1OH3A

E78r mutant of a carbohydrate binding module family 29
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
141
structure length
141
Chain Sequence
RATYTVIFKNASGLPNGYDNWGWGCTLSYYGGAMIINPQEGKYGAVSLKRNSGSFRGGSLRFDMKNEGKVKILVRNSEADEKFEVETISPSDEYVTYILDVDFDLPFDRIDFQDAPGNGDRIWIKNLVHSTGSADDFVDPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ligand-Mediated Dimerization of a Carbohydrate -Binding Module Reveals a Novel Mechanism for Protein-Carbohydrate Recognition
pubmed doi rcsb
source organism Piromyces equi
molecule tags Carbohydrate binding domain
molecule keywords NON-CATALYTIC PROTEIN 1
total genus 32
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-05-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 1oh3A00
2KR2A 2O14A 2Q1FA 4LK6A 3UT0A 1V0AA 1W90A 1W8TA 1W9FA 2K46A 2VXJA 1GWLA 4CP9A 4LKDA 1OKOA 1W8ZA 1HN0A 2WYFA 4YW7A 4A6SA 4CP9B 1GWMA 4YWAA 4AL9A 2LRPA 1WMXA 1WCUA 3ZYFA 4BQ2A 4BQ5A 4CPBA 1L7LA 3ZYBA 1GWKA 3F95A 1WZXA 2C24A 4BQ3A 4LKFA 4BQ4A 1OH3A 4LJHA 3ORJA 2LROA 4YW6A 4LKEA 1UOJA 1W8WA 5D21A 2JWPA 3ZYHA 4LK7A 1W8UA 4CPBD
chains in the Genus database with same CATH superfamily
1KS4A 2OX0A 2DCTA 4YW1A 4LLOA 1XPWA 1O3SA 3DF0A 3AP9A 2C26A 2JICA 4I09A 3OBZA 5FPLA 4AEKA 3HNYM 2JE9A 2DU1A 3K77A 1W8FA 1UU4A 1OC1A 4IEOA 5K0UA 3LEKA 3DUIA 4FP3A 5FZDA 5JLVA 4O65A 2P3YA 1RUF2 4AF9A 3VD9A 4YVWA 4LJHA 5LATA 1HB4A 2Y38A 5BNPC 4XAAA 2Y6HA 1V6NA 5FMOL 1FMD1 4NAMA 3R6SA 4XFBA 4Q4V2 1WUVA 2ZX2A 1GOGA 2QE3A 4LOTA 1EAH1 2ZPXA 4HBNA 4IUGA 2FMDA 2P17A 2W2IA 2A73B 2PHUA 2BNMA 3LEMA 4N8MA 1XNTA 1VBD3 4RHV1 4XDOA 2D6OX 2ZMNA 4XUOA 4A7YA 1HB3A 1G9BA 2FDKA 4CUBA 5T5LA 5FZOB 4CDQA 1KFUL 3DKQA 2PHLA 1QJY1 2ZX4A 2XJQA 3GALA 5HV4A 5I0SA 4CE8A 2JKBA 1W6OB 2P6HA 5FYSA 3ZN4A 2UY8A 2Q30A 3WW1A 3IN9A 5H9QA 1WCDJ 4BXFA 2AEZA 1RUOA 1E5HA 2IFRA 1HQNA 3MICA 4IEPA 5FAXA 3B3QE 3GDBA 1HV0A 4GULA 4QMAA 1R091 4FQ4A 3U11A 4B4PA 4Q8KA 1CAXA 4XZPA 4G3YC 5I0RA 1YI9A 1YUDA 1H2NA 1W3XA 5FUIA 1XU1A 1QIQA 3USSA 1ULGA 5A7NA 2RMU3 4QB6A 2RM21 4Y4RA 3ZIXA 1QJFA 5HPOA 3KV5A 2V4VA 5LEJA 5I0TA 2HLEA 1SBEA 2SBAA 5C70A 2VBPA 1RUC2 4D3WA 2XJPA 3R05A 1JN2P 4JHTA 4O9EA 4UT5A 3OB8A 4ZU7A 3VDDC 3B9IA 2PXJA 4YGBA 4AI8A 3VBUB 3HAGA 5HCBA 4AGVA 1HX6A 4QKDA 3POBA 3THDA 2B45X 3L9JT 5HCFA 3VHPA 3WDUA 3RJRA 3RQ0A 4CDUA 2YMZA 5ACA3 5E8AA 4GH4C 4N43C 1H6XA 1SLLA 2XJSA 2PHFA 5FRAA 2BYVE 2Q1MA 2VUDA 3ZYRA 1JS9A 3NL1A 2WFF3 5FTTC 4AEDB 4E4SA 4DPNA 2QQVA 1ACCA 1STMA 2VTXA 2VY0A 1CZTA 2HWD2 2WUHA 3MV11 4XJAA 5T50A 4XFAA 4BISA 3FJSA 3BKZA 2VQAA 4AI3A 2KD7A 2PHRA 4GWNA 2X5IC 4K8RB 3RZJA 2B9VA 1QNYA 2GN7A 3OUJA 4CEWA 1BMV2 2DCYA 4XJZA 2E32A 3OEBA 2GC0A 2VZVA 4QPIC 4QAWA 4WZFA 2DUOA 1JHNA 1W6NB 3FUQA 4PHZA 5KXDA 3M3IA 1JMUB 4XQWA 3OD0A 4B4RA 1V6IA 3ROUA 3OGGA 5DUXA 5JSOA 4NIAA 2IXLA 1HIXA 3GZEA 2R49A 4XF4A 3AKPA 1ND2A 1RUI3 5FZ0A 3S6PA 4RGAA 3WDVA 2YBKA 3ACHA 4V2VA 5J96B 3LSDA 5JDBA 3VHOA 2ZABA 4NWWA 2A6VA 1RXFA 3JD73 4YGCA 2D44A 4EROA 4YZ1A 2VH9A 2WSUA 2I2SA 2Y6FA 2I07B 1CQ9A 1MS9A 2XONA 3CJIB 4XXPA 5LA9A 4AFAA 4H14A 3JQXA 2O1QA 1IG3A 4MVTA 5I8SA 4OI0A 5AC93 1HLCA 3EMRA 5FOJB 4DIQA 2VZRA 3QLQA 5F3IA 1VBC1 4AI1A 3H9AA 3RMXA 5T5PA 3DGTA 2WAOA 4EWAA 1NY71 4DXSA 2JE7A 1ZREA 1AR71 3SXWA 1VB4A 3WCSA 3QD6A 4P5HA 2ZOEB 4KQ7A 4IQPA 2UWBA 4LK7A 5DUWA 2BWCA 2F17A 4YM3A 5C8CA 1MEC2 4A7ZA 3A21A 3P1IA 4CEWB 1YQCA 1CX4A 1GANA 2QQMA 4FO9A 4MGQA 4B1MA 3T1MA 5JWPA 3C7FA 4LORA 1RHI1 3KSCA 3A23A 5CG9A 1TE1B 4HXCA 4M0NA 1S0FA 5A3UA 3ATGA 3B7MA 3E6CC 3LOBA 3KVAA 4GB33 1QKQA 3USUA 2BBVA 5FO7B 2DUQA 2PN5A 3K46A 1OUSA 2A1XA 4OFGA 5A80A 4M3CB 5IK7A 1KS5A 4PBPA 4F7ZA 2J1VA 4AQ6A 3LA7A 2X8KA 5H9PA 1I3HA 2Z2SB 3UGGA 2VJXA 3CJIA 3RWNA 2FHRA 2VZTA 2VW1A 3AMHA 1K5JA 2VGDA 3RZGA 1QXPA 4FFHA 5FY7A 2RE9A 1Q3EA 5BNOC 4PBOA 4AGRA 1DQ5A 2VOKA 1UOFA 3ACGA 3K4DA 5E6HA 3WNPA 4QB1A 1PGW2 1C8M2 3EYPA 1POV3 1W6MA 2DTWA 4I0AA 2ZMKA 1OI6A 3A4UA 3FMGA 4RGKA 2VE1A 1PZ8A 1TME3 2WN2A 5EJ1B 3VBFB 2GC1A 1US3A 2ZGSA 5GZGA 5B2GB 4D7YA 3M70A 1W9YA 1OFSA 3FFZA 5C8CB 1F31A 1L3JA 5CKQA 4QT6A 5A3WA 1ZRCA 4E27A 4D6QA 1ND3C 2VO5A 1VBB2 2QKDA 4UW6A 3KQRA 4HT1T 1AR92 1DYPA 2WO1A 2B4KA 1ZA7A 2X10A 2ZHNA 4RN5A 3EB7A 3N7KA 1DQ6A 2WS93 1UX7A 3M4FA 1DQ1A 5J98B 4AVSA 5FZ3A 4Y4YA 3USUB 4META 2VW0A 3W20A 1UU6A 1HRI1 2UY9A 1PZ9A 5F6KA 3WF1A 4O61A 4JGZA 3TWIA 1G9AA 3BALA 1LECA 3O1OA 1AHSA 3OUIA 3JB4C 4KI5M 4LOSA 3J7LA 1SACA 4RQPA 1DLLA 1PVC1 1DLCA 2WRAA 2BGCA 3LAGA 4MHRA 3HBZA 5EPAA 4B8EA 3RYRA 1YIFA 2BW8A 4AFDA 2Y34A 2VQUA 4ARYA 2Y33A 1J1LA 2QDNA 3HBKA 1VBC2 1XE7A 4QHBA 5LRSA 1AL22 4OI1A 3ZR5A 4IERA 4Q4Y3 1NYWA 1B09A 2UURA 4N53C 1AR72 1US2A 2EIGA 2ZCWA 4Q0VA 3T08A 3KT4A 2GH2A 3RSJA 3ZR6A 2DCKA 3W9AA 2RS33 1C28A 4U2AA 1QQP3 1SQ4A 1ENXA 1FX5A 1W2NA 3W59A 4JGYA 5LEKA 5CEHA 1WD4A 2XBO1 3L2YA 4HANA 3O1SA 5T54A 3ZOIA 3O1TA 1C3HA 1IKPA 1GWKA 1TZOA 2ZX0A 1XE8A 4QGNA 5C9AA 1UY1A 2JG9C 1ZRRA 2OUJA 5C3OA 3I3MA 4R9AA 1RUJ3 4NO4A 4QXBA 2DDUA 5IVBA 4QPWA 3MF9A 4UOJA 4QU2A 3VD7A 2D40A 4NN0A 4RFRB 4FOYA 4Z2AA 1O5LA 3FX3A 3V0BB 1S1AA 3ZXKA 3APBA 2IXIA 2C1FA 2VULA 4D7TA 3ZX7A 1X9TA 2P3JA 4IESA 5BYNA 1HKDA 1OFNA 4JGYB 1QJX3 1RUF1 1J58A 2MPFA 4AL9A 2RS12 1S0EA 2CDPA 1PX4A 2PMWB 5H9SA 3VBRA 1UIJA 4Y5Z0 1PGW1 4Q4V1 4RSUA 3WP5A 4BLJA 1PIV1 3HPNA 3EO6A 5DAPA 2LALA 4A42A 1I1EA 2W0XA 1OQ1A 3I3QA 1C5IA 1DZTA 1YFWA 3AFGA 2QQOA 4LULA 5EXOA 5FMCA 4CDWA 3OEAA 2WJSA 2IZWA 2BERA 4YW4A 1C1FA 1QJY2 2XVGA 5BNOA 1RITA 1TME2 3POFA 5BPXA 1Y9QA 1S2BA 4Q0SA 1MQTC 4HKLA 2YHJA 3UKTA 4QQOA 5C71A 2A70A 2HWC1 2ZGRA 3GYDA 3ZSJA 4UAPA 2ET1A 5JMCA 4AHWA 2JDZA 3KCXA 1WW4A 3NV2A 1KDMA 3DECA 3IB3A 4GMP1 1PNGA 5A70A 4YGEA 5F9TA 3POSA 4PDWA 2IXJA 1OSGA 3DPRB 2RHPA 4HN0A 1W8WA 4ASLA 2PHWA 3KQ4B 1MZ5A 1N1YA 1AJKA 2BTVC 2H6CA 5A6QA 5ANQA 2GAUA 5J1XA 2BFUS 3ZXFA 1MEC3 3WW3A 2XQRA 3NJVA 5FZFA 1CVNA 1SPPB 1EAH3 2WNVC 3F2ZA 4R52A 3CZUA 2ZEZA 3ASIA 4FVVA 1TMF3 4I02A 5D1IA 2P37A 3IDCB 1LCLA 4FP2A 3I2GA 4H2AA 5JXGA 4UFMA 1LGBA 2YY1A 5F1RA 3FLTA 4RQPC 2IFWA 3T3YA 3CBNA 4XHBA 4LBMA 1IG0A 1AL23 2JD4A 4XQ4A 1HJGA 4LIVA 5E89A 1QDOA 2EIDA 2BFUL 3O1VA 5CFCB 3IMMA 3AP6A 1PVXA 3VZJA 3FN9A 1V0AA 4QQHA 2YROA 2N7GA 1YIPA 3LD8A 4ONUA 1JZ8A 2ATFA 1NXD1 1DGRA 1VIWB 2QCSB 3H8UA 1H8VA 3VBOB 5HI0A 5L9VA 3K4ZA 4XDPA 4I3GA 1UWWA 2GNDA 2A3XA 3E97A 1CX1A 4QX3A 4Q27A 5JXJA 2VPVA 5DABA 4EN7B 3BN6A 1ZBE1 3V0AA 2IXHA 2DVGA 3K2OA 3LOIA 1PK6C 3M3OA 2C6SA 3VZNA 2WABA 5A1AA 4UBHA 2ENRA 4XJ9A 2PAMA 3ZXAC 3ZXLA 4QQLA 4XUTA 2WZPP 4WVWA 3PUAA 4YM1A 2W95A 3POGA 4TWTA 4E9KA 2YPJA 5FZAA 5CFCA 1I5ZA 4ES9A 3CJXA 4LUMA 1PMJX 5JOXA 4BYYA 1SBFA 3BOWA 4NPMA 2UU8A 3KT7A 2JDAA 3BIEA 1O8SA 5CU1A 3WG4A 5FYHA 3AKTA 1XYOA 5FUNA 3M7AA 1G7YA 1F5JA 2VVFA 3J7MA 5C6CA 4YM0A 4BHPA 4GMP0 3S5QA 3V0AB 1S0BA 1EPWA 4ZXEA 2XG3A 4L99A 4MHUA 3LZZA 1COV3 3WP4A 3VBFC 1S0DA 1RL3A 4XQDA 3VD5A 2XJVA 3I7DA 1RUC3 2YV8A 3AXEA 4LQRA 4YG0A 1RUD2 2LS6A 2JIGA 3VHNA 3AZWA 1POV0 2P3KA 4HSJA 1NE6A 2P1BA 2VZUA 3PDQA 1V6LA 1CR7A 4AI2A 1MS5A 2BUKA 1XYNA 4RA0A 1YEWA 3M3EA 3TEWA 1I6XA 1W8TA 5FBZA 2IVIB 3ES4A 5FZOA 2E31A 4RYDA 3ETQA 4CDQB 3NVCA 1D2QA 1XSRA 4FPEA 5EP9A 2WC2A 1BBT3 1VBE3 1OLRA 3BTAA 2RS32 2WBKA 4DQAA 5KHHA 3MO4A 5KWRA 1D0HA 1DGRN 1N1VA 5E88A 1QDCA 5F32A 3ILNA 2DBNA 4KMQA 3KGLA 5DAVA 1MZEA 3I3DA 1I5PA 1SEFA 2AUYA 2GH8A 4OVEA 5JOWA 2J42A 3DEMA 5FQ0B 1K5MC 2HEVF 3O1RA 5BNQA 2NN8A 4RS5B 3WNNA 4EN9B 3CF6E 1MZ6A 2ZEXA 3VBOC 4RR3C 4X8NA 1C8M1 5I0DA 2QNKA 4EN8B 5FYVA 1ODNA 2D6MA 5F2SA 2ZGMA 3AJYA 4ZY9A 2W5FA 4EWEA 2WNVA 5FP4A 1Q8SA 2JDYA 1O4TA 3DCQA 4TLFA 3VKFC 3P3NA 3C7OA 3KT1A 4BQ2A 1RHI3 3H8OA 3WD5A 1TQ5A 3WV6A 2J1UA 5EFUA 1AR91 1BKZA 1TG7A 3J26N 4RS5A 2E7AA 1Y43B 1NCQC 3MIFA 2XGXA 3GZTB 1GLHA 1BVP1 1W9SA 3IBMA 3MIBA 4HN1A 3WP6A 3ZYPA 5BNNC 1MS1A 5CB7A 2JDHA 3NAPA 4H3WA 2DFBA 4PT6A 1SLCA 4MLOA 5IVCA 4CTEA 3VKNA 4OQ8A 3O1UA 2WIIB 4DOUA 5DAWA 5CKNA 1PIV2 4KBBA 4WM8B 3UGHA 4ZS3A 1LHNA 4CP2A 4AEMA 3S5AA 2PHXA 2NQYA 1UW8A 2H0VA 1PO12 4J1XA 5GZFA 1V9U1 1G9FA 2J1AA 3KM5A 3WNMA 2ZHLA 4RGGA 4AQ2A 2R063 2WZEA 4QWNA 4GB32 4XDQA 4NIGA 4NE9A 3RZHA 3TB0A 1ODMA 3BODA 3WQ1A 3D3AA 2WN3A 1LHVA 3CHXA 5A3OA 4CUAA 1GQHA 1OA4A 2YGLA 3T4HB 2GMEA 2EXHA 4I3PA 1IPSA 1WWYA 4H7LA 2PLV1 4FPGA 3MYXA 1FOD1 4LKDA 2WYFA 2R32A 1VBA1 3I97A 1NQDA 3RWKX 1W6NA 4JKLA 3JB8A 3SNMA 5DZEA 5CKMA 1UZVA 1YWKA 1CAUA 3RG0A 1MVQA 3CKHA 5C8WA 5KHJA 2YGMA 3ZFGC 2C24A 3N3HA 5K7PA 3AZZA 2AACA 2ZJCA 4OHVA 1D4VB 4OMCA 5FUPA 2C9AA 1PO21 2VC9A 4JDNA 2WNUA 1UY4A 4K3UA 2W9XA 4OZOA 4IE7A 3GCXA 4AVCA 4IGOA 3WDTA 1L7QA 5FO8B 1ZBA3 2E9QA 5FOBB 1O3TA 2DFCA 4XMIA 1XC6A 3WR0A 3ILFA 4LT5A 2FDIA 5ANNA 1BLZA 3T0BA 1SFPA 4K8FA 3PUSA 2BNNA 1OD5A 1SLTA 4S2HA 3VDDA 4RQPB 3T2TA 4BQ4A 3SH4A 3AP5A 2FD8A 1N1SA 1K5MA 1N47A 1SLIA 1UN1A 3H0OA 1UOJA 5FYYA 4ARXA 1KFXL 1S0JA 3U75A 1H2KA 2JWPA 3HN3A 3IDAA 4BK5A 4COVA 1JBCA 1WA4A 2QQPA 3MW4A 5FKBA 2HWE3 3RZLA 5JMOA 4TYSA 3O12A 1FPN3 1NCRA 4F83A 4AVBA 5AC91 4HETA 5FIXA 5FZBA 5CVRA 1VE0A 2Q8OA 3GM8A 2BWAA 3NV3A 3D0SA 4TXWA 5FZ1A 5GZEA 1JYIA 1F8VA 2W08A 4CYDA 3RMYA 2QQWA 1GQPA 1BZWA 3VBHB 3J8F3 1W0PA 1HW5A 5GM0A 1NE4A 2WINB 3JUUA 2XLAA 4CVUA 1ZVFA 3JBG1 4K1ZA 5C9AB 3OG2A 1NLQA 1VRH3 5JOYA 1IHMA 3DL3A 4AVAA 1RUJ2 3LB9A 4BDVB 2Y0IA 1T6BX 3JCIA 2XKPA 3AFKA 4AEDC 5ISLA 2VMHA 2RMU1 3H50A 4I30A 2P5BA 5L7OC 3N36A 3MZHA 2D3SA 2PTMA 3D6EA 4NIDA 1EUTA 3PU8A 1ZZ9A 4DO0A 2RDQA 5FY9A 3T0DA 4OZXA 4MXVA 1V00A 4YWAA 5A3NA 1EYBA 3NV4A 3W5MA 3MFAA 1O4YA 1AR61 1PO23 1XNBA 3OYWB 5CIRA 1RIRA 2XWBB 1UF2C 4AWDA 5GZCA 1A34A 4J25A 3E5QA 2CAVA 3O14A 4LUKA 1JI6A 1MACA 3DV8A 3OJBA 2WZ8A 1LOCA 1H2MA 3I54A 2JKXA 4URAA 4DRRA 1J84A 1G86A 3AYEA 2BGPA 4GMP3 2VZSA 2GNMA 2YBPA 1GZ9A 1QGLA 3O5SA 3MLJA 3ZN6B 1RVF1 5J37A 3OY8B 5F5IA 3FZ3A 4HVRA 2WA3A 4ZXKA 3VBHA 2Y64A 1CZVA 1WBFA 2DBIA 3MUY1 4UW3A 5DZFA 2ARXA 1AXKA 5H9RA 1F4AA 4Q1RA 4SLIA 3S0MA 2XMLA 1V6KA 5A33B 5CAZA 4CXYA 3CIHA 1UZZA 4FPCA 1ENQA 3KF3A 1AXYA 3DXUA 4C0BA 3N7LA 1L7LA 3H8XA 3A22A 4Q4Y2 1PHMA 3WDYA 4LKFA 4DB5A 1PX3A 1WMFA 3OUHA 2VZ3A 1QJU1 4AW7A 3C7HA 2B5HA 1IKQA 1YQ2A 3V0BA 5FP8A 2H6BA 3WF3A 1W8OA 3PU3A 4K21A 3N9OA 4QPYA 3CJIC 1ZBA2 2VU9A 2BP6A 3N35A 4NOTA 2WR9A 4JCKA 1JXNA 4G4FA 4XZUG 1JZ7A 2D6NA 3H7JA 4LA2A 4NHYA 4XVHA 4KL1A 5GJ6A 4ISQA 4M3CF 3VL8A 2BEOA 5IHRA 3WNKA 4HKOA 1AR81 1HB1A 4IE0A 4CCCA 3ZFEB 5D8AA 1SPPA 2EIEA 5C9AC 1EAH2 4Z82A 1G8WA 2XHNA 3INAA 4TTGA 2HWF1 1RC6A 4ZZ5A 3THTA 5DAXA 3N7MA 3RYKA 2QDRA 2WT2A 1LHWA 5J7MA 1EV13 2V5DA 3W5NA 5ABJA 4CRQA 5K4LA 5HXMA 1XBFA 1UX6A 1QJX2 2YB7A 1HXS2 4YARA 5GLVA 1AYM3 3PL0A 1X8MA 1NG0A 2QJVA 5A33A 4EE2A 4IE4A 5FXWA 4PF5A 5BNOB 2FBEA 1PO11 5DG2A 3PUHA 4A2UA 2EICA 3SCFA 4BB3A 1CWPA 2FQPA 3I8TA 2XVKA 3WCRA 3DXTA 2W47A 1KJLA 2G9ZA 1N3PA 5FZMA 3BIWE 2Y0OA 5DDJ3 3OPTA 2PHDA 2RMU2 4YG3A 2VMEA 1GKBA 2R041 3W21A 4BH9A 2E7TA 1RJ7A 2XDVA 4BQ5A 4UYBA 1XB9A 3C2UA 3T4VA 1W2UA 3IM0A 5DG1A 1TNRA 4AE2A 5IT6A 2EAAA 2W1WA 3A0NA 5T55A 1KEXA 4BZ4A 2PLV2 1RUE2 2O8QA 3WNLA 4IV3A 1SLBA 4KH9A 4P9GA 2C4XA 2DUPA 5LZ6A 1COV1 4Y5SA 2ZGUA 1ZX5A 3LA2A 2JG8A 4XFHA 2C5DA 1H1IA 1QXRA 3AMNA 4XIOA 4HVQA 1CPNA 3LDRA 4N53A 3ALQA 2W1UA 4Q4X2 3VGIA 2EXJA 1OUXA 2JDKA 4AVVA 2VQTA 1JYXA 5APAA 4XFGA 4Q4V3 4AOCA 5BY5A 1EUUA 2XVLA 4PDWB 3J7HA 1DDLA 1ZZ6A 2B9UA 1NXMA 1H6YA 1XNAA 2OQ7A 1LESA 2RV9A 3MW2A 3PUQA 4UI9L 2X53S 5FDBA 3WP3A 5EYYA 5FP7A 3JU9A 4V2WA 4Q1PA 3SC7X 1ONAA 1S2KA 3KS7A 4P14A 4XIKA 2VZPA 3CEWA 3NWKA 3FL7A 1JYNA 2VOWA 2VZQA 4L92A 4QM9A 1D4M2 4ZU5A 4YGDA 2YUEA 3PVNA 3QCWA 4NAOA 4XJWA 5F8PA 2AEYA 3X29B 1JZ4A 1BMV1 2QUOA 3HT1A 4DUWA 3H7YA 3VBUC 4N53B 1JTZX 2BQPA 4WVVA 3VV1A 1PK6B 2VUCA 2E6VA 3FHQA 1Y4WA 2WQ8A 3ABZA 4QPGB 5EIYB 3ZYGA 1R083 3VKOA 5LW9A 3WNOA 4LE3A 2JENA 3PIJA 4J1WA 1ND3A 1PVC3 4NROA 3WQBA 1LOFA 1REDA 5KXCA 1AX0A 2A3YA 1DBNA 2MEV1 2QQUA 3OPZA 1OH4A 3B94A 2IVJA 3PTRB 5EJ3A 3WDXA 1JZ6A 4XF9A 4W6XA 4F8AA 1AYM1 5C33A 3FWEA 5C3RA 1WZXA 1O6UA 3NJYA 2ZHMA 2PQSA 1HRI2 1OT5A 2X5IB 2WL1A 1MEC1 2CTVA 1GMMA 5FYCA 3KGZA 1GP6A 5CA6A 1WW7A 3SLIA 4NHLA 5A32B 1V9U3 3AM2A 4P00B 1M4WA 1J3PA 1AYN1 5CZKA 4CDUB 2I74A 4ZPIA 2XH6A 2EF6A 3OBTA 4ES8A 5FK7A 2VXJA 2MNGA 4JZRA 3JBG2 1W2AX 4GJZA 3UK9A 2AYHA 3S30A 4IXLA 2VM9A 2HWB3 1UL9A 5K0UC 3DKWA 4GXLA 4QXKA 2W46A 5FZCA 1QEXA 3HT2A 3LFMA 4MGZE 4UFHA 5HV0A 5J3UA 2FDGA 1EV12 4CPBA 2ZBJA 2OIIA 4HMZA 3FLPA 4D69A 1W05A 4Q4W3 5BNPA 5KC6A 1CPMA 5IATA 4XOGA 1RHI2 4FTBA 5T3NA 1H1MA 5EV7A 4BQ1A 1CAVB 1OA2A 1O91A 4IV1B 4AI0A 2B8MA 3K51A 1UYPA 2WWJA 5L19A 4EV0A 1AR62 1F35A 1LU1A 3N9MA 1MPXA 3HQXA 3NAPB 4P9WA 1YI7A 4IGPA 4AHYA 1COV2 1ZBE3 2D5FA 5IJRA 1ST8A 4R8HA 1H4GA 1JODA 3AB0A 1TMF2 5F37A 5E16A 5FPXA 2TBVA 3QOPA 2KM2A 2QZ3A 1UAIA 4OHYA 1GBGA 1C8NA 4CCMA 4CUGA 3MFCA 1PIV3 2VMIA 5BNPB 2A6ZA 3PMEA 4XHXA 3ZYBA 2PHTA 1UOBA 1ND2C 3ME2A 3ZIWA 4CCKA 2YPDA 4B7EA 2VMDA 4PLNA 4UW5A 1C57A 4UF0A 2D6PA 3UKNA 2WT0A 3O0VA 3K75B 3HOBA 2HBTA 5L9RA 1W6OA 5FKCA 4QXHA 1Y9GA 2JG8C 3S57A 3PURA 1UU5A 3ZPOA 1W90A 2WS92 2Y6GA 1W6QB 2JXAA 3ZXGA 3LFIA 1IS3A 2WZR2 1QWRA 1QY4A 1VR3A 2ZTNA 3IWZA 3MEPA 4KGQA 5DZGA 2Q8EA 2PFWA 4LO7A 4LEJA 4MGIE 2HWE1 1GZWA 1ZZ8A 3UV9A 3E1F1 3FHIB 1XJAA 2XJRA 1VB2A 3GNEA 5C4WA 1W2TA 5IW0A 4IEVA 1R1A3 2XLGA 4GA9A 5FCCA 3RYPA 4CDUC 1RMU3 3L2HA 3SEPA 1MS4A 4WM8C 5KBFA 4FOQA 4RR3A 2YU1A 4Q29A 2HWC2 3RZKA 2WNVB 1RUNA 1R082 5SV8A 5BUVA 1FATA 3MUZ1 3M2MA 4FXKB 3BB6A 1VRH1 1FNYA 1VRBA 2HYKA 3TEXA 2FCVA 2Z4FA 2XLFA 2DCJA 1GZWB 3LE0A 3N9PA 3Q9OA 2DV9A 2ARBA 2JE8A 1KGYA 3H3UA 2J1EA 4JX0A 2YC0A 4A6OA 5CG8A 4K6BA 3ZFEC 5KC5A 1FAYA 3POWA 1OXCA 4TSVA 5M0TA 2HEYF 4BIFA 3FBYA 3VBFA 3NV1A 3E5UA 2LM3A 4HLTA 3S7IA 3ZFFB 1W6QA 2R073 5JSPA 5F3GA 3K3OA 2YBSA 5CADA 2R042 2X09A 4CCEA 4QU1A 5FWEA 4Q26A 5ERLA 3NKTA 1QH6A 4HPKA 1GFF2 1YFUA 3ZFGB 2Y60A 3NNJA 4LITA 4JRAA 1AR93 2DVBA 3AKRA 4Q4Y1 2ZX1A 3ON7A 1OLMA 4LPLA 1GYKA 4DXRA 5IK5A 3POJA 2QQNA 5LK5A 2WKKA 4QKFA 4JQTA 2BV4A 4O9GA 3ZXJA 3UJOA 1LOAA 4N9HA 4S2DA 3ZFFA 1VPHA 1O4ZA 3J8F2 3LEIA 4F3JA 1VMJA 3BTXA 1VBD1 3TN93 4L8QA 2NPIA 4WVMA 4NRMA 2Q4SA 1ZM1A 3OBAA 4NHKA 1E5IA 2JG9B 3LKJA 2VMGA 4Y24A 4QPIB 2VL4A 4PI0A 3U1XA 3HQRA 1QJY3 2K46A 2RDSA 4MXWB 2GNTA 4KWUA 4QDSA 5J48A 2D43A 4AR2A 3BUCA 5TSWA 1VBC3 4JDMA 4M3CA 3ZVXA 4NJ4A 1A3KA 4CEYA 3AX4A 1RMU1 3IAPA 1IQDC 1YFYA 3UJQA 2VCMA 5FPUA 2Z42A 1Q8VA 1AZDA 2XHKA 3NNGA 2DURA 4MGTA 3UGFA 3FHAA 4X8PA 4UXAA 1XOYA 2OVUA 3I2KA 3SCHA 3VDBA 3TEYA 2G19A 3MGUA 1Q43A 1S0IA 3OF1A 4PI2A 2HBUA 1N3QA 1OPOA 4RS5C 4WVMB 1ASJ2 5FLHA 2W92A 3TAYA 4Y20B 4P9IA 3KCCA 3ZSLA 2HWF3 1XYPA 3RRDA 5F5AA 4MXWA 3WINE 4LK6A 5A7PA 3VUOA 5KXBA 1A6CA 4FTSA 1WW6A 1Z7S1 1GWLA 1W04A 4FOVA 2RR11 1W8ZA 4OLLA 1H8TC 1ENRA 4A6SA 3PIGA 4CU6A 4CXWA 4FTEA 1SBDA 2D7FA 1RUE1 4WM7C 5I93A 1JZ2A 3AP7A 1NZCA 3RVHA 2E7QA 1R092 2ZACA 4N7IA 5FREA 3GHMA 2R062 3MI8A 4AQSA 4AFCA 4LLFA 4XFFA 2W52A 5ACA1 3ZMNA 1RTVA 1A78A 4Y20A 1TNFA 1LGNA 4HVOA 2BGOA 4BA6A 1CJDA 1KXGA 3UL2A 1JYVA 2WDBA 4COZA 2P34A 4X6RB 3WY6A 5C3SA 2PAEA 4GKYA 1EV11 5JIUA 1DYOA 1LJ7A 3GCWA 4AI9A 1XXNA 2ZX3A 4BMBA 3MLLA 4OHXA 1UXXX 3GGLA 4KNCA 3U4XA 1ENSA 4W6WA 4QHZA 4UBGA 1LRHA 1KDKA 3ECQA 2AH2A 4YLZA 4S2GA 3KD4A 2AGSA 5GLZA 3U07A 3ZYFA 1ZRFA 1V6JA 4CCOA 5I91A 1YFXA 1N1TA 3O0XA 1FMD2 2OW4A 1OPMA 3IDEA 3KV6A 1DQ0A 1PGL2 3DYMA 2NM1A 3AYDA 4RHV2 4PLOA 3ZN6A 4ATEA 1RUG2 4JKKA 3DPRA 3I3BA 4HZFA 3B93A 3WUCA 3R4DB 1KITA 3FBMA 2CGPA 2HWD3 4QX1A 1YHFA 2ZKNA 3AJZA 1UZ0A 5JI9A 4YZ4A 4YVWC 3GF6A 1HQLA 3WX5A 1EP0A 2E63A 1QF3A 1OLME 5IAXA 4QX7A 2BOJA 2HKXA 5FPVA 3SITA 4EZ4A 1SCRA 2OS2A 2EVXA 3ACFA 4C0HA 4YG6A 4YZ2A 4YYOA 4I01A 5GKAC 3GBWA 5C3QA 4D0QA 4IEUA 1OHFA 3B01A 3H8RA 1LODA 4CDXA 1RUI2 3RJ2X 4NIIA 4B7KA 3WZ1A 3U37A 2IUWA 4HSLA 3THCA 4BQYA 1N3OA 1SG3A 4Y1UA 1P8JA 4R9DA 5JAXA 1W8HA 2PYTA 2WT1A 5IK8A 2RM22 2WO3A 3WG2A 1ASJ1 3WG3A 1U5YA 5JI7A 1OF4A 1UPIA 1DIWA 4MGSA 3VBRB 4BMEA 4LMFA 3LPGA 4Z8BA 2X29A 1NY72 5FZ7A 1LGCA 4CP9B 1JYWA 1ULFA 4MOAA 3HEIA 3GXUA 4P08A 4JKMA 4QQ2A 4XFIA 5G04L 1Z7S2 1U5IA 4MGKE 5FY1A 5CFDA 5I0UA 4YVSB 5EJZB 5B4NA 4MUVA 4X6QB 4AAXA 3UETA 3TEZA 1NKGA 1WGPA 3MV01 5ABJB 3ZDVA 1WCKA 4GWIA 1F5FA 4TN7A 1YO8A 2LROA 2ARAA 4IETA 1OOPB 1LENA 4P02B 2WQ4A 2A71A 2WYSA 4N7UA 5L36A 1CIYA 4XTPA 5L73A 2R16A 3ZSKA 2R30A 2D3RA 2UYBA 5L9BA 3WF2A 4XJUA 1UQXA 5L7OA 2R0HA 3LQCA 4NPRA 5FZLA 4IE6A 4XAEA 5CFDB 1ULPA 3AXDA 5GLTA 4XILA 3BTYA 3RS6A 5GLUA 4Z2WA 1JYCA 3IMNA 4ET7A 1W0NA 1IPKA 2JX9A 2QQKA 2VQ0A 3AC0A 1NLSA 5G05L 3VB9A 2HWB1 2Q1ZB 2A5ZA 2YDEA 3IDBB 5JR2A 2HWD1 4MH0E 1OOPA 3C8XA 4HFSA 1CN1A 1W03A 3ENRA 2JB8A 2OYZA 3HVDA 3GJAA 3FFQA 2AR6A 2NMOA 4FPKA 2X5IA 2QQIA 4Q4W1 5DDJ2 1DQ2A 3SKVA 1AR83 3MPPG 5JZGA 1HRI3 1UPSA 5FR3A 4XTMA 5L7OB 2K0GA 2EIBA 3ST7A 1X36A 4KU7A 1D0GA 4KG8A 4CCDA 1SHWB 1GP5A 3Q8AA 3J8F1 3NO8A 4LO5B 3WXPA 5JXIA 5LBBA 1W6PB 1ULDA 3NNLA 1UXZA 3N9LA 1RXGA 2ARCA 2J7MA 1MS3A 1QJEA 2TNFA 3JBG3 3LIGA 4LR4A 3ZXEA 4AHXA 1HJFA 4Y22A 1V6MA 2DU0A 5FYBA 4CCJA 3H3ZA 2LTNA 3GZUC 2ERFA 5AC92 2Z79A 3KCYA 4WZCA 4GWMA 3T1LA 2D3PA 2L9LA 4JGZC 1G6NA 2ZXQA 5EHDA 5A7QA 5F7UA 1VMFA 4BJ0A 2QVSB 1QH7A 3E6BA 2OZJA 3HMYA 3NQHA 1WLTA 1AJOA 4E4HA 1BVVA 2GSYA 4NMIA 1QHDA 4RFT0 5C5TA 1TVGA 1AR63 1O7FA 2BOIA 4M3CE 3G7DA 5LA0A 4YW7A 4LHLA 3CU7A 5DUUA 4CDWC 3GJBA 4FPJA 2XUMA 1W28A 3WG1A 3JQWA 5SV5A 2W68A 4GH4A 4N43A 3HNBM 3N7JA 2VECA 3POYA 4RD7A 3VBOA 4CP0A 1RUH3 4QHOA 4DMIA 2Q5TA 2ZGKA 1HXS3 1CONA 1S0CA 3IPVA 5LASA 1PVC2 5JOZA 4QKBA 3I2JA 1OVSA 1F4HA 4OQ9A 3I59B 1UZWA 1YXWA 3GBFA 4EJRA 2CAUA 3VZLA 3S7EA 1H0BA 2DF7A 3J9SA 4OHZA 4Q5OA 4HK9A 2VBDA 4QX8A 3VBSB 3VKLA 5JVVA 4IV1C 2VOVA 2GC2A 3LDKA 5FZ6A 1XNDA 2LUWA 2RVAA 4XC9A 1QOTA 1LULA 2G4IA 3PJYA 3NAPC 4NRPA 5EZWA 1VBB1 1MS8A 1ZZCA 2ZGNA 3B9CA 3F95A 4FPHA 1CAXB 1YQ8A 3ZKUA 4MYEA 1CAVA 5T52A 4I0WB 1NQJA 3TOJA 4ZONA 3BU0A 5LRRA 4FQZA 3VDAA 5LK7B 2HWB2 4CU8A 4PQQA 3VLBB 4K9SA 1WCSA 3SH3A 1HQWA 3CMGA 1FPN2 3D0JA 4Q4W2 1J3QA 1EY2A 1SDDB 4BPZA 4BWOA 4GH4B 4N43B 5HXVA 3ZXDA 2NZ9A 2RS13 1SZBA 3URFA 4BIOA 2G9GA 1OLQA 4QX0A 3AYCA 4PIZA 3E6DA 4AG4A 1RUG1 3T2PA 2EALA 5FZEA 3IPVB 4CCLA 1ZBA1 4YW3A 5LY1A 1NUKA 4P9LA 2W3JA 2ILMA 4FSJA 1LTEA 2XL7A 1CAUB 5AVPA 4D6SA 4NHMA 1GOFA 1TME1 2H0BA 2JECA 1YQ5A 2WNOA 1Q8OA 1UO9A 1BBT1 4LBJA 2R072 4COWA 5JZGC 5FZ9A 5FP3A 4KGGA 1NA1A 3HJRA 3VBUA 2GP5A 3A7QA 5FQ0A 5FY8A 2FDFA 2JDNA 2R043 3P5BA 4MADA 3KB5A 4PJYA 5FXVA 3ZFGA 1RUI1 5FPBA 5DAQA 3ZDSA 1LOFC 1HXS1 4Q0UA 1F9KA 5HCHA 1AVBA 1AL21 4QDQA 1UYYA 2KA3A 3P6BA 3Q8FA 4LBLA 4TZDA 4CDQC 5AVAA 2YU2A 3SKJE 4CEWC 2CNAA 2E53A 4XE9A 1J3RA 5FMDA 4RR3B 3RGBA 4C8DA 5A7OA 3P3PA 3TNQA 3VZKA 4YPJA 1MZFA 1U0AA 5F3CA 4ZS2A 1CAWB 5FY0A 3ACLA 4LO4B 1HDKA 2MHFA 2C9KA 3ZMOA 4E4DX 1CGPA 4NRQA 4A3ZA 2G9FA 3AZXA 4NIHA 3H3LA 1T6GC 2JIJA 3T0AA 1R1A2 2JG9A 5K8SA 5C4WB 1JZ3A 4WBBA 1O59A 2XPJA 1BHGA 2BZDA 2XL9A 4IL7A 5IFPA 1HRV3 3BPSA 2NYYA 4XACA 3AZYA 2W1QA 2ZA9A 4INDA 4MG2A 1SCSA 2WWSA 3N9NA 4O7XA 4OUEA 4BM8A 1NCQB 5FZ4A 4CEYB 2VMCA 1VAVA 5A6XA 1QQP1 3PMSA 4YVSC 5I8YA 2E26A 1NA1B 3LIHA 4WM8A 4CP1A 4OYUA 1OH3A 2DVAA 2B46X 1NCRC 1L7RA 5F5QA 3IKWA 3IT8A 3IZOA 3NRUA 4N90A 3GZAA 2R7EB 5K9YA 2YFUA 5A6ZA 4OUMA 2VVDA 1A8DA 4HPKB 1ZBE2 3O1PA 4LKSA 2UWAA 1XRUA 2HJIA 2VXRA 5IK4A 4OI4A 3VDCA 5A3MA 5A1FA 2R0FA 2W39A 1W39A 3BCWA 2VNGA 1CD3G 1D2SA 1DCSA 1K3IA 2X05A 2CYFA 3C7EA 4XUPA 1ZZ7A 4P9XA 1S55A 2D6KA 1CAWA 3I2HA 2WNUB 4XBLA 1QJX1 1GNZA 1TEIA 5LA2A 2FCUA 1R093 1RJ8A 2FMYA 4A44A 4BCUA 3MW3A 1UCXA 3O7OA 4EN0A 5IVFA 1C4RA 1LR5A 5FV3A 2LW8A 1JOBA 4CCNA 2YYOA 1JHJA 1DZQA 4P9JA 4QPIA 4KU8A 3GHNA 3KLSA 4ZHNA 2FZ1A 1QJU3 4Y1YA 3ZM8A 4AK3A 2PA7A 4CSWA 2IXKA 4PF1A 1IOAA 1NCQA 3K4AA 5DUVA 1BYHA 3LPFA 4QM8A 3PVOA 2VTFA 4HL0A 4U36A 1UIKA 1QNWA 3H1WA 2EAKA 4OHWA 1B35C 2Y6JA 5GLWA 4A3XA 4H55A 1LKNA 4DEQA 1AX1A 1DGWX 4NUBA 5F2WA 3EHKA 1JU4A 4BU2A 3IAQA 3ILRA 1FT9A 4XEZA 1DP0A 5FFOC 1NAEA 2WFF1 3AK0A 4JGZB 2ORXA 5JPMB 1ULEA 4M4RA 1O5UA 3POEA 1X9PA 4K20A 4WVZA 3NJXA 1RUD1 1AX2A 3EBRA 2W94A 4BQWA 2FDHA 2B7YA 2OUHA 2JD9A 3UKVA 1YCIA 4CEYC 3LSEA 3OGJA 4LIUA 1QXJA 2JDUA 1IS4A 4ZZ8A 1ASJ3 1XU2A 2V73A 1LOBA 2VZOA 4GAZA 4J6GA 3LF7A 3M3CA 4XUNA 3ZFEA 1NCRB 1W8NA 4IE5A 4XABA 3I2DA 3PJQA 3K48A 1POQA 2V4AA 1GICA 2W91A 3NSTA 2YC4A 5DDJ1 3OSDA 2RS31 2VNVA 3I4IA 1XSQA 4KG0A 1OQEA 3AMMA 3HIFA 4FOWA 3TYJA 3KV9A 3MIDA 4I2OA 5HBAA 1D4M3 3JD71 4Y1VA 4CDXB 4UFLA 1UY0A 2EXKA 1OA3A 1WBLA 2BDRA 2YC2A 2Q1FA 1PM4A 3KZ4C 3Q8BA 5EWSA 5JXHA 1H8TA 3LDBA 4XF1A 3SCGA 3OOXA 3WEZA 4C90A 3RI8A 5AFEA 2VR4A 3CL1A 5IVEA 4SBVA 2WNUC 4YFZA 1AYM2 4XCBA 3RPQA 1V6OA 3KWVA 1H9PA 4HK8A 5JSRA 2Y6KA 1BK1A 2JJ6A 4R9BA 5FBJA 3VBSC 5FXZA 5EYXA 1MVEA 4HONA 4NPLA 2BBAA 2K9ZA 4MX3A 3AKQA 2WLPA 1VALA 5KHGA 1WLWA 2QTWB 4Q2FA 5B4XA 2VVEA 3U14A 3PVEA 1MQTB 4Y3OA 4Z07A 5JUVA 3B5LB 3HNMA 4XYXA 1GOHA 2AC1A 1JOJA 1RUE3 4M00A 4B4QA 3B69A 1FMD3 1O3RA 3H1MA 2DVDA 3I2FA 4GB31 1RYYA 5FYIA 1H30A 2WO7A 3VKMA 2WFPA 4IEZA 4OULA 2AENA 1YRZA 2V09A 4QKNA 4RHV3 1UYXA 4MGYE 5FZIA 4AZZA 5A6YA 5KR7A 1GP4A 4L9BA 3RZZA 3ZYJB 2Y6LA 4QPGC 3WQ7A 3WW4A 4LBQD 1H9WA 3KV4A 1F15A 4YM2A 4LTAA 2RJ2A 3OTFA 3ITQA 4MO3M 5BXXA 3QH6A 1A8MA 3OGSA 1LNSA 1OBNA 2RG4A 4LO8A 2DYCA 1UY3A 1UKRA 3AZVA 3M8LA 4BE3A 3LGRA 1RUH1 3H42B 4JAAA 3ZPYA 1OKQA 2O8OA 5FJKA 4UW4A 4LBNA 1G9DA 2A6XA 4OMDA 4S2FA 3U10A 2D93A 3QH7A 4KWJA 4IEYA 2YXSA 4R4XA 2XWJB 3T2QA 2F6BA 3UESA 5FYMA 1UYZA 1BQPA 4WM7A 4LBQB 1ND3B 1WLCA 1MQTA 3BOPA 1J83A 3JZVA 1VBA2 1W3VA 3TN91 3KHBA 4NHXA 2RM23 5F39A 3ORJA 1TMF1 1OF3A 2WS91 5D2AA 1FPN1 3DYPA 5IVYA 4D6RA 1PNFA 1JZ5A 4W6YA 4ATFA 5KHIA 5DPNA 5F5CA 4CP9A 1WLDA 2Z69A 1H4HA 3HD8B 1OVPA 4E2QA 3WHTA 3R4UA 2OA2A 5KHKA 2B42B 4XJ8A 1WMDA 3W58A 1W9FA 1DGWA 1JH5A 1E5SA 1NZIA 2ZZQA 2P2KA 4UFJA 1V9U2 4ZU4A 4WM7B 4LBQA 4BXSV 2YG0A 4UFIA 4RL7A 1YJKA 2OXBA 3C3VA 3MLKA 1W9TA 4YFWA 1DGLA 4C1WA 2QBXA 2ADDA 4EWDA 2D98A 1J59A 1C1LA 2WO2A 3TNPB 2ADEA 2JDPA 2ZZJA 4CA9A 2V5YA 2WZR1 1PO13 4LXLA 2W1SA 2GMMA 4JVAA 1REFA 1WD3A 2R1DA 3I2IA 3KMHA 4QGMA 4LNVA 1RINA 1RUG3 2KXLA 4AAPA 2J22A 2J1RA 2A3WA 1EPZA 2YZ4A 4FXGB 4OUSA 4YZ3A 3ZN5A 5FO9B 5LCWL 5LA1A 3B00A 1W0OA 3V64A 4EYUA 4IV3B 3MPBA 4FPYA 3I59A 2TUNA 1DZRA 4LHNA 1PM7A 2RS53 5FMBA 1KD7A 1X82A 1OURA 2JG8B 3NNFA 1AF9A 2K2SA 4QQPA 4W65A 4Y33A 1T2XA 3VL9A 2XJUA 5A7WB 4QGLA 4LBKA 2HYXA 3V56A 3VBSA 2BPA2 1QOSA 4FI9A 1Q5OA 1BJQA 5DN2A 2NMNA 1GQGA 3IIAA 4JQRA 2ZHKA 1RB8G 4DY5A 2D6LX 4Q0QA 1RVF3 5LBFA 2RR12 4YW6A 4FAHA 3I49A 3AP4A 1R1A1 4UF0B 3B02A 4CDWB 2GNBA 3ZYHA 3D8CA 4FPLA 5A7SA 5FJHA 4LA3A 2XBO2 2GP3A 2O14A 3CDZB 4Z92B 1RUF3 4UWDA 4YVWB 2ZKLA 2A6WA 4Y22B 3VD3A 4AYUA 5J09A 1IGOA 3LEGA 1Q8PA 1PO22 1I9RA 1QQP2 3LA3A 1ZYBA 4KWKA 3T09A 1GWMA 2V72A 4AFMA 2CY6A 5A32A 4L2NA 2XUEA 4FPOB 1VBD2 3MIEA 2DVFA 4QPGA 3ZSMA 3D5OA 2ZGTA 3HR9A 4PCRA 2Q8DA 5JIAA 5CYYA 1U12A 2VTXJ 3MIHA 1FXZA 3VZOA 1DYKA 4AEJA 3TN92 1AL0G 2Q8CA 2CV6A 5FLJA 1QJZA 2XXZA 3DYOA 4QX5A 4CPBD 2AREA 3SMHA 2MEV3 2VCCA 2A7AA 2WNEA 2GDFA 4COYA 2CHHA 1DG6A 2ZGLA 1OQDA 1OKOA 3ETPA 3T2OA 3I3EA 2ZGOA 3CQOA 2DCZA 4JRLA 1S0GA 4OI2A 3DPRC 3HQUA 4AHZA 3C7GA 1VJ2A 2IC1A 1X33A 2JDMA 4W4ZA 4A7KA 2EA7A 1REEA 3WLUA 5AFBA 2BVBA 5FK8A 1DHKB 2ZGPA 4GZ9A 2VUJA 1OMIA 1GZTA 2Y26A 1OOPC 4OCTA 1F2NA 1AR82 1LU2A 4GWJA 3GBGA 1UY2A 1WMEA 3OGRA 5C8CC 5FZKA 2WLQA 2IXCA 4CU7A 4XPVA 2B39A 4IV1A 1FYUA 3AMQA 1JU3A 4GD4A 4JDOA 5FP9A 5KXEA 5ACA2 3TBDA 3HN1A 3PHMA 4JTNA 1BEV1 1VLNA 4M0HA 1HRV2 3WOGA 5LBEA 4AEDA 3KHCA 1H1AA 5FPAA 2WFF2 2PQQA 1KJRA 3AL6A 3NW4A 4QX2A 1X50A 2RDNA 3CNAA 4DUVA 2OZ6A 2XQXA 2CWMA 1CESA 2ET7A 4XURA 4YNIA 3NMBA 5E1RA 4DY3A 3EQEA 1JUHA 4XMAA 2RS52 3CZJA 3NJZA 3AKSA 4FT8A 5DQ0A 1AXZA 2F4PA 2R061 4JV4A 4G9SB 4M01A 3KF5A 2O0OA 4A4AA 1FV3A 1O8PA 4N9IA 2OT7A 1ALYA 5FYUA 4ASKA 1W9WA 2WA4A 4P5YA 4Q0PA 1Q56A 1RUD3 1WCUA 1RVF2 1LB2A 2PLV3 3PLQA 1LAJA 1RUH2 3FC0A 1CIWA 2WSVA 3JD72 1VBA3 2P6CA 3JXSA 1Q8QA 4C1XA 2QQJA 2FCTA 4MSVA 4E8DA 5FYTA 3Q8EA 3BI3A 2HEWF 4K40A 2GN3A 4AVTA 1LOEA 4KBZA 4YW5A 3PNAA 2RS11 4L0PA 2GMPA 1NX9A 1VBE2 2D5HA 1E5RA 2UWCA 5A3LA 1QU0A 1O3QA 4Q4X3 2KR2A 1ND2B 2GU9A 3MBWA 4XXAA 2VNOA 4EZHA 4GIQA 1IZ3A 1QJU2 4H7MA 1PGL1 1PGSA 1IPJA 3BGAA 3M1HA 3ACIA 4QDRA 1YNAA 2HWF2 3PTYA 4IGQA 2XJTA 2XR4A 4Q8LA 1K12A 4FFGA 1DU3D 4DS0A 2G1MA 5IYYA 1GU3A 4I0BA 5FLIA 2RDRA 1ULCA 3LWCA 3VZMA 2OKXA 2VAUA 4V1PA 1SMVA 1AYN3 1UD1A 4XUQA 1RGSA 3UNPA 4IDZA 5I8TA 2XKOA 3BU7A 2QZ2A 2VNRA 5LBCA 4B3NA 1SLAA 5FY4A 1XNCA 3VN4A 3I2OA 4XCAA 1U5ZA 3M3QA 1UMHA 4PQ9A 1BEV3 4L97A 2CU5A 1ZA4A 1D4M1 3N4MA 5IAVA 1IS5A 5FWJA 1J1TA 1NOVA 3WW2A 1BK0A 3WF4A 2CL2A 3WSOA 4JTOA 2BVVA 1GZCA 2RJKA 4JGYC 1K5MB 2BNOA 3NNMA 4YW2A 1UKGA 3PVBB 3ZFFC 2ORZA 4Y1ZA 2QFEA 4D94A 4HOOA 3BYWA 3ZYIB 1UOGA 1AUYA 3WF0A 2NP0A 3Q8CA 3J4UH 4DUXA 5IVJA 3VBHC 2R1BA 2WQZC 2XB6C 3CO2A 4FAGA 1C8M3 4LHSA 5A1LA 2VOTA 1VMHA 3G6JB 2C0ZA 5DMYA 3WT3A 1NLRA 3H1YA 2OPWA 2VW2A 3SEEA 4URTA 4YSFA 1YLLA 5BV6A 3CLPA 3U4SA 3ZO0B 2ZGQA 2DTYA 1M06G 1GNHA 2JEMA 4IV3C 1PMHX 3ZSEA 1NT0A 4IW3A 3E5XA 5A3PA 5DXDA 2AZ5A 2CSGA 5GALA 1VBB3 2OQ6A 3N9QA 4E2SA 4Z1VA 2WAAA 4K1YA 3RDIA 2ZEYA 3OCPA 3MDPA 2UYAA 2LRPA 4UFKA 1DF0A 3EXUA 3POIA 1W6MB 4DXZA 2F4LA 3VBRC 3WQ0A 4R4ZA 2E33A 2P4EA 3U78A 1YQ6A 3DN7A 4Q4X1 4BQ3A 2XOMA 1FNZA 4AXOA 5C3PA 2EXIA 1UMZA 1PMIA 3D4KA 3OD4A 5IWFA 3SH5A 1FV2A 4E8CA 1ZNPA 4B29A 3UT0A 1S4CA 1W06A 1MS0A 2CGOA 3R4SA 4QB2A 1C5HA 3SQOA 3ZKYA 4DXTA 1G9CA 2MEV2 5CISA 3AMPA 4A45A 5CFCC 2RJLA 4MV2A 5EQUA 4FFFA 5IFTA 4Y5TA 4XW3A 5FXXA 2GC3A 5GZDA 4CDXC 4IEWA 1WMXA 5JCTA 2J1TA 3OPWA 5T5JA 4D7SA 3RI9A 1V70A 1BXHA 1AR73 4XF3A 2VCBA 4YVSA 1YC61 2VMFA 1Y3TA 3BVCA 4AQTA 4ASMB 5HCAA 1FI2A 2CDOA 3ES1A 1YYNA 1Z7S3 4QD2A 2R6QA 4DRVA 4D8MA 2VOXA 3LCPA 4DNYA 5C7GA 2OPKA 1H8TB 3WNXA 2FZ2A 2WZR3 1KRIA 1H2LA 5C4WC 3WHUA 4EN6B 4TLGA 1JW6A 1GUIA 1ZZBA 2PELA 4LO6B 1UNBA 2A75A 2ZAAA 5IUQA 2JB4A 1LOGA 3UYJA 1APNA 2FDJA 5C5UA 2ZEWA 1R1ZA 3OY8A 1AYN2 2ES3A 4AGGA 2R071 5F3EA 1R081 5FY5A 3VDDB 1UMIA 1ULOA 4IEQA 5FPZA 1NA1C 5FZGA 2HWE2 2A6YA 1FOD2 2CWSA 4M4PA 2HWC3 1VAKA 4R9CA 3MF6A 3OBRA 4GKXA 4LKEA 1LHUA 3QBQA 3OGVA 3HWJA 5LWBA 1RUC1 2ETEA 1HRV1 5D8AB 5JPNB 1K42A 1ZRDA 1CJPA 4LE4A 1D7PM 3WUDA 4DFSA 1VAMA 2P3IA 3R0RA 1GR3A 2Z5WA 2J1SA 3FE5A 1VRH2 2ZS6B 1X7NA 1W6PA 4Y26A 3A0KA 5CNAA 2RS51 2VUAA 3IIIA 3U0ZA 3FLRA 1XQNA 4GJYA 4COUA 1ZRIA 1E57A 1VP6A 4HKWA 4KWLA 4Y1XA 2TEPA 1Z78A 2IWGB 4BOWA 4CZSA 5J36A 2ID4A 4NVPA 3EJKA 1W99A 1LHOA 4E2GA 4E4ZA 1HB2A 5FZHA 3AVSA 1S2EA 5JR7B 4BLIA 4PDWC 3VD4A 2DWRA 1POV1 3AL5A 3VHRA 3FUOA 1URXA 4YRDA 1LEMA 1CZSA 5LY2A 4A41A 1IS6A 1R64A 3AVRA 2E51A 1B35B 2VCAA 3MHZA 3OYWA 4BQXA 1GV9A 2QQLA 5BNNA 4XBQA 2WWUA 4FCAA 1JOPA 4ITCA 4PLMA 1XNKA 4JHZA 4LHKA 5FMOS 4DZGA 3WVJA 1IQAA 3RZMA 1SFYA 1K45A 3PUIA 1BCXA 4JC1A 2I45A 2ZAHA 1HV1A 1DQ4A 1PZ7A 4DEVA 2VBBA 4QXCA 5D21A 1WA6X 1RMU2 3ZLIA 4FPFA 2RR13 4EQVA 3O1MA 1MR5A 4PIXA 2NLRA 4GALA 5A3TA 2CGNA 3RNSA 3RFRA 1BEV2 1HN1A 1WW5A 2VZ1A 2HH9A 2XBO3 4CUCA 5BNNB 1QOOA 3AYAA 4XF0A 1UZYA 5FYZA 4YZ5A 2BU9A 1BBT2 2Q0AA 2GZWA 1DFQA 1RUJ1 4W8JA 4FFIA 1OD3A 4MZUA 5F6LB 2BRTA 5LB6A 3K3NA 1W2OA 3V65A 4CU9A 4K7JA 3J7NA 3QACA 3D82A 4XETA 1PK6A 5D8AC 3BTZA 4W50A 5T5OA 3WDWA 2ZMLA 1SDWA 1GNYA 5K0UB 1X8EA 4ZKTB 3NKGA 1B35A 4AFBA 4IEXA 1W8UA 4BK4A 1SFNA 2PAKA 1Y7BA 5CBLA 4NWVA 4C91A 3BPZA 1U5XA 2SLIA 5ABJC 1XE0A 2GALA 4DINB 1WKYA 1JUIA 1HN0A 4XFCA 3KVBA 4LBOA 5A7WA 2YFZA 5JZGB 2VD7A 4FBFA 1KQRA 3MIGA 3ELNA 1QMJA 2BJSA 1FOD3 2Y8KA 4PIYA 1LEDA 2D97A 4HG6B 3O0WA 4ISRA 2W87A 2VG9A 4WV8A 1VBE1 3T30A 1Z0HA 3THPA 1WCQA 1Y9MA 4L11A 3SHRA 4B1LA 5CFDC 4XBNA 4GQ7A 4NR1A 4P9YA 3TRSB 5IVVA 5FZ8A 4ORFA 4CXXA 1YJLA 3SISA 1GSLA 1JYTA
chains in the Genus database with same CATH topology
2KR2A 2O14A 2Q1FA 4LK6A 3UT0A 1V0AA 1W90A 1W8TA 1W9FA 2K46A 2VXJA 1GWLA 4CP9A 4LKDA 1OKOA 1W8ZA 1HN0A 2WYFA 4YW7A 4A6SA 4CP9B 1GWMA 4YWAA 4AL9A 2LRPA 1WMXA 1WCUA 3ZYFA 4BQ2A 4BQ5A 4CPBA 1L7LA 3ZYBA 1GWKA 3F95A 1WZXA 2C24A 4BQ3A 4LKFA 4BQ4A 1OH3A 4LJHA 3ORJA 2LROA 4YW6A 4LKEA 1UOJA 1W8WA 5D21A 2JWPA 3ZYHA 4LK7A 1W8UA 4CPBD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KR2 A;  2O14 A;  2Q1F A;  4LK6 A;  3UT0 A;  1V0A A;  1W90 A;  1W8T A;  1W9F A;  2K46 A;  2VXJ A;  1GWL A;  4CP9 A;  4LKD A;  1OKO A;  1W8Z A;  1HN0 A;  2WYF A;  4YW7 A;  4A6S A;  4CP9 B;  1GWM A;  4YWA A;  4AL9 A;  2LRP A;  1WMX A;  1WCU A;  3ZYF A;  4BQ2 A;  4BQ5 A;  4CPB A;  1L7L A;  3ZYB A;  1GWK A;  3F95 A;  1WZX A;  2C24 A;  4BQ3 A;  4LKF A;  4BQ4 A;  1OH3 A;  4LJH A;  3ORJ A;  2LRO A;  4YW6 A;  4LKE A;  1UOJ A;  1W8W A;  5D21 A;  2JWP A;  3ZYH A;  4LK7 A;  1W8U A;  4CPB D; 
#chains in the Genus database with same CATH topology
 1KS4 A;  2OX0 A;  2DCT A;  4YW1 A;  4LLO A;  1XPW A;  1O3S A;  3DF0 A;  3AP9 A;  2C26 A;  2JIC A;  4I09 A;  3OBZ A;  5FPL A;  4AEK A;  3HNY M;  2JE9 A;  2DU1 A;  3K77 A;  1W8F A;  1UU4 A;  1OC1 A;  4IEO A;  5K0U A;  3LEK A;  3DUI A;  4FP3 A;  5FZD A;  5JLV A;  4O65 A;  2P3Y A;  1RUF 2;  4AF9 A;  3VD9 A;  4YVW A;  4LJH A;  5LAT A;  1HB4 A;  2Y38 A;  5BNP C;  4XAA A;  2Y6H A;  1V6N A;  5FMO L;  1FMD 1;  4NAM A;  3R6S A;  4XFB A;  4Q4V 2;  1WUV A;  2ZX2 A;  1GOG A;  2QE3 A;  4LOT A;  1EAH 1;  2ZPX A;  4HBN A;  4IUG A;  2FMD A;  2P17 A;  2W2I A;  2A73 B;  2PHU A;  2BNM A;  3LEM A;  4N8M A;  1XNT A;  1VBD 3;  4RHV 1;  4XDO A;  2D6O X;  2ZMN A;  4XUO A;  4A7Y A;  1HB3 A;  1G9B A;  2FDK A;  4CUB A;  5T5L A;  5FZO B;  4CDQ A;  1KFU L;  3DKQ A;  2PHL A;  1QJY 1;  2ZX4 A;  2XJQ A;  3GAL A;  5HV4 A;  5I0S A;  4CE8 A;  2JKB A;  1W6O B;  2P6H A;  5FYS A;  3ZN4 A;  2UY8 A;  2Q30 A;  3WW1 A;  3IN9 A;  5H9Q A;  1WCD J;  4BXF A;  2AEZ A;  1RUO A;  1E5H A;  2IFR A;  1HQN A;  3MIC A;  4IEP A;  5FAX A;  3B3Q E;  3GDB A;  1HV0 A;  4GUL A;  4QMA A;  1R09 1;  4FQ4 A;  3U11 A;  4B4P A;  4Q8K A;  1CAX A;  4XZP A;  4G3Y C;  5I0R A;  1YI9 A;  1YUD A;  1H2N A;  1W3X A;  5FUI A;  1XU1 A;  1QIQ A;  3USS A;  1ULG A;  5A7N A;  2RMU 3;  4QB6 A;  2RM2 1;  4Y4R A;  3ZIX A;  1QJF A;  5HPO A;  3KV5 A;  2V4V A;  5LEJ A;  5I0T A;  2HLE A;  1SBE A;  2SBA A;  5C70 A;  2VBP A;  1RUC 2;  4D3W A;  2XJP A;  3R05 A;  1JN2 P;  4JHT A;  4O9E A;  4UT5 A;  3OB8 A;  4ZU7 A;  3VDD C;  3B9I A;  2PXJ A;  4YGB A;  4AI8 A;  3VBU B;  3HAG A;  5HCB A;  4AGV A;  1HX6 A;  4QKD A;  3POB A;  3THD A;  2B45 X;  3L9J T;  5HCF A;  3VHP A;  3WDU A;  3RJR A;  3RQ0 A;  4CDU A;  2YMZ A;  5ACA 3;  5E8A A;  4GH4 C;  4N43 C;  1H6X A;  1SLL A;  2XJS A;  2PHF A;  5FRA A;  2BYV E;  2Q1M A;  2VUD A;  3ZYR A;  1JS9 A;  3NL1 A;  2WFF 3;  5FTT C;  4AED B;  4E4S A;  4DPN A;  2QQV A;  1ACC A;  1STM A;  2VTX A;  2VY0 A;  1CZT A;  2HWD 2;  2WUH A;  3MV1 1;  4XJA A;  5T50 A;  4XFA A;  4BIS A;  3FJS A;  3BKZ A;  2VQA A;  4AI3 A;  2KD7 A;  2PHR A;  4GWN A;  2X5I C;  4K8R B;  3RZJ A;  2B9V A;  1QNY A;  2GN7 A;  3OUJ A;  4CEW A;  1BMV 2;  2DCY A;  4XJZ A;  2E32 A;  3OEB A;  2GC0 A;  2VZV A;  4QPI C;  4QAW A;  4WZF A;  2DUO A;  1JHN A;  1W6N B;  3FUQ A;  4PHZ A;  5KXD A;  3M3I A;  1JMU B;  4XQW A;  3OD0 A;  4B4R A;  1V6I A;  3ROU A;  3OGG A;  5DUX A;  5JSO A;  4NIA A;  2IXL A;  1HIX A;  3GZE A;  2R49 A;  4XF4 A;  3AKP A;  1ND2 A;  1RUI 3;  5FZ0 A;  3S6P A;  4RGA A;  3WDV A;  2YBK A;  3ACH A;  4V2V A;  5J96 B;  3LSD A;  5JDB A;  3VHO A;  2ZAB A;  4NWW A;  2A6V A;  1RXF A;  3JD7 3;  4YGC A;  2D44 A;  4ERO A;  4YZ1 A;  2VH9 A;  2WSU A;  2I2S A;  2Y6F A;  2I07 B;  1CQ9 A;  1MS9 A;  2XON A;  3CJI B;  4XXP A;  5LA9 A;  4AFA A;  4H14 A;  3JQX A;  2O1Q A;  1IG3 A;  4MVT A;  5I8S A;  4OI0 A;  5AC9 3;  1HLC A;  3EMR A;  5FOJ B;  4DIQ A;  2VZR A;  3QLQ A;  5F3I A;  1VBC 1;  4AI1 A;  3H9A A;  3RMX A;  5T5P A;  3DGT A;  2WAO A;  4EWA A;  1NY7 1;  4DXS A;  2JE7 A;  1ZRE A;  1AR7 1;  3SXW A;  1VB4 A;  3WCS A;  3QD6 A;  4P5H A;  2ZOE B;  4KQ7 A;  4IQP A;  2UWB A;  4LK7 A;  5DUW A;  2BWC A;  2F17 A;  4YM3 A;  5C8C A;  1MEC 2;  4A7Z A;  3A21 A;  3P1I A;  4CEW B;  1YQC A;  1CX4 A;  1GAN A;  2QQM A;  4FO9 A;  4MGQ A;  4B1M A;  3T1M A;  5JWP A;  3C7F A;  4LOR A;  1RHI 1;  3KSC A;  3A23 A;  5CG9 A;  1TE1 B;  4HXC A;  4M0N A;  1S0F A;  5A3U A;  3ATG A;  3B7M A;  3E6C C;  3LOB A;  3KVA A;  4GB3 3;  1QKQ A;  3USU A;  2BBV A;  5FO7 B;  2DUQ A;  2PN5 A;  3K46 A;  1OUS A;  2A1X A;  4OFG A;  5A80 A;  4M3C B;  5IK7 A;  1KS5 A;  4PBP A;  4F7Z A;  2J1V A;  4AQ6 A;  3LA7 A;  2X8K A;  5H9P A;  1I3H A;  2Z2S B;  3UGG A;  2VJX A;  3CJI A;  3RWN A;  2FHR A;  2VZT A;  2VW1 A;  3AMH A;  1K5J A;  2VGD A;  3RZG A;  1QXP A;  4FFH A;  5FY7 A;  2RE9 A;  1Q3E A;  5BNO C;  4PBO A;  4AGR A;  1DQ5 A;  2VOK A;  1UOF A;  3ACG A;  3K4D A;  5E6H A;  3WNP A;  4QB1 A;  1PGW 2;  1C8M 2;  3EYP A;  1POV 3;  1W6M A;  2DTW A;  4I0A A;  2ZMK A;  1OI6 A;  3A4U A;  3FMG A;  4RGK A;  2VE1 A;  1PZ8 A;  1TME 3;  2WN2 A;  5EJ1 B;  3VBF B;  2GC1 A;  1US3 A;  2ZGS A;  5GZG A;  5B2G B;  4D7Y A;  3M70 A;  1W9Y A;  1OFS A;  3FFZ A;  5C8C B;  1F31 A;  1L3J A;  5CKQ A;  4QT6 A;  5A3W A;  1ZRC A;  4E27 A;  4D6Q A;  1ND3 C;  2VO5 A;  1VBB 2;  2QKD A;  4UW6 A;  3KQR A;  4HT1 T;  1AR9 2;  1DYP A;  2WO1 A;  2B4K A;  1ZA7 A;  2X10 A;  2ZHN A;  4RN5 A;  3EB7 A;  3N7K A;  1DQ6 A;  2WS9 3;  1UX7 A;  3M4F A;  1DQ1 A;  5J98 B;  4AVS A;  5FZ3 A;  4Y4Y A;  3USU B;  4MET A;  2VW0 A;  3W20 A;  1UU6 A;  1HRI 1;  2UY9 A;  1PZ9 A;  5F6K A;  3WF1 A;  4O61 A;  4JGZ A;  3TWI A;  1G9A A;  3BAL A;  1LEC A;  3O1O A;  1AHS A;  3OUI A;  3JB4 C;  4KI5 M;  4LOS A;  3J7L A;  1SAC A;  4RQP A;  1DLL A;  1PVC 1;  1DLC A;  2WRA A;  2BGC A;  3LAG A;  4MHR A;  3HBZ A;  5EPA A;  4B8E A;  3RYR A;  1YIF A;  2BW8 A;  4AFD A;  2Y34 A;  2VQU A;  4ARY A;  2Y33 A;  1J1L A;  2QDN A;  3HBK A;  1VBC 2;  1XE7 A;  4QHB A;  5LRS A;  1AL2 2;  4OI1 A;  3ZR5 A;  4IER A;  4Q4Y 3;  1NYW A;  1B09 A;  2UUR A;  4N53 C;  1AR7 2;  1US2 A;  2EIG A;  2ZCW A;  4Q0V A;  3T08 A;  3KT4 A;  2GH2 A;  3RSJ A;  3ZR6 A;  2DCK A;  3W9A A;  2RS3 3;  1C28 A;  4U2A A;  1QQP 3;  1SQ4 A;  1ENX A;  1FX5 A;  1W2N A;  3W59 A;  4JGY A;  5LEK A;  5CEH A;  1WD4 A;  2XBO 1;  3L2Y A;  4HAN A;  3O1S A;  5T54 A;  3ZOI A;  3O1T A;  1C3H A;  1IKP A;  1GWK A;  1TZO A;  2ZX0 A;  1XE8 A;  4QGN A;  5C9A A;  1UY1 A;  2JG9 C;  1ZRR A;  2OUJ A;  5C3O A;  3I3M A;  4R9A A;  1RUJ 3;  4NO4 A;  4QXB A;  2DDU A;  5IVB A;  4QPW A;  3MF9 A;  4UOJ A;  4QU2 A;  3VD7 A;  2D40 A;  4NN0 A;  4RFR B;  4FOY A;  4Z2A A;  1O5L A;  3FX3 A;  3V0B B;  1S1A A;  3ZXK A;  3APB A;  2IXI A;  2C1F A;  2VUL A;  4D7T A;  3ZX7 A;  1X9T A;  2P3J A;  4IES A;  5BYN A;  1HKD A;  1OFN A;  4JGY B;  1QJX 3;  1RUF 1;  1J58 A;  2MPF A;  4AL9 A;  2RS1 2;  1S0E A;  2CDP A;  1PX4 A;  2PMW B;  5H9S A;  3VBR A;  1UIJ A;  4Y5Z 0;  1PGW 1;  4Q4V 1;  4RSU A;  3WP5 A;  4BLJ A;  1PIV 1;  3HPN A;  3EO6 A;  5DAP A;  2LAL A;  4A42 A;  1I1E A;  2W0X A;  1OQ1 A;  3I3Q A;  1C5I A;  1DZT A;  1YFW A;  3AFG A;  2QQO A;  4LUL A;  5EXO A;  5FMC A;  4CDW A;  3OEA A;  2WJS A;  2IZW A;  2BER A;  4YW4 A;  1C1F A;  1QJY 2;  2XVG A;  5BNO A;  1RIT A;  1TME 2;  3POF A;  5BPX A;  1Y9Q A;  1S2B A;  4Q0S A;  1MQT C;  4HKL A;  2YHJ A;  3UKT A;  4QQO A;  5C71 A;  2A70 A;  2HWC 1;  2ZGR A;  3GYD A;  3ZSJ A;  4UAP A;  2ET1 A;  5JMC A;  4AHW A;  2JDZ A;  3KCX A;  1WW4 A;  3NV2 A;  1KDM A;  3DEC A;  3IB3 A;  4GMP 1;  1PNG A;  5A70 A;  4YGE A;  5F9T A;  3POS A;  4PDW A;  2IXJ A;  1OSG A;  3DPR B;  2RHP A;  4HN0 A;  1W8W A;  4ASL A;  2PHW A;  3KQ4 B;  1MZ5 A;  1N1Y A;  1AJK A;  2BTV C;  2H6C A;  5A6Q A;  5ANQ A;  2GAU A;  5J1X A;  2BFU S;  3ZXF A;  1MEC 3;  3WW3 A;  2XQR A;  3NJV A;  5FZF A;  1CVN A;  1SPP B;  1EAH 3;  2WNV C;  3F2Z A;  4R52 A;  3CZU A;  2ZEZ A;  3ASI A;  4FVV A;  1TMF 3;  4I02 A;  5D1I A;  2P37 A;  3IDC B;  1LCL A;  4FP2 A;  3I2G A;  4H2A A;  5JXG A;  4UFM A;  1LGB A;  2YY1 A;  5F1R A;  3FLT A;  4RQP C;  2IFW A;  3T3Y A;  3CBN A;  4XHB A;  4LBM A;  1IG0 A;  1AL2 3;  2JD4 A;  4XQ4 A;  1HJG A;  4LIV A;  5E89 A;  1QDO A;  2EID A;  2BFU L;  3O1V A;  5CFC B;  3IMM A;  3AP6 A;  1PVX A;  3VZJ A;  3FN9 A;  1V0A A;  4QQH A;  2YRO A;  2N7G A;  1YIP A;  3LD8 A;  4ONU A;  1JZ8 A;  2ATF A;  1NXD 1;  1DGR A;  1VIW B;  2QCS B;  3H8U A;  1H8V A;  3VBO B;  5HI0 A;  5L9V A;  3K4Z A;  4XDP A;  4I3G A;  1UWW A;  2GND A;  2A3X A;  3E97 A;  1CX1 A;  4QX3 A;  4Q27 A;  5JXJ A;  2VPV A;  5DAB A;  4EN7 B;  3BN6 A;  1ZBE 1;  3V0A A;  2IXH A;  2DVG A;  3K2O A;  3LOI A;  1PK6 C;  3M3O A;  2C6S A;  3VZN A;  2WAB A;  5A1A A;  4UBH A;  2ENR A;  4XJ9 A;  2PAM A;  3ZXA C;  3ZXL A;  4QQL A;  4XUT A;  2WZP P;  4WVW A;  3PUA A;  4YM1 A;  2W95 A;  3POG A;  4TWT A;  4E9K A;  2YPJ A;  5FZA A;  5CFC A;  1I5Z A;  4ES9 A;  3CJX A;  4LUM A;  1PMJ X;  5JOX A;  4BYY A;  1SBF A;  3BOW A;  4NPM A;  2UU8 A;  3KT7 A;  2JDA A;  3BIE A;  1O8S A;  5CU1 A;  3WG4 A;  5FYH A;  3AKT A;  1XYO A;  5FUN A;  3M7A A;  1G7Y A;  1F5J A;  2VVF A;  3J7M A;  5C6C A;  4YM0 A;  4BHP A;  4GMP 0;  3S5Q A;  3V0A B;  1S0B A;  1EPW A;  4ZXE A;  2XG3 A;  4L99 A;  4MHU A;  3LZZ A;  1COV 3;  3WP4 A;  3VBF C;  1S0D A;  1RL3 A;  4XQD A;  3VD5 A;  2XJV A;  3I7D A;  1RUC 3;  2YV8 A;  3AXE A;  4LQR A;  4YG0 A;  1RUD 2;  2LS6 A;  2JIG A;  3VHN A;  3AZW A;  1POV 0;  2P3K A;  4HSJ A;  1NE6 A;  2P1B A;  2VZU A;  3PDQ A;  1V6L A;  1CR7 A;  4AI2 A;  1MS5 A;  2BUK A;  1XYN A;  4RA0 A;  1YEW A;  3M3E A;  3TEW A;  1I6X A;  1W8T A;  5FBZ A;  2IVI B;  3ES4 A;  5FZO A;  2E31 A;  4RYD A;  3ETQ A;  4CDQ B;  3NVC A;  1D2Q A;  1XSR A;  4FPE A;  5EP9 A;  2WC2 A;  1BBT 3;  1VBE 3;  1OLR A;  3BTA A;  2RS3 2;  2WBK A;  4DQA A;  5KHH A;  3MO4 A;  5KWR A;  1D0H A;  1DGR N;  1N1V A;  5E88 A;  1QDC A;  5F32 A;  3ILN A;  2DBN A;  4KMQ A;  3KGL A;  5DAV A;  1MZE A;  3I3D A;  1I5P A;  1SEF A;  2AUY A;  2GH8 A;  4OVE A;  5JOW A;  2J42 A;  3DEM A;  5FQ0 B;  1K5M C;  2HEV F;  3O1R A;  5BNQ A;  2NN8 A;  4RS5 B;  3WNN A;  4EN9 B;  3CF6 E;  1MZ6 A;  2ZEX A;  3VBO C;  4RR3 C;  4X8N A;  1C8M 1;  5I0D A;  2QNK A;  4EN8 B;  5FYV A;  1ODN A;  2D6M A;  5F2S A;  2ZGM A;  3AJY A;  4ZY9 A;  2W5F A;  4EWE A;  2WNV A;  5FP4 A;  1Q8S A;  2JDY A;  1O4T A;  3DCQ A;  4TLF A;  3VKF C;  3P3N A;  3C7O A;  3KT1 A;  4BQ2 A;  1RHI 3;  3H8O A;  3WD5 A;  1TQ5 A;  3WV6 A;  2J1U A;  5EFU A;  1AR9 1;  1BKZ A;  1TG7 A;  3J26 N;  4RS5 A;  2E7A A;  1Y43 B;  1NCQ C;  3MIF A;  2XGX A;  3GZT B;  1GLH A;  1BVP 1;  1W9S A;  3IBM A;  3MIB A;  4HN1 A;  3WP6 A;  3ZYP A;  5BNN C;  1MS1 A;  5CB7 A;  2JDH A;  3NAP A;  4H3W A;  2DFB A;  4PT6 A;  1SLC A;  4MLO A;  5IVC A;  4CTE A;  3VKN A;  4OQ8 A;  3O1U A;  2WII B;  4DOU A;  5DAW A;  5CKN A;  1PIV 2;  4KBB A;  4WM8 B;  3UGH A;  4ZS3 A;  1LHN A;  4CP2 A;  4AEM A;  3S5A A;  2PHX A;  2NQY A;  1UW8 A;  2H0V A;  1PO1 2;  4J1X A;  5GZF A;  1V9U 1;  1G9F A;  2J1A A;  3KM5 A;  3WNM A;  2ZHL A;  4RGG A;  4AQ2 A;  2R06 3;  2WZE A;  4QWN A;  4GB3 2;  4XDQ A;  4NIG A;  4NE9 A;  3RZH A;  3TB0 A;  1ODM A;  3BOD A;  3WQ1 A;  3D3A A;  2WN3 A;  1LHV A;  3CHX A;  5A3O A;  4CUA A;  1GQH A;  1OA4 A;  2YGL A;  3T4H B;  2GME A;  2EXH A;  4I3P A;  1IPS A;  1WWY A;  4H7L A;  2PLV 1;  4FPG A;  3MYX A;  1FOD 1;  4LKD A;  2WYF A;  2R32 A;  1VBA 1;  3I97 A;  1NQD A;  3RWK X;  1W6N A;  4JKL A;  3JB8 A;  3SNM A;  5DZE A;  5CKM A;  1UZV A;  1YWK A;  1CAU A;  3RG0 A;  1MVQ A;  3CKH A;  5C8W A;  5KHJ A;  2YGM A;  3ZFG C;  2C24 A;  3N3H A;  5K7P A;  3AZZ A;  2AAC A;  2ZJC A;  4OHV A;  1D4V B;  4OMC A;  5FUP A;  2C9A A;  1PO2 1;  2VC9 A;  4JDN A;  2WNU A;  1UY4 A;  4K3U A;  2W9X A;  4OZO A;  4IE7 A;  3GCX A;  4AVC A;  4IGO A;  3WDT A;  1L7Q A;  5FO8 B;  1ZBA 3;  2E9Q A;  5FOB B;  1O3T A;  2DFC A;  4XMI A;  1XC6 A;  3WR0 A;  3ILF A;  4LT5 A;  2FDI A;  5ANN A;  1BLZ A;  3T0B A;  1SFP A;  4K8F A;  3PUS A;  2BNN A;  1OD5 A;  1SLT A;  4S2H A;  3VDD A;  4RQP B;  3T2T A;  4BQ4 A;  3SH4 A;  3AP5 A;  2FD8 A;  1N1S A;  1K5M A;  1N47 A;  1SLI A;  1UN1 A;  3H0O A;  1UOJ A;  5FYY A;  4ARX A;  1KFX L;  1S0J A;  3U75 A;  1H2K A;  2JWP A;  3HN3 A;  3IDA A;  4BK5 A;  4COV A;  1JBC A;  1WA4 A;  2QQP A;  3MW4 A;  5FKB A;  2HWE 3;  3RZL A;  5JMO A;  4TYS A;  3O12 A;  1FPN 3;  1NCR A;  4F83 A;  4AVB A;  5AC9 1;  4HET A;  5FIX A;  5FZB A;  5CVR A;  1VE0 A;  2Q8O A;  3GM8 A;  2BWA A;  3NV3 A;  3D0S A;  4TXW A;  5FZ1 A;  5GZE A;  1JYI A;  1F8V A;  2W08 A;  4CYD A;  3RMY A;  2QQW A;  1GQP A;  1BZW A;  3VBH B;  3J8F 3;  1W0P A;  1HW5 A;  5GM0 A;  1NE4 A;  2WIN B;  3JUU A;  2XLA A;  4CVU A;  1ZVF A;  3JBG 1;  4K1Z A;  5C9A B;  3OG2 A;  1NLQ A;  1VRH 3;  5JOY A;  1IHM A;  3DL3 A;  4AVA A;  1RUJ 2;  3LB9 A;  4BDV B;  2Y0I A;  1T6B X;  3JCI A;  2XKP A;  3AFK A;  4AED C;  5ISL A;  2VMH A;  2RMU 1;  3H50 A;  4I30 A;  2P5B A;  5L7O C;  3N36 A;  3MZH A;  2D3S A;  2PTM A;  3D6E A;  4NID A;  1EUT A;  3PU8 A;  1ZZ9 A;  4DO0 A;  2RDQ A;  5FY9 A;  3T0D A;  4OZX A;  4MXV A;  1V00 A;  4YWA A;  5A3N A;  1EYB A;  3NV4 A;  3W5M A;  3MFA A;  1O4Y A;  1AR6 1;  1PO2 3;  1XNB A;  3OYW B;  5CIR A;  1RIR A;  2XWB B;  1UF2 C;  4AWD A;  5GZC A;  1A34 A;  4J25 A;  3E5Q A;  2CAV A;  3O14 A;  4LUK A;  1JI6 A;  1MAC A;  3DV8 A;  3OJB A;  2WZ8 A;  1LOC A;  1H2M A;  3I54 A;  2JKX A;  4URA A;  4DRR A;  1J84 A;  1G86 A;  3AYE A;  2BGP A;  4GMP 3;  2VZS A;  2GNM A;  2YBP A;  1GZ9 A;  1QGL A;  3O5S A;  3MLJ A;  3ZN6 B;  1RVF 1;  5J37 A;  3OY8 B;  5F5I A;  3FZ3 A;  4HVR A;  2WA3 A;  4ZXK A;  3VBH A;  2Y64 A;  1CZV A;  1WBF A;  2DBI A;  3MUY 1;  4UW3 A;  5DZF A;  2ARX A;  1AXK A;  5H9R A;  1F4A A;  4Q1R A;  4SLI A;  3S0M A;  2XML A;  1V6K A;  5A33 B;  5CAZ A;  4CXY A;  3CIH A;  1UZZ A;  4FPC A;  1ENQ A;  3KF3 A;  1AXY A;  3DXU A;  4C0B A;  3N7L A;  1L7L A;  3H8X A;  3A22 A;  4Q4Y 2;  1PHM A;  3WDY A;  4LKF A;  4DB5 A;  1PX3 A;  1WMF A;  3OUH A;  2VZ3 A;  1QJU 1;  4AW7 A;  3C7H A;  2B5H A;  1IKQ A;  1YQ2 A;  3V0B A;  5FP8 A;  2H6B A;  3WF3 A;  1W8O A;  3PU3 A;  4K21 A;  3N9O A;  4QPY A;  3CJI C;  1ZBA 2;  2VU9 A;  2BP6 A;  3N35 A;  4NOT A;  2WR9 A;  4JCK A;  1JXN A;  4G4F A;  4XZU G;  1JZ7 A;  2D6N A;  3H7J A;  4LA2 A;  4NHY A;  4XVH A;  4KL1 A;  5GJ6 A;  4ISQ A;  4M3C F;  3VL8 A;  2BEO A;  5IHR A;  3WNK A;  4HKO A;  1AR8 1;  1HB1 A;  4IE0 A;  4CCC A;  3ZFE B;  5D8A A;  1SPP A;  2EIE A;  5C9A C;  1EAH 2;  4Z82 A;  1G8W A;  2XHN A;  3INA A;  4TTG A;  2HWF 1;  1RC6 A;  4ZZ5 A;  3THT A;  5DAX A;  3N7M A;  3RYK A;  2QDR A;  2WT2 A;  1LHW A;  5J7M A;  1EV1 3;  2V5D A;  3W5N A;  5ABJ A;  4CRQ A;  5K4L A;  5HXM A;  1XBF A;  1UX6 A;  1QJX 2;  2YB7 A;  1HXS 2;  4YAR A;  5GLV A;  1AYM 3;  3PL0 A;  1X8M A;  1NG0 A;  2QJV A;  5A33 A;  4EE2 A;  4IE4 A;  5FXW A;  4PF5 A;  5BNO B;  2FBE A;  1PO1 1;  5DG2 A;  3PUH A;  4A2U A;  2EIC A;  3SCF A;  4BB3 A;  1CWP A;  2FQP A;  3I8T A;  2XVK A;  3WCR A;  3DXT A;  2W47 A;  1KJL A;  2G9Z A;  1N3P A;  5FZM A;  3BIW E;  2Y0O A;  5DDJ 3;  3OPT A;  2PHD A;  2RMU 2;  4YG3 A;  2VME A;  1GKB A;  2R04 1;  3W21 A;  4BH9 A;  2E7T A;  1RJ7 A;  2XDV A;  4BQ5 A;  4UYB A;  1XB9 A;  3C2U A;  3T4V A;  1W2U A;  3IM0 A;  5DG1 A;  1TNR A;  4AE2 A;  5IT6 A;  2EAA A;  2W1W A;  3A0N A;  5T55 A;  1KEX A;  4BZ4 A;  2PLV 2;  1RUE 2;  2O8Q A;  3WNL A;  4IV3 A;  1SLB A;  4KH9 A;  4P9G A;  2C4X A;  2DUP A;  5LZ6 A;  1COV 1;  4Y5S A;  2ZGU A;  1ZX5 A;  3LA2 A;  2JG8 A;  4XFH A;  2C5D A;  1H1I A;  1QXR A;  3AMN A;  4XIO A;  4HVQ A;  1CPN A;  3LDR A;  4N53 A;  3ALQ A;  2W1U A;  4Q4X 2;  3VGI A;  2EXJ A;  1OUX A;  2JDK A;  4AVV A;  2VQT A;  1JYX A;  5APA A;  4XFG A;  4Q4V 3;  4AOC A;  5BY5 A;  1EUU A;  2XVL A;  4PDW B;  3J7H A;  1DDL A;  1ZZ6 A;  2B9U A;  1NXM A;  1H6Y A;  1XNA A;  2OQ7 A;  1LES A;  2RV9 A;  3MW2 A;  3PUQ A;  4UI9 L;  2X53 S;  5FDB A;  3WP3 A;  5EYY A;  5FP7 A;  3JU9 A;  4V2W A;  4Q1P A;  3SC7 X;  1ONA A;  1S2K A;  3KS7 A;  4P14 A;  4XIK A;  2VZP A;  3CEW A;  3NWK A;  3FL7 A;  1JYN A;  2VOW A;  2VZQ A;  4L92 A;  4QM9 A;  1D4M 2;  4ZU5 A;  4YGD A;  2YUE A;  3PVN A;  3QCW A;  4NAO A;  4XJW A;  5F8P A;  2AEY A;  3X29 B;  1JZ4 A;  1BMV 1;  2QUO A;  3HT1 A;  4DUW A;  3H7Y A;  3VBU C;  4N53 B;  1JTZ X;  2BQP A;  4WVV A;  3VV1 A;  1PK6 B;  2VUC A;  2E6V A;  3FHQ A;  1Y4W A;  2WQ8 A;  3ABZ A;  4QPG B;  5EIY B;  3ZYG A;  1R08 3;  3VKO A;  5LW9 A;  3WNO A;  4LE3 A;  2JEN A;  3PIJ A;  4J1W A;  1ND3 A;  1PVC 3;  4NRO A;  3WQB A;  1LOF A;  1RED A;  5KXC A;  1AX0 A;  2A3Y A;  1DBN A;  2MEV 1;  2QQU A;  3OPZ A;  1OH4 A;  3B94 A;  2IVJ A;  3PTR B;  5EJ3 A;  3WDX A;  1JZ6 A;  4XF9 A;  4W6X A;  4F8A A;  1AYM 1;  5C33 A;  3FWE A;  5C3R A;  1WZX A;  1O6U A;  3NJY A;  2ZHM A;  2PQS A;  1HRI 2;  1OT5 A;  2X5I B;  2WL1 A;  1MEC 1;  2CTV A;  1GMM A;  5FYC A;  3KGZ A;  1GP6 A;  5CA6 A;  1WW7 A;  3SLI A;  4NHL A;  5A32 B;  1V9U 3;  3AM2 A;  4P00 B;  1M4W A;  1J3P A;  1AYN 1;  5CZK A;  4CDU B;  2I74 A;  4ZPI A;  2XH6 A;  2EF6 A;  3OBT A;  4ES8 A;  5FK7 A;  2VXJ A;  2MNG A;  4JZR A;  3JBG 2;  1W2A X;  4GJZ A;  3UK9 A;  2AYH A;  3S30 A;  4IXL A;  2VM9 A;  2HWB 3;  1UL9 A;  5K0U C;  3DKW A;  4GXL A;  4QXK A;  2W46 A;  5FZC A;  1QEX A;  3HT2 A;  3LFM A;  4MGZ E;  4UFH A;  5HV0 A;  5J3U A;  2FDG A;  1EV1 2;  4CPB A;  2ZBJ A;  2OII A;  4HMZ A;  3FLP A;  4D69 A;  1W05 A;  4Q4W 3;  5BNP A;  5KC6 A;  1CPM A;  5IAT A;  4XOG A;  1RHI 2;  4FTB A;  5T3N A;  1H1M A;  5EV7 A;  4BQ1 A;  1CAV B;  1OA2 A;  1O91 A;  4IV1 B;  4AI0 A;  2B8M A;  3K51 A;  1UYP A;  2WWJ A;  5L19 A;  4EV0 A;  1AR6 2;  1F35 A;  1LU1 A;  3N9M A;  1MPX A;  3HQX A;  3NAP B;  4P9W A;  1YI7 A;  4IGP A;  4AHY A;  1COV 2;  1ZBE 3;  2D5F A;  5IJR A;  1ST8 A;  4R8H A;  1H4G A;  1JOD A;  3AB0 A;  1TMF 2;  5F37 A;  5E16 A;  5FPX A;  2TBV A;  3QOP A;  2KM2 A;  2QZ3 A;  1UAI A;  4OHY A;  1GBG A;  1C8N A;  4CCM A;  4CUG A;  3MFC A;  1PIV 3;  2VMI A;  5BNP B;  2A6Z A;  3PME A;  4XHX A;  3ZYB A;  2PHT A;  1UOB A;  1ND2 C;  3ME2 A;  3ZIW A;  4CCK A;  2YPD A;  4B7E A;  2VMD A;  4PLN A;  4UW5 A;  1C57 A;  4UF0 A;  2D6P A;  3UKN A;  2WT0 A;  3O0V A;  3K75 B;  3HOB A;  2HBT A;  5L9R A;  1W6O A;  5FKC A;  4QXH A;  1Y9G A;  2JG8 C;  3S57 A;  3PUR A;  1UU5 A;  3ZPO A;  1W90 A;  2WS9 2;  2Y6G A;  1W6Q B;  2JXA A;  3ZXG A;  3LFI A;  1IS3 A;  2WZR 2;  1QWR A;  1QY4 A;  1VR3 A;  2ZTN A;  3IWZ A;  3MEP A;  4KGQ A;  5DZG A;  2Q8E A;  2PFW A;  4LO7 A;  4LEJ A;  4MGI E;  2HWE 1;  1GZW A;  1ZZ8 A;  3UV9 A;  3E1F 1;  3FHI B;  1XJA A;  2XJR A;  1VB2 A;  3GNE A;  5C4W A;  1W2T A;  5IW0 A;  4IEV A;  1R1A 3;  2XLG A;  4GA9 A;  5FCC A;  3RYP A;  4CDU C;  1RMU 3;  3L2H A;  3SEP A;  1MS4 A;  4WM8 C;  5KBF A;  4FOQ A;  4RR3 A;  2YU1 A;  4Q29 A;  2HWC 2;  3RZK A;  2WNV B;  1RUN A;  1R08 2;  5SV8 A;  5BUV A;  1FAT A;  3MUZ 1;  3M2M A;  4FXK B;  3BB6 A;  1VRH 1;  1FNY A;  1VRB A;  2HYK A;  3TEX A;  2FCV A;  2Z4F A;  2XLF A;  2DCJ A;  1GZW B;  3LE0 A;  3N9P A;  3Q9O A;  2DV9 A;  2ARB A;  2JE8 A;  1KGY A;  3H3U A;  2J1E A;  4JX0 A;  2YC0 A;  4A6O A;  5CG8 A;  4K6B A;  3ZFE C;  5KC5 A;  1FAY A;  3POW A;  1OXC A;  4TSV A;  5M0T A;  2HEY F;  4BIF A;  3FBY A;  3VBF A;  3NV1 A;  3E5U A;  2LM3 A;  4HLT A;  3S7I A;  3ZFF B;  1W6Q A;  2R07 3;  5JSP A;  5F3G A;  3K3O A;  2YBS A;  5CAD A;  2R04 2;  2X09 A;  4CCE A;  4QU1 A;  5FWE A;  4Q26 A;  5ERL A;  3NKT A;  1QH6 A;  4HPK A;  1GFF 2;  1YFU A;  3ZFG B;  2Y60 A;  3NNJ A;  4LIT A;  4JRA A;  1AR9 3;  2DVB A;  3AKR A;  4Q4Y 1;  2ZX1 A;  3ON7 A;  1OLM A;  4LPL A;  1GYK A;  4DXR A;  5IK5 A;  3POJ A;  2QQN A;  5LK5 A;  2WKK A;  4QKF A;  4JQT A;  2BV4 A;  4O9G A;  3ZXJ A;  3UJO A;  1LOA A;  4N9H A;  4S2D A;  3ZFF A;  1VPH A;  1O4Z A;  3J8F 2;  3LEI A;  4F3J A;  1VMJ A;  3BTX A;  1VBD 1;  3TN9 3;  4L8Q A;  2NPI A;  4WVM A;  4NRM A;  2Q4S A;  1ZM1 A;  3OBA A;  4NHK A;  1E5I A;  2JG9 B;  3LKJ A;  2VMG A;  4Y24 A;  4QPI B;  2VL4 A;  4PI0 A;  3U1X A;  3HQR A;  1QJY 3;  2K46 A;  2RDS A;  4MXW B;  2GNT A;  4KWU A;  4QDS A;  5J48 A;  2D43 A;  4AR2 A;  3BUC A;  5TSW A;  1VBC 3;  4JDM A;  4M3C A;  3ZVX A;  4NJ4 A;  1A3K A;  4CEY A;  3AX4 A;  1RMU 1;  3IAP A;  1IQD C;  1YFY A;  3UJQ A;  2VCM A;  5FPU A;  2Z42 A;  1Q8V A;  1AZD A;  2XHK A;  3NNG A;  2DUR A;  4MGT A;  3UGF A;  3FHA A;  4X8P A;  4UXA A;  1XOY A;  2OVU A;  3I2K A;  3SCH A;  3VDB A;  3TEY A;  2G19 A;  3MGU A;  1Q43 A;  1S0I A;  3OF1 A;  4PI2 A;  2HBU A;  1N3Q A;  1OPO A;  4RS5 C;  4WVM B;  1ASJ 2;  5FLH A;  2W92 A;  3TAY A;  4Y20 B;  4P9I A;  3KCC A;  3ZSL A;  2HWF 3;  1XYP A;  3RRD A;  5F5A A;  4MXW A;  3WIN E;  4LK6 A;  5A7P A;  3VUO A;  5KXB A;  1A6C A;  4FTS A;  1WW6 A;  1Z7S 1;  1GWL A;  1W04 A;  4FOV A;  2RR1 1;  1W8Z A;  4OLL A;  1H8T C;  1ENR A;  4A6S A;  3PIG A;  4CU6 A;  4CXW A;  4FTE A;  1SBD A;  2D7F A;  1RUE 1;  4WM7 C;  5I93 A;  1JZ2 A;  3AP7 A;  1NZC A;  3RVH A;  2E7Q A;  1R09 2;  2ZAC A;  4N7I A;  5FRE A;  3GHM A;  2R06 2;  3MI8 A;  4AQS A;  4AFC A;  4LLF A;  4XFF A;  2W52 A;  5ACA 1;  3ZMN A;  1RTV A;  1A78 A;  4Y20 A;  1TNF A;  1LGN A;  4HVO A;  2BGO A;  4BA6 A;  1CJD A;  1KXG A;  3UL2 A;  1JYV A;  2WDB A;  4COZ A;  2P34 A;  4X6R B;  3WY6 A;  5C3S A;  2PAE A;  4GKY A;  1EV1 1;  5JIU A;  1DYO A;  1LJ7 A;  3GCW A;  4AI9 A;  1XXN A;  2ZX3 A;  4BMB A;  3MLL A;  4OHX A;  1UXX X;  3GGL A;  4KNC A;  3U4X A;  1ENS A;  4W6W A;  4QHZ A;  4UBG A;  1LRH A;  1KDK A;  3ECQ A;  2AH2 A;  4YLZ A;  4S2G A;  3KD4 A;  2AGS A;  5GLZ A;  3U07 A;  3ZYF A;  1ZRF A;  1V6J A;  4CCO A;  5I91 A;  1YFX A;  1N1T A;  3O0X A;  1FMD 2;  2OW4 A;  1OPM A;  3IDE A;  3KV6 A;  1DQ0 A;  1PGL 2;  3DYM A;  2NM1 A;  3AYD A;  4RHV 2;  4PLO A;  3ZN6 A;  4ATE A;  1RUG 2;  4JKK A;  3DPR A;  3I3B A;  4HZF A;  3B93 A;  3WUC A;  3R4D B;  1KIT A;  3FBM A;  2CGP A;  2HWD 3;  4QX1 A;  1YHF A;  2ZKN A;  3AJZ A;  1UZ0 A;  5JI9 A;  4YZ4 A;  4YVW C;  3GF6 A;  1HQL A;  3WX5 A;  1EP0 A;  2E63 A;  1QF3 A;  1OLM E;  5IAX A;  4QX7 A;  2BOJ A;  2HKX A;  5FPV A;  3SIT A;  4EZ4 A;  1SCR A;  2OS2 A;  2EVX A;  3ACF A;  4C0H A;  4YG6 A;  4YZ2 A;  4YYO A;  4I01 A;  5GKA C;  3GBW A;  5C3Q A;  4D0Q A;  4IEU A;  1OHF A;  3B01 A;  3H8R A;  1LOD A;  4CDX A;  1RUI 2;  3RJ2 X;  4NII A;  4B7K A;  3WZ1 A;  3U37 A;  2IUW A;  4HSL A;  3THC A;  4BQY A;  1N3O A;  1SG3 A;  4Y1U A;  1P8J A;  4R9D A;  5JAX A;  1W8H A;  2PYT A;  2WT1 A;  5IK8 A;  2RM2 2;  2WO3 A;  3WG2 A;  1ASJ 1;  3WG3 A;  1U5Y A;  5JI7 A;  1OF4 A;  1UPI A;  1DIW A;  4MGS A;  3VBR B;  4BME A;  4LMF A;  3LPG A;  4Z8B A;  2X29 A;  1NY7 2;  5FZ7 A;  1LGC A;  4CP9 B;  1JYW A;  1ULF A;  4MOA A;  3HEI A;  3GXU A;  4P08 A;  4JKM A;  4QQ2 A;  4XFI A;  5G04 L;  1Z7S 2;  1U5I A;  4MGK E;  5FY1 A;  5CFD A;  5I0U A;  4YVS B;  5EJZ B;  5B4N A;  4MUV A;  4X6Q B;  4AAX A;  3UET A;  3TEZ A;  1NKG A;  1WGP A;  3MV0 1;  5ABJ B;  3ZDV A;  1WCK A;  4GWI A;  1F5F A;  4TN7 A;  1YO8 A;  2LRO A;  2ARA A;  4IET A;  1OOP B;  1LEN A;  4P02 B;  2WQ4 A;  2A71 A;  2WYS A;  4N7U A;  5L36 A;  1CIY A;  4XTP A;  5L73 A;  2R16 A;  3ZSK A;  2R30 A;  2D3R A;  2UYB A;  5L9B A;  3WF2 A;  4XJU A;  1UQX A;  5L7O A;  2R0H A;  3LQC A;  4NPR A;  5FZL A;  4IE6 A;  4XAE A;  5CFD B;  1ULP A;  3AXD A;  5GLT A;  4XIL A;  3BTY A;  3RS6 A;  5GLU A;  4Z2W A;  1JYC A;  3IMN A;  4ET7 A;  1W0N A;  1IPK A;  2JX9 A;  2QQK A;  2VQ0 A;  3AC0 A;  1NLS A;  5G05 L;  3VB9 A;  2HWB 1;  2Q1Z B;  2A5Z A;  2YDE A;  3IDB B;  5JR2 A;  2HWD 1;  4MH0 E;  1OOP A;  3C8X A;  4HFS A;  1CN1 A;  1W03 A;  3ENR A;  2JB8 A;  2OYZ A;  3HVD A;  3GJA A;  3FFQ A;  2AR6 A;  2NMO A;  4FPK A;  2X5I A;  2QQI A;  4Q4W 1;  5DDJ 2;  1DQ2 A;  3SKV A;  1AR8 3;  3MPP G;  5JZG A;  1HRI 3;  1UPS A;  5FR3 A;  4XTM A;  5L7O B;  2K0G A;  2EIB A;  3ST7 A;  1X36 A;  4KU7 A;  1D0G A;  4KG8 A;  4CCD A;  1SHW B;  1GP5 A;  3Q8A A;  3J8F 1;  3NO8 A;  4LO5 B;  3WXP A;  5JXI A;  5LBB A;  1W6P B;  1ULD A;  3NNL A;  1UXZ A;  3N9L A;  1RXG A;  2ARC A;  2J7M A;  1MS3 A;  1QJE A;  2TNF A;  3JBG 3;  3LIG A;  4LR4 A;  3ZXE A;  4AHX A;  1HJF A;  4Y22 A;  1V6M A;  2DU0 A;  5FYB A;  4CCJ A;  3H3Z A;  2LTN A;  3GZU C;  2ERF A;  5AC9 2;  2Z79 A;  3KCY A;  4WZC A;  4GWM A;  3T1L A;  2D3P A;  2L9L A;  4JGZ C;  1G6N A;  2ZXQ A;  5EHD A;  5A7Q A;  5F7U A;  1VMF A;  4BJ0 A;  2QVS B;  1QH7 A;  3E6B A;  2OZJ A;  3HMY A;  3NQH A;  1WLT A;  1AJO A;  4E4H A;  1BVV A;  2GSY A;  4NMI A;  1QHD A;  4RFT 0;  5C5T A;  1TVG A;  1AR6 3;  1O7F A;  2BOI A;  4M3C E;  3G7D A;  5LA0 A;  4YW7 A;  4LHL A;  3CU7 A;  5DUU A;  4CDW C;  3GJB A;  4FPJ A;  2XUM A;  1W28 A;  3WG1 A;  3JQW A;  5SV5 A;  2W68 A;  4GH4 A;  4N43 A;  3HNB M;  3N7J A;  2VEC A;  3POY A;  4RD7 A;  3VBO A;  4CP0 A;  1RUH 3;  4QHO A;  4DMI A;  2Q5T A;  2ZGK A;  1HXS 3;  1CON A;  1S0C A;  3IPV A;  5LAS A;  1PVC 2;  5JOZ A;  4QKB A;  3I2J A;  1OVS A;  1F4H A;  4OQ9 A;  3I59 B;  1UZW A;  1YXW A;  3GBF A;  4EJR A;  2CAU A;  3VZL A;  3S7E A;  1H0B A;  2DF7 A;  3J9S A;  4OHZ A;  4Q5O A;  4HK9 A;  2VBD A;  4QX8 A;  3VBS B;  3VKL A;  5JVV A;  4IV1 C;  2VOV A;  2GC2 A;  3LDK A;  5FZ6 A;  1XND A;  2LUW A;  2RVA A;  4XC9 A;  1QOT A;  1LUL A;  2G4I A;  3PJY A;  3NAP C;  4NRP A;  5EZW A;  1VBB 1;  1MS8 A;  1ZZC A;  2ZGN A;  3B9C A;  3F95 A;  4FPH A;  1CAX B;  1YQ8 A;  3ZKU A;  4MYE A;  1CAV A;  5T52 A;  4I0W B;  1NQJ A;  3TOJ A;  4ZON A;  3BU0 A;  5LRR A;  4FQZ A;  3VDA A;  5LK7 B;  2HWB 2;  4CU8 A;  4PQQ A;  3VLB B;  4K9S A;  1WCS A;  3SH3 A;  1HQW A;  3CMG A;  1FPN 2;  3D0J A;  4Q4W 2;  1J3Q A;  1EY2 A;  1SDD B;  4BPZ A;  4BWO A;  4GH4 B;  4N43 B;  5HXV A;  3ZXD A;  2NZ9 A;  2RS1 3;  1SZB A;  3URF A;  4BIO A;  2G9G A;  1OLQ A;  4QX0 A;  3AYC A;  4PIZ A;  3E6D A;  4AG4 A;  1RUG 1;  3T2P A;  2EAL A;  5FZE A;  3IPV B;  4CCL A;  1ZBA 1;  4YW3 A;  5LY1 A;  1NUK A;  4P9L A;  2W3J A;  2ILM A;  4FSJ A;  1LTE A;  2XL7 A;  1CAU B;  5AVP A;  4D6S A;  4NHM A;  1GOF A;  1TME 1;  2H0B A;  2JEC A;  1YQ5 A;  2WNO A;  1Q8O A;  1UO9 A;  1BBT 1;  4LBJ A;  2R07 2;  4COW A;  5JZG C;  5FZ9 A;  5FP3 A;  4KGG A;  1NA1 A;  3HJR A;  3VBU A;  2GP5 A;  3A7Q A;  5FQ0 A;  5FY8 A;  2FDF A;  2JDN A;  2R04 3;  3P5B A;  4MAD A;  3KB5 A;  4PJY A;  5FXV A;  3ZFG A;  1RUI 1;  5FPB A;  5DAQ A;  3ZDS A;  1LOF C;  1HXS 1;  4Q0U A;  1F9K A;  5HCH A;  1AVB A;  1AL2 1;  4QDQ A;  1UYY A;  2KA3 A;  3P6B A;  3Q8F A;  4LBL A;  4TZD A;  4CDQ C;  5AVA A;  2YU2 A;  3SKJ E;  4CEW C;  2CNA A;  2E53 A;  4XE9 A;  1J3R A;  5FMD A;  4RR3 B;  3RGB A;  4C8D A;  5A7O A;  3P3P A;  3TNQ A;  3VZK A;  4YPJ A;  1MZF A;  1U0A A;  5F3C A;  4ZS2 A;  1CAW B;  5FY0 A;  3ACL A;  4LO4 B;  1HDK A;  2MHF A;  2C9K A;  3ZMO A;  4E4D X;  1CGP A;  4NRQ A;  4A3Z A;  2G9F A;  3AZX A;  4NIH A;  3H3L A;  1T6G C;  2JIJ A;  3T0A A;  1R1A 2;  2JG9 A;  5K8S A;  5C4W B;  1JZ3 A;  4WBB A;  1O59 A;  2XPJ A;  1BHG A;  2BZD A;  2XL9 A;  4IL7 A;  5IFP A;  1HRV 3;  3BPS A;  2NYY A;  4XAC A;  3AZY A;  2W1Q A;  2ZA9 A;  4IND A;  4MG2 A;  1SCS A;  2WWS A;  3N9N A;  4O7X A;  4OUE A;  4BM8 A;  1NCQ B;  5FZ4 A;  4CEY B;  2VMC A;  1VAV A;  5A6X A;  1QQP 1;  3PMS A;  4YVS C;  5I8Y A;  2E26 A;  1NA1 B;  3LIH A;  4WM8 A;  4CP1 A;  4OYU A;  1OH3 A;  2DVA A;  2B46 X;  1NCR C;  1L7R A;  5F5Q A;  3IKW A;  3IT8 A;  3IZO A;  3NRU A;  4N90 A;  3GZA A;  2R7E B;  5K9Y A;  2YFU A;  5A6Z A;  4OUM A;  2VVD A;  1A8D A;  4HPK B;  1ZBE 2;  3O1P A;  4LKS A;  2UWA A;  1XRU A;  2HJI A;  2VXR A;  5IK4 A;  4OI4 A;  3VDC A;  5A3M A;  5A1F A;  2R0F A;  2W39 A;  1W39 A;  3BCW A;  2VNG A;  1CD3 G;  1D2S A;  1DCS A;  1K3I A;  2X05 A;  2CYF A;  3C7E A;  4XUP A;  1ZZ7 A;  4P9X A;  1S55 A;  2D6K A;  1CAW A;  3I2H A;  2WNU B;  4XBL A;  1QJX 1;  1GNZ A;  1TEI A;  5LA2 A;  2FCU A;  1R09 3;  1RJ8 A;  2FMY A;  4A44 A;  4BCU A;  3MW3 A;  1UCX A;  3O7O A;  4EN0 A;  5IVF A;  1C4R A;  1LR5 A;  5FV3 A;  2LW8 A;  1JOB A;  4CCN A;  2YYO A;  1JHJ A;  1DZQ A;  4P9J A;  4QPI A;  4KU8 A;  3GHN A;  3KLS A;  4ZHN A;  2FZ1 A;  1QJU 3;  4Y1Y A;  3ZM8 A;  4AK3 A;  2PA7 A;  4CSW A;  2IXK A;  4PF1 A;  1IOA A;  1NCQ A;  3K4A A;  5DUV A;  1BYH A;  3LPF A;  4QM8 A;  3PVO A;  2VTF A;  4HL0 A;  4U36 A;  1UIK A;  1QNW A;  3H1W A;  2EAK A;  4OHW A;  1B35 C;  2Y6J A;  5GLW A;  4A3X A;  4H55 A;  1LKN A;  4DEQ A;  1AX1 A;  1DGW X;  4NUB A;  5F2W A;  3EHK A;  1JU4 A;  4BU2 A;  3IAQ A;  3ILR A;  1FT9 A;  4XEZ A;  1DP0 A;  5FFO C;  1NAE A;  2WFF 1;  3AK0 A;  4JGZ B;  2ORX A;  5JPM B;  1ULE A;  4M4R A;  1O5U A;  3POE A;  1X9P A;  4K20 A;  4WVZ A;  3NJX A;  1RUD 1;  1AX2 A;  3EBR A;  2W94 A;  4BQW A;  2FDH A;  2B7Y A;  2OUH A;  2JD9 A;  3UKV A;  1YCI A;  4CEY C;  3LSE A;  3OGJ A;  4LIU A;  1QXJ A;  2JDU A;  1IS4 A;  4ZZ8 A;  1ASJ 3;  1XU2 A;  2V73 A;  1LOB A;  2VZO A;  4GAZ A;  4J6G A;  3LF7 A;  3M3C A;  4XUN A;  3ZFE A;  1NCR B;  1W8N A;  4IE5 A;  4XAB A;  3I2D A;  3PJQ A;  3K48 A;  1POQ A;  2V4A A;  1GIC A;  2W91 A;  3NST A;  2YC4 A;  5DDJ 1;  3OSD A;  2RS3 1;  2VNV A;  3I4I A;  1XSQ A;  4KG0 A;  1OQE A;  3AMM A;  3HIF A;  4FOW A;  3TYJ A;  3KV9 A;  3MID A;  4I2O A;  5HBA A;  1D4M 3;  3JD7 1;  4Y1V A;  4CDX B;  4UFL A;  1UY0 A;  2EXK A;  1OA3 A;  1WBL A;  2BDR A;  2YC2 A;  2Q1F A;  1PM4 A;  3KZ4 C;  3Q8B A;  5EWS A;  5JXH A;  1H8T A;  3LDB A;  4XF1 A;  3SCG A;  3OOX A;  3WEZ A;  4C90 A;  3RI8 A;  5AFE A;  2VR4 A;  3CL1 A;  5IVE A;  4SBV A;  2WNU C;  4YFZ A;  1AYM 2;  4XCB A;  3RPQ A;  1V6O A;  3KWV A;  1H9P A;  4HK8 A;  5JSR A;  2Y6K A;  1BK1 A;  2JJ6 A;  4R9B A;  5FBJ A;  3VBS C;  5FXZ A;  5EYX A;  1MVE A;  4HON A;  4NPL A;  2BBA A;  2K9Z A;  4MX3 A;  3AKQ A;  2WLP A;  1VAL A;  5KHG A;  1WLW A;  2QTW B;  4Q2F A;  5B4X A;  2VVE A;  3U14 A;  3PVE A;  1MQT B;  4Y3O A;  4Z07 A;  5JUV A;  3B5L B;  3HNM A;  4XYX A;  1GOH A;  2AC1 A;  1JOJ A;  1RUE 3;  4M00 A;  4B4Q A;  3B69 A;  1FMD 3;  1O3R A;  3H1M A;  2DVD A;  3I2F A;  4GB3 1;  1RYY A;  5FYI A;  1H30 A;  2WO7 A;  3VKM A;  2WFP A;  4IEZ A;  4OUL A;  2AEN A;  1YRZ A;  2V09 A;  4QKN A;  4RHV 3;  1UYX A;  4MGY E;  5FZI A;  4AZZ A;  5A6Y A;  5KR7 A;  1GP4 A;  4L9B A;  3RZZ A;  3ZYJ B;  2Y6L A;  4QPG C;  3WQ7 A;  3WW4 A;  4LBQ D;  1H9W A;  3KV4 A;  1F15 A;  4YM2 A;  4LTA A;  2RJ2 A;  3OTF A;  3ITQ A;  4MO3 M;  5BXX A;  3QH6 A;  1A8M A;  3OGS A;  1LNS A;  1OBN A;  2RG4 A;  4LO8 A;  2DYC A;  1UY3 A;  1UKR A;  3AZV A;  3M8L A;  4BE3 A;  3LGR A;  1RUH 1;  3H42 B;  4JAA A;  3ZPY A;  1OKQ A;  2O8O A;  5FJK A;  4UW4 A;  4LBN A;  1G9D A;  2A6X A;  4OMD A;  4S2F A;  3U10 A;  2D93 A;  3QH7 A;  4KWJ A;  4IEY A;  2YXS A;  4R4X A;  2XWJ B;  3T2Q A;  2F6B A;  3UES A;  5FYM A;  1UYZ A;  1BQP A;  4WM7 A;  4LBQ B;  1ND3 B;  1WLC A;  1MQT A;  3BOP A;  1J83 A;  3JZV A;  1VBA 2;  1W3V A;  3TN9 1;  3KHB A;  4NHX A;  2RM2 3;  5F39 A;  3ORJ A;  1TMF 1;  1OF3 A;  2WS9 1;  5D2A A;  1FPN 1;  3DYP A;  5IVY A;  4D6R A;  1PNF A;  1JZ5 A;  4W6Y A;  4ATF A;  5KHI A;  5DPN A;  5F5C A;  4CP9 A;  1WLD A;  2Z69 A;  1H4H A;  3HD8 B;  1OVP A;  4E2Q A;  3WHT A;  3R4U A;  2OA2 A;  5KHK A;  2B42 B;  4XJ8 A;  1WMD A;  3W58 A;  1W9F A;  1DGW A;  1JH5 A;  1E5S A;  1NZI A;  2ZZQ A;  2P2K A;  4UFJ A;  1V9U 2;  4ZU4 A;  4WM7 B;  4LBQ A;  4BXS V;  2YG0 A;  4UFI A;  4RL7 A;  1YJK A;  2OXB A;  3C3V A;  3MLK A;  1W9T A;  4YFW A;  1DGL A;  4C1W A;  2QBX A;  2ADD A;  4EWD A;  2D98 A;  1J59 A;  1C1L A;  2WO2 A;  3TNP B;  2ADE A;  2JDP A;  2ZZJ A;  4CA9 A;  2V5Y A;  2WZR 1;  1PO1 3;  4LXL A;  2W1S A;  2GMM A;  4JVA A;  1REF A;  1WD3 A;  2R1D A;  3I2I A;  3KMH A;  4QGM A;  4LNV A;  1RIN A;  1RUG 3;  2KXL A;  4AAP A;  2J22 A;  2J1R A;  2A3W A;  1EPZ A;  2YZ4 A;  4FXG B;  4OUS A;  4YZ3 A;  3ZN5 A;  5FO9 B;  5LCW L;  5LA1 A;  3B00 A;  1W0O A;  3V64 A;  4EYU A;  4IV3 B;  3MPB A;  4FPY A;  3I59 A;  2TUN A;  1DZR A;  4LHN A;  1PM7 A;  2RS5 3;  5FMB A;  1KD7 A;  1X82 A;  1OUR A;  2JG8 B;  3NNF A;  1AF9 A;  2K2S A;  4QQP A;  4W65 A;  4Y33 A;  1T2X A;  3VL9 A;  2XJU A;  5A7W B;  4QGL A;  4LBK A;  2HYX A;  3V56 A;  3VBS A;  2BPA 2;  1QOS A;  4FI9 A;  1Q5O A;  1BJQ A;  5DN2 A;  2NMN A;  1GQG A;  3IIA A;  4JQR A;  2ZHK A;  1RB8 G;  4DY5 A;  2D6L X;  4Q0Q A;  1RVF 3;  5LBF A;  2RR1 2;  4YW6 A;  4FAH A;  3I49 A;  3AP4 A;  1R1A 1;  4UF0 B;  3B02 A;  4CDW B;  2GNB A;  3ZYH A;  3D8C A;  4FPL A;  5A7S A;  5FJH A;  4LA3 A;  2XBO 2;  2GP3 A;  2O14 A;  3CDZ B;  4Z92 B;  1RUF 3;  4UWD A;  4YVW B;  2ZKL A;  2A6W A;  4Y22 B;  3VD3 A;  4AYU A;  5J09 A;  1IGO A;  3LEG A;  1Q8P A;  1PO2 2;  1I9R A;  1QQP 2;  3LA3 A;  1ZYB A;  4KWK A;  3T09 A;  1GWM A;  2V72 A;  4AFM A;  2CY6 A;  5A32 A;  4L2N A;  2XUE A;  4FPO B;  1VBD 2;  3MIE A;  2DVF A;  4QPG A;  3ZSM A;  3D5O A;  2ZGT A;  3HR9 A;  4PCR A;  2Q8D A;  5JIA A;  5CYY A;  1U12 A;  2VTX J;  3MIH A;  1FXZ A;  3VZO A;  1DYK A;  4AEJ A;  3TN9 2;  1AL0 G;  2Q8C A;  2CV6 A;  5FLJ A;  1QJZ A;  2XXZ A;  3DYO A;  4QX5 A;  4CPB D;  2ARE A;  3SMH A;  2MEV 3;  2VCC A;  2A7A A;  2WNE A;  2GDF A;  4COY A;  2CHH A;  1DG6 A;  2ZGL A;  1OQD A;  1OKO A;  3ETP A;  3T2O A;  3I3E A;  2ZGO A;  3CQO A;  2DCZ A;  4JRL A;  1S0G A;  4OI2 A;  3DPR C;  3HQU A;  4AHZ A;  3C7G A;  1VJ2 A;  2IC1 A;  1X33 A;  2JDM A;  4W4Z A;  4A7K A;  2EA7 A;  1REE A;  3WLU A;  5AFB A;  2BVB A;  5FK8 A;  1DHK B;  2ZGP A;  4GZ9 A;  2VUJ A;  1OMI A;  1GZT A;  2Y26 A;  1OOP C;  4OCT A;  1F2N A;  1AR8 2;  1LU2 A;  4GWJ A;  3GBG A;  1UY2 A;  1WME A;  3OGR A;  5C8C C;  5FZK A;  2WLQ A;  2IXC A;  4CU7 A;  4XPV A;  2B39 A;  4IV1 A;  1FYU A;  3AMQ A;  1JU3 A;  4GD4 A;  4JDO A;  5FP9 A;  5KXE A;  5ACA 2;  3TBD A;  3HN1 A;  3PHM A;  4JTN A;  1BEV 1;  1VLN A;  4M0H A;  1HRV 2;  3WOG A;  5LBE A;  4AED A;  3KHC A;  1H1A A;  5FPA A;  2WFF 2;  2PQQ A;  1KJR A;  3AL6 A;  3NW4 A;  4QX2 A;  1X50 A;  2RDN A;  3CNA A;  4DUV A;  2OZ6 A;  2XQX A;  2CWM A;  1CES A;  2ET7 A;  4XUR A;  4YNI A;  3NMB A;  5E1R A;  4DY3 A;  3EQE A;  1JUH A;  4XMA A;  2RS5 2;  3CZJ A;  3NJZ A;  3AKS A;  4FT8 A;  5DQ0 A;  1AXZ A;  2F4P A;  2R06 1;  4JV4 A;  4G9S B;  4M01 A;  3KF5 A;  2O0O A;  4A4A A;  1FV3 A;  1O8P A;  4N9I A;  2OT7 A;  1ALY A;  5FYU A;  4ASK A;  1W9W A;  2WA4 A;  4P5Y A;  4Q0P A;  1Q56 A;  1RUD 3;  1WCU A;  1RVF 2;  1LB2 A;  2PLV 3;  3PLQ A;  1LAJ A;  1RUH 2;  3FC0 A;  1CIW A;  2WSV A;  3JD7 2;  1VBA 3;  2P6C A;  3JXS A;  1Q8Q A;  4C1X A;  2QQJ A;  2FCT A;  4MSV A;  4E8D A;  5FYT A;  3Q8E A;  3BI3 A;  2HEW F;  4K40 A;  2GN3 A;  4AVT A;  1LOE A;  4KBZ A;  4YW5 A;  3PNA A;  2RS1 1;  4L0P A;  2GMP A;  1NX9 A;  1VBE 2;  2D5H A;  1E5R A;  2UWC A;  5A3L A;  1QU0 A;  1O3Q A;  4Q4X 3;  2KR2 A;  1ND2 B;  2GU9 A;  3MBW A;  4XXA A;  2VNO A;  4EZH A;  4GIQ A;  1IZ3 A;  1QJU 2;  4H7M A;  1PGL 1;  1PGS A;  1IPJ A;  3BGA A;  3M1H A;  3ACI A;  4QDR A;  1YNA A;  2HWF 2;  3PTY A;  4IGQ A;  2XJT A;  2XR4 A;  4Q8L A;  1K12 A;  4FFG A;  1DU3 D;  4DS0 A;  2G1M A;  5IYY A;  1GU3 A;  4I0B A;  5FLI A;  2RDR A;  1ULC A;  3LWC A;  3VZM A;  2OKX A;  2VAU A;  4V1P A;  1SMV A;  1AYN 3;  1UD1 A;  4XUQ A;  1RGS A;  3UNP A;  4IDZ A;  5I8T A;  2XKO A;  3BU7 A;  2QZ2 A;  2VNR A;  5LBC A;  4B3N A;  1SLA A;  5FY4 A;  1XNC A;  3VN4 A;  3I2O A;  4XCA A;  1U5Z A;  3M3Q A;  1UMH A;  4PQ9 A;  1BEV 3;  4L97 A;  2CU5 A;  1ZA4 A;  1D4M 1;  3N4M A;  5IAV A;  1IS5 A;  5FWJ A;  1J1T A;  1NOV A;  3WW2 A;  1BK0 A;  3WF4 A;  2CL2 A;  3WSO A;  4JTO A;  2BVV A;  1GZC A;  2RJK A;  4JGY C;  1K5M B;  2BNO A;  3NNM A;  4YW2 A;  1UKG A;  3PVB B;  3ZFF C;  2ORZ A;  4Y1Z A;  2QFE A;  4D94 A;  4HOO A;  3BYW A;  3ZYI B;  1UOG A;  1AUY A;  3WF0 A;  2NP0 A;  3Q8C A;  3J4U H;  4DUX A;  5IVJ A;  3VBH C;  2R1B A;  2WQZ C;  2XB6 C;  3CO2 A;  4FAG A;  1C8M 3;  4LHS A;  5A1L A;  2VOT A;  1VMH A;  3G6J B;  2C0Z A;  5DMY A;  3WT3 A;  1NLR A;  3H1Y A;  2OPW A;  2VW2 A;  3SEE A;  4URT A;  4YSF A;  1YLL A;  5BV6 A;  3CLP A;  3U4S A;  3ZO0 B;  2ZGQ A;  2DTY A;  1M06 G;  1GNH A;  2JEM A;  4IV3 C;  1PMH X;  3ZSE A;  1NT0 A;  4IW3 A;  3E5X A;  5A3P A;  5DXD A;  2AZ5 A;  2CSG A;  5GAL A;  1VBB 3;  2OQ6 A;  3N9Q A;  4E2S A;  4Z1V A;  2WAA A;  4K1Y A;  3RDI A;  2ZEY A;  3OCP A;  3MDP A;  2UYA A;  2LRP A;  4UFK A;  1DF0 A;  3EXU A;  3POI A;  1W6M B;  4DXZ A;  2F4L A;  3VBR C;  3WQ0 A;  4R4Z A;  2E33 A;  2P4E A;  3U78 A;  1YQ6 A;  3DN7 A;  4Q4X 1;  4BQ3 A;  2XOM A;  1FNZ A;  4AXO A;  5C3P A;  2EXI A;  1UMZ A;  1PMI A;  3D4K A;  3OD4 A;  5IWF A;  3SH5 A;  1FV2 A;  4E8C A;  1ZNP A;  4B29 A;  3UT0 A;  1S4C A;  1W06 A;  1MS0 A;  2CGO A;  3R4S A;  4QB2 A;  1C5H A;  3SQO A;  3ZKY A;  4DXT A;  1G9C A;  2MEV 2;  5CIS A;  3AMP A;  4A45 A;  5CFC C;  2RJL A;  4MV2 A;  5EQU A;  4FFF A;  5IFT A;  4Y5T A;  4XW3 A;  5FXX A;  2GC3 A;  5GZD A;  4CDX C;  4IEW A;  1WMX A;  5JCT A;  2J1T A;  3OPW A;  5T5J A;  4D7S A;  3RI9 A;  1V70 A;  1BXH A;  1AR7 3;  4XF3 A;  2VCB A;  4YVS A;  1YC6 1;  2VMF A;  1Y3T A;  3BVC A;  4AQT A;  4ASM B;  5HCA A;  1FI2 A;  2CDO A;  3ES1 A;  1YYN A;  1Z7S 3;  4QD2 A;  2R6Q A;  4DRV A;  4D8M A;  2VOX A;  3LCP A;  4DNY A;  5C7G A;  2OPK A;  1H8T B;  3WNX A;  2FZ2 A;  2WZR 3;  1KRI A;  1H2L A;  5C4W C;  3WHU A;  4EN6 B;  4TLG A;  1JW6 A;  1GUI A;  1ZZB A;  2PEL A;  4LO6 B;  1UNB A;  2A75 A;  2ZAA A;  5IUQ A;  2JB4 A;  1LOG A;  3UYJ A;  1APN A;  2FDJ A;  5C5U A;  2ZEW A;  1R1Z A;  3OY8 A;  1AYN 2;  2ES3 A;  4AGG A;  2R07 1;  5F3E A;  1R08 1;  5FY5 A;  3VDD B;  1UMI A;  1ULO A;  4IEQ A;  5FPZ A;  1NA1 C;  5FZG A;  2HWE 2;  2A6Y A;  1FOD 2;  2CWS A;  4M4P A;  2HWC 3;  1VAK A;  4R9C A;  3MF6 A;  3OBR A;  4GKX A;  4LKE A;  1LHU A;  3QBQ A;  3OGV A;  3HWJ A;  5LWB A;  1RUC 1;  2ETE A;  1HRV 1;  5D8A B;  5JPN B;  1K42 A;  1ZRD A;  1CJP A;  4LE4 A;  1D7P M;  3WUD A;  4DFS A;  1VAM A;  2P3I A;  3R0R A;  1GR3 A;  2Z5W A;  2J1S A;  3FE5 A;  1VRH 2;  2ZS6 B;  1X7N A;  1W6P A;  4Y26 A;  3A0K A;  5CNA A;  2RS5 1;  2VUA A;  3III A;  3U0Z A;  3FLR A;  1XQN A;  4GJY A;  4COU A;  1ZRI A;  1E57 A;  1VP6 A;  4HKW A;  4KWL A;  4Y1X A;  2TEP A;  1Z78 A;  2IWG B;  4BOW A;  4CZS A;  5J36 A;  2ID4 A;  4NVP A;  3EJK A;  1W99 A;  1LHO A;  4E2G A;  4E4Z A;  1HB2 A;  5FZH A;  3AVS A;  1S2E A;  5JR7 B;  4BLI A;  4PDW C;  3VD4 A;  2DWR A;  1POV 1;  3AL5 A;  3VHR A;  3FUO A;  1URX A;  4YRD A;  1LEM A;  1CZS A;  5LY2 A;  4A41 A;  1IS6 A;  1R64 A;  3AVR A;  2E51 A;  1B35 B;  2VCA A;  3MHZ A;  3OYW A;  4BQX A;  1GV9 A;  2QQL A;  5BNN A;  4XBQ A;  2WWU A;  4FCA A;  1JOP A;  4ITC A;  4PLM A;  1XNK A;  4JHZ A;  4LHK A;  5FMO S;  4DZG A;  3WVJ A;  1IQA A;  3RZM A;  1SFY A;  1K45 A;  3PUI A;  1BCX A;  4JC1 A;  2I45 A;  2ZAH A;  1HV1 A;  1DQ4 A;  1PZ7 A;  4DEV A;  2VBB A;  4QXC A;  5D21 A;  1WA6 X;  1RMU 2;  3ZLI A;  4FPF A;  2RR1 3;  4EQV A;  3O1M A;  1MR5 A;  4PIX A;  2NLR A;  4GAL A;  5A3T A;  2CGN A;  3RNS A;  3RFR A;  1BEV 2;  1HN1 A;  1WW5 A;  2VZ1 A;  2HH9 A;  2XBO 3;  4CUC A;  5BNN B;  1QOO A;  3AYA A;  4XF0 A;  1UZY A;  5FYZ A;  4YZ5 A;  2BU9 A;  1BBT 2;  2Q0A A;  2GZW A;  1DFQ A;  1RUJ 1;  4W8J A;  4FFI A;  1OD3 A;  4MZU A;  5F6L B;  2BRT A;  5LB6 A;  3K3N A;  1W2O A;  3V65 A;  4CU9 A;  4K7J A;  3J7N A;  3QAC A;  3D82 A;  4XET A;  1PK6 A;  5D8A C;  3BTZ A;  4W50 A;  5T5O A;  3WDW A;  2ZML A;  1SDW A;  1GNY A;  5K0U B;  1X8E A;  4ZKT B;  3NKG A;  1B35 A;  4AFB A;  4IEX A;  1W8U A;  4BK4 A;  1SFN A;  2PAK A;  1Y7B A;  5CBL A;  4NWV A;  4C91 A;  3BPZ A;  1U5X A;  2SLI A;  5ABJ C;  1XE0 A;  2GAL A;  4DIN B;  1WKY A;  1JUI A;  1HN0 A;  4XFC A;  3KVB A;  4LBO A;  5A7W A;  2YFZ A;  5JZG B;  2VD7 A;  4FBF A;  1KQR A;  3MIG A;  3ELN A;  1QMJ A;  2BJS A;  1FOD 3;  2Y8K A;  4PIY A;  1LED A;  2D97 A;  4HG6 B;  3O0W A;  4ISR A;  2W87 A;  2VG9 A;  4WV8 A;  1VBE 1;  3T30 A;  1Z0H A;  3THP A;  1WCQ A;  1Y9M A;  4L11 A;  3SHR A;  4B1L A;  5CFD C;  4XBN A;  4GQ7 A;  4NR1 A;  4P9Y A;  3TRS B;  5IVV A;  5FZ8 A;  4ORF A;  4CXX A;  1YJL A;  3SIS A;  1GSL A;  1JYT A; 
#chains in the Genus database with same CATH homology
 2KR2 A;  2O14 A;  2Q1F A;  4LK6 A;  3UT0 A;  1V0A A;  1W90 A;  1W8T A;  1W9F A;  2K46 A;  2VXJ A;  1GWL A;  4CP9 A;  4LKD A;  1OKO A;  1W8Z A;  1HN0 A;  2WYF A;  4YW7 A;  4A6S A;  4CP9 B;  1GWM A;  4YWA A;  4AL9 A;  2LRP A;  1WMX A;  1WCU A;  3ZYF A;  4BQ2 A;  4BQ5 A;  4CPB A;  1L7L A;  3ZYB A;  1GWK A;  3F95 A;  1WZX A;  2C24 A;  4BQ3 A;  4LKF A;  4BQ4 A;  1OH3 A;  4LJH A;  3ORJ A;  2LRO A;  4YW6 A;  4LKE A;  1UOJ A;  1W8W A;  5D21 A;  2JWP A;  3ZYH A;  4LK7 A;  1W8U A;  4CPB D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...