2YBSA

Jmjd2a complexed with s-2-hydroxyglutarate and histone h3k36me3 peptide (30-41)
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
348
structure length
348
Chain Sequence
LNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LYSINE-SPECIFIC DEMETHYLASE 4A
publication title The oncometabolite 2-hydroxyglutarate inhibits histone lysine demethylases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/peptide
total genus 103
structure length 348
sequence length 348
chains with identical sequence B
ec nomenclature ec 1.14.11.-:
pdb deposition date 2011-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 2ybsA01
5FY4A 4AAPA 5FWJA 3DXUA 5KR7A 5A7WA 5F32A 5F3CA 5LWBA 3KV6A 4LIUA 5ISLA 3ZPOA 4DO0A 5FYIA 4GJYA 5FZ4A 2WWJA 4UF0B 2XUEA 5FYSA 5FZ8A 5FP8A 5F5AA 4QX8A 2PXJA 5A3PA 2YBSA 5FZFA 5IWFA 4QU1A 4CCOA 3DXTA 4QXHA 3ZLIA 5FYHA 5FYUA 5F37A 5FZ1A 4GD4A 4IGPA 5F3GA 5FV3A 4QXBA 5A3WA 3U78A 4CCNA 3PTRB 4LXLA 5F5CA 4QX7A 2YU1A 4GJZA 3U4SA 4LITA 3PUAA 5FBJA 5FYTA 5F5IA 5FZ3A 5E6HA 4EZ4A 2OT7A 5FXWA 4EZHA 4IGOA 5FY9A 5FPAA 5FPUA 5FZ6A 5FZOA 5F2SA 5FXXA 5FZHA 5IVBA 4HONA 2Q8EA 2YBKA 5FZEA 5FXZA 5FYBA 3AVRA 4V2VA 5LW9A 5A7SA 5IVJA 5FWEA 5FP9A 5FUNA 4D6QA 4CCKA 3PDQA 4UF0A 4ASKA 5FYMA 5A80A 2OQ7A 3AVSA 3N9NA 5FZ0A 5A7WB 3PU3A 4XDPA 5FPVA 5F3EA 5LY1A 5FYZA 3K3NA 2VD7A 5LY2A 4HOOA 5FZAA 4CCJA 5FPLA 3N9QA 2YPDA 5FYCA 5FZLA 4CUGA 5A1FA 5FY8A 5IVCA 5IVFA 4Y3OA 4D6SA 4EYUA 4Y4RA 5A7OA 2OQ6A 4CCMA 2OS2A 2YU2A 3N9OA 4IGQA 3OPTA 5FY1A 5FP7A 2W2IA 5F39A 5FY0A 2Q8DA 4V2WA 4TN7A 4BISA 2YBPA 2XDVA 5K4LA 4QXCA 5A7NA 5A7QA 5IW0A 5FZIA 5A3TA 5FZ9A 5FY5A 5FZOB 5FPBA 5FZ7A 4DIQA 5FUPA 5IVEA 1VRBA 5FYVA 3KV5A 2XMLA 5FXVA 5A3NA 5FZMA 5F3IA 5CEHA 3AL6A 3K2OA 5A7PA 3N9LA 5FZCA 3OPWA 4URAA 3K3OA 3KV9A 4LIVA 3NJYA 3N9PA 5F2WA 4NUBA 5FP4A 2OX0A 3KVAA 2Q8CA 4C8DA 3UYJA 3N9MA 4E4HA 3RVHA 5IVYA 5FYYA 5FZKA 2GP3A 5IVVA 4QWNA 3AL5A 5FY7A 2WWUA 5FZBA 4CSWA 3PUSA 2P5BA 4XDOA 5FP3A 3KVBA 3PURA 5A1LA 2GP5A 4AI9A 5FJHA 5ANQA 4Y33A 5FZDA 5FZGA 3PU8A 3LD8A 4BXFA 3PUQA 5FJKA 4BU2A 3LDBA 3KV4A 4CCLA 4D6RA 4GAZA 2XXZA
chains in the Genus database with same CATH superfamily
2RS31 4BLJA 5CFDB 2GN7A 2YFZA 2O14A 2TBVA 4QHOA 3AMNA 2QFEA 2ILMA 4LIUA 3B93A 2XLGA 1LULA 3ZN6B 1C1FA 2HBTA 5FZ8A 1O7FA 1IZ3A 4NJ4A 3ROUA 4LKEA 5CYYA 1BEV2 1LHNA 3FLPA 2PQSA 2GN3A 1OVPA 1TME1 3ES4A 4XFCA 4D69A 3AKTA 3AJYA 4QX2A 5D1IA 1XNDA 2ZGLA 4AQ2A 4QMAA 4RL7A 4YW3A 5FOJB 3OTFA 1RVF3 4NPMA 1S0BA 3JQWA 5JVVA 3VBOC 4CCNA 5H9SA 2Y8KA 3IN9A 2HBUA 2BDRA 4AI8A 2W94A 2MHFA 1YJKA 2NQYA 4KWJA 3AP5A 1XRUA 2GSYA 2Q8EA 3RDIA 4AVSA 4D8MA 1OA3A 4BPZA 4QGLA 3U07A 1C4RA 4MYEA 3WQBA 3KB5A 5KBFA 4O9GA 1H9PA 1BCXA 4F7ZA 2WSVA 4QKDA 3VBHC 4XF9A 2YGMA 3H42B 4Q4Y3 4XHXA 3WF1A 4XDPA 1X36A 2Y33A 1A78A 1CN1A 1LU2A 2JB8A 2FDGA 3S0MA 1HN0A 5JUVA 2D3RA 2JDNA 3S7IA 1O4ZA 1TG7A 4XIKA 4BQWA 1VAKA 2XL7A 1NAEA 4B4PA 1RUE3 4Y4RA 2DBIA 4MGIE 3V0BA 2RMU1 1JU3A 2YFUA 1CD3G 4PDWB 1PK6B 3Q8FA 4UW5A 3ZN4A 1ACCA 4LBLA 3FHAA 1UU5A 1CPMA 1HB4A 1RMU1 1HQLA 2RS12 4LKSA 2Z4FA 1ULEA 1GP6A 4M3CB 1POV3 4XC9A 1MQTB 2BW8A 2X5IB 4J1WA 4NHLA 4DMIA 2RJKA 3J7MA 4N43C 5GLWA 2NMOA 2VMHA 2WA3A 4HSJA 4N53B 5EWSA 3JD72 1CZVA 4BMBA 3BCWA 4HT1T 4EN0A 1W03A 4ISQA 5C8CB 4MGKE 1XNTA 1AYM1 5IT6A 2PHTA 3NNGA 4JGZA 2F4PA 3WF0A 2A71A 3K48A 2WYSA 1DGRN 2GDFA 2DVBA 4HK8A 5KHHA 3A0NA 3U75A 2BBVA 1JI6A 2R061 4QX1A 2PLV1 4BK5A 1G86A 5C33A 3VLBB 4QAWA 3CHXA 2ZEYA 3O14A 4FP3A 1HRV1 3RZKA 1WGPA 4A3ZA 1XU2A 2CU5A 5IVVA 3ZYBA 1QJU3 2WWUA 1OFSA 2WS91 1N3PA 3NL1A 3VBRB 3KVBA 1RUH3 4ONUA 2A6YA 2CTVA 2UWCA 2BQPA 4WV8A 2E7TA 4NIIA 4A44A 4I3PA 2UY8A 3RZLA 3M3EA 5FZGA 2ZA9A 2CSGA 4DUWA 5FJKA 2X53S 1H6YA 2G4IA 3TYJA 3WR0A 2ES3A 1AR81 5DAWA 1WLCA 1ZREA 1Q8SA 2QNKA 3MW4A 5LRSA 1EYBA 4IL7A 2C26A 2Y6KA 4XF3A 3MICA 3V65A 2JKXA 1O3TA 1TVGA 1G7YA 1DHKB 1NZCA 2OZJA 2WQZC 4YM3A 3S30A 2WFPA 5DDJ2 2GNBA 2PAMA 5A3UA 1A8MA 1DQ1A 1MS1A 2IFWA 1UY2A 3USUA 3W21A 4WM8A 1UU4A 2QE3A 4GD4A 2VVFA 1C1LA 2A3YA 2A7AA 3Q8CA 1G9CA 1XOYA 2RJ2A 3WUCA 3WW2A 2YU1A 4BQ2A 2ARBA 3DYOA 3O5SA 4JTOA 3K75B 3CKHA 2ZKNA 2D6KA 3S5QA 1YI7A 3VZNA 3BIWE 1SDDB 2AGSA 3ASIA 5FZHA 4NRMA 1C3HA 2J42A 4CDXB 4W6XA 1ZBE1 1QGLA 4W8JA 3UKVA 5LW9A 3VD3A 1MS8A 4ORFA 2FBEA 5CBLA 4WBBA 4ASLA 5IATA 5FTTC 2R1DA 3THTA 4CUCA 1QDOA 2Y64A 1H9WA 4PDWC 2ZOEB 5HCFA 4B1LA 4SLIA 3ZXKA 2GMPA 5GLUA 3GZAA 3ZFEA 1Q8VA 4DZGA 3L2HA 4PI2A 4FPKA 2CNAA 1XXNA 1E5HA 4RR3B 2RDSA 3VBSA 1C57A 1KS5A 4W6WA 2PN5A 3THPA 1JZ7A 2XKOA 4N53C 2EAAA 2P3IA 3VHRA 4Q0PA 2UWAA 3NNLA 4A3XA 2Z5WA 1RGSA 2Q8DA 1DG6A 2QQIA 3MIEA 3M3QA 4PCRA 4Q4Y2 3AC0A 4Q26A 4RGGA 2E26A 1JYCA 1YHFA 4I30A 4Q4V3 5CFCC 5IW0A 1RUD3 1Z0HA 5LB6A 3TEYA 2GNMA 1Q43A 3BVCA 1XPWA 3DPRB 4P9IA 4NROA 4BQ4A 1UY0A 2RS33 1C5IA 1RUE2 4OI0A 1GZWA 2OW4A 1GQGA 4UWDA 1MEC1 1UZYA 4NWWA 1AX1A 3APBA 5F6LB 5FBZA 3E1F1 2GZWA 1LTEA 1W0PA 3NV4A 5HCAA 5AFEA 2V09A 2VBBA 2VZTA 2XHNA 3A0KA 1DLLA 3VBRC 5F8PA 5FZCA 4JRLA 3VDDB 1ND2A 1O59A 5DABA 3W5MA 4DEVA 1TME3 1PIV1 1RITA 4YGDA 4S2FA 1PMJX 1Y43B 2W46A 3N7MA 3UYJA 4I02A 1WUVA 4HANA 1WW6A 3N7JA 2VTXJ 3MUZ1 4LO8A 4C90A 3ETPA 1YQCA 2R16A 2ZGQA 4QKBA 3DCQA 3R0RA 3VHOA 1PVC1 3HAGA 2W9XA 3I97A 4P9WA 3WG3A 5CADA 1AXYA 4P5YA 1KXGA 2GP5A 2B9UA 4Y33A 4AVAA 5FR3A 1NYWA 4L11A 5EYXA 2JWPA 1W3XA 2ARCA 1RUC1 4QB1A 1ZZ8A 2WABA 1LRHA 3LDKA 2R32A 2VZ1A 4LTAA 4M3CF 4MXVA 4EYUA 1KGYA 4FFFA 4Q1RA 2P37A 2EXKA 4LORA 4Y22A 3WDYA 4JDNA 1WW7A 5BPXA 1W6MA 4J25A 4OZXA 3OOXA 1QJU2 4IE4A 2NPIA 1QU0A 1RUH2 4XJZA 5FOBB 2D93A 4R9BA 5GKAC 3QD6A 2WQ8A 4M01A 1NQDA 3RGBA 3ZKUA 3EHKA 1S0CA 2BOJA 1PM4A 3VBHA 1J3RA 5FZFA 4H55A 2AYHA 4QU1A 4JQRA 4XILA 2JXAA 5FYUA 4XMAA 2RMU3 3NV3A 3MDPA 4YZ1A 1XC6A 3HD8B 2HWB1 5JOXA 1URXA 1E5SA 5HBAA 5L9BA 1V6JA 5F5CA 2VULA 2VQ0A 1TQ5A 2O0OA 5I0TA 4EZHA 5HV0A 5CA6A 1QQP2 5FPUA 3ZSEA 5D8AC 2E6VA 4QM8A 3WNLA 2D6MA 4HG6B 1IHMA 3RPQA 1Y9GA 4XUNA 3ZXAC 1YFUA 2H0VA 1DBNA 2LM3A 4JGYB 4ZU5A 5LEJA 4I01A 2AEYA 2XWJB 4QQPA 2WT1A 1AYM3 2PA7A 3T08A 4MVTA 3POSA 3WDUA 1LB2A 5FPVA 1HQNA 3LB9A 1NUKA 3CIHA 1H8TB 1MZ5A 3SC7X 2ID4A 2JKBA 1OPOA 4N43A 2F6BA 2R063 1N1SA 4JHTA 5DUXA 2WZPP 1VP6A 3VL8A 1GKBA 4MV2A 2OYZA 1X7NA 1GLHA 1K12A 3DPRC 2YU2A 2D97A 3Q8EA 3AP7A 3CJIC 1AX0A 2WS93 5FKCA 4B7EA 4ZU7A 2VAUA 5GZGA 1US3A 4LR4A 1D4VB 4BXSV 1IOAA 2IC1A 2ZZQA 4P9XA 4XBLA 4AG4A 1VBA1 2W08A 1G9AA 2PHUA 5JLVA 3GCWA 5FZ9A 3BTAA 3LIGA 3QBQA 4QM9A 1YLLA 5J09A 1DQ6A 4Q4X1 3RMXA 2JDHA 2GU9A 3SKVA 1SG3A 4OI4A 3TN93 3OPZA 1TNFA 3ZN6A 4GALA 3OJBA 1W28A 4YZ4A 2BU9A 5CISA 4AVVA 1WCQA 2DCYA 3R4DB 1W2OA 4FPLA 5GZFA 5A3NA 1AR91 3VBFB 2B39A 3NRUA 4YZ5A 1JOPA 2D43A 3WINE 4D0QA 1APNA 4LIVA 3DN7A 4Q4V2 4QDQA 5A33B 1OHFA 4BMEA 1CAWB 1IS3A 1R091 5EJ1B 2FZ2A 3MBWA 2RS32 1RJ8A 3AMQA 4IERA 5C9AB 1L7RA 1LODA 3A7QA 2YC0A 2D6OX 2VUJA 3H3UA 3JXSA 1W8TA 3ME2A 2JX9A 3I4IA 4LBKA 4OHXA 5FY7A 4PJYA 2VH9A 2VZPA 3JCIA 1LCLA 1W8HA 1CVNA 4AEDB 1A6CA 1O5LA 1QDCA 3PIGA 5C3RA 5DUVA 4BU2A 1OLQA 3LDBA 2W39A 4CPBD 1TME2 2BGOA 1KS4A 3NJVA 4FTSA 5B4XA 2PTMA 1W6QB 2OPKA 2P34A 4P08A 5KR7A 2RDQA 5HI0A 5JMOA 4NR1A 4FXGB 3VZMA 3UESA 5KHGA 3WNPA 4QPYA 2ZJCA 2HWC1 4XFAA 1W8FA 3M3OA 3VBUB 2ORZA 1I5PA 1WBLA 5DUWA 5FP8A 3IAQA 1OD5A 1YQ2A 4EWDA 5J96B 2DFBA 2Q1ZB 3ATGA 4PDWA 3AFGA 3TOJA 1PK6A 1VALA 2DCJA 3MIHA 3BTYA 4YG0A 3T1LA 4RS5C 2E33A 2BNOA 5M0TA 2HEVF 4A7YA 3WNMA 4M3CA 4PIZA 4E2GA 3ALQA 2LUWA 4LITA 3AXDA 5L9VA 1LKNA 1RUOA 4BA6A 2PHRA 4I2OA 1J83A 1RB8G 1H8TC 2UWBA 3O0VA 2JD9A 3SISA 5IVBA 2YB7A 4N53A 3THCA 4C0BA 1UIJA 1NT0A 4HETA 4U36A 2RR11 1A3KA 5T5OA 1O8PA 5FUNA 5E16A 4HZFA 1L3JA 4HBNA 4RHV3 1MEC3 2RMU2 2ZPXA 5A80A 3RRDA 4EN7B 4YFZA 5A7WB 4XYXA 5CFCA 4XFHA 3N36A 3ZO0B 2VNOA 2QBXA 4BQYA 1YUDA 2E7QA 2VD7A 1KFUL 4HOOA 3DKQA 1PIV3 1SCSA 1TEIA 3RZJA 2BJSA 3FHIB 5FY8A 5CG8A 4JC1A 3OGSA 4JZRA 4COUA 4P5HA 1QHDA 1U5ZA 3ZDVA 3VBRA 3Q9OA 4QPGB 1PX4A 4GWNA 3OG2A 5FK8A 4CP9B 1I6XA 4AVTA 1PVC3 3I3EA 1SQ4A 4ATFA 3ITQA 3VBFC 1AL21 3S7EA 5CVRA 4XIOA 3HBKA 1RUC3 5JWPA 2JENA 2R062 5FMCA 2HWD1 3HN1A 3NSTA 4FCAA 4K1YA 4PF1A 5FZOB 4BHPA 3ILFA 2YG0A 4LOTA 2IXLA 3RWKX 1E5IA 3PUHA 3BGAA 3WT3A 2MEV3 3LF7A 2RG4A 4DRVA 1SBFA 4KH9A 3POJA 1PGW2 1JBCA 4ZU4A 1BBT1 4FI9A 5FQ0A 5TSWA 3O1RA 4D7TA 1N1VA 2WS92 4G3YC 3UGGA 2VBPA 3GBFA 4LK6A 4O61A 1S55A 2XVLA 3T0BA 4AEDC 1Q5OA 1OQ1A 3OB8A 3ECQA 4YYOA 4UYBA 3VD9A 1STMA 1GFF2 3HT1A 4PLMA 5B4NA 1DIWA 3LSEA 1SEFA 4E4SA 2ZGPA 1OOPC 5C7GA 1QOTA 2HWB3 4WM7C 3RZMA 4CEWB 1UMZA 1WA4A 5IFPA 4GQ7A 4DY5A 2WN2A 3TN92 3U1XA 2XLFA 5A70A 5D2AA 5BNOB 3BIEA 2CL2A 2B5HA 1UX6A 3VV1A 4RQPB 4MGYE 4K1ZA 1R1A1 3LSDA 2W1UA 3PUQA 1GP4A 1JN2P 3PVEA 3LPFA 1UY4A 2PAEA 3FUQA 1O5UA 2G19A 1VAVA 3IZOA 5KC6A 2V4AA 2VMGA 4LO4B 4YNIA 4JCKA 4IEOA 4BQXA 5AC91 1IS4A 4BIFA 5FYSA 2FCTA 4YZ3A 5FFOC 3ZXDA 2WLQA 3T2PA 4A41A 1ASJ1 1R64A 2R041 2R071 3WNNA 4EE2A 2BV4A 3ZLIA 5HXMA 3I2DA 1PO21 3PVBB 1OQEA 4BDVB 4UFHA 4JGZC 1FMD2 3B9IA 4QPIB 1VR3A 2G9GA 1ENRA 4QQ2A 1IS5A 4DUXA 5FBJA 5FYTA 1EY2A 1W2UA 2VZOA 4K21A 4CP0A 4R8HA 1ALYA 1VBA3 3DPRA 3T2OA 5GZEA 1OD3A 1YFXA 3CJIA 1S4CA 1VRH1 3AZVA 4RGAA 5FP9A 4PI0A 4K3UA 4Q4X3 3U11A 1FOD1 1WLWA 4A7ZA 4HPKB 1OUXA 1W99A 4QPGC 2R30A 5K0UB 1BHGA 4KMQA 2DU0A 1LGCA 1AR93 5C3OA 3AKQA 3POWA 4JAAA 5H9RA 4DINB 2G9FA 1WZXA 4WVMB 2XR4A 1J1TA 1GNHA 2EXIA 2GC3A 1C28A 4WVZA 1GOHA 3N9QA 5FPLA 3MFAA 2BTVC 5FYCA 5A1FA 4AWDA 3EO6A 1WLDA 2FQPA 5LBFA 1VBD2 2QKDA 2J1UA 1R093 1R082 3N9OA 1FV2A 1RXGA 3P3NA 4IGQA 3DECA 2XPJA 4E8DA 1W3VA 1LOAA 1S2KA 4RHV2 1MEC2 1NOVA 2Y6JA 1BK0A 1REEA 4XXAA 1J59A 1B35B 3V0AB 1AR71 4AAXA 5A7NA 2HJIA 2YDEA 5L7OC 1PMIA 5A3OA 4HVRA 3SCGA 3IIIA 3WOGA 4Q8KA 2MPFA 1W8ZA 1YNAA 1PIV2 3ABZA 1EAH1 4CUAA 3LE0A 2EIDA 4B7KA 1MS4A 3AFKA 3J7NA 4UOJA 2ZZJA 3GZEA 4AEMA 5IVEA 1VBC2 4F3JA 4R4ZA 4XFBA 4CU8A 4FAGA 3M1HA 2C1FA 3ZMNA 5A6YA 5BNOC 3IMNA 1Y7BA 1PVC2 3SH3A 3H7YA 3R4UA 4X8PA 3ZYGA 1JZ2A 3WNXA 2K9ZA 1ZZ6A 3T2TA 1D2QA 5J1XA 2RM22 5T5LA 3VD4A 3EMRA 1BMV2 2CY6A 4YVWB 2W68A 2XQXA 1K5MB 1FT9A 1QJY1 1RUC2 2VCAA 3SEPA 3ZXEA 2EF6A 3I8TA 1K3IA 5IJRA 2MEV2 5FAXA 2HWF2 3AL5A 1R1ZA 2NMNA 5APAA 1UXZA 2C5DA 3ZR6A 1ZA4A 4XDOA 4Y4YA 3G7DA 5A3LA 3VKOA 2IXCA 1ZRFA 4TYSA 2FMYA 2FCUA 4RS5A 4JGYA 2DCKA 3ZYFA 5KHJA 3D4KA 4YVSB 3H1MA 3KV4A 1SLIA 4XJ8A 4ZPIA 3JB4C 1VMFA 4OYUA 2C6SA 4MGSA 2PFWA 5FKBA 2QQWA 3TNQA 2HWB2 1H8TA 5FDBA 1CAVB 1OURA 1X82A 2LALA 3DYMA 5FYIA 5FZ4A 5I0SA 2VQUA 1KRIA 2XUEA 2Y0IA 1O4YA 4G4FA 2DUPA 2AH2A 2YPJA 1WBFA 5KHKA 2XONA 1HW5A 4A7KA 1UZVA 1JZ5A 2O1QA 1AR61 4FPYA 3UKTA 5LBEA 1GNYA 1AJKA 4ARYA 3UNPA 4L97A 4P14A 1WW4A 5K0UC 3ZFFB 4GJZA 1DU3D 2DWRA 3FN9A 5FZ3A 4PT6A 4QHBA 1DF0A 1GNZA 3LEGA 3J8F2 4BZ4A 5ABJB 1LR5A 3OD4A 4XFGA 2E31A 1ND2C 1NCQB 2BUKA 3HR9A 5DUUA 3E5XA 3BYWA 2WO7A 4LBNA 1NLSA 4MLOA 2CGNA 3O1PA 1O4TA 5FIXA 3OBRA 1JU4A 2DV9A 2WN3A 4I0AA 4YW4A 5C6CA 3VBFA 1ZBA3 3C3VA 4AQ6A 3B9CA 1BBT3 5JCTA 5T5JA 5E1RA 1AYN1 3PU3A 2VCMA 3AP6A 3WEZA 5F3EA 3O1UA 1I3HA 2XVKA 4XOGA 1O3SA 4H2AA 4NHKA 1B35C 5A33A 1GUIA 2L9LA 1CESA 2Q5TA 1AZDA 2WA4A 5A32B 2QTWB 3USSA 1CAWA 1SACA 5FZLA 5IVCA 1OLRA 2AENA 1F31A 1YFYA 4YG6A 3VL9A 4AFBA 1FAYA 3A23A 3S5AA 1UNBA 3ORJA 3WY6A 1LEMA 5IAXA 3BOWA 2BNMA 1UPIA 3LCPA 4GXLA 5T3NA 4AEDA 3IAPA 4QDRA 3WW1A 5BNQA 3VZOA 2IFRA 2ZTNA 4OUMA 2YBPA 4COVA 3O1SA 1AR92 2XDVA 1KJRA 1RC6A 1KFXL 2P1BA 3AYCA 4XZUG 2ZHNA 4X6RB 2WIIB 1OOPA 1R1A3 4WM7A 1W6QA 3NJZA 5JIUA 1HX6A 2ZCWA 2ZGTA 4A2UA 4LA3A 5A6XA 5I93A 3R4SA 5DQ0A 4ES8A 1YQ8A 4CCCA 1Z78A 1R092 1U5XA 1VRBA 1HDKA 2VMEA 3VBUA 4LNVA 2QQNA 4GB33 4GH4B 1T2XA 5FZMA 1MS0A 5AC93 2P6CA 4BWOA 4BYYA 3ZPYA 3BKZA 2QZ3A 1CIWA 3R6SA 4BE3A 3FX3A 4XEZA 1H1AA 4AE2A 2GH2A 2R043 2R073 1TMF1 3N9MA 4CYDA 1OMIA 3U0ZA 4B4RA 3RSJA 2WZ8A 2ZX1A 4NAMA 3I2JA 1YO8A 3ZFGB 2FMDA 4J6GA 1ZZCA 4DB5A 5A1LA 4OVEA 2A1XA 2YV8A 3P5BA 5I8SA 1XYNA 2QQUA 2WL1A 2YROA 3UL2A 5I0DA 1KQRA 3D3AA 1QXRA 4BXFA 5CIRA 2NN8A 1VRH3 3WHTA 3H9AA 1COV2 4RD7A 2XOMA 4V1PA 3D0JA 3DXUA 1FOD3 4LUKA 3R05A 5A7WA 1TE1B 5J37A 2BOIA 2W91A 4KWLA 4AOCA 1OBNA 1W6NA 1XSQA 3ZFFC 4AFCA 5AVAA 3HPNA 5KXCA 3AYEA 3NMBA 3B01A 4Y1YA 4UF0B 4TZDA 1SFYA 1NCQC 3PHMA 2QDRA 5CFDC 4NWVA 4QPGA 3AZYA 1YIFA 3DXTA 4CP9A 3FLTA 2R6QA 4IEQA 1VB2A 3WF2A 3THDA 3OY8B 3HT2A 4D3WA 1OKOA 2Z69A 4LULA 4QX7A 2TEPA 4A42A 2FDKA 1RUJ3 3POBA 1VE0A 2RHPA 2F17A 5E6HA 1UYXA 1O3QA 3MW3A 4IGOA 1AR73 4MG2A 5FZOA 4LO5B 4EQVA 3FL7A 5C5TA 1H4GA 4KGQA 4KWUA 4XUQA 4CCEA 1VBB2 5FWEA 2YZ4A 4LHLA 3WNOA 1EAH3 3ZKYA 2WLPA 4JKKA 1VBE1 4K8RB 4ASMB 1XU1A 3K4ZA 2ZX2A 2VJXA 5L7OA 3AVSA 4DPNA 4D7SA 1ULOA 3MLKA 1HV1A 2BWAA 3HVDA 1S0JA 1W8WA 4DUVA 2UYBA 1H6XA 2VMIA 3ZIWA 4CCJA 1DGLA 1XNAA 3KF3A 1QNWA 1LHVA 3WLUA 4BM8A 1QJY3 1CR7A 3LZZA 1UMHA 3EJKA 1N3QA 4FPFA 4CCMA 3AXEA 3ZXJA 1JYNA 4PIXA 5BNOA 2J1VA 1GZTA 2B4KA 3H3ZA 4AI0A 1ZBA2 2XUMA 2FDFA 4GH4C 1BBT2 2ARXA 4CP1A 3POFA 3PVOA 3K46A 5CU1A 3V56A 1RUG1 4CXXA 5C3QA 5C70A 2I74A 2ZHLA 3CJXA 3GF6A 4LKFA 2UU8A 1T6BX 2VU9A 1RVF2 1PK6C 1NY71 1YFWA 5A3MA 4N90A 1OH3A 2NM1A 1UYZA 4OHZA 1ZNPA 5FUPA 1SCRA 5E88A 5EV7A 4AHXA 5KXBA 1MQTC 2XMLA 1S1AA 3ZFGC 4C0HA 3UJOA 2X5IC 4KGGA 4XJ9A 5C3SA 3EBRA 3K2OA 3LA3A 3U37A 3O1MA 4CE8A 5JOYA 1IG0A 3CMGA 2EXHA 2FCVA 2TUNA 5KWRA 2JDPA 3NJYA 4YM0A 1Q8OA 3RI9A 3TEXA 5C8CC 3AZXA 1R1A2 1UCXA 2R0HA 1GOGA 1US2A 2CWSA 1AR63 4YGBA 4BIOA 3I2GA 4MO3M 1NE4A 4Q4W1 4Y1XA 2BNNA 4PBOA 4PF5A 5CKMA 5FZKA 1PGL2 1IQAA 3K51A 1G8WA 1FV3A 5FP3A 2VQAA 2VTXA 4GB32 5L19A 1V6LA 4FQZA 1ENSA 4OZOA 1W9TA 4DXSA 1DQ0A 1KITA 1G6NA 2YHJA 1ZRRA 2OA2A 3P6BA 4L9BA 4HPKA 2JG8B 5LA9A 4BJ0A 5K0UA 2R042 2XXZA 2R072 1NLQA 3AKPA 1HXS1 1AX2A 3I3DA 3K4AA 4KI5M 4AAPA 4UFMA 5AFBA 1BVP1 3WDXA 1NCRB 4QX3A 4CA9A 3UKNA 1VJ2A 3IPVB 5F3CA 5LWBA 5GLVA 4IE0A 1S0FA 4WVMA 2ZMLA 4DQAA 3HQXA 4MGTA 1TNRA 1GOFA 1NQJA 1ZYBA 4CDUB 1N3OA 1NA1B 1OLME 5DZEA 1D2SA 2IXJA 4LBQB 5F5AA 4XUTA 1LNSA 2YBSA 4ZZ8A 4Q0VA 3WG1A 4CCOA 1YQ6A 1RHI1 1VRH2 4FPGA 4IGPA 2Y6GA 4H14A 4LQRA 2Y0OA 5A1AA 4UW6A 4Z82A 1MS5A 2QQKA 1FOD2 4LHNA 4O65A 1B35A 3ZXGA 5DAQA 1PZ8A 1FATA 2Z42A 4Q5OA 4Y24A 3A4UA 4R9CA 2O8OA 1KD7A 1VB4A 2AC1A 2OT7A 2D5FA 2VMFA 5FPAA 3RYPA 3GBWA 2C9KA 3AX4A 4NPRA 4QXKA 3RMYA 2VZ3A 5A7SA 1O91A 3C7GA 3T4VA 2VUAA 1Y3TA 4Y1UA 3ZSLA 4XTPA 2VY0A 3HQRA 4YGEA 1DGRA 3POGA 4XAAA 1J58A 2I45A 3C7HA 2RS51 2P3JA 4AYUA 1GU3A 3PDQA 2GNTA 5CAZA 1DGWA 1W90A 3ZDSA 2Q1MA 2OQ7A 4AEKA 4S2DA 3BODA 5FZ0A 4DXTA 1RL3A 4CDXC 1YEWA 3AKSA 1RUJ2 4BH9A 1WLTA 4YVWA 1Q56A 2Q0AA 1BJQA 3NKTA 1ULPA 1AXZA 3NQHA 4OQ8A 1JHNA 1AR72 2PAKA 2JG9B 2PHXA 2JDKA 1QNYA 2YC4A 1PO11 4Y3OA 4D6SA 3ZYJB 1XNCA 3WQ7A 1H0BA 1RMU3 4P9GA 1ULFA 1TMF3 4I3GA 2KXLA 5SV8A 4AF9A 1X9TA 1EAH2 1QMJA 2NLRA 3OPTA 1S0DA 2VMDA 4UFLA 1PHMA 2B9VA 1OPMA 3ZX7A 4YSFA 2ZAAA 4RR3C 1UQXA 3WNKA 4BISA 3CDZB 4YM2A 4IETA 5BNPB 4Q0UA 3KCYA 4RFRB 4UBHA 4YVSA 2VNVA 1MZEA 5BNNB 1W8OA 2X05A 3DKWA 3UT0A 3HNYM 2EALA 2WR9A 3KZ4C 5FO8B 1QJY2 1XBFA 2KR2A 2A70A 3LAGA 1CAVA 4OUSA 3SITA 3AZZA 4FPEA 1D7PM 1JYVA 2Q8OA 3EB7A 2PLV3 1JZ4A 1HKDA 1PNGA 1SLBA 4LUMA 5F3IA 1W9YA 3AL6A 5KXDA 2XJVA 4F8AA 1DQ2A 1AL0G 4LHKA 1HRV3 1XB9A 5JOZA 5FPZA 4N7UA 2DCZA 1OQDA 3MPPG 4TTGA 2OX0A 3KVAA 1MS3A 1SLAA 4QX0A 4WVWA 5FMDA 1H8VA 3WF3A 4C8DA 5F7UA 3ZFFA 3VD7A 5IVYA 5FYYA 4DNYA 5ABJA 1M06G 1NCRC 2VOWA 4E9KA 2V5YA 3VDDC 1NCQA 5IK5A 5CFDA 3H1WA 4M4PA 1S2EA 3WCSA 1AR83 2Y6FA 4CDUC 1EPZA 1ZRIA 4FFIA 2OVUA 4OI1A 1NA1C 2WBKA 3LD8A 2E32A 5H9QA 2ZMNA 3B7MA 3N7LA 1V6OA 1SFPA 2OUHA 2VR4A 1N47A 4C1WA 1YJLA 4GAZA 4IV1B 4EJRA 1BVVA 2PHLA 2JEMA 3J26N 1AR62 2WINB 3WXPA 2FDHA 3SH4A 2XWBB 1V00A 3KV6A 2R49A 1OA2A 2DVDA 2GMEA 4MXWB 5A32A 5ISLA 1RUD2 4YGCA 1LOBA 3KMHA 3LDRA 4QDSA 1YC61 2UURA 2PXJA 1CAUB 4Q8LA 4ES9A 2ZBJA 1QXJA 3JBG1 1CAXB 4L2NA 3D8CA 4QGMA 1LGBA 1G9FA 2C4XA 4QXBA 3OF1A 4XCAA 1B09A 1NZIA 1ZBE3 2WO2A 3VUOA 3OYWB 3JB8A 4EZ4A 1W0OA 3H3LA 1W6PB 1BYHA 4XHBA 2VQTA 2UYAA 2DVFA 3MUY1 2VXRA 1FXZA 1CQ9A 2OZ6A 5EQUA 3AB0A 1GSLA 2DYCA 1YWKA 4XF0A 4FBFA 2VBDA 1C8M1 3TWIA 2XJTA 1XNKA 1RIRA 4GH4A 5CZKA 5F1RA 1OSGA 4UAPA 3T0AA 3SH5A 3WCRA 3WF4A 5JZGB 2Z2SB 3SXWA 5J3UA 2X10A 2VUDA 2ZGMA 3FBYA 1WD3A 4FOYA 4MADA 4XF4A 2BVBA 3RNSA 2DTWA 4DY3A 5FO9B 5IUQA 1ENQA 1F2NA 1Q3EA 3H8UA 3SMHA 3BPZA 4JGYC 5BNPC 3FBMA 3HBZA 4ISRA 4KU8A 5BNNC 2YPDA 1RJ7A 4IXLA 5IFTA 3GM8A 1FX5A 1QJX1 4INDA 1MQTA 4CDWB 4CZSA 5GZCA 2I2SA 3MI8A 2OUJA 3ZFGA 3H50A 2X5IA 5GJ6A 4Q4W3 3X29B 1Q8PA 5FREA 1PM7A 3LGRA 4OMCA 3VHPA 4I09A 1IQDC 2ZGNA 1TZOA 3QOPA 3KGLA 3I54A 5C8CA 4QXCA 4XCBA 2WKKA 4M4RA 4JHZA 4NPLA 3C2UA 4HN1A 5A7QA 2H6CA 1D4M1 4CTEA 2JDUA 3CQOA 3ZYPA 2P17A 4PQ9A 2QVSB 4CDQB 2A6ZA 5BXXA 1PVXA 1BKZA 2ENRA 1JOJA 1NXD1 2VTFA 1RMU2 1IS6A 1RUNA 1TMF2 3KLSA 4JX0A 3I49A 4XJUA 4YW1A 2A3WA 2ORXA 4L8QA 2YUEA 2VOVA 1NX9A 5FXVA 2TNFA 1BLZA 4K7JA 4CP2A 4CPBA 3KT4A 1F5JA 2DFCA 2PELA 1O6UA 4PLNA 4W6YA 1JZ6A 2WAAA 4QPWA 2HEYF 5FPXA 4EROA 3OY8A 2Q8CA 4YW5A 1AYM2 3CEWA 3DUIA 1RHI3 4JTNA 4NHMA 3RWNA 5I8TA 2YMZA 1F4AA 2ZX4A 3J9SA 1UPSA 4PQQA 1GMMA 5FZBA 2PLV2 4UW3A 1WKYA 3PURA 2B45X 3IB3A 5KC5A 3Q8BA 1JZ8A 5JDBA 4J1XA 4QB2A 2SLIA 3NWKA 3NAPB 2QQOA 4OHVA 1EUTA 5LK5A 1HRV2 5C9AC 3O1TA 2CAVA 3IMMA 3ST7A 2RS53 3M3CA 1AJOA 4Z1VA 3VHNA 2WQ4A 4U2AA 1JZ3A 1IG3A 1QJFA 1DDLA 3M7AA 3GJBA 5GM0A 3OUHA 3AMMA 3IKWA 4XPVA 1I9RA 1FPN1 3VDBA 1AR82 2XJRA 3FE5A 2ADEA 2WNOA 4QX8A 5GZDA 1PO13 1PZ7A 2WJSA 5DXDA 2LRPA 4MZUA 4QHZA 5DAVA 3ZXLA 3PMEA 5H9PA 4CDXA 3QH7A 4FAHA 3VBUC 1REFA 4GZ9A 2R0FA 3PTRB 5JZGC 3RFRA 2X8KA 2NZ9A 4LBQD 4MGQA 5CKQA 5FXWA 1JOBA 4O9EA 3DV8A 2J1TA 2PYTA 3MPBA 5FZ6A 4FSJA 4W4ZA 4WM8B 4OQ9A 3ON7A 4HONA 5JSOA 2ZS6B 2VGDA 2JDMA 5FZEA 2IWGB 3PUIA 1OC1A 2AR6A 4O7XA 4ZHNA 4D6QA 4GMP1 5LBCA 4RR3A 4NAOA 4AGRA 1ULDA 4CDWC 1H2LA 1IKPA 1NLRA 4YARA 4NIGA 5FYMA 1GZ9A 3S57A 2EAKA 4S2HA 5BYNA 1ZRCA 1Y4WA 4NHXA 1RUF1 1ZBE2 4OCTA 5AVPA 5LY1A 3HIFA 2VVEA 5D21A 5KHIA 3MF6A 1SPPB 1X50A 2PHFA 2QZ2A 5IK4A 4JDOA 4R9DA 1W04A 1NY72 4COYA 4CDQC 4AVCA 4XDQA 3RYKA 3LPGA 2QQMA 1HLCA 3N35A 1AUYA 4ZZ5A 4IE6A 4XQWA 1W39A 1JUIA 1O3RA 3ZFEB 1QY4A 3I2KA 2XB6C 4YRDA 5JI9A 1F35A 3U14A 2W92A 1W05A 1WW5A 3VBSB 3ACIA 5K4LA 1YXWA 2E53A 2VOKA 4ZXKA 1E57A 1AVBA 1E5RA 3BALA 1NCRA 5CB7A 4YZ2A 3I59B 3VDDA 4DIQA 3IPVA 5DPNA 3NV1A 2A3XA 3KS7A 4MGZE 1WA6X 2VECA 4GMP0 3TRSB 3V64A 5F9TA 1BQPA 2ERFA 4XBQA 4PLOA 2IXIA 4XE9A 4XZPA 3WX5A 4Q4W2 3DGTA 3PLQA 4CDUA 3LOBA 2VMCA 2A6WA 1NA1A 4DRRA 3AJZA 5CEHA 2V73A 4E27A 3AM2A 1GWLA 3M2MA 2WNUB 3VDCA 2BERA 4CEYB 4JQTA 3NAPC 1CJPA 2BEOA 2VNGA 2V5DA 4IW3A 3JBG3 2A73B 3T4HB 1BK1A 1UOGA 1CZSA 1SZBA 2VE1A 3GNEA 3HNMA 4NO4A 2EA7A 4NRQA 3RVHA 4QGNA 2AEZA 1OF4A 3GCXA 3IDAA 2GP3A 1OA4A 2D5HA 4Y5Z0 4CSWA 1RINA 5HCHA 3QH6A 3RS6A 3FLRA 4LO6B 4IV3B 4GWJA 5IAVA 4BQ1A 1K45A 1QJU1 2XQRA 2ZEXA 5BY5A 1W6OB 4AHWA 1WCSA 4EN9B 4CEWC 1YIPA 1JYWA 3ZVXA 1DFQA 4P9YA 1C8M3 2D44A 2HWC3 3ENRA 3KCCA 3MF9A 4QQHA 4ZS3A 2EIBA 1RHI2 2J22A 2E7AA 5F5QA 3FFQA 1SMVA 2RE9A 2VG9A 4RQPC 4AQSA 4AW7A 2VL4A 3ILNA 3F95A 5JR2A 2AUYA 3VBOB 4AQTA 2VZSA 1UXXX 4LPLA 5EHDA 4EV0A 1LOEA 1UKGA 3ZSKA 1QQP1 4LE3A 2HYKA 4FFHA 1QJX3 2XHKA 5FYHA 4L99A 1M4WA 2HH9A 4FPHA 1WD4A 4CRQA 3H8XA 3POEA 2RS52 3WUDA 4LXLA 5CNAA 1GBGA 5BNPA 1UMIA 3HNBM 1K5JA 3PIJA 5BNNA 5FK7A 2RR13 3QACA 5LA1A 4URTA 2D3PA 2PHDA 4KBBA 4ZXEA 1W0NA 4NIHA 4QU2A 1D4M3 4MH0E 4V2VA 4XUOA 3SNMA 4HFSA 1F9KA 3MIDA 4JRAA 4QPIC 4R52A 3WP4A 1PO12 2RVAA 1UZZA 2XJUA 5IYYA 2CWMA 3ZN5A 5SV5A 5J36A 1J84A 2HYXA 1DZQA 2RV9A 3U4XA 1EV11 3I2OA 1U0AA 5EPAA 3N3HA 1QEXA 4EN8B 3M4FA 3LEIA 1X9PA 4HKOA 5JXJA 2Y38A 3K3NA 3EQEA 4LBJA 1NKGA 3S6PA 3AP4A 5FZAA 3BPSA 1ODMA 4K20A 4EWEA 4CUGA 1UU6A 1P8JA 4CXWA 4AXOA 1MVQA 1CX1A 1ZZ9A 5L73A 1UD1A 2VCBA 3NKGA 1AL23 1PZ9A 1ZVFA 5LK7B 2KD7A 2PQQA 2V4VA 5FP7A 4N43B 4A6OA 3OEAA 4FTBA 3BTZA 1VMJA 2HWD3 4GULA 2JDYA 2FHRA 2JICA 3VKNA 5K9YA 3PJQA 4D7YA 2GNDA 2WNUC 4IV1A 4XACA 1W06A 3H1YA 4CEYC 2KA3A 2VO5A 3B00A 2DU1A 3BN6A 3RJ2X 2OIIA 3CNAA 1ULCA 2BYVE 2G1MA 4Q4V1 3ZYIB 2W52A 4MXWA 2ZABA 4XXPA 2WO3A 2BPA2 1DLCA 1H1IA 3NV2A 1BXHA 1VBA2 1W2NA 5JAXA 2WZEA 3IBMA 1DQ4A 4AI1A 2ZXQA 4HVOA 4BQ3A 4IV3C 5C9AA 4YPJA 1CAUA 4KNCA 1FPN3 1CAXA 2DDUA 3HQUA 4Q4X2 4ZS2A 3T30A 2VVDA 5F2WA 5JR7B 3H8RA 2XH6A 2LW8A 4Q27A 3SKJE 2Y60A 3SLIA 5EXOA 3AYDA 3VZJA 1RXFA 3J7HA 3OYWA 1YCIA 2Q30A 2VUCA 4EWAA 1UIKA 4CU7A 1W6PA 3GGLA 3TNPB 4E8CA 2NP0A 4YVWC 1OF3A 1UAIA 1K5MC 4IEUA 4CVUA 2RJLA 3IM0A 5FJHA 3UETA 5HV4A 4CUBA 3RJRA 1LOFA 3J7LA 3WW3A 4EN6B 2D3SA 4OI2A 4XAEA 3VD5A 5I8YA 3ZSMA 1QKQA 4D94A 5JZGA 4FPOB 3BB6A 3NNJA 4QD2A 3K77A 1U5IA 3VZKA 4D6RA 3JBG2 5FWJA 4GMP3 3W5NA 3LFMA 1F8VA 5F32A 4RFT0 4LE4A 4AHZA 4XMIA 4I0BA 4Y1VA 4WZCA 1ASJ3 3CO2A 4H7LA 1DYKA 1RUF3 3SCFA 4YVSC 1UWWA 3MIGA 4FP2A 1PO23 3NNFA 4OFGA 2WC2A 3NVCA 4CDWA 2VZRA 5ACA1 3LIHA 1MZFA 2NYYA 1UO9A 2YC2A 3HN3A 1VMHA 4QXHA 3VGIA 4MUVA 5C4WB 4GA9A 2LTNA 4KG8A 5FZ1A 5FV3A 1C8M2 2AREA 1BZWA 2HWC2 3CU7A 4XFFA 5A3WA 3BTXA 2ADDA 3U4SA 3PUAA 2BFUS 2ZAHA 2J1EA 3H7JA 3OGVA 4LKDA 2D6PA 5F2SA 1GWMA 3ZSJA 4CDQA 3I3MA 3MLLA 3U10A 5FXZA 5FYBA 3ACLA 3OGGA 4KG0A 5CG9A 4BB3A 4K8FA 2WRAA 1QH7A 1QJX2 2B42B 5ABJC 1AHSA 1J3QA 2P6HA 2PHWA 4K40A 3OEBA 1ZM1A 4IQPA 1QOSA 5KXEA 3N9NA 5DZFA 3FMGA 5FUIA 2YY1A 1JUHA 3VZLA 2OXBA 1H4HA 5FLHA 3KM5A 2RR12 1OVSA 3OBTA 4HLTA 3POYA 1D4M2 2D6LX 3ELNA 1XE7A 4M3CE 5A7OA 4C91A 3B5LB 2OS2A 2HLEA 5CFCB 3LOIA 4LA2A 2IXKA 4Z92B 4B8EA 1HJGA 2VOTA 5FCCA 1JYIA 1Y9MA 3ES1A 2ZGKA 1DYPA 2GC1A 4N7IA 2WFF1 5EP9A 5F39A 1CX4A 3WQ1A 3ZR5A 3NAPA 1V70A 1PGW1 1S0EA 2VW2A 2W3JA 1WCUA 2JIGA 3IWZA 4OLLA 1G9DA 1ULGA 4IEYA 2ZGUA 4DXZA 4QQLA 5DG2A 1PGSA 2Q4SA 2XBO1 2WNVB 1S2BA 3PNAA 2X29A 4WZFA 3OUJA 3B94A 3B69A 1AL22 4IEPA 1HJFA 4Y5SA 3WP6A 4FTEA 4TSVA 3WDWA 1N1YA 1JODA 1JW6A 1ONAA 1A34A 4ITCA 2K2SA 2ZGSA 4CEWA 2HWD2 3TN91 2RDNA 3OPWA 5JPMB 1HN1A 4XURA 2WUHA 1QQP3 4HKWA 4L92A 4RQPA 2CDOA 5FQ0B 2QCSB 4BQ5A 4E4HA 3LQCA 1Q8QA 2BBAA 4FXKB 2QUOA 3LKJA 5JMCA 1WMDA 2GMMA 4LEJA 4YWAA 1U12A 1OFNA 4IEVA 3GZTB 3DYPA 5T55A 2YGLA 1L7QA 3CL1A 1LAJA 2BWCA 3WG4A 3HJRA 4NE9A 3WP5A 3WV6A 4OMDA 1DGWX 5JXHA 4W65A 1FPN2 1QF3A 4Y20B 1JXNA 4YLZA 3Q8AA 1DYOA 2BGPA 3F2ZA 4CCLA 3FHQA 3WSOA 1YQ5A 2DURA 5C4WC 1W2TA 3BU7A 5LCWL 1EV13 3A21A 1DZTA 4GKYA 1IPJA 1SPPA 1IPKA 3E5UA 1FMD1 1LGNA 4FOQA 1F4HA 5IK8A 2WWJA 4QPIA 1F5FA 3UGHA 3AZWA 4NN0A 1VPHA 3D0SA 4IE7A 1JH5A 2ZKLA 1GR3A 3C7EA 4K9SA 4CU9A 4NRPA 4NIAA 1UOJA 3A22A 1RUI1 1UYPA 5D8AB 2AACA 5AC92 1HRI1 4IEZA 3IDEA 5JIAA 1QOOA 4P00B 4XQ4A 3RQ0A 3HMYA 3ZYHA 1XSRA 1FNYA 1XNBA 1EUUA 3MIBA 1ASJ2 4QX5A 4Y5TA 1CJDA 4A4AA 2ZEZA 1RUF2 2WT2A 5J7MA 1LOCA 3I59A 1XJAA 1PO22 2FD8A 1LEDA 3J4UH 5L9RA 1QJZA 5A6QA 1AYN3 3ZYRA 3TB0A 1GQHA 3HOBA 4DXRA 5I0UA 4ZY9A 3MV01 3C8XA 4X8NA 4CCKA 1H2NA 1GICA 3G6JB 1VBD1 2ZACA 1R081 1W2AX 1F15A 2WNUA 4CEYA 3GDBA 3CJIB 4I0WB 2W95A 4RHV1 2Y26A 3KWVA 3C7OA 2Q1FA 2GH8A 3KHCA 1SDWA 5LATA 3V0AA 4GIQA 1LECA 4P02B 1WMXA 4B3NA 3E5QA 2WNVC 5GLTA 3KCXA 2RDRA 3MFCA 1IKQA 1W9FA 3DL3A 2FZ1A 4JDMA 5FY1A 3VDAA 3WDVA 2P3YA 4HN0A 4IV3A 4LO7A 4LJHA 2ARAA 2P3KA 1C8NA 2JECA 1VBC1 1W6OA 3MIFA 1Z7S1 2JIJA 3IT8A 3JQXA 3KF5A 3PL0A 3WVJA 4TXWA 1OXCA 2VC9A 2IVIB 2RM21 1BMV1 4AHYA 4DOUA 1SHWB 2JDZA 1K5MA 1A8DA 4B29A 3VBOA 3KT7A 2P2KA 1U5YA 3MYXA 3LA2A 3WHUA 2H6BA 1S0GA 1JS9A 2BZDA 5BV6A 2MEV1 3RZGA 2HWF1 3WQ0A 1UZ0A 1GWKA 4OHYA 3KV9A 3JZVA 4FPCA 4UFIA 2ZGRA 5DZGA 3HEIA 3LWCA 3N9PA 4OULA 1FNZA 3T09A 4ATEA 5ACA3 4DEQA 1UW8A 3O12A 4PBPA 2XGXA 5C5UA 2BVVA 4QKFA 3CZUA 2QDNA 3T3YA 5E89A 1N1TA 3AMPA 2N7GA 4QKNA 1W9WA 2VM9A 3M70A 2P5BA 4M0NA 4F83A 4FO9A 1UOFA 3I2IA 3MV11 1C5HA 2WZR1 1LU1A 3T1MA 4FOVA 3INAA 3WP3A 1H2KA 4C1XA 2XVGA 1GYKA 1JHJA 1WMEA 4YM1A 3NO8A 1MZ6A 4PHZA 3POIA 4XF1A 1NE6A 4UFKA 1SBEA 3L9JT 2B46X 5HPOA 1YRZA 4LLOA 1DP0A 3W9AA 1QWRA 3E97A 4LLFA 5EFUA 4AVBA 1I1EA 2YYOA 4GWIA 4KWKA 5J48A 4AFDA 2VNRA 4RS5B 4TLGA 5LEKA 2J1SA 2QQVA 1ENXA 2JG8C 1V9U1 4UT5A 3ZOIA 2IZWA 4K6BA 2ATFA 3D82A 2GC0A 3J8F1 2D6NA 3ZIXA 4E2SA 3ZM8A 2HWE1 4XETA 5FMOL 5A3PA 5C3PA 4G9SB 5DMYA 2W1WA 3E6BA 1WWYA 4IUGA 1UY1A 5F37A 1VIWB 2E9QA 3FFZA 3DEMA 3LEKA 4HVQA 4M00A 2ZMKA 3MHZA 4YG3A 1SBDA 3LEMA 4N9IA 3U78A 2EICA 5L36A 3N4MA 4HL0A 2WFF3 3L2YA 1EV12 4M0HA 1SFNA 1YYNA 4XJWA 5F5IA 5G04L 4FT8A 5HXVA 3SEEA 3UV9A 2W0XA 1IGOA 2CDPA 1JTZX 1KJLA 1BEV1 1LOGA 3D6EA 2HEWF 3VKFC 1VBE3 1SLTA 3VB9A 1XE8A 1ND3B 1V6KA 2BP6A 2VOXA 2XBO3 4L0PA 3VN4A 2XJSA 2A6XA 2PMWB 4XTMA 4FFGA 1UN1A 1VLNA 3FZ3A 4ASKA 1CZTA 3UJQA 1QIQA 3ACGA 3BOPA 1DQ5A 2DBNA 4BLIA 3GHMA 4KBZA 1JYTA 4BK4A 2XJQA 2P4EA 5FYZA 2CGPA 5LY2A 3UGFA 1UYYA 3WZ1A 4GKXA 4MHRA 4XBNA 1CPNA 4LOSA 4AFAA 1REDA 5DAPA 1XYPA 1RTVA 1W8UA 3NJXA 4NHYA 3B3QE 5J98B 1T6GC 3SCHA 1AYN2 2Y6LA 1V0AA 3PVNA 4AI3A 1RUG3 4ZONA 4E4DX 1OT5A 2IUWA 3MEPA 2GAUA 2JG9C 5C71A 4QT6A 4LK7A 4A45A 2D98A 2JE9A 5CKNA 4IEWA 4QB6A 2CHHA 4H7MA 2JE8A 3NW4A 2BGCA 2O8QA 4FVVA 2FDIA 2GC2A 5FPBA 5FZ7A 3ETQA 4COZA 3D5OA 1QXPA 2W1SA 4UI9L 3KSCA 3I3QA 3IDBB 3W20A 1CGPA 5JSPA 3AMHA 2ETEA 2RS11 1OOPB 3AYAA 3GYDA 1FMD3 4WM7B 1FYUA 5A7PA 4Z8BA 2AZ5A 4URAA 4ZKTB 1YI9A 3K3OA 3H0OA 5C4WA 3ACHA 4GWMA 2XG3A 3FWEA 3SQOA 3JD71 4NIDA 4AI2A 5T5PA 1RUI3 2CV6A 1D0HA 1HRI3 2BRTA 1COV1 2LS6A 2YXSA 4ARXA 1XQNA 3I2HA 4ET7A 3V0BB 5DAXA 1L7LA 1LHWA 1W8NA 5ANQA 2JDAA 5E8AA 1HXS3 2LROA 2D40A 1IPSA 1DCSA 2OKXA 1H1MA 5JPNB 4YW7A 2WSUA 4UF0A 2WO1A 3RYRA 5ACA2 5I0RA 2DF7A 2Z79A 1X8MA 5FRAA 1ZRDA 4B4QA 2OPWA 3QLQA 4IE5A 2SBAA 3PMSA 1CIYA 2ZGOA 3C7FA 5IHRA 1VBD3 1I5ZA 1OI6A 1R083 3ZPOA 2WAOA 1AXKA 4JGZB 2C24A 4W50A 3WD5A 3URFA 4DO0A 1AF9A 4IV1C 1NXMA 3KQRA 3N7KA 1G9BA 4LT5A 1UY3A 4RYDA 5IWFA 1ND3C 1GZCA 1GP5A 1W6NB 5F6KA 1S0IA 2B8MA 5F3GA 2K0GA 1OH4A 1VBB1 3WW4A 1MPXA 4AEJA 2R7EB 3RZHA 3OUIA 4X6QB 1UKRA 2Y34A 5T52A 3P3PA 1VBC3 4XABA 4HKLA 4A6SA 2IVJA 5DDJ1 5FXXA 2WNVA 1SLLA 1Z7S3 3TEWA 2B7YA 3KT1A 4HK9A 1V6IA 2E51A 2JD4A 3AVRA 4KQ7A 4UXAA 1QJEA 2VZQA 2RM23 4AK3A 3GJAA 4KL1A 1KDMA 2E63A 1KDKA 3CZJA 4JKMA 2W47A 4TLFA 1H2MA 2MNGA 3MO4A 2WFF2 1UX7A 2HWF3 2QQLA 2VZVA 1LOFC 4P9JA 1ZBA1 2JJ6A 1CONA 2DUQA 1EP0A 4S2GA 4PIYA 4QWNA 1HV0A 1EPWA 3K4DA 1VBE2 3PJYA 3O1OA 1JYXA 5K8SA 3FJSA 1H30A 3IDCB 3RI8A 4BCUA 4RSUA 3M8LA 5L7OB 5LA0A 2QQPA 2XBO2 5G05L 1RVF1 3OD0A 5FMBA 3USUB 5GALA 3H8OA 1VAMA 2A5ZA 4SBVA 3GBGA 3LA7A 3PTYA 1MACA 4JV4A 4Q0QA 4V2WA 4TN7A 5FY0A 4UW4A 3GALA 2WZR3 1LHUA 4Y20A 4COWA 2XL9A 4IEXA 3I7DA 3OBZA 3RG0A 4DS0A 2G9ZA 3BUCA 2VZUA 4META 4Z2WA 1SLCA 5FY5A 1GV9A 3MGUA 3E6DA 3GXUA 5LZ6A 1J3PA 4XFIA 1WMFA 4LHSA 4NMIA 4RA0A 5JXIA 3SHRA 1GANA 1W9SA 2QQJA 5FMOS 5FYVA 2UY9A 4QQOA 4LBMA 1RUG2 4Q4Y1 2GALA 1FI2A 3DF0A 3MZHA 2ZHKA 3LFIA 1V6MA 3N9LA 5JXGA 1ZX5A 3TEZA 1PGL1 1V9U3 1UZWA 4RGKA 3VKLA 3J8F3 4GB31 3UK9A 5D8AA 2HWE3 4E4ZA 2V72A 3T2QA 4NUBA 4N8MA 2EVXA 1RUE1 1OLMA 5ERLA 4AFMA 4AR2A 3OSDA 2EIGA 4FQ4A 3VKMA 2C9AA 1D0GA 3ILRA 2JG8A 2KM2A 4CU6A 1JMUB 3IIAA 4FPJA 2J7MA 1PMHX 2BFUL 1WCDJ 1POV1 1BEV3 2WT0A 2XKPA 3NNMA 3ZMOA 4AGGA 4XJAA 2C0ZA 5T50A 2DCTA 1XE0A 4YFWA 3CBNA 3WDTA 2R1BA 4NVPA 2W1QA 5C8WA 5EIYB 5LBBA 3EYPA 5FY4A 4LBQA 1O8SA 2J1AA 2JB4A 3OCPA 1XYOA 3OGRA 4LMFA 4UFJA 2X09A 1RUI2 4XW3A 2CAUA 3CLPA 4WVVA 4LBOA 3BI3A 1LJ7A 1MVEA 1X8EA 4KU7A 4MHUA 1HRI2 1GZWB 1OUSA 2ET1A 3QCWA 5DN2A 3TAYA 4AZZA 3E6CC 5B2GB 4GJYA 1UF2C 1UOBA 5LRRA 3O1VA 2Y6HA 4P9LA 2DVGA 3ACFA 1HB1A 1KEXA 1HXS2 4MOAA 1ND2B 4YW2A 1K42A 5I91A 2QJVA 1PNFA 4FOWA 4JKLA 4NOTA 3FC0A 2WNEA 1ZA7A 2ZHMA 3HWJA 1ODNA 5DG1A 3ZXFA 4BOWA 2WWSA 2XJPA 1Y9QA 4IDZA 1RUH1 5FY9A 3O0WA 4Q0SA 4TWTA 1DZRA 5JI7A 4N9HA 1POV0 4HXCA 4Q2FA 5FO7B 2VW1A 1NG0A 1RUJ1 2EIEA 2YBKA 5EZWA 3GHNA 5IVJA 1J1LA 2A75A 2DTYA 1UL9A 2JG9A 3FUOA 3WG2A 4IESA 4R4XA 5HCBA 2ZEWA 4WM8C 2RS13 4Y22B 3MW2A 3T0DA 5FLIA 1W6MB 3KGZA 3MLJA 1ZZ7A 5EJ3A 5A6ZA 3M3IA 2XLAA 3AK0A 1WCKA 2W5FA 2W87A 1Z7S2 3I3BA 5IVFA 3JD73 3O7OA 2EXJA 2HKXA 2OQ6A 4CXYA 1OKQA 5JOWA 4B1MA 2A6VA 3VBHB 4XQDA 2WDBA 1COV3 4Q1PA 2W2IA 2ET7A 2VCCA 1V6NA 3KHBA 4Y26A 5T54A 1HQWA 3CF6E 1ZZBA 1RYYA 2FDJA 1MS9A 2J1RA 2CYFA 4OHWA 5EJZB 1ST8A 3BU0A 1QH6A 4RN5A 4Q29A 3P1IA 4AGVA 1LESA 3AP9A 3OGJA 4Y1ZA 4E2QA 5FZIA 2F4LA 5A3TA 3W59A 4JVAA 2CGOA 5K7PA 3ZFEC 2DUOA 2IXHA 4UBGA 5JSRA 3RZZA 3VBSC 2VXJA 3I2FA 3KV5A 4MX3A 2H0BA 3B02A 3O0XA 1HB2A 1PX3A 5LA2A 4AL9A 1CWPA 3W58A 5LASA 3KD4A 2K46A 2VW0A 2WZR2 5EYYA 4R9AA 5FLJA 3KQ4B 4HSLA 3JUUA 3GZUC 5FP4A 1LHOA 1HB3A 2ZX3A 2D7FA 2JE7A 4XVHA 2VPVA 1X33A 4HMZA 4H3WA 1VBB3 3AKRA 1MR5A 1HIXA 3PUSA 2I07B 5ANNA 3OBAA 4OUEA 4AI9A 4DFSA 3TBDA 1POQA 5BUVA 5DDJ3 1ND3A 5IK7A 5FZDA 3EXUA 3PU8A 1V9U2 1RUD1 2DVAA 4XUPA 1LENA 4CCDA 3JU9A 4Z2AA 1GQPA 4Z07A 4MSVA 5GLZA 4YW6A 2WYFA 2HWE2 2ZX0A
chains in the Genus database with same CATH topology
5FY4A 4AAPA 5FWJA 3DXUA 5KR7A 5A7WA 5F32A 5F3CA 5LWBA 3KV6A 4LIUA 5ISLA 3ZPOA 4DO0A 5FYIA 4GJYA 5FZ4A 2WWJA 4UF0B 2XUEA 5FYSA 5FZ8A 5FP8A 5F5AA 4QX8A 2PXJA 5A3PA 2YBSA 5FZFA 5IWFA 4QU1A 4CCOA 3DXTA 4QXHA 3ZLIA 5FYHA 5FYUA 5F37A 5FZ1A 4GD4A 4IGPA 5F3GA 5FV3A 4QXBA 5A3WA 3U78A 4CCNA 3PTRB 4LXLA 5F5CA 4QX7A 2YU1A 4GJZA 3U4SA 4LITA 3PUAA 5FBJA 5FYTA 5F5IA 5FZ3A 5E6HA 4EZ4A 2OT7A 5FXWA 4EZHA 4IGOA 5FY9A 5FPAA 5FPUA 5FZ6A 5FZOA 5F2SA 5FXXA 5FZHA 5IVBA 4HONA 2Q8EA 2YBKA 5FZEA 5FXZA 5FYBA 3AVRA 4V2VA 5LW9A 5A7SA 5IVJA 5FWEA 5FP9A 5FUNA 4D6QA 4CCKA 3PDQA 4UF0A 4ASKA 5FYMA 5A80A 2OQ7A 3AVSA 3N9NA 5FZ0A 5A7WB 3PU3A 4XDPA 5FPVA 5F3EA 5LY1A 5FYZA 3K3NA 2VD7A 5LY2A 4HOOA 5FZAA 4CCJA 5FPLA 3N9QA 2YPDA 5FYCA 5FZLA 4CUGA 5A1FA 5FY8A 5IVCA 5IVFA 4Y3OA 4D6SA 4EYUA 4Y4RA 5A7OA 2OQ6A 4CCMA 2OS2A 2YU2A 3N9OA 4IGQA 3OPTA 5FY1A 5FP7A 2W2IA 5F39A 5FY0A 2Q8DA 4V2WA 4TN7A 4BISA 2YBPA 2XDVA 5K4LA 4QXCA 5A7NA 5A7QA 5IW0A 5FZIA 5A3TA 5FZ9A 5FY5A 5FZOB 5FPBA 5FZ7A 4DIQA 5FUPA 5IVEA 1VRBA 5FYVA 3KV5A 2XMLA 5FXVA 5A3NA 5FZMA 5F3IA 5CEHA 3AL6A 3K2OA 5A7PA 3N9LA 5FZCA 3OPWA 4URAA 3K3OA 3KV9A 4LIVA 3NJYA 3N9PA 5F2WA 4NUBA 5FP4A 2OX0A 3KVAA 2Q8CA 4C8DA 3UYJA 3N9MA 4E4HA 3RVHA 5IVYA 5FYYA 5FZKA 2GP3A 5IVVA 4QWNA 3AL5A 5FY7A 2WWUA 5FZBA 4CSWA 3PUSA 2P5BA 4XDOA 5FP3A 3KVBA 3PURA 5A1LA 2GP5A 4AI9A 5FJHA 5ANQA 4Y33A 5FZDA 5FZGA 3PU8A 3LD8A 4BXFA 3PUQA 5FJKA 4BU2A 3LDBA 3KV4A 4CCLA 4D6RA 4GAZA 2XXZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FY4 A;  4AAP A;  5FWJ A;  3DXU A;  5KR7 A;  5A7W A;  5F32 A;  5F3C A;  5LWB A;  3KV6 A;  4LIU A;  5ISL A;  3ZPO A;  4DO0 A;  5FYI A;  4GJY A;  5FZ4 A;  2WWJ A;  4UF0 B;  2XUE A;  5FYS A;  5FZ8 A;  5FP8 A;  5F5A A;  4QX8 A;  2PXJ A;  5A3P A;  2YBS A;  5FZF A;  5IWF A;  4QU1 A;  4CCO A;  3DXT A;  4QXH A;  3ZLI A;  5FYH A;  5FYU A;  5F37 A;  5FZ1 A;  4GD4 A;  4IGP A;  5F3G A;  5FV3 A;  4QXB A;  5A3W A;  3U78 A;  4CCN A;  3PTR B;  4LXL A;  5F5C A;  4QX7 A;  2YU1 A;  4GJZ A;  3U4S A;  4LIT A;  3PUA A;  5FBJ A;  5FYT A;  5F5I A;  5FZ3 A;  5E6H A;  4EZ4 A;  2OT7 A;  5FXW A;  4EZH A;  4IGO A;  5FY9 A;  5FPA A;  5FPU A;  5FZ6 A;  5FZO A;  5F2S A;  5FXX A;  5FZH A;  5IVB A;  4HON A;  2Q8E A;  2YBK A;  5FZE A;  5FXZ A;  5FYB A;  3AVR A;  4V2V A;  5LW9 A;  5A7S A;  5IVJ A;  5FWE A;  5FP9 A;  5FUN A;  4D6Q A;  4CCK A;  3PDQ A;  4UF0 A;  4ASK A;  5FYM A;  5A80 A;  2OQ7 A;  3AVS A;  3N9N A;  5FZ0 A;  5A7W B;  3PU3 A;  4XDP A;  5FPV A;  5F3E A;  5LY1 A;  5FYZ A;  3K3N A;  2VD7 A;  5LY2 A;  4HOO A;  5FZA A;  4CCJ A;  5FPL A;  3N9Q A;  2YPD A;  5FYC A;  5FZL A;  4CUG A;  5A1F A;  5FY8 A;  5IVC A;  5IVF A;  4Y3O A;  4D6S A;  4EYU A;  4Y4R A;  5A7O A;  2OQ6 A;  4CCM A;  2OS2 A;  2YU2 A;  3N9O A;  4IGQ A;  3OPT A;  5FY1 A;  5FP7 A;  2W2I A;  5F39 A;  5FY0 A;  2Q8D A;  4V2W A;  4TN7 A;  4BIS A;  2YBP A;  2XDV A;  5K4L A;  4QXC A;  5A7N A;  5A7Q A;  5IW0 A;  5FZI A;  5A3T A;  5FZ9 A;  5FY5 A;  5FZO B;  5FPB A;  5FZ7 A;  4DIQ A;  5FUP A;  5IVE A;  1VRB A;  5FYV A;  3KV5 A;  2XML A;  5FXV A;  5A3N A;  5FZM A;  5F3I A;  5CEH A;  3AL6 A;  3K2O A;  5A7P A;  3N9L A;  5FZC A;  3OPW A;  4URA A;  3K3O A;  3KV9 A;  4LIV A;  3NJY A;  3N9P A;  5F2W A;  4NUB A;  5FP4 A;  2OX0 A;  3KVA A;  2Q8C A;  4C8D A;  3UYJ A;  3N9M A;  4E4H A;  3RVH A;  5IVY A;  5FYY A;  5FZK A;  2GP3 A;  5IVV A;  4QWN A;  3AL5 A;  5FY7 A;  2WWU A;  5FZB A;  4CSW A;  3PUS A;  2P5B A;  4XDO A;  5FP3 A;  3KVB A;  3PUR A;  5A1L A;  2GP5 A;  4AI9 A;  5FJH A;  5ANQ A;  4Y33 A;  5FZD A;  5FZG A;  3PU8 A;  3LD8 A;  4BXF A;  3PUQ A;  5FJK A;  4BU2 A;  3LDB A;  3KV4 A;  4CCL A;  4D6R A;  4GAZ A;  2XXZ A; 
#chains in the Genus database with same CATH topology
 2RS3 1;  4BLJ A;  5CFD B;  2GN7 A;  2YFZ A;  2O14 A;  2TBV A;  4QHO A;  3AMN A;  2QFE A;  2ILM A;  4LIU A;  3B93 A;  2XLG A;  1LUL A;  3ZN6 B;  1C1F A;  2HBT A;  5FZ8 A;  1O7F A;  1IZ3 A;  4NJ4 A;  3ROU A;  4LKE A;  5CYY A;  1BEV 2;  1LHN A;  3FLP A;  2PQS A;  2GN3 A;  1OVP A;  1TME 1;  3ES4 A;  4XFC A;  4D69 A;  3AKT A;  3AJY A;  4QX2 A;  5D1I A;  1XND A;  2ZGL A;  4AQ2 A;  4QMA A;  4RL7 A;  4YW3 A;  5FOJ B;  3OTF A;  1RVF 3;  4NPM A;  1S0B A;  3JQW A;  5JVV A;  3VBO C;  4CCN A;  5H9S A;  2Y8K A;  3IN9 A;  2HBU A;  2BDR A;  4AI8 A;  2W94 A;  2MHF A;  1YJK A;  2NQY A;  4KWJ A;  3AP5 A;  1XRU A;  2GSY A;  2Q8E A;  3RDI A;  4AVS A;  4D8M A;  1OA3 A;  4BPZ A;  4QGL A;  3U07 A;  1C4R A;  4MYE A;  3WQB A;  3KB5 A;  5KBF A;  4O9G A;  1H9P A;  1BCX A;  4F7Z A;  2WSV A;  4QKD A;  3VBH C;  4XF9 A;  2YGM A;  3H42 B;  4Q4Y 3;  4XHX A;  3WF1 A;  4XDP A;  1X36 A;  2Y33 A;  1A78 A;  1CN1 A;  1LU2 A;  2JB8 A;  2FDG A;  3S0M A;  1HN0 A;  5JUV A;  2D3R A;  2JDN A;  3S7I A;  1O4Z A;  1TG7 A;  4XIK A;  4BQW A;  1VAK A;  2XL7 A;  1NAE A;  4B4P A;  1RUE 3;  4Y4R A;  2DBI A;  4MGI E;  3V0B A;  2RMU 1;  1JU3 A;  2YFU A;  1CD3 G;  4PDW B;  1PK6 B;  3Q8F A;  4UW5 A;  3ZN4 A;  1ACC A;  4LBL A;  3FHA A;  1UU5 A;  1CPM A;  1HB4 A;  1RMU 1;  1HQL A;  2RS1 2;  4LKS A;  2Z4F A;  1ULE A;  1GP6 A;  4M3C B;  1POV 3;  4XC9 A;  1MQT B;  2BW8 A;  2X5I B;  4J1W A;  4NHL A;  4DMI A;  2RJK A;  3J7M A;  4N43 C;  5GLW A;  2NMO A;  2VMH A;  2WA3 A;  4HSJ A;  4N53 B;  5EWS A;  3JD7 2;  1CZV A;  4BMB A;  3BCW A;  4HT1 T;  4EN0 A;  1W03 A;  4ISQ A;  5C8C B;  4MGK E;  1XNT A;  1AYM 1;  5IT6 A;  2PHT A;  3NNG A;  4JGZ A;  2F4P A;  3WF0 A;  2A71 A;  3K48 A;  2WYS A;  1DGR N;  2GDF A;  2DVB A;  4HK8 A;  5KHH A;  3A0N A;  3U75 A;  2BBV A;  1JI6 A;  2R06 1;  4QX1 A;  2PLV 1;  4BK5 A;  1G86 A;  5C33 A;  3VLB B;  4QAW A;  3CHX A;  2ZEY A;  3O14 A;  4FP3 A;  1HRV 1;  3RZK A;  1WGP A;  4A3Z A;  1XU2 A;  2CU5 A;  5IVV A;  3ZYB A;  1QJU 3;  2WWU A;  1OFS A;  2WS9 1;  1N3P A;  3NL1 A;  3VBR B;  3KVB A;  1RUH 3;  4ONU A;  2A6Y A;  2CTV A;  2UWC A;  2BQP A;  4WV8 A;  2E7T A;  4NII A;  4A44 A;  4I3P A;  2UY8 A;  3RZL A;  3M3E A;  5FZG A;  2ZA9 A;  2CSG A;  4DUW A;  5FJK A;  2X53 S;  1H6Y A;  2G4I A;  3TYJ A;  3WR0 A;  2ES3 A;  1AR8 1;  5DAW A;  1WLC A;  1ZRE A;  1Q8S A;  2QNK A;  3MW4 A;  5LRS A;  1EYB A;  4IL7 A;  2C26 A;  2Y6K A;  4XF3 A;  3MIC A;  3V65 A;  2JKX A;  1O3T A;  1TVG A;  1G7Y A;  1DHK B;  1NZC A;  2OZJ A;  2WQZ C;  4YM3 A;  3S30 A;  2WFP A;  5DDJ 2;  2GNB A;  2PAM A;  5A3U A;  1A8M A;  1DQ1 A;  1MS1 A;  2IFW A;  1UY2 A;  3USU A;  3W21 A;  4WM8 A;  1UU4 A;  2QE3 A;  4GD4 A;  2VVF A;  1C1L A;  2A3Y A;  2A7A A;  3Q8C A;  1G9C A;  1XOY A;  2RJ2 A;  3WUC A;  3WW2 A;  2YU1 A;  4BQ2 A;  2ARB A;  3DYO A;  3O5S A;  4JTO A;  3K75 B;  3CKH A;  2ZKN A;  2D6K A;  3S5Q A;  1YI7 A;  3VZN A;  3BIW E;  1SDD B;  2AGS A;  3ASI A;  5FZH A;  4NRM A;  1C3H A;  2J42 A;  4CDX B;  4W6X A;  1ZBE 1;  1QGL A;  4W8J A;  3UKV A;  5LW9 A;  3VD3 A;  1MS8 A;  4ORF A;  2FBE A;  5CBL A;  4WBB A;  4ASL A;  5IAT A;  5FTT C;  2R1D A;  3THT A;  4CUC A;  1QDO A;  2Y64 A;  1H9W A;  4PDW C;  2ZOE B;  5HCF A;  4B1L A;  4SLI A;  3ZXK A;  2GMP A;  5GLU A;  3GZA A;  3ZFE A;  1Q8V A;  4DZG A;  3L2H A;  4PI2 A;  4FPK A;  2CNA A;  1XXN A;  1E5H A;  4RR3 B;  2RDS A;  3VBS A;  1C57 A;  1KS5 A;  4W6W A;  2PN5 A;  3THP A;  1JZ7 A;  2XKO A;  4N53 C;  2EAA A;  2P3I A;  3VHR A;  4Q0P A;  2UWA A;  3NNL A;  4A3X A;  2Z5W A;  1RGS A;  2Q8D A;  1DG6 A;  2QQI A;  3MIE A;  3M3Q A;  4PCR A;  4Q4Y 2;  3AC0 A;  4Q26 A;  4RGG A;  2E26 A;  1JYC A;  1YHF A;  4I30 A;  4Q4V 3;  5CFC C;  5IW0 A;  1RUD 3;  1Z0H A;  5LB6 A;  3TEY A;  2GNM A;  1Q43 A;  3BVC A;  1XPW A;  3DPR B;  4P9I A;  4NRO A;  4BQ4 A;  1UY0 A;  2RS3 3;  1C5I A;  1RUE 2;  4OI0 A;  1GZW A;  2OW4 A;  1GQG A;  4UWD A;  1MEC 1;  1UZY A;  4NWW A;  1AX1 A;  3APB A;  5F6L B;  5FBZ A;  3E1F 1;  2GZW A;  1LTE A;  1W0P A;  3NV4 A;  5HCA A;  5AFE A;  2V09 A;  2VBB A;  2VZT A;  2XHN A;  3A0K A;  1DLL A;  3VBR C;  5F8P A;  5FZC A;  4JRL A;  3VDD B;  1ND2 A;  1O59 A;  5DAB A;  3W5M A;  4DEV A;  1TME 3;  1PIV 1;  1RIT A;  4YGD A;  4S2F A;  1PMJ X;  1Y43 B;  2W46 A;  3N7M A;  3UYJ A;  4I02 A;  1WUV A;  4HAN A;  1WW6 A;  3N7J A;  2VTX J;  3MUZ 1;  4LO8 A;  4C90 A;  3ETP A;  1YQC A;  2R16 A;  2ZGQ A;  4QKB A;  3DCQ A;  3R0R A;  3VHO A;  1PVC 1;  3HAG A;  2W9X A;  3I97 A;  4P9W A;  3WG3 A;  5CAD A;  1AXY A;  4P5Y A;  1KXG A;  2GP5 A;  2B9U A;  4Y33 A;  4AVA A;  5FR3 A;  1NYW A;  4L11 A;  5EYX A;  2JWP A;  1W3X A;  2ARC A;  1RUC 1;  4QB1 A;  1ZZ8 A;  2WAB A;  1LRH A;  3LDK A;  2R32 A;  2VZ1 A;  4LTA A;  4M3C F;  4MXV A;  4EYU A;  1KGY A;  4FFF A;  4Q1R A;  2P37 A;  2EXK A;  4LOR A;  4Y22 A;  3WDY A;  4JDN A;  1WW7 A;  5BPX A;  1W6M A;  4J25 A;  4OZX A;  3OOX A;  1QJU 2;  4IE4 A;  2NPI A;  1QU0 A;  1RUH 2;  4XJZ A;  5FOB B;  2D93 A;  4R9B A;  5GKA C;  3QD6 A;  2WQ8 A;  4M01 A;  1NQD A;  3RGB A;  3ZKU A;  3EHK A;  1S0C A;  2BOJ A;  1PM4 A;  3VBH A;  1J3R A;  5FZF A;  4H55 A;  2AYH A;  4QU1 A;  4JQR A;  4XIL A;  2JXA A;  5FYU A;  4XMA A;  2RMU 3;  3NV3 A;  3MDP A;  4YZ1 A;  1XC6 A;  3HD8 B;  2HWB 1;  5JOX A;  1URX A;  1E5S A;  5HBA A;  5L9B A;  1V6J A;  5F5C A;  2VUL A;  2VQ0 A;  1TQ5 A;  2O0O A;  5I0T A;  4EZH A;  5HV0 A;  5CA6 A;  1QQP 2;  5FPU A;  3ZSE A;  5D8A C;  2E6V A;  4QM8 A;  3WNL A;  2D6M A;  4HG6 B;  1IHM A;  3RPQ A;  1Y9G A;  4XUN A;  3ZXA C;  1YFU A;  2H0V A;  1DBN A;  2LM3 A;  4JGY B;  4ZU5 A;  5LEJ A;  4I01 A;  2AEY A;  2XWJ B;  4QQP A;  2WT1 A;  1AYM 3;  2PA7 A;  3T08 A;  4MVT A;  3POS A;  3WDU A;  1LB2 A;  5FPV A;  1HQN A;  3LB9 A;  1NUK A;  3CIH A;  1H8T B;  1MZ5 A;  3SC7 X;  2ID4 A;  2JKB A;  1OPO A;  4N43 A;  2F6B A;  2R06 3;  1N1S A;  4JHT A;  5DUX A;  2WZP P;  1VP6 A;  3VL8 A;  1GKB A;  4MV2 A;  2OYZ A;  1X7N A;  1GLH A;  1K12 A;  3DPR C;  2YU2 A;  2D97 A;  3Q8E A;  3AP7 A;  3CJI C;  1AX0 A;  2WS9 3;  5FKC A;  4B7E A;  4ZU7 A;  2VAU A;  5GZG A;  1US3 A;  4LR4 A;  1D4V B;  4BXS V;  1IOA A;  2IC1 A;  2ZZQ A;  4P9X A;  4XBL A;  4AG4 A;  1VBA 1;  2W08 A;  1G9A A;  2PHU A;  5JLV A;  3GCW A;  5FZ9 A;  3BTA A;  3LIG A;  3QBQ A;  4QM9 A;  1YLL A;  5J09 A;  1DQ6 A;  4Q4X 1;  3RMX A;  2JDH A;  2GU9 A;  3SKV A;  1SG3 A;  4OI4 A;  3TN9 3;  3OPZ A;  1TNF A;  3ZN6 A;  4GAL A;  3OJB A;  1W28 A;  4YZ4 A;  2BU9 A;  5CIS A;  4AVV A;  1WCQ A;  2DCY A;  3R4D B;  1W2O A;  4FPL A;  5GZF A;  5A3N A;  1AR9 1;  3VBF B;  2B39 A;  3NRU A;  4YZ5 A;  1JOP A;  2D43 A;  3WIN E;  4D0Q A;  1APN A;  4LIV A;  3DN7 A;  4Q4V 2;  4QDQ A;  5A33 B;  1OHF A;  4BME A;  1CAW B;  1IS3 A;  1R09 1;  5EJ1 B;  2FZ2 A;  3MBW A;  2RS3 2;  1RJ8 A;  3AMQ A;  4IER A;  5C9A B;  1L7R A;  1LOD A;  3A7Q A;  2YC0 A;  2D6O X;  2VUJ A;  3H3U A;  3JXS A;  1W8T A;  3ME2 A;  2JX9 A;  3I4I A;  4LBK A;  4OHX A;  5FY7 A;  4PJY A;  2VH9 A;  2VZP A;  3JCI A;  1LCL A;  1W8H A;  1CVN A;  4AED B;  1A6C A;  1O5L A;  1QDC A;  3PIG A;  5C3R A;  5DUV A;  4BU2 A;  1OLQ A;  3LDB A;  2W39 A;  4CPB D;  1TME 2;  2BGO A;  1KS4 A;  3NJV A;  4FTS A;  5B4X A;  2PTM A;  1W6Q B;  2OPK A;  2P34 A;  4P08 A;  5KR7 A;  2RDQ A;  5HI0 A;  5JMO A;  4NR1 A;  4FXG B;  3VZM A;  3UES A;  5KHG A;  3WNP A;  4QPY A;  2ZJC A;  2HWC 1;  4XFA A;  1W8F A;  3M3O A;  3VBU B;  2ORZ A;  1I5P A;  1WBL A;  5DUW A;  5FP8 A;  3IAQ A;  1OD5 A;  1YQ2 A;  4EWD A;  5J96 B;  2DFB A;  2Q1Z B;  3ATG A;  4PDW A;  3AFG A;  3TOJ A;  1PK6 A;  1VAL A;  2DCJ A;  3MIH A;  3BTY A;  4YG0 A;  3T1L A;  4RS5 C;  2E33 A;  2BNO A;  5M0T A;  2HEV F;  4A7Y A;  3WNM A;  4M3C A;  4PIZ A;  4E2G A;  3ALQ A;  2LUW A;  4LIT A;  3AXD A;  5L9V A;  1LKN A;  1RUO A;  4BA6 A;  2PHR A;  4I2O A;  1J83 A;  1RB8 G;  1H8T C;  2UWB A;  3O0V A;  2JD9 A;  3SIS A;  5IVB A;  2YB7 A;  4N53 A;  3THC A;  4C0B A;  1UIJ A;  1NT0 A;  4HET A;  4U36 A;  2RR1 1;  1A3K A;  5T5O A;  1O8P A;  5FUN A;  5E16 A;  4HZF A;  1L3J A;  4HBN A;  4RHV 3;  1MEC 3;  2RMU 2;  2ZPX A;  5A80 A;  3RRD A;  4EN7 B;  4YFZ A;  5A7W B;  4XYX A;  5CFC A;  4XFH A;  3N36 A;  3ZO0 B;  2VNO A;  2QBX A;  4BQY A;  1YUD A;  2E7Q A;  2VD7 A;  1KFU L;  4HOO A;  3DKQ A;  1PIV 3;  1SCS A;  1TEI A;  3RZJ A;  2BJS A;  3FHI B;  5FY8 A;  5CG8 A;  4JC1 A;  3OGS A;  4JZR A;  4COU A;  4P5H A;  1QHD A;  1U5Z A;  3ZDV A;  3VBR A;  3Q9O A;  4QPG B;  1PX4 A;  4GWN A;  3OG2 A;  5FK8 A;  4CP9 B;  1I6X A;  4AVT A;  1PVC 3;  3I3E A;  1SQ4 A;  4ATF A;  3ITQ A;  3VBF C;  1AL2 1;  3S7E A;  5CVR A;  4XIO A;  3HBK A;  1RUC 3;  5JWP A;  2JEN A;  2R06 2;  5FMC A;  2HWD 1;  3HN1 A;  3NST A;  4FCA A;  4K1Y A;  4PF1 A;  5FZO B;  4BHP A;  3ILF A;  2YG0 A;  4LOT A;  2IXL A;  3RWK X;  1E5I A;  3PUH A;  3BGA A;  3WT3 A;  2MEV 3;  3LF7 A;  2RG4 A;  4DRV A;  1SBF A;  4KH9 A;  3POJ A;  1PGW 2;  1JBC A;  4ZU4 A;  1BBT 1;  4FI9 A;  5FQ0 A;  5TSW A;  3O1R A;  4D7T A;  1N1V A;  2WS9 2;  4G3Y C;  3UGG A;  2VBP A;  3GBF A;  4LK6 A;  4O61 A;  1S55 A;  2XVL A;  3T0B A;  4AED C;  1Q5O A;  1OQ1 A;  3OB8 A;  3ECQ A;  4YYO A;  4UYB A;  3VD9 A;  1STM A;  1GFF 2;  3HT1 A;  4PLM A;  5B4N A;  1DIW A;  3LSE A;  1SEF A;  4E4S A;  2ZGP A;  1OOP C;  5C7G A;  1QOT A;  2HWB 3;  4WM7 C;  3RZM A;  4CEW B;  1UMZ A;  1WA4 A;  5IFP A;  4GQ7 A;  4DY5 A;  2WN2 A;  3TN9 2;  3U1X A;  2XLF A;  5A70 A;  5D2A A;  5BNO B;  3BIE A;  2CL2 A;  2B5H A;  1UX6 A;  3VV1 A;  4RQP B;  4MGY E;  4K1Z A;  1R1A 1;  3LSD A;  2W1U A;  3PUQ A;  1GP4 A;  1JN2 P;  3PVE A;  3LPF A;  1UY4 A;  2PAE A;  3FUQ A;  1O5U A;  2G19 A;  1VAV A;  3IZO A;  5KC6 A;  2V4A A;  2VMG A;  4LO4 B;  4YNI A;  4JCK A;  4IEO A;  4BQX A;  5AC9 1;  1IS4 A;  4BIF A;  5FYS A;  2FCT A;  4YZ3 A;  5FFO C;  3ZXD A;  2WLQ A;  3T2P A;  4A41 A;  1ASJ 1;  1R64 A;  2R04 1;  2R07 1;  3WNN A;  4EE2 A;  2BV4 A;  3ZLI A;  5HXM A;  3I2D A;  1PO2 1;  3PVB B;  1OQE A;  4BDV B;  4UFH A;  4JGZ C;  1FMD 2;  3B9I A;  4QPI B;  1VR3 A;  2G9G A;  1ENR A;  4QQ2 A;  1IS5 A;  4DUX A;  5FBJ A;  5FYT A;  1EY2 A;  1W2U A;  2VZO A;  4K21 A;  4CP0 A;  4R8H A;  1ALY A;  1VBA 3;  3DPR A;  3T2O A;  5GZE A;  1OD3 A;  1YFX A;  3CJI A;  1S4C A;  1VRH 1;  3AZV A;  4RGA A;  5FP9 A;  4PI0 A;  4K3U A;  4Q4X 3;  3U11 A;  1FOD 1;  1WLW A;  4A7Z A;  4HPK B;  1OUX A;  1W99 A;  4QPG C;  2R30 A;  5K0U B;  1BHG A;  4KMQ A;  2DU0 A;  1LGC A;  1AR9 3;  5C3O A;  3AKQ A;  3POW A;  4JAA A;  5H9R A;  4DIN B;  2G9F A;  1WZX A;  4WVM B;  2XR4 A;  1J1T A;  1GNH A;  2EXI A;  2GC3 A;  1C28 A;  4WVZ A;  1GOH A;  3N9Q A;  5FPL A;  3MFA A;  2BTV C;  5FYC A;  5A1F A;  4AWD A;  3EO6 A;  1WLD A;  2FQP A;  5LBF A;  1VBD 2;  2QKD A;  2J1U A;  1R09 3;  1R08 2;  3N9O A;  1FV2 A;  1RXG A;  3P3N A;  4IGQ A;  3DEC A;  2XPJ A;  4E8D A;  1W3V A;  1LOA A;  1S2K A;  4RHV 2;  1MEC 2;  1NOV A;  2Y6J A;  1BK0 A;  1REE A;  4XXA A;  1J59 A;  1B35 B;  3V0A B;  1AR7 1;  4AAX A;  5A7N A;  2HJI A;  2YDE A;  5L7O C;  1PMI A;  5A3O A;  4HVR A;  3SCG A;  3III A;  3WOG A;  4Q8K A;  2MPF A;  1W8Z A;  1YNA A;  1PIV 2;  3ABZ A;  1EAH 1;  4CUA A;  3LE0 A;  2EID A;  4B7K A;  1MS4 A;  3AFK A;  3J7N A;  4UOJ A;  2ZZJ A;  3GZE A;  4AEM A;  5IVE A;  1VBC 2;  4F3J A;  4R4Z A;  4XFB A;  4CU8 A;  4FAG A;  3M1H A;  2C1F A;  3ZMN A;  5A6Y A;  5BNO C;  3IMN A;  1Y7B A;  1PVC 2;  3SH3 A;  3H7Y A;  3R4U A;  4X8P A;  3ZYG A;  1JZ2 A;  3WNX A;  2K9Z A;  1ZZ6 A;  3T2T A;  1D2Q A;  5J1X A;  2RM2 2;  5T5L A;  3VD4 A;  3EMR A;  1BMV 2;  2CY6 A;  4YVW B;  2W68 A;  2XQX A;  1K5M B;  1FT9 A;  1QJY 1;  1RUC 2;  2VCA A;  3SEP A;  3ZXE A;  2EF6 A;  3I8T A;  1K3I A;  5IJR A;  2MEV 2;  5FAX A;  2HWF 2;  3AL5 A;  1R1Z A;  2NMN A;  5APA A;  1UXZ A;  2C5D A;  3ZR6 A;  1ZA4 A;  4XDO A;  4Y4Y A;  3G7D A;  5A3L A;  3VKO A;  2IXC A;  1ZRF A;  4TYS A;  2FMY A;  2FCU A;  4RS5 A;  4JGY A;  2DCK A;  3ZYF A;  5KHJ A;  3D4K A;  4YVS B;  3H1M A;  3KV4 A;  1SLI A;  4XJ8 A;  4ZPI A;  3JB4 C;  1VMF A;  4OYU A;  2C6S A;  4MGS A;  2PFW A;  5FKB A;  2QQW A;  3TNQ A;  2HWB 2;  1H8T A;  5FDB A;  1CAV B;  1OUR A;  1X82 A;  2LAL A;  3DYM A;  5FYI A;  5FZ4 A;  5I0S A;  2VQU A;  1KRI A;  2XUE A;  2Y0I A;  1O4Y A;  4G4F A;  2DUP A;  2AH2 A;  2YPJ A;  1WBF A;  5KHK A;  2XON A;  1HW5 A;  4A7K A;  1UZV A;  1JZ5 A;  2O1Q A;  1AR6 1;  4FPY A;  3UKT A;  5LBE A;  1GNY A;  1AJK A;  4ARY A;  3UNP A;  4L97 A;  4P14 A;  1WW4 A;  5K0U C;  3ZFF B;  4GJZ A;  1DU3 D;  2DWR A;  3FN9 A;  5FZ3 A;  4PT6 A;  4QHB A;  1DF0 A;  1GNZ A;  3LEG A;  3J8F 2;  4BZ4 A;  5ABJ B;  1LR5 A;  3OD4 A;  4XFG A;  2E31 A;  1ND2 C;  1NCQ B;  2BUK A;  3HR9 A;  5DUU A;  3E5X A;  3BYW A;  2WO7 A;  4LBN A;  1NLS A;  4MLO A;  2CGN A;  3O1P A;  1O4T A;  5FIX A;  3OBR A;  1JU4 A;  2DV9 A;  2WN3 A;  4I0A A;  4YW4 A;  5C6C A;  3VBF A;  1ZBA 3;  3C3V A;  4AQ6 A;  3B9C A;  1BBT 3;  5JCT A;  5T5J A;  5E1R A;  1AYN 1;  3PU3 A;  2VCM A;  3AP6 A;  3WEZ A;  5F3E A;  3O1U A;  1I3H A;  2XVK A;  4XOG A;  1O3S A;  4H2A A;  4NHK A;  1B35 C;  5A33 A;  1GUI A;  2L9L A;  1CES A;  2Q5T A;  1AZD A;  2WA4 A;  5A32 B;  2QTW B;  3USS A;  1CAW A;  1SAC A;  5FZL A;  5IVC A;  1OLR A;  2AEN A;  1F31 A;  1YFY A;  4YG6 A;  3VL9 A;  4AFB A;  1FAY A;  3A23 A;  3S5A A;  1UNB A;  3ORJ A;  3WY6 A;  1LEM A;  5IAX A;  3BOW A;  2BNM A;  1UPI A;  3LCP A;  4GXL A;  5T3N A;  4AED A;  3IAP A;  4QDR A;  3WW1 A;  5BNQ A;  3VZO A;  2IFR A;  2ZTN A;  4OUM A;  2YBP A;  4COV A;  3O1S A;  1AR9 2;  2XDV A;  1KJR A;  1RC6 A;  1KFX L;  2P1B A;  3AYC A;  4XZU G;  2ZHN A;  4X6R B;  2WII B;  1OOP A;  1R1A 3;  4WM7 A;  1W6Q A;  3NJZ A;  5JIU A;  1HX6 A;  2ZCW A;  2ZGT A;  4A2U A;  4LA3 A;  5A6X A;  5I93 A;  3R4S A;  5DQ0 A;  4ES8 A;  1YQ8 A;  4CCC A;  1Z78 A;  1R09 2;  1U5X A;  1VRB A;  1HDK A;  2VME A;  3VBU A;  4LNV A;  2QQN A;  4GB3 3;  4GH4 B;  1T2X A;  5FZM A;  1MS0 A;  5AC9 3;  2P6C A;  4BWO A;  4BYY A;  3ZPY A;  3BKZ A;  2QZ3 A;  1CIW A;  3R6S A;  4BE3 A;  3FX3 A;  4XEZ A;  1H1A A;  4AE2 A;  2GH2 A;  2R04 3;  2R07 3;  1TMF 1;  3N9M A;  4CYD A;  1OMI A;  3U0Z A;  4B4R A;  3RSJ A;  2WZ8 A;  2ZX1 A;  4NAM A;  3I2J A;  1YO8 A;  3ZFG B;  2FMD A;  4J6G A;  1ZZC A;  4DB5 A;  5A1L A;  4OVE A;  2A1X A;  2YV8 A;  3P5B A;  5I8S A;  1XYN A;  2QQU A;  2WL1 A;  2YRO A;  3UL2 A;  5I0D A;  1KQR A;  3D3A A;  1QXR A;  4BXF A;  5CIR A;  2NN8 A;  1VRH 3;  3WHT A;  3H9A A;  1COV 2;  4RD7 A;  2XOM A;  4V1P A;  3D0J A;  3DXU A;  1FOD 3;  4LUK A;  3R05 A;  5A7W A;  1TE1 B;  5J37 A;  2BOI A;  2W91 A;  4KWL A;  4AOC A;  1OBN A;  1W6N A;  1XSQ A;  3ZFF C;  4AFC A;  5AVA A;  3HPN A;  5KXC A;  3AYE A;  3NMB A;  3B01 A;  4Y1Y A;  4UF0 B;  4TZD A;  1SFY A;  1NCQ C;  3PHM A;  2QDR A;  5CFD C;  4NWV A;  4QPG A;  3AZY A;  1YIF A;  3DXT A;  4CP9 A;  3FLT A;  2R6Q A;  4IEQ A;  1VB2 A;  3WF2 A;  3THD A;  3OY8 B;  3HT2 A;  4D3W A;  1OKO A;  2Z69 A;  4LUL A;  4QX7 A;  2TEP A;  4A42 A;  2FDK A;  1RUJ 3;  3POB A;  1VE0 A;  2RHP A;  2F17 A;  5E6H A;  1UYX A;  1O3Q A;  3MW3 A;  4IGO A;  1AR7 3;  4MG2 A;  5FZO A;  4LO5 B;  4EQV A;  3FL7 A;  5C5T A;  1H4G A;  4KGQ A;  4KWU A;  4XUQ A;  4CCE A;  1VBB 2;  5FWE A;  2YZ4 A;  4LHL A;  3WNO A;  1EAH 3;  3ZKY A;  2WLP A;  4JKK A;  1VBE 1;  4K8R B;  4ASM B;  1XU1 A;  3K4Z A;  2ZX2 A;  2VJX A;  5L7O A;  3AVS A;  4DPN A;  4D7S A;  1ULO A;  3MLK A;  1HV1 A;  2BWA A;  3HVD A;  1S0J A;  1W8W A;  4DUV A;  2UYB A;  1H6X A;  2VMI A;  3ZIW A;  4CCJ A;  1DGL A;  1XNA A;  3KF3 A;  1QNW A;  1LHV A;  3WLU A;  4BM8 A;  1QJY 3;  1CR7 A;  3LZZ A;  1UMH A;  3EJK A;  1N3Q A;  4FPF A;  4CCM A;  3AXE A;  3ZXJ A;  1JYN A;  4PIX A;  5BNO A;  2J1V A;  1GZT A;  2B4K A;  3H3Z A;  4AI0 A;  1ZBA 2;  2XUM A;  2FDF A;  4GH4 C;  1BBT 2;  2ARX A;  4CP1 A;  3POF A;  3PVO A;  3K46 A;  5CU1 A;  3V56 A;  1RUG 1;  4CXX A;  5C3Q A;  5C70 A;  2I74 A;  2ZHL A;  3CJX A;  3GF6 A;  4LKF A;  2UU8 A;  1T6B X;  2VU9 A;  1RVF 2;  1PK6 C;  1NY7 1;  1YFW A;  5A3M A;  4N90 A;  1OH3 A;  2NM1 A;  1UYZ A;  4OHZ A;  1ZNP A;  5FUP A;  1SCR A;  5E88 A;  5EV7 A;  4AHX A;  5KXB A;  1MQT C;  2XML A;  1S1A A;  3ZFG C;  4C0H A;  3UJO A;  2X5I C;  4KGG A;  4XJ9 A;  5C3S A;  3EBR A;  3K2O A;  3LA3 A;  3U37 A;  3O1M A;  4CE8 A;  5JOY A;  1IG0 A;  3CMG A;  2EXH A;  2FCV A;  2TUN A;  5KWR A;  2JDP A;  3NJY A;  4YM0 A;  1Q8O A;  3RI9 A;  3TEX A;  5C8C C;  3AZX A;  1R1A 2;  1UCX A;  2R0H A;  1GOG A;  1US2 A;  2CWS A;  1AR6 3;  4YGB A;  4BIO A;  3I2G A;  4MO3 M;  1NE4 A;  4Q4W 1;  4Y1X A;  2BNN A;  4PBO A;  4PF5 A;  5CKM A;  5FZK A;  1PGL 2;  1IQA A;  3K51 A;  1G8W A;  1FV3 A;  5FP3 A;  2VQA A;  2VTX A;  4GB3 2;  5L19 A;  1V6L A;  4FQZ A;  1ENS A;  4OZO A;  1W9T A;  4DXS A;  1DQ0 A;  1KIT A;  1G6N A;  2YHJ A;  1ZRR A;  2OA2 A;  3P6B A;  4L9B A;  4HPK A;  2JG8 B;  5LA9 A;  4BJ0 A;  5K0U A;  2R04 2;  2XXZ A;  2R07 2;  1NLQ A;  3AKP A;  1HXS 1;  1AX2 A;  3I3D A;  3K4A A;  4KI5 M;  4AAP A;  4UFM A;  5AFB A;  1BVP 1;  3WDX A;  1NCR B;  4QX3 A;  4CA9 A;  3UKN A;  1VJ2 A;  3IPV B;  5F3C A;  5LWB A;  5GLV A;  4IE0 A;  1S0F A;  4WVM A;  2ZML A;  4DQA A;  3HQX A;  4MGT A;  1TNR A;  1GOF A;  1NQJ A;  1ZYB A;  4CDU B;  1N3O A;  1NA1 B;  1OLM E;  5DZE A;  1D2S A;  2IXJ A;  4LBQ B;  5F5A A;  4XUT A;  1LNS A;  2YBS A;  4ZZ8 A;  4Q0V A;  3WG1 A;  4CCO A;  1YQ6 A;  1RHI 1;  1VRH 2;  4FPG A;  4IGP A;  2Y6G A;  4H14 A;  4LQR A;  2Y0O A;  5A1A A;  4UW6 A;  4Z82 A;  1MS5 A;  2QQK A;  1FOD 2;  4LHN A;  4O65 A;  1B35 A;  3ZXG A;  5DAQ A;  1PZ8 A;  1FAT A;  2Z42 A;  4Q5O A;  4Y24 A;  3A4U A;  4R9C A;  2O8O A;  1KD7 A;  1VB4 A;  2AC1 A;  2OT7 A;  2D5F A;  2VMF A;  5FPA A;  3RYP A;  3GBW A;  2C9K A;  3AX4 A;  4NPR A;  4QXK A;  3RMY A;  2VZ3 A;  5A7S A;  1O91 A;  3C7G A;  3T4V A;  2VUA A;  1Y3T A;  4Y1U A;  3ZSL A;  4XTP A;  2VY0 A;  3HQR A;  4YGE A;  1DGR A;  3POG A;  4XAA A;  1J58 A;  2I45 A;  3C7H A;  2RS5 1;  2P3J A;  4AYU A;  1GU3 A;  3PDQ A;  2GNT A;  5CAZ A;  1DGW A;  1W90 A;  3ZDS A;  2Q1M A;  2OQ7 A;  4AEK A;  4S2D A;  3BOD A;  5FZ0 A;  4DXT A;  1RL3 A;  4CDX C;  1YEW A;  3AKS A;  1RUJ 2;  4BH9 A;  1WLT A;  4YVW A;  1Q56 A;  2Q0A A;  1BJQ A;  3NKT A;  1ULP A;  1AXZ A;  3NQH A;  4OQ8 A;  1JHN A;  1AR7 2;  2PAK A;  2JG9 B;  2PHX A;  2JDK A;  1QNY A;  2YC4 A;  1PO1 1;  4Y3O A;  4D6S A;  3ZYJ B;  1XNC A;  3WQ7 A;  1H0B A;  1RMU 3;  4P9G A;  1ULF A;  1TMF 3;  4I3G A;  2KXL A;  5SV8 A;  4AF9 A;  1X9T A;  1EAH 2;  1QMJ A;  2NLR A;  3OPT A;  1S0D A;  2VMD A;  4UFL A;  1PHM A;  2B9V A;  1OPM A;  3ZX7 A;  4YSF A;  2ZAA A;  4RR3 C;  1UQX A;  3WNK A;  4BIS A;  3CDZ B;  4YM2 A;  4IET A;  5BNP B;  4Q0U A;  3KCY A;  4RFR B;  4UBH A;  4YVS A;  2VNV A;  1MZE A;  5BNN B;  1W8O A;  2X05 A;  3DKW A;  3UT0 A;  3HNY M;  2EAL A;  2WR9 A;  3KZ4 C;  5FO8 B;  1QJY 2;  1XBF A;  2KR2 A;  2A70 A;  3LAG A;  1CAV A;  4OUS A;  3SIT A;  3AZZ A;  4FPE A;  1D7P M;  1JYV A;  2Q8O A;  3EB7 A;  2PLV 3;  1JZ4 A;  1HKD A;  1PNG A;  1SLB A;  4LUM A;  5F3I A;  1W9Y A;  3AL6 A;  5KXD A;  2XJV A;  4F8A A;  1DQ2 A;  1AL0 G;  4LHK A;  1HRV 3;  1XB9 A;  5JOZ A;  5FPZ A;  4N7U A;  2DCZ A;  1OQD A;  3MPP G;  4TTG A;  2OX0 A;  3KVA A;  1MS3 A;  1SLA A;  4QX0 A;  4WVW A;  5FMD A;  1H8V A;  3WF3 A;  4C8D A;  5F7U A;  3ZFF A;  3VD7 A;  5IVY A;  5FYY A;  4DNY A;  5ABJ A;  1M06 G;  1NCR C;  2VOW A;  4E9K A;  2V5Y A;  3VDD C;  1NCQ A;  5IK5 A;  5CFD A;  3H1W A;  4M4P A;  1S2E A;  3WCS A;  1AR8 3;  2Y6F A;  4CDU C;  1EPZ A;  1ZRI A;  4FFI A;  2OVU A;  4OI1 A;  1NA1 C;  2WBK A;  3LD8 A;  2E32 A;  5H9Q A;  2ZMN A;  3B7M A;  3N7L A;  1V6O A;  1SFP A;  2OUH A;  2VR4 A;  1N47 A;  4C1W A;  1YJL A;  4GAZ A;  4IV1 B;  4EJR A;  1BVV A;  2PHL A;  2JEM A;  3J26 N;  1AR6 2;  2WIN B;  3WXP A;  2FDH A;  3SH4 A;  2XWB B;  1V00 A;  3KV6 A;  2R49 A;  1OA2 A;  2DVD A;  2GME A;  4MXW B;  5A32 A;  5ISL A;  1RUD 2;  4YGC A;  1LOB A;  3KMH A;  3LDR A;  4QDS A;  1YC6 1;  2UUR A;  2PXJ A;  1CAU B;  4Q8L A;  4ES9 A;  2ZBJ A;  1QXJ A;  3JBG 1;  1CAX B;  4L2N A;  3D8C A;  4QGM A;  1LGB A;  1G9F A;  2C4X A;  4QXB A;  3OF1 A;  4XCA A;  1B09 A;  1NZI A;  1ZBE 3;  2WO2 A;  3VUO A;  3OYW B;  3JB8 A;  4EZ4 A;  1W0O A;  3H3L A;  1W6P B;  1BYH A;  4XHB A;  2VQT A;  2UYA A;  2DVF A;  3MUY 1;  2VXR A;  1FXZ A;  1CQ9 A;  2OZ6 A;  5EQU A;  3AB0 A;  1GSL A;  2DYC A;  1YWK A;  4XF0 A;  4FBF A;  2VBD A;  1C8M 1;  3TWI A;  2XJT A;  1XNK A;  1RIR A;  4GH4 A;  5CZK A;  5F1R A;  1OSG A;  4UAP A;  3T0A A;  3SH5 A;  3WCR A;  3WF4 A;  5JZG B;  2Z2S B;  3SXW A;  5J3U A;  2X10 A;  2VUD A;  2ZGM A;  3FBY A;  1WD3 A;  4FOY A;  4MAD A;  4XF4 A;  2BVB A;  3RNS A;  2DTW A;  4DY3 A;  5FO9 B;  5IUQ A;  1ENQ A;  1F2N A;  1Q3E A;  3H8U A;  3SMH A;  3BPZ A;  4JGY C;  5BNP C;  3FBM A;  3HBZ A;  4ISR A;  4KU8 A;  5BNN C;  2YPD A;  1RJ7 A;  4IXL A;  5IFT A;  3GM8 A;  1FX5 A;  1QJX 1;  4IND A;  1MQT A;  4CDW B;  4CZS A;  5GZC A;  2I2S A;  3MI8 A;  2OUJ A;  3ZFG A;  3H50 A;  2X5I A;  5GJ6 A;  4Q4W 3;  3X29 B;  1Q8P A;  5FRE A;  1PM7 A;  3LGR A;  4OMC A;  3VHP A;  4I09 A;  1IQD C;  2ZGN A;  1TZO A;  3QOP A;  3KGL A;  3I54 A;  5C8C A;  4QXC A;  4XCB A;  2WKK A;  4M4R A;  4JHZ A;  4NPL A;  3C2U A;  4HN1 A;  5A7Q A;  2H6C A;  1D4M 1;  4CTE A;  2JDU A;  3CQO A;  3ZYP A;  2P17 A;  4PQ9 A;  2QVS B;  4CDQ B;  2A6Z A;  5BXX A;  1PVX A;  1BKZ A;  2ENR A;  1JOJ A;  1NXD 1;  2VTF A;  1RMU 2;  1IS6 A;  1RUN A;  1TMF 2;  3KLS A;  4JX0 A;  3I49 A;  4XJU A;  4YW1 A;  2A3W A;  2ORX A;  4L8Q A;  2YUE A;  2VOV A;  1NX9 A;  5FXV A;  2TNF A;  1BLZ A;  4K7J A;  4CP2 A;  4CPB A;  3KT4 A;  1F5J A;  2DFC A;  2PEL A;  1O6U A;  4PLN A;  4W6Y A;  1JZ6 A;  2WAA A;  4QPW A;  2HEY F;  5FPX A;  4ERO A;  3OY8 A;  2Q8C A;  4YW5 A;  1AYM 2;  3CEW A;  3DUI A;  1RHI 3;  4JTN A;  4NHM A;  3RWN A;  5I8T A;  2YMZ A;  1F4A A;  2ZX4 A;  3J9S A;  1UPS A;  4PQQ A;  1GMM A;  5FZB A;  2PLV 2;  4UW3 A;  1WKY A;  3PUR A;  2B45 X;  3IB3 A;  5KC5 A;  3Q8B A;  1JZ8 A;  5JDB A;  4J1X A;  4QB2 A;  2SLI A;  3NWK A;  3NAP B;  2QQO A;  4OHV A;  1EUT A;  5LK5 A;  1HRV 2;  5C9A C;  3O1T A;  2CAV A;  3IMM A;  3ST7 A;  2RS5 3;  3M3C A;  1AJO A;  4Z1V A;  3VHN A;  2WQ4 A;  4U2A A;  1JZ3 A;  1IG3 A;  1QJF A;  1DDL A;  3M7A A;  3GJB A;  5GM0 A;  3OUH A;  3AMM A;  3IKW A;  4XPV A;  1I9R A;  1FPN 1;  3VDB A;  1AR8 2;  2XJR A;  3FE5 A;  2ADE A;  2WNO A;  4QX8 A;  5GZD A;  1PO1 3;  1PZ7 A;  2WJS A;  5DXD A;  2LRP A;  4MZU A;  4QHZ A;  5DAV A;  3ZXL A;  3PME A;  5H9P A;  4CDX A;  3QH7 A;  4FAH A;  3VBU C;  1REF A;  4GZ9 A;  2R0F A;  3PTR B;  5JZG C;  3RFR A;  2X8K A;  2NZ9 A;  4LBQ D;  4MGQ A;  5CKQ A;  5FXW A;  1JOB A;  4O9E A;  3DV8 A;  2J1T A;  2PYT A;  3MPB A;  5FZ6 A;  4FSJ A;  4W4Z A;  4WM8 B;  4OQ9 A;  3ON7 A;  4HON A;  5JSO A;  2ZS6 B;  2VGD A;  2JDM A;  5FZE A;  2IWG B;  3PUI A;  1OC1 A;  2AR6 A;  4O7X A;  4ZHN A;  4D6Q A;  4GMP 1;  5LBC A;  4RR3 A;  4NAO A;  4AGR A;  1ULD A;  4CDW C;  1H2L A;  1IKP A;  1NLR A;  4YAR A;  4NIG A;  5FYM A;  1GZ9 A;  3S57 A;  2EAK A;  4S2H A;  5BYN A;  1ZRC A;  1Y4W A;  4NHX A;  1RUF 1;  1ZBE 2;  4OCT A;  5AVP A;  5LY1 A;  3HIF A;  2VVE A;  5D21 A;  5KHI A;  3MF6 A;  1SPP B;  1X50 A;  2PHF A;  2QZ2 A;  5IK4 A;  4JDO A;  4R9D A;  1W04 A;  1NY7 2;  4COY A;  4CDQ C;  4AVC A;  4XDQ A;  3RYK A;  3LPG A;  2QQM A;  1HLC A;  3N35 A;  1AUY A;  4ZZ5 A;  4IE6 A;  4XQW A;  1W39 A;  1JUI A;  1O3R A;  3ZFE B;  1QY4 A;  3I2K A;  2XB6 C;  4YRD A;  5JI9 A;  1F35 A;  3U14 A;  2W92 A;  1W05 A;  1WW5 A;  3VBS B;  3ACI A;  5K4L A;  1YXW A;  2E53 A;  2VOK A;  4ZXK A;  1E57 A;  1AVB A;  1E5R A;  3BAL A;  1NCR A;  5CB7 A;  4YZ2 A;  3I59 B;  3VDD A;  4DIQ A;  3IPV A;  5DPN A;  3NV1 A;  2A3X A;  3KS7 A;  4MGZ E;  1WA6 X;  2VEC A;  4GMP 0;  3TRS B;  3V64 A;  5F9T A;  1BQP A;  2ERF A;  4XBQ A;  4PLO A;  2IXI A;  4XE9 A;  4XZP A;  3WX5 A;  4Q4W 2;  3DGT A;  3PLQ A;  4CDU A;  3LOB A;  2VMC A;  2A6W A;  1NA1 A;  4DRR A;  3AJZ A;  5CEH A;  2V73 A;  4E27 A;  3AM2 A;  1GWL A;  3M2M A;  2WNU B;  3VDC A;  2BER A;  4CEY B;  4JQT A;  3NAP C;  1CJP A;  2BEO A;  2VNG A;  2V5D A;  4IW3 A;  3JBG 3;  2A73 B;  3T4H B;  1BK1 A;  1UOG A;  1CZS A;  1SZB A;  2VE1 A;  3GNE A;  3HNM A;  4NO4 A;  2EA7 A;  4NRQ A;  3RVH A;  4QGN A;  2AEZ A;  1OF4 A;  3GCX A;  3IDA A;  2GP3 A;  1OA4 A;  2D5H A;  4Y5Z 0;  4CSW A;  1RIN A;  5HCH A;  3QH6 A;  3RS6 A;  3FLR A;  4LO6 B;  4IV3 B;  4GWJ A;  5IAV A;  4BQ1 A;  1K45 A;  1QJU 1;  2XQR A;  2ZEX A;  5BY5 A;  1W6O B;  4AHW A;  1WCS A;  4EN9 B;  4CEW C;  1YIP A;  1JYW A;  3ZVX A;  1DFQ A;  4P9Y A;  1C8M 3;  2D44 A;  2HWC 3;  3ENR A;  3KCC A;  3MF9 A;  4QQH A;  4ZS3 A;  2EIB A;  1RHI 2;  2J22 A;  2E7A A;  5F5Q A;  3FFQ A;  1SMV A;  2RE9 A;  2VG9 A;  4RQP C;  4AQS A;  4AW7 A;  2VL4 A;  3ILN A;  3F95 A;  5JR2 A;  2AUY A;  3VBO B;  4AQT A;  2VZS A;  1UXX X;  4LPL A;  5EHD A;  4EV0 A;  1LOE A;  1UKG A;  3ZSK A;  1QQP 1;  4LE3 A;  2HYK A;  4FFH A;  1QJX 3;  2XHK A;  5FYH A;  4L99 A;  1M4W A;  2HH9 A;  4FPH A;  1WD4 A;  4CRQ A;  3H8X A;  3POE A;  2RS5 2;  3WUD A;  4LXL A;  5CNA A;  1GBG A;  5BNP A;  1UMI A;  3HNB M;  1K5J A;  3PIJ A;  5BNN A;  5FK7 A;  2RR1 3;  3QAC A;  5LA1 A;  4URT A;  2D3P A;  2PHD A;  4KBB A;  4ZXE A;  1W0N A;  4NIH A;  4QU2 A;  1D4M 3;  4MH0 E;  4V2V A;  4XUO A;  3SNM A;  4HFS A;  1F9K A;  3MID A;  4JRA A;  4QPI C;  4R52 A;  3WP4 A;  1PO1 2;  2RVA A;  1UZZ A;  2XJU A;  5IYY A;  2CWM A;  3ZN5 A;  5SV5 A;  5J36 A;  1J84 A;  2HYX A;  1DZQ A;  2RV9 A;  3U4X A;  1EV1 1;  3I2O A;  1U0A A;  5EPA A;  3N3H A;  1QEX A;  4EN8 B;  3M4F A;  3LEI A;  1X9P A;  4HKO A;  5JXJ A;  2Y38 A;  3K3N A;  3EQE A;  4LBJ A;  1NKG A;  3S6P A;  3AP4 A;  5FZA A;  3BPS A;  1ODM A;  4K20 A;  4EWE A;  4CUG A;  1UU6 A;  1P8J A;  4CXW A;  4AXO A;  1MVQ A;  1CX1 A;  1ZZ9 A;  5L73 A;  1UD1 A;  2VCB A;  3NKG A;  1AL2 3;  1PZ9 A;  1ZVF A;  5LK7 B;  2KD7 A;  2PQQ A;  2V4V A;  5FP7 A;  4N43 B;  4A6O A;  3OEA A;  4FTB A;  3BTZ A;  1VMJ A;  2HWD 3;  4GUL A;  2JDY A;  2FHR A;  2JIC A;  3VKN A;  5K9Y A;  3PJQ A;  4D7Y A;  2GND A;  2WNU C;  4IV1 A;  4XAC A;  1W06 A;  3H1Y A;  4CEY C;  2KA3 A;  2VO5 A;  3B00 A;  2DU1 A;  3BN6 A;  3RJ2 X;  2OII A;  3CNA A;  1ULC A;  2BYV E;  2G1M A;  4Q4V 1;  3ZYI B;  2W52 A;  4MXW A;  2ZAB A;  4XXP A;  2WO3 A;  2BPA 2;  1DLC A;  1H1I A;  3NV2 A;  1BXH A;  1VBA 2;  1W2N A;  5JAX A;  2WZE A;  3IBM A;  1DQ4 A;  4AI1 A;  2ZXQ A;  4HVO A;  4BQ3 A;  4IV3 C;  5C9A A;  4YPJ A;  1CAU A;  4KNC A;  1FPN 3;  1CAX A;  2DDU A;  3HQU A;  4Q4X 2;  4ZS2 A;  3T30 A;  2VVD A;  5F2W A;  5JR7 B;  3H8R A;  2XH6 A;  2LW8 A;  4Q27 A;  3SKJ E;  2Y60 A;  3SLI A;  5EXO A;  3AYD A;  3VZJ A;  1RXF A;  3J7H A;  3OYW A;  1YCI A;  2Q30 A;  2VUC A;  4EWA A;  1UIK A;  4CU7 A;  1W6P A;  3GGL A;  3TNP B;  4E8C A;  2NP0 A;  4YVW C;  1OF3 A;  1UAI A;  1K5M C;  4IEU A;  4CVU A;  2RJL A;  3IM0 A;  5FJH A;  3UET A;  5HV4 A;  4CUB A;  3RJR A;  1LOF A;  3J7L A;  3WW3 A;  4EN6 B;  2D3S A;  4OI2 A;  4XAE A;  3VD5 A;  5I8Y A;  3ZSM A;  1QKQ A;  4D94 A;  5JZG A;  4FPO B;  3BB6 A;  3NNJ A;  4QD2 A;  3K77 A;  1U5I A;  3VZK A;  4D6R A;  3JBG 2;  5FWJ A;  4GMP 3;  3W5N A;  3LFM A;  1F8V A;  5F32 A;  4RFT 0;  4LE4 A;  4AHZ A;  4XMI A;  4I0B A;  4Y1V A;  4WZC A;  1ASJ 3;  3CO2 A;  4H7L A;  1DYK A;  1RUF 3;  3SCF A;  4YVS C;  1UWW A;  3MIG A;  4FP2 A;  1PO2 3;  3NNF A;  4OFG A;  2WC2 A;  3NVC A;  4CDW A;  2VZR A;  5ACA 1;  3LIH A;  1MZF A;  2NYY A;  1UO9 A;  2YC2 A;  3HN3 A;  1VMH A;  4QXH A;  3VGI A;  4MUV A;  5C4W B;  4GA9 A;  2LTN A;  4KG8 A;  5FZ1 A;  5FV3 A;  1C8M 2;  2ARE A;  1BZW A;  2HWC 2;  3CU7 A;  4XFF A;  5A3W A;  3BTX A;  2ADD A;  3U4S A;  3PUA A;  2BFU S;  2ZAH A;  2J1E A;  3H7J A;  3OGV A;  4LKD A;  2D6P A;  5F2S A;  1GWM A;  3ZSJ A;  4CDQ A;  3I3M A;  3MLL A;  3U10 A;  5FXZ A;  5FYB A;  3ACL A;  3OGG A;  4KG0 A;  5CG9 A;  4BB3 A;  4K8F A;  2WRA A;  1QH7 A;  1QJX 2;  2B42 B;  5ABJ C;  1AHS A;  1J3Q A;  2P6H A;  2PHW A;  4K40 A;  3OEB A;  1ZM1 A;  4IQP A;  1QOS A;  5KXE A;  3N9N A;  5DZF A;  3FMG A;  5FUI A;  2YY1 A;  1JUH A;  3VZL A;  2OXB A;  1H4H A;  5FLH A;  3KM5 A;  2RR1 2;  1OVS A;  3OBT A;  4HLT A;  3POY A;  1D4M 2;  2D6L X;  3ELN A;  1XE7 A;  4M3C E;  5A7O A;  4C91 A;  3B5L B;  2OS2 A;  2HLE A;  5CFC B;  3LOI A;  4LA2 A;  2IXK A;  4Z92 B;  4B8E A;  1HJG A;  2VOT A;  5FCC A;  1JYI A;  1Y9M A;  3ES1 A;  2ZGK A;  1DYP A;  2GC1 A;  4N7I A;  2WFF 1;  5EP9 A;  5F39 A;  1CX4 A;  3WQ1 A;  3ZR5 A;  3NAP A;  1V70 A;  1PGW 1;  1S0E A;  2VW2 A;  2W3J A;  1WCU A;  2JIG A;  3IWZ A;  4OLL A;  1G9D A;  1ULG A;  4IEY A;  2ZGU A;  4DXZ A;  4QQL A;  5DG2 A;  1PGS A;  2Q4S A;  2XBO 1;  2WNV B;  1S2B A;  3PNA A;  2X29 A;  4WZF A;  3OUJ A;  3B94 A;  3B69 A;  1AL2 2;  4IEP A;  1HJF A;  4Y5S A;  3WP6 A;  4FTE A;  4TSV A;  3WDW A;  1N1Y A;  1JOD A;  1JW6 A;  1ONA A;  1A34 A;  4ITC A;  2K2S A;  2ZGS A;  4CEW A;  2HWD 2;  3TN9 1;  2RDN A;  3OPW A;  5JPM B;  1HN1 A;  4XUR A;  2WUH A;  1QQP 3;  4HKW A;  4L92 A;  4RQP A;  2CDO A;  5FQ0 B;  2QCS B;  4BQ5 A;  4E4H A;  3LQC A;  1Q8Q A;  2BBA A;  4FXK B;  2QUO A;  3LKJ A;  5JMC A;  1WMD A;  2GMM A;  4LEJ A;  4YWA A;  1U12 A;  1OFN A;  4IEV A;  3GZT B;  3DYP A;  5T55 A;  2YGL A;  1L7Q A;  3CL1 A;  1LAJ A;  2BWC A;  3WG4 A;  3HJR A;  4NE9 A;  3WP5 A;  3WV6 A;  4OMD A;  1DGW X;  5JXH A;  4W65 A;  1FPN 2;  1QF3 A;  4Y20 B;  1JXN A;  4YLZ A;  3Q8A A;  1DYO A;  2BGP A;  3F2Z A;  4CCL A;  3FHQ A;  3WSO A;  1YQ5 A;  2DUR A;  5C4W C;  1W2T A;  3BU7 A;  5LCW L;  1EV1 3;  3A21 A;  1DZT A;  4GKY A;  1IPJ A;  1SPP A;  1IPK A;  3E5U A;  1FMD 1;  1LGN A;  4FOQ A;  1F4H A;  5IK8 A;  2WWJ A;  4QPI A;  1F5F A;  3UGH A;  3AZW A;  4NN0 A;  1VPH A;  3D0S A;  4IE7 A;  1JH5 A;  2ZKL A;  1GR3 A;  3C7E A;  4K9S A;  4CU9 A;  4NRP A;  4NIA A;  1UOJ A;  3A22 A;  1RUI 1;  1UYP A;  5D8A B;  2AAC A;  5AC9 2;  1HRI 1;  4IEZ A;  3IDE A;  5JIA A;  1QOO A;  4P00 B;  4XQ4 A;  3RQ0 A;  3HMY A;  3ZYH A;  1XSR A;  1FNY A;  1XNB A;  1EUU A;  3MIB A;  1ASJ 2;  4QX5 A;  4Y5T A;  1CJD A;  4A4A A;  2ZEZ A;  1RUF 2;  2WT2 A;  5J7M A;  1LOC A;  3I59 A;  1XJA A;  1PO2 2;  2FD8 A;  1LED A;  3J4U H;  5L9R A;  1QJZ A;  5A6Q A;  1AYN 3;  3ZYR A;  3TB0 A;  1GQH A;  3HOB A;  4DXR A;  5I0U A;  4ZY9 A;  3MV0 1;  3C8X A;  4X8N A;  4CCK A;  1H2N A;  1GIC A;  3G6J B;  1VBD 1;  2ZAC A;  1R08 1;  1W2A X;  1F15 A;  2WNU A;  4CEY A;  3GDB A;  3CJI B;  4I0W B;  2W95 A;  4RHV 1;  2Y26 A;  3KWV A;  3C7O A;  2Q1F A;  2GH8 A;  3KHC A;  1SDW A;  5LAT A;  3V0A A;  4GIQ A;  1LEC A;  4P02 B;  1WMX A;  4B3N A;  3E5Q A;  2WNV C;  5GLT A;  3KCX A;  2RDR A;  3MFC A;  1IKQ A;  1W9F A;  3DL3 A;  2FZ1 A;  4JDM A;  5FY1 A;  3VDA A;  3WDV A;  2P3Y A;  4HN0 A;  4IV3 A;  4LO7 A;  4LJH A;  2ARA A;  2P3K A;  1C8N A;  2JEC A;  1VBC 1;  1W6O A;  3MIF A;  1Z7S 1;  2JIJ A;  3IT8 A;  3JQX A;  3KF5 A;  3PL0 A;  3WVJ A;  4TXW A;  1OXC A;  2VC9 A;  2IVI B;  2RM2 1;  1BMV 1;  4AHY A;  4DOU A;  1SHW B;  2JDZ A;  1K5M A;  1A8D A;  4B29 A;  3VBO A;  3KT7 A;  2P2K A;  1U5Y A;  3MYX A;  3LA2 A;  3WHU A;  2H6B A;  1S0G A;  1JS9 A;  2BZD A;  5BV6 A;  2MEV 1;  3RZG A;  2HWF 1;  3WQ0 A;  1UZ0 A;  1GWK A;  4OHY A;  3KV9 A;  3JZV A;  4FPC A;  4UFI A;  2ZGR A;  5DZG A;  3HEI A;  3LWC A;  3N9P A;  4OUL A;  1FNZ A;  3T09 A;  4ATE A;  5ACA 3;  4DEQ A;  1UW8 A;  3O12 A;  4PBP A;  2XGX A;  5C5U A;  2BVV A;  4QKF A;  3CZU A;  2QDN A;  3T3Y A;  5E89 A;  1N1T A;  3AMP A;  2N7G A;  4QKN A;  1W9W A;  2VM9 A;  3M70 A;  2P5B A;  4M0N A;  4F83 A;  4FO9 A;  1UOF A;  3I2I A;  3MV1 1;  1C5H A;  2WZR 1;  1LU1 A;  3T1M A;  4FOV A;  3INA A;  3WP3 A;  1H2K A;  4C1X A;  2XVG A;  1GYK A;  1JHJ A;  1WME A;  4YM1 A;  3NO8 A;  1MZ6 A;  4PHZ A;  3POI A;  4XF1 A;  1NE6 A;  4UFK A;  1SBE A;  3L9J T;  2B46 X;  5HPO A;  1YRZ A;  4LLO A;  1DP0 A;  3W9A A;  1QWR A;  3E97 A;  4LLF A;  5EFU A;  4AVB A;  1I1E A;  2YYO A;  4GWI A;  4KWK A;  5J48 A;  4AFD A;  2VNR A;  4RS5 B;  4TLG A;  5LEK A;  2J1S A;  2QQV A;  1ENX A;  2JG8 C;  1V9U 1;  4UT5 A;  3ZOI A;  2IZW A;  4K6B A;  2ATF A;  3D82 A;  2GC0 A;  3J8F 1;  2D6N A;  3ZIX A;  4E2S A;  3ZM8 A;  2HWE 1;  4XET A;  5FMO L;  5A3P A;  5C3P A;  4G9S B;  5DMY A;  2W1W A;  3E6B A;  1WWY A;  4IUG A;  1UY1 A;  5F37 A;  1VIW B;  2E9Q A;  3FFZ A;  3DEM A;  3LEK A;  4HVQ A;  4M00 A;  2ZMK A;  3MHZ A;  4YG3 A;  1SBD A;  3LEM A;  4N9I A;  3U78 A;  2EIC A;  5L36 A;  3N4M A;  4HL0 A;  2WFF 3;  3L2Y A;  1EV1 2;  4M0H A;  1SFN A;  1YYN A;  4XJW A;  5F5I A;  5G04 L;  4FT8 A;  5HXV A;  3SEE A;  3UV9 A;  2W0X A;  1IGO A;  2CDP A;  1JTZ X;  1KJL A;  1BEV 1;  1LOG A;  3D6E A;  2HEW F;  3VKF C;  1VBE 3;  1SLT A;  3VB9 A;  1XE8 A;  1ND3 B;  1V6K A;  2BP6 A;  2VOX A;  2XBO 3;  4L0P A;  3VN4 A;  2XJS A;  2A6X A;  2PMW B;  4XTM A;  4FFG A;  1UN1 A;  1VLN A;  3FZ3 A;  4ASK A;  1CZT A;  3UJQ A;  1QIQ A;  3ACG A;  3BOP A;  1DQ5 A;  2DBN A;  4BLI A;  3GHM A;  4KBZ A;  1JYT A;  4BK4 A;  2XJQ A;  2P4E A;  5FYZ A;  2CGP A;  5LY2 A;  3UGF A;  1UYY A;  3WZ1 A;  4GKX A;  4MHR A;  4XBN A;  1CPN A;  4LOS A;  4AFA A;  1RED A;  5DAP A;  1XYP A;  1RTV A;  1W8U A;  3NJX A;  4NHY A;  3B3Q E;  5J98 B;  1T6G C;  3SCH A;  1AYN 2;  2Y6L A;  1V0A A;  3PVN A;  4AI3 A;  1RUG 3;  4ZON A;  4E4D X;  1OT5 A;  2IUW A;  3MEP A;  2GAU A;  2JG9 C;  5C71 A;  4QT6 A;  4LK7 A;  4A45 A;  2D98 A;  2JE9 A;  5CKN A;  4IEW A;  4QB6 A;  2CHH A;  4H7M A;  2JE8 A;  3NW4 A;  2BGC A;  2O8Q A;  4FVV A;  2FDI A;  2GC2 A;  5FPB A;  5FZ7 A;  3ETQ A;  4COZ A;  3D5O A;  1QXP A;  2W1S A;  4UI9 L;  3KSC A;  3I3Q A;  3IDB B;  3W20 A;  1CGP A;  5JSP A;  3AMH A;  2ETE A;  2RS1 1;  1OOP B;  3AYA A;  3GYD A;  1FMD 3;  4WM7 B;  1FYU A;  5A7P A;  4Z8B A;  2AZ5 A;  4URA A;  4ZKT B;  1YI9 A;  3K3O A;  3H0O A;  5C4W A;  3ACH A;  4GWM A;  2XG3 A;  3FWE A;  3SQO A;  3JD7 1;  4NID A;  4AI2 A;  5T5P A;  1RUI 3;  2CV6 A;  1D0H A;  1HRI 3;  2BRT A;  1COV 1;  2LS6 A;  2YXS A;  4ARX A;  1XQN A;  3I2H A;  4ET7 A;  3V0B B;  5DAX A;  1L7L A;  1LHW A;  1W8N A;  5ANQ A;  2JDA A;  5E8A A;  1HXS 3;  2LRO A;  2D40 A;  1IPS A;  1DCS A;  2OKX A;  1H1M A;  5JPN B;  4YW7 A;  2WSU A;  4UF0 A;  2WO1 A;  3RYR A;  5ACA 2;  5I0R A;  2DF7 A;  2Z79 A;  1X8M A;  5FRA A;  1ZRD A;  4B4Q A;  2OPW A;  3QLQ A;  4IE5 A;  2SBA A;  3PMS A;  1CIY A;  2ZGO A;  3C7F A;  5IHR A;  1VBD 3;  1I5Z A;  1OI6 A;  1R08 3;  3ZPO A;  2WAO A;  1AXK A;  4JGZ B;  2C24 A;  4W50 A;  3WD5 A;  3URF A;  4DO0 A;  1AF9 A;  4IV1 C;  1NXM A;  3KQR A;  3N7K A;  1G9B A;  4LT5 A;  1UY3 A;  4RYD A;  5IWF A;  1ND3 C;  1GZC A;  1GP5 A;  1W6N B;  5F6K A;  1S0I A;  2B8M A;  5F3G A;  2K0G A;  1OH4 A;  1VBB 1;  3WW4 A;  1MPX A;  4AEJ A;  2R7E B;  3RZH A;  3OUI A;  4X6Q B;  1UKR A;  2Y34 A;  5T52 A;  3P3P A;  1VBC 3;  4XAB A;  4HKL A;  4A6S A;  2IVJ A;  5DDJ 1;  5FXX A;  2WNV A;  1SLL A;  1Z7S 3;  3TEW A;  2B7Y A;  3KT1 A;  4HK9 A;  1V6I A;  2E51 A;  2JD4 A;  3AVR A;  4KQ7 A;  4UXA A;  1QJE A;  2VZQ A;  2RM2 3;  4AK3 A;  3GJA A;  4KL1 A;  1KDM A;  2E63 A;  1KDK A;  3CZJ A;  4JKM A;  2W47 A;  4TLF A;  1H2M A;  2MNG A;  3MO4 A;  2WFF 2;  1UX7 A;  2HWF 3;  2QQL A;  2VZV A;  1LOF C;  4P9J A;  1ZBA 1;  2JJ6 A;  1CON A;  2DUQ A;  1EP0 A;  4S2G A;  4PIY A;  4QWN A;  1HV0 A;  1EPW A;  3K4D A;  1VBE 2;  3PJY A;  3O1O A;  1JYX A;  5K8S A;  3FJS A;  1H30 A;  3IDC B;  3RI8 A;  4BCU A;  4RSU A;  3M8L A;  5L7O B;  5LA0 A;  2QQP A;  2XBO 2;  5G05 L;  1RVF 1;  3OD0 A;  5FMB A;  3USU B;  5GAL A;  3H8O A;  1VAM A;  2A5Z A;  4SBV A;  3GBG A;  3LA7 A;  3PTY A;  1MAC A;  4JV4 A;  4Q0Q A;  4V2W A;  4TN7 A;  5FY0 A;  4UW4 A;  3GAL A;  2WZR 3;  1LHU A;  4Y20 A;  4COW A;  2XL9 A;  4IEX A;  3I7D A;  3OBZ A;  3RG0 A;  4DS0 A;  2G9Z A;  3BUC A;  2VZU A;  4MET A;  4Z2W A;  1SLC A;  5FY5 A;  1GV9 A;  3MGU A;  3E6D A;  3GXU A;  5LZ6 A;  1J3P A;  4XFI A;  1WMF A;  4LHS A;  4NMI A;  4RA0 A;  5JXI A;  3SHR A;  1GAN A;  1W9S A;  2QQJ A;  5FMO S;  5FYV A;  2UY9 A;  4QQO A;  4LBM A;  1RUG 2;  4Q4Y 1;  2GAL A;  1FI2 A;  3DF0 A;  3MZH A;  2ZHK A;  3LFI A;  1V6M A;  3N9L A;  5JXG A;  1ZX5 A;  3TEZ A;  1PGL 1;  1V9U 3;  1UZW A;  4RGK A;  3VKL A;  3J8F 3;  4GB3 1;  3UK9 A;  5D8A A;  2HWE 3;  4E4Z A;  2V72 A;  3T2Q A;  4NUB A;  4N8M A;  2EVX A;  1RUE 1;  1OLM A;  5ERL A;  4AFM A;  4AR2 A;  3OSD A;  2EIG A;  4FQ4 A;  3VKM A;  2C9A A;  1D0G A;  3ILR A;  2JG8 A;  2KM2 A;  4CU6 A;  1JMU B;  3IIA A;  4FPJ A;  2J7M A;  1PMH X;  2BFU L;  1WCD J;  1POV 1;  1BEV 3;  2WT0 A;  2XKP A;  3NNM A;  3ZMO A;  4AGG A;  4XJA A;  2C0Z A;  5T50 A;  2DCT A;  1XE0 A;  4YFW A;  3CBN A;  3WDT A;  2R1B A;  4NVP A;  2W1Q A;  5C8W A;  5EIY B;  5LBB A;  3EYP A;  5FY4 A;  4LBQ A;  1O8S A;  2J1A A;  2JB4 A;  3OCP A;  1XYO A;  3OGR A;  4LMF A;  4UFJ A;  2X09 A;  1RUI 2;  4XW3 A;  2CAU A;  3CLP A;  4WVV A;  4LBO A;  3BI3 A;  1LJ7 A;  1MVE A;  1X8E A;  4KU7 A;  4MHU A;  1HRI 2;  1GZW B;  1OUS A;  2ET1 A;  3QCW A;  5DN2 A;  3TAY A;  4AZZ A;  3E6C C;  5B2G B;  4GJY A;  1UF2 C;  1UOB A;  5LRR A;  3O1V A;  2Y6H A;  4P9L A;  2DVG A;  3ACF A;  1HB1 A;  1KEX A;  1HXS 2;  4MOA A;  1ND2 B;  4YW2 A;  1K42 A;  5I91 A;  2QJV A;  1PNF A;  4FOW A;  4JKL A;  4NOT A;  3FC0 A;  2WNE A;  1ZA7 A;  2ZHM A;  3HWJ A;  1ODN A;  5DG1 A;  3ZXF A;  4BOW A;  2WWS A;  2XJP A;  1Y9Q A;  4IDZ A;  1RUH 1;  5FY9 A;  3O0W A;  4Q0S A;  4TWT A;  1DZR A;  5JI7 A;  4N9H A;  1POV 0;  4HXC A;  4Q2F A;  5FO7 B;  2VW1 A;  1NG0 A;  1RUJ 1;  2EIE A;  2YBK A;  5EZW A;  3GHN A;  5IVJ A;  1J1L A;  2A75 A;  2DTY A;  1UL9 A;  2JG9 A;  3FUO A;  3WG2 A;  4IES A;  4R4X A;  5HCB A;  2ZEW A;  4WM8 C;  2RS1 3;  4Y22 B;  3MW2 A;  3T0D A;  5FLI A;  1W6M B;  3KGZ A;  3MLJ A;  1ZZ7 A;  5EJ3 A;  5A6Z A;  3M3I A;  2XLA A;  3AK0 A;  1WCK A;  2W5F A;  2W87 A;  1Z7S 2;  3I3B A;  5IVF A;  3JD7 3;  3O7O A;  2EXJ A;  2HKX A;  2OQ6 A;  4CXY A;  1OKQ A;  5JOW A;  4B1M A;  2A6V A;  3VBH B;  4XQD A;  2WDB A;  1COV 3;  4Q1P A;  2W2I A;  2ET7 A;  2VCC A;  1V6N A;  3KHB A;  4Y26 A;  5T54 A;  1HQW A;  3CF6 E;  1ZZB A;  1RYY A;  2FDJ A;  1MS9 A;  2J1R A;  2CYF A;  4OHW A;  5EJZ B;  1ST8 A;  3BU0 A;  1QH6 A;  4RN5 A;  4Q29 A;  3P1I A;  4AGV A;  1LES A;  3AP9 A;  3OGJ A;  4Y1Z A;  4E2Q A;  5FZI A;  2F4L A;  5A3T A;  3W59 A;  4JVA A;  2CGO A;  5K7P A;  3ZFE C;  2DUO A;  2IXH A;  4UBG A;  5JSR A;  3RZZ A;  3VBS C;  2VXJ A;  3I2F A;  3KV5 A;  4MX3 A;  2H0B A;  3B02 A;  3O0X A;  1HB2 A;  1PX3 A;  5LA2 A;  4AL9 A;  1CWP A;  3W58 A;  5LAS A;  3KD4 A;  2K46 A;  2VW0 A;  2WZR 2;  5EYY A;  4R9A A;  5FLJ A;  3KQ4 B;  4HSL A;  3JUU A;  3GZU C;  5FP4 A;  1LHO A;  1HB3 A;  2ZX3 A;  2D7F A;  2JE7 A;  4XVH A;  2VPV A;  1X33 A;  4HMZ A;  4H3W A;  1VBB 3;  3AKR A;  1MR5 A;  1HIX A;  3PUS A;  2I07 B;  5ANN A;  3OBA A;  4OUE A;  4AI9 A;  4DFS A;  3TBD A;  1POQ A;  5BUV A;  5DDJ 3;  1ND3 A;  5IK7 A;  5FZD A;  3EXU A;  3PU8 A;  1V9U 2;  1RUD 1;  2DVA A;  4XUP A;  1LEN A;  4CCD A;  3JU9 A;  4Z2A A;  1GQP A;  4Z07 A;  4MSV A;  5GLZ A;  4YW6 A;  2WYF A;  2HWE 2;  2ZX0 A; 
#chains in the Genus database with same CATH homology
 5FY4 A;  4AAP A;  5FWJ A;  3DXU A;  5KR7 A;  5A7W A;  5F32 A;  5F3C A;  5LWB A;  3KV6 A;  4LIU A;  5ISL A;  3ZPO A;  4DO0 A;  5FYI A;  4GJY A;  5FZ4 A;  2WWJ A;  4UF0 B;  2XUE A;  5FYS A;  5FZ8 A;  5FP8 A;  5F5A A;  4QX8 A;  2PXJ A;  5A3P A;  2YBS A;  5FZF A;  5IWF A;  4QU1 A;  4CCO A;  3DXT A;  4QXH A;  3ZLI A;  5FYH A;  5FYU A;  5F37 A;  5FZ1 A;  4GD4 A;  4IGP A;  5F3G A;  5FV3 A;  4QXB A;  5A3W A;  3U78 A;  4CCN A;  3PTR B;  4LXL A;  5F5C A;  4QX7 A;  2YU1 A;  4GJZ A;  3U4S A;  4LIT A;  3PUA A;  5FBJ A;  5FYT A;  5F5I A;  5FZ3 A;  5E6H A;  4EZ4 A;  2OT7 A;  5FXW A;  4EZH A;  4IGO A;  5FY9 A;  5FPA A;  5FPU A;  5FZ6 A;  5FZO A;  5F2S A;  5FXX A;  5FZH A;  5IVB A;  4HON A;  2Q8E A;  2YBK A;  5FZE A;  5FXZ A;  5FYB A;  3AVR A;  4V2V A;  5LW9 A;  5A7S A;  5IVJ A;  5FWE A;  5FP9 A;  5FUN A;  4D6Q A;  4CCK A;  3PDQ A;  4UF0 A;  4ASK A;  5FYM A;  5A80 A;  2OQ7 A;  3AVS A;  3N9N A;  5FZ0 A;  5A7W B;  3PU3 A;  4XDP A;  5FPV A;  5F3E A;  5LY1 A;  5FYZ A;  3K3N A;  2VD7 A;  5LY2 A;  4HOO A;  5FZA A;  4CCJ A;  5FPL A;  3N9Q A;  2YPD A;  5FYC A;  5FZL A;  4CUG A;  5A1F A;  5FY8 A;  5IVC A;  5IVF A;  4Y3O A;  4D6S A;  4EYU A;  4Y4R A;  5A7O A;  2OQ6 A;  4CCM A;  2OS2 A;  2YU2 A;  3N9O A;  4IGQ A;  3OPT A;  5FY1 A;  5FP7 A;  2W2I A;  5F39 A;  5FY0 A;  2Q8D A;  4V2W A;  4TN7 A;  4BIS A;  2YBP A;  2XDV A;  5K4L A;  4QXC A;  5A7N A;  5A7Q A;  5IW0 A;  5FZI A;  5A3T A;  5FZ9 A;  5FY5 A;  5FZO B;  5FPB A;  5FZ7 A;  4DIQ A;  5FUP A;  5IVE A;  1VRB A;  5FYV A;  3KV5 A;  2XML A;  5FXV A;  5A3N A;  5FZM A;  5F3I A;  5CEH A;  3AL6 A;  3K2O A;  5A7P A;  3N9L A;  5FZC A;  3OPW A;  4URA A;  3K3O A;  3KV9 A;  4LIV A;  3NJY A;  3N9P A;  5F2W A;  4NUB A;  5FP4 A;  2OX0 A;  3KVA A;  2Q8C A;  4C8D A;  3UYJ A;  3N9M A;  4E4H A;  3RVH A;  5IVY A;  5FYY A;  5FZK A;  2GP3 A;  5IVV A;  4QWN A;  3AL5 A;  5FY7 A;  2WWU A;  5FZB A;  4CSW A;  3PUS A;  2P5B A;  4XDO A;  5FP3 A;  3KVB A;  3PUR A;  5A1L A;  2GP5 A;  4AI9 A;  5FJH A;  5ANQ A;  4Y33 A;  5FZD A;  5FZG A;  3PU8 A;  3LD8 A;  4BXF A;  3PUQ A;  5FJK A;  4BU2 A;  3LDB A;  3KV4 A;  4CCL A;  4D6R A;  4GAZ A;  2XXZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...