2YUEA

Solution structure of the neuz (nhr) domain in neuralized from drosophila melanogaster
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
168
structure length
168
Chain Sequence
GSSGSSGPLQFHSVHGDNIRISRDGTLARRFESFCRAITFSARPVRINERICVKFAEISNNWNGGIRFGFTSNDPVTLEGTLPKYACPDLTNRPGFWAKALHEQYCEKDNILYYYVNGAGDVIYGINNEEKGVILTGIDTRSLLWTVIDIYGNCTGIEFLDSRIYMYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein neuralized
publication title Structural and functional characterization of the NHR1 domain of the Drosophila neuralized E3 ligase in the notch signaling pathway.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Rna binding protein
total genus 17
structure length 168
sequence length 168
ec nomenclature
pdb deposition date 2007-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07177 Neuralized Neuralized
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.920 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2yueA01
2YUEA 5JI7A 5C33A 4XW3A 2YYOA 2LM3A 4N7UA 4P9IA 4QT6A 4B3NA 4B8EA 3ZO0B 4KG0A 5F6KA 4X8NA 4N7IA 4WVMA 3KB5A 2E63A 4V1PA 2IWGB 4P9LA 5JIUA 5F6LB 2WL1A 4WVMB 2FBEA 4X8PA 2VOKA 5JIAA 3UV9A 4P9JA 3TOJA 5JI9A
chains in the Genus database with same CATH superfamily
2DYCA 4MH0E 3A22A 1J59A 1XQNA 3GJAA 4GJZA 5FTTC 1HXS3 2E31A 3BCWA 4CEWA 1Q3EA 3A23A 4GMP1 3WDYA 1K5MA 1RUG1 3AMQA 3ECQA 1UW8A 3O0VA 3OD4A 2J1RA 4HOOA 5BNPA 3VBFA 1QEXA 2XJVA 2IXIA 3MIHA 4GQ7A 2WFF3 4IL7A 5L36A 1JZ7A 2YU1A 3S6PA 2XXZA 3T2QA 3VZLA 1G8WA 3LA7A 4QKDA 1GQHA 2J1SA 1OI6A 1OUSA 4LBKA 4YSFA 2WZR3 4YNIA 1UZ0A 1QDOA 4MGSA 1YNAA 5LBBA 1XU1A 1OSGA 4LULA 4KGQA 5J37A 1CGPA 5LA9A 3P3NA 4PBOA 3I97A 5A32A 4EWAA 3N3HA 1ZZ9A 1BBT3 1QNYA 2PHFA 3O0XA 3WP5A 5KXDA 1RUF2 2JWPA 2VZOA 3PVNA 5CBLA 4XVHA 1GANA 1OQDA 5F3EA 4GAZA 3NNFA 4AF9A 4EWDA 5LASA 1W9FA 5FLJA 3JBG3 3D3AA 4HZFA 4XURA 4PF5A 4LITA 4R4XA 1PIV1 4XBLA 3FBMA 3SH4A 4AFMA 1RUNA 3TB0A 4BMBA 1NA1A 3SMHA 4XJUA 1W6MB 2VTXJ 4CP0A 4JKKA 3POJA 4UF0B 2TBVA 2VVEA 2XBO3 3BOWA 4XMIA 3NAPC 5CZKA 4AI2A 4MOAA 2EXIA 4G4FA 2QQMA 4ZS2A 1RUE3 5HCAA 3S30A 2UY9A 1DYPA 5CISA 2VCCA 4OUSA 4A7KA 1F4AA 3CL1A 4ZONA 5F32A 2GP3A 2R6QA 3LZZA 5IUQA 3MUY1 1FNZA 2R7EB 3JXSA 1NUKA 1Y7BA 5FZ7A 2A6XA 1REDA 1RUD2 2FHRA 4IESA 4CDUC 1FV3A 1MS5A 5BNOB 3WG4A 3H50A 4JQTA 5K9YA 1BEV1 1GNZA 1UIKA 4XUTA 3IWZA 2VZPA 3J8F1 4KMQA 4LA2A 3VBSB 1MPXA 3K4ZA 4A41A 1JW6A 1LENA 2ZOEB 5D2AA 1LOFA 1Q43A 4XUNA 3V0AB 3VBUC 2XJUA 1QJY3 3CZJA 1VRH3 1OD3A 4QT6A 1SBEA 4QQOA 4CE8A 1WW7A 1YC61 4FFIA 4QKNA 3RDIA 2GC1A 1RUG2 1Z7S1 4YFWA 2D44A 1W05A 2KXLA 3D82A 3ZFEA 4AFCA 4BISA 1GZCA 1HIXA 3NJXA 1AF9A 4A4AA 4HVOA 1KD7A 2KM2A 5T54A 1UY1A 1AYM3 4A2UA 4AEDC 2XJTA 3Q8CA 4EN0A 4RSUA 4QX5A 1GQGA 4LKFA 2QQVA 4LBMA 1PGL1 1U5ZA 5IK7A 2RG4A 5IJRA 4AXOA 3DPRA 4C8DA 4MGIE 1W9WA 1VBD3 3I2HA 4NN0A 1MS9A 2C26A 3PJQA 2BVVA 1W39A 1RGSA 2GMMA 4WVVA 3NL1A 3G7DA 1WCSA 1ZX5A 3IB3A 3VLBB 4XJZA 3WNLA 2VO5A 4NVPA 4WV8A 2HWC1 2PELA 2I45A 1PK6C 3ZFFC 1ZBE1 3RQ0A 1WA6X 4E9KA 4YW7A 1PIV2 2OA2A 5EXOA 5C4WA 2Q4SA 5C9AC 3DECA 3BB6A 4AQ6A 1FMD3 4JDNA 4KBBA 3PURA 4Z92B 1K42A 1UOGA 2AC1A 3POFA 2YC4A 1PO13 3WF3A 3KSCA 2FZ1A 5KHKA 3PUAA 2HLEA 2XHKA 1W2OA 2E7TA 5F9TA 5JZGB 1GZ9A 2V4AA 4UFMA 1OMIA 3BIWE 4L11A 5DXDA 3Q8EA 4OLLA 1C4RA 3VDDC 4DXTA 2SBAA 4CSWA 1NKGA 3AP9A 2GN7A 5ABJC 1H6YA 1B35A 3ZIWA 2R073 2XVKA 1FOD1 1CD3G 4UFKA 3K4DA 2HYXA 5BV6A 3MIDA 4AI0A 3VBHC 3Q8FA 3KMHA 2X8KA 3ZIXA 1NXD1 4FXKB 4WM7C 1X9TA 3AYAA 4ASMB 1CAVB 4D6QA 5I0DA 1BEV2 2YDEA 5FOJB 3GZUC 4NPMA 4N43B 3MW2A 2XVLA 1FX5A 2ZEXA 3HQUA 3QBQA 4L8QA 3N7LA 5AC91 2W87A 1SLLA 4AVAA 1R093 2JDMA 2X5IA 4OUEA 1L7RA 4JCKA 3B9CA 4OHWA 3BVCA 4S2DA 3VHOA 3HD8B 1JHNA 1JYVA 3ES1A 3MIBA 1Z7S2 2ZZQA 4LO8A 2V4VA 2ZGRA 3W5MA 5BY5A 4E8DA 3BOPA 5K8SA 1OD5A 4XILA 4LBJA 1DQ6A 5JMCA 4QXKA 5BXXA 3WOGA 4FTBA 2DURA 4IGQA 2C0ZA 4IE0A 3BN6A 3CF6E 2Q8CA 4JAAA 1SPPA 3GDBA 3LEGA 2J1UA 4R9CA 4UFLA 5FPZA 3WUCA 1XNAA 4AEMA 4C1XA 5CFCB 5GM0A 4UWDA 3D0SA 1OOPA 1V6OA 3VL9A 3RZLA 2XPJA 2PHWA 2ADEA 1RB8G 1PGL2 2WS91 1NE4A 1YFWA 3MW4A 4AW7A 2BVBA 5FK7A 4HLTA 3MW3A 4RA0A 3AB0A 1ZZ6A 4FOQA 4QPIC 5L7OB 2WQZC 3GF6A 4XDOA 3FHQA 5K0UB 4PQQA 5FY4A 3RPQA 4C91A 2H0BA 1EPZA 1Z0HA 2OIIA 3LFMA 3WZ1A 2HWC2 4C1WA 1AR71 1ZBE2 2AENA 3K3NA 4R52A 3AMPA 3C3VA 3JZVA 4D8MA 4ET7A 2JD9A 2G19A 3ILFA 4IEQA 5KBFA 4XXAA 1GP5A 1JZ6A 5FY1A 1GKBA 4IV1C 4N9IA 1V9U1 4IGOA 4MO3M 2BWCA 4Y4RA 1LECA 4NHXA 1S2KA 3FFZA 4GH4C 5FZ1A 1HRV3 4BQWA 2ZEWA 4XBNA 1XYNA 1WW4A 5J09A 4AI9A 3DKWA 2C1FA 4QQHA 5A3TA 3OTFA 2IFWA 1F8VA 1OT5A 3U07A 3EMRA 3J7NA 3MFCA 3POWA 4KG8A 1RXGA 4COVA 3WW2A 1J83A 2QZ2A 2PFWA 5C4WC 5FYBA 5DABA 5CG9A 3GZEA 1FOD2 4NRPA 2J1VA 2VW0A 1WD4A 3LSEA 4Q4X1 4COZA 4UOJA 2FBEA 1QQP3 2ZABA 2OZ6A 1L7QA 1QXPA 4JX0A 1U5XA 3RNSA 1XPWA 1DG6A 1MQTC 4JGZA 4M3CF 5H9SA 1YQ5A 4CEYC 5AC92 4EJRA 5FQ0A 1O3RA 3ZDVA 4UAPA 2P3JA 1HB2A 2A3YA 2VY0A 5DG2A 1QJZA 3LOIA 4UW3A 1DZTA 2QTWB 5KWRA 4BJ0A 4TSVA 1F31A 1J84A 2Q0AA 3ZXFA 2ZMNA 1WW5A 4GWNA 2BFUL 1JUHA 3AXEA 1WA4A 2D7FA 3ZFGB 2A6YA 4Q0PA 5EWSA 3WUDA 5KXBA 1RYYA 4QX2A 3LPFA 1C1LA 1H2LA 2YGLA 1AHSA 1IZ3A 4M4RA 1SDDB 3R4UA 1QF3A 4ZU5A 3H1MA 2RS11 1AYN1 1SHWB 3FUOA 2G9GA 4P9JA 1QJU1 4UFIA 4QDQA 4EN6B 3ST7A 4Z2AA 3ZXLA 2WO3A 2Y6HA 1RVF1 4V2WA 1UN1A 3N36A 3ZVXA 2WS92 3GHMA 1UOFA 2Z69A 4CRQA 1G9CA 4M3CA 3K51A 3ZN4A 3S7EA 1UY0A 2ZXQA 4D6RA 3N4MA 2ERFA 3EJKA 4NIDA 4XQWA 4MGTA 2JG9C 5FV3A 1QU0A 1E5SA 4KGGA 4DXSA 3BU0A 1GZWB 1VE0A 1RUI3 1AR72 2C4XA 4PIXA 1CAXB 3KWVA 2OXBA 2FDJA 1FATA 3H8OA 1VMHA 4DEVA 4LHKA 5LBCA 1PHMA 1ULEA 2ADDA 1D4M3 4UXAA 1V9U2 2ZKLA 2BNNA 5A70A 5I0SA 1C28A 5IK4A 2W1UA 1DGRA 5FXVA 2HH9A 4QAWA 3OJBA 2ARXA 1LHWA 2VMGA 4ASKA 3CO2A 3O1PA 2CAVA 1YIFA 2ZGNA 2CDPA 4P9IA 5JLVA 1LOBA 5LRSA 4LT5A 1BXHA 4IE6A 4NHLA 2B9UA 1K12A 2Q1FA 4LEJA 4UI9L 1RUC3 4MGYE 3WDWA 3DYOA 1IG0A 3C7OA 5ISLA 1UY2A 3CQOA 3KD4A 1UZWA 3OUIA 1PM4A 1HQLA 3C7FA 4FPOB 5FBZA 3ROUA 3WVJA 1QDCA 1S2EA 3IDAA 4AEKA 2BWAA 1OUXA 1Y9MA 4RR3B 3TYJA 2ZGMA 1YO8A 4ES9A 1DQ4A 3O0WA 4Q4X2 1HQWA 5FMOS 2BQPA 3H8UA 4LE3A 4J25A 4CA9A 2YU2A 4QD2A 4LTAA 4Z07A 2JDNA 2QDNA 2ARCA 1XYPA 5A7WA 3OGRA 5C8CC 4Q4V1 1XSQA 1RIRA 1U5YA 5FJHA 2EAAA 2D3RA 2RJ2A 4CDWC 3RZGA 3NJYA 5FZBA 1S0GA 4FFHA 5I93A 1G9BA 1HB1A 1GMMA 2WZR1 3WT3A 3I4IA 3D0JA 2PAMA 3AJYA 1AJKA 4CU9A 3EO6A 3USSA 3WDUA 3HT2A 4LO6B 2VVDA 1WCUA 5ERLA 2WNUA 3AYDA 3JB8A 4DXRA 2Y60A 4WVMB 1UOJA 2GALA 5JXHA 1H9PA 4QX0A 3N9QA 4QPGB 2IXHA 4GB33 4Y1YA 3BIEA 4RFT0 5FUNA 1J3RA 4JRLA 2RS12 1AYN2 1RMU1 3I59B 4DQAA 1QJU2 2QQNA 4FAGA 1Q8VA 3SKVA 2R061 4IE4A 2EXKA 3RMYA 1RVF2 1SDWA 3JBG1 4XACA 5EFUA 4NIHA 2TEPA 4TYSA 2JIJA 4W6WA 2CU5A 4KBZA 4Y1VA 4GXLA 4HK8A 3ZPYA 3MFAA 2YMZA 5A1FA 5L73A 4YGEA 3IPVB 3H3UA 2Z42A 3B9IA 2QJVA 3LEKA 5JVVA 4LBNA 2A1XA 5DUUA 3UL2A 1NCQA 2XBO1 4AHYA 3LE0A 2VCAA 4DUVA 2YXSA 4U2AA 2UYAA 2RS53 3UYJA 4FPCA 1I6XA 1SBDA 4YZ1A 1I1EA 2WL1A 2B5HA 3PVEA 2R49A 4N53B 1URXA 5GZEA 3NV1A 3WF1A 1GU3A 5C3QA 4R9BA 3VD5A 4LO5B 5BNOC 2WSUA 5C3RA 3I2OA 1Q5OA 1W6QB 5GKAC 2IUWA 4CP9B 2RS31 2VQ0A 4NAOA 3APBA 1ZZ8A 4XPVA 5G05L 3VUOA 4HVRA 4M3CE 3IDCB 1C57A 4ORFA 2GP5A 1HX6A 5A7PA 3CMGA 4AE2A 1W99A 2K0GA 1IPKA 5FAXA 2XB6C 3ACGA 4QM9A 2VQUA 2VNOA 5T5LA 1ZVFA 3O12A 3V56A 4DINB 3U78A 4RQPB 4QXHA 2W5FA 1N1TA 3CKHA 1UL9A 1CJDA 1FT9A 3ZMOA 2ET1A 4IEXA 4XUQA 2F4PA 2W94A 4HN1A 2GNDA 2RMU1 5H9RA 5I8TA 1I5ZA 2A3XA 3OBZA 1N3PA 3KV6A 4IEWA 5FP9A 3ZSMA 2PQQA 3FBYA 4TTGA 1RHI3 2PN5A 1LU1A 4BXSV 1OVPA 3CJIA 1AR92 3ZR6A 4Y1UA 5F39A 4Q4V2 4JZRA 2DCTA 5IK8A 4HFSA 5F3IA 2QE3A 2ZMLA 1QWRA 5CNAA 2D6PA 3AZVA 4GJYA 1AYM1 3H0OA 1EAH1 4I0BA 5FYUA 3N7KA 2V5DA 4D7YA 1ZBA3 2BERA 3GGLA 4HXCA 2WZR2 5A33A 3VBOC 3WLUA 4CEWB 5FPVA 4F3JA 5A6ZA 1MS3A 1K5MB 4FOYA 2UURA 3HOBA 4YVWC 5BNPB 1W3XA 3VBFB 4IDZA 1GNYA 4XUPA 5FYIA 2PLV3 3SLIA 4AHZA 2ZACA 1TMF1 3MDPA 1F2NA 3E6BA 4FQZA 4KWJA 1XNKA 3MF9A 4OFGA 2WINB 1KXGA 1RMU2 3I7DA 1VBC1 5JCTA 5FYHA 2WFPA 2R062 5A3LA 3JBG2 4BMEA 1PMHX 2ID4A 3FHIB 2D5FA 3NNLA 4TLGA 1KGYA 2NN8A 1JTZX 5A32B 2WRAA 1QHDA 1GZTA 1JYCA 5T52A 1R64A 3M4FA 2WWSA 2VH9A 3DKQA 3W59A 4AZZA 4FTEA 3HNYM 3NQHA 3H42B 1OFSA 1V6JA 1ZRIA 4M00A 4YVSC 5FZIA 2P3KA 3T3YA 1QY4A 1TEIA 2B7YA 4FAHA 2J1AA 3JB4C 1NE6A 4OCTA 3MPPG 5IATA 3ZX7A 5FLIA 3EYPA 3HIFA 3NJVA 3T4VA 4AI3A 3PJYA 3ASIA 5L9VA 1S4CA 3V0BA 4BE3A 2RS32 1POV0 2ZTNA 2UU8A 1QXJA 1UNBA 1NA1B 1VPHA 2CNAA 3OBAA 4QPWA 4HT1T 4XDPA 5DDJ3 2SLIA 1QH6A 2C5DA 1FV2A 4NE9A 3TEYA 1O3QA 3TEZA 4Q4Y1 1HB4A 1J3PA 2FQPA 1DGWX 2HEYF 2ZGPA 2CTVA 4KWKA 1F5FA 2FDIA 2WO7A 1N3OA 4DOUA 5HBAA 1EV13 1HN0A 1LODA 2BBAA 4LR4A 1OA4A 1VBB3 2CWSA 2RM21 2O1QA 2WBKA 5SV5A 3J4UH 4AQSA 1S0JA 1WGPA 2QZ3A 5DZEA 2RMU2 4JTNA 4HPKA 4MLOA 1R083 3VN4A 2C9KA 1Q8QA 2NQYA 2DVAA 4G3YC 4EWEA 3FX3A 1VBA1 3JQXA 3O1MA 3FL7A 1BJQA 1ND3C 1H2MA 5LA2A 4YG0A 4FPEA 4YW3A 3URFA 1KFUL 4RHV3 2WJSA 2FCVA 1AYM2 1RJ8A 3L9JT 2R1BA 2J42A 4IETA 1EAH2 3CU7A 3UGFA 1DQ2A 3VD3A 3RMXA 4EYUA 4S2FA 3RFRA 3B01A 1KJLA 4AVTA 4DPNA 1POV1 5L7OC 3DXTA 1V6LA 2D6NA 2XDVA 2VUDA 3KB5A 5EYXA 5FPAA 5FMDA 1DF0A 2QNKA 3U1XA 3NAPA 1ZA7A 3ZFEB 5DPNA 4JRAA 1UO9A 4PF1A 3C7GA 4AOCA 1TMF2 5FZMA 4JKLA 3D5OA 3I59A 4H7LA 4MGQA 4Q0UA 1XBFA 4QXCA 4AI8A 1VBC2 1KFXL 1W6PB 5EJ1B 1R1A3 3NRUA 1TME3 3SISA 1IKQA 3USUA 4MXWA 4NWWA 5LA0A 4W4ZA 3U37A 1RINA 4BLIA 3IPVA 4CDUA 1H9WA 3Q9OA 4Q1RA 3BTZA 4JQRA 4I2OA 5GALA 1HRV1 2O8QA 1MS4A 5J36A 3AKPA 1C8M3 1SFNA 2IXKA 3GM8A 1HN1A 1LHOA 2J22A 2Y6LA 2FZ2A 4FCAA 4FPHA 2IC1A 1SBFA 4LE4A 1UPSA 3CIHA 3VBUA 2ZHNA 2G9ZA 3PUIA 4GMP0 3GNEA 1LR5A 2Z5WA 5C70A 4XFFA 2JE9A 5E6HA 3UV9A 1SEFA 2YC2A 5KHHA 1PMJX 3SXWA 3T2PA 3C7HA 4EN7B 4QU2A 2G1MA 2V09A 3ZSKA 2VUCA 4ZXEA 5B2GB 2VZ1A 3ZYJB 4PQ9A 4Q4Y2 5C3SA 2HYKA 3I2IA 2PHLA 1QQP1 4LBLA 1QXRA 1UZZA 5FY9A 3AZWA 4AEDA 1GP4A 1SLTA 4JHZA 4P9GA 5A7SA 2OUHA 2RM22 3UGGA 4J6GA 5FPLA 2DVFA 1SQ4A 1DGLA 1IOAA 5D8AC 3RRDA 1C1FA 1B35B 1WBFA 4U36A 1JYXA 3MIEA 1BVP1 2E9QA 4YW2A 2WAAA 4S2GA 2YPJA 3IDBB 4GKYA 5LY2A 4C90A 3THDA 2WIIB 1GYKA 3LDRA 1VBA2 2QVSB 3BALA 3WDXA 2J1TA 1AL23 5H9QA 3KZ4C 1UPIA 4OZXA 3B5LB 4B4QA 4Y5TA 3AKTA 4LLOA 2GC3A 2B46X 5A1LA 1LEDA 1ULOA 2BV4A 2VQTA 5EIYB 3K48A 2X5IB 3MLLA 4Q0QA 4Q8LA 5FMBA 4B4RA 3ME2A 1VBE3 1E57A 4COWA 3ZOIA 4DZGA 4K6BA 4Y5SA 1CESA 3U14A 4N7IA 1TQ5A 4NIIA 5KHJA 2IZWA 2V73A 4XIKA 5FKBA 3UT0A 1W9SA 1GWLA 1RUOA 1XC6A 2GNMA 1SCSA 1XNTA 4LUKA 4YZ5A 2A6ZA 3HT1A 4FO9A 4LOSA 2A6WA 4FI9A 4QX7A 1Y43B 4OQ9A 3GBWA 4CUBA 4EE2A 5A3OA 3VDDA 3FFQA 1K5JA 4PI0A 3O1SA 5ABJA 1LGBA 1SPPB 1OPOA 5HV0A 3M3OA 4MHRA 2W2IA 1UMZA 1OOPB 2HBUA 1V6MA 2NYYA 1PX4A 1OURA 2XJSA 2IVIB 3AX4A 2C24A 4URTA 4WM7A 5JWPA 1ND2C 2YV8A 5JSPA 1AR61 1JOPA 3ETPA 2VECA 2XQXA 1SFPA 1VRBA 1W2UA 4NIGA 1UU5A 2ET7A 2ZGSA 4COUA 3K3OA 3LWCA 2K9ZA 1O3TA 4MUVA 5FXWA 4BU2A 2ARAA 3Q8BA 1UYYA 4WZFA 2CGOA 5E1RA 4AVBA 1QJX3 2YGMA 4D7TA 1SLBA 4RR3C 1RUC1 2E6VA 2VOKA 4BQ4A 2DFBA 3LCPA 4RGKA 4CP2A 2IXJA 2CYFA 2HWE1 4XFCA 3SC7X 5IHRA 4BQ3A 2WN2A 3KV4A 2A73B 5G04L 5JR7B 2Z2SB 5JOXA 4NO4A 2H6BA 4GKXA 1W8WA 2EIGA 2AEZA 2AREA 4K21A 4XABA 4FBFA 1VB4A 4B7KA 2QKDA 1QQP2 2BU9A 3DXUA 1V00A 1MZ5A 3ZXAC 2VMIA 3MIFA 1H0BA 1B09A 1CJPA 2TUNA 3B94A 4PI2A 3WNMA 2AZ5A 4LK6A 3ACHA 1OHFA 4V2VA 3THCA 1YQ2A 1RUH1 4YM2A 5IVBA 3AP7A 2P6HA 2Q5TA 2FDKA 3OYWA 4YG6A 5SV8A 4UW6A 3MIGA 1HQNA 3O1VA 2C6SA 3FE5A 2YBSA 3X29B 5FZ9A 5FY5A 5A3PA 4W50A 1D0GA 5KXCA 2VQAA 4JGZB 2QQWA 2YYOA 3AKQA 1HV1A 2E51A 4LKEA 3BTAA 4OI4A 5FQ0B 2JG8A 4ATFA 5JSRA 1XB9A 3W58A 4XETA 3T2TA 2D3PA 1OPMA 2HWF3 1NAEA 4IV1A 2VBDA 4Q1PA 1OH4A 2K46A 3E5QA 1MEC1 1CN1A 2ZHKA 2R16A 1XU2A 4ZS3A 2JIGA 3AM2A 4GH4A 1OKOA 4IUGA 5HCFA 5AFEA 1O7FA 2WNVC 4Y5Z0 5IK5A 1ZRCA 1UU4A 1F5JA 2VAUA 3A0KA 1FAYA 5FYZA 1H8TC 3LA2A 4CDXB 2ZEYA 1W2TA 1W6PA 1W0PA 3DCQA 1G9FA 4BB3A 4EQVA 2C9AA 2R32A 2VMDA 1DQ1A 3VZMA 1QJFA 3EHKA 1WLCA 1NQDA 2VXRA 2GU9A 3KF3A 4XF1A 2DU1A 3VZKA 5JMOA 4Q4W3 5CFDA 4BIOA 5J3UA 5DQ0A 4M3CB 5BNNC 2MNGA 1AR62 2CHHA 1UYZA 2JEMA 1X9PA 1UY4A 5KC6A 2A5ZA 1MQTA 1H4GA 4BPZA 4GIQA 4K40A 2BOJA 2NMNA 3I3QA 3LFIA 4I09A 3PIJA 4AFDA 4K3UA 5FMOL 1J58A 4CTEA 3I3EA 4YARA 5FPXA 4CDQA 1NX9A 1FI2A 1RUC2 3AL5A 3LGRA 3PMSA 1LGCA 1W8OA 1UD1A 4XFIA 2VOVA 2HWE2 2WSVA 2XL7A 4W6YA 4ZHNA 4B4PA 3SCGA 5T55A 1CPNA 3JCIA 2Y6GA 2E33A 3KV5A 1F35A 1LU2A 1XE8A 5T5JA 2F6BA 3NW4A 5FLHA 3M1HA 3LDBA 1DQ0A 3FN9A 1H4HA 2XJQA 1KS5A 3ACLA 4N8MA 1H1MA 1ENXA 1H8VA 1RUH2 4DFSA 5JPMB 4QQPA 1K5MC 1P8JA 3O5SA 3RJRA 2CY6A 1ENQA 1OLME 4XE9A 3WD5A 4I01A 2UYBA 3GBFA 2NLRA 2PHXA 3J8F2 4RS5C 3TRSB 3LQCA 3NNJA 4OZOA 2VNGA 1PZ8A 2LROA 1CPMA 3DYMA 4KQ7A 4LKDA 5FPBA 2BNMA 3TN91 2GC2A 5A7WB 2PLV1 2RR13 3AL6A 1UQXA 1NZCA 3FZ3A 1JZ2A 3FLTA 2QDRA 1W06A 2BZDA 4BWOA 1PO21 3PUSA 5IVYA 3SCHA 5JXJA 4ARYA 1MEC2 2HEVF 3T0DA 5LA1A 2A7AA 2JDKA 3W5NA 2VXJA 2JKXA 3VBRA 4Y20A 3UJOA 3WW4A 1ZM1A 2DCYA 2WNUB 3HEIA 3OBTA 1BMV1 4JGYA 5F5CA 1RUJ1 2XLGA 3RWKX 2PMWB 1UAIA 3VHRA 3CZUA 4BH9A 1UWWA 4NHMA 5EPAA 5FYSA 4XF3A 5BUVA 2MPFA 1NA1C 2ZJCA 2B45X 5A80A 2FCTA 3NWKA 4PIZA 2WA4A 3WSOA 2EIEA 3MGUA 4LIVA 2R0FA 1VIWB 4L2NA 4RGGA 2P3YA 1TZOA 3FUQA 2AYHA 2NPIA 3VD9A 1AX0A 2WZEA 4LBQB 3W20A 3LDKA 5C8CA 1NCQB 1S2BA 3BYWA 2XKOA 3ZYFA 3PVOA 2VD7A 4KI5M 4YZ2A 1TVGA 1ZA4A 4A3XA 3WNXA 1C3HA 1EV11 5JXIA 5K7PA 3TOJA 3ZSEA 1C8NA 3B3QE 1PGW1 1IHMA 5EJ3A 5JSOA 3MV11 5C7GA 1U12A 4FT8A 4CUCA 2VG9A 2BPA2 2GMPA 4Y26A 2BDRA 2VZQA 4QB2A 4DS0A 1LOFC 2XUEA 4XBQA 5FPUA 3OY8B 4FOWA 1H1AA 1NY71 4IQPA 2HWD1 1UY3A 2VUJA 3K77A 3OB8A 5GZDA 2Q8EA 1JYNA 1BQPA 4BM8A 4BHPA 4RHV1 2PHUA 1NZIA 1AVBA 5F5QA 3PLQA 3I2DA 1RUF3 1X36A 2OQ6A 4QKFA 1CX1A 1W6OA 2YPDA 5DAQA 3MZHA 1AJOA 1DQ5A 5JOWA 1S0IA 1HRI3 1A34A 3I2JA 3VKMA 1Y9GA 2BGOA 2YUEA 1O8SA 2VCBA 3CJIB 3N9MA 2V72A 3TN92 2PLV2 2W9XA 2Z4FA 5C71A 4CUAA 1JXNA 3LAGA 4OI0A 1Z78A 2B8MA 3QH6A 4MSVA 1NLRA 3LIHA 1YEWA 3IMMA 3QH7A 1PO22 4JV4A 3DPRC 2MEV1 5A33B 1R1A1 1YFYA 2CDOA 1TME1 3QCWA 1GP6A 2DBNA 1X8EA 5KR7A 2E7QA 3P3PA 4XFBA 4E4ZA 1OQEA 2XLAA 4ARXA 4CDXA 3BGAA 3GBGA 5HCHA 2D3SA 3WW1A 4AFAA 1BMV2 1YHFA 1RUJ2 4EZ4A 3VHPA 2NMOA 4CXYA 4AGVA 5FBJA 5T50A 1NXMA 3ZDSA 3QLQA 5EV7A 4PLNA 2WNEA 1RUD3 3RVHA 3KGLA 3ZYRA 2FMYA 4N7UA 1IG3A 2TNFA 5A7NA 4XCAA 1CZSA 2QCSB 3FHAA 5LK5A 3H9AA 3J26N 2RV9A 4ZU4A 4F83A 1X7NA 2O8OA 2HEWF 5FP8A 3RS6A 3WNNA 4QWNA 2JE7A 4Q5OA 5DZFA 5FZCA 4MVTA 5ACA3 1ULPA 3TEXA 3DUIA 4QQLA 3FJSA 2WNOA 1WZXA 2B9VA 4YW5A 3JD71 2DCZA 3KQ4B 3HAGA 4AQTA 1ZRFA 1HDKA 2BRTA 1WMFA 1DBNA 2V5YA 2ZGLA 1ASJ1 1RUG3 1EV12 2P5BA 4W65A 5FFOC 4NWVA 3M2MA 3VBOA 4AL9A 1DLCA 4FFFA 5C6CA 4IV3C 4PDWC 4XF0A 4DXZA 1PGW2 4TN7A 1GSLA 3V0BB 5JI7A 1V70A 1WBLA 3NSTA 5ANQA 1OLQA 4YVWA 2LM3A 2JECA 4YRDA 5GLWA 2OKXA 3B93A 3FWEA 4XTPA 5L9BA 4R9AA 3EB7A 3ZXDA 2PQSA 2VMCA 4CZSA 5F6KA 1NY72 2VMHA 1NT0A 2HWD2 3LA3A 3WR0A 4YW1A 4D94A 2BGCA 2E63A 2ZPXA 4RHV2 2XONA 1MZ6A 1BKZA 1XNBA 3AP5A 2Y6KA 1EYBA 1HXS1 3OPTA 5FZ6A 4GULA 2RDNA 1U0AA 2OT7A 3VHNA 4P5HA 4DIQA 4HPKB 5IVJA 3HNBM 4IEOA 4QU1A 3O1TA 4XF9A 3ZYHA 2WFF1 5CIRA 3KT4A 5DUXA 2DCKA 4YVSA 1DDLA 4I30A 4L0PA 5FMCA 1PIV3 3OPWA 1I9RA 5FXXA 1O5LA 2VTXA 5EZWA 3QACA 4QB1A 4JTOA 5CU1A 1W0NA 1JYWA 1HJFA 3SNMA 1OOPC 1G9DA 1ZZBA 2MEV2 2VTFA 3ILRA 1R1A2 4DUXA 2LW8A 4YG3A 1X33A 5A3WA 1F4HA 4HONA 5IVFA 1QKQA 3FLPA 1JS9A 4HBNA 1BBT1 2D98A 3C2UA 4GD4A 4TXWA 5FJKA 1MZEA 1G6NA 4KU8A 3SKJE 4B1MA 3NAPB 4Y3OA 1WLTA 2ZA9A 2ZX2A 1MZFA 5DUWA 1YWKA 2VW1A 2XR4A 4OHYA 1FPN3 2O0OA 4D0QA 5HXMA 3LEMA 2P37A 2UY8A 4J1WA 4OMDA 1BEV3 1DFQA 1TNFA 4A42A 3USUB 3DYPA 4UBHA 4MXWB 4UYBA 2G4IA 4CDUB 4D3WA 2B4KA 4LBQA 5GZFA 3OPZA 3KGZA 4GWMA 4WM8A 4NHKA 5FP7A 2GC0A 4Y4YA 1FXZA 3H8RA 2OUJA 2VW2A 1UMHA 2Z79A 3JD72 1RL3A 4LLFA 3U11A 4CPBA 1RUE1 1CR7A 3GZAA 1QOSA 1ASJ2 1SLCA 2RHPA 2WQ8A 1Z7S3 3C8XA 3VBUB 2QQIA 3ZSJA 2Y6FA 3WEZA 2D5HA 3IN9A 4RL7A 1Y9QA 2BNOA 1TNRA 1OA2A 4OHVA 1QIQA 1W8FA 1NCRA 3UKVA 4BXFA 4DUWA 3MICA 5DAXA 3I54A 3I3BA 2KD7A 3PMEA 3VBSC 2P3IA 1OVSA 4QX8A 2DUPA 2XOMA 1I5PA 4PT6A 4B29A 4ZZ8A 4BCUA 3OY8A 1ZYBA 4JVAA 2EA7A 4DNYA 3BKZA 2VZUA 3N9NA 2AH2A 4AEDB 4HETA 2OYZA 1QJY1 3SH5A 2YBPA 2NZ9A 3VKOA 1AX2A 1HXS2 1VRH1 2WLQA 3T30A 3HBKA 5A7OA 2ZKNA 3BODA 4K1ZA 2IFRA 3HMYA 5IVCA 3ETQA 5HXVA 1QH7A 2J7MA 3BPZA 3WQ7A 4QGMA 3WQ0A 2P4EA 2WFF2 4LJHA 4YWAA 4BQXA 4XIOA 4Y33A 4NRQA 5KHGA 3HQRA 1VLNA 1MS8A 5FREA 1S0CA 1PK6B 1CAUB 4IEYA 4QGNA 1YCIA 1GOGA 3FLRA 4M0HA 5BPXA 2CSGA 4IGPA 3WG2A 1VJ2A 1ULFA 2IWGB 4H55A 3PTYA 2D93A 3LPGA 4META 1VBD1 1BBT2 4ZKTB 1ENSA 4X8PA 3WG1A 2YB7A 2VOTA 3AMHA 4M01A 3KF5A 4Q8KA 1DZQA 1BLZA 3RWNA 2VJXA 3SEEA 3CJXA 5DAPA 2VMEA 1GBGA 1FOD3 3D4KA 3U10A 4A6OA 1HJGA 1N1SA 1TE1B 3F95A 4NAMA 5I8SA 5LW9A 5LBFA 3VDDB 2RDQA 3F2ZA 4HKOA 3IZOA 5ABJB 2YY1A 1BVVA 3V64A 2BTVC 4K20A 3LD8A 5FP4A 3O1RA 3R6SA 2WN3A 1MR5A 5JZGC 4WM7B 4YZ3A 3DL3A 1FMD1 3A7QA 1H30A 2GMEA 5AC93 3IKWA 3RGBA 2R043 3T0BA 1F15A 1GOHA 1NOVA 2XBO2 1PO11 3BTYA 3POSA 3S57A 1UCXA 3H3ZA 3FC0A 1RUE2 1O4TA 2WYFA 1CONA 5IFPA 3ITQA 3OG2A 3VKFC 3POGA 3L2YA 2QQOA 4LQRA 4PJYA 2VNVA 3E1F1 3B02A 2XH6A 2R071 3WQBA 2GNBA 2GDFA 4BK4A 3OGSA 1XOYA 4N43C 2VM9A 3IM0A 2XLFA 5D21A 4FQ4A 2LRPA 4LIUA 2OW4A 4P02B 3VD7A 3ORJA 2XHNA 4BIFA 4RD7A 2WQ4A 5FZ4A 2PAKA 1WCDJ 3NNMA 2LS6A 1LKNA 3WCSA 4Y1ZA 3PUQA 3NV4A 3DN7A 1R091 2X29A 1QJY2 4O9EA 5FIXA 1OLRA 1C5IA 1VRH2 1YFXA 5FZLA 1DP0A 2DTWA 2PXJA 1W6NA 4D7SA 4FPJA 4COYA 1V0AA 4I3GA 4FXGB 4YW4A 3R05A 2A3WA 3AKRA 1ND2A 3OYWB 1ZZ7A 4BDVB 2D6KA 5GZCA 1BK1A 5A6QA 2BBVA 5FWEA 5C33A 4QPIB 1YIPA 2VPVA 1K45A 2ZS6B 5CFCC 1XXNA 4QGLA 2VMFA 3B69A 1NLSA 3HWJA 1WWYA 5DG1A 4FVVA 2Q8DA 3WNPA 4D69A 3DV8A 2E32A 1V9U3 4A6SA 2JG8B 3OGJA 3P6BA 3VKNA 5FK8A 5FO9B 3M7AA 2XL9A 4FSJA 4YGDA 5A1AA 5FO8B 1AR83 4IV1B 1SMVA 4V1PA 4ATEA 4CYDA 4P9LA 5K0UC 1UKRA 1VBD2 3K4AA 5IWFA 4GH4B 4Z2WA 1S55A 2VOXA 4NPRA 1S1AA 4CCNA 1GWKA 1NCQC 2ES3A 1DCSA 2QQLA 3AZYA 3K46A 4EZHA 2DTYA 2E53A 2A70A 2WT0A 4LO7A 4YW6A 3J7HA 1L7LA 4UW4A 4NOTA 2CGNA 4IERA 4Q4X3 2IXLA 5GZGA 5CADA 4IW3A 1GOFA 4WVZA 2YROA 5FO7B 3LOBA 5CKQA 2E26A 2HKXA 1W9TA 3R4SA 2VBPA 3ABZA 4HSLA 1FMD2 1W8ZA 4QMAA 5B4XA 4E27A 5CFDB 3VDBA 4NHYA 4W6XA 1LTEA 4AG4A 5KC5A 3T2OA 1PO12 1LAJA 3ALQA 5BNQA 4P14A 4M0NA 5F2WA 3AK0A 1MQTB 2EICA 2OQ7A 2ZX4A 4LOTA 3W21A 3WHTA 4CEYB 1XE0A 3ES4A 3I2KA 5LATA 4YM0A 4X6QB 2QQJA 3NJZA 1OF3A 1OA3A 3H3LA 3PTRB 4WZCA 4CDQB 2R072 2XVGA 2ZAAA 5CEHA 2W1SA 5FP3A 4HKLA 3TEWA 1WMEA 3EQEA 1A8MA 2WNVA 4B7EA 5CG8A 4YM3A 1K3IA 4Y22A 4IXLA 3OBRA 4WBBA 4XTMA 4QHZA 1N47A 2L9LA 1BHGA 2RS13 1AYN3 3WW3A 1H8TA 1J1LA 1HRI1 4OHXA 3BPSA 3N7MA 2EIBA 1W8NA 2NP0A 3CHXA 4K8RB 1LGNA 1RVF3 4NRMA 3HR9A 3WX5A 5CKNA 2Q1MA 2VZ3A 3E5XA 1R092 4E8CA 1LNSA 4OYUA 2X09A 4AHWA 1NQJA 5CVRA 2AUYA 3MF6A 2DU0A 3ZFGC 2D6MA 3HPNA 3AVSA 2W91A 5FDBA 1XRUA 1YYNA 3KLSA 1IGOA 2W39A 5FZAA 4Z82A 5BNNA 5DUVA 2QQPA 2BJSA 4BLJA 1FNYA 5LEKA 4K9SA 3D8CA 1XYOA 5C5TA 1SACA 1SZBA 4QDRA 1PK6A 3ZFFA 1CAUA 5HPOA 2WZ8A 3CNAA 2Y8KA 1R1ZA 2ORXA 3OF1A 4I0WB 1YUDA 1ST8A 5C9AA 3WV6A 3M3CA 3RYKA 2W47A 5CB7A 1N3QA 1RUD1 2YBKA 2JKBA 2ZGOA 4ZU7A 4GWJA 3WF4A 2E7AA 4XEZA 2G9FA 2ZBJA 2Q30A 2ZHLA 2XJRA 5F2SA 1EP0A 4JHTA 5AFBA 3VBRB 3NKGA 4Y20B 5CKMA 2Q8OA 2D6LX 4XUOA 5ACA1 2WDBA 2Y0IA 3HN1A 3ON7A 4R4ZA 4JGYB 1AX1A 5FY8A 1RUI1 3U4SA 3WY6A 2Y6JA 3ZXEA 1GWMA 1W9YA 3O14A 1WKYA 1JZ8A 4RYDA 3VBHA 3IIAA 1AUYA 1JMUB 5FY7A 4E4HA 4FPLA 1UIJA 2GSYA 5FWJA 5FYYA 1D4M1 3ZLIA 1AR93 1UYPA 3N9LA 1S0FA 1COV3 3POIA 4OHZA 5IVEA 3UKTA 3TAYA 4QHBA 1OC1A 2PTMA 1HRV2 4KNCA 4Q4V3 4RS5A 1HV0A 2F4LA 3POYA 1W04A 3WXPA 4RN5A 3ZXGA 2DV9A 3LSDA 5FZDA 3MI8A 4Z1VA 4Q0VA 5C8CB 1AXZA 3THTA 1GQPA 4C0HA 1AXKA 5H9PA 3PHMA 4CDWB 2ARBA 3ZN5A 4PLMA 1W8TA 3M70A 1OLMA 4FFGA 3E6CC 3ZR5A 1OFNA 1VAKA 1JU4A 5AVPA 5AVAA 5F3GA 4IEPA 3H8XA 1LRHA 3PVBB 1IS4A 2P6CA 3POEA 1VB2A 4YGBA 5T3NA 4TZDA 2ZGQA 2ZGTA 4KG0A 3WHUA 1RMU3 1HRI2 3I3DA 1D0HA 5F7UA 1DLLA 3SCFA 2R063 1WMXA 3RG0A 3HBZA 2GH8A 1H2KA 5L19A 1O91A 1EUTA 5A7QA 1AZDA 1GR3A 1NLQA 5DAWA 5F8PA 4AVVA 3RZZA 4BQ1A 4AAPA 1NG0A 1KDKA 4GA9A 1W6OB 2D97A 4QPIA 4H3WA 3S0MA 4PLOA 4QPGC 3RYPA 4LBOA 3WP6A 3ELNA 4X6RB 5A6XA 1DYKA 3U75A 3POBA 4GB31 2EXJA 4XMAA 5FZ3A 2HWB3 2PHDA 2RS33 1FPN1 2OX0A 4Q26A 1RJ7A 5JXGA 3NO8A 1O59A 3G6JB 4PCRA 5APAA 1PNFA 1XJAA 5B4NA 1D4VB 3E5UA 5IAVA 2KA3A 2UWAA 4GZ9A 3TWIA 3ZYPA 4CCEA 2LALA 1UKGA 1A8DA 5ACA2 4E2QA 2RDRA 2QQUA 4N53C 1ZZCA 4YPJA 2VBBA 1RUI2 2BP6A 4HL0A 1O5UA 3KQRA 3AFKA 1XNDA 3ZSLA 2RMU3 2RS51 4XHBA 4DRRA 1JBCA 3I3MA 5EQUA 2AGSA 4XFHA 5E8AA 1GNHA 2RJLA 2OPWA 5FZOA 4ZXKA 5E88A 1QOOA 1JYIA 1QGLA 1D4M2 2ETEA 2DCJA 2WZPP 4BQ2A 3DF0A 4AR2A 4RQPC 3H1WA 2WA3A 4C0BA 5FOBB 4CEYA 5F1RA 2JDHA 1ULDA 1EAH3 3Q8AA 2OZJA 2JJ6A 3U0ZA 4CCDA 2HBTA 3IIIA 2WABA 5FYMA 3LB9A 4XYXA 4OI1A 3SQOA 4CCMA 1PVC3 2BOIA 4MX3A 4KWUA 3VBOB 2VU9A 1WD3A 3HN3A 4CUGA 1H2NA 1LEMA 4LXLA 4XQDA 2WWJA 3AMNA 4XQ4A 3MLJA 1TMF3 1BYHA 2VE1A 3KHBA 4LHNA 4YVWB 1LOGA 1A3KA 5L9RA 3GJBA 1RHI1 2PAEA 3MBWA 4LHSA 4XJAA 2PYTA 1VBC3 5FUPA 1JYTA 1J1TA 2XGXA 4XOGA 2XWJB 5J7MA 1W03A 3KV9A 3CBNA 2R0HA 2W1QA 3OOXA 3VKLA 1M06G 4CEWC 3WG3A 3KM5A 2ZAHA 3MPBA 3OCPA 1X8MA 2H0VA 2MHFA 5BNPC 3GHNA 1YJLA 4A7YA 3VBFC 1ZBA1 4AK3A 4CCJA 3O7OA 4L97A 4K7JA 3RYRA 3TNPB 3ZN6A 2WT1A 4R9DA 1YI9A 3THPA 2BEOA 4XJ8A 2XUMA 4HSJA 2JG9A 2VCMA 2CAUA 4XFGA 1UX6A 2AEYA 2JICA 4XAAA 1OF4A 1PX3A 5CYYA 1PZ9A 3CEWA 2VUAA 1ALYA 2BUKA 4FPKA 4KWLA 4YVSB 3ZO0B 3NV3A 4GB32 3AZZA 4NROA 4LUMA 2CV6A 1ODMA 2ILMA 2RVAA 4P5YA 3ZYBA 5D1IA 1FPN2 1LHNA 1LHUA 5E16A 3WNOA 1S0BA 4IV3A 4PDWA 1Q8OA 2I07B 4Q27A 4DEQA 4Q4Y3 3ZM8A 1V6NA 1PGSA 1ONAA 2HJIA 2WT2A 3SHRA 1DHKB 1CQ9A 4AYUA 1KRIA 4DY3A 5JIAA 1X50A 2EXHA 1IS6A 3CDZB 2RM23 3SH3A 2R041 4CU6A 4CCOA 5HV4A 5I0RA 5IFTA 5FYCA 2WKKA 1H6XA 3KVBA 2W95A 2XQRA 4XC9A 3NMBA 2RS52 2X05A 2D6OX 2ZZJA 1Q56A 4B3NA 5E89A 2OPKA 1VBA3 5IVVA 2ORZA 2EALA 1IQAA 1JH5A 3PU8A 2VC9A 1DIWA 3SITA 4ZPIA 5DDJ1 4GWIA 4SBVA 3AVRA 4WM8B 5HCBA 1C5HA 1ND3B 2JB4A 1E5IA 4CDWA 1RXFA 2BW8A 4EROA 3NVCA 1G86A 3PNAA 1YJKA 1M4WA 3JU9A 1W2NA 3H7JA 3W9AA 1N1VA 1VBB1 1POV3 5FKCA 4B1LA 1XE7A 3WCRA 5F5AA 1REFA 1LCLA 1KS4A 2CGPA 3J7LA 1OH3A 1NCRB 1R081 4K1YA 4AVCA 2VR4A 1RHI2 4R8HA 4CP1A 2LUWA 2WO1A 1LULA 3AZXA 3MHZA 5GLUA 1VAVA 4OVEA 2JG8C 2UWCA 5A3UA 1Y4WA 3B7MA 4K8FA 1GUIA 2P2KA 1W6MA 2W0XA 3EXUA 5C3OA 4UF0A 1ZBA2 3ZFEC 1F9KA 3E6DA 5C8WA 3GZTB 3K75B 2Y34A 5GLVA 5LWBA 3UNPA 3S5AA 3LF7A 4QXBA 1AR81 4L92A 2Y26A 3S7IA 1YI7A 2KR2A 2JE8A 4LNVA 1ULCA 3A4UA 4CXWA 4CVUA 2W08A 1QMJA 2WR9A 4H2AA 4BOWA 2XMLA 3WP4A 2QFEA 2DVGA 4IE5A 5BNOA 1ZRRA 5K4LA 4O9GA 4BK5A 2Y33A 5CFDC 1QNWA 5A3NA 4DRVA 4LO4B 5GLTA 3VBSA 3JQWA 3GYDA 4D6SA 3RZMA 1O6UA 2VZVA 3V0AA 1LOEA 2EAKA 2JDYA 2R042 1WW6A 3WDTA 4EV0A 5DAVA 1UYXA 2EF6A 1C8M1 1S0DA 2X53S 1L3JA 2XWBB 3KHCA 1G7YA 3UETA 1YQ8A 2B39A 4XZUG 4CDQC 1E5RA 4E4DX 5D8AB 4B8EA 4CCLA 2GN3A 2W46A 4QHOA 1GLHA 3I2FA 3VV1A 1POQA 3PL0A 2VOWA 2DF7A 2Y38A 4QB6A 3EBRA 4NJ4A 5FZKA 3O1UA 4YM1A 4I0AA 1STMA 1KQRA 1Q8PA 1YQ6A 3VZNA 3VZOA 2YFZA 5C5UA 5LZ6A 2YG0A 5DDJ2 1A78A 5KXEA 4HKWA 1PNGA 1DGWA 3ENRA 4M4PA 4JC1A 3INAA 4GMP3 3CLPA 4ONUA 1B35C 2CL2A 1SFYA 3HNMA 4G9SB 1E5HA 5LY1A 2JDAA 1VBB2 1JHJA 1ZRDA 3ZXJA 3VZJA 4NIAA 1ENRA 4IEVA 3HQXA 3OEBA 1SCRA 1EUUA 4I3PA 1R082 1IS5A 4TWTA 1HLCA 3RI9A 4NPLA 1AL21 5JUVA 1JZ4A 3OD0A 2X5IC 3T0AA 1V6IA 1AL0G 3OEAA 1UX7A 3OUHA 2YZ4A 1EPWA 2ZEZA 5EYYA 4F8AA 2ATFA 1KEXA 5BYNA 1SLAA 2FCUA 1CAWB 1CX4A 3D6EA 3ILNA 3N7JA 4P9YA 3BUCA 1SG3A 3N9OA 1VBE1 1AR63 2JDZA 1W6NB 4FP2A 3S5QA 3T09A 1LESA 1D2SA 5TSWA 1HB3A 5JZGA 4P08A 1AR82 1Q8SA 2CWMA 1ND2B 3VBRC 1WMDA 3JUUA 3H7YA 4JGYC 1WLDA 2VZRA 4QDSA 5FCCA 2YFUA 5DN2A 3IAPA 4BQYA 2HWE3 1XSRA 1YLLA 3IT8A 4Q2FA 4BQ5A 1AXYA 2XJPA 1HW5A 4OI2A 2EIDA 1JI6A 1VAMA 4AWDA 2R30A 3P5BA 1CAVA 2QBXA 1TME2 1WCKA 4KH9A 4Q0SA 5JIUA 3OGVA 4N43A 3QD6A 1ODNA 3ATGA 2UWBA 3MO4A 5FZ0A 3VL8A 5LK7B 1A6CA 1RITA 1D7PM 2VULA 2ZGUA 1O3SA 1AR91 2IXCA 1COV1 4A7ZA 4LMFA 3ZYGA 4ISRA 2D43A 3GCWA 3L2HA 1C8M2 4AAXA 1RUH3 3I8TA 4TLFA 4XJWA 4O65A 1W28A 4IE7A 1MVQA 1MACA 4MGZE 3TNQA 1QJX1 5GJ6A 1UMIA 1IPSA 5FZFA 4RGAA 1GFF2 2VVFA 1T2XA 3J8F3 3VGIA 4A44A 5LCWL 1Y3TA 5FZGA 1US2A 3ZYIB 5LB6A 4UT5A 3MUZ1 4OMCA 4W8JA 2PHTA 2ZX1A 4GALA 4AFBA 1KITA 4LPLA 2I2SA 2K2SA 1ND3A 4YFZA 2ZMKA 3N35A 4BZ4A 1UXZA 3WINE 5CFCA 3ACFA 5IT6A 4P00B 1US3A 1MEC3 4XZPA 4YGCA 3VB9A 3KVAA 3WNKA 4HMZA 4MV2A 4AGRA 2JX9A 5FY0A 2QUOA 4XF4A 4H14A 4XJ9A 2OS2A 3KS7A 4LA3A 4JDMA 5L7OA 1RTVA 4UFJA 1CVNA 5K0UA 4QX1A 3VD4A 3NNGA 3KT7A 4UW5A 2IVJA 3WQ1A 4JGZC 2JENA 3MV01 5LRRA 1ACCA 4CU8A 2WNVB 4NR1A 4BA6A 2N7GA 4Y22B 1AL22 4N9HA 3ZXKA 4XXPA 3LEIA 1H8TB 5IYYA 2YC0A 3I2GA 5EP9A 1CIWA 2WWUA 3WDVA 2B42B 4P9XA 4Y24A 4YZ4A 1UZVA 1QOTA 1OXCA 2P1BA 2EVXA 5FYTA 4URAA 3WF0A 4OQ8A 2ZHMA 4BYYA 1VBE2 1O4YA 2HWB1 2ZCWA 2HWF1 5I0UA 4O61A 1W2AX 1IS3A 4HANA 4PIYA 2HWC3 4KL1A 2Y0OA 4CDXC 1UOBA 1VR3A 1ZBE3 2W3JA 5BNNB 2Y64A 3QOPA 1YRZA 1FYUA 3IMNA 5ANNA 3RI8A 5A6YA 2X10A 2W92A 4PHZA 4A45A 5I8YA 2P34A 3ZMNA 2FD8A 3ZFFB 2JB8A 4AEJA 2DVDA 2DFCA 5JDBA 5J48A 3PDQA 1RC6A 3ZPOA 2WUHA 4LHLA 3UGHA 2Q1ZB 4RFRB 5C9AB 1LOAA 2BYVE 5F6LB 3M8LA 3PIGA 3R4DB 4HG6B 4Q4W1 2VZSA 3AP6A 4IEZA 1COV2 4YYOA 2QQKA 3I49A 4CCKA 2XG3A 4Q29A 3UKNA 5J96B 1REEA 4FOVA 1YFUA 4I02A 3T1LA 1JUIA 3T08A 1PZ7A 1OQ1A 1BK0A 3PU3A 4E2GA 1ZREA 5D8AA 5T5OA 1QJX2 5EHDA 2VZTA 2VL4A 1VMFA 2WLPA 3AP4A 5LEJA 5JOZA 3ZFGA 1DU3D 5FZ8A 3VBHB 4YLZA 4CCCA 3C7EA 4DO0A 4E4SA 3O1OA 3NV2A 4IEUA 1PVC1 1SLIA 4UBGA 3M3IA 1ZNPA 3UESA 3AKSA 5DMYA 5FRAA 3TN93 1OKQA 2GH2A 1CZTA 4RS5B 1OBNA 5FUIA 2W68A 5DZGA 3MEPA 2BGPA 3T1MA 3LIGA 1PO23 3K2OA 3HVDA 2YHJA 5LBEA 1YXWA 4Y1XA 3UK9A 3ZKUA 1BCXA 2WAOA 3DEMA 3WP3A 2I74A 3OUJA 3BTXA 3PUHA 4JDOA 4ZZ5A 1MS0A 4AHXA 4MHUA 2J1EA 4EN9B 2F17A 3P1IA 4L99A 3ZKYA 4FPFA 3IBMA 1KJRA 3AMMA 1QJEA 1I3HA 2DUOA 2RE9A 2PA7A 1GZWA 1RUJ3 2W1WA 3BU7A 4QM8A 4FPGA 4DMIA 1CAXA 2BFUS 1UXXX 1N1YA 5FZEA 1HKDA 2AR6A 2RDSA 3ACIA 3B00A 4E2SA 3RZHA 4FP3A 4KU7A 4O7XA 3E97A 4A3ZA 4CU7A 2WS93 4XAEA 1CAWA 4XFAA 1KDMA 2RR11 1GICA 4NMIA 1S0EA 1JU3A 2HWB2 3SEPA 1PVXA 2HWF2 5J1XA 4QKBA 5FZHA 2GAUA 1JOBA 2WNUC 1UF2C 3AYEA 1JZ5A 4ITCA 1VMJA 4INDA 2JDPA 1AR73 5C3PA 4QQ2A 1BZWA 2WYSA 3M3EA 3A21A 2LTNA 2GNTA 1GV9A 1H1IA 1LJ7A 2FDGA 5HI0A 2ZX3A 1DYOA 1O4ZA 3M3QA 1TG7A 5I91A 4L9BA 2GZWA 5KHIA 2DVBA 4RR3A 3A0NA 4MZUA 3AFGA 3U4XA 3KT1A 5JAXA 1CIYA 3N9PA 4JKMA 1NYWA 5J98B 1W8UA 2OVUA 2FMDA 2AACA 2ZGKA 3RZKA 2R1DA 2JXAA 1UZYA 1DZRA 4UFHA 4WVWA 3V65A 4XCBA 4HK9A 4Q4W2 3VDCA 3KCCA 2VGDA 4WM8C 4XDQA 4DY5A 4ZY9A 3LKJA 3NKTA 2HWD3 5I0TA 3J7MA 2P17A 3KCXA 3WF2A 2RJKA 2ZX0A 3J9SA 4MYEA 1U5IA 2A75A 3HJRA 1W90A 1IKPA 4ES8A 2A71A 2PHRA 1UU6A 4SLIA 4AVSA 2FDHA 4J1XA 5FYVA 5FZOB 2O14A 1W0OA 5F37A 1XNCA 4QPYA 1NCRC 1PVC2 2D40A 4WVMA 1J3QA 1LHVA 4F7ZA 5JPNB 3IDEA 3GCXA 4QPGA 1DGRN 5T5PA 1T6BX 5JR2A 3TBDA 4FTSA 5CAZA 1V6KA 1MS1A 5M0TA 2JDUA 1LOCA 5CA6A 4LORA 4HN0A 3T4HB 4MXVA 3AYCA 2MEV3 1IPJA 3AJZA 4QX3A 3H1YA 2NM1A 1O8PA 2H6CA 1JOJA 2A6VA 2ENRA 4H7MA 4XW3A 3VDAA 4AI1A 4EN8B 5A3MA 1CWPA 4NUBA 3DPRB 4PBPA 1RUF1 3CJIC 1PM7A 2DBIA 3OGGA 1G9AA 1D2QA 4P9WA 1WUVA 3OSDA 4AQ2A 3DGTA 1JODA 4X8NA 5JOYA 1QJU3 3BI3A 1YQCA 1JN2P 1WCQA 3GXUA 4N53A 4N90A 5GLZA 4MADA 4MG2A 3IAQA 2JD4A 2RR12 1W3VA 1LB2A 1W6QA 3RZJA 4CP9A 4LKSA 1W8HA 3AXDA 5C4WB 2XKPA 5F5IA 3GALA 3RJ2X 1ULGA 3KCYA 4LK7A 4HVQA 1IQDC 4OULA 4Z8BA 1VP6A 1VALA 4FPYA 1APNA 3ZN6B 3JD73 4RQPA 3UJQA 4XHXA 1EY2A 2JG9B 3MYXA 3RSJA 4AGGA 1ASJ3 3FMGA 4S2HA 1T6GC 5IW0A 2W52A 3R0RA 2WC2A 5IAXA 4OUMA 5FXZA 2WO2A 4MGKE 5FR3A 1PMIA 1WLWA 4LBQD 4CXXA 4ASLA 4IV3B 4ISQA 2DWRA 4PDWB 5EJZB 5F3CA 2DUQA 1JZ3A 1X82A 3MLKA 4DB5A 2DDUA 1CZVA 2VNRA 4CPBD 1MVEA 2FDFA 3AC0A 5JI9A
chains in the Genus database with same CATH topology
2DYCA 4MH0E 1J59A 1XQNA 5FTTC 1HXS3 3BCWA 4CEWA 1Q3EA 4GMP1 3WDYA 1K5MA 1RUG1 3AMQA 3ECQA 1UW8A 3O0VA 3OD4A 5BNPA 3VBFA 2XJVA 2IXIA 3MIHA 4GQ7A 2WFF3 4IL7A 5L36A 3S6PA 3VZLA 1G8WA 3LA7A 1GQHA 4LBKA 1OI6A 4YSFA 2WZR3 4YNIA 1QDOA 1YNAA 5J37A 1XU1A 1OSGA 4LULA 4KGQA 1CGPA 3P3NA 4PBOA 5A32A 4EWAA 3N3HA 1ZZ9A 1BBT3 1QNYA 2PHFA 3O0XA 3WP5A 5KXDA 1RUF2 3PVNA 5CBLA 1GANA 1OQDA 4AF9A 4EWDA 5FLJA 3JBG3 4HZFA 3SH4A 4PF5A 4R4XA 4XBLA 1PIV1 3FBMA 4AFMA 1RUNA 3TB0A 4BMBA 1NA1A 3SMHA 4XJUA 1W6MB 4CP0A 4XMIA 2TBVA 2VVEA 2XBO3 3BOWA 3NAPC 4AI2A 2EXIA 4G4FA 1RUE3 5HCAA 3S30A 2UY9A 1DYPA 4OUSA 4A7KA 3CL1A 2R6QA 3LZZA 5IUQA 1FNZA 1Y7BA 2A6XA 1REDA 1RUD2 2FHRA 4IESA 4CDUC 1FV3A 1MS5A 5BNOB 3WG4A 3H50A 5K9YA 1BEV1 1GNZA 1UIKA 3IWZA 3J8F1 4LA2A 3VBSB 1JW6A 1LENA 2ZOEB 1LOFA 1Q43A 3V0AB 3VBUC 2XJUA 1QJY3 1VRH3 4QT6A 1SBEA 4QQOA 1WW7A 3RDIA 2GC1A 1RUG2 1Z7S1 4YFWA 2D44A 2KXLA 3D82A 3ZFEA 4AFCA 1GZCA 1HIXA 1AF9A 4HVOA 1KD7A 2KM2A 5T54A 4A2UA 1AYM3 4AEDC 2XJTA 4EN0A 4RSUA 4QX5A 1GQGA 4LBMA 1PGL1 1U5ZA 5IK7A 4AXOA 3DPRA 4MGIE 1VBD3 4NN0A 1MS9A 3PJQA 2BVVA 1W39A 1RGSA 2GMMA 4WVVA 3NL1A 3G7DA 1WCSA 1ZX5A 3VLBB 4XJZA 4WV8A 4NVPA 2HWC1 2PELA 2I45A 1PK6C 3ZFFC 1ZBE1 3RQ0A 4E9KA 1PIV2 2OA2A 5EXOA 5C4WA 2Q4SA 5C9AC 4AQ6A 3BB6A 1FMD3 4JDNA 4KBBA 4Z92B 1PO13 3KSCA 2FZ1A 5KHKA 2XHKA 5F9TA 2E7TA 5JZGB 1GZ9A 1OMIA 3BIWE 4L11A 5DXDA 4OLLA 1C4RA 3VDDC 2SBAA 3AP9A 2GN7A 5ABJC 3ZIWA 1B35A 2R073 2XVKA 1FOD1 1CD3G 5BV6A 3MIDA 4AI0A 3VBHC 3KMHA 2X8KA 1NXD1 4FXKB 4WM7C 4ASMB 3AYAA 1CAVB 1BEV2 2YDEA 5FOJB 3GZUC 4N43B 3MW2A 2XVLA 1FX5A 3QBQA 5AC91 4L8QA 3N7LA 1SLLA 4AVAA 1R093 2X5IA 4JCKA 3B9CA 4OHWA 4S2DA 3VHOA 3HD8B 1JHNA 3ES1A 3MIBA 1Z7S2 2ZZQA 4LO8A 2ZGRA 5BY5A 3BOPA 5K8SA 1OD5A 4XILA 4LBJA 1DQ6A 5JMCA 4QXKA 5BXXA 3WOGA 4FTBA 2DURA 2C0ZA 3CF6E 4JAAA 4C1XA 4R9CA 5FPZA 3WUCA 4AEMA 5CFCB 5GM0A 3D0SA 1OOPA 1V6OA 3VL9A 1PGL2 2XPJA 2PHWA 1RB8G 2WS91 1NE4A 1YFWA 3MW4A 4AW7A 2BVBA 4HLTA 3MW3A 4RA0A 3AB0A 1ZZ6A 4FOQA 4QPIC 5L7OB 2WQZC 3GF6A 5K0UB 3RPQA 4C91A 2H0BA 1EPZA 1Z0HA 2OIIA 3WZ1A 2HWC2 4C1WA 1AR71 1ZBE2 2AENA 4R52A 3AMPA 3C3VA 3JZVA 3ILFA 4IEQA 5KBFA 4XXAA 1GKBA 4IV1C 4N9IA 1V9U1 2BWCA 1LECA 1S2KA 3FFZA 4GH4C 1HRV3 5J09A 4XBNA 1XYNA 1WW4A 3DKWA 2C1FA 4QQHA 3OTFA 2IFWA 1F8VA 3U07A 3MFCA 3POWA 4KG8A 4COVA 3WW2A 2QZ2A 2PFWA 5CG9A 1FOD2 2VW0A 1WD4A 3LSEA 4Q4X1 4COZA 2FBEA 1QQP3 2ZABA 2OZ6A 1QXPA 3RNSA 1U5XA 1DG6A 1MQTC 4JGZA 4M3CF 5H9SA 4CEYC 5AC92 4EJRA 5FQ0A 1O3RA 2P3JA 2A3YA 2VY0A 5DG2A 1QJZA 3LOIA 4UW3A 1DZTA 5KWRA 4TSVA 1F31A 3ZXFA 2Q0AA 2ZMNA 1WW5A 4GWNA 2BFUL 1JUHA 3AXEA 1WA4A 2D7FA 3ZFGB 2A6YA 4Q0PA 5EWSA 3WUDA 5KXBA 1C1LA 1H2LA 2YGLA 1AHSA 1IZ3A 3R4UA 1QF3A 4ZU5A 3H1MA 2RS11 1AYN1 3FUOA 2G9GA 4P9JA 1QJU1 4EN6B 3ST7A 3ZXLA 1RVF1 1UN1A 3N36A 3ZVXA 2WS92 3GHMA 2Z69A 4CRQA 1G9CA 4M3CA 3K51A 3ZN4A 3S7EA 3N4MA 2ERFA 3EJKA 4XQWA 2JG9C 1QU0A 4KGGA 1GZWB 1RUI3 1AR72 4PIXA 1CAXB 1FATA 4LHKA 1PHMA 1ULEA 1D4M3 4UXAA 1V9U2 2ZKLA 2BNNA 5I0SA 1C28A 5IK4A 1DGRA 3OJBA 2ARXA 1LHWA 2VMGA 3CO2A 2CAVA 1YIFA 2ZGNA 4P9IA 5JLVA 1LOBA 5LRSA 4LT5A 1BXHA 4NHLA 2B9UA 4LEJA 1RUC3 4MGYE 3WDWA 3KD4A 5FBZA 4YM3A 1HQLA 4FPOB 3ROUA 3WVJA 1QDCA 4AEKA 2BWAA 4RR3B 4ES9A 3TYJA 2ZGMA 1YO8A 1DQ4A 3O0WA 4Q4X2 1HQWA 5FMOS 2BQPA 3H8UA 4LE3A 4QD2A 4LTAA 4Z07A 2QDNA 1XYPA 5C8CC 4Q4V1 1RIRA 1U5YA 2EAAA 2D3RA 4CDWC 1S0GA 5I93A 1G9BA 2WZR1 3WT3A 3I4IA 3D0JA 2PAMA 3AJYA 1AJKA 3EO6A 3USSA 3WDUA 3HT2A 4LO6B 2VVDA 2WNUA 3AYDA 3JB8A 4WVMB 2GALA 1H9PA 4QPGB 2IXHA 4GB33 4Y1YA 4RFT0 1J3RA 4JRLA 2RS12 1AYN2 1RMU1 3I59B 4DQAA 1QJU2 4FAGA 1Q8VA 2R061 2EXKA 3RMYA 1RVF2 1SDWA 3JBG1 5EFUA 2TEPA 4TYSA 4W6WA 4Y1VA 4GXLA 4HK8A 3ZPYA 3MFAA 2YMZA 5L73A 4YGEA 3IPVB 3H3UA 2Z42A 3B9IA 2QJVA 5JVVA 4LBNA 5DUUA 3UL2A 1NCQA 2XBO1 4AHYA 2YXSA 4U2AA 2UYAA 2RS53 4FPCA 1I6XA 1SBDA 1I1EA 2WL1A 2B5HA 3PVEA 2R49A 4N53B 1URXA 5GZEA 3NV1A 4R9BA 4LO5B 5BNOC 2WSUA 1Q5OA 1W6QB 5GKAC 2RS31 2VQ0A 4XPVA 3APBA 1ZZ8A 3VUOA 4HVRA 4M3CE 3IDCB 1C57A 4ORFA 1HX6A 4AE2A 2K0GA 1IPKA 5FAXA 2XB6C 4QM9A 5T5LA 2VNOA 4DINB 1ZVFA 3O12A 3V56A 4RQPB 1N1TA 1UL9A 1CJDA 1FT9A 3ZMOA 2ET1A 4IEXA 2F4PA 4HN1A 5H9RA 2GNDA 2RMU1 5I8TA 1I5ZA 2A3XA 4IEWA 1N3PA 3ZSMA 2PQQA 3FBYA 1RHI3 2PN5A 1LU1A 3CJIA 1AR92 4Y1UA 4Q4V2 2DCTA 5IK8A 4HFSA 2QE3A 2ZMLA 1QWRA 5CNAA 2D6PA 3AZVA 1AYM1 3H0OA 1EAH1 4I0BA 3N7KA 4D7YA 1ZBA3 5A33A 3VBOC 3WLUA 2WZR2 4CEWB 4F3JA 1MS3A 1K5MB 4FOYA 2UURA 4YVWC 5BNPB 3VBFB 3SLIA 2PLV3 4AHZA 2ZACA 1TMF1 3MDPA 1F2NA 3E6BA 4FQZA 4KWJA 1XNKA 3MF9A 4OFGA 2WINB 1KXGA 1RMU2 3I7DA 1VBC1 5JCTA 2WFPA 2R062 5A3LA 3JBG2 4BMEA 3FHIB 2D5FA 2NN8A 1JTZX 5A32B 1QHDA 1JYCA 5T52A 3M4FA 2WWSA 2VH9A 3W59A 4FTEA 4YVSC 1OFSA 1V6JA 4M00A 2P3KA 1QY4A 1TEIA 2B7YA 4FAHA 3JB4C 1NE6A 3MPPG 3ZX7A 5FLIA 3HIFA 4AI3A 3PJYA 3ASIA 3V0BA 4BE3A 2RS32 1POV0 2ZTNA 2UU8A 1QXJA 4Y26A 1NA1B 2CNAA 4HT1T 1O3QA 5DDJ3 2SLIA 1QH6A 2C5DA 1FV2A 4Q4Y1 2FQPA 1J3PA 2HEYF 1DGWX 2ZGPA 2CTVA 4KWKA 1F5FA 1N3OA 4DOUA 5HBAA 1EV13 1LODA 4LR4A 1OA4A 1VBB3 2CWSA 2RM21 2O1QA 5SV5A 3J4UH 4AQSA 1S0JA 1WGPA 2QZ3A 5DZEA 2RMU2 4JTNA 4HPKA 4MLOA 1R083 3VN4A 1Q8QA 2NQYA 2DVAA 4G3YC 4EWEA 3FX3A 1VBA1 3JQXA 1BJQA 1ND3C 1H2MA 4YG0A 4FPEA 4YW3A 3URFA 1KFUL 4RHV3 2WJSA 1AYM2 1RJ8A 3L9JT 2R1BA 4IETA 1EAH2 3CU7A 1DQ2A 3RMXA 4S2FA 3B01A 1KJLA 4AVTA 4DPNA 1POV1 5L7OC 1V6LA 2D6NA 3KB5A 5EYXA 3ZFEB 1DF0A 2QNKA 3NAPA 4JRAA 1TMF2 3D5OA 3I59A 4H7LA 4Q0UA 4AI8A 1VBC2 1KFXL 1W6PB 1R1A3 1TME3 3SISA 1IKQA 3USUA 4MXWA 4NWWA 1RINA 4BLIA 3IPVA 4CDUA 1H9WA 3Q9OA 4Q1RA 4JQRA 4I2OA 5GALA 1HRV1 2O8QA 1MS4A 5J36A 3AKPA 1C8M3 1SFNA 2IXKA 1LHOA 4FCAA 4FPHA 2IC1A 1SBFA 4LE4A 1UPSA 3VBUA 2ZHNA 4GMP0 3GNEA 1LR5A 2Z5WA 4XFFA 2JE9A 3UV9A 1SEFA 5KHHA 3SXWA 4EN7B 4QU2A 2V09A 3ZSKA 5B2GB 3ZYJB 4PQ9A 4Q4Y2 2HYKA 2PHLA 1QQP1 4LBLA 1QXRA 1UZZA 3AZWA 4AEDA 1SLTA 4P9GA 2OUHA 2RM22 4J6GA 2DVFA 1SQ4A 1DGLA 1IOAA 5D8AC 3RRDA 1C1FA 1B35B 1WBFA 4U36A 3MIEA 1BVP1 2E9QA 4YW2A 4S2GA 2YPJA 3IDBB 4GKYA 4C90A 2WIIB 1GYKA 3WDXA 1VBA2 2QVSB 3BALA 1AL23 5H9QA 3KZ4C 1UPIA 4OZXA 3B5LB 4B4QA 3AKTA 4LLOA 2GC3A 2B46X 1LEDA 3K48A 2X5IB 3MLLA 4Q0QA 4Q8LA 4B4RA 3ME2A 1VBE3 1E57A 4COWA 4DZGA 4K6BA 1CESA 4N7IA 1TQ5A 5KHJA 2IZWA 2V73A 4XIKA 1RUOA 2GNMA 1SCSA 4LUKA 4YZ5A 2A6ZA 3HT1A 4FO9A 2A6WA 1Y43B 3GBWA 3VDDA 3FFQA 5ABJA 1LGBA 1OPOA 3M3OA 1UMZA 1OOPB 1V6MA 2NYYA 4URTA 2XJSA 3AX4A 4WM7A 3ZIXA 4YZ1A 5JWPA 1ND2C 2YV8A 5JSPA 1AR61 2VECA 1W2UA 1UU5A 2ET7A 2ZGSA 4COUA 3LWCA 2K9ZA 1O3TA 4MUVA 4WZFA 5E1RA 4AVBA 2CGOA 4D7TA 1QJX3 2YGMA 1SLBA 4RR3C 1RUC1 2E6VA 2VOKA 2DFBA 3LCPA 4CP2A 2IXJA 2CYFA 2HWE1 4XFCA 5JR7B 2A73B 2Z2SB 5JOXA 4NO4A 2H6BA 4GKXA 2AREA 2EIGA 4FBFA 4K21A 1VB4A 4B7KA 2QKDA 1QQP2 1V00A 1MZ5A 3ZXAC 2VMIA 3MIFA 1H0BA 1B09A 1CJPA 2TUNA 3B94A 2AZ5A 1OHFA 1RUH1 4YM2A 3AP7A 2Q5TA 3OYWA 4YG6A 5SV8A 4UW6A 3MIGA 1HQNA 3FE5A 3X29B 1D0GA 5KXCA 2VQAA 4JGZB 2YYOA 3AKQA 1HV1A 2E51A 4OI4A 3BTAA 5FQ0B 2JG8A 5JSRA 3W58A 4XETA 3T2TA 2D3PA 1OPMA 2HWF3 4IV1A 4Q1PA 3E5QA 1MEC1 1CN1A 2ZHKA 2R16A 1XU2A 5HCFA 3AM2A 4GH4A 5AFEA 1O7FA 2WNVC 4Y5Z0 5IK5A 1ZRCA 1UU4A 1F5JA 3A0KA 1FAYA 1H8TC 3LA2A 4CDXB 1W6PA 1W0PA 1G9FA 2C9AA 2R32A 1DQ1A 3VZMA 3EHKA 1WLCA 1NQDA 2VXRA 2GU9A 4XF1A 2DU1A 3VZKA 4Q4W3 5CFDA 4BIOA 5J3UA 4M3CB 5BNNC 2MNGA 1AR62 2JEMA 5KC6A 2A5ZA 1MQTA 1H4GA 4BPZA 4GIQA 4K40A 2NMNA 4I09A 4AFDA 4K3UA 5FMOL 1J58A 4CTEA 4YARA 5FPXA 2FZ2A 4CDQA 1RUC2 1FI2A 3LGRA 3PMSA 1LGCA 1UD1A 4XFIA 2VOVA 2HWE2 2WSVA 2XL7A 4W6YA 4B4PA 3SCGA 5T55A 1CPNA 3JCIA 1LU2A 1XE8A 5T5JA 2F6BA 3NW4A 5FLHA 3M1HA 1DQ0A 1H4HA 2XJQA 1KS5A 3ACLA 1H1MA 1ENXA 1H8VA 1RUH2 4DFSA 5JPMB 4QQPA 1K5MC 3RJRA 3O5SA 2CY6A 1ENQA 4XE9A 3WD5A 4I01A 2UYBA 3GBFA 2NLRA 2PHXA 3J8F2 4RS5C 3TRSB 2VNGA 1PZ8A 1CPMA 4KQ7A 2BNMA 3TN91 2GC2A 2PLV1 2RR13 1NZCA 3FZ3A 3FLTA 2QDRA 4BWOA 1PO21 3SCHA 1MEC2 2HEVF 2A7AA 3VBRA 4Y20A 3UJOA 3WW4A 1ZM1A 2DCYA 2WNUB 3OBTA 1BMV1 4JGYA 1RUJ1 2XLGA 1UAIA 3VHRA 4BH9A 4NHMA 4XF3A 5BUVA 2MPFA 1NA1C 2ZJCA 2B45X 3NWKA 4PIZA 2WA4A 3MGUA 2R0FA 1VIWB 4L2NA 4RGGA 3FUQA 2AYHA 2NPIA 1AX0A 4LBQB 5C8CA 1NCQB 1S2BA 2XKOA 3PVOA 4YZ2A 1ZA4A 4A3XA 3WNXA 1C3HA 1EV11 5K7PA 3TOJA 3ZSEA 1C8NA 3B3QE 1PGW1 1IHMA 5EJ3A 5JSOA 1U12A 4FT8A 2VG9A 2BPA2 2GMPA 4DS0A 1LOFC 4XBQA 3OY8B 4FOWA 1H1AA 1NY71 4IQPA 2HWD1 2VUJA 5GZDA 1BQPA 4BM8A 4BHPA 4RHV1 2PHUA 1AVBA 5F5QA 3PLQA 3I2DA 1RUF3 1X36A 1W6OA 3MZHA 1AJOA 1DQ5A 5JOWA 1S0IA 1HRI3 3VKMA 2YUEA 3CJIB 3TN92 2PLV2 4OI0A 1JXNA 3LAGA 1Z78A 2B8MA 3QH6A 4MSVA 1NLRA 3QH7A 1PO22 4JV4A 3DPRC 2MEV1 5A33B 1R1A1 1YFYA 1TME1 3QCWA 1X8EA 2E7QA 3P3PA 4XFBA 4E4ZA 1OQEA 2XLAA 4CDXA 3GBGA 2D3SA 3WW1A 4AFAA 1BMV2 1YHFA 1RUJ2 3VHPA 2NMOA 4AGVA 5T50A 1NXMA 3ZDSA 3QLQA 5EV7A 4PLNA 2WNEA 1RUD3 3ZYRA 3KGLA 5C4WC 2FMYA 4N7UA 2TNFA 2QCSB 5LK5A 3H9AA 3J26N 4F83A 4ZU4A 1X7NA 2O8OA 2HEWF 3RS6A 2JE7A 5DZFA 4MVTA 5ACA3 3DUIA 4QQLA 3FJSA 4YW5A 3JD71 2DCZA 3HAGA 4AQTA 1ZRFA 1HDKA 1WMFA 1DBNA 2V5YA 2ZGLA 1ASJ1 1RUG3 1EV12 4W65A 5FFOC 4NWVA 3M2MA 3VBOA 5C6CA 4IV3C 4PDWC 4XF0A 4DXZA 1PGW2 1GSLA 3V0BB 5JI7A 1V70A 1WBLA 3NSTA 1OLQA 4YVWA 2LM3A 2JECA 4YRDA 5GLWA 3B93A 3FWEA 4XTPA 4R9AA 3ZXDA 4CZSA 5F6KA 1NY72 2VMHA 3WR0A 2HWD2 3LA3A 4D94A 4YW1A 2BGCA 2E63A 2ZPXA 4RHV2 1MZ6A 1BKZA 1XNBA 3AP5A 1HXS1 1EYBA 4GULA 1U0AA 3VHNA 4P5HA 4HPKB 4IEOA 4XF9A 2WFF1 5CIRA 3KT4A 5DUXA 2DCKA 4YVSA 1DDLA 4I30A 1PIV3 1I9RA 1O5LA 5EZWA 3QACA 5CU1A 4JTOA 3SNMA 1OOPC 1G9DA 1ZZBA 2MEV2 3ILRA 1R1A2 4YG3A 1X33A 1QKQA 3FLPA 4HBNA 1BBT1 2D98A 3C2UA 1MZEA 1G6NA 4KU8A 3NAPB 1WLTA 2ZA9A 2ZX2A 1MZFA 5DUWA 1YWKA 2VW1A 4OHYA 1FPN3 2O0OA 2P37A 2UY8A 4J1WA 1BEV3 1DFQA 1TNFA 3USUB 4UBHA 4MXWB 2G4IA 4CDUB 4D3WA 4LBQA 5GZFA 3OPZA 3KGZA 4GWMA 4WM8A 4NHKA 2GC0A 4Y4YA 1FXZA 2OUJA 2VW2A 2Z79A 3JD72 1RL3A 4LLFA 3U11A 1RUE1 1CR7A 3GZAA 1QOSA 1ASJ2 1SLCA 2RHPA 1Z7S3 3VBUB 3ZSJA 2D5HA 3IN9A 4RL7A 1Y9QA 2BNOA 1TNRA 1OA2A 4OHVA 3UKVA 1NCRA 3MICA 3I54A 3PMEA 3VBSC 2P3IA 2DUPA 4B29A 4BCUA 3OY8A 1ZYBA 4JVAA 2EA7A 4DNYA 2AH2A 4AEDB 4HETA 2OYZA 1QJY1 3SH5A 3VKOA 2NZ9A 1AX2A 1HXS2 1VRH1 2WLQA 2ZKNA 3BODA 4K1ZA 2IFRA 3HMYA 3ETQA 5HXVA 1QH7A 3BPZA 3WQ7A 4QGMA 3WQ0A 2WFF2 4XIOA 5KHGA 1VLNA 1MS8A 5FREA 1S0CA 1PK6B 1CAUB 4IEYA 4QGNA 1YCIA 3FLRA 4M0HA 5BPXA 3WG2A 1VJ2A 1ULFA 2IWGB 4H55A 3PTYA 2D93A 4META 1VBD1 1BBT2 4ZKTB 1ENSA 4X8PA 3WG1A 3AMHA 4M01A 4Q8KA 1DZQA 3RWNA 3CJXA 1GBGA 1FOD3 3D4KA 3U10A 1N1SA 1TE1B 5I8SA 3VDDB 4HKOA 5ABJB 2YY1A 1BVVA 3V64A 2BTVC 4K20A 3R6SA 1MR5A 5JZGC 4WM7B 4YZ3A 3DL3A 1FMD1 1H30A 2GMEA 5AC93 3IKWA 2R043 2XBO2 1NOVA 1PO11 3POSA 1UCXA 3H3ZA 3FC0A 1RUE2 1O4TA 1CONA 3VKFC 3L2YA 4PJYA 3B02A 2XH6A 2R071 2GNBA 2GDFA 4N43C 3IM0A 2XLFA 4FQ4A 2OW4A 4BIFA 4RD7A 2WQ4A 2PAKA 1WCDJ 1LKNA 3WCSA 4Y1ZA 3NV4A 3DN7A 1R091 2X29A 1QJY2 4O9EA 1OLRA 1C5IA 1VRH2 1YFXA 2DTWA 1W6NA 4D7SA 4FPJA 4COYA 4I3GA 4FXGB 4YW4A 3R05A 2A3WA 3AKRA 1ND2A 3OYWB 1ZZ7A 2D6KA 5GZCA 1BK1A 2BBVA 5C33A 4QPIB 1YIPA 2VPVA 2ZS6B 5CFCC 1XXNA 4QGLA 3B69A 1NLSA 3HWJA 5DG1A 4FVVA 4D69A 3DV8A 1V9U3 2JG8B 3OGJA 3VKNA 5FO9B 3M7AA 2XL9A 4FSJA 4YGDA 5FO8B 1AR83 4IV1B 1SMVA 4V1PA 4ATEA 4CYDA 4P9LA 5K0UC 1UKRA 1VBD2 4GH4B 4Z2WA 1S55A 2VOXA 4NPRA 1S1AA 1NCQC 2ES3A 3AZYA 2DTYA 2E53A 2A70A 2WT0A 4LO7A 4UW4A 4NOTA 2CGNA 4IERA 4Q4X3 2IXLA 5GZGA 5CADA 4WVZA 2YROA 5FO7B 3LOBA 2HKXA 3R4SA 4HSLA 1FMD2 4QMAA 4E27A 5CFDB 4W6XA 1LTEA 4AG4A 5KC5A 1PO12 3ALQA 5BNQA 4P14A 4M0NA 3AK0A 1MQTB 2ZX4A 3WHTA 4CEYB 3ES4A 4YM0A 4X6QB 3NJZA 1OA3A 4CDQB 4WZCA 2R072 2XVGA 2ZAAA 4HKLA 1WMEA 3EQEA 1A8MA 2WNVA 4B7EA 5CG8A 4Y22A 4IXLA 3OBRA 4WBBA 4XTMA 5FDBA 1N47A 3WW3A 2RS13 1AYN3 1H8TA 1J1LA 1HRI1 4OHXA 3N7MA 1LGNA 1RVF3 3HR9A 3WX5A 2Q1MA 3E5XA 1R092 4AHWA 1NQJA 5CVRA 2AUYA 3MF6A 2DU0A 3ZFGC 2D6MA 1XRUA 1YYNA 3KLSA 1IGOA 2W39A 5BNNA 4Z82A 5DUVA 2QQPA 4BLJA 1FNYA 5LEKA 4K9SA 3D8CA 1XYOA 1SACA 1PK6A 3ZFFA 1CAUA 3CNAA 1R1ZA 3OF1A 4I0WB 1YUDA 5C9AA 3WV6A 3M3CA 3RYKA 5CB7A 1N3QA 1RUD1 2JKBA 2ZGOA 4ZU7A 2E7AA 4XEZA 2G9FA 2ZBJA 2Q30A 2ZHLA 2XJRA 1EP0A 5AFBA 3VBRB 3NKGA 4Y20B 2Q8OA 2D6LX 5ACA1 2Y0IA 3HN1A 4R4ZA 4JGYB 1AX1A 3WY6A 1RUI1 3ZXEA 3O14A 3VBHA 3IIAA 1AUYA 4FPLA 1UIJA 2GSYA 1D4M1 1AR93 4OHZA 1S0FA 1COV3 3UKTA 3TAYA 4QHBA 2PTMA 4Q4V3 1HRV2 4KNCA 4RS5A 1HV0A 3POYA 3WXPA 3ZXGA 2DV9A 3LSDA 3MI8A 4Z1VA 4Q0VA 5C8CB 1AXZA 3THTA 4C0HA 1AXKA 5H9PA 3PHMA 4CDWB 2ARBA 3ZN5A 4PLMA 3M70A 3E6CC 1OFNA 1VAKA 5AVPA 5AVAA 4IEPA 1LRHA 3PVBB 1IS4A 1VB2A 4YGBA 5T3NA 4TZDA 2ZGQA 2ZGTA 4KG0A 3WHUA 1RMU3 1HRI2 1D0HA 1DLLA 3SCFA 2R063 3RG0A 3HBZA 2GH8A 1H2KA 5L19A 1O91A 1AZDA 1GR3A 4AVVA 4BQ1A 3RZZA 1NG0A 1KDKA 4GA9A 1W6OB 2D97A 4QPIA 4H3WA 3S0MA 4PLOA 4QPGC 3RYPA 4LBOA 3WP6A 3ELNA 4X6RB 1DYKA 4GB31 4XMAA 2EXJA 2HWB3 2PHDA 2RS33 1FPN1 4Q26A 1RJ7A 3NO8A 3G6JB 4PCRA 1PNFA 1D4VB 3E5UA 2KA3A 2UWAA 3TWIA 3ZYPA 2LALA 1UKGA 1A8DA 5ACA2 4E2QA 4N53C 1ZZCA 4YFZA 4HL0A 1RUI2 3ZSLA 1O5UA 3KQRA 3AFKA 1XNDA 2RMU3 2RS51 4XHBA 4DRRA 1JBCA 2AGSA 4XFHA 5E8AA 1GNHA 2RJLA 4ZXKA 5E88A 1QOOA 1JYIA 1QGLA 1D4M2 2ETEA 2DCJA 2WZPP 3DF0A 4RQPC 3H1WA 2WA3A 4C0BA 5FOBB 4CEYA 5F1RA 1ULDA 1EAH3 2OZJA 2JJ6A 3U0ZA 3LB9A 4XYXA 4OI1A 1PVC3 4MX3A 3VBOB 2VU9A 1WD3A 1H2NA 1LEMA 4XQDA 3AMNA 4XQ4A 3MLJA 1TMF3 1BYHA 4LHNA 4YVWB 1LOGA 1A3KA 1RHI1 2PAEA 4XJAA 2PYTA 1VBC3 1J1TA 2XGXA 4XOGA 2XWJB 5J7MA 2R0HA 1M06G 3VKLA 4CEWC 3WG3A 3KM5A 2ZAHA 3MPBA 3OCPA 1X8MA 2H0VA 2MHFA 5BNPC 3GHNA 1YJLA 4A7YA 3VBFC 1ZBA1 4AK3A 3O7OA 4L97A 4K7JA 3RYRA 3TNPB 3ZN6A 2WT1A 4R9DA 1YI9A 3THPA 2BEOA 4XJ8A 2XUMA 4HSJA 2JG9A 2CAUA 4XFGA 1UX6A 2JICA 4ATFA 1PZ9A 3CEWA 2VUAA 1ALYA 2BUKA 4FPKA 4KWLA 4YVSB 3ZO0B 3NV3A 4GB32 3AZZA 4LUMA 2CV6A 2ILMA 5D1IA 1FPN2 1LHNA 1LHUA 5E16A 1S0BA 4IV3A 4PDWA 1Q8OA 2I07B 4Q27A 4Q4Y3 1V6NA 1PGSA 1ONAA