1OH3A

E78r mutant of a carbohydrate binding module family 29
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
141
structure length
141
Chain Sequence
RATYTVIFKNASGLPNGYDNWGWGCTLSYYGGAMIINPQEGKYGAVSLKRNSGSFRGGSLRFDMKNEGKVKILVRNSEADEKFEVETISPSDEYVTYILDVDFDLPFDRIDFQDAPGNGDRIWIKNLVHSTGSADDFVDPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NON-CATALYTIC PROTEIN 1
publication title Ligand-Mediated Dimerization of a Carbohydrate -Binding Module Reveals a Novel Mechanism for Protein-Carbohydrate Recognition
pubmed doi rcsb
source organism Piromyces equi
molecule tags Carbohydrate binding domain
total genus 32
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-05-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 1oh3A00
4CP9A 4LK6A 4YWAA 1GWLA 1V0AA 1OKOA 1W8TA 1W9FA 2KR2A 2LRPA 2WYFA 4LJHA 4YW7A 2C24A 2JWPA 2K46A 2Q1FA 4BQ2A 1W8WA 1HN0A 4BQ5A 4LKEA 4BQ3A 1UOJA 1WCUA 1L7LA 4CPBD 4CP9B 3ORJA 3ZYFA 1OH3A 3UT0A 1W90A 1WZXA 3F95A 3ZYHA 4BQ4A 4YW6A 2O14A 4CPBA 1GWKA 1W8ZA 4AL9A 4LKDA 1GWMA 1W8UA 2LROA 4LKFA 4LK7A 1WMXA 5D21A 3ZYBA 2VXJA 4A6SA
chains in the Genus database with same CATH superfamily
5T55A 5C3QA 4UBHA 2VXRA 3IB3A 1PZ9A 4XDPA 3HBKA 4PLMA 3WW4A 3OGJA 4DXZA 1AX1A 4BQ1A 1SPPB 3MBWA 5FY9A 1XRUA 5A32B 2WO3A 3HMYA 1XSRA 4YM0A 5FKBA 3WNNA 2W9XA 4Y1YA 4IEUA 3C8XA 3D5OA 1ULPA 1YQCA 4FPHA 4M3CE 4XOGA 2Y34A 3VZNA 4QPIA 2HWF1 5CVRA 1FV3A 4AEJA 3L9JT 3PU3A 2E7TA 4AFBA 1LRHA 2ZS6B 3QBQA 4PDWB 4RS5B 5FMCA 3BI3A 1C1LA 4GB32 1W99A 2R0HA 3NNGA 2C9KA 2YBPA 4AXOA 4HOOA 1UW8A 3I97A 4N43A 4NPRA 4FPOB 2O8QA 1QKQA 2TUNA 4LA3A 5KHGA 1FPN1 1AR72 1IOAA 1SLAA 2XL9A 5L7OC 3POFA 3PLQA 1S0EA 4QB1A 4BIOA 4GJZA 2QKDA 5J3UA 4RGKA 1X9PA 4KGQA 1V6KA 2P3JA 3DCQA 4UW4A 1IHMA 4FOWA 5A3TA 5JXGA 3ACFA 3SITA 4MHUA 1JHNA 4AR2A 4YLZA 2IXHA 1UD1A 2BWAA 1CESA 2DFCA 3ZFGA 5F6KA 1AL21 4UFMA 1IS4A 2EF6A 1S4CA 3U10A 3VDBA 4KBBA 4Q4Y3 3DGTA 4QAWA 1V00A 4JRLA 3HIFA 1D4M2 2QBXA 4L2NA 1QQP3 3Q8BA 4G4FA 5F5QA 4CU6A 2VOWA 3DPRA 1H4HA 1E5RA 1ASJ1 2GH8A 2D6NA 4XMAA 1H1AA 1XB9A 3V0AB 1A8MA 1RHI2 2AUYA 5GM0A 4M3CA 4CEYC 4LHNA 4XBLA 1EV11 5FMDA 4P9GA 1GOGA 1AR81 4DS0A 4TWTA 1GR3A 3S5AA 4OI2A 2B45X 1YRZA 2RMU1 4XQ4A 1LODA 5D8AB 5A3LA 3DEMA 2BGOA 1TMF3 2JG9C 4E4DX 5LASA 5IAXA 1VBE3 2RS11 4IE7A 5L19A 5A6QA 3AKSA 3AYAA 4GMP0 4JGZC 1ZA7A 2WYSA 2Y6GA 1UU5A 1S0BA 3SQOA 1OUSA 4YFWA 5FBZA 1JU4A 1IS6A 4LORA 5JMCA 4QMAA 1OQ1A 1Q5OA 1RUF3 3WR0A 4B4PA 3VBOA 4KQ7A 3VDDC 3VBUA 4HN1A 3KV6A 3NV4A 4BWOA 1RUE1 1IPSA 1O5LA 1W2AX 3VBHC 1WW5A 2P5BA 5F6LB 3WEZA 1W6NB 5J48A 5A3PA 4OCTA 3KF5A 1VAKA 1LTEA 5K9YA 5HPOA 2ARAA 1PNFA 1L7QA 3AJZA 2JG8C 1CAXB 3KMHA 1XBFA 2C5DA 5TSWA 4E27A 1GZCA 3NMBA 4M4RA 1W9YA 5C8WA 4Z8BA 2IZWA 1PM4A 1AL0G 3OB8A 4AW7A 3POJA 3IZOA 2AZ5A 2XHNA 5A7WB 5FY8A 2VM9A 3H3UA 4YVWA 3MLKA 3RQ0A 1LU1A 4A6OA 5HV0A 1NYWA 1GNYA 1N47A 2VECA 4QM8A 1JW6A 3A4UA 4RGAA 3LD8A 3U07A 3BYWA 4CDUA 4I01A 4M00A 1MS4A 1H8TA 4QPGC 3LKJA 1YXWA 1SCSA 4XAAA 1LB2A 3DECA 3ACIA 1LOEA 5FZMA 2OA2A 1H9PA 1KXGA 2PLV3 2XG3A 2YROA 3N7JA 3ZKYA 4IEPA 1VB2A 5AVAA 1R093 2ENRA 3THTA 4L97A 2PHFA 2RS32 3HQXA 5JUVA 1ZBA1 3KGZA 3ENRA 1NCRA 3RSJA 3IDEA 1PIV3 2OVUA 1W9FA 1RB8G 3EXUA 4NJ4A 1NUKA 1W6OB 1DYPA 1WKYA 2LM3A 3IPVA 2V73A 5FUNA 2C1FA 4LBQB 3VZMA 1YQ2A 5T5PA 2FDKA 3IAPA 3AKTA 4ASMB 1QJFA 3MW4A 4AWDA 1LOGA 3F95A 4PJYA 3HBZA 4GWNA 4RD7A 3JBG2 2OYZA 2ET1A 3GHNA 4FFHA 3GZEA 3VBHB 3T3YA 3BU0A 2LUWA 3FE5A 4LBQD 3W9AA 4ES9A 5JDBA 1S1AA 2JDYA 1SDWA 1CPNA 1GMMA 1HB4A 1MEC1 4LR4A 1F31A 2NMOA 4BYYA 4RHV2 1QF3A 4IESA 4Y1UA 5CU1A 1SDDB 3ZXAC 1LHOA 1LOCA 2WQ4A 1GWLA 1RUG3 3JD73 1REEA 3ACLA 1LR5A 4X6QB 5D1IA 3WOGA 4RL7A 1AYM2 2X5IA 4YZ4A 3FBYA 5FJKA 4OQ8A 3VHNA 5JAXA 3EYPA 1O8SA 5C8CB 1JZ5A 3IKWA 4ATFA 2OZ6A 4UF0B 4HKOA 1RUI3 4IGQA 4XJWA 1WLWA 4FSJA 2E63A 1MS8A 2WLPA 2CHHA 3K4AA 4QGLA 3EJKA 1UAIA 4M3CF 4QPGB 4WVMB 3NQHA 4Y3OA 4JTOA 1GICA 4NRMA 5CG9A 4SBVA 1DBNA 5FCCA 3ELNA 5FZ4A 1RJ7A 2CY6A 2RS53 4BQXA 5C70A 2ZX1A 2Q8DA 3FFQA 1LECA 1S0CA 5F7UA 2VVFA 1BBT3 1V6MA 4C1XA 4IGPA 3WNOA 1B09A 4AFMA 2PELA 4GB31 4OMCA 1UMIA 5FYTA 3WHTA 1W8OA 4DZGA 1ALYA 1IQAA 5E6HA 2XJPA 2XBO3 4LOTA 3M2MA 1UOJA 2IXJA 2D3RA 4D6SA 2A3WA 4YARA 1YJLA 3DXUA 2WT2A 3HNBM 2EAKA 2ZGTA 1YI9A 4AGVA 1PZ8A 1BVP1 1PVC3 2DF7A 2XKOA 2YC4A 4KG8A 4NWWA 4CU9A 1DYKA 3HQRA 1N1VA 1QJU2 1W0OA 3M7AA 5A6ZA 1OXCA 1PHMA 3POBA 2RR12 1CONA 3AZZA 2VUDA 2Q8CA 2H0VA 1W8HA 3WF1A 3NNLA 2YGMA 4IE6A 5FUPA 1D7PM 3N9LA 2Y64A 4Y1XA 1IG3A 3T0DA 4HFSA 4EN6B 2UYBA 5FXVA 3G6JB 2C6SA 1O8PA 2R043 2ZMLA 4KH9A 3U4XA 1D4M1 3AVSA 4B4QA 2HKXA 1XYPA 3IIIA 1V6JA 1W8NA 4IGOA 4MYEA 4M01A 1RHI1 4W4ZA 3ZN6A 5B2GB 4CXXA 1AVBA 4LBNA 1T2XA 5BV6A 3PJYA 5EIYB 1ODMA 1QQP1 2P6HA 2VY0A 5FREA 5GLTA 1OI6A 1SLBA 2AR6A 1J3PA 4NE9A 3RG0A 3VBSC 4ASLA 3AKPA 4LBMA 1R1A2 5B4XA 2VQTA 4O7XA 5FZHA 3T1LA 1CAVA 1TNFA 5HCFA 4FPGA 3VKNA 3V64A 2J1EA 3OD4A 4ONUA 3AFGA 3T2PA 5A6YA 1JZ3A 2EXKA 3GJBA 3WT3A 4ASKA 5JXIA 4ZHNA 2WNVA 4LUMA 2EVXA 2IXCA 5I0SA 1C57A 4QU1A 1Q8QA 3KHCA 1X36A 3WV6A 1YIPA 1YNAA 4K21A 3WX5A 4GMP3 5LBBA 4UFHA 4HZFA 5BNPB 3WD5A 2WC2A 1MZFA 4FPFA 4Z07A 1VRBA 5H9QA 4BXSV 3N9MA 3O0VA 1ND3A 2XJTA 3J7LA 5CNAA 5JPNB 4GA9A 2DTYA 3RZKA 1RL3A 2ZZJA 4JQRA 2ZGPA 1JUIA 5JI9A 2WFPA 2WO2A 1V6LA 5J7MA 5JSOA 4JVAA 4P9JA 3KVAA 4EZ4A 2VBPA 5LEKA 4YSFA 1SLTA 5FO9B 2I74A 4P5HA 2VTXJ 3NJVA 3CU7A 3SKVA 1LEDA 2ZHNA 4Y5SA 1TNRA 3Q8AA 4K8FA 5IVFA 5K0UC 4OI0A 1SBFA 2WNUB 3AYCA 2WQ8A 3KZ4C 1QDCA 1VBC2 2JE7A 2VMEA 4LBOA 3JXSA 4QDQA 3LQCA 5ACA2 3HWJA 1ZRIA 2ILMA 1HRV2 1KQRA 4K20A 3SHRA 1RUH3 1HN1A 3PIJA 4YZ5A 2QQLA 2L9LA 2H0BA 4FOVA 5A32A 3QD6A 3WP3A 2MEV2 4XYXA 4G3YC 4OZOA 4QXBA 3BOPA 1XU2A 2GNBA 4CEWA 2ZPXA 1GOFA 1RUH2 1A3KA 2WLQA 2W39A 2A6XA 4EN9B 2ZABA 3NAPC 4MADA 4PDWA 4RS5A 1CQ9A 5A1FA 3J7HA 5FY1A 4AHWA 5DN2A 1VBA2 3VBFB 3VBSB 1P8JA 4Y24A 1HXS2 5FZ9A 5GZDA 4LKEA 2VOTA 5F1RA 1JTZX 2VNGA 4KNCA 3LZZA 2RS31 3BN6A 1FI2A 4B8EA 5AC93 5JOYA 1I3HA 1UX7A 1NQJA 4DPNA 4FOQA 1VLNA 1QJY3 4HK9A 1PGW2 4ES8A 2O0OA 4YZ3A 2FCUA 4OUEA 4URTA 4JHTA 3LA2A 4TLFA 4DMIA 1PMHX 2CL2A 4YGEA 1XOYA 4JTNA 3ZYGA 2HEYF 4A7YA 1A34A 1TME3 1YQ8A 2Z2SB 1QOTA 4BLIA 2ZX3A 2FMDA 2JDAA 3C3VA 4DRVA 3I2OA 4FPYA 4QX2A 3JBG1 3LPGA 4S2FA 2BNNA 4BMBA 4AEDC 2BV4A 1TQ5A 3O1SA 5LY2A 4AAPA 3RZLA 3VN4A 3BTAA 3USUA 5BNNC 4U2AA 3P1IA 1LHNA 4RHV1 4A42A 4DEVA 4ZKTB 2FCTA 2VE1A 4OHYA 1DZTA 4XQWA 4DRRA 2ZKNA 2WR9A 1SFNA 1HB3A 1XE7A 2BU9A 5K0UB 4NIHA 2W47A 4NROA 3VHRA 2A75A 4IXLA 1AYM1 1K5JA 2QQWA 4R9DA 3I59B 2V4VA 4NHLA 5CKMA 2WNEA 1AR93 1LCLA 1RUG1 4PBPA 5D8AA 5FY4A 2JEMA 1XNDA 1QOSA 1COV2 4GULA 3O1PA 5I8SA 1POV0 4MXVA 4QM9A 1WA4A 4A2UA 3OPZA 3P3NA 5EPAA 2PA7A 5DXDA 3ZXEA 2D40A 3NAPB 3NL1A 1O7FA 1WZXA 4E2SA 4BB3A 1F4AA 1UXZA 1W8ZA 3DYMA 5T3NA 1W6PB 1WCSA 1LGCA 1GZWB 3KLSA 1IQDC 4H55A 4WM7C 5JSPA 3FLTA 2OT7A 4QQ2A 3ZXLA 5ABJC 3OBRA 2RS51 4NR1A 1W6NA 1AXZA 4KWUA 4XFFA 4C0BA 1KS4A 4H7LA 4NMIA 5A1AA 4QWNA 4YVSC 1GV9A 4B7EA 1NA1C 1NCQB 2WN3A 1NAEA 1WBLA 1FMD2 3T30A 4AI0A 1CAXA 1PO22 3PMSA 3A22A 3I2KA 4MH0E 1H2MA 5EHDA 1QJU1 3J8F2 2Y6JA 3JQWA 1PK6C 4XPVA 4FVVA 2GDFA 5JPMB 4AHYA 1N3OA 3ZFFA 4BA6A 2RR11 2XVGA 1UU4A 1FOD3 5A7WA 5HXMA 1OH4A 1LEMA 1UIJA 2X8KA 4AEDB 4K1ZA 4CDXC 4AVBA 2DCJA 4A41A 1V70A 3K77A 2QTWB 4LKFA 1DQ5A 2HWC2 4LK7A 1NG0A 2ZGLA 5BNNB 2Q1MA 3U11A 5B4NA 5FYUA 4P00B 1G9CA 1ZZ9A 2GMEA 4XXAA 5DUWA 2JE9A 1JZ2A 3RZGA 2HWF2 1UPIA 4RFT0 2PXJA 1JODA 1RUD2 3ZR5A 4NHMA 1OLQA 5APAA 4D8MA 1ZM1A 4YGBA 1PGL2 3WSOA 1JN2P 3PTRB 2R062 5FPUA 3WDTA 3PHMA 2ZGQA 3VBRC 4F3JA 1Y9GA 1K12A 3FX3A 3FMGA 3B9CA 4EZHA 4Q4X3 5FUIA 1US2A 1XNKA 5DAQA 4Q0PA 3W59A 5BY5A 1W6QB 3WNMA 3KHBA 3LGRA 1R1A1 1E5HA 3CJIC 2DVBA 4FQ4A 3VL8A 2DCZA 4PLOA 4UT5A 5J98B 1W6OA 2E26A 2PAKA 1UX6A 1LENA 1XPWA 4HSLA 4LBQA 5CADA 4HVQA 4LBKA 3GYDA 3CLPA 2J1SA 2UU8A 3T4HB 2OUJA 1DIWA 1W6MB 2IXIA 4Z2AA 3GZAA 2VBBA 5CFDB 1UCXA 1Z0HA 4P9LA 1NZIA 2HWB3 2X29A 3VBHA 5ABJB 5JLVA 1H8VA 3SH5A 1W8WA 1ENXA 2GZWA 3N9NA 3AXDA 1R1ZA 2G9FA 1FXZA 2HYKA 3AP9A 5FP3A 3USSA 4XIKA 3J7MA 1ASJ2 2CDOA 5J09A 3GHMA 2FDGA 4ET7A 1OUXA 1BKZA 3CL1A 1EV12 2UURA 2Y0OA 1XE8A 1XXNA 1JU3A 3Q8CA 3WQ7A 3OD0A 2WKKA 1LULA 1PMJX 1L3JA 2IFRA 5C8CA 4NIGA 4RGGA 5LW9A 1ZZ8A 5DABA 4CDXB 3SLIA 4KL1A 4NAMA 1V9U3 4IV3C 3K3OA 3IWZA 3TOJA 5ACA1 2RS12 3R4DB 1HRV1 4MO3M 4AQTA 4QXHA 5L9VA 4WVMA 3MFAA 3FLRA 1NOVA 1UY1A 2MEV1 1ZRRA 1RMU3 2NQYA 3HN3A 1JYNA 1HLCA 1BLZA 2D43A 1SACA 2ZAAA 3E5QA 2H6CA 2CGPA 1RUH1 2PHRA 2QQUA 5GALA 4OUMA 1I6XA 4QDSA 4CSWA 5T5OA 1AX0A 1VJ2A 1YHFA 2LALA 1NLQA 2SBAA 1G6NA 1VBA1 3WLUA 2GC0A 1W8FA 4Q4W2 4QX5A 4CDQB 1HXS1 4PIXA 3UJQA 4Q4V3 1OOPA 3MIHA 3LFIA 3KCCA 3PUIA 2EICA 4GD4A 3O1MA 1GYKA 5DAPA 4V2WA 1W0PA 2WZ8A 1PGW1 5GZCA 1ZZ6A 5EYXA 4Y22B 5F8PA 3POIA 4XTMA 2OQ7A 4HVOA 3M3CA 3NV3A 4U36A 3M4FA 1GANA 5FMOL 2BYVE 3NJXA 4OQ9A 2Z79A 5FPLA 4L0PA 5FZ6A 1G9DA 2BW8A 4CCKA 1VBD3 1WCDJ 4NPLA 1B35C 3H3ZA 1BXHA 4GQ7A 3SEEA 3OGVA 1Q56A 1BEV2 4TYSA 1CWPA 1YIFA 3O0XA 3KWVA 4AI2A 2IC1A 3D82A 3O1RA 3LF7A 2QQIA 1ENSA 1TME1 2AREA 4QHZA 5DAWA 4JGYB 2DFBA 3RFRA 5FZOB 2P3YA 4YG3A 5JZGC 1E57A 3GBWA 1O3SA 4J1WA 5F5CA 5FP9A 5IYYA 3SKJE 1OLME 1K5MC 1S55A 1HRI3 2Q4SA 1LHUA 3CF6E 4BQ5A 4FTEA 2Y38A 1JYWA 1S0IA 4URAA 4QXCA 5FZ3A 1E5SA 2YFZA 4NUBA 4XXPA 2B8MA 2GAUA 1N1YA 4M0NA 3RZMA 1AXYA 1COV1 3WHUA 2Y8KA 4C90A 1GP5A 3CBNA 4AAXA 4MX3A 2VULA 3PURA 4RQPB 1QXPA 2AACA 2Q1ZB 2XLGA 1O6UA 4HXCA 1AR91 1OA2A 1Z78A 3F2ZA 1POV3 3KVBA 4QQOA 4D3WA 4ZU7A 5DAXA 5EJ3A 2BERA 1UY0A 2UWAA 3KT1A 4HLTA 2FDJA 5KBFA 4CEWB 4AOCA 2PTMA 4IERA 4CUCA 1U0AA 4EWDA 1MZEA 4HSJA 5BNPA 2G4IA 4UI9L 1KGYA 3I2FA 5EP9A 1XSQA 3J9SA 2QFEA 1RUJ2 1J1LA 5L9BA 2WO1A 2DVGA 3ZOIA 1G9BA 1QJZA 4N53C 4OUSA 3WUDA 3KV9A 5BNQA 5GZEA 4D0QA 2ZGNA 3THDA 2VW1A 3H8RA 3WG3A 2C26A 1FMD1 1BVVA 5L73A 1PO21 1GLHA 3AZYA 4QQLA 2RM23 3ZFEB 1UL9A 5IVVA 3J8F1 4FPJA 5C5TA 4EN7B 2WNUA 4UBGA 4XJ8A 1G9AA 4B1MA 2CDPA 2JDNA 3B7MA 1JOPA 2P1BA 4NHYA 4DUVA 5D2AA 3N7MA 2W87A 3K4DA 3KV4A 5HXVA 3TB0A 2WWSA 4FFIA 1KDMA 2HWD3 4COYA 4XQDA 1JS9A 1AR62 2NLRA 1SBDA 2HWC1 5EZWA 1UN1A 4OHWA 2VTFA 4LIVA 4B1LA 2B46X 3TNPB 3T09A 2RDNA 1OH3A 2VZVA 2LTNA 4QB2A 5DAVA 5T50A 1JYTA 1MZ5A 4WM8C 5FY7A 2VZUA 1RUD1 4XABA 5JR7B 2CWSA 2ATFA 5F32A 1LOFA 2AEYA 3N9QA 3B93A 1X7NA 1M4WA 2YFUA 4YNIA 4KGGA 5FZIA 3ZSMA 1PGL1 2D3PA 2KD7A 2R061 4PHZA 3VBFA 3WP4A 1FV2A 3NNFA 2CWMA 5FYHA 4B29A 3KB5A 5FPVA 1UOFA 3I2GA 2W95A 1HQWA 2ZCWA 3LFMA 1XYNA 3W21A 3DUIA 2HEWF 3THPA 2OS2A 4GH4C 1EPZA 1SLIA 4TLGA 2WT0A 2P2KA 5C9AA 1G86A 3AZWA 3GF6A 3LDBA 2FBEA 2RHPA 3IAQA 4IL7A 2FQPA 1RUNA 5FZ0A 2RJLA 2ZXQA 4JDNA 1GWMA 4L11A 4W65A 3CDZB 1PO13 5GLUA 1D4VB 2P37A 1LAJA 4N53B 3LSDA 1GU3A 4O61A 1ZRDA 4KG0A 5IAVA 3FHQA 3IDAA 2DUOA 4I02A 4Q4Y2 1RUOA 3N3HA 1H30A 1C5IA 4CCJA 1XC6A 4MXWA 2XLFA 2VMHA 1QQP2 5A7SA 1CD3G 3H1WA 1UY3A 3WG2A 3OGRA 4RN5A 2CV6A 5H9SA 2SLIA 5FLHA 2GC2A 2OPWA 3W20A 1LGBA 1J58A 5FXZA 3C7HA 4QPWA 4M4PA 1F4HA 1W9TA 1X8EA 2ZGSA 2V5YA 3HT1A 1GBGA 4HL0A 4AFDA 1HQLA 3THCA 3OTFA 2QQVA 5IVJA 2OXBA 2XKPA 3N7LA 4NN0A 4LO7A 3FWEA 3JB4C 3VZLA 4CUGA 3T1MA 1LHWA 3KD4A 1TMF2 3WW3A 2VG9A 3NAPA 4MGQA 1VBE2 2W91A 2YYOA 3E97A 1EYBA 2OIIA 2A6YA 5FQ0B 5FP8A 3CKHA 2WFF3 1S0DA 1W6PA 2G9GA 3WG4A 4AEKA 4AQSA 1GZWA 5A3OA 5FFOC 4E2GA 4S2HA 4V1PA 1HJFA 2WZPP 3SC7X 1R64A 4N8MA 5L7OB 4Q4W1 1UOGA 3H8UA 4P02B 4S2GA 1H4GA 1RUF2 3HEIA 4AI1A 5JOZA 2VZPA 4GH4B 1NCQA 2B9UA 1OQDA 3QLQA 2C4XA 4HK8A 2VZ3A 5I0TA 4BU2A 4O9EA 4CCNA 3WW2A 1TE1B 1YC61 3FN9A 2G1MA 2VQAA 3WP5A 4N9HA 4OLLA 3R6SA 1BMV2 2XQXA 4FFGA 4N9IA 1OURA 4D6QA 3U37A 2VJXA 4LQRA 4AEDA 1VBB3 4Y26A 3C7GA 3BB6A 4XBQA 4E4ZA 1HB1A 1BEV1 3LEKA 2JKXA 4MGSA 4SLIA 4LLOA 5BNNA 3BPZA 1QJEA 4W50A 2HBUA 1GP6A 1ZZCA 2VMIA 2VW0A 5C4WC 2A7AA 4COUA 5G04L 4CEYB 4JHZA 4XFAA 5SV8A 3OBZA 3GGLA 1NLRA 1IPJA 4XDQA 2JIGA 4A3ZA 1KEXA 1OMIA 3I2HA 3OBTA 4CP0A 2E31A 3ZYRA 5DDJ3 1BJQA 4C8DA 1GP4A 3OOXA 3IMNA 3V0BB 2JG9B 2XONA 4I3GA 3SCGA 2WS93 4CVUA 2PLV2 1W6QA 3RNSA 2XPJA 4NAOA 1OKOA 4YW1A 1CAWB 2VOXA 3CIHA 2W2IA 1HJGA 2ZHMA 5CBLA 1R092 3M3QA 4AYUA 1O91A 2Y6HA 4IV1C 3CEWA 4JGZB 5FJHA 3UESA 2CU5A 5KXBA 3RS6A 4XFGA 1YFXA 1ZBE3 2JKBA 4FI9A 2ZGUA 4KWLA 3OF1A 5BNOA 1L7LA 5BPXA 4CP9B 4GWMA 5J96B 3T4VA 1PIV2 3LE0A 2Y6KA 1YFWA 1DGLA 2ARBA 1GWKA 3VDDB 5JOXA 1W6MA 4K9SA 4RSUA 3IM0A 2RJKA 5EWSA 5FV3A 2RE9A 3WG1A 1RYYA 1WMXA 4QX1A 3DL3A 3BODA 3GXUA 2QDRA 3WVJA 4F8AA 2BPA2 4YFZA 2AYHA 4GIQA 4DY5A 1EP0A 1RUJ1 1DQ6A 1RUC3 1IG0A 2JG8B 2FDFA 4G9SB 4P9IA 4DY3A 4V2VA 4OFGA 1YO8A 2WZR3 1UPSA 1DQ1A 1KFXL 2HH9A 4L99A 3AZXA 1WUVA 1MQTC 3LIGA 3JD72 5F39A 1RUG2 2Z69A 4ZONA 2KM2A 4AQ6A 3EMRA 2F4PA 2OQ6A 3JU9A 1FYUA 3O1UA 4TZDA 1YFUA 2ES3A 1N3QA 2ZKLA 1W28A 5HBAA 1G7YA 4WV8A 1AR61 1OFSA 4NHXA 4DQAA 2VXJA 4K8RB 1RUI2 4QPYA 5JR2A 1NT0A 3J7NA 2XMLA 3LDKA 4COZA 1Y9QA 1S0GA 3A7QA 4Y4RA 2WYFA 1A8DA 2Q1FA 3AP7A 3FUOA 4FPLA 4XHBA 1Y7BA 5IUQA 2XLAA 1JUHA 1O4YA 3NNJA 4QHOA 4CDWC 1LU2A 2PFWA 2YGLA 1XNTA 2RS52 1QXRA 4AG4A 4CDQA 3T0AA 2G9ZA 1QY4A 2JECA 4KBZA 3UT0A 1DP0A 1BBT2 2YPDA 3NV1A 3OEBA 2UWCA 1H2NA 4LULA 4E2QA 4XCBA 3QH6A 2I2SA 4Q8LA 2IVJA 1LGNA 1F35A 2E51A 2LROA 5IHRA 5JIUA 2XBO2 3PVBB 4Y22A 3A0KA 2DVAA 4DB5A 1DLCA 2QCSB 5LBFA 1V6IA 5CFCC 3HAGA 1Z7S3 1WBFA 1REFA 1SBEA 1YFYA 2KA3A 1LKNA 3DN7A 1PVC2 4YW5A 2XR4A 2HWE3 3IDBB 1VAVA 4MSVA 1CX4A 2EALA 3S5QA 3IN9A 2A5ZA 1WLTA 2XUMA 2VR4A 3JZVA 1OF3A 2W5FA 4JC1A 4WVVA 4YM1A 1O59A 3WINE 2QE3A 2WA4A 4JGYA 2GH2A 4QHBA 5F37A 1ULOA 3EO6A 3KGLA 4MG2A 5HV4A 1NE4A 2CTVA 3OG2A 5A33B 1J83A 4Q0SA 2FDHA 4Q4Y1 1RXGA 4LHKA 2DBNA 4WZCA 3BKZA 1UMHA 1MQTB 2QJVA 3BVCA 2R042 1FAYA 3E6BA 2OUHA 4YW4A 4FAGA 3MUZ1 1JYXA 3BIWE 2JIJA 3PTYA 4JRAA 4R4XA 1CR7A 1DQ2A 1OKQA 3TRSB 2Q5TA 4BOWA 1K45A 2RDQA 2YC2A 1W3VA 2IFWA 5I93A 5FZCA 3BTYA 3T2TA 1EAH3 3ILNA 1U5IA 3LWCA 5CFDC 4XAEA 4PLNA 2VU9A 4A7ZA 4FAHA 1MS1A 4HANA 3B02A 5KC5A 4RQPA 4YPJA 3EBRA 3ILFA 4BZ4A 2XOMA 1PM7A 1QGLA 1JZ7A 4PI2A 1O3QA 3DKQA 3ZYHA 3DKWA 1YQ5A 1RXFA 1TMF1 3MW3A 5FYYA 3W58A 3UGGA 4CUAA 1VBE1 2ZJCA 3UKVA 2BQPA 2XVLA 3GZTB 5HCBA 1QH6A 3P6BA 1CX1A 4N43C 1HDKA 2BVVA 2K0GA 5JI7A 4CA9A 2GMPA 4FP2A 3VHPA 1ZRFA 1DHKB 2GSYA 1DQ4A 3ZSJA 5KR7A 4ZY9A 1LOAA 3U4SA 1RUF1 4HKLA 2WFF1 2VW2A 2XJVA 4LO4B 2NP0A 5CKNA 2VCAA 4E9KA 4QX0A 4EWEA 1CJDA 1QU0A 3ZFEA 4HETA 1F2NA 2XJSA 4YYOA 3VLBB 5K7PA 1SEFA 3TN93 2VNOA 2BTVC 2YHJA 3WCRA 1BMV1 1APNA 2ZHKA 2ZX0A 1ZREA 4EE2A 1JH5A 3MLLA 3ZYJB 4AEMA 3WW1A 4CTEA 5CA6A 4QKBA 3PVEA 3K2OA 5I91A 1SPPA 2R1BA 5JVVA 2DUPA 4J6GA 1S0JA 3WF2A 2GP5A 1R083 1ULGA 2XXZA 4WBBA 4PT6A 1YEWA 2IWGB 5FYBA 3UGFA 2ZEZA 4FCAA 3MO4A 3PU8A 1JZ8A 1SQ4A 3DPRC 3ES1A 4XETA 4XJ9A 5GZFA 4CCOA 1H0BA 4QU2A 4XIOA 3B5LB 3ZKUA 3MLJA 4H14A 1H6XA 2DCKA 2GU9A 3QH7A 3GBGA 2J1UA 4J25A 1RVF3 2DURA 3H1YA 4PIZA 1HQNA 3SMHA 4CP2A 1PNGA 1W2OA 3DXTA 4O65A 3RZZA 1UYPA 2ET7A 3ZO0B 4CRQA 5C3RA 3KCYA 5J37A 3VGIA 1OBNA 1GQGA 1NQDA 2PLV1 3A21A 3HOBA 3I7DA 4LO5B 4Q1PA 4XDOA 2W0XA 4Y4YA 4YM2A 4BM8A 3M3IA 1R091 1WW7A 3J4UH 4FOYA 4Z82A 1W04A 3MICA 4MUVA 4A7KA 1UF2C 3GZUC 5AC92 5ISLA 2VO5A 3URFA 3CZUA 3ZVXA 5FLIA 1QJY2 1PIV1 1K3IA 2LW8A 1DDLA 1CGPA 4X6RB 1QHDA 3I2JA 4LMFA 5FYVA 3VBOC 3VBUC 2Y60A 2IXLA 4CCMA 1LESA 3ME2A 1TME2 1X82A 4OULA 4AVCA 4AVTA 1EY2A 1S2KA 5FZ7A 4LBJA 3ZXJA 3ZDVA 3WZ1A 3O1OA 4XC9A 3AP4A 1WA6X 2PHWA 4KI5M 2GNMA 2VCBA 3CO2A 2Y6FA 1TVGA 3C2UA 4XF9A 3RPQA 3SCHA 4C1WA 4WVZA 3V0AA 1C8M3 1G8WA 2YB7A 3T2OA 3WP6A 2D93A 4LLFA 3O7OA 4E8DA 3AL5A 4LBLA 4UW5A 3E1F1 4TXWA 3MIEA 1IS3A 3JD71 3P3PA 4HG6B 4NOTA 3IMMA 4UYBA 3UGHA 2JDZA 2BUKA 2XUEA 4YVWC 5C3SA 5JWPA 5CB7A 4FFFA 2D5HA 3NKGA 1MACA 4OVEA 1VRH3 1AYN3 4UFJA 4CDUC 3QOPA 3AP5A 3DPRB 1QEXA 5T5JA 1IKQA 1AR92 1H8TC 4MZUA 1MVEA 1RUI1 1F15A 4AI8A 2YXSA 3NRUA 4LUKA 1JOBA 3C7EA 1AJOA 1UMZA 1WMDA 4HPKB 1AZDA 5FQ0A 1O5UA 1HV1A 4MOAA 5FTTC 1XU1A 2B7YA 2VAUA 1SG3A 1L7RA 4IE4A 4BK5A 4DNYA 4MGYE 5IJRA 1J3RA 2JD4A 3PVNA 5FK8A 5A7NA 3TYJA 3SEPA 5L7OA 4YWAA 3K75B 3WDVA 2AC1A 1BBT1 4LJHA 1YYNA 2K2SA 4GH4A 1UZZA 1XNCA 1UYXA 5DG2A 4QKNA 1PMIA 2R073 5IK4A 5AFBA 2XBO1 4IEQA 5FPAA 5FOBB 3LSEA 2NZ9A 1DGWX 3OPTA 2W94A 1I5ZA 1JYVA 1BYHA 5LBEA 2I07B 3NWKA 1UY2A 4JZRA 3ZXKA 1PVC1 2CGOA 2YU1A 3EB7A 5FK7A 3NV2A 2OZJA 3B69A 2DVFA 3D4KA 1W03A 4A6SA 4D7SA 4F83A 1PZ7A 1FOD2 3VKOA 5CYYA 1W05A 4S2DA 4DEQA 3WNXA 5FDBA 2PYTA 2JICA 1QIQA 3O1TA 3I3DA 1C28A 4IW3A 4CEYA 5FWJA 3H3LA 4YZ1A 4NRQA 3UK9A 2J22A 4A4AA 3OYWB 4BPZA 3BCWA 1Q8OA 2R041 1NE6A 3SH3A 4BE3A 4IETA 5FMOS 2BBAA 3FC0A 1UZ0A 2BVBA 4Q0QA 2XVKA 2JG9A 4JX0A 5H9PA 3V0BA 4FBFA 3AYEA 4JKMA 5LY1A 3D0JA 1CAWA 2D7FA 1H2KA 1IKPA 1W39A 3AB0A 3AVRA 4CDUB 2VTXA 2A1XA 3L2YA 4ISQA 4JGZA 4LO8A 4Q4X2 5EQUA 1Q3EA 4HT1T 2ZAHA 4QDRA 5JXJA 3AMNA 3GM8A 5BYNA 1UIKA 3B01A 1FPN3 3H0OA 4CP9A 3BTZA 4WM7B 3TEWA 2R16A 3VDDA 4AGGA 2A3YA 2DCYA 4XF1A 4EJRA 5FZEA 1VALA 5E16A 2MPFA 2QVSB 5KXEA 2UY9A 2VOKA 4XVHA 4XMIA 2Q8EA 1ZZ7A 3ATGA 3MHZA 5LK5A 3NJZA 3AFKA 4YVSB 3ZYPA 2A6VA 1OF4A 1NA1B 3JB8A 1UKGA 2W1UA 5I8YA 2JG8A 1AL23 4GMP1 4D7YA 2HWB2 1S0FA 1YCIA 2P4EA 1GSLA 2DDUA 2GC3A 4HVRA 4L92A 1ENQA 2WABA 5FO8B 4LA2A 1PK6B 5FXXA 5FY5A 2GNDA 1GQHA 4MV2A 3CQOA 2VVDA 4FXGB 2D6MA 1ZVFA 2ARXA 2DTWA 5GKAC 2ORZA 2WAOA 5IW0A 1OA3A 5E88A 4CYDA 1UYZA 1F9KA 4UF0A 1PX4A 2ZX4A 3H7JA 2D6KA 1WCKA 4Y33A 2A70A 1AR83 1W2UA 1JHJA 1ZNPA 3VD4A 1OC1A 1KJLA 2ZHLA 4QPGA 2EXIA 2RMU3 2O1QA 4A3XA 3RVHA 4PF5A 3ZSKA 1TZOA 4CP1A 1V9U2 3VD3A 1D0GA 5JOWA 5LBCA 1H1IA 4CXYA 2F6BA 4QQHA 2C9AA 3VBRB 4OYUA 1U12A 4LE4A 1KITA 2KXLA 4XFCA 4P9XA 1YWKA 2PQQA 4DINB 3ZYBA 2VOVA 4EN8B 1GNZA 1RMU2 5I0DA 1DLLA 4HN0A 2XL7A 2FD8A 3OUHA 3CJIB 5FZBA 1QJX3 1Y9MA 2G19A 2ZGMA 4QT6A 5A3NA 1ACCA 1D2SA 4YW7A 3SISA 1UY4A 1CZVA 2R49A 4XUTA 4LTAA 3RMXA 4OHVA 5FPXA 3Q9OA 3UJOA 1RUE3 4YM3A 3TEZA 4K40A 3AM2A 4WZFA 4BMEA 2B4KA 2YBSA 1WCUA 2WNVC 3ILRA 4Q4V2 5JIAA 4Q8KA 5AC91 5M0TA 1REDA 2J1AA 1W90A 3KV5A 5J36A 4XJUA 1QJY1 4KWJA 1SFYA 4NPMA 4LKDA 3OGGA 3ST7A 4BHPA 3MPBA 1LHVA 1DGWA 1YUDA 3VDCA 1ND3C 3NNMA 2K9ZA 5LA2A 3T2QA 1UNBA 2EXHA 3UL2A 1X9TA 2CGNA 4GJYA 1VBD2 1TG7A 1LOBA 5IATA 1MVQA 2BOIA 4DUWA 5C6CA 3B00A 4Q0UA 2J1RA 2VC9A 5A33A 2NM1A 2UWBA 4BQ2A 2VZOA 3DYOA 3I4IA 3VKMA 2BGPA 3PNAA 5FO7B 4UW6A 3ZPOA 4IV3B 3MF9A 3WXPA 2YDEA 3VD9A 2E9QA 4NIAA 3AXEA 4RR3C 2HBTA 5KHHA 3HJRA 4ZS2A 1HRI2 4MGKE 4HBNA 4KU8A 1J84A 1VR3A 2JJ6A 1FX5A 1ZBA3 4XUOA 2WT1A 3HNYM 4L9BA 1URXA 1NXMA 3HVDA 3IDCB 2ZEXA 4CEWC 2ZEYA 3BUCA 4HKWA 2QQKA 3POSA 4RFRB 1RINA 2C24A 4PDWC 4RS5C 3WF0A 5GLZA 3GJAA 3H1MA 3MGUA 1KRIA 4FP3A 2RDRA 1DQ0A 1SLLA 2VMDA 4QX8A 3S0MA 5A7PA 3EQEA 4PQ9A 4CXWA 1BZWA 3O12A 2RJ2A 5IT6A 2A71A 4LOSA 4ORFA 4L8QA 3KT7A 1OPMA 2I45A 2WBKA 3PUHA 3V65A 3ZXFA 2WNVB 1IGOA 1MEC3 2RV9A 4XF0A 2DUQA 1CZSA 2D3SA 3SNMA 3VZJA 5FLJA 4EQVA 1HW5A 2ADDA 3P5BA 2EAAA 1B35B 2E32A 3BPSA 4Q26A 5FAXA 4BQWA 1M06G 4IEYA 5IK8A 1OLMA 1QOOA 3ITQA 3OEAA 3WQ0A 4XFIA 2AH2A 3U0ZA 1OD5A 4XEZA 5KXCA 3FHAA 1KFUL 2R071 5FZDA 2XHKA 3LPFA 1HN0A 4E4SA 2RM22 3UV9A 1YJKA 5IFPA 5JCTA 5GLWA 5JZGB 1NZCA 1WW4A 5IVBA 1FOD1 1H9WA 3CZJA 1Q43A 5F3EA 3LA3A 2QQMA 5A70A 2W3JA 4LT5A 2HWD2 2QQNA 3L2HA 2WIIB 5FYCA 1C3HA 1K5MB 1QH7A 3MIBA 4XTPA 3VBSA 1YI7A 4Q27A 4XZPA 4ATEA 4RR3B 2Y33A 2ZOEB 5D8AC 2LRPA 5CFDA 4FPEA 5E1RA 4EYUA 4GB33 4INDA 4XJAA 3BALA 3G7DA 2WINB 3I3BA 5FMBA 3WUCA 2YPJA 1OQEA 1DGRN 3M70A 1HX6A 4Q4X1 2W46A 1JYCA 4TTGA 1N1TA 2V09A 2GN7A 3K4ZA 3K48A 4XF3A 1AR73 3H9AA 3I8TA 4IE0A 1DZRA 2VMCA 4OHZA 4ISRA 4QB6A 3GDBA 3AMQA 1NY72 1WD3A 1H6YA 1QNWA 4CU7A 3ZX7A 3MZHA 1Y4WA 3OUJA 2DU1A 3DV8A 2W1SA 4AVAA 1PO12 2HWB1 3AJYA 3VV1A 3LA7A 5KXDA 3MIDA 4MHRA 1F5FA 5K0UA 5FWEA 5LWBA 4DXSA 5A7QA 3ZN5A 2BP6A 5A3UA 3E6CC 1D4M3 5C3PA 1SFPA 1RTVA 5FYSA 3I59A 5FY0A 3ZFFC 2R6QA 1TEIA 2Y6LA 2ZGRA 2WJSA 5LCWL 4Z92B 4Y1VA 1RHI3 2X10A 3PIGA 3WF3A 1UKRA 2WAAA 4YGDA 4AFCA 4CCCA 3ALQA 2XWBB 2E6VA 4K7JA 4NVPA 1WWYA 5D21A 3USUB 1VMFA 1G9FA 1F8VA 5A3MA 1VP6A 2W1QA 1UO9A 4WM8B 2WN2A 2E53A 1ENRA 1CAUB 2JX9A 3DF0A 3POGA 3Q8FA 4YGCA 2BFUL 1V9U1 4JDOA 1WLDA 5FP4A 3VB9A 1AXKA 2WRAA 1ZA4A 4HPKA 3UKTA 1FNZA 2FMYA 3ZIWA 1Y43B 3RGBA 2BEOA 2BWCA 4N90A 3RMYA 3KS7A 1GUIA 4RA0A 3FJSA 3ABZA 3GALA 1WMEA 1PVXA 1RMU1 2Q8OA 2VL4A 3KQRA 4CZSA 2WFF2 3S7EA 4I2OA 4FXKB 2ADEA 4QQPA 4NIDA 1S2EA 4ZU5A 1QJX1 2VUAA 3RDIA 4Q4V1 5G05L 2ARCA 1KS5A 1U5YA 3ZLIA 4YZ2A 1JYIA 1OA4A 3NO8A 1LNSA 4PIYA 2QQOA 3LAGA 1IPKA 3KF3A 4LHSA 5LA0A 2HJIA 1CPMA 1YLLA 2ERFA 4MGZE 5FR3A 2PHLA 1J3QA 1VBD1 2R32A 1VBB2 2XGXA 2J42A 1SLCA 5FP7A 3JQXA 4D94A 5A3WA 5KHIA 3MW2A 1ODNA 1E5IA 4UAPA 3OYWA 3D3AA 3AMHA 1GQPA 3ZFFB 3ZM8A 2JDKA 4IDZA 2VZQA 4EROA 1Q8SA 5ANNA 5C8CC 3UYJA 1WD4A 3GCXA 3IT8A 4UWDA 3LEIA 4D69A 1XE0A 3JCIA 2VMGA 3I3QA 4DOUA 4XCAA 4BJ0A 4JV4A 1RITA 3BTXA 4E8CA 2VGDA 3MI8A 2VUCA 3VUOA 4Q5OA 3PVOA 4XFHA 5DDJ2 3RJ2X 4YW2A 4AI3A 2YC0A 3POWA 1HRI1 1W06A 2AGSA 2RS33 2Q30A 2WS92 1OFNA 2VQ0A 4ZXKA 1YQ6A 5KWRA 1RC6A 1JI6A 3OGSA 2DV9A 2NPIA 2PQSA 3A0NA 3OUIA 5LB6A 5AFEA 1QNYA 2P6CA 3NW4A 4WM7A 2QUOA 2YUEA 5L9RA 4CCDA 3QCWA 4XZUG 4XHXA 3BIEA 2V4AA 1ZBE2 5FIXA 5ABJA 4UFIA 4PCRA 4YVSA 1POV1 3VKLA 1OOPC 3OPWA 1NA1A 1BK0A 2EIBA 2DYCA 5K8SA 1NX9A 1VMJA 3JBG3 2C0ZA 3KQ4B 3RYRA 4B3NA 3CJXA 2EIDA 1PGSA 3AKQA 3JUUA 1S2BA 5IVCA 1C1FA 1NKGA 3E5UA 3E6DA 4OZXA 1PK6A 1N1SA 4XUPA 2VZTA 2DCTA 4YG6A 1D2QA 5F5IA 4XF4A 5FRAA 3W5NA 2ETEA 1RUC2 1WCQA 3WQBA 1MPXA 4RHV3 3AZVA 1X8MA 2DVDA 5A1LA 1Q8VA 3I2IA 4IQPA 2R1DA 5DUVA 2WZR2 4CDXA 5JMOA 2TBVA 2B39A 4HONA 4QGMA 4AK3A 3A23A 3ETPA 4AHXA 2CYFA 2WSUA 1AYM3 1DF0A 2PMWB 2RM21 2WWJA 1I9RA 2GALA 2VZRA 3K46A 4MGIE 3K3NA 4CUBA 5C3OA 5C4WB 5C71A 2E7QA 1EPWA 3ECQA 4KWKA 3AMMA 2GMMA 2QZ3A 4RYDA 4YG0A 3VL9A 1OT5A 1ND2C 3VBRA 3S57A 2HWD1 4Q1RA 5F5AA 3TBDA 4QKDA 1SHWB 1UQXA 1WMFA 5BUVA 2Y0IA 3H50A 5FPBA 2F17A 2RG4A 3CJIA 1ZYBA 3LOIA 4IE5A 4YW6A 5CKQA 2D6PA 2YG0A 4IV1B 2PAMA 4DUXA 4JCKA 1OVPA 2YMZA 1ZZBA 2CAUA 2B42B 3VDAA 1OSGA 4ARYA 5JSRA 1MR5A 1IS5A 2D5FA 2UY8A 3M3EA 5IFTA 4I09A 5FYMA 1QDOA 3MYXA 4GALA 3EHKA 1UXXX 1V0AA 3NSTA 3I49A 5FXWA 1QWRA 2VMFA 2D97A 3ON7A 4LPLA 5BNPC 5DG1A 4R52A 5FBJA 1QJU3 2QNKA 1POQA 3AKRA 3OY8B 3U75A 3UKNA 3WDXA 2BNMA 1OOPB 4COWA 2A73B 2QZ2A 3HNMA 2O8OA 1Z7S2 2CSGA 5IVYA 2RR13 4BH9A 1GFF2 1NY71 3HR9A 4FO9A 1D0HA 1AR71 3OBAA 4NHKA 2HWE2 5GLVA 3RRDA 1UU6A 4XE9A 5FZOA 1CIWA 4AL9A 1WLCA 2VVEA 3APBA 4A45A 5F3IA 3RZHA 1BHGA 5IK5A 1PO11 5I0UA 4PBOA 5DQ0A 2AEZA 5E8AA 2ZBJA 4IEVA 4LNVA 3RYKA 3TWIA 2FDIA 2WNUC 2WUHA 2HYXA 4H2AA 4R9BA 4AHZA 4KMQA 4DO0A 4IV3A 4J1XA 3UNPA 2WL1A 5I0RA 3ASIA 3BGAA 2JWPA 4IEOA 4DIQA 1AUYA 2HEVF 2BNOA 5FZKA 2QQJA 2P3IA 3POEA 4AZZA 1FT9A 2ZGKA 4C0HA 1AHSA 2WA3A 2VZSA 3S30A 3VZOA 4BQ4A 5BXXA 1GNHA 1ND2B 1R1A3 4QPIC 4UOJA 5DZFA 5FPZA 3RWNA 1GOHA 3FLPA 3PUQA 1EAH2 2D6LX 4LE3A 1LOFC 3OSDA 4CDWB 5FOJB 1LJ7A 1SZBA 3M3OA 4P14A 3ZDSA 2FCVA 3K51A 3VBFC 4AI9A 1UZYA 2VNRA 5T5LA 5LRRA 5ERLA 4MLOA 2EIGA 3MV11 4LK6A 4LITA 4BQYA 3CNAA 1OHFA 2FZ1A 2ZGOA 2R7EB 4ZS3A 4LKSA 4PQQA 3ACHA 5AVPA 5CFCB 1VIWB 4IEWA 5I8TA 2NMNA 2TNFA 5C9AC 4CPBD 5EFUA 4H7MA 2JENA 1B35A 1A78A 1MS0A 4Y1ZA 3ZFGC 3N7KA 4EV0A 4Y20B 3KCXA 1Y3TA 5A7OA 1W2TA 3C7OA 2V5DA 3FFZA 2A3XA 4MVTA 1US3A 4O9GA 1RIRA 4C91A 5JXHA 3TN92 5JZGA 5CG8A 5ANQA 1VBC3 2XQRA 3AP6A 4IEZA 3PL0A 2DU0A 3ZSEA 2J7MA 5ACA3 2WNOA 4W6WA 3ZXDA 1HRV3 1VBB1 2IXKA 1CJPA 3U14A 2VNVA 4QKFA 1XNBA 4JKKA 1JMUB 1K5MA 4GKXA 2V72A 2YZ4A 3LB9A 3U1XA 4BK4A 1R082 1MS9A 2MEV3 2EIEA 5DUUA 1DCSA 3T0BA 3S6PA 2BBVA 4RR3A 4KU7A 4Z1VA 2D98A 2J1VA 1X50A 3HQUA 4CCEA 1VMHA 3ES4A 4TN7A 1RVF2 4Q2FA 5DUXA 1VBA3 2Q0AA 3D8CA 2CNAA 1CZTA 3Q8EA 5DDJ1 5LK7B 3WDUA 1HXS3 1W9SA 4QPIB 4UFKA 1STMA 2WS91 3MF6A 3R4UA 1O3RA 2XB6C 2D44A 2KR2A 3B94A 1SCRA 3LOBA 3ROUA 4ZXEA 1ZRCA 4PI0A 2CAVA 1NXD1 3RWKX 4CU8A 4N43B 5LRSA 4Y5Z0 5EJZB 2IVIB 4I0BA 1ZBE1 4BIFA 1ULEA 5FKCA 4MGTA 1HV0A 1GZTA 3FUQA 2YU2A 4N53A 3N36A 3RZJA 1JZ4A 2PHUA 1NCQC 4GZ9A 1N3PA 3NJYA 1O4ZA 1XJAA 5C9AB 1V6NA 2XJQA 1C5HA 4Q29A 1AJKA 2N7GA 1RUC1 2NYYA 3FL7A 3IBMA 1UZWA 3ZFGB 4DXTA 2JDHA 3FBMA 1C8M2 2R30A 3PJQA 1ZX5A 1JBCA 2WZR1 3M1HA 4ZPIA 3S7IA 3WDYA 3X29B 1PX3A 4CE8A 4XFBA 4P9WA 1I1EA 1I5PA 1DGRA 2JB4A 5LA9A 3MUY1 5K4LA 3QACA 4WM8A 5IWFA 4R9AA 1CAUA 3WNKA 3MDPA 5LATA 4M3CB 1UYYA 2JDPA 3M8LA 4MXWB 2JDMA 1COV3 3C7FA 4XBNA 1OVSA 5KC6A 1VRH2 1AYN2 4XW3A 2PAEA 3T08A 2GP3A 1QMJA 4Q0VA 3ZYIB 3NVCA 3J26N 3OCPA 1T6BX 1DZQA 4ITCA 1W2NA 1JZ6A 5DZGA 2OPKA 3LCPA 5FZ8A 3LDRA 2Z42A 1NCRC 2VCCA 3WNLA 2P17A 5GZGA 2JDUA 2ZZQA 4N7UA 5CZKA 5FYIA 1CIYA 4BQ3A 4W6YA 4NWVA 2JB8A 1O4TA 5E89A 5BNOC 5SV5A 3FHIB 2WSVA 4W6XA 2XDVA 5J1XA 2VUJA 2NN8A 2WZEA 1RJ8A 5T52A 1MS3A 4Z2WA 4IUGA 3VBOB 1FNYA 4NRPA 3VBUB 5KHJA 2R072 5FYZA 5F2SA 1FMD3 1PO23 2DWRA 3PMEA 2OW4A 3J8F3 2E7AA 4AFAA 3O0WA 1HIXA 4FQZA 1SMVA 5EXOA 4GWIA 1Z7S1 4GAZA 2JE8A 2ZMNA 5HI0A 4K6BA 2HWE1 4R4ZA 3H42B 2YBKA 3R05A 5KHKA 2W1WA 2Z4FA 3ZN4A 1VE0A 3ZR6A 4ZZ8A 4YRDA 4D6RA 4D7TA 2HWC3 5EV7A 4W8JA 2X5IC 4OHXA 4QX3A 2TEPA 3SH4A 3N35A 2MHFA 3N9PA 2HWF3 4FT8A 4YVWB 5F3GA 4ARXA 1RUD3 3E5XA 5A6XA 1BCXA 3GBFA 2UYAA 1HKDA 2R063 3WNPA 5C7GA 2A6ZA 2J1TA 3HD8B 1ULCA 5LA1A 1H8TB 5LZ6A 4JAAA 2W08A 3ZSLA 1VPHA 3AYDA 2OKXA 3VHOA 1J59A 1KDKA 2W92A 2XWJB 2X53S 3AC0A 4LIUA 2PHTA 4N7IA 4X8PA 3AK0A 3R0RA 3O1VA 5F3CA 4GXLA 1OLRA 4OMDA 3H8OA 2ZACA 5IVEA 1EAH1 4BISA 4UFLA 3WDWA 4BLJA 5IK7A 1WW6A 5HCAA 4I30A 3ZIXA 3ZMNA 1FPN2 4K1YA 3V56A 1NCRB 3LIHA 4CDQC 3HT2A 3TEXA 2O14A 1MZ6A 5L36A 3VKFC 4R9CA 1U5XA 4META 3H7YA 4P9YA 2X05A 3PUSA 5GJ6A 3IPVB 2B5HA 3WCSA 4JDMA 5BNOB 1C4RA 4E4HA 1ULFA 2EA7A 4LXLA 3ETQA 5CEHA 5DMYA 2JD9A 4COVA 2E33A 2R0FA 1F5JA 2XJUA 1W9WA 3I54A 4LEJA 3WF4A 5EYYA 4X8NA 2ZA9A 4IEXA 1AL22 1ULDA 2B9VA 3AMPA 4LO6B 5FZFA 1ASJ3 1W8TA 1X33A 5FZAA 3UETA 2K46A 3CHXA 4M0HA 5F9TA 2QQPA 3TNQA 3IIAA 1DYOA 1EV13 5F2WA 5H9RA 1GKBA 2MNGA 3KSCA 3TAYA 1IZ3A 2W52A 1OD3A 2GNTA 1XQNA 2VH9A 1CN1A 3ORJA 5C4WA 2ZMKA 2FHRA 2YV8A 4JGYC 3TN91 4I0AA 1ONAA 4YW3A 5EJ1B 3I2DA 4HMZA 2Z5WA 2EXJA 2P3KA 3N9OA 4NO4A 4UW3A 1W8UA 2RS13 2X5IB 1AR82 3INAA 4I3PA 4R8HA 4FPCA 2RMU2 4AGRA 2VPVA 1WGPA 4NIIA 1R081 5DZEA 3VD5A 2OX0A 1VBC1 4I0WB 2P34A 3AX4A 2BGCA 2HLEA 2A6WA 2XH6A 4B7KA 4CCLA 1HB2A 3BU7A 4IV1A 2GN3A 1O3TA 2ZEWA 4AF9A 4XUNA 1RVF1 2ID4A 1CVNA 1C8NA 1QJX2 4Q4W3 4RQPC 3RI8A 3ZYFA 1FATA 4BCUA 3VZKA 4BDVB 4H3WA 3RJRA 4P08A 2FZ2A 1JXNA 4JQTA 4ZZ5A 2VBDA 1RUE2 4DFSA 3MFCA 1H1MA 4GKYA 4AE2A 5C5UA 1MS5A 3GCWA 5FZLA 3WY6A 5CAZA 2BDRA 3MIFA 1KD7A 4AQ2A 3ACGA 3OY8A 3W5MA 5LEJA 3GNEA 1Q8PA 2H6BA 3TEYA 4QX7A 4OI4A 1DG6A 1V6OA 4AVVA 2BRTA 3VD7A 1XYOA 3LEMA 1OPOA 3H8XA 1BEV3 3LEGA 2QDNA 2PHXA 5DPNA 2AENA 1ST8A 1NLSA 3D0SA 4JKLA 1MQTA 4FTSA 4ZU4A 3ZFEC 1DFQA 4K3UA 2XJRA 1XNAA 2IUWA 5C33A 3SCFA 4F7ZA 2VD7A 4TSVA 1GZ9A 2BZDA 2D6OX 3RYPA 2PHDA 1W0NA 2JXAA 1C8M1 1UOBA 4XACA 3U78A 3OJBA 3MEPA 3POYA 1U5ZA 2BOJA 1VB4A 3KT4A 1EUTA 2PN5A 2ZTNA 5T54A 1DU3D 3NKTA 3RI9A 1ND2A 1A6CA 3PDQA 3ZN6B 2RDSA 4A44A 1AX2A 2WWUA 4OI1A 1J1TA 4CDWA 1AF9A 1W3XA 1VRH1 1AYN1 1ZBA2 3DYPA 4BXFA 1UZVA 3D6EA 5CISA 2W68A 2ORXA 1H2LA 4CPBA 3WQ1A 1CAVB 4WVWA 3HPNA 3HN1A 1VAMA 3B9IA 2X09A 3SXWA 2F4LA 4DXRA 2RVAA 3MPPG 4UXAA 3AL6A 2ZX2A 4FPKA 5CFCA 3I3EA 2WO7A 3FZ3A 4EN0A 1RUJ3 3B3QE 4P5YA 5CIRA 2VZ1A 2VCMA 1KJRA 2VQUA 1K42A 5FZ1A 2BFUS 3CMGA 4XUQA 3R4SA 4EWAA 4FTBA 1ND3B 5HCHA 2BJSA 2LS6A 1MEC2 4PF1A 4Y20A 3I3MA 1UWWA 2WQZC 3KM5A 4LHLA 3N4MA 5FZGA 4AVSA 3O14A 4XURA 5A80A 4B4RA 4XJZA 1BK1A 3ZXGA 3ZMOA 2GC1A 2Y26A 3PUAA 4XILA 1RGSA 2YY1A 1BQPA 4GWJA 4QXKA 1JOJA 3BOWA 3MV01 3O5SA 1EUUA 2WDBA 1QXJA 1AR63 2DBIA 1T6GC 4QD2A 3MIGA 4Y5TA 4QGNA 3ZPYA
chains in the Genus database with same CATH topology
4CP9A 4LK6A 4YWAA 1GWLA 1V0AA 1OKOA 1W8TA 1W9FA 2KR2A 2LRPA 2WYFA 4LJHA 4YW7A 2C24A 2JWPA 2K46A 2Q1FA 4BQ2A 1W8WA 1HN0A 4BQ5A 4LKEA 4BQ3A 1UOJA 1WCUA 1L7LA 4CPBD 4CP9B 3ORJA 3ZYFA 1OH3A 3UT0A 1W90A 1WZXA 3F95A 3ZYHA 4BQ4A 4YW6A 2O14A 4CPBA 1GWKA 1W8ZA 4AL9A 4LKDA 1GWMA 1W8UA 2LROA 4LKFA 4LK7A 1WMXA 5D21A 3ZYBA 2VXJA 4A6SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CP9 A;  4LK6 A;  4YWA A;  1GWL A;  1V0A A;  1OKO A;  1W8T A;  1W9F A;  2KR2 A;  2LRP A;  2WYF A;  4LJH A;  4YW7 A;  2C24 A;  2JWP A;  2K46 A;  2Q1F A;  4BQ2 A;  1W8W A;  1HN0 A;  4BQ5 A;  4LKE A;  4BQ3 A;  1UOJ A;  1WCU A;  1L7L A;  4CPB D;  4CP9 B;  3ORJ A;  3ZYF A;  1OH3 A;  3UT0 A;  1W90 A;  1WZX A;  3F95 A;  3ZYH A;  4BQ4 A;  4YW6 A;  2O14 A;  4CPB A;  1GWK A;  1W8Z A;  4AL9 A;  4LKD A;  1GWM A;  1W8U A;  2LRO A;  4LKF A;  4LK7 A;  1WMX A;  5D21 A;  3ZYB A;  2VXJ A;  4A6S A; 
#chains in the Genus database with same CATH topology
 5T55 A;  5C3Q A;  4UBH A;  2VXR A;  3IB3 A;  1PZ9 A;  4XDP A;  3HBK A;  4PLM A;  3WW4 A;  3OGJ A;  4DXZ A;  1AX1 A;  4BQ1 A;  1SPP B;  3MBW A;  5FY9 A;  1XRU A;  5A32 B;  2WO3 A;  3HMY A;  1XSR A;  4YM0 A;  5FKB A;  3WNN A;  2W9X A;  4Y1Y A;  4IEU A;  3C8X A;  3D5O A;  1ULP A;  1YQC A;  4FPH A;  4M3C E;  4XOG A;  2Y34 A;  3VZN A;  4QPI A;  2HWF 1;  5CVR A;  1FV3 A;  4AEJ A;  3L9J T;  3PU3 A;  2E7T A;  4AFB A;  1LRH A;  2ZS6 B;  3QBQ A;  4PDW B;  4RS5 B;  5FMC A;  3BI3 A;  1C1L A;  4GB3 2;  1W99 A;  2R0H A;  3NNG A;  2C9K A;  2YBP A;  4AXO A;  4HOO A;  1UW8 A;  3I97 A;  4N43 A;  4NPR A;  4FPO B;  2O8Q A;  1QKQ A;  2TUN A;  4LA3 A;  5KHG A;  1FPN 1;  1AR7 2;  1IOA A;  1SLA A;  2XL9 A;  5L7O C;  3POF A;  3PLQ A;  1S0E A;  4QB1 A;  4BIO A;  4GJZ A;  2QKD A;  5J3U A;  4RGK A;  1X9P A;  4KGQ A;  1V6K A;  2P3J A;  3DCQ A;  4UW4 A;  1IHM A;  4FOW A;  5A3T A;  5JXG A;  3ACF A;  3SIT A;  4MHU A;  1JHN A;  4AR2 A;  4YLZ A;  2IXH A;  1UD1 A;  2BWA A;  1CES A;  2DFC A;  3ZFG A;  5F6K A;  1AL2 1;  4UFM A;  1IS4 A;  2EF6 A;  1S4C A;  3U10 A;  3VDB A;  4KBB A;  4Q4Y 3;  3DGT A;  4QAW A;  1V00 A;  4JRL A;  3HIF A;  1D4M 2;  2QBX A;  4L2N A;  1QQP 3;  3Q8B A;  4G4F A;  5F5Q A;  4CU6 A;  2VOW A;  3DPR A;  1H4H A;  1E5R A;  1ASJ 1;  2GH8 A;  2D6N A;  4XMA A;  1H1A A;  1XB9 A;  3V0A B;  1A8M A;  1RHI 2;  2AUY A;  5GM0 A;  4M3C A;  4CEY C;  4LHN A;  4XBL A;  1EV1 1;  5FMD A;  4P9G A;  1GOG A;  1AR8 1;  4DS0 A;  4TWT A;  1GR3 A;  3S5A A;  4OI2 A;  2B45 X;  1YRZ A;  2RMU 1;  4XQ4 A;  1LOD A;  5D8A B;  5A3L A;  3DEM A;  2BGO A;  1TMF 3;  2JG9 C;  4E4D X;  5LAS A;  5IAX A;  1VBE 3;  2RS1 1;  4IE7 A;  5L19 A;  5A6Q A;  3AKS A;  3AYA A;  4GMP 0;  4JGZ C;  1ZA7 A;  2WYS A;  2Y6G A;  1UU5 A;  1S0B A;  3SQO A;  1OUS A;  4YFW A;  5FBZ A;  1JU4 A;  1IS6 A;  4LOR A;  5JMC A;  4QMA A;  1OQ1 A;  1Q5O A;  1RUF 3;  3WR0 A;  4B4P A;  3VBO A;  4KQ7 A;  3VDD C;  3VBU A;  4HN1 A;  3KV6 A;  3NV4 A;  4BWO A;  1RUE 1;  1IPS A;  1O5L A;  1W2A X;  3VBH C;  1WW5 A;  2P5B A;  5F6L B;  3WEZ A;  1W6N B;  5J48 A;  5A3P A;  4OCT A;  3KF5 A;  1VAK A;  1LTE A;  5K9Y A;  5HPO A;  2ARA A;  1PNF A;  1L7Q A;  3AJZ A;  2JG8 C;  1CAX B;  3KMH A;  1XBF A;  2C5D A;  5TSW A;  4E27 A;  1GZC A;  3NMB A;  4M4R A;  1W9Y A;  5C8W A;  4Z8B A;  2IZW A;  1PM4 A;  1AL0 G;  3OB8 A;  4AW7 A;  3POJ A;  3IZO A;  2AZ5 A;  2XHN A;  5A7W B;  5FY8 A;  2VM9 A;  3H3U A;  4YVW A;  3MLK A;  3RQ0 A;  1LU1 A;  4A6O A;  5HV0 A;  1NYW A;  1GNY A;  1N47 A;  2VEC A;  4QM8 A;  1JW6 A;  3A4U A;  4RGA A;  3LD8 A;  3U07 A;  3BYW A;  4CDU A;  4I01 A;  4M00 A;  1MS4 A;  1H8T A;  4QPG C;  3LKJ A;  1YXW A;  1SCS A;  4XAA A;  1LB2 A;  3DEC A;  3ACI A;  1LOE A;  5FZM A;  2OA2 A;  1H9P A;  1KXG A;  2PLV 3;  2XG3 A;  2YRO A;  3N7J A;  3ZKY A;  4IEP A;  1VB2 A;  5AVA A;  1R09 3;  2ENR A;  3THT A;  4L97 A;  2PHF A;  2RS3 2;  3HQX A;  5JUV A;  1ZBA 1;  3KGZ A;  3ENR A;  1NCR A;  3RSJ A;  3IDE A;  1PIV 3;  2OVU A;  1W9F A;  1RB8 G;  3EXU A;  4NJ4 A;  1NUK A;  1W6O B;  1DYP A;  1WKY A;  2LM3 A;  3IPV A;  2V73 A;  5FUN A;  2C1F A;  4LBQ B;  3VZM A;  1YQ2 A;  5T5P A;  2FDK A;  3IAP A;  3AKT A;  4ASM B;  1QJF A;  3MW4 A;  4AWD A;  1LOG A;  3F95 A;  4PJY A;  3HBZ A;  4GWN A;  4RD7 A;  3JBG 2;  2OYZ A;  2ET1 A;  3GHN A;  4FFH A;  3GZE A;  3VBH B;  3T3Y A;  3BU0 A;  2LUW A;  3FE5 A;  4LBQ D;  3W9A A;  4ES9 A;  5JDB A;  1S1A A;  2JDY A;  1SDW A;  1CPN A;  1GMM A;  1HB4 A;  1MEC 1;  4LR4 A;  1F31 A;  2NMO A;  4BYY A;  4RHV 2;  1QF3 A;  4IES A;  4Y1U A;  5CU1 A;  1SDD B;  3ZXA C;  1LHO A;  1LOC A;  2WQ4 A;  1GWL A;  1RUG 3;  3JD7 3;  1REE A;  3ACL A;  1LR5 A;  4X6Q B;  5D1I A;  3WOG A;  4RL7 A;  1AYM 2;  2X5I A;  4YZ4 A;  3FBY A;  5FJK A;  4OQ8 A;  3VHN A;  5JAX A;  3EYP A;  1O8S A;  5C8C B;  1JZ5 A;  3IKW A;  4ATF A;  2OZ6 A;  4UF0 B;  4HKO A;  1RUI 3;  4IGQ A;  4XJW A;  1WLW A;  4FSJ A;  2E63 A;  1MS8 A;  2WLP A;  2CHH A;  3K4A A;  4QGL A;  3EJK A;  1UAI A;  4M3C F;  4QPG B;  4WVM B;  3NQH A;  4Y3O A;  4JTO A;  1GIC A;  4NRM A;  5CG9 A;  4SBV A;  1DBN A;  5FCC A;  3ELN A;  5FZ4 A;  1RJ7 A;  2CY6 A;  2RS5 3;  4BQX A;  5C70 A;  2ZX1 A;  2Q8D A;  3FFQ A;  1LEC A;  1S0C A;  5F7U A;  2VVF A;  1BBT 3;  1V6M A;  4C1X A;  4IGP A;  3WNO A;  1B09 A;  4AFM A;  2PEL A;  4GB3 1;  4OMC A;  1UMI A;  5FYT A;  3WHT A;  1W8O A;  4DZG A;  1ALY A;  1IQA A;  5E6H A;  2XJP A;  2XBO 3;  4LOT A;  3M2M A;  1UOJ A;  2IXJ A;  2D3R A;  4D6S A;  2A3W A;  4YAR A;  1YJL A;  3DXU A;  2WT2 A;  3HNB M;  2EAK A;  2ZGT A;  1YI9 A;  4AGV A;  1PZ8 A;  1BVP 1;  1PVC 3;  2DF7 A;  2XKO A;  2YC4 A;  4KG8 A;  4NWW A;  4CU9 A;  1DYK A;  3HQR A;  1N1V A;  1QJU 2;  1W0O A;  3M7A A;  5A6Z A;  1OXC A;  1PHM A;  3POB A;  2RR1 2;  1CON A;  3AZZ A;  2VUD A;  2Q8C A;  2H0V A;  1W8H A;  3WF1 A;  3NNL A;  2YGM A;  4IE6 A;  5FUP A;  1D7P M;  3N9L A;  2Y64 A;  4Y1X A;  1IG3 A;  3T0D A;  4HFS A;  4EN6 B;  2UYB A;  5FXV A;  3G6J B;  2C6S A;  1O8P A;  2R04 3;  2ZML A;  4KH9 A;  3U4X A;  1D4M 1;  3AVS A;  4B4Q A;  2HKX A;  1XYP A;  3III A;  1V6J A;  1W8N A;  4IGO A;  4MYE A;  4M01 A;  1RHI 1;  4W4Z A;  3ZN6 A;  5B2G B;  4CXX A;  1AVB A;  4LBN A;  1T2X A;  5BV6 A;  3PJY A;  5EIY B;  1ODM A;  1QQP 1;  2P6H A;  2VY0 A;  5FRE A;  5GLT A;  1OI6 A;  1SLB A;  2AR6 A;  1J3P A;  4NE9 A;  3RG0 A;  3VBS C;  4ASL A;  3AKP A;  4LBM A;  1R1A 2;  5B4X A;  2VQT A;  4O7X A;  5FZH A;  3T1L A;  1CAV A;  1TNF A;  5HCF A;  4FPG A;  3VKN A;  3V64 A;  2J1E A;  3OD4 A;  4ONU A;  3AFG A;  3T2P A;  5A6Y A;  1JZ3 A;  2EXK A;  3GJB A;  3WT3 A;  4ASK A;  5JXI A;  4ZHN A;  2WNV A;  4LUM A;  2EVX A;  2IXC A;  5I0S A;  1C57 A;  4QU1 A;  1Q8Q A;  3KHC A;  1X36 A;  3WV6 A;  1YIP A;  1YNA A;  4K21 A;  3WX5 A;  4GMP 3;  5LBB A;  4UFH A;  4HZF A;  5BNP B;  3WD5 A;  2WC2 A;  1MZF A;  4FPF A;  4Z07 A;  1VRB A;  5H9Q A;  4BXS V;  3N9M A;  3O0V A;  1ND3 A;  2XJT A;  3J7L A;  5CNA A;  5JPN B;  4GA9 A;  2DTY A;  3RZK A;  1RL3 A;  2ZZJ A;  4JQR A;  2ZGP A;  1JUI A;  5JI9 A;  2WFP A;  2WO2 A;  1V6L A;  5J7M A;  5JSO A;  4JVA A;  4P9J A;  3KVA A;  4EZ4 A;  2VBP A;  5LEK A;  4YSF A;  1SLT A;  5FO9 B;  2I74 A;  4P5H A;  2VTX J;  3NJV A;  3CU7 A;  3SKV A;  1LED A;  2ZHN A;  4Y5S A;  1TNR A;  3Q8A A;  4K8F A;  5IVF A;  5K0U C;  4OI0 A;  1SBF A;  2WNU B;  3AYC A;  2WQ8 A;  3KZ4 C;  1QDC A;  1VBC 2;  2JE7 A;  2VME A;  4LBO A;  3JXS A;  4QDQ A;  3LQC A;  5ACA 2;  3HWJ A;  1ZRI A;  2ILM A;  1HRV 2;  1KQR A;  4K20 A;  3SHR A;  1RUH 3;  1HN1 A;  3PIJ A;  4YZ5 A;  2QQL A;  2L9L A;  2H0B A;  4FOV A;  5A32 A;  3QD6 A;  3WP3 A;  2MEV 2;  4XYX A;  4G3Y C;  4OZO A;  4QXB A;  3BOP A;  1XU2 A;  2GNB A;  4CEW A;  2ZPX A;  1GOF A;  1RUH 2;  1A3K A;  2WLQ A;  2W39 A;  2A6X A;  4EN9 B;  2ZAB A;  3NAP C;  4MAD A;  4PDW A;  4RS5 A;  1CQ9 A;  5A1F A;  3J7H A;  5FY1 A;  4AHW A;  5DN2 A;  1VBA 2;  3VBF B;  3VBS B;  1P8J A;  4Y24 A;  1HXS 2;  5FZ9 A;  5GZD A;  4LKE A;  2VOT A;  5F1R A;  1JTZ X;  2VNG A;  4KNC A;  3LZZ A;  2RS3 1;  3BN6 A;  1FI2 A;  4B8E A;  5AC9 3;  5JOY A;  1I3H A;  1UX7 A;  1NQJ A;  4DPN A;  4FOQ A;  1VLN A;  1QJY 3;  4HK9 A;  1PGW 2;  4ES8 A;  2O0O A;  4YZ3 A;  2FCU A;  4OUE A;  4URT A;  4JHT A;  3LA2 A;  4TLF A;  4DMI A;  1PMH X;  2CL2 A;  4YGE A;  1XOY A;  4JTN A;  3ZYG A;  2HEY F;  4A7Y A;  1A34 A;  1TME 3;  1YQ8 A;  2Z2S B;  1QOT A;  4BLI A;  2ZX3 A;  2FMD A;  2JDA A;  3C3V A;  4DRV A;  3I2O A;  4FPY A;  4QX2 A;  3JBG 1;  3LPG A;  4S2F A;  2BNN A;  4BMB A;  4AED C;  2BV4 A;  1TQ5 A;  3O1S A;  5LY2 A;  4AAP A;  3RZL A;  3VN4 A;  3BTA A;  3USU A;  5BNN C;  4U2A A;  3P1I A;  1LHN A;  4RHV 1;  4A42 A;  4DEV A;  4ZKT B;  2FCT A;  2VE1 A;  4OHY A;  1DZT A;  4XQW A;  4DRR A;  2ZKN A;  2WR9 A;  1SFN A;  1HB3 A;  1XE7 A;  2BU9 A;  5K0U B;  4NIH A;  2W47 A;  4NRO A;  3VHR A;  2A75 A;  4IXL A;  1AYM 1;  1K5J A;  2QQW A;  4R9D A;  3I59 B;  2V4V A;  4NHL A;  5CKM A;  2WNE A;  1AR9 3;  1LCL A;  1RUG 1;  4PBP A;  5D8A A;  5FY4 A;  2JEM A;  1XND A;  1QOS A;  1COV 2;  4GUL A;  3O1P A;  5I8S A;  1POV 0;  4MXV A;  4QM9 A;  1WA4 A;  4A2U A;  3OPZ A;  3P3N A;  5EPA A;  2PA7 A;  5DXD A;  3ZXE A;  2D40 A;  3NAP B;  3NL1 A;  1O7F A;  1WZX A;  4E2S A;  4BB3 A;  1F4A A;  1UXZ A;  1W8Z A;  3DYM A;  5T3N A;  1W6P B;  1WCS A;  1LGC A;  1GZW B;  3KLS A;  1IQD C;  4H55 A;  4WM7 C;  5JSP A;  3FLT A;  2OT7 A;  4QQ2 A;  3ZXL A;  5ABJ C;  3OBR A;  2RS5 1;  4NR1 A;  1W6N A;  1AXZ A;  4KWU A;  4XFF A;  4C0B A;  1KS4 A;  4H7L A;  4NMI A;  5A1A A;  4QWN A;  4YVS C;  1GV9 A;  4B7E A;  1NA1 C;  1NCQ B;  2WN3 A;  1NAE A;  1WBL A;  1FMD 2;  3T30 A;  4AI0 A;  1CAX A;  1PO2 2;  3PMS A;  3A22 A;  3I2K A;  4MH0 E;  1H2M A;  5EHD A;  1QJU 1;  3J8F 2;  2Y6J A;  3JQW A;  1PK6 C;  4XPV A;  4FVV A;  2GDF A;  5JPM B;  4AHY A;  1N3O A;  3ZFF A;  4BA6 A;  2RR1 1;  2XVG A;  1UU4 A;  1FOD 3;  5A7W A;  5HXM A;  1OH4 A;  1LEM A;  1UIJ A;  2X8K A;  4AED B;  4K1Z A;  4CDX C;  4AVB A;  2DCJ A;  4A41 A;  1V70 A;  3K77 A;  2QTW B;  4LKF A;  1DQ5 A;  2HWC 2;  4LK7 A;  1NG0 A;  2ZGL A;  5BNN B;  2Q1M A;  3U11 A;  5B4N A;  5FYU A;  4P00 B;  1G9C A;  1ZZ9 A;  2GME A;  4XXA A;  5DUW A;  2JE9 A;  1JZ2 A;  3RZG A;  2HWF 2;  1UPI A;  4RFT 0;  2PXJ A;  1JOD A;  1RUD 2;  3ZR5 A;  4NHM A;  1OLQ A;  5APA A;  4D8M A;  1ZM1 A;  4YGB A;  1PGL 2;  3WSO A;  1JN2 P;  3PTR B;  2R06 2;  5FPU A;  3WDT A;  3PHM A;  2ZGQ A;  3VBR C;  4F3J A;  1Y9G A;  1K12 A;  3FX3 A;  3FMG A;  3B9C A;  4EZH A;  4Q4X 3;  5FUI A;  1US2 A;  1XNK A;  5DAQ A;  4Q0P A;  3W59 A;  5BY5 A;  1W6Q B;  3WNM A;  3KHB A;  3LGR A;  1R1A 1;  1E5H A;  3CJI C;  2DVB A;  4FQ4 A;  3VL8 A;  2DCZ A;  4PLO A;  4UT5 A;  5J98 B;  1W6O A;  2E26 A;  2PAK A;  1UX6 A;  1LEN A;  1XPW A;  4HSL A;  4LBQ A;  5CAD A;  4HVQ A;  4LBK A;  3GYD A;  3CLP A;  2J1S A;  2UU8 A;  3T4H B;  2OUJ A;  1DIW A;  1W6M B;  2IXI A;  4Z2A A;  3GZA A;  2VBB A;  5CFD B;  1UCX A;  1Z0H A;  4P9L A;  1NZI A;  2HWB 3;  2X29 A;  3VBH A;  5ABJ B;  5JLV A;  1H8V A;  3SH5 A;  1W8W A;  1ENX A;  2GZW A;  3N9N A;  3AXD A;  1R1Z A;  2G9F A;  1FXZ A;  2HYK A;  3AP9 A;  5FP3 A;  3USS A;  4XIK A;  3J7M A;  1ASJ 2;  2CDO A;  5J09 A;  3GHM A;  2FDG A;  4ET7 A;  1OUX A;  1BKZ A;  3CL1 A;  1EV1 2;  2UUR A;  2Y0O A;  1XE8 A;  1XXN A;  1JU3 A;  3Q8C A;  3WQ7 A;  3OD0 A;  2WKK A;  1LUL A;  1PMJ X;  1L3J A;  2IFR A;  5C8C A;  4NIG A;  4RGG A;  5LW9 A;  1ZZ8 A;  5DAB A;  4CDX B;  3SLI A;  4KL1 A;  4NAM A;  1V9U 3;  4IV3 C;  3K3O A;  3IWZ A;  3TOJ A;  5ACA 1;  2RS1 2;  3R4D B;  1HRV 1;  4MO3 M;  4AQT A;  4QXH A;  5L9V A;  4WVM A;  3MFA A;  3FLR A;  1NOV A;  1UY1 A;  2MEV 1;  1ZRR A;  1RMU 3;  2NQY A;  3HN3 A;  1JYN A;  1HLC A;  1BLZ A;  2D43 A;  1SAC A;  2ZAA A;  3E5Q A;  2H6C A;  2CGP A;  1RUH 1;  2PHR A;  2QQU A;  5GAL A;  4OUM A;  1I6X A;  4QDS A;  4CSW A;  5T5O A;  1AX0 A;  1VJ2 A;  1YHF A;  2LAL A;  1NLQ A;  2SBA A;  1G6N A;  1VBA 1;  3WLU A;  2GC0 A;  1W8F A;  4Q4W 2;  4QX5 A;  4CDQ B;  1HXS 1;  4PIX A;  3UJQ A;  4Q4V 3;  1OOP A;  3MIH A;  3LFI A;  3KCC A;  3PUI A;  2EIC A;  4GD4 A;  3O1M A;  1GYK A;  5DAP A;  4V2W A;  1W0P A;  2WZ8 A;  1PGW 1;  5GZC A;  1ZZ6 A;  5EYX A;  4Y22 B;  5F8P A;  3POI A;  4XTM A;  2OQ7 A;  4HVO A;  3M3C A;  3NV3 A;  4U36 A;  3M4F A;  1GAN A;  5FMO L;  2BYV E;  3NJX A;  4OQ9 A;  2Z79 A;  5FPL A;  4L0P A;  5FZ6 A;  1G9D A;  2BW8 A;  4CCK A;  1VBD 3;  1WCD J;  4NPL A;  1B35 C;  3H3Z A;  1BXH A;  4GQ7 A;  3SEE A;  3OGV A;  1Q56 A;  1BEV 2;  4TYS A;  1CWP A;  1YIF A;  3O0X A;  3KWV A;  4AI2 A;  2IC1 A;  3D82 A;  3O1R A;  3LF7 A;  2QQI A;  1ENS A;  1TME 1;  2ARE A;  4QHZ A;  5DAW A;  4JGY B;  2DFB A;  3RFR A;  5FZO B;  2P3Y A;  4YG3 A;  5JZG C;  1E57 A;  3GBW A;  1O3S A;  4J1W A;  5F5C A;  5FP9 A;  5IYY A;  3SKJ E;  1OLM E;  1K5M C;  1S55 A;  1HRI 3;  2Q4S A;  1LHU A;  3CF6 E;  4BQ5 A;  4FTE A;  2Y38 A;  1JYW A;  1S0I A;  4URA A;  4QXC A;  5FZ3 A;  1E5S A;  2YFZ A;  4NUB A;  4XXP A;  2B8M A;  2GAU A;  1N1Y A;  4M0N A;  3RZM A;  1AXY A;  1COV 1;  3WHU A;  2Y8K A;  4C90 A;  1GP5 A;  3CBN A;  4AAX A;  4MX3 A;  2VUL A;  3PUR A;  4RQP B;  1QXP A;  2AAC A;  2Q1Z B;  2XLG A;  1O6U A;  4HXC A;  1AR9 1;  1OA2 A;  1Z78 A;  3F2Z A;  1POV 3;  3KVB A;  4QQO A;  4D3W A;  4ZU7 A;  5DAX A;  5EJ3 A;  2BER A;  1UY0 A;  2UWA A;  3KT1 A;  4HLT A;  2FDJ A;  5KBF A;  4CEW B;  4AOC A;  2PTM A;  4IER A;  4CUC A;  1U0A A;  4EWD A;  1MZE A;  4HSJ A;  5BNP A;  2G4I A;  4UI9 L;  1KGY A;  3I2F A;  5EP9 A;  1XSQ A;  3J9S A;  2QFE A;  1RUJ 2;  1J1L A;  5L9B A;  2WO1 A;  2DVG A;  3ZOI A;  1G9B A;  1QJZ A;  4N53 C;  4OUS A;  3WUD A;  3KV9 A;  5BNQ A;  5GZE A;  4D0Q A;  2ZGN A;  3THD A;  2VW1 A;  3H8R A;  3WG3 A;  2C26 A;  1FMD 1;  1BVV A;  5L73 A;  1PO2 1;  1GLH A;  3AZY A;  4QQL A;  2RM2 3;  3ZFE B;  1UL9 A;  5IVV A;  3J8F 1;  4FPJ A;  5C5T A;  4EN7 B;  2WNU A;  4UBG A;  4XJ8 A;  1G9A A;  4B1M A;  2CDP A;  2JDN A;  3B7M A;  1JOP A;  2P1B A;  4NHY A;  4DUV A;  5D2A A;  3N7M A;  2W87 A;  3K4D A;  3KV4 A;  5HXV A;  3TB0 A;  2WWS A;  4FFI A;  1KDM A;  2HWD 3;  4COY A;  4XQD A;  1JS9 A;  1AR6 2;  2NLR A;  1SBD A;  2HWC 1;  5EZW A;  1UN1 A;  4OHW A;  2VTF A;  4LIV A;  4B1L A;  2B46 X;  3TNP B;  3T09 A;  2RDN A;  1OH3 A;  2VZV A;  2LTN A;  4QB2 A;  5DAV A;  5T50 A;  1JYT A;  1MZ5 A;  4WM8 C;  5FY7 A;  2VZU A;  1RUD 1;  4XAB A;  5JR7 B;  2CWS A;  2ATF A;  5F32 A;  1LOF A;  2AEY A;  3N9Q A;  3B93 A;  1X7N A;  1M4W A;  2YFU A;  4YNI A;  4KGG A;  5FZI A;  3ZSM A;  1PGL 1;  2D3P A;  2KD7 A;  2R06 1;  4PHZ A;  3VBF A;  3WP4 A;  1FV2 A;  3NNF A;  2CWM A;  5FYH A;  4B29 A;  3KB5 A;  5FPV A;  1UOF A;  3I2G A;  2W95 A;  1HQW A;  2ZCW A;  3LFM A;  1XYN A;  3W21 A;  3DUI A;  2HEW F;  3THP A;  2OS2 A;  4GH4 C;  1EPZ A;  1SLI A;  4TLG A;  2WT0 A;  2P2K A;  5C9A A;  1G86 A;  3AZW A;  3GF6 A;  3LDB A;  2FBE A;  2RHP A;  3IAQ A;  4IL7 A;  2FQP A;  1RUN A;  5FZ0 A;  2RJL A;  2ZXQ A;  4JDN A;  1GWM A;  4L11 A;  4W65 A;  3CDZ B;  1PO1 3;  5GLU A;  1D4V B;  2P37 A;  1LAJ A;  4N53 B;  3LSD A;  1GU3 A;  4O61 A;  1ZRD A;  4KG0 A;  5IAV A;  3FHQ A;  3IDA A;  2DUO A;  4I02 A;  4Q4Y 2;  1RUO A;  3N3H A;  1H30 A;  1C5I A;  4CCJ A;  1XC6 A;  4MXW A;  2XLF A;  2VMH A;  1QQP 2;  5A7S A;  1CD3 G;  3H1W A;  1UY3 A;  3WG2 A;  3OGR A;  4RN5 A;  2CV6 A;  5H9S A;  2SLI A;  5FLH A;  2GC2 A;  2OPW A;  3W20 A;  1LGB A;  1J58 A;  5FXZ A;  3C7H A;  4QPW A;  4M4P A;  1F4H A;  1W9T A;  1X8E A;  2ZGS A;  2V5Y A;  3HT1 A;  1GBG A;  4HL0 A;  4AFD A;  1HQL A;  3THC A;  3OTF A;  2QQV A;  5IVJ A;  2OXB A;  2XKP A;  3N7L A;  4NN0 A;  4LO7 A;  3FWE A;  3JB4 C;  3VZL A;  4CUG A;  3T1M A;  1LHW A;  3KD4 A;  1TMF 2;  3WW3 A;  2VG9 A;  3NAP A;  4MGQ A;  1VBE 2;  2W91 A;  2YYO A;  3E97 A;  1EYB A;  2OII A;  2A6Y A;  5FQ0 B;  5FP8 A;  3CKH A;  2WFF 3;  1S0D A;  1W6P A;  2G9G A;  3WG4 A;  4AEK A;  4AQS A;  1GZW A;  5A3O A;  5FFO C;  4E2G A;  4S2H A;  4V1P A;  1HJF A;  2WZP P;  3SC7 X;  1R64 A;  4N8M A;  5L7O B;  4Q4W 1;  1UOG A;  3H8U A;  4P02 B;  4S2G A;  1H4G A;  1RUF 2;  3HEI A;  4AI1 A;  5JOZ A;  2VZP A;  4GH4 B;  1NCQ A;  2B9U A;  1OQD A;  3QLQ A;  2C4X A;  4HK8 A;  2VZ3 A;  5I0T A;  4BU2 A;  4O9E A;  4CCN A;  3WW2 A;  1TE1 B;  1YC6 1;  3FN9 A;  2G1M A;  2VQA A;  3WP5 A;  4N9H A;  4OLL A;  3R6S A;  1BMV 2;  2XQX A;  4FFG A;  4N9I A;  1OUR A;  4D6Q A;  3U37 A;  2VJX A;  4LQR A;  4AED A;  1VBB 3;  4Y26 A;  3C7G A;  3BB6 A;  4XBQ A;  4E4Z A;  1HB1 A;  1BEV 1;  3LEK A;  2JKX A;  4MGS A;  4SLI A;  4LLO A;  5BNN A;  3BPZ A;  1QJE A;  4W50 A;  2HBU A;  1GP6 A;  1ZZC A;  2VMI A;  2VW0 A;  5C4W C;  2A7A A;  4COU A;  5G04 L;  4CEY B;  4JHZ A;  4XFA A;  5SV8 A;  3OBZ A;  3GGL A;  1NLR A;  1IPJ A;  4XDQ A;  2JIG A;  4A3Z A;  1KEX A;  1OMI A;  3I2H A;  3OBT A;  4CP0 A;  2E31 A;  3ZYR A;  5DDJ 3;  1BJQ A;  4C8D A;  1GP4 A;  3OOX A;  3IMN A;  3V0B B;  2JG9 B;  2XON A;  4I3G A;  3SCG A;  2WS9 3;  4CVU A;  2PLV 2;  1W6Q A;  3RNS A;  2XPJ A;  4NAO A;  1OKO A;  4YW1 A;  1CAW B;  2VOX A;  3CIH A;  2W2I A;  1HJG A;  2ZHM A;  5CBL A;  1R09 2;  3M3Q A;  4AYU A;  1O91 A;  2Y6H A;  4IV1 C;  3CEW A;  4JGZ B;  5FJH A;  3UES A;  2CU5 A;  5KXB A;  3RS6 A;  4XFG A;  1YFX A;  1ZBE 3;  2JKB A;  4FI9 A;  2ZGU A;  4KWL A;  3OF1 A;  5BNO A;  1L7L A;  5BPX A;  4CP9 B;  4GWM A;  5J96 B;  3T4V A;  1PIV 2;  3LE0 A;  2Y6K A;  1YFW A;  1DGL A;  2ARB A;  1GWK A;  3VDD B;  5JOX A;  1W6M A;  4K9S A;  4RSU A;  3IM0 A;  2RJK A;  5EWS A;  5FV3 A;  2RE9 A;  3WG1 A;  1RYY A;  1WMX A;  4QX1 A;  3DL3 A;  3BOD A;  3GXU A;  2QDR A;  3WVJ A;  4F8A A;  2BPA 2;  4YFZ A;  2AYH A;  4GIQ A;  4DY5 A;  1EP0 A;  1RUJ 1;  1DQ6 A;  1RUC 3;  1IG0 A;  2JG8 B;  2FDF A;  4G9S B;  4P9I A;  4DY3 A;  4V2V A;  4OFG A;  1YO8 A;  2WZR 3;  1UPS A;  1DQ1 A;  1KFX L;  2HH9 A;  4L99 A;  3AZX A;  1WUV A;  1MQT C;  3LIG A;  3JD7 2;  5F39 A;  1RUG 2;  2Z69 A;  4ZON A;  2KM2 A;  4AQ6 A;  3EMR A;  2F4P A;  2OQ6 A;  3JU9 A;  1FYU A;  3O1U A;  4TZD A;  1YFU A;  2ES3 A;  1N3Q A;  2ZKL A;  1W28 A;  5HBA A;  1G7Y A;  4WV8 A;  1AR6 1;  1OFS A;  4NHX A;  4DQA A;  2VXJ A;  4K8R B;  1RUI 2;  4QPY A;  5JR2 A;  1NT0 A;  3J7N A;  2XML A;  3LDK A;  4COZ A;  1Y9Q A;  1S0G A;  3A7Q A;  4Y4R A;  2WYF A;  1A8D A;  2Q1F A;  3AP7 A;  3FUO A;  4FPL A;  4XHB A;  1Y7B A;  5IUQ A;  2XLA A;  1JUH A;  1O4Y A;  3NNJ A;  4QHO A;  4CDW C;  1LU2 A;  2PFW A;  2YGL A;  1XNT A;  2RS5 2;  1QXR A;  4AG4 A;  4CDQ A;  3T0A A;  2G9Z A;  1QY4 A;  2JEC A;  4KBZ A;  3UT0 A;  1DP0 A;  1BBT 2;  2YPD A;  3NV1 A;  3OEB A;  2UWC A;  1H2N A;  4LUL A;  4E2Q A;  4XCB A;  3QH6 A;  2I2S A;  4Q8L A;  2IVJ A;  1LGN A;  1F35 A;  2E51 A;  2LRO A;  5IHR A;  5JIU A;  2XBO 2;  3PVB B;  4Y22 A;  3A0K A;  2DVA A;  4DB5 A;  1DLC A;  2QCS B;  5LBF A;  1V6I A;  5CFC C;  3HAG A;  1Z7S 3;  1WBF A;  1REF A;  1SBE A;  1YFY A;  2KA3 A;  1LKN A;  3DN7 A;  1PVC 2;  4YW5 A;  2XR4 A;  2HWE 3;  3IDB B;  1VAV A;  4MSV A;  1CX4 A;  2EAL A;  3S5Q A;  3IN9 A;  2A5Z A;  1WLT A;  2XUM A;  2VR4 A;  3JZV A;  1OF3 A;  2W5F A;  4JC1 A;  4WVV A;  4YM1 A;  1O59 A;  3WIN E;  2QE3 A;  2WA4 A;  4JGY A;  2GH2 A;  4QHB A;  5F37 A;  1ULO A;  3EO6 A;  3KGL A;  4MG2 A;  5HV4 A;  1NE4 A;  2CTV A;  3OG2 A;  5A33 B;  1J83 A;  4Q0S A;  2FDH A;  4Q4Y 1;  1RXG A;  4LHK A;  2DBN A;  4WZC A;  3BKZ A;  1UMH A;  1MQT B;  2QJV A;  3BVC A;  2R04 2;  1FAY A;  3E6B A;  2OUH A;  4YW4 A;  4FAG A;  3MUZ 1;  1JYX A;  3BIW E;  2JIJ A;  3PTY A;  4JRA A;  4R4X A;  1CR7 A;  1DQ2 A;  1OKQ A;  3TRS B;  2Q5T A;  4BOW A;  1K45 A;  2RDQ A;  2YC2 A;  1W3V A;  2IFW A;  5I93 A;  5FZC A;  3BTY A;  3T2T A;  1EAH 3;  3ILN A;  1U5I A;  3LWC A;  5CFD C;  4XAE A;  4PLN A;  2VU9 A;  4A7Z A;  4FAH A;  1MS1 A;  4HAN A;  3B02 A;  5KC5 A;  4RQP A;  4YPJ A;  3EBR A;  3ILF A;  4BZ4 A;  2XOM A;  1PM7 A;  1QGL A;  1JZ7 A;  4PI2 A;  1O3Q A;  3DKQ A;  3ZYH A;  3DKW A;  1YQ5 A;  1RXF A;  1TMF 1;  3MW3 A;  5FYY A;  3W58 A;  3UGG A;  4CUA A;  1VBE 1;  2ZJC A;  3UKV A;  2BQP A;  2XVL A;  3GZT B;  5HCB A;  1QH6 A;  3P6B A;  1CX1 A;  4N43 C;  1HDK A;  2BVV A;  2K0G A;  5JI7 A;  4CA9 A;  2GMP A;  4FP2 A;  3VHP A;  1ZRF A;  1DHK B;  2GSY A;  1DQ4 A;  3ZSJ A;  5KR7 A;  4ZY9 A;  1LOA A;  3U4S A;  1RUF 1;  4HKL A;  2WFF 1;  2VW2 A;  2XJV A;  4LO4 B;  2NP0 A;  5CKN A;  2VCA A;  4E9K A;  4QX0 A;  4EWE A;  1CJD A;  1QU0 A;  3ZFE A;  4HET A;  1F2N A;  2XJS A;  4YYO A;  3VLB B;  5K7P A;  1SEF A;  3TN9 3;  2VNO A;  2BTV C;  2YHJ A;  3WCR A;  1BMV 1;  1APN A;  2ZHK A;  2ZX0 A;  1ZRE A;  4EE2 A;  1JH5 A;  3MLL A;  3ZYJ B;  4AEM A;  3WW1 A;  4CTE A;  5CA6 A;  4QKB A;  3PVE A;  3K2O A;  5I91 A;  1SPP A;  2R1B A;  5JVV A;  2DUP A;  4J6G A;  1S0J A;  3WF2 A;  2GP5 A;  1R08 3;  1ULG A;  2XXZ A;  4WBB A;  4PT6 A;  1YEW A;  2IWG B;  5FYB A;  3UGF A;  2ZEZ A;  4FCA A;  3MO4 A;  3PU8 A;  1JZ8 A;  1SQ4 A;  3DPR C;  3ES1 A;  4XET A;  4XJ9 A;  5GZF A;  4CCO A;  1H0B A;  4QU2 A;  4XIO A;  3B5L B;  3ZKU A;  3MLJ A;  4H14 A;  1H6X A;  2DCK A;  2GU9 A;  3QH7 A;  3GBG A;  2J1U A;  4J25 A;  1RVF 3;  2DUR A;  3H1Y A;  4PIZ A;  1HQN A;  3SMH A;  4CP2 A;  1PNG A;  1W2O A;  3DXT A;  4O65 A;  3RZZ A;  1UYP A;  2ET7 A;  3ZO0 B;  4CRQ A;  5C3R A;  3KCY A;  5J37 A;  3VGI A;  1OBN A;  1GQG A;  1NQD A;  2PLV 1;  3A21 A;  3HOB A;  3I7D A;  4LO5 B;  4Q1P A;  4XDO A;  2W0X A;  4Y4Y A;  4YM2 A;  4BM8 A;  3M3I A;  1R09 1;  1WW7 A;  3J4U H;  4FOY A;  4Z82 A;  1W04 A;  3MIC A;  4MUV A;  4A7K A;  1UF2 C;  3GZU C;  5AC9 2;  5ISL A;  2VO5 A;  3URF A;  3CZU A;  3ZVX A;  5FLI A;  1QJY 2;  1PIV 1;  1K3I A;  2LW8 A;  1DDL A;  1CGP A;  4X6R B;  1QHD A;  3I2J A;  4LMF A;  5FYV A;  3VBO C;  3VBU C;  2Y60 A;  2IXL A;  4CCM A;  1LES A;  3ME2 A;  1TME 2;  1X82 A;  4OUL A;  4AVC A;  4AVT A;  1EY2 A;  1S2K A;  5FZ7 A;  4LBJ A;  3ZXJ A;  3ZDV A;  3WZ1 A;  3O1O A;  4XC9 A;  3AP4 A;  1WA6 X;  2PHW A;  4KI5 M;  2GNM A;  2VCB A;  3CO2 A;  2Y6F A;  1TVG A;  3C2U A;  4XF9 A;  3RPQ A;  3SCH A;  4C1W A;  4WVZ A;  3V0A A;  1C8M 3;  1G8W A;  2YB7 A;  3T2O A;  3WP6 A;  2D93 A;  4LLF A;  3O7O A;  4E8D A;  3AL5 A;  4LBL A;  4UW5 A;  3E1F 1;  4TXW A;  3MIE A;  1IS3 A;  3JD7 1;  3P3P A;  4HG6 B;  4NOT A;  3IMM A;  4UYB A;  3UGH A;  2JDZ A;  2BUK A;  2XUE A;  4YVW C;  5C3S A;  5JWP A;  5CB7 A;  4FFF A;  2D5H A;  3NKG A;  1MAC A;  4OVE A;  1VRH 3;  1AYN 3;  4UFJ A;  4CDU C;  3QOP A;  3AP5 A;  3DPR B;  1QEX A;  5T5J A;  1IKQ A;  1AR9 2;  1H8T C;  4MZU A;  1MVE A;  1RUI 1;  1F15 A;  4AI8 A;  2YXS A;  3NRU A;  4LUK A;  1JOB A;  3C7E A;  1AJO A;  1UMZ A;  1WMD A;  4HPK B;  1AZD A;  5FQ0 A;  1O5U A;  1HV1 A;  4MOA A;  5FTT C;  1XU1 A;  2B7Y A;  2VAU A;  1SG3 A;  1L7R A;  4IE4 A;  4BK5 A;  4DNY A;  4MGY E;  5IJR A;  1J3R A;  2JD4 A;  3PVN A;  5FK8 A;  5A7N A;  3TYJ A;  3SEP A;  5L7O A;  4YWA A;  3K75 B;  3WDV A;  2AC1 A;  1BBT 1;  4LJH A;  1YYN A;  2K2S A;  4GH4 A;  1UZZ A;  1XNC A;  1UYX A;  5DG2 A;  4QKN A;  1PMI A;  2R07 3;  5IK4 A;  5AFB A;  2XBO 1;  4IEQ A;  5FPA A;  5FOB B;  3LSE A;  2NZ9 A;  1DGW X;  3OPT A;  2W94 A;  1I5Z A;  1JYV A;  1BYH A;  5LBE A;  2I07 B;  3NWK A;  1UY2 A;  4JZR A;  3ZXK A;  1PVC 1;  2CGO A;  2YU1 A;  3EB7 A;  5FK7 A;  3NV2 A;  2OZJ A;  3B69 A;  2DVF A;  3D4K A;  1W03 A;  4A6S A;  4D7S A;  4F83 A;  1PZ7 A;  1FOD 2;  3VKO A;  5CYY A;  1W05 A;  4S2D A;  4DEQ A;  3WNX A;  5FDB A;  2PYT A;  2JIC A;  1QIQ A;  3O1T A;  3I3D A;  1C28 A;  4IW3 A;  4CEY A;  5FWJ A;  3H3L A;  4YZ1 A;  4NRQ A;  3UK9 A;  2J22 A;  4A4A A;  3OYW B;  4BPZ A;  3BCW A;  1Q8O A;  2R04 1;  1NE6 A;  3SH3 A;  4BE3 A;  4IET A;  5FMO S;  2BBA A;  3FC0 A;  1UZ0 A;  2BVB A;  4Q0Q A;  2XVK A;  2JG9 A;  4JX0 A;  5H9P A;  3V0B A;  4FBF A;  3AYE A;  4JKM A;  5LY1 A;  3D0J A;  1CAW A;  2D7F A;  1H2K A;  1IKP A;  1W39 A;  3AB0 A;  3AVR A;  4CDU B;  2VTX A;  2A1X A;  3L2Y A;  4ISQ A;  4JGZ A;  4LO8 A;  4Q4X 2;  5EQU A;  1Q3E A;  4HT1 T;  2ZAH A;  4QDR A;  5JXJ A;  3AMN A;  3GM8 A;  5BYN A;  1UIK A;  3B01 A;  1FPN 3;  3H0O A;  4CP9 A;  3BTZ A;  4WM7 B;  3TEW A;  2R16 A;  3VDD A;  4AGG A;  2A3Y A;  2DCY A;  4XF1 A;  4EJR A;  5FZE A;  1VAL A;  5E16 A;  2MPF A;  2QVS B;  5KXE A;  2UY9 A;  2VOK A;  4XVH A;  4XMI A;  2Q8E A;  1ZZ7 A;  3ATG A;  3MHZ A;  5LK5 A;  3NJZ A;  3AFK A;  4YVS B;  3ZYP A;  2A6V A;  1OF4 A;  1NA1 B;  3JB8 A;  1UKG A;  2W1U A;  5I8Y A;  2JG8 A;  1AL2 3;  4GMP 1;  4D7Y A;  2HWB 2;  1S0F A;  1YCI A;  2P4E A;  1GSL A;  2DDU A;  2GC3 A;  4HVR A;  4L92 A;  1ENQ A;  2WAB A;  5FO8 B;  4LA2 A;  1PK6 B;  5FXX A;  5FY5 A;  2GND A;  1GQH A;  4MV2 A;  3CQO A;  2VVD A;  4FXG B;  2D6M A;  1ZVF A;  2ARX A;  2DTW A;  5GKA C;  2ORZ A;  2WAO A;  5IW0 A;  1OA3 A;  5E88 A;  4CYD A;  1UYZ A;  1F9K A;  4UF0 A;  1PX4 A;  2ZX4 A;  3H7J A;  2D6K A;  1WCK A;  4Y33 A;  2A70 A;  1AR8 3;  1W2U A;  1JHJ A;  1ZNP A;  3VD4 A;  1OC1 A;  1KJL A;  2ZHL A;  4QPG A;  2EXI A;  2RMU 3;  2O1Q A;  4A3X A;  3RVH A;  4PF5 A;  3ZSK A;  1TZO A;  4CP1 A;  1V9U 2;  3VD3 A;  1D0G A;  5JOW A;  5LBC A;  1H1I A;  4CXY A;  2F6B A;  4QQH A;  2C9A A;  3VBR B;  4OYU A;  1U12 A;  4LE4 A;  1KIT A;  2KXL A;  4XFC A;  4P9X A;  1YWK A;  2PQQ A;  4DIN B;  3ZYB A;  2VOV A;  4EN8 B;  1GNZ A;  1RMU 2;  5I0D A;  1DLL A;  4HN0 A;  2XL7 A;  2FD8 A;  3OUH A;  3CJI B;  5FZB A;  1QJX 3;  1Y9M A;  2G19 A;  2ZGM A;  4QT6 A;  5A3N A;  1ACC A;  1D2S A;  4YW7 A;  3SIS A;  1UY4 A;  1CZV A;  2R49 A;  4XUT A;  4LTA A;  3RMX A;  4OHV A;  5FPX A;  3Q9O A;  3UJO A;  1RUE 3;  4YM3 A;  3TEZ A;  4K40 A;  3AM2 A;  4WZF A;  4BME A;  2B4K A;  2YBS A;  1WCU A;  2WNV C;  3ILR A;  4Q4V 2;  5JIA A;  4Q8K A;  5AC9 1;  5M0T A;  1RED A;  2J1A A;  1W90 A;  3KV5 A;  5J36 A;  4XJU A;  1QJY 1;  4KWJ A;  1SFY A;  4NPM A;  4LKD A;  3OGG A;  3ST7 A;  4BHP A;  3MPB A;  1LHV A;  1DGW A;  1YUD A;  3VDC A;  1ND3 C;  3NNM A;  2K9Z A;  5LA2 A;  3T2Q A;  1UNB A;  2EXH A;  3UL2 A;  1X9T A;  2CGN A;  4GJY A;  1VBD 2;  1TG7 A;  1LOB A;  5IAT A;  1MVQ A;  2BOI A;  4DUW A;  5C6C A;  3B00 A;  4Q0U A;  2J1R A;  2VC9 A;  5A33 A;  2NM1 A;  2UWB A;  4BQ2 A;  2VZO A;  3DYO A;  3I4I A;  3VKM A;  2BGP A;  3PNA A;  5FO7 B;  4UW6 A;  3ZPO A;  4IV3 B;  3MF9 A;  3WXP A;  2YDE A;  3VD9 A;  2E9Q A;  4NIA A;  3AXE A;  4RR3 C;  2HBT A;  5KHH A;  3HJR A;  4ZS2 A;  1HRI 2;  4MGK E;  4HBN A;  4KU8 A;  1J84 A;  1VR3 A;  2JJ6 A;  1FX5 A;  1ZBA 3;  4XUO A;  2WT1 A;  3HNY M;  4L9B A;  1URX A;  1NXM A;  3HVD A;  3IDC B;  2ZEX A;  4CEW C;  2ZEY A;  3BUC A;  4HKW A;  2QQK A;  3POS A;  4RFR B;  1RIN A;  2C24 A;  4PDW C;  4RS5 C;  3WF0 A;  5GLZ A;  3GJA A;  3H1M A;  3MGU A;  1KRI A;  4FP3 A;  2RDR A;  1DQ0 A;  1SLL A;  2VMD A;  4QX8 A;  3S0M A;  5A7P A;  3EQE A;  4PQ9 A;  4CXW A;  1BZW A;  3O12 A;  2RJ2 A;  5IT6 A;  2A71 A;  4LOS A;  4ORF A;  4L8Q A;  3KT7 A;  1OPM A;  2I45 A;  2WBK A;  3PUH A;  3V65 A;  3ZXF A;  2WNV B;  1IGO A;  1MEC 3;  2RV9 A;  4XF0 A;  2DUQ A;  1CZS A;  2D3S A;  3SNM A;  3VZJ A;  5FLJ A;  4EQV A;  1HW5 A;  2ADD A;  3P5B A;  2EAA A;  1B35 B;  2E32 A;  3BPS A;  4Q26 A;  5FAX A;  4BQW A;  1M06 G;  4IEY A;  5IK8 A;  1OLM A;  1QOO A;  3ITQ A;  3OEA A;  3WQ0 A;  4XFI A;  2AH2 A;  3U0Z A;  1OD5 A;  4XEZ A;  5KXC A;  3FHA A;  1KFU L;  2R07 1;  5FZD A;  2XHK A;  3LPF A;  1HN0 A;  4E4S A;  2RM2 2;  3UV9 A;  1YJK A;  5IFP A;  5JCT A;  5GLW A;  5JZG B;  1NZC A;  1WW4 A;  5IVB A;  1FOD 1;  1H9W A;  3CZJ A;  1Q43 A;  5F3E A;  3LA3 A;  2QQM A;  5A70 A;  2W3J A;  4LT5 A;  2HWD 2;  2QQN A;  3L2H A;  2WII B;  5FYC A;  1C3H A;  1K5M B;  1QH7 A;  3MIB A;  4XTP A;  3VBS A;  1YI7 A;  4Q27 A;  4XZP A;  4ATE A;  4RR3 B;  2Y33 A;  2ZOE B;  5D8A C;  2LRP A;  5CFD A;  4FPE A;  5E1R A;  4EYU A;  4GB3 3;  4IND A;  4XJA A;  3BAL A;  3G7D A;  2WIN B;  3I3B A;  5FMB A;  3WUC A;  2YPJ A;  1OQE A;  1DGR N;  3M70 A;  1HX6 A;  4Q4X 1;  2W46 A;  1JYC A;  4TTG A;  1N1T A;  2V09 A;  2GN7 A;  3K4Z A;  3K48 A;  4XF3 A;  1AR7 3;  3H9A A;  3I8T A;  4IE0 A;  1DZR A;  2VMC A;  4OHZ A;  4ISR A;  4QB6 A;  3GDB A;  3AMQ A;  1NY7 2;  1WD3 A;  1H6Y A;  1QNW A;  4CU7 A;  3ZX7 A;  3MZH A;  1Y4W A;  3OUJ A;  2DU1 A;  3DV8 A;  2W1S A;  4AVA A;  1PO1 2;  2HWB 1;  3AJY A;  3VV1 A;  3LA7 A;  5KXD A;  3MID A;  4MHR A;  1F5F A;  5K0U A;  5FWE A;  5LWB A;  4DXS A;  5A7Q A;  3ZN5 A;  2BP6 A;  5A3U A;  3E6C C;  1D4M 3;  5C3P A;  1SFP A;  1RTV A;  5FYS A;  3I59 A;  5FY0 A;  3ZFF C;  2R6Q A;  1TEI A;  2Y6L A;  2ZGR A;  2WJS A;  5LCW L;  4Z92 B;  4Y1V A;  1RHI 3;  2X10 A;  3PIG A;  3WF3 A;  1UKR A;  2WAA A;  4YGD A;  4AFC A;  4CCC A;  3ALQ A;  2XWB B;  2E6V A;  4K7J A;  4NVP A;  1WWY A;  5D21 A;  3USU B;  1VMF A;  1G9F A;  1F8V A;  5A3M A;  1VP6 A;  2W1Q A;  1UO9 A;  4WM8 B;  2WN2 A;  2E53 A;  1ENR A;  1CAU B;  2JX9 A;  3DF0 A;  3POG A;  3Q8F A;  4YGC A;  2BFU L;  1V9U 1;  4JDO A;  1WLD A;  5FP4 A;  3VB9 A;  1AXK A;  2WRA A;  1ZA4 A;  4HPK A;  3UKT A;  1FNZ A;  2FMY A;  3ZIW A;  1Y43 B;  3RGB A;  2BEO A;  2BWC A;  4N90 A;  3RMY A;  3KS7 A;  1GUI A;  4RA0 A;  3FJS A;  3ABZ A;  3GAL A;  1WME A;  1PVX A;  1RMU 1;  2Q8O A;  2VL4 A;  3KQR A;  4CZS A;  2WFF 2;  3S7E A;  4I2O A;  4FXK B;  2ADE A;  4QQP A;  4NID A;  1S2E A;  4ZU5 A;  1QJX 1;  2VUA A;  3RDI A;  4Q4V 1;  5G05 L;  2ARC A;  1KS5 A;  1U5Y A;  3ZLI A;  4YZ2 A;  1JYI A;  1OA4 A;  3NO8 A;  1LNS A;  4PIY A;  2QQO A;  3LAG A;  1IPK A;  3KF3 A;  4LHS A;  5LA0 A;  2HJI A;  1CPM A;  1YLL A;  2ERF A;  4MGZ E;  5FR3 A;  2PHL A;  1J3Q A;  1VBD 1;  2R32 A;  1VBB 2;  2XGX A;  2J42 A;  1SLC A;  5FP7 A;  3JQX A;  4D94 A;  5A3W A;  5KHI A;  3MW2 A;  1ODN A;  1E5I A;  4UAP A;  3OYW A;  3D3A A;  3AMH A;  1GQP A;  3ZFF B;  3ZM8 A;  2JDK A;  4IDZ A;  2VZQ A;  4ERO A;  1Q8S A;  5ANN A;  5C8C C;  3UYJ A;  1WD4 A;  3GCX A;  3IT8 A;  4UWD A;  3LEI A;  4D69 A;  1XE0 A;  3JCI A;  2VMG A;  3I3Q A;  4DOU A;  4XCA A;  4BJ0 A;  4JV4 A;  1RIT A;  3BTX A;  4E8C A;  2VGD A;  3MI8 A;  2VUC A;  3VUO A;  4Q5O A;  3PVO A;  4XFH A;  5DDJ 2;  3RJ2 X;  4YW2 A;  4AI3 A;  2YC0 A;  3POW A;  1HRI 1;  1W06 A;  2AGS A;  2RS3 3;  2Q30 A;  2WS9 2;  1OFN A;  2VQ0 A;  4ZXK A;  1YQ6 A;  5KWR A;  1RC6 A;  1JI6 A;  3OGS A;  2DV9 A;  2NPI A;  2PQS A;  3A0N A;  3OUI A;  5LB6 A;  5AFE A;  1QNY A;  2P6C A;  3NW4 A;  4WM7 A;  2QUO A;  2YUE A;  5L9R A;  4CCD A;  3QCW A;  4XZU G;  4XHX A;  3BIE A;  2V4A A;  1ZBE 2;  5FIX A;  5ABJ A;  4UFI A;  4PCR A;  4YVS A;  1POV 1;  3VKL A;  1OOP C;  3OPW A;  1NA1 A;  1BK0 A;  2EIB A;  2DYC A;  5K8S A;  1NX9 A;  1VMJ A;  3JBG 3;  2C0Z A;  3KQ4 B;  3RYR A;  4B3N A;  3CJX A;  2EID A;  1PGS A;  3AKQ A;  3JUU A;  1S2B A;  5IVC A;  1C1F A;  1NKG A;  3E5U A;  3E6D A;  4OZX A;  1PK6 A;  1N1S A;  4XUP A;  2VZT A;  2DCT A;  4YG6 A;  1D2Q A;  5F5I A;  4XF4 A;  5FRA A;  3W5N A;  2ETE A;  1RUC 2;  1WCQ A;  3WQB A;  1MPX A;  4RHV 3;  3AZV A;  1X8M A;  2DVD A;  5A1L A;  1Q8V A;  3I2I A;  4IQP A;  2R1D A;  5DUV A;  2WZR 2;  4CDX A;  5JMO A;  2TBV A;  2B39 A;  4HON A;  4QGM A;  4AK3 A;  3A23 A;  3ETP A;  4AHX A;  2CYF A;  2WSU A;  1AYM 3;  1DF0 A;  2PMW B;  2RM2 1;  2WWJ A;  1I9R A;  2GAL A;  2VZR A;  3K46 A;  4MGI E;  3K3N A;  4CUB A;  5C3O A;  5C4W B;  5C71 A;  2E7Q A;  1EPW A;  3ECQ A;  4KWK A;  3AMM A;  2GMM A;  2QZ3 A;  4RYD A;  4YG0 A;  3VL9 A;  1OT5 A;  1ND2 C;  3VBR A;  3S57 A;  2HWD 1;  4Q1R A;  5F5A A;  3TBD A;  4QKD A;  1SHW B;  1UQX A;  1WMF A;  5BUV A;  2Y0I A;  3H50 A;  5FPB A;  2F17 A;  2RG4 A;  3CJI A;  1ZYB A;  3LOI A;  4IE5 A;  4YW6 A;  5CKQ A;  2D6P A;  2YG0 A;  4IV1 B;  2PAM A;  4DUX A;  4JCK A;  1OVP A;  2YMZ A;  1ZZB A;  2CAU A;  2B42 B;  3VDA A;  1OSG A;  4ARY A;  5JSR A;  1MR5 A;  1IS5 A;  2D5F A;  2UY8 A;  3M3E A;  5IFT A;  4I09 A;  5FYM A;  1QDO A;  3MYX A;  4GAL A;  3EHK A;  1UXX X;  1V0A A;  3NST A;  3I49 A;  5FXW A;  1QWR A;  2VMF A;  2D97 A;  3ON7 A;  4LPL A;  5BNP C;  5DG1 A;  4R52 A;  5FBJ A;  1QJU 3;  2QNK A;  1POQ A;  3AKR A;  3OY8 B;  3U75 A;  3UKN A;  3WDX A;  2BNM A;  1OOP B;  4COW A;  2A73 B;  2QZ2 A;  3HNM A;  2O8O A;  1Z7S 2;  2CSG A;  5IVY A;  2RR1 3;  4BH9 A;  1GFF 2;  1NY7 1;  3HR9 A;  4FO9 A;  1D0H A;  1AR7 1;  3OBA A;  4NHK A;  2HWE 2;  5GLV A;  3RRD A;  1UU6 A;  4XE9 A;  5FZO A;  1CIW A;  4AL9 A;  1WLC A;  2VVE A;  3APB A;  4A45 A;  5F3I A;  3RZH A;  1BHG A;  5IK5 A;  1PO1 1;  5I0U A;  4PBO A;  5DQ0 A;  2AEZ A;  5E8A A;  2ZBJ A;  4IEV A;  4LNV A;  3RYK A;  3TWI A;  2FDI A;  2WNU C;  2WUH A;  2HYX A;  4H2A A;  4R9B A;  4AHZ A;  4KMQ A;  4DO0 A;  4IV3 A;  4J1X A;  3UNP A;  2WL1 A;  5I0R A;  3ASI A;  3BGA A;  2JWP A;  4IEO A;  4DIQ A;  1AUY A;  2HEV F;  2BNO A;  5FZK A;  2QQJ A;  2P3I A;  3POE A;  4AZZ A;  1FT9 A;  2ZGK A;  4C0H A;  1AHS A;  2WA3 A;  2VZS A;  3S30 A;  3VZO A;  4BQ4 A;  5BXX A;  1GNH A;  1ND2 B;  1R1A 3;  4QPI C;  4UOJ A;  5DZF A;  5FPZ A;  3RWN A;  1GOH A;  3FLP A;  3PUQ A;  1EAH 2;  2D6L X;  4LE3 A;  1LOF C;  3OSD A;  4CDW B;  5FOJ B;  1LJ7 A;  1SZB A;  3M3O A;  4P14 A;  3ZDS A;  2FCV A;  3K51 A;  3VBF C;  4AI9 A;  1UZY A;  2VNR A;  5T5L A;  5LRR A;  5ERL A;  4MLO A;  2EIG A;  3MV1 1;  4LK6 A;  4LIT A;  4BQY A;  3CNA A;  1OHF A;  2FZ1 A;  2ZGO A;  2R7E B;  4ZS3 A;  4LKS A;  4PQQ A;  3ACH A;  5AVP A;  5CFC B;  1VIW B;  4IEW A;  5I8T A;  2NMN A;  2TNF A;  5C9A C;  4CPB D;  5EFU A;  4H7M A;  2JEN A;  1B35 A;  1A78 A;  1MS0 A;  4Y1Z A;  3ZFG C;  3N7K A;  4EV0 A;  4Y20 B;  3KCX A;  1Y3T A;  5A7O A;  1W2T A;  3C7O A;  2V5D A;  3FFZ A;  2A3X A;  4MVT A;  1US3 A;  4O9G A;  1RIR A;  4C91 A;  5JXH A;  3TN9 2;  5JZG A;  5CG8 A;  5ANQ A;  1VBC 3;  2XQR A;  3AP6 A;  4IEZ A;  3PL0 A;  2DU0 A;  3ZSE A;  2J7M A;  5ACA 3;  2WNO A;  4W6W A;  3ZXD A;  1HRV 3;  1VBB 1;  2IXK A;  1CJP A;  3U14 A;  2VNV A;  4QKF A;  1XNB A;  4JKK A;  1JMU B;  1K5M A;  4GKX A;  2V72 A;  2YZ4 A;  3LB9 A;  3U1X A;  4BK4 A;  1R08 2;  1MS9 A;  2MEV 3;  2EIE A;  5DUU A;  1DCS A;  3T0B A;  3S6P A;  2BBV A;  4RR3 A;  4KU7 A;  4Z1V A;  2D98 A;  2J1V A;  1X50 A;  3HQU A;  4CCE A;  1VMH A;  3ES4 A;  4TN7 A;  1RVF 2;  4Q2F A;  5DUX A;  1VBA 3;  2Q0A A;  3D8C A;  2CNA A;  1CZT A;  3Q8E A;  5DDJ 1;  5LK7 B;  3WDU A;  1HXS 3;  1W9S A;  4QPI B;  4UFK A;  1STM A;  2WS9 1;  3MF6 A;  3R4U A;  1O3R A;  2XB6 C;  2D44 A;  2KR2 A;  3B94 A;  1SCR A;  3LOB A;  3ROU A;  4ZXE A;  1ZRC A;  4PI0 A;  2CAV A;  1NXD 1;  3RWK X;  4CU8 A;  4N43 B;  5LRS A;  4Y5Z 0;  5EJZ B;  2IVI B;  4I0B A;  1ZBE 1;  4BIF A;  1ULE A;  5FKC A;  4MGT A;  1HV0 A;  1GZT A;  3FUQ A;  2YU2 A;  4N53 A;  3N36 A;  3RZJ A;  1JZ4 A;  2PHU A;  1NCQ C;  4GZ9 A;  1N3P A;  3NJY A;  1O4Z A;  1XJA A;  5C9A B;  1V6N A;  2XJQ A;  1C5H A;  4Q29 A;  1AJK A;  2N7G A;  1RUC 1;  2NYY A;  3FL7 A;  3IBM A;  1UZW A;  3ZFG B;  4DXT A;  2JDH A;  3FBM A;  1C8M 2;  2R30 A;  3PJQ A;  1ZX5 A;  1JBC A;  2WZR 1;  3M1H A;  4ZPI A;  3S7I A;  3WDY A;  3X29 B;  1PX3 A;  4CE8 A;  4XFB A;  4P9W A;  1I1E A;  1I5P A;  1DGR A;  2JB4 A;  5LA9 A;  3MUY 1;  5K4L A;  3QAC A;  4WM8 A;  5IWF A;  4R9A A;  1CAU A;  3WNK A;  3MDP A;  5LAT A;  4M3C B;  1UYY A;  2JDP A;  3M8L A;  4MXW B;  2JDM A;  1COV 3;  3C7F A;  4XBN A;  1OVS A;  5KC6 A;  1VRH 2;  1AYN 2;  4XW3 A;  2PAE A;  3T08 A;  2GP3 A;  1QMJ A;  4Q0V A;  3ZYI B;  3NVC A;  3J26 N;  3OCP A;  1T6B X;  1DZQ A;  4ITC A;  1W2N A;  1JZ6 A;  5DZG A;  2OPK A;  3LCP A;  5FZ8 A;  3LDR A;  2Z42 A;  1NCR C;  2VCC A;  3WNL A;  2P17 A;  5GZG A;  2JDU A;  2ZZQ A;  4N7U A;  5CZK A;  5FYI A;  1CIY A;  4BQ3 A;  4W6Y A;  4NWV A;  2JB8 A;  1O4T A;  5E89 A;  5BNO C;  5SV5 A;  3FHI B;  2WSV A;  4W6X A;  2XDV A;  5J1X A;  2VUJ A;  2NN8 A;  2WZE A;  1RJ8 A;  5T52 A;  1MS3 A;  4Z2W A;  4IUG A;  3VBO B;  1FNY A;  4NRP A;  3VBU B;  5KHJ A;  2R07 2;  5FYZ A;  5F2S A;  1FMD 3;  1PO2 3;  2DWR A;  3PME A;  2OW4 A;  3J8F 3;  2E7A A;  4AFA A;  3O0W A;  1HIX A;  4FQZ A;  1SMV A;  5EXO A;  4GWI A;  1Z7S 1;  4GAZ A;  2JE8 A;  2ZMN A;  5HI0 A;  4K6B A;  2HWE 1;  4R4Z A;  3H42 B;  2YBK A;  3R05 A;  5KHK A;  2W1W A;  2Z4F A;  3ZN4 A;  1VE0 A;  3ZR6 A;  4ZZ8 A;  4YRD A;  4D6R A;  4D7T A;  2HWC 3;  5EV7 A;  4W8J A;  2X5I C;  4OHX A;  4QX3 A;  2TEP A;  3SH4 A;  3N35 A;  2MHF A;  3N9P A;  2HWF 3;  4FT8 A;  4YVW B;  5F3G A;  4ARX A;  1RUD 3;  3E5X A;  5A6X A;  1BCX A;  3GBF A;  2UYA A;  1HKD A;  2R06 3;  3WNP A;  5C7G A;  2A6Z A;  2J1T A;  3HD8 B;  1ULC A;  5LA1 A;  1H8T B;  5LZ6 A;  4JAA A;  2W08 A;  3ZSL A;  1VPH A;  3AYD A;  2OKX A;  3VHO A;  1J59 A;  1KDK A;  2W92 A;  2XWJ B;  2X53 S;  3AC0 A;  4LIU A;  2PHT A;  4N7I A;  4X8P A;  3AK0 A;  3R0R A;  3O1V A;  5F3C A;  4GXL A;  1OLR A;  4OMD A;  3H8O A;  2ZAC A;  5IVE A;  1EAH 1;  4BIS A;  4UFL A;  3WDW A;  4BLJ A;  5IK7 A;  1WW6 A;  5HCA A;  4I30 A;  3ZIX A;  3ZMN A;  1FPN 2;  4K1Y A;  3V56 A;  1NCR B;  3LIH A;  4CDQ C;  3HT2 A;  3TEX A;  2O14 A;  1MZ6 A;  5L36 A;  3VKF C;  4R9C A;  1U5X A;  4MET A;  3H7Y A;  4P9Y A;  2X05 A;  3PUS A;  5GJ6 A;  3IPV B;  2B5H A;  3WCS A;  4JDM A;  5BNO B;  1C4R A;  4E4H A;  1ULF A;  2EA7 A;  4LXL A;  3ETQ A;  5CEH A;  5DMY A;  2JD9 A;  4COV A;  2E33 A;  2R0F A;  1F5J A;  2XJU A;  1W9W A;  3I54 A;  4LEJ A;  3WF4 A;  5EYY A;  4X8N A;  2ZA9 A;  4IEX A;  1AL2 2;  1ULD A;  2B9V A;  3AMP A;  4LO6 B;  5FZF A;  1ASJ 3;  1W8T A;  1X33 A;  5FZA A;  3UET A;  2K46 A;  3CHX A;  4M0H A;  5F9T A;  2QQP A;  3TNQ A;  3IIA A;  1DYO A;  1EV1 3;  5F2W A;  5H9R A;  1GKB A;  2MNG A;  3KSC A;  3TAY A;  1IZ3 A;  2W52 A;  1OD3 A;  2GNT A;  1XQN A;  2VH9 A;  1CN1 A;  3ORJ A;  5C4W A;  2ZMK A;  2FHR A;  2YV8 A;  4JGY C;  3TN9 1;  4I0A A;  1ONA A;  4YW3 A;  5EJ1 B;  3I2D A;  4HMZ A;  2Z5W A;  2EXJ A;  2P3K A;  3N9O A;  4NO4 A;  4UW3 A;  1W8U A;  2RS1 3;  2X5I B;  1AR8 2;  3INA A;  4I3P A;  4R8H A;  4FPC A;  2RMU 2;  4AGR A;  2VPV A;  1WGP A;  4NII A;  1R08 1;  5DZE A;  3VD5 A;  2OX0 A;  1VBC 1;  4I0W B;  2P34 A;  3AX4 A;  2BGC A;  2HLE A;  2A6W A;  2XH6 A;  4B7K A;  4CCL A;  1HB2 A;  3BU7 A;  4IV1 A;  2GN3 A;  1O3T A;  2ZEW A;  4AF9 A;  4XUN A;  1RVF 1;  2ID4 A;  1CVN A;  1C8N A;  1QJX 2;  4Q4W 3;  4RQP C;  3RI8 A;  3ZYF A;  1FAT A;  4BCU A;  3VZK A;  4BDV B;  4H3W A;  3RJR A;  4P08 A;  2FZ2 A;  1JXN A;  4JQT A;  4ZZ5 A;  2VBD A;  1RUE 2;  4DFS A;  3MFC A;  1H1M A;  4GKY A;  4AE2 A;  5C5U A;  1MS5 A;  3GCW A;  5FZL A;  3WY6 A;  5CAZ A;  2BDR A;  3MIF A;  1KD7 A;  4AQ2 A;  3ACG A;  3OY8 A;  3W5M A;  5LEJ A;  3GNE A;  1Q8P A;  2H6B A;  3TEY A;  4QX7 A;  4OI4 A;  1DG6 A;  1V6O A;  4AVV A;  2BRT A;  3VD7 A;  1XYO A;  3LEM A;  1OPO A;  3H8X A;  1BEV 3;  3LEG A;  2QDN A;  2PHX A;  5DPN A;  2AEN A;  1ST8 A;  1NLS A;  3D0S A;  4JKL A;  1MQT A;  4FTS A;  4ZU4 A;  3ZFE C;  1DFQ A;  4K3U A;  2XJR A;  1XNA A;  2IUW A;  5C33 A;  3SCF A;  4F7Z A;  2VD7 A;  4TSV A;  1GZ9 A;  2BZD A;  2D6O X;  3RYP A;  2PHD A;  1W0N A;  2JXA A;  1C8M 1;  1UOB A;  4XAC A;  3U78 A;  3OJB A;  3MEP A;  3POY A;  1U5Z A;  2BOJ A;  1VB4 A;  3KT4 A;  1EUT A;  2PN5 A;  2ZTN A;  5T54 A;  1DU3 D;  3NKT A;  3RI9 A;  1ND2 A;  1A6C A;  3PDQ A;  3ZN6 B;  2RDS A;  4A44 A;  1AX2 A;  2WWU A;  4OI1 A;  1J1T A;  4CDW A;  1AF9 A;  1W3X A;  1VRH 1;  1AYN 1;  1ZBA 2;  3DYP A;  4BXF A;  1UZV A;  3D6E A;  5CIS A;  2W68 A;  2ORX A;  1H2L A;  4CPB A;  3WQ1 A;  1CAV B;  4WVW A;  3HPN A;  3HN1 A;  1VAM A;  3B9I A;  2X09 A;  3SXW A;  2F4L A;  4DXR A;  2RVA A;  3MPP G;  4UXA A;  3AL6 A;  2ZX2 A;  4FPK A;  5CFC A;  3I3E A;  2WO7 A;  3FZ3 A;  4EN0 A;  1RUJ 3;  3B3Q E;  4P5Y A;  5CIR A;  2VZ1 A;  2VCM A;  1KJR A;  2VQU A;  1K42 A;  5FZ1 A;  2BFU S;  3CMG A;  4XUQ A;  3R4S A;  4EWA A;  4FTB A;  1ND3 B;  5HCH A;  2BJS A;  2LS6 A;  1MEC 2;  4PF1 A;  4Y20 A;  3I3M A;  1UWW A;  2WQZ C;  3KM5 A;  4LHL A;  3N4M A;  5FZG A;  4AVS A;  3O14 A;  4XUR A;  5A80 A;  4B4R A;  4XJZ A;  1BK1 A;  3ZXG A;  3ZMO A;  2GC1 A;  2Y26 A;  3PUA A;  4XIL A;  1RGS A;  2YY1 A;  1BQP A;  4GWJ A;  4QXK A;  1JOJ A;  3BOW A;  3MV0 1;  3O5S A;  1EUU A;  2WDB A;  1QXJ A;  1AR6 3;  2DBI A;  1T6G C;  4QD2 A;  3MIG A;  4Y5T A;  4QGN A;  3ZPY A; 
#chains in the Genus database with same CATH homology
 4CP9 A;  4LK6 A;  4YWA A;  1GWL A;  1V0A A;  1OKO A;  1W8T A;  1W9F A;  2KR2 A;  2LRP A;  2WYF A;  4LJH A;  4YW7 A;  2C24 A;  2JWP A;  2K46 A;  2Q1F A;  4BQ2 A;  1W8W A;  1HN0 A;  4BQ5 A;  4LKE A;  4BQ3 A;  1UOJ A;  1WCU A;  1L7L A;  4CPB D;  4CP9 B;  3ORJ A;  3ZYF A;  1OH3 A;  3UT0 A;  1W90 A;  1WZX A;  3F95 A;  3ZYH A;  4BQ4 A;  4YW6 A;  2O14 A;  4CPB A;  1GWK A;  1W8Z A;  4AL9 A;  4LKD A;  1GWM A;  1W8U A;  2LRO A;  4LKF A;  4LK7 A;  1WMX A;  5D21 A;  3ZYB A;  2VXJ A;  4A6S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...