1OH3A

E78r mutant of a carbohydrate binding module family 29
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
141
structure length
141
Chain Sequence
RATYTVIFKNASGLPNGYDNWGWGCTLSYYGGAMIINPQEGKYGAVSLKRNSGSFRGGSLRFDMKNEGKVKILVRNSEADEKFEVETISPSDEYVTYILDVDFDLPFDRIDFQDAPGNGDRIWIKNLVHSTGSADDFVDPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Carbohydrate binding domain
molecule keywords NON-CATALYTIC PROTEIN 1
publication title Ligand-Mediated Dimerization of a Carbohydrate -Binding Module Reveals a Novel Mechanism for Protein-Carbohydrate Recognition
pubmed doi rcsb
source organism Piromyces equi
total genus 32
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-05-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 1oh3A00
1GWKA 2LRPA 3ORJA 1V0AA 1UOJA 3F95A 2KR2A 4LJHA 4YW7A 4YWAA 2VXJA 4BQ2A 4BQ3A 1OH3A 4LKDA 4LKFA 4BQ4A 1WZXA 4CP9B 2K46A 1W8ZA 1GWLA 4LKEA 3ZYFA 1WCUA 1GWMA 3ZYHA 1OKOA 2C24A 4AL9A 5D21A 4A6SA 4YW6A 1W9FA 4BQ5A 1W8TA 2WYFA 4LK6A 3UT0A 1W90A 4CPBA 1HN0A 1W8UA 1L7LA 3ZYBA 4LK7A 2O14A 1WMXA 1W8WA 4CP9A 4CPBD 2JWPA 2Q1FA 2LROA
chains in the Genus database with same CATH superfamily
5C9AB 1JZ4A 1XE7A 4DMIA 5JOXA 2A7AA 4A3XA 1VAKA 5HPOA 1XNDA 1FPN1 3ZFFC 4Q4Y2 1OLME 1WLCA 2CAVA 2RR11 4LJHA 3ZYRA 4CEYC 4QGMA 3WVJA 1DQ6A 5C5TA 1LHVA 1PO21 4WM7B 3H3LA 2ZGNA 4BWOA 2HBTA 2VTXA 2FDFA 1G9CA 5IVBA 1HB2A 1UAIA 3UNPA 4ZZ8A 1AR83 2FHRA 4K8RB 2VOVA 1LHUA 3SQOA 1MS4A 2XQRA 3PU3A 1KXGA 1SPPB 3BTYA 1G6NA 3IDAA 1J1TA 3UKVA 4CCNA 3PUAA 1MZFA 2WS91 4QAWA 2FBEA 5ERLA 5GLWA 4DUXA 2WNVC 1QJX3 1U12A 3JBG3 1O3RA 4BCUA 4Y22B 3WNKA 1HDKA 5IVYA 1CPMA 1GFF2 1OQ1A 3ZOIA 4UW6A 1VIWB 4JC1A 1C1LA 1WLDA 3MIHA 4GZ9A 3WP5A 2AGSA 5BPXA 4LO8A 1OH3A 2XHNA 4RGGA 1VBA2 1WZXA 4X8PA 1SLLA 3H8OA 4XETA 5F9TA 2VD7A 4FFIA 1GWMA 2ZEZA 4CU9A 5FBZA 2W9XA 3JD73 3FHAA 4Y1YA 2DCKA 1EUTA 3A0NA 2RM23 1ZNPA 2VNGA 3I8TA 4QHZA 3BKZA 1RB8G 4XXPA 4C1WA 4JDNA 2WA4A 3E5UA 3IKWA 1QGLA 1CAWA 4NMIA 5DQ0A 2PAEA 4LITA 4O65A 3LFMA 3PURA 4AE2A 1JYNA 4AGGA 3PNAA 3IPVB 1ACCA 4PT6A 4Z07A 1FI2A 1GNHA 1RUF2 2Q8EA 2TEPA 2JD9A 4IEVA 5EJ3A 4YFZA 3H7YA 4ZXKA 3RJ2X 1CPNA 1POV1 2VMDA 2KXLA 2XVLA 4GMP1 4LBMA 4MXWA 5BNNA 2E31A 1FNYA 2Y6LA 4KU8A 4K20A 2ENRA 1AHSA 3S5AA 4N43A 3U14A 2W46A 4A41A 1V6MA 4BXFA 3UJQA 3D0JA 1PZ9A 2C5DA 1GP5A 1SFNA 1F2NA 2JDNA 1GKBA 1JUHA 2RDRA 1WLTA 1F4AA 3DN7A 3VKMA 3ZFEB 2X29A 1YFUA 3MF6A 5F5CA 1UY1A 1W6OA 2VXJA 1T2XA 3JB4C 3PU8A 4BYYA 2CTVA 1UX6A 3ILNA 3ZR5A 2MEV1 2QQJA 2Q1ZB 2CGNA 3OYWA 2DDUA 2FQPA 1POQA 3HWJA 3GGLA 5I8YA 1PX4A 2C9KA 1BK0A 1LOFA 2O1QA 4A42A 5FRAA 3PIGA 2ZMLA 1NY72 1D2SA 1O4TA 5FXVA 3RMXA 3T2QA 5A3UA 1LOAA 2FZ2A 1HLCA 1IPSA 1QMJA 5IK4A 3OOXA 3GM8A 2RS33 2Y34A 4LHSA 4CCLA 2C4XA 3CKHA 5LW9A 3WNXA 5F3GA 3KT1A 4IESA 3AP9A 4KMQA 1UZ0A 3W9AA 1IQAA 1QJU1 1FOD1 2ZA9A 3EXUA 1J59A 3RNSA 1JOJA 1YNAA 3HN1A 1SMVA 3SH4A 4YVWC 1ZZ8A 3B5LB 4CVUA 5FZKA 2GU9A 4CA9A 1SLAA 2WIIB 1JHNA 1UU6A 1EP0A 3B01A 4Q1RA 3HBZA 3B93A 1KEXA 1PM7A 4NRQA 4DZGA 2ARXA 4XCAA 3TEZA 1V6IA 1ZZ7A 2JDAA 2N7GA 3EQEA 5EZWA 1PO11 4L8QA 1XJAA 1DHKB 4GH4A 4E2QA 4XFBA 1ONAA 1LENA 4I3PA 5FYTA 3PJYA 2XWBB 1ZRRA 3WR0A 1WD4A 3RS6A 1PK6C 1AR92 4YZ4A 3ZIXA 1COV1 2JDUA 1LULA 1R083 3WDUA 4GULA 1UKRA 5BNNC 2WNEA 2V5DA 1GP6A 1QQP3 1EV13 1SBFA 5FY9A 4LBQA 5EIYB 3WQBA 1AR63 3DUIA 4N43C 1ZBE1 1DDLA 4CU6A 4BU2A 2WN3A 1YLLA 1MZ6A 2C24A 4YZ1A 2R49A 1CAVA 3DEMA 1RUD1 3FLTA 4BLJA 4YG6A 4UFKA 1WMEA 5FZAA 2QQWA 2Y0OA 1L3JA 1AXYA 1U5XA 2HWC2 3POWA 4KI5M 5JZGB 2B39A 3QLQA 2L9LA 3SNMA 2J1RA 3B9IA 2BVBA 2VPVA 5F7UA 2WZR3 3LPGA 3ZXLA 3ILRA 3WCRA 3CBNA 5HXVA 1MS9A 1LOFC 2VQTA 2QQIA 2EAAA 3AMPA 1A8DA 1V70A 2R063 4Q0QA 5KXDA 1L7QA 1U5IA 3M2MA 4A6OA 3VBUA 3JXSA 4UFJA 4FTEA 1OMIA 4Z1VA 2HWD2 3GZTB 3PVNA 1DQ1A 4CDXB 3E5QA 4HONA 5EXOA 1AR72 3TRSB 1TE1B 3UGFA 5FYMA 1DGLA 3ZYHA 4BMBA 2GH8A 4C1XA 4M4PA 5FYVA 3S57A 2A6YA 1BBT2 2WO3A 1Y7BA 1NCQB 4YRDA 4JZRA 2R6QA 1ZX5A 2AYHA 5FYIA 3VN4A 2VOKA 3ACLA 3GBWA 5AVAA 5HBAA 3ACIA 4UAPA 3UGHA 4BISA 1H6XA 3AZWA 3N7KA 2RMU2 4WM8A 2PQSA 3ME2A 4BE3A 3HAGA 2E32A 1NE6A 1NA1B 1URXA 2ZJCA 3MBWA 4EN9B 1SBEA 3OBZA 3NNMA 1HIXA 4AI0A 4X6RB 5EYYA 3BALA 3DYMA 3J7LA 3N7JA 3ILFA 1R093 2NP0A 2WWJA 4M3CA 4LBOA 2BGCA 4LK6A 1YHFA 2WL1A 2IXJA 4AAXA 5EPAA 3VDBA 1N3PA 1Q8PA 3HOBA 3MW2A 1L7LA 3MUZ1 1JU3A 2E9QA 2DCJA 2VOXA 2W3JA 4JCKA 3BU0A 2ZHKA 3OEBA 2Q8OA 3VDDB 4PIZA 2OPKA 4QM8A 4SLIA 2LROA 2R32A 3ZXDA 4XDOA 2X5IC 5A3PA 5F1RA 1MR5A 4YZ5A 5A3NA 1RUI3 1OPMA 3NO8A 4HVRA 1UL9A 3FMGA 1SFYA 5C8CA 3DL3A 4FVVA 2XBO1 4JGYC 1W8ZA 2ZTNA 2WABA 1WKYA 3AP5A 2R1BA 1ZRCA 3H42B 1PIV2 1SLIA 2WSVA 5JI9A 5IK5A 1VRBA 5J37A 1C57A 2DFCA 4QQHA 1UZZA 3MICA 4LPLA 2YV8A 1JBCA 4CSWA 1W6MB 1WWYA 4XJZA 5L19A 2FDIA 3VBUC 1BZWA 4I0BA 3SISA 4EWAA 2CAUA 4OMDA 1JYVA 5FKCA 3AYAA 4HKLA 2VE1A 2RS12 2VZ3A 3DYOA 3GYDA 3MPBA 4PDWA 1V6OA 4L0PA 3ACFA 3VDAA 2EICA 2W47A 1ULGA 1HJFA 3ATGA 2WZPP 2BV4A 2JE8A 1PVC1 1LEDA 1VBD1 1UMIA 5J1XA 1QIQA 1NUKA 5FMOS 5C3RA 3ZDVA 5F2WA 5FUPA 3OGRA 1RVF2 4P14A 3C2UA 4E4DX 5JPNB 4AK3A 4JTNA 1H30A 1O7FA 3VL8A 2Y6HA 1QH7A 5AFBA 4WM8C 2H0VA 3WW3A 1D7PM 2EIEA 4LBJA 1YWKA 1CIYA 1EY2A 4ZY9A 3UT0A 4CCKA 3AJYA 4D7YA 2QQMA 2VTFA 3S30A 1CX1A 1EPZA 1ZA4A 4AQ6A 1Y9QA 2A73B 5I0TA 2IUWA 3AP4A 3WP3A 2TNFA 3PDQA 1ASJ2 3PVBB 3POEA 4YM2A 1BEV3 1H2NA 1YUDA 1FMD3 2DUPA 3IAPA 4RHV1 5JOZA 1Q8VA 1V9U1 4KGQA 1VBC2 5D8AA 5AC93 4AI1A 1OFSA 5CBLA 1RINA 1RUJ1 2VZ1A 1HRI2 2CSGA 2YBPA 3BTZA 3BIEA 1H9WA 1TQ5A 2R16A 1W99A 1XNBA 4LBQD 1RUG1 2VXRA 2UURA 5ANNA 4CXYA 4NIGA 1Z7S3 1ULFA 4RR3A 3NNLA 3U4SA 5FYSA 2XXZA 4C91A 3FBMA 2Y6KA 4Y20A 1EPWA 5DDJ2 1WMDA 3A22A 4A45A 2R7EB 4NWWA 1KITA 3RFRA 4YVSB 2XB6C 2FDHA 5C8CC 1UMHA 4GWMA 1IZ3A 1WUVA 4COWA 2ORXA 1OF4A 1DGRA 3NJXA 3POSA 3BTXA 4CEYB 4NPLA 2GMEA 3T4VA 1CJDA 4B3NA 1RXGA 4Q27A 1W3XA 4XF1A 1PZ8A 2E7TA 2HWB1 1VBB1 2IC1A 2SBAA 4NUBA 1F35A 1RC6A 5H9RA 3WUCA 1IHMA 1W2TA 1W6NB 2W68A 2WQ4A 1H8TA 2WNUA 2WS93 4FPYA 4J6GA 4NHLA 2X05A 1CD3G 4Y24A 4QXCA 3LOBA 1BMV1 2D93A 4IV1A 3FZ3A 3THDA 4FP2A 4IEXA 4YLZA 2ZGLA 3ZYGA 4PDWC 1HQWA 2PHDA 4LHLA 3BU7A 1HQNA 3VKLA 5D2AA 2WWUA 3ZYBA 4XZPA 3EMRA 4FPOB 1LU2A 4LK7A 4XF3A 2Z69A 1C3HA 4IXLA 4RA0A 3TN92 1MQTA 3ZYIB 5LEKA 3N3HA 1OFNA 4HK8A 3VBSA 1DG6A 1U5ZA 1O5UA 3HN3A 3B94A 1R1A1 5KHKA 1WGPA 4AXOA 1FATA 2XWJB 4QB1A 3OY8B 5FYZA 2Q1MA 4XYXA 2VOWA 4XMIA 4CYDA 5I0DA 3B7MA 3Q8AA 3JUUA 4Y33A 3LFIA 4NPMA 2E53A 1BLZA 3AKRA 1JYCA 4SBVA 4QPYA 3KT4A 1JZ5A 1QF3A 1WBLA 2CHHA 5D8AC 1NE4A 4AQTA 3BGAA 1O8PA 1QXPA 1ULCA 1AYM1 3PLQA 3S0MA 5GJ6A 1F5FA 4FPLA 4CDWC 2OYZA 2ZGMA 3Q8EA 3J26N 3OGGA 3SH5A 5JSRA 1J1LA 3O14A 3NV4A 1N1VA 1UZVA 1POV3 4RR3C 3SITA 4KU7A 4XCBA 4GMP3 5CIRA 1QNWA 1OVSA 3QACA 4AVAA 4M01A 1DFQA 4JX0A 3HIFA 5KR7A 2WAAA 3C7FA 3N9OA 3O1SA 3ZYFA 5IFTA 4TWTA 5C3SA 1B35C 1UZYA 5FZFA 5IT6A 2RDQA 3OEAA 4YGCA 4JQRA 1H1AA 3AMNA 1CAXB 2UYBA 4I3GA 4WVMA 4DOUA 1H2LA 1HX6A 1HJGA 4YGEA 3U10A 3WF1A 4E9KA 3L9JT 3M3CA 2P34A 1VBA1 3GXUA 3T0AA 4D0QA 3R0RA 4ZXEA 3PHMA 2MEV3 2V4VA 1H8TC 1FXZA 2WA3A 4S2GA 4B7KA 5FDBA 1PX3A 3D4KA 3ZKYA 4NN0A 1H4HA 4XF9A 2PLV3 1PNGA 1NXD1 3CIHA 3CMGA 5I0UA 2EXHA 4CCCA 2EIBA 5I0RA 1QOOA 4WV8A 2GDFA 5I0SA 1WCKA 2XJSA 1SCRA 2UWAA 3CJXA 3VZKA 1ZREA 4IEOA 5L9BA 1AL22 1TG7A 3AL6A 2Y33A 3M7AA 2P6CA 4Q4W1 3SCFA 1O59A 1ZVFA 2PQQA 4KG0A 2R073 1FOD3 2QNKA 5D1IA 2D43A 1BQPA 4TN7A 1IS3A 1KFXL 2BJSA 1W8UA 1D4M2 1KGYA 5K4LA 4FFHA 4JKMA 2R0HA 1FYUA 1MEC1 3U07A 4HN1A 3B9CA 2OUHA 1RUC2 4YVWB 2YGLA 3S6PA 1PO13 5JXHA 4GXLA 4ARXA 4PIXA 1M4WA 3RWKX 3SC7X 4WVVA 3ASIA 5JI7A 5GZGA 3VBFA 1KD7A 3ZX7A 4R4XA 2F4LA 5CEHA 4YZ3A 1BKZA 2JG9A 3K48A 1YCIA 5FZOB 3AVSA 3ETQA 5JSPA 1K5MA 2QQOA 1S4CA 2R042 2BOJA 2EAKA 2WT2A 4XJ9A 4MOAA 3TOJA 4ZU5A 3U75A 2ZKLA 4CPBA 5F3CA 2BTVC 1UXXX 1IQDC 2W1WA 1QJY1 3I3EA 5EQUA 3RZGA 5FZEA 3RZLA 1PK6B 2WT1A 1KS5A 4MXWB 4META 1UQXA 1RUD3 4QPGA 5BNNB 5EJ1B 2D6MA 2ZEXA 1AJOA 4QX2A 3ZN4A 1LGBA 2ZZQA 4L99A 2Q5TA 4S2HA 2QDNA 3POJA 4N43B 4XEZA 3ECQA 5DUXA 3TEWA 1LGCA 2ADDA 2HWE1 2JDKA 3IMNA 5A3WA 4Z82A 4BOWA 4Q5OA 3UKTA 1JMUB 4DEQA 5LA1A 1UN1A 4L9BA 5ACA1 2WZ8A 5FY4A 1ENSA 1XPWA 3HEIA 3O7OA 4YW1A 2E63A 3SEEA 5BNOB 3VHPA 1NG0A 3MEPA 4LR4A 4MG2A 1XU2A 2WFF2 4GAZA 3CF6E 1WMXA 4AVVA 5B4NA 3OYWB 3MLJA 2BEOA 2XJTA 5K0UA 5LBBA 1Q43A 1RHI1 1MS1A 3ZN6B 1S0DA 1TVGA 2W39A 1OH4A 1PMHX 2R1DA 3AP7A 1C5IA 3GALA 4PIYA 4A3ZA 1QY4A 2PTMA 1A34A 4LNVA 2FD8A 1U0AA 2A6ZA 4ORFA 4XE9A 5LY1A 2ADEA 2ZX1A 5JMCA 3VB9A 2G4IA 2P3JA 4XQWA 4KBZA 3WP6A 2BBVA 3ELNA 1JXNA 3KF5A 5GZCA 3RGBA 3CEWA 3SMHA 1DGWX 4XQDA 3E6BA 3E6DA 4QB2A 4D7SA 1XSQA 4I30A 3KWVA 3RZKA 1HXS1 3VBFC 4HPKB 2UY8A 4EROA 1G9BA 1XYNA 1MVEA 1N3QA 5A3OA 3FL7A 4CCOA 4NHXA 2JG9C 1IPJA 5LK5A 4A44A 3VHOA 5FZCA 1DGRN 2HJIA 2H6BA 3MF9A 4AEKA 4XURA 5C4WA 3VBRB 3USUA 3FUQA 4Q4V3 5C5UA 4OCTA 4CXXA 2C9AA 3D82A 3LZZA 3AL5A 1CQ9A 3IWZA 3POGA 4LMFA 4XF0A 3VBHB 4B1MA 5L7OA 1G7YA 3V0BA 4NVPA 4QPGC 1W8TA 3DCQA 1YQ6A 1UX7A 4LBQB 4PI2A 1F8VA 2UYAA 1TME3 2I07B 4RD7A 5FZ0A 2X5IB 3MW3A 5C3QA 3RJRA 2QE3A 2ZX3A 2DFBA 1YIFA 3VZMA 3ZSKA 4ATEA 1OUSA 2NMNA 3RZJA 4UXAA 5FR3A 4JGYB 2D6LX 3JU9A 3WF4A 4FPFA 4MGIE 5CAZA 5I8SA 1CJPA 4MZUA 1D2QA 1UY4A 4M0NA 4CZSA 4EWDA 1GOFA 5A7NA 2V4AA 4OUSA 2YC4A 3UL2A 3RYPA 1ENQA 2JDZA 4GKYA 2O0OA 2R0FA 5JXIA 1DYKA 1RUH2 1XBFA 4QKDA 1PVC3 4R9AA 1LECA 1VBD3 2XUMA 1UYPA 3I2KA 3TBDA 3E6CC 5GKAC 3UETA 1DP0A 1WW6A 3DXTA 2Y26A 4N9IA 4OHWA 3H7JA 3VDCA 3H1YA 3MIBA 2YY1A 1GWKA 1XYOA 3WQ1A 4FOQA 3WW2A 5CKMA 4E27A 1E5RA 1HV1A 4E4ZA 5I8TA 4KWKA 3GCWA 3N36A 2BGPA 4OHZA 2VMHA 1ND3A 1JOPA 1UYZA 4QPWA 2VNVA 2VW1A 2GNMA 4LKEA 2IWGB 5KXBA 1I9RA 3WSOA 1G8WA 4WM8B 4RHV3 2VUDA 1AR82 1V9U3 4BIFA 5FO9B 2BRTA 2EALA 2Q0AA 4Q26A 5C7GA 4PI0A 3ZSMA 2WKKA 1RUJ3 4Z2AA 5FO8B 4ES8A 5C4WC 2RV9A 1OUXA 4R52A 4CPBD 2XG3A 1RUG3 4MX3A 1QJX2 1PIV1 3JBG2 5GLTA 3WW4A 4CEWA 2DVBA 2BOIA 3I4IA 4KNCA 4AVSA 4Q2FA 4H2AA 3MUY1 5T5LA 1ZRDA 1LHNA 4GJYA 4XAAA 4MHRA 4YZ2A 2PHRA 4OI1A 3FN9A 1ND2A 2YZ4A 4FTBA 2QCSB 3PIJA 3UGGA 1NQDA 3KGZA 5GLVA 3I3BA 1I6XA 1ST8A 3M3OA 4E4HA 2WT0A 2RS11 4FSJA 1WW4A 3I97A 1KFUL 3GZAA 3JD72 3CQOA 3O1RA 3IZOA 3ZXAC 1G9DA 2RM22 2IXHA 2HWB3 3OPWA 1VBB3 3VD9A 2HLEA 2PELA 4XFCA 3ZO0B 4Q8LA 4W50A 3J7HA 4DS0A 4CUGA 5I93A 3AKPA 1X33A 4XFIA 1Q5OA 3TNPB 3T2OA 5JPMB 1C8M3 4WVWA 1IG0A 4S2FA 4FPCA 2HYKA 2JE7A 2YB7A 1CGPA 2JECA 4DUVA 3JZVA 2W5FA 1RL3A 1S0CA 3BOPA 1GQPA 4M4RA 4LQRA 5LA9A 1ASJ1 3LF7A 4WBBA 4Y3OA 4D69A 1ULPA 2ZAAA 3URFA 3GBFA 1VRH3 2LALA 1VBC1 4NIDA 1R1A3 4FPHA 3KS7A 2YFZA 3JB8A 5DAVA 4L11A 4MYEA 1V6KA 2YBKA 4G3YC 5FZ4A 4FOYA 3J7MA 5A7WB 2GN3A 1DQ2A 1P8JA 3EHKA 1JODA 4XHBA 3RRDA 3ZLIA 4CTEA 1UF2C 2H0BA 2XL9A 4GWJA 1GU3A 4NIAA 1W8NA 2W2IA 4R9BA 3O12A 3PMEA 3VBOB 2EVXA 2AEYA 2GP5A 3ZVXA 4XIOA 3NQHA 4FXKB 1LHWA 4IE6A 4MUVA 5A80A 1GQHA 4CDUC 5ANQA 5FZBA 3HQRA 1AYM3 1CN1A 4P9GA 4ISRA 3C7HA 1TNFA 1VMFA 2A75A 1YI7A 3AZVA 3I2OA 4CEWC 5D8AB 3ZM8A 1B09A 4UF0B 1UOBA 4CCJA 1IG3A 3GHNA 1VALA 3LA7A 4CDWB 4JAAA 5BY5A 3MFAA 2QUOA 5EJZB 2RS32 4LBNA 5GALA 2GNBA 2LS6A 3KV9A 3QOPA 5J98B 3A21A 2EIGA 5FLJA 1JYIA 4OI0A 4RR3B 2WYSA 4NRMA 4W6WA 5LA0A 1CESA 4LLFA 5FP7A 3DPRA 3H0OA 2OT7A 3T2TA 3S7EA 4LE3A 5JVVA 1AUYA 1B35B 3VD7A 1I3HA 1SCSA 4O61A 2FCTA 3AMQA 4DY3A 3WW1A 4D6SA 1SBDA 1LTEA 3AXDA 3TNQA 1IOAA 2BGOA 4EN8B 1VBE1 1XE8A 2H6CA 4XJUA 3FE5A 2WQ8A 1KDMA 3V56A 1PVXA 2CYFA 2WWSA 1H8TB 1X36A 1W8FA 2B42B 1PGL2 4P9LA 4M0HA 3H8UA 4Q4W3 4XVHA 2BNNA 4ATFA 2BW8A 3OUHA 5T3NA 2GH2A 5E16A 1UW8A 1H0BA 5FIXA 1KDKA 1XB9A 3FHIB 1R082 2K9ZA 3WQ7A 4XMAA 1J3PA 1QQP2 1EV12 1RJ7A 2ARBA 1PZ7A 1W06A 2BFUL 4YWAA 1AR62 2ZHMA 3I3DA 2QBXA 4UYBA 3FX3A 1WCUA 4KL1A 4YSFA 3WDYA 1MEC3 1ZRIA 4QX8A 4UFHA 4JRAA 3LEGA 3ZYJB 2NYYA 4UFIA 3FFZA 5FP3A 4EWEA 5IWFA 4AEDA 3PUIA 5A6XA 1WBFA 4Y4RA 2HKXA 5LBEA 5CFCA 5L36A 3SKJE 1BCXA 2VNOA 4AEMA 5J36A 1OVPA 3NJZA 2WZR2 5T55A 1JTZX 1QNYA 3A23A 4HETA 2LM3A 3WNNA 2KR2A 1MPXA 1R64A 3BIWE 2R062 2ZGSA 3B00A 3W5NA 2RHPA 2J1UA 2CNAA 4AFDA 2VL4A 1QJY3 3ES1A 3C8XA 3ST7A 3DF0A 4BQ1A 4JHZA 2CY6A 1US3A 2FDJA 3RSJA 1DZRA 4AL9A 3J8F1 2B5HA 4AHZA 2HBUA 2RS51 1NQJA 1HB3A 3SHRA 5FPZA 4UFLA 4B29A 5DAPA 3WX5A 3DPRC 5DZGA 3IDEA 3ZFGA 4I0WB 2VMIA 3QBQA 5BV6A 2HWE3 4XPVA 5FREA 3VD4A 2PHXA 1AL21 4GKXA 3KMHA 3ZXFA 5BNPA 1KS4A 1WW7A 1W03A 3FBYA 5ACA3 5F3EA 3KF3A 1GP4A 2WFPA 3B3QE 2A71A 1ULOA 1Q8QA 2JG8A 2JICA 5K7PA 1ZBA3 4KG8A 2VCCA 4XHXA 4JGZA 1OT5A 1D4M1 4JHTA 2IVJA 2IXCA 3OBAA 5DXDA 3T08A 2HWF3 3ZMNA 4Q4X1 4YARA 5IYYA 5CG8A 5FPBA 4QKNA 2C6SA 4HLTA 4J1WA 1Z0HA 2VM9A 1RHI3 1GNYA 5HCHA 2J1TA 3LD8A 1R092 1IKQA 5JXGA 4IE7A 1UXZA 2ZKNA 2D6KA 3T09A 3I3QA 4N90A 5HV4A 4R9DA 3O1TA 1UY2A 1YJLA 4N7IA 1APNA 3KCYA 1FNZA 2CGOA 3T3YA 4YW4A 3T4HB 5IJRA 1NLQA 2DBNA 5FLIA 3RYRA 3OTFA 2VZUA 4JVAA 2RE9A 2R041 1RUI2 2RJKA 5CKNA 3ACGA 3H9AA 2FCUA 2J1SA 1MZ5A 3NAPA 4FT8A 5C71A 2ZPXA 5L9VA 5LB6A 3DXUA 4BQ4A 4GH4C 1HXS3 2QQVA 2VZTA 5CFCC 3LOIA 5F3IA 1W6PA 4N53B 4OI4A 1LOBA 5F32A 1DLLA 2JD4A 1RUE1 5FZ6A 4MXVA 4RN5A 1T6BX 1UY0A 2V73A 4YFWA 1GZWA 2I2SA 5A7QA 2BYVE 2P17A 5C6CA 3E1F1 1BK1A 2VZQA 2JG9B 3ZSLA 5ABJA 2ARCA 1LOCA 2HEVF 3WDXA 5JOYA 3HMYA 1NYWA 2ZS6B 1NCRB 1GQGA 1REEA 4QPIA 5SV8A 4LLOA 2W1UA 3RMYA 3ZFGC 2Y6FA 2ID4A 3G6JB 4Q1PA 1WCQA 5B2GB 5BNPC 1TMF3 4QPGB 3JCIA 5FZ3A 4HZFA 3WNPA 4TLFA 2JDYA 2WR9A 2JG8C 4RS5A 3H3ZA 4YNIA 1JI6A 3HT1A 5FQ0B 4BPZA 4WM7A 4JGZC 4ZHNA 3O1PA 5A33B 2WYFA 2AH2A 5FUNA 3R05A 1OA4A 1BEV2 4DO0A 4AEJA 1FMD2 3OGVA 2BNMA 2QDRA 4GB31 4U36A 5F8PA 5IVVA 4R4ZA 3WXPA 1VAVA 3GNEA 3N9QA 3P5BA 5C70A 5AC92 2QVSB 3U11A 5FAXA 1SPPA 3NRUA 2LTNA 3I2IA 1G9FA 2ZCWA 1IKPA 2X8KA 2YHJA 4EE2A 1Z7S2 1WA6X 1YQ8A 5AFEA 4AFBA 4Y22A 2TBVA 2DUOA 3T0BA 3D0SA 2W0XA 1W9TA 1XQNA 3AKTA 2G9FA 2IZWA 2A6VA 3QCWA 4HXCA 4NHKA 5IFPA 1J3RA 5K9YA 5HCBA 5IVEA 2E51A 1O3QA 1W39A 3NAPC 3PUHA 4XC9A 5LCWL 4QMAA 1S2BA 1E57A 2WO7A 4QQLA 2Q30A 1FV2A 4IV3A 3TYJA 1W0OA 3LQCA 2AREA 2PXJA 3K4AA 4RQPA 5FYBA 3RVHA 5JLVA 3POYA 5FYUA 5CNAA 2E7QA 4P9YA 1XNTA 1REFA 1YYNA 2VMCA 4XF4A 5A3LA 4ASLA 1WD3A 1S55A 4ZONA 4AQ2A 2RG4A 4EN6B 2DVFA 2WS92 2XR4A 3KV6A 4CP9B 5CFDA 1FT9A 1GWLA 1PMJX 3CJIA 4QHBA 3E5XA 3W5MA 5D21A 2QFEA 4OQ9A 5J96B 1L7RA 3IPVA 3O0WA 1QH6A 3T1MA 4CUCA 2XUEA 3VKOA 5C4WB 1FPN3 1UWWA 2D6PA 2RVAA 1ZZCA 2B4KA 2RR13 2XOMA 4LEJA 2GNDA 3LIHA 4QPIC 1PO23 3NW4A 2Z4FA 3AKSA 3K51A 3OGJA 3P1IA 4Y5TA 1XNKA 1HRV1 3ZFFB 1RMU1 1AYN1 4AHYA 1NZIA 4NHYA 1C5HA 3IM0A 4RS5C 3NVCA 2YU2A 3BCWA 5FXZA 4FFGA 4XUOA 4LKFA 4LOTA 3SKVA 3WD5A 2E33A 1PNFA 3KHBA 1YQ2A 1JOBA 3INAA 2YUEA 1LESA 2GNTA 4TZDA 3USSA 3LA3A 3PUSA 3ZFEA 4RFT0 2I74A 1RIRA 2ETEA 5CADA 1STMA 1AX1A 4EYUA 1NOVA 5EHDA 5A7OA 2JKBA 4E8DA 2E6VA 4Q0PA 3WG4A 2WNVB 2V5YA 4RSUA 1H8VA 1PHMA 3QH6A 3VD3A 1LCLA 3V0AB 2XLGA 3OPZA 4XJAA 3H8RA 1AR81 1W8OA 3CLPA 4AHWA 1RUOA 2WQZC 3Q9OA 3OBTA 1BVP1 2UWCA 4I2OA 4I01A 3K3NA 2HEYF 4DPNA 4IUGA 3VZJA 3NNJA 4JV4A 2GMMA 5DABA 2P2KA 4XTPA 3LWCA 1EAH1 4BK5A 4NJ4A 4ONUA 3KHCA 1O5LA 2A70A 1JYWA 2GC3A 4IV3C 3G7DA 5FZ1A 3K4ZA 4A6SA 4COVA 4BQ5A 4RQPC 3ZXJA 4K1YA 4H55A 1GLHA 4Q4Y1 4IEUA 3SH3A 5J09A 2QQNA 1WLWA 5BYNA 5CYYA 3MIFA 3RQ0A 3RPQA 3IN9A 2MEV2 5FZDA 5A6YA 1H2MA 2OQ6A 3U37A 5CFDC 1AF9A 1W0NA 1W04A 3CJIC 3RZMA 4HANA 4OZXA 3HQUA 4CDUB 4MGKE 1NXMA 2PLV2 1FV3A 1RUNA 4XABA 2Q4SA 4DFSA 1XC6A 2A3YA 3DECA 1CONA 4GD4A 1QJZA 3Q8FA 2RDNA 1MZEA 3GJBA 3BVCA 4CEWB 1OLQA 2J42A 2ZGUA 2Y64A 1X50A 5FWEA 2R072 4ES9A 1OLRA 1FOD2 2NLRA 4XUTA 3LEIA 4PQ9A 3VD5A 3S5QA 5FPXA 5T54A 2WC2A 4IQPA 5LZ6A 3VKFC 2VNRA 4NHMA 3WINE 5A32A 1BXHA 4DEVA 1A78A 4LO6B 1W2NA 2OVUA 2YGMA 3R4UA 4LXLA 2WNUC 2C26A 4D3WA 4AF9A 3RYKA 3WEZA 5KHIA 5FMOL 5T5PA 5A1AA 4MV2A 1PO12 1VBE3 2VAUA 3FWEA 4IV1C 3ZFEC 3THPA 3NNGA 1O3TA 1UU5A 2ZGTA 2AZ5A 4KWLA 2PAMA 1UIJA 2LUWA 5JZGA 4I02A 4QXHA 2ARAA 1UIKA 3HNBM 5FPLA 1MQTC 5F37A 2DF7A 3VBSC 1UD1A 2OXBA 4U2AA 5GZEA 3VHNA 2ZGKA 4BDVB 1LAJA 1QJU3 3GZEA 5F39A 5FP9A 1OA2A 4RFRB 2ZX0A 1V6JA 2NZ9A 1RUF1 4Q8KA 2Z5WA 1IGOA 2J1VA 1AVBA 4OFGA 4XDQA 3CO2A 1SDWA 1GBGA 2VBDA 1DZTA 4CDXA 2G9GA 4H7LA 2GAUA 3WF3A 4GWNA 4CU7A 2YMZA 1RUD2 4K9SA 1AXKA 4P02B 3MZHA 1GZCA 5F6LB 2BERA 3EO6A 5FV3A 5JXJA 3B02A 4XBNA 4BQ3A 5DPNA 2DV9A 4DRRA 3BI3A 4LA3A 1CAWB 4ZS3A 4WZCA 4Z92B 1OKOA 4E4SA 3H1WA 5DZFA 1HB4A 1COV3 2A1XA 2JENA 4QGNA 1AZDA 2XHKA 2JB4A 2JE9A 1NA1A 3CDZB 2WINB 2WZEA 3IDCB 1W3VA 2VG9A 2Q8DA 1ZBE3 1H1MA 4G9SB 4F83A 1S0JA 1UOFA 4YYOA 1QXJA 4A2UA 3J8F3 4IE0A 1YFWA 3AMMA 3THCA 5A6QA 2RS53 5FTTC 1ZA7A 1NY71 3FFQA 4MGSA 4DXTA 2BBAA 4OYUA 4D7TA 4G4FA 1VE0A 5EFUA 4H14A 3POFA 4P9WA 4R8HA 2XPJA 2F4PA 3I59A 5FZLA 4P9IA 3VDDA 1OPOA 3VLBB 4YM0A 3RI9A 2Y8KA 4QB6A 1W2AX 4BHPA 3EB7A 2CWMA 1SDDB 4RGAA 3T1LA 4HOOA 1QJFA 1YXWA 3DPRB 2JDPA 3OPTA 3TEYA 1ZZBA 2VBPA 2OS2A 3CZUA 2VUCA 3GDBA 2Y0IA 4CCMA 1AR61 1W6OB 1W90A 5JR2A 2BP6A 3P3PA 4Q4X3 1GMMA 1A6CA 4D6QA 2DUQA 2XDVA 3LGRA 4Z2WA 2ZEYA 3UK9A 4A7KA 3ALQA 3DGTA 3KVAA 4YG0A 2W52A 3KSCA 2Y6GA 1LGNA 1PGSA 4UBGA 1WW5A 4FPEA 2HYXA 2NM1A 4AI3A 5FZHA 1LOGA 3SEPA 4Q4V2 4L92A 4PLNA 4CU8A 1TNRA 1E5HA 1Y9MA 2A6WA 3QH7A 3ABZA 4PF1A 3W59A 5LK7B 4X6QB 1AR91 1BYHA 3P3NA 1V00A 5FY7A 2OQ7A 4ZPIA 2D3RA 4HKOA 1HKDA 1SACA 2XJVA 5HXMA 2PAKA 5AVPA 4DXRA 1Y3TA 3OUIA 2WBKA 4RYDA 1TME2 4KWJA 4PBPA 1FAYA 3HD8B 2UWBA 2VU9A 3W20A 2DU1A 3ZPYA 3BPZA 4IGPA 1IS6A 2IVIB 4W65A 1LNSA 2PHTA 3KB5A 2G1MA 2ILMA 4D6RA 5A70A 1OSGA 2DYCA 2GC0A 4QKFA 1RUE3 2ZGQA 1ULEA 3N35A 4HL0A 3MPPG 4YGBA 1K5MC 2P3IA 3KM5A 1YFXA 3OG2A 1AXZA 2D97A 4FQ4A 4GH4B 2VBBA 2HWC1 2CU5A 3FUOA 4NPRA 4R9CA 1LHOA 1X9TA 2IXLA 2WSUA 5DAWA 2YU1A 1BVVA 2D44A 2Y60A 5JCTA 2OIIA 1OQEA 1J58A 1H9PA 5T5JA 1ENXA 2VTXJ 4XFHA 4MSVA 3AK0A 2D3SA 1PVC2 2D5HA 1VBD2 2OPWA 5BXXA 4NIHA 2XL7A 2AENA 4FO9A 4ARYA 3SLIA 2HWD1 5LY2A 2XBO3 5FO7B 2Q1FA 1W6QA 3VDDC 1AR71 5HCAA 2ZX2A 1CAVB 1UPSA 5T5OA 4PLOA 1BBT1 4HSJA 4NOTA 5F6KA 4ASMB 3ZN5A 3NKTA 1TZOA 3IIIA 4Y1UA 2ZAHA 5HV0A 1VJ2A 2ORZA 5FJHA 3M3QA 3WNOA 4MH0E 3NMBA 4TTGA 3WNMA 3WLUA 4IGQA 5KWRA 4IEYA 3KQRA 3PMSA 4GB33 4RHV2 5K0UC 5FMCA 4MGTA 1RUI1 2RMU1 2P6HA 1V9U2 3LIGA 1RITA 3LB9A 4LIUA 1PGW2 1S0BA 4JGZB 5ISLA 4XQ4A 1RUJ2 2C0ZA 3AZZA 3VBUB 3IAQA 2WUHA 4Y1XA 4N9HA 2XJUA 4CP1A 1RUG2 5F2SA 3FHQA 2DU0A 4Q29A 3C3VA 4GQ7A 4E2GA 1QDCA 3VL9A 3GJAA 4QWNA 4QXBA 4URTA 4AFCA 4AHXA 4QX7A 3F95A 4AFMA 3ITQA 3M3IA 3ZDSA 1S0GA 3HJRA 4I09A 4W6XA 1SLBA 3RI8A 2BUKA 2YC0A 1MACA 4RGKA 1J3QA 1UU4A 5J48A 5J7MA 2QKDA 1PMIA 2EXKA 1O4YA 4LBKA 3N7MA 1OLMA 4H3WA 4O9GA 4OHVA 3NL1A 5TSWA 4FCAA 2EA7A 3NAPB 1CZSA 3OY8A 2HWB2 1VBB2 2EXJA 4K40A 4EZHA 2ERFA 1E5SA 1QXRA 3D3AA 2D5FA 4NAOA 3KD4A 4FPGA 5HCFA 2WLQA 1CAUA 3RZZA 1F15A 5IATA 2D98A 2JEMA 1BMV2 3K3OA 2OW4A 1C8M2 2LRPA 3VHRA 5FWJA 4E8CA 1GZWB 4M3CB 5L7OC 5LBCA 3WF0A 5GZFA 4EN7B 4PLMA 1I5PA 5FZGA 2K0GA 1Z78A 3I7DA 4COUA 4OI2A 2VMFA 1BEV1 3CL1A 1MS0A 1FMD1 2W1SA 2VZPA 4XBLA 1VRH2 1UYYA 3C7EA 1HRV3 1R1A2 3PUQA 1RMU3 1AYN3 3BN6A 3WDWA 3OJBA 5IVFA 4QPIB 2JDMA 4P9XA 1AX0A 5C8CB 4Q0VA 1O4ZA 5FZ7A 1T6GC 1BHGA 1Z7S1 5A3MA 1DYOA 3AFGA 3OGSA 4YW2A 1RVF1 1MS3A 4AI9A 1FX5A 2DVGA 3LSEA 1MS8A 2W95A 4RS5B 2VY0A 3LEMA 4AVCA 5JUVA 4IEZA 1CAXA 1S2EA 1ENRA 1N1TA 1W2OA 4C90A 1AYM2 1TEIA 2B45X 4DQAA 4AW7A 2ZBJA 5KHJA 2IFWA 2VZSA 2Z2SB 5CVRA 4QQPA 1OOPA 4QGLA 2NPIA 1CVNA 4IW3A 4PDWB 4HVOA 4DRVA 3UV9A 5IAVA 1OF3A 4V1PA 3ZR6A 1DZQA 1CIWA 3THTA 1HRI1 3C7OA 3DKQA 3ZYPA 2ZABA 4K21A 4P00B 4JTOA 2V09A 1ND3C 4GIQA 4OMCA 4UOJA 5IK7A 1EAH3 3CZJA 4MHUA 3TEXA 5GZDA 1G86A 3T0DA 1A3KA 4IERA 2VH9A 5C3PA 5DDJ1 4Q4Y3 2QZ3A 1HV0A 4YW7A 4BQWA 3HBKA 2NN8A 1JS9A 2VULA 3IDBB 1D0HA 3KVBA 3M1HA 5LRRA 1N1SA 4FPJA 2DURA 4IV3B 1JHJA 4UI9L 4EQVA 3AX4A 2GC1A 3MYXA 4RQPB 3PVOA 3LSDA 5FFOC 1XRUA 4YVWA 5CB7A 4BJ0A 3WQ0A 1X82A 1YO8A 2MHFA 1DQ5A 4AWDA 1W9WA 5KHGA 2ZHLA 3K75B 4WZFA 1RTVA 4B7EA 4Z8BA 5LRSA 2EXIA 1HN0A 3AYCA 4OHYA 2OUJA 2W1QA 3N7LA 4LUMA 5CFDB 2VW2A 1ND2C 2GALA 3HPNA 2XLFA 4XFFA 3CJIB 2Y6JA 1NAEA 4Q4W2 4S2DA 5A1LA 3K46A 4DUWA 3R6SA 2A6XA 2VOTA 3E97A 5FZOA 3W21A 3ZXGA 1JYXA 1ZZ6A 2VVEA 4Y20B 3LDRA 4QX0A 4N7UA 3DYPA 4LORA 1W2UA 1RXFA 5FZIA 5BNQA 4ZKTB 4B1LA 1O8SA 2DVAA 1VBA3 3F2ZA 3EYPA 2VVFA 3TN91 4HVQA 1PK6A 3ZSJA 1K45A 4M3CF 1DF0A 1MEC2 3D6EA 4IEWA 4OHXA 4ZU7A 2UU8A 4NR1A 1Y9GA 3M70A 3IB3A 1SEFA 4FQZA 3VZLA 4PF5A 3B69A 3K77A 2VCMA 4B4PA 2WNUB 5E88A 3V64A 5GLZA 3ROUA 3TWIA 3MIGA 4HBNA 4XZUG 2XKPA 3N9NA 5G04L 5FZ8A 4IV1B 1KJLA 1OOPC 5FZMA 1GYKA 5E89A 5A6ZA 4V2VA 5BNOA 3O1MA 2XH6A 5EYXA 3I2GA 4IEQA 1C4RA 1RUF3 3PVEA 1DBNA 5LA2A 3NKGA 1NZCA 1QJY2 4KH9A 1MQTB 4Q0UA 3VBSB 2JIJA 2AACA 4O9EA 3MV11 2ZGOA 3BODA 3ZN6A 4GWIA 2PLV1 4FPKA 4XFAA 4V2WA 4HKWA 3ETPA 5FY1A 3VZNA 4TYSA 3BOWA 2HWE2 1KQRA 4MGYE 2F6BA 4NAMA 1O91A 4NRPA 3RWNA 4CE8A 3FLRA 2GC2A 2R071 1DQ4A 5ACA2 4Y5SA 3JQXA 1JU4A 1ZBA2 1VB4A 2EIDA 3DKWA 2PHUA 3IBMA 2D3PA 1Q8SA 1UNBA 3ON7A 5H9QA 1NLSA 2FCVA 2HWF2 4OLLA 5G05L 2K46A 1DYPA 4HPKA 2JXAA 1RHI2 1QU0A 4FFFA 1OHFA 4UBHA 1O3SA 2WDBA 3ZIWA 4KBBA 4Y5Z0 4DNYA 5I91A 2PMWB 1UMZA 2VO5A 3D8CA 3FC0A 1Q3EA 3ACHA 5LBFA 3VBRA 1UKGA 4YW5A 1X7NA 4UW3A 4OUMA 4XUPA 4XAEA 1SLTA 3CHXA 2NMOA 3I49A 2C1FA 2BWCA 1OD5A 3HR9A 3VBHA 4BQXA 1DLCA 3R4SA 5L9RA 3BB6A 2A3WA 2XVKA 4ITCA 5JIAA 4WVMB 4LA2A 1KJRA 3IT8A 5A32B 4GA9A 4BQ2A 2PYTA 1OQDA 2HEWF 1HXS2 2CV6A 4XJ8A 2X5IA 3IMMA 4Y26A 4CDQA 5GLUA 4OUEA 5F5QA 1RUC1 5FOJB 2DTWA 1E5IA 3KQ4B 4P5HA 4FOVA 2KM2A 3POIA 4JGYA 3WNLA 5BNOC 1D4VB 3M3EA 1K5JA 4AGRA 1RJ8A 4LO5B 3VGIA 5FXWA 3VV1A 2DCYA 2XGXA 3AC0A 4P08A 4AG4A 1AR93 2JJ6A 3AMHA 2Z42A 2ZACA 4AR2A 4C0BA 1YI9A 4XUNA 3MLLA 4AEDC 3OCPA 2O8QA 2X53S 5EP9A 2QZ2A 3U0ZA 1TMF2 1F9KA 1VPHA 2BU9A 1HN1A 3GBGA 3LAGA 4QU2A 2GMPA 5FK7A 5C8WA 1X8MA 1NX9A 2J7MA 1EUUA 2HWC3 4KWUA 3VBFB 2PFWA 1OI6A 5F5AA 4OQ8A 1H1IA 2I45A 3O1OA 2VC9A 4WVZA 1YC61 2RJ2A 4IEPA 4UT5A 3K2OA 5JR7B 1SFPA 4LO7A 2PHWA 1ZZ9A 4IDZA 1K5MB 4KQ7A 3AM2A 3NV2A 2ZGPA 2ZEWA 1IS5A 3KGLA 4QDQA 3AYEA 4CP0A 1JUIA 2WFF1 3LCPA 3WV6A 3VBRC 1SHWB 2CL2A 1XU1A 3HNMA 1GR3A 2HWD3 1LRHA 3VKNA 2OZ6A 1AR73 1DU3D 1UPIA 5CU1A 3TB0A 1JZ2A 2E26A 3NSTA 5C9AA 1BBT3 1JH5A 4YW6A 1W05A 4HFSA 4QQOA 3VBHC 4JKKA 3AP6A 3AXEA 5FZ9A 3AZXA 2B7YA 2KD7A 4PCRA 4A7YA 2DTYA 4DIQA 1XSRA 3AZYA 3WG2A 1S0IA 3MFCA 3I59B 3JQWA 4Q4V1 4XTMA 3WUDA 3X29B 4AI2A 5CA6A 5FCCA 1X9PA 2PA7A 5F5IA 4CDQC 4YM3A 5EV7A 2RMU3 5FKBA 1V0AA 1UOJA 1ALYA 1C8NA 2YBSA 5FP8A 4ET7A 5IVJA 1TME1 1XYPA 3NJYA 4COYA 1A8MA 2VCAA 2GSYA 4BIOA 5KC5A 4K1ZA 2ATFA 4XW3A 5K0UB 4M3CE 2X10A 4IETA 5IAXA 1RYYA 4QKBA 2DVDA 1YEWA 2ZMKA 3H3UA 3MV01 3OBRA 3I2HA 3MDPA 1W28A 1FPN2 1JZ8A 4QM9A 2RR12 5DAXA 3WP4A 2W91A 4QT6A 1N3OA 1PO22 3S7IA 4LO4B 4N8MA 3J9SA 2P37A 3WOGA 2RDSA 3LE0A 4IGOA 4NE9A 2FDGA 4JDMA 4Y4YA 5FY0A 1GOGA 1S1AA 4LBLA 4COZA 4C0HA 2BQPA 4KGGA 3UYJA 4DXZA 3O0XA 4AQSA 2ZZJA 5E6HA 5A7WA 2D6OX 2BZDA 4UW4A 3N9MA 4RL7A 3WG1A 2VECA 2DWRA 1H6YA 3KCCA 4FI9A 4LHKA 1YRZA 3VBOA 3WCSA 2LW8A 3MIDA 1PIV3 3M8LA 4C8DA 4IE5A 1YQCA 1GOHA 4CCDA 5ABJC 2MNGA 1QKQA 2WN2A 5DUVA 4CUAA 1CR7A 1VB2A 2OX0A 4LKSA 2XMLA 4XFGA 5JAXA 3USUB 2ZMNA 4LUKA 1W8WA 2XVGA 2SLIA 1ZM1A 2WAOA 4MGQA 4BM8A 2VGDA 4B4QA 3U1XA 5CKQA 5L7OB 2RS13 4UF0A 4E2SA 2AUYA 3NV1A 1PGW1 4PHZA 3WF2A 5C9AC 3V0BB 1QWRA 5GM0A 2K2SA 3PL0A 1RUH1 3TAYA 3ES4A 5FY5A 2Q8CA 4CDWA 2W94A 4XUQA 2VUAA 5B4XA 1W6QB 4WM7C 4XILA 2BDRA 3WZ1A 5JOWA 1JZ3A 1RVF3 3EJKA 2Y38A 4LULA 5KC6A 1I1EA 2JKXA 4F7ZA 3N4MA 2CGPA 2OKXA 2PHLA 3EBRA 4NO4A 1H2KA 4FP3A 3AB0A 1VMJA 5JSOA 2AEZA 5FXXA 2FMYA 2VVDA 2BVVA 5IK8A 3V65A 1B35A 1F4HA 1K12A 2QTWB 2TUNA 2JWPA 4QX3A 1PM4A 4XJWA 1ASJ3 4AZZA 2IXIA 1LR5A 2WO1A 1KRIA 1SLCA 4GALA 2VMEA 4HN0A 4QHOA 4EN0A 2ES3A 1ULDA 1VBC3 3LEKA 1EYBA 3A7QA 3U78A 4LHNA 4TSVA 5FMDA 3HQXA 1HRI3 2YPDA 3UJOA 5APAA 1Y4WA 1GICA 2F17A 5DN2A 1OURA 3OSDA 2FZ1A 1QJX1 1DCSA 3JBG1 2JDHA 1C8M1 4F8AA 4Q0SA 3LA2A 2JIGA 3BUCA 4URAA 2ZOEB 4B4RA 3I2FA 5DDJ3 1RGSA 2VZRA 1Q8OA 5E1RA 3RDIA 1OC1A 1W9YA 3T30A 1ND3B 3KLSA 4CP2A 4JKLA 3ZXKA 4DY5A 2VMGA 2X09A 2YDEA 4OZOA 1AL0G 2ZXQA 1JZ7A 4XBQA 1GSLA 4D94A 1VRH1 5LWBA 2B46X 4YW3A 1ZRFA 5FK8A 3VBOC 2XLAA 3GF6A 1XE0A 3JD71 1VBE2 1UZWA 5FBJA 2RM21 3ZMOA 1WMFA 1O6UA 2WNOA 3WDVA 4BZ4A 4LT5A 1C28A 1F5JA 1HB1A 4F3JA 1CAUB 5FPAA 1LB2A 4UW5A 3MGUA 4INDA 3K4DA 4NROA 2GN7A 2VQUA 4FOWA 4X8NA 3APBA 3C7GA 4K7JA 1QJU2 1W0PA 2BWAA 1LOEA 2FMDA 5FYYA 5H9PA 1CWPA 1ND2B 2OZJA 4K8FA 2W08A 2GP3A 4MVTA 3SCHA 1S0FA 4BB3A 1R1ZA 3N9PA 3TN93 3AYDA 1JW6A 5DZEA 4FBFA 5FP4A 5FJKA 2OA2A 1HQLA 2P4EA 1VAMA 3POBA 4W6YA 2ZX4A 4LE4A 5C3OA 3GCXA 4FAGA 4MLOA 4BK4A 4UFMA 5DMYA 1YJKA 1K42A 4ZZ5A 1XOYA 2A3XA 4QX1A 3WHUA 1JN2P 4PBOA 4HK9A 4XACA 2P3YA 1MS5A 4XIKA 4FAHA 5HI0A 1NKGA 2B8MA 1IS4A 5L73A 1ZYBA 1COV2 2ZHNA 5KBFA 3P6BA 4HMZA 2AC1A 3LDKA 5DUUA 2IXKA 3MHZA 3N9LA 5KHHA 5J3UA 2D6NA 5JDBA 3KV5A 3IIAA 3R4DB 1ZBE2 1OOPB 1QHDA 4AVTA 4BH9A 2XJRA 3FLPA 2A5ZA 1OD3A 2MPFA 3J8F2 1N1YA 2J1AA 4QDRA 4OULA 1LODA 2RS52 4AOCA 2FDKA 4UWDA 2J1EA 1NCQA 3HVDA 1AJKA 4TLGA 2RS31 1QOSA 1UOGA 1SG3A 2VJXA 3MO4A 3ENRA 4DINB 3VUOA 3WY6A 4LOSA 1XNCA 3LKJA 5FUIA 2P3KA 1H4GA 4QQ2A 2QQLA 2G9ZA 3O0VA 4YPJA 4EJRA 3KZ4C 1US2A 3Q8BA 3I54A 3LDBA 3SCGA 5DG2A 4Q4X2 4CXWA 5FYHA 2CWSA 3Q8CA 1C1FA 5DAQA 2VZOA 4N53A 4ZU4A 2PHFA 2D40A 2QQKA 4FTSA 1MVQA 1QDOA 3NV3A 4Y1VA 1VP6A 5BUVA 4QX5A 2VW0A 4M00A 4OVEA 1PGL1 5FLHA 5T52A 1AL23 3AFKA 4P9JA 3MW4A 4YM1A 4IL7A 2ZGRA 5A3TA 1GANA 2WJSA 3A4UA 4O7XA 4PJYA 2XONA 1R081 1J83A 1NCRA 1EV11 1QQP1 4ISQA 1POV0 1LJ7A 1F31A 1D4M3 4GMP0 2ET7A 3LPFA 1UYXA 2VQ0A 3GHMA 2W92A 1GUIA 1NLRA 1YFYA 2G19A 1D0GA 3VZOA 1N47A 5JZGC 3T2PA 2W87A 4L2NA 1DIWA 1RUE2 3PJQA 1RUC3 5LASA 3ZXEA 5CZKA 3ZPOA 4Y1ZA 5FYCA 2V72A 5A7SA 5IHRA 5FQ0A 3HNYM 1GV9A 4XOGA 2BPA2 1ODMA 3GZUC 4H7MA 5KXEA 1W6MA 2UY9A 3H1MA 1GNZA 3OUJA 5A33A 1OA3A 4HT1T 2WZR1 4MO3M 1CZTA 4BLIA 4CDXC 5JMOA 1W9SA 2QQUA 1ZBA1 3J4UH 5A7PA 2R043 2YG0A 5LEJA 1DQ0A 5CG9A 4XDPA 1K3IA 1YIPA 2R061 1SZBA 1QOTA 2HWF1 3BTAA 4EZ4A 1NCQC 3RZHA 2QJVA 5DG1A 2O14A 2GZWA 3AJZA 3H50A 1QEXA 4QU1A 2XBO2 4QXKA 1U5YA 3NJVA 4QD2A 3WG3A 3BYWA 3WDTA 2YROA 5FMBA 3ZKUA 1OKQA 4AEDB 2VZVA 3CNAA 3CU7A 3W58A 4AI8A 3MLKA 2DBIA 4CRQA 4FXGB 4GJZA 4BQYA 3WT3A 5CFCB 2NQYA 1REDA 3H8XA 4HSLA 3ZSEA 2YC2A 1G9AA 1NA1C 1GZ9A 1XXNA 2YYOA 4GB32 4N53C 3O1UA 1M06G 1LU1A 4W8JA 4AGVA 1W9FA 4YGDA 2WO2A 4K3UA 4A7ZA 4L97A 4AYUA 2CDOA 1WCSA 4IE4A 2JX9A 2VCBA 2WFF3 2R30A 3SXWA 4J1XA 1J84A 1QJEA 1S0EA 3HT2A 4CP9A 4D8MA 3M4FA 3UESA 4QDSA 1YQ5A 3KV4A 4LKDA 4W4ZA 2HH9A 2VUJA 1R091 3O5SA 3ORJA 2BNOA 2O8OA 3PTYA 1IPKA 1GZTA 3L2HA 3UKNA 5IUQA 4EV0A 4LTAA 5FOBB 3FJSA 4LIVA 1JZ6A 1V6NA 1NCRC 1I5ZA 5FY8A 3ZFGB 2XQXA 2YXSA 4MGZE 3BPSA 4YVSA 3OD4A 1VR3A 5BNPB 3QD6A 5FPVA 5DUWA 5IVCA 3O1VA 1VLNA 1VMHA 2CDPA 3ZFFA 2JG8B 4CEYA 4HG6B 4AFAA 4AVBA 1OBNA 2B9VA 3WHTA 2B9UA 1ODNA 4JDOA 2RJLA 5H9SA 4CDQB 2XKOA 1W6NA 4MADA 5CISA 1TMF1 5T50A 1X8EA 3L2YA 4JQTA 4K6BA 5M0TA 2VQAA 1WA4A 2Z79A 2AR6A 3I2DA 5SV5A 3OF1A 1HW5A 4BA6A 5JWPA 2EF6A 3U4XA 1SQ4A 2KA3A 3I2JA 1WCDJ 3KT7A 4PQQA 4DXSA 3D5OA 1AX2A 5EWSA 2WNVA 3V0AA 4NWVA 1Y43B 3OD0A 4NIIA 3KCXA 1HRV2 1OXCA 1RMU2 1AYN2 2J22A 2PN5A 4B8EA 5KXCA 2XJQA 2QQPA 5C33A 2YFUA 3RG0A 2D7FA 4YG3A 1LEMA 1LKNA 3PTRB 3NNFA 2IFRA 4BXSV 3MIEA 1DGWA 2JB8A 3MI8A 3NWKA 1CZVA 1W6PB 2P1BA 4DB5A 4CUBA 4J25A 5A1FA 4CCEA 3OB8A 1XNAA 3AKQA 4P5YA 3I3MA 4ZS2A 1S2KA 3J7NA 4BMEA 3A0KA 4I0AA 2XJPA 5JIUA 2WRAA 1W8HA 5FPUA 2YPJA 5IW0A 4AAPA 4TXWA 1V6LA 4ASKA 1UCXA 1Q56A 5ABJB 4A4AA 2BFUS 3AVRA 2DCZA 4CDUA 1BJQA 1NT0A 2ET1A 5AC91 2WLPA 1RUH3 4XXAA 2E7AA 1CX4A 2VR4A 5E8AA 5K8SA 2P5BA 5LATA 1UO9A 1UY3A 3DV8A 4JRLA 1EAH2 4YVSC 2DCTA 1JYTA
chains in the Genus database with same CATH topology
1GWKA 2LRPA 3ORJA 1V0AA 1UOJA 3F95A 2KR2A 4LJHA 4YW7A 4YWAA 2VXJA 4BQ2A 4BQ3A 1OH3A 4LKDA 4LKFA 4BQ4A 1WZXA 4CP9B 2K46A 1W8ZA 1GWLA 4LKEA 3ZYFA 1WCUA 1GWMA 3ZYHA 1OKOA 2C24A 4AL9A 5D21A 4A6SA 4YW6A 1W9FA 4BQ5A 1W8TA 2WYFA 4LK6A 3UT0A 1W90A 4CPBA 1HN0A 1W8UA 1L7LA 3ZYBA 4LK7A 2O14A 1WMXA 1W8WA 4CP9A 4CPBD 2JWPA 2Q1FA 2LROA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GWK A;  2LRP A;  3ORJ A;  1V0A A;  1UOJ A;  3F95 A;  2KR2 A;  4LJH A;  4YW7 A;  4YWA A;  2VXJ A;  4BQ2 A;  4BQ3 A;  1OH3 A;  4LKD A;  4LKF A;  4BQ4 A;  1WZX A;  4CP9 B;  2K46 A;  1W8Z A;  1GWL A;  4LKE A;  3ZYF A;  1WCU A;  1GWM A;  3ZYH A;  1OKO A;  2C24 A;  4AL9 A;  5D21 A;  4A6S A;  4YW6 A;  1W9F A;  4BQ5 A;  1W8T A;  2WYF A;  4LK6 A;  3UT0 A;  1W90 A;  4CPB A;  1HN0 A;  1W8U A;  1L7L A;  3ZYB A;  4LK7 A;  2O14 A;  1WMX A;  1W8W A;  4CP9 A;  4CPB D;  2JWP A;  2Q1F A;  2LRO A; 
#chains in the Genus database with same CATH topology
 5C9A B;  1JZ4 A;  1XE7 A;  4DMI A;  5JOX A;  2A7A A;  4A3X A;  1VAK A;  5HPO A;  1XND A;  1FPN 1;  3ZFF C;  4Q4Y 2;  1OLM E;  1WLC A;  2CAV A;  2RR1 1;  4LJH A;  3ZYR A;  4CEY C;  4QGM A;  3WVJ A;  1DQ6 A;  5C5T A;  1LHV A;  1PO2 1;  4WM7 B;  3H3L A;  2ZGN A;  4BWO A;  2HBT A;  2VTX A;  2FDF A;  1G9C A;  5IVB A;  1HB2 A;  1UAI A;  3UNP A;  4ZZ8 A;  1AR8 3;  2FHR A;  4K8R B;  2VOV A;  1LHU A;  3SQO A;  1MS4 A;  2XQR A;  3PU3 A;  1KXG A;  1SPP B;  3BTY A;  1G6N A;  3IDA A;  1J1T A;  3UKV A;  4CCN A;  3PUA A;  1MZF A;  2WS9 1;  4QAW A;  2FBE A;  5ERL A;  5GLW A;  4DUX A;  2WNV C;  1QJX 3;  1U12 A;  3JBG 3;  1O3R A;  4BCU A;  4Y22 B;  3WNK A;  1HDK A;  5IVY A;  1CPM A;  1GFF 2;  1OQ1 A;  3ZOI A;  4UW6 A;  1VIW B;  4JC1 A;  1C1L A;  1WLD A;  3MIH A;  4GZ9 A;  3WP5 A;  2AGS A;  5BPX A;  4LO8 A;  1OH3 A;  2XHN A;  4RGG A;  1VBA 2;  1WZX A;  4X8P A;  1SLL A;  3H8O A;  4XET A;  5F9T A;  2VD7 A;  4FFI A;  1GWM A;  2ZEZ A;  4CU9 A;  5FBZ A;  2W9X A;  3JD7 3;  3FHA A;  4Y1Y A;  2DCK A;  1EUT A;  3A0N A;  2RM2 3;  1ZNP A;  2VNG A;  3I8T A;  4QHZ A;  3BKZ A;  1RB8 G;  4XXP A;  4C1W A;  4JDN A;  2WA4 A;  3E5U A;  3IKW A;  1QGL A;  1CAW A;  4NMI A;  5DQ0 A;  2PAE A;  4LIT A;  4O65 A;  3LFM A;  3PUR A;  4AE2 A;  1JYN A;  4AGG A;  3PNA A;  3IPV B;  1ACC A;  4PT6 A;  4Z07 A;  1FI2 A;  1GNH A;  1RUF 2;  2Q8E A;  2TEP A;  2JD9 A;  4IEV A;  5EJ3 A;  4YFZ A;  3H7Y A;  4ZXK A;  3RJ2 X;  1CPN A;  1POV 1;  2VMD A;  2KXL A;  2XVL A;  4GMP 1;  4LBM A;  4MXW A;  5BNN A;  2E31 A;  1FNY A;  2Y6L A;  4KU8 A;  4K20 A;  2ENR A;  1AHS A;  3S5A A;  4N43 A;  3U14 A;  2W46 A;  4A41 A;  1V6M A;  4BXF A;  3UJQ A;  3D0J A;  1PZ9 A;  2C5D A;  1GP5 A;  1SFN A;  1F2N A;  2JDN A;  1GKB A;  1JUH A;  2RDR A;  1WLT A;  1F4A A;  3DN7 A;  3VKM A;  3ZFE B;  2X29 A;  1YFU A;  3MF6 A;  5F5C A;  1UY1 A;  1W6O A;  2VXJ A;  1T2X A;  3JB4 C;  3PU8 A;  4BYY A;  2CTV A;  1UX6 A;  3ILN A;  3ZR5 A;  2MEV 1;  2QQJ A;  2Q1Z B;  2CGN A;  3OYW A;  2DDU A;  2FQP A;  1POQ A;  3HWJ A;  3GGL A;  5I8Y A;  1PX4 A;  2C9K A;  1BK0 A;  1LOF A;  2O1Q A;  4A42 A;  5FRA A;  3PIG A;  2ZML A;  1NY7 2;  1D2S A;  1O4T A;  5FXV A;  3RMX A;  3T2Q A;  5A3U A;  1LOA A;  2FZ2 A;  1HLC A;  1IPS A;  1QMJ A;  5IK4 A;  3OOX A;  3GM8 A;  2RS3 3;  2Y34 A;  4LHS A;  4CCL A;  2C4X A;  3CKH A;  5LW9 A;  3WNX A;  5F3G A;  3KT1 A;  4IES A;  3AP9 A;  4KMQ A;  1UZ0 A;  3W9A A;  1IQA A;  1QJU 1;  1FOD 1;  2ZA9 A;  3EXU A;  1J59 A;  3RNS A;  1JOJ A;  1YNA A;  3HN1 A;  1SMV A;  3SH4 A;  4YVW C;  1ZZ8 A;  3B5L B;  4CVU A;  5FZK A;  2GU9 A;  4CA9 A;  1SLA A;  2WII B;  1JHN A;  1UU6 A;  1EP0 A;  3B01 A;  4Q1R A;  3HBZ A;  3B93 A;  1KEX A;  1PM7 A;  4NRQ A;  4DZG A;  2ARX A;  4XCA A;  3TEZ A;  1V6I A;  1ZZ7 A;  2JDA A;  2N7G A;  3EQE A;  5EZW A;  1PO1 1;  4L8Q A;  1XJA A;  1DHK B;  4GH4 A;  4E2Q A;  4XFB A;  1ONA A;  1LEN A;  4I3P A;  5FYT A;  3PJY A;  2XWB B;  1ZRR A;  3WR0 A;  1WD4 A;  3RS6 A;  1PK6 C;  1AR9 2;  4YZ4 A;  3ZIX A;  1COV 1;  2JDU A;  1LUL A;  1R08 3;  3WDU A;  4GUL A;  1UKR A;  5BNN C;  2WNE A;  2V5D A;  1GP6 A;  1QQP 3;  1EV1 3;  1SBF A;  5FY9 A;  4LBQ A;  5EIY B;  3WQB A;  1AR6 3;  3DUI A;  4N43 C;  1ZBE 1;  1DDL A;  4CU6 A;  4BU2 A;  2WN3 A;  1YLL A;  1MZ6 A;  2C24 A;  4YZ1 A;  2R49 A;  1CAV A;  3DEM A;  1RUD 1;  3FLT A;  4BLJ A;  4YG6 A;  4UFK A;  1WME A;  5FZA A;  2QQW A;  2Y0O A;  1L3J A;  1AXY A;  1U5X A;  2HWC 2;  3POW A;  4KI5 M;  5JZG B;  2B39 A;  3QLQ A;  2L9L A;  3SNM A;  2J1R A;  3B9I A;  2BVB A;  2VPV A;  5F7U A;  2WZR 3;  3LPG A;  3ZXL A;  3ILR A;  3WCR A;  3CBN A;  5HXV A;  1MS9 A;  1LOF C;  2VQT A;  2QQI A;  2EAA A;  3AMP A;  1A8D A;  1V70 A;  2R06 3;  4Q0Q A;  5KXD A;  1L7Q A;  1U5I A;  3M2M A;  4A6O A;  3VBU A;  3JXS A;  4UFJ A;  4FTE A;  1OMI A;  4Z1V A;  2HWD 2;  3GZT B;  3PVN A;  1DQ1 A;  4CDX B;  3E5Q A;  4HON A;  5EXO A;  1AR7 2;  3TRS B;  1TE1 B;  3UGF A;  5FYM A;  1DGL A;  3ZYH A;  4BMB A;  2GH8 A;  4C1X A;  4M4P A;  5FYV A;  3S57 A;  2A6Y A;  1BBT 2;  2WO3 A;  1Y7B A;  1NCQ B;  4YRD A;  4JZR A;  2R6Q A;  1ZX5 A;  2AYH A;  5FYI A;  3VN4 A;  2VOK A;  3ACL A;  3GBW A;  5AVA A;  5HBA A;  3ACI A;  4UAP A;  3UGH A;  4BIS A;  1H6X A;  3AZW A;  3N7K A;  2RMU 2;  4WM8 A;  2PQS A;  3ME2 A;  4BE3 A;  3HAG A;  2E32 A;  1NE6 A;  1NA1 B;  1URX A;  2ZJC A;  3MBW A;  4EN9 B;  1SBE A;  3OBZ A;  3NNM A;  1HIX A;  4AI0 A;  4X6R B;  5EYY A;  3BAL A;  3DYM A;  3J7L A;  3N7J A;  3ILF A;  1R09 3;  2NP0 A;  2WWJ A;  4M3C A;  4LBO A;  2BGC A;  4LK6 A;  1YHF A;  2WL1 A;  2IXJ A;  4AAX A;  5EPA A;  3VDB A;  1N3P A;  1Q8P A;  3HOB A;  3MW2 A;  1L7L A;  3MUZ 1;  1JU3 A;  2E9Q A;  2DCJ A;  2VOX A;  2W3J A;  4JCK A;  3BU0 A;  2ZHK A;  3OEB A;  2Q8O A;  3VDD B;  4PIZ A;  2OPK A;  4QM8 A;  4SLI A;  2LRO A;  2R32 A;  3ZXD A;  4XDO A;  2X5I C;  5A3P A;  5F1R A;  1MR5 A;  4YZ5 A;  5A3N A;  1RUI 3;  1OPM A;  3NO8 A;  4HVR A;  1UL9 A;  3FMG A;  1SFY A;  5C8C A;  3DL3 A;  4FVV A;  2XBO 1;  4JGY C;  1W8Z A;  2ZTN A;  2WAB A;  1WKY A;  3AP5 A;  2R1B A;  1ZRC A;  3H42 B;  1PIV 2;  1SLI A;  2WSV A;  5JI9 A;  5IK5 A;  1VRB A;  5J37 A;  1C57 A;  2DFC A;  4QQH A;  1UZZ A;  3MIC A;  4LPL A;  2YV8 A;  1JBC A;  4CSW A;  1W6M B;  1WWY A;  4XJZ A;  5L19 A;  2FDI A;  3VBU C;  1BZW A;  4I0B A;  3SIS A;  4EWA A;  2CAU A;  4OMD A;  1JYV A;  5FKC A;  3AYA A;  4HKL A;  2VE1 A;  2RS1 2;  2VZ3 A;  3DYO A;  3GYD A;  3MPB A;  4PDW A;  1V6O A;  4L0P A;  3ACF A;  3VDA A;  2EIC A;  2W47 A;  1ULG A;  1HJF A;  3ATG A;  2WZP P;  2BV4 A;  2JE8 A;  1PVC 1;  1LED A;  1VBD 1;  1UMI A;  5J1X A;  1QIQ A;  1NUK A;  5FMO S;  5C3R A;  3ZDV A;  5F2W A;  5FUP A;  3OGR A;  1RVF 2;  4P14 A;  3C2U A;  4E4D X;  5JPN B;  4AK3 A;  4JTN A;  1H30 A;  1O7F A;  3VL8 A;  2Y6H A;  1QH7 A;  5AFB A;  4WM8 C;  2H0V A;  3WW3 A;  1D7P M;  2EIE A;  4LBJ A;  1YWK A;  1CIY A;  1EY2 A;  4ZY9 A;  3UT0 A;  4CCK A;  3AJY A;  4D7Y A;  2QQM A;  2VTF A;  3S30 A;  1CX1 A;  1EPZ A;  1ZA4 A;  4AQ6 A;  1Y9Q A;  2A73 B;  5I0T A;  2IUW A;  3AP4 A;  3WP3 A;  2TNF A;  3PDQ A;  1ASJ 2;  3PVB B;  3POE A;  4YM2 A;  1BEV 3;  1H2N A;  1YUD A;  1FMD 3;  2DUP A;  3IAP A;  4RHV 1;  5JOZ A;  1Q8V A;  1V9U 1;  4KGQ A;  1VBC 2;  5D8A A;  5AC9 3;  4AI1 A;  1OFS A;  5CBL A;  1RIN A;  1RUJ 1;  2VZ1 A;  1HRI 2;  2CSG A;  2YBP A;  3BTZ A;  3BIE A;  1H9W A;  1TQ5 A;  2R16 A;  1W99 A;  1XNB A;  4LBQ D;  1RUG 1;  2VXR A;  2UUR A;  5ANN A;  4CXY A;  4NIG A;  1Z7S 3;  1ULF A;  4RR3 A;  3NNL A;  3U4S A;  5FYS A;  2XXZ A;  4C91 A;  3FBM A;  2Y6K A;  4Y20 A;  1EPW A;  5DDJ 2;  1WMD A;  3A22 A;  4A45 A;  2R7E B;  4NWW A;  1KIT A;  3RFR A;  4YVS B;  2XB6 C;  2FDH A;  5C8C C;  1UMH A;  4GWM A;  1IZ3 A;  1WUV A;  4COW A;  2ORX A;  1OF4 A;  1DGR A;  3NJX A;  3POS A;  3BTX A;  4CEY B;  4NPL A;  2GME A;  3T4V A;  1CJD A;  4B3N A;  1RXG A;  4Q27 A;  1W3X A;  4XF1 A;  1PZ8 A;  2E7T A;  2HWB 1;  1VBB 1;  2IC1 A;  2SBA A;  4NUB A;  1F35 A;  1RC6 A;  5H9R A;  3WUC A;  1IHM A;  1W2T A;  1W6N B;  2W68 A;  2WQ4 A;  1H8T A;  2WNU A;  2WS9 3;  4FPY A;  4J6G A;  4NHL A;  2X05 A;  1CD3 G;  4Y24 A;  4QXC A;  3LOB A;  1BMV 1;  2D93 A;  4IV1 A;  3FZ3 A;  3THD A;  4FP2 A;  4IEX A;  4YLZ A;  2ZGL A;  3ZYG A;  4PDW C;  1HQW A;  2PHD A;  4LHL A;  3BU7 A;  1HQN A;  3VKL A;  5D2A A;  2WWU A;  3ZYB A;  4XZP A;  3EMR A;  4FPO B;  1LU2 A;  4LK7 A;  4XF3 A;  2Z69 A;  1C3H A;  4IXL A;  4RA0 A;  3TN9 2;  1MQT A;  3ZYI B;  5LEK A;  3N3H A;  1OFN A;  4HK8 A;  3VBS A;  1DG6 A;  1U5Z A;  1O5U A;  3HN3 A;  3B94 A;  1R1A 1;  5KHK A;  1WGP A;  4AXO A;  1FAT A;  2XWJ B;  4QB1 A;  3OY8 B;  5FYZ A;  2Q1M A;  4XYX A;  2VOW A;  4XMI A;  4CYD A;  5I0D A;  3B7M A;  3Q8A A;  3JUU A;  4Y33 A;  3LFI A;  4NPM A;  2E53 A;  1BLZ A;  3AKR A;  1JYC A;  4SBV A;  4QPY A;  3KT4 A;  1JZ5 A;  1QF3 A;  1WBL A;  2CHH A;  5D8A C;  1NE4 A;  4AQT A;  3BGA A;  1O8P A;  1QXP A;  1ULC A;  1AYM 1;  3PLQ A;  3S0M A;  5GJ6 A;  1F5F A;  4FPL A;  4CDW C;  2OYZ A;  2ZGM A;  3Q8E A;  3J26 N;  3OGG A;  3SH5 A;  5JSR A;  1J1L A;  3O14 A;  3NV4 A;  1N1V A;  1UZV A;  1POV 3;  4RR3 C;  3SIT A;  4KU7 A;  4XCB A;  4GMP 3;  5CIR A;  1QNW A;  1OVS A;  3QAC A;  4AVA A;  4M01 A;  1DFQ A;  4JX0 A;  3HIF A;  5KR7 A;  2WAA A;  3C7F A;  3N9O A;  3O1S A;  3ZYF A;  5IFT A;  4TWT A;  5C3S A;  1B35 C;  1UZY A;  5FZF A;  5IT6 A;  2RDQ A;  3OEA A;  4YGC A;  4JQR A;  1H1A A;  3AMN A;  1CAX B;  2UYB A;  4I3G A;  4WVM A;  4DOU A;  1H2L A;  1HX6 A;  1HJG A;  4YGE A;  3U10 A;  3WF1 A;  4E9K A;  3L9J T;  3M3C A;  2P34 A;  1VBA 1;  3GXU A;  3T0A A;  4D0Q A;  3R0R A;  4ZXE A;  3PHM A;  2MEV 3;  2V4V A;  1H8T C;  1FXZ A;  2WA3 A;  4S2G A;  4B7K A;  5FDB A;  1PX3 A;  3D4K A;  3ZKY A;  4NN0 A;  1H4H A;  4XF9 A;  2PLV 3;  1PNG A;  1NXD 1;  3CIH A;  3CMG A;  5I0U A;  2EXH A;  4CCC A;  2EIB A;  5I0R A;  1QOO A;  4WV8 A;  2GDF A;  5I0S A;  1WCK A;  2XJS A;  1SCR A;  2UWA A;  3CJX A;  3VZK A;  1ZRE A;  4IEO A;  5L9B A;  1AL2 2;  1TG7 A;  3AL6 A;  2Y33 A;  3M7A A;  2P6C A;  4Q4W 1;  3SCF A;  1O59 A;  1ZVF A;  2PQQ A;  4KG0 A;  2R07 3;  1FOD 3;  2QNK A;  5D1I A;  2D43 A;  1BQP A;  4TN7 A;  1IS3 A;  1KFX L;  2BJS A;  1W8U A;  1D4M 2;  1KGY A;  5K4L A;  4FFH A;  4JKM A;  2R0H A;  1FYU A;  1MEC 1;  3U07 A;  4HN1 A;  3B9C A;  2OUH A;  1RUC 2;  4YVW B;  2YGL A;  3S6P A;  1PO1 3;  5JXH A;  4GXL A;  4ARX A;  4PIX A;  1M4W A;  3RWK X;  3SC7 X;  4WVV A;  3ASI A;  5JI7 A;  5GZG A;  3VBF A;  1KD7 A;  3ZX7 A;  4R4X A;  2F4L A;  5CEH A;  4YZ3 A;  1BKZ A;  2JG9 A;  3K48 A;  1YCI A;  5FZO B;  3AVS A;  3ETQ A;  5JSP A;  1K5M A;  2QQO A;  1S4C A;  2R04 2;  2BOJ A;  2EAK A;  2WT2 A;  4XJ9 A;  4MOA A;  3TOJ A;  4ZU5 A;  3U75 A;  2ZKL A;  4CPB A;  5F3C A;  2BTV C;  1UXX X;  1IQD C;  2W1W A;  1QJY 1;  3I3E A;  5EQU A;  3RZG A;  5FZE A;  3RZL A;  1PK6 B;  2WT1 A;  1KS5 A;  4MXW B;  4MET A;  1UQX A;  1RUD 3;  4QPG A;  5BNN B;  5EJ1 B;  2D6M A;  2ZEX A;  1AJO A;  4QX2 A;  3ZN4 A;  1LGB A;  2ZZQ A;  4L99 A;  2Q5T A;  4S2H A;  2QDN A;  3POJ A;  4N43 B;  4XEZ A;  3ECQ A;  5DUX A;  3TEW A;  1LGC A;  2ADD A;  2HWE 1;  2JDK A;  3IMN A;  5A3W A;  4Z82 A;  4BOW A;  4Q5O A;  3UKT A;  1JMU B;  4DEQ A;  5LA1 A;  1UN1 A;  4L9B A;  5ACA 1;  2WZ8 A;  5FY4 A;  1ENS A;  1XPW A;  3HEI A;  3O7O A;  4YW1 A;  2E63 A;  3SEE A;  5BNO B;  3VHP A;  1NG0 A;  3MEP A;  4LR4 A;  4MG2 A;  1XU2 A;  2WFF 2;  4GAZ A;  3CF6 E;  1WMX A;  4AVV A;  5B4N A;  3OYW B;  3MLJ A;  2BEO A;  2XJT A;  5K0U A;  5LBB A;  1Q43 A;  1RHI 1;  1MS1 A;  3ZN6 B;  1S0D A;  1TVG A;  2W39 A;  1OH4 A;  1PMH X;  2R1D A;  3AP7 A;  1C5I A;  3GAL A;  4PIY A;  4A3Z A;  1QY4 A;  2PTM A;  1A34 A;  4LNV A;  2FD8 A;  1U0A A;  2A6Z A;  4ORF A;  4XE9 A;  5LY1 A;  2ADE A;  2ZX1 A;  5JMC A;  3VB9 A;  2G4I A;  2P3J A;  4XQW A;  4KBZ A;  3WP6 A;  2BBV A;  3ELN A;  1JXN A;  3KF5 A;  5GZC A;  3RGB A;  3CEW A;  3SMH A;  1DGW X;  4XQD A;  3E6B A;  3E6D A;  4QB2 A;  4D7S A;  1XSQ A;  4I30 A;  3KWV A;  3RZK A;  1HXS 1;  3VBF C;  4HPK B;  2UY8 A;  4ERO A;  1G9B A;  1XYN A;  1MVE A;  1N3Q A;  5A3O A;  3FL7 A;  4CCO A;  4NHX A;  2JG9 C;  1IPJ A;  5LK5 A;  4A44 A;  3VHO A;  5FZC A;  1DGR N;  2HJI A;  2H6B A;  3MF9 A;  4AEK A;  4XUR A;  5C4W A;  3VBR B;  3USU A;  3FUQ A;  4Q4V 3;  5C5U A;  4OCT A;  4CXX A;  2C9A A;  3D82 A;  3LZZ A;  3AL5 A;  1CQ9 A;  3IWZ A;  3POG A;  4LMF A;  4XF0 A;  3VBH B;  4B1M A;  5L7O A;  1G7Y A;  3V0B A;  4NVP A;  4QPG C;  1W8T A;  3DCQ A;  1YQ6 A;  1UX7 A;  4LBQ B;  4PI2 A;  1F8V A;  2UYA A;  1TME 3;  2I07 B;  4RD7 A;  5FZ0 A;  2X5I B;  3MW3 A;  5C3Q A;  3RJR A;  2QE3 A;  2ZX3 A;  2DFB A;  1YIF A;  3VZM A;  3ZSK A;  4ATE A;  1OUS A;  2NMN A;  3RZJ A;  4UXA A;  5FR3 A;  4JGY B;  2D6L X;  3JU9 A;  3WF4 A;  4FPF A;  4MGI E;  5CAZ A;  5I8S A;  1CJP A;  4MZU A;  1D2Q A;  1UY4 A;  4M0N A;  4CZS A;  4EWD A;  1GOF A;  5A7N A;  2V4A A;  4OUS A;  2YC4 A;  3UL2 A;  3RYP A;  1ENQ A;  2JDZ A;  4GKY A;  2O0O A;  2R0F A;  5JXI A;  1DYK A;  1RUH 2;  1XBF A;  4QKD A;  1PVC 3;  4R9A A;  1LEC A;  1VBD 3;  2XUM A;  1UYP A;  3I2K A;  3TBD A;  3E6C C;  5GKA C;  3UET A;  1DP0 A;  1WW6 A;  3DXT A;  2Y26 A;  4N9I A;  4OHW A;  3H7J A;  3VDC A;  3H1Y A;  3MIB A;  2YY1 A;  1GWK A;  1XYO A;  3WQ1 A;  4FOQ A;  3WW2 A;  5CKM A;  4E27 A;  1E5R A;  1HV1 A;  4E4Z A;  5I8T A;  4KWK A;  3GCW A;  3N36 A;  2BGP A;  4OHZ A;  2VMH A;  1ND3 A;  1JOP A;  1UYZ A;  4QPW A;  2VNV A;  2VW1 A;  2GNM A;  4LKE A;  2IWG B;  5KXB A;  1I9R A;  3WSO A;  1G8W A;  4WM8 B;  4RHV 3;  2VUD A;  1AR8 2;  1V9U 3;  4BIF A;  5FO9 B;  2BRT A;  2EAL A;  2Q0A A;  4Q26 A;  5C7G A;  4PI0 A;  3ZSM A;  2WKK A;  1RUJ 3;  4Z2A A;  5FO8 B;  4ES8 A;  5C4W C;  2RV9 A;  1OUX A;  4R52 A;  4CPB D;  2XG3 A;  1RUG 3;  4MX3 A;  1QJX 2;  1PIV 1;  3JBG 2;  5GLT A;  3WW4 A;  4CEW A;  2DVB A;  2BOI A;  3I4I A;  4KNC A;  4AVS A;  4Q2F A;  4H2A A;  3MUY 1;  5T5L A;  1ZRD A;  1LHN A;  4GJY A;  4XAA A;  4MHR A;  4YZ2 A;  2PHR A;  4OI1 A;  3FN9 A;  1ND2 A;  2YZ4 A;  4FTB A;  2QCS B;  3PIJ A;  3UGG A;  1NQD A;  3KGZ A;  5GLV A;  3I3B A;  1I6X A;  1ST8 A;  3M3O A;  4E4H A;  2WT0 A;  2RS1 1;  4FSJ A;  1WW4 A;  3I97 A;  1KFU L;  3GZA A;  3JD7 2;  3CQO A;  3O1R A;  3IZO A;  3ZXA C;  1G9D A;  2RM2 2;  2IXH A;  2HWB 3;  3OPW A;  1VBB 3;  3VD9 A;  2HLE A;  2PEL A;  4XFC A;  3ZO0 B;  4Q8L A;  4W50 A;  3J7H A;  4DS0 A;  4CUG A;  5I93 A;  3AKP A;  1X33 A;  4XFI A;  1Q5O A;  3TNP B;  3T2O A;  5JPM B;  1C8M 3;  4WVW A;  1IG0 A;  4S2F A;  4FPC A;  2HYK A;  2JE7 A;  2YB7 A;  1CGP A;  2JEC A;  4DUV A;  3JZV A;  2W5F A;  1RL3 A;  1S0C A;  3BOP A;  1GQP A;  4M4R A;  4LQR A;  5LA9 A;  1ASJ 1;  3LF7 A;  4WBB A;  4Y3O A;  4D69 A;  1ULP A;  2ZAA A;  3URF A;  3GBF A;  1VRH 3;  2LAL A;  1VBC 1;  4NID A;  1R1A 3;  4FPH A;  3KS7 A;  2YFZ A;  3JB8 A;  5DAV A;  4L11 A;  4MYE A;  1V6K A;  2YBK A;  4G3Y C;  5FZ4 A;  4FOY A;  3J7M A;  5A7W B;  2GN3 A;  1DQ2 A;  1P8J A;  3EHK A;  1JOD A;  4XHB A;  3RRD A;  3ZLI A;  4CTE A;  1UF2 C;  2H0B A;  2XL9 A;  4GWJ A;  1GU3 A;  4NIA A;  1W8N A;  2W2I A;  4R9B A;  3O12 A;  3PME A;  3VBO B;  2EVX A;  2AEY A;  2GP5 A;  3ZVX A;  4XIO A;  3NQH A;  4FXK B;  1LHW A;  4IE6 A;  4MUV A;  5A80 A;  1GQH A;  4CDU C;  5ANQ A;  5FZB A;  3HQR A;  1AYM 3;  1CN1 A;  4P9G A;  4ISR A;  3C7H A;  1TNF A;  1VMF A;  2A75 A;  1YI7 A;  3AZV A;  3I2O A;  4CEW C;  5D8A B;  3ZM8 A;  1B09 A;  4UF0 B;  1UOB A;  4CCJ A;  1IG3 A;  3GHN A;  1VAL A;  3LA7 A;  4CDW B;  4JAA A;  5BY5 A;  3MFA A;  2QUO A;  5EJZ B;  2RS3 2;  4LBN A;  5GAL A;  2GNB A;  2LS6 A;  3KV9 A;  3QOP A;  5J98 B;  3A21 A;  2EIG A;  5FLJ A;  1JYI A;  4OI0 A;  4RR3 B;  2WYS A;  4NRM A;  4W6W A;  5LA0 A;  1CES A;  4LLF A;  5FP7 A;  3DPR A;  3H0O A;  2OT7 A;  3T2T A;  3S7E A;  4LE3 A;  5JVV A;  1AUY A;  1B35 B;  3VD7 A;  1I3H A;  1SCS A;  4O61 A;  2FCT A;  3AMQ A;  4DY3 A;  3WW1 A;  4D6S A;  1SBD A;  1LTE A;  3AXD A;  3TNQ A;  1IOA A;  2BGO A;  4EN8 B;  1VBE 1;  1XE8 A;  2H6C A;  4XJU A;  3FE5 A;  2WQ8 A;  1KDM A;  3V56 A;  1PVX A;  2CYF A;  2WWS A;  1H8T B;  1X36 A;  1W8F A;  2B42 B;  1PGL 2;  4P9L A;  4M0H A;  3H8U A;  4Q4W 3;  4XVH A;  2BNN A;  4ATF A;  2BW8 A;  3OUH A;  5T3N A;  2GH2 A;  5E16 A;  1UW8 A;  1H0B A;  5FIX A;  1KDK A;  1XB9 A;  3FHI B;  1R08 2;  2K9Z A;  3WQ7 A;  4XMA A;  1J3P A;  1QQP 2;  1EV1 2;  1RJ7 A;  2ARB A;  1PZ7 A;  1W06 A;  2BFU L;  4YWA A;  1AR6 2;  2ZHM A;  3I3D A;  2QBX A;  4UYB A;  3FX3 A;  1WCU A;  4KL1 A;  4YSF A;  3WDY A;  1MEC 3;  1ZRI A;  4QX8 A;  4UFH A;  4JRA A;  3LEG A;  3ZYJ B;  2NYY A;  4UFI A;  3FFZ A;  5FP3 A;  4EWE A;  5IWF A;  4AED A;  3PUI A;  5A6X A;  1WBF A;  4Y4R A;  2HKX A;  5LBE A;  5CFC A;  5L36 A;  3SKJ E;  1BCX A;  2VNO A;  4AEM A;  5J36 A;  1OVP A;  3NJZ A;  2WZR 2;  5T55 A;  1JTZ X;  1QNY A;  3A23 A;  4HET A;  2LM3 A;  3WNN A;  2KR2 A;  1MPX A;  1R64 A;  3BIW E;  2R06 2;  2ZGS A;  3B00 A;  3W5N A;  2RHP A;  2J1U A;  2CNA A;  4AFD A;  2VL4 A;  1QJY 3;  3ES1 A;  3C8X A;  3ST7 A;  3DF0 A;  4BQ1 A;  4JHZ A;  2CY6 A;  1US3 A;  2FDJ A;  3RSJ A;  1DZR A;  4AL9 A;  3J8F 1;  2B5H A;  4AHZ A;  2HBU A;  2RS5 1;  1NQJ A;  1HB3 A;  3SHR A;  5FPZ A;  4UFL A;  4B29 A;  5DAP A;  3WX5 A;  3DPR C;  5DZG A;  3IDE A;  3ZFG A;  4I0W B;  2VMI A;  3QBQ A;  5BV6 A;  2HWE 3;  4XPV A;  5FRE A;  3VD4 A;  2PHX A;  1AL2 1;  4GKX A;  3KMH A;  3ZXF A;  5BNP A;  1KS4 A;  1WW7 A;  1W03 A;  3FBY A;  5ACA 3;  5F3E A;  3KF3 A;  1GP4 A;  2WFP A;  3B3Q E;  2A71 A;  1ULO A;  1Q8Q A;  2JG8 A;  2JIC A;  5K7P A;  1ZBA 3;  4KG8 A;  2VCC A;  4XHX A;  4JGZ A;  1OT5 A;  1D4M 1;  4JHT A;  2IVJ A;  2IXC A;  3OBA A;  5DXD A;  3T08 A;  2HWF 3;  3ZMN A;  4Q4X 1;  4YAR A;  5IYY A;  5CG8 A;  5FPB A;  4QKN A;  2C6S A;  4HLT A;  4J1W A;  1Z0H A;  2VM9 A;  1RHI 3;  1GNY A;  5HCH A;  2J1T A;  3LD8 A;  1R09 2;  1IKQ A;  5JXG A;  4IE7 A;  1UXZ A;  2ZKN A;  2D6K A;  3T09 A;  3I3Q A;  4N90 A;  5HV4 A;  4R9D A;  3O1T A;  1UY2 A;  1YJL A;  4N7I A;  1APN A;  3KCY A;  1FNZ A;  2CGO A;  3T3Y A;  4YW4 A;  3T4H B;  5IJR A;  1NLQ A;  2DBN A;  5FLI A;  3RYR A;  3OTF A;  2VZU A;  4JVA A;  2RE9 A;  2R04 1;  1RUI 2;  2RJK A;  5CKN A;  3ACG A;  3H9A A;  2FCU A;  2J1S A;  1MZ5 A;  3NAP A;  4FT8 A;  5C71 A;  2ZPX A;  5L9V A;  5LB6 A;  3DXU A;  4BQ4 A;  4GH4 C;  1HXS 3;  2QQV A;  2VZT A;  5CFC C;  3LOI A;  5F3I A;  1W6P A;  4N53 B;  4OI4 A;  1LOB A;  5F32 A;  1DLL A;  2JD4 A;  1RUE 1;  5FZ6 A;  4MXV A;  4RN5 A;  1T6B X;  1UY0 A;  2V73 A;  4YFW A;  1GZW A;  2I2S A;  5A7Q A;  2BYV E;  2P17 A;  5C6C A;  3E1F 1;  1BK1 A;  2VZQ A;  2JG9 B;  3ZSL A;  5ABJ A;  2ARC A;  1LOC A;  2HEV F;  3WDX A;  5JOY A;  3HMY A;  1NYW A;  2ZS6 B;  1NCR B;  1GQG A;  1REE A;  4QPI A;  5SV8 A;  4LLO A;  2W1U A;  3RMY A;  3ZFG C;  2Y6F A;  2ID4 A;  3G6J B;  4Q1P A;  1WCQ A;  5B2G B;  5BNP C;  1TMF 3;  4QPG B;  3JCI A;  5FZ3 A;  4HZF A;  3WNP A;  4TLF A;  2JDY A;  2WR9 A;  2JG8 C;  4RS5 A;  3H3Z A;  4YNI A;  1JI6 A;  3HT1 A;  5FQ0 B;  4BPZ A;  4WM7 A;  4JGZ C;  4ZHN A;  3O1P A;  5A33 B;  2WYF A;  2AH2 A;  5FUN A;  3R05 A;  1OA4 A;  1BEV 2;  4DO0 A;  4AEJ A;  1FMD 2;  3OGV A;  2BNM A;  2QDR A;  4GB3 1;  4U36 A;  5F8P A;  5IVV A;  4R4Z A;  3WXP A;  1VAV A;  3GNE A;  3N9Q A;  3P5B A;  5C70 A;  5AC9 2;  2QVS B;  3U11 A;  5FAX A;  1SPP A;  3NRU A;  2LTN A;  3I2I A;  1G9F A;  2ZCW A;  1IKP A;  2X8K A;  2YHJ A;  4EE2 A;  1Z7S 2;  1WA6 X;  1YQ8 A;  5AFE A;  4AFB A;  4Y22 A;  2TBV A;  2DUO A;  3T0B A;  3D0S A;  2W0X A;  1W9T A;  1XQN A;  3AKT A;  2G9F A;  2IZW A;  2A6V A;  3QCW A;  4HXC A;  4NHK A;  5IFP A;  1J3R A;  5K9Y A;  5HCB A;  5IVE A;  2E51 A;  1O3Q A;  1W39 A;  3NAP C;  3PUH A;  4XC9 A;  5LCW L;  4QMA A;  1S2B A;  1E57 A;  2WO7 A;  4QQL A;  2Q30 A;  1FV2 A;  4IV3 A;  3TYJ A;  1W0O A;  3LQC A;  2ARE A;  2PXJ A;  3K4A A;  4RQP A;  5FYB A;  3RVH A;  5JLV A;  3POY A;  5FYU A;  5CNA A;  2E7Q A;  4P9Y A;  1XNT A;  1REF A;  1YYN A;  2VMC A;  4XF4 A;  5A3L A;  4ASL A;  1WD3 A;  1S55 A;  4ZON A;  4AQ2 A;  2RG4 A;  4EN6 B;  2DVF A;  2WS9 2;  2XR4 A;  3KV6 A;  4CP9 B;  5CFD A;  1FT9 A;  1GWL A;  1PMJ X;  3CJI A;  4QHB A;  3E5X A;  3W5M A;  5D21 A;  2QFE A;  4OQ9 A;  5J96 B;  1L7R A;  3IPV A;  3O0W A;  1QH6 A;  3T1M A;  4CUC A;  2XUE A;  3VKO A;  5C4W B;  1FPN 3;  1UWW A;  2D6P A;  2RVA A;  1ZZC A;  2B4K A;  2RR1 3;  2XOM A;  4LEJ A;  2GND A;  3LIH A;  4QPI C;  1PO2 3;  3NW4 A;  2Z4F A;  3AKS A;  3K51 A;  3OGJ A;  3P1I A;  4Y5T A;  1XNK A;  1HRV 1;  3ZFF B;  1RMU 1;  1AYN 1;  4AHY A;  1NZI A;  4NHY A;  1C5H A;  3IM0 A;  4RS5 C;  3NVC A;  2YU2 A;  3BCW A;  5FXZ A;  4FFG A;  4XUO A;  4LKF A;  4LOT A;  3SKV A;  3WD5 A;  2E33 A;  1PNF A;  3KHB A;  1YQ2 A;  1JOB A;  3INA A;  2YUE A;  1LES A;  2GNT A;  4TZD A;  3USS A;  3LA3 A;  3PUS A;  3ZFE A;  4RFT 0;  2I74 A;  1RIR A;  2ETE A;  5CAD A;  1STM A;  1AX1 A;  4EYU A;  1NOV A;  5EHD A;  5A7O A;  2JKB A;  4E8D A;  2E6V A;  4Q0P A;  3WG4 A;  2WNV B;  2V5Y A;  4RSU A;  1H8V A;  1PHM A;  3QH6 A;  3VD3 A;  1LCL A;  3V0A B;  2XLG A;  3OPZ A;  4XJA A;  3H8R A;  1AR8 1;  1W8O A;  3CLP A;  4AHW A;  1RUO A;  2WQZ C;  3Q9O A;  3OBT A;  1BVP 1;  2UWC A;  4I2O A;  4I01 A;  3K3N A;  2HEY F;  4DPN A;  4IUG A;  3VZJ A;  3NNJ A;  4JV4 A;  2GMM A;  5DAB A;  2P2K A;  4XTP A;  3LWC A;  1EAH 1;  4BK5 A;  4NJ4 A;  4ONU A;  3KHC A;  1O5L A;  2A70 A;  1JYW A;  2GC3 A;  4IV3 C;  3G7D A;  5FZ1 A;  3K4Z A;  4A6S A;  4COV A;  4BQ5 A;  4RQP C;  3ZXJ A;  4K1Y A;  4H55 A;  1GLH A;  4Q4Y 1;  4IEU A;  3SH3 A;  5J09 A;  2QQN A;  1WLW A;  5BYN A;  5CYY A;  3MIF A;  3RQ0 A;  3RPQ A;  3IN9 A;  2MEV 2;  5FZD A;  5A6Y A;  1H2M A;  2OQ6 A;  3U37 A;  5CFD C;  1AF9 A;  1W0N A;  1W04 A;  3CJI C;  3RZM A;  4HAN A;  4OZX A;  3HQU A;  4CDU B;  4MGK E;  1NXM A;  2PLV 2;  1FV3 A;  1RUN A;  4XAB A;  2Q4S A;  4DFS A;  1XC6 A;  2A3Y A;  3DEC A;  1CON A;  4GD4 A;  1QJZ A;  3Q8F A;  2RDN A;  1MZE A;  3GJB A;  3BVC A;  4CEW B;  1OLQ A;  2J42 A;  2ZGU A;  2Y64 A;  1X50 A;  5FWE A;  2R07 2;  4ES9 A;  1OLR A;  1FOD 2;  2NLR A;  4XUT A;  3LEI A;  4PQ9 A;  3VD5 A;  3S5Q A;  5FPX A;  5T54 A;  2WC2 A;  4IQP A;  5LZ6 A;  3VKF C;  2VNR A;  4NHM A;  3WIN E;  5A32 A;  1BXH A;  4DEV A;  1A78 A;  4LO6 B;  1W2N A;  2OVU A;  2YGM A;  3R4U A;  4LXL A;  2WNU C;  2C26 A;  4D3W A;  4AF9 A;  3RYK A;  3WEZ A;  5KHI A;  5FMO L;  5T5P A;  5A1A A;  4MV2 A;  1PO1 2;  1VBE 3;  2VAU A;  3FWE A;  4IV1 C;  3ZFE C;  3THP A;  3NNG A;  1O3T A;  1UU5 A;  2ZGT A;  2AZ5 A;  4KWL A;  2PAM A;  1UIJ A;  2LUW A;  5JZG A;  4I02 A;  4QXH A;  2ARA A;  1UIK A;  3HNB M;  5FPL A;  1MQT C;  5F37 A;  2DF7 A;  3VBS C;  1UD1 A;  2OXB A;  4U2A A;  5GZE A;  3VHN A;  2ZGK A;  4BDV B;  1LAJ A;  1QJU 3;  3GZE A;  5F39 A;  5FP9 A;  1OA2 A;  4RFR B;  2ZX0 A;  1V6J A;  2NZ9 A;  1RUF 1;  4Q8K A;  2Z5W A;  1IGO A;  2J1V A;  1AVB A;  4OFG A;  4XDQ A;  3CO2 A;  1SDW A;  1GBG A;  2VBD A;  1DZT A;  4CDX A;  2G9G A;  4H7L A;  2GAU A;  3WF3 A;  4GWN A;  4CU7 A;  2YMZ A;  1RUD 2;  4K9S A;  1AXK A;  4P02 B;  3MZH A;  1GZC A;  5F6L B;  2BER A;  3EO6 A;  5FV3 A;  5JXJ A;  3B02 A;  4XBN A;  4BQ3 A;  5DPN A;  2DV9 A;  4DRR A;  3BI3 A;  4LA3 A;  1CAW B;  4ZS3 A;  4WZC A;  4Z92 B;  1OKO A;  4E4S A;  3H1W A;  5DZF A;  1HB4 A;  1COV 3;  2A1X A;  2JEN A;  4QGN A;  1AZD A;  2XHK A;  2JB4 A;  2JE9 A;  1NA1 A;  3CDZ B;  2WIN B;  2WZE A;  3IDC B;  1W3V A;  2VG9 A;  2Q8D A;  1ZBE 3;  1H1M A;  4G9S B;  4F83 A;  1S0J A;  1UOF A;  4YYO A;  1QXJ A;  4A2U A;  3J8F 3;  4IE0 A;  1YFW A;  3AMM A;  3THC A;  5A6Q A;  2RS5 3;  5FTT C;  1ZA7 A;  1NY7 1;  3FFQ A;  4MGS A;  4DXT A;  2BBA A;  4OYU A;  4D7T A;  4G4F A;  1VE0 A;  5EFU A;  4H14 A;  3POF A;  4P9W A;  4R8H A;  2XPJ A;  2F4P A;  3I59 A;  5FZL A;  4P9I A;  3VDD A;  1OPO A;  3VLB B;  4YM0 A;  3RI9 A;  2Y8K A;  4QB6 A;  1W2A X;  4BHP A;  3EB7 A;  2CWM A;  1SDD B;  4RGA A;  3T1L A;  4HOO A;  1QJF A;  1YXW A;  3DPR B;  2JDP A;  3OPT A;  3TEY A;  1ZZB A;  2VBP A;  2OS2 A;  3CZU A;  2VUC A;  3GDB A;  2Y0I A;  4CCM A;  1AR6 1;  1W6O B;  1W90 A;  5JR2 A;  2BP6 A;  3P3P A;  4Q4X 3;  1GMM A;  1A6C A;  4D6Q A;  2DUQ A;  2XDV A;  3LGR A;  4Z2W A;  2ZEY A;  3UK9 A;  4A7K A;  3ALQ A;  3DGT A;  3KVA A;  4YG0 A;  2W52 A;  3KSC A;  2Y6G A;  1LGN A;  1PGS A;  4UBG A;  1WW5 A;  4FPE A;  2HYX A;  2NM1 A;  4AI3 A;  5FZH A;  1LOG A;  3SEP A;  4Q4V 2;  4L92 A;  4PLN A;  4CU8 A;  1TNR A;  1E5H A;  1Y9M A;  2A6W A;  3QH7 A;  3ABZ A;  4PF1 A;  3W59 A;  5LK7 B;  4X6Q B;  1AR9 1;  1BYH A;  3P3N A;  1V00 A;  5FY7 A;  2OQ7 A;  4ZPI A;  2D3R A;  4HKO A;  1HKD A;  1SAC A;  2XJV A;  5HXM A;  2PAK A;  5AVP A;  4DXR A;  1Y3T A;  3OUI A;  2WBK A;  4RYD A;  1TME 2;  4KWJ A;  4PBP A;  1FAY A;  3HD8 B;  2UWB A;  2VU9 A;  3W20 A;  2DU1 A;  3ZPY A;  3BPZ A;  4IGP A;  1IS6 A;  2IVI B;  4W65 A;  1LNS A;  2PHT A;  3KB5 A;  2G1M A;  2ILM A;  4D6R A;  5A70 A;  1OSG A;  2DYC A;  2GC0 A;  4QKF A;  1RUE 3;  2ZGQ A;  1ULE A;  3N35 A;  4HL0 A;  3MPP G;  4YGB A;  1K5M C;  2P3I A;  3KM5 A;  1YFX A;  3OG2 A;  1AXZ A;  2D97 A;  4FQ4 A;  4GH4 B;  2VBB A;  2HWC 1;  2CU5 A;  3FUO A;  4NPR A;  4R9C A;  1LHO A;  1X9T A;  2IXL A;  2WSU A;  5DAW A;  2YU1 A;  1BVV A;  2D44 A;  2Y60 A;  5JCT A;  2OII A;  1OQE A;  1J58 A;  1H9P A;  5T5J A;  1ENX A;  2VTX J;  4XFH A;  4MSV A;  3AK0 A;  2D3S A;  1PVC 2;  2D5H A;  1VBD 2;  2OPW A;  5BXX A;  4NIH A;  2XL7 A;  2AEN A;  4FO9 A;  4ARY A;  3SLI A;  2HWD 1;  5LY2 A;  2XBO 3;  5FO7 B;  2Q1F A;  1W6Q A;  3VDD C;  1AR7 1;  5HCA A;  2ZX2 A;  1CAV B;  1UPS A;  5T5O A;  4PLO A;  1BBT 1;  4HSJ A;  4NOT A;  5F6K A;  4ASM B;  3ZN5 A;  3NKT A;  1TZO A;  3III A;  4Y1U A;  2ZAH A;  5HV0 A;  1VJ2 A;  2ORZ A;  5FJH A;  3M3Q A;  3WNO A;  4MH0 E;  3NMB A;  4TTG A;  3WNM A;  3WLU A;  4IGQ A;  5KWR A;  4IEY A;  3KQR A;  3PMS A;  4GB3 3;  4RHV 2;  5K0U C;  5FMC A;  4MGT A;  1RUI 1;  2RMU 1;  2P6H A;  1V9U 2;  3LIG A;  1RIT A;  3LB9 A;  4LIU A;  1PGW 2;  1S0B A;  4JGZ B;  5ISL A;  4XQ4 A;  1RUJ 2;  2C0Z A;  3AZZ A;  3VBU B;  3IAQ A;  2WUH A;  4Y1X A;  4N9H A;  2XJU A;  4CP1 A;  1RUG 2;  5F2S A;  3FHQ A;  2DU0 A;  4Q29 A;  3C3V A;  4GQ7 A;  4E2G A;  1QDC A;  3VL9 A;  3GJA A;  4QWN A;  4QXB A;  4URT A;  4AFC A;  4AHX A;  4QX7 A;  3F95 A;  4AFM A;  3ITQ A;  3M3I A;  3ZDS A;  1S0G A;  3HJR A;  4I09 A;  4W6X A;  1SLB A;  3RI8 A;  2BUK A;  2YC0 A;  1MAC A;  4RGK A;  1J3Q A;  1UU4 A;  5J48 A;  5J7M A;  2QKD A;  1PMI A;  2EXK A;  1O4Y A;  4LBK A;  3N7M A;  1OLM A;  4H3W A;  4O9G A;  4OHV A;  3NL1 A;  5TSW A;  4FCA A;  2EA7 A;  3NAP B;  1CZS A;  3OY8 A;  2HWB 2;  1VBB 2;  2EXJ A;  4K40 A;  4EZH A;  2ERF A;  1E5S A;  1QXR A;  3D3A A;  2D5F A;  4NAO A;  3KD4 A;  4FPG A;  5HCF A;  2WLQ A;  1CAU A;  3RZZ A;  1F15 A;  5IAT A;  2D98 A;  2JEM A;  1BMV 2;  3K3O A;  2OW4 A;  1C8M 2;  2LRP A;  3VHR A;  5FWJ A;  4E8C A;  1GZW B;  4M3C B;  5L7O C;  5LBC A;  3WF0 A;  5GZF A;  4EN7 B;  4PLM A;  1I5P A;  5FZG A;  2K0G A;  1Z78 A;  3I7D A;  4COU A;  4OI2 A;  2VMF A;  1BEV 1;  3CL1 A;  1MS0 A;  1FMD 1;  2W1S A;  2VZP A;  4XBL A;  1VRH 2;  1UYY A;  3C7E A;  1HRV 3;  1R1A 2;  3PUQ A;  1RMU 3;  1AYN 3;  3BN6 A;  3WDW A;  3OJB A;  5IVF A;  4QPI B;  2JDM A;  4P9X A;  1AX0 A;  5C8C B;  4Q0V A;  1O4Z A;  5FZ7 A;  1T6G C;  1BHG A;  1Z7S 1;  5A3M A;  1DYO A;  3AFG A;  3OGS A;  4YW2 A;  1RVF 1;  1MS3 A;  4AI9 A;  1FX5 A;  2DVG A;  3LSE A;  1MS8 A;  2W95 A;  4RS5 B;  2VY0 A;  3LEM A;  4AVC A;  5JUV A;  4IEZ A;  1CAX A;  1S2E A;  1ENR A;  1N1T A;  1W2O A;  4C90 A;  1AYM 2;  1TEI A;  2B45 X;  4DQA A;  4AW7 A;  2ZBJ A;  5KHJ A;  2IFW A;  2VZS A;  2Z2S B;  5CVR A;  4QQP A;  1OOP A;  4QGL A;  2NPI A;  1CVN A;  4IW3 A;  4PDW B;  4HVO A;  4DRV A;  3UV9 A;  5IAV A;  1OF3 A;  4V1P A;  3ZR6 A;  1DZQ A;  1CIW A;  3THT A;  1HRI 1;  3C7O A;  3DKQ A;  3ZYP A;  2ZAB A;  4K21 A;  4P00 B;  4JTO A;  2V09 A;  1ND3 C;  4GIQ A;  4OMC A;  4UOJ A;  5IK7 A;  1EAH 3;  3CZJ A;  4MHU A;  3TEX A;  5GZD A;  1G86 A;  3T0D A;  1A3K A;  4IER A;  2VH9 A;  5C3P A;  5DDJ 1;  4Q4Y 3;  2QZ3 A;  1HV0 A;  4YW7 A;  4BQW A;  3HBK A;  2NN8 A;  1JS9 A;  2VUL A;  3IDB B;  1D0H A;  3KVB A;  3M1H A;  5LRR A;  1N1S A;  4FPJ A;  2DUR A;  4IV3 B;  1JHJ A;  4UI9 L;  4EQV A;  3AX4 A;  2GC1 A;  3MYX A;  4RQP B;  3PVO A;  3LSD A;  5FFO C;  1XRU A;  4YVW A;  5CB7 A;  4BJ0 A;  3WQ0 A;  1X82 A;  1YO8 A;  2MHF A;  1DQ5 A;  4AWD A;  1W9W A;  5KHG A;  2ZHL A;  3K75 B;  4WZF A;  1RTV A;  4B7E A;  4Z8B A;  5LRS A;  2EXI A;  1HN0 A;  3AYC A;  4OHY A;  2OUJ A;  2W1Q A;  3N7L A;  4LUM A;  5CFD B;  2VW2 A;  1ND2 C;  2GAL A;  3HPN A;  2XLF A;  4XFF A;  3CJI B;  2Y6J A;  1NAE A;  4Q4W 2;  4S2D A;  5A1L A;  3K46 A;  4DUW A;  3R6S A;  2A6X A;  2VOT A;  3E97 A;  5FZO A;  3W21 A;  3ZXG A;  1JYX A;  1ZZ6 A;  2VVE A;  4Y20 B;  3LDR A;  4QX0 A;  4N7U A;  3DYP A;  4LOR A;  1W2U A;  1RXF A;  5FZI A;  5BNQ A;  4ZKT B;  4B1L A;  1O8S A;  2DVA A;  1VBA 3;  3F2Z A;  3EYP A;  2VVF A;  3TN9 1;  4HVQ A;  1PK6 A;  3ZSJ A;  1K45 A;  4M3C F;  1DF0 A;  1MEC 2;  3D6E A;  4IEW A;  4OHX A;  4ZU7 A;  2UU8 A;  4NR1 A;  1Y9G A;  3M70 A;  3IB3 A;  1SEF A;  4FQZ A;  3VZL A;  4PF5 A;  3B69 A;  3K77 A;  2VCM A;  4B4P A;  2WNU B;  5E88 A;  3V64 A;  5GLZ A;  3ROU A;  3TWI A;  3MIG A;  4HBN A;  4XZU G;  2XKP A;  3N9N A;  5G04 L;  5FZ8 A;  4IV1 B;  1KJL A;  1OOP C;  5FZM A;  1GYK A;  5E89 A;  5A6Z A;  4V2V A;  5BNO A;  3O1M A;  2XH6 A;  5EYX A;  3I2G A;  4IEQ A;  1C4R A;  1RUF 3;  3PVE A;  1DBN A;  5LA2 A;  3NKG A;  1NZC A;  1QJY 2;  4KH9 A;  1MQT B;  4Q0U A;  3VBS B;  2JIJ A;  2AAC A;  4O9E A;  3MV1 1;  2ZGO A;  3BOD A;  3ZN6 A;  4GWI A;  2PLV 1;  4FPK A;  4XFA A;  4V2W A;  4HKW A;  3ETP A;  5FY1 A;  3VZN A;  4TYS A;  3BOW A;  2HWE 2;  1KQR A;  4MGY E;  2F6B A;  4NAM A;  1O91 A;  4NRP A;  3RWN A;  4CE8 A;  3FLR A;  2GC2 A;  2R07 1;  1DQ4 A;  5ACA 2;  4Y5S A;  3JQX A;  1JU4 A;  1ZBA 2;  1VB4 A;  2EID A;  3DKW A;  2PHU A;  3IBM A;  2D3P A;  1Q8S A;  1UNB A;  3ON7 A;  5H9Q A;  1NLS A;  2FCV A;  2HWF 2;  4OLL A;  5G05 L;  2K46 A;  1DYP A;  4HPK A;  2JXA A;  1RHI 2;  1QU0 A;  4FFF A;  1OHF A;  4UBH A;  1O3S A;  2WDB A;  3ZIW A;  4KBB A;  4Y5Z 0;  4DNY A;  5I91 A;  2PMW B;  1UMZ A;  2VO5 A;  3D8C A;  3FC0 A;  1Q3E A;  3ACH A;  5LBF A;  3VBR A;  1UKG A;  4YW5 A;  1X7N A;  4UW3 A;  4OUM A;  4XUP A;  4XAE A;  1SLT A;  3CHX A;  2NMO A;  3I49 A;  2C1F A;  2BWC A;  1OD5 A;  3HR9 A;  3VBH A;  4BQX A;  1DLC A;  3R4S A;  5L9R A;  3BB6 A;  2A3W A;  2XVK A;  4ITC A;  5JIA A;  4WVM B;  4LA2 A;  1KJR A;  3IT8 A;  5A32 B;  4GA9 A;  4BQ2 A;  2PYT A;  1OQD A;  2HEW F;  1HXS 2;  2CV6 A;  4XJ8 A;  2X5I A;  3IMM A;  4Y26 A;  4CDQ A;  5GLU A;  4OUE A;  5F5Q A;  1RUC 1;  5FOJ B;  2DTW A;  1E5I A;  3KQ4 B;  4P5H A;  4FOV A;  2KM2 A;  3POI A;  4JGY A;  3WNL A;  5BNO C;  1D4V B;  3M3E A;  1K5J A;  4AGR A;  1RJ8 A;  4LO5 B;  3VGI A;  5FXW A;  3VV1 A;  2DCY A;  2XGX A;  3AC0 A;  4P08 A;  4AG4 A;  1AR9 3;  2JJ6 A;  3AMH A;  2Z42 A;  2ZAC A;  4AR2 A;  4C0B A;  1YI9 A;  4XUN A;  3MLL A;  4AED C;  3OCP A;  2O8Q A;  2X53 S;  5EP9 A;  2QZ2 A;  3U0Z A;  1TMF 2;  1F9K A;  1VPH A;  2BU9 A;  1HN1 A;  3GBG A;  3LAG A;  4QU2 A;  2GMP A;  5FK7 A;  5C8W A;  1X8M A;  1NX9 A;  2J7M A;  1EUU A;  2HWC 3;  4KWU A;  3VBF B;  2PFW A;  1OI6 A;  5F5A A;  4OQ8 A;  1H1I A;  2I45 A;  3O1O A;  2VC9 A;  4WVZ A;  1YC6 1;  2RJ2 A;  4IEP A;  4UT5 A;  3K2O A;  5JR7 B;  1SFP A;  4LO7 A;  2PHW A;  1ZZ9 A;  4IDZ A;  1K5M B;  4KQ7 A;  3AM2 A;  3NV2 A;  2ZGP A;  2ZEW A;  1IS5 A;  3KGL A;  4QDQ A;  3AYE A;  4CP0 A;  1JUI A;  2WFF 1;  3LCP A;  3WV6 A;  3VBR C;  1SHW B;  2CL2 A;  1XU1 A;  3HNM A;  1GR3 A;  2HWD 3;  1LRH A;  3VKN A;  2OZ6 A;  1AR7 3;  1DU3 D;  1UPI A;  5CU1 A;  3TB0 A;  1JZ2 A;  2E26 A;  3NST A;  5C9A A;  1BBT 3;  1JH5 A;  4YW6 A;  1W05 A;  4HFS A;  4QQO A;  3VBH C;  4JKK A;  3AP6 A;  3AXE A;  5FZ9 A;  3AZX A;  2B7Y A;  2KD7 A;  4PCR A;  4A7Y A;  2DTY A;  4DIQ A;  1XSR A;  3AZY A;  3WG2 A;  1S0I A;  3MFC A;  3I59 B;  3JQW A;  4Q4V 1;  4XTM A;  3WUD A;  3X29 B;  4AI2 A;  5CA6 A;  5FCC A;  1X9P A;  2PA7 A;  5F5I A;  4CDQ C;  4YM3 A;  5EV7 A;  2RMU 3;  5FKB A;  1V0A A;  1UOJ A;  1ALY A;  1C8N A;  2YBS A;  5FP8 A;  4ET7 A;  5IVJ A;  1TME 1;  1XYP A;  3NJY A;  4COY A;  1A8M A;  2VCA A;  2GSY A;  4BIO A;  5KC5 A;  4K1Z A;  2ATF A;  4XW3 A;  5K0U B;  4M3C E;  2X10 A;  4IET A;  5IAX A;  1RYY A;  4QKB A;  2DVD A;  1YEW A;  2ZMK A;  3H3U A;  3MV0 1;  3OBR A;  3I2H A;  3MDP A;  1W28 A;  1FPN 2;  1JZ8 A;  4QM9 A;  2RR1 2;  5DAX A;  3WP4 A;  2W91 A;  4QT6 A;  1N3O A;  1PO2 2;  3S7I A;  4LO4 B;  4N8M A;  3J9S A;  2P37 A;  3WOG A;  2RDS A;  3LE0 A;  4IGO A;  4NE9 A;  2FDG A;  4JDM A;  4Y4Y A;  5FY0 A;  1GOG A;  1S1A A;  4LBL A;  4COZ A;  4C0H A;  2BQP A;  4KGG A;  3UYJ A;  4DXZ A;  3O0X A;  4AQS A;  2ZZJ A;  5E6H A;  5A7W A;  2D6O X;  2BZD A;  4UW4 A;  3N9M A;  4RL7 A;  3WG1 A;  2VEC A;  2DWR A;  1H6Y A;  3KCC A;  4FI9 A;  4LHK A;  1YRZ A;  3VBO A;  3WCS A;  2LW8 A;  3MID A;  1PIV 3;  3M8L A;  4C8D A;  4IE5 A;  1YQC A;  1GOH A;  4CCD A;  5ABJ C;  2MNG A;  1QKQ A;  2WN2 A;  5DUV A;  4CUA A;  1CR7 A;  1VB2 A;  2OX0 A;  4LKS A;  2XML A;  4XFG A;  5JAX A;  3USU B;  2ZMN A;  4LUK A;  1W8W A;  2XVG A;  2SLI A;  1ZM1 A;  2WAO A;  4MGQ A;  4BM8 A;  2VGD A;  4B4Q A;  3U1X A;  5CKQ A;  5L7O B;  2RS1 3;  4UF0 A;  4E2S A;  2AUY A;  3NV1 A;  1PGW 1;  4PHZ A;  3WF2 A;  5C9A C;  3V0B B;  1QWR A;  5GM0 A;  2K2S A;  3PL0 A;  1RUH 1;  3TAY A;  3ES4 A;  5FY5 A;  2Q8C A;  4CDW A;  2W94 A;  4XUQ A;  2VUA A;  5B4X A;  1W6Q B;  4WM7 C;  4XIL A;  2BDR A;  3WZ1 A;  5JOW A;  1JZ3 A;  1RVF 3;  3EJK A;  2Y38 A;  4LUL A;  5KC6 A;  1I1E A;  2JKX A;  4F7Z A;  3N4M A;  2CGP A;  2OKX A;  2PHL A;  3EBR A;  4NO4 A;  1H2K A;  4FP3 A;  3AB0 A;  1VMJ A;  5JSO A;  2AEZ A;  5FXX A;  2FMY A;  2VVD A;  2BVV A;  5IK8 A;  3V65 A;  1B35 A;  1F4H A;  1K12 A;  2QTW B;  2TUN A;  2JWP A;  4QX3 A;  1PM4 A;  4XJW A;  1ASJ 3;  4AZZ A;  2IXI A;  1LR5 A;  2WO1 A;  1KRI A;  1SLC A;  4GAL A;  2VME A;  4HN0 A;  4QHO A;  4EN0 A;  2ES3 A;  1ULD A;  1VBC 3;  3LEK A;  1EYB A;  3A7Q A;  3U78 A;  4LHN A;  4TSV A;  5FMD A;  3HQX A;  1HRI 3;  2YPD A;  3UJO A;  5APA A;  1Y4W A;  1GIC A;  2F17 A;  5DN2 A;  1OUR A;  3OSD A;  2FZ1 A;  1QJX 1;  1DCS A;  3JBG 1;  2JDH A;  1C8M 1;  4F8A A;  4Q0S A;  3LA2 A;  2JIG A;  3BUC A;  4URA A;  2ZOE B;  4B4R A;  3I2F A;  5DDJ 3;  1RGS A;  2VZR A;  1Q8O A;  5E1R A;  3RDI A;  1OC1 A;  1W9Y A;  3T30 A;  1ND3 B;  3KLS A;  4CP2 A;  4JKL A;  3ZXK A;  4DY5 A;  2VMG A;  2X09 A;  2YDE A;  4OZO A;  1AL0 G;  2ZXQ A;  1JZ7 A;  4XBQ A;  1GSL A;  4D94 A;  1VRH 1;  5LWB A;  2B46 X;  4YW3 A;  1ZRF A;  5FK8 A;  3VBO C;  2XLA A;  3GF6 A;  1XE0 A;  3JD7 1;  1VBE 2;  1UZW A;  5FBJ A;  2RM2 1;  3ZMO A;  1WMF A;  1O6U A;  2WNO A;  3WDV A;  4BZ4 A;  4LT5 A;  1C28 A;  1F5J A;  1HB1 A;  4F3J A;  1CAU B;  5FPA A;  1LB2 A;  4UW5 A;  3MGU A;  4IND A;  3K4D A;  4NRO A;  2GN7 A;  2VQU A;  4FOW A;  4X8N A;  3APB A;  3C7G A;  4K7J A;  1QJU 2;  1W0P A;  2BWA A;  1LOE A;  2FMD A;  5FYY A;  5H9P A;  1CWP A;  1ND2 B;  2OZJ A;  4K8F A;  2W08 A;  2GP3 A;  4MVT A;  3SCH A;  1S0F A;  4BB3 A;  1R1Z A;  3N9P A;  3TN9 3;  3AYD A;  1JW6 A;  5DZE A;  4FBF A;  5FP4 A;  5FJK A;  2OA2 A;  1HQL A;  2P4E A;  1VAM A;  3POB A;  4W6Y A;  2ZX4 A;  4LE4 A;  5C3O A;  3GCX A;  4FAG A;  4MLO A;  4BK4 A;  4UFM A;  5DMY A;  1YJK A;  1K42 A;  4ZZ5 A;  1XOY A;  2A3X A;  4QX1 A;  3WHU A;  1JN2 P;  4PBO A;  4HK9 A;  4XAC A;  2P3Y A;  1MS5 A;  4XIK A;  4FAH A;  5HI0 A;  1NKG A;  2B8M A;  1IS4 A;  5L73 A;  1ZYB A;  1COV 2;  2ZHN A;  5KBF A;  3P6B A;  4HMZ A;  2AC1 A;  3LDK A;  5DUU A;  2IXK A;  3MHZ A;  3N9L A;  5KHH A;  5J3U A;  2D6N A;  5JDB A;  3KV5 A;  3IIA A;  3R4D B;  1ZBE 2;  1OOP B;  1QHD A;  4AVT A;  4BH9 A;  2XJR A;  3FLP A;  2A5Z A;  1OD3 A;  2MPF A;  3J8F 2;  1N1Y A;  2J1A A;  4QDR A;  4OUL A;  1LOD A;  2RS5 2;  4AOC A;  2FDK A;  4UWD A;  2J1E A;  1NCQ A;  3HVD A;  1AJK A;  4TLG A;  2RS3 1;  1QOS A;  1UOG A;  1SG3 A;  2VJX A;  3MO4 A;  3ENR A;  4DIN B;  3VUO A;  3WY6 A;  4LOS A;  1XNC A;  3LKJ A;  5FUI A;  2P3K A;  1H4G A;  4QQ2 A;  2QQL A;  2G9Z A;  3O0V A;  4YPJ A;  4EJR A;  3KZ4 C;  1US2 A;  3Q8B A;  3I54 A;  3LDB A;  3SCG A;  5DG2 A;  4Q4X 2;  4CXW A;  5FYH A;  2CWS A;  3Q8C A;  1C1F A;  5DAQ A;  2VZO A;  4N53 A;  4ZU4 A;  2PHF A;  2D40 A;  2QQK A;  4FTS A;  1MVQ A;  1QDO A;  3NV3 A;  4Y1V A;  1VP6 A;  5BUV A;  4QX5 A;  2VW0 A;  4M00 A;  4OVE A;  1PGL 1;  5FLH A;  5T52 A;  1AL2 3;  3AFK A;  4P9J A;  3MW4 A;  4YM1 A;  4IL7 A;  2ZGR A;  5A3T A;  1GAN A;  2WJS A;  3A4U A;  4O7X A;  4PJY A;  2XON A;  1R08 1;  1J83 A;  1NCR A;  1EV1 1;  1QQP 1;  4ISQ A;  1POV 0;  1LJ7 A;  1F31 A;  1D4M 3;  4GMP 0;  2ET7 A;  3LPF A;  1UYX A;  2VQ0 A;  3GHM A;  2W92 A;  1GUI A;  1NLR A;  1YFY A;  2G19 A;  1D0G A;  3VZO A;  1N47 A;  5JZG C;  3T2P A;  2W87 A;  4L2N A;  1DIW A;  1RUE 2;  3PJQ A;  1RUC 3;  5LAS A;  3ZXE A;  5CZK A;  3ZPO A;  4Y1Z A;  5FYC A;  2V72 A;  5A7S A;  5IHR A;  5FQ0 A;  3HNY M;  1GV9 A;  4XOG A;  2BPA 2;  1ODM A;  3GZU C;  4H7M A;  5KXE A;  1W6M A;  2UY9 A;  3H1M A;  1GNZ A;  3OUJ A;  5A33 A;  1OA3 A;  4HT1 T;  2WZR 1;  4MO3 M;  1CZT A;  4BLI A;  4CDX C;  5JMO A;  1W9S A;  2QQU A;  1ZBA 1;  3J4U H;  5A7P A;  2R04 3;  2YG0 A;  5LEJ A;  1DQ0 A;  5CG9 A;  4XDP A;  1K3I A;  1YIP A;  2R06 1;  1SZB A;  1QOT A;  2HWF 1;  3BTA A;  4EZ4 A;  1NCQ C;  3RZH A;  2QJV A;  5DG1 A;  2O14 A;  2GZW A;  3AJZ A;  3H50 A;  1QEX A;  4QU1 A;  2XBO 2;  4QXK A;  1U5Y A;  3NJV A;  4QD2 A;  3WG3 A;  3BYW A;  3WDT A;  2YRO A;  5FMB A;  3ZKU A;  1OKQ A;  4AED B;  2VZV A;  3CNA A;  3CU7 A;  3W58 A;  4AI8 A;  3MLK A;  2DBI A;  4CRQ A;  4FXG B;  4GJZ A;  4BQY A;  3WT3 A;  5CFC B;  2NQY A;  1RED A;  3H8X A;  4HSL A;  3ZSE A;  2YC2 A;  1G9A A;  1NA1 C;  1GZ9 A;  1XXN A;  2YYO A;  4GB3 2;  4N53 C;  3O1U A;  1M06 G;  1LU1 A;  4W8J A;  4AGV A;  1W9F A;  4YGD A;  2WO2 A;  4K3U A;  4A7Z A;  4L97 A;  4AYU A;  2CDO A;  1WCS A;  4IE4 A;  2JX9 A;  2VCB A;  2WFF 3;  2R30 A;  3SXW A;  4J1X A;  1J84 A;  1QJE A;  1S0E A;  3HT2 A;  4CP9 A;  4D8M A;  3M4F A;  3UES A;  4QDS A;  1YQ5 A;  3KV4 A;  4LKD A;  4W4Z A;  2HH9 A;  2VUJ A;  1R09 1;  3O5S A;  3ORJ A;  2BNO A;  2O8O A;  3PTY A;  1IPK A;  1GZT A;  3L2H A;  3UKN A;  5IUQ A;  4EV0 A;  4LTA A;  5FOB B;  3FJS A;  4LIV A;  1JZ6 A;  1V6N A;  1NCR C;  1I5Z A;  5FY8 A;  3ZFG B;  2XQX A;  2YXS A;  4MGZ E;  3BPS A;  4YVS A;  3OD4 A;  1VR3 A;  5BNP B;  3QD6 A;  5FPV A;  5DUW A;  5IVC A;  3O1V A;  1VLN A;  1VMH A;  2CDP A;  3ZFF A;  2JG8 B;  4CEY A;  4HG6 B;  4AFA A;  4AVB A;  1OBN A;  2B9V A;  3WHT A;  2B9U A;  1ODN A;  4JDO A;  2RJL A;  5H9S A;  4CDQ B;  2XKO A;  1W6N A;  4MAD A;  5CIS A;  1TMF 1;  5T50 A;  1X8E A;  3L2Y A;  4JQT A;  4K6B A;  5M0T A;  2VQA A;  1WA4 A;  2Z79 A;  2AR6 A;  3I2D A;  5SV5 A;  3OF1 A;  1HW5 A;  4BA6 A;  5JWP A;  2EF6 A;  3U4X A;  1SQ4 A;  2KA3 A;  3I2J A;  1WCD J;  3KT7 A;  4PQQ A;  4DXS A;  3D5O A;  1AX2 A;  5EWS A;  2WNV A;  3V0A A;  4NWV A;  1Y43 B;  3OD0 A;  4NII A;  3KCX A;  1HRV 2;  1OXC A;  1RMU 2;  1AYN 2;  2J22 A;  2PN5 A;  4B8E A;  5KXC A;  2XJQ A;  2QQP A;  5C33 A;  2YFU A;  3RG0 A;  2D7F A;  4YG3 A;  1LEM A;  1LKN A;  3PTR B;  3NNF A;  2IFR A;  4BXS V;  3MIE A;  1DGW A;  2JB8 A;  3MI8 A;  3NWK A;  1CZV A;  1W6P B;  2P1B A;  4DB5 A;  4CUB A;  4J25 A;  5A1F A;  4CCE A;  3OB8 A;  1XNA A;  3AKQ A;  4P5Y A;  3I3M A;  4ZS2 A;  1S2K A;  3J7N A;  4BME A;  3A0K A;  4I0A A;  2XJP A;  5JIU A;  2WRA A;  1W8H A;  5FPU A;  2YPJ A;  5IW0 A;  4AAP A;  4TXW A;  1V6L A;  4ASK A;  1UCX A;  1Q56 A;  5ABJ B;  4A4A A;  2BFU S;  3AVR A;  2DCZ A;  4CDU A;  1BJQ A;  1NT0 A;  2ET1 A;  5AC9 1;  2WLP A;  1RUH 3;  4XXA A;  2E7A A;  1CX4 A;  2VR4 A;  5E8A A;  5K8S A;  2P5B A;  5LAT A;  1UO9 A;  1UY3 A;  3DV8 A;  4JRL A;  1EAH 2;  4YVS C;  2DCT A;  1JYT A; 
#chains in the Genus database with same CATH homology
 1GWK A;  2LRP A;  3ORJ A;  1V0A A;  1UOJ A;  3F95 A;  2KR2 A;  4LJH A;  4YW7 A;  4YWA A;  2VXJ A;  4BQ2 A;  4BQ3 A;  1OH3 A;  4LKD A;  4LKF A;  4BQ4 A;  1WZX A;  4CP9 B;  2K46 A;  1W8Z A;  1GWL A;  4LKE A;  3ZYF A;  1WCU A;  1GWM A;  3ZYH A;  1OKO A;  2C24 A;  4AL9 A;  5D21 A;  4A6S A;  4YW6 A;  1W9F A;  4BQ5 A;  1W8T A;  2WYF A;  4LK6 A;  3UT0 A;  1W90 A;  4CPB A;  1HN0 A;  1W8U A;  1L7L A;  3ZYB A;  4LK7 A;  2O14 A;  1WMX A;  1W8W A;  4CP9 A;  4CPB D;  2JWP A;  2Q1F A;  2LRO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...