2YUEA

Solution structure of the neuz (nhr) domain in neuralized from drosophila melanogaster
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
168
structure length
168
Chain Sequence
GSSGSSGPLQFHSVHGDNIRISRDGTLARRFESFCRAITFSARPVRINERICVKFAEISNNWNGGIRFGFTSNDPVTLEGTLPKYACPDLTNRPGFWAKALHEQYCEKDNILYYYVNGAGDVIYGINNEEKGVILTGIDTRSLLWTVIDIYGNCTGIEFLDSRIYMYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords Protein neuralized
publication title Structural and functional characterization of the NHR1 domain of the Drosophila neuralized E3 ligase in the notch signaling pathway.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 17
structure length 168
sequence length 168
ec nomenclature
pdb deposition date 2007-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07177 Neuralized Neuralized
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.920 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2yueA01
2LM3A 2VOKA 4N7UA 5F6LB 4X8PA 3ZO0B 5JI7A 4WVMB 5JI9A 4QT6A 3KB5A 4B3NA 4WVMA 2FBEA 4KG0A 4P9IA 4P9JA 2E63A 4P9LA 4N7IA 4XW3A 5C33A 2YYOA 2YUEA 5JIAA 5JIUA 5F6KA 2IWGB 4X8NA 3UV9A 4B8EA 3TOJA 2WL1A 4V1PA
chains in the Genus database with same CATH superfamily
1FOD1 2FDGA 2WA4A 4L2NA 4AVSA 1Y43B 2FCTA 5A33A 3RZGA 3N9LA 1JXNA 2ZAAA 1GSLA 2ET1A 2QZ2A 2I2SA 1PGW2 2VVFA 3N36A 5FZOB 4AR2A 4YG3A 3RZLA 1BQPA 1S0CA 4LT5A 4OHWA 2VOVA 1FPN2 1JH5A 2RDQA 3GF6A 2BP6A 2YUEA 3NJYA 4HANA 1AF9A 4L99A 4ES9A 4P9XA 3PDQA 3O1TA 1MS1A 5JDBA 2K46A 4JRAA 1DYKA 3MUY1 1OOPB 5H9PA 1O6UA 5EV7A 3WDXA 1I1EA 2ES3A 1PVC2 1EAH3 2WUHA 4Q4X3 1NLSA 3PVNA 1RVF3 4LR4A 1AXKA 2GC0A 2VMIA 2VZOA 2DCZA 1O59A 1UY0A 4HPKB 4Q5OA 3T2OA 2D6NA 1CPMA 2IVIB 2Y6KA 5BUVA 2QQJA 3H8RA 3WNKA 4XF9A 4XAAA 4YM0A 4QDRA 5A3OA 1ND3A 4DS0A 1NA1A 3ZIWA 4AEJA 4CDWB 3OPZA 5JPMB 5CFDC 3HQXA 4COWA 3PIJA 1PX3A 1A78A 1DIWA 2RV9A 1YXWA 4LE4A 1W2TA 4E8CA 1N1VA 3PUQA 4FPLA 3WW2A 5C8CA 3ZFFB 3GZUC 4DOUA 3BOWA 5CFCA 4RR3B 2CTVA 1E5HA 2C4XA 5LRRA 3R4DB 2YGMA 4CUCA 4LO6B 4ZU7A 2DTYA 4F3JA 5I0SA 4WM7B 4JGZB 1UKRA 4QQHA 1A6CA 1OF3A 2CSGA 4GKYA 1UX7A 4KWJA 2VGDA 3VBFA 2J1TA 4JX0A 4XJZA 1GNHA 1OKQA 1W6QB 3W20A 4BK5A 4EROA 4BXSV 1L3JA 3U4XA 1UYPA 2CY6A 2GSYA 2VBDA 5LBEA 1QXJA 4OMDA 5FZMA 2W1QA 4GB32 3LEIA 1CAUA 3V56A 3AL5A 5CISA 5BV6A 1O4ZA 1ZBE3 4KMQA 2R061 2XKOA 1PVXA 2HEVF 1MR5A 3I2JA 1KFXL 1MVQA 1RUI1 1MVEA 3O14A 3PUSA 4UFHA 4X6QB 4A7KA 4XJWA 5I8SA 5L7OA 4IV3C 1ALYA 4LBQD 2Q4SA 1HJFA 3B02A 4A3XA 2PHDA 5M0TA 2WT2A 1DZRA 5EJ3A 5EXOA 2HWE1 4LJHA 4LA3A 4M01A 3J7LA 4BMEA 2JICA 5I0TA 2ZGOA 2VUAA 3ME2A 3WCSA 5C9AB 3THPA 2Z79A 4CEYB 2XQRA 1N3OA 1I5ZA 2Y6GA 3JB4C 4NPLA 4CE8A 2JG8C 1O8PA 4PQQA 1XE0A 3PURA 2ZKLA 5FK7A 4AI0A 2JD4A 4NHKA 5JSOA 2BERA 2VNVA 1W03A 2MEV1 4K1ZA 3A0NA 1RUC2 2HLEA 2BRTA 2R0HA 3MBWA 2J42A 2Q30A 5B2GB 2WO3A 4Z82A 2R041 1LGBA 2IXJA 5T5LA 3OUJA 4KGQA 3NW4A 2P2KA 3K77A 3Q8FA 3WD5A 1NXD1 3HNMA 2O8QA 2AGSA 4JTNA 5D8AC 3FHAA 5ISLA 1N1SA 1F8VA 3NSTA 4NHXA 5FK8A 4YW4A 2YDEA 1YQCA 1XJAA 3RPQA 5A1FA 5K0UC 4XDOA 5FP3A 3IPVA 5J96B 4MLOA 4OCTA 3LCPA 3VBSB 3ON7A 1BLZA 3J8F1 5IATA 4IEQA 4BIFA 2RS11 2RR12 1AR81 3WCRA 4PF5A 2CNAA 3ZFGA 5AC92 3V0AB 4I2OA 5CAZA 3BPSA 2VUJA 1WW7A 3CIHA 3ZFEA 4JHZA 3GBGA 3TYJA 1L7QA 3ZXGA 1KDMA 5F2SA 3WEZA 1NZIA 2VTXJ 4LLOA 2OVUA 3KCCA 4XURA 3CJIA 1ZRFA 2VCAA 4FPYA 2MHFA 1JU3A 1Q8PA 2VMFA 3ZYIB 1OMIA 3AKPA 2VZPA 1SACA 3AM2A 5DUXA 2CL2A 1YFUA 3W5MA 1OH3A 2XJTA 3BVCA 1GANA 2HWF1 2HWB1 4D6RA 3B3QE 4IV1C 4NOTA 1Q5OA 2VUDA 1FPN3 1TEIA 3AZZA 2WFPA 2XBO3 3JXSA 4OUEA 5CKMA 3N9QA 1CR7A 5ABJC 4CEWC 2B42B 3LB9A 4XXAA 1JYIA 2Z69A 4RFT0 2NP0A 4FTEA 3ENRA 4QKNA 1BMV2 1W9SA 2WQ8A 2XLAA 4NRQA 2WYFA 2XJQA 4ARXA 4E9KA 5JZGC 4XF3A 1PO21 2DBNA 4AGRA 1KJLA 3ILNA 5CIRA 3S30A 3FHIB 1RUD2 4OI0A 1OQ1A 4BCUA 4NHYA 5FZOA 1Q3EA 3QD6A 2Q8EA 1QJFA 3LAGA 3BN6A 3OGVA 3K51A 4XFGA 1PZ7A 3M70A 5BNPC 2J1VA 5APAA 4RL7A 4XFCA 4CU6A 2ZKNA 3QACA 5FZCA 4B4QA 1KITA 2ZMLA 4YFZA 3U78A 1H8VA 1IS4A 2XWBB 4OI4A 3O1VA 1R081 3USUB 2VU9A 4UFMA 4XFHA 1F5JA 3K48A 3MUZ1 2C26A 4AAXA 3VBOC 2J1RA 3POYA 1NUKA 4OHVA 4BPZA 3LGRA 4AQ6A 3HEIA 1HXS3 2FDKA 3RJ2X 1DQ4A 2W46A 5DAXA 4IDZA 3AXEA 1LNSA 4OI2A 4FQ4A 2E9QA 3VDAA 3J7NA 1ZNPA 3IDBB 3ITQA 2Z4FA 3CNAA 4CDWA 5HPOA 5JIAA 4GB33 4FFFA 4KBZA 4UFJA 3KWVA 1W9WA 3D0JA 5BPXA 2WWUA 2WRAA 3T1LA 4BISA 3ZFFA 3DECA 5FCCA 3PTRB 4RGAA 5FYCA 1LTEA 2W08A 1G8WA 1DQ5A 4LHNA 1HV1A 2QQIA 4QPIA 4LUMA 2IXKA 1CZSA 3DYPA 4G4FA 4JGZA 4LBJA 4LEJA 1AR91 4WM7A 2LS6A 4CSWA 4ARYA 1MS5A 4ISRA 2ZX3A 4HKLA 5F3CA 1ULGA 3L9JT 1FMD2 3IIIA 3AP6A 3GBWA 3RNSA 1WZXA 3CJXA 5I0RA 2LW8A 4HFSA 3SNMA 2VR4A 2BGPA 3NJVA 3AP7A 4DB5A 5KHJA 1ZREA 1CQ9A 1Q8QA 2YV8A 3I2FA 3AZXA 3U11A 5AFEA 1DQ6A 3ES1A 5F2WA 5FY4A 1R091 4Z8BA 4AI8A 4CPBD 4Q1PA 3H7YA 1RUC3 4QDQA 4QPGA 2WS91 3MIFA 2AZ5A 3WNPA 1AR72 1WMXA 1VBD1 4QGNA 5KHHA 4DXRA 5LB6A 3HT2A 1D4M1 4AFMA 1S0IA 4Y33A 2EXKA 4P9GA 1X36A 1VAMA 4CXYA 1AR61 5FO8B 4A41A 5K4LA 3X29B 5C9AA 3M7AA 5JXJA 1URXA 2XLFA 1UOFA 1V00A 1SFYA 4KWKA 4LO4B 3POIA 1RUE1 2R1BA 3IDCB 3U1XA 2DBIA 4AEDC 5FUNA 1QNYA 3WDYA 2JE8A 2RR13 1AYM2 4FPGA 2WO1A 4XQWA 2UY9A 3UV9A 1JW6A 5AC93 1X7NA 2PAMA 1AZDA 2AEZA 5BNOC 4QXKA 3VD4A 1SLTA 3S6PA 1QQP2 4XILA 1JU4A 2VQTA 2WZEA 3JD71 4L9BA 4COYA 4LO7A 2W2IA 1VP6A 3OGRA 4TYSA 2B46X 3CDZB 4NROA 3Q8EA 5CKQA 3ETQA 3ZXEA 3D3AA 3WY6A 5ACA2 1V9U3 5LWBA 3OSDA 2RJLA 2WWJA 1W3VA 4YG0A 1OA4A 1QIQA 3JBG2 3UNPA 1HDKA 4BWOA 3T2QA 4BQYA 1HQNA 4YVSB 1SQ4A 4AL9A 5DDJ2 5C3SA 1IGOA 1QXRA 3LSDA 1QDOA 2XJPA 5FP9A 5LK7B 4H7MA 2OQ7A 4FPKA 2CDOA 3R4SA 5FLHA 4O7XA 5CZKA 2X05A 5L9VA 3C7EA 5FJHA 1FYUA 3ELNA 2VCCA 1H6XA 5BY5A 5C4WB 5JPNB 2RE9A 3TEZA 3Q8AA 2RDSA 4Y5Z0 4B7KA 3GHNA 4KGGA 2Q8CA 1LAJA 4Q4V3 4HK8A 5F1RA 4PLMA 3IBMA 4GXLA 4QT6A 2R042 1W3XA 3N7JA 2XVGA 4YGDA 2O0OA 2WNUC 3EJKA 2BVVA 3WHTA 1W8FA 3ZR6A 4D94A 1RUD3 3SKJE 4OZOA 1CWPA 2JDAA 2WZR1 4QQLA 5GZEA 3RQ0A 1H1MA 2H0BA 3E5UA 4QX1A 2ZGRA 4OZXA 4FP2A 3LD8A 4CP0A 1CN1A 1W2UA 4NJ4A 4BXFA 1W05A 4JTOA 5FPLA 4D7TA 3AKQA 3LEKA 4GJYA 3M8LA 4QHZA 1LHVA 3TOJA 4V1PA 1V6OA 1FV2A 2RS12 4XCAA 4KQ7A 4JRLA 1AR82 2WBKA 4N7UA 5EJ1B 2UWAA 2Y64A 2MPFA 1VBC2 3GYDA 4HT1T 1ZX5A 1VRBA 2BFUS 4LHSA 1CJPA 4QAWA 1ULDA 5I91A 4R9DA 4JGYB 4GKXA 1COV2 5GJ6A 2CYFA 2QUOA 1ODNA 1GOGA 1S55A 1VIWB 3RYKA 1V6NA 3MPPG 4UW4A 3IWZA 4QX5A 4XMAA 2WAOA 4BMBA 2Y60A 1RJ8A 5CFDB 2GNTA 1OFSA 2HWF2 3MV11 4A4AA 3KV5A 4LIVA 1RUH2 4CXXA 1U0AA 3HOBA 4LBQA 3JZVA 5KHIA 5GM0A 3O1UA 2W94A 5AVPA 1WW5A 1J59A 2DWRA 5GLUA 3HWJA 1W8UA 4IL7A 4WZCA 1GKBA 2D93A 1YQ5A 3MF9A 2D43A 2AYHA 1UWWA 4PDWC 5KC6A 1W2NA 3MZHA 2HH9A 2KD7A 1QKQA 4BB3A 4DY3A 3HR9A 4AI2A 1FMD3 1V6MA 5LASA 5FQ0A 2C24A 2NPIA 1PO22 4QX2A 3ST7A 5IW0A 4DMIA 5I0DA 3H3LA 3I97A 4OQ9A 5JWPA 5FPAA 3BU7A 4CP1A 1U5YA 1ZZ8A 2A7AA 3TBDA 4AVTA 4IEWA 2CGNA 1UU5A 2BWCA 2QBXA 3FLPA 4L92A 3WUDA 4Y1YA 5EWSA 4YRDA 3OOXA 1AR73 1KQRA 3OD0A 3I2OA 3CBNA 3VHRA 1QHDA 1PNGA 4FOQA 1XQNA 4NUBA 1NAEA 1IQAA 5HCFA 2UY8A 3DUIA 1G9BA 1VE0A 2FHRA 4ZONA 4ASKA 3ABZA 2WZ8A 1G9AA 1FXZA 2SLIA 1DFQA 5J09A 2VZRA 2RM22 5A3LA 1PO11 2YC4A 1O7FA 2RMU1 3AMQA 2V73A 1IS5A 1ST8A 1NOVA 1S0JA 1X8EA 1HV0A 4AGGA 3AYCA 1VBE1 2ZHLA 3M3IA 4XIKA 2VZ3A 4DO0A 2QQWA 1DZQA 1AYM3 3FC0A 4YW6A 4E4DX 3KF5A 1UN1A 4K40A 4L8QA 1S0DA 2PN5A 5T55A 3URFA 1W9TA 4LK6A 3E6BA 5BNNC 4IETA 1YI7A 4XXPA 1EUTA 5KXCA 3SEPA 3WP3A 3RZMA 3T0DA 4OHZA 5E88A 1J1LA 1QQP3 3FHQA 4Z07A 2O1QA 5LATA 2JKXA 3PUAA 5LA9A 4B3NA 4CU8A 1CAWA 2XG3A 3ACFA 4H14A 3UKNA 2O8OA 2XMLA 1IS6A 2VCMA 4GMP3 4XHBA 5ACA3 1OKOA 2QDRA 5LBCA 1QJX1 3B00A 3BGAA 4UW6A 3JBG3 4CVUA 4UW3A 3KHBA 5F5CA 1ENXA 2BEOA 2NZ9A 2XHNA 3PIGA 4QB2A 1PNFA 5DDJ3 2WNVC 4W8JA 2NN8A 1CAXB 4BQXA 1DHKB 3ZYBA 1YFXA 4CP9B 1JODA 4QU2A 1LHUA 2RS32 2NM1A 3AMPA 2YXSA 3R05A 1W6OB 3QBQA 2W1UA 2A70A 5GKAC 4Y20A 1XYNA 4P02B 2BWAA 4UOJA 4MZUA 2JKBA 1F9KA 2Y38A 1H2NA 1NA1B 2R32A 2UWBA 3A21A 3DF0A 2YB7A 5HCAA 5LY2A 4META 4N9IA 2DTWA 3EO6A 2PQSA 2R043 3HAGA 1VBD2 1XNKA 1TMF2 5A32A 5C8CB 5JAXA 1VBB2 5JLVA 5CFCB 5FZFA 4FOWA 4WM8C 3ZN4A 3WR0A 3I54A 2R30A 3AMHA 1UY3A 4DRRA 1PX4A 4XUNA 1AR62 4KL1A 4CCKA 3AYDA 5IVYA 3IKWA 4KU8A 2P37A 1MS3A 1H1AA 4HZFA 4XFBA 3DYOA 2JB8A 3VBFB 1RUE2 3MGUA 5FZIA 2P6HA 1QJU2 2PLV1 1XPWA 4JDOA 3NV2A 1HB2A 1ZZBA 4CDXC 5LY1A 1MS0A 3R4UA 3W9AA 1I9RA 1TME1 3O12A 4D0QA 1W06A 2EIBA 1WD3A 1VBC3 4QGLA 5DABA 4ZKTB 3OY8A 3S5QA 2B7YA 1JZ8A 3K4AA 2X09A 2Q5TA 4IEOA 1D4VB 1H30A 1XNBA 4SBVA 4R8HA 5FZ1A 5G04L 5L9BA 2SBAA 1COV3 5BNOA 1IKQA 2DCJA 4HL0A 4RS5C 4AEKA 3D4KA 5L7OB 4D69A 1F35A 3E5QA 1SEFA 1U5XA 1I3HA 4W4ZA 4IE5A 3UL2A 2JDZA 3FBYA 5FYUA 5CU1A 3GBFA 1EPWA 1CAVB 2HWF3 4JCKA 3TEYA 1UOJA 4I0WB 1RUH3 4CCLA 1LOBA 1JZ4A 5FIXA 5LW9A 4SLIA 1QEXA 1PK6C 5JXGA 1PGL2 4N53C 2QNKA 1BK0A 4GWMA 4JAAA 3MFAA 5FZAA 3WX5A 4F8AA 2BVBA 3VB9A 2GH8A 2ILMA 3Q8CA 2PHTA 5FZ0A 5FZ6A 1LECA 4MGZE 1J84A 4XW3A 3PMEA 1MZ5A 1RXGA 4IUGA 3I59A 1RHI1 4LKDA 3VDBA 1JS9A 2ZEXA 1AJKA 2P34A 1KGYA 1QY4A 1PO23 5JOYA 3VBUC 1KXGA 4A7ZA 4K1YA 1SLCA 2XXZA 4AI3A 2X53S 1FNYA 1VMJA 3MF6A 4I0AA 3WW3A 3DEMA 5FAXA 5CFDA 1G9CA 1LODA 3SH3A 3JU9A 1YCIA 2LUWA 2XJRA 4CDQC 4NVPA 3IPVB 4MGSA 3HPNA 4UYBA 3Q8BA 3J9SA 3FFQA 4C90A 2LTNA 4MV2A 4Y1UA 5FO9B 4A6SA 3ZFGB 1C5HA 2HEWF 4FPEA 3ZFEB 4HETA 1DP0A 2RM23 2Z2SB 1IOAA 1D0GA 3AYEA 3BOPA 5L36A 1GZTA 1RL3A 2GDFA 3KQRA 1JZ7A 1DDLA 4QHOA 1XNCA 2ZTNA 5SV5A 5JXIA 3HQRA 1JZ2A 1ODMA 1VRH1 3QOPA 3RWNA 1RB8G 3F95A 5LA0A 3POGA 3NNJA 1HRI1 1W0NA 2CHHA 2P3JA 2X8KA 3M2MA 4QXHA 5DUUA 2VNRA 1X9TA 2W47A 2XKPA 2EAAA 4P9IA 4KWLA 2FCVA 3KCYA 1H2MA 1GNYA 1K5JA 2CAUA 1GBGA 4IV3A 3VBHC 5FZLA 1QDCA 3BCWA 2BNOA 4OYUA 4TXWA 3ZPOA 5FR3A 3HN3A 2WJSA 3R0RA 4IEZA 4JC1A 4QXCA 1O3TA 1NCRC 3E6DA 4IXLA 4RSUA 1JOPA 2DCYA 1XE8A 3HQUA 5C71A 3THCA 3ACIA 2QQUA 2LRPA 3WZ1A 1IS3A 3WSOA 5EYXA 3ZYFA 5JR2A 4Q4W2 2WSVA 1C1FA 1OSGA 1BVVA 1G7YA 1ZA4A 2RS33 5B4NA 5F3EA 1V0AA 4YZ5A 1VBA1 2JG8A 4DQAA 2ZHNA 4IE7A 3ZKYA 5JUVA 4WZFA 5FOBB 2EICA 3INAA 3G7DA 4XQ4A 4WVMA 1OF4A 3N9MA 1HJGA 5EZWA 4GA9A 2VPVA 3LEGA 4XBLA 1ZRCA 3ZSEA 3EB7A 4TLFA 4Y4YA 4UBGA 4DUXA 3GGLA 4DXZA 4XFIA 1TMF3 3ZMNA 4D8MA 2UYBA 1VBB3 4Q4Y1 2QE3A 3FJSA 4RHV2 5FP8A 5D8AA 5TSWA 2EIDA 3MW3A 3RSJA 3WDVA 1GLHA 4B8EA 4CDUC 1CVNA 2ETEA 3S0MA 3HMYA 1CAXA 2Y0OA 5DN2A 5K0UA 2RMU2 1IPSA 2YGLA 5FBJA 4CCOA 4CP9A 1HW5A 5EP9A 4LUKA 2YY1A 3DPRC 2OZ6A 2ZBJA 3H1WA 1QJU3 2XLGA 1MS9A 3GZTB 4LHKA 4YW5A 1W6OA 1VBE2 5EYYA 3ZXLA 3LQCA 3I3DA 1LHNA 1HN0A 2KR2A 4BQ2A 2OPKA 1W99A 3ILFA 4P00B 1DGWA 3KV4A 4UFIA 1E5IA 1VALA 3SLIA 1JZ5A 1UOGA 2ZZQA 2ZMKA 3OTFA 2R7EB 3K2OA 4MVTA 4NIAA 3WHUA 2WYSA 1WCKA 4YARA 5A1AA 4WVZA 3ORJA 4PCRA 1H8TC 1VMHA 2GNMA 2JDPA 3OUIA 4K7JA 4XF0A 5EHDA 1AHSA 1ULPA 1WW4A 3MI8A 1G9DA 1MEC2 3OYWB 1UU6A 4GJZA 2VOWA 2R073 2X10A 2HWD1 4QKDA 1QJX2 4QPIB 4NIGA 2GC1A 4I0BA 3T1MA 3WDUA 1RUNA 3IM0A 5CVRA 2YBKA 1ULEA 1Z7S1 2VTFA 2WC2A 2IFRA 4UAPA 3LOIA 4IV1A 3NL1A 2XPJA 2WFF3 2WLPA 1O4TA 1BEV2 1TQ5A 2DUPA 3NAPB 4CEWA 5ABJA 3NRUA 2DFBA 1SCSA 2ORXA 2VJXA 3E97A 4Q0SA 4ZPIA 3FWEA 3RRDA 2OZJA 3O0WA 1EV11 2DV9A 2JX9A 1BKZA 1X9PA 5FZ4A 3R6SA 5DAVA 3ZM8A 2BBVA 1CX4A 4AFCA 1S0GA 1E57A 3DKWA 4QPGB 5JZGA 2JDYA 1FNZA 3HIFA 2D5HA 4IEVA 4XHXA 2ZGKA 4UW5A 1V6IA 4YGCA 4FT8A 2IXIA 4BHPA 3O1RA 3BYWA 1Z78A 4ZU5A 3TRSB 4HVRA 4ZXEA 3RYPA 2NMNA 1H2LA 2Q0AA 4AQSA 1YO8A 4NAOA 4MGQA 1QJY1 1Q8OA 1CAVA 5DMYA 3I3QA 4FPCA 2YU1A 4QDSA 1AL22 3PHMA 2PMWB 5BNPA 3GDBA 2CU5A 4MYEA 1C4RA 4RA0A 5FYHA 3I4IA 4B4PA 3K4DA 2WT1A 4LMFA 1TME2 4W65A 1XU2A 4R9CA 4K8RB 3WF1A 3O0VA 1MPXA 1ZRIA 5C3RA 2AACA 2VQUA 2Z5WA 3VBOA 3V0BA 1MS8A 1POQA 2H6BA 2PFWA 4EJRA 2QVSB 1MQTC 5FWEA 1XYOA 5FZDA 5A3UA 2TUNA 4E2GA 4YZ3A 5JMOA 3N4MA 1NQDA 5FMOS 1RUJ1 3ZXJA 2DVDA 2AEYA 1VR3A 3ZO0B 2WWSA 1NG0A 1OD5A 4XZUG 3HBKA 2G4IA 3WOGA 4TLGA 3N9PA 2ARXA 4K21A 1GMMA 1XRUA 5IVBA 3VDCA 3FZ3A 1XNDA 4AOCA 3KLSA 2X5IC 2JDHA 3OBAA 5IVCA 3BKZA 2ZHMA 3VZNA 3WUCA 2QQMA 5FFOC 5FJKA 1DYOA 3RZHA 2IUWA 2OPWA 3S5AA 2D5FA 4YZ2A 3ZSMA 4ES8A 3LKJA 4MX3A 1GYKA 3CHXA 2YPJA 3PU8A 4HN0A 4BU2A 1PIV2 3TN91 4Y1XA 1WKYA 3FBMA 1RTVA 1HKDA 1TG7A 3VDDC 5FYYA 5IVFA 2BGCA 4Q4W3 1WMEA 4AVBA 3ES4A 5ANNA 3ZLIA 1IPJA 2NQYA 4HG6B 1JHNA 1F2NA 3J26N 3LA7A 4TN7A 3VL8A 5LCWL 3AP4A 3KGZA 2DVFA 2IZWA 1WBFA 3U0ZA 2J22A 2VZVA 2E33A 2TNFA 1WCUA 3LE0A 2WINB 1LR5A 4YSFA 3E5XA 3EYPA 5FYSA 1F15A 5FPZA 1M4WA 3SCHA 3H3ZA 2JG9C 1LEMA 4COZA 1NY72 4LPLA 2V5YA 1JN2P 2DU1A 5CYYA 3MLKA 2IXHA 1OVPA 1UQXA 3DXTA 1UIJA 2E53A 4NHMA 4MOAA 4O65A 4RHV3 5FLJA 2VNOA 2WL1A 2LROA 1QNWA 2YPDA 1CIYA 1UZYA 1PVC3 4CCMA 3S7EA 2WNVB 2RMU3 2BV4A 1J3QA 3PMSA 4AAPA 3DV8A 1HRV1 3KB5A 5FYMA 4ZZ8A 4AEDA 2RJKA 1GOFA 5FKBA 3T4VA 4NIDA 1VRH2 4LBLA 4CCDA 1LENA 3WP5A 1U5IA 3PU3A 4GH4C 4XJ8A 1C8M1 1HRI2 4FI9A 4I3GA 1R1A1 2OXBA 2QJVA 3MHZA 1J3RA 1FI2A 1K3IA 1ND2C 2D7FA 4LBQB 4OUMA 3WF4A 2BU9A 2GN3A 3GALA 4CUAA 1JI6A 1MEC3 3NO8A 3M3CA 4WM8B 3I49A 5L73A 2VZSA 1QJX3 3K3OA 3MIGA 1OUSA 2HWC1 1AVBA 4GWJA 4HKWA 2P1BA 4OULA 2E26A 3SITA 4CZSA 5JSRA 5ANQA 4AHXA 2A3XA 4COVA 4LHLA 1NYWA 3BB6A 1POV3 1LOGA 2R1DA 3LDKA 4LBMA 5FQ0B 3SH4A 4EN0A 5A6YA 1BEV3 1FOD2 1ZM1A 4FBFA 2E6VA 5A7QA 1NQJA 5T5JA 3TNQA 3U37A 3VHNA 1W8NA 4XBNA 1VBA2 4BQWA 2E7TA 3ZDVA 3LIHA 3QH6A 5J3UA 1G9FA 2QQOA 3DCQA 3J4UH 3K75B 3H0OA 4XJUA 3KF3A 4ZY9A 4MH0E 3VHPA 4EQVA 2JDKA 1OQDA 2WO2A 1AX1A 4XDPA 1RMU1 1R64A 1ZBA1 2GC2A 4EYUA 3AP5A 1CX1A 2ET7A 3P1IA 1I5PA 4Y22A 2WNUA 1WCDJ 4Q4Y2 1BXHA 3OYWA 3HT1A 5FXXA 3VKNA 4QXBA 1WW6A 5DPNA 5H9QA 4HVQA 3IMMA 2RS51 2ZX1A 3IB3A 5J7MA 5FXZA 1VAKA 5FMOL 4Y5SA 4URAA 1X50A 5AVAA 1F4HA 4GMP0 1AL23 3UGGA 4L11A 2QQNA 1N1YA 3NAPA 1PK6B 1T6BX 4P08A 2W9XA 3MLLA 4PIZA 2Q1MA 1BBT1 1TME3 3ETPA 2W5FA 4LK7A 1RUG1 4LO5B 2P3IA 4ISQA 2QZ3A 3CL1A 1W6NA 3QH7A 2VBBA 2AC1A 4EWDA 2FD8A 4QQ2A 2OUJA 1RC6A 2RVAA 5FMDA 1JZ6A 4B1LA 2QKDA 3RZJA 5CB7A 3AMNA 5KXEA 3VBUB 2Q8DA 1CAWB 5LRSA 4YYOA 1VMFA 3FE5A 1AUYA 2HWD2 2WA3A 4UXAA 4PIYA 5A7PA 5T5OA 5GZFA 3O7OA 1QJEA 1LEDA 3MW4A 3B5LB 1H2KA 5CG8A 1FAYA 4QWNA 2G9FA 4YM3A 4TZDA 5FZ3A 3JUUA 1FX5A 2E51A 3WNOA 2BTVC 4ZHNA 1MZEA 1DYPA 1UL9A 2ZEWA 3AK0A 3AZWA 1OPOA 2B45X 1LOFC 1JUIA 5SV8A 3WINE 3MW2A 5FLIA 4AFBA 3LFMA 3BIWE 4W50A 3FLTA 1A8DA 1IG0A 3FUOA 3IAQA 3M3QA 4YFWA 2XUEA 5FPVA 5DG1A 3LPFA 3VBUA 1NE4A 5HXMA 4Y20B 1FT9A 1WMDA 4PDWA 2VQ0A 4LO8A 4DZGA 1OLQA 3HD8B 2V4AA 1PIV3 5LBFA 5T3NA 1UW8A 2R062 4M4PA 5G05L 4PBPA 2C9KA 2GU9A 4Y3OA 1S2KA 5DAWA 3GCXA 1OUXA 1XNTA 1RUI2 2O14A 1GZWA 2ZGPA 4E2SA 5HI0A 1ZRDA 3QCWA 3DKQA 5A32B 2Y8KA 3ALQA 4A2UA 4V2VA 2OT7A 5FOJB 1EAH1 4Q4X1 2VH9A 1F5FA 1BZWA 4XBQA 1RVF1 3RMYA 5K8SA 2ZGLA 2VVEA 2HWE2 4JZRA 4OHXA 2WNEA 4ATEA 2YYOA 2KM2A 3AVSA 4FFHA 1OI6A 3LOBA 2ZGNA 1J1TA 4KH9A 3OF1A 2GP3A 4XCBA 4N9HA 3AZYA 3WV6A 2WIIB 4TWTA 2WLQA 1OLRA 3VD3A 5HV0A 3U4SA 3ZYGA 2ZOEB 4WBBA 2DF7A 1S2EA 3VZOA 2BUKA 2MEV2 3OY8B 3WVJA 5JI9A 2HBTA 2ZGMA 5FPXA 1OOPC 3D6EA 5GLTA 1Y7BA 5LZ6A 5BNOB 2Y0IA 2DDUA 1C1LA 3NJZA 1DGRN 1XXNA 5GLVA 4R52A 5KBFA 2JDNA 4XIOA 5BNNA 3H7JA 4YGBA 5DQ0A 1C57A 1HRI3 1AXZA 1OC1A 4BLJA 5C6CA 1LHWA 4S2DA 4XUPA 4QPYA 3J8F2 3KD4A 4LE3A 4LOSA 3OPTA 1Q8SA 3MO4A 4C91A 1ZBE1 4QKBA 2VNGA 1RINA 1YNAA 3KVAA 3ZFFC 1DQ0A 5GZDA 3WNNA 4A7YA 4RR3C 4JKKA 4FTBA 4FPHA 2ZZJA 3POBA 4CDUB 1XOYA 5KXBA 1V6LA 2PELA 2WNVA 3BALA 4B4RA 2PAEA 3I59B 4WM7C 4NO4A 4AYUA 3D0SA 2J1UA 3A23A 4Z1VA 1WLWA 1UCXA 1AYN1 1FOD3 1YFWA 2XVKA 3KM5A 4GIQA 4XZPA 5KR7A 3O1OA 3OJBA 4OQ8A 1VBA3 5JOXA 3IDAA 4BIOA 3POJA 3H8OA 3ATGA 2IXCA 1KJRA 4LXLA 1UY4A 5IVVA 1SMVA 3CEWA 2Q1ZB 2HWB2 3WF0A 2ZEYA 1UXXX 3O1PA 4FPFA 1ONAA 4FOVA 4M3CE 4XPVA 5T52A 1UMIA 5C8WA 4X8PA 1E5RA 4CUBA 4AHZA 1H6YA 4WM8A 4UI9L 1HB1A 1DLLA 4PJYA 5FZ9A 3V64A 1UZ0A 5I93A 4W6WA 5DAQA 5FWJA 5GLZA 1TE1B 2ADDA 5D1IA 5CBLA 5A6ZA 4P9WA 3NWKA 3VD5A 5C33A 3OD4A 2PHWA 1SPPB 3N9OA 4XDQA 1JYCA 5BNQA 4XTPA 1HRV2 2A6XA 4Y5TA 3AKRA 4JKMA 4CDXA 3T2PA 1W28A 4AFAA 2DYCA 2BQPA 3CLPA 4FPOB 4CEYC 3OG2A 3BTYA 4LKSA 4QX8A 4QX0A 3ZN6B 4QX3A 3ZSLA 1JUHA 3ZPYA 1R1A2 4IEXA 5FRAA 2W95A 1PM4A 1EP0A 3H42B 4AXOA 4V2WA 4BQ5A 3KZ4C 5FP4A 1Q8VA 3APBA 3THTA 1Q56A 1RXFA 3GCWA 2EAKA 2UU8A 4YW3A 4RS5A 4XUTA 2FBEA 4NWWA 4IV3B 4QGMA 1SFPA 5JVVA 2ZS6B 4OFGA 1R082 4P9LA 2HWC2 4GULA 3OUHA 5J98B 1W8ZA 3LA3A 4LNVA 4YZ1A 4I3PA 2IWGB 2RDNA 2H6CA 1PK6A 1US3A 2F17A 4N53A 4AE2A 1PGW1 5D2AA 2GAUA 2ERFA 1VLNA 4QPWA 1QXPA 1UYZA 1DQ2A 4AK3A 3VBSC 4C0HA 2JG8B 4NMIA 1FPN1 3OB8A 3M3OA 4R9BA 4AVCA 5A6QA 2XBO1 4RGGA 3RYRA 4HXCA 5JI7A 4WVMB 3HN1A 5F7UA 1WD4A 3ACLA 1RMU2 2R063 3H1YA 1LU2A 1CPNA 5LK5A 1RUI3 1MQTB 1SBEA 2DFCA 2IVJA 1N3QA 2V72A 2Y6HA 3N9NA 3NV4A 1REDA 3OGSA 3PTYA 4GAZA 4L0PA 3VZMA 1ZZCA 3GJAA 4XJ9A 2I74A 2Y6FA 5E16A 1NKGA 5F8PA 5HCBA 5LA2A 1AR92 1BK1A 2HWE3 5D8AB 1AJOA 3KT1A 5IVEA 1R1ZA 1YQ2A 2J1SA 5H9SA 3T0BA 4CDQA 1O5UA 5F32A 5K0UB 2TBVA 3LFIA 2X5IB 2GMMA 4NE9A 4BM8A 4NHLA 3T0AA 3H9AA 1WLDA 1BBT2 2XR4A 4NPRA 1F31A 3SMHA 2P17A 2W92A 2NLRA 3EQEA 1R092 2PYTA 2VXRA 4OHYA 4JHTA 4AHWA 2MEV3 1JYTA 1JHJA 1ULFA 5EPAA 1GQHA 3AMMA 1RUF1 2WS92 1DLCA 3B7MA 4E8DA 1T6GC 2UYAA 2ARBA 5IAVA 4JQRA 1NCQC 2E32A 2D6LX 1D4M2 3SH5A 5GZCA 3PVEA 1DQ1A 1O5LA 2PA7A 1W2AX 1JOBA 2DU0A 4DXTA 5A6XA 1NLRA 4HMZA 1SLIA 3RFRA 1LCLA 2D6PA 4XQDA 5C5TA 1HXS1 2YZ4A 4X8NA 1JYVA 2WAAA 3KSCA 2G19A 3HJRA 2XOMA 4IV1B 1HLCA 3J8F3 4GB31 2C0ZA 3WQ7A 1SBDA 1X8MA 2RS13 4LULA 4CEWB 1T2XA 2A5ZA 5ABJB 1AR83 5C3QA 3T3YA 3VGIA 5EQUA 1GZ9A 1XC6A 3AFGA 1NCRA 3ZR5A 3BTAA 4E27A 2RG4A 1TNRA 3I8TA 1GWKA 5D21A 3K3NA 5FPUA 2ZGQA 3BPZA 1C28A 4YLZA 3JD72 2BOJA 3U10A 4NN0A 2AENA 2G1MA 5JZGB 2D97A 2YMZA 2DVGA 2K0GA 3FN9A 4W6YA 2BNMA 4IE0A 2ZABA 1UPIA 1BVP1 5FUPA 4YG6A 3VKLA 4CRQA 1H4GA 2PHLA 4EZ4A 4G9SB 1WBLA 2J7MA 1UOBA 2HWB3 2VTXA 4C0BA 1QF3A 4RD7A 4LORA 5F5QA 1JZ3A 1ND2B 4XC9A 5BNPB 4CA9A 2W91A 4EN8B 4DEQA 1ZA7A 3GJBA 3T30A 1RUC1 1UZWA 1W04A 5FZHA 1W8HA 3RMXA 4CTEA 5I8YA 4S2HA 4J25A 1YJLA 1ENSA 2GZWA 1GP5A 5A3NA 5IFPA 1OH4A 4CDUA 2DCTA 4ASLA 1W39A 4N43C 3AFKA 4N8MA 2CGPA 1BCXA 3TB0A 3W59A 2ZX0A 1ZZ7A 4OMCA 4NRMA 4NIIA 3T09A 3VBOB 4AFDA 3V0BB 3K4ZA 3WP6A 5J48A 4LBOA 2EXIA 1HRV3 3DPRA 4J6GA 2D6MA 1F4AA 1UY1A 2WZR2 2XJVA 3KVBA 1ENQA 4ASMB 4Q29A 4S2GA 3ZMOA 4E4SA 2ZCWA 3NV3A 1UZZA 5FYBA 1WGPA 1HX6A 3MEPA 1A8MA 1WUVA 1HB3A 1TVGA 1R1A3 4H55A 2ZGUA 1AX0A 4Q27A 5IHRA 5BYNA 1H8TA 2R49A 4A42A 4P9YA 1QU0A 2R0FA 3ZOIA 4XUOA 4QX7A 5DAPA 3B9IA 4Q8LA 5A70A 1W6PB 2XL7A 1TZOA 3E1F1 4LTAA 4E2QA 1R083 2HWC3 1JBCA 3D82A 4HOOA 2QFEA 2VE1A 4HSLA 3FL7A 3LEMA 2VD7A 4LBKA 4YM2A 4MXWA 1SPPA 1V9U1 2ZACA 2J1AA 2PXJA 1UX6A 5IWFA 2L9LA 3ZSKA 1AYN2 3N7MA 2VMDA 1NLQA 1OPMA 2ID4A 3NVCA 3MIDA 4MADA 3MIHA 1YEWA 3CF6E 3ZIXA 3M3EA 2YFUA 1WWYA 3EXUA 3ZN6A 2WR9A 1UYXA 4DEVA 4Z2AA 3A7QA 5KHKA 2YFZA 1Y9MA 3RI8A 1JYWA 3I3MA 4D7YA 1PZ8A 5J37A 3C7OA 4Q0UA 4Y24A 4Y4RA 1BMV1 4EZHA 4Q4V1 4QHBA 2VOTA 2FDHA 2ZAHA 2HJIA 2JIJA 1XSQA 1AR93 1ULCA 3VKFC 1DGWX 1FATA 1MACA 2R16A 2W3JA 1RUD1 4RQPC 3NKTA 4LQRA 2G9GA 4U2AA 3IIAA 1K5MC 2IXLA 3OGJA 2QQKA 3MICA 4YVSC 5IVJA 3WNMA 4AEDB 3AZVA 3JQXA 2BZDA 1BBT3 2JENA 1O8SA 3NJXA 5HXVA 1VB2A 3EBRA 2C5DA 4AWDA 2RHPA 2GMEA 3WW4A 1DZTA 2A6YA 1UMHA 2EXJA 1UF2C 1R093 1POV0 1ZZ6A 3FFZA 3SHRA 3L2YA 4RN5A 3KV9A 1QGLA 2WS93 5C4WC 1MQTA 3OBZA 1VBD3 2GN7A 4UT5A 1ASJ1 1QWRA 2WZPP 1D4M3 3Q9OA 3GXUA 4P5YA 4XE9A 2Y6LA 1VPHA 3WLUA 5DZGA 1WLCA 1AR63 4KG8A 5JOZA 4MHUA 1NX9A 3H8UA 2WO7A 4H2AA 1PO12 1J83A 1GP6A 2P3YA 3CO2A 5F5AA 5CADA 2X5IA 2D44A 4PI2A 2YBSA 1ZYBA 3UJQA 2YG0A 1RUE3 4QB6A 2B39A 3LA2A 2P4EA 3LSEA 3N35A 2YU2A 2GNDA 3ZX7A 3WNXA 1NE6A 2ADEA 4YW1A 5F3IA 1MZ6A 2R6QA 2A3WA 2XBO2 2GMPA 3RDIA 5LEJA 1O3QA 4XABA 1DGRA 4D7SA 3AXDA 3LWCA 4J1WA 2ZGSA 4IE4A 3VBRC 3GM8A 3VDDA 2QQPA 2HBUA 2N7GA 4JV4A 3JD73 4FAGA 5JCTA 4Y22B 2WNUB 3P5BA 2ORZA 2GNBA 1W8TA 3PUIA 1FMD1 5FY7A 3FUQA 3OPWA 4JGYC 1V6KA 3WNLA 3ZYJB 4DINB 5IK5A 3VKOA 3I2IA 1XE7A 2ARCA 1P8JA 2GALA 3U75A 3VHOA 1Y3TA 3I2GA 4BH9A 1UO9A 3UETA 3B93A 4RFRB 3VD7A 2JG9A 2QQVA 4AQTA 4KG0A 1ZZ9A 4ONUA 5AFBA 5T5PA 4N7IA 4YVWC 3B9CA 3TAYA 5FY8A 1AR71 1QJZA 2OUHA 3MIEA 3WQBA 2EIEA 2PQQA 4AI1A 2NYYA 2VBPA 1W6NB 2AH2A 3DYMA 3VN4A 3PNAA 4J1XA 1RUF2 3WF3A 5ERLA 5C3PA 1MS4A 3ROUA 3WG2A 3G6JB 5F6LB 4FXKB 3MLJA 4O61A 2VW0A 4AG4A 3OEBA 5HCHA 2WZR3 4QQPA 3HNBM 3M4FA 2VXJA 1DU3D 1HXS2 3WG4A 4YGEA 4HBNA 4GH4A 1GR3A 4XF4A 5FY5A 3RVHA 4F83A 4UFLA 5FZKA 1AYM1 2AREA 4A44A 4GALA 1ND2A 3B94A 5FY1A 2ZJCA 2EIGA 2PLV2 2X29A 2CGOA 5FZGA 4RGKA 1RITA 4M4RA 4ZS3A 3N3HA 4BZ4A 5IFTA 2BGOA 1ENRA 4DIQA 1QQP1 4G3YC 5GZGA 1W9FA 1B35C 1IKPA 3MFCA 1D2QA 3AKSA 2LALA 1YYNA 4PDWB 4Z2WA 3NV1A 4GMP1 4QQOA 5ACA1 3BTXA 5EFUA 1DG6A 2KA3A 1N47A 3JBG1 4Y1ZA 5E8AA 4CU7A 1GZWB 2OQ6A 1AYN3 1YRZA 4XFAA 2VO5A 1DBNA 1D2SA 5DDJ1 2HYKA 4HN1A 5E89A 3EMRA 3KHCA 2F4PA 1LRHA 1L7RA 3W58A 5C70A 3ZXDA 1QMJA 3AJYA 5FO7B 1K45A 4LITA 4CPBA 3CKHA 4CCEA 2W52A 4Z92B 3A0KA 2BPA2 3VKMA 1OXCA 1AL0G 4D3WA 5JMCA 4XTMA 4I01A 1LHOA 4QM9A 3ZYRA 5B4XA 1W6PA 2WQ4A 4PIXA 1D7PM 4CCJA 4BOWA 4I02A 4JQTA 3WT3A 5A7NA 2GP5A 2CWMA 2C1FA 1GP4A 5L9RA 2VQAA 4YPJA 4Q8KA 2D6OX 4IW3A 4H3WA 4XJAA 1RHI2 2XWJB 1H1IA 3LPGA 3VZLA 1W0PA 1UIKA 4YZ4A 1UY2A 4TTGA 4PLOA 2J1EA 5KHGA 4GQ7A 1B09A 1Y9QA 4Q0PA 2JJ6A 4UF0B 4MGKE 5A3PA 2HEYF 4FFGA 4XAEA 1OA2A 1WLTA 3FX3A 1O4YA 4C1XA 5BNNB 1C3HA 5DUVA 1ND3C 1S2BA 1NA1C 1VBC1 5F6KA 2PTMA 2DUQA 2VM9A 3AVRA 2JIGA 1SLLA 2K9ZA 4NAMA 2FDFA 5C8CC 1W6MB 1OLME 3DL3A 4KWUA 2QQLA 4U36A 3WQ0A 2UURA 4DXSA 5CFCC 5FYVA 1COV1 2I45A 4XACA 4DFSA 4COUA 1PO13 5HBAA 5HV4A 3VV1A 1V9U2 2FCUA 2YROA 4WV8A 3AP9A 1KEXA 1LOFA 3TWIA 3V65A 1AXYA 3RZZA 4DPNA 1VBE3 2XJUA 1PMHX 1RUH1 3VBFC 1OVSA 2H0VA 3O0XA 4QB1A 5A3TA 4DY5A 3BI3A 1LU1A 2D40A 4IE6A 2WQZC 3NMBA 1YIPA 3DGTA 5A7WA 4P5HA 1SLAA 4E4HA 1W8OA 3NQHA 2FZ1A 5DUWA 4BLIA 3W5NA 1CGPA 3VD9A 2B4KA 2F4LA 1NCQB 1GNZA 1UNBA 2E7QA 2ZHKA 3LDBA 5F39A 1IHMA 1PHMA 4Q4V2 3RWKX 3MPBA 1H4HA 1PMJX 2LM3A 2PHRA 4AF9A 1IZ3A 3IT8A 5E1RA 4K3UA 2VG9A 2NMOA 4GWNA 1YQ6A 1NZCA 2BOIA 5L7OC 1OQEA 2BBAA 3GNEA 4UFKA 4N90A 3VZJA 3SKVA 5T50A 3F2ZA 1GOHA 2VMCA 1Z0HA 3FMGA 4CYDA 5C5UA 4NRPA 4FAHA 1BYHA 4KBBA 4CDXB 5FP7A 3LZZA 3RG0A 2ZGTA 1STMA 1W90A 4DNYA 3I3EA 1IG3A 3H3UA 4FFIA 5F3GA 4EN6B 1UU4A 3RGBA 4RYDA 1YI9A 3HVDA 4DUVA 2FMDA 1RUF3 2HYXA 1L7LA 1OOPA 4MGIE 4AGVA 3TEWA 1OLMA 1ASJ2 1N1TA 1GV9A 1RYYA 4BA6A 3JB8A 5A3WA 2RM21 1X33A 4A45A 4RS5B 4QMAA 2PHFA 4HPKA 1O3SA 2VZUA 1APNA 3OCPA 2FDIA 2ZMNA 2JDUA 2C9AA 4Q0VA 2VMHA 5DXDA 3NNMA 4HONA 5GLWA 3CMGA 4DUWA 3IMNA 1UKGA 1Y4WA 4M0NA 3IN9A 4BQ1A 1G86A 2DVAA 3PLQA 3B69A 3THDA 1KFUL 2OKXA 3UGFA 3SCGA 2D3PA 2PLV3 5CNAA 2VZ1A 4N53B 4EWAA 3MYXA 2D98A 2DURA 3LIGA 4IGOA 4UWDA 4XVHA 4EWEA 4DRVA 4HVOA 2BW8A 4Q1RA 1OFNA 3OEAA 4RR3A 3O1MA 4K20A 3A22A 2JXAA 4IESA 1GU3A 4M3CB 4N43B 3ZVXA 1SFNA 4ORFA 1WA4A 4X6RB 2VOKA 3ZFGC 3RJRA 4F7ZA 3ZFEC 4HK9A 2XB6C 1LOAA 4IEUA 1W6QA 1EYBA 4B1MA 4ATFA 5FZ7A 3CJIC 2ZX2A 3P6BA 2RS31 1Z7S2 1OT5A 4MXVA 3RS6A 1SHWB 1YUDA 5FMBA 2XUMA 4O9GA 1S0EA 2FMYA 4CDQB 1OD3A 4PF1A 2CWSA 5A3MA 2B5HA 5EIYB 4AHYA 2DVBA 1KDKA 3AL6A 1WCQA 3KMHA 4K6BA 4XYXA 1WMFA 3ZYHA 1V6JA 2OX0A 4M00A 4QU1A 3UKVA 3W21A 1TMF1 3WDTA 4HKOA 1YQ8A 2AR6A 2JE9A 5JXHA 1EV12 1VBB1 2AUYA 4IGPA 2QCSB 2Y26A 3C8XA 4MHRA 2E7AA 1RHI3 3GHMA 1XU1A 5F5IA 3WW1A 4URTA 4YWAA 2C6SA 2QTWB 1SDWA 4I30A 4IERA 4XFFA 4A6OA 1X82A 5LA1A 2VL4A 3VLBB 4CEYA 4FSJA 3FLRA 3PJYA 3BODA 2W39A 1CZVA 3AC0A 4AVVA 2WABA 1QJU1 1QJY2 2D6KA 2XHKA 2FDJA 5IUQA 5IK4A 1CZTA 3IAPA 2YC0A 4FO9A 3PJQA 2K2SA 4S2FA 3GZEA 4OVEA 2VAUA 1PGSA 4ZXKA 3RI9A 4BQ3A 5J36A 1O3RA 3VBHB 5FYIA 1XNAA 2A73B 1M06G 2A6ZA 3PVBB 4LKEA 3KS7A 3H1MA 1UAIA 1I6XA 4RQPB 1NCRB 4EV0A 3T08A 4ET7A 3BUCA 1EY2A 2R071 3VUOA 4O9EA 2P6CA 2VY0A 3ACGA 4C1WA 1SG3A 4MSVA 5FKCA 1K5MB 1RUJ2 4Q0QA 1YWKA 2XDVA 4UF0A 5JOWA 3VBSA 1C5IA 3PUHA 2WFF1 3WP4A 1VRH3 1WA6X 1YIFA 2JB4A 1PGL1 1WCSA 2VMGA 1H0BA 3NKGA 2DCKA 3TEXA 4KU7A 1KS5A 2CAVA 4BK4A 2V5DA 3AJZA 3OBRA 3V0AA 1PZ9A 4CDWC 1SBFA 2EVXA 1EUUA 4EN7B 4LKFA 5K9YA 1W6MA 3LF7A 2XONA 1CONA 5FXVA 3TNPB 4CXWA 3MV01 5IK8A 3P3NA 4JKLA 4R4XA 4YW2A 4B7EA 4LOTA 1NT0A 1GWMA 4FP3A 3TN92 3B01A 3CQOA 1XSRA 2JD9A 2WSUA 4QPIC 4KNCA 1CD3G 4JGZC 3AX4A 2IC1A 4EN9B 2Y6JA 2EA7A 3POEA 3DPRB 4IQPA 5LEKA 2B9UA 4BQ4A 1NXMA 1YHFA 3K46A 3E6CC 3UGHA 3NAPC 5FV3A 4HSJA 1Q43A 4AW7A 1E5SA 2ARAA 2BYVE 2XVLA 3SCFA 4Q26A 3VBRB 1LULA 2EXHA 1G6NA 4HLTA 4OLLA 5FZEA 5KC5A 1NCQA 1H9WA 1ASJ3 1H8TB 2A1XA 4GWIA 1OBNA 1DGLA 4Q4Y3 1REEA 4QPGC 1KD7A 4JVAA 2VCBA 2V4VA 5IT6A 3UESA 1S0FA 1REFA 2IFWA 5JR7B 1LJ7A 4OUSA 2A75A 3UT0A 4MXWB 4YM1A 1VJ2A 5JSPA 3UK9A 3D8CA 1S0BA 4BDVB 2XL9A 4QM8A 5C9AC 4QD2A 1LGCA 2VMEA 3M1HA 1BHGA 4YVWB 3I3BA 3O5SA 1FV3A 2A3YA 2ZA9A 2ZX4A 1C8M2 2PAKA 2W0XA 2OA2A 2Q1FA 3USUA 4XETA 3ZYPA 1RGSA 1W9YA 5DZFA 3SC7X 4ZS2A 5CKNA 3CZUA 4P9JA 1GQPA 3S57A 2HWD3 4IEYA 1HB4A 1UMZA 4Q4W1 2XJSA 3J7MA 2A6VA 4PI0A 3QLQA 1UZVA 5C7GA 1Z7S3 3ZXKA 5IJRA 2EALA 3ZDSA 5JIUA 2B8MA 1J3PA 4NPMA 2BNNA 2VVDA 3UKTA 3WG1A 4D6SA 1DCSA 4LIUA 2Z42A 4CCNA 2TEPA 1VB4A 5DZEA 2VW2A 4XF1A 5T54A 2PHUA 1RUOA 2XGXA 2A71A 1B35B 4M3CA 2OYZA 4N43A 2QDNA 1EV13 4FVVA 4XEZA 1A34A 4CUGA 1US2A 4B29A 1ZBA2 4RHV1 3C7GA 3I7DA 2BDRA 2W87A 2RJ2A 4Q2FA 4FXGB 4NR1A 3ZSJA 1PVC1 1LGNA 2WDBA 3AB0A 3I2DA 2RS52 1PM7A 1W0OA 4AEMA 1PMIA 4PBOA 5E6HA 1LOCA 3H8XA 5A1LA 1QJY3 2YBPA 3D5OA 4ZZ5A 2VW1A 4BJ0A 5C3OA 2B9VA 4H7LA 4W6XA 5A33B 1K42A 1GZCA 4UBHA 2ENRA 5L19A 1GUIA 2XH6A 1J58A 3OBTA 3BU0A 4MG2A 2W1WA 1TNFA 3WQ1A 5IAXA 1IQDC 3KV6A 3BIEA 1XBFA 5FZ8A 1RUG2 2E31A 3KT4A 2ZPXA 3CZJA 3I2HA 5K7PA 4MO3M 5FYZA 5FY9A 5FUIA 1DF0A 1MEC1 4JDMA 3VZKA 5DG2A 2V09A 2E63A 5FTTC 3ZXAC 1RJ7A 3JCIA 4BE3A 2BJSA 3VDDB 2RDRA 2VZTA 1YJKA 1HIXA 1RUJ3 2P5BA 2JWPA 2VC9A 2G9ZA 5A7OA 3AYAA 4ITCA 4GZ9A 1POV1 4CP2A 1JYXA 1BEV1 2JEMA 2VZQA 5IK7A 5EJZB 1SLBA 2EF6A 4M0HA 4OI1A 1HQWA 4NIHA 3C2UA 1ND3B 2JE7A 1SZBA 2ATFA 2JG9B 3JQWA 4P14A 3VBHA 2CV6A 1GQGA 1W8WA 5FBZA 1GICA 3ECQA 3N7KA 3SXWA 4RQPA 2BFUL 3C7HA 3TN93 3MDPA 4IEPA 4ZU4A 3SEEA 2Y33A 2YC2A 5FYTA 3BTZA 1KRIA 4K8FA 3PL0A 1K5MA 4LBNA 2WNOA 3MIBA 3DN7A 4YVSA 5I8TA 1CJDA 1OURA 1EAH2 4Q4X2 5FDBA 1U5ZA 4AQ2A 1RVF2 2JDMA 1AL21 1ZRRA 4YW7A 1UYYA 3I2KA 4PT6A 4CU9A 1BJQA 4GH4B 1OHFA 5BXXA 5CEHA 5FMCA 3NNGA 1SCRA 1RIRA 5C4WA 3VL9A 1ACCA 3O1SA 2A6WA 1MZFA 1CAUB 1SDDB 2Y34A 4KI5M 5KXDA 1HN1A 2OS2A 2F6BA 4IGQA 3OGGA 5A80A 2WT0A 3NNFA 1XYPA 1VAVA 3AKTA 3T2TA 3T4HB 2R072 3ILRA 3USSA 3C7FA 4M3CF 3CU7A 5J1XA 1AX2A 3ACHA 3ZKUA 2VULA 4C8DA 1JOJA 2FQPA 1QOTA 3S7IA 4YNIA 3POFA 2WFF2 5FXWA 4NWVA 4Y1VA 4Y26A 5KWRA 2UWCA 1N3PA 1YLLA 3VBRA 3ZN5A 1C8M3 4MGYE 4JDNA 2RR11 2W1SA 4QKFA 1LESA 1YC61 3J7HA 2WKKA 2OW4A 2I07B 1H9PA 2PHXA 5AC91 1EPZA 4PHZA 5I0UA 5F37A 4GD4A 2JECA 3L2HA 5F9TA 1PIV1 3RZKA 1V70A 1ZBE2 4PLNA 1OA3A 3SISA 3POSA 4LA2A 2ZEZA 4JGYA 4D6QA 4FTSA 2WN3A 5FY0A 3U14A 1UD1A 1JMUB 4AZZA 1IPKA 2XQXA 1LKNA 2GC3A 4EE2A 4TSVA 1LOEA 2VOXA 3KCXA 4LLFA 4CCCA 3POWA 4XMIA 4XOGA 1QH6A 4YVWA 3WG3A 1QOOA 1CIWA 2VUCA 3ASIA 4FQZA 1NY71 4MGTA 1D0HA 3U07A 4FOYA 1RMU3 3HBZA 1ZBA3 2CDPA 5LBBA 1O91A 5A7SA 3DXUA 4WVWA 5CA6A 5CG9A 2VECA 4AVAA 2RS53 1ZVFA 2YHJA 3P3PA 4L97A 1CESA 3EHKA 1K12A 3WXPA 1HQLA 2P3KA 3KGLA 3CJIB 1ULOA 4PQ9A 1XB9A 4INDA 5FREA 5FPBA 3UJOA 4E4ZA 1GWLA 2D3RA 4R9AA 1C8NA 2W68A 2HKXA 2ZXQA 2Q8OA 3IDEA 1LB2A 3WDWA 3C3VA 2DUOA 3KT7A 1UXZA 3GZAA 4FPJA 1B35A 1QOSA 1RUG3 2GH2A 4FCAA 2FZ2A 3HNYM 3KQ4B 3A4UA 4K9SA 4I09A 1W2OA 5A7WB 1U12A 2WN2A 3ZXFA 2D3SA 1QH7A 2KXLA 4WVVA 3PVOA 2MNGA 1JYNA 4AI9A 2OIIA 4MUVA 4A3ZA 1KS4A 3H50A 3N7LA 3LDRA 5GALA 3IZOA 1GFF2 1A3KA 3WF2A 1Y9GA 5IYYA 5H9RA 4R4ZA 3NNLA 5FZBA 3SQOA 4BYYA 1YFYA 3UYJA 1JTZX 4XUQA 1S1AA 1UPSA 1S4CA
chains in the Genus database with same CATH topology
1FOD1 2WA4A 4L2NA 4AVSA 1Y43B 5A33A 1JXNA 2ZAAA 1GSLA 2ET1A 2QZ2A 2I2SA 1PGW2 2VVFA 3N36A 4YG3A 1BQPA 1S0CA 4LT5A 4OHWA 2VOVA 1FPN2 1JH5A 3GF6A 2YUEA 4HANA 4L99A 1AF9A 4ES9A 4P9XA 1MS1A 5JDBA 4JRAA 1DYKA 1OOPB 5H9PA 5EV7A 3WDXA 1I1EA 2ES3A 1PVC2 1EAH3 4Q4X3 1NLSA 3PVNA 1RVF3 4LR4A 1AXKA 2GC0A 2VMIA 4YFWA 2DCZA 4HPKB 2D6NA 1CPMA 5BUVA 4XF9A 4YM0A 1ND3A 4DS0A 1NA1A 3ZIWA 4AEJA 4CDWB 3OPZA 5JPMB 5CFDC 3HQXA 4COWA 1A78A 1DIWA 1YXWA 4LE4A 5C8CA 1N1VA 4FPLA 3WW2A 3ZFFB 3GZUC 4DOUA 3BOWA 5CFCA 4RR3B 2CTVA 5LRRA 3R4DB 2YGMA 4ZU7A 4LO6B 2DTYA 4F3JA 5I0SA 4WM7B 4JGZB 1UKRA 4QQHA 1A6CA 4GKYA 4KWJA 2VGDA 3VBFA 4XJZA 1GNHA 1OKQA 1W6QB 4EROA 1L3JA 3U4XA 2CY6A 2GSYA 1QXJA 4GB32 1CAUA 3V56A 5BV6A 1O4ZA 1ZBE3 2R061 2XKOA 1PVXA 2HEVF 1MR5A 3O14A 1KFXL 1MVQA 1RUI1 1MVEA 4X6QB 4A7KA 4XJWA 5I8SA 5L7OA 4IV3C 1ALYA 4LBQD 2Q4SA 3B02A 4A3XA 2PHDA 2WT2A 1DZRA 5EJ3A 5EXOA 2HWE1 4LA3A 4M01A 4BMEA 2JICA 5I0TA 2ZGOA 2VUAA 3ME2A 3WCSA 5C9AB 3THPA 2Z79A 4CEYB 1N3OA 1I5ZA 3JB4C 2JG8C 2ZKLA 4AI0A 2JD4A 4NHKA 5JSOA 2MEV1 4K1ZA 3A0NA 1RUC2 2R0HA 2Q30A 5B2GB 4Z82A 2R041 1LGBA 2IXJA 5T5LA 4KGQA 3NW4A 2P2KA 3WD5A 1NXD1 2O8QA 2AGSA 4JTNA 5D8AC 1N1SA 1F8VA 3NSTA 4YW4A 2YDEA 3RPQA 5K0UC 3IPVA 5J96B 4MLOA 3LCPA 3VBSB 3J8F1 4IEQA 4BIFA 2RS11 2RR12 1AR81 3WCRA 4PF5A 2CNAA 3ZFGA 5AC92 3V0AB 5CAZA 3ZFEA 2VUJA 1WW7A 3GBGA 3TYJA 3ZXGA 1KDMA 4LLOA 2OVUA 3KCCA 3CJIA 1ZRFA 4FPYA 2MHFA 3ZYIB 1Q8PA 1OMIA 3AKPA 1SACA 3AM2A 5DUXA 2CL2A 1YFUA 2XJTA 1GANA 2HWF1 2HWB1 3B3QE 4IV1C 4NOTA 1Q5OA 1FPN3 1TEIA 3AZZA 2WFPA 2XBO3 5ABJC 1CR7A 4CEWC 2B42B 3LB9A 4XXAA 1JYIA 2Z69A 4RFT0 2NP0A 4FTEA 3ENRA 1BMV2 2XLAA 2XJQA 4E9KA 5JZGC 4XF3A 1PO21 4AGRA 1KJLA 3ILNA 5CIRA 3S30A 3FHIB 1RUD2 4OI0A 1OQ1A 4BCUA 1Q3EA 3QD6A 3LAGA 4XFGA 3K51A 1PZ7A 3M70A 5BNPC 4RL7A 4XFCA 2ZKNA 3QACA 4B4QA 1KITA 2ZMLA 4YFZA 1H8VA 1IS4A 2XWBB 4OI4A 1R081 3USUB 2VU9A 4XFHA 1F5JA 3K48A 3VBOC 3POYA 4OHVA 4BPZA 3LGRA 4AQ6A 1HXS3 3RJ2X 1DQ4A 3AXEA 4OI2A 4FQ4A 2E9QA 1ZNPA 3IDBB 4CDWA 3CNAA 5JIAA 4GB33 3D0JA 5BPXA 3T1LA 3ZFFA 5FCCA 4RGAA 1LTEA 2W08A 1G8WA 1DQ5A 4LHNA 1HV1A 4QPIA 4LUMA 2IXKA 4LBJA 4LEJA 4G4FA 4JGZA 4WM7A 1AR91 1MS5A 4ISRA 2ZX3A 4HKLA 1ULGA 3L9JT 1FMD2 3AP6A 3GBWA 3RNSA 3CJXA 5I0RA 4HFSA 3SNMA 4DB5A 3AP7A 1ZREA 5KHJA 1CQ9A 1Q8QA 2YV8A 3AZXA 3U11A 5AFEA 1DQ6A 3ES1A 1R091 4Z8BA 4AI8A 4Q1PA 3H7YA 1RUC3 4QPGA 2WS91 3MIFA 2AZ5A 1AR72 1VBD1 4QGNA 5KHHA 3HT2A 1D4M1 4AFMA 1S0IA 2EXKA 4P9GA 1X36A 1VAMA 1AR61 5FO8B 3X29B 5C9AA 3M7AA 1URXA 2XLFA 4KWKA 1V00A 1SFYA 4LO4B 1RUE1 2R1BA 3IDCB 4AEDC 1QNYA 3WDYA 2RR13 1AYM2 4FPGA 4XQWA 2UY9A 3UV9A 1JW6A 5AC93 1X7NA 2PAMA 1AZDA 4QXKA 1SLTA 3S6PA 1QQP2 4XILA 4L9BA 3JD71 4COYA 4LO7A 1VP6A 3ZXEA 4TYSA 2B46X 3ETQA 3WY6A 5ACA2 1V9U3 2RJLA 4YG0A 1OA4A 3JBG2 1HDKA 4BWOA 1HQNA 4YVSB 1SQ4A 5DDJ2 1IGOA 1QXRA 3LSDA 1QDOA 2XJPA 5LK7B 4H7MA 4FPKA 3R4SA 5FLHA 1FYUA 3ELNA 5BY5A 5C4WB 5JPNB 2RE9A 4Y5Z0 4B7KA 3GHNA 4KGGA 4Q4V3 4HK8A 5F1RA 4PLMA 3IBMA 4GXLA 4QT6A 2R042 4YGDA 3N7JA 2XVGA 2O0OA 2WNUC 3EJKA 2BVVA 3WHTA 4D94A 1RUD3 2WZR1 4QQLA 3RQ0A 5GZEA 1H1MA 2H0BA 3E5UA 2ZGRA 4OZXA 4FP2A 4CP0A 1CN1A 1W2UA 4JTOA 4D7TA 3AKQA 3M8LA 3TOJA 1LHVA 4V1PA 1V6OA 1FV2A 2RS12 4KQ7A 4JRLA 1AR82 4N7UA 2UWAA 2MPFA 1VBC2 3GYDA 4HT1T 1ZX5A 2BFUS 1CJPA 1ULDA 5I91A 4R9DA 4JGYB 4GKXA 1COV2 5GJ6A 2CYFA 2QUOA 3RYKA 1S55A 1VIWB 1V6NA 3MPPG 4UW4A 3IWZA 4QX5A 4XMAA 4BMBA 1RJ8A 5CFDB 2GNTA 1OFSA 2HWF2 1RUH2 1U0AA 4LBQA 3JZVA 5KHIA 5GM0A 5AVPA 1J59A 1WW5A 2DWRA 5GLUA 3HWJA 4WZCA 4IL7A 1GKBA 2D93A 3MF9A 2D43A 2AYHA 4PDWC 5KC6A 3MZHA 1QKQA 4DY3A 3HR9A 4AI2A 1FMD3 1V6MA 5FQ0A 2NPIA 3ST7A 1PO22 4DMIA 5JWPA 3BU7A 4CP1A 1U5YA 1ZZ8A 2A7AA 1S1AA 3TBDA 4AVTA 4IEWA 2CGNA 1UU5A 2BWCA 4L92A 3FLPA 3WUDA 4Y1YA 5EWSA 4YRDA 1AR73 1KQRA 3OD0A 3VHRA 1QHDA 1PNGA 4FOQA 1XQNA 1IQAA 5HCFA 2UY8A 3DUIA 1G9BA 2FHRA 1G9AA 1FXZA 2SLIA 1DFQA 5J09A 2RM22 5A3LA 1PO11 1O7FA 2RMU1 3AMQA 2V73A 1IS5A 1NOVA 1S0JA 1X8EA 1HV0A 4AGGA 3AYCA 1VBE1 2ZHLA 3M3IA 4XIKA 1DZQA 1AYM3 3FC0A 4E4DX 1UN1A 4K40A 4L8QA 1S0DA 2PN5A 5T55A 3URFA 5KXCA 3E6BA 5BNNC 4IETA 1YI7A 4XXPA 3WP3A 4OHZA 5E88A 1J1LA 1QQP3 4Z07A 2O1QA 4B3NA 1CAWA 2XG3A 4H14A 3UKNA 2O8OA 4GMP3 1IS6A 4XHBA 5ACA3 2QDRA 1QJX1 3B00A 4UW6A 3JBG3 4UW3A 2NZ9A 1ENXA 2BEOA 5DDJ3 1PNFA 2WNVC 2NN8A 1CAXB 1DHKB 1YFXA 4QU2A 1LHUA 2RS32 2NM1A 3AMPA 2YXSA 3R05A 1W6OB 3QBQA 5GKAC 2A70A 4Y20A 1XYNA 2BWAA 4MZUA 2JKBA 1F9KA 2Y38A 1H2NA 1NA1B 2R32A 2UWBA 3DF0A 5HCAA 4META 4N9IA 2DTWA 3EO6A 3HAGA 2R043 5C8CB 1VBD2 1XNKA 1TMF2 5A32A 5JAXA 1VBB2 5JLVA 5CFCB 4FOWA 4WM8C 3ZN4A 3WR0A 3I54A 2R30A 3AMHA 4DRRA 1AR62 4KL1A 3AYDA 3IKWA 4KU8A 2P37A 1MS3A 1H1AA 4HZFA 4XFBA 3VBFB 1RUE2 3MGUA 4JDOA 1QJU2 2PLV1 3NV2A 1ZZBA 4CDXC 1MS0A 3R4UA 3W9AA 1I9RA 1TME1 3O12A 1WD3A 1VBC3 4QGLA 4ZKTB 3OY8A 2B7YA 2Q5TA 4IEOA 1D4VB 1H30A 1XNBA 4SBVA 4R8HA 5BNOA 2SBAA 1COV3 1IKQA 2DCJA 4HL0A 4RS5C 4AEKA 3D4KA 5L7OB 4D69A 3E5QA 1SEFA 1U5XA 1I3HA 3UL2A 2JDZA 3FBYA 5CU1A 3GBFA 1EPWA 1CAVB 2HWF3 4JCKA 4I0WB 1RUH3 1LOBA 4SLIA 1PGL2 1PK6C 4N53C 2QNKA 4GWMA 4JAAA 3WX5A 3MFAA 4F8AA 2BVBA 2GH8A 2ILMA 2PHTA 1LECA 4MGZE 4XW3A 3PMEA 1MZ5A 3I59A 1RHI1 1AJKA 2P34A 1QY4A 1PO23 5JOYA 3VBUC 1KXGA 4A7ZA 4K1YA 1SLCA 4AI3A 2X53S 1FNYA 3MF6A 4I0AA 3WW3A 5FAXA 5CFDA 1G9CA 1LODA 3SH3A 3JU9A 1YCIA 2LUWA 2XJRA 4CDQC 4NVPA 3IPVB 3J9SA 3FFQA 4C90A 2LTNA 4MV2A 4Y1UA 5FO9B 3ZFGB 1C5HA 2HEWF 4FPEA 3ZFEB 4HETA 2RM23 2Z2SB 1IOAA 1D0GA 3AYEA 3BOPA 5L36A 1RL3A 2GDFA 3KQRA 1DDLA 1XNCA 2ZTNA 5SV5A 1VRH1 3QOPA 3RWNA 1RB8G 5DUUA 1HRI1 2P3JA 2X8KA 3M2MA 2VNRA 2XKPA 2EAAA 4P9IA 4KWLA 3KCYA 1H2MA 2CAUA 1GBGA 4IV3A 3VBHC 5KHKA 1QDCA 3BCWA 2BNOA 2WJSA 3R0RA 4IEZA 4JC1A 1O3TA 1NCRC 3E6DA 4IXLA 4RSUA 2DCYA 1XE8A 3WZ1A 1IS3A 5EYXA 4Q4W2 2WSVA 1C1FA 1OSGA 1BVVA 1G7YA 1ZA4A 2RS33 4YZ5A 1VBA1 2JG8A 4DQAA 2ZHNA 4WZFA 5FOBB 3INAA 3G7DA 4XQ4A 4WVMA 5EZWA 4GA9A 2VPVA 4XBLA 1ZRCA 3ZSEA 4TLFA 4Y4YA 4UBGA 4DXZA 4XFIA 1TMF3 3ZMNA 2UYBA 1VBB3 4Q4Y1 2QE3A 3FJSA 4RHV2 5D8AA 5TSWA 3MW3A 3RSJA 3WDVA 1GLHA 4B8EA 4CDUC 1CVNA 2ETEA 3S0MA 3HMYA 1CAXA 2Y0OA 5K0UA 2RMU2 2YGLA 1HW5A 4LUKA 2YY1A 3DPRC 2OZ6A 2ZBJA 3H1WA 1QJU3 2XLGA 1MS9A 3GZTB 4LHKA 4YW5A 1W6OA 1VBE2 5EYYA 3ZXLA 1LHNA 2OPKA 3ILFA 1DGWA 1VALA 3SLIA 2ZZQA 2ZMKA 3OTFA 4MVTA 3WHUA 4YARA 1WCKA 4WVZA 4PCRA 1H8TC 2GNMA 4XF0A 4K7JA 1AHSA 1G9DA 1WW4A 3MI8A 1MEC2 3OYWB 1UU6A 2VOWA 2R073 2HWD1 1QJX2 4QPIB 2GC1A 4I0BA 3T1MA 3WDUA 1RUNA 3IM0A 5CVRA 1ULEA 1Z7S1 2WC2A 2IFRA 3LOIA 4IV1A 3NL1A 2XPJA 2WFF3 2WLPA 1O4TA 1BEV2 1TQ5A 2DUPA 3NAPB 4CEWA 5ABJA 2DFBA 1SCSA 3E97A 4Q0SA 3RRDA 3FWEA 2OZJA 3O0WA 1EV11 2DV9A 2JX9A 1BKZA 3R6SA 2BBVA 1CX4A 4AFCA 1S0GA 1E57A 3DKWA 4QPGB 5JZGA 1FNZA 3HIFA 2D5HA 4IEVA 4XHXA 2ZGKA 4UW5A 1V6IA 4YGCA 4FT8A 2IXIA 4BHPA 1Z78A 4ZU5A 3TRSB 4HVRA 3RYPA 2NMNA 1H2LA 2Q0AA 4AQSA 1YO8A 1QJY1 1Q8OA 1CAVA 4FPCA 1AL22 3PHMA 5BNPA 4MYEA 1C4RA 4RA0A 3I4IA 4B4PA 2WT1A 1TME2 4W65A 1XU2A 4R9CA 3O0VA 2Z5WA 3VBOA 3V0BA 1MS8A 2H6BA 2PFWA 4EJRA 2QVSB 1MQTC 1XYOA 3N4MA 2TUNA 4E2GA 4YZ3A 1NQDA 5FMOS 1RUJ1 3ZXJA 2DVDA 1VR3A 3ZO0B 2WWSA 1NG0A 1OD5A 3WOGA 2G4IA 2ARXA 4K21A 1XRUA 3FZ3A 1XNDA 3KLSA 2X5IC 2ZHMA 3VZNA 3WUCA 5FFOC 2D5FA 4YZ2A 3ZSMA 4ES8A 3LKJA 4MX3A 1GYKA 2YPJA 4HN0A 1PIV2 3TN91 4Y1XA 3FBMA 1RTVA 1HKDA 3VDDC 2BGCA 4Q4W3 1WMEA 4AVBA 3ES4A 1IPJA 2NQYA 1JHNA 1F2NA 3J26N 3LA7A 3VL8A 3AP4A 3KGZA 2DVFA 2IZWA 1WBFA 3U0ZA 2TNFA 2WINB 1LR5A 4YSFA 3E5XA 5FPZA 1M4WA 3SCHA 3H3ZA 2JG9C 1LEMA 4COZA 1NY72 2V5YA 1JN2P 2DU1A 3MLKA 2IXHA 4NHMA 1UIJA 2E53A 4RHV3 5FLJA 2VNOA 2WL1A 1QNWA 1UZYA 1PVC3 3S7EA 2WNVB 2RMU3 1J3QA 3PMSA 3DV8A 1HRV1 3KB5A 4AEDA 2RJKA 1VRH2 4LBLA 1LENA 3WP5A 1U5IA 4GH4C 4XJ8A 1C8M1 1HRI2 4I3GA 1R1A1 2QJVA 1J3RA 1FI2A 1ND2C 2D7FA 4LBQB 4OUMA 2GN3A 3GALA 1MEC3 3NO8A 3M3CA 4WM8B 5L73A 1QJX3 3MIGA 2HWC1 1AVBA 4HKWA 3SITA 4OULA 4CZSA 5JSRA 4AHXA 2A3XA 4COVA 4LHLA 1NYWA 3BB6A 1POV3 1LOGA 2R1DA 4LBMA 5FQ0B 3SH4A 4EN0A 4EWAA 1BEV3 1FOD2 1ZM1A 4FBFA 2E6VA 3TNQA 1NQJA 5T5JA 3VHNA 4XBNA 1VBA2 2E7TA 3QH6A 5J3UA 1G9FA 3J4UH 4XJUA 3H0OA 3VHPA 4MH0E 1OQDA 1AX1A 1RMU1 1ZBA1 2GC2A 3AP5A 2ET7A 4Y22A 2WNUA 1WCDJ 4Q4Y2 1BXHA 3OYWA 3HT1A 3VKNA 1WW6A 5H9QA 4HVQA 2RS51 2ZX1A 5J7MA 1VAKA 5FMOL 1X50A 5AVAA 4GMP0 1AL23 4L11A 1N1YA 3NAPA 1PK6B 4PIZA 3MLLA 2Q1MA 1BBT1 1TME3 1RUG1 4LO5B 2P3IA 4ISQA 3CL1A 3QH7A 1W6NA 4EWDA 4QQ2A 2OUJA 1RC6A 2QKDA 5CB7A 3AMNA 5KXEA 3VBUB 1CAWB 5LRSA 4YYOA 3FE5A 1AUYA 2HWD2 2WA3A 4UXAA 4PIYA 5T5OA 5GZFA 3O7OA 1LEDA 3MW4A 3B5LB 1H2KA 5CG8A 1FAYA 2G9FA 4YM3A 4TZDA 3JUUA 1FX5A 2E51A 2BTVC 1MZEA 1DYPA 1UL9A 3AK0A 3AZWA 1OPOA 2B45X 1LOFC 1JUIA 5SV8A 3WINE 3MW2A 5FLIA 4AFBA 3BIWE 5FREA 3FLTA 1A8DA 3FUOA 3M3QA 5DG1A 1NE4A 4Y20B 1FT9A 1WMDA 4PDWA 2VQ0A 4LO8A 4DZGA 1OLQA 3HD8B 1PIV3 5T3NA 1UW8A 2R062 4PBPA 2GU9A 1S2KA 1ZRDA 2ZGPA 1RUI2 4E2SA 1GZWA 5HI0A 3QCWA 5A32B 3ALQA 4A2UA 5FOJB 1EAH1 4Q4X1 2VH9A 1F5FA 1BZWA 4XBQA 1RVF1 3RMYA 5K8SA 2ZGLA 2VVEA 2HWE2 4OHXA 2WNEA 4ATEA 2YYOA 2KM2A 1OI6A 3LOBA 2ZGNA 1J1TA 4KH9A 3OF1A 4N9HA 3AZYA 3WV6A 2WIIB 4TWTA 2WLQA 1OLRA 3ZYGA 2ZOEB 4WBBA 2DF7A 3VZOA 2BUKA 2MEV2 3OY8B 3WVJA 5JI9A 2ZGMA 5FPXA 1OOPC 3D6EA 5GLTA 1Y7BA 5BNOB 2Y0IA 1C1LA 3NJZA 1DGRN 1XXNA 5GLVA 4R52A 5KBFA 4XIOA 5BNNA 3H7JA 4YGBA 1C57A 1HRI3 1AXZA 4BLJA 5C6CA 1LHWA 4S2DA 4QPYA 3J8F2 3KD4A 4LE3A 1Q8SA 4C91A 1ZBE1 2VNGA 1RINA 1YNAA 3ZFFC 1DQ0A 5GZDA 4A7YA 4RR3C 4FTBA 4FPHA 2ZZJA 4CDUB 5KXBA 1V6LA 2PELA 2WNVA 3BALA 4B4RA 2PAEA 3I59B 4WM7C 4NO4A 4AYUA 3D0SA 4Z1VA 1WLWA 1UCXA 1AYN1 1FOD3 1YFWA 2XVKA 3KM5A 4GIQA 4XZPA 3OJBA 1VBA3 5JOXA 4BIOA 3ATGA 2IXCA 1KJRA 1SMVA 3CEWA 2Q1ZB 2HWB2 4FPFA 1ONAA 4FOVA 4M3CE 4XPVA 5T52A 5C8WA 4X8PA 4AHZA 4WM8A 1DLLA 4PJYA 3V64A 5I93A 4W6WA 5GLZA 1TE1B 5D1IA 5CBLA 4P9WA 3NWKA 5C33A 3OD4A 2PHWA 5BNQA 4XDQA 1JYCA 4XTPA 1HRV2 2A6XA 3AKRA 4CDXA 4AFAA 2DYCA 2BQPA 3CLPA 4FPOB 4CEYC 3ZN6B 3ZSLA 1JUHA 3ZPYA 1R1A2 4IEXA 5FRAA 4AXOA 1EP0A 3KZ4C 1Q8VA 3APBA 3THTA 1Q56A 2EAKA 2UU8A 4YW3A 4RS5A 2FBEA 4NWWA 4IV3B 4QGMA 5JVVA 2ZS6B 4OFGA 1R082 4P9LA 2HWC2 4GULA 5J98B 3LA3A 4LNVA 4YZ1A 4I3PA 2IWGB 2H6CA 1PK6A 4AE2A 4N53A 1PGW1 2GAUA 2ERFA 1VLNA 1QXPA 1DQ2A 4AK3A 3VBSC 4C0HA 2JG8B 1FPN1 4AVCA 3M3OA 4R9BA 2XBO1 4RGGA 3RYRA 5JI7A 4WVMB 3HN1A 1WD4A 3ACLA 1RMU2 2R063 3H1YA 1LU2A 1CPNA 5LK5A 1RUI3 1MQTB 1SBEA 2DFCA 3NV4A 1N3QA 3PTYA 3VBUA 4AF9A 1REDA 3VZMA 1ZZCA 4XJ9A 2I74A 5E16A 5HCBA 1AR92 1BK1A 2HWE3 5D8AB 1AJOA 3KT1A 1R1ZA 5H9SA 4CDQA 1O5UA 5K0UB 2TBVA 2X5IB 2GMMA 4BM8A 4NHLA 3H9AA 1WLDA 1BBT2 4NPRA 1F31A 3SMHA 2P17A 2NLRA 3EQEA 1R092 2PYTA 2VXRA 4OHYA 4AHWA 2MEV3 1ULFA 1GQHA 3AMMA 1RUF1 2WS92 3B7MA 1T6GC 2UYAA 2ARBA 4JQRA 1NCQC 2D6LX 1D4M2 3SH5A 5GZCA 3PVEA 1DQ1A 1O5LA 2PA7A 2DU0A 1NLRA 4HMZA 1SLIA 1LCLA 2D6PA 4XQDA 1HXS1 2YZ4A 4X8NA 3KSCA 4IV1B 1HLCA 3J8F3 4GB31 2C0ZA 3WQ7A 1SBDA 1X8MA 2RS13 4LULA 4CEWB 5ABJB 2A5ZA 1AR83 3VGIA 1GZ9A 3AFGA 1NCRA 3BTAA 4E27A 1TNRA 3I8TA 2ZGQA 3BPZA 1C28A 4YLZA 3JD72 3U10A 5JZGB 4NN0A 2AENA 2D97A 2YMZA 2DVGA 2K0GA 4W6YA 2BNMA 2ZABA 1UPIA 1BVP1 4CRQA 4YG6A 3VKLA 1H4GA 2PHLA 4G9SB 1WBLA 2HWB3 4C0BA 1QF3A 4RD7A 5F5QA 1ND2B 5BNPB 4EN8B 1RUC1 3RMXA 4CTEA 5I8YA 4S2HA 1YJLA 1ENSA 2GZWA 4CDUA 2DCTA 4ASLA 1W39A 4N43C 3AFKA 2CGPA 1BCXA 3TB0A 3W59A 2ZX0A 1ZZ7A 4AFDA 3VBOB 3V0BB 5J48A 3WP6A 4LBOA 2EXIA 1HRV3 3DPRA 4J6GA 2D6MA 2WZR2 2XJVA 1ENQA 4ASMB 4Q29A 4S2GA 3ZMOA 4E4SA 2ZCWA 3NV3A 1UZZA 1WGPA 1HX6A 3MEPA 1A8MA 1WUVA 1R1A3 4H55A 2ZGUA 1AX0A 4Q27A 5BYNA 1H8TA 2R49A 4P9YA 1QU0A 2R0FA 3B9IA 4Q8LA 1W6PB 2XL7A 4LTAA 4E2QA 1R083 2HWC3 1JBCA 3D82A 2QFEA 4HSLA 4LBKA 4YM2A 4MXWA 1V9U1 2ZACA 1UX6A 3ZSKA 1AYN2 3N7MA 1OPMA 3NVCA 3MIDA 3MIHA 3CF6E 3ZIXA 3M3EA 3EXUA 3ZN6A 3RI8A 4D7YA 1PZ8A 5J37A 4Q0UA 4Y24A 1BMV1 4Q4V1 4QHBA 2ZAHA 2HJIA 1AR93 1ULCA 3VKFC 1DGWX 1FATA 1MACA 2R16A 4RQPC 1RUD1 3NKTA 2G9GA 4U2AA 3IIAA 1K5MC 2IXLA 3OGJA 4YVSC 3MICA 4AEDB 3AZVA 3JQXA 1BBT3 2JENA 5HXVA 1VB2A 3EBRA 2C5DA 4AWDA 2RHPA 2GMEA 3WW4A 1DZTA 2A6YA 3FFZA 2EXJA 1UF2C 1R093 1POV0 1ZZ6A 3SHRA 3L2YA 1QGLA 2WS93 5C4WC 1MQTA 1VBD3 2GN7A 1ASJ1 1QWRA 2WZPP 1D4M3 3Q9OA 4XE9A 3WLUA 5DZGA 1WLCA 1AR63 4KG8A 5JOZA 3H8UA 1PO12 3CO2A 5CADA 2X5IA 2D44A 1ZYBA 3UJQA 1RUE3 2B39A 3LA2A 3LSEA 3N35A 2GNDA 3ZX7A 3WNXA 1NE6A 4YW1A 1MZ6A 2R6QA 2A3WA 2XBO2 2GMPA 3RDIA 5LEJA 1O3QA 1DGRA 4D7SA 3AXDA 3LWCA 4J1WA 2ZGSA 3VBRC 3VDDA 2QQPA 4JV4A 2N7GA 4FAGA 3JD73 5JCTA 4Y22B 2WNUB 2GNBA 1FMD1 3FUQA 4JGYC 1V6KA 3ZYJB 4DINB 5IK5A 3VKOA 1XE7A 3VHOA 2GALA 1Y3TA 4BH9A 3B93A 2JG9A 4AQTA 4KG0A 1ZZ9A 4ONUA 5AFBA 5T5PA 4N7IA 4YVWC 3B9CA 3TAYA 1AR71 1QJZA 2OUHA 3MIEA 2PQQA 4AI1A 2NYYA 1W6NB 2AH2A 3VN4A 3PNAA 4J1XA 1RUF2 1MS4A 3ROUA 3WG2A 3G6JB 5F6LB 4FXKB 3MLJA 4AG4A 2VW0A 2WZR3 4QQPA 3M4FA 1DU3D 1HXS2 3WG4A 4YGEA 4HBNA 4GH4A 1GR3A 4XF4A 4F83A 1AYM1 2AREA 4GALA 1ND2A 3B94A 2ZJCA 2PLV2 2EIGA 2X29A 2CGOA 4BZ4A 1RITA 3N3HA 1ENRA 1QQP1 4G3YC 5GZGA 1B35C 1IKPA 3MFCA 1D2QA 3AKSA 2LALA 1YYNA 4PDWB 4Z2WA 3NV1A 4GMP1 4QQOA 5ACA1 5EFUA 1DG6A 2KA3A 1N47A 3JBG1 4Y1ZA 5E8AA 1GZWB 1AYN3 1YRZA 4XFAA 5DDJ1 1DBNA 1D2SA 5E89A 2HYKA 4HN1A 2F4PA 1LRHA 3W58A 3ZXDA 1QMJA 3AJYA 5FO7B 2W52A 4Z92B 3A0KA 2BPA2 3VKMA 1AL0G 4D3WA 5JMCA 4XTMA 4I01A 1LHOA 4QM9A 3ZYRA 1W6PA 2WQ4A 4PIXA 4BOWA 4I02A 3WT3A 2CWMA 2C1FA 2VQAA 4Q8KA 2D6OX 4H3WA 4XJAA 1RHI2 2XWJB 1H1IA 3VZLA 1W0PA 1UIKA 4YZ4A 4PLOA 5KHGA 4GQ7A 1B09A 1Y9QA 4Q0PA 2JJ6A 4MGKE 2HEYF 1OA2A 1WLTA 3FX3A 1O4YA 4C1XA 5BNNB 1C3HA 5DUVA 1ND3C 1S2BA 1NA1C 1VBC1 5F6KA 2PTMA 2DUQA 1SLLA 2K9ZA 5C8CC 1W6MB 3DL3A 4U36A 3WQ0A 2UURA 5CFCC 1COV1 2I45A 4DFSA 4COUA 1PO13 5HBAA 3VV1A 1V9U2 2YROA 4WV8A 3AP9A 1LOFA 3TWIA 3V65A 1AXYA 3RZZA 4DPNA 1VBE3 2XJUA 1RUH1 3VBFC 2H0VA 3O0XA