2YBSA

Jmjd2a complexed with s-2-hydroxyglutarate and histone h3k36me3 peptide (30-41)
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
348
structure length
348
Chain Sequence
b'LNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LYSINE-SPECIFIC DEMETHYLASE 4A
publication title The oncometabolite 2-hydroxyglutarate inhibits histone lysine demethylases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/peptide
total genus 103
structure length 348
sequence length 348
chains with identical sequence B
ec nomenclature ec 1.14.11.-:
pdb deposition date 2011-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 2ybsA01
5FP7A 5FP8A 4Y33A 5FUNA 5FY9A 4AI9A 5IVVA 5F39A 3LDBA 5A3PA 2OQ6A 5IVYA 5F3GA 5FPVA 3KV5A 5FJHA 4CCKA 2YU1A 5A3TA 5FY0A 3PTRB 3PURA 3U4SA 4URAA 5FP3A 5FPAA 5FZMA 5FYUA 3KV9A 4QX7A 4AAPA 4LITA 4QXHA 5A7NA 4CCJA 3K3OA 3AVSA 4ASKA 5F37A 3PU8A 3PUSA 5FYYA 5FZDA 5A1FA 4D6QA 5A7PA 4XDOA 4EZ4A 5FZCA 4TN7A 5F3EA 5F32A 5F2SA 4CUGA 4DIQA 2YBPA 4Y4RA 4QU1A 5A1LA 5FYTA 4CSWA 2GP3A 2OS2A 3K3NA 5FZOA 4IGQA 4V2WA 5F5CA 1VRBA 3ZLIA 4HOOA 5FYMA 5FPLA 5FZIA 4LXLA 5FYCA 4EZHA 5FZKA 4BISA 2PXJA 2XUEA 4LIVA 5FZOB 5FY7A 5FXWA 5A7SA 5FZ0A 5FZ8A 2XDVA 3PU3A 5FYSA 5FZEA 2Q8EA 3N9NA 4EYUA 5FPUA 2XMLA 3AVRA 3U78A 5FY5A 5K4LA 4XDPA 3N9QA 5F3IA 5FXZA 3UYJA 5LW9A 3KVBA 4Y3OA 4NUBA 3NJYA 4QX8A 5FP4A 5LY2A 5FZ1A 3N9PA 4DO0A 2OT7A 3KVAA 4UF0A 2YPDA 2YU2A 5FBJA 5IVBA 5A7OA 4QXBA 5ISLA 5FXVA 5F5AA 5A3WA 4IGOA 3PUAA 5FP9A 5IVJA 5LY1A 5FZBA 2OQ7A 4GAZA 5ANQA 2YBKA 3KV6A 4BU2A 5FWJA 4UF0B 4LIUA 4GJYA 2GP5A 4IGPA 4CCMA 5E6HA 5F3CA 5IVCA 3N9LA 4QWNA 2Q8CA 5FUPA 4V2VA 4C8DA 4GJZA 2OX0A 2YBSA 4D6SA 4CCLA 3OPTA 3PDQA 5CEHA 5FXXA 2WWJA 3AL6A 5A7QA 3K2OA 5FZ9A 2VD7A 5FYVA 5FYZA 4QXCA 5FZ4A 2Q8DA 5KR7A 3AL5A 5FZHA 5A7WA 5FZGA 5IW0A 5A80A 4HONA 5FYBA 3OPWA 5FZ6A 3PUQA 5LWBA 5FZAA 4BXFA 5FJKA 5FYIA 5IWFA 3DXTA 5FY8A 4D6RA 3DXUA 5A7WB 5FV3A 5F2WA 5FWEA 3LD8A 3KV4A 5FPBA 5IVFA 3N9MA 4E4HA 4CCOA 2P5BA 4GD4A 3ZPOA 2XXZA 5FZFA 5FZ3A 5IVEA 5FYHA 3RVHA 5F5IA 4CCNA 5FZ7A 3N9OA 5A3NA 2W2IA 2WWUA 5FY1A 5FY4A 5FZLA
chains in the Genus database with same CATH superfamily
2AZ5A 1PO11 2CAUA 2H0BA 2X05A 1VRH3 3MPPG 2KA3A 4TSVA 2A70A 3A4UA 2VY0A 5FY9A 1UY0A 5LK5A 5ERLA 5F39A 1UWWA 3CZUA 1H4HA 4IEYA 4V1PA 5CKMA 2IFRA 3ZDSA 4CCEA 2YU1A 1VMHA 4DRRA 3H9AA 5JXHA 1RUJ3 1W0PA 1C1FA 4QX3A 4GMP3 4NJ4A 4JHTA 4OHXA 3TAYA 4BQWA 2DUQA 2JWPA 3P5BA 4QQHA 3ZYPA 3Q8CA 1FXZA 4CEYB 1SBFA 2X10A 2X8KA 3FN9A 1G9CA 3D6EA 4G3YC 4YW7A 1HV1A 4OI0A 2JKXA 5I8TA 4L0PA 2OUJA 3R0RA 2UYBA 2ZMNA 4I0AA 2HWE2 1RUC2 1PX4A 2PLV3 2SLIA 1VR3A 3DCQA 2Q8OA 3AJYA 4CP9B 2JE8A 1UNBA 2Y6FA 3NQHA 1BZWA 1UXZA 4EQVA 3AKQA 4DY3A 2W92A 5BNNA 4CSWA 5FK7A 4LOSA 3USUB 5F5CA 2AC1A 4AEDA 1NLRA 5FPLA 1H30A 1WW7A 2ZGKA 4D7YA 4LTAA 2WSVA 3WV6A 2VW1A 1YQ6A 1G9BA 1PK6C 5C4WA 2ZX1A 1YO8A 2IXKA 3U1XA 3I3MA 1HRV1 1JZ2A 4UFHA 4Q4Y2 5L9BA 1O6UA 1CAXA 3WW2A 2ZZJA 4E4SA 2FMDA 1GSLA 3OYWB 1R091 5FPUA 4I0BA 2JDYA 5LW9A 1D2QA 2XR4A 4CDXA 1SFNA 2RJLA 3UKVA 5FP4A 4AI8A 4ZHNA 3ACIA 2ZX0A 3N9PA 3T4HB 2WO7A 2WZPP 4UF0A 1GZWA 5FBJA 2VQTA 3Q8FA 2XQRA 1XYPA 5FXVA 1O5UA 1HDKA 4FPGA 4CEYC 5JSOA 1H8VA 1MS3A 2DFCA 3F2ZA 2RS12 2JE9A 4B4PA 5FWJA 5E1RA 3PUIA 2WINB 4OULA 2J1EA 4FPFA 1DG6A 2YHJA 1UCXA 4HG6B 1PVXA 2UURA 1WMEA 2YG0A 3WCSA 1I5PA 2QQKA 4CCLA 3OPTA 1J58A 2BERA 2QQNA 1OOPB 3ZFFB 2Q0AA 3FFQA 3ZXDA 4IEPA 1SG3A 2WFF2 4EN8B 1J59A 1JOJA 1NX9A 4Y22B 2R0FA 4GZ9A 5EJ1B 2G19A 3LEKA 4BLJA 4BLIA 4GWIA 2HWE1 1RUC1 2FZ1A 2GC1A 2ORXA 5CB7A 4BE3A 3TEWA 3RPQA 2PA7A 1HXS3 1NQDA 2VUJA 1POV1 2AUYA 5C3OA 4DUXA 4B7KA 1DP0A 1C8NA 1UN1A 2NPIA 1NCQA 3IN9A 4NAOA 3WP5A 1WBFA 3CJXA 1MEC2 2P3YA 4CCNA 3J8F2 5FR3A 4ISQA 2CWMA 4YM2A 3IWZA 1O4TA 3SH4A 5KXBA 1HB1A 3CNAA 4FP3A 2DWRA 3RZZA 2PTMA 5FREA 2J7MA 3FLPA 1RUOA 4OMDA 1CJPA 4Q4Y1 2SBAA 1PMJX 3R4SA 4BQYA 4YW5A 1OT5A 2WR9A 3WD5A 4CXXA 4CDQA 3AM2A 2EXJA 2HJIA 2IZWA 1ZRIA 3CJIB 4Y20B 3FJSA 2MEV2 3EMRA 1UIKA 1E5HA 1W6QB 5KHIA 3LSEA 2CTVA 5J37A 1A8MA 2XQXA 1RMU2 1OOPC 3HN1A 4JRLA 4I2OA 2PAKA 1OLQA 3NL1A 1YJLA 3JQWA 4W65A 4Y1VA 2QQIA 2RS11 2X53S 2ATFA 1XU2A 3AC0A 2WSUA 4DINB 5BNQA 1OF3A 1QY4A 3O1VA 4CRQA 2AR6A 1SCRA 3HIFA 1VAMA 2R1BA 3R4UA 3VBRB 4BQXA 4DRVA 4NHMA 3H0OA 1UMHA 3HD8B 4KG0A 1W28A 1Y4WA 1KJLA 1ULGA 3H7YA 5AFBA 3VBFA 4BISA 2NZ9A 5FKBA 1MVQA 4P9LA 1ZZ7A 2WFF1 2BFUS 4UAPA 5FOBB 4PIYA 5FY7A 2W1WA 1RUD3 4QPYA 1STMA 3Q8BA 2VOVA 5HV0A 5KC6A 4Z07A 3FHIB 2IXHA 2QVSB 4YW1A 4YW2A 3CLPA 5LA9A 5FIXA 2ZMKA 3O5SA 5LATA 4MGSA 3NJYA 4LHNA 4DEQA 3BTYA 1MEC1 3KCYA 4HN0A 2PFWA 3VBHA 3J8F1 1J1LA 3OOXA 3CJIC 1VBA2 2BWAA 3JBG3 4XXAA 5B4XA 3NKTA 2FBEA 3B69A 3VBSB 2WC2A 4K3UA 4CU9A 5ANQA 1WZXA 1LCLA 2ZEZA 1FATA 3OUIA 4GJYA 1DBNA 2GP5A 4KU8A 5DZEA 5LBEA 2BFUL 1H8TA 1NYWA 4M3CF 4TTGA 1UIJA 5FAXA 1V6MA 4XHBA 4C91A 1KD7A 2BP6A 4KBBA 1J3RA 1FPN3 4IDZA 5K8SA 1KEXA 5LZ6A 1N3OA 2Q8DA 4AVTA 2MEV1 3KMHA 4ZONA 4PIZA 3UGFA 2VOWA 3I2JA 2JDPA 2OKXA 1UYXA 1RMU1 4NPLA 4CYDA 4N90A 4LEJA 3AFKA 1WCDJ 1R64A 4H2AA 5FJKA 1UU5A 1MS5A 4TYSA 5JSRA 1NXMA 1DYPA 3FL7A 3S57A 1LESA 4I09A 5I0SA 2RS53 2J1UA 1VB2A 3AK0A 3PTYA 5IVFA 1UF2C 3H42B 3A22A 2WAAA 4CCOA 3T1LA 4PDWA 2XXZA 2QCSB 5FZ3A 2PQSA 4P9WA 3RYPA 2NMNA 2R16A 4S2FA 5DDJ2 2VTFA 3U07A 5A3NA 2Q4SA 2W2IA 2WWUA 4I3GA 2FDKA 3LOIA 3NRUA 1CVNA 2YB7A 5FP8A 3P6BA 3TRSB 4BCUA 5JXIA 5IK5A 5J09A 1RIRA 1YFXA 3I2IA 5A33A 4UXAA 1AYM2 1V6NA 1DGRN 2UY8A 2VCCA 4LQRA 5BNPC 5F3GA 5FPVA 3KV5A 3VBSC 4B3NA 2GH8A 4Q1RA 1MS0A 4PBOA 1EP0A 2VZ3A 3TNQA 4R9DA 5C9AC 3RWKX 4BJ0A 3PTRB 4M3CE 1KITA 1U5ZA 1UYZA 4WM8B 4W6XA 2YC2A 4BIFA 3Q8EA 3K48A 4WM7B 4B8EA 2WZ8A 3KV9A 1AL23 1A34A 4QXHA 2VUCA 1VE0A 3MGUA 2WNUA 4IEZA 1CPNA 1IS6A 4WVMA 5IK7A 1HKDA 1VAVA 4XABA 3AMQA 4Q5OA 3VUOA 4N43A 2WZR3 4MHUA 3PL0A 4Y4RA 3AXEA 1ZA7A 5DUXA 2ZA9A 4MX3A 4UFLA 4OI4A 1RVF2 2XKOA 4OVEA 5FZOA 5D2AA 1MZ5A 3UK9A 3IM0A 5CFCA 5EWSA 1TNFA 2CSGA 3ALQA 3GBGA 5FLHA 2EXIA 3H7JA 4A2UA 5C3RA 5A3UA 4BWOA 2W0XA 2WNVC 3JD72 2OW4A 1V6OA 4ONUA 5FXWA 3ZYFA 1YUDA 3THDA 4Q0SA 4IE0A 4PLNA 1Q8QA 1NZCA 4AFCA 2R6QA 1UY3A 1CPMA 2DU1A 1ZZ8A 3VDAA 1UZZA 2EAAA 4UBHA 5D8AA 3AMNA 1J1TA 3N9QA 5BUVA 3GHNA 1VRH2 2O8OA 3QLQA 2WT0A 3ILRA 4LBQB 5DDJ1 1KQRA 1QHDA 1ZX5A 1PNFA 3D5OA 5A7OA 2PQQA 2WIIB 2O1QA 4JRAA 1NG0A 4SBVA 4C0HA 2OYZA 1S55A 1WA4A 3VHPA 2NN8A 1JHNA 2ENRA 2GZWA 1RUJ2 4GAZA 4E4ZA 4QT6A 1AYM1 3WF1A 3BTXA 4BQ5A 4N53B 3UJOA 5HXVA 3C3VA 1HRI2 3KSCA 4M01A 2WYFA 5E6HA 3ZR5A 3O1RA 4IERA 4XJ9A 5C70A 2VM9A 2Y6LA 4BA6A 4XQ4A 2DCJA 2GU9A 2RHPA 3K4ZA 5BY5A 4GWJA 5HCBA 1LRHA 1GQPA 1ZZ9A 2IFWA 3IT8A 1UMIA 5IYYA 2CU5A 2VD7A 3NO8A 2PLV2 1LGCA 1K5MB 1KGYA 4QPIB 4PLMA 1WD4A 3O12A 5I91A 5KR7A 4OUMA 2NLRA 2VOXA 2EAKA 4E8CA 2FD8A 4KL1A 1QJEA 4HN1A 3RGBA 1HIXA 3OCPA 4QQLA 4CCDA 4AVBA 1ND2B 3MICA 2WAOA 5FYIA 3OJBA 2JICA 5C8CB 2V5YA 3WQBA 3FWEA 2BV4A 1PZ9A 3GYDA 1UY2A 3ILNA 3LIHA 4Q0VA 5EHDA 3WXPA 3ZKUA 3U4XA 2XBO3 3WUDA 4EN6B 5JSPA 4HKWA 1EY2A 3IDEA 3T30A 2YGLA 4P9XA 4PF5A 4E4HA 1RVF1 4EV0A 4G9SB 3T2PA 1OUXA 2AGSA 2XB6C 4META 2EIGA 2X5IB 4FFGA 4RYDA 3RZLA 3IDBB 2VZUA 4ZY9A 3DPRB 1V00A 4LBQD 4R8HA 1W8HA 2A5ZA 1A8DA 1A6CA 1CQ9A 1N1SA 1VALA 1S0EA 3NNJA 3JB4C 5DXDA 5CG9A 3JD71 3MLKA 3W9AA 3GCXA 4N9HA 5JZGC 5A6YA 3DKWA 2D98A 4FPLA 2XH6A 3VBOB 4M4RA 2LRPA 1JOBA 1PZ7A 3LIGA 4QDQA 1POV3 5IVVA 3U75A 2DUPA 5D21A 2EF6A 4BM8A 5JPMB 1QXJA 4CUAA 4YNIA 1BK0A 2G4IA 1FOD2 3KQ4B 4GALA 5FY0A 1H2NA 1VRH1 2WBKA 3IPVA 3T0BA 2W9XA 5A3MA 5JOZA 3CF6E 4AAPA 2XLAA 4HPKA 1GP4A 1SQ4A 4LK6A 3MFAA 2LUWA 2YZ4A 5KC5A 2VZOA 5CFDB 4ASKA 5F37A 4RGKA 1DQ1A 2Y34A 4WVVA 2VAUA 3KHCA 4D6QA 1K5MC 2QBXA 1RUJ1 1H0BA 1NE6A 1XBFA 3GHMA 1OFSA 4ISRA 4E4DX 1HRI1 4IEQA 4OHZA 1ND2C 5FYTA 3NKGA 4RS5A 1ULFA 1Y9MA 5C8CC 4Q8LA 4IGQA 4XFIA 2JG9B 1RYYA 2D6NA 4DUVA 2WQ4A 5FZIA 3RYKA 4RQPA 4HMZA 4XTPA 2PLV1 3FUOA 1Y43B 2XVKA 3RI8A 4YPJA 4BDVB 1HXS2 1W2AX 1ALYA 2X5IC 5DUWA 5H9SA 3T1MA 5FZ0A 1HJFA 1TNRA 2A1XA 1BMV2 3OEBA 5GM0A 3RNSA 4DZGA 4AYUA 4Z82A 3VBOC 3I7DA 1YEWA 4LNVA 3B9IA 3R05A 2E63A 5EP9A 1ULOA 2DBNA 4GKYA 1BHGA 3KGLA 5GKAC 3WOGA 1ENQA 5FOJB 4AQSA 3WG2A 1G9AA 3V56A 5FDBA 5JMOA 5H9PA 3GALA 4D94A 5GZCA 4XCAA 5IVJA 4Y1YA 5FFOC 1OVSA 4BQ2A 2DF7A 5CFDC 2OA2A 3CIHA 2ZCWA 4XFBA 1MS9A 1NLQA 2GNTA 4XF4A 3RMXA 4C1WA 5D1IA 4E2SA 4LKSA 1MEC3 1N1VA 1FOD1 2K2SA 2J1RA 1GLHA 3CZJA 3GJBA 2VZQA 2ZHLA 5C33A 1YXWA 4FSJA 2J1VA 2ZEWA 1J3PA 1AHSA 1RINA 4Q0UA 1ZRCA 4N7IA 3ZFGB 3SQOA 3LB9A 5GALA 1BKZA 3I49A 4JKLA 1EPZA 5CAZA 2RDSA 3ZSMA 1GV9A 1T6GC 1PHMA 5A80A 4BYYA 3JU9A 2WNOA 3HEIA 2XJUA 2DFBA 3VBUA 3LAGA 3MLLA 3IMNA 1JZ8A 5DG1A 1XE8A 3M8LA 3N9MA 1F15A 2OPKA 4CEWC 5IVEA 2IXIA 2I07B 5F5IA 1REEA 3AYDA 1SPPA 1UOBA 1PM7A 4CU6A 1HXS1 4Y33A 1PIV2 1TVGA 1EUTA 2RJ2A 1QKQA 1QQP3 3ZIXA 4QKDA 4AI9A 5GZEA 2VCBA 4XQDA 4AFDA 3V0BB 1LB2A 1BMV1 3POIA 5J1XA 4NRMA 4W6WA 2YUEA 4KWLA 2D5HA 3NAPB 4YW6A 3JBG2 4A42A 1JYXA 3AZWA 4AGVA 1X82A 1Y9QA 1FV3A 1XNDA 5FO9B 3AVSA 2QQLA 1D4M3 1DGLA 4YFWA 3ACGA 5FUIA 2ZX3A 4QPWA 4FTEA 1RXGA 5KXDA 1FPN2 4CXYA 3DUIA 5J7MA 1GU3A 1LHWA 3MIFA 4NHLA 3ETQA 5CIRA 4FPOB 4NO4A 4JX0A 4YVWA 4IEUA 1U5XA 2GP3A 4OUEA 3OY8A 5TSWA 4XHXA 4OI2A 3WDUA 1CX4A 4UW3A 4WV8A 3WX5A 1KS5A 1RL3A 3SEEA 4CXWA 3MIEA 5T3NA 3T09A 1T2XA 3AKRA 1AR72 2QUOA 2RS52 2VVFA 2IXJA 3WNLA 4CDUB 1NT0A 3PMSA 2NMOA 5LA2A 4GB33 1UPSA 1UMZA 1Q8VA 4YYOA 4B4QA 1VBC2 3SKJE 2XMLA 3LDKA 2VVEA 1W8ZA 2EXHA 3O0XA 5F3IA 4EJRA 4D7TA 2BNMA 3AP7A 1OQ1A 5I8YA 4DXRA 1MR5A 4OFGA 3NAPC 4ET7A 2XJRA 5IVBA 2YPDA 4MSVA 2R32A 2VO5A 4OQ9A 5LY1A 4FPJA 1DLLA 1PIV1 1SFPA 2R7EB 2VW0A 3GZUC 2VZVA 3J26N 3JXSA 1W6PB 4FP2A 4XF0A 5FZBA 2XL7A 3C7HA 4JZRA 3O0VA 3ZYHA 1CX1A 3GZTB 2CGNA 2A6ZA 1DGWA 1AL22 4L11A 3AKTA 4D7SA 5F3CA 3O1PA 2CGPA 3JBG1 2GH2A 2DVAA 5FLJA 3OTFA 4J6GA 2JDMA 2Y6KA 1XE0A 2ET7A 3POYA 5CVRA 4YM1A 5K0UB 1W3XA 1MACA 2B5HA 2YGMA 5IJRA 5LBBA 2WZR2 1US3A 4XW3A 2J22A 4FPHA 3ON7A 1U0AA 5FZHA 3AMHA 4AGGA 4IE4A 3OPWA 3TYJA 1EV13 1WUVA 3I59A 4S2HA 1FPN1 1LOFA 1UYPA 4L2NA 4AGRA 4BK5A 4CDUC 5EYYA 3DXTA 1FT9A 5GLTA 5A7WB 3E5QA 1D4VB 1K12A 4K21A 3E6BA 2YC0A 4RR3B 5IAVA 1QNWA 1H9WA 1ODNA 1HV0A 4ITCA 3OGRA 3HR9A 3C7EA 2RM23 2ZHKA 4A6OA 4DEVA 3LDRA 3QD6A 2OVUA 4L9BA 3INAA 4NPRA 5APAA 2BPA2 3AKPA 4LUKA 4MXVA 1WLCA 3BPSA 1AR71 1X36A 2RS51 5FP7A 5BPXA 3J7MA 2DTYA 5JLVA 4NWVA 2J1TA 3UGHA 1JZ6A 2WKKA 5GLZA 3SNMA 4R52A 3HQRA 2RMU3 3GZEA 1VBC1 4IUGA 3ZFGC 3MPBA 1L7LA 1W04A 3O14A 4JQRA 4YSFA 1SLLA 2WQZC 2W94A 1RUG3 5BYNA 3BU0A 3OEAA 4QB1A 3ORJA 3RFRA 1V6KA 1ZBE2 3WUCA 4CE8A 1LU1A 1IKPA 4D8MA 4YG0A 3N36A 3SHRA 5FMBA 3PNAA 3PUSA 4CTEA 5K0UC 5FYYA 1ZRFA 3KZ4C 4WZCA 3CEWA 1CAUB 2JD9A 2PHUA 3I2HA 3MLJA 5F3EA 5F32A 4B29A 4AW7A 3ZN6A 1I6XA 2H6BA 4XCBA 5I0DA 1AL21 1M06G 3ME2A 4JC1A 1H1AA 1UOGA 4IW3A 3ZMOA 2W52A 2C0ZA 1VB4A 1IKQA 4XF1A 3FC0A 4QKBA 4RR3C 4XF9A 5DAPA 2PHFA 5H9RA 3WY6A 4AEKA 2WZR1 1OH4A 5FZKA 4FTBA 4HK8A 1YRZA 2XUEA 3NVCA 3WCRA 2XBO2 5I0TA 1V6IA 4O65A 1HRI3 1QNYA 1V6JA 4YWAA 5A7SA 2JDKA 4LBJA 4OLLA 2XDVA 3A21A 1IHMA 2NQYA 5KHHA 2V73A 2Y26A 3S6PA 3SMHA 2WNEA 4EYUA 1IQAA 1H6XA 1LHNA 4GH4B 4NROA 5FKCA 3BUCA 3MIGA 1MVEA 3ZFEB 3DN7A 4E8DA 1YQCA 2ZGTA 4HBNA 4WVZA 3C8XA 4HL0A 1RGSA 5LY2A 3IMMA 3ZR6A 3BVCA 3KVAA 3AP4A 1JZ7A 1TME3 2W1QA 3NV3A 3GBFA 2YXSA 4AEDC 4J25A 3MIHA 4CPBD 1GOFA 3WDVA 4WZFA 3BIEA 3U10A 4FFIA 1SBDA 3H8RA 1W90A 3VZNA 1NQJA 1YFWA 3HNMA 4YGBA 4K1YA 1KJRA 2V72A 1JI6A 3V64A 2JB4A 4BXSV 4HT1T 3WDYA 1FNZA 4PLOA 1SLBA 1AXKA 2D5FA 2DCZA 1XSRA 2JG8A 5T5OA 4ZZ8A 4AQ2A 1AXZA 3PLQA 1ZBE1 1OA2A 4QXCA 2W5FA 3AFGA 1H1IA 1XYNA 2FCTA 4CDXC 2JECA 3I54A 2TBVA 5LRRA 4AEJA 5JWPA 2YFUA 2WQ8A 3AP9A 5LCWL 4XFGA 5KWRA 1FOD3 3LPFA 2O8QA 1N3PA 1PK6A 4KWJA 3TN93 5F2WA 3OBTA 3O1MA 3EO6A 1V9U3 1VLNA 2R063 3DL3A 4YGDA 1W0NA 3WG1A 2AACA 4GH4C 3A0NA 3QH6A 4BH9A 3UGGA 3ZFEC 4QQOA 1C28A 3DYOA 2D6MA 1ZVFA 3KLSA 2XBO1 3P1IA 1C4RA 2E33A 5FUNA 1MQTB 3WDXA 1QJX3 1R1ZA 3KWVA 2I45A 3W5MA 1WCQA 4XMIA 3DV8A 1NE4A 2G1MA 1A3KA 1NOVA 4CCKA 1GZ9A 4CEYA 1SACA 4B1LA 3VLBB 1O3TA 2VZ1A 4XAAA 3PURA 4UBGA 1MS8A 3QH7A 5FPAA 1VBB3 3OBAA 1O4YA 2R073 2HWF3 4RHV3 4Q1PA 2B8MA 3VBFB 3WF3A 3QOPA 3VZOA 1UAIA 3LZZA 3IB3A 2D3RA 5GZGA 3FX3A 4PI0A 1GANA 1G9FA 1WMFA 1QXPA 4MYEA 4X6QB 5FZCA 3USUA 5CKNA 2WT1A 2K9ZA 5M0TA 2C1FA 4CUGA 4QHOA 3WG4A 2YBPA 4LOTA 4QU1A 4COWA 3B9CA 4DMIA 1GNHA 1O8SA 4NIGA 1DQ4A 1N1TA 1E5IA 4IV1B 2VUAA 2P3KA 3K3NA 1VRBA 4YVSA 3ZLIA 2XOMA 2HWD3 1ZNPA 4AWDA 4MXWB 1AX2A 1YQ5A 1GWKA 2XONA 4JGYB 4UW5A 1UQXA 2GNBA 2VQAA 5G05L 2P2KA 3G7DA 4NIIA 4P9GA 4XACA 1IPSA 2LALA 4FI9A 1AVBA 3UJQA 4DY5A 1XNKA 2QQUA 4LPLA 3OYWA 1OKOA 1BLZA 1CAVA 1MZFA 5J36A 1GICA 1JXNA 3WLUA 3IZOA 1MQTC 3PJYA 3C2UA 3N9NA 5EZWA 4JKKA 2LTNA 3WNMA 5K4LA 5GZDA 1W06A 1XYOA 2CWSA 1E57A 1GYKA 1VIWB 2ARAA 4IEVA 3MV01 2ERFA 1QQP2 1UZVA 4LJHA 2ZGLA 5L36A 1QDCA 1GUIA 1W0OA 1I9RA 4EWEA 3SC7X 3PUAA 3K75B 5FP9A 4FAGA 3QACA 4M4PA 1GZTA 2N7GA 3A0KA 4MUVA 2ORZA 3D0JA 3VBFC 1H2MA 3C7FA 3KHBA 5A32B 4OI1A 3ZFFA 4AHXA 3RJRA 1D4M2 5C3PA 4AL9A 2BGPA 2OX0A 1KXGA 1RHI3 4W6YA 3VZJA 4PDWB 1Q56A 2VMEA 2AEZA 4E2GA 3N4MA 5FYZA 2BRTA 4IV1C 1PIV3 3EYPA 4DQAA 4Y1ZA 2WT2A 1XPWA 4LHSA 4JGYC 4R9CA 1XOYA 3BKZA 1E5SA 3VBHC 5FO8B 2FCUA 4LBMA 1PZ8A 5BNPB 2QQOA 4I3PA 5FV3A 1LOBA 1X8EA 3U11A 1RB8G 1OMIA 5C9AB 2J42A 3ZN5A 3ZPOA 1QJU3 1CJDA 3SH5A 4IETA 3FMGA 4NHKA 4GB32 3K51A 3I8TA 2BQPA 1H8TC 1LHUA 1L7QA 4HVRA 4FPYA 5E88A 5JOWA 5E8AA 4QM8A 4F7ZA 4XUPA 3RG0A 2QQJA 4WVMB 4KU7A 4UFJA 5FO7B 5E16A 2GC2A 4OUSA 2P6HA 3VB9A 1VBD3 3CJIA 1DQ5A 4N43B 3ZXJA 5T50A 5A3PA 5C8WA 2VNRA 3NJVA 2NYYA 1AR92 3JCIA 1K5JA 1GFF2 1W6QA 4J1WA 1WA6X 4DUWA 3ZYIB 4UFKA 4LBLA 4G4FA 1DGWX 2DVFA 3VGIA 3K46A 1AR73 1ZBA3 1QQP1 4ORFA 1XRUA 4Q0QA 1W9SA 2FDJA 2WNVB 4PDWC 2R043 3G6JB 3VBRA 1VBC3 4EZ4A 3H1YA 5JR7B 1FAYA 4LO4B 5JAXA 2GALA 1W8WA 3WNKA 1F2NA 1WCKA 1OFNA 1U5YA 1UXXX 3T2OA 4K8FA 5LEKA 3BOPA 1TZOA 2IVIB 4XJ8A 4TLGA 2ARXA 5D8AB 1D4M1 4AQTA 4COZA 3ZSJA 4V2WA 4Q2FA 5DUUA 3RRDA 2CDPA 1EV12 3T08A 3PUHA 2VOTA 4QB2A 2V4AA 1CIWA 1QIQA 1O3RA 1SZBA 4ZXEA 5L9VA 4AXOA 1MPXA 3MO4A 3RJ2X 1IG3A 3B01A 2PN5A 3IBMA 4PQQA 4BPZA 5T55A 2QQPA 3OB8A 5EPAA 1OLRA 2RM22 3PU3A 1HN0A 2WNUC 1UZWA 3W5NA 2ARCA 2JIGA 4COUA 3AB0A 4ZS3A 4BMEA 4N43C 2DCYA 4NAMA 4LBOA 1LU2A 1AR82 1B35B 3JZVA 2E53A 2CYFA 3KF5A 4M00A 3VDDA 3LEGA 4C90A 1LEMA 1XU1A 2C4XA 4QX8A 4GB31 5KHJA 1APNA 2R0HA 3APBA 1G86A 5DQ0A 1RTVA 2RMU2 1CR7A 1FYUA 2GN3A 4N9IA 4UFMA 2TNFA 2WA3A 2EICA 1N3QA 2IXCA 4PT6A 1RUG2 2GNDA 3MYXA 3PVOA 3ACLA 3ZXGA 1S0IA 1JW6A 3F95A 4XURA 2A71A 1YI9A 5DPNA 1SLTA 5I0UA 1DHKB 3URFA 2ID4A 1AR91 2XGXA 2QQWA 1OD5A 3WF2A 5FUPA 4YZ1A 1QH6A 4JTNA 5A6ZA 2PHXA 5FLIA 4QXKA 3ZIWA 4MGKE 5D8AC 1HQWA 4ATEA 4WBBA 1AR63 3AL5A 4CP1A 4X8PA 4IESA 2CY6A 3ASIA 2MNGA 3AYEA 4JDNA 5IUQA 3VD3A 3ZVXA 5JZGB 1ZZCA 4NR1A 2HWB3 3TEYA 1OPMA 1O8PA 1XE7A 3DF0A 2V09A 2XLGA 2XJPA 5JCTA 3H8UA 2W39A 2YC4A 3PJQA 2MHFA 3J7LA 4NRPA 2D3SA 1DZRA 1ZBE3 2OZ6A 4JGZB 1UYYA 5FZFA 5K7PA 3UNPA 1EV11 1RJ8A 3IPVB 1S0FA 3K4DA 4GWMA 4HXCA 2BUKA 3BYWA 2RV9A 4A4AA 1B35C 2LW8A 2Z79A 2QQMA 1XB9A 1GWLA 1Z7S3 4E27A 1NCRB 2BVBA 4ZS2A 2BWCA 4LO5B 2QJVA 4WM8A 1PVC3 1UD1A 1G8WA 1PGW2 2IC1A 2RM21 4HKOA 4WM7A 4HK9A 3UESA 1TME2 5T5PA 2Y6GA 1O3QA 5HXMA 4AVAA 2VECA 4UOJA 4RS5B 3AYAA 3U0ZA 1AR81 4KWKA 3BCWA 4K40A 3EHKA 3M7AA 5FBZA 2A3XA 4LKFA 4RQPB 2RMU1 2YYOA 1G7YA 2Q30A 4LITA 4WVWA 1Q8OA 4CCJA 2WN2A 3N35A 1ZA4A 4H7MA 4YGEA 2WO1A 1PO23 3ZO0B 5DN2A 4KBZA 3A7QA 1RUG1 4MZUA 3S5QA 4DFSA 3B5LB 3WZ1A 2XVGA 5LBFA 4QKNA 4AHZA 4L97A 4FT8A 4S2DA 1QGLA 3D3AA 3POEA 4P08A 5KHGA 3V0AB 3R4DB 2C24A 3HN3A 3I2GA 4FTSA 2OUHA 1RUH2 1W05A 3H50A 4XJZA 3J7NA 3WDWA 5LB6A 4ES8A 3LA3A 2AENA 5AVPA 4KNCA 2W3JA 3TN92 1JUIA 5F7UA 4JGZC 4F8AA 1JHJA 3WP4A 2VBDA 1V9U2 2E31A 1NAEA 2PHWA 3KQRA 4BB3A 2Y33A 1W9YA 4PIXA 5F5QA 2UWAA 3RDIA 3WQ7A 3X29B 2R062 5IFTA 2ZABA 5J96B 2UU8A 5SV5A 3HVDA 4LBQA 1NCRC 5FTTC 4XDQA 1NKGA 1LHVA 1OLME 4FOWA 1W39A 3HNBM 1NA1A 1JYCA 1Z0HA 1D0HA 2OPWA 4XDPA 5E89A 5FY5A 5FXZA 3UYJA 5HPOA 4XFCA 3EQEA 4MGIE 3U37A 1QJX2 2D44A 1PNGA 2J1AA 2E7AA 3THTA 5ABJB 4RS5C 1LOAA 5FQ0B 4N53A 2BDRA 3MI8A 3E1F1 4MGYE 1S1AA 1RUE3 3P3NA 4XC9A 1V0AA 3VD7A 2QNKA 2VTXJ 3E5UA 4LA2A 4NHXA 4R4ZA 1I3HA 2ZACA 3TWIA 1LJ7A 2EA7A 4RQPC 4YZ2A 2OQ7A 3AZYA 3KV6A 3M2MA 4BU2A 1UZ0A 3M3OA 1PGW1 1DYKA 1CD3G 3IAPA 1VBB2 4QPGA 1W9FA 2ARBA 2HWF2 2K0GA 2R072 3FLRA 4OCTA 4RHV2 4IGPA 4CCMA 3LOBA 3C7OA 3N9LA 1CZVA 1TME1 4QPIA 5IT6A 5LK7B 4OZXA 1ODMA 5LRSA 4OHWA 1EPWA 4ASLA 4A7ZA 3FBMA 3OF1A 4CDWB 2ADEA 4U2AA 4CEWB 1ND2A 1FX5A 4ARXA 2HYXA 4A7YA 2BVVA 3ZDVA 5C8CA 5L7OA 5B4NA 3BPZA 2KD7A 1VMJA 2Z4FA 4BQ3A 4P00B 4LA3A 1SMVA 2WABA 3RQ0A 2BBAA 3OUHA 5FZ6A 2ZPXA 3IKWA 3VHOA 4ARYA 5LA0A 1IQDC 5JOYA 1W99A 2HWD2 4NVPA 4P9YA 4AF9A 5HCAA 5FY8A 2X5IA 4M3CA 3D0SA 4IL7A 1W6MB 3DECA 3DPRA 3AZZA 3N7LA 1OURA 1S0BA 4PHZA 3TB0A 3WVJA 4IXLA 1RUH1 2P5BA 4DB5A 3DKQA 4XPVA 5EJ3A 3VBOA 3BALA 1WCSA 2XHNA 3DEMA 4RSUA 2TUNA 4QM9A 3TN91 3TNPB 4BQ4A 2I2SA 2RG4A 3VL8A 1AX0A 1JOPA 1V9U1 5ABJC 3MHZA 4YW3A 3VHNA 4YFZA 2R061 4QQ2A 1AJOA 4YZ5A 1HQNA 3LDBA 2FMYA 1BVP1 3H1MA 5DUVA 3HPNA 3HT2A 3SLIA 4EN7B 4HSJA 2VMFA 1Q5OA 2IUWA 2NP0A 3HQUA 4URAA 1KFUL 3IDAA 4AI0A 1QJX1 4XVHA 1IS3A 2BOJA 2PHRA 4OYUA 1YIPA 1D2SA 4QMAA 3VD9A 4QX2A 3HBKA 2XLFA 3M3QA 2WLQA 4Q29A 4CDWC 5GLUA 4FCAA 5A1FA 2VMCA 1DDLA 1FI2A 1F5JA 5EIYB 4XETA 2P4EA 2JG9A 1RHI2 2VUDA 3E97A 3ES4A 5F2SA 1VBB1 2R071 2HWF1 4RHV1 5DZFA 5FPXA 1RITA 1ND3A 2VOKA 1PX3A 2WFPA 2WL1A 4JCKA 4NOTA 2V4VA 3TOJA 2B39A 2RJKA 2P37A 2JB8A 2WN3A 3LEIA 4HOOA 4LBNA 3MW3A 4LXLA 1MS4A 1QDOA 1YWKA 4PQ9A 4YZ3A 1WGPA 2HKXA 2JDUA 2P6CA 4YW4A 3WEZA 1ZM1A 2W87A 4LO6B 3M70A 1R082 4P9JA 1RUNA 3WNNA 2VW2A 1QJU2 2WYSA 2ADDA 2VNVA 2Y8KA 2HWD1 5FRAA 5FZ8A 4TZDA 5DAVA 1NZIA 3WF4A 1NLSA 3AZXA 4HETA 2QTWB 2HYKA 4NE9A 3UKTA 2VCMA 2RVAA 2ILMA 4FPEA 2CGOA 4UW4A 3ZYJB 3OBRA 3VKFC 1GR3A 1F8VA 1YCIA 3KD4A 1TG7A 4LUMA 1VBD2 1LEDA 3WNXA 3BB6A 4CZSA 3S5AA 2VZPA 4BMBA 2OT7A 2TEPA 1JBCA 2YU2A 1LKNA 2DYCA 3LSDA 4RGGA 4QU2A 2P3JA 4H14A 2LS6A 1I1EA 2GMPA 1N47A 1CAWB 1WBLA 3OD0A 2QDRA 2ZGUA 4GIQA 4A7KA 5A70A 3NJZA 1H4GA 2W46A 1LECA 3LFIA 1ZBA2 2W08A 2HBTA 5IVCA 3DGTA 2IWGB 3N7KA 2XJQA 3ZSEA 4QWNA 3MZHA 4DXTA 3KGZA 2E51A 2XWBB 3M3IA 2W1SA 2R042 1WLTA 3D82A 3T2TA 3LCPA 4FO9A 1S0JA 4AFBA 4LKEA 1YC61 1SHWB 2C6SA 5JIUA 1V70A 2WO3A 2WWJA 2Y0OA 3H3UA 3K2OA 5JXGA 1HB4A 4COYA 4IV3A 1W6NB 2ZS6B 4UI9L 4LLOA 2VMIA 3SEPA 5J48A 3J9SA 2DVBA 3E6DA 1DGRA 1C5HA 2B45X 4BIOA 2VH9A 4CUBA 3GGLA 3VZLA 1AR93 4A44A 3Q8AA 2RR13 3QBQA 1RHI1 4LKDA 1RUF2 3NWKA 5IHRA 1GQGA 1L7RA 3I97A 3M3CA 3UETA 3IIIA 2XWJB 4ZU5A 1L3JA 4TLFA 4EN9B 1G9DA 2B46X 2G9FA 2ZXQA 3W20A 4A45A 4AEMA 1COV2 1CIYA 1REFA 1IPJA 4ZZ5A 2R49A 3CBNA 1EAH2 4MHRA 2BJSA 5CYYA 4MOAA 3V0BA 1KS4A 4ATFA 2H0VA 3WQ0A 3LGRA 2DUOA 5IK4A 1EUUA 2VQ0A 4JDMA 1R081 3GM8A 4AQ6A 4UWDA 2A7AA 1QJU1 1AXYA 1UU4A 2P3IA 4TXWA 4O61A 1F4AA 3T0AA 1AYN3 3FZ3A 1CZSA 2JD4A 4QGMA 3WNOA 2YY1A 3MW2A 4RA0A 5FMOS 4XUOA 5JXJA 5IFPA 3ZXLA 1OPOA 1VBD1 4QX7A 4SLIA 1S2KA 1YNAA 4E9KA 3O0WA 3K3OA 1BEV3 3GCWA 3U14A 1FMD2 1BQPA 4P14A 4AHYA 5BNOA 2EIDA 5KBFA 4HLTA 4CUCA 2R30A 3POJA 2W47A 2ZEYA 4QGLA 3ZXAC 4DIQA 1ZBA1 1AR83 4QKFA 4Z2WA 1LGBA 4A3XA 5BV6A 1AR62 4KGGA 4BZ4A 4Z92B 3RWNA 2R041 4CDUA 4XTMA 4K7JA 1GWMA 1TMF2 2PHTA 4YRDA 2HWB2 2HBUA 4E2QA 3ZSLA 5BNNB 1W2TA 4IE5A 3FE5A 2HH9A 4FOQA 5C5UA 2JE7A 2W68A 5FCCA 4AEDB 1US2A 1PGL2 5FMOL 5JOXA 4LHKA 1XNCA 1JH5A 1LTEA 1RUF1 1W6OA 2A6WA 2VPVA 1VP6A 3ETPA 3KT4A 4MV2A 1ENSA 5FZEA 5JI9A 4H3WA 1AJKA 4XZUG 4GKXA 5C4WB 1POQA 4QB6A 4RN5A 2IVJA 1WLWA 4LO8A 1DZTA 1Z7S2 2VZSA 4HVQA 1CAXB 1COV1 3HWJA 4Y3OA 3ZFGA 1EAH1 2WLPA 4BQ1A 2D3PA 3WNPA 1PVC2 1W6PA 1W9TA 1P8JA 3HQXA 5FZ1A 1C1LA 3ZX7A 2R1DA 4QXBA 3BTZA 1OI6A 4UFIA 2JDAA 4LMFA 3GF6A 4CDXB 1UZYA 3RI9A 2WDBA 1X33A 4YM0A 1W8NA 4N8MA 2RDQA 2KXLA 3FFZA 1YQ8A 4UF0B 1GZWB 3ECQA 2EALA 4MO3M 2RS32 3V65A 4XQWA 5BXXA 3OUJA 4EWAA 3BIWE 4C8DA 1UX6A 1PO22 1XSQA 2Y38A 1DQ6A 4R4XA 4H7LA 1YIFA 4JVAA 2JJ6A 4LLFA 5FZ4A 3DYPA 2FDGA 2ETEA 1YFYA 2Q1FA 3CO2A 5A7WA 4RR3A 1FMD1 5FYBA 1DF0A 5BNNC 3UL2A 3SITA 1OBNA 2DVDA 2VVDA 4CCCA 1KFXL 5C5TA 3AJZA 3K4AA 4GWNA 4QQPA 2ZGSA 5FWEA 1REDA 3MIBA 1R1A3 2DDUA 1OC1A 3VN4A 1AR61 3WT3A 3B7MA 2E9QA 3ACFA 1J83A 5AC93 2JDZA 2HLEA 4HKLA 3BODA 1TMF1 2HWB1 5C4WC 2WRAA 1LOGA 5FY1A 2CL2A 1PMHX 3ZKYA 3W59A 3I2KA 4RL7A 2JG8C 2P1BA 3W21A 1NCQB 1PGL1 2E32A 4LORA 4ZXKA 3UT0A 3WHUA 4OHVA 4Q0PA 4QGNA 1K3IA 1UO9A 5DG2A 1VJ2A 4Z8BA 5KHKA 3LF7A 4MG2A 5LA1A 1RUH3 4YLZA 3VZMA 4UW6A 3ZYBA 3M1HA 1RUE2 2GMEA 4I02A 3VKMA 4YARA 3RZGA 1CWPA 4CPBA 1Z7S1 1C5IA 4I30A 1CAUA 2P17A 4YVSB 5FZMA 4Y1XA 3VL9A 4AFMA 1PVC1 1ZZBA 1YI7A 3O7OA 5A7NA 3ZM8A 4CDQB 5FZDA 4Z1VA 4FOVA 4KG8A 3S0MA 1BYHA 1TE1B 4P9IA 2A6VA 3VDCA 5IK8A 3FLTA 4W4ZA 3KF3A 4AG4A 1ULPA 2VQUA 1CAVB 3ZYRA 2A75A 2D97A 3HT1A 3IDCB 1O7FA 4Q4W2 5GLWA 2RS31 1XQNA 1Q3EA 2HEVF 1FV2A 2O14A 4XEZA 3CDZB 3WR0A 1H6YA 2BU9A 2EXKA 1OHFA 1PO21 3I2OA 1JU3A 2QFEA 5FK8A 4AK3A 1UOJA 4YZ4A 3T4VA 2VNOA 2C26A 2E6VA 2RDNA 4LE4A 3N7MA 5J98B 2JXAA 4HZFA 3ZN4A 4GA9A 1JU4A 2UWBA 3ILFA 3LPGA 1H2LA 3LWCA 4GH4A 3ZFEA 5F6KA 4PCRA 1AF9A 1W8FA 2ZAAA 3HAGA 4NN0A 1Y9GA 2VMHA 4CP9A 1JZ3A 2WS93 4FOYA 1NCQC 4O9GA 4Q4X3 4B4RA 3H3LA 3AVRA 1YFUA 1JODA 2BGOA 4Y1UA 3SCFA 1DFQA 1DYOA 3POWA 1SLCA 5F6LB 3KVBA 1BXHA 3ABZA 3RZMA 4NIDA 1IS5A 2PHDA 4XJWA 1ULCA 4ZU4A 1LGNA 3NJXA 1ONAA 4DO0A 1ZREA 2VBBA 3QCWA 4YVSC 1JYIA 4XF3A 3WSOA 1WW4A 2B9UA 4O7XA 1WW5A 4CDQC 1IS4A 1S0CA 2JENA 5JI7A 4L99A 1SDDB 3VBHB 1VPHA 4UYBA 1RJ7A 3NV4A 1JYWA 4AI3A 4J1XA 1H1MA 5JPNB 2VTXA 3T2QA 3S7IA 2QKDA 3KT1A 4Y5TA 1RUE1 1S0GA 5EFUA 4FAHA 5IATA 2Q1MA 1QEXA 1D0GA 2YBSA 4D6SA 4IQPA 3AZVA 4B7EA 1W8OA 1W2NA 1LNSA 5FXXA 4QX5A 4XAEA 5I93A 2EIBA 1H8TB 3DYMA 5HCHA 5AVAA 4NIAA 1Y3TA 1IGOA 3EXUA 2FHRA 5A6XA 1ASJ2 1H9PA 2GC3A 1G6NA 5G04L 4Q4W1 1GQHA 2X09A 5JIAA 3RMYA 4D6RA 3S30A 1S4CA 1GOGA 3VD4A 4RFT0 4K6BA 3LFMA 3FBYA 5ACA2 2G9GA 4F3JA 2A6XA 1QH7A 1VBE3 1OF4A 3NNFA 5CBLA 1MQTA 4RFRB 3MF9A 3E6CC 1OOPA 2GDFA 4GQ7A 3ZOIA 4A41A 4CVUA 3ZFFC 1RUI2 5EYXA 3SCHA 5T5LA 1U5IA 3M3EA 4Q26A 3D8CA 2ZEXA 4XJAA 4Y22A 3RZJA 3T0DA 2DURA 1OKQA 3AMPA 2KR2A 5CISA 1UY1A 4YGCA 1IG0A 1OVPA 4CU8A 3SH3A 3H1WA 1F4HA 3KCCA 3IIAA 4KMQA 2RDRA 2I74A 3VD5A 5DAWA 4LO7A 4DPNA 4C1XA 5A33B 5A3TA 1S2BA 4AVVA 3KB5A 4FPCA 3U4SA 3RZKA 3MUY1 4BHPA 5FYUA 5DMYA 2DV9A 1WLDA 1R083 4K8RB 4DXZA 5F8PA 3VDBA 1GMMA 1GNYA 1HQLA 2OXBA 5L9RA 3NNLA 5A7PA 4XDOA 3T3YA 1J3QA 1UKGA 4IV1A 4ZPIA 3O1UA 1OQEA 3FHAA 4MH0E 2WNUB 4MXWA 1KDMA 3KT7A 1UPIA 4JGYA 1ENRA 1XC6A 3SCGA 1YHFA 5L73A 4Y20A 2HWC2 1E5RA 5KXEA 2RR12 1GZCA 4PBPA 4PJYA 3VDDB 3ZXFA 4AFAA 4XBQA 2VMDA 3OGVA 1HN1A 3AMMA 4NRQA 1XJAA 2XVLA 5FZOB 4CA9A 4ZKTB 5CFCB 3H8XA 4XUNA 3N3HA 1ASJ1 1JYVA 1LULA 2UY9A 4DOUA 2EIEA 4W50A 2BEOA 4Q27A 4ES9A 5FYSA 1QJY3 5LASA 5GZFA 3VBRC 5IAXA 3SISA 5ACA1 3BN6A 2AREA 1LR5A 4Q4V3 1QOTA 5JMCA 1DCSA 2CAVA 4D3WA 2ZOEB 4GMP0 1RUI1 1BBT3 1AYN2 2ZX4A 4FBFA 5A32A 3EBRA 4CP0A 1RUF3 3GZAA 3S7EA 1X8MA 2D93A 4L92A 3MEPA 2PMWB 3ROUA 3EB7A 3L2YA 1KRIA 1COV3 4XFFA 3THCA 5A6QA 1EAH3 1BEV2 2X29A 3ZXEA 1BK1A 3BOWA 4NIHA 2QDNA 2A3WA 2DVGA 5DZGA 1C8M3 3VKOA 2D40A 3OBZA 4JHZA 4XZPA 5A7QA 3PIGA 2Y64A 4A3ZA 5FYVA 1PMIA 2ZGPA 1PM4A 1YJKA 3JB8A 1OXCA 3JUUA 4I01A 2VZRA 2ZGNA 3ES1A 5BNPA 1UW8A 2ZMLA 1QOSA 3VBSA 3VDDC 5IW0A 2YMZA 1I5ZA 5LWBA 2VL4A 2ET1A 4NMIA 1UKRA 3OPZA 5FZAA 4BXFA 4QDRA 4HVOA 5C9AA 5CFCC 3M4FA 1LAJA 1IZ3A 4RGAA 4EN0A 1SCSA 1CN1A 1PO13 3LEMA 4NWWA 5T5JA 3UKNA 1W2UA 1VBA1 2HWC1 4GD4A 2DU0A 2K46A 5GLVA 4R9AA 2RR11 2OZJA 4EROA 3WW3A 1FMD3 2Y0IA 1Q43A 5FZLA 3GXUA 5DABA 1OA4A 4FFHA 5ANNA 2DBIA 2BTVC 1F35A 1X9PA 4PF1A 3CU7A 1W8UA 2JDNA 4FQZA 3H8OA 3POGA 3USSA 1TMF3 3AP6A 3KCXA 3NSTA 5GJ6A 5FMDA 4INDA 2CDOA 1XNAA 3VV1A 1W8TA 2WNVA 3AP5A 4Y24A 2GAUA 4DNYA 1D7PM 2YFZA 3GBWA 2VJXA 1N1YA 2L9LA 3EJKA 1AX1A 4CU7A 1AYN1 1DLCA 1WKYA 3R6SA 1O3SA 5JVVA 2ZKNA 4TN7A 2LM3A 4HPKB 3ACHA 1ZZ6A 3WG3A 2ZX2A 4URTA 5A1LA 2W91A 1CGPA 3OG2A 1BEV1 1VMFA 5H9QA 5C3QA 1NA1B 1HRV3 1LODA 4WM8C 5I8SA 1QMJA 4NHYA 2D6KA 3CKHA 4XILA 4AI1A 4WM7C 5FYCA 2VXRA 1JS9A 4QX0A 1R093 1HX6A 2GC0A 4M0NA 1JYTA 1DZQA 1R1A2 4EE2A 3PVNA 4P5YA 3B3QE 5JDBA 2RS33 2B42B 3NNMA 4AZZA 5AC92 3RZHA 1AUYA 1B35A 2AEYA 4KGQA 5EJZB 1Q8PA 2O0OA 4LR4A 2E7QA 2VU9A 2Q8EA 4QPGB 3B00A 4L8QA 2VMGA 5EQUA 4LULA 3AX4A 2DTWA 3WDTA 4COVA 3Q9OA 3RS6A 1YLLA 1A78A 2BNOA 2DCTA 4KI5M 1HLCA 5JUVA 1OSGA 1DIWA 4FXKB 2VULA 4FXGB 3I4IA 4K20A 3MFCA 4OMCA 2ES3A 1QWRA 2JKBA 5L7OB 3TEXA 2VGDA 2ZJCA 5F5AA 1HW5A 2ZHNA 4IEWA 5CADA 4LBKA 5HV4A 1ST8A 4YM3A 2JEMA 3NV1A 2JX9A 2UYAA 1HJGA 2YBKA 4AVSA 2GNMA 1OUSA 1SLIA 2FDHA 5L19A 4JQTA 4M3CB 4YG6A 2BGCA 4M0HA 4V2VA 2ZHMA 3FUQA 1S2EA 2CV6A 2GN7A 3I2DA 5JZGA 2HWE3 1RUC3 2IXLA 3AL6A 1JN2P 2WO2A 2YV8A 1DU3D 2D7FA 2MPFA 2QE3A 4P02B 1ACCA 1NA1C 4UT5A 4AR2A 1UY4A 4DXSA 3LQCA 3KM5A 1BCXA 3MF6A 1X50A 4HONA 1HB3A 1SDWA 2D6PA 2FDIA 4N53C 4JGZA 5HI0A 1OH3A 3ITQA 5IWFA 5I0RA 3DXUA 1GKBA 2BNNA 2OIIA 2VXJA 4R9BA 2XJVA 1LOCA 3POBA 1UL9A 2JDHA 5C6CA 3VBUB 4Q4Y3 5EV7A 1NCRA 4QPGC 4Y5Z0 5FYHA 2A3YA 2VBPA 1QJFA 3RVHA 4AE2A 1K5MA 1NUKA 1LOEA 5DAXA 4QPIC 2PELA 3MBWA 5AFEA 3WW1A 2VG9A 2WS92 4XIKA 5F1RA 1MZ6A 4GMP1 4Q4X2 4BK4A 3OGJA 1CZTA 2EVXA 3HOBA 3MUZ1 4XUQA 1R1A1 2QQVA 2C5DA 4OZOA 4Q4W3 5A1AA 5AC91 3RSJA 5C3SA 5L7OC 1SPPB 3I3QA 4XE9A 2D6OX 3W58A 3WINE 1K42A 1O5LA 2B9VA 1ND3B 2WA4A 2BYVE 4JTOA 2XL9A 1F31A 1Z78A 2ZKLA 3I2FA 1JZ5A 5FP3A 2CHHA 1QXRA 3AKSA 3HJRA 2RS13 4D69A 3ATGA 3DPRC 5DAQA 4FQ4A 2NM1A 1SBEA 1WWYA 3I3BA 4F83A 1SEFA 3ST7A 4X6RB 4ASMB 3V0AA 1O4ZA 2VNGA 3VKLA 3ZMNA 2BZDA 3MV11 3B02A 4XFHA 1OD3A 3C7GA 4FVVA 3BTAA 4Q8KA 2A6YA 2P34A 2WFF3 5FPZA 4YG3A 4MGQA 1SFYA 2YPJA 4HSLA 1QF3A 2C9AA 4A6SA 4N7UA 4XIOA 4LE3A 1IPKA 2GMMA 1JZ4A 2HEYF 3NNGA 2WWSA 3ENRA 4C0BA 3A23A 5CFDA 2PXJA 4NPMA 2G9ZA 2QZ3A 3GNEA 4LIVA 4YVWB 3VBUC 1J84A 3J4UH 1UX7A 3OY8B 2F4LA 3NMBA 4W8JA 3I3DA 4AI2A 1VBE2 2F4PA 3JQXA 1MS1A 1DQ0A 2AH2A 3J8F3 3PMEA 2Z5WA 1Q8SA 3BGAA 5ABJA 5FQ0A 3U78A 2GSYA 4QDSA 2JG9C 1NY72 1S0DA 4IE6A 4XMAA 1MZEA 4FPKA 1ND3C 2FCVA 4HFSA 1W03A 2WS91 4Q4X1 1ASJ3 2RE9A 4IV3B 4Z2AA 5ISLA 5A3WA 3GJAA 3ELNA 4O9EA 1FNYA 3O1SA 1SLAA 2ZGQA 4MGZE 4CP2A 3ZSKA 2PHLA 3POFA 4HANA 1GP5A 2MEV3 4QAWA 2CNAA 5CZKA 4CDWA 4LIUA 4CEWA 4DS0A 5ACA3 1RUD2 3HBZA 3O1OA 1BVVA 2D6LX 2Z42A 3LA7A 1YQ2A 3BU7A 4QX1A 1LENA 4QHBA 1RMU3 4XFAA 2WJSA 5T52A 2Q8CA 4GJZA 3PVBB 4P5HA 1RUI3 1XNTA 5CU1A 5A3LA 4IEOA 4KH9A 4AVCA 3PDQA 1WD3A 3CQOA 3BI3A 2VC9A 3OD4A 4K1ZA 3O1TA 3LKJA 4XBNA 2XG3A 3FHQA 1W6MA 5FZGA 3WP6A 3NW4A 1KDKA 5SV8A 3RYRA 1LHOA 3UV9A 1HB2A 4YVWC 4PI2A 2XKPA 3B94A 5CA6A 4AHWA 2ZGMA 2YDEA 2WUHA 1UU6A 4RD7A 2ZTNA 3N7JA 5CKQA 1JYNA 4JDOA 1OA3A 3I59B 1ZYBA 1ENXA 1B09A 1RXFA 2PAMA 3HNYM 2J1SA 1W3VA 1X7NA 1O91A 2E26A 1GP6A 3D4KA 1ZRRA 3L2HA 4I0WB 4MVTA 4U36A 5FZ7A 4AOCA 2VR4A 4XBLA 4KWUA 1QJY2 3KS7A 2ZGOA 4S2GA 1ZRDA 2BW8A 1VBE1 4Q4V2 3ZXKA 4GXLA 5BNOB 4IV3C 3K77A 4KQ7A 3LE0A 1IOAA 2C9KA 2OQ6A 1X9TA 2ZZQA 4H55A 1VBA3 1WMXA 2HWC3 5IVYA 1H2KA 1U12A 1WMDA 2QZ2A 5FJHA 1BBT2 5HCFA 5CG8A 2B7YA 2DCKA 1RC6A 1TQ5A 4Y5SA 2V5DA 1F5FA 4IEXA 3MIDA 2XPJA 1NY71 3VZKA 1C3HA 2A73B 2FDFA 1NXD1 3L9JT 1Y7BA 5FMCA 2W1UA 3WHTA 3VKNA 4XOGA 2LROA 5KXCA 3J7HA 3PU8A 5JR2A 2KM2A 1GOHA 4FFFA 1OLMA 2ZBJA 3OGSA 2F17A 2BBVA 1C8M2 2FQPA 2YROA 2VZTA 4LK7A 3ZPYA 5C71A 3AXDA 3OSDA 5K9YA 4ZU7A 4JKMA 4QD2A 3NAPA 1W6OB 1RUD1 3PIJA 1JUHA 2E7TA 3NV2A 4LHLA 3TBDA 4MGTA 2OS2A 1WW6A 1T6BX 1ULEA 2ZAHA 1QOOA 2F6BA 5FYMA 3ZN6B 5A3OA 2HEWF 4EZHA 3WW4A 4Y4YA 2W95A 3AYCA 1LOFC 1QU0A 3PHMA 4JAAA 3ZYGA 2Y60A 1PO12 4Y26A 1EYBA 4X8NA 4MLOA 2H6CA 3WF0A 4AAXA 1XNBA 5F9TA 5J3UA 4BOWA 5DDJ3 3TEZA 2VCAA 3E5XA 2UWCA 2XJSA 1W9WA 4K9SA 1POV0 1GBGA 2Y6JA 3MW4A 5BNOC 4XXPA 3THPA 4OHYA 1URXA 4XUTA 1O59A 1CAWA 1AYM3 2PYTA 4B1MA 1GNZA 1QJZA 2JIJA 2XJTA 4NUBA 2Y6HA 2FZ2A 2Z2SB 1PGSA 3CMGA 3H3ZA 2WZEA 1F9KA 1QJY1 2B4KA 1JMUB 4IGOA 5EXOA 4LT5A 4D0QA 4OQ8A 4Q4V1 3MDPA 3P3PA 2XUMA 4XJUA 4TWTA 3OGGA 3POSA 1AZDA 1BBT1 1BJQA 1W6NA 2BOIA 3VHRA 4EWDA 1W2OA 3GDBA 3CL1A 1AL0G 2VE1A 5CEHA 5LBCA 2ZGRA 5FZ9A 2PAEA 4GULA 1K45A 1ULDA 3B93A 4XYXA 1CONA 5CNAA 1WCUA 4IE7A 4QHZA 1RVF3 3WQ1A 2JG8B 1HRV2 2D43A 3PUQA 3LA2A 1C8M1 1V6LA 1TEIA 2Z69A 3HMYA 3I3EA 2AYHA 3IAQA 3SXWA 3JD73 1JTZX 1UOFA 1M4WA 1R092 2Q1ZB 4MADA 3LD8A 1C57A 1VAKA 3KV4A 3WP3A 5FPBA 3CHXA 2XHKA 5K0UA 1DQ2A 5T54A 3SKVA 4JV4A 5HBAA 1PK6B 3N9OA 1XXNA 3PVEA 2Q5TA 5B2GB 5LEJA 5FY4A 1CESA 5C7GA 1OQDA 1YYNA
chains in the Genus database with same CATH topology
5FP7A 5FP8A 4Y33A 5FUNA 5FY9A 4AI9A 5IVVA 5F39A 3LDBA 5A3PA 2OQ6A 5IVYA 5F3GA 5FPVA 3KV5A 5FJHA 4CCKA 2YU1A 5A3TA 5FY0A 3PTRB 3PURA 3U4SA 4URAA 5FP3A 5FPAA 5FZMA 5FYUA 3KV9A 4QX7A 4AAPA 4LITA 4QXHA 5A7NA 4CCJA 3K3OA 3AVSA 4ASKA 5F37A 3PU8A 3PUSA 5FYYA 5FZDA 5A1FA 4D6QA 5A7PA 4XDOA 4EZ4A 5FZCA 4TN7A 5F3EA 5F32A 5F2SA 4CUGA 4DIQA 2YBPA 4Y4RA 4QU1A 5A1LA 5FYTA 4CSWA 2GP3A 2OS2A 3K3NA 5FZOA 4IGQA 4V2WA 5F5CA 1VRBA 3ZLIA 4HOOA 5FYMA 5FPLA 5FZIA 4LXLA 5FYCA 4EZHA 5FZKA 4BISA 2PXJA 2XUEA 4LIVA 5FZOB 5FY7A 5FXWA 5A7SA 5FZ0A 5FZ8A 2XDVA 3PU3A 5FYSA 5FZEA 2Q8EA 3N9NA 4EYUA 5FPUA 2XMLA 3AVRA 3U78A 5FY5A 5K4LA 4XDPA 3N9QA 5F3IA 5FXZA 3UYJA 5LW9A 3KVBA 4Y3OA 4NUBA 3NJYA 4QX8A 5FP4A 5LY2A 5FZ1A 3N9PA 4DO0A 2OT7A 3KVAA 4UF0A 2YPDA 2YU2A 5FBJA 5IVBA 5A7OA 4QXBA 5ISLA 5FXVA 5F5AA 5A3WA 4IGOA 3PUAA 5FP9A 5IVJA 5LY1A 5FZBA 2OQ7A 4GAZA 5ANQA 2YBKA 3KV6A 4BU2A 5FWJA 4UF0B 4LIUA 4GJYA 2GP5A 4IGPA 4CCMA 5E6HA 5F3CA 5IVCA 3N9LA 4QWNA 2Q8CA 5FUPA 4V2VA 4C8DA 4GJZA 2OX0A 2YBSA 4D6SA 4CCLA 3OPTA 3PDQA 5CEHA 5FXXA 2WWJA 3AL6A 5A7QA 3K2OA 5FZ9A 2VD7A 5FYVA 5FYZA 4QXCA 5FZ4A 2Q8DA 5KR7A 3AL5A 5FZHA 5A7WA 5FZGA 5IW0A 5A80A 4HONA 5FYBA 3OPWA 5FZ6A 3PUQA 5LWBA 5FZAA 4BXFA 5FJKA 5FYIA 5IWFA 3DXTA 5FY8A 4D6RA 3DXUA 5A7WB 5FV3A 5F2WA 5FWEA 3LD8A 3KV4A 5FPBA 5IVFA 3N9MA 4E4HA 4CCOA 2P5BA 4GD4A 3ZPOA 2XXZA 5FZFA 5FZ3A 5IVEA 5FYHA 3RVHA 5F5IA 4CCNA 5FZ7A 3N9OA 5A3NA 2W2IA 2WWUA 5FY1A 5FY4A 5FZLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FP7 A;  5FP8 A;  4Y33 A;  5FUN A;  5FY9 A;  4AI9 A;  5IVV A;  5F39 A;  3LDB A;  5A3P A;  2OQ6 A;  5IVY A;  5F3G A;  5FPV A;  3KV5 A;  5FJH A;  4CCK A;  2YU1 A;  5A3T A;  5FY0 A;  3PTR B;  3PUR A;  3U4S A;  4URA A;  5FP3 A;  5FPA A;  5FZM A;  5FYU A;  3KV9 A;  4QX7 A;  4AAP A;  4LIT A;  4QXH A;  5A7N A;  4CCJ A;  3K3O A;  3AVS A;  4ASK A;  5F37 A;  3PU8 A;  3PUS A;  5FYY A;  5FZD A;  5A1F A;  4D6Q A;  5A7P A;  4XDO A;  4EZ4 A;  5FZC A;  4TN7 A;  5F3E A;  5F32 A;  5F2S A;  4CUG A;  4DIQ A;  2YBP A;  4Y4R A;  4QU1 A;  5A1L A;  5FYT A;  4CSW A;  2GP3 A;  2OS2 A;  3K3N A;  5FZO A;  4IGQ A;  4V2W A;  5F5C A;  1VRB A;  3ZLI A;  4HOO A;  5FYM A;  5FPL A;  5FZI A;  4LXL A;  5FYC A;  4EZH A;  5FZK A;  4BIS A;  2PXJ A;  2XUE A;  4LIV A;  5FZO B;  5FY7 A;  5FXW A;  5A7S A;  5FZ0 A;  5FZ8 A;  2XDV A;  3PU3 A;  5FYS A;  5FZE A;  2Q8E A;  3N9N A;  4EYU A;  5FPU A;  2XML A;  3AVR A;  3U78 A;  5FY5 A;  5K4L A;  4XDP A;  3N9Q A;  5F3I A;  5FXZ A;  3UYJ A;  5LW9 A;  3KVB A;  4Y3O A;  4NUB A;  3NJY A;  4QX8 A;  5FP4 A;  5LY2 A;  5FZ1 A;  3N9P A;  4DO0 A;  2OT7 A;  3KVA A;  4UF0 A;  2YPD A;  2YU2 A;  5FBJ A;  5IVB A;  5A7O A;  4QXB A;  5ISL A;  5FXV A;  5F5A A;  5A3W A;  4IGO A;  3PUA A;  5FP9 A;  5IVJ A;  5LY1 A;  5FZB A;  2OQ7 A;  4GAZ A;  5ANQ A;  2YBK A;  3KV6 A;  4BU2 A;  5FWJ A;  4UF0 B;  4LIU A;  4GJY A;  2GP5 A;  4IGP A;  4CCM A;  5E6H A;  5F3C A;  5IVC A;  3N9L A;  4QWN A;  2Q8C A;  5FUP A;  4V2V A;  4C8D A;  4GJZ A;  2OX0 A;  2YBS A;  4D6S A;  4CCL A;  3OPT A;  3PDQ A;  5CEH A;  5FXX A;  2WWJ A;  3AL6 A;  5A7Q A;  3K2O A;  5FZ9 A;  2VD7 A;  5FYV A;  5FYZ A;  4QXC A;  5FZ4 A;  2Q8D A;  5KR7 A;  3AL5 A;  5FZH A;  5A7W A;  5FZG A;  5IW0 A;  5A80 A;  4HON A;  5FYB A;  3OPW A;  5FZ6 A;  3PUQ A;  5LWB A;  5FZA A;  4BXF A;  5FJK A;  5FYI A;  5IWF A;  3DXT A;  5FY8 A;  4D6R A;  3DXU A;  5A7W B;  5FV3 A;  5F2W A;  5FWE A;  3LD8 A;  3KV4 A;  5FPB A;  5IVF A;  3N9M A;  4E4H A;  4CCO A;  2P5B A;  4GD4 A;  3ZPO A;  2XXZ A;  5FZF A;  5FZ3 A;  5IVE A;  5FYH A;  3RVH A;  5F5I A;  4CCN A;  5FZ7 A;  3N9O A;  5A3N A;  2W2I A;  2WWU A;  5FY1 A;  5FY4 A;  5FZL A; 
#chains in the Genus database with same CATH topology
 2AZ5 A;  1PO1 1;  2CAU A;  2H0B A;  2X05 A;  1VRH 3;  3MPP G;  2KA3 A;  4TSV A;  2A70 A;  3A4U A;  2VY0 A;  5FY9 A;  1UY0 A;  5LK5 A;  5ERL A;  5F39 A;  1UWW A;  3CZU A;  1H4H A;  4IEY A;  4V1P A;  5CKM A;  2IFR A;  3ZDS A;  4CCE A;  2YU1 A;  1VMH A;  4DRR A;  3H9A A;  5JXH A;  1RUJ 3;  1W0P A;  1C1F A;  4QX3 A;  4GMP 3;  4NJ4 A;  4JHT A;  4OHX A;  3TAY A;  4BQW A;  2DUQ A;  2JWP A;  3P5B A;  4QQH A;  3ZYP A;  3Q8C A;  1FXZ A;  4CEY B;  1SBF A;  2X10 A;  2X8K A;  3FN9 A;  1G9C A;  3D6E A;  4G3Y C;  4YW7 A;  1HV1 A;  4OI0 A;  2JKX A;  5I8T A;  4L0P A;  2OUJ A;  3R0R A;  2UYB A;  2ZMN A;  4I0A A;  2HWE 2;  1RUC 2;  1PX4 A;  2PLV 3;  2SLI A;  1VR3 A;  3DCQ A;  2Q8O A;  3AJY A;  4CP9 B;  2JE8 A;  1UNB A;  2Y6F A;  3NQH A;  1BZW A;  1UXZ A;  4EQV A;  3AKQ A;  4DY3 A;  2W92 A;  5BNN A;  4CSW A;  5FK7 A;  4LOS A;  3USU B;  5F5C A;  2AC1 A;  4AED A;  1NLR A;  5FPL A;  1H30 A;  1WW7 A;  2ZGK A;  4D7Y A;  4LTA A;  2WSV A;  3WV6 A;  2VW1 A;  1YQ6 A;  1G9B A;  1PK6 C;  5C4W A;  2ZX1 A;  1YO8 A;  2IXK A;  3U1X A;  3I3M A;  1HRV 1;  1JZ2 A;  4UFH A;  4Q4Y 2;  5L9B A;  1O6U A;  1CAX A;  3WW2 A;  2ZZJ A;  4E4S A;  2FMD A;  1GSL A;  3OYW B;  1R09 1;  5FPU A;  4I0B A;  2JDY A;  5LW9 A;  1D2Q A;  2XR4 A;  4CDX A;  1SFN A;  2RJL A;  3UKV A;  5FP4 A;  4AI8 A;  4ZHN A;  3ACI A;  2ZX0 A;  3N9P A;  3T4H B;  2WO7 A;  2WZP P;  4UF0 A;  1GZW A;  5FBJ A;  2VQT A;  3Q8F A;  2XQR A;  1XYP A;  5FXV A;  1O5U A;  1HDK A;  4FPG A;  4CEY C;  5JSO A;  1H8V A;  1MS3 A;  2DFC A;  3F2Z A;  2RS1 2;  2JE9 A;  4B4P A;  5FWJ A;  5E1R A;  3PUI A;  2WIN B;  4OUL A;  2J1E A;  4FPF A;  1DG6 A;  2YHJ A;  1UCX A;  4HG6 B;  1PVX A;  2UUR A;  1WME A;  2YG0 A;  3WCS A;  1I5P A;  2QQK A;  4CCL A;  3OPT A;  1J58 A;  2BER A;  2QQN A;  1OOP B;  3ZFF B;  2Q0A A;  3FFQ A;  3ZXD A;  4IEP A;  1SG3 A;  2WFF 2;  4EN8 B;  1J59 A;  1JOJ A;  1NX9 A;  4Y22 B;  2R0F A;  4GZ9 A;  5EJ1 B;  2G19 A;  3LEK A;  4BLJ A;  4BLI A;  4GWI A;  2HWE 1;  1RUC 1;  2FZ1 A;  2GC1 A;  2ORX A;  5CB7 A;  4BE3 A;  3TEW A;  3RPQ A;  2PA7 A;  1HXS 3;  1NQD A;  2VUJ A;  1POV 1;  2AUY A;  5C3O A;  4DUX A;  4B7K A;  1DP0 A;  1C8N A;  1UN1 A;  2NPI A;  1NCQ A;  3IN9 A;  4NAO A;  3WP5 A;  1WBF A;  3CJX A;  1MEC 2;  2P3Y A;  4CCN A;  3J8F 2;  5FR3 A;  4ISQ A;  2CWM A;  4YM2 A;  3IWZ A;  1O4T A;  3SH4 A;  5KXB A;  1HB1 A;  3CNA A;  4FP3 A;  2DWR A;  3RZZ A;  2PTM A;  5FRE A;  2J7M A;  3FLP A;  1RUO A;  4OMD A;  1CJP A;  4Q4Y 1;  2SBA A;  1PMJ X;  3R4S A;  4BQY A;  4YW5 A;  1OT5 A;  2WR9 A;  3WD5 A;  4CXX A;  4CDQ A;  3AM2 A;  2EXJ A;  2HJI A;  2IZW A;  1ZRI A;  3CJI B;  4Y20 B;  3FJS A;  2MEV 2;  3EMR A;  1UIK A;  1E5H A;  1W6Q B;  5KHI A;  3LSE A;  2CTV A;  5J37 A;  1A8M A;  2XQX A;  1RMU 2;  1OOP C;  3HN1 A;  4JRL A;  4I2O A;  2PAK A;  1OLQ A;  3NL1 A;  1YJL A;  3JQW A;  4W65 A;  4Y1V A;  2QQI A;  2RS1 1;  2X53 S;  2ATF A;  1XU2 A;  3AC0 A;  2WSU A;  4DIN B;  5BNQ A;  1OF3 A;  1QY4 A;  3O1V A;  4CRQ A;  2AR6 A;  1SCR A;  3HIF A;  1VAM A;  2R1B A;  3R4U A;  3VBR B;  4BQX A;  4DRV A;  4NHM A;  3H0O A;  1UMH A;  3HD8 B;  4KG0 A;  1W28 A;  1Y4W A;  1KJL A;  1ULG A;  3H7Y A;  5AFB A;  3VBF A;  4BIS A;  2NZ9 A;  5FKB A;  1MVQ A;  4P9L A;  1ZZ7 A;  2WFF 1;  2BFU S;  4UAP A;  5FOB B;  4PIY A;  5FY7 A;  2W1W A;  1RUD 3;  4QPY A;  1STM A;  3Q8B A;  2VOV A;  5HV0 A;  5KC6 A;  4Z07 A;  3FHI B;  2IXH A;  2QVS B;  4YW1 A;  4YW2 A;  3CLP A;  5LA9 A;  5FIX A;  2ZMK A;  3O5S A;  5LAT A;  4MGS A;  3NJY A;  4LHN A;  4DEQ A;  3BTY A;  1MEC 1;  3KCY A;  4HN0 A;  2PFW A;  3VBH A;  3J8F 1;  1J1L A;  3OOX A;  3CJI C;  1VBA 2;  2BWA A;  3JBG 3;  4XXA A;  5B4X A;  3NKT A;  2FBE A;  3B69 A;  3VBS B;  2WC2 A;  4K3U A;  4CU9 A;  5ANQ A;  1WZX A;  1LCL A;  2ZEZ A;  1FAT A;  3OUI A;  4GJY A;  1DBN A;  2GP5 A;  4KU8 A;  5DZE A;  5LBE A;  2BFU L;  1H8T A;  1NYW A;  4M3C F;  4TTG A;  1UIJ A;  5FAX A;  1V6M A;  4XHB A;  4C91 A;  1KD7 A;  2BP6 A;  4KBB A;  1J3R A;  1FPN 3;  4IDZ A;  5K8S A;  1KEX A;  5LZ6 A;  1N3O A;  2Q8D A;  4AVT A;  2MEV 1;  3KMH A;  4ZON A;  4PIZ A;  3UGF A;  2VOW A;  3I2J A;  2JDP A;  2OKX A;  1UYX A;  1RMU 1;  4NPL A;  4CYD A;  4N90 A;  4LEJ A;  3AFK A;  1WCD J;  1R64 A;  4H2A A;  5FJK A;  1UU5 A;  1MS5 A;  4TYS A;  5JSR A;  1NXM A;  1DYP A;  3FL7 A;  3S57 A;  1LES A;  4I09 A;  5I0S A;  2RS5 3;  2J1U A;  1VB2 A;  3AK0 A;  3PTY A;  5IVF A;  1UF2 C;  3H42 B;  3A22 A;  2WAA A;  4CCO A;  3T1L A;  4PDW A;  2XXZ A;  2QCS B;  5FZ3 A;  2PQS A;  4P9W A;  3RYP A;  2NMN A;  2R16 A;  4S2F A;  5DDJ 2;  2VTF A;  3U07 A;  5A3N A;  2Q4S A;  2W2I A;  2WWU A;  4I3G A;  2FDK A;  3LOI A;  3NRU A;  1CVN A;  2YB7 A;  5FP8 A;  3P6B A;  3TRS B;  4BCU A;  5JXI A;  5IK5 A;  5J09 A;  1RIR A;  1YFX A;  3I2I A;  5A33 A;  4UXA A;  1AYM 2;  1V6N A;  1DGR N;  2UY8 A;  2VCC A;  4LQR A;  5BNP C;  5F3G A;  5FPV A;  3KV5 A;  3VBS C;  4B3N A;  2GH8 A;  4Q1R A;  1MS0 A;  4PBO A;  1EP0 A;  2VZ3 A;  3TNQ A;  4R9D A;  5C9A C;  3RWK X;  4BJ0 A;  3PTR B;  4M3C E;  1KIT A;  1U5Z A;  1UYZ A;  4WM8 B;  4W6X A;  2YC2 A;  4BIF A;  3Q8E A;  3K48 A;  4WM7 B;  4B8E A;  2WZ8 A;  3KV9 A;  1AL2 3;  1A34 A;  4QXH A;  2VUC A;  1VE0 A;  3MGU A;  2WNU A;  4IEZ A;  1CPN A;  1IS6 A;  4WVM A;  5IK7 A;  1HKD A;  1VAV A;  4XAB A;  3AMQ A;  4Q5O A;  3VUO A;  4N43 A;  2WZR 3;  4MHU A;  3PL0 A;  4Y4R A;  3AXE A;  1ZA7 A;  5DUX A;  2ZA9 A;  4MX3 A;  4UFL A;  4OI4 A;  1RVF 2;  2XKO A;  4OVE A;  5FZO A;  5D2A A;  1MZ5 A;  3UK9 A;  3IM0 A;  5CFC A;  5EWS A;  1TNF A;  2CSG A;  3ALQ A;  3GBG A;  5FLH A;  2EXI A;  3H7J A;  4A2U A;  5C3R A;  5A3U A;  4BWO A;  2W0X A;  2WNV C;  3JD7 2;  2OW4 A;  1V6O A;  4ONU A;  5FXW A;  3ZYF A;  1YUD A;  3THD A;  4Q0S A;  4IE0 A;  4PLN A;  1Q8Q A;  1NZC A;  4AFC A;  2R6Q A;  1UY3 A;  1CPM A;  2DU1 A;  1ZZ8 A;  3VDA A;  1UZZ A;  2EAA A;  4UBH A;  5D8A A;  3AMN A;  1J1T A;  3N9Q A;  5BUV A;  3GHN A;  1VRH 2;  2O8O A;  3QLQ A;  2WT0 A;  3ILR A;  4LBQ B;  5DDJ 1;  1KQR A;  1QHD A;  1ZX5 A;  1PNF A;  3D5O A;  5A7O A;  2PQQ A;  2WII B;  2O1Q A;  4JRA A;  1NG0 A;  4SBV A;  4C0H A;  2OYZ A;  1S55 A;  1WA4 A;  3VHP A;  2NN8 A;  1JHN A;  2ENR A;  2GZW A;  1RUJ 2;  4GAZ A;  4E4Z A;  4QT6 A;  1AYM 1;  3WF1 A;  3BTX A;  4BQ5 A;  4N53 B;  3UJO A;  5HXV A;  3C3V A;  1HRI 2;  3KSC A;  4M01 A;  2WYF A;  5E6H A;  3ZR5 A;  3O1R A;  4IER A;  4XJ9 A;  5C70 A;  2VM9 A;  2Y6L A;  4BA6 A;  4XQ4 A;  2DCJ A;  2GU9 A;  2RHP A;  3K4Z A;  5BY5 A;  4GWJ A;  5HCB A;  1LRH A;  1GQP A;  1ZZ9 A;  2IFW A;  3IT8 A;  1UMI A;  5IYY A;  2CU5 A;  2VD7 A;  3NO8 A;  2PLV 2;  1LGC A;  1K5M B;  1KGY A;  4QPI B;  4PLM A;  1WD4 A;  3O12 A;  5I91 A;  5KR7 A;  4OUM A;  2NLR A;  2VOX A;  2EAK A;  4E8C A;  2FD8 A;  4KL1 A;  1QJE A;  4HN1 A;  3RGB A;  1HIX A;  3OCP A;  4QQL A;  4CCD A;  4AVB A;  1ND2 B;  3MIC A;  2WAO A;  5FYI A;  3OJB A;  2JIC A;  5C8C B;  2V5Y A;  3WQB A;  3FWE A;  2BV4 A;  1PZ9 A;  3GYD A;  1UY2 A;  3ILN A;  3LIH A;  4Q0V A;  5EHD A;  3WXP A;  3ZKU A;  3U4X A;  2XBO 3;  3WUD A;  4EN6 B;  5JSP A;  4HKW A;  1EY2 A;  3IDE A;  3T30 A;  2YGL A;  4P9X A;  4PF5 A;  4E4H A;  1RVF 1;  4EV0 A;  4G9S B;  3T2P A;  1OUX A;  2AGS A;  2XB6 C;  4MET A;  2EIG A;  2X5I B;  4FFG A;  4RYD A;  3RZL A;  3IDB B;  2VZU A;  4ZY9 A;  3DPR B;  1V00 A;  4LBQ D;  4R8H A;  1W8H A;  2A5Z A;  1A8D A;  1A6C A;  1CQ9 A;  1N1S A;  1VAL A;  1S0E A;  3NNJ A;  3JB4 C;  5DXD A;  5CG9 A;  3JD7 1;  3MLK A;  3W9A A;  3GCX A;  4N9H A;  5JZG C;  5A6Y A;  3DKW A;  2D98 A;  4FPL A;  2XH6 A;  3VBO B;  4M4R A;  2LRP A;  1JOB A;  1PZ7 A;  3LIG A;  4QDQ A;  1POV 3;  5IVV A;  3U75 A;  2DUP A;  5D21 A;  2EF6 A;  4BM8 A;  5JPM B;  1QXJ A;  4CUA A;  4YNI A;  1BK0 A;  2G4I A;  1FOD 2;  3KQ4 B;  4GAL A;  5FY0 A;  1H2N A;  1VRH 1;  2WBK A;  3IPV A;  3T0B A;  2W9X A;  5A3M A;  5JOZ A;  3CF6 E;  4AAP A;  2XLA A;  4HPK A;  1GP4 A;  1SQ4 A;  4LK6 A;  3MFA A;  2LUW A;  2YZ4 A;  5KC5 A;  2VZO A;  5CFD B;  4ASK A;  5F37 A;  4RGK A;  1DQ1 A;  2Y34 A;  4WVV A;  2VAU A;  3KHC A;  4D6Q A;  1K5M C;  2QBX A;  1RUJ 1;  1H0B A;  1NE6 A;  1XBF A;  3GHM A;  1OFS A;  4ISR A;  4E4D X;  1HRI 1;  4IEQ A;  4OHZ A;  1ND2 C;  5FYT A;  3NKG A;  4RS5 A;  1ULF A;  1Y9M A;  5C8C C;  4Q8L A;  4IGQ A;  4XFI A;  2JG9 B;  1RYY A;  2D6N A;  4DUV A;  2WQ4 A;  5FZI A;  3RYK A;  4RQP A;  4HMZ A;  4XTP A;  2PLV 1;  3FUO A;  1Y43 B;  2XVK A;  3RI8 A;  4YPJ A;  4BDV B;  1HXS 2;  1W2A X;  1ALY A;  2X5I C;  5DUW A;  5H9S A;  3T1M A;  5FZ0 A;  1HJF A;  1TNR A;  2A1X A;  1BMV 2;  3OEB A;  5GM0 A;  3RNS A;  4DZG A;  4AYU A;  4Z82 A;  3VBO C;  3I7D A;  1YEW A;  4LNV A;  3B9I A;  3R05 A;  2E63 A;  5EP9 A;  1ULO A;  2DBN A;  4GKY A;  1BHG A;  3KGL A;  5GKA C;  3WOG A;  1ENQ A;  5FOJ B;  4AQS A;  3WG2 A;  1G9A A;  3V56 A;  5FDB A;  5JMO A;  5H9P A;  3GAL A;  4D94 A;  5GZC A;  4XCA A;  5IVJ A;  4Y1Y A;  5FFO C;  1OVS A;  4BQ2 A;  2DF7 A;  5CFD C;  2OA2 A;  3CIH A;  2ZCW A;  4XFB A;  1MS9 A;  1NLQ A;  2GNT A;  4XF4 A;  3RMX A;  4C1W A;  5D1I A;  4E2S A;  4LKS A;  1MEC 3;  1N1V A;  1FOD 1;  2K2S A;  2J1R A;  1GLH A;  3CZJ A;  3GJB A;  2VZQ A;  2ZHL A;  5C33 A;  1YXW A;  4FSJ A;  2J1V A;  2ZEW A;  1J3P A;  1AHS A;  1RIN A;  4Q0U A;  1ZRC A;  4N7I A;  3ZFG B;  3SQO A;  3LB9 A;  5GAL A;  1BKZ A;  3I49 A;  4JKL A;  1EPZ A;  5CAZ A;  2RDS A;  3ZSM A;  1GV9 A;  1T6G C;  1PHM A;  5A80 A;  4BYY A;  3JU9 A;  2WNO A;  3HEI A;  2XJU A;  2DFB A;  3VBU A;  3LAG A;  3MLL A;  3IMN A;  1JZ8 A;  5DG1 A;  1XE8 A;  3M8L A;  3N9M A;  1F15 A;  2OPK A;  4CEW C;  5IVE A;  2IXI A;  2I07 B;  5F5I A;  1REE A;  3AYD A;  1SPP A;  1UOB A;  1PM7 A;  4CU6 A;  1HXS 1;  4Y33 A;  1PIV 2;  1TVG A;  1EUT A;  2RJ2 A;  1QKQ A;  1QQP 3;  3ZIX A;  4QKD A;  4AI9 A;  5GZE A;  2VCB A;  4XQD A;  4AFD A;  3V0B B;  1LB2 A;  1BMV 1;  3POI A;  5J1X A;  4NRM A;  4W6W A;  2YUE A;  4KWL A;  2D5H A;  3NAP B;  4YW6 A;  3JBG 2;  4A42 A;  1JYX A;  3AZW A;  4AGV A;  1X82 A;  1Y9Q A;  1FV3 A;  1XND A;  5FO9 B;  3AVS A;  2QQL A;  1D4M 3;  1DGL A;  4YFW A;  3ACG A;  5FUI A;  2ZX3 A;  4QPW A;  4FTE A;  1RXG A;  5KXD A;  1FPN 2;  4CXY A;  3DUI A;  5J7M A;  1GU3 A;  1LHW A;  3MIF A;  4NHL A;  3ETQ A;  5CIR A;  4FPO B;  4NO4 A;  4JX0 A;  4YVW A;  4IEU A;  1U5X A;  2GP3 A;  4OUE A;  3OY8 A;  5TSW A;  4XHX A;  4OI2 A;  3WDU A;  1CX4 A;  4UW3 A;  4WV8 A;  3WX5 A;  1KS5 A;  1RL3 A;  3SEE A;  4CXW A;  3MIE A;  5T3N A;  3T09 A;  1T2X A;  3AKR A;  1AR7 2;  2QUO A;  2RS5 2;  2VVF A;  2IXJ A;  3WNL A;  4CDU B;  1NT0 A;  3PMS A;  2NMO A;  5LA2 A;  4GB3 3;  1UPS A;  1UMZ A;  1Q8V A;  4YYO A;  4B4Q A;  1VBC 2;  3SKJ E;  2XML A;  3LDK A;  2VVE A;  1W8Z A;  2EXH A;  3O0X A;  5F3I A;  4EJR A;  4D7T A;  2BNM A;  3AP7 A;  1OQ1 A;  5I8Y A;  4DXR A;  1MR5 A;  4OFG A;  3NAP C;  4ET7 A;  2XJR A;  5IVB A;  2YPD A;  4MSV A;  2R32 A;  2VO5 A;  4OQ9 A;  5LY1 A;  4FPJ A;  1DLL A;  1PIV 1;  1SFP A;  2R7E B;  2VW0 A;  3GZU C;  2VZV A;  3J26 N;  3JXS A;  1W6P B;  4FP2 A;  4XF0 A;  5FZB A;  2XL7 A;  3C7H A;  4JZR A;  3O0V A;  3ZYH A;  1CX1 A;  3GZT B;  2CGN A;  2A6Z A;  1DGW A;  1AL2 2;  4L11 A;  3AKT A;  4D7S A;  5F3C A;  3O1P A;  2CGP A;  3JBG 1;  2GH2 A;  2DVA A;  5FLJ A;  3OTF A;  4J6G A;  2JDM A;  2Y6K A;  1XE0 A;  2ET7 A;  3POY A;  5CVR A;  4YM1 A;  5K0U B;  1W3X A;  1MAC A;  2B5H A;  2YGM A;  5IJR A;  5LBB A;  2WZR 2;  1US3 A;  4XW3 A;  2J22 A;  4FPH A;  3ON7 A;  1U0A A;  5FZH A;  3AMH A;  4AGG A;  4IE4 A;  3OPW A;  3TYJ A;  1EV1 3;  1WUV A;  3I59 A;  4S2H A;  1FPN 1;  1LOF A;  1UYP A;  4L2N A;  4AGR A;  4BK5 A;  4CDU C;  5EYY A;  3DXT A;  1FT9 A;  5GLT A;  5A7W B;  3E5Q A;  1D4V B;  1K12 A;  4K21 A;  3E6B A;  2YC0 A;  4RR3 B;  5IAV A;  1QNW A;  1H9W A;  1ODN A;  1HV0 A;  4ITC A;  3OGR A;  3HR9 A;  3C7E A;  2RM2 3;  2ZHK A;  4A6O A;  4DEV A;  3LDR A;  3QD6 A;  2OVU A;  4L9B A;  3INA A;  4NPR A;  5APA A;  2BPA 2;  3AKP A;  4LUK A;  4MXV A;  1WLC A;  3BPS A;  1AR7 1;  1X36 A;  2RS5 1;  5FP7 A;  5BPX A;  3J7M A;  2DTY A;  5JLV A;  4NWV A;  2J1T A;  3UGH A;  1JZ6 A;  2WKK A;  5GLZ A;  3SNM A;  4R52 A;  3HQR A;  2RMU 3;  3GZE A;  1VBC 1;  4IUG A;  3ZFG C;  3MPB A;  1L7L A;  1W04 A;  3O14 A;  4JQR A;  4YSF A;  1SLL A;  2WQZ C;  2W94 A;  1RUG 3;  5BYN A;  3BU0 A;  3OEA A;  4QB1 A;  3ORJ A;  3RFR A;  1V6K A;  1ZBE 2;  3WUC A;  4CE8 A;  1LU1 A;  1IKP A;  4D8M A;  4YG0 A;  3N36 A;  3SHR A;  5FMB A;  3PNA A;  3PUS A;  4CTE A;  5K0U C;  5FYY A;  1ZRF A;  3KZ4 C;  4WZC A;  3CEW A;  1CAU B;  2JD9 A;  2PHU A;  3I2H A;  3MLJ A;  5F3E A;  5F32 A;  4B29 A;  4AW7 A;  3ZN6 A;  1I6X A;  2H6B A;  4XCB A;  5I0D A;  1AL2 1;  1M06 G;  3ME2 A;  4JC1 A;  1H1A A;  1UOG A;  4IW3 A;  3ZMO A;  2W52 A;  2C0Z A;  1VB4 A;  1IKQ A;  4XF1 A;  3FC0 A;  4QKB A;  4RR3 C;  4XF9 A;  5DAP A;  2PHF A;  5H9R A;  3WY6 A;  4AEK A;  2WZR 1;  1OH4 A;  5FZK A;  4FTB A;  4HK8 A;  1YRZ A;  2XUE A;  3NVC A;  3WCR A;  2XBO 2;  5I0T A;  1V6I A;  4O65 A;  1HRI 3;  1QNY A;  1V6J A;  4YWA A;  5A7S A;  2JDK A;  4LBJ A;  4OLL A;  2XDV A;  3A21 A;  1IHM A;  2NQY A;  5KHH A;  2V73 A;  2Y26 A;  3S6P A;  3SMH A;  2WNE A;  4EYU A;  1IQA A;  1H6X A;  1LHN A;  4GH4 B;  4NRO A;  5FKC A;  3BUC A;  3MIG A;  1MVE A;  3ZFE B;  3DN7 A;  4E8D A;  1YQC A;  2ZGT A;  4HBN A;  4WVZ A;  3C8X A;  4HL0 A;  1RGS A;  5LY2 A;  3IMM A;  3ZR6 A;  3BVC A;  3KVA A;  3AP4 A;  1JZ7 A;  1TME 3;  2W1Q A;  3NV3 A;  3GBF A;  2YXS A;  4AED C;  4J25 A;  3MIH A;  4CPB D;  1GOF A;  3WDV A;  4WZF A;  3BIE A;  3U10 A;  4FFI A;  1SBD A;  3H8R A;  1W90 A;  3VZN A;  1NQJ A;  1YFW A;  3HNM A;  4YGB A;  4K1Y A;  1KJR A;  2V72 A;  1JI6 A;  3V64 A;  2JB4 A;  4BXS V;  4HT1 T;  3WDY A;  1FNZ A;  4PLO A;  1SLB A;  1AXK A;  2D5F A;  2DCZ A;  1XSR A;  2JG8 A;  5T5O A;  4ZZ8 A;  4AQ2 A;  1AXZ A;  3PLQ A;  1ZBE 1;  1OA2 A;  4QXC A;  2W5F A;  3AFG A;  1H1I A;  1XYN A;  2FCT A;  4CDX C;  2JEC A;  3I54 A;  2TBV A;  5LRR A;  4AEJ A;  5JWP A;  2YFU A;  2WQ8 A;  3AP9 A;  5LCW L;  4XFG A;  5KWR A;  1FOD 3;  3LPF A;  2O8Q A;  1N3P A;  1PK6 A;  4KWJ A;  3TN9 3;  5F2W A;  3OBT A;  3O1M A;  3EO6 A;  1V9U 3;  1VLN A;  2R06 3;  3DL3 A;  4YGD A;  1W0N A;  3WG1 A;  2AAC A;  4GH4 C;  3A0N A;  3QH6 A;  4BH9 A;  3UGG A;  3ZFE C;  4QQO A;  1C28 A;  3DYO A;  2D6M A;  1ZVF A;  3KLS A;  2XBO 1;  3P1I A;  1C4R A;  2E33 A;  5FUN A;  1MQT B;  3WDX A;  1QJX 3;  1R1Z A;  3KWV A;  2I45 A;  3W5M A;  1WCQ A;  4XMI A;  3DV8 A;  1NE4 A;  2G1M A;  1A3K A;  1NOV A;  4CCK A;  1GZ9 A;  4CEY A;  1SAC A;  4B1L A;  3VLB B;  1O3T A;  2VZ1 A;  4XAA A;  3PUR A;  4UBG A;  1MS8 A;  3QH7 A;  5FPA A;  1VBB 3;  3OBA A;  1O4Y A;  2R07 3;  2HWF 3;  4RHV 3;  4Q1P A;  2B8M A;  3VBF B;  3WF3 A;  3QOP A;  3VZO A;  1UAI A;  3LZZ A;  3IB3 A;  2D3R A;  5GZG A;  3FX3 A;  4PI0 A;  1GAN A;  1G9F A;  1WMF A;  1QXP A;  4MYE A;  4X6Q B;  5FZC A;  3USU A;  5CKN A;  2WT1 A;  2K9Z A;  5M0T A;  2C1F A;  4CUG A;  4QHO A;  3WG4 A;  2YBP A;  4LOT A;  4QU1 A;  4COW A;  3B9C A;  4DMI A;  1GNH A;  1O8S A;  4NIG A;  1DQ4 A;  1N1T A;  1E5I A;  4IV1 B;  2VUA A;  2P3K A;  3K3N A;  1VRB A;  4YVS A;  3ZLI A;  2XOM A;  2HWD 3;  1ZNP A;  4AWD A;  4MXW B;  1AX2 A;  1YQ5 A;  1GWK A;  2XON A;  4JGY B;  4UW5 A;  1UQX A;  2GNB A;  2VQA A;  5G05 L;  2P2K A;  3G7D A;  4NII A;  4P9G A;  4XAC A;  1IPS A;  2LAL A;  4FI9 A;  1AVB A;  3UJQ A;  4DY5 A;  1XNK A;  2QQU A;  4LPL A;  3OYW A;  1OKO A;  1BLZ A;  1CAV A;  1MZF A;  5J36 A;  1GIC A;  1JXN A;  3WLU A;  3IZO A;  1MQT C;  3PJY A;  3C2U A;  3N9N A;  5EZW A;  4JKK A;  2LTN A;  3WNM A;  5K4L A;  5GZD A;  1W06 A;  1XYO A;  2CWS A;  1E57 A;  1GYK A;  1VIW B;  2ARA A;  4IEV A;  3MV0 1;  2ERF A;  1QQP 2;  1UZV A;  4LJH A;  2ZGL A;  5L36 A;  1QDC A;  1GUI A;  1W0O A;  1I9R A;  4EWE A;  3SC7 X;  3PUA A;  3K75 B;  5FP9 A;  4FAG A;  3QAC A;  4M4P A;  1GZT A;  2N7G A;  3A0K A;  4MUV A;  2ORZ A;  3D0J A;  3VBF C;  1H2M A;  3C7F A;  3KHB A;  5A32 B;  4OI1 A;  3ZFF A;  4AHX A;  3RJR A;  1D4M 2;  5C3P A;  4AL9 A;  2BGP A;  2OX0 A;  1KXG A;  1RHI 3;  4W6Y A;  3VZJ A;  4PDW B;  1Q56 A;  2VME A;  2AEZ A;  4E2G A;  3N4M A;  5FYZ A;  2BRT A;  4IV1 C;  1PIV 3;  3EYP A;  4DQA A;  4Y1Z A;  2WT2 A;  1XPW A;  4LHS A;  4JGY C;  4R9C A;  1XOY A;  3BKZ A;  1E5S A;  3VBH C;  5FO8 B;  2FCU A;  4LBM A;  1PZ8 A;  5BNP B;  2QQO A;  4I3P A;  5FV3 A;  1LOB A;  1X8E A;  3U11 A;  1RB8 G;  1OMI A;  5C9A B;  2J42 A;  3ZN5 A;  3ZPO A;  1QJU 3;  1CJD A;  3SH5 A;  4IET A;  3FMG A;  4NHK A;  4GB3 2;  3K51 A;  3I8T A;  2BQP A;  1H8T C;  1LHU A;  1L7Q A;  4HVR A;  4FPY A;  5E88 A;  5JOW A;  5E8A A;  4QM8 A;  4F7Z A;  4XUP A;  3RG0 A;  2QQJ A;  4WVM B;  4KU7 A;  4UFJ A;  5FO7 B;  5E16 A;  2GC2 A;  4OUS A;  2P6H A;  3VB9 A;  1VBD 3;  3CJI A;  1DQ5 A;  4N43 B;  3ZXJ A;  5T50 A;  5A3P A;  5C8W A;  2VNR A;  3NJV A;  2NYY A;  1AR9 2;  3JCI A;  1K5J A;  1GFF 2;  1W6Q A;  4J1W A;  1WA6 X;  4DUW A;  3ZYI B;  4UFK A;  4LBL A;  4G4F A;  1DGW X;  2DVF A;  3VGI A;  3K46 A;  1AR7 3;  1ZBA 3;  1QQP 1;  4ORF A;  1XRU A;  4Q0Q A;  1W9S A;  2FDJ A;  2WNV B;  4PDW C;  2R04 3;  3G6J B;  3VBR A;  1VBC 3;  4EZ4 A;  3H1Y A;  5JR7 B;  1FAY A;  4LO4 B;  5JAX A;  2GAL A;  1W8W A;  3WNK A;  1F2N A;  1WCK A;  1OFN A;  1U5Y A;  1UXX X;  3T2O A;  4K8F A;  5LEK A;  3BOP A;  1TZO A;  2IVI B;  4XJ8 A;  4TLG A;  2ARX A;  5D8A B;  1D4M 1;  4AQT A;  4COZ A;  3ZSJ A;  4V2W A;  4Q2F A;  5DUU A;  3RRD A;  2CDP A;  1EV1 2;  3T08 A;  3PUH A;  2VOT A;  4QB2 A;  2V4A A;  1CIW A;  1QIQ A;  1O3R A;  1SZB A;  4ZXE A;  5L9V A;  4AXO A;  1MPX A;  3MO4 A;  3RJ2 X;  1IG3 A;  3B01 A;  2PN5 A;  3IBM A;  4PQQ A;  4BPZ A;  5T55 A;  2QQP A;  3OB8 A;  5EPA A;  1OLR A;  2RM2 2;  3PU3 A;  1HN0 A;  2WNU C;  1UZW A;  3W5N A;  2ARC A;  2JIG A;  4COU A;  3AB0 A;  4ZS3 A;  4BME A;  4N43 C;  2DCY A;  4NAM A;  4LBO A;  1LU2 A;  1AR8 2;  1B35 B;  3JZV A;  2E53 A;  2CYF A;  3KF5 A;  4M00 A;  3VDD A;  3LEG A;  4C90 A;  1LEM A;  1XU1 A;  2C4X A;  4QX8 A;  4GB3 1;  5KHJ A;  1APN A;  2R0H A;  3APB A;  1G86 A;  5DQ0 A;  1RTV A;  2RMU 2;  1CR7 A;  1FYU A;  2GN3 A;  4N9I A;  4UFM A;  2TNF A;  2WA3 A;  2EIC A;  1N3Q A;  2IXC A;  4PT6 A;  1RUG 2;  2GND A;  3MYX A;  3PVO A;  3ACL A;  3ZXG A;  1S0I A;  1JW6 A;  3F95 A;  4XUR A;  2A71 A;  1YI9 A;  5DPN A;  1SLT A;  5I0U A;  1DHK B;  3URF A;  2ID4 A;  1AR9 1;  2XGX A;  2QQW A;  1OD5 A;  3WF2 A;  5FUP A;  4YZ1 A;  1QH6 A;  4JTN A;  5A6Z A;  2PHX A;  5FLI A;  4QXK A;  3ZIW A;  4MGK E;  5D8A C;  1HQW A;  4ATE A;  4WBB A;  1AR6 3;  3AL5 A;  4CP1 A;  4X8P A;  4IES A;  2CY6 A;  3ASI A;  2MNG A;  3AYE A;  4JDN A;  5IUQ A;  3VD3 A;  3ZVX A;  5JZG B;  1ZZC A;  4NR1 A;  2HWB 3;  3TEY A;  1OPM A;  1O8P A;  1XE7 A;  3DF0 A;  2V09 A;  2XLG A;  2XJP A;  5JCT A;  3H8U A;  2W39 A;  2YC4 A;  3PJQ A;  2MHF A;  3J7L A;  4NRP A;  2D3S A;  1DZR A;  1ZBE 3;  2OZ6 A;  4JGZ B;  1UYY A;  5FZF A;  5K7P A;  3UNP A;  1EV1 1;  1RJ8 A;  3IPV B;  1S0F A;  3K4D A;  4GWM A;  4HXC A;  2BUK A;  3BYW A;  2RV9 A;  4A4A A;  1B35 C;  2LW8 A;  2Z79 A;  2QQM A;  1XB9 A;  1GWL A;  1Z7S 3;  4E27 A;  1NCR B;  2BVB A;  4ZS2 A;  2BWC A;  4LO5 B;  2QJV A;  4WM8 A;  1PVC 3;  1UD1 A;  1G8W A;  1PGW 2;  2IC1 A;  2RM2 1;  4HKO A;  4WM7 A;  4HK9 A;  3UES A;  1TME 2;  5T5P A;  2Y6G A;  1O3Q A;  5HXM A;  4AVA A;  2VEC A;  4UOJ A;  4RS5 B;  3AYA A;  3U0Z A;  1AR8 1;  4KWK A;  3BCW A;  4K40 A;  3EHK A;  3M7A A;  5FBZ A;  2A3X A;  4LKF A;  4RQP B;  2RMU 1;  2YYO A;  1G7Y A;  2Q30 A;  4LIT A;  4WVW A;  1Q8O A;  4CCJ A;  2WN2 A;  3N35 A;  1ZA4 A;  4H7M A;  4YGE A;  2WO1 A;  1PO2 3;  3ZO0 B;  5DN2 A;  4KBZ A;  3A7Q A;  1RUG 1;  4MZU A;  3S5Q A;  4DFS A;  3B5L B;  3WZ1 A;  2XVG A;  5LBF A;  4QKN A;  4AHZ A;  4L97 A;  4FT8 A;  4S2D A;  1QGL A;  3D3A A;  3POE A;  4P08 A;  5KHG A;  3V0A B;  3R4D B;  2C24 A;  3HN3 A;  3I2G A;  4FTS A;  2OUH A;  1RUH 2;  1W05 A;  3H50 A;  4XJZ A;  3J7N A;  3WDW A;  5LB6 A;  4ES8 A;  3LA3 A;  2AEN A;  5AVP A;  4KNC A;  2W3J A;  3TN9 2;  1JUI A;  5F7U A;  4JGZ C;  4F8A A;  1JHJ A;  3WP4 A;  2VBD A;  1V9U 2;  2E31 A;  1NAE A;  2PHW A;  3KQR A;  4BB3 A;  2Y33 A;  1W9Y A;  4PIX A;  5F5Q A;  2UWA A;  3RDI A;  3WQ7 A;  3X29 B;  2R06 2;  5IFT A;  2ZAB A;  5J96 B;  2UU8 A;  5SV5 A;  3HVD A;  4LBQ A;  1NCR C;  5FTT C;  4XDQ A;  1NKG A;  1LHV A;  1OLM E;  4FOW A;  1W39 A;  3HNB M;  1NA1 A;  1JYC A;  1Z0H A;  1D0H A;  2OPW A;  4XDP A;  5E89 A;  5FY5 A;  5FXZ A;  3UYJ A;  5HPO A;  4XFC A;  3EQE A;  4MGI E;  3U37 A;  1QJX 2;  2D44 A;  1PNG A;  2J1A A;  2E7A A;  3THT A;  5ABJ B;  4RS5 C;  1LOA A;  5FQ0 B;  4N53 A;  2BDR A;  3MI8 A;  3E1F 1;  4MGY E;  1S1A A;  1RUE 3;  3P3N A;  4XC9 A;  1V0A A;  3VD7 A;  2QNK A;  2VTX J;  3E5U A;  4LA2 A;  4NHX A;  4R4Z A;  1I3H A;  2ZAC A;  3TWI A;  1LJ7 A;  2EA7 A;  4RQP C;  4YZ2 A;  2OQ7 A;  3AZY A;  3KV6 A;  3M2M A;  4BU2 A;  1UZ0 A;  3M3O A;  1PGW 1;  1DYK A;  1CD3 G;  3IAP A;  1VBB 2;  4QPG A;  1W9F A;  2ARB A;  2HWF 2;  2K0G A;  2R07 2;  3FLR A;  4OCT A;  4RHV 2;  4IGP A;  4CCM A;  3LOB A;  3C7O A;  3N9L A;  1CZV A;  1TME 1;  4QPI A;  5IT6 A;  5LK7 B;  4OZX A;  1ODM A;  5LRS A;  4OHW A;  1EPW A;  4ASL A;  4A7Z A;  3FBM A;  3OF1 A;  4CDW B;  2ADE A;  4U2A A;  4CEW B;  1ND2 A;  1FX5 A;  4ARX A;  2HYX A;  4A7Y A;  2BVV A;  3ZDV A;  5C8C A;  5L7O A;  5B4N A;  3BPZ A;  2KD7 A;  1VMJ A;  2Z4F A;  4BQ3 A;  4P00 B;  4LA3 A;  1SMV A;  2WAB A;  3RQ0 A;  2BBA A;  3OUH A;  5FZ6 A;  2ZPX A;  3IKW A;  3VHO A;  4ARY A;  5LA0 A;  1IQD C;  5JOY A;  1W99 A;  2HWD 2;  4NVP A;  4P9Y A;  4AF9 A;  5HCA A;  5FY8 A;  2X5I A;  4M3C A;  3D0S A;  4IL7 A;  1W6M B;  3DEC A;  3DPR A;  3AZZ A;  3N7L A;  1OUR A;  1S0B A;  4PHZ A;  3TB0 A;  3WVJ A;  4IXL A;  1RUH 1;  2P5B A;  4DB5 A;  3DKQ A;  4XPV A;  5EJ3 A;  3VBO A;  3BAL A;  1WCS A;  2XHN A;  3DEM A;  4RSU A;  2TUN A;  4QM9 A;  3TN9 1;  3TNP B;  4BQ4 A;  2I2S A;  2RG4 A;  3VL8 A;  1AX0 A;  1JOP A;  1V9U 1;  5ABJ C;  3MHZ A;  4YW3 A;  3VHN A;  4YFZ A;  2R06 1;  4QQ2 A;  1AJO A;  4YZ5 A;  1HQN A;  3LDB A;  2FMY A;  1BVP 1;  3H1M A;  5DUV A;  3HPN A;  3HT2 A;  3SLI A;  4EN7 B;  4HSJ A;  2VMF A;  1Q5O A;  2IUW A;  2NP0 A;  3HQU A;  4URA A;  1KFU L;  3IDA A;  4AI0 A;  1QJX 1;  4XVH A;  1IS3 A;  2BOJ A;  2PHR A;  4OYU A;  1YIP A;  1D2S A;  4QMA A;  3VD9 A;  4QX2 A;  3HBK A;  2XLF A;  3M3Q A;  2WLQ A;  4Q29 A;  4CDW C;  5GLU A;  4FCA A;  5A1F A;  2VMC A;  1DDL A;  1FI2 A;  1F5J A;  5EIY B;  4XET A;  2P4E A;  2JG9 A;  1RHI 2;  2VUD A;  3E97 A;  3ES4 A;  5F2S A;  1VBB 1;  2R07 1;  2HWF 1;  4RHV 1;  5DZF A;  5FPX A;  1RIT A;  1ND3 A;  2VOK A;  1PX3 A;  2WFP A;  2WL1 A;  4JCK A;  4NOT A;  2V4V A;  3TOJ A;  2B39 A;  2RJK A;  2P37 A;  2JB8 A;  2WN3 A;  3LEI A;  4HOO A;  4LBN A;  3MW3 A;  4LXL A;  1MS4 A;  1QDO A;  1YWK A;  4PQ9 A;  4YZ3 A;  1WGP A;  2HKX A;  2JDU A;  2P6C A;  4YW4 A;  3WEZ A;  1ZM1 A;  2W87 A;  4LO6 B;  3M70 A;  1R08 2;  4P9J A;  1RUN A;  3WNN A;  2VW2 A;  1QJU 2;  2WYS A;  2ADD A;  2VNV A;  2Y8K A;  2HWD 1;  5FRA A;  5FZ8 A;  4TZD A;  5DAV A;  1NZI A;  3WF4 A;  1NLS A;  3AZX A;  4HET A;  2QTW B;  2HYK A;  4NE9 A;  3UKT A;  2VCM A;  2RVA A;  2ILM A;  4FPE A;  2CGO A;  4UW4 A;  3ZYJ B;  3OBR A;  3VKF C;  1GR3 A;  1F8V A;  1YCI A;  3KD4 A;  1TG7 A;  4LUM A;  1VBD 2;  1LED A;  3WNX A;  3BB6 A;  4CZS A;  3S5A A;  2VZP A;  4BMB A;  2OT7 A;  2TEP A;  1JBC A;  2YU2 A;  1LKN A;  2DYC A;  3LSD A;  4RGG A;  4QU2 A;  2P3J A;  4H14 A;  2LS6 A;  1I1E A;  2GMP A;  1N47 A;  1CAW B;  1WBL A;  3OD0 A;  2QDR A;  2ZGU A;  4GIQ A;  4A7K A;  5A70 A;  3NJZ A;  1H4G A;  2W46 A;  1LEC A;  3LFI A;  1ZBA 2;  2W08 A;  2HBT A;  5IVC A;  3DGT A;  2IWG B;  3N7K A;  2XJQ A;  3ZSE A;  4QWN A;  3MZH A;  4DXT A;  3KGZ A;  2E51 A;  2XWB B;  3M3I A;  2W1S A;  2R04 2;  1WLT A;  3D82 A;  3T2T A;  3LCP A;  4FO9 A;  1S0J A;  4AFB A;  4LKE A;  1YC6 1;  1SHW B;  2C6S A;  5JIU A;  1V70 A;  2WO3 A;  2WWJ A;  2Y0O A;  3H3U A;  3K2O A;  5JXG A;  1HB4 A;  4COY A;  4IV3 A;  1W6N B;  2ZS6 B;  4UI9 L;  4LLO A;  2VMI A;  3SEP A;  5J48 A;  3J9S A;  2DVB A;  3E6D A;  1DGR A;  1C5H A;  2B45 X;  4BIO A;  2VH9 A;  4CUB A;  3GGL A;  3VZL A;  1AR9 3;  4A44 A;  3Q8A A;  2RR1 3;  3QBQ A;  1RHI 1;  4LKD A;  1RUF 2;  3NWK A;  5IHR A;  1GQG A;  1L7R A;  3I97 A;  3M3C A;  3UET A;  3III A;  2XWJ B;  4ZU5 A;  1L3J A;  4TLF A;  4EN9 B;  1G9D A;  2B46 X;  2G9F A;  2ZXQ A;  3W20 A;  4A45 A;  4AEM A;  1COV 2;  1CIY A;  1REF A;  1IPJ A;  4ZZ5 A;  2R49 A;  3CBN A;  1EAH 2;  4MHR A;  2BJS A;  5CYY A;  4MOA A;  3V0B A;  1KS4 A;  4ATF A;  2H0V A;  3WQ0 A;  3LGR A;  2DUO A;  5IK4 A;  1EUU A;  2VQ0 A;  4JDM A;  1R08 1;  3GM8 A;  4AQ6 A;  4UWD A;  2A7A A;  1QJU 1;  1AXY A;  1UU4 A;  2P3I A;  4TXW A;  4O61 A;  1F4A A;  3T0A A;  1AYN 3;  3FZ3 A;  1CZS A;  2JD4 A;  4QGM A;  3WNO A;  2YY1 A;  3MW2 A;  4RA0 A;  5FMO S;  4XUO A;  5JXJ A;  5IFP A;  3ZXL A;  1OPO A;  1VBD 1;  4QX7 A;  4SLI A;  1S2K A;  1YNA A;  4E9K A;  3O0W A;  3K3O A;  1BEV 3;  3GCW A;  3U14 A;  1FMD 2;  1BQP A;  4P14 A;  4AHY A;  5BNO A;  2EID A;  5KBF A;  4HLT A;  4CUC A;  2R30 A;  3POJ A;  2W47 A;  2ZEY A;  4QGL A;  3ZXA C;  4DIQ A;  1ZBA 1;  1AR8 3;  4QKF A;  4Z2W A;  1LGB A;  4A3X A;  5BV6 A;  1AR6 2;  4KGG A;  4BZ4 A;  4Z92 B;  3RWN A;  2R04 1;  4CDU A;  4XTM A;  4K7J A;  1GWM A;  1TMF 2;  2PHT A;  4YRD A;  2HWB 2;  2HBU A;  4E2Q A;  3ZSL A;  5BNN B;  1W2T A;  4IE5 A;  3FE5 A;  2HH9 A;  4FOQ A;  5C5U A;  2JE7 A;  2W68 A;  5FCC A;  4AED B;  1US2 A;  1PGL 2;  5FMO L;  5JOX A;  4LHK A;  1XNC A;  1JH5 A;  1LTE A;  1RUF 1;  1W6O A;  2A6W A;  2VPV A;  1VP6 A;  3ETP A;  3KT4 A;  4MV2 A;  1ENS A;  5FZE A;  5JI9 A;  4H3W A;  1AJK A;  4XZU G;  4GKX A;  5C4W B;  1POQ A;  4QB6 A;  4RN5 A;  2IVJ A;  1WLW A;  4LO8 A;  1DZT A;  1Z7S 2;  2VZS A;  4HVQ A;  1CAX B;  1COV 1;  3HWJ A;  4Y3O A;  3ZFG A;  1EAH 1;  2WLP A;  4BQ1 A;  2D3P A;  3WNP A;  1PVC 2;  1W6P A;  1W9T A;  1P8J A;  3HQX A;  5FZ1 A;  1C1L A;  3ZX7 A;  2R1D A;  4QXB A;  3BTZ A;  1OI6 A;  4UFI A;  2JDA A;  4LMF A;  3GF6 A;  4CDX B;  1UZY A;  3RI9 A;  2WDB A;  1X33 A;  4YM0 A;  1W8N A;  4N8M A;  2RDQ A;  2KXL A;  3FFZ A;  1YQ8 A;  4UF0 B;  1GZW B;  3ECQ A;  2EAL A;  4MO3 M;  2RS3 2;  3V65 A;  4XQW A;  5BXX A;  3OUJ A;  4EWA A;  3BIW E;  4C8D A;  1UX6 A;  1PO2 2;  1XSQ A;  2Y38 A;  1DQ6 A;  4R4X A;  4H7L A;  1YIF A;  4JVA A;  2JJ6 A;  4LLF A;  5FZ4 A;  3DYP A;  2FDG A;  2ETE A;  1YFY A;  2Q1F A;  3CO2 A;  5A7W A;  4RR3 A;  1FMD 1;  5FYB A;  1DF0 A;  5BNN C;  3UL2 A;  3SIT A;  1OBN A;  2DVD A;  2VVD A;  4CCC A;  1KFX L;  5C5T A;  3AJZ A;  3K4A A;  4GWN A;  4QQP A;  2ZGS A;  5FWE A;  1RED A;  3MIB A;  1R1A 3;  2DDU A;  1OC1 A;  3VN4 A;  1AR6 1;  3WT3 A;  3B7M A;  2E9Q A;  3ACF A;  1J83 A;  5AC9 3;  2JDZ A;  2HLE A;  4HKL A;  3BOD A;  1TMF 1;  2HWB 1;  5C4W C;  2WRA A;  1LOG A;  5FY1 A;  2CL2 A;  1PMH X;  3ZKY A;  3W59 A;  3I2K A;  4RL7 A;  2JG8 C;  2P1B A;  3W21 A;  1NCQ B;  1PGL 1;  2E32 A;  4LOR A;  4ZXK A;  3UT0 A;  3WHU A;  4OHV A;  4Q0P A;  4QGN A;  1K3I A;  1UO9 A;  5DG2 A;  1VJ2 A;  4Z8B A;  5KHK A;  3LF7 A;  4MG2 A;  5LA1 A;  1RUH 3;  4YLZ A;  3VZM A;  4UW6 A;  3ZYB A;  3M1H A;  1RUE 2;  2GME A;  4I02 A;  3VKM A;  4YAR A;  3RZG A;  1CWP A;  4CPB A;  1Z7S 1;  1C5I A;  4I30 A;  1CAU A;  2P17 A;  4YVS B;  5FZM A;  4Y1X A;  3VL9 A;  4AFM A;  1PVC 1;  1ZZB A;  1YI7 A;  3O7O A;  5A7N A;  3ZM8 A;  4CDQ B;  5FZD A;  4Z1V A;  4FOV A;  4KG8 A;  3S0M A;  1BYH A;  1TE1 B;  4P9I A;  2A6V A;  3VDC A;  5IK8 A;  3FLT A;  4W4Z A;  3KF3 A;  4AG4 A;  1ULP A;  2VQU A;  1CAV B;  3ZYR A;  2A75 A;  2D97 A;  3HT1 A;  3IDC B;  1O7F A;  4Q4W 2;  5GLW A;  2RS3 1;  1XQN A;  1Q3E A;  2HEV F;  1FV2 A;  2O14 A;  4XEZ A;  3CDZ B;  3WR0 A;  1H6Y A;  2BU9 A;  2EXK A;  1OHF A;  1PO2 1;  3I2O A;  1JU3 A;  2QFE A;  5FK8 A;  4AK3 A;  1UOJ A;  4YZ4 A;  3T4V A;  2VNO A;  2C26 A;  2E6V A;  2RDN A;  4LE4 A;  3N7M A;  5J98 B;  2JXA A;  4HZF A;  3ZN4 A;  4GA9 A;  1JU4 A;  2UWB A;  3ILF A;  3LPG A;  1H2L A;  3LWC A;  4GH4 A;  3ZFE A;  5F6K A;  4PCR A;  1AF9 A;  1W8F A;  2ZAA A;  3HAG A;  4NN0 A;  1Y9G A;  2VMH A;  4CP9 A;  1JZ3 A;  2WS9 3;  4FOY A;  1NCQ C;  4O9G A;  4Q4X 3;  4B4R A;  3H3L A;  3AVR A;  1YFU A;  1JOD A;  2BGO A;  4Y1U A;  3SCF A;  1DFQ A;  1DYO A;  3POW A;  1SLC A;  5F6L B;  3KVB A;  1BXH A;  3ABZ A;  3RZM A;  4NID A;  1IS5 A;  2PHD A;  4XJW A;  1ULC A;  4ZU4 A;  1LGN A;  3NJX A;  1ONA A;  4DO0 A;  1ZRE A;  2VBB A;  3QCW A;  4YVS C;  1JYI A;  4XF3 A;  3WSO A;  1WW4 A;  2B9U A;  4O7X A;  1WW5 A;  4CDQ C;  1IS4 A;  1S0C A;  2JEN A;  5JI7 A;  4L99 A;  1SDD B;  3VBH B;  1VPH A;  4UYB A;  1RJ7 A;  3NV4 A;  1JYW A;  4AI3 A;  4J1X A;  1H1M A;  5JPN B;  2VTX A;  3T2Q A;  3S7I A;  2QKD A;  3KT1 A;  4Y5T A;  1RUE 1;  1S0G A;  5EFU A;  4FAH A;  5IAT A;  2Q1M A;  1QEX A;  1D0G A;  2YBS A;  4D6S A;  4IQP A;  3AZV A;  4B7E A;  1W8O A;  1W2N A;  1LNS A;  5FXX A;  4QX5 A;  4XAE A;  5I93 A;  2EIB A;  1H8T B;  3DYM A;  5HCH A;  5AVA A;  4NIA A;  1Y3T A;  1IGO A;  3EXU A;  2FHR A;  5A6X A;  1ASJ 2;  1H9P A;  2GC3 A;  1G6N A;  5G04 L;  4Q4W 1;  1GQH A;  2X09 A;  5JIA A;  3RMY A;  4D6R A;  3S30 A;  1S4C A;  1GOG A;  3VD4 A;  4RFT 0;  4K6B A;  3LFM A;  3FBY A;  5ACA 2;  2G9G A;  4F3J A;  2A6X A;  1QH7 A;  1VBE 3;  1OF4 A;  3NNF A;  5CBL A;  1MQT A;  4RFR B;  3MF9 A;  3E6C C;  1OOP A;  2GDF A;  4GQ7 A;  3ZOI A;  4A41 A;  4CVU A;  3ZFF C;  1RUI 2;  5EYX A;  3SCH A;  5T5L A;  1U5I A;  3M3E A;  4Q26 A;  3D8C A;  2ZEX A;  4XJA A;  4Y22 A;  3RZJ A;  3T0D A;  2DUR A;  1OKQ A;  3AMP A;  2KR2 A;  5CIS A;  1UY1 A;  4YGC A;  1IG0 A;  1OVP A;  4CU8 A;  3SH3 A;  3H1W A;  1F4H A;  3KCC A;  3IIA A;  4KMQ A;  2RDR A;  2I74 A;  3VD5 A;  5DAW A;  4LO7 A;  4DPN A;  4C1X A;  5A33 B;  5A3T A;  1S2B A;  4AVV A;  3KB5 A;  4FPC A;  3U4S A;  3RZK A;  3MUY 1;  4BHP A;  5FYU A;  5DMY A;  2DV9 A;  1WLD A;  1R08 3;  4K8R B;  4DXZ A;  5F8P A;  3VDB A;  1GMM A;  1GNY A;  1HQL A;  2OXB A;  5L9R A;  3NNL A;  5A7P A;  4XDO A;  3T3Y A;  1J3Q A;  1UKG A;  4IV1 A;  4ZPI A;  3O1U A;  1OQE A;  3FHA A;  4MH0 E;  2WNU B;  4MXW A;  1KDM A;  3KT7 A;  1UPI A;  4JGY A;  1ENR A;  1XC6 A;  3SCG A;  1YHF A;  5L73 A;  4Y20 A;  2HWC 2;  1E5R A;  5KXE A;  2RR1 2;  1GZC A;  4PBP A;  4PJY A;  3VDD B;  3ZXF A;  4AFA A;  4XBQ A;  2VMD A;  3OGV A;  1HN1 A;  3AMM A;  4NRQ A;  1XJA A;  2XVL A;  5FZO B;  4CA9 A;  4ZKT B;  5CFC B;  3H8X A;  4XUN A;  3N3H A;  1ASJ 1;  1JYV A;  1LUL A;  2UY9 A;  4DOU A;  2EIE A;  4W50 A;  2BEO A;  4Q27 A;  4ES9 A;  5FYS A;  1QJY 3;  5LAS A;  5GZF A;  3VBR C;  5IAX A;  3SIS A;  5ACA 1;  3BN6 A;  2ARE A;  1LR5 A;  4Q4V 3;  1QOT A;  5JMC A;  1DCS A;  2CAV A;  4D3W A;  2ZOE B;  4GMP 0;  1RUI 1;  1BBT 3;  1AYN 2;  2ZX4 A;  4FBF A;  5A32 A;  3EBR A;  4CP0 A;  1RUF 3;  3GZA A;  3S7E A;  1X8M A;  2D93 A;  4L92 A;  3MEP A;  2PMW B;  3ROU A;  3EB7 A;  3L2Y A;  1KRI A;  1COV 3;  4XFF A;  3THC A;  5A6Q A;  1EAH 3;  1BEV 2;  2X29 A;  3ZXE A;  1BK1 A;  3BOW A;  4NIH A;  2QDN A;  2A3W A;  2DVG A;  5DZG A;  1C8M 3;  3VKO A;  2D40 A;  3OBZ A;  4JHZ A;  4XZP A;  5A7Q A;  3PIG A;  2Y64 A;  4A3Z A;  5FYV A;  1PMI A;  2ZGP A;  1PM4 A;  1YJK A;  3JB8 A;  1OXC A;  3JUU A;  4I01 A;  2VZR A;  2ZGN A;  3ES1 A;  5BNP A;  1UW8 A;  2ZML A;  1QOS A;  3VBS A;  3VDD C;  5IW0 A;  2YMZ A;  1I5Z A;  5LWB A;  2VL4 A;  2ET1 A;  4NMI A;  1UKR A;  3OPZ A;  5FZA A;  4BXF A;  4QDR A;  4HVO A;  5C9A A;  5CFC C;  3M4F A;  1LAJ A;  1IZ3 A;  4RGA A;  4EN0 A;  1SCS A;  1CN1 A;  1PO1 3;  3LEM A;  4NWW A;  5T5J A;  3UKN A;  1W2U A;  1VBA 1;  2HWC 1;  4GD4 A;  2DU0 A;  2K46 A;  5GLV A;  4R9A A;  2RR1 1;  2OZJ A;  4ERO A;  3WW3 A;  1FMD 3;  2Y0I A;  1Q43 A;  5FZL A;  3GXU A;  5DAB A;  1OA4 A;  4FFH A;  5ANN A;  2DBI A;  2BTV C;  1F35 A;  1X9P A;  4PF1 A;  3CU7 A;  1W8U A;  2JDN A;  4FQZ A;  3H8O A;  3POG A;  3USS A;  1TMF 3;  3AP6 A;  3KCX A;  3NST A;  5GJ6 A;  5FMD A;  4IND A;  2CDO A;  1XNA A;  3VV1 A;  1W8T A;  2WNV A;  3AP5 A;  4Y24 A;  2GAU A;  4DNY A;  1D7P M;  2YFZ A;  3GBW A;  2VJX A;  1N1Y A;  2L9L A;  3EJK A;  1AX1 A;  4CU7 A;  1AYN 1;  1DLC A;  1WKY A;  3R6S A;  1O3S A;  5JVV A;  2ZKN A;  4TN7 A;  2LM3 A;  4HPK B;  3ACH A;  1ZZ6 A;  3WG3 A;  2ZX2 A;  4URT A;  5A1L A;  2W91 A;  1CGP A;  3OG2 A;  1BEV 1;  1VMF A;  5H9Q A;  5C3Q A;  1NA1 B;  1HRV 3;  1LOD A;  4WM8 C;  5I8S A;  1QMJ A;  4NHY A;  2D6K A;  3CKH A;  4XIL A;  4AI1 A;  4WM7 C;  5FYC A;  2VXR A;  1JS9 A;  4QX0 A;  1R09 3;  1HX6 A;  2GC0 A;  4M0N A;  1JYT A;  1DZQ A;  1R1A 2;  4EE2 A;  3PVN A;  4P5Y A;  3B3Q E;  5JDB A;  2RS3 3;  2B42 B;  3NNM A;  4AZZ A;  5AC9 2;  3RZH A;  1AUY A;  1B35 A;  2AEY A;  4KGQ A;  5EJZ B;  1Q8P A;  2O0O A;  4LR4 A;  2E7Q A;  2VU9 A;  2Q8E A;  4QPG B;  3B00 A;  4L8Q A;  2VMG A;  5EQU A;  4LUL A;  3AX4 A;  2DTW A;  3WDT A;  4COV A;  3Q9O A;  3RS6 A;  1YLL A;  1A78 A;  2BNO A;  2DCT A;  4KI5 M;  1HLC A;  5JUV A;  1OSG A;  1DIW A;  4FXK B;  2VUL A;  4FXG B;  3I4I A;  4K20 A;  3MFC A;  4OMC A;  2ES3 A;  1QWR A;  2JKB A;  5L7O B;  3TEX A;  2VGD A;  2ZJC A;  5F5A A;  1HW5 A;  2ZHN A;  4IEW A;  5CAD A;  4LBK A;  5HV4 A;  1ST8 A;  4YM3 A;  2JEM A;  3NV1 A;  2JX9 A;  2UYA A;  1HJG A;  2YBK A;  4AVS A;  2GNM A;  1OUS A;  1SLI A;  2FDH A;  5L19 A;  4JQT A;  4M3C B;  4YG6 A;  2BGC A;  4M0H A;  4V2V A;  2ZHM A;  3FUQ A;  1S2E A;  2CV6 A;  2GN7 A;  3I2D A;  5JZG A;  2HWE 3;  1RUC 3;  2IXL A;  3AL6 A;  1JN2 P;  2WO2 A;  2YV8 A;  1DU3 D;  2D7F A;  2MPF A;  2QE3 A;  4P02 B;  1ACC A;  1NA1 C;  4UT5 A;  4AR2 A;  1UY4 A;  4DXS A;  3LQC A;  3KM5 A;  1BCX A;  3MF6 A;  1X50 A;  4HON A;  1HB3 A;  1SDW A;  2D6P A;  2FDI A;  4N53 C;  4JGZ A;  5HI0 A;  1OH3 A;  3ITQ A;  5IWF A;  5I0R A;  3DXU A;  1GKB A;  2BNN A;  2OII A;  2VXJ A;  4R9B A;  2XJV A;  1LOC A;  3POB A;  1UL9 A;  2JDH A;  5C6C A;  3VBU B;  4Q4Y 3;  5EV7 A;  1NCR A;  4QPG C;  4Y5Z 0;  5FYH A;  2A3Y A;  2VBP A;  1QJF A;  3RVH A;  4AE2 A;  1K5M A;  1NUK A;  1LOE A;  5DAX A;  4QPI C;  2PEL A;  3MBW A;  5AFE A;  3WW1 A;  2VG9 A;  2WS9 2;  4XIK A;  5F1R A;  1MZ6 A;  4GMP 1;  4Q4X 2;  4BK4 A;  3OGJ A;  1CZT A;  2EVX A;  3HOB A;  3MUZ 1;  4XUQ A;  1R1A 1;  2QQV A;  2C5D A;  4OZO A;  4Q4W 3;  5A1A A;  5AC9 1;  3RSJ A;  5C3S A;  5L7O C;  1SPP B;  3I3Q A;  4XE9 A;  2D6O X;  3W58 A;  3WIN E;  1K42 A;  1O5L A;  2B9V A;  1ND3 B;  2WA4 A;  2BYV E;  4JTO A;  2XL9 A;  1F31 A;  1Z78 A;  2ZKL A;  3I2F A;  1JZ5 A;  5FP3 A;  2CHH A;  1QXR A;  3AKS A;  3HJR A;  2RS1 3;  4D69 A;  3ATG A;  3DPR C;  5DAQ A;  4FQ4 A;  2NM1 A;  1SBE A;  1WWY A;  3I3B A;  4F83 A;  1SEF A;  3ST7 A;  4X6R B;  4ASM B;  3V0A A;  1O4Z A;  2VNG A;  3VKL A;  3ZMN A;  2BZD A;  3MV1 1;  3B02 A;  4XFH A;  1OD3 A;  3C7G A;  4FVV A;  3BTA A;  4Q8K A;  2A6Y A;  2P34 A;  2WFF 3;  5FPZ A;  4YG3 A;  4MGQ A;  1SFY A;  2YPJ A;  4HSL A;  1QF3 A;  2C9A A;  4A6S A;  4N7U A;  4XIO A;  4LE3 A;  1IPK A;  2GMM A;  1JZ4 A;  2HEY F;  3NNG A;  2WWS A;  3ENR A;  4C0B A;  3A23 A;  5CFD A;  2PXJ A;  4NPM A;  2G9Z A;  2QZ3 A;  3GNE A;  4LIV A;  4YVW B;  3VBU C;  1J84 A;  3J4U H;  1UX7 A;  3OY8 B;  2F4L A;  3NMB A;  4W8J A;  3I3D A;  4AI2 A;  1VBE 2;  2F4P A;  3JQX A;  1MS1 A;  1DQ0 A;  2AH2 A;  3J8F 3;  3PME A;  2Z5W A;  1Q8S A;  3BGA A;  5ABJ A;  5FQ0 A;  3U78 A;  2GSY A;  4QDS A;  2JG9 C;  1NY7 2;  1S0D A;  4IE6 A;  4XMA A;  1MZE A;  4FPK A;  1ND3 C;  2FCV A;  4HFS A;  1W03 A;  2WS9 1;  4Q4X 1;  1ASJ 3;  2RE9 A;  4IV3 B;  4Z2A A;  5ISL A;  5A3W A;  3GJA A;  3ELN A;  4O9E A;  1FNY A;  3O1S A;  1SLA A;  2ZGQ A;  4MGZ E;  4CP2 A;  3ZSK A;  2PHL A;  3POF A;  4HAN A;  1GP5 A;  2MEV 3;  4QAW A;  2CNA A;  5CZK A;  4CDW A;  4LIU A;  4CEW A;  4DS0 A;  5ACA 3;  1RUD 2;  3HBZ A;  3O1O A;  1BVV A;  2D6L X;  2Z42 A;  3LA7 A;  1YQ2 A;  3BU7 A;  4QX1 A;  1LEN A;  4QHB A;  1RMU 3;  4XFA A;  2WJS A;  5T52 A;  2Q8C A;  4GJZ A;  3PVB B;  4P5H A;  1RUI 3;  1XNT A;  5CU1 A;  5A3L A;  4IEO A;  4KH9 A;  4AVC A;  3PDQ A;  1WD3 A;  3CQO A;  3BI3 A;  2VC9 A;  3OD4 A;  4K1Z A;  3O1T A;  3LKJ A;  4XBN A;  2XG3 A;  3FHQ A;  1W6M A;  5FZG A;  3WP6 A;  3NW4 A;  1KDK A;  5SV8 A;  3RYR A;  1LHO A;  3UV9 A;  1HB2 A;  4YVW C;  4PI2 A;  2XKP A;  3B94 A;  5CA6 A;  4AHW A;  2ZGM A;  2YDE A;  2WUH A;  1UU6 A;  4RD7 A;  2ZTN A;  3N7J A;  5CKQ A;  1JYN A;  4JDO A;  1OA3 A;  3I59 B;  1ZYB A;  1ENX A;  1B09 A;  1RXF A;  2PAM A;  3HNY M;  2J1S A;  1W3V A;  1X7N A;  1O91 A;  2E26 A;  1GP6 A;  3D4K A;  1ZRR A;  3L2H A;  4I0W B;  4MVT A;  4U36 A;  5FZ7 A;  4AOC A;  2VR4 A;  4XBL A;  4KWU A;  1QJY 2;  3KS7 A;  2ZGO A;  4S2G A;  1ZRD A;  2BW8 A;  1VBE 1;  4Q4V 2;  3ZXK A;  4GXL A;  5BNO B;  4IV3 C;  3K77 A;  4KQ7 A;  3LE0 A;  1IOA A;  2C9K A;  2OQ6 A;  1X9T A;  2ZZQ A;  4H55 A;  1VBA 3;  1WMX A;  2HWC 3;  5IVY A;  1H2K A;  1U12 A;  1WMD A;  2QZ2 A;  5FJH A;  1BBT 2;  5HCF A;  5CG8 A;  2B7Y A;  2DCK A;  1RC6 A;  1TQ5 A;  4Y5S A;  2V5D A;  1F5F A;  4IEX A;  3MID A;  2XPJ A;  1NY7 1;  3VZK A;  1C3H A;  2A73 B;  2FDF A;  1NXD 1;  3L9J T;  1Y7B A;  5FMC A;  2W1U A;  3WHT A;  3VKN A;  4XOG A;  2LRO A;  5KXC A;  3J7H A;  3PU8 A;  5JR2 A;  2KM2 A;  1GOH A;  4FFF A;  1OLM A;  2ZBJ A;  3OGS A;  2F17 A;  2BBV A;  1C8M 2;  2FQP A;  2YRO A;  2VZT A;  4LK7 A;  3ZPY A;  5C71 A;  3AXD A;  3OSD A;  5K9Y A;  4ZU7 A;  4JKM A;  4QD2 A;  3NAP A;  1W6O B;  1RUD 1;  3PIJ A;  1JUH A;  2E7T A;  3NV2 A;  4LHL A;  3TBD A;  4MGT A;  2OS2 A;  1WW6 A;  1T6B X;  1ULE A;  2ZAH A;  1QOO A;  2F6B A;  5FYM A;  3ZN6 B;  5A3O A;  2HEW F;  4EZH A;  3WW4 A;  4Y4Y A;  2W95 A;  3AYC A;  1LOF C;  1QU0 A;  3PHM A;  4JAA A;  3ZYG A;  2Y60 A;  1PO1 2;  4Y26 A;  1EYB A;  4X8N A;  4MLO A;  2H6C A;  3WF0 A;  4AAX A;  1XNB A;  5F9T A;  5J3U A;  4BOW A;  5DDJ 3;  3TEZ A;  2VCA A;  3E5X A;  2UWC A;  2XJS A;  1W9W A;  4K9S A;  1POV 0;  1GBG A;  2Y6J A;  3MW4 A;  5BNO C;  4XXP A;  3THP A;  4OHY A;  1URX A;  4XUT A;  1O59 A;  1CAW A;  1AYM 3;  2PYT A;  4B1M A;  1GNZ A;  1QJZ A;  2JIJ A;  2XJT A;  4NUB A;  2Y6H A;  2FZ2 A;  2Z2S B;  1PGS A;  3CMG A;  3H3Z A;  2WZE A;  1F9K A;  1QJY 1;  2B4K A;  1JMU B;  4IGO A;  5EXO A;  4LT5 A;  4D0Q A;  4OQ8 A;  4Q4V 1;  3MDP A;  3P3P A;  2XUM A;  4XJU A;  4TWT A;  3OGG A;  3POS A;  1AZD A;  1BBT 1;  1BJQ A;  1W6N A;  2BOI A;  3VHR A;  4EWD A;  1W2O A;  3GDB A;  3CL1 A;  1AL0 G;  2VE1 A;  5CEH A;  5LBC A;  2ZGR A;  5FZ9 A;  2PAE A;  4GUL A;  1K45 A;  1ULD A;  3B93 A;  4XYX A;  1CON A;  5CNA A;  1WCU A;  4IE7 A;  4QHZ A;  1RVF 3;  3WQ1 A;  2JG8 B;  1HRV 2;  2D43 A;  3PUQ A;  3LA2 A;  1C8M 1;  1V6L A;  1TEI A;  2Z69 A;  3HMY A;  3I3E A;  2AYH A;  3IAQ A;  3SXW A;  3JD7 3;  1JTZ X;  1UOF A;  1M4W A;  1R09 2;  2Q1Z B;  4MAD A;  3LD8 A;  1C57 A;  1VAK A;  3KV4 A;  3WP3 A;  5FPB A;  3CHX A;  2XHK A;  5K0U A;  1DQ2 A;  5T54 A;  3SKV A;  4JV4 A;  5HBA A;  1PK6 B;  3N9O A;  1XXN A;  3PVE A;  2Q5T A;  5B2G B;  5LEJ A;  5FY4 A;  1CES A;  5C7G A;  1OQD A;  1YYN A; 
#chains in the Genus database with same CATH homology
 5FP7 A;  5FP8 A;  4Y33 A;  5FUN A;  5FY9 A;  4AI9 A;  5IVV A;  5F39 A;  3LDB A;  5A3P A;  2OQ6 A;  5IVY A;  5F3G A;  5FPV A;  3KV5 A;  5FJH A;  4CCK A;  2YU1 A;  5A3T A;  5FY0 A;  3PTR B;  3PUR A;  3U4S A;  4URA A;  5FP3 A;  5FPA A;  5FZM A;  5FYU A;  3KV9 A;  4QX7 A;  4AAP A;  4LIT A;  4QXH A;  5A7N A;  4CCJ A;  3K3O A;  3AVS A;  4ASK A;  5F37 A;  3PU8 A;  3PUS A;  5FYY A;  5FZD A;  5A1F A;  4D6Q A;  5A7P A;  4XDO A;  4EZ4 A;  5FZC A;  4TN7 A;  5F3E A;  5F32 A;  5F2S A;  4CUG A;  4DIQ A;  2YBP A;  4Y4R A;  4QU1 A;  5A1L A;  5FYT A;  4CSW A;  2GP3 A;  2OS2 A;  3K3N A;  5FZO A;  4IGQ A;  4V2W A;  5F5C A;  1VRB A;  3ZLI A;  4HOO A;  5FYM A;  5FPL A;  5FZI A;  4LXL A;  5FYC A;  4EZH A;  5FZK A;  4BIS A;  2PXJ A;  2XUE A;  4LIV A;  5FZO B;  5FY7 A;  5FXW A;  5A7S A;  5FZ0 A;  5FZ8 A;  2XDV A;  3PU3 A;  5FYS A;  5FZE A;  2Q8E A;  3N9N A;  4EYU A;  5FPU A;  2XML A;  3AVR A;  3U78 A;  5FY5 A;  5K4L A;  4XDP A;  3N9Q A;  5F3I A;  5FXZ A;  3UYJ A;  5LW9 A;  3KVB A;  4Y3O A;  4NUB A;  3NJY A;  4QX8 A;  5FP4 A;  5LY2 A;  5FZ1 A;  3N9P A;  4DO0 A;  2OT7 A;  3KVA A;  4UF0 A;  2YPD A;  2YU2 A;  5FBJ A;  5IVB A;  5A7O A;  4QXB A;  5ISL A;  5FXV A;  5F5A A;  5A3W A;  4IGO A;  3PUA A;  5FP9 A;  5IVJ A;  5LY1 A;  5FZB A;  2OQ7 A;  4GAZ A;  5ANQ A;  2YBK A;  3KV6 A;  4BU2 A;  5FWJ A;  4UF0 B;  4LIU A;  4GJY A;  2GP5 A;  4IGP A;  4CCM A;  5E6H A;  5F3C A;  5IVC A;  3N9L A;  4QWN A;  2Q8C A;  5FUP A;  4V2V A;  4C8D A;  4GJZ A;  2OX0 A;  2YBS A;  4D6S A;  4CCL A;  3OPT A;  3PDQ A;  5CEH A;  5FXX A;  2WWJ A;  3AL6 A;  5A7Q A;  3K2O A;  5FZ9 A;  2VD7 A;  5FYV A;  5FYZ A;  4QXC A;  5FZ4 A;  2Q8D A;  5KR7 A;  3AL5 A;  5FZH A;  5A7W A;  5FZG A;  5IW0 A;  5A80 A;  4HON A;  5FYB A;  3OPW A;  5FZ6 A;  3PUQ A;  5LWB A;  5FZA A;  4BXF A;  5FJK A;  5FYI A;  5IWF A;  3DXT A;  5FY8 A;  4D6R A;  3DXU A;  5A7W B;  5FV3 A;  5F2W A;  5FWE A;  3LD8 A;  3KV4 A;  5FPB A;  5IVF A;  3N9M A;  4E4H A;  4CCO A;  2P5B A;  4GD4 A;  3ZPO A;  2XXZ A;  5FZF A;  5FZ3 A;  5IVE A;  5FYH A;  3RVH A;  5F5I A;  4CCN A;  5FZ7 A;  3N9O A;  5A3N A;  2W2I A;  2WWU A;  5FY1 A;  5FY4 A;  5FZL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...