2YBSA

Jmjd2a complexed with s-2-hydroxyglutarate and histone h3k36me3 peptide (30-41)
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
348
structure length
348
Chain Sequence
LNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The oncometabolite 2-hydroxyglutarate inhibits histone lysine demethylases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/peptide
molecule keywords LYSINE-SPECIFIC DEMETHYLASE 4A
total genus 103
structure length 348
sequence length 348
chains with identical sequence B
ec nomenclature ec 1.14.11.-:
pdb deposition date 2011-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 2ybsA01
5IVCA 4QU1A 3AVRA 3PTRB 4BU2A 5FYHA 5A7WA 3KVAA 2XXZA 5F3CA 5FYCA 2OQ7A 4QXBA 4V2WA 4IGPA 4GD4A 5FP4A 5FZFA 4GJZA 5FPAA 5FZHA 5LY2A 4ASKA 2YBSA 5FYZA 4QXHA 5LWBA 5FY1A 3PU3A 5FZOA 5F5CA 5F3GA 2OS2A 5FY5A 5A7SA 5A3NA 2W2IA 3KV9A 5FYYA 3U4SA 5A1FA 5FY4A 3NJYA 4D6QA 5FP3A 3AL5A 5FP7A 5A7NA 2YU2A 3PURA 3KV5A 5F2WA 5A7QA 4CCNA 5FP9A 5F3EA 2Q8DA 3DXTA 5FXVA 5IVBA 4AI9A 3K2OA 5LY1A 2P5BA 4UF0B 5F37A 5FZBA 5A7WB 4CCLA 5IW0A 3ZLIA 3LDBA 3OPTA 5FZKA 5A3TA 5F32A 5ANQA 5FWJA 4E4HA 5FZ6A 4Y4RA 5FYMA 3KV6A 4DO0A 5FUNA 5FXWA 4CCOA 5A1LA 3K3NA 5FWEA 4D6SA 4IGOA 5FV3A 4HONA 5FBJA 3N9PA 3LD8A 5KR7A 4CSWA 5A3WA 5FY0A 5IVYA 5FZ3A 4UF0A 5A7PA 2VD7A 2OQ6A 5A7OA 5FPUA 5FZ4A 2Q8EA 4LXLA 4Y3OA 5FPBA 5FXXA 4HOOA 4XDPA 2GP3A 4CUGA 5IVVA 2GP5A 5F39A 5FYBA 5LW9A 5FZMA 2OT7A 2YU1A 4EZHA 3AVSA 5FZCA 2WWJA 3PUSA 5IVFA 5FZGA 4NUBA 5A80A 4EZ4A 3N9NA 4D6RA 2XDVA 4URAA 5FZLA 4EYUA 4CCMA 3N9OA 5FPVA 3N9QA 4GAZA 5IWFA 3PUQA 5F2SA 5FPLA 5FY7A 3PDQA 5FZ0A 2Q8CA 3DXUA 4Y33A 4XDOA 5FJKA 4TN7A 3KVBA 5A3PA 3PUAA 1VRBA 4V2VA 5FYSA 5FYVA 5FYTA 4LIVA 2YBKA 5FZ7A 5K4LA 4C8DA 4GJYA 4CCJA 4AAPA 2XUEA 2PXJA 2YBPA 3KV4A 2WWUA 4BXFA 3K3OA 5FZAA 5ISLA 4QX8A 5F5AA 4CCKA 5FP8A 5FZEA 4DIQA 4LITA 5FYIA 4QWNA 4QX7A 5IVEA 3RVHA 5IVJA 5FZDA 3UYJA 2XMLA 3ZPOA 3N9LA 5FXZA 5FZIA 5F5IA 3OPWA 5FY8A 3N9MA 5E6HA 5FZ8A 2YPDA 5FZ9A 5CEHA 5F3IA 3AL6A 3PU8A 4IGQA 4BISA 4QXCA 5FJHA 5FUPA 5FZ1A 5FYUA 2OX0A 3U78A 4LIUA 5FZOB 5FY9A
chains in the Genus database with same CATH superfamily
3DPRA 1PK6B 1NXD1 2EVXA 3WQBA 3P6BA 2HWD2 2V09A 4ZU5A 3Q8AA 2E51A 2Y6GA 5FYHA 5JSPA 5EIYB 1ZZ6A 1PMJX 2GMEA 4QB1A 1U5YA 5HCAA 4GJZA 1WGPA 1RUC3 2WC2A 1RIRA 5L7OA 4A6SA 4CDWA 2WQ4A 3VKOA 5F5CA 4QM9A 2OS2A 5T54A 3N7JA 2XVLA 1LOFA 2WFF1 1NAEA 4FFIA 4ZY9A 1KFXL 4E4SA 4QM8A 4CPBD 2YYOA 3WW2A 3OUHA 4D6QA 1UYZA 3H3UA 2O0OA 4ZPIA 3BTXA 1DU3D 4JTNA 4XFIA 4IEOA 4I3GA 1Z7S2 3GBGA 1GYKA 1VP6A 1W9WA 2Q8DA 2I2SA 5FOJB 3K2OA 1BCXA 3VBOC 4ZU7A 5C4WC 4C0HA 2BZDA 5CBLA 5H9SA 4CCLA 1NCRA 3WNOA 5JXJA 4WM8B 1CZSA 2ZACA 1H2KA 2ENRA 4JGZA 3MLLA 5ANQA 1C8M2 2QQJA 1G86A 2QBXA 4KGQA 1BMV1 1ZA7A 1BMV2 4DB5A 4HK8A 4JQRA 4UXAA 4XMIA 2P3KA 4YZ4A 4F83A 1TNRA 5JCTA 1FOD1 1PX3A 4UF0A 4YM0A 5EP9A 1F8VA 1BK0A 1OFSA 2RVAA 3GZTB 1OLQA 2HLEA 4IETA 5K7PA 2E26A 3B3QE 2C9AA 3JBG2 3G6JB 3K46A 1JHJA 3LEGA 3D4KA 3R0RA 4FBFA 5BYNA 3I59B 4NWVA 3MEPA 3KF3A 5C70A 4BMBA 1R1ZA 1QOOA 3HN3A 1OPMA 1SBDA 3NJXA 5DN2A 1RHI1 2XJVA 4AXOA 2DDUA 3B94A 3ILNA 3PLQA 1W6NA 1LOAA 4IEWA 1VALA 2X53S 3WF3A 5FR3A 3VBUB 1LGNA 5ACA3 3AXEA 1N1VA 3A0NA 1OQ1A 3ZN5A 1H8TC 2JD4A 4IE0A 3ZXGA 1N1SA 3LB9A 5CZKA 4LOSA 2CDPA 2WS93 5FYVA 5FYTA 3ILFA 2J1SA 2RM23 1LNSA 2CAUA 1KS5A 4LE4A 3LKJA 2A73B 1S2EA 1GZ9A 2DV9A 2VOKA 4KMQA 5LBCA 1IPSA 5A70A 1OURA 5FKBA 3HPNA 3NV3A 4HZFA 1RUE3 5L19A 1UQXA 1ND2B 4K1YA 2C6SA 4MV2A 1AL22 2Z69A 2FDGA 4DIQA 1I6XA 1W8TA 4H2AA 3ENRA 1SG3A 4XFAA 3T0DA 2JG9C 3VKLA 1O4TA 3JZVA 1VBC3 4KGGA 3VD9A 3KHBA 4HSJA 1I5ZA 3ZFEA 3HOBA 3H1MA 5E6HA 3UKVA 3BKZA 4E9KA 4OULA 4AQTA 2V4AA 1W8OA 5FOBB 5AVPA 2W1QA 4Q4W1 1YFWA 1PO22 3PIJA 1CIWA 1NA1A 1O59A 2VPVA 4GWMA 4IEZA 4YW2A 4A3ZA 3VZJA 4D0QA 3K51A 1C8M1 5E16A 1N3QA 4LULA 4P5YA 4FQ4A 3OGJA 3WNKA 2WO1A 1KFUL 1WZXA 3K75B 4GKXA 2TUNA 3NKTA 1LCLA 5HCFA 4CP1A 1WMFA 4CDUB 2W52A 4CU8A 1Y9MA 2WZR3 4CDQB 1BVP1 1DIWA 4CP2A 1HJGA 3O0VA 3TN93 4BCUA 2VNOA 5EJZB 3C7HA 4AHXA 1SLCA 3J8F3 1AX1A 2P3IA 3Q8FA 1DGRN 2ZX4A 3ZXJA 1LULA 4HN1A 5BNPC 2WZR1 3U4SA 2VTFA 1CAWA 3DGTA 3VBRB 3VL9A 5JXIA 1J1LA 3B7MA 3OTFA 3Q8CA 3H42B 5J96B 3S5QA 3PNAA 2QQMA 4IERA 3SKVA 4FAHA 4N9HA 1D0GA 5GZCA 1AYM2 5F3EA 2AC1A 4DS0A 4EWAA 2C24A 1B09A 2WNVC 2NP0A 4GB31 5F37A 2GU9A 3POGA 3T1LA 5IATA 2MEV3 1SPPA 4XFHA 2DWRA 5FZKA 3UGHA 3VD3A 3B5LB 3CL1A 3K4AA 1OOPB 3ZMNA 1T6GC 4R9AA 4QXKA 1EV12 3IT8A 2RMU1 5K8SA 2ZCWA 3KCYA 3VZLA 2W1WA 3FUQA 4B29A 1TMF2 3NV2A 5FV3A 1CAUB 4O61A 4U36A 1AXYA 3NVCA 4MGQA 3AXDA 2Q4SA 1FOD3 1DQ1A 3ORJA 4AEJA 2V5DA 3B9IA 3CZUA 4HVQA 4MHUA 4OCTA 2EAKA 1RUE1 1RYYA 2VZOA 4EWDA 1GV9A 1RJ7A 1ODMA 2RMU3 3NKGA 2CDOA 2IXLA 3WF0A 2ET7A 5BNOC 1H9WA 1AJOA 2XJUA 4EWEA 2ZX3A 3KB5A 3NNFA 2WWJA 3CO2A 3ALQA 4J6GA 2XVKA 2W0XA 1W0OA 4NIGA 5FQ0A 5KHHA 4N7UA 5BNNC 5I8TA 2R6QA 1IS6A 5IWFA 1DQ5A 2RR12 3KT1A 5F2SA 1IQAA 1BHGA 4R9BA 1ACCA 2W39A 4R4ZA 2IXCA 4RGKA 1PX4A 2ZGUA 5K0UB 1S55A 1K5JA 2XLFA 4A2UA 4FFGA 4QB6A 5DQ0A 1S0FA 1AYN2 4UW3A 5FMOL 1AXZA 1J1TA 4UBGA 1UU6A 4CCJA 4AI3A 1GICA 4P00B 3FWEA 3KV4A 5T5JA 3LA7A 4C1WA 4Q4V1 3MW2A 1KEXA 4FTEA 2VTXJ 4JTOA 4OMCA 5HI0A 4V1PA 4QX1A 1RINA 2B9UA 4QX0A 2XR4A 1ZBA1 2ZEYA 3KT7A 5LZ6A 4B3NA 2QZ2A 2Y60A 4AVAA 1NUKA 4Y22B 5A32B 4YVWB 1XE0A 2GH8A 3AKSA 3H8XA 1GNYA 1W9SA 2E53A 2ZMNA 1PVC2 2JX9A 3TAYA 3UJQA 2QNKA 4G3YC 4UT5A 3OUIA 1UXXX 2WR9A 4MGKE 3O1OA 4IGQA 2HWF2 1PZ9A 4NIAA 2QQVA 1UOBA 3VDDA 2OX0A 1JH5A 3E6BA 2WS92 4AQSA 2CHHA 2HH9A 1JHNA 5K9YA 2XWBB 4QPIB 3LPGA 4N43A 4RHV1 2LW8A 2VZRA 3I2HA 5GLZA 2GZWA 5JOWA 4SLIA 5L7OB 2W91A 4K1ZA 1LU1A 1BXHA 3DF0A 3CQOA 5BNNA 5GJ6A 4KQ7A 2PFWA 1HXS1 1OQEA 1PGW1 3S30A 1NE4A 3HN1A 4Y1UA 2VW1A 5M0TA 2YBSA 4AHYA 1A8MA 2W95A 2ZEXA 3DN7A 4XURA 1GP5A 3OEBA 2OXBA 3HWJA 4Z92B 3T1MA 2VUDA 3J7HA 5ERLA 3S7IA 3WQ1A 1PO11 1UF2C 2W2IA 4Q5OA 5A3UA 2HBUA 3BIEA 1S0CA 2GALA 1DQ4A 1GKBA 1ZYBA 1EUUA 2YUEA 2ZMLA 4XPVA 3SCFA 3WR0A 3ZYJB 3JD71 4LO8A 2AR6A 3AMMA 1NCRB 1MZ6A 1KS4A 4XW3A 3TRSB 3PURA 1UIKA 3M3OA 4YW3A 3H8OA 4FTBA 1CN1A 2PYTA 5FXVA 3WNXA 5IVBA 1ST8A 5JOXA 2DURA 4WZCA 4AGGA 4IESA 4TTGA 5ACA2 2VU9A 5FK7A 2C0ZA 4B7KA 3URFA 1NY71 3SLIA 2A6YA 3NAPA 4Y5TA 1OOPC 2QDNA 5AFEA 2FQPA 4GH4B 4Y4RA 5KHGA 3BVCA 4CEYC 4BQWA 4Z2WA 5IT6A 1AR71 1C5IA 4QPGC 5JXGA 4EN6B 4JDMA 5T50A 3U37A 5J37A 2GDFA 1I9RA 1WCKA 1WBLA 1WCSA 2OQ6A 1BK1A 1YRZA 5FZ4A 5CFDA 3ZN4A 2Q8EA 3PHMA 4Q29A 2EXJA 4LBOA 2YDEA 2I74A 4NAOA 2XHNA 2W46A 5F39A 5T52A 5FBZA 4YZ1A 2OIIA 4C91A 2OUHA 2QQNA 2RR13 3DKQA 4JKMA 3VBUA 5FZCA 4WM7B 2ZGSA 2PELA 5A80A 2BNMA 4YWAA 4E4DX 1B35B 3BPZA 1A8DA 4M00A 4X6QB 4MGSA 4K9SA 3IMMA 3FHIB 4META 3RI9A 1GNZA 3NNGA 3GJAA 3PVNA 2Y6FA 1Y7BA 2OZJA 1UY3A 4Y1YA 4Y33A 4XDOA 3WHUA 1G7YA 4MX3A 4COWA 4JKLA 3NW4A 3HBKA 4HMZA 3ZYPA 2RS53 3H9AA 3RYKA 2HYXA 4OHXA 1LEDA 4IUGA 5DAPA 1HB3A 2R061 1W6OB 2R072 2YGMA 4MUVA 1QQP2 3R05A 4NRQA 3ZFEC 1X36A 1OMIA 1R092 2D6LX 1S2KA 1OD3A 4PT6A 4XFCA 4EE2A 1NZIA 5JOYA 1R1A1 1W04A 4BMEA 4DNYA 5LA0A 1DHKB 4XJAA 3ZMOA 1ZBE2 3VD5A 2DCTA 3CEWA 3OPWA 1HRI2 1LHWA 4NO4A 4LT5A 1AR93 2VQAA 3LFMA 4HVOA 2RDNA 1PGL1 2R043 3AL6A 4BZ4A 3PU8A 3ZN6B 3K48A 3U07A 4W6YA 4BISA 1XRUA 1MZFA 1P8JA 2B42B 5CFCC 2WUHA 1QJY1 1QDCA 2BWCA 2E7QA 2VCMA 3ZFEB 1NX9A 2GN3A 4NWWA 3VUOA 2XBO2 4ARXA 4NHYA 4MGZE 2VGDA 4RFRB 3EHKA 3PTRB 1H4HA 1RUOA 4QHBA 4ISQA 1YO8A 2PQSA 4LPLA 5FAXA 1XQNA 4ASLA 1U5ZA 3WZ1A 3TYJA 2H6BA 1NCQC 1Y4WA 2C5DA 1YC61 4COZA 3WX5A 2Z79A 1G8WA 3VD4A 4AQ2A 1WD4A 3VB9A 4JHTA 1LB2A 1UYYA 5LRSA 1QXJA 2Y8KA 4LHNA 5A7SA 1HDKA 1VBD2 1AYM3 1ULOA 4E8CA 2JB8A 1XYNA 2O14A 4NMIA 5FP7A 1NLRA 4MYEA 2BERA 3HNYM 1ULPA 1RTVA 2BFUS 4Q8LA 1H9PA 1NG0A 3KS7A 3MIFA 3GHNA 5HPOA 1O3TA 2VE1A 1CAVA 1D4M2 3FFQA 1DLLA 1LKNA 1SLAA 3EBRA 3I2FA 2PHLA 2W3JA 1W8ZA 3R4UA 2NMNA 1QF3A 4UFHA 1PIV2 5F32A 1OFNA 2A70A 1XXNA 5GZEA 2RS52 2WS91 2A6XA 1CWPA 2RS51 3LGRA 3POEA 4Q1RA 1JOPA 4CU6A 2WT0A 5A1LA 1W6MB 1JZ5A 4D3WA 3NNJA 4W4ZA 3BALA 4JQTA 1T2XA 5J3UA 3HMYA 1S1AA 3I2KA 3VHRA 4IL7A 2VR4A 1OA3A 2DU1A 1TME3 1PK6C 3ZSKA 1W03A 3AKTA 1LOCA 3OY8B 4LA3A 3UESA 2GP5A 1A34A 2JE9A 4Q1PA 1Z0HA 5DUWA 1LOBA 1VBB3 3TNQA 1LRHA 4JGYA 1UPSA 3V56A 5KXDA 4CEYB 3PTYA 4R9CA 4CA9A 3FBYA 1VAKA 4URAA 1B35C 2C9KA 4GAZA 3GCXA 1HJFA 3ZFFC 1W6QA 2I07B 3USUA 1US2A 1WLDA 1YUDA 1CPNA 3MYXA 2JXAA 2WT2A 2D6PA 3VL8A 2GNTA 2D43A 3GDBA 3S0MA 2F17A 1OF4A 3K4ZA 5FZ7A 3T4HB 2KXLA 4XJ8A 4ET7A 4LTAA 3I49A 3EB7A 1IS3A 1RL3A 3NMBA 2AZ5A 2EICA 2PXJA 1DCSA 5JR7B 1F31A 5FZAA 4AL9A 2UY9A 3OB8A 2HWF3 1WW6A 2ZA9A 3THPA 2CNAA 2OA2A 4CCKA 4RGGA 1X9TA 1SCSA 4AR2A 4TLFA 4W6XA 3RJ2X 2JE7A 5FFOC 3MV01 4CCCA 1W6PA 3VBHA 3RDIA 3ZPOA 1OH3A 3N9LA 4XAAA 1L3JA 2ZXQA 1N1TA 1EAH2 1SLIA 4S2HA 5CEHA 4N43B 1QJX3 4JX0A 4ZONA 5EV7A 4Q4W3 2WABA 4OI0A 3AK0A 1D7PM 4CDWC 5JWPA 4ZS3A 1C5HA 1I5PA 3LDKA 2VZUA 3OBAA 1H1MA 1NQJA 2OUJA 5BUVA 4AGVA 2ID4A 4O9EA 3VBSA 2XL7A 4Z8BA 2W87A 3D0JA 3WF4A 3AP4A 3N3HA 3U11A 4QXBA 3G7DA 1JYCA 1XYPA 4MXVA 3N4MA 1GZTA 2XLGA 3OSDA 1C4RA 1VBA1 4AI0A 1UY2A 2VL4A 5FZHA 3RZGA 4BE3A 4URTA 3V0AB 2VVDA 4QXHA 4COVA 3CF6E 2HWC1 2QFEA 5C5TA 1W39A 2DBIA 2ZKNA 1RUG1 5BNNB 4N53C 3WG1A 2BUKA 1TME1 1R081 3NJYA 3USUB 4Y5Z0 1H4GA 1OOPA 4IEVA 4Y20B 1WA6X 4MG2A 3FX3A 3K4DA 3SH4A 3TEXA 1KDMA 1W8FA 3KQ4B 3N35A 3M7AA 2JG8A 2VUAA 2OPWA 3IDCB 4LBLA 4BQ1A 5AC92 3T0AA 2ZHLA 4FPHA 4AI9A 5GLTA 3JXSA 2RS12 5FZBA 1VB2A 2JECA 1UNBA 2YMZA 4C0BA 4HKLA 5CKQA 1Y3TA 3ZYHA 5A3TA 1HRI3 4QQPA 1C28A 2VMIA 1H30A 2K0GA 2WNVA 2BOIA 1NY72 3ZIWA 1DYKA 2VVFA 4L99A 1FPN3 2GMMA 4XAEA 2J1AA 4GIQA 1QU0A 2ZGNA 4XUOA 2K9ZA 3FHAA 3OGVA 4P02B 1J58A 4CCEA 3UKTA 3AKQA 4EQVA 4GH4A 4FFFA 2E31A 2Y26A 3PJQA 1LECA 3A0KA 4GWNA 5F1RA 1S0JA 4HOOA 2BYVE 2GP3A 4GXLA 1D2QA 5EYXA 2X10A 3ZSJA 1QJU3 4RN5A 4U2AA 3POBA 3WEZA 3T2PA 1ENRA 2BBVA 1A78A 1HB2A 3I7DA 1W2OA 4CYDA 1VPHA 3PVEA 1NXMA 4L97A 5IVFA 1PZ8A 2PHXA 4LLFA 2ZAHA 1FXZA 3PL0A 4EROA 2GNBA 2CTVA 1HX6A 3BI3A 3ZOIA 4M0HA 2N7GA 2B5HA 2R042 1WBFA 5FY7A 2B7YA 3TN92 1V70A 4J25A 4MOAA 2Y6JA 2LROA 3AMPA 1GQHA 2WRAA 1B35A 1Q56A 5FYSA 1COV2 2YG0A 5TSWA 1ZBE3 3KLSA 1TVGA 2J7MA 5FREA 3ZKYA 1S4CA 1YCIA 4UW6A 2Y6KA 4YLZA 3M1HA 2ZX1A 2VVEA 4OI2A 4Y20A 3D8CA 1YFUA 1YYNA 1OI6A 2B45X 1X9PA 2WA3A 3TB0A 2Y64A 5I0RA 1QJEA 4QWNA 1JZ8A 4AVVA 4FCAA 4XUTA 1WKYA 1EPWA 4HG6B 5C3SA 3ECQA 2YXSA 1YIPA 2RDRA 4XZPA 1RGSA 4DY3A 2YPDA 2RS33 2Z2SB 4KNCA 1CQ9A 4FOVA 3USSA 3CJXA 2P1BA 1OA2A 2DTYA 5FYUA 4JRLA 5FO7B 3V65A 3WDVA 4HKWA 1JU4A 2JDPA 2PN5A 5CVRA 5IVCA 3LA2A 3IPVA 5DDJ1 3W21A 4XJWA 4A45A 4AOCA 4AZZA 1YJLA 5DAQA 3SISA 1PHMA 4K6BA 1V6IA 4NHMA 1PO23 3MZHA 5FYZA 4OHZA 1MZ5A 2VH9A 2W1UA 1RMU1 3AKRA 2EXIA 4LKFA 5A33A 5F7UA 3BOWA 2WNUA 5I93A 4QB2A 5HXMA 1UY1A 4XEZA 1YFYA 5CFDB 1DYPA 4IQPA 1OKQA 3AL5A 2Z42A 1HRV2 2BOJA 4Z1VA 1QJX2 1YQCA 4C1XA 3MUZ1 4DINB 5KWRA 1PGSA 5F2WA 3V0AA 2VUJA 2IZWA 1BBT1 1G9AA 2WA4A 2Y0IA 4AW7A 1ALYA 1QOTA 2P6HA 1QEXA 3J8F1 1Y43B 2JENA 3ATGA 3IB3A 2JKBA 1ZREA 2Q1FA 5FYMA 2WQ8A 4AFMA 3SKJE 1HB4A 1XU1A 1IG0A 1UU4A 3K3NA 4XABA 5IFTA 5JPNB 2JDKA 3AZZA 2A71A 4HONA 4IV3A 1ND3A 3I2IA 1U0AA 2FCUA 2RS32 4QKFA 3E5QA 4QPIC 2B8MA 5IAXA 2X5IC 4OUMA 5FPBA 5FXXA 1IPKA 1UIJA 1UZYA 4H3WA 3MIEA 1ZRCA 3I2JA 4D7SA 1IQDC 5L7OC 4AHZA 5FLJA 2XBO1 2YV8A 3I2DA 3QBQA 4P9XA 3T09A 4DY5A 4EZ4A 4P9LA 3DECA 1SMVA 4YPJA 3T0BA 2NN8A 2QQLA 2VCCA 3IDBB 2XG3A 5FZLA 1NA1C 3K77A 4FP2A 3D82A 4CCDA 4XBLA 1CAXB 1UAIA 1WMDA 3PUAA 1MEC3 2VZTA 4YRDA 5L9BA 4LHSA 1U5IA 4BLJA 5KBFA 3O1SA 4I3PA 4AEKA 4PIXA 1J59A 1HRV3 2EIBA 4Q4Y3 3R4SA 4D7YA 5A6YA 1WCQA 4R9DA 4BXFA 2Q1ZB 2VMCA 1K42A 3OBTA 1C1LA 1Z7S3 4PLMA 4EN7B 4AG4A 5I8YA 4RSUA 2R071 4UW4A 3ACIA 1H8TB 4NN0A 2D97A 5JXHA 1OD5A 4MXWA 2VMEA 3POIA 3VDAA 4B4RA 4CUAA 3I54A 3BB6A 1RVF2 3KM5A 1JYIA 3E1F1 3ZKUA 5A6ZA 2ZS6B 2MPFA 2WFF3 5ANNA 4Q27A 3SCGA 3WVJA 1AL21 2D6MA 3TN91 1YQ8A 3D3AA 1YFXA 1W6PB 3VBHB 3LQCA 4LIUA 2VMDA 3EXUA 2C26A 2RG4A 1AX0A 1VRH3 2PHRA 2ZGQA 5DG2A 3L2HA 1YQ6A 2FDHA 1WLCA 2AREA 1LHOA 4ONUA 2ORXA 1O5UA 4JDNA 5A7WA 2DBNA 4MGIE 4QDRA 4XXAA 4BOWA 5JOZA 1IOAA 2P4EA 4QHOA 5CFCA 1VIWB 2H0BA 3AYCA 4JVAA 2CGPA 3WCSA 5BXXA 3KCXA 2A75A 2LM3A 5AC93 2BTVC 2HWE1 1NA1B 1YI7A 3GZAA 5HV4A 2VECA 4RR3A 3H8UA 3MW3A 5FZOA 1GR3A 1RHI2 1SDDB 3WOGA 3MICA 2MNGA 3GGLA 2Y34A 5IK5A 5LEJA 3R4DB 1VBC1 4DUXA 4K7JA 5BPXA 5FP3A 3I3BA 3CHXA 4YFZA 2XVGA 2BDRA 4CDUA 1WLWA 4ATEA 1CZTA 1J3QA 3P3NA 1X50A 2PHWA 4ITCA 4XHXA 3QLQA 2G19A 1S0IA 5CKMA 3WDXA 1IHMA 3BTAA 3VBOA 3DXTA 3ZXDA 4CEYA 2WNVB 3VV1A 5CAZA 5LY1A 3I8TA 2ZHKA 1R093 2EAAA 1DQ2A 3B69A 4FFHA 4ZXEA 2WNUB 5GM0A 5DDJ2 4CU7A 1RUH1 3GCWA 4QAWA 5F6LB 3OGRA 1FMD2 1UZVA 3HEIA 2FZ2A 2UY8A 5DABA 3ZN6A 3D5OA 4IEPA 4BQ3A 1REDA 2AUYA 3ZPYA 5B4NA 3MHZA 3LD8A 3MIGA 5KR7A 4HETA 3OD0A 1CD3G 1QJU2 2D44A 2IXIA 3O5SA 2VD7A 3VZMA 2JKXA 2FDIA 5CADA 1W9YA 2VOVA 5AFBA 1JYNA 1OLME 1XBFA 1ZZ9A 4RHV3 4QD2A 3H1YA 5EFUA 2XB6C 4A4AA 5FRAA 2FD8A 3MV11 2E7AA 2EXKA 4QPIA 3POFA 4H55A 2WFF2 4IEQA 4A44A 1MZEA 1LGBA 2VQUA 1VBA3 2Z4FA 3JQWA 4FPEA 4NUBA 3CJIB 3W5NA 2O1QA 4Q0PA 4P08A 3U0ZA 3N9QA 4FO9A 4XTMA 2JDAA 2HWE2 3ES1A 4QX3A 2PLV3 4N43C 3ABZA 1VBE2 3LEIA 1S0EA 3KVBA 4I02A 1L7LA 3AKPA 3SXWA 1CPMA 1AR81 1DQ0A 2HWD1 3EYPA 4IV3B 3WNNA 4M3CF 4XIKA 5KHIA 5IFPA 4RGAA 2XUEA 1V6NA 1QHDA 1F5JA 3M70A 1AL0G 1BEV1 1L7RA 5EWSA 2Y38A 4YFWA 1OSGA 2R0HA 5JSOA 1NKGA 3MO4A 1VRH1 3LE0A 4FT8A 1RUF3 3OYWB 1GZCA 2XHKA 1AYN1 3SEPA 5IVJA 3C3VA 1RJ8A 1Y9QA 1KXGA 1X82A 1ND2A 5FXZA 1FNYA 1GLHA 5FY8A 5FZ8A 2A6ZA 3GXUA 1AUYA 1RUC1 2G9GA 1X8EA 4RS5A 4EN9B 5BNPB 2E32A 3W58A 2F4PA 3U78A 5C33A 3OBZA 4M4PA 4W50A 3AVRA 2ZMKA 2CGOA 3ZVXA 4WM8C 3PIGA 1V6JA 1BVVA 4AFAA 3HQRA 4CUCA 1KJRA 2WAOA 5C7GA 1URXA 1E57A 5EXOA 3I2OA 4Q4X1 3VBSC 1ZBE1 4YGDA 2WYFA 4CU9A 3O1MA 3WG2A 1NLSA 4Q2FA 4FQZA 1NQDA 1S0DA 5F3GA 5DAVA 1AHSA 1H6XA 3WDUA 1TME2 1YLLA 3O1PA 3E97A 4GALA 4GQ7A 4XFFA 1AR91 3WD5A 4KBBA 4AFDA 4AE2A 1CX4A 4OHVA 4W6WA 2HWC2 1XNAA 5A33B 2Q5TA 3VBHC 3VZKA 4JC1A 1LENA 4UBHA 1RUI2 4CXYA 2D3RA 2J1RA 2QQUA 3LOBA 1H1AA 1LTEA 4IDZA 4LNVA 5EHDA 3DKWA 1OH4A 5KHJA 4MLOA 1GZWA 3LDBA 4XC9A 3LSEA 4CEWC 5FWJA 2VXRA 1A3KA 4AVSA 1VR3A 2VMGA 1ASJ3 2VZPA 1GUIA 1UPIA 1V6KA 3AMHA 3F2ZA 4QKBA 4YG0A 4YW4A 4D6SA 3E6CC 2XGXA 1VMJA 1RUJ1 1SPPB 3RZHA 2LS6A 2HKXA 2GC0A 1EAH1 2P3JA 2Y6LA 1D4M1 4OVEA 3THTA 3MBWA 1NYWA 1W6NB 1XYOA 2GNDA 4PDWA 5CISA 4BWOA 1H2NA 4AEDB 4LQRA 4LXLA 2PHUA 3R6SA 1N1YA 1OA4A 2AGSA 2ZABA 2JDMA 5IK4A 4IE6A 1CZVA 1ND3B 2CL2A 4P9JA 4M0NA 4PF5A 4QDQA 2HWD3 2C4XA 2AH2A 1XNTA 2C1FA 1VBD1 4OLLA 1CONA 2DUOA 5LK5A 4RL7A 3VBOB 4AHWA 5ABJB 5CNAA 4JKKA 5GZFA 4WZFA 4JHZA 1RHI3 1ZM1A 1QQP3 1ZA4A 3AC0A 5F8PA 1UZZA 1M06G 3HVDA 4PQQA 3MIHA 4FOWA 3AZXA 4DEVA 2MHFA 1QNWA 2E33A 4TN7A 1TNFA 3J4UH 5IYYA 5LBFA 4D7TA 1EV13 3VDCA 4AFBA 3OG2A 5DUXA 5KXEA 2RE9A 3WDYA 2UYBA 3FBMA 4GJYA 4EN8B 4K8FA 4AAPA 3RZLA 1QJY2 1QWRA 5LA9A 1VRH2 3S5AA 2WWUA 2JG8C 1H0BA 3WW4A 2VOXA 1XPWA 4PJYA 3WT3A 3ZDSA 3TEYA 5ISLA 4YW7A 1MPXA 3P5BA 1J3RA 2Y33A 1FI2A 2GAUA 1DG6A 2V73A 4CE8A 2AEZA 3FMGA 1VMHA 2OKXA 1CIYA 1LODA 2P6CA 1GP6A 3HT1A 2ZGOA 2ZTNA 5FZIA 2NMOA 2G4IA 5E89A 1R1A2 1F2NA 2YROA 1Q8OA 4KU7A 2FCVA 3RYRA 5CIRA 4KWLA 1O3SA 4NR1A 5FZ1A 2DU0A 1FAYA 3BU7A 2W5FA 1E5HA 4HK9A 2TBVA 2NM1A 1PVXA 5IHRA 4GWJA 1IPJA 5DZGA 2HWF1 2WO2A 2VY0A 4BLIA 1OLRA 3KVAA 4WVMA 3W9AA 2JDZA 4LEJA 3ZXEA 2ZBJA 2XKPA 2J42A 1FPN2 3B00A 2R32A 4P9IA 4KI5M 3KSCA 3RJRA 4FTSA 2JDNA 4BK4A 2ARBA 4S2DA 4B1LA 2EA7A 4XF3A 5FKCA 3MPBA 3ES4A 2RM22 4YW5A 4OI1A 1MQTC 3DL3A 2XPJA 4CPBA 4GZ9A 1GP4A 4D94A 1DGWX 2CWMA 1RUD2 5T5OA 2IVJA 4YVSB 4RS5B 1AX2A 2FHRA 3F95A 1N47A 2WYSA 3IM0A 2DCZA 4EN0A 3POSA 4ZZ8A 3MF9A 2FCTA 3S6PA 3B02A 4A7ZA 3O0XA 3AP7A 5I8SA 1AL23 5JLVA 1ENSA 2WKKA 2PQQA 2A6VA 1O3QA 5C9AC 1JTZX 1HQWA 1CAXA 4R4XA 1CESA 3J26N 4IEXA 5FXWA 2ARAA 1STMA 2F6BA 4Q0VA 5KC6A 1H1IA 1EUTA 2A3WA 1GWMA 2BP6A 1JUIA 3VKFC 1UO9A 3GBFA 4GMP3 1ZZ8A 4YZ3A 1HRI1 1APNA 5IK7A 4K20A 5A7PA 4P9WA 1UXZA 1FV3A 5FLHA 3JB8A 3VHOA 1O6UA 3WG4A 4AWDA 1MQTA 3ZYBA 2UWBA 4HKOA 4FSJA 4LBKA 1I3HA 4R52A 5DUVA 3ACHA 3OJBA 3HNBM 3JD72 4CDUC 2JDUA 3MUY1 1GOFA 4YYOA 4EZHA 4PDWC 4A3XA 2BW8A 2QQIA 3WP5A 4L11A 3PVBB 1UY4A 4CRQA 1YIFA 2H0VA 1GQGA 3MF6A 2WFPA 5F6KA 4EYUA 4RQPB 5A32A 3RZKA 2H6CA 2R062 4PQ9A 5FIXA 1IS4A 1GZWB 1AR82 3DV8A 3B93A 5FPLA 3TNPB 3MLJA 4XTPA 5FZ0A 4UWDA 4BJ0A 1HXS2 4QX5A 5CA6A 1VBE1 4V2VA 1BQPA 3WSOA 4COYA 1SLLA 4I30A 2VZVA 2BVBA 2JIJA 4BHPA 3U10A 1HN0A 3I3QA 4XUQA 2X05A 2GC2A 2I45A 5JMOA 2QQWA 1MS5A 3SCHA 2OZ6A 3AMQA 4I0WB 2QQPA 5LBBA 1W2NA 4IXLA 4LA2A 4IV1A 5C9AA 2DUQA 1VLNA 3GNEA 5D8AB 1X8MA 1ZBA3 2X09A 3MFAA 1SDWA 1UX6A 4LJHA 5FZDA 3KQRA 3UYJA 3MW4A 5IJRA 2DVAA 4NRMA 5BNQA 2W94A 3BYWA 3ZSMA 1QXRA 2ZGKA 4MO3M 2TEPA 5F5IA 4FPFA 5HCBA 4WBBA 3W20A 3PMSA 3QOPA 4L9BA 4DRRA 1LR5A 3RZJA 1FV2A 1W6QB 5FMCA 1TMF3 4Q4V2 4I01A 1S0GA 2X29A 4XF0A 5FUPA 1KITA 1J84A 4MHRA 1PNGA 5CG9A 5FZOB 1RB8G 2QKDA 1HIXA 1UOFA 4LBMA 1Q43A 1ULGA 2CU5A 3IDEA 3U4XA 3D6EA 5BNPA 2AEYA 3GJBA 2WNUC 2DVFA 3E5XA 1XOYA 5BNOA 2WDBA 4NIIA 1W05A 2XLAA 1GMMA 4QGNA 4P9YA 3FL7A 4CP9B 3OEAA 4FPJA 1V9U1 3ZM8A 4B4PA 2F4LA 2VOWA 4DPNA 4ES8A 5FY5A 1LOEA 3N7KA 2NZ9A 2RMU2 3WDTA 4CP0A 4WVMB 3T2TA 1LU2A 4DEQA 2ZJCA 1GBGA 3J8F2 4PF1A 3UETA 2RJLA 3WP3A 1XNCA 2DVBA 3FC0A 4UFJA 4XBNA 3T08A 3QD6A 4OUSA 2ZHNA 3UK9A 4OHYA 2LALA 3H3LA 4GB32 3AMNA 5L73A 3IIIA 4KWJA 4UFKA 1G9BA 3OBRA 1QOSA 4MH0E 4UFMA 2VNRA 3M3CA 1OUSA 1F35A 1O5LA 3LIHA 4O65A 1UMIA 4GB33 3PVOA 1VAMA 3NJZA 1PM7A 1RVF3 1ZX5A 2UWCA 5FUNA 3JCIA 4BIFA 4R8HA 4WM7A 3AFGA 1UL9A 5A3LA 5FBJA 1YI9A 2R073 5CKNA 4CSWA 4M01A 1DQ6A 3VBFB 3KF5A 5JZGB 1W6OA 4K3UA 2W47A 2RS13 5IK8A 3QH6A 1ASJ2 1RVF1 2QQOA 4N7IA 1YNAA 2KR2A 4BPZA 3SITA 5CFCB 1ZBA2 1FOD2 5D8AC 2J1VA 4LKEA 5EPAA 4D8MA 3VLBB 4HPKB 3ZR6A 4AEMA 4PDWB 3IDAA 4W8JA 3V0BA 2DYCA 4TZDA 3O1VA 3N9NA 1S2BA 4D6RA 2XDVA 1W28A 4CCMA 2EIEA 3N9OA 1GNHA 2D3SA 3AP6A 1ULFA 1HKDA 4QPGA 4WM8A 4AI8A 4ES9A 3WY6A 2MEV2 3O1RA 1POV0 2DCJA 1JZ6A 5FJKA 5H9QA 4XYXA 3N36A 2GH2A 3CDZB 1O4ZA 2YBKA 1ONAA 1UMZA 2VCAA 3P1IA 4YM1A 4C8DA 5LEKA 4F7ZA 1FATA 4S2FA 1SZBA 5DG1A 1RITA 3LAGA 2WL1A 4LBQD 2W9XA 4FAGA 5D21A 2XJRA 4QX8A 3PUHA 4Q4W2 4Y1XA 2VO5A 4DUVA 2DTWA 3WCRA 5C4WB 1V6MA 2G9FA 4Q26A 4YVWC 4MSVA 1F15A 2HJIA 3RVHA 2XJPA 4B1MA 4BH9A 1Q8QA 4BQXA 1RUE2 3J7NA 1DZRA 3LPFA 3M4FA 3IKWA 3NRUA 2D7FA 4O7XA 1UKRA 3N9MA 5FUIA 4PIYA 3NV1A 1D2SA 1LHNA 2QE3A 4XFBA 1TMF1 3BU0A 4XVHA 2BFUL 1GOHA 1ZZBA 3TEWA 4N9IA 3PJYA 3FLTA 1BKZA 4OMDA 4YM2A 4UI9L 1Q8PA 3PMEA 4LHLA 3AJYA 3OOXA 4JGYC 4M3CB 3ZFFB 3CU7A 2ORZA 4Q4V3 4XJUA 4XUNA 3ZSEA 1LOFC 4LO6B 2EF6A 5J36A 3I2GA 1HB1A 2R063 3C2UA 5JR2A 1REFA 5A3MA 4OZOA 5FP4A 2WT1A 3ZFGA 2BGPA 3CBNA 2J22A 1JS9A 5D8AA 3D0SA 1FYUA 5FO9B 1JYTA 3WG3A 3Q9OA 3WDWA 4XF1A 5FYYA 3PUIA 5CFDC 1VBE3 1SBEA 2R7EB 4XJ9A 3MFCA 3AYDA 4Z07A 3ZDVA 3KZ4C 3KGZA 1O8PA 2XQXA 1UWWA 3NNLA 5FP9A 4H7MA 1LOGA 4OQ9A 2QUOA 1QJU1 1UKGA 1ND2C 1WUVA 3I4IA 5AC91 1K3IA 2BPA2 3OPTA 4KH9A 1JOBA 2XWJB 5A6QA 1LEMA 2JD9A 4CCOA 4CDQC 4YZ5A 3UJOA 2DF7A 3BIWE 2FDJA 1C3HA 1F4AA 4KWKA 5FY0A 1RUD3 4AYUA 1POV3 1RUG2 1GSLA 1D4M3 5FZ3A 2WN2A 4G4FA 1PNFA 3WUCA 1H2LA 1VBA2 4AI2A 5LA1A 3QH7A 1LAJA 2WSUA 4BB3A 2J1TA 3VBRC 1J83A 2Q30A 2YGLA 4D69A 1AJKA 3LFIA 2RJ2A 3QCWA 4DUWA 5DZFA 1PO12 2ADDA 3DPRC 2IWGB 3EMRA 1F9KA 3VBFA 1AXKA 3SQOA 4XHBA 1BZWA 1JMUB 3T4VA 2HEWF 4PCRA 3NL1A 3VGIA 5DPNA 2VCBA 5B4XA 2XH6A 4I0BA 5AVAA 1WW5A 4GMP0 1COV1 1H6YA 2BV4A 3C7EA 3NAPC 3ON7A 2JWPA 4FOQA 3VDDC 4BK5A 1PK6A 4HPKA 3CNAA 4CTEA 2UU8A 1VBB1 3L9JT 3S57A 1X7NA 4KG8A 5FQ0B 3W59A 1JBCA 4ZHNA 1W2TA 1JN2P 3IAQA 4CVUA 1JODA 4FPOB 3RWKX 3INAA 4LK6A 3EJKA 5F5AA 1OT5A 1JU3A 5LATA 4XCAA 1NLQA 2NPIA 2DVGA 1DLCA 1QJZA 4DFSA 5IVEA 1UOJA 4CEWB 4XZUG 1U5XA 4PHZA 5GALA 1VBD3 1MS9A 5L9RA 3WP4A 4JZRA 2QCSB 5ABJC 3MDPA 4AK3A 5KC5A 1ULCA 2OPKA 4PBPA 4Y5SA 1V9U3 2ZX2A 5FTTC 1IZ3A 3CZJA 1N3OA 1FT9A 1GQPA 4IEYA 4NHKA 1EYBA 1CR7A 4NOTA 1GFF2 5BNOB 2PTMA 3AP5A 4UW5A 2VOTA 5CG8A 1DF0A 2IC1A 5KXCA 1Y9GA 1F4HA 3ST7A 2JEMA 1SLBA 1RUH2 4BU2A 3O0WA 3OGSA 2E7TA 4LBNA 4H14A 3OCPA 3SNMA 2JE8A 4HANA 2WO7A 2ZEWA 5SV5A 1UD1A 4GD4A 2FDKA 3AJZA 4AI1A 2JG8B 5FZFA 3WF1A 2Y0OA 5LY2A 5I0SA 2BQPA 5C3PA 2D93A 2HWC3 2CSGA 3DYMA 1US3A 1IKQA 3M2MA 2JICA 3HJRA 2HWB3 1RXFA 2X5IA 3QACA 5FY4A 1IGOA 3KMHA 4PI2A 1YXWA 2RDSA 1WA4A 4CDXB 1KD7A 2EIGA 2A7AA 5A3OA 1YHFA 3A7QA 3NO8A 3ZFGB 2PA7A 1Q8SA 3B01A 2ILMA 3UL2A 2P5BA 3ZSLA 1DGRA 1BJQA 3CMGA 3HQXA 3J7LA 3RFRA 5FDBA 2AENA 1CAUA 1O4YA 2A3YA 2P3YA 5I0UA 3RG0A 3TEZA 2WNOA 2XQRA 4UFIA 4ZXKA 3AYAA 5FZ6A 4E4ZA 3KT4A 1GOGA 1BBT2 3N7MA 1XJAA 4XCBA 4N53B 1UCXA 2RDQA 2EALA 4M3CE 4MZUA 5A3WA 2JG9A 4FPLA 3T2QA 5JAXA 1QJFA 4EV0A 2HBTA 1DFQA 1JXNA 1MACA 1AR63 5BY5A 2YB7A 5FPUA 3RNSA 1W2UA 1PO13 1E5IA 2WSVA 1REEA 2B39A 3BOPA 4XDPA 4CUGA 3NQHA 4NJ4A 1QJX1 3BUCA 1OHFA 1UYXA 1HRV1 5FYBA 1RUF2 3GYDA 1AR83 4FPYA 4LO4B 2E9QA 2YU1A 1GWLA 5DZEA 3SC7X 2XJSA 1ZNPA 1QXPA 2FMDA 3PUSA 1HXS3 3VKMA 4AGRA 4PBOA 5K0UA 1OQDA 2WINB 1HLCA 2B9VA 4YG6A 1W8HA 4LK7A 3UGFA 3P3PA 4GMP1 1POV1 3S7EA 3WHTA 3LIGA 1RUJ3 4BQYA 4WVVA 4BYYA 1DBNA 4JGZC 3LWCA 3I3MA 3JB4C 4QQOA 4E27A 5A3PA 1XSQA 4Y24A 4AEDC 4XQDA 5C4WA 3X29B 5JIAA 4QPWA 3BN6A 4ATFA 5LB6A 2QVSB 1K12A 2YC0A 3CJIA 1TEIA 4MADA 1JI6A 2NQYA 3E5UA 3RYPA 1R082 1JOJA 4NPLA 2ZEZA 4I0AA 4WVWA 4AVCA 1ZRDA 1W9TA 1C8M3 2CV6A 4XQWA 1T6BX 1WCUA 1QQP1 4IE5A 4LITA 3VDBA 2WZ8A 1C1FA 4HFSA 1F5FA 4QX7A 4JRAA 4X6RB 5JUVA 4JDOA 2VBBA 3POYA 2XMLA 4BIOA 3U14A 3I3DA 2A3XA 3H3ZA 2B4KA 5CYYA 3H0OA 3DUIA 5J48A 1W3VA 1EV11 4QT6A 4NAMA 1BYHA 1DZQA 2XKOA 5F3IA 3WNMA 4NIHA 4MVTA 2KD7A 3LCPA 2VZ1A 4Y22A 4DZGA 1UZ0A 3N7LA 4FPGA 4TYSA 3TOJA 3I59A 3ZR5A 1PIV1 5GLVA 5HBAA 1TZOA 2G1MA 4HVRA 1VBB2 5G05L 2A1XA 1RUNA 5H9PA 3RGBA 1AYN3 5T3NA 4NROA 2ADEA 3AFKA 4YG3A 3T3YA 3VBRA 1JUHA 4IE4A 3OY8A 2WZPP 1KQRA 3A23A 3JUUA 4Q0UA 4FXKB 1U12A 1BEV3 5LRRA 2ES3A 5JI9A 3VZOA 2VG9A 4NHLA 2J1EA 3FJSA 5FY1A 1RMU3 1VJ2A 3OYWA 4FXGB 3TWIA 4MGTA 1L7QA 2DUPA 2WAAA 5D1IA 4ZU4A 2XONA 4EJRA 1HW5A 1MEC1 4YGEA 2DFCA 2WJSA 3GALA 4LO7A 5LBEA 2FMYA 4HT1T 3AZYA 3RS6A 4IV3C 2PLV1 1OLMA 2DVDA 2WZEA 2D40A 2P17A 2VMHA 2YU2A 4CDXC 4PLNA 4Z82A 1ENXA 3BCWA 4A7YA 1O3RA 4E2GA 1WWYA 1MS3A 4JCKA 4GWIA 2BWAA 3ZXAC 2MEV1 3H1WA 1SHWB 2HWE3 1YJKA 2W92A 3C8XA 3IAPA 3VN4A 5E1RA 3CJIC 4HXCA 3RWNA 4AQ6A 5CB7A 2IXKA 3UKNA 1H2MA 4AVTA 1KJLA 4B8EA 3KCCA 2DCKA 3WNPA 1NCQB 2HWB2 1QNYA 4W65A 1K5MC 2RM21 1JZ3A 3VD7A 4JV4A 2VAUA 3LOIA 5L36A 1KDKA 5I0TA 3FFZA 1CAVB 3UGGA 1W3XA 1UX7A 3FN9A 3O14A 4JAAA 4LR4A 2FDFA 3NSTA 4BM8A 3OGGA 2P37A 2QJVA 1R64A 2VULA 2XJTA 2YHJA 2E63A 3AX4A 1SFNA 3WQ0A 4YARA 5J1XA 2A6WA 2BNOA 4RD7A 4TSVA 5JPMB 2R30A 3GF6A 4INDA 3OF1A 3HR9A 3DPRB 2Y6HA 4NIDA 1H8TA 5CU1A 1RUH3 5JIUA 1WLTA 4XUPA 1DGLA 1W6MA 2VTXA 5C8CB 1RXGA 1R091 3ITQA 4YM3A 3H8RA 4TXWA 2FZ1A 5H9RA 5LA2A 3WINE 4L0PA 4BQ2A 4F8AA 5HV0A 4P9GA 4P5HA 2ZHMA 3ETQA 3ZX7A 3EO6A 1WCDJ 3DYPA 3PDQA 3A4UA 1MS0A 4YW6A 2Q0AA 2BBAA 4ZS2A 3VHPA 2KA3A 1VRBA 4X8NA 4Y26A 1K45A 1ZRRA 5C5UA 3M3QA 3ZYIB 4LIVA 3ZYRA 2D5FA 1MS8A 2GC1A 2VW2A 2Q1MA 1GU3A 3WXPA 3ZXKA 2G9ZA 4O9GA 4QU2A 4CEWA 1NOVA 3W5MA 4UYBA 3THCA 2VNVA 1UYPA 2ERFA 3K3OA 5FP8A 4B7EA 2BJSA 4BXSV 5FYIA 4RR3B 1AF9A 4LE3A 1AZDA 1OC1A 4YNIA 1CJPA 3VKNA 2WO3A 1UN1A 3BTZA 4QDSA 4Q4X2 5EJ1B 1WW4A 1V0AA 1VB4A 4DXSA 3ACLA 3H7JA 1UU5A 2GNMA 3MLKA 4Y4YA 1D0HA 5JZGA 2RJKA 1SFPA 3FUOA 4Q4Y2 2WN3A 1LJ7A 3RPQA 4S2GA 1NCQA 4HLTA 1AR72 4QXCA 5FJHA 1W8NA 3IBMA 3C7OA 3SH3A 3Q8EA 4QU1A 1ULEA 1O7FA 4OYUA 5F5QA 2VC9A 4K8RB 3ZO0B 4B4QA 2OYZA 2WLQA 3JQXA 3RMXA 1W8UA 3ETPA 4N90A 2RS11 1AR61 2GSYA 2JIGA 5B2GB 3RSJA 4IGPA 4QGMA 1W90A 4LUMA 3ZXFA 2PHTA 4X8PA 5GLUA 3TBDA 4DXTA 2BVVA 5DAXA 4ASKA 3HAGA 5LWBA 3VBUC 2ZPXA 5C6CA 2BGCA 5F9TA 1XNDA 3PU3A 2ZAAA 4LUKA 4RQPA 1K5MA 2FBEA 3V64A 1XNKA 2AYHA 1XE7A 2VQTA 3KV9A 3ME2A 4XILA 4BQ5A 3BPSA 2R1BA 3LEKA 4GH4C 4L92A 3IIAA 2OW4A 2LRPA 3M3IA 2BU9A 2K2SA 3NAPB 4OFGA 3T30A 3VZNA 2XOMA 2O8QA 2ZOEB 3JD73 4YVSC 5A7NA 4L2NA 4YGCA 4OZXA 1NCRC 1X33A 2OVUA 3IZOA 3BODA 4J1XA 5C8CC 1SCRA 3KV5A 5A7QA 3POWA 4KWUA 1PGW2 2IXHA 3ACFA 1G9DA 2NYYA 3ZXLA 3SMHA 4RYDA 3HQUA 4KG0A 4CDXA 2XUMA 5JVVA 3HD8B 1G9FA 1LGCA 1PMHX 2JG9B 2YC4A 3RRDA 1PVC3 1OVPA 4E4HA 5C9AB 1UY0A 2D3PA 3I97A 3KV6A 1MVQA 1YEWA 2ZZQA 4LBQB 2ARCA 4E8DA 1AR73 3WF2A 4ISRA 4KL1A 1YWKA 3HIFA 3N9PA 2E6VA 2PAKA 4KU8A 3VDDB 3WLUA 4Q8KA 5L9VA 1V6LA 5C3QA 5K0UC 2UYAA 3LF7A 4DRVA 3ZFFA 4NPMA 4JGYB 5FMOS 4Y3OA 4L8QA 2D6OX 1JZ4A 3ACGA 4WVZA 1PIV3 5IVVA 4N53A 5LW9A 2SBAA 4RR3C 4Y1ZA 3NV4A 2OT7A 4LKDA 4YVSA 5FZMA 5J7MA 4IE7A 4ASMB 4OQ8A 3B9CA 3IPVB 2WNEA 2WIIB 3DCQA 2ATFA 4AEDA 2GMPA 4GA9A 4G9SB 3UT0A 5LK7B 4RQPC 2VNGA 2GN7A 4BDVB 4QPYA 3ILRA 2V72A 4COUA 1G9CA 1VAVA 3PUQA 5ACA1 2ET1A 1C57A 1RUC2 1W9FA 5EJ3A 2VBPA 2Q8CA 1YQ2A 2VM9A 3CKHA 1UMHA 1NE6A 4NHXA 4Q4Y1 3GZEA 4PIZA 5DMYA 5JZGC 3LZZA 1DGWA 2RHPA 4FP3A 1K5MB 1AR62 4YSFA 1Z78A 5K4LA 3DYOA 4RS5C 4XXPA 2PHFA 5DXDA 1RUD1 4GULA 4DMIA 2YBPA 2VZ3A 1WMXA 2DCYA 3MPPG 2VW0A 1SACA 4Q4X3 4CZSA 1W0PA 3ELNA 5G04L 1FMD3 2L9LA 2V5YA 2XBO3 2YFUA 1D4VB 3HBZA 4FPCA 5DDJ3 4Q0QA 5EQUA 1G6NA 4N8MA 1VMFA 5C8CA 2QDRA 4FI9A 4UOJA 4FOYA 4ARYA 3LSDA 2VZSA 2W68A 5IAVA 4UFLA 1RC6A 3BGAA 5GZDA 2Z5WA 4NPRA 4LO5B 4NE9A 1WD3A 4RHV2 3L2YA 2D5HA 3AZWA 4CUBA 2VMFA 3O1TA 4LOTA 1OVSA 1PM4A 2ZGPA 1GANA 3U1XA 2X5IB 3J7MA 1CVNA 1M4WA 3NNMA 3IMNA 1Q3EA 2XXZA 5F3CA 1JZ2A 2WQZC 3JBG1 3AYEA 2OQ7A 2CY6A 5FYCA 2BEOA 4J1WA 1ZZ7A 3MIDA 4OHWA 3OD4A 4V2WA 1SQ4A 3ZIXA 2BNNA 4DXZA 1V6OA 2WWSA 1OBNA 5FPAA 3VBSB 1SBFA 1SLTA 3V0BB 3AB0A 1FX5A 2PAMA 3FHQA 2P2KA 1AR92 3E6DA 4HSLA 1MS4A 5A3NA 2PAEA 2RV9A 3T2OA 2PMWB 2CWSA 2WZR2 2YPJA 5A1FA 1EP0A 1UOGA 5J09A 3AP9A 3FE5A 4QHZA 3C7GA 4I2OA 1ND3C 4A7KA 3ASIA 4FPKA 5FCCA 3KGLA 1JZ7A 1IKPA 3OPZA 1JYWA 1ENQA 4XACA 4CCNA 2VUCA 3MGUA 1QJY3 3JU9A 3IWZA 4SBVA 3HT2A 3U75A 1XE8A 4MGYE 1XSRA 5SV8A 4HL0A 4Q0SA 1CAWB 3NWKA 1AVBA 1QH7A 2D98A 3LEMA 4LKSA 3UV9A 5A6XA 2SLIA 1HN1A 4DO0A 3MIBA 1VBC2 4MXWB 2JB4A 5FWEA 4DXRA 5ABJA 3WW1A 1TG7A 2VBDA 1PGL2 3VBFC 1QH6A 3WW3A 5IVYA 2UURA 1EAH3 2EXHA 4ORFA 4QQ2A 3SEEA 5E88A 4TWTA 5D2AA 2QTWB 3GBWA 4PLOA 5A7OA 1DZTA 1Q5OA 2HYKA 1V00A 1C8NA 3AZVA 1J3PA 3VHNA 4AAXA 1HV0A 4GKYA 4P14A 1ZVFA 1W2AX 2UWAA 2AACA 3ROUA 1MEC2 4LBQA 1POQA 3RMYA 1ULDA 3AVSA 2JJ6A 4M3CA 3WQ7A 4AFCA 5FO8B 1OKOA 2XJQA 1BEV2 2NLRA 4RFT0 3Q8BA 3ZFGC 2DFBA 3KHCA 3CLPA 3MI8A 4CXWA 2QZ3A 2LTNA 3IN9A 1OF3A 1IS5A 5EYYA 3GM8A 4RA0A 3FZ3A 3RI8A 5EZWA 1FPN1 3WUDA 3CIHA 4XIOA 4Z2AA 5I91A 4K21A 1QY4A 1AYM1 4QKNA 5C71A 1WMEA 2CYFA 1HQLA 3OUJA 4H7LA 3JBG3 5DAWA 4M4RA 3BTYA 2R1DA 5BV6A 3GZUC 2IXJA 1NZCA 1RUI3 2JDHA 4DQAA 4XOGA 4LMFA 4LHKA 4ZKTB 5APAA 3O12A 2ZX0A 4XDQA 1RMU2 4HBNA 4QGLA 1MR5A 1O8SA 2YZ4A 2PHDA 1EY2A 1I1EA 1SEFA 1N3PA 2A5ZA 5JI7A 4NRPA 1R083 5C3RA 3KD4A 4XE9A 1UW8A 1E5SA 1BLZA 2P34A 5GZGA 1TQ5A 4LLOA 3EQEA 1A6CA 2HEYF 4LBJA 3M3EA 2HWB1 5GKAC 2B46X 2VQ0A 4I09A 5I0DA 2IFWA 5FMBA 4CDWB 4QQLA 5FY9A 4F3JA 4QX2A 1FMD1 4E2SA 1HQNA 1OXCA 1ZRFA 1SFYA 3THDA 2WLPA 4AF9A 1ODNA 2HEVF 2VJXA 1RUF1 3GHMA 5FPZA 2ZGLA 4WV8A 1CJDA 5FK8A 1KRIA 1QGLA 2R49A 2J1UA 2BGOA 4OI4A 3LA3A 2CGNA 3A21A 3C7FA 1ASJ1 2PLV2 3HNMA 2ZKLA 1XU2A 2IFRA 5E8AA 2RS31 3ZYGA 2KM2A 1LESA 1MVEA 3LDRA 4Y1VA 3AM2A 4OUEA 3RZZA 1JW6A 2JDYA 4A6OA 2W1SA 5GLWA 5T5PA 4K40A 1MQTB 4YVWA 2YC2A 1NT0A 1Q8VA 4JGZB 4QKDA 3RQ0A 5FPXA 2ARXA 5C3OA 1JYXA 4LORA 2X8KA 4BQ4A 3O7OA 2XL9A 5T55A 2ZGMA 1ZZCA 1JYVA 2W08A 1WW7A 4XJZA 5HCHA 5A1AA 2YY1A 1IG3A 1ZRIA 4YGBA 4IW3A 4UF0B 3H7YA 4IV1C 5DUUA 4YW1A 1CX1A 3SH5A 4FVVA 1RUJ2 3WP6A 5A7WB 2D6KA 1TE1B 2ZGRA 1MS1A 5IW0A 3ZLIA 5JDBA 2QQKA 2R16A 1W06A 2VZQA 4XFGA 2CAVA 2BRTA 2VXJA 5LCWL 4TLGA 1QMJA 1PZ7A 3FLRA 4IGOA 1QDOA 1KGYA 1YQ5A 2YFZA 1V9U2 1PVC1 4DOUA 4CXXA 1DYOA 1QIQA 4XBQA 3POJA 1COV3 1O91A 1RUI1 4NVPA 3RZMA 1E5RA 2R0FA 3H50A 5FLIA 1VE0A 3M8LA 4XF9A 4IV1B 4AVBA 1W0NA 1OPOA 5LASA 1BBT3 4XETA 4A42A 2ETEA 5FZGA 3I3EA 2V4VA 1LHUA 1W8WA 5FPVA 1GWKA 2EIDA 1XB9A 3KWVA 1R1A3 4BA6A 3DEMA 3ZYFA 2TNFA 4E2QA 1CGPA 3DXUA 1XC6A 5J98B 1PMIA 5JSRA 2IUWA 5HXVA 2Q8OA 4XQ4A 1OUXA 1Z7S1 1W99A 4QPGB 2RR11 3WNLA 4A41A 5FMDA 4ZZ5A 5KHKA 1UZWA 1S0BA 1PO21 2LUWA 3WV6A 4CDQA 3O1UA 4QMAA 5FZEA 4PI0A 4CP9A 2ZGTA 3A22A 2WBKA 1HV1A 1H8VA 4QQHA 4C90A 3NJVA 1LHVA 3J9SA 1EPZA 1DP0A 4KBZA 4WM7C 4XF4A 5T5LA 5KXBA 5C8WA 4HN0A 2K46A 1FNZA 1QKQA 4IEUA 5FZ9A 1RUG3 5JMCA 4UAPA 4XMAA 2D6NA 1XNBA 2R041 3FLPA 4YZ2A 1DDLA 3UNPA 3APBA 5IUQA 2GC3A 2ZZJA 2IVIB 3SHRA 2O8OA
chains in the Genus database with same CATH topology
5IVCA 4QU1A 3AVRA 3PTRB 4BU2A 5FYHA 5A7WA 3KVAA 2XXZA 5F3CA 5FYCA 2OQ7A 4QXBA 4V2WA 4IGPA 4GD4A 5FP4A 5FZFA 4GJZA 5FPAA 5FZHA 5LY2A 4ASKA 2YBSA 5FYZA 4QXHA 5LWBA 5FY1A 3PU3A 5FZOA 5F5CA 5F3GA 2OS2A 5FY5A 5A7SA 5A3NA 2W2IA 3KV9A 5FYYA 3U4SA 5A1FA 5FY4A 3NJYA 4D6QA 5FP3A 3AL5A 5FP7A 5A7NA 2YU2A 3PURA 3KV5A 5F2WA 5A7QA 4CCNA 5FP9A 5F3EA 2Q8DA 3DXTA 5FXVA 5IVBA 4AI9A 3K2OA 5LY1A 2P5BA 4UF0B 5F37A 5FZBA 5A7WB 4CCLA 5IW0A 3ZLIA 3LDBA 3OPTA 5FZKA 5A3TA 5F32A 5ANQA 5FWJA 4E4HA 5FZ6A 4Y4RA 5FYMA 3KV6A 4DO0A 5FUNA 5FXWA 4CCOA 5A1LA 3K3NA 5FWEA 4D6SA 4IGOA 5FV3A 4HONA 5FBJA 3N9PA 3LD8A 5KR7A 4CSWA 5A3WA 5FY0A 5IVYA 5FZ3A 4UF0A 5A7PA 2VD7A 2OQ6A 5A7OA 5FPUA 5FZ4A 2Q8EA 4LXLA 4Y3OA 5FPBA 5FXXA 4HOOA 4XDPA 2GP3A 4CUGA 5IVVA 2GP5A 5F39A 5FYBA 5LW9A 5FZMA 2OT7A 2YU1A 4EZHA 3AVSA 5FZCA 2WWJA 3PUSA 5IVFA 5FZGA 4NUBA 5A80A 4EZ4A 3N9NA 4D6RA 2XDVA 4URAA 5FZLA 4EYUA 4CCMA 3N9OA 5FPVA 3N9QA 4GAZA 5IWFA 3PUQA 5F2SA 5FPLA 5FY7A 3PDQA 5FZ0A 2Q8CA 3DXUA 4Y33A 4XDOA 5FJKA 4TN7A 3KVBA 5A3PA 3PUAA 1VRBA 4V2VA 5FYSA 5FYVA 5FYTA 4LIVA 2YBKA 5FZ7A 5K4LA 4C8DA 4GJYA 4CCJA 4AAPA 2XUEA 2PXJA 2YBPA 3KV4A 2WWUA 4BXFA 3K3OA 5FZAA 5ISLA 4QX8A 5F5AA 4CCKA 5FP8A 5FZEA 4DIQA 4LITA 5FYIA 4QWNA 4QX7A 5IVEA 3RVHA 5IVJA 5FZDA 3UYJA 2XMLA 3ZPOA 3N9LA 5FXZA 5FZIA 5F5IA 3OPWA 5FY8A 3N9MA 5E6HA 5FZ8A 2YPDA 5FZ9A 5CEHA 5F3IA 3AL6A 3PU8A 4IGQA 4BISA 4QXCA 5FJHA 5FUPA 5FZ1A 5FYUA 2OX0A 3U78A 4LIUA 5FZOB 5FY9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IVC A;  4QU1 A;  3AVR A;  3PTR B;  4BU2 A;  5FYH A;  5A7W A;  3KVA A;  2XXZ A;  5F3C A;  5FYC A;  2OQ7 A;  4QXB A;  4V2W A;  4IGP A;  4GD4 A;  5FP4 A;  5FZF A;  4GJZ A;  5FPA A;  5FZH A;  5LY2 A;  4ASK A;  2YBS A;  5FYZ A;  4QXH A;  5LWB A;  5FY1 A;  3PU3 A;  5FZO A;  5F5C A;  5F3G A;  2OS2 A;  5FY5 A;  5A7S A;  5A3N A;  2W2I A;  3KV9 A;  5FYY A;  3U4S A;  5A1F A;  5FY4 A;  3NJY A;  4D6Q A;  5FP3 A;  3AL5 A;  5FP7 A;  5A7N A;  2YU2 A;  3PUR A;  3KV5 A;  5F2W A;  5A7Q A;  4CCN A;  5FP9 A;  5F3E A;  2Q8D A;  3DXT A;  5FXV A;  5IVB A;  4AI9 A;  3K2O A;  5LY1 A;  2P5B A;  4UF0 B;  5F37 A;  5FZB A;  5A7W B;  4CCL A;  5IW0 A;  3ZLI A;  3LDB A;  3OPT A;  5FZK A;  5A3T A;  5F32 A;  5ANQ A;  5FWJ A;  4E4H A;  5FZ6 A;  4Y4R A;  5FYM A;  3KV6 A;  4DO0 A;  5FUN A;  5FXW A;  4CCO A;  5A1L A;  3K3N A;  5FWE A;  4D6S A;  4IGO A;  5FV3 A;  4HON A;  5FBJ A;  3N9P A;  3LD8 A;  5KR7 A;  4CSW A;  5A3W A;  5FY0 A;  5IVY A;  5FZ3 A;  4UF0 A;  5A7P A;  2VD7 A;  2OQ6 A;  5A7O A;  5FPU A;  5FZ4 A;  2Q8E A;  4LXL A;  4Y3O A;  5FPB A;  5FXX A;  4HOO A;  4XDP A;  2GP3 A;  4CUG A;  5IVV A;  2GP5 A;  5F39 A;  5FYB A;  5LW9 A;  5FZM A;  2OT7 A;  2YU1 A;  4EZH A;  3AVS A;  5FZC A;  2WWJ A;  3PUS A;  5IVF A;  5FZG A;  4NUB A;  5A80 A;  4EZ4 A;  3N9N A;  4D6R A;  2XDV A;  4URA A;  5FZL A;  4EYU A;  4CCM A;  3N9O A;  5FPV A;  3N9Q A;  4GAZ A;  5IWF A;  3PUQ A;  5F2S A;  5FPL A;  5FY7 A;  3PDQ A;  5FZ0 A;  2Q8C A;  3DXU A;  4Y33 A;  4XDO A;  5FJK A;  4TN7 A;  3KVB A;  5A3P A;  3PUA A;  1VRB A;  4V2V A;  5FYS A;  5FYV A;  5FYT A;  4LIV A;  2YBK A;  5FZ7 A;  5K4L A;  4C8D A;  4GJY A;  4CCJ A;  4AAP A;  2XUE A;  2PXJ A;  2YBP A;  3KV4 A;  2WWU A;  4BXF A;  3K3O A;  5FZA A;  5ISL A;  4QX8 A;  5F5A A;  4CCK A;  5FP8 A;  5FZE A;  4DIQ A;  4LIT A;  5FYI A;  4QWN A;  4QX7 A;  5IVE A;  3RVH A;  5IVJ A;  5FZD A;  3UYJ A;  2XML A;  3ZPO A;  3N9L A;  5FXZ A;  5FZI A;  5F5I A;  3OPW A;  5FY8 A;  3N9M A;  5E6H A;  5FZ8 A;  2YPD A;  5FZ9 A;  5CEH A;  5F3I A;  3AL6 A;  3PU8 A;  4IGQ A;  4BIS A;  4QXC A;  5FJH A;  5FUP A;  5FZ1 A;  5FYU A;  2OX0 A;  3U78 A;  4LIU A;  5FZO B;  5FY9 A; 
#chains in the Genus database with same CATH topology
 3DPR A;  1PK6 B;  1NXD 1;  2EVX A;  3WQB A;  3P6B A;  2HWD 2;  2V09 A;  4ZU5 A;  3Q8A A;  2E51 A;  2Y6G A;  5FYH A;  5JSP A;  5EIY B;  1ZZ6 A;  1PMJ X;  2GME A;  4QB1 A;  1U5Y A;  5HCA A;  4GJZ A;  1WGP A;  1RUC 3;  2WC2 A;  1RIR A;  5L7O A;  4A6S A;  4CDW A;  2WQ4 A;  3VKO A;  5F5C A;  4QM9 A;  2OS2 A;  5T54 A;  3N7J A;  2XVL A;  1LOF A;  2WFF 1;  1NAE A;  4FFI A;  4ZY9 A;  1KFX L;  4E4S A;  4QM8 A;  4CPB D;  2YYO A;  3WW2 A;  3OUH A;  4D6Q A;  1UYZ A;  3H3U A;  2O0O A;  4ZPI A;  3BTX A;  1DU3 D;  4JTN A;  4XFI A;  4IEO A;  4I3G A;  1Z7S 2;  3GBG A;  1GYK A;  1VP6 A;  1W9W A;  2Q8D A;  2I2S A;  5FOJ B;  3K2O A;  1BCX A;  3VBO C;  4ZU7 A;  5C4W C;  4C0H A;  2BZD A;  5CBL A;  5H9S A;  4CCL A;  1NCR A;  3WNO A;  5JXJ A;  4WM8 B;  1CZS A;  2ZAC A;  1H2K A;  2ENR A;  4JGZ A;  3MLL A;  5ANQ A;  1C8M 2;  2QQJ A;  1G86 A;  2QBX A;  4KGQ A;  1BMV 1;  1ZA7 A;  1BMV 2;  4DB5 A;  4HK8 A;  4JQR A;  4UXA A;  4XMI A;  2P3K A;  4YZ4 A;  4F83 A;  1TNR A;  5JCT A;  1FOD 1;  1PX3 A;  4UF0 A;  4YM0 A;  5EP9 A;  1F8V A;  1BK0 A;  1OFS A;  2RVA A;  3GZT B;  1OLQ A;  2HLE A;  4IET A;  5K7P A;  2E26 A;  3B3Q E;  2C9A A;  3JBG 2;  3G6J B;  3K46 A;  1JHJ A;  3LEG A;  3D4K A;  3R0R A;  4FBF A;  5BYN A;  3I59 B;  4NWV A;  3MEP A;  3KF3 A;  5C70 A;  4BMB A;  1R1Z A;  1QOO A;  3HN3 A;  1OPM A;  1SBD A;  3NJX A;  5DN2 A;  1RHI 1;  2XJV A;  4AXO A;  2DDU A;  3B94 A;  3ILN A;  3PLQ A;  1W6N A;  1LOA A;  4IEW A;  1VAL A;  2X53 S;  3WF3 A;  5FR3 A;  3VBU B;  1LGN A;  5ACA 3;  3AXE A;  1N1V A;  3A0N A;  1OQ1 A;  3ZN5 A;  1H8T C;  2JD4 A;  4IE0 A;  3ZXG A;  1N1S A;  3LB9 A;  5CZK A;  4LOS A;  2CDP A;  2WS9 3;  5FYV A;  5FYT A;  3ILF A;  2J1S A;  2RM2 3;  1LNS A;  2CAU A;  1KS5 A;  4LE4 A;  3LKJ A;  2A73 B;  1S2E A;  1GZ9 A;  2DV9 A;  2VOK A;  4KMQ A;  5LBC A;  1IPS A;  5A70 A;  1OUR A;  5FKB A;  3HPN A;  3NV3 A;  4HZF A;  1RUE 3;  5L19 A;  1UQX A;  1ND2 B;  4K1Y A;  2C6S A;  4MV2 A;  1AL2 2;  2Z69 A;  2FDG A;  4DIQ A;  1I6X A;  1W8T A;  4H2A A;  3ENR A;  1SG3 A;  4XFA A;  3T0D A;  2JG9 C;  3VKL A;  1O4T A;  3JZV A;  1VBC 3;  4KGG A;  3VD9 A;  3KHB A;  4HSJ A;  1I5Z A;  3ZFE A;  3HOB A;  3H1M A;  5E6H A;  3UKV A;  3BKZ A;  4E9K A;  4OUL A;  4AQT A;  2V4A A;  1W8O A;  5FOB B;  5AVP A;  2W1Q A;  4Q4W 1;  1YFW A;  1PO2 2;  3PIJ A;  1CIW A;  1NA1 A;  1O59 A;  2VPV A;  4GWM A;  4IEZ A;  4YW2 A;  4A3Z A;  3VZJ A;  4D0Q A;  3K51 A;  1C8M 1;  5E16 A;  1N3Q A;  4LUL A;  4P5Y A;  4FQ4 A;  3OGJ A;  3WNK A;  2WO1 A;  1KFU L;  1WZX A;  3K75 B;  4GKX A;  2TUN A;  3NKT A;  1LCL A;  5HCF A;  4CP1 A;  1WMF A;  4CDU B;  2W52 A;  4CU8 A;  1Y9M A;  2WZR 3;  4CDQ B;  1BVP 1;  1DIW A;  4CP2 A;  1HJG A;  3O0V A;  3TN9 3;  4BCU A;  2VNO A;  5EJZ B;  3C7H A;  4AHX A;  1SLC A;  3J8F 3;  1AX1 A;  2P3I A;  3Q8F A;  1DGR N;  2ZX4 A;  3ZXJ A;  1LUL A;  4HN1 A;  5BNP C;  2WZR 1;  3U4S A;  2VTF A;  1CAW A;  3DGT A;  3VBR B;  3VL9 A;  5JXI A;  1J1L A;  3B7M A;  3OTF A;  3Q8C A;  3H42 B;  5J96 B;  3S5Q A;  3PNA A;  2QQM A;  4IER A;  3SKV A;  4FAH A;  4N9H A;  1D0G A;  5GZC A;  1AYM 2;  5F3E A;  2AC1 A;  4DS0 A;  4EWA A;  2C24 A;  1B09 A;  2WNV C;  2NP0 A;  4GB3 1;  5F37 A;  2GU9 A;  3POG A;  3T1L A;  5IAT A;  2MEV 3;  1SPP A;  4XFH A;  2DWR A;  5FZK A;  3UGH A;  3VD3 A;  3B5L B;  3CL1 A;  3K4A A;  1OOP B;  3ZMN A;  1T6G C;  4R9A A;  4QXK A;  1EV1 2;  3IT8 A;  2RMU 1;  5K8S A;  2ZCW A;  3KCY A;  3VZL A;  2W1W A;  3FUQ A;  4B29 A;  1TMF 2;  3NV2 A;  5FV3 A;  1CAU B;  4O61 A;  4U36 A;  1AXY A;  3NVC A;  4MGQ A;  3AXD A;  2Q4S A;  1FOD 3;  1DQ1 A;  3ORJ A;  4AEJ A;  2V5D A;  3B9I A;  3CZU A;  4HVQ A;  4MHU A;  4OCT A;  2EAK A;  1RUE 1;  1RYY A;  2VZO A;  4EWD A;  1GV9 A;  1RJ7 A;  1ODM A;  2RMU 3;  3NKG A;  2CDO A;  2IXL A;  3WF0 A;  2ET7 A;  5BNO C;  1H9W A;  1AJO A;  2XJU A;  4EWE A;  2ZX3 A;  3KB5 A;  3NNF A;  2WWJ A;  3CO2 A;  3ALQ A;  4J6G A;  2XVK A;  2W0X A;  1W0O A;  4NIG A;  5FQ0 A;  5KHH A;  4N7U A;  5BNN C;  5I8T A;  2R6Q A;  1IS6 A;  5IWF A;  1DQ5 A;  2RR1 2;  3KT1 A;  5F2S A;  1IQA A;  1BHG A;  4R9B A;  1ACC A;  2W39 A;  4R4Z A;  2IXC A;  4RGK A;  1PX4 A;  2ZGU A;  5K0U B;  1S55 A;  1K5J A;  2XLF A;  4A2U A;  4FFG A;  4QB6 A;  5DQ0 A;  1S0F A;  1AYN 2;  4UW3 A;  5FMO L;  1AXZ A;  1J1T A;  4UBG A;  1UU6 A;  4CCJ A;  4AI3 A;  1GIC A;  4P00 B;  3FWE A;  3KV4 A;  5T5J A;  3LA7 A;  4C1W A;  4Q4V 1;  3MW2 A;  1KEX A;  4FTE A;  2VTX J;  4JTO A;  4OMC A;  5HI0 A;  4V1P A;  4QX1 A;  1RIN A;  2B9U A;  4QX0 A;  2XR4 A;  1ZBA 1;  2ZEY A;  3KT7 A;  5LZ6 A;  4B3N A;  2QZ2 A;  2Y60 A;  4AVA A;  1NUK A;  4Y22 B;  5A32 B;  4YVW B;  1XE0 A;  2GH8 A;  3AKS A;  3H8X A;  1GNY A;  1W9S A;  2E53 A;  2ZMN A;  1PVC 2;  2JX9 A;  3TAY A;  3UJQ A;  2QNK A;  4G3Y C;  4UT5 A;  3OUI A;  1UXX X;  2WR9 A;  4MGK E;  3O1O A;  4IGQ A;  2HWF 2;  1PZ9 A;  4NIA A;  2QQV A;  1UOB A;  3VDD A;  2OX0 A;  1JH5 A;  3E6B A;  2WS9 2;  4AQS A;  2CHH A;  2HH9 A;  1JHN A;  5K9Y A;  2XWB B;  4QPI B;  3LPG A;  4N43 A;  4RHV 1;  2LW8 A;  2VZR A;  3I2H A;  5GLZ A;  2GZW A;  5JOW A;  4SLI A;  5L7O B;  2W91 A;  4K1Z A;  1LU1 A;  1BXH A;  3DF0 A;  3CQO A;  5BNN A;  5GJ6 A;  4KQ7 A;  2PFW A;  1HXS 1;  1OQE A;  1PGW 1;  3S30 A;  1NE4 A;  3HN1 A;  4Y1U A;  2VW1 A;  5M0T A;  2YBS A;  4AHY A;  1A8M A;  2W95 A;  2ZEX A;  3DN7 A;  4XUR A;  1GP5 A;  3OEB A;  2OXB A;  3HWJ A;  4Z92 B;  3T1M A;  2VUD A;  3J7H A;  5ERL A;  3S7I A;  3WQ1 A;  1PO1 1;  1UF2 C;  2W2I A;  4Q5O A;  5A3U A;  2HBU A;  3BIE A;  1S0C A;  2GAL A;  1DQ4 A;  1GKB A;  1ZYB A;  1EUU A;  2YUE A;  2ZML A;  4XPV A;  3SCF A;  3WR0 A;  3ZYJ B;  3JD7 1;  4LO8 A;  2AR6 A;  3AMM A;  1NCR B;  1MZ6 A;  1KS4 A;  4XW3 A;  3TRS B;  3PUR A;  1UIK A;  3M3O A;  4YW3 A;  3H8O A;  4FTB A;  1CN1 A;  2PYT A;  5FXV A;  3WNX A;  5IVB A;  1ST8 A;  5JOX A;  2DUR A;  4WZC A;  4AGG A;  4IES A;  4TTG A;  5ACA 2;  2VU9 A;  5FK7 A;  2C0Z A;  4B7K A;  3URF A;  1NY7 1;  3SLI A;  2A6Y A;  3NAP A;  4Y5T A;  1OOP C;  2QDN A;  5AFE A;  2FQP A;  4GH4 B;  4Y4R A;  5KHG A;  3BVC A;  4CEY C;  4BQW A;  4Z2W A;  5IT6 A;  1AR7 1;  1C5I A;  4QPG C;  5JXG A;  4EN6 B;  4JDM A;  5T50 A;  3U37 A;  5J37 A;  2GDF A;  1I9R A;  1WCK A;  1WBL A;  1WCS A;  2OQ6 A;  1BK1 A;  1YRZ A;  5FZ4 A;  5CFD A;  3ZN4 A;  2Q8E A;  3PHM A;  4Q29 A;  2EXJ A;  4LBO A;  2YDE A;  2I74 A;  4NAO A;  2XHN A;  2W46 A;  5F39 A;  5T52 A;  5FBZ A;  4YZ1 A;  2OII A;  4C91 A;  2OUH A;  2QQN A;  2RR1 3;  3DKQ A;  4JKM A;  3VBU A;  5FZC A;  4WM7 B;  2ZGS A;  2PEL A;  5A80 A;  2BNM A;  4YWA A;  4E4D X;  1B35 B;  3BPZ A;  1A8D A;  4M00 A;  4X6Q B;  4MGS A;  4K9S A;  3IMM A;  3FHI B;  4MET A;  3RI9 A;  1GNZ A;  3NNG A;  3GJA A;  3PVN A;  2Y6F A;  1Y7B A;  2OZJ A;  1UY3 A;  4Y1Y A;  4Y33 A;  4XDO A;  3WHU A;  1G7Y A;  4MX3 A;  4COW A;  4JKL A;  3NW4 A;  3HBK A;  4HMZ A;  3ZYP A;  2RS5 3;  3H9A A;  3RYK A;  2HYX A;  4OHX A;  1LED A;  4IUG A;  5DAP A;  1HB3 A;  2R06 1;  1W6O B;  2R07 2;  2YGM A;  4MUV A;  1QQP 2;  3R05 A;  4NRQ A;  3ZFE C;  1X36 A;  1OMI A;  1R09 2;  2D6L X;  1S2K A;  1OD3 A;  4PT6 A;  4XFC A;  4EE2 A;  1NZI A;  5JOY A;  1R1A 1;  1W04 A;  4BME A;  4DNY A;  5LA0 A;  1DHK B;  4XJA A;  3ZMO A;  1ZBE 2;  3VD5 A;  2DCT A;  3CEW A;  3OPW A;  1HRI 2;  1LHW A;  4NO4 A;  4LT5 A;  1AR9 3;  2VQA A;  3LFM A;  4HVO A;  2RDN A;  1PGL 1;  2R04 3;  3AL6 A;  4BZ4 A;  3PU8 A;  3ZN6 B;  3K48 A;  3U07 A;  4W6Y A;  4BIS A;  1XRU A;  1MZF A;  1P8J A;  2B42 B;  5CFC C;  2WUH A;  1QJY 1;  1QDC A;  2BWC A;  2E7Q A;  2VCM A;  3ZFE B;  1NX9 A;  2GN3 A;  4NWW A;  3VUO A;  2XBO 2;  4ARX A;  4NHY A;  4MGZ E;  2VGD A;  4RFR B;  3EHK A;  3PTR B;  1H4H A;  1RUO A;  4QHB A;  4ISQ A;  1YO8 A;  2PQS A;  4LPL A;  5FAX A;  1XQN A;  4ASL A;  1U5Z A;  3WZ1 A;  3TYJ A;  2H6B A;  1NCQ C;  1Y4W A;  2C5D A;  1YC6 1;  4COZ A;  3WX5 A;  2Z79 A;  1G8W A;  3VD4 A;  4AQ2 A;  1WD4 A;  3VB9 A;  4JHT A;  1LB2 A;  1UYY A;  5LRS A;  1QXJ A;  2Y8K A;  4LHN A;  5A7S A;  1HDK A;  1VBD 2;  1AYM 3;  1ULO A;  4E8C A;  2JB8 A;  1XYN A;  2O14 A;  4NMI A;  5FP7 A;  1NLR A;  4MYE A;  2BER A;  3HNY M;  1ULP A;  1RTV A;  2BFU S;  4Q8L A;  1H9P A;  1NG0 A;  3KS7 A;  3MIF A;  3GHN A;  5HPO A;  1O3T A;  2VE1 A;  1CAV A;  1D4M 2;  3FFQ A;  1DLL A;  1LKN A;  1SLA A;  3EBR A;  3I2F A;  2PHL A;  2W3J A;  1W8Z A;  3R4U A;  2NMN A;  1QF3 A;  4UFH A;  1PIV 2;  5F32 A;  1OFN A;  2A70 A;  1XXN A;  5GZE A;  2RS5 2;  2WS9 1;  2A6X A;  1CWP A;  2RS5 1;  3LGR A;  3POE A;  4Q1R A;  1JOP A;  4CU6 A;  2WT0 A;  5A1L A;  1W6M B;  1JZ5 A;  4D3W A;  3NNJ A;  4W4Z A;  3BAL A;  4JQT A;  1T2X A;  5J3U A;  3HMY A;  1S1A A;  3I2K A;  3VHR A;  4IL7 A;  2VR4 A;  1OA3 A;  2DU1 A;  1TME 3;  1PK6 C;  3ZSK A;  1W03 A;  3AKT A;  1LOC A;  3OY8 B;  4LA3 A;  3UES A;  2GP5 A;  1A34 A;  2JE9 A;  4Q1P A;  1Z0H A;  5DUW A;  1LOB A;  1VBB 3;  3TNQ A;  1LRH A;  4JGY A;  1UPS A;  3V56 A;  5KXD A;  4CEY B;  3PTY A;  4R9C A;  4CA9 A;  3FBY A;  1VAK A;  4URA A;  1B35 C;  2C9K A;  4GAZ A;  3GCX A;  1HJF A;  3ZFF C;  1W6Q A;  2I07 B;  3USU A;  1US2 A;  1WLD A;  1YUD A;  1CPN A;  3MYX A;  2JXA A;  2WT2 A;  2D6P A;  3VL8 A;  2GNT A;  2D43 A;  3GDB A;  3S0M A;  2F17 A;  1OF4 A;  3K4Z A;  5FZ7 A;  3T4H B;  2KXL A;  4XJ8 A;  4ET7 A;  4LTA A;  3I49 A;  3EB7 A;  1IS3 A;  1RL3 A;  3NMB A;  2AZ5 A;  2EIC A;  2PXJ A;  1DCS A;  5JR7 B;  1F31 A;  5FZA A;  4AL9 A;  2UY9 A;  3OB8 A;  2HWF 3;  1WW6 A;  2ZA9 A;  3THP A;  2CNA A;  2OA2 A;  4CCK A;  4RGG A;  1X9T A;  1SCS A;  4AR2 A;  4TLF A;  4W6X A;  3RJ2 X;  2JE7 A;  5FFO C;  3MV0 1;  4CCC A;  1W6P A;  3VBH A;  3RDI A;  3ZPO A;  1OH3 A;  3N9L A;  4XAA A;  1L3J A;  2ZXQ A;  1N1T A;  1EAH 2;  1SLI A;  4S2H A;  5CEH A;  4N43 B;  1QJX 3;  4JX0 A;  4ZON A;  5EV7 A;  4Q4W 3;  2WAB A;  4OI0 A;  3AK0 A;  1D7P M;  4CDW C;  5JWP A;  4ZS3 A;  1C5H A;  1I5P A;  3LDK A;  2VZU A;  3OBA A;  1H1M A;  1NQJ A;  2OUJ A;  5BUV A;  4AGV A;  2ID4 A;  4O9E A;  3VBS A;  2XL7 A;  4Z8B A;  2W87 A;  3D0J A;  3WF4 A;  3AP4 A;  3N3H A;  3U11 A;  4QXB A;  3G7D A;  1JYC A;  1XYP A;  4MXV A;  3N4M A;  1GZT A;  2XLG A;  3OSD A;  1C4R A;  1VBA 1;  4AI0 A;  1UY2 A;  2VL4 A;  5FZH A;  3RZG A;  4BE3 A;  4URT A;  3V0A B;  2VVD A;  4QXH A;  4COV A;  3CF6 E;  2HWC 1;  2QFE A;  5C5T A;  1W39 A;  2DBI A;  2ZKN A;  1RUG 1;  5BNN B;  4N53 C;  3WG1 A;  2BUK A;  1TME 1;  1R08 1;  3NJY A;  3USU B;  4Y5Z 0;  1H4G A;  1OOP A;  4IEV A;  4Y20 B;  1WA6 X;  4MG2 A;  3FX3 A;  3K4D A;  3SH4 A;  3TEX A;  1KDM A;  1W8F A;  3KQ4 B;  3N35 A;  3M7A A;  2JG8 A;  2VUA A;  2OPW A;  3IDC B;  4LBL A;  4BQ1 A;  5AC9 2;  3T0A A;  2ZHL A;  4FPH A;  4AI9 A;  5GLT A;  3JXS A;  2RS1 2;  5FZB A;  1VB2 A;  2JEC A;  1UNB A;  2YMZ A;  4C0B A;  4HKL A;  5CKQ A;  1Y3T A;  3ZYH A;  5A3T A;  1HRI 3;  4QQP A;  1C28 A;  2VMI A;  1H30 A;  2K0G A;  2WNV A;  2BOI A;  1NY7 2;  3ZIW A;  1DYK A;  2VVF A;  4L99 A;  1FPN 3;  2GMM A;  4XAE A;  2J1A A;  4GIQ A;  1QU0 A;  2ZGN A;  4XUO A;  2K9Z A;  3FHA A;  3OGV A;  4P02 B;  1J58 A;  4CCE A;  3UKT A;  3AKQ A;  4EQV A;  4GH4 A;  4FFF A;  2E31 A;  2Y26 A;  3PJQ A;  1LEC A;  3A0K A;  4GWN A;  5F1R A;  1S0J A;  4HOO A;  2BYV E;  2GP3 A;  4GXL A;  1D2Q A;  5EYX A;  2X10 A;  3ZSJ A;  1QJU 3;  4RN5 A;  4U2A A;  3POB A;  3WEZ A;  3T2P A;  1ENR A;  2BBV A;  1A78 A;  1HB2 A;  3I7D A;  1W2O A;  4CYD A;  1VPH A;  3PVE A;  1NXM A;  4L97 A;  5IVF A;  1PZ8 A;  2PHX A;  4LLF A;  2ZAH A;  1FXZ A;  3PL0 A;  4ERO A;  2GNB A;  2CTV A;  1HX6 A;  3BI3 A;  3ZOI A;  4M0H A;  2N7G A;  2B5H A;  2R04 2;  1WBF A;  5FY7 A;  2B7Y A;  3TN9 2;  1V70 A;  4J25 A;  4MOA A;  2Y6J A;  2LRO A;  3AMP A;  1GQH A;  2WRA A;  1B35 A;  1Q56 A;  5FYS A;  1COV 2;  2YG0 A;  5TSW A;  1ZBE 3;  3KLS A;  1TVG A;  2J7M A;  5FRE A;  3ZKY A;  1S4C A;  1YCI A;  4UW6 A;  2Y6K A;  4YLZ A;  3M1H A;  2ZX1 A;  2VVE A;  4OI2 A;  4Y20 A;  3D8C A;  1YFU A;  1YYN A;  1OI6 A;  2B45 X;  1X9P A;  2WA3 A;  3TB0 A;  2Y64 A;  5I0R A;  1QJE A;  4QWN A;  1JZ8 A;  4AVV A;  4FCA A;  4XUT A;  1WKY A;  1EPW A;  4HG6 B;  5C3S A;  3ECQ A;  2YXS A;  1YIP A;  2RDR A;  4XZP A;  1RGS A;  4DY3 A;  2YPD A;  2RS3 3;  2Z2S B;  4KNC A;  1CQ9 A;  4FOV A;  3USS A;  3CJX A;  2P1B A;  1OA2 A;  2DTY A;  5FYU A;  4JRL A;  5FO7 B;  3V65 A;  3WDV A;  4HKW A;  1JU4 A;  2JDP A;  2PN5 A;  5CVR A;  5IVC A;  3LA2 A;  3IPV A;  5DDJ 1;  3W21 A;  4XJW A;  4A45 A;  4AOC A;  4AZZ A;  1YJL A;  5DAQ A;  3SIS A;  1PHM A;  4K6B A;  1V6I A;  4NHM A;  1PO2 3;  3MZH A;  5FYZ A;  4OHZ A;  1MZ5 A;  2VH9 A;  2W1U A;  1RMU 1;  3AKR A;  2EXI A;  4LKF A;  5A33 A;  5F7U A;  3BOW A;  2WNU A;  5I93 A;  4QB2 A;  5HXM A;  1UY1 A;  4XEZ A;  1YFY A;  5CFD B;  1DYP A;  4IQP A;  1OKQ A;  3AL5 A;  2Z42 A;  1HRV 2;  2BOJ A;  4Z1V A;  1QJX 2;  1YQC A;  4C1X A;  3MUZ 1;  4DIN B;  5KWR A;  1PGS A;  5F2W A;  3V0A A;  2VUJ A;  2IZW A;  1BBT 1;  1G9A A;  2WA4 A;  2Y0I A;  4AW7 A;  1ALY A;  1QOT A;  2P6H A;  1QEX A;  3J8F 1;  1Y43 B;  2JEN A;  3ATG A;  3IB3 A;  2JKB A;  1ZRE A;  2Q1F A;  5FYM A;  2WQ8 A;  4AFM A;  3SKJ E;  1HB4 A;  1XU1 A;  1IG0 A;  1UU4 A;  3K3N A;  4XAB A;  5IFT A;  5JPN B;  2JDK A;  3AZZ A;  2A71 A;  4HON A;  4IV3 A;  1ND3 A;  3I2I A;  1U0A A;  2FCU A;  2RS3 2;  4QKF A;  3E5Q A;  4QPI C;  2B8M A;  5IAX A;  2X5I C;  4OUM A;  5FPB A;  5FXX A;  1IPK A;  1UIJ A;  1UZY A;  4H3W A;  3MIE A;  1ZRC A;  3I2J A;  4D7S A;  1IQD C;  5L7O C;  4AHZ A;  5FLJ A;  2XBO 1;  2YV8 A;  3I2D A;  3QBQ A;  4P9X A;  3T09 A;  4DY5 A;  4EZ4 A;  4P9L A;  3DEC A;  1SMV A;  4YPJ A;  3T0B A;  2NN8 A;  2QQL A;  2VCC A;  3IDB B;  2XG3 A;  5FZL A;  1NA1 C;  3K77 A;  4FP2 A;  3D82 A;  4CCD A;  4XBL A;  1CAX B;  1UAI A;  1WMD A;  3PUA A;  1MEC 3;  2VZT A;  4YRD A;  5L9B A;  4LHS A;  1U5I A;  4BLJ A;  5KBF A;  3O1S A;  4I3P A;  4AEK A;  4PIX A;  1J59 A;  1HRV 3;  2EIB A;  4Q4Y 3;  3R4S A;  4D7Y A;  5A6Y A;  1WCQ A;  4R9D A;  4BXF A;  2Q1Z B;  2VMC A;  1K42 A;  3OBT A;  1C1L A;  1Z7S 3;  4PLM A;  4EN7 B;  4AG4 A;  5I8Y A;  4RSU A;  2R07 1;  4UW4 A;  3ACI A;  1H8T B;  4NN0 A;  2D97 A;  5JXH A;  1OD5 A;  4MXW A;  2VME A;  3POI A;  3VDA A;  4B4R A;  4CUA A;  3I54 A;  3BB6 A;  1RVF 2;  3KM5 A;  1JYI A;  3E1F 1;  3ZKU A;  5A6Z A;  2ZS6 B;  2MPF A;  2WFF 3;  5ANN A;  4Q27 A;  3SCG A;  3WVJ A;  1AL2 1;  2D6M A;  3TN9 1;  1YQ8 A;  3D3A A;  1YFX A;  1W6P B;  3VBH B;  3LQC A;  4LIU A;  2VMD A;  3EXU A;  2C26 A;  2RG4 A;  1AX0 A;  1VRH 3;  2PHR A;  2ZGQ A;  5DG2 A;  3L2H A;  1YQ6 A;  2FDH A;  1WLC A;  2ARE A;  1LHO A;  4ONU A;  2ORX A;  1O5U A;  4JDN A;  5A7W A;  2DBN A;  4MGI E;  4QDR A;  4XXA A;  4BOW A;  5JOZ A;  1IOA A;  2P4E A;  4QHO A;  5CFC A;  1VIW B;  2H0B A;  3AYC A;  4JVA A;  2CGP A;  3WCS A;  5BXX A;  3KCX A;  2A75 A;  2LM3 A;  5AC9 3;  2BTV C;  2HWE 1;  1NA1 B;  1YI7 A;  3GZA A;  5HV4 A;  2VEC A;  4RR3 A;  3H8U A;  3MW3 A;  5FZO A;  1GR3 A;  1RHI 2;  1SDD B;  3WOG A;  3MIC A;  2MNG A;  3GGL A;  2Y34 A;  5IK5 A;  5LEJ A;  3R4D B;  1VBC 1;  4DUX A;  4K7J A;  5BPX A;  5FP3 A;  3I3B A;  3CHX A;  4YFZ A;  2XVG A;  2BDR A;  4CDU A;  1WLW A;  4ATE A;  1CZT A;  1J3Q A;  3P3N A;  1X50 A;  2PHW A;  4ITC A;  4XHX A;  3QLQ A;  2G19 A;  1S0I A;  5CKM A;  3WDX A;  1IHM A;  3BTA A;  3VBO A;  3DXT A;  3ZXD A;  4CEY A;  2WNV B;  3VV1 A;  5CAZ A;  5LY1 A;  3I8T A;  2ZHK A;  1R09 3;  2EAA A;  1DQ2 A;  3B69 A;  4FFH A;  4ZXE A;  2WNU B;  5GM0 A;  5DDJ 2;  4CU7 A;  1RUH 1;  3GCW A;  4QAW A;  5F6L B;  3OGR A;  1FMD 2;  1UZV A;  3HEI A;  2FZ2 A;  2UY8 A;  5DAB A;  3ZN6 A;  3D5O A;  4IEP A;  4BQ3 A;  1RED A;  2AUY A;  3ZPY A;  5B4N A;  3MHZ A;  3LD8 A;  3MIG A;  5KR7 A;  4HET A;  3OD0 A;  1CD3 G;  1QJU 2;  2D44 A;  2IXI A;  3O5S A;  2VD7 A;  3VZM A;  2JKX A;  2FDI A;  5CAD A;  1W9Y A;  2VOV A;  5AFB A;  1JYN A;  1OLM E;  1XBF A;  1ZZ9 A;  4RHV 3;  4QD2 A;  3H1Y A;  5EFU A;  2XB6 C;  4A4A A;  5FRA A;  2FD8 A;  3MV1 1;  2E7A A;  2EXK A;  4QPI A;  3POF A;  4H55 A;  2WFF 2;  4IEQ A;  4A44 A;  1MZE A;  1LGB A;  2VQU A;  1VBA 3;  2Z4F A;  3JQW A;  4FPE A;  4NUB A;  3CJI B;  3W5N A;  2O1Q A;  4Q0P A;  4P08 A;  3U0Z A;  3N9Q A;  4FO9 A;  4XTM A;  2JDA A;  2HWE 2;  3ES1 A;  4QX3 A;  2PLV 3;  4N43 C;  3ABZ A;  1VBE 2;  3LEI A;  1S0E A;  3KVB A;  4I02 A;  1L7L A;  3AKP A;  3SXW A;  1CPM A;  1AR8 1;  1DQ0 A;  2HWD 1;  3EYP A;  4IV3 B;  3WNN A;  4M3C F;  4XIK A;  5KHI A;  5IFP A;  4RGA A;  2XUE A;  1V6N A;  1QHD A;  1F5J A;  3M70 A;  1AL0 G;  1BEV 1;  1L7R A;  5EWS A;  2Y38 A;  4YFW A;  1OSG A;  2R0H A;  5JSO A;  1NKG A;  3MO4 A;  1VRH 1;  3LE0 A;  4FT8 A;  1RUF 3;  3OYW B;  1GZC A;  2XHK A;  1AYN 1;  3SEP A;  5IVJ A;  3C3V A;  1RJ8 A;  1Y9Q A;  1KXG A;  1X82 A;  1ND2 A;  5FXZ A;  1FNY A;  1GLH A;  5FY8 A;  5FZ8 A;  2A6Z A;  3GXU A;  1AUY A;  1RUC 1;  2G9G A;  1X8E A;  4RS5 A;  4EN9 B;  5BNP B;  2E32 A;  3W58 A;  2F4P A;  3U78 A;  5C33 A;  3OBZ A;  4M4P A;  4W50 A;  3AVR A;  2ZMK A;  2CGO A;  3ZVX A;  4WM8 C;  3PIG A;  1V6J A;  1BVV A;  4AFA A;  3HQR A;  4CUC A;  1KJR A;  2WAO A;  5C7G A;  1URX A;  1E57 A;  5EXO A;  3I2O A;  4Q4X 1;  3VBS C;  1ZBE 1;  4YGD A;  2WYF A;  4CU9 A;  3O1M A;  3WG2 A;  1NLS A;  4Q2F A;  4FQZ A;  1NQD A;  1S0D A;  5F3G A;  5DAV A;  1AHS A;  1H6X A;  3WDU A;  1TME 2;  1YLL A;  3O1P A;  3E97 A;  4GAL A;  4GQ7 A;  4XFF A;  1AR9 1;  3WD5 A;  4KBB A;  4AFD A;  4AE2 A;  1CX4 A;  4OHV A;  4W6W A;  2HWC 2;  1XNA A;  5A33 B;  2Q5T A;  3VBH C;  3VZK A;  4JC1 A;  1LEN A;  4UBH A;  1RUI 2;  4CXY A;  2D3R A;  2J1R A;  2QQU A;  3LOB A;  1H1A A;  1LTE A;  4IDZ A;  4LNV A;  5EHD A;  3DKW A;  1OH4 A;  5KHJ A;  4MLO A;  1GZW A;  3LDB A;  4XC9 A;  3LSE A;  4CEW C;  5FWJ A;  2VXR A;  1A3K A;  4AVS A;  1VR3 A;  2VMG A;  1ASJ 3;  2VZP A;  1GUI A;  1UPI A;  1V6K A;  3AMH A;  3F2Z A;  4QKB A;  4YG0 A;  4YW4 A;  4D6S A;  3E6C C;  2XGX A;  1VMJ A;  1RUJ 1;  1SPP B;  3RZH A;  2LS6 A;  2HKX A;  2GC0 A;  1EAH 1;  2P3J A;  2Y6L A;  1D4M 1;  4OVE A;  3THT A;  3MBW A;  1NYW A;  1W6N B;  1XYO A;  2GND A;  4PDW A;  5CIS A;  4BWO A;  1H2N A;  4AED B;  4LQR A;  4LXL A;  2PHU A;  3R6S A;  1N1Y A;  1OA4 A;  2AGS A;  2ZAB A;  2JDM A;  5IK4 A;  4IE6 A;  1CZV A;  1ND3 B;  2CL2 A;  4P9J A;  4M0N A;  4PF5 A;  4QDQ A;  2HWD 3;  2C4X A;  2AH2 A;  1XNT A;  2C1F A;  1VBD 1;  4OLL A;  1CON A;  2DUO A;  5LK5 A;  4RL7 A;  3VBO B;  4AHW A;  5ABJ B;  5CNA A;  4JKK A;  5GZF A;  4WZF A;  4JHZ A;  1RHI 3;  1ZM1 A;  1QQP 3;  1ZA4 A;  3AC0 A;  5F8P A;  1UZZ A;  1M06 G;  3HVD A;  4PQQ A;  3MIH A;  4FOW A;  3AZX A;  4DEV A;  2MHF A;  1QNW A;  2E33 A;  4TN7 A;  1TNF A;  3J4U H;  5IYY A;  5LBF A;  4D7T A;  1EV1 3;  3VDC A;  4AFB A;  3OG2 A;  5DUX A;  5KXE A;  2RE9 A;  3WDY A;  2UYB A;  3FBM A;  4GJY A;  4EN8 B;  4K8F A;  4AAP A;  3RZL A;  1QJY 2;  1QWR A;  5LA9 A;  1VRH 2;  3S5A A;  2WWU A;  2JG8 C;  1H0B A;  3WW4 A;  2VOX A;  1XPW A;  4PJY A;  3WT3 A;  3ZDS A;  3TEY A;  5ISL A;  4YW7 A;  1MPX A;  3P5B A;  1J3R A;  2Y33 A;  1FI2 A;  2GAU A;  1DG6 A;  2V73 A;  4CE8 A;  2AEZ A;  3FMG A;  1VMH A;  2OKX A;  1CIY A;  1LOD A;  2P6C A;  1GP6 A;  3HT1 A;  2ZGO A;  2ZTN A;  5FZI A;  2NMO A;  2G4I A;  5E89 A;  1R1A 2;  1F2N A;  2YRO A;  1Q8O A;  4KU7 A;  2FCV A;  3RYR A;  5CIR A;  4KWL A;  1O3S A;  4NR1 A;  5FZ1 A;  2DU0 A;  1FAY A;  3BU7 A;  2W5F A;  1E5H A;  4HK9 A;  2TBV A;  2NM1 A;  1PVX A;  5IHR A;  4GWJ A;  1IPJ A;  5DZG A;  2HWF 1;  2WO2 A;  2VY0 A;  4BLI A;  1OLR A;  3KVA A;  4WVM A;  3W9A A;  2JDZ A;  4LEJ A;  3ZXE A;  2ZBJ A;  2XKP A;  2J42 A;  1FPN 2;  3B00 A;  2R32 A;  4P9I A;  4KI5 M;  3KSC A;  3RJR A;  4FTS A;  2JDN A;  4BK4 A;  2ARB A;  4S2D A;  4B1L A;  2EA7 A;  4XF3 A;  5FKC A;  3MPB A;  3ES4 A;  2RM2 2;  4YW5 A;  4OI1 A;  1MQT C;  3DL3 A;  2XPJ A;  4CPB A;  4GZ9 A;  1GP4 A;  4D94 A;  1DGW X;  2CWM A;  1RUD 2;  5T5O A;  2IVJ A;  4YVS B;  4RS5 B;  1AX2 A;  2FHR A;  3F95 A;  1N47 A;  2WYS A;  3IM0 A;  2DCZ A;  4EN0 A;  3POS A;  4ZZ8 A;  3MF9 A;  2FCT A;  3S6P A;  3B02 A;  4A7Z A;  3O0X A;  3AP7 A;  5I8S A;  1AL2 3;  5JLV A;  1ENS A;  2WKK A;  2PQQ A;  2A6V A;  1O3Q A;  5C9A C;  1JTZ X;  1HQW A;  1CAX A;  4R4X A;  1CES A;  3J26 N;  4IEX A;  5FXW A;  2ARA A;  1STM A;  2F6B A;  4Q0V A;  5KC6 A;  1H1I A;  1EUT A;  2A3W A;  1GWM A;  2BP6 A;  1JUI A;  3VKF C;  1UO9 A;  3GBF A;  4GMP 3;  1ZZ8 A;  4YZ3 A;  1HRI 1;  1APN A;  5IK7 A;  4K20 A;  5A7P A;  4P9W A;  1UXZ A;  1FV3 A;  5FLH A;  3JB8 A;  3VHO A;  1O6U A;  3WG4 A;  4AWD A;  1MQT A;  3ZYB A;  2UWB A;  4HKO A;  4FSJ A;  4LBK A;  1I3H A;  4R52 A;  5DUV A;  3ACH A;  3OJB A;  3HNB M;  3JD7 2;  4CDU C;  2JDU A;  3MUY 1;  1GOF A;  4YYO A;  4EZH A;  4PDW C;  4A3X A;  2BW8 A;  2QQI A;  3WP5 A;  4L11 A;  3PVB B;  1UY4 A;  4CRQ A;  1YIF A;  2H0V A;  1GQG A;  3MF6 A;  2WFP A;  5F6K A;  4EYU A;  4RQP B;  5A32 A;  3RZK A;  2H6C A;  2R06 2;  4PQ9 A;  5FIX A;  1IS4 A;  1GZW B;  1AR8 2;  3DV8 A;  3B93 A;  5FPL A;  3TNP B;  3MLJ A;  4XTP A;  5FZ0 A;  4UWD A;  4BJ0 A;  1HXS 2;  4QX5 A;  5CA6 A;  1VBE 1;  4V2V A;  1BQP A;  3WSO A;  4COY A;  1SLL A;  4I30 A;  2VZV A;  2BVB A;  2JIJ A;  4BHP A;  3U10 A;  1HN0 A;  3I3Q A;  4XUQ A;  2X05 A;  2GC2 A;  2I45 A;  5JMO A;  2QQW A;  1MS5 A;  3SCH A;  2OZ6 A;  3AMQ A;  4I0W B;  2QQP A;  5LBB A;  1W2N A;  4IXL A;  4LA2 A;  4IV1 A;  5C9A A;  2DUQ A;  1VLN A;  3GNE A;  5D8A B;  1X8M A;  1ZBA 3;  2X09 A;  3MFA A;  1SDW A;  1UX6 A;  4LJH A;  5FZD A;  3KQR A;  3UYJ A;  3MW4 A;  5IJR A;  2DVA A;  4NRM A;  5BNQ A;  2W94 A;  3BYW A;  3ZSM A;  1QXR A;  2ZGK A;  4MO3 M;  2TEP A;  5F5I A;  4FPF A;  5HCB A;  4WBB A;  3W20 A;  3PMS A;  3QOP A;  4L9B A;  4DRR A;  1LR5 A;  3RZJ A;  1FV2 A;  1W6Q B;  5FMC A;  1TMF 3;  4Q4V 2;  4I01 A;  1S0G A;  2X29 A;  4XF0 A;  5FUP A;  1KIT A;  1J84 A;  4MHR A;  1PNG A;  5CG9 A;  5FZO B;  1RB8 G;  2QKD A;  1HIX A;  1UOF A;  4LBM A;  1Q43 A;  1ULG A;  2CU5 A;  3IDE A;  3U4X A;  3D6E A;  5BNP A;  2AEY A;  3GJB A;  2WNU C;  2DVF A;  3E5X A;  1XOY A;  5BNO A;  2WDB A;  4NII A;  1W05 A;  2XLA A;  1GMM A;  4QGN A;  4P9Y A;  3FL7 A;  4CP9 B;  3OEA A;  4FPJ A;  1V9U 1;  3ZM8 A;  4B4P A;  2F4L A;  2VOW A;  4DPN A;  4ES8 A;  5FY5 A;  1LOE A;  3N7K A;  2NZ9 A;  2RMU 2;  3WDT A;  4CP0 A;  4WVM B;  3T2T A;  1LU2 A;  4DEQ A;  2ZJC A;  1GBG A;  3J8F 2;  4PF1 A;  3UET A;  2RJL A;  3WP3 A;  1XNC A;  2DVB A;  3FC0 A;  4UFJ A;  4XBN A;  3T08 A;  3QD6 A;  4OUS A;  2ZHN A;  3UK9 A;  4OHY A;  2LAL A;  3H3L A;  4GB3 2;  3AMN A;  5L73 A;  3III A;  4KWJ A;  4UFK A;  1G9B A;  3OBR A;  1QOS A;  4MH0 E;  4UFM A;  2VNR A;  3M3C A;  1OUS A;  1F35 A;  1O5L A;  3LIH A;  4O65 A;  1UMI A;  4GB3 3;  3PVO A;  1VAM A;  3NJZ A;  1PM7 A;  1RVF 3;  1ZX5 A;  2UWC A;  5FUN A;  3JCI A;  4BIF A;  4R8H A;  4WM7 A;  3AFG A;  1UL9 A;  5A3L A;  5FBJ A;  1YI9 A;  2R07 3;  5CKN A;  4CSW A;  4M01 A;  1DQ6 A;  3VBF B;  3KF5 A;  5JZG B;  1W6O A;  4K3U A;  2W47 A;  2RS1 3;  5IK8 A;  3QH6 A;  1ASJ 2;  1RVF 1;  2QQO A;  4N7I A;  1YNA A;  2KR2 A;  4BPZ A;  3SIT A;  5CFC B;  1ZBA 2;  1FOD 2;  5D8A C;  2J1V A;  4LKE A;  5EPA A;  4D8M A;  3VLB B;  4HPK B;  3ZR6 A;  4AEM A;  4PDW B;  3IDA A;  4W8J A;  3V0B A;  2DYC A;  4TZD A;  3O1V A;  3N9N A;  1S2B A;  4D6R A;  2XDV A;  1W28 A;  4CCM A;  2EIE A;  3N9O A;  1GNH A;  2D3S A;  3AP6 A;  1ULF A;  1HKD A;  4QPG A;  4WM8 A;  4AI8 A;  4ES9 A;  3WY6 A;  2MEV 2;  3O1R A;  1POV 0;  2DCJ A;  1JZ6 A;  5FJK A;  5H9Q A;  4XYX A;  3N36 A;  2GH2 A;  3CDZ B;  1O4Z A;  2YBK A;  1ONA A;  1UMZ A;  2VCA A;  3P1I A;  4YM1 A;  4C8D A;  5LEK A;  4F7Z A;  1FAT A;  4S2F A;  1SZB A;  5DG1 A;  1RIT A;  3LAG A;  2WL1 A;  4LBQ D;  2W9X A;  4FAG A;  5D21 A;  2XJR A;  4QX8 A;  3PUH A;  4Q4W 2;  4Y1X A;  2VO5 A;  4DUV A;  2DTW A;  3WCR A;  5C4W B;  1V6M A;  2G9F A;  4Q26 A;  4YVW C;  4MSV A;  1F15 A;  2HJI A;  3RVH A;  2XJP A;  4B1M A;  4BH9 A;  1Q8Q A;  4BQX A;  1RUE 2;  3J7N A;  1DZR A;  3LPF A;  3M4F A;  3IKW A;  3NRU A;  2D7F A;  4O7X A;  1UKR A;  3N9M A;  5FUI A;  4PIY A;  3NV1 A;  1D2S A;  1LHN A;  2QE3 A;  4XFB A;  1TMF 1;  3BU0 A;  4XVH A;  2BFU L;  1GOH A;  1ZZB A;  3TEW A;  4N9I A;  3PJY A;  3FLT A;  1BKZ A;  4OMD A;  4YM2 A;  4UI9 L;  1Q8P A;  3PME A;  4LHL A;  3AJY A;  3OOX A;  4JGY C;  4M3C B;  3ZFF B;  3CU7 A;  2ORZ A;  4Q4V 3;  4XJU A;  4XUN A;  3ZSE A;  1LOF C;  4LO6 B;  2EF6 A;  5J36 A;  3I2G A;  1HB1 A;  2R06 3;  3C2U A;  5JR2 A;  1REF A;  5A3M A;  4OZO A;  5FP4 A;  2WT1 A;  3ZFG A;  2BGP A;  3CBN A;  2J22 A;  1JS9 A;  5D8A A;  3D0S A;  1FYU A;  5FO9 B;  1JYT A;  3WG3 A;  3Q9O A;  3WDW A;  4XF1 A;  5FYY A;  3PUI A;  5CFD C;  1VBE 3;  1SBE A;  2R7E B;  4XJ9 A;  3MFC A;  3AYD A;  4Z07 A;  3ZDV A;  3KZ4 C;  3KGZ A;  1O8P A;  2XQX A;  1UWW A;  3NNL A;  5FP9 A;  4H7M A;  1LOG A;  4OQ9 A;  2QUO A;  1QJU 1;  1UKG A;  1ND2 C;  1WUV A;  3I4I A;  5AC9 1;  1K3I A;  2BPA 2;  3OPT A;  4KH9 A;  1JOB A;  2XWJ B;  5A6Q A;  1LEM A;  2JD9 A;  4CCO A;  4CDQ C;  4YZ5 A;  3UJO A;  2DF7 A;  3BIW E;  2FDJ A;  1C3H A;  1F4A A;  4KWK A;  5FY0 A;  1RUD 3;  4AYU A;  1POV 3;  1RUG 2;  1GSL A;  1D4M 3;  5FZ3 A;  2WN2 A;  4G4F A;  1PNF A;  3WUC A;  1H2L A;  1VBA 2;  4AI2 A;  5LA1 A;  3QH7 A;  1LAJ A;  2WSU A;  4BB3 A;  2J1T A;  3VBR C;  1J83 A;  2Q30 A;  2YGL A;  4D69 A;  1AJK A;  3LFI A;  2RJ2 A;  3QCW A;  4DUW A;  5DZF A;  1PO1 2;  2ADD A;  3DPR C;  2IWG B;  3EMR A;  1F9K A;  3VBF A;  1AXK A;  3SQO A;  4XHB A;  1BZW A;  1JMU B;  3T4V A;  2HEW F;  4PCR A;  3NL1 A;  3VGI A;  5DPN A;  2VCB A;  5B4X A;  2XH6 A;  4I0B A;  5AVA A;  1WW5 A;  4GMP 0;  1COV 1;  1H6Y A;  2BV4 A;  3C7E A;  3NAP C;  3ON7 A;  2JWP A;  4FOQ A;  3VDD C;  4BK5 A;  1PK6 A;  4HPK A;  3CNA A;  4CTE A;  2UU8 A;  1VBB 1;  3L9J T;  3S57 A;  1X7N A;  4KG8 A;  5FQ0 B;  3W59 A;  1JBC A;  4ZHN A;  1W2T A;  1JN2 P;  3IAQ A;  4CVU A;  1JOD A;  4FPO B;  3RWK X;  3INA A;  4LK6 A;  3EJK A;  5F5A A;  1OT5 A;  1JU3 A;  5LAT A;  4XCA A;  1NLQ A;  2NPI A;  2DVG A;  1DLC A;  1QJZ A;  4DFS A;  5IVE A;  1UOJ A;  4CEW B;  4XZU G;  1U5X A;  4PHZ A;  5GAL A;  1VBD 3;  1MS9 A;  5L9R A;  3WP4 A;  4JZR A;  2QCS B;  5ABJ C;  3MDP A;  4AK3 A;  5KC5 A;  1ULC A;  2OPK A;  4PBP A;  4Y5S A;  1V9U 3;  2ZX2 A;  5FTT C;  1IZ3 A;  3CZJ A;  1N3O A;  1FT9 A;  1GQP A;  4IEY A;  4NHK A;  1EYB A;  1CR7 A;  4NOT A;  1GFF 2;  5BNO B;  2PTM A;  3AP5 A;  4UW5 A;  2VOT A;  5CG8 A;  1DF0 A;  2IC1 A;  5KXC A;  1Y9G A;  1F4H A;  3ST7 A;  2JEM A;  1SLB A;  1RUH 2;  4BU2 A;  3O0W A;  3OGS A;  2E7T A;  4LBN A;  4H14 A;  3OCP A;  3SNM A;  2JE8 A;  4HAN A;  2WO7 A;  2ZEW A;  5SV5 A;  1UD1 A;  4GD4 A;  2FDK A;  3AJZ A;  4AI1 A;  2JG8 B;  5FZF A;  3WF1 A;  2Y0O A;  5LY2 A;  5I0S A;  2BQP A;  5C3P A;  2D93 A;  2HWC 3;  2CSG A;  3DYM A;  1US3 A;  1IKQ A;  3M2M A;  2JIC A;  3HJR A;  2HWB 3;  1RXF A;  2X5I A;  3QAC A;  5FY4 A;  1IGO A;  3KMH A;  4PI2 A;  1YXW A;  2RDS A;  1WA4 A;  4CDX B;  1KD7 A;  2EIG A;  2A7A A;  5A3O A;  1YHF A;  3A7Q A;  3NO8 A;  3ZFG B;  2PA7 A;  1Q8S A;  3B01 A;  2ILM A;  3UL2 A;  2P5B A;  3ZSL A;  1DGR A;  1BJQ A;  3CMG A;  3HQX A;  3J7L A;  3RFR A;  5FDB A;  2AEN A;  1CAU A;  1O4Y A;  2A3Y A;  2P3Y A;  5I0U A;  3RG0 A;  3TEZ A;  2WNO A;  2XQR A;  4UFI A;  4ZXK A;  3AYA A;  5FZ6 A;  4E4Z A;  3KT4 A;  1GOG A;  1BBT 2;  3N7M A;  1XJA A;  4XCB A;  4N53 B;  1UCX A;  2RDQ A;  2EAL A;  4M3C E;  4MZU A;  5A3W A;  2JG9 A;  4FPL A;  3T2Q A;  5JAX A;  1QJF A;  4EV0 A;  2HBT A;  1DFQ A;  1JXN A;  1MAC A;  1AR6 3;  5BY5 A;  2YB7 A;  5FPU A;  3RNS A;  1W2U A;  1PO1 3;  1E5I A;  2WSV A;  1REE A;  2B39 A;  3BOP A;  4XDP A;  4CUG A;  3NQH A;  4NJ4 A;  1QJX 1;  3BUC A;  1OHF A;  1UYX A;  1HRV 1;  5FYB A;  1RUF 2;  3GYD A;  1AR8 3;  4FPY A;  4LO4 B;  2E9Q A;  2YU1 A;  1GWL A;  5DZE A;  3SC7 X;  2XJS A;  1ZNP A;  1QXP A;  2FMD A;  3PUS A;  1HXS 3;  3VKM A;  4AGR A;  4PBO A;  5K0U A;  1OQD A;  2WIN B;  1HLC A;  2B9V A;  4YG6 A;  1W8H A;  4LK7 A;  3UGF A;  3P3P A;  4GMP 1;  1POV 1;  3S7E A;  3WHT A;  3LIG A;  1RUJ 3;  4BQY A;  4WVV A;  4BYY A;  1DBN A;  4JGZ C;  3LWC A;  3I3M A;  3JB4 C;  4QQO A;  4E27 A;  5A3P A;  1XSQ A;  4Y24 A;  4AED C;  4XQD A;  5C4W A;  3X29 B;  5JIA A;  4QPW A;  3BN6 A;  4ATF A;  5LB6 A;  2QVS B;  1K12 A;  2YC0 A;  3CJI A;  1TEI A;  4MAD A;  1JI6 A;  2NQY A;  3E5U A;  3RYP A;  1R08 2;  1JOJ A;  4NPL A;  2ZEZ A;  4I0A A;  4WVW A;  4AVC A;  1ZRD A;  1W9T A;  1C8M 3;  2CV6 A;  4XQW A;  1T6B X;  1WCU A;  1QQP 1;  4IE5 A;  4LIT A;  3VDB A;  2WZ8 A;  1C1F A;  4HFS A;  1F5F A;  4QX7 A;  4JRA A;  4X6R B;  5JUV A;  4JDO A;  2VBB A;  3POY A;  2XML A;  4BIO A;  3U14 A;  3I3D A;  2A3X A;  3H3Z A;  2B4K A;  5CYY A;  3H0O A;  3DUI A;  5J48 A;  1W3V A;  1EV1 1;  4QT6 A;  4NAM A;  1BYH A;  1DZQ A;  2XKO A;  5F3I A;  3WNM A;  4NIH A;  4MVT A;  2KD7 A;  3LCP A;  2VZ1 A;  4Y22 A;  4DZG A;  1UZ0 A;  3N7L A;  4FPG A;  4TYS A;  3TOJ A;  3I59 A;  3ZR5 A;  1PIV 1;  5GLV A;  5HBA A;  1TZO A;  2G1M A;  4HVR A;  1VBB 2;  5G05 L;  2A1X A;  1RUN A;  5H9P A;  3RGB A;  1AYN 3;  5T3N A;  4NRO A;  2ADE A;  3AFK A;  4YG3 A;  3T3Y A;  3VBR A;  1JUH A;  4IE4 A;  3OY8 A;  2WZP P;  1KQR A;  3A23 A;  3JUU A;  4Q0U A;  4FXK B;  1U12 A;  1BEV 3;  5LRR A;  2ES3 A;  5JI9 A;  3VZO A;  2VG9 A;  4NHL A;  2J1E A;  3FJS A;  5FY1 A;  1RMU 3;  1VJ2 A;  3OYW A;  4FXG B;  3TWI A;  4MGT A;  1L7Q A;  2DUP A;  2WAA A;  5D1I A;  4ZU4 A;  2XON A;  4EJR A;  1HW5 A;  1MEC 1;  4YGE A;  2DFC A;  2WJS A;  3GAL A;  4LO7 A;  5LBE A;  2FMY A;  4HT1 T;  3AZY A;  3RS6 A;  4IV3 C;  2PLV 1;  1OLM A;  2DVD A;  2WZE A;  2D40 A;  2P17 A;  2VMH A;  2YU2 A;  4CDX C;  4PLN A;  4Z82 A;  1ENX A;  3BCW A;  4A7Y A;  1O3R A;  4E2G A;  1WWY A;  1MS3 A;  4JCK A;  4GWI A;  2BWA A;  3ZXA C;  2MEV 1;  3H1W A;  1SHW B;  2HWE 3;  1YJK A;  2W92 A;  3C8X A;  3IAP A;  3VN4 A;  5E1R A;  3CJI C;  4HXC A;  3RWN A;  4AQ6 A;  5CB7 A;  2IXK A;  3UKN A;  1H2M A;  4AVT A;  1KJL A;  4B8E A;  3KCC A;  2DCK A;  3WNP A;  1NCQ B;  2HWB 2;  1QNY A;  4W65 A;  1K5M C;  2RM2 1;  1JZ3 A;  3VD7 A;  4JV4 A;  2VAU A;  3LOI A;  5L36 A;  1KDK A;  5I0T A;  3FFZ A;  1CAV B;  3UGG A;  1W3X A;  1UX7 A;  3FN9 A;  3O14 A;  4JAA A;  4LR4 A;  2FDF A;  3NST A;  4BM8 A;  3OGG A;  2P37 A;  2QJV A;  1R64 A;  2VUL A;  2XJT A;  2YHJ A;  2E63 A;  3AX4 A;  1SFN A;  3WQ0 A;  4YAR A;  5J1X A;  2A6W A;  2BNO A;  4RD7 A;  4TSV A;  5JPM B;  2R30 A;  3GF6 A;  4IND A;  3OF1 A;  3HR9 A;  3DPR B;  2Y6H A;  4NID A;  1H8T A;  5CU1 A;  1RUH 3;  5JIU A;  1WLT A;  4XUP A;  1DGL A;  1W6M A;  2VTX A;  5C8C B;  1RXG A;  1R09 1;  3ITQ A;  4YM3 A;  3H8R A;  4TXW A;  2FZ1 A;  5H9R A;  5LA2 A;  3WIN E;  4L0P A;  4BQ2 A;  4F8A A;  5HV0 A;  4P9G A;  4P5H A;  2ZHM A;  3ETQ A;  3ZX7 A;  3EO6 A;  1WCD J;  3DYP A;  3PDQ A;  3A4U A;  1MS0 A;  4YW6 A;  2Q0A A;  2BBA A;  4ZS2 A;  3VHP A;  2KA3 A;  1VRB A;  4X8N A;  4Y26 A;  1K45 A;  1ZRR A;  5C5U A;  3M3Q A;  3ZYI B;  4LIV A;  3ZYR A;  2D5F A;  1MS8 A;  2GC1 A;  2VW2 A;  2Q1M A;  1GU3 A;  3WXP A;  3ZXK A;  2G9Z A;  4O9G A;  4QU2 A;  4CEW A;  1NOV A;  3W5M A;  4UYB A;  3THC A;  2VNV A;  1UYP A;  2ERF A;  3K3O A;  5FP8 A;  4B7E A;  2BJS A;  4BXS V;  5FYI A;  4RR3 B;  1AF9 A;  4LE3 A;  1AZD A;  1OC1 A;  4YNI A;  1CJP A;  3VKN A;  2WO3 A;  1UN1 A;  3BTZ A;  4QDS A;  4Q4X 2;  5EJ1 B;  1WW4 A;  1V0A A;  1VB4 A;  4DXS A;  3ACL A;  3H7J A;  1UU5 A;  2GNM A;  3MLK A;  4Y4Y A;  1D0H A;  5JZG A;  2RJK A;  1SFP A;  3FUO A;  4Q4Y 2;  2WN3 A;  1LJ7 A;  3RPQ A;  4S2G A;  1NCQ A;  4HLT A;  1AR7 2;  4QXC A;  5FJH A;  1W8N A;  3IBM A;  3C7O A;  3SH3 A;  3Q8E A;  4QU1 A;  1ULE A;  1O7F A;  4OYU A;  5F5Q A;  2VC9 A;  4K8R B;  3ZO0 B;  4B4Q A;  2OYZ A;  2WLQ A;  3JQX A;  3RMX A;  1W8U A;  3ETP A;  4N90 A;  2RS1 1;  1AR6 1;  2GSY A;  2JIG A;  5B2G B;  3RSJ A;  4IGP A;  4QGM A;  1W90 A;  4LUM A;  3ZXF A;  2PHT A;  4X8P A;  5GLU A;  3TBD A;  4DXT A;  2BVV A;  5DAX A;  4ASK A;  3HAG A;  5LWB A;  3VBU C;  2ZPX A;  5C6C A;  2BGC A;  5F9T A;  1XND A;  3PU3 A;  2ZAA A;  4LUK A;  4RQP A;  1K5M A;  2FBE A;  3V64 A;  1XNK A;  2AYH A;  1XE7 A;  2VQT A;  3KV9 A;  3ME2 A;  4XIL A;  4BQ5 A;  3BPS A;  2R1B A;  3LEK A;  4GH4 C;  4L92 A;  3IIA A;  2OW4 A;  2LRP A;  3M3I A;  2BU9 A;  2K2S A;  3NAP B;  4OFG A;  3T30 A;  3VZN A;  2XOM A;  2O8Q A;  2ZOE B;  3JD7 3;  4YVS C;  5A7N A;  4L2N A;  4YGC A;  4OZX A;  1NCR C;  1X33 A;  2OVU A;  3IZO A;  3BOD A;  4J1X A;  5C8C C;  1SCR A;  3KV5 A;  5A7Q A;  3POW A;  4KWU A;  1PGW 2;  2IXH A;  3ACF A;  1G9D A;  2NYY A;  3ZXL A;  3SMH A;  4RYD A;  3HQU A;  4KG0 A;  4CDX A;  2XUM A;  5JVV A;  3HD8 B;  1G9F A;  1LGC A;  1PMH X;  2JG9 B;  2YC4 A;  3RRD A;  1PVC 3;  1OVP A;  4E4H A;  5C9A B;  1UY0 A;  2D3P A;  3I97 A;  3KV6 A;  1MVQ A;  1YEW A;  2ZZQ A;  4LBQ B;  2ARC A;  4E8D A;  1AR7 3;  3WF2 A;  4ISR A;  4KL1 A;  1YWK A;  3HIF A;  3N9P A;  2E6V A;  2PAK A;  4KU8 A;  3VDD B;  3WLU A;  4Q8K A;  5L9V A;  1V6L A;  5C3Q A;  5K0U C;  2UYA A;  3LF7 A;  4DRV A;  3ZFF A;  4NPM A;  4JGY B;  5FMO S;  4Y3O A;  4L8Q A;  2D6O X;  1JZ4 A;  3ACG A;  4WVZ A;  1PIV 3;  5IVV A;  4N53 A;  5LW9 A;  2SBA A;  4RR3 C;  4Y1Z A;  3NV4 A;  2OT7 A;  4LKD A;  4YVS A;  5FZM A;  5J7M A;  4IE7 A;  4ASM B;  4OQ8 A;  3B9C A;  3IPV B;  2WNE A;  2WII B;  3DCQ A;  2ATF A;  4AED A;  2GMP A;  4GA9 A;  4G9S B;  3UT0 A;  5LK7 B;  4RQP C;  2VNG A;  2GN7 A;  4BDV B;  4QPY A;  3ILR A;  2V72 A;  4COU A;  1G9C A;  1VAV A;  3PUQ A;  5ACA 1;  2ET1 A;  1C57 A;  1RUC 2;  1W9F A;  5EJ3 A;  2VBP A;  2Q8C A;  1YQ2 A;  2VM9 A;  3CKH A;  1UMH A;  1NE6 A;  4NHX A;  4Q4Y 1;  3GZE A;  4PIZ A;  5DMY A;  5JZG C;  3LZZ A;  1DGW A;  2RHP A;  4FP3 A;  1K5M B;  1AR6 2;  4YSF A;  1Z78 A;  5K4L A;  3DYO A;  4RS5 C;  4XXP A;  2PHF A;  5DXD A;  1RUD 1;  4GUL A;  4DMI A;  2YBP A;  2VZ3 A;  1WMX A;  2DCY A;  3MPP G;  2VW0 A;  1SAC A;  4Q4X 3;  4CZS A;  1W0P A;  3ELN A;  5G04 L;  1FMD 3;  2L9L A;  2V5Y A;  2XBO 3;  2YFU A;  1D4V B;  3HBZ A;  4FPC A;  5DDJ 3;  4Q0Q A;  5EQU A;  1G6N A;  4N8M A;  1VMF A;  5C8C A;  2QDR A;  4FI9 A;  4UOJ A;  4FOY A;  4ARY A;  3LSD A;  2VZS A;  2W68 A;  5IAV A;  4UFL A;  1RC6 A;  3BGA A;  5GZD A;  2Z5W A;  4NPR A;  4LO5 B;  4NE9 A;  1WD3 A;  4RHV 2;  3L2Y A;  2D5H A;  3AZW A;  4CUB A;  2VMF A;  3O1T A;  4LOT A;  1OVS A;  1PM4 A;  2ZGP A;  1GAN A;  3U1X A;  2X5I B;  3J7M A;  1CVN A;  1M4W A;  3NNM A;  3IMN A;  1Q3E A;  2XXZ A;  5F3C A;  1JZ2 A;  2WQZ C;  3JBG 1;  3AYE A;  2OQ7 A;  2CY6 A;  5FYC A;  2BEO A;  4J1W A;  1ZZ7 A;  3MID A;  4OHW A;  3OD4 A;  4V2W A;  1SQ4 A;  3ZIX A;  2BNN A;  4DXZ A;  1V6O A;  2WWS A;  1OBN A;  5FPA A;  3VBS B;  1SBF A;  1SLT A;  3V0B B;  3AB0 A;  1FX5 A;  2PAM A;  3FHQ A;  2P2K A;  1AR9 2;  3E6D A;  4HSL A;  1MS4 A;  5A3N A;  2PAE A;  2RV9 A;  3T2O A;  2PMW B;  2CWS A;  2WZR 2;  2YPJ A;  5A1F A;  1EP0 A;  1UOG A;  5J09 A;  3AP9 A;  3FE5 A;  4QHZ A;  3C7G A;  4I2O A;  1ND3 C;  4A7K A;  3ASI A;  4FPK A;  5FCC A;  3KGL A;  1JZ7 A;  1IKP A;  3OPZ A;  1JYW A;  1ENQ A;  4XAC A;  4CCN A;  2VUC A;  3MGU A;  1QJY 3;  3JU9 A;  3IWZ A;  4SBV A;  3HT2 A;  3U75 A;  1XE8 A;  4MGY E;  1XSR A;  5SV8 A;  4HL0 A;  4Q0S A;  1CAW B;  3NWK A;  1AVB A;  1QH7 A;  2D98 A;  3LEM A;  4LKS A;  3UV9 A;  5A6X A;  2SLI A;  1HN1 A;  4DO0 A;  3MIB A;  1VBC 2;  4MXW B;  2JB4 A;  5FWE A;  4DXR A;  5ABJ A;  3WW1 A;  1TG7 A;  2VBD A;  1PGL 2;  3VBF C;  1QH6 A;  3WW3 A;  5IVY A;  2UUR A;  1EAH 3;  2EXH A;  4ORF A;  4QQ2 A;  3SEE A;  5E88 A;  4TWT A;  5D2A A;  2QTW B;  3GBW A;  4PLO A;  5A7O A;  1DZT A;  1Q5O A;  2HYK A;  1V00 A;  1C8N A;  3AZV A;  1J3P A;  3VHN A;  4AAX A;  1HV0 A;  4GKY A;  4P14 A;  1ZVF A;  1W2A X;  2UWA A;  2AAC A;  3ROU A;  1MEC 2;  4LBQ A;  1POQ A;  3RMY A;  1ULD A;  3AVS A;  2JJ6 A;  4M3C A;  3WQ7 A;  4AFC A;  5FO8 B;  1OKO A;  2XJQ A;  1BEV 2;  2NLR A;  4RFT 0;  3Q8B A;  3ZFG C;  2DFB A;  3KHC A;  3CLP A;  3MI8 A;  4CXW A;  2QZ3 A;  2LTN A;  3IN9 A;  1OF3 A;  1IS5 A;  5EYY A;  3GM8 A;  4RA0 A;  3FZ3 A;  3RI8 A;  5EZW A;  1FPN 1;  3WUD A;  3CIH A;  4XIO A;  4Z2A A;  5I91 A;  4K21 A;  1QY4 A;  1AYM 1;  4QKN A;  5C71 A;  1WME A;  2CYF A;  1HQL A;  3OUJ A;  4H7L A;  3JBG 3;  5DAW A;  4M4R A;  3BTY A;  2R1D A;  5BV6 A;  3GZU C;  2IXJ A;  1NZC A;  1RUI 3;  2JDH A;  4DQA A;  4XOG A;  4LMF A;  4LHK A;  4ZKT B;  5APA A;  3O12 A;  2ZX0 A;  4XDQ A;  1RMU 2;  4HBN A;  4QGL A;  1MR5 A;  1O8S A;  2YZ4 A;  2PHD A;  1EY2 A;  1I1E A;  1SEF A;  1N3P A;  2A5Z A;  5JI7 A;  4NRP A;  1R08 3;  5C3R A;  3KD4 A;  4XE9 A;  1UW8 A;  1E5S A;  1BLZ A;  2P34 A;  5GZG A;  1TQ5 A;  4LLO A;  3EQE A;  1A6C A;  2HEY F;  4LBJ A;  3M3E A;  2HWB 1;  5GKA C;  2B46 X;  2VQ0 A;  4I09 A;  5I0D A;  2IFW A;  5FMB A;  4CDW B;  4QQL A;  5FY9 A;  4F3J A;  4QX2 A;  1FMD 1;  4E2S A;  1HQN A;  1OXC A;  1ZRF A;  1SFY A;  3THD A;  2WLP A;  4AF9 A;  1ODN A;  2HEV F;  2VJX A;  1RUF 1;  3GHM A;  5FPZ A;  2ZGL A;  4WV8 A;  1CJD A;  5FK8 A;  1KRI A;  1QGL A;  2R49 A;  2J1U A;  2BGO A;  4OI4 A;  3LA3 A;  2CGN A;  3A21 A;  3C7F A;  1ASJ 1;  2PLV 2;  3HNM A;  2ZKL A;  1XU2 A;  2IFR A;  5E8A A;  2RS3 1;  3ZYG A;  2KM2 A;  1LES A;  1MVE A;  3LDR A;  4Y1V A;  3AM2 A;  4OUE A;  3RZZ A;  1JW6 A;  2JDY A;  4A6O A;  2W1S A;  5GLW A;  5T5P A;  4K40 A;  1MQT B;  4YVW A;  2YC2 A;  1NT0 A;  1Q8V A;  4JGZ B;  4QKD A;  3RQ0 A;  5FPX A;  2ARX A;  5C3O A;  1JYX A;  4LOR A;  2X8K A;  4BQ4 A;  3O7O A;  2XL9 A;  5T55 A;  2ZGM A;  1ZZC A;  1JYV A;  2W08 A;  1WW7 A;  4XJZ A;  5HCH A;  5A1A A;  2YY1 A;  1IG3 A;  1ZRI A;  4YGB A;  4IW3 A;  4UF0 B;  3H7Y A;  4IV1 C;  5DUU A;  4YW1 A;  1CX1 A;  3SH5 A;  4FVV A;  1RUJ 2;  3WP6 A;  5A7W B;  2D6K A;  1TE1 B;  2ZGR A;  1MS1 A;  5IW0 A;  3ZLI A;  5JDB A;  2QQK A;  2R16 A;  1W06 A;  2VZQ A;  4XFG A;  2CAV A;  2BRT A;  2VXJ A;  5LCW L;  4TLG A;  1QMJ A;  1PZ7 A;  3FLR A;  4IGO A;  1QDO A;  1KGY A;  1YQ5 A;  2YFZ A;  1V9U 2;  1PVC 1;  4DOU A;  4CXX A;  1DYO A;  1QIQ A;  4XBQ A;  3POJ A;  1COV 3;  1O91 A;  1RUI 1;  4NVP A;  3RZM A;  1E5R A;  2R0F A;  3H50 A;  5FLI A;  1VE0 A;  3M8L A;  4XF9 A;  4IV1 B;  4AVB A;  1W0N A;  1OPO A;  5LAS A;  1BBT 3;  4XET A;  4A42 A;  2ETE A;  5FZG A;  3I3E A;  2V4V A;  1LHU A;  1W8W A;  5FPV A;  1GWK A;  2EID A;  1XB9 A;  3KWV A;  1R1A 3;  4BA6 A;  3DEM A;  3ZYF A;  2TNF A;  4E2Q A;  1CGP A;  3DXU A;  1XC6 A;  5J98 B;  1PMI A;  5JSR A;  2IUW A;  5HXV A;  2Q8O A;  4XQ4 A;  1OUX A;  1Z7S 1;  1W99 A;  4QPG B;  2RR1 1;  3WNL A;  4A41 A;  5FMD A;  4ZZ5 A;  5KHK A;  1UZW A;  1S0B A;  1PO2 1;  2LUW A;  3WV6 A;  4CDQ A;  3O1U A;  4QMA A;  5FZE A;  4PI0 A;  4CP9 A;  2ZGT A;  3A22 A;  2WBK A;  1HV1 A;  1H8V A;  4QQH A;  4C90 A;  3NJV A;  1LHV A;  3J9S A;  1EPZ A;  1DP0 A;  4KBZ A;  4WM7 C;  4XF4 A;  5T5L A;  5KXB A;  5C8W A;  4HN0 A;  2K46 A;  1FNZ A;  1QKQ A;  4IEU A;  5FZ9 A;  1RUG 3;  5JMC A;  4UAP A;  4XMA A;  2D6N A;  1XNB A;  2R04 1;  3FLP A;  4YZ2 A;  1DDL A;  3UNP A;  3APB A;  5IUQ A;  2GC3 A;  2ZZJ A;  2IVI B;  3SHR A;  2O8O A; 
#chains in the Genus database with same CATH homology
 5IVC A;  4QU1 A;  3AVR A;  3PTR B;  4BU2 A;  5FYH A;  5A7W A;  3KVA A;  2XXZ A;  5F3C A;  5FYC A;  2OQ7 A;  4QXB A;  4V2W A;  4IGP A;  4GD4 A;  5FP4 A;  5FZF A;  4GJZ A;  5FPA A;  5FZH A;  5LY2 A;  4ASK A;  2YBS A;  5FYZ A;  4QXH A;  5LWB A;  5FY1 A;  3PU3 A;  5FZO A;  5F5C A;  5F3G A;  2OS2 A;  5FY5 A;  5A7S A;  5A3N A;  2W2I A;  3KV9 A;  5FYY A;  3U4S A;  5A1F A;  5FY4 A;  3NJY A;  4D6Q A;  5FP3 A;  3AL5 A;  5FP7 A;  5A7N A;  2YU2 A;  3PUR A;  3KV5 A;  5F2W A;  5A7Q A;  4CCN A;  5FP9 A;  5F3E A;  2Q8D A;  3DXT A;  5FXV A;  5IVB A;  4AI9 A;  3K2O A;  5LY1 A;  2P5B A;  4UF0 B;  5F37 A;  5FZB A;  5A7W B;  4CCL A;  5IW0 A;  3ZLI A;  3LDB A;  3OPT A;  5FZK A;  5A3T A;  5F32 A;  5ANQ A;  5FWJ A;  4E4H A;  5FZ6 A;  4Y4R A;  5FYM A;  3KV6 A;  4DO0 A;  5FUN A;  5FXW A;  4CCO A;  5A1L A;  3K3N A;  5FWE A;  4D6S A;  4IGO A;  5FV3 A;  4HON A;  5FBJ A;  3N9P A;  3LD8 A;  5KR7 A;  4CSW A;  5A3W A;  5FY0 A;  5IVY A;  5FZ3 A;  4UF0 A;  5A7P A;  2VD7 A;  2OQ6 A;  5A7O A;  5FPU A;  5FZ4 A;  2Q8E A;  4LXL A;  4Y3O A;  5FPB A;  5FXX A;  4HOO A;  4XDP A;  2GP3 A;  4CUG A;  5IVV A;  2GP5 A;  5F39 A;  5FYB A;  5LW9 A;  5FZM A;  2OT7 A;  2YU1 A;  4EZH A;  3AVS A;  5FZC A;  2WWJ A;  3PUS A;  5IVF A;  5FZG A;  4NUB A;  5A80 A;  4EZ4 A;  3N9N A;  4D6R A;  2XDV A;  4URA A;  5FZL A;  4EYU A;  4CCM A;  3N9O A;  5FPV A;  3N9Q A;  4GAZ A;  5IWF A;  3PUQ A;  5F2S A;  5FPL A;  5FY7 A;  3PDQ A;  5FZ0 A;  2Q8C A;  3DXU A;  4Y33 A;  4XDO A;  5FJK A;  4TN7 A;  3KVB A;  5A3P A;  3PUA A;  1VRB A;  4V2V A;  5FYS A;  5FYV A;  5FYT A;  4LIV A;  2YBK A;  5FZ7 A;  5K4L A;  4C8D A;  4GJY A;  4CCJ A;  4AAP A;  2XUE A;  2PXJ A;  2YBP A;  3KV4 A;  2WWU A;  4BXF A;  3K3O A;  5FZA A;  5ISL A;  4QX8 A;  5F5A A;  4CCK A;  5FP8 A;  5FZE A;  4DIQ A;  4LIT A;  5FYI A;  4QWN A;  4QX7 A;  5IVE A;  3RVH A;  5IVJ A;  5FZD A;  3UYJ A;  2XML A;  3ZPO A;  3N9L A;  5FXZ A;  5FZI A;  5F5I A;  3OPW A;  5FY8 A;  3N9M A;  5E6H A;  5FZ8 A;  2YPD A;  5FZ9 A;  5CEH A;  5F3I A;  3AL6 A;  3PU8 A;  4IGQ A;  4BIS A;  4QXC A;  5FJH A;  5FUP A;  5FZ1 A;  5FYU A;  2OX0 A;  3U78 A;  4LIU A;  5FZO B;  5FY9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...