1OH4A

Structural and thermodynamic dissection of specific mannan recognition by a carbohydrate-binding module
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
174
structure length
174
Chain Sequence
b'ARYVLAEEVDFSSPEEVKNWWNSGTWQAEFGSPDIEWNGEVGNGALQLNVKLPGKSDWEEVRVARKFERLSECEILEYDIYIPNVEGLKGRLRPYAVLNPGWVKIGLDMNNANVESAEIITFGGKEYRRFHVRIEFDRTAGVKELHIGVVGDHLRYDGPIFIDNVRLYKRTGGM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-MANNOSIDASE
publication title Structural and Thermodynamic Dissection of Specific Mannan Recognition by a Carbohydrate Binding Module, Tmcbm27
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
total genus 38
structure length 174
sequence length 174
ec nomenclature
pdb deposition date 2003-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09212 CBM27 Carbohydrate binding module 27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 1oh4A00
3LPGA 1D7PM 2VTFA 2W46A 4A3ZA 3F2ZA 4XUPA 1HN1A 5LA0A 2W5FA 5F7UA 2HYXA 3DYPA 3CKHA 2XOMA 1BHGA 5LCWL 2E31A 3I3DA 5B4NA 3ACFA 2WN3A 2ZEXA 3VD7A 3T0BA 1OF3A 1UYXA 2VO5A 2VZUA 4XZUG 3VD5A 1JYVA 2JKXA 3MUY1 1H6YA 4A44A 4ZZ8A 4JKLA 3W5NA 3FHQA 1UY4A 4Z2AA 2EICA 4KMQA 2JE8A 5J1XA 2W47A 3VD9A 5A1AA 4DUXA 4P5YA 3WNKA 3FN9A 4P08A 4DXRA 4A6OA 1JHJA 4PF1A 3WNNA 3WNOA 2RJ2A 1WCQA 2XQXA 1GMMA 5G05L 3HNMA 1PMJX 2VCBA 2VZPA 4QAWA 3IAPA 3SEPA 1H6XA 1UY1A 3J7HA 4QX1A 3ZM8A 2W87A 1IQDC 5EJ1B 2BGOA 2V4VA 3WF0A 5FUIA 1GUIA 3CMGA 3VDBA 2W1QA 3I2IA 1W99A 1JU3A 3VDCA 1JZ6A 1W8OA 4JX0A 1YQ2A 4D8MA 4KWUA 3T0DA 4LPLA 4A41A 1UXXX 2BERA 3DECA 4BK5A 3IDAA 1CIYA 1DLCA 3C7FA 2DDUA 2W1SA 1CZSA 4BXSV 4QB6A 5C71A 3HEIA 2QQJA 3AC0A 3K4ZA 1XC6A 2DCJA 4OMCA 2VZOA 1I5PA 2WUHA 2YC4A 3THDA 4ZZ5A 3T0AA 3WF3A 4BDVB 4XUQA 2XONA 3WF2A 3I2GA 2LS6A 3T2QA 2R7EB 2VOTA 2WQ8A 4GZ9A 3FHAA 1W0NA 2Z4FA 2VZ3A 3SEEA 1CZVA 3I2KA 3K4AA 3PUHA 3HPNA 2QQKA 2WN2A 3WNLA 3K46A 3C7GA 4MGSA 4MOAA 1UYZA 1NKGA 2W91A 3P1IA 4CU7A 5JXHA 1NAEA 3I3EA 1F4HA 2VMCA 4DXTA 1OH4A 4M4RA 2VZTA 2ZEWA 5IHRA 2W94A 5C70A 1UYYA 1ULPA 3OGVA 1O8SA 5DQ0A 5EIYB 1GOFA 2WYSA 3I97A 3OEAA 1L7QA 2J22A 2W92A 2ZEYA 4W50A 3WF4A 1UXZA 1J83A 4JKKA 3NRUA 3UNPA 2PQSA 1XPWA 4CUBA 5DPNA 3C7OA 5JR2A 1OD3A 1EUUA 4D0QA 4CVUA 5HXMA 1JYXA 4YPJA 4OYUA 4XURA 1UWWA 2VL4A 5G04L 2W3JA 3HOBA 4CUCA 1JZ4A 2WDBA 3CZUA 3LQCA 3LE0A 5EJZB 3ETPA 1W9SA 1W8NA 2E26A 2J1AA 4XUOA 2VQUA 4QX3A 2DCKA 3DYMA 3U37A 3ACIA 3HJRA 4RYDA 3MV11 4QDSA 3MV01 4TXWA 4E8DA 3OB8A 1XNTA 3DYOA 2WAAA 3WNMA 2YG0A 4PT6A 3OBAA 1UY3A 1DYOA 2L9LA 4A4AA 1NUKA 1K3IA 2VMDA 2RV9A 2X09A 2EIBA 3ACGA 3THCA 2ZEZA 5HPOA 1UX7A 5JXGA 2WO2A 3T08A 4XUNA 4XUTA 5JXIA 3ABZA 4GWIA 4UI9L 2OKXA 3WNPA 1GQPA 3HNBM 1SDDB 1ULOA 1JZ7A 2J1RA 1NX9A 2JD9A 3GM8A 2VM9A 4MO3M 1JI6A 3K77A 4JHZA 1J84A 2VZRA 4QDRA 4CU9A 1UZ0A 4CUAA 2WABA 3I2JA 3BGAA 1OT5A 2J1SA 3WF1A 1PX4A 5IFTA 1W9TA 4PQQA 3NJVA 3ACHA 1DP0A 3IB3A 2YFZA 2WZ8A 3UESA 3T2OA 3FL7A 1JU4A 3SKVA 3OEBA 1SHWB 4ET7A 4OUEA 3I3BA 5JUVA 3W5MA 2VMEA 3GXUA 2QBXA 4AAXA 3HN3A 3NNGA 3GGLA 1OF4A 1KGYA 2J1EA 3HNYM 3EB7A 2YC2A 4DEVA 3T2PA 3A23A 3GDBA 3VD4A 5CYYA 2VCAA 4L0PA 4QPWA 1JYWA 1W9WA 2BZDA 3A21A 3WQBA 5IJRA 1JZ5A 4ARYA 2ORZA 3LEGA 4QDQA 2W9XA 2W95A 3C7HA 1GOGA 2WAOA 2Y6KA 3LEKA 4BJ0A 4BK4A 3BN6A 1US2A 3VDAA 2BGPA 3E1F1 4HG6B 2Y64A 2YFUA 1JZ8A 1PMHX 2VZVA 1PX3A 4LQRA 4P02B 2Y6HA 3IAQA 2WO1A 3VD3A 4DEQA 2VQTA 1WKYA 4MADA 3WEZA 4LHSA 2VR4A 3T09A 4IUGA 2QQMA 1MPXA 1US3A 2B4KA 2ZXQA 3CDZB 3MUZ1 1JZ3A 3NQHA 4A45A 4CU6A 1K12A 3OG2A 5C7GA 1UY2A 4KI5M 3UETA 5LA1A 2J7MA 1JYNA 2J1VA 4QB1A 1UMIA 2QQLA 3PUIA 3SKJE 2QQNA 2CDPA 4ZXEA 4W4ZA 1O8PA 1JZ2A 1LNSA 2EIDA 2VJXA 4P00B 1KEXA 2J1TA 4UAPA 2X10A 4OMDA 2X05A 2V72A 2B9VA 5LA2A 4AG4A 3IIIA 1EUTA 2BBAA 1K42A 1L7RA 1UMHA 1GU3A 2KD7A 2E33A 2VCCA 4M4PA 2Y6LA 3JXSA 2WBKA 2VZQA 5CZKA 1UY0A 2E32A 4DUWA 3I2FA 1R64A 3CQOA 3EYPA 3OGSA 4RN5A 3P6BA 5IYYA 1O59A 2C9KA 1CX1A 2W1UA 2VZSA 3D3AA 2YB7A 1F4AA 3C8XA 2Y8KA 3CIHA 2Y6JA 4ZY9A 5JMOA 2V5DA 5IFPA 1CZTA 1GOHA 4A42A 4QB2A 1TVGA 2RVAA 1XNAA 3CZJA 5JXJA 1K45A 5DN2A 1P8JA 2ORXA 4UOJA 3OGRA 4W8JA 2XHNA 5B4XA 2J1UA 4LKSA 4QX0A 2EIEA 2JDAA 4MGQA 2QQIA 1T2XA 2C26A 2ID4A 2LW8A 3LPFA 3MBWA 2VC9A 2CDOA 5I0DA 3WSOA 4DXSA 2VMFA 3MO4A 1RYYA 3A22A 3A7QA 3K4DA 2VZ1A 4TTGA 4CU8A 3NJXA 2QQOA 4OZOA 1TG7A 2C4XA 2WO3A 3C7EA 2W1WA 4FI9A 4E8CA 5DMYA 4DUVA 2WZEA 3K75B 4JKMA 4QX2A 2HLEA 4GWJA 3ECQA 3LEIA 2Y6GA 3I2HA 4XVHA 1SG3A 4ARXA 1GNYA
chains in the Genus database with same CATH superfamily
3IDEA 4CCCA 3TN93 2W46A 5CKMA 3ZFFA 4AEKA 4B4PA 2EAKA 3F2ZA 1J1TA 1HN1A 4XUPA 3VBSB 2VMIA 4EWEA 1AZDA 2D3PA 1LCLA 2RS32 2HYXA 2W5FA 2Y38A 1RUD3 3LOIA 4ITCA 1PVC1 4Q1PA 2XOMA 3VBRA 1Z7S2 2RDNA 4UF0B 4CRQA 5FMDA 1RVF2 1JOJA 5LCWL 2E31A 3ACLA 4XHXA 1J3PA 1DDLA 2AEYA 4XCBA 3ASIA 5KHKA 3MHZA 3U14A 3V64A 2JDHA 1ZBA2 1A6CA 3DN7A 4XDQA 2VULA 5D21A 4AQ2A 1OF3A 3ATGA 4IV1A 1RMU3 2VG9A 1N1YA 1VBA1 1X50A 1LOEA 2JICA 2Q30A 4IE4A 1JYVA 1W8UA 3PUQA 4NR1A 3ORJA 4MUVA 2RR11 4NWVA 5E88A 1YCIA 1W6QB 2DTYA 1H6YA 4YM0A 5F6KA 1IS6A 3AMPA 4UW3A 2BU9A 2WNUA 4URAA 1YNAA 2R16A 5F39A 1GICA 2D6PA 2BGCA 2EICA 1GWKA 2JE8A 3VKOA 4MXWA 2ZZJA 4HPKB 1GANA 2VECA 3VZJA 1PO12 1CGPA 1AR62 4Q4Y3 3ILFA 3BPSA 4I30A 3WX5A 2WNVC 1OUSA 2GP5A 3FN9A 2GNDA 3PUSA 4A6OA 4DXRA 2Q8EA 2WINB 1PNGA 2V5YA 1YXWA 5LB6A 4LIVA 1NY71 4KGQA 2ZAAA 4NPMA 1VE0A 4HFSA 1M06G 5G05L 1JYCA 5IK8A 3C2UA 5I8SA 4Q8KA 5BNOB 3M2MA 5FXXA 2YPDA 4B4RA 4DB5A 2VZPA 2JG9B 1UPIA 1APNA 3NV4A 2IXJA 3J7HA 3DXUA 1PVC3 4XIOA 1COV3 3ZM8A 2P34A 3KT1A 2FCVA 3OSDA 2BUKA 3IKWA 4UBHA 3B00A 1GP6A 3WDXA 4P5HA 1OA4A 1HRV2 3NV1A 4QGLA 2DVBA 1NQDA 4EN6B 4LT5A 1CAVA 4Y20B 4EQVA 3VGIA 4RFT0 1D0GA 2W1QA 3VDBA 3VDCA 4L11A 2WS92 1JZ6A 1W8OA 1JYTA 5AC91 3PJYA 4CDWB 1S2KA 1HB1A 2ZS6B 1PGL1 3THTA 4D8MA 1WMFA 4L97A 1NA1A 4LPLA 3MZHA 1MVQA 3JB8A 3FUOA 1CX4A 1K5MB 2ZMNA 3ZX7A 2JENA 1SQ4A 2BERA 3AL5A 4YYOA 3WG4A 1E5IA 1QJU1 2DDUA 1ENSA 3OPWA 5IK7A 4FAHA 1DFQA 2ZGTA 4YLZA 1EV11 2DUPA 4RL7A 1HDKA 3LF7A 3ZXDA 5C71A 3APBA 3HEIA 1WLWA 4CCOA 5F2WA 1BBT1 5F3EA 1XOYA 4K21A 3DEMA 2D6KA 5FYHA 4K3UA 3JQXA 3AC0A 5T3NA 1YJKA 1XC6A 2W08A 3POEA 1ALYA 2VZOA 3TB0A 4R8HA 2VBPA 3VBUB 4ZZ5A 1YFYA 1R091 4IE0A 3CBNA 1FV3A 4Y4YA 3ZXJA 5FY0A 5FOBB 5GZGA 1OFSA 1Y9GA 2B39A 3CU7A 3GHNA 2LS6A 5KC6A 2BEOA 4Z92B 1RUF2 2HEYF 3USUA 2BYVE 2HBTA 5CFDC 3HMYA 5FIXA 2LALA 1IKQA 3HBKA 1AXZA 4GZ9A 2VBDA 4PLMA 5C4WA 3I2KA 2D98A 3KHBA 3IWZA 3OD4A 3PVOA 4NRQA 4CE8A 1OLRA 2P6HA 3NNMA 1UYZA 2W91A 3P1IA 4CU7A 2VTXA 3AKSA 3P5BA 4QXKA 3N9PA 4XFCA 4KL1A 5A3UA 1FYUA 3BB6A 1NAEA 1MR5A 2ZOEB 2HWB1 1GZ9A 1R1ZA 2VMCA 2XDVA 1PO22 1OH4A 4GKYA 5IVYA 1MS9A 3SITA 2GSYA 2ZEWA 3TN92 1PM7A 1KS5A 3AP9A 1EV13 5I0TA 4H3WA 5A33B 5F3IA 3EJKA 5BNPA 1BBT3 2BP6A 1RUD2 4GWNA 3ZYPA 4QHOA 1YI9A 1O8SA 2TNFA 1GOFA 1ZA7A 1QKQA 4Y5SA 1DGLA 1RUJ3 2P1BA 1LOAA 4JGYA 1SCSA 2VH9A 4FPJA 2YDEA 5LA9A 5C3PA 1S2BA 3RYRA 2W92A 3KB5A 2NN8A 4RQPB 4RS5C 2ZEYA 4JRLA 5CFCB 4W50A 2BNOA 2H0BA 4I0WB 1RMU2 1J83A 3K48A 4CCDA 1VBB2 2PQSA 3O0XA 2MEV1 3HD8B 1SBFA 4NN0A 3FMGA 4CUBA 4LO4B 3OUIA 4Q4V2 4AHWA 3BTYA 4DQAA 2UURA 3KVAA 3KD4A 3JUUA 4SBVA 3HIFA 1IG3A 2FBEA 4CVUA 1JYXA 2JDKA 2AC1A 3FUQA 5A6ZA 1UWWA 2VL4A 3OBRA 3HOBA 3KF5A 5FMOL 4YG0A 5L73A 3ES4A 3O0VA 4Q4Y2 4Q29A 2HJIA 1TZOA 2ZCWA 4MGIE 2VW1A 2D7FA 2XGXA 5LBCA 4IV1C 4X6RB 1AR83 1CIWA 2HWC3 1H1AA 4K1ZA 4AAPA 1S0IA 2WWUA 3CF6E 4LXLA 4V2VA 4YG3A 2HWB3 3MPPG 3ZYJB 3NAPA 4EV0A 1WZXA 3T4HB 4BHPA 5IVJA 3AL6A 2C5DA 4HETA 3CEWA 3MV11 3BTXA 2HWE1 3WQ1A 5GLZA 4QQ2A 2XR4A 1VRH2 3OB8A 3MFAA 4E8DA 5A7PA 2XH6A 1Q8OA 1RTVA 2YG0A 1OOPC 4CDUB 4CEYC 5FOJB 4IEPA 3VKLA 2A70A 5IVBA 5CADA 2EXJA 4JTOA 3ZFGA 2EIGA 2ZGUA 3ACGA 3VZLA 2PLV1 5JXGA 2MEV3 4NAOA 2WO2A 4X8PA 3TBDA 2P4EA 2PA7A 4XUNA 4XUTA 5JXIA 3VUOA 1JS9A 3ABZA 2G19A 3PMSA 4UFMA 3J9SA 1GQPA 4AI3A 3BI3A 5BXXA 1YEWA 1NX9A 4NHMA 2XPJA 4MYEA 2RS11 1BYHA 1WGPA 3JCIA 4MO3M 1JI6A 1XU1A 4PCRA 4V1PA 3X29B 3GJAA 1UIKA 4YG6A 3QD6A 1TMF1 1UPSA 3NNLA 2IXKA 4HKLA 2DVAA 1WUVA 1OT5A 3WF1A 1PNFA 1W2UA 5DUVA 2A6ZA 5IFTA 2VBBA 1DZTA 1I1EA 4PQQA 3UT0A 1YFWA 4ISRA 4DO0A 4GA9A 4CUGA 1W9YA 4LBOA 3SH3A 5GALA 2ET1A 1Q8PA 1GZWA 3FL7A 3SKVA 3RWKX 3ZXAC 1IZ3A 2BWCA 1D4M3 5JUVA 2NMNA 4NHKA 4NUBA 1OPMA 2VMEA 2R071 5JZGB 4M01A 3LA2A 1V6OA 3ZFEA 1ZZ7A 3OJBA 3O0WA 1OF4A 3OGJA 1KGYA 3E5UA 4I01A 1VAKA 2ERFA 4JC1A 2ZX2A 1CAUB 1YQ6A 2J1EA 5FLHA 2WYFA 3B01A 5IUQA 2BTVC 2W68A 4D69A 3KHCA 4XCAA 2VE1A 4XFFA 2WWSA 1H8TA 3LIHA 2C0ZA 2R043 2PLV3 2GH8A 4DXZA 2IXLA 2JEMA 5T5PA 3AZXA 1PHMA 4GB31 4LHNA 3N9OA 3I2OA 1OHFA 4ATFA 1V6NA 2JECA 2OT7A 1BVVA 1QJY1 1F35A 5FO7B 3BVCA 3S0MA 1LAJA 3P3NA 3KQ4B 3KLSA 4ARYA 4I2OA 1Q5OA 1AUYA 2QVSB 2CGPA 3PTRB 1WCUA 1N1SA 1POV1 1ND2A 3AFGA 4BCUA 3C3VA 2E63A 1ZNPA 4UWDA 3VB9A 1TMF3 1NLSA 2WAOA 5GLUA 2GNTA 3UKTA 1RGSA 1J3QA 4OFGA 1X33A 1RINA 3WHUA 3BN6A 4BQWA 4O9GA 5ISLA 4I09A 5FZOA 4JDMA 2A3XA 2VMGA 2YBSA 2PHUA 3POGA 3PU3A 2YFUA 4XF1A 5E16A 2FDGA 4RA0A 4XQ4A 1XXNA 4LQRA 4BZ4A 2Y6HA 2GMMA 3A0KA 4AVBA 1RUJ2 3DKQA 3T3YA 3AVSA 3M7AA 4NAMA 2NMOA 5H9RA 2JB8A 2WO1A 5LW9A 4QPYA 2D44A 4LHSA 3NL1A 1JTZX 4MX3A 4IUGA 4IV3A 2OPWA 2GNBA 1MPXA 1US3A 1KD7A 3CDZB 3FFZA 3KVBA 3NQHA 5DAPA 1ENQA 5EFUA 3UKVA 5D8AA 1JZ3A 5FDBA 1FOD2 1AYN1 1K12A 1ND3A 2PHWA 3OTFA 4MGYE 4P14A 3ZYRA 5BNPC 5JSPA 5JOXA 1GP5A 4QKFA 2J7MA 1OSGA 2JXAA 5FPVA 3KSCA 5AFEA 4D3WA 4J1WA 3I59A 1VMHA 4XEZA 3LDKA 1CAXA 4DINB 5C9AA 1UMIA 3GBWA 3LB9A 3MW2A 4JGYC 2Q0AA 3PUIA 1W3VA 2GC0A 4YZ3A 1A8DA 3SKJE 5C3RA 3VZKA 4WM8C 4AVSA 3ETQA 4B8EA 4W4ZA 1AR82 4C0HA 1SZBA 4PDWB 2HWC2 1JZ2A 1ODMA 3ZXKA 2RM21 1TEIA 1Q8SA 1KEXA 2A6VA 4WVMA 3RJRA 1FMD2 3WNXA 3J26N 4L2NA 3H0OA 1LTEA 5TSWA 3VN4A 2ZX0A 2CTVA 1MZFA 1NCRC 5LA2A 5CB7A 4AG4A 4YVSB 3U4XA 3OUHA 1J3RA 3MIFA 1UMHA 3PURA 3S7EA 4M3CF 1MS8A 1CONA 4M4PA 2EVXA 5HCAA 1UF2C 2LTNA 2P3JA 2CHHA 2RG4A 4Y1YA 1OVSA 2OUJA 3VV1A 1R1A2 1ASJ1 2OUHA 2IXCA 4JHTA 2E7TA 3ZDVA 2EA7A 4QPGA 4XIKA 1UY0A 2RDSA 4NRPA 1GNZA 5ACA2 2JD4A 1EYBA 4BA6A 1VMFA 4JGZC 4EJRA 3RZGA 3DKWA 4BQYA 1CWPA 3CQOA 2PHTA 5EXOA 4QX8A 1JUHA 5JI9A 4ZKTB 4QKDA 2B46X 1XNBA 4FOVA 4YW2A 2G9FA 3H8OA 5J96B 4S2HA 2R6QA 4AFAA 2VW0A 4RR3A 1NCQB 4BLIA 4K9SA 4W65A 1VBE2 3VBFB 2AEZA 4QXBA 5AVAA 4LO7A 5IYYA 1BLZA 4J6GA 1C8M3 4OUMA 5BYNA 3UV9A 2Y8KA 1HLCA 2Y6JA 2DV9A 2RM23 5IFPA 2JX9A 1CZTA 1GOHA 2EAAA 4QB2A 5CKNA 2LRPA 4XHBA 4XJWA 5JOYA 2DU1A 4Y1ZA 2O8QA 1UOBA 3WP4A 1MQTA 1D4M2 5L9VA 5B4XA 4YFZA 2J1UA 5DZEA 1RB8G 1IS3A 1S0GA 2QDNA 4JV4A 2NQYA 3NVCA 2EXKA 2JDAA 3BIWE 3BOWA 3WG2A 1BMV1 4NHXA 5FP9A 1BEV1 1T2XA 1NZCA 1NG0A 5EPAA 5FJHA 2AREA 2ID4A 4AHXA 2IVIB 1CPMA 1ZX5A 1WLDA 3H42B 2D6NA 2R042 1W6OA 2OYZA 4AEDB 5C3OA 2VMFA 3CL1A 2ZGNA 3MO4A 5HBAA 3WINE 4YZ1A 1V6IA 1REEA 2JIGA 2VZ1A 4ORFA 4TWTA 2JDYA 4TTGA 2BPA2 1O4TA 1X9PA 2BV4A 2QTWB 1W8ZA 3CJIC 3Q8AA 4GALA 4OZOA 1TG7A 1G7YA 2WO3A 4E8CA 3MIDA 4CA9A 3AP4A 1RITA 3O7OA 4IESA 3SCHA 3N35A 1XRUA 1RUI1 2R061 1UKRA 4OI2A 4CPBD 1WCSA 4OHXA 3ECQA 3LEIA 4ZS3A 3ZYIB 1H2LA 2GNMA 2Z42A 3R6SA 4CEWB 5CG8A 1R082 1ZZCA 4YGCA 1CJPA 4QPIB 5FUPA 5KXEA 1C8NA 3WQ0A 4E4HA 3IMNA 3CKHA 4UT5A 3KT4A 4LBQA 3AYAA 1WMXA 2XBO1 1DZRA 3AVRA 1RUG1 5FXWA 5T54A 4IW3A 3PUAA 4CCLA 3ACFA 5FPXA 2WN3A 3DPRB 1SFYA 2ZEXA 4YW1A 1Q8VA 1QJX2 5FYMA 5LY1A 3VD7A 4ES9A 1H9PA 3AJYA 4Z1VA 4JCKA 5F32A 2AACA 2VO5A 2VZUA 2ZBJA 4XZUG 4PI2A 1V6LA 5FMOS 5FYTA 3EQEA 2B42B 4B3NA 2WZR2 1X8EA 2UYBA 3I7DA 4ZZ8A 3W5NA 1MS1A 1PK6B 1UY4A 2JDUA 5HCHA 4LBQD 5IW0A 4Z2AA 4ISQA 4KMQA 4BPZA 4CEYA 2OS2A 2W47A 1O3TA 1AL21 1VJ2A 2IXIA 3QLQA 4FPFA 4DUXA 1TME1 3RI8A 2NPIA 1AVBA 5A6YA 3N7LA 5D8AC 2R063 2IFWA 1ND3C 4K8FA 4YW6A 5LBBA 3OCPA 4AEMA 2RS52 1EAH1 4IDZA 4DIQA 3DGTA 3T1MA 1TNFA 5KHGA 1LJ7A 2RJ2A 1WCQA 4DFSA 1Y9QA 1DIWA 3HNMA 1RUOA 1A3KA 4QAWA 3IAPA 3SEPA 2XJQA 2BVBA 2FDJA 4XOGA 2GZWA 2XL9A 3ZR6A 1H6XA 4BU2A 4GH4B 2HWF3 4IEVA 3VL8A 1GYKA 3AP5A 2XBO3 1LESA 1EY2A 2FMYA 5JIAA 3E6DA 4HL0A 4YARA 2ZAHA 4AR2A 5EJ1B 1CAWB 4ES8A 1DBNA 2GMEA 2V4VA 4N7IA 5K4LA 4AW7A 5GLTA 3H8XA 5T5OA 2NP0A 1GUIA 3CMGA 3RWNA 2QUOA 3DV8A 1H4HA 3UGFA 4JQRA 4K40A 3OY8B 4CDWA 3M1HA 3VBOC 1MVEA 4XF0A 5DABA 5CIRA 5C8CC 4XFGA 4N53A 4XJZA 1AR72 2XVLA 3KS7A 3LSEA 5EZWA 5FMBA 4GWMA 4A41A 1V6JA 1K5MA 2J42A 3OPZA 1RXFA 1DZQA 5GZDA 4D7TA 5IT6A 3DECA 3DXTA 4O65A 1O4ZA 1C8M2 5BY5A 4EZHA 4QPGC 2K9ZA 3H3ZA 4W6XA 1X36A 1Y43B 2W1SA 3CHXA 1OMIA 3JZVA 1WA6X 1H0BA 4BXSV 1QH7A 1ZRFA 2JJ6A 2D43A 3FWEA 4QB6A 3ZXLA 2QQJA 2JG8B 3NW4A 1FATA 1DGRN 1SDWA 4KG0A 4LK7A 4NWWA 1A8MA 5IAXA 2GC2A 2XKPA 1HB4A 4PJYA 1ULDA 3MF6A 3M4FA 4XJ9A 2DCJA 4OMCA 2DFCA 3D8CA 4BISA 1QJEA 1E5SA 4IQPA 4KWJA 1KXGA 1ZBE2 2WUHA 4HMZA 4FPHA 1LR5A 4OHYA 1H4GA 2ZX4A 4YGEA 5A32B 2BOIA 1UZZA 1X7NA 2QE3A 1AL0G 1XNCA 3WF3A 3BALA 3BUCA 1VBC1 3VLBB 4TN7A 3GCXA 2D3SA 3R4DB 4KG8A 3ZPOA 4BDVB 3OBTA 5FZ9A 4GXLA 4LUKA 3ZN6A 2FZ1A 1RUH3 3O1PA 2XLAA 2UWCA 1UU5A 1F2NA 3UKNA 3JD73 4NHLA 4GD4A 1ODNA 1S4CA 1YWKA 3AMMA 1QXPA 2PHFA 4P9XA 4CXXA 2C1FA 2WFF1 4NIGA 2VZ3A 3AX4A 1F5FA 4LA2A 3S7IA 1AF9A 2YGLA 4WVZA 3VBHB 1CZVA 2I07B 1GBGA 2E7AA 4QHZA 3PUHA 4M3CB 4IGOA 1LHNA 2XVGA 4XBLA 4MV2A 3K46A 4RS5A 5FMCA 3WNLA 5IVEA 4MGSA 1W2OA 1WLTA 2RDRA 2ZGRA 3TEXA 4MZUA 4B1MA 2Y6FA 2GALA 4XZPA 3JBG1 4FT8A 4M00A 2VVEA 3S5AA 3M3EA 4M4RA 2ARXA 4FPYA 3CJXA 5T5JA 4DS0A 5IHRA 3PMEA 3AZWA 2K0GA 4BQ5A 4EWAA 3UGHA 1S0CA 3WCRA 3D0JA 5C70A 1UYYA 5IK5A 1BKZA 1ULPA 3NNFA 3P3PA 4WM7C 1IQAA 1W03A 1OQEA 2JB4A 2BNMA 2LROA 3K3NA 4XPVA 3IDCB 5DUXA 3GZUC 5EIYB 4LBNA 2DCTA 1N47A 4N8MA 2Q1ZB 5HXVA 3AZYA 1GFF2 4QKBA 3RZLA 1G9BA 1G9DA 3N4MA 2FDFA 2PHLA 1XNKA 1QU0A 1DCSA 4AEJA 1VBC3 4GJYA 4CP9A 4JKKA 1LOBA 4YM1A 1W0PA 1XPWA 4Q4X2 3AYCA 5JR2A 3VBSC 2ZA9A 1BK1A 1HN0A 1DF0A 4CYDA 2WNVB 3N9NA 4QXCA 2PMWB 1ACCA 1HRI3 1OOPA 2XJPA 1N3QA 2WFF3 3I54A 4OYUA 4XURA 3RNSA 2ZHMA 1LU2A 2DWRA 3VZOA 5F8PA 4OI1A 1JYIA 4YGDA 5EJZB 5E1RA 5FJKA 1FT9A 3ETPA 4CZSA 2R0HA 2E26A 2FCUA 3H8RA 2HH9A 4XUOA 3JBG3 4OLLA 2EXIA 2Q4SA 3ZYBA 4COVA 2PN5A 2Y60A 4FVVA 3CO2A 3U37A 1Y4WA 4HSLA 1V9U2 5T52A 4AFMA 1XYOA 1HJFA 3ZXFA 4O61A 1PZ7A 2HWF2 2TEPA 3KF3A 4K20A 4LKDA 3ZMNA 4AL9A 1HKDA 5GM0A 5C5TA 3H7JA 3DYOA 4LR4A 4S2DA 4Y1XA 1VBD1 2BNNA 4R9DA 4JRAA 2JKBA 2OVUA 2XKOA 4LBKA 3OBAA 1YYNA 1UY3A 1DYOA 4UW4A 4XILA 3UL2A 3O1TA 4OQ9A 1VBA3 2CAUA 5EP9A 3NWKA 3LKJA 1W8TA 5JWPA 2RV9A 5BNOC 2RR13 4XMIA 1D4VB 5HPOA 1UX7A 5JPNB 1IS5A 5F3CA 1YQCA 1SLLA 1UCXA 2BFUS 2JG9C 3JQWA 4P9JA 5AFBA 4BQ1A 3G7DA 4DRVA 4A2UA 4GWIA 3POWA 1UL9A 1SDDB 3HNBM 3VHRA 1JZ7A 2JD9A 3I3MA 2K2SA 4QGNA 4C91A 5FY4A 4JHZA 4FP3A 4OHWA 1UZ0A 2IXHA 4QM9A 3AKQA 1UN1A 4CUAA 4Q26A 3I2JA 4IL7A 3BGAA 3KGLA 4W6WA 3WR0A 3KCXA 4LNVA 2D6LX 3Q8BA 4AQTA 3ACHA 4CDWC 3IDBB 4BMEA 1M4WA 2YFZA 3IIAA 4QQLA 3AMQA 4MH0E 3KMHA 5FYCA 4N53C 1SHWB 3U11A 3N9LA 4UXAA 1K5MC 1TNRA 4QX7A 3W5MA 3SCFA 3R4UA 1I6XA 5L9RA 1RUNA 2ZGSA 5H9PA 1QMJA 3O1RA 5FP8A 1K5JA 2ZHNA 1CQ9A 1VBD3 3GGLA 1LHVA 1O3QA 4MLOA 1U5YA 1VAVA 1RUH2 4RGGA 2A73B 2ZTNA 3HNYM 4LK6A 4YW5A 3EB7A 3PL0A 3JD72 1FI2A 1W2NA 5AC93 1UAIA 3D0SA 1HXS2 3GF6A 4Q0QA 3GDBA 3WT3A 1VALA 2I2SA 3FBMA 4DMIA 3IPVB 3VD4A 5LEJA 4GAZA 3VBUC 2VOVA 4QPWA 3BCWA 1DQ5A 1IPSA 3ZYHA 3HR9A 3A21A 5FWEA 3O1UA 5FLIA 4K6BA 4N43B 2ORZA 4Y5Z0 2RHPA 1LEDA 3ALQA 1QJU3 1HB2A 3LEGA 3SMHA 1JUIA 1XJAA 2W9XA 3ZSLA 5K7PA 1F5JA 4IEYA 4Y22A 5FO8B 1AJOA 3AM2A 5FYZA 2UU8A 2XQRA 1G9FA 2WJSA 1GWLA 3M8LA 1ZZBA 2ZGMA 4QWNA 4RHV1 4R9CA 3OOXA 5FZIA 2RMU1 3VDAA 3E1F1 4LLOA 5F6LB 3H1MA 3B93A 2KA3A 1W6NB 4AFBA 4E2SA 1Q3EA 1RIRA 5A3LA 2ZGOA 4OZXA 4YVWB 2ETEA 4HVRA 4Y1VA 5CISA 4WM8A 1R093 4EN8B 4LA3A 1C5HA 3H3UA 4XC9A 3ZFFB 3VD3A 4DEQA 2HWD1 2VQTA 3LD8A 1ULCA 4GMP0 4IEUA 1HIXA 3WEZA 4ASLA 5I0SA 5I8YA 3HAGA 3T09A 3VBRB 1WD4A 3ZVXA 1W90A 1DQ1A 2CU5A 4KBZA 1ZRRA 1JODA 2BWAA 1DYKA 2B4KA 1UZWA 1PVXA 2B8MA 2ZXQA 3K51A 4O9EA 3ZN5A 4A45A 4CU6A 1NCRA 1VPHA 4TLGA 4XFAA 4EE2A 2V09A 4ZU5A 5ABJB 3BOPA 1L3JA 5LA1A 4LO5B 4GQ7A 1HRI2 1RUE1 2QQWA 4IV1B 2J1VA 4L92A 4QB1A 4YM3A 2C6SA 4XBQA 4MGZE 3WHTA 4INDA 1VRBA 1XB9A 2K46A 1LHOA 4RQPC 5CFCC 3WLUA 4XJAA 3WD5A 2AYHA 2TUNA 1RHI1 2QQNA 4OULA 4XF4A 2WFPA 4ZXEA 3S30A 1O8PA 3EMRA 2WNUB 3RJ2X 1AXKA 1QQP1 2CY6A 4M0NA 4FTEA 4JGZA 4MXWB 4UAPA 3N36A 2DVGA 1LOCA 4RHV3 4OMDA 1LODA 1IOAA 4IXLA 1PVC2 1COV2 4A7ZA 1QJFA 2V72A 2RMU3 1O4YA 4BMBA 1BQPA 3J8F1 5GKAC 1K42A 1L7RA 2D5HA 1XBFA 1GU3A 1S0JA 3MFCA 3TYJA 5B2GB 2YU2A 4Z07A 4ZU7A 1T6BX 4YFWA 1VBA2 3ZXEA 2HWD3 4YZ2A 5IK4A 4UBGA 5J36A 4XQWA 2RR12 5CZKA 4R9AA 2VPVA 4O7XA 3M3OA 5I0UA 3U1XA 1XNDA 3PTYA 5ANNA 1WMEA 4MG2A 4XYXA 4DUWA 2WLPA 1ULGA 2PTMA 3Q8FA 4COZA 3M3QA 4F3JA 3BYWA 1H30A 5FPUA 1JOPA 2PYTA 1AYM1 1C4RA 1CAVB 2X29A 4HVQA 1RUE3 1LOGA 2VNRA 2Z69A 4HK9A 4Q0UA 4RD7A 4XAEA 4AQ6A 5CEHA 1KDMA 1Q43A 3OBZA 3ZYGA 2FDHA 4S2FA 1NY72 1O59A 4H14A 1CJDA 2DCZA 4QU2A 5L7OA 1CX1A 3D3AA 4PBPA 3J7MA 1YQ5A 5FPZA 1NA1B 5FZ0A 3U4SA 1WCDJ 4AI1A 4K1YA 5JMOA 2FHRA 5KHHA 3POFA 1TVGA 4UFHA 4AQSA 1OLQA 4QU1A 3CZJA 2HWE3 5KBFA 5FKBA 2YU1A 1K45A 4UW6A 3CJIA 5A6XA 1F15A 3DL3A 1DG6A 4UOJA 5FY5A 4P9YA 1XE7A 1POQA 3OGRA 4Q27A 4RFRB 3VDDB 1VLNA 2P3YA 1EP0A 3ROUA 1YFUA 1NXD1 3T2TA 4AE2A 5K0UB 4DNYA 3ZOIA 1XE0A 5D1IA 5FYIA 2QQIA 2MNGA 2Z79A 3H8UA 1CN1A 1LKNA 2DURA 2WKKA 5I0DA 5AC92 3DF0A 5KWRA 4DZGA 2XWBB 4DXSA 1PGL2 1G9CA 2EF6A 1RYYA 1DYPA 3A7QA 5JZGC 1XYPA 4UFLA 2RS13 3FLRA 3K4DA 5LZ6A 3USUB 2ATFA 5DG2A 5C3QA 4CU8A 4JQTA 5J37A 4G4FA 2WT1A 2QQOA 2QFEA 3VKNA 2C4XA 1QJU2 1MEC1 1LHWA 4FI9A 2AUYA 5C4WB 3KM5A 4D7YA 3RZMA 1EV12 1NLRA 5FCCA 2DUQA 1RL3A 1AR91 2HLEA 5D2AA 1D2SA 1BBT2 2P17A 3I4IA 1W28A 2P5BA 1ZRCA 2DBIA 4JVAA 3H3LA 4LIUA 2GC3A 4XVHA 1SG3A 2VMHA 4Y5TA 4NRMA 3TNQA 3WP3A 1YLLA 2VTFA 3J7LA 4WBBA 4URTA 4E27A 1W8HA 5FAXA 2R073 2V4AA 2VY0A 5F7UA 3DYPA 3RG0A 5LA0A 1R092 1GR3A 1W6PA 3LZZA 2VUJA 4IEQA 2JDZA 2R1BA 3RYPA 4I3GA 2CGNA 2YROA 3ZIXA 5GLVA 4E2QA 4XXAA 2GH2A 5B4NA 3KGZA 3GCWA 4PI0A 3OF1A 2C24A 4LEJA 5FRAA 4EROA 4BB3A 3O5SA 3E6BA 1YUDA 5A7WA 1SLBA 4GB33 3VD5A 1RC6A 2YC0A 4NPRA 4Z82A 2QQUA 3MGUA 1LOFA 3MUY1 1FPN1 3NKGA 1QJY3 5C8WA 1PK6A 4A44A 2OW4A 2DVFA 4JKLA 4X6QB 1A34A 2VQAA 4ZONA 3SC7X 5J1XA 4IE6A 4LO8A 3WDUA 5LATA 1POV3 3VD9A 2QJVA 2HWB2 1STMA 4P5YA 2ZKNA 4FPEA 3N9MA 1MZEA 1MEC3 4FQZA 5FZDA 5I91A 4B1LA 3M70A 2XXZA 4EN9B 3HT2A 1KJRA 1JHJA 1QWRA 3AKPA 3WNNA 2IVJA 5FXZA 4XETA 3VBOA 2PAKA 2XQXA 1GMMA 3PLQA 4Q4W1 2R1DA 4XJUA 5F5CA 5C8CA 1WBFA 2VCBA 1CD3G 3WOGA 1ULFA 4IE5A 4EWDA 1O3RA 3NJZA 3BTZA 3PDQA 5JVVA 1WBLA 1HB3A 4LBJA 5SV5A 3NAPB 5FREA 1UY1A 1C1FA 2B45X 2BDRA 1LRHA 1OVPA 4XBNA 4BIOA 4PDWC 2W87A 4PIZA 4BQ2A 3L9JT 1UX6A 1LHUA 2MEV2 1LGBA 5LRSA 2ENRA 3SQOA 4AFDA 3O1OA 2P37A 1SPPA 1AYN3 1PGW1 1REFA 3O14A 2YZ4A 1ST8A 5EHDA 5JLVA 5FZAA 1JOBA 1UYPA 5F5IA 3ZR5A 3ENRA 1VMJA 3KT7A 1SEFA 3ZFGB 4JX0A 2WSUA 3ITQA 3MIGA 1N1VA 1RUC1 1DQ6A 1PIV1 1QOSA 4XAAA 3QH6A 1JHNA 4LJHA 3WDVA 4KWUA 5IWFA 4PF5A 4TSVA 3OYWA 5FP4A 2XJVA 1YJLA 4PLOA 2XLFA 2OQ6A 2GDFA 4H55A 1CIYA 2VOWA 3FBYA 3OD0A 2VNGA 4I02A 3ELNA 1CZSA 2Z5WA 2OXBA 4CDQA 5BV6A 2XUMA 2ZZQA 2QKDA 2HWE2 4FPCA 2ZJCA 3V0BA 3HT1A 2KXLA 3L2HA 5GZFA 1UD1A 1O6UA 4KU8A 4FFHA 5DDJ1 5IATA 1G86A 2A3YA 1NCQC 3QH7A 3W9AA 3AKRA 3O1VA 3VBFC 4CPBA 3FZ3A 4Y33A 2RS31 4N9HA 5FZCA 1ASJ3 1GZWB 3D5OA 4MHUA 5DUWA 3THDA 2A7AA 4Q0VA 5L7OC 1UZYA 4Y26A 1Z7S1 3R05A 4L9BA 2ADDA 2HKXA 2PLV2 3POIA 1RVF1 4IEXA 3IT8A 3WF2A 1MS5A 2QQVA 3T2QA 2FDKA 3ZFEB 1AJKA 3U07A 1B35B 1ZBA1 2VOTA 2WQ8A 4YSFA 2VNOA 1MACA 4WM7A 5F5AA 4LE3A 4Q0SA 2RS12 1W0NA 3MICA 5LK5A 2Z4FA 4FCAA 3VKFC 4Q5OA 1Y7BA 2JDPA 4G3YC 3AMNA 2YPJA 3RZKA 1TMF2 3AZZA 4Y1UA 1RUC3 1H8TB 3THPA 5A70A 5KHJA 4E4ZA 2AH2A 3IMMA 4QMAA 2GAUA 1AX1A 2Q5TA 4MOAA 4XE9A 1NKGA 2PHXA 5JXHA 3D82A 1F8VA 1DQ4A 5C6CA 1BK0A 4JAAA 1PO11 1F4HA 1XSQA 1AR61 3NJYA 3PIGA 5DZFA 1Y9MA 3T1LA 3VBSA 4AEDC 2GMPA 5CKQA 3J4UH 3UGGA 2E51A 1WW5A 1LEMA 4CP2A 2VTXJ 2VZTA 2CV6A 4UF0A 3U78A 3ZIWA 1ND2B 4CTEA 4SLIA 1DQ0A 3NV2A 4LOSA 3BIEA 3I3QA 4XABA 2R072 1HV0A 2N7GA 4Q0PA 1KFUL 2XB6C 4AYUA 3MIBA 4A3XA 5DDJ3 4W6YA 3ZKUA 5FY8A 1UZVA 2HEWF 4C8DA 3IZOA 3IBMA 4MHRA 4H7LA 5FK8A 5FZOB 3I97A 1BEV3 5L9BA 3URFA 3EHKA 1B09A 5FZBA 5J3UA 3PNAA 2UY9A 1OXCA 4LOTA 2VAUA 4CDXB 2E7QA 1W6QA 2ZPXA 3H1YA 2TBVA 3WF4A 4CEWC 1RVF3 4CP1A 4ASMB 4K8RB 4GB32 1X8MA 1OKOA 3C7OA 4QPIC 1HRV1 1OD3A 3R4SA 1ENXA 1SLAA 4HPKA 3WP5A 1QJY2 3TEYA 4IV3B 2A1XA 4D0QA 4P9IA 2YV8A 5EYYA 5HXMA 3RMYA 2BBVA 1H8VA 5CAZA 2WS91 1MS3A 2ARCA 2B5HA 1Q8QA 3LSDA 5BNNB 3DPRC 3PJQA 1OURA 1BXHA 1D0HA 1RUI3 4AI9A 3I8TA 5FR3A 2WC2A 2WDBA 3B02A 3LGRA 5SV8A 1F9KA 5FY7A 2Q1FA 2X5IB 3I59B 5C9AB 1J58A 1CAXB 2QNKA 5BNOA 1W9SA 4XDOA 2J1AA 2B7YA 4EZ4A 5JI7A 3QBQA 4PQ9A 5F37A 3AYDA 2JG9A 3HBZA 3MF9A 3UJOA 5M0TA 1PO13 2VUAA 2DCKA 1LOFC 2XWJB 5LWBA 4LKFA 5LY2A 1VB2A 1PK6C 1LECA 4V2WA 3HN1A 3HJRA 4GULA 4R4ZA 4RYDA 2WA4A 4WVMB 5FP3A 3MV01 1RUG3 4TXWA 1RXGA 2ZGLA 3GJBA 4YW3A 4COYA 4XW3A 4NIDA 1EPWA 3UK9A 4A7YA 5F1RA 5A6QA 4PT6A 5DAVA 1GZCA 4Y20A 5T50A 5A3WA 2H6BA 5A3OA 4FPKA 1AYN2 4OUSA 1DLLA 4A4AA 1X82A 4AI2A 3DUIA 3E97A 3FX3A 5CG9A 4H7MA 5AVPA 3THCA 3W20A 5IVVA 5T5LA 4L99A 5LRRA 3B9IA 2EALA 5EV7A 3NKTA 1HRV3 1RUF1 4NVPA 4GH4C 3VL9A 3BPZA 4QPGB 3LOBA 1NYWA 3TWIA 4UI9L 3WNPA 4AVCA 1AL23 1ULOA 5C3SA 1TME3 1WA4A 5L36A 3O12A 1GP4A 1WW4A 2RM22 2VM9A 2WS93 4XQDA 3PVEA 2ZMKA 3K77A 1J84A 1LGCA 5A7SA 4CU9A 1FNZA 1ZM1A 3LCPA 2WABA 4R52A 1EAH3 2J1SA 4AOCA 1PX4A 1AX2A 2OA2A 2BRTA 1IG0A 5F5QA 5J98B 5JSRA 4RR3B 4ZHNA 4NHYA 1Q56A 3L2YA 4HANA 2OIIA 4F7ZA 4E4DX 3U75A 2WZ8A 3VBUA 1PO21 3T2OA 2W0XA 4PBOA 3TN91 4ET7A 4OUEA 3I3BA 2XHKA 5H9QA 2ZABA 1W6MB 3GALA 2AENA 1ASJ2 3GXUA 1RUD1 2QBXA 3LFMA 3MIHA 2ZGKA 2X8KA 1WW7A 3HN3A 3NNGA 1MQTB 3BKZA 2CWMA 1QGLA 3A4UA 1CR7A 4CDQC 3RZHA 2JG8C 3KV6A 2W2IA 4YGBA 4IEOA 5T55A 1DGWX 1ONAA 3GZAA 1IPKA 3POYA 4I0AA 2VVDA 4DEVA 3KQRA 1RMU1 3A23A 1VBB1 2DYCA 4NOTA 1S0FA 5FYUA 4OQ8A 1Y3TA 4Q4V1 1RUF3 4MGTA 5EQUA 5GZCA 1JYWA 1E5RA 2BZDA 1W6OB 2A6XA 4MSVA 1WWYA 3KZ4C 5IJRA 4Z2WA 4XFHA 4CCNA 4IEZA 5FPLA 1AHSA 2W95A 5A33A 3C7HA 1GOGA 2Y6KA 3LEKA 4Q4Y1 4CCMA 3LIGA 3RYKA 1JH5A 4AK3A 1US2A 1W0OA 1XU2A 3F95A 3MDPA 2BGPA 4JZRA 3ZN4A 5FZ6A 1H2NA 3INAA 1UW8A 3KCCA 5BUVA 3VBHC 2H0VA 2A3WA 1JZ8A 3O1MA 1PMHX 1PZ8A 1PO23 1PX3A 3ZMOA 4P02B 4RQPA 4BQ4A 4HKOA 5CFCA 2YBPA 3QACA 4ASKA 1BMV2 3IM0A 1QJZA 1BEV2 3RMXA 1FXZA 2ET7A 1OPOA 2Y0IA 1VRH1 1WKYA 4MADA 5BPXA 2VR4A 2ADEA 1COV1 1HJGA 2DTWA 4FP2A 5APAA 4LBQB 4YWAA 4FTSA 2QQMA 1V6MA 4ONUA 3HQXA 5EWSA 1QOTA 4AI8A 3I2DA 3MUZ1 4AF9A 1H2MA 3FLPA 5FZ4A 2E6VA 3RGBA 4AFCA 3OG2A 5ABJA 5CA6A 5FK7A 2W39A 5C7GA 1O91A 5FZEA 1UIJA 2YUEA 5HV4A 2D93A 2YHJA 3HWJA 4Q8LA 1VBB3 2PFWA 3KV9A 4D6SA 3POSA 2HEVF 4GKXA 2F4LA 2H6CA 5FYSA 1OI6A 5FQ0B 2R062 1RUI2 4Q4V3 3MIEA 5JCTA 1KRIA 1HQWA 5IVCA 4PIXA 1FX5A 5E6HA 3PVNA 5GLWA 4N90A 3TAYA 1W9FA 3WW3A 1OQDA 1LNSA 1ZVFA 2VJXA 1XYNA 1S55A 4IETA 3VZMA 3ZSKA 4B7KA 1CESA 2J1TA 2YMZA 2X10A 4FSJA 3CNAA 3SH5A 3PIJA 4FOWA 4LORA 2WO7A 1NZIA 4OHVA 5FPBA 4CDUA 4GIQA 2B9VA 2A5ZA 2XBO2 2P3IA 1RUG2 1OD5A 4ZU4A 1IHMA 5A1FA 2CAVA 2WIIB 2WR9A 3MLJA 1TE1B 2F4PA 5BNQA 1W39A 3ILNA 2KD7A 1X9TA 5HCBA 2E33A 1U0AA 3TNPB 3ZSMA 5FXVA 2BQPA 1DHKB 2Y6LA 3JXSA 2WBKA 2JE9A 4BOWA 1VRH3 2XJTA 3GZTB 1KQRA 2VZQA 4LTAA 4FQ4A 5I93A 4CCJA 1N3OA 4OI4A 3AXEA 5FZKA 1RJ8A 1GWMA 2W52A 5JAXA 3EYPA 2VD7A 3NSTA 1AL22 4YW7A 3OGSA 1TME2 4RN5A 5FV3A 4KNCA 4AVAA 2MHFA 4WV8A 4A7KA 1NXMA 3WDTA 1EAH2 2C9KA 4N53B 4QKNA 3BU0A 2VZSA 3FC0A 1F4AA 1F31A 3C8XA 3CIHA 4A42A 4NE9A 2RVAA 1XNAA 2XUEA 5JZGA 4RGKA 1CVNA 1REDA 3I49A 1SLCA 5CFDB 4GJZA 1QNWA 1V0AA 1KFXL 3RSJA 3NO8A 3VDDA 4W8JA 2CYFA 3GBFA 1CAUA 2YXSA 2ZX3A 1LB2A 5K0UA 3N7MA 1U5ZA 4K7JA 2P2KA 4LITA 1RUJ1 3MPBA 1VR3A 2BOJA 4L8QA 2LW8A 3MBWA 1OFNA 1O7FA 2VC9A 2CDOA 2RDQA 1RJ7A 3AK0A 3ZPYA 4E9KA 5JIUA 2BW8A 1QF3A 2FCTA 3WSOA 4F8AA 5JOWA 3KV5A 5H9SA 3W21A 2DF7A 3V0AB 3ZN6B 1JXNA 3A22A 3U10A 1FOD1 3JB4C 4QHBA 2FZ2A 3RS6A 2ZGQA 1Z78A 4Y3OA 2D97A 2PXJA 1DGWA 4UYBA 4TLFA 5EYXA 3E6CC 2VUDA 4RGAA 3V65A 3HQUA 4HOOA 3RI9A 1S0BA 5KHIA 2YGMA 3TOJA 2VXJA 1C3HA 1ZZ6A 5FBZA 2WZEA 4N9IA 4JKMA 1SBEA 4QX2A 4GWJA 1HX6A 2BJSA 2VVFA 2R30A 2VOKA 3MW4A 4KGGA 2Y6GA 5E8AA 3RZZA 1ULEA 3DCQA 4RS5B 3AFKA 1AR81 5I0RA 2CWSA 4ARXA 2HWC1 2WLQA 1OC1A 1GNYA 3LPGA 3WVJA 1D7PM 2WA3A 4A3ZA 1FMD1 4AVTA 2XVKA 1H9WA 1BCXA 4JTNA 2WNOA 4JDOA 5DAWA 4N43C 2SBAA 1OLMA 1VBC2 5A3TA 1BHGA 1JMUB 5IVFA 1QIQA 1Z0HA 3I3DA 1H2KA 4QX5A 4BIFA 1EPZA 1MS4A 2XLGA 1VB4A 4J1XA 4KWKA 3HQRA 5FYYA 1OLME 4HVOA 3T0BA 5LASA 5HCFA 4META 4P9LA 1R1A1 4YRDA 1UYXA 4FPLA 2WFF2 4HZFA 1AX0A 3SISA 4BYYA 3U0ZA 5DG1A 4YVWC 2JKXA 5F2SA 4HK8A 4ZXKA 5FKCA 4Y4RA 1UOFA 2GP3A 4CP9B 5ACA1 3GBGA 2RJKA 3ZFFC 2HYKA 4PDWA 3FHQA 4D6RA 4XDPA 4BE3A 1FOD3 1ZYBA 3WW2A 1YI7A 5CNAA 3BU7A 5A1AA 3VBRC 1ZRDA 3JBG2 2O1QA 4DPNA 4F83A 2OQ7A 5FO9B 2HBUA 5JOZA 3WNKA 1OOPB 4CEYB 4P08A 1SLTA 2ZHLA 2ILMA 4YVSA 4FTBA 1V6KA 1H1IA 2D6OX 1VBE1 5ABJC 4PF1A 3ZSEA 1WMDA 1YC61 3RVHA 3WNOA 4QQOA 4KH9A 5K9YA 2WWJA 4ZPIA 1PMJX 2GN7A 2KM2A 2LUWA 4BM8A 1FMD3 2VOXA 4HSJA 3NNJA 3PHMA 4I0BA 4OVEA 4NPLA 2JE7A 4QX1A 4ZS2A 1D4M1 1IQDC 2WNUC 5FTTC 5FZGA 5J48A 2GC1A 4FOYA 1V00A 1S1AA 3QCWA 4M0HA 1POV0 5KC5A 2BGOA 3AYEA 2CSGA 3WF0A 5FUIA 4CDUC 2Z2SB 3I2IA 1R1A3 1W99A 3EO6A 1JU3A 1YIPA 4YZ4A 1NCQA 3GZEA 3MW3A 3VBFA 2R041 4J25A 2R0FA 4U2AA 1YQ2A 1T6GC 3WG1A 5ACA3 3T0DA 1RHI3 2YY1A 5E89A 1UXXX 2A71A 3ZSJA 5FPAA 4E2GA 2DFBA 3PVBB 4GMP1 5IAVA 1AXYA 5C33A 1HW5A 1QQP3 1UOJA 2Y33A 1OBNA 1ZA4A 1N1TA 3IDAA 4BK5A 1GKBA 1DLCA 3C7FA 4U36A 4OHZA 5I8TA 2G1MA 1HV1A 3TEWA 3Q8CA 1G9AA 1YRZA 1VBE3 4KU7A 4BLJA 3J8F3 1QY4A 3WCSA 4MVTA 2OZ6A 3TEZA 1QXRA 1VBD2 4FXGB 4D6QA 3K4ZA 2FMDA 2A75A 4LHKA 1R081 4QQHA 3BODA 1C28A 4WVWA 1YO8A 3ZDSA 2AGSA 1I5PA 3VZNA 2YC4A 2O0OA 1C5IA 4NJ4A 3T0AA 3NV3A 1NA1C 3SLIA 5JDBA 2UWAA 4AEDA 1C57A 2A6YA 4XUQA 4CCKA 2XONA 3VHNA 2WT2A 5FZLA 3I2GA 2WL1A 4RSUA 1E57A 1B35A 4NIIA 2R7EB 1QJX1 1OA3A 5CVRA 3T4VA 2FDIA 5J09A 1UOGA 1HQNA 4LE4A 2RE9A 3RPQA 3FHAA 5JSOA 1AYM3 3VDDC 4ATEA 4LBMA 3AZVA 2B9UA 2WNEA 2Y0OA 3SEEA 3WP6A 5K0UC 1MS0A 3K4AA 2WZR1 2XJSA 3HPNA 2QQKA 2WN2A 4EN7B 2XJUA 3WY6A 3O1SA 3C7GA 2EXHA 2NZ9A 4WVVA 2O14A 3AXDA 4CEWA 2OX0A 1SMVA 2VNVA 1KDKA 4GMP3 5CU1A 2YBKA 2R32A 3I3EA 4QPIA 2F17A 4C1WA 1QEXA 2PAEA 4XF9A 3JU9A 3WXPA 1QDOA 4PHZA 4LBLA 1LULA 4AZZA 4BXFA 5A7QA 1WCKA 4LMFA 3POBA 3MI8A 4Y22B 2QDRA 2W94A 1DU3D 1O5LA 2QQPA 2RS51 5BNPB 1NOVA 3OGVA 4COUA 3AP6A 3CLPA 1UMZA 3DPRA 3VKMA 4FAGA 3SH4A 1KITA 4FBFA 4HXCA 5DQ0A 2X53S 3WDWA 5C4WC 5KXBA 2WYSA 2DCYA 1GLHA 1W2AX 1R083 2ZHKA 1PMIA 5FUNA 2XL7A 1PM4A 2Q1MA 4JGYB 4N7UA 3OEAA 1IS4A 1L7QA 2J22A 4CDXA 4AGGA 5DAXA 4WM8B 4Y24A 1PZ9A 4HKWA 4IGQA 1UXZA 3OPTA 3NRUA 3UNPA 2ARAA 2F6BA 4MGKE 5FZMA 5DPNA 4FOQA 3LAGA 1QJX3 3IN9A 1EUUA 5L19A 5KXCA 2ZGPA 4LO6B 2PHRA 3FJSA 2QZ3A 1NQJA 3MEPA 5FZ1A 4YPJA 1SFPA 5BNNA 1NCRB 2PAMA 5LK7B 4P9GA 3H9AA 5G04L 2W3JA 5HI0A 1W2TA 3LWCA 4CUCA 1JZ4A 4AGRA 2WZR3 4RHV2 2XJRA 1AR93 2X5IA 1AR71 3CZUA 3LE0A 3LQCA 4IEWA 5FZFA 1OA2A 3LA3A 3SHRA 2PELA 2RMU2 1W8NA 1I9RA 4WZFA 3USSA 3A0NA 5LBEA 3ZO0B 1C8M1 2VQUA 4QX3A 3DYMA 4GH4A 4FPOB 1S2EA 1G8WA 4Z8BA 3S5QA 4EYUA 1IKPA 3FFQA 3N3HA 4NMIA 4IERA 2DBNA 3ACIA 3B94A 4XTPA 1ENRA 4JGZB 4XF3A 1U5IA 4QDSA 2HWD2 1OUXA 4XXPA 5A80A 3T30A 3ZLIA 4IGPA 2RS53 1LU1A 4QXHA 4S2GA 2Q8CA 4YZ5A 4KQ7A 1CAWA 1XNTA 2WAAA 3WNMA 5A1LA 1I5ZA 1E5HA 4FFIA 3FLTA 1W8FA 1QOOA 3K2OA 1TQ5A 4YVSC 1ZBE1 3ME2A 2E53A 3OY8A 2L9LA 5ERLA 1NUKA 2IUWA 1K3IA 2VMDA 2XMLA 3QOPA 4FO9A 4PLNA 3ZXGA 2OZJA 2X09A 2EIBA 1H1MA 2ZEZA 1RUE2 1FPN3 1WW6A 2Y26A 3T08A 2WQ4A 2XG3A 5A3PA 3RDIA 3H50A 3NAPC 4QT6A 3ST7A 2CGOA 3WQ7A 2OKXA 4XFIA 3WW4A 3AMHA 2CL2A 3LA7A 1RHI2 1OQ1A 4DY3A 2J1RA 2VXRA 4UFJA 4B4QA 2V73A 3GM8A 4MXVA 3WG3A 3B69A 1QQP2 1U12A 1VP6A 4QDRA 2VZRA 2JG8A 1AR73 1UO9A 2ZACA 4OCTA 4YW4A 2PHDA 2BFUL 5DZGA 1W9TA 5EJ3A 3NJVA 4Q4W3 1W06A 3J8F2 2GU9A 1MZ6A 1DP0A 3IB3A 3ZFGC 5L7OB 3UESA 3RZJA 3RFRA 3E5QA 1JU4A 5A32A 4AXOA 1UQXA 1LGNA 5DAQA 2AR6A 1IPJA 3H1WA 3OEBA 5JMCA 4P9WA 1FV2A 1W6MA 5F3GA 2PQQA 2D6MA 4R4XA 2JWPA 5K8SA 3POJA 1HQLA 4A6SA 4AAXA 4AHZA 3MLKA 3CJIB 3ES1A 1SBDA 3LDRA 1I3HA 1YHFA 4QM8A 3LFIA 3WUDA 2ARBA 4C1XA 1O3SA 1ZBE3 2QZ2A 4AI0A 5A3NA 3G6JB 2YC2A 3D6EA 5JPMB 1YQ8A 1S0DA 3VBHA 4QQPA 1N3PA 4FXKB 1AYM2 1XQNA 4M3CA 3T2PA 1PIV3 5FYVA 4Q4X1 1UU4A 5CYYA 2VCAA 4L0PA 5FYBA 3EBRA 1VIWB 1W9WA 3ILRA 3WQBA 1OKQA 4G9SB 3N9QA 4QGMA 5A3MA 1JZ5A 4OI0A 4M3CE 1QNYA 1VAMA 4FPGA 1A78A 1QHDA 2LM3A 4QDQA 3ZFEC 4HLTA 1KS4A 1BVP1 4XFBA 1B35C 4CXYA 1JBCA 2KR2A 4LLFA 5A7NA 1D2QA 2D5FA 3WZ1A 3TRSB 4BK4A 4D94A 4TYSA 4IE7A 4HG6B 5ANQA 4Q2FA 1BZWA 2Y64A 4LHLA 2IWGB 3MYXA 2SLIA 1GV9A 1NT0A 5FFOC 2VZVA 1H8TC 5FZ3A 2WRAA 1W05A 1NE4A 2RS33 3IAQA 5FY9A 1SCRA 1V9U1 1MZ5A 2C9AA 3SCGA 1QH6A 1Z7S3 4DXTA 1GNHA 4NIAA 2JDNA 4KWLA 3LDBA 3UJQA 3WV6A 2QCSB 4WZCA 5A7OA 2HWF1 4DOUA 5F9TA 3Q8EA 3GNEA 3S57A 1W6PB 4XTMA 3BTAA 5DXDA 3RQ0A 1ZBA3 2WNVA 1ND2C 2DVDA 3HVDA 4B29A 2G9ZA 2D3RA 5D8AB 3FHIB 3AJZA 1ND3B 1UY2A 2O8OA 1QDCA 3H7YA 4KI5M 4HN0A 1UNBA 2VGDA 4XMAA 3UETA 4UFKA 2Q8OA 2VCMA 1MEC2 1JYNA 5A7WB 5CBLA 1FNYA 4Q4X3 5FQ0A 1GSLA 2A6WA 2WZPP 2MPFA 2QQLA 2ZX1A 3KWVA 1AR92 2WQZC 3WDYA 2UYAA 2VUCA 4CDXC 2I74A 2CDPA 4E4SA 1AR63 1YFXA 3VHOA 1JN2P 2EIDA 5FLJA 4P00B 3OGGA 2IZWA 4NIHA 2FQPA 1YIFA 2IFRA 3ZKYA 1CPNA 5FY1A 3W58A 3LEMA 3R0RA 4IV3C 2VW2A 4HT1T 4LUMA 4AVVA 2BVVA 4R9BA 4FFGA 1SLIA 1W04A 5FZHA 1G6NA 4JDNA 3OUJA 2X05A 2P6CA 2WT0A 5BNNC 3NMBA 3IIIA 1URXA 3KV4A 1EUTA 2AZ5A 2BBAA 4HN1A 2JDMA 1O5UA 4UW5A 1XSRA 3V56A 4BQXA 4D7SA 5J7MA 3VBOB 2G9GA 2P3KA 4CXWA 2X5IC 4NO4A 4CSWA 5C8CB 2VCCA 3W59A 1S0EA 4C90A 5C9AC 1V9U3 4AHYA 3B9CA 5LEKA 1J59A 4DRRA 1LENA 5HV0A 5FZ7A 1SFNA 2D40A 4UFIA 3E5XA 2UWBA 4CP0A 1FPN2 1XE8A 3WUCA 1GQGA 2E32A 1RUH1 3I2FA 2NLRA 1U5XA 4AGVA 1R64A 1SPPB 3JD71 1HXS1 1GQHA 1OH3A 4FFFA 1NE6A 4PIYA 3VHPA 2VU9A 5FZ8A 3B7MA 1GZTA 4CCEA 4TZDA 1J1LA 3ON7A 3P6BA 3N7KA 1KJLA 4H2AA 2JIJA 4EN0A 5KXDA 5GZEA 4NROA 1QXJA 2W1UA 2RJLA 4YNIA 3GYDA 1DQ2A 2YB7A 1IGOA 4Q4W2 4C0BA 5FP7A 4ZY9A 4X8NA 2V5DA 3OYWB 3M3CA 1ZZ9A 1WD3A 3UYJA 4BH9A 1UKGA 2IC1A 1SACA 3J7NA 5CFDA 2GN3A 4HONA 5C5UA 3AP7A 5JXJA 4AWDA 2I45A 1P8JA 2ZMLA 2VQ0A 2ORXA 5DN2A 3SNMA 4CDQB 5KR7A 2DUOA 3RRDA 3MLLA 2XHNA 5GJ6A 3V0BB 4I3PA 3K3OA 4LKSA 4QX0A 3S6PA 1V70A 2EIEA 4XJ8A 3EXUA 1PGW2 4KBBA 4MGQA 4DY5A 4HBNA 4RR3C 3AB0A 2R49A 2C26A 5FWJA 3IPVA 3ZYFA 4BWOA 1UU6A 3LPFA 5FBJA 1ZREA 3GHMA 1ZZ8A 3M3IA 3B5LB 1W8WA 1RUC2 2E9QA 1FAYA 3V0AA 3B3QE 1BJQA 1PIV2 2OPKA 2CNAA 4LKEA 1NLQA 2YYOA 4N43A 4YM2A 4BJ0A 1L7LA 2NYYA 1W3XA 2ES3A 5LBFA 1JW6A 4LULA 4Q1RA 3D4KA 3N7JA 4QD2A 4BQ3A 5JR7B 2FD8A 1HXS3 1MQTC 3NJXA 4WM7B 3WW1A 1ZRIA 1PGSA 1HRI1 2NM1A 2DU0A 3AKTA 3PU8A 2Y34A 2W1WA 3C7EA 4XACA 5DMYA 2UY8A 4DUVA 4COWA 4B7EA 1C1LA 2Q8DA 3K75B 1W6NA 2G4IA 3FE5A 3KCYA 5DUUA 2WSVA 3SXWA 3I2HA 4YVWA 3Q9OA 2ZKLA 1DGRA 1WLCA 5DDJ2
chains in the Genus database with same CATH topology
3LPGA 1D7PM 2VTFA 2W46A 4A3ZA 3F2ZA 4XUPA 1HN1A 5LA0A 2W5FA 5F7UA 2HYXA 3DYPA 3CKHA 2XOMA 1BHGA 5LCWL 2E31A 3I3DA 5B4NA 3ACFA 2WN3A 2ZEXA 3VD7A 3T0BA 1OF3A 1UYXA 2VO5A 2VZUA 4XZUG 3VD5A 1JYVA 2JKXA 3MUY1 1H6YA 4A44A 4ZZ8A 4JKLA 3W5NA 3FHQA 1UY4A 4Z2AA 2EICA 4KMQA 2JE8A 5J1XA 2W47A 3VD9A 5A1AA 4DUXA 4P5YA 3WNKA 3FN9A 4P08A 4DXRA 4A6OA 1JHJA 4PF1A 3WNNA 3WNOA 2RJ2A 1WCQA 2XQXA 1GMMA 5G05L 3HNMA 1PMJX 2VCBA 2VZPA 4QAWA 3IAPA 3SEPA 1H6XA 1UY1A 3J7HA 4QX1A 3ZM8A 2W87A 1IQDC 5EJ1B 2BGOA 2V4VA 3WF0A 5FUIA 1GUIA 3CMGA 3VDBA 2W1QA 3I2IA 1W99A 1JU3A 3VDCA 1JZ6A 1W8OA 4JX0A 1YQ2A 4D8MA 4KWUA 3T0DA 4LPLA 4A41A 1UXXX 2BERA 3DECA 4BK5A 3IDAA 1CIYA 1DLCA 3C7FA 2DDUA 2W1SA 1CZSA 4BXSV 4QB6A 5C71A 3HEIA 2QQJA 3AC0A 3K4ZA 1XC6A 2DCJA 4OMCA 2VZOA 1I5PA 2WUHA 2YC4A 3THDA 4ZZ5A 3T0AA 3WF3A 4BDVB 4XUQA 2XONA 3WF2A 3I2GA 2LS6A 3T2QA 2R7EB 2VOTA 2WQ8A 4GZ9A 3FHAA 1W0NA 2Z4FA 2VZ3A 3SEEA 1CZVA 3I2KA 3K4AA 3PUHA 3HPNA 2QQKA 2WN2A 3WNLA 3K46A 3C7GA 4MGSA 4MOAA 1UYZA 1NKGA 2W91A 3P1IA 4CU7A 5JXHA 1NAEA 3I3EA 1F4HA 2VMCA 4DXTA 1OH4A 4M4RA 2VZTA 2ZEWA 5IHRA 2W94A 5C70A 1UYYA 1ULPA 3OGVA 1O8SA 5DQ0A 5EIYB 1GOFA 2WYSA 3I97A 3OEAA 1L7QA 2J22A 2W92A 2ZEYA 4W50A 3WF4A 1UXZA 1J83A 4JKKA 3NRUA 3UNPA 2PQSA 1XPWA 4CUBA 5DPNA 3C7OA 5JR2A 1OD3A 1EUUA 4D0QA 4CVUA 5HXMA 1JYXA 4YPJA 4OYUA 4XURA 1UWWA 2VL4A 5G04L 2W3JA 3HOBA 4CUCA 1JZ4A 2WDBA 3CZUA 3LQCA 3LE0A 5EJZB 3ETPA 1W9SA 1W8NA 2E26A 2J1AA 4XUOA 2VQUA 4QX3A 2DCKA 3DYMA 3U37A 3ACIA 3HJRA 4RYDA 3MV11 4QDSA 3MV01 4TXWA 4E8DA 3OB8A 1XNTA 3DYOA 2WAAA 3WNMA 2YG0A 4PT6A 3OBAA 1UY3A 1DYOA 2L9LA 4A4AA 1NUKA 1K3IA 2VMDA 2RV9A 2X09A 2EIBA 3ACGA 3THCA 2ZEZA 5HPOA 1UX7A 5JXGA 2WO2A 3T08A 4XUNA 4XUTA 5JXIA 3ABZA 4GWIA 4UI9L 2OKXA 3WNPA 1GQPA 3HNBM 1SDDB 1ULOA 1JZ7A 2J1RA 1NX9A 2JD9A 3GM8A 2VM9A 4MO3M 1JI6A 3K77A 4JHZA 1J84A 2VZRA 4QDRA 4CU9A 1UZ0A 4CUAA 2WABA 3I2JA 3BGAA 1OT5A 2J1SA 3WF1A 1PX4A 5IFTA 1W9TA 4PQQA 3NJVA 3ACHA 1DP0A 3IB3A 2YFZA 2WZ8A 3UESA 3T2OA 3FL7A 1JU4A 3SKVA 3OEBA 1SHWB 4ET7A 4OUEA 3I3BA 5JUVA 3W5MA 2VMEA 3GXUA 2QBXA 4AAXA 3HN3A 3NNGA 3GGLA 1OF4A 1KGYA 2J1EA 3HNYM 3EB7A 2YC2A 4DEVA 3T2PA 3A23A 3GDBA 3VD4A 5CYYA 2VCAA 4L0PA 4QPWA 1JYWA 1W9WA 2BZDA 3A21A 3WQBA 5IJRA 1JZ5A 4ARYA 2ORZA 3LEGA 4QDQA 2W9XA 2W95A 3C7HA 1GOGA 2WAOA 2Y6KA 3LEKA 4BJ0A 4BK4A 3BN6A 1US2A 3VDAA 2BGPA 3E1F1 4HG6B 2Y64A 2YFUA 1JZ8A 1PMHX 2VZVA 1PX3A 4LQRA 4P02B 2Y6HA 3IAQA 2WO1A 3VD3A 4DEQA 2VQTA 1WKYA 4MADA 3WEZA 4LHSA 2VR4A 3T09A 4IUGA 2QQMA 1MPXA 1US3A 2B4KA 2ZXQA 3CDZB 3MUZ1 1JZ3A 3NQHA 4A45A 4CU6A 1K12A 3OG2A 5C7GA 1UY2A 4KI5M 3UETA 5LA1A 2J7MA 1JYNA 2J1VA 4QB1A 1UMIA 2QQLA 3PUIA 3SKJE 2QQNA 2CDPA 4ZXEA 4W4ZA 1O8PA 1JZ2A 1LNSA 2EIDA 2VJXA 4P00B 1KEXA 2J1TA 4UAPA 2X10A 4OMDA 2X05A 2V72A 2B9VA 5LA2A 4AG4A 3IIIA 1EUTA 2BBAA 1K42A 1L7RA 1UMHA 1GU3A 2KD7A 2E33A 2VCCA 4M4PA 2Y6LA 3JXSA 2WBKA 2VZQA 5CZKA 1UY0A 2E32A 4DUWA 3I2FA 1R64A 3CQOA 3EYPA 3OGSA 4RN5A 3P6BA 5IYYA 1O59A 2C9KA 1CX1A 2W1UA 2VZSA 3D3AA 2YB7A 1F4AA 3C8XA 2Y8KA 3CIHA 2Y6JA 4ZY9A 5JMOA 2V5DA 5IFPA 1CZTA 1GOHA 4A42A 4QB2A 1TVGA 2RVAA 1XNAA 3CZJA 5JXJA 1K45A 5DN2A 1P8JA 2ORXA 4UOJA 3OGRA 4W8JA 2XHNA 5B4XA 2J1UA 4LKSA 4QX0A 2EIEA 2JDAA 4MGQA 2QQIA 1T2XA 2C26A 2ID4A 2LW8A 3LPFA 3MBWA 2VC9A 2CDOA 5I0DA 3WSOA 4DXSA 2VMFA 3MO4A 1RYYA 3A22A 3A7QA 3K4DA 2VZ1A 4TTGA 4CU8A 3NJXA 2QQOA 4OZOA 1TG7A 2C4XA 2WO3A 3C7EA 2W1WA 4FI9A 4E8CA 5DMYA 4DUVA 2WZEA 3K75B 4JKMA 4QX2A 2HLEA 4GWJA 3ECQA 3LEIA 2Y6GA 3I2HA 4XVHA 1SG3A 4ARXA 1GNYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LPG A;  1D7P M;  2VTF A;  2W46 A;  4A3Z A;  3F2Z A;  4XUP A;  1HN1 A;  5LA0 A;  2W5F A;  5F7U A;  2HYX A;  3DYP A;  3CKH A;  2XOM A;  1BHG A;  5LCW L;  2E31 A;  3I3D A;  5B4N A;  3ACF A;  2WN3 A;  2ZEX A;  3VD7 A;  3T0B A;  1OF3 A;  1UYX A;  2VO5 A;  2VZU A;  4XZU G;  3VD5 A;  1JYV A;  2JKX A;  3MUY 1;  1H6Y A;  4A44 A;  4ZZ8 A;  4JKL A;  3W5N A;  3FHQ A;  1UY4 A;  4Z2A A;  2EIC A;  4KMQ A;  2JE8 A;  5J1X A;  2W47 A;  3VD9 A;  5A1A A;  4DUX A;  4P5Y A;  3WNK A;  3FN9 A;  4P08 A;  4DXR A;  4A6O A;  1JHJ A;  4PF1 A;  3WNN A;  3WNO A;  2RJ2 A;  1WCQ A;  2XQX A;  1GMM A;  5G05 L;  3HNM A;  1PMJ X;  2VCB A;  2VZP A;  4QAW A;  3IAP A;  3SEP A;  1H6X A;  1UY1 A;  3J7H A;  4QX1 A;  3ZM8 A;  2W87 A;  1IQD C;  5EJ1 B;  2BGO A;  2V4V A;  3WF0 A;  5FUI A;  1GUI A;  3CMG A;  3VDB A;  2W1Q A;  3I2I A;  1W99 A;  1JU3 A;  3VDC A;  1JZ6 A;  1W8O A;  4JX0 A;  1YQ2 A;  4D8M A;  4KWU A;  3T0D A;  4LPL A;  4A41 A;  1UXX X;  2BER A;  3DEC A;  4BK5 A;  3IDA A;  1CIY A;  1DLC A;  3C7F A;  2DDU A;  2W1S A;  1CZS A;  4BXS V;  4QB6 A;  5C71 A;  3HEI A;  2QQJ A;  3AC0 A;  3K4Z A;  1XC6 A;  2DCJ A;  4OMC A;  2VZO A;  1I5P A;  2WUH A;  2YC4 A;  3THD A;  4ZZ5 A;  3T0A A;  3WF3 A;  4BDV B;  4XUQ A;  2XON A;  3WF2 A;  3I2G A;  2LS6 A;  3T2Q A;  2R7E B;  2VOT A;  2WQ8 A;  4GZ9 A;  3FHA A;  1W0N A;  2Z4F A;  2VZ3 A;  3SEE A;  1CZV A;  3I2K A;  3K4A A;  3PUH A;  3HPN A;  2QQK A;  2WN2 A;  3WNL A;  3K46 A;  3C7G A;  4MGS A;  4MOA A;  1UYZ A;  1NKG A;  2W91 A;  3P1I A;  4CU7 A;  5JXH A;  1NAE A;  3I3E A;  1F4H A;  2VMC A;  4DXT A;  1OH4 A;  4M4R A;  2VZT A;  2ZEW A;  5IHR A;  2W94 A;  5C70 A;  1UYY A;  1ULP A;  3OGV A;  1O8S A;  5DQ0 A;  5EIY B;  1GOF A;  2WYS A;  3I97 A;  3OEA A;  1L7Q A;  2J22 A;  2W92 A;  2ZEY A;  4W50 A;  3WF4 A;  1UXZ A;  1J83 A;  4JKK A;  3NRU A;  3UNP A;  2PQS A;  1XPW A;  4CUB A;  5DPN A;  3C7O A;  5JR2 A;  1OD3 A;  1EUU A;  4D0Q A;  4CVU A;  5HXM A;  1JYX A;  4YPJ A;  4OYU A;  4XUR A;  1UWW A;  2VL4 A;  5G04 L;  2W3J A;  3HOB A;  4CUC A;  1JZ4 A;  2WDB A;  3CZU A;  3LQC A;  3LE0 A;  5EJZ B;  3ETP A;  1W9S A;  1W8N A;  2E26 A;  2J1A A;  4XUO A;  2VQU A;  4QX3 A;  2DCK A;  3DYM A;  3U37 A;  3ACI A;  3HJR A;  4RYD A;  3MV1 1;  4QDS A;  3MV0 1;  4TXW A;  4E8D A;  3OB8 A;  1XNT A;  3DYO A;  2WAA A;  3WNM A;  2YG0 A;  4PT6 A;  3OBA A;  1UY3 A;  1DYO A;  2L9L A;  4A4A A;  1NUK A;  1K3I A;  2VMD A;  2RV9 A;  2X09 A;  2EIB A;  3ACG A;  3THC A;  2ZEZ A;  5HPO A;  1UX7 A;  5JXG A;  2WO2 A;  3T08 A;  4XUN A;  4XUT A;  5JXI A;  3ABZ A;  4GWI A;  4UI9 L;  2OKX A;  3WNP A;  1GQP A;  3HNB M;  1SDD B;  1ULO A;  1JZ7 A;  2J1R A;  1NX9 A;  2JD9 A;  3GM8 A;  2VM9 A;  4MO3 M;  1JI6 A;  3K77 A;  4JHZ A;  1J84 A;  2VZR A;  4QDR A;  4CU9 A;  1UZ0 A;  4CUA A;  2WAB A;  3I2J A;  3BGA A;  1OT5 A;  2J1S A;  3WF1 A;  1PX4 A;  5IFT A;  1W9T A;  4PQQ A;  3NJV A;  3ACH A;  1DP0 A;  3IB3 A;  2YFZ A;  2WZ8 A;  3UES A;  3T2O A;  3FL7 A;  1JU4 A;  3SKV A;  3OEB A;  1SHW B;  4ET7 A;  4OUE A;  3I3B A;  5JUV A;  3W5M A;  2VME A;  3GXU A;  2QBX A;  4AAX A;  3HN3 A;  3NNG A;  3GGL A;  1OF4 A;  1KGY A;  2J1E A;  3HNY M;  3EB7 A;  2YC2 A;  4DEV A;  3T2P A;  3A23 A;  3GDB A;  3VD4 A;  5CYY A;  2VCA A;  4L0P A;  4QPW A;  1JYW A;  1W9W A;  2BZD A;  3A21 A;  3WQB A;  5IJR A;  1JZ5 A;  4ARY A;  2ORZ A;  3LEG A;  4QDQ A;  2W9X A;  2W95 A;  3C7H A;  1GOG A;  2WAO A;  2Y6K A;  3LEK A;  4BJ0 A;  4BK4 A;  3BN6 A;  1US2 A;  3VDA A;  2BGP A;  3E1F 1;  4HG6 B;  2Y64 A;  2YFU A;  1JZ8 A;  1PMH X;  2VZV A;  1PX3 A;  4LQR A;  4P02 B;  2Y6H A;  3IAQ A;  2WO1 A;  3VD3 A;  4DEQ A;  2VQT A;  1WKY A;  4MAD A;  3WEZ A;  4LHS A;  2VR4 A;  3T09 A;  4IUG A;  2QQM A;  1MPX A;  1US3 A;  2B4K A;  2ZXQ A;  3CDZ B;  3MUZ 1;  1JZ3 A;  3NQH A;  4A45 A;  4CU6 A;  1K12 A;  3OG2 A;  5C7G A;  1UY2 A;  4KI5 M;  3UET A;  5LA1 A;  2J7M A;  1JYN A;  2J1V A;  4QB1 A;  1UMI A;  2QQL A;  3PUI A;  3SKJ E;  2QQN A;  2CDP A;  4ZXE A;  4W4Z A;  1O8P A;  1JZ2 A;  1LNS A;  2EID A;  2VJX A;  4P00 B;  1KEX A;  2J1T A;  4UAP A;  2X10 A;  4OMD A;  2X05 A;  2V72 A;  2B9V A;  5LA2 A;  4AG4 A;  3III A;  1EUT A;  2BBA A;  1K42 A;  1L7R A;  1UMH A;  1GU3 A;  2KD7 A;  2E33 A;  2VCC A;  4M4P A;  2Y6L A;  3JXS A;  2WBK A;  2VZQ A;  5CZK A;  1UY0 A;  2E32 A;  4DUW A;  3I2F A;  1R64 A;  3CQO A;  3EYP A;  3OGS A;  4RN5 A;  3P6B A;  5IYY A;  1O59 A;  2C9K A;  1CX1 A;  2W1U A;  2VZS A;  3D3A A;  2YB7 A;  1F4A A;  3C8X A;  2Y8K A;  3CIH A;  2Y6J A;  4ZY9 A;  5JMO A;  2V5D A;  5IFP A;  1CZT A;  1GOH A;  4A42 A;  4QB2 A;  1TVG A;  2RVA A;  1XNA A;  3CZJ A;  5JXJ A;  1K45 A;  5DN2 A;  1P8J A;  2ORX A;  4UOJ A;  3OGR A;  4W8J A;  2XHN A;  5B4X A;  2J1U A;  4LKS A;  4QX0 A;  2EIE A;  2JDA A;  4MGQ A;  2QQI A;  1T2X A;  2C26 A;  2ID4 A;  2LW8 A;  3LPF A;  3MBW A;  2VC9 A;  2CDO A;  5I0D A;  3WSO A;  4DXS A;  2VMF A;  3MO4 A;  1RYY A;  3A22 A;  3A7Q A;  3K4D A;  2VZ1 A;  4TTG A;  4CU8 A;  3NJX A;  2QQO A;  4OZO A;  1TG7 A;  2C4X A;  2WO3 A;  3C7E A;  2W1W A;  4FI9 A;  4E8C A;  5DMY A;  4DUV A;  2WZE A;  3K75 B;  4JKM A;  4QX2 A;  2HLE A;  4GWJ A;  3ECQ A;  3LEI A;  2Y6G A;  3I2H A;  4XVH A;  1SG3 A;  4ARX A;  1GNY A; 
#chains in the Genus database with same CATH topology
 3IDE A;  4CCC A;  3TN9 3;  2W46 A;  5CKM A;  3ZFF A;  4AEK A;  4B4P A;  2EAK A;  3F2Z A;  1J1T A;  1HN1 A;  4XUP A;  3VBS B;  2VMI A;  4EWE A;  1AZD A;  2D3P A;  1LCL A;  2RS3 2;  2HYX A;  2W5F A;  2Y38 A;  1RUD 3;  3LOI A;  4ITC A;  1PVC 1;  4Q1P A;  2XOM A;  3VBR A;  1Z7S 2;  2RDN A;  4UF0 B;  4CRQ A;  5FMD A;  1RVF 2;  1JOJ A;  5LCW L;  2E31 A;  3ACL A;  4XHX A;  1J3P A;  1DDL A;  2AEY A;  4XCB A;  3ASI A;  5KHK A;  3MHZ A;  3U14 A;  3V64 A;  2JDH A;  1ZBA 2;  1A6C A;  3DN7 A;  4XDQ A;  2VUL A;  5D21 A;  4AQ2 A;  1OF3 A;  3ATG A;  4IV1 A;  1RMU 3;  2VG9 A;  1N1Y A;  1VBA 1;  1X50 A;  1LOE A;  2JIC A;  2Q30 A;  4IE4 A;  1JYV A;  1W8U A;  3PUQ A;  4NR1 A;  3ORJ A;  4MUV A;  2RR1 1;  4NWV A;  5E88 A;  1YCI A;  1W6Q B;  2DTY A;  1H6Y A;  4YM0 A;  5F6K A;  1IS6 A;  3AMP A;  4UW3 A;  2BU9 A;  2WNU A;  4URA A;  1YNA A;  2R16 A;  5F39 A;  1GIC A;  2D6P A;  2BGC A;  2EIC A;  1GWK A;  2JE8 A;  3VKO A;  4MXW A;  2ZZJ A;  4HPK B;  1GAN A;  2VEC A;  3VZJ A;  1PO1 2;  1CGP A;  1AR6 2;  4Q4Y 3;  3ILF A;  3BPS A;  4I30 A;  3WX5 A;  2WNV C;  1OUS A;  2GP5 A;  3FN9 A;  2GND A;  3PUS A;  4A6O A;  4DXR A;  2Q8E A;  2WIN B;  1PNG A;  2V5Y A;  1YXW A;  5LB6 A;  4LIV A;  1NY7 1;  4KGQ A;  2ZAA A;  4NPM A;  1VE0 A;  4HFS A;  1M06 G;  5G05 L;  1JYC A;  5IK8 A;  3C2U A;  5I8S A;  4Q8K A;  5BNO B;  3M2M A;  5FXX A;  2YPD A;  4B4R A;  4DB5 A;  2VZP A;  2JG9 B;  1UPI A;  1APN A;  3NV4 A;  2IXJ A;  3J7H A;  3DXU A;  1PVC 3;  4XIO A;  1COV 3;  3ZM8 A;  2P34 A;  3KT1 A;  2FCV A;  3OSD A;  2BUK A;  3IKW A;  4UBH A;  3B00 A;  1GP6 A;  3WDX A;  4P5H A;  1OA4 A;  1HRV 2;  3NV1 A;  4QGL A;  2DVB A;  1NQD A;  4EN6 B;  4LT5 A;  1CAV A;  4Y20 B;  4EQV A;  3VGI A;  4RFT 0;  1D0G A;  2W1Q A;  3VDB A;  3VDC A;  4L11 A;  2WS9 2;  1JZ6 A;  1W8O A;  1JYT A;  5AC9 1;  3PJY A;  4CDW B;  1S2K A;  1HB1 A;  2ZS6 B;  1PGL 1;  3THT A;  4D8M A;  1WMF A;  4L97 A;  1NA1 A;  4LPL A;  3MZH A;  1MVQ A;  3JB8 A;  3FUO A;  1CX4 A;  1K5M B;  2ZMN A;  3ZX7 A;  2JEN A;  1SQ4 A;  2BER A;  3AL5 A;  4YYO A;  3WG4 A;  1E5I A;  1QJU 1;  2DDU A;  1ENS A;  3OPW A;  5IK7 A;  4FAH A;  1DFQ A;  2ZGT A;  4YLZ A;  1EV1 1;  2DUP A;  4RL7 A;  1HDK A;  3LF7 A;  3ZXD A;  5C71 A;  3APB A;  3HEI A;  1WLW A;  4CCO A;  5F2W A;  1BBT 1;  5F3E A;  1XOY A;  4K21 A;  3DEM A;  2D6K A;  5FYH A;  4K3U A;  3JQX A;  3AC0 A;  5T3N A;  1YJK A;  1XC6 A;  2W08 A;  3POE A;  1ALY A;  2VZO A;  3TB0 A;  4R8H A;  2VBP A;  3VBU B;  4ZZ5 A;  1YFY A;  1R09 1;  4IE0 A;  3CBN A;  1FV3 A;  4Y4Y A;  3ZXJ A;  5FY0 A;  5FOB B;  5GZG A;  1OFS A;  1Y9G A;  2B39 A;  3CU7 A;  3GHN A;  2LS6 A;  5KC6 A;  2BEO A;  4Z92 B;  1RUF 2;  2HEY F;  3USU A;  2BYV E;  2HBT A;  5CFD C;  3HMY A;  5FIX A;  2LAL A;  1IKQ A;  3HBK A;  1AXZ A;  4GZ9 A;  2VBD A;  4PLM A;  5C4W A;  3I2K A;  2D98 A;  3KHB A;  3IWZ A;  3OD4 A;  3PVO A;  4NRQ A;  4CE8 A;  1OLR A;  2P6H A;  3NNM A;  1UYZ A;  2W91 A;  3P1I A;  4CU7 A;  2VTX A;  3AKS A;  3P5B A;  4QXK A;  3N9P A;  4XFC A;  4KL1 A;  5A3U A;  1FYU A;  3BB6 A;  1NAE A;  1MR5 A;  2ZOE B;  2HWB 1;  1GZ9 A;  1R1Z A;  2VMC A;  2XDV A;  1PO2 2;  1OH4 A;  4GKY A;  5IVY A;  1MS9 A;  3SIT A;  2GSY A;  2ZEW A;  3TN9 2;  1PM7 A;  1KS5 A;  3AP9 A;  1EV1 3;  5I0T A;  4H3W A;  5A33 B;  5F3I A;  3EJK A;  5BNP A;  1BBT 3;  2BP6 A;  1RUD 2;  4GWN A;  3ZYP A;  4QHO A;  1YI9 A;  1O8S A;  2TNF A;  1GOF A;  1ZA7 A;  1QKQ A;  4Y5S A;  1DGL A;  1RUJ 3;  2P1B A;  1LOA A;  4JGY A;  1SCS A;  2VH9 A;  4FPJ A;  2YDE A;  5LA9 A;  5C3P A;  1S2B A;  3RYR A;  2W92 A;  3KB5 A;  2NN8 A;  4RQP B;  4RS5 C;  2ZEY A;  4JRL A;  5CFC B;  4W50 A;  2BNO A;  2H0B A;  4I0W B;  1RMU 2;  1J83 A;  3K48 A;  4CCD A;  1VBB 2;  2PQS A;  3O0X A;  2MEV 1;  3HD8 B;  1SBF A;  4NN0 A;  3FMG A;  4CUB A;  4LO4 B;  3OUI A;  4Q4V 2;  4AHW A;  3BTY A;  4DQA A;  2UUR A;  3KVA A;  3KD4 A;  3JUU A;  4SBV A;  3HIF A;  1IG3 A;  2FBE A;  4CVU A;  1JYX A;  2JDK A;  2AC1 A;  3FUQ A;  5A6Z A;  1UWW A;  2VL4 A;  3OBR A;  3HOB A;  3KF5 A;  5FMO L;  4YG0 A;  5L73 A;  3ES4 A;  3O0V A;  4Q4Y 2;  4Q29 A;  2HJI A;  1TZO A;  2ZCW A;  4MGI E;  2VW1 A;  2D7F A;  2XGX A;  5LBC A;  4IV1 C;  4X6R B;  1AR8 3;  1CIW A;  2HWC 3;  1H1A A;  4K1Z A;  4AAP A;  1S0I A;  2WWU A;  3CF6 E;  4LXL A;  4V2V A;  4YG3 A;  2HWB 3;  3MPP G;  3ZYJ B;  3NAP A;  4EV0 A;  1WZX A;  3T4H B;  4BHP A;  5IVJ A;  3AL6 A;  2C5D A;  4HET A;  3CEW A;  3MV1 1;  3BTX A;  2HWE 1;  3WQ1 A;  5GLZ A;  4QQ2 A;  2XR4 A;  1VRH 2;  3OB8 A;  3MFA A;  4E8D A;  5A7P A;  2XH6 A;  1Q8O A;  1RTV A;  2YG0 A;  1OOP C;  4CDU B;  4CEY C;  5FOJ B;  4IEP A;  3VKL A;  2A70 A;  5IVB A;  5CAD A;  2EXJ A;  4JTO A;  3ZFG A;  2EIG A;  2ZGU A;  3ACG A;  3VZL A;  2PLV 1;  5JXG A;  2MEV 3;  4NAO A;  2WO2 A;  4X8P A;  3TBD A;  2P4E A;  2PA7 A;  4XUN A;  4XUT A;  5JXI A;  3VUO A;  1JS9 A;  3ABZ A;  2G19 A;  3PMS A;  4UFM A;  3J9S A;  1GQP A;  4AI3 A;  3BI3 A;  5BXX A;  1YEW A;  1NX9 A;  4NHM A;  2XPJ A;  4MYE A;  2RS1 1;  1BYH A;  1WGP A;  3JCI A;  4MO3 M;  1JI6 A;  1XU1 A;  4PCR A;  4V1P A;  3X29 B;  3GJA A;  1UIK A;  4YG6 A;  3QD6 A;  1TMF 1;  1UPS A;  3NNL A;  2IXK A;  4HKL A;  2DVA A;  1WUV A;  1OT5 A;  3WF1 A;  1PNF A;  1W2U A;  5DUV A;  2A6Z A;  5IFT A;  2VBB A;  1DZT A;  1I1E A;  4PQQ A;  3UT0 A;  1YFW A;  4ISR A;  4DO0 A;  4GA9 A;  4CUG A;  1W9Y A;  4LBO A;  3SH3 A;  5GAL A;  2ET1 A;  1Q8P A;  1GZW A;  3FL7 A;  3SKV A;  3RWK X;  3ZXA C;  1IZ3 A;  2BWC A;  1D4M 3;  5JUV A;  2NMN A;  4NHK A;  4NUB A;  1OPM A;  2VME A;  2R07 1;  5JZG B;  4M01 A;  3LA2 A;  1V6O A;  3ZFE A;  1ZZ7 A;  3OJB A;  3O0W A;  1OF4 A;  3OGJ A;  1KGY A;  3E5U A;  4I01 A;  1VAK A;  2ERF A;  4JC1 A;  2ZX2 A;  1CAU B;  1YQ6 A;  2J1E A;  5FLH A;  2WYF A;  3B01 A;  5IUQ A;  2BTV C;  2W68 A;  4D69 A;  3KHC A;  4XCA A;  2VE1 A;  4XFF A;  2WWS A;  1H8T A;  3LIH A;  2C0Z A;  2R04 3;  2PLV 3;  2GH8 A;  4DXZ A;  2IXL A;  2JEM A;  5T5P A;  3AZX A;  1PHM A;  4GB3 1;  4LHN A;  3N9O A;  3I2O A;  1OHF A;  4ATF A;  1V6N A;  2JEC A;  2OT7 A;  1BVV A;  1QJY 1;  1F35 A;  5FO7 B;  3BVC A;  3S0M A;  1LAJ A;  3P3N A;  3KQ4 B;  3KLS A;  4ARY A;  4I2O A;  1Q5O A;  1AUY A;  2QVS B;  2CGP A;  3PTR B;  1WCU A;  1N1S A;  1POV 1;  1ND2 A;  3AFG A;  4BCU A;  3C3V A;  2E63 A;  1ZNP A;  4UWD A;  3VB9 A;  1TMF 3;  1NLS A;  2WAO A;  5GLU A;  2GNT A;  3UKT A;  1RGS A;  1J3Q A;  4OFG A;  1X33 A;  1RIN A;  3WHU A;  3BN6 A;  4BQW A;  4O9G A;  5ISL A;  4I09 A;  5FZO A;  4JDM A;  2A3X A;  2VMG A;  2YBS A;  2PHU A;  3POG A;  3PU3 A;  2YFU A;  4XF1 A;  5E16 A;  2FDG A;  4RA0 A;  4XQ4 A;  1XXN A;  4LQR A;  4BZ4 A;  2Y6H A;  2GMM A;  3A0K A;  4AVB A;  1RUJ 2;  3DKQ A;  3T3Y A;  3AVS A;  3M7A A;  4NAM A;  2NMO A;  5H9R A;  2JB8 A;  2WO1 A;  5LW9 A;  4QPY A;  2D44 A;  4LHS A;  3NL1 A;  1JTZ X;  4MX3 A;  4IUG A;  4IV3 A;  2OPW A;  2GNB A;  1MPX A;  1US3 A;  1KD7 A;  3CDZ B;  3FFZ A;  3KVB A;  3NQH A;  5DAP A;  1ENQ A;  5EFU A;  3UKV A;  5D8A A;  1JZ3 A;  5FDB A;  1FOD 2;  1AYN 1;  1K12 A;  1ND3 A;  2PHW A;  3OTF A;  4MGY E;  4P14 A;  3ZYR A;  5BNP C;  5JSP A;  5JOX A;  1GP5 A;  4QKF A;  2J7M A;  1OSG A;  2JXA A;  5FPV A;  3KSC A;  5AFE A;  4D3W A;  4J1W A;  3I59 A;  1VMH A;  4XEZ A;  3LDK A;  1CAX A;  4DIN B;  5C9A A;  1UMI A;  3GBW A;  3LB9 A;  3MW2 A;  4JGY C;  2Q0A A;  3PUI A;  1W3V A;  2GC0 A;  4YZ3 A;  1A8D A;  3SKJ E;  5C3R A;  3VZK A;  4WM8 C;  4AVS A;  3ETQ A;  4B8E A;  4W4Z A;  1AR8 2;  4C0H A;  1SZB A;  4PDW B;  2HWC 2;  1JZ2 A;  1ODM A;  3ZXK A;  2RM2 1;  1TEI A;  1Q8S A;  1KEX A;  2A6V A;  4WVM A;  3RJR A;  1FMD 2;  3WNX A;  3J26 N;  4L2N A;  3H0O A;  1LTE A;  5TSW A;  3VN4 A;  2ZX0 A;  2CTV A;  1MZF A;  1NCR C;  5LA2 A;  5CB7 A;  4AG4 A;  4YVS B;  3U4X A;  3OUH A;  1J3R A;  3MIF A;  1UMH A;  3PUR A;  3S7E A;  4M3C F;  1MS8 A;  1CON A;  4M4P A;  2EVX A;  5HCA A;  1UF2 C;  2LTN A;  2P3J A;  2CHH A;  2RG4 A;  4Y1Y A;  1OVS A;  2OUJ A;  3VV1 A;  1R1A 2;  1ASJ 1;  2OUH A;  2IXC A;  4JHT A;  2E7T A;  3ZDV A;  2EA7 A;  4QPG A;  4XIK A;  1UY0 A;  2RDS A;  4NRP A;  1GNZ A;  5ACA 2;  2JD4 A;  1EYB A;  4BA6 A;  1VMF A;  4JGZ C;  4EJR A;  3RZG A;  3DKW A;  4BQY A;  1CWP A;  3CQO A;  2PHT A;  5EXO A;  4QX8 A;  1JUH A;  5JI9 A;  4ZKT B;  4QKD A;  2B46 X;  1XNB A;  4FOV A;  4YW2 A;  2G9F A;  3H8O A;  5J96 B;  4S2H A;  2R6Q A;  4AFA A;  2VW0 A;  4RR3 A;  1NCQ B;  4BLI A;  4K9S A;  4W65 A;  1VBE 2;  3VBF B;  2AEZ A;  4QXB A;  5AVA A;  4LO7 A;  5IYY A;  1BLZ A;  4J6G A;  1C8M 3;  4OUM A;  5BYN A;  3UV9 A;  2Y8K A;  1HLC A;  2Y6J A;  2DV9 A;  2RM2 3;  5IFP A;  2JX9 A;  1CZT A;  1GOH A;  2EAA A;  4QB2 A;  5CKN A;  2LRP A;  4XHB A;  4XJW A;  5JOY A;  2DU1 A;  4Y1Z A;  2O8Q A;  1UOB A;  3WP4 A;  1MQT A;  1D4M 2;  5L9V A;  5B4X A;  4YFZ A;  2J1U A;  5DZE A;  1RB8 G;  1IS3 A;  1S0G A;  2QDN A;  4JV4 A;  2NQY A;  3NVC A;  2EXK A;  2JDA A;  3BIW E;  3BOW A;  3WG2 A;  1BMV 1;  4NHX A;  5FP9 A;  1BEV 1;  1T2X A;  1NZC A;  1NG0 A;  5EPA A;  5FJH A;  2ARE A;  2ID4 A;  4AHX A;  2IVI B;  1CPM A;  1ZX5 A;  1WLD A;  3H42 B;  2D6N A;  2R04 2;  1W6O A;  2OYZ A;  4AED B;  5C3O A;  2VMF A;  3CL1 A;  2ZGN A;  3MO4 A;  5HBA A;  3WIN E;  4YZ1 A;  1V6I A;  1REE A;  2JIG A;  2VZ1 A;  4ORF A;  4TWT A;  2JDY A;  4TTG A;  2BPA 2;  1O4T A;  1X9P A;  2BV4 A;  2QTW B;  1W8Z A;  3CJI C;  3Q8A A;  4GAL A;  4OZO A;  1TG7 A;  1G7Y A;  2WO3 A;  4E8C A;  3MID A;  4CA9 A;  3AP4 A;  1RIT A;  3O7O A;  4IES A;  3SCH A;  3N35 A;  1XRU A;  1RUI 1;  2R06 1;  1UKR A;  4OI2 A;  4CPB D;  1WCS A;  4OHX A;  3ECQ A;  3LEI A;  4ZS3 A;  3ZYI B;  1H2L A;  2GNM A;  2Z42 A;  3R6S A;  4CEW B;  5CG8 A;  1R08 2;  1ZZC A;  4YGC A;  1CJP A;  4QPI B;  5FUP A;  5KXE A;  1C8N A;  3WQ0 A;  4E4H A;  3IMN A;  3CKH A;  4UT5 A;  3KT4 A;  4LBQ A;  3AYA A;  1WMX A;  2XBO 1;  1DZR A;  3AVR A;  1RUG 1;  5FXW A;  5T54 A;  4IW3 A;  3PUA A;  4CCL A;  3ACF A;  5FPX A;  2WN3 A;  3DPR B;  1SFY A;  2ZEX A;  4YW1 A;  1Q8V A;  1QJX 2;  5FYM A;  5LY1 A;  3VD7 A;  4ES9 A;  1H9P A;  3AJY A;  4Z1V A;  4JCK A;  5F32 A;  2AAC A;  2VO5 A;  2VZU A;  2ZBJ A;  4XZU G;  4PI2 A;  1V6L A;  5FMO S;  5FYT A;  3EQE A;  2B42 B;  4B3N A;  2WZR 2;  1X8E A;  2UYB A;  3I7D A;  4ZZ8 A;  3W5N A;  1MS1 A;  1PK6 B;  1UY4 A;  2JDU A;  5HCH A;  4LBQ D;  5IW0 A;  4Z2A A;  4ISQ A;  4KMQ A;  4BPZ A;  4CEY A;  2OS2 A;  2W47 A;  1O3T A;  1AL2 1;  1VJ2 A;  2IXI A;  3QLQ A;  4FPF A;  4DUX A;  1TME 1;  3RI8 A;  2NPI A;  1AVB A;  5A6Y A;  3N7L A;  5D8A C;  2R06 3;  2IFW A;  1ND3 C;  4K8F A;  4YW6 A;  5LBB A;  3OCP A;  4AEM A;  2RS5 2;  1EAH 1;  4IDZ A;  4DIQ A;  3DGT A;  3T1M A;  1TNF A;  5KHG A;  1LJ7 A;  2RJ2 A;  1WCQ A;  4DFS A;  1Y9Q A;  1DIW A;  3HNM A;  1RUO A;  1A3K A;  4QAW A;  3IAP A;  3SEP A;  2XJQ A;  2BVB A;  2FDJ A;  4XOG A;  2GZW A;  2XL9 A;  3ZR6 A;  1H6X A;  4BU2 A;  4GH4 B;  2HWF 3;  4IEV A;  3VL8 A;  1GYK A;  3AP5 A;  2XBO 3;  1LES A;  1EY2 A;  2FMY A;  5JIA A;  3E6D A;  4HL0 A;  4YAR A;  2ZAH A;  4AR2 A;  5EJ1 B;  1CAW B;  4ES8 A;  1DBN A;  2GME A;  2V4V A;  4N7I A;  5K4L A;  4AW7 A;  5GLT A;  3H8X A;  5T5O A;  2NP0 A;  1GUI A;  3CMG A;  3RWN A;  2QUO A;  3DV8 A;  1H4H A;  3UGF A;  4JQR A;  4K40 A;  3OY8 B;  4CDW A;  3M1H A;  3VBO C;  1MVE A;  4XF0 A;  5DAB A;  5CIR A;  5C8C C;  4XFG A;  4N53 A;  4XJZ A;  1AR7 2;  2XVL A;  3KS7 A;  3LSE A;  5EZW A;  5FMB A;  4GWM A;  4A41 A;  1V6J A;  1K5M A;  2J42 A;  3OPZ A;  1RXF A;  1DZQ A;  5GZD A;  4D7T A;  5IT6 A;  3DEC A;  3DXT A;  4O65 A;  1O4Z A;  1C8M 2;  5BY5 A;  4EZH A;  4QPG C;  2K9Z A;  3H3Z A;  4W6X A;  1X36 A;  1Y43 B;  2W1S A;  3CHX A;  1OMI A;  3JZV A;  1WA6 X;  1H0B A;  4BXS V;  1QH7 A;  1ZRF A;  2JJ6 A;  2D43 A;  3FWE A;  4QB6 A;  3ZXL A;  2QQJ A;  2JG8 B;  3NW4 A;  1FAT A;  1DGR N;  1SDW A;  4KG0 A;  4LK7 A;  4NWW A;  1A8M A;  5IAX A;  2GC2 A;  2XKP A;  1HB4 A;  4PJY A;  1ULD A;  3MF6 A;  3M4F A;  4XJ9 A;  2DCJ A;  4OMC A;  2DFC A;  3D8C A;  4BIS A;  1QJE A;  1E5S A;  4IQP A;  4KWJ A;  1KXG A;  1ZBE 2;  2WUH A;  4HMZ A;  4FPH A;  1LR5 A;  4OHY A;  1H4G A;  2ZX4 A;  4YGE A;  5A32 B;  2BOI A;  1UZZ A;  1X7N A;  2QE3 A;  1AL0 G;  1XNC A;  3WF3 A;  3BAL A;  3BUC A;  1VBC 1;  3VLB B;  4TN7 A;  3GCX A;  2D3S A;  3R4D B;  4KG8 A;  3ZPO A;  4BDV B;  3OBT A;  5FZ9 A;  4GXL A;  4LUK A;  3ZN6 A;  2FZ1 A;  1RUH 3;  3O1P A;  2XLA A;  2UWC A;  1UU5 A;  1F2N A;  3UKN A;  3JD7 3;  4NHL A;  4GD4 A;  1ODN A;  1S4C A;  1YWK A;  3AMM A;  1QXP A;  2PHF A;  4P9X A;  4CXX A;  2C1F A;  2WFF 1;  4NIG A;  2VZ3 A;  3AX4 A;  1F5F A;  4LA2 A;  3S7I A;  1AF9 A;  2YGL A;  4WVZ A;  3VBH B;  1CZV A;  2I07 B;  1GBG A;  2E7A A;  4QHZ A;  3PUH A;  4M3C B;  4IGO A;  1LHN A;  2XVG A;  4XBL A;  4MV2 A;  3K46 A;  4RS5 A;  5FMC A;  3WNL A;  5IVE A;  4MGS A;  1W2O A;  1WLT A;  2RDR A;  2ZGR A;  3TEX A;  4MZU A;  4B1M A;  2Y6F A;  2GAL A;  4XZP A;  3JBG 1;  4FT8 A;  4M00 A;  2VVE A;  3S5A A;  3M3E A;  4M4R A;  2ARX A;  4FPY A;  3CJX A;  5T5J A;  4DS0 A;  5IHR A;  3PME A;  3AZW A;  2K0G A;  4BQ5 A;  4EWA A;  3UGH A;  1S0C A;  3WCR A;  3D0J A;  5C70 A;  1UYY A;  5IK5 A;  1BKZ A;  1ULP A;  3NNF A;  3P3P A;  4WM7 C;  1IQA A;  1W03 A;  1OQE A;  2JB4 A;  2BNM A;  2LRO A;  3K3N A;  4XPV A;  3IDC B;  5DUX A;  3GZU C;  5EIY B;  4LBN A;  2DCT A;  1N47 A;  4N8M A;  2Q1Z B;  5HXV A;  3AZY A;  1GFF 2;  4QKB A;  3RZL A;  1G9B A;  1G9D A;  3N4M A;  2FDF A;  2PHL A;  1XNK A;  1QU0 A;  1DCS A;  4AEJ A;  1VBC 3;  4GJY A;  4CP9 A;  4JKK A;  1LOB A;  4YM1 A;  1W0P A;  1XPW A;  4Q4X 2;  3AYC A;  5JR2 A;  3VBS C;  2ZA9 A;  1BK1 A;  1HN0 A;  1DF0 A;  4CYD A;  2WNV B;  3N9N A;  4QXC A;  2PMW B;  1ACC A;  1HRI 3;  1OOP A;  2XJP A;  1N3Q A;  2WFF 3;  3I54 A;  4OYU A;  4XUR A;  3RNS A;  2ZHM A;  1LU2 A;  2DWR A;  3VZO A;  5F8P A;  4OI1 A;  1JYI A;  4YGD A;  5EJZ B;  5E1R A;  5FJK A;  1FT9 A;  3ETP A;  4CZS A;  2R0H A;  2E26 A;  2FCU A;  3H8R A;  2HH9 A;  4XUO A;  3JBG 3;  4OLL A;  2EXI A;  2Q4S A;  3ZYB A;  4COV A;  2PN5 A;  2Y60 A;  4FVV A;  3CO2 A;  3U37 A;  1Y4W A;  4HSL A;  1V9U 2;  5T52 A;  4AFM A;  1XYO A;  1HJF A;  3ZXF A;  4O61 A;  1PZ7 A;  2HWF 2;  2TEP A;  3KF3 A;  4K20 A;  4LKD A;  3ZMN A;  4AL9 A;  1HKD A;  5GM0 A;  5C5T A;  3H7J A;  3DYO A;  4LR4 A;  4S2D A;  4Y1X A;  1VBD 1;  2BNN A;  4R9D A;  4JRA A;  2JKB A;  2OVU A;  2XKO A;  4LBK A;  3OBA A;  1YYN A;  1UY3 A;  1DYO A;  4UW4 A;  4XIL A;  3UL2 A;  3O1T A;  4OQ9 A;  1VBA 3;  2CAU A;  5EP9 A;  3NWK A;  3LKJ A;  1W8T A;  5JWP A;  2RV9 A;  5BNO C;  2RR1 3;  4XMI A;  1D4V B;  5HPO A;  1UX7 A;  5JPN B;  1IS5 A;  5F3C A;  1YQC A;  1SLL A;  1UCX A;  2BFU S;  2JG9 C;  3JQW A;  4P9J A;  5AFB A;  4BQ1 A;  3G7D A;  4DRV A;  4A2U A;  4GWI A;  3POW A;  1UL9 A;  1SDD B;  3HNB M;  3VHR A;  1JZ7 A;  2JD9 A;  3I3M A;  2K2S A;  4QGN A;  4C91 A;  5FY4 A;  4JHZ A;  4FP3 A;  4OHW A;  1UZ0 A;  2IXH A;  4QM9 A;  3AKQ A;  1UN1 A;  4CUA A;  4Q26 A;  3I2J A;  4IL7 A;  3BGA A;  3KGL A;  4W6W A;  3WR0 A;  3KCX A;  4LNV A;  2D6L X;  3Q8B A;  4AQT A;  3ACH A;  4CDW C;  3IDB B;  4BME A;  1M4W A;  2YFZ A;  3IIA A;  4QQL A;  3AMQ A;  4MH0 E;  3KMH A;  5FYC A;  4N53 C;  1SHW B;  3U11 A;  3N9L A;  4UXA A;  1K5M C;  1TNR A;  4QX7 A;  3W5M A;  3SCF A;  3R4U A;  1I6X A;  5L9R A;  1RUN A;  2ZGS A;  5H9P A;  1QMJ A;  3O1R A;  5FP8 A;  1K5J A;  2ZHN A;  1CQ9 A;  1VBD 3;  3GGL A;  1LHV A;  1O3Q A;  4MLO A;  1U5Y A;  1VAV A;  1RUH 2;  4RGG A;  2A73 B;  2ZTN A;  3HNY M;  4LK6 A;  4YW5 A;  3EB7 A;  3PL0 A;  3JD7 2;  1FI2 A;  1W2N A;  5AC9 3;  1UAI A;  3D0S A;  1HXS 2;  3GF6 A;  4Q0Q A;  3GDB A;  3WT3 A;  1VAL A;  2I2S A;  3FBM A;  4DMI A;  3IPV B;  3VD4 A;  5LEJ A;  4GAZ A;  3VBU C;  2VOV A;  4QPW A;  3BCW A;  1DQ5 A;  1IPS A;  3ZYH A;  3HR9 A;  3A21 A;  5FWE A;  3O1U A;  5FLI A;  4K6B A;  4N43 B;  2ORZ A;  4Y5Z 0;  2RHP A;  1LED A;  3ALQ A;  1QJU 3;  1HB2 A;  3LEG A;  3SMH A;  1JUI A;  1XJA A;  2W9X A;  3ZSL A;  5K7P A;  1F5J A;  4IEY A;  4Y22 A;  5FO8 B;  1AJO A;  3AM2 A;  5FYZ A;  2UU8 A;  2XQR A;  1G9F A;  2WJS A;  1GWL A;  3M8L A;  1ZZB A;  2ZGM A;  4QWN A;  4RHV 1;  4R9C A;  3OOX A;  5FZI A;  2RMU 1;  3VDA A;  3E1F 1;  4LLO A;  5F6L B;  3H1M A;  3B93 A;  2KA3 A;  1W6N B;  4AFB A;  4E2S A;  1Q3E A;  1RIR A;  5A3L A;  2ZGO A;  4OZX A;  4YVW B;  2ETE A;  4HVR A;  4Y1V A;  5CIS A;  4WM8 A;  1R09 3;  4EN8 B;  4LA3 A;  1C5H A;  3H3U A;  4XC9 A;  3ZFF B;  3VD3 A;  4DEQ A;  2HWD 1;  2VQT A;  3LD8 A;  1ULC A;  4GMP 0;  4IEU A;  1HIX A;  3WEZ A;  4ASL A;  5I0S A;  5I8Y A;  3HAG A;  3T09 A;  3VBR B;  1WD4 A;  3ZVX A;  1W90 A;  1DQ1 A;  2CU5 A;  4KBZ A;  1ZRR A;  1JOD A;  2BWA A;  1DYK A;  2B4K A;  1UZW A;  1PVX A;  2B8M A;  2ZXQ A;  3K51 A;  4O9E A;  3ZN5 A;  4A45 A;  4CU6 A;  1NCR A;  1VPH A;  4TLG A;  4XFA A;  4EE2 A;  2V09 A;  4ZU5 A;  5ABJ B;  3BOP A;  1L3J A;  5LA1 A;  4LO5 B;  4GQ7 A;  1HRI 2;  1RUE 1;  2QQW A;  4IV1 B;  2J1V A;  4L92 A;  4QB1 A;  4YM3 A;  2C6S A;  4XBQ A;  4MGZ E;  3WHT A;  4IND A;  1VRB A;  1XB9 A;  2K46 A;  1LHO A;  4RQP C;  5CFC C;  3WLU A;  4XJA A;  3WD5 A;  2AYH A;  2TUN A;  1RHI 1;  2QQN A;  4OUL A;  4XF4 A;  2WFP A;  4ZXE A;  3S30 A;  1O8P A;  3EMR A;  2WNU B;  3RJ2 X;  1AXK A;  1QQP 1;  2CY6 A;  4M0N A;  4FTE A;  4JGZ A;  4MXW B;  4UAP A;  3N36 A;  2DVG A;  1LOC A;  4RHV 3;  4OMD A;  1LOD A;  1IOA A;  4IXL A;  1PVC 2;  1COV 2;  4A7Z A;  1QJF A;  2V72 A;  2RMU 3;  1O4Y A;  4BMB A;  1BQP A;  3J8F 1;  5GKA C;  1K42 A;  1L7R A;  2D5H A;  1XBF A;  1GU3 A;  1S0J A;  3MFC A;  3TYJ A;  5B2G B;  2YU2 A;  4Z07 A;  4ZU7 A;  1T6B X;  4YFW A;  1VBA 2;  3ZXE A;  2HWD 3;  4YZ2 A;  5IK4 A;  4UBG A;  5J36 A;  4XQW A;  2RR1 2;  5CZK A;  4R9A A;  2VPV A;  4O7X A;  3M3O A;  5I0U A;  3U1X A;  1XND A;  3PTY A;  5ANN A;  1WME A;  4MG2 A;  4XYX A;  4DUW A;  2WLP A;  1ULG A;  2PTM A;  3Q8F A;  4COZ A;  3M3Q A;  4F3J A;  3BYW A;  1H30 A;  5FPU A;  1JOP A;  2PYT A;  1AYM 1;  1C4R A;  1CAV B;  2X29 A;  4HVQ A;  1RUE 3;  1LOG A;  2VNR A;  2Z69 A;  4HK9 A;  4Q0U A;  4RD7 A;  4XAE A;  4AQ6 A;  5CEH A;  1KDM A;  1Q43 A;  3OBZ A;  3ZYG A;  2FDH A;  4S2F A;  1NY7 2;  1O59 A;  4H14 A;  1CJD A;  2DCZ A;  4QU2 A;  5L7O A;  1CX1 A;  3D3A A;  4PBP A;  3J7M A;  1YQ5 A;  5FPZ A;  1NA1 B;  5FZ0 A;  3U4S A;  1WCD J;  4AI1 A;  4K1Y A;  5JMO A;  2FHR A;  5KHH A;  3POF A;  1TVG A;  4UFH A;  4AQS A;  1OLQ A;  4QU1 A;  3CZJ A;  2HWE 3;  5KBF A;  5FKB A;  2YU1 A;  1K45 A;  4UW6 A;  3CJI A;  5A6X A;  1F15 A;  3DL3 A;  1DG6 A;  4UOJ A;  5FY5 A;  4P9Y A;  1XE7 A;  1POQ A;  3OGR A;  4Q27 A;  4RFR B;  3VDD B;  1VLN A;  2P3Y A;  1EP0 A;  3ROU A;  1YFU A;  1NXD 1;  3T2T A;  4AE2 A;  5K0U B;  4DNY A;  3ZOI A;  1XE0 A;  5D1I A;  5FYI A;  2QQI A;  2MNG A;  2Z79 A;  3H8U A;  1CN1 A;  1LKN A;  2DUR A;  2WKK A;  5I0D A;  5AC9 2;  3DF0 A;  5KWR A;  4DZG A;  2XWB B;  4DXS A;  1PGL 2;  1G9C A;  2EF6 A;  1RYY A;  1DYP A;  3A7Q A;  5JZG C;  1XYP A;  4UFL A;  2RS1 3;  3FLR A;  3K4D A;  5LZ6 A;  3USU B;  2ATF A;  5DG2 A;  5C3Q A;  4CU8 A;  4JQT A;  5J37 A;  4G4F A;  2WT1 A;  2QQO A;  2QFE A;  3VKN A;  2C4X A;  1QJU 2;  1MEC 1;  1LHW A;  4FI9 A;  2AUY A;  5C4W B;  3KM5 A;  4D7Y A;  3RZM A;  1EV1 2;  1NLR A;  5FCC A;  2DUQ A;  1RL3 A;  1AR9 1;  2HLE A;  5D2A A;  1D2S A;  1BBT 2;  2P17 A;  3I4I A;  1W28 A;  2P5B A;  1ZRC A;  2DBI A;  4JVA A;  3H3L A;  4LIU A;  2GC3 A;  4XVH A;  1SG3 A;  2VMH A;  4Y5T A;  4NRM A;  3TNQ A;  3WP3 A;  1YLL A;  2VTF A;  3J7L A;  4WBB A;  4URT A;  4E27 A;  1W8H A;  5FAX A;  2R07 3;  2V4A A;  2VY0 A;  5F7U A;  3DYP A;  3RG0 A;  5LA0 A;  1R09 2;  1GR3 A;  1W6P A;  3LZZ A;  2VUJ A;  4IEQ A;  2JDZ A;  2R1B A;  3RYP A;  4I3G A;  2CGN A;  2YRO A;  3ZIX A;  5GLV A;  4E2Q A;  4XXA A;  2GH2 A;  5B4N A;  3KGZ A;  3GCW A;  4PI0 A;  3OF1 A;  2C24 A;  4LEJ A;  5FRA A;  4ERO A;  4BB3 A;  3O5S A;  3E6B A;  1YUD A;  5A7W A;  1SLB A;  4GB3 3;  3VD5 A;  1RC6 A;  2YC0 A;  4NPR A;  4Z82 A;  2QQU A;  3MGU A;  1LOF A;  3MUY 1;  1FPN 1;  3NKG A;  1QJY 3;  5C8W A;  1PK6 A;  4A44 A;  2OW4 A;  2DVF A;  4JKL A;  4X6Q B;  1A34 A;  2VQA A;  4ZON A;  3SC7 X;  5J1X A;  4IE6 A;  4LO8 A;  3WDU A;  5LAT A;  1POV 3;  3VD9 A;  2QJV A;  2HWB 2;  1STM A;  4P5Y A;  2ZKN A;  4FPE A;  3N9M A;  1MZE A;  1MEC 3;  4FQZ A;  5FZD A;  5I91 A;  4B1L A;  3M70 A;  2XXZ A;  4EN9 B;  3HT2 A;  1KJR A;  1JHJ A;  1QWR A;  3AKP A;  3WNN A;  2IVJ A;  5FXZ A;  4XET A;  3VBO A;  2PAK A;  2XQX A;  1GMM A;  3PLQ A;  4Q4W 1;  2R1D A;  4XJU A;  5F5C A;  5C8C A;  1WBF A;  2VCB A;  1CD3 G;  3WOG A;  1ULF A;  4IE5 A;  4EWD A;  1O3R A;  3NJZ A;  3BTZ A;  3PDQ A;  5JVV A;  1WBL A;  1HB3 A;  4LBJ A;  5SV5 A;  3NAP B;  5FRE A;  1UY1 A;  1C1F A;  2B45 X;  2BDR A;  1LRH A;  1OVP A;  4XBN A;  4BIO A;  4PDW C;  2W87 A;  4PIZ A;  4BQ2 A;  3L9J T;  1UX6 A;  1LHU A;  2MEV 2;  1LGB A;  5LRS A;  2ENR A;  3SQO A;  4AFD A;  3O1O A;  2P37 A;  1SPP A;  1AYN 3;  1PGW 1;  1REF A;  3O14 A;  2YZ4 A;  1ST8 A;  5EHD A;  5JLV A;  5FZA A;  1JOB A;  1UYP A;  5F5I A;  3ZR5 A;  3ENR A;  1VMJ A;  3KT7 A;  1SEF A;  3ZFG B;  4JX0 A;  2WSU A;  3ITQ A;  3MIG A;  1N1V A;  1RUC 1;  1DQ6 A;  1PIV 1;  1QOS A;  4XAA A;  3QH6 A;  1JHN A;  4LJH A;  3WDV A;  4KWU A;  5IWF A;  4PF5 A;  4TSV A;  3OYW A;  5FP4 A;  2XJV A;  1YJL A;  4PLO A;  2XLF A;  2OQ6 A;  2GDF A;  4H55 A;  1CIY A;  2VOW A;  3FBY A;  3OD0 A;  2VNG A;  4I02 A;  3ELN A;  1CZS A;  2Z5W A;  2OXB A;  4CDQ A;  5BV6 A;  2XUM A;  2ZZQ A;  2QKD A;  2HWE 2;  4FPC A;  2ZJC A;  3V0B A;  3HT1 A;  2KXL A;  3L2H A;  5GZF A;  1UD1 A;  1O6U A;  4KU8 A;  4FFH A;  5DDJ 1;  5IAT A;  1G86 A;  2A3Y A;  1NCQ C;  3QH7 A;  3W9A A;  3AKR A;  3O1V A;  3VBF C;  4CPB A;  3FZ3 A;  4Y33 A;  2RS3 1;  4N9H A;  5FZC A;  1ASJ 3;  1GZW B;  3D5O A;  4MHU A;  5DUW A;  3THD A;  2A7A A;  4Q0V A;  5L7O C;  1UZY A;  4Y26 A;  1Z7S 1;  3R05 A;  4L9B A;  2ADD A;  2HKX A;  2PLV 2;  3POI A;  1RVF 1;  4IEX A;  3IT8 A;  3WF2 A;  1MS5 A;  2QQV A;  3T2Q A;  2FDK A;  3ZFE B;  1AJK A;  3U07 A;  1B35 B;  1ZBA 1;  2VOT A;  2WQ8 A;  4YSF A;  2VNO A;  1MAC A;  4WM7 A;  5F5A A;  4LE3 A;  4Q0S A;  2RS1 2;  1W0N A;  3MIC A;  5LK5 A;  2Z4F A;  4FCA A;  3VKF C;  4Q5O A;  1Y7B A;  2JDP A;  4G3Y C;  3AMN A;  2YPJ A;  3RZK A;  1TMF 2;  3AZZ A;  4Y1U A;  1RUC 3;  1H8T B;  3THP A;  5A70 A;  5KHJ A;  4E4Z A;  2AH2 A;  3IMM A;  4QMA A;  2GAU A;  1AX1 A;  2Q5T A;  4MOA A;  4XE9 A;  1NKG A;  2PHX A;  5JXH A;  3D82 A;  1F8V A;  1DQ4 A;  5C6C A;  1BK0 A;  4JAA A;  1PO1 1;  1F4H A;  1XSQ A;  1AR6 1;  3NJY A;  3PIG A;  5DZF A;  1Y9M A;  3T1L A;  3VBS A;  4AED C;  2GMP A;  5CKQ A;  3J4U H;  3UGG A;  2E51 A;  1WW5 A;  1LEM A;  4CP2 A;  2VTX J;  2VZT A;  2CV6 A;  4UF0 A;  3U78 A;  3ZIW A;  1ND2 B;  4CTE A;  4SLI A;  1DQ0 A;  3NV2 A;  4LOS A;  3BIE A;  3I3Q A;  4XAB A;  2R07 2;  1HV0 A;  2N7G A;  4Q0P A;  1KFU L;  2XB6 C;  4AYU A;  3MIB A;  4A3X A;  5DDJ 3;  4W6Y A;  3ZKU A;  5FY8 A;  1UZV A;  2HEW F;  4C8D A;  3IZO A;  3IBM A;  4MHR A;  4H7L A;  5FK8 A;  5FZO B;  3I97 A;  1BEV 3;  5L9B A;  3URF A;  3EHK A;  1B09 A;  5FZB A;  5J3U A;  3PNA A;  2UY9 A;  1OXC A;  4LOT A;  2VAU A;  4CDX B;  2E7Q A;  1W6Q A;  2ZPX A;  3H1Y A;  2TBV A;  3WF4 A;  4CEW C;  1RVF 3;  4CP1 A;  4ASM B;  4K8R B;  4GB3 2;  1X8M A;  1OKO A;  3C7O A;  4QPI C;  1HRV 1;  1OD3 A;  3R4S A;  1ENX A;  1SLA A;  4HPK A;  3WP5 A;  1QJY 2;  3TEY A;  4IV3 B;  2A1X A;  4D0Q A;  4P9I A;  2YV8 A;  5EYY A;  5HXM A;  3RMY A;  2BBV A;  1H8V A;  5CAZ A;  2WS9 1;  1MS3 A;  2ARC A;  2B5H A;  1Q8Q A;  3LSD A;  5BNN B;  3DPR C;  3PJQ A;  1OUR A;  1BXH A;  1D0H A;  1RUI 3;  4AI9 A;  3I8T A;  5FR3 A;  2WC2 A;  2WDB A;  3B02 A;  3LGR A;  5SV8 A;  1F9K A;  5FY7 A;  2Q1F A;  2X5I B;  3I59 B;  5C9A B;  1J58 A;  1CAX B;  2QNK A;  5BNO A;  1W9S A;  4XDO A;  2J1A A;  2B7Y A;  4EZ4 A;  5JI7 A;  3QBQ A;  4PQ9 A;  5F37 A;  3AYD A;  2JG9 A;  3HBZ A;  3MF9 A;  3UJO A;  5M0T A;  1PO1 3;  2VUA A;  2DCK A;  1LOF C;  2XWJ B;  5LWB A;  4LKF A;  5LY2 A;  1VB2 A;  1PK6 C;  1LEC A;  4V2W A;  3HN1 A;  3HJR A;  4GUL A;  4R4Z A;  4RYD A;  2WA4 A;  4WVM B;  5FP3 A;  3MV0 1;  1RUG 3;  4TXW A;  1RXG A;  2ZGL A;  3GJB A;  4YW3 A;  4COY A;  4XW3 A;  4NID A;  1EPW A;  3UK9 A;  4A7Y A;  5F1R A;  5A6Q A;  4PT6 A;  5DAV A;  1GZC A;  4Y20 A;  5T50 A;  5A3W A;  2H6B A;  5A3O A;  4FPK A;  1AYN 2;  4OUS A;  1DLL A;  4A4A A;  1X82 A;  4AI2 A;  3DUI A;  3E97 A;  3FX3 A;  5CG9 A;  4H7M A;  5AVP A;  3THC A;  3W20 A;  5IVV A;  5T5L A;  4L99 A;  5LRR A;  3B9I A;  2EAL A;  5EV7 A;  3NKT A;  1HRV 3;  1RUF 1;  4NVP A;  4GH4 C;  3VL9 A;  3BPZ A;  4QPG B;  3LOB A;  1NYW A;  3TWI A;  4UI9 L;  3WNP A;  4AVC A;  1AL2 3;  1ULO A;  5C3S A;  1TME 3;  1WA4 A;  5L36 A;  3O12 A;  1GP4 A;  1WW4 A;  2RM2 2;  2VM9 A;  2WS9 3;  4XQD A;  3PVE A;  2ZMK A;  3K77 A;  1J84 A;  1LGC A;  5A7S A;  4CU9 A;  1FNZ A;  1ZM1 A;  3LCP A;  2WAB A;  4R52 A;  1EAH 3;  2J1S A;  4AOC A;  1PX4 A;  1AX2 A;  2OA2 A;  2BRT A;  1IG0 A;  5F5Q A;  5J98 B;  5JSR A;  4RR3 B;  4ZHN A;  4NHY A;  1Q56 A;  3L2Y A;  4HAN A;  2OII A;  4F7Z A;  4E4D X;  3U75 A;  2WZ8 A;  3VBU A;  1PO2 1;  3T2O A;  2W0X A;  4PBO A;  3TN9 1;  4ET7 A;  4OUE A;  3I3B A;  2XHK A;  5H9Q A;  2ZAB A;  1W6M B;  3GAL A;  2AEN A;  1ASJ 2;  3GXU A;  1RUD 1;  2QBX A;  3LFM A;  3MIH A;  2ZGK A;  2X8K A;  1WW7 A;  3HN3 A;  3NNG A;  1MQT B;  3BKZ A;  2CWM A;  1QGL A;  3A4U A;  1CR7 A;  4CDQ C;  3RZH A;  2JG8 C;  3KV6 A;  2W2I A;  4YGB A;  4IEO A;  5T55 A;  1DGW X;  1ONA A;  3GZA A;  1IPK A;  3POY A;  4I0A A;  2VVD A;  4DEV A;  3KQR A;  1RMU 1;  3A23 A;  1VBB 1;  2DYC A;  4NOT A;  1S0F A;  5FYU A;  4OQ8 A;  1Y3T A;  4Q4V 1;  1RUF 3;  4MGT A;  5EQU A;  5GZC A;  1JYW A;  1E5R A;  2BZD A;  1W6O B;  2A6X A;  4MSV A;  1WWY A;  3KZ4 C;  5IJR A;  4Z2W A;  4XFH A;  4CCN A;  4IEZ A;  5FPL A;  1AHS A;  2W95 A;  5A33 A;  3C7H A;  1GOG A;  2Y6K A;  3LEK A;  4Q4Y 1;  4CCM A;  3LIG A;  3RYK A;  1JH5 A;  4AK3 A;  1US2 A;  1W0O A;  1XU2 A;  3F95 A;  3MDP A;  2BGP A;  4JZR A;  3ZN4 A;  5FZ6 A;  1H2N A;  3INA A;  1UW8 A;  3KCC A;  5BUV A;  3VBH C;  2H0V A;  2A3W A;  1JZ8 A;  3O1M A;  1PMH X;  1PZ8 A;  1PO2 3;  1PX3 A;  3ZMO A;  4P02 B;  4RQP A;  4BQ4 A;  4HKO A;  5CFC A;  2YBP A;  3QAC A;  4ASK A;  1BMV 2;  3IM0 A;  1QJZ A;  1BEV 2;  3RMX A;  1FXZ A;  2ET7 A;  1OPO A;  2Y0I A;  1VRH 1;  1WKY A;  4MAD A;  5BPX A;  2VR4 A;  2ADE A;  1COV 1;  1HJG A;  2DTW A;  4FP2 A;  5APA A;  4LBQ B;  4YWA A;  4FTS A;  2QQM A;  1V6M A;  4ONU A;  3HQX A;  5EWS A;  1QOT A;  4AI8 A;  3I2D A;  3MUZ 1;  4AF9 A;  1H2M A;  3FLP A;  5FZ4 A;  2E6V A;  3RGB A;  4AFC A;  3OG2 A;  5ABJ A;  5CA6 A;  5FK7 A;  2W39 A;  5C7G A;  1O91 A;  5FZE A;  1UIJ A;  2YUE A;  5HV4 A;  2D93 A;  2YHJ A;  3HWJ A;  4Q8L A;  1VBB 3;  2PFW A;  3KV9 A;  4D6S A;  3POS A;  2HEV F;  4GKX A;  2F4L A;  2H6C A;  5FYS A;  1OI6 A;  5FQ0 B;  2R06 2;  1RUI 2;  4Q4V 3;  3MIE A;  5JCT A;  1KRI A;  1HQW A;  5IVC A;  4PIX A;  1FX5 A;  5E6H A;  3PVN A;  5GLW A;  4N90 A;  3TAY A;  1W9F A;  3WW3 A;  1OQD A;  1LNS A;  1ZVF A;  2VJX A;  1XYN A;  1S55 A;  4IET A;  3VZM A;  3ZSK A;  4B7K A;  1CES A;  2J1T A;  2YMZ A;  2X10 A;  4FSJ A;  3CNA A;  3SH5 A;  3PIJ A;  4FOW A;  4LOR A;  2WO7 A;  1NZI A;  4OHV A;  5FPB A;  4CDU A;  4GIQ A;  2B9V A;  2A5Z A;  2XBO 2;  2P3I A;  1RUG 2;  1OD5 A;  4ZU4 A;  1IHM A;  5A1F A;  2CAV A;  2WII B;  2WR9 A;  3MLJ A;  1TE1 B;  2F4P A;  5BNQ A;  1W39 A;  3ILN A;  2KD7 A;  1X9T A;  5HCB A;  2E33 A;  1U0A A;  3TNP B;  3ZSM A;  5FXV A;  2BQP A;  1DHK B;  2Y6L A;  3JXS A;  2WBK A;  2JE9 A;  4BOW A;  1VRH 3;  2XJT A;  3GZT B;  1KQR A;  2VZQ A;  4LTA A;  4FQ4 A;  5I93 A;  4CCJ A;  1N3O A;  4OI4 A;  3AXE A;  5FZK A;  1RJ8 A;  1GWM A;  2W52 A;  5JAX A;  3EYP A;  2VD7 A;  3NST A;  1AL2 2;  4YW7 A;  3OGS A;  1TME 2;  4RN5 A;  5FV3 A;  4KNC A;  4AVA A;  2MHF A;  4WV8 A;  4A7K A;  1NXM A;  3WDT A;  1EAH 2;  2C9K A;  4N53 B;  4QKN A;  3BU0 A;  2VZS A;  3FC0 A;  1F4A A;  1F31 A;  3C8X A;  3CIH A;  4A42 A;  4NE9 A;  2RVA A;  1XNA A;  2XUE A;  5JZG A;  4RGK A;  1CVN A;  1RED A;  3I49 A;  1SLC A;  5CFD B;  4GJZ A;  1QNW A;  1V0A A;  1KFX L;  3RSJ A;  3NO8 A;  3VDD A;  4W8J A;  2CYF A;  3GBF A;  1CAU A;  2YXS A;  2ZX3 A;  1LB2 A;  5K0U A;  3N7M A;  1U5Z A;  4K7J A;  2P2K A;  4LIT A;  1RUJ 1;  3MPB A;  1VR3 A;  2BOJ A;  4L8Q A;  2LW8 A;  3MBW A;  1OFN A;  1O7F A;  2VC9 A;  2CDO A;  2RDQ A;  1RJ7 A;  3AK0 A;  3ZPY A;  4E9K A;  5JIU A;  2BW8 A;  1QF3 A;  2FCT A;  3WSO A;  4F8A A;  5JOW A;  3KV5 A;  5H9S A;  3W21 A;  2DF7 A;  3V0A B;  3ZN6 B;  1JXN A;  3A22 A;  3U10 A;  1FOD 1;  3JB4 C;  4QHB A;  2FZ2 A;  3RS6 A;  2ZGQ A;  1Z78 A;  4Y3O A;  2D97 A;  2PXJ A;  1DGW A;  4UYB A;  4TLF A;  5EYX A;  3E6C C;  2VUD A;  4RGA A;  3V65 A;  3HQU A;  4HOO A;  3RI9 A;  1S0B A;  5KHI A;  2YGM A;  3TOJ A;  2VXJ A;  1C3H A;  1ZZ6 A;  5FBZ A;  2WZE A;  4N9I A;  4JKM A;  1SBE A;  4QX2 A;  4GWJ A;  1HX6 A;  2BJS A;  2VVF A;  2R30 A;  2VOK A;  3MW4 A;  4KGG A;  2Y6G A;  5E8A A;  3RZZ A;  1ULE A;  3DCQ A;  4RS5 B;  3AFK A;  1AR8 1;  5I0R A;  2CWS A;  4ARX A;  2HWC 1;  2WLQ A;  1OC1 A;  1GNY A;  3LPG A;  3WVJ A;  1D7P M;  2WA3 A;  4A3Z A;  1FMD 1;  4AVT A;  2XVK A;  1H9W A;  1BCX A;  4JTN A;  2WNO A;  4JDO A;  5DAW A;  4N43 C;  2SBA A;  1OLM A;  1VBC 2;  5A3T A;  1BHG A;  1JMU B;  5IVF A;  1QIQ A;  1Z0H A;  3I3D A;  1H2K A;  4QX5 A;  4BIF A;  1EPZ A;  1MS4 A;  2XLG A;  1VB4 A;  4J1X A;  4KWK A;  3HQR A;  5FYY A;  1OLM E;  4HVO A;  3T0B A;  5LAS A;  5HCF A;  4MET A;  4P9L A;  1R1A 1;  4YRD A;  1UYX A;  4FPL A;  2WFF 2;  4HZF A;  1AX0 A;  3SIS A;  4BYY A;  3U0Z A;  5DG1 A;  4YVW C;  2JKX A;  5F2S A;  4HK8 A;  4ZXK A;  5FKC A;  4Y4R A;  1UOF A;  2GP3 A;  4CP9 B;  5ACA 1;  3GBG A;  2RJK A;  3ZFF C;  2HYK A;  4PDW A;  3FHQ A;  4D6R A;  4XDP A;  4BE3 A;  1FOD 3;  1ZYB A;  3WW2 A;  1YI7 A;  5CNA A;  3BU7 A;  5A1A A;  3VBR C;  1ZRD A;  3JBG 2;  2O1Q A;  4DPN A;  4F83 A;  2OQ7 A;  5FO9 B;  2HBU A;  5JOZ A;  3WNK A;  1OOP B;  4CEY B;  4P08 A;  1SLT A;  2ZHL A;  2ILM A;  4YVS A;  4FTB A;  1V6K A;  1H1I A;  2D6O X;  1VBE 1;  5ABJ C;  4PF1 A;  3ZSE A;  1WMD A;  1YC6 1;  3RVH A;  3WNO A;  4QQO A;  4KH9 A;  5K9Y A;  2WWJ A;  4ZPI A;  1PMJ X;  2GN7 A;  2KM2 A;  2LUW A;  4BM8 A;  1FMD 3;  2VOX A;  4HSJ A;  3NNJ A;  3PHM A;  4I0B A;  4OVE A;  4NPL A;  2JE7 A;  4QX1 A;  4ZS2 A;  1D4M 1;  1IQD C;  2WNU C;  5FTT C;  5FZG A;  5J48 A;  2GC1 A;  4FOY A;  1V00 A;  1S1A A;  3QCW A;  4M0H A;  1POV 0;  5KC5 A;  2BGO A;  3AYE A;  2CSG A;  3WF0 A;  5FUI A;  4CDU C;  2Z2S B;  3I2I A;  1R1A 3;  1W99 A;  3EO6 A;  1JU3 A;  1YIP A;  4YZ4 A;  1NCQ A;  3GZE A;  3MW3 A;  3VBF A;  2R04 1;  4J25 A;  2R0F A;  4U2A A;  1YQ2 A;  1T6G C;  3WG1 A;  5ACA 3;  3T0D A;  1RHI 3;  2YY1 A;  5E89 A;  1UXX X;  2A71 A;  3ZSJ A;  5FPA A;  4E2G A;  2DFB A;  3PVB B;  4GMP 1;  5IAV A;  1AXY A;  5C33 A;  1HW5 A;  1QQP 3;  1UOJ A;  2Y33 A;  1OBN A;  1ZA4 A;  1N1T A;  3IDA A;  4BK5 A;  1GKB A;  1DLC A;  3C7F A;  4U36 A;  4OHZ A;  5I8T A;  2G1M A;  1HV1 A;  3TEW A;  3Q8C A;  1G9A A;  1YRZ A;  1VBE 3;  4KU7 A;  4BLJ A;  3J8F 3;  1QY4 A;  3WCS A;  4MVT A;  2OZ6 A;  3TEZ A;  1QXR A;  1VBD 2;  4FXG B;  4D6Q A;  3K4Z A;  2FMD A;  2A75 A;  4LHK A;  1R08 1;  4QQH A;  3BOD A;  1C28 A;  4WVW A;  1YO8 A;  3ZDS A;  2AGS A;  1I5P A;  3VZN A;  2YC4 A;  2O0O A;  1C5I A;  4NJ4 A;  3T0A A;  3NV3 A;  1NA1 C;  3SLI A;  5JDB A;  2UWA A;  4AED A;  1C57 A;  2A6Y A;  4XUQ A;  4CCK A;  2XON A;  3VHN A;  2WT2 A;  5FZL A;  3I2G A;  2WL1 A;  4RSU A;  1E57 A;  1B35 A;  4NII A;  2R7E B;  1QJX 1;  1OA3 A;  5CVR A;  3T4V A;  2FDI A;  5J09 A;  1UOG A;  1HQN A;  4LE4 A;  2RE9 A;  3RPQ A;  3FHA A;  5JSO A;  1AYM 3;  3VDD C;  4ATE A;  4LBM A;  3AZV A;  2B9U A;  2WNE A;  2Y0O A;  3SEE A;  3WP6 A;  5K0U C;  1MS0 A;  3K4A A;  2WZR 1;  2XJS A;  3HPN A;  2QQK A;  2WN2 A;  4EN7 B;  2XJU A;  3WY6 A;  3O1S A;  3C7G A;  2EXH A;  2NZ9 A;  4WVV A;  2O14 A;  3AXD A;  4CEW A;  2OX0 A;  1SMV A;  2VNV A;  1KDK A;  4GMP 3;  5CU1 A;  2YBK A;  2R32 A;  3I3E A;  4QPI A;  2F17 A;  4C1W A;  1QEX A;  2PAE A;  4XF9 A;  3JU9 A;  3WXP A;  1QDO A;  4PHZ A;  4LBL A;  1LUL A;  4AZZ A;  4BXF A;  5A7Q A;  1WCK A;  4LMF A;  3POB A;  3MI8 A;  4Y22 B;  2QDR A;  2W94 A;  1DU3 D;  1O5L A;  2QQP A;  2RS5 1;  5BNP B;  1NOV A;  3OGV A;  4COU A;  3AP6 A;  3CLP A;  1UMZ A;  3DPR A;  3VKM A;  4FAG A;  3SH4 A;  1KIT A;  4FBF A;  4HXC A;  5DQ0 A;  2X53 S;  3WDW A;  5C4W C;  5KXB A;  2WYS A;  2DCY A;  1GLH A;  1W2A X;  1R08 3;  2ZHK A;  1PMI A;  5FUN A;  2XL7 A;  1PM4 A;  2Q1M A;  4JGY B;  4N7U A;  3OEA A;  1IS4 A;  1L7Q A;  2J22 A;  4CDX A;  4AGG A;  5DAX A;  4WM8 B;  4Y24 A;  1PZ9 A;  4HKW A;  4IGQ A;  1UXZ A;  3OPT A;  3NRU A;  3UNP A;  2ARA A;  2F6B A;  4MGK E;  5FZM A;  5DPN A;  4FOQ A;  3LAG A;  1QJX 3;  3IN9 A;  1EUU A;  5L19 A;  5KXC A;  2ZGP A;  4LO6 B;  2PHR A;  3FJS A;  2QZ3 A;  1NQJ A;  3MEP A;  5FZ1 A;  4YPJ A;  1SFP A;  5BNN A;  1NCR B;  2PAM A;  5LK7 B;  4P9G A;  3H9A A;  5G04 L;  2W3J A;  5HI0 A;  1W2T A;  3LWC A;  4CUC A;  1JZ4 A;  4AGR A;  2WZR 3;  4RHV 2;  2XJR A;  1AR9 3;  2X5I A;  1AR7 1;  3CZU A;  3LE0 A;  3LQC A;  4IEW A;  5FZF A;  1OA2 A;  3LA3 A;  3SHR A;  2PEL A;  2RMU 2;  1W8N A;  1I9R A;  4WZF A;  3USS A;  3A0N A;  5LBE A;  3ZO0 B;  1C8M 1;  2VQU A;  4QX3 A;  3DYM A;  4GH4 A;  4FPO B;  1S2E A;  1G8W A;  4Z8B A;  3S5Q A;  4EYU A;  1IKP A;  3FFQ A;  3N3H A;  4NMI A;  4IER A;  2DBN A;  3ACI A;  3B94 A;  4XTP A;  1ENR A;  4JGZ B;  4XF3 A;  1U5I A;  4QDS A;  2HWD 2;  1OUX A;  4XXP A;  5A80 A;  3T30 A;  3ZLI A;  4IGP A;  2RS5 3;  1LU1 A;  4QXH A;  4S2G A;  2Q8C A;  4YZ5 A;  4KQ7 A;  1CAW A;  1XNT A;  2WAA A;  3WNM A;  5A1L A;  1I5Z A;  1E5H A;  4FFI A;  3FLT A;  1W8F A;  1QOO A;  3K2O A;  1TQ5 A;  4YVS C;  1ZBE 1;  3ME2 A;  2E53 A;  3OY8 A;  2L9L A;  5ERL A;  1NUK A;  2IUW A;  1K3I A;  2VMD A;  2XML A;  3QOP A;  4FO9 A;  4PLN A;  3ZXG A;  2OZJ A;  2X09 A;  2EIB A;  1H1M A;  2ZEZ A;  1RUE 2;  1FPN 3;  1WW6 A;  2Y26 A;  3T08 A;  2WQ4 A;  2XG3 A;  5A3P A;  3RDI A;  3H50 A;  3NAP C;  4QT6 A;  3ST7 A;  2CGO A;  3WQ7 A;  2OKX A;  4XFI A;  3WW4 A;  3AMH A;  2CL2 A;  3LA7 A;  1RHI 2;  1OQ1 A;  4DY3 A;  2J1R A;  2VXR A;  4UFJ A;  4B4Q A;  2V73 A;  3GM8 A;  4MXV A;  3WG3 A;  3B69 A;  1QQP 2;  1U12 A;  1VP6 A;  4QDR A;  2VZR A;  2JG8 A;  1AR7 3;  1UO9 A;  2ZAC A;  4OCT A;  4YW4 A;  2PHD A;  2BFU L;  5DZG A;  1W9T A;  5EJ3 A;  3NJV A;  4Q4W 3;  1W06 A;  3J8F 2;  2GU9 A;  1MZ6 A;  1DP0 A;  3IB3 A;  3ZFG C;  5L7O B;  3UES A;  3RZJ A;  3RFR A;  3E5Q A;  1JU4 A;  5A32 A;  4AXO A;  1UQX A;  1LGN A;  5DAQ A;  2AR6 A;  1IPJ A;  3H1W A;  3OEB A;  5JMC A;  4P9W A;  1FV2 A;  1W6M A;  5F3G A;  2PQQ A;  2D6M A;  4R4X A;  2JWP A;  5K8S A;  3POJ A;  1HQL A;  4A6S A;  4AAX A;  4AHZ A;  3MLK A;  3CJI B;  3ES1 A;  1SBD A;  3LDR A;  1I3H A;  1YHF A;  4QM8 A;  3LFI A;  3WUD A;  2ARB A;  4C1X A;  1O3S A;  1ZBE 3;  2QZ2 A;  4AI0 A;  5A3N A;  3G6J B;  2YC2 A;  3D6E A;  5JPM B;  1YQ8 A;  1S0D A;  3VBH A;  4QQP A;  1N3P A;  4FXK B;  1AYM 2;  1XQN A;  4M3C A;  3T2P A;  1PIV 3;  5FYV A;  4Q4X 1;  1UU4 A;  5CYY A;  2VCA A;  4L0P A;  5FYB A;  3EBR A;  1VIW B;  1W9W A;  3ILR A;  3WQB A;  1OKQ A;  4G9S B;  3N9Q A;  4QGM A;  5A3M A;  1JZ5 A;  4OI0 A;  4M3C E;  1QNY A;  1VAM A;  4FPG A;  1A78 A;  1QHD A;  2LM3 A;  4QDQ A;  3ZFE C;  4HLT A;  1KS4 A;  1BVP 1;  4XFB A;  1B35 C;  4CXY A;  1JBC A;  2KR2 A;  4LLF A;  5A7N A;  1D2Q A;  2D5F A;  3WZ1 A;  3TRS B;  4BK4 A;  4D94 A;  4TYS A;  4IE7 A;  4HG6 B;  5ANQ A;  4Q2F A;  1BZW A;  2Y64 A;  4LHL A;  2IWG B;  3MYX A;  2SLI A;  1GV9 A;  1NT0 A;  5FFO C;  2VZV A;  1H8T C;  5FZ3 A;  2WRA A;  1W05 A;  1NE4 A;  2RS3 3;  3IAQ A;  5FY9 A;  1SCR A;  1V9U 1;  1MZ5 A;  2C9A A;  3SCG A;  1QH6 A;  1Z7S 3;  4DXT A;  1GNH A;  4NIA A;  2JDN A;  4KWL A;  3LDB A;  3UJQ A;  3WV6 A;  2QCS B;  4WZC A;  5A7O A;  2HWF 1;  4DOU A;  5F9T A;  3Q8E A;  3GNE A;  3S57 A;  1W6P B;  4XTM A;  3BTA A;  5DXD A;  3RQ0 A;  1ZBA 3;  2WNV A;  1ND2 C;  2DVD A;  3HVD A;  4B29 A;  2G9Z A;  2D3R A;  5D8A B;  3FHI B;  3AJZ A;  1ND3 B;  1UY2 A;  2O8O A;  1QDC A;  3H7Y A;  4KI5 M;  4HN0 A;  1UNB A;  2VGD A;  4XMA A;  3UET A;  4UFK A;  2Q8O A;  2VCM A;  1MEC 2;  1JYN A;  5A7W B;  5CBL A;  1FNY A;  4Q4X 3;  5FQ0 A;  1GSL A;  2A6W A;  2WZP P;  2MPF A;  2QQL A;  2ZX1 A;  3KWV A;  1AR9 2;  2WQZ C;  3WDY A;  2UYA A;  2VUC A;  4CDX C;  2I74 A;  2CDP A;  4E4S A;  1AR6 3;  1YFX A;  3VHO A;  1JN2 P;  2EID A;  5FLJ A;  4P00 B;  3OGG A;  2IZW A;  4NIH A;  2FQP A;  1YIF A;  2IFR A;  3ZKY A;  1CPN A;  5FY1 A;  3W58 A;  3LEM A;  3R0R A;  4IV3 C;  2VW2 A;  4HT1 T;  4LUM A;  4AVV A;  2BVV A;  4R9B A;  4FFG A;  1SLI A;  1W04 A;  5FZH A;  1G6N A;  4JDN A;  3OUJ A;  2X05 A;  2P6C A;  2WT0 A;  5BNN C;  3NMB A;  3III A;  1URX A;  3KV4 A;  1EUT A;  2AZ5 A;  2BBA A;  4HN1 A;  2JDM A;  1O5U A;  4UW5 A;  1XSR A;  3V56 A;  4BQX A;  4D7S A;  5J7M A;  3VBO B;  2G9G A;  2P3K A;  4CXW A;  2X5I C;  4NO4 A;  4CSW A;  5C8C B;  2VCC A;  3W59 A;  1S0E A;  4C90 A;  5C9A C;  1V9U 3;  4AHY A;  3B9C A;  5LEK A;  1J59 A;  4DRR A;  1LEN A;  5HV0 A;  5FZ7 A;  1SFN A;  2D40 A;  4UFI A;  3E5X A;  2UWB A;  4CP0 A;  1FPN 2;  1XE8 A;  3WUC A;  1GQG A;  2E32 A;  1RUH 1;  3I2F A;  2NLR A;  1U5X A;  4AGV A;  1R64 A;  1SPP B;  3JD7 1;  1HXS 1;  1GQH A;  1OH3 A;  4FFF A;  1NE6 A;  4PIY A;  3VHP A;  2VU9 A;  5FZ8 A;  3B7M A;  1GZT A;  4CCE A;  4TZD A;  1J1L A;  3ON7 A;  3P6B A;  3N7K A;  1KJL A;  4H2A A;  2JIJ A;  4EN0 A;  5KXD A;  5GZE A;  4NRO A;  1QXJ A;  2W1U A;  2RJL A;  4YNI A;  3GYD A;  1DQ2 A;  2YB7 A;  1IGO A;  4Q4W 2;  4C0B A;  5FP7 A;  4ZY9 A;  4X8N A;  2V5D A;  3OYW B;  3M3C A;  1ZZ9 A;  1WD3 A;  3UYJ A;  4BH9 A;  1UKG A;  2IC1 A;  1SAC A;  3J7N A;  5CFD A;  2GN3 A;  4HON A;  5C5U A;  3AP7 A;  5JXJ A;  4AWD A;  2I45 A;  1P8J A;  2ZML A;  2VQ0 A;  2ORX A;  5DN2 A;  3SNM A;  4CDQ B;  5KR7 A;  2DUO A;  3RRD A;  3MLL A;  2XHN A;  5GJ6 A;  3V0B B;  4I3P A;  3K3O A;  4LKS A;  4QX0 A;  3S6P A;  1V70 A;  2EIE A;  4XJ8 A;  3EXU A;  1PGW 2;  4KBB A;  4MGQ A;  4DY5 A;  4HBN A;  4RR3 C;  3AB0 A;  2R49 A;  2C26 A;  5FWJ A;  3IPV A;  3ZYF A;  4BWO A;  1UU6 A;  3LPF A;  5FBJ A;  1ZRE A;  3GHM A;  1ZZ8 A;  3M3I A;  3B5L B;  1W8W A;  1RUC 2;  2E9Q A;  1FAY A;  3V0A A;  3B3Q E;  1BJQ A;  1PIV 2;  2OPK A;  2CNA A;  4LKE A;  1NLQ A;  2YYO A;  4N43 A;  4YM2 A;  4BJ0 A;  1L7L A;  2NYY A;  1W3X A;  2ES3 A;  5LBF A;  1JW6 A;  4LUL A;  4Q1R A;  3D4K A;  3N7J A;  4QD2 A;  4BQ3 A;  5JR7 B;  2FD8 A;  1HXS 3;  1MQT C;  3NJX A;  4WM7 B;  3WW1 A;  1ZRI A;  1PGS A;  1HRI 1;  2NM1 A;  2DU0 A;  3AKT A;  3PU8 A;  2Y34 A;  2W1W A;  3C7E A;  4XAC A;  5DMY A;  2UY8 A;  4DUV A;  4COW A;  4B7E A;  1C1L A;  2Q8D A;  3K75 B;  1W6N A;  2G4I A;  3FE5 A;  3KCY A;  5DUU A;  2WSV A;  3SXW A;  3I2H A;  4YVW A;  3Q9O A;  2ZKL A;  1DGR A;  1WLC A;  5DDJ 2; 
#chains in the Genus database with same CATH homology
 3LPG A;  1D7P M;  2VTF A;  2W46 A;  4A3Z A;  3F2Z A;  4XUP A;  1HN1 A;  5LA0 A;  2W5F A;  5F7U A;  2HYX A;  3DYP A;  3CKH A;  2XOM A;  1BHG A;  5LCW L;  2E31 A;  3I3D A;  5B4N A;  3ACF A;  2WN3 A;  2ZEX A;  3VD7 A;  3T0B A;  1OF3 A;  1UYX A;  2VO5 A;  2VZU A;  4XZU G;  3VD5 A;  1JYV A;  2JKX A;  3MUY 1;  1H6Y A;  4A44 A;  4ZZ8 A;  4JKL A;  3W5N A;  3FHQ A;  1UY4 A;  4Z2A A;  2EIC A;  4KMQ A;  2JE8 A;  5J1X A;  2W47 A;  3VD9 A;  5A1A A;  4DUX A;  4P5Y A;  3WNK A;  3FN9 A;  4P08 A;  4DXR A;  4A6O A;  1JHJ A;  4PF1 A;  3WNN A;  3WNO A;  2RJ2 A;  1WCQ A;  2XQX A;  1GMM A;  5G05 L;  3HNM A;  1PMJ X;  2VCB A;  2VZP A;  4QAW A;  3IAP A;  3SEP A;  1H6X A;  1UY1 A;  3J7H A;  4QX1 A;  3ZM8 A;  2W87 A;  1IQD C;  5EJ1 B;  2BGO A;  2V4V A;  3WF0 A;  5FUI A;  1GUI A;  3CMG A;  3VDB A;  2W1Q A;  3I2I A;  1W99 A;  1JU3 A;  3VDC A;  1JZ6 A;  1W8O A;  4JX0 A;  1YQ2 A;  4D8M A;  4KWU A;  3T0D A;  4LPL A;  4A41 A;  1UXX X;  2BER A;  3DEC A;  4BK5 A;  3IDA A;  1CIY A;  1DLC A;  3C7F A;  2DDU A;  2W1S A;  1CZS A;  4BXS V;  4QB6 A;  5C71 A;  3HEI A;  2QQJ A;  3AC0 A;  3K4Z A;  1XC6 A;  2DCJ A;  4OMC A;  2VZO A;  1I5P A;  2WUH A;  2YC4 A;  3THD A;  4ZZ5 A;  3T0A A;  3WF3 A;  4BDV B;  4XUQ A;  2XON A;  3WF2 A;  3I2G A;  2LS6 A;  3T2Q A;  2R7E B;  2VOT A;  2WQ8 A;  4GZ9 A;  3FHA A;  1W0N A;  2Z4F A;  2VZ3 A;  3SEE A;  1CZV A;  3I2K A;  3K4A A;  3PUH A;  3HPN A;  2QQK A;  2WN2 A;  3WNL A;  3K46 A;  3C7G A;  4MGS A;  4MOA A;  1UYZ A;  1NKG A;  2W91 A;  3P1I A;  4CU7 A;  5JXH A;  1NAE A;  3I3E A;  1F4H A;  2VMC A;  4DXT A;  1OH4 A;  4M4R A;  2VZT A;  2ZEW A;  5IHR A;  2W94 A;  5C70 A;  1UYY A;  1ULP A;  3OGV A;  1O8S A;  5DQ0 A;  5EIY B;  1GOF A;  2WYS A;  3I97 A;  3OEA A;  1L7Q A;  2J22 A;  2W92 A;  2ZEY A;  4W50 A;  3WF4 A;  1UXZ A;  1J83 A;  4JKK A;  3NRU A;  3UNP A;  2PQS A;  1XPW A;  4CUB A;  5DPN A;  3C7O A;  5JR2 A;  1OD3 A;  1EUU A;  4D0Q A;  4CVU A;  5HXM A;  1JYX A;  4YPJ A;  4OYU A;  4XUR A;  1UWW A;  2VL4 A;  5G04 L;  2W3J A;  3HOB A;  4CUC A;  1JZ4 A;  2WDB A;  3CZU A;  3LQC A;  3LE0 A;  5EJZ B;  3ETP A;  1W9S A;  1W8N A;  2E26 A;  2J1A A;  4XUO A;  2VQU A;  4QX3 A;  2DCK A;  3DYM A;  3U37 A;  3ACI A;  3HJR A;  4RYD A;  3MV1 1;  4QDS A;  3MV0 1;  4TXW A;  4E8D A;  3OB8 A;  1XNT A;  3DYO A;  2WAA A;  3WNM A;  2YG0 A;  4PT6 A;  3OBA A;  1UY3 A;  1DYO A;  2L9L A;  4A4A A;  1NUK A;  1K3I A;  2VMD A;  2RV9 A;  2X09 A;  2EIB A;  3ACG A;  3THC A;  2ZEZ A;  5HPO A;  1UX7 A;  5JXG A;  2WO2 A;  3T08 A;  4XUN A;  4XUT A;  5JXI A;  3ABZ A;  4GWI A;  4UI9 L;  2OKX A;  3WNP A;  1GQP A;  3HNB M;  1SDD B;  1ULO A;  1JZ7 A;  2J1R A;  1NX9 A;  2JD9 A;  3GM8 A;  2VM9 A;  4MO3 M;  1JI6 A;  3K77 A;  4JHZ A;  1J84 A;  2VZR A;  4QDR A;  4CU9 A;  1UZ0 A;  4CUA A;  2WAB A;  3I2J A;  3BGA A;  1OT5 A;  2J1S A;  3WF1 A;  1PX4 A;  5IFT A;  1W9T A;  4PQQ A;  3NJV A;  3ACH A;  1DP0 A;  3IB3 A;  2YFZ A;  2WZ8 A;  3UES A;  3T2O A;  3FL7 A;  1JU4 A;  3SKV A;  3OEB A;  1SHW B;  4ET7 A;  4OUE A;  3I3B A;  5JUV A;  3W5M A;  2VME A;  3GXU A;  2QBX A;  4AAX A;  3HN3 A;  3NNG A;  3GGL A;  1OF4 A;  1KGY A;  2J1E A;  3HNY M;  3EB7 A;  2YC2 A;  4DEV A;  3T2P A;  3A23 A;  3GDB A;  3VD4 A;  5CYY A;  2VCA A;  4L0P A;  4QPW A;  1JYW A;  1W9W A;  2BZD A;  3A21 A;  3WQB A;  5IJR A;  1JZ5 A;  4ARY A;  2ORZ A;  3LEG A;  4QDQ A;  2W9X A;  2W95 A;  3C7H A;  1GOG A;  2WAO A;  2Y6K A;  3LEK A;  4BJ0 A;  4BK4 A;  3BN6 A;  1US2 A;  3VDA A;  2BGP A;  3E1F 1;  4HG6 B;  2Y64 A;  2YFU A;  1JZ8 A;  1PMH X;  2VZV A;  1PX3 A;  4LQR A;  4P02 B;  2Y6H A;  3IAQ A;  2WO1 A;  3VD3 A;  4DEQ A;  2VQT A;  1WKY A;  4MAD A;  3WEZ A;  4LHS A;  2VR4 A;  3T09 A;  4IUG A;  2QQM A;  1MPX A;  1US3 A;  2B4K A;  2ZXQ A;  3CDZ B;  3MUZ 1;  1JZ3 A;  3NQH A;  4A45 A;  4CU6 A;  1K12 A;  3OG2 A;  5C7G A;  1UY2 A;  4KI5 M;  3UET A;  5LA1 A;  2J7M A;  1JYN A;  2J1V A;  4QB1 A;  1UMI A;  2QQL A;  3PUI A;  3SKJ E;  2QQN A;  2CDP A;  4ZXE A;  4W4Z A;  1O8P A;  1JZ2 A;  1LNS A;  2EID A;  2VJX A;  4P00 B;  1KEX A;  2J1T A;  4UAP A;  2X10 A;  4OMD A;  2X05 A;  2V72 A;  2B9V A;  5LA2 A;  4AG4 A;  3III A;  1EUT A;  2BBA A;  1K42 A;  1L7R A;  1UMH A;  1GU3 A;  2KD7 A;  2E33 A;  2VCC A;  4M4P A;  2Y6L A;  3JXS A;  2WBK A;  2VZQ A;  5CZK A;  1UY0 A;  2E32 A;  4DUW A;  3I2F A;  1R64 A;  3CQO A;  3EYP A;  3OGS A;  4RN5 A;  3P6B A;  5IYY A;  1O59 A;  2C9K A;  1CX1 A;  2W1U A;  2VZS A;  3D3A A;  2YB7 A;  1F4A A;  3C8X A;  2Y8K A;  3CIH A;  2Y6J A;  4ZY9 A;  5JMO A;  2V5D A;  5IFP A;  1CZT A;  1GOH A;  4A42 A;  4QB2 A;  1TVG A;  2RVA A;  1XNA A;  3CZJ A;  5JXJ A;  1K45 A;  5DN2 A;  1P8J A;  2ORX A;  4UOJ A;  3OGR A;  4W8J A;  2XHN A;  5B4X A;  2J1U A;  4LKS A;  4QX0 A;  2EIE A;  2JDA A;  4MGQ A;  2QQI A;  1T2X A;  2C26 A;  2ID4 A;  2LW8 A;  3LPF A;  3MBW A;  2VC9 A;  2CDO A;  5I0D A;  3WSO A;  4DXS A;  2VMF A;  3MO4 A;  1RYY A;  3A22 A;  3A7Q A;  3K4D A;  2VZ1 A;  4TTG A;  4CU8 A;  3NJX A;  2QQO A;  4OZO A;  1TG7 A;  2C4X A;  2WO3 A;  3C7E A;  2W1W A;  4FI9 A;  4E8C A;  5DMY A;  4DUV A;  2WZE A;  3K75 B;  4JKM A;  4QX2 A;  2HLE A;  4GWJ A;  3ECQ A;  3LEI A;  2Y6G A;  3I2H A;  4XVH A;  1SG3 A;  4ARX A;  1GNY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...