2YUEA

Solution structure of the neuz (nhr) domain in neuralized from drosophila melanogaster
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
168
structure length
168
Chain Sequence
b'GSSGSSGPLQFHSVHGDNIRISRDGTLARRFESFCRAITFSARPVRINERICVKFAEISNNWNGGIRFGFTSNDPVTLEGTLPKYACPDLTNRPGFWAKALHEQYCEKDNILYYYVNGAGDVIYGINNEEKGVILTGIDTRSLLWTVIDIYGNCTGIEFLDSRIYMYQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein neuralized
publication title Structural and functional characterization of the NHR1 domain of the Drosophila neuralized E3 ligase in the notch signaling pathway.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Rna binding protein
total genus 17
structure length 168
sequence length 168
ec nomenclature
pdb deposition date 2007-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07177 Neuralized Neuralized
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.920 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2yueA01
4KG0A 4X8NA 4N7IA 5F6KA 2E63A 4B8EA 4XW3A 2VOKA 4X8PA 3KB5A 3UV9A 4P9JA 4P9LA 4QT6A 2LM3A 2WL1A 4WVMA 5JI9A 5C33A 2FBEA 2IWGB 2YUEA 4P9IA 5F6LB 5JIAA 4V1PA 5JIUA 5JI7A 4WVMB 4N7UA 3ZO0B 4B3NA 2YYOA 3TOJA
chains in the Genus database with same CATH superfamily
1XNDA 3IIIA 4S2GA 1G7YA 5EJ1B 2ZHLA 3KMHA 4IV1C 4LE4A 5K0UB 1DHKB 2JDHA 2FCUA 2ZGMA 4EYUA 2NM1A 3ENRA 4LHLA 2WS91 4FO9A 1COV1 3NV1A 4JRLA 1YQ2A 1CN1A 1POQA 4IEQA 1ZRRA 2ZMLA 3NRUA 3ZDVA 3RZKA 2VOTA 2C6SA 5DQ0A 1SHWB 1ENXA 4AFDA 3ZDSA 4ONUA 1ULFA 5FYZA 1UZWA 2BOIA 4AQTA 5AFEA 1GR3A 2VZSA 3UGFA 3LD8A 3ZN4A 2XBO2 4FXKB 4ZHNA 4K1ZA 3ZSMA 1ST8A 1RUC2 1NE4A 3B69A 5TSWA 1EY2A 1PNFA 3SH5A 2BNNA 2HWC1 2HWD3 1XXNA 2VZVA 4GB33 1X33A 2G9GA 2MHFA 1DIWA 1T6GC 2AGSA 4IQPA 2I45A 4U36A 5ACA1 1CESA 4L8QA 3ZXJA 1SFPA 5APAA 2DCZA 2ZEWA 4RHV1 4QB2A 2AENA 4CZSA 2ERFA 2VBBA 3RPQA 4QDRA 5AC91 4AVBA 2TUNA 3J8F1 3ALQA 1H9WA 1O5UA 1UZVA 4MX3A 4PDWC 5DDJ1 3AKSA 1BZWA 2Q5TA 1BKZA 4JGYB 4CEWC 4Q4Y2 5CYYA 3I2KA 1MEC1 2CAUA 4XDOA 4XUPA 3HBZA 1ND3A 4Z82A 3PIGA 4YVSA 3I2DA 2ORXA 2J42A 2W1SA 4COYA 1CPMA 3OUJA 1ZRIA 5FREA 5A7SA 2LW8A 3IMNA 4MXWB 3UYJA 3BTYA 1IS5A 1HB3A 2ZX0A 2E7AA 4BA6A 5F5QA 1D4M2 2VXRA 1NUKA 2VMEA 3GZUC 5K9YA 1QXJA 4PF5A 4YPJA 4A7YA 1SCSA 2LUWA 4PLNA 2RJ2A 3KQRA 4KGQA 4PHZA 1DGRA 2E31A 2Q8CA 4GWMA 2VU9A 5F2SA 2FDKA 1W8FA 2R071 4XBQA 1KEXA 2KD7A 4K21A 2XHKA 5A7PA 3ILRA 4F3JA 3N7MA 4Z07A 3RG0A 2ILMA 2UYAA 4FFHA 1ULGA 3NKTA 4Y4YA 1C1FA 1MS0A 5A6XA 4PI0A 5M0TA 2Y34A 4LHNA 5CKQA 4QDQA 3LFMA 1KXGA 5BNPC 4UFIA 2D43A 3MPPG 1Q8VA 4FP3A 2E26A 3CL1A 3POEA 5JXIA 2ZMNA 2HWE2 3OY8B 5FYTA 1BLZA 2GNBA 1NLSA 4FPEA 4AEDA 2PQSA 4CEYB 5DMYA 3ZN6A 4LBJA 3J9SA 3ZFGA 4NRQA 5CB7A 1GOHA 3K3OA 1LAJA 4FOQA 3W59A 2DBIA 2Z42A 3F95A 2WO1A 1IPJA 3TEWA 4EZHA 2L9LA 3AP5A 4AEDB 4HKOA 3ZXLA 3ZMOA 4Z2AA 1JZ6A 5FZ6A 2R30A 2YC2A 3ZFGB 1RTVA 5A6ZA 1ZBA3 3UKNA 1FOD1 2WA4A 2PA7A 4HONA 5I91A 4E4DX 1PO21 4IV1A 3DKQA 1R1A1 2WNVA 3G6JB 4JDMA 2OXBA 4OCTA 1OI6A 4BDVB 2BDRA 5LK5A 1APNA 4IEPA 4E4HA 2D97A 4E27A 4AHYA 4QKBA 4JDOA 4XTMA 2VQTA 3EO6A 3H1MA 1PX4A 4P9WA 3AJYA 2ZGKA 4IV1B 5FXVA 5FY8A 3WZ1A 1V6KA 4JCKA 1KS5A 2P3YA 5A7QA 1S2EA 3WDWA 2K46A 1ODMA 2A5ZA 2C5DA 3P5BA 2JE8A 2ZGQA 5A3LA 4QXHA 1LOCA 1ZYBA 4N9IA 3SEEA 4Y1ZA 3JB4C 3LE0A 1AR73 2W1WA 5FZKA 2Y6GA 3PU3A 3RZMA 4N7IA 1HN1A 2J7MA 4JKMA 3WW1A 2JDPA 2P6CA 3J7NA 4META 3WG2A 2VZRA 3LB9A 1V6MA 2B8MA 2GN3A 4UWDA 4LBLA 5FY4A 1O3SA 5ANQA 3QOPA 1HRV1 1NLQA 1FATA 4PDWA 2NMNA 3HPNA 3U4SA 1JN2P 5LB6A 2BBAA 5LZ6A 4CDWA 2A3WA 2HWD1 4GWJA 4GB31 1QQP2 1FV3A 5HI0A 1ASJ2 4IGOA 4LK7A 4L2NA 4RR3A 4EWEA 1FPN2 4O61A 3POBA 2DCKA 4PDWB 1H0BA 2GZWA 1DCSA 4M00A 3H9AA 1ZZ6A 2BRTA 2WZR2 3AXEA 1JYNA 5E89A 2Y38A 4CEWB 1SLTA 2AR6A 3E5QA 1N3QA 3E5XA 3ILFA 5JOXA 4I3PA 4TN7A 4XQDA 4B7KA 1NZIA 2B9UA 3A0KA 3VLBB 4A6OA 4QB1A 2XJQA 3H42B 4X8PA 2B46X 1PO13 3JCIA 2XWJB 2HEWF 1KDMA 2RM21 3RYPA 1Y9MA 1UX7A 3OJBA 4OVEA 3MW2A 4QM8A 4D6QA 2PAKA 1PM7A 3JD73 3OGSA 3VHRA 3NNLA 4BK4A 3J4UH 4BQYA 3KV9A 2W52A 4AL9A 1BHGA 1YFUA 3EHKA 3P1IA 4YW5A 1VRH2 2BGPA 3C7OA 4BXSV 3SEPA 3V0BA 2QCSB 4DXSA 4D94A 1SLLA 3MLLA 3AKTA 2HEVF 4PLOA 5FQ0B 1FAYA 1UMZA 3GGLA 3KHCA 1PGL2 5J7MA 3VBFC 3BU7A 2RHPA 4IETA 4RS5A 3VN4A 4GD4A 1H2NA 1N1SA 1Y3TA 2UWBA 4HOOA 1KITA 2WDBA 4KMQA 2UYBA 3UGGA 5BNPB 1LOGA 3W5MA 2BUKA 1UY0A 2BJSA 4O7XA 1UU4A 1C8M1 4KNCA 4Q4V1 3POSA 1KGYA 5FZDA 2VZUA 3O1PA 1QNWA 2DU0A 3KM5A 5J37A 2GMPA 2JKBA 2VH9A 3A23A 1HXS2 5HCFA 4HZFA 4FT8A 2UWAA 4ASKA 1MS1A 4OUEA 3A4UA 3NNGA 4O9EA 2VBPA 2DWRA 5C5UA 5K8SA 1W6QA 1XNKA 2RR12 2XBO3 3VBSC 4CYDA 3N9OA 2JDUA 3M3CA 1GZCA 3ETQA 4BIOA 4C90A 1RUC3 1VBD2 1G8WA 1HB1A 3DF0A 1C8NA 5LRRA 2C24A 4YVWA 2FZ2A 3OBZA 4P5HA 2HWF2 1YI9A 1YHFA 3WHUA 4NUBA 1RYYA 3D5OA 3J7HA 3OTFA 4LMFA 3T0BA 2IVJA 1VMFA 2JDZA 1VAMA 5DABA 3W9AA 3KLSA 5A1FA 2DF7A 2VOWA 3HMYA 4QX7A 2B4KA 4AQSA 2V72A 2ARAA 2Y26A 5IK4A 1WLWA 1TQ5A 1RUE1 3IZOA 3GCWA 4OLLA 4NIIA 5HV4A 1NYWA 4NHLA 3AZZA 3O5SA 2RS12 4YGBA 1JYXA 4Q4Y3 1K42A 1AR61 4LR4A 1W6PB 4NHKA 2XL9A 4L97A 3VZJA 1UMIA 1YQ8A 1QDOA 1Y9QA 2VC9A 2J1UA 2ZHNA 2HYXA 4D8MA 4YZ3A 5DAVA 2IXKA 3NKGA 2Y6KA 4NAMA 1PM4A 1BVP1 4GKXA 4B8EA 2WBKA 3BUCA 1D4M3 2BPA2 2XVKA 4HVQA 3THCA 1MZ5A 5B4XA 3T0DA 3VL9A 3ABZA 3CHXA 2P4EA 4MUVA 4XJAA 1E5SA 1GANA 2AYHA 1GZTA 2A6XA 1JYVA 2ZGUA 3RJ2X 5C33A 2DTWA 3SH3A 4AI0A 2D5FA 5A80A 2JDAA 1TG7A 1MQTA 1N1TA 4JTNA 3USUA 5DUVA 4BK5A 1UU5A 5EWSA 1UXZA 4JKLA 2W3JA 4UI9L 4Y4RA 2Z79A 5KHIA 3NJZA 1L7LA 2ID4A 3H50A 3KF3A 4DXTA 4K1YA 5C3QA 2WC2A 1U5IA 4N90A 1UAIA 1X50A 5KC5A 2HWE3 2VTXA 4Q5OA 3I2FA 5HCBA 3I97A 3MFCA 4MHRA 1YCIA 2CYFA 3BOPA 2HWC2 4M0HA 3AC0A 4KWUA 3PHMA 1VBE2 4QPWA 3BCWA 1D7PM 1XSRA 3VKFC 1OLRA 2ZX1A 4GALA 1W6NA 3WNPA 5T5PA 2RVAA 1PO11 1CZVA 3N4MA 4AAPA 4AGRA 3NL1A 2EF6A 5C4WA 4AZZA 4QX2A 2LROA 2PLV2 3PUQA 3VBFA 3ECQA 4WVZA 3WF4A 3JD71 5KXCA 3J8F2 4UF0A 1CAWB 1MACA 5A7WB 5DDJ2 2I2SA 2G9ZA 4S2DA 4E2SA 1WMEA 2YU1A 1W6NB 4XCBA 5FO7B 4HK8A 4AQ2A 4E4ZA 2XGXA 5JR2A 4LEJA 3DXTA 3KV4A 3CO2A 2P3IA 3VBFB 3HQRA 4UF0B 2ZJCA 4DQAA 3T2TA 4IV3C 5FYUA 3K77A 2QKDA 1LENA 1ODNA 2BZDA 3HN3A 3R4DB 4Q4W2 3VBSA 4LO7A 2VCMA 4QXCA 2YBKA 5F6LB 1UZZA 1XU2A 1DGRN 1F5JA 3WOGA 3ZFEC 4RFT0 4CCMA 1SLCA 3C7FA 1Y9GA 2ZTNA 3JQWA 2PHWA 3K4ZA 4OI2A 3TEZA 3V0AA 1BMV1 1QWRA 3VBSB 2R072 1LHNA 4MHUA 3WNLA 4S2FA 4TWTA 4OI1A 4CCJA 4XXAA 3N7JA 1H8VA 3ZYPA 3OYWA 1NCQC 3GCXA 4LTAA 1LB2A 2A6ZA 2XBO1 3JXSA 3LCPA 1AJOA 5GLVA 3LA7A 5CKNA 3FBYA 1ENSA 3ROUA 4ASMB 4LIVA 1UOFA 4HLTA 1HRI1 5AFBA 3OYWB 4XFCA 1QQP3 1ASJ3 3Q8EA 4B4PA 1GKBA 1JODA 3GBFA 3QLQA 1FPN3 3I3BA 1BK0A 3O1SA 4OZOA 5DZEA 1A34A 3ORJA 1LR5A 1J3RA 4ZS3A 3O1UA 1WCSA 1QEXA 3D82A 2VZTA 3D4KA 1D0HA 2WZR3 2Z69A 5F5IA 3WINE 4CDUC 2A6VA 3T1MA 1WD4A 3RZLA 5GJ6A 5A6QA 4LBQD 1SLBA 5CADA 4UFJA 1YRZA 4AVVA 2EA7A 1WLTA 4IEVA 2DYCA 4XACA 5L19A 1OOPC 1REFA 3KZ4C 4EV0A 1A6CA 2O14A 1PO22 1R1A2 2ARCA 3E5UA 2VZPA 4FOWA 1HW5A 4CPBD 4LBOA 1DF0A 5L9RA 3WSOA 2C26A 4XF9A 4IERA 1QHDA 1VRH3 3DGTA 3THDA 1UYZA 4QQOA 2DVAA 1NT0A 3HQXA 5D2AA 1W9FA 2W91A 4IEZA 1SFNA 3AK0A 4IE5A 3DEMA 4LO4B 4FTEA 1VALA 2QDNA 5A32B 3LDBA 1AUYA 3A0NA 3C7HA 3K3NA 4K8RB 1XSQA 5CFCC 4M4RA 2EAKA 2XKPA 2RDRA 3FHQA 4OYUA 4DUVA 3VDCA 5FYCA 5FZ8A 2Q8EA 1HXS3 2JJ6A 2QTWB 3BU0A 3UKTA 4BQ4A 3MIGA 3RZHA 2RR13 5CZKA 4ET7A 2P37A 4J1XA 1HRV2 5A3WA 5CG8A 3SNMA 5C70A 1VBD3 4OI0A 1WBFA 3GJBA 1UYXA 4EZ4A 4AEMA 1I3HA 1XE0A 5IUQA 3LFIA 2HWF3 3OPWA 1KJRA 4XAEA 2EIBA 5FMOL 5EIYB 2EALA 4XFGA 5ANNA 1JMUB 5FUIA 2CWMA 4ZU7A 1LGBA 1OUSA 4XABA 2K0GA 4KI5M 3AMQA 4CP1A 1RUD2 5JSRA 4FSJA 2IVIB 1GZ9A 3Q8BA 3MIDA 5LEKA 3AZVA 3O1MA 2VUJA 1QKQA 4AI1A 2WO3A 4IV3B 4DMIA 1UMHA 5DG1A 2XJUA 5FY7A 5JIAA 1QU0A 2A71A 4CCDA 4DOUA 5F3CA 4OULA 1DZTA 1CONA 1FI2A 1UZYA 2RM22 2RS13 4MZUA 4YRDA 1LEMA 5LA0A 4QPIA 4NJ4A 4YZ1A 3MZHA 2BBVA 1DG6A 4W65A 5FYVA 2XJTA 1JW6A 1UOGA 1XJAA 3LEMA 2ORZA 4YW3A 4BPZA 1NCQA 1V6IA 4AI2A 4XAAA 1CX1A 4PCRA 2HKXA 4DEQA 5FPXA 3W58A 2DVGA 1CD3G 1NCQB 1N47A 4OZXA 4IW3A 5F37A 2VXJA 2VNRA 3W5NA 1OHFA 2FHRA 3IT8A 2YUEA 1WZXA 2WT1A 4EJRA 1KD7A 2BVVA 4N53C 2GC2A 3GHNA 4MLOA 1DQ1A 1G9CA 3OF1A 2ZAAA 1C8M2 3I3QA 3N9QA 4Q4V2 1DQ6A 1PZ9A 2VQ0A 3NJYA 3RZZA 3WNOA 4YZ4A 4AVAA 2UURA 4H14A 5I0RA 4WVWA 4GKYA 1XYPA 1ASJ1 3KQ4B 4XIKA 4CDUB 1FPN1 3RYKA 1DGWX 4JC1A 4Y1XA 3QACA 5IK7A 1ZZCA 4JX0A 4NHXA 5LWBA 2BERA 5DAPA 4CUCA 4B7EA 4Y20A 3D6EA 4K8FA 2VOXA 4B4RA 1NAEA 2HWC3 1SCRA 1C3HA 4RFRB 3AX4A 1OOPB 1VBE3 3HBKA 1AX2A 3U37A 2D6OX 3IDBB 1IKQA 1S0GA 3I4IA 3AZWA 5FP7A 2BTVC 3H3ZA 1L7RA 1POV0 5C8CA 3DECA 3WW3A 2XJPA 4ATFA 2C9KA 2EAAA 1WLCA 1IQAA 4GWIA 3VZNA 1PIV2 2JG9A 2PLV3 3CIHA 2EICA 3ACGA 3VBUC 3J8F3 4P9YA 5T5JA 1RUE2 5DDJ3 3POGA 3NAPA 1W6MA 4MG2A 3APBA 3VBHC 3H7YA 1X36A 5JPNB 3FC0A 1AR62 5HCHA 4IL7A 4IE7A 1BCXA 1L7QA 2HJIA 1Y4WA 3VZLA 4NOTA 4XCAA 5C9AA 5GLWA 4EQVA 1ULDA 4Q4W3 3V56A 5CFCB 4CCCA 3O0WA 1PGL1 3TN91 5J3UA 1RUH2 3KT7A 1OQEA 1WCKA 2KM2A 5FBJA 4A4AA 3TAYA 5F3GA 3K75B 2A3YA 3N7LA 4ZONA 4M3CA 5KR7A 2ARXA 3UJQA 1BXHA 2R073 4FPFA 2R1DA 4YG6A 2E32A 1MZFA 3IDCB 4Q29A 2GC0A 1HXS1 2OQ7A 5LBFA 4CDXC 4Z2WA 1S2BA 4CU7A 3GBGA 3MUY1 1AR92 1SG3A 2EVXA 2VGDA 3IPVB 1UY2A 4JDNA 4M3CB 4Y1VA 5T54A 5FMOS 2ZABA 1RITA 4QD2A 2XVGA 1G9FA 1VBD1 5DZFA 4H7MA 1QGLA 3CJIA 3QH6A 4K6BA 4XYXA 5CA6A 3C7EA 1MZ6A 1ZA4A 4LA3A 5DXDA 1IOAA 5F3EA 4R4ZA 2O0OA 5FP8A 4W50A 4OHYA 4HVOA 3T2PA 3NNMA 3FFZA 4C1XA 2WWSA 4NROA 3FX3A 5J98B 4XTPA 3FLRA 2RMU1 1UY3A 2XOMA 4GJYA 4IE0A 4QPYA 2PQQA 2XUEA 5GZGA 5HV0A 4YW2A 1MS9A 3FMGA 4I0AA 3ZR6A 4HSLA 4R52A 2JICA 3AL5A 3RFRA 4DFSA 2RS11 3H1WA 2BEOA 3KHBA 2R042 1I5ZA 5IJRA 1HQLA 4NIAA 1PO23 4JAAA 4XJZA 1R1A3 2ZX4A 5FZ0A 3ST7A 5FZEA 4N53A 1LOBA 3DPRA 1B35A 2XQXA 1V0AA 1VE0A 2NP0A 1YLLA 3M3EA 4JTOA 3OPTA 3ITQA 5K0UA 1SPPB 4YYOA 2YU2A 4HT1T 2ZGRA 4LO6B 4N53B 4INDA 4RGKA 5A1LA 4YW1A 5IVVA 3CJXA 3J7MA 2JE7A 5KXDA 2EXJA 2Q1FA 2W39A 3TRSB 1X9PA 5DN2A 3EXUA 1ZZ8A 5FWJA 2QFEA 3LSEA 1O3RA 2H6BA 1UYPA 3NV3A 4QQPA 1G9DA 1BMV2 3AP9A 3ZPYA 2Y6HA 4LKSA 2WFPA 3IB3A 3POWA 4AVSA 2VQAA 2QQMA 1UO9A 2WAOA 1T6BX 1CAVB 1MS5A 1S1AA 4ZXKA 3RQ0A 1DYPA 3E6CC 2MNGA 3EBRA 2ADDA 4CP2A 3O1RA 2Q8OA 4PIYA 3D8CA 1OURA 3ASIA 1HRV3 4XBNA 5CEHA 3FBMA 3MICA 1HRI2 1S0FA 5E1RA 3RMYA 5CAZA 1I5PA 1UOJA 3HNBM 4Q0UA 4R9CA 1CR7A 1VBE1 4NWWA 1ZBE2 3H1YA 3LAGA 1AZDA 2EIEA 3VBUB 2A75A 3C2UA 5LCWL 1GQHA 1GQPA 2LTNA 2OZ6A 3BVCA 3ES1A 4JHTA 5LBEA 3M8LA 5E16A 1SFYA 1V6JA 2VL4A 2OUHA 4JGYA 2HLEA 4Q0QA 3VBHB 4BHPA 1RUD3 2HBUA 2VUDA 2PLV1 3CEWA 2GH2A 1XYNA 3WXPA 5FYYA 2VVFA 3ZYJB 4HL0A 2XG3A 5FY5A 3POJA 4CA9A 3GF6A 4CDUA 2VMGA 4MXWA 3PURA 4QQLA 4YZ5A 1YIFA 5GZDA 2RM23 4XHBA 1C57A 4FOYA 4UW4A 1F15A 2QQVA 5DPNA 1DZRA 5EV7A 3WV6A 1E57A 1US3A 3K2OA 4CCLA 3MGUA 1RXFA 4P08A 5BUVA 2JDKA 3OD4A 4LBQB 3ZSLA 1KFUL 4Q4W1 2GH8A 4WZCA 4Y5TA 4GA9A 5GZCA 1N3OA 1FX5A 1AYN1 4GAZA 3ZFEB 5C6CA 1CJPA 1OQ1A 1GP5A 2V4AA 5BPXA 5A7OA 4CDXB 4FQZA 3PMSA 4DO0A 4Q0VA 3VUOA 4AVCA 4L99A 4YGDA 3S7IA 4COUA 1MS8A 1BYHA 4ZKTB 1VBA2 4QKDA 1JYWA 3T4HB 5DAWA 3ZMNA 3L2HA 4EN0A 2IFWA 5JPMB 3KT4A 4QM9A 2BGOA 2IXHA 4HKLA 1C8M3 1OBNA 3OY8A 2VCAA 4Q4V3 3PMEA 1KDKA 4CEYA 4GMP0 2CGPA 1OPOA 4BH9A 1LHUA 2XL7A 4H3WA 2QJVA 3MEPA 1IPSA 4R8HA 1RB8G 3KT1A 2D40A 2YHJA 4K3UA 1WBLA 5FYIA 1RHI1 3K48A 4N43C 4IESA 1H6XA 1JU4A 3N9MA 3POFA 4FOVA 2G9FA 5L9BA 1JZ7A 2WSVA 3T0AA 4AFMA 1QIQA 1JZ5A 1AR82 3AZYA 3KF5A 2JXAA 3R4SA 2WN2A 4J6GA 1W2UA 2QUOA 3ZSKA 3QBQA 5FO8B 5T55A 4ES8A 1IS3A 4YSFA 1EV12 5C71A 2YYOA 5IVYA 3AP6A 1PIV3 1GQGA 1V6NA 3ACHA 4FAGA 4QHZA 1RUE3 4LKFA 3VZMA 1WMFA 3MV11 3DCQA 1W06A 3N3HA 4DRRA 3AYCA 4MGIE 5HXVA 1OA4A 1AR63 1RUF2 5FPZA 4DZGA 1VP6A 1H6YA 2VM9A 2YBPA 3AZXA 4XDPA 2RS31 5T3NA 3RDIA 2PHTA 4BM8A 4CXYA 3LPGA 1JZ8A 4LBKA 5A1AA 2W46A 3MYXA 2IWGB 2VJXA 3I7DA 1U5YA 4V1PA 1RUH3 1LJ7A 3WG3A 1S4CA 3J7LA 1GBGA 4PLMA 1GNZA 1VPHA 1AL0G 1XNBA 4W6WA 4AYUA 5H9RA 1U5ZA 4CCOA 4HVRA 2Q0AA 5HPOA 1UW8A 3FLTA 4WBBA 4WM8C 1ZVFA 3AVSA 4ASLA 1LRHA 4UW6A 2VTXJ 5I8TA 2O8QA 5D8AC 2Y33A 1W6OA 2VZ3A 3LIHA 4Q0SA 4I02A 5FBZA 5FYSA 4LBMA 3WW2A 5JSPA 1AR93 2QBXA 3LA2A 4K40A 2HH9A 2XLAA 5FUNA 2FMYA 5FY0A 1VJ2A 1OLQA 3KV5A 3N9PA 5KBFA 3H3LA 1DYKA 2XH6A 1GP6A 4LITA 1XRUA 1W6OB 1YFXA 3ZPOA 3IAPA 3M4FA 3SISA 3T2QA 2ZZQA 2QDRA 3B01A 4UBGA 3THTA 3ZXFA 3WW4A 5KHGA 2KA3A 4CEWA 5IVJA 4B1LA 3U14A 1CJDA 2BW8A 1MVEA 5CU1A 2OW4A 2E7TA 3HNMA 1S55A 1S0IA 1QJX1 2NZ9A 2I74A 5KWRA 1RUD1 3AFGA 1D2SA 3KCXA 3H8UA 2WNOA 5FP3A 2OUJA 3AKRA 4RA0A 4ATEA 2CSGA 1VBC2 1UQXA 4F83A 4NAOA 3R6SA 1JUIA 4V2VA 5EQUA 3N35A 2R061 1AVBA 3JUUA 4QGMA 5FY9A 2XQRA 4MV2A 2WL1A 4QPGC 2R043 5FUPA 2GNDA 3LIGA 1OQDA 4W6YA 2A6YA 2GNMA 3B3QE 3ZYBA 5FQ0A 3J26N 4HKWA 4ZU5A 1O3QA 1AJKA 4XJ8A 3UL2A 2UY9A 5A3UA 3S6PA 4LLFA 3NV4A 2WZPP 3B9IA 5FPBA 4GXLA 4ZPIA 5BNPA 1I1EA 3RZJA 1KRIA 4KBBA 2JDMA 5E8AA 3GDBA 1O3TA 3U4XA 2W95A 5FZ3A 1GZWB 3TN92 2E63A 1WMDA 1TMF2 1IGOA 3BPZA 4FPHA 2Y0OA 4N43A 4XJ9A 3BTZA 1XOYA 5FZBA 4XUOA 4CXXA 2FDIA 1JZ4A 4XF4A 5FPVA 4EE2A 4NPMA 2X10A 4LA2A 1W2TA 2DCJA 3WVJA 5CG9A 5D21A 4N43B 1VAVA 3B02A 3AYAA 3OGGA 5FJHA 1JZ2A 2IZWA 1RGSA 5FZLA 1JOJA 1HQWA 2IXCA 1UKRA 4ISQA 2VAUA 2X8KA 2OQ6A 1FMD1 2P17A 2P3KA 2D98A 3AMHA 1O4ZA 2WQ8A 2QQLA 1WLDA 3VD9A 1J84A 5H9PA 1JOBA 1HRI3 4TXWA 2VMIA 4LKEA 1NQJA 4O9GA 1D4VB 1OH3A 5FPAA 4UXAA 4XW3A 3CKHA 4LUMA 1ZBE3 4RN5A 3HVDA 3MIBA 4BQ5A 1UIJA 1LCLA 1JUHA 4FPCA 1AYM2 1VBB2 4WM7C 4KWLA 5GKAC 3S30A 3V65A 3WQBA 1K3IA 2RMU2 2D3RA 2B9VA 2ZEXA 1RUI1 3QH7A 4FPKA 1J83A 1PIV1 1SLAA 1L3JA 1W6PA 3DYPA 3GNEA 4J25A 2YPDA 1VLNA 1U0AA 2F4PA 1YUDA 4MSVA 3TNQA 1WKYA 4XF1A 5BY5A 1XE7A 3H8OA 1AXYA 4OMDA 4D0QA 1TVGA 1Z78A 3GALA 3VDDC 3N9LA 3S5QA 3MW4A 4OHZA 3M2MA 3Q8AA 3O1VA 2YPJA 1G9AA 2LALA 4NHYA 5FJKA 5LY2A 5I8YA 2VTFA 3IDEA 1HB4A 1NCRC 4H55A 4KL1A 4WM8B 4A41A 1POV3 1RUH1 2ZOEB 2ZKLA 5D8AB 5FZIA 2JEMA 4YFZA 4KU8A 3WX5A 2ZGTA 1OD3A 1UWWA 2CY6A 2VECA 3LDRA 3MPBA 4QX8A 5FXZA 3GM8A 2W9XA 4AEJA 3HOBA 5CVRA 1VBA3 1YIPA 1LNSA 3BALA 3OGRA 4CP9B 5BNNC 4RSUA 2PYTA 2KR2A 1X7NA 3VKMA 5FAXA 1AR91 4BE3A 2WUHA 1QDCA 5L36A 2G19A 1W05A 3P3PA 1PGSA 4A6SA 4D3WA 2VCBA 2WYSA 4AOCA 1K5JA 1DQ4A 4KH9A 1H8TC 3LZZA 2CDOA 4GZ9A 1SEFA 3ZM8A 4C91A 1JYIA 1GP4A 4EN7B 2JKXA 5LBCA 2XJVA 4FFIA 1SDWA 4S2HA 2YXSA 3HJRA 2XLGA 4G3YC 3NWKA 5FMBA 2WFF2 3EB7A 4QT6A 2B7YA 3VKLA 4Z1VA 2ZZJA 5ABJC 5A3OA 2VZOA 2HBTA 2YFUA 1YQ5A 2F17A 2X5IC 1HIXA 3KGZA 1AR83 4BB3A 4CDQC 5A7WA 1CAWA 2VUCA 1V70A 2Z2SB 2OVUA 3I3DA 4QPGB 3RVHA 5DG2A 2BGCA 1QF3A 4H7LA 5FLJA 3UESA 2DTYA 1ACCA 1NLRA 3KCYA 4I30A 2KXLA 5LEJA 1RJ7A 1EV13 2O1QA 4G4FA 4FAHA 2ZPXA 4ORFA 2R041 4IUGA 2NQYA 1AX1A 3OB8A 1W3XA 4NVPA 1OLMA 3BPSA 4R4XA 2V5YA 1HJGA 2ZEZA 2ZGOA 3B00A 4ZXEA 1RINA 5FTTC 5H9SA 4C0HA 3SHRA 2BNOA 1V00A 2W0XA 4PBPA 4COVA 1RUF3 5FZCA 2NLRA 2QVSB 2CU5A 2EXHA 2DUQA 3BGAA 4AK3A 4HN0A 3H7JA 1PGW1 3A7QA 2MEV2 1AYN2 4GH4C 4HXCA 2TEPA 1M4WA 1UPIA 1REDA 3AM2A 4JV4A 1F35A 2PHUA 5FWEA 1YQ6A 4I0BA 1QJFA 3FN9A 3HQUA 3CBNA 5GLTA 4D7SA 4L11A 3I49A 2ATFA 3ACIA 2GNTA 2ZHMA 2JD4A 5LA9A 5F5AA 1XE8A 3CDZB 3BN6A 3PVBB 1E5RA 4XJWA 3THPA 4IXLA 1UN1A 1HDKA 1YJLA 3DN7A 3EYPA 5FZ7A 4QQHA 3HT1A 4COZA 2FDJA 4WM7B 5KC6A 4XXPA 1ZBE1 4XF3A 1RHI2 3OOXA 2YC4A 4E9KA 1XPWA 4EN9B 1WD3A 2PHLA 1QJU2 4GJZA 4I09A 4MVTA 4PI2A 1RVF2 4BOWA 3WP5A 2XB6C 4LO5B 3OCPA 3FL7A 3RJRA 3ZFFC 1NCRA 4HMZA 2YMZA 5FY1A 2ADEA 2WZ8A 4HETA 4QGNA 3T08A 3VDDB 5F3IA 3WHTA 3WCSA 1IZ3A 4KWJA 1NX9A 4AFCA 1R64A 4LULA 3HEIA 2B42B 3M3OA 1ZZ9A 1DBNA 3WUDA 4IE4A 1J1LA 1NCRB 2ETEA 1F31A 4LNVA 1BQPA 3W20A 4XFFA 1PNGA 3INAA 3ATGA 3POYA 2WIIB 4BQ3A 5J96B 2AC1A 3WF1A 1K45A 1CGPA 4DY3A 1G86A 5IHRA 1POV1 1ENRA 2O8OA 3I2IA 3LQCA 4EROA 4JKKA 2AACA 2DDUA 5J48A 5BNNB 1CAXA 1H8TA 4JVAA 2Q4SA 2RS32 5A32A 3DXUA 1WW5A 2QQOA 3JU9A 5GZEA 1FNYA 4GULA 4FCAA 2JE9A 1TE1B 2J22A 4BXFA 3TN93 2ZKNA 1UPSA 1G6NA 1VBA1 3R4UA 3WQ1A 1TMF3 4DXRA 2FCVA 3I54A 3QD6A 4BISA 1CAXB 1H8TB 1J3PA 4ARYA 2DCTA 1LODA 2DVDA 4MO3M 1VMHA 5GM0A 5HCAA 1GMMA 4OI4A 2GC1A 4UFKA 4CDQA 2ZAHA 1GOFA 4EWAA 3PTYA 3PU8A 4QX5A 4BLIA 3DYMA 3I2JA 1Q3EA 4FPJA 4P02B 5ABJB 1SBEA 3ILNA 4K7JA 4ISRA 4YW4A 4CSWA 3PVEA 3I2OA 1PVXA 3WG1A 2X5IB 3QCWA 3KD4A 4CDQB 2AZ5A 4CUBA 1ALYA 2JB4A 2Y6FA 2A3XA 4Y1YA 4ZY9A 1W39A 4PBOA 3H0OA 4GIQA 2QQNA 1MZEA 2R7EB 1AR81 3JBG2 5FPUA 4DNYA 1LULA 1BBT1 4IV3A 1ZX5A 1AYM3 4AVTA 1VBB3 1RUOA 1QJX2 5A7NA 1RUG2 3AMNA 3B5LB 2RMU3 2V5DA 1EV11 1DQ2A 2VQUA 1GNYA 2WLPA 4SBVA 1RUJ2 2DBNA 3ETPA 1OC1A 1K5MC 5FMDA 1FYUA 3URFA 1Z0HA 2XONA 1EPWA 3UJOA 1VMJA 1N1VA 1UOBA 3NNFA 3TEXA 1RUF1 2DCYA 1X82A 2R062 2Z4FA 2RE9A 4MGZE 1Q43A 3BKZA 4LO8A 1ZM1A 1B09A 4GH4B 1SMVA 2VVDA 5F39A 5FZFA 3VBOC 5J1XA 2D6NA 1OA3A 1PVC1 2WKKA 2HYKA 4N9HA 5LASA 4RL7A 4AI9A 2XJRA 4XIOA 5EXOA 3GZAA 1TME2 1H9PA 1YFWA 2GP5A 5FZHA 5IYYA 2JG8C 2ET7A 1ZRFA 2LM3A 2XVLA 4QDSA 2VOVA 3T30A 1BVVA 5JDBA 5EFUA 2XDVA 3U75A 4M3CF 3E6BA 4QKFA 5ISLA 3CU7A 5SV5A 3ZIXA 2BQPA 1XNCA 1W3VA 2PHRA 2VUAA 5C3RA 2AUYA 2CNAA 5J09A 4QX0A 3VV1A 1REEA 2WO7A 3CNAA 3U1XA 2FZ1A 2X05A 2UWCA 1T2XA 3PJQA 1PK6C 4BU2A 4Q26A 1IQDC 1A8MA 3ZVXA 4G9SB 1OOPA 2WNUC 3ZFFB 1VRBA 1OD5A 3PNAA 2V4VA 4P9LA 5FYMA 3RRDA 3RWNA 1FMD2 1ZZBA 2R0FA 3PL0A 2CWSA 3OBAA 4RGGA 4AGGA 5L7OC 1SACA 4CU6A 3IIAA 4Q8KA 1GWLA 1CVNA 2X29A 4PQQA 3PTRB 4R9DA 3WY6A 2CAVA 3VB9A 4A7KA 4WVMB 1VBC1 2X09A 4FP2A 3LSDA 2J1AA 2EIGA 4LK6A 3WNXA 4L92A 1RUI2 2PELA 4CCNA 4DIQA 2FDFA 2GDFA 4IEWA 4NRPA 4Q8LA 4KG0A 3S7EA 2CGOA 1PX3A 3SMHA 3ZXKA 4BQXA 5JSOA 5IVFA 2FCTA 2YV8A 4K9SA 4NN0A 4AI3A 5CFCA 1RMU2 5FO9B 4FTSA 2NN8A 5F32A 2DURA 1X8MA 1NQDA 2GALA 1WCQA 5BNQA 5FZGA 2DV9A 1G9BA 4LORA 4EN8B 3USSA 4B29A 2BVBA 4UAPA 3RI9A 4D7YA 2QE3A 5BNOC 4LXLA 1KJLA 1BEV1 1O6UA 3A22A 1TMF1 3K51A 2BYVE 5JIUA 3AL6A 1AYN3 1HV0A 1IHMA 5A3TA 3MF6A 2IUWA 4Y24A 1F4AA 3IPVA 3N9NA 4E8CA 1VB2A 1R1ZA 3O12A 3FJSA 2YB7A 1UU6A 5CFDC 2AEYA 3SLIA 5LY1A 2PHXA 1SQ4A 4Q27A 1W8NA 4CTEA 1W90A 1S0JA 4DUWA 2GSYA 3VZOA 3JZVA 2PAMA 3U78A 5IVBA 3KSCA 1QJY2 2GC3A 5FOBB 1H1AA 1JS9A 3T09A 2JX9A 1OSGA 4J1WA 4QU1A 1K5MA 2WSUA 4EWDA 5CNAA 4MGYE 5FZ9A 3SQOA 2XXZA 1RHI3 4BMEA 2VZ1A 1OF4A 2GMMA 2E51A 3PVOA 1AYM1 1DGWA 2RS51 1VBB1 1F4HA 1ND3C 1K5MB 1PMIA 1GUIA 1QJU3 1QJZA 1RVF3 4GMP1 4YVSC 5FZ4A 5JLVA 3ZN5A 2MPFA 1GV9A 4UFHA 1UNBA 5EZWA 1A8DA 4L0PA 4AWDA 3VBOB 5T5LA 1LHWA 4YG0A 1W0OA 4P9JA 2WYFA 5A3MA 2P34A 4YM2A 5D1IA 4YNIA 1HN0A 2GAUA 3NNJA 1SPPA 1CZTA 1XB9A 1D2QA 2P1BA 1UL9A 2FBEA 2JG8B 2JIJA 3PJYA 5GLUA 4B3NA 4N7UA 1XQNA 5F9TA 1QXPA 4YLZA 5IFPA 5FIXA 4D69A 5AVPA 2RS33 3BIEA 2DU1A 1NXMA 1PK6A 1VAKA 4BCUA 3AMPA 4MGSA 3T4VA 3R0RA 4DINB 2Y6LA 2WNUA 1W99A 3K4AA 1PGW2 3N7KA 4PT6A 2JWPA 2R49A 1CAVA 3E6DA 4NR1A 3UNPA 1PK6B 1GYKA 4XQWA 3K46A 4I2OA 1D0GA 1OFSA 2WNUB 4GQ7A 2A73B 4XZPA 4HBNA 3WT3A 4Y1UA 2YGLA 3WF3A 2P6HA 2E33A 3D0JA 5A33A 4AHXA 5A6YA 4LT5A 5L7OB 3VZKA 3LEKA 3OEAA 2Y6JA 1DP0A 2WRAA 3FUQA 4URTA 1R091 2QQPA 1Q8OA 3OPZA 1W8OA 3VBUA 4ITCA 1F5FA 2PTMA 2WFF1 3KVAA 5I0DA 4BLJA 2JENA 5FZOB 5A33B 2XWBB 4V2WA 5LBBA 2OA2A 3GYDA 5DUUA 3VBHA 2XKOA 2WNVC 4AFBA 2ZEYA 1EAH1 2BU9A 4OFGA 3UT0A 3JBG3 2B39A 3NQHA 5KHKA 4QGLA 1NA1C 2E9QA 1O4TA 1OMIA 1QJX3 1RUG3 2OT7A 2Z5WA 2SBAA 3O14A 5IATA 2XHNA 5KHHA 3HAGA 4LKDA 1U5XA 5FLIA 2WAAA 3AVRA 5FP9A 5BNOA 4MGTA 1TEIA 2FMDA 1RUJ3 1S0DA 4KQ7A 1ULCA 2ZXQA 5HXMA 1ULPA 1H2LA 2H0BA 2Y0IA 3EQEA 3MIEA 4LBQA 3U11A 1F2NA 1NY71 4ES9A 4HK9A 4AR2A 1PZ8A 1QJEA 5KXBA 4JQRA 5BNOB 2R063 2CV6A 5CFDA 3ZFEA 1M06G 1ZRCA 4O65A 4CDXA 5EYXA 4EN6B 3EMRA 2ZGPA 5CBLA 1XC6A 1YXWA 2JB8A 4XBLA 2AEZA 4AI8A 4CPBA 1WW6A 3OG2A 2MEV1 5CFDB 1W03A 5JXHA 5IK8A 1TME3 3TNPB 2VULA 3OSDA 2QQJA 3GJAA 4XFIA 1OT5A 3BOWA 2EXIA 4CDWC 4BIFA 4UW5A 1OKOA 3MW3A 4RD7A 1LKNA 3DL3A 4RR3C 1WW7A 4TSVA 2GP3A 3DYOA 5JI7A 4XHXA 4WV8A 1FV2A 3ZXAC 1VR3A 2A7AA 3PVNA 3MUZ1 4QMAA 3X29B 5FKBA 4AXOA 2W92A 2VW2A 1WA4A 2DVBA 2EIDA 1V9U2 2VVEA 5EHDA 5I93A 3OEBA 1ND3B 2RG4A 4YVSB 4A7ZA 3SXWA 3WDYA 5HBAA 3AYDA 1LEDA 2JIGA 2XUMA 1UD1A 2HWB1 4LOTA 3WP3A 1EPZA 1FMD3 1LGNA 1QJU1 2XR4A 1C1LA 1RVF1 4UFLA 4WZFA 3RYRA 3MIHA 2VG9A 1OF3A 2YC0A 3BYWA 5I0TA 2W87A 2ZBJA 4QX1A 5DAXA 4XILA 2VW0A 1C4RA 2PAEA 1JBCA 3AP7A 2F4LA 2ZGLA 2GU9A 4QQ2A 1BBT2 4YW7A 3I8TA 4WVVA 1LTEA 3MF9A 3H8RA 5JR7B 3O0VA 3BI3A 2DFCA 4R9BA 1RUI3 3WNMA 2RJLA 2BNMA 3WEZA 1C28A 1X9TA 2TBVA 1W8TA 4IE6A 3T1LA 2N7GA 4RS5C 4AHWA 3I2HA 2VOKA 5GLZA 4HFSA 1DGLA 3MFAA 3OGVA 1A78A 4A44A 4FPOB 4XEZA 1RMU3 1WW4A 1JZ3A 3HWJA 1TNFA 3BB6A 1I6XA 3W21A 3NV2A 2PXJA 2ET1A 4YM1A 1URXA 1QOTA 2PHFA 2R6QA 5G04L 1W2AX 1PVC2 1VB4A 4P9GA 3ZN6B 4XMAA 5F1RA 5JMCA 1NOVA 2FQPA 1AL22 2I07B 2ZCWA 3NO8A 3MBWA 1J1TA 1CAUA 3VDBA 1J58A 1Z7S2 2C0ZA 2E7QA 1LECA 4LHSA 5FKCA 1LOFC 2ZS6B 4OHXA 2XPJA 1DU3D 4YVWC 1QMJA 4NPRA 2GMEA 1JYCA 4Q4X2 3S5AA 4NPLA 2DUOA 4YWAA 3WF2A 4XUTA 1IG0A 2JDNA 1CAUB 1NA1A 3ZXGA 4CP0A 5LW9A 3M1HA 3HR9A 1R081 1XU1A 5FYHA 1A3KA 1JHNA 2WQ4A 3IAQA 2WNVB 5DUXA 1QJY3 1UY1A 3C8XA 1C5IA 4P00B 4XOGA 5H9QA 2Y64A 4MYEA 3RGBA 1NA1B 2R0HA 4NO4A 1W04A 3UGHA 5E88A 3VKOA 3MV01 1H30A 1H1IA 2LS6A 3JB8A 3AB0A 5A3PA 1AF9A 3T2OA 3JBG1 1JHJA 4FI9A 4M01A 4U2AA 4NHMA 4OUSA 1O59A 1F9KA 3FE5A 4Z8BA 1OKQA 1F8VA 4XFBA 1Q56A 1RUG1 3GZEA 1WWYA 1ZREA 3WQ7A 3WG4A 4LHKA 1RUJ1 4I01A 4A45A 1AX0A 5FXWA 3VHPA 3PDQA 4MOAA 1W8WA 3VDAA 5C3SA 2XJSA 4A3ZA 2WJSA 3VHOA 2ZACA 1MS4A 4P5YA 1EUTA 1Y43B 5JOWA 5CKMA 1QY4A 1W28A 3ACFA 4QHBA 4XMIA 1W9YA 2P2KA 2IXIA 5FZ1A 1ULOA 1GZWA 4CDWB 1ZRDA 1PHMA 1MQTC 4Q2FA 3FZ3A 1ONAA 1TME1 4W8JA 4Y5SA 1P8JA 4RR3B 3WDUA 1VIWB 3BTXA 3N36A 4I0WB 4XE9A 2WLQA 5FK8A 1ENQA 2WINB 3BIWE 4JGZC 4Y26A 1ULEA 2CL2A 4XUNA 1BEV2 3VHNA 4DXZA 2D6KA 3DV8A 4JRAA 2WN3A 3FLPA 2W08A 1CX4A 2WR9A 3IN9A 3M3IA 2BOJA 4P9XA 3WD5A 1YO8A 1MS3A 4Y3OA 5G05L 4CUAA 2VBDA 2J1RA 1NKGA 4Y22A 1OUXA 1YYNA 2VD7A 1BK1A 1JI6A 3LKJA 4SLIA 4YGEA 2WZEA 4IGPA 5FCCA 5IT6A 3UETA 3ACLA 4RQPC 5KXEA 3IMMA 5C4WC 1MVQA 3VGIA 1GOGA 1XNAA 1O8PA 3M70A 2VY0A 1W2NA 4MXVA 4Y22B 2IXJA 3V0BB 3ZKYA 1ND2C 3S0MA 4YM0A 1W0NA 5EJ3A 1SBFA 1QOSA 1W9WA 1LU2A 3RI8A 4RS5B 2Y60A 5IAVA 2RS52 3FHIB 4NWVA 4YM3A 2R1BA 4CVUA 5GZFA 1ZNPA 1JXNA 2A1XA 2QQWA 3FUOA 1IG3A 3FFQA 3SCGA 1H2MA 5JVVA 1W8ZA 2QZ2A 4MGKE 4XFHA 4Z92B 1LOFA 1FXZA 2RJKA 4UYBA 1RMU1 1DDLA 4ZS2A 1IPKA 4WM8A 5BV6A 2Q1ZB 3TBDA 5C5TA 5F2WA 1W6QB 3ME2A 5D8AA 4LE3A 3MHZA 2VO5A 4URAA 3GBWA 4MH0E 3H8XA 1IS4A 2W47A 3C7GA 5EYYA 4YVWB 1ZBA1 4LOSA 4BJ0A 4BQ2A 5K7PA 5JUVA 3ZXEA 5LA2A 4CP9A 2ES3A 3IBMA 3IWZA 2VCCA 4KU7A 3TEYA 5I0UA 4PJYA 1AXKA 4XURA 1YNAA 3CF6E 1XNTA 2F6BA 3TWIA 1QNYA 1GWMA 2P5BA 3WLUA 5FR3A 1Y7BA 1H4HA 4E2GA 3EJKA 3OGJA 5EJZB 1FT9A 3KGLA 4TLFA 4JHZA 1HJFA 1Q8PA 4TLGA 1QJY1 3MLKA 3ZR5A 5C3PA 2WT0A 3HIFA 3HN1A 4L9BA 4X8NA 1DQ5A 4P14A 1V9U3 3MI8A 1EYBA 5DUWA 1UF2C 1V6LA 1YFYA 2V09A 1R092 3OD0A 1NZCA 2PHDA 2D7FA 4RGAA 5IVCA 4QPGA 1OVSA 1AR71 4DPNA 4B4QA 1JH5A 5C3OA 2A6WA 4C0BA 5BXXA 4CCEA 1OLME 3OBRA 3ZYFA 4YARA 1EAH2 2WS92 3FWEA 1XYOA 1COV2 5JZGA 3S57A 3B94A 1BBT3 1GNHA 1RJ8A 4KWKA 4ZZ8A 2W2IA 2WQZC 5I8SA 5T5OA 1W9TA 4JGZA 1LHOA 1SDDB 2OS2A 5FLHA 3SCFA 4LIUA 1EP0A 1ZA7A 3RZGA 1MQTB 2G4IA 1E5HA 2CHHA 5F6KA 3USUB 3VKNA 4AHZA 2VE1A 3LDKA 5FK7A 1S0EA 1PMHX 5EP9A 1Q5OA 5FRAA 4C1WA 1H1MA 3IKWA 2C4XA 2CTVA 1NY72 5ERLA 3I2GA 4JGZB 3UK9A 2IC1A 1WA6X 4YW6A 3KCCA 4IEYA 4XFAA 2OX0A 2W5FA 4CU9A 1CWPA 2IFRA 2D6PA 5ACA2 4OHWA 5JOZA 4LJHA 3LOBA 2VR4A 3WUCA 1PVC3 1LGCA 4RHV2 3AP4A 3SC7X 2A70A 4FQ4A 1AL23 4RQPA 1UX6A 3OUHA 4E8DA 4R9AA 2VMFA 3M3QA 4Q1PA 5AC92 4W6XA 2DUPA 1Z7S3 2QZ3A 3RMXA 3U10A 3ZSEA 1XBFA 4OMCA 1LHVA 4X6RB 1ND2A 3WDXA 2J1TA 1U12A 2UY8A 5L73A 5B2GB 1RL3A 3RS6A 4QHOA 4Q4X3 4RQPB 1DYOA 2G1MA 5C4WB 2Q30A 2WWJA 1MEC2 2YZ4A 4ZU4A 3JQXA 5LATA 4WM7A 5EPAA 3RWKX 4DEVA 5CISA 2QQUA 1SLIA 3ES4A 1ND2B 2JD9A 2BWAA 1JYTA 3B9CA 5JI9A 2E6VA 4XUQA 3MO4A 5F8PA 5FOJB 5JMOA 2OKXA 5KHJA 2NYYA 1WCDJ 4BZ4A 3VDDA 2HWB2 1YEWA 3ZX7A 5JCTA 4JQTA 4NIGA 3VL8A 2D3PA 4QPIC 4NRMA 3ZXDA 1S0CA 3LWCA 4C8DA 4FTBA 1YJKA 2Q8DA 1HQNA 5AVAA 3RSJA 3V0AB 1O8SA 1X8EA 4MGQA 2ZX3A 1UY4A 3B93A 4ARXA 3WR0A 4UBHA 1HB2A 2W1QA 4LBNA 4LLOA 1RUC1 1VBC3 3U0ZA 5IW0A 4AQ6A 4TZDA 3E1F1 3ZYRA 1LOAA 3LA3A 1FNZA 5DAQA 4AG4A 3CLPA 3P3NA 2YY1A 5FPLA 1W2OA 1WGPA 3ON7A 3VBRC 2B45X 4FFFA 4P9IA 4AW7A 4D6RA 5BNNA 4BYYA 1KS4A 4XDQA 5FV3A 1H2KA 1W8UA 1UIKA 4FVVA 3MIFA 1PMJX 1GICA 2EXKA 3AFKA 5F5CA 5F7UA 5JZGC 3P6BA 3SH4A 1US2A 2JDYA 4ZZ5A 2J1SA 4HPKA 1YQCA 4QU2A 2W68A 1KFXL 4DB5A 4KGGA 2VMCA 1BEV3 4Q4Y1 1DLCA 4OQ8A 1FOD2 4GWNA 3IM0A 5ABJA 2J1VA 1JU3A 2RDQA 3Q8FA 5A3NA 2ENRA 4HPKB 1CQ9A 3CMGA 2X5IA 3AYEA 5JOYA 1WMXA 5L9VA 4NIHA 1O5LA 4D6SA 3HNYM 1V9U1 1D4M1 1GWKA 1UCXA 3FHAA 4OUMA 2VNVA 2K2SA 2P3JA 1R082 2W1UA 4YFWA 3WP4A 1W8HA 2PMWB 4QXKA 2RDSA 4N8MA 4QXBA 2RV9A 3I59A 5C8CC 3WNNA 3I3MA 4QWNA 2JG9C 1CIYA 2H0VA 1QH7A 3VD5A 1HLCA 4AEKA 4CCKA 3NAPC 1RUNA 3AXDA 4QB6A 3I59B 5FZAA 1DFQA 4NMIA 4XQ4A 1O91A 3POIA 1K12A 2VZQA 4FPYA 5JWPA 2WABA 1WUVA 1TZOA 3NW4A 1BJQA 2RS53 1KQRA 3PUHA 4PIXA 4GMP3 4PQ9A 5K4LA 4D7TA 1W9SA 3SKVA 4BWOA 2BV4A 5C9AC 4W4ZA 2OYZA 4I3GA 3NMBA 1GU3A 3LPFA 2J1EA 2HWE1 2D5HA 4GH4A 4HN1A 2D93A 4HSJA 1LOEA 1HV1A 4IEXA 2HWD2 1UYYA 4GB32 3F2ZA 3LGRA 2VNOA 5FZMA 4CXWA 4FBFA 5LK7B 1C5HA 4Y33A 3VD7A 3CZUA 4CUGA 4E4SA 4YG3A 1ZZ7A 3O1OA 1AHSA 4QKNA 1PZ7A 1AL21 2YFZA 3TB0A 4PF1A 1AXZA 2Q1MA 3KB5A 3UV9A 2FDHA 4IEUA 1YWKA 3E97A 3KS7A 1Z7S1 2W94A 2YBSA 2OIIA 4F7ZA 1OH4A 4DUXA 4TTGA 1S0BA 3CJIC 2BFUL 1QOOA 2WO2A 1H4GA 3BTAA 5FDBA 3RNSA 4Q4X1 3SKJE 3GXUA 5I0SA 3SITA 4BMBA 2ZMKA 3L2YA 2XLFA 3PIJA 3G7DA 3PUIA 5T50A 3M7AA 3CQOA 3NJVA 3SCHA 2BWCA 2AH2A 2SLIA 2V73A 3C3VA 1E5IA 3OBTA 4KBZA 3H3UA 5FMCA 4CE8A 3ZFFA 3WP6A 1JOPA 3L9JT 3K4DA 5LRSA 1I9RA 1LU1A 5B4NA 1QH6A 3ZLIA 2UU8A 4XC9A 1MR5A 2WT2A 4QPIB 5FP4A 4IDZA 5CIRA 4F8AA 4HG6B 3ZYIB 1R093 1QXRA 2NPIA 3O7OA 4RYDA 3O1TA 4XPVA 5IVEA 4AAXA 2WFF3 4WVMA 2ARBA 4JZRA 3VBRA 1IS6A 4M0NA 2GN7A 1EAH3 4A3XA 3DPRC 3VBOA 2WS93 5DZGA 1YC61 1COV3 2PN5A 1B35C 3NSTA 2K9ZA 2PFWA 3CZJA 5T52A 3ZO0B 3VD4A 2B5HA 3Q9OA 3VBRB 5IFTA 4UW3A 5FFOC 4IGQA 4DRVA 5K0UC 2VW1A 3VD3A 2QNKA 2FD8A 1MPXA 1QQP1 3KV6A 3MLJA 4XETA 4H2AA 4A42A 1SBDA 2HEYF 2ZX2A 5JZGB 1SZBA 2ZA9A 1N3PA 1JTZX 1OA2A 4DS0A 4X6QB 2FDGA 4MADA 1N1YA 2WZR1 2C9AA 4M3CE 3HT2A 1O7FA 1DQ0A 4XF0A 1CIWA 4OHVA 1J3QA 3D3AA 3DKWA 5A70A 1YI7A 3B7MA 3BODA 3PLQA 5ACA3 2DFBA 3LOIA 3ZSJA 4Y20B 4AFAA 4RHV3 1ZBA2 5FXXA 4UT5A 3ZOIA 1RIRA 2MEV3 2ZGSA 1UZ0A 3WQ0A 1STMA 1Q8QA 3ELNA 5AC93 2BP6A 3GZTB 4A2UA 5E6HA 2VNGA 2OPKA 4BQWA 5IK5A 1RXGA 2TNFA 4OQ9A 4QAWA 5GALA 5C8CB 1GSLA 2NMOA 4Q1RA 2YROA 3ZYHA 1WCUA 1VRH1 2JG9B 5JXJA 5LA1A 1MEC3 2D6LX 1OVPA 4M4PA 3AMMA 4NIDA 1OPMA 3NAPB 2D44A 1W6MB 2D6MA 4FPLA 3OUIA 4JGYC 5FYBA 4BQ1A 4Q0PA 3AKQA 2R16A 4E2QA 4LUKA 1GFF2 4YGCA 2Y8KA 1Q8SA 2CGNA 3MDPA 3AJZA 4TYSA 4QX3A 4CRQA 4UFMA 1DLLA 1OXCA 2LRPA 5C9AB 5SV8A 4HANA 3GHMA 2WA3A 2YGMA 4K20A 5JAXA 2HWB3 1V6OA 1AR72 4XZUG 4AF9A 1IKPA 1HX6A 1EUUA 2R32A 3LEIA 1S2KA 4FFGA 4KG8A 3ZKUA 2VPVA 3LEGA 2QQIA 2RDNA 3TYJA 4YZ2A 2YDEA 4COWA 2RR11 3A21A 4PIZA 3DUIA 5C8WA 3WF0A 2VMDA 3WDVA 2JG8A 3AKPA 3LF7A 3V64A 3O0XA 2DVFA 4LPLA 2JECA 2YG0A 4XVHA 3WNKA 2WNEA 3KVBA 2HWF1 3WDTA 3UKVA 3PUAA 2H6CA 2ZHKA 1CZSA 1LESA 1TNRA 2XMLA 5JXGA 2OZJA 1UXXX 3R05A 2BFUS 3KWVA 4UOJA 3CJIB 2IXLA 2X53S 4AE2A 4NE9A 4CU8A 5C7GA 3T3YA 2C1FA 5IWFA 3TOJA 4DY5A 3WCRA 4CEYC 5J36A 1NE6A 2AREA 3I3EA 3Q8CA 2VMHA 1J59A 1RC6A 1PO12 4FPGA 3IDAA 5IAXA 1FOD3 1W0PA 4Y5Z0 4AEDC 2QQKA 3JD72 1HKDA 4IEOA 5L7OA 1GLHA 1UKGA 1NG0A 1OFNA 2CDPA 1NXD1 2E53A 4FXGB 3ZFGC 4AGVA 4B1MA 2WWUA 1O4YA 3NVCA 3ZYGA 3NJXA 3ZIWA 3PUSA 3U07A 5FZOA 3D0SA 4LQRA 3HD8B 1R083 2D3SA 2OPWA 4XJUA 2ZGNA 3DPRB 5BYNA 1CPNA 1DZQA 1B35B
chains in the Genus database with same CATH topology
1XNDA 4S2GA 1G7YA 2ZHLA 3KMHA 4IV1C 4LE4A 5K0UB 1DHKB 2ZGMA 2NM1A 3ENRA 4LHLA 2WS91 4FO9A 1COV1 3NV1A 4JRLA 1CN1A 4IEQA 1ZRRA 2ZMLA 1ENXA 4AFDA 3ZDSA 4ONUA 1ULFA 4AQTA 5AFEA 1GR3A 3ZN4A 2XBO2 4FXKB 4K1ZA 3ZSMA 1RUC2 1NE4A 3B69A 5TSWA 1EY2A 1PNFA 3SH5A 2BNNA 2HWC1 2HWD3 1XXNA 4GB33 1X33A 2G9GA 2MHFA 1DIWA 1T6GC 2AGSA 4IQPA 2I45A 4U36A 5ACA1 1CESA 4L8QA 3ZXJA 2DCZA 4RHV1 2AENA 4CZSA 2ERFA 3RPQA 5AC91 4AVBA 2TUNA 3J8F1 3ALQA 1H9WA 1O5UA 4MX3A 4PDWC 5DDJ1 3AKSA 1BZWA 2Q5TA 1BKZA 4JGYB 4CEWC 4Q4Y2 4Z82A 1MEC1 2CAUA 3HBZA 1ND3A 4YVSA 3I2DA 4COYA 1CPMA 5FREA 3IMNA 4MXWB 1IS5A 2ZX0A 2E7AA 4BA6A 5F5QA 1D4M2 2VXRA 5K9YA 3GZUC 1QXJA 4PF5A 4A7YA 1SCSA 2LUWA 4PLNA 3KQRA 4KGQA 1DGRA 4GWMA 2VU9A 2R071 4XBQA 4K21A 2XHKA 4F3JA 3ILRA 3N7MA 4Z07A 3RG0A 2ILMA 2UYAA 1ULGA 3NKTA 4Y4YA 1C1FA 1MS0A 4LHNA 1KXGA 5BNPC 2D43A 3MPPG 1Q8VA 4FP3A 3CL1A 2ZMNA 2HWE2 3OY8B 2GNBA 1NLSA 4FPEA 4AEDA 4CEYB 3ZN6A 4LBJA 3J9SA 3ZFGA 5CB7A 4FOQA 3W59A 2Z42A 1IPJA 3AP5A 4AEDB 4HKOA 3ZXLA 3ZMOA 2R30A 3ZFGB 1RTVA 1ZBA3 3UKNA 1FOD1 2WA4A 2PA7A 5I91A 4E4DX 1PO21 4IV1A 1R1A1 2WNVA 3G6JB 4JDMA 1OI6A 5LK5A 1APNA 4IEPA 2D97A 4E27A 4AHYA 4JDOA 4XTMA 3EO6A 3H1MA 4P9WA 3AJYA 2ZGKA 4IV1B 3WZ1A 1V6KA 4JCKA 1KS5A 3WDWA 2A5ZA 2C5DA 2ZGQA 5A3LA 1LOCA 1ZYBA 4N9IA 4Y1ZA 3JB4C 1AR73 4N7IA 3WW1A 4META 3WG2A 3LB9A 1V6MA 2B8MA 2GN3A 4LBLA 1O3SA 3QOPA 1HRV1 1FATA 4PDWA 2NMNA 1JN2P 4CDWA 2A3WA 2HWD1 4GB31 1QQP2 1FV3A 5HI0A 1ASJ2 4EWEA 4L2NA 4RR3A 1FPN2 2DCKA 4PDWB 1H0BA 2GZWA 4M00A 3H9AA 1ZZ6A 2WZR2 3AXEA 5E89A 2Y38A 4CEWB 1SLTA 2AR6A 3E5QA 1N3QA 3E5XA 3ILFA 5JOXA 4I3PA 4XQDA 4B7KA 2B9UA 3A0KA 3VLBB 2XJQA 4X8PA 2B46X 1PO13 3JCIA 2XWJB 2HEWF 1KDMA 2RM21 3RYPA 4QM8A 3OJBA 4OVEA 3MW2A 2PAKA 1PM7A 3JD73 3VHRA 3J4UH 2W52A 1YFUA 3EHKA 4YW5A 1VRH2 3V0BA 2QCSB 4D94A 1SLLA 3MLLA 3AKTA 2HEVF 4PLOA 5FQ0B 1FAYA 1UMZA 1PGL2 5J7MA 3VBFC 3BU7A 2RHPA 4IETA 4RS5A 3VN4A 1H2NA 1N1SA 1Y3TA 2UWBA 1KITA 5BNPB 2UYBA 1LOGA 2BUKA 1UU4A 1C8M1 4KNCA 4Q4V1 3POSA 1QNWA 2DU0A 3KM5A 5J37A 2GMPA 2JKBA 2VH9A 5HCFA 1HXS2 4HZFA 4FT8A 2UWAA 1MS1A 3A4UA 4O9EA 5K8SA 2DWRA 1W6QA 1XNKA 2RR12 2XBO3 3VBSC 4CYDA 3M3CA 1GZCA 3ETQA 4BIOA 4C90A 1RUC3 1VBD2 1G8WA 3DF0A 1C8NA 5LRRA 2FZ2A 4YVWA 4P5HA 2HWF2 1YI9A 1YHFA 3WHUA 3D5OA 3OTFA 2JDZA 1VAMA 3W9AA 3KLSA 2DF7A 2VOWA 3HMYA 4AQSA 2Y26A 5IK4A 1WLWA 1TQ5A 1RUE1 4OLLA 1NYWA 4NHLA 3AZZA 3O5SA 2RS12 4YGBA 4Q4Y3 1AR61 4LR4A 1W6PB 4NHKA 2XL9A 4L97A 3VZJA 1QDOA 1Y9QA 2ZHNA 4YZ3A 2IXKA 3NKGA 1BVP1 4GKXA 4B8EA 1D4M3 2BPA2 2XVKA 4HVQA 1MZ5A 3VL9A 4MUVA 4XJAA 1GANA 2AYHA 2A6XA 2ZGUA 3RJ2X 5C33A 2DTWA 3SH3A 4AI0A 2D5FA 1MQTA 1N1TA 4JTNA 3USUA 5DUVA 1UU5A 5EWSA 2Z79A 5KHIA 3NJZA 3H50A 4K1YA 2WC2A 1U5IA 4N90A 1UAIA 1X50A 5KC5A 2HWE3 5HCBA 3MFCA 1YCIA 2CYFA 3BOPA 2HWC2 4M0HA 3PHMA 1VBE2 3BCWA 3VKFC 1OLRA 2ZX1A 4GALA 1W6NA 5T5PA 1PO11 3N4MA 4AGRA 3NL1A 2EF6A 5C4WA 2PLV2 3VBFA 3ECQA 4WVZA 3JD71 5KXCA 3J8F2 1CAWB 1MACA 5DDJ2 2I2SA 4S2DA 4E2SA 1WMEA 5FO7B 1W6NB 4AQ2A 4E4ZA 4HK8A 2XGXA 4LEJA 3CO2A 2P3IA 3VBFB 2ZJCA 4DQAA 3T2TA 4IV3C 2QKDA 1LENA 3R4DB 4Q4W2 3VBSA 4LO7A 5F6LB 1UZZA 1XU2A 1DGRN 1F5JA 3WOGA 4RFT0 1SLCA 3V0AA 2ZTNA 3JQWA 4OI2A 2PHWA 1BMV1 1QWRA 3VBSB 2R072 1LHNA 4S2FA 4TWTA 4OI1A 4XXAA 3N7JA 1H8VA 3ZYPA 3OYWA 1NCQC 4LTAA 1LB2A 2A6ZA 2XBO1 3LCPA 1AJOA 5GLVA 3LA7A 3FBYA 1ENSA 3ROUA 4ASMB 4HLTA 1HRI1 5AFBA 3OYWB 4XFCA 1QQP3 1ASJ3 4B4PA 1GKBA 3QLQA 3GBFA 1FPN3 5DZEA 1LR5A 1J3RA 1WCSA 3D82A 3D4KA 1D0HA 2WZR3 2Z69A 3WINE 4CDUC 2A6VA 3T1MA 1WD4A 5GJ6A 4LBQD 1SLBA 5CADA 1YRZA 4AVVA 2EA7A 1WLTA 4IEVA 2DYCA 5L19A 1OOPC 1REFA 3KZ4C 4EV0A 1A6CA 1PO22 1R1A2 4FOWA 3E5UA 1HW5A 4LBOA 1DF0A 4XF9A 4IERA 1QHDA 1VRH3 3DGTA 4QQOA 2DVAA 3HQXA 4IEZA 1SFNA 3AK0A 4LO4B 4FTEA 1VALA 2QDNA 5A32B 1AUYA 3A0NA 5CFCC 2EAKA 2XKPA 1HXS3 2JJ6A 3MIGA 2RR13 2P37A 4J1XA 1HRV2 5CG8A 3SNMA 4OI0A 1VBD3 1WBFA 4AEMA 1I3HA 5IUQA 2HWF3 1KJRA 5FMOL 2EALA 4XFGA 2CWMA 4ZU7A 1LGBA 2K0GA 4CP1A 3AMQA 1RUD2 5JSRA 1GZ9A 5LEKA 3MIDA 3AZVA 2VUJA 1QKQA 4AI1A 4IV3B 4DMIA 4DOUA 5DG1A 2XJUA 5JIAA 1QU0A 2A71A 4OULA 1DZTA 1CONA 1FI2A 1UZYA 2RM22 2RS13 4MZUA 4YRDA 1LEMA 3MZHA 4QPIA 4YZ1A 2BBVA 1DG6A 4W65A 2XJTA 1JW6A 4BPZA 4YW3A 1NCQA 1V6IA 4AI2A 4PCRA 2HKXA 5FPXA 3W58A 2DVGA 1CD3G 1NCQB 1N47A 4OZXA 2VNRA 1OHFA 2FHRA 3IT8A 2YUEA 2WT1A 4EJRA 1KD7A 2BVVA 4N53C 2GC2A 3GHNA 4MLOA 1DQ1A 1G9CA 3OF1A 2ZAAA 1C8M2 4Q4V2 3RZZA 4CDUA 1DQ6A 1PZ9A 2VQ0A 5JZGA 4AVAA 4YZ4A 2UURA 4H14A 5I0RA 4WVWA 4GKYA 1XYPA 1ASJ1 4XIKA 4CDUB 1FPN1 3RYKA 1DGWX 4JC1A 4Y1XA 3QACA 5IK7A 1ZZCA 4B7EA 4Y20A 3D6EA 4K8FA 2VOXA 4B4RA 2HWC3 1SCRA 1C3HA 3AX4A 1OOPB 1VBE3 1AX2A 2D6OX 3IDBB 1IKQA 1S0GA 3I4IA 3AZWA 2BTVC 3H3ZA 1POV0 5C8CA 3WW3A 2XJPA 4ATFA 2EAAA 1WLCA 1IQAA 3VZNA 1PIV2 2JG9A 2PLV3 3VBUC 3J8F3 4P9YA 5T5JA 1RUE2 5DDJ3 3NAPA 1W6MA 3APBA 3VBHC 3H7YA 1X36A 5JPNB 3FC0A 1AR62 4IL7A 1BCXA 3VZLA 2HJIA 4NOTA 5C9AA 5GLWA 1ULDA 4Q4W3 3V56A 5CFCB 1PGL1 3O0WA 3TN91 5J3UA 1RUH2 3KT7A 1OQEA 1WCKA 2KM2A 3TAYA 2A3YA 3N7LA 4M3CA 2ARXA 3UJQA 1BXHA 2R073 4FPFA 2R1DA 4YG6A 3ZFEC 1MZFA 3IDCB 4Q29A 2GC0A 1HXS1 4Z2WA 4CDXC 1S2BA 3GBGA 1AR92 2EVXA 2VGDA 3IPVB 4JDNA 4M3CB 4Y1VA 5T54A 5FMOS 2ZABA 1RITA 4QD2A 2XVGA 1G9FA 1VBD1 5DZFA 4H7MA 1QGLA 3CJIA 3QH6A 4K6BA 4XYXA 5CA6A 1MZ6A 1ZA4A 4LA3A 5DXDA 1IOAA 4B4QA 4R4ZA 2O0OA 4OHYA 4HVOA 3FFZA 4C1XA 2WWSA 5J98B 3FX3A 4XTPA 3FLRA 2RMU1 4QPYA 2PQQA 5GZGA 4YW2A 1MS9A 3FMGA 4I0AA 4HSLA 4R52A 2JICA 4DFSA 2RS11 3H1WA 2BEOA 2R042 1I5ZA 1HQLA 1PO23 4JAAA 4XJZA 1R1A3 2ZX4A 3ST7A 4N53A 1LOBA 3DPRA 1B35A 2NP0A 1YLLA 3M3EA 4JTOA 5K0UA 4YYOA 4HT1T 2ZGRA 4LO6B 4N53B 4INDA 4YW1A 3CJXA 2JE7A 5KXDA 2EXJA 2W39A 3TRSB 3EXUA 1ZZ8A 2QFEA 3LSEA 1O3RA 2H6BA 3NV3A 4QQPA 1G9DA 1BMV2 3AP9A 3ZPYA 2WFPA 3POWA 4AVSA 2VQAA 3RQ0A 4ZXKA 1CAVB 1MS5A 1S1AA 1DYPA 3E6CC 2MNGA 3EBRA 4CP2A 2Q8OA 4PIYA 3D8CA 3ASIA 4XBNA 1HRV3 3FBMA 3MICA 1HRI2 1S0FA 5E1RA 3RMYA 5CAZA 4Q0UA 4R9CA 1CR7A 1VBE1 4NWWA 1ZBE2 3H1YA 3LAGA 1AZDA 3VBUB 2A75A 3C2UA 1GQHA 2LTNA 2OZ6A 3ES1A 3M8LA 5E16A 1SFYA 1V6JA 2OUHA 4JGYA 4Q0QA 3VBHB 4BHPA 1RUD3 2PLV1 3CEWA 2GH2A 1XYNA 3WXPA 2VVFA 3ZYJB 4HL0A 2XG3A 3GF6A 2VMGA 4MXWA 4QQLA 4YZ5A 1YIFA 5GZDA 2RM23 4XHBA 1C57A 4FOYA 4UW4A 5EV7A 1DZRA 3WV6A 1E57A 3MGUA 5BUVA 3OD4A 4LBQB 3ZSLA 1KFUL 4Q4W1 2GH8A 4WZCA 4GA9A 5GZCA 1N3OA 1FX5A 1AYN1 3ZFEB 5C6CA 1CJPA 1OQ1A 4CDXB 5BPXA 4FQZA 3PMSA 4Q0VA 3VUOA 4AVCA 4L99A 4YGDA 3S7IA 4COUA 1MS8A 1BYHA 4ZKTB 1VBA2 3ZMNA 3L2HA 4EN0A 2IFWA 3KT4A 4QM9A 2IXHA 4HKLA 1C8M3 3OY8A 4Q4V3 3PMEA 1KDKA 4CEYA 4GMP0 2CGPA 1OPOA 4BH9A 1LHUA 2XL7A 4H3WA 2QJVA 3MEPA 1RB8G 4R8HA 3KT1A 2D40A 2YHJA 4K3UA 1WBLA 1RHI1 3K48A 4N43C 4IESA 4FOVA 2G9FA 2WSVA 4AFMA 1AR82 3AZYA 2JXAA 3R4SA 4J6GA 1W2UA 2QUOA 3ZSKA 3QBQA 5FO8B 5T55A 4ES8A 1IS3A 4YSFA 1EV12 2YYOA 3AP6A 1PIV3 1GQGA 1V6NA 4FAGA 1RUE3 3VZMA 1WMFA 3N3HA 4DRRA 3AYCA 4MGIE 5HXVA 1OA4A 1AR63 1RUF2 5FPZA 4DZGA 1VP6A 3AZXA 5T3NA 3RDIA 2RS31 2PHTA 4BM8A 4LBKA 3MYXA 2IWGB 3I7DA 1U5YA 4V1PA 1RUH3 1LJ7A 3WG3A 1GBGA 4PLMA 1GNZA 1XNBA 1AL0G 4W6WA 4AYUA 5H9RA 1U5ZA 4HVRA 2Q0AA 1UW8A 3FLTA 4WBBA 4WM8C 1ZVFA 4ASLA 1LRHA 4UW6A 5I8TA 2O8QA 5D8AC 1W6OA 4Q0SA 3WW2A 4I02A 5FBZA 5JSPA 4LBMA 5JPMB 1AR93 3LA2A 4K40A 2XLAA 2FMYA 1VJ2A 1OLQA 5KBFA 1DYKA 2XH6A 1XRUA 1W6OB 1YFXA 3M4FA 3SISA 2ZZQA 2QDRA 3B01A 4UBGA 3THTA 3ZXFA 3WW4A 5KHGA 2KA3A 4CEWA 1CJDA 2BW8A 1MVEA 5CU1A 2OW4A 2E7TA 1S55A 1S0IA 1QJX1 2NZ9A 2I74A 5KWRA 1RUD1 3AFGA 1D2SA 3KCXA 3H8UA 2OUJA 3AKRA 4RA0A 4ATEA 1VBC2 4F83A 3R6SA 1JUIA 3N35A 2R061 1AVBA 3JUUA 4QGMA 4MV2A 4QPGC 2WL1A 2R043 2GNDA 1OQDA 4W6YA 2A6YA 2GNMA 3B3QE 5FQ0A 3J26N 4HKWA 4ZU5A 1O3QA 1AJKA 4XJ8A 3UL2A 2UY9A 3S6PA 4LLFA 3NV4A 2WZPP 3B9IA 4GXLA 5BNPA 1I1EA 1KRIA 4KBBA 5E8AA 1O3TA 3U4XA 1GZWB 3TN92 2E63A 1WMDA 1TMF2 1IGOA 3BPZA 4FPHA 2Y0OA 4N43A 4XJ9A 4XF4A 4LA2A 2DCJA 3WVJA 5CG9A 4N43B 1VAVA 3B02A 3AYAA 3OGGA 2IZWA 1RGSA 1JOJA 1HQWA 2IXCA 1UKRA 4ISQA 2X8KA 1FMD1 2P17A 2P3KA 2D98A 3AMHA 1O4ZA 1WLDA 5H9PA 1HRI3 2VMIA 1NQJA 4O9GA 1D4VB 4UXAA 4XW3A 4LUMA 1ZBE3 3MIBA 1UIJA 1LCLA 1JUHA 4FPCA 1AYM2 1VBB2 4WM7C 4KWLA 5GKAC 3S30A 3V65A 2RMU2 2D3RA 1RUI1 3QH7A 4FPKA 1PIV1 1SLAA 1L3JA 1W6PA 3GNEA 1VLNA 1U0AA 2F4PA 1YUDA 4MSVA 3TNQA 4XF1A 5BY5A 1XE7A 1AXYA 1Z78A 3GALA 3VDDC 3MW4A 4OHZA 3M2MA 2YPJA 1G9AA 2LALA 5I8YA 3IDEA 1NCRC 4H55A 4KL1A 4WM8B 1POV3 1RUH1 2ZOEB 2ZKLA 5D8AB 2JEMA 4YFZA 4KU8A 3WX5A 2ZGTA 2CY6A 2VECA 3MPBA 4AEJA 5CVRA 1VBA3 1YIPA 5BNNC 3BALA 4RSUA 2PYTA 3VKMA 1X7NA 5FAXA 1AR91 4BE3A 1QDCA 5L36A 3P3PA 1PGSA 4D3WA 1DQ4A 4KH9A 1H8TC 3LZZA 1SEFA 4C91A 4EN7B 2XJVA 1SDWA 4S2HA 2YXSA 2XLGA 4G3YC 3NWKA 2WFF2 4QT6A 2B7YA 3VKLA 4Z1VA 2ZZJA 5ABJC 2X5IC 1HIXA 3KGZA 1AR83 4CDQC 1CAWA 2Z2SB 1V70A 4QPGB 2OVUA 5DG2A 2BGCA 1QF3A 4H7LA 5FLJA 2DTYA 1NLRA 3KCYA 4I30A 2KXLA 5LEJA 1RJ7A 2O1QA 1EV13 4G4FA 4FAHA 2ZPXA 4ORFA 2R041 2NQYA 1AX1A 4NVPA 4R4XA 2V5YA 2ZGOA 3B00A 1RINA 5FTTC 5H9SA 4C0HA 3SHRA 2BNOA 1V00A 2W0XA 4PBPA 4COVA 1RUF3 2NLRA 2QVSB 2EXHA 2DUQA 4AK3A 4HN0A 3H7JA 1PGW1 2MEV2 1AYN2 4GH4C 2TEPA 1M4WA 1UPIA 1REDA 3AM2A 4JV4A 2PHUA 4I0BA 5GLTA 4D7SA 4L11A 2ATFA 2GNTA 2ZHMA 2JD4A 1XE8A 3PVBB 4XJWA 3THPA 4IXLA 1UN1A 1HDKA 1YJLA 3DN7A 4QQHA 3HT1A 4COZA 5KC6A 4WM7B 4XXPA 1ZBE1 4XF3A 1RHI2 4E9KA 4EN9B 1WD3A 2PHLA 1QJU2 4I09A 4MVTA 4BOWA 1RVF2 3WP5A 2XB6C 4LO5B 3OCPA 3RJRA 3ZFFC 1NCRA 4HMZA 2YMZA 4HETA 4QGNA 3VDDB 3WHTA 3WCSA 1IZ3A 4KWJA 4AFCA 4LULA 2B42B 3M3OA 1ZZ9A 1DBNA 3WUDA 1J1LA 1NCRB 2ETEA 1F31A 4LNVA 1BQPA 4XFFA 1PNGA 3INAA 3ATGA 3POYA 2WIIB 5J96B 1CGPA 4DY3A 1G86A 1POV1 1ENRA 2O8OA 4EROA 5J48A 5BNNB 1CAXA 1H8TA 4JVAA 2Q4SA 2RS32 5A32A 1WW5A 3JU9A 5GZEA 1FNYA 4GULA 4FCAA 2JE9A 1TE1B 3TN93 2ZKNA 1UPSA 1G6NA 1VBA1 3R4UA 3WQ1A 1TMF3 3I54A 3QD6A 1CAXB 1H8TB 1J3PA 2DCTA 1LODA 2DVDA 5GM0A 5HCAA 4OI4A 2GC1A 4CDQA 2ZAHA 4EWAA 3PTYA 4QX5A 4BLIA 4FPJA 1Q3EA 5ABJB 1SBEA 3ILNA 4K7JA 4ISRA 4YW4A 3PVEA 1PVXA 3WG1A 2X5IB 3QCWA 3KD4A 4CDQB 2AZ5A 1ALYA 2A3XA 4Y1YA 1W39A 4PBOA 3H0OA 4GIQA 1MZEA 1AR81 3JBG2 4DNYA 1LULA 1BBT1 4IV3A 1ZX5A 1AYM3 4AVTA 1VBB3 1RUOA 1QJX2 1RUG2 3AMNA 3B5LB 2RMU3 1EV11 1DQ2A 2WLPA 4SBVA 1RUJ2 1K5MC 1FYUA 3URFA 1Z0HA 1EPWA 3UJOA 1N1VA 1RUF1 2DCYA 1X82A 2R062 2RE9A 4MGZE 1Q43A 4LO8A 1ZM1A 1B09A 4GH4B 1SMVA 2VVDA 3VBOC 2D6NA 1OA3A 1PVC1 2WKKA 2HYKA 4N9HA 4RL7A 2XJRA 4XIOA 5EXOA 3GZAA 1TME2 1H9PA 1YFWA 2JG8C 2ET7A 1ZRFA 2LM3A 2XVLA 2VOVA 1BVVA 5JDBA 5EFUA 4M3CF 3E6BA 3CU7A 5SV5A 3ZIXA 2BQPA 1XNCA 2PHRA 2VUAA 2AUYA 2CNAA 5J09A 3VV1A 1REEA 3CNAA 2FZ1A 2UWCA 3PJQA 1PK6C 4Q26A 1A8MA 3ZVXA 4G9SB 1OOPA 2WNUC 3ZFFB 1OD5A 3PNAA 4P9LA 3RRDA 3RWNA 1FMD2 1ZZBA 2R0FA 2CWSA 4RGGA 4AGGA 5L7OC 1SACA 3IIAA 4Q8KA 1CVNA 2X29A 4R9DA 3WY6A 2CAVA 4A7KA 4WVMB 1VBC1 4FP2A 3LSDA 2EIGA 3WNXA 4L92A 1RUI2 2PELA 2GDFA 4IEWA 3S7EA 4Q8LA 4KG0A 3ZXKA 2CGOA 5JSOA 3SMHA 4NN0A 2YV8A 4K9SA 4AI3A 5CFCA 1RMU2 5FO9B 4FTSA 2NN8A 2DURA 1X8MA 1NQDA 2GALA 5BNQA 2DV9A 1G9BA 4EN8B 3USSA 4B29A 2BVBA 3RI9A 4D7YA 2QE3A 5BNOC 1KJLA 1BEV1 3K51A 5JIUA 1TMF1 2BYVE 1AYN3 1HV0A 1IHMA 3MF6A 4Y24A 3IPVA 1VB2A 1R1ZA 3O12A 3FJSA 1UU6A 5CFDC 3SLIA 2PHXA 1SQ4A 4Q27A 4CTEA 1S0JA 2GSYA 3VZOA 3JZVA 2PAMA 3KSCA 1QJY2 2GC3A 5FOBB 1H1AA 2JX9A 1OSGA 4J1WA 1K5MA 2WSUA 4EWDA 5CNAA 4MGYE 1RHI3 4BMEA 2GMMA 2E51A 3PVOA 1AYM1 1DGWA 2RS51 1QJU3 1ND3C 1VBB1 1K5MB 1PMIA 1QJZA 1RVF3 4GMP1 4YVSC 5JLVA 3ZN5A 2MPFA 1GV9A 5EZWA 1A8DA 4AWDA 3VBOB 5T5LA 1LHWA 4YG0A 1W0OA 4P9JA 5A3MA 2P34A 4YM2A 5D1IA 4YNIA 2GAUA 1D2QA 1UL9A 2FBEA 2JG8B 3PJYA 5GLUA 4B3NA 4N7UA 1XQNA 5F9TA 1QXPA 4YLZA 4D69A 5AVPA 2RS33 2DU1A 1NXMA 1PK6A 1VAKA 4BCUA 3AMPA 3R0RA 4DINB 2WNUA 1PGW2 3N7KA 2R49A 1CAVA 3E6DA 4NR1A 1PK6B 1GYKA 4XQWA 4I2OA 1D0GA 1OFSA 2WNUB 4GQ7A 2A73B 4XZPA 4HBNA 3WT3A 4Y1UA 2YGLA 4AHXA 3D0JA 5A33A 4LT5A 5L7OB 3VZKA 3FUQA 4URTA 2QQPA 1R091 1Q8OA 3OPZA 3VBUA 4ITCA 1F5FA 2PTMA 2WFF1 4BLJA 2JENA 5A33B 2XWBB 2OA2A 3GYDA 5DUUA 3VBHA 2XKOA 2WNVC 4AFBA 1EAH1 4OFGA 3JBG3 2B39A 5KHKA 4QGLA 1NA1C 2E9QA 1O4TA 1OMIA 1QJX3 1RUG3 2Z5WA 2SBAA 3O14A 1JYIA 5KHHA 5BNOA 3HAGA 1U5XA 5FLIA 1TEIA 2FMDA 1RUJ3 1S0DA 4KQ7A 1ULCA 2H0BA 1H2LA 3EQEA 2Y0IA 3MIEA 4LBQA 3U11A 4ES9A 1F2NA 1NY71 4HK9A 1PZ8A 5KXBA 4JQRA 5BNOB 2R063 2CV6A 5CFDA 3ZFEA 1M06G 1ZRCA 4CDXA 5EYXA 4EN6B 2ZGPA 5CBLA 1YXWA 4XBLA 4AI8A 1WW6A 2MEV1 5CFDB 5IK8A 1TME3 3TNPB 2VULA 4XFIA 3BOWA 2EXIA 4CDWC 4BIFA 4UW5A 3MW3A 4RD7A 1LKNA 3DL3A 4RR3C 1WW7A 4TSVA 5JI7A 4XHXA 4WV8A 1FV2A 3ZXAC 1VR3A 2A7AA 3PVNA 3X29B 4QMAA 4AXOA 2VW2A 1WA4A 2DVBA 2VVEA 1V9U2 5I93A 1ND3B 4A7ZA 4YVSB 3SXWA 3WDYA 5HBAA 3AYDA 1LEDA 2XUMA 1UD1A 2HWB1 3WP3A 1EPZA 1FMD3 1LGNA 1QJU1 3RYRA 1C1LA 1RVF1 3UKTA 4WZFA 3MIHA 2VG9A 2YC0A 5I0TA 2ZBJA 4XILA 2VW0A 1C4RA 2PAEA 1JBCA 3AP7A 2ZGLA 4QQ2A 2GU9A 1BBT2 3I8TA 4WVVA 1LTEA 3MF9A 5JR7B 3O0VA 2DFCA 4R9BA 1RUI3 2RJLA 2BNMA 1C28A 2TBVA 3T1LA 4AHWA 2N7GA 4RS5C 2VOKA 5GLZA 4HFSA 1DGLA 3MFAA 1A78A 4FPOB 4XEZA 1RMU3 1WW4A 3HWJA 1TNFA 3BB6A 1I6XA 3NV2A 2ET1A 4YM1A 1URXA 1QOTA 2PHFA 2R6QA 3ZN6B 1PVC2 1VB4A 4P9GA 5JMCA 4XMAA 5F1RA 1NOVA 2FQPA 1AL22 2I07B 2ZCWA 3NO8A 1J1TA 1CAUA 1J58A 1Z7S2 2C0ZA 2E7QA 1LECA 1LOFC 2ZS6B 4OHXA 2XPJA 1DU3D 4YVWC 1QMJA 4NPRA 2GMEA 1JYCA 4Q4X2 2DUOA 3ZXGA 4CP0A 1CAUB 1NA1A 3M1HA 3HR9A 1R081 1XU1A 1A3KA 1JHNA 2WQ4A 5DUXA 2WNVB 1QJY3 1C5IA 4XOGA 5H9QA 4MYEA 1NA1B 2R0HA 4NO4A 3VKOA 5E88A 1H30A 1H1IA 3JB8A 3AB0A 1AF9A 3JBG1 4U2AA 4M01A 4NHMA 4OUSA 3FE5A 1F9KA 4Z8BA 1F8VA 1OKQA 4XFBA 1Q56A 1RUG1 1ZREA 3WQ7A 3WG4A 4LHKA 1RUJ1 4I01A 1AX0A 3VHPA 2XJSA 2WJSA 3VHOA 2ZACA 1MS4A 1Y43B 5JOWA 1QY4A 4QHBA 4XMIA 2P2KA 2IXIA 1ZRDA 4CDWB 1GZWA 1PHMA 1MQTC 4Q2FA 3FZ3A 1ONAA 1TME1 3WDUA 4RR3B 1VIWB 3N36A 4I0WB 4XE9A 2WLQA 1ENQA 2WINB 3BIWE