2YUEA

Solution structure of the neuz (nhr) domain in neuralized from drosophila melanogaster
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
168
structure length
168
Chain Sequence
GSSGSSGPLQFHSVHGDNIRISRDGTLARRFESFCRAITFSARPVRINERICVKFAEISNNWNGGIRFGFTSNDPVTLEGTLPKYACPDLTNRPGFWAKALHEQYCEKDNILYYYVNGAGDVIYGINNEEKGVILTGIDTRSLLWTVIDIYGNCTGIEFLDSRIYMYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein neuralized
publication title Structural and functional characterization of the NHR1 domain of the Drosophila neuralized E3 ligase in the notch signaling pathway.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Rna binding protein
total genus 17
structure length 168
sequence length 168
ec nomenclature
pdb deposition date 2007-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07177 Neuralized Neuralized
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.920 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2yueA01
5JI9A 4P9JA 4B3NA 3TOJA 4XW3A 4WVMB 2WL1A 3KB5A 2E63A 4P9IA 4B8EA 4P9LA 2YUEA 2FBEA 5JIAA 5F6LB 4X8NA 2IWGB 2YYOA 4KG0A 4N7IA 2LM3A 5JIUA 4WVMA 4QT6A 5JI7A 3ZO0B 5C33A 5F6KA 2VOKA 3UV9A 4X8PA 4N7UA 4V1PA
chains in the Genus database with same CATH superfamily
4IEUA 3NKGA 2KXLA 4YW6A 4C91A 1I9RA 1QDOA 3CNAA 5LA9A 4A41A 4XE9A 3ZFFC 2BWAA 4AEKA 1FATA 2J1AA 5D8AA 2RM21 1NKGA 3ZXEA 5L9RA 1OT5A 4QPGA 3I4IA 3BPZA 1YCIA 1I3HA 3R05A 1HB4A 2A6XA 5I8TA 3OBTA 1TQ5A 2ES3A 2ADDA 3VKOA 4RR3A 1RGSA 1RUG3 5LB6A 3NV2A 4DUVA 4BU2A 4CPBD 3I3QA 3MICA 3URFA 1LJ7A 1XU1A 4UFIA 4W6WA 1H0BA 2Y6KA 4XXAA 5KWRA 2R49A 4IE7A 1JUIA 2NP0A 1VBA3 1KEXA 3I3MA 3EBRA 4QXCA 1Y9GA 4GJYA 2E63A 4ES8A 1QWRA 2W1UA 3ZYHA 1W2TA 3CIHA 1WCQA 3T0DA 1REFA 3C7EA 5DUUA 5L36A 5FDBA 1WLWA 4JGYB 2WSVA 5J37A 1UKGA 1QQP3 3VBUB 2CU5A 3M7AA 4WBBA 5FP3A 5LEKA 4OHXA 5A6YA 4QX1A 1A8MA 1BJQA 1PX3A 1RUH1 3KCCA 1W9FA 4JGZA 4LULA 2XUEA 3ZSLA 4E27A 3U1XA 2HWF1 2PHWA 3CU7A 4QQPA 3AMPA 1YC61 4YW1A 1KFUL 1NZIA 3GJAA 3KSCA 1GLHA 4E2QA 5A33B 1W8OA 3KGZA 4WVMB 2RDRA 1XNDA 4LNVA 3RVHA 1AVBA 2HWB2 4FPOB 1MQTA 1K42A 2HLEA 4B8EA 1CIWA 3JU9A 4LUMA 1OPMA 3VL8A 4MGQA 3RYKA 3FE5A 4M4RA 3C7GA 2JKXA 5F5AA 1AF9A 3WZ1A 2ILMA 3LE0A 1N47A 3E5UA 3DKQA 3MIDA 2RJKA 3ZM8A 2BPA2 3A4UA 1GZCA 3B00A 1RJ8A 1VMFA 3QH7A 4W50A 3RG0A 3WNXA 3BKZA 1Q3EA 1QKQA 4QB2A 3THCA 3PURA 4UF0B 3DL3A 1F5FA 1W3XA 2J22A 2PHTA 1CD3G 1UWWA 2Z42A 4LBQB 4ZXEA 3WF0A 5CFCA 3VBSB 5LZ6A 1SLAA 1S0JA 1AYN3 3BUCA 1CPMA 4C0HA 5T3NA 4R4ZA 1VE0A 1OQ1A 4LA3A 1PIV2 1UYXA 3IWZA 3H3UA 3JD72 4COZA 2FDKA 1W8WA 1RUC3 2BVBA 3POWA 4BLJA 4E2GA 5FZOA 1UAIA 5FJKA 4CEWA 1RVF3 4X6RB 3S5QA 3J7MA 5IVEA 4Z2AA 1RTVA 3OUJA 3LDKA 3CEWA 1RHI2 4MX3A 5F3IA 4S2DA 2TEPA 2VMFA 3BB6A 1EY2A 1LOEA 2HEVF 1FPN3 4Y4RA 4M4PA 4CUGA 2WSUA 4ISQA 4JGYC 4R9CA 3UV9A 3WQ1A 1A8DA 2GC3A 5DG1A 3VBUC 1WW7A 3RYRA 4KBBA 3O1OA 2CNAA 5FZ8A 2OS2A 2ZGPA 3POJA 3VBRB 3SKJE 1W06A 1PO11 1CAUA 3MLJA 2E26A 3VDDB 4NVPA 4NPRA 4QPIB 2E6VA 2P34A 2AREA 2VMEA 5F7UA 4XQDA 2OVUA 4BOWA 2BEOA 5G05L 3IIAA 4KWKA 3VD7A 3ZXDA 4IEVA 3IAPA 5L7OA 2ZGNA 5FKBA 3V0BB 5F9TA 1JYNA 1EUTA 1I6XA 3VD3A 4QU1A 1ENRA 4CUAA 1IKPA 2G9GA 4DINB 5IVFA 3J9SA 3KGLA 4AOCA 1TZOA 4MO3M 1PM4A 5FZMA 2W87A 3S5AA 2QQOA 1A78A 1S2BA 5FPAA 4URAA 3T2PA 3ZDVA 4Q0SA 2JG8B 3MFAA 4LKEA 1AX1A 1SLBA 3UK9A 5K9YA 3GZUC 1O4YA 1SMVA 1OLRA 2NPIA 3ZFFA 3WG3A 5FZIA 4A7KA 3D8CA 5CISA 4IDZA 2XQRA 2D44A 1XRUA 3VHNA 4D8MA 2BGPA 5LRRA 4B1LA 3OGRA 4HSJA 2GSYA 1GV9A 3PUHA 1OOPA 4UT5A 3CJXA 1FMD2 4RGGA 2W1WA 1J1TA 5F6KA 1FOD3 4GAZA 4CCNA 3NVCA 2WR9A 3AP4A 1AR92 1YJKA 1CONA 1Q8SA 1Y7BA 2R041 3LIHA 1HN0A 4MUVA 4PJYA 4LO4B 1RUD1 3KB5A 1B35A 2P5BA 3GBWA 1AL0G 2Y0OA 3S7IA 5A3NA 3MF9A 2BRTA 2QTWB 3IPVB 1SPPB 2D97A 1OVSA 4CDXB 5BNPB 3MV11 4F8AA 3G7DA 4NAMA 1W6NA 5A3MA 1RINA 3THPA 1AHSA 1RMU2 4N53A 2NMNA 2LM3A 3AKPA 3C2UA 2GZWA 3MF6A 1XXNA 3DCQA 4HMZA 2Y6JA 4K20A 4LBMA 3VBRC 3VDBA 4LE3A 4R9DA 3IDBB 4HL0A 5CG9A 5KHGA 4NAOA 5IK7A 2CL2A 3VDDC 4UW3A 5JDBA 4QPIC 5M0TA 3SCHA 4I0AA 3TNQA 3T0BA 1VLNA 1OF3A 3NQHA 1PVC1 3T3YA 3T1MA 1W2AX 2HWB3 4XUPA 4BA6A 5A1LA 4LPLA 3PUIA 1W03A 3ROUA 3LPFA 3WNMA 3N9PA 1GYKA 1T2XA 2WN2A 3GHMA 4FXKB 2XR4A 2EICA 4QDQA 5EJZB 5I0TA 4CP0A 1C28A 2ARAA 1AX0A 3QLQA 4Q4Y2 4M0HA 2R16A 4EN0A 5C8WA 4YRDA 2JG8C 3FLTA 3OYWB 4DXSA 5LA1A 1TVGA 5FO9B 1UU6A 3LGRA 3WG1A 3BIEA 1C1LA 3ELNA 4URTA 4ES9A 5CADA 4WVWA 3Q8AA 3SMHA 4BK5A 2RS31 3DUIA 3U14A 5F3EA 5GZEA 1YIFA 3WD5A 1CAXA 3OG2A 4Q5OA 4L92A 4WZCA 4QM9A 4BM8A 2R30A 1PIV3 5JMCA 2XL7A 3LSDA 4OI4A 4NO4A 3A0NA 2OQ7A 3HVDA 3L9JT 3PTYA 2OKXA 2DUOA 5SV8A 4O7XA 2RDNA 4JTNA 2PAKA 3WDWA 4CCCA 1VBC1 4CDQB 3M3IA 2BBVA 2R1BA 2HWF3 4Q4V2 2W2IA 1YFWA 5FYTA 4AFDA 4BWOA 1UMIA 1KS4A 5G04L 3BTXA 1HRI1 1PZ9A 2GALA 5AVAA 3GYDA 3R4SA 1JYXA 3NAPA 4CDXC 1KD7A 5BNPC 3CHXA 3VBOC 3K3NA 1U5XA 2EXKA 2D3SA 2XMLA 1KDKA 2VO5A 2ZOEB 2WN3A 4MGIE 5F2WA 5A7OA 5ISLA 2A1XA 2WZPP 3VBUA 4LOSA 3APBA 5IAXA 2WT1A 4H7LA 3AXDA 1BLZA 1J3PA 2QKDA 5EFUA 5FMDA 3RS6A 2VMHA 3BTZA 1ULCA 1KITA 2CDPA 4XETA 1MZ5A 4Q4X1 4Q8KA 2VZOA 4HKOA 1US2A 3OPTA 2QDNA 1UIJA 2JD4A 4XCBA 4XIKA 2BGCA 3AC0A 3ES1A 3OGSA 2DDUA 3ZXJA 3SLIA 4WVMA 1O7FA 2YY1A 1ENSA 2LTNA 1DQ2A 5IK4A 1H6XA 2D6NA 2LALA 5F37A 2V72A 4CU6A 3Q8FA 1WW5A 4OHWA 4KG8A 1FV3A 4QX7A 1ZZBA 3OEBA 4NN0A 1DZQA 2ZCWA 4MZUA 1W6MB 4PHZA 1VBE1 4BDVB 4JHZA 3U0ZA 3FHAA 2JG9A 4Y24A 3ZN6B 4P08A 1OD5A 1D2QA 2UURA 3ILNA 4EN6B 2A6WA 3WCRA 1GNYA 1RUOA 3FMGA 4DY5A 1KJLA 4LT5A 4IUGA 2MPFA 1ZZCA 2JDYA 1S4CA 4UF0A 3W21A 1PGSA 3N7LA 1DZRA 5JIUA 4DZGA 1Z0HA 4D6SA 3O0WA 2Y6GA 2VM9A 3O1TA 1OLME 1AR93 2DWRA 3HQXA 5A6XA 4YM1A 2Y34A 1ULOA 2P3KA 5FZEA 5ANQA 1UL9A 2VQAA 3VBHB 3KV5A 1GUIA 4ZHNA 2W3JA 2Y8KA 4M3CF 4H2AA 4OYUA 3ACGA 2HYXA 3ALQA 4W65A 1W3VA 1QXJA 1QH7A 4D7SA 1XE0A 2ZAHA 5A7WB 3VZNA 4FI9A 5FBJA 2R0HA 3T0AA 4LBOA 4PDWB 4FAGA 2OXBA 4JKLA 1V9U2 4PIZA 2H0VA 1RMU3 2I07B 2RS11 1UPSA 5ABJA 4E2SA 4QGMA 1X7NA 2VW0A 4DXTA 4K3UA 3QBQA 4DO0A 2DCJA 2HWD1 4XJUA 3T2TA 5IWFA 2V4AA 4P9GA 5T5PA 5GZGA 3VGIA 3VBRA 2WAOA 3T30A 3WQ0A 3BYWA 1V6LA 4LHLA 1BKZA 1UW8A 4D0QA 2ET1A 3AVSA 4N7UA 4V1PA 3A7QA 3I2DA 3ZR6A 3KCYA 3C7FA 4CEYB 3OSDA 1JYTA 2GNMA 1ULEA 3B94A 1SG3A 1D0HA 3VDAA 4YWAA 3CZUA 4CCKA 4Q4Y3 5FBZA 2WZR2 4AI8A 1LEMA 1Y9QA 4BQ2A 1K5MB 5KC5A 4GB32 4LEJA 2BFUL 4FPGA 4L0PA 4DQAA 1IGOA 2XQXA 4C8DA 2PLV1 5IATA 1XYPA 1VBD2 3SXWA 4LIVA 3LEKA 4FP2A 1X36A 3E5QA 4GKYA 1RUD3 5FXZA 5A3WA 1AL22 1NAEA 2EAAA 2IC1A 2C0ZA 4DS0A 1W2OA 1PGL2 3U07A 3W5NA 1FV2A 2FDJA 1G86A 4AVVA 5FO8B 2PTMA 1YJLA 3ILFA 2WABA 2GNDA 2BQPA 1JU3A 3ORJA 4NHMA 1MS9A 4JV4A 3K4DA 4AR2A 4YW3A 2VUDA 1UPIA 3SCFA 4Q4V3 5BNNB 3VBHC 5BUVA 1GOFA 2Y6LA 3WEZA 3HQRA 1G9BA 1UZ0A 2DCZA 3HT1A 3PUSA 5FYSA 3HAGA 5EJ3A 1POV0 3KF5A 3WP4A 1C3HA 1AR71 4X6QB 1PVC3 4V2VA 3ST7A 5JSOA 4PDWC 4LIUA 3IB3A 3P1IA 3QACA 5AC91 4CDWB 2HH9A 5KC6A 1LOFC 2JECA 1GZWA 3IPVA 4UBHA 1PMHX 1ZZ9A 2EIGA 2Q8DA 1SPPA 3VHRA 4ATFA 4D69A 5FPUA 3VBOA 4CU9A 3WQ7A 1GZ9A 5F5QA 3AP7A 1WLTA 2E7TA 2K46A 3HJRA 3PDQA 3H1MA 3V64A 4NWWA 1N3OA 3U75A 4FOYA 4AI1A 1QJU1 1OSGA 2GP3A 4NR1A 4XC9A 4MXVA 1B09A 3QD6A 4FPJA 1WKYA 1DCSA 2WNVA 5D2AA 4MXWB 1EPWA 3PUAA 3MDPA 2E51A 2GMMA 1H2KA 2VCBA 3ZPOA 4CEYC 2WZEA 2XWBB 4UYBA 4FXGB 5JI7A 4RHV2 1HLCA 4GWMA 3ECQA 1AR82 3VZLA 1ENXA 5FYCA 1K5MC 3LA7A 1V6OA 3C3VA 3KT1A 4J25A 4CPBA 1PX4A 1CR7A 5FMOL 1GNZA 1IS6A 5A3UA 3I2GA 4YGBA 3WUDA 1RUE1 4COUA 3C7HA 1VBC3 3VD4A 4RS5B 1ZA4A 2YV8A 5A3PA 2YC0A 2D93A 3HNBM 2GAUA 5EHDA 1VAVA 3GF6A 4CZSA 1WLCA 1XNTA 2WINB 4MYEA 2XG3A 2PHLA 5FK8A 4PLOA 5C9AA 4R52A 4P14A 3KQ4B 3ZMOA 1HRI3 4F83A 2ZJCA 3KV9A 1DLCA 4CXYA 4IEWA 5EXOA 3UT0A 3ITQA 3MUY1 1VBA1 2W1SA 3ZN5A 1QJEA 4NPLA 4LKFA 3R4UA 5FZ7A 2FQPA 1NA1B 3I2JA 1UQXA 4FPFA 4J1WA 3WCSA 2OA2A 5BNNC 4KU7A 5K7PA 3R6SA 2VR4A 2UYAA 3ASIA 2XOMA 4Q4X3 2YHJA 3O12A 4I30A 1OQEA 1V9U3 2V73A 5FY8A 4Y1UA 2D5FA 4OUMA 2RR12 2DFBA 4ET7A 4CDWC 5LW9A 1KDMA 4QM8A 3QOPA 3WLUA 3WR0A 3AKSA 1ZBE2 1DDLA 2ZZQA 4ZS2A 2XKPA 1ENQA 1PK6B 1UX7A 1W05A 2RMU2 4AHWA 5E8AA 2PXJA 1VBE3 2A6VA 1F31A 3ZVXA 3S0MA 1NQDA 1A3KA 4XIOA 3FN9A 5D21A 4GKXA 2FDIA 2VOVA 4CDUA 1WZXA 3X29B 2WFF3 2FCUA 3AMMA 2G19A 5ACA2 4GALA 4S2FA 2EF6A 2WZR3 2RDSA 4CUBA 1QOOA 1MPXA 2IFWA 3LFMA 4FPHA 4GB33 4HPKB 2ZHKA 1VRH2 3HIFA 4XPVA 4FTBA 2B8MA 4K40A 4BXSV 1F8VA 2BTVC 1YNAA 2C6SA 2J42A 1DLLA 1XYOA 3MHZA 1ASJ2 4RS5C 5LCWL 4LBQD 1UMZA 1AYN1 3H42B 2JENA 3RZLA 1DHKB 4P00B 4PQQA 5ANNA 4A3ZA 4NWVA 3A21A 1HRV1 3MPPG 2RE9A 2WO3A 2WQZC 3PLQA 4UFMA 2YXSA 2D6PA 1HDKA 2DUQA 2R073 1AYM2 2ZGUA 4PT6A 3ZN6A 1HQLA 1RUC1 1IQAA 2JXAA 2ZKNA 1MACA 4Q2FA 5FR3A 2V5DA 3F2ZA 2RS13 3DGTA 2QE3A 1NA1C 2IFRA 4JKKA 1JHJA 4YM2A 5FO7B 1OH4A 1GQGA 4BIFA 4K6BA 1VPHA 1M4WA 2D98A 4UW5A 5FZGA 4AQ2A 1EP0A 5DUVA 4UFKA 4XBQA 4XF4A 4AFMA 1V6JA 2ID4A 4RFRB 4UXAA 4CYDA 2XXZA 3M2MA 1OHFA 4JQRA 3K2OA 3RNSA 2X5IB 2ZGKA 2Q1MA 5A7WA 3ETPA 5IHRA 1L7RA 1WD4A 1LESA 2F4PA 2IXLA 3AZVA 3GZEA 4M3CB 4PDWA 4BMBA 1YYNA 3RGBA 4DFSA 1DF0A 2UY9A 1LOFA 1MEC1 1QY4A 1R1A1 2VZPA 2VOTA 3WP3A 4C0BA 1CZTA 2VQUA 4FAHA 4XAAA 3B02A 3KWVA 4AHYA 1PK6C 4HG6B 4XTPA 2A3XA 3D3AA 1D4M2 5FXXA 1RXFA 4KGGA 2PLV3 4A3XA 4YGDA 2H6BA 2TNFA 1WBLA 3H50A 4O9EA 3ZDSA 5T5JA 3THDA 1UZVA 5FZDA 2JDNA 5H9RA 4ZY9A 5JOZA 5KXCA 3AP5A 4Y26A 5C71A 1UXZA 1XNBA 2G4IA 3N4MA 3ZKUA 1X33A 5JLVA 1QJFA 3J4UH 4NHXA 3WNLA 2P1BA 4S2HA 2VVEA 1WCUA 1K5MA 5LBFA 4AXOA 1ZX5A 2IXCA 2JDZA 2UWBA 3LAGA 1RUI2 3OBAA 3RJRA 3TOJA 2O8OA 1XNCA 2BJSA 3EJKA 4AQTA 3AMNA 4LKSA 4OHYA 5EP9A 5GLVA 1FOD1 3LB9A 3L2YA 1J1LA 1AR62 2YU1A 4DEVA 1NYWA 5T5OA 1XQNA 4ASMB 4HXCA 4LO6B 4W6XA 2G9FA 3PJQA 3KS7A 1NY72 2JIGA 3NSTA 3RPQA 5FLJA 4GA9A 1UIKA 1UU5A 1PO22 1AZDA 1ND3B 2B4KA 1AXKA 1ZZ6A 4XBLA 5FPVA 1MVQA 5C9AC 5BNNA 1QJU3 4IV3B 1BZWA 2OUJA 4W8JA 3TN92 4AQSA 2DFCA 2VTXJ 4FPCA 4FVVA 2PHXA 1E5RA 5F3GA 2X5IC 3W58A 4XF1A 5BYNA 2ZX3A 3KVBA 4AGGA 2ZHMA 1CWPA 1WMDA 4YYOA 3MPBA 1ZBE3 1F4HA 1T6GC 2OPKA 4YVSB 3JQXA 4YM3A 2XHNA 5DXDA 1DGRA 1SLCA 2HWB1 1DFQA 2GC2A 3P6BA 1FNYA 4ASKA 1QNYA 5FCCA 1MS8A 3N36A 2JB4A 1RUE3 4TXWA 4XOGA 1LTEA 5FZKA 3ZIXA 2Z5WA 5JUVA 2QQNA 1W8UA 3SQOA 1F4AA 1GP6A 1IOAA 2Z79A 3PJYA 5FP9A 5CZKA 5IUQA 4MXWA 3I7DA 4GWIA 1CVNA 3N7KA 1LGNA 2J1EA 4Q29A 4GZ9A 5J7MA 3AKRA 4QHOA 1NZCA 2ZMNA 4CP9B 4ARXA 2VTFA 1ASJ3 1OQDA 2FBEA 3HBZA 3K48A 3OTFA 4JQTA 1LU2A 5GALA 2Y38A 1LHNA 2HWE2 2ENRA 1CIYA 1ZRCA 1E5IA 2HYKA 1V00A 1PIV1 1XB9A 4XHXA 4UBGA 1BYHA 2GP5A 4RS5A 5JPNB 1EAH2 2WS92 1W39A 5CB7A 4ZXKA 1W99A 2GNBA 3MV01 1WW6A 3O0VA 5DZFA 4OUEA 1VBB2 3FC0A 1RHI1 2XL9A 1IPKA 2ZGMA 5C3QA 5CAZA 5CFDB 4NROA 1JBCA 3U78A 1O3RA 2VQ0A 5F1RA 1ND3C 5EIYB 4XFCA 2J1TA 3UYJA 5E89A 2D7FA 4XDQA 1NOVA 2ADEA 5E6HA 2Q8CA 3VKLA 2HBUA 3CL1A 1AXYA 5FP4A 4EWEA 4IV3C 5H9PA 1RUJ2 2VZ3A 1YI7A 3I59A 1V6NA 4KH9A 2P37A 4BB3A 1KXGA 4HETA 2J1VA 5EQUA 2YFZA 5FZFA 5AFBA 4DRRA 2P6CA 3GHNA 3SHRA 4YSFA 5F32A 3AXEA 3S6PA 4N9IA 1KFXL 2Z2SB 1PNFA 1UF2C 4YVSC 4B4RA 3FFZA 3ZSEA 5HCAA 4XCAA 1STMA 5DPNA 2VCMA 1D4M3 1U5ZA 3LPGA 3O14A 4FP3A 4IEPA 2EIDA 4ISRA 3ZXGA 2OPWA 2QQLA 4MLOA 1WGPA 1YHFA 2DF7A 3BGAA 3ACFA 3OF1A 3DYMA 5JR7B 5JWPA 2WWJA 1SLIA 2E7QA 3SITA 2RS52 5GZDA 4Y5SA 4Y20B 1HRV3 3TNPB 4KGQA 1OI6A 1G9CA 1UCXA 1Q8OA 1G9AA 2D40A 1IHMA 2WQ4A 3LD8A 3LEIA 4HSLA 1AX2A 4FQZA 2IZWA 5JSPA 4P9WA 4YM0A 4ZU4A 3IT8A 3FL7A 1CAWB 3MIFA 4R4XA 1QDCA 2B9UA 4Q4W2 5JCTA 1DG6A 2YPDA 4R9AA 4HPKA 4XILA 3OCPA 2B45X 2ZX0A 3A23A 1FMD1 3UGFA 4XF3A 4XJ8A 1F35A 2P2KA 3U10A 2NMOA 2WWSA 3CMGA 3T4HB 1EYBA 2QQIA 3LKJA 4XAEA 1LGBA 5HXVA 1HB1A 1AR91 3NNJA 2WNOA 4CSWA 4GULA 3EYPA 4PBOA 3I2FA 4XUOA 4AEMA 5I0SA 2FMDA 3ZYJB 3V0AB 5E88A 1W0NA 1HQWA 2D3PA 4OI2A 5BNOB 5JZGB 1YWKA 3WDVA 1HXS2 5CFDC 2VC9A 1MEC3 1R1A3 3JBG2 3KT4A 4IE4A 4QGLA 4E8DA 4NJ4A 3FBMA 1UY1A 1N3PA 4Y22B 1L7QA 1DYKA 4QPWA 4AEJA 3UESA 1RMU1 3TN93 1ULGA 4IV1A 1PVXA 1PZ8A 4L97A 1LOGA 4EWAA 4CE8A 3EMRA 3OUIA 3J8F2 3UL2A 5F2SA 1H9WA 5DUWA 3VZKA 3E97A 5FXWA 5CEHA 1TME2 4Y3OA 4U36A 1BBT2 1SDDB 2JE7A 4KNCA 3POGA 4B7KA 4OLLA 3HEIA 1QJY2 3LFIA 1IS5A 2XLAA 1ALYA 3LZZA 3AMHA 5GLTA 4M3CA 4P02B 3SH4A 4X8NA 1JI6A 2IWGB 4AF9A 3VDCA 1R082 3ZR5A 2ZHNA 3KVAA 3VBSC 2JDKA 3JUUA 4OUSA 4YZ5A 3AL6A 1UY0A 4Q4Y1 1ZVFA 3I3BA 1J83A 1U5YA 4RQPB 1XNAA 4UW4A 1UX6A 2W52A 3VZMA 1WCSA 2UWCA 4BQ1A 3NJYA 1O5UA 1PMIA 2B39A 2KD7A 3NO8A 3H8XA 3EXUA 2Y33A 3RZHA 1SBDA 1AJKA 3KQRA 3OJBA 4IETA 5GLWA 3T4VA 5A32A 1FXZA 1H4GA 5IVCA 4DUWA 1NQJA 1W8HA 1QOTA 1I5PA 4DB5A 4E4SA 2HWE3 1JOBA 5EV7A 3RWKX 2C26A 2BW8A 2WFPA 4NUBA 4BQXA 2L9LA 3QH6A 1IQDC 3WF4A 4EE2A 3B01A 3IM0A 2W08A 4NHKA 5CKMA 4AVCA 1EAH3 4N9HA 2DVGA 2J1UA 2MEV2 3ZKYA 2IXIA 2UWAA 1OMIA 2PN5A 5KHJA 4QAWA 2XVGA 1QMJA 2VNVA 2FCTA 1VBB3 4G4FA 3IZOA 4Q4V1 2W91A 3K4AA 3KF3A 1W8ZA 4Y1ZA 2YBKA 1W6PB 3RRDA 5BNOC 4XUNA 5JZGC 1JHNA 5FZCA 4H3WA 4X8PA 1PO12 1ZZ8A 2VUJA 4GJZA 4MSVA 5JXGA 1Y43B 2EIBA 3D6EA 2D43A 3WY6A 3JXSA 2DCKA 1DQ1A 1ND3A 2LROA 2A3WA 4CP1A 3I3EA 4M0NA 4KI5M 5JVVA 1ULPA 1Y3TA 1KQRA 2A73B 5T52A 4XFGA 4GWJA 4AVTA 4IV3A 3KZ4C 2BNOA 4XZPA 3H8OA 1Q8VA 5IVBA 4RFT0 4QXKA 5D1IA 3CLPA 4Y1XA 3ZXLA 3V65A 3SH3A 3EQEA 3MBWA 2BWCA 2ZABA 2BDRA 3ACLA 4MGZE 2BYVE 4NPMA 5A3LA 5CIRA 1XJAA 4XJZA 3WQBA 4YVSA 5FZ6A 2VBBA 1SCSA 4CXXA 2R062 4HFSA 3CJIB 2PHDA 3ZSMA 1MVEA 1YQ5A 4BISA 1WLDA 3ZFEB 4NRMA 5FTTC 5GLUA 2RS53 3ZFGB 4N43B 3JQWA 5I0UA 3IDEA 4RQPC 3FHIB 4QQOA 4ORFA 5FMCA 3JD73 2DUPA 2LRPA 4H14A 1LHWA 4QXHA 4BYYA 2IXHA 4XABA 3WF1A 3KLSA 2Q1FA 1IG0A 1WCKA 2QQPA 3O7OA 1ACCA 3KCXA 4Q4W3 3Q8CA 5DABA 3USUB 4ASLA 5IYYA 1RHI3 2QZ3A 3N9NA 1LENA 5HXMA 3GALA 1GP4A 1W0OA 2DVBA 3WG4A 4RN5A 5FIXA 3ZSJA 2TUNA 4XACA 4Y1YA 1DZTA 4LKDA 3N35A 4ARYA 1YO8A 1YFUA 2DBNA 2VZRA 3SEEA 1V70A 4OCTA 4JGYA 1QJZA 4AI0A 1H1IA 3MIBA 1W6OB 1NCRB 3ENRA 3N3HA 1ND2B 2KR2A 2QQVA 3BU7A 3JBG3 5HCHA 2JDUA 5C8CB 1HW5A 1US3A 3G6JB 2OQ6A 4LK6A 4TLFA 4K1ZA 5FYHA 3VLBB 4FPEA 1V9U1 5B4NA 1MZFA 5CVRA 2VZSA 3FWEA 5CFDA 5A33A 2VW2A 2CWMA 3WP5A 2W1QA 2O14A 4YFZA 3NJZA 5DAWA 1A34A 1D0GA 2TBVA 3TBDA 2XJSA 4GIQA 1JH5A 1TME3 1QHDA 2OIIA 2ZX4A 1UZYA 4R9BA 1OLQA 2ZGQA 2ZZJA 3U11A 4EN9B 5JR2A 5APAA 1VALA 3WV6A 3BOPA 2Q1ZB 1HJFA 1XPWA 1Z7S2 1NUKA 3LEGA 4FO9A 1NE6A 1TE1B 3I2KA 2VZQA 5C3SA 2WFF1 4HONA 1H8VA 4DRVA 3CF6E 4ZZ8A 4GWNA 2CDOA 1PGW1 3CJIC 1FMD3 4QD2A 3Q9OA 3ZFEC 2WZR1 4JDNA 3PVBB 1PNGA 3VBFB 3ZFGC 4N43C 1REDA 2SLIA 1QXPA 4GB31 4I3PA 4LBQA 4LLFA 3VBSA 1TG7A 4PLNA 2VMCA 2YROA 4PI0A 5KXDA 4XYXA 3TAYA 2BOJA 1ZM1A 1VBD1 4MV2A 1S0IA 3UNPA 4XBNA 3O0XA 4CDQC 3FBYA 3HD8B 4YNIA 1H30A 1W9SA 4IESA 2ZBJA 5L9BA 1K5JA 1AL21 3M3QA 1UNBA 3FUOA 3GBGA 1C5HA 1PGL1 5H9QA 3WNNA 5JSRA 1X50A 4QKDA 2R071 5HBAA 4BK4A 4Z92B 4AVSA 2WT2A 2W94A 2Y6FA 1UZZA 5FJHA 1Q43A 2ZEZA 4QB1A 1UU4A 4A7YA 1DU3D 5FPXA 1DGRN 5EYXA 5A7NA 5IFTA 4XQ4A 2VMDA 3B93A 1C8M2 1NCRC 4I02A 1ND2C 3GZAA 4QHZA 4QXBA 2Y6HA 4YLZA 3ME2A 4MH0E 4COWA 3AX4A 3VDDA 4QPIA 1GBGA 1UMHA 2W92A 4YVWB 4XMIA 2WBKA 3MFCA 1GSLA 1OXCA 1BMV1 5LBEA 3GCWA 3V0BA 2VZ1A 2QJVA 1G8WA 1PMJX 2J1RA 2X53S 4Q26A 3BTAA 5A7PA 4BE3A 3SC7X 3BCWA 2XJQA 4ZPIA 3W20A 4I2OA 1H6YA 2DYCA 3DXUA 4A6SA 2DCTA 3IMNA 4AEDB 4LTAA 4C1WA 2WNUB 1HJGA 2K9ZA 2JG8A 1WUVA 1ZBA2 2ZGRA 1W90A 3NKTA 4FQ4A 3WINE 4Z1VA 2VVFA 5JXJA 3D0SA 3B69A 1GU3A 2WZ8A 3WSOA 1AR81 1J84A 5LA0A 3ZYRA 4MGKE 3VBFC 3M3OA 1JMUB 1XC6A 1OC1A 4K7JA 2A70A 2VGDA 4CA9A 2WLPA 1CQ9A 1HKDA 3SEPA 4KBZA 4ZZ5A 1VB2A 4Y5TA 2IVIB 5FZAA 4EWDA 1OA2A 3TEYA 3PIGA 4Y33A 4J1XA 1RYYA 3NNGA 2X05A 3M3EA 4I09A 3T2QA 4FTSA 4LBLA 1VP6A 4OI0A 4BPZA 2DURA 5IFPA 3U4SA 4IGOA 1X9TA 4OHVA 3GDBA 4WM8B 3HNMA 2R7EB 1OKOA 2JDHA 2CSGA 2ZEWA 3L2HA 5EWSA 4BMEA 4CDXA 3QCWA 4JAAA 5BNPA 1C5IA 5FUIA 2YC2A 1QJX2 3AP6A 4TLGA 1CAVB 1ODNA 2XWJB 3ZXFA 1S0DA 4A6OA 1W8FA 4QGNA 2HWD2 2OZJA 1TEIA 2OUHA 4IEZA 2YMZA 3A22A 3KT7A 1O3TA 2ZPXA 3ZSKA 2D6OX 2VULA 3PU3A 4UW6A 4BZ4A 1ZRDA 1UOJA 4BQWA 2PHRA 3N7MA 1QIQA 4EN8B 2VD7A 5D8AB 3H9AA 1ZBE1 1VMHA 4GXLA 4JX0A 4U2AA 4QPGB 5JMOA 1S1AA 2QQKA 2PMWB 2WT0A 3WDYA 4D6QA 1JZ3A 2RJ2A 4WV8A 4RR3B 1Z7S3 2ZACA 5LBCA 3VL9A 1W28A 2EXJA 4AEDC 1MS5A 3D5OA 3MIHA 3K3OA 1SFPA 3OYWA 3K75B 5ACA1 5KBFA 4FOWA 2BERA 4N8MA 4B4QA 1HIXA 5FQ0B 1GOHA 1FNZA 1FT9A 3I2IA 5CYYA 3HQUA 3ZFEA 3NV3A 4A7ZA 3ZFGA 3T08A 1V6IA 3FLRA 4G3YC 1ASJ1 2HEYF 1U12A 1FI2A 3DV8A 5J09A 2Y60A 5HI0A 3DEMA 2DV9A 2LS6A 4HKWA 5FZBA 5C70A 4AW7A 3I3DA 2GH2A 4CDQA 1AYM1 1YFYA 2R32A 3WW4A 3USUA 3HMYA 1TNFA 1R092 2VU9A 1KS5A 4JGZB 3S57A 1BEV2 1EV12 4LO5B 4WM8C 2WAAA 3D4KA 2C1FA 2WO2A 2CV6A 2VW1A 2P3YA 4DIQA 2I2SA 1GFF2 5DMYA 1C8M3 3WW1A 3DYPA 4NRPA 4HN1A 4HVRA 4LR4A 2JIJA 5K8SA 1SBEA 5A1AA 1MQTB 2D5HA 4Q0PA 3E6CC 1XNKA 3ZYIB 3AYAA 4CVUA 1COV2 4XJ9A 2WRAA 3J7NA 1NCRA 4HN0A 2DVDA 3E6DA 3CO2A 5FYMA 1WMXA 1O4ZA 1LKNA 1ZZ7A 4QDRA 4JZRA 1UOBA 4CP2A 2W39A 2PELA 5D8AC 5FUNA 4AK3A 2RG4A 1OBNA 4TSVA 5FZ1A 4QPGC 2X29A 4IXLA 2B42B 4MGSA 3FFQA 1J3RA 3IDCB 4C1XA 1QU0A 1D4M1 1SHWB 2Y0IA 3SNMA 4UFLA 5FZ9A 1K12A 1R1ZA 1CPNA 4FBFA 1VBD3 1W9TA 4PLMA 1OA4A 5FFOC 3NL1A 4OI1A 1ZBA3 5T54A 3H0OA 1AL23 1W6MA 3ZMNA 2HWC2 4GH4B 5C33A 4M01A 2V09A 3SH5A 2LW8A 1RUG2 1XSQA 2HJIA 5T50A 5CBLA 1JZ2A 1N1VA 3OGJA 4D94A 1SZBA 1OFNA 5FZOB 1G6NA 1W2UA 3ON7A 4CEWB 2WLQA 5KXBA 2H0BA 4XFFA 1Q5OA 4FFFA 5AVPA 4Y1VA 1DQ4A 2A5ZA 1VBA2 4JCKA 1RUI1 5LY2A 4E4HA 4PCRA 5IK8A 1RIRA 2ETEA 3PVNA 4S2GA 2YPJA 4XJAA 3VD5A 3TB0A 3J7LA 2QVSB 2ZTNA 1H9PA 4AFBA 2RJLA 4NIAA 3VBHA 1AR61 2DCYA 4YZ2A 1IPSA 2LUWA 3BALA 1CJPA 5A6ZA 2YC4A 1NG0A 2VCCA 2P3IA 3OBZA 4JGZC 5FZHA 1QQP2 3S30A 1CAUB 2JD9A 4IERA 1ZNPA 2CGNA 3IMMA 2PHFA 2B7YA 1NY71 5DDJ2 1MS1A 1PO21 2UY8A 5I8SA 1W9WA 2C4XA 1QJX3 4B3NA 2QDRA 4BQ4A 2NLRA 3I49A 2P3JA 1MQTC 4QX8A 4XHBA 2XBO2 5A3OA 3H8UA 3TN91 2F6BA 2C5DA 4M00A 5FLIA 4IEYA 5FK7A 3I8TA 4OVEA 4XQWA 4QKNA 4ATEA 4CU8A 4CCDA 2E31A 4SBVA 2Z69A 4RHV3 5JXHA 1AR83 1H2MA 2RVAA 3P3NA 4QU2A 1GP5A 5DN2A 2PYTA 4CEYA 3VKFC 4DMIA 4OZXA 3HPNA 1Q8PA 4WVZA 2WYFA 3POBA 4AVAA 4D7TA 4TTGA 1OOPB 1HV0A 2QQMA 3VD9A 2ORZA 4P9JA 5JXIA 5FMBA 2MHFA 1UY3A 1DP0A 3I54A 1WA6X 2RV9A 4GH4C 2W47A 3NW4A 2R6QA 4P9IA 2BP6A 1JZ8A 1C57A 4CEWC 4Y4YA 2WUHA 4Z07A 3NJXA 4JDMA 5IW0A 1B35B 1POQA 2G1MA 2O0OA 2XVLA 1VIWB 3C7OA 1DYPA 3WOGA 1RVF2 1X8EA 1F5JA 2HWE1 4HKLA 3AMQA 5IVJA 4AHZA 1QNWA 1UYZA 1VR3A 1EAH1 4N53B 2AR6A 4QWNA 1R093 5EPAA 2QUOA 1FPN2 1BEV3 1EV13 3S7EA 3O1PA 2RR13 2QNKA 2MNGA 1VBB1 3M70A 3LEMA 4MGTA 2FMYA 1AUYA 3ABZA 2R0FA 3VKNA 1MS4A 4YW7A 5FUPA 1O91A 2Q30A 1K45A 1PM7A 4P9LA 1JW6A 4UFJA 4CDWA 4UWDA 1ZRIA 3F95A 3FX3A 3T2OA 2RMU3 2EXHA 1RUF2 1COV3 2VBDA 3FJSA 3Q8BA 4IE5A 4L99A 4Q8LA 4BQ3A 2EAKA 1RUJ1 4Z8BA 1O8PA 3K51A 4JHTA 2D3RA 3LOIA 4F7ZA 1VAMA 1KRIA 1GR3A 5E1RA 1GICA 5LY1A 4K1YA 5F5CA 1J3QA 3AZYA 4P5HA 5ACA3 5I93A 4A4AA 2ARXA 4RL7A 3WT3A 5LBBA 4YPJA 4Q27A 2FDHA 5B4XA 1VRH3 1YQ8A 1GQPA 2VNGA 1ZRRA 1YXWA 2PAEA 2HEWF 2VECA 4FPLA 1QF3A 4INDA 4K9SA 1XYNA 4LLOA 4TN7A 5DG2A 5DUXA 3MO4A 3WDTA 1OOPC 4UFHA 2ZGLA 4LHSA 4META 1CAXB 5L19A 4EQVA 3TEXA 3LWCA 1WW4A 2HWC3 1QXRA 2RS51 4KG0A 5HPOA 4EJRA 5DAPA 5CG8A 4TWTA 2XHKA 1BVP1 1AYM3 3JD71 4IL7A 4AVBA 1KJRA 2YGMA 3JB8A 3KMHA 1DGWX 3UETA 4Y5Z0 4OQ9A 1FOD2 2ZEXA 1GWMA 2BUKA 5C3RA 3UKTA 4LK7A 4Q4W1 1GWLA 5FYYA 4ZU7A 5JAXA 1B35C 1POV1 1Y9MA 2GDFA 4YW4A 5C4WB 2VMGA 5FQ0A 4P5YA 4OMCA 1BVVA 3NAPB 3D82A 1U0AA 5F8PA 4MADA 3BODA 1NA1A 4Q0UA 4IW3A 4N53C 5FPZA 3AM2A 3FLPA 2ZGTA 4CRQA 4KWLA 4N7IA 4B1MA 5IVYA 5FYUA 1CESA 2A75A 1UXXX 2EXIA 5CKNA 1TMF2 1BCXA 5DDJ3 2XJUA 4COYA 1H2LA 1UY4A 1N3QA 4IEXA 4RA0A 1HXS1 4IQPA 3JBG1 1YRZA 1O3SA 2Q5TA 2QQJA 4CTEA 4ZONA 3GZTB 1CGPA 2XBO3 4ZKTB 5J36A 1K3IA 2RM22 1S0FA 4KL1A 4MG2A 1QOSA 1ODMA 1DBNA 2OX0A 4YZ3A 5FWJA 1DQ6A 3J8F1 1PK6A 1GQHA 2IXKA 2XH6A 1GANA 4D3WA 2V4VA 4GQ7A 4QQ2A 1TME1 2I45A 1BBT1 2Q8EA 1ULFA 2NZ9A 1HB2A 2Y64A 3OY8B 1WMEA 4L8QA 4AI9A 4OULA 1SDWA 1N1SA 1QJY1 2J1SA 3WW3A 3KD4A 1BXHA 1GWKA 4FPKA 2JG9B 4IEQA 4XJWA 3T1LA 5KHIA 3O1UA 2AGSA 2P6HA 4XMAA 4HVOA 4K21A 1LRHA 1R081 1AXZA 3J7HA 3PVEA 3ATGA 3T09A 1RUI3 1RJ7A 4PIXA 4QKBA 4JRAA 5LATA 3VB9A 5A6QA 1OPOA 2VQTA 5K0UB 1REEA 2AENA 4BCUA 2PAMA 3VKMA 4AQ6A 3R0RA 1AR63 3TRSB 3I2OA 2Q8OA 2B46X 3OPZA 1RL3A 1S2EA 3LIGA 4GH4A 5L9VA 2YUEA 1WBFA 4D6RA 4I01A 2FZ2A 2WQ8A 3DXTA 1MS0A 2RDQA 5C4WC 3WG2A 1PO23 1RUH2 3THTA 1SFNA 3KV4A 5EYYA 3NAPC 3PU8A 2HWF2 2DVFA 4YW2A 4EROA 4LHNA 2ZKLA 2IXJA 2HKXA 1D7PM 5ABJB 5FOBB 2MEV1 2ZEYA 2VUAA 1ZA7A 1I5ZA 3GXUA 3AZXA 5C5UA 1LOCA 4GMP1 3WF2A 2BNMA 1UOGA 5LEJA 2CAVA 1FYUA 2WA3A 1VMJA 4QX5A 4YARA 4NIHA 4OQ8A 2GMPA 1SLLA 2GC0A 2WL1A 1UZWA 3ZYPA 1RITA 1GOGA 1IZ3A 3MYXA 1BK1A 3WDUA 2X5IA 1LHUA 5J96B 2ZS6B 3O1VA 3AYCA 2ZGSA 1RUF3 2XB6C 4MHUA 2W46A 2WC2A 4CCJA 2PQSA 5IK5A 1O3QA 4Q0VA 1HV1A 2A3YA 2E7AA 1JTZX 4NOTA 1UN1A 4DUXA 4KQ7A 5T55A 5A70A 1GMMA 3H1WA 5IJRA 5FAXA 3O1MA 4CXWA 4BQ5A 3P5BA 2JDMA 3ZYGA 1URXA 3AYEA 2ZGOA 3JCIA 1NLQA 1N1TA 3LOBA 2GC1A 2JJ6A 1JYWA 1O6UA 5LRSA 2VG9A 1OUXA 4AFAA 4CCOA 3RJ2X 4LHKA 4FSJA 1IPJA 4QDSA 2JG9C 2ZAAA 3HN3A 5BNQA 4P9XA 3DECA 2VMIA 5CNAA 4V2WA 2R061 1UD1A 3PL0A 4K8FA 4CCLA 3OB8A 3BI3A 1JZ4A 1VJ2A 4PF5A 1XU2A 3AP9A 4AAPA 1FAYA 5K0UC 3NWKA 2WS93 4XEZA 3RZZA 1E57A 1EPZA 1RB8G 1XE7A 5KHHA 2ERFA 2DBIA 2CAUA 3TWIA 4Z82A 3IBMA 1W04A 1WD3A 5DQ0A 3PIJA 3UGGA 1ZREA 4NHLA 1S0CA 2UYBA 4MOAA 1P8JA 2VNOA 3VZOA 5HCBA 1W6QB 3WDXA 1VRBA 2C24A 1RC6A 1ZYBA 2H6CA 3E1F1 3NV4A 4HANA 4XF9A 1DYOA 1GZWB 1NCQB 3HWJA 3NNLA 5ABJC 1LB2A 2F4LA 1YLLA 5FRAA 1RUJ3 1X8MA 3MW2A 5J1XA 3VBOB 1S55A 2NYYA 2A71A 2JE8A 4XFBA 1PZ7A 3PNAA 3W9AA 1TMF3 2YBSA 4RYDA 2EA7A 3RWNA 2W5FA 4MVTA 4WM7B 3SCGA 2CTVA 3NMBA 3U4XA 3CBNA 4NIGA 4M3CE 1DGLA 4XDPA 2X10A 3AKQA 1NT0A 3OBRA 1O59A 5HV4A 1SBFA 1HX6A 2WNVB 4QPYA 2RM23 1APNA 4FOVA 1WCDJ 4H55A 3TYJA 3EO6A 4CUCA 1C8NA 3O1RA 5J3UA 4PIYA 1LNSA 4DOUA 1IG3A 2PQQA 3POEA 4PI2A 3OEAA 4OMDA 3DKWA 3PMSA 1AJOA 5JIAA 5LK7B 2AACA 2XGXA 4E9KA 4F3JA 2D6MA 1Z7S1 2XJRA 5K4LA 4B29A 4FFHA 2XLFA 2EVXA 1C4RA 5C9AB 2HBTA 4KMQA 2QZ2A 5FKCA 1POV3 2CYFA 1LECA 5LASA 3ZO0B 5GKAC 3H8RA 1FX5A 5I91A 3H3ZA 1RUNA 2WA4A 2R042 1JU4A 1JYVA 5DAVA 3NNMA 3K4ZA 4XFIA 5FP8A 1RUD2 1SFYA 5LWBA 3ZXAC 2O1QA 4RSUA 2ZA9A 1YFXA 4CP9A 1JZ7A 4PBPA 5FWEA 2ATFA 4G9SB 5F39A 2ARBA 2VCAA 4HVQA 4OZOA 3BTYA 4IE6A 1LCLA 4EN7B 2K0GA 4YG0A 3FZ3A 1NE4A 4E4DX 1ULDA 4AI2A 1JYCA 3N9MA 2IUWA 1RUH3 2OT7A 1HXS3 3M4FA 1OLMA 5FYZA 4LBKA 4HZFA 3MW4A 3I2HA 1SEFA 5EZWA 5BPXA 5C4WA 3DF0A 4R8HA 4XDOA 3KHBA 1NCQC 2JKBA 4NIDA 1M06G 1MR5A 4HBNA 2EALA 2YFUA 3K77A 1PVC2 3WUCA 4EZHA 5IT6A 4JRLA 3J8F3 4XXPA 4Q0QA 2XUMA 1LHOA 3WXPA 1V6MA 3IDAA 5GZCA 1C8M1 2AUYA 4JVAA 1BBT3 5CU1A 5FYBA 3PHMA 4WM7C 5A1FA 3W5MA 2K2SA 4B4PA 5FZLA 1F9KA 2JB8A 1QEXA 1QJY3 3ETQA 4AI3A 4D7YA 4XUTA 1OF4A 1L3JA 2IVJA 4ZS3A 1CX1A 2VJXA 2WNVC 4CDUB 2W9XA 3RMYA 1NXD1 3GGLA 5F3CA 4DXRA 1OURA 1R083 3VUOA 3HR9A 1JN2P 1DQ0A 2VY0A 2GN3A 2OYZA 1J58A 4BH9A 3KHCA 2W95A 1ZRFA 3ZLIA 5KHKA 3BU0A 4AGRA 4J6GA 2F17A 2Q4SA 2AYHA 4PF1A 2RS32 4DY3A 5H9SA 3RZMA 2XPJA 1UYPA 2VOXA 3HBKA 5FYIA 5A3TA 2NQYA 3HT2A 5FY9A 4XZUG 5DAXA 3WNKA 4LUKA 1YQCA 4Y20A 5B2GB 3JB4C 2QQUA 1JODA 2XVKA 1LGCA 1ZBA1 2GNTA 3MIGA 3OY8A 5BXXA 2N7GA 4COVA 4EYUA 2QQWA 2Z4FA 1SCRA 1H1AA 3BIWE 5DZGA 3ZYFA 2JDPA 2XONA 4DXZA 1RXGA 1VBC2 3PUQA 4FFIA 3VV1A 2V5YA 1G9DA 5SV5A 1CAWA 2BBAA 2VBPA 2GU9A 3E5XA 3LQCA 2I74A 1D2SA 1H2NA 4HK8A 5F6LB 2VH9A 3VHOA 1HRI2 2MEV3 3RZJA 1UYYA 1G9FA 1XSRA 3MI8A 3U37A 2E9QA 2ARCA 4GMP3 3O1SA 1BHGA 5K0UA 4TZDA 1JYIA 2P17A 3WVJA 3RFRA 3AYDA 3HOBA 2VVDA 2D6LX 1X9PA 1KGYA 1PO13 4HLTA 4RGKA 2VOKA 4OFGA 1LHVA 3WNPA 2YBPA 5C8CC 3V0AA 3POIA 5JI9A 5BNOA 4A44A 5JZGA 3ACIA 2Q0AA 3IAQA 4Q4X2 3INAA 4AWDA 1WMFA 2AH2A 2DTWA 2YG0A 1UO9A 3H1YA 2VUCA 4MHRA 4Y22A 4YGCA 5DZEA 3UJQA 4AHXA 1W2NA 4LBNA 3CKHA 3AFGA 1QJX1 1GNHA 1H1MA 1F2NA 3ES4A 4ITCA 4RD7A 1LULA 1ONAA 2GH8A 3N7JA 5FZ3A 4FPYA 1Q56A 2P4EA 4Z2WA 3RYPA 2XLGA 4LJHA 1HQNA 3VZJA 2AZ5A 2WWUA 5E16A 4XFAA 5KR7A 1G7YA 3OUHA 2CY6A 3PTRB 4CDUC 2XDVA 3MZHA 5C3PA 1EUUA 3OGGA 3WNOA 2R063 1VBE2 1A6CA 3ILRA 4XFHA 2O8QA 4QMAA 4LOTA 3JZVA 4LXLA 2FDFA 3AKTA 1CZVA 4QT6A 4RHV1 4AL9A 2FHRA 4BIOA 3NRUA 4XW3A 2WFF2 2YB7A 5GLZA 3O5SA 3AFKA 1PGW2 3DPRB 2PFWA 3RI9A 3LSEA 4NE9A 5IVVA 1DGWA 2ZMLA 1HN1A 2OW4A 4TYSA 5EJ1B 3B3QE 5FPLA 4BLIA 4RQPA 4LO7A 4XVHA 2W0XA 1H8TB 1NLSA 5FYVA 5A7SA 2YGLA 1NLRA 2VE1A 4ZU5A 4QHBA 4PQ9A 2R043 3AL5A 1SACA 3EB7A 4HK9A 2A6ZA 2XJPA 1CN1A 4AZZA 4DNYA 2JE9A 3NJVA 1DIWA 2OZ6A 4CU7A 5HV0A 4CCEA 5KXEA 1UKRA 3SISA 3MIEA 3N9OA 3N9QA 2ZXQA 2R072 3W59A 4ONUA 3WX5A 3PVOA 3OPWA 5FP7A 3R4DB 5FY4A 2BGOA 4HOOA 4EZ4A 1T6BX 1YIPA 2RS12 1VB4A 2JX9A 3MW3A 4JC1A 4I3GA 1X82A 2XKOA 4LA2A 4AYUA 2VZTA 1CJDA 1ST8A 3ZN4A 4EV0A 4GD4A 2YU2A 3P3PA 3DN7A 4QX3A 3MLLA 3ZIWA 1R091 5I8YA 1BEV1 1EV11 4CCMA 3TEWA 2GMEA 2RR11 1W6PA 1NXMA 3B9CA 4O61A 2A6YA 5AFEA 1UOFA 1W6QA 1LU1A 3IKWA 5FREA 4YVWC 3OGVA 4UOJA 3ZOIA 2AC1A 4LITA 2DVAA 2J7MA 1NCQA 2BFUS 3FHQA 4BJ0A 1XOYA 3ACHA 3IIIA 3A0KA 3HNYM 5A80A 4I0WB 3AZZA 3N9LA 1BMV2 2FZ1A 2RMU1 1COV1 2VPVA 2ET7A 3LA2A 1F15A 2UU8A 3J26N 3HN1A 1OH3A 3AB0A 3BOWA 4WM7A 1E5HA 5FY5A 3H7JA 4K8RB 5LK5A 3GNEA 2WNUC 4JDOA 5TSWA 2Y26A 3UKVA 1VAKA 2PLV2 1LODA 3WP6A 1O8SA 5I0RA 5L73A 5C6CA 4I0BA 4IGQA 3WHUA 2DU0A 2RS33 1VRH1 1OA3A 1OFSA 4Q1PA 3CJIA 2BVVA 3DPRC 4NRQA 4UAPA 1E5SA 4FCAA 1YUDA 5IAVA 4N43A 3D0JA 1O4TA 2YZ4A 2A7AA 1GZTA 1H8TC 3RMXA 1JOJA 2HWC1 1OUSA 3C8XA 3PMEA 1JZ5A 1RUG1 1QGLA 3BVCA 1JXNA 4QQHA 4NIIA 5CKQA 4IGPA 3GBFA 2WO1A 1V6KA 2VZUA 4E4ZA 1UY2A 5J48A 1IS4A 4UI9L 1S0GA 3E6BA 5FY0A 1AR72 4WZFA 3RZKA 4NMIA 2E53A 3AZWA 4FFGA 4YZ4A 3ZXKA 1D4VB 2B9VA 2VTXA 2FCVA 1H4HA 3RI8A 5AC92 1I1EA 3K46A 2JDAA 1HB3A 2G9ZA 2JWPA 4N90A 3RQ0A 2BU9A 4DEQA 1SLTA 4DPNA 1N1YA 2X8KA 4YGEA 5BY5A 5FZ0A 3I59B 2D6KA 2VNRA 3SKVA 1W6OA 3UJOA 5C5TA 1NX9A 1QQP1 1ND2A 3USSA 1YQ2A 2ZX2A 2VXRA 3POSA 5JOXA 1QJU2 5C8CA 1MS3A 1SQ4A 4MGYE 5DDJ1 1OD3A 1W9YA 1YI9A 3M8LA 3OD4A 5FMOS 1U5IA 2WNEA 3B7MA 4KU8A 3UKNA 4A45A 5FY7A 2CWSA 4GMP0 1Y4WA 1LOAA 2QFEA 2XBO1 5CFCB 3RZGA 1TNRA 1YQ6A 4RR3C 2QBXA 5FZ4A 3LDRA 3V56A 1W8TA 4LE4A 5I0DA 1RUE2 5C3OA 4AG4A 2XJTA 1LAJA 1W0PA 4AE2A 5FOJB 1L7LA 4B7EA 3H3LA 4L2NA 1OVPA 4YG6A 1V0AA 3POFA 2RHPA 4KWJA 3VBFA 3EHKA 3Q8EA 2WO7A 4QX2A 2CGOA 3WW2A 2C9AA 5BV6A 3RSJA 3OD0A 4O65A 2ZX1A 1Z78A 4FT8A 4NHYA 1QH6A 4W4ZA 5FLHA 5GZFA 3ZPYA 1PHMA 2VZVA 3BN6A 5GJ6A 2WDBA 4LO8A 1WWYA 4L9BA 4SLIA 1CZSA 4HT1T 3VHPA 1GKBA 3GJBA 4IE0A 4L11A 4OHZA 4AAXA 2BNNA 5T5LA 2E33A 4H7MA 3POYA 2NM1A 4LORA 5FXVA 5CA6A 1RVF1 3DYOA 2WJSA 4O9GA 2YDEA 2SBAA 3LCPA 4Q1RA 2AEZA 4XF0A 3GM8A 5L7OB 4A42A 2HWD3 4XURA 3MEPA 4IV1B 1FPN1 3MUZ1 3TEZA 4WVVA 5FPBA 4A2UA 2EIEA 3ZYBA 1MZEA 4IEOA 2CGPA 1LEDA 2WKKA 3WHTA 4FOQA 4QQLA 4XUQA 5FY1A 2PHUA 5HCFA 4LBJA 5ERLA 1MZ6A 3B5LB 4LMFA 2VL4A 3GCXA 4P9YA 2WYSA 3AVRA 4KWUA 2E32A 4YVWA 3ZFFB 2W68A 4AFCA 3I97A 4QB6A 4YFWA 1RUF1 3M1HA 2BOIA 2KM2A 4YG3A 4BHPA 1DQ5A 3AK0A 2PA7A 5CFCC 3LDBA 3KM5A 4QKFA 2VXJA 2C9KA 5J98B 5JOYA 1Q8QA 3RDIA 1S0BA 1C1FA 3H7YA 2DU1A 1S2KA 1S0EA 5A7QA 3VN4A 4YZ1A 4JKMA 2KA3A 4AEDA 1AYN2 2WNUA 3MGUA 3LF7A 2XJVA 1JOPA 1XE8A 5A32B 4YW5A 1HRV2 5C7GA 4E8CA 3AJZA 2GN7A 1CX4A 3MLKA 3IN9A 3NNFA 1RUC2 4W6YA 5LA2A 2BV4A 3DPRA 1XBFA 3WF3A 2AEYA 1BQPA 1BK0A 2JICA 2VAUA 1W8NA 3BPSA 3FUQA 1W6NB 5F5IA 3M3CA 2WS91 2NN8A 4BQYA 2X09A 1IS3A 1H8TA 5JPMB 3OOXA 1JZ6A 3UGHA 1JUHA 1R64A 3AJYA 2DTYA 1YEWA 3CDZB 1AR73 3B9IA 5FV3A 5GM0A 1LR5A 1J59A 2FD8A 3CZJA 4C90A 2QCSB 2ZHLA 4RGAA 5DAQA 2VOWA 1LOBA 1OKQA 5AC93 3LA3A 2B5HA 4WM8A 2FDGA 3KV6A 4AGVA 1JS9A 2YYOA 1O5LA 5L7OC 3NV1A 2R1DA 1IKQA 1WA4A 2ORXA 4BXFA 5JOWA 4FTEA 1MEC2 1R1A2 4IV1C 4LQRA 4XTMA 2CHHA 4QX0A 4JTOA 2BZDA 3ZX7A 1CAVA 2ZMKA 1TMF1 2WIIB 3CQOA 2JEMA
chains in the Genus database with same CATH topology
4IEUA 3NKGA 2KXLA 4C91A 1I9RA 1QDOA 3CNAA 4XE9A 3ZFFC 2BWAA 4AEKA 1FATA 5D8AA 2RM21 3ZXEA 4QPGA 3I4IA 3BPZA 1YCIA 1I3HA 3R05A 2A6XA 5I8TA 3OBTA 1TQ5A 2ES3A 3VKOA 4RR3A 1RGSA 1RUG3 3NV2A 3MICA 3URFA 1LJ7A 1XU1A 4W6WA 1H0BA 4XXAA 5KWRA 2R49A 1JUIA 2NP0A 1VBA3 3EBRA 2E63A 4ES8A 1QWRA 1REFA 5DUUA 5L36A 5FDBA 1WLWA 4JGYB 2WSVA 5J37A 1UKGA 1QQP3 3VBUB 3M7AA 4WBBA 5LEKA 4OHXA 1A8MA 1BJQA 1RUH1 3KCCA 4JGZA 4LULA 4E27A 3ZSLA 2HWF1 2PHWA 3CU7A 4QQPA 3AMPA 4YW1A 1KFUL 3KSCA 1GLHA 4E2QA 5A33B 3KGZA 4WVMB 1XNDA 4LNVA 1AVBA 2HWB2 4FPOB 1MQTA 4B8EA 1CIWA 3JU9A 4LUMA 1OPMA 3VL8A 3RYKA 3FE5A 1AF9A 3WZ1A 2ILMA 1N47A 3E5UA 3MIDA 2RJKA 2BPA2 3A4UA 1GZCA 3B00A 1RJ8A 3QH7A 3RG0A 3WNXA 1Q3EA 1QKQA 3DL3A 1F5FA 2PHTA 1CD3G 2Z42A 5CFCA 4LBQB 3VBSB 1SLAA 1S0JA 1AYN3 1CPMA 4C0HA 5T3NA 4R4ZA 1OQ1A 4LA3A 1PIV2 3IWZA 3H3UA 3JD72 4COZA 1RUC3 2BVBA 3POWA 4BLJA 4E2GA 1UAIA 4CEWA 1RVF3 4X6RB 1RTVA 3CEWA 1RHI2 4MX3A 4S2DA 2TEPA 3BB6A 1EY2A 1LOEA 2HEVF 1FPN3 2WSUA 4ISQA 4JGYC 4R9CA 3UV9A 3WQ1A 1A8DA 2GC3A 5DG1A 3VBUC 1WW7A 3RYRA 4KBBA 2CNAA 2ZGPA 3VBRB 1PO11 1CAUA 3MLJA 3VDDB 4NVPA 4NPRA 4QPIB 2E6VA 2P34A 2AREA 4XQDA 2OVUA 4BOWA 2BEOA 3IIAA 4KWKA 3ZXDA 4IEVA 5L7OA 2ZGNA 3V0BB 5F9TA 1I6XA 1ENRA 1IKPA 2G9GA 4DINB 3J9SA 3KGLA 1A78A 1S2BA 4Q0SA 2JG8B 3MFAA 1AX1A 1SLBA 3UK9A 5K9YA 3GZUC 1O4YA 1SMVA 1OLRA 2NPIA 3ZFFA 3WG3A 4A7KA 3D8CA 2D44A 1XRUA 3VHNA 5LRRA 4HSJA 2GSYA 1GV9A 1OOPA 3CJXA 1FMD2 4RGGA 1J1TA 5F6KA 1FOD3 3NVCA 3AP4A 1AR92 1YJKA 1CONA 1Q8SA 1Y7BA 2R041 4MUVA 4PJYA 4LO4B 1RUD1 3KB5A 1B35A 3GBWA 3S7IA 1AL0G 2Y0OA 3MF9A 3IPVB 2D97A 4CDXB 5BNPB 4F8AA 3G7DA 1W6NA 5A3MA 1RINA 3THPA 1AHSA 1RMU2 4N53A 2NMNA 2LM3A 3AKPA 3C2UA 2GZWA 3MF6A 1XXNA 4HMZA 4K20A 3VBRC 4LBMA 4LE3A 4R9DA 3IDBB 4HL0A 5CG9A 5IK7A 2CL2A 3VDDC 4UW3A 5JDBA 4QPIC 3SCHA 4I0AA 3TNQA 1VLNA 1PVC1 3T1MA 2HWB3 4BA6A 3ROUA 1GYKA 4CP0A 3GHMA 4FXKB 5I0TA 1C28A 1AX0A 3QLQA 4Q4Y2 4M0HA 2R16A 4EN0A 5C8WA 4YRDA 2JG8C 3FLTA 3OYWB 5FO9B 1UU6A 3LGRA 3WG1A 1C1LA 3ELNA 4URTA 4ES9A 5CADA 4WVWA 3SMHA 2RS31 3DUIA 5GZEA 1YIFA 3WD5A 1CAXA 4L92A 4WZCA 4QM9A 4BM8A 2R30A 1PIV3 5JMCA 2XL7A 3LSDA 4OI4A 4NO4A 3A0NA 3L9JT 3PTYA 2DUOA 5SV8A 4JTNA 2PAKA 3WDWA 1VBC1 4CDQB 3M3IA 2BBVA 2R1BA 2HWF3 4Q4V2 1YFWA 4AFDA 4BWOA 1KS4A 1HRI1 1PZ9A 2GALA 5AVAA 3GYDA 3R4SA 3NAPA 4CDXC 1KD7A 5BNPC 3VBOC 1U5XA 2EXKA 2D3SA 1KDKA 2ZOEB 4MGIE 2WZPP 3VBUA 3APBA 2WT1A 4H7LA 3AXDA 5EFUA 1J3PA 2QKDA 3RS6A 2VMHA 1ULCA 1KITA 4XETA 1MZ5A 4Q4X1 4Q8KA 4HKOA 2QDNA 1UIJA 2JD4A 4XIKA 2BGCA 3ES1A 3ZXJA 3SLIA 4WVMA 1O7FA 2YY1A 1ENSA 2LTNA 1DQ2A 5IK4A 2D6NA 2LALA 1WW5A 4OHWA 4KG8A 1FV3A 1ZZBA 4NN0A 1DZQA 2ZCWA 4MZUA 1W6MB 1VBE1 3U0ZA 2JG9A 4Y24A 3ZN6B 1OD5A 1D2QA 2UURA 3ILNA 4EN6B 2A6WA 3WCRA 1RUOA 3FMGA 4DY5A 1KJLA 4LT5A 2MPFA 1ZZCA 1PGSA 3N7LA 1DZRA 5JIUA 4DZGA 1Z0HA 3O0WA 1AR93 2DWRA 3HQXA 4YM1A 2P3KA 1UL9A 2VQAA 3VBHB 4M3CF 3ALQA 4W65A 1QXJA 1QH7A 4D7SA 2ZAHA 3VZNA 2R0HA 4FAGA 4LBOA 4PDWB 1V9U2 4PIZA 2H0VA 1RMU3 2I07B 2RS11 1UPSA 5ABJA 4E2SA 4QGMA 1X7NA 2VW0A 4K3UA 3QBQA 2DCJA 2HWD1 4XJUA 3T2TA 4P9GA 5T5PA 5GZGA 3VGIA 3VBRA 3WQ0A 1V6LA 4LHLA 1BKZA 1UW8A 2ET1A 4N7UA 4V1PA 3I2DA 3KCYA 4CEYB 2GNMA 1ULEA 3B94A 1D0HA 4Q4Y3 5FBZA 2WZR2 4AI8A 1LEMA 1Y9QA 1K5MB 5KC5A 4GB32 4LEJA 2BFUL 4FPGA 4DQAA 1IGOA 2PLV1 1XYPA 1VBD2 3SXWA 4FP2A 1X36A 3E5QA 4GKYA 1RUD3 1AL22 2EAAA 2IC1A 2C0ZA 4DS0A 1PGL2 3U07A 1FV2A 4AVVA 1G86A 5FO8B 2PTMA 1YJLA 3ILFA 2GNDA 2BQPA 4NHMA 1MS9A 4JV4A 4YW3A 3SCFA 1UPIA 4Q4V3 5BNNB 3VBHC 5BUVA 1G9BA 2DCZA 3HT1A 3HAGA 5EJ3A 1POV0 3WP4A 1C3HA 1AR71 4X6QB 1PVC3 5JSOA 3ST7A 4PDWC 3QACA 5AC91 4CDWB 5KC6A 1LOFC 2JECA 1GZWA 3IPVA 4UBHA 3VHRA 1ZZ9A 2EIGA 4D69A 4ATFA 3VBOA 3WQ7A 1GZ9A 5F5QA 3AP7A 1WLTA 2E7TA 3H1MA 3V64A 4NWWA 1N3OA 4FOYA 4AI1A 1QJU1 1OSGA 4NR1A 4MXVA 1B09A 3QD6A 4FPJA 2WNVA 4MXWB 1EPWA 3MDPA 2E51A 2GMMA 1H2KA 4CEYC 2XWBB 4FXGB 5JI7A 4RHV2 1HLCA 4GWMA 3ECQA 1AR82 3VZLA 1ENXA 1K5MC 3LA7A 1V6OA 3C3VA 3KT1A 1CR7A 5FMOL 1GNZA 1IS6A 4YGBA 3WUDA 1RUE1 4COUA 1VBC3 4RS5B 1ZA4A 2YV8A 2YC0A 2D93A 2GAUA 1VAVA 3GF6A 4CZSA 1WLCA 2WINB 4MYEA 5C9AA 2XG3A 2PHLA 4PLOA 4R52A 4P14A 3ZMOA 1HRI3 4F83A 2ZJCA 4IEWA 5EXOA 1VBA1 3ZN5A 3R4UA 2FQPA 1NA1B 4FPFA 4J1WA 3WCSA 2OA2A 5BNNC 4KU7A 5K7PA 3R6SA 2UYAA 3ASIA 4Q4X3 2YHJA 3O12A 4I30A 1OQEA 1V9U3 2V73A 4Y1UA 2D5FA 4OUMA 2RR12 2DFBA 4CDWC 1KDMA 4QM8A 3QOPA 3WLUA 3WR0A 3AKSA 1ZBE2 1DDLA 2ZZQA 2XKPA 1ENQA 1PK6B 2RMU2 4AHWA 5E8AA 1VBE3 2A6VA 1F31A 3ZVXA 3S0MA 1NQDA 1A3KA 4XIOA 4GKXA 2VOVA 4CDUA 3X29B 2WFF3 3AMMA 5ACA2 4GALA 4S2FA 2EF6A 2WZR3 1QOOA 4FPHA 2IFWA 4GB33 4HPKB 2ZHKA 1VRH2 3HIFA 4XPVA 4FTBA 2B8MA 4K40A 1F8VA 2BTVC 1YNAA 1DLLA 1XYOA 4RS5C 1ASJ2 4LBQD 1UMZA 1AYN1 2JENA 1DHKB 4NWVA 3MPPG 1HRV1 2RE9A 2WQZC 3PLQA 2YXSA 2D6PA 1HDKA 2DUQA 2R073 1AYM2 2ZGUA 3ZN6A 1HQLA 1RUC1 1IQAA 2JXAA 2ZKNA 1MACA 4Q2FA 2RS13 3DGTA 2QE3A 1NA1C 2IFRA 4YM2A 5FO7B 1GQGA 4BIFA 4K6BA 1M4WA 2D98A 4UW5A 4AQ2A 1EP0A 5DUVA 4XBQA 4XF4A 4AFMA 1V6JA 4UXAA 4CYDA 3M2MA 1OHFA 4JQRA 3RNSA 2X5IB 2ZGKA 2Q1MA 1WD4A 1LESA 2F4PA 2IXLA 3AZVA 4M3CB 4PDWA 4BMBA 1YYNA 4DFSA 1DF0A 2UY9A 1LOFA 1MEC1 1QY4A 1R1A1 4C0BA 3WP3A 4FAHA 3B02A 4AHYA 1PK6C 4XTPA 2A3XA 1D4M2 4KGGA 4A3XA 2PLV3 4YGDA 2H6BA 2TNFA 1WBLA 3H50A 4O9EA 3ZDSA 5T5JA 5H9RA 5JOZA 5KXCA 3AP5A 4Y26A 1XNBA 2G4IA 3N4MA 1X33A 5JLVA 3J4UH 4S2HA 2VVEA 1K5MA 4AXOA 1ZX5A 2IXCA 2JDZA 2UWBA 3LAGA 1RUI2 3RJRA 3TOJA 2O8OA 1XNCA 3EJKA 4AQTA 3AMNA 4OHYA 5GLVA 1FOD1 3LB9A 3L2YA 1J1LA 1AR62 1NYWA 5T5OA 1XQNA 4ASMB 4LO6B 4W6XA 2G9FA 3PJQA 3KS7A 1NY72 3NSTA 3RPQA 5FLJA 4GA9A 1UIKA 1UU5A 1PO22 1AZDA 1ND3B 1AXKA 1ZZ6A 4XBLA 1MVQA 5BNNA 1QJU3 4IV3B 1BZWA 2OUJA 3TN92 4AQSA 2DFCA 4FPCA 4FVVA 2PHXA 2X5IC 3W58A 4XF1A 5BYNA 2ZX3A 4AGGA 2ZHMA 1WMDA 4YYOA 3MPBA 1ZBE3 1T6GC 2OPKA 4YVSB 3JQXA 4YM3A 5DXDA 1DGRA 1SLCA 2HWB1 1DFQA 2GC2A 1FNYA 1QNYA 5FCCA 1MS8A 3N36A 1RUE3 4XOGA 1LTEA 3ZIXA 2Z5WA 2Z79A 1IOAA 3PJYA 5IUQA 4MXWA 3I7DA 1CVNA 3N7KA 1LGNA 4Q29A 5J7MA 3AKRA 1NZCA 2ZMNA 1ASJ3 1OQDA 2FBEA 3HBZA 3K48A 3OTFA 5GALA 1LU2A 2Y38A 1LHNA 2ENRA 2HWE2 1ZRCA 2HYKA 1V00A 1PIV1 4XHXA 4UBGA 1BYHA 4RS5A 5JPNB 1EAH2 2WS92 1W39A 5CB7A 4ZXKA 2GNBA 1WW6A 3O0VA 5DZFA 1VBB2 3FC0A 1RHI1 2XL9A 1IPKA 2ZGMA 5CAZA 5CFDB 1JBCA 1O3RA 2VQ0A 5F1RA 1ND3C 4XFCA 5E89A 2D7FA 4XDQA 1NOVA 3VKLA 3CL1A 1AXYA 4EWEA 4IV3C 5H9PA 1RUJ2 1YI7A 3I59A 1V6NA 4KH9A 2P37A 1KXGA 4HETA 5AFBA 4DRRA 3GHNA 3SHRA 4YSFA 3AXEA 3S6PA 4N9IA 1KFXL 2Z2SB 1PNFA 1UF2C 4YVSC 4B4RA 3FFZA 3ZSEA 5HCAA 1D4M3 1U5ZA 3O14A 4FP3A 4IEPA 4ISRA 3ZXGA 4MLOA 1WGPA 1YHFA 2DF7A 3OF1A 5JR7B 5JWPA 3SITA 1SLIA 2E7QA 2RS52 5GZDA 4Y20B 1HRV3 3TNPB 4KGQA 1OI6A 1G9CA 1UCXA 1Q8OA 1G9AA 2D40A 1IHMA 2WQ4A 4HSLA 1AX2A 4FQZA 2IZWA 5JSPA 4P9WA 4YM0A 4ZU4A 3IT8A 1CAWB 3MIFA 4R4XA 1QDCA 2B9UA 4Q4W2 5JCTA 1DG6A 4R9AA 4HPKA 4XILA 3OCPA 2B45X 2ZX0A 1FMD1 4XF3A 4XJ8A 2P2KA 3U10A 2NMOA 2WWSA 1EYBA 3LKJA 5HXVA 1LGBA 1AR91 4GULA 4PBOA 5I0SA 4AEMA 2FMDA 3ZYJB 3V0AB 5E88A 1HQWA 2D3PA 4OI2A 5BNOB 5JZGB 1YWKA 3WDVA 1HXS2 5CFDC 3JBG2 1MEC3 1R1A3 4QGLA 3KT4A 3FBMA 1N3PA 4Y22B 1DYKA 4AEJA 1RMU1 3TN93 1ULGA 4IV1A 1PVXA 1PZ8A 4L97A 1LOGA 4EWAA 3J8F2 3UL2A 1H9WA 5DUWA 3VZKA 3E97A 1TME2 4U36A 1BBT2 2JE7A 4KNCA 4B7KA 4OLLA 1QJY2 5GLTA 1IS5A 2XLAA 1ALYA 3LZZA 3AMHA 4M3CA 3SH4A 4X8NA 2IWGB 4AF9A 1R082 2ZHNA 3VBSC 3JUUA 4OUSA 4YZ5A 4Q4Y1 1ZVFA 1U5YA 4UW4A 4RQPB 1UX6A 2W52A 3VZMA 1WCSA 2UWCA 4BQ1A 1O5UA 1PMIA 2B39A 3NO8A 3EXUA 1SBDA 1AJKA 3KQRA 3OJBA 4IETA 5GLWA 5A32A 1FXZA 1H4GA 1NQJA 1QOTA 4DB5A 4E4SA 2HWE3 5EV7A 2BW8A 2WFPA 3QH6A 3B01A 3IM0A 2W08A 4NHKA 4AVCA 1EAH3 4N9HA 2DVGA 2MEV2 2IXIA 2UWAA 1OMIA 2PN5A 5KHJA 2XVGA 1QMJA 1VBB3 4G4FA 4Q4V1 4Y1ZA 5BNOC 1W6PB 3RRDA 5JZGC 1JHNA 4H3WA 4X8PA 1PO12 1ZZ8A 2VUJA 4MSVA 1Y43B 3D6EA 2D43A 3WY6A 2DCKA 1DQ1A 1ND3A 4CP1A 2A3WA 4M0NA 5JVVA 1Y3TA 1KQRA 2A73B 5T52A 4XFGA 4AVTA 4IV3A 3KZ4C 2BNOA 4XZPA 1Q8VA 4RFT0 4QXKA 5D1IA 3CLPA 4Y1XA 3ZXLA 3V65A 3SH3A 3EQEA 2BWCA 2ZABA 3ACLA 4MGZE 2BYVE 5A3LA 5CIRA 4XJZA 4YVSA 1SCSA 2R062 4HFSA 3CJIB 2PHDA 3ZSMA 1MVEA 1WLDA 3ZFEB 5FTTC 5GLUA 2RS53 3ZFGB 4N43B 3JQWA 5I0UA 3IDEA 4RQPC 3FHIB 4QQOA 4ORFA 3JD73 2DUPA 4BYYA 4H14A 1LHWA 2IXHA 3KLSA 1WCKA 2QQPA 3O7OA 3KCXA 4Q4W3 3USUB 4ASLA 1RHI3 2QZ3A 1LENA 3GALA 1W0OA 2DVBA 3WG4A 3ZSJA 2TUNA 4Y1YA 1DZTA 3N35A 1YO8A 1YFUA 1V70A 4JGYA 1QJZA 4AI0A 1H1IA 3MIBA 1W6OB 1NCRB 3ENRA 3N3HA 1ND2B 3BU7A 3JBG3 5C8CB 1HW5A 3VLBB 3G6JB 4TLFA 4K1ZA 4FPEA 1V9U1 1MZFA 5CVRA 3FWEA 5CFDA 5A33A 2VW2A 2CWMA 3WP5A 4YFZA 3NJZA 1D0GA 2TBVA 3TBDA 2XJSA 4GIQA 1JH5A 1TME3 1QHDA 2OIIA 2ZX4A 1UZYA 4R9BA 1OLQA 2ZGQA 2ZZJA 3U11A 4EN9B 1VALA 3WV6A 3BOPA 2Q1ZB 1Z7S2 4FO9A 1NE6A 1TE1B 2WFF1 1H8VA 4DRVA 3CF6E 4GWNA 1PGW1 3CJIC 1FMD3 4QD2A 3Q9OA 3ZFEC 2WZR1 4JDNA 3PVBB 1PNGA 3VBFB 3ZFGC 4N43C 1REDA 2SLIA 1QXPA 4GB31 4I3PA 4LBQA 4LLFA 3VBSA 4PLNA 2YROA 5KXDA 4XYXA 3TAYA 1ZM1A 1VBD1 4MV2A 1S0IA 4XBNA 3O0XA 4CDQC 3FBYA 3HD8B 4YNIA 1H30A 4IESA 2ZBJA 3M3QA 1AL21 3FUOA 3GBGA 1C5HA 1PGL1 5H9QA 5JSRA 1X50A 5HBAA 2R071 4Z92B 4AVSA 2WT2A 1UZZA 1Q43A 1UU4A 4A7YA 1DU3D 5FPXA 1DGRN 5EYXA 4XQ4A 3B93A 1C8M2 1NCRC 4I02A 1ND2C 3GZAA 4YLZA 3ME2A 4MH0E 4COWA 3AX4A 3VDDA 4QPIA 1GBGA 4YVWB 4XMIA 3MFCA 1GSLA 1BMV1 3V0BA 2QJVA 1G8WA 2X53S 4Q26A 3BTAA 4BE3A 3BCWA 2XJQA 4I2OA 2DYCA 4AEDB 2DCTA 3IMNA 4LTAA 4C1WA 2WNUB 2K9ZA 2JG8A 1WUVA 1ZBA2 2ZGRA 4FQ4A 3NKTA 3WINE 4Z1VA 2VVFA 3D0SA 3B69A 1AR81 3ZYRA 4MGKE 3VBFC 3M3OA 4K7JA 2A70A 2VGDA 2WLPA 1CQ9A 1HKDA 1VB2A 4EWDA 1OA2A 4J1XA 3M3EA 4I09A 4FTSA 4LBLA 1VP6A 4OI0A 4BPZA 2DURA 4WM8B 4OHVA 3L2HA 5EWSA 4CDXA 4BMEA 5BNPA 3QCWA 4JAAA 1C5IA 1QJX2 3AP6A 1CAVB 2XWJB 3ZXFA 1S0DA 4QGNA 2HWD2 2OZJA 1TEIA 2OUHA 4IEZA 2YMZA 3KT7A 1O3TA 2ZPXA 3ZSKA 2D6OX 2VULA 4UW6A 4BZ4A 1ZRDA 2PHRA 3N7MA 4EN8B 5D8AB 3H9AA 1ZBE1 4GXLA 4U2AA 4QPGB 1S1AA 2WT0A 3WDYA 4WV8A 4RR3B 1Z7S3 2ZACA 3VL9A 2EXJA 4AEDC 1MS5A 3D5OA 3MIHA 3OYWA 5ACA1 5KBFA 4FOWA 4B4QA 1HIXA 5FQ0B 1FNZA 1FT9A 3ZFEA 3NV3A 4A7ZA 3ZFGA 1V6IA 3FLRA 4G3YC 1ASJ1 2HEYF 1U12A 1FI2A 3DV8A 5J09A 5HI0A 4HKWA 2DV9A 4AW7A 2GH2A 4CDQA 1AYM1 1YFYA 2R32A 3WW4A 3USUA 3HMYA 1TNFA 1R092 2VU9A 1KS5A 4JGZB 1BEV2 1EV12 4LO5B 4WM8C 3D4KA 2C1FA 2CV6A 2VW1A 2I2SA 1GFF2 1C8M3 3WW1A 4HN1A 4HVRA 4LR4A 5K8SA 1SBEA 1MQTB 2D5HA 4Q0PA 3E6CC 1XNKA 3ZYIB 3AYAA 1COV2 4XJ9A 1NCRA 4HN0A 2DVDA 3E6DA 3CO2A 1O4ZA 1LKNA 1ZZ7A 4CP2A 2W39A 2PELA 5D8AC 4AK3A 4TSVA 4QPGC 2X29A 4IXLA 2B42B 3FFQA 1J3RA 3IDCB 4C1XA 1QU0A 1D4M1 3SNMA 2Y0IA 1R1ZA 1CPNA 4FBFA 1VBD3 5FFOC 4PLMA 1OA4A 3NL1A 4OI1A 1ZBA3 5T54A 3H0OA 1AL23 1W6MA 3ZMNA 2HWC2 4GH4B 5C33A 4M01A 2V09A 3SH5A 1RUG2 2HJIA 5T50A 5CBLA 1N1VA 3OGJA 4D94A 1OFNA 5KXBA 1G6NA 1W2UA 4CEWB 2WLQA 2H0BA 4XFFA 1Q5OA 5AVPA 4Y1VA 1DQ4A 2A5ZA 1VBA2 4JCKA 1RUI1 5IK8A 4PCRA 1RIRA 2ETEA 3PVNA 4S2GA 2YPJA 4XJAA 3TB0A 2QVSB 2ZTNA 1H9PA 4AFBA 2RJLA 3VBHA 1AR61 2DCYA 4YZ2A 2LUWA 3BALA 1CJPA 1NG0A 2P3IA 4JGZC 3S30A 1QQP2 1CAUB 4IERA 1ZNPA 2CGNA 2PHFA 2B7YA 1NY71 5DDJ2 1MS1A 1PO21 2UY8A 5I8SA 1QJX3 4B3NA 2QDRA 2NLRA 2P3JA 1MQTC 4XHBA 2XBO2 3H8UA 3TN91 2F6BA 2C5DA 4M00A 5FLIA 4IEYA 3I8TA 4OVEA 4XQWA 4ATEA 4SBVA 2Z69A 4RHV3 1AR83 1H2MA 3P3NA 4QU2A 2PYTA 4CEYA 3VKFC 4DMIA 4OZXA 1Q8PA 4WVZA 4AVAA 4D7TA 1OOPB 1HV0A 4P9JA 2MHFA 3I54A 4GH4C 3NW4A 2R6QA 4P9IA 1C57A 4CEWC 4Y4YA 4Z07A 4JDMA 1B35B 2O0OA 2XVLA 1VIWB 1DYPA 3WOGA 1RVF2 1X8EA 1F5JA 2HWE1 4HKLA 3AMQA 4AHZA 1QNWA 1VR3A 1EAH1 4N53B 2AR6A 1R093 2QUOA 1FPN2 1BEV3 1EV13 3S7EA 2RR13 2QNKA 2MNGA 1VBB1 3M70A 2FMYA 1AUYA 2R0FA 3VKNA 1MS4A 1O91A 2Q30A 1PM7A 4P9LA 1JW6A 4CDWA 3FX3A 2RMU3 2EXHA 1RUF2 1COV3 3FJSA 4L99A 4Q8LA 2EAKA 1RUJ1 4Z8BA 3K51A 2D3RA 3LOIA 4F7ZA 1VAMA 1KRIA 1GR3A 5E1RA 1GICA 4K1YA 5I93A 1J3QA 3AZYA 4P5HA 5ACA3 2ARXA 4RL7A 3WT3A 4Q27A 1VRH3 2VNGA 1ZRRA 1YXWA 2PAEA 2HEWF 2VECA 4FPLA 1QF3A 4INDA 4K9SA 1XYNA 4LLOA 5DG2A 5DUXA 3WDTA 1OOPC 2ZGLA 5L19A 4META 1CAXB 3LWCA 1WW4A 2HWC3 1QXRA 2RS51 4KG0A 4EJRA 5CG8A 4TWTA 2XHKA 1BVP1 1AYM3 3JD71 4IL7A 4AVBA 1KJRA 2YGMA 3JB8A 3KMHA 1DGWX 4Y5Z0 1FOD2 2BUKA 3UKTA 4Q4W1 5JAXA 4ZU7A 1B35C 1POV1 2GDFA 4YW4A 5C4WB 2VMGA 5FQ0A 1BVVA 3NAPB 3D82A 1U0AA 3BODA 1NA1A 4Q0UA 4N53C 5FPZA 3AM2A 3FLPA 2ZGTA 4CRQA 4KWLA 4N7IA 1CESA 2A75A 2EXIA 1TMF2 1BCXA 5DDJ3 2XJUA 4COYA 1H2LA 1N3QA 4IEXA 4RA0A 1HXS1 4IQPA 3JBG1 1YRZA 1O3SA 2Q5TA 4CTEA 3GZTB 1CGPA 2XBO3 4ZKTB 5J36A 2RM22 1S0FA 4KL1A 1QOSA 1DBNA 4YZ3A 1DQ6A 3J8F1 1PK6A 1GQHA 2IXKA 2XH6A 1GANA 4D3WA 4GQ7A 4QQ2A 1TME1 2I45A 1BBT1 1ULFA 2NZ9A 3OY8B 1WMEA 4L8QA 4OULA 1SDWA 1N1SA 1QJY1 3WW3A 4DXZA 3KD4A 1BXHA 4FPKA 4XJWA 2JG9B 4IEQA 3T1LA 5KHIA 2AGSA 4XMAA 4HVOA 4K21A 1LRHA 1R081 1AXZA 3PVEA 3ATGA 1RUI3 1RJ7A 4PIXA 4JRAA 1OPOA 5K0UB 1REEA 2AENA 4BCUA 2PAMA 3VKMA 4AQ6A 3R0RA 1AR63 3TRSB 2Q8OA 2B46X 3OPZA 1RL3A 4GH4A 2YUEA 1WBFA 4I01A 2FZ2A 1MS0A 5C4WC 3WG2A 1PO23 1RUH2 3THTA 1SFNA 5EYYA 3NAPC 2HWF2 2DVFA 4YW2A 4EROA 4LHNA 2ZKLA 2IXJA 2HKXA 5ABJB 5FOBB 2MEV1 2VUAA 1I5ZA 3AZXA 1LOCA 4GMP1 5LEJA 2BNMA 2CAVA 1FYUA 2WA3A 4QX5A 4YARA 2GMPA 1SLLA 2GC0A 2WL1A 3ZYPA 1RITA 1IZ3A 3MYXA 1BK1A 3WDUA 2X5IA 1LHUA 5J96B 2ZS6B 3AYCA 2ZGSA 1RUF3 2XB6C 5IK5A 2WC2A 1O3QA 4Q0VA 1HV1A 2A3YA 2E7AA 1JTZX 4NOTA 1UN1A 4KQ7A 5T55A 3H1WA 5FAXA 3ZYGA 1URXA 3AYEA 2ZGOA 3JCIA 1N1TA 2GC1A 2JJ6A 5LRSA 2VG9A 4AFAA 3RJ2X 4LHKA 4FSJA 1IPJA 2JG9C 2ZAAA 5BNQA 4P9XA 5CNAA 2VMIA 2R061 1UD1A 4K8FA 1VJ2A 4PF5A 1XU2A 3AP9A 1FAYA 5K0UC 3NWKA 2WS93 4XEZA 3RZZA 1E57A 1EPZA 1RB8G 1XE7A 5KHHA 2ERFA 2CAUA 3TWIA 4Z82A 3IBMA 1WD3A 1ZREA 4NHLA 1S0CA 2UYBA 2VNOA 3VZOA 5HCBA 1W6QB 3WDXA 1RC6A 1ZYBA 2H6CA 3NV4A 4HANA 4XF9A 1NCQB 1GZWB 3HWJA 5ABJC 1LB2A 1YLLA 5FRAA 1RUJ3 1X8MA 3MW2A 3VBOB 1S55A 2NYYA 2A71A 4XFBA 1PZ7A