A 4MHUA 5HCBA 1UU5A 4NMIA 4P9WA 4COUA 1LOEA 2O0OA 4Q0SA 5EYXA 5A3OA 1L7RA 3AX4A 4RN5A 2J22A 3B01A 3I3EA 4CCCA 5JLVA 3IIIA 4UAPA 1TME3 3WLUA 4D6RA 1AVBA 2E31A 2Q4SA 3USSA 1NY72 5IATA 5JMCA 1WCDJ 1NYWA 3OY8A 3V64A 4XMAA 3MICA 4XW3A 2DFCA 3HBKA 3MW3A 4HKWA 3INAA 2ZGTA 2A75A 2WL1A 2RS12 3JQWA 4K8FA 4N7UA 1WCSA 1SDWA 2E6VA 2ZMKA 4WM8C 3MPBA 1H8VA 1AX1A 1SLBA 3DXTA 3R4UA 1GZ9A 4HPKA 2WFF3 2XJUA 1MZEA 3IDCB 4Y22B 2VZOA 5D2AA 1XNTA 3RG0A 4LA3A 4YWAA 1K5JA 2FCVA 4MO3M 5HI0A 1COV3 1LHVA 1W6QA 3ON7A 4IEWA 4HKLA 3W9AA 3BTYA 2UU8A 1AHSA 3GHNA 4IESA 3PJYA 1FMD1 4ASLA 2VMGA 4HXCA 3THTA 2BVVA 1HXS3 4YSFA 2VMEA 2HWE2 1PMIA 2OKXA 3T1LA 3A4UA 4QX2A 1QEXA 2IUWA 4G3YC 1SMVA 5LATA 4RFRB 1TNFA 1WKYA 3R05A 5FZOA 5FUNA 4AI0A 5F1RA 1FT9A 4BM8A 1GKBA 4ZXEA 1W6OB 1UMIA 1NCRB 1BXHA 5FUIA 1UOBA 1ZZ6A 2GC2A 1RUE3 2FDHA 2AC1A 1DF0A 1E5SA 1UQXA 2VQTA 3AKTA 1OA4A 2ZEXA 1RUD1 2FCTA 5FREA 4ZU7A 4LBNA 1RGSA 3U14A 1SBDA 3I97A 2R073 1VBB3 1CZSA 2VTXA 3U1XA 3HWJA 3AYDA 1C4RA 4YYOA 2P4EA 4QM9A 5I0RA 3ZFEB 4C91A 1PMHX 4XUQA 1AYN2 1N3OA 5IK4A 2IVJA 4YZ5A 1V9U2 2GP3A 4GJYA 4Q4X2 5FOJB 3ZM8A 1RIRA 2XJRA 2JJ6A 3A0KA 5G04L 4ARYA 2OZ6A 5C9AB 4LO5B 3SQOA 3VZMA 4OYUA 3ZYJB 5IAXA 3A7QA 3NRUA 2TUNA 1N47A 1VBA1 1Y7BA 3JBG2 4XF3A 3HR9A 5K0UA 3MLLA 1YUDA 4RHV3 1W0NA 1WA4A 3OGRA 5I0TA 4DXTA 4K9SA 1F8VA 4C0HA 2Z69A 2A73B 3CF6E 1O8SA 2R49A 4E8CA 3ELNA 4OMDA 2IVIB 4CDXA 2CY6A 1CAXA 2DTYA 3OBRA 2XH6A 2P3YA 3VHOA 4WVMA 4AVTA 1YXWA 1ZA7A 4C90A 2LUWA 1R082 3JB4C 4MADA 5IWFA 1N3PA 3PIGA 4NAOA 5A33A 4AWDA 1RMU3 1BVVA 2VUCA 4DPNA 4IETA 1QXPA 3O5SA 1REDA 5FO9B 4ZZ8A 4J25A 2W91A 2WWUA 5T5OA 2XB6C 4LBQB 3CEWA 2ZX2A 4UWDA 5A80A 3WEZA 4QGNA 3AYCA 3VKLA 3MUZ1 2D7FA 1O3QA 3O12A 1QF3A 3EQEA 2WQ4A 4B4RA 4W65A 5FMOL 5F37A 4FPCA 4AFAA 4IEZA 3VL9A 1YEWA 2WA4A 1FV2A 1SLCA 2D44A 4Y1VA 2WZPP 3WDTA 1HQWA 2BFUL 2RV9A 3GZEA 4RQPA 3D0SA 1BHGA 1YFYA 4AVSA 2DV9A 4FXGB 3H8RA 1MPXA 4CA9A 1QJY3 3WW1A 3P5BA 1BQPA 4BZ4A 4N90A 4Q0PA 1ZBA2 4YVWC 2BBVA 2ZPXA 4I0WB 5FXVA 3ZFGA 3OBZA 4YW5A 4EE2A 3I49A 2RE9A 4S2FA 5T54A 3TN93 4LE3A 2QZ3A 2EIGA 4LULA 1YQ6A 5BNOC 4KH9A 1RUOA 2XKOA 2Y0OA 1R1A1 5BNNC 5BYNA 1AYM2 1LKNA 2R32A 2QE3A 1LESA 1LR5A 1NOVA 1BEV2 1NCQB 3BIEA 2BGCA 4MYEA 3RZKA 3IDEA 1VAVA 2WO2A 3MO4A 4HT1T 4PI2A 2JG9B 2VTXJ 2AEYA 5FZ6A 3ACGA 2JDPA 2Q1FA 4Y20A 5DQ0A 4OMCA 4JDNA 2JG8B 3ENRA 1WLCA 3CKHA 4OQ9A 4CDQA 2A71A 5FZFA 2VTFA 2XWJB 4LKSA 4NIAA 3IIAA 2DCJA 4B8EA 2MPFA 4LR4A 1QXJA 1ULEA 5CYYA 1KD7A 4BK4A 3AKQA 2B8MA 1HRV2 2EICA 4XQWA 4O9EA 4YGBA 1W8OA 3WF0A 3HQRA 3OGJA 1RTVA 2P2KA 3ZLIA 3I59A 5FKCA 4QQ2A 3RJRA 3TEZA 4YGEA 1H4GA 1Y3TA 4CU9A 3VBFC 1S4CA 3H50A 3RFRA 1X8MA 5DDJ1 5DPNA 1W9TA 3GJAA 3QH6A 4CEYC 3W58A 3N9MA 2YBSA 1POV1 3QCWA 1R092 4YG0A 1JS9A 5JZGA 1QJU1 3B69A 4GXLA 1BBT2 1J3PA 2WFPA 2VZTA 3J4UH 3ZOIA 4XJ8A 1S55A 3PTRB 5ABJB 4GH4A 5FY0A 2ZXQA 1W9SA 4N9IA 4XTPA 2QZ2A 4CDWB 5A1AA 4XC9A 1UYZA 3AM2A 3LE0A 1FI2A 1YQ8A 1PGSA 4P9YA 2VZUA 3O1MA 3W5NA 1G7YA 3CJIA 4ZHNA 1VPHA 3DYPA 5FY1A 1I5PA 3ZR6A 1RHI1 4PJYA 1OHFA 3ITQA 5CFCC 1GFF2 2O14A 2RJKA 4E2QA 2P3KA 1ODNA 4LNVA 1LECA 1OQDA 1JU3A 1LJ7A 2WS91 3BOPA 3DECA 3ZYPA 1YCIA 2YV8A 4ORFA 4PLOA 5JI9A 1K5MC 2XJVA 3GDBA 5DG2A 4L2NA 3RDIA 1GWLA 4E9KA 1OQEA 1RUF1 1W2NA 2ZGNA 3FX3A 3BTZA 3VV1A 3VBRB 3ZYIB 2WZEA 3IAPA 4LK7A 2R061 2ZHLA 4FT8A 2WNUB 3WP5A 2XOMA 3ILFA 3NV2A 1SZBA 3FLTA 1UYPA 3LCPA 4IDZA 2WBKA 4UI9L 1AZDA 1W2TA 2Y33A 1PIV1 2CGPA 2W52A 2X5IC 3LOBA 3BI3A 3FN9A 3I8TA 4MGSA 1RUC1 2RS51 2VOWA 5JSPA 4I0AA 1F31A 2EIDA 1W6PA 1X82A 3RS6A 5LRRA 4XEZA 4UXAA 1CN1A 2EXKA 4BCUA 4AI1A 1B35B 1UY4A 4AG4A 1UZYA 3U0ZA 4MH0E 2LROA 1YQCA 4ZY9A 1RYYA 2CTVA 3ZYGA 1DQ6A 3M70A 2Y6KA 1CAUA 3BALA 4NWWA 5FUPA 4PDWB 1DU3D 3WDYA 4TTGA 4LTAA 3B3QE 3ZXDA 2ZHMA 2YU2A 2YG0A 3M3OA 4PQQA 5B4XA 4AOCA 5FY8A 2WABA 2NM1A 2RMU3 1JOBA 1UN1A 3KVAA 4XCBA 1TE1B 3NJYA 4YGCA 5FOBB 2VPVA 2JDUA 4KG8A 2VAUA 4F7ZA 3ZN5A 2RM23 2NYYA 4R9DA 5BNPA 2D5FA 3OF1A 1URXA 1WMDA 2DBNA 3H3UA 4RGKA 1LOBA 1XXNA 5CU1A 5DXDA 4B4QA 3DL3A 3AXEA 4BOWA 3ZFFB 5KHKA 1HB2A 1X33A 3BU7A 4FP2A 2GMPA 4QMAA 4XCAA 4Y26A 3ES4A 3SH4A 3SITA 4AFMA 5JPMB 2OUJA 4K3UA 5A7WB 2QKDA 4ES8A 1H8TA 2PLV2 2XKPA 5C8CA 4BLIA 2VVDA 5FMCA 1AR73 5IK8A 2B46X 3S7EA 2AUYA 4P14A 1PGW2 4X8NA 2QQMA 5K8SA 1AR91 3H1WA 2HEWF 4MGTA 2ZX1A 4DUWA 2WZR2 3H9AA 1RUI2 1W28A 1O3RA 4BIFA 2IXHA 3CHXA 5C3OA 4IQPA 1U5ZA 2FD8A 1QGLA 1IS3A 3J8F1 4E4SA 5EJZB 3SH5A 1O5UA 4AFDA 3R0RA 5KXDA 2WR9A 3O0VA 4LO6B 4FCAA 3AP9A 2HWF2 4OQ8A 3RZLA 2ETEA 4UFMA 2XUEA 3AZYA 3WXPA 3T4VA 5C3PA 3WP3A 1ULPA 1EP0A 1N1TA 2PHWA 1JTZX 1QY4A 2Z5WA 3IMNA 4Y5Z0 5FYIA 3ZSMA 4D6QA 4CU8A 5K0UC 2VOKA 4AI2A 1RB8G 4I30A 4X8PA 3ZVXA 3QLQA 5AC92 1OBNA 1GWKA 4LA2A 3WHTA 4YZ2A 3Q8CA 2RR12 3PU3A 1FMD3 4OUSA 3S5QA 2C9AA 3NKTA 4N43A 1DIWA 5L7OA 1S2KA 3RJ2X 4FP3A 5ANNA 1DZTA 2VMDA 2JEMA 3NW4A 4QPYA 4FFFA 4FPKA 3TAYA 3H8UA 4ZS3A 1JXNA 1W8TA 3KV5A 2DVBA 2CDPA 5CVRA 2BZDA 1AXZA 3VZJA 4Q4Y1 2ZTNA 4YW7A 3UT0A 3LA7A 5LRSA 3SC7X 1RUD3 1RINA 1VRH3 2JD9A 3CBNA 1LCLA 1X50A 4MV2A 4URTA 3ZKUA 4COYA 5FZGA 3VZOA 5AVAA 3BUCA 4RQPC 1PZ7A 1W04A 1FPN1 1XSQA 2XGXA 3KMHA 3HD8B 1UKRA 3PLQA 2ERFA 4LOTA 1GOFA 3AB0A 1MS3A 5DUVA 2PELA 3N36A 5D1IA 4UW5A 4IXLA 5CKQA 2B4KA 2CGOA 4HK8A 3ZFGC 5L19A 4OHYA 4MXWA 3WDUA 1HQNA 3VKOA 2A3YA 4IEPA 1O4ZA 1W8ZA 1ZBE1 2DUPA 3R4DB 4LLOA 3JQXA 4Q5OA 5F5IA 1VBA3 4Z2WA 4UFKA 4IEXA 2P6HA 3JB8A 5LBBA 4A3ZA 5F7UA 4YM1A 1ALYA 4YGDA 4Y5TA 4E8DA 3QD6A 1VBD1 3HNBM 1AJOA 1O4YA 5LK5A 1HB3A 2CAUA 3PUAA 2MEV1 1HDKA 2Y8KA 3K3OA 3PMSA 2ZAAA 4YFWA 5EXOA 5FZEA 5I8YA 1W6MA 4P9LA 4XMIA 5ACA1 1JOPA 2K0GA 2Z42A 3AC0A 3H8OA 3I3MA 4UF0A 4CDQC 1QWRA 4QDRA 1VE0A 2GAUA 4AFBA 4DS0A 2A6VA 5FAXA 5J37A 4FSJA 1QIQA 2ARCA 5L36A 1AL0G 4J6GA 3AK0A 4XAAA 1K3IA 3OBTA 5FYCA 3DPRA 5EJ1B 3U78A 3KQRA 4UW6A 4EWDA 4AHZA 4Z8BA 1BLZA 1GOHA 1SDDB 1PGL2 2GC3A 4IL7A 4EN8B 4NIDA 5EV7A 2KM2A 4PIYA 4QQLA 1NY71 1WZXA 3T0BA 4RR3C 3U4XA 4CDUB 4QPGB 3N3HA 2V4VA 4OULA 2QQVA 1HRI2 3WSOA 4BQ1A 1AF9A 1WBLA 5HCHA 1WD4A 2YUEA 3ACFA 5GLZA 5A3WA 1GU3A 2HLEA 2RS11 5IVYA 4O65A 5IVJA 4N9HA 1YNAA 3T2QA 1YWKA 1YI7A 3UGGA 5A7OA 3MZHA 3IDAA 4GWJA 2BYVE 3J7NA 3D8CA 4QQOA 5JZGC 5FPVA 3WV6A 4YFZA 2DTWA 2DUQA 1L7LA 2XL7A 3AFGA 4BQ3A 4XUNA 3VLBB 4GH4C 3KV6A 2Z2SB 3RZZA 5J1XA 2QQNA 2QUOA 4L11A 2WNVA 4YVSB 4OUEA 4AF9A 4DXZA 1R1A3 2JB4A 4HN0A 4A3XA 5C6CA 1STMA 3AYEA 3G6JB 2BRTA 4FPJA 1D2QA 2F4LA 3CJIC 3KWVA 4QX0A 5LA2A 1JBCA 2ZZJA 3AL6A 4NWVA 1FV3A 1L7QA 1AR61 5CA6A 3VZKA 4G9SB 1EV12 4GQ7A 5DUXA 4AVAA 2WRAA 3USUB 3A21A 4BWOA 1UU6A 2IFRA 4MSVA 5A70A 4QB1A 4BU2A 4KMQA 2TNFA 4ZU4A 5D8AB 1S0GA 3P3NA 4P9JA 3UL2A 2Z79A 3FFZA 1KJLA 5FMOS 4LUMA 4JRLA 4JC1A 2B7YA 1WW5A 2ZGPA 2BOIA 1OF4A 3AJYA 4Q0QA 4MGZE 4P9GA 2ZGOA 2D6OX 2WQZC 3AMPA 4CCMA 1SEFA 2VR4A 1NQJA 1NX9A 3K75B 3QOPA 5EP9A 4MVTA 1EPZA 1WWYA 4NIIA 5CKMA 4ET7A 5A3MA 4KWKA 1JZ8A 5IK5A 1QH7A 4E2GA 4IV1A 5FK8A 5GLUA 1UY0A 1I5ZA 4R52A 4KGQA 2XL9A 5F3EA 4B7KA 1I1EA 2FHRA 1V9U1 4RL7A 1DGWX 2F17A 5DDJ3 4DXSA 2OUHA 3VDCA 1POV3 4M3CE 2XXZA 1QJU3 3VZLA 1US3A 3MV01 2VOXA 5E1RA 2YU1A 5FLJA 3VBSB 4KG0A 3JBG1 4XPVA 4D69A 5KHIA 3U37A 3B5LB 3E6BA 1OH3A 2R042 2J1UA 1OQ1A 3SEPA 5A3TA 3HN3A 2VZSA 1R081 1YYNA 2XJTA 4NROA 1RXGA 2D40A 4XHBA 1W9YA 5CG8A 1AX0A 4NR1A 3VDDA 3TEWA 2F4PA 1ND3A 2CV6A 2WS93 2WWSA 5BNPC 3KM5A 3MI8A 4FPOB 3ATGA 3VHPA 1ND2A 4DRVA 3WF3A 1RUF3 2EALA 3JZVA 4A7KA 2GC1A 4BYYA 5AFEA 1ZYBA 2OYZA 1CD3G 5FZ9A 2QJVA 2J42A 4YM2A 4QX8A 4YW2A 2Y34A 2J1RA 2Q5TA 4LJHA 3BODA 3BOWA 4JGYB 4OHVA 3ZXAC 1CZTA 5GZEA 1BMV2 2ZGMA 4YRDA 2CNAA 2PYTA 1H8TC 3A0NA 3UETA 3K4ZA 3LA3A 3M1HA 4IV3B 5C8CC 2B9UA 3N7LA 1W03A 4QB6A 5BNOA 2UWCA 2D3RA 4LT5A 4YM3A 4COVA 1RUC3 2RS53 4F83A 1Q8SA 1SBEA 2XPJA 1ZBA1 4YW6A 5FPUA 1SLIA 3V0BA 1JHJA 4NHKA 4BPZA 4WV8A 1YHFA 2E32A 5T50A 4HVRA 2SLIA 4S2GA 4Y1UA 2JWPA 2VC9A 2ZEWA 3AP4A 3NKGA 1VLNA 3RZGA 3PHMA 2V5DA 2BWCA 2XBO2 5G05L 3UJQA 1AYM1 5FYYA 2OX0A 3M3QA 1Y9MA 3NO8A 1N3QA 4XJAA 5LW9A 1BEV1 5CFDB 2DU1A 1MS5A 3IPVA 1PMJX 1RUG2 3DV8A 2CU5A 1UX6A 4ONUA 4UFJA 4I0BA 5FK7A 4XBLA 1H1AA 1FNZA 3PVOA 5T3NA 3D82A 2DVFA 4RSUA 3VN4A 3MV11 1SCSA 3ZN6B 1PO12 5T5PA 5IT6A 1NE6A 1QJX2 5GM0A 5LY2A 2EVXA 2I74A 2YGLA 4IEOA 1LOGA 2D6LX 4HBNA 3RPQA 5FV3A 3VBFA 3ZXEA 4AQ6A 4EWEA 2VMCA 2WUHA 3LGRA 3MIBA 1RUH2 4Y22A 4B3NA 3ME2A 2C6SA 1D4M1 4N43C 5JUVA 5L7OC 1GWMA 2Q8CA 2WNEA 3VHNA 4AAXA 5CG9A 2E51A 4GAZA 3T30A 4TXWA 3PU8A 1IKQA 3NNGA 1GP4A 5L9RA 5LBCA 2G9GA 3OEBA 4GMP1 2H6BA 2N7GA 2X53S 4HOOA 1TEIA 2ZGUA 5KXCA 1R091 2ID4A 1SG3A 2K2SA 1BBT1 4ATFA 4AXOA 1TME2 4JTOA 4XE9A 2X10A 1JW6A 1DGRA 2UYBA 5H9RA 2PAKA 4FAGA 1PK6A 4D0QA 1W6OA 4QXKA 4XQDA 1YIFA 3H3LA 1BK0A 4QD2A 5EHDA 1OOPB 2YC4A 2MHFA 2D6MA 4RFT0 4XBNA 5JXHA 1TMF3 3J8F3 5C5TA 4OFGA 3UKTA 1XYPA 4CCDA 1H30A 4Q4V1 1NE4A 4BK5A 4HETA 3TEYA 2WFF2 3KHBA 3NAPB 5KXEA 4TSVA 1POQA 3ZFEA 1COV2 1SCRA 3DCQA 3UYJA 4GB31 4AEDC 3Q8EA 4DXRA 4DZGA 1WCUA 1AXYA 5HBAA 2YB7A 1D0GA 4ATEA 2BP6A 1KQRA 1SLAA 4BHPA 4HVOA 5F32A 3HEIA 1QU0A 2B9VA 5C9AA 2RS31 1HJGA 1CQ9A 5FCCA 3W5MA 4PIZA 1JZ7A 3K4AA 1KEXA 1IS4A 2DYCA 2LW8A 3I2OA 1JZ3A 1Q3EA 1W05A 4ZU5A 4AEJA 1RUE2 5FZBA 2FCUA 2HWC2 2WIIB 3AKPA 4QXHA 2VBDA 4J1WA 4Y24A 4Q4Y3 3DPRC 4ITCA 2VE1A 1IPKA 2R072 3MF6A 3OCPA 5SV8A 1OKQA 1VBB2 1MS4A 5JIAA 4DB5A 5LWBA 3H7JA 4FPGA 1NZIA 1VBC3 1W06A 2Q0AA 1DLCA 2RJLA 3CNAA 3FMGA 3N9PA 2WSVA 3MFCA 1MZFA 1IQDC 2IC1A 3LF7A 4GWNA 3UV9A 1FPN3 4CTEA 2VW2A 2GZWA 3GCXA 3PVNA 5C4WB 1CWPA 4INDA 5FP3A 1POV0 4FFHA 1OVPA 1O91A 3OJBA 1YQ2A 2J1SA 2WT1A 1UAIA 5FWEA 5JWPA 1EAH3 5C71A 2W08A 2HYKA 3A22A 3ZIXA 3ES1A 3WY6A 2XQXA 2XJPA 1S0BA 4QGMA 2DVDA 5D21A 2WYFA 4RHV2 2X05A 1DQ5A 1OUSA 2VBBA 2WNVC 1YI9A 1ZBE3 4IE5A 5GZDA 4BB3A 4CP0A 4D94A 1FOD3 1UXZA 2UWAA 4TLFA 1OLQA 2QFEA 1DCSA 2CL2A 2VCBA 4H3WA 3T4HB 4DO0A 5FYBA 5KWRA 1T2XA 3KT4A 3D3AA 4KWJA 4NHLA 4XBQA 4BMBA 1AR82 3FFQA 3WQ7A 2MEV3 4DOUA 1ENQA 4COZA 2PLV1 2OA2A 5ACA3 1G86A 2V5YA 3AZWA 1WMEA 3NL1A 4CZSA 1Y4WA 2YPJA 3VBOB 3KB5A 2OQ7A 2AR6A 3GF6A 1XC6A 2E7AA 5FIXA 2XWBB 4CVUA 4MZUA 3MDPA 1GZWA 4J1XA 3BTXA 4UFLA 1PNGA 1UIJA 3EJKA 1W6NA 4R9BA 5BPXA 3LIHA 2EIBA 2WZR1 4NUBA 4XUOA 2JG8A 1RUI1 4K8RB 4FFIA 2W2IA 4KWLA 3FHAA 4IV1C 1EY2A 4C1WA 3LFIA 1UU4A 1G9CA 1QJY2 2SBAA 1QMJA 3ZXFA 2GH8A 3Q9OA 4R8HA 2RS13 3VD9A 1J1TA 2VO5A 3LEIA 5A6QA 4JRAA 1H2NA 2RDSA 4B1MA 5F5AA 5KXBA 4CUAA 4MGIE 3FZ3A 4Y1YA 4BH9A 2PXJA 5CB7A 4FAHA 5CAZA 1IG0A 1PO21 2ZHKA 1U5IA 3PIJA 4FTEA 3NNFA 4BQ5A 2P37A 4C1XA 5AC91 2W9XA 4ISQA 4CE8A 2RR11 3T1MA 4LBMA 5LA9A 1S0EA 3RWNA 1JHNA 5F9TA 2VXRA 4R9AA 3POYA 4HVQA 5ABJA 4AHWA 3POSA 4CPBA 1AL23 1W39A 5A32A 1AR63 2G9ZA 4QX3A 4RYDA 3VDDC 1ZZCA 2BNNA 1ND3C 2BEOA 4XFCA 3OPTA 1ND2C 3ETQA 4XHXA 4JQTA 4NIGA 2JE9A 1LHOA 3ZSEA 4TN7A 2PHUA 2D3PA 3ILRA 3WINE 4GZ9A 2CAVA 4CEWB 4FPHA 1WCQA 1JN2P 3B9IA 1PVXA 5H9QA 3D0JA 4HPKB 4K1YA 1UZ0A 1S0FA 4BXFA 1ZRCA 3RNSA 4M3CA 3J26N 3VBRA 5LEKA 3N7KA 4QM8A 1W6QB 1WD3A 3THPA 2VQ0A 5DUWA 2JIJA 1HX6A 4NIHA 1V9U3 4JDOA 3WF2A 3CMGA 1O5LA 1UXXX 4L97A 4QKDA 4UOJA 3ORJA 1J83A 5DAVA 5EWSA 2EXIA 2W95A 1PX4A 3SISA 3I54A 1HB4A 1DP0A 1LHUA 5FZOB 4A41A 1ZA4A 1ZRIA 5A6XA 4QPIB 3AJZA 1J3RA 4PI0A 2VBPA 1NKGA 2P3JA 4Z82A 4YLZA 3AKRA 1M4WA 4BJ0A 3N4MA 1B35A 1X36A 2J1TA 2XUMA 1GP5A 5FY7A 4AGRA 4BQXA 4DUXA 1X9TA 4GWMA 1R083 4K1ZA 4LIUA 4W6YA 2WN2A 3L2HA 4AE2A 5AFBA 4FTBA 1IZ3A 3W20A 4LHNA 4PDWA 5IFTA 5IVCA 2FMYA 3NJVA 1GV9A 4RR3A 3ZSJA 2AENA 5FPZA 2PHXA 4U2AA 1H6YA 1PHMA 1WA6X 1CESA 2C0ZA 1K45A 2R1DA 3SMHA 3GALA 3VBOC 4N53B 2WKKA 4JGZB 4M3CF 1DQ0A 4AFCA 2VMIA 2Y6LA 1W8HA 1KFXL 3J9SA 5GZGA 1MEC3 2JXAA 3O1PA 2H6CA 2BNMA 1IKPA 1HRI1 1CAWB 1N1VA 2IXJA 1VBE2 4I02A 1SQ4A 4DMIA 1OVSA 3CO2A 2ZKLA 4ZKTB 1LRHA 4LEJA 1F5JA 4H7LA 5A7WA 4CCOA 4CDXB 1ZZ7A 5FZHA 2MNGA 1CAXB 1H1MA 4IEVA 2DCTA 4GA9A 1BJQA 5FJKA 1YQ5A 1PK6C 2B42B 3K2OA 1NCRC 1WLWA 3CZUA 2E33A 2QQLA 1RVF2 4XF9A 3L2YA 5J09A 2J1EA 3RYRA 4LOSA 1KGYA 1PZ9A 1YC61 3NSTA 5T5JA 1AYM3 1NA1B 5JAXA 4LHKA 3WDWA 3FLRA 3UESA 3HAGA 4GIQA 1UMZA 2RDNA 3GHMA 2RM22 1EYBA 1KXGA 4QAWA 5BNQA 4A6SA 3ZFEC 3WNPA 3ZMOA 3T2PA 4DIQA 4M4RA 2DURA 2JKBA 1NXD1 2BBAA 2JENA 4N7IA 1D7PM 5EPAA 4JKLA 4NJ4A 4PBOA 2GMMA 2W1QA 3WW2A 2UY8A 4NHYA 5C9AC 4XDQA 5CZKA 3IZOA 1ONAA 5C33A 3LKJA 2AEZA 1VAKA 4W6XA 3VBHB 1IS6A 3NV1A 1D4M3 4QKFA 1I6XA 2R7EB 4RA0A 3ZXKA 3P6BA 2XDVA 2ZGSA 4I01A 2WLPA 1C8M2 4ASKA 1UD1A 3ZXGA 3IDBB 4IE4A 2WO7A 1S0JA 5FZIA 3S7IA 1AR72 3U07A 3WF1A 4AK3A 4CXXA 5JOWA 3G7DA 2YBPA 3VBUB 4OI0A 1ZX5A 4AZZA 4MOAA 2W1WA 1UZWA 3LZZA 4GMP3 1YFUA 4LORA 1BYHA 1GSLA 1UY3A 1GOGA 4CP9B 3K4DA 4AGVA 5FPXA 2WYSA 5FYVA 3O1VA 3GZAA 2Q8OA 2YXSA 3C3VA 3CU7A 3JCIA 4Y20B 4XFIA 3B94A 4HLTA 1SLTA 3PUIA 1KS5A 1UW8A 3J7HA 4L0PA 3RMYA 2R041 1GLHA 4YNIA 1LHWA 3M4FA 1VALA 2GN3A 4Q4V3 3ZKYA 5C3QA 3EO6A 3WT3A 3L9JT 5F5CA 1ZRFA 4MGYE 5E8AA 1WLTA 4YG6A 4IEUA 3NMBA 4CRQA 1BCXA 1RUJ2 1U5YA 4LMFA 1QDOA 1W8NA 4OUMA 1PVC3 4XF4A 1WMFA 2NLRA 4GB33 4XDOA 3ABZA 2X29A 3I2JA 3WW4A 1OLRA 2AYHA 2VW0A 2QQKA 4Y4YA 1APNA 1DZRA 4Y1ZA 3ZO0B 4NRPA 1G9BA 2RS33 3KSCA 4FBFA 3O1TA 1J59A 3H0OA 3KLSA 3X29B 4Z07A 5GZFA 5KBFA 5F3IA 3ZYBA 1BMV1 2JDHA 4QDSA 4HL0A 3QH7A 5FZ3A 5I0SA 4JVAA 3C7GA 3TRSB 5FP8A 1QOTA 5GJ6A 5BY5A 1NCQC 2ET1A 1DYOA 3POBA 3HNYM 5IAVA 4RS5A 2QQUA 1CX1A 2P3IA 1QOSA 1RUD2 1VRH2 2JG9C 4OZXA 3AP6A 3PUHA 2ILMA 5JIUA 2OS2A 2UYAA 2JX9A 5JCTA 1LGCA 3O0WA 1BVP1 2RJ2A 2FDGA 2JG8C 4ZXKA 3MLJA 1R1ZA 1I3HA 2OXBA 4A7ZA 2VQAA 1ULCA 4UBGA 2XBO1 1JZ4A 4NE9A 4TLGA 1MQTB 3WHUA 5A1FA 3HOBA 2ADDA 2HWD2 1GMMA 4XFBA 4S2DA 2Y0IA 4UYBA 1JUIA 4YZ1A 4JKKA 4X6RB 5E16A 5JXIA 3JUUA 4A7YA 4CDUA 5I8TA 4ZPIA 1PO11 1VBA2 2QBXA 1QJX1 2QQOA 1QQP1 5FMDA 1YO8A 1KFUL 1VJ2A 5KC6A 2ZMNA 2YFZA 1NLRA 2ARBA 5F6KA 1RUH1 2EAAA 4QQPA 2A7AA 4D8MA 2WLQA 5ABJC 1O6UA 1XYOA 2V4AA 1IS5A 3K48A 3WQ0A 1XOYA 4Y1XA 2FDIA 4YVSA 2JIGA 4CDWC 5TSWA 3W59A 4OZOA 3U10A 3ZXLA 4HANA 5FFOC 2YPDA 4FPFA 3K77A 2PLV3 3SCFA 3IAQA 4FPYA 1H2KA 5BXXA 1UX7A 3BYWA 1PM7A 2NPIA 3ZMNA 1EUTA 1Z78A 1XU2A 1W3VA 2JE8A 4LBKA 4OHXA 5K9YA 4XQ4A 3MF9A 4BE3A 4E2SA 1E57A 5F2WA 5I8SA 3USUA 4EWAA 1Z7S2 3MUY1 3NNLA 3SKJE 1QH6A 2WZR3 5D8AA 2I07B 2Q8EA 4EROA 3AVRA 1TNRA 4META 3LA2A 1F4AA 2ZGLA 3GBFA 4LLFA 3VBRC 1C3HA 1G6NA 3H7YA 1QOOA 5HV0A 3WW3A 5LA1A 4IEQA 4AEDA 3DGTA 2WNUC 2WFF1 1OA2A 2DCZA 4H14A 1TZOA 2OT7A 3E97A 4OI4A 2PQSA 3OD0A 2CHHA 2IZWA 2QQJA 2WJSA 1PO23 1DDLA
chains in the Genus database with same CATH topology
1XBFA 2P6HA 2CU5A 1VMJA 1VPHA 1VE0A 2P6CA 1VMHA 1VMFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XBF A;  2P6H A;  2CU5 A;  1VMJ A;  1VPH A;  1VE0 A;  2P6C A;  1VMH A;  1VMF A; 
#chains in the Genus database with same CATH topology
 3NVC A;  5FPB A;  4D7Y A;  5HV4 A;  4XJZ A;  1OD5 A;  2IFW A;  2WT0 A;  5L9B A;  2PA7 A;  3V0A B;  3KCY A;  2OW4 A;  5FZL A;  3DXU A;  4V2W A;  2WQ8 A;  3EHK A;  3THC A;  4OHZ A;  1W8W A;  1B35 C;  1KS4 A;  2QCS B;  3B00 A;  3N9Q A;  2GH2 A;  4CCL A;  4NPM A;  5J48 A;  2BUK A;  1BKZ A;  2VZR A;  3OGV A;  3VBS A;  5A7N A;  4EN7 B;  1REF A;  3WX5 A;  1W8U A;  1NXM A;  1W2O A;  2BGO A;  2TBV A;  1GZT A;  3HNM A;  3KVB A;  4PDW C;  1PNF A;  4YW3 A;  3CQO A;  1GNH A;  1W9W A;  3CJX A;  1RUE 1;  1SBF A;  1ZM1 A;  2HWC 1;  2JKX A;  3NQH A;  4Q4W 2;  1LOF A;  1Q8O A;  3IN9 A;  3H8X A;  4QX7 A;  1LEN A;  3WG2 A;  2WO1 A;  2W39 A;  5A7Q A;  3C7O A;  1VBB 1;  3DYM A;  5EIY B;  4K6B A;  2CDO A;  2FBE A;  1LUL A;  3LSD A;  5DN2 A;  2YRO A;  2C5D A;  2PHL A;  1H2M A;  3VKN A;  5KR7 A;  4GMP 0;  5K4L A;  5LCW L;  3T2T A;  3ZFF C;  1CJD A;  1DLL A;  2W0X A;  5J7M A;  4ISR A;  4JAA A;  3MYX A;  2GNM A;  2NN8 A;  4WM7 B;  4D7T A;  1CR7 A;  2VNV A;  1QJU 2;  3ZX7 A;  3WVJ A;  2G4I A;  3ILN A;  4XJ9 A;  1C1F A;  1LOC A;  5I93 A;  2WNO A;  3EBR A;  1O8P A;  4MGQ A;  2HWE 1;  1QJE A;  4FVV A;  3LWC A;  3C7H A;  1RXF A;  4DRR A;  3P1I A;  4IV3 A;  3KCX A;  4RHV 1;  4F3J A;  1XE7 A;  5IYY A;  2CYF A;  1XPW A;  3N9N A;  5GAL A;  4CXW A;  2EA7 A;  2V72 A;  4NOT A;  3VDA A;  3WP6 A;  4SBV A;  5KC5 A;  1XNB A;  1JYN A;  1O7F A;  1EUU A;  1V6M A;  1D4V B;  4GAL A;  5JSR A;  1AUY A;  4OI2 A;  3VKM A;  2BU9 A;  4Z2A A;  4KQ7 A;  1AR8 1;  3SNM A;  3ZSK A;  1JH5 A;  4LBO A;  3I2K A;  5I0D A;  1UPS A;  2FZ2 A;  1WUV A;  1GP6 A;  2BWA A;  4KI5 M;  5LY1 A;  3DKW A;  4AR2 A;  2BFU S;  1F2N A;  4B1L A;  1RUF 2;  3NWK A;  2VNR A;  2P5B A;  5CFD A;  5HPO A;  4MXV A;  3M3E A;  5IHR A;  3DKQ A;  4LXL A;  1ZRE A;  1MAC A;  1S0C A;  3UJO A;  2OQ6 A;  2KD7 A;  5KHH A;  4JKM A;  4AEM A;  1AYN 1;  1H4H A;  2BJS A;  4CSW A;  3IMM A;  1DG6 A;  2AZ5 A;  4Q4X 1;  3ZN6 A;  2D98 A;  4Q8L A;  4M0H A;  1OUX A;  1A78 A;  2B45 X;  3OYW B;  1XRU A;  1WW4 A;  3AFK A;  4AQ2 A;  4Z92 B;  1QJY 1;  1HRI 3;  3E5Q A;  2ORZ A;  5C7G A;  4YPJ A;  3BGA A;  2ZKN A;  3GGL A;  2PHF A;  3WZ1 A;  5A6Y A;  3AMN A;  2A6W A;  3KQ4 B;  4DY3 A;  1JZ6 A;  3ALQ A;  1UNB A;  1ASJ 2;  5FYU A;  5FXW A;  1UCX A;  4JHT A;  4QHB A;  4QQH A;  3H1M A;  2Q1M A;  2JDY A;  2ZGK A;  3GZT B;  2HBT A;  1LU2 A;  5A3U A;  1RHI 3;  1UYY A;  3T2O A;  2JDA A;  1UPI A;  5FP7 A;  3PJQ A;  4XZP A;  3UNP A;  1RIT A;  3B7M A;  3IKW A;  5AVP A;  2E63 A;  1PM4 A;  2BTV C;  1VP6 A;  3BPZ A;  3KF3 A;  3WF4 A;  2XQR A;  1JZ2 A;  3PVE A;  4WM8 B;  2RDR A;  1DZQ A;  2ZOE B;  5FQ0 A;  2VNO A;  2R06 3;  2VU9 A;  3HBZ A;  4P9X A;  5GZC A;  2KA3 A;  1XBF A;  4PHZ A;  1KRI A;  1JU4 A;  2Y6H A;  3J7L A;  1JYC A;  3T09 A;  2IXI A;  2OII A;  1US2 A;  3RYK A;  5F39 A;  5CIS A;  2QQP A;  1FAY A;  1HLC A;  1PIV 3;  4DEQ A;  2PAE A;  4Y3O A;  4AVB A;  4GUL A;  3T08 A;  2L9L A;  3AP5 A;  1ENR A;  3UGH A;  3WNK A;  1SFN A;  2D43 A;  2GME A;  3TEX A;  4B29 A;  1ACC A;  2VXJ A;  3OEA A;  1DYK A;  5EQU A;  2ARE A;  3AZX A;  2D6N A;  2RHP A;  5FYZ A;  4RS5 C;  2XVK A;  5FLH A;  5E88 A;  3BCW A;  1LTE A;  2DF7 A;  5JVV A;  2HWB 2;  1K42 A;  1SAC A;  4LQR A;  1W3X A;  5IK7 A;  1XND A;  3P3P A;  1UF2 C;  3OD4 A;  1Y9Q A;  1TMF 2;  3J8F 2;  3KZ4 C;  3JD7 2;  4O61 A;  2BDR A;  3N9L A;  2R04 3;  3ACH A;  2A1X A;  2FQP A;  3KGZ A;  3ZDV A;  1N1Y A;  3GNE A;  4ZS2 A;  2PHD A;  1GZC A;  2X09 A;  3KV4 A;  3POI A;  4Q0U A;  3N7J A;  3NV3 A;  1QKQ A;  3OTF A;  1NZC A;  4LUK A;  4QPG C;  4W4Z A;  4CDU C;  1G9F A;  4WZF A;  1HRV 1;  5LAS A;  3MID A;  3I4I A;  5C4W A;  1WBF A;  3M8L A;  4E4H A;  5A6Z A;  4IE0 A;  2ES3 A;  1ULD A;  2D93 A;  2ZCW A;  2Q8D A;  4L92 A;  1HQL A;  3VD7 A;  3TBD A;  1QNW A;  4M0N A;  5FZD A;  2O8O A;  2NMN A;  1SPP B;  2VGD A;  3BN6 A;  4HSJ A;  3TOJ A;  1D0H A;  1LED A;  1CZV A;  3T0D A;  4YVS C;  4EN0 A;  4XXP A;  2Y26 A;  1LGN A;  1W0O A;  1AR9 3;  1VBE 1;  3T0A A;  1GQP A;  1NCR A;  3E5U A;  4ES9 A;  4IE6 A;  3U11 A;  3I3Q A;  4KL1 A;  4LBJ A;  2ZEZ A;  3W21 A;  4A44 A;  2FDF A;  2A3W A;  1CVN A;  3CIH A;  3MIE A;  1VBC 2;  3ZYF A;  4XVH A;  2RDQ A;  2XG3 A;  3SCG A;  1VMF A;  5D8A C;  3CDZ B;  1RVF 1;  2Y6J A;  3VBO A;  4EV0 A;  4BQW A;  3I2G A;  3VDD B;  3WG3 A;  1W2A X;  1FPN 2;  1ND3 B;  4OVE A;  1DGL A;  4XZU G;  3TYJ A;  3WNO A;  2XBO 3;  4P5Y A;  5FY5 A;  3ETP A;  2GND A;  1EAH 2;  2W46 A;  1E5R A;  2ZAH A;  4QB2 A;  5K7P A;  1HXS 2;  4Y4R A;  4GJZ A;  2ARX A;  1LB2 A;  3POF A;  4YVW B;  3OB8 A;  5GLV A;  1D2S A;  2VVE A;  5H9P A;  4MX3 A;  1YLL A;  1FOD 2;  2ZBJ A;  4M01 A;  1QJX 3;  2FMD A;  3WOG A;  1QQP 3;  1UMH A;  2Y38 A;  4BDV B;  5BNO B;  3M2M A;  3AMQ A;  1M06 G;  4IE7 A;  3VD5 A;  1ENX A;  4MG2 A;  1RUH 3;  4AGG A;  5IW0 A;  5BNN B;  5J98 B;  4YM0 A;  2MEV 2;  1A3K A;  1LNS A;  1OA3 A;  1T6G C;  3PUQ A;  4LKE A;  3HPN A;  4FFG A;  4IER A;  3VBS C;  4LKD A;  1C8M 1;  5ACA 2;  1W9F A;  4KBZ A;  1OKO A;  3POG A;  5A7S A;  1Q56 A;  1AR7 1;  3D4K A;  1G9A A;  5T52 A;  5IJR A;  1OPM A;  1OXC A;  1LOF C;  4K7J A;  4Q1R A;  2HBU A;  3R6S A;  4JHZ A;  4Q26 A;  4LBQ A;  3ROU A;  4LHL A;  3BB6 A;  1P8J A;  3IBM A;  5FYM A;  3IPV B;  3D6E A;  4YZ4 A;  2VH9 A;  2DWR A;  2VOV A;  4AEK A;  1X9P A;  5FJH A;  1HN0 A;  2JD4 A;  4HG6 B;  1CAV B;  1F4H A;  2XHN A;  3PUR A;  4QT6 A;  5C3S A;  4Y5S A;  3Q8B A;  1UZV A;  4CEW A;  1KDM A;  3VKF C;  1A8M A;  3DUI A;  3VBF B;  4JGY C;  1IPS A;  4UFI A;  1F35 A;  4XFH A;  4NO4 A;  2EF6 A;  2QDR A;  3RQ0 A;  2QVS B;  4CEY B;  1WGP A;  1VBD 3;  3DN7 A;  1RUJ 1;  4IV3 C;  2ZML A;  4H7M A;  3POJ A;  1RMU 2;  4D3W A;  3RZM A;  1ZZ9 A;  2W68 A;  3I2I A;  4CU7 A;  1NCQ A;  2VM9 A;  4HN1 A;  2YGM A;  3WQ1 A;  1LAJ A;  5IUQ A;  1AL2 2;  1OMI A;  1PGW 1;  3B93 A;  3WNN A;  4F8A A;  1AR6 2;  2JG9 A;  2LS6 A;  5DZG A;  4YAR A;  3IWZ A;  4PF5 A;  1XNA A;  2CWS A;  4QPI A;  1PK6 B;  1W99 A;  2YC0 A;  3DF0 A;  4Q0V A;  4NHX A;  2WT2 A;  5GKA C;  3WNX A;  5CFC B;  1HJF A;  5FXX A;  5F8P A;  5LBE A;  5CFD C;  2HWC 3;  1H1I A;  1XNK A;  4KBB A;  3BU0 A;  1GQH A;  4IUG A;  4EYU A;  3ZSL A;  5FR3 A;  1HW5 A;  2VVF A;  1N1S A;  4I3P A;  1K5M B;  1VRH 1;  4TZD A;  1U0A A;  4IEY A;  4LHS A;  5EZW A;  5FDB A;  1WLD A;  3GZU C;  2A6Z A;  2C9K A;  3I3B A;  5FRA A;  3VHR A;  2HWF 1;  1XU1 A;  2E26 A;  2WN3 A;  4NHM A;  2RVA A;  3WG4 A;  3WR0 A;  5F6L B;  1YFX A;  4JZR A;  3AMH A;  2BQP A;  3RSJ A;  3TN9 2;  2PFW A;  1CON A;  1UY2 A;  1C57 A;  1UO9 A;  3QBQ A;  3TB0 A;  5F3G A;  1T6B X;  1AX2 A;  4QPW A;  1V6K A;  1UZZ A;  2DU0 A;  2DVG A;  3OBA A;  1REE A;  2HWD 1;  1SFY A;  4N53 A;  2BV4 A;  1GAN A;  1OSG A;  2JIC A;  4JGZ A;  2QTW B;  4MUV A;  1X8E A;  2Q1Z B;  1DFQ A;  2W47 A;  2X5I B;  5C3R A;  4P5H A;  4KNC A;  1KDK A;  3ZIW A;  4BIS A;  4QX5 A;  2BER A;  1CAW A;  2HWE 3;  3DYO A;  3OUH A;  1DQ1 A;  2JDM A;  3FWE A;  2BGP A;  4FOY A;  1OPO A;  5GLT A;  5EJ3 A;  4CDW A;  1GNY A;  2GSY A;  2R16 A;  5APA A;  5F3C A;  3O1R A;  3ZN4 A;  1HKD A;  1LEM A;  5FO7 B;  4XAC A;  4XET A;  3MIH A;  3E6C C;  2WC2 A;  3OY8 B;  5FYT A;  1RL3 A;  4YG3 A;  3RRD A;  5FZ4 A;  4XJW A;  4V1P A;  1TG7 A;  2BNO A;  1DGW A;  3SXW A;  1AR8 3;  1V6N A;  4HON A;  3S30 A;  4KWU A;  1OOP C;  3VDB A;  4P9I A;  1ZRR A;  5T5L A;  4AVV A;  3RVH A;  3O7O A;  1NA1 A;  2J1A A;  4BQY A;  5B4N A;  3ECQ A;  1AXK A;  2R6Q A;  1JMU B;  1CPM A;  2DFB A;  3SHR A;  4LO4 B;  5JR7 B;  5JOY A;  3NAP C;  2R1B A;  2NP0 A;  1AYN 3;  1NAE A;  2VEC A;  2YDE A;  1Y9G A;  4FOQ A;  1Z7S 1;  2E53 A;  2WNU A;  2XVL A;  4Q4X 3;  3EMR A;  4Q8K A;  2XJS A;  3VUO A;  2I45 A;  1MEC 2;  3IM0 A;  4BIO A;  1V6O A;  3PUS A;  5FYS A;  3SKV A;  2CWM A;  1QNY A;  3LD8 A;  2WAO A;  5IFP A;  1UY1 A;  1PZ8 A;  2W92 A;  1ULO A;  4HMZ A;  4JQR A;  1LU1 A;  4TWT A;  1FX5 A;  4AVC A;  2HEV F;  2ZGQ A;  3JBG 3;  3VBH A;  4DQA A;  2ZS6 B;  5M0T A;  1S0D A;  3TNQ A;  2HEY F;  3OOX A;  3U75 A;  2Q30 A;  2O8Q A;  4DUV A;  4HK9 A;  5DAP A;  3WUC A;  3K46 A;  1H9W A;  2VZP A;  1CGP A;  1UYX A;  2NMO A;  2PHT A;  3S6P A;  3OPW A;  3VBU A;  4AHX A;  4Q1P A;  5ANQ A;  1ULG A;  2W5F A;  3AP7 A;  4CP9 A;  2ZZQ A;  4XF1 A;  2ET7 A;  3ACI A;  2WA3 A;  4DY5 A;  1GZW B;  5JOX A;  3KT7 A;  5A7P A;  1QJZ A;  5EYY A;  4CXY A;  4NPR A;  1IG3 A;  5CNA A;  1ODM A;  2C1F A;  1I9R A;  1W6N B;  3EXU A;  2IXL A;  5LEJ A;  2ZX0 A;  3HQX A;  4HSL A;  3F2Z A;  5HXV A;  4DNY A;  1JI6 A;  4LPL A;  1S0I A;  3DEM A;  4EZH A;  1PGL 1;  5C4W C;  4XXA A;  3LPG A;  2VCM A;  1LHN A;  4GKY A;  4O9G A;  4Q4W 1;  1GYK A;  4XFG A;  4B4P A;  3PTY A;  3MIF A;  2GNT A;  3GXU A;  1HV0 A;  2CGN A;  1WCK A;  4QHO A;  5K0U B;  3ZFF A;  5DZE A;  1D4M 2;  5DAW A;  5JOZ A;  4P08 A;  2K9Z A;  3AL5 A;  5LBF A;  5BV6 A;  2XLA A;  1MZ5 A;  1ZBA 3;  2AH2 A;  1VMJ A;  2BW8 A;  2DVA A;  1Q8P A;  2OVU A;  2ZX4 A;  5F2S A;  5FBJ A;  3RYP A;  3APB A;  1V70 A;  4PF1 A;  3LQC A;  4WVM B;  3S57 A;  1O3S A;  1NQD A;  2GC0 A;  2VZV A;  3NJZ A;  5A33 B;  4BA6 A;  3AKS A;  5FKB A;  1J3Q A;  2EXH A;  5CBL A;  2VZ1 A;  4PLN A;  5FLI A;  3N35 A;  2PTM A;  1DQ2 A;  2ZEY A;  2RMU 2;  1BEV 3;  4NRM A;  1MR5 A;  2ORX A;  1FNY A;  3KT1 A;  2KXL A;  5KHG A;  2AGS A;  4QGL A;  5A32 B;  4A2U A;  2XON A;  1DQ4 A;  1QDC A;  1NLQ A;  1EV1 1;  2O1Q A;  2D6P A;  2QQI A;  3LEM A;  1FYU A;  3OG2 A;  3H3Z A;  1OFN A;  3I2H A;  3KCC A;  4QU2 A;  3E5X A;  3OUJ A;  3K51 A;  2WWJ A;  4Q4V 2;  2BOJ A;  5LA0 A;  3HJR A;  5FY9 A;  1JYI A;  3AMM A;  2Z4F A;  1YRZ A;  4RQP B;  2H0V A;  1OLM E;  2C24 A;  4CCN A;  2E9Q A;  1S2E A;  4L99 A;  5A3N A;  4QKB A;  1FAT A;  2J1V A;  1PVC 2;  5FY4 A;  1MQT A;  3AZV A;  4GB3 2;  1HRV 3;  3ZFG B;  3IT8 A;  2VL4 A;  2YBK A;  5FPL A;  5FZM A;  4HFS A;  4M3C B;  1QHD A;  3ST7 A;  5IVB A;  2OPK A;  3PME A;  4MGK E;  4A6O A;  2R0F A;  2PQQ A;  3GBW A;  3MIG A;  2PMW B;  2RS3 2;  4UBH A;  4S2H A;  2GNB A;  2ZAB A;  4XFF A;  5FTT C;  2WO3 A;  4ZON A;  1XJA A;  1G8W A;  5LK7 B;  3POE A;  1R09 3;  2Y60 A;  4H55 A;  3MPP G;  4FPL A;  1BBT 3;  1RJ8 A;  2W94 A;  4NVP A;  2VCC A;  3OGG A;  3FLP A;  4D6S A;  3VD4 A;  4CU6 A;  1VBE 3;  3HMY A;  4PLM A;  4XFA A;  2BPA 2;  4OI1 A;  1HB1 A;  4CDQ B;  3NNJ A;  4LO7 A;  1ASJ 1;  4N8M A;  4AQT A;  2A5Z A;  4AHY A;  4LIV A;  2LRP A;  1E5H A;  1C28 A;  1JYX A;  2IWG B;  1ULF A;  4AI9 A;  3GJB A;  1RVF 3;  4XF0 A;  3BPS A;  3N9O A;  3FJS A;  2A6X A;  3LOI A;  5FZ8 A;  3NJX A;  5A3P A;  4NPL A;  2EIE A;  4OHW A;  3I59 B;  4KU7 A;  4XDP A;  4RR3 B;  5E6H A;  3ZR5 A;  4CCK A;  3LB9 A;  3SLI A;  4CEW C;  2VJX A;  1FMD 2;  3CLP A;  2W87 A;  2PN5 A;  3C8X A;  4RGA A;  2QNK A;  4JX0 A;  4AAP A;  2IXC A;  5JZG B;  1BK1 A;  4JCK A;  5CAD A;  4AQS A;  1HIX A;  5C8W A;  5FZ1 A;  4AW7 A;  1ST8 A;  5CIR A;  2YHJ A;  5JMO A;  5J36 A;  4GH4 B;  2VUD A;  5F5Q A;  2FDK A;  2VCA A;  3O14 A;  3ZYR A;  1CIW A;  1V0A A;  4FOW A;  3LPF A;  4GD4 A;  3KGL A;  4PT6 A;  3CJI B;  4QPI C;  1C8M 3;  1KJR A;  2HJI A;  1O59 A;  4XOG A;  3V0A A;  4Q27 A;  3MGU A;  2ATF A;  4CCJ A;  2VOT A;  2ARA A;  1RUN A;  1J58 A;  2Y6F A;  1IPJ A;  3Q8F A;  4WVV A;  1R64 A;  4I3G A;  2UY9 A;  2D5H A;  1DHK B;  2HWB 1;  4FOV A;  2R30 A;  3RGB A;  3WUD A;  2ZHN A;  5FWJ A;  1RUG 1;  4XAB A;  2YC2 A;  2IXK A;  4IGP A;  1TMF 1;  4QPG A;  2EXJ A;  3ZXJ A;  3RI8 A;  1AJK A;  4BXS V;  1IGO A;  5FZ0 A;  3JD7 1;  4LIT A;  5HXM A;  1SLL A;  2JDN A;  2EAK A;  4QX1 A;  4N53 C;  4XTM A;  4JGZ C;  1XNC A;  3S0M A;  5SV5 A;  1Q8V A;  2G9F A;  3LDK A;  4M4P A;  3KHC A;  4K20 A;  5FP9 A;  2V73 A;  4PBP A;  3FL7 A;  1A34 A;  1H6X A;  3QAC A;  1PO2 2;  3OGS A;  1VR3 A;  5FZA A;  1C8N A;  4LK6 A;  1W6P B;  1W8F A;  4Q29 A;  3WNL A;  2XR4 A;  1RUJ 3;  5DAX A;  5DMY A;  1JYV A;  3TWI A;  2HKX A;  2P34 A;  1OI6 A;  3FHI B;  3K3N A;  4R9C A;  1ENS A;  2VMF A;  1JUH A;  4WM7 A;  1MS0 A;  1OD3 A;  2W1U A;  1Q8Q A;  3POW A;  1H0B A;  4QU1 A;  3JU9 A;  3URF A;  4CDX C;  4D7S A;  5IVV A;  5FPA A;  1CAU B;  1TQ5 A;  5DAB A;  2V09 A;  3WDX A;  4FQZ A;  2VZQ A;  1MS9 A;  1LOD A;  2D6K A;  5A3L A;  3GCW A;  1S1A A;  4IW3 A;  4JV4 A;  5DAQ A;  4CYD A;  1K12 A;  1TME 1;  1OC1 A;  2DCY A;  3F95 A;  4E4D X;  4XIL A;  3WP4 A;  1NA1 C;  2ZGR A;  4NAM A;  2GDF A;  4C8D A;  1RUI 3;  2JDZ A;  2VQU A;  4LBL A;  4WBB A;  5BNP B;  2OPW A;  1Y43 B;  4BQ2 A;  2I2S A;  5L73 A;  2Y6G A;  1JOJ A;  1NLS A;  2ZX3 A;  3LDR A;  3PL0 A;  1VBC 1;  2GP5 A;  3MW2 A;  4P00 B;  4AL9 A;  1U5X A;  2HWF 3;  5FZC A;  5LB6 A;  3VL8 A;  1MZ6 A;  4CCE A;  1IHM A;  2C4X A;  2D97 A;  4HZF A;  4URA A;  1GR3 A;  1COV 1;  4ZZ5 A;  4OCT A;  1C5H A;  2XLF A;  5FZK A;  4PIX A;  3LEK A;  1W90 A;  4XUP A;  5FYH A;  2JDK A;  3VZN A;  1A8D A;  4GKX A;  2XVG A;  1H8T B;  2DBI A;  1ZNP A;  2WSU A;  1EAH 1;  1R1A 2;  2E7T A;  3C7E A;  3UK9 A;  3VBH C;  2HWD 3;  3FE5 A;  5C8C B;  1HXS 1;  5AC9 3;  2X8K A;  3OYW A;  2RR1 3;  4FI9 A;  4A45 A;  1GUI A;  5FO8 B;  3ZPY A;  4EJR A;  3KS7 A;  4JTN A;  3VBU C;  1FOD 1;  4U36 A;  4V2V A;  4COW A;  3LIG A;  4I09 A;  4Y33 A;  3PDQ A;  1GBG A;  1OUR A;  1F15 A;  2A3X A;  3A23 A;  3BVC A;  3CL1 A;  2F6B A;  3NNM A;  5FP4 A;  3MEP A;  5CKN A;  3BKZ A;  3WCR A;  1NUK A;  5B2G B;  4UT5 A;  4RS5 B;  1CX4 A;  1DYP A;  5J3U A;  3LFM A;  2RG4 A;  5C70 A;  3ZDS A;  2R07 1;  1O3T A;  1JYW A;  4LKF A;  2VW1 A;  3J7M A;  4NRQ A;  3V56 A;  4BME A;  2ADE A;  2B39 A;  4IGO A;  3R4S A;  1DGR N;  4KU8 A;  3FHQ A;  3HT2 A;  2WZ8 A;  1VAM A;  5J96 B;  1X7N A;  1H2L A;  2VZ3 A;  3AVS A;  3NV4 A;  1V6J A;  4FXK B;  4WM8 A;  5DDJ 2;  3RWK X;  1Z7S 3;  4JGY A;  4AI8 A;  5L9V A;  5IVF A;  3O1S A;  4JDM A;  4L8Q A;  4QXC A;  3HVD A;  4N43 B;  3MW4 A;  2VD7 A;  5L7O B;  1DBN A;  2J7M A;  1ZZ8 A;  4X6Q B;  2DCK A;  2P1B A;  5H9S A;  1F5F A;  1WMX A;  3OUI A;  4EN6 B;  5LZ6 A;  5HCF A;  2GAL A;  1OF3 A;  1MS1 A;  1UOJ A;  1YFW A;  1GQG A;  4XUT A;  3ZPO A;  1RHI 2;  1BZW A;  4WZC A;  1RMU 1;  1MVE A;  1NG0 A;  4DFS A;  2WIN B;  1XE8 A;  2WS9 2;  3RMX A;  3WG1 A;  1VMH A;  5ERL A;  2ZA9 A;  1E5I A;  2YYO A;  1G9D A;  1AL2 1;  2A70 A;  2JB8 A;  2NZ9 A;  3E6D A;  1VB2 A;  1YJL A;  4KGG A;  1Z0H A;  2Y64 A;  5JXJ A;  3UKV A;  1JYT A;  2R06 2;  4IGQ A;  4CUB A;  2ZAC A;  2VUA A;  3V65 A;  3WCS A;  3RI9 A;  5JR2 A;  1MQT C;  4FPE A;  2VG9 A;  4R4X A;  2GN7 A;  2D3S A;  4MXW B;  3VB9 A;  4Q4W 3;  1PIV 2;  1V6I A;  3WD5 A;  1C5I A;  2TEP A;  2XJQ A;  1PX3 A;  2YZ4 A;  3VGI A;  3B9C A;  1RUC 2;  2RS5 2;  4Z1V A;  4AED B;  5FBZ A;  4CUG A;  1L3J A;  4EZ4 A;  5I91 A;  1W0P A;  4OLL A;  2W1S A;  3TN9 1;  5C5U A;  2AAC A;  1MVQ A;  3C7F A;  4E4Z A;  2BVB A;  1C1L A;  1FXZ A;  4NN0 A;  4K21 A;  1HV1 A;  3LDB A;  1W6M B;  1H9P A;  4PQ9 A;  4R4Z A;  4BLJ A;  3B02 A;  1U12 A;  1SPP A;  4M00 A;  4UF0 B;  1CJP A;  4L9B A;  2C26 A;  3MFA A;  2NQY A;  3CZJ A;  5BUV A;  2VUJ A;  4XIO A;  3WNM A;  1UL9 A;  1XYN A;  4XAE A;  4SLI A;  1OLM A;  3AYA A;  3DPR B;  4HKO A;  4ASM B;  4MLO A;  2P6C A;  1EV1 3;  3I3D A;  5JDB A;  1OOP A;  4PCR A;  4XYX A;  1IQA A;  1VIW B;  3FBY A;  4QWN A;  2E7Q A;  1EPW A;  1KIT A;  2WAA A;  3MLK A;  4W50 A;  3O1U A;  4FQ4 A;  4RGG A;  1Q43 A;  3NAP A;  4W6W A;  4XJU A;  4EN9 B;  3WDV A;  1QJF A;  3LSE A;  1XQN A;  3HQU A;  3M7A A;  2HYX A;  4QKN A;  4MHR A;  4UW3 A;  4BQ4 A;  3MHZ A;  5JSO A;  1XB9 A;  3GBG A;  3D5O A;  1GIC A;  4CP1 A;  4P02 B;  1O4T A;  3ACL A;  2LTN A;  3EB7 A;  1ZVF A;  2WNV B;  5JXG A;  3MBW A;  4TYS A;  1OT5 A;  5FZ7 A;  2JE7 A;  2OZJ A;  3I2F A;  3LEG A;  4YVW A;  4LBQ D;  2W3J A;  4A4A A;  4I2O A;  2YY1 A;  3HIF A;  1MEC 1;  1AR9 2;  4YW4 A;  3TNP B;  1NT0 A;  4AI3 A;  2FZ1 A;  3HN1 A;  1RJ7 A;  2CSG A;  2XLG A;  4W8J A;  3FUQ A;  5DG1 A;  3SEE A;  1UWW A;  3VD3 A;  2P17 A;  3KD4 A;  2VUL A;  3HT1 A;  5BNN A;  1VRB A;  5T55 A;  2G1M A;  1A6C A;  3Q8A A;  3GM8 A;  2FDJ A;  1UOG A;  1ASJ 3;  4CUC A;  1S2B A;  3I7D A;  2YFU A;  4WVZ A;  5CEH A;  4QHZ A;  3T3Y A;  4EQV A;  1YJK A;  2LM3 A;  1J84 A;  3WQB A;  1TVG A;  1JOD A;  3UGF A;  2UWB A;  5IVE A;  4A42 A;  3RZH A;  5DUU A;  4LO8 A;  2LAL A;  1UKG A;  2VNG A;  4IV1 B;  2DDU A;  4XIK A;  1LOA A;  3THD A;  3E1F 1;  5A1L A;  1F9K A;  1CAV A;  4DEV A;  1VB4 A;  3IB3 A;  1SHW B;  1QQP 2;  4H2A A;  3M3C A;  3OPZ A;  3PNA A;  3BTA A;  3KF5 A;  4WM7 C;  4WVW A;  3U4S A;  4QXB A;  1IOA A;  4Q2F A;  2ZJC A;  5JPN B;  1V00 A;  3H1Y A;  1V6L A;  4QDQ A;  4CEY A;  2A6Y A;  3N7M A;  4Q4Y 2;  2QDN A;  4G4F A;  3SH3 A;  5GLW A;  1QXR A;  1WW6 A;  2QQW A;  1OH4 A;  4B7E A;  1Q5O A;  1YIP A;  4UFH A;  3AXD A;  1XE0 A;  1RC6 A;  4C0B A;  2JEC A;  2HH9 A;  5EFU A;  3FUO A;  1ZRD A;  3AZZ A;  1CIY A;  2GU9 A;  1UIK A;  2WDB A;  3H42 B;  1UOF A;  1LGB A;  1SFP A;  2XHK A;  4K40 A;  2DUO A;  1OFS A;  2PAM A;  4ARX A;  1JZ5 A;  1ND2 B;  1ZZB A;  2XML A;  2RMU 1;  2VMH A;  4LE4 A;  1GNZ A;  3RZJ A;  4GWI A;  1CPN A;  2HWB 3;  5DZF A;  4CP2 A;  5HCA A;  2YMZ A;  3SCH A;  5CFC A;  3M3I A;  5ISL A;  1RUG 3;  2RM2 1;  1W2U A;  5FQ0 B;  3KV9 A;  3LAG A;  3JXS A;  1K5M A;  3GYD A;  4FTS A;  3ZYH A;  1ZBE 2;  1XSR A;  4CPB D;  3JD7 3;  3OSD A;  1PO1 3;  3C2U A;  1MS8 A;  2UUR A;  1J1L A;  3I2D A;  2G19 A;  3UKN A;  3O1O A;  4DIN B;  2R0H A;  5E89 A;  3FBM A;  2ENR A;  5I0U A;  3S5A A;  4UW4 A;  4O7X A;  4YZ3 A;  5FXZ A;  5KHJ A;  1VBD 2;  3FC0 A;  4AYU A;  1PVC 1;  1HN1 A;  2PHR A;  3V0B B;  5FMB A;  2K46 A;  3ASI A;  4FO9 A;  4XUR A;  5JI7 A;  2H0B A;  4E27 A;  1B09 A;  1WW7 A;  3O0X A;  2VY0 A;  2X5I A;  3PVB B;  2B5H A;  4RD7 A;  3EYP A;  3BIW E;  4YW1 A;  2KR2 A;  4MHU A;  5HCB A;  1UU5 A;  4NMI A;  4P9W A;  4COU A;  1LOE A;  2O0O A;  4Q0S A;  5EYX A;  5A3O A;  1L7R A;  3AX4 A;  4RN5 A;  2J22 A;  3B01 A;  3I3E A;  4CCC A;  5JLV A;  3III A;  4UAP A;  1TME 3;  3WLU A;  4D6R A;  1AVB A;  2E31 A;  2Q4S A;  3USS A;  1NY7 2;  5IAT A;  5JMC A;  1WCD J;  1NYW A;  3OY8 A;  3V64 A;  4XMA A;  3MIC A;  4XW3 A;  2DFC A;  3HBK A;  3MW3 A;  4HKW A;  3INA A;  2ZGT A;  2A75 A;  2WL1 A;  2RS1 2;  3JQW A;  4K8F A;  4N7U A;  1WCS A;  1SDW A;  2E6V A;  2ZMK A;  4WM8 C;  3MPB A;  1H8V A;  1AX1 A;  1SLB A;  3DXT A;  3R4U A;  1GZ9 A;  4HPK A;  2WFF 3;  2XJU A;  1MZE A;  3IDC B;  4Y22 B;  2VZO A;  5D2A A;  1XNT A;  3RG0 A;  4LA3 A;  4YWA A;  1K5J A;  2FCV A;  4MO3 M;  5HI0 A;  1COV 3;  1LHV A;  1W6Q A;  3ON7 A;  4IEW A;  4HKL A;  3W9A A;  3BTY A;  2UU8 A;  1AHS A;  3GHN A;  4IES A;  3PJY A;  1FMD 1;  4ASL A;  2VMG A;  4HXC A;  3THT A;  2BVV A;  1HXS 3;  4YSF A;  2VME A;  2HWE 2;  1PMI A;  2OKX A;  3T1L A;  3A4U A;  4QX2 A;  1QEX A;  2IUW A;  4G3Y C;  1SMV A;  5LAT A;  4RFR B;  1TNF A;  1WKY A;  3R05 A;  5FZO A;  5FUN A;  4AI0 A;  5F1R A;  1FT9 A;  4BM8 A;  1GKB A;  4ZXE A;  1W6O B;  1UMI A;  1NCR B;  1BXH A;  5FUI A;  1UOB A;  1ZZ6 A;  2GC2 A;  1RUE 3;  2FDH A;  2AC1 A;  1DF0 A;  1E5S A;  1UQX A;  2VQT A;  3AKT A;  1OA4 A;  2ZEX A;  1RUD 1;  2FCT A;  5FRE A;  4ZU7 A;  4LBN A;  1RGS A;  3U14 A;  1SBD A;  3I97 A;  2R07 3;  1VBB 3;  1CZS A;  2VTX A;  3U1X A;  3HWJ A;  3AYD A;  1C4R A;  4YYO A;  2P4E A;  4QM9 A;  5I0R A;  3ZFE B;  4C91 A;  1PMH X;  4XUQ A;  1AYN 2;  1N3O A;  5IK4 A;  2IVJ A;  4YZ5 A;  1V9U 2;  2GP3 A;  4GJY A;  4Q4X 2;  5FOJ B;  3ZM8 A;  1RIR A;  2XJR A;  2JJ6 A;  3A0K A;  5G04 L;  4ARY A;  2OZ6 A;  5C9A B;  4LO5 B;  3SQO A;  3VZM A;  4OYU A;  3ZYJ B;  5IAX A;  3A7Q A;  3NRU A;  2TUN A;  1N47 A;  1VBA 1;  1Y7B A;  3JBG 2;  4XF3 A;  3HR9 A;  5K0U A;  3MLL A;  1YUD A;  4RHV 3;  1W0N A;  1WA4 A;  3OGR A;  5I0T A;  4DXT A;  4K9S A;  1F8V A;  4C0H A;  2Z69 A;  2A73 B;  3CF6 E;  1O8S A;  2R49 A;  4E8C A;  3ELN A;  4OMD A;  2IVI B;  4CDX A;  2CY6 A;  1CAX A;  2DTY A;  3OBR A;  2XH6 A;  2P3Y A;  3VHO A;  4WVM A;  4AVT A;  1YXW A;  1ZA7 A;  4C90 A;  2LUW A;  1R08 2;  3JB4 C;  4MAD A;  5IWF A;  1N3P A;  3PIG A;  4NAO A;  5A33 A;  4AWD A;  1RMU 3;  1BVV A;  2VUC A;  4DPN A;  4IET A;  1QXP A;  3O5S A;  1RED A;  5FO9 B;  4ZZ8 A;  4J25 A;  2W91 A;  2WWU A;  5T5O A;  2XB6 C;  4LBQ B;  3CEW A;  2ZX2 A;  4UWD A;  5A80 A;  3WEZ A;  4QGN A;  3AYC A;  3VKL A;  3MUZ 1;  2D7F A;  1O3Q A;  3O12 A;  1QF3 A;  3EQE A;  2WQ4 A;  4B4R A;  4W65 A;  5FMO L;  5F37 A;  4FPC A;  4AFA A;  4IEZ A;  3VL9 A;  1YEW A;  2WA4 A;  1FV2 A;  1SLC A;  2D44 A;  4Y1V A;  2WZP P;  3WDT A;  1HQW A;  2BFU L;  2RV9 A;  3GZE A;  4RQP A;  3D0S A;  1BHG A;  1YFY A;  4AVS A;  2DV9 A;  4FXG B;  3H8R A;  1MPX A;  4CA9 A;  1QJY 3;  3WW1 A;  3P5B A;  1BQP A;  4BZ4 A;  4N90 A;  4Q0P A;  1ZBA 2;  4YVW C;  2BBV A;  2ZPX A;  4I0W B;  5FXV A;  3ZFG A;  3OBZ A;  4YW5 A;  4EE2 A;  3I49 A;  2RE9 A;  4S2F A;  5T54 A;  3TN9 3;  4LE3 A;  2QZ3 A;  2EIG A;  4LUL A;  1YQ6 A;  5BNO C;  4KH9 A;  1RUO A;  2XKO A;  2Y0O A;  1R1A 1;  5BNN C;  5BYN A;  1AYM 2;  1LKN A;  2R32 A;  2QE3 A;  1LES A;  1LR5 A;  1NOV A;  1BEV 2;  1NCQ B;  3BIE A;  2BGC A;  4MYE A;  3RZK A;  3IDE A;  1VAV A;  2WO2 A;  3MO4 A;  4HT1 T;  4PI2 A;  2JG9 B;  2VTX J;  2AEY A;  5FZ6 A;  3ACG A;  2JDP A;  2Q1F A;  4Y20 A;  5DQ0 A;  4OMC A;  4JDN A;  2JG8 B;  3ENR A;  1WLC A;  3CKH A;  4OQ9 A;  4CDQ A;  2A71 A;  5FZF A;  2VTF A;  2XWJ B;  4LKS A;  4NIA A;  3IIA A;  2DCJ A;  4B8E A;  2MPF A;  4LR4 A;  1QXJ A;  1ULE A;  5CYY A;  1KD7 A;  4BK4 A;  3AKQ A;  2B8M A;  1HRV 2;  2EIC A;  4XQW A;  4O9E A;  4YGB A;  1W8O A;  3WF0 A;  3HQR A;  3OGJ A;  1RTV A;  2P2K A;  3ZLI A;  3I59 A;  5FKC A;  4QQ2 A;  3RJR A;  3TEZ A;  4YGE A;  1H4G A;  1Y3T A;  4CU9 A;  3VBF C;  1S4C A;  3H50 A;  3RFR A;  1X8M A;  5DDJ 1;  5DPN A;  1W9T A;  3GJA A;  3QH6 A;  4CEY C;  3W58 A;  3N9M A;  2YBS A;  1POV 1;  3QCW A;  1R09 2;  4YG0 A;  1JS9 A;  5JZG A;  1QJU 1;  3B69 A;  4GXL A;  1BBT 2;  1J3P A;  2WFP A;  2VZT A;  3J4U H;  3ZOI A;  4XJ8 A;  1S55 A;  3PTR B;  5ABJ B;  4GH4 A;  5FY0 A;  2ZXQ A;  1W9S A;  4N9I A;  4XTP A;  2QZ2 A;  4CDW B;  5A1A A;  4XC9 A;  1UYZ A;  3AM2 A;  3LE0 A;  1FI2 A;  1YQ8 A;  1PGS A;  4P9Y A;  2VZU A;  3O1M A;  3W5N A;  1G7Y A;  3CJI A;  4ZHN A;  1VPH A;  3DYP A;  5FY1 A;  1I5P A;  3ZR6 A;  1RHI 1;  4PJY A;  1OHF A;  3ITQ A;  5CFC C;  1GFF 2;  2O14 A;  2RJK A;  4E2Q A;  2P3K A;  1ODN A;  4LNV A;  1LEC A;  1OQD A;  1JU3 A;  1LJ7 A;  2WS9 1;  3BOP A;  3DEC A;  3ZYP A;  1YCI A;  2YV8 A;  4ORF A;  4PLO A;  5JI9 A;  1K5M C;  2XJV A;  3GDB A;  5DG2 A;  4L2N A;  3RDI A;  1GWL A;  4E9K A;  1OQE A;  1RUF 1;  1W2N A;  2ZGN A;  3FX3 A;  3BTZ A;  3VV1 A;  3VBR B;  3ZYI B;  2WZE A;  3IAP A;  4LK7 A;  2R06 1;  2ZHL A;  4FT8 A;  2WNU B;  3WP5 A;  2XOM A;  3ILF A;  3NV2 A;  1SZB A;  3FLT A;  1UYP A;  3LCP A;  4IDZ A;  2WBK A;  4UI9 L;  1AZD A;  1W2T A;  2Y33 A;  1PIV 1;  2CGP A;  2W52 A;  2X5I C;  3LOB A;  3BI3 A;  3FN9 A;  3I8T A;  4MGS A;  1RUC 1;  2RS5 1;  2VOW A;  5JSP A;  4I0A A;  1F31 A;  2EID A;  1W6P A;  1X82 A;  3RS6 A;  5LRR A;  4XEZ A;  4UXA A;  1CN1 A;  2EXK A;  4BCU A;  4AI1 A;  1B35 B;  1UY4 A;  4AG4 A;  1UZY A;  3U0Z A;  4MH0 E;  2LRO A;  1YQC A;  4ZY9 A;  1RYY A;  2CTV A;  3ZYG A;  1DQ6 A;  3M70 A;  2Y6K A;  1CAU A;  3BAL A;  4NWW A;  5FUP A;  4PDW B;  1DU3 D;  3WDY A;  4TTG A;  4LTA A;  3B3Q E;  3ZXD A;  2ZHM A;  2YU2 A;  2YG0 A;  3M3O A;  4PQQ A;  5B4X A;  4AOC A;  5FY8 A;  2WAB A;  2NM1 A;  2RMU 3;  1JOB A;  1UN1 A;  3KVA A;  4XCB A;  1TE1 B;  3NJY A;  4YGC A;  5FOB B;  2VPV A;  2JDU A;  4KG8 A;  2VAU A;  4F7Z A;  3ZN5 A;  2RM2 3;  2NYY A;  4R9D A;  5BNP A;  2D5F A;  3OF1 A;  1URX A;  1WMD A;  2DBN A;  3H3U A;  4RGK A;  1LOB A;  1XXN A;  5CU1 A;  5DXD A;  4B4Q A;  3DL3 A;  3AXE A;  4BOW A;  3ZFF B;  5KHK A;  1HB2 A;  1X33 A;  3BU7 A;  4FP2 A;  2GMP A;  4QMA A;  4XCA A;  4Y26 A;  3ES4 A;  3SH4 A;  3SIT A;  4AFM A;  5JPM B;  2OUJ A;  4K3U A;  5A7W B;  2QKD A;  4ES8 A;  1H8T A;  2PLV 2;  2XKP A;  5C8C A;  4BLI A;  2VVD A;  5FMC A;  1AR7 3;  5IK8 A;  2B46 X;  3S7E A;  2AUY A;  4P14 A;  1PGW 2;  4X8N A;  2QQM A;  5K8S A;  1AR9 1;  3H1W A;  2HEW F;  4MGT A;  2ZX1 A;  4DUW A;  2WZR 2;  3H9A A;  1RUI 2;  1W28 A;  1O3R A;  4BIF A;  2IXH A;  3CHX A;  5C3O A;  4IQP A;  1U5Z A;  2FD8 A;  1QGL A;  1IS3 A;  3J8F 1;  4E4S A;  5EJZ B;  3SH5 A;  1O5U A;  4AFD A;  3R0R A;  5KXD A;  2WR9 A;  3O0V A;  4LO6 B;  4FCA A;  3AP9 A;  2HWF 2;  4OQ8 A;  3RZL A;  2ETE A;  4UFM A;  2XUE A;  3AZY A;  3WXP A;  3T4V A;  5C3P A;  3WP3 A;  1ULP A;  1EP0 A;  1N1T A;  2PHW A;  1JTZ X;  1QY4 A;  2Z5W A;  3IMN A;  4Y5Z 0;  5FYI A;  3ZSM A;  4D6Q A;  4CU8 A;  5K0U C;  2VOK A;  4AI2 A;  1RB8 G;  4I30 A;  4X8P A;  3ZVX A;  3QLQ A;  5AC9 2;  1OBN A;  1GWK A;  4LA2 A;  3WHT A;  4YZ2 A;  3Q8C A;  2RR1 2;  3PU3 A;  1FMD 3;  4OUS A;  3S5Q A;  2C9A A;  3NKT A;  4N43 A;  1DIW A;  5L7O A;  1S2K A;  3RJ2 X;  4FP3 A;  5ANN A;  1DZT A;  2VMD A;  2JEM A;  3NW4 A;  4QPY A;  4FFF A;  4FPK A;  3TAY A;  3H8U A;  4ZS3 A;  1JXN A;  1W8T A;  3KV5 A;  2DVB A;  2CDP A;  5CVR A;  2BZD A;  1AXZ A;  3VZJ A;  4Q4Y 1;  2ZTN A;  4YW7 A;  3UT0 A;  3LA7 A;  5LRS A;  3SC7 X;  1RUD 3;  1RIN A;  1VRH 3;  2JD9 A;  3CBN A;  1LCL A;  1X50 A;  4MV2 A;  4URT A;  3ZKU A;  4COY A;  5FZG A;  3VZO A;  5AVA A;  3BUC A;  4RQP C;  1PZ7 A;  1W04 A;  1FPN 1;  1XSQ A;  2XGX A;  3KMH A;  3HD8 B;  1UKR A;  3PLQ A;  2ERF A;  4LOT A;  1GOF A;  3AB0 A;  1MS3 A;  5DUV A;  2PEL A;  3N36 A;  5D1I A;  4UW5 A;  4IXL A;  5CKQ A;  2B4K A;  2CGO A;  4HK8 A;  3ZFG C;  5L19 A;  4OHY A;  4MXW A;  3WDU A;  1HQN A;  3VKO A;  2A3Y A;  4IEP A;  1O4Z A;  1W8Z A;  1ZBE 1;  2DUP A;  3R4D B;  4LLO A;  3JQX A;  4Q5O A;  5F5I A;  1VBA 3;  4Z2W A;  4UFK A;  4IEX A;  2P6H A;  3JB8 A;  5LBB A;  4A3Z A;  5F7U A;  4YM1 A;  1ALY A;  4YGD A;  4Y5T A;  4E8D A;  3QD6 A;  1VBD 1;  3HNB M;  1AJO A;  1O4Y A;  5LK5 A;  1HB3 A;  2CAU A;  3PUA A;  2MEV 1;  1HDK A;  2Y8K A;  3K3O A;  3PMS A;  2ZAA A;  4YFW A;  5EXO A;  5FZE A;  5I8Y A;  1W6M A;  4P9L A;  4XMI A;  5ACA 1;  1JOP A;  2K0G A;  2Z42 A;  3AC0 A;  3H8O A;  3I3M A;  4UF0 A;  4CDQ C;  1QWR A;  4QDR A;  1VE0 A;  2GAU A;  4AFB A;  4DS0 A;  2A6V A;  5FAX A;  5J37 A;  4FSJ A;  1QIQ A;  2ARC A;  5L36 A;  1AL0 G;  4J6G A;  3AK0 A;  4XAA A;  1K3I A;  3OBT A;  5FYC A;  3DPR A;  5EJ1 B;  3U78 A;  3KQR A;  4UW6 A;  4EWD A;  4AHZ A;  4Z8B A;  1BLZ A;  1GOH A;  1SDD B;  1PGL 2;  2GC3 A;  4IL7 A;  4EN8 B;  4NID A;  5EV7 A;  2KM2 A;  4PIY A;  4QQL A;  1NY7 1;  1WZX A;  3T0B A;  4RR3 C;  3U4X A;  4CDU B;  4QPG B;  3N3H A;  2V4V A;  4OUL A;  2QQV A;  1HRI 2;  3WSO A;  4BQ1 A;  1AF9 A;  1WBL A;  5HCH A;  1WD4 A;  2YUE A;  3ACF A;  5GLZ A;  5A3W A;  1GU3 A;  2HLE A;  2RS1 1;  5IVY A;  4O65 A;  5IVJ A;  4N9H A;  1YNA A;  3T2Q A;  1YWK A;  1YI7 A;  3UGG A;  5A7O A;  3MZH A;  3IDA A;  4GWJ A;  2BYV E;  3J7N A;  3D8C A;  4QQO A;  5JZG C;  5FPV A;  3WV6 A;  4YFZ A;  2DTW A;  2DUQ A;  1L7L A;  2XL7 A;  3AFG A;  4BQ3 A;  4XUN A;  3VLB B;  4GH4 C;  3KV6 A;  2Z2S B;  3RZZ A;  5J1X A;  2QQN A;  2QUO A;  4L11 A;  2WNV A;  4YVS B;  4OUE A;  4AF9 A;  4DXZ A;  1R1A 3;  2JB4 A;  4HN0 A;  4A3X A;  5C6C A;  1STM A;  3AYE A;  3G6J B;  2BRT A;  4FPJ A;  1D2Q A;  2F4L A;  3CJI C;  3KWV A;  4QX0 A;  5LA2 A;  1JBC A;  2ZZJ A;  3AL6 A;  4NWV A;  1FV3 A;  1L7Q A;  1AR6 1;  5CA6 A;  3VZK A;  4G9S B;  1EV1 2;  4GQ7 A;  5DUX A;  4AVA A;  2WRA A;  3USU B;  3A21 A;  4BWO A;  1UU6 A;  2IFR A;  4MSV A;  5A70 A;  4QB1 A;  4BU2 A;  4KMQ A;  2TNF A;  4ZU4 A;  5D8A B;  1S0G A;  3P3N A;  4P9J A;  3UL2 A;  2Z79 A;  3FFZ A;  1KJL A;  5FMO S;  4LUM A;  4JRL A;  4JC1 A;  2B7Y A;  1WW5 A;  2ZGP A;  2BOI A;  1OF4 A;  3AJY A;  4Q0Q A;  4MGZ E;  4P9G A;  2ZGO A;  2D6O X;  2WQZ C;  3AMP A;  4CCM A;  1SEF A;  2VR4 A;  1NQJ A;  1NX9 A;  3K75 B;  3QOP A;  5EP9 A;  4MVT A;  1EPZ A;  1WWY A;  4NII A;  5CKM A;  4ET7 A;  5A3M A;  4KWK A;  1JZ8 A;  5IK5 A;  1QH7 A;  4E2G A;  4IV1 A;  5FK8 A;  5GLU A;  1UY0 A;  1I5Z A;  4R52 A;  4KGQ A;  2XL9 A;  5F3E A;  4B7K A;  1I1E A;  2FHR A;  1V9U 1;  4RL7 A;  1DGW X;  2F17 A;  5DDJ 3;  4DXS A;  2OUH A;  3VDC A;  1POV 3;  4M3C E;  2XXZ A;  1QJU 3;  3VZL A;  1US3 A;  3MV0 1;  2VOX A;  5E1R A;  2YU1 A;  5FLJ A;  3VBS B;  4KG0 A;  3JBG 1;  4XPV A;  4D69 A;  5KHI A;  3U37 A;  3B5L B;  3E6B A;  1OH3 A;  2R04 2;  2J1U A;  1OQ1 A;  3SEP A;  5A3T A;  3HN3 A;  2VZS A;  1R08 1;  1YYN A;  2XJT A;  4NRO A;  1RXG A;  2D40 A;  4XHB A;  1W9Y A;  5CG8 A;  1AX0 A;  4NR1 A;  3VDD A;  3TEW A;  2F4P A;  1ND3 A;  2CV6 A;  2WS9 3;  2WWS A;  5BNP C;  3KM5 A;  3MI8 A;  4FPO B;  3ATG A;  3VHP A;  1ND2 A;  4DRV A;  3WF3 A;  1RUF 3;  2EAL A;  3JZV A;  4A7K A;  2GC1 A;  4BYY A;  5AFE A;  1ZYB A;  2OYZ A;  1CD3 G;  5FZ9 A;  2QJV A;  2J42 A;  4YM2 A;  4QX8 A;  4YW2 A;  2Y34 A;  2J1R A;  2Q5T A;  4LJH A;  3BOD A;  3BOW A;  4JGY B;  4OHV A;  3ZXA C;  1CZT A;  5GZE A;  1BMV 2;  2ZGM A;  4YRD A;  2CNA A;  2PYT A;  1H8T C;  3A0N A;  3UET A;  3K4Z A;  3LA3 A;  3M1H A;  4IV3 B;  5C8C C;  2B9U A;  3N7L A;  1W03 A;  4QB6 A;  5BNO A;  2UWC A;  2D3R A;  4LT5 A;  4YM3 A;  4COV A;  1RUC 3;  2RS5 3;  4F83 A;  1Q8S A;  1SBE A;  2XPJ A;  1ZBA 1;  4YW6 A;  5FPU A;  1SLI A;  3V0B A;  1JHJ A;  4NHK A;  4BPZ A;  4WV8 A;  1YHF A;  2E32 A;  5T50 A;  4HVR A;  2SLI A;  4S2G A;  4Y1U A;  2JWP A;  2VC9 A;  2ZEW A;  3AP4 A;  3NKG A;  1VLN A;  3RZG A;  3PHM A;  2V5D A;  2BWC A;  2XBO 2;  5G05 L;  3UJQ A;  1AYM 1;  5FYY A;  2OX0 A;  3M3Q A;  1Y9M A;  3NO8 A;  1N3Q A;  4XJA A;  5LW9 A;  1BEV 1;  5CFD B;  2DU1 A;  1MS5 A;  3IPV A;  1PMJ X;  1RUG 2;  3DV8 A;  2CU5 A;  1UX6 A;  4ONU A;  4UFJ A;  4I0B A;  5FK7 A;  4XBL A;  1H1A A;  1FNZ A;  3PVO A;  5T3N A;  3D82 A;  2DVF A;  4RSU A;  3VN4 A;  3MV1 1;  1SCS A;  3ZN6 B;  1PO1 2;  5T5P A;  5IT6 A;  1NE6 A;  1QJX 2;  5GM0 A;  5LY2 A;  2EVX A;  2I74 A;  2YGL A;  4IEO A;  1LOG A;  2D6L X;  4HBN A;  3RPQ A;  5FV3 A;  3VBF A;  3ZXE A;  4AQ6 A;  4EWE A;  2VMC A;  2WUH A;  3LGR A;  3MIB A;  1RUH 2;  4Y22 A;  4B3N A;  3ME2 A;  2C6S A;  1D4M 1;  4N43 C;  5JUV A;  5L7O C;  1GWM A;  2Q8C A;  2WNE A;  3VHN A;  4AAX A;  5CG9 A;  2E51 A;  4GAZ A;  3T30 A;  4TXW A;  3PU8 A;  1IKQ A;  3NNG A;  1GP4 A;  5L9R A;  5LBC A;  2G9G A;  3OEB A;  4GMP 1;  2H6B A;  2N7G A;  2X53 S;  4HOO A;  1TEI A;  2ZGU A;  5KXC A;  1R09 1;  2ID4 A;  1SG3 A;  2K2S A;  1BBT 1;  4ATF A;  4AXO A;  1TME 2;  4JTO A;  4XE9 A;  2X10 A;  1JW6 A;  1DGR A;  2UYB A;  5H9R A;  2PAK A;  4FAG A;  1PK6 A;  4D0Q A;  1W6O A;  4QXK A;  4XQD A;  1YIF A;  3H3L A;  1BK0 A;  4QD2 A;  5EHD A;  1OOP B;  2YC4 A;  2MHF A;  2D6M A;  4RFT 0;  4XBN A;  5JXH A;  1TMF 3;  3J8F 3;  5C5T A;  4OFG A;  3UKT A;  1XYP A;  4CCD A;  1H30 A;  4Q4V 1;  1NE4 A;  4BK5 A;  4HET A;  3TEY A;  2WFF 2;  3KHB A;  3NAP B;  5KXE A;  4TSV A;  1POQ A;  3ZFE A;  1COV 2;  1SCR A;  3DCQ A;  3UYJ A;  4GB3 1;  4AED C;  3Q8E A;  4DXR A;  4DZG A;  1WCU A;  1AXY A;  5HBA A;  2YB7 A;  1D0G A;  4ATE A;  2BP6 A;  1KQR A;  1SLA A;  4BHP A;  4HVO A;  5F32 A;  3HEI A;  1QU0 A;  2B9V A;  5C9A A;  2RS3 1;  1HJG A;  1CQ9 A;  5FCC A;  3W5M A;  4PIZ A;  1JZ7 A;  3K4A A;  1KEX A;  1IS4 A;  2DYC A;  2LW8 A;  3I2O A;  1JZ3 A;  1Q3E A;  1W05 A;  4ZU5 A;  4AEJ A;  1RUE 2;  5FZB A;  2FCU A;  2HWC 2;  2WII B;  3AKP A;  4QXH A;  2VBD A;  4J1W A;  4Y24 A;  4Q4Y 3;  3DPR C;  4ITC A;  2VE1 A;  1IPK A;  2R07 2;  3MF6 A;  3OCP A;  5SV8 A;  1OKQ A;  1VBB 2;  1MS4 A;  5JIA A;  4DB5 A;  5LWB A;  3H7J A;  4FPG A;  1NZI A;  1VBC 3;  1W06 A;  2Q0A A;  1DLC A;  2RJL A;  3CNA A;  3FMG A;  3N9P A;  2WSV A;  3MFC A;  1MZF A;  1IQD C;  2IC1 A;  3LF7 A;  4GWN A;  3UV9 A;  1FPN 3;  4CTE A;  2VW2 A;  2GZW A;  3GCX A;  3PVN A;  5C4W B;  1CWP A;  4IND A;  5FP3 A;  1POV 0;  4FFH A;  1OVP A;  1O91 A;  3OJB A;  1YQ2 A;  2J1S A;  2WT1 A;  1UAI A;  5FWE A;  5JWP A;  1EAH 3;  5C71 A;  2W08 A;  2HYK A;  3A22 A;  3ZIX A;  3ES1 A;  3WY6 A;  2XQX A;  2XJP A;  1S0B A;  4QGM A;  2DVD A;  5D21 A;  2WYF A;  4RHV 2;  2X05 A;  1DQ5 A;  1OUS A;  2VBB A;  2WNV C;  1YI9 A;  1ZBE 3;  4IE5 A;  5GZD A;  4BB3 A;  4CP0 A;  4D94 A;  1FOD 3;  1UXZ A;  2UWA A;  4TLF A;  1OLQ A;  2QFE A;  1DCS A;  2CL2 A;  2VCB A;  4H3W A;  3T4H B;  4DO0 A;  5FYB A;  5KWR A;  1T2X A;  3KT4 A;  3D3A A;  4KWJ A;  4NHL A;  4XBQ A;  4BMB A;  1AR8 2;  3FFQ A;  3WQ7 A;  2MEV 3;  4DOU A;  1ENQ A;  4COZ A;  2PLV 1;  2OA2 A;  5ACA 3;  1G86 A;  2V5Y A;  3AZW A;  1WME A;  3NL1 A;  4CZS A;  1Y4W A;  2YPJ A;  3VBO B;  3KB5 A;  2OQ7 A;  2AR6 A;  3GF6 A;  1XC6 A;  2E7A A;  5FIX A;  2XWB B;  4CVU A;  4MZU A;  3MDP A;  1GZW A;  4J1X A;  3BTX A;  4UFL A;  1PNG A;  1UIJ A;  3EJK A;  1W6N A;  4R9B A;  5BPX A;  3LIH A;  2EIB A;  2WZR 1;  4NUB A;  4XUO A;  2JG8 A;  1RUI 1;  4K8R B;  4FFI A;  2W2I A;  4KWL A;  3FHA A;  4IV1 C;  1EY2 A;  4C1W A;  3LFI A;  1UU4 A;  1G9C A;  1QJY 2;  2SBA A;  1QMJ A;  3ZXF A;  2GH8 A;  3Q9O A;  4R8H A;  2RS1 3;  3VD9 A;  1J1T A;  2VO5 A;  3LEI A;  5A6Q A;  4JRA A;  1H2N A;  2RDS A;  4B1M A;  5F5A A;  5KXB A;  4CUA A;  4MGI E;  3FZ3 A;  4Y1Y A;  4BH9 A;  2PXJ A;  5CB7 A;  4FAH A;  5CAZ A;  1IG0 A;  1PO2 1;  2ZHK A;  1U5I A;  3PIJ A;  4FTE A;  3NNF A;  4BQ5 A;  2P37 A;  4C1X A;  5AC9 1;  2W9X A;  4ISQ A;  4CE8 A;  2RR1 1;  3T1M A;  4LBM A;  5LA9 A;  1S0E A;  3RWN A;  1JHN A;  5F9T A;  2VXR A;  4R9A A;  3POY A;  4HVQ A;  5ABJ A;  4AHW A;  3POS A;  4CPB A;  1AL2 3;  1W39 A;  5A32 A;  1AR6 3;  2G9Z A;  4QX3 A;  4RYD A;  3VDD C;  1ZZC A;  2BNN A;  1ND3 C;  2BEO A;  4XFC A;  3OPT A;  1ND2 C;  3ETQ A;  4XHX A;  4JQT A;  4NIG A;  2JE9 A;  1LHO A;  3ZSE A;  4TN7 A;  2PHU A;  2D3P A;  3ILR A;  3WIN E;  4GZ9 A;  2CAV A;  4CEW B;  4FPH A;  1WCQ A;  1JN2 P;  3B9I A;  1PVX A;  5H9Q A;  3D0J A;  4HPK B;  4K1Y A;  1UZ0 A;  1S0F A;  4BXF A;  1ZRC A;  3RNS A;  4M3C A;  3J26 N;  3VBR A;  5LEK A;  3N7K A;  4QM8 A;  1W6Q B;  1WD3 A;  3THP A;  2VQ0 A;  5DUW A;  2JIJ A;  1HX6 A;  4NIH A;  1V9U 3;  4JDO A;  3WF2 A;  3CMG A;  1O5L A;  1UXX X;  4L97 A;  4QKD A;  4UOJ A;  3ORJ A;  1J83 A;  5DAV A;  5EWS A;  2EXI A;  2W95 A;  1PX4 A;  3SIS A;  3I54 A;  1HB4 A;  1DP0 A;  1LHU A;  5FZO B;  4A41 A;  1ZA4 A;  1ZRI A;  5A6X A;  4QPI B;  3AJZ A;  1J3R A;  4PI0 A;  2VBP A;  1NKG A;  2P3J A;  4Z82 A;  4YLZ A;  3AKR A;  1M4W A;  4BJ0 A;  3N4M A;  1B35 A;  1X36 A;  2J1T A;  2XUM A;  1GP5 A;  5FY7 A;  4AGR A;  4BQX A;  4DUX A;  1X9T A;  4GWM A;  1R08 3;  4K1Z A;  4LIU A;  4W6Y A;  2WN2 A;  3L2H A;  4AE2 A;  5AFB A;  4FTB A;  1IZ3 A;  3W20 A;  4LHN A;  4PDW A;  5IFT A;  5IVC A;  2FMY A;  3NJV A;  1GV9 A;  4RR3 A;  3ZSJ A;  2AEN A;  5FPZ A;  2PHX A;  4U2A A;  1H6Y A;  1PHM A;  1WA6 X;  1CES A;  2C0Z A;  1K45 A;  2R1D A;  3SMH A;  3GAL A;  3VBO C;  4N53 B;  2WKK A;  4JGZ B;  4M3C F;  1DQ0 A;  4AFC A;  2VMI A;  2Y6L A;  1W8H A;  1KFX L;  3J9S A;  5GZG A;  1MEC 3;  2JXA A;  3O1P A;  2H6C A;  2BNM A;  1IKP A;  1HRI 1;  1CAW B;  1N1V A;  2IXJ A;  1VBE 2;  4I02 A;  1SQ4 A;  4DMI A;  1OVS A;  3CO2 A;  2ZKL A;  4ZKT B;  1LRH A;  4LEJ A;  1F5J A;  4H7L A;  5A7W A;  4CCO A;  4CDX B;  1ZZ7 A;  5FZH A;  2MNG A;  1CAX B;  1H1M A;  4IEV A;  2DCT A;  4GA9 A;  1BJQ A;  5FJK A;  1YQ5 A;  1PK6 C;  2B42 B;  3K2O A;  1NCR C;  1WLW A;  3CZU A;  2E33 A;  2QQL A;  1RVF 2;  4XF9 A;  3L2Y A;  5J09 A;  2J1E A;  3RYR A;  4LOS A;  1KGY A;  1PZ9 A;  1YC6 1;  3NST A;  5T5J A;  1AYM 3;  1NA1 B;  5JAX A;  4LHK A;  3WDW A;  3FLR A;  3UES A;  3HAG A;  4GIQ A;  1UMZ A;  2RDN A;  3GHM A;  2RM2 2;  1EYB A;  1KXG A;  4QAW A;  5BNQ A;  4A6S A;  3ZFE C;  3WNP A;  3ZMO A;  3T2P A;  4DIQ A;  4M4R A;  2DUR A;  2JKB A;  1NXD 1;  2BBA A;  2JEN A;  4N7I A;  1D7P M;  5EPA A;  4JKL A;  4NJ4 A;  4PBO A;  2GMM A;  2W1Q A;  3WW2 A;  2UY8 A;  4NHY A;  5C9A C;  4XDQ A;  5CZK A;  3IZO A;  1ONA A;  5C33 A;  3LKJ A;  2AEZ A;  1VAK A;  4W6X A;  3VBH B;  1IS6 A;  3NV1 A;  1D4M 3;  4QKF A;  1I6X A;  2R7E B;  4RA0 A;  3ZXK A;  3P6B A;  2XDV A;  2ZGS A;  4I01 A;  2WLP A;  1C8M 2;  4ASK A;  1UD1 A;  3ZXG A;  3IDB B;  4IE4 A;  2WO7 A;  1S0J A;  5FZI A;  3S7I A;  1AR7 2;  3U07 A;  3WF1 A;  4AK3 A;  4CXX A;  5JOW A;  3G7D A;  2YBP A;  3VBU B;  4OI0 A;  1ZX5 A;  4AZZ A;  4MOA A;  2W1W A;  1UZW A;  3LZZ A;  4GMP 3;  1YFU A;  4LOR A;  1BYH A;  1GSL A;  1UY3 A;  1GOG A;  4CP9 B;  3K4D A;  4AGV A;  5FPX A;  2WYS A;  5FYV A;  3O1V A;  3GZA A;  2Q8O A;  2YXS A;  3C3V A;  3CU7 A;  3JCI A;  4Y20 B;  4XFI A;  3B94 A;  4HLT A;  1SLT A;  3PUI A;  1KS5 A;  1UW8 A;  3J7H A;  4L0P A;  3RMY A;  2R04 1;  1GLH A;  4YNI A;  1LHW A;  3M4F A;  1VAL A;  2GN3 A;  4Q4V 3;  3ZKY A;  5C3Q A;  3EO6 A;  3WT3 A;  3L9J T;  5F5C A;  1ZRF A;  4MGY E;  5E8A A;  1WLT A;  4YG6 A;  4IEU A;  3NMB A;  4CRQ A;  1BCX A;  1RUJ 2;  1U5Y A;  4LMF A;  1QDO A;  1W8N A;  4OUM A;  1PVC 3;  4XF4 A;  1WMF A;  2NLR A;  4GB3 3;  4XDO A;  3ABZ A;  2X29 A;  3I2J A;  3WW4 A;  1OLR A;  2AYH A;  2VW0 A;  2QQK A;  4Y4Y A;  1APN A;  1DZR A;  4Y1Z A;  3ZO0 B;  4NRP A;  1G9B A;  2RS3 3;  3KSC A;  4FBF A;  3O1T A;  1J59 A;  3H0O A;  3KLS A;  3X29 B;  4Z07 A;  5GZF A;  5KBF A;  5F3I A;  3ZYB A;  1BMV 1;  2JDH A;  4QDS A;  4HL0 A;  3QH7 A;  5FZ3 A;  5I0S A;  4JVA A;  3C7G A;  3TRS B;  5FP8 A;  1QOT A;  5GJ6 A;  5BY5 A;  1NCQ C;  2ET1 A;  1DYO A;  3POB A;  3HNY M;  5IAV A;  4RS5 A;  2QQU A;  1CX1 A;  2P3I A;  1QOS A;  1RUD 2;  1VRH 2;  2JG9 C;  4OZX A;  3AP6 A;  3PUH A;  2ILM A;  5JIU A;  2OS2 A;  2UYA A;  2JX9 A;  5JCT A;  1LGC A;  3O0W A;  1BVP 1;  2RJ2 A;  2FDG A;  2JG8 C;  4ZXK A;  3MLJ A;  1R1Z A;  1I3H A;  2OXB A;  4A7Z A;  2VQA A;  1ULC A;  4UBG A;  2XBO 1;  1JZ4 A;  4NE9 A;  4TLG A;  1MQT B;  3WHU A;  5A1F A;  3HOB A;  2ADD A;  2HWD 2;  1GMM A;  4XFB A;  4S2D A;  2Y0I A;  4UYB A;  1JUI A;  4YZ1 A;  4JKK A;  4X6R B;  5E16 A;  5JXI A;  3JUU A;  4A7Y A;  4CDU A;  5I8T A;  4ZPI A;  1PO1 1;  1VBA 2;  2QBX A;  1QJX 1;  2QQO A;  1QQP 1;  5FMD A;  1YO8 A;  1KFU L;  1VJ2 A;  5KC6 A;  2ZMN A;  2YFZ A;  1NLR A;  2ARB A;  5F6K A;  1RUH 1;  2EAA A;  4QQP A;  2A7A A;  4D8M A;  2WLQ A;  5ABJ C;  1O6U A;  1XYO A;  2V4A A;  1IS5 A;  3K48 A;  3WQ0 A;  1XOY A;  4Y1X A;  2FDI A;  4YVS A;  2JIG A;  4CDW C;  5TSW A;  3W59 A;  4OZO A;  3U10 A;  3ZXL A;  4HAN A;  5FFO C;  2YPD A;  4FPF A;  3K77 A;  2PLV 3;  3SCF A;  3IAQ A;  4FPY A;  1H2K A;  5BXX A;  1UX7 A;  3BYW A;  1PM7 A;  2NPI A;  3ZMN A;  1EUT A;  1Z78 A;  1XU2 A;  1W3V A;  2JE8 A;  4LBK A;  4OHX A;  5K9Y A;  4XQ4 A;  3MF9 A;  4BE3 A;  4E2S A;  1E57 A;  5F2W A;  5I8S A;  3USU A;  4EWA A;  1Z7S 2;  3MUY 1;  3NNL A;  3SKJ E;  1QH6 A;  2WZR 3;  5D8A A;  2I07 B;  2Q8E A;  4ERO A;  3AVR A;  1TNR A;  4MET A;  3LA2 A;  1F4A A;  2ZGL A;  3GBF A;  4LLF A;  3VBR C;  1C3H A;  1G6N A;  3H7Y A;  1QOO A;  5HV0 A;  3WW3 A;  5LA1 A;  4IEQ A;  4AED A;  3DGT A;  2WNU C;  2WFF 1;  1OA2 A;  2DCZ A;  4H14 A;  1TZO A;  2OT7 A;  3E97 A;  4OI4 A;  2PQS A;  3OD0 A;  2CHH A;  2IZW A;  2QQJ A;  2WJS A;  1PO2 3;  1DDL A; 
#chains in the Genus database with same CATH homology
 1XBF A;  2P6H A;  2CU5 A;  1VMJ A;  1VPH A;  1VE0 A;  2P6C A;  1VMH A;  1VMF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...