1OA3A

Comparison of family 12 glycoside hydrolases and recruited substitutions important for thermal stability
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
218
structure length
218
Chain Sequence
ETSCDQYATFSGNGYIVSNNLWGASAGSGFGCVTSVSLNGAASWHADWQWSGGQNNVKSYQNVQINIPQKRTVNSIGSMPTTASWSYSGSDIRANVAYDLFTAANPNHVTYSGDYELMIWLGKYGDIGPIGSSQGTVNVGGQTWTLYYGYNGAMQVYSFVAQSNTTSYSGDVKNFFNYLRDNKGYNAGGQYVLSYQFGTEPFTGSGTLNVASWTASIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Comparison of Family 12 Glycoside Hydrolases and Recruited Substitutions Important for Thermal Stability
pubmed doi rcsb
source organism Hypocrea schweinitzii
molecule tags Hydrolase
molecule keywords ENDO-BETA-1-4-GLUCANASE
total genus 55
structure length 218
sequence length 218
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2002-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01670 Glyco_hydro_12 Glycosyl hydrolase family 12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1oa3A00
3B5LB 3VHOA 3M4FA 3VZKA 2VGDA 3AMNA 4HKOA 3VZLA 2DFCA 3WXPA 3EXUA 3WX5A 3HD8B 4NPRA 2DCYA 3VHPA 1YNAA 3WP3A 3AKTA 2BWCA 2DFBA 5K9YA 3MF9A 3WQ0A 1XNKA 4HKWA 3RI9A 3VZMA 2B46X 1TE1B 4H7MA 3WP6A 2Z79A 4IXLA 2BW8A 2NQYA 1XXNA 3O7OA 3WR0A 2D97A 2VUJA 1REEA 2QZ3A 3VZNA 1REDA 4S2GA 2F6BA 5EJ3A 2C1FA 1OA2A 1H8VA 2DCZA 3MF6A 1REFA 1XYOA 1OLRA 3VL8A 1QH6A 1HIXA 1KS4A 3VL9A 2B42B 1XNDA 4XPVA 3AKRA 1W2UA 3B7MA 2BWAA 3WY6A 2DCKA 1NLRA 3AKQA 3MFCA 2VG9A 4HK8A 2QZ2A 3VHNA 1ENXA 1C5IA 4HK9A 2BVVA 3WP5A 1BVVA 4S2FA 1AXKA 1UU4A 1H4HA 4S2DA 3LGRA 1UU5A 5K7PA 1H4GA 3AMHA 3VGIA 1BK1A 3WQ1A 1UU6A 4XQWA 3ZSEA 4XQ4A 2JICA 5HXVA 2JENA 1M4WA 1QH7A 1IGOA 2JEMA 3MFAA 1XYNA 2NLRA 3WP4A 1T6GC 2B45X 1XNCA 2DCJA 3AMMA 3VZJA 4HKLA 1UKRA 3WQ7A 1BCXA 1C5HA 1OLQA 2VULA 1HV1A 1OA4A 1XYPA 1PVXA 4XQDA 3VLBB 3AKSA 1KS5A 3WT3A 2D98A 3AMPA 3VZOA 1H1AA 3AMQA 1XNBA 3AKPA 1HV0A 3LB9A 1OA3A 4S2HA 1H0BA 1F5JA 3RI8A
chains in the Genus database with same CATH superfamily
1NCRC 1UY2A 3H1WA 3GCXA 3U0ZA 5DDJ3 3KV5A 3T0AA 1NZCA 3OF1A 3AX4A 5L7OA 1OKOA 4NPRA 3OUJA 4EV0A 5JOYA 1S0FA 2UU8A 3ABZA 3PUSA 4IE0A 4Y4YA 2VE1A 2WQ4A 4RFRB 2JDYA 2ZCWA 4CP0A 4HOOA 4AWDA 5DUXA 1O4TA 1IZ3A 4FSJA 4CDQC 4QPYA 2LRPA 3AYCA 1JOPA 3ENRA 1Q56A 2RJ2A 3RG0A 1UCXA 3GALA 4E9KA 1ND2B 3IM0A 1ASJ1 3HEIA 3RRDA 2W94A 1OUXA 3UKTA 3USSA 1LOFA 3VBSB 2WC2A 5IATA 1BYHA 2GALA 1W06A 4NHYA 4Q27A 3I3BA 1AYN2 4FPJA 2XVLA 5LRRA 2R063 2VTXA 1LGBA 2A3YA 4Q0QA 1UIJA 3A23A 3ECQA 3ZFEB 5C4WB 1HRV2 4JZRA 3VL9A 2RDSA 3WW3A 2ZMKA 1VAVA 4IV3C 1FMD3 1QU0A 4M0NA 4XFHA 2XJVA 4WVMA 2JDPA 4OI1A 5A3PA 1CIYA 3QH7A 4NR1A 2WO3A 2XVGA 3MFCA 1AR61 1TEIA 2YGMA 3LEIA 4GALA 4N90A 2PQSA 2OQ6A 5CISA 5FPXA 1YWKA 4XZUG 5ANNA 5J7MA 2P3YA 3BPSA 1Y43B 5APAA 4A3XA 2RS33 2JDKA 3B00A 1WD4A 3L2YA 3Q9OA 1VBC1 3KQ4B 5F2WA 1CPNA 4A41A 5A6ZA 5CBLA 1YO8A 1VRH3 2WNVB 4M3CF 4ZPIA 1UU4A 1VPHA 3MV01 4MXWA 4FP2A 4NHLA 4AEDC 1JZ2A 2ZGLA 3USUA 2JD4A 1V6OA 3P6BA 3QLQA 1W90A 2ATFA 3GBGA 5K4LA 1ULFA 1X9PA 4A2UA 4N53B 2VW1A 3ZDVA 1LJ7A 2EXHA 2RS32 4PDWA 4OYUA 4B1LA 3B02A 3UNPA 1PGW1 2IFWA 3U1XA 3ZXDA 1ND3B 1QWRA 2W08A 2JENA 4FBFA 1F5FA 1R081 4CCEA 1W8FA 4J1WA 4Q4W3 4UBGA 3APBA 1X9TA 5F3GA 3WSOA 1XYNA 2PTMA 1HN0A 4IGOA 4YFWA 5DZGA 3RWNA 3NWKA 4XETA 3WP4A 4CCCA 1VBE2 4K40A 2E31A 3AMMA 1AR92 4K3UA 4NIAA 4A45A 4BH9A 4QU2A 1W0OA 3W59A 3V0BB 1B35A 2A6VA 5G04L 3AP4A 3WQ7A 2VULA 1OA4A 3I59B 4ZS2A 3VD9A 2GMPA 4Y5TA 2BYVE 1LNSA 2WS93 3NAPB 4R9BA 2H6BA 5H9PA 5A33B 1AF9A 1UYZA 3AMQA 4KGQA 5FOJB 4OMDA 3MV11 3WDTA 1COV3 5K8SA 2N7GA 1UIKA 1W9FA 1OA3A 3TWIA 3K51A 2CY6A 4S2HA 4AI0A 5GLUA 4ES9A 1OPOA 3VBOC 1UY0A 5CFCA 3GHMA 5F5CA 5C6CA 2ORZA 4D3WA 1URXA 2QTWB 2MNGA 3D82A 4QHBA 5FBJA 3ZFFB 4QX0A 1S0DA 3AP6A 3H1MA 3OGRA 1ASJ3 3VKMA 4GWNA 5K0UB 1U5YA 1XPWA 2CAVA 5BXXA 3IAPA 5FUPA 2Q0AA 3CHXA 4Y5SA 5AFBA 4KU8A 1ULCA 5E16A 1W99A 3LPFA 4GH4B 2HWC3 1WW5A 4YM2A 3VBUB 4LUMA 3PVEA 3O0WA 2VW2A 1AR91 4KBZA 3PJYA 1CQ9A 1XXNA 4LXLA 5B4XA 1CAXA 1QIQA 1SDDB 3PL0A 4GB31 1XOYA 1VB2A 2ZKLA 4OMCA 4C91A 4CDUA 3JQXA 5I0DA 3OBZA 1PIV1 3I3EA 5DZEA 5FPUA 1MEC1 1W6PB 3EQEA 3ZIWA 2XJUA 3DXTA 3VBUC 1XYOA 2VU9A 3JQWA 4FXKB 3ZFGC 4QB2A 5FPAA 2P2KA 1BEV3 4CXXA 1HQLA 1XNDA 1RTVA 5IWFA 2NN8A 5L36A 2RR11 2PHRA 3RZZA 1AYM3 2VH9A 4KWUA 1A34A 5DG1A 4AFCA 2WFF3 1HRI3 2ZPXA 1ZZBA 4V2VA 5DPNA 2DBIA 2EXJA 1J1TA 5LBFA 2JDNA 2R061 4CTEA 5D1IA 1B09A 1NLSA 1DGWA 2NYYA 4HVOA 4HK9A 4QX2A 4YRDA 2RJKA 1W2OA 2FDGA 2YZ4A 4LTAA 2WABA 5FY4A 1BVVA 1UWWA 5FWEA 5C3OA 1RB8G 2ZGPA 3VBRC 4OI0A 1VALA 2JE7A 3JBG1 3CZJA 3Q8CA 4AR2A 5FLJA 1RUF3 2MPFA 4RQPC 2JIGA 3C7OA 3KQRA 4QDSA 2CGOA 1H4GA 4QB6A 4BMEA 1V6JA 2YGLA 3OBRA 4HN0A 4UFIA 5DABA 3LE0A 3D4KA 1VMFA 4YM1A 1W8HA 2Q8DA 4XQWA 4OHZA 2WNEA 5EQUA 4C1WA 5IK4A 5JIUA 4WBBA 4SLIA 1MR5A 1MEC2 5A3WA 2VUCA 4Q4V3 3MW3A 1SLIA 2E9QA 4KGGA 4W65A 4FTSA 1NA1A 3K46A 3KS7A 3PJQA 3TN91 5T54A 1GNYA 5IK8A 1T2XA 3ST7A 1RUD2 2FBEA 2AEZA 2E53A 5A6QA 4RN5A 1GWKA 4N8MA 2YBPA 3J8F1 4XUOA 3J8F3 3I7DA 1RUC3 3O0VA 2BFUS 2R1BA 1EYBA 1MZ6A 4NN0A 1HV1A 1R1ZA 4Q2FA 2DVAA 5LY2A 2HYKA 2WIIB 4FQ4A 4MSVA 3H8UA 1SBFA 1LOCA 4UW4A 3WQBA 4K21A 4KWJA 1BBT1 2AUYA 1COV1 3I59A 1QQP1 4A6OA 3VDAA 1APNA 3WNOA 5FO8B 2RS52 3AKPA 4PQQA 5A3LA 2B4KA 1AX2A 2CV6A 1VBE3 4D8MA 1CVNA 3IDCB 3SH5A 4PT6A 4AGRA 1AYM1 5GLVA 2GN3A 1RUJ2 4BWOA 3GYDA 5FO9B 2EAKA 2VBPA 3WCRA 4LMFA 4B7EA 3RZJA 3V56A 1W03A 1W6NA 4RS5B 1Q8OA 4BE3A 5D21A 2XLAA 3WNMA 1HXS3 2D5FA 4CP2A 2A1XA 4FT8A 4CUBA 3S57A 4LKFA 1YNAA 4ITCA 3DXUA 3SH4A 3AKTA 3I3DA 1JYWA 2YY1A 1XNKA 3RI9A 1K5MC 1RUD1 4RR3A 3OPTA 4CPBD 2UY9A 4YW7A 2CNAA 1FYUA 3NV1A 4DY5A 1I5PA 2FD8A 4XVHA 2ZA9A 1LTEA 2Z5WA 4HBNA 2WJSA 1V6LA 2GNMA 3MIHA 2J7MA 5DAPA 3THPA 1R092 3PTYA 4WVZA 2ZHMA 3R4SA 3TNPB 3LEKA 4PF5A 5IW0A 3LEGA 2RV9A 5C7GA 4H2AA 1M06G 4HLTA 1QJY2 2YXSA 4K6BA 5FYYA 3FUOA 2JIJA 1QQP2 1RUG3 2AZ5A 2WDBA 2NMOA 2X5IC 2YFZA 3H9AA 2CAUA 1DYPA 1V9U1 2VVEA 3AP7A 1LHVA 3D5OA 3FWEA 3KT4A 3AKRA 4HZFA 1AYM2 3NNGA 4IQPA 1NUKA 4Y33A 3WNPA 5EP9A 1O3SA 5CIRA 1XU2A 2VOVA 3I2GA 4AEDA 1OOPA 3AFGA 4PIYA 4X6QB 1GNZA 3H3UA 2VG9A 3EHKA 3H42B 2KM2A 4OHXA 4QPGC 1JN2P 3TEWA 5J48A 1CZVA 3B93A 2QZ2A 1LODA 1EAH2 2D44A 3VBFC 3K4DA 3OY8A 2B8MA 1DQ0A 4FO9A 3UYJA 4DZGA 5KXCA 1W2NA 2PHXA 4FQZA 3DUIA 1UOFA 1J3PA 3WP5A 5IVYA 1MS3A 3KV6A 2YU1A 5A7SA 2HBTA 4EN6B 1GOGA 2FCVA 1UU5A 5L9RA 2G19A 5BNNC 5B4NA 1WW7A 3ILRA 5FPLA 3WF0A 2WA3A 2R042 4Q0PA 1OMIA 3ITQA 1LESA 1I1EA 1YRZA 1FNYA 5EYYA 3T2TA 2IXKA 4O7XA 4LOTA 2GC1A 3ZX7A 3FFZA 2BOIA 2A3WA 3PURA 4UF0A 1ZREA 3AVSA 5FPVA 1I9RA 1H2MA 3N7JA 5J98B 3J7HA 3NVCA 4IE5A 2I74A 1H2KA 1UOGA 1YYNA 5LA0A 4BQ3A 1FOD2 2J42A 2GH8A 4KG8A 1XNCA 3R0RA 3KT1A 3V64A 4J25A 4RS5C 1IKQA 3D0SA 3VBSC 2VL4A 4PHZA 4JCKA 3BB6A 4Z07A 1PVXA 1RVF2 2PLV1 4AI2A 4AQTA 1S1AA 4JDOA 1QOOA 3OBAA 2JDUA 3MYXA 5D2AA 1V6IA 4Z8BA 2XXZA 2EIEA 1CAWB 3CL1A 4Y22B 1JXNA 2BJSA 4BYYA 2JG8A 2VOXA 5F5AA 1DGWX 1F35A 5F37A 3ACLA 2JXAA 2CYFA 1RUJ3 4YGCA 2P5BA 3CIHA 3SXWA 3BYWA 4MUVA 4XACA 2YYOA 4H55A 4XUNA 3ZSMA 1Y9QA 2UWAA 3M4FA 4AQ2A 5IAXA 5EJZB 1AUYA 1X82A 3QOPA 1W9YA 2A6ZA 4QB1A 1SLAA 4BIOA 2CGPA 2ZX3A 4PIXA 5I93A 4O9GA 1NCRA 2D6KA 3AZXA 3DYOA 3FE5A 4M4PA 2MEV2 3ACHA 4JQTA 1BQPA 1Q8VA 3RSJA 2WNUB 1C1LA 4AOCA 4QQHA 1G8WA 3VZMA 5BV6A 2GAUA 1AR73 2DUPA 1E5RA 2XL7A 3HMYA 5FCCA 1FOD1 5FYCA 2KD7A 3S5QA 1RUF1 1CJDA 2OZJA 2XJTA 2W1UA 1W0PA 4NJ4A 4XUTA 2XKPA 1QJX3 3M2MA 1YQ8A 3G7DA 2EXKA 4U36A 4LBKA 2F17A 2C26A 4NWWA 4ZONA 3ZYGA 4BQWA 1RUNA 1PMJX 1NY71 3P3NA 1ND3A 4INDA 4W8JA 2W1QA 4Q29A 5FZCA 1OXCA 5A3OA 4BCUA 1PO11 4IEWA 5JDBA 3I4IA 2VBDA 1A8MA 4CDXA 3OJBA 1E5HA 4YWAA 3POWA 1HIXA 1LULA 3ILFA 4GH4C 5FLIA 5FLHA 4YW4A 1O3TA 2Q5TA 3VV1A 1W6NB 2E51A 3C7EA 4YYOA 4K20A 3DN7A 2VUAA 4IEUA 2J1SA 3TYJA 4CP1A 5HCAA 4IEOA 3GBFA 1S0JA 4MVTA 4OZOA 1GZ9A 2GC3A 5L9BA 4IEYA 4UOJA 4KBBA 4L11A 4QD2A 4DEVA 1YCIA 4HVRA 4KWKA 2C9KA 2Y6LA 3AXEA 2Y6JA 4NRQA 5FZAA 4WM8C 3HOBA 4BOWA 2AC1A 5C4WA 4D94A 1BEV1 3WLUA 4MG2A 4CDQB 2VOWA 5F32A 3IPVB 4JRAA 1T6BX 4BQXA 2HWB2 1RIRA 2OA2A 4I0WB 4HONA 4IW3A 2VR4A 3PIGA 4XF4A 3DGTA 1AL23 3KV9A 3KSCA 2PHLA 5ACA2 5BNPC 3NSTA 1GQPA 2JG9A 4XHBA 2ZGNA 3IDAA 1ENQA 1YQCA 5F3IA 5CFDC 2WKKA 3POBA 1ZM1A 2LROA 4CU8A 4W4ZA 1IPSA 5ABJA 4K8FA 2XUMA 3ZSKA 5JSRA 1OOPB 2ZKNA 4PLNA 3ZSLA 4UFKA 3O0XA 1O4ZA 3ZXEA 1SFPA 2D3RA 2UWBA 4BU2A 5FQ0A 2J1TA 4JGYA 4UFMA 1V6KA 3PUQA 1GYKA 1TG7A 1BMV2 1ASJ2 2W68A 4MGKE 4PF1A 4XC9A 3ZXLA 4LLFA 4TLGA 5CFDB 4XF0A 5JUVA 1XYPA 4FPYA 3BPZA 1LRHA 3HT2A 1IG3A 4AL9A 1Q8SA 2P37A 3AL5A 3SNMA 3O1MA 4AEJA 1H6YA 1BEV2 2GC2A 4FPFA 1MS5A 1EPZA 1H30A 3ZSJA 4LUKA 1H1AA 4GZ9A 2BVBA 2D6LX 2VZSA 2R0HA 3N35A 4MGYE 4XFGA 1YJKA 2HJIA 3I49A 1KD7A 1RYYA 2ILMA 1H0BA 3RI8A 1UOJA 1D4VB 3FHAA 2EALA 3KCXA 4XXAA 5ACA1 2GC0A 5L19A 4AQSA 3HBKA 5JXIA 4NOTA 3NMBA 4JVAA 5GALA 2HH9A 3ZM8A 1PX4A 3TNQA 4C8DA 2ID4A 4AI9A 3O1SA 5F1RA 4Q0UA 5FY9A 3DPRA 5T50A 2E33A 2R1DA 5KWRA 1HQNA 2AGSA 5C70A 5CG9A 3E6DA 4FP3A 4LBQD 1NCRB 2VQAA 3ZOIA 1U5ZA 1R083 5C3QA 5JZGA 5BNOC 2YMZA 4IXLA 4EYUA 4DXTA 5FO7B 3CJIA 4LQRA 2C0ZA 1EV12 3K4ZA 1OLME 3LA3A 3O1PA 3LKJA 4RSUA 1HW5A 4TWTA 2WWUA 4HSJA 1PO13 3VDCA 4QXBA 3HR9A 2ET7A 4A44A 4BK5A 4GQ7A 4AVCA 3I2OA 4LO8A 3TEXA 3WDUA 1H8TB 3ZR5A 1PGW2 1UXXX 5JI9A 5CG8A 3PHMA 3UL2A 4E2QA 4FTEA 5C8CB 5A7OA 1QJZA 4A6SA 5L7OC 4WVMB 4F83A 2OW4A 1IOAA 3EO6A 1DFQA 4GWMA 4PBPA 2ZHNA 3ZLIA 3CKHA 2D6PA 3WDVA 2DDUA 4O61A 1VBE1 3ZFGA 2XVKA 3DPRB 1OI6A 4XBQA 4ZXKA 4D69A 2CL2A 3LWCA 5C5UA 3AKQA 4NO4A 3M7AA 4LT5A 2FCTA 4CCOA 2O8OA 1OVPA 1UZWA 4MGZE 5FMBA 5FZHA 1UO9A 1DZTA 2W39A 2ZBJA 4OUEA 1O6UA 2RVAA 1U12A 1EUUA 2I2SA 1G9FA 4IV3B 5FZFA 5FZ7A 3ZIXA 1LHNA 1UNBA 4DINB 2IUWA 3NJZA 3ZMOA 1S4CA 2ZGKA 1H4HA 1MVEA 1YFWA 1CN1A 3LGRA 2WO7A 3ON7A 5ACA3 2XR4A 1GP4A 3NO8A 2DTYA 4MOAA 3LFIA 5CADA 4K9SA 1QOSA 1KFUL 4YW2A 5FYIA 5LY1A 4OHVA 3SC7X 1ENSA 1LAJA 5JXJA 4COVA 2XLFA 4QM8A 1RITA 3ZYRA 5KHKA 2A6XA 4SBVA 2VY0A 2VNGA 3CO2A 3FX3A 3VBHA 3O1TA 1AR71 5IVFA 1WLWA 2LS6A 2R073 2VCCA 3K77A 4HSLA 4QX7A 1MVQA 4Q1RA 5GJ6A 2EVXA 2RHPA 1WD3A 1DLCA 3M1HA 5A6YA 4Y22A 3DV8A 4ES8A 1HDKA 5BNOA 2JDMA 3I2IA 2V4AA 1T6GC 2Y8KA 1F31A 3PU3A 4CU6A 4CDXC 5FP3A 1UKGA 1GANA 1AR83 2Q30A 2WO1A 3LA2A 1DQ6A 1F4AA 3N7MA 4FI9A 2HWF3 5I8TA 3CEWA 4L0PA 3AZYA 2BNNA 5I0SA 2V09A 3FLTA 1NE4A 5FZBA 2BRTA 2KR2A 4LORA 4XIOA 1QEXA 1OH4A 1VP6A 2JJ6A 2WA4A 2WR9A 3POJA 2ZAAA 5C33A 2JG9B 1IQAA 2I45A 1TVGA 4P9GA 4DUVA 2DBNA 4XFIA 1RHI3 4L2NA 2HWE1 2QVSB 5I8YA 3ACFA 3HQXA 3AP9A 3NQHA 1L3JA 1CR7A 3IMMA 4WZCA 4BZ4A 1GOHA 1ZZ6A 4XBNA 1CAVA 2VQ0A 1JI6A 5FP8A 5FXVA 4CDQA 1PK6C 4NAMA 4OUSA 4BQYA 3OGSA 1VBC3 2ZZQA 4Y1ZA 3B01A 1WW6A 1HRV3 3PTRB 3RNSA 5LCWL 3TEYA 3WP6A 5C71A 4GH4A 2FCUA 1US3A 1J58A 3ZYPA 1UYPA 3IPVA 2K46A 1PMHX 2PHUA 4EZHA 1WCUA 2IC1A 3OEBA 1NKGA 1N1YA 3TEZA 3QD6A 2ARBA 3KF3A 3R05A 4LIVA 5FZ3A 2KXLA 3NNMA 4AFMA 4C1XA 4DO0A 1H8VA 2DU1A 2QQIA 5BPXA 3I2KA 5JCTA 1KDMA 4Q4V2 2WSVA 3VDDC 3VL8A 4AVTA 1QH6A 4RL7A 3VBOB 4F7ZA 3WV6A 3N3HA 1V6MA 1IG0A 1KS4A 1ODMA 4FPOB 2DVGA 2GNTA 5A7PA 5KC6A 4P9JA 3SEEA 4A7KA 2D3PA 1W6OA 1O3RA 2DF7A 1POV3 1D0GA 2D5HA 1JS9A 2R30A 3LD8A 4RGAA 5IYYA 2W2IA 3K3NA 1GBGA 4XBLA 1X50A 3S7IA 4GKXA 2XH6A 3H8OA 1CGPA 2D6MA 4HK8A 3OYWB 2XLGA 4YVSB 2EIBA 2IVJA 5C9AC 2Y6FA 1L7RA 2H0VA 3V0BA 1VAKA 4RHV2 2BBVA 4GKYA 2QQWA 2D3SA 3MW4A 4NVPA 2VMCA 1KEXA 2E7TA 3VBFA 3FC0A 1FPN3 1PO21 2VMIA 4QKDA 3LDBA 1C8M1 3ZXAC 4TYSA 3C8XA 5CB7A 1JZ4A 1AHSA 4YZ5A 4PDWC 1BLZA 1S0EA 4LITA 5C8WA 3BIEA 2JX9A 1UMHA 1K5JA 2IXJA 2XMLA 3IDBB 3K4AA 4EN9B 2DUQA 2TEPA 2O0OA 5E6HA 5JZGB 2D7FA 3V0AA 1SLTA 2EICA 5FR3A 2ZEZA 4I02A 5FYZA 1MS9A 1KITA 1FATA 2BGPA 1VMJA 2BP6A 2Q4SA 1VRH1 2D43A 5F6KA 4N43C 1PZ7A 2Q1FA 4Y3OA 3OUHA 1JYIA 2E7QA 4AXOA 4ZHNA 1OF3A 2G9FA 5BUVA 3LSEA 3FZ3A 1AR93 5FIXA 5A1FA 2D40A 1R091 2ZMNA 3GZUC 1PZ9A 2MEV3 1DQ5A 2HWE3 4WVVA 4YZ3A 4AVVA 2FZ2A 2D6NA 4DRVA 1AYN1 1SLBA 1QJY1 4Y1UA 5KXDA 1AL0G 4N43B 3AYDA 2D98A 1EAH3 3AMPA 2XGXA 4XJZA 3ZN4A 1QQP3 4XDOA 1POV1 2VMGA 1J3QA 2WNUC 1JMUB 1KXGA 1SCRA 3U07A 5GZFA 3KF5A 3LZZA 1VB4A 2HKXA 1YQ6A 2FMYA 4MXWB 1Y4WA 4UF0B 3S30A 4AVSA 2O14A 1AR62 1UZYA 4E8CA 5ANQA 5JVVA 1V0AA 3E97A 3WDYA 4QXHA 4Z1VA 2WS92 4PBOA 4CU9A 1JHNA 2WRAA 2BEOA 2XBO3 1JZ8A 3BVCA 4OHYA 2DFBA 1LKNA 5FTTC 4HKWA 4JGZB 2ZX2A 4YVWB 1N1VA 1ZBE3 1VBD3 3NAPC 4QPGA 4FPLA 4V1PA 4XYXA 3BU0A 1CAUA 1SPPA 5DUWA 4YVSC 5FYSA 3ZDSA 2VZOA 4MHUA 3QCWA 5BNPB 3OD4A 3WF2A 1PM7A 4AEMA 1LHUA 1REDA 4XABA 1ULGA 1E5IA 2XHNA 5T5PA 3WG3A 3U10A 2XWJB 1G86A 2XBO2 3THTA 4UFJA 2R49A 1IS6A 5EV7A 4FXGB 4XUQA 3PNAA 4YM0A 3IIIA 2W52A 5DAVA 1AJKA 3K3OA 2QDRA 3JD71 3P3PA 1JU3A 4TLFA 3ZYJB 1RMU3 1K45A 1QOTA 1X8MA 4I01A 4AVBA 1MQTB 2YG0A 3E5QA 4R52A 4B4RA 4QKBA 3TRSB 1FX5A 3UT0A 1RUC1 1WWYA 3GZEA 4ARYA 3O12A 5HV0A 4A7ZA 1NOVA 2PLV2 3E5UA 4YW6A 5FV3A 5LBBA 1PIV3 3A21A 1RUH1 3RGBA 5A6XA 1Z7S1 2YC2A 1NXMA 2FDFA 5C4WC 4QGMA 5EHDA 4YW3A 4E2GA 5K7PA 3MBWA 4QWNA 1KJLA 1OT5A 1XNAA 3AMHA 4MZUA 3RYRA 3RJ2X 1UU6A 4GMP0 4EZ4A 1W6QA 2JG8C 4MADA 4K7JA 4LBMA 4NIGA 1QJFA 2FDJA 4GMP1 5FOBB 2JG9C 3SISA 1UMZA 5LW9A 3MPPG 3QACA 5KR7A 4URAA 2OIIA 4NWVA 4LK7A 3EYPA 1ZRCA 1R64A 4AHXA 1ZA4A 2DUOA 2X10A 2SLIA 4H3WA 1ULEA 5E8AA 5FZMA 1RUC2 5FMOS 3POYA 2GP5A 4ZKTB 2QKDA 3OSDA 4Q4X3 4UYBA 5HCHA 3M3EA 5JOXA 1NY72 3AB0A 1LR5A 3LOBA 3LCPA 2VQTA 4ATEA 2D93A 4N53C 1NA1B 1RUH2 3VLBB 3N4MA 5I0TA 3CNAA 5JIAA 2Q8CA 1Y3TA 1OPMA 2UYBA 1JBCA 2VZ3A 4Q4W2 3RJRA 3MIFA 2RDQA 3ZFGB 5LB6A 1US2A 2A7AA 3E6BA 3I2FA 3LB9A 4KL1A 1UX6A 3J4UH 5F7UA 1W2TA 4XUPA 2LUWA 2RMU1 1K3IA 1EY2A 1VBA3 1IQDC 3ZKUA 1DF0A 1XE8A 3OGJA 3GNEA 1R093 4L9BA 1DIWA 5FJKA 3SMHA 4Q4X2 4H7LA 4IL7A 4Y20A 1O5LA 3T4VA 3VZKA 5IT6A 2YUEA 4A4AA 4BJ0A 3ACGA 4FFIA 2RM21 3VKOA 2Y6HA 2JD9A 2VNVA 3HBZA 1DGLA 4D7TA 3WP3A 1JYNA 2VM9A 1NLQA 2VCMA 2WT0A 2ZMLA 2ZX0A 2P34A 3SEPA 3WQ0A 1B35B 3VBOA 1LOBA 4QDRA 4DXSA 3RYKA 5CFCC 4Q8KA 1F8VA 4QDQA 2B5HA 1S0CA 1GZCA 1ENRA 3H0OA 4OI4A 5DDJ2 4I0BA 5DUUA 5FXWA 5T52A 3UETA 4AE2A 2JE9A 5FYUA 3VBFB 3WR0A 4C90A 2ADEA 1HB2A 4YG3A 1R1A3 3W9AA 1AL21 1Q3EA 4L99A 5DG2A 3NJXA 3BALA 4JTOA 1CAXB 4LLOA 1CESA 4S2GA 4UW3A 5F5IA 5HI0A 4BQ4A 4FPGA 4QX5A 3THDA 1XRUA 1ZVFA 1GFF2 2PAMA 3D6EA 1ZBE2 3NKGA 3U37A 3T2QA 4AW7A 2Y34A 4EN0A 1VBB2 2WINB 2B42B 2ZEYA 2V72A 4XPVA 2K9ZA 3T2PA 3KM5A 3ME2A 1HX6A 2BERA 4LE3A 4PLMA 5T5JA 2RMU2 3IB3A 4B29A 5FZOB 1OF4A 3B94A 3FBMA 4GWJA 1LGCA 5ABJC 4Y24A 3RVHA 3CQOA 4AGVA 4Q4X1 2G9GA 1D7PM 3MHZA 3POFA 4JQRA 4P5YA 2IWGB 4MLOA 1AZDA 3C7FA 4FFFA 5FZIA 3JB4C 1HKDA 2JDHA 3SKJE 5FY5A 4BMBA 5BYNA 1H2LA 2FHRA 2VZ1A 4CCDA 4IEZA 2HWC2 2B9UA 2RS12 1O5UA 4P9YA 4LR4A 4EWEA 5T55A 1I6XA 2FZ1A 5BNNA 4ATFA 2NZ9A 1UZZA 4QHZA 1YUDA 4N43A 5FK7A 1AXYA 1ONAA 4W6YA 3DYPA 1IS4A 5GLTA 3W21A 5J96B 2ZGSA 1ZRFA 2AYHA 3MIBA 2BUKA 1KFXL 1NT0A 1NQJA 4YLZA 5ABJB 3ES1A 3KZ4C 3LEMA 1PIV2 4XQ4A 1QXRA 4LOSA 4IDZA 4JV4A 5A3MA 1OKQA 1LCLA 2WO2A 3IIAA 2J1AA 4LBJA 4XMAA 5A3NA 1D0HA 3DECA 2RS13 4TSVA 5GZEA 1ZBE1 1BK0A 1QHDA 5LBCA 1S55A 3ZFFA 1Z7S3 4XFBA 1YI9A 3QBQA 5D8AC 2RR12 1VRBA 2UYAA 1X7NA 4Q0VA 3VDBA 4YSFA 1WLDA 1SFNA 2JWPA 3ZMNA 1EV11 1HB3A 2WNUA 2GH2A 3VZJA 5KHGA 3WZ1A 3UGFA 3C7HA 3H3ZA 1UKRA 1WA4A 3ALQA 1WA6X 4FVVA 1HQWA 3N7LA 1UY3A 2R0FA 4EROA 3MIGA 4ORFA 1X36A 2A73B 1RVF3 2Q1MA 4FPKA 3T2OA 5IVJA 1ZZ7A 2VXJA 1KS5A 2ZGMA 1QMJA 2ZHKA 4LBLA 3NL1A 1E5SA 3BTYA 4CUCA 4NRMA 2VTXJ 3OY8B 4RYDA 3R6SA 1GV9A 1O59A 2QUOA 2W92A 4P00B 4ZXEA 4AI1A 1V9U2 4CEYA 2ADDA 3E1F1 2A70A 2WLQA 4OI2A 2CTVA 2ZZJA 4JRLA 4CXWA 4DXZA 1CJPA 3PUIA 1XSQA 2VD7A 1D2SA 2PYTA 1J3RA 3GZAA 4YVSA 4LBQA 3VZLA 4B3NA 5C3SA 3E6CC 4I0AA 4JKKA 2W1WA 4JGYC 1F2NA 3ELNA 4ISQA 5DN2A 1SEFA 2ZGTA 3AP5A 2RDNA 2P3JA 3C7GA 5K9YA 4J1XA 4GJZA 5IVVA 1CWPA 4HMZA 4ZZ8A 4Z2AA 5A1AA 2R072 5DAQA 3ROUA 4XIKA 4EN8B 1HLCA 2BDRA 3J8F2 2XB6C 2FQPA 5JOWA 4K1ZA 3BIWE 3GCWA 1MS1A 1ST8A 5A1LA 3MW2A 4P08A 1HB1A 2QFEA 4Y5Z0 1G6NA 2YC0A 2ENRA 3K48A 4NMIA 4YZ2A 2R041 1NCQB 1JZ3A 1COV2 4GJYA 1BJQA 1AVBA 4Q4Y2 2JKBA 3CDZB 3FBYA 4AG4A 2YU2A 4JTNA 1XNTA 4IE6A 4YNIA 3I8TA 4GAZA 4D7SA 1DZQA 2D6OX 4Y4RA 1YQ2A 3MLLA 4Y26A 2EF6A 3VD7A 3B7MA 2HYXA 3F2ZA 3NRUA 1ZRDA 2JG8B 4AHZA 1H9PA 4Q0SA 3VN4A 3NNJA 2WZEA 3P5BA 1VAMA 3WHTA 1K42A 3WF4A 3N9QA 4XAAA 4XF3A 4UW6A 3AZWA 1WCSA 4M3CA 3ZN6A 4GULA 4AFBA 2ZABA 1G9CA 2Q8EA 4QPIB 2OX0A 1ALYA 2FDIA 5IJRA 1JZ6A 4CEWB 5SV8A 2X5IB 5FAXA 3N9OA 1N3OA 2V4VA 3D3AA 3SLIA 4AAPA 4DXRA 2HWE2 3KGZA 3KVAA 4DQAA 1BK1A 3WQ1A 1YIFA 4KU7A 3BUCA 2DVDA 4FPHA 3MZHA 5J3UA 4RQPB 3PLQA 2OPWA 2VZTA 4XURA 5FQ0B 5EZWA 1A78A 5GLWA 3DYMA 2WWJA 2RR13 1YC61 3MFAA 3JCIA 4NUBA 2VW0A 2WZ8A 1ZX5A 3H7JA 4QAWA 1RUOA 1RUE1 4BQ1A 3WW4A 1Y9GA 4FOQA 4FPCA 2J1UA 4J6GA 3WNKA 1J83A 1W8WA 1WZXA 4IE7A 4KQ7A 1LB2A 4B4PA 4EJRA 5FZ6A 2OS2A 4GB33 1FI2A 4ET7A 4G3YC 3BGAA 1SMVA 4M0HA 4E4ZA 3S7EA 1QNWA 2YPDA 1C28A 1TME3 3IDEA 4XHXA 1K5MB 4M3CB 4CPBA 4P9IA 1GP6A 3LDKA 2YC4A 2BTVC 4YGDA 2H6CA 1V70A 5LA1A 2A75A 4NIHA 2J22A 4RS5A 1WMFA 2OPKA 4ZU7A 1SLLA 3R4DB 3AZVA 2XHKA 2LM3A 3B5LB 1CD3G 2R32A 4XAEA 4HVQA 3WOGA 1ULDA 5DAXA 2BU9A 2ZTNA 1WBLA 5LASA 5EYXA 5JR2A 4Z2WA 4DS0A 1CZSA 4L92A 2E32A 1HRI1 4LO4B 5JZGC 3HIFA 3VD3A 3LA7A 1DYKA 1GKBA 5FPZA 2ZGQA 3T1MA 3DKWA 1OVSA 4DPNA 5CEHA 1UYYA 2PXJA 2ZS6B 5T5OA 1W6MA 4X8PA 4AF9A 2UWCA 2BV4A 3KCCA 1YFXA 5FUNA 1J59A 2OQ7A 3RZMA 3RMXA 4YVWA 3CZUA 2ZAHA 3WG1A 2ZHLA 3T0DA 1NE6A 4P9XA 5FY8A 1YFYA 5JLVA 3O1OA 3OUIA 1REEA 3HN3A 4P5HA 5K0UA 3MIDA 5FKCA 2F6BA 2Y64A 3RZHA 2C1FA 2TUNA 2DCZA 4WVWA 5AC92 4NPMA 3H7YA 3OG2A 2GP3A 2HLEA 2P3IA 1A8DA 3HJRA 4XMIA 2CGNA 3RMYA 3VHRA 4IEXA 1VRH2 3N9MA 1WMXA 3ZVXA 3Q8EA 3I3MA 5KXBA 1W2UA 1TMF1 1SLCA 1W28A 2XUEA 1NCQC 1W9SA 2QQMA 3HVDA 3ZPOA 3AXDA 1AR81 5A70A 1BVP1 4AGGA 1RJ8A 2WAOA 2ZEXA 1BKZA 3W5MA 2H0BA 1UY4A 4M4RA 3RYPA 4ARXA 2ZX4A 4QQPA 2E63A 1C5IA 3BOWA 3F95A 4GWIA 4DNYA 4OQ8A 2P6HA 4XFCA 2BVVA 4FCAA 4JGZC 2P4EA 4PJYA 5A3UA 4Q26A 4DRRA 5FRAA 5JMOA 1LU1A 1XU1A 3CBNA 4LKSA 1RL3A 4S2DA 2F4PA 3GXUA 1SBDA 3PDQA 1XE7A 2J1EA 4BXFA 2WT2A 5FKBA 3VGIA 4COYA 3DCQA 3FN9A 3O1UA 3I3QA 4WM8A 4COZA 5I0RA 1XE0A 3ZYBA 1VJ2A 1WLTA 5HXVA 2BPA2 2G9ZA 2V5DA 1N3PA 2GZWA 2W5FA 2CDPA 3EMRA 3LF7A 4HN1A 3J26N 5FZ1A 4OULA 2W91A 5EWSA 2DVBA 1Q8PA 2JEMA 4BIFA 1O4YA 1WBFA 4I30A 3S6PA 2WNVC 5JOZA 1TMF2 4AFDA 3WF1A 3J9SA 4BB3A 2DCJA 3M70A 1TNRA 2A71A 3PMEA 4XTPA 2TBVA 5DAWA 3NV3A 4QKNA 5HXMA 1GZTA 2EIDA 2R043 1UW8A 2WN3A 1BCXA 5GLZA 1C5HA 1GLHA 4TZDA 4CYDA 1SFYA 4KWLA 1JUHA 3POSA 1Z0HA 3AKSA 1LU2A 2VC9A 4OZXA 4XJ8A 4CEWC 2NP0A 1VE0A 2YFUA 1GSLA 5FMDA 2IXLA 2XPJA 1FOD3 1PX3A 3PU8A 1ZRRA 2Q8OA 5D8AB 4AQ6A 1TMF3 3MDPA 2C4XA 4R4XA 5I91A 4MX3A 5L9VA 2PA7A 1PK6A 4PI0A 1H2NA 2RMU3 2VOTA 4CZSA 5BNQA 4OCTA 1MACA 2DFCA 3PVBB 2QQOA 5EXOA 3KD4A 2BGCA 5J09A 4NAOA 4AVAA 3AYEA 4N9IA 2RDRA 1VBC2 1HJFA 2OXBA 3JD73 3MF9A 3KV4A 2JKXA 2HEWF 1ZA7A 4AHWA 2Z79A 1MZEA 2W87A 1ULOA 3C2UA 1N47A 3MIEA 4IGQA 5FY7A 3AC0A 5EPAA 1QXJA 2ETEA 3HN1A 3OEAA 4N7IA 2YV8A 5IK7A 3U11A 1W9TA 2F4LA 1PNGA 2QQKA 5GZCA 2AR6A 2HBUA 3CJXA 1LHWA 3UGGA 2RS31 4AHYA 5GZGA 3A4UA 4YGBA 4CU7A 1CX1A 1WGPA 1FV2A 1NXD1 1AR72 2VTFA 3GDBA 1R082 1DP0A 4GMP3 4WM7B 3H8XA 1JH5A 4MGIE 2YHJA 4QXCA 4CDWA 2C9AA 1LECA 4Y20B 4ZU5A 5KHIA 2L9LA 4QKFA 5J36A 1RXFA 1OQ1A 4JDMA 3D8CA 1AXZA 2W46A 3MICA 3NAPA 5A33A 2E6VA 2YB7A 3UK9A 1OQDA 5KHHA 1CAWA 3GM8A 3VD5A 1FV3A 1H8TA 4A7YA 3FLRA 4CCLA 4IEVA 3WHUA 1JYXA 2CHHA 5DXDA 1W3XA 5F8PA 4CEWA 1RUH3 2QBXA 3OGVA 2AEYA 4XFAA 3SCFA 1IHMA 4QQ2A 4Q4W1 1W3VA 3PUAA 4QHOA 3JZVA 3VB9A 3J7MA 1UOBA 4WM7C 3WCSA 1OHFA 1LGNA 2QQNA 5C8CC 1OC1A 5EJ1B 3SKVA 2DURA 1D4M1 2W3JA 3ILNA 3N9PA 4N53A 1GQGA 3MUZ1 2OUJA 4LO6B 2K0GA 4YW5A 4ZZ5A 4UT5A 4IERA 4U2AA 3ZSEA 1SACA 2WAAA 2WFF1 3A0KA 3W5NA 3WD5A 3WW2A 5LA9A 5FYHA 1W6MB 3ZFEC 1HRV1 4BHPA 4MYEA 1IGOA 4HL0A 1JOBA 1QJU3 2W95A 5E89A 1K5MA 3POIA 1QJU1 1W8UA 2X8KA 1PGSA 4QT6A 2E7AA 3AYAA 3JBG3 5C9AB 2LTNA 4B7KA 2JDZA 4BQ5A 4RGGA 3RZLA 2UY8A 4N9HA 5ERLA 4E2SA 1W9WA 2AH2A 1AR63 4XE9A 2ZGOA 1OLQA 2A3XA 1OH3A 1BBT3 3OPWA 1AL22 1ZYBA 1YEWA 5FZDA 2OYZA 4AZZA 4I3GA 3OGGA 1DDLA 1GUIA 2HEVF 1JU4A 1QDOA 1P8JA 2PFWA 4E8DA 3IKWA 5KC5A 1GMMA 1S0GA 1O8PA 1VBB1 3WNLA 5IK5A 4BLIA 4ASLA 1MQTA 2WYFA 1F5JA 1GU3A 5M0TA 2FMDA 4D0QA 2ZACA 1BXHA 1GNHA 4UW5A 2AENA 3LSDA 1LHOA 3VHOA 1SHWB 3HAGA 5FYVA 3ETQA 1DQ2A 1C8NA 4FAGA 1IKPA 4N7UA 3WX5A 2WFF2 4Q4Y3 3U4SA 1RUG2 3HNMA 4L8QA 2VXRA 2R062 4CDUC 5A7WA 1OFNA 1WW4A 4COWA 1QJY3 4UFHA 1RUI3 2BNMA 1RUI1 2ES3A 1DU3D 5FYBA 4YFZA 3KB5A 3VDDB 1O8SA 2CSGA 4M3CE 1JYVA 3O7OA 2YDEA 4FFGA 4O9EA 5FBZA 3K75B 4QX3A 3RFRA 4ASMB 1VMHA 1WMDA 4BA6A 4B1MA 4D6QA 1UL9A 5HCBA 3BCWA 2XDVA 2VMHA 3QH6A 3ES4A 4QMAA 1CZTA 4YW1A 4BISA 5F9TA 1JHJA 1Q43A 1UX7A 4LPLA 1OBNA 1OA2A 2TNFA 1DCSA 2QQJA 1G9BA 1REFA 1H1IA 3LIGA 5J1XA 2WQ8A 5E88A 3IAQA 4QPIA 3WNNA 3IBMA 2VPVA 2XG3A 2BWAA 1DZRA 4MXVA 1QNYA 4YM3A 4CCMA 3PVOA 2ZX1A 1STMA 3DL3A 3T3YA 1XB9A 4IV3A 4JGYB 1ULPA 1MZFA 4AFAA 4UAPA 1AYN3 4Q8LA 4K1YA 4CA9A 1IS3A 1WCKA 2I07B 3UKNA 1E57A 3PIJA 5A3TA 2Y6GA 1RJ7A 1XJAA 4GD4A 2GU9A 5JXGA 2OUHA 1EV13 2P17A 1XBFA 3WG2A 4E4DX 4CXYA 3B3QE 2Y38A 4C0BA 2WZR3 2WZPP 5E1RA 4GB32 4EWAA 2CDOA 3HQRA 2ZXQA 3UV9A 2KA3A 2GMMA 3ASIA 4UWDA 3ZO0B 3UKVA 3ZN6B 4YPJA 1UPSA 2JICA 2SBAA 5A80A 5H9RA 1WMEA 5JPNB 2OT7A 2V73A 1L7QA 4BK4A 4META 2E26A 1OD5A 1XSRA 1JOJA 3AM2A 2Z2SB 3VKNA 3DF0A 1DQ4A 3MEPA 2AACA 4YARA 4NHMA 3B9IA 2WZR2 4IV1B 4X8NA 4NIDA 5LK7B 3BTXA 2X29A 4XEZA 5IFPA 2QQUA 4LE4A 1IPKA 1PM4A 4NPLA 1YIPA 2VMDA 1KRIA 2GNBA 3Q8AA 3BI3A 4LEJA 5AC93 2IXCA 4I2OA 1NYWA 4LULA 1AJOA 2X53S 2QDNA 2Z42A 1B35C 3ZYFA 4XCBA 3OOXA 2XBO1 3WUDA 3Q8FA 1DG6A 3GZTB 3OYWA 2BFUL 2LALA 4XFFA 1LOFC 3MUY1 4NROA 2R6QA 3JBG2 1WCQA 3KVBA 4XF1A 3MLJA 4NIIA 3T1LA 4R8HA 5LATA 1S0IA 1VIWB 1UN1A 1TNFA 4Q5OA 1KGYA 1RGSA 2BGOA 4HPKB 4TTGA 4WZFA 1S0BA 3USUB 4PLOA 3WXPA 3N36A 3POGA 2YBKA 1W8TA 1NQDA 3N9NA 3PVNA 3NV2A 1EP0A 5HV4A 1ND2C 2Y0IA 5L7OB 2C24A 1QJEA 1EAH1 1ZRIA 4I3PA 3CU7A 1W6PA 2Z4FA 1UAIA 3OCPA 4JKLA 5J37A 3MPBA 5IVBA 3OPZA 3TOJA 4Z82A 1L7LA 1GZWA 1VBB3 1WUVA 2W1SA 3OD0A 4H7MA 4O65A 4F3JA 5JWPA 1RHI2 3I97A 2WZR1 1WLCA 1YHFA 1LEMA 3G6JB 4CDWC 1JZ5A 2PAKA 3UJOA 1RMU1 4RD7A 1V00A 1SCSA 4XXPA 5H9SA 2AREA 3WVJA 5IVEA 5LEKA 1Q8QA 2EIGA 4QQOA 3VZNA 1R1A2 4CCKA 1C3HA 3ETPA 4P02B 5C5TA 1JYTA 2G4IA 1UQXA 2YPJA 1SBEA 5CFDA 3MGUA 2Y26A 4L97A 4LHNA 3MF6A 4UXAA 1JYCA 1JTZX 5JXHA 2ARCA 2XQXA 3B69A 5F2SA 1RINA 1GQHA 4K8RB 1DGRA 2WSUA 4LIUA 4DEQA 1FMD1 1ZZ9A 3A0NA 4LA2A 5F3EA 3RQ0A 4JAAA 3THCA 2QQPA 1OD3A 4MHRA 1NLRA 3JB8A 3MO4A 4M00A 4XOGA 4CDUB 3ZPYA 4AK3A 4OUMA 1FT9A 3M3OA 3U78A 4CE8A 1RVF1 3VHNA 4D6SA 4IV1C 4CP9B 5FP9A 5FZ8A 1ACCA 3IT8A 3VBHB 3R4UA 5I0UA 4S2FA 3H3LA 2VMFA 1TME2 2XJSA 3FMGA 1AXKA 4HANA 3KWVA 5A32A 1RMU2 4QXKA 1G7YA 3L2HA 1VLNA 3V0AB 1W8OA 2JECA 4Q1PA 4HXCA 1QF3A 2ET1A 1GOFA 2W47A 4CDXB 2GNDA 3B9CA 3EJKA 1JODA 4ZY9A 5I8SA 5IAVA 3ZR6A 4IE4A 4W6WA 3DPRC 3U4XA 3FHQA 4LBOA 2J1VA 3VDDA 4UFLA 4PDWB 2W9XA 4FFHA 3HNBM 2EAAA 4KMQA 2PELA 1G9AA 3LOIA 1V9U3 1FMD2 3JD72 4RA0A 1ZNPA 2B45X 1RUF2 3I2HA 3CJIC 4CEYB 4DFSA 5DMYA 4E4HA 1OURA 5DZFA 1GWLA 2A6YA 4R4ZA 1DBNA 3MI8A 3POEA 1O91A 3GHNA 1OUSA 2VZRA 4HG6B 1LOEA 2Y60A 4LBNA 3T09A 4P9LA 4RHV3 4QX1A 1PO12 5FYMA 5LEJA 2BQPA 3VBRB 4GXLA 1SZBA 2NPIA 3M3IA 4YVWC 4MGSA 3WG4A 1FPN2 4URTA 1W6OB 1Z7S2 2XJRA 3O14A 5FMOL 1TME1 3KHBA 2ZOEB 2XWBB 3M3QA 1J1LA 1GR3A 2QNKA 3LIHA 3AJZA 1O7FA 3M3CA 4GIQA 5GZDA 2WQZC 3W20A 1C1FA 4PI2A 4JHTA 1QJX2 2C5DA 2B7YA 3SITA 2BNOA 2WUHA 3JU9A 4CRQA 4Y1YA 2QJVA 3NKTA 4OVEA 3HD8B 1NAEA 1QKQA 5CKQA 1Y9MA 3AVRA 2BOJA 4IV1A 2VO5A 1LOAA 1NCQA 2BWCA 2HWC1 2RE9A 3N9LA 5CNAA 3URFA 2VZQA 1TE1B 3ZXFA 1NZIA 2HWB3 2BW8A 2NQYA 2QCSB 1QGLA 5AVAA 2ZGRA 3ZXGA 4JDNA 4RR3B 1PO23 5CYYA 3KCYA 4LBQB 3ZXKA 4FOWA 1RXGA 3UESA 1ZBA1 4DY3A 5LWBA 3JUUA 4DB5A 2QZ3A 4B4QA 1I3HA 2WNOA 4GA9A 1EUTA 4A42A 5EJ3A 4OQ9A 3T08A 4D6RA 2RJLA 1POQA 1UYXA 1W2AX 2P1BA 2QQVA 1IPJA 2ZEWA 5CAZA 1FPN1 4ONUA 4AI8A 4XJUA 3VBHC 1W6QB 4ZS3A 2FDKA 4MH0E 1QDCA 3LPGA 2JB4A 2DCKA 2Z69A 1MS0A 3WNXA 1QJX1 2ARAA 3FUQA 3RPQA 2FDHA 4YG0A 3LAGA 2PHWA 5IUQA 1FXZA 3LFMA 1NX9A 4LNVA 1C57A 1MS4A 2RM22 1S2BA 1FAYA 3GGLA 2WFPA 3GF6A 2MEV1 5B2GB 3CJIB 5HPOA 3A7QA 4CDWB 4KNCA 4AEKA 2IXIA 4EE2A 1H8TC 5IHRA 1HN1A 2MHFA 1AX0A 1CONA 1W8ZA 4XW3A 3SH3A 1AX1A 4IGPA 5DDJ1 4AI3A 2EA7A 2YBSA 1BHGA 1ZBA2 2P6CA 4HT1T 3OB8A 4FTBA 1KQRA 3D0JA 2VCAA 1PVC1 2PLV3 2IXHA 2XJPA 2Y6KA 3AL6A 3LQCA 5A7WB 3NNFA 1J84A 2QQLA 2XJQA 4V2WA 5LK5A 3T4HB 3IZOA 1W04A 3MLKA 3P1IA 4G4FA 4QPGB 5DQ0A 1SDWA 3K2OA 3O1RA 5FK8A 5G05L 3BOPA 2NMNA 5CVRA 4AEDB 1Z78A 2YROA 4IEPA 2ZGUA 3ZXJA 1RC6A 4W6XA 3BN6A 1W8NA 4LO7A 5EFUA 5T5LA 2HWD3 3AK0A 2P3KA 2IFRA 4MO3M 3KMHA 1UF2C 2A6WA 3GJAA 4JGZA 1PHMA 4CUAA 3HWJA 2PQQA 4I09A 4KI5M 3CF6E 4IUGA 3KHCA 3UJQA 1U5XA 5BNNB 1OQEA 1OFSA 2WN2A 4XQDA 3ZFFC 4RQPA 2G1MA 3WDXA 3ACIA 4BM8A 4CCJA 2RS11 5D8AA 3AFKA 4Z92B 4BDVB 3NJYA 5BY5A 4FOYA 1F4HA 2GSYA 2HEYF 3WW1A 3I2DA 5CFCB 1YXWA 4HETA 1HV0A 2DWRA 4P9WA 5FXXA 3VKFC 1PK6B 4LHSA 4BLJA 2JE8A 2Y0OA 4X6RB 4MGTA 4XTMA 1LEDA 5JPMB 1NA1C 3M8LA 4QGLA 1Y7BA 3CLPA 1D4M3 2V5YA 1PVC2 1LOGA 4F8AA 2VMEA 4TXWA 4XJWA 2EXIA 1BZWA 4IETA 2A5ZA 3U14A 2DCYA 3VHPA 4DUWA 4M01A 2XL9A 3A22A 5C9AA 3TN92 1OOPC 4YG6A 5FZ4A 5FJHA 1YQ5A 5JI7A 1U0AA 4NHXA 5DUVA 3EB7A 4CEYC 4YZ1A 4QX8A 3I2JA 1QXPA 4Y1XA 1DYOA 4R9DA 1FNZA 3WUCA 4DOUA 1V6NA 5CKMA 5FP7A 1ODNA 3EBRA 1EPWA 1BMV1 2VUDA 1D4M2 1W05A 4WM8B 2VBBA 2XKOA 3PMSA 4JC1A 1F15A 3BU7A 1Q5OA 2D97A 1MEC3 5FZGA 5TSWA 4MGQA 5FMCA 2BBAA 2WBKA 4WM7A 2DCTA 4HFSA 4QPWA 4EQVA 1BBT2 4LJHA 1MS8A 1XQNA 4KG0A 5BNOB 2JB8A 2LW8A 3I54A 1GWMA 1TQ5A 2RS51 3RWKX 5F5QA 2O1QA 2IVIB 2W0XA 2CU5A 2RG4A 2R16A 2VVFA 1QJU2 1RUJ1 2DV9A 3GJBA 5HCFA 5T3NA 4CUGA 4NRPA 1S2KA 5FREA 1UZ0A 2O8QA 2R7EB 5FZ0A 1NG0A 2RM23 2GN7A 4BQ2A 4CP9A 3HNYM 2GMEA 5FZKA 1POV0 5CA6A 4LO5B 1IS5A 5FFOC 4NE9A 1N3QA 3FJSA 3TB0A 1ZZ8A 2ZJCA 4JX0A 5KHJA 5LZ6A 3BTZA 1ENXA 3DKQA 3T0BA 4RFT0 4KH9A 4XDPA 2PN5A 2J1RA 4FPEA 3VD4A 3OTFA 2R071 3V65A 1MPXA 1X8EA 4OHWA 3J7LA 4LHLA 2WL1A 5GKAC 1DLLA 3VBSA 1JUIA 2PMWB 2WLPA 1PZ8A 5LBEA 4R9CA 3NW4A 2X5IA 1WCDJ 4NHKA 3PUHA 3VKLA 1MQTC 3JXSA 4XZPA 5IVCA 1RUG1 1HRI2 2DTWA 4PQ9A 4XILA 3H1YA 3RZGA 4Q4Y1 2WNVA 1M4WA 1DHKB 2ARXA 2ERFA 2VZUA 5FPBA 1KJRA 4B8EA 1ZZCA 4CSWA 4EN7B 4Y1VA 1RUI2 2NLRA 5FXZA 5AFEA 3ZN5A 1YI7A 1YJLA 3U75A 1C8M3 1ZBA3 3J7NA 2WYSA 5JR7B 2C6SA 5CU1A 2DYCA 4XJAA 4LK6A 1SQ4A 3FHIB 4HKLA 5FY0A 5LA2A 2OKXA 2K2SA 4LA3A 5FZ9A 2VZPA 2Y33A 3IMNA 4G9SB 4FAHA 1QY4A 1S2EA 3BKZA 3N7KA 4A3ZA 1CAVB 1O3QA 4RGKA 4IEQA 1HB4A 4JKMA 4ISRA 4P14A 3DEMA 4AAXA 4ASKA 5AC91 1G9DA 2XOMA 4Q4V1 1GICA 3NNLA 1XNBA 5FZOA 1HXS1 3S5AA 3WDWA 2HWD2 4CCNA 2BZDA 1ND3C 4QQLA 2PAEA 3SCHA 2PHTA 4WV8A 3Q8BA 4DMIA 1VBD2 2CWMA 4W50A 1RUE3 5C3RA 1UPIA 1OLMA 5A7QA 2IZWA 3BTAA 3ZFEA 3FLPA 4C0HA 1U5IA 3UGHA 1DGRN 2B9VA 2VAUA 4COUA 2JDAA 2VGDA 2VNRA 3AMNA 3FFQA 4HKOA 4QU1A 3EXUA 3TAYA 5FP4A 5IFTA 4RR3C 3X29B 3SHRA 3IN9A 2QE3A 5FWJA 4R9AA 1K12A 3ZKYA 1RUD3 5A7NA 1CX4A 2NM1A 4E27A 1ND2A 2VCBA 3ATGA 1OSGA 2B46X 5FDBA 3O1VA 3RZKA 5FZLA 1RUE2 2VVDA 1LENA 5CZKA 3O5SA 2RS53 1H1MA 3KLSA 1GZWB 4HPKA 4MV2A 4QM9A 3RDIA 4XDQA 1PVC3 4JHZA 1D2QA 3KGLA 5AVPA 4DUXA 4YGEA 2VUJA 4AYUA 1CAUB 1SPPB 2B39A 2VJXA 1UMIA 3E5XA 3IWZA 3INAA 4LKEA 4XCAA 5LRSA 2HWF1 3FL7A 5SV5A 2PHDA 1W0NA 1HJGA 5H9QA 1WKYA 4EWDA 1UD1A 2VQUA 4LKDA 1PNFA 4LHKA 3SCGA 3TN93 4DIQA 3BODA 4YZ4A 4IESA 1OLRA 1HXS2 3ZYHA 1I5ZA 2HWD1 2WT1A 5F6LB 1VBA1 1VBD1 4PCRA 2DU0A 4CVUA 4UI9L 4FOVA 3WY6A 4OLLA 2WWSA 3WF3A 5K0UC 1KDKA 1A3KA 1YLLA 2GDFA 2OZ6A 3NV4A 1N1TA 1VR3A 1F9KA 5FUIA 3SQOA 4PIZA 3VBUA 3CMGA 3VUOA 3RS6A 1PGL2 1C4RA 3HT1A 4OFGA 3WEZA 2UURA 5C8CA 1JW6A 5FYTA 2XONA 2DVFA 4ZU4A 3AJYA 3C3VA 1GP5A 1PMIA 5HBAA 5JSOA 2CWSA 1JZ7A 1MZ5A 3LDRA 3TBDA 4QGNA 1A6CA 1N1SA 3HPNA 4QPIC 2VNOA 2HWF2 1CIWA 3W58A 1UY1A 3KT7A 4D7YA 5CKNA 5FY1A 2XQRA 5JAXA 5KBFA 4BXSV 1SG3A 5F39A 4E4SA 2WS91 3T30A 1H6XA 2VZVA 2ORXA 1QH7A 3VBRA 5C3PA 4UBHA 3WINE 3H8RA 3H50A 3GBWA 1TZOA 1VBA2 2VECA 5F3CA 2OVUA 1RHI1 1XC6A 5JMCA 1W39A 4TN7A 1YFUA 3HQUA 4XJ9A 2PHFA 1AR82 3ORJA 5FZEA 3L9JT 5JSPA 1PGL1 1R1A1 5ISLA 2X09A 1X33A 4RHV1 5GM0A 3NJVA 1DQ1A 5A32B 3OBTA 5BNPA 3S0MA 3WT3A 1UXZA 1UZVA 3VZOA 2HWB1 1CPMA 2VOKA 2Q1ZB 5EIYB 1PO22 3ZYIB 5KXEA 1C8M2 4H14A 2X05A 4BPZA 4XF9A 1H9WA 5L73A 3AZZA
chains in the Genus database with same CATH topology
1NCRC 3H1WA 3U0ZA 5DDJ3 1NZCA 3OF1A 3AX4A 5L7OA 4NPRA 5JOYA 4EV0A 1S0FA 2UU8A 4Y4YA 2WQ4A 2ZCWA 4CP0A 4AWDA 5DUXA 1O4TA 1IZ3A 4FSJA 4CDQC 4QPYA 3AYCA 3ENRA 1Q56A 3RG0A 1UCXA 3GALA 4E9KA 1ND2B 3IM0A 1ASJ1 3RRDA 3UKTA 3USSA 1LOFA 3VBSB 2WC2A 1BYHA 2GALA 4Q27A 1AYN2 4FPJA 2XVLA 5LRRA 2R063 1LGBA 2A3YA 4Q0QA 1UIJA 3ECQA 3ZFEB 5C4WB 1HRV2 3VL9A 3WW3A 2ZMKA 1VAVA 4IV3C 1FMD3 1QU0A 4M0NA 4XFHA 2XJVA 4WVMA 4OI1A 3QH7A 4NR1A 2XVGA 3MFCA 1AR61 1TEIA 2YGMA 4GALA 4N90A 5FPXA 1YWKA 5J7MA 1Y43B 4A3XA 2RS33 3B00A 1WD4A 3L2YA 3Q9OA 1VBC1 1CPNA 5CBLA 1YO8A 1VRH3 2WNVB 4M3CF 1UU4A 4AEDC 4MXWA 4FP2A 4NHLA 2ZGLA 3USUA 2JD4A 1V6OA 3QLQA 2ATFA 3GBGA 1ULFA 4A2UA 4N53B 2VW1A 1LJ7A 2EXHA 2RS32 4PDWA 3B02A 1PGW1 2IFWA 3ZXDA 1ND3B 1QWRA 2W08A 2JENA 4FBFA 1F5FA 1R081 4J1WA 4Q4W3 4UBGA 3APBA 1XYNA 2PTMA 4YFWA 3RWNA 5DZGA 3WP4A 3NWKA 4XETA 1VBE2 4K40A 3AMMA 1AR92 4K3UA 4BH9A 4QU2A 1W0OA 3W59A 3V0BB 1B35A 2A6VA 3WQ7A 3AP4A 2VULA 1OA4A 3I59B 2GMPA 2BYVE 2WS93 3NAPB 5A33B 4R9BA 2H6BA 5H9PA 1AF9A 3AMQA 4KGQA 5FOJB 3WDTA 1COV3 5K8SA 2N7GA 1UIKA 1OA3A 3TWIA 3K51A 2CY6A 4S2HA 4AI0A 5GLUA 4ES9A 1OPOA 3VBOC 5CFCA 3GHMA 5C6CA 4D3WA 1URXA 2MNGA 3D82A 4QHBA 3ZFFB 1S0DA 3AP6A 3H1MA 1ASJ3 3VKMA 4GWNA 5K0UB 1U5YA 2CAVA 5BXXA 5AFBA 2Q0AA 4KU8A 1ULCA 5E16A 4GH4B 2HWC3 1WW5A 4YM2A 3VBUB 4LUMA 3PVEA 3O0WA 2VW2A 1AR91 3PJYA 1CQ9A 1XXNA 1CAXA 4GB31 4C91A 1VB2A 2ZKLA 4CDUA 3JQXA 1PIV1 5DZEA 1MEC1 1W6PB 3EQEA 3ZIWA 2XJUA 3VBUC 1XYOA 2VU9A 3JQWA 4FXKB 3ZFGC 2P2KA 1BEV3 1HQLA 1XNDA 1RTVA 5L36A 2NN8A 2RR11 2PHRA 3RZZA 1AYM3 2VH9A 5DG1A 4AFCA 2WFF3 1HRI3 2ZPXA 1ZZBA 2EXJA 1J1TA 4CTEA 2R061 5D1IA 1B09A 1NLSA 1DGWA 2NYYA 4HVOA 4HK9A 4YRDA 2RJKA 2YZ4A 4LTAA 1BVVA 1RB8G 2ZGPA 3VBRC 4OI0A 1VALA 2JE7A 3JBG1 5FLJA 1RUF3 2MPFA 4RQPC 3KQRA 4BMEA 2CGOA 1H4GA 1V6JA 2YGLA 3OBRA 4HN0A 3D4KA 4YM1A 4XQWA 4OHZA 2WNEA 5IK4A 4C1WA 5JIUA 4WBBA 4SLIA 1MR5A 1MEC2 4Q4V3 3MW3A 1SLIA 2E9QA 4KGGA 4W65A 4FTSA 1NA1A 3KS7A 3PJQA 3TN91 5T54A 5IK8A 3ST7A 1RUD2 2FBEA 2E53A 3J8F1 3J8F3 3I7DA 1RUC3 3O0VA 2BFUS 2R1BA 1EYBA 1MZ6A 4NN0A 1HV1A 1R1ZA 4Q2FA 2DVAA 2HYKA 2WIIB 4FQ4A 4MSVA 3H8UA 1SBFA 1LOCA 4UW4A 4K21A 4KWJA 1BBT1 2AUYA 1COV1 3I59A 1QQP1 1APNA 5FO8B 2RS52 3AKPA 5A3LA 1AX2A 2CV6A 1VBE3 1CVNA 3IDCB 3SH5A 4AGRA 1AYM1 5GLVA 2GN3A 1RUJ2 4BWOA 3GYDA 5FO9B 2EAKA 3WCRA 4B7EA 3V56A 1W6NA 4RS5B 1Q8OA 4BE3A 2XLAA 1HXS3 2D5FA 4CP2A 4FT8A 1YNAA 4ITCA 3SH4A 3AKTA 2YY1A 1XNKA 3RI9A 1K5MC 1RUD1 4RR3A 2UY9A 2CNAA 1FYUA 3NV1A 4DY5A 2ZA9A 1LTEA 2Z5WA 4HBNA 2WJSA 1V6LA 2GNMA 3MIHA 3THPA 1R092 3PTYA 4WVZA 2ZHMA 3R4SA 3TNPB 4PF5A 1M06G 4HLTA 1QJY2 2YXSA 4K6BA 3FUOA 1QQP2 1RUG3 2AZ5A 2NMOA 2X5IC 3H9AA 2CAUA 1DYPA 1V9U1 3AP7A 2VVEA 1LHVA 3D5OA 3FWEA 3KT4A 3AKRA 4HZFA 1AYM2 4IQPA 1O3SA 5CIRA 1XU2A 2VOVA 4AEDA 1OOPA 3AFGA 4PIYA 4X6QB 1GNZA 3H3UA 2VG9A 3EHKA 2KM2A 4OHXA 4QPGC 1JN2P 5J48A 3B93A 2QZ2A 1LODA 1EAH2 2D44A 3VBFC 3OY8A 2B8MA 1DQ0A 4FO9A 4DZGA 5KXCA 2PHXA 4FQZA 3DUIA 1J3PA 3WP5A 1MS3A 4EN6B 1UU5A 5BNNC 1WW7A 3ILRA 2WA3A 2R042 4Q0PA 1OMIA 1LESA 1I1EA 1YRZA 1FNYA 5EYYA 3T2TA 2IXKA 2GC1A 3ZX7A 3FFZA 2A3WA 1ZREA 1I9RA 1H2MA 3N7JA 5J98B 3NVCA 2I74A 1H2KA 1YYNA 1FOD2 2GH8A 4KG8A 1XNCA 3R0RA 3KT1A 3V64A 4RS5C 1IKQA 3D0SA 3VBSC 4JCKA 3BB6A 4Z07A 1PVXA 1RVF2 2PLV1 4AI2A 4AQTA 1S1AA 4JDOA 1QOOA 3MYXA 1V6IA 4Z8BA 1CAWB 3CL1A 4Y22B 1JXNA 4BYYA 2JG8A 2VOXA 1DGWX 3ACLA 2JXAA 2CYFA 1RUJ3 4YGCA 3SXWA 3ZSMA 4MUVA 2YYOA 4H55A 1Y9QA 2UWAA 3M4FA 4AQ2A 1AUYA 1X82A 3QOPA 2CGPA 2A6ZA 1SLAA 4BIOA 2ZX3A 4PIXA 5I93A 4O9GA 1NCRA 2D6KA 3AZXA 3FE5A 2MEV2 1BQPA 1Q8VA 3RSJA 2WNUB 1C1LA 4QQHA 1G8WA 3VZMA 5BV6A 2GAUA 1AR73 2XL7A 2DUPA 3HMYA 5FCCA 1FOD1 1RUF1 1CJDA 2OZJA 2XJTA 1W0PA 2XKPA 1QJX3 3M2MA 3G7DA 2EXKA 4U36A 4LBKA 4NWWA 3ZYGA 1RUNA 4INDA 1NY71 3P3NA 1ND3A 4Q29A 4BCUA 1PO11 4IEWA 5JDBA 3I4IA 1A8MA 4CDXA 3OJBA 3POWA 1HIXA 1LULA 3ILFA 4GH4C 5FLIA 5FLHA 4YW4A 1O3TA 2Q5TA 3VV1A 1W6NB 2E51A 4YYOA 4K20A 3DN7A 2VUAA 4IEUA 3TYJA 4CP1A 5HCAA 4IEOA 3GBFA 1S0JA 4MVTA 1GZ9A 2GC3A 4IEYA 4KBBA 4L11A 4QD2A 1YCIA 4HVRA 4KWKA 3AXEA 4WM8C 4BOWA 4D94A 5C4WA 1BEV1 3WLUA 4CDQB 2VOWA 3IPVB 4JRAA 2HWB2 1RIRA 2OA2A 4I0WB 4XF4A 3DGTA 1AL23 3KSCA 2PHLA 5ACA2 5BNPC 3NSTA 2JG9A 4XHBA 2ZGNA 1ENQA 5CFDC 2WKKA 5ABJA 1ZM1A 4K8FA 2XUMA 3ZSKA 5JSRA 1OOPB 2ZKNA 4PLNA 3ZSLA 3O0XA 1O4ZA 3ZXEA 5FQ0A 2D3RA 2UWBA 4JGYA 1V6KA 1GYKA 1BMV2 1ASJ2 2W68A 4MGKE 3ZXLA 4LLFA 5CFDB 4XF0A 1XYPA 4FPYA 3BPZA 1LRHA 3HT2A 1Q8SA 2P37A 3SNMA 4AEJA 1BEV2 2GC2A 4FPFA 1MS5A 1EPZA 1H30A 3ZSJA 4LUKA 1H1AA 2BVBA 2D6LX 2R0HA 3N35A 4MGYE 4XFGA 1YJKA 2HJIA 1KD7A 2ILMA 1H0BA 3RI8A 1D4VB 2EALA 3KCXA 4XXAA 5ACA1 2GC0A 5L19A 4AQSA 4NOTA 4JVAA 5GALA 3TNQA 5F1RA 4Q0UA 3DPRA 5T50A 2R1DA 5KWRA 1HQNA 2AGSA 5CG9A 3E6DA 4FP3A 4LBQD 1NCRB 2VQAA 1U5ZA 1R083 5JZGA 5BNOC 2YMZA 4IXLA 5FO7B 3CJIA 2C0ZA 1EV12 3LA3A 3LKJA 4RSUA 1HW5A 4TWTA 4HSJA 1PO13 3HR9A 2ET7A 4GQ7A 4AVCA 4LO8A 3WDUA 1H8TB 1PGW2 5CG8A 3PHMA 3UL2A 4E2QA 4FTEA 5C8CB 1QJZA 5L7OC 4WVMB 4F83A 2OW4A 1IOAA 3EO6A 1DFQA 4GWMA 4PBPA 2ZHNA 2D6PA 3WDVA 3ZFGA 1VBE1 4D69A 2XVKA 3DPRB 1OI6A 4XBQA 4ZXKA 4LT5A 2CL2A 3LWCA 3AKQA 4NO4A 3M7AA 2O8OA 4MGZE 1DZTA 2W39A 2ZBJA 1U12A 2I2SA 1G9FA 4IV3B 3ZIXA 1LHNA 4DINB 3NJZA 3ZMOA 2ZGKA 1H4HA 1MVEA 1YFWA 1CN1A 3LGRA 5ACA3 3NO8A 2DTYA 5CADA 4K9SA 1QOSA 1KFUL 4YW2A 4OHVA 1ENSA 4COVA 2XLFA 4QM8A 1RITA 3ZYRA 5KHKA 2A6XA 4SBVA 2VY0A 2VNGA 3CO2A 3FX3A 3VBHA 1AR71 1WLWA 2R073 4HSLA 1MVQA 4Q1RA 5GJ6A 2EVXA 2RHPA 1WD3A 3M1HA 4Y22A 3DV8A 4ES8A 1HDKA 5BNOA 1T6GC 1F31A 1UKGA 1GANA 1AR83 2Q30A 3LA2A 1DQ6A 3N7MA 5I8TA 2HWF3 3CEWA 3AZYA 2BNNA 5I0SA 2V09A 3FLTA 1NE4A 4XIOA 1VP6A 2JJ6A 2WA4A 2ZAAA 5C33A 2JG9B 1IQAA 2I45A 4P9GA 4XFIA 1RHI3 4L2NA 2HWE1 2QVSB 5I8YA 3HQXA 3AP9A 1L3JA 1CR7A 4WZCA 4BZ4A 1ZZ6A 4XBNA 1CAVA 2VQ0A 4CDQA 1PK6C 4OUSA 1VBC3 2ZZQA 4Y1ZA 3B01A 1WW6A 1HRV3 3RNSA 3WP6A 4GH4A 1J58A 3ZYPA 3IPVA 2PHUA 2IC1A 1N1YA 3QD6A 2ARBA 3R05A 4AFMA 4C1XA 2KXLA 1H8VA 2DU1A 5BPXA 5JCTA 1KDMA 4Q4V2 2WSVA 3VDDC 3VL8A 4AVTA 1QH6A 4RL7A 3VBOB 4F7ZA 3WV6A 3N3HA 1V6MA 4FPOB 1KS4A 5JI9A 2DVGA 2GNTA 5KC6A 4P9JA 4A7KA 2D3PA 1W6OA 1O3RA 2DF7A 1POV3 1D0GA 2D5HA 2R30A 4RGAA 3S7IA 4XBLA 1GBGA 1X50A 4GKXA 2XH6A 1CGPA 2D6MA 4HK8A 3OYWB 2XLGA 4YVSB 5C9AC 2H0VA 3V0BA 1VAKA 4RHV2 2BBVA 4GKYA 4NVPA 2D3SA 3MW4A 2E7TA 3VBFA 3FC0A 1FPN3 1PO21 2VMIA 1C8M1 3ZXAC 4TYSA 5CB7A 1AHSA 4YZ5A 4PDWC 1S0EA 5C8WA 2JX9A 2IXJA 3IDBB 4EN9B 2DUQA 2TEPA 2O0OA 3V0AA 2D7FA 1SLTA 4I02A 1MS9A 1KITA 1FATA 2Q4SA 1VRH1 2D43A 5F6KA 4N43C 1PZ7A 1JYIA 2E7QA 4AXOA 2G9FA 5BUVA 3LSEA 3FZ3A 1AR93 2D40A 1R091 2ZMNA 3GZUC 1PZ9A 2MEV3 1DQ5A 2HWE3 4WVVA 4YZ3A 4AVVA 2FZ2A 2D6NA 4DRVA 1AYN1 1SLBA 1QJY1 4Y1UA 5KXDA 1AL0G 4N43B 3AYDA 2D98A 1EAH3 3AMPA 2XGXA 4XJZA 3ZN4A 1QQP3 1POV1 2VMGA 1J3QA 2WNUC 1KXGA 1SCRA 3U07A 5GZFA 3LZZA 1VB4A 2HKXA 2FMYA 4MXWB 3S30A 4AVSA 1AR62 1UZYA 5JVVA 3E97A 3WDYA 4Z1VA 2WS92 4PBOA 1JHNA 2BEOA 2XBO3 4OHYA 2DFBA 1LKNA 5FTTC 4HKWA 4JGZB 2ZX2A 4YVWB 1N1VA 1ZBE3 1VBD3 3NAPC 4QPGA 4FPLA 4V1PA 4XYXA 1CAUA 5DUWA 4YVSC 3ZDSA 3QCWA 5BNPB 3OD4A 1PM7A 4AEMA 1LHUA 1REDA 1ULGA 5T5PA 3WG3A 3U10A 2XWJB 1G86A 2XBO2 3THTA 2R49A 1IS6A 5EV7A 4FXGB 3PNAA 4YM0A 2W52A 1AJKA 2QDRA 3JD71 3P3PA 4TLFA 3ZYJB 1RMU3 1QOTA 1X8MA 4I01A 4AVBA 1MQTB 3E5QA 4R52A 4B4RA 3TRSB 1FX5A 1RUC1 3O12A 4A7ZA 1NOVA 2PLV2 3E5UA 1PIV3 1RUH1 1Z7S1 1NXMA 5C4WC 4QGMA 4YW3A 4E2GA 5K7PA 1KJLA 4MZUA 3AMHA 3RYRA 3RJ2X 1UU6A 4GMP0 1W6QA 2JG8C 4K7JA 4LBMA 4GMP1 5FOBB 2JG9C 3SISA 1UMZA 3MPPG 3QACA 2OIIA 4NWVA 1ZRCA 4AHXA 1ZA4A 2DUOA 2SLIA 4H3WA 1ULEA 5E8AA 1RUC2 5FMOS 3POYA 4ZKTB 2QKDA 4Q4X3 3M3EA 5JOXA 1NY72 3AB0A 1LR5A 3LOBA 3LCPA 4ATEA 3N4MA 2D93A 4N53C 1NA1B 1RUH2 3VLBB 5I0TA 3CNAA 5JIAA 1Y3TA 1OPMA 2UYBA 1JBCA 4Q4W2 3RJRA 3MIFA 3ZFGB 2A7AA 3E6BA 3LB9A 4KL1A 1UX6A 3J4UH 2LUWA 2RMU1 1EY2A 1VBA3 1DF0A 1XE8A 3OGJA 3GNEA 1R093 4L9BA 1DIWA 3SMHA 4CDXC 4Q4X2 4H7LA 4IL7A 4Y20A 1O5LA 3VZKA 5IT6A 2YUEA 2RM21 3VKOA 3HBZA 1DGLA 4D7TA 3WP3A 2ZX0A 2WT0A 2ZMLA 3WQ0A 2P34A 1B35B 3VBOA 1LOBA 5CFCC 3RYKA 4Q8KA 1F8VA 2B5HA 1S0CA 1GZCA 1ENRA 3H0OA 4OI4A 5DDJ2 4I0BA 5DUUA 5T52A 4AE2A 5JZGB 2JE9A 3WR0A 3VBFB 4C90A 4YG3A 1R1A3 3W9AA 1AL21 1Q3EA 4L99A 5DG2A 3BALA 4JTOA 1CAXB 4LLOA 1CESA 4S2GA 4UW3A 5HI0A 4FPGA 4QX5A 1XRUA 1ZVFA 1GFF2 2PAMA 3D6EA 1ZBE2 3NKGA 4AW7A 4EN0A 1VBB2 2WINB 2B42B 4XPVA 2K9ZA 3KM5A 3ME2A 1HX6A 4LE3A 4PLMA 5T5JA 2RMU2 4B29A 3B94A 3FBMA 1LGCA 5ABJC 4Y24A 4AGVA 4Q4X1 2G9GA 4JQRA 2IWGB 4MLOA 1AZDA 3JB4C 1HKDA 4BMBA 5BYNA 1H2LA 2FHRA 4IEZA 2HWC2 2B9UA 2RS12 1O5UA 4P9YA 4LR4A 4EWEA 5T55A 1I6XA 2FZ1A 5BNNA 4ATFA 2NZ9A 1UZZA 1YUDA 4N43A 1AXYA 1ONAA 4W6YA 1IS4A 5GLTA 5J96B 1ZRFA 2ZGSA 2AYHA 3MIBA 2BUKA 1KFXL 5ABJB 1NQJA 4YLZA 3ES1A 3KZ4C 1PIV2 4XQ4A 1QXRA 4JV4A 5A3MA 1OKQA 1LCLA 3IIAA 4XMAA 4LBJA 1D0HA 4TSVA 2RS13 5GZEA 1ZBE1 1QHDA 3ZFFA 1S55A 1Z7S3 4XFBA 1YI9A 3QBQA 5D8AC 2RR12 2UYAA 1X7NA 4Q0VA 4YSFA 1WLDA 1SFNA 5KHGA 3ZMNA 1EV11 2WNUA 3VZJA 2GH2A 3WZ1A 3H3ZA 1UKRA 1WA4A 3ALQA 4FVVA 1HQWA 3N7LA 2R0FA 4EROA 3MIGA 4ORFA 1X36A 2A73B 1RVF3 2Q1MA 4FPKA 1ZZ7A 1KS5A 2ZHKA 1QMJA 2ZGMA 4LBLA 3NL1A 3OY8B 3R6SA 1GV9A 2QUOA 4AI1A 1V9U2 4CEYA 2A70A 2WLQA 4OI2A 2CTVA 2ZZJA 4JRLA 4DXZA 1CJPA 1D2SA 2PYTA 1J3RA 3GZAA 4YVSA 4LBQA 3VZLA 4B3NA 3E6CC 4I0AA 4JGYC 1F2NA 3ELNA 4ISQA 1SEFA 2ZGTA 3AP5A 2P3JA 5K9YA 4J1XA 4HMZA 2R072 3ROUA 4EN8B 4XIKA 1HLCA 3J8F2 2XB6C 2FQPA 5JOWA 4K1ZA 3BIWE 1MS1A 3MW2A 2QFEA 4Y5Z0 1G6NA 2YC0A 2ENRA 3K48A 4YZ2A 2R041 1NCQB 1COV2 1BJQA 1AVBA 4Q4Y2 2JKBA 3FBYA 4AG4A 4JTNA 4YNIA 3I8TA 4D7SA 1DZQA 2D6OX 3MLLA 4Y26A 2EF6A 3B7MA 1ZRDA 2JG8B 4AHZA 1H9PA 4Q0SA 3VN4A 1VAMA 3WHTA 4XF3A 4UW6A 3AZWA 1WCSA 4M3CA 3ZN6A 4GULA 4AFBA 2ZABA 1G9CA 4QPIB 1ALYA 4CEWB 5SV8A 2X5IB 5FAXA 1N3OA 3SLIA 2HWE2 3KGZA 4DQAA 1BK1A 3WQ1A 1YIFA 4KU7A 2DVDA 4FPHA 3MZHA 5J3UA 4RQPB 3PLQA 5FQ0B 5GLWA 5EZWA 1A78A 2RR13 3MFAA 3JCIA 2VW0A 1ZX5A 3H7JA 1RUOA 1RUE1 4BQ1A 3WW4A 4FOQA 4FPCA 4J6GA 4KQ7A 1LB2A 4B4PA 4EJRA 4GB33 1FI2A 4G3YC 1SMVA 4M0HA 4E4ZA 3S7EA 1QNWA 1C28A 1TME3 3IDEA 4XHXA 1K5MB 4M3CB 4P9IA 2BTVC 4YGDA 2H6CA 1V70A 2A75A 4RS5A 1WMFA 2OPKA 4ZU7A 1SLLA 3R4DB 3AZVA 2XHKA 2LM3A 3B5LB 1CD3G 2R32A 4HVQA 3WOGA 1ULDA 2ZTNA 1WBLA 5EYXA 4Z2WA 4DS0A 4L92A 1HRI1 4LO4B 5JZGC 3HIFA 3LA7A 1DYKA 1GKBA 5FPZA 2ZGQA 3T1MA 3DKWA 4DPNA 2ZS6B 5T5OA 1W6MA 4X8PA 4AF9A 2UWCA 3KCCA 1YFXA 1J59A 3RMXA 4YVWA 2ZAHA 3WG1A 2ZHLA 1NE6A 4P9XA 1YFYA 5JLVA 1REEA 4P5HA 5K0UA 3MIDA 2F6BA 2C1FA 2TUNA 2DCZA 4WVWA 5AC92 3H7YA 2P3IA 1A8DA 4XMIA 2CGNA 3RMYA 3VHRA 4IEXA 1VRH2 3ZVXA 5KXBA 1W2UA 1TMF1 1SLCA 1NCQC 3AXDA 1AR81 1BVP1 4AGGA 1RJ8A 1BKZA 2H0BA 3RYPA 2ZX4A 4QQPA 2E63A 1C5IA 3BOWA 4DNYA 4XFCA 2BVVA 4FCAA 4JGZC 4PJYA 4Q26A 4DRRA 5FRAA 1LU1A 1XU1A 1RL3A 4S2DA 2F4PA 1SBDA 1XE7A 2WT2A 3VGIA 4COYA 4WM8A 4COZA 5I0RA 1VJ2A 1WLTA 5HXVA 2BPA2 4JC1A 1N3PA 2GZWA 4HN1A 3J26N 4OULA 5EWSA 2DVBA 1Q8PA 2JEMA 4BIFA 1O4YA 1WBFA 4I30A 3S6PA 2WNVC 5JOZA 1TMF2 4AFDA 3J9SA 2DCJA 3M70A 1TNRA 2A71A 3PMEA 4XTPA 2TBVA 3NV3A 2R043 1UW8A 1BCXA 5GLZA 1C5HA 1GLHA 4TZDA 4CYDA 1SFYA 4KWLA 1JUHA 3POSA 1Z0HA 3AKSA 1LU2A 4OZXA 4XJ8A 4CEWC 2NP0A 1GSLA 2IXLA 2XPJA 1FOD3 1ZRRA 2Q8OA 5D8AB 4AQ6A 1TMF3 3MDPA 4R4XA 5I91A 4MX3A 2PA7A 1PK6A 4CZSA 1H2NA 2RMU3 5BNQA 1MACA 2DFCA 3PVBB 5EXOA 3KD4A 2BGCA 5J09A 4AVAA 3AYEA 4N9IA 1VBC2 3JD73 3MF9A 2HEWF 4AHWA 2Z79A 1MZEA 3C2UA 1N47A 3MIEA 1QXJA 2ETEA 3HN1A 4N7IA 2YV8A 3U11A 1PNGA 5GZCA 2AR6A 3CJXA 1LHWA 2RS31 4AHYA 5GZGA 3A4UA 4YGBA 1WGPA 1FV2A 1NXD1 1AR72 4WM7B 4GMP3 1R082 1JH5A 4MGIE 2YHJA 4CDWA 2C9AA 1LECA 4Y20B 4ZU5A 5KHIA 5J36A 1OQ1A 4JDMA 3D8CA 1AXZA 3MICA 3NAPA 5A33A 2E6VA 3UK9A 1OQDA 5KHHA 1CAWA 1FV3A 1H8TA 4A7YA 3FLRA 4IEVA 3WHUA 5DXDA 4CEWA 1RUH3 3SCFA 4XFAA 1IHMA 4QQ2A 4Q4W1 3JZVA 4WM7C 3WCSA 1OHFA 1LGNA 5C8CC 5IK7A 2DURA 1D4M1 3ILNA 4N53A 1GQGA 2OUJA 4LO6B 2K0GA 4YW5A 4IERA 4U2AA 3ZSEA 1SACA 2WFF1 3A0KA 3WD5A 3WW2A 1W6MB 3ZFEC 1HRV1 4BHPA 4MYEA 1IGOA 4HL0A 1QJU3 5E89A 1K5MA 1QJU1 2X8KA 1PGSA 4QT6A 2E7AA 3AYAA 3JBG3 5C9AB 2LTNA 4B7KA 2JDZA 4RGGA 2UY8A 4N9HA 4E2SA 2AH2A 1AR63 4XE9A 2ZGOA 1OLQA 2A3XA 1BBT3 1AL22 1ZYBA 2OYZA 4I3GA 3OGGA 1DDLA 2HEVF 1QDOA 2PFWA 5KC5A 3IKWA 1S0GA 1VBB1 5IK5A 4BLIA 4ASLA 1MQTA 1F5JA 2FMDA 2ZACA 1BXHA 1GNHA 4UW5A 2AENA 3LSDA 1LHOA 3VHOA 3HAGA 3ETQA 1DQ2A 1C8NA 4FAGA 1IKPA 4N7UA 3WX5A 2WFF2 4Q4Y3 1RUG2 4L8QA 2VXRA 2R062 4CDUC 1OFNA 1WW4A 4COWA 1QJY3 1RUI3 2BNMA 1RUI1 2ES3A 1DU3D 4YFZA 3KB5A 3VDDB 4M3CE 3O7OA 2YDEA 4O9EA 5FBZA 4ASMB 4BA6A 1WMDA 1UL9A 5HCBA 3BCWA 3QH6A 2VMHA 3ES4A 4QMAA 4YW1A 5F9TA 1Q43A 1OA2A 2TNFA 1G9BA 1REFA 1H1IA 5E88A 4QPIA 3IBMA 2VPVA 2XG3A 2BWAA 1DZRA 4MXVA 1QNYA 4YM3A 3PVOA 2ZX1A 3DL3A 4IV3A 4JGYB 1MZFA 4AFAA 1AYN3 4Q8LA 4K1YA 1IS3A 1WCKA 2I07B 3UKNA 1E57A 1RJ7A 2GU9A 2OUHA 1EV13 2P17A 3WG2A 4E4DX 3B3QE 2Y38A 4C0BA 2WZR3 2WZPP 5E1RA 4GB32 4EWAA 3UV9A 2KA3A 2GMMA 3ASIA 3ZO0B 3UKVA 3ZN6B 1UPSA 2JICA 2SBAA 5H9RA 1WMEA