2YBSA

Jmjd2a complexed with s-2-hydroxyglutarate and histone h3k36me3 peptide (30-41)
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
348
structure length
348
Chain Sequence
LNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LYSINE-SPECIFIC DEMETHYLASE 4A
publication title The oncometabolite 2-hydroxyglutarate inhibits histone lysine demethylases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/peptide
total genus 103
structure length 348
sequence length 348
chains with identical sequence B
ec nomenclature ec 1.14.11.-:
pdb deposition date 2011-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 2ybsA01
2YBKA 3KVBA 4HOOA 3NJYA 2XMLA 5FYBA 5FZ4A 5K4LA 5FWJA 5FY0A 5FYHA 5FBJA 3K3OA 5A3PA 4QXCA 5IVBA 2OT7A 4XDPA 4GAZA 5F5IA 3N9OA 4CCMA 3PU3A 2OQ6A 5FZOB 5F5CA 3KVAA 4DO0A 5A3NA 4AI9A 2YBSA 5FZ9A 5FZOA 5A7QA 5F3CA 4UF0B 5A7NA 2P5BA 2YU2A 5FZ8A 2YBPA 3ZPOA 4QXHA 3N9NA 2OX0A 4LITA 4IGPA 4Y3OA 4QXBA 3N9PA 2OS2A 3DXUA 2WWJA 5F39A 5A7WA 5IVCA 4CCLA 3KV5A 4Y4RA 5A3WA 4CUGA 3KV9A 3K2OA 4QX8A 3N9LA 5FPVA 5FZ6A 5FUNA 5IVVA 3PTRB 3KV6A 3AVSA 4D6SA 2Q8EA 3PU8A 3ZLIA 5FP7A 5IVEA 4DIQA 3LD8A 3PUQA 4HONA 3DXTA 5FZKA 4CCOA 3AVRA 2XDVA 5FZ3A 4D6QA 5FYUA 5FZMA 5FYMA 3LDBA 3U4SA 2YPDA 2W2IA 1VRBA 5FY9A 5A7SA 5FJHA 3N9MA 5FYIA 5FP3A 5FYZA 4GD4A 5FPLA 5IVYA 4E4HA 4BU2A 4EZ4A 5F37A 4UF0A 4Y33A 5A7OA 4D6RA 5IW0A 4EYUA 4CCNA 3PURA 4GJYA 2VD7A 4LIVA 5A7PA 4QU1A 5FZHA 5F3GA 4LIUA 5FXWA 5A80A 3OPWA 4CCKA 2XUEA 2OQ7A 4V2WA 4CCJA 5FZDA 4EZHA 5IVJA 5IWFA 5FZGA 5FPBA 5A3TA 5FYSA 5LWBA 5F2SA 3PUAA 4NUBA 5FZLA 4IGQA 5FZ7A 5FXVA 3AL6A 5FUPA 3KV4A 4QWNA 4TN7A 3K3NA 3OPTA 5FV3A 4IGOA 5FXZA 5FY1A 4ASKA 5LY1A 4CSWA 4BISA 3PDQA 5FYYA 3N9QA 5A1LA 3PUSA 3U78A 4URAA 5FY4A 5FJKA 5FPUA 5CEHA 5KR7A 5FXXA 4V2VA 5FZIA 5FZFA 4QX7A 5F3IA 5FY7A 5A1FA 5FYTA 2Q8CA 5F2WA 2YU1A 3RVHA 5FP9A 2GP5A 2WWUA 5FWEA 5ANQA 3UYJA 4BXFA 4LXLA 5FPAA 2GP3A 2Q8DA 4AAPA 5ISLA 5FZBA 5FP4A 5LY2A 5FZ1A 2XXZA 5IVFA 5F32A 5A7WB 4GJZA 5FYCA 2PXJA 5FZEA 3AL5A 5FZCA 4C8DA 5F3EA 5FZAA 5E6HA 5FY8A 4XDOA 5FYVA 5LW9A 5F5AA 5FY5A 5FP8A 5FZ0A
chains in the Genus database with same CATH superfamily
3IAQA 1P8JA 3MUY1 1EPZA 5FZ4A 4AK3A 2BVBA 1AJKA 4JKMA 3UGGA 4QT6A 3NV4A 1OLME 4YNIA 4F3JA 1G9CA 2WAOA 4F83A 3TBDA 2VTXJ 3B94A 5FZOB 2VMCA 4PI2A 3WEZA 4YARA 5KHKA 1RJ8A 3ZSEA 1LHVA 1RUE3 1UOFA 4HKWA 1AL23 2W0XA 4LKDA 5GLUA 3T0BA 4LEJA 5KXBA 2HWF2 4FPOB 2D6OX 2XKPA 1G9BA 1RL3A 2XHNA 1GQGA 3EO6A 3MF9A 2GNDA 4YVSC 3WW3A 4Q4X1 2Q1MA 1R082 4XJ9A 4LKEA 1W8UA 3M3OA 1VBB3 4LKFA 3KQ4B 2P3IA 3O0WA 1LR5A 2ZAAA 2H0VA 3AMPA 4AHXA 1WUVA 4JTOA 2ZEWA 3ILNA 3T08A 1U5XA 1NOVA 4L8QA 5J3UA 4TXWA 1PO11 3H7YA 3AKQA 3RNSA 3H1MA 3THPA 1V6MA 5FJHA 2Y6LA 3J26N 4M0HA 4RHV1 3SITA 4DINB 4E4HA 5JIUA 1D2SA 4IEUA 2VVEA 5CZKA 1W2NA 2Z42A 4A45A 1UMZA 2D6KA 2V4VA 2W5FA 4N43C 4MGYE 4PBPA 1LECA 4AOCA 4DFSA 3ZN4A 3MIDA 1WCQA 2K2SA 4AQTA 1DP0A 3WDXA 1IOAA 5EJ3A 4IE0A 4FT8A 4EZHA 2D97A 1R64A 3ZSMA 1KFUL 1N1VA 3LFIA 5IWFA 3VD9A 3VKLA 2BP6A 2RS31 3VD4A 1US3A 3KQRA 5EJZB 4QWNA 3I2JA 4IGOA 2D3RA 3IIAA 5J48A 2FMYA 1ZBA1 1DQ6A 1DQ1A 1XBFA 2CWMA 2JIJA 4OLLA 3OGRA 1MZ5A 4HT1T 1EYBA 3A7QA 5AVPA 1S55A 2WNUB 3E5UA 3E6DA 1GP6A 4LLOA 4Y24A 1UO9A 1NCQB 1FV2A 4UI9L 1ENXA 3AKTA 1W06A 2XJPA 2YY1A 3OY8B 2IXCA 1V9U2 1UZWA 3IKWA 3OD4A 1QQP3 1O3TA 5GLTA 4COVA 4DUXA 3TN92 4XJAA 2QQVA 3OTFA 5LA2A 2D6MA 2DF7A 2KR2A 2RM23 1W0OA 4YG6A 1XNTA 3VHOA 4NRQA 1PK6C 4EWAA 2GSYA 3WDWA 3SKJE 1VAMA 1SFNA 4AGRA 3APBA 3IBMA 4H2AA 5FZEA 4JTNA 1S0IA 3W58A 2AENA 3FHQA 2HWE3 4J25A 4NHXA 1SDWA 2QUOA 4MHRA 1DGLA 1VBD3 2VULA 4K3UA 4QX1A 4BK4A 2E6VA 2AEZA 1QJY3 1JMUB 1D4M3 2P37A 4C0HA 2GH8A 3WDUA 1ENRA 1IQDC 4P08A 5FP8A 2DDUA 2HWC1 1DCSA 3OYWB 2WNUA 1VMFA 2LROA 1W8FA 2FCTA 1NCQA 1HV0A 2UU8A 3WG3A 1ULDA 3H1YA 2V72A 2SLIA 2OT7A 2A75A 2ZEZA 3E5XA 2GH2A 1F31A 1ALYA 2NMNA 3OY8A 4CCMA 4E8CA 3PVNA 1FX5A 1Z7S2 3UNPA 4Q4W3 2NP0A 3BN6A 2QQMA 3HWJA 5LB6A 3ZYJB 1SMVA 4AAXA 3UKNA 2KM2A 1PGW1 3BB6A 5B4XA 4CEYB 3RGBA 1QEXA 2OUJA 1WMFA 1MQTB 4J6GA 2QQLA 4Q29A 4QXHA 2XJQA 2ZKNA 1R1A3 3VL8A 4EN8B 2ZGMA 1ST8A 4ATFA 2E63A 2QDNA 2CAVA 2WS92 3T3YA 2JDZA 3D0SA 3WF2A 2BGOA 4IESA 1HRV2 3PTRB 3USSA 1VIWB 2Q8EA 4JX0A 4HKLA 3T2TA 3AP5A 3AYEA 4IE4A 4ORFA 5D8AC 3WG1A 2VMEA 4YZ2A 3O1RA 1RUC2 3OYWA 2XJUA 2MEV2 3LGRA 3M70A 2B4KA 1OOPB 4GMP3 4Q8LA 4RN5A 4WM7A 2BBVA 3HBKA 2BNNA 1EV13 5J09A 5J7MA 2WZPP 4DQAA 1T6BX 4WBBA 1PMJX 3N9MA 4W8JA 3GDBA 4RFT0 3ZR5A 4CDXB 4K8FA 2CWSA 3ECQA 3ILRA 2ZGOA 3I3MA 1X82A 3VDDC 2W95A 1GNHA 2XONA 3VZLA 2WQZC 5GZFA 2WO7A 5I8SA 3L9JT 1CJDA 2W87A 4Q4Y2 2JD4A 1PZ8A 1OA2A 2JXAA 1UMHA 1QNWA 2OW4A 2W47A 3BYWA 1HB4A 4QQPA 4QX3A 4WZFA 4B8EA 5JXGA 1RUD2 4AXOA 3D5OA 3IDAA 3LEGA 4U2AA 1W6QB 5IAXA 3BOPA 1S0JA 5LEJA 3KV4A 4ET7A 2P6HA 3HVDA 1WD4A 5C8CC 1F8VA 1JS9A 2BBAA 4CDUB 1OOPA 4H14A 1TME2 2QJVA 4DY3A 1WLTA 1VRH3 4HPKB 4BOWA 4I3PA 1AYN2 4IV3C 3I8TA 1RJ7A 2R063 4CDXA 1FMD2 1REEA 5DAVA 2VQ0A 4UT5A 4A3ZA 4UFLA 4CU8A 3RMXA 1HXS2 2EF6A 2H6CA 4LK7A 2XBO3 4QX5A 3I49A 3RG0A 3FJSA 5CIRA 3IPVA 3PIGA 2PLV2 1C4RA 1YC61 4PQQA 1JXNA 3KCYA 4BB3A 4DEQA 3AXEA 3M3IA 4OI2A 4XTMA 5C3OA 4UW3A 5GZGA 2DYCA 4UYBA 4Y5SA 1D4VB 3G7DA 2D43A 1JYCA 2ZS6B 1L7LA 2JICA 4AAPA 3THTA 1H4GA 1W6QA 2VQAA 1A6CA 1UU5A 4HVRA 4YM0A 1PVC1 4BH9A 5EV7A 1YFXA 4GJZA 1RUH1 4YM2A 1N1SA 1MS8A 1QJU3 1RUJ2 1UZZA 2VNVA 3K4DA 3BODA 4CDUA 3UKVA 2VMHA 3B69A 2VUDA 2VVFA 3CJXA 4PIZA 4NIAA 3W9AA 3WD5A 1K5JA 1SLBA 4HPKA 1Q56A 1VALA 5A70A 1JW6A 4HOOA 3VHPA 4YM3A 3S5AA 4F8AA 2VBDA 2X09A 2YFUA 2UY8A 3IM0A 4COWA 1XYPA 5DG1A 1HRI2 4NRPA 5FZ9A 1QXJA 5IK7A 5LA0A 3AFKA 2OKXA 1WLWA 1NQDA 3VV1A 1XQNA 1QY4A 1H4HA 1H1IA 4MGTA 3LCPA 2D3PA 3N9PA 4AFAA 5H9RA 2WZR1 5A33A 5IVCA 1DDLA 1LOAA 4QX8A 2V4AA 1UKRA 4LBJA 2FZ1A 2VZQA 2XG3A 1J59A 5HPOA 5LBFA 1F4AA 2C1FA 1YFUA 5DDJ3 3VKMA 2VC9A 3PUQA 5G04L 4OQ8A 5FZKA 1APNA 1UN1A 1K42A 1AR81 5KHIA 1WCKA 2ZGLA 1QDOA 1WW5A 2XDVA 1DQ5A 5FZ3A 1QOOA 4D6QA 4RS5C 3U4SA 1W99A 3WR0A 1COV1 1LJ7A 5JXJA 5C3QA 4GH4C 5DMYA 2GC2A 1ULOA 5LASA 3WP5A 5A1AA 1GNYA 5A7OA 3T2PA 5FK8A 3CDZB 1J83A 3ETQA 3IT8A 4MXVA 3ZDSA 3NNLA 4H7MA 3MW3A 2PMWB 4UOJA 1AR63 4YLZA 5FLJA 1FPN1 4LNVA 4MGIE 1GWMA 4UFJA 4ZZ8A 3JU9A 4XXAA 3GJBA 3ST7A 3C2UA 3UJQA 1ASJ2 3H50A 1SFYA 2CDPA 2BQPA 2GC3A 1NZIA 3OGVA 4NAOA 1CZSA 3ACIA 4H3WA 4FFGA 1RGSA 1YEWA 4I0AA 4NUBA 5ERLA 1HLCA 1YQ8A 2RR11 4KU7A 3POYA 2G9FA 4UFKA 4HLTA 5T54A 2X29A 4D0QA 5A6YA 1S2EA 1UAIA 2WWSA 2OZJA 2WA3A 2ZBJA 4GKXA 5K8SA 3J7NA 2GMMA 4RGKA 3THCA 1Y3TA 1KS5A 2ES3A 4IEYA 3FUOA 3ORJA 4DMIA 4HL0A 5I93A 1G8WA 2W92A 1VBA1 4IEPA 2VW1A 1D7PM 4JQRA 1W9WA 1PIV1 2J1UA 1FYUA 1BJQA 3BOWA 4WVMB 5AFEA 1IHMA 3MYXA 2VH9A 3WW1A 5IUQA 3BI3A 4BQ1A 1LRHA 1IG3A 5D21A 2YPJA 3RVHA 1MR5A 1YO8A 5ANQA 2FDFA 1PNGA 4GIQA 3MF6A 4HETA 1KFXL 3C3VA 2A3XA 4YGBA 3WDTA 1JYIA 2QQNA 3NAPC 5ISLA 1RUF3 2ET1A 4D7TA 1OHFA 1UF2C 2K0GA 5E89A 1SG3A 4COZA 4AI1A 4OI0A 4M4RA 3MZHA 3AL5A 2HEYF 2ZGQA 3SH3A 1UY3A 4ASMB 2YXSA 2WL1A 3EJKA 4OCTA 4YRDA 2GMPA 2HBTA 4BK5A 2JE8A 2WUHA 5FYVA 2JG9B 4Z92B 1GP4A 1SACA 2QE3A 5FFOC 2PN5A 3MPPG 3ZXEA 2O1QA 1GANA 3HIFA 4Q0UA 3LF7A 4BDVB 5J98B 2QQPA 4CP2A 3Q8EA 1IGOA 1QF3A 4WVMA 4L99A 2RDSA 1W8ZA 2WIIB 4QDSA 4Q8KA 2VZ1A 1EAH2 3NSTA 4QB2A 1PO12 3AJYA 2A6YA 4IEVA 3OBZA 1R1ZA 2AC1A 3POWA 3MIHA 3CBNA 4XF1A 5A7QA 4RHV2 1FNZA 2VMIA 1TMF2 2VZUA 3GCXA 2R043 4Y26A 2YBPA 3ZPOA 2A6XA 4OUMA 2H0BA 1GZWA 1C8M2 1W0NA 4CRQA 1K5MB 3PUHA 2XVKA 3A22A 2YYOA 5JXIA 3WINE 3KV9A 4Q0PA 4QD2A 1DLCA 1CAVB 1NZCA 1OH4A 3BUCA 2OPKA 1O8SA 1D2QA 1JH5A 3HNMA 3ZN5A 5I0TA 1V9U1 1ULFA 3EHKA 4EQVA 4NMIA 3N4MA 4AQ2A 2LRPA 2JB4A 3TN91 1ZRIA 2NN8A 2SBAA 2ZX1A 1OLQA 1AXZA 1ZBA2 4YW5A 2J1RA 4HG6B 5FYIA 4LUMA 4NIDA 1V00A 2G1MA 2YROA 2LUWA 4LBOA 3I2GA 5J36A 5JOXA 4YGCA 1UD1A 1GQHA 4DS0A 1SBEA 1NA1B 2HWD3 4QKDA 5A32B 4XFHA 3JBG2 4KWUA 2X53S 1J3RA 1W9TA 1RUG2 1YUDA 3SKVA 3O1VA 3OGGA 4JV4A 3WY6A 5GZCA 3H8UA 2IXIA 5BNOB 3OPWA 4QHOA 4MH0E 3ZKYA 3U0ZA 2WLPA 2VMDA 1CAVA 4BLJA 4FP3A 4P9LA 1LAJA 4FFFA 2OUHA 4R9DA 3JD72 1VR3A 3N35A 2DTWA 2VNOA 4JAAA 3B9IA 1Z7S1 3AMHA 3VHNA 3ZYRA 2DWRA 2CSGA 1G6NA 3NVCA 1ZBE1 2NM1A 2WNUC 4FAGA 5HCHA 2BZDA 1NCQC 3N9QA 3WP4A 4CU7A 3U78A 3M7AA 2AACA 3LZZA 3SHRA 3ENRA 4CP9B 3M2MA 3O1PA 1GBGA 2QQKA 4QPIB 4XFAA 4Y1UA 4AWDA 1U0AA 2HWC2 2A1XA 4QQLA 5A32A 3VBSB 3CQOA 5FZFA 1YJLA 2YGLA 1CR7A 3ZFFB 1UL9A 1S0FA 1HDKA 4E9KA 1S0GA 3BPZA 5BNOA 1V6JA 1IZ3A 5KBFA 4RYDA 4LO7A 3V0BB 2A6WA 3CZUA 1VMHA 1S4CA 1UOBA 2Q8DA 4LHSA 4B29A 5FZ1A 3WHTA 2OYZA 3SLIA 2RJKA 4CP1A 3C7OA 4E8DA 1FNYA 1PZ9A 1RYYA 2HYKA 2W91A 2YMZA 4DRRA 2JG8B 3ZXDA 1YQ6A 2XKOA 5FY8A 3H42B 1W8TA 3ELNA 4XDOA 4FFIA 4XVHA 3RJ2X 1JYVA 5FKBA 2ORZA 4XXPA 3JQWA 3WUCA 2W1SA 3GBWA 1KXGA 3D6EA 4V1PA 1DLLA 1YNAA 4CP9A 4QPIA 5FY0A 3HPNA 5FKCA 4XUOA 5BNPB 4QDQA 4FPKA 3VBSA 5LCWL 1LHOA 5F5IA 1LKNA 4B1LA 1F9KA 2WZR3 3PU3A 4QAWA 4CEYC 4CXWA 1MQTC 1RUD1 5F8PA 1PX4A 3RYKA 3LQCA 3SCHA 4QPGA 3DL3A 1SBDA 1A34A 1W0PA 3GBGA 3UGHA 1E5IA 1GOFA 2YU2A 5DXDA 3GALA 3N7JA 1GZCA 1VB2A 1AYM3 1XE0A 3Q8BA 2R6QA 1TME1 3LIGA 1AR83 2OS2A 4C90A 4IEZA 4ZXKA 5JR2A 3NV3A 3WG4A 5C5TA 1FMD1 3RYRA 1COV3 1SEFA 3W21A 5IVVA 5FREA 1XNAA 1HXS1 4Y5Z0 3ZLIA 2QTWB 4YW1A 5T5LA 1W6MB 3KD4A 3WW2A 1JZ2A 1YHFA 2RVAA 2PLV1 1GZTA 4QPWA 4HSLA 4YZ1A 4CDXC 2YZ4A 3WVJA 1NKGA 5BNPA 1C3HA 5C9AB 4OMDA 5D1IA 2WFF1 1BHGA 1JU4A 3ATGA 1XNCA 3IN9A 4BQ4A 4XC9A 3AX4A 4D6RA 1UW8A 4NAMA 3WP6A 4EYUA 3NJZA 4DXZA 1RUJ1 1VAVA 4PF1A 2GC0A 3AZWA 4Z82A 1IPSA 4YW7A 4FPEA 4CCKA 2XUEA 2MPFA 3NJVA 1HB1A 3FBMA 3FX3A 3LE0A 3P3PA 5FMBA 2BGCA 2HBUA 3MLKA 1W6MA 2BOJA 4XETA 4CDUC 2HWF3 2KD7A 2VW2A 1G9AA 3OJBA 4F7ZA 3SH4A 3WZ1A 3BU0A 1BK1A 3O0VA 3VBUB 1PMHX 4RGGA 1OA4A 3FLPA 1GU3A 1AX2A 1PVC2 1XNBA 4OHXA 1WBLA 3A4UA 1R083 1RUH2 2V5DA 4N53B 4BISA 1WCDJ 5C9AA 3MFCA 5HCFA 1UU4A 1QIQA 1H8TB 4OI1A 2LALA 2ADEA 3KB5A 2PHLA 3MFAA 2IFRA 3OPZA 4Q4V1 3O1UA 3CZJA 1HQLA 2JDKA 5IATA 3RZZA 1FT9A 1DF0A 2JECA 2OVUA 1Q3EA 2ZGTA 2CDOA 1OD5A 1AR71 1URXA 5FY7A 1HJGA 4P00B 2UYBA 1NAEA 2GP5A 4OVEA 3SEPA 4DRVA 1IPKA 1YQ5A 1J84A 3AP4A 1KDMA 4BXFA 4KNCA 1CPMA 4YGEA 5I0UA 1T6GC 5CAZA 4AHWA 1O3QA 1KRIA 2E7AA 4TTGA 3EMRA 3NQHA 5JOWA 5GJ6A 3VBUA 4DZGA 3RRDA 1LB2A 1YQ2A 3NV2A 1JZ8A 3DYPA 3FMGA 4GB33 5AFBA 2WFPA 4NE9A 3KHCA 1H8TA 2ENRA 2Y64A 1OA3A 4PT6A 4R9CA 4XUQA 4M01A 4OHZA 4K6BA 2O8QA 1FAYA 3ZPYA 1QJZA 3ZXJA 5K4LA 3KF5A 3WNLA 2BEOA 2R16A 4XE9A 1HX6A 3LEKA 2CY6A 2CYFA 1ASJ1 2JDAA 3H0OA 3H3LA 3R4DB 4QB1A 3VBHA 3AYDA 4P5YA 3ZXAC 1Q8VA 5K9YA 4FXKB 3BPSA 3AK0A 5F5CA 3B9CA 3DEMA 1OLRA 3AMMA 2RS13 1TE1B 2RG4A 1OBNA 4FPLA 4XURA 5T5OA 1DG6A 3RPQA 3QOPA 1BBT3 3BTAA 1N3PA 4H55A 1CZVA 4JGYB 1JI6A 1VAKA 4LA3A 2YC2A 1SLAA 1REFA 2WWJA 2CU5A 2VUJA 4PIYA 4QM9A 2WBKA 3BU7A 3HN1A 4MHUA 1QJEA 1KITA 2JDNA 3SC7X 1F2NA 4A6OA 4CEWB 1MVQA 4YSFA 1UY0A 1YFWA 5I8TA 3RYPA 3IDCB 2EIGA 3NJXA 4G3YC 4CCOA 1ULCA 2RR12 1SQ4A 3WV6A 1NE4A 4HN0A 2ZX0A 4FFHA 4Q27A 2A5ZA 2Q30A 5TSWA 2ZTNA 4PCRA 3WW4A 4BJ0A 5JMOA 1JZ3A 5ACA2 4GD4A 5BUVA 3TEYA 1ZZCA 5A3OA 5DAQA 1VBA2 2XOMA 4HK9A 1G86A 4AYUA 5FO7B 4GJYA 2QDRA 2VU9A 1PIV2 3LWCA 4XCAA 5A7PA 3RS6A 4JGYA 2ARBA 2BV4A 1Z7S3 4LT5A 5F3GA 3OUHA 1H1MA 2WZEA 4PF5A 4AEKA 3VHRA 1NT0A 1NYWA 3A0NA 4FCAA 4PDWB 3WNKA 1AXYA 5A3TA 4LO5B 5LWBA 1F4HA 1STMA 1A8DA 1WWYA 4CEWA 1KD7A 4FAHA 1X50A 3DPRA 2LS6A 1CIWA 2PHUA 3AL6A 5A6QA 1EAH1 2C4XA 5DQ0A 2WS93 3B3QE 2WAAA 4CYDA 5LK5A 3U37A 5FO9B 2AYHA 1HRV3 1CPNA 3H3UA 3HOBA 5F6LB 3ZDVA 1TMF1 3POIA 4URAA 5F9TA 4O7XA 1POV0 3T4VA 1NXMA 2WT1A 4Y20B 5CKMA 2D6NA 3V64A 2G19A 4A7ZA 1RUC3 5HV4A 2QBXA 1C8M1 2ZGKA 2MEV3 1BQPA 3LA7A 5A6ZA 4KG0A 4Y1VA 1OMIA 4LE3A 2RDQA 3KCCA 3KM5A 2F4PA 2JDHA 5JPNB 3HJRA 4N9IA 1H9PA 3VBOB 4K20A 4ZS2A 1IS3A 4PDWA 4QHZA 1XRUA 2BJSA 4OUSA 2GP3A 5D2AA 4LE4A 3RDIA 2FDKA 1DQ2A 2JE7A 3OBRA 4QGNA 4BM8A 3ZXGA 4L2NA 3ZFEB 2JG9C 4HK8A 2XJSA 4Q4Y3 3VD7A 3VUOA 4C8DA 1C8NA 3BVCA 1O4YA 3MIFA 4J1WA 4JC1A 1PZ7A 1W9YA 4B1MA 1OD3A 1V6LA 1YLLA 1UX6A 4P9GA 3GHMA 2ZEXA 3HNBM 3JBG1 4INDA 1R092 4GWJA 4Y20A 2BPA2 4IUGA 1RUG1 2FD8A 2XB6C 1F5FA 5FPZA 4P9WA 3PJQA 2P3KA 2QQWA 4ZXEA 2CL2A 1UMIA 4NHLA 5L7OB 5IYYA 3TEZA 1OVPA 2W1UA 4QX2A 2J1TA 1AYN3 2VNRA 2O14A 4TLFA 4ZKTB 5IHRA 3NW4A 1POQA 4QDRA 1O8PA 4JDOA 3VBOA 2CGPA 3JD71 1GNZA 2VL4A 2XPJA 4MYEA 1K5MC 1LULA 3R6SA 5I8YA 5FZ8A 3FFZA 2R071 1S0EA 3TRSB 2PLV3 5E1RA 5AVAA 3OG2A 4EN6B 1L7RA 1MS0A 2Y33A 4ZU7A 3ZFEA 1JODA 4GQ7A 5SV5A 3FWEA 1AUYA 3K2OA 3OGJA 4HBNA 4XMIA 4YZ3A 3R05A 4BQ2A 1IS4A 1VBE2 2CV6A 4R8HA 1OF4A 1UPSA 4M3CA 2B9VA 3WNMA 1ZRRA 3NL1A 1RXGA 4AVCA 4Q1RA 1NY72 4WM7B 4AQ6A 1RC6A 1RUJ3 4YW4A 4A7KA 5A6XA 1VMJA 5L7OA 1AVBA 1UX7A 3OF1A 4Q2FA 2J1SA 4UW5A 1CN1A 2RS52 2YPDA 1NA1C 5LZ6A 5EWSA 1ZBE2 5FY9A 2B8MA 3PMSA 1QDCA 1OPOA 2Y6KA 5A7SA 4A44A 1VBC2 5FP3A 3HR9A 2NPIA 3ZFGA 2RMU2 5F37A 1UYZA 3VGIA 1JYWA 1RVF2 5BNOC 4UBGA 2O8OA 1SLLA 2VD7A 5FY5A 2ZACA 2YUEA 3DECA 2QFEA 3HQRA 3NMBA 4GWNA 1RUE2 4MGSA 3BKZA 3WF4A 2DBNA 4D69A 2VVDA 4LR4A 1HRI3 3FHIB 5T3NA 2WQ4A 1POV1 4V2WA 2BFUL 1SCSA 2JE9A 4L0PA 4MO3M 1S0BA 2X5IB 3KCXA 5DUXA 3B00A 4K21A 4GALA 1LODA 4FSJA 5FUPA 3OCPA 5G05L 1OC1A 3FLRA 1GWKA 2UY9A 2VZTA 2OIIA 1HV1A 2ZX3A 1HN1A 1XPWA 2VOXA 3ASIA 4QPIC 1W8WA 3I2FA 4W6WA 3WG2A 1DYPA 3WP3A 1RIRA 4YPJA 3BTZA 3VBSC 2FDIA 4HFSA 4YZ5A 2D93A 2J7MA 1ZA4A 3VBRB 2BYVE 3ZFFC 1H6YA 2B9UA 4YFZA 2R7EB 1QNYA 3IPVB 5H9QA 4DUWA 2Q1FA 2W39A 4W6YA 1IQAA 1QGLA 4QX7A 3TEXA 4XW3A 5KHJA 5LEKA 3OEAA 4KWJA 2Y34A 4CUAA 2CHHA 1XSQA 2ADDA 2Y6HA 1TQ5A 4ARYA 2VO5A 3AZYA 3RWNA 1OFSA 2JG8C 2X5IA 1JHJA 4SBVA 2JD9A 5FZBA 4AI0A 1Y4WA 3CO2A 4XABA 1Y7BA 5A7WB 3ETPA 4BLIA 3RZHA 4LHLA 1SCRA 2Q5TA 2ILMA 1J1LA 2JX9A 2ZGRA 3EBRA 2XLAA 3AP7A 4LBKA 3E5QA 1VJ2A 5GALA 5BNPC 2ZZQA 3O1SA 1ULGA 1Q8OA 1UPIA 1XSRA 3J7MA 1PNFA 2NLRA 3I7DA 3VBRA 5K7PA 1RXFA 2X10A 4I2OA 4TLGA 1WW6A 5FBJA 2P6CA 2VQTA 3ILFA 3K3OA 3QH7A 3M4FA 4CDWA 5A3PA 2X05A 4EV0A 2ARXA 1IKQA 2CGOA 4LHKA 3WF1A 2GNTA 1RUOA 4JCKA 1WLCA 1X8MA 1HW5A 1RMU1 2WLQA 5A3NA 2WFF2 2YG0A 2WDBA 4C1WA 3VDBA 1QQP2 2ZX4A 3U1XA 2Z4FA 4QQHA 3I3QA 2ZHLA 3WQ0A 2LM3A 5A33B 2W9XA 4UWDA 1W3VA 4RQPB 4OHVA 1KS4A 4OULA 2DFBA 5A7WA 4BIOA 3KV5A 4E27A 3K48A 4XFGA 4B3NA 3MLLA 4M00A 4BQWA 5FOBB 3V0AA 3M3QA 3PU8A 4KGGA 4AZZA 3J4UH 5C3RA 1W8HA 5C9AC 1QJY2 1RINA 3BGAA 4IE6A 1GR3A 5CA6A 1LTEA 3POJA 5FYUA 1LGCA 1FOD1 2GC1A 4Q4X3 1D0HA 2KA3A 1H2MA 1TNFA 4N7IA 4WZCA 3I3BA 1XU1A 5FPLA 4XJWA 2PHDA 5IK8A 5T52A 4Q4V2 4ASLA 1ZZBA 3B7MA 1WW7A 3MW2A 2AREA 2PFWA 4LIVA 2CGNA 2ZGUA 1PO13 2QCSB 4RQPA 3FHAA 4QGLA 4IQPA 4NN0A 3BALA 1Q8SA 1XNKA 1AR72 4N90A 4RHV3 1TMF3 2C0ZA 3DV8A 3VBUC 3LDKA 3I2KA 3I2DA 1W03A 3PUAA 1UZVA 4N53C 5FXVA 1C8M3 2VUCA 1O91A 1H8TC 2PYTA 3AB0A 2B5HA 4LO8A 5GLWA 2WA4A 1ND3B 1W2OA 3O5SA 4CU6A 3JZVA 4XJUA 1MZ6A 2RS33 5FY4A 4BCUA 3MHZA 1UY1A 1UY2A 3ZMOA 4QQOA 3WT3A 5F3IA 4I01A 1XC6A 1ZBA3 2DURA 3PTYA 1BYHA 1L3JA 4AEMA 1J1TA 4AGVA 4DPNA 3O14A 3D8CA 2XWBB 3KGZA 2XR4A 4FPCA 3DUIA 5EXOA 1PVXA 3JBG3 3WQ7A 3CLPA 3LEIA 1O3SA 5FP4A 2LTNA 1RUG3 2Y38A 3NNJA 5LK7B 4NIHA 5LBBA 2Y0OA 5EIYB 4JHZA 3AKSA 5F32A 4BZ4A 3QD6A 2DUPA 4KWKA 4IV1A 1DFQA 5ACA1 1FXZA 2FCUA 5I0RA 1ND3A 2BNMA 3T30A 2HWB1 4BMEA 1UZYA 1DZTA 1VRH2 4Y1ZA 3MV11 2IXKA 5FZ0A 3WF0A 1ND2B 1GKBA 2D40A 3JCIA 3QH6A 4XIOA 2FZ2A 2VY0A 5HBAA 3J9SA 4QXCA 1OQEA 3UT0A 3WDVA 4GAZA 2BNOA 3PMEA 1NG0A 2XBO2 2C26A 2P4EA 4XBNA 5T50A 1LOGA 1ZA7A 3AXDA 3E6BA 4JGYC 3EXUA 2XVGA 5F3CA 3W5NA 1LNSA 2ETEA 2HWC3 4BQ5A 5DZEA 1GZWB 4HN1A 3N9NA 3LOIA 1X8EA 3KF3A 1ZZ9A 1C28A 2UYAA 4FPJA 4FOQA 4CEWC 4IE7A 4Y4RA 1O6UA 4IXLA 3WQBA 3HQUA 4P9YA 1AX0A 3RQ0A 1DBNA 3ACFA 2HLEA 3AVSA 2RDRA 4RSUA 4QX0A 3AKRA 1H1AA 3C7EA 3J8F2 4MGKE 1WW4A 1YQCA 4HMZA 1VPHA 3HMYA 3WUDA 1O5LA 1VE0A 2PHFA 3EYPA 1KDKA 4QB6A 1UOJA 1ND2A 4FOYA 1QKQA 4KH9A 3FN9A 2YFZA 2ORXA 4XHBA 4DXSA 3RZKA 3OUIA 4AI2A 4KQ7A 4Y1YA 2ZEYA 4AHZA 1POV3 3IMMA 3WCRA 3MI8A 1N3OA 2ATFA 3BIEA 1AR91 1DYOA 3RJRA 3HEIA 4PQ9A 5JWPA 2VZSA 1YWKA 4PDWC 2EAKA 2HYXA 4YVWB 3C8XA 3GF6A 4XPVA 4L9BA 2W1QA 5JI9A 1T2XA 1F35A 5FK7A 2IVJA 4WVZA 3FZ3A 3SH5A 4EN9B 1ZRDA 1R091 1PM7A 2GALA 2JDMA 5DABA 1JYXA 2V09A 3UV9A 2TNFA 4R4XA 5GLVA 3RI8A 1H2KA 2K9ZA 1Y9GA 2L9LA 5FPXA 1QMJA 4IGQA 3D0JA 3WQ1A 2VZRA 1W6NB 3S7IA 1ZX5A 2XHKA 3K3NA 2J42A 2UWAA 2WKKA 2YGMA 2AH2A 2ZPXA 4FXGB 2E51A 4COYA 2PQSA 1D0GA 2A3YA 2A73B 3ZXFA 2PHWA 2JKBA 2EALA 1PGSA 2BWCA 5KR7A 2ZABA 4Y22B 5L36A 4AFDA 5FXXA 3EB7A 1C5IA 4FP2A 1OSGA 5FZIA 1JYTA 4YVWA 1A8MA 4LK6A 2JKXA 4Z8BA 1V6KA 3B5LB 1VBE1 1NCRB 3T2QA 1YXWA 5C5UA 1AR62 1MEC1 2ZHNA 1O7FA 2H6BA 4IEOA 3UYJA 5C4WB 3N7KA 3ZFEC 1NY71 5FPAA 2ERFA 1LCLA 3PNAA 1GMMA 1NUKA 1W2UA 1WMXA 4IDZA 4QKBA 4D8MA 2IVIB 2IXJA 2RS51 3VZOA 1W6NA 3FLTA 4O65A 2R072 2VM9A 2V73A 2D7FA 3WOGA 2WNVB 4K9SA 4LMFA 4DXRA 3A21A 3RWKX 1VBC1 3D3AA 3GZTB 1B09A 2RMU1 5BXXA 1WGPA 2JJ6A 1ZRFA 5L7OC 1RVF1 2ZAHA 4YW2A 4Q0QA 4BQ3A 1RUE1 1LEMA 1AL21 2YBKA 3ZN6B 2WINB 3MIEA 1XE8A 5FDBA 4DB5A 5HI0A 4QU2A 2I2SA 1OURA 5FYHA 5A3LA 1PVC3 4Y22A 1RUH3 3PUIA 5F7UA 3GZAA 5IVBA 1V6IA 2G9ZA 4OHYA 5FO8B 1OLMA 2E7TA 4QPGB 1NCRA 3KVAA 2VJXA 4MGZE 3Q8AA 3BTYA 3WNPA 1MS4A 5C4WA 4I30A 2Y8KA 5A7NA 1VBB1 4GZ9A 1S0CA 4AI8A 2XLFA 1CZTA 1W8OA 3ALQA 3BIWE 4MGQA 2EXIA 4B7KA 4Y3OA 2P34A 3ZYHA 1QHDA 4BE3A 2WNVA 4CCLA 1E5RA 5HCBA 1VLNA 2J22A 3HBZA 1LOCA 5A3WA 2ID4A 3AKPA 4WM7C 5CKNA 2D3SA 2CNAA 4RA0A 4XF9A 2WO1A 1I5PA 4YW6A 5SV8A 4HXCA 3NV1A 5C3PA 1NE6A 5GKAC 5CFCB 3NO8A 3PLQA 4R4ZA 4AL9A 3ZN6A 2VBPA 5IK5A 3Q9OA 4LLFA 4XBQA 2XJTA 4XF0A 3NWKA 4P9XA 4JZRA 1MZFA 1RHI2 3AM2A 5L73A 3SCFA 3LDBA 1BCXA 3B01A 1KGYA 2VQUA 3CHXA 3OUJA 1WA4A 4UXAA 4NIGA 3M3EA 4FOVA 5FYZA 5IVYA 3U07A 1NXD1 4DEVA 4J1XA 1BEV2 1NLQA 2JEMA 4CCNA 2VECA 4I09A 1X36A 2DU1A 2TBVA 1V6NA 1GZ9A 2I74A 2RJLA 4FPFA 1MVEA 3P6BA 4OZXA 2X5IC 3CJIB 4CUBA 5A3UA 2OPWA 2ZA9A 4KBBA 5FXWA 1E57A 3ZR6A 2OA2A 3KHBA 1N3QA 3KWVA 5FPBA 1OOPC 4EE2A 4KWLA 1Q8QA 4AHYA 2DUQA 1JZ6A 1DGRA 1JOPA 3M1HA 3MGUA 3OBTA 4AVTA 5BYNA 5CFCA 4D7YA 5F1RA 1XOYA 3I2OA 3HN3A 4JRAA 3W59A 4QKFA 1FPN3 1QOSA 3FE5A 2Z79A 4KI5M 1NQJA 3DCQA 3VBRC 4PI0A 1N1TA 2DCTA 1QQP1 4PBOA 3ZSKA 5JOYA 1W05A 4WVVA 4ZONA 4KBZA 3UL2A 5EHDA 2VPVA 2NQYA 2RR13 5C8CA 5FAXA 1JYNA 3DGTA 2E26A 2Q0AA 4LBQD 4PLNA 5FBZA 1LENA 4X6RB 5EJ1B 1ODMA 1PMIA 4OFGA 5L9VA 2GDFA 5FYTA 3S30A 2W52A 4AEJA 4CUCA 3CJIA 5GM0A 2XGXA 1UIJA 3GHNA 3UKTA 1WZXA 2Y6FA 4IEXA 1VBA3 1QJY1 1RMU2 4I0WB 1D4M1 3POGA 1PIV3 2JDPA 3VL9A 2BOIA 4Y4YA 5LY2A 1YIFA 2WJSA 2WR9A 2YC0A 3C7FA 3FL7A 4LOTA 1AF9A 2PHXA 1QU0A 1RITA 5DAPA 5L9BA 2G4IA 3U11A 4W50A 5F3EA 3VBFB 1MS1A 1OKQA 3LEMA 1DGWA 3ACHA 4PHZA 3RSJA 4Q4W1 1GUIA 1W9SA 2YHJA 1PHMA 3H7JA 3WSOA 1CAWB 1HB2A 3RZLA 1WKYA 1WMDA 4FQZA 3U75A 4UW6A 3F2ZA 3VBHB 2QVSB 3IWZA 2FBEA 3OD0A 3ZMNA 1R1A1 3MIBA 4YWAA 4TYSA 1I1EA 1HJFA 1LGBA 2PHTA 3AJZA 5DAWA 1FOD2 3K77A 3ME2A 1GICA 4LOSA 4BWOA 4RQPC 5J96B 2Y0IA 2ET7A 4IETA 5AC92 3GM8A 1DGRN 4IEWA 4YG3A 4AVBA 3EQEA 1JOJA 4ZU4A 2XWJB 4EROA 2YDEA 1SBFA 1WMEA 4YG0A 4B4QA 3OSDA 2BFUS 3AYCA 5F39A 2D98A 4GMP1 2DCJA 4KGQA 1C1FA 1UYYA 1UU6A 4O9GA 3ZM8A 3VBFA 1S2BA 4L97A 2JB8A 3LB9A 2FCVA 3R0RA 3VD3A 2D44A 1CJPA 2XJRA 5T55A 2D5FA 1CAWA 3LD8A 1AL0G 4DXTA 4HONA 3DXTA 4A2UA 5HXMA 4LBNA 3WXPA 4L92A 2A71A 1XU2A 1Q43A 5H9SA 3MO4A 2QQIA 4AEDB 4C1XA 4LHNA 3T0DA 5FIXA 1Q8PA 1QJX2 4FPYA 3TNPB 4XFIA 1SPPB 2P3YA 4QQ2A 4E2QA 4BQYA 4NHYA 2FQPA 1H2LA 5FUIA 3B93A 4P02B 3G6JB 2FHRA 5C7GA 3MBWA 1IPJA 1V9U3 1AXKA 1W6OA 1X9TA 2VOWA 3PHMA 5CG8A 4CE8A 2QKDA 1G9FA 3GGLA 4RS5A 3TN93 1XYNA 2F4LA 3MW4A 3SISA 5KHHA 4XEZA 2WRAA 3QACA 1KEXA 4A7YA 3VZJA 5A80A 3S7EA 2OQ7A 1VRH1 2ZHMA 4ZPIA 4XAEA 5FZDA 1BKZA 3OGSA 4GKYA 4CCJA 1BMV2 2GMEA 3DPRB 1UNBA 2RJ2A 2VGDA 5CADA 3RZMA 4H7LA 2YB7A 4BYYA 1ACCA 1ND3C 2ZGSA 5C8WA 5APAA 4MUVA 2XBO1 5DN2A 4AEDA 4ASKA 5C6CA 5B2GB 5HCAA 4X8PA 4NIIA 4DOUA 5CG9A 3IZOA 1PGL1 1VBE3 1UY4A 3WLUA 1SPPA 4QPYA 2WSVA 2XUMA 2CAUA 1QXPA 1HN0A 5FPUA 2BUKA 2HWB2 3ES4A 3GZUC 4I3GA 3TOJA 2VZVA 4JGZB 4XBLA 5BY5A 2AZ5A 1RUI2 1Y9MA 2RS53 4Q0SA 1ZBE3 2DFCA 2E31A 1C57A 3KT4A 1QJU1 3LSEA 1VBC3 3J8F1 3GCWA 2RMU3 1HQWA 4LO6B 2C6SA 2VMGA 3USUB 4XOGA 2W3JA 4C91A 1RVF3 2ARAA 2DV9A 2Q1ZB 3ACGA 4JKKA 3T09A 3AC0A 1U5IA 4YFWA 4HKOA 3M8LA 1ZM1A 3IDBB 4JRLA 4XCBA 3OBAA 2FDGA 1NX9A 3T1LA 4MZUA 1HB3A 1ND2C 2EVXA 5KWRA 2BGPA 1DZRA 4QXKA 5BNNB 4NVPA 3NAPA 4R9AA 3JB4C 5LW9A 3A0KA 4UFIA 5CYYA 2R0HA 3JQXA 1DZQA 2ZHKA 3GNEA 3P1IA 5FYBA 1I5ZA 2G9GA 3IMNA 1W39A 4FTSA 4CU9A 4JGZA 3LPFA 2EAAA 2D6PA 2BW8A 1S1AA 3CNAA 3AP6A 3VLBB 4M4PA 4OUEA 1C1LA 4DO0A 1W8NA 2B39A 2QQUA 4JKLA 1SHWB 3AMQA 2DVDA 2VAUA 4NPMA 5FZOA 3USUA 3ZIWA 1WCSA 4AVSA 1AR92 2BVVA 5DDJ1 3DF0A 1LHUA 5C33A 3ITQA 1NLRA 1PO22 1UQXA 2XQXA 5JPMB 3DXUA 3ZYBA 2N7GA 2IXLA 4D7SA 5I0SA 1RUD3 3N9LA 1AZDA 5JZGB 4M3CB 5KHGA 3L2YA 1LOBA 3ZXKA 5BNNA 4OI4A 4DIQA 1MS3A 5KC6A 3K4ZA 4XFCA 4OQ9A 4GB32 3OEBA 1TME3 1O4TA 1I6XA 5K0UB 5DUUA 4L11A 4WVWA 1AR61 4ES8A 2VZ3A 3R4UA 3FUQA 5DUVA 5FYMA 1FMD3 3U14A 1MACA 4NHMA 3ZFGB 1VRBA 2A6VA 4BIFA 2QZ3A 1HXS3 3ACLA 4YVWC 5JLVA 3H8XA 3FC0A 3V65A 2R49A 4FTBA 4A3XA 1O59A 4QHBA 1X9PA 4TSVA 1UOGA 1GYKA 5ABJB 5DAXA 5FMCA 1CONA 1OPMA 1YI9A 1GFF2 4META 2RS12 4XQ4A 2ZOEB 2NMOA 4ZHNA 1LOFA 1BBT2 2VR4A 5KXEA 3R4SA 1UXZA 3AMNA 4GULA 2WFF3 1XNDA 4XJ8A 1SDDB 3AZZA 4K7JA 1VB4A 2PAEA 5JZGA 1MEC2 5FYSA 3KGLA 2ZMLA 3P3NA 2Q8OA 5FZLA 4FQ4A 2WYSA 2ZZJA 4RD7A 5IFTA 1YYNA 1XXNA 5K0UA 4EJRA 5JSOA 1DHKB 2VXRA 2UURA 5FY1A 4XILA 5LY1A 3SXWA 3INAA 2WN2A 2EIEA 3GBFA 4XF4A 5I91A 2JDYA 4XZUG 1QH6A 5LATA 1BXHA 2IUWA 3I54A 4KU8A 5FMOL 5DUWA 5CISA 2E33A 1NCRC 2EXKA 5ABJA 5CEHA 2W1WA 1RUF1 3SQOA 1AL22 1MZEA 4BMBA 2VNGA 3CU7A 5C4WC 1W90A 3QCWA 3VZMA 3TNQA 3K51A 5F6KA 3B02A 2Q8CA 2HKXA 2J1AA 5F2WA 1MS9A 3V56A 4KL1A 1W04A 4Q4V3 4Z2AA 5IK4A 2WNVC 2EXHA 4CDQB 4S2DA 3HT2A 1VBB2 4XJZA 5IT6A 1H9WA 1RHI1 4CXXA 4CVUA 2ZX2A 2VTXA 4K8RB 5JSPA 1AR73 3ZIXA 2ZGNA 4LBQB 4R9BA 4I02A 2PTMA 1FV3A 1HQNA 4XFFA 1OKOA 1GOHA 2WT0A 4NR1A 1BEV1 3POEA 1H6XA 4JQTA 2NZ9A 5F5AA 2RDNA 1QH7A 1E5SA 4QPGC 1U5YA 2R041 1C5HA 5DG2A 3TWIA 4CDWB 4LKSA 4URTA 4ZU5A 3E6CC 4LPLA 4ISQA 2OQ6A 1HIXA 1CGPA 4FI9A 3NNFA 3UETA 2A7AA 1ENSA 2UWBA 3JUUA 3BTXA 1AX1A 4UF0B 5CKQA 5DZFA 3WNNA 2P5BA 4CDQA 2E7QA 1XYOA 3KZ4C 2D5HA 5JIAA 4CEYA 2VCMA 1M06G 1ASJ3 1S0DA 1MQTA 1JOBA 1TZOA 2VCBA 1E5HA 3P5BA 5HXVA 3V0AB 5CFCC 4LBQA 3X29B 3VDCA 3C7HA 3SMHA 1JZ4A 4CTEA 2PHRA 1A78A 1W6PB 4S2HA 4NJ4A 5FUNA 4AFCA 4D94A 4FTEA 5C70A 2R1DA 4LQRA 4MSVA 4OMCA 5L9RA 2XL7A 2HWD1 4O61A 4JDMA 1OT5A 3AVRA 3IIIA 3AYAA 3CF6E 1OH3A 2RV9A 3RZJA 4YYOA 1JZ5A 5FZMA 3UK9A 4QKNA 1UIKA 2NYYA 1HKDA 1Q5OA 4FBFA 3LOBA 5GZEA 1I3HA 3IAPA 1NLSA 2B42B 2V5YA 3CJIC 1BZWA 4UF0A 3KMHA 2RM22 2W94A 4IERA 2WT2A 3WX5A 2WO3A 3H8OA 5IJRA 4CCDA 4XTPA 4QU1A 1ODNA 5FZHA 2R30A 3VB9A 3SEEA 2WO2A 5JMCA 2VE1A 5BNQA 5IVJA 4MX3A 2HWE2 5JDBA 2W08A 3D4KA 3S5QA 1VBD2 1W6PA 1IS5A 3PL0A 3ZOIA 4U36A 1VP6A 1D4M2 2EIBA 5T5PA 3AP9A 1XJAA 2HEWF 4NPLA 1JHNA 2PELA 2I45A 2XL9A 5FV3A 1OXCA 3LFMA 5LRRA 5AC91 1EPWA 1PM4A 1LESA 3Q8FA 2W68A 3J8F3 1H0BA 4IL7A 4MXWB 1YFYA 4W4ZA 4YW3A 3VDAA 1ZREA 1EY2A 2WSUA 4Q4W2 5IFPA 4EN0A 3NRUA 3DKWA 2F6BA 5FJKA 5C3SA 4UW4A 1EAH3 5GLZA 5J37A 1L7QA 1Z78A 2BTVC 1B35B 1CAXB 2BRTA 4KG8A 3ZX7A 5FLHA 3M3CA 1R1A2 2DUOA 3GZEA 4Q5OA 3U10A 5CFDB 2DVAA 4GA9A 1JU3A 2WWUA 5FWEA 2QQJA 3J7LA 3T2OA 3C7GA 5ANNA 2A6ZA 4FVVA 4IE5A 3ZYPA 1DYKA 2J1VA 3NKGA 2YC4A 3VBFC 4JVAA 1QJX1 1F5JA 1TNRA 2DCKA 4IV1B 3VKFC 2QQOA 5IVFA 2PAKA 2C24A 3SCGA 5I0DA 2Y60A 3E1F1 4LO4B 3VBHC 3I3EA 4P14A 3IDEA 2GNMA 1EV12 4K40A 2P2KA 4RR3B 5E88A 4MXWA 5IAVA 1AHSA 4IEQA 4YGDA 2AGSA 3KS7A 5LA9A 3I4IA 3KVBA 5EPAA 1ZZ8A 5LBEA 4WM8B 4DUVA 1AYM1 3TYJA 4ITCA 4ES9A 1DQ0A 1RB8G 1O5UA 1B35A 1CAXA 2WZ8A 4LJHA 2IFWA 1J3QA 1YIPA 1TEIA 2VCAA 1LEDA 1YRZA 1BMV1 5T5JA 2R32A 1WD3A 5CFDA 4GXLA 2JDUA 2VW0A 1EP0A 2VCCA 2GZWA 4AI9A 4PLOA 3KT7A 5FOJB 1GOGA 4ATEA 4BA6A 3POFA 3LKJA 3MLJA 1N47A 3ZSLA 2OX0A 4IGPA 4R52A 1UKGA 2C5DA 2P17A 2IXHA 3TB0A 1IG0A 1GWLA 4PLMA 1UWWA 5FPVA 4CUGA 2QNKA 3KSCA 1XB9A 2FDJA 4BXSV 3JD73 3KV6A 1V0AA 3KT1A 4M3CE 1ZVFA 3GYDA 4RR3A 4AEDC 4ZZ5A 1S2KA 2IZWA 4A41A 2VZOA 4YVSB 1RUI1 2R062 5FLIA 1XE7A 2EA7A 2O0OA 2R073 4RGAA 1YJKA 2AR6A 1WLDA 2VZPA 1CWPA 4WM8A 1PX3A 3H1WA 1LOEA 3LPGA 1SLCA 5JVVA 1JZ7A 2WYFA 2W2IA 1J3PA 2OXBA 4BPZA 3VKOA 5FMDA 2LW8A 4UAPA 3MDPA 1PGL2 4LTAA 1OQ1A 3ZO0B 4EZ4A 2XH6A 2EIDA 4BU2A 3ZKUA 1U5ZA 2HWF1 4AW7A 3PURA 1CX4A 3K46A 1BVP1 1DIWA 3ZYIB 3O1OA 2UWCA 4AVVA 4E4DX 3DPRC 4Z2WA 3THDA 2P3JA 1GV9A 3POSA 3VN4A 4GWMA 1MS5A 1R081 1UYPA 4N43B 1LU1A 1QJU2 5DPNA 4RL7A 1CQ9A 4AG4A 4ZY9A 5L19A 1O3RA 1KJLA 2D6LX 4MLOA 4MOAA 3T1MA 2XLGA 1CAUB 5F2SA 5FQ0B 4FO9A 4BHPA 1OUXA 4QGMA 2A3WA 4N7UA 4YVSA 4XUPA 1BLZA 4RFRB 3N7MA 3Q8CA 2VXJA 3OPTA 3UESA 3LAGA 4XHXA 2ZXQA 4OHWA 3CL1A 1US2A 4JGZC 5CVRA 3F95A 3PVOA 4KMQA 2DCYA 1GSLA 2AUYA 3DKQA 4FOWA 4Q4X2 1PO21 3O1TA 2EICA 3H9AA 5EYYA 2IC1A 1UCXA 2GAUA 2Z5WA 1RHI3 2DVBA 4K1YA 4V2VA 2X8KA 3MV01 2PA7A 3J7HA 1IS6A 3MEPA 2Z2SB 3AFGA 4NOTA 5A1FA 5LRSA 4CXYA 2FDHA 3VZKA 5FP9A 2DVGA 4N43A 4GB31 3W20A 1DQ4A 1BEV3 3SNMA 2DBIA 1OUSA 2BU9A 2XQRA 4LXLA 2WNEA 1CAUA 5FQ0A 3DYMA 3FBYA 5JSRA 1ZNPA 1QJFA 2XXZA 3N3HA 5DDJ2 5BNNC 1FATA 5KXDA 2PXJA 1PK6B 5M0TA 1W9FA 2VOTA 5FZAA 5BV6A 2JWPA 5BPXA 1SFPA 2FMDA 2RS11 4LA2A 2DVFA 3UJOA 4G4FA 4CA9A 3VBOC 1BBT1 3OOXA 4CPBD 2JG9A 2XMLA 3K4AA 5FWJA 4AF9A 4JDNA 2RS32 3N9OA 4B4PA 4E4SA 3I2HA 1JN2P 1LOFC 4M0NA 5HV0A 4W65A 5B4NA 1LHNA 1U12A 3TEWA 1KJRA 4HSJA 5JZGC 2TUNA 1H8VA 2ZCWA 3NNGA 4UFMA 2B7YA 4DY5A 4Q1PA 4S2GA 4K1ZA 5JUVA 4MV2A 3JXSA 1PK6A 1RMU3 1SZBA 1K5MA 5JAXA 5K0UC 3CKHA 3ON7A 1ULPA 3ES1A 2ARCA 4EWDA 2ZMKA 1V70A 1QOTA 1ZZ7A 3ZFGC 1GLHA 1J58A 4E4ZA 2GNBA 5KXCA 4B4RA 4CP0A 5JXHA 4TWTA 5J1XA 3GJAA 3HT1A 5ABJC 5JOZA 1LHWA 1DU3D 4NPRA 1ULEA 5D8AB 3VD5A 4IW3A 1TG7A 5DZGA 1BVVA 4Q0VA 4YM1A 4MG2A 5EP9A 4Y33A 4AQSA 4CCEA 4AE2A 5IW0A 4P9IA 5EQUA 4Z07A 1UXXX 2BWAA 3LIHA 1LGNA 1RUF2 4AR2A 1NA1A 3ABZA 2C9AA 2WS91 4NRMA 4BQXA 1FOD3 4LIUA 4B7EA 1JUIA 3QLQA 4A42A 1G9DA 1HRV1 5AC93 3S0MA 2HH9A 2VTFA 3VDDB 4AFBA 3PJYA 5FZGA 2MNGA 3IB3A 3N7LA 3NKTA 5CB7A 5E16A 4ISRA 2HJIA 3TAYA 1RUC1 5FZ7A 5LBCA 5EYXA 4XQWA 1MPXA 1PGW2 2MEV1 3S6PA 4OYUA 4TN7A 4W6XA 3WCSA 2RE9A 1K45A 3MIGA 4GMP0 3ZSJA 3PDQA 4I0BA 4ONUA 5FYYA 4NWVA 1W2AX 5D8AA 3PUSA 3DN7A 1RUNA 1YCIA 2Q4SA 5C8CB 4COUA 1H30A 3O12A 2VOKA 1QWRA 1SLTA 2CTVA 2ZJCA 4XF3A 4P9JA 2VBBA 3GXUA 5A3MA 1CVNA 1QJX3 2R042 4IV3B 1A3KA 1REDA 4CDQC 4LORA 3MICA 2JENA 4X6QB 2VUAA 3UGFA 4TZDA 4G9SB 5F5QA 4Q4Y1 5FCCA 2YU1A 3LA3A 1OVSA 4YZ4A 3ZFFA 3VDDA 1ZZ6A 3I2IA 1K12A 1RTVA 2I07B 4HVOA 2F17A 5CU1A 4NWWA 3V0BA 1WBFA 1Y43B 4XFBA 4AVAA 4HVQA 2J1EA 2BDRA 2B46X 1X33A 2VOVA 3PIJA 4GWIA 5JR7B 4AGGA 4CPBA 2TEPA 2WABA 4MADA 4MVTA 5CNAA 4XACA 2E32A 5EFUA 4Z1VA 5H9PA 3ZYGA 4CZSA 1EUUA 4CDWC 1AYN1 2OZ6A 4A4AA 3MPBA 1EUTA 5E6HA 3CMGA 2RM21 4UFHA 4XDQA 2JG8A 4CCCA 4E2GA 3RI9A 3ZXLA 4JHTA 2WQ8A 4P5HA 3NJYA 1F15A 2B45X 3FFQA 2Y6GA 2HWD2 4IV3A 4XAAA 5CBLA 3H3ZA 2HWE1 3U4XA 3E97A 4XDPA 1OI6A 5ACA3 3ZYFA 1VBD1 3T4HB 4OZOA 4EN7B 4PJYA 2JIGA 3AZXA 3VKNA 5KC5A 4NO4A 4XQDA 2W46A 1CD3G 4FPHA 2HWB3 2YBSA 1KQRA 2KXLA 2ZKLA 2Z69A 1FI2A 1CIYA 2WN3A 5C71A 1RUI3 5JCTA 3WNOA 3A23A 4LITA 2DCZA 4QXBA 1ZYBA 1WA6X 5EZWA 2QZ2A 5GZDA 4NHKA 4NROA 1W3XA 2DU0A 2VG9A 1K3IA 1I9RA 2XVLA 5FZ6A 3ROUA 1AJOA 4XMAA 4ARXA 1OQDA 4LULA 4XZPA 5E8AA 4D3WA 1ONAA 1UZ0A 4D6SA 5IVEA 5FP7A 1LU2A 4LBMA 1ZRCA 3LDRA 2GU9A 1QXRA 3WF3A 3HNYM 1GQPA 1UYXA 3WDYA 1IKPA 4O9EA 4AI3A 4DNYA 3PVBB 2Y6JA 1OFNA 4XYXA 1V6OA 4HANA 3HAGA 3O1MA 1HRI1 3K75B 1N1YA 3L2HA 5FMOS 3DYOA 1WCUA 3I3DA 3JB8A 4XUNA 3RMYA 3T0AA 1W6OB 4E2SA 3AZVA 3CEWA 3N36A 1H2NA 4RS5B 3VZNA 2WNOA 2WC2A 2PQQA 1JUHA 3D82A 3POBA 2ZMNA 2PAMA 4GH4B 2R0FA 3LA2A 1JTZX 1EV11 4HZFA 4Y1XA 5FTTC 1JBCA 4AFMA 1CESA 2IWGB 2P1BA 2EXJA 1W2TA 4LBLA 3O0XA 1AR93 4N8MA 1M4WA 4QMAA 3HQXA 4C0BA 2ZGPA 2E53A 3RFRA 1BK0A 1PO23 3I59B 1GP5A 3RZGA 2RHPA 3CIHA 2HEVF 5LA1A 2R1BA 3HD8B 5FXZA 3W5MA 4S2FA 2GN7A 4CSWA 1R093 1TVGA 4X8NA 5A1LA 2C9KA 1B35C 2WZR2 4N53A 1SLIA 4EWEA 3H8RA 3O7OA 4XIKA 3MUZ1 1OF3A 3URFA 3S57A 3NNMA 5CFDC 4PIXA 4LUKA 4XUTA 1Z0HA 1DGWX 1Y9QA 1X7NA 3BCWA 4GH4A 1O4ZA 1AYM2 5FR3A 4FPGA 4ZS3A 1AR82 2GN3A 3LSDA 3WHUA 1ENQA 2R061 2VMFA 4IV1C 5JI7A 2DTYA 1COV2 4A6SA 1G7YA 2A70A 3KLSA 4N9HA 4SLIA 1CX1A 2MHFA 3OB8A 2XJVA 1YI7A 3I59A 2Y26A 3QBQA 4QM8A 2YV8A 4RR3C 5FRAA 2AEYA 5FYCA 5FZCA 3NAPB 3I97A 1MEC3 2K46A 3ZVXA 4WV8A 1W28A 4Y5TA 4WM8C 1FPN2 4M3CF 2BERA 3WNXA 4Q26A 4UBHA 3PVEA 2E9QA
chains in the Genus database with same CATH topology
2YBKA 3KVBA 4HOOA 3NJYA 2XMLA 5FYBA 5FZ4A 5K4LA 5FWJA 5FY0A 5FYHA 5FBJA 3K3OA 5A3PA 4QXCA 5IVBA 2OT7A 4XDPA 4GAZA 5F5IA 3N9OA 4CCMA 3PU3A 2OQ6A 5FZOB 5F5CA 3KVAA 4DO0A 5A3NA 4AI9A 2YBSA 5FZ9A 5FZOA 5A7QA 5F3CA 4UF0B 5A7NA 2P5BA 2YU2A 5FZ8A 2YBPA 3ZPOA 4QXHA 3N9NA 2OX0A 4LITA 4IGPA 4Y3OA 4QXBA 3N9PA 2OS2A 3DXUA 2WWJA 5F39A 5A7WA 5IVCA 4CCLA 3KV5A 4Y4RA 5A3WA 4CUGA 3KV9A 3K2OA 4QX8A 3N9LA 5FPVA 5FZ6A 5FUNA 5IVVA 3PTRB 3KV6A 3AVSA 4D6SA 2Q8EA 3PU8A 3ZLIA 5FP7A 5IVEA 4DIQA 3LD8A 3PUQA 4HONA 3DXTA 5FZKA 4CCOA 3AVRA 2XDVA 5FZ3A 4D6QA 5FYUA 5FZMA 5FYMA 3LDBA 3U4SA 2YPDA 2W2IA 1VRBA 5FY9A 5A7SA 5FJHA 3N9MA 5FYIA 5FP3A 5FYZA 4GD4A 5FPLA 5IVYA 4E4HA 4BU2A 4EZ4A 5F37A 4UF0A 4Y33A 5A7OA 4D6RA 5IW0A 4EYUA 4CCNA 3PURA 4GJYA 2VD7A 4LIVA 5A7PA 4QU1A 5FZHA 5F3GA 4LIUA 5FXWA 5A80A 3OPWA 4CCKA 2XUEA 2OQ7A 4V2WA 4CCJA 5FZDA 4EZHA 5IVJA 5IWFA 5FZGA 5FPBA 5A3TA 5FYSA 5LWBA 5F2SA 3PUAA 4NUBA 5FZLA 4IGQA 5FZ7A 5FXVA 3AL6A 5FUPA 3KV4A 4QWNA 4TN7A 3K3NA 3OPTA 5FV3A 4IGOA 5FXZA 5FY1A 4ASKA 5LY1A 4CSWA 4BISA 3PDQA 5FYYA 3N9QA 5A1LA 3PUSA 3U78A 4URAA 5FY4A 5FJKA 5FPUA 5CEHA 5KR7A 5FXXA 4V2VA 5FZIA 5FZFA 4QX7A 5F3IA 5FY7A 5A1FA 5FYTA 2Q8CA 5F2WA 2YU1A 3RVHA 5FP9A 2GP5A 2WWUA 5FWEA 5ANQA 3UYJA 4BXFA 4LXLA 5FPAA 2GP3A 2Q8DA 4AAPA 5ISLA 5FZBA 5FP4A 5LY2A 5FZ1A 2XXZA 5IVFA 5F32A 5A7WB 4GJZA 5FYCA 2PXJA 5FZEA 3AL5A 5FZCA 4C8DA 5F3EA 5FZAA 5E6HA 5FY8A 4XDOA 5FYVA 5LW9A 5F5AA 5FY5A 5FP8A 5FZ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YBK A;  3KVB A;  4HOO A;  3NJY A;  2XML A;  5FYB A;  5FZ4 A;  5K4L A;  5FWJ A;  5FY0 A;  5FYH A;  5FBJ A;  3K3O A;  5A3P A;  4QXC A;  5IVB A;  2OT7 A;  4XDP A;  4GAZ A;  5F5I A;  3N9O A;  4CCM A;  3PU3 A;  2OQ6 A;  5FZO B;  5F5C A;  3KVA A;  4DO0 A;  5A3N A;  4AI9 A;  2YBS A;  5FZ9 A;  5FZO A;  5A7Q A;  5F3C A;  4UF0 B;  5A7N A;  2P5B A;  2YU2 A;  5FZ8 A;  2YBP A;  3ZPO A;  4QXH A;  3N9N A;  2OX0 A;  4LIT A;  4IGP A;  4Y3O A;  4QXB A;  3N9P A;  2OS2 A;  3DXU A;  2WWJ A;  5F39 A;  5A7W A;  5IVC A;  4CCL A;  3KV5 A;  4Y4R A;  5A3W A;  4CUG A;  3KV9 A;  3K2O A;  4QX8 A;  3N9L A;  5FPV A;  5FZ6 A;  5FUN A;  5IVV A;  3PTR B;  3KV6 A;  3AVS A;  4D6S A;  2Q8E A;  3PU8 A;  3ZLI A;  5FP7 A;  5IVE A;  4DIQ A;  3LD8 A;  3PUQ A;  4HON A;  3DXT A;  5FZK A;  4CCO A;  3AVR A;  2XDV A;  5FZ3 A;  4D6Q A;  5FYU A;  5FZM A;  5FYM A;  3LDB A;  3U4S A;  2YPD A;  2W2I A;  1VRB A;  5FY9 A;  5A7S A;  5FJH A;  3N9M A;  5FYI A;  5FP3 A;  5FYZ A;  4GD4 A;  5FPL A;  5IVY A;  4E4H A;  4BU2 A;  4EZ4 A;  5F37 A;  4UF0 A;  4Y33 A;  5A7O A;  4D6R A;  5IW0 A;  4EYU A;  4CCN A;  3PUR A;  4GJY A;  2VD7 A;  4LIV A;  5A7P A;  4QU1 A;  5FZH A;  5F3G A;  4LIU A;  5FXW A;  5A80 A;  3OPW A;  4CCK A;  2XUE A;  2OQ7 A;  4V2W A;  4CCJ A;  5FZD A;  4EZH A;  5IVJ A;  5IWF A;  5FZG A;  5FPB A;  5A3T A;  5FYS A;  5LWB A;  5F2S A;  3PUA A;  4NUB A;  5FZL A;  4IGQ A;  5FZ7 A;  5FXV A;  3AL6 A;  5FUP A;  3KV4 A;  4QWN A;  4TN7 A;  3K3N A;  3OPT A;  5FV3 A;  4IGO A;  5FXZ A;  5FY1 A;  4ASK A;  5LY1 A;  4CSW A;  4BIS A;  3PDQ A;  5FYY A;  3N9Q A;  5A1L A;  3PUS A;  3U78 A;  4URA A;  5FY4 A;  5FJK A;  5FPU A;  5CEH A;  5KR7 A;  5FXX A;  4V2V A;  5FZI A;  5FZF A;  4QX7 A;  5F3I A;  5FY7 A;  5A1F A;  5FYT A;  2Q8C A;  5F2W A;  2YU1 A;  3RVH A;  5FP9 A;  2GP5 A;  2WWU A;  5FWE A;  5ANQ A;  3UYJ A;  4BXF A;  4LXL A;  5FPA A;  2GP3 A;  2Q8D A;  4AAP A;  5ISL A;  5FZB A;  5FP4 A;  5LY2 A;  5FZ1 A;  2XXZ A;  5IVF A;  5F32 A;  5A7W B;  4GJZ A;  5FYC A;  2PXJ A;  5FZE A;  3AL5 A;  5FZC A;  4C8D A;  5F3E A;  5FZA A;  5E6H A;  5FY8 A;  4XDO A;  5FYV A;  5LW9 A;  5F5A A;  5FY5 A;  5FP8 A;  5FZ0 A; 
#chains in the Genus database with same CATH topology
 3IAQ A;  1P8J A;  3MUY 1;  1EPZ A;  5FZ4 A;  4AK3 A;  2BVB A;  1AJK A;  4JKM A;  3UGG A;  4QT6 A;  3NV4 A;  1OLM E;  4YNI A;  4F3J A;  1G9C A;  2WAO A;  4F83 A;  3TBD A;  2VTX J;  3B94 A;  5FZO B;  2VMC A;  4PI2 A;  3WEZ A;  4YAR A;  5KHK A;  1RJ8 A;  3ZSE A;  1LHV A;  1RUE 3;  1UOF A;  4HKW A;  1AL2 3;  2W0X A;  4LKD A;  5GLU A;  3T0B A;  4LEJ A;  5KXB A;  2HWF 2;  4FPO B;  2D6O X;  2XKP A;  1G9B A;  1RL3 A;  2XHN A;  1GQG A;  3EO6 A;  3MF9 A;  2GND A;  4YVS C;  3WW3 A;  4Q4X 1;  2Q1M A;  1R08 2;  4XJ9 A;  4LKE A;  1W8U A;  3M3O A;  1VBB 3;  4LKF A;  3KQ4 B;  2P3I A;  3O0W A;  1LR5 A;  2ZAA A;  2H0V A;  3AMP A;  4AHX A;  1WUV A;  4JTO A;  2ZEW A;  3ILN A;  3T08 A;  1U5X A;  1NOV A;  4L8Q A;  5J3U A;  4TXW A;  1PO1 1;  3H7Y A;  3AKQ A;  3RNS A;  3H1M A;  3THP A;  1V6M A;  5FJH A;  2Y6L A;  3J26 N;  4M0H A;  4RHV 1;  3SIT A;  4DIN B;  4E4H A;  5JIU A;  1D2S A;  4IEU A;  2VVE A;  5CZK A;  1W2N A;  2Z42 A;  4A45 A;  1UMZ A;  2D6K A;  2V4V A;  2W5F A;  4N43 C;  4MGY E;  4PBP A;  1LEC A;  4AOC A;  4DFS A;  3ZN4 A;  3MID A;  1WCQ A;  2K2S A;  4AQT A;  1DP0 A;  3WDX A;  1IOA A;  5EJ3 A;  4IE0 A;  4FT8 A;  4EZH A;  2D97 A;  1R64 A;  3ZSM A;  1KFU L;  1N1V A;  3LFI A;  5IWF A;  3VD9 A;  3VKL A;  2BP6 A;  2RS3 1;  3VD4 A;  1US3 A;  3KQR A;  5EJZ B;  4QWN A;  3I2J A;  4IGO A;  2D3R A;  3IIA A;  5J48 A;  2FMY A;  1ZBA 1;  1DQ6 A;  1DQ1 A;  1XBF A;  2CWM A;  2JIJ A;  4OLL A;  3OGR A;  1MZ5 A;  4HT1 T;  1EYB A;  3A7Q A;  5AVP A;  1S55 A;  2WNU B;  3E5U A;  3E6D A;  1GP6 A;  4LLO A;  4Y24 A;  1UO9 A;  1NCQ B;  1FV2 A;  4UI9 L;  1ENX A;  3AKT A;  1W06 A;  2XJP A;  2YY1 A;  3OY8 B;  2IXC A;  1V9U 2;  1UZW A;  3IKW A;  3OD4 A;  1QQP 3;  1O3T A;  5GLT A;  4COV A;  4DUX A;  3TN9 2;  4XJA A;  2QQV A;  3OTF A;  5LA2 A;  2D6M A;  2DF7 A;  2KR2 A;  2RM2 3;  1W0O A;  4YG6 A;  1XNT A;  3VHO A;  4NRQ A;  1PK6 C;  4EWA A;  2GSY A;  3WDW A;  3SKJ E;  1VAM A;  1SFN A;  4AGR A;  3APB A;  3IBM A;  4H2A A;  5FZE A;  4JTN A;  1S0I A;  3W58 A;  2AEN A;  3FHQ A;  2HWE 3;  4J25 A;  4NHX A;  1SDW A;  2QUO A;  4MHR A;  1DGL A;  1VBD 3;  2VUL A;  4K3U A;  4QX1 A;  4BK4 A;  2E6V A;  2AEZ A;  1QJY 3;  1JMU B;  1D4M 3;  2P37 A;  4C0H A;  2GH8 A;  3WDU A;  1ENR A;  1IQD C;  4P08 A;  5FP8 A;  2DDU A;  2HWC 1;  1DCS A;  3OYW B;  2WNU A;  1VMF A;  2LRO A;  1W8F A;  2FCT A;  1NCQ A;  1HV0 A;  2UU8 A;  3WG3 A;  1ULD A;  3H1Y A;  2V72 A;  2SLI A;  2OT7 A;  2A75 A;  2ZEZ A;  3E5X A;  2GH2 A;  1F31 A;  1ALY A;  2NMN A;  3OY8 A;  4CCM A;  4E8C A;  3PVN A;  1FX5 A;  1Z7S 2;  3UNP A;  4Q4W 3;  2NP0 A;  3BN6 A;  2QQM A;  3HWJ A;  5LB6 A;  3ZYJ B;  1SMV A;  4AAX A;  3UKN A;  2KM2 A;  1PGW 1;  3BB6 A;  5B4X A;  4CEY B;  3RGB A;  1QEX A;  2OUJ A;  1WMF A;  1MQT B;  4J6G A;  2QQL A;  4Q29 A;  4QXH A;  2XJQ A;  2ZKN A;  1R1A 3;  3VL8 A;  4EN8 B;  2ZGM A;  1ST8 A;  4ATF A;  2E63 A;  2QDN A;  2CAV A;  2WS9 2;  3T3Y A;  2JDZ A;  3D0S A;  3WF2 A;  2BGO A;  4IES A;  1HRV 2;  3PTR B;  3USS A;  1VIW B;  2Q8E A;  4JX0 A;  4HKL A;  3T2T A;  3AP5 A;  3AYE A;  4IE4 A;  4ORF A;  5D8A C;  3WG1 A;  2VME A;  4YZ2 A;  3O1R A;  1RUC 2;  3OYW A;  2XJU A;  2MEV 2;  3LGR A;  3M70 A;  2B4K A;  1OOP B;  4GMP 3;  4Q8L A;  4RN5 A;  4WM7 A;  2BBV A;  3HBK A;  2BNN A;  1EV1 3;  5J09 A;  5J7M A;  2WZP P;  4DQA A;  1T6B X;  4WBB A;  1PMJ X;  3N9M A;  4W8J A;  3GDB A;  4RFT 0;  3ZR5 A;  4CDX B;  4K8F A;  2CWS A;  3ECQ A;  3ILR A;  2ZGO A;  3I3M A;  1X82 A;  3VDD C;  2W95 A;  1GNH A;  2XON A;  3VZL A;  2WQZ C;  5GZF A;  2WO7 A;  5I8S A;  3L9J T;  1CJD A;  2W87 A;  4Q4Y 2;  2JD4 A;  1PZ8 A;  1OA2 A;  2JXA A;  1UMH A;  1QNW A;  2OW4 A;  2W47 A;  3BYW A;  1HB4 A;  4QQP A;  4QX3 A;  4WZF A;  4B8E A;  5JXG A;  1RUD 2;  4AXO A;  3D5O A;  3IDA A;  3LEG A;  4U2A A;  1W6Q B;  5IAX A;  3BOP A;  1S0J A;  5LEJ A;  3KV4 A;  4ET7 A;  2P6H A;  3HVD A;  1WD4 A;  5C8C C;  1F8V A;  1JS9 A;  2BBA A;  4CDU B;  1OOP A;  4H14 A;  1TME 2;  2QJV A;  4DY3 A;  1WLT A;  1VRH 3;  4HPK B;  4BOW A;  4I3P A;  1AYN 2;  4IV3 C;  3I8T A;  1RJ7 A;  2R06 3;  4CDX A;  1FMD 2;  1REE A;  5DAV A;  2VQ0 A;  4UT5 A;  4A3Z A;  4UFL A;  4CU8 A;  3RMX A;  1HXS 2;  2EF6 A;  2H6C A;  4LK7 A;  2XBO 3;  4QX5 A;  3I49 A;  3RG0 A;  3FJS A;  5CIR A;  3IPV A;  3PIG A;  2PLV 2;  1C4R A;  1YC6 1;  4PQQ A;  1JXN A;  3KCY A;  4BB3 A;  4DEQ A;  3AXE A;  3M3I A;  4OI2 A;  4XTM A;  5C3O A;  4UW3 A;  5GZG A;  2DYC A;  4UYB A;  4Y5S A;  1D4V B;  3G7D A;  2D43 A;  1JYC A;  2ZS6 B;  1L7L A;  2JIC A;  4AAP A;  3THT A;  1H4G A;  1W6Q A;  2VQA A;  1A6C A;  1UU5 A;  4HVR A;  4YM0 A;  1PVC 1;  4BH9 A;  5EV7 A;  1YFX A;  4GJZ A;  1RUH 1;  4YM2 A;  1N1S A;  1MS8 A;  1QJU 3;  1RUJ 2;  1UZZ A;  2VNV A;  3K4D A;  3BOD A;  4CDU A;  3UKV A;  2VMH A;  3B69 A;  2VUD A;  2VVF A;  3CJX A;  4PIZ A;  4NIA A;  3W9A A;  3WD5 A;  1K5J A;  1SLB A;  4HPK A;  1Q56 A;  1VAL A;  5A70 A;  1JW6 A;  4HOO A;  3VHP A;  4YM3 A;  3S5A A;  4F8A A;  2VBD A;  2X09 A;  2YFU A;  2UY8 A;  3IM0 A;  4COW A;  1XYP A;  5DG1 A;  1HRI 2;  4NRP A;  5FZ9 A;  1QXJ A;  5IK7 A;  5LA0 A;  3AFK A;  2OKX A;  1WLW A;  1NQD A;  3VV1 A;  1XQN A;  1QY4 A;  1H4H A;  1H1I A;  4MGT A;  3LCP A;  2D3P A;  3N9P A;  4AFA A;  5H9R A;  2WZR 1;  5A33 A;  5IVC A;  1DDL A;  1LOA A;  4QX8 A;  2V4A A;  1UKR A;  4LBJ A;  2FZ1 A;  2VZQ A;  2XG3 A;  1J59 A;  5HPO A;  5LBF A;  1F4A A;  2C1F A;  1YFU A;  5DDJ 3;  3VKM A;  2VC9 A;  3PUQ A;  5G04 L;  4OQ8 A;  5FZK A;  1APN A;  1UN1 A;  1K42 A;  1AR8 1;  5KHI A;  1WCK A;  2ZGL A;  1QDO A;  1WW5 A;  2XDV A;  1DQ5 A;  5FZ3 A;  1QOO A;  4D6Q A;  4RS5 C;  3U4S A;  1W99 A;  3WR0 A;  1COV 1;  1LJ7 A;  5JXJ A;  5C3Q A;  4GH4 C;  5DMY A;  2GC2 A;  1ULO A;  5LAS A;  3WP5 A;  5A1A A;  1GNY A;  5A7O A;  3T2P A;  5FK8 A;  3CDZ B;  1J83 A;  3ETQ A;  3IT8 A;  4MXV A;  3ZDS A;  3NNL A;  4H7M A;  3MW3 A;  2PMW B;  4UOJ A;  1AR6 3;  4YLZ A;  5FLJ A;  1FPN 1;  4LNV A;  4MGI E;  1GWM A;  4UFJ A;  4ZZ8 A;  3JU9 A;  4XXA A;  3GJB A;  3ST7 A;  3C2U A;  3UJQ A;  1ASJ 2;  3H50 A;  1SFY A;  2CDP A;  2BQP A;  2GC3 A;  1NZI A;  3OGV A;  4NAO A;  1CZS A;  3ACI A;  4H3W A;  4FFG A;  1RGS A;  1YEW A;  4I0A A;  4NUB A;  5ERL A;  1HLC A;  1YQ8 A;  2RR1 1;  4KU7 A;  3POY A;  2G9F A;  4UFK A;  4HLT A;  5T54 A;  2X29 A;  4D0Q A;  5A6Y A;  1S2E A;  1UAI A;  2WWS A;  2OZJ A;  2WA3 A;  2ZBJ A;  4GKX A;  5K8S A;  3J7N A;  2GMM A;  4RGK A;  3THC A;  1Y3T A;  1KS5 A;  2ES3 A;  4IEY A;  3FUO A;  3ORJ A;  4DMI A;  4HL0 A;  5I93 A;  1G8W A;  2W92 A;  1VBA 1;  4IEP A;  2VW1 A;  1D7P M;  4JQR A;  1W9W A;  1PIV 1;  2J1U A;  1FYU A;  1BJQ A;  3BOW A;  4WVM B;  5AFE A;  1IHM A;  3MYX A;  2VH9 A;  3WW1 A;  5IUQ A;  3BI3 A;  4BQ1 A;  1LRH A;  1IG3 A;  5D21 A;  2YPJ A;  3RVH A;  1MR5 A;  1YO8 A;  5ANQ A;  2FDF A;  1PNG A;  4GIQ A;  3MF6 A;  4HET A;  1KFX L;  3C3V A;  2A3X A;  4YGB A;  3WDT A;  1JYI A;  2QQN A;  3NAP C;  5ISL A;  1RUF 3;  2ET1 A;  4D7T A;  1OHF A;  1UF2 C;  2K0G A;  5E89 A;  1SG3 A;  4COZ A;  4AI1 A;  4OI0 A;  4M4R A;  3MZH A;  3AL5 A;  2HEY F;  2ZGQ A;  3SH3 A;  1UY3 A;  4ASM B;  2YXS A;  2WL1 A;  3EJK A;  4OCT A;  4YRD A;  2GMP A;  2HBT A;  4BK5 A;  2JE8 A;  2WUH A;  5FYV A;  2JG9 B;  4Z92 B;  1GP4 A;  1SAC A;  2QE3 A;  5FFO C;  2PN5 A;  3MPP G;  3ZXE A;  2O1Q A;  1GAN A;  3HIF A;  4Q0U A;  3LF7 A;  4BDV B;  5J98 B;  2QQP A;  4CP2 A;  3Q8E A;  1IGO A;  1QF3 A;  4WVM A;  4L99 A;  2RDS A;  1W8Z A;  2WII B;  4QDS A;  4Q8K A;  2VZ1 A;  1EAH 2;  3NST A;  4QB2 A;  1PO1 2;  3AJY A;  2A6Y A;  4IEV A;  3OBZ A;  1R1Z A;  2AC1 A;  3POW A;  3MIH A;  3CBN A;  4XF1 A;  5A7Q A;  4RHV 2;  1FNZ A;  2VMI A;  1TMF 2;  2VZU A;  3GCX A;  2R04 3;  4Y26 A;  2YBP A;  3ZPO A;  2A6X A;  4OUM A;  2H0B A;  1GZW A;  1C8M 2;  1W0N A;  4CRQ A;  1K5M B;  3PUH A;  2XVK A;  3A22 A;  2YYO A;  5JXI A;  3WIN E;  3KV9 A;  4Q0P A;  4QD2 A;  1DLC A;  1CAV B;  1NZC A;  1OH4 A;  3BUC A;  2OPK A;  1O8S A;  1D2Q A;  1JH5 A;  3HNM A;  3ZN5 A;  5I0T A;  1V9U 1;  1ULF A;  3EHK A;  4EQV A;  4NMI A;  3N4M A;  4AQ2 A;  2LRP A;  2JB4 A;  3TN9 1;  1ZRI A;  2NN8 A;  2SBA A;  2ZX1 A;  1OLQ A;  1AXZ A;  1ZBA 2;  4YW5 A;  2J1R A;  4HG6 B;  5FYI A;  4LUM A;  4NID A;  1V00 A;  2G1M A;  2YRO A;  2LUW A;  4LBO A;  3I2G A;  5J36 A;  5JOX A;  4YGC A;  1UD1 A;  1GQH A;  4DS0 A;  1SBE A;  1NA1 B;  2HWD 3;  4QKD A;  5A32 B;  4XFH A;  3JBG 2;  4KWU A;  2X53 S;  1J3R A;  1W9T A;  1RUG 2;  1YUD A;  3SKV A;  3O1V A;  3OGG A;  4JV4 A;  3WY6 A;  5GZC A;  3H8U A;  2IXI A;  5BNO B;  3OPW A;  4QHO A;  4MH0 E;  3ZKY A;  3U0Z A;  2WLP A;  2VMD A;  1CAV A;  4BLJ A;  4FP3 A;  4P9L A;  1LAJ A;  4FFF A;  2OUH A;  4R9D A;  3JD7 2;  1VR3 A;  3N35 A;  2DTW A;  2VNO A;  4JAA A;  3B9I A;  1Z7S 1;  3AMH A;  3VHN A;  3ZYR A;  2DWR A;  2CSG A;  1G6N A;  3NVC A;  1ZBE 1;  2NM1 A;  2WNU C;  4FAG A;  5HCH A;  2BZD A;  1NCQ C;  3N9Q A;  3WP4 A;  4CU7 A;  3U78 A;  3M7A A;  2AAC A;  3LZZ A;  3SHR A;  3ENR A;  4CP9 B;  3M2M A;  3O1P A;  1GBG A;  2QQK A;  4QPI B;  4XFA A;  4Y1U A;  4AWD A;  1U0A A;  2HWC 2;  2A1X A;  4QQL A;  5A32 A;  3VBS B;  3CQO A;  5FZF A;  1YJL A;  2YGL A;  1CR7 A;  3ZFF B;  1UL9 A;  1S0F A;  1HDK A;  4E9K A;  1S0G A;  3BPZ A;  5BNO A;  1V6J A;  1IZ3 A;  5KBF A;  4RYD A;  4LO7 A;  3V0B B;  2A6W A;  3CZU A;  1VMH A;  1S4C A;  1UOB A;  2Q8D A;  4LHS A;  4B29 A;  5FZ1 A;  3WHT A;  2OYZ A;  3SLI A;  2RJK A;  4CP1 A;  3C7O A;  4E8D A;  1FNY A;  1PZ9 A;  1RYY A;  2HYK A;  2W91 A;  2YMZ A;  4DRR A;  2JG8 B;  3ZXD A;  1YQ6 A;  2XKO A;  5FY8 A;  3H42 B;  1W8T A;  3ELN A;  4XDO A;  4FFI A;  4XVH A;  3RJ2 X;  1JYV A;  5FKB A;  2ORZ A;  4XXP A;  3JQW A;  3WUC A;  2W1S A;  3GBW A;  1KXG A;  3D6E A;  4V1P A;  1DLL A;  1YNA A;  4CP9 A;  4QPI A;  5FY0 A;  3HPN A;  5FKC A;  4XUO A;  5BNP B;  4QDQ A;  4FPK A;  3VBS A;  5LCW L;  1LHO A;  5F5I A;  1LKN A;  4B1L A;  1F9K A;  2WZR 3;  3PU3 A;  4QAW A;  4CEY C;  4CXW A;  1MQT C;  1RUD 1;  5F8P A;  1PX4 A;  3RYK A;  3LQC A;  3SCH A;  4QPG A;  3DL3 A;  1SBD A;  1A34 A;  1W0P A;  3GBG A;  3UGH A;  1E5I A;  1GOF A;  2YU2 A;  5DXD A;  3GAL A;  3N7J A;  1GZC A;  1VB2 A;  1AYM 3;  1XE0 A;  3Q8B A;  2R6Q A;  1TME 1;  3LIG A;  1AR8 3;  2OS2 A;  4C90 A;  4IEZ A;  4ZXK A;  5JR2 A;  3NV3 A;  3WG4 A;  5C5T A;  1FMD 1;  3RYR A;  1COV 3;  1SEF A;  3W21 A;  5IVV A;  5FRE A;  1XNA A;  1HXS 1;  4Y5Z 0;  3ZLI A;  2QTW B;  4YW1 A;  5T5L A;  1W6M B;  3KD4 A;  3WW2 A;  1JZ2 A;  1YHF A;  2RVA A;  2PLV 1;  1GZT A;  4QPW A;  4HSL A;  4YZ1 A;  4CDX C;  2YZ4 A;  3WVJ A;  1NKG A;  5BNP A;  1C3H A;  5C9A B;  4OMD A;  5D1I A;  2WFF 1;  1BHG A;  1JU4 A;  3ATG A;  1XNC A;  3IN9 A;  4BQ4 A;  4XC9 A;  3AX4 A;  4D6R A;  1UW8 A;  4NAM A;  3WP6 A;  4EYU A;  3NJZ A;  4DXZ A;  1RUJ 1;  1VAV A;  4PF1 A;  2GC0 A;  3AZW A;  4Z82 A;  1IPS A;  4YW7 A;  4FPE A;  4CCK A;  2XUE A;  2MPF A;  3NJV A;  1HB1 A;  3FBM A;  3FX3 A;  3LE0 A;  3P3P A;  5FMB A;  2BGC A;  2HBU A;  3MLK A;  1W6M A;  2BOJ A;  4XET A;  4CDU C;  2HWF 3;  2KD7 A;  2VW2 A;  1G9A A;  3OJB A;  4F7Z A;  3SH4 A;  3WZ1 A;  3BU0 A;  1BK1 A;  3O0V A;  3VBU B;  1PMH X;  4RGG A;  1OA4 A;  3FLP A;  1GU3 A;  1AX2 A;  1PVC 2;  1XNB A;  4OHX A;  1WBL A;  3A4U A;  1R08 3;  1RUH 2;  2V5D A;  4N53 B;  4BIS A;  1WCD J;  5C9A A;  3MFC A;  5HCF A;  1UU4 A;  1QIQ A;  1H8T B;  4OI1 A;  2LAL A;  2ADE A;  3KB5 A;  2PHL A;  3MFA A;  2IFR A;  3OPZ A;  4Q4V 1;  3O1U A;  3CZJ A;  1HQL A;  2JDK A;  5IAT A;  3RZZ A;  1FT9 A;  1DF0 A;  2JEC A;  2OVU A;  1Q3E A;  2ZGT A;  2CDO A;  1OD5 A;  1AR7 1;  1URX A;  5FY7 A;  1HJG A;  4P00 B;  2UYB A;  1NAE A;  2GP5 A;  4OVE A;  3SEP A;  4DRV A;  1IPK A;  1YQ5 A;  1J84 A;  3AP4 A;  1KDM A;  4BXF A;  4KNC A;  1CPM A;  4YGE A;  5I0U A;  1T6G C;  5CAZ A;  4AHW A;  1O3Q A;  1KRI A;  2E7A A;  4TTG A;  3EMR A;  3NQH A;  5JOW A;  5GJ6 A;  3VBU A;  4DZG A;  3RRD A;  1LB2 A;  1YQ2 A;  3NV2 A;  1JZ8 A;  3DYP A;  3FMG A;  4GB3 3;  5AFB A;  2WFP A;  4NE9 A;  3KHC A;  1H8T A;  2ENR A;  2Y64 A;  1OA3 A;  4PT6 A;  4R9C A;  4XUQ A;  4M01 A;  4OHZ A;  4K6B A;  2O8Q A;  1FAY A;  3ZPY A;  1QJZ A;  3ZXJ A;  5K4L A;  3KF5 A;  3WNL A;  2BEO A;  2R16 A;  4XE9 A;  1HX6 A;  3LEK A;  2CY6 A;  2CYF A;  1ASJ 1;  2JDA A;  3H0O A;  3H3L A;  3R4D B;  4QB1 A;  3VBH A;  3AYD A;  4P5Y A;  3ZXA C;  1Q8V A;  5K9Y A;  4FXK B;  3BPS A;  3AK0 A;  5F5C A;  3B9C A;  3DEM A;  1OLR A;  3AMM A;  2RS1 3;  1TE1 B;  2RG4 A;  1OBN A;  4FPL A;  4XUR A;  5T5O A;  1DG6 A;  3RPQ A;  3QOP A;  1BBT 3;  3BTA A;  1N3P A;  4H55 A;  1CZV A;  4JGY B;  1JI6 A;  1VAK A;  4LA3 A;  2YC2 A;  1SLA A;  1REF A;  2WWJ A;  2CU5 A;  2VUJ A;  4PIY A;  4QM9 A;  2WBK A;  3BU7 A;  3HN1 A;  4MHU A;  1QJE A;  1KIT A;  2JDN A;  3SC7 X;  1F2N A;  4A6O A;  4CEW B;  1MVQ A;  4YSF A;  1UY0 A;  1YFW A;  5I8T A;  3RYP A;  3IDC B;  2EIG A;  3NJX A;  4G3Y C;  4CCO A;  1ULC A;  2RR1 2;  1SQ4 A;  3WV6 A;  1NE4 A;  4HN0 A;  2ZX0 A;  4FFH A;  4Q27 A;  2A5Z A;  2Q30 A;  5TSW A;  2ZTN A;  4PCR A;  3WW4 A;  4BJ0 A;  5JMO A;  1JZ3 A;  5ACA 2;  4GD4 A;  5BUV A;  3TEY A;  1ZZC A;  5A3O A;  5DAQ A;  1VBA 2;  2XOM A;  4HK9 A;  1G86 A;  4AYU A;  5FO7 B;  4GJY A;  2QDR A;  2VU9 A;  1PIV 2;  3LWC A;  4XCA A;  5A7P A;  3RS6 A;  4JGY A;  2ARB A;  2BV4 A;  1Z7S 3;  4LT5 A;  5F3G A;  3OUH A;  1H1M A;  2WZE A;  4PF5 A;  4AEK A;  3VHR A;  1NT0 A;  1NYW A;  3A0N A;  4FCA A;  4PDW B;  3WNK A;  1AXY A;  5A3T A;  4LO5 B;  5LWB A;  1F4H A;  1STM A;  1A8D A;  1WWY A;  4CEW A;  1KD7 A;  4FAH A;  1X50 A;  3DPR A;  2LS6 A;  1CIW A;  2PHU A;  3AL6 A;  5A6Q A;  1EAH 1;  2C4X A;  5DQ0 A;  2WS9 3;  3B3Q E;  2WAA A;  4CYD A;  5LK5 A;  3U37 A;  5FO9 B;  2AYH A;  1HRV 3;  1CPN A;  3H3U A;  3HOB A;  5F6L B;  3ZDV A;  1TMF 1;  3POI A;  4URA A;  5F9T A;  4O7X A;  1POV 0;  3T4V A;  1NXM A;  2WT1 A;  4Y20 B;  5CKM A;  2D6N A;  3V64 A;  2G19 A;  4A7Z A;  1RUC 3;  5HV4 A;  2QBX A;  1C8M 1;  2ZGK A;  2MEV 3;  1BQP A;  3LA7 A;  5A6Z A;  4KG0 A;  4Y1V A;  1OMI A;  4LE3 A;  2RDQ A;  3KCC A;  3KM5 A;  2F4P A;  2JDH A;  5JPN B;  3HJR A;  4N9I A;  1H9P A;  3VBO B;  4K20 A;  4ZS2 A;  1IS3 A;  4PDW A;  4QHZ A;  1XRU A;  2BJS A;  4OUS A;  2GP3 A;  5D2A A;  4LE4 A;  3RDI A;  2FDK A;  1DQ2 A;  2JE7 A;  3OBR A;  4QGN A;  4BM8 A;  3ZXG A;  4L2N A;  3ZFE B;  2JG9 C;  4HK8 A;  2XJS A;  4Q4Y 3;  3VD7 A;  3VUO A;  4C8D A;  1C8N A;  3BVC A;  1O4Y A;  3MIF A;  4J1W A;  4JC1 A;  1PZ7 A;  1W9Y A;  4B1M A;  1OD3 A;  1V6L A;  1YLL A;  1UX6 A;  4P9G A;  3GHM A;  2ZEX A;  3HNB M;  3JBG 1;  4IND A;  1R09 2;  4GWJ A;  4Y20 A;  2BPA 2;  4IUG A;  1RUG 1;  2FD8 A;  2XB6 C;  1F5F A;  5FPZ A;  4P9W A;  3PJQ A;  2P3K A;  2QQW A;  4ZXE A;  2CL2 A;  1UMI A;  4NHL A;  5L7O B;  5IYY A;  3TEZ A;  1OVP A;  2W1U A;  4QX2 A;  2J1T A;  1AYN 3;  2VNR A;  2O14 A;  4TLF A;  4ZKT B;  5IHR A;  3NW4 A;  1POQ A;  4QDR A;  1O8P A;  4JDO A;  3VBO A;  2CGP A;  3JD7 1;  1GNZ A;  2VL4 A;  2XPJ A;  4MYE A;  1K5M C;  1LUL A;  3R6S A;  5I8Y A;  5FZ8 A;  3FFZ A;  2R07 1;  1S0E A;  3TRS B;  2PLV 3;  5E1R A;  5AVA A;  3OG2 A;  4EN6 B;  1L7R A;  1MS0 A;  2Y33 A;  4ZU7 A;  3ZFE A;  1JOD A;  4GQ7 A;  5SV5 A;  3FWE A;  1AUY A;  3K2O A;  3OGJ A;  4HBN A;  4XMI A;  4YZ3 A;  3R05 A;  4BQ2 A;  1IS4 A;  1VBE 2;  2CV6 A;  4R8H A;  1OF4 A;  1UPS A;  4M3C A;  2B9V A;  3WNM A;  1ZRR A;  3NL1 A;  1RXG A;  4AVC A;  4Q1R A;  1NY7 2;  4WM7 B;  4AQ6 A;  1RC6 A;  1RUJ 3;  4YW4 A;  4A7K A;  5A6X A;  1VMJ A;  5L7O A;  1AVB A;  1UX7 A;  3OF1 A;  4Q2F A;  2J1S A;  4UW5 A;  1CN1 A;  2RS5 2;  2YPD A;  1NA1 C;  5LZ6 A;  5EWS A;  1ZBE 2;  5FY9 A;  2B8M A;  3PMS A;  1QDC A;  1OPO A;  2Y6K A;  5A7S A;  4A44 A;  1VBC 2;  5FP3 A;  3HR9 A;  2NPI A;  3ZFG A;  2RMU 2;  5F37 A;  1UYZ A;  3VGI A;  1JYW A;  1RVF 2;  5BNO C;  4UBG A;  2O8O A;  1SLL A;  2VD7 A;  5FY5 A;  2ZAC A;  2YUE A;  3DEC A;  2QFE A;  3HQR A;  3NMB A;  4GWN A;  1RUE 2;  4MGS A;  3BKZ A;  3WF4 A;  2DBN A;  4D69 A;  2VVD A;  4LR4 A;  1HRI 3;  3FHI B;  5T3N A;  2WQ4 A;  1POV 1;  4V2W A;  2BFU L;  1SCS A;  2JE9 A;  4L0P A;  4MO3 M;  1S0B A;  2X5I B;  3KCX A;  5DUX A;  3B00 A;  4K21 A;  4GAL A;  1LOD A;  4FSJ A;  5FUP A;  3OCP A;  5G05 L;  1OC1 A;  3FLR A;  1GWK A;  2UY9 A;  2VZT A;  2OII A;  1HV1 A;  2ZX3 A;  1HN1 A;  1XPW A;  2VOX A;  3ASI A;  4QPI C;  1W8W A;  3I2F A;  4W6W A;  3WG2 A;  1DYP A;  3WP3 A;  1RIR A;  4YPJ A;  3BTZ A;  3VBS C;  2FDI A;  4HFS A;  4YZ5 A;  2D93 A;  2J7M A;  1ZA4 A;  3VBR B;  2BYV E;  3ZFF C;  1H6Y A;  2B9U A;  4YFZ A;  2R7E B;  1QNY A;  3IPV B;  5H9Q A;  4DUW A;  2Q1F A;  2W39 A;  4W6Y A;  1IQA A;  1QGL A;  4QX7 A;  3TEX A;  4XW3 A;  5KHJ A;  5LEK A;  3OEA A;  4KWJ A;  2Y34 A;  4CUA A;  2CHH A;  1XSQ A;  2ADD A;  2Y6H A;  1TQ5 A;  4ARY A;  2VO5 A;  3AZY A;  3RWN A;  1OFS A;  2JG8 C;  2X5I A;  1JHJ A;  4SBV A;  2JD9 A;  5FZB A;  4AI0 A;  1Y4W A;  3CO2 A;  4XAB A;  1Y7B A;  5A7W B;  3ETP A;  4BLI A;  3RZH A;  4LHL A;  1SCR A;  2Q5T A;  2ILM A;  1J1L A;  2JX9 A;  2ZGR A;  3EBR A;  2XLA A;  3AP7 A;  4LBK A;  3E5Q A;  1VJ2 A;  5GAL A;  5BNP C;  2ZZQ A;  3O1S A;  1ULG A;  1Q8O A;  1UPI A;  1XSR A;  3J7M A;  1PNF A;  2NLR A;  3I7D A;  3VBR A;  5K7P A;  1RXF A;  2X10 A;  4I2O A;  4TLG A;  1WW6 A;  5FBJ A;  2P6C A;  2VQT A;  3ILF A;  3K3O A;  3QH7 A;  3M4F A;  4CDW A;  5A3P A;  2X05 A;  4EV0 A;  2ARX A;  1IKQ A;  2CGO A;  4LHK A;  3WF1 A;  2GNT A;  1RUO A;  4JCK A;  1WLC A;  1X8M A;  1HW5 A;  1RMU 1;  2WLQ A;  5A3N A;  2WFF 2;  2YG0 A;  2WDB A;  4C1W A;  3VDB A;  1QQP 2;  2ZX4 A;  3U1X A;  2Z4F A;  4QQH A;  3I3Q A;  2ZHL A;  3WQ0 A;  2LM3 A;  5A33 B;  2W9X A;  4UWD A;  1W3V A;  4RQP B;  4OHV A;  1KS4 A;  4OUL A;  2DFB A;  5A7W A;  4BIO A;  3KV5 A;  4E27 A;  3K48 A;  4XFG A;  4B3N A;  3MLL A;  4M00 A;  4BQW A;  5FOB B;  3V0A A;  3M3Q A;  3PU8 A;  4KGG A;  4AZZ A;  3J4U H;  5C3R A;  1W8H A;  5C9A C;  1QJY 2;  1RIN A;  3BGA A;  4IE6 A;  1GR3 A;  5CA6 A;  1LTE A;  3POJ A;  5FYU A;  1LGC A;  1FOD 1;  2GC1 A;  4Q4X 3;  1D0H A;  2KA3 A;  1H2M A;  1TNF A;  4N7I A;  4WZC A;  3I3B A;  1XU1 A;  5FPL A;  4XJW A;  2PHD A;  5IK8 A;  5T52 A;  4Q4V 2;  4ASL A;  1ZZB A;  3B7M A;  1WW7 A;  3MW2 A;  2ARE A;  2PFW A;  4LIV A;  2CGN A;  2ZGU A;  1PO1 3;  2QCS B;  4RQP A;  3FHA A;  4QGL A;  4IQP A;  4NN0 A;  3BAL A;  1Q8S A;  1XNK A;  1AR7 2;  4N90 A;  4RHV 3;  1TMF 3;  2C0Z A;  3DV8 A;  3VBU C;  3LDK A;  3I2K A;  3I2D A;  1W03 A;  3PUA A;  1UZV A;  4N53 C;  5FXV A;  1C8M 3;  2VUC A;  1O91 A;  1H8T C;  2PYT A;  3AB0 A;  2B5H A;  4LO8 A;  5GLW A;  2WA4 A;  1ND3 B;  1W2O A;  3O5S A;  4CU6 A;  3JZV A;  4XJU A;  1MZ6 A;  2RS3 3;  5FY4 A;  4BCU A;  3MHZ A;  1UY1 A;  1UY2 A;  3ZMO A;  4QQO A;  3WT3 A;  5F3I A;  4I01 A;  1XC6 A;  1ZBA 3;  2DUR A;  3PTY A;  1BYH A;  1L3J A;  4AEM A;  1J1T A;  4AGV A;  4DPN A;  3O14 A;  3D8C A;  2XWB B;  3KGZ A;  2XR4 A;  4FPC A;  3DUI A;  5EXO A;  1PVX A;  3JBG 3;  3WQ7 A;  3CLP A;  3LEI A;  1O3S A;  5FP4 A;  2LTN A;  1RUG 3;  2Y38 A;  3NNJ A;  5LK7 B;  4NIH A;  5LBB A;  2Y0O A;  5EIY B;  4JHZ A;  3AKS A;  5F32 A;  4BZ4 A;  3QD6 A;  2DUP A;  4KWK A;  4IV1 A;  1DFQ A;  5ACA 1;  1FXZ A;  2FCU A;  5I0R A;  1ND3 A;  2BNM A;  3T30 A;  2HWB 1;  4BME A;  1UZY A;  1DZT A;  1VRH 2;  4Y1Z A;  3MV1 1;  2IXK A;  5FZ0 A;  3WF0 A;  1ND2 B;  1GKB A;  2D40 A;  3JCI A;  3QH6 A;  4XIO A;  2FZ2 A;  2VY0 A;  5HBA A;  3J9S A;  4QXC A;  1OQE A;  3UT0 A;  3WDV A;  4GAZ A;  2BNO A;  3PME A;  1NG0 A;  2XBO 2;  2C26 A;  2P4E A;  4XBN A;  5T50 A;  1LOG A;  1ZA7 A;  3AXD A;  3E6B A;  4JGY C;  3EXU A;  2XVG A;  5F3C A;  3W5N A;  1LNS A;  2ETE A;  2HWC 3;  4BQ5 A;  5DZE A;  1GZW B;  4HN1 A;  3N9N A;  3LOI A;  1X8E A;  3KF3 A;  1ZZ9 A;  1C28 A;  2UYA A;  4FPJ A;  4FOQ A;  4CEW C;  4IE7 A;  4Y4R A;  1O6U A;  4IXL A;  3WQB A;  3HQU A;  4P9Y A;  1AX0 A;  3RQ0 A;  1DBN A;  3ACF A;  2HLE A;  3AVS A;  2RDR A;  4RSU A;  4QX0 A;  3AKR A;  1H1A A;  3C7E A;  3J8F 2;  4MGK E;  1WW4 A;  1YQC A;  4HMZ A;  1VPH A;  3HMY A;  3WUD A;  1O5L A;  1VE0 A;  2PHF A;  3EYP A;  1KDK A;  4QB6 A;  1UOJ A;  1ND2 A;  4FOY A;  1QKQ A;  4KH9 A;  3FN9 A;  2YFZ A;  2ORX A;  4XHB A;  4DXS A;  3RZK A;  3OUI A;  4AI2 A;  4KQ7 A;  4Y1Y A;  2ZEY A;  4AHZ A;  1POV 3;  3IMM A;  3WCR A;  3MI8 A;  1N3O A;  2ATF A;  3BIE A;  1AR9 1;  1DYO A;  3RJR A;  3HEI A;  4PQ9 A;  5JWP A;  2VZS A;  1YWK A;  4PDW C;  2EAK A;  2HYX A;  4YVW B;  3C8X A;  3GF6 A;  4XPV A;  4L9B A;  2W1Q A;  5JI9 A;  1T2X A;  1F35 A;  5FK7 A;  2IVJ A;  4WVZ A;  3FZ3 A;  3SH5 A;  4EN9 B;  1ZRD A;  1R09 1;  1PM7 A;  2GAL A;  2JDM A;  5DAB A;  1JYX A;  2V09 A;  3UV9 A;  2TNF A;  4R4X A;  5GLV A;  3RI8 A;  1H2K A;  2K9Z A;  1Y9G A;  2L9L A;  5FPX A;  1QMJ A;  4IGQ A;  3D0J A;  3WQ1 A;  2VZR A;  1W6N B;  3S7I A;  1ZX5 A;  2XHK A;  3K3N A;  2J42 A;  2UWA A;  2WKK A;  2YGM A;  2AH2 A;  2ZPX A;  4FXG B;  2E51 A;  4COY A;  2PQS A;  1D0G A;  2A3Y A;  2A73 B;  3ZXF A;  2PHW A;  2JKB A;  2EAL A;  1PGS A;  2BWC A;  5KR7 A;  2ZAB A;  4Y22 B;  5L36 A;  4AFD A;  5FXX A;  3EB7 A;  1C5I A;  4FP2 A;  1OSG A;  5FZI A;  1JYT A;  4YVW A;  1A8M A;  4LK6 A;  2JKX A;  4Z8B A;  1V6K A;  3B5L B;  1VBE 1;  1NCR B;  3T2Q A;  1YXW A;  5C5U A;  1AR6 2;  1MEC 1;  2ZHN A;  1O7F A;  2H6B A;  4IEO A;  3UYJ A;  5C4W B;  3N7K A;  3ZFE C;  1NY7 1;  5FPA A;  2ERF A;  1LCL A;  3PNA A;  1GMM A;  1NUK A;  1W2U A;  1WMX A;  4IDZ A;  4QKB A;  4D8M A;  2IVI B;  2IXJ A;  2RS5 1;  3VZO A;  1W6N A;  3FLT A;  4O65 A;  2R07 2;  2VM9 A;  2V73 A;  2D7F A;  3WOG A;  2WNV B;  4K9S A;  4LMF A;  4DXR A;  3A21 A;  3RWK X;  1VBC 1;  3D3A A;  3GZT B;  1B09 A;  2RMU 1;  5BXX A;  1WGP A;  2JJ6 A;  1ZRF A;  5L7O C;  1RVF 1;  2ZAH A;  4YW2 A;  4Q0Q A;  4BQ3 A;  1RUE 1;  1LEM A;  1AL2 1;  2YBK A;  3ZN6 B;  2WIN B;  3MIE A;  1XE8 A;  5FDB A;  4DB5 A;  5HI0 A;  4QU2 A;  2I2S A;  1OUR A;  5FYH A;  5A3L A;  1PVC 3;  4Y22 A;  1RUH 3;  3PUI A;  5F7U A;  3GZA A;  5IVB A;  1V6I A;  2G9Z A;  4OHY A;  5FO8 B;  1OLM A;  2E7T A;  4QPG B;  1NCR A;  3KVA A;  2VJX A;  4MGZ E;  3Q8A A;  3BTY A;  3WNP A;  1MS4 A;  5C4W A;  4I30 A;  2Y8K A;  5A7N A;  1VBB 1;  4GZ9 A;  1S0C A;  4AI8 A;  2XLF A;  1CZT A;  1W8O A;  3ALQ A;  3BIW E;  4MGQ A;  2EXI A;  4B7K A;  4Y3O A;  2P34 A;  3ZYH A;  1QHD A;  4BE3 A;  2WNV A;  4CCL A;  1E5R A;  5HCB A;  1VLN A;  2J22 A;  3HBZ A;  1LOC A;  5A3W A;  2ID4 A;  3AKP A;  4WM7 C;  5CKN A;  2D3S A;  2CNA A;  4RA0 A;  4XF9 A;  2WO1 A;  1I5P A;  4YW6 A;  5SV8 A;  4HXC A;  3NV1 A;  5C3P A;  1NE6 A;  5GKA C;  5CFC B;  3NO8 A;  3PLQ A;  4R4Z A;  4AL9 A;  3ZN6 A;  2VBP A;  5IK5 A;  3Q9O A;  4LLF A;  4XBQ A;  2XJT A;  4XF0 A;  3NWK A;  4P9X A;  4JZR A;  1MZF A;  1RHI 2;  3AM2 A;  5L73 A;  3SCF A;  3LDB A;  1BCX A;  3B01 A;  1KGY A;  2VQU A;  3CHX A;  3OUJ A;  1WA4 A;  4UXA A;  4NIG A;  3M3E A;  4FOV A;  5FYZ A;  5IVY A;  3U07 A;  1NXD 1;  4DEV A;  4J1X A;  1BEV 2;  1NLQ A;  2JEM A;  4CCN A;  2VEC A;  4I09 A;  1X36 A;  2DU1 A;  2TBV A;  1V6N A;  1GZ9 A;  2I74 A;  2RJL A;  4FPF A;  1MVE A;  3P6B A;  4OZX A;  2X5I C;  3CJI B;  4CUB A;  5A3U A;  2OPW A;  2ZA9 A;  4KBB A;  5FXW A;  1E57 A;  3ZR6 A;  2OA2 A;  3KHB A;  1N3Q A;  3KWV A;  5FPB A;  1OOP C;  4EE2 A;  4KWL A;  1Q8Q A;  4AHY A;  2DUQ A;  1JZ6 A;  1DGR A;  1JOP A;  3M1H A;  3MGU A;  3OBT A;  4AVT A;  5BYN A;  5CFC A;  4D7Y A;  5F1R A;  1XOY A;  3I2O A;  3HN3 A;  4JRA A;  3W59 A;  4QKF A;  1FPN 3;  1QOS A;  3FE5 A;  2Z79 A;  4KI5 M;  1NQJ A;  3DCQ A;  3VBR C;  4PI0 A;  1N1T A;  2DCT A;  1QQP 1;  4PBO A;  3ZSK A;  5JOY A;  1W05 A;  4WVV A;  4ZON A;  4KBZ A;  3UL2 A;  5EHD A;  2VPV A;  2NQY A;  2RR1 3;  5C8C A;  5FAX A;  1JYN A;  3DGT A;  2E26 A;  2Q0A A;  4LBQ D;  4PLN A;  5FBZ A;  1LEN A;  4X6R B;  5EJ1 B;  1ODM A;  1PMI A;  4OFG A;  5L9V A;  2GDF A;  5FYT A;  3S30 A;  2W52 A;  4AEJ A;  4CUC A;  3CJI A;  5GM0 A;  2XGX A;  1UIJ A;  3GHN A;  3UKT A;  1WZX A;  2Y6F A;  4IEX A;  1VBA 3;  1QJY 1;  1RMU 2;  4I0W B;  1D4M 1;  3POG A;  1PIV 3;  2JDP A;  3VL9 A;  2BOI A;  4Y4Y A;  5LY2 A;  1YIF A;  2WJS A;  2WR9 A;  2YC0 A;  3C7F A;  3FL7 A;  4LOT A;  1AF9 A;  2PHX A;  1QU0 A;  1RIT A;  5DAP A;  5L9B A;  2G4I A;  3U11 A;  4W50 A;  5F3E A;  3VBF B;  1MS1 A;  1OKQ A;  3LEM A;  1DGW A;  3ACH A;  4PHZ A;  3RSJ A;  4Q4W 1;  1GUI A;  1W9S A;  2YHJ A;  1PHM A;  3H7J A;  3WSO A;  1CAW B;  1HB2 A;  3RZL A;  1WKY A;  1WMD A;  4FQZ A;  3U75 A;  4UW6 A;  3F2Z A;  3VBH B;  2QVS B;  3IWZ A;  2FBE A;  3OD0 A;  3ZMN A;  1R1A 1;  3MIB A;  4YWA A;  4TYS A;  1I1E A;  1HJF A;  1LGB A;  2PHT A;  3AJZ A;  5DAW A;  1FOD 2;  3K77 A;  3ME2 A;  1GIC A;  4LOS A;  4BWO A;  4RQP C;  5J96 B;  2Y0I A;  2ET7 A;  4IET A;  5AC9 2;  3GM8 A;  1DGR N;  4IEW A;  4YG3 A;  4AVB A;  3EQE A;  1JOJ A;  4ZU4 A;  2XWJ B;  4ERO A;  2YDE A;  1SBF A;  1WME A;  4YG0 A;  4B4Q A;  3OSD A;  2BFU S;  3AYC A;  5F39 A;  2D98 A;  4GMP 1;  2DCJ A;  4KGQ A;  1C1F A;  1UYY A;  1UU6 A;  4O9G A;  3ZM8 A;  3VBF A;  1S2B A;  4L97 A;  2JB8 A;  3LB9 A;  2FCV A;  3R0R A;  3VD3 A;  2D44 A;  1CJP A;  2XJR A;  5T55 A;  2D5F A;  1CAW A;  3LD8 A;  1AL0 G;  4DXT A;  4HON A;  3DXT A;  4A2U A;  5HXM A;  4LBN A;  3WXP A;  4L92 A;  2A71 A;  1XU2 A;  1Q43 A;  5H9S A;  3MO4 A;  2QQI A;  4AED B;  4C1X A;  4LHN A;  3T0D A;  5FIX A;  1Q8P A;  1QJX 2;  4FPY A;  3TNP B;  4XFI A;  1SPP B;  2P3Y A;  4QQ2 A;  4E2Q A;  4BQY A;  4NHY A;  2FQP A;  1H2L A;  5FUI A;  3B93 A;  4P02 B;  3G6J B;  2FHR A;  5C7G A;  3MBW A;  1IPJ A;  1V9U 3;  1AXK A;  1W6O A;  1X9T A;  2VOW A;  3PHM A;  5CG8 A;  4CE8 A;  2QKD A;  1G9F A;  3GGL A;  4RS5 A;  3TN9 3;  1XYN A;  2F4L A;  3MW4 A;  3SIS A;  5KHH A;  4XEZ A;  2WRA A;  3QAC A;  1KEX A;  4A7Y A;  3VZJ A;  5A80 A;  3S7E A;  2OQ7 A;  1VRH 1;  2ZHM A;  4ZPI A;  4XAE A;  5FZD A;  1BKZ A;  3OGS A;  4GKY A;  4CCJ A;  1BMV 2;  2GME A;  3DPR B;  1UNB A;  2RJ2 A;  2VGD A;  5CAD A;  3RZM A;  4H7L A;  2YB7 A;  4BYY A;  1ACC A;  1ND3 C;  2ZGS A;  5C8W A;  5APA A;  4MUV A;  2XBO 1;  5DN2 A;  4AED A;  4ASK A;  5C6C A;  5B2G B;  5HCA A;  4X8P A;  4NII A;  4DOU A;  5CG9 A;  3IZO A;  1PGL 1;  1VBE 3;  1UY4 A;  3WLU A;  1SPP A;  4QPY A;  2WSV A;  2XUM A;  2CAU A;  1QXP A;  1HN0 A;  5FPU A;  2BUK A;  2HWB 2;  3ES4 A;  3GZU C;  4I3G A;  3TOJ A;  2VZV A;  4JGZ B;  4XBL A;  5BY5 A;  2AZ5 A;  1RUI 2;  1Y9M A;  2RS5 3;  4Q0S A;  1ZBE 3;  2DFC A;  2E31 A;  1C57 A;  3KT4 A;  1QJU 1;  3LSE A;  1VBC 3;  3J8F 1;  3GCW A;  2RMU 3;  1HQW A;  4LO6 B;  2C6S A;  2VMG A;  3USU B;  4XOG A;  2W3J A;  4C91 A;  1RVF 3;  2ARA A;  2DV9 A;  2Q1Z B;  3ACG A;  4JKK A;  3T09 A;  3AC0 A;  1U5I A;  4YFW A;  4HKO A;  3M8L A;  1ZM1 A;  3IDB B;  4JRL A;  4XCB A;  3OBA A;  2FDG A;  1NX9 A;  3T1L A;  4MZU A;  1HB3 A;  1ND2 C;  2EVX A;  5KWR A;  2BGP A;  1DZR A;  4QXK A;  5BNN B;  4NVP A;  3NAP A;  4R9A A;  3JB4 C;  5LW9 A;  3A0K A;  4UFI A;  5CYY A;  2R0H A;  3JQX A;  1DZQ A;  2ZHK A;  3GNE A;  3P1I A;  5FYB A;  1I5Z A;  2G9G A;  3IMN A;  1W39 A;  4FTS A;  4CU9 A;  4JGZ A;  3LPF A;  2EAA A;  2D6P A;  2BW8 A;  1S1A A;  3CNA A;  3AP6 A;  3VLB B;  4M4P A;  4OUE A;  1C1L A;  4DO0 A;  1W8N A;  2B39 A;  2QQU A;  4JKL A;  1SHW B;  3AMQ A;  2DVD A;  2VAU A;  4NPM A;  5FZO A;  3USU A;  3ZIW A;  1WCS A;  4AVS A;  1AR9 2;  2BVV A;  5DDJ 1;  3DF0 A;  1LHU A;  5C33 A;  3ITQ A;  1NLR A;  1PO2 2;  1UQX A;  2XQX A;  5JPM B;  3DXU A;  3ZYB A;  2N7G A;  2IXL A;  4D7S A;  5I0S A;  1RUD 3;  3N9L A;  1AZD A;  5JZG B;  4M3C B;  5KHG A;  3L2Y A;  1LOB A;  3ZXK A;  5BNN A;  4OI4 A;  4DIQ A;  1MS3 A;  5KC6 A;  3K4Z A;  4XFC A;  4OQ9 A;  4GB3 2;  3OEB A;  1TME 3;  1O4T A;  1I6X A;  5K0U B;  5DUU A;  4L11 A;  4WVW A;  1AR6 1;  4ES8 A;  2VZ3 A;  3R4U A;  3FUQ A;  5DUV A;  5FYM A;  1FMD 3;  3U14 A;  1MAC A;  4NHM A;  3ZFG B;  1VRB A;  2A6V A;  4BIF A;  2QZ3 A;  1HXS 3;  3ACL A;  4YVW C;  5JLV A;  3H8X A;  3FC0 A;  3V65 A;  2R49 A;  4FTB A;  4A3X A;  1O59 A;  4QHB A;  1X9P A;  4TSV A;  1UOG A;  1GYK A;  5ABJ B;  5DAX A;  5FMC A;  1CON A;  1OPM A;  1YI9 A;  1GFF 2;  4MET A;  2RS1 2;  4XQ4 A;  2ZOE B;  2NMO A;  4ZHN A;  1LOF A;  1BBT 2;  2VR4 A;  5KXE A;  3R4S A;  1UXZ A;  3AMN A;  4GUL A;  2WFF 3;  1XND A;  4XJ8 A;  1SDD B;  3AZZ A;  4K7J A;  1VB4 A;  2PAE A;  5JZG A;  1MEC 2;  5FYS A;  3KGL A;  2ZML A;  3P3N A;  2Q8O A;  5FZL A;  4FQ4 A;  2WYS A;  2ZZJ A;  4RD7 A;  5IFT A;  1YYN A;  1XXN A;  5K0U A;  4EJR A;  5JSO A;  1DHK B;  2VXR A;  2UUR A;  5FY1 A;  4XIL A;  5LY1 A;  3SXW A;  3INA A;  2WN2 A;  2EIE A;  3GBF A;  4XF4 A;  5I91 A;  2JDY A;  4XZU G;  1QH6 A;  5LAT A;  1BXH A;  2IUW A;  3I54 A;  4KU8 A;  5FMO L;  5DUW A;  5CIS A;  2E33 A;  1NCR C;  2EXK A;  5ABJ A;  5CEH A;  2W1W A;  1RUF 1;  3SQO A;  1AL2 2;  1MZE A;  4BMB A;  2VNG A;  3CU7 A;  5C4W C;  1W90 A;  3QCW A;  3VZM A;  3TNQ A;  3K51 A;  5F6K A;  3B02 A;  2Q8C A;  2HKX A;  2J1A A;  5F2W A;  1MS9 A;  3V56 A;  4KL1 A;  1W04 A;  4Q4V 3;  4Z2A A;  5IK4 A;  2WNV C;  2EXH A;  4CDQ B;  4S2D A;  3HT2 A;  1VBB 2;  4XJZ A;  5IT6 A;  1H9W A;  1RHI 1;  4CXX A;  4CVU A;  2ZX2 A;  2VTX A;  4K8R B;  5JSP A;  1AR7 3;  3ZIX A;  2ZGN A;  4LBQ B;  4R9B A;  4I02 A;  2PTM A;  1FV3 A;  1HQN A;  4XFF A;  1OKO A;  1GOH A;  2WT0 A;  4NR1 A;  1BEV 1;  3POE A;  1H6X A;  4JQT A;  2NZ9 A;  5F5A A;  2RDN A;  1QH7 A;  1E5S A;  4QPG C;  1U5Y A;  2R04 1;  1C5H A;  5DG2 A;  3TWI A;  4CDW B;  4LKS A;  4URT A;  4ZU5 A;  3E6C C;  4LPL A;  4ISQ A;  2OQ6 A;  1HIX A;  1CGP A;  4FI9 A;  3NNF A;  3UET A;  2A7A A;  1ENS A;  2UWB A;  3JUU A;  3BTX A;  1AX1 A;  4UF0 B;  5CKQ A;  5DZF A;  3WNN A;  2P5B A;  4CDQ A;  2E7Q A;  1XYO A;  3KZ4 C;  2D5H A;  5JIA A;  4CEY A;  2VCM A;  1M06 G;  1ASJ 3;  1S0D A;  1MQT A;  1JOB A;  1TZO A;  2VCB A;  1E5H A;  3P5B A;  5HXV A;  3V0A B;  5CFC C;  4LBQ A;  3X29 B;  3VDC A;  3C7H A;  3SMH A;  1JZ4 A;  4CTE A;  2PHR A;  1A78 A;  1W6P B;  4S2H A;  4NJ4 A;  5FUN A;  4AFC A;  4D94 A;  4FTE A;  5C70 A;  2R1D A;  4LQR A;  4MSV A;  4OMC A;  5L9R A;  2XL7 A;  2HWD 1;  4O61 A;  4JDM A;  1OT5 A;  3AVR A;  3III A;  3AYA A;  3CF6 E;  1OH3 A;  2RV9 A;  3RZJ A;  4YYO A;  1JZ5 A;  5FZM A;  3UK9 A;  4QKN A;  1UIK A;  2NYY A;  1HKD A;  1Q5O A;  4FBF A;  3LOB A;  5GZE A;  1I3H A;  3IAP A;  1NLS A;  2B42 B;  2V5Y A;  3CJI C;  1BZW A;  4UF0 A;  3KMH A;  2RM2 2;  2W94 A;  4IER A;  2WT2 A;  3WX5 A;  2WO3 A;  3H8O A;  5IJR A;  4CCD A;  4XTP A;  4QU1 A;  1ODN A;  5FZH A;  2R30 A;  3VB9 A;  3SEE A;  2WO2 A;  5JMC A;  2VE1 A;  5BNQ A;  5IVJ A;  4MX3 A;  2HWE 2;  5JDB A;  2W08 A;  3D4K A;  3S5Q A;  1VBD 2;  1W6P A;  1IS5 A;  3PL0 A;  3ZOI A;  4U36 A;  1VP6 A;  1D4M 2;  2EIB A;  5T5P A;  3AP9 A;  1XJA A;  2HEW F;  4NPL A;  1JHN A;  2PEL A;  2I45 A;  2XL9 A;  5FV3 A;  1OXC A;  3LFM A;  5LRR A;  5AC9 1;  1EPW A;  1PM4 A;  1LES A;  3Q8F A;  2W68 A;  3J8F 3;  1H0B A;  4IL7 A;  4MXW B;  1YFY A;  4W4Z A;  4YW3 A;  3VDA A;  1ZRE A;  1EY2 A;  2WSU A;  4Q4W 2;  5IFP A;  4EN0 A;  3NRU A;  3DKW A;  2F6B A;  5FJK A;  5C3S A;  4UW4 A;  1EAH 3;  5GLZ A;  5J37 A;  1L7Q A;  1Z78 A;  2BTV C;  1B35 B;  1CAX B;  2BRT A;  4KG8 A;  3ZX7 A;  5FLH A;  3M3C A;  1R1A 2;  2DUO A;  3GZE A;  4Q5O A;  3U10 A;  5CFD B;  2DVA A;  4GA9 A;  1JU3 A;  2WWU A;  5FWE A;  2QQJ A;  3J7L A;  3T2O A;  3C7G A;  5ANN A;  2A6Z A;  4FVV A;  4IE5 A;  3ZYP A;  1DYK A;  2J1V A;  3NKG A;  2YC4 A;  3VBF C;  4JVA A;  1QJX 1;  1F5J A;  1TNR A;  2DCK A;  4IV1 B;  3VKF C;  2QQO A;  5IVF A;  2PAK A;  2C24 A;  3SCG A;  5I0D A;  2Y60 A;  3E1F 1;  4LO4 B;  3VBH C;  3I3E A;  4P14 A;  3IDE A;  2GNM A;  1EV1 2;  4K40 A;  2P2K A;  4RR3 B;  5E88 A;  4MXW A;  5IAV A;  1AHS A;  4IEQ A;  4YGD A;  2AGS A;  3KS7 A;  5LA9 A;  3I4I A;  3KVB A;  5EPA A;  1ZZ8 A;  5LBE A;  4WM8 B;  4DUV A;  1AYM 1;  3TYJ A;  4ITC A;  4ES9 A;  1DQ0 A;  1RB8 G;  1O5U A;  1B35 A;  1CAX A;  2WZ8 A;  4LJH A;  2IFW A;  1J3Q A;  1YIP A;  1TEI A;  2VCA A;  1LED A;  1YRZ A;  1BMV 1;  5T5J A;  2R32 A;  1WD3 A;  5CFD A;  4GXL A;  2JDU A;  2VW0 A;  1EP0 A;  2VCC A;  2GZW A;  4AI9 A;  4PLO A;  3KT7 A;  5FOJ B;  1GOG A;  4ATE A;  4BA6 A;  3POF A;  3LKJ A;  3MLJ A;  1N47 A;  3ZSL A;  2OX0 A;  4IGP A;  4R52 A;  1UKG A;  2C5D A;  2P17 A;  2IXH A;  3TB0 A;  1IG0 A;  1GWL A;  4PLM A;  1UWW A;  5FPV A;  4CUG A;  2QNK A;  3KSC A;  1XB9 A;  2FDJ A;  4BXS V;  3JD7 3;  3KV6 A;  1V0A A;  3KT1 A;  4M3C E;  1ZVF A;  3GYD A;  4RR3 A;  4AED C;  4ZZ5 A;  1S2K A;  2IZW A;  4A41 A;  2VZO A;  4YVS B;  1RUI 1;  2R06 2;  5FLI A;  1XE7 A;  2EA7 A;  2O0O A;  2R07 3;  4RGA A;  1YJK A;  2AR6 A;  1WLD A;  2VZP A;  1CWP A;  4WM8 A;  1PX3 A;  3H1W A;  1LOE A;  3LPG A;  1SLC A;  5JVV A;  1JZ7 A;  2WYF A;  2W2I A;  1J3P A;  2OXB A;  4BPZ A;  3VKO A;  5FMD A;  2LW8 A;  4UAP A;  3MDP A;  1PGL 2;  4LTA A;  1OQ1 A;  3ZO0 B;  4EZ4 A;  2XH6 A;  2EID A;  4BU2 A;  3ZKU A;  1U5Z A;  2HWF 1;  4AW7 A;  3PUR A;  1CX4 A;  3K46 A;  1BVP 1;  1DIW A;  3ZYI B;  3O1O A;  2UWC A;  4AVV A;  4E4D X;  3DPR C;  4Z2W A;  3THD A;  2P3J A;  1GV9 A;  3POS A;  3VN4 A;  4GWM A;  1MS5 A;  1R08 1;  1UYP A;  4N43 B;  1LU1 A;  1QJU 2;  5DPN A;  4RL7 A;  1CQ9 A;  4AG4 A;  4ZY9 A;  5L19 A;  1O3R A;  1KJL A;  2D6L X;  4MLO A;  4MOA A;  3T1M A;  2XLG A;  1CAU B;  5F2S A;  5FQ0 B;  4FO9 A;  4BHP A;  1OUX A;  4QGM A;  2A3W A;  4N7U A;  4YVS A;  4XUP A;  1BLZ A;  4RFR B;  3N7M A;  3Q8C A;  2VXJ A;  3OPT A;  3UES A;  3LAG A;  4XHX A;  2ZXQ A;  4OHW A;  3CL1 A;  1US2 A;  4JGZ C;  5CVR A;  3F95 A;  3PVO A;  4KMQ A;  2DCY A;  1GSL A;  2AUY A;  3DKQ A;  4FOW A;  4Q4X 2;  1PO2 1;  3O1T A;  2EIC A;  3H9A A;  5EYY A;  2IC1 A;  1UCX A;  2GAU A;  2Z5W A;  1RHI 3;  2DVB A;  4K1Y A;  4V2V A;  2X8K A;  3MV0 1;  2PA7 A;  3J7H A;  1IS6 A;  3MEP A;  2Z2S B;  3AFG A;  4NOT A;  5A1F A;  5LRS A;  4CXY A;  2FDH A;  3VZK A;  5FP9 A;  2DVG A;  4N43 A;  4GB3 1;  3W20 A;  1DQ4 A;  1BEV 3;  3SNM A;  2DBI A;  1OUS A;  2BU9 A;  2XQR A;  4LXL A;  2WNE A;  1CAU A;  5FQ0 A;  3DYM A;  3FBY A;  5JSR A;  1ZNP A;  1QJF A;  2XXZ A;  3N3H A;  5DDJ 2;  5BNN C;  1FAT A;  5KXD A;  2PXJ A;  1PK6 B;  5M0T A;  1W9F A;  2VOT A;  5FZA A;  5BV6 A;  2JWP A;  5BPX A;  1SFP A;  2FMD A;  2RS1 1;  4LA2 A;  2DVF A;  3UJO A;  4G4F A;  4CA9 A;  3VBO C;  1BBT 1;  3OOX A;  4CPB D;  2JG9 A;  2XML A;  3K4A A;  5FWJ A;  4AF9 A;  4JDN A;  2RS3 2;  3N9O A;  4B4P A;  4E4S A;  3I2H A;  1JN2 P;  1LOF C;  4M0N A;  5HV0 A;  4W65 A;  5B4N A;  1LHN A;  1U12 A;  3TEW A;  1KJR A;  4HSJ A;  5JZG C;  2TUN A;  1H8V A;  2ZCW A;  3NNG A;  4UFM A;  2B7Y A;  4DY5 A;  4Q1P A;  4S2G A;  4K1Z A;  5JUV A;  4MV2 A;  3JXS A;  1PK6 A;  1RMU 3;  1SZB A;  1K5M A;  5JAX A;  5K0U C;  3CKH A;  3ON7 A;  1ULP A;  3ES1 A;  2ARC A;  4EWD A;  2ZMK A;  1V70 A;  1QOT A;  1ZZ7 A;  3ZFG C;  1GLH A;  1J58 A;  4E4Z A;  2GNB A;  5KXC A;  4B4R A;  4CP0 A;  5JXH A;  4TWT A;  5J1X A;  3GJA A;  3HT1 A;  5ABJ C;  5JOZ A;  1LHW A;  1DU3 D;  4NPR A;  1ULE A;  5D8A B;  3VD5 A;  4IW3 A;  1TG7 A;  5DZG A;  1BVV A;  4Q0V A;  4YM1 A;  4MG2 A;  5EP9 A;  4Y33 A;  4AQS A;  4CCE A;  4AE2 A;  5IW0 A;  4P9I A;  5EQU A;  4Z07 A;  1UXX X;  2BWA A;  3LIH A;  1LGN A;  1RUF 2;  4AR2 A;  1NA1 A;  3ABZ A;  2C9A A;  2WS9 1;  4NRM A;  4BQX A;  1FOD 3;  4LIU A;  4B7E A;  1JUI A;  3QLQ A;  4A42 A;  1G9D A;  1HRV 1;  5AC9 3;  3S0M A;  2HH9 A;  2VTF A;  3VDD B;  4AFB A;  3PJY A;  5FZG A;  2MNG A;  3IB3 A;  3N7L A;  3NKT A;  5CB7 A;  5E16 A;  4ISR A;  2HJI A;  3TAY A;  1RUC 1;  5FZ7 A;  5LBC A;  5EYX A;  4XQW A;  1MPX A;  1PGW 2;  2MEV 1;  3S6P A;  4OYU A;  4TN7 A;  4W6X A;  3WCS A;  2RE9 A;  1K45 A;  3MIG A;  4GMP 0;  3ZSJ A;  3PDQ A;  4I0B A;  4ONU A;  5FYY A;  4NWV A;  1W2A X;  5D8A A;  3PUS A;  3DN7 A;  1RUN A;  1YCI A;  2Q4S A;  5C8C B;  4COU A;  1H30 A;  3O12 A;  2VOK A;  1QWR A;  1SLT A;  2CTV A;  2ZJC A;  4XF3 A;  4P9J A;  2VBB A;  3GXU A;  5A3M A;  1CVN A;  1QJX 3;  2R04 2;  4IV3 B;  1A3K A;  1RED A;  4CDQ C;  4LOR A;  3MIC A;  2JEN A;  4X6Q B;  2VUA A;  3UGF A;  4TZD A;  4G9S B;  5F5Q A;  4Q4Y 1;  5FCC A;  2YU1 A;  3LA3 A;  1OVS A;  4YZ4 A;  3ZFF A;  3VDD A;  1ZZ6 A;  3I2I A;  1K12 A;  1RTV A;  2I07 B;  4HVO A;  2F17 A;  5CU1 A;  4NWW A;  3V0B A;  1WBF A;  1Y43 B;  4XFB A;  4AVA A;  4HVQ A;  2J1E A;  2BDR A;  2B46 X;  1X33 A;  2VOV A;  3PIJ A;  4GWI A;  5JR7 B;  4AGG A;  4CPB A;  2TEP A;  2WAB A;  4MAD A;  4MVT A;  5CNA A;  4XAC A;  2E32 A;  5EFU A;  4Z1V A;  5H9P A;  3ZYG A;  4CZS A;  1EUU A;  4CDW C;  1AYN 1;  2OZ6 A;  4A4A A;  3MPB A;  1EUT A;  5E6H A;  3CMG A;  2RM2 1;  4UFH A;  4XDQ A;  2JG8 A;  4CCC A;  4E2G A;  3RI9 A;  3ZXL A;  4JHT A;  2WQ8 A;  4P5H A;  3NJY A;  1F15 A;  2B45 X;  3FFQ A;  2Y6G A;  2HWD 2;  4IV3 A;  4XAA A;  5CBL A;  3H3Z A;  2HWE 1;  3U4X A;  3E97 A;  4XDP A;  1OI6 A;  5ACA 3;  3ZYF A;  1VBD 1;  3T4H B;  4OZO A;  4EN7 B;  4PJY A;  2JIG A;  3AZX A;  3VKN A;  5KC5 A;  4NO4 A;  4XQD A;  2W46 A;  1CD3 G;  4FPH A;  2HWB 3;  2YBS A;  1KQR A;  2KXL A;  2ZKL A;  2Z69 A;  1FI2 A;  1CIY A;  2WN3 A;  5C71 A;  1RUI 3;  5JCT A;  3WNO A;  3A23 A;  4LIT A;  2DCZ A;  4QXB A;  1ZYB A;  1WA6 X;  5EZW A;  2QZ2 A;  5GZD A;  4NHK A;  4NRO A;  1W3X A;  2DU0 A;  2VG9 A;  1K3I A;  1I9R A;  2XVL A;  5FZ6 A;  3ROU A;  1AJO A;  4XMA A;  4ARX A;  1OQD A;  4LUL A;  4XZP A;  5E8A A;  4D3W A;  1ONA A;  1UZ0 A;  4D6S A;  5IVE A;  5FP7 A;  1LU2 A;  4LBM A;  1ZRC A;  3LDR A;  2GU9 A;  1QXR A;  3WF3 A;  3HNY M;  1GQP A;  1UYX A;  3WDY A;  1IKP A;  4O9E A;  4AI3 A;  4DNY A;  3PVB B;  2Y6J A;  1OFN A;  4XYX A;  1V6O A;  4HAN A;  3HAG A;  3O1M A;  1HRI 1;  3K75 B;  1N1Y A;  3L2H A;  5FMO S;  3DYO A;  1WCU A;  3I3D A;  3JB8 A;  4XUN A;  3RMY A;  3T0A A;  1W6O B;  4E2S A;  3AZV A;  3CEW A;  3N36 A;  1H2N A;  4RS5 B;  3VZN A;  2WNO A;  2WC2 A;  2PQQ A;  1JUH A;  3D82 A;  3POB A;  2ZMN A;  2PAM A;  4GH4 B;  2R0F A;  3LA2 A;  1JTZ X;  1EV1 1;  4HZF A;  4Y1X A;  5FTT C;  1JBC A;  4AFM A;  1CES A;  2IWG B;  2P1B A;  2EXJ A;  1W2T A;  4LBL A;  3O0X A;  1AR9 3;  4N8M A;  1M4W A;  4QMA A;  3HQX A;  4C0B A;  2ZGP A;  2E53 A;  3RFR A;  1BK0 A;  1PO2 3;  3I59 B;  1GP5 A;  3RZG A;  2RHP A;  3CIH A;  2HEV F;  5LA1 A;  2R1B A;  3HD8 B;  5FXZ A;  3W5M A;  4S2F A;  2GN7 A;  4CSW A;  1R09 3;  1TVG A;  4X8N A;  5A1L A;  2C9K A;  1B35 C;  2WZR 2;  4N53 A;  1SLI A;  4EWE A;  3H8R A;  3O7O A;  4XIK A;  3MUZ 1;  1OF3 A;  3URF A;  3S57 A;  3NNM A;  5CFD C;  4PIX A;  4LUK A;  4XUT A;  1Z0H A;  1DGW X;  1Y9Q A;  1X7N A;  3BCW A;  4GH4 A;  1O4Z A;  1AYM 2;  5FR3 A;  4FPG A;  4ZS3 A;  1AR8 2;  2GN3 A;  3LSD A;  3WHU A;  1ENQ A;  2R06 1;  2VMF A;  4IV1 C;  5JI7 A;  2DTY A;  1COV 2;  4A6S A;  1G7Y A;  2A70 A;  3KLS A;  4N9H A;  4SLI A;  1CX1 A;  2MHF A;  3OB8 A;  2XJV A;  1YI7 A;  3I59 A;  2Y26 A;  3QBQ A;  4QM8 A;  2YV8 A;  4RR3 C;  5FRA A;  2AEY A;  5FYC A;  5FZC A;  3NAP B;  3I97 A;  1MEC 3;  2K46 A;  3ZVX A;  4WV8 A;  1W28 A;  4Y5T A;  4WM8 C;  1FPN 2;  4M3C F;  2BER A;  3WNX A;  4Q26 A;  4UBH A;  3PVE A;  2E9Q A; 
#chains in the Genus database with same CATH homology
 2YBK A;  3KVB A;  4HOO A;  3NJY A;  2XML A;  5FYB A;  5FZ4 A;  5K4L A;  5FWJ A;  5FY0 A;  5FYH A;  5FBJ A;  3K3O A;  5A3P A;  4QXC A;  5IVB A;  2OT7 A;  4XDP A;  4GAZ A;  5F5I A;  3N9O A;  4CCM A;  3PU3 A;  2OQ6 A;  5FZO B;  5F5C A;  3KVA A;  4DO0 A;  5A3N A;  4AI9 A;  2YBS A;  5FZ9 A;  5FZO A;  5A7Q A;  5F3C A;  4UF0 B;  5A7N A;  2P5B A;  2YU2 A;  5FZ8 A;  2YBP A;  3ZPO A;  4QXH A;  3N9N A;  2OX0 A;  4LIT A;  4IGP A;  4Y3O A;  4QXB A;  3N9P A;  2OS2 A;  3DXU A;  2WWJ A;  5F39 A;  5A7W A;  5IVC A;  4CCL A;  3KV5 A;  4Y4R A;  5A3W A;  4CUG A;  3KV9 A;  3K2O A;  4QX8 A;  3N9L A;  5FPV A;  5FZ6 A;  5FUN A;  5IVV A;  3PTR B;  3KV6 A;  3AVS A;  4D6S A;  2Q8E A;  3PU8 A;  3ZLI A;  5FP7 A;  5IVE A;  4DIQ A;  3LD8 A;  3PUQ A;  4HON A;  3DXT A;  5FZK A;  4CCO A;  3AVR A;  2XDV A;  5FZ3 A;  4D6Q A;  5FYU A;  5FZM A;  5FYM A;  3LDB A;  3U4S A;  2YPD A;  2W2I A;  1VRB A;  5FY9 A;  5A7S A;  5FJH A;  3N9M A;  5FYI A;  5FP3 A;  5FYZ A;  4GD4 A;  5FPL A;  5IVY A;  4E4H A;  4BU2 A;  4EZ4 A;  5F37 A;  4UF0 A;  4Y33 A;  5A7O A;  4D6R A;  5IW0 A;  4EYU A;  4CCN A;  3PUR A;  4GJY A;  2VD7 A;  4LIV A;  5A7P A;  4QU1 A;  5FZH A;  5F3G A;  4LIU A;  5FXW A;  5A80 A;  3OPW A;  4CCK A;  2XUE A;  2OQ7 A;  4V2W A;  4CCJ A;  5FZD A;  4EZH A;  5IVJ A;  5IWF A;  5FZG A;  5FPB A;  5A3T A;  5FYS A;  5LWB A;  5F2S A;  3PUA A;  4NUB A;  5FZL A;  4IGQ A;  5FZ7 A;  5FXV A;  3AL6 A;  5FUP A;  3KV4 A;  4QWN A;  4TN7 A;  3K3N A;  3OPT A;  5FV3 A;  4IGO A;  5FXZ A;  5FY1 A;  4ASK A;  5LY1 A;  4CSW A;  4BIS A;  3PDQ A;  5FYY A;  3N9Q A;  5A1L A;  3PUS A;  3U78 A;  4URA A;  5FY4 A;  5FJK A;  5FPU A;  5CEH A;  5KR7 A;  5FXX A;  4V2V A;  5FZI A;  5FZF A;  4QX7 A;  5F3I A;  5FY7 A;  5A1F A;  5FYT A;  2Q8C A;  5F2W A;  2YU1 A;  3RVH A;  5FP9 A;  2GP5 A;  2WWU A;  5FWE A;  5ANQ A;  3UYJ A;  4BXF A;  4LXL A;  5FPA A;  2GP3 A;  2Q8D A;  4AAP A;  5ISL A;  5FZB A;  5FP4 A;  5LY2 A;  5FZ1 A;  2XXZ A;  5IVF A;  5F32 A;  5A7W B;  4GJZ A;  5FYC A;  2PXJ A;  5FZE A;  3AL5 A;  5FZC A;  4C8D A;  5F3E A;  5FZA A;  5E6H A;  5FY8 A;  4XDO A;  5FYV A;  5LW9 A;  5F5A A;  5FY5 A;  5FP8 A;  5FZ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...