1OH3A

E78r mutant of a carbohydrate binding module family 29
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
141
structure length
141
Chain Sequence
RATYTVIFKNASGLPNGYDNWGWGCTLSYYGGAMIINPQEGKYGAVSLKRNSGSFRGGSLRFDMKNEGKVKILVRNSEADEKFEVETISPSDEYVTYILDVDFDLPFDRIDFQDAPGNGDRIWIKNLVHSTGSADDFVDPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NON-CATALYTIC PROTEIN 1
publication title Ligand-Mediated Dimerization of a Carbohydrate -Binding Module Reveals a Novel Mechanism for Protein-Carbohydrate Recognition
pubmed doi rcsb
source organism Piromyces equi
molecule tags Carbohydrate binding domain
total genus 32
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-05-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 1oh3A00
2C24A 1WMXA 4BQ2A 2JWPA 4LK7A 3ZYHA 1OH3A 3ORJA 5D21A 3UT0A 1W8ZA 1W9FA 4YWAA 2O14A 2Q1FA 1W8TA 1W8WA 4LKDA 4YW6A 4BQ3A 4LKFA 4AL9A 4CPBD 4A6SA 1GWKA 4LJHA 2KR2A 2VXJA 4CP9A 4CP9B 3ZYFA 4CPBA 2LRPA 1W90A 1L7LA 1HN0A 3ZYBA 1OKOA 1V0AA 1GWMA 2WYFA 1WCUA 3F95A 4LK6A 4BQ5A 2LROA 1UOJA 4BQ4A 1WZXA 1W8UA 1GWLA 4LKEA 4YW7A 2K46A
chains in the Genus database with same CATH superfamily
4W50A 1VBD1 1WWYA 4HVOA 5FPZA 2XVLA 3HNYM 2BW8A 3ACIA 2E32A 3UT0A 3NV4A 2JG9B 4OI2A 4OZOA 5H9RA 4GD4A 1D2SA 2HWC2 2JE9A 3USSA 1BK0A 4AVBA 3EJKA 2Y8KA 3JQXA 3D0SA 3H0OA 1GANA 1YHFA 2R041 5FO8B 1MEC2 1OMIA 2D98A 3AM2A 3AVSA 3LOIA 4JRAA 4PQ9A 1B09A 5FMBA 4D7SA 5FKBA 1S0JA 1LEDA 3PVBB 2FDIA 1J83A 2W95A 1F2NA 3IAQA 1O3RA 5K9YA 2P37A 2R6QA 1SACA 2RVAA 3C2UA 4IE4A 1W9TA 4FO9A 3VBHB 3S0MA 5JMCA 1NCRB 1O8SA 1QQP1 3BCWA 1OXCA 4LKSA 1Q5OA 3KF5A 1CESA 1RYYA 2IWGB 4P9IA 2A70A 2ZX1A 2BOIA 2XL9A 1DG6A 5FO7B 2BP6A 3AMQA 2VMIA 4Y1UA 4BU2A 2CV6A 4IGPA 1YXWA 3VLBB 4LE3A 2D44A 3KWVA 5L19A 1J59A 1D4M1 2GH8A 4QDRA 5FWEA 1UXXX 2QQKA 1A78A 3ENRA 5D8AA 3WP6A 2AGSA 1NT0A 2G9FA 2NM1A 5KR7A 5FMOL 4ARXA 5F5IA 2MPFA 2VOKA 1C8M3 4HBNA 4FT8A 4QPIC 4RHV3 5AVAA 3H3UA 2DBIA 1US3A 4AWDA 1REDA 1S4CA 1YO8A 1LHVA 1JYVA 2IXCA 3SITA 5FQ0A 3O12A 4PT6A 4MO3M 5A7QA 3ZXEA 2VR4A 1RUG3 5J36A 3JBG2 3U4XA 3VL8A 1S0CA 4COYA 4RGGA 4Q4Y1 4CP9A 4AYUA 1DGRA 3ZFEC 4IV3A 4S2DA 4I02A 2ZGQA 1CR7A 3PURA 1QEXA 3OGRA 3E6BA 2D93A 2G1MA 5DXDA 4RYDA 3AB0A 1RUNA 3I2GA 3GBWA 3S7IA 2AREA 3FUOA 3EMRA 4IQPA 1SDDB 2VMCA 2Q8OA 4QDSA 2D5HA 4IE5A 5T50A 3FUQA 5DDJ2 4D69A 5IATA 4LUMA 1W6MA 1VB4A 1ZYBA 1DZQA 1VBD3 2ZEYA 1AVBA 3HPNA 4Y24A 1FYUA 5GZFA 3MLKA 1RUJ2 1QOTA 5HXVA 2W87A 4IW3A 2DFBA 2VUJA 2XJTA 2OZJA 2RJLA 3HBZA 5FP4A 3J8F1 3IMMA 3K77A 3W5MA 2R16A 4CYDA 5H9QA 2LS6A 2OQ6A 2G4IA 4XE9A 3FL7A 1GOFA 1AYM2 2JDNA 4ZONA 3N3HA 1X8EA 1PO13 4LBOA 5FYZA 2P1BA 1CJPA 1J3QA 1J84A 3AZVA 3ON7A 5LY2A 3ALQA 3ZLIA 5FZLA 4NHLA 5CFDA 4OHWA 4CXYA 3VV1A 3I59A 5IAVA 3FLPA 3VL9A 2Z69A 4P9JA 1PK6B 4CDUC 2EIGA 3ZYIB 1OSGA 2XBO2 4BQ1A 1IGOA 2DWRA 5FIXA 1VBB3 2WO1A 5JIAA 3V56A 3WG3A 4D3WA 2UYBA 4Y5TA 1EP0A 2LUWA 2FD8A 2Z4FA 1POV1 5FKCA 5L36A 1MVQA 1XC6A 3SEPA 2PELA 3ZM8A 1OT5A 4Y1ZA 5DAVA 2I2SA 3ATGA 1C57A 1H8TA 2GP5A 4N53C 2HJIA 2EF6A 5DG1A 4XC9A 4TLFA 5CKNA 2WO2A 2A6VA 1V6IA 4YG0A 3P6BA 5IK4A 3L9JT 2W94A 4A3ZA 2XVKA 2XG3A 1R1A3 5LBEA 3ACLA 4LKEA 4XHBA 3B69A 3OD4A 4RGKA 2W46A 3ILRA 4Q1RA 3RZHA 5E8AA 2YC2A 1HB2A 1QXJA 5FLHA 1JI6A 2OUJA 1EUUA 4GXLA 2QVSB 2RS12 4KI5M 4PQQA 4M00A 4UWDA 5FCCA 5FY0A 3ZN6B 3LPGA 4CDQB 4ZZ5A 5HPOA 4HOOA 1W6NA 3IB3A 3DECA 4UBHA 4BM8A 1GWKA 2LW8A 2ZKNA 4N43A 4PDWA 3MIGA 1IQDC 4IV3C 3IKWA 4NVPA 1WMEA 3MICA 4XQDA 5FZ7A 5J7MA 2WWJA 5FZ3A 3WEZA 3U14A 4XVHA 2WKKA 3LE0A 2Y6JA 4BLJA 4DUXA 4DQAA 5GLTA 2EIDA 4JKLA 2VQUA 1E5SA 4QGLA 3C7EA 4DMIA 2AEYA 4B8EA 2JDPA 1VIWB 3RFRA 4K21A 3T2TA 4BA6A 1G9DA 3POJA 2B8MA 2H6CA 2Z2SB 2BEOA 1DU3D 2BU9A 3HT1A 1SZBA 4I0WB 2BFUS 4XXAA 5F3GA 3WSOA 4XHXA 2JENA 3CJXA 3O1PA 2XHKA 2H6BA 2V4AA 3WNXA 2WFF2 3U0ZA 3HQUA 3GBGA 4AL9A 2WSUA 4LBQD 5EWSA 3RG0A 1OOPA 2GMMA 1LAJA 1RVF2 2BUKA 2QDRA 2DDUA 2LRPA 3M3CA 2CDOA 1H4GA 2WJSA 1JUHA 3DEMA 4L0PA 3ZMOA 1KS5A 4ZY9A 4XMIA 2JDKA 2WQZC 4URTA 3KD4A 1MZEA 2ET7A 4XXPA 3BTXA 1JZ8A 3H8XA 2JE8A 4UI9L 4HMZA 1UZVA 2W3JA 3QH7A 1NY72 1YFXA 2QTWB 3V64A 3RZMA 2Y0IA 5JCTA 4I0BA 5JI7A 1JYTA 1U12A 5FOJB 4F8AA 2L9LA 4YYOA 1MS8A 2RDRA 2WN2A 2Y64A 1UPIA 1SPPB 4PBOA 4FTEA 3LPFA 2GNTA 4AHZA 4NIDA 3GCWA 3AFGA 3VHOA 3ZSEA 3ZYFA 1NXD1 2PLV3 3WP5A 1JZ7A 2D6NA 2VM9A 1GUIA 1H8TC 1KFXL 3ME2A 4HN0A 2D97A 2RS33 2DV9A 1IPKA 1BMV1 4Y4RA 3LKJA 5HV0A 3WQ0A 2O8QA 2Q30A 2WZR1 1VB2A 1YQ8A 3ILFA 4FPOB 4Q4W2 2W92A 4IEUA 5KXEA 1X9TA 3TNPB 1QKQA 1QJY1 1QNYA 1NLQA 2NMNA 4QX0A 3LOBA 3JD72 2RJKA 3ZN5A 3VD7A 1YUDA 1GQPA 2G19A 2JWPA 2NLRA 4JCKA 1B35A 3APBA 2DBNA 3KT7A 1UY0A 4NIAA 1N3PA 1QDCA 5CNAA 1UY2A 5F3EA 4R9DA 4N43C 1Z78A 3IN9A 3PVOA 3H8OA 1XE8A 4BISA 4CDWC 3B02A 3O1UA 4H7LA 5FZKA 4CUCA 4YM1A 4NAOA 1RUC3 2HWB1 4B3NA 1FV3A 4JGYB 4JQRA 4LIVA 3ZN4A 4IDZA 1AR92 2AACA 5T55A 4JGZB 1RHI2 5JXHA 5FXZA 4NIHA 1NOVA 4AVTA 5GKAC 5DZGA 2X5IB 3OPWA 1NLSA 1ASJ2 3FFQA 1US2A 2VC9A 5CIRA 3LQCA 4HK8A 2OZ6A 3USUB 4HSJA 1LOGA 1R091 3C8XA 2A71A 3RPQA 3E97A 4X6RB 4NRQA 3HNBM 1XNAA 2QZ3A 2YC4A 2QQMA 2R073 4QGNA 1D0GA 4AVAA 1D7PM 4OHVA 5JZGB 3AKRA 5CKQA 2QQPA 4QX5A 3WY6A 1XU2A 4YM2A 4AEMA 1WW7A 1MQTB 2F17A 4MG2A 1EUTA 4XPVA 2HEYF 3SEEA 2VG9A 4MXWA 3BPZA 2WNVA 2K46A 1ODNA 1W0NA 5LA1A 1J3PA 1PHMA 5FO9B 2DCTA 4DXZA 1SEFA 1W6OA 3FBYA 1I3HA 1I9RA 1Y4WA 3CLPA 5AC92 4LJHA 2Y6FA 2C4XA 4CRQA 5F9TA 1WCQA 2CHHA 1CIYA 5BNQA 5F37A 4Q1PA 3I4IA 4AOCA 4ZHNA 3G6JB 2VZVA 3BVCA 1X82A 2BYVE 2R061 3J26N 4CCDA 5FJKA 5FMOS 3EQEA 3KVBA 3PLQA 1JOJA 3K2OA 3M7AA 3O0WA 1WCDJ 3RYRA 1ZVFA 3S7EA 2WLQA 2AH2A 4KGGA 2LTNA 3D3AA 2B4KA 1O5LA 2ZEZA 2XDVA 3LEIA 5FR3A 4Q27A 3LCPA 1V9U3 3ZR6A 3ZYGA 1LHNA 1C8M2 2HWD1 2QQVA 1WGPA 4XTPA 1ZZ9A 5FBJA 4RHV2 4ATFA 3S30A 1JYWA 2F4PA 3AMNA 1VBA1 4LBQA 1L7LA 2GDFA 3LFIA 3TBDA 5JOXA 3JBG1 1XU1A 1ZZCA 4DB5A 1ZREA 4GULA 1VMHA 1ST8A 2BBAA 2WO7A 4J25A 1RUG2 1QOOA 2WL1A 2E33A 5JXJA 2RR11 2P17A 2W68A 2VUCA 4RSUA 3WW2A 2ZGRA 3MGUA 1A8MA 3OBTA 4XIKA 2YV8A 2VTXA 3MF9A 3PUHA 5HCBA 1JZ2A 1Q8OA 4XDQA 2HKXA 4XMAA 4QKDA 2PHTA 4XJZA 5LATA 3W59A 3VD9A 1U5XA 2P3IA 1KEXA 1UYPA 3B5LB 4NR1A 1ENXA 3MV01 5LRSA 1KD7A 3AKQA 4XJAA 2B39A 2UU8A 1FPN3 5I0SA 1UX6A 5IHRA 2RG4A 5ACA2 2AZ5A 2ZGMA 2J1SA 3X29B 1ZBE1 2WS91 4O9EA 3NV1A 4RR3B 4BE3A 1H2LA 3GJBA 1AJOA 1V6OA 1SFYA 2JDYA 3I2JA 4P14A 4RQPA 5EPAA 2BWCA 2WNVC 1XNTA 2BNNA 4YVWA 1KJLA 5J1XA 4V2VA 4FPEA 1PO12 4UOJA 5FPBA 1DF0A 4HETA 4JHZA 5J09A 1OURA 2XJPA 4OI1A 4EN7B 1X8MA 5LY1A 1FMD1 2DVFA 1K5JA 1EAH1 3EYPA 3SLIA 1CPNA 4Y20A 1EV11 1NE6A 2B7YA 1PZ7A 2WWSA 1KJRA 1HRI3 5SV5A 5AFBA 2RJ2A 5KC5A 1AR83 1UZYA 1VBB2 2V5DA 3WOGA 2NPIA 2JDAA 1W2TA 3G7DA 3ZSKA 3JQWA 4FOVA 5EYYA 5A80A 1QJU3 3ETPA 5KXDA 3ACHA 1UKRA 1SBFA 3WDYA 1JS9A 1W05A 4Q4X1 4YW7A 2SLIA 3WZ1A 1UWWA 1JZ6A 2JIJA 1AL23 2VUDA 1QIQA 4NPLA 4X8NA 5JAXA 4DY5A 3O14A 5C8WA 5I8SA 3I2FA 1UZ0A 4JKKA 2D6MA 1FAYA 5L7OB 1JYIA 3WF3A 2VTFA 2XJVA 3H50A 3LDRA 4O65A 4LPLA 1X9PA 1SDWA 3IPVB 3IIIA 3J7LA 3I2IA 1R1A2 1Y9GA 2BDRA 5E88A 5FZ1A 2VCMA 4IEQA 3NJVA 5D8AB 1NQDA 3GGLA 3V0AB 3FZ3A 3H1YA 2LALA 4NPRA 5KXBA 4SBVA 3MPBA 4P00B 3ZXDA 4QX1A 1GYKA 5JPMB 4LK6A 1OPOA 1YLLA 3OBZA 4QU2A 3NNMA 1ENSA 1L3JA 3U78A 5CFCB 2I07B 5FZEA 4A4AA 4YZ5A 3O5SA 4YW4A 3OYWB 4QHZA 2J1UA 5T54A 1OH4A 3MFAA 5JMOA 4QQ2A 5GLWA 2DCYA 4CCEA 2GSYA 5BUVA 2VNGA 3MW4A 3BUCA 2EXJA 1W8TA 4OQ9A 4JC1A 5A3UA 2Q5TA 1OD5A 3NAPB 4EE2A 1PMIA 1WBLA 5LBCA 3AX4A 1DGLA 3KCXA 5A32B 1QF3A 3D0JA 4LE4A 4KL1A 2EAKA 2OVUA 3GZEA 2XJQA 3SQOA 1JW6A 4TZDA 4OI0A 1ZA4A 2FBEA 1Z7S1 2BNOA 5A3LA 1OC1A 4B29A 1R083 1CN1A 4Z82A 3A22A 4ZPIA 3I49A 3LEKA 5A1FA 1K5MB 2AEZA 3BODA 3RI8A 3ZPYA 1LOFC 1PIV1 5CZKA 2A6ZA 1VBE3 2QCSB 3BPSA 1W6MB 4DZGA 1RUD3 2ZS6B 2VL4A 1LULA 1TNRA 1PM4A 2DVGA 2PTMA 1QJEA 3KF3A 1WW6A 2JB8A 4K1ZA 2YBKA 2W1UA 4XFGA 2J1VA 2W5FA 5LBBA 4LOSA 1GP4A 3WINE 1HRV1 1Y43B 2DF7A 3HVDA 3OJBA 4FPFA 1GQGA 2K2SA 3JB4C 5JXGA 1HLCA 1OKOA 4GH4C 2IFWA 3FHQA 1LNSA 2NMOA 4XFFA 5CFDB 3AP6A 1DQ6A 1HIXA 1OQEA 1WUVA 3URFA 4EROA 2N7GA 2MHFA 3S5AA 1H8VA 5ERLA 1GV9A 4CEYA 1NLRA 4WVMA 2JG8A 2PLV2 3MIFA 1G9FA 3VBRB 4Q4W1 2DCZA 3H7JA 2RS32 3DF0A 2XHNA 5LWBA 2GNDA 2DU0A 3NMBA 2RMU3 3CEWA 1AXZA 4C1XA 3LSDA 4FPLA 3A23A 2R7EB 2GMEA 2W9XA 2C0ZA 2D3RA 5KHGA 1LGCA 4HKWA 4YRDA 3CJIA 3MEPA 3CNAA 1JZ5A 2RS53 4KQ7A 2CAUA 1NA1A 5CG9A 3OB8A 1OD3A 1VRBA 2JB4A 1D4VB 2XGXA 3Q9OA 3CIHA 2ZACA 4KWKA 3NSTA 4AFMA 4N7IA 4BQ5A 2MEV1 4RFT0 3T0AA 3LD8A 4YGDA 1O3TA 4BH9A 2YZ4A 2YBPA 4WVVA 4EYUA 1CAWB 3GBFA 4MSVA 5LBFA 3CDZB 1BQPA 5F5CA 3L2HA 4B4RA 4E8CA 2RM21 4NO4A 1RUC2 3LGRA 5FY9A 1HX6A 4GIQA 4ZU5A 1A6CA 2OA2A 2Y33A 3CQOA 4NROA 1W3XA 1XSQA 3N9QA 4W6WA 4LO7A 3ZFFB 1UMZA 1RUI1 3AYCA 4PDWB 2JKXA 4FFGA 1AR62 2ERFA 3FN9A 3CHXA 3VKMA 5FZFA 4LUKA 4BXSV 4FQ4A 1FI2A 1H2NA 4MH0E 1V00A 4OULA 5FXXA 3ZR5A 3PIJA 4IETA 1FATA 2BJSA 1ACCA 1ULDA 3BOWA 3VHPA 1BEV2 4XOGA 1DQ0A 3VKFC 2ZMLA 1LOAA 4QPGB 1NAEA 2K9ZA 3HQXA 4CUGA 3LZZA 2W1SA 2R072 1ZRFA 4DXSA 2VZQA 5C8CC 5DZEA 2J7MA 4B7KA 5C33A 5D21A 2GZWA 3VBSA 4OVEA 2WNUB 3KB5A 1H1MA 4KBBA 2XOMA 4JDNA 3LSEA 1LCLA 1OOPB 1TEIA 2IXLA 4GB31 3POYA 4I09A 1SQ4A 2D3SA 1OLMA 4PIZA 4TWTA 2RDSA 1MS0A 3BTZA 2OPWA 1PO23 3RMXA 4D8MA 1RUOA 1F4AA 2VBPA 2XONA 2E51A 4CSWA 1SHWB 1APNA 4AF9A 5IFTA 2QFEA 4FPYA 4CEYC 1VALA 5IVJA 5FYMA 2WQ8A 2WFPA 4JKMA 2YC0A 4G4FA 4QM8A 5JR2A 5JOYA 3BB6A 1H2KA 3TN93 2BPA2 4AI2A 1OF3A 5FXVA 5FYIA 2IXKA 2JIGA 3LDBA 4YLZA 5FAXA 1SCRA 1BYHA 2B9VA 4L2NA 2HEVF 1YI7A 3W20A 1LKNA 3FHAA 3R6SA 5A3TA 2WN3A 4E27A 2D40A 2ZHNA 3GZAA 5FUPA 3ZFEA 4BJ0A 3D6EA 2ZGLA 1N1YA 2JICA 1JOBA 1H6XA 1DBNA 5GALA 4LULA 4FAGA 4H3WA 1CAVA 1ZA7A 4AI3A 1UY4A 1FOD1 1V9U2 1AYN3 2VW0A 3RYKA 2V5YA 4YW5A 3BN6A 4YZ4A 2ZGPA 5C4WA 3CL1A 4K40A 1NX9A 2JEMA 4URAA 2UWCA 2ARXA 1B35B 1HXS1 4MVTA 1RUF3 4XAEA 4FXGB 5AFEA 2EA7A 2W0XA 4UFJA 3BIEA 4AFBA 4OI4A 1ENQA 1K12A 1UYZA 3MPPG 5FZ4A 5C7GA 2WYSA 3OEAA 1CQ9A 5ABJB 1QWRA 4QPYA 3WR0A 5H9SA 1MVEA 4OYUA 4XETA 1AXKA 4WM7B 4ZKTB 1YFUA 1JU4A 2IUWA 3WNNA 5E1RA 2H0BA 4AEDB 1QJX1 1YFYA 2Y38A 3I2HA 3KGLA 1RMU1 1H6YA 3OBRA 3WQBA 3BALA 3ZKUA 1ULOA 2GNMA 3ETQA 5C9AA 3AJZA 4KU8A 5IK5A 5EFUA 4YFWA 2ID4A 3WLUA 5ACA1 3AZZA 3AP4A 5KWRA 1KITA 3N9PA 1W9WA 3AC0A 4ZZ8A 1FPN2 3ZXJA 5HXMA 1G9CA 2A7AA 3RQ0A 5BY5A 4CDUA 1PGW2 4CCNA 5DMYA 3VBSC 1HQWA 4W6XA 1TMF3 3M3OA 3VDDA 3RYPA 4A7KA 2X09A 2ZX2A 1DCSA 5FY7A 2WT0A 2FQPA 3FHIB 1DP0A 1VRH3 3RGBA 1U5YA 2WIIB 1F5FA 4OZXA 4N53A 1CGPA 2VO5A 3I2OA 1ODMA 2VECA 1NXMA 1XNKA 1UNBA 3LA2A 4MXWB 5KHIA 1QNWA 2XMLA 1IS3A 3HQRA 2EICA 2BWAA 3DV8A 4PI2A 1HRI2 1E5RA 4CCMA 1W0OA 1AR82 3WCRA 4C1WA 5BNOC 5BNPB 1ZZ6A 5BNNB 5LK7B 2FMYA 3V0BB 2CWSA 1DQ1A 1QJU2 4MOAA 4PLMA 5B4XA 1W9YA 1VBC1 3JU9A 4OMDA 4CCCA 4CTEA 3ELNA 4YZ1A 4ONUA 4D6QA 3H3LA 3NQHA 1O4ZA 1AR71 5E16A 3AMHA 1AL22 2RHPA 4BLIA 3ZVXA 4XUNA 4E4DX 3VKOA 1J1LA 1JHJA 1SBDA 4Y1XA 1GNHA 1O3SA 4LHKA 5SV8A 4HT1T 3AKSA 3DKQA 1BVVA 1IOAA 4UFHA 2BGCA 1QXPA 3N35A 1Z0HA 1SFNA 1HB3A 1MPXA 2BRTA 2P3YA 5C4WC 5I8TA 1I1EA 2DVDA 3AVRA 2QUOA 2ORXA 1XNDA 2P4EA 5JOWA 3QD6A 1PX3A 4LHNA 4W6YA 4JDOA 5A33A 3FMGA 4BYYA 3U11A 4OUMA 3VBFB 1KQRA 3L2YA 2ZAAA 5GLZA 4ISRA 5FOBB 2PQQA 3OF1A 4PHZA 1PGL1 3T1MA 1DHKB 5F3IA 1C1LA 3BU7A 2Q8DA 2R043 1DQ2A 1CAUA 2HLEA 5C9AC 4HPKB 5C70A 3ZFGA 4B7EA 2DCKA 3I7DA 1TQ5A 3KLSA 1UU4A 4HSLA 4N9IA 3GCXA 4D7TA 5HI0A 5FYUA 3GNEA 1GZCA 1UX7A 4DRVA 2B45X 3PJQA 3ZX7A 5C3QA 1QQP3 2ZJCA 3VDDC 4E4SA 4BIFA 1R082 3HR9A 5J37A 3AYEA 1XYOA 2ZMNA 3RI9A 2HWE1 5DAQA 2VOVA 3MW3A 4CEWA 5EIYB 1PVC1 1VBE2 3T30A 3LEGA 2W91A 3N9LA 4LR4A 5L73A 2ZABA 1RUD2 2HWF1 5F6LB 2VVFA 4Q0VA 1D4M3 2XL7A 4A42A 4XUTA 1TNFA 2FZ1A 2ET1A 4RQPB 4PLNA 5A7WA 1OLME 1LU1A 4YVWB 2B46X 5EV7A 3K3OA 2YGMA 4FCAA 1GNYA 3AYDA 4QPWA 2PHWA 3WF0A 5T5LA 4MHRA 5FREA 1LGNA 3OGJA 1RXFA 1VR3A 3A7QA 4YPJA 5KC6A 1O6UA 5FYTA 4IERA 1YIPA 1M4WA 2JD9A 3MFCA 1O59A 2ZX3A 5FZOA 1Q8QA 3I2KA 4MLOA 3RDIA 2TBVA 4WBBA 4NMIA 2IC1A 2I74A 3BTAA 4Q4Y3 4CDWA 1W39A 2VUAA 2RMU2 1ND3B 4ES9A 3E6DA 1UAIA 3OGVA 4UYBA 4DUVA 4ZXEA 1GNZA 3OBAA 2BGOA 1RUE1 4IEZA 3NV2A 2VZUA 2RS52 2QZ2A 4Y33A 4P9GA 4TN7A 4YGBA 4W65A 1COV1 4OQ8A 3DYPA 2VPVA 2DFCA 2FZ2A 4Y5Z0 4CDXB 1O7FA 1OA3A 3J8F3 2XVGA 1OHFA 1TME2 4Y5SA 1U5IA 1LOCA 1W04A 2O0OA 3ILNA 1EY2A 1DYOA 4QT6A 4CXWA 5T5JA 1YFWA 3VZMA 1REFA 2YGLA 4M4RA 2VOTA 2WRAA 1AR61 4AHYA 3ZFGC 4LXLA 4IEPA 2JD4A 5LA9A 1WLCA 3ES1A 5DUUA 4CUAA 1TG7A 5A3NA 1QDOA 3DCQA 1BEV1 5J98B 4MGQA 1L7RA 2JECA 1RUH1 2PFWA 1UKGA 1WD3A 3N36A 1ZBA1 3R4SA 4UFLA 2ZX0A 4OUSA 3KCYA 4IV1B 4ISQA 4RS5C 3GM8A 4M3CF 4UBGA 3O0VA 3RZZA 1C8NA 3M2MA 4LKDA 3ZXFA 3AXDA 4CPBD 4CEWC 4KWJA 2R49A 1POV3 1BBT1 4FVVA 4D7YA 2QQWA 3PUQA 4BOWA 5BXXA 4NHMA 2ZXQA 1UPSA 2DCJA 3GZUC 3NO8A 4M3CA 4XDPA 4XJ8A 3KSCA 4B4QA 4UW3A 2BV4A 5A3WA 2YBSA 4C91A 1UOJA 3PU3A 4FQZA 1W6QB 5FUIA 4MYEA 1FNYA 2SBAA 1NCQB 1ZX5A 5CA6A 3B7MA 1PO22 3VKNA 3RJ2X 5C3SA 3TEWA 4QHBA 1CZVA 1REEA 1A3KA 1W2OA 2OW4A 2ZAHA 4OHYA 1H30A 3FJSA 1W8WA 3ZXLA 1WA6X 4DO0A 1JYNA 3FLTA 4C0HA 4BMEA 5C3OA 5FYVA 2O8OA 1BK1A 3LIHA 4JTOA 1H1IA 4LHSA 4UW6A 4PI0A 2FCVA 1S0DA 3TN92 2FCUA 4Q4V1 2R30A 3ROUA 5G05L 4XF4A 3OGGA 3ECQA 4XURA 2BZDA 3WP3A 5HCHA 3POGA 4YVSC 3BIWE 4PLOA 4Q0QA 5FY8A 5CB7A 3V65A 3VBUA 2P6CA 2P3JA 3PTYA 3B93A 4KBZA 4KH9A 2JG8B 4HXCA 1PNGA 1S2BA 1PX4A 3NJZA 1YJLA 1V6KA 2EXKA 4P9XA 5DAXA 3WX5A 3I2DA 2OT7A 3R4DB 3LDKA 2OQ7A 2VU9A 1XRUA 3P3NA 3PUAA 4AXOA 4CE8A 2RDNA 3T08A 1LODA 1RXGA 2XR4A 3ZSLA 4FP2A 4E4ZA 3WVJA 4R9CA 3VUOA 1AYN2 1CPMA 1YQCA 4Q2FA 4HG6B 4AI9A 3CJIB 2R0HA 2AENA 1VAVA 1ULGA 1NA1B 4XUOA 4E8DA 5M0TA 3B94A 3TWIA 2HWC1 2RV9A 4GA9A 3VBOC 2E63A 2ZZQA 1RUF2 5FK7A 2EALA 3AMMA 3LF7A 4AR2A 2OX0A 4LBKA 1MEC1 1W2UA 5FZCA 4AZZA 3D5OA 4C8DA 5GJ6A 1HV0A 2R0FA 3NW4A 3VBHA 2A1XA 1NCRA 5DAPA 4OHXA 4ZXKA 4IE7A 1CAXB 2TUNA 2YPDA 3W9AA 3KV5A 2ZZJA 1GU3A 1HV1A 2GALA 2VH9A 5A6XA 3U10A 1ZBA3 3HJRA 1AJKA 3S5QA 1SLCA 2D6PA 2DTWA 5I0UA 4RN5A 1N47A 1FT9A 1JOPA 4HVQA 2BBVA 4WM8C 4MGKE 5A3PA 1IS6A 3O1MA 4IXLA 1GZTA 3WG4A 4LMFA 3T4HB 4AHXA 3ZYRA 2VMGA 1PNFA 1DGWA 4S2FA 4LORA 4HANA 5IAXA 4UW4A 1TMF2 2WO3A 4I3PA 3RVHA 4AQTA 1KDMA 2PN5A 2WZR3 3NVCA 1ND2B 1Q8VA 4WVZA 4ZU7A 4X8PA 3SC7X 5I0TA 4UAPA 1VRH2 4DIQA 1QJY3 2EXHA 3B9CA 2A6WA 3FFZA 1GZWB 2Q8CA 4P9LA 4ATEA 4NUBA 2JX9A 5FZMA 1IKPA 2E6VA 3DPRC 2G9ZA 5IVEA 5ISLA 4C90A 2GC1A 3MW2A 1ZNPA 2P3KA 3E5UA 1O8PA 4UFKA 4YNIA 2I45A 3K4AA 1JZ3A 3NJYA 4LBMA 3HNMA 4NJ4A 2A75A 3VBUC 5KXCA 1OKQA 1P8JA 2HWB3 5A7OA 2R1DA 5KHJA 4QPIB 1KDKA 2VOXA 2VZPA 4QQHA 4XW3A 1CD3G 3WW3A 4Z07A 5K0UB 1W8FA 3RSJA 4FOYA 4BQ2A 3N9OA 4FOQA 3ZYHA 1OH3A 2JG9C 3K75B 4WVWA 4Y22B 1AXYA 1DGRN 3PMEA 2PAEA 3ZSJA 1XOYA 5DDJ1 1DGWX 4QKBA 3AJYA 2ZGOA 1R093 1F9KA 1X50A 4WM7C 1XYPA 2PA7A 4LNVA 1RUJ1 3ZFEB 4CPBA 3U75A 2QQJA 4FOWA 2VZ1A 4RFRB 4B1LA 3UKVA 3Q8CA 5C5TA 1CAVB 1SLAA 1VBD2 2E26A 3SH3A 1KRIA 5F8PA 1PZ8A 1E5IA 1UW8A 4HKOA 1QU0A 2QQOA 5EJ3A 1AYM1 2D5FA 2QNKA 2VY0A 5DG2A 5I91A 4EZHA 2GU9A 3VBHC 1LOFA 4ZS3A 1NCRC 4QKFA 1SLIA 1PK6A 4BK4A 3OUHA 4XDOA 4EN8B 2R042 4GWNA 1HQNA 4GMP1 2NN8A 4G9SB 3OY8A 2IXHA 4XZPA 2MNGA 4CCOA 1DZTA 1WMFA 3HMYA 2VMHA 4KGQA 3SH4A 1MZ6A 2XBO1 4MGYE 5JPNB 5JSPA 4L11A 3OOXA 3WHUA 1J3RA 4R4ZA 2OKXA 4BXFA 2VNOA 1G6NA 1GOHA 2Z79A 1S0GA 4DEVA 4Q8KA 1QQP2 2AC1A 4GH4A 2ARCA 4NOTA 3A21A 5FZBA 4Z2AA 2YG0A 3KV6A 5K7PA 4COZA 1S2KA 4XCBA 2Y26A 4GQ7A 5I0RA 1WLWA 2W08A 2GAUA 2R063 2XH6A 4LBLA 3ZDSA 1LECA 1F15A 4MUVA 4AGRA 4LO8A 4CDUB 3HWJA 5F5QA 4M3CE 2E9QA 1RINA 4LITA 4PF5A 3ZN6A 5IK8A 1D4M2 2YYOA 2PAKA 5FYYA 4CDQA 5EJ1B 1AX2A 1QH7A 4K1YA 3EB7A 3TOJA 3UETA 3UK9A 5CBLA 1J1TA 1D0HA 2HWD3 2RS11 3N7JA 1UQXA 1VLNA 4CU8A 2B42B 4QXKA 1VBA3 3C7OA 4N90A 3OCPA 4EN9B 4YARA 3JBG3 1N3QA 3OPZA 1GSLA 4KWUA 4GKYA 4J1WA 4YG6A 3TYJA 1N3OA 2ZEXA 2E7AA 4I0AA 3SKJE 1S2EA 1CZSA 4OFGA 2VJXA 2C24A 2RR13 5K4LA 1TVGA 1E5HA 5FYSA 3THDA 4Q4Y2 5I8YA 2P5BA 5FQ0B 4U2AA 3ZPOA 4E2QA 2V09A 1W9FA 5FP8A 5BPXA 4S2GA 2VTXJ 3PVNA 3N9NA 3JZVA 4H2AA 5F2SA 4A44A 3FX3A 3KV4A 4CP9B 3WNOA 4IV3B 1JHNA 2UWAA 3O0XA 4BMBA 3H7YA 2B9UA 4LQRA 2WFF1 5GZCA 1LB2A 2CDPA 3AKTA 2QQNA 4QU1A 2A3WA 4XF3A 5A1LA 3J4UH 2A3YA 1GLHA 1TME1 1QOSA 1RVF1 4XTMA 1ZBE3 2WS93 2ATFA 3QH6A 1OF4A 5DPNA 4AFAA 2W1WA 2WT2A 2IFRA 1OUXA 3J8F2 3VZNA 1NQJA 1PK6C 3UGGA 3POEA 4A6OA 4FPGA 1UIKA 2OS2A 4M01A 5C8CA 1RIRA 3K4DA 2UWBA 3TAYA 4A7YA 4AQ6A 4A3XA 1NY71 1RC6A 2ZEWA 1VAMA 4B1MA 4LIUA 3CZJA 2A73B 1SPPA 2QQLA 4HFSA 3S6PA 4ASMB 4AHWA 4QAWA 4H7MA 4IGOA 1FMD3 1EAH3 3ZKYA 2WT1A 5CU1A 3OTFA 4GJZA 2XUMA 2FMDA 1LHOA 1EV13 1R1ZA 5HV4A 4MHUA 4QKNA 2CGNA 1UU6A 2VVDA 4GWIA 2RDQA 4QXBA 4DPNA 4E2SA 3I3MA 3I59B 4JAAA 4IEWA 1S0BA 3DXUA 3NRUA 2FHRA 2Y6HA 4BB3A 5K8SA 1DIWA 3DL3A 1LHWA 2YXSA 3LB9A 4UXAA 3DGTA 5DQ0A 3J7NA 3T2PA 4Q4X3 4L8QA 2WA4A 1BCXA 3I3DA 4YZ3A 4AK3A 4CDQC 4K20A 1DQ4A 1JODA 3T1LA 5GZEA 1SG3A 2XLGA 3IIAA 3JD71 3THPA 3RZLA 1IS4A 1C5HA 1XNCA 4Y26A 1H0BA 4JHTA 1H8TB 2RS13 3C7GA 3NL1A 1F31A 4MXVA 4Q8LA 4Q5OA 3CO2A 5H9PA 1ND3C 4D6RA 2E7QA 4YZ2A 3HIFA 5FV3A 2WWUA 4LBNA 2DYCA 4YGEA 2IVIB 5GM0A 3MYXA 4LOTA 3IDBB 2YFZA 2X5IA 1IQAA 4XQ4A 3WDVA 4QX7A 4OLLA 1UCXA 4GAZA 2C9AA 3TEYA 4LLFA 1AR91 2ILMA 2VQTA 1RHI1 1STMA 1YNAA 5C5UA 2NP0A 4NRMA 2J1AA 3KV9A 1AUYA 1QH6A 2WC2A 1ASJ1 1W6NB 3MIBA 1PGSA 4W4ZA 1DLLA 4N9HA 4E4HA 4N43B 4QM9A 5FJHA 4NWVA 1W90A 3AYAA 4CDWB 4CP1A 1T6GC 2PQSA 4QXHA 5JZGA 2PHRA 1UMIA 2OIIA 4JDMA 1WCUA 3MIEA 1Z7S3 1YIFA 4PIXA 4Y3OA 4C0BA 2YU2A 4XFCA 4DRRA 3O1RA 1RVF3 1ZZBA 2A5ZA 3PNAA 2BOJA 5C3PA 1VMFA 2Y6LA 3POSA 3AZYA 1PIV3 5F6KA 5BYNA 4BQYA 3EO6A 4KG0A 1NZIA 1URXA 3A4UA 1GZ9A 3OD0A 4YWAA 3UKTA 4CA9A 4EWEA 5FZ8A 4LT5A 1NZCA 2VMFA 2ES3A 3VGIA 4OHZA 4M0HA 3BOPA 3PUSA 4GWMA 1OLQA 4QQLA 1HRV3 3ACGA 4BQXA 2ZHKA 1MACA 1ONAA 1T6BX 2Y60A 5GLUA 2PHFA 2X8KA 5GZDA 1Q56A 3PDQA 1FNZA 2ZTNA 5AC91 5FP3A 3H1WA 2FDKA 3CBNA 4QDQA 3WUCA 1WZXA 3JUUA 2CNAA 1S1AA 3UL2A 1PMHX 2YUEA 4UFMA 5L9BA 2DUOA 3AL5A 3ASIA 3LA7A 4MX3A 2AUYA 3ORJA 5BNOA 2ZHMA 2UY8A 2GN3A 4BDVB 1MZFA 2ZHLA 4Q4W3 5IVBA 1BMV2 4YW6A 3VD4A 1G9BA 1IS5A 2A6YA 2WZR2 2XQXA 3N7LA 4FFIA 1K42A 3T2OA 5T5PA 5KHHA 1O91A 1OQ1A 1G7YA 4M3CB 5L9VA 2ZOEB 4BQWA 1L7QA 3GXUA 1QJY2 1C8M1 2KM2A 4QWNA 4JGYC 3KQ4B 1VMJA 4I01A 3F95A 2D7FA 3NNLA 4RHV1 1O3QA 1GBGA 2OYZA 4JGZC 2R1BA 3CU7A 1FV2A 5EHDA 3BU0A 2Z42A 2X5IC 1MR5A 2KD7A 2MEV3 3GF6A 2EAAA 1DZRA 2H0VA 3VHNA 2KXLA 2W39A 1MS4A 1RUG1 4IEOA 5JR7B 4BHPA 3GHNA 2ZX4A 4NIGA 5EJZB 2RM23 2YMZA 3UKNA 2HWB2 5CISA 5FYBA 1DDLA 3CZUA 1ZZ7A 3SHRA 4AQSA 5FZHA 1RUI3 3HOBA 4ZU4A 5JZGC 2ZGTA 4A7ZA 4CZSA 2K0GA 1QHDA 2HBUA 3RJRA 1ULPA 4RR3A 1MQTC 3NV3A 1GKBA 3CKHA 4K9SA 5F32A 5A6YA 1XYNA 1WMDA 5FZ6A 2BERA 5FP7A 3M3IA 1UY3A 1RJ7A 1UN1A 1LESA 3SMHA 1R092 1UO9A 2C9KA 2WDBA 5FTTC 2ADEA 5A6QA 3C7HA 4I30A 1WW5A 5CVRA 2VZ3A 4ES8A 3GALA 4I2OA 4GALA 2W2IA 4CUBA 2CGPA 3WQ1A 3SNMA 4GWJA 4IEXA 5IWFA 1PO11 3BGAA 4D94A 1C4RA 1WLDA 3WHTA 4GB33 4AI8A 5IVFA 4FTBA 2IVJA 3VD5A 2WBKA 2PHDA 4BPZA 3EBRA 3H42B 3K3NA 4J1XA 5AC93 1BZWA 1Y3TA 3H3ZA 3MV11 4QB6A 1ND2C 3GJAA 1YWKA 1VBB1 2GC2A 2WNVB 5FDBA 4MGIE 1NYWA 3N7MA 4ZS2A 4XF1A 4JTNA 1F35A 3LEMA 3R4UA 4A2UA 5EYXA 2YHJA 5L7OA 4XIOA 1CWPA 1W6OB 3J7MA 5FY4A 1IG0A 3IPVA 4EN6B 3VHRA 2R062 2D6KA 1UIJA 3GDBA 1QJFA 3SXWA 3P1IA 1HN0A 1UXZA 5A7NA 3UJOA 1PZ9A 4ASLA 5CADA 1XB9A 3HEIA 3V0AA 3WG1A 5FRAA 3AP5A 1R1A1 3U4SA 5CFCA 5T5OA 3LAGA 5CG8A 2HBTA 3OYWA 2JE7A 2VW2A 2WNOA 1FOD3 3B00A 5K0UC 3O1TA 2HWD2 4Q29A 5DUXA 3A0KA 3JCIA 3OGSA 5E6HA 4FPCA 1AX0A 1BVP1 1XSRA 2EIEA 1JUIA 1HKDA 4XBLA 2YY1A 3KVAA 4EZ4A 2D6OX 1VBA2 5A6ZA 1DQ5A 5IVCA 1HXS3 3VB9A 3O1VA 2WLPA 4BQ3A 4ET7A 4R4XA 2TNFA 1A34A 1JN2P 1CVNA 3NAPA 4GKXA 2JXAA 4MGZE 1W28A 1WCSA 2JKBA 4LBQB 2VCCA 2ARBA 3ACFA 3FC0A 2RR12 5FUNA 3VZOA 5A32A 2WABA 3D8CA 1RITA 4YGCA 1LOEA 3IZOA 4RR3C 2P6HA 3VDBA 2GMPA 2VQ0A 1QJX3 1K5MA 3NKGA 1RMU3 4RA0A 4JX0A 2D6LX 4EQVA 1UOFA 2VW1A 3M3QA 4YW2A 1V6NA 5IFPA 1HB4A 5ACA3 2EIBA 2OUHA 4Y1VA 3LWCA 1WMXA 4AVVA 5B2GB 3MUZ1 5B4NA 3RZKA 5JWPA 3RS6A 5F5AA 2HYKA 4RS5A 4HLTA 4UF0A 1ZBE2 2WS92 2XLFA 3UGHA 2YB7A 3VZLA 3WDXA 5C3RA 4XJ9A 1X36A 2BVVA 1HW5A 2VBDA 5CAZA 1JU3A 1UU5A 3WF2A 2ZGSA 4ARYA 4CU9A 1QY4A 1Q8SA 3M8LA 1K45A 3KQRA 5CEHA 1GOGA 4X6QB 1JZ4A 4MGTA 1FMD2 3INAA 1EAH2 3K48A 1YQ5A 2E7TA 3VBRA 2WZEA 1EV12 5FZAA 3P3PA 1SCSA 2PXJA 2VZTA 3OY8B 1GICA 5E89A 3PTRB 4DNYA 2QE3A 2RE9A 1YC61 2JDUA 1K3IA 1NG0A 4KG8A 5L7OC 4GJYA 1T2XA 3KT1A 2PLV1 4Y20B 3Q8EA 3I3BA 4TLGA 4AFDA 4JQTA 2RS31 1ZRCA 1VBC3 5FPXA 3DXTA 5A3MA 5D8AC 4LLOA 1LU2A 5LEJA 4AGGA 2DUQA 5FP9A 1AR73 4F3JA 3KM5A 5J96B 3B01A 2DVBA 4GH4B 4Q4X2 3MZHA 3JB8A 1QXRA 2IZWA 3MUY1 4RGAA 1U5ZA 2LROA 4R9BA 2Y0OA 3RRDA 5CFCC 4YVSA 5FBZA 2B5HA 4Z1VA 2CL2A 1S55A 1CAWA 5A7PA 1OI6A 3ZYPA 3BTYA 4LBJA 2WAOA 2WSVA 3THTA 1YYNA 3MO4A 4A45A 2WUHA 4BK5A 2WR9A 1YQ6A 3PMSA 3ZFFA 3NAPC 4QX8A 3WP4A 2WA3A 4LO5B 3N7KA 4LEJA 5EP9A 1RB8G 1RUC1 2CGOA 2A6XA 3S57A 2C6SA 3P5BA 2PHLA 1OA4A 1S0IA 2ARAA 2VVEA 3TB0A 3KHBA 3ZIXA 1XJAA 5T3NA 3WDWA 3VBOA 2PHXA 2YFUA 2NQYA 4PBPA 2J1RA 3SCHA 3O1OA 1K5MC 3AZWA 4BWOA 1MS9A 2XB6C 4ASKA 2CWMA 2IXJA 4KU7A 4QPGA 5FY1A 3U07A 1OFNA 2Q1ZB 4XZUG 1R64A 5FPLA 4FI9A 3UJQA 1OA2A 3TRSB 2J22A 4IEVA 3T2QA 2P34A 5D2AA 3WW4A 1N1TA 2BQPA 4KMQA 5HBAA 2WNUA 1NUKA 1OVSA 2VCBA 1Z7S2 2R071 4QQOA 3M1HA 2ZMKA 1UOGA 4QX3A 4TYSA 1C28A 4OUEA 3NKTA 4COUA 4META 4AAXA 2C1FA 4WM8A 2HWE3 4DFSA 1CIWA 1PIV2 3ZYBA 4IESA 1PVC3 4PJYA 2XXZA 5CFDC 3WUDA 4D6SA 2HWF3 1ULCA 4H14A 4U36A 3AK0A 4LA2A 1IZ3A 1YRZA 4CVUA 1HJFA 3ZIWA 1W6PA 3FBMA 3RNSA 3VBRC 1VJ2A 2BGPA 4MV2A 5LEKA 1N1SA 2VXRA 5C8CB 1HRV2 2E31A 3H8RA 3WNMA 5J48A 5APAA 5LRRA 1KGYA 3EXUA 4INDA 4L99A 2FDGA 1RL3A 5LB6A 1SLLA 3WQ7A 1IPSA 4O9GA 5IUQA 4FPHA 1BJQA 3MBWA 2W47A 3OPTA 3POIA 3WNLA 1HQLA 3DPRA 4LTAA 4XUQA 3RMYA 3KCCA 4LA3A 5FPVA 2VCAA 4NHXA 1HJGA 1WKYA 2GNBA 4XJUA 1XBFA 3WT3A 4Y4YA 3K4ZA 4KNCA 1LTEA 2O1QA 4V2WA 5EXOA 1GP5A 1AL0G 2A3XA 4YW3A 3H9AA 1PVXA 5IVVA 4CEYB 1OBNA 1QGLA 4HK9A 4XBQA 5JUVA 2DURA 4WVMB 2P2KA 4ORFA 4DOUA 1UD1A 4RL7A 5FZDA 4NIIA 1RUE3 3IM0A 1V9U1 2FCTA 4CCJA 5GZGA 5HCFA 3AFKA 4XABA 1UZWA 3BYWA 2JG9A 4YFZA 3ZXAC 2XUEA 3POBA 3ZFFC 2XJRA 1XNBA 3PUIA 4PDWC 1COV3 4O61A 4CU6A 5ABJA 4F7ZA 1V70A 1UF2C 3KS7A 4AVSA 1UOBA 2MEV2 2VOWA 3CMGA 4LO4B 4WM7A 3OG2A 3AP7A 5LW9A 2D43A 2QQIA 3E5QA 4AEDA 4XF9A 3K46A 4B4PA 4XUPA 3RZJA 2JDHA 3AP9A 3MLLA 4UW5A 2VZRA 3B9IA 2WINB 2X10A 3IAPA 2RM22 1POQA 3ES4A 3GZTB 1JXNA 4DINB 4AVCA 4QPGC 1CZTA 4XJWA 2XPJA 1AR63 3TNQA 4FFHA 3WG2A 4FXKB 4L97A 4PIYA 5A7SA 1F5JA 5JDBA 1RUI2 3QACA 1W06A 4Q0SA 4WV8A 1LOBA 1PMJX 2NZ9A 1BEV3 1ALYA 2WNUC 4IUGA 5KHKA 1Q8PA 1RUH3 4NRPA 3RWNA 4AW7A 3N9MA 2G9GA 3QCWA 4LKFA 5I93A 1OOPC 1FPN1 3J7HA 2CSGA 4W8JA 4QB1A 3ITQA 1PGW1 3AZXA 3NJXA 4H55A 5IJRA 4V1PA 3THCA 4YM3A 2DUPA 1DYKA 1BBT3 2GP3A 1FX5A 2W52A 4JZRA 3SH5A 5FMCA 2PYTA 4XCAA 2ADDA 1LEMA 1QJZA 3B3QE 3WXPA 3QBQA 1GMMA 3OSDA 2LM3A 1OLRA 1H4HA 1Q43A 1XPWA 1H1AA 5C71A 2V73A 1G86A 2Q4SA 5JXIA 4GB32 5DUWA 5BNPA 4K3UA 5BNNA 4QQPA 5FFOC 4QX2A 3VBSB 3V0BA 1Y9MA 2O14A 5HCAA 1ZM1A 1HRI1 5F1RA 3HD8B 1AR81 2OXBA 4BIOA 2KR2A 3J9SA 1G8WA 2WZ8A 1POV0 3MIHA 4XYXA 5FZGA 1YEWA 3MHZA 1QJU1 5LCWL 2VZOA 4QB2A 3WDTA 3LA3A 3DYOA 4XAAA 4Q4V3 1V6JA 3O1SA 3ZSMA 4CCLA 2C26A 5FYCA 1G9AA 1AX1A 1SLBA 1QMJA 1GQHA 3FLRA 1ZZ8A 4MADA 3I8TA 5CKMA 1AL21 1GWLA 4ITCA 2VNVA 3IMNA 1C5IA 4UT5A 5JLVA 2Q0AA 3E1F1 4TXWA 3O7OA 5FXWA 5BNOB 1B35C 2CYFA 4XILA 3VBFA 1OFSA 1O4TA 3C3VA 4E9KA 3POWA 5KBFA 5ABJC 4CCKA 4UFIA 5F3CA 4K7JA 5FZ0A 3QOPA 1FOD2 2ENRA 4L92A 1WCKA 4LHLA 5JOZA 4AEDC 3SKVA 1UZZA 3KZ4C 4P5YA 2J42A 1XE0A 1LJ7A 2WNEA 3A0NA 2HWC3 4HPKA 4CP2A 2AYHA 1HXS2 5L9RA 4N7UA 5DN2A 2WQ4A 3MF6A 3PVEA 2YU1A 3NWKA 3T3YA 2DVAA 1MEC3 3I54A 4J6GA 5C4WB 4WZFA 4HKLA 1WD4A 2ZPXA 4Q26A 1XXNA 5JVVA 2PAMA 2GN7A 1QJX2 3UYJA 3ABZA 1RMU2 4AFCA 4FTSA 3VZKA 1IG3A 4COVA 1V6MA 1UY1A 3C7FA 3CF6E 3M4FA 1AZDA 1R081 2R32A 1MS3A 4QMAA 4XACA 5F39A 2CY6A 3UNPA 1JBCA 1V0AA 2GC3A 3VD3A 3BI3A 4AQ2A 1ULFA 4HZFA 5C9AB 1YCIA 2J1EA 1O5UA 1VBE1 5IVYA 2PHUA 3TEXA 4EWAA 1RUD1 4JV4A 1W9SA 4Z92B 2EXIA 1LENA 1WLTA 2QJVA 3DN7A 3PHMA 3UGFA 1BXHA 3IT8A 5BNPC 5BNNC 2BNMA 3JXSA 3VDDB 2YPJA 4I3GA 1E57A 1KXGA 3ZDVA 1CX1A 1EYBA 3PU8A 1SMVA 5EZWA 5JSRA 4PCRA 1C1FA 5GLVA 4A6SA 3ZOIA 2VULA 4IGQA 1H9WA 1BKZA 1DYPA 4Q0PA 3T0DA 4N53B 5FK8A 1VAKA 3K51A 4NE9A 3VZJA 1ND3A 2UY9A 3ZMNA 3M70A 1YI9A 1U0AA 3W21A 1CX4A 2BVBA 2XLAA 4CU7A 1W8UA 2OPKA 1VBC2 4EJRA 3D82A 5IK7A 2RMU1 4A41A 3F2ZA 4G3YC 3RWKX 3FE5A 1AR72 5IW0A 3HN1A 3OUIA 4F83A 2VE1A 1WA4A 3VBFC 3MLJA 1JH5A 2JDZA 2VNRA 4MZUA 4QD2A 4QHOA 2QBXA 2RS51 3E5XA 3DYMA 4CDXA 1KS4A 2ZKLA 4IL7A 1H9PA 4CXXA 2CAVA 4JRLA 3W58A 5DDJ3 3ZO0B 4WZCA 5IYYA 2IXIA 4M4PA 1RUJ3 4HL0A 1A8DA 2XWBB 1W2AX 3DKWA 1MS5A 1D2QA 1W0PA 2ZBJA 5DAWA 1UYXA 2VMEA 5F7UA 1IPJA 4DEQA 3ZYJB 1AYM3 4R9AA 4IEYA 4E2GA 3ZXKA 4CP0A 2WAAA 3M3EA 3IDAA 1W8HA 4XF0A 2TEPA 3T4VA 1PGL2 4FSJA 5A33B 3NNGA 4XFBA 1W8OA 5DUVA 4AEKA 3T0BA 4IV1A 5J3UA 1WW4A 1I5ZA 1S0FA 1RJ8A 2NYYA 4DXTA 4SLIA 1FXZA 4GMP3 4AEJA 3FWEA 3KMHA 1TZOA 5AVPA 4DUWA 4R8HA 4XFAA 3ST7A 3H8UA 2XKOA 4DS0A 2ZCWA 4R52A 1I6XA 3HT2A 1GP6A 2XBO3 3HN3A 3WV6A 2VBBA 3IWZA 1LHUA 4LO6B 2J1TA 2QQUA 1OPMA 4XBNA 1CAUB 4K6BA 1VPHA 3U1XA 1LRHA 3E6CC 2XWJB 4KWLA 3ZFGB 4RQPC 2Y6KA 1RTVA 2ZA9A 3VN4A 1N1VA 1W6QA 2VGDA 4YW1A 1NCQA 4YVWC 1XE7A 3PJYA 4IE6A 2HWE2 1ZRIA 1OVPA 4XQWA 5JIUA 4K8FA 1PVC2 4PF1A 3MIDA 5FPUA 4Z2WA 1W99A 4RS5B 4AI0A 2HWF2 4UF0B 2HH9A 4M0NA 5FMDA 5JI9A 1CJDA 1PO21 4NHYA 5FLJA 4CEWB 4FBFA 2FDHA 3HBKA 3IDEA 3MI8A 3VKLA 1V6LA 4EN0A 3WD5A 4AI1A 5DZFA 4Q0UA 2XJSA 2ZGKA 2GH2A 1GWMA 2XQRA 1Q3EA 4JGYA 3VDAA 2X53S 3TN91 1HDKA 1X7NA 5A7WB 4JGZA 4XEZA 1J58A 1LGBA 2YROA 1HN1A 5FPAA 1Y9QA 2DU1A 3I97A 1PM7A 2FDFA 1OUSA 2UURA 3W5NA 1IHMA 3IDCB 4LK7A 5FYHA 3KT4A 1JYCA 5FZ9A 5FZIA 1MS1A 3T09A 3USUA 2EVXA 2HEWF 2Q1FA 4QXCA 3PIGA 5F2WA 2V72A 1AF9A 4S2HA 1AHSA 5A3OA 4CDXC 1CONA 2XJUA 3WNPA 2FDJA 5FZOB 2X05A 4Y1YA 4P9YA 2C5DA 3IBMA 4QGMA 3SISA 4BZ4A 1SBEA 2ORZA 1XQNA 1KFUL 1RUE2 5DABA 4N8MA 4FP3A 1AYN1 4OMCA 3NNJA 5G04L 1GFF2 2WFF3 3SCGA 4YVSB 2CTVA 4P02B 1MQTA 1YQ2A 4OCTA 3SCFA 1COV2 1RGSA 1TME3 3I3QA 4MGSA 1W8NA 4TSVA 4YM0A 5A1AA 1JTZX 1RUF1 5C6CA 4P5HA 1SFPA 1CAXA 1VE0A 2BFUL 2X29A 1NE4A 5LK5A 4DXRA 4P08A 1UL9A 1ZRRA 2QDNA 4FAHA 5A70A 4IV1C 1EPZA 5FLIA 5LASA 4NAMA 2PMWB 3WNKA 4AAPA 4COWA 3N4MA 4NHKA 1C3HA 1OQDA 3WCSA 3WF1A 4Z8BA 4FFFA 5FWJA 1WBFA 3TEZA 4IE0A 2JJ6A 1JYXA 1W2NA 3AMPA 4D0QA 1S0EA 3AXEA 3MDPA 4NWWA 4YSFA 3VBOB 2KA3A 1VP6A 3AL6A 2WYFA 4HN1A 5LZ6A 2DTYA 4AE2A 3OUJA 3KGZA 3D4KA 1RUH2 1EPWA 1ZBA2 2ETEA 3OEBA 5LA2A 2VZSA 1NCQC 2E53A 4FPKA 4NN0A 2VAUA 1ND2A 1W03A 3POFA 1W3VA 3LFMA 3QLQA 1TMF1 4L9BA 3H1MA 4O7XA 4YG3A 4HONA 4AGVA 1M06G 1F8VA 1BBT2 1F4HA 2Z5WA 3GYDA 3WF4A 3DUIA 3PL0A 1GZWA 1DLCA 3UV9A 3Q8FA 2VD7A 4EV0A 4NPMA 4GMP0 3AKPA 3GHMA 3EHKA 1VRH1 4TTGA 4AG4A 2AR6A 2VXJA 3Q8BA 4WM8B 4P9WA 5BV6A 3R05A 1BLZA 1X33A 2YDEA 1BHGA 1GR3A 2ZGNA 3JD73 1I5PA 1ULEA 3NNFA 1IKQA 2D3PA 2GC0A 5D1IA 5I0DA 4XFIA 1ZRDA 5IT6A 1UMHA 2F6BA 4EWDA 3VDCA 1LR5A 3KHCA 3I3EA 1W6PB 1ENRA 2W1QA 4K8RB 1TE1B 5ANNA 2JG8C 3Q8AA 4QPIA 1JMUB 5FY5A 4BQ4A 3BKZA 1SLTA 2XKPA 5ANQA 5K0UA 4XFHA 1NKGA 4FPJA 2Q8EA 5TSWA 1W8ZA 2JDMA 2UYAA 3R0RA 4Y22A 4Q4V2 4BCUA 3RZGA 1AR93 5LA0A 1RHI3 4GZ9A 3U37A 2BTVC 2Y6GA 3CJIC 3DPRB 5EQUA 2HYXA 4DY3A 1ASJ3 1NA1C 3UESA 1H2MA 3WDUA 2QKDA 2ZGUA 2V4VA 2CU5A 2Q1MA 1UYYA 2VQAA 2Y34A 3LIGA 3ZXGA 4JVAA 4RD7A 1Y7BA 2F4LA 2VMDA 3VBUB 3WW1A 1DFQA 2WZPP 1YJKA 5JSOA 1MZ5A 5CYYA 3HAGA 1O4YA 5T52A 1HB1A 4HVRA
chains in the Genus database with same CATH topology
2C24A 1WMXA 4BQ2A 2JWPA 4LK7A 3ZYHA 1OH3A 3ORJA 5D21A 3UT0A 1W8ZA 1W9FA 4YWAA 2O14A 2Q1FA 1W8TA 1W8WA 4LKDA 4YW6A 4BQ3A 4LKFA 4AL9A 4CPBD 4A6SA 1GWKA 4LJHA 2KR2A 2VXJA 4CP9A 4CP9B 3ZYFA 4CPBA 2LRPA 1W90A 1L7LA 1HN0A 3ZYBA 1OKOA 1V0AA 1GWMA 2WYFA 1WCUA 3F95A 4LK6A 4BQ5A 2LROA 1UOJA 4BQ4A 1WZXA 1W8UA 1GWLA 4LKEA 4YW7A 2K46A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C24 A;  1WMX A;  4BQ2 A;  2JWP A;  4LK7 A;  3ZYH A;  1OH3 A;  3ORJ A;  5D21 A;  3UT0 A;  1W8Z A;  1W9F A;  4YWA A;  2O14 A;  2Q1F A;  1W8T A;  1W8W A;  4LKD A;  4YW6 A;  4BQ3 A;  4LKF A;  4AL9 A;  4CPB D;  4A6S A;  1GWK A;  4LJH A;  2KR2 A;  2VXJ A;  4CP9 A;  4CP9 B;  3ZYF A;  4CPB A;  2LRP A;  1W90 A;  1L7L A;  1HN0 A;  3ZYB A;  1OKO A;  1V0A A;  1GWM A;  2WYF A;  1WCU A;  3F95 A;  4LK6 A;  4BQ5 A;  2LRO A;  1UOJ A;  4BQ4 A;  1WZX A;  1W8U A;  1GWL A;  4LKE A;  4YW7 A;  2K46 A; 
#chains in the Genus database with same CATH topology
 4W50 A;  1VBD 1;  1WWY A;  4HVO A;  5FPZ A;  2XVL A;  3HNY M;  2BW8 A;  3ACI A;  2E32 A;  3UT0 A;  3NV4 A;  2JG9 B;  4OI2 A;  4OZO A;  5H9R A;  4GD4 A;  1D2S A;  2HWC 2;  2JE9 A;  3USS A;  1BK0 A;  4AVB A;  3EJK A;  2Y8K A;  3JQX A;  3D0S A;  3H0O A;  1GAN A;  1YHF A;  2R04 1;  5FO8 B;  1MEC 2;  1OMI A;  2D98 A;  3AM2 A;  3AVS A;  3LOI A;  4JRA A;  4PQ9 A;  1B09 A;  5FMB A;  4D7S A;  5FKB A;  1S0J A;  1LED A;  3PVB B;  2FDI A;  1J83 A;  2W95 A;  1F2N A;  3IAQ A;  1O3R A;  5K9Y A;  2P37 A;  2R6Q A;  1SAC A;  2RVA A;  3C2U A;  4IE4 A;  1W9T A;  4FO9 A;  3VBH B;  3S0M A;  5JMC A;  1NCR B;  1O8S A;  1QQP 1;  3BCW A;  1OXC A;  4LKS A;  1Q5O A;  3KF5 A;  1CES A;  1RYY A;  2IWG B;  4P9I A;  2A70 A;  2ZX1 A;  2BOI A;  2XL9 A;  1DG6 A;  5FO7 B;  2BP6 A;  3AMQ A;  2VMI A;  4Y1U A;  4BU2 A;  2CV6 A;  4IGP A;  1YXW A;  3VLB B;  4LE3 A;  2D44 A;  3KWV A;  5L19 A;  1J59 A;  1D4M 1;  2GH8 A;  4QDR A;  5FWE A;  1UXX X;  2QQK A;  1A78 A;  3ENR A;  5D8A A;  3WP6 A;  2AGS A;  1NT0 A;  2G9F A;  2NM1 A;  5KR7 A;  5FMO L;  4ARX A;  5F5I A;  2MPF A;  2VOK A;  1C8M 3;  4HBN A;  4FT8 A;  4QPI C;  4RHV 3;  5AVA A;  3H3U A;  2DBI A;  1US3 A;  4AWD A;  1RED A;  1S4C A;  1YO8 A;  1LHV A;  1JYV A;  2IXC A;  3SIT A;  5FQ0 A;  3O12 A;  4PT6 A;  4MO3 M;  5A7Q A;  3ZXE A;  2VR4 A;  1RUG 3;  5J36 A;  3JBG 2;  3U4X A;  3VL8 A;  1S0C A;  4COY A;  4RGG A;  4Q4Y 1;  4CP9 A;  4AYU A;  1DGR A;  3ZFE C;  4IV3 A;  4S2D A;  4I02 A;  2ZGQ A;  1CR7 A;  3PUR A;  1QEX A;  3OGR A;  3E6B A;  2D93 A;  2G1M A;  5DXD A;  4RYD A;  3AB0 A;  1RUN A;  3I2G A;  3GBW A;  3S7I A;  2ARE A;  3FUO A;  3EMR A;  4IQP A;  1SDD B;  2VMC A;  2Q8O A;  4QDS A;  2D5H A;  4IE5 A;  5T50 A;  3FUQ A;  5DDJ 2;  4D69 A;  5IAT A;  4LUM A;  1W6M A;  1VB4 A;  1ZYB A;  1DZQ A;  1VBD 3;  2ZEY A;  1AVB A;  3HPN A;  4Y24 A;  1FYU A;  5GZF A;  3MLK A;  1RUJ 2;  1QOT A;  5HXV A;  2W87 A;  4IW3 A;  2DFB A;  2VUJ A;  2XJT A;  2OZJ A;  2RJL A;  3HBZ A;  5FP4 A;  3J8F 1;  3IMM A;  3K77 A;  3W5M A;  2R16 A;  4CYD A;  5H9Q A;  2LS6 A;  2OQ6 A;  2G4I A;  4XE9 A;  3FL7 A;  1GOF A;  1AYM 2;  2JDN A;  4ZON A;  3N3H A;  1X8E A;  1PO1 3;  4LBO A;  5FYZ A;  2P1B A;  1CJP A;  1J3Q A;  1J84 A;  3AZV A;  3ON7 A;  5LY2 A;  3ALQ A;  3ZLI A;  5FZL A;  4NHL A;  5CFD A;  4OHW A;  4CXY A;  3VV1 A;  3I59 A;  5IAV A;  3FLP A;  3VL9 A;  2Z69 A;  4P9J A;  1PK6 B;  4CDU C;  2EIG A;  3ZYI B;  1OSG A;  2XBO 2;  4BQ1 A;  1IGO A;  2DWR A;  5FIX A;  1VBB 3;  2WO1 A;  5JIA A;  3V56 A;  3WG3 A;  4D3W A;  2UYB A;  4Y5T A;  1EP0 A;  2LUW A;  2FD8 A;  2Z4F A;  1POV 1;  5FKC A;  5L36 A;  1MVQ A;  1XC6 A;  3SEP A;  2PEL A;  3ZM8 A;  1OT5 A;  4Y1Z A;  5DAV A;  2I2S A;  3ATG A;  1C57 A;  1H8T A;  2GP5 A;  4N53 C;  2HJI A;  2EF6 A;  5DG1 A;  4XC9 A;  4TLF A;  5CKN A;  2WO2 A;  2A6V A;  1V6I A;  4YG0 A;  3P6B A;  5IK4 A;  3L9J T;  2W94 A;  4A3Z A;  2XVK A;  2XG3 A;  1R1A 3;  5LBE A;  3ACL A;  4LKE A;  4XHB A;  3B69 A;  3OD4 A;  4RGK A;  2W46 A;  3ILR A;  4Q1R A;  3RZH A;  5E8A A;  2YC2 A;  1HB2 A;  1QXJ A;  5FLH A;  1JI6 A;  2OUJ A;  1EUU A;  4GXL A;  2QVS B;  2RS1 2;  4KI5 M;  4PQQ A;  4M00 A;  4UWD A;  5FCC A;  5FY0 A;  3ZN6 B;  3LPG A;  4CDQ B;  4ZZ5 A;  5HPO A;  4HOO A;  1W6N A;  3IB3 A;  3DEC A;  4UBH A;  4BM8 A;  1GWK A;  2LW8 A;  2ZKN A;  4N43 A;  4PDW A;  3MIG A;  1IQD C;  4IV3 C;  3IKW A;  4NVP A;  1WME A;  3MIC A;  4XQD A;  5FZ7 A;  5J7M A;  2WWJ A;  5FZ3 A;  3WEZ A;  3U14 A;  4XVH A;  2WKK A;  3LE0 A;  2Y6J A;  4BLJ A;  4DUX A;  4DQA A;  5GLT A;  2EID A;  4JKL A;  2VQU A;  1E5S A;  4QGL A;  3C7E A;  4DMI A;  2AEY A;  4B8E A;  2JDP A;  1VIW B;  3RFR A;  4K21 A;  3T2T A;  4BA6 A;  1G9D A;  3POJ A;  2B8M A;  2H6C A;  2Z2S B;  2BEO A;  1DU3 D;  2BU9 A;  3HT1 A;  1SZB A;  4I0W B;  2BFU S;  4XXA A;  5F3G A;  3WSO A;  4XHX A;  2JEN A;  3CJX A;  3O1P A;  2XHK A;  2H6B A;  2V4A A;  3WNX A;  2WFF 2;  3U0Z A;  3HQU A;  3GBG A;  4AL9 A;  2WSU A;  4LBQ D;  5EWS A;  3RG0 A;  1OOP A;  2GMM A;  1LAJ A;  1RVF 2;  2BUK A;  2QDR A;  2DDU A;  2LRP A;  3M3C A;  2CDO A;  1H4G A;  2WJS A;  1JUH A;  3DEM A;  4L0P A;  3ZMO A;  1KS5 A;  4ZY9 A;  4XMI A;  2JDK A;  2WQZ C;  4URT A;  3KD4 A;  1MZE A;  2ET7 A;  4XXP A;  3BTX A;  1JZ8 A;  3H8X A;  2JE8 A;  4UI9 L;  4HMZ A;  1UZV A;  2W3J A;  3QH7 A;  1NY7 2;  1YFX A;  2QTW B;  3V64 A;  3RZM A;  2Y0I A;  5JCT A;  4I0B A;  5JI7 A;  1JYT A;  1U12 A;  5FOJ B;  4F8A A;  2L9L A;  4YYO A;  1MS8 A;  2RDR A;  2WN2 A;  2Y64 A;  1UPI A;  1SPP B;  4PBO A;  4FTE A;  3LPF A;  2GNT A;  4AHZ A;  4NID A;  3GCW A;  3AFG A;  3VHO A;  3ZSE A;  3ZYF A;  1NXD 1;  2PLV 3;  3WP5 A;  1JZ7 A;  2D6N A;  2VM9 A;  1GUI A;  1H8T C;  1KFX L;  3ME2 A;  4HN0 A;  2D97 A;  2RS3 3;  2DV9 A;  1IPK A;  1BMV 1;  4Y4R A;  3LKJ A;  5HV0 A;  3WQ0 A;  2O8Q A;  2Q30 A;  2WZR 1;  1VB2 A;  1YQ8 A;  3ILF A;  4FPO B;  4Q4W 2;  2W92 A;  4IEU A;  5KXE A;  1X9T A;  3TNP B;  1QKQ A;  1QJY 1;  1QNY A;  1NLQ A;  2NMN A;  4QX0 A;  3LOB A;  3JD7 2;  2RJK A;  3ZN5 A;  3VD7 A;  1YUD A;  1GQP A;  2G19 A;  2JWP A;  2NLR A;  4JCK A;  1B35 A;  3APB A;  2DBN A;  3KT7 A;  1UY0 A;  4NIA A;  1N3P A;  1QDC A;  5CNA A;  1UY2 A;  5F3E A;  4R9D A;  4N43 C;  1Z78 A;  3IN9 A;  3PVO A;  3H8O A;  1XE8 A;  4BIS A;  4CDW C;  3B02 A;  3O1U A;  4H7L A;  5FZK A;  4CUC A;  4YM1 A;  4NAO A;  1RUC 3;  2HWB 1;  4B3N A;  1FV3 A;  4JGY B;  4JQR A;  4LIV A;  3ZN4 A;  4IDZ A;  1AR9 2;  2AAC A;  5T55 A;  4JGZ B;  1RHI 2;  5JXH A;  5FXZ A;  4NIH A;  1NOV A;  4AVT A;  5GKA C;  5DZG A;  2X5I B;  3OPW A;  1NLS A;  1ASJ 2;  3FFQ A;  1US2 A;  2VC9 A;  5CIR A;  3LQC A;  4HK8 A;  2OZ6 A;  3USU B;  4HSJ A;  1LOG A;  1R09 1;  3C8X A;  2A71 A;  3RPQ A;  3E97 A;  4X6R B;  4NRQ A;  3HNB M;  1XNA A;  2QZ3 A;  2YC4 A;  2QQM A;  2R07 3;  4QGN A;  1D0G A;  4AVA A;  1D7P M;  4OHV A;  5JZG B;  3AKR A;  5CKQ A;  2QQP A;  4QX5 A;  3WY6 A;  1XU2 A;  4YM2 A;  4AEM A;  1WW7 A;  1MQT B;  2F17 A;  4MG2 A;  1EUT A;  4XPV A;  2HEY F;  3SEE A;  2VG9 A;  4MXW A;  3BPZ A;  2WNV A;  2K46 A;  1ODN A;  1W0N A;  5LA1 A;  1J3P A;  1PHM A;  5FO9 B;  2DCT A;  4DXZ A;  1SEF A;  1W6O A;  3FBY A;  1I3H A;  1I9R A;  1Y4W A;  3CLP A;  5AC9 2;  4LJH A;  2Y6F A;  2C4X A;  4CRQ A;  5F9T A;  1WCQ A;  2CHH A;  1CIY A;  5BNQ A;  5F37 A;  4Q1P A;  3I4I A;  4AOC A;  4ZHN A;  3G6J B;  2VZV A;  3BVC A;  1X82 A;  2BYV E;  2R06 1;  3J26 N;  4CCD A;  5FJK A;  5FMO S;  3EQE A;  3KVB A;  3PLQ A;  1JOJ A;  3K2O A;  3M7A A;  3O0W A;  1WCD J;  3RYR A;  1ZVF A;  3S7E A;  2WLQ A;  2AH2 A;  4KGG A;  2LTN A;  3D3A A;  2B4K A;  1O5L A;  2ZEZ A;  2XDV A;  3LEI A;  5FR3 A;  4Q27 A;  3LCP A;  1V9U 3;  3ZR6 A;  3ZYG A;  1LHN A;  1C8M 2;  2HWD 1;  2QQV A;  1WGP A;  4XTP A;  1ZZ9 A;  5FBJ A;  4RHV 2;  4ATF A;  3S30 A;  1JYW A;  2F4P A;  3AMN A;  1VBA 1;  4LBQ A;  1L7L A;  2GDF A;  3LFI A;  3TBD A;  5JOX A;  3JBG 1;  1XU1 A;  1ZZC A;  4DB5 A;  1ZRE A;  4GUL A;  1VMH A;  1ST8 A;  2BBA A;  2WO7 A;  4J25 A;  1RUG 2;  1QOO A;  2WL1 A;  2E33 A;  5JXJ A;  2RR1 1;  2P17 A;  2W68 A;  2VUC A;  4RSU A;  3WW2 A;  2ZGR A;  3MGU A;  1A8M A;  3OBT A;  4XIK A;  2YV8 A;  2VTX A;  3MF9 A;  3PUH A;  5HCB A;  1JZ2 A;  1Q8O A;  4XDQ A;  2HKX A;  4XMA A;  4QKD A;  2PHT A;  4XJZ A;  5LAT A;  3W59 A;  3VD9 A;  1U5X A;  2P3I A;  1KEX A;  1UYP A;  3B5L B;  4NR1 A;  1ENX A;  3MV0 1;  5LRS A;  1KD7 A;  3AKQ A;  4XJA A;  2B39 A;  2UU8 A;  1FPN 3;  5I0S A;  1UX6 A;  5IHR A;  2RG4 A;  5ACA 2;  2AZ5 A;  2ZGM A;  2J1S A;  3X29 B;  1ZBE 1;  2WS9 1;  4O9E A;  3NV1 A;  4RR3 B;  4BE3 A;  1H2L A;  3GJB A;  1AJO A;  1V6O A;  1SFY A;  2JDY A;  3I2J A;  4P14 A;  4RQP A;  5EPA A;  2BWC A;  2WNV C;  1XNT A;  2BNN A;  4YVW A;  1KJL A;  5J1X A;  4V2V A;  4FPE A;  1PO1 2;  4UOJ A;  5FPB A;  1DF0 A;  4HET A;  4JHZ A;  5J09 A;  1OUR A;  2XJP A;  4OI1 A;  4EN7 B;  1X8M A;  5LY1 A;  1FMD 1;  2DVF A;  1K5J A;  1EAH 1;  3EYP A;  3SLI A;  1CPN A;  4Y20 A;  1EV1 1;  1NE6 A;  2B7Y A;  1PZ7 A;  2WWS A;  1KJR A;  1HRI 3;  5SV5 A;  5AFB A;  2RJ2 A;  5KC5 A;  1AR8 3;  1UZY A;  1VBB 2;  2V5D A;  3WOG A;  2NPI A;  2JDA A;  1W2T A;  3G7D A;  3ZSK A;  3JQW A;  4FOV A;  5EYY A;  5A80 A;  1QJU 3;  3ETP A;  5KXD A;  3ACH A;  1UKR A;  1SBF A;  3WDY A;  1JS9 A;  1W05 A;  4Q4X 1;  4YW7 A;  2SLI A;  3WZ1 A;  1UWW A;  1JZ6 A;  2JIJ A;  1AL2 3;  2VUD A;  1QIQ A;  4NPL A;  4X8N A;  5JAX A;  4DY5 A;  3O14 A;  5C8W A;  5I8S A;  3I2F A;  1UZ0 A;  4JKK A;  2D6M A;  1FAY A;  5L7O B;  1JYI A;  3WF3 A;  2VTF A;  2XJV A;  3H50 A;  3LDR A;  4O65 A;  4LPL A;  1X9P A;  1SDW A;  3IPV B;  3III A;  3J7L A;  3I2I A;  1R1A 2;  1Y9G A;  2BDR A;  5E88 A;  5FZ1 A;  2VCM A;  4IEQ A;  3NJV A;  5D8A B;  1NQD A;  3GGL A;  3V0A B;  3FZ3 A;  3H1Y A;  2LAL A;  4NPR A;  5KXB A;  4SBV A;  3MPB A;  4P00 B;  3ZXD A;  4QX1 A;  1GYK A;  5JPM B;  4LK6 A;  1OPO A;  1YLL A;  3OBZ A;  4QU2 A;  3NNM A;  1ENS A;  1L3J A;  3U78 A;  5CFC B;  2I07 B;  5FZE A;  4A4A A;  4YZ5 A;  3O5S A;  4YW4 A;  3OYW B;  4QHZ A;  2J1U A;  5T54 A;  1OH4 A;  3MFA A;  5JMO A;  4QQ2 A;  5GLW A;  2DCY A;  4CCE A;  2GSY A;  5BUV A;  2VNG A;  3MW4 A;  3BUC A;  2EXJ A;  1W8T A;  4OQ9 A;  4JC1 A;  5A3U A;  2Q5T A;  1OD5 A;  3NAP B;  4EE2 A;  1PMI A;  1WBL A;  5LBC A;  3AX4 A;  1DGL A;  3KCX A;  5A32 B;  1QF3 A;  3D0J A;  4LE4 A;  4KL1 A;  2EAK A;  2OVU A;  3GZE A;  2XJQ A;  3SQO A;  1JW6 A;  4TZD A;  4OI0 A;  1ZA4 A;  2FBE A;  1Z7S 1;  2BNO A;  5A3L A;  1OC1 A;  4B29 A;  1R08 3;  1CN1 A;  4Z82 A;  3A22 A;  4ZPI A;  3I49 A;  3LEK A;  5A1F A;  1K5M B;  2AEZ A;  3BOD A;  3RI8 A;  3ZPY A;  1LOF C;  1PIV 1;  5CZK A;  2A6Z A;  1VBE 3;  2QCS B;  3BPS A;  1W6M B;  4DZG A;  1RUD 3;  2ZS6 B;  2VL4 A;  1LUL A;  1TNR A;  1PM4 A;  2DVG A;  2PTM A;  1QJE A;  3KF3 A;  1WW6 A;  2JB8 A;  4K1Z A;  2YBK A;  2W1U A;  4XFG A;  2J1V A;  2W5F A;  5LBB A;  4LOS A;  1GP4 A;  3WIN E;  1HRV 1;  1Y43 B;  2DF7 A;  3HVD A;  3OJB A;  4FPF A;  1GQG A;  2K2S A;  3JB4 C;  5JXG A;  1HLC A;  1OKO A;  4GH4 C;  2IFW A;  3FHQ A;  1LNS A;  2NMO A;  4XFF A;  5CFD B;  3AP6 A;  1DQ6 A;  1HIX A;  1OQE A;  1WUV A;  3URF A;  4ERO A;  2N7G A;  2MHF A;  3S5A A;  1H8V A;  5ERL A;  1GV9 A;  4CEY A;  1NLR A;  4WVM A;  2JG8 A;  2PLV 2;  3MIF A;  1G9F A;  3VBR B;  4Q4W 1;  2DCZ A;  3H7J A;  2RS3 2;  3DF0 A;  2XHN A;  5LWB A;  2GND A;  2DU0 A;  3NMB A;  2RMU 3;  3CEW A;  1AXZ A;  4C1X A;  3LSD A;  4FPL A;  3A23 A;  2R7E B;  2GME A;  2W9X A;  2C0Z A;  2D3R A;  5KHG A;  1LGC A;  4HKW A;  4YRD A;  3CJI A;  3MEP A;  3CNA A;  1JZ5 A;  2RS5 3;  4KQ7 A;  2CAU A;  1NA1 A;  5CG9 A;  3OB8 A;  1OD3 A;  1VRB A;  2JB4 A;  1D4V B;  2XGX A;  3Q9O A;  3CIH A;  2ZAC A;  4KWK A;  3NST A;  4AFM A;  4N7I A;  4BQ5 A;  2MEV 1;  4RFT 0;  3T0A A;  3LD8 A;  4YGD A;  1O3T A;  4BH9 A;  2YZ4 A;  2YBP A;  4WVV A;  4EYU A;  1CAW B;  3GBF A;  4MSV A;  5LBF A;  3CDZ B;  1BQP A;  5F5C A;  3L2H A;  4B4R A;  4E8C A;  2RM2 1;  4NO4 A;  1RUC 2;  3LGR A;  5FY9 A;  1HX6 A;  4GIQ A;  4ZU5 A;  1A6C A;  2OA2 A;  2Y33 A;  3CQO A;  4NRO A;  1W3X A;  1XSQ A;  3N9Q A;  4W6W A;  4LO7 A;  3ZFF B;  1UMZ A;  1RUI 1;  3AYC A;  4PDW B;  2JKX A;  4FFG A;  1AR6 2;  2ERF A;  3FN9 A;  3CHX A;  3VKM A;  5FZF A;  4LUK A;  4BXS V;  4FQ4 A;  1FI2 A;  1H2N A;  4MH0 E;  1V00 A;  4OUL A;  5FXX A;  3ZR5 A;  3PIJ A;  4IET A;  1FAT A;  2BJS A;  1ACC A;  1ULD A;  3BOW A;  3VHP A;  1BEV 2;  4XOG A;  1DQ0 A;  3VKF C;  2ZML A;  1LOA A;  4QPG B;  1NAE A;  2K9Z A;  3HQX A;  4CUG A;  3LZZ A;  2W1S A;  2R07 2;  1ZRF A;  4DXS A;  2VZQ A;  5C8C C;  5DZE A;  2J7M A;  4B7K A;  5C33 A;  5D21 A;  2GZW A;  3VBS A;  4OVE A;  2WNU B;  3KB5 A;  1H1M A;  4KBB A;  2XOM A;  4JDN A;  3LSE A;  1LCL A;  1OOP B;  1TEI A;  2IXL A;  4GB3 1;  3POY A;  4I09 A;  1SQ4 A;  2D3S A;  1OLM A;  4PIZ A;  4TWT A;  2RDS A;  1MS0 A;  3BTZ A;  2OPW A;  1PO2 3;  3RMX A;  4D8M A;  1RUO A;  1F4A A;  2VBP A;  2XON A;  2E51 A;  4CSW A;  1SHW B;  1APN A;  4AF9 A;  5IFT A;  2QFE A;  4FPY A;  4CEY C;  1VAL A;  5IVJ A;  5FYM A;  2WQ8 A;  2WFP A;  4JKM A;  2YC0 A;  4G4F A;  4QM8 A;  5JR2 A;  5JOY A;  3BB6 A;  1H2K A;  3TN9 3;  2BPA 2;  4AI2 A;  1OF3 A;  5FXV A;  5FYI A;  2IXK A;  2JIG A;  3LDB A;  4YLZ A;  5FAX A;  1SCR A;  1BYH A;  2B9V A;  4L2N A;  2HEV F;  1YI7 A;  3W20 A;  1LKN A;  3FHA A;  3R6S A;  5A3T A;  2WN3 A;  4E27 A;  2D40 A;  2ZHN A;  3GZA A;  5FUP A;  3ZFE A;  4BJ0 A;  3D6E A;  2ZGL A;  1N1Y A;  2JIC A;  1JOB A;  1H6X A;  1DBN A;  5GAL A;  4LUL A;  4FAG A;  4H3W A;  1CAV A;  1ZA7 A;  4AI3 A;  1UY4 A;  1FOD 1;  1V9U 2;  1AYN 3;  2VW0 A;  3RYK A;  2V5Y A;  4YW5 A;  3BN6 A;  4YZ4 A;  2ZGP A;  5C4W A;  3CL1 A;  4K40 A;  1NX9 A;  2JEM A;  4URA A;  2UWC A;  2ARX A;  1B35 B;  1HXS 1;  4MVT A;  1RUF 3;  4XAE A;  4FXG B;  5AFE A;  2EA7 A;  2W0X A;  4UFJ A;  3BIE A;  4AFB A;  4OI4 A;  1ENQ A;  1K12 A;  1UYZ A;  3MPP G;  5FZ4 A;  5C7G A;  2WYS A;  3OEA A;  1CQ9 A;  5ABJ B;  1QWR A;  4QPY A;  3WR0 A;  5H9S A;  1MVE A;  4OYU A;  4XET A;  1AXK A;  4WM7 B;  4ZKT B;  1YFU A;  1JU4 A;  2IUW A;  3WNN A;  5E1R A;  2H0B A;  4AED B;  1QJX 1;  1YFY A;  2Y38 A;  3I2H A;  3KGL A;  1RMU 1;  1H6Y A;  3OBR A;  3WQB A;  3BAL A;  3ZKU A;  1ULO A;  2GNM A;  3ETQ A;  5C9A A;  3AJZ A;  4KU8 A;  5IK5 A;  5EFU A;  4YFW A;  2ID4 A;  3WLU A;  5ACA 1;  3AZZ A;  3AP4 A;  5KWR A;  1KIT A;  3N9P A;  1W9W A;  3AC0 A;  4ZZ8 A;  1FPN 2;  3ZXJ A;  5HXM A;  1G9C A;  2A7A A;  3RQ0 A;  5BY5 A;  4CDU A;  1PGW 2;  4CCN A;  5DMY A;  3VBS C;  1HQW A;  4W6X A;  1TMF 3;  3M3O A;  3VDD A;  3RYP A;  4A7K A;  2X09 A;  2ZX2 A;  1DCS A;  5FY7 A;  2WT0 A;  2FQP A;  3FHI B;  1DP0 A;  1VRH 3;  3RGB A;  1U5Y A;  2WII B;  1F5F A;  4OZX A;  4N53 A;  1CGP A;  2VO5 A;  3I2O A;  1ODM A;  2VEC A;  1NXM A;  1XNK A;  1UNB A;  3LA2 A;  4MXW B;  5KHI A;  1QNW A;  2XML A;  1IS3 A;  3HQR A;  2EIC A;  2BWA A;  3DV8 A;  4PI2 A;  1HRI 2;  1E5R A;  4CCM A;  1W0O A;  1AR8 2;  3WCR A;  4C1W A;  5BNO C;  5BNP B;  1ZZ6 A;  5BNN B;  5LK7 B;  2FMY A;  3V0B B;  2CWS A;  1DQ1 A;  1QJU 2;  4MOA A;  4PLM A;  5B4X A;  1W9Y A;  1VBC 1;  3JU9 A;  4OMD A;  4CCC A;  4CTE A;  3ELN A;  4YZ1 A;  4ONU A;  4D6Q A;  3H3L A;  3NQH A;  1O4Z A;  1AR7 1;  5E16 A;  3AMH A;  1AL2 2;  2RHP A;  4BLI A;  3ZVX A;  4XUN A;  4E4D X;  3VKO A;  1J1L A;  1JHJ A;  1SBD A;  4Y1X A;  1GNH A;  1O3S A;  4LHK A;  5SV8 A;  4HT1 T;  3AKS A;  3DKQ A;  1BVV A;  1IOA A;  4UFH A;  2BGC A;  1QXP A;  3N35 A;  1Z0H A;  1SFN A;  1HB3 A;  1MPX A;  2BRT A;  2P3Y A;  5C4W C;  5I8T A;  1I1E A;  2DVD A;  3AVR A;  2QUO A;  2ORX A;  1XND A;  2P4E A;  5JOW A;  3QD6 A;  1PX3 A;  4LHN A;  4W6Y A;  4JDO A;  5A33 A;  3FMG A;  4BYY A;  3U11 A;  4OUM A;  3VBF B;  1KQR A;  3L2Y A;  2ZAA A;  5GLZ A;  4ISR A;  5FOB B;  2PQQ A;  3OF1 A;  4PHZ A;  1PGL 1;  3T1M A;  1DHK B;  5F3I A;  1C1L A;  3BU7 A;  2Q8D A;  2R04 3;  1DQ2 A;  1CAU A;  2HLE A;  5C9A C;  4HPK B;  5C70 A;  3ZFG A;  4B7E A;  2DCK A;  3I7D A;  1TQ5 A;  3KLS A;  1UU4 A;  4HSL A;  4N9I A;  3GCX A;  4D7T A;  5HI0 A;  5FYU A;  3GNE A;  1GZC A;  1UX7 A;  4DRV A;  2B45 X;  3PJQ A;  3ZX7 A;  5C3Q A;  1QQP 3;  2ZJC A;  3VDD C;  4E4S A;  4BIF A;  1R08 2;  3HR9 A;  5J37 A;  3AYE A;  1XYO A;  2ZMN A;  3RI9 A;  2HWE 1;  5DAQ A;  2VOV A;  3MW3 A;  4CEW A;  5EIY B;  1PVC 1;  1VBE 2;  3T30 A;  3LEG A;  2W91 A;  3N9L A;  4LR4 A;  5L73 A;  2ZAB A;  1RUD 2;  2HWF 1;  5F6L B;  2VVF A;  4Q0V A;  1D4M 3;  2XL7 A;  4A42 A;  4XUT A;  1TNF A;  2FZ1 A;  2ET1 A;  4RQP B;  4PLN A;  5A7W A;  1OLM E;  1LU1 A;  4YVW B;  2B46 X;  5EV7 A;  3K3O A;  2YGM A;  4FCA A;  1GNY A;  3AYD A;  4QPW A;  2PHW A;  3WF0 A;  5T5L A;  4MHR A;  5FRE A;  1LGN A;  3OGJ A;  1RXF A;  1VR3 A;  3A7Q A;  4YPJ A;  5KC6 A;  1O6U A;  5FYT A;  4IER A;  1YIP A;  1M4W A;  2JD9 A;  3MFC A;  1O59 A;  2ZX3 A;  5FZO A;  1Q8Q A;  3I2K A;  4MLO A;  3RDI A;  2TBV A;  4WBB A;  4NMI A;  2IC1 A;  2I74 A;  3BTA A;  4Q4Y 3;  4CDW A;  1W39 A;  2VUA A;  2RMU 2;  1ND3 B;  4ES9 A;  3E6D A;  1UAI A;  3OGV A;  4UYB A;  4DUV A;  4ZXE A;  1GNZ A;  3OBA A;  2BGO A;  1RUE 1;  4IEZ A;  3NV2 A;  2VZU A;  2RS5 2;  2QZ2 A;  4Y33 A;  4P9G A;  4TN7 A;  4YGB A;  4W65 A;  1COV 1;  4OQ8 A;  3DYP A;  2VPV A;  2DFC A;  2FZ2 A;  4Y5Z 0;  4CDX B;  1O7F A;  1OA3 A;  3J8F 3;  2XVG A;  1OHF A;  1TME 2;  4Y5S A;  1U5I A;  1LOC A;  1W04 A;  2O0O A;  3ILN A;  1EY2 A;  1DYO A;  4QT6 A;  4CXW A;  5T5J A;  1YFW A;  3VZM A;  1REF A;  2YGL A;  4M4R A;  2VOT A;  2WRA A;  1AR6 1;  4AHY A;  3ZFG C;  4LXL A;  4IEP A;  2JD4 A;  5LA9 A;  1WLC A;  3ES1 A;  5DUU A;  4CUA A;  1TG7 A;  5A3N A;  1QDO A;  3DCQ A;  1BEV 1;  5J98 B;  4MGQ A;  1L7R A;  2JEC A;  1RUH 1;  2PFW A;  1UKG A;  1WD3 A;  3N36 A;  1ZBA 1;  3R4S A;  4UFL A;  2ZX0 A;  4OUS A;  3KCY A;  4IV1 B;  4ISQ A;  4RS5 C;  3GM8 A;  4M3C F;  4UBG A;  3O0V A;  3RZZ A;  1C8N A;  3M2M A;  4LKD A;  3ZXF A;  3AXD A;  4CPB D;  4CEW C;  4KWJ A;  2R49 A;  1POV 3;  1BBT 1;  4FVV A;  4D7Y A;  2QQW A;  3PUQ A;  4BOW A;  5BXX A;  4NHM A;  2ZXQ A;  1UPS A;  2DCJ A;  3GZU C;  3NO8 A;  4M3C A;  4XDP A;  4XJ8 A;  3KSC A;  4B4Q A;  4UW3 A;  2BV4 A;  5A3W A;  2YBS A;  4C91 A;  1UOJ A;  3PU3 A;  4FQZ A;  1W6Q B;  5FUI A;  4MYE A;  1FNY A;  2SBA A;  1NCQ B;  1ZX5 A;  5CA6 A;  3B7M A;  1PO2 2;  3VKN A;  3RJ2 X;  5C3S A;  3TEW A;  4QHB A;  1CZV A;  1REE A;  1A3K A;  1W2O A;  2OW4 A;  2ZAH A;  4OHY A;  1H30 A;  3FJS A;  1W8W A;  3ZXL A;  1WA6 X;  4DO0 A;  1JYN A;  3FLT A;  4C0H A;  4BME A;  5C3O A;  5FYV A;  2O8O A;  1BK1 A;  3LIH A;  4JTO A;  1H1I A;  4LHS A;  4UW6 A;  4PI0 A;  2FCV A;  1S0D A;  3TN9 2;  2FCU A;  4Q4V 1;  2R30 A;  3ROU A;  5G05 L;  4XF4 A;  3OGG A;  3ECQ A;  4XUR A;  2BZD A;  3WP3 A;  5HCH A;  3POG A;  4YVS C;  3BIW E;  4PLO A;  4Q0Q A;  5FY8 A;  5CB7 A;  3V65 A;  3VBU A;  2P6C A;  2P3J A;  3PTY A;  3B93 A;  4KBZ A;  4KH9 A;  2JG8 B;  4HXC A;  1PNG A;  1S2B A;  1PX4 A;  3NJZ A;  1YJL A;  1V6K A;  2EXK A;  4P9X A;  5DAX A;  3WX5 A;  3I2D A;  2OT7 A;  3R4D B;  3LDK A;  2OQ7 A;  2VU9 A;  1XRU A;  3P3N A;  3PUA A;  4AXO A;  4CE8 A;  2RDN A;  3T08 A;  1LOD A;  1RXG A;  2XR4 A;  3ZSL A;  4FP2 A;  4E4Z A;  3WVJ A;  4R9C A;  3VUO A;  1AYN 2;  1CPM A;  1YQC A;  4Q2F A;  4HG6 B;  4AI9 A;  3CJI B;  2R0H A;  2AEN A;  1VAV A;  1ULG A;  1NA1 B;  4XUO A;  4E8D A;  5M0T A;  3B94 A;  3TWI A;  2HWC 1;  2RV9 A;  4GA9 A;  3VBO C;  2E63 A;  2ZZQ A;  1RUF 2;  5FK7 A;  2EAL A;  3AMM A;  3LF7 A;  4AR2 A;  2OX0 A;  4LBK A;  1MEC 1;  1W2U A;  5FZC A;  4AZZ A;  3D5O A;  4C8D A;  5GJ6 A;  1HV0 A;  2R0F A;  3NW4 A;  3VBH A;  2A1X A;  1NCR A;  5DAP A;  4OHX A;  4ZXK A;  4IE7 A;  1CAX B;  2TUN A;  2YPD A;  3W9A A;  3KV5 A;  2ZZJ A;  1GU3 A;  1HV1 A;  2GAL A;  2VH9 A;  5A6X A;  3U10 A;  1ZBA 3;  3HJR A;  1AJK A;  3S5Q A;  1SLC A;  2D6P A;  2DTW A;  5I0U A;  4RN5 A;  1N47 A;  1FT9 A;  1JOP A;  4HVQ A;  2BBV A;  4WM8 C;  4MGK E;  5A3P A;  1IS6 A;  3O1M A;  4IXL A;  1GZT A;  3WG4 A;  4LMF A;  3T4H B;  4AHX A;  3ZYR A;  2VMG A;  1PNF A;  1DGW A;  4S2F A;  4LOR A;  4HAN A;  5IAX A;  4UW4 A;  1TMF 2;  2WO3 A;  4I3P A;  3RVH A;  4AQT A;  1KDM A;  2PN5 A;  2WZR 3;  3NVC A;  1ND2 B;  1Q8V A;  4WVZ A;  4ZU7 A;  4X8P A;  3SC7 X;  5I0T A;  4UAP A;  1VRH 2;  4DIQ A;  1QJY 3;  2EXH A;  3B9C A;  2A6W A;  3FFZ A;  1GZW B;  2Q8C A;  4P9L A;  4ATE A;  4NUB A;  2JX9 A;  5FZM A;  1IKP A;  2E6V A;  3DPR C;  2G9Z A;  5IVE A;  5ISL A;  4C90 A;  2GC1 A;  3MW2 A;  1ZNP A;  2P3K A;  3E5U A;  1O8P A;  4UFK A;  4YNI A;  2I45 A;  3K4A A;  1JZ3 A;  3NJY A;  4LBM A;  3HNM A;  4NJ4 A;  2A75 A;  3VBU C;  5KXC A;  1OKQ A;  1P8J A;  2HWB 3;  5A7O A;  2R1D A;  5KHJ A;  4QPI B;  1KDK A;  2VOX A;  2VZP A;  4QQH A;  4XW3 A;  1CD3 G;  3WW3 A;  4Z07 A;  5K0U B;  1W8F A;  3RSJ A;  4FOY A;  4BQ2 A;  3N9O A;  4FOQ A;  3ZYH A;  1OH3 A;  2JG9 C;  3K75 B;  4WVW A;  4Y22 B;  1AXY A;  1DGR N;  3PME A;  2PAE A;  3ZSJ A;  1XOY A;  5DDJ 1;  1DGW X;  4QKB A;  3AJY A;  2ZGO A;  1R09 3;  1F9K A;  1X50 A;  4WM7 C;  1XYP A;  2PA7 A;  4LNV A;  1RUJ 1;  3ZFE B;  4CPB A;  3U75 A;  2QQJ A;  4FOW A;  2VZ1 A;  4RFR B;  4B1L A;  3UKV A;  3Q8C A;  5C5T A;  1CAV B;  1SLA A;  1VBD 2;  2E26 A;  3SH3 A;  1KRI A;  5F8P A;  1PZ8 A;  1E5I A;  1UW8 A;  4HKO A;  1QU0 A;  2QQO A;  5EJ3 A;  1AYM 1;  2D5F A;  2QNK A;  2VY0 A;  5DG2 A;  5I91 A;  4EZH A;  2GU9 A;  3VBH C;  1LOF A;  4ZS3 A;  1NCR C;  4QKF A;  1SLI A;  1PK6 A;  4BK4 A;  3OUH A;  4XDO A;  4EN8 B;  2R04 2;  4GWN A;  1HQN A;  4GMP 1;  2NN8 A;  4G9S B;  3OY8 A;  2IXH A;  4XZP A;  2MNG A;  4CCO A;  1DZT A;  1WMF A;  3HMY A;  2VMH A;  4KGQ A;  3SH4 A;  1MZ6 A;  2XBO 1;  4MGY E;  5JPN B;  5JSP A;  4L11 A;  3OOX A;  3WHU A;  1J3R A;  4R4Z A;  2OKX A;  4BXF A;  2VNO A;  1G6N A;  1GOH A;  2Z79 A;  1S0G A;  4DEV A;  4Q8K A;  1QQP 2;  2AC1 A;  4GH4 A;  2ARC A;  4NOT A;  3A21 A;  5FZB A;  4Z2A A;  2YG0 A;  3KV6 A;  5K7P A;  4COZ A;  1S2K A;  4XCB A;  2Y26 A;  4GQ7 A;  5I0R A;  1WLW A;  2W08 A;  2GAU A;  2R06 3;  2XH6 A;  4LBL A;  3ZDS A;  1LEC A;  1F15 A;  4MUV A;  4AGR A;  4LO8 A;  4CDU B;  3HWJ A;  5F5Q A;  4M3C E;  2E9Q A;  1RIN A;  4LIT A;  4PF5 A;  3ZN6 A;  5IK8 A;  1D4M 2;  2YYO A;  2PAK A;  5FYY A;  4CDQ A;  5EJ1 B;  1AX2 A;  1QH7 A;  4K1Y A;  3EB7 A;  3TOJ A;  3UET A;  3UK9 A;  5CBL A;  1J1T A;  1D0H A;  2HWD 3;  2RS1 1;  3N7J A;  1UQX A;  1VLN A;  4CU8 A;  2B42 B;  4QXK A;  1VBA 3;  3C7O A;  4N90 A;  3OCP A;  4EN9 B;  4YAR A;  3JBG 3;  1N3Q A;  3OPZ A;  1GSL A;  4KWU A;  4GKY A;  4J1W A;  4YG6 A;  3TYJ A;  1N3O A;  2ZEX A;  2E7A A;  4I0A A;  3SKJ E;  1S2E A;  1CZS A;  4OFG A;  2VJX A;  2C24 A;  2RR1 3;  5K4L A;  1TVG A;  1E5H A;  5FYS A;  3THD A;  4Q4Y 2;  5I8Y A;  2P5B A;  5FQ0 B;  4U2A A;  3ZPO A;  4E2Q A;  2V09 A;  1W9F A;  5FP8 A;  5BPX A;  4S2G A;  2VTX J;  3PVN A;  3N9N A;  3JZV A;  4H2A A;  5F2S A;  4A44 A;  3FX3 A;  3KV4 A;  4CP9 B;  3WNO A;  4IV3 B;  1JHN A;  2UWA A;  3O0X A;  4BMB A;  3H7Y A;  2B9U A;  4LQR A;  2WFF 1;  5GZC A;  1LB2 A;  2CDP A;  3AKT A;  2QQN A;  4QU1 A;  2A3W A;  4XF3 A;  5A1L A;  3J4U H;  2A3Y A;  1GLH A;  1TME 1;  1QOS A;  1RVF 1;  4XTM A;  1ZBE 3;  2WS9 3;  2ATF A;  3QH6 A;  1OF4 A;  5DPN A;  4AFA A;  2W1W A;  2WT2 A;  2IFR A;  1OUX A;  3J8F 2;  3VZN A;  1NQJ A;  1PK6 C;  3UGG A;  3POE A;  4A6O A;  4FPG A;  1UIK A;  2OS2 A;  4M01 A;  5C8C A;  1RIR A;  3K4D A;  2UWB A;  3TAY A;  4A7Y A;  4AQ6 A;  4A3X A;  1NY7 1;  1RC6 A;  2ZEW A;  1VAM A;  4B1M A;  4LIU A;  3CZJ A;  2A73 B;  1SPP A;  2QQL A;  4HFS A;  3S6P A;  4ASM B;  4AHW A;  4QAW A;  4H7M A;  4IGO A;  1FMD 3;  1EAH 3;  3ZKY A;  2WT1 A;  5CU1 A;  3OTF A;  4GJZ A;  2XUM A;  2FMD A;  1LHO A;  1EV1 3;  1R1Z A;  5HV4 A;  4MHU A;  4QKN A;  2CGN A;  1UU6 A;  2VVD A;  4GWI A;  2RDQ A;  4QXB A;  4DPN A;  4E2S A;  3I3M A;  3I59 B;  4JAA A;  4IEW A;  1S0B A;  3DXU A;  3NRU A;  2FHR A;  2Y6H A;  4BB3 A;  5K8S A;  1DIW A;  3DL3 A;  1LHW A;  2YXS A;  3LB9 A;  4UXA A;  3DGT A;  5DQ0 A;  3J7N A;  3T2P A;  4Q4X 3;  4L8Q A;  2WA4 A;  1BCX A;  3I3D A;  4YZ3 A;  4AK3 A;  4CDQ C;  4K20 A;  1DQ4 A;  1JOD A;  3T1L A;  5GZE A;  1SG3 A;  2XLG A;  3IIA A;  3JD7 1;  3THP A;  3RZL A;  1IS4 A;  1C5H A;  1XNC A;  4Y26 A;  1H0B A;  4JHT A;  1H8T B;  2RS1 3;  3C7G A;  3NL1 A;  1F31 A;  4MXV A;  4Q8L A;  4Q5O A;  3CO2 A;  5H9P A;  1ND3 C;  4D6R A;  2E7Q A;  4YZ2 A;  3HIF A;  5FV3 A;  2WWU A;  4LBN A;  2DYC A;  4YGE A;  2IVI B;  5GM0 A;  3MYX A;  4LOT A;  3IDB B;  2YFZ A;  2X5I A;  1IQA A;  4XQ4 A;  3WDV A;  4QX7 A;  4OLL A;  1UCX A;  4GAZ A;  2C9A A;  3TEY A;  4LLF A;  1AR9 1;  2ILM A;  2VQT A;  1RHI 1;  1STM A;  1YNA A;  5C5U A;  2NP0 A;  4NRM A;  2J1A A;  3KV9 A;  1AUY A;  1QH6 A;  2WC2 A;  1ASJ 1;  1W6N B;  3MIB A;  1PGS A;  4W4Z A;  1DLL A;  4N9H A;  4E4H A;  4N43 B;  4QM9 A;  5FJH A;  4NWV A;  1W90 A;  3AYA A;  4CDW B;  4CP1 A;  1T6G C;  2PQS A;  4QXH A;  5JZG A;  2PHR A;  1UMI A;  2OII A;  4JDM A;  1WCU A;  3MIE A;  1Z7S 3;  1YIF A;  4PIX A;  4Y3O A;  4C0B A;  2YU2 A;  4XFC A;  4DRR A;  3O1R A;  1RVF 3;  1ZZB A;  2A5Z A;  3PNA A;  2BOJ A;  5C3P A;  1VMF A;  2Y6L A;  3POS A;  3AZY A;  1PIV 3;  5F6K A;  5BYN A;  4BQY A;  3EO6 A;  4KG0 A;  1NZI A;  1URX A;  3A4U A;  1GZ9 A;  3OD0 A;  4YWA A;  3UKT A;  4CA9 A;  4EWE A;  5FZ8 A;  4LT5 A;  1NZC A;  2VMF A;  2ES3 A;  3VGI A;  4OHZ A;  4M0H A;  3BOP A;  3PUS A;  4GWM A;  1OLQ A;  4QQL A;  1HRV 3;  3ACG A;  4BQX A;  2ZHK A;  1MAC A;  1ONA A;  1T6B X;  2Y60 A;  5GLU A;  2PHF A;  2X8K A;  5GZD A;  1Q56 A;  3PDQ A;  1FNZ A;  2ZTN A;  5AC9 1;  5FP3 A;  3H1W A;  2FDK A;  3CBN A;  4QDQ A;  3WUC A;  1WZX A;  3JUU A;  2CNA A;  1S1A A;  3UL2 A;  1PMH X;  2YUE A;  4UFM A;  5L9B A;  2DUO A;  3AL5 A;  3ASI A;  3LA7 A;  4MX3 A;  2AUY A;  3ORJ A;  5BNO A;  2ZHM A;  2UY8 A;  2GN3 A;  4BDV B;  1MZF A;  2ZHL A;  4Q4W 3;  5IVB A;  1BMV 2;  4YW6 A;  3VD4 A;  1G9B A;  1IS5 A;  2A6Y A;  2WZR 2;  2XQX A;  3N7L A;  4FFI A;  1K42 A;  3T2O A;  5T5P A;  5KHH A;  1O91 A;  1OQ1 A;  1G7Y A;  4M3C B;  5L9V A;  2ZOE B;  4BQW A;  1L7Q A;  3GXU A;  1QJY 2;  1C8M 1;  2KM2 A;  4QWN A;  4JGY C;  3KQ4 B;  1VMJ A;  4I01 A;  3F95 A;  2D7F A;  3NNL A;  4RHV 1;  1O3Q A;  1GBG A;  2OYZ A;  4JGZ C;  2R1B A;  3CU7 A;  1FV2 A;  5EHD A;  3BU0 A;  2Z42 A;  2X5I C;  1MR5 A;  2KD7 A;  2MEV 3;  3GF6 A;  2EAA A;  1DZR A;  2H0V A;  3VHN A;  2KXL A;  2W39 A;  1MS4 A;  1RUG 1;  4IEO A;  5JR7 B;  4BHP A;  3GHN A;  2ZX4 A;  4NIG A;  5EJZ B;  2RM2 3;  2YMZ A;  3UKN A;  2HWB 2;  5CIS A;  5FYB A;  1DDL A;  3CZU A;  1ZZ7 A;  3SHR A;  4AQS A;  5FZH A;  1RUI 3;  3HOB A;  4ZU4 A;  5JZG C;  2ZGT A;  4A7Z A;  4CZS A;  2K0G A;  1QHD A;  2HBU A;  3RJR A;  1ULP A;  4RR3 A;  1MQT C;  3NV3 A;  1GKB A;  3CKH A;  4K9S A;  5F32 A;  5A6Y A;  1XYN A;  1WMD A;  5FZ6 A;  2BER A;  5FP7 A;  3M3I A;  1UY3 A;  1RJ7 A;  1UN1 A;  1LES A;  3SMH A;  1R09 2;  1UO9 A;  2C9K A;  2WDB A;  5FTT C;  2ADE A;  5A6Q A;  3C7H A;  4I30 A;  1WW5 A;  5CVR A;  2VZ3 A;  4ES8 A;  3GAL A;  4I2O A;  4GAL A;  2W2I A;  4CUB A;  2CGP A;  3WQ1 A;  3SNM A;  4GWJ A;  4IEX A;  5IWF A;  1PO1 1;  3BGA A;  4D94 A;  1C4R A;  1WLD A;  3WHT A;  4GB3 3;  4AI8 A;  5IVF A;  4FTB A;  2IVJ A;  3VD5 A;  2WBK A;  2PHD A;  4BPZ A;  3EBR A;  3H42 B;  3K3N A;  4J1X A;  5AC9 3;  1BZW A;  1Y3T A;  3H3Z A;  3MV1 1;  4QB6 A;  1ND2 C;  3GJA A;  1YWK A;  1VBB 1;  2GC2 A;  2WNV B;  5FDB A;  4MGI E;  1NYW A;  3N7M A;  4ZS2 A;  4XF1 A;  4JTN A;  1F35 A;  3LEM A;  3R4U A;  4A2U A;  5EYX A;  2YHJ A;  5L7O A;  4XIO A;  1CWP A;  1W6O B;  3J7M A;  5FY4 A;  1IG0 A;  3IPV A;  4EN6 B;  3VHR A;  2R06 2;  2D6K A;  1UIJ A;  3GDB A;  1QJF A;  3SXW A;  3P1I A;  1HN0 A;  1UXZ A;  5A7N A;  3UJO A;  1PZ9 A;  4ASL A;  5CAD A;  1XB9 A;  3HEI A;  3V0A A;  3WG1 A;  5FRA A;  3AP5 A;  1R1A 1;  3U4S A;  5CFC A;  5T5O A;  3LAG A;  5CG8 A;  2HBT A;  3OYW A;  2JE7 A;  2VW2 A;  2WNO A;  1FOD 3;  3B00 A;  5K0U C;  3O1T A;  2HWD 2;  4Q29 A;  5DUX A;  3A0K A;  3JCI A;  3OGS A;  5E6H A;  4FPC A;  1AX0 A;  1BVP 1;  1XSR A;  2EIE A;  1JUI A;  1HKD A;  4XBL A;  2YY1 A;  3KVA A;  4EZ4 A;  2D6O X;  1VBA 2;  5A6Z A;  1DQ5 A;  5IVC A;  1HXS 3;  3VB9 A;  3O1V A;  2WLP A;  4BQ3 A;  4ET7 A;  4R4X A;  2TNF A;  1A34 A;  1JN2 P;  1CVN A;  3NAP A;  4GKX A;  2JXA A;  4MGZ E;  1W28 A;  1WCS A;  2JKB A;  4LBQ B;  2VCC A;  2ARB A;  3ACF A;  3FC0 A;  2RR1 2;  5FUN A;  3VZO A;  5A32 A;  2WAB A;  3D8C A;  1RIT A;  4YGC A;  1LOE A;  3IZO A;  4RR3 C;  2P6H A;  3VDB A;  2GMP A;  2VQ0 A;  1QJX 3;  1K5M A;  3NKG A;  1RMU 3;  4RA0 A;  4JX0 A;  2D6L X;  4EQV A;  1UOF A;  2VW1 A;  3M3Q A;  4YW2 A;  1V6N A;  5IFP A;  1HB4 A;  5ACA 3;  2EIB A;  2OUH A;  4Y1V A;  3LWC A;  1WMX A;  4AVV A;  5B2G B;  3MUZ 1;  5B4N A;  3RZK A;  5JWP A;  3RS6 A;  5F5A A;  2HYK A;  4RS5 A;  4HLT A;  4UF0 A;  1ZBE 2;  2WS9 2;  2XLF A;  3UGH A;  2YB7 A;  3VZL A;  3WDX A;  5C3R A;  4XJ9 A;  1X36 A;  2BVV A;  1HW5 A;  2VBD A;  5CAZ A;  1JU3 A;  1UU5 A;  3WF2 A;  2ZGS A;  4ARY A;  4CU9 A;  1QY4 A;  1Q8S A;  3M8L A;  1K45 A;  3KQR A;  5CEH A;  1GOG A;  4X6Q B;  1JZ4 A;  4MGT A;  1FMD 2;  3INA A;  1EAH 2;  3K48 A;  1YQ5 A;  2E7T A;  3VBR A;  2WZE A;  1EV1 2;  5FZA A;  3P3P A;  1SCS A;  2PXJ A;  2VZT A;  3OY8 B;  1GIC A;  5E89 A;  3PTR B;  4DNY A;  2QE3 A;  2RE9 A;  1YC6 1;  2JDU A;  1K3I A;  1NG0 A;  4KG8 A;  5L7O C;  4GJY A;  1T2X A;  3KT1 A;  2PLV 1;  4Y20 B;  3Q8E A;  3I3B A;  4TLG A;  4AFD A;  4JQT A;  2RS3 1;  1ZRC A;  1VBC 3;  5FPX A;  3DXT A;  5A3M A;  5D8A C;  4LLO A;  1LU2 A;  5LEJ A;  4AGG A;  2DUQ A;  5FP9 A;  1AR7 3;  4F3J A;  3KM5 A;  5J96 B;  3B01 A;  2DVB A;  4GH4 B;  4Q4X 2;  3MZH A;  3JB8 A;  1QXR A;  2IZW A;  3MUY 1;  4RGA A;  1U5Z A;  2LRO A;  4R9B A;  2Y0O A;  3RRD A;  5CFC C;  4YVS A;  5FBZ A;  2B5H A;  4Z1V A;  2CL2 A;  1S55 A;  1CAW A;  5A7P A;  1OI6 A;  3ZYP A;  3BTY A;  4LBJ A;  2WAO A;  2WSV A;  3THT A;  1YYN A;  3MO4 A;  4A45 A;  2WUH A;  4BK5 A;  2WR9 A;  1YQ6 A;  3PMS A;  3ZFF A;  3NAP C;  4QX8 A;  3WP4 A;  2WA3 A;  4LO5 B;  3N7K A;  4LEJ A;  5EP9 A;  1RB8 G;  1RUC 1;  2CGO A;  2A6X A;  3S57 A;  2C6S A;  3P5B A;  2PHL A;  1OA4 A;  1S0I A;  2ARA A;  2VVE A;  3TB0 A;  3KHB A;  3ZIX A;  1XJA A;  5T3N A;  3WDW A;  3VBO A;  2PHX A;  2YFU A;  2NQY A;  4PBP A;  2J1R A;  3SCH A;  3O1O A;  1K5M C;  3AZW A;  4BWO A;  1MS9 A;  2XB6 C;  4ASK A;  2CWM A;  2IXJ A;  4KU7 A;  4QPG A;  5FY1 A;  3U07 A;  1OFN A;  2Q1Z B;  4XZU G;  1R64 A;  5FPL A;  4FI9 A;  3UJQ A;  1OA2 A;  3TRS B;  2J22 A;  4IEV A;  3T2Q A;  2P34 A;  5D2A A;  3WW4 A;  1N1T A;  2BQP A;  4KMQ A;  5HBA A;  2WNU A;  1NUK A;  1OVS A;  2VCB A;  1Z7S 2;  2R07 1;  4QQO A;  3M1H A;  2ZMK A;  1UOG A;  4QX3 A;  4TYS A;  1C28 A;  4OUE A;  3NKT A;  4COU A;  4MET A;  4AAX A;  2C1F A;  4WM8 A;  2HWE 3;  4DFS A;  1CIW A;  1PIV 2;  3ZYB A;  4IES A;  1PVC 3;  4PJY A;  2XXZ A;  5CFD C;  3WUD A;  4D6S A;  2HWF 3;  1ULC A;  4H14 A;  4U36 A;  3AK0 A;  4LA2 A;  1IZ3 A;  1YRZ A;  4CVU A;  1HJF A;  3ZIW A;  1W6P A;  3FBM A;  3RNS A;  3VBR C;  1VJ2 A;  2BGP A;  4MV2 A;  5LEK A;  1N1S A;  2VXR A;  5C8C B;  1HRV 2;  2E31 A;  3H8R A;  3WNM A;  5J48 A;  5APA A;  5LRR A;  1KGY A;  3EXU A;  4IND A;  4L99 A;  2FDG A;  1RL3 A;  5LB6 A;  1SLL A;  3WQ7 A;  1IPS A;  4O9G A;  5IUQ A;  4FPH A;  1BJQ A;  3MBW A;  2W47 A;  3OPT A;  3POI A;  3WNL A;  1HQL A;  3DPR A;  4LTA A;  4XUQ A;  3RMY A;  3KCC A;  4LA3 A;  5FPV A;  2VCA A;  4NHX A;  1HJG A;  1WKY A;  2GNB A;  4XJU A;  1XBF A;  3WT3 A;  4Y4Y A;  3K4Z A;  4KNC A;  1LTE A;  2O1Q A;  4V2W A;  5EXO A;  1GP5 A;  1AL0 G;  2A3X A;  4YW3 A;  3H9A A;  1PVX A;  5IVV A;  4CEY B;  1OBN A;  1QGL A;  4HK9 A;  4XBQ A;  5JUV A;  2DUR A;  4WVM B;  2P2K A;  4ORF A;  4DOU A;  1UD1 A;  4RL7 A;  5FZD A;  4NII A;  1RUE 3;  3IM0 A;  1V9U 1;  2FCT A;  4CCJ A;  5GZG A;  5HCF A;  3AFK A;  4XAB A;  1UZW A;  3BYW A;  2JG9 A;  4YFZ A;  3ZXA C;  2XUE A;  3POB A;  3ZFF C;  2XJR A;  1XNB A;  3PUI A;  4PDW C;  1COV 3;  4O61 A;  4CU6 A;  5ABJ A;  4F7Z A;  1V70 A;  1UF2 C;  3KS7 A;  4AVS A;  1UOB A;  2MEV 2;  2VOW A;  3CMG A;  4LO4 B;  4WM7 A;  3OG2 A;  3AP7 A;  5LW9 A;  2D43 A;  2QQI A;  3E5Q A;  4AED A;  4XF9 A;  3K46 A;  4B4P A;  4XUP A;  3RZJ A;  2JDH A;  3AP9 A;  3MLL A;  4UW5 A;  2VZR A;  3B9I A;  2WIN B;  2X10 A;  3IAP A;  2RM2 2;  1POQ A;  3ES4 A;  3GZT B;  1JXN A;  4DIN B;  4AVC A;  4QPG C;  1CZT A;  4XJW A;  2XPJ A;  1AR6 3;  3TNQ A;  4FFH A;  3WG2 A;  4FXK B;  4L97 A;  4PIY A;  5A7S A;  1F5J A;  5JDB A;  1RUI 2;  3QAC A;  1W06 A;  4Q0S A;  4WV8 A;  1LOB A;  1PMJ X;  2NZ9 A;  1BEV 3;  1ALY A;  2WNU C;  4IUG A;  5KHK A;  1Q8P A;  1RUH 3;  4NRP A;  3RWN A;  4AW7 A;  3N9M A;  2G9G A;  3QCW A;  4LKF A;  5I93 A;  1OOP C;  1FPN 1;  3J7H A;  2CSG A;  4W8J A;  4QB1 A;  3ITQ A;  1PGW 1;  3AZX A;  3NJX A;  4H55 A;  5IJR A;  4V1P A;  3THC A;  4YM3 A;  2DUP A;  1DYK A;  1BBT 3;  2GP3 A;  1FX5 A;  2W52 A;  4JZR A;  3SH5 A;  5FMC A;  2PYT A;  4XCA A;  2ADD A;  1LEM A;  1QJZ A;  3B3Q E;  3WXP A;  3QBQ A;  1GMM A;  3OSD A;  2LM3 A;  1OLR A;  1H4H A;  1Q43 A;  1XPW A;  1H1A A;  5C71 A;  2V73 A;  1G86 A;  2Q4S A;  5JXI A;  4GB3 2;  5DUW A;  5BNP A;  4K3U A;  5BNN A;  4QQP A;  5FFO C;  4QX2 A;  3VBS B;  3V0B A;  1Y9M A;  2O14 A;  5HCA A;  1ZM1 A;  1HRI 1;  5F1R A;  3HD8 B;  1AR8 1;  2OXB A;  4BIO A;  2KR2 A;  3J9S A;  1G8W A;  2WZ8 A;  1POV 0;  3MIH A;  4XYX A;  5FZG A;  1YEW A;  3MHZ A;  1QJU 1;  5LCW L;  2VZO A;  4QB2 A;  3WDT A;  3LA3 A;  3DYO A;  4XAA A;  4Q4V 3;  1V6J A;  3O1S A;  3ZSM A;  4CCL A;  2C26 A;  5FYC A;  1G9A A;  1AX1 A;  1SLB A;  1QMJ A;  1GQH A;  3FLR A;  1ZZ8 A;  4MAD A;  3I8T A;  5CKM A;  1AL2 1;  1GWL A;  4ITC A;  2VNV A;  3IMN A;  1C5I A;  4UT5 A;  5JLV A;  2Q0A A;  3E1F 1;  4TXW A;  3O7O A;  5FXW A;  5BNO B;  1B35 C;  2CYF A;  4XIL A;  3VBF A;  1OFS A;  1O4T A;  3C3V A;  4E9K A;  3POW A;  5KBF A;  5ABJ C;  4CCK A;  4UFI A;  5F3C A;  4K7J A;  5FZ0 A;  3QOP A;  1FOD 2;  2ENR A;  4L92 A;  1WCK A;  4LHL A;  5JOZ A;  4AED C;  3SKV A;  1UZZ A;  3KZ4 C;  4P5Y A;  2J42 A;  1XE0 A;  1LJ7 A;  2WNE A;  3A0N A;  2HWC 3;  4HPK A;  4CP2 A;  2AYH A;  1HXS 2;  5L9R A;  4N7U A;  5DN2 A;  2WQ4 A;  3MF6 A;  3PVE A;  2YU1 A;  3NWK A;  3T3Y A;  2DVA A;  1MEC 3;  3I54 A;  4J6G A;  5C4W B;  4WZF A;  4HKL A;  1WD4 A;  2ZPX A;  4Q26 A;  1XXN A;  5JVV A;  2PAM A;  2GN7 A;  1QJX 2;  3UYJ A;  3ABZ A;  1RMU 2;  4AFC A;  4FTS A;  3VZK A;  1IG3 A;  4COV A;  1V6M A;  1UY1 A;  3C7F A;  3CF6 E;  3M4F A;  1AZD A;  1R08 1;  2R32 A;  1MS3 A;  4QMA A;  4XAC A;  5F39 A;  2CY6 A;  3UNP A;  1JBC A;  1V0A A;  2GC3 A;  3VD3 A;  3BI3 A;  4AQ2 A;  1ULF A;  4HZF A;  5C9A B;  1YCI A;  2J1E A;  1O5U A;  1VBE 1;  5IVY A;  2PHU A;  3TEX A;  4EWA A;  1RUD 1;  4JV4 A;  1W9S A;  4Z92 B;  2EXI A;  1LEN A;  1WLT A;  2QJV A;  3DN7 A;  3PHM A;  3UGF A;  1BXH A;  3IT8 A;  5BNP C;  5BNN C;  2BNM A;  3JXS A;  3VDD B;  2YPJ A;  4I3G A;  1E57 A;  1KXG A;  3ZDV A;  1CX1 A;  1EYB A;  3PU8 A;  1SMV A;  5EZW A;  5JSR A;  4PCR A;  1C1F A;  5GLV A;  4A6S A;  3ZOI A;  2VUL A;  4IGQ A;  1H9W A;  1BKZ A;  1DYP A;  4Q0P A;  3T0D A;  4N53 B;  5FK8 A;  1VAK A;  3K51 A;  4NE9 A;  3VZJ A;  1ND3 A;  2UY9 A;  3ZMN A;  3M70 A;  1YI9 A;  1U0A A;  3W21 A;  1CX4 A;  2BVB A;  2XLA A;  4CU7 A;  1W8U A;  2OPK A;  1VBC 2;  4EJR A;  3D82 A;  5IK7 A;  2RMU 1;  4A41 A;  3F2Z A;  4G3Y C;  3RWK X;  3FE5 A;  1AR7 2;  5IW0 A;  3HN1 A;  3OUI A;  4F83 A;  2VE1 A;  1WA4 A;  3VBF C;  3MLJ A;  1JH5 A;  2JDZ A;  2VNR A;  4MZU A;  4QD2 A;  4QHO A;  2QBX A;  2RS5 1;  3E5X A;  3DYM A;  4CDX A;  1KS4 A;  2ZKL A;  4IL7 A;  1H9P A;  4CXX A;  2CAV A;  4JRL A;  3W58 A;  5DDJ 3;  3ZO0 B;  4WZC A;  5IYY A;  2IXI A;  4M4P A;  1RUJ 3;  4HL0 A;  1A8D A;  2XWB B;  1W2A X;  3DKW A;  1MS5 A;  1D2Q A;  1W0P A;  2ZBJ A;  5DAW A;  1UYX A;  2VME A;  5F7U A;  1IPJ A;  4DEQ A;  3ZYJ B;  1AYM 3;  4R9A A;  4IEY A;  4E2G A;  3ZXK A;  4CP0 A;  2WAA A;  3M3E A;  3IDA A;  1W8H A;  4XF0 A;  2TEP A;  3T4V A;  1PGL 2;  4FSJ A;  5A33 B;  3NNG A;  4XFB A;  1W8O A;  5DUV A;  4AEK A;  3T0B A;  4IV1 A;  5J3U A;  1WW4 A;  1I5Z A;  1S0F A;  1RJ8 A;  2NYY A;  4DXT A;  4SLI A;  1FXZ A;  4GMP 3;  4AEJ A;  3FWE A;  3KMH A;  1TZO A;  5AVP A;  4DUW A;  4R8H A;  4XFA A;  3ST7 A;  3H8U A;  2XKO A;  4DS0 A;  2ZCW A;  4R52 A;  1I6X A;  3HT2 A;  1GP6 A;  2XBO 3;  3HN3 A;  3WV6 A;  2VBB A;  3IWZ A;  1LHU A;  4LO6 B;  2J1T A;  2QQU A;  1OPM A;  4XBN A;  1CAU B;  4K6B A;  1VPH A;  3U1X A;  1LRH A;  3E6C C;  2XWJ B;  4KWL A;  3ZFG B;  4RQP C;  2Y6K A;  1RTV A;  2ZA9 A;  3VN4 A;  1N1V A;  1W6Q A;  2VGD A;  4YW1 A;  1NCQ A;  4YVW C;  1XE7 A;  3PJY A;  4IE6 A;  2HWE 2;  1ZRI A;  1OVP A;  4XQW A;  5JIU A;  4K8F A;  1PVC 2;  4PF1 A;  3MID A;  5FPU A;  4Z2W A;  1W99 A;  4RS5 B;  4AI0 A;  2HWF 2;  4UF0 B;  2HH9 A;  4M0N A;  5FMD A;  5JI9 A;  1CJD A;  1PO2 1;  4NHY A;  5FLJ A;  4CEW B;  4FBF A;  2FDH A;  3HBK A;  3IDE A;  3MI8 A;  3VKL A;  1V6L A;  4EN0 A;  3WD5 A;  4AI1 A;  5DZF A;  4Q0U A;  2XJS A;  2ZGK A;  2GH2 A;  1GWM A;  2XQR A;  1Q3E A;  4JGY A;  3VDA A;  2X53 S;  3TN9 1;  1HDK A;  1X7N A;  5A7W B;  4JGZ A;  4XEZ A;  1J58 A;  1LGB A;  2YRO A;  1HN1 A;  5FPA A;  1Y9Q A;  2DU1 A;  3I97 A;  1PM7 A;  2FDF A;  1OUS A;  2UUR A;  3W5N A;  1IHM A;  3IDC B;  4LK7 A;  5FYH A;  3KT4 A;  1JYC A;  5FZ9 A;  5FZI A;  1MS1 A;  3T09 A;  3USU A;  2EVX A;  2HEW F;  2Q1F A;  4QXC A;  3PIG A;  5F2W A;  2V72 A;  1AF9 A;  4S2H A;  1AHS A;  5A3O A;  4CDX C;  1CON A;  2XJU A;  3WNP A;  2FDJ A;  5FZO B;  2X05 A;  4Y1Y A;  4P9Y A;  2C5D A;  3IBM A;  4QGM A;  3SIS A;  4BZ4 A;  1SBE A;  2ORZ A;  1XQN A;  1KFU L;  1RUE 2;  5DAB A;  4N8M A;  4FP3 A;  1AYN 1;  4OMC A;  3NNJ A;  5G04 L;  1GFF 2;  2WFF 3;  3SCG A;  4YVS B;  2CTV A;  4P02 B;  1MQT A;  1YQ2 A;  4OCT A;  3SCF A;  1COV 2;  1RGS A;  1TME 3;  3I3Q A;  4MGS A;  1W8N A;  4TSV A;  4YM0 A;  5A1A A;  1JTZ X;  1RUF 1;  5C6C A;  4P5H A;  1SFP A;  1CAX A;  1VE0 A;  2BFU L;  2X29 A;  1NE4 A;  5LK5 A;  4DXR A;  4P08 A;  1UL9 A;  1ZRR A;  2QDN A;  4FAH A;  5A70 A;  4IV1 C;  1EPZ A;  5FLI A;  5LAS A;  4NAM A;  2PMW B;  3WNK A;  4AAP A;  4COW A;  3N4M A;  4NHK A;  1C3H A;  1OQD A;  3WCS A;  3WF1 A;  4Z8B A;  4FFF A;  5FWJ A;  1WBF A;  3TEZ A;  4IE0 A;  2JJ6 A;  1JYX A;  1W2N A;  3AMP A;  4D0Q A;  1S0E A;  3AXE A;  3MDP A;  4NWW A;  4YSF A;  3VBO B;  2KA3 A;  1VP6 A;  3AL6 A;  2WYF A;  4HN1 A;  5LZ6 A;  2DTY A;  4AE2 A;  3OUJ A;  3KGZ A;  3D4K A;  1RUH 2;  1EPW A;  1ZBA 2;  2ETE A;  3OEB A;  5LA2 A;  2VZS A;  1NCQ C;  2E53 A;  4FPK A;  4NN0 A;  2VAU A;  1ND2 A;  1W03 A;  3POF A;  1W3V A;  3LFM A;  3QLQ A;  1TMF 1;  4L9B A;  3H1M A;  4O7X A;  4YG3 A;  4HON A;  4AGV A;  1M06 G;  1F8V A;  1BBT 2;  1F4H A;  2Z5W A;  3GYD A;  3WF4 A;  3DUI A;  3PL0 A;  1GZW A;  1DLC A;  3UV9 A;  3Q8F A;  2VD7 A;  4EV0 A;  4NPM A;  4GMP 0;  3AKP A;  3GHM A;  3EHK A;  1VRH 1;  4TTG A;  4AG4 A;  2AR6 A;  2VXJ A;  3Q8B A;  4WM8 B;  4P9W A;  5BV6 A;  3R05 A;  1BLZ A;  1X33 A;  2YDE A;  1BHG A;  1GR3 A;  2ZGN A;  3JD7 3;  1I5P A;  1ULE A;  3NNF A;  1IKQ A;  2D3P A;  2GC0 A;  5D1I A;  5I0D A;  4XFI A;  1ZRD A;  5IT6 A;  1UMH A;  2F6B A;  4EWD A;  3VDC A;  1LR5 A;  3KHC A;  3I3E A;  1W6P B;  1ENR A;  2W1Q A;  4K8R B;  1TE1 B;  5ANN A;  2JG8 C;  3Q8A A;  4QPI A;  1JMU B;  5FY5 A;  4BQ4 A;  3BKZ A;  1SLT A;  2XKP A;  5ANQ A;  5K0U A;  4XFH A;  1NKG A;  4FPJ A;  2Q8E A;  5TSW A;  1W8Z A;  2JDM A;  2UYA A;  3R0R A;  4Y22 A;  4Q4V 2;  4BCU A;  3RZG A;  1AR9 3;  5LA0 A;  1RHI 3;  4GZ9 A;  3U37 A;  2BTV C;  2Y6G A;  3CJI C;  3DPR B;  5EQU A;  2HYX A;  4DY3 A;  1ASJ 3;  1NA1 C;  3UES A;  1H2M A;  3WDU A;  2QKD A;  2ZGU A;  2V4V A;  2CU5 A;  2Q1M A;  1UYY A;  2VQA A;  2Y34 A;  3LIG A;  3ZXG A;  4JVA A;  4RD7 A;  1Y7B A;  2F4L A;  2VMD A;  3VBU B;  3WW1 A;  1DFQ A;  2WZP P;  1YJK A;  5JSO A;  1MZ5 A;  5CYY A;  3HAG A;  1O4Y A;  5T52 A;  1HB1 A;  4HVR A; 
#chains in the Genus database with same CATH homology
 2C24 A;  1WMX A;  4BQ2 A;  2JWP A;  4LK7 A;  3ZYH A;  1OH3 A;  3ORJ A;  5D21 A;  3UT0 A;  1W8Z A;  1W9F A;  4YWA A;  2O14 A;  2Q1F A;  1W8T A;  1W8W A;  4LKD A;  4YW6 A;  4BQ3 A;  4LKF A;  4AL9 A;  4CPB D;  4A6S A;  1GWK A;  4LJH A;  2KR2 A;  2VXJ A;  4CP9 A;  4CP9 B;  3ZYF A;  4CPB A;  2LRP A;  1W90 A;  1L7L A;  1HN0 A;  3ZYB A;  1OKO A;  1V0A A;  1GWM A;  2WYF A;  1WCU A;  3F95 A;  4LK6 A;  4BQ5 A;  2LRO A;  1UOJ A;  4BQ4 A;  1WZX A;  1W8U A;  1GWL A;  4LKE A;  4YW7 A;  2K46 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...