2YBSA

Jmjd2a complexed with s-2-hydroxyglutarate and histone h3k36me3 peptide (30-41)
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
348
structure length
348
Chain Sequence
LNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/peptide
molecule keywords LYSINE-SPECIFIC DEMETHYLASE 4A
publication title The oncometabolite 2-hydroxyglutarate inhibits histone lysine demethylases.
pubmed doi rcsb
source organism Homo sapiens
total genus 103
structure length 348
sequence length 348
chains with identical sequence B
ec nomenclature ec 1.14.11.-:
pdb deposition date 2011-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 2ybsA01
5FZKA 3UYJA 4QWNA 5F2SA 2YU2A 3PURA 5FY5A 3N9LA 5FYUA 4QXHA 4BU2A 3AVSA 5FYZA 5FZEA 2YBSA 5IVFA 5F37A 4EZ4A 2OT7A 5FYHA 5FZGA 5FZAA 5A7PA 3ZPOA 5FZFA 3N9OA 5FYCA 5A7NA 3NJYA 5A3NA 5FZBA 1VRBA 2Q8CA 5IVBA 3PTRB 5A3TA 5ISLA 5FZ8A 4URAA 5FZDA 3K3OA 4BISA 2Q8EA 4IGPA 5LWBA 5FP4A 4Y4RA 4CCLA 5LW9A 5FYBA 4LIVA 2OQ7A 5FZ0A 3KVAA 4IGOA 4QU1A 2W2IA 5FZ6A 5FPVA 4D6RA 4HONA 5FYVA 4GJYA 5FZLA 5FJHA 4E4HA 5FPUA 5IVJA 5LY1A 4EYUA 5FZHA 2Q8DA 3KV9A 3LDBA 4ASKA 5IVCA 4QXCA 4UF0B 4DIQA 3N9PA 4BXFA 5FP3A 3KV5A 5F3IA 5FJKA 5FPLA 5FY4A 5FZCA 4C8DA 5A7OA 5FZ9A 4GD4A 5A3PA 5A7WB 5IWFA 5FZOB 4CCKA 2GP3A 5FUNA 4DO0A 5F39A 2OQ6A 4V2WA 2WWJA 5FV3A 3AL5A 5FXWA 2YBKA 4AI9A 3AVRA 5E6HA 5FP9A 4GAZA 5FPBA 5FYIA 4HOOA 2PXJA 5ANQA 5FY1A 2XUEA 5F3GA 4QX8A 3N9QA 5F5CA 2VD7A 2WWUA 2XMLA 5FYMA 5F3EA 5A7SA 5IVEA 5F5IA 3K2OA 4CCMA 3K3NA 5FYSA 5FXXA 4QX7A 4XDPA 4TN7A 5CEHA 4CCNA 5FWJA 4AAPA 5A1LA 5FP7A 3N9MA 5FYTA 4LXLA 3ZLIA 5FZ7A 3U4SA 5F5AA 5FY9A 5FYYA 3PUAA 5FZIA 3OPTA 4Y33A 5FPAA 2GP5A 5FXZA 4GJZA 5FZMA 4EZHA 5A80A 5FZ3A 2XXZA 4QXBA 5FWEA 2YU1A 4XDOA 5FZ4A 3RVHA 5LY2A 4CCOA 3PDQA 5F2WA 3PU8A 3PUSA 2OX0A 3PUQA 3PU3A 4IGQA 4CSWA 5FUPA 2YPDA 4LIUA 3LD8A 5FZ1A 3U78A 5FXVA 3DXUA 5IVYA 4UF0A 5FY7A 2OS2A 4D6SA 5F32A 2P5BA 4V2VA 3KVBA 5A7WA 4LITA 5KR7A 5FZOA 5FP8A 5IVVA 3KV4A 3OPWA 2XDVA 5K4LA 5FY0A 5A3WA 5F3CA 5IW0A 3DXTA 4CUGA 4Y3OA 4D6QA 4NUBA 3KV6A 5FBJA 4CCJA 3N9NA 5A1FA 5FY8A 2YBPA 5A7QA 3AL6A
chains in the Genus database with same CATH superfamily
1QMJA 1OFSA 1W8FA 4RQPC 5F2SA 4FPYA 3AP6A 3BOPA 4JKLA 1MVEA 1W8HA 2D5HA 4LUMA 1RUC1 3KCXA 4OUSA 4AEDB 4U36A 3F2ZA 2JG9A 1I9RA 3KQ4B 5CKQA 4UOJA 4QKFA 4H55A 1JTZX 1W2UA 3UK9A 5A7PA 1IS6A 2JXAA 3WQ1A 1QJY2 1QDCA 2TEPA 2WLPA 1UYZA 4B4PA 3NJYA 1HXS1 2XR4A 1CAXB 1JMUB 1UIKA 1TZOA 1VPHA 4AFBA 2QCSB 1G8WA 1RHI2 2BJSA 1PO22 2QQOA 5T5OA 4AW7A 5A3UA 2E51A 2IXLA 4UFHA 2W46A 4X8PA 4E4SA 3M8LA 4WVWA 1MPXA 5FPXA 5JXGA 4XFAA 4MVTA 2A3XA 3D0JA 1BJQA 4L2NA 3W58A 4YZ1A 2PLV3 4HLTA 1JZ8A 1STMA 2UY8A 4JGYA 5E89A 3D82A 4K7JA 2RS12 5GLZA 3ZYJB 1LGBA 2WT1A 3C7FA 4OHWA 1PZ8A 1WLCA 4Q4W1 2F4LA 4XCBA 3LAGA 4KGGA 1RUH2 1W6OA 2GC2A 2JX9A 3H8RA 5ACA2 3K4ZA 4UF0B 1GFF2 3N9PA 4DIQA 1X33A 5LASA 4C8DA 1TMF2 2ZX3A 3OG2A 1ASJ1 1JHNA 1GQGA 3J7NA 1F5JA 4XMAA 4XJ8A 1ZZBA 2QQJA 3T3YA 1SFPA 2QZ2A 3O5SA 5FDBA 3O1TA 2OQ6A 2R043 1SZBA 1NKGA 1ND2A 5E6HA 5FP9A 3V56A 3RWKX 4XMIA 2MEV1 1VBD3 2OIIA 3BYWA 3QBQA 3ZXDA 1OPOA 3B94A 2R062 2WO1A 4GWJA 1HQLA 4OQ9A 3PHMA 2WR9A 2XJUA 3MLJA 2ZPXA 4CCMA 2BDRA 3K46A 2W1WA 4JQRA 3WDTA 1BKZA 1YO8A 4DUVA 4M3CA 1GSLA 4QHZA 5FYTA 3VKLA 2ORZA 2XVGA 2FDJA 1AXZA 1OQ1A 1Y9GA 1Z7S3 2BWCA 2WDBA 3LSDA 3MGUA 4MXWB 4Q29A 4AQ6A 2JKBA 4GJZA 4QXBA 3WG4A 1BHGA 1VRH3 3AP4A 1ZBE2 4NRQA 1GR3A 3BVCA 2Y6HA 3ZR5A 4OVEA 3PLQA 3KB5A 5KC5A 4IXLA 2JJ6A 3C3VA 2JG9B 3GYDA 4Q0PA 4CVUA 2IXHA 4RHV1 2CGOA 3CIHA 1K42A 1NY71 1ODMA 3FWEA 3BGAA 1YQ2A 4LKEA 1AVBA 2D6LX 2FDGA 4YLZA 4CEYB 1K5JA 1ZA4A 2XHNA 2NP0A 1BBT2 3AMHA 5HPOA 4YVSA 3KLSA 4CCJA 4TTGA 1QQP1 4K8FA 5FKCA 3E6DA 4O65A 5FLIA 2HWC2 3AYCA 3HT2A 4IE7A 1XQNA 5FYUA 1H30A 4FOYA 3ON7A 2JIJA 2GH2A 5JMCA 3RZKA 4FCAA 2DUOA 4D69A 2XWBB 1WZXA 3LFMA 1WWYA 1W6OB 3JZVA 5BNQA 3FUOA 2Q1ZB 4NOTA 4PT6A 1DCSA 1ZM1A 3DPRC 1WD4A 1VMJA 3ZFGB 3WG1A 2ETEA 1ACCA 3CJIA 1GWKA 4AI2A 1N1YA 5KHKA 4JHZA 4XAEA 2FQPA 1DGRA 5GM0A 4AWDA 3LEKA 2P2KA 1T2XA 3KVAA 1G9FA 1QJY3 4N53A 1A34A 4LHSA 3E97A 1NLSA 1MS0A 1FNZA 1U5YA 3CKHA 5AFBA 3WLUA 1RHI3 1O3RA 1MZ5A 4L11A 1S2KA 3WINE 5A6ZA 3CZJA 4IV3A 2RM23 1W8UA 1FYUA 3AP9A 2EF6A 2JB8A 4N7IA 2EIBA 1G9AA 2AH2A 2BGCA 4JAAA 1TME2 3LZZA 5FZ9A 1HQWA 2HYKA 1QXPA 5LBBA 3VBRC 2ZHMA 5CFCB 2RDNA 1A3KA 3I3EA 2KD7A 1O4YA 3MIEA 1REEA 4YW6A 2CSGA 3J7MA 3VHOA 3ZFEB 2RS13 4ZY9A 1H1IA 4COUA 3FN9A 5T3NA 1RUH3 1WW7A 3HN3A 1V00A 2ZAAA 4QPGA 5ACA3 1ONAA 4AGGA 1SBFA 5D1IA 5I8YA 5ANQA 1TMF3 3MICA 4YNIA 5GZEA 4FPEA 4COZA 1GP6A 3H42B 4C1WA 3E5XA 1LCLA 1TE1B 2WN3A 3O1OA 5GKAC 3FFQA 4A6SA 2G9GA 2GMPA 1X82A 1A8DA 1ZNPA 2ZABA 1DQ0A 1F4HA 1W2NA 5FMOL 5EYYA 3K51A 3VBOC 2B42B 1W6PB 2ZMNA 1NA1C 2EAKA 1WMFA 2ZA9A 4CZSA 1ZRFA 5C4WC 1V70A 3LCPA 2DCTA 1S0CA 5F5AA 4DEVA 1LTEA 1U12A 1U5IA 2HWF1 5FYYA 3PUAA 2R063 3OPTA 4ATFA 4Q8KA 2V73A 2WZEA 3OGRA 2BGPA 3GZEA 5A80A 1RUI2 4CCOA 4DRVA 5FZ4A 2WINB 1OA4A 4I0AA 5KXCA 4YVSB 3DECA 4V1PA 3MPPG 4EN0A 2JKXA 2QQWA 3PUSA 2B8MA 2R1BA 2K2SA 2YFUA 5CFDA 3ZXLA 1KXGA 1XE0A 4P9JA 3FC0A 2VMCA 5J09A 5FZ1A 4DS0A 5IT6A 1NCRA 1E5HA 3O1RA 2DCZA 1R1A1 2KA3A 4UXAA 4WM7A 4AL9A 2BVBA 2IZWA 4V2VA 4CEWA 2FDHA 2D43A 2E53A 2XLGA 4OHZA 4QB6A 2VBPA 1RXFA 1ZBE3 3IDBB 1WBLA 4DUWA 2XDVA 3JD71 3LPGA 3H9AA 4DXTA 2P3IA 2UU8A 3O7OA 4Z8BA 4S2GA 1RC6A 3O0WA 3WQ0A 4MGTA 2X53S 1Y4WA 2A1XA 4E2SA 5AVAA 4UFLA 5IK4A 2ADEA 3ALQA 1RVF1 3PIJA 4OULA 2ADDA 4WZFA 1XSQA 5A3MA 3RZJA 4BU2A 1H1MA 2YMZA 2VMHA 4N53B 4D8MA 2G1MA 3FBMA 3J4UH 1KGYA 2WWSA 3U11A 4E2GA 3MLKA 4EZ4A 3PMSA 3F95A 3X29B 1UKRA 5LK7B 1BBT3 2P3YA 3KCYA 1BEV2 2JB4A 2VULA 5ANNA 5AFEA 4Y1YA 1AR91 5EQUA 1QIQA 4XFIA 5AC93 1FMD2 2HWC3 3QH6A 3AXEA 4FP2A 4DRRA 3RI8A 2OKXA 4XJAA 5FZDA 1ENSA 3SQOA 4URAA 5K8SA 1O3QA 1CIYA 3MF9A 1E57A 4CDQC 1ULFA 4AGRA 3VN4A 1IKQA 4B7EA 4Y1VA 5FYBA 2C24A 4K1YA 4XOGA 1NCQB 3T30A 3UL2A 3VBSC 1Y7BA 3NW4A 3FBYA 1W04A 3T4VA 4FTEA 4S2DA 5DG1A 2PHXA 5FPVA 4QPGB 2FCUA 1RB8G 5JVVA 1EPWA 3USUA 5DMYA 2CGNA 4L0PA 3ACIA 1UU6A 4WVMB 2XLFA 3CDZB 1BYHA 1LODA 1TNRA 1V0AA 1CAWA 2Y6LA 3HN1A 3KV9A 2DVBA 4AI1A 5EIYB 1CQ9A 1DYPA 4Q2FA 5I91A 3NAPB 2RJLA 5F3IA 1Q56A 1UMIA 2RMU1 1AYN2 4CU8A 1O8PA 5LZ6A 4MXVA 4YZ5A 4A41A 1A8MA 3HQRA 4SLIA 5FCCA 4Y20A 3DGTA 3VDAA 2VR4A 2YHJA 4XQWA 2ZMLA 5F39A 3G6JB 3PVNA 3VBHA 3PUIA 4S2HA 4BXSV 1NOVA 5FR3A 2D93A 3OUHA 3TEYA 5CU1A 1VBC2 2UWBA 3VV1A 1TME3 3FHAA 5C3RA 1V9U1 2I07B 2NLRA 2JE8A 3S5QA 2XMLA 5CFDB 2CWMA 1GNHA 4LK6A 4LKDA 4WM8A 4YW4A 2VOWA 2YPJA 2OYZA 1OUXA 1NCRB 3FZ3A 4Y26A 3VBFA 1W0NA 3CZUA 3NWKA 4WM7B 5FP7A 2WYFA 4GQ7A 4XF0A 3RDIA 1GWMA 2FMYA 4Y1ZA 4L8QA 1T6GC 4Y5SA 2YC0A 2Y38A 3NV4A 4X8NA 5FZIA 5ERLA 1MEC1 3M3CA 1W8NA 3GALA 2OVUA 3BTXA 3TEWA 1GUIA 1GZWA 3D5OA 5BNNC 3RZMA 5A70A 2GMEA 3OY8B 2WZR1 2P6CA 4QDSA 1NZIA 3ZMOA 1XE8A 1LESA 1COV2 2VG9A 3H1MA 3VKFC 4CSWA 2JIGA 1GZCA 1QGLA 3A0NA 1YLLA 1FATA 4XUPA 2QE3A 4BLIA 1NT0A 1RUC2 4LEJA 4CDWC 2ZZJA 4K21A 2F6BA 2QKDA 5T5LA 2PHLA 3RRDA 2H0VA 2RJ2A 1D4M3 1GMMA 2BTVC 1UPSA 1UQXA 4NUBA 2YB7A 4OZXA 2VTXA 2YBPA 4HG6B 2Z2SB 3KF5A 5LA0A 5A1AA 1RMU1 4UFMA 4AE2A 5BNPA 3ACGA 5DN2A 2JDHA 1LOFC 4UW4A 2P37A 4PCRA 4C0BA 4LE3A 3USUB 4Z92B 5E1RA 5HCBA 2CAVA 1UX6A 4HN0A 4B4QA 5A6XA 3ZPOA 1JYNA 1XNTA 2JDPA 3LQCA 2WNUA 4Q4W2 1OQDA 4IV1A 4XJ9A 4GKYA 5FZBA 4ZXEA 1LU2A 2WNVC 3GBGA 3W21A 1OD5A 3Q8CA 1AYM1 4HPKA 4QQPA 5FLJA 5EP9A 3BPZA 3V65A 3MUY1 4LBQA 4BZ4A 1U0AA 4IGPA 2VZTA 4W65A 3O1SA 1UZYA 1ASJ2 1JUIA 1XU1A 2VW2A 3BN6A 3RYPA 2GNTA 1ZRRA 2CU5A 4Y20B 1OKOA 3ZXEA 2YY1A 4J25A 4RGKA 1BEV3 2GNDA 3U1XA 1SLTA 2VZPA 1IG0A 3VBHB 4OQ8A 4LO4B 3GBFA 2DFBA 2EIEA 2PHFA 3EO6A 5FYVA 4W8JA 1AR71 3HT1A 1QH6A 1POV3 3UGFA 2MEV2 1MZ6A 2AZ5A 1CJPA 4NMIA 3FLRA 2E33A 2WRAA 4GA9A 2GMMA 2X8KA 4WM8B 4XEZA 4ZKTB 3ZDVA 5C8CC 2NN8A 3BTYA 2Q1FA 5FP3A 5FY4A 5FRAA 2JDYA 5FZCA 3UKNA 2W94A 1CAUA 2BNNA 3GNEA 3H1WA 4JX0A 5A7WB 4PDWA 3VZNA 4FAGA 5JXJA 2XGXA 4IEPA 1JZ2A 5FUNA 2ZEYA 3LA3A 4AVSA 3ITQA 3NSTA 4COYA 3UV9A 4CDUC 4AVAA 1GZ9A 1V6NA 2WN2A 4Y1UA 1O7FA 2E9QA 1JHJA 1W28A 1GZWB 1J83A 1H6XA 3C2UA 4I3PA 3TB0A 3POGA 5BNOC 4Z07A 1AYN3 1SLBA 2VTFA 1X7NA 1F8VA 1QEXA 2D3PA 1K5MA 3BIEA 1QJU1 2XPJA 3T0BA 3WG2A 3PIGA 4O9GA 1KQRA 2TBVA 3AKTA 5B2GB 1O3SA 4Q27A 3MHZA 4YZ3A 2HBUA 2KXLA 1VBC3 4RHV2 1D4VB 1LKNA 1LEMA 3WZ1A 5C71A 5FUIA 4DXRA 2P6HA 4AF9A 4LHNA 1X8EA 4GH4B 3WF3A 4KI5M 3WF4A 2Z5WA 3O1VA 4GULA 2R7EB 2B4KA 2HH9A 1UPIA 4IGQA 5DZFA 5J98B 1QQP2 2VZ1A 1RJ7A 1CD3G 2GC1A 1W8WA 3ATGA 4HMZA 4PI2A 5CIRA 5BNPB 3WNXA 1KJRA 1WCDJ 2VUCA 4LIUA 2XLAA 1B35C 1Q8QA 5A33A 5FXVA 3OEBA 4Q4V1 2O8QA 1UWWA 4D6SA 2WNOA 2QQMA 4GWIA 1BCXA 1SLLA 1MZEA 2P5BA 5FKBA 3E6CC 3OBTA 1AJKA 2YC4A 4QQ2A 1YIFA 2WNUB 5H9SA 4LBQD 1COV3 2RS31 4I0BA 2GN7A 4EROA 4DPNA 2FCVA 4P9WA 5CA6A 1GWLA 4QXKA 5M0TA 4O61A 4BQYA 4BQ5A 2PQQA 3N9NA 5SV5A 1FI2A 3ZN5A 3NO8A 4BDVB 4F3JA 4F8AA 3WP6A 1RUC3 2DU0A 2BNMA 1JI6A 1GLHA 2VE1A 3I2HA 3LGRA 3SH5A 1K45A 2D97A 1OUSA 1SBEA 1LHUA 3S30A 1JBCA 1OVPA 4S2FA 3PNAA 5EYXA 5GALA 1YUDA 4IEWA 1NE6A 2IXCA 2EXIA 5FYHA 4H3WA 1DGWA 1HXS3 1QOOA 1S0GA 2XBO1 4KL1A 1WW4A 2VXRA 3NKGA 5APAA 5FZGA 4BIOA 1QJX2 1AX1A 1A6CA 3IAQA 4AVCA 1EV11 5IVBA 4FOWA 1D2SA 2FCTA 4A7ZA 1JYIA 4AI8A 4ZU5A 3ZYFA 3M7AA 2WJSA 1CAUB 2ZKLA 3AYEA 1W6MA 3KS7A 2A6WA 2EXHA 1CR7A 4XF1A 1AF9A 1PGW1 2ZHLA 5CADA 1OI6A 1MR5A 1PVXA 1V6OA 5FZ6A 4R9CA 2CDOA 3WHUA 4Q4W3 2UYBA 1KS5A 1ODNA 2JDAA 4P00B 3ZFFA 1N1TA 4GB31 2VMEA 1W8ZA 5FPUA 4I09A 4B1LA 5IVJA 2ZEZA 2VH9A 4RS5C 4W6XA 3WT3A 4CXYA 4UW5A 1ASJ3 1EY2A 1OF4A 1YFXA 1ND3C 1XYNA 5HBAA 3MV11 2W1SA 5L36A 5CNAA 5FPLA 4W6YA 3POIA 3WDUA 1YYNA 4FVVA 4KH9A 2ZEWA 2O0OA 4Q4Y1 1OMIA 1QNWA 2JDMA 2XL9A 3TBDA 1LEDA 2MEV3 1PMHX 3D4KA 2XKOA 1IPSA 2WFF1 3ZM8A 2HWF2 4B7KA 1JH5A 2LRPA 2WT0A 1YQ6A 1RITA 2PHDA 2PXJA 2D6KA 2XB6C 2RS51 4F7ZA 2CDPA 4QDQA 3M3OA 1S0IA 2C9AA 4W6WA 4YGEA 2D98A 5CG9A 4CU6A 4QPIA 4K9SA 5F5IA 5FXXA 1H2NA 1EP0A 1XBFA 3MZHA 4EWEA 5JSPA 1C1LA 1ZBA1 2D6NA 2WQZC 4NAMA 4CCNA 1RUD1 3OCPA 4EV0A 2VZ3A 5FWJA 3Q8AA 1CAXA 4PF5A 5CKMA 5FZ7A 1UYYA 3WDXA 2C9KA 3BB6A 3T0DA 1YXWA 4AVBA 4WVZA 4ZPIA 5FZMA 1EUTA 3SLIA 3HNYM 1OC1A 4C0HA 3JD72 3DN7A 1G86A 1XOYA 1PNGA 2VC9A 2ZGUA 3KT7A 3ZN4A 1DQ2A 2D6PA 4NN0A 3AZZA 1Q5OA 4P5YA 4XF3A 3ZSLA 4RHV3 3WDVA 4BCUA 3VLBB 4ET7A 1RVF2 2W95A 3LD8A 4XBLA 2YV8A 1ZA7A 2B9UA 4RGGA 2ES3A 5DABA 1GOFA 1H2KA 4KG0A 4UF0A 1ZRCA 4ZONA 3U14A 1H4GA 3OOXA 3WNPA 1DLLA 2IXJA 1D0GA 4XACA 5C9AC 1G9BA 2H6BA 3LB9A 3OPWA 4I3GA 1DF0A 1QQP3 1AR92 2A6VA 2VMDA 1ENQA 1GANA 2Z42A 2ZKNA 4K1ZA 2A71A 2P17A 3LWCA 4WV8A 5FTTC 1W6MB 4RN5A 4ES8A 4P9XA 2DU1A 1YFWA 2X5IC 3KM5A 2VECA 2VUAA 3WW4A 2AYHA 5C6CA 4MX3A 1KDMA 1WCSA 5FY5A 4BQ4A 3QCWA 3MEPA 4RSUA 5C5UA 1UZ0A 4DB5A 3FFZA 5IVFA 4K20A 3ZFFB 4OHYA 3IAPA 4E27A 2GC0A 1SQ4A 1LECA 2WIIB 2G9ZA 2JECA 4IEYA 1HW5A 1ULGA 4KWJA 3AYAA 3I54A 3LOBA 1LHNA 2DCYA 2WLQA 3OPZA 4OZOA 3VHRA 5JZGA 4QKDA 2OPWA 4R9DA 3VBUB 1XXNA 5JOZA 1LENA 4UW3A 4TYSA 4C1XA 3LA7A 4QKNA 2V5DA 2RMU2 2GN3A 4M00A 4LIVA 4OI4A 4JDMA 1QH7A 2ZXQA 5F1RA 3RZZA 4RD7A 5JOYA 1N1VA 1OH4A 3IBMA 1F15A 2VNVA 1UAIA 1H8TB 2PHTA 2XUMA 3POYA 4FOQA 4NWWA 1X9PA 5FJHA 3PVEA 2WKKA 3T08A 3I2DA 5BY5A 1I5ZA 3R05A 4QPIB 1UY2A 1LHVA 1V9U2 1KJLA 1DG6A 4QXCA 5C3QA 4BXFA 1IPJA 1TNFA 1CPNA 1UN1A 4FAHA 3VDDC 3P3NA 1POQA 3UGGA 4AI3A 4CEYA 2W1UA 3B93A 3THTA 3C8XA 1MQTC 4RQPB 5L19A 2FD8A 2ARXA 1O4ZA 2BERA 2RM22 4XUNA 2PYTA 5F9TA 1RYYA 3TN91 4HKOA 5J7MA 4LA3A 4YW5A 2PA7A 1WA4A 2XUEA 3DKQA 4FPGA 3S0MA 2Y60A 3BALA 3N9QA 2YYOA 1UY0A 2DVGA 2RR11 4H7MA 5JSRA 3K48A 4XBNA 1W0OA 2OUJA 3ST7A 4O9EA 2LTNA 2VQAA 4YM0A 1JYXA 3UJOA 3WNOA 3EXUA 3HBZA 2HWB1 2HWF3 3CQOA 3OBRA 4BOWA 4OFGA 1BZWA 4URTA 3WUDA 4DOUA 3V64A 1T6BX 2W1QA 1QF3A 3FJSA 1R081 1HB4A 3AZXA 4NHYA 5DAVA 3ZFGA 3DL3A 4Y33A 4LMFA 3NNLA 2H6CA 1OLMA 4P9IA 1Q8VA 2AACA 5FAXA 3JUUA 3GJBA 2XKPA 3AKPA 3CF6E 2O8OA 2YUEA 4XHXA 4YWAA 1PMJX 2B46X 4CRQA 1R1A3 3VL8A 2QFEA 1RMU2 3MW4A 5KXDA 3WP3A 1NG0A 2LW8A 3FLTA 5LA2A 1F9KA 3AZWA 4FQ4A 1RIRA 3WX5A 4HK9A 3JD73 1CPMA 4YRDA 5CFCA 1W0PA 3KT4A 1UX7A 1DZQA 3T2TA 4OI1A 3V0AA 3ZFEA 2ZBJA 4A2UA 5KHHA 1KEXA 3EB7A 1GQPA 5KXEA 3MUZ1 2JG8C 1DQ4A 2JD4A 3I2JA 4D6QA 1RVF3 4DXZA 3KV6A 2PHRA 1F5FA 2NPIA 1AYM2 5E16A 1ULOA 4QX3A 5I8TA 3WNLA 1W3XA 5DUUA 5KC6A 1CJDA 5HXMA 4HSJA 3EBRA 4LK7A 1JZ7A 3BU0A 2OXBA 3AZYA 5A6QA 1OA2A 3MF6A 4CCEA 2MNGA 5HV4A 4LNVA 1ZREA 3MFCA 4YG0A 4KU8A 1AR93 4XDQA 3BODA 2VJXA 3L9JT 4FOVA 4E9KA 1X50A 3IMMA 4HSLA 4QKBA 4QDRA 4XZPA 2Z69A 1DBNA 1AR72 2R071 1W6PA 5FZFA 4XXAA 3SCHA 3BCWA 2DWRA 3ACFA 4JRLA 4BYYA 1IPKA 5I0TA 2VMGA 3NJXA 4N9HA 4FTBA 3K3OA 4E8CA 1DGRN 3MIFA 4UFJA 5FO8B 2FHRA 2W91A 4N90A 4YZ4A 2XVLA 2BFUL 3ZDSA 4PIYA 2PMWB 3T09A 5LW9A 1C8M1 2HJIA 2VZOA 1DYOA 4WBBA 1DGWX 5JIAA 4MYEA 2P3JA 4P9LA 1QOTA 4HVRA 4A45A 1AR61 3IZOA 5AC92 5LBEA 3VBOA 5CKNA 3N3HA 4JTOA 5J36A 1GKBA 1GICA 1NA1A 1SDWA 4IERA 5FZLA 5A3LA 4CE8A 2B45X 1QHDA 5D2AA 1REDA 1ZRIA 3PVOA 2RMU3 3NQHA 3P3PA 3W59A 5IVCA 2JD9A 2V5YA 3TYJA 1IQDC 3PMEA 3WHTA 2BOIA 1QJU2 1LJ7A 4JGYC 5B4XA 1XNKA 1IQAA 5KHIA 4FP3A 4KGQA 3DYOA 3HOBA 1XNCA 1SDDB 2VY0A 1E5IA 2O14A 4F83A 2EA7A 1FAYA 1V9U3 1R64A 1U5ZA 4GMP0 1E5RA 4HT1T 2DBNA 4P14A 5IFTA 5CYYA 3KSCA 4YG6A 4D7SA 4Y22A 1DHKB 1N3QA 1ND2C 1VMHA 1YI9A 4LOTA 3PL0A 3K2OA 3SNMA 2CTVA 4MLOA 4FPLA 1C8NA 4BWOA 2SBAA 3EMRA 3TOJA 4YFZA 3DPRB 4GMP1 1GZTA 1HRV1 1W8OA 4COWA 4CYDA 4OCTA 2DVDA 1MEC3 2UWCA 3VGIA 4Q4V2 1N3PA 2BYVE 3GZUC 4XJZA 5L9BA 3VHNA 1OQEA 3WQBA 1ULEA 3U10A 2EIDA 2Q30A 3V0AB 1VB4A 2NQYA 1NCQA 2WZR3 1J3PA 3M3IA 2YU1A 4XDOA 2RS32 4PLMA 4YVWC 1UZWA 3WP4A 4Y4YA 3QACA 2VGDA 3HNBM 2R0FA 5H9PA 3W5NA 1QNYA 3PU3A 3WCSA 2ARBA 4AEKA 3H8OA 1UZVA 3E5QA 5C3SA 4IL7A 4YGBA 1ST8A 4WVMA 5LBFA 3IKWA 1JOBA 2GZWA 1NUKA 1ZZ9A 2Q8OA 3VBRB 3ENRA 1NYWA 3VD7A 4JZRA 4CDQA 1WLTA 3NAPA 4IDZA 1W8TA 3VBSA 2GDFA 2V09A 3H0OA 4RR3C 5KR7A 2AEZA 2J1VA 2XBO2 4XURA 1NLQA 4DZGA 2GH8A 4EJRA 1RMU3 2W68A 1W9SA 3W20A 1OFNA 1SLCA 2VZRA 3SH4A 1W2OA 2RVAA 2LM3A 4XW3A 5FZKA 4OI0A 1Y43B 2BFUS 2C26A 1BQPA 1PGW2 3A22A 3C7EA 1IS4A 3JBG1 3MLLA 1D4M2 3DYMA 1I6XA 5FLHA 3KF3A 4YVSC 3VBOB 5DUVA 4AOCA 5IK5A 3K75B 3RZGA 1W2TA 5CB7A 1NA1B 2P1BA 1L7RA 5C4WB 3O1PA 2DCJA 2VBDA 4GB32 2WO3A 4PQQA 3JB4C 1DIWA 1US3A 4IW3A 2NM1A 1AYM3 1RUF1 3IIIA 4QX5A 4EWDA 5L7OC 1HJFA 5I93A 1VRBA 3RYKA 1QJFA 4JCKA 2ZGSA 4GWMA 1IHMA 2J1TA 2OZJA 4AHWA 5LCWL 2W52A 4PLNA 1X9TA 2YC2A 1QOSA 1UU4A 3HPNA 3IPVA 3SCGA 4A44A 4W4ZA 2D5FA 3IN9A 1NLRA 1Q8SA 3GCXA 1FPN1 3OY8A 4MGQA 1AR73 2ZX0A 4AHYA 4B29A 2KM2A 3CJIC 4FFGA 1NE4A 2WFF2 1PGL1 1LU1A 1FX5A 2W08A 2VZSA 3SMHA 1X36A 2UY9A 1JZ5A 1WGPA 1S0FA 4XJWA 4Y22B 2RS52 4N53C 5B4NA 4HFSA 2EXKA 1F31A 4IESA 3O14A 4B1MA 1JYCA 3KV5A 4IEZA 2JDUA 2AGSA 1WA6X 4RFT0 1MVQA 2IFWA 4XTPA 5LEJA 1H8VA 4ZZ5A 3B69A 1YWKA 1LGNA 1ZBA2 2J22A 4IV3C 4AR2A 1RUD2 5I0DA 2Y26A 2ZGQA 5LA9A 3KCCA 5FMBA 4R4ZA 1KFUL 3KGLA 1JYWA 3RS6A 3SCFA 2Y6FA 5JDBA 1AXYA 3M4FA 4XILA 4XPVA 3UKTA 3RZLA 1QJU3 4B8EA 3CHXA 2XONA 3ACHA 3ZSJA 1HLCA 5LRSA 4INDA 4AZZA 2XJTA 4QHBA 1UF2C 2B39A 5A7SA 3WP5A 3IWZA 4CUAA 5LK5A 3BKZA 4N8MA 5IHRA 4XXPA 1FV2A 1TQ5A 2Y64A 5FK8A 1O91A 1FV3A 3N4MA 1Q43A 3NNFA 1XRUA 4CDQB 5A1LA 1LOBA 3VD5A 3VBSB 3LSEA 4HBNA 4NRPA 2XQRA 1Q8OA 2FZ1A 4ZS3A 1PK6C 3A23A 5FMOS 1ULDA 1G9DA 4PIXA 1LOFA 3HQXA 2VU9A 3BTZA 1MS8A 4I2OA 3T1LA 3BI3A 2DVAA 4ARYA 3CLPA 5DPNA 1FOD1 2E31A 2DVFA 1PX4A 1M4WA 3IB3A 3CMGA 1CX4A 4LUKA 4Q4V3 5FUPA 3R4UA 1DU3D 1ULCA 2J1AA 1YRZA 3VZOA 4FPFA 4OLLA 1HV1A 3C7HA 1RUG1 3CL1A 2W0XA 2XVKA 4HKLA 2VVDA 1C28A 3DXUA 1OOPC 3ORJA 4A4AA 3EHKA 1W6QB 2RS33 5F32A 3J8F1 4ONUA 2VZUA 4KWKA 1DLCA 2YXSA 3D3AA 3HD8B 5A7WA 3THPA 3OBAA 3KV4A 1NCRC 1CVNA 4Q4X1 4Q0SA 5F3CA 5IW0A 1BMV1 2ZACA 4CUGA 4DEQA 4CEWC 4FT8A 3KMHA 5EZWA 2BVVA 1EYBA 4DMIA 3IPVB 5JR2A 4EN8B 4KBBA 3S57A 5BXXA 2H0BA 5C8CA 5A32B 1WW5A 2XBO3 4J1XA 3B9CA 5F37A 3NNJA 3OYWA 1EV13 5FZAA 1AL0G 2BUKA 3CEWA 3I59A 3DF0A 3WG3A 4CDUA 2YFZA 2CHHA 2HWD1 3PTRB 4JDNA 4LHKA 5JI7A 4NIDA 5FZ8A 2XH6A 4IEUA 1JOJA 5BNOA 4MGYE 3DKWA 5BNNB 1JOPA 1N47A 1MS1A 2ENRA 1LRHA 3MIBA 3M3QA 3WW1A 2Y34A 2V4VA 1HXS2 5GLWA 1VBA1 4GH4A 4NHKA 2V4AA 3Q9OA 5I8SA 1HRI1 5BV6A 4GB33 1BLZA 1KDKA 4FPHA 3GHMA 1HB2A 3BTAA 2PN5A 4CDWB 4LQRA 3HNMA 2AENA 1XSRA 1WMXA 1D0HA 3TN92 1DZRA 2FZ2A 1JZ4A 5FFOC 5FZHA 3KD4A 4ASKA 2ATFA 4NRMA 4Q0QA 2RR12 4Q4Y3 4NROA 2XHKA 4FPCA 3LF7A 5A7OA 4XQ4A 2VNRA 2WFF3 2HWB2 4JC1A 4JV4A 4LPLA 1ENRA 3H8UA 3FHIB 4CCDA 1AHSA 3DUIA 3FUQA 2RS53 4XUTA 1R082 1H1AA 1PZ7A 1B35A 3EQEA 4JGZA 5IK7A 5GLVA 1Y3TA 2VL4A 2E6VA 4U2AA 5KHJA 4I01A 2VM9A 4XZUG 2VCCA 3ZSMA 1VBE1 5IVEA 1ZBA3 2E7QA 3U4XA 1RUD3 3W9AA 1XYOA 4HANA 4XDPA 4XHBA 3NL1A 3ZSKA 5EV7A 1FT9A 4AAPA 2WABA 2ZTNA 2VTXJ 2BEOA 2PAMA 3VB9A 3AJYA 2PHWA 2DV9A 2F4PA 1WLWA 1LNSA 3T2QA 2QDNA 3VBFC 2W87A 3AP5A 1QWRA 2HWE1 4EQVA 1AX0A 2NZ9A 1RUE1 2WZ8A 2R49A 3QLQA 4AFAA 2BPA2 1D2QA 3POWA 5DQ0A 1VAVA 1EAH1 2RHPA 1SHWB 4CP2A 5C8CB 2ZGPA 5FPZA 3ZPYA 3G7DA 3I2FA 1PIV1 2XJSA 3OYWB 1VJ2A 3RYRA 4GZ9A 3N36A 3THCA 4QX2A 3TWIA 1P8JA 4N43C 4A3ZA 2KR2A 5C33A 3I59B 5IVVA 4CDUB 1YQ5A 1YCIA 2R072 4L92A 3QOPA 4YM1A 5FY0A 4DNYA 5C3PA 4LO7A 3IDAA 1W06A 4LOSA 1R1ZA 3SH3A 5BNOB 1NY72 1GP4A 2VOKA 3W5MA 5FOBB 5CISA 1W6NA 1QY4A 4RS5A 1XNBA 2GNBA 3SC7X 3N35A 4M0HA 4UWDA 5T5JA 1ND3A 4KMQA 2VO5A 3T2PA 1C8M2 4UI9L 4NE9A 4CTEA 2Y0IA 4AAXA 2RE9A 1AZDA 4XYXA 3TAYA 5FMDA 1MS9A 2NYYA 1OURA 4YPJA 2VVFA 2ET7A 1C5HA 4EN6B 5C7GA 1AR62 2OT7A 1BVVA 1MZFA 1AL21 2VMIA 3K4DA 4FTSA 2ILMA 2CL2A 3A4UA 4HVQA 4TSVA 3WDWA 5ABJC 3LDKA 4YM2A 2J7MA 3LA2A 1SFNA 5LA1A 3R4DB 4IEXA 3KWVA 1OT5A 3DYPA 3VL9A 4IV1C 1VE0A 3S5AA 1NQJA 5GZFA 5L9VA 5C70A 1C3HA 4KNCA 4CDXA 2IC1A 4OUMA 1B35B 3WV6A 3PVBB 4JGZB 2YG0A 1AR81 5IYYA 4TWTA 1SLAA 5E88A 4LJHA 2BNOA 1IS3A 2VQUA 1WMDA 1JU4A 1DYKA 2PELA 4P9YA 2WNEA 3Q8EA 4TLGA 4AG4A 4MH0E 5K0UC 1KS4A 5E8AA 1OLQA 2RDSA 1HRV2 4PLOA 3THDA 2VOXA 2EXJA 3TN93 4K8RB 2YROA 4YW2A 2WWJA 4R4XA 4BQ1A 1OHFA 4PDWC 2A6YA 2ZS6B 3LIHA 3DCQA 5EPAA 5L9RA 2RR13 1XU2A 3CO2A 2WZPP 1H0BA 1VALA 2GSYA 4GWNA 4JKKA 5C9AA 3WY6A 4QX1A 1MS3A 4XF4A 4GALA 2HWB3 2FDKA 4IE6A 4H7LA 5FYSA 2ET1A 2WC2A 5I0UA 3POSA 5BPXA 1NAEA 3OUJA 4FFIA 4RFRB 3SHRA 4QQHA 4IE0A 2IXIA 1R083 1JZ3A 2DTWA 2WSVA 2X5IA 1K5MC 4EN9B 5C3OA 4UFIA 3VBUA 4DFSA 3U4SA 3ACLA 1GQHA 2K9ZA 3R6SA 2VZQA 4LBNA 5FK7A 5HV0A 4M3CE 3DEMA 3PDQA 5JPNB 3PU8A 3ZKUA 2MPFA 1W6NB 1LOEA 4RS5B 1H6YA 1H8TA 2BOJA 2DYCA 2OZ6A 3GXUA 3J7LA 2L9LA 4HKWA 4I30A 4Q26A 3WCRA 1ND3B 4L97A 1DQ6A 1CZSA 4P5HA 4RYDA 2DUPA 3VUOA 4YGCA 4BHPA 4NHMA 5LEKA 2DBIA 3JBG2 4BLJA 4XUQA 1JS9A 1LOAA 3E5UA 2XJQA 4ES9A 4R9BA 5JLVA 1S0JA 3RZHA 3I2KA 1XNDA 1Q3EA 2BBAA 5AVPA 1OD3A 4FXKB 3T2OA 4CP1A 2Y33A 1O5UA 2I2SA 2V72A 2XQXA 4H2AA 4CP0A 1UY1A 2X09A 5I0SA 1R1A2 4CP9A 3N7JA 4PHZA 4RQPA 1RUF2 4QX0A 5K4LA 5FO7B 3VHPA 1PVC1 2AREA 3P6BA 1SFYA 2TUNA 4META 5A1FA 1L7LA 2WBKA 3WD5A 3AL6A 1V6KA 1CAVA 1LAJA 1OF3A 5TSWA 1UYPA 2YU2A 2ZGKA 4SBVA 3GDBA 4CDXB 3ROUA 3ZXFA 1YFYA 1PO11 2C5DA 3AVSA 5FZEA 3ZYRA 2R073 1FMD1 2FDFA 2WS91 2MHFA 4AQSA 3ZXJA 3I3MA 5KHGA 1MQTA 1PGL2 3E1F1 2G19A 2A3WA 5A7NA 2CV6A 1IOAA 4BK5A 2B5HA 4YG3A 1BK0A 3WNNA 3WNMA 1REFA 1C8M3 4P08A 5JR7B 3RJ2X 3ZYPA 3ECQA 4W50A 4XBQA 1K12A 5F7UA 2ORXA 5JUVA 3ZXGA 1XE7A 5EJ3A 5FP4A 1AR63 3EJKA 5JPMB 1ZVFA 1RINA 2QQIA 1VAKA 3GM8A 3VD9A 1N3OA 4IGOA 4OUEA 4NAOA 5A3OA 4D6RA 4HONA 2ZGMA 4XABA 1LR5A 4ASMB 3C7GA 3VKNA 5C9AB 3FL7A 3NRUA 2XWJB 1OLRA 4XFGA 5L73A 1WCUA 2XL7A 4LLOA 1VAMA 4A6OA 1LULA 5D8AC 2E7TA 4FQZA 3VZJA 2J1EA 5FJKA 3T4HB 4XFCA 3P5BA 4QM8A 2X5IB 4PI0A 5GZCA 3RGBA 4Q1PA 2C0ZA 4XAAA 2YZ4A 1JODA 4B3NA 3ZMNA 1TEIA 2WA3A 1S1AA 3VDCA 3WF0A 4ASLA 3HAGA 1QJX3 5IAVA 5HCFA 4CU7A 5T50A 4TZDA 1BK1A 3ME2A 2QQKA 3O0XA 1QJZA 3CNAA 3UESA 3K77A 4NIIA 2VD7A 2E32A 5J1XA 4GMP3 4K6BA 4M01A 1HRV3 3ZO0B 2VMFA 4QX7A 3CBNA 2JG8A 4AEDC 1RUJ1 4TN7A 1GOGA 1UKGA 4NIHA 3WOGA 4NHXA 1WMEA 1QDOA 1RUG2 1S0EA 2ZEXA 3ZLIA 5K7PA 3UKVA 1YNAA 2ZGLA 3ETPA 4Y5TA 2HLEA 2IUWA 5FPAA 4CP9B 1O3TA 4GXLA 1EPZA 2IVIB 1J58A 1J1TA 2BRTA 2GNMA 4TLFA 5FZ3A 3I2IA 2ZGTA 2VBBA 2CNAA 4Q4X2 3RJRA 4C91A 1BMV2 2C6SA 1W3VA 1CGPA 4E4DX 1UL9A 5JAXA 1MEC2 4ISRA 4B4RA 1CAVB 1PZ9A 5F5QA 3OBZA 1U5XA 2HYXA 4BB3A 2VCMA 4D7YA 1NQDA 1JN2P 4Q0VA 3VDDB 2WZR2 2DCKA 4PBPA 1CZTA 2OS2A 5JOWA 4BH9A 1D7PM 1MQTB 2R6QA 1SACA 2EAAA 4NWVA 4Q1RA 3TNPB 2AUYA 4BPZA 4BK4A 4X6RB 2AR6A 1W39A 2EIGA 3L2HA 1DDLA 3WF2A 1CZVA 4AFDA 4COVA 3OB8A 2HWD2 4LBJA 1YC61 3PJQA 3JBG3 5GJ6A 3LEMA 3ABZA 1YIPA 2WA4A 1VBB1 4KQ7A 3H50A 2EALA 1YQ8A 5JSOA 2B7YA 3PURA 3PUHA 2HEWF 1WD3A 4ISQA 2JE9A 1PM7A 2ERFA 1VBA2 3OEAA 2C1FA 3D0SA 3KHBA 1HRI2 5FYZA 1H2MA 4XFBA 3H3UA 1PGSA 5JCTA 3MDPA 1RUF3 2XG3A 1WW6A 1PHMA 1C57A 3U37A 3DPRA 4LBKA 4CPBA 3T1MA 1XYPA 3POJA 1S55A 4A7KA 4YM3A 2ZZQA 5FYCA 3SEPA 1UXXX 1NXMA 3KT1A 1F4AA 1DP0A 4Y24A 2K0GA 4YYOA 5KBFA 1ZZ8A 3B01A 2QQVA 3POBA 4UBHA 1SBDA 1FPN3 3ZIXA 1LHWA 1UMZA 2F17A 4NVPA 4X6QB 5FREA 3RQ0A 1JW6A 3AYDA 3JU9A 5JZGC 2A7AA 5BYNA 2WUHA 2WAOA 1R091 2QQUA 3BUCA 1NXD1 3LE0A 5A6YA 4NIGA 3D6EA 4GJYA 3U07A 5EJZB 3VBRA 1G6NA 3T0AA 5DAPA 4AQTA 5LY1A 3VZMA 4LBOA 1JXNA 1YQCA 4IEVA 4BQWA 1UOFA 1VBE2 3B5LB 4Q5OA 2GALA 2JG8B 1AUYA 3FLPA 4DQAA 2JDKA 2R1DA 4YVWA 2GC3A 1J1LA 2W9XA 2JG9C 1LOCA 2NMOA 5A3PA 1HV0A 5FZOB 5J96B 2D40A 2ZHNA 4MGKE 3WF1A 3ZKYA 1YHFA 2P4EA 4E8DA 5FO9B 4ZZ8A 3HWJA 3MW2A 4XUOA 1JYTA 4LTAA 5EHDA 3WDYA 4CEYC 4GAZA 5FYIA 4JHTA 4CA9A 2XJRA 4XTMA 4BJ0A 1JYVA 1V6MA 2HWE2 3VDBA 5CG8A 4QX8A 3HR9A 4P02B 3ETQA 3ZYBA 1RUE2 2C4XA 3GJAA 4RR3A 4ZU4A 1S0BA 5C4WA 1H9PA 3RMYA 4KBZA 3K3NA 4HXCA 1GP5A 1W9WA 1EAH2 2LS6A 4JTNA 3SEEA 4FSJA 2RDRA 4QPWA 1W05A 3N9MA 1PIV2 4AFCA 1YEWA 3NV1A 5DDJ1 2A70A 1FOD3 1UO9A 3AFGA 3P1IA 1L7QA 1X8MA 3KGZA 2GP5A 4IETA 4YFWA 5JXHA 1WKYA 1XB9A 1ZX5A 3M3EA 2X05A 4QD2A 5LY2A 1SMVA 4D0QA 5DZGA 3ZFGC 3AKQA 4FPJA 4LULA 4C90A 3NNGA 5L7OA 3AKSA 1RUG3 3NNMA 1O59A 3I3DA 3ZXAC 3AZVA 4JGYB 3MO4A 2I74A 4LO6B 2ZCWA 3J8F3 4AFMA 1GBGA 1QU0A 1SCRA 4CPBD 4J1WA 5FY7A 1APNA 1G7YA 3NJZA 4CUCA 4EWAA 4Q4X3 3RSJA 4NPRA 4QQOA 5FP8A 1AL22 3SXWA 1C4RA 4Z2WA 3NKTA 3DXTA 2HBTA 4OHXA 2J1UA 5CFCC 3ZVXA 4AHZA 4Q8LA 2FBEA 3AMQA 4RGAA 2ARAA 2BP6A 3ZFEC 1ND2B 2A75A 2Z79A 1UW8A 2ZX1A 3OTFA 1HB1A 5JI9A 1QJX1 4A3XA 4YW1A 4D94A 5CEHA 3I2OA 4MSVA 1PO23 2YGMA 3FE5A 5IJRA 3MIGA 4QGNA 4BE3A 1CESA 2HWD3 3ZN6A 3A7QA 1AR82 1W2AX 5F6KA 5A3NA 1UY3A 3O0VA 4FO9A 4M3CB 1L3JA 2VCAA 3AP7A 5FQ0A 2VAUA 4R9AA 4YVWB 1VBA3 2WQ8A 3ILRA 4UT5A 1HRI3 2WT2A 4MHRA 1HIXA 4XFHA 1EV12 3OD0A 4Y4RA 2CY6A 3OGJA 4Z1VA 4WZCA 5LRRA 5D21A 2P34A 4BQ2A 1JU3A 2VNGA 4AXOA 3POEA 1UIJA 1RXGA 2QQNA 4XIKA 4Z2AA 1V6IA 4PF1A 2G9FA 3H8XA 3PJYA 3VD4A 1HN1A 2PLV1 4AYUA 4RR3B 5IATA 4O7XA 1PK6A 2W92A 1W6QA 5FMCA 3ZOIA 3DV8A 5C8WA 1LHOA 2G4IA 1QXRA 4LT5A 4GD4A 3O12A 4K40A 4MV2A 4R8HA 4IE4A 2A6XA 2CYFA 4IQPA 4LBLA 4UW6A 4CCKA 2UYAA 2HEVF 4KWUA 1BXHA 5J3UA 3N7LA 4AI9A 1GOHA 2YBKA 3AVRA 3VD3A 5FPBA 4Q4Y2 2ZHKA 4LE4A 3O1UA 1RL3A 1VBE3 1OOPA 4HOOA 5A32A 3HJRA 4NR1A 4HL0A 2R041 2JDZA 3KZ4C 4AHXA 2ZGRA 2QJVA 2WWUA 3CJXA 5L7OB 1VBD1 1O4TA 2E7AA 2WO2A 3HEIA 3GCWA 1UZZA 4OMDA 4ARXA 3RFRA 1KRIA 4I0WB 4QU2A 1US2A 4QGMA 5GZDA 3ZYIB 1SG3A 4ZHNA 4ORFA 4FPKA 1UOBA 1OBNA 2BW8A 3MBWA 5BNNA 2HWE3 4R52A 5JWPA 3O1MA 1FXZA 1PNFA 5GLUA 3OGSA 1RUE3 5G05L 2XJVA 5DUWA 2R32A 3CJIB 1Z7S1 2BZDA 4YZ2A 3JCIA 4LA2A 5IFPA 1EAH3 3CU7A 1OKQA 4QM9A 1OXCA 1PVC2 2WQ4A 2ZOEB 4ZS2A 4CDWA 3LPFA 3TRSB 1PIV3 1NCQC 1UYXA 4MG2A 2QQLA 1CN1A 1VRH1 1CX1A 4LHLA 1VMFA 3AMPA 3U78A 3WEZA 3M2MA 3H3ZA 3MV01 4K3UA 2BV4A 3APBA 4QPGC 4YW3A 4KU7A 5LB6A 1PO12 2JE7A 1F2NA 4IV3B 1TVGA 2VW0A 2X10A 3WW3A 3ZN6B 4CU9A 2A6ZA 2WS92 3URFA 2EICA 4LO5B 5H9RA 1S2BA 2BWAA 5A3WA 4NIAA 5FQ0B 3NAPC 4XCAA 3OJBA 1GYKA 1W90A 3U75A 4YSFA 1DQ1A 3E6BA 4LBMA 1YJLA 4QHOA 2CGPA 1A78A 1KD7A 2I45A 3TNQA 5BUVA 4E2QA 2BU9A 3POFA 1W99A 2A73B 3MIDA 3UYJA 4AEJA 3H1YA 3HQUA 4QWNA 3SKVA 5JMOA 5GLTA 4MGSA 3AX4A 5F8PA 1AL23 1YFUA 3GBWA 5K9YA 3H7JA 1NX9A 2WNVA 1S4CA 5CZKA 3LDRA 3OD4A 2D7FA 3RNSA 5C5TA 1KFXL 3B9IA 4ATEA 3M70A 5CFDC 1PK6B 5IK8A 3LIGA 1XPWA 3VKMA 4M0NA 5ISLA 3ZX7A 1J3QA 1GNYA 3J9SA 4AGVA 2BQPA 3LEGA 3RI9A 4BISA 5I0RA 3UGHA 4DXSA 4WM7C 3WW2A 3IT8A 1HKDA 3ILFA 3JQXA 3JXSA 3K4AA 1UU5A 1KITA 2ZAHA 1AR83 4QU1A 2N7GA 1XJAA 2R0HA 5KXBA 4BMEA 1WCQA 4MO3M 3WUCA 1OOPB 1HX6A 1NZCA 4E4HA 2QBXA 2Y8KA 3UNPA 1QJY1 4BQ3A 3RG0A 1SCSA 3RWNA 4I02A 1UOGA 2Y0OA 4EYUA 2GU9A 2Q0AA 2Q8DA 1W9TA 1RHI1 1DZTA 1PO21 1Y9MA 5DZEA 4JRAA 4YGDA 4RA0A 2D6OX 4CEWB 1AX2A 2RM21 1ZZ6A 5IWFA 1RUJ2 1RJ8A 3OUIA 4XF9A 4DO0A 4A7YA 4G3YC 4Y5Z0 4QB2A 1MS4A 5FV3A 5FXWA 3ASIA 5HI0A 2RS11 1ZYBA 3H7YA 2LROA 4QT6A 3IMNA 3I3BA 5FY1A 1RUH1 1XC6A 3J7HA 5F3GA 4N43A 5F5CA 4BMBA 4XC9A 1SPPA 1H9WA 4ZXKA 1UXZA 5CVRA 5ACA1 3Q8FA 2NMNA 4QGLA 4ITCA 1TMF1 1EUUA 1OSGA 3BOWA 3MI8A 2W3JA 3RPQA 1RUI3 4AVVA 2K46A 4LLFA 1V6JA 3B7MA 5GZGA 4YARA 3WR0A 5DAXA 1GV9A 2Q4SA 3IIAA 5J48A 1GU3A 5FOJB 4PBOA 3HVDA 3ZYHA 3GF6A 3AFKA 3UT0A 3FMGA 2CAUA 2DFCA 5FXZA 4OHVA 1JZ6A 3TEZA 1LGCA 2LUWA 1IS5A 1J84A 2QVSB 2XXZA 1UMHA 3I2GA 1LB2A 2W5FA 3RVHA 2R061 2E63A 4G4FA 3N7MA 4HN1A 4AQ2A 2OX0A 5F6LB 3PUQA 1H2LA 3H3LA 3AMMA 1B09A 1VBB2 4RL7A 1QJEA 1I5PA 3VBHC 5ABJA 1I3HA 1J3RA 1CIWA 1RGSA 2VQ0A 2WNVB 2Y6JA 3AK0A 4OYUA 3TEXA 3B3QE 4BIFA 1CAWB 1E5SA 3MFAA 1UCXA 2QUOA 3KVBA 2PTMA 3ZR6A 1PVC3 2ZGNA 4WM8C 2ARCA 3MPBA 1J59A 1ZZCA 3AKRA 3R0RA 1CWPA 1SEFA 4PIZA 4Y1XA 4CCCA 4Q0UA 3ES1A 4Y3OA 1ZBE1 5CAZA 2QDRA 3V0BA 2EVXA 2PHUA 4NPLA 1RUOA 3NMBA 3AM2A 1FNYA 1PO13 1IZ3A 1C5IA 1VLNA 4FBFA 3KQRA 5T54A 1FMD3 2WS93 3U0ZA 2O1QA 4QXHA 4AK3A 2YBSA 5K0UA 2YGLA 1R092 1YJKA 3WNKA 2ID4A 2SLIA 3FHQA 3JQWA 2OUHA 1OH3A 2VCBA 2ZX2A 4FPOB 3A0KA 3S6PA 2VZVA 1M06G 3N9OA 3QD6A 4M4PA 2X29A 3LOIA 1TG7A 1AJOA 4HVOA 3VBFB 2WYSA 1BBT1 4FFFA 2D3SA 3IM0A 3NV3A 4NJ4A 5A3TA 5IAXA 3MYXA 5DUXA 5AC91 2HWC1 2QNKA 4XJUA 2J1RA 2ZGOA 5DXDA 4CCLA 5LWBA 1SLIA 3AXDA 3OGGA 3N7KA 2VUDA 4OMCA 3JB8A 1HDKA 3D8CA 2QTWB 4MGZE 4LKFA 4UFKA 1W9FA 4QB1A 2AC1A 1V6LA 4MGIE 1MS5A 2PQSA 3A21A 5DG2A 3UETA 4GH4C 5DAWA 2BGOA 4XFFA 2UWAA 4L9BA 4N43B 1GNZA 1SPPB 4MUVA 4NPMA 2VPVA 3NV2A 3WVJA 4FXGB 4MZUA 1Q8PA 3LDBA 4JKMA 3INAA 3ZYGA 1UNBA 1DQ5A 3Q8BA 5BNPC 4FFHA 1MACA 1OA3A 2A5ZA 1Z78A 2OA2A 3BU7A 2PAEA 3I49A 2D3RA 3I4IA 4KG8A 3UJQA 2OPKA 4QAWA 3USSA 2GP3A 4IEQA 2VQTA 1ZZ7A 2J42A 4QMAA 2WNUC 4AVTA 2QQPA 2TNFA 1O8SA 4UBGA 5DDJ2 1RTVA 2B9VA 4P9GA 1UY4A 1VB2A 3ES4A 3VZKA 4N7UA 3I7DA 2Y6GA 2J1SA 4QQLA 2VUJA 1RUJ3 5F3EA 2WAAA 1QXJA 5G04L 3C7OA 4JGZC 1YI7A 1O6UA 1TME1 5ABJB 1VP6A 3RMXA 4UYBA 3GGLA 1IGOA 2QZ3A 2RDQA 2IWGB 3QH7A 1PX3A 1XNAA 4IV1B 1HN0A 2PFWA 3PTYA 4LORA 4LXLA 4D7TA 1Z0HA 2D44A 4DUXA 4HPKB 4DY3A 4OI2A 2RJKA 1VR3A 2RG4A 4LBQB 1RUNA 2Q1MA 2R16A 1ULPA 1UD1A 4IUGA 5F2WA 4D3WA 3J26N 3V0BB 2D6MA 4MOAA 1BVP1 1G9CA 1QKQA 4J6GA 3M1HA 4JDOA 3ILNA 3OF1A 2YPDA 1OLME 3AJZA 5T5PA 1AXKA 2HKXA 3MIHA 5JZGB 2JICA 5K0UB 3WSOA 1DFQA 4LO8A 5IVYA 5SV8A 5HCAA 4EN7B 5DAQA 4GKXA 2BBVA 3IDCB 2A3YA 2DF7A 4XVHA 2R30A 2DTYA 1LOGA 1OPMA 2VOVA 4LITA 3SKJE 3HMYA 3VZLA 1PM4A 1RUI1 1Y9QA 4HZFA 3LKJA 2CWSA 4MADA 4PDWB 1VBB3 2WO7A 2ZJCA 3WXPA 4IEOA 1D4M1 3EYPA 3WQ7A 3SITA 4AI0A 4XETA 1URXA 5A7QA 1WLDA 2VW1A 3ZSEA 5D8AA 3N9LA 3BPSA 2UURA 4AEMA 1K5MB 3I3QA 4XQDA 1HB3A 3S7IA 3I97A 4EE2A 3L2YA 3S7EA 2PLV2 4LR4A 4NO4A 2Q8CA 5EJ1B 4ZU7A 4DY5A 2WFPA 4YW7A 4Z82A 4QPYA 4E4ZA 1VIWB 5EFUA 2Q8EA 1OVSA 2OW4A 2IVJA 1R093 3LEIA 1IG3A 2OQ7A 2Q5TA 5KWRA 1POV0 3KHCA 5FZ0A 1S0DA 3ZXKA 3B02A 2W2IA 3ELNA 2RV9A 4AEDA 4PJYA 2WSUA 5J37A 4XIOA 1BEV1 1I1EA 5T55A 3VDDA 1FPN2 3OSDA 4JQTA 4CDXC 5JOXA 2R042 5A33B 1N1SA 1POV1 4BA6A 4CXWA 1VBD2 1UOJA 3BIWE 4CUBA 4BQXA 1ALYA 2AEYA 5CBLA 2DUQA 3IDEA 4H14A 5JXIA 2P3KA 1ENXA 3SISA 2FMDA 3MW3A 1DGLA 1HQNA 4A42A 1K3IA 4V2WA 3B00A 3VKOA 3AL5A 3GHNA 4NHLA 3ZIWA 5LATA 4CXXA 1Z7S2 4HETA 2IFRA 2XOMA 4IE5A 3NVCA 5FYMA 3FX3A 3GZAA 1HJGA 4GIQA 3HBKA 1PMIA 1AYN1 1S2EA 2JEMA 3OGVA 4M3CF 4KWLA 2W39A 2IXKA 4N9IA 1F35A 1O5LA 1W03A 3LFIA 2W47A 1VRH2 2VVEA 4UAPA 4WVVA 5DDJ3 2E26A 2VNOA 3ZFFC 5EWSA 4DINB 3AMNA 1ZRDA 1WCKA 5FY9A 3I8TA 2ZMKA 3AB0A 4M4RA 4EZHA 1VBC1 1WBFA 2DDUA 5FWEA 3R4SA 5T52A 3VBUC 2FDIA 2VXJA 4FI9A 4HK8A 5JIUA 2PAKA 2YDEA 4BM8A 3NJVA 3GZTB 2LALA 4L99A 5D8AB 1FOD2 2Z4FA 2JDNA 5H9QA 5IUQA 4TXWA 2Y6KA 1H4HA 2JENA 2JWPA 1WUVA 5HCHA 1H8TC 4JVAA 5FIXA 4G9SB 1C1FA 2XJPA 5EXOA 4MXWA 2GAUA 4XE9A 2ZX4A 4QPIC 5FZOA 1IKPA 5FBZA 1W9YA 4LKSA 1CONA 1JUHA 2DURA 2WL1A 3J8F2 4MHUA 5FBJA 1COV1 5HXVA 4PQ9A 5FY8A 3HIFA 2VOTA 5LBCA 3AC0A 2HEYF
chains in the Genus database with same CATH topology
5FZKA 3UYJA 4QWNA 5F2SA 2YU2A 3PURA 5FY5A 3N9LA 5FYUA 4QXHA 4BU2A 3AVSA 5FYZA 5FZEA 2YBSA 5IVFA 5F37A 4EZ4A 2OT7A 5FYHA 5FZGA 5FZAA 5A7PA 3ZPOA 5FZFA 3N9OA 5FYCA 5A7NA 3NJYA 5A3NA 5FZBA 1VRBA 2Q8CA 5IVBA 3PTRB 5A3TA 5ISLA 5FZ8A 4URAA 5FZDA 3K3OA 4BISA 2Q8EA 4IGPA 5LWBA 5FP4A 4Y4RA 4CCLA 5LW9A 5FYBA 4LIVA 2OQ7A 5FZ0A 3KVAA 4IGOA 4QU1A 2W2IA 5FZ6A 5FPVA 4D6RA 4HONA 5FYVA 4GJYA 5FZLA 5FJHA 4E4HA 5FPUA 5IVJA 5LY1A 4EYUA 5FZHA 2Q8DA 3KV9A 3LDBA 4ASKA 5IVCA 4QXCA 4UF0B 4DIQA 3N9PA 4BXFA 5FP3A 3KV5A 5F3IA 5FJKA 5FPLA 5FY4A 5FZCA 4C8DA 5A7OA 5FZ9A 4GD4A 5A3PA 5A7WB 5IWFA 5FZOB 4CCKA 2GP3A 5FUNA 4DO0A 5F39A 2OQ6A 4V2WA 2WWJA 5FV3A 3AL5A 5FXWA 2YBKA 4AI9A 3AVRA 5E6HA 5FP9A 4GAZA 5FPBA 5FYIA 4HOOA 2PXJA 5ANQA 5FY1A 2XUEA 5F3GA 4QX8A 3N9QA 5F5CA 2VD7A 2WWUA 2XMLA 5FYMA 5F3EA 5A7SA 5IVEA 5F5IA 3K2OA 4CCMA 3K3NA 5FYSA 5FXXA 4QX7A 4XDPA 4TN7A 5CEHA 4CCNA 5FWJA 4AAPA 5A1LA 5FP7A 3N9MA 5FYTA 4LXLA 3ZLIA 5FZ7A 3U4SA 5F5AA 5FY9A 5FYYA 3PUAA 5FZIA 3OPTA 4Y33A 5FPAA 2GP5A 5FXZA 4GJZA 5FZMA 4EZHA 5A80A 5FZ3A 2XXZA 4QXBA 5FWEA 2YU1A 4XDOA 5FZ4A 3RVHA 5LY2A 4CCOA 3PDQA 5F2WA 3PU8A 3PUSA 2OX0A 3PUQA 3PU3A 4IGQA 4CSWA 5FUPA 2YPDA 4LIUA 3LD8A 5FZ1A 3U78A 5FXVA 3DXUA 5IVYA 4UF0A 5FY7A 2OS2A 4D6SA 5F32A 2P5BA 4V2VA 3KVBA 5A7WA 4LITA 5KR7A 5FZOA 5FP8A 5IVVA 3KV4A 3OPWA 2XDVA 5K4LA 5FY0A 5A3WA 5F3CA 5IW0A 3DXTA 4CUGA 4Y3OA 4D6QA 4NUBA 3KV6A 5FBJA 4CCJA 3N9NA 5A1FA 5FY8A 2YBPA 5A7QA 3AL6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FZK A;  3UYJ A;  4QWN A;  5F2S A;  2YU2 A;  3PUR A;  5FY5 A;  3N9L A;  5FYU A;  4QXH A;  4BU2 A;  3AVS A;  5FYZ A;  5FZE A;  2YBS A;  5IVF A;  5F37 A;  4EZ4 A;  2OT7 A;  5FYH A;  5FZG A;  5FZA A;  5A7P A;  3ZPO A;  5FZF A;  3N9O A;  5FYC A;  5A7N A;  3NJY A;  5A3N A;  5FZB A;  1VRB A;  2Q8C A;  5IVB A;  3PTR B;  5A3T A;  5ISL A;  5FZ8 A;  4URA A;  5FZD A;  3K3O A;  4BIS A;  2Q8E A;  4IGP A;  5LWB A;  5FP4 A;  4Y4R A;  4CCL A;  5LW9 A;  5FYB A;  4LIV A;  2OQ7 A;  5FZ0 A;  3KVA A;  4IGO A;  4QU1 A;  2W2I A;  5FZ6 A;  5FPV A;  4D6R A;  4HON A;  5FYV A;  4GJY A;  5FZL A;  5FJH A;  4E4H A;  5FPU A;  5IVJ A;  5LY1 A;  4EYU A;  5FZH A;  2Q8D A;  3KV9 A;  3LDB A;  4ASK A;  5IVC A;  4QXC A;  4UF0 B;  4DIQ A;  3N9P A;  4BXF A;  5FP3 A;  3KV5 A;  5F3I A;  5FJK A;  5FPL A;  5FY4 A;  5FZC A;  4C8D A;  5A7O A;  5FZ9 A;  4GD4 A;  5A3P A;  5A7W B;  5IWF A;  5FZO B;  4CCK A;  2GP3 A;  5FUN A;  4DO0 A;  5F39 A;  2OQ6 A;  4V2W A;  2WWJ A;  5FV3 A;  3AL5 A;  5FXW A;  2YBK A;  4AI9 A;  3AVR A;  5E6H A;  5FP9 A;  4GAZ A;  5FPB A;  5FYI A;  4HOO A;  2PXJ A;  5ANQ A;  5FY1 A;  2XUE A;  5F3G A;  4QX8 A;  3N9Q A;  5F5C A;  2VD7 A;  2WWU A;  2XML A;  5FYM A;  5F3E A;  5A7S A;  5IVE A;  5F5I A;  3K2O A;  4CCM A;  3K3N A;  5FYS A;  5FXX A;  4QX7 A;  4XDP A;  4TN7 A;  5CEH A;  4CCN A;  5FWJ A;  4AAP A;  5A1L A;  5FP7 A;  3N9M A;  5FYT A;  4LXL A;  3ZLI A;  5FZ7 A;  3U4S A;  5F5A A;  5FY9 A;  5FYY A;  3PUA A;  5FZI A;  3OPT A;  4Y33 A;  5FPA A;  2GP5 A;  5FXZ A;  4GJZ A;  5FZM A;  4EZH A;  5A80 A;  5FZ3 A;  2XXZ A;  4QXB A;  5FWE A;  2YU1 A;  4XDO A;  5FZ4 A;  3RVH A;  5LY2 A;  4CCO A;  3PDQ A;  5F2W A;  3PU8 A;  3PUS A;  2OX0 A;  3PUQ A;  3PU3 A;  4IGQ A;  4CSW A;  5FUP A;  2YPD A;  4LIU A;  3LD8 A;  5FZ1 A;  3U78 A;  5FXV A;  3DXU A;  5IVY A;  4UF0 A;  5FY7 A;  2OS2 A;  4D6S A;  5F32 A;  2P5B A;  4V2V A;  3KVB A;  5A7W A;  4LIT A;  5KR7 A;  5FZO A;  5FP8 A;  5IVV A;  3KV4 A;  3OPW A;  2XDV A;  5K4L A;  5FY0 A;  5A3W A;  5F3C A;  5IW0 A;  3DXT A;  4CUG A;  4Y3O A;  4D6Q A;  4NUB A;  3KV6 A;  5FBJ A;  4CCJ A;  3N9N A;  5A1F A;  5FY8 A;  2YBP A;  5A7Q A;  3AL6 A; 
#chains in the Genus database with same CATH topology
 1QMJ A;  1OFS A;  1W8F A;  4RQP C;  5F2S A;  4FPY A;  3AP6 A;  3BOP A;  4JKL A;  1MVE A;  1W8H A;  2D5H A;  4LUM A;  1RUC 1;  3KCX A;  4OUS A;  4AED B;  4U36 A;  3F2Z A;  2JG9 A;  1I9R A;  3KQ4 B;  5CKQ A;  4UOJ A;  4QKF A;  4H55 A;  1JTZ X;  1W2U A;  3UK9 A;  5A7P A;  1IS6 A;  2JXA A;  3WQ1 A;  1QJY 2;  1QDC A;  2TEP A;  2WLP A;  1UYZ A;  4B4P A;  3NJY A;  1HXS 1;  2XR4 A;  1CAX B;  1JMU B;  1UIK A;  1TZO A;  1VPH A;  4AFB A;  2QCS B;  1G8W A;  1RHI 2;  2BJS A;  1PO2 2;  2QQO A;  5T5O A;  4AW7 A;  5A3U A;  2E51 A;  2IXL A;  4UFH A;  2W46 A;  4X8P A;  4E4S A;  3M8L A;  4WVW A;  1MPX A;  5FPX A;  5JXG A;  4XFA A;  4MVT A;  2A3X A;  3D0J A;  1BJQ A;  4L2N A;  3W58 A;  4YZ1 A;  2PLV 3;  4HLT A;  1JZ8 A;  1STM A;  2UY8 A;  4JGY A;  5E89 A;  3D82 A;  4K7J A;  2RS1 2;  5GLZ A;  3ZYJ B;  1LGB A;  2WT1 A;  3C7F A;  4OHW A;  1PZ8 A;  1WLC A;  4Q4W 1;  2F4L A;  4XCB A;  3LAG A;  4KGG A;  1RUH 2;  1W6O A;  2GC2 A;  2JX9 A;  3H8R A;  5ACA 2;  3K4Z A;  4UF0 B;  1GFF 2;  3N9P A;  4DIQ A;  1X33 A;  5LAS A;  4C8D A;  1TMF 2;  2ZX3 A;  3OG2 A;  1ASJ 1;  1JHN A;  1GQG A;  3J7N A;  1F5J A;  4XMA A;  4XJ8 A;  1ZZB A;  2QQJ A;  3T3Y A;  1SFP A;  2QZ2 A;  3O5S A;  5FDB A;  3O1T A;  2OQ6 A;  2R04 3;  1SZB A;  1NKG A;  1ND2 A;  5E6H A;  5FP9 A;  3V56 A;  3RWK X;  4XMI A;  2MEV 1;  1VBD 3;  2OII A;  3BYW A;  3QBQ A;  3ZXD A;  1OPO A;  3B94 A;  2R06 2;  2WO1 A;  4GWJ A;  1HQL A;  4OQ9 A;  3PHM A;  2WR9 A;  2XJU A;  3MLJ A;  2ZPX A;  4CCM A;  2BDR A;  3K46 A;  2W1W A;  4JQR A;  3WDT A;  1BKZ A;  1YO8 A;  4DUV A;  4M3C A;  1GSL A;  4QHZ A;  5FYT A;  3VKL A;  2ORZ A;  2XVG A;  2FDJ A;  1AXZ A;  1OQ1 A;  1Y9G A;  1Z7S 3;  2BWC A;  2WDB A;  3LSD A;  3MGU A;  4MXW B;  4Q29 A;  4AQ6 A;  2JKB A;  4GJZ A;  4QXB A;  3WG4 A;  1BHG A;  1VRH 3;  3AP4 A;  1ZBE 2;  4NRQ A;  1GR3 A;  3BVC A;  2Y6H A;  3ZR5 A;  4OVE A;  3PLQ A;  3KB5 A;  5KC5 A;  4IXL A;  2JJ6 A;  3C3V A;  2JG9 B;  3GYD A;  4Q0P A;  4CVU A;  2IXH A;  4RHV 1;  2CGO A;  3CIH A;  1K42 A;  1NY7 1;  1ODM A;  3FWE A;  3BGA A;  1YQ2 A;  4LKE A;  1AVB A;  2D6L X;  2FDG A;  4YLZ A;  4CEY B;  1K5J A;  1ZA4 A;  2XHN A;  2NP0 A;  1BBT 2;  3AMH A;  5HPO A;  4YVS A;  3KLS A;  4CCJ A;  4TTG A;  1QQP 1;  4K8F A;  5FKC A;  3E6D A;  4O65 A;  5FLI A;  2HWC 2;  3AYC A;  3HT2 A;  4IE7 A;  1XQN A;  5FYU A;  1H30 A;  4FOY A;  3ON7 A;  2JIJ A;  2GH2 A;  5JMC A;  3RZK A;  4FCA A;  2DUO A;  4D69 A;  2XWB B;  1WZX A;  3LFM A;  1WWY A;  1W6O B;  3JZV A;  5BNQ A;  3FUO A;  2Q1Z B;  4NOT A;  4PT6 A;  1DCS A;  1ZM1 A;  3DPR C;  1WD4 A;  1VMJ A;  3ZFG B;  3WG1 A;  2ETE A;  1ACC A;  3CJI A;  1GWK A;  4AI2 A;  1N1Y A;  5KHK A;  4JHZ A;  4XAE A;  2FQP A;  1DGR A;  5GM0 A;  4AWD A;  3LEK A;  2P2K A;  1T2X A;  3KVA A;  1G9F A;  1QJY 3;  4N53 A;  1A34 A;  4LHS A;  3E97 A;  1NLS A;  1MS0 A;  1FNZ A;  1U5Y A;  3CKH A;  5AFB A;  3WLU A;  1RHI 3;  1O3R A;  1MZ5 A;  4L11 A;  1S2K A;  3WIN E;  5A6Z A;  3CZJ A;  4IV3 A;  2RM2 3;  1W8U A;  1FYU A;  3AP9 A;  2EF6 A;  2JB8 A;  4N7I A;  2EIB A;  1G9A A;  2AH2 A;  2BGC A;  4JAA A;  1TME 2;  3LZZ A;  5FZ9 A;  1HQW A;  2HYK A;  1QXP A;  5LBB A;  3VBR C;  2ZHM A;  5CFC B;  2RDN A;  1A3K A;  3I3E A;  2KD7 A;  1O4Y A;  3MIE A;  1REE A;  4YW6 A;  2CSG A;  3J7M A;  3VHO A;  3ZFE B;  2RS1 3;  4ZY9 A;  1H1I A;  4COU A;  3FN9 A;  5T3N A;  1RUH 3;  1WW7 A;  3HN3 A;  1V00 A;  2ZAA A;  4QPG A;  5ACA 3;  1ONA A;  4AGG A;  1SBF A;  5D1I A;  5I8Y A;  5ANQ A;  1TMF 3;  3MIC A;  4YNI A;  5GZE A;  4FPE A;  4COZ A;  1GP6 A;  3H42 B;  4C1W A;  3E5X A;  1LCL A;  1TE1 B;  2WN3 A;  3O1O A;  5GKA C;  3FFQ A;  4A6S A;  2G9G A;  2GMP A;  1X82 A;  1A8D A;  1ZNP A;  2ZAB A;  1DQ0 A;  1F4H A;  1W2N A;  5FMO L;  5EYY A;  3K51 A;  3VBO C;  2B42 B;  1W6P B;  2ZMN A;  1NA1 C;  2EAK A;  1WMF A;  2ZA9 A;  4CZS A;  1ZRF A;  5C4W C;  1V70 A;  3LCP A;  2DCT A;  1S0C A;  5F5A A;  4DEV A;  1LTE A;  1U12 A;  1U5I A;  2HWF 1;  5FYY A;  3PUA A;  2R06 3;  3OPT A;  4ATF A;  4Q8K A;  2V73 A;  2WZE A;  3OGR A;  2BGP A;  3GZE A;  5A80 A;  1RUI 2;  4CCO A;  4DRV A;  5FZ4 A;  2WIN B;  1OA4 A;  4I0A A;  5KXC A;  4YVS B;  3DEC A;  4V1P A;  3MPP G;  4EN0 A;  2JKX A;  2QQW A;  3PUS A;  2B8M A;  2R1B A;  2K2S A;  2YFU A;  5CFD A;  3ZXL A;  1KXG A;  1XE0 A;  4P9J A;  3FC0 A;  2VMC A;  5J09 A;  5FZ1 A;  4DS0 A;  5IT6 A;  1NCR A;  1E5H A;  3O1R A;  2DCZ A;  1R1A 1;  2KA3 A;  4UXA A;  4WM7 A;  4AL9 A;  2BVB A;  2IZW A;  4V2V A;  4CEW A;  2FDH A;  2D43 A;  2E53 A;  2XLG A;  4OHZ A;  4QB6 A;  2VBP A;  1RXF A;  1ZBE 3;  3IDB B;  1WBL A;  4DUW A;  2XDV A;  3JD7 1;  3LPG A;  3H9A A;  4DXT A;  2P3I A;  2UU8 A;  3O7O A;  4Z8B A;  4S2G A;  1RC6 A;  3O0W A;  3WQ0 A;  4MGT A;  2X53 S;  1Y4W A;  2A1X A;  4E2S A;  5AVA A;  4UFL A;  5IK4 A;  2ADE A;  3ALQ A;  1RVF 1;  3PIJ A;  4OUL A;  2ADD A;  4WZF A;  1XSQ A;  5A3M A;  3RZJ A;  4BU2 A;  1H1M A;  2YMZ A;  2VMH A;  4N53 B;  4D8M A;  2G1M A;  3FBM A;  3J4U H;  1KGY A;  2WWS A;  3U11 A;  4E2G A;  3MLK A;  4EZ4 A;  3PMS A;  3F95 A;  3X29 B;  1UKR A;  5LK7 B;  1BBT 3;  2P3Y A;  3KCY A;  1BEV 2;  2JB4 A;  2VUL A;  5ANN A;  5AFE A;  4Y1Y A;  1AR9 1;  5EQU A;  1QIQ A;  4XFI A;  5AC9 3;  1FMD 2;  2HWC 3;  3QH6 A;  3AXE A;  4FP2 A;  4DRR A;  3RI8 A;  2OKX A;  4XJA A;  5FZD A;  1ENS A;  3SQO A;  4URA A;  5K8S A;  1O3Q A;  1CIY A;  3MF9 A;  1E57 A;  4CDQ C;  1ULF A;  4AGR A;  3VN4 A;  1IKQ A;  4B7E A;  4Y1V A;  5FYB A;  2C24 A;  4K1Y A;  4XOG A;  1NCQ B;  3T30 A;  3UL2 A;  3VBS C;  1Y7B A;  3NW4 A;  3FBY A;  1W04 A;  3T4V A;  4FTE A;  4S2D A;  5DG1 A;  2PHX A;  5FPV A;  4QPG B;  2FCU A;  1RB8 G;  5JVV A;  1EPW A;  3USU A;  5DMY A;  2CGN A;  4L0P A;  3ACI A;  1UU6 A;  4WVM B;  2XLF A;  3CDZ B;  1BYH A;  1LOD A;  1TNR A;  1V0A A;  1CAW A;  2Y6L A;  3HN1 A;  3KV9 A;  2DVB A;  4AI1 A;  5EIY B;  1CQ9 A;  1DYP A;  4Q2F A;  5I91 A;  3NAP B;  2RJL A;  5F3I A;  1Q56 A;  1UMI A;  2RMU 1;  1AYN 2;  4CU8 A;  1O8P A;  5LZ6 A;  4MXV A;  4YZ5 A;  4A41 A;  1A8M A;  3HQR A;  4SLI A;  5FCC A;  4Y20 A;  3DGT A;  3VDA A;  2VR4 A;  2YHJ A;  4XQW A;  2ZML A;  5F39 A;  3G6J B;  3PVN A;  3VBH A;  3PUI A;  4S2H A;  4BXS V;  1NOV A;  5FR3 A;  2D93 A;  3OUH A;  3TEY A;  5CU1 A;  1VBC 2;  2UWB A;  3VV1 A;  1TME 3;  3FHA A;  5C3R A;  1V9U 1;  2I07 B;  2NLR A;  2JE8 A;  3S5Q A;  2XML A;  5CFD B;  2CWM A;  1GNH A;  4LK6 A;  4LKD A;  4WM8 A;  4YW4 A;  2VOW A;  2YPJ A;  2OYZ A;  1OUX A;  1NCR B;  3FZ3 A;  4Y26 A;  3VBF A;  1W0N A;  3CZU A;  3NWK A;  4WM7 B;  5FP7 A;  2WYF A;  4GQ7 A;  4XF0 A;  3RDI A;  1GWM A;  2FMY A;  4Y1Z A;  4L8Q A;  1T6G C;  4Y5S A;  2YC0 A;  2Y38 A;  3NV4 A;  4X8N A;  5FZI A;  5ERL A;  1MEC 1;  3M3C A;  1W8N A;  3GAL A;  2OVU A;  3BTX A;  3TEW A;  1GUI A;  1GZW A;  3D5O A;  5BNN C;  3RZM A;  5A70 A;  2GME A;  3OY8 B;  2WZR 1;  2P6C A;  4QDS A;  1NZI A;  3ZMO A;  1XE8 A;  1LES A;  1COV 2;  2VG9 A;  3H1M A;  3VKF C;  4CSW A;  2JIG A;  1GZC A;  1QGL A;  3A0N A;  1YLL A;  1FAT A;  4XUP A;  2QE3 A;  4BLI A;  1NT0 A;  1RUC 2;  4LEJ A;  4CDW C;  2ZZJ A;  4K21 A;  2F6B A;  2QKD A;  5T5L A;  2PHL A;  3RRD A;  2H0V A;  2RJ2 A;  1D4M 3;  1GMM A;  2BTV C;  1UPS A;  1UQX A;  4NUB A;  2YB7 A;  4OZX A;  2VTX A;  2YBP A;  4HG6 B;  2Z2S B;  3KF5 A;  5LA0 A;  5A1A A;  1RMU 1;  4UFM A;  4AE2 A;  5BNP A;  3ACG A;  5DN2 A;  2JDH A;  1LOF C;  4UW4 A;  2P37 A;  4PCR A;  4C0B A;  4LE3 A;  3USU B;  4Z92 B;  5E1R A;  5HCB A;  2CAV A;  1UX6 A;  4HN0 A;  4B4Q A;  5A6X A;  3ZPO A;  1JYN A;  1XNT A;  2JDP A;  3LQC A;  2WNU A;  4Q4W 2;  1OQD A;  4IV1 A;  4XJ9 A;  4GKY A;  5FZB A;  4ZXE A;  1LU2 A;  2WNV C;  3GBG A;  3W21 A;  1OD5 A;  3Q8C A;  1AYM 1;  4HPK A;  4QQP A;  5FLJ A;  5EP9 A;  3BPZ A;  3V65 A;  3MUY 1;  4LBQ A;  4BZ4 A;  1U0A A;  4IGP A;  2VZT A;  4W65 A;  3O1S A;  1UZY A;  1ASJ 2;  1JUI A;  1XU1 A;  2VW2 A;  3BN6 A;  3RYP A;  2GNT A;  1ZRR A;  2CU5 A;  4Y20 B;  1OKO A;  3ZXE A;  2YY1 A;  4J25 A;  4RGK A;  1BEV 3;  2GND A;  3U1X A;  1SLT A;  2VZP A;  1IG0 A;  3VBH B;  4OQ8 A;  4LO4 B;  3GBF A;  2DFB A;  2EIE A;  2PHF A;  3EO6 A;  5FYV A;  4W8J A;  1AR7 1;  3HT1 A;  1QH6 A;  1POV 3;  3UGF A;  2MEV 2;  1MZ6 A;  2AZ5 A;  1CJP A;  4NMI A;  3FLR A;  2E33 A;  2WRA A;  4GA9 A;  2GMM A;  2X8K A;  4WM8 B;  4XEZ A;  4ZKT B;  3ZDV A;  5C8C C;  2NN8 A;  3BTY A;  2Q1F A;  5FP3 A;  5FY4 A;  5FRA A;  2JDY A;  5FZC A;  3UKN A;  2W94 A;  1CAU A;  2BNN A;  3GNE A;  3H1W A;  4JX0 A;  5A7W B;  4PDW A;  3VZN A;  4FAG A;  5JXJ A;  2XGX A;  4IEP A;  1JZ2 A;  5FUN A;  2ZEY A;  3LA3 A;  4AVS A;  3ITQ A;  3NST A;  4COY A;  3UV9 A;  4CDU C;  4AVA A;  1GZ9 A;  1V6N A;  2WN2 A;  4Y1U A;  1O7F A;  2E9Q A;  1JHJ A;  1W28 A;  1GZW B;  1J83 A;  1H6X A;  3C2U A;  4I3P A;  3TB0 A;  3POG A;  5BNO C;  4Z07 A;  1AYN 3;  1SLB A;  2VTF A;  1X7N A;  1F8V A;  1QEX A;  2D3P A;  1K5M A;  3BIE A;  1QJU 1;  2XPJ A;  3T0B A;  3WG2 A;  3PIG A;  4O9G A;  1KQR A;  2TBV A;  3AKT A;  5B2G B;  1O3S A;  4Q27 A;  3MHZ A;  4YZ3 A;  2HBU A;  2KXL A;  1VBC 3;  4RHV 2;  1D4V B;  1LKN A;  1LEM A;  3WZ1 A;  5C71 A;  5FUI A;  4DXR A;  2P6H A;  4AF9 A;  4LHN A;  1X8E A;  4GH4 B;  3WF3 A;  4KI5 M;  3WF4 A;  2Z5W A;  3O1V A;  4GUL A;  2R7E B;  2B4K A;  2HH9 A;  1UPI A;  4IGQ A;  5DZF A;  5J98 B;  1QQP 2;  2VZ1 A;  1RJ7 A;  1CD3 G;  2GC1 A;  1W8W A;  3ATG A;  4HMZ A;  4PI2 A;  5CIR A;  5BNP B;  3WNX A;  1KJR A;  1WCD J;  2VUC A;  4LIU A;  2XLA A;  1B35 C;  1Q8Q A;  5A33 A;  5FXV A;  3OEB A;  4Q4V 1;  2O8Q A;  1UWW A;  4D6S A;  2WNO A;  2QQM A;  4GWI A;  1BCX A;  1SLL A;  1MZE A;  2P5B A;  5FKB A;  3E6C C;  3OBT A;  1AJK A;  2YC4 A;  4QQ2 A;  1YIF A;  2WNU B;  5H9S A;  4LBQ D;  1COV 3;  2RS3 1;  4I0B A;  2GN7 A;  4ERO A;  4DPN A;  2FCV A;  4P9W A;  5CA6 A;  1GWL A;  4QXK A;  5M0T A;  4O61 A;  4BQY A;  4BQ5 A;  2PQQ A;  3N9N A;  5SV5 A;  1FI2 A;  3ZN5 A;  3NO8 A;  4BDV B;  4F3J A;  4F8A A;  3WP6 A;  1RUC 3;  2DU0 A;  2BNM A;  1JI6 A;  1GLH A;  2VE1 A;  3I2H A;  3LGR A;  3SH5 A;  1K45 A;  2D97 A;  1OUS A;  1SBE A;  1LHU A;  3S30 A;  1JBC A;  1OVP A;  4S2F A;  3PNA A;  5EYX A;  5GAL A;  1YUD A;  4IEW A;  1NE6 A;  2IXC A;  2EXI A;  5FYH A;  4H3W A;  1DGW A;  1HXS 3;  1QOO A;  1S0G A;  2XBO 1;  4KL1 A;  1WW4 A;  2VXR A;  3NKG A;  5APA A;  5FZG A;  4BIO A;  1QJX 2;  1AX1 A;  1A6C A;  3IAQ A;  4AVC A;  1EV1 1;  5IVB A;  4FOW A;  1D2S A;  2FCT A;  4A7Z A;  1JYI A;  4AI8 A;  4ZU5 A;  3ZYF A;  3M7A A;  2WJS A;  1CAU B;  2ZKL A;  3AYE A;  1W6M A;  3KS7 A;  2A6W A;  2EXH A;  1CR7 A;  4XF1 A;  1AF9 A;  1PGW 1;  2ZHL A;  5CAD A;  1OI6 A;  1MR5 A;  1PVX A;  1V6O A;  5FZ6 A;  4R9C A;  2CDO A;  3WHU A;  4Q4W 3;  2UYB A;  1KS5 A;  1ODN A;  2JDA A;  4P00 B;  3ZFF A;  1N1T A;  4GB3 1;  2VME A;  1W8Z A;  5FPU A;  4I09 A;  4B1L A;  5IVJ A;  2ZEZ A;  2VH9 A;  4RS5 C;  4W6X A;  3WT3 A;  4CXY A;  4UW5 A;  1ASJ 3;  1EY2 A;  1OF4 A;  1YFX A;  1ND3 C;  1XYN A;  5HBA A;  3MV1 1;  2W1S A;  5L36 A;  5CNA A;  5FPL A;  4W6Y A;  3POI A;  3WDU A;  1YYN A;  4FVV A;  4KH9 A;  2ZEW A;  2O0O A;  4Q4Y 1;  1OMI A;  1QNW A;  2JDM A;  2XL9 A;  3TBD A;  1LED A;  2MEV 3;  1PMH X;  3D4K A;  2XKO A;  1IPS A;  2WFF 1;  3ZM8 A;  2HWF 2;  4B7K A;  1JH5 A;  2LRP A;  2WT0 A;  1YQ6 A;  1RIT A;  2PHD A;  2PXJ A;  2D6K A;  2XB6 C;  2RS5 1;  4F7Z A;  2CDP A;  4QDQ A;  3M3O A;  1S0I A;  2C9A A;  4W6W A;  4YGE A;  2D98 A;  5CG9 A;  4CU6 A;  4QPI A;  4K9S A;  5F5I A;  5FXX A;  1H2N A;  1EP0 A;  1XBF A;  3MZH A;  4EWE A;  5JSP A;  1C1L A;  1ZBA 1;  2D6N A;  2WQZ C;  4NAM A;  4CCN A;  1RUD 1;  3OCP A;  4EV0 A;  2VZ3 A;  5FWJ A;  3Q8A A;  1CAX A;  4PF5 A;  5CKM A;  5FZ7 A;  1UYY A;  3WDX A;  2C9K A;  3BB6 A;  3T0D A;  1YXW A;  4AVB A;  4WVZ A;  4ZPI A;  5FZM A;  1EUT A;  3SLI A;  3HNY M;  1OC1 A;  4C0H A;  3JD7 2;  3DN7 A;  1G86 A;  1XOY A;  1PNG A;  2VC9 A;  2ZGU A;  3KT7 A;  3ZN4 A;  1DQ2 A;  2D6P A;  4NN0 A;  3AZZ A;  1Q5O A;  4P5Y A;  4XF3 A;  3ZSL A;  4RHV 3;  3WDV A;  4BCU A;  3VLB B;  4ET7 A;  1RVF 2;  2W95 A;  3LD8 A;  4XBL A;  2YV8 A;  1ZA7 A;  2B9U A;  4RGG A;  2ES3 A;  5DAB A;  1GOF A;  1H2K A;  4KG0 A;  4UF0 A;  1ZRC A;  4ZON A;  3U14 A;  1H4G A;  3OOX A;  3WNP A;  1DLL A;  2IXJ A;  1D0G A;  4XAC A;  5C9A C;  1G9B A;  2H6B A;  3LB9 A;  3OPW A;  4I3G A;  1DF0 A;  1QQP 3;  1AR9 2;  2A6V A;  2VMD A;  1ENQ A;  1GAN A;  2Z42 A;  2ZKN A;  4K1Z A;  2A71 A;  2P17 A;  3LWC A;  4WV8 A;  5FTT C;  1W6M B;  4RN5 A;  4ES8 A;  4P9X A;  2DU1 A;  1YFW A;  2X5I C;  3KM5 A;  2VEC A;  2VUA A;  3WW4 A;  2AYH A;  5C6C A;  4MX3 A;  1KDM A;  1WCS A;  5FY5 A;  4BQ4 A;  3QCW A;  3MEP A;  4RSU A;  5C5U A;  1UZ0 A;  4DB5 A;  3FFZ A;  5IVF A;  4K20 A;  3ZFF B;  4OHY A;  3IAP A;  4E27 A;  2GC0 A;  1SQ4 A;  1LEC A;  2WII B;  2G9Z A;  2JEC A;  4IEY A;  1HW5 A;  1ULG A;  4KWJ A;  3AYA A;  3I54 A;  3LOB A;  1LHN A;  2DCY A;  2WLQ A;  3OPZ A;  4OZO A;  3VHR A;  5JZG A;  4QKD A;  2OPW A;  4R9D A;  3VBU B;  1XXN A;  5JOZ A;  1LEN A;  4UW3 A;  4TYS A;  4C1X A;  3LA7 A;  4QKN A;  2V5D A;  2RMU 2;  2GN3 A;  4M00 A;  4LIV A;  4OI4 A;  4JDM A;  1QH7 A;  2ZXQ A;  5F1R A;  3RZZ A;  4RD7 A;  5JOY A;  1N1V A;  1OH4 A;  3IBM A;  1F15 A;  2VNV A;  1UAI A;  1H8T B;  2PHT A;  2XUM A;  3POY A;  4FOQ A;  4NWW A;  1X9P A;  5FJH A;  3PVE A;  2WKK A;  3T08 A;  3I2D A;  5BY5 A;  1I5Z A;  3R05 A;  4QPI B;  1UY2 A;  1LHV A;  1V9U 2;  1KJL A;  1DG6 A;  4QXC A;  5C3Q A;  4BXF A;  1IPJ A;  1TNF A;  1CPN A;  1UN1 A;  4FAH A;  3VDD C;  3P3N A;  1POQ A;  3UGG A;  4AI3 A;  4CEY A;  2W1U A;  3B93 A;  3THT A;  3C8X A;  1MQT C;  4RQP B;  5L19 A;  2FD8 A;  2ARX A;  1O4Z A;  2BER A;  2RM2 2;  4XUN A;  2PYT A;  5F9T A;  1RYY A;  3TN9 1;  4HKO A;  5J7M A;  4LA3 A;  4YW5 A;  2PA7 A;  1WA4 A;  2XUE A;  3DKQ A;  4FPG A;  3S0M A;  2Y60 A;  3BAL A;  3N9Q A;  2YYO A;  1UY0 A;  2DVG A;  2RR1 1;  4H7M A;  5JSR A;  3K48 A;  4XBN A;  1W0O A;  2OUJ A;  3ST7 A;  4O9E A;  2LTN A;  2VQA A;  4YM0 A;  1JYX A;  3UJO A;  3WNO A;  3EXU A;  3HBZ A;  2HWB 1;  2HWF 3;  3CQO A;  3OBR A;  4BOW A;  4OFG A;  1BZW A;  4URT A;  3WUD A;  4DOU A;  3V64 A;  1T6B X;  2W1Q A;  1QF3 A;  3FJS A;  1R08 1;  1HB4 A;  3AZX A;  4NHY A;  5DAV A;  3ZFG A;  3DL3 A;  4Y33 A;  4LMF A;  3NNL A;  2H6C A;  1OLM A;  4P9I A;  1Q8V A;  2AAC A;  5FAX A;  3JUU A;  3GJB A;  2XKP A;  3AKP A;  3CF6 E;  2O8O A;  2YUE A;  4XHX A;  4YWA A;  1PMJ X;  2B46 X;  4CRQ A;  1R1A 3;  3VL8 A;  2QFE A;  1RMU 2;  3MW4 A;  5KXD A;  3WP3 A;  1NG0 A;  2LW8 A;  3FLT A;  5LA2 A;  1F9K A;  3AZW A;  4FQ4 A;  1RIR A;  3WX5 A;  4HK9 A;  3JD7 3;  1CPM A;  4YRD A;  5CFC A;  1W0P A;  3KT4 A;  1UX7 A;  1DZQ A;  3T2T A;  4OI1 A;  3V0A A;  3ZFE A;  2ZBJ A;  4A2U A;  5KHH A;  1KEX A;  3EB7 A;  1GQP A;  5KXE A;  3MUZ 1;  2JG8 C;  1DQ4 A;  2JD4 A;  3I2J A;  4D6Q A;  1RVF 3;  4DXZ A;  3KV6 A;  2PHR A;  1F5F A;  2NPI A;  1AYM 2;  5E16 A;  1ULO A;  4QX3 A;  5I8T A;  3WNL A;  1W3X A;  5DUU A;  5KC6 A;  1CJD A;  5HXM A;  4HSJ A;  3EBR A;  4LK7 A;  1JZ7 A;  3BU0 A;  2OXB A;  3AZY A;  5A6Q A;  1OA2 A;  3MF6 A;  4CCE A;  2MNG A;  5HV4 A;  4LNV A;  1ZRE A;  3MFC A;  4YG0 A;  4KU8 A;  1AR9 3;  4XDQ A;  3BOD A;  2VJX A;  3L9J T;  4FOV A;  4E9K A;  1X50 A;  3IMM A;  4HSL A;  4QKB A;  4QDR A;  4XZP A;  2Z69 A;  1DBN A;  1AR7 2;  2R07 1;  1W6P A;  5FZF A;  4XXA A;  3SCH A;  3BCW A;  2DWR A;  3ACF A;  4JRL A;  4BYY A;  1IPK A;  5I0T A;  2VMG A;  3NJX A;  4N9H A;  4FTB A;  3K3O A;  4E8C A;  1DGR N;  3MIF A;  4UFJ A;  5FO8 B;  2FHR A;  2W91 A;  4N90 A;  4YZ4 A;  2XVL A;  2BFU L;  3ZDS A;  4PIY A;  2PMW B;  3T09 A;  5LW9 A;  1C8M 1;  2HJI A;  2VZO A;  1DYO A;  4WBB A;  1DGW X;  5JIA A;  4MYE A;  2P3J A;  4P9L A;  1QOT A;  4HVR A;  4A45 A;  1AR6 1;  3IZO A;  5AC9 2;  5LBE A;  3VBO A;  5CKN A;  3N3H A;  4JTO A;  5J36 A;  1GKB A;  1GIC A;  1NA1 A;  1SDW A;  4IER A;  5FZL A;  5A3L A;  4CE8 A;  2B45 X;  1QHD A;  5D2A A;  1RED A;  1ZRI A;  3PVO A;  2RMU 3;  3NQH A;  3P3P A;  3W59 A;  5IVC A;  2JD9 A;  2V5Y A;  3TYJ A;  1IQD C;  3PME A;  3WHT A;  2BOI A;  1QJU 2;  1LJ7 A;  4JGY C;  5B4X A;  1XNK A;  1IQA A;  5KHI A;  4FP3 A;  4KGQ A;  3DYO A;  3HOB A;  1XNC A;  1SDD B;  2VY0 A;  1E5I A;  2O14 A;  4F83 A;  2EA7 A;  1FAY A;  1V9U 3;  1R64 A;  1U5Z A;  4GMP 0;  1E5R A;  4HT1 T;  2DBN A;  4P14 A;  5IFT A;  5CYY A;  3KSC A;  4YG6 A;  4D7S A;  4Y22 A;  1DHK B;  1N3Q A;  1ND2 C;  1VMH A;  1YI9 A;  4LOT A;  3PL0 A;  3K2O A;  3SNM A;  2CTV A;  4MLO A;  4FPL A;  1C8N A;  4BWO A;  2SBA A;  3EMR A;  3TOJ A;  4YFZ A;  3DPR B;  4GMP 1;  1GZT A;  1HRV 1;  1W8O A;  4COW A;  4CYD A;  4OCT A;  2DVD A;  1MEC 3;  2UWC A;  3VGI A;  4Q4V 2;  1N3P A;  2BYV E;  3GZU C;  4XJZ A;  5L9B A;  3VHN A;  1OQE A;  3WQB A;  1ULE A;  3U10 A;  2EID A;  2Q30 A;  3V0A B;  1VB4 A;  2NQY A;  1NCQ A;  2WZR 3;  1J3P A;  3M3I A;  2YU1 A;  4XDO A;  2RS3 2;  4PLM A;  4YVW C;  1UZW A;  3WP4 A;  4Y4Y A;  3QAC A;  2VGD A;  3HNB M;  2R0F A;  5H9P A;  3W5N A;  1QNY A;  3PU3 A;  3WCS A;  2ARB A;  4AEK A;  3H8O A;  1UZV A;  3E5Q A;  5C3S A;  4IL7 A;  4YGB A;  1ST8 A;  4WVM A;  5LBF A;  3IKW A;  1JOB A;  2GZW A;  1NUK A;  1ZZ9 A;  2Q8O A;  3VBR B;  3ENR A;  1NYW A;  3VD7 A;  4JZR A;  4CDQ A;  1WLT A;  3NAP A;  4IDZ A;  1W8T A;  3VBS A;  2GDF A;  2V09 A;  3H0O A;  4RR3 C;  5KR7 A;  2AEZ A;  2J1V A;  2XBO 2;  4XUR A;  1NLQ A;  4DZG A;  2GH8 A;  4EJR A;  1RMU 3;  2W68 A;  1W9S A;  3W20 A;  1OFN A;  1SLC A;  2VZR A;  3SH4 A;  1W2O A;  2RVA A;  2LM3 A;  4XW3 A;  5FZK A;  4OI0 A;  1Y43 B;  2BFU S;  2C26 A;  1BQP A;  1PGW 2;  3A22 A;  3C7E A;  1IS4 A;  3JBG 1;  3MLL A;  1D4M 2;  3DYM A;  1I6X A;  5FLH A;  3KF3 A;  4YVS C;  3VBO B;  5DUV A;  4AOC A;  5IK5 A;  3K75 B;  3RZG A;  1W2T A;  5CB7 A;  1NA1 B;  2P1B A;  1L7R A;  5C4W B;  3O1P A;  2DCJ A;  2VBD A;  4GB3 2;  2WO3 A;  4PQQ A;  3JB4 C;  1DIW A;  1US3 A;  4IW3 A;  2NM1 A;  1AYM 3;  1RUF 1;  3III A;  4QX5 A;  4EWD A;  5L7O C;  1HJF A;  5I93 A;  1VRB A;  3RYK A;  1QJF A;  4JCK A;  2ZGS A;  4GWM A;  1IHM A;  2J1T A;  2OZJ A;  4AHW A;  5LCW L;  2W52 A;  4PLN A;  1X9T A;  2YC2 A;  1QOS A;  1UU4 A;  3HPN A;  3IPV A;  3SCG A;  4A44 A;  4W4Z A;  2D5F A;  3IN9 A;  1NLR A;  1Q8S A;  3GCX A;  1FPN 1;  3OY8 A;  4MGQ A;  1AR7 3;  2ZX0 A;  4AHY A;  4B29 A;  2KM2 A;  3CJI C;  4FFG A;  1NE4 A;  2WFF 2;  1PGL 1;  1LU1 A;  1FX5 A;  2W08 A;  2VZS A;  3SMH A;  1X36 A;  2UY9 A;  1JZ5 A;  1WGP A;  1S0F A;  4XJW A;  4Y22 B;  2RS5 2;  4N53 C;  5B4N A;  4HFS A;  2EXK A;  1F31 A;  4IES A;  3O14 A;  4B1M A;  1JYC A;  3KV5 A;  4IEZ A;  2JDU A;  2AGS A;  1WA6 X;  4RFT 0;  1MVQ A;  2IFW A;  4XTP A;  5LEJ A;  1H8V A;  4ZZ5 A;  3B69 A;  1YWK A;  1LGN A;  1ZBA 2;  2J22 A;  4IV3 C;  4AR2 A;  1RUD 2;  5I0D A;  2Y26 A;  2ZGQ A;  5LA9 A;  3KCC A;  5FMB A;  4R4Z A;  1KFU L;  3KGL A;  1JYW A;  3RS6 A;  3SCF A;  2Y6F A;  5JDB A;  1AXY A;  3M4F A;  4XIL A;  4XPV A;  3UKT A;  3RZL A;  1QJU 3;  4B8E A;  3CHX A;  2XON A;  3ACH A;  3ZSJ A;  1HLC A;  5LRS A;  4IND A;  4AZZ A;  2XJT A;  4QHB A;  1UF2 C;  2B39 A;  5A7S A;  3WP5 A;  3IWZ A;  4CUA A;  5LK5 A;  3BKZ A;  4N8M A;  5IHR A;  4XXP A;  1FV2 A;  1TQ5 A;  2Y64 A;  5FK8 A;  1O91 A;  1FV3 A;  3N4M A;  1Q43 A;  3NNF A;  1XRU A;  4CDQ B;  5A1L A;  1LOB A;  3VD5 A;  3VBS B;  3LSE A;  4HBN A;  4NRP A;  2XQR A;  1Q8O A;  2FZ1 A;  4ZS3 A;  1PK6 C;  3A23 A;  5FMO S;  1ULD A;  1G9D A;  4PIX A;  1LOF A;  3HQX A;  2VU9 A;  3BTZ A;  1MS8 A;  4I2O A;  3T1L A;  3BI3 A;  2DVA A;  4ARY A;  3CLP A;  5DPN A;  1FOD 1;  2E31 A;  2DVF A;  1PX4 A;  1M4W A;  3IB3 A;  3CMG A;  1CX4 A;  4LUK A;  4Q4V 3;  5FUP A;  3R4U A;  1DU3 D;  1ULC A;  2J1A A;  1YRZ A;  3VZO A;  4FPF A;  4OLL A;  1HV1 A;  3C7H A;  1RUG 1;  3CL1 A;  2W0X A;  2XVK A;  4HKL A;  2VVD A;  1C28 A;  3DXU A;  1OOP C;  3ORJ A;  4A4A A;  3EHK A;  1W6Q B;  2RS3 3;  5F32 A;  3J8F 1;  4ONU A;  2VZU A;  4KWK A;  1DLC A;  2YXS A;  3D3A A;  3HD8 B;  5A7W A;  3THP A;  3OBA A;  3KV4 A;  1NCR C;  1CVN A;  4Q4X 1;  4Q0S A;  5F3C A;  5IW0 A;  1BMV 1;  2ZAC A;  4CUG A;  4DEQ A;  4CEW C;  4FT8 A;  3KMH A;  5EZW A;  2BVV A;  1EYB A;  4DMI A;  3IPV B;  5JR2 A;  4EN8 B;  4KBB A;  3S57 A;  5BXX A;  2H0B A;  5C8C A;  5A32 B;  1WW5 A;  2XBO 3;  4J1X A;  3B9C A;  5F37 A;  3NNJ A;  3OYW A;  1EV1 3;  5FZA A;  1AL0 G;  2BUK A;  3CEW A;  3I59 A;  3DF0 A;  3WG3 A;  4CDU A;  2YFZ A;  2CHH A;  2HWD 1;  3PTR B;  4JDN A;  4LHK A;  5JI7 A;  4NID A;  5FZ8 A;  2XH6 A;  4IEU A;  1JOJ A;  5BNO A;  4MGY E;  3DKW A;  5BNN B;  1JOP A;  1N47 A;  1MS1 A;  2ENR A;  1LRH A;  3MIB A;  3M3Q A;  3WW1 A;  2Y34 A;  2V4V A;  1HXS 2;  5GLW A;  1VBA 1;  4GH4 A;  4NHK A;  2V4A A;  3Q9O A;  5I8S A;  1HRI 1;  5BV6 A;  4GB3 3;  1BLZ A;  1KDK A;  4FPH A;  3GHM A;  1HB2 A;  3BTA A;  2PN5 A;  4CDW B;  4LQR A;  3HNM A;  2AEN A;  1XSR A;  1WMX A;  1D0H A;  3TN9 2;  1DZR A;  2FZ2 A;  1JZ4 A;  5FFO C;  5FZH A;  3KD4 A;  4ASK A;  2ATF A;  4NRM A;  4Q0Q A;  2RR1 2;  4Q4Y 3;  4NRO A;  2XHK A;  4FPC A;  3LF7 A;  5A7O A;  4XQ4 A;  2VNR A;  2WFF 3;  2HWB 2;  4JC1 A;  4JV4 A;  4LPL A;  1ENR A;  3H8U A;  3FHI B;  4CCD A;  1AHS A;  3DUI A;  3FUQ A;  2RS5 3;  4XUT A;  1R08 2;  1H1A A;  1PZ7 A;  1B35 A;  3EQE A;  4JGZ A;  5IK7 A;  5GLV A;  1Y3T A;  2VL4 A;  2E6V A;  4U2A A;  5KHJ A;  4I01 A;  2VM9 A;  4XZU G;  2VCC A;  3ZSM A;  1VBE 1;  5IVE A;  1ZBA 3;  2E7Q A;  3U4X A;  1RUD 3;  3W9A A;  1XYO A;  4HAN A;  4XDP A;  4XHB A;  3NL1 A;  3ZSK A;  5EV7 A;  1FT9 A;  4AAP A;  2WAB A;  2ZTN A;  2VTX J;  2BEO A;  2PAM A;  3VB9 A;  3AJY A;  2PHW A;  2DV9 A;  2F4P A;  1WLW A;  1LNS A;  3T2Q A;  2QDN A;  3VBF C;  2W87 A;  3AP5 A;  1QWR A;  2HWE 1;  4EQV A;  1AX0 A;  2NZ9 A;  1RUE 1;  2WZ8 A;  2R49 A;  3QLQ A;  4AFA A;  2BPA 2;  1D2Q A;  3POW A;  5DQ0 A;  1VAV A;  1EAH 1;  2RHP A;  1SHW B;  4CP2 A;  5C8C B;  2ZGP A;  5FPZ A;  3ZPY A;  3G7D A;  3I2F A;  1PIV 1;  2XJS A;  3OYW B;  1VJ2 A;  3RYR A;  4GZ9 A;  3N36 A;  3THC A;  4QX2 A;  3TWI A;  1P8J A;  4N43 C;  4A3Z A;  2KR2 A;  5C33 A;  3I59 B;  5IVV A;  4CDU B;  1YQ5 A;  1YCI A;  2R07 2;  4L92 A;  3QOP A;  4YM1 A;  5FY0 A;  4DNY A;  5C3P A;  4LO7 A;  3IDA A;  1W06 A;  4LOS A;  1R1Z A;  3SH3 A;  5BNO B;  1NY7 2;  1GP4 A;  2VOK A;  3W5M A;  5FOB B;  5CIS A;  1W6N A;  1QY4 A;  4RS5 A;  1XNB A;  2GNB A;  3SC7 X;  3N35 A;  4M0H A;  4UWD A;  5T5J A;  1ND3 A;  4KMQ A;  2VO5 A;  3T2P A;  1C8M 2;  4UI9 L;  4NE9 A;  4CTE A;  2Y0I A;  4AAX A;  2RE9 A;  1AZD A;  4XYX A;  3TAY A;  5FMD A;  1MS9 A;  2NYY A;  1OUR A;  4YPJ A;  2VVF A;  2ET7 A;  1C5H A;  4EN6 B;  5C7G A;  1AR6 2;  2OT7 A;  1BVV A;  1MZF A;  1AL2 1;  2VMI A;  3K4D A;  4FTS A;  2ILM A;  2CL2 A;  3A4U A;  4HVQ A;  4TSV A;  3WDW A;  5ABJ C;  3LDK A;  4YM2 A;  2J7M A;  3LA2 A;  1SFN A;  5LA1 A;  3R4D B;  4IEX A;  3KWV A;  1OT5 A;  3DYP A;  3VL9 A;  4IV1 C;  1VE0 A;  3S5A A;  1NQJ A;  5GZF A;  5L9V A;  5C70 A;  1C3H A;  4KNC A;  4CDX A;  2IC1 A;  4OUM A;  1B35 B;  3WV6 A;  3PVB B;  4JGZ B;  2YG0 A;  1AR8 1;  5IYY A;  4TWT A;  1SLA A;  5E88 A;  4LJH A;  2BNO A;  1IS3 A;  2VQU A;  1WMD A;  1JU4 A;  1DYK A;  2PEL A;  4P9Y A;  2WNE A;  3Q8E A;  4TLG A;  4AG4 A;  4MH0 E;  5K0U C;  1KS4 A;  5E8A A;  1OLQ A;  2RDS A;  1HRV 2;  4PLO A;  3THD A;  2VOX A;  2EXJ A;  3TN9 3;  4K8R B;  2YRO A;  4YW2 A;  2WWJ A;  4R4X A;  4BQ1 A;  1OHF A;  4PDW C;  2A6Y A;  2ZS6 B;  3LIH A;  3DCQ A;  5EPA A;  5L9R A;  2RR1 3;  1XU2 A;  3CO2 A;  2WZP P;  1H0B A;  1VAL A;  2GSY A;  4GWN A;  4JKK A;  5C9A A;  3WY6 A;  4QX1 A;  1MS3 A;  4XF4 A;  4GAL A;  2HWB 3;  2FDK A;  4IE6 A;  4H7L A;  5FYS A;  2ET1 A;  2WC2 A;  5I0U A;  3POS A;  5BPX A;  1NAE A;  3OUJ A;  4FFI A;  4RFR B;  3SHR A;  4QQH A;  4IE0 A;  2IXI A;  1R08 3;  1JZ3 A;  2DTW A;  2WSV A;  2X5I A;  1K5M C;  4EN9 B;  5C3O A;  4UFI A;  3VBU A;  4DFS A;  3U4S A;  3ACL A;  1GQH A;  2K9Z A;  3R6S A;  2VZQ A;  4LBN A;  5FK7 A;  5HV0 A;  4M3C E;  3DEM A;  3PDQ A;  5JPN B;  3PU8 A;  3ZKU A;  2MPF A;  1W6N B;  1LOE A;  4RS5 B;  1H6Y A;  1H8T A;  2BOJ A;  2DYC A;  2OZ6 A;  3GXU A;  3J7L A;  2L9L A;  4HKW A;  4I30 A;  4Q26 A;  3WCR A;  1ND3 B;  4L97 A;  1DQ6 A;  1CZS A;  4P5H A;  4RYD A;  2DUP A;  3VUO A;  4YGC A;  4BHP A;  4NHM A;  5LEK A;  2DBI A;  3JBG 2;  4BLJ A;  4XUQ A;  1JS9 A;  1LOA A;  3E5U A;  2XJQ A;  4ES9 A;  4R9B A;  5JLV A;  1S0J A;  3RZH A;  3I2K A;  1XND A;  1Q3E A;  2BBA A;  5AVP A;  1OD3 A;  4FXK B;  3T2O A;  4CP1 A;  2Y33 A;  1O5U A;  2I2S A;  2V72 A;  2XQX A;  4H2A A;  4CP0 A;  1UY1 A;  2X09 A;  5I0S A;  1R1A 2;  4CP9 A;  3N7J A;  4PHZ A;  4RQP A;  1RUF 2;  4QX0 A;  5K4L A;  5FO7 B;  3VHP A;  1PVC 1;  2ARE A;  3P6B A;  1SFY A;  2TUN A;  4MET A;  5A1F A;  1L7L A;  2WBK A;  3WD5 A;  3AL6 A;  1V6K A;  1CAV A;  1LAJ A;  1OF3 A;  5TSW A;  1UYP A;  2YU2 A;  2ZGK A;  4SBV A;  3GDB A;  4CDX B;  3ROU A;  3ZXF A;  1YFY A;  1PO1 1;  2C5D A;  3AVS A;  5FZE A;  3ZYR A;  2R07 3;  1FMD 1;  2FDF A;  2WS9 1;  2MHF A;  4AQS A;  3ZXJ A;  3I3M A;  5KHG A;  1MQT A;  1PGL 2;  3E1F 1;  2G19 A;  2A3W A;  5A7N A;  2CV6 A;  1IOA A;  4BK5 A;  2B5H A;  4YG3 A;  1BK0 A;  3WNN A;  3WNM A;  1REF A;  1C8M 3;  4P08 A;  5JR7 B;  3RJ2 X;  3ZYP A;  3ECQ A;  4W50 A;  4XBQ A;  1K12 A;  5F7U A;  2ORX A;  5JUV A;  3ZXG A;  1XE7 A;  5EJ3 A;  5FP4 A;  1AR6 3;  3EJK A;  5JPM B;  1ZVF A;  1RIN A;  2QQI A;  1VAK A;  3GM8 A;  3VD9 A;  1N3O A;  4IGO A;  4OUE A;  4NAO A;  5A3O A;  4D6R A;  4HON A;  2ZGM A;  4XAB A;  1LR5 A;  4ASM B;  3C7G A;  3VKN A;  5C9A B;  3FL7 A;  3NRU A;  2XWJ B;  1OLR A;  4XFG A;  5L73 A;  1WCU A;  2XL7 A;  4LLO A;  1VAM A;  4A6O A;  1LUL A;  5D8A C;  2E7T A;  4FQZ A;  3VZJ A;  2J1E A;  5FJK A;  3T4H B;  4XFC A;  3P5B A;  4QM8 A;  2X5I B;  4PI0 A;  5GZC A;  3RGB A;  4Q1P A;  2C0Z A;  4XAA A;  2YZ4 A;  1JOD A;  4B3N A;  3ZMN A;  1TEI A;  2WA3 A;  1S1A A;  3VDC A;  3WF0 A;  4ASL A;  3HAG A;  1QJX 3;  5IAV A;  5HCF A;  4CU7 A;  5T50 A;  4TZD A;  1BK1 A;  3ME2 A;  2QQK A;  3O0X A;  1QJZ A;  3CNA A;  3UES A;  3K77 A;  4NII A;  2VD7 A;  2E32 A;  5J1X A;  4GMP 3;  4K6B A;  4M01 A;  1HRV 3;  3ZO0 B;  2VMF A;  4QX7 A;  3CBN A;  2JG8 A;  4AED C;  1RUJ 1;  4TN7 A;  1GOG A;  1UKG A;  4NIH A;  3WOG A;  4NHX A;  1WME A;  1QDO A;  1RUG 2;  1S0E A;  2ZEX A;  3ZLI A;  5K7P A;  3UKV A;  1YNA A;  2ZGL A;  3ETP A;  4Y5T A;  2HLE A;  2IUW A;  5FPA A;  4CP9 B;  1O3T A;  4GXL A;  1EPZ A;  2IVI B;  1J58 A;  1J1T A;  2BRT A;  2GNM A;  4TLF A;  5FZ3 A;  3I2I A;  2ZGT A;  2VBB A;  2CNA A;  4Q4X 2;  3RJR A;  4C91 A;  1BMV 2;  2C6S A;  1W3V A;  1CGP A;  4E4D X;  1UL9 A;  5JAX A;  1MEC 2;  4ISR A;  4B4R A;  1CAV B;  1PZ9 A;  5F5Q A;  3OBZ A;  1U5X A;  2HYX A;  4BB3 A;  2VCM A;  4D7Y A;  1NQD A;  1JN2 P;  4Q0V A;  3VDD B;  2WZR 2;  2DCK A;  4PBP A;  1CZT A;  2OS2 A;  5JOW A;  4BH9 A;  1D7P M;  1MQT B;  2R6Q A;  1SAC A;  2EAA A;  4NWV A;  4Q1R A;  3TNP B;  2AUY A;  4BPZ A;  4BK4 A;  4X6R B;  2AR6 A;  1W39 A;  2EIG A;  3L2H A;  1DDL A;  3WF2 A;  1CZV A;  4AFD A;  4COV A;  3OB8 A;  2HWD 2;  4LBJ A;  1YC6 1;  3PJQ A;  3JBG 3;  5GJ6 A;  3LEM A;  3ABZ A;  1YIP A;  2WA4 A;  1VBB 1;  4KQ7 A;  3H50 A;  2EAL A;  1YQ8 A;  5JSO A;  2B7Y A;  3PUR A;  3PUH A;  2HEW F;  1WD3 A;  4ISQ A;  2JE9 A;  1PM7 A;  2ERF A;  1VBA 2;  3OEA A;  2C1F A;  3D0S A;  3KHB A;  1HRI 2;  5FYZ A;  1H2M A;  4XFB A;  3H3U A;  1PGS A;  5JCT A;  3MDP A;  1RUF 3;  2XG3 A;  1WW6 A;  1PHM A;  1C57 A;  3U37 A;  3DPR A;  4LBK A;  4CPB A;  3T1M A;  1XYP A;  3POJ A;  1S55 A;  4A7K A;  4YM3 A;  2ZZQ A;  5FYC A;  3SEP A;  1UXX X;  1NXM A;  3KT1 A;  1F4A A;  1DP0 A;  4Y24 A;  2K0G A;  4YYO A;  5KBF A;  1ZZ8 A;  3B01 A;  2QQV A;  3POB A;  4UBH A;  1SBD A;  1FPN 3;  3ZIX A;  1LHW A;  1UMZ A;  2F17 A;  4NVP A;  4X6Q B;  5FRE A;  3RQ0 A;  1JW6 A;  3AYD A;  3JU9 A;  5JZG C;  2A7A A;  5BYN A;  2WUH A;  2WAO A;  1R09 1;  2QQU A;  3BUC A;  1NXD 1;  3LE0 A;  5A6Y A;  4NIG A;  3D6E A;  4GJY A;  3U07 A;  5EJZ B;  3VBR A;  1G6N A;  3T0A A;  5DAP A;  4AQT A;  5LY1 A;  3VZM A;  4LBO A;  1JXN A;  1YQC A;  4IEV A;  4BQW A;  1UOF A;  1VBE 2;  3B5L B;  4Q5O A;  2GAL A;  2JG8 B;  1AUY A;  3FLP A;  4DQA A;  2JDK A;  2R1D A;  4YVW A;  2GC3 A;  1J1L A;  2W9X A;  2JG9 C;  1LOC A;  2NMO A;  5A3P A;  1HV0 A;  5FZO B;  5J96 B;  2D40 A;  2ZHN A;  4MGK E;  3WF1 A;  3ZKY A;  1YHF A;  2P4E A;  4E8D A;  5FO9 B;  4ZZ8 A;  3HWJ A;  3MW2 A;  4XUO A;  1JYT A;  4LTA A;  5EHD A;  3WDY A;  4CEY C;  4GAZ A;  5FYI A;  4JHT A;  4CA9 A;  2XJR A;  4XTM A;  4BJ0 A;  1JYV A;  1V6M A;  2HWE 2;  3VDB A;  5CG8 A;  4QX8 A;  3HR9 A;  4P02 B;  3ETQ A;  3ZYB A;  1RUE 2;  2C4X A;  3GJA A;  4RR3 A;  4ZU4 A;  1S0B A;  5C4W A;  1H9P A;  3RMY A;  4KBZ A;  3K3N A;  4HXC A;  1GP5 A;  1W9W A;  1EAH 2;  2LS6 A;  4JTN A;  3SEE A;  4FSJ A;  2RDR A;  4QPW A;  1W05 A;  3N9M A;  1PIV 2;  4AFC A;  1YEW A;  3NV1 A;  5DDJ 1;  2A70 A;  1FOD 3;  1UO9 A;  3AFG A;  3P1I A;  1L7Q A;  1X8M A;  3KGZ A;  2GP5 A;  4IET A;  4YFW A;  5JXH A;  1WKY A;  1XB9 A;  1ZX5 A;  3M3E A;  2X05 A;  4QD2 A;  5LY2 A;  1SMV A;  4D0Q A;  5DZG A;  3ZFG C;  3AKQ A;  4FPJ A;  4LUL A;  4C90 A;  3NNG A;  5L7O A;  3AKS A;  1RUG 3;  3NNM A;  1O59 A;  3I3D A;  3ZXA C;  3AZV A;  4JGY B;  3MO4 A;  2I74 A;  4LO6 B;  2ZCW A;  3J8F 3;  4AFM A;  1GBG A;  1QU0 A;  1SCR A;  4CPB D;  4J1W A;  5FY7 A;  1APN A;  1G7Y A;  3NJZ A;  4CUC A;  4EWA A;  4Q4X 3;  3RSJ A;  4NPR A;  4QQO A;  5FP8 A;  1AL2 2;  3SXW A;  1C4R A;  4Z2W A;  3NKT A;  3DXT A;  2HBT A;  4OHX A;  2J1U A;  5CFC C;  3ZVX A;  4AHZ A;  4Q8L A;  2FBE A;  3AMQ A;  4RGA A;  2ARA A;  2BP6 A;  3ZFE C;  1ND2 B;  2A75 A;  2Z79 A;  1UW8 A;  2ZX1 A;  3OTF A;  1HB1 A;  5JI9 A;  1QJX 1;  4A3X A;  4YW1 A;  4D94 A;  5CEH A;  3I2O A;  4MSV A;  1PO2 3;  2YGM A;  3FE5 A;  5IJR A;  3MIG A;  4QGN A;  4BE3 A;  1CES A;  2HWD 3;  3ZN6 A;  3A7Q A;  1AR8 2;  1W2A X;  5F6K A;  5A3N A;  1UY3 A;  3O0V A;  4FO9 A;  4M3C B;  1L3J A;  2VCA A;  3AP7 A;  5FQ0 A;  2VAU A;  4R9A A;  4YVW B;  1VBA 3;  2WQ8 A;  3ILR A;  4UT5 A;  1HRI 3;  2WT2 A;  4MHR A;  1HIX A;  4XFH A;  1EV1 2;  3OD0 A;  4Y4R A;  2CY6 A;  3OGJ A;  4Z1V A;  4WZC A;  5LRR A;  5D21 A;  2P34 A;  4BQ2 A;  1JU3 A;  2VNG A;  4AXO A;  3POE A;  1UIJ A;  1RXG A;  2QQN A;  4XIK A;  4Z2A A;  1V6I A;  4PF1 A;  2G9F A;  3H8X A;  3PJY A;  3VD4 A;  1HN1 A;  2PLV 1;  4AYU A;  4RR3 B;  5IAT A;  4O7X A;  1PK6 A;  2W92 A;  1W6Q A;  5FMC A;  3ZOI A;  3DV8 A;  5C8W A;  1LHO A;  2G4I A;  1QXR A;  4LT5 A;  4GD4 A;  3O12 A;  4K40 A;  4MV2 A;  4R8H A;  4IE4 A;  2A6X A;  2CYF A;  4IQP A;  4LBL A;  4UW6 A;  4CCK A;  2UYA A;  2HEV F;  4KWU A;  1BXH A;  5J3U A;  3N7L A;  4AI9 A;  1GOH A;  2YBK A;  3AVR A;  3VD3 A;  5FPB A;  4Q4Y 2;  2ZHK A;  4LE4 A;  3O1U A;  1RL3 A;  1VBE 3;  1OOP A;  4HOO A;  5A32 A;  3HJR A;  4NR1 A;  4HL0 A;  2R04 1;  2JDZ A;  3KZ4 C;  4AHX A;  2ZGR A;  2QJV A;  2WWU A;  3CJX A;  5L7O B;  1VBD 1;  1O4T A;  2E7A A;  2WO2 A;  3HEI A;  3GCW A;  1UZZ A;  4OMD A;  4ARX A;  3RFR A;  1KRI A;  4I0W B;  4QU2 A;  1US2 A;  4QGM A;  5GZD A;  3ZYI B;  1SG3 A;  4ZHN A;  4ORF A;  4FPK A;  1UOB A;  1OBN A;  2BW8 A;  3MBW A;  5BNN A;  2HWE 3;  4R52 A;  5JWP A;  3O1M A;  1FXZ A;  1PNF A;  5GLU A;  3OGS A;  1RUE 3;  5G05 L;  2XJV A;  5DUW A;  2R32 A;  3CJI B;  1Z7S 1;  2BZD A;  4YZ2 A;  3JCI A;  4LA2 A;  5IFP A;  1EAH 3;  3CU7 A;  1OKQ A;  4QM9 A;  1OXC A;  1PVC 2;  2WQ4 A;  2ZOE B;  4ZS2 A;  4CDW A;  3LPF A;  3TRS B;  1PIV 3;  1NCQ C;  1UYX A;  4MG2 A;  2QQL A;  1CN1 A;  1VRH 1;  1CX1 A;  4LHL A;  1VMF A;  3AMP A;  3U78 A;  3WEZ A;  3M2M A;  3H3Z A;  3MV0 1;  4K3U A;  2BV4 A;  3APB A;  4QPG C;  4YW3 A;  4KU7 A;  5LB6 A;  1PO1 2;  2JE7 A;  1F2N A;  4IV3 B;  1TVG A;  2VW0 A;  2X10 A;  3WW3 A;  3ZN6 B;  4CU9 A;  2A6Z A;  2WS9 2;  3URF A;  2EIC A;  4LO5 B;  5H9R A;  1S2B A;  2BWA A;  5A3W A;  4NIA A;  5FQ0 B;  3NAP C;  4XCA A;  3OJB A;  1GYK A;  1W90 A;  3U75 A;  4YSF A;  1DQ1 A;  3E6B A;  4LBM A;  1YJL A;  4QHO A;  2CGP A;  1A78 A;  1KD7 A;  2I45 A;  3TNQ A;  5BUV A;  4E2Q A;  2BU9 A;  3POF A;  1W99 A;  2A73 B;  3MID A;  3UYJ A;  4AEJ A;  3H1Y A;  3HQU A;  4QWN A;  3SKV A;  5JMO A;  5GLT A;  4MGS A;  3AX4 A;  5F8P A;  1AL2 3;  1YFU A;  3GBW A;  5K9Y A;  3H7J A;  1NX9 A;  2WNV A;  1S4C A;  5CZK A;  3LDR A;  3OD4 A;  2D7F A;  3RNS A;  5C5T A;  1KFX L;  3B9I A;  4ATE A;  3M70 A;  5CFD C;  1PK6 B;  5IK8 A;  3LIG A;  1XPW A;  3VKM A;  4M0N A;  5ISL A;  3ZX7 A;  1J3Q A;  1GNY A;  3J9S A;  4AGV A;  2BQP A;  3LEG A;  3RI9 A;  4BIS A;  5I0R A;  3UGH A;  4DXS A;  4WM7 C;  3WW2 A;  3IT8 A;  1HKD A;  3ILF A;  3JQX A;  3JXS A;  3K4A A;  1UU5 A;  1KIT A;  2ZAH A;  1AR8 3;  4QU1 A;  2N7G A;  1XJA A;  2R0H A;  5KXB A;  4BME A;  1WCQ A;  4MO3 M;  3WUC A;  1OOP B;  1HX6 A;  1NZC A;  4E4H A;  2QBX A;  2Y8K A;  3UNP A;  1QJY 1;  4BQ3 A;  3RG0 A;  1SCS A;  3RWN A;  4I02 A;  1UOG A;  2Y0O A;  4EYU A;  2GU9 A;  2Q0A A;  2Q8D A;  1W9T A;  1RHI 1;  1DZT A;  1PO2 1;  1Y9M A;  5DZE A;  4JRA A;  4YGD A;  4RA0 A;  2D6O X;  4CEW B;  1AX2 A;  2RM2 1;  1ZZ6 A;  5IWF A;  1RUJ 2;  1RJ8 A;  3OUI A;  4XF9 A;  4DO0 A;  4A7Y A;  4G3Y C;  4Y5Z 0;  4QB2 A;  1MS4 A;  5FV3 A;  5FXW A;  3ASI A;  5HI0 A;  2RS1 1;  1ZYB A;  3H7Y A;  2LRO A;  4QT6 A;  3IMN A;  3I3B A;  5FY1 A;  1RUH 1;  1XC6 A;  3J7H A;  5F3G A;  4N43 A;  5F5C A;  4BMB A;  4XC9 A;  1SPP A;  1H9W A;  4ZXK A;  1UXZ A;  5CVR A;  5ACA 1;  3Q8F A;  2NMN A;  4QGL A;  4ITC A;  1TMF 1;  1EUU A;  1OSG A;  3BOW A;  3MI8 A;  2W3J A;  3RPQ A;  1RUI 3;  4AVV A;  2K46 A;  4LLF A;  1V6J A;  3B7M A;  5GZG A;  4YAR A;  3WR0 A;  5DAX A;  1GV9 A;  2Q4S A;  3IIA A;  5J48 A;  1GU3 A;  5FOJ B;  4PBO A;  3HVD A;  3ZYH A;  3GF6 A;  3AFK A;  3UT0 A;  3FMG A;  2CAU A;  2DFC A;  5FXZ A;  4OHV A;  1JZ6 A;  3TEZ A;  1LGC A;  2LUW A;  1IS5 A;  1J84 A;  2QVS B;  2XXZ A;  1UMH A;  3I2G A;  1LB2 A;  2W5F A;  3RVH A;  2R06 1;  2E63 A;  4G4F A;  3N7M A;  4HN1 A;  4AQ2 A;  2OX0 A;  5F6L B;  3PUQ A;  1H2L A;  3H3L A;  3AMM A;  1B09 A;  1VBB 2;  4RL7 A;  1QJE A;  1I5P A;  3VBH C;  5ABJ A;  1I3H A;  1J3R A;  1CIW A;  1RGS A;  2VQ0 A;  2WNV B;  2Y6J A;  3AK0 A;  4OYU A;  3TEX A;  3B3Q E;  4BIF A;  1CAW B;  1E5S A;  3MFA A;  1UCX A;  2QUO A;  3KVB A;  2PTM A;  3ZR6 A;  1PVC 3;  2ZGN A;  4WM8 C;  2ARC A;  3MPB A;  1J59 A;  1ZZC A;  3AKR A;  3R0R A;  1CWP A;  1SEF A;  4PIZ A;  4Y1X A;  4CCC A;  4Q0U A;  3ES1 A;  4Y3O A;  1ZBE 1;  5CAZ A;  2QDR A;  3V0B A;  2EVX A;  2PHU A;  4NPL A;  1RUO A;  3NMB A;  3AM2 A;  1FNY A;  1PO1 3;  1IZ3 A;  1C5I A;  1VLN A;  4FBF A;  3KQR A;  5T54 A;  1FMD 3;  2WS9 3;  3U0Z A;  2O1Q A;  4QXH A;  4AK3 A;  2YBS A;  5K0U A;  2YGL A;  1R09 2;  1YJK A;  3WNK A;  2ID4 A;  2SLI A;  3FHQ A;  3JQW A;  2OUH A;  1OH3 A;  2VCB A;  2ZX2 A;  4FPO B;  3A0K A;  3S6P A;  2VZV A;  1M06 G;  3N9O A;  3QD6 A;  4M4P A;  2X29 A;  3LOI A;  1TG7 A;  1AJO A;  4HVO A;  3VBF B;  2WYS A;  1BBT 1;  4FFF A;  2D3S A;  3IM0 A;  3NV3 A;  4NJ4 A;  5A3T A;  5IAX A;  3MYX A;  5DUX A;  5AC9 1;  2HWC 1;  2QNK A;  4XJU A;  2J1R A;  2ZGO A;  5DXD A;  4CCL A;  5LWB A;  1SLI A;  3AXD A;  3OGG A;  3N7K A;  2VUD A;  4OMC A;  3JB8 A;  1HDK A;  3D8C A;  2QTW B;  4MGZ E;  4LKF A;  4UFK A;  1W9F A;  4QB1 A;  2AC1 A;  1V6L A;  4MGI E;  1MS5 A;  2PQS A;  3A21 A;  5DG2 A;  3UET A;  4GH4 C;  5DAW A;  2BGO A;  4XFF A;  2UWA A;  4L9B A;  4N43 B;  1GNZ A;  1SPP B;  4MUV A;  4NPM A;  2VPV A;  3NV2 A;  3WVJ A;  4FXG B;  4MZU A;  1Q8P A;  3LDB A;  4JKM A;  3INA A;  3ZYG A;  1UNB A;  1DQ5 A;  3Q8B A;  5BNP C;  4FFH A;  1MAC A;  1OA3 A;  2A5Z A;  1Z78 A;  2OA2 A;  3BU7 A;  2PAE A;  3I49 A;  2D3R A;  3I4I A;  4KG8 A;  3UJQ A;  2OPK A;  4QAW A;  3USS A;  2GP3 A;  4IEQ A;  2VQT A;  1ZZ7 A;  2J42 A;  4QMA A;  2WNU C;  4AVT A;  2QQP A;  2TNF A;  1O8S A;  4UBG A;  5DDJ 2;  1RTV A;  2B9V A;  4P9G A;  1UY4 A;  1VB2 A;  3ES4 A;  3VZK A;  4N7U A;  3I7D A;  2Y6G A;  2J1S A;  4QQL A;  2VUJ A;  1RUJ 3;  5F3E A;  2WAA A;  1QXJ A;  5G04 L;  3C7O A;  4JGZ C;  1YI7 A;  1O6U A;  1TME 1;  5ABJ B;  1VP6 A;  3RMX A;  4UYB A;  3GGL A;  1IGO A;  2QZ3 A;  2RDQ A;  2IWG B;  3QH7 A;  1PX3 A;  1XNA A;  4IV1 B;  1HN0 A;  2PFW A;  3PTY A;  4LOR A;  4LXL A;  4D7T A;  1Z0H A;  2D44 A;  4DUX A;  4HPK B;  4DY3 A;  4OI2 A;  2RJK A;  1VR3 A;  2RG4 A;  4LBQ B;  1RUN A;  2Q1M A;  2R16 A;  1ULP A;  1UD1 A;  4IUG A;  5F2W A;  4D3W A;  3J26 N;  3V0B B;  2D6M A;  4MOA A;  1BVP 1;  1G9C A;  1QKQ A;  4J6G A;  3M1H A;  4JDO A;  3ILN A;  3OF1 A;  2YPD A;  1OLM E;  3AJZ A;  5T5P A;  1AXK A;  2HKX A;  3MIH A;  5JZG B;  2JIC A;  5K0U B;  3WSO A;  1DFQ A;  4LO8 A;  5IVY A;  5SV8 A;  5HCA A;  4EN7 B;  5DAQ A;  4GKX A;  2BBV A;  3IDC B;  2A3Y A;  2DF7 A;  4XVH A;  2R30 A;  2DTY A;  1LOG A;  1OPM A;  2VOV A;  4LIT A;  3SKJ E;  3HMY A;  3VZL A;  1PM4 A;  1RUI 1;  1Y9Q A;  4HZF A;  3LKJ A;  2CWS A;  4MAD A;  4PDW B;  1VBB 3;  2WO7 A;  2ZJC A;  3WXP A;  4IEO A;  1D4M 1;  3EYP A;  3WQ7 A;  3SIT A;  4AI0 A;  4XET A;  1URX A;  5A7Q A;  1WLD A;  2VW1 A;  3ZSE A;  5D8A A;  3N9L A;  3BPS A;  2UUR A;  4AEM A;  1K5M B;  3I3Q A;  4XQD A;  1HB3 A;  3S7I A;  3I97 A;  4EE2 A;  3L2Y A;  3S7E A;  2PLV 2;  4LR4 A;  4NO4 A;  2Q8C A;  5EJ1 B;  4ZU7 A;  4DY5 A;  2WFP A;  4YW7 A;  4Z82 A;  4QPY A;  4E4Z A;  1VIW B;  5EFU A;  2Q8E A;  1OVS A;  2OW4 A;  2IVJ A;  1R09 3;  3LEI A;  1IG3 A;  2OQ7 A;  2Q5T A;  5KWR A;  1POV 0;  3KHC A;  5FZ0 A;  1S0D A;  3ZXK A;  3B02 A;  2W2I A;  3ELN A;  2RV9 A;  4AED A;  4PJY A;  2WSU A;  5J37 A;  4XIO A;  1BEV 1;  1I1E A;  5T55 A;  3VDD A;  1FPN 2;  3OSD A;  4JQT A;  4CDX C;  5JOX A;  2R04 2;  5A33 B;  1N1S A;  1POV 1;  4BA6 A;  4CXW A;  1VBD 2;  1UOJ A;  3BIW E;  4CUB A;  4BQX A;  1ALY A;  2AEY A;  5CBL A;  2DUQ A;  3IDE A;  4H14 A;  5JXI A;  2P3K A;  1ENX A;  3SIS A;  2FMD A;  3MW3 A;  1DGL A;  1HQN A;  4A42 A;  1K3I A;  4V2W A;  3B00 A;  3VKO A;  3AL5 A;  3GHN A;  4NHL A;  3ZIW A;  5LAT A;  4CXX A;  1Z7S 2;  4HET A;  2IFR A;  2XOM A;  4IE5 A;  3NVC A;  5FYM A;  3FX3 A;  3GZA A;  1HJG A;  4GIQ A;  3HBK A;  1PMI A;  1AYN 1;  1S2E A;  2JEM A;  3OGV A;  4M3C F;  4KWL A;  2W39 A;  2IXK A;  4N9I A;  1F35 A;  1O5L A;  1W03 A;  3LFI A;  2W47 A;  1VRH 2;  2VVE A;  4UAP A;  4WVV A;  5DDJ 3;  2E26 A;  2VNO A;  3ZFF C;  5EWS A;  4DIN B;  3AMN A;  1ZRD A;  1WCK A;  5FY9 A;  3I8T A;  2ZMK A;  3AB0 A;  4M4R A;  4EZH A;  1VBC 1;  1WBF A;  2DDU A;  5FWE A;  3R4S A;  5T52 A;  3VBU C;  2FDI A;  2VXJ A;  4FI9 A;  4HK8 A;  5JIU A;  2PAK A;  2YDE A;  4BM8 A;  3NJV A;  3GZT B;  2LAL A;  4L99 A;  5D8A B;  1FOD 2;  2Z4F A;  2JDN A;  5H9Q A;  5IUQ A;  4TXW A;  2Y6K A;  1H4H A;  2JEN A;  2JWP A;  1WUV A;  5HCH A;  1H8T C;  4JVA A;  5FIX A;  4G9S B;  1C1F A;  2XJP A;  5EXO A;  4MXW A;  2GAU A;  4XE9 A;  2ZX4 A;  4QPI C;  5FZO A;  1IKP A;  5FBZ A;  1W9Y A;  4LKS A;  1CON A;  1JUH A;  2DUR A;  2WL1 A;  3J8F 2;  4MHU A;  5FBJ A;  1COV 1;  5HXV A;  4PQ9 A;  5FY8 A;  3HIF A;  2VOT A;  5LBC A;  3AC0 A;  2HEY F; 
#chains in the Genus database with same CATH homology
 5FZK A;  3UYJ A;  4QWN A;  5F2S A;  2YU2 A;  3PUR A;  5FY5 A;  3N9L A;  5FYU A;  4QXH A;  4BU2 A;  3AVS A;  5FYZ A;  5FZE A;  2YBS A;  5IVF A;  5F37 A;  4EZ4 A;  2OT7 A;  5FYH A;  5FZG A;  5FZA A;  5A7P A;  3ZPO A;  5FZF A;  3N9O A;  5FYC A;  5A7N A;  3NJY A;  5A3N A;  5FZB A;  1VRB A;  2Q8C A;  5IVB A;  3PTR B;  5A3T A;  5ISL A;  5FZ8 A;  4URA A;  5FZD A;  3K3O A;  4BIS A;  2Q8E A;  4IGP A;  5LWB A;  5FP4 A;  4Y4R A;  4CCL A;  5LW9 A;  5FYB A;  4LIV A;  2OQ7 A;  5FZ0 A;  3KVA A;  4IGO A;  4QU1 A;  2W2I A;  5FZ6 A;  5FPV A;  4D6R A;  4HON A;  5FYV A;  4GJY A;  5FZL A;  5FJH A;  4E4H A;  5FPU A;  5IVJ A;  5LY1 A;  4EYU A;  5FZH A;  2Q8D A;  3KV9 A;  3LDB A;  4ASK A;  5IVC A;  4QXC A;  4UF0 B;  4DIQ A;  3N9P A;  4BXF A;  5FP3 A;  3KV5 A;  5F3I A;  5FJK A;  5FPL A;  5FY4 A;  5FZC A;  4C8D A;  5A7O A;  5FZ9 A;  4GD4 A;  5A3P A;  5A7W B;  5IWF A;  5FZO B;  4CCK A;  2GP3 A;  5FUN A;  4DO0 A;  5F39 A;  2OQ6 A;  4V2W A;  2WWJ A;  5FV3 A;  3AL5 A;  5FXW A;  2YBK A;  4AI9 A;  3AVR A;  5E6H A;  5FP9 A;  4GAZ A;  5FPB A;  5FYI A;  4HOO A;  2PXJ A;  5ANQ A;  5FY1 A;  2XUE A;  5F3G A;  4QX8 A;  3N9Q A;  5F5C A;  2VD7 A;  2WWU A;  2XML A;  5FYM A;  5F3E A;  5A7S A;  5IVE A;  5F5I A;  3K2O A;  4CCM A;  3K3N A;  5FYS A;  5FXX A;  4QX7 A;  4XDP A;  4TN7 A;  5CEH A;  4CCN A;  5FWJ A;  4AAP A;  5A1L A;  5FP7 A;  3N9M A;  5FYT A;  4LXL A;  3ZLI A;  5FZ7 A;  3U4S A;  5F5A A;  5FY9 A;  5FYY A;  3PUA A;  5FZI A;  3OPT A;  4Y33 A;  5FPA A;  2GP5 A;  5FXZ A;  4GJZ A;  5FZM A;  4EZH A;  5A80 A;  5FZ3 A;  2XXZ A;  4QXB A;  5FWE A;  2YU1 A;  4XDO A;  5FZ4 A;  3RVH A;  5LY2 A;  4CCO A;  3PDQ A;  5F2W A;  3PU8 A;  3PUS A;  2OX0 A;  3PUQ A;  3PU3 A;  4IGQ A;  4CSW A;  5FUP A;  2YPD A;  4LIU A;  3LD8 A;  5FZ1 A;  3U78 A;  5FXV A;  3DXU A;  5IVY A;  4UF0 A;  5FY7 A;  2OS2 A;  4D6S A;  5F32 A;  2P5B A;  4V2V A;  3KVB A;  5A7W A;  4LIT A;  5KR7 A;  5FZO A;  5FP8 A;  5IVV A;  3KV4 A;  3OPW A;  2XDV A;  5K4L A;  5FY0 A;  5A3W A;  5F3C A;  5IW0 A;  3DXT A;  4CUG A;  4Y3O A;  4D6Q A;  4NUB A;  3KV6 A;  5FBJ A;  4CCJ A;  3N9N A;  5A1F A;  5FY8 A;  2YBP A;  5A7Q A;  3AL6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...