1OA3A

Comparison of family 12 glycoside hydrolases and recruited substitutions important for thermal stability
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
218
structure length
218
Chain Sequence
ETSCDQYATFSGNGYIVSNNLWGASAGSGFGCVTSVSLNGAASWHADWQWSGGQNNVKSYQNVQINIPQKRTVNSIGSMPTTASWSYSGSDIRANVAYDLFTAANPNHVTYSGDYELMIWLGKYGDIGPIGSSQGTVNVGGQTWTLYYGYNGAMQVYSFVAQSNTTSYSGDVKNFFNYLRDNKGYNAGGQYVLSYQFGTEPFTGSGTLNVASWTASIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDO-BETA-1-4-GLUCANASE
publication title Comparison of Family 12 Glycoside Hydrolases and Recruited Substitutions Important for Thermal Stability
pubmed doi rcsb
source organism Hypocrea schweinitzii
molecule tags Hydrolase
total genus 55
structure length 218
sequence length 218
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2002-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01670 Glyco_hydro_12 Glycosyl hydrolase family 12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1oa3A00
2VGDA 1XXNA 3WQ0A 3MF6A 3RI8A 1UU4A 3AKPA 1XNBA 2DCYA 3AMNA 1H4HA 1XNKA 2DFBA 1IGOA 1AXKA 2D97A 3B7MA 5K7PA 3MFAA 4HKOA 1REEA 1HV1A 2BVVA 2D98A 4HK9A 1REFA 4S2GA 1H1AA 2JENA 1H4GA 3VL9A 1UU5A 2VG9A 3WXPA 2QZ2A 5K9YA 3WY6A 3VZKA 5EJ3A 1XNCA 1BVVA 3HD8B 1YNAA 2DCKA 3O7OA 3LGRA 2BWAA 1QH6A 1T6GC 1H8VA 1OA4A 1KS5A 2B45X 2VUJA 4XQDA 3M4FA 4S2DA 3WP4A 4XQWA 4XQ4A 3VZOA 3WX5A 3AMQA 1H0BA 2Z79A 3AMHA 3WP3A 1OA2A 4IXLA 1KS4A 3WQ1A 2NQYA 3EXUA 2VULA 1UU6A 1BK1A 1TE1B 3WP6A 4H7MA 3VZLA 3VHPA 4NPRA 3ZSEA 3AKSA 1C5IA 1F5JA 1XNDA 1ENXA 3AKQA 3VZJA 1C5HA 3LB9A 3MFCA 1OLQA 3VGIA 4HKLA 3RI9A 2NLRA 3WP5A 1M4WA 5HXVA 3AKTA 3AMMA 1XYPA 1NLRA 3VHOA 3AKRA 4S2FA 3VL8A 2C1FA 3VZMA 2B42B 2DFCA 2JEMA 4HK8A 1UKRA 3MF9A 1PVXA 4S2HA 1OA3A 3WT3A 1XYNA 1QH7A 4XPVA 3VZNA 3VHNA 1BCXA 1W2UA 1REDA 1XYOA 1OLRA 2B46X 3WQ7A 2JICA 1HV0A 1HIXA 2DCZA 3B5LB 3AMPA 2QZ3A 4HKWA 2BWCA 3VLBB 3WR0A 2DCJA 2BW8A 2F6BA
chains in the Genus database with same CATH superfamily
1VIWB 3POFA 2WNVA 3DPRB 3FZ3A 2VZSA 5BNOA 1SQ4A 3MF6A 1LTEA 3HNMA 2WQ8A 4FPLA 1WLDA 3AFGA 2D3RA 1BK0A 2IFRA 5JMOA 3CJIC 3IPVA 2VZVA 1A6CA 1H4HA 5LA1A 1FPN2 1SDWA 3X29B 4NIIA 4NAOA 5I0SA 1W2AX 3B7MA 1S0JA 3A0NA 1W8NA 5LZ6A 1XRUA 4E2SA 1UKGA 2XG3A 1W8OA 5D8AB 2BVVA 3FMGA 4MZUA 5HBAA 5FPLA 1HRV1 2DCTA 3G7DA 3GHMA 2ES3A 2ZZJA 3B94A 1UX6A 4I02A 3PUHA 1XC6A 5F3GA 4DZGA 2VMHA 4NO4A 2RDQA 1X9TA 2IXLA 2ZGKA 3OPZA 4ITCA 4FFGA 4XIOA 3FC0A 1F4HA 1JOPA 1GZCA 2GNMA 4KBBA 1KS5A 4B3NA 3UKVA 4CEYA 2B8MA 4XDOA 1ZBA3 4QKDA 3IM0A 1AR61 1V9U3 1DQ0A 1R091 1HN0A 1UMHA 3J8F3 5FY4A 2EIGA 5FMOS 3TEXA 1R1A3 1E5HA 3AK0A 3TN92 5FV3A 1NLSA 1QJU3 2NPIA 3LEKA 4JHZA 4MYEA 4RGGA 3O0WA 3IN9A 3NNMA 2YDEA 2W46A 1BK1A 4FOVA 3T2OA 4CXYA 2ARCA 1DZTA 3LSDA 4UI9L 2RDRA 5KXBA 4HOOA 1VAVA 1EUTA 4NRMA 4MLOA 1JYTA 4JQRA 4AVTA 2PLV1 1SLAA 3AKQA 4P02B 5DDJ3 1QQP3 2DUPA 4IV3C 3WDTA 2JWPA 3LFMA 1HW5A 5K0UA 4AR2A 4K6BA 3WW4A 3RZJA 1M4WA 3FWEA 5FBZA 1HB2A 3RWKX 1FPN3 3L2HA 4P9WA 4CEWA 4E4DX 2QQMA 4FSJA 3W5NA 5F5IA 4BXSV 1WLCA 1J83A 2OUHA 1XYPA 4XJZA 2Y6FA 1RC6A 2SLIA 4LT5A 5TSWA 2PHFA 1ALYA 2BV4A 3AP7A 2Y8KA 1D4VB 3KLSA 3POJA 4ZU4A 1W06A 2BVBA 1OH3A 4ONUA 5FZ6A 1AF9A 3SLIA 5C3SA 4IE0A 4AZZA 4KGQA 1W3XA 3VHRA 4UXAA 3U4XA 4AI3A 4GH4A 2G9FA 1XYNA 4JGYB 4DUWA 4FFFA 5KXCA 2RHPA 4P9IA 3SC7X 3LD8A 3NV1A 1AL21 3E97A 2ZX2A 3ON7A 1JHJA 4NPMA 2V09A 4FPCA 4PDWA 4WVZA 1JUHA 2W92A 4YSFA 1LB2A 1KDKA 1VMHA 2XVLA 2DCZA 2BGPA 1J84A 4KL1A 1CONA 4CCMA 1LOGA 1ZZBA 2JDMA 1SMVA 2Q1FA 3TN93 2J1EA 4DB5A 1E5IA 1BBT2 1WD3A 1W2OA 1YQ6A 3NAPA 4P9YA 4B4PA 5FKCA 1VRH1 4YZ4A 2CGPA 3S57A 2P3JA 3VKLA 3E5XA 5C8CA 5CKNA 3V0AA 1ZZ8A 2ZGSA 4X8PA 3FL7A 5IK5A 3AYCA 5FY8A 1LOEA 3H1MA 2W94A 2DBIA 2EVXA 3HNBM 4W50A 2W5FA 3ETQA 3BOPA 1PK6A 2GP3A 2UY9A 4CDXB 2OZJA 4YGBA 1C1LA 2GDFA 3OEAA 3ZOIA 1WW5A 2QCSB 3WNNA 5LRSA 3J7NA 5IK8A 1C8M1 1ULFA 4OHXA 5IFTA 5FYYA 4AAXA 1HRV2 5G05L 3V65A 3IB3A 4YNIA 5JMCA 3CZUA 4HETA 2IZWA 5I8YA 1LNSA 4YG6A 2VUJA 4RSUA 3WUCA 2HWD1 1RUE1 1QGLA 4FP2A 5F5CA 1JXNA 2NYYA 2BFUL 2R043 4EN7B 1CIWA 4CZSA 4L2NA 3PVNA 1ZBE1 4P14A 4QM9A 2Z4FA 5H9RA 5A7OA 2VE1A 4NVPA 3B01A 2GMMA 2RM21 1S0GA 3WP3A 1OD3A 4IXLA 5C70A 3WQ1A 4JDOA 2IFWA 1Z0HA 5A32B 1AR62 1DFQA 2BDRA 2XQRA 3GCWA 1R092 4AHXA 3VBUA 4AQ6A 4DFSA 5C4WC 5BUVA 2GMEA 2QVSB 4RQPC 2HEYF 2ARXA 5ABJA 5A7WB 1BBT3 3MLJA 2ZHKA 5E88A 3ACHA 2WINB 3KF5A 2WT2A 3VBHA 5KHIA 5FYTA 1Q8PA 2JE7A 4M00A 3MFCA 4AFDA 1OLQA 2VH9A 4GJZA 3NNJA 4NPLA 2X8KA 3RI9A 4LBOA 3ACGA 2ADDA 1FMD1 2AGSA 2PLV2 3I3DA 2Q1MA 3I3BA 1PMJX 2CHHA 2VUCA 3QLQA 4GA9A 1IPKA 5IAVA 2Q8DA 1MS3A 1UMIA 2CGOA 1UZWA 3GZTB 3THTA 4ARYA 3HJRA 4LO7A 3UL2A 3KVAA 1YFWA 4M3CB 2ZX1A 3ACLA 4HPKB 2B42B 4CE8A 4XETA 5BNPB 3WINE 1NCQC 3LDBA 5A3OA 1W28A 3HN1A 3U4SA 4UFHA 1DHKB 4YARA 1T2XA 5HV4A 4KWJA 1AJOA 1GQGA 4QPGC 3WT3A 4EN0A 1AL0G 3MGUA 4A7ZA 1HRV3 2UU8A 4CRQA 3CJXA 4Y20B 2ZHLA 1HRI1 4BE3A 5JWPA 4TSVA 2OT7A 2MEV1 1G9FA 4QX2A 1UXXX 1V0AA 3PDQA 5IW0A 2RVAA 4QX7A 3J7LA 1JODA 3RMXA 3WQ7A 5IATA 2QQLA 4YW6A 5LBCA 4DMIA 5C71A 2KA3A 3PVBB 4GULA 1AL22 2HBUA 3MUY1 4M0HA 4ATEA 1SHWB 4P00B 1AYN1 1QY4A 2RS51 3KCXA 4QM8A 4K21A 2XHNA 1F15A 4Q29A 5BNNC 1F8VA 2WDBA 1V6JA 4NIAA 1AR63 4OUSA 2OS2A 1G9CA 1R093 3U0ZA 2OYZA 1JZ3A 3KCCA 5EZWA 2BERA 1JU3A 4Q27A 2PMWB 4AVVA 3NJYA 1AX1A 4Y4YA 3K4AA 1YI7A 1AR91 4FPOB 3MPBA 4CDUB 1CGPA 2QQUA 4YG3A 3T1MA 2XXZA 2XVGA 2GC1A 1IGOA 1ZRDA 3KSCA 1VRH2 3RDIA 3MZHA 3KCYA 2W0XA 3MFAA 4UFJA 5FP4A 3T0BA 4CDQB 1XB9A 5JSRA 2PLV3 2RS31 2QNKA 1HV1A 4Y5SA 4AEDC 4BMBA 3KV6A 2A6ZA 2P3KA 2R0HA 3LKJA 4JQTA 5DG2A 4DPNA 1CIYA 2CTVA 4KMQA 4CYDA 1HQNA 2QZ2A 2E32A 5L36A 4O61A 3FFQA 1NT0A 2VVDA 1GYKA 3ST7A 2YGLA 4YVWA 5IVJA 1C8M2 4QX5A 2NN8A 1T6GC 2P34A 1NE4A 2X5IB 2AYHA 3LDRA 5A3WA 5LK7B 1WZXA 4QPIA 4JZRA 4L11A 2KM2A 2WO1A 3VBFB 4HN1A 2JDHA 5FPAA 4WVVA 1H0BA 3EYPA 3CLPA 3D0SA 3UKTA 3AZYA 3M3EA 4RFT0 4D7YA 1DLLA 2HWD2 1RUE2 1AL23 1JMUB 4IEVA 2JG9B 1GWKA 4GWMA 2KD7A 1ZBE2 2J1SA 2OQ7A 3K3NA 4I0BA 1FYUA 4XYXA 1WA4A 1DCSA 1S0CA 2RM22 3F95A 3DPRA 3IMNA 5T54A 2AUYA 3H9AA 2VQAA 3DXUA 3DKWA 2WIIB 3E1F1 1OKOA 3N9QA 4UW5A 5CKQA 3CMGA 2FQPA 4IERA 4ZPIA 2VL4A 4LHNA 1LHWA 4GWNA 3ROUA 1YO8A 3SISA 2RV9A 5L7OB 4X8NA 3WP5A 3JQXA 5F9TA 1PM4A 1GANA 3IDCB 3MIDA 3WDYA 5C6CA 3POWA 4LQRA 1X9PA 3BPZA 4COVA 4RS5C 2CV6A 3HT1A 1D7PM 1VRH3 5D8AA 5DAWA 1DYOA 5IK7A 5IUQA 3WF3A 2UY8A 1AHSA 5GLTA 4CCLA 1FMD2 3FHQA 2GP5A 3NO8A 3BUCA 3RZMA 4TN7A 5FRAA 3H50A 1IZ3A 5KXEA 3ES1A 3HOBA 3A23A 3LWCA 3DN7A 4Z8BA 5A6QA 4AI0A 2ID4A 3IDAA 1D4M1 2I07B 1ODMA 4KH9A 4XF4A 3I59B 2GC2A 5EP9A 2R32A 1QKQA 1AR81 1XYOA 4OYUA 4QHOA 3ZXGA 5IT6A 1C8M3 2V4VA 5GZCA 2XJSA 4YG0A 1F9KA 2IXCA 1NXMA 2Y6KA 3P3PA 1ZYBA 5APAA 5F39A 3V64A 4AL9A 4JC1A 4AQTA 3RZZA 1H6XA 1CN1A 1VE0A 1HRI2 2YZ4A 3EHKA 5JR7B 5JLVA 1ZRRA 2MEV2 2E7AA 3B69A 5ERLA 2WNUC 3C3VA 1NA1B 4N53B 3ILFA 3Q8EA 4XW3A 3LOBA 5AC91 2HWD3 1W3VA 1RUE3 1C8NA 1SZBA 2F6BA 3JCIA 3GM8A 3KQRA 4LO8A 4R9DA 3PMEA 5HCAA 3FLPA 4FXGB 4QGNA 5BXXA 1ZBE3 1AYN2 1UWWA 2RS52 4YZ3A 1GP4A 1Y9GA 1X8EA 3PU3A 1RXFA 4UW6A 3WG2A 2RM23 3W9AA 3O1OA 5FFOC 5FXZA 3WEZA 1O4YA 1UQXA 3I3MA 5FZBA 4JRAA 1GWLA 5JOXA 1J1TA 4BQ4A 1YQ2A 2R0FA 1W8TA 2FHRA 3LPGA 4QDQA 4GB31 5FXXA 3RGBA 2R071 2RG4A 4BQ5A 4RD7A 1CVNA 1AR92 2R16A 5A3PA 1OOPB 3PL0A 4IE4A 2GN3A 4AVAA 4V2VA 4RL7A 1UCXA 2Q5TA 2D44A 2R49A 2WABA 2ZGOA 3KM5A 1RXGA 1OVSA 1FMD3 2RS32 3SCFA 3DXTA 4K7JA 2FD8A 1QDCA 3H8RA 4OZOA 3N7KA 4NROA 3VKFC 2X09A 3WDUA 4Y3OA 3D8CA 3GZUC 1OFNA 3ZN4A 2IC1A 3T1LA 2BOJA 3ZYIB 1I6XA 4JDNA 3POBA 4R52A 2BNNA 1QJY1 3A7QA 1GKBA 3BN6A 5FZ7A 4DUXA 1TNRA 1XBFA 2E51A 3AMQA 3ZSJA 4ES8A 5EFUA 4JGZA 4YW5A 3ZXKA 4WM8B 2VECA 5FLHA 1MPXA 4HMZA 3PLQA 5C8WA 1L7RA 1HRI3 1NLQA 2VR4A 3OYWB 1CX1A 2MEV3 5CG8A 4ZU5A 2A3YA 2HEVF 4H14A 3VDBA 3ZDVA 4MGKE 5EJZB 4PI0A 2Y60A 3GALA 5CVRA 4CUCA 4FPHA 2WUHA 4MH0E 2VOVA 1AYN3 5E89A 3BYWA 3WW1A 2AZ5A 4META 1YI9A 3AYAA 4IQPA 3NV3A 4IETA 4B4QA 2C24A 3O1VA 2D6OX 2D3SA 5GLUA 1W39A 1OFSA 5CG9A 3EMRA 2RR11 1X7NA 1FV2A 3AKTA 4XAEA 3AYDA 1Q43A 5FK7A 2ZGPA 4AI8A 2H0BA 4CDXA 1JN2P 4S2FA 4BQWA 3MICA 5CFDA 4XZUG 1AR93 4N7UA 5HXMA 2BEOA 2A6XA 2FDHA 4B1MA 1SLBA 4AI9A 1ND3B 2Y34A 1OQ1A 2YPDA 5K4LA 1DQ4A 2C0ZA 4C1XA 2W1QA 4S2HA 3I97A 3MEPA 2RS33 4CP9B 3DYOA 2ETEA 3KV9A 1LU1A 4XPVA 2XHKA 1W2UA 1W9YA 2I2SA 1CAXB 4LK7A 3T08A 1DGLA 4YM2A 4ZS2A 1E5SA 3ZYFA 4DINB 4DRRA 2HBTA 2PN5A 4YVSC 4AI1A 2JICA 3IDEA 1D4M2 4U36A 2LTNA 4Q26A 1GMMA 2ZMNA 4Y1ZA 3WF4A 1AR82 5FZMA 3ES4A 2BOIA 3D3AA 4OI4A 4Q0VA 1H8TC 5FZFA 5A32A 4CUAA 1MS1A 2BWCA 4Y1UA 2YPJA 5C33A 4LKDA 4QMAA 2IXJA 5FMDA 3NMBA 1PX3A 2BW8A 2OX0A 1UYXA 2VTXJ 4NRQA 4OUMA 3R4SA 4LBKA 1DGWX 2C5DA 3Q8CA 2W87A 2YFUA 5FP9A 1D0GA 5FO8B 5A70A 1AYM2 1QDOA 1QOSA 1RHI1 2FZ1A 3IIAA 4CU6A 5AC92 2OA2A 1QJU1 2DCYA 5CZKA 1LAJA 5FYMA 2PAKA 4G9SB 3KGLA 1MR5A 1RUG1 2LALA 1LCLA 3LA3A 1O5UA 2JB4A 4Z1VA 2TUNA 3KV4A 1GOFA 1UYZA 3WDWA 1N1TA 5K8SA 5KWRA 3LIGA 4GMP0 1UD1A 4XTPA 2O1QA 4F8AA 4YRDA 5BYNA 5FZ3A 3MIGA 1W0OA 2D98A 2OVUA 2VW1A 4FTSA 1K5MB 5JXIA 2BRTA 3BI3A 4KU7A 4M3CA 1Q8VA 4HPKA 4RHV2 5BNPA 1H6YA 1O91A 4GB32 4PF5A 2R072 1NE6A 4XZPA 2F4PA 3LA7A 1CPNA 2E6VA 1PZ8A 2OXBA 3DCQA 4LMFA 3U1XA 2Y26A 5FWEA 5FPUA 5K9YA 3K4DA 4TLFA 3WCSA 2WNEA 5F1RA 3TEZA 2CNAA 4FAGA 2EF6A 1VAKA 3CJIB 3HT2A 1ZA7A 4RYDA 4ATFA 1LEMA 1PM7A 4MV2A 1KFXL 4N8MA 1HB1A 3MUZ1 4P9GA 2YC2A 5T5OA 4OI1A 4M01A 4ORFA 1JZ5A 3T2PA 1UO9A 1UL9A 2EAKA 2YXSA 3O5SA 4UBHA 5C3OA 2WT1A 1HDKA 1D4M3 2BPA2 2VJXA 3HN3A 3POIA 5C5TA 1OLMA 5F2SA 4SLIA 4YYOA 3WZ1A 4LLOA 2Y64A 1OVPA 1TE1B 3CO2A 1HQWA 2ORZA 4NPRA 2VVEA 1CZVA 3RZLA 1FV3A 1E5RA 4GIQA 4YGEA 2E53A 3NNFA 4LXLA 4R9BA 4XUNA 1CESA 5DAQA 2VW2A 2VC9A 5DN2A 3NSTA 3VDDA 2CL2A 1AYM3 1POQA 1WA6X 4HVRA 5FXVA 2A73B 4CDUA 1SFYA 3VBSC 1OF3A 3Q9OA 3CEWA 4BCUA 3IZOA 3MBWA 5AC93 2OUJA 2ZCWA 4W4ZA 3ZIXA 3MHZA 5KR7A 2ZEYA 5FZDA 3U37A 4CDQA 4G3YC 1YRZA 3I2JA 2H6BA 5L9RA 4LOTA 2QBXA 2F17A 2ZAAA 4LHKA 1QJFA 4MGQA 4COZA 3DEMA 3BCWA 3VZMA 4OHYA 2RR12 3HMYA 1HXS3 4Z82A 3ENRA 3T4VA 4RHV3 5JXGA 3WUDA 4D3WA 2R073 5LK5A 5FOBB 4IV3B 4ZS3A 4I2OA 1H1MA 4YZ2A 1FNYA 4FVVA 4QB6A 4A4AA 2P6CA 2YY1A 4A41A 5LEJA 2DYCA 2PQQA 2X5IA 5DMYA 1X36A 3PU8A 4GALA 2VMCA 5FIXA 3UV9A 5T5PA 1MACA 2ET1A 3VBFA 2WBKA 4AGGA 1Y9QA 4TXWA 1A8DA 3UJOA 4BH9A 3B5LB 1C3HA 5I0RA 1WUVA 1W6OB 4HKWA 1SPPB 1O4ZA 4IUGA 3TNPB 4CU7A 1DLCA 2W1WA 1YIPA 2WL1A 2JG9A 4LBQB 5FPVA 2RJKA 5T5LA 3USUB 4A2UA 3BTYA 3RZHA 3DF0A 3I7DA 2Q1ZB 3N7MA 1BXHA 2FCVA 2JXAA 3ZLIA 4DQAA 4IEQA 2R041 1UMZA 4XBNA 3W20A 1XXNA 4PIXA 3OTFA 3V0BB 4P9XA 2D6LX 3ZX7A 5B4NA 1CAUB 3POGA 3Q8FA 4F83A 2VNRA 1UPSA 1DQ1A 1VLNA 3ZR5A 5L7OA 2P3IA 5C8CC 5CFCC 4D0QA 3H8UA 3WHTA 3RZGA 1H2KA 2AC1A 2DFBA 2VBPA 4AYUA 1RHI2 3FN9A 1H1IA 2HWF2 1ND2C 2R7EB 3HIFA 4GJYA 1ZNPA 3UJQA 1QJU2 2GNBA 2DF7A 4DY5A 3E6DA 1RUG2 4D7SA 5IHRA 3J26N 1REFA 2WRAA 3RRDA 1LHNA 1BYHA 4JV4A 1UU5A 2Q0AA 4LO6B 4EWAA 2IVJA 2E9QA 4AG4A 2DVBA 3MIFA 5ANQA 4B8EA 1US3A 3BTXA 2GMPA 5EHDA 2XMLA 3NKTA 4Y5Z0 1DQ6A 2RR13 3QD6A 2XL9A 4XFAA 1BKZA 3FUQA 5T55A 4K20A 3NWKA 1UXZA 1GICA 3I59A 4QWNA 3UKNA 1QOTA 2BWAA 4M3CF 4N43C 1ZZCA 4CTEA 3H3ZA 5FZ0A 2BTVC 2VMFA 1E57A 4ASLA 4EJRA 4UAPA 1WLWA 4E4ZA 1LGBA 4R4ZA 4F3JA 5J1XA 2RDNA 3SH5A 2BUKA 2CY6A 2ZKLA 4Q2FA 3R6SA 4XJ8A 2VCMA 1XSRA 1NA1A 4N53A 4WVMB 5F6LB 3THCA 3OUHA 3T4HB 2PHRA 4QD2A 5CYYA 1ULDA 3N9PA 1W9SA 4MXVA 5FO7B 2WQ4A 3URFA 3PJQA 1V70A 3SH3A 4LULA 3PUQA 4IE7A 5ABJC 1C5HA 2HYXA 2WZR1 4QXCA 1SFNA 3E5UA 1VBB1 4Q4X1 3S7EA 1DP0A 4I09A 2ZMLA 5A33B 3A0KA 3QOPA 2EIDA 4ZU7A 2WNOA 5L19A 1UZZA 2DVDA 3M3IA 4XUQA 4QAWA 4QB2A 3FHAA 4XFHA 1OOPA 1PO11 4IGPA 1RHI3 1HQLA 1OUSA 2HWF3 2WR9A 3R05A 2VQTA 3OCPA 2K46A 5J98B 1RGSA 2C1FA 4GZ9A 3FBYA 1RUG3 2QQJA 3O0VA 4AHZA 1S2BA 5LBEA 2XQXA 4XVHA 1YIFA 4K8RB 4AEKA 3BU0A 5DUXA 4CSWA 2XUEA 1GLHA 2DVAA 1QH7A 4AEJA 3GHNA 4Y4RA 5IVEA 2W47A 5GLWA 3VD4A 3JB4C 3D5OA 1I5PA 3PHMA 4XUPA 2Y6LA 2QFEA 4FPKA 4QQHA 1NCRA 1OQDA 4NHKA 4A3ZA 4WZFA 3SCGA 5LW9A 3LEMA 1D0HA 3EB7A 4QXHA 2V5YA 2X05A 5LA0A 3HNYM 4WZCA 2NM1A 3C7EA 4IEUA 4WM8A 3RSJA 3J4UH 2VU9A 5FZ1A 3OYWA 1F4AA 3SMHA 1NCQB 1TNFA 4LPLA 4PLNA 2JIGA 5HCFA 1W8FA 5FYSA 4MXWB 1POV0 4EWDA 4R4XA 3EO6A 3FX3A 2ZABA 4LA3A 1ZRIA 4QPGB 5CNAA 2ZGRA 5I0TA 5I93A 4ZXEA 1LKNA 2EXIA 4BWOA 1S55A 4QX0A 3GF6A 5EPAA 2R042 3U11A 3AJZA 2PXJA 5C7GA 3RNSA 3TOJA 2MHFA 1X82A 1QNYA 2D6MA 4I30A 3GJBA 4Z92B 1STMA 1QJZA 1F5FA 3K46A 1LULA 5AFEA 2WO2A 4FXKB 4OI0A 4MO3M 5GJ6A 5BNNB 2GH2A 5JIUA 1LOFC 5GZFA 3ZFGC 4QX1A 4K1YA 1QEXA 3ATGA 2FDKA 4XC9A 4U2AA 1XSQA 2WWSA 4CP9A 2J22A 4WVWA 3TAYA 5CA6A 4NN0A 2JDKA 3B00A 4UT5A 3VKNA 1ZZ9A 2ZGNA 3WG3A 3I8TA 4RR3C 5FZKA 5FZAA 3ZPOA 2ZXQA 4RN5A 2VZUA 5FYCA 3O1TA 4XEZA 4PBOA 1HLCA 5KHHA 4AEDB 4HSJA 5C5UA 3BB6A 1NAEA 2QQKA 1OA2A 2BQPA 5FP8A 1LGNA 3C8XA 4IE5A 4XJUA 4AE2A 3CQOA 3GJAA 1CQ9A 4MX3A 4P9LA 2EXJA 3ZXEA 3VD5A 3R4UA 4NOTA 1LEDA 3VZJA 3GGLA 1Z78A 5DUUA 4B4RA 1QIQA 3LEGA 1WMEA 4FBFA 5FZIA 2J42A 1VMFA 2D6KA 2P6HA 4FT8A 2P5BA 2PHDA 4IGOA 3RFRA 4YZ1A 1JS9A 5IFPA 2WZR2 3JUUA 3PVOA 1Y3TA 1GP5A 2E31A 2PHXA 2HWC1 1F35A 1VBB2 4GKYA 4Q4X2 1K5MA 1NLRA 4H7LA 3ZSKA 2VNOA 1HX6A 2XLAA 1JZ4A 4K9SA 5EJ1B 5LRRA 5F7UA 1PO12 3VBRC 3T3YA 1UKRA 1OBNA 3MF9A 3PTRB 2C6SA 1LR5A 4A44A 4YW7A 1LGCA 4XTMA 4XUOA 4BDVB 4DXRA 4DUVA 3VHNA 2R061 4NRPA 5FYBA 4OHZA 4OCTA 5FDBA 2JDAA 4C1WA 4OZXA 4XBLA 4IEWA 1BEV1 1C57A 2FCTA 2VW0A 2ZHMA 2ARAA 4W65A 3ZMNA 1UY0A 1NYWA 2GC3A 3MDPA 4RS5B 3NRUA 1W6PB 2WC2A 2ARBA 1OMIA 3H7JA 4NWVA 1TVGA 5JXHA 2JKBA 3E6BA 3C2UA 3UK9A 5F37A 3WNKA 4YLZA 1MEC1 4BQYA 3VD7A 5B4XA 3SKVA 5FY1A 2WO3A 3WNPA 1QWRA 2XJUA 4DNYA 2Z69A 3B9CA 3WVJA 2FBEA 5JCTA 2P3YA 1K45A 1I1EA 3H1YA 1LOAA 4QGMA 1W6QB 3F2ZA 3K2OA 2R30A 3KWVA 3THDA 3AFKA 3DV8A 3OY8B 5DZGA 2GAUA 5CU1A 4FPJA 3WNLA 4BYYA 4QXBA 1R64A 3FLRA 1PMHX 1CAWB 3O1UA 1JW6A 3ZFFC 1RUOA 5LA2A 4ZHNA 1W9TA 5HCBA 2QDNA 1MS0A 3SKJE 2Z5WA 3T09A 2WNUB 1DG6A 2WZR3 1PHMA 1H1AA 4L0PA 1VBB3 2V5DA 1XU2A 2VMIA 2XLGA 3LEIA 4N90A 4Q4X3 3ZFEC 3I2OA 2WJSA 4XILA 3ZM8A 2EA7A 5LATA 4OVEA 4MVTA 3B02A 2JG8C 4OHVA 4QU2A 2VD7A 4NIHA 1BMV1 4GWJA 4G4FA 1GP6A 4HG6B 4QDSA 3B9IA 1PO13 4IV3A 4O7XA 2VZ3A 3BVCA 2JB8A 3UESA 3VZKA 2DVFA 3O7OA 4LIVA 4ZONA 1NG0A 4J1WA 1AR71 1RUF1 2A6WA 5JOZA 2NMOA 2XDVA 5FREA 2GSYA 2D5FA 3N35A 4PF1A 4XFIA 3ZXLA 2A3WA 2CGNA 1UF2C 4GWIA 4L8QA 4N9IA 5FZLA 5A3MA 5IYYA 1C28A 4Z2WA 3NVCA 2QE3A 1V6KA 1W6OA 4BLJA 1SPPA 3ZYPA 3KHBA 1ULCA 4UF0B 4JGZC 5LA9A 2BBVA 5BNQA 3K75B 5A6YA 4LBQA 3USUA 3JBG1 5A80A 4KGGA 4D8MA 1I9RA 1JOBA 2P37A 3ORJA 4AQSA 1GBGA 4D6SA 3V0BA 4O9EA 2J1VA 1LODA 1LECA 4HANA 1F5JA 3NQHA 1CAUA 3L2YA 4YM0A 1WGPA 4D69A 3LB9A 1J3RA 2YROA 3THPA 2WKKA 2MPFA 1HKDA 1YLLA 3GBWA 1JZ8A 1WD4A 2LRPA 1AUYA 1OC1A 4QPWA 1HN1A 5FOJB 3RYRA 4JVAA 5I8SA 1B35B 2B9UA 1RIRA 2JECA 2ZX4A 1DBNA 3LSEA 1SACA 3JB8A 3VD9A 4Q1PA 1NUKA 5C9AB 4CP2A 1U0AA 5CFDC 2BU9A 1Y9MA 1D2SA 4E4HA 5JSOA 1OQEA 2HWC2 3O12A 3PIGA 2YBKA 1CZTA 3PUSA 1CD3G 3E6CC 2HEWF 2I74A 2VTFA 3M8LA 4QQPA 4A3XA 1PGW2 5DPNA 5J09A 4UW4A 3DECA 5AVAA 1LU2A 2VTXA 2BNMA 4CCJA 5FPZA 5JAXA 3JD71 2H6CA 4XUTA 2OW4A 2EALA 5FLJA 3WG1A 1LHOA 4JAAA 2YGMA 3MPPG 3M3OA 1KEXA 3EJKA 1BVP1 4E8DA 2R062 4OMCA 4XJ9A 2RDSA 4Y26A 3H8XA 4YW1A 2ZPXA 4C0BA 3HPNA 4P08A 1W05A 1BEV2 4YGCA 2XPJA 2ORXA 2A75A 2N7GA 4WVMA 5FCCA 5FUIA 1JTZX 4JRLA 4D6QA 1VB2A 4CP1A 5EYXA 1YFYA 1MEC2 4M0NA 4BA6A 1IG0A 1NQDA 3AKPA 4PBPA 3AL5A 1EPWA 5FUPA 3IDBB 3M3CA 4P5HA 2EIEA 4DXZA 5CB7A 1VALA 5EYYA 5HV0A 5A33A 3AMNA 1K42A 4YVSB 4XAAA 4DEVA 2ZZQA 3PNAA 2XH6A 3D6EA 1Z7S1 3S30A 5K7PA 3O1RA 3QBQA 2C9AA 3VN4A 4MADA 4LE3A 3IIIA 3PUAA 4XFCA 1H8TB 5T50A 1H4GA 2ZTNA 3M2MA 5FZ8A 1AYM1 5ISLA 4MGTA 1KXGA 3OJBA 3OGVA 4TZDA 5AFBA 1RUC3 4GAZA 1KQRA 3H8OA 2WSUA 5FJKA 3HQUA 3FHIB 2XL7A 4YPJA 3UNPA 2HWC3 2Q8OA 4AGRA 1FOD2 2E33A 3HQXA 4LKSA 2CYFA 1V6NA 5DQ0A 3BU7A 4A6OA 3LGRA 4AFBA 4UFMA 4CDWC 1BMV2 1OA4A 2X53S 3HWJA 2QQPA 4QX8A 1JYCA 2ZX3A 2GC0A 3W5MA 2OPWA 1HXS1 1UY3A 2QJVA 1ZA4A 3EQEA 4Y1YA 3VZOA 2XONA 4RHV1 5EWSA 3O0XA 5J7MA 2JDPA 1AR72 1RUF2 1TG7A 1T6BX 3HVDA 3K48A 1WKYA 3LIHA 1W9WA 2R063 4BMEA 1NCQA 2W1SA 3UGHA 2QQIA 1MQTC 4FPFA 1QHDA 1BEV3 1ULEA 4M4PA 4MXWA 1QXRA 5F3CA 4X6RB 4O9GA 2ZBJA 4QPGA 1ZREA 1UNBA 1F2NA 2DBNA 5JR2A 5JPNB 3SEEA 2KXLA 3VBOC 3RS6A 1XNDA 3AP5A 4JGYA 3MLLA 1G7YA 2VCBA 3JBG2 4ET7A 4GMP3 1MEC3 2ZMKA 3VDDC 1N47A 5JZGC 5F5QA 1QNWA 3FLTA 5SV5A 2A70A 2ET7A 2WZ8A 1JZ7A 3RG0A 4IEZA 2Q8CA 4A45A 1CZSA 5JSPA 4QXKA 2XLFA 1Q3EA 1RINA 4RFRB 2GZWA 3VKOA 3ALQA 3VHOA 2CWMA 5E6HA 5BNNA 3KZ4C 1FX5A 1PO21 4IE6A 4WM7C 4XHXA 1XE0A 4L99A 4R9AA 1GZWB 2B39A 1AX0A 1S2EA 1SBDA 2WS91 4Y22B 1YHFA 2WFF1 3LAGA 4TYSA 4GXLA 1Y7BA 5DAPA 3T0AA 4XBQA 3UETA 3WW2A 4BPZA 1OH4A 2XJVA 1AJKA 4I3GA 3RWNA 3VBSB 3D0JA 4MUVA 3Q8BA 1FOD3 1BQPA 1YXWA 2QUOA 2VMDA 2VCAA 3I2DA 4JKMA 3P5BA 4JKLA 1IS4A 1O59A 1PVC1 3BTZA 3AXEA 3MO4A 2PTMA 4Q5OA 4AEDA 4NR1A 2AR6A 1FAYA 4AF9A 2VZOA 3OSDA 5GM0A 3W21A 3ETPA 3JD72 4UFLA 5A1LA 4FOWA 2G4IA 1RUD1 3CKHA 1AR73 1RUF3 3J7MA 3GCXA 1OXCA 2W1UA 3VLBB 2WYFA 5EV7A 5GKAC 4K40A 3WHUA 2X29A 4IDZA 4LBJA 4W6WA 5E1RA 4CA9A 1YEWA 3V56A 2UWCA 1EUUA 4OHWA 4N9HA 2NZ9A 4YM1A 5JDBA 3L9JT 4IV1C 3QH7A 1UY4A 4XOGA 4PI2A 3JBG3 4Q4Y1 2G1MA 3HBKA 1JOJA 3OOXA 3MLKA 1JHNA 3RJRA 4ASKA 5IAXA 3CIHA 3GNEA 2PHUA 3CZJA 1J3QA 1EY2A 2JENA 3VL9A 1Z7S2 4LO5B 4LLFA 4L97A 3BTAA 1O4TA 1TQ5A 2PA7A 1N3OA 2VOTA 1WMDA 5A7WA 3OBTA 2IXHA 1DGRN 3DYMA 2WNVC 3HD8B 4CPBD 1U5XA 2HWF1 5BNOC 1EAH1 5CFCB 1UY2A 1G9BA 1H8VA 2VBBA 1L7LA 3H7YA 2ZA9A 1ND2B 2A71A 4OMDA 2BGOA 3R0RA 4GKXA 4RS5A 2W2IA 4OQ9A 4BOWA 1W6PA 2FDIA 2R1BA 2ZAHA 4CUGA 4MOAA 4FTBA 3NV4A 4N7IA 4LO4B 5LB6A 1XOYA 4D7TA 3EXUA 1HXS2 2CDPA 2R1DA 2VULA 1O8PA 3WCRA 3JD73 3BOWA 4GQ7A 1FT9A 1U12A 1SBEA 2VO5A 4H7MA 3VHPA 3KMHA 4FP3A 3ZDSA 1RUJ1 1W6QA 1G6NA 2D5HA 1BLZA 2XJQA 5IWFA 4MSVA 4QQLA 2XWJB 3OY8A 4N43B 1KRIA 1OUXA 4HZFA 4O65A 2WLPA 1EV11 2WA3A 5FKBA 4Y20A 2DTYA 4HKLA 1N1SA 2K9ZA 2FDJA 5B2GB 3FE5A 2FDGA 4A42A 3WNMA 4CEYC 3GBGA 1FNZA 1Q56A 4AFMA 5FMCA 2VMGA 2FCUA 4HVQA 1GU3A 5F6KA 2WNUA 2FDFA 3AKRA 4Q4W1 3WNOA 3BALA 4HN0A 3WF2A 2QKDA 3TB0A 1GNYA 1O3TA 4DY3A 2D43A 4QB1A 1VBD1 2VZ1A 1TME1 1Z7S3 3P6BA 1B09A 1JU4A 1PO22 2AEZA 2IUWA 2VCCA 1SLIA 2BBAA 1QF3A 2W39A 4MGIE 3U14A 3S0MA 4QX3A 5A6XA 4MGYE 2XWBB 4DO0A 2BZDA 2BNOA 2WZPP 5T5JA 1MVEA 4C90A 3H1WA 5T52A 4CCNA 2WS92 2XB6C 1I5ZA 1OLRA 1S0DA 2P17A 4OI2A 4RA0A 1NCRC 2WFF2 4Q8KA 5A1FA 5K0UC 1HV0A 1LENA 2VOKA 1W04A 3VKMA 3AJYA 3HQRA 3ZKYA 1UIJA 4YZ5A 3USSA 4DEQA 4CEWC 1OPOA 4UF0A 4LKFA 4UWDA 1GQHA 3T30A 4AVCA 5FPXA 1PVC2 3ZYBA 3AP4A 4J1XA 1XNTA 3PTYA 4NMIA 1W6NB 1S0IA 2YUEA 1W99A 1H9WA 1HJGA 4PHZA 3BPSA 4MHRA 1N1YA 2RE9A 2HJIA 1DQ2A 3EBRA 4IEXA 1H2MA 1RUD2 3RI8A 2DURA 4CCKA 4NJ4A 2G9GA 5DZEA 1VMJA 2W08A 3WD5A 4GH4C 3KT7A 2BGCA 3GDBA 2K2SA 4KWKA 1AX2A 3INAA 1WWYA 5FMBA 3GBFA 2QQOA 1NKGA 2J7MA 2P4EA 1B35A 1UX7A 4IEOA 4PDWC 1Y43B 4FI9A 2CAUA 4YGDA 1SDDB 2C4XA 4Q4Y2 5C9AA 4A7KA 5JPMB 1W6MB 1S0EA 4CVUA 1LHUA 5CISA 2RS11 2XJRA 3KS7A 3N36A 3MW3A 3WY6A 1EYBA 3ME2A 4E2GA 1K5JA 1W9FA 3CF6E 3NAPC 5CKMA 4WV8A 5EJ3A 4EN6B 1PO23 3AM2A 1VJ2A 1UOBA 4UW3A 2B45X 4EWEA 4LE4A 3I49A 2V73A 4OUEA 3VB9A 2PAMA 2E7TA 3AZVA 3HBZA 3LZZA 2A6VA 3M4FA 4PLOA 5F2WA 5FP3A 3WF1A 2WS93 4XQ4A 3WNXA 1EAH2 2WFF3 3I2HA 1UOJA 2ZACA 4UFKA 3DL3A 5FZCA 5A6ZA 5T3NA 1OF4A 4AOCA 2WSVA 3ZFGB 1PK6C 4ISRA 2AACA 4AVSA 3H0OA 1W2TA 2VVFA 2DDUA 2AREA 1PVC3 1ZZ7A 2J1TA 3LA2A 1RYYA 3S5AA 2JD9A 2YB7A 2ZGTA 3AKSA 3PVEA 4YFZA 3NJZA 1ENXA 5CADA 3RQ0A 4XF1A 3DYPA 2ZEWA 3OGSA 3AX4A 4RR3B 3ECQA 1RUD3 4SBVA 2I45A 3R4DB 4YVSA 1RUJ2 1W90A 1JBCA 1W0PA 1W03A 2JIJA 2PQSA 1IG3A 3KD4A 3ZPYA 2VAUA 1ODNA 1Y4WA 5HXVA 2PYTA 5A3LA 1MS5A 4I0WB 1EV12 5I0UA 3AMMA 2LM3A 4LTAA 1QXPA 5J3UA 1C4RA 4B7KA 2D7FA 4Q4V1 4XCBA 3M7AA 3NL1A 5FQ0B 2YBSA 4P9JA 4Q4Y3 4XFBA 3ZYJB 1O7FA 4DS0A 3AB0A 1SEFA 2RJLA 4HK8A 4Q4W2 3VBUC 4PJYA 2OIIA 3UGGA 4NWWA 4BQ3A 1H2NA 2VZTA 4XFGA 4ZZ5A 3VV1A 4COYA 1W8HA 1VBD2 3VBHC 1PIV3 1CAVB 4BQ2A 4KWLA 3N9MA 5FWJA 1TME2 4PT6A 4QQOA 1S4CA 2W95A 2WAAA 2ATFA 4I01A 4LBQD 3A22A 4OLLA 2D93A 2LROA 3SCHA 3TNQA 3LPFA 3TEWA 3ITQA 2WWUA 4H2AA 1EAH3 3AYEA 4RGAA 3VBRB 1L3JA 5C4WB 4C8DA 1G86A 4RQPB 5LY2A 5EXOA 5GZGA 4FFIA 2WWJA 5DAXA 4XMAA 5GZEA 2BYVE 1YJLA 2VMEA 3I2IA 2MNGA 1WBLA 1YQ8A 4E8CA 1H9PA 2YBPA 3ZFFB 1RUI1 1XNKA 2VQUA 1Q8OA 1ST8A 2D97A 4Y1XA 3I3QA 2ZEZA 1LJ7A 5BV6A 1GZTA 1RUJ3 2IXIA 3RJ2X 4CPBA 3VD3A 3WF0A 3ZYRA 3WW3A 3S7IA 1EV13 1GV9A 3SEPA 4QHZA 2ZGMA 1GZWA 3P1IA 4Q0PA 4ZKTB 1GWMA 4FQZA 4Y22A 3O1PA 2EXKA 3JXSA 5FY9A 4D6RA 5L9BA 2A5ZA 1COV1 4URAA 4Q4W3 1LOBA 1YNAA 3OBAA 4IESA 3VBSA 5ANNA 1HB3A 1PMIA 2RS12 4CU9A 2ADEA 1IKPA 5H9PA 1BZWA 2B5HA 2UYBA 2ZGUA 1SCSA 3QACA 4JKKA 1VBD3 3DGTA 4KWUA 4XQDA 4HSLA 5FZOB 4ZY9A 1NQJA 1TME3 4IW3A 5FAXA 1TEIA 2GN7A 2VXJA 4M3CE 1V6OA 1GFF2 3ZFEB 1VBE1 1SLCA 3SH4A 1KS4A 2PAEA 2NQYA 3CDZB 1O3RA 1RMU1 1X8MA 2JG8B 1N3QA 2EXHA 1ND3A 2JDUA 4BJ0A 3U07A 5G04L 4YW2A 5KC5A 4KG8A 1K3IA 3OB8A 3APBA 5FY5A 1YCIA 3OUIA 4FTEA 1J3PA 1UOFA 3QH6A 1P8JA 1EP0A 5FZEA 1SLTA 4LOSA 4HL0A 3M3QA 2W3JA 2Y0OA 4YVWC 5JOWA 3NNLA 3RYKA 4FAHA 2QDRA 1UZYA 1CAXA 2G19A 4V2WA 4W6XA 2KR2A 3K77A 1VAMA 1YQ5A 3U75A 5EIYB 1ZRFA 3RPQA 5GLZA 1N3PA 3ACFA 4QPIC 4JGZB 1OLME 1ENQA 4LBMA 3VL8A 4DXTA 4GD4A 5CIRA 3CBNA 1AVBA 1IOAA 1QU0A 4Y24A 5LBBA 4A6SA 1RUH1 4QPYA 1CWPA 3IKWA 1IHMA 3W59A 4QKNA 5KHKA 3AP6A 4LKEA 4ZXKA 4Q4V2 2NP0A 1NOVA 2GNTA 3I4IA 3IBMA 1NX9A 3DPRC 1XQNA 5FZHA 1JYXA 5CFCA 1DZRA 1G8WA 5IVYA 2G9ZA 5F5AA 3O1MA 1S0BA 1ND2A 2DVGA 4AEMA 1JI6A 5A7NA 2RS13 1PGL1 1GR3A 4Z2AA 1RUC1 1QJX1 1YUDA 5F3IA 4AGVA 1MZFA 2IXKA 5E8AA 5CFDB 5D8AC 1GOGA 2GNDA 1W0NA 3PURA 3OF1A 3NV2A 1PGW1 1DYKA 4XF3A 3DUIA 4Q0SA 2GU9A 1VBA1 1UIKA 4LNVA 5D2AA 4QHBA 2QQNA 2UURA 1V6MA 3MV11 4JX0A 4N43A 4CUBA 3CJIA 4JTOA 4NIDA 4EZHA 2W68A 2RMU1 2J1UA 3KGZA 4HVOA 5CEHA 2WO7A 1KD7A 1CR7A 4XXPA 4HKOA 3J9SA 1IS3A 1REEA 1XE8A 2XKPA 4CCCA 1YJKA 1RUI2 1W8UA 1MZ6A 2D40A 4GMP1 1WCKA 5HCHA 4X6QB 1O6UA 3WXPA 3AC0A 1RTVA 2WA4A 5FK8A 3M70A 3PUIA 5H9QA 2VUAA 2ILMA 3WSOA 1JYIA 2VZQA 5KC6A 5KHGA 1XNCA 4E4SA 2DCKA 1ULPA 3ZO0B 5A1AA 4Q4V3 4WBBA 1QH6A 1A3KA 2A3XA 2CDOA 2IWGB 4HFSA 2SBAA 2Y38A 2E7QA 4I0AA 1VRBA 3LOIA 3N7JA 1Q8SA 1COV2 4XFFA 5H9SA 2WLQA 3BIWE 4BLIA 4HONA 2JKXA 4NHYA 2CAVA 4XURA 2OKXA 3LFIA 5DXDA 1JYWA 3ZXAC 1PX4A 1WMFA 1W6NA 5LWBA 1FOD1 1RVF1 1UU6A 3OBZA 3WP6A 1CJDA 4COUA 3VZLA 2VXRA 1MS9A 5D1IA 1VBE2 2ERFA 4KQ7A 4BZ4A 1A8MA 1C5IA 2Q4SA 3OD0A 5FYIA 2E26A 4KG0A 1RMU2 3ZYGA 1J58A 1WCDJ 4CDWB 2UYAA 5C3QA 4JGYC 1UY1A 4IEPA 3LCPA 4BK5A 1PNFA 4UYBA 4CCDA 1W2NA 2WZEA 3NKGA 5JVVA 4JHTA 3POSA 4L92A 2HYKA 3AXDA 2CWSA 3B3QE 2HWB1 4UFIA 1VBC1 2OQ6A 5GALA 1J1LA 1SLLA 4XIKA 4B29A 5JOYA 1MQTB 1W6MA 2LW8A 1DQ5A 2WFPA 4FPYA 5HPOA 4Y1VA 3MIEA 1J59A 4XABA 5ACA1 2JX9A 2DUOA 1RUI3 3ZN6B 2WAOA 5LBFA 2DWRA 3PJYA 3VBOB 1RB8G 4Y5TA 3ZXDA 2IVIB 2HWE1 3MI8A 4XACA 2P1BA 4LK6A 3ZIWA 1K12A 1YFXA 2L9LA 4ASMB 4XJAA 2QQVA 3VDDB 4I3PA 5JZGB 3VZNA 1M06G 2PHLA 1BCXA 3OEBA 3ELNA 1RUH2 1UZVA 2DU0A 4J25A 1BJQA 1JZ6A 2B46X 1TZOA 2H0VA 5FMOL 1DIWA 2R6QA 5F8PA 4ES9A 4XF0A 1KJRA 3AZXA 3UYJA 4TWTA 4OULA 1COV3 4WM7B 4K1ZA 3GXUA 3I54A 1LOFA 3ZFGA 2EIBA 3Q8AA 1NZIA 4CDXC 1R081 3I3EA 1OURA 3KQ4B 4Q0QA 1PGL2 1RUC2 3WR0A 1QJX2 2DCJA 2JDNA 2VNGA 1VPHA 1IQAA 1W8WA 1OHFA 3LE0A 4UBGA 5FZGA 5SV8A 1W8ZA 1EPZA 5KBFA 3WQ0A 4FOYA 1G9AA 4AW7A 1X33A 1APNA 2NMNA 1VBE3 4RR3A 4H3WA 5I8TA 1ONAA 4NE9A 1TMF1 1VBA2 1RMU3 3PMSA 4QKFA 5A3UA 4NUBA 3AP9A 3H42B 3FJSA 1PNGA 2PELA 4D94A 2PHWA 4LA2A 3OG2A 4FFHA 4LORA 4EROA 3NJVA 5FZ4A 3A4UA 5LEKA 1ZRCA 4FO9A 3BIEA 2RMU2 3CU7A 3TBDA 5FQ0A 1OPMA 4KU8A 5F3EA 2JJ6A 2VG9A 2C26A 2YMZA 2ZJCA 5DAVA 4TTGA 2DV9A 4PLMA 2VY0A 1UAIA 4XXAA 4FQ4A 1DGWA 4CXWA 3N7LA 2W52A 2Y6JA 4IV1B 5L9VA 1ZZ6A 1RUNA 4BIOA 2CU5A 1BVVA 3AZZA 3GYDA 4AXOA 1A78A 2ZX0A 1QMJA 1CAVA 1ASJ1 5FR3A 4C0HA 1OI6A 1RJ8A 5JXJA 2ZKNA 3O14A 1SG3A 3OGJA 2YG0A 3VDCA 1RUH3 2HKXA 2AEYA 1O3QA 3S6PA 1GSLA 1GNHA 3POEA 2Z79A 2Z2SB 5F32A 1CX4A 1WMXA 2O0OA 2RJ2A 3IT8A 3A21A 4BIFA 3MIBA 5FYHA 3VBRA 1WBFA 5C4WA 4DIQA 4LITA 4AHYA 4RQPA 5FPBA 3RMYA 3OD4A 3ZSEA 2CSGA 5BNPC 4BU2A 2A7AA 2VQ0A 3JQWA 3K4ZA 1QJX3 2AENA 3VDAA 1MVQA 2W91A 2WNVB 2VM9A 2XVKA 5BNOB 5J48A 5FLIA 2XBO1 2ZGLA 3E5QA 3ILRA 4YFWA 1RVF2 1MS8A 2YFZA 2Q8EA 2XR4A 4BQ1A 3B93A 4W8JA 3WOGA 5IK4A 3IPVB 4NHLA 2ZS6B 4QQ2A 1ZX5A 1U5ZA 1VBA3 3I2KA 2AH2A 4XE9A 2QTWB 4MGZE 4PIYA 1O3SA 5FYUA 1UN1A 1DU3D 5C3RA 3LDKA 4BXFA 1RJ7A 3NW4A 4BB3A 2LS6A 4EYUA 4Q1RA 2RMU3 1JYNA 2HWB2 4QKBA 1VBC2 2ZEXA 3T0DA 1WCQA 3KVBA 2PHTA 1LRHA 2HLEA 2Q30A 5A7QA 2YC4A 5FJHA 1RITA 3ZN5A 4NHXA 5FXWA 2FZ2A 5ACA2 2W9XA 3C7FA 3OPTA 4CP0A 4YW3A 2TNFA 1REDA 5DABA 1IQDC 5A3NA 1DZQA 3ZFFA 3ZR6A 4CEYB 2HWE2 4W6YA 3OPWA 5FZOA 3ZSMA 4CDUC 5HI0A 1G9DA 5L73A 3ZKUA 4COWA 1JH5A 2K0GA 2JE9A 3ZXJA 1XNAA 4AK3A 3SXWA 3BGAA 2B4KA 2C9KA 3KT1A 3ZFEA 4CDQC 1GOHA 2YC0A 4KNCA 2B9VA 2VNVA 2XJTA 4LR4A 2A1XA 4MHUA 5D21A 4YW4A 3T2QA 2JG8A 1Q5OA 1RL3A 3ACIA 3JZVA 4DOUA 4EV0A 1NY71 5AVPA 1O8SA 1WW6A 4KI5M 2VZPA 4LBNA 4NAMA 2VGDA 1R082 1FXZA 2LUWA 1OD5A 1POV1 5DUVA 2GALA 3WDXA 2D6PA 2VBDA 1C1FA 1XNBA 2FMDA 2DUQA 3ILNA 4UOJA 3ABZA 2O14A 1O5LA 1YFUA 4DRVA 4ZZ8A 1NCRB 1JZ2A 3BODA 5K0UB 1OT5A 1RVF3 2Z42A 4PCRA 1AXKA 2X5IC 3SITA 3ZMOA 3MW2A 4B1LA 4C91A 1IKQA 2Y33A 4LHSA 4CEWB 1KDMA 1B35C 4BM8A 3VBFC 1WW7A 1BHGA 1TMF2 3OBRA 4YM3A 1AXYA 1UW8A 5DG1A 4S2GA 2UWBA 5A7PA 4J6GA 1Q8QA 3HAGA 3OUJA 5FYVA 4XF9A 3RYPA 5C9AC 1GZ9A 4CU8A 1GUIA 2J1AA 3FBMA 2JG9C 4LEJA 2OPKA 3GZEA 2P2KA 1QJEA 3CL1A 2WQZC 2HWB3 4FCAA 1VBC3 2JE8A 3H3UA 1CJPA 4GH4B 4R8HA 2ZOEB 2RS53 3ZSLA 2V4AA 1OKQA 3I2FA 3HEIA 4NIGA 1WW4A 1HJFA 5ACA3 2YU2A 4LUMA 4AFCA 4PQQA 2X10A 5LASA 1UYPA 2F4LA 5A7SA 5L7OC 4PDWB 5CBLA 2EAAA 2XOMA 3SHRA 3K3OA 2HWE3 5FUNA 5KHJA 1KITA 4XJWA 1S0FA 1ASJ2 2XJPA 2XKOA 5I0DA 1JYVA 2D3PA 4A7YA 1XE7A 3KV5A 4Q0UA 4XDQA 4AFAA 4V1PA 4INDA 1L7QA 1PIV1 1FI2A 3KB5A 5DZFA 2Y6HA 4XCAA 1VB4A 2UWAA 1IS5A 1YWKA 2DU1A 2J1RA 4BK4A 3NAPB 5DUWA 5IVCA 3OGGA 3D4KA 4URTA 1VR3A 3AVRA 3LF7A 3N3HA 3TRSB 1R1ZA 1IPSA 1R083 3IAQA 3UT0A 3VGIA 2YHJA 2A6YA 5C8CB 3V0AB 4XHBA 3C7HA 3SNMA 2VUDA 1AXZA 3QCWA 5C3PA 1XU1A 2XBO2 2YU1A 4XDPA 4DXSA 2VZRA 4HXCA 3N4MA 1PK6B 5JIAA 4MGSA 1QXJA 1DF0A 3CNAA 3T2TA 5FBJA 1TMF3 4AHWA 1LESA 1NA1C 1ZBA1 4N53C 1V9U1 3WG4A 5KXDA 4HT1T 1H30A 2O8QA 3K51A 5FP7A 1PVXA 3J8F1 3IAPA 2Y6GA 1R1A1 1XPWA 1ENRA 2XGXA 3N9LA 4IGQA 4IEYA 3MV01 3ZVXA 5IVBA 1V6IA 1GNZA 1YC61 4FPGA 1UYYA 4LHLA 4QGLA 5IVFA 3LQCA 1V6LA 4HLTA 4BHPA 4PIZA 1CAWA 1GQPA 1S1AA 3IWZA 4QDRA 2JD4A 5FO9B 1HIXA 5DDJ1 2QQWA 1DGRA 3AMPA 3POYA 1QQP1 5FZ9A 1OOPC 2BP6A 1PZ9A 3RZKA 1ASJ3 5LCWL 3MW4A 5BY5A 3AZWA 3WDVA 4F7ZA 5JUVA 3VBUB 1YYNA 2ZGQA 4K8FA 4EN8B 1PZ7A 1FPN1 3WQBA 3N9NA 1MZEA 2YV8A 5ABJB 2WN3A 1UU4A 3VBHB 4CDWA 1U5IA 4PQ9A 5GZDA 5J37A 3P3NA 2FMYA 1NY72 4Q8LA 4TLGA 4EN9B 2VPVA 4RGKA 1PGSA 1I3HA 1S2KA 1UZ0A 2OZ6A 3U78A 3O1SA 3WV6A 2ZHNA 4E9KA 4NHMA 1N1VA 1CPMA 1NXD1 2WT0A 2XBO3 3C7GA 1ULGA 4HK9A 4M4RA 1MQTA 1QJY2 3I2GA 5BPXA 1F31A 1US2A 3AL6A 3HR9A 1AR83 4AAPA 4AVBA 4WM8C 3W58A 2YYOA 1A34A 3ZN6A 4Z07A 2WYSA 3VBOA 4LUKA 2VOWA 2XUMA 1ACCA 4QT6A 2V72A 3U10A 3AVSA 3FUOA 3OGRA 5JZGA 4YWAA 5E16A 4OFGA 1SFPA 1D2QA 2B7YA 3SQOA 2JDZA 1FATA 3FFZA 3MYXA 5GLVA 5IJRA 3TN91 4BISA 5LY1A 3KF3A 4EE2A 1VP6A 1H2LA 4BQXA 2TBVA 1MS4A 3H3LA 4S2DA 4XQWA 3WP4A 5J36A 1JUIA 3WX5A 4LBLA 4OQ8A 4WM7A 2GH8A 1ZM1A 3AMHA 5J96B 2E63A 1HB4A 4QU1A 1WLTA 2WN2A 3ZYHA 1DYPA 3KT4A 4HBNA 4ISQA 1KFUL 4CXXA 3GZAA 3TWIA 3G6JB 5FY7A 4GB33 3CHXA 4E2QA 1V00A 1NZCA 1ND3C 2DTWA 4FOQA 5JI7A 3S5QA 1LHVA 5FY0A 5CAZA 3IMMA 1WCSA 2O8OA 2JDYA 4XMIA 1PIV2 1MZ5A 3TEYA 3J7HA 5EQUA 4KBZA 4Y33A 2NLRA 1ZVFA 3PIJA 1UOGA 4JCKA 1U5YA 2BFUS 1SBFA 4H55A 5FTTC 3RVHA 3N9OA 3WLUA 5FYZA 4AWDA 5M0TA 1KGYA 1KJLA 3BKZA 1POV3 1X50A 4E27A 1XJAA 4JTNA 3ASIA 1AZDA 1QJY3 1SCRA 1DDLA 4P5YA 2DFCA 2D6NA 2JEMA 4MG2A 5IVVA 4ARXA 4R9CA 4AI2A 1OA3A 1URXA 3JU9A 1UPIA 4IV1A 3TYJA 4CCEA 2Y0IA 5JI9A 4YVWB 5I91A 4JDMA 3NNGA 4K3UA 1LOCA 3KHCA 1ZBA2 1ULOA 1V9U2 2HH9A 4CCOA 1IS6A 4EZ4A 2BJSA 3J8F2 3D82A 4B7EA 1R1A2 2ENRA 4LIUA 4EQVA 4QPIB 1WCUA 4IL7A 4LJHA 3ZXFA 1BBT1 3DKQA 3VUOA 1YQCA 2QZ3A 1H8TA 3NJXA 1K5MC 1QOOA 3UGFA 1OSGA 3M1HA 2EICA 4FPEA 2TEPA 3MIHA 4AQ2A 1IPJA 1ENSA 2VOXA 3C7OA 4L9BA 5A3TA 5DDJ2 2PFWA 1QQP2
chains in the Genus database with same CATH topology
1VIWB 2WNVA 3DPRB 3FZ3A 5BNOA 1SQ4A 3MF6A 1LTEA 4FPLA 1WLDA 3AFGA 2D3RA 2IFRA 3CJIC 3IPVA 1A6CA 1H4HA 1FPN2 1SDWA 3X29B 5I0SA 3B7MA 1S0JA 3A0NA 1XRUA 4E2SA 1UKGA 2XG3A 5D8AB 2BVVA 3FMGA 4MZUA 5HBAA 1HRV1 2DCTA 3G7DA 3GHMA 2ES3A 2ZZJA 3B94A 1UX6A 4I02A 4DZGA 2VMHA 4NO4A 2IXLA 2ZGKA 3OPZA 4ITCA 4XIOA 3FC0A 1GZCA 4B3NA 2GNMA 4KBBA 1KS5A 4CEYA 3UKVA 2B8MA 1ZBA3 3IM0A 1AR61 1V9U3 1DQ0A 1R091 3J8F3 2EIGA 5FMOS 1R1A3 3AK0A 3TN92 1NLSA 1QJU3 2NPIA 4MYEA 4RGGA 3O0WA 3IN9A 2YDEA 1BK1A 4FOVA 1DZTA 3LSDA 5KXBA 1VAVA 4MLOA 4JQRA 4AVTA 2PLV1 1SLAA 3AKQA 5DDJ3 1QQP3 2DUPA 4IV3C 3WDTA 1HW5A 5K0UA 4K6BA 3WW4A 1M4WA 3FWEA 5FBZA 4CEWA 1FPN3 3L2HA 4P9WA 4E4DX 4FSJA 1WLCA 2OUHA 1XYPA 4XJZA 4LT5A 1RC6A 2SLIA 5TSWA 2PHFA 1ALYA 3AP7A 4ZU4A 1D4VB 3KLSA 2BVBA 4ONUA 1AF9A 3SLIA 4KGQA 3VHRA 3U4XA 4UXAA 4AI3A 4GH4A 2G9FA 1XYNA 4JGYB 5KXCA 2RHPA 4P9IA 3NV1A 1AL21 3E97A 2ZX2A 2V09A 4FPCA 4PDWA 4WVZA 1JUHA 4YSFA 1LB2A 1KDKA 2XVLA 2DCZA 4KL1A 1CONA 1LOGA 1ZZBA 1SMVA 3TN93 4DB5A 1BBT2 1WD3A 3NAPA 4P9YA 4B4PA 1VRH1 4YZ4A 2CGPA 2P3JA 3VKLA 3E5XA 5C8CA 3V0AA 1ZZ8A 2ZGSA 4X8PA 5IK5A 3AYCA 1LOEA 3H1MA 2EVXA 3ETQA 3BOPA 1PK6A 2UY9A 4CDXB 2OZJA 4YGBA 1C1LA 2GDFA 1WW5A 2QCSB 5LRSA 5IK8A 1C8M1 1ULFA 4OHXA 1HRV2 3V65A 4YNIA 5JMCA 4HETA 2IZWA 5I8YA 4YG6A 2VUJA 4RSUA 3WUCA 2HWD1 1RUE1 1QGLA 4FP2A 1JXNA 2NYYA 2BFUL 2R043 4EN7B 1CIWA 4CZSA 4L2NA 3PVNA 1ZBE1 4P14A 4QM9A 5H9RA 4NVPA 3B01A 2GMMA 2RM21 1S0GA 3WP3A 4IXLA 3WQ1A 4JDOA 2IFWA 1Z0HA 5A32B 1AR62 1DFQA 4AHXA 1R092 3VBUA 4AQ6A 4DFSA 5C4WC 5BUVA 2GMEA 2QVSB 4RQPC 2HEYF 2ARXA 5ABJA 1BBT3 3MLJA 2ZHKA 5E88A 3VBHA 2WINB 5KHIA 2WT2A 1Q8PA 2JE7A 4M00A 3MFCA 4AFDA 1OLQA 2VH9A 2X8KA 3RI9A 4LBOA 1FMD1 2AGSA 2PLV2 2Q1MA 3QLQA 4GA9A 1IPKA 1MS3A 2CGOA 3THTA 3GZTB 4LO7A 3UL2A 1YFWA 4M3CB 2ZX1A 3ACLA 4HPKB 2B42B 5BNPB 4XETA 3WINE 1NCQC 3HN1A 1DHKB 4YARA 4KWJA 1AJOA 1GQGA 4QPGC 3WT3A 4EN0A 1AL0G 3MGUA 4A7ZA 1HRV3 2UU8A 4CRQA 3CJXA 4Y20B 2ZHLA 1HRI1 4BE3A 5JWPA 4TSVA 2MEV1 1G9FA 3RMXA 3WQ7A 4DMIA 2KA3A 3PVBB 4GULA 1AL22 4M0HA 4ATEA 1AYN1 1QY4A 2RS51 3KCXA 4QM8A 4K21A 4Q29A 5BNNC 1F8VA 1V6JA 1AR63 4OUSA 1G9CA 1R093 3U0ZA 2OYZA 3KCCA 5EZWA 4Q27A 4AVVA 1AX1A 4Y4YA 1YI7A 1AR91 4FPOB 3MPBA 4CDUB 1CGPA 4YG3A 3T1MA 2XVGA 2GC1A 1IGOA 1ZRDA 3KSCA 1VRH2 3RDIA 3MZHA 3KCYA 2W0XA 3MFAA 4CDQB 5JSRA 2PLV3 2RS31 2QNKA 1HV1A 4AEDC 4BMBA 2A6ZA 2P3KA 2R0HA 3LKJA 5DG2A 4DPNA 2CTVA 4CYDA 1HQNA 2QZ2A 5L36A 3FFQA 2VVDA 1GYKA 3ST7A 2YGLA 4YVWA 1C8M2 4QX5A 2NN8A 1T6GC 2P34A 1NE4A 2X5IB 2AYHA 5LK7B 4QPIA 4L11A 2KM2A 3VBFB 4HN1A 4WVVA 1H0BA 3CLPA 3D0SA 3UKTA 3AZYA 3M3EA 4RFT0 4D7YA 1DLLA 2HWD2 1RUE2 1AL23 4IEVA 2JG9B 4I0BA 4GWMA 1ZBE2 1FYUA 4XYXA 1WA4A 1S0CA 2RM22 3DPRA 3IMNA 5T54A 2AUYA 3H9AA 2VQAA 4UW5A 3DKWA 2WIIB 2FQPA 4IERA 4LHNA 1LHWA 4GWNA 3ROUA 1YO8A 3SISA 5L7OB 4X8NA 3WP5A 3JQXA 5F9TA 1GANA 3IDCB 3MIDA 3WDYA 5C6CA 3POWA 3BPZA 4COVA 4RS5C 2CV6A 3HT1A 1VRH3 5D8AA 5IK7A 5IUQA 2UY8A 1AHSA 5GLTA 1FMD2 3NO8A 5FRAA 3H50A 1IZ3A 5KXEA 3ES1A 3LWCA 3DN7A 4Z8BA 4AI0A 1D4M1 2I07B 4KH9A 4XF4A 3I59B 2GC2A 2R32A 1QKQA 1AR81 1XYOA 3ZXGA 5IT6A 1C8M3 5GZCA 2XJSA 4YG0A 1F9KA 2IXCA 1NXMA 3P3PA 1ZYBA 3V64A 4AQTA 4JC1A 3RZZA 1CN1A 2YZ4A 1HRI2 3EHKA 5JR7B 5JLVA 1ZRRA 2MEV2 2E7AA 3B69A 2WNUC 3C3VA 1NA1B 4N53B 3ILFA 4XW3A 3LOBA 5AC91 2HWD3 1RUE3 1C8NA 2F6BA 3KQRA 3JCIA 4LO8A 4R9DA 5HCAA 3PMEA 3FLPA 4FXGB 4QGNA 5BXXA 1ZBE3 1AYN2 2RS52 4YZ3A 3WG2A 1X8EA 4UW6A 2RM23 3W9AA 5FFOC 1O4YA 4JRAA 5JOXA 1J1TA 2R0FA 2FHRA 4GB31 2R071 4RD7A 1CVNA 1AR92 2R16A 1OOPB 2GN3A 4AVAA 4RL7A 1UCXA 2Q5TA 2D44A 2R49A 2ZGOA 3KM5A 1FMD3 2RS32 3SCFA 4K7JA 1QDCA 3N7KA 3VKFC 3WDUA 3D8CA 3GZUC 1OFNA 3ZN4A 2IC1A 3T1LA 3ZYIB 1I6XA 4JDNA 4R52A 2BNNA 1QJY1 1GKBA 1TNRA 2E51A 3AMQA 3ZSJA 4ES8A 5EFUA 4JGZA 4YW5A 3ZXKA 4WM8B 2VECA 5FLHA 4HMZA 3PLQA 5C8WA 1HRI3 3OYWB 2MEV3 5CG8A 4ZU5A 2A3YA 2HEVF 4H14A 4MGKE 3GALA 5CVRA 4FPHA 4MH0E 2VOVA 1AYN3 5E89A 3WW1A 2AZ5A 4META 1YI9A 3AYAA 4IQPA 3NV3A 4IETA 4B4QA 2D6OX 2D3SA 5GLUA 1W39A 1OFSA 5CG9A 2RR11 1X7NA 1FV2A 3AKTA 4AI8A 3AYDA 1Q43A 4CDXA 2ZGPA 2H0BA 1JN2P 4S2FA 3MICA 5CFDA 1AR93 4N7UA 2BEOA 2A6XA 1SLBA 1ND3B 1OQ1A 1DQ4A 2C0ZA 4C1XA 4S2HA 3MEPA 2RS33 2ETEA 4XPVA 1LU1A 2XHKA 1W2UA 1CAXB 2I2SA 1DGLA 4YM2A 4DINB 4DRRA 2PN5A 4YVSC 4AI1A 2JICA 3IDEA 1D4M2 4U36A 2LTNA 4Q26A 2ZMNA 4Y1ZA 1AR82 3ES4A 4OI4A 4Q0VA 5A32A 1H8TC 1MS1A 2BWCA 4Y1UA 2YPJA 5C33A 4QMAA 2IXJA 2BW8A 4OUMA 3R4SA 4LBKA 1DGWX 2C5DA 5FO8B 1D0GA 1AYM2 1QDOA 1QOSA 1RHI1 2FZ1A 3IIAA 5AC92 2OA2A 1QJU1 2DCYA 2PAKA 4G9SB 3KGLA 1MR5A 1RUG1 2LALA 1LCLA 3LA3A 1O5UA 4Z1VA 2TUNA 3WDWA 5K8SA 1N1TA 5KWRA 4GMP0 1UD1A 4XTPA 2O1QA 4F8AA 4YRDA 5BYNA 3MIGA 1W0OA 2D98A 2OVUA 2VW1A 4FTSA 1K5MB 4KU7A 4M3CA 1Q8VA 4HPKA 4RHV2 5BNPA 1O91A 4GB32 4PF5A 4XZPA 2R072 1NE6A 2F4PA 3LA7A 1CPNA 2E6VA 1PZ8A 5K9YA 2Y26A 4TLFA 3WCSA 2WNEA 5F1RA 2CNAA 4FAGA 2EF6A 1VAKA 3CJIB 3HT2A 4ATFA 1LEMA 1PM7A 4MV2A 1KFXL 4P9GA 5T5OA 4OI1A 4M01A 4ORFA 2EAKA 1UL9A 3O5SA 2YXSA 4UBHA 2WT1A 1HDKA 1D4M3 2BPA2 4SLIA 4YYOA 3WZ1A 4LLOA 1TE1B 3CO2A 1HQWA 4NPRA 2VVEA 1FV3A 4GIQA 4YGEA 2E53A 4R9BA 1CESA 2VW2A 3NSTA 3VDDA 2CL2A 1AYM3 4CDUA 4HVRA 2A73B 1SFYA 3VBSC 3Q9OA 3CEWA 4BCUA 5AC93 2OUJA 2ZCWA 3ZIXA 4CDQA 4G3YC 1YRZA 2H6BA 2ZAAA 4LHKA 4COZA 3BCWA 3VZMA 4OHYA 2RR12 3HMYA 1HXS3 4Z82A 3ENRA 4RHV3 3WUDA 4D3WA 2R073 5LK5A 5FOBB 4IV3B 4I2OA 1H1MA 4YZ2A 1FNYA 4FVVA 2YY1A 5LEJA 2DYCA 2PQQA 2X5IA 1X36A 4GALA 3UV9A 5T5PA 1MACA 2ET1A 3VBFA 4AGGA 1Y9QA 1A8DA 3UJOA 4BH9A 3B5LB 1C3HA 5I0RA 1WUVA 1W6OB 4HKWA 1O4ZA 3TNPB 1YIPA 2WL1A 2JG9A 4LBQB 5T5LA 2RJKA 3USUB 4A2UA 3DF0A 3I7DA 2Q1ZB 3N7MA 1BXHA 4DQAA 2JXAA 4IEQA 2R041 1UMZA 4XBNA 3V0BB 1XXNA 4PIXA 3OTFA 4P9XA 2D6LX 3ZX7A 1CAUB 4F83A 2VNRA 1UPSA 1DQ1A 1VLNA 5L7OA 2P3IA 5C8CC 5CFCC 3H8UA 3WHTA 1H2KA 2DFBA 4AYUA 1RHI2 1H1IA 2HWF2 1ND2C 3HIFA 1ZNPA 3UJQA 1QJU2 2GNBA 2DF7A 4DY5A 3E6DA 1RUG2 4D7SA 3J26N 1REFA 3RRDA 1LHNA 1BYHA 4JV4A 1UU5A 2Q0AA 4LO6B 4EWAA 2E9QA 4AG4A 2DVBA 3MIFA 4B8EA 2GMPA 3NKTA 4Y5Z0 1DQ6A 2RR13 3QD6A 2XL9A 4XFAA 1BKZA 3FUQA 5T55A 4K20A 3NWKA 1GICA 3I59A 3UKNA 1QOTA 2BWAA 4M3CF 4N43C 1ZZCA 4CTEA 3H3ZA 2BTVC 1E57A 4ASLA 4EJRA 1WLWA 4E4ZA 1LGBA 4R4ZA 4F3JA 3SH5A 2BUKA 2CY6A 2ZKLA 4Q2FA 3R6SA 4XJ8A 1NA1A 4N53A 4WVMB 5F6LB 2PHRA 4QD2A 1ULDA 4MXVA 5FO7B 2WQ4A 3URFA 3PJQA 1V70A 3SH3A 4LULA 5ABJC 1C5HA 2WZR1 1SFNA 3E5UA 1VBB1 4Q4X1 3S7EA 4I09A 2ZMLA 5A33B 3A0KA 3QOPA 4ZU7A 5L19A 1UZZA 2DVDA 3M3IA 4XFHA 1OOPA 1PO11 1RHI3 1HQLA 2HWF3 3R05A 3OCPA 5J98B 1RGSA 2C1FA 3FBYA 1RUG3 3O0VA 4AHZA 1S2BA 1YIFA 4AEKA 5DUXA 1GLHA 2DVAA 1QH7A 4AEJA 3GHNA 5GLWA 3JB4C 3D5OA 3PHMA 2QFEA 4FPKA 4QQHA 1NCRA 1OQDA 4NHKA 4WZFA 3SCGA 1D0HA 2V5YA 4WZCA 2NM1A 4IEUA 3RSJA 4WM8A 3J4UH 2VU9A 3OYWA 3SMHA 1NCQB 1TNFA 4PLNA 5HCFA 4EWDA 4MXWB 1POV0 4R4XA 3EO6A 3FX3A 2ZABA 4LA3A 4QPGB 5CNAA 2ZGRA 5I0TA 5I93A 1LKNA 2EXIA 4BWOA 1S55A 3GF6A 2R042 3U11A 3AJZA 3RNSA 3TOJA 2MHFA 1X82A 1QNYA 2D6MA 4I30A 4Z92B 1QJZA 1F5FA 1LULA 5AFEA 4FXKB 4OI0A 5GJ6A 5BNNB 2GH2A 5JIUA 1LOFC 5GZFA 3ZFGC 4K1YA 3ATGA 4U2AA 2WWSA 5CA6A 4WVWA 3TAYA 4NN0A 3B00A 3VKNA 1ZZ9A 2ZGNA 3WG3A 3I8TA 4RR3C 4XEZA 4PBOA 1HLCA 5KHHA 4AEDB 4HSJA 3BB6A 1OA2A 2BQPA 1LGNA 4XJUA 4AE2A 1CQ9A 4MX3A 4P9LA 2EXJA 3ZXEA 3R4UA 4NOTA 1LEDA 3VZJA 1Z78A 5DUUA 4B4RA 1WMEA 4FBFA 2D6KA 4FT8A 2PHDA 4YZ1A 2WZR2 3JUUA 3PVOA 1Y3TA 2PHXA 1VBB2 2HWC1 4Q4X2 4GKYA 1K5MA 1NLRA 4H7LA 3ZSKA 2VNOA 1HX6A 2XLAA 4K9SA 5LRRA 1PO12 3VBRC 1UKRA 3MF9A 1LR5A 1LGCA 4XTMA 3VHNA 2R061 5FDBA 4OHZA 4C1WA 4OZXA 4XBLA 4IEWA 1BEV1 1C57A 2VW0A 2ZHMA 4W65A 3ZMNA 2GC3A 1NYWA 3MDPA 4RS5B 1W6PB 2WC2A 2ARBA 1OMIA 3H7JA 4NWVA 2JKBA 3E6BA 3C2UA 3UK9A 4YLZA 1MEC1 1QWRA 2XJUA 4DNYA 2Z69A 3B9CA 3WVJA 2FBEA 5JCTA 1I1EA 3H1YA 1LOAA 4QGMA 1W6QB 2R30A 3AFKA 3DV8A 3OY8B 5DZGA 2GAUA 5CU1A 4FPJA 4BYYA 3FLRA 1CAWB 1JW6A 3ZFFC 1RUOA 5HCBA 2QDNA 1MS0A 2Z5WA 2WNUB 1DG6A 2WZR3 1PHMA 1H1AA 4N90A 1VBB3 3ZFEC 1XU2A 2VMIA 2XLGA 4Q4X3 2WJSA 4XILA 2EA7A 4OVEA 4MVTA 3B02A 2JG8C 4OHVA 4QU2A 1BMV1 4G4FA 3B9IA 1PO13 4IV3A 3VZKA 2DVFA 3O7OA 1NG0A 4J1WA 1AR71 1RUF1 2A6WA 5JOZA 2NMOA 5FREA 2GSYA 2D5FA 3N35A 4XFIA 3ZXLA 2A3WA 2CGNA 1UF2C 4L8QA 5A3MA 4N9IA 1C28A 4Z2WA 3NVCA 2QE3A 1V6KA 1W6OA 4BLJA 3ZYPA 1ULCA 4JGZC 2BBVA 5BNQA 4LBQA 3USUA 3JBG1 4KGGA 1I9RA 2P37A 4AQSA 1GBGA 3V0BA 4O9EA 1LODA 1LECA 4HANA 1F5JA 1CAUA 3L2YA 4YM0A 1WGPA 4D69A 3LB9A 1J3RA 2YROA 3THPA 2WKKA 2MPFA 1HKDA 1YLLA 3GBWA 1WD4A 1AUYA 5FOJB 3RYRA 4JVAA 5I8SA 1B35B 2B9UA 1RIRA 2JECA 2ZX4A 1DBNA 3LSEA 1SACA 3JB8A 4Q1PA 5C9AB 4CP2A 1U0AA 5CFDC 1D2SA 5JSOA 1OQEA 2HWC2 3O12A 3E6CC 1CD3G 2HEWF 2I74A 3M8LA 4QQPA 4A3XA 1PGW2 5J09A 4UW4A 5AVAA 1LU2A 2BNMA 5FPZA 5JAXA 3JD71 2H6CA 5FLJA 2OW4A 2EALA 3WG1A 1LHOA 4JAAA 2YGMA 3MPPG 3M3OA 3EJKA 1BVP1 2R062 4XJ9A 4Y26A 4YW1A 2ZPXA 4C0BA 2XPJA 4YGCA 1BEV2 2A75A 2N7GA 4WVMA 5FCCA 1JTZX 4JRLA 1VB2A 4CP1A 5EYXA 1YFYA 1MEC2 4M0NA 4BA6A 1NQDA 3AKPA 4PBPA 1EPWA 3IDBB 3M3CA 4P5HA 4DXZA 5CB7A 1VALA 5EYYA 5A33A 3AMNA 4YVSB 2ZZQA 3PNAA 2XH6A 3D6EA 1Z7S1 3S30A 5K7PA 3QBQA 2C9AA 3VN4A 4LE3A 4XFCA 1H8TB 5T50A 1H4GA 2ZTNA 3M2MA 1AYM1 1KXGA 3OJBA 4TZDA 5AFBA 1RUC3 1KQRA 2WSUA 3FHIB 2XL7A 2HWC3 2Q8OA 4AGRA 1FOD2 3HQXA 2CYFA 1V6NA 3BU7A 3LGRA 4AFBA 4CDWC 1BMV2 1OA4A 2X53S 3HWJA 2QQPA 1JYCA 2ZX3A 2GC0A 2QJVA 1HXS1 1ZA4A 3EQEA 4Y1YA 3VZOA 4RHV1 5EWSA 3O0XA 5J7MA 1AR72 1RUF2 3K48A 2R063 4BMEA 1NCQA 1MQTC 4FPFA 1QHDA 1BEV3 1ULEA 4MXWA 1QXRA 4X6RB 4O9GA 2ZBJA 4QPGA 1ZREA 5JPNB 1F2NA 2KXLA 3VBOC 3RS6A 1XNDA 3AP5A 4JGYA 3MLLA 1G7YA 3JBG2 4GMP3 1MEC3 2ZMKA 3VDDC 1N47A 5JZGC 5F5QA 1QNWA 3FLTA 5SV5A 2A70A 2ET7A 3RG0A 4IEZA 5JSPA 4QXKA 2XLFA 1Q3EA 1RINA 2GZWA 3VKOA 3ALQA 3VHOA 2CWMA 5BNNA 3KZ4C 1FX5A 1PO21 4WM7C 4XHXA 4L99A 4R9AA 1GZWB 2B39A 1AX0A 1SBDA 2WS91 4Y22B 1YHFA 2WFF1 3LAGA 4TYSA 4GXLA 1Y7BA 3WW2A 4XBQA 4BPZA 2XJVA 4I3GA 1AJKA 3VBSB 3RWNA 3D0JA 4MUVA 1BQPA 1FOD3 1YXWA 2QUOA 3I2DA 1IS4A 1PVC1 3AXEA 2PTMA 4AEDA 4NR1A 2AR6A 1FAYA 4AF9A 5GM0A 3JD72 4FOWA 2G4IA 1RUD1 1AR73 1RUF3 3VLBB 5EV7A 5GKAC 4K40A 3WHUA 2X29A 4LBJA 4W6WA 5E1RA 3V56A 2UWCA 4OHWA 4N9HA 2NZ9A 4YM1A 5JDBA 3L9JT 4IV1C 3QH7A 4XOGA 3JBG3 4Q4Y1 1JOJA 3MLKA 1JHNA 3RJRA 3GNEA 2PHUA 1J3QA 1EY2A 2JENA 3VL9A 1Z7S2 4LO5B 4LLFA 4L97A 3BTAA 1O4TA 1TQ5A 2PA7A 1N3OA 1WMDA 3OBTA 2IXHA 1DGRN 2WNVC 3HD8B 1U5XA 2HWF1 5BNOC 1EAH1 5CFCB 1G9BA 1H8VA 3H7YA 2ZA9A 1ND2B 2A71A 4GKXA 3R0RA 4RS5A 4BOWA 1W6PA 2R1BA 2ZAHA 4FTBA 3NV4A 4N7IA 4LO4B 4D7TA 3EXUA 1HXS2 2R1DA 2VULA 3WCRA 3JD73 3BOWA 4GQ7A 1FT9A 1U12A 1SBEA 4H7MA 3VHPA 3KMHA 4FP3A 3ZDSA 1RUJ1 1W6QA 1G6NA 2D5HA 2XJQA 4MSVA 4QQLA 2XWJB 3OY8A 4N43B 1KRIA 4HZFA 2WLPA 1EV11 2WA3A 4Y20A 2DTYA 4HKLA 1N1SA 2K9ZA 3FE5A 4CEYC 3GBGA 1FNZA 1Q56A 4AFMA 2VMGA 4HVQA 5F6KA 2WNUA 3AKRA 4Q4W1 3BALA 4HN0A 2QKDA 3TB0A 1O3TA 4DY3A 2D43A 1VBD1 1TME1 1Z7S3 1B09A 1PO22 1SLIA 2W39A 1QF3A 4MGIE 3S0MA 4MGYE 2XWBB 2BNOA 2WZPP 5T5JA 1MVEA 4C90A 3H1WA 5T52A 2WS92 2XB6C 1I5ZA 1OLRA 1S0DA 2P17A 4OI2A 4RA0A 1NCRC 2WFF2 4Q8KA 5K0UC 1HV0A 1LENA 2VOKA 3VKMA 3AJYA 1UIJA 4YZ5A 3USSA 4CEWC 1OPOA 4AVCA 5FPXA 1GQHA 1PVC2 3AP4A 4J1XA 3PTYA 1W6NB 1S0IA 2YUEA 1H9WA 1N1YA 2RE9A 2HJIA 1DQ2A 3EBRA 4IEXA 1H2MA 1RUD2 3RI8A 2DURA 2G9GA 5DZEA 2W08A 3WD5A 4GH4C 3KT7A 2BGCA 2K2SA 4KWKA 1AX2A 3INAA 3GBFA 1B35A 4IEOA 4PDWC 1Y43B 2CAUA 4YGDA 4Q4Y2 5C9AA 4A7KA 5JPMB 1W6MB 1S0EA 1LHUA 2RS11 2XJRA 3KS7A 3N36A 3MW3A 3WY6A 1EYBA 3ME2A 4E2GA 3NAPC 3CF6E 5EJ3A 4EN6B 4WV8A 1PO23 3AM2A 1VJ2A 4UW3A 2B45X 4EWEA 4LE4A 2V73A 2PAMA 2E7TA 3AZVA 3HBZA 3LZZA 2A6VA 3M4FA 4PLOA 2WS93 4XQ4A 3WNXA 1EAH2 2WFF3 2ZACA 3DL3A 5T3NA 2WSVA 3ZFGB 1PK6C 4ISRA 4AVSA 3H0OA 2VVFA 1PVC3 1ZZ7A 2AREA 3LA2A 2ZGTA 3AKSA 3PVEA 4YFZA 3NJZA 1ENXA 5CADA 3RQ0A 4XF1A 3AX4A 4RR3B 3ECQA 1RUD3 4SBVA 2I45A 3R4DB 4YVSA 1RUJ2 1W0PA 1JBCA 3KD4A 3ZPYA 5A3LA 5HXVA 2PYTA 1MS5A 4I0WB 1EV12 5I0UA 3AMMA 2LM3A 4LTAA 1QXPA 5J3UA 1C4RA 4B7KA 2D7FA 4Q4V1 3M7AA 3NL1A 5FQ0B 4P9JA 4Q4Y3 4XFBA 3ZYJB 1O7FA 4DS0A 3AB0A 1SEFA 2RJLA 4HK8A 4Q4W2 3VBUC 4PJYA 2OIIA 4NWWA 1H2NA 4XFGA 3VV1A 4COYA 3VBHC 1VBD2 1PIV3 1CAVB 4KWLA 1TME2 4QQOA 2ATFA 4I01A 4LBQD 4OLLA 2D93A 3SCHA 3TNQA 1EAH3 3AYEA 4RGAA 3VBRB 1L3JA 5C4WB 1G86A 4RQPB 5EXOA 5GZGA 4XMAA 5GZEA 2BYVE 1YJLA 2MNGA 1WBLA 1H9PA 1RUI1 1XNKA 1Q8OA 2D97A 4Y1XA 1LJ7A 5BV6A 1RUJ3 2IXIA 3RJ2X 3ZYRA 3WW3A 3S7IA 1EV13 1GV9A 2ZGMA 1GZWA 4Q0PA 4ZKTB 4FQZA 4Y22A 2EXKA 2A5ZA 1COV1 4Q4W3 1LOBA 1YNAA 4IESA 3VBSA 1PMIA 2RS12 1IKPA 5H9PA 1BZWA 2B5HA 2UYBA 2ZGUA 1SCSA 3QACA 4XQDA 1VBD3 3DGTA 3ZFFB 5B2GB 4HSLA 1NQJA 1TME3 5FAXA 1TEIA 2GN7A 4M3CE 1V6OA 1GFF2 3ZFEB 1VBE1 1SLCA 3SH4A 1KS4A 2PAEA 2NQYA 1O3RA 1RMU1 1X8MA 2JG8B 1N3QA 2EXHA 1ND3A 3U07A 4YW2A 5KC5A 4KG8A 3APBA 1YCIA 4FTEA 1J3PA 3QH6A 1EP0A 1SLTA 4HL0A 3M3QA 2Y0OA 5JOWA 4YVWC 3RYKA 4FAHA 2QDRA 1UZYA 1CAXA 4W6XA 1VAMA 1ZRFA 3RPQA 5GLZA 1N3PA 4QPIC 4JGZB 1ENQA 4LBMA 3VL8A 5CIRA 1AVBA 1IOAA 1QU0A 4Y24A 1RUH1 4QPYA 3IKWA