1OH3A

E78r mutant of a carbohydrate binding module family 29
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
141
structure length
141
Chain Sequence
b'RATYTVIFKNASGLPNGYDNWGWGCTLSYYGGAMIINPQEGKYGAVSLKRNSGSFRGGSLRFDMKNEGKVKILVRNSEADEKFEVETISPSDEYVTYILDVDFDLPFDRIDFQDAPGNGDRIWIKNLVHSTGSADDFVDPI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NON-CATALYTIC PROTEIN 1
publication title Ligand-Mediated Dimerization of a Carbohydrate -Binding Module Reveals a Novel Mechanism for Protein-Carbohydrate Recognition
pubmed doi rcsb
source organism Piromyces equi
molecule tags Carbohydrate binding domain
total genus 32
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-05-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 1oh3A00
1HN0A 2WYFA 4BQ3A 4BQ4A 4LK6A 2O14A 1WMXA 1WZXA 2LROA 2KR2A 2Q1FA 3UT0A 1W8WA 4CPBA 4YWAA 4YW6A 4LKFA 2K46A 1W8TA 1GWMA 1W9FA 2LRPA 1W8ZA 1GWLA 4AL9A 1OH3A 3ZYHA 3ORJA 4CP9A 4CPBD 1W8UA 1OKOA 1V0AA 3F95A 5D21A 4CP9B 1W90A 1L7LA 2JWPA 4LKEA 4A6SA 3ZYBA 4LK7A 2C24A 4YW7A 3ZYFA 2VXJA 4LJHA 1UOJA 4BQ5A 1GWKA 4LKDA 1WCUA 4BQ2A
chains in the Genus database with same CATH superfamily
1F2NA 1QDCA 5LB6A 1RVF1 3K3NA 1YC61 2RDQA 3WNLA 4CXWA 4TLFA 4AAPA 1CWPA 1Z78A 4Q4X1 2OPWA 2VTFA 3AFGA 1PHMA 5FZ4A 3D0SA 4BPZA 1JYVA 1NCQC 4CCOA 4K40A 5E6HA 3ECQA 4HANA 4ZKTB 3FFZA 2XKPA 1F15A 1C3HA 1DFQA 2XXZA 1OUSA 2BFUL 4PDWA 2OZ6A 1Z7S1 3RI9A 2OW4A 2WS92 2D6MA 1HB3A 4N9HA 2C6SA 2DVAA 4YW3A 3MIBA 4QM9A 5FK7A 3EJKA 4FP3A 1XC6A 3WR0A 3O1MA 1YI7A 4JHZA 4LR4A 4C90A 3DXUA 5JR7B 1KGYA 1Y9GA 2FCVA 3VD5A 4QDQA 1UU4A 3ZXDA 4ZU7A 3VL8A 2XJTA 2HWB3 2A70A 2JENA 2XUEA 3AB0A 3OGSA 3H7YA 5JI9A 4GAZA 5C8CC 2A5ZA 5L73A 3LSDA 1KITA 2WN2A 5FKBA 3V64A 3MUZ1 4QKBA 3ACLA 4I30A 1BEV1 1AVBA 4PIZA 2ZGPA 4XC9A 5I8TA 4YZ1A 1LOFC 3WXPA 1JYWA 3GCWA 2FD8A 4P9WA 3L2HA 5CIRA 1AR82 4ARXA 1WWYA 1WKYA 3J8F3 3H50A 3KZ4C 3FUQA 4YM1A 3ZFGC 3M8LA 5ANNA 1X9TA 4PLOA 3VBFA 1UWWA 4J6GA 2Y6LA 4ZPIA 2CAUA 3V56A 1CVNA 2BVVA 2JG8B 3H1WA 1WCQA 3MIHA 4GH4A 4GWNA 1NUKA 3THTA 2JIJA 5A7SA 3RWNA 3ZFEA 4AI9A 4Z1VA 5LW9A 1YFWA 1EAH2 1ZZ8A 1X50A 3J7HA 5A33A 5FY8A 2QQVA 3VBUA 3PL0A 1JZ8A 1COV3 1GV9A 3VKNA 2P6CA 5JIUA 3A4UA 4OVEA 5A3NA 1Q5OA 3VD7A 3K3OA 4IESA 3K77A 2UYAA 2CGOA 1HKDA 1WBLA 1Y7BA 2XJSA 1C8M2 3LEGA 3RZZA 4P5HA 2RDRA 2WO7A 1SLCA 1SLBA 1UAIA 1UOJA 1WA6X 1XU2A 4S2GA 3ZN4A 4PDWB 3ZN5A 2CGNA 1HRV3 1S2KA 1NLQA 3T1MA 4JDNA 5DN2A 2QQWA 1TMF1 3BKZA 5GKAC 4KG8A 3UJQA 5FY4A 4FPOB 3W5NA 1GUIA 4LOTA 2KR2A 2BQPA 1NKGA 1O59A 1OFNA 1NLRA 2WINB 2AR6A 4Q4W3 4LBJA 4FAGA 1EPZA 1WA4A 5IATA 1RUJ3 1W39A 1QJY1 2HWD2 4YVSA 5CA6A 2X53S 1GZTA 3OGGA 3POJA 2PFWA 4CEWB 4YRDA 5C5UA 2JX9A 2Y6FA 2DURA 3ZFFA 4MGQA 3ZXLA 2W68A 5D21A 3AVRA 5G04L 3SEEA 3JD71 1WLCA 1QGLA 1OKQA 1ZBE3 4XJZA 4YPJA 3E5QA 1BBT3 3WEZA 5I8YA 2VZVA 1KRIA 1YHFA 1H9PA 3CKHA 3GZTB 5C3RA 1CQ9A 5KHJA 2GMPA 5FYVA 4OMCA 2XBO2 4JQTA 1R083 4M0NA 2A6XA 3T08A 2D3SA 1ZA4A 2JD9A 3AJYA 1U5ZA 1Q43A 1KDKA 4QPIC 2PXJA 2PELA 5AFBA 1D7PM 5L19A 3ZOIA 4NRMA 3ZFEB 2PHWA 2VW0A 5IK5A 3HWJA 3AJZA 1A3KA 2BEOA 3ELNA 5IVVA 4AFBA 1ALYA 2KD7A 5FP9A 3N7LA 2TUNA 2OXBA 5JSOA 1VBC3 4RL7A 3C2UA 5LK5A 1PGL2 2RV9A 5DAVA 5KXBA 4DOUA 3GDBA 5F5IA 2VCAA 3KM5A 4JQRA 1DCSA 2P6HA 2R063 4CEYA 5FZHA 1CAXA 5IYYA 2RS11 4XPVA 3DN7A 2CSGA 2E63A 4LIUA 1US3A 3THPA 4BQWA 1RUF2 5KBFA 4OFGA 4BZ4A 3WY6A 1W6MA 2OT7A 4YVSB 2DTYA 3BIWE 4JGYC 4UFHA 5T5JA 3M3IA 3V0BA 3SKVA 1V0AA 2O0OA 3FMGA 3ZFFB 4GULA 1KFXL 1ZRIA 5FK8A 4DPNA 4EN0A 1JYTA 3BPZA 4HOOA 1W04A 2A3WA 4L99A 1TME3 5CVRA 4DO0A 1LU1A 2VOVA 3ME2A 1LHWA 4FTBA 1C5HA 2RM23 5IAVA 3DYMA 1OD5A 4AEKA 4SBVA 4FQZA 5FYBA 4MSVA 3RYPA 2QNKA 5JXIA 5EXOA 3TEWA 4RQPA 1O3SA 2DVGA 2FQPA 4DXSA 2ZABA 4QGNA 1AX1A 1W9WA 4D3WA 3VZKA 4B1MA 4LA3A 3VDAA 4O65A 2JE7A 2XGXA 1VIWB 4IV3A 4H7LA 3WUDA 4QPIA 2VZRA 1HDKA 2E7TA 1KJLA 1RUC2 5A80A 3TN92 2B8MA 3CNAA 4CEYB 1OQDA 1CAXB 5DABA 5IWFA 2XQXA 3IZOA 3AZYA 4CVUA 3GXUA 2XDVA 2XVGA 3DYOA 1W3VA 3WT3A 4V2VA 4I3GA 2YDEA 4YM3A 2PN5A 5FPXA 4FPLA 4A2UA 1UU6A 1V9U1 4PF5A 2HWE3 2QQUA 1HQLA 1RMU3 1HB2A 2WWUA 3IBMA 3FC0A 4LE3A 4FPHA 4PLMA 3NKTA 4TXWA 1W6MB 1G7YA 5JIAA 4XF4A 3CZJA 4XDQA 2W39A 3V0BB 3H8XA 4Z92B 1OA2A 4CU8A 2HEYF 4O9GA 4AG4A 1ZRRA 3KV6A 2BDRA 3V0AA 3NJXA 4EZHA 2OQ7A 3LCPA 1BMV1 3WP3A 1HX6A 1NOVA 4ONUA 1U0AA 4KH9A 5FUPA 4X6QB 1PMIA 3AXEA 4YFWA 5IW0A 3VZLA 2YU2A 4XUTA 1AR91 1EV13 3OYWA 4CYDA 4ASKA 2HH9A 1PGSA 2ZEXA 5FFOC 3SCFA 1IS4A 1D4VB 1RVF3 1ULGA 1RUD1 3AXDA 4JGYA 1URXA 1SCSA 3DPRC 1HB4A 4NRPA 4RQPB 1V70A 4QKFA 2YPDA 4Q4X3 1PVC1 1VP6A 4RR3A 5JXGA 3I2FA 1C5IA 4M3CE 4ITCA 4AEDB 3EHKA 1IG3A 3I3MA 2ARCA 2R1BA 2XJUA 5FZEA 1CX1A 1AUYA 2ZCWA 5FDBA 2WZPP 1H30A 2E9QA 2X29A 4IV3B 1QHDA 1MVEA 5HCFA 4YW2A 1APNA 3DEMA 1R091 1WUVA 4BQ5A 4AGGA 1UZYA 2XJPA 1CX4A 2PAMA 4RHV2 3SEPA 4CDQA 5FLHA 5IAXA 3VBHA 3H3ZA 1QWRA 3CQOA 3FE5A 2Z2SB 3HD8B 2DUOA 2V5YA 5LASA 2VZQA 3T2QA 2YB7A 1KFUL 5KHGA 1HN1A 4LE4A 1UZWA 3TB0A 1DZRA 4BWOA 1WGPA 1U12A 4AXOA 1MS9A 1UY2A 1ND3C 1Y4WA 4XILA 2A6WA 1BBT2 3IAQA 3OG2A 4UW6A 2RMU2 4WM8C 4D6SA 3AM2A 5FPAA 2BRTA 3O1PA 2JDUA 4KI5M 4WVWA 4AHWA 1HQNA 4EQVA 1ZRDA 1BEV3 1JU4A 4COZA 1YJLA 3OGVA 1P8JA 1WLTA 1SFPA 3GGLA 1Z0HA 3ASIA 3OYWB 1SMVA 2FDHA 2ZGMA 3P3PA 4KWLA 4IDZA 1I6XA 4O7XA 2Z42A 1RUG3 4P9GA 4KG0A 4BOWA 4YW6A 2CGPA 2QJVA 2K9ZA 3CEWA 1GWMA 1XE7A 4YW4A 2BW8A 3RYKA 4EN9B 5FZIA 4RR3B 3FL7A 2YPJA 5JPMB 2GC3A 2AZ5A 1NE4A 3DGTA 2WN3A 3CDZB 5GALA 4UW3A 1ASJ2 4LKEA 1XNTA 1E57A 2R062 1LJ7A 4NIDA 3O0XA 2OZJA 1UMHA 3CHXA 2PAKA 3JBG3 3FZ3A 4LKDA 1POV0 1RXGA 3SITA 2VW2A 4CDQB 1QJX3 4YFZA 2UU8A 3VBHB 1G9CA 5FPBA 2XJVA 3NVCA 5A3PA 2FMYA 1Q8OA 3TAYA 3C7EA 2ZX1A 2L9LA 4JKLA 3BN6A 4Y22A 3VD9A 1RUI1 4MO3M 3VD4A 4KU7A 5F3EA 2VZ3A 3UJOA 3ZXGA 4C0HA 5LK7B 2WABA 3ZN6A 2ZAHA 2GAUA 2VH9A 5IK8A 1C28A 1VBE3 2C24A 2HEVF 3RZLA 4AE2A 1O3QA 3WVJA 3LE0A 1NZIA 4IE4A 1EUUA 2CDPA 3B01A 3PDQA 4Z2WA 1H2KA 3KCYA 1IGOA 2JDZA 4P9LA 3NNGA 5C4WC 5F6KA 2DUPA 4YVWA 2JDKA 2EXIA 1OF4A 1YXWA 1JZ3A 1WMEA 2PQSA 4QX5A 2RS51 3IMMA 2Q0AA 4RS5C 2VBPA 2G1MA 5I0UA 3NNMA 3VHNA 4Q29A 1ENSA 3KWVA 2A71A 5TSWA 3T4VA 3VDDC 3VZOA 5CFDA 4FFGA 1S55A 2YFZA 1REDA 5BPXA 3VZMA 3DKQA 2W87A 5LY2A 5JXHA 1L7RA 2GALA 1JI6A 2QQNA 2RS13 1STMA 4AW7A 4Y22B 3PIGA 1AL22 3M1HA 2F6BA 5DUUA 3ETPA 3ETQA 1ZNPA 4FPGA 1SLLA 3SHRA 5IUQA 5CBLA 1NXMA 5C9AA 2VCCA 3WF1A 3ZN6B 4HKOA 3WDYA 1K5MA 1YQCA 2VW1A 3AFKA 3OY8A 4OI4A 3CBNA 3GYDA 4UWDA 3EYPA 5DAWA 4E2GA 1OLQA 3MI8A 1LAJA 1RVF2 1TG7A 2GSYA 3ACIA 4I0BA 4RGAA 4YM0A 4MGTA 1YQ2A 3C7FA 4BQXA 5GZDA 3LF7A 5FMOL 3ATGA 3VLBB 4HN1A 3HIFA 4AVSA 4Y1YA 4Q4X2 3TN91 4QX3A 1W8WA 3RZKA 2BGOA 2FZ2A 1DQ6A 1DF0A 3RMYA 1QOTA 4YVWB 2R7EB 3OBAA 3LDBA 3VHPA 5FY7A 1HXS3 1BVVA 3LAGA 2JDYA 3ZO0B 1OVPA 4LITA 5FZBA 5JWPA 5FZLA 3AKPA 1N3QA 5T5LA 1FNYA 3W21A 5K0UC 1UNBA 2D5HA 2J1EA 1NA1C 1Z7S2 2PHXA 2GDFA 2WSUA 3AZVA 3OD0A 5SV5A 2K0GA 1XYOA 4JKMA 4LA2A 2W46A 3DECA 4MXWA 4PCRA 4RA0A 3ZVXA 5CFDB 1CAUB 2KXLA 1BK1A 5D8AA 1UPIA 4IV1B 2WYFA 2OX0A 1POV1 1YQ6A 1W99A 2JB8A 4LMFA 1O4ZA 3HQUA 2BBVA 4BXSV 4QWNA 5B4XA 4GWJA 3WINE 5LA1A 2JB4A 4L9BA 4RS5A 4L0PA 4WZFA 4UF0B 1V9U3 2VMGA 3OUHA 3PVBB 2BOJA 4FVVA 1MZ6A 2OIIA 5BYNA 2EVXA 4Y33A 4NHMA 4QPWA 3N36A 5CZKA 1BEV2 3VDDA 1G86A 5C9AB 1SPPA 2Y6JA 4XE9A 1HV0A 4NIAA 3D82A 3SH3A 3RZGA 3WDXA 1K5MB 3MV01 1LGBA 5J3UA 3OY8B 1QJZA 3N3HA 1W2TA 4XTMA 4EN6B 3RG0A 1NE6A 1VMHA 2VQUA 2HBUA 2PHRA 3VKMA 2RDNA 3E5UA 1WD3A 1Q8VA 3WZ1A 2RG4A 4A3XA 1PM7A 2VOWA 3AKQA 4R9BA 1AR93 4R9CA 2ZX2A 2WO2A 2Q1MA 1LULA 1ZBA1 1W3XA 2P34A 4H14A 1OUXA 1QXJA 2LALA 2VQAA 5KC6A 4HPKB 5SV8A 3FBMA 3MV11 4CTEA 3MZHA 2X09A 1MEC1 4FFFA 2Q8DA 1PVC3 3ACHA 5LBBA 5FO9B 1DQ1A 1HB1A 2QTWB 3AMHA 1W0PA 4CDXB 2CHHA 2A3YA 2H6CA 3AYAA 3HR9A 1W0OA 2D6KA 1BLZA 3B7MA 3KMHA 3VV1A 2XWBB 1H6YA 1TMF2 4IXLA 4MXWB 1SLTA 5LA0A 4KBZA 1W8NA 5APAA 1R093 1W6NA 4K20A 4XFAA 5L9BA 3K46A 2R32A 2DFCA 4FXGB 1S0CA 2IXIA 3MF6A 2YG0A 3VL9A 2BNOA 1QJY2 3OCPA 1VBA1 2E6VA 2Q5TA 4E4ZA 5FZOB 4YG6A 5HCBA 4PIYA 3AP6A 5FXVA 3WP6A 2W0XA 1S0EA 4QQPA 2ADEA 3WQ0A 5FZ1A 1JOBA 3JD72 1EP0A 1KXGA 4KQ7A 3FX3A 1SPPB 4Z07A 2I2SA 5FMBA 3RJ2X 1EAH3 3AKTA 3PMEA 2PHLA 5F2SA 5K4LA 3GALA 4N53A 1QJU1 4UI9L 1ULPA 3OPWA 4OLLA 2DBNA 2OPKA 2X5IA 3B93A 1V6KA 4MGYE 4X8NA 4D8MA 4Q0UA 1F8VA 5LBCA 4OUEA 1WCSA 2DCTA 2ZGQA 5FLIA 2W91A 4E4SA 1NCRC 3HNBM 4LO5B 4XF0A 2WLPA 4NHYA 2ZGUA 2ORZA 3ILRA 1PIV1 1KQRA 4CUCA 1UY4A 2WC2A 4AI3A 1N1YA 3HT1A 2VULA 4N7UA 4AAXA 3B02A 5FO8B 5FUIA 1UMIA 3ACFA 4A6SA 2ARAA 2DV9A 3PUAA 1UQXA 2ZEZA 1B35C 3JZVA 4P9IA 4FOQA 4LBLA 1M06G 4XBNA 2RS12 4DY5A 3ZSMA 1VMFA 2PAEA 1NG0A 1W6NB 4QU1A 5BY5A 2FDIA 1IG0A 4A7KA 2CWSA 1FT9A 4Q5OA 2XBO3 1Y9QA 2VMDA 4UOJA 3GF6A 3KQ4B 2BBAA 4YNIA 2QZ3A 3I3BA 1RUI3 1YEWA 1JZ6A 1I5ZA 2RS31 2WZ8A 5T5PA 2FDKA 4NPLA 4Q4V1 4D7YA 3KSCA 1S2BA 3ZXEA 5FMCA 4C91A 4N43B 2E7AA 4HSLA 4OI2A 3CLPA 4XHBA 5CG8A 1GOHA 1REFA 5J96B 1UXXX 4N53B 1OPOA 1IHMA 2CU5A 3AP7A 3RDIA 2VNGA 3K4ZA 4ZXEA 1AR61 4QB6A 5E88A 4GB31 5DZGA 4LK6A 4LIVA 1LRHA 3MPBA 4OUMA 3DUIA 2WQ4A 2ZZQA 4LO6B 4LO4B 5DDJ1 5FO7B 3NJZA 4ZS2A 3UKNA 5CG9A 3Q8FA 4QHBA 4FSJA 2YMZA 1A8MA 4NO4A 4B8EA 2P3JA 4OZXA 3PTRB 3K75B 3ORJA 3O1OA 2VZPA 4OI0A 2JG9B 1W8HA 4IEOA 3WF0A 3JU9A 5JOWA 1AR71 2MNGA 2YY1A 3K51A 4CP2A 5FYMA 1AXYA 2UWAA 1M4WA 2H0BA 1CPNA 4QKDA 5C3OA 2Q8CA 1H1MA 1DBNA 4AHXA 1GKBA 4AL9A 3LGRA 2NMOA 4WBBA 3MLJA 4YARA 3TEZA 1OBNA 1V9U2 5ACA1 1JW6A 3VBSA 1CAWA 4XURA 3USSA 4XUNA 4FTSA 2GNTA 3M3EA 3VHRA 1XU1A 4MGKE 4QX0A 4FTEA 4XAEA 3HN3A 5CYYA 1OI6A 5ABJA 1G9BA 5IFPA 2PA7A 2GC2A 5AC91 4B29A 4L92A 1B35A 2VUAA 3N9NA 1ND2C 3CF6E 4GWIA 4LBQD 2V4VA 3POEA 2JDNA 3CJIC 4AI2A 4JDOA 2WFF1 4M0HA 1BMV2 1E5RA 1LHOA 2D6OX 4XOGA 5JVVA 4BISA 5A3MA 5JZGC 1OPMA 2XQRA 4HETA 1AR92 1D4M1 1GYKA 3AMQA 4LHSA 1BK0A 4AFCA 2FCTA 3A23A 5IJRA 5L7OC 4GALA 3TNQA 1RUD2 2ARBA 4I01A 2VD7A 1WMXA 4XF1A 4CPBA 5J48A 3GCXA 1C1FA 1RUC3 1PVC2 2XLAA 2DVFA 3KT1A 3NNJA 4XDOA 4K1ZA 3TN93 2RE9A 4XDPA 2IVJA 2YGMA 3AKRA 4QPYA 4IEWA 2VY0A 4BXFA 4IETA 3ACGA 5B2GB 3CZUA 3I54A 1X82A 1OA4A 2QQMA 4JGZC 4MGZE 1QH6A 3WW2A 1OSGA 1GOFA 5C33A 5CKNA 1R092 4XBQA 1OH4A 1UOFA 1Y3TA 4OHZA 2J1RA 3SH4A 5CU1A 3ZXFA 4CUGA 1HRI1 2EXJA 1LNSA 3KF3A 4HVRA 1VBB1 2WA3A 4O9EA 2ZHLA 4E4HA 3VDCA 3QD6A 1V00A 4XMAA 1RL3A 2N7GA 3NW4A 1JYCA 1RC6A 3FUOA 3K4AA 1BKZA 1O7FA 1POQA 3O5SA 4NJ4A 3ZMNA 1AYM1 3VKOA 4A45A 3I59A 4URTA 1G9DA 5ABJB 4GMP0 3Q8EA 5CFCC 5F3GA 4CDWA 5BNOC 1Q3EA 2ZX3A 1V6IA 4PT6A 3POFA 4FFHA 4PQ9A 5A7QA 5JDBA 4GKXA 1MS0A 1GNHA 2ZGSA 4BQ1A 2AEYA 3GZUC 1XB9A 1RYYA 1WW6A 3OTFA 3RZHA 2LUWA 4XABA 5FY5A 5GLTA 2QQOA 3RSJA 5KXEA 2VG9A 5D1IA 3WW3A 3AMPA 1IS5A 1Y43B 5EFUA 5IK4A 2A7AA 5DUVA 2ZMLA 2NZ9A 3UYJA 2VL4A 1NCQA 4KL1A 3FLRA 4XW3A 4LBNA 4RHV3 1VB4A 3WG3A 5A3TA 4KNCA 4L2NA 2QQKA 1OT5A 4MLOA 3MLKA 3AP5A 5LWBA 1XPWA 3R4SA 1MEC3 1X9PA 2GN3A 2IWGB 3GBGA 3ABZA 5K7PA 1ENRA 5EIYB 3ENRA 3IDAA 3GZAA 1C1LA 1GZCA 5FMOS 4COWA 2D44A 2RMU3 3NWKA 2ORXA 4S2HA 1OKOA 2GU9A 1QJFA 2AEZA 4XJ8A 3BOPA 4IE7A 3BU0A 1JHNA 4BMBA 1AXZA 2WNUC 5FYIA 1QKQA 3POIA 1RIRA 3VBFB 3S30A 1UY0A 2ZGNA 1RUI2 4L97A 4B7KA 1XRUA 3LPFA 4XEZA 4GH4B 1YQ5A 1K45A 2W95A 4QXKA 4Y3OA 4BYYA 3J7NA 5DXDA 5FZ9A 4JGZA 4TLGA 3I59B 1DQ2A 4LLOA 3N7MA 4CDWB 4Z2AA 5A33B 3HOBA 4QB2A 1YO8A 3VBUB 2LW8A 1LOFA 1N1VA 4JAAA 3HQRA 1JH5A 2OVUA 2ZX4A 3LSEA 4A4AA 4ASLA 3O0VA 5H9PA 3ZFGA 3H8UA 1JN2P 4QX1A 4QAWA 5CB7A 3O7OA 4C1WA 1PO11 2JJ6A 1RUOA 3AP9A 5GJ6A 3KD4A 2YC2A 5KHHA 4NIHA 1ASJ3 1N1SA 1QJU3 3OF1A 4ORFA 2EIDA 1IS6A 4DINB 5C5TA 3UNPA 2GP3A 1G9FA 3ZSLA 4CCKA 5CFCA 2F17A 4AVAA 4JTNA 1NCQB 1RITA 2A73B 4CCLA 3A0NA 2R6QA 3ON7A 3T2TA 2RS52 3AZXA 4IERA 1H8TC 2RDSA 2CTVA 2O8QA 2WZR1 4MV2A 3FJSA 2EF6A 1V6JA 1YRZA 3PMSA 4KU8A 1LEDA 2Z4FA 4Y1ZA 4UFIA 2IXHA 1L7LA 4F7ZA 1J1LA 1GNYA 1UL9A 2GMMA 2WA4A 1JOPA 1W03A 1X33A 5JPNB 1FPN1 1ZZ6A 2WNVC 4KBBA 5KXCA 4AEJA 2ZXQA 4MGSA 2IFWA 3POYA 3POBA 2JE9A 4JVAA 4G3YC 3M3QA 4CXYA 2J1AA 4HBNA 1LOEA 3O1RA 3VKLA 5C8CB 2ZHKA 1YUDA 1QH7A 1CPMA 4ISRA 4UW4A 5FJHA 1JUHA 1TNRA 5JOXA 4GMP1 2WRAA 1KEXA 1CONA 1SDWA 2RS33 3C7GA 3MIGA 4HL0A 2DWRA 4Q4V3 4FPCA 2E32A 5CKQA 2VVFA 4WVVA 2VCBA 4H55A 4FO9A 2PQQA 3SC7X 3ZR6A 4E2QA 2A3XA 4B4QA 1F35A 3RGBA 5J36A 1OD3A 5F5QA 4BQ2A 2GMEA 2HWF1 5C6CA 2ETEA 4ZONA 4WVMA 4Y1UA 1UYPA 4HT1T 5GZCA 2J42A 2XL7A 3MW3A 2RHPA 5A6XA 5KHIA 4RN5A 5FY0A 4FPFA 1KDMA 4K8RB 2Y60A 5FYZA 3RNSA 3RRDA 3I2DA 4W6YA 4XQWA 1AHSA 1IPKA 1U5IA 3S0MA 5DDJ3 2QBXA 1DLCA 1DIWA 2BGPA 4MZUA 4N90A 5HCAA 2Z5WA 1FMD1 1YNAA 5DZEA 3NV3A 4CP9A 1W6QA 3BIEA 2HEWF 1W90A 4Y1VA 3QCWA 1AL23 3P6BA 2VPVA 1AR73 4YSFA 2BGCA 4QPGC 4GKYA 1BVP1 4XYXA 3KGZA 3R4DB 3OOXA 4BU2A 1XE8A 3POWA 2BWCA 5I0SA 2CV6A 2XONA 2ZGLA 4YGEA 1JZ5A 4HZFA 5FKCA 3UL2A 4ZU5A 1MPXA 2DVBA 4BIFA 2ZZJA 3UGGA 4A44A 3OSDA 5ACA3 2W9XA 3ZSEA 3FBYA 4S2FA 2ADDA 2XLGA 1SACA 5E16A 3ZR5A 1VAKA 2NPIA 1XYNA 2IXLA 2P3YA 2TBVA 4Y4YA 3ZKYA 1FNZA 1SLAA 2PHDA 3M2MA 2R49A 4DNYA 5JMOA 2VBDA 4LHLA 1YQ8A 1GBGA 3K2OA 5T50A 2XUMA 4NE9A 1W2NA 2R071 2D97A 2Y38A 1LOCA 4QGMA 2JIGA 2W52A 4XFFA 3UGHA 1DGWX 2PLV1 2QDNA 3LZZA 4IQPA 3L2YA 3WNOA 4QPIB 4XF9A 3AMMA 1D2QA 2NP0A 2YBKA 4GJZA 4WVMB 3I3QA 2EALA 1Z7S3 3T3YA 1MS3A 2VMEA 1ZBA2 3LFMA 2DF7A 4V1PA 1IKQA 3WF4A 1HV1A 4CA9A 2Z79A 4CDUC 1ULCA 1AX0A 1H0BA 1R1A1 2PMWB 4K3UA 2FBEA 2VCMA 4NHLA 1MEC2 2D3PA 4UYBA 1PMJX 3ZSJA 1GWLA 1H9WA 1OH3A 3CO2A 1YIFA 3AK0A 1AF9A 1O4TA 1W8UA 1W6QB 2D6LX 4D7SA 2UYBA 3A7QA 3ZXJA 1UMZA 3ZPOA 1PK6C 5FV3A 4I3PA 2C9KA 1QEXA 3V0AB 4AZZA 1PNGA 1CGPA 5IFTA 2YU1A 1E5HA 2ES3A 4LNVA 2HWC1 2A1XA 5EYXA 4AI8A 2DYCA 4CCEA 3NJYA 1VBD1 1OQEA 2YBPA 3BU7A 3OPTA 1VBA2 1VBB3 2Q30A 5DAXA 4E8DA 1VRH1 2Y26A 3KS7A 2ZHNA 4JGYB 3T2OA 5HBAA 1W06A 2JECA 2DCZA 2QE3A 2VVDA 3N9OA 3QH7A 5GZFA 5L36A 3DYPA 4J25A 2IXJA 3HBKA 5F3IA 3MHZA 3T0BA 5T5OA 1H4HA 3O1UA 2WNEA 3M3CA 4O61A 1OOPC 2DTWA 3PIJA 4B3NA 5KHKA 2CAVA 3WSOA 3U0ZA 2P1BA 4IEPA 5FZGA 3I49A 1K12A 4B1LA 1QJU2 4IL7A 4QKNA 4B4RA 1PX3A 1CIYA 1UXZA 4QT6A 5L9RA 2W1UA 1T6GC 2YXSA 4W65A 3DPRA 3E6DA 4HKLA 4CRQA 2J22A 2WDBA 3C3VA 3DCQA 3KQRA 4HKWA 3HPNA 4IV1C 4JDMA 4ZU4A 1PO21 5F7UA 1TMF3 1PIV2 4AGVA 3I3EA 2GH2A 2P37A 4YW5A 1XE0A 4AHYA 2OUHA 2VE1A 1OLRA 3GJAA 4I09A 4WM7C 2OUJA 4RYDA 5B4NA 2W1QA 1QJY3 3NJVA 5I0TA 2LTNA 3I3DA 2QQJA 1FX5A 2BFUS 4JX0A 4QHZA 4CSWA 2VU9A 1MQTC 2P3IA 2VOXA 3NAPC 4KMQA 5DZFA 4AK3A 3H42B 3IWZA 2EICA 1KD7A 3CU7A 3JD73 1WMDA 3RZMA 4CDUA 5A70A 1GZ9A 2J1SA 3VBRC 2O8OA 1XXNA 1T2XA 2D43A 3MUY1 1ZVFA 2DBIA 2B5HA 4PF1A 1ZRFA 3WNNA 2A6ZA 5HCHA 5LEJA 1EPWA 4XUQA 1ND3A 2RS32 4WM8A 1RUNA 2FDFA 1UN1A 1GQGA 4Q4V2 3RWKX 1WCKA 1J3QA 2A6VA 1OFSA 1PK6A 3ALQA 3MIDA 4XIOA 5FYCA 3ZM8A 4AYUA 1PNFA 4DUWA 3MFAA 1VR3A 1UKRA 4K6BA 3B5LB 5CISA 5A6ZA 1LB2A 1D0HA 2R1DA 4PQQA 1VAVA 4XACA 2VUDA 2W5FA 4F3JA 1AR62 3FHQA 4UFMA 2B9UA 4GB32 3ZYFA 3OUIA 5LCWL 2XB6C 1PO13 3T1LA 3KGLA 4UXAA 2XG3A 2ZMNA 4ZZ5A 5DDJ2 1W8FA 1S0IA 4KGGA 4IE0A 2LM3A 3U11A 5T55A 3S5QA 1OOPA 3AZWA 4LBMA 1CJDA 1G8WA 4P9YA 1ACCA 4EZ4A 4PI2A 3FLTA 5LRRA 3F2ZA 5FWEA 3OBZA 4HSJA 2BV4A 5F32A 4LULA 3O14A 1AR72 1CZTA 4Y4RA 1LOGA 2WWSA 4XUPA 3JQWA 2XOMA 3RZJA 2WUHA 1SBEA 3KCCA 2IXKA 3LEIA 3Q9OA 2RR11 5GM0A 3WP4A 4ES8A 1FOD1 2E31A 3C7OA 4ARYA 1QQP1 2WSVA 4C1XA 4D6QA 3ZDVA 4XXPA 3SLIA 1NLSA 4ATEA 5ACA2 4LO8A 2Z69A 4UAPA 4X8PA 5J37A 1R64A 3I7DA 1UZ0A 5FXZA 2O14A 4A41A 4OULA 3WNPA 3W58A 3T30A 3UESA 4TZDA 2WLQA 1GSLA 2ATFA 1JZ7A 3VBOC 5FZFA 3DF0A 5AC92 1ND3B 4Y20A 2EXKA 4WM8B 3D8CA 3NV4A 4AHZA 1RB8G 4MG2A 2CYFA 1RUH1 3WQ7A 1H2LA 2WFF2 4MADA 4FOVA 2BNNA 4XCAA 5HXVA 5LBEA 2GP5A 1GR3A 3MBWA 1IQDC 3QLQA 1QF3A 4FP2A 5BNNC 1D4M2 3CJXA 3H1YA 1F4AA 5IVJA 3VBRA 4TTGA 1S4CA 1GZWA 1O5LA 4FI9A 2DCYA 2E7QA 4XFHA 2TNFA 1UZZA 2C9AA 2Y64A 5C3PA 4HONA 5JXJA 2D3RA 3PUSA 5C4WA 2ZEWA 4TN7A 4PHZA 2GNDA 1OLME 3ZDSA 1ZX5A 3OGJA 1VPHA 2WQ8A 3PTYA 2HWB1 2ILMA 3BTXA 4AR2A 4OCTA 2W3JA 1UYZA 4KWKA 5A3LA 4CZSA 1DQ5A 3KF5A 3LIGA 4OYUA 4KWUA 4W50A 1YCIA 1XNDA 3KV5A 3MIFA 4QB1A 1F4HA 4GIQA 3BPSA 2EAKA 4LOSA 1G6NA 1RGSA 1HRI2 4N43C 3ZYPA 2PTMA 4XQ4A 3J8F1 5EJZB 1YLLA 2ZA9A 1ULDA 1VBB2 3ZIWA 3S5AA 3O0WA 4MOAA 1KS4A 4R9AA 4D0QA 4YZ2A 5JSRA 4NHXA 2IVIB 2CNAA 2XJQA 5K8SA 2IXCA 5BNPC 3R4UA 3H9AA 3K48A 3TEYA 3UV9A 1AYM2 1ULOA 4RGGA 4IGQA 5IK7A 3INAA 2B4KA 5AFEA 3TOJA 2IUWA 1RUD3 1DGWA 4PI0A 1COV1 4Y20B 4YG0A 4NIIA 2G9GA 1BJQA 4A3ZA 1YFUA 5J1XA 3ZKUA 5BNQA 5FPLA 3VHOA 1LOBA 1UU5A 2JG9C 2MPFA 2W08A 3RJRA 4JRAA 5EV7A 2BU9A 4MVTA 4BE3A 3U4SA 4QQ2A 1HRV1 5F1RA 2R073 5EHDA 2YC4A 5FYYA 5C3SA 4XUOA 4NVPA 4BK4A 2P3KA 4ES9A 3BVCA 3LA7A 5D8AB 3TWIA 1UX7A 5FY1A 4Q4W1 5C4WB 5IVYA 3IM0A 3SCHA 1RUJ1 2DDUA 4YWAA 3ZYBA 1R1A3 4K8FA 4RS5B 3J26N 2AENA 2Y0OA 5BNNA 5E1RA 3N4MA 1AX2A 5K0UA 1UPSA 1NA1A 1TVGA 1ZBE1 2Y8KA 1HJFA 5LRSA 3D6EA 1K5JA 3VDDB 3QOPA 2DU1A 4FT8A 5FIXA 5A1FA 3AL6A 3U78A 3LEMA 1ZRCA 4Q4Y1 1TNFA 5T3NA 3WX5A 1DGRN 1R081 2PHTA 2MEV1 4LXLA 3N7JA 4Q8KA 2B45X 1PZ8A 4BHPA 3LFIA 4Y1XA 3WF3A 2HWC3 1LOAA 5GLWA 1LHNA 2Y34A 4COVA 3BTZA 4I2OA 3HAGA 4GZ9A 5A1AA 1UIKA 1W05A 2QQLA 1ZA7A 4NWVA 2JDPA 3M4FA 4EN7B 1FAYA 3VB9A 3OUJA 4BJ0A 3W5MA 3GBFA 3N9MA 5A3UA 3ES1A 1UY3A 3MF9A 5ERLA 2QZ2A 5H9RA 1VBC1 3R05A 4HG6B 3TBDA 1HW5A 4OQ8A 1S1AA 3E5XA 1PO12 4DXZA 4LORA 3ZLIA 3H0OA 3L9JT 5CNAA 2R0HA 3BGAA 3HNYM 4OI1A 2VOKA 2ZGKA 2WAOA 3IPVA 4BQ3A 2OS2A 2ZKLA 2NQYA 1ULFA 2WJSA 5AVAA 3M3OA 4AVTA 3VDBA 2WZR2 4XJWA 1US2A 2JG8C 4HXCA 3ZXKA 5IVFA 1YIPA 1Q8QA 5ISLA 4AVCA 5K0UB 4I0AA 2UURA 1NA1B 2ZX0A 3FFQA 1QOSA 3N9PA 4I0WB 3T4HB 3ZYRA 1YJKA 1LGNA 1RUE1 1SG3A 1FPN2 1JS9A 1TME1 2VZOA 3ZIXA 1W6PA 4A42A 4C0BA 1XSQA 3S7EA 3RQ0A 2VXJA 4DS0A 1K3IA 2RM21 1OF3A 1NAEA 4R4ZA 1H6XA 3PHMA 4YGBA 1PGW1 1JOJA 3I97A 1YI9A 4LHNA 4COYA 5F6LB 1J84A 2X5IB 3LEKA 4PDWC 1A34A 1JTZX 1ODMA 4I02A 4IEQA 4LQRA 1O6UA 3ZYIB 3U07A 1JHJA 1V6NA 3I2KA 3GHMA 2AC1A 5AVPA 3RPQA 1ODNA 1SFYA 2Y6GA 5DG2A 3BTYA 4M00A 3V65A 4W4ZA 5C70A 4A7YA 4CUAA 2AGSA 3D4KA 4HK9A 1X36A 5FQ0A 5C8CA 2BTVC 2VMCA 3IMNA 2ZGRA 1IKPA 1TQ5A 2DUQA 4CEWC 2RS53 1MS5A 4EWAA 3N9LA 3U75A 3N7KA 2HWF2 4MYEA 1J83A 5F3CA 3WW1A 2ET7A 5C7GA 2GC1A 4QXCA 1J3RA 2VNRA 4P00B 3VN4A 2XL9A 4YYOA 3IPVB 1NCRA 2HWE1 1RMU1 1GQHA 4QD2A 4PBPA 2JDMA 4RFRB 2DCKA 4NN0A 4ZXKA 3VBFC 4XXAA 1FMD2 3OPZA 1ST8A 3MDPA 2D5FA 2LRPA 4GH4C 3ZFEC 4HK8A 5FP7A 2J1TA 1RHI1 3G7DA 1FV2A 5DUWA 5HPOA 3R0RA 4EN8B 1XQNA 2XVLA 5FP4A 2RR13 2VMIA 2NYYA 2E26A 3WG2A 1TZOA 1UCXA 1FOD3 2OQ6A 2W94A 4IEZA 4LTAA 1EV11 5A7OA 5ANQA 3RS6A 4P5YA 4AFAA 4JC1A 2JDAA 2G9ZA 3AL5A 5FOJB 4S2DA 2JG8A 2UWCA 1H1AA 3O1SA 1UY1A 4N8MA 3ROUA 5GLVA 4ET7A 2ZTNA 5J98B 5H9SA 4V2WA 4LUKA 2K46A 1O91A 1A78A 4IEYA 4QGLA 4AGRA 1ENQA 2VMFA 4CCJA 2VECA 2QQPA 4F83A 3ZYHA 2R072 2VGDA 3B9IA 1AXKA 1RUH3 3AYCA 3HNMA 4YVSC 5FQ0B 4F8AA 3WP5A 4UFJA 4BDVB 2PLV2 4Q8LA 2IZWA 2XVKA 1V6MA 1WLDA 5DMYA 3WNXA 3ZFFC 1SHWB 4LHKA 1W6OA 4U2AA 4YW7A 5I8SA 3AC0A 4Q2FA 4CP1A 2YV8A 2XKOA 3VUOA 3MGUA 4EWDA 5HXMA 2R042 1AZDA 4A6OA 5FBZA 5DPNA 4IEUA 4HN0A 1R1A2 3GM8A 4FOYA 1NCRB 3WG4A 5IHRA 1UOGA 2UWBA 1DYPA 1WMFA 3VBSB 4IGOA 1CAWB 1POV3 3B00A 1XNKA 3BCWA 5JOZA 3I2OA 3ILFA 1RTVA 3J7LA 4CEWA 1ONAA 1SZBA 2G19A 2YC0A 4MUVA 4TSVA 5JI7A 2P2KA 1NT0A 1B35B 4MH0E 1LEMA 1HLCA 1JODA 1WW7A 2QUOA 3B69A 3POGA 5DUXA 3O1VA 5FP8A 5A7WA 1W28A 2HWC2 2FDJA 3OGRA 5FY9A 1BHGA 2BJSA 5EJ3A 1VBD2 4KWJA 4UW5A 2GH8A 3IIIA 4XMIA 1SCRA 1V6LA 1VRH2 1QXRA 1WW4A 1ZYBA 2Q1ZB 4BQ4A 1RUG1 3SISA 3SKJE 2WO1A 3HEIA 4CEYC 2ZJCA 4AEMA 2WT1A 2YGLA 1MZ5A 2R0FA 2VUCA 2V4AA 4QQHA 4XFCA 5FYSA 3N9QA 3PJYA 3U37A 4DUVA 5C71A 1ND2A 1L7QA 3CJIA 1ZBA3 2JICA 5FYTA 2QFEA 1FV3A 2J1VA 5A7PA 3FWEA 5DAQA 3SH5A 1C4RA 3IDEA 1LU2A 3LDKA 5JZGA 5T54A 1MS8A 1QNWA 4ZY9A 4J1WA 1V6OA 3JBG1 1OC1A 1KS5A 1EUTA 1UIJA 4QXHA 5L7OA 1W6OB 3EBRA 1QJX1 2WYSA 3J9SA 4XZPA 2WT0A 3EMRA 5L9VA 3QACA 1G9AA 4GJYA 1J3PA 3PVOA 1PO22 1LTEA 1UO9A 2WFPA 4NUBA 4P9XA 1GP5A 2KM2A 3TEXA 1B09A 3JXSA 1F5FA 5IVCA 3UT0A 1H4GA 3NNLA 4AQTA 2NMNA 1GANA 1VAMA 5LA2A 4DXRA 3VGIA 1HQWA 2V72A 2JKXA 3WDTA 5JR2A 4P9JA 3H8OA 3U4XA 2FCUA 3A22A 1VBA3 4PLNA 3RVHA 5FOBB 4ASMB 2YBSA 1VJ2A 4HMZA 4RQPC 4CPBD 3OBRA 1VBE1 1IOAA 2MHFA 2RJKA 4W6XA 3LA3A 2Q8EA 2BVBA 2VAUA 4AEDC 4LK7A 3QBQA 5FLJA 5A7WB 4CXXA 4BIOA 1H2NA 1XNAA 1ZM1A 3E97A 5A3OA 1YFYA 3E6BA 4Q4Y3 1IS3A 1OXCA 5F5AA 1DHKB 2C26A 3APBA 4HFSA 4GXLA 5FZKA 3S6PA 4IV3C 4QQOA 2MEV3 2C1FA 2VNVA 5EP9A 4EV0A 3ZMOA 3ZPYA 4Q0SA 2BPA2 4FBFA 2XWJB 4NHKA 5BNOA 2BOIA 5LA9A 2HKXA 4CU9A 2EA7A 4CCMA 4OZOA 5FXWA 4DFSA 5LZ6A 4GA9A 1ND2B 3WOGA 4D69A 4FPJA 1MZEA 3CJIB 2WIIB 4TYSA 3W20A 3A21A 1D2SA 3SXWA 2VTXJ 3WNKA 1NY71 1PIV3 2D6PA 5EPAA 2C5DA 5JZGB 4IW3A 3N35A 3WDWA 4QX7A 2WAAA 4HLTA 5L7OB 3BB6A 3LOIA 4WVZA 4BLIA 3K4DA 1OA3A 1F9KA 1F31A 2BUKA 4UFKA 3PNAA 5JUVA 4C8DA 1DZQA 2ZGOA 3KLSA 2UY8A 2X10A 1D0GA 4AF9A 3KT4A 3LDRA 4LKFA 4FOWA 3NMBA 5FMDA 4FPKA 4AI1A 1YWKA 1QMJA 2VC9A 1BQPA 2RR12 4JGZB 3JUUA 5I0RA 1ZZCA 1FOD2 3EO6A 1BCXA 1QQP2 1ZZ7A 5FR3A 2XJRA 5D2AA 1XSRA 4RR3C 3KV9A 5HV4A 4RD7A 1H2MA 1DP0A 4DZGA 1PVXA 5FRAA 1RUE3 2JXAA 1CIWA 2WR9A 1AYN1 2YFUA 3AX4A 3PUHA 4RGKA 4LBOA 3ZFGB 2WNUA 4CCDA 5LY1A 1UYXA 2BWAA 4PBOA 1W2AX 2XHNA 4AFDA 3FHIB 2PYTA 2QDRA 1AR63 4CDQC 2HYKA 1WZXA 3NL1A 5K9YA 4GB33 2B46X 2VZSA 3VBHC 2ZAAA 1LKNA 5CFCB 1HXS1 3T09A 5BNOB 1RUH2 1CD3G 2WNOA 2V5DA 4JHTA 4XAAA 3TNPB 4R9DA 1DG6A 1MS1A 4FCAA 4AEDA 4IE6A 2DVDA 4XVHA 5FPVA 2X05A 1PZ7A 3AKSA 4Y26A 3A0KA 5FXXA 5EYYA 5FZ0A 2I07B 4BA6A 2V09A 5A6QA 4MX3A 1QY4A 1VMJA 1J59A 5F39A 4BCUA 3OEBA 1Q8SA 3O12A 3TYJA 1NXD1 1CZSA 4NAMA 1ZREA 4BMEA 3LPGA 2WL1A 2RVAA 1CAVA 1PZ9A 3NQHA 5G05L 1Q8PA 2HWB2 4WZCA 5F8PA 5JLVA 4OMDA 5F2WA 5DG1A 4NPRA 1GLHA 1HJGA 1H8TA 3PU8A 4AI0A 2UY9A 3AP4A 1QNYA 2XLFA 4LPLA 5LEKA 1E5SA 2BNMA 3NV1A 1DLLA 3WUCA 3LWCA 5DQ0A 5HI0A 4RSUA 3I2GA 1OURA 1QIQA 5AC93 3J8F2 2YUEA 3RYRA 4D94A 1RHI3 4YM2A 2GC0A 1GU3A 1MR5A 3DXTA 4Z82A 2WNVA 3NV2A 1YYNA 5I93A 5H9QA 2WFF3 2WQZC 2ZEYA 5IT6A 1E5IA 1N3PA 3JB8A 3M7AA 2WNUB 1DYOA 1W9TA 2QCSB 2VZUA 3UK9A 4CUBA 2JKBA 1D4M3 4OQ9A 4COUA 1N1TA 1SBDA 2WS91 4AVBA 2R041 4OHXA 2WWJA 1COV2 2V73A 4UBGA 4FAHA 3LB9A 4QX8A 5C3QA 3UKTA 4NWWA 2ZHMA 4XETA 3FN9A 1XNBA 3PURA 4FQ4A 1GP6A 3KV4A 4NOTA 5EWSA 3WHUA 4Y5SA 4E2SA 3I2IA 2VJXA 4CP9B 4D6RA 1HRV2 5A1LA 1FI2A 3KHBA 5I91A 1GFF2 5C8WA 2SBAA 3VKFC 3WF2A 3WV6A 3S7IA 1GWKA 4Q4W2 4DB5A 4IEVA 1UZVA 3MLLA 3NO8A 1AR81 5F5CA 1CAVB 1HRI3 1RUJ2 1AJOA 1UOBA 4K7JA 2DU0A 4Y24A 3NNFA 3PUQA 4GD4A 2XR4A 4YLZA 2VBBA 5LATA 1SBFA 1H8TB 1LESA 2P4EA 4M01A 2R16A 3MYXA 4IUGA 2H6BA 2VR4A 5EQUA 1ZBE2 2VOTA 4YZ5A 1CN1A 1YFXA 3M70A 2D93A 1AYM3 3C8XA 5KXDA 1NQDA 3ILNA 4YVWC 1EAH1 2G9FA 3ITQA 4UT5A 4NR1A 4PIXA 4Q4Y2 2VQ0A 4QPGA 4W8JA 5LBFA 5CKMA 4OHYA 1R082 5J7MA 3MW4A 2E33A 2MEV2 2WNVB 3PVNA 2A75A 1TE1B 1A8DA 4L11A 1IQAA 4X6RB 4IEXA 5FZ3A 1O8SA 3ES4A 3SNMA 1PMHX 1C8M1 2F4PA 1LR5A 2B42B 3GBWA 1GMMA 5CFDC 2C0ZA 1TEIA 1DZTA 2A6YA 4XJ9A 3UGFA 2VZ1A 2FDGA 4W6WA 2ENRA 2VZTA 5FUNA 5J09A 3WW4A 5EJ1B 5FP3A 2C4XA 2W1WA 4BM8A 2OA2A 1JZ4A 3E1F1 3SCGA 5M0TA 1VBC2 5A6YA 4A7ZA 5EZWA 3HQXA 4AQSA 1T6BX 2HWD1 2VM9A 3SMHA 4KGQA 4AVVA 5FZDA 5C9AC 1CR7A 3GNEA 4Q0VA 1H8VA 2VO5A 5FZAA 2EIBA 4QMAA 4TWTA 1K5MC 4NMIA 1PX4A 2FMDA 4AWDA 3AYEA 4K21A 3ZSKA 2EIEA 4MGIE 2I45A 2B39A 3BODA 1DQ4A 1SDDB 3I4IA 5JCTA 1W9SA 2YZ4A 2W47A 5FCCA 2P5BA 2XBO1 1W8OA 2Q1FA 1N3OA 3DL3A 3H3UA 3D5OA 5FZ7A 3ZXAC 3BI3A 4D7TA 1O5UA 1RXFA 2JD4A 3POSA 2NM1A 1BXHA 3OEAA 3USUA 2X8KA 4XJAA 3IB3A 4META 4QDSA 2BYVE 1JYNA 1QU0A 4B4PA 5FREA 3S57A 1RUE2 2W92A 3AMNA 1GQPA 5GLZA 3T0DA 1TME2 5FYUA 2NN8A 5FAXA 5F9TA 4FPEA 4QPGB 3PU3A 1OVSA 2RM22 4JKKA 1VRBA 5JMCA 3P3NA 1DGLA 4LKSA 4CDXC 1PGW2 4LJHA 2QVSB 4AQ6A 3EXUA 5GZGA 1JYIA 1IZ3A 2ZGTA 4XFIA 4XHXA 3DKWA 4JZRA 1SFNA 5BXXA 3Q8AA 2F4LA 2Y6KA 1PGL1 2B9VA 1Y9MA 5KC5A 3DPRB 5D8AC 2EIGA 1DDLA 3QH6A 2CWMA 2R30A 1UW8A 4YG3A 3T2PA 2WZEA 4NAOA 1OHFA 2HJIA 1W8TA 1CZVA 1JZ2A 2GNBA 4OUSA 1RUF1 5DAPA 2AREA 4EWEA 3MFCA 2WZR3 3NRUA 5FZMA 3P5BA 4DUXA 3BUCA 4M4RA 4M3CA 3J4UH 4XFGA 4OHVA 1EYBA 2ZPXA 1GP4A 2YROA 4YGDA 1LHVA 1I5PA 1CAUA 1I3HA 3NSTA 1H1IA 3WCSA 1WD4A 4MHUA 1K42A 4GWMA 4EROA 2O1QA 4IV1A 4LO7A 4G9SB 5JSPA 2HWE2 3O1TA 1RMU2 5IVBA 4CDUB 4HVOA 1FPN3 1U5YA 4K9SA 1O3TA 2VVEA 3B9CA 3CMGA 3U1XA 3PJQA 2NLRA 4WM7A 1C8NA 1UD1A 4UF0A 1X7NA 4NRQA 1FXZA 4Q1PA 4YGCA 1Q56A 1RHI2 4R4XA 3USUB 2W2IA 1C57A 3G6JB 4DRRA 3THDA 4XQDA 3WQ1A 1MQTA 3NAPA 4XBLA 1PK6B 1EY2A 3HJRA 5GLUA 3KT7A 2FHRA 2IC1A 5BV6A 2OKXA 3RMXA 4GMP3 1EV12 5KR7A 1FATA 2WO3A 4DMIA 4LLFA 4H7MA 3IAPA 4BK5A 3KVAA 1WCDJ 3IIAA 4FPYA 2SLIA 4L8QA 3RFRA 4BB3A 1AYN3 1MACA 4E4DX 1U5XA 2ERFA 4GQ7A 1NYWA 4MHRA 3WQBA 1RUC1 1VB2A 4DY3A 1LCLA 2HWF3 3PVEA 3RI8A 3P1IA 2BZDA 2LROA 1ZZ9A 1S0JA 2AACA 3ZYGA 5I0DA 3H8RA 2PHUA 1KJRA 4XIKA 4HPKA 2AH2A 2H0VA 4QDRA 5FWJA 1OOPB 4NPMA 4XFBA 4XJUA 1MVQA 2I74A 3MICA 2TEPA 3WNMA 1S0BA 1O8PA 4WV8A 4NROA 4XCBA 4CDXA 5FZ6A 2BP6A 3OBTA 1FMD3 2ZMKA 5GZEA 4M3CB 2K2SA 2P17A 3HMYA 4Q26A 3WLUA 3MPPG 1DU3D 1FYUA 1I1EA 3WDVA 4URAA 3OJBA 4ZS3A 1REEA 2VTXA 1I9RA 2GNMA 3MIEA 4LUMA 3KHCA 4N53C 3U14A 1JYXA 2ZACA 4U36A 4JCKA 2X5IC 3FLPA 2ZS6B 3OB8A 5A3WA 5FZOA 2VMHA 1GNZA 4WM7B 4CCCA 2XPJA 3J7MA 2BERA 4Y5TA 2JEMA 3BYWA 4CE8A 1DGRA 1RJ7A 4G4FA 3CIHA 2YHJA 4Q0QA 3LD8A 3BALA 4AOCA 5JOYA 2VUJA 3HBZA 3HN1A 3ZYJB 1MQTB 3NAPB 1F5JA 2E51A 2ET1A 4Q27A 4ISQA 2HYXA 4P08A 4E8CA 1ENXA 1NZCA 4FXKB 3VBRB 2DCJA 1GZWB 1HIXA 1X8MA 2VQTA 3MW2A 3URFA 1AL0G 1RUG2 2PLV3 1VALA 2QQIA 1N47A 2D7FA 5CAZA 2D40A 4FFIA 3DV8A 3THCA 3VBOA 1S0DA 5E89A 4HVQA 5HV0A 4RHV1 2J7MA 1UKGA 3WD5A 5CEHA 4LT5A 4QM8A 4J1XA 1SQ4A 2WS93 1QOOA 2HBTA 2R043 1W2UA 2WKKA 4M3CF 3WHTA 1MZFA 3JCIA 1WW5A 4ATFA 3H7JA 1BYHA 1SLIA 3EB7A 3JBG2 3OD4A 3PLQA 5FJKA 4DEQA 3Q8BA 1LENA 2B7YA 5E8AA 1QJX2 1BBT1 3C7HA 1S2EA 2RMU1 3ZX7A 4CU6A 1W9YA 3TRSB 1XJAA 5FPUA 1WBFA 1MS4A 3MEPA 2WBKA 3WCRA 5CADA 3WG1A 3FHAA 4N7IA 1HN0A 3Q8CA 4DEVA 4QXBA 5FTTC 1AR83 3CL1A 2LS6A 2G4IA 1VBD3 4AFMA 4R52A 4CCNA 4QHOA 3ST7A 2ZKNA 4EE2A 2HLEA 1VRH3 2FZ1A 4UFLA 5F37A 1W8ZA 1VBE2 2ARXA 2XMLA 3IDBB 1QXPA 4H2AA 1DYKA 4OHWA 4QU2A 1GOGA 4N43A 3GJBA 4DQAA 2IFRA 5FZCA 4E27A 1JXNA 4AQ2A 2XH6A 4Q0PA 2JWPA 1QDOA 1BZWA 2Y6HA 5A7NA 3UETA 2CL2A 2VNOA 4UBHA 4CU7A 4JTOA 3UKVA 1ASJ1 3B3QE 5BNPA 1IPSA 1UYYA 2R061 3IDCB 4RFT0 5FYHA 1X8EA 5JAXA 3VBOB 1C8M3 3AYDA 4LEJA 4DIQA 4P02B 4INDA 3W59A 4LBQA 3VZNA 3LKJA 4LBKA 2CDOA 1JMUB 3MO4A 3WDUA 4Q1RA 1PO23 1LGCA 3LQCA 4PJYA 3VBSC 1S0GA 1VE0A 2ZOEB 4B7EA 1NY72 3I2JA 1A6CA 3BTAA 4SLIA 4E9KA 3KVBA 1RJ8A 2JG9A 5BNNB 3AVSA 5ABJC 1XBFA 3F95A 4IE5A 2HWD3 5BUVA 1OQ1A 2Q4SA 3H1MA 2YYOA 4Z8BA 3KB5A 5A32A 3U10A 2GZWA 1R1ZA 4P14A 1JU3A 2E53A 3E6CC 4QQLA 1PM4A 4YW1A 1LECA 5FBJA 1UF2C 1XOYA 1J1TA 1VLNA 3IKWA 4YZ4A 4BQYA 1S0FA 1CJPA 3LOBA 2VXRA 3D0JA 2CY6A 4JRLA 4XF3A 3SQOA 2Y33A 3IN9A 4N9IA 1ZZBA 2W1SA 2OYZA 1OLMA 4DXTA 1NX9A 2AUYA 1W9FA 2Y0IA 3BOWA 4DRVA 2RJ2A 3LIHA 2PHFA 3KCXA 5T52A 2DFBA 4R8HA 1IPJA 1QJEA 4K1YA 2Q8OA 1JUIA 3D3AA 1XNCA 4CP0A 1AYN2 1LHUA 2ZBJA 4NIGA 3X29B 3AZZA 1L3JA 4XZUG 1W0NA 5IVEA 1NQJA 1SEFA 2RJLA 5BNPB 2GN7A 3EQEA 2WT2A 2JE8A 1JBCA 3NKGA 1W2OA 2XHKA 4H3WA 1J58A 1LODA 2AYHA 2EAAA 4XTPA 4EYUA 1XYPA 3VD3A 3HVDA 1HXS2 3R6SA 5FPZA 3T0AA 4ZHNA 2D98A 1RINA 2KA3A 2QKDA 4LBQB 1UX6A 4JV4A 3W9AA 3GHNA 3IT8A 3LA2A 3HT2A 3VZJA 2J1UA 2JDHA 1OMIA 4MXVA 4M4PA 3JQXA 4QX2A 1CESA 1AL21 3JB4C 3B94A 3GZEA 5FZ8A 4EJRA 3H3LA 3PUIA 1O3RA 2EXHA 1RUF3 1AJKA 4CDWC 1DQ0A 5KWRA 1O4YA 3VBUC 4BLJA 4IGPA 2D6NA 3I2HA 4YZ3A 5A32B 4Y5Z0 1ULEA 2ID4A 1WLWA 3I8TA 1W6PB 1GICA 1WCUA 1QQP3 4BH9A 4ZZ8A
chains in the Genus database with same CATH topology
1HN0A 2WYFA 4BQ3A 4BQ4A 4LK6A 2O14A 1WMXA 1WZXA 2LROA 2KR2A 2Q1FA 3UT0A 1W8WA 4CPBA 4YWAA 4YW6A 4LKFA 2K46A 1W8TA 1GWMA 1W9FA 2LRPA 1W8ZA 1GWLA 4AL9A 1OH3A 3ZYHA 3ORJA 4CP9A 4CPBD 1W8UA 1OKOA 1V0AA 3F95A 5D21A 4CP9B 1W90A 1L7LA 2JWPA 4LKEA 4A6SA 3ZYBA 4LK7A 2C24A 4YW7A 3ZYFA 2VXJA 4LJHA 1UOJA 4BQ5A 1GWKA 4LKDA 1WCUA 4BQ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HN0 A;  2WYF A;  4BQ3 A;  4BQ4 A;  4LK6 A;  2O14 A;  1WMX A;  1WZX A;  2LRO A;  2KR2 A;  2Q1F A;  3UT0 A;  1W8W A;  4CPB A;  4YWA A;  4YW6 A;  4LKF A;  2K46 A;  1W8T A;  1GWM A;  1W9F A;  2LRP A;  1W8Z A;  1GWL A;  4AL9 A;  1OH3 A;  3ZYH A;  3ORJ A;  4CP9 A;  4CPB D;  1W8U A;  1OKO A;  1V0A A;  3F95 A;  5D21 A;  4CP9 B;  1W90 A;  1L7L A;  2JWP A;  4LKE A;  4A6S A;  3ZYB A;  4LK7 A;  2C24 A;  4YW7 A;  3ZYF A;  2VXJ A;  4LJH A;  1UOJ A;  4BQ5 A;  1GWK A;  4LKD A;  1WCU A;  4BQ2 A; 
#chains in the Genus database with same CATH topology
 1F2N A;  1QDC A;  5LB6 A;  1RVF 1;  3K3N A;  1YC6 1;  2RDQ A;  3WNL A;  4CXW A;  4TLF A;  4AAP A;  1CWP A;  1Z78 A;  4Q4X 1;  2OPW A;  2VTF A;  3AFG A;  1PHM A;  5FZ4 A;  3D0S A;  4BPZ A;  1JYV A;  1NCQ C;  4CCO A;  4K40 A;  5E6H A;  3ECQ A;  4HAN A;  4ZKT B;  3FFZ A;  2XKP A;  1F15 A;  1C3H A;  1DFQ A;  2XXZ A;  1OUS A;  2BFU L;  4PDW A;  2OZ6 A;  1Z7S 1;  3RI9 A;  2OW4 A;  2WS9 2;  2D6M A;  1HB3 A;  4N9H A;  2C6S A;  2DVA A;  4YW3 A;  3MIB A;  4QM9 A;  5FK7 A;  3EJK A;  4FP3 A;  1XC6 A;  3WR0 A;  3O1M A;  1YI7 A;  4JHZ A;  4LR4 A;  4C90 A;  3DXU A;  5JR7 B;  1KGY A;  1Y9G A;  2FCV A;  3VD5 A;  4QDQ A;  1UU4 A;  3ZXD A;  4ZU7 A;  3VL8 A;  2XJT A;  2HWB 3;  2A70 A;  2JEN A;  2XUE A;  3AB0 A;  3OGS A;  3H7Y A;  5JI9 A;  4GAZ A;  5C8C C;  2A5Z A;  5L73 A;  3LSD A;  1KIT A;  2WN2 A;  5FKB A;  3V64 A;  3MUZ 1;  4QKB A;  3ACL A;  4I30 A;  1BEV 1;  1AVB A;  4PIZ A;  2ZGP A;  4XC9 A;  5I8T A;  4YZ1 A;  1LOF C;  3WXP A;  1JYW A;  3GCW A;  2FD8 A;  4P9W A;  3L2H A;  5CIR A;  1AR8 2;  4ARX A;  1WWY A;  1WKY A;  3J8F 3;  3H50 A;  3KZ4 C;  3FUQ A;  4YM1 A;  3ZFG C;  3M8L A;  5ANN A;  1X9T A;  4PLO A;  3VBF A;  1UWW A;  4J6G A;  2Y6L A;  4ZPI A;  2CAU A;  3V56 A;  1CVN A;  2BVV A;  2JG8 B;  3H1W A;  1WCQ A;  3MIH A;  4GH4 A;  4GWN A;  1NUK A;  3THT A;  2JIJ A;  5A7S A;  3RWN A;  3ZFE A;  4AI9 A;  4Z1V A;  5LW9 A;  1YFW A;  1EAH 2;  1ZZ8 A;  1X50 A;  3J7H A;  5A33 A;  5FY8 A;  2QQV A;  3VBU A;  3PL0 A;  1JZ8 A;  1COV 3;  1GV9 A;  3VKN A;  2P6C A;  5JIU A;  3A4U A;  4OVE A;  5A3N A;  1Q5O A;  3VD7 A;  3K3O A;  4IES A;  3K77 A;  2UYA A;  2CGO A;  1HKD A;  1WBL A;  1Y7B A;  2XJS A;  1C8M 2;  3LEG A;  3RZZ A;  4P5H A;  2RDR A;  2WO7 A;  1SLC A;  1SLB A;  1UAI A;  1UOJ A;  1WA6 X;  1XU2 A;  4S2G A;  3ZN4 A;  4PDW B;  3ZN5 A;  2CGN A;  1HRV 3;  1S2K A;  1NLQ A;  3T1M A;  4JDN A;  5DN2 A;  2QQW A;  1TMF 1;  3BKZ A;  5GKA C;  4KG8 A;  3UJQ A;  5FY4 A;  4FPO B;  3W5N A;  1GUI A;  4LOT A;  2KR2 A;  2BQP A;  1NKG A;  1O59 A;  1OFN A;  1NLR A;  2WIN B;  2AR6 A;  4Q4W 3;  4LBJ A;  4FAG A;  1EPZ A;  1WA4 A;  5IAT A;  1RUJ 3;  1W39 A;  1QJY 1;  2HWD 2;  4YVS A;  5CA6 A;  2X53 S;  1GZT A;  3OGG A;  3POJ A;  2PFW A;  4CEW B;  4YRD A;  5C5U A;  2JX9 A;  2Y6F A;  2DUR A;  3ZFF A;  4MGQ A;  3ZXL A;  2W68 A;  5D21 A;  3AVR A;  5G04 L;  3SEE A;  3JD7 1;  1WLC A;  1QGL A;  1OKQ A;  1ZBE 3;  4XJZ A;  4YPJ A;  3E5Q A;  1BBT 3;  3WEZ A;  5I8Y A;  2VZV A;  1KRI A;  1YHF A;  1H9P A;  3CKH A;  3GZT B;  5C3R A;  1CQ9 A;  5KHJ A;  2GMP A;  5FYV A;  4OMC A;  2XBO 2;  4JQT A;  1R08 3;  4M0N A;  2A6X A;  3T08 A;  2D3S A;  1ZA4 A;  2JD9 A;  3AJY A;  1U5Z A;  1Q43 A;  1KDK A;  4QPI C;  2PXJ A;  2PEL A;  5AFB A;  1D7P M;  5L19 A;  3ZOI A;  4NRM A;  3ZFE B;  2PHW A;  2VW0 A;  5IK5 A;  3HWJ A;  3AJZ A;  1A3K A;  2BEO A;  3ELN A;  5IVV A;  4AFB A;  1ALY A;  2KD7 A;  5FP9 A;  3N7L A;  2TUN A;  2OXB A;  5JSO A;  1VBC 3;  4RL7 A;  3C2U A;  5LK5 A;  1PGL 2;  2RV9 A;  5DAV A;  5KXB A;  4DOU A;  3GDB A;  5F5I A;  2VCA A;  3KM5 A;  4JQR A;  1DCS A;  2P6H A;  2R06 3;  4CEY A;  5FZH A;  1CAX A;  5IYY A;  2RS1 1;  4XPV A;  3DN7 A;  2CSG A;  2E63 A;  4LIU A;  1US3 A;  3THP A;  4BQW A;  1RUF 2;  5KBF A;  4OFG A;  4BZ4 A;  3WY6 A;  1W6M A;  2OT7 A;  4YVS B;  2DTY A;  3BIW E;  4JGY C;  4UFH A;  5T5J A;  3M3I A;  3V0B A;  3SKV A;  1V0A A;  2O0O A;  3FMG A;  3ZFF B;  4GUL A;  1KFX L;  1ZRI A;  5FK8 A;  4DPN A;  4EN0 A;  1JYT A;  3BPZ A;  4HOO A;  1W04 A;  2A3W A;  4L99 A;  1TME 3;  5CVR A;  4DO0 A;  1LU1 A;  2VOV A;  3ME2 A;  1LHW A;  4FTB A;  1C5H A;  2RM2 3;  5IAV A;  3DYM A;  1OD5 A;  4AEK A;  4SBV A;  4FQZ A;  5FYB A;  4MSV A;  3RYP A;  2QNK A;  5JXI A;  5EXO A;  3TEW A;  4RQP A;  1O3S A;  2DVG A;  2FQP A;  4DXS A;  2ZAB A;  4QGN A;  1AX1 A;  1W9W A;  4D3W A;  3VZK A;  4B1M A;  4LA3 A;  3VDA A;  4O65 A;  2JE7 A;  2XGX A;  1VIW B;  4IV3 A;  4H7L A;  3WUD A;  4QPI A;  2VZR A;  1HDK A;  2E7T A;  1KJL A;  1RUC 2;  5A80 A;  3TN9 2;  2B8M A;  3CNA A;  4CEY B;  1OQD A;  1CAX B;  5DAB A;  5IWF A;  2XQX A;  3IZO A;  3AZY A;  4CVU A;  3GXU A;  2XDV A;  2XVG A;  3DYO A;  1W3V A;  3WT3 A;  4V2V A;  4I3G A;  2YDE A;  4YM3 A;  2PN5 A;  5FPX A;  4FPL A;  4A2U A;  1UU6 A;  1V9U 1;  4PF5 A;  2HWE 3;  2QQU A;  1HQL A;  1RMU 3;  1HB2 A;  2WWU A;  3IBM A;  3FC0 A;  4LE3 A;  4FPH A;  4PLM A;  3NKT A;  4TXW A;  1W6M B;  1G7Y A;  5JIA A;  4XF4 A;  3CZJ A;  4XDQ A;  2W39 A;  3V0B B;  3H8X A;  4Z92 B;  1OA2 A;  4CU8 A;  2HEY F;  4O9G A;  4AG4 A;  1ZRR A;  3KV6 A;  2BDR A;  3V0A A;  3NJX A;  4EZH A;  2OQ7 A;  3LCP A;  1BMV 1;  3WP3 A;  1HX6 A;  1NOV A;  4ONU A;  1U0A A;  4KH9 A;  5FUP A;  4X6Q B;  1PMI A;  3AXE A;  4YFW A;  5IW0 A;  3VZL A;  2YU2 A;  4XUT A;  1AR9 1;  1EV1 3;  3OYW A;  4CYD A;  4ASK A;  2HH9 A;  1PGS A;  2ZEX A;  5FFO C;  3SCF A;  1IS4 A;  1D4V B;  1RVF 3;  1ULG A;  1RUD 1;  3AXD A;  4JGY A;  1URX A;  1SCS A;  3DPR C;  1HB4 A;  4NRP A;  4RQP B;  1V70 A;  4QKF A;  2YPD A;  4Q4X 3;  1PVC 1;  1VP6 A;  4RR3 A;  5JXG A;  3I2F A;  1C5I A;  4M3C E;  4ITC A;  4AED B;  3EHK A;  1IG3 A;  3I3M A;  2ARC A;  2R1B A;  2XJU A;  5FZE A;  1CX1 A;  1AUY A;  2ZCW A;  5FDB A;  2WZP P;  1H30 A;  2E9Q A;  2X29 A;  4IV3 B;  1QHD A;  1MVE A;  5HCF A;  4YW2 A;  1APN A;  3DEM A;  1R09 1;  1WUV A;  4BQ5 A;  4AGG A;  1UZY A;  2XJP A;  1CX4 A;  2PAM A;  4RHV 2;  3SEP A;  4CDQ A;  5FLH A;  5IAX A;  3VBH A;  3H3Z A;  1QWR A;  3CQO A;  3FE5 A;  2Z2S B;  3HD8 B;  2DUO A;  2V5Y A;  5LAS A;  2VZQ A;  3T2Q A;  2YB7 A;  1KFU L;  5KHG A;  1HN1 A;  4LE4 A;  1UZW A;  3TB0 A;  1DZR A;  4BWO A;  1WGP A;  1U12 A;  4AXO A;  1MS9 A;  1UY2 A;  1ND3 C;  1Y4W A;  4XIL A;  2A6W A;  1BBT 2;  3IAQ A;  3OG2 A;  4UW6 A;  2RMU 2;  4WM8 C;  4D6S A;  3AM2 A;  5FPA A;  2BRT A;  3O1P A;  2JDU A;  4KI5 M;  4WVW A;  4AHW A;  1HQN A;  4EQV A;  1ZRD A;  1BEV 3;  1JU4 A;  4COZ A;  1YJL A;  3OGV A;  1P8J A;  1WLT A;  1SFP A;  3GGL A;  1Z0H A;  3ASI A;  3OYW B;  1SMV A;  2FDH A;  2ZGM A;  3P3P A;  4KWL A;  4IDZ A;  1I6X A;  4O7X A;  2Z42 A;  1RUG 3;  4P9G A;  4KG0 A;  4BOW A;  4YW6 A;  2CGP A;  2QJV A;  2K9Z A;  3CEW A;  1GWM A;  1XE7 A;  4YW4 A;  2BW8 A;  3RYK A;  4EN9 B;  5FZI A;  4RR3 B;  3FL7 A;  2YPJ A;  5JPM B;  2GC3 A;  2AZ5 A;  1NE4 A;  3DGT A;  2WN3 A;  3CDZ B;  5GAL A;  4UW3 A;  1ASJ 2;  4LKE A;  1XNT A;  1E57 A;  2R06 2;  1LJ7 A;  4NID A;  3O0X A;  2OZJ A;  1UMH A;  3CHX A;  2PAK A;  3JBG 3;  3FZ3 A;  4LKD A;  1POV 0;  1RXG A;  3SIT A;  2VW2 A;  4CDQ B;  1QJX 3;  4YFZ A;  2UU8 A;  3VBH B;  1G9C A;  5FPB A;  2XJV A;  3NVC A;  5A3P A;  2FMY A;  1Q8O A;  3TAY A;  3C7E A;  2ZX1 A;  2L9L A;  4JKL A;  3BN6 A;  4Y22 A;  3VD9 A;  1RUI 1;  4MO3 M;  3VD4 A;  4KU7 A;  5F3E A;  2VZ3 A;  3UJO A;  3ZXG A;  4C0H A;  5LK7 B;  2WAB A;  3ZN6 A;  2ZAH A;  2GAU A;  2VH9 A;  5IK8 A;  1C28 A;  1VBE 3;  2C24 A;  2HEV F;  3RZL A;  4AE2 A;  1O3Q A;  3WVJ A;  3LE0 A;  1NZI A;  4IE4 A;  1EUU A;  2CDP A;  3B01 A;  3PDQ A;  4Z2W A;  1H2K A;  3KCY A;  1IGO A;  2JDZ A;  4P9L A;  3NNG A;  5C4W C;  5F6K A;  2DUP A;  4YVW A;  2JDK A;  2EXI A;  1OF4 A;  1YXW A;  1JZ3 A;  1WME A;  2PQS A;  4QX5 A;  2RS5 1;  3IMM A;  2Q0A A;  4RS5 C;  2VBP A;  2G1M A;  5I0U A;  3NNM A;  3VHN A;  4Q29 A;  1ENS A;  3KWV A;  2A71 A;  5TSW A;  3T4V A;  3VDD C;  3VZO A;  5CFD A;  4FFG A;  1S55 A;  2YFZ A;  1RED A;  5BPX A;  3VZM A;  3DKQ A;  2W87 A;  5LY2 A;  5JXH A;  1L7R A;  2GAL A;  1JI6 A;  2QQN A;  2RS1 3;  1STM A;  4AW7 A;  4Y22 B;  3PIG A;  1AL2 2;  3M1H A;  2F6B A;  5DUU A;  3ETP A;  3ETQ A;  1ZNP A;  4FPG A;  1SLL A;  3SHR A;  5IUQ A;  5CBL A;  1NXM A;  5C9A A;  2VCC A;  3WF1 A;  3ZN6 B;  4HKO A;  3WDY A;  1K5M A;  1YQC A;  2VW1 A;  3AFK A;  3OY8 A;  4OI4 A;  3CBN A;  3GYD A;  4UWD A;  3EYP A;  5DAW A;  4E2G A;  1OLQ A;  3MI8 A;  1LAJ A;  1RVF 2;  1TG7 A;  2GSY A;  3ACI A;  4I0B A;  4RGA A;  4YM0 A;  4MGT A;  1YQ2 A;  3C7F A;  4BQX A;  5GZD A;  3LF7 A;  5FMO L;  3ATG A;  3VLB B;  4HN1 A;  3HIF A;  4AVS A;  4Y1Y A;  4Q4X 2;  3TN9 1;  4QX3 A;  1W8W A;  3RZK A;  2BGO A;  2FZ2 A;  1DQ6 A;  1DF0 A;  3RMY A;  1QOT A;  4YVW B;  2R7E B;  3OBA A;  3LDB A;  3VHP A;  5FY7 A;  1HXS 3;  1BVV A;  3LAG A;  2JDY A;  3ZO0 B;  1OVP A;  4LIT A;  5FZB A;  5JWP A;  5FZL A;  3AKP A;  1N3Q A;  5T5L A;  1FNY A;  3W21 A;  5K0U C;  1UNB A;  2D5H A;  2J1E A;  1NA1 C;  1Z7S 2;  2PHX A;  2GDF A;  2WSU A;  3AZV A;  3OD0 A;  5SV5 A;  2K0G A;  1XYO A;  4JKM A;  4LA2 A;  2W46 A;  3DEC A;  4MXW A;  4PCR A;  4RA0 A;  3ZVX A;  5CFD B;  1CAU B;  2KXL A;  1BK1 A;  5D8A A;  1UPI A;  4IV1 B;  2WYF A;  2OX0 A;  1POV 1;  1YQ6 A;  1W99 A;  2JB8 A;  4LMF A;  1O4Z A;  3HQU A;  2BBV A;  4BXS V;  4QWN A;  5B4X A;  4GWJ A;  3WIN E;  5LA1 A;  2JB4 A;  4L9B A;  4RS5 A;  4L0P A;  4WZF A;  4UF0 B;  1V9U 3;  2VMG A;  3OUH A;  3PVB B;  2BOJ A;  4FVV A;  1MZ6 A;  2OII A;  5BYN A;  2EVX A;  4Y33 A;  4NHM A;  4QPW A;  3N36 A;  5CZK A;  1BEV 2;  3VDD A;  1G86 A;  5C9A B;  1SPP A;  2Y6J A;  4XE9 A;  1HV0 A;  4NIA A;  3D82 A;  3SH3 A;  3RZG A;  3WDX A;  1K5M B;  3MV0 1;  1LGB A;  5J3U A;  3OY8 B;  1QJZ A;  3N3H A;  1W2T A;  4XTM A;  4EN6 B;  3RG0 A;  1NE6 A;  1VMH A;  2VQU A;  2HBU A;  2PHR A;  3VKM A;  2RDN A;  3E5U A;  1WD3 A;  1Q8V A;  3WZ1 A;  2RG4 A;  4A3X A;  1PM7 A;  2VOW A;  3AKQ A;  4R9B A;  1AR9 3;  4R9C A;  2ZX2 A;  2WO2 A;  2Q1M A;  1LUL A;  1ZBA 1;  1W3X A;  2P34 A;  4H14 A;  1OUX A;  1QXJ A;  2LAL A;  2VQA A;  5KC6 A;  4HPK B;  5SV8 A;  3FBM A;  3MV1 1;  4CTE A;  3MZH A;  2X09 A;  1MEC 1;  4FFF A;  2Q8D A;  1PVC 3;  3ACH A;  5LBB A;  5FO9 B;  1DQ1 A;  1HB1 A;  2QTW B;  3AMH A;  1W0P A;  4CDX B;  2CHH A;  2A3Y A;  2H6C A;  3AYA A;  3HR9 A;  1W0O A;  2D6K A;  1BLZ A;  3B7M A;  3KMH A;  3VV1 A;  2XWB B;  1H6Y A;  1TMF 2;  4IXL A;  4MXW B;  1SLT A;  5LA0 A;  4KBZ A;  1W8N A;  5APA A;  1R09 3;  1W6N A;  4K20 A;  4XFA A;  5L9B A;  3K46 A;  2R32 A;  2DFC A;  4FXG B;  1S0C A;  2IXI A;  3MF6 A;  2YG0 A;  3VL9 A;  2BNO A;  1QJY 2;  3OCP A;  1VBA 1;  2E6V A;  2Q5T A;  4E4Z A;  5FZO B;  4YG6 A;  5HCB A;  4PIY A;  3AP6 A;  5FXV A;  3WP6 A;  2W0X A;  1S0E A;  4QQP A;  2ADE A;  3WQ0 A;  5FZ1 A;  1JOB A;  3JD7 2;  1EP0 A;  1KXG A;  4KQ7 A;  3FX3 A;  1SPP B;  4Z07 A;  2I2S A;  5FMB A;  3RJ2 X;  1EAH 3;  3AKT A;  3PME A;  2PHL A;  5F2S A;  5K4L A;  3GAL A;  4N53 A;  1QJU 1;  4UI9 L;  1ULP A;  3OPW A;  4OLL A;  2DBN A;  2OPK A;  2X5I A;  3B93 A;  1V6K A;  4MGY E;  4X8N A;  4D8M A;  4Q0U A;  1F8V A;  5LBC A;  4OUE A;  1WCS A;  2DCT A;  2ZGQ A;  5FLI A;  2W91 A;  4E4S A;  1NCR C;  3HNB M;  4LO5 B;  4XF0 A;  2WLP A;  4NHY A;  2ZGU A;  2ORZ A;  3ILR A;  1PIV 1;  1KQR A;  4CUC A;  1UY4 A;  2WC2 A;  4AI3 A;  1N1Y A;  3HT1 A;  2VUL A;  4N7U A;  4AAX A;  3B02 A;  5FO8 B;  5FUI A;  1UMI A;  3ACF A;  4A6S A;  2ARA A;  2DV9 A;  3PUA A;  1UQX A;  2ZEZ A;  1B35 C;  3JZV A;  4P9I A;  4FOQ A;  4LBL A;  1M06 G;  4XBN A;  2RS1 2;  4DY5 A;  3ZSM A;  1VMF A;  2PAE A;  1NG0 A;  1W6N B;  4QU1 A;  5BY5 A;  2FDI A;  1IG0 A;  4A7K A;  2CWS A;  1FT9 A;  4Q5O A;  2XBO 3;  1Y9Q A;  2VMD A;  4UOJ A;  3GF6 A;  3KQ4 B;  2BBA A;  4YNI A;  2QZ3 A;  3I3B A;  1RUI 3;  1YEW A;  1JZ6 A;  1I5Z A;  2RS3 1;  2WZ8 A;  5T5P A;  2FDK A;  4NPL A;  4Q4V 1;  4D7Y A;  3KSC A;  1S2B A;  3ZXE A;  5FMC A;  4C91 A;  4N43 B;  2E7A A;  4HSL A;  4OI2 A;  3CLP A;  4XHB A;  5CG8 A;  1GOH A;  1REF A;  5J96 B;  1UXX X;  4N53 B;  1OPO A;  1IHM A;  2CU5 A;  3AP7 A;  3RDI A;  2VNG A;  3K4Z A;  4ZXE A;  1AR6 1;  4QB6 A;  5E88 A;  4GB3 1;  5DZG A;  4LK6 A;  4LIV A;  1LRH A;  3MPB A;  4OUM A;  3DUI A;  2WQ4 A;  2ZZQ A;  4LO6 B;  4LO4 B;  5DDJ 1;  5FO7 B;  3NJZ A;  4ZS2 A;  3UKN A;  5CG9 A;  3Q8F A;  4QHB A;  4FSJ A;  2YMZ A;  1A8M A;  4NO4 A;  4B8E A;  2P3J A;  4OZX A;  3PTR B;  3K75 B;  3ORJ A;  3O1O A;  2VZP A;  4OI0 A;  2JG9 B;  1W8H A;  4IEO A;  3WF0 A;  3JU9 A;  5JOW A;  1AR7 1;  2MNG A;  2YY1 A;  3K51 A;  4CP2 A;  5FYM A;  1AXY A;  2UWA A;  1M4W A;  2H0B A;  1CPN A;  4QKD A;  5C3O A;  2Q8C A;  1H1M A;  1DBN A;  4AHX A;  1GKB A;  4AL9 A;  3LGR A;  2NMO A;  4WBB A;  3MLJ A;  4YAR A;  3TEZ A;  1OBN A;  1V9U 2;  5ACA 1;  1JW6 A;  3VBS A;  1CAW A;  4XUR A;  3USS A;  4XUN A;  4FTS A;  2GNT A;  3M3E A;  3VHR A;  1XU1 A;  4MGK E;  4QX0 A;  4FTE A;  4XAE A;  3HN3 A;  5CYY A;  1OI6 A;  5ABJ A;  1G9B A;  5IFP A;  2PA7 A;  2GC2 A;  5AC9 1;  4B29 A;  4L92 A;  1B35 A;  2VUA A;  3N9N A;  1ND2 C;  3CF6 E;  4GWI A;  4LBQ D;  2V4V A;  3POE A;  2JDN A;  3CJI C;  4AI2 A;  4JDO A;  2WFF 1;  4M0H A;  1BMV 2;  1E5R A;  1LHO A;  2D6O X;  4XOG A;  5JVV A;  4BIS A;  5A3M A;  5JZG C;  1OPM A;  2XQR A;  4HET A;  1AR9 2;  1D4M 1;  1GYK A;  3AMQ A;  4LHS A;  1BK0 A;  4AFC A;  2FCT A;  3A23 A;  5IJR A;  5L7O C;  4GAL A;  3TNQ A;  1RUD 2;  2ARB A;  4I01 A;  2VD7 A;  1WMX A;  4XF1 A;  4CPB A;  5J48 A;  3GCX A;  1C1F A;  1RUC 3;  1PVC 2;  2XLA A;  2DVF A;  3KT1 A;  3NNJ A;  4XDO A;  4K1Z A;  3TN9 3;  2RE9 A;  4XDP A;  2IVJ A;  2YGM A;  3AKR A;  4QPY A;  4IEW A;  2VY0 A;  4BXF A;  4IET A;  3ACG A;  5B2G B;  3CZU A;  3I54 A;  1X82 A;  1OA4 A;  2QQM A;  4JGZ C;  4MGZ E;  1QH6 A;  3WW2 A;  1OSG A;  1GOF A;  5C33 A;  5CKN A;  1R09 2;  4XBQ A;  1OH4 A;  1UOF A;  1Y3T A;  4OHZ A;  2J1R A;  3SH4 A;  5CU1 A;  3ZXF A;  4CUG A;  1HRI 1;  2EXJ A;  1LNS A;  3KF3 A;  4HVR A;  1VBB 1;  2WA3 A;  4O9E A;  2ZHL A;  4E4H A;  3VDC A;  3QD6 A;  1V00 A;  4XMA A;  1RL3 A;  2N7G A;  3NW4 A;  1JYC A;  1RC6 A;  3FUO A;  3K4A A;  1BKZ A;  1O7F A;  1POQ A;  3O5S A;  4NJ4 A;  3ZMN A;  1AYM 1;  3VKO A;  4A45 A;  3I59 A;  4URT A;  1G9D A;  5ABJ B;  4GMP 0;  3Q8E A;  5CFC C;  5F3G A;  4CDW A;  5BNO C;  1Q3E A;  2ZX3 A;  1V6I A;  4PT6 A;  3POF A;  4FFH A;  4PQ9 A;  5A7Q A;  5JDB A;  4GKX A;  1MS0 A;  1GNH A;  2ZGS A;  4BQ1 A;  2AEY A;  3GZU C;  1XB9 A;  1RYY A;  1WW6 A;  3OTF A;  3RZH A;  2LUW A;  4XAB A;  5FY5 A;  5GLT A;  2QQO A;  3RSJ A;  5KXE A;  2VG9 A;  5D1I A;  3WW3 A;  3AMP A;  1IS5 A;  1Y43 B;  5EFU A;  5IK4 A;  2A7A A;  5DUV A;  2ZML A;  2NZ9 A;  3UYJ A;  2VL4 A;  1NCQ A;  4KL1 A;  3FLR A;  4XW3 A;  4LBN A;  4RHV 3;  1VB4 A;  3WG3 A;  5A3T A;  4KNC A;  4L2N A;  2QQK A;  1OT5 A;  4MLO A;  3MLK A;  3AP5 A;  5LWB A;  1XPW A;  3R4S A;  1MEC 3;  1X9P A;  2GN3 A;  2IWG B;  3GBG A;  3ABZ A;  5K7P A;  1ENR A;  5EIY B;  3ENR A;  3IDA A;  3GZA A;  1C1L A;  1GZC A;  5FMO S;  4COW A;  2D44 A;  2RMU 3;  3NWK A;  2ORX A;  4S2H A;  1OKO A;  2GU9 A;  1QJF A;  2AEZ A;  4XJ8 A;  3BOP A;  4IE7 A;  3BU0 A;  1JHN A;  4BMB A;  1AXZ A;  2WNU C;  5FYI A;  1QKQ A;  3POI A;  1RIR A;  3VBF B;  3S30 A;  1UY0 A;  2ZGN A;  1RUI 2;  4L97 A;  4B7K A;  1XRU A;  3LPF A;  4XEZ A;  4GH4 B;  1YQ5 A;  1K45 A;  2W95 A;  4QXK A;  4Y3O A;  4BYY A;  3J7N A;  5DXD A;  5FZ9 A;  4JGZ A;  4TLG A;  3I59 B;  1DQ2 A;  4LLO A;  3N7M A;  4CDW B;  4Z2A A;  5A33 B;  3HOB A;  4QB2 A;  1YO8 A;  3VBU B;  2LW8 A;  1LOF A;  1N1V A;  4JAA A;  3HQR A;  1JH5 A;  2OVU A;  2ZX4 A;  3LSE A;  4A4A A;  4ASL A;  3O0V A;  5H9P A;  3ZFG A;  3H8U A;  1JN2 P;  4QX1 A;  4QAW A;  5CB7 A;  3O7O A;  4C1W A;  1PO1 1;  2JJ6 A;  1RUO A;  3AP9 A;  5GJ6 A;  3KD4 A;  2YC2 A;  5KHH A;  4NIH A;  1ASJ 3;  1N1S A;  1QJU 3;  3OF1 A;  4ORF A;  2EID A;  1IS6 A;  4DIN B;  5C5T A;  3UNP A;  2GP3 A;  1G9F A;  3ZSL A;  4CCK A;  5CFC A;  2F17 A;  4AVA A;  4JTN A;  1NCQ B;  1RIT A;  2A73 B;  4CCL A;  3A0N A;  2R6Q A;  3ON7 A;  3T2T A;  2RS5 2;  3AZX A;  4IER A;  1H8T C;  2RDS A;  2CTV A;  2O8Q A;  2WZR 1;  4MV2 A;  3FJS A;  2EF6 A;  1V6J A;  1YRZ A;  3PMS A;  4KU8 A;  1LED A;  2Z4F A;  4Y1Z A;  4UFI A;  2IXH A;  1L7L A;  4F7Z A;  1J1L A;  1GNY A;  1UL9 A;  2GMM A;  2WA4 A;  1JOP A;  1W03 A;  1X33 A;  5JPN B;  1FPN 1;  1ZZ6 A;  2WNV C;  4KBB A;  5KXC A;  4AEJ A;  2ZXQ A;  4MGS A;  2IFW A;  3POY A;  3POB A;  2JE9 A;  4JVA A;  4G3Y C;  3M3Q A;  4CXY A;  2J1A A;  4HBN A;  1LOE A;  3O1R A;  3VKL A;  5C8C B;  2ZHK A;  1YUD A;  1QH7 A;  1CPM A;  4ISR A;  4UW4 A;  5FJH A;  1JUH A;  1TNR A;  5JOX A;  4GMP 1;  2WRA A;  1KEX A;  1CON A;  1SDW A;  2RS3 3;  3C7G A;  3MIG A;  4HL0 A;  2DWR A;  4Q4V 3;  4FPC A;  2E32 A;  5CKQ A;  2VVF A;  4WVV A;  2VCB A;  4H55 A;  4FO9 A;  2PQQ A;  3SC7 X;  3ZR6 A;  4E2Q A;  2A3X A;  4B4Q A;  1F35 A;  3RGB A;  5J36 A;  1OD3 A;  5F5Q A;  4BQ2 A;  2GME A;  2HWF 1;  5C6C A;  2ETE A;  4ZON A;  4WVM A;  4Y1U A;  1UYP A;  4HT1 T;  5GZC A;  2J42 A;  2XL7 A;  3MW3 A;  2RHP A;  5A6X A;  5KHI A;  4RN5 A;  5FY0 A;  4FPF A;  1KDM A;  4K8R B;  2Y60 A;  5FYZ A;  3RNS A;  3RRD A;  3I2D A;  4W6Y A;  4XQW A;  1AHS A;  1IPK A;  1U5I A;  3S0M A;  5DDJ 3;  2QBX A;  1DLC A;  1DIW A;  2BGP A;  4MZU A;  4N90 A;  5HCA A;  2Z5W A;  1FMD 1;  1YNA A;  5DZE A;  3NV3 A;  4CP9 A;  1W6Q A;  3BIE A;  2HEW F;  1W90 A;  4Y1V A;  3QCW A;  1AL2 3;  3P6B A;  2VPV A;  1AR7 3;  4YSF A;  2BGC A;  4QPG C;  4GKY A;  1BVP 1;  4XYX A;  3KGZ A;  3R4D B;  3OOX A;  4BU2 A;  1XE8 A;  3POW A;  2BWC A;  5I0S A;  2CV6 A;  2XON A;  2ZGL A;  4YGE A;  1JZ5 A;  4HZF A;  5FKC A;  3UL2 A;  4ZU5 A;  1MPX A;  2DVB A;  4BIF A;  2ZZJ A;  3UGG A;  4A44 A;  3OSD A;  5ACA 3;  2W9X A;  3ZSE A;  3FBY A;  4S2F A;  2ADD A;  2XLG A;  1SAC A;  5E16 A;  3ZR5 A;  1VAK A;  2NPI A;  1XYN A;  2IXL A;  2P3Y A;  2TBV A;  4Y4Y A;  3ZKY A;  1FNZ A;  1SLA A;  2PHD A;  3M2M A;  2R49 A;  4DNY A;  5JMO A;  2VBD A;  4LHL A;  1YQ8 A;  1GBG A;  3K2O A;  5T50 A;  2XUM A;  4NE9 A;  1W2N A;  2R07 1;  2D97 A;  2Y38 A;  1LOC A;  4QGM A;  2JIG A;  2W52 A;  4XFF A;  3UGH A;  1DGW X;  2PLV 1;  2QDN A;  3LZZ A;  4IQP A;  3L2Y A;  3WNO A;  4QPI B;  4XF9 A;  3AMM A;  1D2Q A;  2NP0 A;  2YBK A;  4GJZ A;  4WVM B;  3I3Q A;  2EAL A;  1Z7S 3;  3T3Y A;  1MS3 A;  2VME A;  1ZBA 2;  3LFM A;  2DF7 A;  4V1P A;  1IKQ A;  3WF4 A;  1HV1 A;  4CA9 A;  2Z79 A;  4CDU C;  1ULC A;  1AX0 A;  1H0B A;  1R1A 1;  2PMW B;  4K3U A;  2FBE A;  2VCM A;  4NHL A;  1MEC 2;  2D3P A;  4UYB A;  1PMJ X;  3ZSJ A;  1GWL A;  1H9W A;  1OH3 A;  3CO2 A;  1YIF A;  3AK0 A;  1AF9 A;  1O4T A;  1W8U A;  1W6Q B;  2D6L X;  4D7S A;  2UYB A;  3A7Q A;  3ZXJ A;  1UMZ A;  3ZPO A;  1PK6 C;  5FV3 A;  4I3P A;  2C9K A;  1QEX A;  3V0A B;  4AZZ A;  1PNG A;  1CGP A;  5IFT A;  2YU1 A;  1E5H A;  2ES3 A;  4LNV A;  2HWC 1;  2A1X A;  5EYX A;  4AI8 A;  2DYC A;  4CCE A;  3NJY A;  1VBD 1;  1OQE A;  2YBP A;  3BU7 A;  3OPT A;  1VBA 2;  1VBB 3;  2Q30 A;  5DAX A;  4E8D A;  1VRH 1;  2Y26 A;  3KS7 A;  2ZHN A;  4JGY B;  3T2O A;  5HBA A;  1W06 A;  2JEC A;  2DCZ A;  2QE3 A;  2VVD A;  3N9O A;  3QH7 A;  5GZF A;  5L36 A;  3DYP A;  4J25 A;  2IXJ A;  3HBK A;  5F3I A;  3MHZ A;  3T0B A;  5T5O A;  1H4H A;  3O1U A;  2WNE A;  3M3C A;  4O61 A;  1OOP C;  2DTW A;  3PIJ A;  4B3N A;  5KHK A;  2CAV A;  3WSO A;  3U0Z A;  2P1B A;  4IEP A;  5FZG A;  3I49 A;  1K12 A;  4B1L A;  1QJU 2;  4IL7 A;  4QKN A;  4B4R A;  1PX3 A;  1CIY A;  1UXZ A;  4QT6 A;  5L9R A;  2W1U A;  1T6G C;  2YXS A;  4W65 A;  3DPR A;  3E6D A;  4HKL A;  4CRQ A;  2J22 A;  2WDB A;  3C3V A;  3DCQ A;  3KQR A;  4HKW A;  3HPN A;  4IV1 C;  4JDM A;  4ZU4 A;  1PO2 1;  5F7U A;  1TMF 3;  1PIV 2;  4AGV A;  3I3E A;  2GH2 A;  2P37 A;  4YW5 A;  1XE0 A;  4AHY A;  2OUH A;  2VE1 A;  1OLR A;  3GJA A;  4I09 A;  4WM7 C;  2OUJ A;  4RYD A;  5B4N A;  2W1Q A;  1QJY 3;  3NJV A;  5I0T A;  2LTN A;  3I3D A;  2QQJ A;  1FX5 A;  2BFU S;  4JX0 A;  4QHZ A;  4CSW A;  2VU9 A;  1MQT C;  2P3I A;  2VOX A;  3NAP C;  4KMQ A;  5DZF A;  4AK3 A;  3H42 B;  3IWZ A;  2EIC A;  1KD7 A;  3CU7 A;  3JD7 3;  1WMD A;  3RZM A;  4CDU A;  5A70 A;  1GZ9 A;  2J1S A;  3VBR C;  2O8O A;  1XXN A;  1T2X A;  2D43 A;  3MUY 1;  1ZVF A;  2DBI A;  2B5H A;  4PF1 A;  1ZRF A;  3WNN A;  2A6Z A;  5HCH A;  5LEJ A;  1EPW A;  4XUQ A;  1ND3 A;  2RS3 2;  4WM8 A;  1RUN A;  2FDF A;  1UN1 A;  1GQG A;  4Q4V 2;  3RWK X;  1WCK A;  1J3Q A;  2A6V A;  1OFS A;  1PK6 A;  3ALQ A;  3MID A;  4XIO A;  5FYC A;  3ZM8 A;  4AYU A;  1PNF A;  4DUW A;  3MFA A;  1VR3 A;  1UKR A;  4K6B A;  3B5L B;  5CIS A;  5A6Z A;  1LB2 A;  1D0H A;  2R1D A;  4PQQ A;  1VAV A;  4XAC A;  2VUD A;  2W5F A;  4F3J A;  1AR6 2;  3FHQ A;  4UFM A;  2B9U A;  4GB3 2;  3ZYF A;  3OUI A;  5LCW L;  2XB6 C;  1PO1 3;  3T1L A;  3KGL A;  4UXA A;  2XG3 A;  2ZMN A;  4ZZ5 A;  5DDJ 2;  1W8F A;  1S0I A;  4KGG A;  4IE0 A;  2LM3 A;  3U11 A;  5T55 A;  3S5Q A;  1OOP A;  3AZW A;  4LBM A;  1CJD A;  1G8W A;  4P9Y A;  1ACC A;  4EZ4 A;  4PI2 A;  3FLT A;  5LRR A;  3F2Z A;  5FWE A;  3OBZ A;  4HSJ A;  2BV4 A;  5F32 A;  4LUL A;  3O14 A;  1AR7 2;  1CZT A;  4Y4R A;  1LOG A;  2WWS A;  4XUP A;  3JQW A;  2XOM A;  3RZJ A;  2WUH A;  1SBE A;  3KCC A;  2IXK A;  3LEI A;  3Q9O A;  2RR1 1;  5GM0 A;  3WP4 A;  4ES8 A;  1FOD 1;  2E31 A;  3C7O A;  4ARY A;  1QQP 1;  2WSV A;  4C1X A;  4D6Q A;  3ZDV A;  4XXP A;  3SLI A;  1NLS A;  4ATE A;  5ACA 2;  4LO8 A;  2Z69 A;  4UAP A;  4X8P A;  5J37 A;  1R64 A;  3I7D A;  1UZ0 A;  5FXZ A;  2O14 A;  4A41 A;  4OUL A;  3WNP A;  3W58 A;  3T30 A;  3UES A;  4TZD A;  2WLQ A;  1GSL A;  2ATF A;  1JZ7 A;  3VBO C;  5FZF A;  3DF0 A;  5AC9 2;  1ND3 B;  4Y20 A;  2EXK A;  4WM8 B;  3D8C A;  3NV4 A;  4AHZ A;  1RB8 G;  4MG2 A;  2CYF A;  1RUH 1;  3WQ7 A;  1H2L A;  2WFF 2;  4MAD A;  4FOV A;  2BNN A;  4XCA A;  5HXV A;  5LBE A;  2GP5 A;  1GR3 A;  3MBW A;  1IQD C;  3QLQ A;  1QF3 A;  4FP2 A;  5BNN C;  1D4M 2;  3CJX A;  3H1Y A;  1F4A A;  5IVJ A;  3VBR A;  4TTG A;  1S4C A;  1GZW A;  1O5L A;  4FI9 A;  2DCY A;  2E7Q A;  4XFH A;  2TNF A;  1UZZ A;  2C9A A;  2Y64 A;  5C3P A;  4HON A;  5JXJ A;  2D3R A;  3PUS A;  5C4W A;  2ZEW A;  4TN7 A;  4PHZ A;  2GND A;  1OLM E;  3ZDS A;  1ZX5 A;  3OGJ A;  1VPH A;  2WQ8 A;  3PTY A;  2HWB 1;  2ILM A;  3BTX A;  4AR2 A;  4OCT A;  2W3J A;  1UYZ A;  4KWK A;  5A3L A;  4CZS A;  1DQ5 A;  3KF5 A;  3LIG A;  4OYU A;  4KWU A;  4W50 A;  1YCI A;  1XND A;  3KV5 A;  3MIF A;  4QB1 A;  1F4H A;  4GIQ A;  3BPS A;  2EAK A;  4LOS A;  1G6N A;  1RGS A;  1HRI 2;  4N43 C;  3ZYP A;  2PTM A;  4XQ4 A;  3J8F 1;  5EJZ B;  1YLL A;  2ZA9 A;  1ULD A;  1VBB 2;  3ZIW A;  3S5A A;  3O0W A;  4MOA A;  1KS4 A;  4R9A A;  4D0Q A;  4YZ2 A;  5JSR A;  4NHX A;  2IVI B;  2CNA A;  2XJQ A;  5K8S A;  2IXC A;  5BNP C;  3R4U A;  3H9A A;  3K48 A;  3TEY A;  3UV9 A;  1AYM 2;  1ULO A;  4RGG A;  4IGQ A;  5IK7 A;  3INA A;  2B4K A;  5AFE A;  3TOJ A;  2IUW A;  1RUD 3;  1DGW A;  4PI0 A;  1COV 1;  4Y20 B;  4YG0 A;  4NII A;  2G9G A;  1BJQ A;  4A3Z A;  1YFU A;  5J1X A;  3ZKU A;  5BNQ A;  5FPL A;  3VHO A;  1LOB A;  1UU5 A;  2JG9 C;  2MPF A;  2W08 A;  3RJR A;  4JRA A;  5EV7 A;  2BU9 A;  4MVT A;  4BE3 A;  3U4S A;  4QQ2 A;  1HRV 1;  5F1R A;  2R07 3;  5EHD A;  2YC4 A;  5FYY A;  5C3S A;  4XUO A;  4NVP A;  4BK4 A;  2P3K A;  4ES9 A;  3BVC A;  3LA7 A;  5D8A B;  3TWI A;  1UX7 A;  5FY1 A;  4Q4W 1;  5C4W B;  5IVY A;  3IM0 A;  3SCH A;  1RUJ 1;  2DDU A;  4YWA A;  3ZYB A;  1R1A 3;  4K8F A;  4RS5 B;  3J26 N;  2AEN A;  2Y0O A;  5BNN A;  5E1R A;  3N4M A;  1AX2 A;  5K0U A;  1UPS A;  1NA1 A;  1TVG A;  1ZBE 1;  2Y8K A;  1HJF A;  5LRS A;  3D6E A;  1K5J A;  3VDD B;  3QOP A;  2DU1 A;  4FT8 A;  5FIX A;  5A1F A;  3AL6 A;  3U78 A;  3LEM A;  1ZRC A;  4Q4Y 1;  1TNF A;  5T3N A;  3WX5 A;  1DGR N;  1R08 1;  2PHT A;  2MEV 1;  4LXL A;  3N7J A;  4Q8K A;  2B45 X;  1PZ8 A;  4BHP A;  3LFI A;  4Y1X A;  3WF3 A;  2HWC 3;  1LOA A;  5GLW A;  1LHN A;  2Y34 A;  4COV A;  3BTZ A;  4I2O A;  3HAG A;  4GZ9 A;  5A1A A;  1UIK A;  1W05 A;  2QQL A;  1ZA7 A;  4NWV A;  2JDP A;  3M4F A;  4EN7 B;  1FAY A;  3VB9 A;  3OUJ A;  4BJ0 A;  3W5M A;  3GBF A;  3N9M A;  5A3U A;  3ES1 A;  1UY3 A;  3MF9 A;  5ERL A;  2QZ2 A;  5H9R A;  1VBC 1;  3R05 A;  4HG6 B;  3TBD A;  1HW5 A;  4OQ8 A;  1S1A A;  3E5X A;  1PO1 2;  4DXZ A;  4LOR A;  3ZLI A;  3H0O A;  3L9J T;  5CNA A;  2R0H A;  3BGA A;  3HNY M;  4OI1 A;  2VOK A;  2ZGK A;  2WAO A;  3IPV A;  4BQ3 A;  2OS2 A;  2ZKL A;  2NQY A;  1ULF A;  2WJS A;  5AVA A;  3M3O A;  4AVT A;  3VDB A;  2WZR 2;  4XJW A;  1US2 A;  2JG8 C;  4HXC A;  3ZXK A;  5IVF A;  1YIP A;  1Q8Q A;  5ISL A;  4AVC A;  5K0U B;  4I0A A;  2UUR A;  1NA1 B;  2ZX0 A;  3FFQ A;  1QOS A;  3N9P A;  4I0W B;  3T4H B;  3ZYR A;  1YJK A;  1LGN A;  1RUE 1;  1SG3 A;  1FPN 2;  1JS9 A;  1TME 1;  2VZO A;  3ZIX A;  1W6P A;  4A42 A;  4C0B A;  1XSQ A;  3S7E A;  3RQ0 A;  2VXJ A;  4DS0 A;  1K3I A;  2RM2 1;  1OF3 A;  1NAE A;  4R4Z A;  1H6X A;  3PHM A;  4YGB A;  1PGW 1;  1JOJ A;  3I97 A;  1YI9 A;  4LHN A;  4COY A;  5F6L B;  1J84 A;  2X5I B;  3LEK A;  4PDW C;  1A34 A;  1JTZ X;  1ODM A;  4I02 A;  4IEQ A;  4LQR A;  1O6U A;  3ZYI B;  3U07 A;  1JHJ A;  1V6N A;  3I2K A;  3GHM A;  2AC1 A;  5AVP A;  3RPQ A;  1ODN A;  1SFY A;  2Y6G A;  5DG2 A;  3BTY A;  4M00 A;  3V65 A;  4W4Z A;  5C70 A;  4A7Y A;  4CUA A;  2AGS A;  3D4K A;  4HK9 A;  1X36 A;  5FQ0 A;  5C8C A;  2BTV C;  2VMC A;  3IMN A;  2ZGR A;  1IKP A;  1TQ5 A;  2DUQ A;  4CEW C;  2RS5 3;  1MS5 A;  4EWA A;  3N9L A;  3U75 A;  3N7K A;  2HWF 2;  4MYE A;  1J83 A;  5F3C A;  3WW1 A;  2ET7 A;  5C7G A;  2GC1 A;  4QXC A;  1J3R A;  2VNR A;  4P00 B;  3VN4 A;  2XL9 A;  4YYO A;  3IPV B;  1NCR A;  2HWE 1;  1RMU 1;  1GQH A;  4QD2 A;  4PBP A;  2JDM A;  4RFR B;  2DCK A;  4NN0 A;  4ZXK A;  3VBF C;  4XXA A;  1FMD 2;  3OPZ A;  1ST8 A;  3MDP A;  2D5F A;  2LRP A;  4GH4 C;  3ZFE C;  4HK8 A;  5FP7 A;  2J1T A;  1RHI 1;  3G7D A;  1FV2 A;  5DUW A;  5HPO A;  3R0R A;  4EN8 B;  1XQN A;  2XVL A;  5FP4 A;  2RR1 3;  2VMI A;  2NYY A;  2E26 A;  3WG2 A;  1TZO A;  1UCX A;  1FOD 3;  2OQ6 A;  2W94 A;  4IEZ A;  4LTA A;  1EV1 1;  5A7O A;  5ANQ A;  3RS6 A;  4P5Y A;  4AFA A;  4JC1 A;  2JDA A;  2G9Z A;  3AL5 A;  5FOJ B;  4S2D A;  2JG8 A;  2UWC A;  1H1A A;  3O1S A;  1UY1 A;  4N8M A;  3ROU A;  5GLV A;  4ET7 A;  2ZTN A;  5J98 B;  5H9S A;  4V2W A;  4LUK A;  2K46 A;  1O91 A;  1A78 A;  4IEY A;  4QGL A;  4AGR A;  1ENQ A;  2VMF A;  4CCJ A;  2VEC A;  2QQP A;  4F83 A;  3ZYH A;  2R07 2;  2VGD A;  3B9I A;  1AXK A;  1RUH 3;  3AYC A;  3HNM A;  4YVS C;  5FQ0 B;  4F8A A;  3WP5 A;  4UFJ A;  4BDV B;  2PLV 2;  4Q8L A;  2IZW A;  2XVK A;  1V6M A;  1WLD A;  5DMY A;  3WNX A;  3ZFF C;  1SHW B;  4LHK A;  1W6O A;  4U2A A;  4YW7 A;  5I8S A;  3AC0 A;  4Q2F A;  4CP1 A;  2YV8 A;  2XKO A;  3VUO A;  3MGU A;  4EWD A;  5HXM A;  2R04 2;  1AZD A;  4A6O A;  5FBZ A;  5DPN A;  4IEU A;  4HN0 A;  1R1A 2;  3GM8 A;  4FOY A;  1NCR B;  3WG4 A;  5IHR A;  1UOG A;  2UWB A;  1DYP A;  1WMF A;  3VBS B;  4IGO A;  1CAW B;  1POV 3;  3B00 A;  1XNK A;  3BCW A;  5JOZ A;  3I2O A;  3ILF A;  1RTV A;  3J7L A;  4CEW A;  1ONA A;  1SZB A;  2G19 A;  2YC0 A;  4MUV A;  4TSV A;  5JI7 A;  2P2K A;  1NT0 A;  1B35 B;  4MH0 E;  1LEM A;  1HLC A;  1JOD A;  1WW7 A;  2QUO A;  3B69 A;  3POG A;  5DUX A;  3O1V A;  5FP8 A;  5A7W A;  1W28 A;  2HWC 2;  2FDJ A;  3OGR A;  5FY9 A;  1BHG A;  2BJS A;  5EJ3 A;  1VBD 2;  4KWJ A;  4UW5 A;  2GH8 A;  3III A;  4XMI A;  1SCR A;  1V6L A;  1VRH 2;  1QXR A;  1WW4 A;  1ZYB A;  2Q1Z B;  4BQ4 A;  1RUG 1;  3SIS A;  3SKJ E;  2WO1 A;  3HEI A;  4CEY C;  2ZJC A;  4AEM A;  2WT1 A;  2YGL A;  1MZ5 A;  2R0F A;  2VUC A;  2V4A A;  4QQH A;  4XFC A;  5FYS A;  3N9Q A;  3PJY A;  3U37 A;  4DUV A;  5C71 A;  1ND2 A;  1L7Q A;  3CJI A;  1ZBA 3;  2JIC A;  5FYT A;  2QFE A;  1FV3 A;  2J1V A;  5A7P A;  3FWE A;  5DAQ A;  3SH5 A;  1C4R A;  3IDE A;  1LU2 A;  3LDK A;  5JZG A;  5T54 A;  1MS8 A;  1QNW A;  4ZY9 A;  4J1W A;  1V6O A;  3JBG 1;  1OC1 A;  1KS5 A;  1EUT A;  1UIJ A;  4QXH A;  5L7O A;  1W6O B;  3EBR A;  1QJX 1;  2WYS A;  3J9S A;  4XZP A;  2WT0 A;  3EMR A;  5L9V A;  3QAC A;  1G9A A;  4GJY A;  1J3P A;  3PVO A;  1PO2 2;  1LTE A;  1UO9 A;  2WFP A;  4NUB A;  4P9X A;  1GP5 A;  2KM2 A;  3TEX A;  1B09 A;  3JXS A;  1F5F A;  5IVC A;  3UT0 A;  1H4G A;  3NNL A;  4AQT A;  2NMN A;  1GAN A;  1VAM A;  5LA2 A;  4DXR A;  3VGI A;  1HQW A;  2V72 A;  2JKX A;  3WDT A;  5JR2 A;  4P9J A;  3H8O A;  3U4X A;  2FCU A;  3A22 A;  1VBA 3;  4PLN A;  3RVH A;  5FOB B;  4ASM B;  2YBS A;  1VJ2 A;  4HMZ A;  4RQP C;  4CPB D;  3OBR A;  1VBE 1;  1IOA A;  2MHF A;  2RJK A;  4W6X A;  3LA3 A;  2Q8E A;  2BVB A;  2VAU A;  4AED C;  4LK7 A;  3QBQ A;  5FLJ A;  5A7W B;  4CXX A;  4BIO A;  1H2N A;  1XNA A;  1ZM1 A;  3E97 A;  5A3O A;  1YFY A;  3E6B A;  4Q4Y 3;  1IS3 A;  1OXC A;  5F5A A;  1DHK B;  2C26 A;  3APB A;  4HFS A;  4GXL A;  5FZK A;  3S6P A;  4IV3 C;  4QQO A;  2MEV 3;  2C1F A;  2VNV A;  5EP9 A;  4EV0 A;  3ZMO A;  3ZPY A;  4Q0S A;  2BPA 2;  4FBF A;  2XWJ B;  4NHK A;  5BNO A;  2BOI A;  5LA9 A;  2HKX A;  4CU9 A;  2EA7 A;  4CCM A;  4OZO A;  5FXW A;  4DFS A;  5LZ6 A;  4GA9 A;  1ND2 B;  3WOG A;  4D69 A;  4FPJ A;  1MZE A;  3CJI B;  2WII B;  4TYS A;  3W20 A;  3A21 A;  1D2S A;  3SXW A;  2VTX J;  3WNK A;  1NY7 1;  1PIV 3;  2D6P A;  5EPA A;  2C5D A;  5JZG B;  4IW3 A;  3N35 A;  3WDW A;  4QX7 A;  2WAA A;  4HLT A;  5L7O B;  3BB6 A;  3LOI A;  4WVZ A;  4BLI A;  3K4D A;  1OA3 A;  1F9K A;  1F31 A;  2BUK A;  4UFK A;  3PNA A;  5JUV A;  4C8D A;  1DZQ A;  2ZGO A;  3KLS A;  2UY8 A;  2X10 A;  1D0G A;  4AF9 A;  3KT4 A;  3LDR A;  4LKF A;  4FOW A;  3NMB A;  5FMD A;  4FPK A;  4AI1 A;  1YWK A;  1QMJ A;  2VC9 A;  1BQP A;  2RR1 2;  4JGZ B;  3JUU A;  5I0R A;  1ZZC A;  1FOD 2;  3EO6 A;  1BCX A;  1QQP 2;  1ZZ7 A;  5FR3 A;  2XJR A;  5D2A A;  1XSR A;  4RR3 C;  3KV9 A;  5HV4 A;  4RD7 A;  1H2M A;  1DP0 A;  4DZG A;  1PVX A;  5FRA A;  1RUE 3;  2JXA A;  1CIW A;  2WR9 A;  1AYN 1;  2YFU A;  3AX4 A;  3PUH A;  4RGK A;  4LBO A;  3ZFG B;  2WNU A;  4CCD A;  5LY1 A;  1UYX A;  2BWA A;  4PBO A;  1W2A X;  2XHN A;  4AFD A;  3FHI B;  2PYT A;  2QDR A;  1AR6 3;  4CDQ C;  2HYK A;  1WZX A;  3NL1 A;  5K9Y A;  4GB3 3;  2B46 X;  2VZS A;  3VBH C;  2ZAA A;  1LKN A;  5CFC B;  1HXS 1;  3T09 A;  5BNO B;  1RUH 2;  1CD3 G;  2WNO A;  2V5D A;  4JHT A;  4XAA A;  3TNP B;  4R9D A;  1DG6 A;  1MS1 A;  4FCA A;  4AED A;  4IE6 A;  2DVD A;  4XVH A;  5FPV A;  2X05 A;  1PZ7 A;  3AKS A;  4Y26 A;  3A0K A;  5FXX A;  5EYY A;  5FZ0 A;  2I07 B;  4BA6 A;  2V09 A;  5A6Q A;  4MX3 A;  1QY4 A;  1VMJ A;  1J59 A;  5F39 A;  4BCU A;  3OEB A;  1Q8S A;  3O12 A;  3TYJ A;  1NXD 1;  1CZS A;  4NAM A;  1ZRE A;  4BME A;  3LPG A;  2WL1 A;  2RVA A;  1CAV A;  1PZ9 A;  3NQH A;  5G05 L;  1Q8P A;  2HWB 2;  4WZC A;  5F8P A;  5JLV A;  4OMD A;  5F2W A;  5DG1 A;  4NPR A;  1GLH A;  1HJG A;  1H8T A;  3PU8 A;  4AI0 A;  2UY9 A;  3AP4 A;  1QNY A;  2XLF A;  4LPL A;  5LEK A;  1E5S A;  2BNM A;  3NV1 A;  1DLL A;  3WUC A;  3LWC A;  5DQ0 A;  5HI0 A;  4RSU A;  3I2G A;  1OUR A;  1QIQ A;  5AC9 3;  3J8F 2;  2YUE A;  3RYR A;  4D94 A;  1RHI 3;  4YM2 A;  2GC0 A;  1GU3 A;  1MR5 A;  3DXT A;  4Z82 A;  2WNV A;  3NV2 A;  1YYN A;  5I93 A;  5H9Q A;  2WFF 3;  2WQZ C;  2ZEY A;  5IT6 A;  1E5I A;  1N3P A;  3JB8 A;  3M7A A;  2WNU B;  1DYO A;  1W9T A;  2QCS B;  2VZU A;  3UK9 A;  4CUB A;  2JKB A;  1D4M 3;  4OQ9 A;  4COU A;  1N1T A;  1SBD A;  2WS9 1;  4AVB A;  2R04 1;  4OHX A;  2WWJ A;  1COV 2;  2V73 A;  4UBG A;  4FAH A;  3LB9 A;  4QX8 A;  5C3Q A;  3UKT A;  4NWW A;  2ZHM A;  4XET A;  3FN9 A;  1XNB A;  3PUR A;  4FQ4 A;  1GP6 A;  3KV4 A;  4NOT A;  5EWS A;  3WHU A;  4Y5S A;  4E2S A;  3I2I A;  2VJX A;  4CP9 B;  4D6R A;  1HRV 2;  5A1L A;  1FI2 A;  3KHB A;  5I91 A;  1GFF 2;  5C8W A;  2SBA A;  3VKF C;  3WF2 A;  3WV6 A;  3S7I A;  1GWK A;  4Q4W 2;  4DB5 A;  4IEV A;  1UZV A;  3MLL A;  3NO8 A;  1AR8 1;  5F5C A;  1CAV B;  1HRI 3;  1RUJ 2;  1AJO A;  1UOB A;  4K7J A;  2DU0 A;  4Y24 A;  3NNF A;  3PUQ A;  4GD4 A;  2XR4 A;  4YLZ A;  2VBB A;  5LAT A;  1SBF A;  1H8T B;  1LES A;  2P4E A;  4M01 A;  2R16 A;  3MYX A;  4IUG A;  2H6B A;  2VR4 A;  5EQU A;  1ZBE 2;  2VOT A;  4YZ5 A;  1CN1 A;  1YFX A;  3M70 A;  2D93 A;  1AYM 3;  3C8X A;  5KXD A;  1NQD A;  3ILN A;  4YVW C;  1EAH 1;  2G9F A;  3ITQ A;  4UT5 A;  4NR1 A;  4PIX A;  4Q4Y 2;  2VQ0 A;  4QPG A;  4W8J A;  5LBF A;  5CKM A;  4OHY A;  1R08 2;  5J7M A;  3MW4 A;  2E33 A;  2MEV 2;  2WNV B;  3PVN A;  2A75 A;  1TE1 B;  1A8D A;  4L11 A;  1IQA A;  4X6R B;  4IEX A;  5FZ3 A;  1O8S A;  3ES4 A;  3SNM A;  1PMH X;  1C8M 1;  2F4P A;  1LR5 A;  2B42 B;  3GBW A;  1GMM A;  5CFD C;  2C0Z A;  1TEI A;  1DZT A;  2A6Y A;  4XJ9 A;  3UGF A;  2VZ1 A;  2FDG A;  4W6W A;  2ENR A;  2VZT A;  5FUN A;  5J09 A;  3WW4 A;  5EJ1 B;  5FP3 A;  2C4X A;  2W1W A;  4BM8 A;  2OA2 A;  1JZ4 A;  3E1F 1;  3SCG A;  5M0T A;  1VBC 2;  5A6Y A;  4A7Z A;  5EZW A;  3HQX A;  4AQS A;  1T6B X;  2HWD 1;  2VM9 A;  3SMH A;  4KGQ A;  4AVV A;  5FZD A;  5C9A C;  1CR7 A;  3GNE A;  4Q0V A;  1H8V A;  2VO5 A;  5FZA A;  2EIB A;  4QMA A;  4TWT A;  1K5M C;  4NMI A;  1PX4 A;  2FMD A;  4AWD A;  3AYE A;  4K21 A;  3ZSK A;  2EIE A;  4MGI E;  2I45 A;  2B39 A;  3BOD A;  1DQ4 A;  1SDD B;  3I4I A;  5JCT A;  1W9S A;  2YZ4 A;  2W47 A;  5FCC A;  2P5B A;  2XBO 1;  1W8O A;  2Q1F A;  1N3O A;  3DL3 A;  3H3U A;  3D5O A;  5FZ7 A;  3ZXA C;  3BI3 A;  4D7T A;  1O5U A;  1RXF A;  2JD4 A;  3POS A;  2NM1 A;  1BXH A;  3OEA A;  3USU A;  2X8K A;  4XJA A;  3IB3 A;  4MET A;  4QDS A;  2BYV E;  1JYN A;  1QU0 A;  4B4P A;  5FRE A;  3S57 A;  1RUE 2;  2W92 A;  3AMN A;  1GQP A;  5GLZ A;  3T0D A;  1TME 2;  5FYU A;  2NN8 A;  5FAX A;  5F9T A;  4FPE A;  4QPG B;  3PU3 A;  1OVS A;  2RM2 2;  4JKK A;  1VRB A;  5JMC A;  3P3N A;  1DGL A;  4LKS A;  4CDX C;  1PGW 2;  4LJH A;  2QVS B;  4AQ6 A;  3EXU A;  5GZG A;  1JYI A;  1IZ3 A;  2ZGT A;  4XFI A;  4XHX A;  3DKW A;  4JZR A;  1SFN A;  5BXX A;  3Q8A A;  2F4L A;  2Y6K A;  1PGL 1;  2B9V A;  1Y9M A;  5KC5 A;  3DPR B;  5D8A C;  2EIG A;  1DDL A;  3QH6 A;  2CWM A;  2R30 A;  1UW8 A;  4YG3 A;  3T2P A;  2WZE A;  4NAO A;  1OHF A;  2HJI A;  1W8T A;  1CZV A;  1JZ2 A;  2GNB A;  4OUS A;  1RUF 1;  5DAP A;  2ARE A;  4EWE A;  3MFC A;  2WZR 3;  3NRU A;  5FZM A;  3P5B A;  4DUX A;  3BUC A;  4M4R A;  4M3C A;  3J4U H;  4XFG A;  4OHV A;  1EYB A;  2ZPX A;  1GP4 A;  2YRO A;  4YGD A;  1LHV A;  1I5P A;  1CAU A;  1I3H A;  3NST A;  1H1I A;  3WCS A;  1WD4 A;  4MHU A;  1K42 A;  4GWM A;  4ERO A;  2O1Q A;  4IV1 A;  4LO7 A;  4G9S B;  5JSP A;  2HWE 2;  3O1T A;  1RMU 2;  5IVB A;  4CDU B;  4HVO A;  1FPN 3;  1U5Y A;  4K9S A;  1O3T A;  2VVE A;  3B9C A;  3CMG A;  3U1X A;  3PJQ A;  2NLR A;  4WM7 A;  1C8N A;  1UD1 A;  4UF0 A;  1X7N A;  4NRQ A;  1FXZ A;  4Q1P A;  4YGC A;  1Q56 A;  1RHI 2;  4R4X A;  3USU B;  2W2I A;  1C57 A;  3G6J B;  4DRR A;  3THD A;  4XQD A;  3WQ1 A;  1MQT A;  3NAP A;  4XBL A;  1PK6 B;  1EY2 A;  3HJR A;  5GLU A;  3KT7 A;  2FHR A;  2IC1 A;  5BV6 A;  2OKX A;  3RMX A;  4GMP 3;  1EV1 2;  5KR7 A;  1FAT A;  2WO3 A;  4DMI A;  4LLF A;  4H7M A;  3IAP A;  4BK5 A;  3KVA A;  1WCD J;  3IIA A;  4FPY A;  2SLI A;  4L8Q A;  3RFR A;  4BB3 A;  1AYN 3;  1MAC A;  4E4D X;  1U5X A;  2ERF A;  4GQ7 A;  1NYW A;  4MHR A;  3WQB A;  1RUC 1;  1VB2 A;  4DY3 A;  1LCL A;  2HWF 3;  3PVE A;  3RI8 A;  3P1I A;  2BZD A;  2LRO A;  1ZZ9 A;  1S0J A;  2AAC A;  3ZYG A;  5I0D A;  3H8R A;  2PHU A;  1KJR A;  4XIK A;  4HPK A;  2AH2 A;  2H0V A;  4QDR A;  5FWJ A;  1OOP B;  4NPM A;  4XFB A;  4XJU A;  1MVQ A;  2I74 A;  3MIC A;  2TEP A;  3WNM A;  1S0B A;  1O8P A;  4WV8 A;  4NRO A;  4XCB A;  4CDX A;  5FZ6 A;  2BP6 A;  3OBT A;  1FMD 3;  2ZMK A;  5GZE A;  4M3C B;  2K2S A;  2P17 A;  3HMY A;  4Q26 A;  3WLU A;  3MPP G;  1DU3 D;  1FYU A;  1I1E A;  3WDV A;  4URA A;  3OJB A;  4ZS3 A;  1REE A;  2VTX A;  1I9R A;  2GNM A;  3MIE A;  4LUM A;  3KHC A;  4N53 C;  3U14 A;  1JYX A;  2ZAC A;  4U36 A;  4JCK A;  2X5I C;  3FLP A;  2ZS6 B;  3OB8 A;  5A3W A;  5FZO A;  2VMH A;  1GNZ A;  4WM7 B;  4CCC A;  2XPJ A;  3J7M A;  2BER A;  4Y5T A;  2JEM A;  3BYW A;  4CE8 A;  1DGR A;  1RJ7 A;  4G4F A;  3CIH A;  2YHJ A;  4Q0Q A;  3LD8 A;  3BAL A;  4AOC A;  5JOY A;  2VUJ A;  3HBZ A;  3HN1 A;  3ZYJ B;  1MQT B;  3NAP B;  1F5J A;  2E51 A;  2ET1 A;  4Q27 A;  4ISQ A;  2HYX A;  4P08 A;  4E8C A;  1ENX A;  1NZC A;  4FXK B;  3VBR B;  2DCJ A;  1GZW B;  1HIX A;  1X8M A;  2VQT A;  3MW2 A;  3URF A;  1AL0 G;  1RUG 2;  2PLV 3;  1VAL A;  2QQI A;  1N47 A;  2D7F A;  5CAZ A;  2D40 A;  4FFI A;  3DV8 A;  3THC A;  3VBO A;  1S0D A;  5E89 A;  4HVQ A;  5HV0 A;  4RHV 1;  2J7M A;  1UKG A;  3WD5 A;  5CEH A;  4LT5 A;  4QM8 A;  4J1X A;  1SQ4 A;  2WS9 3;  1QOO A;  2HBT A;  2R04 3;  1W2U A;  2WKK A;  4M3C F;  3WHT A;  1MZF A;  3JCI A;  1WW5 A;  4ATF A;  3H7J A;  1BYH A;  1SLI A;  3EB7 A;  3JBG 2;  3OD4 A;  3PLQ A;  5FJK A;  4DEQ A;  3Q8B A;  1LEN A;  2B7Y A;  5E8A A;  1QJX 2;  1BBT 1;  3C7H A;  1S2E A;  2RMU 1;  3ZX7 A;  4CU6 A;  1W9Y A;  3TRS B;  1XJA A;  5FPU A;  1WBF A;  1MS4 A;  3MEP A;  2WBK A;  3WCR A;  5CAD A;  3WG1 A;  3FHA A;  4N7I A;  1HN0 A;  3Q8C A;  4DEV A;  4QXB A;  5FTT C;  1AR8 3;  3CL1 A;  2LS6 A;  2G4I A;  1VBD 3;  4AFM A;  4R52 A;  4CCN A;  4QHO A;  3ST7 A;  2ZKN A;  4EE2 A;  2HLE A;  1VRH 3;  2FZ1 A;  4UFL A;  5F37 A;  1W8Z A;  1VBE 2;  2ARX A;  2XML A;  3IDB B;  1QXP A;  4H2A A;  1DYK A;  4OHW A;  4QU2 A;  1GOG A;  4N43 A;  3GJB A;  4DQA A;  2IFR A;  5FZC A;  4E27 A;  1JXN A;  4AQ2 A;  2XH6 A;  4Q0P A;  2JWP A;  1QDO A;  1BZW A;  2Y6H A;  5A7N A;  3UET A;  2CL2 A;  2VNO A;  4UBH A;  4CU7 A;  4JTO A;  3UKV A;  1ASJ 1;  3B3Q E;  5BNP A;  1IPS A;  1UYY A;  2R06 1;  3IDC B;  4RFT 0;  5FYH A;  1X8E A;  5JAX A;  3VBO B;  1C8M 3;  3AYD A;  4LEJ A;  4DIQ A;  4P02 B;  4IND A;  3W59 A;  4LBQ A;  3VZN A;  3LKJ A;  4LBK A;  2CDO A;  1JMU B;  3MO4 A;  3WDU A;  4Q1R A;  1PO2 3;  1LGC A;  3LQC A;  4PJY A;  3VBS C;  1S0G A;  1VE0 A;  2ZOE B;  4B7E A;  1NY7 2;  3I2J A;  1A6C A;  3BTA A;  4SLI A;  4E9K A;  3KVB A;  1RJ8 A;  2JG9 A;  5BNN B;  3AVS A;  5ABJ C;  1XBF A;  3F95 A;  4IE5 A;  2HWD 3;  5BUV A;  1OQ1 A;  2Q4S A;  3H1M A;  2YYO A;  4Z8B A;  3KB5 A;  5A32 A;  3U10 A;  2GZW A;  1R1Z A;  4P14 A;  1JU3 A;  2E53 A;  3E6C C;  4QQL A;  1PM4 A;  4YW1 A;  1LEC A;  5FBJ A;  1UF2 C;  1XOY A;  1J1T A;  1VLN A;  3IKW A;  4YZ4 A;  4BQY A;  1S0F A;  1CJP A;  3LOB A;  2VXR A;  3D0J A;  2CY6 A;  4JRL A;  4XF3 A;  3SQO A;  2Y33 A;  3IN9 A;  4N9I A;  1ZZB A;  2W1S A;  2OYZ A;  1OLM A;  4DXT A;  1NX9 A;  2AUY A;  1W9F A;  2Y0I A;  3BOW A;  4DRV A;  2RJ2 A;  3LIH A;  2PHF A;  3KCX A;  5T52 A;  2DFB A;  4R8H A;  1IPJ A;  1QJE A;  4K1Y A;  2Q8O A;  1JUI A;  3D3A A;  1XNC A;  4CP0 A;  1AYN 2;  1LHU A;  2ZBJ A;  4NIG A;  3X29 B;  3AZZ A;  1L3J A;  4XZU G;  1W0N A;  5IVE A;  1NQJ A;  1SEF A;  2RJL A;  5BNP B;  2GN7 A;  3EQE A;  2WT2 A;  2JE8 A;  1JBC A;  3NKG A;  1W2O A;  2XHK A;  4H3W A;  1J58 A;  1LOD A;  2AYH A;  2EAA A;  4XTP A;  4EYU A;  1XYP A;  3VD3 A;  3HVD A;  1HXS 2;  3R6S A;  5FPZ A;  3T0A A;  4ZHN A;  2D98 A;  1RIN A;  2KA3 A;  2QKD A;  4LBQ B;  1UX6 A;  4JV4 A;  3W9A A;  3GHN A;  3IT8 A;  3LA2 A;  3HT2 A;  3VZJ A;  2J1U A;  2JDH A;  1OMI A;  4MXV A;  4M4P A;  3JQX A;  4QX2 A;  1CES A;  1AL2 1;  3JB4 C;  3B94 A;  3GZE A;  5FZ8 A;  4EJR A;  3H3L A;  3PUI A;  1O3R A;  2EXH A;  1RUF 3;  1AJK A;  4CDW C;  1DQ0 A;  5KWR A;  1O4Y A;  3VBU C;  4BLJ A;  4IGP A;  2D6N A;  3I2H A;  4YZ3 A;  5A32 B;  4Y5Z 0;  1ULE A;  2ID4 A;  1WLW A;  3I8T A;  1W6P B;  1GIC A;  1WCU A;  1QQP 3;  4BH9 A;  4ZZ8 A; 
#chains in the Genus database with same CATH homology
 1HN0 A;  2WYF A;  4BQ3 A;  4BQ4 A;  4LK6 A;  2O14 A;  1WMX A;  1WZX A;  2LRO A;  2KR2 A;  2Q1F A;  3UT0 A;  1W8W A;  4CPB A;  4YWA A;  4YW6 A;  4LKF A;  2K46 A;  1W8T A;  1GWM A;  1W9F A;  2LRP A;  1W8Z A;  1GWL A;  4AL9 A;  1OH3 A;  3ZYH A;  3ORJ A;  4CP9 A;  4CPB D;  1W8U A;  1OKO A;  1V0A A;  3F95 A;  5D21 A;  4CP9 B;  1W90 A;  1L7L A;  2JWP A;  4LKE A;  4A6S A;  3ZYB A;  4LK7 A;  2C24 A;  4YW7 A;  3ZYF A;  2VXJ A;  4LJH A;  1UOJ A;  4BQ5 A;  1GWK A;  4LKD A;  1WCU A;  4BQ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...