2VTXJ

Activation of nucleoplasmin, an oligomeric histone chaperone, challenges its stability
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
102
structure length
93
Chain Sequence
LIWGCELNEQNKTFEFKHQLALRTVCLGDKAKDEFHIVEIVDQEEGAEKVVPIATLKPSILPMATMVGIELDPPVTFRLKAGSGPLYISGQHV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NPM-A PROTEIN
publication title Activation of Nucleoplasmin, an Oligomeric Histone Chaperone, Challenges its Stability.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Nuclear protein
total genus 14
structure length 93
sequence length 102
ec nomenclature
pdb deposition date 2008-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF03066 Nucleoplasmin Nucleoplasmin/nucleophosmin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.340 Mainly Beta Sandwich Jelly Rolls Nucleoplasmin core domain 2vtxJ00
2P1BA 2VTXA 1K5JA 4CA9A 3T30A 5EHDA 2VTXJ 4N8MA 1XB9A 1XE0A 1NLQA
chains in the Genus database with same CATH superfamily
3PURA 4FSJA 4YG0A 3AL5A 5J48A 4GH4C 4B1MA 1UOFA 2WA3A 4Z2WA 2Q1FA 1AF9A 3ZPOA 5A6ZA 4OI0A 2JIGA 4HG6B 4RA0A 1YQ8A 4X6QB 2E9QA 1BYHA 5HPOA 5JR2A 5LRSA 4NIDA 2ZAAA 2RM22 5FO7B 3QBQA 5ABJB 1HX6A 1VBB3 3T2QA 1RUD3 3V65A 2MEV3 2P6CA 2WLQA 1W8UA 2JG9C 4IEYA 4MG2A 5FZKA 1RUC3 2CV6A 4BE3A 2XDVA 2VBDA 2Y8KA 2HWC3 4GAZA 2FMYA 4I0BA 5A7QA 2FZ1A 4CCLA 1YIFA 1JHJA 5KHJA 2D3PA 4CEYB 1IHMA 3LA7A 4ISQA 4CDQB 4BMBA 3KGLA 3CDZB 1R64A 1PX3A 3N7LA 2GNMA 4XQDA 2H6CA 3I3EA 3ETPA 3T1LA 1TNFA 2ZMKA 4WBBA 3U75A 1ND2B 3P3PA 3VLBB 4KBBA 1I3HA 5EWSA 1Y9MA 1SFYA 1W9SA 2DCYA 3K51A 4M0NA 5BNQA 5JXGA 1VMHA 5HCFA 1D4M2 4GIQA 3C3VA 1HJFA 3R4SA 4LBQA 4LTAA 3RZGA 1AYM3 3BIEA 1PO23 1W9YA 2WA4A 1UIJA 4QB1A 2JDHA 2A6XA 3IN9A 4C1WA 1LJ7A 1CAXA 1O5UA 1JU4A 3ALQA 2G4IA 4YARA 1W6QB 5FYHA 1EAH1 3S5AA 1Y43B 3IPVA 5FQ0B 1RC6A 1F4HA 4FQZA 1OXCA 4COYA 3UGFA 1GICA 5L7OB 1ENSA 2RM23 3J4UH 4QQPA 4P5HA 5IJRA 3B69A 1XC6A 2A73B 4Q4W2 4QT6A 4HONA 2ZX2A 1TG7A 3OUIA 4LKFA 4X8PA 2P3IA 4AHYA 4LKDA 2VMDA 1W39A 4WZCA 4CXXA 5IATA 2X10A 2NQYA 1UOJA 3B3QE 4IV3C 2FCTA 4JQRA 1K42A 2AREA 3GZTB 3POEA 4V2WA 4UFMA 3SLIA 4J25A 3ROUA 4HETA 3VBUB 2HH9A 2ZKNA 5C6CA 1UZWA 3JZVA 1B35C 1V6LA 2L9LA 5IUQA 4BQ1A 1VRH2 2EXJA 3DXUA 3OBZA 5H9PA 1TME2 2VVEA 1WMXA 3A0NA 3I2GA 3ILRA 5FZHA 1FMD2 1QIQA 2R16A 1JYCA 5FLJA 1NLRA 2B8MA 2ZHNA 1COV3 2Q4SA 1ONAA 3AMNA 1KD7A 5JPNB 1NCQA 5FZ1A 5F3CA 2OQ7A 1F15A 3B01A 1D4M3 1K5JA 2UYAA 4LKEA 4O61A 1YQ2A 2WQ8A 1ASJ2 1H2LA 2Y6HA 1XYPA 4JHTA 1HRI2 4W50A 3K75B 5GJ6A 4CCKA 1V6IA 2ET7A 1S0BA 2GP3A 3CMGA 3GF6A 5FZ0A 4Y4RA 3BU7A 2DBNA 4HMZA 2ZX1A 2JD9A 1O8PA 3SHRA 3TYJA 1WBFA 5J37A 4JX0A 2VZ1A 2JDYA 4Y20A 5A7SA 3WG3A 3V0BB 3LAGA 2XPJA 4IEQA 2P37A 3AP7A 3KM5A 2W1UA 4KL1A 4LHKA 4P14A 1UL9A 3EQEA 1C5IA 1DYOA 3AM2A 4H14A 3ZKUA 1OA3A 3AVSA 4Q4W3 1YFUA 2RS11 2AR6A 4GWIA 3OGVA 2JDNA 1QJU1 3B9IA 1WGPA 2ZZJA 1LU1A 2BBAA 3D0SA 3GHMA 5JXIA 3K3NA 4WM7C 3N7KA 4M3CA 1WCSA 1CQ9A 3DPRB 2WNUC 3NNMA 4EV0A 1QOOA 2X53S 1WCDJ 5CAZA 2JWPA 1MVQA 1UYZA 5FPUA 1UNBA 1VRH3 1G9FA 2WZR2 2GALA 1TME3 3GCXA 3NAPA 4QPIB 4AQSA 4URAA 5BY5A 4K20A 5FPAA 2VQUA 4FPJA 4NIIA 4NRMA 3RYRA 3ZDVA 4ES8A 4JZRA 2CGNA 3THPA 4B4RA 3FJSA 5I0TA 5FKCA 2AEZA 1QEXA 2DUPA 1DQ2A 3UT0A 5F5IA 5I8TA 1CX4A 3B00A 1ASJ3 2ATFA 1YUDA 3MPBA 1HRI3 2WO3A 2XJVA 3ENRA 1R092 4LKSA 3PUIA 3VBSC 4Z92B 4I30A 3KV9A 2PAKA 4RR3B 2ZGOA 3LA2A 2VUAA 2X5IC 1YO8A 4PF1A 4XTPA 1LOGA 1H4HA 3HJRA 4JDOA 3WQ0A 1NZCA 4LIUA 3WHTA 4KMQA 4QX7A 4XCBA 1NCRA 1EY2A 1QNWA 2ZHMA 2RDNA 1HLCA 1VP6A 3J26N 5T5LA 3RI8A 4A7ZA 5EZWA 1AR92 2EXIA 4XOGA 1MS5A 1WZXA 3AP5A 2HWB2 2X05A 2OUHA 3FHQA 2B9UA 3VZJA 3MLJA 4JRAA 1W6PB 4P9JA 5FYZA 5F6LB 2WZR3 4MOAA 3O1UA 2ORXA 4D7SA 2FDGA 4ZS3A 4BU2A 1O6UA 1ZBA1 2B5HA 3TEWA 4XUNA 2W08A 4N43B 4DS0A 4XJWA 5ISLA 4PI0A 2YY1A 4KGQA 4COVA 2AENA 4M00A 3WP6A 4W6XA 4BQ2A 4PBOA 1XBFA 1NQJA 4E4SA 3EB7A 4K7JA 4XF0A 4EN6B 1O8SA 2E7TA 2K46A 1R093 4Q0SA 3FUOA 4Y24A 2WNVC 1LTEA 2BFUL 1PIV3 2QBXA 3KMHA 4JC1A 1VPHA 5GZFA 1BJQA 3AKQA 3L2HA 2E7AA 3WNNA 5DAQA 1FPN3 4I0WB 5IYYA 1AXYA 4IERA 5HCHA 3LA3A 1IQAA 1N47A 5DAPA 4GWNA 2BERA 1L7QA 2YXSA 1XU1A 1CAVA 1VBE3 3NAPC 3H8RA 3R6SA 1CESA 1X33A 1FOD3 2IXCA 2PHDA 1RUF3 3O0VA 4TYSA 3ZIWA 2FDKA 4QPWA 4MX3A 2XVLA 4OZOA 1V6NA 4PIZA 1AR93 3NL1A 2WNEA 4GA9A 3VN4A 3J9SA 3RYPA 1TZOA 2A3YA 4DXTA 2HWB3 5LASA 3W9AA 4NRQA 3FLPA 1SCRA 1SQ4A 4NHXA 1YFWA 4UW3A 1RUH1 3DYPA 2GN3A 4B1LA 4NAOA 1CAUB 4YVSA 5A80A 4RHV2 4UFIA 4AI1A 1HXS3 4AEDB 3AZVA 1UW8A 5AFBA 1N1VA 3OUJA 4E8DA 4MO3M 4FFHA 4F83A 3M3IA 1VBD1 3WG1A 3U37A 4RD7A 3KVAA 3ACLA 3PL0A 4XYXA 4CU6A 1AJOA 5A7WA 1ULPA 2A70A 2WWSA 4XUQA 4D3WA 2FCVA 3MPPG 2I45A 3QACA 3W21A 2CWSA 4YLZA 4A41A 5BYNA 1HB4A 3HNMA 4QKDA 3ZFGC 5ABJA 2CAUA 2QE3A 2OUJA 5F3IA 2HWD3 2B45X 4MGSA 4KWUA 2WS93 3DECA 3JD73 3KHBA 1AR73 4LBMA 4CXYA 3KD4A 3M8LA 4LO8A 2XQRA 4ATEA 4XAAA 1POV0 1OD3A 3AL6A 3MYXA 1DQ6A 2O14A 3AKTA 3POYA 3ZOIA 1ULEA 1X9TA 4CP1A 4FPOB 4CEYA 2C24A 2PHXA 5DABA 4JTOA 4E2GA 1BVP1 4CDQA 4XEZA 2ZKLA 3WHUA 1GP6A 4AEJA 3N9PA 1VBA1 5GLTA 3OGSA 1GZ9A 4E9KA 1JOPA 4LEJA 3NSTA 4LLOA 4TXWA 1VB4A 1DHKB 5AVPA 1LHUA 4DRRA 3ZXLA 4LOTA 2H0BA 1X7NA 3RSJA 1Z7S2 4CCMA 3HBKA 1RJ7A 2A6WA 2RMU1 3PUQA 2FDFA 2D3SA 3DGTA 4JGYC 4PI2A 5T50A 4QDSA 1IKQA 1W99A 4PLOA 1NLSA 4GXLA 3WDYA 4AHWA 1ENRA 5CG8A 1W8HA 2VECA 1W6QA 4XF4A 3J7MA 3VBHC 3INAA 5A1FA 5FQ0A 2EAAA 4H3WA 1DZQA 5L7OA 2P17A 1Y9GA 3VHNA 3PLQA 1DQ5A 1XE0A 2Z5WA 4XBNA 4GB32 1SPPB 1NZIA 5GM0A 1YI9A 1PMJX 2VG9A 4LBQD 4FOVA 4NOTA 3H50A 3PNAA 1GZTA 1AX0A 1RUI1 2OVUA 3RWKX 3UKTA 4YPJA 1AHSA 3WCSA 3AP9A 4A44A 1W0PA 2GMEA 3N35A 3VBUA 1KS4A 3I3QA 5GKAC 1W04A 2XL9A 4FBFA 1NXMA 2A3XA 5FZMA 5FPXA 2W87A 4YW7A 1BCXA 2J1VA 5J36A 1VAVA 3I2DA 2JB8A 4YM2A 1XYOA 4XBQA 5GLUA 1IZ3A 2FBEA 1W9TA 1ZNPA 5FXWA 4OHVA 4ZY9A 3ES1A 1O3TA 1UXXX 3LDKA 3MGUA 5T5PA 3N7MA 2BWCA 3NJYA 4FPFA 5FZ3A 5HV4A 3HBZA 5IVJA 3E5QA 5F7UA 3VBRC 5DUWA 2Z2SB 1NA1B 3I59B 3PU8A 3CHXA 3VDDB 5LA1A 5LY1A 5C70A 4Z8BA 1R082 4N8MA 4QHBA 3KSCA 1GLHA 4HZFA 4Q0VA 2Q0AA 1AR81 4I02A 1AL21 4R9AA 5L9RA 4DUXA 5JAXA 1G9AA 3V0BA 1RUG1 2WFF2 4XABA 3MIFA 2C5DA 1NG0A 2W95A 4CXWA 2F4PA 3LEMA 2ZHKA 1S0IA 3GCWA 3AFGA 4JKKA 4DZGA 1OLRA 3NV4A 1BXHA 2UWCA 3NNJA 3NNLA 3I7DA 4LQRA 1AR61 1HQWA 2W52A 5IAXA 3AZYA 4UW6A 5BNPC 1K45A 2A75A 1FI2A 1LHVA 1NUKA 1HIXA 2VZOA 2ADDA 4MZUA 4Q4Y2 4DRVA 4KWKA 2PA7A 5DUXA 3DPRA 4RFT0 1NAEA 3NKTA 1H30A 2PAMA 3UKVA 3P5BA 3K4DA 5EHDA 2W1QA 1P8JA 1AZDA 4FPEA 5FYCA 5JCTA 3NQHA 4YVWB 2DBIA 5I0DA 2QQWA 3CIHA 2PELA 3LDBA 1HN1A 4YGBA 1KFUL 4QD2A 3E5XA 3T08A 1POV1 1SHWB 4CEWC 2V72A 2ZGPA 3AXEA 3S7IA 3WDWA 1OOPB 5C3PA 3RZMA 1CGPA 3WP3A 4R9DA 1JW6A 4FCAA 1US3A 4LO7A 1R083 1UOGA 4RSUA 3KWVA 5D21A 1PNFA 3JUUA 4RR3A 4E27A 2TNFA 2PQSA 1LODA 1VR3A 5FMDA 3HQRA 2VZSA 2C1FA 2WR9A 2WFF3 4Q26A 5LA2A 1XE7A 5JI9A 2XH6A 3RZHA 4AVCA 1R1A1 4A7YA 4MGIE 3O0WA 4BXSV 3GYDA 5HXVA 1UMHA 4ISRA 1IPKA 2NLRA 3AKPA 1QJEA 2VVDA 2EF6A 1LOBA 5LRRA 3AJZA 3TEXA 2IWGB 3H8OA 3AZXA 3THDA 5C9AC 2AZ5A 1LECA 5JZGB 5JIUA 2ORZA 3I97A 3OBRA 2XR4A 2VZVA 5K0UC 5B4NA 2BTVC 4DUWA 4CRQA 5F37A 1EP0A 4GULA 4BQYA 3O1OA 1LEMA 3ZMNA 2JDKA 1UY2A 2ZMNA 4N43A 5FMOL 3LB9A 2WUHA 4WVMB 3VBOB 4K9SA 2VW0A 3CZJA 1IS4A 1SLLA 1CR7A 2R062 2JDUA 3UKNA 4B4PA 5DMYA 1SLIA 2AC1A 4CDWC 2XLAA 1CIYA 4FOWA 5BNNB 2XJUA 4COZA 2YGMA 3KQ4B 3ITQA 1PX4A 1H2MA 2QQUA 3VZMA 5HBAA 3WNOA 5T54A 2ZABA 5LWBA 5LZ6A 3E6CC 3HNYM 3ZM8A 1UMZA 3S0MA 3PJQA 3MIHA 1AXZA 4QDQA 2X5IB 3IAQA 3KZ4C 1CPMA 4XFIA 5EXOA 2V5YA 2UURA 3LEIA 4NMIA 2TUNA 5IHRA 4BOWA 5JOWA 1GOFA 5A7OA 2VMIA 3NMBA 2J1EA 1BMV1 3NVCA 5F32A 2HWE2 5HI0A 4WZFA 4BQWA 3ZSEA 5C8WA 1GYKA 4HANA 5DAWA 1QQP1 1PHMA 1W0NA 2IXJA 2IZWA 2ZXQA 1S2EA 3ST7A 2C26A 1QJY1 3UV9A 1CAUA 3WEZA 2ZX3A 4LBNA 2RE9A 4KG0A 5IWFA 1CD3G 3DYMA 1Q8QA 1RUJ2 3A21A 3IDBB 3I3BA 4IEZA 1JMUB 5IAVA 1W90A 4N9IA 1GZCA 4OQ9A 4FPKA 3RNSA 1SMVA 4DIQA 5CFDC 2B42B 3VZOA 1V9U2 1AYN1 5IVFA 5FY7A 3VL8A 3UJQA 1DGLA 2BGPA 2HEWF 4KWLA 4EROA 3AMHA 3NV2A 1PVC1 4IUGA 4BK5A 4XCAA 1C3HA 4XDOA 2R063 5ACA3 3NNFA 5FMBA 1GQGA 3FL7A 4PDWB 2Q30A 1YJLA 1JZ2A 4XZPA 4CP0A 3I2KA 3LCPA 2WABA 1LEDA 2YBPA 5A3PA 4CU9A 2RS32 2QDNA 2C0ZA 3AMQA 1JXNA 2HBTA 4O65A 5FZAA 3ZXKA 4AEKA 3K2OA 5J1XA 4OMDA 1MQTC 1CAWB 1J1TA 1JBCA 4JKMA 1HRV1 1BEV2 1C8M1 3ACFA 2P34A 3MW2A 1EYBA 2A7AA 2QJVA 2XBO3 4GALA 4C0HA 2PAEA 5BPXA 2BOIA 4CYDA 2HEVF 2Y26A 4YGDA 3I3DA 3OF1A 4K6BA 2E63A 4P9GA 1F5FA 3WF2A 2VR4A 4NWVA 2VQAA 4V2VA 4FQ4A 5JIAA 2ZACA 4A2UA 3PVBB 3PU3A 3AJYA 1PZ7A 2ARBA 4Q27A 4QPYA 2JE9A 3O1MA 3HEIA 1MVEA 3MICA 2PYTA 4QU2A 1RUJ3 1RHI2 4XC9A 3WDVA 1FV2A 3RJ2X 4JGZB 1U5ZA 1ODNA 2IFRA 3JBG1 4L9BA 3BTZA 3PUHA 2JICA 1V9U3 3WF0A 4MGZE 4KQ7A 2R071 4IE4A 2GC2A 2DYCA 3RWNA 3KCYA 4NR1A 1C1FA 1PMIA 3FUQA 2RR12 4Y1UA 3M3EA 3WG4A 4ONUA 5FYYA 2ZEXA 4OI2A 3QH7A 5ANQA 1IOAA 3VKMA 1Q8PA 1RIRA 2QUOA 4AVAA 1YWKA 1GQHA 3E6DA 3P6BA 2R1DA 1WWYA 1K5MB 3LSDA 1SPPA 4XTMA 5ERLA 3LSEA 2RS33 3KV5A 4BDVB 3H3LA 2Z69A 1UF2C 4QX8A 3ABZA 2VBBA 1QH6A 3WX5A 4UW4A 1PO12 1H6XA 1Z78A 3M4FA 5D1IA 1VMJA 4A45A 5CIRA 3MFCA 5KHHA 1RUD1 2UY9A 1OKQA 2MEV1 1SEFA 3AC0A 4M0HA 5FRAA 5JSOA 3HN1A 1CPNA 2ARAA 3O1SA 2BP6A 1RUC1 2LTNA 1I5PA 4DQAA 1Y7BA 3M7AA 4XETA 2HWC1 4ZONA 4J1WA 1L7RA 2GZWA 1WCQA 3B5LB 5FZOB 3U1XA 1DDLA 3BVCA 3WNLA 5KHGA 1MEC2 1MS8A 2D6PA 2DTWA 3MF6A 3MLKA 3IDCB 4P5YA 2V73A 2VNGA 3LD8A 5FO8B 5F5AA 2W68A 3M1HA 2HEYF 5A3OA 1LHWA 3ZYHA 1RHI3 4XBLA 1E5RA 4QWNA 5FZEA 4BK4A 1NA1A 3I59A 4B29A 5KBFA 3RI9A 3VDDA 3NJVA 5JOXA 2XG3A 1W3VA 3SQOA 4CDXB 2UY8A 4LNVA 5LW9A 3K48A 5FDBA 4XJ9A 3HT2A 4KG8A 1LESA 1AYM1 1PO21 4LPLA 5FZ8A 1C5HA 5FY1A 2BPA2 3FX3A 5BUVA 1ND3B 1KDMA 2ZGMA 1W9FA 1WW7A 3HQUA 4DO0A 2VD7A 4Y5Z0 4KBZA 1ACCA 4FTBA 4AI3A 3D6EA 1RITA 4OUEA 4BYYA 4AEMA 5JOZA 1PO13 4UBGA 4QB6A 3H9AA 3BYWA 2LS6A 1AUYA 1WD3A 4I0AA 4OQ8A 1V00A 1ULDA 5A32A 4OUSA 2BVVA 3EHKA 3OB8A 4MVTA 1VJ2A 1XYNA 1V6MA 2LUWA 2TEPA 1VBC3 1LOFC 1JTZX 3BI3A 5B4XA 3L2YA 2R6QA 4OCTA 4YVWA 4HBNA 5L73A 3I3MA 5IK8A 5CG9A 1XSQA 3ACGA 3WSOA 1DGWX 3ZVXA 2OPKA 1Q43A 2OQ6A 4AFAA 1OOPA 3OEAA 1OLME 3ZR6A 2GMPA 5AVAA 2UWAA 4BMEA 2CGOA 1Q5OA 3BGAA 1H8TA 1J84A 1UY1A 1COV1 3K4ZA 1W6OB 4TWTA 1H9PA 4UT5A 5FUPA 1WLCA 5DAVA 4AHXA 4Q0QA 2ZJCA 3C7FA 1D4M1 4K40A 4DNYA 1Z0HA 2BZDA 2GNBA 3ZFEC 5I93A 4DINB 2OA2A 1FXZA 4YWAA 4BA6A 3WT3A 2O0OA 2WT1A 5J3UA 1FV3A 3LKJA 4BPZA 2VQ0A 4EZ4A 5A3TA 3WNPA 3O7OA 2V4VA 2ZX4A 5F9TA 2VMFA 4P9XA 2VNRA 1TMF2 5FBJA 1W8NA 4Z82A 3EO6A 5C33A 4JTNA 4Q5OA 4IV1B 3QD6A 3KV4A 5CFCB 3AMMA 5KXCA 1UX6A 4Q4W1 4QPGC 5JZGA 5BNOC 3ES4A 4CUBA 3V0AA 4LA2A 2WJSA 5JR7B 5KXEA 5FWJA 4IDZA 2JD4A 4CDUB 1O4YA 1ZBE2 3PVNA 1RUE1 4QM8A 2ES3A 2E33A 2BOJA 3HR9A 3DL3A 1KITA 4WVMA 1OMIA 1QH7A 3VBOA 1VRH1 4XF3A 1OKOA 2GH2A 2Q8EA 1F5JA 1TME1 1UY0A 1OFSA 4WVVA 5JPMB 4NIHA 4Y5TA 2CTVA 2WWJA 1EAH2 5CKMA 2VOVA 3HMYA 2AH2A 1JHNA 1UZZA 1W8TA 2DWRA 2P1BA 3SCFA 4Q8KA 2XWBB 5C3SA 2JJ6A 2KA3A 5H9QA 1O3QA 2WBKA 3FMGA 1Q8SA 2Y6GA 3J8F2 1E57A 4SBVA 1ASJ1 1S0EA 1UU5A 3LPFA 1HRI1 2DU0A 4YZ3A 5FK7A 5KHIA 5FYIA 1C4RA 5H9RA 5JOYA 2WZ8A 4UW5A 2VCCA 2PLV2 3JCIA 4MSVA 4Y1VA 4ZKTB 3POWA 3NNGA 3ACIA 1UU6A 4XMAA 4MH0E 3BKZA 3H7JA 4XJ8A 1VE0A 1OI6A 4QDRA 2YBSA 1TMF3 2VUCA 3ZYPA 4AW7A 1WA4A 3S30A 5C71A 2ZEZA 4XILA 3OGGA 3Q8FA 1OQ1A 5AC92 2WC2A 2XONA 3VDCA 5C8CB 4ET7A 5FY8A 1DQ4A 1RGSA 3KVBA 3RQ0A 1JOBA 2ADEA 1H8TC 3GDBA 4CUCA 1DGRN 4PIYA 1ZBE3 5I0SA 2YROA 3BTAA 3ZFFB 5C4WB 3K3OA 3TEYA 1BLZA 1YQ5A 1JYTA 1W9WA 2JG8B 3WF4A 5L9BA 2WZR1 1ZRDA 2XJRA 4HN0A 1D2SA 1TEIA 2VW2A 5FUIA 1EAH3 3VL9A 4F7ZA 4BQ5A 1WD4A 3BPSA 4FT8A 4NWWA 4WM8A 1FMD3 2C9KA 3GZAA 3K46A 3MO4A 3QH6A 4MUVA 3ZSMA 3S57A 3ZYFA 4OFGA 3DEMA 2RG4A 3ON7A 3ZX7A 3J8F3 1SLTA 1E5HA 1D0GA 3C7EA 2GU9A 5FAXA 1GOGA 1UYXA 1R091 4RQPA 2QZ2A 5T52A 1PIV1 2D40A 2PLV3 1CAWA 4HVOA 4ZPIA 1BKZA 2WZPP 4CP9B 3J7LA 1J58A 3EJKA 3TWIA 1LKNA 1W06A 1FPN1 2VL4A 2OX0A 3O1PA 1H1IA 5FWEA 3FC0A 3WW1A 1UPSA 2R30A 5FBZA 5FOJB 1RINA 2G9ZA 1PK6B 1JUHA 2ZHLA 3EBRA 4P00B 1ZA7A 5AC93 3NWKA 1VBE1 4XURA 5FZLA 3GXUA 3HVDA 5EPAA 4UF0B 5FYUA 5LA9A 1NX9A 1DFQA 1FOD1 1W8OA 1WLDA 1RUF1 4O9GA 4RS5B 5K7PA 1KS5A 3C7OA 3USUB 1AR91 5CADA 1BHGA 3POFA 2VUJA 3JQWA 2EAKA 2C4XA 2HWB1 4DB5A 1RMU1 4QXBA 5FMOS 4EYUA 3SH3A 3G7DA 1NCQC 2YPJA 5CFDB 3AMPA 5E88A 4CTEA 3DV8A 4QKFA 4QGMA 4Y3OA 1PGW2 1HXS1 3T1MA 1DP0A 4KI5M 5IVYA 2BGOA 4LOSA 4NRPA 4Q29A 4DXRA 1GZWB 1XPWA 3VDBA 3ZSJA 2WDBA 2VTXA 5JXHA 1LOAA 4QXKA 2RJKA 4W65A 5FZ7A 1RJ8A 4QX0A 2CHHA 1LHOA 4LHSA 4D0QA 3TEZA 5FPBA 4LO6B 5FP3A 1K5MA 3VKLA 4FP2A 2P3YA 1WKYA 2NN8A 4COUA 4JQTA 2WT2A 4BLIA 5JDBA 1JZ8A 3MDPA 1KJRA 2ZX0A 1JYWA 1RTVA 4YW2A 5IVVA 2VO5A 3JQXA 4F8AA 3DF0A 2ZGUA 2HWD1 2B46X 1CX1A 1UPIA 2WS91 3JD71 2YC2A 1ZZ7A 4OYUA 1AR71 2JDMA 1EV12 5FLIA 4Q0UA 3ZSKA 4ASKA 5D8AB 2YPDA 4YM3A 4KH9A 2DCJA 3ZMOA 4O9EA 3CL1A 3ILNA 3T2PA 1ZBA2 2WSUA 2Y6JA 3S7EA 4WVZA 2DVGA 2KD7A 3H3ZA 4UFLA 4B8EA 3Q9OA 2J22A 4WM8C 3MV01 3T2OA 5A70A 2A6ZA 4EN9B 4XFBA 3H42B 1DU3D 4N53B 2P6HA 1IQDC 2R042 2G9GA 3E5UA 1W2TA 5FYVA 2F6BA 2RDQA 4LBOA 4F3JA 4EN0A 4UI9L 4C1XA 3POBA 4NO4A 3HN3A 4JAAA 4JVAA 1RL3A 1GV9A 1CJDA 4R52A 1PGL1 1YCIA 3U07A 4RQPC 5A6YA 3OYWA 1REDA 1YFXA 4FI9A 4Y1YA 3D3AA 3L9JT 4P9WA 4YSFA 5JMOA 3RZJA 4OMCA 4BIOA 3FZ3A 4Y22B 1ND3A 1S2KA 1HB1A 3DKWA 2D93A 3MIGA 5LK7B 2XHNA 4FTSA 1UOBA 4H2AA 4QHOA 5FTTC 1G7YA 2AUYA 4MHRA 2ZZQA 5EYXA 2LM3A 4M01A 4Q4X2 5DZFA 1JODA 2HLEA 3EMRA 2EVXA 1NCRC 4MHUA 2QFEA 1XNTA 4CE8A 3MLLA 2HWF1 5I0RA 2E51A 1ZA4A 1US2A 2YHJA 4CUGA 3THCA 1HB3A 1XNCA 2W46A 1RUH2 2A6YA 2XGXA 1EV13 1J83A 4R8HA 3CLPA 4W4ZA 4R4XA 4E2QA 4FPCA 3TAYA 1DZRA 3VBFB 4TZDA 2ID4A 5JXJA 4INDA 1YXWA 2VTXJ 3ELNA 2YB7A 3M70A 2DVBA 1WUVA 1SBEA 4BZ4A 2R043 3WVJA 4JV4A 1H8VA 1L3JA 2IVJA 4OLLA 4GJYA 1QY4A 3ZR5A 4CCDA 4DUVA 2DVAA 4L97A 1W6OA 1ND2A 2V09A 5LBCA 3WCRA 3VD7A 2WQZC 3CF6E 4XPVA 5J96B 3EXUA 4H7LA 1A6CA 4RHV3 4FXKB 1XQNA 4OHYA 4EWAA 3CJIB 1MACA 3SCGA 4MGQA 1KGYA 1DGWA 1UIKA 2BNOA 4IXLA 4NHKA 4PLMA 5DPNA 1I1EA 1QXPA 3KS7A 2BJSA 1V6JA 1PZ8A 1DLCA 3SXWA 3GALA 3C8XA 3KLSA 2D97A 4ZU4A 2Y6FA 4GH4B 4K21A 1T6BX 1J3RA 2GN7A 4QHZA 4Q4X3 2Z42A 1LGBA 5DUVA 2D6NA 3KF5A 5FYBA 4IV1A 1VBA2 3W58A 4AK3A 3OPZA 2BQPA 4AL9A 3BTXA 3LOBA 2ZTNA 1ZM1A 4ZU7A 5FR3A 2OPWA 4CDUA 4YW6A 1F31A 2JG9B 4EJRA 1NT0A 4YVSC 3I54A 5EJ1B 3ZDSA 1XNAA 2GH8A 3V64A 2ZBJA 5ANNA 5LK5A 3FHAA 1Q8OA 4XDPA 4XZUG 3MBWA 2BNNA 2VU9A 1GMMA 3U78A 3M3QA 4KWJA 5CKNA 3SC7X 1ZZ9A 1S0DA 3WUCA 3WNKA 3RG0A 1OH4A 4NUBA 2OW4A 3MFAA 1TQ5A 4MXWB 1YJKA 1Z7S3 3KHCA 2WNOA 1L7LA 1NY71 3A4UA 3KQRA 3I2JA 2PXJA 3DXTA 5JI7A 4DXSA 3VD4A 2BWAA 5GLZA 1R081 5HCAA 4EWDA 3ZXJA 5ABJC 5CYYA 3O1RA 1RUI2 2BRTA 1WW5A 4HK8A 4Y4YA 2QVSB 1OURA 1QHDA 3SITA 3WOGA 4A42A 1G86A 4COWA 3I8TA 2EIEA 3OTFA 4CEYC 4I2OA 1SDWA 2XL7A 1GNYA 3HD8B 4CDQC 1WMDA 4MADA 2VQTA 2ENRA 3MI8A 5DDJ2 5FCCA 5C8CA 1C1LA 1QJX2 1YI7A 2JDAA 2CYFA 5FPLA 2JDZA 4GB33 5FZBA 2VCMA 3A0KA 4K8RB 5DAXA 2VZUA 2XB6C 1DYPA 3KF3A 1ND2C 5J98B 5F5QA 1LGCA 2D6OX 3C7GA 3WF1A 5C4WA 4Y1ZA 4JDMA 5CEHA 4IV3B 2BVBA 4I3GA 2Z79A 3AB0A 2JG8A 2VJXA 2WWUA 4AOCA 4HVQA 1V70A 3BODA 3O5SA 1STMA 4KNCA 1N3OA 5FYMA 1AR82 1B35B 1AL22 1JZ4A 4QPIA 1WMFA 1RUG2 3AYCA 3N9NA 5J7MA 1HQNA 1NOVA 3VKNA 4V1PA 5EJ3A 4QQLA 2H6BA 4J1XA 5FY5A 1GWKA 4WVWA 2P2KA 2AGSA 4XIKA 4Z07A 1MS0A 1XNDA 4XUTA 5L7OC 3CU7A 1W8WA 3WV6A 1LNSA 1AR62 4YW1A 3PIGA 2OS2A 5I0UA 1RUI3 4CP9A 4AVSA 4CU7A 5FYTA 5GZDA 3B93A 3PHMA 3H8XA 5DZEA 1C28A 1CVNA 1LENA 4W6YA 1O5LA 2GC3A 4OHXA 2EIDA 1PK6A 4GJZA 3VBUC 4XAEA 1PGSA 4PT6A 2D98A 4FPHA 2WO2A 1J3PA 4YM0A 5DDJ3 5LBEA 1UY4A 1QJX3 4LUMA 4UF0A 4IEVA 4RS5A 4ZXEA 2R32A 4NPLA 5BV6A 4A4AA 2WKKA 1F2NA 4XJZA 1VRBA 2XQXA 5SV8A 4M4RA 3VZNA 4D6SA 2VZTA 3OBTA 2FD8A 4YGCA 2XJPA 4EE2A 5DG2A 4Q4Y3 1REEA 4WM7B 1S4CA 4AQTA 4OZXA 4D6RA 1W6PA 2CL2A 4LLFA 1GZWA 2BV4A 2EXKA 1LR5A 3ZPYA 1XB9A 4LBQB 5FV3A 2WNUB 1AL23 1S2BA 3U10A 5K9YA 1CWPA 1O7FA 1YQCA 5CNAA 5L9VA 3OGRA 4XUOA 3T3YA 4QGLA 4P9IA 2WAAA 1CN1A 3IIAA 1OA2A 3O0XA 4JHZA 5F5CA 2O1QA 2R061 5ACA1 4AI8A 1JZ5A 1SZBA 2PTMA 2Y34A 5G04L 1AR63 2WYSA 4HKOA 4IESA 2Y60A 2Q8OA 2YUEA 4IE7A 3APBA 2A5ZA 3VUOA 3AXDA 3GBFA 4HOOA 3JXSA 3ETQA 4LIVA 3SMHA 5LCWL 3W20A 4OUMA 1PNGA 2VTFA 3VBSB 2W39A 4ITCA 3LIGA 5JUVA 1YYNA 2PMWB 2YC0A 1W0OA 5D8AA 5DN2A 5IW0A 3RZZA 5C3OA 1W05A 5HV0A 2ZGKA 2DFCA 3WP4A 3A23A 4RL7A 1TE1B 3DPRC 2XBO1 2ZOEB 4RGKA 4A6OA 3WD5A 4CP2A 4MV2A 3IMNA 3B9CA 4AXOA 3LDRA 4GMP3 3H0OA 1POV3 4QPIC 3WQBA 2Z4FA 1KFXL 3IWZA 3SH5A 4CU8A 4N53A 1S0FA 1S0JA 1ZZBA 4BISA 5CKQA 1OPMA 5B2GB 2ARXA 1SFNA 1UXZA 1YNAA 1H2KA 5FY9A 2BYVE 4KU8A 5FZCA 4TTGA 1O3SA 1C8NA 1O59A 2TBVA 2VMGA 1A8DA 1NYWA 4CCJA 4Q0PA 4CCEA 5G05L 2J1RA 3OJBA 1J59A 3IB3A 3E97A 5A3WA 3I49A 4RR3C 3PMSA 1V9U1 4Y22A 1OVPA 3KT1A 1JU3A 2H0VA 4LUKA 1W8ZA 4XW3A 2NMNA 2FCUA 1O91A 4YYOA 4YZ1A 4FTEA 2UU8A 1RVF1 1BMV2 2PHFA 3M2MA 5FYSA 5GZCA 2VUDA 2NYYA 2Q1ZB 4N90A 4A7KA 3QOPA 4QXHA 1QQP2 2GC0A 2R7EB 4ZS2A 2WNVB 1OLMA 4RGGA 2EALA 2W47A 3WW4A 4B7KA 1QJY2 5D2AA 1JN2P 3EYPA 2AACA 2G1MA 5L36A 3ZYIB 4AAXA 3BU0A 1H6YA 2O8QA 1F4AA 2WSVA 5FY4A 1GBGA 3R05A 5DZGA 5FPZA 3T0AA 2W91A 4BQXA 4TSVA 3NAPB 2QKDA 1WA6X 3DN7A 2D5FA 2R49A 4Q4V1 1JYIA 4ASMB 4N43C 2HWE3 3FLTA 2ARCA 3W59A 1N3PA 2OT7A 2FQPA 1H4GA 2PHLA 4ARXA 4D94A 2P5BA 4EN7B 4YW3A 5FP4A 1OSGA 4G9SB 4AR2A 1IS6A 1RHI1 2QQIA 1OFNA 2XUEA 1KQRA 1BBT2 4MXVA 2W2IA 4AI9A 5A33B 1ZVFA 3CJIA 1LOEA 4LE4A 4YFZA 2JIJA 2QTWB 2ZGTA 1GP5A 4FVVA 3RGBA 5FMCA 4JDNA 1GFF2 5F39A 2YC4A 1IS5A 3VV1A 3LGRA 4XFAA 2VGDA 1YLLA 4GH4A 4TN7A 3RPQA 4AYUA 4FPGA 3ZXDA 2RS52 3URFA 4FO9A 5FXVA 2YFUA 4EWEA 1W2UA 4XHXA 2AEYA 5T5JA 5T3NA 3TN92 2EA7A 3PVEA 1ALYA 3D0JA 1RYYA 2K9ZA 2R1BA 5EP9A 4XFFA 2B39A 3T4HB 3WW3A 1WBLA 1AJKA 1YHFA 5FXZA 5LB6A 2XJQA 1QJY3 2OZJA 1PO11 1SLAA 3LIHA 3ZFGB 4QU1A 1PMHX 3UNPA 3CQOA 2VM9A 5GALA 4ZXKA 4QX2A 2JG9A 4S2DA 1BEV3 3ZYRA 3JBG2 1VMFA 2XUMA 3PTRB 4AEDC 1Q8VA 1VBB1 3PUAA 4XMIA 1GR3A 4DFSA 1FAYA 2YDEA 1VBC1 1MZ6A 2R072 3AX4A 4L11A 3ZN4A 5JSRA 1ZX5A 2VBPA 4P9LA 5TSWA 4XUPA 4XDQA 4C91A 3DKQA 2WYFA 3HOBA 4MXWA 1MS1A 4FP3A 1WCUA 4AFMA 4JRLA 1XJAA 1BBT3 2XOMA 4HKWA 4ARYA 5CA6A 4FPYA 1MZFA 1DYKA 4H7MA 3PJYA 4JGYB 4AGVA 5LA0A 1O4TA 2RJ2A 3OD0A 1I9RA 4QQOA 5IFTA 3KT4A 2Y0OA 3KV6A 5LBBA 3WUDA 1N3QA 1RUD2 3RRDA 2MEV2 1JS9A 4HPKB 2YZ4A 4NN0A 2RR13 2RS53 2DUOA 2IC1A 3HAGA 3TN93 5IK4A 3AYDA 1RUNA 1LU2A 2Y33A 3VBHB 3X29B 1CAVB 2VW1A 3BIWE 2GP5A 3GM8A 1CZVA 2IUWA 3H3UA 3THTA 5A1LA 1EPZA 2EXHA 1HV0A 4YRDA 3T09A 3WNMA 5FPVA 3SKVA 3ILFA 3LE0A 3PVOA 3VKFC 2ZS6B 5CVRA 3MUY1 4AVTA 3DCQA 4LORA 3WW2A 5IVBA 2YU2A 2RM21 5FP8A 3UYJA 3JBG3 2E26A 5T55A 2VNOA 4ZHNA 1D2QA 2R073 4B7EA 3AZWA 1ZYBA 1GWMA 3Q8AA 2RV9A 1B35A 5F2WA 1AYM2 2VOXA 1PO22 2NPIA 1U0AA 1MEC3 3FWEA 1DG6A 4CCNA 5F1RA 4I01A 1GP4A 5A7WB 4AEDA 4DY5A 1QDOA 1A34A 4L2NA 4D8MA 1UKRA 4AI0A 4IE6A 3OUHA 2JDPA 4BB3A 5A3UA 1QXRA 1HN0A 1ULCA 3B02A 4SLIA 3TNQA 2WN3A 2Q1MA 1N1SA 3VBRB 4Z1VA 2PHWA 3IMMA 4PQQA 1S0CA 4DPNA 1ZRIA 4XXPA 4Y26A 1ULFA 4LHLA 3NW4A 1XOYA 2P4EA 3LEGA 3AYEA 1S55A 2D6LX 4HK9A 1VALA 4AZZA 4QX1A 3LZZA 4A3XA 3TNPB 5HXMA 3N9MA 5I91A 4MLOA 4PHZA 3MF9A 3ZXGA 1IS3A 4Q1RA 1YRZA 2WLPA 2VE1A 2C6SA 3NJZA 1W6MB 3VD5A 1TMF1 4XJUA 4R9BA 5A1AA 2JE8A 2JB4A 1OA4A 2D5HA 2NZ9A 1POQA 1GUIA 3Q8BA 4QQHA 2I2SA 2YU1A 3BUCA 3LFMA 4CCCA 2QQOA 4RFRB 4OULA 1NQDA 3ECQA 4ASLA 5BNPB 1RUOA 1COV2 3AFKA 4MGKE 4META 4WM7A 1K3IA 2ZPXA 1NA1C 3CO2A 3VDDC 1ZBE1 4AQ2A 1WLTA 3T4VA 3FHIB 3UETA 1UYYA 2J42A 2WNUA 2HBUA 4PIXA 3UGHA 1QJZA 1GNZA 4HVRA 1A3KA 2QNKA 4FFIA 2Y64A 5DUUA 4AG4A 2QDRA 2QQNA 2B4KA 1XRUA 2YBKA 3H7YA 4BCUA 4LT5A 3MW3A 3ATGA 2ZEWA 2XXZA 3FLRA 1NE6A 4UFHA 2XWJB 4HKLA 3SKJE 3WY6A 2YYOA 4O7XA 1G9DA 2JEMA 2JECA 1U5IA 2W1WA 3O12A 1FMD1 4CEWB 1LAJA 3E6BA 3H1MA 5BNNA 2BW8A 4IE5A 1JYXA 1KRIA 1AL0G 4IGOA 3J8F1 3VBSA 4URTA 5CU1A 2UWBA 2QQVA 2PFWA 2VOWA 3OCPA 1Q56A 3N9OA 1HDKA 2Y6KA 5IVEA 3Q8EA 2PLV1 1U5YA 1H1MA 3IDAA 3MUZ1 3SEEA 1BZWA 2X5IA 2XHKA 3HWJA 4YG3A 3OSDA 1F35A 2DCKA 1RUE2 2GSYA 3ACHA 2E53A 1OHFA 3OPTA 4UYBA 2E32A 5LEKA 3I2HA 2ZGNA 5E8AA 5T5OA 3IIIA 4M3CF 4YVWC 4NJ4A 4Y33A 2LROA 4NVPA 5AC91 1UYPA 4EN8B 4OVEA 5FP9A 2XJTA 4KGGA 4AGRA 1OOPC 3TB0A 4ZZ5A 4L8QA 5C9AB 4HSJA 2VCBA 5K0UB 4FPLA 1UZYA 4MGTA 4NE9A 2IFWA 2J1TA 3AK0A 1QWRA 3BPZA 1T2XA 1X8MA 1ZZ6A 2D3RA 4GD4A 3C7HA 3ZYJB 2DVFA 2ET1A 4JCKA 1HV1A 2WRAA 3IBMA 3GZEA 1ZZ8A 3FFQA 3T30A 4A6SA 1AX1A 5DQ0A 2XVGA 3N9QA 4LXLA 3U11A 4CPBA 1DBNA 4PDWA 4C0BA 5A7NA 3VKOA 3NO8A 4PF5A 3ZLIA 4CDWB 2GNDA 5E16A 4QAWA 3ZN6B 1WMEA 2EIBA 1MS3A 2QQMA 2WNVA 1GSLA 4UOJA 1Q3EA 5JZGC 2RS12 4CSWA 1WCKA 2XKPA 1QJU2 2YV8A 4XJAA 2JX9A 5IFPA 3S6PA 2JE7A 1EUTA 1PVXA 1RUE3 3N36A 1J1LA 1IPJA 5EQUA 5C5TA 3ZYBA 2XLGA 4E4DX 1Y4WA 4FOQA 4BLJA 5I8YA 4XFCA 5KHKA 4L0PA 4UAPA 1PM7A 4BH9A 2DU1A 5FP7A 2B7YA 2CNAA 5KWRA 2LALA 3VBOC 3OY8B 3GBWA 2FMDA 1EPWA 3D8CA 3FE5A 5C7GA 3C2UA 4IEXA 4XF1A 1D7PM 5BNNC 5A33A 5JVVA 2FDJA 2MPFA 4HT1T 1OT5A 3VD9A 4N7UA 2ZGLA 4D6QA 3NJXA 2ZGQA 4ES9A 1UX7A 3GBGA 1H1AA 4JGZA 1PGW1 1PIV2 1E5SA 1W2OA 3RZLA 3UGGA 4R4ZA 3NKGA 3P1IA 1JYNA 4AFDA 2C9AA 4CZSA 2QQJA 1FPN2 2GAUA 4LO5B 4WV8A 4E2SA 2A71A 4OHWA 1RXGA 4LITA 4W6WA 3RZKA 1JZ3A 2NP0A 1QU0A 1TNRA 3S5QA 2W0XA 3WLUA 4ZZ8A 5JWPA 1ULGA 5FY0A 4OI1A 1IPSA 2BGCA 3VHPA 1W2NA 3WG2A 1VBE2 2J1SA 3UL2A 4QM9A 1XXNA 4DY3A 4XACA 1URXA 1FOD2 2F4LA 2YGLA 1RUF2 3D4KA 5H9SA 2ZGRA 3ZFGA 1RXFA 2RS13 4NROA 1BK1A 1QJU3 3E1F1 4P02B 2VH9A 1RMU2 1GQPA 4QX5A 1EV11 1MQTB 1H0BA 5K8SA 5E6HA 3NV1A 1OUSA 4UBHA 4XIOA 3F95A 1HXS2 2OZ6A 3G6JB 4DEVA 5F3EA 1GANA 3LWCA 4C90A 3FBYA 1D0HA 1CZSA 3POIA 4YW4A 1QMJA 2O8OA 5FZOA 1JZ7A 3N3HA 1J3QA 5L19A 3IDEA 4D7TA 1W2AX 4QKNA 2IXKA 4HN1A 2K0GA 4RGAA 4XQWA 3TOJA 2R041 3MW4A 5KXDA 2P3JA 3BOPA 4PDWC 5FZ6A 4AHZA 3SNMA 2IXIA 4LR4A 4NHLA 2VZPA 1V6OA 2PN5A 4XVHA 4BWOA 1UZVA 2B9VA 2DF7A 2VOTA 5F6KA 1JI6A 4FAGA 1OC1A 4JGYA 5CISA 4LK6A 2HJIA 3LOIA 3VZLA 3WINE 2CGPA 1JOJA 4RHV1 2Q8CA 4CDXA 5A3NA 2HWD2 4QGNA 3D82A 2WS92 3JD72 3POGA 2XKOA 3TRSB 2Y0IA 3WNXA 1AR72 1H9WA 2Y38A 1NKGA 4HPKA 2EIGA 2YFZA 2N7GA 5FUNA 4DMIA 1OLQA 3LPGA 2LW8A 5IK5A 4LMFA 4YZ2A 3VBHA 4Q1PA 2DVDA 2WIIB 4Q2FA 3K77A 3WZ1A 3CBNA 1NE4A 5CZKA 3HPNA 5A6XA 4Q4X1 1IGOA 4P08A 4YFWA 1UWWA 4AFCA 1I5ZA 3T2TA 3AKRA 3SEPA 1RMU3 1GU3A 1DIWA 2DURA 4HXCA 3VHOA 3BN6A 1DGRA 5C3RA 2PHUA 4YW5A 3GZUC 1OVSA 4HSLA 5FREA 3I2OA 1CIWA 3BOWA 1IG0A 4JGZC 4NIGA 1PGL2 1REFA 3OBAA 2SBAA 1U5XA 2VXRA 3B94A 2VAUA 3TBDA 5CBLA 5EIYB 3GJAA 3KGZA 2YMZA 5FK8A 3H8UA 3M3CA 1ZBA3 3CEWA 3N9LA 2IVIB 1VBD2 5GZGA 2ZEYA 4QQ2A 2CSGA 5FZFA 4ORFA 1ULOA 4GWJA 2CDPA 3VBRA 5IVCA 1K5MC 2AYHA 1Z7S1 2I74A 1BQPA 4IGPA 2HWF2 1M4WA 4M3CE 1LHNA 1SACA 1MR5A 1Y3TA 2ETEA 4LHNA 2RDRA 3KCXA 4GMP0 2SLIA 2CDOA 1DQ1A 4LO4B 3WQ7A 3MHZA 3POJA 2JXAA 4K8FA 4PCRA 2BDRA 4AI2A 5KXBA 2BNMA 4BQ4A 4BIFA 1AX2A 4BM8A 4BJ0A 1W6MA 2R0HA 3K4AA 3PTYA 1QGLA 3CJXA 1BK0A 2VNVA 4FAHA 5DXDA 4A3ZA 2QQLA 3O1VA 5CFCA 4AE2A 5BNPA 4GB31 2BEOA 2Y6LA 1F8VA 4YNIA 3MEPA 1W6NB 4XQ4A 2ERFA 1JUIA 1RUH3 2PQQA 4XF9A 2WO7A 3BTYA 4L92A 3CZUA 4HL0A 2RMU2 2PHRA 4QB2A 3USSA 2D43A 3RJRA 3ASIA 4EZHA 4CDXC 4I3PA 3U4SA 3AZZA 3ZO0B 4LJHA 1X36A 1PM4A 1VIWB 1GNHA 1FT9A 1VBD3 3UESA 2VMCA 3JU9A 3R4UA 5LBFA 4OI4A 2OXBA 1ND3C 1HKDA 1FYUA 1U12A 2W1SA 4CEWA 2VC9A 4H55A 3IM0A 3QLQA 2E31A 4DOUA 1QNYA 1SLCA 3MIEA 1KJLA 2BBVA 2HWF3 2KR2A 1WW6A 3H1YA 3FFZA 2HYXA 5FFOC 4FFFA 4XE9A 4DXZA 4AFBA 1MS4A 4D7YA 4B3NA 3J7HA 4G4FA 1LOCA 4HFSA 3ZFEB 3FBMA 5FOBB 3O14A 1S0GA 2D6MA 4GWMA 3OGJA 3VDAA 3HNBM 1TVGA 2QCSB 4IEOA 4N7IA 4QXCA 2RHPA 4W8JA 4NIAA 5C5UA 3RS6A 4G3YC 1GKBA 2WFF1 4IGQA 1MZEA 4EQVA 2JENA 5M0TA 4NHMA 3VHRA 2ZMLA 5DDJ1 3N4MA 1HQLA 1VBA3 4PQ9A 3O1TA 1QJX1 4QX3A 4Z2AA 2D7FA 5KC6A 4UFJA 5A7PA 4K3UA 3ZXFA 1XNKA 3OOXA 4QPGB 5C9AA 5BNOB 5K0UA 1NY72 2CY6A 2RMU3 4K1ZA 2J1UA 3PMEA 3WQ1A 1JH5A 5KR7A 4M4PA 4Q4Y1 3ZFFA 2W5FA 2W3JA 4I09A 3CNAA 1VB2A 3DUIA 3ME2A 1OF4A 4HLTA 1DQ0A 1OUXA 3QCWA 2WN2A 2VZQA 4NHYA 2WFPA 1APNA 3HQXA 2R0FA 1DCSA 4X6RB 3H1WA 1G8WA 3VGIA 1SLBA 2QQPA 4U36A 5E1RA 4CDWA 2RDSA 2VZ3A 3ZN6A 1X9PA 2ZCWA 3B7MA 2JKBA 1ODMA 2W94A 2X8KA 4IV1C 5DG1A 5CFCC 4NAMA 3W5MA 1XNBA 4IW3A 1IG3A 3IAPA 3WXPA 1SBFA 4E4HA 2VVFA 4B4QA 1V0AA 1VAKA 3WF3A 1W8FA 5A32B 1C57A 4YM1A 2CU5A 2GNTA 2A1XA 1CZTA 4GQ7A 3PUSA 2GMMA 4CDUC 2VY0A 4AF9A 4UWDA 1CJPA 2X29A 1UN1A 4CPBD 3ZYGA 1LCLA 1W28A 2D6KA 2PHTA 4E8CA 4GMP1 5FZ4A 1B09A 2RVAA 1M06G 3OY8A 1YC61 5GLWA 1UMIA 3USUA 2BUKA 4YG6A 2OKXA 5FZDA 2FDIA 1SG3A 1H8TB 3UJOA 2VCAA 1SFPA 4GZ9A 1I6XA 1XE8A 1VLNA 5LATA 2VMEA 4AVVA 4Y5SA 3OEBA 4S2HA 5CFDA 2WQ4A 5EFUA 4GKXA 2I07B 4RYDA 1OQDA 5F3GA 1S1AA 3BCWA 1VAMA 1HW5A 5GZEA 1QOSA 4NPRA 3T0BA 3ORJA 1AR83 5J09A 1RUG3 1ST8A 2DFBA 2WT0A 4IL7A 5FZIA 4MYEA 5BXXA 5KC5A 2IXLA 5EV7A 1O3RA 3U4XA 1CAXB 2DUQA 5GLVA 1UU4A 1QOTA 1YIPA 2W9XA 1R1A2 3BB6A 2A6VA 5F8PA 3MIDA 5K4LA 3U14A 1F9KA 4S2FA 1DF0A 4IEWA 3WDXA 4AVBA 3IPVB 2RJLA 4ATFA 5C8CC 1OBNA 3GJBA 3KT7A 3JB4C 3N7JA 4N9HA 4CVUA 1UY3A 5E89A 2E6VA 5CB7A 2ZGSA 1QXJA 5FLHA 3V0AB 1LB2A 3FN9A 1YEWA 1A78A 1MQTA 3ZSLA 3AKSA 4LK7A 4ZU5A 2GDFA 3AYAA 3R0RA 4KU7A 4AAPA 4XFHA 3ZFFC 5C4WC 3AP4A 4JKLA 4AGGA 4E4ZA 2Q8DA 2X09A 1NXD1 1XSRA 3RVHA 2JG8C 4RN5A 1UKGA 2FZ2A 3R4DB 1WW4A 2VXJA 5FXXA 1BVVA 1HJGA 2GC1A 4NPMA 5AFEA 4XFGA 5SV5A 2HWE1 3D5OA 5ACA2 4PJYA 3PDQA 1YFYA 4AWDA 1N1YA 3OD4A 3SISA 3I4IA 5EJZB 4LBKA 3GGLA 4DEQA 2E7QA 2HKXA 1LGNA 3ZN5A 4YGEA 2KXLA 3OPWA 2HYKA 1NCQB 5FZ9A 3RYKA 1RUJ1 3P3NA 3RMXA 1SDDB 2UYBA 1UD1A 4CUAA 5IK7A 3SCHA 3DYOA 3V56A 5FIXA 5FJKA 2G9FA 3UK9A 1PZ9A 3RFRA 2FDHA 3KCCA 3I2IA 3NV3A 4BHPA 1UAIA 2XBO2 2V5DA 3VB9A 2WO1A 2D44A 2XMLA 1R1A3 4IETA 2WZEA 4XHBA 1PK6C 3WDUA 4Y20B 1G9BA 1DLLA 2KM2A 3J7NA 4FOYA 1SCSA 2P3KA 3ZIXA 1N1TA 4RS5C 3A22A 1Y9QA 4D69A 1T6GC 1JZ6A 5FJHA 4OHZA 2RS31 2DTYA 3ZXAC 2DCTA 1LRHA 2J7MA 3WR0A 1FNZA 1O4ZA 2LRPA 1BEV1 2CWMA 2VZRA 1OF3A 5LEJA 2QQKA 4TLFA 1WLWA 1D4VB 5APAA 3GNEA 2A3WA 4M3CB 3M3OA 2CAVA 3VBFA 4R9CA 1FX5A 1GOHA 2BU9A 4L99A 3Q8CA 3ZXEA 1AYN2 2G19A 4Q8LA 3MV11 4FFGA 3ZKYA 2QZ3A 4WM8B 1PVC2 1ZREA 4IQPA 3AVRA 2DCZA 1RVF2 2IXHA 3IT8A 1K12A 4UXAA 3A7QA 1ENQA 1MS9A 5EYYA 3HIFA 5I8SA 1BBT1 1X82A 1ZRCA 3KB5A 1OD5A 1OQEA 1UQXA 1G6NA 4X8NA 2V4AA 4RQPB 5JSPA 2EICA 4MGYE 1UCXA 2OIIA 4AQ6A 1A8MA 3VZKA 1YQ6A 3LEKA 1NLQA 3F2ZA 5HCBA 2FHRA 4YZ5A 1HRV2 5D8AC 1OPOA 4IEPA 1C8M2 1G9CA 4BXFA 2RR11 5JLVA 2RS51 3CKHA 3MIBA 3WDTA 4CCOA 3TN91 4CA9A 1ZRFA 1QJFA 4Q4V2 1AXKA 4PBPA 2ILMA 2W92A 4N53C 1QQP3 1FNYA 1NCRB 1W6NA 4UFKA 3RMYA 1QF3A 5A3LA 1GWLA 3LFIA 3I2FA 1UZ0A 2XVKA 1QKQA 3GHNA 3IKWA 4PLNA 4LULA 1LOFA 2MHFA 1ZRRA 2XJSA 2WINB 2F17A 2ZA9A 3JB8A 4S2GA 1DZTA 1KXGA 1AYN3 2VULA 5F2SA 3BALA 1SBDA 1MZ5A 1W3XA 4GKYA 1PVC3 2BFUS 3VD3A 3LQCA 1MEC1 3PIJA 2MNGA 5FKBA 1RVF3 4U2AA 1W03A 5IT6A 4QKBA 2VMHA 1OH3A 1X8EA 4LBJA 2K2SA 3LF7A 4LA3A 1FATA 3W5NA 1KDKA 3MZHA 2NMOA 1CONA 2DV9A 4BQ3A 5A6QA 4IEUA 1JYVA 3AP6A 3ZFEA 1KEXA 1V6KA 3HT1A 5FZGA 1IKPA 1HRV3 1X50A 4YZ4A 1C8M3 2DDUA 5LY2A 1VBB2 2J1AA 1VBC2 5A3MA 3RDIA 3OG2A 4C8DA 1ENXA 4Y1XA 1RUC2 2XLFA 3VBFC 4Q4V3 3NRUA 2HWC2 2YG0A 2JKXA 3IZOA 1ZZCA 4XXAA 1RB8G 1EUUA 1R1ZA 2VOKA 4J6GA 4LBLA 4IE0A 4QPGA 1AVBA 4P9YA 2OYZA 5BNOA 2VPVA 1H2NA 1LULA 5C3QA 5JMCA 1QDCA 4FXGB 3T0DA 3U0ZA 3SH4A 4LE3A 3CJIC 2NM1A 4IV3A 2WL1A 2ZAHA 1HB2A 1MPXA 4YVSB 5FO9B 1UO9A 2WAOA 3OYWB 3POSA 4K1YA 3WP5A 2Q5TA 4TLGA 4QMAA 1XU2A 1E5IA
chains in the Genus database with same CATH topology
2P1BA 2VTXA 1K5JA 4CA9A 3T30A 5EHDA 2VTXJ 4N8MA 1XB9A 1XE0A 1NLQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P1B A;  2VTX A;  1K5J A;  4CA9 A;  3T30 A;  5EHD A;  2VTX J;  4N8M A;  1XB9 A;  1XE0 A;  1NLQ A; 
#chains in the Genus database with same CATH topology
 3PUR A;  4FSJ A;  4YG0 A;  3AL5 A;  5J48 A;  4GH4 C;  4B1M A;  1UOF A;  2WA3 A;  4Z2W A;  2Q1F A;  1AF9 A;  3ZPO A;  5A6Z A;  4OI0 A;  2JIG A;  4HG6 B;  4RA0 A;  1YQ8 A;  4X6Q B;  2E9Q A;  1BYH A;  5HPO A;  5JR2 A;  5LRS A;  4NID A;  2ZAA A;  2RM2 2;  5FO7 B;  3QBQ A;  5ABJ B;  1HX6 A;  1VBB 3;  3T2Q A;  1RUD 3;  3V65 A;  2MEV 3;  2P6C A;  2WLQ A;  1W8U A;  2JG9 C;  4IEY A;  4MG2 A;  5FZK A;  1RUC 3;  2CV6 A;  4BE3 A;  2XDV A;  2VBD A;  2Y8K A;  2HWC 3;  4GAZ A;  2FMY A;  4I0B A;  5A7Q A;  2FZ1 A;  4CCL A;  1YIF A;  1JHJ A;  5KHJ A;  2D3P A;  4CEY B;  1IHM A;  3LA7 A;  4ISQ A;  4CDQ B;  4BMB A;  3KGL A;  3CDZ B;  1R64 A;  1PX3 A;  3N7L A;  2GNM A;  4XQD A;  2H6C A;  3I3E A;  3ETP A;  3T1L A;  1TNF A;  2ZMK A;  4WBB A;  3U75 A;  1ND2 B;  3P3P A;  3VLB B;  4KBB A;  1I3H A;  5EWS A;  1Y9M A;  1SFY A;  1W9S A;  2DCY A;  3K51 A;  4M0N A;  5BNQ A;  5JXG A;  1VMH A;  5HCF A;  1D4M 2;  4GIQ A;  3C3V A;  1HJF A;  3R4S A;  4LBQ A;  4LTA A;  3RZG A;  1AYM 3;  3BIE A;  1PO2 3;  1W9Y A;  2WA4 A;  1UIJ A;  4QB1 A;  2JDH A;  2A6X A;  3IN9 A;  4C1W A;  1LJ7 A;  1CAX A;  1O5U A;  1JU4 A;  3ALQ A;  2G4I A;  4YAR A;  1W6Q B;  5FYH A;  1EAH 1;  3S5A A;  1Y43 B;  3IPV A;  5FQ0 B;  1RC6 A;  1F4H A;  4FQZ A;  1OXC A;  4COY A;  3UGF A;  1GIC A;  5L7O B;  1ENS A;  2RM2 3;  3J4U H;  4QQP A;  4P5H A;  5IJR A;  3B69 A;  1XC6 A;  2A73 B;  4Q4W 2;  4QT6 A;  4HON A;  2ZX2 A;  1TG7 A;  3OUI A;  4LKF A;  4X8P A;  2P3I A;  4AHY A;  4LKD A;  2VMD A;  1W39 A;  4WZC A;  4CXX A;  5IAT A;  2X10 A;  2NQY A;  1UOJ A;  3B3Q E;  4IV3 C;  2FCT A;  4JQR A;  1K42 A;  2ARE A;  3GZT B;  3POE A;  4V2W A;  4UFM A;  3SLI A;  4J25 A;  3ROU A;  4HET A;  3VBU B;  2HH9 A;  2ZKN A;  5C6C A;  1UZW A;  3JZV A;  1B35 C;  1V6L A;  2L9L A;  5IUQ A;  4BQ1 A;  1VRH 2;  2EXJ A;  3DXU A;  3OBZ A;  5H9P A;  1TME 2;  2VVE A;  1WMX A;  3A0N A;  3I2G A;  3ILR A;  5FZH A;  1FMD 2;  1QIQ A;  2R16 A;  1JYC A;  5FLJ A;  1NLR A;  2B8M A;  2ZHN A;  1COV 3;  2Q4S A;  1ONA A;  3AMN A;  1KD7 A;  5JPN B;  1NCQ A;  5FZ1 A;  5F3C A;  2OQ7 A;  1F15 A;  3B01 A;  1D4M 3;  1K5J A;  2UYA A;  4LKE A;  4O61 A;  1YQ2 A;  2WQ8 A;  1ASJ 2;  1H2L A;  2Y6H A;  1XYP A;  4JHT A;  1HRI 2;  4W50 A;  3K75 B;  5GJ6 A;  4CCK A;  1V6I A;  2ET7 A;  1S0B A;  2GP3 A;  3CMG A;  3GF6 A;  5FZ0 A;  4Y4R A;  3BU7 A;  2DBN A;  4HMZ A;  2ZX1 A;  2JD9 A;  1O8P A;  3SHR A;  3TYJ A;  1WBF A;  5J37 A;  4JX0 A;  2VZ1 A;  2JDY A;  4Y20 A;  5A7S A;  3WG3 A;  3V0B B;  3LAG A;  2XPJ A;  4IEQ A;  2P37 A;  3AP7 A;  3KM5 A;  2W1U A;  4KL1 A;  4LHK A;  4P14 A;  1UL9 A;  3EQE A;  1C5I A;  1DYO A;  3AM2 A;  4H14 A;  3ZKU A;  1OA3 A;  3AVS A;  4Q4W 3;  1YFU A;  2RS1 1;  2AR6 A;  4GWI A;  3OGV A;  2JDN A;  1QJU 1;  3B9I A;  1WGP A;  2ZZJ A;  1LU1 A;  2BBA A;  3D0S A;  3GHM A;  5JXI A;  3K3N A;  4WM7 C;  3N7K A;  4M3C A;  1WCS A;  1CQ9 A;  3DPR B;  2WNU C;  3NNM A;  4EV0 A;  1QOO A;  2X53 S;  1WCD J;  5CAZ A;  2JWP A;  1MVQ A;  1UYZ A;  5FPU A;  1UNB A;  1VRH 3;  1G9F A;  2WZR 2;  2GAL A;  1TME 3;  3GCX A;  3NAP A;  4QPI B;  4AQS A;  4URA A;  5BY5 A;  4K20 A;  5FPA A;  2VQU A;  4FPJ A;  4NII A;  4NRM A;  3RYR A;  3ZDV A;  4ES8 A;  4JZR A;  2CGN A;  3THP A;  4B4R A;  3FJS A;  5I0T A;  5FKC A;  2AEZ A;  1QEX A;  2DUP A;  1DQ2 A;  3UT0 A;  5F5I A;  5I8T A;  1CX4 A;  3B00 A;  1ASJ 3;  2ATF A;  1YUD A;  3MPB A;  1HRI 3;  2WO3 A;  2XJV A;  3ENR A;  1R09 2;  4LKS A;  3PUI A;  3VBS C;  4Z92 B;  4I30 A;  3KV9 A;  2PAK A;  4RR3 B;  2ZGO A;  3LA2 A;  2VUA A;  2X5I C;  1YO8 A;  4PF1 A;  4XTP A;  1LOG A;  1H4H A;  3HJR A;  4JDO A;  3WQ0 A;  1NZC A;  4LIU A;  3WHT A;  4KMQ A;  4QX7 A;  4XCB A;  1NCR A;  1EY2 A;  1QNW A;  2ZHM A;  2RDN A;  1HLC A;  1VP6 A;  3J26 N;  5T5L A;  3RI8 A;  4A7Z A;  5EZW A;  1AR9 2;  2EXI A;  4XOG A;  1MS5 A;  1WZX A;  3AP5 A;  2HWB 2;  2X05 A;  2OUH A;  3FHQ A;  2B9U A;  3VZJ A;  3MLJ A;  4JRA A;  1W6P B;  4P9J A;  5FYZ A;  5F6L B;  2WZR 3;  4MOA A;  3O1U A;  2ORX A;  4D7S A;  2FDG A;  4ZS3 A;  4BU2 A;  1O6U A;  1ZBA 1;  2B5H A;  3TEW A;  4XUN A;  2W08 A;  4N43 B;  4DS0 A;  4XJW A;  5ISL A;  4PI0 A;  2YY1 A;  4KGQ A;  4COV A;  2AEN A;  4M00 A;  3WP6 A;  4W6X A;  4BQ2 A;  4PBO A;  1XBF A;  1NQJ A;  4E4S A;  3EB7 A;  4K7J A;  4XF0 A;  4EN6 B;  1O8S A;  2E7T A;  2K46 A;  1R09 3;  4Q0S A;  3FUO A;  4Y24 A;  2WNV C;  1LTE A;  2BFU L;  1PIV 3;  2QBX A;  3KMH A;  4JC1 A;  1VPH A;  5GZF A;  1BJQ A;  3AKQ A;  3L2H A;  2E7A A;  3WNN A;  5DAQ A;  1FPN 3;  4I0W B;  5IYY A;  1AXY A;  4IER A;  5HCH A;  3LA3 A;  1IQA A;  1N47 A;  5DAP A;  4GWN A;  2BER A;  1L7Q A;  2YXS A;  1XU1 A;  1CAV A;  1VBE 3;  3NAP C;  3H8R A;  3R6S A;  1CES A;  1X33 A;  1FOD 3;  2IXC A;  2PHD A;  1RUF 3;  3O0V A;  4TYS A;  3ZIW A;  2FDK A;  4QPW A;  4MX3 A;  2XVL A;  4OZO A;  1V6N A;  4PIZ A;  1AR9 3;  3NL1 A;  2WNE A;  4GA9 A;  3VN4 A;  3J9S A;  3RYP A;  1TZO A;  2A3Y A;  4DXT A;  2HWB 3;  5LAS A;  3W9A A;  4NRQ A;  3FLP A;  1SCR A;  1SQ4 A;  4NHX A;  1YFW A;  4UW3 A;  1RUH 1;  3DYP A;  2GN3 A;  4B1L A;  4NAO A;  1CAU B;  4YVS A;  5A80 A;  4RHV 2;  4UFI A;  4AI1 A;  1HXS 3;  4AED B;  3AZV A;  1UW8 A;  5AFB A;  1N1V A;  3OUJ A;  4E8D A;  4MO3 M;  4FFH A;  4F83 A;  3M3I A;  1VBD 1;  3WG1 A;  3U37 A;  4RD7 A;  3KVA A;  3ACL A;  3PL0 A;  4XYX A;  4CU6 A;  1AJO A;  5A7W A;  1ULP A;  2A70 A;  2WWS A;  4XUQ A;  4D3W A;  2FCV A;  3MPP G;  2I45 A;  3QAC A;  3W21 A;  2CWS A;  4YLZ A;  4A41 A;  5BYN A;  1HB4 A;  3HNM A;  4QKD A;  3ZFG C;  5ABJ A;  2CAU A;  2QE3 A;  2OUJ A;  5F3I A;  2HWD 3;  2B45 X;  4MGS A;  4KWU A;  2WS9 3;  3DEC A;  3JD7 3;  3KHB A;  1AR7 3;  4LBM A;  4CXY A;  3KD4 A;  3M8L A;  4LO8 A;  2XQR A;  4ATE A;  4XAA A;  1POV 0;  1OD3 A;  3AL6 A;  3MYX A;  1DQ6 A;  2O14 A;  3AKT A;  3POY A;  3ZOI A;  1ULE A;  1X9T A;  4CP1 A;  4FPO B;  4CEY A;  2C24 A;  2PHX A;  5DAB A;  4JTO A;  4E2G A;  1BVP 1;  4CDQ A;  4XEZ A;  2ZKL A;  3WHU A;  1GP6 A;  4AEJ A;  3N9P A;  1VBA 1;  5GLT A;  3OGS A;  1GZ9 A;  4E9K A;  1JOP A;  4LEJ A;  3NST A;  4LLO A;  4TXW A;  1VB4 A;  1DHK B;  5AVP A;  1LHU A;  4DRR A;  3ZXL A;  4LOT A;  2H0B A;  1X7N A;  3RSJ A;  1Z7S 2;  4CCM A;  3HBK A;  1RJ7 A;  2A6W A;  2RMU 1;  3PUQ A;  2FDF A;  2D3S A;  3DGT A;  4JGY C;  4PI2 A;  5T50 A;  4QDS A;  1IKQ A;  1W99 A;  4PLO A;  1NLS A;  4GXL A;  3WDY A;  4AHW A;  1ENR A;  5CG8 A;  1W8H A;  2VEC A;  1W6Q A;  4XF4 A;  3J7M A;  3VBH C;  3INA A;  5A1F A;  5FQ0 A;  2EAA A;  4H3W A;  1DZQ A;  5L7O A;  2P17 A;  1Y9G A;  3VHN A;  3PLQ A;  1DQ5 A;  1XE0 A;  2Z5W A;  4XBN A;  4GB3 2;  1SPP B;  1NZI A;  5GM0 A;  1YI9 A;  1PMJ X;  2VG9 A;  4LBQ D;  4FOV A;  4NOT A;  3H50 A;  3PNA A;  1GZT A;  1AX0 A;  1RUI 1;  2OVU A;  3RWK X;  3UKT A;  4YPJ A;  1AHS A;  3WCS A;  3AP9 A;  4A44 A;  1W0P A;  2GME A;  3N35 A;  3VBU A;  1KS4 A;  3I3Q A;  5GKA C;  1W04 A;  2XL9 A;  4FBF A;  1NXM A;  2A3X A;  5FZM A;  5FPX A;  2W87 A;  4YW7 A;  1BCX A;  2J1V A;  5J36 A;  1VAV A;  3I2D A;  2JB8 A;  4YM2 A;  1XYO A;  4XBQ A;  5GLU A;  1IZ3 A;  2FBE A;  1W9T A;  1ZNP A;  5FXW A;  4OHV A;  4ZY9 A;  3ES1 A;  1O3T A;  1UXX X;  3LDK A;  3MGU A;  5T5P A;  3N7M A;  2BWC A;  3NJY A;  4FPF A;  5FZ3 A;  5HV4 A;  3HBZ A;  5IVJ A;  3E5Q A;  5F7U A;  3VBR C;  5DUW A;  2Z2S B;  1NA1 B;  3I59 B;  3PU8 A;  3CHX A;  3VDD B;  5LA1 A;  5LY1 A;  5C70 A;  4Z8B A;  1R08 2;  4N8M A;  4QHB A;  3KSC A;  1GLH A;  4HZF A;  4Q0V A;  2Q0A A;  1AR8 1;  4I02 A;  1AL2 1;  4R9A A;  5L9R A;  4DUX A;  5JAX A;  1G9A A;  3V0B A;  1RUG 1;  2WFF 2;  4XAB A;  3MIF A;  2C5D A;  1NG0 A;  2W95 A;  4CXW A;  2F4P A;  3LEM A;  2ZHK A;  1S0I A;  3GCW A;  3AFG A;  4JKK A;  4DZG A;  1OLR A;  3NV4 A;  1BXH A;  2UWC A;  3NNJ A;  3NNL A;  3I7D A;  4LQR A;  1AR6 1;  1HQW A;  2W52 A;  5IAX A;  3AZY A;  4UW6 A;  5BNP C;  1K45 A;  2A75 A;  1FI2 A;  1LHV A;  1NUK A;  1HIX A;  2VZO A;  2ADD A;  4MZU A;  4Q4Y 2;  4DRV A;  4KWK A;  2PA7 A;  5DUX A;  3DPR A;  4RFT 0;  1NAE A;  3NKT A;  1H30 A;  2PAM A;  3UKV A;  3P5B A;  3K4D A;  5EHD A;  2W1Q A;  1P8J A;  1AZD A;  4FPE A;  5FYC A;  5JCT A;  3NQH A;  4YVW B;  2DBI A;  5I0D A;  2QQW A;  3CIH A;  2PEL A;  3LDB A;  1HN1 A;  4YGB A;  1KFU L;  4QD2 A;  3E5X A;  3T08 A;  1POV 1;  1SHW B;  4CEW C;  2V72 A;  2ZGP A;  3AXE A;  3S7I A;  3WDW A;  1OOP B;  5C3P A;  3RZM A;  1CGP A;  3WP3 A;  4R9D A;  1JW6 A;  4FCA A;  1US3 A;  4LO7 A;  1R08 3;  1UOG A;  4RSU A;  3KWV A;  5D21 A;  1PNF A;  3JUU A;  4RR3 A;  4E27 A;  2TNF A;  2PQS A;  1LOD A;  1VR3 A;  5FMD A;  3HQR A;  2VZS A;  2C1F A;  2WR9 A;  2WFF 3;  4Q26 A;  5LA2 A;  1XE7 A;  5JI9 A;  2XH6 A;  3RZH A;  4AVC A;  1R1A 1;  4A7Y A;  4MGI E;  3O0W A;  4BXS V;  3GYD A;  5HXV A;  1UMH A;  4ISR A;  1IPK A;  2NLR A;  3AKP A;  1QJE A;  2VVD A;  2EF6 A;  1LOB A;  5LRR A;  3AJZ A;  3TEX A;  2IWG B;  3H8O A;  3AZX A;  3THD A;  5C9A C;  2AZ5 A;  1LEC A;  5JZG B;  5JIU A;  2ORZ A;  3I97 A;  3OBR A;  2XR4 A;  2VZV A;  5K0U C;  5B4N A;  2BTV C;  4DUW A;  4CRQ A;  5F37 A;  1EP0 A;  4GUL A;  4BQY A;  3O1O A;  1LEM A;  3ZMN A;  2JDK A;  1UY2 A;  2ZMN A;  4N43 A;  5FMO L;  3LB9 A;  2WUH A;  4WVM B;  3VBO B;  4K9S A;  2VW0 A;  3CZJ A;  1IS4 A;  1SLL A;  1CR7 A;  2R06 2;  2JDU A;  3UKN A;  4B4P A;  5DMY A;  1SLI A;  2AC1 A;  4CDW C;  2XLA A;  1CIY A;  4FOW A;  5BNN B;  2XJU A;  4COZ A;  2YGM A;  3KQ4 B;  3ITQ A;  1PX4 A;  1H2M A;  2QQU A;  3VZM A;  5HBA A;  3WNO A;  5T54 A;  2ZAB A;  5LWB A;  5LZ6 A;  3E6C C;  3HNY M;  3ZM8 A;  1UMZ A;  3S0M A;  3PJQ A;  3MIH A;  1AXZ A;  4QDQ A;  2X5I B;  3IAQ A;  3KZ4 C;  1CPM A;  4XFI A;  5EXO A;  2V5Y A;  2UUR A;  3LEI A;  4NMI A;  2TUN A;  5IHR A;  4BOW A;  5JOW A;  1GOF A;  5A7O A;  2VMI A;  3NMB A;  2J1E A;  1BMV 1;  3NVC A;  5F32 A;  2HWE 2;  5HI0 A;  4WZF A;  4BQW A;  3ZSE A;  5C8W A;  1GYK A;  4HAN A;  5DAW A;  1QQP 1;  1PHM A;  1W0N A;  2IXJ A;  2IZW A;  2ZXQ A;  1S2E A;  3ST7 A;  2C26 A;  1QJY 1;  3UV9 A;  1CAU A;  3WEZ A;  2ZX3 A;  4LBN A;  2RE9 A;  4KG0 A;  5IWF A;  1CD3 G;  3DYM A;  1Q8Q A;  1RUJ 2;  3A21 A;  3IDB B;  3I3B A;  4IEZ A;  1JMU B;  5IAV A;  1W90 A;  4N9I A;  1GZC A;  4OQ9 A;  4FPK A;  3RNS A;  1SMV A;  4DIQ A;  5CFD C;  2B42 B;  3VZO A;  1V9U 2;  1AYN 1;  5IVF A;  5FY7 A;  3VL8 A;  3UJQ A;  1DGL A;  2BGP A;  2HEW F;  4KWL A;  4ERO A;  3AMH A;  3NV2 A;  1PVC 1;  4IUG A;  4BK5 A;  4XCA A;  1C3H A;  4XDO A;  2R06 3;  5ACA 3;  3NNF A;  5FMB A;  1GQG A;  3FL7 A;  4PDW B;  2Q30 A;  1YJL A;  1JZ2 A;  4XZP A;  4CP0 A;  3I2K A;  3LCP A;  2WAB A;  1LED A;  2YBP A;  5A3P A;  4CU9 A;  2RS3 2;  2QDN A;  2C0Z A;  3AMQ A;  1JXN A;  2HBT A;  4O65 A;  5FZA A;  3ZXK A;  4AEK A;  3K2O A;  5J1X A;  4OMD A;  1MQT C;  1CAW B;  1J1T A;  1JBC A;  4JKM A;  1HRV 1;  1BEV 2;  1C8M 1;  3ACF A;  2P34 A;  3MW2 A;  1EYB A;  2A7A A;  2QJV A;  2XBO 3;  4GAL A;  4C0H A;  2PAE A;  5BPX A;  2BOI A;  4CYD A;  2HEV F;  2Y26 A;  4YGD A;  3I3D A;  3OF1 A;  4K6B A;  2E63 A;  4P9G A;  1F5F A;  3WF2 A;  2VR4 A;  4NWV A;  2VQA A;  4V2V A;  4FQ4 A;  5JIA A;  2ZAC A;  4A2U A;  3PVB B;  3PU3 A;  3AJY A;  1PZ7 A;  2ARB A;  4Q27 A;  4QPY A;  2JE9 A;  3O1M A;  3HEI A;  1MVE A;  3MIC A;  2PYT A;  4QU2 A;  1RUJ 3;  1RHI 2;  4XC9 A;  3WDV A;  1FV2 A;  3RJ2 X;  4JGZ B;  1U5Z A;  1ODN A;  2IFR A;  3JBG 1;  4L9B A;  3BTZ A;  3PUH A;  2JIC A;  1V9U 3;  3WF0 A;  4MGZ E;  4KQ7 A;  2R07 1;  4IE4 A;  2GC2 A;  2DYC A;  3RWN A;  3KCY A;  4NR1 A;  1C1F A;  1PMI A;  3FUQ A;  2RR1 2;  4Y1U A;  3M3E A;  3WG4 A;  4ONU A;  5FYY A;  2ZEX A;  4OI2 A;  3QH7 A;  5ANQ A;  1IOA A;  3VKM A;  1Q8P A;  1RIR A;  2QUO A;  4AVA A;  1YWK A;  1GQH A;  3E6D A;  3P6B A;  2R1D A;  1WWY A;  1K5M B;  3LSD A;  1SPP A;  4XTM A;  5ERL A;  3LSE A;  2RS3 3;  3KV5 A;  4BDV B;  3H3L A;  2Z69 A;  1UF2 C;  4QX8 A;  3ABZ A;  2VBB A;  1QH6 A;  3WX5 A;  4UW4 A;  1PO1 2;  1H6X A;  1Z78 A;  3M4F A;  5D1I A;  1VMJ A;  4A45 A;  5CIR A;  3MFC A;  5KHH A;  1RUD 1;  2UY9 A;  1OKQ A;  2MEV 1;  1SEF A;  3AC0 A;  4M0H A;  5FRA A;  5JSO A;  3HN1 A;  1CPN A;  2ARA A;  3O1S A;  2BP6 A;  1RUC 1;  2LTN A;  1I5P A;  4DQA A;  1Y7B A;  3M7A A;  4XET A;  2HWC 1;  4ZON A;  4J1W A;  1L7R A;  2GZW A;  1WCQ A;  3B5L B;  5FZO B;  3U1X A;  1DDL A;  3BVC A;  3WNL A;  5KHG A;  1MEC 2;  1MS8 A;  2D6P A;  2DTW A;  3MF6 A;  3MLK A;  3IDC B;  4P5Y A;  2V73 A;  2VNG A;  3LD8 A;  5FO8 B;  5F5A A;  2W68 A;  3M1H A;  2HEY F;  5A3O A;  1LHW A;  3ZYH A;  1RHI 3;  4XBL A;  1E5R A;  4QWN A;  5FZE A;  4BK4 A;  1NA1 A;  3I59 A;  4B29 A;  5KBF A;  3RI9 A;  3VDD A;  3NJV A;  5JOX A;  2XG3 A;  1W3V A;  3SQO A;  4CDX B;  2UY8 A;  4LNV A;  5LW9 A;  3K48 A;  5FDB A;  4XJ9 A;  3HT2 A;  4KG8 A;  1LES A;  1AYM 1;  1PO2 1;  4LPL A;  5FZ8 A;  1C5H A;  5FY1 A;  2BPA 2;  3FX3 A;  5BUV A;  1ND3 B;  1KDM A;  2ZGM A;  1W9F A;  1WW7 A;  3HQU A;  4DO0 A;  2VD7 A;  4Y5Z 0;  4KBZ A;  1ACC A;  4FTB A;  4AI3 A;  3D6E A;  1RIT A;  4OUE A;  4BYY A;  4AEM A;  5JOZ A;  1PO1 3;  4UBG A;  4QB6 A;  3H9A A;  3BYW A;  2LS6 A;  1AUY A;  1WD3 A;  4I0A A;  4OQ8 A;  1V00 A;  1ULD A;  5A32 A;  4OUS A;  2BVV A;  3EHK A;  3OB8 A;  4MVT A;  1VJ2 A;  1XYN A;  1V6M A;  2LUW A;  2TEP A;  1VBC 3;  1LOF C;  1JTZ X;  3BI3 A;  5B4X A;  3L2Y A;  2R6Q A;  4OCT A;  4YVW A;  4HBN A;  5L73 A;  3I3M A;  5IK8 A;  5CG9 A;  1XSQ A;  3ACG A;  3WSO A;  1DGW X;  3ZVX A;  2OPK A;  1Q43 A;  2OQ6 A;  4AFA A;  1OOP A;  3OEA A;  1OLM E;  3ZR6 A;  2GMP A;  5AVA A;  2UWA A;  4BME A;  2CGO A;  1Q5O A;  3BGA A;  1H8T A;  1J84 A;  1UY1 A;  1COV 1;  3K4Z A;  1W6O B;  4TWT A;  1H9P A;  4UT5 A;  5FUP A;  1WLC A;  5DAV A;  4AHX A;  4Q0Q A;  2ZJC A;  3C7F A;  1D4M 1;  4K40 A;  4DNY A;  1Z0H A;  2BZD A;  2GNB A;  3ZFE C;  5I93 A;  4DIN B;  2OA2 A;  1FXZ A;  4YWA A;  4BA6 A;  3WT3 A;  2O0O A;  2WT1 A;  5J3U A;  1FV3 A;  3LKJ A;  4BPZ A;  2VQ0 A;  4EZ4 A;  5A3T A;  3WNP A;  3O7O A;  2V4V A;  2ZX4 A;  5F9T A;  2VMF A;  4P9X A;  2VNR A;  1TMF 2;  5FBJ A;  1W8N A;  4Z82 A;  3EO6 A;  5C33 A;  4JTN A;  4Q5O A;  4IV1 B;  3QD6 A;  3KV4 A;  5CFC B;  3AMM A;  5KXC A;  1UX6 A;  4Q4W 1;  4QPG C;  5JZG A;  5BNO C;  3ES4 A;  4CUB A;  3V0A A;  4LA2 A;  2WJS A;  5JR7 B;  5KXE A;  5FWJ A;  4IDZ A;  2JD4 A;  4CDU B;  1O4Y A;  1ZBE 2;  3PVN A;  1RUE 1;  4QM8 A;  2ES3 A;  2E33 A;  2BOJ A;  3HR9 A;  3DL3 A;  1KIT A;  4WVM A;  1OMI A;  1QH7 A;  3VBO A;  1VRH 1;  4XF3 A;  1OKO A;  2GH2 A;  2Q8E A;  1F5J A;  1TME 1;  1UY0 A;  1OFS A;  4WVV A;  5JPM B;  4NIH A;  4Y5T A;  2CTV A;  2WWJ A;  1EAH 2;  5CKM A;  2VOV A;  3HMY A;  2AH2 A;  1JHN A;  1UZZ A;  1W8T A;  2DWR A;  2P1B A;  3SCF A;  4Q8K A;  2XWB B;  5C3S A;  2JJ6 A;  2KA3 A;  5H9Q A;  1O3Q A;  2WBK A;  3FMG A;  1Q8S A;  2Y6G A;  3J8F 2;  1E57 A;  4SBV A;  1ASJ 1;  1S0E A;  1UU5 A;  3LPF A;  1HRI 1;  2DU0 A;  4YZ3 A;  5FK7 A;  5KHI A;  5FYI A;  1C4R A;  5H9R A;  5JOY A;  2WZ8 A;  4UW5 A;  2VCC A;  2PLV 2;  3JCI A;  4MSV A;  4Y1V A;  4ZKT B;  3POW A;  3NNG A;  3ACI A;  1UU6 A;  4XMA A;  4MH0 E;  3BKZ A;  3H7J A;  4XJ8 A;  1VE0 A;  1OI6 A;  4QDR A;  2YBS A;  1TMF 3;  2VUC A;  3ZYP A;  4AW7 A;  1WA4 A;  3S30 A;  5C71 A;  2ZEZ A;  4XIL A;  3OGG A;  3Q8F A;  1OQ1 A;  5AC9 2;  2WC2 A;  2XON A;  3VDC A;  5C8C B;  4ET7 A;  5FY8 A;  1DQ4 A;  1RGS A;  3KVB A;  3RQ0 A;  1JOB A;  2ADE A;  1H8T C;  3GDB A;  4CUC A;  1DGR N;  4PIY A;  1ZBE 3;  5I0S A;  2YRO A;  3BTA A;  3ZFF B;  5C4W B;  3K3O A;  3TEY A;  1BLZ A;  1YQ5 A;  1JYT A;  1W9W A;  2JG8 B;  3WF4 A;  5L9B A;  2WZR 1;  1ZRD A;  2XJR A;  4HN0 A;  1D2S A;  1TEI A;  2VW2 A;  5FUI A;  1EAH 3;  3VL9 A;  4F7Z A;  4BQ5 A;  1WD4 A;  3BPS A;  4FT8 A;  4NWW A;  4WM8 A;  1FMD 3;  2C9K A;  3GZA A;  3K46 A;  3MO4 A;  3QH6 A;  4MUV A;  3ZSM A;  3S57 A;  3ZYF A;  4OFG A;  3DEM A;  2RG4 A;  3ON7 A;  3ZX7 A;  3J8F 3;  1SLT A;  1E5H A;  1D0G A;  3C7E A;  2GU9 A;  5FAX A;  1GOG A;  1UYX A;  1R09 1;  4RQP A;  2QZ2 A;  5T52 A;  1PIV 1;  2D40 A;  2PLV 3;  1CAW A;  4HVO A;  4ZPI A;  1BKZ A;  2WZP P;  4CP9 B;  3J7L A;  1J58 A;  3EJK A;  3TWI A;  1LKN A;  1W06 A;  1FPN 1;  2VL4 A;  2OX0 A;  3O1P A;  1H1I A;  5FWE A;  3FC0 A;  3WW1 A;  1UPS A;  2R30 A;  5FBZ A;  5FOJ B;  1RIN A;  2G9Z A;  1PK6 B;  1JUH A;  2ZHL A;  3EBR A;  4P00 B;  1ZA7 A;  5AC9 3;  3NWK A;  1VBE 1;  4XUR A;  5FZL A;  3GXU A;  3HVD A;  5EPA A;  4UF0 B;  5FYU A;  5LA9 A;  1NX9 A;  1DFQ A;  1FOD 1;  1W8O A;  1WLD A;  1RUF 1;  4O9G A;  4RS5 B;  5K7P A;  1KS5 A;  3C7O A;  3USU B;  1AR9 1;  5CAD A;  1BHG A;  3POF A;  2VUJ A;  3JQW A;  2EAK A;  2C4X A;  2HWB 1;  4DB5 A;  1RMU 1;  4QXB A;  5FMO S;  4EYU A;  3SH3 A;  3G7D A;  1NCQ C;  2YPJ A;  5CFD B;  3AMP A;  5E88 A;  4CTE A;  3DV8 A;  4QKF A;  4QGM A;  4Y3O A;  1PGW 2;  1HXS 1;  3T1M A;  1DP0 A;  4KI5 M;  5IVY A;  2BGO A;  4LOS A;  4NRP A;  4Q29 A;  4DXR A;  1GZW B;  1XPW A;  3VDB A;  3ZSJ A;  2WDB A;  2VTX A;  5JXH A;  1LOA A;  4QXK A;  2RJK A;  4W65 A;  5FZ7 A;  1RJ8 A;  4QX0 A;  2CHH A;  1LHO A;  4LHS A;  4D0Q A;  3TEZ A;  5FPB A;  4LO6 B;  5FP3 A;  1K5M A;  3VKL A;  4FP2 A;  2P3Y A;  1WKY A;  2NN8 A;  4COU A;  4JQT A;  2WT2 A;  4BLI A;  5JDB A;  1JZ8 A;  3MDP A;  1KJR A;  2ZX0 A;  1JYW A;  1RTV A;  4YW2 A;  5IVV A;  2VO5 A;  3JQX A;  4F8A A;  3DF0 A;  2ZGU A;  2HWD 1;  2B46 X;  1CX1 A;  1UPI A;  2WS9 1;  3JD7 1;  2YC2 A;  1ZZ7 A;  4OYU A;  1AR7 1;  2JDM A;  1EV1 2;  5FLI A;  4Q0U A;  3ZSK A;  4ASK A;  5D8A B;  2YPD A;  4YM3 A;  4KH9 A;  2DCJ A;  3ZMO A;  4O9E A;  3CL1 A;  3ILN A;  3T2P A;  1ZBA 2;  2WSU A;  2Y6J A;  3S7E A;  4WVZ A;  2DVG A;  2KD7 A;  3H3Z A;  4UFL A;  4B8E A;  3Q9O A;  2J22 A;  4WM8 C;  3MV0 1;  3T2O A;  5A70 A;  2A6Z A;  4EN9 B;  4XFB A;  3H42 B;  1DU3 D;  4N53 B;  2P6H A;  1IQD C;  2R04 2;  2G9G A;  3E5U A;  1W2T A;  5FYV A;  2F6B A;  2RDQ A;  4LBO A;  4F3J A;  4EN0 A;  4UI9 L;  4C1X A;  3POB A;  4NO4 A;  3HN3 A;  4JAA A;  4JVA A;  1RL3 A;  1GV9 A;  1CJD A;  4R52 A;  1PGL 1;  1YCI A;  3U07 A;  4RQP C;  5A6Y A;  3OYW A;  1RED A;  1YFX A;  4FI9 A;  4Y1Y A;  3D3A A;  3L9J T;  4P9W A;  4YSF A;  5JMO A;  3RZJ A;  4OMC A;  4BIO A;  3FZ3 A;  4Y22 B;  1ND3 A;  1S2K A;  1HB1 A;  3DKW A;  2D93 A;  3MIG A;  5LK7 B;  2XHN A;  4FTS A;  1UOB A;  4H2A A;  4QHO A;  5FTT C;  1G7Y A;  2AUY A;  4MHR A;  2ZZQ A;  5EYX A;  2LM3 A;  4M01 A;  4Q4X 2;  5DZF A;  1JOD A;  2HLE A;  3EMR A;  2EVX A;  1NCR C;  4MHU A;  2QFE A;  1XNT A;  4CE8 A;  3MLL A;  2HWF 1;  5I0R A;  2E51 A;  1ZA4 A;  1US2 A;  2YHJ A;  4CUG A;  3THC A;  1HB3 A;  1XNC A;  2W46 A;  1RUH 2;  2A6Y A;  2XGX A;  1EV1 3;  1J83 A;  4R8H A;  3CLP A;  4W4Z A;  4R4X A;  4E2Q A;  4FPC A;  3TAY A;  1DZR A;  3VBF B;  4TZD A;  2ID4 A;  5JXJ A;  4IND A;  1YXW A;  2VTX J;  3ELN A;  2YB7 A;  3M70 A;  2DVB A;  1WUV A;  1SBE A;  4BZ4 A;  2R04 3;  3WVJ A;  4JV4 A;  1H8V A;  1L3J A;  2IVJ A;  4OLL A;  4GJY A;  1QY4 A;  3ZR5 A;  4CCD A;  4DUV A;  2DVA A;  4L97 A;  1W6O A;  1ND2 A;  2V09 A;  5LBC A;  3WCR A;  3VD7 A;  2WQZ C;  3CF6 E;  4XPV A;  5J96 B;  3EXU A;  4H7L A;  1A6C A;  4RHV 3;  4FXK B;  1XQN A;  4OHY A;  4EWA A;  3CJI B;  1MAC A;  3SCG A;  4MGQ A;  1KGY A;  1DGW A;  1UIK A;  2BNO A;  4IXL A;  4NHK A;  4PLM A;  5DPN A;  1I1E A;  1QXP A;  3KS7 A;  2BJS A;  1V6J A;  1PZ8 A;  1DLC A;  3SXW A;  3GAL A;  3C8X A;  3KLS A;  2D97 A;  4ZU4 A;  2Y6F A;  4GH4 B;  4K21 A;  1T6B X;  1J3R A;  2GN7 A;  4QHZ A;  4Q4X 3;  2Z42 A;  1LGB A;  5DUV A;  2D6N A;  3KF5 A;  5FYB A;  4IV1 A;  1VBA 2;  3W58 A;  4AK3 A;  3OPZ A;  2BQP A;  4AL9 A;  3BTX A;  3LOB A;  2ZTN A;  1ZM1 A;  4ZU7 A;  5FR3 A;  2OPW A;  4CDU A;  4YW6 A;  1F31 A;  2JG9 B;  4EJR A;  1NT0 A;  4YVS C;  3I54 A;  5EJ1 B;  3ZDS A;  1XNA A;  2GH8 A;  3V64 A;  2ZBJ A;  5ANN A;  5LK5 A;  3FHA A;  1Q8O A;  4XDP A;  4XZU G;  3MBW A;  2BNN A;  2VU9 A;  1GMM A;  3U78 A;  3M3Q A;  4KWJ A;  5CKN A;  3SC7 X;  1ZZ9 A;  1S0D A;  3WUC A;  3WNK A;  3RG0 A;  1OH4 A;  4NUB A;  2OW4 A;  3MFA A;  1TQ5 A;  4MXW B;  1YJK A;  1Z7S 3;  3KHC A;  2WNO A;  1L7L A;  1NY7 1;  3A4U A;  3KQR A;  3I2J A;  2PXJ A;  3DXT A;  5JI7 A;  4DXS A;  3VD4 A;  2BWA A;  5GLZ A;  1R08 1;  5HCA A;  4EWD A;  3ZXJ A;  5ABJ C;  5CYY A;  3O1R A;  1RUI 2;  2BRT A;  1WW5 A;  4HK8 A;  4Y4Y A;  2QVS B;  1OUR A;  1QHD A;  3SIT A;  3WOG A;  4A42 A;  1G86 A;  4COW A;  3I8T A;  2EIE A;  3OTF A;  4CEY C;  4I2O A;  1SDW A;  2XL7 A;  1GNY A;  3HD8 B;  4CDQ C;  1WMD A;  4MAD A;  2VQT A;  2ENR A;  3MI8 A;  5DDJ 2;  5FCC A;  5C8C A;  1C1L A;  1QJX 2;  1YI7 A;  2JDA A;  2CYF A;  5FPL A;  2JDZ A;  4GB3 3;  5FZB A;  2VCM A;  3A0K A;  4K8R B;  5DAX A;  2VZU A;  2XB6 C;  1DYP A;  3KF3 A;  1ND2 C;  5J98 B;  5F5Q A;  1LGC A;  2D6O X;  3C7G A;  3WF1 A;  5C4W A;  4Y1Z A;  4JDM A;  5CEH A;  4IV3 B;  2BVB A;  4I3G A;  2Z79 A;  3AB0 A;  2JG8 A;  2VJX A;  2WWU A;  4AOC A;  4HVQ A;  1V70 A;  3BOD A;  3O5S A;  1STM A;  4KNC A;  1N3O A;  5FYM A;  1AR8 2;  1B35 B;  1AL2 2;  1JZ4 A;  4QPI A;  1WMF A;  1RUG 2;  3AYC A;  3N9N A;  5J7M A;  1HQN A;  1NOV A;  3VKN A;  4V1P A;  5EJ3 A;  4QQL A;  2H6B A;  4J1X A;  5FY5 A;  1GWK A;  4WVW A;  2P2K A;  2AGS A;  4XIK A;  4Z07 A;  1MS0 A;  1XND A;  4XUT A;  5L7O C;  3CU7 A;  1W8W A;  3WV6 A;  1LNS A;  1AR6 2;  4YW1 A;  3PIG A;  2OS2 A;  5I0U A;  1RUI 3;  4CP9 A;  4AVS A;  4CU7 A;  5FYT A;  5GZD A;  3B93 A;  3PHM A;  3H8X A;  5DZE A;  1C28 A;  1CVN A;  1LEN A;  4W6Y A;  1O5L A;  2GC3 A;  4OHX A;  2EID A;  1PK6 A;  4GJZ A;  3VBU C;  4XAE A;  1PGS A;  4PT6 A;  2D98 A;  4FPH A;  2WO2 A;  1J3P A;  4YM0 A;  5DDJ 3;  5LBE A;  1UY4 A;  1QJX 3;  4LUM A;  4UF0 A;  4IEV A;  4RS5 A;  4ZXE A;  2R32 A;  4NPL A;  5BV6 A;  4A4A A;  2WKK A;  1F2N A;  4XJZ A;  1VRB A;  2XQX A;  5SV8 A;  4M4R A;  3VZN A;  4D6S A;  2VZT A;  3OBT A;  2FD8 A;  4YGC A;  2XJP A;  4EE2 A;  5DG2 A;  4Q4Y 3;  1REE A;  4WM7 B;  1S4C A;  4AQT A;  4OZX A;  4D6R A;  1W6P A;  2CL2 A;  4LLF A;  1GZW A;  2BV4 A;  2EXK A;  1LR5 A;  3ZPY A;  1XB9 A;  4LBQ B;  5FV3 A;  2WNU B;  1AL2 3;  1S2B A;  3U10 A;  5K9Y A;  1CWP A;  1O7F A;  1YQC A;  5CNA A;  5L9V A;  3OGR A;  4XUO A;  3T3Y A;  4QGL A;  4P9I A;  2WAA A;  1CN1 A;  3IIA A;  1OA2 A;  3O0X A;  4JHZ A;  5F5C A;  2O1Q A;  2R06 1;  5ACA 1;  4AI8 A;  1JZ5 A;  1SZB A;  2PTM A;  2Y34 A;  5G04 L;  1AR6 3;  2WYS A;  4HKO A;  4IES A;  2Y60 A;  2Q8O A;  2YUE A;  4IE7 A;  3APB A;  2A5Z A;  3VUO A;  3AXD A;  3GBF A;  4HOO A;  3JXS A;  3ETQ A;  4LIV A;  3SMH A;  5LCW L;  3W20 A;  4OUM A;  1PNG A;  2VTF A;  3VBS B;  2W39 A;  4ITC A;  3LIG A;  5JUV A;  1YYN A;  2PMW B;  2YC0 A;  1W0O A;  5D8A A;  5DN2 A;  5IW0 A;  3RZZ A;  5C3O A;  1W05 A;  5HV0 A;  2ZGK A;  2DFC A;  3WP4 A;  3A23 A;  4RL7 A;  1TE1 B;  3DPR C;  2XBO 1;  2ZOE B;  4RGK A;  4A6O A;  3WD5 A;  4CP2 A;  4MV2 A;  3IMN A;  3B9C A;  4AXO A;  3LDR A;  4GMP 3;  3H0O A;  1POV 3;  4QPI C;  3WQB A;  2Z4F A;  1KFX L;  3IWZ A;  3SH5 A;  4CU8 A;  4N53 A;  1S0F A;  1S0J A;  1ZZB A;  4BIS A;  5CKQ A;  1OPM A;  5B2G B;  2ARX A;  1SFN A;  1UXZ A;  1YNA A;  1H2K A;  5FY9 A;  2BYV E;  4KU8 A;  5FZC A;  4TTG A;  1O3S A;  1C8N A;  1O59 A;  2TBV A;  2VMG A;  1A8D A;  1NYW A;  4CCJ A;  4Q0P A;  4CCE A;  5G05 L;  2J1R A;  3OJB A;  1J59 A;  3IB3 A;  3E97 A;  5A3W A;  3I49 A;  4RR3 C;  3PMS A;  1V9U 1;  4Y22 A;  1OVP A;  3KT1 A;  1JU3 A;  2H0V A;  4LUK A;  1W8Z A;  4XW3 A;  2NMN A;  2FCU A;  1O91 A;  4YYO A;  4YZ1 A;  4FTE A;  2UU8 A;  1RVF 1;  1BMV 2;  2PHF A;  3M2M A;  5FYS A;  5GZC A;  2VUD A;  2NYY A;  2Q1Z B;  4N90 A;  4A7K A;  3QOP A;  4QXH A;  1QQP 2;  2GC0 A;  2R7E B;  4ZS2 A;  2WNV B;  1OLM A;  4RGG A;  2EAL A;  2W47 A;  3WW4 A;  4B7K A;  1QJY 2;  5D2A A;  1JN2 P;  3EYP A;  2AAC A;  2G1M A;  5L36 A;  3ZYI B;  4AAX A;  3BU0 A;  1H6Y A;  2O8Q A;  1F4A A;  2WSV A;  5FY4 A;  1GBG A;  3R05 A;  5DZG A;  5FPZ A;  3T0A A;  2W91 A;  4BQX A;  4TSV A;  3NAP B;  2QKD A;  1WA6 X;  3DN7 A;  2D5F A;  2R49 A;  4Q4V 1;  1JYI A;  4ASM B;  4N43 C;  2HWE 3;  3FLT A;  2ARC A;  3W59 A;  1N3P A;  2OT7 A;  2FQP A;  1H4G A;  2PHL A;  4ARX A;  4D94 A;  2P5B A;  4EN7 B;  4YW3 A;  5FP4 A;  1OSG A;  4G9S B;  4AR2 A;  1IS6 A;  1RHI 1;  2QQI A;  1OFN A;  2XUE A;  1KQR A;  1BBT 2;  4MXV A;  2W2I A;  4AI9 A;  5A33 B;  1ZVF A;  3CJI A;  1LOE A;  4LE4 A;  4YFZ A;  2JIJ A;  2QTW B;  2ZGT A;  1GP5 A;  4FVV A;  3RGB A;  5FMC A;  4JDN A;  1GFF 2;  5F39 A;  2YC4 A;  1IS5 A;  3VV1 A;  3LGR A;  4XFA A;  2VGD A;  1YLL A;  4GH4 A;  4TN7 A;  3RPQ A;  4AYU A;  4FPG A;  3ZXD A;  2RS5 2;  3URF A;  4FO9 A;  5FXV A;  2YFU A;  4EWE A;  1W2U A;  4XHX A;  2AEY A;  5T5J A;  5T3N A;  3TN9 2;  2EA7 A;  3PVE A;  1ALY A;  3D0J A;  1RYY A;  2K9Z A;  2R1B A;  5EP9 A;  4XFF A;  2B39 A;  3T4H B;  3WW3 A;  1WBL A;  1AJK A;  1YHF A;  5FXZ A;  5LB6 A;  2XJQ A;  1QJY 3;  2OZJ A;  1PO1 1;  1SLA A;  3LIH A;  3ZFG B;  4QU1 A;  1PMH X;  3UNP A;  3CQO A;  2VM9 A;  5GAL A;  4ZXK A;  4QX2 A;  2JG9 A;  4S2D A;  1BEV 3;  3ZYR A;  3JBG 2;  1VMF A;  2XUM A;  3PTR B;  4AED C;  1Q8V A;  1VBB 1;  3PUA A;  4XMI A;  1GR3 A;  4DFS A;  1FAY A;  2YDE A;  1VBC 1;  1MZ6 A;  2R07 2;  3AX4 A;  4L11 A;  3ZN4 A;  5JSR A;  1ZX5 A;  2VBP A;  4P9L A;  5TSW A;  4XUP A;  4XDQ A;  4C91 A;  3DKQ A;  2WYF A;  3HOB A;  4MXW A;  1MS1 A;  4FP3 A;  1WCU A;  4AFM A;  4JRL A;  1XJA A;  1BBT 3;  2XOM A;  4HKW A;  4ARY A;  5CA6 A;  4FPY A;  1MZF A;  1DYK A;  4H7M A;  3PJY A;  4JGY B;  4AGV A;  5LA0 A;  1O4T A;  2RJ2 A;  3OD0 A;  1I9R A;  4QQO A;  5IFT A;  3KT4 A;  2Y0O A;  3KV6 A;  5LBB A;  3WUD A;  1N3Q A;  1RUD 2;  3RRD A;  2MEV 2;  1JS9 A;  4HPK B;  2YZ4 A;  4NN0 A;  2RR1 3;  2RS5 3;  2DUO A;  2IC1 A;  3HAG A;  3TN9 3;  5IK4 A;  3AYD A;  1RUN A;  1LU2 A;  2Y33 A;  3VBH B;  3X29 B;  1CAV B;  2VW1 A;  3BIW E;  2GP5 A;  3GM8 A;  1CZV A;  2IUW A;  3H3U A;  3THT A;  5A1L A;  1EPZ A;  2EXH A;  1HV0 A;  4YRD A;  3T09 A;  3WNM A;  5FPV A;  3SKV A;  3ILF A;  3LE0 A;  3PVO A;  3VKF C;  2ZS6 B;  5CVR A;  3MUY 1;  4AVT A;  3DCQ A;  4LOR A;  3WW2 A;  5IVB A;  2YU2 A;  2RM2 1;  5FP8 A;  3UYJ A;  3JBG 3;  2E26 A;  5T55 A;  2VNO A;  4ZHN A;  1D2Q A;  2R07 3;  4B7E A;  3AZW A;  1ZYB A;  1GWM A;  3Q8A A;  2RV9 A;  1B35 A;  5F2W A;  1AYM 2;  2VOX A;  1PO2 2;  2NPI A;  1U0A A;  1MEC 3;  3FWE A;  1DG6 A;  4CCN A;  5F1R A;  4I01 A;  1GP4 A;  5A7W B;  4AED A;  4DY5 A;  1QDO A;  1A34 A;  4L2N A;  4D8M A;  1UKR A;  4AI0 A;  4IE6 A;  3OUH A;  2JDP A;  4BB3 A;  5A3U A;  1QXR A;  1HN0 A;  1ULC A;  3B02 A;  4SLI A;  3TNQ A;  2WN3 A;  2Q1M A;  1N1S A;  3VBR B;  4Z1V A;  2PHW A;  3IMM A;  4PQQ A;  1S0C A;  4DPN A;  1ZRI A;  4XXP A;  4Y26 A;  1ULF A;  4LHL A;  3NW4 A;  1XOY A;  2P4E A;  3LEG A;  3AYE A;  1S55 A;  2D6L X;  4HK9 A;  1VAL A;  4AZZ A;  4QX1 A;  3LZZ A;  4A3X A;  3TNP B;  5HXM A;  3N9M A;  5I91 A;  4MLO A;  4PHZ A;  3MF9 A;  3ZXG A;  1IS3 A;  4Q1R A;  1YRZ A;  2WLP A;  2VE1 A;  2C6S A;  3NJZ A;  1W6M B;  3VD5 A;  1TMF 1;  4XJU A;  4R9B A;  5A1A A;  2JE8 A;  2JB4 A;  1OA4 A;  2D5H A;  2NZ9 A;  1POQ A;  1GUI A;  3Q8B A;  4QQH A;  2I2S A;  2YU1 A;  3BUC A;  3LFM A;  4CCC A;  2QQO A;  4RFR B;  4OUL A;  1NQD A;  3ECQ A;  4ASL A;  5BNP B;  1RUO A;  1COV 2;  3AFK A;  4MGK E;  4MET A;  4WM7 A;  1K3I A;  2ZPX A;  1NA1 C;  3CO2 A;  3VDD C;  1ZBE 1;  4AQ2 A;  1WLT A;  3T4V A;  3FHI B;  3UET A;  1UYY A;  2J42 A;  2WNU A;  2HBU A;  4PIX A;  3UGH A;  1QJZ A;  1GNZ A;  4HVR A;  1A3K A;  2QNK A;  4FFI A;  2Y64 A;  5DUU A;  4AG4 A;  2QDR A;  2QQN A;  2B4K A;  1XRU A;  2YBK A;  3H7Y A;  4BCU A;  4LT5 A;  3MW3 A;  3ATG A;  2ZEW A;  2XXZ A;  3FLR A;  1NE6 A;  4UFH A;  2XWJ B;  4HKL A;  3SKJ E;  3WY6 A;  2YYO A;  4O7X A;  1G9D A;  2JEM A;  2JEC A;  1U5I A;  2W1W A;  3O12 A;  1FMD 1;  4CEW B;  1LAJ A;  3E6B A;  3H1M A;  5BNN A;  2BW8 A;  4IE5 A;  1JYX A;  1KRI A;  1AL0 G;  4IGO A;  3J8F 1;  3VBS A;  4URT A;  5CU1 A;  2UWB A;  2QQV A;  2PFW A;  2VOW A;  3OCP A;  1Q56 A;  3N9O A;  1HDK A;  2Y6K A;  5IVE A;  3Q8E A;  2PLV 1;  1U5Y A;  1H1M A;  3IDA A;  3MUZ 1;  3SEE A;  1BZW A;  2X5I A;  2XHK A;  3HWJ A;  4YG3 A;  3OSD A;  1F35 A;  2DCK A;  1RUE 2;  2GSY A;  3ACH A;  2E53 A;  1OHF A;  3OPT A;  4UYB A;  2E32 A;  5LEK A;  3I2H A;  2ZGN A;  5E8A A;  5T5O A;  3III A;  4M3C F;  4YVW C;  4NJ4 A;  4Y33 A;  2LRO A;  4NVP A;  5AC9 1;  1UYP A;  4EN8 B;  4OVE A;  5FP9 A;  2XJT A;  4KGG A;  4AGR A;  1OOP C;  3TB0 A;  4ZZ5 A;  4L8Q A;  5C9A B;  4HSJ A;  2VCB A;  5K0U B;  4FPL A;  1UZY A;  4MGT A;  4NE9 A;  2IFW A;  2J1T A;  3AK0 A;  1QWR A;  3BPZ A;  1T2X A;  1X8M A;  1ZZ6 A;  2D3R A;  4GD4 A;  3C7H A;  3ZYJ B;  2DVF A;  2ET1 A;  4JCK A;  1HV1 A;  2WRA A;  3IBM A;  3GZE A;  1ZZ8 A;  3FFQ A;  3T30 A;  4A6S A;  1AX1 A;  5DQ0 A;  2XVG A;  3N9Q A;  4LXL A;  3U11 A;  4CPB A;  1DBN A;  4PDW A;  4C0B A;  5A7N A;  3VKO A;  3NO8 A;  4PF5 A;  3ZLI A;  4CDW B;  2GND A;  5E16 A;  4QAW A;  3ZN6 B;  1WME A;  2EIB A;  1MS3 A;  2QQM A;  2WNV A;  1GSL A;  4UOJ A;  1Q3E A;  5JZG C;  2RS1 2;  4CSW A;  1WCK A;  2XKP A;  1QJU 2;  2YV8 A;  4XJA A;  2JX9 A;  5IFP A;  3S6P A;  2JE7 A;  1EUT A;  1PVX A;  1RUE 3;  3N36 A;  1J1L A;  1IPJ A;  5EQU A;  5C5T A;  3ZYB A;  2XLG A;  4E4D X;  1Y4W A;  4FOQ A;  4BLJ A;  5I8Y A;  4XFC A;  5KHK A;  4L0P A;  4UAP A;  1PM7 A;  4BH9 A;  2DU1 A;  5FP7 A;  2B7Y A;  2CNA A;  5KWR A;  2LAL A;  3VBO C;  3OY8 B;  3GBW A;  2FMD A;  1EPW A;  3D8C A;  3FE5 A;  5C7G A;  3C2U A;  4IEX A;  4XF1 A;  1D7P M;  5BNN C;  5A33 A;  5JVV A;  2FDJ A;  2MPF A;  4HT1 T;  1OT5 A;  3VD9 A;  4N7U A;  2ZGL A;  4D6Q A;  3NJX A;  2ZGQ A;  4ES9 A;  1UX7 A;  3GBG A;  1H1A A;  4JGZ A;  1PGW 1;  1PIV 2;  1E5S A;  1W2O A;  3RZL A;  3UGG A;  4R4Z A;  3NKG A;  3P1I A;  1JYN A;  4AFD A;  2C9A A;  4CZS A;  2QQJ A;  1FPN 2;  2GAU A;  4LO5 B;  4WV8 A;  4E2S A;  2A71 A;  4OHW A;  1RXG A;  4LIT A;  4W6W A;  3RZK A;  1JZ3 A;  2NP0 A;  1QU0 A;  1TNR A;  3S5Q A;  2W0X A;  3WLU A;  4ZZ8 A;  5JWP A;  1ULG A;  5FY0 A;  4OI1 A;  1IPS A;  2BGC A;  3VHP A;  1W2N A;  3WG2 A;  1VBE 2;  2J1S A;  3UL2 A;  4QM9 A;  1XXN A;  4DY3 A;  4XAC A;  1URX A;  1FOD 2;  2F4L A;  2YGL A;  1RUF 2;  3D4K A;  5H9S A;  2ZGR A;  3ZFG A;  1RXF A;  2RS1 3;  4NRO A;  1BK1 A;  1QJU 3;  3E1F 1;  4P02 B;  2VH9 A;  1RMU 2;  1GQP A;  4QX5 A;  1EV1 1;  1MQT B;  1H0B A;  5K8S A;  5E6H A;  3NV1 A;  1OUS A;  4UBH A;  4XIO A;  3F95 A;  1HXS 2;  2OZ6 A;  3G6J B;  4DEV A;  5F3E A;  1GAN A;  3LWC A;  4C90 A;  3FBY A;  1D0H A;  1CZS A;  3POI A;  4YW4 A;  1QMJ A;  2O8O A;  5FZO A;  1JZ7 A;  3N3H A;  1J3Q A;  5L19 A;  3IDE A;  4D7T A;  1W2A X;  4QKN A;  2IXK A;  4HN1 A;  2K0G A;  4RGA A;  4XQW A;  3TOJ A;  2R04 1;  3MW4 A;  5KXD A;  2P3J A;  3BOP A;  4PDW C;  5FZ6 A;  4AHZ A;  3SNM A;  2IXI A;  4LR4 A;  4NHL A;  2VZP A;  1V6O A;  2PN5 A;  4XVH A;  4BWO A;  1UZV A;  2B9V A;  2DF7 A;  2VOT A;  5F6K A;  1JI6 A;  4FAG A;  1OC1 A;  4JGY A;  5CIS A;  4LK6 A;  2HJI A;  3LOI A;  3VZL A;  3WIN E;  2CGP A;  1JOJ A;  4RHV 1;  2Q8C A;  4CDX A;  5A3N A;  2HWD 2;  4QGN A;  3D82 A;  2WS9 2;  3JD7 2;  3POG A;  2XKO A;  3TRS B;  2Y0I A;  3WNX A;  1AR7 2;  1H9W A;  2Y38 A;  1NKG A;  4HPK A;  2EIG A;  2YFZ A;  2N7G A;  5FUN A;  4DMI A;  1OLQ A;  3LPG A;  2LW8 A;  5IK5 A;  4LMF A;  4YZ2 A;  3VBH A;  4Q1P A;  2DVD A;  2WII B;  4Q2F A;  3K77 A;  3WZ1 A;  3CBN A;  1NE4 A;  5CZK A;  3HPN A;  5A6X A;  4Q4X 1;  1IGO A;  4P08 A;  4YFW A;  1UWW A;  4AFC A;  1I5Z A;  3T2T A;  3AKR A;  3SEP A;  1RMU 3;  1GU3 A;  1DIW A;  2DUR A;  4HXC A;  3VHO A;  3BN6 A;  1DGR A;  5C3R A;  2PHU A;  4YW5 A;  3GZU C;  1OVS A;  4HSL A;  5FRE A;  3I2O A;  1CIW A;  3BOW A;  1IG0 A;  4JGZ C;  4NIG A;  1PGL 2;  1REF A;  3OBA A;  2SBA A;  1U5X A;  2VXR A;  3B94 A;  2VAU A;  3TBD A;  5CBL A;  5EIY B;  3GJA A;  3KGZ A;  2YMZ A;  5FK8 A;  3H8U A;  3M3C A;  1ZBA 3;  3CEW A;  3N9L A;  2IVI B;  1VBD 2;  5GZG A;  2ZEY A;  4QQ2 A;  2CSG A;  5FZF A;  4ORF A;  1ULO A;  4GWJ A;  2CDP A;  3VBR A;  5IVC A;  1K5M C;  2AYH A;  1Z7S 1;  2I74 A;  1BQP A;  4IGP A;  2HWF 2;  1M4W A;  4M3C E;  1LHN A;  1SAC A;  1MR5 A;  1Y3T A;  2ETE A;  4LHN A;  2RDR A;  3KCX A;  4GMP 0;  2SLI A;  2CDO A;  1DQ1 A;  4LO4 B;  3WQ7 A;  3MHZ A;  3POJ A;  2JXA A;  4K8F A;  4PCR A;  2BDR A;  4AI2 A;  5KXB A;  2BNM A;  4BQ4 A;  4BIF A;  1AX2 A;  4BM8 A;  4BJ0 A;  1W6M A;  2R0H A;  3K4A A;  3PTY A;  1QGL A;  3CJX A;  1BK0 A;  2VNV A;  4FAH A;  5DXD A;  4A3Z A;  2QQL A;  3O1V A;  5CFC A;  4AE2 A;  5BNP A;  4GB3 1;  2BEO A;  2Y6L A;  1F8V A;  4YNI A;  3MEP A;  1W6N B;  4XQ4 A;  2ERF A;  1JUI A;  1RUH 3;  2PQQ A;  4XF9 A;  2WO7 A;  3BTY A;  4L92 A;  3CZU A;  4HL0 A;  2RMU 2;  2PHR A;  4QB2 A;  3USS A;  2D43 A;  3RJR A;  3ASI A;  4EZH A;  4CDX C;  4I3P A;  3U4S A;  3AZZ A;  3ZO0 B;  4LJH A;  1X36 A;  1PM4 A;  1VIW B;  1GNH A;  1FT9 A;  1VBD 3;  3UES A;  2VMC A;  3JU9 A;  3R4U A;  5LBF A;  4OI4 A;  2OXB A;  1ND3 C;  1HKD A;  1FYU A;  1U12 A;  2W1S A;  4CEW A;  2VC9 A;  4H55 A;  3IM0 A;  3QLQ A;  2E31 A;  4DOU A;  1QNY A;  1SLC A;  3MIE A;  1KJL A;  2BBV A;  2HWF 3;  2KR2 A;  1WW6 A;  3H1Y A;  3FFZ A;  2HYX A;  5FFO C;  4FFF A;  4XE9 A;  4DXZ A;  4AFB A;  1MS4 A;  4D7Y A;  4B3N A;  3J7H A;  4G4F A;  1LOC A;  4HFS A;  3ZFE B;  3FBM A;  5FOB B;  3O14 A;  1S0G A;  2D6M A;  4GWM A;  3OGJ A;  3VDA A;  3HNB M;  1TVG A;  2QCS B;  4IEO A;  4N7I A;  4QXC A;  2RHP A;  4W8J A;  4NIA A;  5C5U A;  3RS6 A;  4G3Y C;  1GKB A;  2WFF 1;  4IGQ A;  1MZE A;  4EQV A;  2JEN A;  5M0T A;  4NHM A;  3VHR A;  2ZML A;  5DDJ 1;  3N4M A;  1HQL A;  1VBA 3;  4PQ9 A;  3O1T A;  1QJX 1;  4QX3 A;  4Z2A A;  2D7F A;  5KC6 A;  4UFJ A;  5A7P A;  4K3U A;  3ZXF A;  1XNK A;  3OOX A;  4QPG B;  5C9A A;  5BNO B;  5K0U A;  1NY7 2;  2CY6 A;  2RMU 3;  4K1Z A;  2J1U A;  3PME A;  3WQ1 A;  1JH5 A;  5KR7 A;  4M4P A;  4Q4Y 1;  3ZFF A;  2W5F A;  2W3J A;  4I09 A;  3CNA A;  1VB2 A;  3DUI A;  3ME2 A;  1OF4 A;  4HLT A;  1DQ0 A;  1OUX A;  3QCW A;  2WN2 A;  2VZQ A;  4NHY A;  2WFP A;  1APN A;  3HQX A;  2R0F A;  1DCS A;  4X6R B;  3H1W A;  1G8W A;  3VGI A;  1SLB A;  2QQP A;  4U36 A;  5E1R A;  4CDW A;  2RDS A;  2VZ3 A;  3ZN6 A;  1X9P A;  2ZCW A;  3B7M A;  2JKB A;  1ODM A;  2W94 A;  2X8K A;  4IV1 C;  5DG1 A;  5CFC C;  4NAM A;  3W5M A;  1XNB A;  4IW3 A;  1IG3 A;  3IAP A;  3WXP A;  1SBF A;  4E4H A;  2VVF A;  4B4Q A;  1V0A A;  1VAK A;  3WF3 A;  1W8F A;  5A32 B;  1C57 A;  4YM1 A;  2CU5 A;  2GNT A;  2A1X A;  1CZT A;  4GQ7 A;  3PUS A;  2GMM A;  4CDU C;  2VY0 A;  4AF9 A;  4UWD A;  1CJP A;  2X29 A;  1UN1 A;  4CPB D;  3ZYG A;  1LCL A;  1W28 A;  2D6K A;  2PHT A;  4E8C A;  4GMP 1;  5FZ4 A;  1B09 A;  2RVA A;  1M06 G;  3OY8 A;  1YC6 1;  5GLW A;  1UMI A;  3USU A;  2BUK A;  4YG6 A;  2OKX A;  5FZD A;  2FDI A;  1SG3 A;  1H8T B;  3UJO A;  2VCA A;  1SFP A;  4GZ9 A;  1I6X A;  1XE8 A;  1VLN A;  5LAT A;  2VME A;  4AVV A;  4Y5S A;  3OEB A;  4S2H A;  5CFD A;  2WQ4 A;  5EFU A;  4GKX A;  2I07 B;  4RYD A;  1OQD A;  5F3G A;  1S1A A;  3BCW A;  1VAM A;  1HW5 A;  5GZE A;  1QOS A;  4NPR A;  3T0B A;  3ORJ A;  1AR8 3;  5J09 A;  1RUG 3;  1ST8 A;  2DFB A;  2WT0 A;  4IL7 A;  5FZI A;  4MYE A;  5BXX A;  5KC5 A;  2IXL A;  5EV7 A;  1O3R A;  3U4X A;  1CAX B;  2DUQ A;  5GLV A;  1UU4 A;  1QOT A;  1YIP A;  2W9X A;  1R1A 2;  3BB6 A;  2A6V A;  5F8P A;  3MID A;  5K4L A;  3U14 A;  1F9K A;  4S2F A;  1DF0 A;  4IEW A;  3WDX A;  4AVB A;  3IPV B;  2RJL A;  4ATF A;  5C8C C;  1OBN A;  3GJB A;  3KT7 A;  3JB4 C;  3N7J A;  4N9H A;  4CVU A;  1UY3 A;  5E89 A;  2E6V A;  5CB7 A;  2ZGS A;  1QXJ A;  5FLH A;  3V0A B;  1LB2 A;  3FN9 A;  1YEW A;  1A78 A;  1MQT A;  3ZSL A;  3AKS A;  4LK7 A;  4ZU5 A;  2GDF A;  3AYA A;  3R0R A;  4KU7 A;  4AAP A;  4XFH A;  3ZFF C;  5C4W C;  3AP4 A;  4JKL A;  4AGG A;  4E4Z A;  2Q8D A;  2X09 A;  1NXD 1;  1XSR A;  3RVH A;  2JG8 C;  4RN5 A;  1UKG A;  2FZ2 A;  3R4D B;  1WW4 A;  2VXJ A;  5FXX A;  1BVV A;  1HJG A;  2GC1 A;  4NPM A;  5AFE A;  4XFG A;  5SV5 A;  2HWE 1;  3D5O A;  5ACA 2;  4PJY A;  3PDQ A;  1YFY A;  4AWD A;  1N1Y A;  3OD4 A;  3SIS A;  3I4I A;  5EJZ B;  4LBK A;  3GGL A;  4DEQ A;  2E7Q A;  2HKX A;  1LGN A;  3ZN5 A;  4YGE A;  2KXL A;  3OPW A;  2HYK A;  1NCQ B;  5FZ9 A;  3RYK A;  1RUJ 1;  3P3N A;  3RMX A;  1SDD B;  2UYB A;  1UD1 A;  4CUA A;  5IK7 A;  3SCH A;  3DYO A;  3V56 A;  5FIX A;  5FJK A;  2G9F A;  3UK9 A;  1PZ9 A;  3RFR A;  2FDH A;  3KCC A;  3I2I A;  3NV3 A;  4BHP A;  1UAI A;  2XBO 2;  2V5D A;  3VB9 A;  2WO1 A;  2D44 A;  2XML A;  1R1A 3;  4IET A;  2WZE A;  4XHB A;  1PK6 C;  3WDU A;  4Y20 B;  1G9B A;  1DLL A;  2KM2 A;  3J7N A;  4FOY A;  1SCS A;  2P3K A;  3ZIX A;  1N1T A;  4RS5 C;  3A22 A;  1Y9Q A;  4D69 A;  1T6G C;  1JZ6 A;  5FJH A;  4OHZ A;  2RS3 1;  2DTY A;  3ZXA C;  2DCT A;  1LRH A;  2J7M A;  3WR0 A;  1FNZ A;  1O4Z A;  2LRP A;  1BEV 1;  2CWM A;  2VZR A;  1OF3 A;  5LEJ A;  2QQK A;  4TLF A;  1WLW A;  1D4V B;  5APA A;  3GNE A;  2A3W A;  4M3C B;  3M3O A;  2CAV A;  3VBF A;  4R9C A;  1FX5 A;  1GOH A;  2BU9 A;  4L99 A;  3Q8C A;  3ZXE A;  1AYN 2;  2G19 A;  4Q8L A;  3MV1 1;  4FFG A;  3ZKY A;  2QZ3 A;  4WM8 B;  1PVC 2;  1ZRE A;  4IQP A;  3AVR A;  2DCZ A;  1RVF 2;  2IXH A;  3IT8 A;  1K12 A;  4UXA A;  3A7Q A;  1ENQ A;  1MS9 A;  5EYY A;  3HIF A;  5I8S A;  1BBT 1;  1X82 A;  1ZRC A;  3KB5 A;  1OD5 A;  1OQE A;  1UQX A;  1G6N A;  4X8N A;  2V4A A;  4RQP B;  5JSP A;  2EIC A;  4MGY E;  1UCX A;  2OII A;  4AQ6 A;  1A8M A;  3VZK A;  1YQ6 A;  3LEK A;  1NLQ A;  3F2Z A;  5HCB A;  2FHR A;  4YZ5 A;  1HRV 2;  5D8A C;  1OPO A;  4IEP A;  1C8M 2;  1G9C A;  4BXF A;  2RR1 1;  5JLV A;  2RS5 1;  3CKH A;  3MIB A;  3WDT A;  4CCO A;  3TN9 1;  4CA9 A;  1ZRF A;  1QJF A;  4Q4V 2;  1AXK A;  4PBP A;  2ILM A;  2W92 A;  4N53 C;  1QQP 3;  1FNY A;  1NCR B;  1W6N A;  4UFK A;  3RMY A;  1QF3 A;  5A3L A;  1GWL A;  3LFI A;  3I2F A;  1UZ0 A;  2XVK A;  1QKQ A;  3GHN A;  3IKW A;  4PLN A;  4LUL A;  1LOF A;  2MHF A;  1ZRR A;  2XJS A;  2WIN B;  2F17 A;  2ZA9 A;  3JB8 A;  4S2G A;  1DZT A;  1KXG A;  1AYN 3;  2VUL A;  5F2S A;  3BAL A;  1SBD A;  1MZ5 A;  1W3X A;  4GKY A;  1PVC 3;  2BFU S;  3VD3 A;  3LQC A;  1MEC 1;  3PIJ A;  2MNG A;  5FKB A;  1RVF 3;  4U2A A;  1W03 A;  5IT6 A;  4QKB A;  2VMH A;  1OH3 A;  1X8E A;  4LBJ A;  2K2S A;  3LF7 A;  4LA3 A;  1FAT A;  3W5N A;  1KDK A;  3MZH A;  2NMO A;  1CON A;  2DV9 A;  4BQ3 A;  5A6Q A;  4IEU A;  1JYV A;  3AP6 A;  3ZFE A;  1KEX A;  1V6K A;  3HT1 A;  5FZG A;  1IKP A;  1HRV 3;  1X50 A;  4YZ4 A;  1C8M 3;  2DDU A;  5LY2 A;  1VBB 2;  2J1A A;  1VBC 2;  5A3M A;  3RDI A;  3OG2 A;  4C8D A;  1ENX A;  4Y1X A;  1RUC 2;  2XLF A;  3VBF C;  4Q4V 3;  3NRU A;  2HWC 2;  2YG0 A;  2JKX A;  3IZO A;  1ZZC A;  4XXA A;  1RB8 G;  1EUU A;  1R1Z A;  2VOK A;  4J6G A;  4LBL A;  4IE0 A;  4QPG A;  1AVB A;  4P9Y A;  2OYZ A;  5BNO A;  2VPV A;  1H2N A;  1LUL A;  5C3Q A;  5JMC A;  1QDC A;  4FXG B;  3T0D A;  3U0Z A;  3SH4 A;  4LE3 A;  3CJI C;  2NM1 A;  4IV3 A;  2WL1 A;  2ZAH A;  1HB2 A;  1MPX A;  4YVS B;  5FO9 B;  1UO9 A;  2WAO A;  3OYW B;  3POS A;  4K1Y A;  3WP5 A;  2Q5T A;  4TLG A;  4QMA A;  1XU2 A;  1E5I A; 
#chains in the Genus database with same CATH homology
 2P1B A;  2VTX A;  1K5J A;  4CA9 A;  3T30 A;  5EHD A;  2VTX J;  4N8M A;  1XB9 A;  1XE0 A;  1NLQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...