1OH4A

Structural and thermodynamic dissection of specific mannan recognition by a carbohydrate-binding module
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
174
structure length
174
Chain Sequence
ARYVLAEEVDFSSPEEVKNWWNSGTWQAEFGSPDIEWNGEVGNGALQLNVKLPGKSDWEEVRVARKFERLSECEILEYDIYIPNVEGLKGRLRPYAVLNPGWVKIGLDMNNANVESAEIITFGGKEYRRFHVRIEFDRTAGVKELHIGVVGDHLRYDGPIFIDNVRLYKRTGGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Thermodynamic Dissection of Specific Mannan Recognition by a Carbohydrate Binding Module, Tmcbm27
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
molecule keywords BETA-MANNOSIDASE
total genus 38
structure length 174
sequence length 174
ec nomenclature
pdb deposition date 2003-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09212 CBM27 Carbohydrate binding module 27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 1oh4A00
3UETA 2BGOA 3T0BA 2J1EA 3K4ZA 5F7UA 1KEXA 1CX1A 4PQQA 3FN9A 3WSOA 3PUIA 2WQ8A 2Y6GA 5DMYA 2JE8A 3C7HA 3K75B 2QQNA 2W1WA 4L0PA 2BERA 4CU6A 4YPJA 5LA1A 2VZTA 1OT5A 1GOHA 1JU4A 3EYPA 1W9WA 4OMCA 2VC9A 4CU7A 3WNNA 2WZEA 2DDUA 2VZPA 3NNGA 3I97A 3VD3A 3ACIA 4QDRA 1DLCA 3VD9A 3AC0A 2RJ2A 1UYXA 2WUHA 4OZOA 3WF0A 3CMGA 4QPWA 4XURA 3DYPA 3OGVA 2B9VA 1UXZA 3T08A 1UZ0A 4ZZ8A 4D0QA 4DUWA 2J1AA 3A21A 4P5YA 3T0DA 1UWWA 1WCQA 5HXMA 4E8DA 4QDSA 1JZ3A 4XVHA 3I2HA 4XUOA 1YQ2A 4M4PA 1UMIA 4LQRA 3WNKA 1JHJA 4W4ZA 1PMJX 4KMQA 5IFPA 3MO4A 3J7HA 5DN2A 5JXIA 3T2OA 1ULPA 4BK4A 3K4AA 2WBKA 2VZRA 4ZZ5A 3WF3A 4QAWA 3LPGA 2VCCA 2VTFA 2QQLA 2W47A 4TXWA 3C8XA 2X10A 3HEIA 4LPLA 2VL4A 3VDBA 2VMFA 3IAPA 3OG2A 1GOFA 1T2XA 2YFZA 1K42A 2V72A 4E8CA 1H6XA 1NX9A 1H6YA 4ARXA 2J1UA 2E32A 2EIBA 4A45A 2J1RA 3WNPA 2ORZA 2LW8A 2XHNA 5IYYA 4QX2A 1JZ8A 2QQOA 4HG6B 3HJRA 3CZUA 1WKYA 3LQCA 2W91A 4DEQA 3WNLA 2RV9A 3A22A 4UOJA 4MGQA 1UY2A 3LPFA 4ZXEA 2W3JA 2VMCA 3HN3A 1O8PA 3CDZB 2QQMA 2YB7A 4JHZA 3K77A 1K45A 2WN2A 2ZEZA 4UAPA 5B4XA 2B4KA 2VZSA 3W5NA 1I5PA 2VOTA 1CZTA 1DP0A 4A3ZA 4A44A 2W46A 1OH4A 2W1UA 2JDAA 2Y6JA 3MV01 2VMEA 1US3A 2C26A 1L7RA 2X09A 3NRUA 5EJZB 5FUIA 1OD3A 2VQUA 1K3IA 1UY1A 1OF4A 2VM9A 2VCAA 1XPWA 4Z2AA 2CDOA 2VR4A 2YFUA 2W87A 3I3BA 4ZY9A 4MOAA 2QQIA 2KD7A 3I3DA 2JD9A 3WNOA 1UY0A 3SKJE 3SEEA 3NJVA 1DYOA 2C9KA 2Y6KA 1JYNA 2W95A 3UNPA 4JKMA 1JYWA 2WN3A 2WDBA 4JX0A 5G04L 3CKHA 4XUQA 3NQHA 3DYOA 1UX7A 1UYYA 3I2GA 4ARYA 4BDVB 3CIHA 5JUVA 2R7EB 2XQXA 5IFTA 3THCA 4CUCA 3C7GA 3EB7A 3ACHA 1EUTA 5C7GA 3FL7A 2Y64A 5JMOA 4A42A 4CVUA 3C7OA 2VZQA 3A23A 5JXGA 3JXSA 2J1SA 4GWIA 3CQOA 4KWUA 5CZKA 3DECA 2J1TA 2VZUA 2DCKA 4DEVA 3VDCA 2QBXA 3HNMA 4MGSA 1JZ4A 2PQSA 4DXRA 1SHWB 3MBWA 1UY3A 1W9SA 2DCJA 1D7PM 3I2JA 1GU3A 5I0DA 3UESA 1W9TA 2QQKA 3T2QA 4XUNA 2Y6LA 2QQJA 2W1QA 5LCWL 2XOMA 3F2ZA 1J84A 1P8JA 4P08A 2WO2A 4W8JA 5LA0A 2WZ8A 2WABA 5DPNA 3IAQA 2EIDA 4GZ9A 3I2FA 4QX0A 1GNYA 4BJ0A 3VDAA 4QX3A 2BBAA 5JXHA 2W9XA 1W8OA 1XNTA 3DYMA 3W5MA 2W1SA 5A1AA 2ORXA 3ZM8A 3C7EA 3GXUA 3MV11 1JZ7A 1NAEA 1SDDB 2V4VA 4A4AA 1GUIA 4IUGA 2YC2A 4MADA 2E33A 5IHRA 5LA2A 2WYSA 4XZUG 4CUBA 4KI5M 2C4XA 1CZSA 4XUPA 3OGSA 3LEKA 4MO3M 2VZVA 5DQ0A 4AG4A 1W99A 2LS6A 3VD4A 1JI6A 3ABZA 4AAXA 3CZJA 1HN1A 4RYDA 1W0NA 3I3EA 4PT6A 3VD5A 1JZ2A 2W5FA 1J83A 2WO1A 4ET7A 4XUTA 2VMDA 3OGRA 5JXJA 5IJRA 3SEPA 4P02B 4M4RA 1TG7A 3IB3A 3P6BA 3ECQA 1K12A 1PMHX 3HPNA 3WEZA 1US2A 3WF4A 2J1VA 4QB1A 4OYUA 5G05L 4DXSA 3LEIA 1NKGA 3GGLA 1JYXA 1PX4A 3OEBA 2HLEA 2ZEXA 1ULOA 5B4NA 2W94A 3MUZ1 3T0AA 1RYYA 3LEGA 4GWJA 1GOGA 3BGAA 1NUKA 2ZXQA 4OUEA 1UMHA 4QX1A 5J1XA 5EIYB 1GQPA 1OF3A 2L9LA 5EJ1B 1W8NA 3BN6A 3K46A 4DXTA 4DUVA 5C70A 2RVAA 3WF1A 3MUY1 2Y6HA 1IQDC 4W50A 1EUUA 4LHSA 3HNBM 1XC6A 4DUXA 1CIYA 2BZDA 2V5DA 3ETPA 3NJXA 1JZ5A 3GM8A 4OMDA 3SKVA 4UI9L 3P1IA 4A41A 4RN5A 3LE0A 4BK5A 4BXSV 1SG3A 4PF1A 1LNSA 3E1F1 2Y8KA 1R64A 1BHGA 2CDPA 3WF2A 4P00B 2VCBA 4CU9A 2ZEWA 2VZ1A 1JYVA 1O59A 3THDA 3U37A 4CUAA 2E31A 3T09A 2VO5A 2VJXA 2EICA 3GDBA 2WAAA 4CU8A 5CYYA 1L7QA 4D8MA 1CZVA 1PX3A 3C7FA 2YC4A 2BGPA 2JKXA 3T2PA 1KGYA 1O8SA 3OBAA 2YG0A 2X05A 2J7MA 3IIIA 1UYZA 1GMMA 4JKKA 4QDQA 1UY4A 3FHQA 2EIEA 2VZOA 1JZ6A 2WO3A 1F4HA 3OB8A 4A6OA 1TVGA 5JR2A 2J22A 3K4DA 4FI9A 2E26A 2OKXA 4JKLA 3OEAA 3VD7A 1XNAA 5HPOA 3A7QA 2W92A 3HNYM 4QB6A 1MPXA 3IDAA 3D3AA 2Z4FA 4TTGA 3I2KA 1F4AA 1UXXX 3WNMA 2VQTA 4QB2A 3PUHA 3FHAA 1JU3A 4LKSA 2ID4A 2XONA 3ACFA 3I2IA 2WAOA 3HOBA 2VZ3A 2ZEYA 2HYXA 5C71A 3ACGA 3WQBA
chains in the Genus database with same CATH superfamily
1CAXA 4B1MA 1VR3A 1D2QA 1YI9A 5EXOA 1A8MA 2X8KA 3V56A 2WZR2 2VBBA 1AHSA 1QQP2 3GCXA 4CCKA 2J1EA 2P6HA 1M06G 3IIAA 4AOCA 4B3NA 4FFHA 3FN9A 4RGGA 1N3OA 3PUIA 1Q56A 3MGUA 1ND3B 4OI1A 1FAYA 4YFZA 3BTYA 1LGBA 3C7HA 1SDWA 3BALA 1ND3C 1REEA 3K75B 4MUVA 4PIYA 1CR7A 4XQDA 4H2AA 4Y5SA 2K9ZA 1W90A 3WQ0A 5L9RA 1XXNA 2WNOA 4IV1B 3FBMA 4RGKA 4EN0A 3JU9A 3ZSLA 5DAPA 1EP0A 1G9FA 3WNNA 2YDEA 2G4IA 3NNGA 3RFRA 4IQPA 2ENRA 3VD3A 5JCTA 2YU2A 2BGCA 4JGYA 3VGIA 4K1ZA 4FCAA 2RJKA 4IE6A 1V9U2 2RJ2A 3AP4A 2Q8OA 4S2DA 4WV8A 5F2SA 4UFIA 5A7NA 3BIEA 4KNCA 4QPWA 4Q4W1 4XURA 3MZHA 5F5CA 1TME2 2D43A 4PDWA 1J58A 4JQRA 1UZ0A 2QKDA 3J4UH 2XUEA 3IDBB 4L2NA 4ZZ8A 3POEA 5ABJA 1IG0A 1FMD3 5FYYA 5EYXA 3AKSA 2XLAA 4CCDA 3LEMA 4RD7A 4HVQA 3I2HA 3UKVA 1YQ2A 3IM0A 2FMDA 4M4PA 1UMIA 4XYXA 1OQEA 4CDWC 2FDKA 1ZZ8A 3ZXDA 1VBD1 3HMYA 2YBSA 3WNKA 3VBUB 3TEZA 3VDBA 4W4ZA 1GZCA 4LBLA 5IFPA 3J7HA 2WNUB 1O6UA 4FTSA 2NN8A 1WD4A 1S0GA 5A7PA 1YC61 2VY0A 3WNXA 3W59A 5DZFA 2Q1ZB 3B5LB 2BFUL 3VKNA 2O1QA 5L36A 2OXBA 1BVVA 5A70A 5JMCA 3HQUA 4BLJA 3APBA 4NHLA 4MGYE 4M01A 1AYN3 1VBE2 1T6BX 1RVF3 2AEYA 2VL4A 3AX4A 4LPLA 2VMFA 2CL2A 2JG8B 1SFPA 2ET1A 2WS91 3OG2A 1GOFA 3MLKA 4IV3C 1T2XA 4LBNA 4OHZA 1KDMA 2V72A 3DPRC 4G9SB 4IEQA 1DU3D 2WLPA 4YNIA 4ARXA 3O12A 2HWD2 4IL7A 5LY1A 2EIBA 3POIA 4IEOA 3ZSMA 4LA2A 4Q0SA 1W6QB 2V73A 4XJAA 1NCRB 5D2AA 1LULA 2QJVA 3VL8A 5C3QA 5FOBB 1UMZA 1GR3A 1PZ8A 1VB2A 3WQ1A 1C3HA 2WL1A 2ZHMA 3ITQA 4YM0A 3U0ZA 1XU1A 1WKYA 3HQXA 3KGLA 3GBFA 4MH0E 2JICA 2W68A 2RDQA 3LQCA 2CWMA 2RJLA 4KWLA 4NWWA 3WNLA 2C5DA 2RV9A 3A22A 2JENA 1GKBA 3ES1A 4CCOA 2ET7A 4MGQA 1N1VA 5D8AB 5FYTA 1UY2A 3LPFA 5FYSA 4ZXEA 4N9HA 3S30A 3PUQA 3M70A 2IFWA 2QQMA 2XG3A 3GCWA 2DUQA 3VV1A 1APNA 4XAAA 1WMXA 3K77A 4MVTA 5FYVA 1VBB1 3WHTA 1YUDA 3ORJA 2WN2A 1PIV3 1N1SA 5T54A 2ZEZA 4MSVA 1C1LA 4UAPA 2B4KA 1IPSA 1TZOA 2A6YA 4I09A 1OQ1A 4CUGA 2H0VA 4LKDA 5JZGB 1JOBA 2ZX0A 3W5NA 3R4SA 4JDOA 1EPWA 3Q8EA 5JI7A 5KC5A 3AZWA 1DGWX 1ZRCA 4OQ9A 1S0IA 2LRPA 1XBFA 1NT0A 4A3ZA 2DYCA 5F37A 5CIRA 5D8AA 4GQ7A 1YFWA 4AGRA 4E9KA 2W46A 5JSOA 5HV0A 1UNBA 1HQWA 4XOGA 2CTVA 4FVVA 4C0HA 5C8WA 2JDAA 2FCTA 1B09A 2P5BA 2PLV2 3RS6A 2EALA 1LKNA 3MV01 3PIGA 4OULA 1IS5A 1FPN3 4MGTA 2VMEA 3VL9A 2AH2A 3UV9A 3RYPA 4O9GA 5H9SA 5HBAA 3VKOA 5FZGA 4CCMA 2RMU3 5EJZB 5L7OC 2UYAA 1S0FA 5FZAA 3NWKA 4PIZA 5A6QA 1CGPA 1OD3A 2VQUA 4QPGC 3WQ7A 3OUIA 4DZGA 2PYTA 1UY1A 3HT1A 2QDNA 5JLVA 1XPWA 1ZRFA 1JYCA 4CCJA 1QJY3 2D6OX 2VH9A 2W87A 2KM2A 3EQEA 1TME1 2BP6A 4QPGB 5GALA 3U75A 5AFEA 5BNNB 3VBFA 2Q8EA 1SLLA 1OURA 2XL9A 1XB9A 1YQ5A 2JD9A 4GALA 5FIXA 3RZKA 4GKYA 5BNNC 1GBGA 1N1TA 3W58A 4XCAA 5FP9A 2YU1A 1D4M3 3H8RA 1UPIA 1RUH1 4JKMA 4Z8BA 4EN6B 4BHPA 2HWB2 4JV4A 2WDBA 3BTAA 3ETQA 2VOWA 2PAEA 3VKMA 2ZZQA 4XUQA 1OA4A 3AMQA 3NQHA 1UYYA 4Q1RA 4XQWA 5I0SA 3HD8B 2I45A 2DURA 3NV2A 4QHOA 1O3TA 3I2GA 4ARYA 4ZHNA 2A3XA 4QQ2A 2OVUA 3CIHA 4XF0A 3IBMA 1AR83 3O14A 1Z7S2 5LB6A 3EMRA 1JN2P 1D0HA 4CUCA 1H1AA 1JBCA 5I8TA 1Y43B 1AX1A 3B3QE 3ACHA 1W28A 1VP6A 2E7QA 3VKLA 4Q29A 1DLLA 1TMF1 3ZMNA 2Y64A 1H2MA 4N8MA 1W3XA 1ZZ7A 3DKWA 5JMOA 1LOBA 4ONUA 2WQ4A 4IGQA 2GH8A 3MEPA 2YZ4A 3C7OA 1FI2A 1ZBA1 5T5PA 5JXGA 5HV4A 4GWIA 2J1SA 4JC1A 4RR3C 5AVPA 3NAPA 4W6YA 3KV9A 4BISA 4KBBA 2RS33 3OYWB 5CZKA 5GLWA 3WDXA 1J3QA 2VZUA 2Q0AA 1EAH3 4DEVA 3S57A 4GB33 2NM1A 1SZBA 2QBXA 4MGSA 2VNGA 1LTEA 4AW7A 5T5JA 1W9SA 1C8M3 4OUMA 2FHRA 4GWNA 1YFXA 2SBAA 3RZLA 1D7PM 2X5IA 2ZX4A 5T55A 2FZ2A 3B69A 5FUPA 4IV1A 3T2QA 1C5HA 5FXVA 3KF5A 2C24A 1W2NA 5LCWL 1JXNA 1LOCA 2XOMA 4Y3OA 2JDPA 4K8FA 3TNPB 4CP2A 5DAXA 1SCSA 5J36A 2D3RA 2WO2A 5LA0A 5IK8A 2R0FA 1AZDA 4QGMA 4CDWA 3TEYA 3OBZA 1XNDA 2PA7A 5FP7A 4GZ9A 1ACCA 5C5TA 1RB8G 1PNGA 4IEVA 2ATFA 3FLPA 1VBC3 4EWAA 1QXJA 4QX3A 3KQ4B 1OKOA 4GMP1 2ZACA 4LUKA 1G86A 2GNMA 1YNAA 2ERFA 3W5MA 3IKWA 1R1A2 3TWIA 2ZJCA 5A1AA 2PAMA 2Y0IA 2WNUA 2G19A 3C7EA 4HSJA 3USUB 5HXVA 3RJ2X 1BBT3 2RM21 3MV11 4YVWA 2P37A 1J1LA 4YZ1A 2A75A 5FMOS 1H4GA 2HWB1 5L9BA 4E4SA 5IK7A 5IVBA 3MLLA 4WM7B 3RYRA 3VLBB 1GUIA 5J37A 5LK5A 1X8EA 1KJLA 3VBRB 2A73B 2DUPA 3AKPA 3W20A 1E5HA 4XTPA 1SFNA 5I0UA 5JOZA 3ZYJB 5FZ4A 2XH6A 4BQXA 4YG3A 2XJTA 3FBYA 3R4UA 1NZCA 4N43C 2C4XA 4XUPA 1RUE2 1RUD1 2O8QA 1I5ZA 3NAPB 4I30A 4N53A 4LKFA 3V0AB 1H2KA 3PTRB 2AREA 2O8OA 5DQ0A 4ZKTB 3VD4A 1H4HA 2JXAA 4GA9A 1HN1A 1ZRRA 3AB0A 4H7MA 1O5LA 1TQ5A 3DKQA 5FOJB 1WMFA 3TRSB 2VOKA 4QQHA 3LDKA 4OHWA 4UW3A 2BWCA 3V65A 3ST7A 4BLIA 3ZYBA 3WINE 4IERA 4COWA 4E4ZA 3WD5A 2F6BA 5IK4A 5IJRA 3PTYA 4Q26A 1SBFA 2Y33A 3IB3A 4M4RA 2OYZA 1AXKA 5EHDA 1MVEA 1XSQA 2E9QA 3DCQA 1ZZCA 2GH2A 4KQ7A 5F5IA 2ZBJA 3HPNA 1W03A 5M0TA 1JMUB 4LO4B 3SQOA 1W9FA 5HI0A 4XFIA 2R16A 3NNMA 4OYUA 4Q0UA 5G05L 2VE1A 1NKGA 4GH4A 4I3GA 4OI2A 4AEMA 1JYXA 3CU7A 4N90A 1UZZA 1ULOA 3D4KA 1DGLA 5ACA1 5IUQA 5FZFA 1V70A 2AEZA 3UT0A 1BJQA 3LEGA 5BNNA 4GWJA 3OPWA 1AR63 5T50A 5T5LA 1HJFA 3ZX7A 3AMHA 4LO7A 4Q4X2 2WNEA 4AEDC 1R1A1 3GJBA 3IN9A 3H0OA 3WVJA 4C90A 3VUOA 5BNPB 4AEDB 1Y9GA 4DUVA 4DXTA 4L9BA 2JB8A 1LOGA 1SLBA 2WNUC 4Q8KA 1I1EA 3WF1A 3ZXLA 3MICA 5FP4A 5CVRA 3LKJA 3LFIA 4W50A 1EUUA 4LHSA 1N3PA 1O5UA 4YGEA 4LO8A 3RZZA 3PURA 2DF7A 3A4UA 1IS4A 2V5DA 3ZFFC 1VRH3 4QKDA 1EY2A 1EV12 4K20A 4DO0A 2D5HA 3AYEA 4LLOA 4QPGA 2WINB 4LORA 1VBA2 1JH5A 2PQQA 5FXXA 2YXSA 2WT0A 4RS5C 3PNAA 1A6CA 4PF1A 4Q1PA 3E1F1 2OPKA 4JAAA 5EWSA 1W2AX 5DZGA 1RMU2 3ZXFA 4P00B 1IG3A 4Q8LA 2ZEWA 5FY1A 2ARBA 3CJIA 1QJU3 3JB8A 4ISRA 5A80A 3T1LA 1JYVA 4NIHA 1NCRC 2VMIA 2HWD3 5FYMA 5GLVA 3RZHA 3CO2A 4UBHA 1RUI3 2XJRA 3PMSA 3HAGA 4WZFA 4XBQA 4NHYA 4C0BA 3S7IA 1DBNA 1AR72 1W8WA 2WFF1 1W2OA 5FWJA 4CXXA 2BGPA 3B94A 3F95A 2HWF2 2JKXA 2RS31 4JRLA 1UZVA 1QDCA 2J7MA 5JDBA 3IIIA 1W6QA 4O9EA 1W2TA 4IESA 3WG1A 1UY4A 3O1RA 3CHXA 5CG9A 4IGOA 4I0AA 2PLV1 3OB8A 3URFA 1TVGA 5A3TA 2DFCA 4E2GA 1TMF3 3AZZA 4FPFA 4M3CB 4MXWA 2VPVA 4A3XA 2W2IA 3HIFA 3LFMA 3SHRA 3AM2A 4HN0A 4QU2A 5A6ZA 1H1IA 2V5YA 4C8DA 4ZU7A 4LR4A 4FOVA 1ENXA 1S4CA 2G9FA 3ZN5A 5FWEA 2H0BA 3HWJA 4KBZA 3N7JA 3J9SA 1GYKA 2W92A 2RS11 2D3SA 1R091 1OMIA 3HNYM 3POBA 4QB6A 3TNQA 2R6QA 2VTXA 1MQTB 1HIXA 2XMLA 3I2KA 1DFQA 2BWAA 5FZHA 3PUHA 3AYDA 4HBNA 3K2OA 2P6CA 2VOXA 2UY9A 1NQJA 4BIFA 2HWE2 1RUH2 1F2NA 1JU3A 3TN92 4AFCA 1FT9A 4XF3A 3QD6A 5L7OB 3HOBA 4QXKA 3H8XA 1ZM1A 2GMMA 3LA3A 1MS0A 3WQBA 1PGL2 3UETA 3WR0A 4HKOA 4PLOA 1HV0A 3S5AA 2D6LX 4LIVA 5FJHA 5J96B 5FY5A 5FZ3A 2WT2A 1CX1A 1JOPA 1QWRA 5LBEA 4EE2A 1Q43A 3NMBA 2R071 2A3WA 4QQOA 3WSOA 5KC6A 1WA6X 1ALYA 4V1PA 4X6RB 2QQUA 3OPTA 1SACA 5A33A 4F8AA 1HB4A 1MEC3 3IDEA 4AI8A 1NA1A 4K40A 2X5IC 2VBDA 2R043 3OJBA 4HLTA 4Q4V3 5LBFA 3A0NA 3LZZA 3KWVA 4YPJA 3KHBA 3UK9A 2C6SA 1W9WA 5GKAC 2OW4A 4OMCA 4CU7A 4ES8A 1ODMA 2WZEA 3WCRA 4NE9A 1PVC3 1NCQA 1JYTA 2OIIA 2VZPA 4GMP0 4OCTA 3WW4A 1FMD2 2XQRA 1XE8A 2NLRA 1J3RA 2ZGMA 3PIJA 1LR5A 4LK7A 4QDRA 3ZFGA 1YYNA 1RGSA 2HBUA 3AC0A 1AR82 1C1FA 3MIBA 1V0AA 5FO8B 1UYXA 2WUHA 1RUE3 3ME2A 1BXHA 2HEVF 1EV11 4OZOA 2OPWA 5EJ3A 3U1XA 4AHXA 2E6VA 3WF0A 1OC1A 3OGGA 3R0RA 3N4MA 4JDMA 4RL7A 1H1MA 1RUF2 1SBDA 2WIIB 3LAGA 1W6MB 1UXZA 3CEWA 3OGVA 2DTYA 5FMBA 4AZZA 1Y3TA 1GP6A 3ZFGC 3T4VA 4DUWA 2J1AA 3A21A 5LBBA 5KBFA 4JRAA 3V64A 3ZFEB 1QNYA 3ILNA 3T0DA 4K6BA 3VZOA 1RUH3 1XYNA 2BEOA 2B7YA 4B4QA 4E8DA 2B42B 4QDSA 2GDFA 1JZ3A 2CGPA 4JHTA 3I7DA 3IPVA 4QX5A 1YCIA 4XCBA 4CE8A 3BU0A 5JWPA 2DCZA 3ASIA 1UIJA 5EPAA 4Z1VA 4FSJA 5BNOC 1JHJA 2XVGA 3H9AA 1G9AA 5LRSA 4EYUA 1QJY1 4KMQA 4JCKA 3MO4A 3RI8A 3USUA 4YZ5A 3GZEA 3ZVXA 5C3SA 2UWBA 3N9QA 2WSVA 2PN5A 1TE1B 1LCLA 3W9AA 2FBEA 2OT7A 2BJSA 1ULPA 3M3QA 4XMAA 1DCSA 3K4AA 4LEJA 4Y4RA 2WBKA 1FXZA 1RVF1 4ZZ5A 3VBFC 5C33A 3GZUC 2GNBA 4AVBA 2IUWA 1H8TA 4FQZA 2A3YA 1AR93 2W47A 2VNRA 1GZWA 3C8XA 2D97A 4G4FA 3VBFB 1G7YA 1WLDA 4NOTA 5JI9A 3RYKA 3HEIA 2NZ9A 1ZZBA 3ZXGA 1DYKA 1BBT1 1RUJ2 2RM23 1AJOA 3G6JB 4XETA 4I0WB 4OFGA 3HQRA 4NRMA 4ATEA 1C5IA 1H6XA 3BU7A 5LEJA 1MZ6A 1E5SA 2YY1A 3AMPA 2J1UA 1O91A 2VUCA 1FYUA 4MHUA 2PHUA 2K0GA 5BUVA 3M3CA 3WW1A 1IKPA 2J1RA 2F4PA 2RG4A 3WXPA 4MZUA 5IWFA 2D6MA 4ATFA 2LW8A 2ZGTA 4QX2A 3AVSA 1VBB2 2QQOA 2IXCA 4AQSA 4BQ1A 1JZ8A 1X36A 4HG6B 2WO7A 3RVHA 1DGRA 3UL2A 4AVCA 3CZUA 1B35C 4LE3A 3ZYGA 1UN1A 3AK0A 2IVJA 1X9PA 2ZX2A 4JQTA 1U5ZA 4B4PA 1LRHA 1UKGA 1BMV1 1ZBE3 2JDNA 4JGZA 4UOJA 2GMPA 3OYWA 4MGIE 5JSPA 4N43B 2FQPA 4BE3A 1CAWB 3NAPC 3ZXKA 1IKQA 4FP2A 4A7KA 3MFCA 3CDZB 1QIQA 4CXWA 2CYFA 3EJKA 5I91A 4CYDA 5JZGA 3JUUA 4MV2A 2DVGA 2FDJA 2TNFA 5E88A 2ZMKA 4ZONA 4FPCA 1XU2A 4I3PA 1W04A 3ON7A 4COVA 1RMU3 3AZYA 3ZKUA 1YIPA 1WGPA 4GJYA 5LA9A 2N7GA 5A1FA 2XWJB 1UX6A 1ZZ6A 4Y1ZA 3M2MA 4XHBA 1LEMA 5F3IA 4BYYA 5ACA2 5JSRA 3SISA 5A6XA 4BM8A 1KD7A 1LESA 4HT1T 4AGGA 1IGOA 4L92A 1FV3A 2BU9A 5GZEA 1CN1A 3WP4A 2W1UA 3ZSEA 4L99A 2IWGB 1WD3A 4K21A 1YXWA 3RMXA 5E16A 1QGLA 2HEYF 2D6PA 3E97A 3V0BA 4EZHA 2EXKA 2QQWA 2VULA 1X82A 3NV1A 3VN4A 5AVAA 1WWYA 1X8MA 2F4LA 1O7FA 1US3A 4NPLA 4R9BA 3NKTA 3GJAA 5FZEA 5I0TA 3T1MA 2D7FA 4PF5A 1QJX3 2GAUA 1D4M2 2X09A 3NRUA 4FPEA 1RITA 3J26N 1AR81 4R9CA 4IV3A 4XXAA 2ADEA 3DPRA 2VM9A 3B9CA 1ENSA 3ZXJA 1C57A 4I0BA 2JG8A 2VR4A 3I3BA 4IEZA 4WM8A 2DU1A 5JOWA 2WT1A 1VBD3 4META 2OQ6A 4UBGA 4WM8C 3I3DA 4XFAA 4K1YA 5GM0A 4DOUA 1OD5A 1Z7S1 2RS13 3CL1A 1H8TB 1ND2B 1GP4A 3VHRA 1UY0A 5L9VA 3WHUA 3UKNA 4AL9A 2XVKA 1DYOA 4OUSA 4PLMA 1JYNA 2W95A 3UNPA 1SLTA 4OI4A 1J3PA 1W06A 5CKNA 1X7NA 4JX0A 1IZ3A 5JPMB 1KFXL 2YBKA 5G04L 3SMHA 1UOJA 1UX7A 1HB2A 5EYYA 5KXBA 3KT1A 1WCDJ 4H55A 2RR11 2JDMA 1PNFA 1RUC3 3TN93 1V9U1 2PAKA 3ZFFB 2VQAA 1C8M1 1UOGA 2R0HA 1OBNA 2XQXA 2G9ZA 4Y4YA 3ZXEA 3IPVB 2RMU1 4FQ4A 3HN1A 5DXDA 4WVMA 2DBIA 5ACA3 1QOTA 1Y7BA 4PBPA 3P3NA 4CDXB 1EUTA 2ZX1A 1FOD2 5ABJC 2HWF1 2BRTA 3VDDB 1XOYA 3O0XA 5GLUA 4PDWB 2MPFA 3FWEA 1ZZ9A 4Q4Y3 3LOBA 3PL0A 3A23A 3U78A 2B45X 2VVEA 3JXSA 4YM1A 4U36A 4Q4V1 1YQ8A 1QOOA 1MEC1 2GC3A 3DECA 3J8F1 3WT3A 1MS8A 3QBQA 4R4ZA 1W05A 5FTTC 1RIRA 1Y9QA 5A3NA 3RRDA 3THTA 3VDCA 1CWPA 1UQXA 1OVSA 5SV5A 4JGYB 1G9BA 2JIJA 1AXYA 1PGSA 1O4TA 2CGOA 4D7TA 1H8VA 4QKFA 5FZLA 4QXBA 2WNVA 1SPPA 5FP3A 4MYEA 5C4WB 2XJQA 2AC1A 4YVWB 4YVSB 4B1LA 2HWF3 1LU1A 1YLLA 2VECA 2QQKA 2KR2A 1DQ6A 3E5UA 3VBHB 1KRIA 3KV4A 1VJ2A 2RS32 4LE4A 4E4HA 4P08A 1DHKB 3ACLA 3ILRA 3SITA 3U4SA 3VBHC 1DQ0A 1XSRA 1D4M1 1OOPC 3WDYA 3IAQA 1N3QA 2RS52 3TN91 4BB3A 4CEYB 3M3OA 4AI9A 2EXHA 4QX0A 2HYKA 2R1DA 1OOPB 1R081 1OUSA 4BJ0A 1RL3A 2JWPA 4LO5B 5JXHA 2ZAHA 2W9XA 4HL0A 3RZGA 1CAVA 5FUNA 1W8OA 1S2EA 1PGW2 3I54A 4AFBA 1MZ5A 3M3IA 2W1SA 2FMYA 1KJRA 3ES4A 4H14A 4AF9A 3VBHA 4WM7A 3EO6A 5H9QA 5LEKA 1PGL1 5DAWA 1QJX1 5BXXA 5C4WA 3E6DA 1AL22 1OUXA 1U5IA 1SDDB 3I49A 1RUD2 5CFDA 4A4AA 5IVEA 4IUGA 2YC2A 4QQPA 3ZN4A 1COV1 4TN7A 5IHRA 1H2NA 1UO9A 4PI0A 1XE0A 1UOBA 1G6NA 3AKRA 3DL3A 1SEFA 3KD4A 1BEV2 4P9IA 5CG8A 4BQ4A 4KI5M 4YM2A 4CUBA 1KS4A 2R063 4FFFA 4LBMA 4XMIA 3UGFA 4CDUA 1WCUA 2ZGSA 4LUMA 2P4EA 3PVNA 4MO3M 1C4RA 4AG4A 2B9UA 3D5OA 2WFF3 1RUJ3 2RM22 3SCFA 4F83A 4NVPA 1QXRA 3B9IA 3CZJA 1KQRA 2C0ZA 5HCBA 4KG0A 3RPQA 1W0NA 2OUJA 2RDNA 3I3EA 3J8F2 4HZFA 4XJ9A 2ZKNA 1NOVA 4PT6A 1OLRA 2ARXA 4DMIA 3VD5A 1J1TA 2WA3A 1RHI3 4GKXA 2XWBB 4YFWA 4PHZA 4XUTA 1TNFA 2Q5TA 1F5FA 2VMDA 2IXIA 3OGRA 2B46X 5JXJA 2BUKA 4COUA 1EAH1 4P9JA 3SEPA 5C3OA 4P02B 5C3RA 3J7NA 1H0BA 3P6BA 4LOSA 2P2KA 4XPVA 1PMHX 2R061 2ZA9A 1J59A 2ZGPA 4KWJA 4P9YA 5CEHA 4HPKA 4QB1A 3AP6A 3MYXA 4NHKA 3GGLA 2WZPP 3GYDA 5FPXA 1PX4A 3HVDA 2ZEXA 1GANA 3WY6A 4NRPA 4GD4A 4JZRA 5K8SA 3D0SA 3B02A 4NIAA 2W94A 5C6CA 1IPKA 2BPA2 5JR7B 3BPSA 5AC92 1S0BA 4R9AA 4CSWA 1NUKA 2ES3A 1YIFA 2NPIA 4DIQA 4XZPA 1VRH2 2CSGA 3VZMA 2ZXQA 2LTNA 4AI3A 4OUEA 2JG8C 4IV3B 3O1MA 1R082 2HWB3 4KL1A 4GMP3 1YRZA 4YZ3A 5GLZA 1IS6A 1GQPA 2L9LA 3J7LA 2QE3A 1W8NA 1RUG2 3BN6A 3K46A 1AJKA 3VBOA 3ZR6A 1K5MC 2BVVA 5K7PA 3MUY1 1HW5A 2Y6HA 1ODNA 3U4XA 1IQDC 4Y20A 3K48A 5FY0A 3O1SA 3AP7A 3HNBM 5FPZA 3CNAA 4X8NA 1N47A 4XC9A 1UU6A 1Z7S3 1ZA4A 5CFCC 3BPZA 4ASMB 4XACA 1QJX2 1XJAA 2PMWB 3NJXA 4K3UA 1JZ5A 4OMDA 1LHNA 5FZDA 3SKVA 3LA2A 1W8ZA 2E63A 1VAVA 4M0NA 2GN7A 2Q1FA 3JQWA 5D8AC 5ANQA 3IMNA 4HETA 2YC0A 1BMV2 1REDA 5C9AC 1AR92 5HCAA 1VAKA 3BVCA 3UYJA 4BK5A 4OI0A 2P3KA 2VXJA 1W6NB 1Y4WA 2XJPA 3RMYA 3KLSA 3FLTA 4EWEA 3WF2A 2Y38A 3NV3A 3IWZA 3KVAA 2VCBA 2AGSA 4UF0B 3ILFA 5K0UA 3VHNA 1OHFA 3W21A 1UZWA 4CUAA 3N7KA 1VBA1 1CAWA 2FDGA 4UFJA 4PLNA 1EV13 1TMF2 2VO5A 3GZAA 5FY4A 1ZREA 2X29A 3GDBA 4NWVA 2FCVA 2WAAA 1B35B 1X50A 1L7QA 4XF4A 3QLQA 4D8MA 4AFMA 3GBWA 1W3VA 3BODA 3L2YA 3NW4A 4DNYA 2DWRA 4Y1XA 5FY8A 3ZYHA 1KGYA 1NCQC 2YG0A 2X05A 3ZO0B 1NCRA 1UYZA 3CJIB 4KH9A 2QCSB 4QDQA 2D6KA 2GALA 3FHQA 4LTAA 4P5HA 4QT6A 1GSLA 2WO3A 3RWKX 3AZXA 5DAQA 1HLCA 4URTA 4NO4A 3WZ1A 4RFRB 1F9KA 5JPNB 2C1FA 3AL5A 3K4DA 4DB5A 1AX2A 2E26A 5AC91 1S0JA 3LIHA 3N3HA 2W39A 4XILA 2ZPXA 3V0AA 3D8CA 1XNBA 3K3NA 2VMGA 4LBQA 5FPLA 4DRRA 4N43A 3PVEA 1V9U3 5CNAA 5HPOA 4KU7A 5F3CA 2WWJA 4JGZB 5KXEA 1VIWB 4XE9A 1DGRN 2DCYA 2ZHLA 3LIGA 5F3GA 3OF1A 2ZGKA 4DS0A 2WJSA 5FV3A 5LATA 2Z4FA 2WKKA 1TME3 2A6ZA 3M3EA 5CA6A 2D3PA 5LY2A 5CFDC 1F4AA 3WNMA 1XE7A 1OQDA 2BYVE 4CP1A 4XJ8A 1K5MA 1HRI2 5A32B 3VBUC 3H3LA 3S7EA 1HN0A 1UPSA 2HBTA 4D7YA 2XONA 3I2IA 2C9AA 4LIUA 4AHWA 4CZSA 2HYXA 3ACGA 2ZS6B 3T4HB 2VU9A 4LO6B 3ZSJA 4FBFA 1AYM2 1CIWA 3SCGA 3H8UA 3K4ZA 1LGCA 3M1HA 1OOPA 4N7IA 4HFSA 4TWTA 4XFFA 3E5QA 4CEYA 2ZHNA 3AP5A 1MACA 2BTVC 3PMEA 4QQLA 3WP5A 5IVJA 1S0EA 2NMNA 2WQ8A 2A5ZA 2Y6GA 3KV6A 5DMYA 1JW6A 5FBZA 1RUOA 4AXOA 3RDIA 2QQNA 3O1UA 1WLCA 2PHLA 2BERA 4CP9B 1QHDA 1CJDA 2WWSA 1R1ZA 4YZ4A 4XIKA 1LOFC 1OT5A 1GOHA 1JU4A 2TBVA 3EYPA 4YGDA 1H9WA 3GF6A 4ZS3A 2CNAA 2VC9A 2DCTA 4QKNA 2XBO2 3K51A 2BOIA 1NZIA 4FO9A 1JOJA 2DDUA 2VCMA 1WA4A 4HK8A 5DG2A 3VZKA 2WQZC 5T52A 2XJUA 2KXLA 4Y1YA 3ACIA 4RHV2 1DLCA 3VD9A 5CKQA 2BNMA 5LRRA 3JBG1 1LOFA 2PTMA 2FCUA 1F31A 1LHVA 4FPKA 2ZCWA 2P17A 4GJZA 4BU2A 3CMGA 2NMOA 3DYPA 2YPJA 1GLHA 3MI8A 1W6MA 3O0VA 1ND3A 2VG9A 4I02A 5DDJ1 5JVVA 5A3MA 4XFHA 3T08A 4J1XA 4BZ4A 5BYNA 1POV1 2PFWA 4D0QA 3E6CC 3FMGA 4CPBA 3VHPA 4MHRA 1V6NA 5IVYA 2VUJA 5D1IA 2R32A 3POWA 1YFUA 1YQCA 3C2UA 4QGLA 4WVMB 3M4FA 4XUOA 1YI7A 1W0PA 1BCXA 2Y6FA 5FLJA 5FZ1A 2VW1A 3POGA 4M3CE 1AYN1 1SQ4A 3MIGA 3BIWE 2R041 3ZLIA 3KMHA 4LMFA 1UD1A 2Z79A 1BBT2 1RUJ1 1RUF1 5DZEA 4R52A 1QQP3 1VMHA 3FLRA 1QJFA 3PHMA 5DN2A 2OZJA 5JXIA 4EZ4A 3GZTB 3N9MA 3T2OA 4QKBA 3MIDA 2R073 3NVCA 4Y5TA 4EWDA 4BK4A 1ZNPA 1SLCA 2VZRA 3RWNA 3I3MA 1GQHA 3KQRA 2VCCA 1DF0A 1PVXA 2VTFA 4Y22B 5L73A 4CCNA 3NKGA 1FPN1 2A6XA 1AXZA 2B8MA 1COV2 3I3QA 4DY5A 1E57A 1X9TA 4JVAA 5J7MA 2UYBA 1HRV2 5APAA 5LW9A 2HWC1 4YGCA 1CAXB 4AEJA 3O0WA 5FO9B 2YMZA 1K42A 3GHNA 1QJU2 4FP3A 2P3JA 3THPA 1NX9A 1V6LA 4GULA 5FK8A 5F9TA 2XKPA 2PHRA 1PK6A 4P9LA 4A45A 1BK1A 3ZDSA 5L7OA 4XDPA 2FDFA 1RUI2 2HJIA 4Y5Z0 2ZGRA 5JOXA 4AI0A 1PGW1 3MHZA 5IYYA 4RA0A 4Q0QA 1RXFA 1VRBA 2I74A 2IFRA 4E2QA 1S55A 1W39A 4Q4W3 1HXS1 2Y34A 5AFBA 4WBBA 1O3RA 2W91A 3KV5A 4QXHA 3D6EA 2PHFA 5A7SA 5A3UA 1QKQA 2D5FA 4NJ4A 2Z69A 1LHWA 3JBG2 4BMBA 3PJYA 2W3JA 2VMCA 1O8PA 1UKRA 4NRQA 4UF0A 5C8CA 1RHI1 4JHZA 2R062 2EXIA 4S2FA 1AYM1 4FT8A 2WZR1 3OBRA 5FRAA 1DZTA 3MIEA 3BKZA 4RQPA 4XHXA 4ZPIA 1OPOA 4XBLA 5JIUA 1X33A 2ZTNA 5DUWA 3MW3A 4QMAA 2VOTA 4HVRA 4Q4X3 4EN9B 5FYIA 3NV4A 3J8F3 4HSLA 1TNRA 4YSFA 3WUDA 2QZ2A 1Z0HA 4YW5A 3UJQA 3ZYIB 3BTZA 3ZPOA 2AENA 2Y6JA 2UURA 1VRH1 2A70A 3OD4A 3ZYFA 4C1XA 1COV3 4LBKA 4BQ2A 4UW6A 3R6SA 5IAXA 1AYN2 4HOOA 5F1RA 1FV2A 1HV1A 4QX7A 2DV9A 4QPIC 1L7RA 3G7DA 1PO11 2D44A 3B93A 1EYBA 5FUIA 2BNNA 3HBZA 2NYYA 1K3IA 1MZFA 4QPIB 3BOPA 3ZIWA 4BWOA 2VCAA 1ULDA 3BCWA 3EHKA 5FYBA 5CBLA 2CDOA 2YFUA 4HK9A 3QH6A 4EN7B 1GZTA 4IEWA 2BV4A 4D3WA 3DPRB 3H1MA 4BH9A 2QQVA 4R4XA 3Q8BA 1NE4A 2OQ7A 4Y22A 3SKJE 2ZAAA 2RR12 3SEEA 4GH4B 3NJVA 1LENA 4AVVA 2Y6KA 1IOAA 3K3OA 5FP8A 3NSTA 3MW4A 1YJLA 2IVIB 3OCPA 4GH4C 4PI2A 5CB7A 3VBOC 3FUQA 3DYOA 2XJSA 3MPPG 1HRI3 3H42B 2ZOEB 1LHUA 1R093 4Q4Y2 3VBOB 3WX5A 4FPOB 4AEDA 4BDVB 2W08A 5T3NA 1RINA 2CY6A 3AVRA 4AVAA 5BNPA 1RUE1 3LDRA 2OA2A 3OPZA 4UW4A 4DY3A 1JODA 4L11A 5E89A 2YYOA 2MNGA 2MHFA 1C28A 3LA7A 1IS3A 3ZN6A 3EB7A 2JE9A 3PU3A 5FZ8A 1UCXA 1W6PA 3DGTA 5FZ9A 3FL7A 2IXJA 2CU5A 4ITCA 1OA2A 4Q27A 3IZOA 4RQPB 3WOGA 3WDTA 4TSVA 4Y1VA 3O1VA 5F32A 3H3UA 5JZGC 4G3YC 4IE5A 4EROA 1Q3EA 4RQPC 2VZQA 4CVUA 5EZWA 5FZCA 3MIFA 2VW0A 4BQ5A 2JDZA 2MEV2 1FOD1 1D2SA 4HPKB 1QJU1 4LXLA 2PXJA 1CD3G 4KWUA 4OHYA 1Q8PA 4FPYA 3KS7A 2DCKA 4CCEA 5KHIA 2RMU2 2D6NA 3VBSA 1UF2C 3R05A 1UL9A 1KDKA 1RUI1 3HNMA 4DXRA 1G9CA 3P3PA 3MBWA 2JDHA 1JHNA 2EAKA 1NCQB 1NLSA 1O4ZA 5A6YA 4CEWC 2Q4SA 3I2JA 1GU3A 5I0DA 3CJIC 1Z78A 3FUOA 3OY8B 4Z82A 3WDVA 3UESA 5FPAA 1PK6B 1KXGA 1PO12 4YLZA 2TEPA 4ISQA 4YW6A 1LEDA 4CEWB 1HQLA 4A7YA 2QTWB 2OX0A 2ZGLA 3HBKA 3F2ZA 1P8JA 5H9PA 1URXA 2VW2A 4ORFA 4W8JA 2WZ8A 4JTOA 4N53C 1QEXA 4CDUC 1Q8OA 4YGBA 3FFQA 2GP3A 5A7WA 1AL23 4GAZA 5FJKA 4YW3A 3AZVA 2XLGA 4N53B 3I2FA 1GNYA 4CDUB 4XAEA 2D40A 2JX9A 1JUHA 1S0DA 2XLFA 2VGDA 4P9GA 4HANA 4XJWA 2H6BA 3JQXA 3AYAA 1LGNA 1XNTA 1BEV3 2RS51 1KITA 3DYMA 1OKQA 2VXRA 2VAUA 4H3WA 1ZRIA 2O14A 2ORXA 2AYHA 5CFDB 1OXCA 4AR2A 3ZM8A 4FOYA 3CJXA 4CDQA 2HWC3 3MFAA 2WFF2 2X5IB 4FTEA 5BNQA 1BEV1 1DZQA 1ZX5A 2RS53 1ASJ3 4IEUA 2V4VA 3MDPA 1PZ7A 2A71A 3KM5A 4Y26A 4MADA 2VUAA 3AKTA 5LWBA 3JD71 1GNZA 3I8TA 3H1YA 4W6WA 4CPBD 1NG0A 1VPHA 1CAVB 3FC0A 2MEV3 3B01A 3ZPYA 2WYSA 1AL21 3Q8AA 4NPMA 2NP0A 2GU9A 3MW2A 3AXDA 1CONA 1CZSA 4OHVA 4PCRA 1AVBA 1PMIA 3POJA 1EAH2 4W6XA 5D21A 5FLIA 2XPJA 2VZVA 4EQVA 1POQA 4AGVA 1RUF3 4UXAA 4B4RA 5FPUA 4RHV1 4ZU4A 1DG6A 4HKLA 4RYDA 4OHXA 4AHYA 2XVLA 1G8WA 4M3CA 1U5YA 4FXKB 2GSYA 1GWMA 3ZFGB 1FATA 4F7ZA 4DINB 2WNVC 3BYWA 1NQDA 2G1MA 2W5FA 1JZ2A 1IHMA 1E5RA 1NY71 3ZFEC 1XQNA 1G9DA 5GLTA 3MPBA 4CP0A 1V6JA 1W6OB 1RXGA 2ARCA 1H30A 2WNVB 1BQPA 4MG2A 2JEMA 5H9RA 1PHMA 4Q4W2 5FY7A 5E8AA 3EXUA 1KFUL 1WLWA 2JB4A 1OSGA 1QOSA 1ST8A 2GC2A 1K12A 3WEZA 1US2A 3OD0A 3NNFA 3WF4A 2VD7A 3JBG3 1STMA 2DVBA 2PELA 4IW3A 1XYOA 4MXVA 5CKMA 4LLFA 1SFYA 1I6XA 4RHV3 5E6HA 3WV6A 4DXSA 3LEIA 5I93A 2I07B 2EXJA 1V6KA 2HLEA 4BQYA 1I3HA 4NMIA 3RG0A 1AR73 2ZMLA 5B4NA 5KXDA 4B29A 4IE7A 3TAYA 1PVC1 1VBD2 1I9RA 3JB4C 1RYYA 3LSDA 3AP9A 4XF9A 2Z42A 4Z92B 2RS12 3BGAA 4QD2A 5ISLA 1QJZA 5IT6A 1ZBA2 3JD73 2HEWF 5FZ0A 2ZGQA 1Q8SA 2PHTA 2WWUA 3CF6E 5A3OA 4K8RB 1GWKA 4QX1A 3BTXA 2XDVA 5FMOL 4EV0A 1LECA 5A7OA 4AI2A 5EJ1B 5L19A 1U12A 3S0MA 3RZMA 2RVAA 1DIWA 3U11A 4D6QA 5FMCA 1XNKA 5TSWA 1RUC2 4WM7C 1FPN2 4DPNA 3O7OA 4LITA 3JCIA 3ELNA 3L2HA 4A7ZA 3ZDVA 1PO23 5KWRA 1HX6A 2RE9A 1XC6A 5EFUA 1CIYA 1ZVFA 2WS92 2WYFA 1AR91 1Q5OA 3DXUA 4QXCA 4X8PA 4BPZA 1LOAA 3ETPA 5BNOA 1DZRA 5GJ6A 1VAMA 3GM8A 4K7JA 4XFCA 1LB2A 2UU8A 1ZA7A 3DUIA 1HKDA 2WFPA 3KB5A 3P1IA 3R4DB 5FDBA 1RJ7A 3DF0A 2CAUA 2CHHA 5FPVA 4A41A 5FQ0A 2K2SA 5DUXA 3WG3A 3LE0A 3RGBA 4QM9A 3S6PA 4MXWB 4Z07A 4MX3A 3UJOA 1HRV3 2Y8KA 1BHGA 4Z2WA 3FHIB 4DXZA 1KS5A 2JDUA 2VZ1A 1A34A 1QMJA 4AFDA 1O59A 2XHKA 1JTZX 4UT5A 3RI9A 4COYA 3RZJA 2YGLA 2E31A 3SC7X 3T09A 2VJXA 1YEWA 3NJZA 2UY8A 1FMD1 1EPZA 2RDSA 3KCXA 4LBQD 3HR9A 1D4VB 1PX3A 3C7FA 2XJVA 4GB31 5FZKA 5A7QA 5GZFA 2YC4A 1ULEA 4Q0PA 1PM7A 5DDJ3 2ZGOA 2OS2A 2A1XA 5K9YA 3T2PA 1O8SA 3OBAA 2VQ0A 3AJYA 3RJRA 1MEC2 3KZ4C 4IEPA 4RR3A 4UFHA 1NYWA 1ZBA3 2V4AA 3JD72 4L97A 1GMMA 4IGPA 4JKKA 1ENRA 2EIEA 2VZOA 3LB9A 1GICA 3OBTA 5FY9A 1JZ6A 3U07A 1F4HA 1GP5A 4GXLA 3MF9A 2A6WA 2PHDA 1PVC2 2J22A 2WRAA 3B7MA 1HRI1 4N9IA 3AFKA 1BK0A 3LWCA 5FQ0B 4RS5A 3OEAA 4QX8A 4DFSA 1W8TA 1ZBE1 2VNOA 3BOWA 4NHXA 2FDHA 3VD7A 2RHPA 2VUDA 2HKXA 2Q8DA 3LD8A 5BNPC 1XNAA 3A7QA 5F6LB 3ENRA 3WLUA 1QXPA 1PM4A 1T6GC 3N7LA 3PDQA 1MPXA 2E53A 3WW3A 5A3WA 4AE2A 1NY72 1WMEA 3GALA 3IDAA 4AVTA 1NXD1 5IVVA 4Y20B 5F6KA 1UXXX 1DGWA 1U5XA 5HCHA 2VQTA 4Y1UA 3ZMOA 2ZHKA 1QNWA 1QY4A 3GHMA 1QDOA 1HB3A 2EF6A 2IXHA 1OH3A 4LKSA 1UYPA 1PO13 2WAOA 4O61A 2ZZJA 3LOIA 1WMDA 3POFA 3J7MA 5CISA 4RGAA 5FYHA 1WBLA 2BW8A 1O4YA 1YO8A 1K5JA 4AQTA 5C71A 4FAGA 4B7KA 2Q1MA 5FK7A 2ETEA 1UOFA 2BGOA 1F15A 3T0BA 1PZ9A 4KGQA 4PJYA 1DYPA 5J09A 4BQ3A 4BXFA 4NIDA 3UGGA 5F7UA 1DDLA 1KEXA 4PQQA 2EIGA 3D0JA 4B7EA 3QOPA 2IC1A 4PIXA 1CVNA 4UWDA 4WZCA 3VDDC 4A6SA 5F3EA 2JE8A 4AFAA 4Q4X1 1SBEA 4YG6A 2W1WA 5DG1A 2K46A 5GZDA 2DVFA 4L0PA 1CAUA 1MS4A 1DQ4A 3LGRA 4ZU5A 1RUNA 3OGJA 4CU6A 1ZYBA 3I2DA 5LA1A 2VZTA 3OTFA 2FZ1A 3MLJA 1QH6A 2WZR3 2WC2A 3KSCA 5SV8A 4HONA 3VBRC 3ZSKA 4U2AA 3I97A 1UZYA 5KXCA 4NIIA 4LJHA 2JJ6A 1LU2A 2ZX3A 4AQ6A 4CA9A 4COZA 4IE0A 2DUOA 5IW0A 4YRDA 5DUVA 4YZ2A 2XUMA 3IMMA 2PHWA 2Z5WA 2WR9A 4MGZE 4YVSC 4AAPA 5FO7B 4J25A 1VBB3 4BOWA 1O3QA 3MIHA 1YJKA 2B9VA 4XXPA 4FPJA 1ZBE2 3GNEA 4URAA 4OZXA 3UKTA 2JE7A 4P5YA 2X53S 4HKWA 3VZJA 3FZ3A 3N9PA 4P9XA 4BCUA 2BQPA 3AL6A 4RFT0 1DQ1A 3KCYA 4CDXA 2ADDA 4CEYC 1UWWA 1LAJA 1WCQA 1CPNA 5HXMA 3OUHA 3ZN6B 1HXS3 3N9OA 1MQTC 1VMJA 3SH4A 1L3JA 2DFBA 1WBFA 3N35A 4XVHA 1OA3A 3PUSA 4LQRA 1GZ9A 4BQWA 3ZFFA 3KT7A 1HRV1 3KHCA 1VBE3 2EVXA 4FAHA 1MS3A 1BKZA 1PMJX 2R1BA 3DEMA 1Q8VA 1PK6C 2YROA 1C8M2 2VVFA 1RUD3 3AMNA 1Q8QA 1D0GA 2VNVA 4QM8A 4FOWA 4IEYA 1SLAA 5FZMA 4XTMA 3WF3A 4QAWA 3RSJA 2HWE1 2XL7A 2XXZA 4UYBA 3N36A 3LPGA 3VB9A 2Y0OA 3BB6A 3H1WA 2QQLA 2DVDA 2BNOA 3PU8A 4OLLA 2QUOA 3FE5A 4WVZA 4TXWA 5IATA 4O65A 1PO21 4P9WA 3X29B 5A7WB 4AQ2A 2X10A 4IEXA 3DV8A 4C91A 5FR3A 1LODA 1RUG1 3IAPA 3WG2A 5ERLA 2YFZA 2B39A 4E8CA 3AXEA 4KGGA 5I8YA 1H6YA 4QPIA 4XJZA 2JG9A 2R072 1VALA 1LJ7A 2E32A 2XB6C 3T3YA 1CESA 1ND2C 4XBNA 1VBE1 1RHI2 3DXTA 1FNZA 1MS1A 1QU0A 1R1A3 2ORZA 2YV8A 4H7LA 4ZXKA 2XHNA 5A32A 4QGNA 1YWKA 5DABA 5J48A 3AFGA 3HJRA 1PIV1 2RDRA 3ROUA 1H2LA 1OVPA 4BMEA 1MQTA 4FFGA 1MS5A 5FYZA 3ATGA 3N9NA 4DEQA 2YGMA 3LDBA 4LHNA 2OZ6A 5C3PA 3WCSA 4NR1A 4NN0A 4LBQB 1POV3 5FKCA 3HN3A 1NE6A 2IXLA 5A1LA 5LZ6A 1HXS2 2YB7A 4AK3A 2AR6A 1JS9A 5FREA 1CJPA 1CPMA 4RS5B 4TLFA 2BFUS 2F17A 4LBOA 3USSA 2PLV3 1VBA3 1RC6A 3OUJA 1UIKA 2XKOA 1K45A 4XW3A 3SXWA 5B2GB 3Q8FA 1WCKA 2R49A 4L8QA 4MLOA 4XQ4A 1N1YA 5B4XA 2VZSA 4ASKA 1OFNA 4XFBA 1I5PA 1C8NA 5LBCA 2JD4A 5HCFA 1CZTA 2O0OA 1DP0A 4AI1A 1ENQA 1FOD3 4IE4A 4A44A 2ARAA 1XRUA 2XR4A 1GV9A 3TOJA 5BNOB 1JUIA 1QF3A 4S2GA 1OH4A 5BPXA 3I59A 1RUG3 3SCHA 4D69A 3TYJA 2NQYA 3H50A 3GBGA 4TLGA 4X6QB 5KHJA 1B35A 2JDKA 3I4IA 1W2UA 2YHJA 4QWNA 4GIQA 1M4WA 5JAXA 4YWAA 3U10A 4CTEA 2D98A 5ANNA 4YG0A 5C4WC 1DQ2A 2C26A 4CDQC 3B00A 3CBNA 3D82A 4LA3A 1UU4A 1NXMA 4IDZA 4XFGA 5EQUA 3SH5A 1UW8A 2Y26A 4DRVA 3LCPA 4ZS2A 3AMMA 3AKQA 1OF4A 4HMZA 3O1OA 5F39A 4YARA 4Z2AA 4HXCA 2LM3A 3BUCA 4ZY9A 3PVBB 1ASJ1 4MOAA 3UGHA 2QQIA 3RQ0A 2KD7A 2VTXJ 5C9AB 5KR7A 5FZ7A 5A3LA 4LHKA 5CADA 1AR62 1E5IA 3WNOA 1WCSA 1DQ5A 5F8PA 4CCCA 3NNJA 1OFSA 3KCCA 4LOTA 2C9KA 2QVSB 4PQ9A 5F5AA 4V2WA 4I2OA 2P3IA 4AEKA 1JYWA 2QQPA 1O3SA 2AACA 5FKBA 5EV7A 1MR5A 2WN3A 4TYSA 3LSEA 2R30A 4YW7A 1IQAA 1WZXA 2GNDA 4K9SA 3CKHA 1VBC1 4IV1C 2QFEA 5DAVA 1F5JA 2DTWA 4PBOA 3I59B 5FPBA 3KF3A 1QJY2 2GP5A 1TEIA 2YPDA 4J1WA 4M00A 2CAVA 3N7MA 5JUVA 4Q0VA 2R7EB 5I0RA 2H6CA 1MZEA 3QCWA 5IFTA 5LASA 1AX0A 1F35A 1ONAA 1WUVA 2DVAA 5EP9A 5JOYA 4GB32 3THCA 3C7GA 4A2UA 1AR71 4XIOA 1REFA 5IVCA 4O7XA 4E2SA 5C7GA 2XBO1 3VHOA 3ZFEA 3KGZA 4XDQA 4UW5A 1POV0 1VB4A 2FD8A 4A42A 3ZOIA 4Q4Y1 4CXYA 4E4DX 5F2WA 3WW2A 1OLQA 1MS9A 3CQOA 3HT2A 2J1TA 2R042 2WA4A 3PLQA 3T30A 1RMU1 4YW4A 3VBRA 2PQSA 1JZ4A 5CU1A 3AJZA 1SHWB 4JGZC 1UY3A 1W8HA 2QDRA 2MEV1 1L7LA 5FAXA 5BV6A 2P3YA 4FXGB 2VOVA 2DCJA 5FFOC 3TEWA 1XYPA 3FJSA 1NA1C 5FCCA 1AF9A 5DDJ2 4ASLA 3I2OA 1W9TA 4XJUA 4XUNA 1WW4A 2Y6LA 4XDOA 1BLZA 5FYUA 2QQJA 2W1QA 1NA1B 3NJYA 4OVEA 4YW1A 1J84A 4JDNA 2JKBA 4LNVA 1ULFA 4SLIA 4Q2FA 5A33B 2HWC2 1A8DA 5IK5A 2WABA 5DPNA 2DU0A 3PUAA 2EIDA 3L9JT 2JECA 1ULGA 1CX4A 3EBRA 3VDAA 1H8TC 4AYUA 1ZRDA 2BBAA 4CDWB 2VVDA 1VMFA 4XABA 4QHZA 5BY5A 4FOQA 3POYA 3KVBA 1YHFA 3M8LA 5J3UA 1SCRA 4D6SA 1FNYA 1AR61 2SLIA 4LHLA 1V6IA 3GXUA 2AUYA 4KG8A 3OY8A 1RTVA 3JZVA 4GWMA 5E1RA 2GN3A 3QH7A 4S2HA 1NAEA 5AC93 1JZ7A 3H3ZA 1K5MB 4J6GA 1MVQA 3H8OA 2P34A 2J42A 3WDWA 2QZ3A 4FFIA 4INDA 4DQAA 4QHBA 3TEXA 1VBC2 1OLMA 2E33A 3ZR5A 1R083 3DN7A 2HWE3 4M3CF 2W0XA 3ZIXA 2ZABA 5LA2A 1CQ9A 2G9GA 4CDXC 2EAAA 2IZWA 1SLIA 2Z2SB 3AYCA 2WLQA 4XZUG 3U14A 5ABJB 3MF6A 4Y24A 2BDRA 3OGSA 5FMDA 3LEKA 1LHOA 2UWAA 1UU5A 3BI3A 4PDWC 4QPYA 1W99A 2LS6A 1JI6A 1W9YA 3ABZA 1OI6A 5IAVA 4AAXA 1ASJ2 2YUEA 2D93A 4NUBA 3VZNA 4AHZA 4CEWA 3S5QA 5FZOB 1S0CA 3CLPA 1VE0A 5KHHA 1BVP1 1WW7A 4JGYC 1J83A 2JDYA 2WO1A 4YVSA 4YYOA 4M0HA 2XGXA 4ET7A 4Q4V2 1SPPB 1GWLA 1V00A 4NIGA 3FX3A 3VBSC 2QNKA 2Y60A 4AWDA 4BA6A 1TG7A 3ZYPA 3M7AA 3ECQA 5A3PA 3VBSB 2GC0A 4CP9A 1CAUB 3Q8CA 2OUHA 1XNCA 2J1VA 2PHXA 4UFLA 5FYCA 3WP3A 1QH7A 1V6MA 1S2KA 2W52A 3OSDA 4LK6A 1S1AA 4CCLA 4R8HA 3SNMA 3PJQA 1ND2A 1HDKA 3OEBA 2Q8CA 3PVOA 3FFZA 1A3KA 1WW5A 2GMEA 1GQGA 4WVWA 4Y33A 3VDDA 5C9AA 3O1TA 3IDCB 1AUYA 5GZGA 3MUZ1 3O5SA 3T0AA 1W6NA 3E6BA 3H7JA 1YQ6A 2E7TA 3C3VA 4B8EA 1W6PB 4HN1A 1RVF2 2BOJA 2WS93 1GOGA 2ZMNA 1U0AA 1IPJA 3TB0A 1RUC1 4QU1A 1UMHA 1H9PA 1WLTA 2I2SA 4FPLA 3VKFC 5J1XA 5EIYB 1OF3A 1V6OA 4W65A 5C70A 3ZXAC 5CFCA 1FX5A 5FXZA 2E51A 3ZKYA 4KU8A 2UWCA 4CU9A 4EN8B 2ZGUA 1OPMA 4Q5OA 5T5OA 3SLIA 4DUXA 3KT4A 1HB1A 2BZDA 4FPGA 4ES9A 3Q9OA 4BIOA 3T2TA 2IXKA 4I01A 1OLME 3QACA 4UI9L 2AZ5A 2YBPA 2ZGNA 4C1WA 4V2VA 2CV6A 2P1BA 1JYIA 5JIAA 1NLRA 4P14A 4WM8B 5FXWA 4RN5A 4NHMA 3WDUA 5F5QA 4LKEA 4WVVA 4NPRA 2KA3A 4MGKE 4BXSV 1QQP1 4UFKA 4YW2A 4IXLA 1PIV2 1SG3A 2A7AA 1LNSA 2LALA 3E5XA 1R64A 3WUCA 3POSA 5K4LA 4CRQA 4KWKA 1PO22 2BVBA 2CDPA 4E27A 2B5HA 5J98B 5LK7B 4FTBA 1NLQA 5C8CB 1LOEA 1GNHA 2WSUA 1BYHA 4NROA 2V09A 4RR3B 2CGNA 3THDA 3U37A 3P5BA 1AYM3 1W8FA 5C8CC 2EICA 3LF7A 5FLHA 4AVSA 3ALQA 3VZLA 5CAZA 2VMHA 5CYYA 4CU8A 3V0BB 1CZVA 1WW6A 4NAOA 1HJGA 3INAA 3WP6A 2GZWA 3O1PA 2CWSA 2FDIA 1W6OA 1S2BA 5K0UB 3RNSA 3A0KA 2E7AA 1GFF2 5FZIA 2ILMA 5FBJA 5KHGA 5FZOA 4TZDA 2JIGA 2GNTA 1BZWA 4A6OA 3NO8A 3WG4A 5K0UC 5JR2A 1QJEA 4R9DA 2XBO3 4XEZA 3OOXA 3ZYRA 4EJRA 2ZKLA 2GC1A 4XF1A 4LT5A 3N9LA 4FI9A 2OKXA 4LBJA 4JKLA 5IVFA 5KHKA 2VBPA 5GZCA 2HH9A 2LROA 4D94A 4OQ8A 2BBVA 1GZWB 5FZBA 4N7UA 1W0OA 3H7YA 2HWD1 2TUNA 1ULCA 1SMVA 1Y9MA 1AL0G 4HVOA 2A6VA 2RR13 1YFYA 4IETA 3NNLA 3NL1A 1A78A 2EA7A 3D3AA 1HQNA 4YM3A 4TTGA 1VLNA 4YVWC 4D6RA 5DUUA 5C5UA 4QB2A 5FZ6A 2LUWA 5CFCB 3IT8A 2JG9C 5I8SA 1R092 3FHAA 4SBVA 4LULA 3SH3A 3VBUA 4CDQB 4UFMA 4D7SA 2ID4A 3ACFA 4FPHA 4JTNA 4F3JA 2JG9B 1F8VA 2DBNA 2VZ3A 2Q30A 2ZEYA 4RSUA 1RJ8A 3TBDA 1W8UA 3WNPA 4NAMA 1UAIA
chains in the Genus database with same CATH topology
3UETA 2BGOA 3T0BA 2J1EA 3K4ZA 5F7UA 1KEXA 1CX1A 4PQQA 3FN9A 3WSOA 3PUIA 2WQ8A 2Y6GA 5DMYA 2JE8A 3C7HA 3K75B 2QQNA 2W1WA 4L0PA 2BERA 4CU6A 4YPJA 5LA1A 2VZTA 1OT5A 1GOHA 1JU4A 3EYPA 1W9WA 4OMCA 2VC9A 4CU7A 3WNNA 2WZEA 2DDUA 2VZPA 3NNGA 3I97A 3VD3A 3ACIA 4QDRA 1DLCA 3VD9A 3AC0A 2RJ2A 1UYXA 2WUHA 4OZOA 3WF0A 3CMGA 4QPWA 4XURA 3DYPA 3OGVA 2B9VA 1UXZA 3T08A 1UZ0A 4ZZ8A 4D0QA 4DUWA 2J1AA 3A21A 4P5YA 3T0DA 1UWWA 1WCQA 5HXMA 4E8DA 4QDSA 1JZ3A 4XVHA 3I2HA 4XUOA 1YQ2A 4M4PA 1UMIA 4LQRA 3WNKA 1JHJA 4W4ZA 1PMJX 4KMQA 5IFPA 3MO4A 3J7HA 5DN2A 5JXIA 3T2OA 1ULPA 4BK4A 3K4AA 2WBKA 2VZRA 4ZZ5A 3WF3A 4QAWA 3LPGA 2VCCA 2VTFA 2QQLA 2W47A 4TXWA 3C8XA 2X10A 3HEIA 4LPLA 2VL4A 3VDBA 2VMFA 3IAPA 3OG2A 1GOFA 1T2XA 2YFZA 1K42A 2V72A 4E8CA 1H6XA 1NX9A 1H6YA 4ARXA 2J1UA 2E32A 2EIBA 4A45A 2J1RA 3WNPA 2ORZA 2LW8A 2XHNA 5IYYA 4QX2A 1JZ8A 2QQOA 4HG6B 3HJRA 3CZUA 1WKYA 3LQCA 2W91A 4DEQA 3WNLA 2RV9A 3A22A 4UOJA 4MGQA 1UY2A 3LPFA 4ZXEA 2W3JA 2VMCA 3HN3A 1O8PA 3CDZB 2QQMA 2YB7A 4JHZA 3K77A 1K45A 2WN2A 2ZEZA 4UAPA 5B4XA 2B4KA 2VZSA 3W5NA 1I5PA 2VOTA 1CZTA 1DP0A 4A3ZA 4A44A 2W46A 1OH4A 2W1UA 2JDAA 2Y6JA 3MV01 2VMEA 1US3A 2C26A 1L7RA 2X09A 3NRUA 5EJZB 5FUIA 1OD3A 2VQUA 1K3IA 1UY1A 1OF4A 2VM9A 2VCAA 1XPWA 4Z2AA 2CDOA 2VR4A 2YFUA 2W87A 3I3BA 4ZY9A 4MOAA 2QQIA 2KD7A 3I3DA 2JD9A 3WNOA 1UY0A 3SKJE 3SEEA 3NJVA 1DYOA 2C9KA 2Y6KA 1JYNA 2W95A 3UNPA 4JKMA 1JYWA 2WN3A 2WDBA 4JX0A 5G04L 3CKHA 4XUQA 3NQHA 3DYOA 1UX7A 1UYYA 3I2GA 4ARYA 4BDVB 3CIHA 5JUVA 2R7EB 2XQXA 5IFTA 3THCA 4CUCA 3C7GA 3EB7A 3ACHA 1EUTA 5C7GA 3FL7A 2Y64A 5JMOA 4A42A 4CVUA 3C7OA 2VZQA 3A23A 5JXGA 3JXSA 2J1SA 4GWIA 3CQOA 4KWUA 5CZKA 3DECA 2J1TA 2VZUA 2DCKA 4DEVA 3VDCA 2QBXA 3HNMA 4MGSA 1JZ4A 2PQSA 4DXRA 1SHWB 3MBWA 1UY3A 1W9SA 2DCJA 1D7PM 3I2JA 1GU3A 5I0DA 3UESA 1W9TA 2QQKA 3T2QA 4XUNA 2Y6LA 2QQJA 2W1QA 5LCWL 2XOMA 3F2ZA 1J84A 1P8JA 4P08A 2WO2A 4W8JA 5LA0A 2WZ8A 2WABA 5DPNA 3IAQA 2EIDA 4GZ9A 3I2FA 4QX0A 1GNYA 4BJ0A 3VDAA 4QX3A 2BBAA 5JXHA 2W9XA 1W8OA 1XNTA 3DYMA 3W5MA 2W1SA 5A1AA 2ORXA 3ZM8A 3C7EA 3GXUA 3MV11 1JZ7A 1NAEA 1SDDB 2V4VA 4A4AA 1GUIA 4IUGA 2YC2A 4MADA 2E33A 5IHRA 5LA2A 2WYSA 4XZUG 4CUBA 4KI5M 2C4XA 1CZSA 4XUPA 3OGSA 3LEKA 4MO3M 2VZVA 5DQ0A 4AG4A 1W99A 2LS6A 3VD4A 1JI6A 3ABZA 4AAXA 3CZJA 1HN1A 4RYDA 1W0NA 3I3EA 4PT6A 3VD5A 1JZ2A 2W5FA 1J83A 2WO1A 4ET7A 4XUTA 2VMDA 3OGRA 5JXJA 5IJRA 3SEPA 4P02B 4M4RA 1TG7A 3IB3A 3P6BA 3ECQA 1K12A 1PMHX 3HPNA 3WEZA 1US2A 3WF4A 2J1VA 4QB1A 4OYUA 5G05L 4DXSA 3LEIA 1NKGA 3GGLA 1JYXA 1PX4A 3OEBA 2HLEA 2ZEXA 1ULOA 5B4NA 2W94A 3MUZ1 3T0AA 1RYYA 3LEGA 4GWJA 1GOGA 3BGAA 1NUKA 2ZXQA 4OUEA 1UMHA 4QX1A 5J1XA 5EIYB 1GQPA 1OF3A 2L9LA 5EJ1B 1W8NA 3BN6A 3K46A 4DXTA 4DUVA 5C70A 2RVAA 3WF1A 3MUY1 2Y6HA 1IQDC 4W50A 1EUUA 4LHSA 3HNBM 1XC6A 4DUXA 1CIYA 2BZDA 2V5DA 3ETPA 3NJXA 1JZ5A 3GM8A 4OMDA 3SKVA 4UI9L 3P1IA 4A41A 4RN5A 3LE0A 4BK5A 4BXSV 1SG3A 4PF1A 1LNSA 3E1F1 2Y8KA 1R64A 1BHGA 2CDPA 3WF2A 4P00B 2VCBA 4CU9A 2ZEWA 2VZ1A 1JYVA 1O59A 3THDA 3U37A 4CUAA 2E31A 3T09A 2VO5A 2VJXA 2EICA 3GDBA 2WAAA 4CU8A 5CYYA 1L7QA 4D8MA 1CZVA 1PX3A 3C7FA 2YC4A 2BGPA 2JKXA 3T2PA 1KGYA 1O8SA 3OBAA 2YG0A 2X05A 2J7MA 3IIIA 1UYZA 1GMMA 4JKKA 4QDQA 1UY4A 3FHQA 2EIEA 2VZOA 1JZ6A 2WO3A 1F4HA 3OB8A 4A6OA 1TVGA 5JR2A 2J22A 3K4DA 4FI9A 2E26A 2OKXA 4JKLA 3OEAA 3VD7A 1XNAA 5HPOA 3A7QA 2W92A 3HNYM 4QB6A 1MPXA 3IDAA 3D3AA 2Z4FA 4TTGA 3I2KA 1F4AA 1UXXX 3WNMA 2VQTA 4QB2A 3PUHA 3FHAA 1JU3A 4LKSA 2ID4A 2XONA 3ACFA 3I2IA 2WAOA 3HOBA 2VZ3A 2ZEYA 2HYXA 5C71A 3ACGA 3WQBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UET A;  2BGO A;  3T0B A;  2J1E A;  3K4Z A;  5F7U A;  1KEX A;  1CX1 A;  4PQQ A;  3FN9 A;  3WSO A;  3PUI A;  2WQ8 A;  2Y6G A;  5DMY A;  2JE8 A;  3C7H A;  3K75 B;  2QQN A;  2W1W A;  4L0P A;  2BER A;  4CU6 A;  4YPJ A;  5LA1 A;  2VZT A;  1OT5 A;  1GOH A;  1JU4 A;  3EYP A;  1W9W A;  4OMC A;  2VC9 A;  4CU7 A;  3WNN A;  2WZE A;  2DDU A;  2VZP A;  3NNG A;  3I97 A;  3VD3 A;  3ACI A;  4QDR A;  1DLC A;  3VD9 A;  3AC0 A;  2RJ2 A;  1UYX A;  2WUH A;  4OZO A;  3WF0 A;  3CMG A;  4QPW A;  4XUR A;  3DYP A;  3OGV A;  2B9V A;  1UXZ A;  3T08 A;  1UZ0 A;  4ZZ8 A;  4D0Q A;  4DUW A;  2J1A A;  3A21 A;  4P5Y A;  3T0D A;  1UWW A;  1WCQ A;  5HXM A;  4E8D A;  4QDS A;  1JZ3 A;  4XVH A;  3I2H A;  4XUO A;  1YQ2 A;  4M4P A;  1UMI A;  4LQR A;  3WNK A;  1JHJ A;  4W4Z A;  1PMJ X;  4KMQ A;  5IFP A;  3MO4 A;  3J7H A;  5DN2 A;  5JXI A;  3T2O A;  1ULP A;  4BK4 A;  3K4A A;  2WBK A;  2VZR A;  4ZZ5 A;  3WF3 A;  4QAW A;  3LPG A;  2VCC A;  2VTF A;  2QQL A;  2W47 A;  4TXW A;  3C8X A;  2X10 A;  3HEI A;  4LPL A;  2VL4 A;  3VDB A;  2VMF A;  3IAP A;  3OG2 A;  1GOF A;  1T2X A;  2YFZ A;  1K42 A;  2V72 A;  4E8C A;  1H6X A;  1NX9 A;  1H6Y A;  4ARX A;  2J1U A;  2E32 A;  2EIB A;  4A45 A;  2J1R A;  3WNP A;  2ORZ A;  2LW8 A;  2XHN A;  5IYY A;  4QX2 A;  1JZ8 A;  2QQO A;  4HG6 B;  3HJR A;  3CZU A;  1WKY A;  3LQC A;  2W91 A;  4DEQ A;  3WNL A;  2RV9 A;  3A22 A;  4UOJ A;  4MGQ A;  1UY2 A;  3LPF A;  4ZXE A;  2W3J A;  2VMC A;  3HN3 A;  1O8P A;  3CDZ B;  2QQM A;  2YB7 A;  4JHZ A;  3K77 A;  1K45 A;  2WN2 A;  2ZEZ A;  4UAP A;  5B4X A;  2B4K A;  2VZS A;  3W5N A;  1I5P A;  2VOT A;  1CZT A;  1DP0 A;  4A3Z A;  4A44 A;  2W46 A;  1OH4 A;  2W1U A;  2JDA A;  2Y6J A;  3MV0 1;  2VME A;  1US3 A;  2C26 A;  1L7R A;  2X09 A;  3NRU A;  5EJZ B;  5FUI A;  1OD3 A;  2VQU A;  1K3I A;  1UY1 A;  1OF4 A;  2VM9 A;  2VCA A;  1XPW A;  4Z2A A;  2CDO A;  2VR4 A;  2YFU A;  2W87 A;  3I3B A;  4ZY9 A;  4MOA A;  2QQI A;  2KD7 A;  3I3D A;  2JD9 A;  3WNO A;  1UY0 A;  3SKJ E;  3SEE A;  3NJV A;  1DYO A;  2C9K A;  2Y6K A;  1JYN A;  2W95 A;  3UNP A;  4JKM A;  1JYW A;  2WN3 A;  2WDB A;  4JX0 A;  5G04 L;  3CKH A;  4XUQ A;  3NQH A;  3DYO A;  1UX7 A;  1UYY A;  3I2G A;  4ARY A;  4BDV B;  3CIH A;  5JUV A;  2R7E B;  2XQX A;  5IFT A;  3THC A;  4CUC A;  3C7G A;  3EB7 A;  3ACH A;  1EUT A;  5C7G A;  3FL7 A;  2Y64 A;  5JMO A;  4A42 A;  4CVU A;  3C7O A;  2VZQ A;  3A23 A;  5JXG A;  3JXS A;  2J1S A;  4GWI A;  3CQO A;  4KWU A;  5CZK A;  3DEC A;  2J1T A;  2VZU A;  2DCK A;  4DEV A;  3VDC A;  2QBX A;  3HNM A;  4MGS A;  1JZ4 A;  2PQS A;  4DXR A;  1SHW B;  3MBW A;  1UY3 A;  1W9S A;  2DCJ A;  1D7P M;  3I2J A;  1GU3 A;  5I0D A;  3UES A;  1W9T A;  2QQK A;  3T2Q A;  4XUN A;  2Y6L A;  2QQJ A;  2W1Q A;  5LCW L;  2XOM A;  3F2Z A;  1J84 A;  1P8J A;  4P08 A;  2WO2 A;  4W8J A;  5LA0 A;  2WZ8 A;  2WAB A;  5DPN A;  3IAQ A;  2EID A;  4GZ9 A;  3I2F A;  4QX0 A;  1GNY A;  4BJ0 A;  3VDA A;  4QX3 A;  2BBA A;  5JXH A;  2W9X A;  1W8O A;  1XNT A;  3DYM A;  3W5M A;  2W1S A;  5A1A A;  2ORX A;  3ZM8 A;  3C7E A;  3GXU A;  3MV1 1;  1JZ7 A;  1NAE A;  1SDD B;  2V4V A;  4A4A A;  1GUI A;  4IUG A;  2YC2 A;  4MAD A;  2E33 A;  5IHR A;  5LA2 A;  2WYS A;  4XZU G;  4CUB A;  4KI5 M;  2C4X A;  1CZS A;  4XUP A;  3OGS A;  3LEK A;  4MO3 M;  2VZV A;  5DQ0 A;  4AG4 A;  1W99 A;  2LS6 A;  3VD4 A;  1JI6 A;  3ABZ A;  4AAX A;  3CZJ A;  1HN1 A;  4RYD A;  1W0N A;  3I3E A;  4PT6 A;  3VD5 A;  1JZ2 A;  2W5F A;  1J83 A;  2WO1 A;  4ET7 A;  4XUT A;  2VMD A;  3OGR A;  5JXJ A;  5IJR A;  3SEP A;  4P02 B;  4M4R A;  1TG7 A;  3IB3 A;  3P6B A;  3ECQ A;  1K12 A;  1PMH X;  3HPN A;  3WEZ A;  1US2 A;  3WF4 A;  2J1V A;  4QB1 A;  4OYU A;  5G05 L;  4DXS A;  3LEI A;  1NKG A;  3GGL A;  1JYX A;  1PX4 A;  3OEB A;  2HLE A;  2ZEX A;  1ULO A;  5B4N A;  2W94 A;  3MUZ 1;  3T0A A;  1RYY A;  3LEG A;  4GWJ A;  1GOG A;  3BGA A;  1NUK A;  2ZXQ A;  4OUE A;  1UMH A;  4QX1 A;  5J1X A;  5EIY B;  1GQP A;  1OF3 A;  2L9L A;  5EJ1 B;  1W8N A;  3BN6 A;  3K46 A;  4DXT A;  4DUV A;  5C70 A;  2RVA A;  3WF1 A;  3MUY 1;  2Y6H A;  1IQD C;  4W50 A;  1EUU A;  4LHS A;  3HNB M;  1XC6 A;  4DUX A;  1CIY A;  2BZD A;  2V5D A;  3ETP A;  3NJX A;  1JZ5 A;  3GM8 A;  4OMD A;  3SKV A;  4UI9 L;  3P1I A;  4A41 A;  4RN5 A;  3LE0 A;  4BK5 A;  4BXS V;  1SG3 A;  4PF1 A;  1LNS A;  3E1F 1;  2Y8K A;  1R64 A;  1BHG A;  2CDP A;  3WF2 A;  4P00 B;  2VCB A;  4CU9 A;  2ZEW A;  2VZ1 A;  1JYV A;  1O59 A;  3THD A;  3U37 A;  4CUA A;  2E31 A;  3T09 A;  2VO5 A;  2VJX A;  2EIC A;  3GDB A;  2WAA A;  4CU8 A;  5CYY A;  1L7Q A;  4D8M A;  1CZV A;  1PX3 A;  3C7F A;  2YC4 A;  2BGP A;  2JKX A;  3T2P A;  1KGY A;  1O8S A;  3OBA A;  2YG0 A;  2X05 A;  2J7M A;  3III A;  1UYZ A;  1GMM A;  4JKK A;  4QDQ A;  1UY4 A;  3FHQ A;  2EIE A;  2VZO A;  1JZ6 A;  2WO3 A;  1F4H A;  3OB8 A;  4A6O A;  1TVG A;  5JR2 A;  2J22 A;  3K4D A;  4FI9 A;  2E26 A;  2OKX A;  4JKL A;  3OEA A;  3VD7 A;  1XNA A;  5HPO A;  3A7Q A;  2W92 A;  3HNY M;  4QB6 A;  1MPX A;  3IDA A;  3D3A A;  2Z4F A;  4TTG A;  3I2K A;  1F4A A;  1UXX X;  3WNM A;  2VQT A;  4QB2 A;  3PUH A;  3FHA A;  1JU3 A;  4LKS A;  2ID4 A;  2XON A;  3ACF A;  3I2I A;  2WAO A;  3HOB A;  2VZ3 A;  2ZEY A;  2HYX A;  5C71 A;  3ACG A;  3WQB A; 
#chains in the Genus database with same CATH topology
 1CAX A;  4B1M A;  1VR3 A;  1D2Q A;  1YI9 A;  5EXO A;  1A8M A;  2X8K A;  3V56 A;  2WZR 2;  2VBB A;  1AHS A;  1QQP 2;  3GCX A;  4CCK A;  2J1E A;  2P6H A;  1M06 G;  3IIA A;  4AOC A;  4B3N A;  4FFH A;  3FN9 A;  4RGG A;  1N3O A;  3PUI A;  1Q56 A;  3MGU A;  1ND3 B;  4OI1 A;  1FAY A;  4YFZ A;  3BTY A;  1LGB A;  3C7H A;  1SDW A;  3BAL A;  1ND3 C;  1REE A;  3K75 B;  4MUV A;  4PIY A;  1CR7 A;  4XQD A;  4H2A A;  4Y5S A;  2K9Z A;  1W90 A;  3WQ0 A;  5L9R A;  1XXN A;  2WNO A;  4IV1 B;  3FBM A;  4RGK A;  4EN0 A;  3JU9 A;  3ZSL A;  5DAP A;  1EP0 A;  1G9F A;  3WNN A;  2YDE A;  2G4I A;  3NNG A;  3RFR A;  4IQP A;  2ENR A;  3VD3 A;  5JCT A;  2YU2 A;  2BGC A;  4JGY A;  3VGI A;  4K1Z A;  4FCA A;  2RJK A;  4IE6 A;  1V9U 2;  2RJ2 A;  3AP4 A;  2Q8O A;  4S2D A;  4WV8 A;  5F2S A;  4UFI A;  5A7N A;  3BIE A;  4KNC A;  4QPW A;  4Q4W 1;  4XUR A;  3MZH A;  5F5C A;  1TME 2;  2D43 A;  4PDW A;  1J58 A;  4JQR A;  1UZ0 A;  2QKD A;  3J4U H;  2XUE A;  3IDB B;  4L2N A;  4ZZ8 A;  3POE A;  5ABJ A;  1IG0 A;  1FMD 3;  5FYY A;  5EYX A;  3AKS A;  2XLA A;  4CCD A;  3LEM A;  4RD7 A;  4HVQ A;  3I2H A;  3UKV A;  1YQ2 A;  3IM0 A;  2FMD A;  4M4P A;  1UMI A;  4XYX A;  1OQE A;  4CDW C;  2FDK A;  1ZZ8 A;  3ZXD A;  1VBD 1;  3HMY A;  2YBS A;  3WNK A;  3VBU B;  3TEZ A;  3VDB A;  4W4Z A;  1GZC A;  4LBL A;  5IFP A;  3J7H A;  2WNU B;  1O6U A;  4FTS A;  2NN8 A;  1WD4 A;  1S0G A;  5A7P A;  1YC6 1;  2VY0 A;  3WNX A;  3W59 A;  5DZF A;  2Q1Z B;  3B5L B;  2BFU L;  3VKN A;  2O1Q A;  5L36 A;  2OXB A;  1BVV A;  5A70 A;  5JMC A;  3HQU A;  4BLJ A;  3APB A;  4NHL A;  4MGY E;  4M01 A;  1AYN 3;  1VBE 2;  1T6B X;  1RVF 3;  2AEY A;  2VL4 A;  3AX4 A;  4LPL A;  2VMF A;  2CL2 A;  2JG8 B;  1SFP A;  2ET1 A;  2WS9 1;  3OG2 A;  1GOF A;  3MLK A;  4IV3 C;  1T2X A;  4LBN A;  4OHZ A;  1KDM A;  2V72 A;  3DPR C;  4G9S B;  4IEQ A;  1DU3 D;  2WLP A;  4YNI A;  4ARX A;  3O12 A;  2HWD 2;  4IL7 A;  5LY1 A;  2EIB A;  3POI A;  4IEO A;  3ZSM A;  4LA2 A;  4Q0S A;  1W6Q B;  2V73 A;  4XJA A;  1NCR B;  5D2A A;  1LUL A;  2QJV A;  3VL8 A;  5C3Q A;  5FOB B;  1UMZ A;  1GR3 A;  1PZ8 A;  1VB2 A;  3WQ1 A;  1C3H A;  2WL1 A;  2ZHM A;  3ITQ A;  4YM0 A;  3U0Z A;  1XU1 A;  1WKY A;  3HQX A;  3KGL A;  3GBF A;  4MH0 E;  2JIC A;  2W68 A;  2RDQ A;  3LQC A;  2CWM A;  2RJL A;  4KWL A;  4NWW A;  3WNL A;  2C5D A;  2RV9 A;  3A22 A;  2JEN A;  1GKB A;  3ES1 A;  4CCO A;  2ET7 A;  4MGQ A;  1N1V A;  5D8A B;  5FYT A;  1UY2 A;  3LPF A;  5FYS A;  4ZXE A;  4N9H A;  3S30 A;  3PUQ A;  3M70 A;  2IFW A;  2QQM A;  2XG3 A;  3GCW A;  2DUQ A;  3VV1 A;  1APN A;  4XAA A;  1WMX A;  3K77 A;  4MVT A;  5FYV A;  1VBB 1;  3WHT A;  1YUD A;  3ORJ A;  2WN2 A;  1PIV 3;  1N1S A;  5T54 A;  2ZEZ A;  4MSV A;  1C1L A;  4UAP A;  2B4K A;  1IPS A;  1TZO A;  2A6Y A;  4I09 A;  1OQ1 A;  4CUG A;  2H0V A;  4LKD A;  5JZG B;  1JOB A;  2ZX0 A;  3W5N A;  3R4S A;  4JDO A;  1EPW A;  3Q8E A;  5JI7 A;  5KC5 A;  3AZW A;  1DGW X;  1ZRC A;  4OQ9 A;  1S0I A;  2LRP A;  1XBF A;  1NT0 A;  4A3Z A;  2DYC A;  5F37 A;  5CIR A;  5D8A A;  4GQ7 A;  1YFW A;  4AGR A;  4E9K A;  2W46 A;  5JSO A;  5HV0 A;  1UNB A;  1HQW A;  4XOG A;  2CTV A;  4FVV A;  4C0H A;  5C8W A;  2JDA A;  2FCT A;  1B09 A;  2P5B A;  2PLV 2;  3RS6 A;  2EAL A;  1LKN A;  3MV0 1;  3PIG A;  4OUL A;  1IS5 A;  1FPN 3;  4MGT A;  2VME A;  3VL9 A;  2AH2 A;  3UV9 A;  3RYP A;  4O9G A;  5H9S A;  5HBA A;  3VKO A;  5FZG A;  4CCM A;  2RMU 3;  5EJZ B;  5L7O C;  2UYA A;  1S0F A;  5FZA A;  3NWK A;  4PIZ A;  5A6Q A;  1CGP A;  1OD3 A;  2VQU A;  4QPG C;  3WQ7 A;  3OUI A;  4DZG A;  2PYT A;  1UY1 A;  3HT1 A;  2QDN A;  5JLV A;  1XPW A;  1ZRF A;  1JYC A;  4CCJ A;  1QJY 3;  2D6O X;  2VH9 A;  2W87 A;  2KM2 A;  3EQE A;  1TME 1;  2BP6 A;  4QPG B;  5GAL A;  3U75 A;  5AFE A;  5BNN B;  3VBF A;  2Q8E A;  1SLL A;  1OUR A;  2XL9 A;  1XB9 A;  1YQ5 A;  2JD9 A;  4GAL A;  5FIX A;  3RZK A;  4GKY A;  5BNN C;  1GBG A;  1N1T A;  3W58 A;  4XCA A;  5FP9 A;  2YU1 A;  1D4M 3;  3H8R A;  1UPI A;  1RUH 1;  4JKM A;  4Z8B A;  4EN6 B;  4BHP A;  2HWB 2;  4JV4 A;  2WDB A;  3BTA A;  3ETQ A;  2VOW A;  2PAE A;  3VKM A;  2ZZQ A;  4XUQ A;  1OA4 A;  3AMQ A;  3NQH A;  1UYY A;  4Q1R A;  4XQW A;  5I0S A;  3HD8 B;  2I45 A;  2DUR A;  3NV2 A;  4QHO A;  1O3T A;  3I2G A;  4ARY A;  4ZHN A;  2A3X A;  4QQ2 A;  2OVU A;  3CIH A;  4XF0 A;  3IBM A;  1AR8 3;  3O14 A;  1Z7S 2;  5LB6 A;  3EMR A;  1JN2 P;  1D0H A;  4CUC A;  1H1A A;  1JBC A;  5I8T A;  1Y43 B;  1AX1 A;  3B3Q E;  3ACH A;  1W28 A;  1VP6 A;  2E7Q A;  3VKL A;  4Q29 A;  1DLL A;  1TMF 1;  3ZMN A;  2Y64 A;  1H2M A;  4N8M A;  1W3X A;  1ZZ7 A;  3DKW A;  5JMO A;  1LOB A;  4ONU A;  2WQ4 A;  4IGQ A;  2GH8 A;  3MEP A;  2YZ4 A;  3C7O A;  1FI2 A;  1ZBA 1;  5T5P A;  5JXG A;  5HV4 A;  4GWI A;  2J1S A;  4JC1 A;  4RR3 C;  5AVP A;  3NAP A;  4W6Y A;  3KV9 A;  4BIS A;  4KBB A;  2RS3 3;  3OYW B;  5CZK A;  5GLW A;  3WDX A;  1J3Q A;  2VZU A;  2Q0A A;  1EAH 3;  4DEV A;  3S57 A;  4GB3 3;  2NM1 A;  1SZB A;  2QBX A;  4MGS A;  2VNG A;  1LTE A;  4AW7 A;  5T5J A;  1W9S A;  1C8M 3;  4OUM A;  2FHR A;  4GWN A;  1YFX A;  2SBA A;  3RZL A;  1D7P M;  2X5I A;  2ZX4 A;  5T55 A;  2FZ2 A;  3B69 A;  5FUP A;  4IV1 A;  3T2Q A;  1C5H A;  5FXV A;  3KF5 A;  2C24 A;  1W2N A;  5LCW L;  1JXN A;  1LOC A;  2XOM A;  4Y3O A;  2JDP A;  4K8F A;  3TNP B;  4CP2 A;  5DAX A;  1SCS A;  5J36 A;  2D3R A;  2WO2 A;  5LA0 A;  5IK8 A;  2R0F A;  1AZD A;  4QGM A;  4CDW A;  3TEY A;  3OBZ A;  1XND A;  2PA7 A;  5FP7 A;  4GZ9 A;  1ACC A;  5C5T A;  1RB8 G;  1PNG A;  4IEV A;  2ATF A;  3FLP A;  1VBC 3;  4EWA A;  1QXJ A;  4QX3 A;  3KQ4 B;  1OKO A;  4GMP 1;  2ZAC A;  4LUK A;  1G86 A;  2GNM A;  1YNA A;  2ERF A;  3W5M A;  3IKW A;  1R1A 2;  3TWI A;  2ZJC A;  5A1A A;  2PAM A;  2Y0I A;  2WNU A;  2G19 A;  3C7E A;  4HSJ A;  3USU B;  5HXV A;  3RJ2 X;  1BBT 3;  2RM2 1;  3MV1 1;  4YVW A;  2P37 A;  1J1L A;  4YZ1 A;  2A75 A;  5FMO S;  1H4G A;  2HWB 1;  5L9B A;  4E4S A;  5IK7 A;  5IVB A;  3MLL A;  4WM7 B;  3RYR A;  3VLB B;  1GUI A;  5J37 A;  5LK5 A;  1X8E A;  1KJL A;  3VBR B;  2A73 B;  2DUP A;  3AKP A;  3W20 A;  1E5H A;  4XTP A;  1SFN A;  5I0U A;  5JOZ A;  3ZYJ B;  5FZ4 A;  2XH6 A;  4BQX A;  4YG3 A;  2XJT A;  3FBY A;  3R4U A;  1NZC A;  4N43 C;  2C4X A;  4XUP A;  1RUE 2;  1RUD 1;  2O8Q A;  1I5Z A;  3NAP B;  4I30 A;  4N53 A;  4LKF A;  3V0A B;  1H2K A;  3PTR B;  2ARE A;  2O8O A;  5DQ0 A;  4ZKT B;  3VD4 A;  1H4H A;  2JXA A;  4GA9 A;  1HN1 A;  1ZRR A;  3AB0 A;  4H7M A;  1O5L A;  1TQ5 A;  3DKQ A;  5FOJ B;  1WMF A;  3TRS B;  2VOK A;  4QQH A;  3LDK A;  4OHW A;  4UW3 A;  2BWC A;  3V65 A;  3ST7 A;  4BLI A;  3ZYB A;  3WIN E;  4IER A;  4COW A;  4E4Z A;  3WD5 A;  2F6B A;  5IK4 A;  5IJR A;  3PTY A;  4Q26 A;  1SBF A;  2Y33 A;  3IB3 A;  4M4R A;  2OYZ A;  1AXK A;  5EHD A;  1MVE A;  1XSQ A;  2E9Q A;  3DCQ A;  1ZZC A;  2GH2 A;  4KQ7 A;  5F5I A;  2ZBJ A;  3HPN A;  1W03 A;  5M0T A;  1JMU B;  4LO4 B;  3SQO A;  1W9F A;  5HI0 A;  4XFI A;  2R16 A;  3NNM A;  4OYU A;  4Q0U A;  5G05 L;  2VE1 A;  1NKG A;  4GH4 A;  4I3G A;  4OI2 A;  4AEM A;  1JYX A;  3CU7 A;  4N90 A;  1UZZ A;  1ULO A;  3D4K A;  1DGL A;  5ACA 1;  5IUQ A;  5FZF A;  1V70 A;  2AEZ A;  3UT0 A;  1BJQ A;  3LEG A;  5BNN A;  4GWJ A;  3OPW A;  1AR6 3;  5T50 A;  5T5L A;  1HJF A;  3ZX7 A;  3AMH A;  4LO7 A;  4Q4X 2;  2WNE A;  4AED C;  1R1A 1;  3GJB A;  3IN9 A;  3H0O A;  3WVJ A;  4C90 A;  3VUO A;  5BNP B;  4AED B;  1Y9G A;  4DUV A;  4DXT A;  4L9B A;  2JB8 A;  1LOG A;  1SLB A;  2WNU C;  4Q8K A;  1I1E A;  3WF1 A;  3ZXL A;  3MIC A;  5FP4 A;  5CVR A;  3LKJ A;  3LFI A;  4W50 A;  1EUU A;  4LHS A;  1N3P A;  1O5U A;  4YGE A;  4LO8 A;  3RZZ A;  3PUR A;  2DF7 A;  3A4U A;  1IS4 A;  2V5D A;  3ZFF C;  1VRH 3;  4QKD A;  1EY2 A;  1EV1 2;  4K20 A;  4DO0 A;  2D5H A;  3AYE A;  4LLO A;  4QPG A;  2WIN B;  4LOR A;  1VBA 2;  1JH5 A;  2PQQ A;  5FXX A;  2YXS A;  2WT0 A;  4RS5 C;  3PNA A;  1A6C A;  4PF1 A;  4Q1P A;  3E1F 1;  2OPK A;  4JAA A;  5EWS A;  1W2A X;  5DZG A;  1RMU 2;  3ZXF A;  4P00 B;  1IG3 A;  4Q8L A;  2ZEW A;  5FY1 A;  2ARB A;  3CJI A;  1QJU 3;  3JB8 A;  4ISR A;  5A80 A;  3T1L A;  1JYV A;  4NIH A;  1NCR C;  2VMI A;  2HWD 3;  5FYM A;  5GLV A;  3RZH A;  3CO2 A;  4UBH A;  1RUI 3;  2XJR A;  3PMS A;  3HAG A;  4WZF A;  4XBQ A;  4NHY A;  4C0B A;  3S7I A;  1DBN A;  1AR7 2;  1W8W A;  2WFF 1;  1W2O A;  5FWJ A;  4CXX A;  2BGP A;  3B94 A;  3F95 A;  2HWF 2;  2JKX A;  2RS3 1;  4JRL A;  1UZV A;  1QDC A;  2J7M A;  5JDB A;  3III A;  1W6Q A;  4O9E A;  1W2T A;  4IES A;  3WG1 A;  1UY4 A;  3O1R A;  3CHX A;  5CG9 A;  4IGO A;  4I0A A;  2PLV 1;  3OB8 A;  3URF A;  1TVG A;  5A3T A;  2DFC A;  4E2G A;  1TMF 3;  3AZZ A;  4FPF A;  4M3C B;  4MXW A;  2VPV A;  4A3X A;  2W2I A;  3HIF A;  3LFM A;  3SHR A;  3AM2 A;  4HN0 A;  4QU2 A;  5A6Z A;  1H1I A;  2V5Y A;  4C8D A;  4ZU7 A;  4LR4 A;  4FOV A;  1ENX A;  1S4C A;  2G9F A;  3ZN5 A;  5FWE A;  2H0B A;  3HWJ A;  4KBZ A;  3N7J A;  3J9S A;  1GYK A;  2W92 A;  2RS1 1;  2D3S A;  1R09 1;  1OMI A;  3HNY M;  3POB A;  4QB6 A;  3TNQ A;  2R6Q A;  2VTX A;  1MQT B;  1HIX A;  2XML A;  3I2K A;  1DFQ A;  2BWA A;  5FZH A;  3PUH A;  3AYD A;  4HBN A;  3K2O A;  2P6C A;  2VOX A;  2UY9 A;  1NQJ A;  4BIF A;  2HWE 2;  1RUH 2;  1F2N A;  1JU3 A;  3TN9 2;  4AFC A;  1FT9 A;  4XF3 A;  3QD6 A;  5L7O B;  3HOB A;  4QXK A;  3H8X A;  1ZM1 A;  2GMM A;  3LA3 A;  1MS0 A;  3WQB A;  1PGL 2;  3UET A;  3WR0 A;  4HKO A;  4PLO A;  1HV0 A;  3S5A A;  2D6L X;  4LIV A;  5FJH A;  5J96 B;  5FY5 A;  5FZ3 A;  2WT2 A;  1CX1 A;  1JOP A;  1QWR A;  5LBE A;  4EE2 A;  1Q43 A;  3NMB A;  2R07 1;  2A3W A;  4QQO A;  3WSO A;  5KC6 A;  1WA6 X;  1ALY A;  4V1P A;  4X6R B;  2QQU A;  3OPT A;  1SAC A;  5A33 A;  4F8A A;  1HB4 A;  1MEC 3;  3IDE A;  4AI8 A;  1NA1 A;  4K40 A;  2X5I C;  2VBD A;  2R04 3;  3OJB A;  4HLT A;  4Q4V 3;  5LBF A;  3A0N A;  3LZZ A;  3KWV A;  4YPJ A;  3KHB A;  3UK9 A;  2C6S A;  1W9W A;  5GKA C;  2OW4 A;  4OMC A;  4CU7 A;  4ES8 A;  1ODM A;  2WZE A;  3WCR A;  4NE9 A;  1PVC 3;  1NCQ A;  1JYT A;  2OII A;  2VZP A;  4GMP 0;  4OCT A;  3WW4 A;  1FMD 2;  2XQR A;  1XE8 A;  2NLR A;  1J3R A;  2ZGM A;  3PIJ A;  1LR5 A;  4LK7 A;  4QDR A;  3ZFG A;  1YYN A;  1RGS A;  2HBU A;  3AC0 A;  1AR8 2;  1C1F A;  3MIB A;  1V0A A;  5FO8 B;  1UYX A;  2WUH A;  1RUE 3;  3ME2 A;  1BXH A;  2HEV F;  1EV1 1;  4OZO A;  2OPW A;  5EJ3 A;  3U1X A;  4AHX A;  2E6V A;  3WF0 A;  1OC1 A;  3OGG A;  3R0R A;  3N4M A;  4JDM A;  4RL7 A;  1H1M A;  1RUF 2;  1SBD A;  2WII B;  3LAG A;  1W6M B;  1UXZ A;  3CEW A;  3OGV A;  2DTY A;  5FMB A;  4AZZ A;  1Y3T A;  1GP6 A;  3ZFG C;  3T4V A;  4DUW A;  2J1A A;  3A21 A;  5LBB A;  5KBF A;  4JRA A;  3V64 A;  3ZFE B;  1QNY A;  3ILN A;  3T0D A;  4K6B A;  3VZO A;  1RUH 3;  1XYN A;  2BEO A;  2B7Y A;  4B4Q A;  4E8D A;  2B42 B;  4QDS A;  2GDF A;  1JZ3 A;  2CGP A;  4JHT A;  3I7D A;  3IPV A;  4QX5 A;  1YCI A;  4XCB A;  4CE8 A;  3BU0 A;  5JWP A;  2DCZ A;  3ASI A;  1UIJ A;  5EPA A;  4Z1V A;  4FSJ A;  5BNO C;  1JHJ A;  2XVG A;  3H9A A;  1G9A A;  5LRS A;  4EYU A;  1QJY 1;  4KMQ A;  4JCK A;  3MO4 A;  3RI8 A;  3USU A;  4YZ5 A;  3GZE A;  3ZVX A;  5C3S A;  2UWB A;  3N9Q A;  2WSV A;  2PN5 A;  1TE1 B;  1LCL A;  3W9A A;  2FBE A;  2OT7 A;  2BJS A;  1ULP A;  3M3Q A;  4XMA A;  1DCS A;  3K4A A;  4LEJ A;  4Y4R A;  2WBK A;  1FXZ A;  1RVF 1;  4ZZ5 A;  3VBF C;  5C33 A;  3GZU C;  2GNB A;  4AVB A;  2IUW A;  1H8T A;  4FQZ A;  2A3Y A;  1AR9 3;  2W47 A;  2VNR A;  1GZW A;  3C8X A;  2D97 A;  4G4F A;  3VBF B;  1G7Y A;  1WLD A;  4NOT A;  5JI9 A;  3RYK A;  3HEI A;  2NZ9 A;  1ZZB A;  3ZXG A;  1DYK A;  1BBT 1;  1RUJ 2;  2RM2 3;  1AJO A;  3G6J B;  4XET A;  4I0W B;  4OFG A;  3HQR A;  4NRM A;  4ATE A;  1C5I A;  1H6X A;  3BU7 A;  5LEJ A;  1MZ6 A;  1E5S A;  2YY1 A;  3AMP A;  2J1U A;  1O91 A;  2VUC A;  1FYU A;  4MHU A;  2PHU A;  2K0G A;  5BUV A;  3M3C A;  3WW1 A;  1IKP A;  2J1R A;  2F4P A;  2RG4 A;  3WXP A;  4MZU A;  5IWF A;  2D6M A;  4ATF A;  2LW8 A;  2ZGT A;  4QX2 A;  3AVS A;  1VBB 2;  2QQO A;  2IXC A;  4AQS A;  4BQ1 A;  1JZ8 A;  1X36 A;  4HG6 B;  2WO7 A;  3RVH A;  1DGR A;  3UL2 A;  4AVC A;  3CZU A;  1B35 C;  4LE3 A;  3ZYG A;  1UN1 A;  3AK0 A;  2IVJ A;  1X9P A;  2ZX2 A;  4JQT A;  1U5Z A;  4B4P A;  1LRH A;  1UKG A;  1BMV 1;  1ZBE 3;  2JDN A;  4JGZ A;  4UOJ A;  2GMP A;  3OYW A;  4MGI E;  5JSP A;  4N43 B;  2FQP A;  4BE3 A;  1CAW B;  3NAP C;  3ZXK A;  1IKQ A;  4FP2 A;  4A7K A;  3MFC A;  3CDZ B;  1QIQ A;  4CXW A;  2CYF A;  3EJK A;  5I91 A;  4CYD A;  5JZG A;  3JUU A;  4MV2 A;  2DVG A;  2FDJ A;  2TNF A;  5E88 A;  2ZMK A;  4ZON A;  4FPC A;  1XU2 A;  4I3P A;  1W04 A;  3ON7 A;  4COV A;  1RMU 3;  3AZY A;  3ZKU A;  1YIP A;  1WGP A;  4GJY A;  5LA9 A;  2N7G A;  5A1F A;  2XWJ B;  1UX6 A;  1ZZ6 A;  4Y1Z A;  3M2M A;  4XHB A;  1LEM A;  5F3I A;  4BYY A;  5ACA 2;  5JSR A;  3SIS A;  5A6X A;  4BM8 A;  1KD7 A;  1LES A;  4HT1 T;  4AGG A;  1IGO A;  4L92 A;  1FV3 A;  2BU9 A;  5GZE A;  1CN1 A;  3WP4 A;  2W1U A;  3ZSE A;  4L99 A;  2IWG B;  1WD3 A;  4K21 A;  1YXW A;  3RMX A;  5E16 A;  1QGL A;  2HEY F;  2D6P A;  3E97 A;  3V0B A;  4EZH A;  2EXK A;  2QQW A;  2VUL A;  1X82 A;  3NV1 A;  3VN4 A;  5AVA A;  1WWY A;  1X8M A;  2F4L A;  1O7F A;  1US3 A;  4NPL A;  4R9B A;  3NKT A;  3GJA A;  5FZE A;  5I0T A;  3T1M A;  2D7F A;  4PF5 A;  1QJX 3;  2GAU A;  1D4M 2;  2X09 A;  3NRU A;  4FPE A;  1RIT A;  3J26 N;  1AR8 1;  4R9C A;  4IV3 A;  4XXA A;  2ADE A;  3DPR A;  2VM9 A;  3B9C A;  1ENS A;  3ZXJ A;  1C57 A;  4I0B A;  2JG8 A;  2VR4 A;  3I3B A;  4IEZ A;  4WM8 A;  2DU1 A;  5JOW A;  2WT1 A;  1VBD 3;  4MET A;  2OQ6 A;  4UBG A;  4WM8 C;  3I3D A;  4XFA A;  4K1Y A;  5GM0 A;  4DOU A;  1OD5 A;  1Z7S 1;  2RS1 3;  3CL1 A;  1H8T B;  1ND2 B;  1GP4 A;  3VHR A;  1UY0 A;  5L9V A;  3WHU A;  3UKN A;  4AL9 A;  2XVK A;  1DYO A;  4OUS A;  4PLM A;  1JYN A;  2W95 A;  3UNP A;  1SLT A;  4OI4 A;  1J3P A;  1W06 A;  5CKN A;  1X7N A;  4JX0 A;  1IZ3 A;  5JPM B;  1KFX L;  2YBK A;  5G04 L;  3SMH A;  1UOJ A;  1UX7 A;  1HB2 A;  5EYY A;  5KXB A;  3KT1 A;  1WCD J;  4H55 A;  2RR1 1;  2JDM A;  1PNF A;  1RUC 3;  3TN9 3;  1V9U 1;  2PAK A;  3ZFF B;  2VQA A;  1C8M 1;  1UOG A;  2R0H A;  1OBN A;  2XQX A;  2G9Z A;  4Y4Y A;  3ZXE A;  3IPV B;  2RMU 1;  4FQ4 A;  3HN1 A;  5DXD A;  4WVM A;  2DBI A;  5ACA 3;  1QOT A;  1Y7B A;  4PBP A;  3P3N A;  4CDX B;  1EUT A;  2ZX1 A;  1FOD 2;  5ABJ C;  2HWF 1;  2BRT A;  3VDD B;  1XOY A;  3O0X A;  5GLU A;  4PDW B;  2MPF A;  3FWE A;  1ZZ9 A;  4Q4Y 3;  3LOB A;  3PL0 A;  3A23 A;  3U78 A;  2B45 X;  2VVE A;  3JXS A;  4YM1 A;  4U36 A;  4Q4V 1;  1YQ8 A;  1QOO A;  1MEC 1;  2GC3 A;  3DEC A;  3J8F 1;  3WT3 A;  1MS8 A;  3QBQ A;  4R4Z A;  1W05 A;  5FTT C;  1RIR A;  1Y9Q A;  5A3N A;  3RRD A;  3THT A;  3VDC A;  1CWP A;  1UQX A;  1OVS A;  5SV5 A;  4JGY B;  1G9B A;  2JIJ A;  1AXY A;  1PGS A;  1O4T A;  2CGO A;  4D7T A;  1H8V A;  4QKF A;  5FZL A;  4QXB A;  2WNV A;  1SPP A;  5FP3 A;  4MYE A;  5C4W B;  2XJQ A;  2AC1 A;  4YVW B;  4YVS B;  4B1L A;  2HWF 3;  1LU1 A;  1YLL A;  2VEC A;  2QQK A;  2KR2 A;  1DQ6 A;  3E5U A;  3VBH B;  1KRI A;  3KV4 A;  1VJ2 A;  2RS3 2;  4LE4 A;  4E4H A;  4P08 A;  1DHK B;  3ACL A;  3ILR A;  3SIT A;  3U4S A;  3VBH C;  1DQ0 A;  1XSR A;  1D4M 1;  1OOP C;  3WDY A;  3IAQ A;  1N3Q A;  2RS5 2;  3TN9 1;  4BB3 A;  4CEY B;  3M3O A;  4AI9 A;  2EXH A;  4QX0 A;  2HYK A;  2R1D A;  1OOP B;  1R08 1;  1OUS A;  4BJ0 A;  1RL3 A;  2JWP A;  4LO5 B;  5JXH A;  2ZAH A;  2W9X A;  4HL0 A;  3RZG A;  1CAV A;  5FUN A;  1W8O A;  1S2E A;  1PGW 2;  3I54 A;  4AFB A;  1MZ5 A;  3M3I A;  2W1S A;  2FMY A;  1KJR A;  3ES4 A;  4H14 A;  4AF9 A;  3VBH A;  4WM7 A;  3EO6 A;  5H9Q A;  5LEK A;  1PGL 1;  5DAW A;  1QJX 1;  5BXX A;  5C4W A;  3E6D A;  1AL2 2;  1OUX A;  1U5I A;  1SDD B;  3I49 A;  1RUD 2;  5CFD A;  4A4A A;  5IVE A;  4IUG A;  2YC2 A;  4QQP A;  3ZN4 A;  1COV 1;  4TN7 A;  5IHR A;  1H2N A;  1UO9 A;  4PI0 A;  1XE0 A;  1UOB A;  1G6N A;  3AKR A;  3DL3 A;  1SEF A;  3KD4 A;  1BEV 2;  4P9I A;  5CG8 A;  4BQ4 A;  4KI5 M;  4YM2 A;  4CUB A;  1KS4 A;  2R06 3;  4FFF A;  4LBM A;  4XMI A;  3UGF A;  4CDU A;  1WCU A;  2ZGS A;  4LUM A;  2P4E A;  3PVN A;  4MO3 M;  1C4R A;  4AG4 A;  2B9U A;  3D5O A;  2WFF 3;  1RUJ 3;  2RM2 2;  3SCF A;  4F83 A;  4NVP A;  1QXR A;  3B9I A;  3CZJ A;  1KQR A;  2C0Z A;  5HCB A;  4KG0 A;  3RPQ A;  1W0N A;  2OUJ A;  2RDN A;  3I3E A;  3J8F 2;  4HZF A;  4XJ9 A;  2ZKN A;  1NOV A;  4PT6 A;  1OLR A;  2ARX A;  4DMI A;  3VD5 A;  1J1T A;  2WA3 A;  1RHI 3;  4GKX A;  2XWB B;  4YFW A;  4PHZ A;  4XUT A;  1TNF A;  2Q5T A;  1F5F A;  2VMD A;  2IXI A;  3OGR A;  2B46 X;  5JXJ A;  2BUK A;  4COU A;  1EAH 1;  4P9J A;  3SEP A;  5C3O A;  4P02 B;  5C3R A;  3J7N A;  1H0B A;  3P6B A;  4LOS A;  2P2K A;  4XPV A;  1PMH X;  2R06 1;  2ZA9 A;  1J59 A;  2ZGP A;  4KWJ A;  4P9Y A;  5CEH A;  4HPK A;  4QB1 A;  3AP6 A;  3MYX A;  4NHK A;  3GGL A;  2WZP P;  3GYD A;  5FPX A;  1PX4 A;  3HVD A;  2ZEX A;  1GAN A;  3WY6 A;  4NRP A;  4GD4 A;  4JZR A;  5K8S A;  3D0S A;  3B02 A;  4NIA A;  2W94 A;  5C6C A;  1IPK A;  2BPA 2;  5JR7 B;  3BPS A;  5AC9 2;  1S0B A;  4R9A A;  4CSW A;  1NUK A;  2ES3 A;  1YIF A;  2NPI A;  4DIQ A;  4XZP A;  1VRH 2;  2CSG A;  3VZM A;  2ZXQ A;  2LTN A;  4AI3 A;  4OUE A;  2JG8 C;  4IV3 B;  3O1M A;  1R08 2;  2HWB 3;  4KL1 A;  4GMP 3;  1YRZ A;  4YZ3 A;  5GLZ A;  1IS6 A;  1GQP A;  2L9L A;  3J7L A;  2QE3 A;  1W8N A;  1RUG 2;  3BN6 A;  3K46 A;  1AJK A;  3VBO A;  3ZR6 A;  1K5M C;  2BVV A;  5K7P A;  3MUY 1;  1HW5 A;  2Y6H A;  1ODN A;  3U4X A;  1IQD C;  4Y20 A;  3K48 A;  5FY0 A;  3O1S A;  3AP7 A;  3HNB M;  5FPZ A;  3CNA A;  4X8N A;  1N47 A;  4XC9 A;  1UU6 A;  1Z7S 3;  1ZA4 A;  5CFC C;  3BPZ A;  4ASM B;  4XAC A;  1QJX 2;  1XJA A;  2PMW B;  3NJX A;  4K3U A;  1JZ5 A;  4OMD A;  1LHN A;  5FZD A;  3SKV A;  3LA2 A;  1W8Z A;  2E63 A;  1VAV A;  4M0N A;  2GN7 A;  2Q1F A;  3JQW A;  5D8A C;  5ANQ A;  3IMN A;  4HET A;  2YC0 A;  1BMV 2;  1RED A;  5C9A C;  1AR9 2;  5HCA A;  1VAK A;  3BVC A;  3UYJ A;  4BK5 A;  4OI0 A;  2P3K A;  2VXJ A;  1W6N B;  1Y4W A;  2XJP A;  3RMY A;  3KLS A;  3FLT A;  4EWE A;  3WF2 A;  2Y38 A;  3NV3 A;  3IWZ A;  3KVA A;  2VCB A;  2AGS A;  4UF0 B;  3ILF A;  5K0U A;  3VHN A;  1OHF A;  3W21 A;  1UZW A;  4CUA A;  3N7K A;  1VBA 1;  1CAW A;  2FDG A;  4UFJ A;  4PLN A;  1EV1 3;  1TMF 2;  2VO5 A;  3GZA A;  5FY4 A;  1ZRE A;  2X29 A;  3GDB A;  4NWV A;  2FCV A;  2WAA A;  1B35 B;  1X50 A;  1L7Q A;  4XF4 A;  3QLQ A;  4D8M A;  4AFM A;  3GBW A;  1W3V A;  3BOD A;  3L2Y A;  3NW4 A;  4DNY A;  2DWR A;  4Y1X A;  5FY8 A;  3ZYH A;  1KGY A;  1NCQ C;  2YG0 A;  2X05 A;  3ZO0 B;  1NCR A;  1UYZ A;  3CJI B;  4KH9 A;  2QCS B;  4QDQ A;  2D6K A;  2GAL A;  3FHQ A;  4LTA A;  4P5H A;  4QT6 A;  1GSL A;  2WO3 A;  3RWK X;  3AZX A;  5DAQ A;  1HLC A;  4URT A;  4NO4 A;  3WZ1 A;  4RFR B;  1F9K A;  5JPN B;  2C1F A;  3AL5 A;  3K4D A;  4DB5 A;  1AX2 A;  2E26 A;  5AC9 1;  1S0J A;  3LIH A;  3N3H A;  2W39 A;  4XIL A;  2ZPX A;  3V0A A;  3D8C A;  1XNB A;  3K3N A;  2VMG A;  4LBQ A;  5FPL A;  4DRR A;  4N43 A;  3PVE A;  1V9U 3;  5CNA A;  5HPO A;  4KU7 A;  5F3C A;  2WWJ A;  4JGZ B;  5KXE A;  1VIW B;  4XE9 A;  1DGR N;  2DCY A;  2ZHL A;  3LIG A;  5F3G A;  3OF1 A;  2ZGK A;  4DS0 A;  2WJS A;  5FV3 A;  5LAT A;  2Z4F A;  2WKK A;  1TME 3;  2A6Z A;  3M3E A;  5CA6 A;  2D3P A;  5LY2 A;  5CFD C;  1F4A A;  3WNM A;  1XE7 A;  1OQD A;  2BYV E;  4CP1 A;  4XJ8 A;  1K5M A;  1HRI 2;  5A32 B;  3VBU C;  3H3L A;  3S7E A;  1HN0 A;  1UPS A;  2HBT A;  4D7Y A;  2XON A;  3I2I A;  2C9A A;  4LIU A;  4AHW A;  4CZS A;  2HYX A;  3ACG A;  2ZS6 B;  3T4H B;  2VU9 A;  4LO6 B;  3ZSJ A;  4FBF A;  1AYM 2;  1CIW A;  3SCG A;  3H8U A;  3K4Z A;  1LGC A;  3M1H A;  1OOP A;  4N7I A;  4HFS A;  4TWT A;  4XFF A;  3E5Q A;  4CEY A;  2ZHN A;  3AP5 A;  1MAC A;  2BTV C;  3PME A;  4QQL A;  3WP5 A;  5IVJ A;  1S0E A;  2NMN A;  2WQ8 A;  2A5Z A;  2Y6G A;  3KV6 A;  5DMY A;  1JW6 A;  5FBZ A;  1RUO A;  4AXO A;  3RDI A;  2QQN A;  3O1U A;  1WLC A;  2PHL A;  2BER A;  4CP9 B;  1QHD A;  1CJD A;  2WWS A;  1R1Z A;  4YZ4 A;  4XIK A;  1LOF C;  1OT5 A;  1GOH A;  1JU4 A;  2TBV A;  3EYP A;  4YGD A;  1H9W A;  3GF6 A;  4ZS3 A;  2CNA A;  2VC9 A;  2DCT A;  4QKN A;  2XBO 2;  3K51 A;  2BOI A;  1NZI A;  4FO9 A;  1JOJ A;  2DDU A;  2VCM A;  1WA4 A;  4HK8 A;  5DG2 A;  3VZK A;  2WQZ C;  5T52 A;  2XJU A;  2KXL A;  4Y1Y A;  3ACI A;  4RHV 2;  1DLC A;  3VD9 A;  5CKQ A;  2BNM A;  5LRR A;  3JBG 1;  1LOF A;  2PTM A;  2FCU A;  1F31 A;  1LHV A;  4FPK A;  2ZCW A;  2P17 A;  4GJZ A;  4BU2 A;  3CMG A;  2NMO A;  3DYP A;  2YPJ A;  1GLH A;  3MI8 A;  1W6M A;  3O0V A;  1ND3 A;  2VG9 A;  4I02 A;  5DDJ 1;  5JVV A;  5A3M A;  4XFH A;  3T08 A;  4J1X A;  4BZ4 A;  5BYN A;  1POV 1;  2PFW A;  4D0Q A;  3E6C C;  3FMG A;  4CPB A;  3VHP A;  4MHR A;  1V6N A;  5IVY A;  2VUJ A;  5D1I A;  2R32 A;  3POW A;  1YFU A;  1YQC A;  3C2U A;  4QGL A;  4WVM B;  3M4F A;  4XUO A;  1YI7 A;  1W0P A;  1BCX A;  2Y6F A;  5FLJ A;  5FZ1 A;  2VW1 A;  3POG A;  4M3C E;  1AYN 1;  1SQ4 A;  3MIG A;  3BIW E;  2R04 1;  3ZLI A;  3KMH A;  4LMF A;  1UD1 A;  2Z79 A;  1BBT 2;  1RUJ 1;  1RUF 1;  5DZE A;  4R52 A;  1QQP 3;  1VMH A;  3FLR A;  1QJF A;  3PHM A;  5DN2 A;  2OZJ A;  5JXI A;  4EZ4 A;  3GZT B;  3N9M A;  3T2O A;  4QKB A;  3MID A;  2R07 3;  3NVC A;  4Y5T A;  4EWD A;  4BK4 A;  1ZNP A;  1SLC A;  2VZR A;  3RWN A;  3I3M A;  1GQH A;  3KQR A;  2VCC A;  1DF0 A;  1PVX A;  2VTF A;  4Y22 B;  5L73 A;  4CCN A;  3NKG A;  1FPN 1;  2A6X A;  1AXZ A;  2B8M A;  1COV 2;  3I3Q A;  4DY5 A;  1E57 A;  1X9T A;  4JVA A;  5J7M A;  2UYB A;  1HRV 2;  5APA A;  5LW9 A;  2HWC 1;  4YGC A;  1CAX B;  4AEJ A;  3O0W A;  5FO9 B;  2YMZ A;  1K42 A;  3GHN A;  1QJU 2;  4FP3 A;  2P3J A;  3THP A;  1NX9 A;  1V6L A;  4GUL A;  5FK8 A;  5F9T A;  2XKP A;  2PHR A;  1PK6 A;  4P9L A;  4A45 A;  1BK1 A;  3ZDS A;  5L7O A;  4XDP A;  2FDF A;  1RUI 2;  2HJI A;  4Y5Z 0;  2ZGR A;  5JOX A;  4AI0 A;  1PGW 1;  3MHZ A;  5IYY A;  4RA0 A;  4Q0Q A;  1RXF A;  1VRB A;  2I74 A;  2IFR A;  4E2Q A;  1S55 A;  1W39 A;  4Q4W 3;  1HXS 1;  2Y34 A;  5AFB A;  4WBB A;  1O3R A;  2W91 A;  3KV5 A;  4QXH A;  3D6E A;  2PHF A;  5A7S A;  5A3U A;  1QKQ A;  2D5F A;  4NJ4 A;  2Z69 A;  1LHW A;  3JBG 2;  4BMB A;  3PJY A;  2W3J A;  2VMC A;  1O8P A;  1UKR A;  4NRQ A;  4UF0 A;  5C8C A;  1RHI 1;  4JHZ A;  2R06 2;  2EXI A;  4S2F A;  1AYM 1;  4FT8 A;  2WZR 1;  3OBR A;  5FRA A;  1DZT A;  3MIE A;  3BKZ A;  4RQP A;  4XHX A;  4ZPI A;  1OPO A;  4XBL A;  5JIU A;  1X33 A;  2ZTN A;  5DUW A;  3MW3 A;  4QMA A;  2VOT A;  4HVR A;  4Q4X 3;  4EN9 B;  5FYI A;  3NV4 A;  3J8F 3;  4HSL A;  1TNR A;  4YSF A;  3WUD A;  2QZ2 A;  1Z0H A;  4YW5 A;  3UJQ A;  3ZYI B;  3BTZ A;  3ZPO A;  2AEN A;  2Y6J A;  2UUR A;  1VRH 1;  2A70 A;  3OD4 A;  3ZYF A;  4C1X A;  1COV 3;  4LBK A;  4BQ2 A;  4UW6 A;  3R6S A;  5IAX A;  1AYN 2;  4HOO A;  5F1R A;  1FV2 A;  1HV1 A;  4QX7 A;  2DV9 A;  4QPI C;  1L7R A;  3G7D A;  1PO1 1;  2D44 A;  3B93 A;  1EYB A;  5FUI A;  2BNN A;  3HBZ A;  2NYY A;  1K3I A;  1MZF A;  4QPI B;  3BOP A;  3ZIW A;  4BWO A;  2VCA A;  1ULD A;  3BCW A;  3EHK A;  5FYB A;  5CBL A;  2CDO A;  2YFU A;  4HK9 A;  3QH6 A;  4EN7 B;  1GZT A;  4IEW A;  2BV4 A;  4D3W A;  3DPR B;  3H1M A;  4BH9 A;  2QQV A;  4R4X A;  3Q8B A;  1NE4 A;  2OQ7 A;  4Y22 A;  3SKJ E;  2ZAA A;  2RR1 2;  3SEE A;  4GH4 B;  3NJV A;  1LEN A;  4AVV A;  2Y6K A;  1IOA A;  3K3O A;  5FP8 A;  3NST A;  3MW4 A;  1YJL A;  2IVI B;  3OCP A;  4GH4 C;  4PI2 A;  5CB7 A;  3VBO C;  3FUQ A;  3DYO A;  2XJS A;  3MPP G;  1HRI 3;  3H42 B;  2ZOE B;  1LHU A;  1R09 3;  4Q4Y 2;  3VBO B;  3WX5 A;  4FPO B;  4AED A;  4BDV B;  2W08 A;  5T3N A;  1RIN A;  2CY6 A;  3AVR A;  4AVA A;  5BNP A;  1RUE 1;  3LDR A;  2OA2 A;  3OPZ A;  4UW4 A;  4DY3 A;  1JOD A;  4L11 A;  5E89 A;  2YYO A;  2MNG A;  2MHF A;  1C28 A;  3LA7 A;  1IS3 A;  3ZN6 A;  3EB7 A;  2JE9 A;  3PU3 A;  5FZ8 A;  1UCX A;  1W6P A;  3DGT A;  5FZ9 A;  3FL7 A;  2IXJ A;  2CU5 A;  4ITC A;  1OA2 A;  4Q27 A;  3IZO A;  4RQP B;  3WOG A;  3WDT A;  4TSV A;  4Y1V A;  3O1V A;  5F32 A;  3H3U A;  5JZG C;  4G3Y C;  4IE5 A;  4ERO A;  1Q3E A;  4RQP C;  2VZQ A;  4CVU A;  5EZW A;  5FZC A;  3MIF A;  2VW0 A;  4BQ5 A;  2JDZ A;  2MEV 2;  1FOD 1;  1D2S A;  4HPK B;  1QJU 1;  4LXL A;  2PXJ A;  1CD3 G;  4KWU A;  4OHY A;  1Q8P A;  4FPY A;  3KS7 A;  2DCK A;  4CCE A;  5KHI A;  2RMU 2;  2D6N A;  3VBS A;  1UF2 C;  3R05 A;  1UL9 A;  1KDK A;  1RUI 1;  3HNM A;  4DXR A;  1G9C A;  3P3P A;  3MBW A;  2JDH A;  1JHN A;  2EAK A;  1NCQ B;  1NLS A;  1O4Z A;  5A6Y A;  4CEW C;  2Q4S A;  3I2J A;  1GU3 A;  5I0D A;  3CJI C;  1Z78 A;  3FUO A;  3OY8 B;  4Z82 A;  3WDV A;  3UES A;  5FPA A;  1PK6 B;  1KXG A;  1PO1 2;  4YLZ A;  2TEP A;  4ISQ A;  4YW6 A;  1LED A;  4CEW B;  1HQL A;  4A7Y A;  2QTW B;  2OX0 A;  2ZGL A;  3HBK A;  3F2Z A;  1P8J A;  5H9P A;  1URX A;  2VW2 A;  4ORF A;  4W8J A;  2WZ8 A;  4JTO A;  4N53 C;  1QEX A;  4CDU C;  1Q8O A;  4YGB A;  3FFQ A;  2GP3 A;  5A7W A;  1AL2 3;  4GAZ A;  5FJK A;  4YW3 A;  3AZV A;  2XLG A;  4N53 B;  3I2F A;  1GNY A;  4CDU B;  4XAE A;  2D40 A;  2JX9 A;  1JUH A;  1S0D A;  2XLF A;  2VGD A;  4P9G A;  4HAN A;  4XJW A;  2H6B A;  3JQX A;  3AYA A;  1LGN A;  1XNT A;  1BEV 3;  2RS5 1;  1KIT A;  3DYM A;  1OKQ A;  2VXR A;  2VAU A;  4H3W A;  1ZRI A;  2O14 A;  2ORX A;  2AYH A;  5CFD B;  1OXC A;  4AR2 A;  3ZM8 A;  4FOY A;  3CJX A;  4CDQ A;  2HWC 3;  3MFA A;  2WFF 2;  2X5I B;  4FTE A;  5BNQ A;  1BEV 1;  1DZQ A;  1ZX5 A;  2RS5 3;  1ASJ 3;  4IEU A;  2V4V A;  3MDP A;  1PZ7 A;  2A71 A;  3KM5 A;  4Y26 A;  4MAD A;  2VUA A;  3AKT A;  5LWB A;  3JD7 1;  1GNZ A;  3I8T A;  3H1Y A;  4W6W A;  4CPB D;  1NG0 A;  1VPH A;  1CAV B;  3FC0 A;  2MEV 3;  3B01 A;  3ZPY A;  2WYS A;  1AL2 1;  3Q8A A;  4NPM A;  2NP0 A;  2GU9 A;  3MW2 A;  3AXD A;  1CON A;  1CZS A;  4OHV A;  4PCR A;  1AVB A;  1PMI A;  3POJ A;  1EAH 2;  4W6X A;  5D21 A;  5FLI A;  2XPJ A;  2VZV A;  4EQV A;  1POQ A;  4AGV A;  1RUF 3;  4UXA A;  4B4R A;  5FPU A;  4RHV 1;  4ZU4 A;  1DG6 A;  4HKL A;  4RYD A;  4OHX A;  4AHY A;  2XVL A;  1G8W A;  4M3C A;  1U5Y A;  4FXK B;  2GSY A;  1GWM A;  3ZFG B;  1FAT A;  4F7Z A;  4DIN B;  2WNV C;  3BYW A;  1NQD A;  2G1M A;  2W5F A;  1JZ2 A;  1IHM A;  1E5R A;  1NY7 1;  3ZFE C;  1XQN A;  1G9D A;  5GLT A;  3MPB A;  4CP0 A;  1V6J A;  1W6O B;  1RXG A;  2ARC A;  1H30 A;  2WNV B;  1BQP A;  4MG2 A;  2JEM A;  5H9R A;  1PHM A;  4Q4W 2;  5FY7 A;  5E8A A;  3EXU A;  1KFU L;  1WLW A;  2JB4 A;  1OSG A;  1QOS A;  1ST8 A;  2GC2 A;  1K12 A;  3WEZ A;  1US2 A;  3OD0 A;  3NNF A;  3WF4 A;  2VD7 A;  3JBG 3;  1STM A;  2DVB A;  2PEL A;  4IW3 A;  1XYO A;  4MXV A;  5CKM A;  4LLF A;  1SFY A;  1I6X A;  4RHV 3;  5E6H A;  3WV6 A;  4DXS A;  3LEI A;  5I93 A;  2I07 B;  2EXJ A;  1V6K A;  2HLE A;  4BQY A;  1I3H A;  4NMI A;  3RG0 A;  1AR7 3;  2ZML A;  5B4N A;  5KXD A;  4B29 A;  4IE7 A;  3TAY A;  1PVC 1;  1VBD 2;  1I9R A;  3JB4 C;  1RYY A;  3LSD A;  3AP9 A;  4XF9 A;  2Z42 A;  4Z92 B;  2RS1 2;  3BGA A;  4QD2 A;  5ISL A;  1QJZ A;  5IT6 A;  1ZBA 2;  3JD7 3;  2HEW F;  5FZ0 A;  2ZGQ A;  1Q8S A;  2PHT A;  2WWU A;  3CF6 E;  5A3O A;  4K8R B;  1GWK A;  4QX1 A;  3BTX A;  2XDV A;  5FMO L;  4EV0 A;  1LEC A;  5A7O A;  4AI2 A;  5EJ1 B;  5L19 A;  1U12 A;  3S0M A;  3RZM A;  2RVA A;  1DIW A;  3U11 A;  4D6Q A;  5FMC A;  1XNK A;  5TSW A;  1RUC 2;  4WM7 C;  1FPN 2;  4DPN A;  3O7O A;  4LIT A;  3JCI A;  3ELN A;  3L2H A;  4A7Z A;  3ZDV A;  1PO2 3;  5KWR A;  1HX6 A;  2RE9 A;  1XC6 A;  5EFU A;  1CIY A;  1ZVF A;  2WS9 2;  2WYF A;  1AR9 1;  1Q5O A;  3DXU A;  4QXC A;  4X8P A;  4BPZ A;  1LOA A;  3ETP A;  5BNO A;  1DZR A;  5GJ6 A;  1VAM A;  3GM8 A;  4K7J A;  4XFC A;  1LB2 A;  2UU8 A;  1ZA7 A;  3DUI A;  1HKD A;  2WFP A;  3KB5 A;  3P1I A;  3R4D B;  5FDB A;  1RJ7 A;  3DF0 A;  2CAU A;  2CHH A;  5FPV A;  4A41 A;  5FQ0 A;  2K2S A;  5DUX A;  3WG3 A;  3LE0 A;  3RGB A;  4QM9 A;  3S6P A;  4MXW B;  4Z07 A;  4MX3 A;  3UJO A;  1HRV 3;  2Y8K A;  1BHG A;  4Z2W A;  3FHI B;  4DXZ A;  1KS5 A;  2JDU A;  2VZ1 A;  1A34 A;  1QMJ A;  4AFD A;  1O59 A;  2XHK A;  1JTZ X;  4UT5 A;  3RI9 A;  4COY A;  3RZJ A;  2YGL A;  2E31 A;  3SC7 X;  3T09 A;  2VJX A;  1YEW A;  3NJZ A;  2UY8 A;  1FMD 1;  1EPZ A;  2RDS A;  3KCX A;  4LBQ D;  3HR9 A;  1D4V B;  1PX3 A;  3C7F A;  2XJV A;  4GB3 1;  5FZK A;  5A7Q A;  5GZF A;  2YC4 A;  1ULE A;  4Q0P A;  1PM7 A;  5DDJ 3;  2ZGO A;  2OS2 A;  2A1X A;  5K9Y A;  3T2P A;  1O8S A;  3OBA A;  2VQ0 A;  3AJY A;  3RJR A;  1MEC 2;  3KZ4 C;  4IEP A;  4RR3 A;  4UFH A;  1NYW A;  1ZBA 3;  2V4A A;  3JD7 2;  4L97 A;  1GMM A;  4IGP A;  4JKK A;  1ENR A;  2EIE A;  2VZO A;  3LB9 A;  1GIC A;  3OBT A;  5FY9 A;  1JZ6 A;  3U07 A;  1F4H A;  1GP5 A;  4GXL A;  3MF9 A;  2A6W A;  2PHD A;  1PVC 2;  2J22 A;  2WRA A;  3B7M A;  1HRI 1;  4N9I A;  3AFK A;  1BK0 A;  3LWC A;  5FQ0 B;  4RS5 A;  3OEA A;  4QX8 A;  4DFS A;  1W8T A;  1ZBE 1;  2VNO A;  3BOW A;  4NHX A;  2FDH A;  3VD7 A;  2RHP A;  2VUD A;  2HKX A;  2Q8D A;  3LD8 A;  5BNP C;  1XNA A;  3A7Q A;  5F6L B;  3ENR A;  3WLU A;  1QXP A;  1PM4 A;  1T6G C;  3N7L A;  3PDQ A;  1MPX A;  2E53 A;  3WW3 A;  5A3W A;  4AE2 A;  1NY7 2;  1WME A;  3GAL A;  3IDA A;  4AVT A;  1NXD 1;  5IVV A;  4Y20 B;  5F6K A;  1UXX X;  1DGW A;  1U5X A;  5HCH A;  2VQT A;  4Y1U A;  3ZMO A;  2ZHK A;  1QNW A;  1QY4 A;  3GHM A;  1QDO A;  1HB3 A;  2EF6 A;  2IXH A;  1OH3 A;  4LKS A;  1UYP A;  1PO1 3;  2WAO A;  4O61 A;  2ZZJ A;  3LOI A;  1WMD A;  3POF A;  3J7M A;  5CIS A;  4RGA A;  5FYH A;  1WBL A;  2BW8 A;  1O4Y A;  1YO8 A;  1K5J A;  4AQT A;  5C71 A;  4FAG A;  4B7K A;  2Q1M A;  5FK7 A;  2ETE A;  1UOF A;  2BGO A;  1F15 A;  3T0B A;  1PZ9 A;  4KGQ A;  4PJY A;  1DYP A;  5J09 A;  4BQ3 A;  4BXF A;  4NID A;  3UGG A;  5F7U A;  1DDL A;  1KEX A;  4PQQ A;  2EIG A;  3D0J A;  4B7E A;  3QOP A;  2IC1 A;  4PIX A;  1CVN A;  4UWD A;  4WZC A;  3VDD C;  4A6S A;  5F3E A;  2JE8 A;  4AFA A;  4Q4X 1;  1SBE A;  4YG6 A;  2W1W A;  5DG1 A;  2K46 A;  5GZD A;  2DVF A;  4L0P A;  1CAU A;  1MS4 A;  1DQ4 A;  3LGR A;  4ZU5 A;  1RUN A;  3OGJ A;  4CU6 A;  1ZYB A;  3I2D A;  5LA1 A;  2VZT A;  3OTF A;  2FZ1 A;  3MLJ A;  1QH6 A;  2WZR 3;  2WC2 A;  3KSC A;  5SV8 A;  4HON A;  3VBR C;  3ZSK A;  4U2A A;  3I97 A;  1UZY A;  5KXC A;  4NII A;  4LJH A;  2JJ6 A;  1LU2 A;  2ZX3 A;  4AQ6 A;  4CA9 A;  4COZ A;  4IE0 A;  2DUO A;  5IW0 A;  4YRD A;  5DUV A;  4YZ2 A;  2XUM A;  3IMM A;  2PHW A;  2Z5W A;  2WR9 A;  4MGZ E;  4YVS C;  4AAP A;  5FO7 B;  4J25 A;  1VBB 3;  4BOW A;  1O3Q A;  3MIH A;  1YJK A;  2B9V A;  4XXP A;  4FPJ A;  1ZBE 2;  3GNE A;  4URA A;  4OZX A;  3UKT A;  2JE7 A;  4P5Y A;  2X53 S;  4HKW A;  3VZJ A;  3FZ3 A;  3N9P A;  4P9X A;  4BCU A;  2BQP A;  3AL6 A;  4RFT 0;  1DQ1 A;  3KCY A;  4CDX A;  2ADD A;  4CEY C;  1UWW A;  1LAJ A;  1WCQ A;  1CPN A;  5HXM A;  3OUH A;  3ZN6 B;  1HXS 3;  3N9O A;  1MQT C;  1VMJ A;  3SH4 A;  1L3J A;  2DFB A;  1WBF A;  3N35 A;  4XVH A;  1OA3 A;  3PUS A;  4LQR A;  1GZ9 A;  4BQW A;  3ZFF A;  3KT7 A;  1HRV 1;  3KHC A;  1VBE 3;  2EVX A;  4FAH A;  1MS3 A;  1BKZ A;  1PMJ X;  2R1B A;  3DEM A;  1Q8V A;  1PK6 C;  2YRO A;  1C8M 2;  2VVF A;  1RUD 3;  3AMN A;  1Q8Q A;  1D0G A;  2VNV A;  4QM8 A;  4FOW A;  4IEY A;  1SLA A;  5FZM A;  4XTM A;  3WF3 A;  4QAW A;  3RSJ A;  2HWE 1;  2XL7 A;  2XXZ A;  4UYB A;  3N36 A;  3LPG A;  3VB9 A;  2Y0O A;  3BB6 A;  3H1W A;  2QQL A;  2DVD A;  2BNO A;  3PU8 A;  4OLL A;  2QUO A;  3FE5 A;  4WVZ A;  4TXW A;  5IAT A;  4O65 A;  1PO2 1;  4P9W A;  3X29 B;  5A7W B;  4AQ2 A;  2X10 A;  4IEX A;  3DV8 A;  4C91 A;  5FR3 A;  1LOD A;  1RUG 1;  3IAP A;  3WG2 A;  5ERL A;  2YFZ A;  2B39 A;  4E8C A;  3AXE A;  4KGG A;  5I8Y A;  1H6Y A;  4QPI A;  4XJZ A;  2JG9 A;  2R07 2;  1VAL A;  1LJ7 A;  2E32 A;  2XB6 C;  3T3Y A;  1CES A;  1ND2 C;  4XBN A;  1VBE 1;  1RHI 2;  3DXT A;  1FNZ A;  1MS1 A;  1QU0 A;  1R1A 3;  2ORZ A;  2YV8 A;  4H7L A;  4ZXK A;  2XHN A;  5A32 A;  4QGN A;  1YWK A;  5DAB A;  5J48 A;  3AFG A;  3HJR A;  1PIV 1;  2RDR A;  3ROU A;  1H2L A;  1OVP A;  4BME A;  1MQT A;  4FFG A;  1MS5 A;  5FYZ A;  3ATG A;  3N9N A;  4DEQ A;  2YGM A;  3LDB A;  4LHN A;  2OZ6 A;  5C3P A;  3WCS A;  4NR1 A;  4NN0 A;  4LBQ B;  1POV 3;  5FKC A;  3HN3 A;  1NE6 A;  2IXL A;  5A1L A;  5LZ6 A;  1HXS 2;  2YB7 A;  4AK3 A;  2AR6 A;  1JS9 A;  5FRE A;  1CJP A;  1CPM A;  4RS5 B;  4TLF A;  2BFU S;  2F17 A;  4LBO A;  3USS A;  2PLV 3;  1VBA 3;  1RC6 A;  3OUJ A;  1UIK A;  2XKO A;  1K45 A;  4XW3 A;  3SXW A;  5B2G B;  3Q8F A;  1WCK A;  2R49 A;  4L8Q A;  4MLO A;  4XQ4 A;  1N1Y A;  5B4X A;  2VZS A;  4ASK A;  1OFN A;  4XFB A;  1I5P A;  1C8N A;  5LBC A;  2JD4 A;  5HCF A;  1CZT A;  2O0O A;  1DP0 A;  4AI1 A;  1ENQ A;  1FOD 3;  4IE4 A;  4A44 A;  2ARA A;  1XRU A;  2XR4 A;  1GV9 A;  3TOJ A;  5BNO B;  1JUI A;  1QF3 A;  4S2G A;  1OH4 A;  5BPX A;  3I59 A;  1RUG 3;  3SCH A;  4D69 A;  3TYJ A;  2NQY A;  3H50 A;  3GBG A;  4TLG A;  4X6Q B;  5KHJ A;  1B35 A;  2JDK A;  3I4I A;  1W2U A;  2YHJ A;  4QWN A;  4GIQ A;  1M4W A;  5JAX A;  4YWA A;  3U10 A;  4CTE A;  2D98 A;  5ANN A;  4YG0 A;  5C4W C;  1DQ2 A;  2C26 A;  4CDQ C;  3B00 A;  3CBN A;  3D82 A;  4LA3 A;  1UU4 A;  1NXM A;  4IDZ A;  4XFG A;  5EQU A;  3SH5 A;  1UW8 A;  2Y26 A;  4DRV A;  3LCP A;  4ZS2 A;  3AMM A;  3AKQ A;  1OF4 A;  4HMZ A;  3O1O A;  5F39 A;  4YAR A;  4Z2A A;  4HXC A;  2LM3 A;  3BUC A;  4ZY9 A;  3PVB B;  1ASJ 1;  4MOA A;  3UGH A;  2QQI A;  3RQ0 A;  2KD7 A;  2VTX J;  5C9A B;  5KR7 A;  5FZ7 A;  5A3L A;  4LHK A;  5CAD A;  1AR6 2;  1E5I A;  3WNO A;  1WCS A;  1DQ5 A;  5F8P A;  4CCC A;  3NNJ A;  1OFS A;  3KCC A;  4LOT A;  2C9K A;  2QVS B;  4PQ9 A;  5F5A A;  4V2W A;  4I2O A;  2P3I A;  4AEK A;  1JYW A;  2QQP A;  1O3S A;  2AAC A;  5FKB A;  5EV7 A;  1MR5 A;  2WN3 A;  4TYS A;  3LSE A;  2R30 A;  4YW7 A;  1IQA A;  1WZX A;  2GND A;  4K9S A;  3CKH A;  1VBC 1;  4IV1 C;  2QFE A;  5DAV A;  1F5J A;  2DTW A;  4PBO A;  3I59 B;  5FPB A;  3KF3 A;  1QJY 2;  2GP5 A;  1TEI A;  2YPD A;  4J1W A;  4M00 A;  2CAV A;  3N7M A;  5JUV A;  4Q0V A;  2R7E B;  5I0R A;  2H6C A;  1MZE A;  3QCW A;  5IFT A;  5LAS A;  1AX0 A;  1F35 A;  1ONA A;  1WUV A;  2DVA A;  5EP9 A;  5JOY A;  4GB3 2;  3THC A;  3C7G A;  4A2U A;  1AR7 1;  4XIO A;  1REF A;  5IVC A;  4O7X A;  4E2S A;  5C7G A;  2XBO 1;  3VHO A;  3ZFE A;  3KGZ A;  4XDQ A;  4UW5 A;  1POV 0;  1VB4 A;  2FD8 A;  4A42 A;  3ZOI A;  4Q4Y 1;  4CXY A;  4E4D X;  5F2W A;  3WW2 A;  1OLQ A;  1MS9 A;  3CQO A;  3HT2 A;  2J1T A;  2R04 2;  2WA4 A;  3PLQ A;  3T30 A;  1RMU 1;  4YW4 A;  3VBR A;  2PQS A;  1JZ4 A;  5CU1 A;  3AJZ A;  1SHW B;  4JGZ C;  1UY3 A;  1W8H A;  2QDR A;  2MEV 1;  1L7L A;  5FAX A;  5BV6 A;  2P3Y A;  4FXG B;  2VOV A;  2DCJ A;  5FFO C;  3TEW A;  1XYP A;  3FJS A;  1NA1 C;  5FCC A;  1AF9 A;  5DDJ 2;  4ASL A;  3I2O A;  1W9T A;  4XJU A;  4XUN A;  1WW4 A;  2Y6L A;  4XDO A;  1BLZ A;  5FYU A;  2QQJ A;  2W1Q A;  1NA1 B;  3NJY A;  4OVE A;  4YW1 A;  1J84 A;  4JDN A;  2JKB A;  4LNV A;  1ULF A;  4SLI A;  4Q2F A;  5A33 B;  2HWC 2;  1A8D A;  5IK5 A;  2WAB A;  5DPN A;  2DU0 A;  3PUA A;  2EID A;  3L9J T;  2JEC A;  1ULG A;  1CX4 A;  3EBR A;  3VDA A;  1H8T C;  4AYU A;  1ZRD A;  2BBA A;  4CDW B;  2VVD A;  1VMF A;  4XAB A;  4QHZ A;  5BY5 A;  4FOQ A;  3POY A;  3KVB A;  1YHF A;  3M8L A;  5J3U A;  1SCR A;  4D6S A;  1FNY A;  1AR6 1;  2SLI A;  4LHL A;  1V6I A;  3GXU A;  2AUY A;  4KG8 A;  3OY8 A;  1RTV A;  3JZV A;  4GWM A;  5E1R A;  2GN3 A;  3QH7 A;  4S2H A;  1NAE A;  5AC9 3;  1JZ7 A;  3H3Z A;  1K5M B;  4J6G A;  1MVQ A;  3H8O A;  2P34 A;  2J42 A;  3WDW A;  2QZ3 A;  4FFI A;  4IND A;  4DQA A;  4QHB A;  3TEX A;  1VBC 2;  1OLM A;  2E33 A;  3ZR5 A;  1R08 3;  3DN7 A;  2HWE 3;  4M3C F;  2W0X A;  3ZIX A;  2ZAB A;  5LA2 A;  1CQ9 A;  2G9G A;  4CDX C;  2EAA A;  2IZW A;  1SLI A;  2Z2S B;  3AYC A;  2WLQ A;  4XZU G;  3U14 A;  5ABJ B;  3MF6 A;  4Y24 A;  2BDR A;  3OGS A;  5FMD A;  3LEK A;  1LHO A;  2UWA A;  1UU5 A;  3BI3 A;  4PDW C;  4QPY A;  1W99 A;  2LS6 A;  1JI6 A;  1W9Y A;  3ABZ A;  1OI6 A;  5IAV A;  4AAX A;  1ASJ 2;  2YUE A;  2D93 A;  4NUB A;  3VZN A;  4AHZ A;  4CEW A;  3S5Q A;  5FZO B;  1S0C A;  3CLP A;  1VE0 A;  5KHH A;  1BVP 1;  1WW7 A;  4JGY C;  1J83 A;  2JDY A;  2WO1 A;  4YVS A;  4YYO A;  4M0H A;  2XGX A;  4ET7 A;  4Q4V 2;  1SPP B;  1GWL A;  1V00 A;  4NIG A;  3FX3 A;  3VBS C;  2QNK A;  2Y60 A;  4AWD A;  4BA6 A;  1TG7 A;  3ZYP A;  3M7A A;  3ECQ A;  5A3P A;  3VBS B;  2GC0 A;  4CP9 A;  1CAU B;  3Q8C A;  2OUH A;  1XNC A;  2J1V A;  2PHX A;  4UFL A;  5FYC A;  3WP3 A;  1QH7 A;  1V6M A;  1S2K A;  2W52 A;  3OSD A;  4LK6 A;  1S1A A;  4CCL A;  4R8H A;  3SNM A;  3PJQ A;  1ND2 A;  1HDK A;  3OEB A;  2Q8C A;  3PVO A;  3FFZ A;  1A3K A;  1WW5 A;  2GME A;  1GQG A;  4WVW A;  4Y33 A;  3VDD A;  5C9A A;  3O1T A;  3IDC B;  1AUY A;  5GZG A;  3MUZ 1;  3O5S A;  3T0A A;  1W6N A;  3E6B A;  3H7J A;  1YQ6 A;  2E7T A;  3C3V A;  4B8E A;  1W6P B;  4HN1 A;  1RVF 2;  2BOJ A;  2WS9 3;  1GOG A;  2ZMN A;  1U0A A;  1IPJ A;  3TB0 A;  1RUC 1;  4QU1 A;  1UMH A;  1H9P A;  1WLT A;  2I2S A;  4FPL A;  3VKF C;  5J1X A;  5EIY B;  1OF3 A;  1V6O A;  4W65 A;  5C70 A;  3ZXA C;  5CFC A;  1FX5 A;  5FXZ A;  2E51 A;  3ZKY A;  4KU8 A;  2UWC A;  4CU9 A;  4EN8 B;  2ZGU A;  1OPM A;  4Q5O A;  5T5O A;  3SLI A;  4DUX A;  3KT4 A;  1HB1 A;  2BZD A;  4FPG A;  4ES9 A;  3Q9O A;  4BIO A;  3T2T A;  2IXK A;  4I01 A;  1OLM E;  3QAC A;  4UI9 L;  2AZ5 A;  2YBP A;  2ZGN A;  4C1W A;  4V2V A;  2CV6 A;  2P1B A;  1JYI A;  5JIA A;  1NLR A;  4P14 A;  4WM8 B;  5FXW A;  4RN5 A;  4NHM A;  3WDU A;  5F5Q A;  4LKE A;  4WVV A;  4NPR A;  2KA3 A;  4MGK E;  4BXS V;  1QQP 1;  4UFK A;  4YW2 A;  4IXL A;  1PIV 2;  1SG3 A;  2A7A A;  1LNS A;  2LAL A;  3E5X A;  1R64 A;  3WUC A;  3POS A;  5K4L A;  4CRQ A;  4KWK A;  1PO2 2;  2BVB A;  2CDP A;  4E27 A;  2B5H A;  5J98 B;  5LK7 B;  4FTB A;  1NLQ A;  5C8C B;  1LOE A;  1GNH A;  2WSU A;  1BYH A;  4NRO A;  2V09 A;  4RR3 B;  2CGN A;  3THD A;  3U37 A;  3P5B A;  1AYM 3;  1W8F A;  5C8C C;  2EIC A;  3LF7 A;  5FLH A;  4AVS A;  3ALQ A;  3VZL A;  5CAZ A;  2VMH A;  5CYY A;  4CU8 A;  3V0B B;  1CZV A;  1WW6 A;  4NAO A;  1HJG A;  3INA A;  3WP6 A;  2GZW A;  3O1P A;  2CWS A;  2FDI A;  1W6O A;  1S2B A;  5K0U B;  3RNS A;  3A0K A;  2E7A A;  1GFF 2;  5FZI A;  2ILM A;  5FBJ A;  5KHG A;  5FZO A;  4TZD A;  2JIG A;  2GNT A;  1BZW A;  4A6O A;  3NO8 A;  3WG4 A;  5K0U C;  5JR2 A;  1QJE A;  4R9D A;  2XBO 3;  4XEZ A;  3OOX A;  3ZYR A;  4EJR A;  2ZKL A;  2GC1 A;  4XF1 A;  4LT5 A;  3N9L A;  4FI9 A;  2OKX A;  4LBJ A;  4JKL A;  5IVF A;  5KHK A;  2VBP A;  5GZC A;  2HH9 A;  2LRO A;  4D94 A;  4OQ8 A;  2BBV A;  1GZW B;  5FZB A;  4N7U A;  1W0O A;  3H7Y A;  2HWD 1;  2TUN A;  1ULC A;  1SMV A;  1Y9M A;  1AL0 G;  4HVO A;  2A6V A;  2RR1 3;  1YFY A;  4IET A;  3NNL A;  3NL1 A;  1A78 A;  2EA7 A;  3D3A A;  1HQN A;  4YM3 A;  4TTG A;  1VLN A;  4YVW C;  4D6R A;  5DUU A;  5C5U A;  4QB2 A;  5FZ6 A;  2LUW A;  5CFC B;  3IT8 A;  2JG9 C;  5I8S A;  1R09 2;  3FHA A;  4SBV A;  4LUL A;  3SH3 A;  3VBU A;  4CDQ B;  4UFM A;  4D7S A;  2ID4 A;  3ACF A;  4FPH A;  4JTN A;  4F3J A;  2JG9 B;  1F8V A;  2DBN A;  2VZ3 A;  2Q30 A;  2ZEY A;  4RSU A;  1RJ8 A;  3TBD A;  1W8U A;  3WNP A;  4NAM A;  1UAI A; 
#chains in the Genus database with same CATH homology
 3UET A;  2BGO A;  3T0B A;  2J1E A;  3K4Z A;  5F7U A;  1KEX A;  1CX1 A;  4PQQ A;  3FN9 A;  3WSO A;  3PUI A;  2WQ8 A;  2Y6G A;  5DMY A;  2JE8 A;  3C7H A;  3K75 B;  2QQN A;  2W1W A;  4L0P A;  2BER A;  4CU6 A;  4YPJ A;  5LA1 A;  2VZT A;  1OT5 A;  1GOH A;  1JU4 A;  3EYP A;  1W9W A;  4OMC A;  2VC9 A;  4CU7 A;  3WNN A;  2WZE A;  2DDU A;  2VZP A;  3NNG A;  3I97 A;  3VD3 A;  3ACI A;  4QDR A;  1DLC A;  3VD9 A;  3AC0 A;  2RJ2 A;  1UYX A;  2WUH A;  4OZO A;  3WF0 A;  3CMG A;  4QPW A;  4XUR A;  3DYP A;  3OGV A;  2B9V A;  1UXZ A;  3T08 A;  1UZ0 A;  4ZZ8 A;  4D0Q A;  4DUW A;  2J1A A;  3A21 A;  4P5Y A;  3T0D A;  1UWW A;  1WCQ A;  5HXM A;  4E8D A;  4QDS A;  1JZ3 A;  4XVH A;  3I2H A;  4XUO A;  1YQ2 A;  4M4P A;  1UMI A;  4LQR A;  3WNK A;  1JHJ A;  4W4Z A;  1PMJ X;  4KMQ A;  5IFP A;  3MO4 A;  3J7H A;  5DN2 A;  5JXI A;  3T2O A;  1ULP A;  4BK4 A;  3K4A A;  2WBK A;  2VZR A;  4ZZ5 A;  3WF3 A;  4QAW A;  3LPG A;  2VCC A;  2VTF A;  2QQL A;  2W47 A;  4TXW A;  3C8X A;  2X10 A;  3HEI A;  4LPL A;  2VL4 A;  3VDB A;  2VMF A;  3IAP A;  3OG2 A;  1GOF A;  1T2X A;  2YFZ A;  1K42 A;  2V72 A;  4E8C A;  1H6X A;  1NX9 A;  1H6Y A;  4ARX A;  2J1U A;  2E32 A;  2EIB A;  4A45 A;  2J1R A;  3WNP A;  2ORZ A;  2LW8 A;  2XHN A;  5IYY A;  4QX2 A;  1JZ8 A;  2QQO A;  4HG6 B;  3HJR A;  3CZU A;  1WKY A;  3LQC A;  2W91 A;  4DEQ A;  3WNL A;  2RV9 A;  3A22 A;  4UOJ A;  4MGQ A;  1UY2 A;  3LPF A;  4ZXE A;  2W3J A;  2VMC A;  3HN3 A;  1O8P A;  3CDZ B;  2QQM A;  2YB7 A;  4JHZ A;  3K77 A;  1K45 A;  2WN2 A;  2ZEZ A;  4UAP A;  5B4X A;  2B4K A;  2VZS A;  3W5N A;  1I5P A;  2VOT A;  1CZT A;  1DP0 A;  4A3Z A;  4A44 A;  2W46 A;  1OH4 A;  2W1U A;  2JDA A;  2Y6J A;  3MV0 1;  2VME A;  1US3 A;  2C26 A;  1L7R A;  2X09 A;  3NRU A;  5EJZ B;  5FUI A;  1OD3 A;  2VQU A;  1K3I A;  1UY1 A;  1OF4 A;  2VM9 A;  2VCA A;  1XPW A;  4Z2A A;  2CDO A;  2VR4 A;  2YFU A;  2W87 A;  3I3B A;  4ZY9 A;  4MOA A;  2QQI A;  2KD7 A;  3I3D A;  2JD9 A;  3WNO A;  1UY0 A;  3SKJ E;  3SEE A;  3NJV A;  1DYO A;  2C9K A;  2Y6K A;  1JYN A;  2W95 A;  3UNP A;  4JKM A;  1JYW A;  2WN3 A;  2WDB A;  4JX0 A;  5G04 L;  3CKH A;  4XUQ A;  3NQH A;  3DYO A;  1UX7 A;  1UYY A;  3I2G A;  4ARY A;  4BDV B;  3CIH A;  5JUV A;  2R7E B;  2XQX A;  5IFT A;  3THC A;  4CUC A;  3C7G A;  3EB7 A;  3ACH A;  1EUT A;  5C7G A;  3FL7 A;  2Y64 A;  5JMO A;  4A42 A;  4CVU A;  3C7O A;  2VZQ A;  3A23 A;  5JXG A;  3JXS A;  2J1S A;  4GWI A;  3CQO A;  4KWU A;  5CZK A;  3DEC A;  2J1T A;  2VZU A;  2DCK A;  4DEV A;  3VDC A;  2QBX A;  3HNM A;  4MGS A;  1JZ4 A;  2PQS A;  4DXR A;  1SHW B;  3MBW A;  1UY3 A;  1W9S A;  2DCJ A;  1D7P M;  3I2J A;  1GU3 A;  5I0D A;  3UES A;  1W9T A;  2QQK A;  3T2Q A;  4XUN A;  2Y6L A;  2QQJ A;  2W1Q A;  5LCW L;  2XOM A;  3F2Z A;  1J84 A;  1P8J A;  4P08 A;  2WO2 A;  4W8J A;  5LA0 A;  2WZ8 A;  2WAB A;  5DPN A;  3IAQ A;  2EID A;  4GZ9 A;  3I2F A;  4QX0 A;  1GNY A;  4BJ0 A;  3VDA A;  4QX3 A;  2BBA A;  5JXH A;  2W9X A;  1W8O A;  1XNT A;  3DYM A;  3W5M A;  2W1S A;  5A1A A;  2ORX A;  3ZM8 A;  3C7E A;  3GXU A;  3MV1 1;  1JZ7 A;  1NAE A;  1SDD B;  2V4V A;  4A4A A;  1GUI A;  4IUG A;  2YC2 A;  4MAD A;  2E33 A;  5IHR A;  5LA2 A;  2WYS A;  4XZU G;  4CUB A;  4KI5 M;  2C4X A;  1CZS A;  4XUP A;  3OGS A;  3LEK A;  4MO3 M;  2VZV A;  5DQ0 A;  4AG4 A;  1W99 A;  2LS6 A;  3VD4 A;  1JI6 A;  3ABZ A;  4AAX A;  3CZJ A;  1HN1 A;  4RYD A;  1W0N A;  3I3E A;  4PT6 A;  3VD5 A;  1JZ2 A;  2W5F A;  1J83 A;  2WO1 A;  4ET7 A;  4XUT A;  2VMD A;  3OGR A;  5JXJ A;  5IJR A;  3SEP A;  4P02 B;  4M4R A;  1TG7 A;  3IB3 A;  3P6B A;  3ECQ A;  1K12 A;  1PMH X;  3HPN A;  3WEZ A;  1US2 A;  3WF4 A;  2J1V A;  4QB1 A;  4OYU A;  5G05 L;  4DXS A;  3LEI A;  1NKG A;  3GGL A;  1JYX A;  1PX4 A;  3OEB A;  2HLE A;  2ZEX A;  1ULO A;  5B4N A;  2W94 A;  3MUZ 1;  3T0A A;  1RYY A;  3LEG A;  4GWJ A;  1GOG A;  3BGA A;  1NUK A;  2ZXQ A;  4OUE A;  1UMH A;  4QX1 A;  5J1X A;  5EIY B;  1GQP A;  1OF3 A;  2L9L A;  5EJ1 B;  1W8N A;  3BN6 A;  3K46 A;  4DXT A;  4DUV A;  5C70 A;  2RVA A;  3WF1 A;  3MUY 1;  2Y6H A;  1IQD C;  4W50 A;  1EUU A;  4LHS A;  3HNB M;  1XC6 A;  4DUX A;  1CIY A;  2BZD A;  2V5D A;  3ETP A;  3NJX A;  1JZ5 A;  3GM8 A;  4OMD A;  3SKV A;  4UI9 L;  3P1I A;  4A41 A;  4RN5 A;  3LE0 A;  4BK5 A;  4BXS V;  1SG3 A;  4PF1 A;  1LNS A;  3E1F 1;  2Y8K A;  1R64 A;  1BHG A;  2CDP A;  3WF2 A;  4P00 B;  2VCB A;  4CU9 A;  2ZEW A;  2VZ1 A;  1JYV A;  1O59 A;  3THD A;  3U37 A;  4CUA A;  2E31 A;  3T09 A;  2VO5 A;  2VJX A;  2EIC A;  3GDB A;  2WAA A;  4CU8 A;  5CYY A;  1L7Q A;  4D8M A;  1CZV A;  1PX3 A;  3C7F A;  2YC4 A;  2BGP A;  2JKX A;  3T2P A;  1KGY A;  1O8S A;  3OBA A;  2YG0 A;  2X05 A;  2J7M A;  3III A;  1UYZ A;  1GMM A;  4JKK A;  4QDQ A;  1UY4 A;  3FHQ A;  2EIE A;  2VZO A;  1JZ6 A;  2WO3 A;  1F4H A;  3OB8 A;  4A6O A;  1TVG A;  5JR2 A;  2J22 A;  3K4D A;  4FI9 A;  2E26 A;  2OKX A;  4JKL A;  3OEA A;  3VD7 A;  1XNA A;  5HPO A;  3A7Q A;  2W92 A;  3HNY M;  4QB6 A;  1MPX A;  3IDA A;  3D3A A;  2Z4F A;  4TTG A;  3I2K A;  1F4A A;  1UXX X;  3WNM A;  2VQT A;  4QB2 A;  3PUH A;  3FHA A;  1JU3 A;  4LKS A;  2ID4 A;  2XON A;  3ACF A;  3I2I A;  2WAO A;  3HOB A;  2VZ3 A;  2ZEY A;  2HYX A;  5C71 A;  3ACG A;  3WQB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...