1OA3A

Comparison of family 12 glycoside hydrolases and recruited substitutions important for thermal stability
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
218
structure length
218
Chain Sequence
ETSCDQYATFSGNGYIVSNNLWGASAGSGFGCVTSVSLNGAASWHADWQWSGGQNNVKSYQNVQINIPQKRTVNSIGSMPTTASWSYSGSDIRANVAYDLFTAANPNHVTYSGDYELMIWLGKYGDIGPIGSSQGTVNVGGQTWTLYYGYNGAMQVYSFVAQSNTTSYSGDVKNFFNYLRDNKGYNAGGQYVLSYQFGTEPFTGSGTLNVASWTASIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ENDO-BETA-1-4-GLUCANASE
publication title Comparison of Family 12 Glycoside Hydrolases and Recruited Substitutions Important for Thermal Stability
pubmed doi rcsb
source organism Hypocrea schweinitzii
total genus 55
structure length 218
sequence length 218
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2002-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01670 Glyco_hydro_12 Glycosyl hydrolase family 12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1oa3A00
2JICA 2JEMA 2DFBA 2QZ3A 1OA4A 2VGDA 1REEA 3M4FA 1XNCA 2B45X 4XQWA 3WP6A 1XXNA 2NLRA 3WXPA 3VZNA 1NLRA 5HXVA 2DCJA 2DCYA 5K7PA 1XYNA 1OA3A 1OLRA 3MF6A 3WX5A 1REDA 3WT3A 1H0BA 3LB9A 2NQYA 2VULA 3AKTA 4H7MA 3VZLA 3WQ7A 1XYPA 5K9YA 3WP5A 3RI8A 1QH6A 1T6GC 1YNAA 2BWCA 4HKOA 4XPVA 2BWAA 1XNKA 3VL8A 2QZ2A 3VZJA 1KS5A 1UU5A 2C1FA 2B42B 4HK9A 3HD8B 3VGIA 3VHNA 1HIXA 3WQ1A 3AMMA 3MFAA 3VLBB 2BVVA 1UU4A 2F6BA 1XNDA 2VUJA 4S2FA 3VZMA 1TE1B 1H8VA 1BK1A 2D98A 1PVXA 2Z79A 3VL9A 2DFCA 3B5LB 3AKSA 3LGRA 1XNBA 4XQDA 3VHOA 1BCXA 3EXUA 1ENXA 1C5IA 4HK8A 4HKLA 4S2GA 1IGOA 2VG9A 1W2UA 4XQ4A 2D97A 1UKRA 1AXKA 3AMPA 3MFCA 1H1AA 5EJ3A 3WR0A 3VZOA 3WQ0A 3MF9A 3AKPA 3WP3A 3AMQA 1KS4A 1XYOA 3WY6A 4IXLA 3WP4A 1QH7A 2DCZA 3AKRA 3B7MA 1HV1A 3AMHA 3ZSEA 1BVVA 4NPRA 1UU6A 2B46X 1C5HA 1HV0A 3AMNA 1OLQA 1OA2A 1F5JA 4S2DA 4S2HA 2JENA 4HKWA 3VZKA 2BW8A 1M4WA 3AKQA 3RI9A 1H4GA 1REFA 3O7OA 1H4HA 3VHPA 2DCKA
chains in the Genus database with same CATH superfamily
2MEV3 2E53A 1S1AA 2ZZQA 4BMBA 1ND2A 1SBEA 5FMBA 4F7ZA 4QXHA 3TYJA 2VUAA 3SQOA 2JX9A 4KQ7A 1DP0A 3Q9OA 1OMIA 3EYPA 4GWIA 5A3OA 5IFTA 4Q8KA 1CAWB 1XE7A 5F7UA 3AFKA 2Q5TA 3NNFA 1OQDA 2Y60A 2VZTA 4GJZA 3ILRA 3OYWB 1CAWA 1W8HA 2TNFA 4BCUA 4XFBA 4XXAA 4PBOA 3THCA 4QX3A 4NIDA 2OIIA 2B4KA 2WABA 1LTEA 3UGFA 1FATA 2D5HA 2CDOA 4P5YA 4PBPA 4LORA 1LCLA 1O4TA 3WG2A 3WG4A 3SLIA 4JKMA 2ET1A 1UIKA 4NHMA 5DXDA 2JDYA 4K21A 1T6GC 4HKOA 1C28A 2A1XA 4H55A 1DGLA 2W08A 5JR7B 4EWDA 1S0EA 5AC93 1JW6A 1QHDA 2HWC2 1C1FA 4UFLA 3OGJA 2QBXA 3P6BA 4IQPA 1W2AX 2C1FA 5AC91 5L73A 1EY2A 4NRQA 1SACA 5FXVA 5B4NA 2FDKA 1Y7BA 1QKQA 4EYUA 2E26A 2HWB1 2P3KA 1U12A 2C9KA 3IKWA 3N9LA 1HXS3 5F39A 3VBOB 4Y4YA 5FQ0B 1I1EA 3TEYA 3CL1A 4MV2A 2RMU3 1LR5A 2A6WA 4CDUC 1PO13 3VBOA 4E2GA 5FQ0A 1GQHA 1D4M3 3SCHA 4LHSA 2X10A 2ZGSA 2VCCA 3IAPA 3ZSJA 1OF3A 2ZPXA 2VZRA 4NRPA 4Q4V1 1QXJA 3ZFGA 2HH9A 5FYMA 5T50A 3VHOA 2ARAA 2WLQA 2XBO3 1W6PB 1WZXA 2I45A 3OPTA 2JDHA 4YW4A 5H9QA 2IC1A 2WNVC 4FI9A 3N7MA 3A7QA 1UMZA 1R081 1U5YA 3CHXA 5JMOA 5KWRA 3JQWA 4EE2A 1LGNA 2XDVA 4TLFA 5FZ8A 2WQ8A 4B4PA 2C5DA 2HWF3 5CFCB 3SKJE 1NA1C 3M3IA 5CKNA 4NN0A 1H1IA 4CEYA 4EWAA 1W28A 3JD72 3WQ0A 4JGYB 2ZZJA 4LUKA 2VZ1A 4FVVA 1HB2A 4DY5A 4A3ZA 2ZGMA 1QJY3 2ARBA 2FDJA 1BXHA 1LOEA 1YRZA 3CJXA 4IESA 4Y3OA 4AVAA 2FDHA 3C8XA 3F95A 2C4XA 1U5IA 3VN4A 4CCDA 3B7MA 1OLMA 2DVBA 4HSLA 5FXWA 2YU1A 3J26N 5FY8A 3VKOA 1HDKA 1O7FA 2XHNA 4AAXA 5BV6A 1NUKA 5LW9A 1AXYA 4UYBA 3OEBA 1IOAA 2D5FA 2GZWA 2D6KA 4ISRA 5FYBA 3NJXA 1CAXB 2WSVA 1W6OB 2D93A 1ZZBA 2WZ8A 4NPLA 4QPIC 2V09A 4D6QA 1RJ7A 1JMUB 1W6OA 3PUIA 4HXCA 5DAXA 2ERFA 3RGBA 1LOBA 1RUD3 2ZEWA 5AVAA 5FYZA 2IXCA 2CGNA 5FZ6A 2J1UA 5C4WA 4N43B 3VHPA 4YRDA 3J8F3 3OUIA 4AGGA 4FTEA 1BLZA 2OXBA 3B9CA 3I2JA 1IQDC 2G9GA 1JZ8A 4ZS2A 4LBOA 3POIA 1REEA 3NJYA 4BIFA 1RINA 4WM8C 1Y9GA 3WP6A 3ZXKA 1ACCA 2VE1A 3MIEA 4FPEA 3FN9A 1WW7A 4ITCA 3O1MA 4LBQB 2AENA 4MX3A 4FQ4A 2V4AA 4LBQA 1UN1A 5FPZA 5TSWA 4DXTA 4IL7A 1S2EA 3D0JA 1GP4A 4PDWC 4D6SA 2BRTA 1JYVA 3ZSLA 1PMJX 1NCQA 3WUCA 1UQXA 3MUZ1 4JX0A 3VBFC 2VULA 1L7LA 4ZY9A 1UZYA 5LK5A 2ZBJA 3AL6A 1XYPA 3JBG2 4ZKTB 2Y6FA 4Y20B 3E6BA 1GNZA 1WW5A 3RI8A 1G9FA 3B69A 4A45A 1XOYA 4Y20A 3HBZA 4XPVA 4C8DA 2YC2A 3T2PA 3BTYA 4GJYA 2CTVA 5F37A 2J42A 5LB6A 1F9KA 1KS5A 4E2SA 3RQ0A 2VMEA 1NKGA 1UX6A 2YFZA 3KCCA 4AFMA 4P9GA 4XDOA 3N9PA 4XTMA 4P14A 1SEFA 2Z2SB 3AMMA 3CQOA 4YW5A 5FPUA 1AJKA 1DQ0A 1CAVB 4QKNA 3ZFFB 1W8UA 4P00B 4A7KA 1UPSA 3CO2A 5FFOC 5LRRA 3ZYGA 2GC0A 3ZFFA 3Q8FA 2V72A 1PGSA 1RVF3 2HWC1 4GD4A 1H9PA 4QD2A 1BZWA 2W46A 2VCMA 3RVHA 4NWVA 3I7DA 4FP2A 3M3QA 2QCSB 2VCBA 3VKNA 1WA4A 4LBQD 4UF0B 1A6CA 2JDUA 3BTZA 4D7SA 2DBNA 2E51A 1OUSA 2JDNA 1DGRA 2BP6A 1AUYA 2WFF2 4DY3A 2XH6A 1EP0A 5E1RA 4S2GA 3D82A 4IDZA 4QHZA 3D5OA 4DUWA 3G7DA 1I5PA 5GALA 1FV3A 4XTPA 3CJIC 4I0BA 2F17A 4N53B 3RS6A 4Z2AA 2WNUB 4J6GA 2ZGNA 5F1RA 1N3OA 1QQP3 4YM3A 2VL4A 1IPSA 3FJSA 3GM8A 3LA3A 4CDXB 2VXRA 5IYYA 1RUF3 2FMDA 3RMYA 1MVQA 4GULA 4XFGA 3WP4A 1NE4A 3H3LA 4L0PA 3M8LA 4COVA 1QGLA 1UYPA 1ZZ9A 1UF2C 2VW2A 4WZCA 2JDKA 1XU1A 2WLPA 4RS5B 1N1SA 4QM9A 1KITA 3JD71 2PHWA 2R073 4KWLA 3WF0A 4RS5A 3OY8B 3PVNA 1CPNA 5BNOC 3VD5A 2P17A 5IVBA 2WS93 2ZJCA 4CUGA 5IVVA 2QTWB 2J1RA 4HKWA 4ARXA 4YFZA 5FYUA 4DEQA 3AYAA 2I74A 4IE0A 1W8ZA 2DTWA 3O7OA 1H4HA 3WDYA 2WRAA 5K8SA 2E7QA 3NAPB 5AC92 4LO6B 1UY2A 5L9VA 4R4ZA 2RJKA 1BMV2 2B45X 2JDPA 2FD8A 1HB4A 3DKWA 3C7FA 3CZJA 3WXPA 2W87A 2XOMA 5IATA 2DDUA 3WDVA 3WF3A 4YZ2A 3POWA 5I8SA 4LO4B 4KBZA 4NHXA 5K7PA 1JYWA 4LIVA 1AL21 1H2MA 4I3GA 4IV3A 3AZZA 5IAVA 2LM3A 2RMU2 5KXDA 4AVTA 1LOFC 1PO12 2RM23 1GZCA 3AC0A 5BNPA 2XQXA 3GCXA 3IPVB 2JIGA 3E5XA 3O1PA 1GP5A 1HRV1 3O14A 2OZ6A 2C0ZA 1J3QA 4CXWA 1SFPA 2WYFA 4QHOA 2ARXA 4INDA 2Q8EA 4B1MA 5JWPA 2O1QA 2XBO2 4AI0A 1QH6A 3NNGA 1OQEA 4BK5A 2CAUA 1SLCA 2DU1A 4AI3A 3RZLA 1LHWA 1W9FA 3CF6E 2NYYA 2O8QA 2XLAA 4N8MA 3N7JA 2MHFA 5FXZA 2Q30A 1OOPA 1D0GA 1KJLA 1F35A 5LA2A 2HWF2 3D8CA 2E6VA 2VTFA 2YGMA 3LPGA 4DUVA 3H8OA 4XUOA 1AXZA 4XUNA 5FYCA 4AHZA 4M4RA 2VAUA 5EZWA 4LLOA 1QJY2 3HIFA 3KCXA 2IXIA 4QB1A 2XGXA 1X82A 1G9AA 4MZUA 5CFDA 2OKXA 4LO5B 2VUJA 4NAMA 2XUEA 1U5ZA 4WVZA 4JQTA 2Q1MA 3ZO0B 4J1WA 2PMWB 4W65A 5GZFA 4AWDA 2DF7A 4CU6A 2ZX1A 3SCGA 1POV1 2GAUA 2C24A 4RSUA 3U14A 2LRPA 3TNPB 3AJZA 3D3AA 3VBUC 3A4UA 4B7EA 2EXJA 2NMNA 2YXSA 2BZDA 3TB0A 1V6KA 2XWJB 2QQLA 3LDBA 1T6BX 3LSDA 4NE9A 4Q4X2 2XL7A 1OPOA 4ZZ8A 5EJ3A 2Z42A 4XMAA 2A6VA 4JRLA 3J8F2 4OHWA 4P9LA 2WQZC 2ORZA 5FUNA 1PMHX 3NWKA 4OI1A 5HBAA 1SMVA 3AFGA 5LCWL 2WFF1 3VHRA 2UURA 3I97A 5C5TA 4IV1A 4WM7B 2QQKA 5F5AA 3AXEA 1GANA 2O14A 3ZN5A 4JV4A 2V5YA 3ZKYA 1MQTC 2ZABA 2ZHMA 3P3PA 1C8NA 4Y1ZA 4JAAA 2ZS6B 5H9SA 1DGWX 4EJRA 4GQ7A 2W1WA 5FYTA 3AMNA 1AR82 1VRH3 5A1FA 3PJYA 1JHJA 3OGVA 4ATEA 2JENA 5CEHA 1K5MA 2CGOA 3PMEA 2F4LA 1XQNA 2ENRA 3MYXA 5KHHA 4YZ1A 5JI9A 4COWA 3RI9A 1F5FA 4IGOA 4COUA 4AFAA 4M3CA 1C3HA 1SLIA 2UWAA 1JOJA 4GMP3 1AHSA 4OVEA 1VAMA 1AYM3 1YCIA 2XMLA 3D0SA 4J1XA 5DPNA 5JZGA 4FSJA 1Q5OA 1QJZA 4LMFA 2DU0A 2PHXA 3ROUA 3C3VA 2QQMA 1PK6B 1WMEA 2YMZA 3VKMA 1XU2A 4F8AA 4JHTA 1SG3A 1MZFA 3J9SA 3R4SA 2LW8A 3ZN6A 2R043 5A7WB 2P6HA 4H7LA 4LHNA 5E89A 3WQBA 4O61A 4R9BA 1RVF2 4RR3C 4XF0A 3SNMA 5A7WA 4D69A 4JGZA 3VD3A 1BMV1 1UZZA 1RUC3 3AKTA 1HQNA 1W99A 3EJKA 4H7MA 4CUCA 4BM8A 4XFHA 5FY0A 5D21A 1S55A 4YW2A 3WG1A 5KHGA 1HXS1 4M0HA 3NRUA 4AI1A 4C1XA 4GH4A 2LTNA 3SMHA 1S0BA 2Y33A 2RMU1 3S7EA 1PO11 2VUCA 4JRAA 3ITQA 5C8WA 1TEIA 1AX0A 4Q4W3 4WVMB 1US2A 3KV4A 4BQYA 2D6LX 4QXCA 4O9GA 3VBRB 3FX3A 1X33A 1F8VA 1QQP2 4QPGC 1LESA 1NCRB 1X9PA 3K4ZA 2XBO1 2VJXA 3VBRA 1DHKB 2NP0A 4IGQA 3HR9A 1RUF2 2BVVA 3R4UA 4HT1T 1NCRA 3WNNA 3MI8A 2XJTA 3ZN4A 1O3RA 2W39A 4A2UA 4CEWC 3O1RA 3VD9A 2AC1A 4N90A 4XDPA 5CNAA 1PVXA 2HWF1 4FCAA 4AQSA 2QQNA 1SCSA 3OBRA 1RUH3 3NV2A 3E97A 2R072 4AVVA 1DQ2A 1ND3C 4MOAA 4LOTA 1QJY1 2V4VA 2FBEA 2HBTA 1KEXA 2EF6A 2VU9A 3TNQA 2R6QA 2A71A 4CDQB 4Y22A 4AHXA 1D2QA 2ZX2A 2VNVA 1B35B 2RHPA 1O91A 1UOFA 4ONUA 2ET7A 5JVVA 4BQWA 4CDQA 1JBCA 2ZMLA 4RQPC 3WG3A 4GKYA 1KS4A 2FMYA 2JE7A 2WAOA 1FT9A 2WBKA 2VMHA 4BISA 2ZKLA 1SLBA 1YQ5A 4HANA 4YVWC 4QHBA 1UL9A 3K2OA 3PJQA 3KMHA 4QKBA 3E5QA 2BBAA 3CBNA 4Z82A 5HI0A 5FYVA 3I2OA 1CJPA 4BQ5A 1UOJA 3BU7A 4XF4A 1DGWA 1H8TB 3AP6A 2ZTNA 3J8F1 5IFPA 1SLTA 2R30A 2RM22 4PIZA 1AL0G 1Z78A 1H8TA 5JSPA 3FUQA 1YWKA 5T5OA 3ZLIA 5C70A 5KC5A 5T55A 2O8OA 3U07A 5FY4A 2WO7A 5BNNC 1VBE2 1Z0HA 4MGKE 5F5IA 3AKQA 5JUVA 1CONA 1O3SA 4FXGB 1H4GA 1REFA 1GKBA 1W6NB 4GKXA 4UW4A 5FPVA 1OURA 3I2DA 2X29A 1GR3A 1RGSA 2DCKA 3IDEA 1WCDJ 4QB2A 2JG9B 3H3UA 1ULPA 1YJLA 2VZSA 3HOBA 2JG9A 5EJ1B 2PHLA 1PZ8A 3HQUA 1PVC3 1YI7A 4MH0E 1NLRA 4PJYA 4RGGA 4AEDB 4AEJA 3FZ3A 2ZKNA 1JOBA 3POEA 1UYXA 2KM2A 4AEDA 5GLWA 1JXNA 2BJSA 2HEYF 4E4HA 3VBHA 5HCBA 2ZGUA 4Q2FA 3DF0A 2EAAA 3DPRC 3WCRA 4I0AA 5LATA 4HG6B 2AREA 4FPGA 1TQ5A 2NQYA 1AX2A 3LQCA 5HPOA 1MS8A 3MZHA 1LEDA 2VQTA 3ZFEA 1PIV2 2YY1A 1WCQA 2BQPA 4N7UA 3NJVA 3NMBA 3U37A 4I09A 1DCSA 3ACGA 1J59A 5FO7B 1W6MA 3PNAA 3HT2A 1GU3A 1O4YA 3WZ1A 2VNOA 3UKVA 1JZ6A 1EV13 1GQPA 4BU2A 1RVF1 3WHUA 2YROA 1ULFA 4Y1UA 3WUDA 4XDQA 4QWNA 3HQXA 5FDBA 5FOJB 1G9DA 2XPJA 4EZ4A 1B09A 1DBNA 4FOQA 2VBBA 3KHBA 4XIKA 5FPBA 5JLVA 1TMF3 1H2KA 1UU4A 5GKAC 1DYKA 1XB9A 2AYHA 4SLIA 1HN1A 2YV8A 1TE1B 3OOXA 1BK1A 4CDUB 2K0GA 1MS0A 2DUQA 3N36A 4OFGA 4OUMA 3T4HB 3MLJA 3THTA 4L2NA 3V0BB 1VBA3 2VC9A 1PX4A 1QQP1 2P3JA 2UWCA 5DDJ3 1HQWA 4CP9A 3DL3A 1VRH2 3KM5A 3MO4A 3H8UA 5FKCA 3V0BA 2OW4A 1S2KA 1RUF1 1XPWA 4AZZA 4V2WA 5I0TA 5A33B 4XQ4A 1IG0A 1AR62 2DURA 1YFUA 2ZHLA 3O5SA 1WCSA 4C0BA 4BQ2A 3DN7A 5KHKA 5FYIA 1UY0A 4P9WA 1NA1B 3FE5A 4IE6A 2R071 3N35A 1AYM2 5IVCA 5DUWA 2VVFA 1CPMA 1NQJA 2WFPA 2P2KA 4BLJA 1S0FA 2WS91 4Z92B 2DVAA 2QE3A 5FJKA 1CIWA 2ZGOA 1ULDA 4D6RA 4L11A 1K45A 5A3PA 5A7QA 1EUUA 1I6XA 1QH7A 3TWIA 4DXZA 3IM0A 5IUQA 3ZSMA 3AMHA 3JBG3 4KL1A 3UL2A 5E16A 5JPMB 1Q8PA 1LU2A 2B7YA 5ANQA 1UU6A 5C71A 2R042 2XUMA 4YZ5A 2W0XA 1PX3A 1CQ9A 2A6YA 5J1XA 1WLDA 5FZ0A 2AACA 1VRBA 2XKPA 5C3RA 1J3PA 4CDWC 5EFUA 4CP2A 3AP7A 4XUTA 4Y1YA 5A7PA 4NIGA 1FOD3 4QPIB 3BOPA 2IXLA 4IEQA 3ES4A 5EPAA 4AI9A 4K3UA 3T08A 1VP6A 1BQPA 2Z4FA 5FUIA 2DCTA 2JXAA 4X8NA 3ST7A 3APBA 4HN0A 1GNYA 2EIGA 3F2ZA 5CZKA 2RM21 3ZYFA 1UY3A 2PHRA 3KF5A 3WDUA 3PUSA 4FPYA 4XQWA 4Q4W2 2NLRA 1JUIA 2KD7A 4WM8B 1GICA 2P4EA 2Y0IA 4L92A 4XC9A 4CZSA 1AR73 2JG8A 1ZZ8A 1RUE3 1XYNA 3L2YA 1X8EA 4HONA 1HN0A 4EROA 2BGCA 4LULA 1H1MA 2DVDA 3H42B 4PDWB 4CP1A 3C7GA 3ETPA 3GDBA 3VBFB 3S0MA 3OSDA 4LT5A 2DWRA 2ZGRA 1FX5A 2RS52 2Q8CA 5C3QA 1VMJA 2BVBA 3WF1A 4MUVA 3KV5A 3VBSC 1APNA 4B4QA 2HWE2 1NLSA 2ZA9A 1P8JA 5C9AC 2XJVA 3WDXA 5I0SA 1TZOA 4W6YA 1CN1A 1JH5A 2YZ4A 2ZHKA 1POV0 4ZXEA 1FYUA 1VMHA 1XNKA 1YUDA 3H50A 5H9RA 3BIEA 2AEZA 2WINB 2VECA 3IWZA 3HD8B 1HQLA 3LE0A 1PIV1 4IUGA 3TAYA 3POJA 4YZ4A 4QQOA 2Y6JA 4L97A 2K9ZA 2VW1A 1OVPA 2Q8DA 2W2IA 1MR5A 3PIGA 1CD3G 4NR1A 5CISA 4TTGA 3OYWA 1XNDA 3FFZA 4LJHA 3V64A 5IVEA 3NKGA 4IEVA 4OLLA 1H8VA 1LKNA 5FZ9A 1YJKA 4CA9A 4IEXA 4CXXA 1BBT2 2J1VA 4NROA 3VDCA 3I2IA 2WN2A 2JDMA 1L7RA 1N3PA 2YHJA 2OYZA 3ZXLA 1PZ9A 4D94A 4P08A 4L8QA 4LPLA 5CBLA 2R16A 1V70A 4XF1A 3HNBM 3UKNA 4DIQA 3I8TA 3KLSA 4BQ1A 1MS9A 3BALA 2WWJA 3ZDVA 1RUJ2 5E8AA 5FXXA 4OYUA 1LENA 2J1SA 3LIHA 2WJSA 3MGUA 4COZA 5ABJC 3QH7A 3CJIB 4OUEA 2MPFA 2IFWA 3TEWA 2DVFA 2WR9A 1W6QB 3GF6A 2D6MA 4QQ2A 2FDIA 4E4DX 1VRH1 3SEEA 3GBWA 4YGEA 2D3PA 1YFWA 4OUSA 3C7EA 3GBFA 2E31A 1PVC2 4Z1VA 4XZPA 4Q0VA 3HN1A 5EV7A 5FPLA 1AR61 3FFQA 3UETA 3AYCA 4NRMA 3MW4A 1IS5A 2PQQA 2B39A 1E5HA 1RXGA 3MV01 5CVRA 2DVGA 4YVSC 4GMP1 2VZPA 3I54A 4BE3A 2CNAA 2CGPA 2VOVA 3DEMA 1AYM1 5F2SA 1W6PA 4EV0A 1RUNA 3C7OA 3AM2A 3ELNA 3OB8A 4QQLA 5F5CA 3HQRA 3I2HA 2OVUA 4FOYA 5CFCA 2JDZA 4YG3A 2J1AA 5F6KA 3LPFA 3KT7A 4O7XA 5J7MA 2R041 3MW3A 4G9SB 4XMIA 4JGYA 1JOPA 3DV8A 1EV12 3DKQA 3USUB 3NKTA 2F4PA 2P3IA 1EPWA 4QQHA 4AAPA 4DO0A 1A8DA 5K0UC 2WA3A 1RUC1 4NJ4A 4A44A 4YPJA 2UY8A 2XHKA 4HL0A 2BNMA 3RG0A 3VZNA 4D8MA 3TN93 2WDBA 4R9AA 1CX1A 4OHYA 2J7MA 1O6UA 4AW7A 2QQPA 1PM7A 5I8YA 4BQ4A 1TMF2 1QEXA 2E33A 2VQ0A 3NNMA 4M0NA 2Z69A 4IETA 2YB7A 1RMU3 2IXJA 2JD9A 1CAXA 2RDNA 1IG3A 3MIDA 1MVEA 4UOJA 3T0BA 3DECA 5LBFA 4Q4W1 4A4AA 3GBGA 2NM1A 3I3QA 3NJZA 4Q4X3 5IWFA 1VBA2 3WQ7A 2ZMNA 5DDJ2 5K9YA 1L3JA 2RDSA 3R0RA 3PU3A 2FZ1A 4CCKA 4IEUA 5KXCA 1Y9QA 3GZTB 4RYDA 1TNFA 1HRI2 4N43A 4YW1A 4JQRA 1NZIA 2VZOA 2PN5A 4XCBA 5C7GA 2VMGA 2BWAA 2EIEA 2QZ2A 3VZJA 1YIFA 2O0OA 1JZ4A 1N3QA 3MEPA 4JHZA 4I3PA 5IK5A 1RUH1 3DYMA 1MPXA 1O8PA 1Y4WA 4K8FA 5EP9A 1HIXA 3JXSA 2HWE1 2Q1FA 4LLFA 1AR83 1UX7A 4MGZE 4NO4A 3ZYJB 5DZEA 4HVOA 4R9CA 4AVCA 1JYNA 3EQEA 4AGVA 4LBKA 2OQ7A 4N9IA 1PMIA 1ZM1A 1I9RA 1C8M3 1W9SA 1XE0A 2JB8A 2OA2A 4FOVA 4JTOA 3B5LB 4PQQA 3FBMA 4IEWA 3U78A 2R1BA 1NYWA 5I8TA 4HK8A 4HKLA 5CB7A 2Z5WA 4YGCA 4E4ZA 3J7LA 4YWAA 5C3PA 3VBUB 3N7KA 1IGOA 2X5IC 3H1MA 1FOD2 4IE5A 1UYZA 1W2UA 3T30A 4QDQA 3HMYA 4M3CF 4XFAA 5HV4A 1UWWA 4MXVA 3KQRA 4URAA 4O65A 4Y1XA 2V73A 4XJUA 3H8XA 2ZEXA 4LKDA 3ENRA 4DQAA 3I3BA 1ND2C 1G7YA 2YPDA 1GWKA 4G4FA 5FPAA 1CAVA 2RJ2A 3N3HA 4CCMA 3IDBB 2H0BA 2VPVA 3LEIA 4IXLA 1NE6A 4WZFA 2CAVA 2JDAA 3UESA 3OPZA 1AR72 5FLJA 5LASA 5LEKA 1RUE2 1BVVA 2VOXA 3ZM8A 2OZJA 3WHTA 3BVCA 1MQTB 2R1DA 4QDSA 5F3GA 3IIIA 4UF0A 4Q4Y2 3BKZA 2W91A 4QDRA 1A8MA 1MQTA 2XVGA 4R8HA 5F9TA 5FPXA 3VDBA 4FTSA 4MYEA 1F5JA 1PVC1 3HPNA 4LHKA 2BW8A 4KWKA 2VW0A 1ONAA 4Y1VA 1ZBA3 4QPWA 1H30A 4N53A 3QD6A 5F32A 2W92A 3RZMA 2WNUA 4PLOA 1OI6A 4FPLA 4I2OA 3RFRA 3WEZA 2XR4A 4CU8A 3THPA 1W90A 2JICA 3LFMA 3ZPOA 2EXHA 1RUG3 2BGOA 1OA4A 4BDVB 4CDXA 3SEPA 4AHWA 2D6NA 3RZGA 1LU1A 4FFHA 4IE7A 4Y5SA 2Q4SA 1QJX3 3M3OA 4HLTA 4WVWA 2DCYA 3RYRA 2LROA 5LK7B 1Y9MA 3D6EA 4MVTA 1X36A 5A80A 4CPBA 3LFIA 1I3HA 1K12A 1BEV3 4XYXA 3NVCA 3H9AA 3RYPA 4H14A 3WVJA 1QOTA 2XG3A 4CRQA 3B93A 3PMSA 3W5NA 1D2SA 3OY8A 1EV11 2GN3A 2RDQA 3WNKA 4R4XA 4UXAA 3ZFGC 4RR3B 4XJAA 3K48A 1S0IA 5DQ0A 2ZGTA 2H6BA 2ZXQA 1GOHA 1GP6A 3RMXA 1F15A 5A1AA 1LOCA 2X53S 4MO3M 1EUTA 2BWCA 1F2NA 1TMF1 1DLLA 1GZTA 2VBDA 1W3XA 1LHOA 2ES3A 2QQWA 3NAPA 3JU9A 1AYN3 1GZWB 3M1HA 1URXA 3SH4A 1F31A 1VE0A 2EIBA 2WC2A 3NL1A 5FUPA 3AYDA 4C90A 4BA6A 4EN6B 1GZWA 4FAGA 1NXMA 4CEYC 2FZ2A 2QKDA 3S57A 1BKZA 1KFUL 2P37A 1VBA1 4OI4A 3O1SA 2QDNA 2RS33 5DDJ1 4X6RB 2XJPA 3RWKX 4K6BA 3VHNA 4QPGB 3WQ1A 3DCQA 4QAWA 2AUYA 2VTXJ 1TG7A 1QMJA 4S2FA 2PXJA 1E5IA 2A70A 3HJRA 2D98A 3IPVA 3LAGA 4KH9A 4UFJA 1VBE3 1YYNA 2QQIA 4CEWB 4CCOA 5JI7A 5HV0A 2R0FA 4CPBD 1UO9A 4FQZA 4AFBA 4QGNA 3T2TA 3OGRA 4CEWA 3Q8EA 4UW3A 4P9YA 1LODA 3O0WA 3BCWA 5ACA3 1ND3B 2GN7A 4MSVA 4YARA 4FFFA 2FCVA 1Q8SA 4QU2A 3FL7A 4DXSA 3WD5A 5FR3A 3JQXA 1Q43A 4AXOA 2WWSA 2GH2A 4MGTA 3GNEA 1W05A 3JBG1 2XONA 5C4WC 4W6XA 2VOTA 2ZHNA 5C8CB 4SBVA 1W8TA 4KU7A 1O4ZA 5C8CA 4XFCA 4DINB 4RGAA 1GV9A 1QU0A 4RQPB 5E88A 2IWGB 3B94A 2ILMA 5FZHA 3MHZA 1VBB3 5DABA 5FZIA 1IPJA 5A3NA 3TN92 4YVWB 1FOD1 2AR6A 1AR92 4LNVA 1JI6A 2PTMA 3JB8A 3PIJA 4AEKA 1HV1A 2ZAAA 3LIGA 3PURA 1PIV3 3AP9A 1CGPA 4YYOA 3LEGA 1QOSA 1NCQC 4Q26A 3VD7A 4D7TA 1KXGA 2A3XA 4UWDA 5FV3A 1RMU2 1XRUA 4Q0SA 1O8SA 3WW3A 2J1EA 1V00A 4G3YC 2PAMA 5JDBA 5KC6A 5EWSA 1CAUB 4CE8A 2P6CA 2NZ9A 5FP4A 4KGGA 4BZ4A 1AR71 3ILFA 5BNNB 1S0JA 5FZOB 2GMPA 4UFMA 1RUE1 5L9RA 3LA2A 2XJUA 1CZVA 3K4DA 1QF3A 4QX7A 1GUIA 2VMDA 3S6PA 4Q4Y1 3HNYM 4GB32 5J98B 1V6MA 3KVBA 3WF4A 5FZCA 2DFBA 4RFRB 2CWSA 3LOIA 2YU2A 4WM7A 2VOKA 2ZX3A 3EO6A 3DXTA 2DCJA 1WLTA 4A6OA 5CKMA 2RR13 5A3TA 1V9U2 4URTA 1YI9A 5I0UA 2BNOA 4DUXA 2ZAHA 4M01A 3FHIB 4QXBA 3T2OA 2A7AA 4AOCA 2GNDA 3PL0A 3N7LA 5A3LA 3DPRB 4BB3A 5I93A 5EHDA 4QX2A 3ZSKA 3R4DB 1C8M2 1RXFA 1AR63 2FHRA 1CVNA 2IVJA 2Y6HA 1WUVA 1Z7S2 2XLGA 3BIWE 3PLQA 4UBHA 5DUUA 1YXWA 3SH3A 4PF1A 4NVPA 4Z8BA 1WGPA 5FMOS 5BPXA 4K1ZA 3MIGA 1COV3 2Q1ZB 2A6ZA 4FFGA 5FMOL 1JYTA 3KV6A 1X50A 1FV2A 1J84A 5A3UA 3ACHA 1MEC3 2B8MA 2WIIB 5EJZB 4JC1A 4B1LA 1GWMA 5DUXA 3ACLA 4N7IA 5BUVA 4XABA 3J7NA 3NQHA 1VB2A 3JZVA 4IGPA 4OZOA 4E4SA 1KDKA 4PQ9A 1RB8G 3ZDSA 3B01A 1PK6A 3SKVA 3USSA 3CU7A 3ATGA 5DAQA 3MFAA 4AHYA 2E63A 5JIUA 1S0DA 4LE4A 4UT5A 1ZZ7A 2LUWA 3M3EA 1PO23 3KWVA 2RS12 2XVKA 2W68A 3VL9A 5JXHA 3ZX7A 5EXOA 3O1TA 4LQRA 3PVEA 2CYFA 1X9TA 1RUI2 1NZCA 1V6OA 2EA7A 3UJOA 5LBEA 2BPA2 1FPN2 1VBD2 3EXUA 3IT8A 3GHNA 4X8PA 3DGTA 5GZCA 1ULCA 2ZCWA 3PUHA 4JDNA 4BHPA 4QM8A 4XOGA 1CJDA 3RWNA 3WINE 1ZBA2 1JN2P 2Y8KA 3MFCA 3LF7A 4WVMA 1RUOA 3BTAA 4GZ9A 3GYDA 1OD5A 4PI0A 1F4AA 3RPQA 3MF9A 1QJU2 3AKPA 4HFSA 2AEYA 3E6DA 3KGLA 1RUG2 2R063 1XNTA 2VNRA 4K1YA 4XBLA 4YW7A 2KA3A 2DUOA 2VY0A 5L19A 1QJX2 3PU8A 3I59B 4AEMA 2VUDA 1TNRA 4ZS3A 4CCEA 2RS53 4IV3C 1BEV2 3I59A 3GZEA 4YGDA 2W94A 5FZGA 2A6XA 3J7HA 3T2QA 2HWE3 5BNPC 3T1LA 5T52A 3IBMA 5EYYA 3H0OA 4QQPA 3RJ2X 4OI2A 3K3OA 1OSGA 4UW5A 4EQVA 3T0DA 4OHZA 1DF0A 3VZKA 3TN91 4CDWB 3I3EA 4EN9B 1W8FA 1Q8QA 3ON7A 1ST8A 4CDWA 2YBPA 1B35A 3LEKA 2Y6KA 3O0XA 5AVPA 1JHNA 4LO7A 2UYBA 1QNYA 1OOPC 1YHFA 3POGA 1AYN2 3DUIA 2VO5A 3E5UA 1ZRRA 1W2NA 1RMU1 2D3SA 3M4FA 1Q3EA 3E1F1 1OLME 5FTTC 4PCRA 4Q4X1 2UYAA 1BBT3 2RS32 2OT7A 2WT2A 2Y34A 4NPMA 4P5HA 5CFDC 4GAZA 5JXIA 4META 2W1SA 1VALA 3KT4A 3Q8AA 4KNCA 4RD7A 2YPJA 1SLAA 5C5UA 2VMCA 1PZ7A 1RUJ3 2VOWA 2KR2A 1HJFA 2GNBA 2HYXA 3H3ZA 1K3IA 2IXHA 2JECA 2W9XA 4Q1PA 3AZYA 3N9QA 1DQ1A 4XHBA 2D40A 3AJYA 1IQAA 4QKFA 4O9EA 1W6NA 4XEZA 5ACA2 3AVSA 3K51A 3MBWA 3VBSB 1AR81 4ASMB 1RHI2 3DYOA 2B5HA 4BPZA 5C9AB 1WD3A 1DQ5A 1ZYBA 2PYTA 2VR4A 4XCAA 5IAXA 4XJWA 1AX1A 4HPKB 3ZXJA 3RDIA 1C8M1 1LHUA 3OGSA 3OPWA 1DYOA 1ZRDA 4ORFA 5FIXA 2WZR3 4NHYA 3CZUA 1SZBA 3OG2A 3IB3A 5J96B 3U0ZA 3W58A 4IV1C 4ZU4A 1VBB2 3J7MA 4TWTA 1C57A 1LECA 1JS9A 1WMDA 5IVJA 4IEOA 1GSLA 4Y5Z0 1UOGA 4QXKA 1POQA 1Q8OA 5I91A 4FAHA 4Q0UA 1DQ6A 1W2TA 5FZMA 5L9BA 3NV4A 4XQDA 4QX5A 3H1YA 5FP9A 1LAJA 1R1A3 3HT1A 1H2LA 4I0WB 3WV6A 4CUAA 4IEZA 2RDRA 1K5MC 5LBCA 1LB2A 1HLCA 4X6QB 2IFRA 4YGBA 3W59A 5I0RA 4OMDA 3AZXA 4E2QA 2B9VA 3CEWA 1WBFA 3NO8A 4HZFA 4PIYA 4BJ0A 4H3WA 3MICA 2WNOA 1H1AA 3AP5A 1MACA 3OD0A 3PTRB 5DZGA 3SITA 1WA6X 5ABJB 1RUI1 3MW2A 3URFA 1C4RA 2E32A 2SLIA 1IPKA 4AGRA 1XSQA 4ASLA 5SV5A 5DAWA 5JZGC 1UY1A 3KHCA 3PUQA 1XE8A 2QNKA 4FPHA 2YG0A 5FZLA 3WCSA 3MLLA 4LOSA 3KQ4B 4OMCA 4EN7B 2R32A 1OPMA 3AKRA 4Y33A 4CDUA 2RR12 1VBC2 1ZBA1 1HB3A 2FDGA 2EIDA 2BDRA 3ZIWA 3WW1A 1GOGA 1G9BA 2BV4A 3O12A 4HVRA 1UW8A 1QJU1 1HRI3 1M06G 4A7ZA 4JGZC 4YVSB 2WNVB 4DZGA 1OA2A 1RUG1 2UU8A 1XJAA 2OUHA 1QJFA 2FQPA 2WNVA 3MV11 4CXYA 4HBNA 3W21A 3ME2A 5A33A 1QJX1 1LGCA 4ZONA 2ZOEB 1NOVA 1COV2 2CHHA 2ETEA 1BEV1 2HWB2 4GH4C 3FLTA 4TXWA 1ODNA 1U0AA 1NA1A 1QXPA 1MEC2 2I2SA 3I49A 5DN2A 3LEMA 2D6PA 3QH6A 1W3VA 2HWD3 5K0UB 1XNCA 3K4AA 3NSTA 1GWLA 3LWCA 4FPFA 1OH3A 4JCKA 1WKYA 1IKQA 2B9UA 4YM0A 1NX9A 2NPIA 5KHIA 2Y64A 4A41A 1A34A 2VH9A 4LITA 5FBJA 1H9WA 1OBNA 1BVP1 3AYEA 2TBVA 5C3OA 5LY1A 1PO22 1AYN1 3WT3A 2LS6A 3GCWA 1VAKA 5F3EA 3BTXA 2BFUS 4QT6A 2BFUL 5FAXA 3RJRA 2QVSB 2LALA 1ZREA 2OUJA 2R7EB 4QPIA 2D43A 2RS31 5FZKA 3BN6A 3IMNA 2EALA 3LDKA 1WWYA 3LSEA 1DZTA 4QPYA 5D8AC 4YW3A 4BK4A 1ZRCA 2DYCA 2E7AA 3WDWA 1N1YA 3ES1A 4YFWA 4TZDA 4GALA 4XACA 3BPSA 2PHTA 1MZEA 3VL8A 2AZ5A 1VBE1 5H9PA 1N1VA 1VIWB 2BGPA 4WM8A 4AL9A 3WNMA 4ET7A 1OFSA 4P9JA 3HBKA 1J1TA 3KSCA 4Q4Y3 2R062 5C33A 5KHJA 5LY2A 1V0AA 5ACA1 4ZPIA 3HAGA 1L7QA 4ES9A 1E5SA 2ZX0A 5FP3A 4LK7A 4NOTA 4XBQA 4PDWA 3HN3A 4LHLA 2EICA 2OQ6A 2WO2A 3CIHA 4PT6A 4QX0A 4L9BA 4CYDA 1SCRA 1JODA 3L2HA 4WVVA 3VBFA 3I2GA 1SPPB 3ZR6A 1XNBA 3P1IA 4Y5TA 2GC2A 1BCXA 1H8TC 3GGLA 3ILNA 4UI9L 4XF3A 4EWEA 3DYPA 5JAXA 1I5ZA 4I30A 5T5JA 1PNGA 1VBB1 1QDOA 2VG9A 3M2MA 2X5IB 1YQ6A 2V5DA 1V6JA 5T54A 1UNBA 1W9YA 2NMOA 2PHDA 4LA2A 1LJ7A 1MZ5A 5FO8B 2PFWA 1W04A 4V2VA 4LTAA 2W95A 4XILA 1NXD1 2GDFA 3EB7A 4PHZA 4JKLA 4EN8B 1UIJA 2DCZA 4AEDC 2XVLA 3TEXA 3VDDC 3VBHC 4YG6A 1Y43B 1O5UA 1ZZ6A 1OKQA 4CU9A 4YZ3A 4AFDA 3O1UA 1C5HA 5LEJA 2OX0A 3IAQA 4P02B 3VKLA 2WA4A 4Q1RA 5T5PA 4JZRA 5ANNA 5D2AA 5LA1A 3ZFEC 1W8NA 3UGGA 5FZ1A 1GZ9A 5HXMA 4LBLA 3OBZA 4ASKA 1UY4A 1LNSA 2CL2A 1VBC1 2RR11 3CJIA 5BYNA 5E6HA 1FMD3 3EMRA 1W6QA 2VQAA 3KVAA 4PLMA 3TEZA 1YEWA 3U1XA 4B4RA 1BYHA 4C0HA 2PLV3 2TEPA 2ID4A 1HJGA 2PAEA 1RJ8A 4Q5OA 5FZ7A 1RL3A 1XXNA 2BYVE 3P5BA 1S2BA 2WZR2 4LBMA 2HBUA 3LCPA 1DQ4A 3BPZA 2KXLA 4U36A 1PGL2 2VQUA 2VZVA 1COV1 3KGZA 2XXZA 4D7YA 2GMEA 3SH5A 1GFF2 1ZA4A 3MF6A 4RFT0 4BYYA 4DXRA 1MEC1 1RTVA 1R093 3H7JA 5LA9A 5BNOB 3SXWA 1IS6A 5L7OC 5FZAA 3TOJA 1IS4A 4LE3A 4UBGA 3THDA 5BNOA 5FO9B 3RZKA 3ZFGB 4XFFA 2E7TA 5T5LA 1R1A2 4M3CE 1VB4A 2GMMA 4NHLA 1ZA7A 1QOOA 4W6WA 5A7NA 3WP5A 4PIXA 5KXEA 1NT0A 3A23A 4K9SA 1QJEA 2PHFA 4DEVA 2EAKA 2VD7A 1UPIA 5FKBA 1PO21 3USUA 1JYCA 3WOGA 4FPKA 5JXGA 1ZZCA 4RN5A 4RA0A 1AR93 5FJHA 2RG4A 4K7JA 3AK0A 2ZMKA 4R52A 1KJRA 3BGAA 3KCYA 4GA9A 1GLHA 3IDCB 4KI5M 4CEYB 1BHGA 4DOUA 3A0NA 2FCTA 5F3IA 2D44A 3IDAA 4UFHA 4DMIA 2W1QA 1RIRA 2R49A 2VNGA 5KBFA 1O3QA 3KT1A 3ABZA 4XXPA 3T4VA 2QDRA 1LOFA 3FLRA 3QCWA 5AFBA 4WV8A 2GC1A 3AKSA 3ZR5A 2BEOA 1N47A 5L36A 4J25A 2WZPP 1HKDA 4KBBA 4OCTA 1G9CA 3W9AA 1ENXA 5IK4A 4GB33 2R061 4CCNA 1S0CA 5DAVA 1J58A 4HVQA 1O5LA 5FYYA 2WT1A 3AZWA 2RS51 2VMIA 3ZXAC 1J1LA 1NLQA 3IMMA 1TME3 1W8OA 4LBJA 4QMAA 3WNXA 1DZRA 5C4WB 1V9U3 1KRIA 1OD3A 1AL22 3A0KA 1ZVFA 4NWWA 1CWPA 1OHFA 2HWD2 2H0VA 4DRRA 2W1UA 3ASIA 3WY6A 1HW5A 1DZQA 2A3YA 3V56A 3VUOA 3W5MA 2JG8C 5IK7A 1Z7S3 2AH2A 1HRV2 3GZUC 5IJRA 1UKGA 1BK0A 1JZ7A 3NNJA 1S0GA 3S5QA 3ZKUA 5GZGA 1UMIA 2ARCA 3CNAA 1HX6A 2HLEA 4LO8A 2QUOA 3R6SA 1U5XA 1NCQB 3ORJA 5M0TA 2JWPA 3GHMA 2G4IA 2YC4A 5JSOA 3FLPA 3I3DA 3VBUA 4JDOA 2WT0A 1CR7A 5CG9A 1BBT1 2NN8A 4YNIA 1UZVA 2J1TA 4RHV3 2WO3A 3RRDA 3GZAA 2GNTA 3PVOA 5LWBA 1PHMA 1DYPA 5FOBB 4DNYA 3GJBA 3ETQA 3K3NA 4LIUA 1US3A 3VKFC 2EXIA 3ZMNA 2QZ3A 2DV9A 1RUJ1 1KQRA 2RS13 3FBYA 4E27A 4LUMA 3QLQA 1WMXA 5JOZA 3JUUA 2WWUA 1RUI3 4DRVA 1KGYA 3GALA 1A3KA 1OA3A 3AP4A 1FPN3 1VBD3 1FI2A 2WAAA 5CA6A 4CSWA 4GIQA 5D1IA 1F4HA 1GNHA 4QX8A 4NIIA 4ZU7A 4MG2A 1FNZA 2K2SA 3DXUA 2VBPA 3EBRA 4IE4A 1ZBE3 2FDFA 3N4MA 1LHVA 4AK3A 5DG2A 3VZLA 2Y38A 2WZR1 4PLNA 3VD4A 2Y26A 3HWJA 2W5FA 2XL9A 3H7YA 3LA7A 5FK8A 2FCUA 3NW4A 5GLVA 1PGL1 4Z2WA 4BMEA 1CESA 1OT5A 1QJU3 3UT0A 1EAH3 4OULA 4LKFA 4COYA 4Z07A 3B3QE 5GJ6A 1W9WA 2XJSA 3OEAA 3ZYRA 4KMQA 2EVXA 2WKKA 4XE9A 3UK9A 3MIBA 1KD7A 1PGW2 2B42B 5IW0A 4I02A 3E6CC 5F6LB 4HK9A 1AZDA 3CLPA 4TYSA 3I3MA 1WW4A 1R1A1 1UOBA 2IXKA 3BB6A 3LDRA 1YO8A 3ZYBA 4BXSV 3VBOC 1YFXA 1ASJ3 2Q8OA 1QXRA 4A6SA 4BXFA 4XETA 3WLUA 5A6QA 3BODA 4JKKA 1W0NA 2MEV2 2F6BA 5J37A 1W39A 2BBVA 4QX1A 5FRAA 3U4SA 1V6NA 1XBFA 4XHXA 4KWUA 4RR3A 1MS5A 3L9JT 4B8EA 3LGRA 1ODMA 4Q29A 5FYHA 2A5ZA 4CCCA 5JPNB 1C5IA 5GZDA 3JCIA 1GYKA 5HCAA 2PELA 2ZACA 3MIFA 1ZRFA 2YDEA 1FNYA 1G8WA 2ZGKA 2WZEA 4XF9A 5CFCC 2D97A 2YBKA 1E5RA 3IZOA 1D0HA 1UKRA 4IEYA 3U10A 5JOWA 3J4UH 3SCFA 4JGYC 4MHRA 3ZOIA 1ZX5A 4XJ8A 1UMHA 1FMD2 3OBAA 4YM1A 5GM0A 3C7HA 5K4LA 4MGSA 4TLGA 3VZOA 1HRI1 4BLIA 1OF4A 1JTZX 4WBBA 3T09A 4QPGA 5FLHA 3WW2A 2HKXA 2PLV2 2UY9A 1SDWA 1JU4A 3FC0A 5IT6A 5FREA 2DTYA 2ZGLA 2J22A 4AG4A 2BOIA 1SQ4A 3RSJA 1JZ2A 1JYXA 3ZSEA 3W20A 3FUOA 2YBSA 3POYA 4OHVA 3ZYPA 3WF2A 4IV3B 4B3NA 1R092 2Y6GA 4FFIA 5B4XA 4D3WA 1HXS2 5BY5A 5JOYA 3BI3A 1RHI3 5BNPB 3EHKA 4NAOA 1ND3A 2HWD1 4N9HA 1EPZA 1UD1A 4S2HA 5CKQA 3WW4A 3RZHA 2CV6A 2D6OX 5JOXA 5LZ6A 4YW6A 4KG8A 4XJZA 3VB9A 4E8CA 1D4M2 2CY6A 4CVUA 2OPKA 2QQVA 3BOWA 4N43C 4V1PA 2JD4A 1UYYA 3Q8BA 2MNGA 5JCTA 4BH9A 2HJIA 2XKOA 3HEIA 4MGIE 4RQPA 2A3WA 1OOPB 4BIOA 4KWJA 1O3TA 5IVFA 4QKDA 3ZPYA 3QACA 5IHRA 1R64A 2IUWA 3GJAA 4YVWA 5FZBA 3AL5A 2VZ3A 3NNLA 1MS3A 3P3NA 3O1VA 1UAIA 4C1WA 1YIPA 4U2AA 1SDDB 1J83A 5CFDB 3KD4A 3FHAA 1GQGA 2QQOA 3ALQA 5FMDA 5GZEA 3NV1A 2W3JA 3Q8CA 3MUY1 1IKPA 4LKEA 3T3YA 4K40A 2WN3A 3MIHA 2XJQA 1DG6A 2ZGPA 3KZ4C 1CAUA 4A42A 1C1LA 1XC6A 2PHUA 2HEVF 4ZHNA 1JU3A 5BNNA 5FZOA 5AFEA 2IVIB 5HCHA 3K46A 5F3CA 1W2OA 5F8PA 1SBFA 1ULEA 2VZUA 3ZYIB 5FY1A 2BU9A 2G1MA 5I0DA 1ULGA 1O59A 1UU5A 1WW6A 3C2UA 3CMGA 3LD8A 1H6XA 1TME2 1VBC3 1RUD2 2BOJA 4YM2A 3N9OA 1GBGA 3ZIXA 3ZFFC 3SISA 1ENQA 1DGRN 4MLOA 1YQ2A 1ENSA 1G86A 1YLLA 5DUVA 3VLBB 4AI2A 4AYUA 1JZ3A 4IV1B 4FTBA 3OCPA 4HOOA 3DPRA 4Y4RA 1W03A 2BERA 3AXDA 1DFQA 2Z79A 1PGW1 2DFCA 3OGGA 3R05A 2OS2A 5GLUA 1ENRA 5FZ4A 2HWB3 5FZDA 1NAEA 1UZWA 5HCFA 4NHKA 4GWNA 5T3NA 5JSRA 1VPHA 5BNQA 1UCXA 1NG0A 3MPBA 4XJ9A 1K5MB 2VCAA 2MEV1 3IIAA 4HMZA 5FYSA 4OI0A 1PM4A 3G6JB 4M00A 3VDAA 2ADEA 3ZVXA 4AQTA 4E9KA 4ZZ5A 4N53C 1CX4A 2VM9A 4RHV2 5CYYA 3U11A 2WNUC 4E8DA 4XAEA 4DFSA 4AF9A 4CP0A 4Q4V3 4M3CB 2R0HA 3FWEA 4HN1A 3WR0A 2GC3A 3U4XA 2VZQA 2VXJA 4CDXC 5APAA 3WP3A 3MDPA 3AZVA 3ZXDA 4FPJA 3WNPA 4DPNA 5FMCA 1WCKA 3FMGA 3B02A 4MADA 2PA7A 3ECQA 4FT8A 4OZXA 3N9NA 5JZGB 5ISLA 1R083 4IERA 5A1LA 5KR7A 2P5BA 2Y0OA 1OFNA 2WO1A 3D4KA 2RV9A 4FXKB 4RS5C 5CG8A 3KF3A 1UXXX 5A7OA 2HEWF 4ZXKA 1SFYA 3ZN6B 1FMD1 1WLCA 3ZYHA 4M4PA 4JTNA 3RYKA 4Y24A 4GMP0 1OLQA 3JB4C 4MHUA 2PLV1 4AVBA 1ZBE2 4JGZB 3RZZA 1NY72 1PNFA 4XAAA 3B9IA 5IK8A 5A6XA 1SLLA 5KXBA 1M4WA 2TUNA 2GH8A 1MZ6A 2XQRA 4LBNA 1DIWA 4AI8A 5J3UA 1EAH2 3LZZA 1W06A 5J09A 2JE9A 3NAPC 5J36A 1VJ2A 3ACIA 3N9MA 4GH4B 3V0AB 2K46A 1R091 2XB6C 4Q8LA 2YUEA 2GP3A 1CZTA 3M3CA 3PTYA 2JEMA 2VGDA 2VTXA 3V0AA 3IN9A 2EXKA 2ZEZA 2X05A 3OUJA 5A3MA 2C26A 4F83A 1D7PM 1D4M1 1X8MA 4I01A 4DS0A 3VV1A 5FY5A 5LRSA 5GLTA 1ASJ2 3BUCA 3WNLA 3OJBA 3SC7X 1W0OA 3OBTA 5JIAA 2E9QA 1Q56A 3PVBB 1IZ3A 4FP3A 2AGSA 4FOWA 4LEJA 4CUBA 4D0QA 4EZHA 1K42A 4QGMA 1FXZA 4A3XA 1WD4A 4XW3A 4ZU5A 3ZXEA 4ATFA 1NQDA 1AR91 2RVAA 3PDQA 4L99A 4QB6A 2CWMA 4GWMA 4Y26A 5FK7A 4MGQA 4IW3A 1LRHA 5FY7A 2WQ4A 4H2AA 4K8RB 3KB5A 3K77A 1SHWB 5D8AB 3UYJA 4ES8A 4UAPA 2CU5A 2JB4A 2X8KA 1E57A 3HNMA 2VMFA 2WS92 5D8AA 1OC1A 2YYOA 4Y22B 2PQSA 4Q0QA 5EQUA 1IS3A 5C8CC 5DG1A 5G05L 2JE8A 1OUXA 1UXZA 5FBZA 2JIJA 1J3RA 3VGIA 5EYXA 4BQ3A 4GB31 4XFIA 1OH4A 1WBLA 4NUBA 3H1WA 2H6CA 4K20A 5F5QA 4NIHA 3CDZB 4CTEA 1W0PA 3UNPA 1A78A 4CU7A 5FWJA 2XJRA 3GXUA 3RNSA 1VAVA 2GP5A 4IEPA 4XBNA 2HYKA 3T1MA 3UJQA 1VR3A 1TME1 2DBIA 1G6NA 2A73B 1RUD1 1V9U1 1VLNA 4ISQA 5DMYA 2XLFA 2PAKA 3INAA 2Q0AA 1V6LA 2D3RA 4JDMA 3V65A 2C9AA 4ARYA 5FWEA 1OVSA 3VBSA 5FP7A 1D4VB 1QY4A 5CU1A 5A3WA 4LA3A 2BTVC 5C9AA 2W52A 4OQ9A 3M70A 3ZMOA 1Z7S1 2HWC3 4HPKA 4W8JA 3QOPA 2QQUA 2JKXA 1UZ0A 1JYIA 4QU1A 1V6IA 5JR2A 4C91A 1RC6A 3AMQA 2X09A 4RGKA 4A7YA 4WM7C 4GWJA 2ADDA 3HVDA 1YQCA 4Q0PA 1OXCA 1XYOA 4BWOA 5CAZA 4TSVA 3LOBA 2GNMA 3B00A 2L9LA 1S4CA 3A21A 4NIAA 5J48A 2I07B 1Q8VA 3LKJA 4LKSA 3I2KA 4MXWB 4RHV1 4NPRA 2YGLA 3S30A 3VDDB 5B2GB 5IVYA 3VBHB 4QGLA 4YSFA 2YC0A 2P1BA 2B46X 2ZEYA 3OF1A 4MXWA 1R1ZA 1HV0A 3M7AA 3MPPG 2G9ZA 1H2NA 5FP8A 3VDDA 4B7KA 5C6CA 1AJOA 1N1TA 1LHNA 4XUQA 3CKHA 2RS11 3POFA 4F3JA 2P34A 2RE9A 1MS1A 3ZFEB 1FAYA 4W50A 4NMIA 4PF5A 1TVGA 4UFKA 1FPN1 1RYYA 1VBD1 3SHRA 5ABJA 1W6MB 3TBDA 3JD73 1MS4A 4BQXA 4W4ZA 2Y6LA 3T0AA 2C6SA 5A6YA 2G9FA 4YG0A 2WL1A 4DB5A 3NV3A 3UKTA 3ZXFA 4OHXA 1ZBE1 1W9TA 1LOGA 2QQJA 4KGQA 1NY71 3A22A 1W8WA 3KV9A 1PK6C 2JKBA 1DU3D 5HXVA 4XURA 3I2FA 5FZEA 4LXLA 5ERLA 1EAH1 1LGBA 1OLRA 4MGYE 4UFIA 5A7SA 3WX5A 1REDA 4XVHA 1SFNA 3AX4A 3POBA 3U75A 4FPOB 4TN7A 1H0BA 2VVEA 4YVSA 3LB9A 3PHMA 1ALYA 1WMFA 4PI2A 5L7OB 1LEMA 3I4IA 1YC61 2BNNA 2SBAA 5L7OA 1DDLA 4CP9B 1BJQA 1X7NA 1ASJ1 1AL23 1SBDA 1QDCA 5FLIA 4AQ6A 1YNAA 4GXLA 2CSGA 2ZGQA 2GALA 3WDTA 1WCUA 4OQ8A 5CIRA 5K0UA 4KU8A 3X29B 2A75A 4FPCA 3VBRC 1HRV3 3UGHA 4Q4V2 1T2XA 3QBQA 2GSYA 4EN0A 1NCRC 2CDPA 2UWBA 1LOAA 4XIOA 1XSRA 4AVSA 1JUHA 2WNEA 5G04L 5LA0A 1JZ5A 4AR2A 3RZJA 1OKOA 3KS7A 4LR4A 1ZNPA 2RJLA 4FO9A 1ZRIA 5FY9A 1OQ1A 2W47A 5C3SA 1R082 3BU0A 3OTFA 5GLZA 3UV9A 4CCLA 3S7IA 1Y3TA 3VZMA 1AF9A 2ATFA 5SV8A 1WLWA 4YLZA 1EYBA 2D7FA 3OUHA 5F2WA 4P9XA 3PUAA 1QIQA 2OPWA 4RL7A 2XWBB 4P9IA 4B29A 4R9DA 3AVRA 2WUHA 2QFEA 4AQ2A 5EIYB 1ULOA 4UW6A 5DAPA 1AVBA 4CDQC 1RUC2 3WNOA 3WSOA 5LBBA 1B35C 5FZ3A 1AXKA 1GMMA 2YFUA 3AMPA 1IHMA 1YQ8A 4HSJA 2ORXA 4FBFA 5BXXA 1HB1A 1K5JA 4JVAA 2P3YA 2IZWA 1CZSA 5CADA 1POV3 1STMA 1RHI1 4HETA 5FCCA 1LULA 1XNAA 3POSA 4AFCA 4AE2A 1QNWA 2VVDA 1GOFA 3AB0A 2ZX4A 2JG8B 5A70A 3O0VA 1H6YA 2DUPA 1CIYA 2QJVA 1SPPA 3ZXGA 5A6ZA 1YFYA 3ACFA 2JJ6A 4XZUG 4BOWA 5JXJA 1QWRA 2GU9A 3K75B 5DZFA 2BUKA 5A32B 4S2DA 2WFF3 5JMCA 2WSUA 3TRSB 2G19A 1VMFA 5A32A 3OD4A 3H8RA 2N7GA 4Q27A 2X5IA 3BYWA 3MLKA 4KG0A 4XUPA 3FHQA 1RUH2 1KFXL 2JG9C 1DLCA 5FZFA 1RITA 4LK6A 1KDMA 3S5AA 1ND2B 4CCJA 3O1OA 2WYSA
chains in the Genus database with same CATH topology
2MEV3 2E53A 1S1AA 2ZZQA 4BMBA 1ND2A 1SBEA 4F7ZA 3TYJA 2VUAA 2JX9A 4KQ7A 3Q9OA 1OMIA 4Q8KA 1CAWB 1XE7A 3AFKA 2Q5TA 1OQDA 3ILRA 3OYWB 1CAWA 2TNFA 4BCUA 4XFBA 4XXAA 4PBOA 2OIIA 1LTEA 1FATA 2D5HA 4PBPA 1LCLA 1O4TA 3WG2A 3WG4A 3SLIA 2ET1A 1UIKA 4NHMA 5DXDA 4K21A 1T6GC 4HKOA 1C28A 4H55A 1DGLA 2W08A 5JR7B 4EWDA 1S0EA 5AC93 1JW6A 1QHDA 2HWC2 1C1FA 3OGJA 4IQPA 2C1FA 5L73A 1EY2A 1SACA 1Y7BA 1QKQA 2HWB1 2P3KA 1U12A 3IKWA 1HXS3 3VBOB 4Y4YA 5FQ0B 1I1EA 3CL1A 4MV2A 2RMU3 1LR5A 2A6WA 4CDUC 1PO13 3VBOA 4E2GA 5FQ0A 1GQHA 1D4M3 3SCHA 2ZGSA 3ZSJA 2ZPXA 4Q4V1 3ZFGA 1QXJA 5T50A 3VHOA 2WLQA 2XBO3 1W6PB 2I45A 4YW4A 5H9QA 2IC1A 2WNVC 3N7MA 1UMZA 1R081 1U5YA 5KWRA 3JQWA 1LGNA 4TLFA 4B4PA 2C5DA 2HWF3 5CFCB 1NA1C 3M3IA 4NN0A 1H1IA 4CEYA 4EWAA 3JD72 3WQ0A 4JGYB 2ZZJA 4LUKA 4FVVA 4DY5A 2ZGMA 1QJY3 2ARBA 3CJXA 1BXHA 1LOEA 1YRZA 4IESA 3VN4A 1U5IA 3B7MA 4HSLA 2DVBA 3VKOA 3J26N 1HDKA 1O7FA 5BV6A 1AXYA 1IOAA 2D5FA 2GZWA 2D6KA 4ISRA 1CAXB 2WSVA 1W6OB 2D93A 1ZZBA 4QPIC 2V09A 1RJ7A 1W6OA 2ERFA 1LOBA 1RUD3 5AVAA 2IXCA 2CGNA 5C4WA 4N43B 3VHPA 4YRDA 3J8F3 4AGGA 4FTEA 3B9CA 2G9GA 4LBOA 1REEA 4BIFA 1RINA 4WM8C 3WP6A 3ZXKA 3MIEA 4FPEA 1WW7A 4ITCA 4LBQB 2AENA 4MX3A 4FQ4A 5TSWA 4LBQA 1UN1A 5FPZA 4IL7A 3D0JA 4PDWC 3ZSLA 1NCQA 3WUCA 3VBFC 2VULA 1UZYA 5LK5A 2ZBJA 1XYPA 3JBG2 4ZKTB 4Y20B 3E6BA 1GNZA 1WW5A 3RI8A 1G9FA 3B69A 4Y20A 3HBZA 4XPVA 2CTVA 1F9KA 1KS5A 4E2SA 3RQ0A 1UX6A 3KCCA 4AFMA 4P9GA 4XTMA 4P14A 1SEFA 2Z2SB 3AMMA 4YW5A 1AJKA 1DQ0A 1CAVB 3ZFFB 4A7KA 1UPSA 3CO2A 5FFOC 5LRRA 3ZYGA 2GC0A 3ZFFA 1PGSA 1RVF3 2HWC1 1H9PA 4QD2A 1BZWA 4NWVA 3I7DA 4FP2A 3M3QA 2QCSB 3VKNA 1WA4A 4LBQD 1A6CA 4D7SA 2E51A 1DGRA 2WFF2 1AUYA 4DY3A 2XH6A 1EP0A 5E1RA 4S2GA 3D82A 3D5OA 3G7DA 5GALA 1FV3A 4XTPA 3CJIC 4I0BA 4N53B 3RS6A 2WNUB 4J6GA 2ZGNA 5F1RA 1N3OA 1QQP3 4YM3A 3FJSA 3LA3A 4CDXB 2VXRA 1RUF3 2FMDA 3RMYA 1MVQA 4GULA 4XFGA 3WP4A 1NE4A 3M8LA 4COVA 1QGLA 1ZZ9A 2VW2A 1UF2C 4WZCA 1XU1A 2WLPA 4RS5B 1N1SA 4QM9A 1KITA 3JD71 2PHWA 2R073 4KWLA 4RS5A 3OY8B 3PVNA 1CPNA 5BNOC 2P17A 2WS93 2ZJCA 4HKWA 4YFZA 3AYAA 2I74A 2DTWA 3O7OA 1H4HA 3WDYA 5K8SA 2E7QA 3NAPB 5AC92 4LO6B 4R4ZA 2RJKA 1BMV2 2B45X 3DKWA 3WXPA 3WDVA 4YZ2A 3POWA 5I8SA 4LO4B 5K7PA 1AL21 1H2MA 4I3GA 4IV3A 3AZZA 2LM3A 2RMU2 5KXDA 4AVTA 1LOFC 1PO12 2RM23 1GZCA 5BNPA 3IPVB 3E5XA 1HRV1 3O14A 2OZ6A 2C0ZA 1J3QA 5JWPA 2ARXA 4INDA 2O1QA 2XBO2 4AI0A 1QH6A 1OQEA 2CAUA 1SLCA 2DU1A 4AI3A 1LHWA 3CF6E 2NYYA 2O8QA 2XLAA 3N7JA 2MHFA 2Q30A 1OOPA 1D0GA 1KJLA 2HWF2 3D8CA 2E6VA 2YGMA 1AXZA 4AHZA 5EZWA 4LLOA 1QJY2 3HIFA 3KCXA 2IXIA 2XGXA 1X82A 1G9AA 4MZUA 5CFDA 4LO5B 2VUJA 4WVZA 1U5ZA 2Q1MA 3ZO0B 4J1WA 4W65A 5GZFA 4AWDA 2DF7A 2ZX1A 3SCGA 1POV1 2GAUA 4RSUA 3TNPB 3AJZA 3VBUC 3A4UA 4B7EA 2EXJA 2NMNA 2YXSA 3TB0A 1V6KA 2XWJB 3LSDA 4Q4X2 2XL7A 1OPOA 5EJ3A 2Z42A 4XMAA 2A6VA 4JRLA 3J8F2 4OHWA 4P9LA 2WQZC 4OI1A 3NWKA 5HBAA 1SMVA 3AFGA 2WFF1 3VHRA 2UURA 4IV1A 4WM7B 3AXEA 1GANA 3ZN5A 4JV4A 2V5YA 1MQTC 2ZABA 2ZHMA 3P3PA 1C8NA 4Y1ZA 4JAAA 2ZS6B 5H9SA 1DGWX 4EJRA 4GQ7A 3AMNA 1AR82 1VRH3 3PJYA 4ATEA 2JENA 1K5MA 2CGOA 3PMEA 1XQNA 2ENRA 3MYXA 5KHHA 4YZ1A 5JI9A 4COWA 3RI9A 1F5FA 4COUA 4AFAA 4M3CA 1C3HA 1SLIA 2UWAA 1JOJA 4GMP3 1AHSA 4OVEA 1VAMA 1AYM3 1YCIA 3D0SA 4J1XA 5JZGA 4FSJA 1Q5OA 1QJZA 2DU0A 2PHXA 3ROUA 3C3VA 1PK6B 1WMEA 2YMZA 3VKMA 1XU2A 4F8AA 3J9SA 1MZFA 3R4SA 3ZN6A 2R043 4H7LA 4LHNA 5E89A 4D69A 4R9BA 4XF0A 1RVF2 4RR3C 3SNMA 5AC91 1BMV1 4JGZA 1UZZA 1RUC3 3AKTA 1HQNA 4H7MA 3EJKA 4XFHA 1S55A 4YW2A 3WG1A 5KHGA 1HXS1 4M0HA 4C1XA 4AI1A 4GH4A 2LTNA 3SMHA 1S0BA 2RMU1 3S7EA 1PO11 4JRAA 1TEIA 1AX0A 4Q4W3 4WVMB 2D6LX 3VBRB 4O9GA 3FX3A 1X33A 1F8VA 1QQP2 4QPGC 1LESA 1NCRB 3VBRA 2XBO1 2NP0A 1DHKB 3HR9A 1RUF2 2BVVA 3R4UA 4HT1T 1NCRA 3MI8A 2XJTA 3ZN4A 1O3RA 2W39A 4A2UA 4CEWC 4N90A 5CNAA 1PVXA 2HWF1 4FCAA 4AQSA 1SCSA 3OBRA 1RUH3 3NV2A 3E97A 2R072 4AVVA 1DQ2A 1ND3C 1QJY1 2FBEA 2EF6A 2VU9A 3TNQA 2R6QA 2A71A 4CDQB 4Y22A 4AHXA 1D2QA 2ZX2A 4ONUA 1B35B 2RHPA 1O91A 5JVVA 5C8WA 2ET7A 4CDQA 1JBCA 2ZMLA 4RQPC 4GKYA 1KS4A 2FMYA 2JE7A 1FT9A 2VMHA 2ZKLA 1SLBA 4HANA 4YVWC 4QHBA 1UL9A 3PJQA 3KMHA 3E5QA 4Z82A 5HI0A 1CJPA 3BU7A 4XF4A 1DGWA 1H8TB 3AP6A 2ZTNA 3J8F1 1SLTA 2R30A 2RM22 4PIZA 1AL0G 1Z78A 1H8TA 5JSPA 3FUQA 1YWKA 5T5OA 5KC5A 5T55A 2O8OA 3U07A 5BNNC 1VBE2 1Z0HA 4MGKE 3AKQA 1CONA 1O3SA 4FXGB 1H4GA 1REFA 1GKBA 1W6NB 4GKXA 4UW4A 3I2DA 2X29A 1GR3A 1RGSA 2DCKA 3IDEA 1WCDJ 2JG9B 3H3UA 1YJLA 2JG9A 2PHLA 1PZ8A 1PVC3 1YI7A 4MH0E 1NLRA 4PJYA 4RGGA 4AEDB 4AEJA 3FZ3A 2ZKNA 2KM2A 4AEDA 5GLWA 1JXNA 2HEYF 3VBHA 5HCBA 2ZGUA 4Q2FA 3DF0A 2EAAA 3DPRC 3WCRA 4I0AA 2AREA 4FPGA 1TQ5A 2NQYA 1AX2A 3MZHA 1MS8A 1LEDA 3ZFEA 1PIV2 2YY1A 2BQPA 4N7UA 4I09A 1J59A 5FO7B 1W6MA 3PNAA 3HT2A 1O4YA 3WZ1A 2VNOA 3UKVA 1EV13 1RVF1 3WHUA 2YROA 1ULFA 4Y1UA 3WUDA 4XDQA 3HQXA 5FDBA 5FOJB 1G9DA 2XPJA 1B09A 1DBNA 4FOQA 4XIKA 5JLVA 1TMF3 1H2KA 1UU4A 5GKAC 1DYKA 2AYHA 4SLIA 2YV8A 1TE1B 1BK1A 4CDUB 2K0GA 1MS0A 2DUQA 3N36A 4OFGA 4OUMA 3THTA 3MLJA 4L2NA 3V0BB 1VBA3 5DDJ3 2P3JA 1QQP1 2UWCA 1HQWA 3DL3A 1VRH2 3KM5A 3H8UA 3V0BA 2OW4A 1S2KA 1RUF1 5I0TA 5A33B 4XQ4A 1AR62 2DURA 1YFUA 2ZHLA 3O5SA 1WCSA 4C0BA 3DN7A 5KHKA 4P9WA 1NA1B 3FE5A 2R071 3N35A 1AYM2 5DUWA 2VVFA 1CPMA 1NQJA 2WFPA 2P2KA 4BLJA 1S0FA 2WS91 4Z92B 2DVAA 2QE3A 1CIWA 2ZGOA 1ULDA 4L11A 1I6XA 1QH7A 3TWIA 4DXZA 3IM0A 5IUQA 3ZSMA 3AMHA 3JBG3 4KL1A 3UL2A 5E16A 5JPMB 1Q8PA 1LU2A 2B7YA 1UU6A 2R042 2XUMA 4YZ5A 2W0XA 1CQ9A 2A6YA 1WLDA 2XKPA 1J3PA 4CDWC 5EFUA 4CP2A 3AP7A 4Y1YA 1FOD3 4QPIB 3BOPA 2IXLA 4IEQA 3ES4A 4K3UA 1VP6A 1BQPA 2DCTA 2JXAA 4X8NA 3ST7A 3APBA 4HN0A 4E4ZA 2EIGA 5BNQA 2RM21 2PHRA 3WDUA 4FPYA 4XQWA 4Q4W2 2NLRA 1JUIA 4WM8B 1GICA 2Y0IA 4L92A 4CZSA 1AR73 2JG8A 1ZZ8A 1RUE3 1XYNA 3L2YA 1X8EA 4EROA 2BGCA 4LULA 1H1MA 2DVDA 4PDWB 4CP1A 4LT5A 3S0MA 3VBFB 2DWRA 2ZGRA 1FX5A 2RS52 2BVBA 4MUVA 3VBSC 1APNA 4B4QA 2HWE2 1NLSA 2ZA9A 5C9AC 5I0SA 2XJVA 3WDXA 4W6YA 1CN1A 1JH5A 2YZ4A 2ZHKA 1POV0 1FYUA 1YUDA 1XNKA 3H50A 5H9RA 2WINB 2VECA 3IWZA 3HD8B 1HQLA 1PIV1 3TAYA 4YZ4A 4QQOA 4L97A 2K9ZA 2VW1A 4NR1A 1MR5A 1CD3G 3OYWA 1XNDA 3FFZA 3V64A 3NKGA 4IEVA 4OLLA 1H8VA 1LKNA 1YJKA 4IEXA 1BBT2 2YHJA 3ZXLA 1N3PA 2OYZA 4D94A 3VUOA 1PZ9A 4L8QA 5CBLA 2R16A 1V70A 4XF1A 3UKNA 3I8TA 3KLSA 4BQ1A 1MS9A 3BALA 1RUJ2 5E8AA 1LENA 2WJSA 3MGUA 4COZA 5ABJC 3QH7A 3CJIB 2MPFA 2IFWA 2DVFA 1W6QB 3GF6A 2D6MA 4QQ2A 4E4DX 1VRH1 3GBWA 4YGEA 2D3PA 1YFWA 4OUSA 3GBFA 4Z1VA 1PVC2 4XZPA 4Q0VA 3HN1A 5EV7A 1AR61 3FFQA 3AYCA 3MW4A 1IS5A 2PQQA 2B39A 5CVRA 4BE3A 2DVGA 4YVSC 4GMP1 2CGPA 3I54A 2CNAA 2VOVA 1AYM1 1RUNA 1W6PA 4EV0A 3AM2A 3ELNA 4QQLA 2OVUA 4FOYA 5CFCA 2JDZA 4YG3A 5F6KA 3KT7A 5J7MA 2R041 3MW3A 4G9SB 4XMIA 4JGYA 3DV8A 1EV12 3USUB 3NKTA 2F4PA 2P3IA 1EPWA 4QQHA 5K0UC 1A8DA 2WA3A 1RUC1 2UY8A 2XHKA 4HL0A 2BNMA 3RG0A 3VZNA 3TN93 4R9AA 4OHYA 4AW7A 2QQPA 1PM7A 5I8YA 1TMF2 2VQ0A 4M0NA 2Z69A 4IETA 1RMU3 2IXJA 1CAXA 3MIDA 1MVEA 4Q4W1 3GBGA 2NM1A 3NJZA 3WQ7A 4Q4X3 1VBA2 2ZMNA 5DDJ2 5K9YA 1L3JA 3R0RA 2FZ1A 4IEUA 5KXCA 1Y9QA 3GZTB 1TNFA 1HRI2 4N43A 4YW1A 4JQRA 2PN5A 2VMGA 2BWAA 2QZ2A 3VZJA 1YIFA 2O0OA 1N3QA 3MEPA 4I3PA 5IK5A 1RUH1 4K8FA 1HIXA 2HWE1 4LLFA 1AR83 4MGZE 3ZYJB 4NO4A 4AVCA 5DZEA 4HVOA 4R9CA 3EQEA 4AGVA 4LBKA 4N9IA 1PMIA 1ZM1A 1I9RA 1C8M3 2OA2A 4JTOA 4FOVA 3B5LB 3FBMA 4IEWA 2R1BA 1NYWA 5I8TA 4HK8A 4HKLA 5CB7A 2Z5WA 4YGCA 3VBUB 3N7KA 1IGOA 2X5IC 3H1MA 1FOD2 1W2UA 3HMYA 4M3CF 4XFAA 4MXVA 3KQRA 4Y1XA 2V73A 4XJUA 3ENRA 4DQAA 1ND2C 1G7YA 4G4FA 1CAVA 3N3HA 3IDBB 2H0BA 2VPVA 4IXLA 1NE6A 4WZFA 2CAVA 3OPZA 1AR72 5FLJA 5LEKA 1RUE2 1BVVA 2VOXA 2OZJA 3WHTA 1MQTB 2R1DA 4Q4Y2 1A8MA 1MQTA 2XVGA 4R8HA 5F9TA 5FPXA 4FTSA 4MYEA 1F5JA 1PVC1 4LHKA 2BW8A 4KWKA 2VW0A 1ONAA 4Y1VA 1ZBA3 1H30A 4N53A 3QD6A 2WNUA 4PLOA 1OI6A 4FPLA 4I2OA 3THPA 2JICA 4CDXA 2EXHA 1RUG3 1OA4A 4AHWA 2D6NA 1LU1A 2Q4SA 1QJX3 3M3OA 4HLTA 4WVWA 2DCYA 3RYRA 5LK7B 3D6EA 4MVTA 1X36A 1I3HA 4XYXA 1BEV3 3NVCA 3H9AA 3RYPA 4H14A 3WVJA 1QOTA 2XG3A 4CRQA 3B93A 3PMSA 1D2SA 3OY8A 1EV11 2GN3A 4R4XA 4UXAA 3ZFGC 4RR3B 4XJAA 3K48A 1S0IA 2ZGTA 2H6BA 3RMXA 1LOCA 2X53S 4PCRA 1TMF1 1F2NA 2BWCA 1DLLA 2ES3A 1LHOA 3NAPA 3JU9A 1AYN3 1GZWB 3M1HA 1URXA 3SH4A 1F31A 4C90A 2WC2A 3NL1A 4EN6B 4FAGA 3AYDA 4BA6A 1GZWA 1NXMA 4CEYC 2FZ2A 2QKDA 1BKZA 1KFUL 2P37A 1VBA1 4OI4A 2QDNA 2RS33 5DDJ1 4X6RB 2XJPA 4K6BA 3VHNA 4QPGB 3WQ1A 2AUYA 1QMJA 4S2FA 2A70A 3LAGA 4KH9A 2D98A 3IPVA 5JOZA 1VBE3 1YYNA 4CEWB 5JI7A 2R0FA 4FQZA 4AFBA 4QGNA 3T2TA 4CEWA 4UW3A 4P9YA 1LODA 3O0WA 3BCWA 5ACA3 1ND3B 2GN7A 4MSVA 4YARA 4QU2A 1Q8SA 3WD5A 3JQXA 1Q43A 4AXOA 2WWSA 2GH2A 3GNEA 3JBG1 5C4WC 4W6XA 2ZHNA 5C8CB 4SBVA 4KU7A 1O4ZA 5C8CA 4XFCA 4DINB 4RGAA 1GV9A 1QU0A 4RQPB 5E88A 2IWGB 3B94A 2ILMA 1VBB3 1IPJA 3TN92 4YVWB 1FOD1 2AR6A 1AR92 4LNVA 2PTMA 3JB8A 4AEKA 1HV1A 2ZAAA 1PIV3 3AP9A 1CGPA 4YYOA 1QOSA 1NCQC 4Q26A 4D7TA 1KXGA 2A3XA 3WW3A 1RMU2 1XRUA 4Q0SA 1V00A 4G3YC 2PAMA 5JDBA 5KC6A 5EWSA 1CAUB 2NZ9A 4KGGA 4BZ4A 1AR71 3ILFA 5BNNB 1S0JA 2GMPA 1RUE1 3LA2A 2XJUA 1QF3A 3S6PA 4Q4Y1 4GB32 5J98B 1V6MA 2DFBA 2CWSA 3LOIA 4WM7A 2VOKA 2ZX3A 3EO6A 2DCJA 1WLTA 2RR13 1V9U2 4URTA 1YI9A 5I0UA 2BNOA 2ZAHA 4M01A 3FHIB 2A7AA 2GNDA 3N7LA 5A3LA 3DPRB 5I93A 3ZSKA 3R4DB 1C8M2 2FHRA 1AR63 3WG3A 1CVNA 3SH3A 1WUVA 1Z7S2 2XLGA 3BIWE 3PLQA 4UBHA 5DUUA 1YXWA 4AVAA 4Z8BA 4NVPA 1WGPA 5FMOS 5BPXA 4K1ZA 3MIGA 1COV3 2Q1ZB 2A6ZA 5FMOL 1X50A 1FV2A 1MEC3 2B8MA 2WIIB 4JC1A 5DUXA 3ACLA 4N7IA 5BUVA 4E4SA 1VB2A 3JZVA 1KDKA 4PQ9A 1RB8G 3ZDSA 3B01A 1PK6A 3USSA 3CU7A 3ATGA 3MFAA 4AHYA 2E63A 5JIUA 1S0DA 4LE4A 1ZZ7A 2LUWA 3M3EA 1PO23 2RS12 2XVKA 2W68A 3VL9A 3ZX7A 5EXOA 3PVEA 2CYFA 1RUI2 1NZCA 1V6OA 2EA7A 3UJOA 2BPA2 1FPN2 1VBD2 3EXUA 3IT8A 3GHNA 4X8PA 3DGTA 5GZCA 1ULCA 2ZCWA 4JDNA 4BHPA 4QM8A 4XOGA 1CJDA 3RWNA 3WINE 1ZBA2 1JN2P 3MFCA 4WVMA 1RUOA 3BTAA 3GYDA 1OD5A 3RPQA 3MF9A 1QJU2 3AKPA 4HFSA 3E6DA 3KGLA 1RUG2 2R063 2VNRA 4K1YA 4XBLA 2KA3A 2DUOA 2VY0A 5L19A 1QJX2 3I59B 4AEMA 1TNRA 2RS53 4IV3C 1BEV2 3I59A 4YGDA 2A6XA 2HWE3 5BNPC 3T1LA 5T52A 3IBMA 5EYYA 3H0OA 4QQPA 3RJ2X 4OI2A 1OSGA 4UW5A 4OHZA 1DF0A 3VZKA 3TN91 4CDWB 4EN9B 1Q8QA 4CDWA 1B35A 3O0XA 5AVPA 1JHNA 4LO7A 2UYBA 1QNYA 1OOPC 1YHFA 1AYN2 3DUIA 3E5UA 1ZRRA 1RMU1 2D3SA 3M4FA 1Q3EA 5FTTC 4Q4X1 2UYAA 1BBT3 2RS32 2WT2A 4P5HA 5CFDC 4META 3KT4A 1VALA 4KNCA 4RD7A 2YPJA 1SLAA 1PZ7A 1RUJ3 2VOWA 2GNBA 3H3ZA 2JECA 2IXHA 4Q1PA 3AZYA 1DQ1A 4XHBA 2D40A 3AJYA 1IQAA 4O9EA 1W6NA 4XEZA 5ACA2 3K51A 3VBSB 4ASMB 1AR81 1RHI2 2B5HA 4BPZA 5C9AB 1WD3A 1DQ5A 1ZYBA 2PYTA 4XJWA 1AX1A 4HPKB 3ZXJA 3RDIA 1C8M1 1LHUA 1ZRDA 4ORFA 2WZR3 5J96B 3U0ZA 3W58A 4IV1C 4ZU4A 1VBB2 4TWTA 1C57A 1LECA 1WMDA 4IEOA 1GSLA 4Y5Z0 4QXKA 1Q8OA 5I91A 4FAHA 4Q0UA 1DQ6A 3NV4A 4XQDA 4QX5A 3H1YA 1R1A3 3HT1A 1H2LA 4I0WB 3WV6A 4IEZA 1K5MC 1LB2A 1HLCA 4X6QB 2IFRA 4YGBA 3W59A 5I0RA 3AZXA 4E2QA 3CEWA 1WBFA 3NO8A 4HZFA 4PIYA 4H3WA 3MICA 3OD0A 1H1AA 3AP5A 1MACA 5DZGA 3SITA 5ABJB 1RUI1 3MW2A 3URFA 1C4RA 2SLIA 1IPKA 4AGRA 4ASLA 5JZGC 5SV5A 1XE8A 2QNKA 4FPHA 3WCSA 3MLLA 4EN7B 2R32A 1OPMA 3AKRA 4CDUA 2RR12 1VBC2 1ZBA1 3ZIWA 3WW1A 1G9BA 3O12A 4HVRA 1UW8A 1QJU1 1HRI3 1M06G 4A7ZA 4JGZC 4YVSB 2WNVB 4DZGA 1OA2A 1RUG1 2UU8A 2OUHA 2FQPA 2WNVA 4HBNA 3ME2A 5A33A 1QJX1 1LGCA 2ZOEB 1NOVA 1COV2 2ETEA 1BEV1 2HWB2 4GH4C 3FLTA 1U0AA 1NA1A 1QXPA 1MEC2 2I2SA 2D6PA 3QH6A 2HWD3 5K0UB 1XNCA 3NSTA 3LWCA 4FPFA 4JCKA 1IKQA 2B9UA 4YM0A 2NPIA 5KHIA 2VH9A 1H9WA 1BVP1 3AYEA 2TBVA 1PO22 1AYN1 3WT3A 1VAKA 2BFUS 4QT6A 2BFUL 5FAXA 3RJRA 2QVSB 2LALA 1ZREA 2OUJA 4QPIA 2D43A 2RS31 3IMNA 2EALA 3LSEA 5D8AC 4YW3A 1DZTA 4QPYA 1ZRCA 2DYCA 2E7AA 3WDWA 1N1YA 3ES1A 4YFWA 4GALA 2PHTA 1MZEA 3VL8A 2AZ5A 1VBE1 5H9PA 1N1VA 1VIWB 4WM8A 1OFSA 4P9JA 1J1TA 3KSCA 4Q4Y3 2R062 5C33A 5KHJA 5ACA1 3HAGA 4ES9A 2ZX0A 4NOTA 4XBQA 4PDWA 4LHLA 4L9BA 4CYDA 1SCRA 3L2HA 4WVVA 3VBFA 1XNBA 2GC2A 1BCXA 1H8TC 4XF3A 3ILNA 4EWEA 5JAXA 1I5ZA 4I30A 5T5JA 1PNGA 1VBB1 1QDOA 2VG9A 3M2MA 2X5IB 1V6JA 5T54A 2PHDA 2NMOA 4LA2A 1LJ7A 1MZ5A 5FO8B 2PFWA 4LTAA 4XILA 1NXD1 2GDFA 4EN8B 1UIJA 2DCZA 4AEDC 2XVLA 3VDDC 3VBHC 4YG6A 1Y43B 1O5UA 1ZZ6A 1OKQA 4YZ3A 4AFDA 1C5HA 5LEJA 3VKLA 2WA4A 4Q1RA 5T5PA 3ZFEC 1GZ9A 4LBLA 2CL2A 2RR11 1VBC1 3CJIA 5BYNA 1FMD3 1W6QA 2VQAA 4PLMA 4C0HA 4B4RA 1BYHA 2PLV3 2TEPA 2PAEA 1RJ8A 1RL3A 1XXNA 2BYVE 1S2BA 2WZR2 4LBMA 3LCPA 1DQ4A 3BPZA 2KXLA 4U36A 1PGL2 1COV1 3KGZA 4D7YA 2GMEA 3SH5A 1GFF2 1ZA4A 3MF6A 4RFT0 4BYYA 1MEC1 1RTVA 1R093 3H7JA 5BNOB 3SXWA 1IS6A 5L7OC 3TOJA 1IS4A 4LE3A 4UBGA 5BNOA 5FO9B 3ZFGB 4XFFA 2E7TA 5T5LA 1R1A2 4M3CE 1VB4A 2GMMA 4NHLA 3WP5A 1QOOA 4W6WA 5KXEA 4PIXA 4K9SA 2PHFA 2EAKA 1UPIA 1PO21 3USUA 1JYCA 3WOGA 4FPKA 1ZZCA 4RA0A 1AR93 4K7JA 3AK0A 2ZMKA 4R52A 1KJRA 3KCYA 4GA9A 4CEYB 1GLHA 3IDCB 4DOUA 3A0NA 2D44A 4DMIA 1RIRA 2R49A 2VNGA 5KBFA 1O3QA 3KT1A 4XXPA 2QDRA 1LOFA 3FLRA 3QCWA 5AFBA 4WV8A 2GC1A 3AKSA 2BEOA 1N47A 5L36A 2WZPP 1HKDA 4KBBA 1G9CA 3W9AA 1ENXA 5IK4A 4GB33 2R061 1S0CA 1J58A 4HVQA 1O5LA 2WT1A 3AZWA 2RS51 2VMIA 3ZXAC 1J1LA 1TME3 4QMAA<