1OH3A

E78r mutant of a carbohydrate binding module family 29
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
141
structure length
141
Chain Sequence
RATYTVIFKNASGLPNGYDNWGWGCTLSYYGGAMIINPQEGKYGAVSLKRNSGSFRGGSLRFDMKNEGKVKILVRNSEADEKFEVETISPSDEYVTYILDVDFDLPFDRIDFQDAPGNGDRIWIKNLVHSTGSADDFVDPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ligand-Mediated Dimerization of a Carbohydrate -Binding Module Reveals a Novel Mechanism for Protein-Carbohydrate Recognition
pubmed doi rcsb
source organism Piromyces equi
molecule tags Carbohydrate binding domain
molecule keywords NON-CATALYTIC PROTEIN 1
total genus 32
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-05-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 1oh3A00
1W8TA 4CPBA 1W8WA 4CP9B 4CP9A 1W90A 4LJHA 2C24A 1OH3A 4LKFA 1W9FA 1WZXA 2LROA 4BQ5A 4LK7A 2K46A 1V0AA 1UOJA 4BQ2A 3UT0A 1W8UA 3ZYFA 1WMXA 1W8ZA 3ORJA 3ZYBA 2O14A 4YWAA 4AL9A 4LKEA 4BQ3A 1GWMA 2Q1FA 1GWLA 2JWPA 1GWKA 3F95A 3ZYHA 2LRPA 4A6SA 5D21A 4YW7A 1L7LA 4YW6A 4CPBD 2VXJA 4LK6A 4BQ4A 1OKOA 2KR2A 4LKDA 1WCUA 1HN0A 2WYFA
chains in the Genus database with same CATH superfamily
3ZSJA 2P3JA 3KT4A 1RUC3 4XVHA 4GMP3 4LLFA 4OMCA 2WKKA 3SKJE 1S2BA 4AHWA 4AW7A 3PVEA 1H30A 1OMIA 4CXWA 2B46X 4GWJA 1AYM1 5LATA 4YZ1A 2YGMA 4XFIA 5A7OA 1TQ5A 5KR7A 5C4WB 1J3RA 2ZGLA 3NNLA 4QB6A 1GWMA 2YB7A 2WNVC 4K1YA 4KWKA 1UMZA 1YQ5A 2FCTA 1AF9A 4Q29A 2DFBA 3NNMA 2D97A 4XE9A 4UOJA 2WS93 3C7GA 4I3PA 2VMDA 3ZFGA 3QH7A 1KS5A 2B5HA 2GU9A 1XNDA 2JDMA 2AH2A 3AMHA 1A8MA 4N9HA 1PIV3 4KBBA 3WG2A 4K6BA 3VBFC 1FNZA 1AR71 3KF5A 4CP9B 3IDBB 1KDMA 3H50A 5FZ8A 3WHTA 5F2SA 1DCSA 5IVVA 4GB31 4IE5A 3O1RA 2V72A 3RQ0A 2VQUA 3BU7A 3VDAA 2BOJA 3ZFFA 1UIKA 5DDJ3 1DQ5A 3OGJA 3ZFFC 1BEV1 3ETQA 3AKSA 3QBQA 4QX7A 5C70A 3FWEA 3M70A 1MR5A 1COV2 3GM8A 1I9RA 1DLLA 4GMP0 5JZGC 2VCMA 2RDNA 1E5HA 3C7FA 1L7RA 1Q43A 1DZRA 1G7YA 3NW4A 4MADA 4XAAA 3VBFA 4D6RA 5BNOA 4RA0A 1QH6A 2OUHA 2OQ7A 3PNAA 2JDYA 4Q1RA 4Y1XA 4META 3SCHA 4EYUA 4ZZ5A 2YC4A 3ZFGC 3H3ZA 1PIV1 1QJU3 1PO22 2OVUA 4ITCA 2VNVA 1IGOA 4MGSA 2BRTA 3O1UA 4EJRA 1YI9A 4UW4A 4CU8A 1C28A 3CKHA 4NIAA 5A70A 5KBFA 1GZWA 1N3OA 1XNAA 1HX6A 5ABJA 4PIYA 2CU5A 4LPLA 5KXDA 4NPMA 3T30A 1UZWA 2JIJA 2RG4A 4NE9A 4XDPA 3MF9A 1UY3A 2UURA 1NCRA 2ZX3A 5ACA3 3ME2A 3CMGA 2FZ2A 1V00A 3F95A 3UNPA 3GBWA 4YM1A 1WUVA 1ONAA 4K9SA 4Y4RA 2A1XA 4QX5A 1TG7A 1UN1A 4HOOA 2FZ1A 3WT3A 1BEV2 1O91A 3KQRA 5GALA 2R1BA 1NCQC 1VMJA 1PZ9A 1R1A2 2Y6HA 3VBOA 1GZCA 3H7YA 4P00B 5A6ZA 1A78A 1D2QA 1OPMA 2SBAA 4AFAA 1RUC2 4XZUG 2ARXA 3Q8FA 3WF4A 3ZN5A 4CCOA 3SCFA 4MG2A 4E4ZA 2ZX4A 3U4SA 2E7AA 3DUIA 5FIXA 1AYN3 2IUWA 2XBO3 5F6KA 2WZR2 2VNRA 3F2ZA 3VBFB 3WUDA 3AVSA 5JIUA 2WN3A 4FOVA 3HEIA 2WLQA 4IGQA 2RDRA 4QX1A 2HEWF 3AC0A 4W4ZA 4U2AA 2C5DA 3D0SA 1D4M2 1KS4A 1LHUA 2TNFA 1RHI2 5FY9A 3S30A 2VVEA 1U0AA 5CFDA 3OGGA 3MLJA 4D7SA 1MS3A 2ZKLA 4RFT0 4BB3A 2QE3A 4EWAA 1N1TA 1FMD1 2P3KA 2V73A 4L92A 4E8DA 3OEAA 1BZWA 1HXS2 2WNOA 2ZEZA 4BIOA 1KJLA 2F17A 2CL2A 1S0BA 1NA1C 4QQHA 3VD5A 2C4XA 3R4DB 4DUVA 4JGZB 4MGTA 5C6CA 4HVOA 2IVIB 5FZHA 4CU9A 1JZ2A 4Q4X2 4L2NA 3B02A 4HN0A 1QHDA 2GMEA 4P9WA 1LOGA 4CYDA 2QQLA 4XFFA 1SMVA 3HNYM 1EY2A 1IQDC 3MHZA 3NNGA 4CUAA 4QKDA 4XURA 5FZ9A 3GZAA 2BWCA 4UW3A 3RNSA 5ANQA 1W2AX 3C7EA 3VBHA 2VZ3A 4DNYA 3GGLA 1CAXB 3HBKA 1E57A 1OOPC 1SPPA 2XJRA 3KM5A 1W3XA 3JD73 1H8TB 2IXJA 3I2DA 1LKNA 3NSTA 1ZZ7A 3DXUA 2WT2A 4HN1A 5CVRA 5FK8A 4D7TA 3OEBA 5A3PA 5C7GA 1RYYA 4ZS3A 1HJFA 2BJSA 3RMYA 3WF2A 3OCPA 2OS2A 2QCSB 4WVVA 1Z7S1 2D3SA 3L2YA 1RVF3 5FBJA 1JYNA 1RUG2 4DUWA 1O8SA 3ALQA 5BNNC 3QLQA 2YYOA 3IB3A 5AVPA 2FDGA 3ASIA 4QX8A 4UFMA 3WV6A 1YYNA 1DQ2A 2KXLA 2Q5TA 1MEC3 4A3ZA 1UW8A 4XQ4A 3FUQA 3O1SA 2YU1A 1EUTA 3RYKA 4JZRA 3RZGA 1ZBE2 2RDSA 1SBEA 3R6SA 2PQSA 4E2GA 3PUSA 5A1LA 1STMA 1EP0A 2ZGOA 3FFQA 5FY4A 5FREA 1YQ6A 2Y33A 1VBE3 3BN6A 4AFDA 3VB9A 2CGPA 1U5IA 2A6XA 4DINB 1W99A 1HRV1 2JXAA 2ZBJA 4WV8A 3ZFGB 1C57A 4KL1A 4PCRA 1IPKA 3JB8A 5FP8A 4M3CA 4CEWA 1CAVA 1QJY1 3H1WA 3WOGA 1H6XA 1SG3A 2BGCA 4XQWA 2A6VA 2ETEA 5B4NA 4YVSB 3EBRA 1G9CA 5T3NA 5BNPC 1RC6A 1CN1A 5FZ6A 5KHKA 4MGKE 1JI6A 5CKQA 3MPBA 3BB6A 3CNAA 2RS51 3VDCA 2RMU3 2YC2A 1ZBA2 4OUSA 1SFPA 2EAKA 4DFSA 1EV11 5FZDA 2E63A 5LW9A 2RM23 1W0PA 3M3OA 1IS4A 2H0BA 3N7KA 1P8JA 4XOGA 4XYXA 4QPYA 2WQ8A 1I6XA 2D6NA 4B1LA 3LA2A 2I07B 3PUIA 2RS12 1QNWA 4V2VA 5FZFA 4CDWA 2R16A 4CP0A 2JG8A 1I3HA 1X7NA 2IXCA 3PVNA 2XQXA 1RUE1 2B39A 1YJKA 4ISQA 2OIIA 4IV1C 3GDBA 2Z5WA 1CONA 5F7UA 3HR9A 1JMUB 1HIXA 2RVAA 3WP5A 3E6CC 1ULDA 1MS1A 1VBE2 4OHVA 1HRV2 2RS53 4NHLA 1QEXA 2ARBA 3GZTB 1E5IA 2VZOA 4LIVA 5FYBA 5A3TA 4UFLA 1CAXA 4M4PA 1LGBA 2VG9A 2YDEA 1YLLA 5HPOA 2GC1A 4XXAA 4O65A 3L2HA 4RL7A 3TOJA 1XU2A 4LUKA 1UOFA 2DURA 4NN0A 1X8MA 5H9PA 1RHI1 2UYBA 3S5QA 4N53A 4AVBA 4DIQA 5JXGA 5E8AA 3W5MA 1CAWB 1YC61 2JE7A 1I5ZA 2IC1A 1Y4WA 5FYUA 2G1MA 5F5AA 4AEDC 2O14A 1SBDA 2A75A 1YFYA 4Y22B 1XNTA 2QBXA 2LUWA 4R4XA 3ZFEB 4UW5A 5F3GA 5IVBA 3VZJA 4GXLA 3OJBA 4GH4C 1W8NA 5HXMA 1PO13 5C8CA 3RSJA 5LEJA 5BNOB 2ZKNA 2ZXQA 2DCKA 4HG6B 5IK4A 3PTRB 4C8DA 3KVAA 1LOFC 1XBFA 1LECA 3CBNA 3VN4A 1NY72 5K0UB 3H7JA 3MW3A 3WDYA 3H8RA 1RUNA 5H9RA 3U4XA 4JDOA 3A0KA 4QPIC 4XF1A 3OPZA 5IJRA 4LHNA 2JICA 2YPJA 5FXXA 1UU5A 1ZVFA 4NHKA 4FXKB 4NUBA 4BYYA 3J4UH 4UBGA 2Q8DA 4HANA 2NYYA 1F5JA 4GH4A 4JVAA 4XBNA 1HRI3 1OKOA 3KWVA 4N53B 3IKWA 4QQPA 2ERFA 2GNMA 4E8CA 4I2OA 1GU3A 3ZIWA 1I5PA 3L9JT 1REFA 3JQWA 3LIGA 4AQSA 4XIKA 5A80A 2JDPA 4KBZA 3CIHA 3BUCA 3OSDA 2BBAA 4RHV1 4N90A 4KH9A 3JZVA 4A6OA 1D0HA 1DZTA 1OVPA 1XOYA 3KV4A 1ZRFA 2VVFA 3WG4A 5C9AA 2GH8A 3WQ7A 1WBFA 2HWD2 2BNNA 5FXWA 4OI1A 2P3IA 2RS33 4ZY9A 5BNQA 1JODA 3AZZA 5I0DA 4BQ1A 3MFCA 3O1OA 4IEWA 4Y5SA 4AI0A 3VBOB 1AR81 5EQUA 2R7EB 2ZGUA 3WF0A 1FPN3 3N9LA 2VNOA 4DY3A 3HN3A 5I8YA 2YU2A 4FPEA 4R52A 3VZOA 4RN5A 2VZTA 1GP6A 3RJ2X 4LTAA 1UCXA 1W8HA 3RZZA 3WQ0A 4FCAA 3O7OA 1SZBA 4QKNA 3ZSMA 2B9UA 3MFAA 4FOYA 4ZS2A 5L9RA 5JCTA 5DZFA 3DXTA 4BIFA 5HCBA 3BI3A 2JG8C 3PURA 3SEPA 2CV6A 3CF6E 3UT0A 2JG9B 2J1TA 3ZYFA 4AI2A 4FPCA 1NA1B 5FYYA 3HT2A 4QKFA 4PDWB 2BOIA 2EA7A 2CYFA 5FPLA 1CX1A 2VNGA 1GNHA 1YFUA 3AJZA 4S2DA 1NG0A 3O0XA 2HWD1 1LR5A 2CNAA 2JKXA 3OB8A 4Q4Y2 1LOCA 1ZZ8A 2OW4A 2LALA 3I97A 2W1UA 4KG0A 5BNPA 1PK6A 5EP9A 1BK1A 1H1AA 2YPDA 5KC6A 3BU0A 1RUC1 3S5AA 1H4HA 5K0UA 1H6YA 1GNZA 2DF7A 3J7HA 5FPXA 2WINB 3LDKA 3LFMA 2BQPA 2WL1A 1QY4A 3KV9A 1W28A 1JHNA 2P3YA 1U5YA 1S1AA 1PK6B 4YZ4A 4YGDA 3AL6A 5LA9A 4GALA 1K5JA 4D7YA 2ZGSA 2VVDA 5FYMA 5FPVA 2G9GA 4YSFA 3W21A 2ZABA 3AMMA 5T5OA 3APBA 1VBE1 4XDOA 5T52A 5M0TA 2J1RA 2BVVA 2W9XA 2P5BA 1RUI1 2IXKA 4I30A 4LT5A 1JYIA 3AMQA 2OX0A 3ZIXA 5C3PA 2W1WA 2J1EA 1QJY3 1DBNA 1VBC3 4A41A 4ARXA 2H6CA 3I49A 2VE1A 1REDA 2XVKA 2ZX1A 3TNQA 1KXGA 2D7FA 4QXHA 3BODA 2Y6GA 4R9AA 2C26A 4QMAA 5FLHA 4KWLA 1R1ZA 5JXHA 3VDDC 1O3QA 4UFIA 4CE8A 5F3CA 4RR3B 2WS91 4YZ5A 4UFHA 4PI0A 2HEVF 4IESA 3IMNA 1JW6A 4RS5A 5F5QA 2J1UA 4RYDA 1HJGA 3VZNA 3KV6A 3DV8A 3UJOA 4IDZA 5A7NA 4PLOA 3J26N 3I3EA 2ATFA 3M3EA 2P6HA 4PF5A 4PHZA 3RJRA 5DUWA 3AZYA 4AVAA 1ND3A 1RVF1 1CJDA 4LHSA 1RHI3 1ZRCA 4KGQA 1K5MB 3HAGA 4Q4X1 1BVP1 1QQP1 1OI6A 4MUVA 5FY0A 5A3MA 1WMXA 5EIYB 3K48A 4HVQA 1CZSA 1V6KA 1HXS3 1NA1A 2VJXA 1CESA 1DQ1A 3T08A 1PM4A 1D7PM 1S2EA 1C1LA 2B45X 3NWKA 3OBTA 4AI3A 5F6LB 5FZIA 1L7LA 1MS4A 2WFF3 4LO4B 5FUPA 5F8PA 1OSGA 3ACIA 2W46A 3K51A 4TSVA 1VBD1 5CFDC 3AP6A 4MXVA 5DAQA 1W2OA 3M7AA 5JMOA 2D40A 2ZZQA 3I8TA 1PO21 1UXZA 4KWJA 5BNPB 5LY2A 4ZU4A 1ULPA 1W6QA 2LROA 3ST7A 2PN5A 5FZMA 4FPYA 1H1MA 2WABA 3ZN6A 1NKGA 5CFCA 1Z7S2 3LZZA 4E27A 3ZYBA 2DU1A 1YCIA 1AL22 2RJLA 1POQA 4YARA 2NP0A 4EN9B 2X8KA 1NCRB 2XH6A 1JHJA 2C0ZA 4FPOB 3N7LA 5FZEA 2WYSA 1WCKA 4SBVA 2WT1A 4BA6A 1WD3A 1ND3B 2VZUA 3OTFA 2D6OX 4LBQB 3U10A 4W65A 2C24A 4P9JA 3S0MA 2VBBA 3V0BA 1GV9A 3DEMA 1NCRC 3BTZA 2VTXA 3JXSA 1C5HA 3PL0A 1Y43B 2WSVA 4OI4A 2RJ2A 5DG1A 1PVXA 3V56A 3N7JA 4C91A 4DRRA 3KHCA 1RXGA 1MPXA 4MGZE 4NIGA 1ZRRA 3NV1A 4G9SB 3WY6A 3RI8A 1WW5A 4PQ9A 2D5HA 3EJKA 5HCHA 2GAUA 5L7OB 5BNOC 1UKRA 1W3VA 4CDQA 1BKZA 3VL9A 2YUEA 4PBPA 5EJ3A 3PVBB 3MF6A 1MQTB 3D4KA 1LJ7A 1W06A 4D6QA 2VOTA 3POYA 5FZBA 1QJX3 4AQ6A 4AHXA 3H1YA 3ZKUA 5K7PA 1UMIA 1WLDA 2MEV2 5FZKA 1Q56A 3OPTA 2XXZA 2UWAA 1K45A 2W39A 3M2MA 2EF6A 2YG0A 5LBFA 2F6BA 1MQTA 2ZGQA 3AP5A 3HWJA 2E31A 4BMEA 1ASJ2 1ST8A 1W6PA 3KCXA 3U75A 4CU7A 4B7KA 4CUBA 3QOPA 3MPPG 5D1IA 4I09A 2AEZA 1RUJ1 3LCPA 4NHMA 4QM9A 3IT8A 3UKTA 1YQCA 3KZ4C 2FMYA 1A6CA 4Z2AA 5FYVA 3GZUC 4Z1VA 5C3OA 3S57A 1EUUA 1SFYA 3UGGA 1YQ8A 1VR3A 3LPFA 4LJHA 5JSPA 4COWA 4QHBA 3WSOA 2BNMA 4JHZA 2JD9A 2BW8A 1CWPA 1UMHA 3ZXKA 4IETA 4S2GA 2OT7A 1FNYA 2HWC1 3I2HA 3RPQA 3AZXA 3S7IA 4EN8B 5FPUA 3TRSB 3D3AA 4YM0A 1LOEA 4P14A 2JDNA 2PYTA 4N9IA 3CJIC 4WVMB 3WW3A 2JEMA 4ZU7A 1VRBA 1GUIA 1LOAA 5FYIA 3AYDA 4FP2A 1S0CA 1GP4A 3ZYHA 2BP6A 5FOJB 3MW2A 3PVOA 3BPZA 1ZM1A 5A33A 1V6NA 5DAPA 3BKZA 1XNKA 2IVJA 2FDJA 4WM8C 4UF0B 4CDWB 4Y5TA 1RGSA 3LSDA 3E1F1 5CISA 3MBWA 5FQ0B 5JXJA 2RR12 3NMBA 4I01A 2FHRA 4HETA 1XYNA 1ASJ1 3Q8AA 5JAXA 2WWJA 3THCA 5FZ1A 4I0WB 1D4M3 1PX3A 3B5LB 4EN6B 2VCCA 1RUF1 1OT5A 4W50A 5CFCC 4Q4X3 3UKNA 2WO7A 4JKKA 2IFWA 4YVSC 4QHOA 1UZYA 2GMPA 2R062 4AK3A 3AYCA 4JDMA 3WDUA 1RUE2 3INAA 5G04L 1TMF3 3ZSEA 1AXKA 2VBDA 4R9BA 1H2LA 3AP9A 4IV3C 5T5LA 4QU1A 3S7EA 2D6PA 5AC93 1W2UA 1YWKA 4H3WA 5IAXA 4E4HA 3MIBA 5LK7B 2E26A 5FZAA 1B35C 4DB5A 3JUUA 1HQWA 4GQ7A 5EPAA 1OPOA 1DGWA 3ZXAC 3HMYA 4FPJA 4KQ7A 5I91A 1W9WA 3RZLA 4MHUA 4XUOA 2OYZA 3K3OA 1G9DA 1GQPA 3KSCA 3PMEA 4J1WA 4PDWC 4NO4A 1MACA 4IEQA 1UY1A 2HBTA 2QKDA 2Y38A 4JC1A 4QX0A 3I2FA 5J96B 4FPFA 4M01A 5FWEA 1J1TA 2DCTA 2OUJA 4OLLA 3ACGA 3ZM8A 5BV6A 4K3UA 4RQPB 3AL5A 3I2JA 2NN8A 3H0OA 2WQ4A 1NT0A 3VHOA 5C71A 2J7MA 4NRQA 1GZTA 4M3CB 1VRH1 3KV5A 1JZ8A 3NV4A 3B94A 2RM22 2Y6FA 1TE1B 1W2TA 1WCUA 4LXLA 4Y3OA 3SNMA 5APAA 1BBT1 1W9YA 3N9NA 2VUAA 4A42A 4MYEA 1CPNA 1W90A 3AMNA 4Z82A 5KC5A 5DZGA 3RG0A 1ZREA 1N1YA 5FFOC 1LRHA 4DQAA 4FBFA 1N1SA 2WDBA 4URTA 1CD3G 1VIWB 4QDRA 5FJKA 1BLZA 4XJAA 4KMQA 5HI0A 3ZR5A 5BNNB 2XJSA 4Q0VA 1F5FA 2A71A 2D44A 4OUMA 3LOBA 2PELA 3DGTA 2R041 2JDHA 2WWUA 4Y22A 5LBCA 4XJUA 4MOAA 3POJA 4GAZA 2XJUA 2FQPA 4IEPA 3WNNA 1B09A 3ZYRA 4DMIA 5JLVA 5IYYA 4JCKA 1H9PA 1PZ8A 4RFRB 4EE2A 1QDOA 4OULA 2WS92 3U11A 2PMWB 4QQ2A 2VMIA 1MZFA 4B4PA 1OLRA 2XHNA 2JENA 3FZ3A 3ZX7A 1UOJA 1QIQA 2WLPA 3PU3A 1LTEA 1HB3A 1PK6C 1W0OA 4IEOA 4Z2WA 1Y9MA 5KHHA 1ZZ9A 2A5ZA 1XB9A 1LGCA 2VZ1A 3IIAA 1JU3A 5GZCA 1JH5A 2DVGA 4NRPA 3FX3A 2D6KA 2Y34A 3DN7A 4XUPA 2Q8CA 4NVPA 4J6GA 4E4SA 2ES3A 2HWB2 5DXDA 2N7GA 1LOBA 2HWD3 4HSLA 4LHKA 1RL3A 3LIHA 4LKFA 4WM8B 3UL2A 3H42B 5AC92 5CFDB 3N7MA 3UETA 2WAAA 4NHYA 5FPAA 4UW6A 1QU0A 1SCRA 3B01A 3Q8BA 3I59A 5C8CB 2BTVC 1PO12 2ZHKA 5DAVA 2BFUS 1AYN1 2XBO1 4XJWA 5DDJ1 1YXWA 4IEXA 5A7WA 5FZ3A 3WNLA 3LE0A 4BPZA 3OBAA 1GOGA 1GSLA 2ZGTA 1LNSA 2VU9A 4QKBA 1LU1A 2RJKA 1RMU3 5DABA 1VBB1 1Q8PA 4BHPA 4FP3A 4FQ4A 3CHXA 1UOGA 4KGGA 3TEXA 5IK8A 5F5CA 3SITA 1ALYA 1CAVB 1WW7A 2FBEA 2WUHA 4K8RB 2BERA 2IXHA 3R0RA 3PTYA 4AEKA 1S0JA 2WC2A 4AZZA 1H8TC 4RR3A 5C5UA 1QDCA 1JUIA 3NAPB 5A32B 4XUNA 5FLIA 1I1EA 2ZX0A 4XPVA 5EZWA 1UOBA 3VZMA 1JYVA 2BZDA 4UXAA 5C9AC 4FSJA 1T6GC 5CFCB 2W1SA 4LBMA 2AACA 1RUD3 4QHZA 2ZZJA 2W94A 1Y9QA 4EWDA 2Y6JA 3ROUA 2E7QA 2QNKA 3EB7A 2WO3A 2C9KA 3PJYA 3USUB 1C3HA 4AVSA 2DFCA 2WNUA 3C7HA 3LB9A 4MHRA 4EN7B 4GH4B 4PIZA 1VBA3 1F2NA 4Q0QA 4C1WA 2C6SA 5CG9A 4XXPA 2FMDA 2A6ZA 4CPBA 5DUUA 1A34A 5HCFA 1BQPA 1ENQA 1WA4A 5IWFA 4QPIA 3VD4A 1YHFA 1BHGA 2VZSA 5JOYA 1OD3A 2XJVA 1POV1 5EFUA 1QJX2 1QOTA 3OYWB 5AVAA 2Y6LA 2CAUA 1EAH2 1XE0A 1J58A 1V6IA 5ACA2 1F4HA 1GFF2 1LOFA 4COUA 4YWAA 2IFRA 2VQAA 1H2KA 4L8QA 2EVXA 1BCXA 4X8NA 1V9U2 4JDNA 4XUQA 4HSJA 4H55A 4M0NA 3H8XA 2CTVA 2G9FA 2QZ2A 4Q4Y3 3WF1A 4CCEA 1FMD2 2DVFA 5GZDA 1ULGA 2KM2A 2B8MA 3GCXA 1PO23 4IE7A 4K21A 4Y20B 1KFUL 3JBG2 4CZSA 5LRSA 1KGYA 3WVJA 4OI0A 3WUCA 2CDPA 1PGSA 4P9YA 2EIEA 4C1XA 4ASMB 1HQNA 5JXIA 3VD3A 5EHDA 3ZLIA 4DXTA 4WVWA 1LB2A 2R32A 3H9AA 4TWTA 1AZDA 2WZR1 3BVCA 5A3LA 3W20A 1W6NB 2HWE2 3BGAA 4M0HA 1MS8A 1PVC2 2RDQA 3CJIB 5A7PA 5KXEA 3EMRA 3FHAA 5DG2A 1J3PA 1TME1 4ISRA 1H8TA 1VMFA 3BOPA 4RR3C 1UY4A 4BQXA 3PIJA 2HWC2 4A7YA 4IE6A 4UBHA 4G4FA 1WW4A 1WMEA 1RUG3 2HYXA 2BV4A 4FT8A 5F2WA 5I93A 2DU0A 1WW6A 1OVSA 1RTVA 1AL23 4YFWA 3T2PA 5CZKA 5FOBB 3B93A 4QU2A 1CIYA 3N9PA 1JYWA 2QFEA 5FPZA 3NAPA 1H2NA 1WZXA 2YY1A 3AX4A 2MPFA 4OFGA 2JDZA 5FTTC 2H0VA 4S2HA 2EXKA 3RWNA 2VULA 4A2UA 5FWJA 3ZN4A 4QDSA 1J1LA 2CY6A 2WN2A 1Z7S3 1WBLA 1Q8SA 1AJOA 1R64A 2WZEA 1H2MA 1REEA 4HKOA 1UO9A 3VZLA 5A3UA 3FUOA 5DAWA 4MXWB 4CSWA 2P4EA 2JD4A 5FO8B 1WMFA 2HKXA 5A7WB 4OHYA 3OPWA 2QUOA 3IM0A 1F4AA 2WO2A 5A6XA 1BXHA 1AYM2 2GP5A 4H14A 5I0RA 3PIGA 3ZYGA 2GZWA 1LESA 2J1VA 3RZMA 1V6JA 1CZTA 4Q4W2 5IAVA 3A23A 3KCCA 3JQXA 3K4DA 3VKNA 2GN7A 1CAUB 1HKDA 2OZJA 2QDNA 1IOAA 5C3RA 4LKSA 2GN3A 4MGYE 2LS6A 1J83A 4CU6A 2D3RA 4XACA 2XDVA 4DO0A 1VBB3 3O0WA 4FFGA 4XMIA 3X29B 5I8TA 1RMU1 1C5IA 1SDWA 3I3DA 4CXYA 2C9AA 2OQ6A 4HBNA 1ENRA 1POV0 4XW3A 1OHFA 1OKQA 4Y1ZA 1OOPB 4ET7A 1AYN2 2W95A 2XBO2 3K46A 2WAOA 3WF3A 2IZWA 4E2SA 1J59A 2PHTA 3RYPA 5E1RA 2XGXA 1JOJA 1ZZBA 3FHQA 2V09A 4V1PA 3PUAA 3ZFEA 1VAKA 3RZJA 1W9FA 2YZ4A 4NJ4A 5T50A 5BNNA 1OQDA 4FFIA 3VBSB 2D93A 1RUOA 4LIUA 1NE4A 4RGKA 1BEV3 4EWEA 4XEZA 5CB7A 3A21A 5SV8A 3SH4A 4Q5OA 3V64A 1CVNA 5J7MA 4LKEA 1JYXA 5FY5A 2PLV1 3JCIA 2XLAA 3KT1A 4IGOA 1ACCA 3IN9A 3MICA 3HPNA 4IQPA 5JR2A 5A3OA 2ILMA 1US2A 2Y64A 4YW6A 3WXPA 4XFAA 1RUH3 3EYPA 4AYUA 1XSRA 4YGBA 4GIQA 4CCKA 3FC0A 2A3WA 4CP9A 4DEVA 1LHVA 3HVDA 4Q4V2 2XKPA 2BNOA 5C3QA 2CDOA 4GWIA 4M3CE 5KXCA 1LGNA 5JI7A 1RXFA 3LF7A 5FP4A 1Q5OA 3P1IA 1W05A 4LHLA 5IK7A 1SQ4A 2QDRA 5K9YA 1ZX5A 2SLIA 4JQRA 3JBG1 1O8PA 4B29A 3ZDSA 2W87A 1W8ZA 4PDWA 4AE2A 1ZBA1 1JU4A 4BQ3A 1R1A1 2JWPA 2BYVE 3N3HA 2KD7A 1WKYA 1GOHA 5A7SA 4QXKA 1JZ4A 5IT6A 3RVHA 4AFMA 4Y26A 1UWWA 3T2TA 2XL9A 1AR92 2DVBA 1LEMA 3AJYA 3ILNA 2X05A 3URFA 2Q8EA 1PVC3 5L7OC 4Y1VA 1AR73 1XPWA 4L0PA 4XILA 3ZXFA 1QWRA 2WR9A 1N3PA 2YXSA 4LR4A 5FY7A 3SEEA 4FAGA 4QB1A 4MO3M 4BXFA 1RUI3 4YVSA 3ZYJB 2BPA2 2K46A 4FFFA 3M4FA 2PA7A 3Q8EA 1RB8G 4CDUC 3GJBA 4IV1B 3Q8CA 4Q4V1 2WT0A 3ZMOA 3WQ1A 2G9ZA 4BZ4A 5CKNA 2Q1FA 3PLQA 2ORXA 1DQ4A 4AF9A 3I2OA 1GKBA 5D8AA 2Q8OA 2ARCA 1VRH3 4HMZA 1OLQA 1WLWA 2W5FA 3J7NA 1PVC1 2VR4A 3ZPYA 5CADA 4IGPA 3A22A 4LO6B 1JZ5A 1KRIA 4QX3A 1W6MA 5C33A 1RUG1 3GYDA 2GC3A 3LSEA 1JBCA 4NAOA 2P17A 1H1IA 1QMJA 2UY8A 3RWKX 2FDHA 3BOWA 3KGLA 5FP7A 2HYKA 3ZSLA 3D8CA 4NROA 5T55A 3MEPA 5L36A 3O0VA 3SH5A 1VAVA 1U5ZA 2DUOA 5EV7A 3WNMA 1DYPA 3SH3A 1X33A 5B2GB 1JYTA 3HQRA 4YW5A 3CJXA 1OA2A 1AVBA 5JI9A 5DMYA 4PJYA 1JS9A 2XJPA 3V65A 4NPRA 5BXXA 4AG4A 4CPBD 1QXJA 3C8XA 4P9GA 3P3NA 1AX1A 3I3BA 4ZU5A 4E9KA 3EHKA 5JOWA 1HB2A 1X9PA 1HN0A 3MLLA 1WLTA 3D82A 2VMGA 3LGRA 2RM21 2WBKA 3FLTA 5JZGA 1MQTC 4B3NA 1LODA 3SQOA 5C4WC 2VZQA 3ACFA 3CU7A 3POIA 2AUYA 4HT1T 1ZZCA 1DF0A 1ODNA 2GNTA 3MIEA 1K5MC 3DYMA 4I3GA 1DQ6A 3H8OA 1RUE3 1WD4A 3T0AA 4Q4W3 4QGLA 2QQVA 1AR83 1FT9A 3P6BA 5I0TA 3OOXA 2GC0A 2VUJA 1DP0A 1D2SA 2ZOEB 5FBZA 3DYPA 3USSA 4CVUA 4R4ZA 3I2GA 4BQ4A 4FPLA 4YRDA 1UYXA 3I3MA 2Y60A 3VZKA 2W08A 3GCWA 4XBQA 4IXLA 3PUQA 2ZMNA 4URAA 3TEWA 1IQAA 3QACA 4FOQA 1OF3A 3I2IA 1LENA 1XE7A 3D0JA 4GJYA 2XUMA 4YYOA 1QQP2 4BU2A 4CDXB 1V0AA 3LKJA 2J1AA 3J8F1 1ODMA 4XFGA 2XB6C 5FKCA 4M00A 1IKQA 3I54A 1AYM3 4CRQA 4Z8BA 5FP3A 5D2AA 5GJ6A 3NL1A 4FVVA 4AEJA 4E2QA 4AI8A 4HXCA 4Q4Y1 4XJ8A 3K2OA 1CAWA 4D3WA 2Z69A 4XFBA 1XYPA 2ENRA 1AJKA 3I2KA 3VBHB 1O5UA 5D8AC 3NQHA 1QH7A 1TVGA 1AR61 1C8M3 3BYWA 4Q8LA 4A44A 4F7ZA 1G86A 4FI9A 1PGW1 2GALA 2ZPXA 1RUF3 1GYKA 3DYOA 4ATEA 2RS13 3M8LA 3ATGA 5FYZA 3VBUB 2HEYF 1QJX1 5LZ6A 2ZHMA 4JQTA 2J1SA 4ZXEA 2DWRA 2NM1A 4XQDA 4QDQA 2F4LA 4FTEA 2VM9A 2FCUA 1FOD1 1OFSA 5GZGA 4FTSA 4X6QB 1UY0A 1UL9A 4W8JA 5L7OA 3RZHA 1TME2 3ZKYA 2QQWA 3TEZA 4I0BA 3B69A 4ES9A 3VBUC 1C1FA 1FYUA 2EIBA 3DL3A 2R6QA 2WWSA 4YM3A 5JZGB 1CGPA 4Q27A 5FXVA 1QJU1 4BMBA 3T4HB 1ZRDA 4L97A 3HOBA 2IXIA 2PHWA 2PHXA 4L9BA 1LCLA 1GQHA 1O5LA 4ZKTB 1NZCA 5AFEA 1SBFA 5J09A 3OF1A 3MZHA 3JBG3 4Q4W1 4LBQA 2VCBA 5JDBA 1ENSA 4LNVA 1A3KA 3IIIA 3UESA 1RJ7A 4KWUA 4RSUA 1QNYA 5LBEA 1VB4A 4B4QA 3N9OA 2BDRA 2BGPA 3KMHA 4LMFA 2GH2A 2VTFA 1WCSA 3VUOA 2X5IC 3B9CA 3MLKA 2V5YA 2XMLA 4UFJA 2WQZC 1VALA 2RS32 4EZ4A 1MEC2 1AL0G 3KF3A 4XF0A 4E4DX 3H8UA 5FXZA 1QQP3 3S6PA 1W2NA 2YBSA 4PQQA 1SPPB 5JOZA 5TSWA 4AHZA 4ZONA 1JZ6A 1HB4A 3VKMA 3ES1A 1AX2A 1WGPA 3I3QA 4O9EA 2Z79A 5FKBA 1UF2C 4CTEA 3UGFA 3ILRA 3TWIA 1W6OA 4TTGA 5IATA 2FDFA 2XQRA 2EAAA 1V6OA 1VBD2 3CLPA 2WRAA 1XJAA 3N35A 3WZ1A 1BBT3 1DZQA 2AZ5A 4CDXC 1H9WA 2R30A 2XR4A 1UPIA 4XF4A 4AEDB 1PNGA 1UNBA 3WP6A 5KHIA 2XLGA 2XVGA 2WSUA 5I8SA 1VLNA 1YRZA 3C2UA 3RI9A 4XFHA 3ZSKA 1MZEA 3D5OA 4AQ2A 2VW1A 4AEMA 3ABZA 2GMMA 4YGCA 1RINA 5LCWL 4UYBA 2VH9A 3LA3A 5ACA1 4Z92B 3P3PA 2B4KA 2WFF1 2PQQA 3CO2A 3DKWA 1R082 1YNAA 3OY8B 4UAPA 5FZ7A 4JKMA 1RMU2 5BPXA 3E5XA 5T5JA 1Y7BA 4KU8A 2PAMA 4D8MA 1OXCA 1WMDA 2WJSA 4D0QA 2ZJCA 4Y24A 5JOXA 3I4IA 4TYSA 3MUY1 1DYOA 1F31A 4OQ9A 1PNFA 1AL21 4HLTA 1CQ9A 1R083 4FPKA 2W1QA 2EICA 5FAXA 4HL0A 5FRAA 2NQYA 4OZXA 4YM2A 2WZR3 3EQEA 1ULOA 1UYZA 1W6OB 3BCWA 4WM7A 1NX9A 2HWB3 4GWMA 1SCSA 4XFCA 1R1A3 4C0BA 2DBIA 4D6SA 4XC9A 3NJZA 2H6BA 5FV3A 1UZ0A 3UK9A 3WP3A 4OZOA 3AFKA 1IS3A 1NZIA 2W68A 1VRH2 2E53A 1VBC2 4BJ0A 1DGWX 1UYPA 2ADDA 1OH4A 3U07A 1ND2C 3NJVA 4RD7A 4NPLA 3K75B 4BK5A 4XJ9A 3THTA 1C8NA 4JHTA 4WVZA 3T1LA 5JR7B 2X53S 4IEUA 4Q0UA 5ANNA 4U36A 3VBRC 2QQUA 3ZDVA 2TUNA 4ATFA 4PLMA 3WNOA 5HV0A 5IVCA 3I59B 4FQZA 2W0XA 3TN91 4S2FA 1W8UA 2R0FA 5GLVA 2D3PA 5A7QA 3VKLA 1COV3 3RDIA 1QJU2 2QQJA 5HCAA 1NXD1 3MDPA 4BQYA 2CGOA 1RUJ3 2FCVA 5LA2A 4BDVB 1YI7A 2RMU2 1QKQA 1TNRA 2UY9A 2VUDA 1VBA1 1W6NA 4H7LA 1OUSA 1ZYBA 3VBRB 2HWE3 3KQ4B 2KR2A 3KD4A 4N43A 5C3SA 1X82A 1N3QA 2JG9C 3MIGA 1RUH1 1GZWB 3NVCA 4GB33 5GLTA 4BLJA 2UWCA 2YGLA 1EPZA 5F39A 1J3QA 1MVEA 3WNXA 2WNVB 4AFBA 1V9U3 2Y8KA 4EV0A 3H3UA 1K12A 1RUD1 1JOBA 4PIXA 3IPVB 4A7KA 1KITA 2XWBB 1AR93 1OLMA 1X8EA 3N9MA 1OQ1A 1HV1A 2ZA9A 4OHXA 4N7UA 1ENXA 4ZZ8A 1W04A 4GB32 4LLOA 1MEC1 3O1MA 4MSVA 4CUGA 3AKPA 1KFXL 1QOSA 2DDUA 5FZGA 1OUXA 4AXOA 2JG9A 1FOD3 4JX0A 1ZBE3 4UF0A 2OKXA 4ONUA 4P08A 4QT6A 3ITQA 5GKAC 1EAH3 2DUQA 1UQXA 3HBZA 5J98B 1PM7A 3AYAA 4GMP1 3PU8A 3AVRA 3VKFC 4LOTA 3WCSA 5DPNA 4NOTA 3GBFA 5EYXA 4QM8A 3CDZB 5CEHA 2NPIA 4TXWA 3E6DA 4AEDA 4K1ZA 4IL7A 4LK7A 4RHV3 1GMMA 1PIV2 2ZCWA 4HPKB 4QX2A 1RUH2 2ORZA 4N53C 1ULFA 1VJ2A 4Q8KA 5LRRA 1UPSA 3TYJA 1KJRA 5G05L 5K8SA 2RR11 2QQNA 4Q4V3 3GALA 1ND2A 3JB4C 3FHIB 3KVBA 2P2KA 4Y5Z0 1CAUA 5IVYA 2DUPA 5FY1A 1SLCA 1Y3TA 2VXJA 5FDBA 1UU6A 5JSRA 3MIDA 4QD2A 1XYOA 3AP7A 5A3WA 2ZMLA 2VQTA 4K8FA 4FPGA 4NMIA 3TEYA 3AKQA 3BTXA 4O9GA 1H0BA 4QAWA 4COYA 4JV4A 2D43A 3LQCA 2E32A 2VZVA 2W2IA 4NIIA 2YHJA 4DXZA 1GLHA 1XXNA 3PHMA 4P5HA 1IHMA 1XNCA 4AI1A 2Q30A 2JDAA 1EV12 4JGZA 2R063 4YVWC 4ASLA 4CDWC 1UD1A 3FFZA 5BUVA 1K42A 4R9CA 4QPGC 1NQDA 2YBPA 1NLQA 1VBB2 3CZJA 3WNKA 4A7ZA 2G19A 2GC2A 4BCUA 4MZUA 3ZPOA 4AAXA 2PHRA 1IZ3A 2PHFA 2P1BA 2E51A 1SLAA 1UY2A 2A3YA 2X10A 3AKRA 5CNAA 3T3YA 3NNJA 4YG6A 1TEIA 4Z07A 2RHPA 2XUEA 2GSYA 3HQXA 3IDCB 4QPIB 1AUYA 3V0AA 5KHGA 1QJFA 3OBZA 1R081 2VPVA 4BXSV 4LE3A 1YO8A 3VL8A 4FAHA 3ZXJA 3BALA 3WP4A 3DPRB 1HRV3 2RS52 3ILFA 4RS5B 1F8VA 5FMDA 4LORA 1LHNA 4CEWC 1CX4A 2LW8A 4G3YC 4XUTA 3IPVA 5CYYA 5CAZA 1O4TA 1Q3EA 1GR3A 2BUKA 1C4RA 2K0GA 3SCGA 2VUCA 4PF1A 1DDLA 3OD4A 4OI2A 1UX6A 2PHDA 2D98A 1SHWB 2P34A 1HV0A 3POBA 1TNFA 5CIRA 1FOD2 4LO5B 4XTPA 5J1XA 1VBD3 2QQKA 2QQIA 5EYYA 3O1PA 4M3CF 3TAYA 2XLFA 3OGSA 1D0GA 3AYEA 3M3QA 1RJ8A 1VB2A 5CU1A 4QQLA 2DTYA 3OG2A 4EZHA 1DYKA 2VD7A 2W52A 3K77A 3UKVA 1SLBA 3DF0A 1W6MB 5IUQA 1VBC1 4SLIA 4FXGB 3NJXA 1NQJA 4XAEA 2VOXA 2DCZA 4WZFA 4TLFA 4LUMA 3SXWA 5C5TA 3POSA 3MYXA 4M4RA 1JUHA 2A70A 1S55A 4CXXA 1JOPA 3U78A 4FO9A 2CWMA 2X5IA 4B7EA 4LBNA 4BLIA 1OA3A 3HQUA 3IWZA 4JRAA 2XG3A 1OOPA 2VGDA 4CEYC 4QPWA 4XF3A 3H1MA 5GM0A 1AR72 1S0GA 3MV11 2TEPA 4CP2A 4COZA 3CZUA 2ADEA 2BBVA 2B42B 1GZ9A 1GQGA 3U0ZA 3VDDB 5EWSA 2AYHA 4RGGA 3WX5A 4YFZA 1W8FA 5DDJ2 1L3JA 3ELNA 5FYTA 5LBBA 1SLTA 3USUA 4NWVA 5FLJA 5JWPA 2ET1A 3HD8B 3J7MA 2CAVA 1G9AA 1XRUA 4Y1YA 5FY8A 5LA1A 1VPHA 3CEWA 4XHBA 5LY1A 2LM3A 5L9VA 2XJQA 1F35A 2XONA 2QJVA 3JD71 4DS0A 2B7YA 3UYJA 3E5UA 3VBUA 2PTMA 4AI9A 4IERA 1O3TA 4Y1UA 2AGSA 2VAUA 3HNBM 5E16A 3J7LA 3WNPA 1G9FA 3GF6A 1OQEA 1IPJA 2JG8B 3MUZ1 3POFA 5LASA 1K3IA 1OLME 5C8WA 5JPMB 4YPJA 5CG8A 1NYWA 3ZVXA 1UYYA 2OZ6A 3TNPB 3ZOIA 4MVTA 2XPJA 1US3A 2WZPP 4JKLA 3ES4A 3WEZA 3W58A 4CUCA 5FCCA 5FJHA 1KDKA 2EALA 1EYBA 4FOWA 3T2OA 1JZ3A 3LEMA 2D6MA 3FE5A 1O4ZA 1OA4A 1GWKA 3G6JB 4PBOA 2Y0IA 3FBYA 1FI2A 4YNIA 2HWF1 5GZFA 4TZDA 3NKGA 2WFF2 5JUVA 2Y0OA 4GULA 4HK8A 1N1VA 1W9SA 1ZA4A 4OHZA 4BISA 3CL1A 2I2SA 3JU9A 4NRMA 4AGRA 4WM8A 1PX4A 1ZBE1 1CPMA 1H8VA 3HJRA 1R093 1CJPA 2MEV1 4XHXA 1LULA 3HN1A 2E6VA 3A4UA 3B9IA 1DU3D 3WW4A 4F83A 4Q2FA 4DUXA 1AR63 1C8M1 3AXDA 3K4AA 3SC7X 2OXBA 2YMZA 3CJIA 2A73B 2R49A 5I0UA 3BPSA 1YIFA 2RS11 2FD8A 5ABJC 5F1RA 4OQ8A 4XABA 3PDQA 3SHRA 3WW2A 3FN9A 2DBNA 2JECA 2AENA 3LA7A 1PGL2 2JX9A 1MZ5A 4KU7A 3WD5A 5E88A 3KS7A 4CEWB 2I45A 4WVMA 4BOWA 1O4YA 1FPN1 4XF9A 1SACA 1UU4A 3LD8A 2W3JA 3OY8A 1EAH1 1GICA 2YC0A 5L19A 5JPNB 3OUJA 1TZOA 1QJZA 3WINE 1MS5A 2QQOA 1CZVA 1X36A 4RGAA 1L7QA 1DQ0A 2ID4A 3OUHA 4EROA 4HKWA 3ZYPA 1NUKA 1BJQA 1K5MA 4WBBA 5FUNA 3I7DA 4QGNA 1XU1A 4UWDA 1W8OA 2MHFA 5F3EA 1R092 2O8OA 1ZA7A 2LTNA 5C4WA 3MO4A 3RRDA 1ZNPA 2CHHA 3WW1A 4A6SA 4QXCA 4CDQC 1HQLA 4YW7A 3KLSA 2UYAA 2R072 3O12A 3LFIA 4ZHNA 4NIHA 5DN2A 3V0BB 2RMU1 2JIGA 1VE0A 4UFKA 3GBGA 2WNUB 2XWJB 4DEQA 2YROA 1PO11 1N47A 3W9AA 2ZX2A 1V6MA 2P37A 3N9QA 2WNVA 3RS6A 1OH3A 4MLOA 3PUHA 5CBLA 3GJAA 5F9TA 3NRUA 3RGBA 3VHRA 4Q1PA 1U12A 2E9QA 4PLNA 4CCDA 1M06G 5AFBA 3FBMA 4JTOA 4XBLA 4BK4A 3O1TA 1FATA 1NY71 4DRVA 5IVJA 3KHBA 5H9SA 2WO1A 2XOMA 4OMDA 5HV4A 2A6YA 5FMOL 2TBVA 4AHYA 1CR7A 1BMV1 4MXWA 1NLSA 3NO8A 1TME3 3M3IA 4PI2A 3SMHA 4ASKA 4CA9A 3ZXEA 1XQNA 2QQMA 5GLUA 3POGA 4BWOA 1JYCA 4ZXKA 2AC1A 1NCQB 2AREA 3A0NA 1W8TA 1W8WA 3NV2A 4R8HA 4HONA 2ZEWA 4YW4A 5HXVA 4COVA 3RFRA 4N7IA 5F3IA 3SKVA 5A6YA 3T4VA 4CDUA 1RUJ2 2V4VA 1B35B 1NLRA 3GHMA 3QH6A 3RZKA 1UKGA 1GANA 4JTNA 2VQ0A 5FYHA 5FZ4A 3Q9OA 2DVDA 1GBGA 1GWLA 3C7OA 1PMIA 1WCQA 5A6QA 3RYRA 2G4IA 1TMF1 3WG3A 4CCCA 2HBUA 4XMAA 4W6XA 3BTYA 4QWNA 4EN0A 4GD4A 2PAKA 3A7QA 3WR0A 3ZXLA 2K2SA 4QPGB 1BK0A 4RQPA 4DOUA 2Y6KA 1UZVA 1RITA 3NKTA 3T09A 1W39A 1SLLA 1F9KA 1IKPA 5BYNA 3MIFA 5F5IA 5IW0A 3SLIA 4BQ2A 4YLZA 5LWBA 1ND3C 4K40A 4Y20A 2RE9A 2XHKA 4O61A 4D94A 2CWSA 4YW3A 4IUGA 3ZFFB 4FPHA 3M1HA 1C8M2 2EXIA 4MGIE 4XJZA 4BH9A 1LHWA 2W47A 2YBKA 3ETPA 5FQ0A 3DKQA 1W6PB 1DIWA 1QGLA 1HB1A 4RS5C 4CEYA 2XJTA 4AGVA 4YW1A 3OGRA 5L9BA 3UJQA 3IAQA 3WHUA 2GNBA 1H4GA 1HRI1 1ND2B 1ULEA 1VBA2 1NAEA 2WYFA 4KNCA 4GJZA 4HKLA 3OYWA 4Q0PA 3VKOA 4C0HA 4I0AA 1UXXX 3VDDA 1PGL1 4LO8A 3U1XA 1YIPA 4X6RB 2PLV2 3AM2A 4JGYA 4A4AA 4CEYB 1QXPA 2PFWA 3MW4A 4CDQB 4LQRA 4P9IA 1DGRA 5FZ0A 1RUD2 2ET7A 1WLCA 4OUEA 5F32A 3ORJA 2VMCA 4LOSA 3ZFEC 5E6HA 3KT7A 3H3LA 3B00A 2PLV3 2X29A 4LITA 1J84A 1UAIA 2A7AA 3PMSA 4JAAA 5GLWA 2WNEA 2ZHNA 2Q0AA 4IW3A 4MGQA 3MV01 1FV3A 2GNDA 1LU2A 4XZPA 3WDXA 3WDWA 2O0OA 2OPKA 4YZ3A 3WQBA 5KXBA 3ACLA 1DGLA 2HWE1 1W6QB 4NR1A 4OHWA 4OVEA 5EJZB 5FZOA 4B1MA 2VY0A 3VBSA 1V6LA 1LHOA 4N43B 1EPWA 1LAJA 1AX0A 1PMJX 3UGHA 3J8F2 5JSOA 5K0UC 4RHV2 5A3NA 4IEVA 4EQVA 1HLCA 3DPRA 1FAYA 3ENRA 5FZCA 2ZHLA 4IE4A 4A3XA 2Q1MA 4LA2A 4YG0A 1YFWA 4ZPIA 1SEFA 4DPNA 3EXUA 1VMHA 2VW2A 1IS6A 2YFUA 3HT1A 2D5FA 3IMMA 1R091 2MEV3 1OF4A 5FYSA 3FLPA 1FV2A 4LKDA 2J42A 3NV3A 3U37A 3T0BA 4LBLA 1KD7A 2GDFA 4I02A 4CP1A 4DXSA 3LEIA 4QPGA 1QXRA 2VBPA 4NIDA 1RUI2 4A45A 1IPSA 1T6BX 5FMBA 1QF3A 4AGGA 4JGZC 2Z4FA 3IAPA 4IV3B 4LEJA 4YVWA 1YEWA 2BGOA 2DV9A 2OA2A 5FUIA 2VOWA 2P6CA 1ZRIA 1XSQA 1YJLA 1COV1 2O8QA 3M3CA 1CIWA 3ZR6A 2MNGA 3NAPC 2QTWB 1YUDA 3ECQA 2VMFA 2DTWA 3BIWE 2VECA 3E6BA 2EIDA 2JDKA 1BVVA 1PZ7A 1BYHA 3VHNA 2FDIA 2UU8A 2YV8A 1UZZA 3VGIA 3VD7A 3WCRA 5D8AB 1DG6A 4J1XA 2UWBA 5FK7A 4P9XA 3THPA 3WG1A 2X5IB 5B4XA 4KG8A 3BTAA 2PHLA 2XKOA 4GWNA 4TLGA 2VOVA 4F8AA 5J37A 4XETA 2XVLA 1IG3A 2JDUA 4AFCA 1V70A 4IE0A 5IVEA 5F37A 1WA6X 1RVF2 3TN93 5FP9A 1WCDJ 2EIGA 4R9DA 4XCAA 1S0FA 1X50A 1DLCA 4OCTA 3GZEA 4TN7A 1NE6A 3ZYIB 5T54A 2XL7A 4Y33A 2Q4SA 1RUF2 4XIOA 4CCJA 3UV9A 4AR2A 4OYUA 2VO5A 3OUIA 3QD6A 3R4SA 3JD72 1FX5A 5C9AB 4QXBA 3LEKA 2ZACA 4QQOA 4UT5A 1IS5A 3R05A 1TMF2 5T5PA 1QJEA 2CSGA 4XTMA 1F15A 1PGW2 5FO9B 1UX7A 1Z78A 1POV3 1Q8VA 1Q8OA 5JMCA 1O3RA 5FYCA 5IK5A 4CCMA 3G7DA 2JJ6A 1S0DA 2VMHA 1SLIA 1HRI2 2W92A 4H7MA 1E5RA 4QGMA 3NJYA 2VCAA 3ON7A 2EXHA 4CCNA 2DCYA 4MV2A 1HN1A 2WFPA 2BFUL 2ZGMA 5FMCA 3OGVA 3GHNA 3LPGA 1VAMA 1U5XA 5D21A 2VOKA 5JVVA 4N43C 4LULA 2E33A 2VMEA 5C8CC 3SISA 3O5SA 3PJQA 1JZ7A 5FO7B 2IXLA 4Q0SA 2O1QA 1OBNA 3ZO0B 5A33B 2WNUC 1JN2P 3MIHA 3LWCA 5DZEA 3VHPA 1XNBA 4AAPA 5L73A 5H9QA 2C1FA 2YFZA 3W59A 3IZOA 1XE8A 3ACHA 5E89A 3AB0A 4K7JA 3ZMNA 1YQ2A 1QJY2 2VW0A 3T0DA 2BWAA 1W9TA 3K3NA 3VLBB 1Z0HA 3TB0A 5FPBA 1BBT2 2RV9A 3U14A 3VBRA 2QQPA 2HLEA 2PHUA 4CDUB 3QCWA 5A1AA 3AKTA 3B7MA 4BM8A 4ES8A 2ARAA 2BVBA 4Y4YA 3HNMA 3BIEA 3AZVA 4F3JA 4MX3A 2A6WA 2F4PA 2OPWA 3POWA 3R4UA 2JE8A 2DCJA 4WM7B 4INDA 1AR62 1PMHX 5LA0A 4LBQD 5CKMA 3ZXGA 2R071 3D6EA 1E5SA 2JE9A 1O59A 4XCBA 4AVCA 2ZGRA 5J3UA 4HZFA 2QZ3A 2I74A 1KEXA 5A32A 4IV1A 4L11A 2BU9A 4WM7C 4BQ5A 4JRLA 1OFNA 1JTZX 1D4M1 1VP6A 4HPKA 2L9LA 4KI5M 5K4LA 1W03A 2JKBA 3T1MA 4MH0E 5ABJB 1IG0A 3C3VA 3KB5A 4UI9L 5FMOS 2NMNA 5AC91 1T2XA 2LRPA 2NMOA 2ZAHA 2ZGPA 3DECA 4LBJA 1ZZ6A 2ZEYA 4J25A 4NWWA 5DUXA 2HWF2 4LO7A 5HBAA 1ULCA 4C90A 5LEKA 3LOIA 5DUVA 4K20A 2AR6A 3IDEA 1OD5A 2HJIA 4YGEA 3MI8A 5ERLA 4P02B 2NLRA 4ARYA 4V2WA 2Z2SB 3AZWA 4AOCA 4AWDA 4QB2A 1WWYA 2QVSB 1GOFA 2HWC3 2VTXJ 1ASJ3 3DPRC 1G9BA 2BEOA 1G6NA 2PAEA 1URXA 4GKYA 3TN92 2ZAAA 3AXEA 3B3QE 5EJ1B 3LDRA 1ZBA3 4O7XA 4N8MA 2CGNA 2K9ZA 3WDVA 4X8PA 1QOOA 3OBRA 1DFQA 4BE3A 1G8WA 2WIIB 5KHJA 3E97A 3VBSC 4AVTA 3FL7A 5FZOB 5J48A 3KCYA 4CDXA 2Q1ZB 1AHSA 2IWGB 5JIAA 4IEYA 3THDA 4YW2A 5I0SA 3FJSA 4JGYB 1DHKB 1PHMA 4IEZA 5LB6A 3AK0A 3POEA 3AP4A 5FZLA 3WDTA 2VL4A 1HW5A 1OURA 3KGZA 1O7FA 3N4MA 2DYCA 3T2QA 4D69A 3IBMA 1LEDA 1S4CA 2JB8A 1NOVA 2PXJA 2ZEXA 3WLUA 1KQRA 2ZGKA 2VC9A 4FFHA 4B4RA 4PT6A 4WZCA 1AR91 3GXUA 4CCLA 4AL9A 2R1DA 2VZRA 4JGYC 2R061 2W91A 1FXZA 5J36A 3O14A 2FDKA 5IFPA 1MS9A 1XC6A 2Z42A 1MS0A 2HWF3 3HIFA 3FMGA 1A8DA 1FMD3 3ZN6B 2R073 1FPN2 3AFGA 2R043 3FLRA 1HDKA 4W6YA 1X9TA 3VBHC 2DVAA 3EO6A 4DXRA 1MZ6A 1D4VB 1MVQA 1Y9GA 2A3XA 3CQOA 1DGRN 4LBOA 1V9U1 2D6LX 3E5QA 4YZ2A 5CA6A 4HVRA 4B8EA 1OC1A 5A1FA 4GZ9A 5KWRA 5BY5A 2R0HA 3J8F3 2VXRA 5DAXA 4FTBA 5GLZA 3W5NA 4YVWB 5SV5A 4RQPC 3GNEA 2EXJA 4DZGA 4AVVA 3NNFA 3ZXDA 2WA3A 3O1VA 1RIRA 1AR82 1SDDB 2AEYA 3K4ZA 1Q8QA 1O3SA 3LEGA 1S0EA 3IDAA 4P5YA 1B35A 1AXYA 2VZPA 5DQ0A 4GKXA 4LK6A 5FR3A 5LK5A 2Y26A 3DCQA 4YG3A 2ZS6B 4ORFA 3TBDA 2HH9A 2KA3A 3OD0A 1GNYA 2NZ9A 2WZ8A 3AMPA 2JB4A 1M4WA 2ZTNA 3LAGA 3N36A 2WA4A 4IV3A 4W6WA 5IHRA 1UIJA 4LE4A 1W0NA 4HFSA 4H2AA 5IFTA 3V0AB 3LDBA 2GP3A 4GA9A 4NAMA 4Q26A 3VDBA 2E7TA 2HWB1 1YFXA 4LA3A 3P5BA 4P9LA 1O6UA 1S0IA 2B9VA 1AXZA 1SFNA 2ZMKA 4L99A 4AQTA 5EXOA 2RR13 1JXNA 1HXS1 1NXMA 2ZGNA 2RS31 3J9SA 4NHXA 3VBOC 4LBKA 4XDQA 3RMXA 3VV1A 2V4AA 1BMV2 1NCQA 2V5DA 4HK9A 5IVFA 4BQWA 2J22A 2X09A 2R042 4DY5A 1EV13 3VD9A 1GP5A 1APNA 3MGUA 5ISLA 5GZEA 1S2KA
chains in the Genus database with same CATH topology
1W8TA 4CPBA 1W8WA 4CP9B 4CP9A 1W90A 4LJHA 2C24A 1OH3A 4LKFA 1W9FA 1WZXA 2LROA 4BQ5A 4LK7A 2K46A 1V0AA 1UOJA 4BQ2A 3UT0A 1W8UA 3ZYFA 1WMXA 1W8ZA 3ORJA 3ZYBA 2O14A 4YWAA 4AL9A 4LKEA 4BQ3A 1GWMA 2Q1FA 1GWLA 2JWPA 1GWKA 3F95A 3ZYHA 2LRPA 4A6SA 5D21A 4YW7A 1L7LA 4YW6A 4CPBD 2VXJA 4LK6A 4BQ4A 1OKOA 2KR2A 4LKDA 1WCUA 1HN0A 2WYFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W8T A;  4CPB A;  1W8W A;  4CP9 B;  4CP9 A;  1W90 A;  4LJH A;  2C24 A;  1OH3 A;  4LKF A;  1W9F A;  1WZX A;  2LRO A;  4BQ5 A;  4LK7 A;  2K46 A;  1V0A A;  1UOJ A;  4BQ2 A;  3UT0 A;  1W8U A;  3ZYF A;  1WMX A;  1W8Z A;  3ORJ A;  3ZYB A;  2O14 A;  4YWA A;  4AL9 A;  4LKE A;  4BQ3 A;  1GWM A;  2Q1F A;  1GWL A;  2JWP A;  1GWK A;  3F95 A;  3ZYH A;  2LRP A;  4A6S A;  5D21 A;  4YW7 A;  1L7L A;  4YW6 A;  4CPB D;  2VXJ A;  4LK6 A;  4BQ4 A;  1OKO A;  2KR2 A;  4LKD A;  1WCU A;  1HN0 A;  2WYF A; 
#chains in the Genus database with same CATH topology
 3ZSJ A;  2P3J A;  3KT4 A;  1RUC 3;  4XVH A;  4GMP 3;  4LLF A;  4OMC A;  2WKK A;  3SKJ E;  1S2B A;  4AHW A;  4AW7 A;  3PVE A;  1H30 A;  1OMI A;  4CXW A;  2B46 X;  4GWJ A;  1AYM 1;  5LAT A;  4YZ1 A;  2YGM A;  4XFI A;  5A7O A;  1TQ5 A;  5KR7 A;  5C4W B;  1J3R A;  2ZGL A;  3NNL A;  4QB6 A;  1GWM A;  2YB7 A;  2WNV C;  4K1Y A;  4KWK A;  1UMZ A;  1YQ5 A;  2FCT A;  1AF9 A;  4Q29 A;  2DFB A;  3NNM A;  2D97 A;  4XE9 A;  4UOJ A;  2WS9 3;  3C7G A;  4I3P A;  2VMD A;  3ZFG A;  3QH7 A;  1KS5 A;  2B5H A;  2GU9 A;  1XND A;  2JDM A;  2AH2 A;  3AMH A;  1A8M A;  4N9H A;  1PIV 3;  4KBB A;  3WG2 A;  4K6B A;  3VBF C;  1FNZ A;  1AR7 1;  3KF5 A;  4CP9 B;  3IDB B;  1KDM A;  3H50 A;  5FZ8 A;  3WHT A;  5F2S A;  1DCS A;  5IVV A;  4GB3 1;  4IE5 A;  3O1R A;  2V72 A;  3RQ0 A;  2VQU A;  3BU7 A;  3VDA A;  2BOJ A;  3ZFF A;  1UIK A;  5DDJ 3;  1DQ5 A;  3OGJ A;  3ZFF C;  1BEV 1;  3ETQ A;  3AKS A;  3QBQ A;  4QX7 A;  5C70 A;  3FWE A;  3M70 A;  1MR5 A;  1COV 2;  3GM8 A;  1I9R A;  1DLL A;  4GMP 0;  5JZG C;  2VCM A;  2RDN A;  1E5H A;  3C7F A;  1L7R A;  1Q43 A;  1DZR A;  1G7Y A;  3NW4 A;  4MAD A;  4XAA A;  3VBF A;  4D6R A;  5BNO A;  4RA0 A;  1QH6 A;  2OUH A;  2OQ7 A;  3PNA A;  2JDY A;  4Q1R A;  4Y1X A;  4MET A;  3SCH A;  4EYU A;  4ZZ5 A;  2YC4 A;  3ZFG C;  3H3Z A;  1PIV 1;  1QJU 3;  1PO2 2;  2OVU A;  4ITC A;  2VNV A;  1IGO A;  4MGS A;  2BRT A;  3O1U A;  4EJR A;  1YI9 A;  4UW4 A;  4CU8 A;  1C28 A;  3CKH A;  4NIA A;  5A70 A;  5KBF A;  1GZW A;  1N3O A;  1XNA A;  1HX6 A;  5ABJ A;  4PIY A;  2CU5 A;  4LPL A;  5KXD A;  4NPM A;  3T30 A;  1UZW A;  2JIJ A;  2RG4 A;  4NE9 A;  4XDP A;  3MF9 A;  1UY3 A;  2UUR A;  1NCR A;  2ZX3 A;  5ACA 3;  3ME2 A;  3CMG A;  2FZ2 A;  1V00 A;  3F95 A;  3UNP A;  3GBW A;  4YM1 A;  1WUV A;  1ONA A;  4K9S A;  4Y4R A;  2A1X A;  4QX5 A;  1TG7 A;  1UN1 A;  4HOO A;  2FZ1 A;  3WT3 A;  1BEV 2;  1O91 A;  3KQR A;  5GAL A;  2R1B A;  1NCQ C;  1VMJ A;  1PZ9 A;  1R1A 2;  2Y6H A;  3VBO A;  1GZC A;  3H7Y A;  4P00 B;  5A6Z A;  1A78 A;  1D2Q A;  1OPM A;  2SBA A;  4AFA A;  1RUC 2;  4XZU G;  2ARX A;  3Q8F A;  3WF4 A;  3ZN5 A;  4CCO A;  3SCF A;  4MG2 A;  4E4Z A;  2ZX4 A;  3U4S A;  2E7A A;  3DUI A;  5FIX A;  1AYN 3;  2IUW A;  2XBO 3;  5F6K A;  2WZR 2;  2VNR A;  3F2Z A;  3VBF B;  3WUD A;  3AVS A;  5JIU A;  2WN3 A;  4FOV A;  3HEI A;  2WLQ A;  4IGQ A;  2RDR A;  4QX1 A;  2HEW F;  3AC0 A;  4W4Z A;  4U2A A;  2C5D A;  3D0S A;  1D4M 2;  1KS4 A;  1LHU A;  2TNF A;  1RHI 2;  5FY9 A;  3S30 A;  2VVE A;  1U0A A;  5CFD A;  3OGG A;  3MLJ A;  4D7S A;  1MS3 A;  2ZKL A;  4RFT 0;  4BB3 A;  2QE3 A;  4EWA A;  1N1T A;  1FMD 1;  2P3K A;  2V73 A;  4L92 A;  4E8D A;  3OEA A;  1BZW A;  1HXS 2;  2WNO A;  2ZEZ A;  4BIO A;  1KJL A;  2F17 A;  2CL2 A;  1S0B A;  1NA1 C;  4QQH A;  3VD5 A;  2C4X A;  3R4D B;  4DUV A;  4JGZ B;  4MGT A;  5C6C A;  4HVO A;  2IVI B;  5FZH A;  4CU9 A;  1JZ2 A;  4Q4X 2;  4L2N A;  3B02 A;  4HN0 A;  1QHD A;  2GME A;  4P9W A;  1LOG A;  4CYD A;  2QQL A;  4XFF A;  1SMV A;  3HNY M;  1EY2 A;  1IQD C;  3MHZ A;  3NNG A;  4CUA A;  4QKD A;  4XUR A;  5FZ9 A;  3GZA A;  2BWC A;  4UW3 A;  3RNS A;  5ANQ A;  1W2A X;  3C7E A;  3VBH A;  2VZ3 A;  4DNY A;  3GGL A;  1CAX B;  3HBK A;  1E57 A;  1OOP C;  1SPP A;  2XJR A;  3KM5 A;  1W3X A;  3JD7 3;  1H8T B;  2IXJ A;  3I2D A;  1LKN A;  3NST A;  1ZZ7 A;  3DXU A;  2WT2 A;  4HN1 A;  5CVR A;  5FK8 A;  4D7T A;  3OEB A;  5A3P A;  5C7G A;  1RYY A;  4ZS3 A;  1HJF A;  2BJS A;  3RMY A;  3WF2 A;  3OCP A;  2OS2 A;  2QCS B;  4WVV A;  1Z7S 1;  2D3S A;  3L2Y A;  1RVF 3;  5FBJ A;  1JYN A;  1RUG 2;  4DUW A;  1O8S A;  3ALQ A;  5BNN C;  3QLQ A;  2YYO A;  3IB3 A;  5AVP A;  2FDG A;  3ASI A;  4QX8 A;  4UFM A;  3WV6 A;  1YYN A;  1DQ2 A;  2KXL A;  2Q5T A;  1MEC 3;  4A3Z A;  1UW8 A;  4XQ4 A;  3FUQ A;  3O1S A;  2YU1 A;  1EUT A;  3RYK A;  4JZR A;  3RZG A;  1ZBE 2;  2RDS A;  1SBE A;  3R6S A;  2PQS A;  4E2G A;  3PUS A;  5A1L A;  1STM A;  1EP0 A;  2ZGO A;  3FFQ A;  5FY4 A;  5FRE A;  1YQ6 A;  2Y33 A;  1VBE 3;  3BN6 A;  4AFD A;  3VB9 A;  2CGP A;  1U5I A;  2A6X A;  4DIN B;  1W99 A;  1HRV 1;  2JXA A;  2ZBJ A;  4WV8 A;  3ZFG B;  1C57 A;  4KL1 A;  4PCR A;  1IPK A;  3JB8 A;  5FP8 A;  4M3C A;  4CEW A;  1CAV A;  1QJY 1;  3H1W A;  3WOG A;  1H6X A;  1SG3 A;  2BGC A;  4XQW A;  2A6V A;  2ETE A;  5B4N A;  4YVS B;  3EBR A;  1G9C A;  5T3N A;  5BNP C;  1RC6 A;  1CN1 A;  5FZ6 A;  5KHK A;  4MGK E;  1JI6 A;  5CKQ A;  3MPB A;  3BB6 A;  3CNA A;  2RS5 1;  3VDC A;  2RMU 3;  2YC2 A;  1ZBA 2;  4OUS A;  1SFP A;  2EAK A;  4DFS A;  1EV1 1;  5FZD A;  2E63 A;  5LW9 A;  2RM2 3;  1W0P A;  3M3O A;  1IS4 A;  2H0B A;  3N7K A;  1P8J A;  4XOG A;  4XYX A;  4QPY A;  2WQ8 A;  1I6X A;  2D6N A;  4B1L A;  3LA2 A;  2I07 B;  3PUI A;  2RS1 2;  1QNW A;  4V2V A;  5FZF A;  4CDW A;  2R16 A;  4CP0 A;  2JG8 A;  1I3H A;  1X7N A;  2IXC A;  3PVN A;  2XQX A;  1RUE 1;  2B39 A;  1YJK A;  4ISQ A;  2OII A;  4IV1 C;  3GDB A;  2Z5W A;  1CON A;  5F7U A;  3HR9 A;  1JMU B;  1HIX A;  2RVA A;  3WP5 A;  3E6C C;  1ULD A;  1MS1 A;  1VBE 2;  4OHV A;  1HRV 2;  2RS5 3;  4NHL A;  1QEX A;  2ARB A;  3GZT B;  1E5I A;  2VZO A;  4LIV A;  5FYB A;  5A3T A;  4UFL A;  1CAX A;  4M4P A;  1LGB A;  2VG9 A;  2YDE A;  1YLL A;  5HPO A;  2GC1 A;  4XXA A;  4O65 A;  3L2H A;  4RL7 A;  3TOJ A;  1XU2 A;  4LUK A;  1UOF A;  2DUR A;  4NN0 A;  1X8M A;  5H9P A;  1RHI 1;  2UYB A;  3S5Q A;  4N53 A;  4AVB A;  4DIQ A;  5JXG A;  5E8A A;  3W5M A;  1CAW B;  1YC6 1;  2JE7 A;  1I5Z A;  2IC1 A;  1Y4W A;  5FYU A;  2G1M A;  5F5A A;  4AED C;  2O14 A;  1SBD A;  2A75 A;  1YFY A;  4Y22 B;  1XNT A;  2QBX A;  2LUW A;  4R4X A;  3ZFE B;  4UW5 A;  5F3G A;  5IVB A;  3VZJ A;  4GXL A;  3OJB A;  4GH4 C;  1W8N A;  5HXM A;  1PO1 3;  5C8C A;  3RSJ A;  5LEJ A;  5BNO B;  2ZKN A;  2ZXQ A;  2DCK A;  4HG6 B;  5IK4 A;  3PTR B;  4C8D A;  3KVA A;  1LOF C;  1XBF A;  1LEC A;  3CBN A;  3VN4 A;  1NY7 2;  5K0U B;  3H7J A;  3MW3 A;  3WDY A;  3H8R A;  1RUN A;  5H9R A;  3U4X A;  4JDO A;  3A0K A;  4QPI C;  4XF1 A;  3OPZ A;  5IJR A;  4LHN A;  2JIC A;  2YPJ A;  5FXX A;  1UU5 A;  1ZVF A;  4NHK A;  4FXK B;  4NUB A;  4BYY A;  3J4U H;  4UBG A;  2Q8D A;  4HAN A;  2NYY A;  1F5J A;  4GH4 A;  4JVA A;  4XBN A;  1HRI 3;  1OKO A;  3KWV A;  4N53 B;  3IKW A;  4QQP A;  2ERF A;  2GNM A;  4E8C A;  4I2O A;  1GU3 A;  3ZIW A;  1I5P A;  3L9J T;  1REF A;  3JQW A;  3LIG A;  4AQS A;  4XIK A;  5A80 A;  2JDP A;  4KBZ A;  3CIH A;  3BUC A;  3OSD A;  2BBA A;  4RHV 1;  4N90 A;  4KH9 A;  3JZV A;  4A6O A;  1D0H A;  1DZT A;  1OVP A;  1XOY A;  3KV4 A;  1ZRF A;  2VVF A;  3WG4 A;  5C9A A;  2GH8 A;  3WQ7 A;  1WBF A;  2HWD 2;  2BNN A;  5FXW A;  4OI1 A;  2P3I A;  2RS3 3;  4ZY9 A;  5BNQ A;  1JOD A;  3AZZ A;  5I0D A;  4BQ1 A;  3MFC A;  3O1O A;  4IEW A;  4Y5S A;  4AI0 A;  3VBO B;  1AR8 1;  5EQU A;  2R7E B;  2ZGU A;  3WF0 A;  1FPN 3;  3N9L A;  2VNO A;  4DY3 A;  3HN3 A;  5I8Y A;  2YU2 A;  4FPE A;  4R52 A;  3VZO A;  4RN5 A;  2VZT A;  1GP6 A;  3RJ2 X;  4LTA A;  1UCX A;  1W8H A;  3RZZ A;  3WQ0 A;  4FCA A;  3O7O A;  1SZB A;  4QKN A;  3ZSM A;  2B9U A;  3MFA A;  4FOY A;  4ZS2 A;  5L9R A;  5JCT A;  5DZF A;  3DXT A;  4BIF A;  5HCB A;  3BI3 A;  2JG8 C;  3PUR A;  3SEP A;  2CV6 A;  3CF6 E;  3UT0 A;  2JG9 B;  2J1T A;  3ZYF A;  4AI2 A;  4FPC A;  1NA1 B;  5FYY A;  3HT2 A;  4QKF A;  4PDW B;  2BOI A;  2EA7 A;  2CYF A;  5FPL A;  1CX1 A;  2VNG A;  1GNH A;  1YFU A;  3AJZ A;  4S2D A;  1NG0 A;  3O0X A;  2HWD 1;  1LR5 A;  2CNA A;  2JKX A;  3OB8 A;  4Q4Y 2;  1LOC A;  1ZZ8 A;  2OW4 A;  2LAL A;  3I97 A;  2W1U A;  4KG0 A;  5BNP A;  1PK6 A;  5EP9 A;  1BK1 A;  1H1A A;  2YPD A;  5KC6 A;  3BU0 A;  1RUC 1;  3S5A A;  1H4H A;  5K0U A;  1H6Y A;  1GNZ A;  2DF7 A;  3J7H A;  5FPX A;  2WIN B;  3LDK A;  3LFM A;  2BQP A;  2WL1 A;  1QY4 A;  3KV9 A;  1W28 A;  1JHN A;  2P3Y A;  1U5Y A;  1S1A A;  1PK6 B;  4YZ4 A;  4YGD A;  3AL6 A;  5LA9 A;  4GAL A;  1K5J A;  4D7Y A;  2ZGS A;  2VVD A;  5FYM A;  5FPV A;  2G9G A;  4YSF A;  3W21 A;  2ZAB A;  3AMM A;  5T5O A;  3APB A;  1VBE 1;  4XDO A;  5T52 A;  5M0T A;  2J1R A;  2BVV A;  2W9X A;  2P5B A;  1RUI 1;  2IXK A;  4I30 A;  4LT5 A;  1JYI A;  3AMQ A;  2OX0 A;  3ZIX A;  5C3P A;  2W1W A;  2J1E A;  1QJY 3;  1DBN A;  1VBC 3;  4A41 A;  4ARX A;  2H6C A;  3I49 A;  2VE1 A;  1RED A;  2XVK A;  2ZX1 A;  3TNQ A;  1KXG A;  2D7F A;  4QXH A;  3BOD A;  2Y6G A;  4R9A A;  2C26 A;  4QMA A;  5FLH A;  4KWL A;  1R1Z A;  5JXH A;  3VDD C;  1O3Q A;  4UFI A;  4CE8 A;  5F3C A;  4RR3 B;  2WS9 1;  4YZ5 A;  4UFH A;  4PI0 A;  2HEV F;  4IES A;  3IMN A;  1JW6 A;  4RS5 A;  5F5Q A;  2J1U A;  4RYD A;  1HJG A;  3VZN A;  3KV6 A;  3DV8 A;  3UJO A;  4IDZ A;  5A7N A;  4PLO A;  3J26 N;  3I3E A;  2ATF A;  3M3E A;  2P6H A;  4PF5 A;  4PHZ A;  3RJR A;  5DUW A;  3AZY A;  4AVA A;  1ND3 A;  1RVF 1;  1CJD A;  4LHS A;  1RHI 3;  1ZRC A;  4KGQ A;  1K5M B;  3HAG A;  4Q4X 1;  1BVP 1;  1QQP 1;  1OI6 A;  4MUV A;  5FY0 A;  5A3M A;  1WMX A;  5EIY B;  3K48 A;  4HVQ A;  1CZS A;  1V6K A;  1HXS 3;  1NA1 A;  2VJX A;  1CES A;  1DQ1 A;  3T08 A;  1PM4 A;  1D7P M;  1S2E A;  1C1L A;  2B45 X;  3NWK A;  3OBT A;  4AI3 A;  5F6L B;  5FZI A;  1L7L A;  1MS4 A;  2WFF 3;  4LO4 B;  5FUP A;  5F8P A;  1OSG A;  3ACI A;  2W46 A;  3K51 A;  4TSV A;  1VBD 1;  5CFD C;  3AP6 A;  4MXV A;  5DAQ A;  1W2O A;  3M7A A;  5JMO A;  2D40 A;  2ZZQ A;  3I8T A;  1PO2 1;  1UXZ A;  4KWJ A;  5BNP B;  5LY2 A;  4ZU4 A;  1ULP A;  1W6Q A;  2LRO A;  3ST7 A;  2PN5 A;  5FZM A;  4FPY A;  1H1M A;  2WAB A;  3ZN6 A;  1NKG A;  5CFC A;  1Z7S 2;  3LZZ A;  4E27 A;  3ZYB A;  2DU1 A;  1YCI A;  1AL2 2;  2RJL A;  1POQ A;  4YAR A;  2NP0 A;  4EN9 B;  2X8K A;  1NCR B;  2XH6 A;  1JHJ A;  2C0Z A;  4FPO B;  3N7L A;  5FZE A;  2WYS A;  1WCK A;  4SBV A;  2WT1 A;  4BA6 A;  1WD3 A;  1ND3 B;  2VZU A;  3OTF A;  2D6O X;  4LBQ B;  3U10 A;  4W65 A;  2C24 A;  4P9J A;  3S0M A;  2VBB A;  3V0B A;  1GV9 A;  3DEM A;  1NCR C;  3BTZ A;  2VTX A;  3JXS A;  1C5H A;  3PL0 A;  1Y43 B;  2WSV A;  4OI4 A;  2RJ2 A;  5DG1 A;  1PVX A;  3V56 A;  3N7J A;  4C91 A;  4DRR A;  3KHC A;  1RXG A;  1MPX A;  4MGZ E;  4NIG A;  1ZRR A;  3NV1 A;  4G9S B;  3WY6 A;  3RI8 A;  1WW5 A;  4PQ9 A;  2D5H A;  3EJK A;  5HCH A;  2GAU A;  5L7O B;  5BNO C;  1UKR A;  1W3V A;  4CDQ A;  1BKZ A;  3VL9 A;  2YUE A;  4PBP A;  5EJ3 A;  3PVB B;  3MF6 A;  1MQT B;  3D4K A;  1LJ7 A;  1W06 A;  4D6Q A;  2VOT A;  3POY A;  5FZB A;  1QJX 3;  4AQ6 A;  4AHX A;  3H1Y A;  3ZKU A;  5K7P A;  1UMI A;  1WLD A;  2MEV 2;  5FZK A;  1Q56 A;  3OPT A;  2XXZ A;  2UWA A;  1K45 A;  2W39 A;  3M2M A;  2EF6 A;  2YG0 A;  5LBF A;  2F6B A;  1MQT A;  2ZGQ A;  3AP5 A;  3HWJ A;  2E31 A;  4BME A;  1ASJ 2;  1ST8 A;  1W6P A;  3KCX A;  3U75 A;  4CU7 A;  4B7K A;  4CUB A;  3QOP A;  3MPP G;  5D1I A;  4I09 A;  2AEZ A;  1RUJ 1;  3LCP A;  4NHM A;  4QM9 A;  3IT8 A;  3UKT A;  1YQC A;  3KZ4 C;  2FMY A;  1A6C A;  4Z2A A;  5FYV A;  3GZU C;  4Z1V A;  5C3O A;  3S57 A;  1EUU A;  1SFY A;  3UGG A;  1YQ8 A;  1VR3 A;  3LPF A;  4LJH A;  5JSP A;  4COW A;  4QHB A;  3WSO A;  2BNM A;  4JHZ A;  2JD9 A;  2BW8 A;  1CWP A;  1UMH A;  3ZXK A;  4IET A;  4S2G A;  2OT7 A;  1FNY A;  2HWC 1;  3I2H A;  3RPQ A;  3AZX A;  3S7I A;  4EN8 B;  5FPU A;  3TRS B;  3D3A A;  4YM0 A;  1LOE A;  4P14 A;  2JDN A;  2PYT A;  4N9I A;  3CJI C;  4WVM B;  3WW3 A;  2JEM A;  4ZU7 A;  1VRB A;  1GUI A;  1LOA A;  5FYI A;  3AYD A;  4FP2 A;  1S0C A;  1GP4 A;  3ZYH A;  2BP6 A;  5FOJ B;  3MW2 A;  3PVO A;  3BPZ A;  1ZM1 A;  5A33 A;  1V6N A;  5DAP A;  3BKZ A;  1XNK A;  2IVJ A;  2FDJ A;  4WM8 C;  4UF0 B;  4CDW B;  4Y5T A;  1RGS A;  3LSD A;  3E1F 1;  5CIS A;  3MBW A;  5FQ0 B;  5JXJ A;  2RR1 2;  3NMB A;  4I01 A;  2FHR A;  4HET A;  1XYN A;  1ASJ 1;  3Q8A A;  5JAX A;  2WWJ A;  3THC A;  5FZ1 A;  4I0W B;  1D4M 3;  1PX3 A;  3B5L B;  4EN6 B;  2VCC A;  1RUF 1;  1OT5 A;  4W50 A;  5CFC C;  4Q4X 3;  3UKN A;  2WO7 A;  4JKK A;  2IFW A;  4YVS C;  4QHO A;  1UZY A;  2GMP A;  2R06 2;  4AK3 A;  3AYC A;  4JDM A;  3WDU A;  1RUE 2;  3INA A;  5G04 L;  1TMF 3;  3ZSE A;  1AXK A;  2VBD A;  4R9B A;  1H2L A;  3AP9 A;  4IV3 C;  5T5L A;  4QU1 A;  3S7E A;  2D6P A;  5AC9 3;  1W2U A;  1YWK A;  4H3W A;  5IAX A;  4E4H A;  3MIB A;  5LK7 B;  2E26 A;  5FZA A;  1B35 C;  4DB5 A;  3JUU A;  1HQW A;  4GQ7 A;  5EPA A;  1OPO A;  1DGW A;  3ZXA C;  3HMY A;  4FPJ A;  4KQ7 A;  5I91 A;  1W9W A;  3RZL A;  4MHU A;  4XUO A;  2OYZ A;  3K3O A;  1G9D A;  1GQP A;  3KSC A;  3PME A;  4J1W A;  4PDW C;  4NO4 A;  1MAC A;  4IEQ A;  1UY1 A;  2HBT A;  2QKD A;  2Y38 A;  4JC1 A;  4QX0 A;  3I2F A;  5J96 B;  4FPF A;  4M01 A;  5FWE A;  1J1T A;  2DCT A;  2OUJ A;  4OLL A;  3ACG A;  3ZM8 A;  5BV6 A;  4K3U A;  4RQP B;  3AL5 A;  3I2J A;  2NN8 A;  3H0O A;  2WQ4 A;  1NT0 A;  3VHO A;  5C71 A;  2J7M A;  4NRQ A;  1GZT A;  4M3C B;  1VRH 1;  3KV5 A;  1JZ8 A;  3NV4 A;  3B94 A;  2RM2 2;  2Y6F A;  1TE1 B;  1W2T A;  1WCU A;  4LXL A;  4Y3O A;  3SNM A;  5APA A;  1BBT 1;  1W9Y A;  3N9N A;  2VUA A;  4A42 A;  4MYE A;  1CPN A;  1W90 A;  3AMN A;  4Z82 A;  5KC5 A;  5DZG A;  3RG0 A;  1ZRE A;  1N1Y A;  5FFO C;  1LRH A;  4DQA A;  4FBF A;  1N1S A;  2WDB A;  4URT A;  1CD3 G;  1VIW B;  4QDR A;  5FJK A;  1BLZ A;  4XJA A;  4KMQ A;  5HI0 A;  3ZR5 A;  5BNN B;  2XJS A;  4Q0V A;  1F5F A;  2A71 A;  2D44 A;  4OUM A;  3LOB A;  2PEL A;  3DGT A;  2R04 1;  2JDH A;  2WWU A;  4Y22 A;  5LBC A;  4XJU A;  4MOA A;  3POJ A;  4GAZ A;  2XJU A;  2FQP A;  4IEP A;  3WNN A;  1B09 A;  3ZYR A;  4DMI A;  5JLV A;  5IYY A;  4JCK A;  1H9P A;  1PZ8 A;  4RFR B;  4EE2 A;  1QDO A;  4OUL A;  2WS9 2;  3U11 A;  2PMW B;  4QQ2 A;  2VMI A;  1MZF A;  4B4P A;  1OLR A;  2XHN A;  2JEN A;  3FZ3 A;  3ZX7 A;  1UOJ A;  1QIQ A;  2WLP A;  3PU3 A;  1LTE A;  1HB3 A;  1PK6 C;  1W0O A;  4IEO A;  4Z2W A;  1Y9M A;  5KHH A;  1ZZ9 A;  2A5Z A;  1XB9 A;  1LGC A;  2VZ1 A;  3IIA A;  1JU3 A;  5GZC A;  1JH5 A;  2DVG A;  4NRP A;  3FX3 A;  2D6K A;  2Y34 A;  3DN7 A;  4XUP A;  2Q8C A;  4NVP A;  4J6G A;  4E4S A;  2ES3 A;  2HWB 2;  5DXD A;  2N7G A;  1LOB A;  2HWD 3;  4HSL A;  4LHK A;  1RL3 A;  3LIH A;  4LKF A;  4WM8 B;  3UL2 A;  3H42 B;  5AC9 2;  5CFD B;  3N7M A;  3UET A;  2WAA A;  4NHY A;  5FPA A;  4UW6 A;  1QU0 A;  1SCR A;  3B01 A;  3Q8B A;  3I59 A;  5C8C B;  2BTV C;  1PO1 2;  2ZHK A;  5DAV A;  2BFU S;  1AYN 1;  2XBO 1;  4XJW A;  5DDJ 1;  1YXW A;  4IEX A;  5A7W A;  5FZ3 A;  3WNL A;  3LE0 A;  4BPZ A;  3OBA A;  1GOG A;  1GSL A;  2ZGT A;  1LNS A;  2VU9 A;  4QKB A;  1LU1 A;  2RJK A;  1RMU 3;  5DAB A;  1VBB 1;  1Q8P A;  4BHP A;  4FP3 A;  4FQ4 A;  3CHX A;  1UOG A;  4KGG A;  3TEX A;  5IK8 A;  5F5C A;  3SIT A;  1ALY A;  1CAV B;  1WW7 A;  2FBE A;  2WUH A;  4K8R B;  2BER A;  2IXH A;  3R0R A;  3PTY A;  4AEK A;  1S0J A;  2WC2 A;  4AZZ A;  1H8T C;  4RR3 A;  5C5U A;  1QDC A;  1JUI A;  3NAP B;  5A32 B;  4XUN A;  5FLI A;  1I1E A;  2ZX0 A;  4XPV A;  5EZW A;  1UOB A;  3VZM A;  1JYV A;  2BZD A;  4UXA A;  5C9A C;  4FSJ A;  1T6G C;  5CFC B;  2W1S A;  4LBM A;  2AAC A;  1RUD 3;  4QHZ A;  2ZZJ A;  2W94 A;  1Y9Q A;  4EWD A;  2Y6J A;  3ROU A;  2E7Q A;  2QNK A;  3EB7 A;  2WO3 A;  2C9K A;  3PJY A;  3USU B;  1C3H A;  4AVS A;  2DFC A;  2WNU A;  3C7H A;  3LB9 A;  4MHR A;  4EN7 B;  4GH4 B;  4PIZ A;  1VBA 3;  1F2N A;  4Q0Q A;  4C1W A;  2C6S A;  5CG9 A;  4XXP A;  2FMD A;  2A6Z A;  4CPB A;  5DUU A;  1A34 A;  5HCF A;  1BQP A;  1ENQ A;  1WA4 A;  5IWF A;  4QPI A;  3VD4 A;  1YHF A;  1BHG A;  2VZS A;  5JOY A;  1OD3 A;  2XJV A;  1POV 1;  5EFU A;  1QJX 2;  1QOT A;  3OYW B;  5AVA A;  2Y6L A;  2CAU A;  1EAH 2;  1XE0 A;  1J58 A;  1V6I A;  5ACA 2;  1F4H A;  1GFF 2;  1LOF A;  4COU A;  4YWA A;  2IFR A;  2VQA A;  1H2K A;  4L8Q A;  2EVX A;  1BCX A;  4X8N A;  1V9U 2;  4JDN A;  4XUQ A;  4HSJ A;  4H55 A;  4M0N A;  3H8X A;  2CTV A;  2G9F A;  2QZ2 A;  4Q4Y 3;  3WF1 A;  4CCE A;  1FMD 2;  2DVF A;  5GZD A;  1ULG A;  2KM2 A;  2B8M A;  3GCX A;  1PO2 3;  4IE7 A;  4K21 A;  4Y20 B;  1KFU L;  3JBG 2;  4CZS A;  5LRS A;  1KGY A;  3WVJ A;  4OI0 A;  3WUC A;  2CDP A;  1PGS A;  4P9Y A;  2EIE A;  4C1X A;  4ASM B;  1HQN A;  5JXI A;  3VD3 A;  5EHD A;  3ZLI A;  4DXT A;  4WVW A;  1LB2 A;  2R32 A;  3H9A A;  4TWT A;  1AZD A;  2WZR 1;  3BVC A;  5A3L A;  3W20 A;  1W6N B;  2HWE 2;  3BGA A;  4M0H A;  1MS8 A;  1PVC 2;  2RDQ A;  3CJI B;  5A7P A;  5KXE A;  3EMR A;  3FHA A;  5DG2 A;  1J3P A;  1TME 1;  4ISR A;  1H8T A;  1VMF A;  3BOP A;  4RR3 C;  1UY4 A;  4BQX A;  3PIJ A;  2HWC 2;  4A7Y A;  4IE6 A;  4UBH A;  4G4F A;  1WW4 A;  1WME A;  1RUG 3;  2HYX A;  2BV4 A;  4FT8 A;  5F2W A;  5I93 A;  2DU0 A;  1WW6 A;  1OVS A;  1RTV A;  1AL2 3;  4YFW A;  3T2P A;  5CZK A;  5FOB B;  3B93 A;  4QU2 A;  1CIY A;  3N9P A;  1JYW A;  2QFE A;  5FPZ A;  3NAP A;  1H2N A;  1WZX A;  2YY1 A;  3AX4 A;  2MPF A;  4OFG A;  2JDZ A;  5FTT C;  2H0V A;  4S2H A;  2EXK A;  3RWN A;  2VUL A;  4A2U A;  5FWJ A;  3ZN4 A;  4QDS A;  1J1L A;  2CY6 A;  2WN2 A;  1Z7S 3;  1WBL A;  1Q8S A;  1AJO A;  1R64 A;  2WZE A;  1H2M A;  1REE A;  4HKO A;  1UO9 A;  3VZL A;  5A3U A;  3FUO A;  5DAW A;  4MXW B;  4CSW A;  2P4E A;  2JD4 A;  5FO8 B;  1WMF A;  2HKX A;  5A7W B;  4OHY A;  3OPW A;  2QUO A;  3IM0 A;  1F4A A;  2WO2 A;  5A6X A;  1BXH A;  1AYM 2;  2GP5 A;  4H14 A;  5I0R A;  3PIG A;  3ZYG A;  2GZW A;  1LES A;  2J1V A;  3RZM A;  1V6J A;  1CZT A;  4Q4W 2;  5IAV A;  3A23 A;  3KCC A;  3JQX A;  3K4D A;  3VKN A;  2GN7 A;  1CAU B;  1HKD A;  2OZJ A;  2QDN A;  1IOA A;  5C3R A;  4LKS A;  2GN3 A;  4MGY E;  2LS6 A;  1J83 A;  4CU6 A;  2D3R A;  4XAC A;  2XDV A;  4DO0 A;  1VBB 3;  3O0W A;  4FFG A;  4XMI A;  3X29 B;  5I8T A;  1RMU 1;  1C5I A;  1SDW A;  3I3D A;  4CXY A;  2C9A A;  2OQ6 A;  4HBN A;  1ENR A;  1POV 0;  4XW3 A;  1OHF A;  1OKQ A;  4Y1Z A;  1OOP B;  4ET7 A;  1AYN 2;  2W95 A;  2XBO 2;  3K46 A;  2WAO A;  3WF3 A;  2IZW A;  4E2S A;  1J59 A;  2PHT A;  3RYP A;  5E1R A;  2XGX A;  1JOJ A;  1ZZB A;  3FHQ A;  2V09 A;  4V1P A;  3PUA A;  3ZFE A;  1VAK A;  3RZJ A;  1W9F A;  2YZ4 A;  4NJ4 A;  5T50 A;  5BNN A;  1OQD A;  4FFI A;  3VBS B;  2D93 A;  1RUO A;  4LIU A;  1NE4 A;  4RGK A;  1BEV 3;  4EWE A;  4XEZ A;  5CB7 A;  3A21 A;  5SV8 A;  3SH4 A;  4Q5O A;  3V64 A;  1CVN A;  5J7M A;  4LKE A;  1JYX A;  5FY5 A;  2PLV 1;  3JCI A;  2XLA A;  3KT1 A;  4IGO A;  1ACC A;  3IN9 A;  3MIC A;  3HPN A;  4IQP A;  5JR2 A;  5A3O A;  2ILM A;  1US2 A;  2Y64 A;  4YW6 A;  3WXP A;  4XFA A;  1RUH 3;  3EYP A;  4AYU A;  1XSR A;  4YGB A;  4GIQ A;  4CCK A;  3FC0 A;  2A3W A;  4CP9 A;  4DEV A;  1LHV A;  3HVD A;  4Q4V 2;  2XKP A;  2BNO A;  5C3Q A;  2CDO A;  4GWI A;  4M3C E;  5KXC A;  1LGN A;  5JI7 A;  1RXF A;  3LF7 A;  5FP4 A;  1Q5O A;  3P1I A;  1W05 A;  4LHL A;  5IK7 A;  1SQ4 A;  2QDR A;  5K9Y A;  1ZX5 A;  2SLI A;  4JQR A;  3JBG 1;  1O8P A;  4B29 A;  3ZDS A;  2W87 A;  1W8Z A;  4PDW A;  4AE2 A;  1ZBA 1;  1JU4 A;  4BQ3 A;  1R1A 1;  2JWP A;  2BYV E;  3N3H A;  2KD7 A;  1WKY A;  1GOH A;  5A7S A;  4QXK A;  1JZ4 A;  5IT6 A;  3RVH A;  4AFM A;  4Y26 A;  1UWW A;  3T2T A;  2XL9 A;  1AR9 2;  2DVB A;  1LEM A;  3AJY A;  3ILN A;  2X05 A;  3URF A;  2Q8E A;  1PVC 3;  5L7O C;  4Y1V A;  1AR7 3;  1XPW A;  4L0P A;  4XIL A;  3ZXF A;  1QWR A;  2WR9 A;  1N3P A;  2YXS A;  4LR4 A;  5FY7 A;  3SEE A;  4FAG A;  4QB1 A;  4MO3 M;  4BXF A;  1RUI 3;  4YVS A;  3ZYJ B;  2BPA 2;  2K46 A;  4FFF A;  3M4F A;  2PA7 A;  3Q8E A;  1RB8 G;  4CDU C;  3GJB A;  4IV1 B;  3Q8C A;  4Q4V 1;  2WT0 A;  3ZMO A;  3WQ1 A;  2G9Z A;  4BZ4 A;  5CKN A;  2Q1F A;  3PLQ A;  2ORX A;  1DQ4 A;  4AF9 A;  3I2O A;  1GKB A;  5D8A A;  2Q8O A;  2ARC A;  1VRH 3;  4HMZ A;  1OLQ A;  1WLW A;  2W5F A;  3J7N A;  1PVC 1;  2VR4 A;  3ZPY A;  5CAD A;  4IGP A;  3A22 A;  4LO6 B;  1JZ5 A;  1KRI A;  4QX3 A;  1W6M A;  5C33 A;  1RUG 1;  3GYD A;  2GC3 A;  3LSE A;  1JBC A;  4NAO A;  2P17 A;  1H1I A;  1QMJ A;  2UY8 A;  3RWK X;  2FDH A;  3BOW A;  3KGL A;  5FP7 A;  2HYK A;  3ZSL A;  3D8C A;  4NRO A;  5T55 A;  3MEP A;  5L36 A;  3O0V A;  3SH5 A;  1VAV A;  1U5Z A;  2DUO A;  5EV7 A;  3WNM A;  1DYP A;  3SH3 A;  1X33 A;  5B2G B;  1JYT A;  3HQR A;  4YW5 A;  3CJX A;  1OA2 A;  1AVB A;  5JI9 A;  5DMY A;  4PJY A;  1JS9 A;  2XJP A;  3V65 A;  4NPR A;  5BXX A;  4AG4 A;  4CPB D;  1QXJ A;  3C8X A;  4P9G A;  3P3N A;  1AX1 A;  3I3B A;  4ZU5 A;  4E9K A;  3EHK A;  5JOW A;  1HB2 A;  1X9P A;  1HN0 A;  3MLL A;  1WLT A;  3D82 A;  2VMG A;  3LGR A;  2RM2 1;  2WBK A;  3FLT A;  5JZG A;  1MQT C;  4B3N A;  1LOD A;  3SQO A;  5C4W C;  2VZQ A;  3ACF A;  3CU7 A;  3POI A;  2AUY A;  4HT1 T;  1ZZC A;  1DF0 A;  1ODN A;  2GNT A;  3MIE A;  1K5M C;  3DYM A;  4I3G A;  1DQ6 A;  3H8O A;  1RUE 3;  1WD4 A;  3T0A A;  4Q4W 3;  4QGL A;  2QQV A;  1AR8 3;  1FT9 A;  3P6B A;  5I0T A;  3OOX A;  2GC0 A;  2VUJ A;  1DP0 A;  1D2S A;  2ZOE B;  5FBZ A;  3DYP A;  3USS A;  4CVU A;  4R4Z A;  3I2G A;  4BQ4 A;  4FPL A;  4YRD A;  1UYX A;  3I3M A;  2Y60 A;  3VZK A;  2W08 A;  3GCW A;  4XBQ A;  4IXL A;  3PUQ A;  2ZMN A;  4URA A;  3TEW A;  1IQA A;  3QAC A;  4FOQ A;  1OF3 A;  3I2I A;  1LEN A;  1XE7 A;  3D0J A;  4GJY A;  2XUM A;  4YYO A;  1QQP 2;  4BU2 A;  4CDX B;  1V0A A;  3LKJ A;  2J1A A;  3J8F 1;  1ODM A;  4XFG A;  2XB6 C;  5FKC A;  4M00 A;  1IKQ A;  3I54 A;  1AYM 3;  4CRQ A;  4Z8B A;  5FP3 A;  5D2A A;  5GJ6 A;  3NL1 A;  4FVV A;  4AEJ A;  4E2Q A;  4AI8 A;  4HXC A;  4Q4Y 1;  4XJ8 A;  3K2O A;  1CAW A;  4D3W A;  2Z69 A;  4XFB A;  1XYP A;  2ENR A;  1AJK A;  3I2K A;  3VBH B;  1O5U A;  5D8A C;  3NQH A;  1QH7 A;  1TVG A;  1AR6 1;  1C8M 3;  3BYW A;  4Q8L A;  4A44 A;  4F7Z A;  1G86 A;  4FI9 A;  1PGW 1;  2GAL A;  2ZPX A;  1RUF 3;  1GYK A;  3DYO A;  4ATE A;  2RS1 3;  3M8L A;  3ATG A;  5FYZ A;  3VBU B;  2HEY F;  1QJX 1;  5LZ6 A;  2ZHM A;  4JQT A;  2J1S A;  4ZXE A;  2DWR A;  2NM1 A;  4XQD A;  4QDQ A;  2F4L A;  4FTE A;  2VM9 A;  2FCU A;  1FOD 1;  1OFS A;  5GZG A;  4FTS A;  4X6Q B;  1UY0 A;  1UL9 A;  4W8J A;  5L7O A;  3RZH A;  1TME 2;  3ZKY A;  2QQW A;  3TEZ A;  4I0B A;  3B69 A;  4ES9 A;  3VBU C;  1C1F A;  1FYU A;  2EIB A;  3DL3 A;  2R6Q A;  2WWS A;  4YM3 A;  5JZG B;  1CGP A;  4Q27 A;  5FXV A;  1QJU 1;  4BMB A;  3T4H B;  1ZRD A;  4L97 A;  3HOB A;  2IXI A;  2PHW A;  2PHX A;  4L9B A;  1LCL A;  1GQH A;  1O5L A;  4ZKT B;  1NZC A;  5AFE A;  1SBF A;  5J09 A;  3OF1 A;  3MZH A;  3JBG 3;  4Q4W 1;  4LBQ A;  2VCB A;  5JDB A;  1ENS A;  4LNV A;  1A3K A;  3III A;  3UES A;  1RJ7 A;  4KWU A;  4RSU A;  1QNY A;  5LBE A;  1VB4 A;  4B4Q A;  3N9O A;  2BDR A;  2BGP A;  3KMH A;  4LMF A;  2GH2 A;  2VTF A;  1WCS A;  3VUO A;  2X5I C;  3B9C A;  3MLK A;  2V5Y A;  2XML A;  4UFJ A;  2WQZ C;  1VAL A;  2RS3 2;  4EZ4 A;  1MEC 2;  1AL0 G;  3KF3 A;  4XF0 A;  4E4D X;  3H8U A;  5FXZ A;  1QQP 3;  3S6P A;  1W2N A;  2YBS A;  4PQQ A;  1SPP B;  5JOZ A;  5TSW A;  4AHZ A;  4ZON A;  1JZ6 A;  1HB4 A;  3VKM A;  3ES1 A;  1AX2 A;  1WGP A;  3I3Q A;  4O9E A;  2Z79 A;  5FKB A;  1UF2 C;  4CTE A;  3UGF A;  3ILR A;  3TWI A;  1W6O A;  4TTG A;  5IAT A;  2FDF A;  2XQR A;  2EAA A;  1V6O A;  1VBD 2;  3CLP A;  2WRA A;  1XJA A;  3N35 A;  3WZ1 A;  1BBT 3;  1DZQ A;  2AZ5 A;  4CDX C;  1H9W A;  2R30 A;  2XR4 A;  1UPI A;  4XF4 A;  4AED B;  1PNG A;  1UNB A;  3WP6 A;  5KHI A;  2XLG A;  2XVG A;  2WSU A;  5I8S A;  1VLN A;  1YRZ A;  3C2U A;  3RI9 A;  4XFH A;  3ZSK A;  1MZE A;  3D5O A;  4AQ2 A;  2VW1 A;  4AEM A;  3ABZ A;  2GMM A;  4YGC A;  1RIN A;  5LCW L;  4UYB A;  2VH9 A;  3LA3 A;  5ACA 1;  4Z92 B;  3P3P A;  2B4K A;  2WFF 1;  2PQQ A;  3CO2 A;  3DKW A;  1R08 2;  1YNA A;  3OY8 B;  4UAP A;  5FZ7 A;  4JKM A;  1RMU 2;  5BPX A;  3E5X A;  5T5J A;  1Y7B A;  4KU8 A;  2PAM A;  4D8M A;  1OXC A;  1WMD A;  2WJS A;  4D0Q A;  2ZJC A;  4Y24 A;  5JOX A;  3I4I A;  4TYS A;  3MUY 1;  1DYO A;  1F31 A;  4OQ9 A;  1PNF A;  1AL2 1;  4HLT A;  1CQ9 A;  1R08 3;  4FPK A;  2W1Q A;  2EIC A;  5FAX A;  4HL0 A;  5FRA A;  2NQY A;  4OZX A;  4YM2 A;  2WZR 3;  3EQE A;  1ULO A;  1UYZ A;  1W6O B;  3BCW A;  4WM7 A;  1NX9 A;  2HWB 3;  4GWM A;  1SCS A;  4XFC A;  1R1A 3;  4C0B A;  2DBI A;  4D6S A;  4XC9 A;  3NJZ A;  2H6B A;  5FV3 A;  1UZ0 A;  3UK9 A;  3WP3 A;  4OZO A;  3AFK A;  1IS3 A;  1NZI A;  2W68 A;  1VRH 2;  2E53 A;  1VBC 2;  4BJ0 A;  1DGW X;  1UYP A;  2ADD A;  1OH4 A;  3U07 A;  1ND2 C;  3NJV A;  4RD7 A;  4NPL A;  3K75 B;  4BK5 A;  4XJ9 A;  3THT A;  1C8N A;  4JHT A;  4WVZ A;  3T1L A;  5JR7 B;  2X53 S;  4IEU A;  4Q0U A;  5ANN A;  4U36 A;  3VBR C;  2QQU A;  3ZDV A;  2TUN A;  4ATF A;  4PLM A;  3WNO A;  5HV0 A;  5IVC A;  3I59 B;  4FQZ A;  2W0X A;  3TN9 1;  4S2F A;  1W8U A;  2R0F A;  5GLV A;  2D3P A;  5A7Q A;  3VKL A;  1COV 3;  3RDI A;  1QJU 2;  2QQJ A;  5HCA A;  1NXD 1;  3MDP A;  4BQY A;  2CGO A;  1RUJ 3;  2FCV A;  5LA2 A;  4BDV B;  1YI7 A;  2RMU 2;  1QKQ A;  1TNR A;  2UY9 A;  2VUD A;  1VBA 1;  1W6N A;  4H7L A;  1OUS A;  1ZYB A;  3VBR B;  2HWE 3;  3KQ4 B;  2KR2 A;  3KD4 A;  4N43 A;  5C3S A;  1X82 A;  1N3Q A;  2JG9 C;  3MIG A;  1RUH 1;  1GZW B;  3NVC A;  4GB3 3;  5GLT A;  4BLJ A;  2UWC A;  2YGL A;  1EPZ A;  5F39 A;  1J3Q A;  1MVE A;  3WNX A;  2WNV B;  4AFB A;  1V9U 3;  2Y8K A;  4EV0 A;  3H3U A;  1K12 A;  1RUD 1;  1JOB A;  4PIX A;  3IPV B;  4A7K A;  1KIT A;  2XWB B;  1AR9 3;  1OLM A;  1X8E A;  3N9M A;  1OQ1 A;  1HV1 A;  2ZA9 A;  4OHX A;  4N7U A;  1ENX A;  4ZZ8 A;  1W04 A;  4GB3 2;  4LLO A;  1MEC 1;  3O1M A;  4MSV A;  4CUG A;  3AKP A;  1KFX L;  1QOS A;  2DDU A;  5FZG A;  1OUX A;  4AXO A;  2JG9 A;  1FOD 3;  4JX0 A;  1ZBE 3;  4UF0 A;  2OKX A;  4ONU A;  4P08 A;  4QT6 A;  3ITQ A;  5GKA C;  1EAH 3;  2DUQ A;  1UQX A;  3HBZ A;  5J98 B;  1PM7 A;  3AYA A;  4GMP 1;  3PU8 A;  3AVR A;  3VKF C;  4LOT A;  3WCS A;  5DPN A;  4NOT A;  3GBF A;  5EYX A;  4QM8 A;  3CDZ B;  5CEH A;  2NPI A;  4TXW A;  3E6D A;  4AED A;  4K1Z A;  4IL7 A;  4LK7 A;  4RHV 3;  1GMM A;  1PIV 2;  2ZCW A;  4HPK B;  4QX2 A;  1RUH 2;  2ORZ A;  4N53 C;  1ULF A;  1VJ2 A;  4Q8K A;  5LRR A;  1UPS A;  3TYJ A;  1KJR A;  5G05 L;  5K8S A;  2RR1 1;  2QQN A;  4Q4V 3;  3GAL A;  1ND2 A;  3JB4 C;  3FHI B;  3KVB A;  2P2K A;  4Y5Z 0;  1CAU A;  5IVY A;  2DUP A;  5FY1 A;  1SLC A;  1Y3T A;  2VXJ A;  5FDB A;  1UU6 A;  5JSR A;  3MID A;  4QD2 A;  1XYO A;  3AP7 A;  5A3W A;  2ZML A;  2VQT A;  4K8F A;  4FPG A;  4NMI A;  3TEY A;  3AKQ A;  3BTX A;  4O9G A;  1H0B A;  4QAW A;  4COY A;  4JV4 A;  2D43 A;  3LQC A;  2E32 A;  2VZV A;  2W2I A;  4NII A;  2YHJ A;  4DXZ A;  1GLH A;  1XXN A;  3PHM A;  4P5H A;  1IHM A;  1XNC A;  4AI1 A;  2Q30 A;  2JDA A;  1EV1 2;  4JGZ A;  2R06 3;  4YVW C;  4ASL A;  4CDW C;  1UD1 A;  3FFZ A;  5BUV A;  1K42 A;  4R9C A;  4QPG C;  1NQD A;  2YBP A;  1NLQ A;  1VBB 2;  3CZJ A;  3WNK A;  4A7Z A;  2G19 A;  2GC2 A;  4BCU A;  4MZU A;  3ZPO A;  4AAX A;  2PHR A;  1IZ3 A;  2PHF A;  2P1B A;  2E51 A;  1SLA A;  1UY2 A;  2A3Y A;  2X10 A;  3AKR A;  5CNA A;  3T3Y A;  3NNJ A;  4YG6 A;  1TEI A;  4Z07 A;  2RHP A;  2XUE A;  2GSY A;  3HQX A;  3IDC B;  4QPI B;  1AUY A;  3V0A A;  5KHG A;  1QJF A;  3OBZ A;  1R08 1;  2VPV A;  4BXS V;  4LE3 A;  1YO8 A;  3VL8 A;  4FAH A;  3ZXJ A;  3BAL A;  3WP4 A;  3DPR B;  1HRV 3;  2RS5 2;  3ILF A;  4RS5 B;  1F8V A;  5FMD A;  4LOR A;  1LHN A;  4CEW C;  1CX4 A;  2LW8 A;  4G3Y C;  4XUT A;  3IPV A;  5CYY A;  5CAZ A;  1O4T A;  1Q3E A;  1GR3 A;  2BUK A;  1C4R A;  2K0G A;  3SCG A;  2VUC A;  4PF1 A;  1DDL A;  3OD4 A;  4OI2 A;  1UX6 A;  2PHD A;  2D98 A;  1SHW B;  2P34 A;  1HV0 A;  3POB A;  1TNF A;  5CIR A;  1FOD 2;  4LO5 B;  4XTP A;  5J1X A;  1VBD 3;  2QQK A;  2QQI A;  5EYY A;  3O1P A;  4M3C F;  3TAY A;  2XLF A;  3OGS A;  1D0G A;  3AYE A;  3M3Q A;  1RJ8 A;  1VB2 A;  5CU1 A;  4QQL A;  2DTY A;  3OG2 A;  4EZH A;  1DYK A;  2VD7 A;  2W52 A;  3K77 A;  3UKV A;  1SLB A;  3DF0 A;  1W6M B;  5IUQ A;  1VBC 1;  4SLI A;  4FXG B;  3NJX A;  1NQJ A;  4XAE A;  2VOX A;  2DCZ A;  4WZF A;  4TLF A;  4LUM A;  3SXW A;  5C5T A;  3POS A;  3MYX A;  4M4R A;  1JUH A;  2A70 A;  1S55 A;  4CXX A;  1JOP A;  3U78 A;  4FO9 A;  2CWM A;  2X5I A;  4B7E A;  4LBN A;  4BLI A;  1OA3 A;  3HQU A;  3IWZ A;  4JRA A;  2XG3 A;  1OOP A;  2VGD A;  4CEY C;  4QPW A;  4XF3 A;  3H1M A;  5GM0 A;  1AR7 2;  1S0G A;  3MV1 1;  2TEP A;  4CP2 A;  4COZ A;  3CZU A;  2ADE A;  2BBV A;  2B42 B;  1GZ9 A;  1GQG A;  3U0Z A;  3VDD B;  5EWS A;  2AYH A;  4RGG A;  3WX5 A;  4YFZ A;  1W8F A;  5DDJ 2;  1L3J A;  3ELN A;  5FYT A;  5LBB A;  1SLT A;  3USU A;  4NWV A;  5FLJ A;  5JWP A;  2ET1 A;  3HD8 B;  3J7M A;  2CAV A;  1G9A A;  1XRU A;  4Y1Y A;  5FY8 A;  5LA1 A;  1VPH A;  3CEW A;  4XHB A;  5LY1 A;  2LM3 A;  5L9V A;  2XJQ A;  1F35 A;  2XON A;  2QJV A;  3JD7 1;  4DS0 A;  2B7Y A;  3UYJ A;  3E5U A;  3VBU A;  2PTM A;  4AI9 A;  4IER A;  1O3T A;  4Y1U A;  2AGS A;  2VAU A;  3HNB M;  5E16 A;  3J7L A;  3WNP A;  1G9F A;  3GF6 A;  1OQE A;  1IPJ A;  2JG8 B;  3MUZ 1;  3POF A;  5LAS A;  1K3I A;  1OLM E;  5C8W A;  5JPM B;  4YPJ A;  5CG8 A;  1NYW A;  3ZVX A;  1UYY A;  2OZ6 A;  3TNP B;  3ZOI A;  4MVT A;  2XPJ A;  1US3 A;  2WZP P;  4JKL A;  3ES4 A;  3WEZ A;  3W58 A;  4CUC A;  5FCC A;  5FJH A;  1KDK A;  2EAL A;  1EYB A;  4FOW A;  3T2O A;  1JZ3 A;  3LEM A;  2D6M A;  3FE5 A;  1O4Z A;  1OA4 A;  1GWK A;  3G6J B;  4PBO A;  2Y0I A;  3FBY A;  1FI2 A;  4YNI A;  2HWF 1;  5GZF A;  4TZD A;  3NKG A;  2WFF 2;  5JUV A;  2Y0O A;  4GUL A;  4HK8 A;  1N1V A;  1W9S A;  1ZA4 A;  4OHZ A;  4BIS A;  3CL1 A;  2I2S A;  3JU9 A;  4NRM A;  4AGR A;  4WM8 A;  1PX4 A;  1ZBE 1;  1CPM A;  1H8V A;  3HJR A;  1R09 3;  1CJP A;  2MEV 1;  4XHX A;  1LUL A;  3HN1 A;  2E6V A;  3A4U A;  3B9I A;  1DU3 D;  3WW4 A;  4F83 A;  4Q2F A;  4DUX A;  1AR6 3;  1C8M 1;  3AXD A;  3K4A A;  3SC7 X;  2OXB A;  2YMZ A;  3CJI A;  2A73 B;  2R49 A;  5I0U A;  3BPS A;  1YIF A;  2RS1 1;  2FD8 A;  5ABJ C;  5F1R A;  4OQ8 A;  4XAB A;  3PDQ A;  3SHR A;  3WW2 A;  3FN9 A;  2DBN A;  2JEC A;  2AEN A;  3LA7 A;  1PGL 2;  2JX9 A;  1MZ5 A;  4KU7 A;  3WD5 A;  5E88 A;  3KS7 A;  4CEW B;  2I45 A;  4WVM A;  4BOW A;  1O4Y A;  1FPN 1;  4XF9 A;  1SAC A;  1UU4 A;  3LD8 A;  2W3J A;  3OY8 A;  1EAH 1;  1GIC A;  2YC0 A;  5L19 A;  5JPN B;  3OUJ A;  1TZO A;  1QJZ A;  3WIN E;  1MS5 A;  2QQO A;  1CZV A;  1X36 A;  4RGA A;  1L7Q A;  1DQ0 A;  2ID4 A;  3OUH A;  4ERO A;  4HKW A;  3ZYP A;  1NUK A;  1BJQ A;  1K5M A;  4WBB A;  5FUN A;  3I7D A;  4QGN A;  1XU1 A;  4UWD A;  1W8O A;  2MHF A;  5F3E A;  1R09 2;  2O8O A;  1ZA7 A;  2LTN A;  5C4W A;  3MO4 A;  3RRD A;  1ZNP A;  2CHH A;  3WW1 A;  4A6S A;  4QXC A;  4CDQ C;  1HQL A;  4YW7 A;  3KLS A;  2UYA A;  2R07 2;  3O12 A;  3LFI A;  4ZHN A;  4NIH A;  5DN2 A;  3V0B B;  2RMU 1;  2JIG A;  1VE0 A;  4UFK A;  3GBG A;  2WNU B;  2XWJ B;  4DEQ A;  2YRO A;  1PO1 1;  1N47 A;  3W9A A;  2ZX2 A;  1V6M A;  2P37 A;  3N9Q A;  2WNV A;  3RS6 A;  1OH3 A;  4MLO A;  3PUH A;  5CBL A;  3GJA A;  5F9T A;  3NRU A;  3RGB A;  3VHR A;  4Q1P A;  1U12 A;  2E9Q A;  4PLN A;  4CCD A;  1M06 G;  5AFB A;  3FBM A;  4JTO A;  4XBL A;  4BK4 A;  3O1T A;  1FAT A;  1NY7 1;  4DRV A;  5IVJ A;  3KHB A;  5H9S A;  2WO1 A;  2XOM A;  4OMD A;  5HV4 A;  2A6Y A;  5FMO L;  2TBV A;  4AHY A;  1CR7 A;  1BMV 1;  4MXW A;  1NLS A;  3NO8 A;  1TME 3;  3M3I A;  4PI2 A;  3SMH A;  4ASK A;  4CA9 A;  3ZXE A;  1XQN A;  2QQM A;  5GLU A;  3POG A;  4BWO A;  1JYC A;  4ZXK A;  2AC1 A;  1NCQ B;  2ARE A;  3A0N A;  1W8T A;  1W8W A;  3NV2 A;  4R8H A;  4HON A;  2ZEW A;  4YW4 A;  5HXV A;  4COV A;  3RFR A;  4N7I A;  5F3I A;  3SKV A;  5A6Y A;  3T4V A;  4CDU A;  1RUJ 2;  2V4V A;  1B35 B;  1NLR A;  3GHM A;  3QH6 A;  3RZK A;  1UKG A;  1GAN A;  4JTN A;  2VQ0 A;  5FYH A;  5FZ4 A;  3Q9O A;  2DVD A;  1GBG A;  1GWL A;  3C7O A;  1PMI A;  1WCQ A;  5A6Q A;  3RYR A;  2G4I A;  1TMF 1;  3WG3 A;  4CCC A;  2HBU A;  4XMA A;  4W6X A;  3BTY A;  4QWN A;  4EN0 A;  4GD4 A;  2PAK A;  3A7Q A;  3WR0 A;  3ZXL A;  2K2S A;  4QPG B;  1BK0 A;  4RQP A;  4DOU A;  2Y6K A;  1UZV A;  1RIT A;  3NKT A;  3T09 A;  1W39 A;  1SLL A;  1F9K A;  1IKP A;  5BYN A;  3MIF A;  5F5I A;  5IW0 A;  3SLI A;  4BQ2 A;  4YLZ A;  5LWB A;  1ND3 C;  4K40 A;  4Y20 A;  2RE9 A;  2XHK A;  4O61 A;  4D94 A;  2CWS A;  4YW3 A;  4IUG A;  3ZFF B;  4FPH A;  3M1H A;  1C8M 2;  2EXI A;  4MGI E;  4XJZ A;  4BH9 A;  1LHW A;  2W47 A;  2YBK A;  3ETP A;  5FQ0 A;  3DKQ A;  1W6P B;  1DIW A;  1QGL A;  1HB1 A;  4RS5 C;  4CEY A;  2XJT A;  4AGV A;  4YW1 A;  3OGR A;  5L9B A;  3UJQ A;  3IAQ A;  3WHU A;  2GNB A;  1H4G A;  1HRI 1;  1ND2 B;  1ULE A;  1VBA 2;  1NAE A;  2WYF A;  4KNC A;  4GJZ A;  4HKL A;  3OYW A;  4Q0P A;  3VKO A;  4C0H A;  4I0A A;  1UXX X;  3VDD A;  1PGL 1;  4LO8 A;  3U1X A;  1YIP A;  4X6R B;  2PLV 2;  3AM2 A;  4JGY A;  4A4A A;  4CEY B;  1QXP A;  2PFW A;  3MW4 A;  4CDQ B;  4LQR A;  4P9I A;  1DGR A;  5FZ0 A;  1RUD 2;  2ET7 A;  1WLC A;  4OUE A;  5F32 A;  3ORJ A;  2VMC A;  4LOS A;  3ZFE C;  5E6H A;  3KT7 A;  3H3L A;  3B00 A;  2PLV 3;  2X29 A;  4LIT A;  1J84 A;  1UAI A;  2A7A A;  3PMS A;  4JAA A;  5GLW A;  2WNE A;  2ZHN A;  2Q0A A;  4IW3 A;  4MGQ A;  3MV0 1;  1FV3 A;  2GND A;  1LU2 A;  4XZP A;  3WDX A;  3WDW A;  2O0O A;  2OPK A;  4YZ3 A;  3WQB A;  5KXB A;  3ACL A;  1DGL A;  2HWE 1;  1W6Q B;  4NR1 A;  4OHW A;  4OVE A;  5EJZ B;  5FZO A;  4B1M A;  2VY0 A;  3VBS A;  1V6L A;  1LHO A;  4N43 B;  1EPW A;  1LAJ A;  1AX0 A;  1PMJ X;  3UGH A;  3J8F 2;  5JSO A;  5K0U C;  4RHV 2;  5A3N A;  4IEV A;  4EQV A;  1HLC A;  3DPR A;  1FAY A;  3ENR A;  5FZC A;  2ZHL A;  4IE4 A;  4A3X A;  2Q1M A;  4LA2 A;  4YG0 A;  1YFW A;  4ZPI A;  1SEF A;  4DPN A;  3EXU A;  1VMH A;  2VW2 A;  1IS6 A;  2YFU A;  3HT1 A;  2D5F A;  3IMM A;  1R09 1;  2MEV 3;  1OF4 A;  5FYS A;  3FLP A;  1FV2 A;  4LKD A;  2J42 A;  3NV3 A;  3U37 A;  3T0B A;  4LBL A;  1KD7 A;  2GDF A;  4I02 A;  4CP1 A;  4DXS A;  3LEI A;  4QPG A;  1QXR A;  2VBP A;  4NID A;  1RUI 2;  4A45 A;  1IPS A;  1T6B X;  5FMB A;  1QF3 A;  4AGG A;  4JGZ C;  2Z4F A;  3IAP A;  4IV3 B;  4LEJ A;  4YVW A;  1YEW A;  2BGO A;  2DV9 A;  2OA2 A;  5FUI A;  2VOW A;  2P6C A;  1ZRI A;  1XSQ A;  1YJL A;  1COV 1;  2O8Q A;  3M3C A;  1CIW A;  3ZR6 A;  2MNG A;  3NAP C;  2QTW B;  1YUD A;  3ECQ A;  2VMF A;  2DTW A;  3BIW E;  2VEC A;  3E6B A;  2EID A;  2JDK A;  1BVV A;  1PZ7 A;  1BYH A;  3VHN A;  2FDI A;  2UU8 A;  2YV8 A;  1UZZ A;  3VGI A;  3VD7 A;  3WCR A;  5D8A B;  1DG6 A;  4J1X A;  2UWB A;  5FK7 A;  4P9X A;  3THP A;  3WG1 A;  2X5I B;  5B4X A;  4KG8 A;  3BTA A;  2PHL A;  2XKO A;  4GWN A;  4TLG A;  2VOV A;  4F8A A;  5J37 A;  4XET A;  2XVL A;  1IG3 A;  2JDU A;  4AFC A;  1V70 A;  4IE0 A;  5IVE A;  5F37 A;  1WA6 X;  1RVF 2;  3TN9 3;  5FP9 A;  1WCD J;  2EIG A;  4R9D A;  4XCA A;  1S0F A;  1X50 A;  1DLC A;  4OCT A;  3GZE A;  4TN7 A;  1NE6 A;  3ZYI B;  5T54 A;  2XL7 A;  4Y33 A;  2Q4S A;  1RUF 2;  4XIO A;  4CCJ A;  3UV9 A;  4AR2 A;  4OYU A;  2VO5 A;  3OUI A;  3QD6 A;  3R4S A;  3JD7 2;  1FX5 A;  5C9A B;  4QXB A;  3LEK A;  2ZAC A;  4QQO A;  4UT5 A;  1IS5 A;  3R05 A;  1TMF 2;  5T5P A;  1QJE A;  2CSG A;  4XTM A;  1F15 A;  1PGW 2;  5FO9 B;  1UX7 A;  1Z78 A;  1POV 3;  1Q8V A;  1Q8O A;  5JMC A;  1O3R A;  5FYC A;  5IK5 A;  4CCM A;  3G7D A;  2JJ6 A;  1S0D A;  2VMH A;  1SLI A;  1HRI 2;  2W92 A;  4H7M A;  1E5R A;  4QGM A;  3NJY A;  2VCA A;  3ON7 A;  2EXH A;  4CCN A;  2DCY A;  4MV2 A;  1HN1 A;  2WFP A;  2BFU L;  2ZGM A;  5FMC A;  3OGV A;  3GHN A;  3LPG A;  1VAM A;  1U5X A;  5D21 A;  2VOK A;  5JVV A;  4N43 C;  4LUL A;  2E33 A;  2VME A;  5C8C C;  3SIS A;  3O5S A;  3PJQ A;  1JZ7 A;  5FO7 B;  2IXL A;  4Q0S A;  2O1Q A;  1OBN A;  3ZO0 B;  5A33 B;  2WNU C;  1JN2 P;  3MIH A;  3LWC A;  5DZE A;  3VHP A;  1XNB A;  4AAP A;  5L73 A;  5H9Q A;  2C1F A;  2YFZ A;  3W59 A;  3IZO A;  1XE8 A;  3ACH A;  5E89 A;  3AB0 A;  4K7J A;  3ZMN A;  1YQ2 A;  1QJY 2;  2VW0 A;  3T0D A;  2BWA A;  1W9T A;  3K3N A;  3VLB B;  1Z0H A;  3TB0 A;  5FPB A;  1BBT 2;  2RV9 A;  3U14 A;  3VBR A;  2QQP A;  2HLE A;  2PHU A;  4CDU B;  3QCW A;  5A1A A;  3AKT A;  3B7M A;  4BM8 A;  4ES8 A;  2ARA A;  2BVB A;  4Y4Y A;  3HNM A;  3BIE A;  3AZV A;  4F3J A;  4MX3 A;  2A6W A;  2F4P A;  2OPW A;  3POW A;  3R4U A;  2JE8 A;  2DCJ A;  4WM7 B;  4IND A;  1AR6 2;  1PMH X;  5LA0 A;  4LBQ D;  5CKM A;  3ZXG A;  2R07 1;  3D6E A;  1E5S A;  2JE9 A;  1O59 A;  4XCB A;  4AVC A;  2ZGR A;  5J3U A;  4HZF A;  2QZ3 A;  2I74 A;  1KEX A;  5A32 A;  4IV1 A;  4L11 A;  2BU9 A;  4WM7 C;  4BQ5 A;  4JRL A;  1OFN A;  1JTZ X;  1D4M 1;  1VP6 A;  4HPK A;  2L9L A;  4KI5 M;  5K4L A;  1W03 A;  2JKB A;  3T1M A;  4MH0 E;  5ABJ B;  1IG0 A;  3C3V A;  3KB5 A;  4UI9 L;  5FMO S;  2NMN A;  5AC9 1;  1T2X A;  2LRP A;  2NMO A;  2ZAH A;  2ZGP A;  3DEC A;  4LBJ A;  1ZZ6 A;  2ZEY A;  4J25 A;  4NWW A;  5DUX A;  2HWF 2;  4LO7 A;  5HBA A;  1ULC A;  4C90 A;  5LEK A;  3LOI A;  5DUV A;  4K20 A;  2AR6 A;  3IDE A;  1OD5 A;  2HJI A;  4YGE A;  3MI8 A;  5ERL A;  4P02 B;  2NLR A;  4ARY A;  4V2W A;  2Z2S B;  3AZW A;  4AOC A;  4AWD A;  4QB2 A;  1WWY A;  2QVS B;  1GOF A;  2HWC 3;  2VTX J;  1ASJ 3;  3DPR C;  1G9B A;  2BEO A;  1G6N A;  2PAE A;  1URX A;  4GKY A;  3TN9 2;  2ZAA A;  3AXE A;  3B3Q E;  5EJ1 B;  3LDR A;  1ZBA 3;  4O7X A;  4N8M A;  2CGN A;  2K9Z A;  3WDV A;  4X8P A;  1QOO A;  3OBR A;  1DFQ A;  4BE3 A;  1G8W A;  2WII B;  5KHJ A;  3E97 A;  3VBS C;  4AVT A;  3FL7 A;  5FZO B;  5J48 A;  3KCY A;  4CDX A;  2Q1Z B;  1AHS A;  2IWG B;  5JIA A;  4IEY A;  3THD A;  4YW2 A;  5I0S A;  3FJS A;  4JGY B;  1DHK B;  1PHM A;  4IEZ A;  5LB6 A;  3AK0 A;  3POE A;  3AP4 A;  5FZL A;  3WDT A;  2VL4 A;  1HW5 A;  1OUR A;  3KGZ A;  1O7F A;  3N4M A;  2DYC A;  3T2Q A;  4D69 A;  3IBM A;  1LED A;  1S4C A;  2JB8 A;  1NOV A;  2PXJ A;  2ZEX A;  3WLU A;  1KQR A;  2ZGK A;  2VC9 A;  4FFH A;  4B4R A;  4PT6 A;  4WZC A;  1AR9 1;  3GXU A;  4CCL A;  4AL9 A;  2R1D A;  2VZR A;  4JGY C;  2R06 1;  2W91 A;  1FXZ A;  5J36 A;  3O14 A;  2FDK A;  5IFP A;  1MS9 A;  1XC6 A;  2Z42 A;  1MS0 A;  2HWF 3;  3HIF A;  3FMG A;  1A8D A;  1FMD 3;  3ZN6 B;  2R07 3;  1FPN 2;  3AFG A;  2R04 3;  3FLR A;  1HDK A;  4W6Y A;  1X9T A;  3VBH C;  2DVA A;  3EO6 A;  4DXR A;  1MZ6 A;  1D4V B;  1MVQ A;  1Y9G A;  2A3X A;  3CQO A;  1DGR N;  4LBO A;  1V9U 1;  2D6L X;  3E5Q A;  4YZ2 A;  5CA6 A;  4HVR A;  4B8E A;  1OC1 A;  5A1F A;  4GZ9 A;  5KWR A;  5BY5 A;  2R0H A;  3J8F 3;  2VXR A;  5DAX A;  4FTB A;  5GLZ A;  3W5N A;  4YVW B;  5SV5 A;  4RQP C;  3GNE A;  2EXJ A;  4DZG A;  4AVV A;  3NNF A;  3ZXD A;  2WA3 A;  3O1V A;  1RIR A;  1AR8 2;  1SDD B;  2AEY A;  3K4Z A;  1Q8Q A;  1O3S A;  3LEG A;  1S0E A;  3IDA A;  4P5Y A;  1B35 A;  1AXY A;  2VZP A;  5DQ0 A;  4GKX A;  4LK6 A;  5FR3 A;  5LK5 A;  2Y26 A;  3DCQ A;  4YG3 A;  2ZS6 B;  4ORF A;  3TBD A;  2HH9 A;  2KA3 A;  3OD0 A;  1GNY A;  2NZ9 A;  2WZ8 A;  3AMP A;  2JB4 A;  1M4W A;  2ZTN A;  3LAG A;  3N36 A;  2WA4 A;  4IV3 A;  4W6W A;  5IHR A;  1UIJ A;  4LE4 A;  1W0N A;  4HFS A;  4H2A A;  5IFT A;  3V0A B;  3LDB A;  2GP3 A;  4GA9 A;  4NAM A;  4Q26 A;  3VDB A;  2E7T A;  2HWB 1;  1YFX A;  4LA3 A;  3P5B A;  4P9L A;  1O6U A;  1S0I A;  2B9V A;  1AXZ A;  1SFN A;  2ZMK A;  4L99 A;  4AQT A;  5EXO A;  2RR1 3;  1JXN A;  1HXS 1;  1NXM A;  2ZGN A;  2RS3 1;  3J9S A;  4NHX A;  3VBO C;  4LBK A;  4XDQ A;  3RMX A;  3VV1 A;  2V4A A;  1BMV 2;  1NCQ A;  2V5D A;  4HK9 A;  5IVF A;  4BQW A;  2J22 A;  2X09 A;  2R04 2;  4DY5 A;  1EV1 3;  3VD9 A;  1GP5 A;  1APN A;  3MGU A;  5ISL A;  5GZE A;  1S2K A; 
#chains in the Genus database with same CATH homology
 1W8T A;  4CPB A;  1W8W A;  4CP9 B;  4CP9 A;  1W90 A;  4LJH A;  2C24 A;  1OH3 A;  4LKF A;  1W9F A;  1WZX A;  2LRO A;  4BQ5 A;  4LK7 A;  2K46 A;  1V0A A;  1UOJ A;  4BQ2 A;  3UT0 A;  1W8U A;  3ZYF A;  1WMX A;  1W8Z A;  3ORJ A;  3ZYB A;  2O14 A;  4YWA A;  4AL9 A;  4LKE A;  4BQ3 A;  1GWM A;  2Q1F A;  1GWL A;  2JWP A;  1GWK A;  3F95 A;  3ZYH A;  2LRP A;  4A6S A;  5D21 A;  4YW7 A;  1L7L A;  4YW6 A;  4CPB D;  2VXJ A;  4LK6 A;  4BQ4 A;  1OKO A;  2KR2 A;  4LKD A;  1WCU A;  1HN0 A;  2WYF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...