1OH4A

Structural and thermodynamic dissection of specific mannan recognition by a carbohydrate-binding module
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
174
structure length
174
Chain Sequence
ARYVLAEEVDFSSPEEVKNWWNSGTWQAEFGSPDIEWNGEVGNGALQLNVKLPGKSDWEEVRVARKFERLSECEILEYDIYIPNVEGLKGRLRPYAVLNPGWVKIGLDMNNANVESAEIITFGGKEYRRFHVRIEFDRTAGVKELHIGVVGDHLRYDGPIFIDNVRLYKRTGGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-MANNOSIDASE
publication title Structural and Thermodynamic Dissection of Specific Mannan Recognition by a Carbohydrate Binding Module, Tmcbm27
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
total genus 38
structure length 174
sequence length 174
ec nomenclature
pdb deposition date 2003-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09212 CBM27 Carbohydrate binding module 27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 1oh4A00
3HNBM 3CDZB 2VJXA 3OGVA 4OZOA 3PUHA 3ETPA 4OUEA 2VCAA 3VD4A 4BJ0A 1SG3A 1OF4A 4CUAA 5EJZB 2ORXA 2VMDA 2QQOA 2VCCA 1H6XA 3I2KA 4QAWA 4P08A 1R64A 3ACHA 2ZXQA 3BGAA 4XVHA 2WQ8A 1IQDC 2VZQA 4LKSA 3W5MA 2W5FA 3SKVA 3I2JA 4JHZA 2VO5A 3VD3A 1UY3A 2VC9A 3OEAA 3DYPA 1F4HA 3OEBA 4PF1A 1GMMA 1W8NA 1UYXA 3HJRA 3K4DA 3I2GA 4LPLA 1UMHA 4DUVA 3VDCA 1ULOA 2W1QA 1O59A 5DQ0A 4A6OA 1WKYA 2QQIA 4XUTA 1NX9A 4XUQA 3ACFA 1OF3A 3WSOA 4E8DA 2BBAA 3T09A 3ACGA 3VDBA 4DUWA 2Y6LA 3T2PA 3T0BA 2YFUA 1GOGA 1MPXA 2VOTA 5LA0A 5HPOA 3NJXA 2VZRA 1TG7A 2WDBA 2BZDA 2J22A 1W8OA 2QQLA 3MO4A 3LEGA 2W94A 1UWWA 2L9LA 5EJ1B 4CUBA 3FHQA 4CU8A 2VQTA 2Z4FA 4AG4A 1PX4A 3WNNA 3JXSA 2E32A 5JUVA 3A21A 3THDA 3I97A 2WBKA 2JE8A 3WNKA 5B4XA 3ECQA 2Y6KA 1CZTA 3A22A 1W9WA 2W9XA 4CU7A 4DEQA 4DEVA 3HNYM 2VTFA 3VD9A 1JZ8A 4BDVB 5IYYA 4A3ZA 3F2ZA 3THCA 1JZ6A 2DCKA 1PMJX 4A44A 4DXTA 2R7EB 2DCJA 3VD5A 1P8JA 3WNOA 5B4NA 1K3IA 1BHGA 1JYWA 4XUNA 3IAPA 3IIIA 4JKLA 4MGQA 4ARXA 2VZOA 5HXMA 1JHJA 2J1EA 4M4RA 1L7QA 5CYYA 4A41A 1O8PA 3C7FA 3PUIA 2VZVA 3LE0A 4PT6A 2KD7A 3I2FA 2RJ2A 4MOAA 2VR4A 3D3AA 4CU6A 3IAQA 4ZXEA 4KI5M 3OBAA 2WZ8A 2WO2A 2ZEXA 3MBWA 4QDRA 1O8SA 4A42A 4DXRA 2W1WA 1GUIA 3OGRA 3GDBA 2Y6HA 3MV11 3WF4A 1KGYA 2LS6A 3K77A 1JI6A 1EUUA 3IB3A 2WO3A 4ZY9A 2QQKA 2PQSA 4JKMA 4XUPA 4QB1A 4MGSA 1WCQA 1UMIA 3T2QA 5JMOA 3FL7A 4GWIA 4OMDA 2OKXA 1F4AA 3WQBA 2YC2A 1GNYA 3DYMA 5C71A 2BGPA 4M4PA 4QB2A 1EUTA 4W8JA 1UYYA 2VZSA 4FI9A 2J1TA 1JZ7A 2Y64A 3HN3A 4UAPA 3NRUA 2Y6JA 3T08A 5LA2A 2QBXA 3ZM8A 1OH4A 1XNTA 3MUZ1 1LNSA 1J83A 3C8XA 2QQNA 4OYUA 4W50A 3I2IA 5DN2A 2CDPA 3EB7A 2YG0A 4QX2A 5A1AA 5JR2A 2XQXA 5CZKA 2WN3A 1UZ0A 3NJVA 3EYPA 2WYSA 3SEPA 4ARYA 1JZ3A 2VQUA 4QPWA 2YB7A 2WAOA 2BGOA 1NUKA 3WF1A 5DPNA 2C26A 3SEEA 3BN6A 3K4AA 3OB8A 4P02B 3LEIA 4GWJA 4QX1A 3CIHA 2XHNA 1GU3A 3WNPA 2Y6GA 5F7UA 3T0AA 5G05L 2W95A 4AAXA 3HNMA 4RYDA 1W9TA 3GM8A 3WF3A 2J1AA 3C7OA 4UOJA 2HLEA 2ZEWA 3LPGA 2J1RA 4HG6B 3MUY1 2W46A 4BXSV 3T0DA 5IFPA 1I5PA 3LQCA 1W0NA 3CKHA 4QX0A 2E31A 2JDAA 1HN1A 5J1XA 3VD7A 1H6YA 3WNMA 3WEZA 4IUGA 1L7RA 4D0QA 1CZVA 4UI9L 1W99A 3K75B 3UNPA 1RYYA 4GZ9A 3NQHA 1XPWA 2E26A 1K42A 4XZUG 3K46A 4QB6A 3VDAA 3WF0A 1PMHX 4JKKA 2W1UA 1ULPA 2RVAA 1J84A 1CIYA 2W1SA 2Y8KA 4XURA 3E1F1 5G04L 1XNAA 4Z2AA 1UY0A 3LEKA 3UETA 3LPFA 4QDSA 1US2A 2J1UA 3K4ZA 4JX0A 2EIEA 2ZEYA 2VMFA 2VMCA 4DUXA 5JXJA 1SDDB 2XONA 3OG2A 3OGSA 1UY2A 2W87A 3UESA 2WZEA 2VCBA 5JXGA 1JYNA 2JKXA 1JZ4A 3C7EA 5JXIA 4KWUA 3DECA 1DP0A 2QQJA 3CZUA 4QDQA 2V72A 4RN5A 2VL4A 3I3BA 3MV01 2WO1A 5IHRA 4ET7A 5IFTA 1D7PM 2EICA 3NNGA 3CZJA 2HYXA 3ABZA 4P00B 4TXWA 1OD3A 4ZZ5A 5JXHA 4P5YA 2V4VA 2W47A 4LQRA 1JYVA 1K45A 2DDUA 3A23A 1NAEA 4L0PA 2WUHA 5C70A 3P6BA 1OT5A 4QX3A 3GGLA 2E33A 2WABA 3J7HA 1NKGA 1K12A 2W91A 1SHWB 1DLCA 1UX7A 2BERA 2RV9A 1GOFA 3HPNA 2V5DA 2XOMA 4CU9A 3W5NA 1CZSA 2ZEZA 4BK4A 2QQMA 2X05A 2VZ1A 2JD9A 4TTGA 2YFZA 4A4AA 1W9SA 2VM9A 3C7HA 5C7GA 4XUOA 3HOBA 2ORZA 3HEIA 1CX1A 4CVUA 2EIDA 1JYXA 3CQOA 1UXZA 2B4KA 4KMQA 2C9KA 2C4XA 2VZUA 1PX3A 2J1VA 2YC4A 2VZ3A 5FUIA 2VZPA 1UY4A 1GOHA 3AC0A 3FHAA 1US3A 3CMGA 1UYZA 3P1IA 2X10A 3ACIA 3WNLA 4A45A 2WAAA 1TVGA 4OMCA 1T2XA 4MADA 2W92A 4D8MA 4BK5A 4PQQA 2EIBA 3IDAA 1JU4A 2J7MA 2B9VA 2ID4A 3I3EA 2VMEA 2W3JA 1UY1A 4DXSA 4E8CA 1GQPA 5LA1A 2J1SA 1XC6A 1JZ5A 3FN9A 1KEXA 4YPJA 1JZ2A 5IJRA 4ZZ8A 5DMYA 3C7GA 3I3DA 4CUCA 5LCWL 3SKJE 1JU3A 3U37A 3DYOA 3I2HA 2LW8A 3T2OA 4LHSA 2CDOA 2VZTA 4MO3M 3WF2A 5EIYB 3GXUA 1YQ2A 4W4ZA 2X09A 5I0DA 1DYOA 1UXXX 2WN2A 3A7QA
chains in the Genus database with same CATH superfamily
4GH4B 3SMHA 2X53S 1S0GA 3HNBM 5IK7A 2ERFA 1CQ9A 4D6RA 4CDXB 4XJ8A 4Q1PA 4NHXA 2DF7A 2ZCWA 4OUEA 5FBZA 1RXFA 1W6NB 3NKTA 4LIVA 4DO0A 3FUQA 2HYKA 2V73A 4PQ9A 1GZTA 4CUGA 2ORXA 2VMDA 3A0KA 3GALA 5A6QA 3RZKA 3VBRA 2GNDA 1STMA 1X36A 2ARCA 1OH3A 2XJRA 1AYN3 1HV1A 2ZOEB 2ZTNA 1H9PA 3DL3A 4HOOA 4QAWA 3AXEA 4XFHA 2RDNA 3GZUC 4H55A 4BYYA 2XKPA 4UFKA 3ZFEC 5C5TA 1J1LA 1H2NA 1OURA 1OA3A 3CBNA 1MEC3 2VZQA 3VBRB 2HEWF 1W8HA 3GF6A 4FPYA 4RHV2 4FTEA 1NCRC 2XLGA 4LKSA 3FC0A 1ULGA 5C3OA 4AVCA 4KL1A 3MYXA 3SKVA 3I2JA 4OUSA 3ZYGA 1AR91 2VC9A 2RR11 5FO9B 4H7LA 5D8AB 1ULEA 2DBIA 1CAWB 4CZSA 1HDKA 2PTMA 3K4DA 4LPLA 5JI7A 4LE4A 4QKFA 5K8SA 2A6VA 4DUVA 5FZLA 3BVCA 3WP6A 4FOWA 1ULOA 4XMIA 1R1A2 2W1QA 1E5RA 1QJZA 3UKVA 1AR81 1SCSA 2AH2A 3M2MA 2AGSA 1NX9A 4XQDA 4XUTA 3TEXA 4HSJA 4JZRA 4XAEA 2WNVC 4XUQA 4OQ8A 1OF3A 3WSOA 2ZHMA 1MZ5A 3T09A 1U5IA 4P14A 1AL0G 1WLTA 4QPIC 4PLOA 5FZFA 2PFWA 1CPNA 4RGAA 4FSJA 1GOGA 1JOJA 1C8M1 3ILRA 5HPOA 2ZABA 4EWDA 4MZUA 2GP3A 1AX2A 3NL1A 5JSPA 3WDTA 1LU2A 1TG7A 2WDBA 3B93A 2SLIA 3N4MA 2O8OA 5FY8A 1DQ2A 2VMHA 2QQLA 3MO4A 3LEGA 1UF2C 1ZZBA 3M70A 2Q4SA 5EJ1B 2EXHA 3PHMA 1IPJA 5FP3A 2W68A 1OOPC 4AG4A 4O9GA 1PX4A 4XHXA 4BA6A 4AEDA 1QJU3 1B35B 1VBA3 3AM2A 5L19A 1BLZA 4N9IA 3OBTA 2ZPXA 3EBRA 3VB9A 2KXLA 5M0TA 1NCQA 4HLTA 2YHJA 4LULA 1V6KA 4YNIA 1SLAA 5B4XA 2HBTA 1YI9A 3LF7A 4AEDB 4DMIA 3ST7A 3VBFC 1FT9A 2W9XA 1OD5A 2PAEA 4PLNA 1W28A 3VD9A 2VTFA 4NN0A 1JZ8A 3RJRA 1FNYA 4UBGA 5JMCA 2D5HA 1IQAA 4M3CB 4N53B 5LEKA 2KR2A 1LULA 1N47A 1JZ6A 1I6XA 1VMFA 1NLRA 1VBC3 1TME3 4M00A 5C8WA 1RUG2 5JOYA 5LZ6A 1RITA 1MQTA 3WR0A 1OQ1A 2H6BA 1BVVA 3ZXFA 5KC6A 1ZRDA 3VD5A 1P8JA 5CBLA 3CNAA 1K3IA 1PVC1 4Y3OA 4CCNA 5B4NA 4ASKA 4HZFA 2JEMA 1WWYA 3IAPA 5J37A 2XR4A 3PUQA 4C91A 4EYUA 4ES8A 1YCIA 1G8WA 1JBCA 3IN9A 1BZWA 5CYYA 1N1SA 2HWD1 3S6PA 3UKNA 4HPKA 1JW6A 2PLV3 1SBEA 5CADA 1SLLA 4BQWA 3BTZA 1UOJA 3K48A 2CWSA 2VZVA 4FFHA 3ZIWA 2VCMA 1ENSA 2RDSA 2VUJA 1FPN3 3OCPA 4Q2FA 5F6KA 1MS0A 4UF0B 3I2FA 4NIDA 1AJOA 5I93A 3D3AA 3O1PA 4CU6A 1LU1A 4ZXEA 3OBAA 3KHCA 2ZEXA 4XEZA 3VBUC 5BYNA 2HEYF 1AYN2 5FMOS 5ANQA 1GUIA 2TEPA 2JDKA 1LOBA 3GDBA 1O91A 3UJOA 3LKJA 1MEC2 5BNOC 1UAIA 5BNQA 3ZSMA 1R083 2QJVA 4HVOA 4IE6A 1EUUA 2VNVA 1T6GC 3AMHA 3WDUA 4YW2A 2WSVA 2PQSA 4BXFA 3ZYJB 5F5CA 4JKMA 4AFDA 4QB1A 4JHTA 2BUKA 1Q8SA 3APBA 5FYYA 4IXLA 1U5YA 5DUWA 3ELNA 5BNNA 2Z69A 1AYM1 3FL7A 1ULFA 2JDYA 2YYOA 4UW4A 3AFGA 4JGYC 4LKEA 4AGGA 5JOXA 4CXXA 3DYMA 4IEXA 1WMEA 4J6GA 4QB2A 1EUTA 3O1SA 4E4HA 3GJAA 1UYYA 4FI9A 4GJZA 4YZ4A 2A3WA 3VZMA 3WP3A 5BNNB 5FPXA 5BPXA 3MGUA 4MHRA 1RJ8A 1YFYA 2Y64A 5F5IA 3OTFA 2JG9A 3FMGA 2A6WA 1RUC1 3VKMA 3B00A 1AF9A 1Z0HA 3UK9A 2YV8A 1HXS3 2PHXA 1O4YA 3ZM8A 5GKAC 3AP4A 5ABJB 1DIWA 5K0UC 3KVBA 2JG9B 4AI3A 4XJAA 1J83A 1DZTA 1YO8A 3C8XA 4YG6A 2RS51 1UD1A 1Q5OA 2UY9A 3S7EA 4AHZA 2QE3A 1TEIA 2DWRA 2ZHNA 3FBYA 5DN2A 5GLWA 4NIAA 3LSEA 3U14A 3ZR6A 1KS5A 4OHZA 3VBOC 1BMV2 1H2LA 2YG0A 3FHIB 4QX2A 5A1AA 2DUQA 2WFF1 3NJVA 2RM23 3EYPA 2B8MA 3QACA 3A0NA 1NZIA 4FQ4A 1UZVA 3OYWA 4PI2A 1AX1A 1JUHA 1L3JA 1MQTC 5LWBA 1QJU2 5C4WB 1VBA2 4MGKE 2NLRA 1X9PA 1CVNA 5HCAA 3X29B 1WLWA 2JD4A 1QJY1 1NLSA 3LEIA 3N9OA 4Q0QA 4Q1RA 3WNPA 2GNMA 1IZ3A 3M3IA 5F7UA 4GB31 1OFSA 2NYYA 4AAXA 4P9LA 3LA7A 4CP2A 3D6EA 4YZ3A 5FOJB 4PDWC 5AVPA 3GM8A 3WF3A 3BCWA 1LRHA 3M8LA 3ASIA 2HLEA 3PDQA 5FPLA 1SEFA 1WCKA 2E7QA 5F6LB 2J1RA 5DAVA 5JPNB 3PU8A 4PBOA 4SLIA 1JS9A 1TME2 4BXSV 5E8AA 2SBAA 1YQ8A 3U78A 2RR13 5KHHA 4XF0A 4AE2A 5FY0A 5F37A 3RMXA 1REFA 3WLUA 1KFXL 1V6LA 3PNAA 4QU1A 3VDDB 4DRRA 3R05A 5A3UA 4YZ5A 3I59A 4ZPIA 3USSA 1UOFA 2RJKA 2LM3A 5A6YA 5FK7A 3VD7A 3KGLA 4YVWB 2HKXA 2E63A 4UYBA 1FATA 4D0QA 4WBBA 2OYZA 2GMPA 2PLV2 1ZZ8A 1W99A 3RYRA 3RRDA 3I59B 1W9YA 4NRQA 3A4UA 1V9U1 4GZ9A 1LB2A 3NQHA 5GZEA 1X7NA 1XPWA 4ZS3A 1BBT1 2E26A 3ZFFA 1LHVA 2R1DA 3U10A 4HVRA 3WW4A 4YW5A 1BEV3 3WVJA 1O3SA 1FPN2 4LBKA 1YNAA 1RUJ3 4QB6A 5I0UA 4QKBA 1PZ8A 2P3YA 5FZHA 1F15A 5CVRA 4C0BA 4NOTA 5BUVA 4AVBA 3GZTB 2W52A 2NMOA 4IL7A 4BOWA 5HI0A 1A34A 1ULPA 1RUNA 2CSGA 2DTYA 3D0JA 4QD2A 4HKOA 1JMUB 1UOGA 3SNMA 1DFQA 2ZGRA 3I4IA 3ETQA 3AXDA 1I5ZA 1CAVA 1CAUA 4F83A 2FDHA 2D6NA 4N43B 4Q4W3 3UYJA 1S1AA 1ASJ1 5AC91 2R0HA 2PHTA 2OPKA 1R082 1UY0A 2HBUA 1LEDA 2CV6A 3LOIA 1EV13 1US2A 2D43A 2V5YA 2WT2A 3K4ZA 4L11A 1CAVB 5DAWA 1CAUB 3KLSA 3D5OA 1LAJA 2VMFA 1SDDB 5A6XA 2ENRA 3B01A 2QNKA 2E6VA 3OG2A 4QM9A 1JN2P 2Q8OA 2FMDA 1FXZA 5J7MA 1A6CA 4N8MA 2WZEA 4IE7A 5BNPA 2HWF1 3WG1A 3O1MA 2JDMA 1W9FA 3K3OA 3IKWA 2A6ZA 5HBAA 5A7PA 5JXIA 4M0NA 3JUUA 2F4LA 2QQJA 4KWUA 3TNQA 1W6PA 4IEQA 4QDQA 5CA6A 5C8CC 4GWNA 5F1RA 3O1RA 4RR3B 4RN5A 4ONUA 3I3BA 4LLOA 1AL23 1WW6A 3RZMA 2Y0IA 4AFCA 1W2TA 1D7PM 4HSLA 3ZDSA 5I0RA 5FZ0A 3DPRA 4TLFA 1HXS2 3ABZA 2DCTA 4MG2A 3NKGA 4P00B 3BIEA 1ZBE1 1ENQA 1OD3A 1PVC3 3AMPA 4YARA 1Q8OA 4LORA 3EXUA 3S7IA 3AZWA 3AZXA 2AUYA 2OT7A 1QQP1 3KT1A 1J1TA 4IV3A 2RDQA 5CFCA 1CGPA 3DPRB 1DGWX 3SQOA 4HMZA 4KGGA 4L0PA 5C70A 2YZ4A 1YRZA 1OT5A 1URXA 1E5HA 2Z2SB 3KSCA 2WABA 1EAH1 1OA4A 3J7HA 1S2EA 2RM22 2WS91 3VL8A 3W20A 5CFCB 1N3QA 3KV9A 2VOXA 1CWPA 1G9CA 4CU9A 1CZSA 1YYNA 5F2WA 4B1LA 2VQ0A 1W03A 5FPUA 3TBDA 2QQMA 3G6JB 4DS0A 4LR4A 1QOTA 2YFZA 4L2NA 1S0BA 2ZMLA 5FMBA 3N36A 5C7GA 1Z7S1 3NJZA 2IXJA 3WCSA 2NMNA 3FZ3A 1PGSA 3FX3A 1NYWA 4QMAA 3KMHA 1ZA7A 3B9IA 1CX4A 1HW5A 3ZFGB 2RJLA 4DXZA 1UXZA 4JGZC 3ZFFC 3AYCA 4LUKA 2JIGA 4DRVA 1K5MA 1QOSA 2A71A 2YC4A 2RR12 1GZ9A 3POBA 3ACLA 1AYM3 3KCCA 3SCHA 4Y24A 4CP1A 4OFGA 3AC0A 3FHAA 4D69A 1GLHA 3MLKA 1LOEA 1VIWB 3M3QA 1YQ6A 2W2IA 1UYZA 2EVXA 5FZKA 1JYCA 1OFNA 3POYA 3P1IA 3IIAA 1XRUA 1XNKA 5IK4A 3AKPA 4K9SA 2VXRA 4D7SA 2YU2A 4FOYA 4K40A 2JIJA 2WLQA 2W92A 4DY5A 4YW6A 1T6BX 2EIBA 4TWTA 1LESA 1W2UA 1RUC3 3ME2A 3E6BA 2WR9A 1JU4A 4PI0A 4AVTA 2ADDA 4CEWC 2ID4A 5F39A 4RD7A 3GBGA 4QGLA 3B94A 3MFCA 4NUBA 1XE0A 1V0AA 1BEV2 1RUH1 1VMJA 3M1HA 1RUJ2 3CJIC 4R9DA 1HB3A 5A3LA 1ND2A 4M3CF 2J1SA 1ZBA3 3FN9A 4NRPA 3ZKYA 3KZ4C 4YPJA 1JZ2A 5A3WA 2VW1A 4LT5A 1XBFA 2O1QA 2EF6A 1BQPA 3MPPG 2XWJB 4XQ4A 3U4SA 4LUMA 1Q56A 4YW7A 1YJKA 1Y9MA 3KV6A 5LEJA 1K5JA 4CDUB 5DMYA 1ND3A 2RDRA 1AR61 1DLLA 3JD73 3ENRA 2Y60A 4QPGC 3IM0A 4FPEA 4Q4W2 4UXAA 2GDFA 4XYXA 1ENXA 3CHXA 5DUVA 5CB7A 2UY8A 3SKJE 1JU3A 3J4UH 2WT1A 3AP5A 3DYOA 1OLQA 3TAYA 4LHSA 4XDQA 1G9AA 5ACA3 1RMU1 4XABA 1KD7A 4BCUA 4NHYA 4W4ZA 2WWJA 4LBQB 4PIXA 1BYHA 4LNVA 1MS9A 4QQLA 1H4HA 2LRPA 3OBRA 4OVEA 5FAXA 3OPTA 4UFHA 1OF4A 3VUOA 4L8QA 4F3JA 1BK0A 3CDZB 3TRSB 2VJXA 1PO13 4OZOA 3PUHA 1QWRA 4KQ7A 2ZMNA 3ETPA 3FBMA 3RNSA 4C0HA 3N9QA 3TN93 4GWMA 4NAMA 1J58A 2ADEA 3H3LA 4QU2A 3J8F3 4BJ0A 3VBSB 2BPA2 4U2AA 1AL22 1SFPA 3DGTA 1POQA 4JTOA 5EJZB 3AJYA 3ZN6A 2R32A 4NWVA 1GYKA 4X6RB 1ALYA 2VCCA 4LKFA 4NPRA 3I2KA 1PVC2 5FZEA 3V64A 4P08A 1R64A 1WLCA 3PIJA 4CDQC 3BGAA 3JCIA 3J7MA 1OQEA 3J9SA 3MW4A 4OUMA 4QXKA 4V1PA 1ULCA 3ZN6B 2X5IA 2CNAA 4FBFA 1F35A 4JV4A 4NMIA 4I3GA 1IQDC 1QJFA 4OLLA 3RZLA 5GLZA 2KA3A 1QDCA 3DXTA 3D4KA 4NIGA 1HB1A 4AHXA 5J48A 3NNMA 5DAXA 2JENA 1BBT3 4FFFA 3P5BA 3POWA 3IMMA 3SHRA 1SQ4A 1JUIA 2VO5A 5GZGA 1UY3A 3D82A 3DYPA 2ZJCA 3OD0A 3ZKUA 2A3XA 5FCCA 5EYXA 4BQ2A 4URAA 4LA2A 1W8NA 2QDNA 3M3CA 2OIIA 2PXJA 4BQ5A 3M3EA 1UMHA 4R9CA 3JBG1 1QNWA 5H9SA 5LK7B 5DG2A 3WG2A 3ON7A 2O8QA 3OPZA 4KG8A 5CKQA 1SLIA 4E8DA 2BBAA 5A3MA 1ASJ3 1YQCA 3RFRA 3NAPC 3ACGA 2KM2A 3BODA 4DUWA 5KWRA 3VDBA 1A8DA 3T2PA 4IEZA 3T0BA 3O0VA 1HKDA 5LA0A 3N7KA 5IVFA 3QLQA 3B7MA 1OPMA 3IT8A 2ET7A 1AYM2 5CFDC 2IXKA 3RZJA 4P9JA 3R4DB 4KGQA 2PYTA 3ZN5A 5F3CA 1ZVFA 2FBEA 4AYUA 3EMRA 1W8OA 1LECA 2IVIB 4IETA 4D7TA 3NNLA 5EPAA 4XC9A 5JZGA 4FAHA 2D7FA 2W94A 4S2DA 1ND3C 1REEA 1UWWA 3V65A 4CUBA 5A7WA 4O9EA 3FHQA 4CU8A 2Z4FA 2DUOA 2A1XA 1RUC2 5IK8A 2RHPA 3USUA 1XQNA 2A75A 1O5UA 4PBPA 5JZGB 5JOWA 4LKDA 4EWAA 3ES4A 1SLTA 3AKSA 5HCFA 2ZGOA 1KXGA 1YXWA 3ZFEB 3I97A 3LOBA 2PQQA 1Q8QA 3WHTA 1OUSA 1QXRA 1V6JA 4BIFA 4CRQA 4IQPA 1G9FA 1HQLA 2FCUA 3QD6A 2CGNA 1MS5A 3USUB 2Y6KA 1QH6A 1CZTA 1RVF1 3ES1A 4XF1A 1QQP3 4ZU7A 2BNNA 3VBHC 4EWEA 3U1XA 3V0AA 3ZSKA 3HNYM 2X8KA 3FFZA 4EV0A 2YMZA 3IPVB 5IYYA 5J3UA 3KWVA 1OBNA 2QVSB 1EAH3 4G9SB 3F2ZA 1QJX1 3JD72 5FXWA 2WNUA 2DCKA 5JPMB 2D97A 1PMJX 4FPFA 4A44A 4DXTA 2ATFA 1HJFA 2RE9A 3FLTA 4FO9A 1WD3A 5E16A 3AP6A 5JSOA 1VRH1 3WCRA 4EN0A 2B39A 1CR7A 1LGNA 1V70A 2BFUL 3WNOA 3ZLIA 5ACA2 1BHGA 4XUNA 2QQUA 1MS3A 1Y4WA 1C5HA 2VVFA 1LOFA 1RUD1 2LROA 2G9GA 2R49A 3DKQA 2VUCA 3IIIA 3NVCA 4GH4A 4INDA 4ORFA 4QHOA 3ZO0B 2VZOA 2GALA 1D0HA 2J1EA 1WZXA 4XBNA 4AVAA 4ARXA 3ZMNA 1OI6A 3LIGA 4AR2A 4IV1A 3SC7X 3U75A 1PO12 4RQPC 4XHBA 4Z07A 1C5IA 1S0IA 4ASMB 1LR5A 2YXSA 4CPBA 4XXPA 1PGW1 3S5AA 1VBB1 3MLJA 2FCVA 3C7FA 4LBNA 3TN92 3LE0A 2PELA 1XE8A 4J25A 2PN5A 3J8F2 1UCXA 4PT6A 5A80A 2JG8C 1J3QA 1J3RA 4BE3A 1VLNA 2NZ9A 1IGOA 4LK7A 4IV1B 4HETA 2ZGPA 2UWCA 2XJPA 3NJYA 2CAUA 5SV8A 1C57A 2VULA 3PVBB 4FT8A 2WINB 3WHUA 2B9UA 1IS6A 1PK6C 2ZGLA 2VGDA 4A42A 2WZR3 3H8RA 2R30A 4NRMA 3AX4A 5FJKA 1G9DA 2ZGUA 3MV11 1U5XA 4AI1A 3UGGA 4KWLA 2JE9A 5IVJA 1KGYA 3K77A 2R1BA 1H8TA 1MACA 1NT0A 1W06A 3IB3A 4ZY9A 1PIV1 4IEPA 4XUPA 1BBT2 4E2QA 1GBGA 1WCQA 1UMIA 3T2QA 5D8AA 3HN1A 1HRI1 1JZ3A 5CAZA 1RUH3 2ZGSA 5LA9A 2Q8CA 1H8TB 1CAWA 3TEZA 2RS31 4H7MA 3PURA 3TB0A 1FI2A 1IHMA 1NG0A 3OGJA 2JJ6A 2BGPA 4M4PA 2BP6A 2HJIA 2R041 4JRLA 3PU3A 1G86A 1WMFA 2BDRA 2J1TA 3UGFA 4Q0SA 1TZOA 2QCSB 3WW2A 1GP4A 2ARAA 3GBWA 4UW3A 3WG3A 4AWDA 5C9AB 4GD4A 1HIXA 1ASJ2 5AC92 1NE6A 2Y6JA 4WM8A 2XJSA 4S2FA 1H2MA 3GNEA 4GXLA 3T08A 2E7TA 5D2AA 1Y7BA 5FO8B 5CKMA 3WUCA 3POSA 1LNSA 5E88A 4EN8B 2B7YA 1JHNA 4WM8B 3MIDA 1AR73 4W50A 2Q1ZB 1COV1 2RMU1 1BXHA 4UT5A 2CDPA 1I9RA 3EB7A 3PVOA 2DTWA 1X8EA 3ITQA 3IWZA 3URFA 3LZZA 5CG8A 2WN3A 1NA1C 3PVNA 3I2OA 1FOD3 4QHBA 5LBFA 3W58A 3M4FA 3KT4A 3NSTA 3L9JT 4FPLA 1AZDA 4ARYA 2GH8A 4CP9A 4Q4Y3 1B35A 1VMHA 2P37A 2YC0A 3DV8A 5AVAA 4OI0A 1YEWA 2C1FA 1NUKA 1VRBA 3BOPA 5DPNA 1W8TA 3AK0A 3RS6A 1RHI3 4LTAA 1DZQA 3MEPA 4LE3A 4YW1A 4XQWA 4CP9B 4HN1A 5AFEA 4LHKA 5BNOB 4GH4C 5KHJA 4K1ZA 5G05L 2W95A 5L9BA 4MGIE 1QQP2 4RYDA 2A6XA 4CDXC 3LEMA 1W9TA 5K9YA 2J1AA 4I01A 1VE0A 4UOJA 3O1TA 4Q4X1 1X8MA 2FD8A 4M3CA 4N53A 3LPGA 2F17A 1ULDA 4XCBA 1LOGA 1EAH2 4BMBA 2W46A 5EJ3A 5FQ0A 4Z82A 4I0WB 1CJPA 1XB9A 2VMGA 2XVKA 1RUF3 2D40A 3NV2A 3PUSA 4YGBA 3B02A 5FO7B 4OQ9A 2QDRA 1WA4A 2BQPA 4XJ9A 4HXCA 5FQ0B 3NO8A 4B1MA 1W3VA 4Q4V1 1DYKA 1W8ZA 2HWB3 4AEJA 4EE2A 1ZRFA 4UFJA 3VKOA 1H6YA 1FNZA 1IS4A 3VBRC 4Z2WA 4YG3A 1L7RA 1CZVA 3E5QA 5FYSA 2HWC3 1WD4A 4Y1VA 2IFWA 4RFRB 2Y0OA 3EJKA 4D94A 5K0UB 2GU9A 2ZKNA 2VH9A 5LK5A 1K42A 1IG0A 4QQ2A 4UF0A 3EQEA 5D8AC 4DQAA 5EHDA 2WWSA 4IEYA 3RPQA 2I2SA 3VBOB 3M3OA 4JDMA 4OI1A 4CXYA 3NV3A 2W1UA 5TSWA 3EO6A 4S2GA 2K9ZA 4EN7B 4BWOA 3HMYA 2RVAA 4P9YA 4AI2A 4PF5A 2WZPP 3KV5A 2WZR2 2ZZQA 3NNFA 1NZCA 2ZS6B 4YVSA 2W1SA 2Y8KA 4YM1A 4WVMA 1V00A 4GMP1 1AXKA 2QFEA 3BTYA 1GZWA 1GR3A 4YM0A 3THPA 3MDPA 5FLJA 1PGL1 2CY6A 2DU1A 3MF6A 1V6NA 3DN7A 3T2TA 2WJSA 4YVSB 3SCFA 3LPFA 1GNZA 5E1RA 3GHNA 4WVMB 2EIEA 2P3JA 5FYBA 2PHUA 2VMCA 1GZWB 3GZAA 1PZ7A 4XMAA 3I2DA 1RUH2 4HK8A 1RUI1 1BJQA 1VPHA 4AFMA 3JB4C 1UY2A 2R061 1JYIA 1R091 3UESA 3UETA 2Q1MA 3AYDA 2BGCA 3AL6A 1JYNA 2FDKA 1D4M1 3MIBA 1GV9A 3BTAA 4AXOA 4IE0A 5CU1A 5BV6A 4ES9A 4UFMA 5DAPA 2XQRA 3WD5A 1QJX3 4N90A 2Y26A 4CCOA 4YFZA 3PL0A 5IHRA 2A70A 1OKOA 1IG3A 1VRH3 1OC1A 2OX0A 3NNGA 5ABJA 2HYXA 3LGRA 3TNPB 4OCTA 1SBDA 4JCKA 4QQPA 4MGTA 1H1AA 1N3OA 4P5YA 5FZ7A 4AEDC 1LOCA 2V4VA 1UIJA 3VLBB 1C4RA 1D2SA 2YPJA 3ZYHA 3BB6A 4RS5B 1K45A 1AR72 2VECA 1NCQC 2XBO3 3A23A 4JQRA 5EFUA 1NAEA 4BQ1A 1O4TA 1JYTA 1E5IA 3OD4A 4N53C 2VE1A 3GGLA 2E33A 4P9GA 4FAGA 2W91A 1FOD2 3AMMA 1VBB3 1XNDA 1UX7A 2EA7A 3HQRA 1UN1A 2CU5A 2ZKLA 2V5DA 3HPNA 2XOMA 3W5NA 4Q4Y2 5C4WA 2ZACA 1WMDA 2X05A 4GULA 1CAXB 1POV1 1RHI2 1W9SA 2VVEA 2ZGKA 1OLRA 2DCZA 1IKQA 3OUJA 5F3IA 2TBVA 2YGLA 1DGRN 1YIFA 2D93A 4XJWA 3WV6A 3HOBA 3PMSA 2WA3A 3IZOA 3HEIA 1TE1B 5DDJ1 1OSGA 2GMEA 2IWGB 1S4CA 4CPBD 1WA6X 4CVUA 3VV1A 3WQ7A 1CX1A 2Z42A 2I74A 1Q3EA 4CCDA 2EIDA 4DB5A 1JYXA 3MFAA 2B4KA 2HWE1 2O14A 3LA2A 4A6SA 2IC1A 3Q8BA 4AL9A 2QQWA 2C9KA 2DCYA 2C4XA 4XACA 3H50A 1RUF2 2CYFA 3MIHA 5FUIA 4XFGA 3VDDA 4JQTA 5FZBA 4ZONA 3S5QA 1WCUA 2QZ3A 1GOHA 5F2SA 2R071 3B5LB 1OQDA 2MEV1 2RS11 2OQ6A 3CMGA 5DUUA 1AR93 1DQ5A 4YVWA 4W65A 2HWB2 1W6MB 2X10A 3WNLA 2VD7A 5LRRA 1Y3TA 4A45A 5C8CB 4LOSA 4X8PA 3WUDA 3ALQA 2JKBA 5IVEA 4YLZA 1GWLA 5IUQA 4BK5A 1W3XA 4PQQA 4YSFA 2HWC2 4ISQA 1HB2A 3FE5A 2MNGA 4FFGA 4GMP0 4MX3A 1ZRRA 1AR83 2AYHA 1F31A 1VBD1 5FRAA 3I3EA 4BU2A 1D0GA 3ROUA 5GLVA 3R4SA 1LKNA 4A7ZA 4Y22A 4DXSA 4E8CA 2WSUA 2WIIB 4AW7A 2P2KA 2ZA9A 1IKPA 2AREA 3RYPA 2RMU3 3MF9A 1PNFA 5IJRA 4QQOA 2XDVA 3Q8FA 5BNNC 1C8M3 1C8NA 3SH5A 1RUOA 2CWMA 4NROA 4YWAA 1OXCA 4Y22B 5EQUA 1ODMA 1XNCA 4N43A 5FPBA 3O0XA 4R9BA 4ZZ8A 1S0DA 2WT0A 3C7GA 3I3DA 2ETEA 1UOBA 1W6OB 5GZDA 3AKTA 3U37A 1W0PA 3HIFA 3I2HA 4XXAA 5HCBA 3K2OA 1W6QB 1CESA 2PHRA 2BWCA 4PJYA 2CDOA 5B2GB 2VZTA 2JG9C 5EIYB 1XYPA 3RVHA 2XUMA 1YQ2A 2VTXJ 3P3PA 2X09A 4RHV1 3H8XA 1GFF2 4JC1A 4Q26A 1DYOA 2RG4A 3TOJA 2WNOA 5FZ3A 5JVVA 1NOVA 4FFIA 4X8NA 5LY2A 3SISA 1C28A 3I49A 4FVVA 3ZSLA 3DKWA 4JVAA 4V2WA 1VB4A 5T54A 4Q4X3 3LSDA 2BVBA 2VCAA 4IEWA 4DZGA 4OHWA 2LTNA 4RR3A 1CN1A 1FX5A 3G7DA 3VD4A 3H0OA 2YBSA 1QJX2 3T30A 5HV0A 4K7JA 5A7SA 4EQVA 4CUAA 2GC2A 4ATFA 2IVJA 4PLMA 4YM2A 3ZXJA 1GQGA 1VRH2 5JIAA 1HRV1 1H6XA 2ZAAA 5FZIA 1TNRA 4MYEA 1G6NA 5C3RA 1POV0 1F9KA 4P9XA 4XVHA 4K20A 1SMVA 1SPPB 2G9ZA 2Q8EA 1JXNA 2GNBA 3BOWA 4YYOA 2E51A 2AENA 2XBO2 2D6MA 4HANA 2GH2A 4AHWA 5JAXA 1PNGA 1SDWA 3R0RA 4V2VA 4CEWB 1G9BA 3Q8CA 2Y34A 3W5MA 1YC61 1GZCA 1X50A 2Z5WA 3INAA 4IEUA 1VBB2 2DUPA 2FCTA 2HWD3 5JCTA 2XUEA 4JHZA 3VD3A 5LATA 5JDBA 1F4HA 3POGA 1QXPA 4Y1XA 5KBFA 3JQXA 3FUOA 4HK9A 4PF1A 1NQDA 2VOVA 3KT7A 4M01A 4MH0E 3HJRA 4QX7A 4YVWC 1JTZX 1GICA 3PTRB 1GANA 2JDHA 3VDCA 2J42A 5DQ0A 1O59A 4A6OA 4DPNA 1WKYA 4NIHA 3RI8A 2QQIA 3R4UA 1XYOA 1DCSA 3ZXKA 1ENRA 2ZGNA 5J96B 3ZFGA 4GAZA 4LK6A 2BOIA 2XJVA 5DZEA 2OPWA 2Y6LA 4O61A 4G4FA 1VJ2A 2YFUA 3MIFA 4FPOB 4I2OA 1LGBA 1H30A 1IPKA 4P9WA 4R8HA 1RUI3 5IK5A 4HKWA 4J1WA 4MGZE 5F5AA 1Q43A 1GKBA 4URTA 1OMIA 2R063 4I3PA 1R093 2BZDA 1DGLA 1AR92 3AL5A 3N9MA 3M7AA 1D4M3 4N43C 5I0SA 1QH7A 4Y5SA 4NHLA 1PMIA 4E4ZA 2G9FA 1AXYA 1HQNA 4MV2A 2D3SA 2VQTA 3CJXA 5FPAA 2XVLA 3WNNA 4MUVA 3I8TA 5T3NA 3JXSA 3TEYA 2E32A 3WW1A 1AR82 2QTWB 3A21A 4XJUA 3THDA 4CDQB 5JUVA 5J36A 2WBKA 4OHVA 3CF6E 4L97A 3RQ0A 4FP3A 3OGGA 1EYBA 3GZEA 3OY8A 1WMXA 2WYFA 4XF9A 2IXCA 4GQ7A 5FYIA 3CL1A 3T4VA 2DVBA 2G1MA 2RMU2 3BTXA 4DEQA 1F5FA 4DEVA 1C8M2 1VP6A 4IDZA 1N3PA 1HV0A 5LB6A 4CDUA 4BDVB 1Y9GA 2RS53 4IERA 3FJSA 3OY8B 3QH6A 5FV3A 1S0EA 5BNPC 1XSQA 2BEOA 4LO5B 5FK8A 3THCA 5FKBA 1O5LA 3POEA 2DFBA 4TYSA 2JWPA 5H9QA 2R7EB 4XBLA 2NPIA 4WVVA 2P17A 5CNAA 3KCXA 4CEYA 4D7YA 3O12A 2WFF3 3SITA 1DG6A 2OW4A 4YGDA 4LBQA 1UU4A 1WBFA 3N3HA 1MS1A 1S2KA 4AEKA 5H9RA 2CGOA 4LO7A 5DUXA 2FDFA 2Q0AA 4JKLA 3TWIA 1AJKA 5GM0A 4MGQA 5FYMA 1DQ4A 3DPRC 4OI4A 4WM7A 4CEYB 1O3RA 4M4RA 1L7QA 3O1OA 4LO6B 3AVRA 3KCYA 4LJHA 4EN9B 1TMF1 5JR7B 3WP4A 1QJY3 1UPSA 3S57A 1O4ZA 1O7FA 3E6CC 4Q4X2 1KFUL 3AKRA 4GB33 2H6CA 2P6HA 2ZX2A 3PUIA 4IV3C 1ZZ9A 4WM7B 2C0ZA 3VBSA 5C5UA 5CFCC 2Y6FA 5KHGA 2HWE3 3AB0A 3WNXA 5FZ6A 2KD7A 4JDOA 2CGPA 2RJ2A 2YU1A 5EXOA 2DV9A 3I54A 1IOAA 4MOAA 2VR4A 2BWAA 5FTTC 3ZVXA 1UU5A 2DBNA 4UW6A 4KI5M 4Y1ZA 2WO2A 3BPZA 1ZRCA 1XU1A 2Z79A 3MBWA 4QDRA 1O8SA 4QWNA 2FZ1A 2RS13 5FR3A 1DU3D 4K6BA 2W1WA 3OGRA 1ST8A 4XTPA 2BTVC 3WG4A 2Y6HA 4KBBA 4YRDA 3MW3A 2EXIA 3MIEA 4CDWB 2ZZJA 4YZ1A 1H0BA 4MVTA 4XOGA 2LS6A 4KG0A 3ZXDA 4ATEA 2XMLA 3ZDVA 1W8FA 3RZHA 2QQKA 2D3RA 3WY6A 2JB4A 2B42B 4P5HA 4QKDA 2HWD2 4UFLA 5FMDA 4MGSA 1WW7A 1BMV1 1VBD3 5T5LA 5IVYA 5FZDA 3T1MA 1V9U3 4GWIA 4NR1A 5FYUA 3VBHB 4OMDA 1CONA 1V6MA 1F4AA 4AAPA 2YC2A 5F3EA 4CTEA 1GNYA 4AQ6A 1K5MC 2O0OA 4XDOA 3WQ1A 5C71A 2B46X 4QGNA 5T52A 3RI9A 3DXUA 4W8JA 1M06G 2IFRA 3ZPOA 3POJA 1QJU1 5FYTA 1VBA1 5L7OA 1JZ7A 3J26N 5FZGA 4GKYA 2X29A 2Q30A 5A7OA 5EYYA 4B7KA 3SH3A 4UAPA 1X33A 4D6SA 3I7DA 1FAYA 3TEWA 5FMOL 1Y43B 3UV9A 5L7OB 3KGZA 5LA2A 2QBXA 3ZYRA 3WDWA 4SBVA 4AF9A 1XNTA 3MUZ1 3POFA 5AC93 1W8WA 1QNYA 4AZZA 4AEMA 4XCAA 2QQNA 3KHBA 4FXKB 2VQAA 1RGSA 3S30A 5K7PA 1RUI2 4OYUA 2BYVE 2WKKA 3I2IA 4XETA 4CCKA 5I91A 2R062 1VBC1 1HLCA 1OPOA 1R092 1TME1 3MW2A 3ZYBA 5KHIA 1LHNA 4BLJA 1MS4A 3ZXEA 4CDUC 3RGBA 2XQXA 4NPLA 2JG8B 1ND2C 3FFQA 3N7JA 5CZKA 5FY1A 1UZ0A 1D4M2 5IVVA 4W6XA 1OA2A 2WYSA 5FP7A 1DBNA 2BNMA 2HWF3 1E5SA 2VQUA 2YGMA 4GALA 4QPWA 4LMFA 5ANNA 3VKNA 3KB5A 1AUYA 1UIKA 3ZFEA 3U4XA 3JB8A 4Y4YA 5DAQA 3SEEA 1HRV3 3MICA 3K4AA 3VL9A 3NV1A 2PLV1 4GWJA 4QX1A 3WX5A 5IAVA 2XHNA 1GU3A 3ORJA 2W39A 3ZOIA 5KC5A 2XL7A 3T0AA 4ZS2A 3UL2A 4LA3A 2VU9A 2D6LX 1ZBE3 3E5UA 1TQ5A 2YBPA 1FPN1 3C7OA 3IPVA 4LITA 4LBJA 3U11A 4AK3A 4CXWA 1TNFA 1S55A 2ZEWA 1RJ7A 3LB9A 4XPVA 5FP4A 2RS52 1LENA 1NCRB 1BVP1 2PA7A 5I8SA 4B4QA 2VBPA 2LALA 3T0DA 5IFPA 5JLVA 1I5PA 2I07B 3LQCA 3UT0A 3AYAA 1RL3A 3LFMA 3RWNA 3KS7A 1RXGA 2WFF2 2D6PA 3C3VA 2WS93 2QZ2A 3PUAA 5GLUA 2P1BA 2WNVA 1R081 5J1XA 4AI0A 2BBVA 2I45A 2OZJA 3WNMA 3AP9A 2XJQA 3WEZA 4QPIA 2OVUA 5BY5A 5ERLA 5KXDA 1QU0A 4QKNA 5DDJ2 3K75B 3RWKX 1QJY2 4ITCA 1CIWA 1Z7S3 1RYYA 1H8VA 1SCRA 2WNVB 3DEMA 3HQUA 2X5IC 1QHDA 4GB32 3E5XA 4C1WA 5ISLA 1FMD1 2VOWA 1MVQA 4TN7A 2DVDA 2HWE2 2IZWA 3H1YA 4QPIB 4UBHA 5IAXA 3J7NA 2GN3A 1KDMA 5DZFA 2HEVF 4FP2A 3UGHA 3BYWA 3VDAA 3E6DA 4YW3A 4N7IA 5H9PA 3T1LA 2GC1A 3UJQA 4BM8A 4JKKA 5FOBB 4MXVA 1S0JA 1I1EA 2BOJA 4NHMA 1W0OA 2JICA 2PAKA 2ZGTA 2C24A 2RS12 1LODA 4TLGA 1CIYA 2D6KA 1UPIA 1OOPA 4E4SA 1UKGA 2XG3A 4Q5OA 4XURA 1QIQA 5DG1A 3E1F1 3BALA 1XNAA 1HXS1 2ZGQA 4GIQA 4BHPA 2JDPA 1VALA 2YY1A 4Z2AA 5FXVA 2GMMA 1GNHA 1W2AX 3LEKA 3HBZA 1NE4A 5F8PA 1OOPB 4Q27A 4HFSA 1CJDA 5FYCA 4NWWA 4XJZA 1SLBA 2J1UA 4JX0A 4XW3A 1UL9A 2ZEYA 3Q9OA 1QF3A 2BNOA 3N9NA 4MGYE 1VBD2 4XFBA 5CIRA 5DZGA 5A3NA 5FY4A 4C90A 4BH9A 4R52A 1V9U2 1ACCA 1QEXA 3OGSA 2RM21 3OUIA 2VCBA 3VHRA 5JXGA 3VBFB 4M3CE 1QJEA 2BW8A 3B3QE 4O7XA 4MXWA 4BQYA 2JKXA 2AEYA 3J7LA 3C7EA 5D1IA 2OZ6A 1WCDJ 1DP0A 3CZUA 2PMWB 3DECA 5C9AA 2A6YA 1XNBA 2V72A 3RDIA 1DDLA 3LIHA 4ZHNA 3POIA 2WO1A 5JZGC 1LOAA 5FZMA 4WVWA 4ET7A 4MXWB 5IFTA 2VW2A 2QQVA 3ILNA 1AR63 2ZAHA 1MS8A 2AACA 4ZZ5A 1BKZA 4KH9A 3HVDA 5L73A 3IDCB 3ZIXA 3VBFA 4LQRA 4YGEA 3UKTA 4XFIA 1VAVA 1RMU3 4IGPA 1LHWA 2ZX1A 5FY5A 4W6YA 4KU7A 3BIWE 1TMF3 2WUHA 2VVDA 2B45X 4YGCA 4QX3A 1QOOA 2EXJA 3I3QA 1NXD1 1SHWB 5C3QA 2XPJA 1DLCA 2RV9A 5GLTA 4E9KA 4TZDA 1GOFA 2HWF2 2ZMKA 3IDEA 3VBUA 3H3ZA 3ATGA 4BK4A 1H4GA 2XWBB 4LBQD 2VZ1A 3C2UA 4TTGA 3MPBA 2FDJA 4HONA 1KQRA 2XVGA 2WNUC 4AQSA 4A4AA 1ZZ6A 4IE4A 1HRV2 2VM9A 3H9AA 4AOCA 3C7HA 1ONAA 4LLFA 5BNOA 4CCMA 3KF3A 3VBUB 4LHNA 2A73B 1AHSA 5FBJA 5JI9A 4L92A 2YUEA 3GCWA 4OHYA 1ZBE2 1BEV1 4PIZA 3R6SA 1LOFC 1YFXA 1RUJ1 5L36A 1WUVA 1NY71 4IW3A 1AVBA 4YFWA 4XFFA 4RGKA 4B4PA 4JGYA 4XE9A 3V56A 2VBBA 4IV1C 3W9AA 2VZUA 2J1VA 4S2HA 4CA9A 2VZ3A 4NHKA 1HQWA 1UY4A 2ES3A 1VBE1 2WS92 3VGIA 3BPSA 3OUHA 4AQ2A 4Q4W1 4JGYB 4QX8A 3ZR5A 3ACIA 2WAAA 1EV11 4H3WA 3ZXGA 3OOXA 2VXJA 2AC1A 1T2XA 2UYBA 4OMCA 4D8MA 4FOQA 2WRAA 5K0UA 3JBG3 1Z7S2 1JOBA 5C3PA 4IEOA 5FP8A 5FIXA 2B9VA 2UWBA 1QDOA 4FPHA 4DY3A 1H1MA 4AFBA 1G7YA 2GN7A 1FV3A 2W3JA 1H8TC 1UY1A 4IE5A 4XFAA 3VBOA 4XF3A 1NCQB 1LEMA 2K0GA 4R4ZA 5FZAA 4L9BA 4OI2A 1KEXA 2ZGMA 3TYJA 4E4DX 1DF0A 2P5BA 4QXBA 2VTXA 4FTSA 1SZBA 1AL21 4B7EA 3K3NA 2DVAA 1W90A 5DXDA 1EPWA 5E89A 2GNTA 5C9AC 5FMCA 1RINA 3LDKA 5L9RA 1YUDA 5HXVA 5BXXA 5K4LA 1RUE1 2G4IA 5EV7A 1GQHA 4M0HA 5T5PA 4FPGA 3LWCA 3T2OA 1MQTB 3D0SA 2XGXA 4CYDA 1RB8G 5SV5A 4UWDA 5JR2A 1O6UA 1Q8VA 4PDWA 2A3YA 3WDXA 4BLIA 2FDGA 1DGRA 5LBEA 5I0DA 2WQ4A 3MIGA 4WM8C 3KQ4B 2W08A 4LO4B 5DABA 3A7QA 4FXGB 1OVSA 2PAMA 2AEZA 4HPKB 4PDWB 2WNEA 3RZGA 1WW5A 3OGVA 4EROA 4QGMA 1REDA 2OXBA 2E7AA 4AVSA 4Q8LA 2FZ2A 1RVF3 2EXKA 2IXIA 3N7LA 5FWEA 3K51A 3LCPA 5FWJA 1O3QA 1SG3A 2K2SA 2P34A 3AP7A 4I30A 2QQOA 3JQWA 1AR62 1B35C 2ZX4A 4PHZA 3SCGA 4RS5A 3ACHA 1PM7A 2ZXQA 5T50A 3RJ2X 5FUPA 3B9CA 1LCLA 2VUDA 4IEVA 1OLME 4NJ4A 3BKZA 1KS4A 2WQ8A 1RIRA 5FYVA 1RMU2 1TMF2 1PO21 4ZXKA 3WDVA 3AZVA 4DOUA 1RUD3 1DYPA 4AQTA 2R0FA 2W5FA 4XBQA 4W6WA 4META 1FMD3 4XFCA 4Y20A 1LTEA 3OEAA 4Y1YA 5CEHA 1CAXA 3AZZA 3L2YA 5KR7A 5FREA 3OEBA 1GMMA 2WFPA 3AMQA 4XAAA 4Q0UA 2Y33A 4XF4A 1UYXA 3I2GA 4Y20B 1ZX5A 4IGQA 1QGLA 1X82A 1OKQA 3DUIA 5A7QA 4CE8A 3N35A 1J59A 1YQ5A 1Q8PA 3ACFA 5A3TA 3D8CA 1QY4A 5FLHA 1ZRIA 2JDUA 3PLQA 1UYPA 2FQPA 4IGOA 4R4XA 1YWKA 3NWKA 4AVVA 4Y5Z0 1ZBA1 4GJYA 4LHLA 1KRIA 1MPXA 2D3PA 2VOTA 5IWFA 4J1XA 5A7NA 4OULA 3WOGA 4ZU4A 3NJXA 5FYZA 3ZMOA 3LDRA 1W05A 1YI7A 1PIV3 1UQXA 2TNFA 3PJQA 2VZRA 4PIYA 2DVGA 2OUHA 2DYCA 3JD71 5FZ8A 5JSRA 3PJYA 1W6MA 5C8CA 4LBMA 2D6OX 1HRI3 2J22A 4P9IA 1EY2A 2WC2A 3ZYPA 4AFAA 2BFUS 4N7UA 4CSWA 2NM1A 3WP5A 1SACA 2RS33 5FY9A 3I3MA 5ACA1 2NN8A 4HT1T 1W8UA 2L9LA 1VAMA 2GP5A 2R043 4QHZA 4LEJA 3JBG2 4YVSC 2XHKA 1UZYA 3OYWB 3N7MA 1OLMA 3WW3A 5IW0A 4WVZA 2VAUA 1EP0A 5CKNA 4Z8BA 5LY1A 5FZ1A 1BCXA 5AFBA 4NPMA 2JE8A 1PO11 1VAKA 3WNKA 5EWSA 2WA4A 3VN4A 3VZKA 1WBLA 3LDBA 5IVBA 3ECQA 3TN91 3PTYA 2VNRA 1W9WA 3A22A 3J8F1 4RFT0 4CU7A 5IVCA 3U0ZA 3WZ1A 3PMEA 3VZJA 1VBC2 2E53A 3QBQA 3DCQA 2D98A 5F9TA 1COV3 4A3ZA 1W6OA 3P3NA 4G3YC 3BUCA 2ZX0A 5J09A 4QT6A 1XOYA 3CLPA 1W6QA 4IESA 4BQ4A 3WT3A 2VBDA 1O3TA 2DCJA 2NP0A 2ZX3A 1H9WA 1C1FA 3GJBA 4RGGA 2DFCA 1JODA 4BMEA 4NAOA 2EALA 4BQ3A 1JYWA 1UU6A 5CISA 4RS5C 2IUWA 4COYA 4H14A 5FZ9A 3AYEA 5ABJC 5HXMA 2B5HA 1JHJA 4Y5TA 4JGZA 4EN6B 2UYAA 4A41A 5FZCA 1A78A 1O8PA 1J3PA 1ZM1A 3AVSA 3KM5A 4DINB 3FLRA 4E2GA 5KHKA 2MHFA 1DGWA 1VR3A 1YFWA 1SBFA 1V6IA 4QX5A 1YFUA 2ARBA 1RVF2 1PM4A 4D6QA 3RG0A 2CTVA 4JGZB 4LO8A 3ZFFB 3HBKA 4HL0A 1OHFA 4KWKA 1V6OA 1GSLA 4QXCA 1UO9A 2F6BA 1NLQA 4CUCA 2JECA 5FDBA 3N9PA 1RTVA 3IAQA 4EZHA 4GA9A 3T3YA 2WZ8A 1APNA 1VBE3 2FMYA 4KU8A 4MHUA 5E6HA 3W21A 3ZSJA 5C4WC 4D3WA 1SPPA 4DXRA 1R1A1 4B4RA 3PVEA 5F32A 1LGCA 3VZNA 3H1MA 2V09A 4JDNA 1PZ9A 2BU9A 4Y33A 2PHDA 1ZYBA 5GALA 3ZPYA 4CEWA 5LW9A 2PHLA 3WF4A 3VHPA 1RC6A 1UMZA 2VNOA 4K1YA 4EZ4A 4Q4V3 1JI6A 3LD8A 1RUD2 2Q8DA 4E2SA 2WO3A 5F5QA 3CJIA 1SLCA 3QCWA 4CCLA 4HN0A 2YBKA 5FP9A 1LHOA 1YLLA 4AGVA 3OPWA 5IATA 1FMD2 3NNJA 4QQHA 5JMOA 4L99A 3LFIA 4YG0A 1PGW2 2OA2A 2OKXA 3HAGA 3CJIB 3WQBA 5LBCA 4LBOA 4BISA 4RSUA 4A7KA 3WQ0A 1YIPA 3IMNA 1KJRA 3NMBA 4Q0PA 2BJSA 2P6CA 4QPGA 2K46A 1HJGA 5BNPB 3RMYA 3VDDC 2VZSA 4Z1VA 2C9AA 2GAUA 4DIQA 1YHFA 4C1XA 5LRSA 1X9TA 1ZA4A 3H7YA 3HN3A 1B09A 1W6PB 3QOPA 1W04A 4JAAA 4QPGB 3NRUA 1RUE3 4C8DA 3O7OA 5FZOA 3LA3A 4Y26A 4UFIA 4DFSA 1HN0A 1YJLA 4GMP3 4ASLA 5JWPA 5GZFA 1OH4A 1H2KA 1U5ZA 5I8TA 4CCCA 1OVPA 2UU8A 3JU9A 1PIV2 3H42B 2CL2A 5FZOB 4IV3B 1HRI2 4I02A 2JXAA 2GC0A 3KVAA 2WWUA 2YPDA 1IPSA 2RS32 4K8FA 1ZZ7A 3SEPA 2XXZA 4O65A 1RUG1 3VHNA 1A3KA 2R042 2YB7A 3AKQA 2WAOA 2JDNA 1MVEA 3ZN4A 4CDQA 2BGOA 3WF1A 2Q5TA 2C26A 3BN6A 3DF0A 2Q1FA 3OB8A 4P02B 5A33A 2UWAA 3Q8EA 3CIHA 2P3KA 5KXBA 1DQ0A 3QH7A 2Y6GA 5EP9A 5A1LA 4KNCA 5IT6A 2PHWA 2XJTA 3EHKA 3O14A 4NVPA 1M4WA 3HNMA 3B69A 3O5SA 4NO4A 4XIOA 3MZHA 1UKRA 2ILMA 3ZXLA 5A33B 2VMIA 1C3HA 3H8UA 4EJRA 1PO23 4GKXA 1F5JA 3KF5A 4HG6B 3MUY1 1COV2 3HT2A 2WLPA 3GYDA 3CO2A 2CAVA 1W0NA 1XXNA 2A5ZA 2WZR1 2ZBJA 1K5MB 3CKHA 4I0BA 4A7YA 2FDIA 1PVXA 4RR3C 4CCJA 2VOKA 4QX0A 2E31A 2JDAA 1HN1A 4LXLA 4U36A 4FTBA 1AYN1 4JRAA 5C33A 3IBMA 2VNGA 4RA0A 3IDBB 4PCRA 2YDEA 3NAPA 4BIOA 3VHOA 1POV3 5JOZA 1MEC1 4IUGA 2P3IA 5KXCA 1N1YA 3AFKA 3SH4A 3OSDA 1EPZA 3WDYA 3WXPA 2BVVA 4UI9L 4Z92B 1ZREA 3F95A 5C6CA 3MI8A 4HKLA 5GJ6A 3UNPA 2AZ5A 2LUWA 1SFNA 3NAPB 1NY72 4FPCA 1D4VB 5CFDA 3GHMA 2PHFA 2TUNA 3KQRA 3HT1A 1S0FA 3GBFA 3K46A 4XZUG 5DDJ3 5LBBA 3N9LA 4N9HA 2IXLA 3O1UA 1IS3A 3NV4A 3MLLA 2OQ7A 5FUNA 3Q8AA 1CD3G 3ZXAC 1XE7A 5FPZA 2H0BA 3WF0A 1UZZA 1PMHX 5A70A 4TSVA 4BQXA 2VPVA 3BI3A 2WQZC 4QM8A 1VBE2 1ND2B 3HWJA 5CFDB 4ZU5A 2JDZA 2JE7A 2XB6C 3GCXA 3SLIA 4BB3A 3W59A 1J84A 3E97A 2EAAA 4UW5A 3NW4A 2XLFA 1PHMA 5HV4A 2P4EA 3HR9A 5FKCA 4CP0A 4K3UA 5G04L 4CDWA 4BZ4A 1EV12 3FLPA 2VW0A 2R073 3ZSEA 1DHKB 1ND3B 2MEV3 5HCHA 4K21A 1N1VA 1Y9QA 4Q4V2 1UW8A 4HVQA 2W0XA 4F7ZA 4A3XA 4MSVA 1AR71 3AZYA 5EZWA 4QDSA 1D2QA 4WZCA 4LIUA 2H0VA 1BK1A 1KJLA 2BRTA 4FPJA 2D5FA 1WCSA 1MR5A 3LAGA 4XIKA 3VBHA 3ZFGC 4DUXA 4X6QB 5JXJA 4JTNA 1SFYA 2XH6A 2XONA 4NIIA 2UURA 1UZWA 1FOD1 3RSJA 1CPMA 2W87A 2GSYA 4QXHA 3RZZA 1WGPA 2GC3A 4Q4Y1 1IS5A 5GZCA 2AR6A 5LASA 1JZ4A 1HX6A 1NXMA 1WLDA 4LBLA 1W2NA 2DVFA 3O0WA 1RHI1 3O1VA 2VL4A 1QXJA 1S0CA 3H7JA 3MV01 4LOTA 5F3GA 5FY7A 5A1FA 5I0TA 1RUE2 1JOPA 1WW4A 2EICA 4CCEA 1XU2A 3CZJA 5CG9A 1VB2A 2G19A 2EIGA 2OS2A 4TXWA 5FJHA 4B3NA 5JXHA 1R1ZA 3H8OA 2N7GA 1PGL2 4OZXA 2XKOA 4RQPA 2W47A 1JYVA 3V0BB 2DDUA 2ET1A 1GP6A 1MZFA 1ZZCA 2X5IB 5A3PA 2JG8A 2D44A 1RUF1 3JZVA 4RHV3 2C5DA 2NQYA 2XL9A 1LJ7A 3P6BA 5T55A 3ZYIB 4RQPB 1NKGA 1K12A 2GZWA 4B29A 2R16A 1KITA 2BERA 2XLAA 3H3UA 4NE9A 5A3OA 2ZHKA 4WZFA 1W2OA 3KD4A 1PK6A 2V4AA 2HWB1 3AJZA 2ZEZA 3VKFC 5I8YA 4XTMA 2Y38A 4AI9A 2JD9A 3FWEA 3ZYFA 5FFOC 1AXZA 4FQZA 5KXEA 3V0BA 4Q29A 1Z78A 5FZ4A 4COWA 5L9VA 2FHRA 2JX9A 3VZLA 1AX0A 2HWC1 1HB4A 3KV4A 4ISRA 3ILFA 5FXZA 1PK6B 4CEYC 1N1TA 1MZEA 2OUJA 3L2HA 5D21A 1R1A3 1XYNA 4XUOA 4ZKTB 4Q8KA 1W39A 2A7AA 2ORZA 4K8RB 4WV8A 2DU0A 4Y4RA 1DZRA 1NCRA 1PO22 3CQOA 1UX6A 2CHHA 3MHZA 4WM7C 5C3SA 1F8VA 5A6ZA 4YZ2A 4KMQA 3T4HB 1JH5A 5J98B 4COZA 1UNBA 1PX3A 3VZOA 4E27A 4XZPA 2VZPA 3VBSC 4B8EA 1GP5A 1GWKA 1S2BA 2MPFA 5T5OA 4Q0VA 1KDKA 2DURA 4AGRA 4F8AA 1US3A 4DNYA 3VKLA 1DQ1A 1QKQA 5APAA 3HQXA 5FLIA 3OBZA 1MZ6A 1TVGA 3PIGA 4FOVA 4CDWC 4QPYA 2EAKA 4MADA 2BV4A 2F4PA 4XILA 2ARXA 1OUXA 2E9QA 3THTA 4MLOA 3IDAA 3S0MA 5A7WB 2VUAA 4FPKA 4I09A 3RYKA 2HH9A 2VG9A 3H1WA 2J7MA 4H2AA 2C6SA 1LHUA 2XJUA 4HBNA 4YM3A 1ZBA2 1E57A 1F2NA 5T5JA 1U0AA 1FV2A 2VMEA 4KWJA 1I3HA 1C1LA 1ODNA 1NQJA 1XSRA 1GQPA 1ZNPA 2QUOA 4RL7A 5LA1A 1XJAA 1U12A 1NA1A 1XC6A 1JZ5A 3WINE 4FCAA 4COUA 2VY0A 4YW4A 3HD8B 2QKDA 1H1IA 4COVA 4KBZA 5FPVA 2WO7A 3SXWA 5A32A 3AMNA 3V0AB 1FYUA 3OJBA 3BU0A 1NA1B 2R072 5JIUA 2MEV2 2WL1A 5LCWL 5FXXA 3U07A 1QMJA 2WNUB 1RUG3 3CEWA 4R9AA 5FYHA 2ZHLA 5A32B 4AI8A 5L7OC 1A8MA 2LW8A 1GWMA 4I0AA 3BU7A 1DQ6A 2IXHA 4MO3M 2XBO1 3WF2A 3GXUA 4CDXA 2YROA 4BPZA 4OHXA 3CU7A 4Y1UA 4XDPA 3ZX7A 2JB8A 2R6QA 1UXXX 2QQPA 4AHYA 2WN2A 3OF1A 4A2UA 1W6NA 1L7LA
chains in the Genus database with same CATH topology
3HNBM 3CDZB 2VJXA 3OGVA 4OZOA 3PUHA 3ETPA 4OUEA 2VCAA 3VD4A 4BJ0A 1SG3A 1OF4A 4CUAA 5EJZB 2ORXA 2VMDA 2QQOA 2VCCA 1H6XA 3I2KA 4QAWA 4P08A 1R64A 3ACHA 2ZXQA 3BGAA 4XVHA 2WQ8A 1IQDC 2VZQA 4LKSA 3W5MA 2W5FA 3SKVA 3I2JA 4JHZA 2VO5A 3VD3A 1UY3A 2VC9A 3OEAA 3DYPA 1F4HA 3OEBA 4PF1A 1GMMA 1W8NA 1UYXA 3HJRA 3K4DA 3I2GA 4LPLA 1UMHA 4DUVA 3VDCA 1ULOA 2W1QA 1O59A 5DQ0A 4A6OA 1WKYA 2QQIA 4XUTA 1NX9A 4XUQA 3ACFA 1OF3A 3WSOA 4E8DA 2BBAA 3T09A 3ACGA 3VDBA 4DUWA 2Y6LA 3T2PA 3T0BA 2YFUA 1GOGA 1MPXA 2VOTA 5LA0A 5HPOA 3NJXA 2VZRA 1TG7A 2WDBA 2BZDA 2J22A 1W8OA 2QQLA 3MO4A 3LEGA 2W94A 1UWWA 2L9LA 5EJ1B 4CUBA 3FHQA 4CU8A 2VQTA 2Z4FA 4AG4A 1PX4A 3WNNA 3JXSA 2E32A 5JUVA 3A21A 3THDA 3I97A 2WBKA 2JE8A 3WNKA 5B4XA 3ECQA 2Y6KA 1CZTA 3A22A 1W9WA 2W9XA 4CU7A 4DEQA 4DEVA 3HNYM 2VTFA 3VD9A 1JZ8A 4BDVB 5IYYA 4A3ZA 3F2ZA 3THCA 1JZ6A 2DCKA 1PMJX 4A44A 4DXTA 2R7EB 2DCJA 3VD5A 1P8JA 3WNOA 5B4NA 1K3IA 1BHGA 1JYWA 4XUNA 3IAPA 3IIIA 4JKLA 4MGQA 4ARXA 2VZOA 5HXMA 1JHJA 2J1EA 4M4RA 1L7QA 5CYYA 4A41A 1O8PA 3C7FA 3PUIA 2VZVA 3LE0A 4PT6A 2KD7A 3I2FA 2RJ2A 4MOAA 2VR4A 3D3AA 4CU6A 3IAQA 4ZXEA 4KI5M 3OBAA 2WZ8A 2WO2A 2ZEXA 3MBWA 4QDRA 1O8SA 4A42A 4DXRA 2W1WA 1GUIA 3OGRA 3GDBA 2Y6HA 3MV11 3WF4A 1KGYA 2LS6A 3K77A 1JI6A 1EUUA 3IB3A 2WO3A 4ZY9A 2QQKA 2PQSA 4JKMA 4XUPA 4QB1A 4MGSA 1WCQA 1UMIA 3T2QA 5JMOA 3FL7A 4GWIA 4OMDA 2OKXA 1F4AA 3WQBA 2YC2A 1GNYA 3DYMA 5C71A 2BGPA 4M4PA 4QB2A 1EUTA 4W8JA 1UYYA 2VZSA 4FI9A 2J1TA 1JZ7A 2Y64A 3HN3A 4UAPA 3NRUA 2Y6JA 3T08A 5LA2A 2QBXA 3ZM8A 1OH4A 1XNTA 3MUZ1 1LNSA 1J83A 3C8XA 2QQNA 4OYUA 4W50A 3I2IA 5DN2A 2CDPA 3EB7A 2YG0A 4QX2A 5A1AA 5JR2A 2XQXA 5CZKA 2WN3A 1UZ0A 3NJVA 3EYPA 2WYSA 3SEPA 4ARYA 1JZ3A 2VQUA 4QPWA 2YB7A 2WAOA 2BGOA 1NUKA 3WF1A 5DPNA 2C26A 3SEEA 3BN6A 3K4AA 3OB8A 4P02B 3LEIA 4GWJA 4QX1A 3CIHA 2XHNA 1GU3A 3WNPA 2Y6GA 5F7UA 3T0AA 5G05L 2W95A 4AAXA 3HNMA 4RYDA 1W9TA 3GM8A 3WF3A 2J1AA 3C7OA 4UOJA 2HLEA 2ZEWA 3LPGA 2J1RA 4HG6B 3MUY1 2W46A 4BXSV 3T0DA 5IFPA 1I5PA 3LQCA 1W0NA 3CKHA 4QX0A 2E31A 2JDAA 1HN1A 5J1XA 3VD7A 1H6YA 3WNMA 3WEZA 4IUGA 1L7RA 4D0QA 1CZVA 4UI9L 1W99A 3K75B 3UNPA 1RYYA 4GZ9A 3NQHA 1XPWA 2E26A 1K42A 4XZUG 3K46A 4QB6A 3VDAA 3WF0A 1PMHX 4JKKA 2W1UA 1ULPA 2RVAA 1J84A 1CIYA 2W1SA 2Y8KA 4XURA 3E1F1 5G04L 1XNAA 4Z2AA 1UY0A 3LEKA 3UETA 3LPFA 4QDSA 1US2A 2J1UA 3K4ZA 4JX0A 2EIEA 2ZEYA 2VMFA 2VMCA 4DUXA 5JXJA 1SDDB 2XONA 3OG2A 3OGSA 1UY2A 2W87A 3UESA 2WZEA 2VCBA 5JXGA 1JYNA 2JKXA 1JZ4A 3C7EA 5JXIA 4KWUA 3DECA 1DP0A 2QQJA 3CZUA 4QDQA 2V72A 4RN5A 2VL4A 3I3BA 3MV01 2WO1A 5IHRA 4ET7A 5IFTA 1D7PM 2EICA 3NNGA 3CZJA 2HYXA 3ABZA 4P00B 4TXWA 1OD3A 4ZZ5A 5JXHA 4P5YA 2V4VA 2W47A 4LQRA 1JYVA 1K45A 2DDUA 3A23A 1NAEA 4L0PA 2WUHA 5C70A 3P6BA 1OT5A 4QX3A 3GGLA 2E33A 2WABA 3J7HA 1NKGA 1K12A 2W91A 1SHWB 1DLCA 1UX7A 2BERA 2RV9A 1GOFA 3HPNA 2V5DA 2XOMA 4CU9A 3W5NA 1CZSA 2ZEZA 4BK4A 2QQMA 2X05A 2VZ1A 2JD9A 4TTGA 2YFZA 4A4AA 1W9SA 2VM9A 3C7HA 5C7GA 4XUOA 3HOBA 2ORZA 3HEIA 1CX1A 4CVUA 2EIDA 1JYXA 3CQOA 1UXZA 2B4KA 4KMQA 2C9KA 2C4XA 2VZUA 1PX3A 2J1VA 2YC4A 2VZ3A 5FUIA 2VZPA 1UY4A 1GOHA 3AC0A 3FHAA 1US3A 3CMGA 1UYZA 3P1IA 2X10A 3ACIA 3WNLA 4A45A 2WAAA 1TVGA 4OMCA 1T2XA 4MADA 2W92A 4D8MA 4BK5A 4PQQA 2EIBA 3IDAA 1JU4A 2J7MA 2B9VA 2ID4A 3I3EA 2VMEA 2W3JA 1UY1A 4DXSA 4E8CA 1GQPA 5LA1A 2J1SA 1XC6A 1JZ5A 3FN9A 1KEXA 4YPJA 1JZ2A 5IJRA 4ZZ8A 5DMYA 3C7GA 3I3DA 4CUCA 5LCWL 3SKJE 1JU3A 3U37A 3DYOA 3I2HA 2LW8A 3T2OA 4LHSA 2CDOA 2VZTA 4MO3M 3WF2A 5EIYB 3GXUA 1YQ2A 4W4ZA 2X09A 5I0DA 1DYOA 1UXXX 2WN2A 3A7QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HNB M;  3CDZ B;  2VJX A;  3OGV A;  4OZO A;  3PUH A;  3ETP A;  4OUE A;  2VCA A;  3VD4 A;  4BJ0 A;  1SG3 A;  1OF4 A;  4CUA A;  5EJZ B;  2ORX A;  2VMD A;  2QQO A;  2VCC A;  1H6X A;  3I2K A;  4QAW A;  4P08 A;  1R64 A;  3ACH A;  2ZXQ A;  3BGA A;  4XVH A;  2WQ8 A;  1IQD C;  2VZQ A;  4LKS A;  3W5M A;  2W5F A;  3SKV A;  3I2J A;  4JHZ A;  2VO5 A;  3VD3 A;  1UY3 A;  2VC9 A;  3OEA A;  3DYP A;  1F4H A;  3OEB A;  4PF1 A;  1GMM A;  1W8N A;  1UYX A;  3HJR A;  3K4D A;  3I2G A;  4LPL A;  1UMH A;  4DUV A;  3VDC A;  1ULO A;  2W1Q A;  1O59 A;  5DQ0 A;  4A6O A;  1WKY A;  2QQI A;  4XUT A;  1NX9 A;  4XUQ A;  3ACF A;  1OF3 A;  3WSO A;  4E8D A;  2BBA A;  3T09 A;  3ACG A;  3VDB A;  4DUW A;  2Y6L A;  3T2P A;  3T0B A;  2YFU A;  1GOG A;  1MPX A;  2VOT A;  5LA0 A;  5HPO A;  3NJX A;  2VZR A;  1TG7 A;  2WDB A;  2BZD A;  2J22 A;  1W8O A;  2QQL A;  3MO4 A;  3LEG A;  2W94 A;  1UWW A;  2L9L A;  5EJ1 B;  4CUB A;  3FHQ A;  4CU8 A;  2VQT A;  2Z4F A;  4AG4 A;  1PX4 A;  3WNN A;  3JXS A;  2E32 A;  5JUV A;  3A21 A;  3THD A;  3I97 A;  2WBK A;  2JE8 A;  3WNK A;  5B4X A;  3ECQ A;  2Y6K A;  1CZT A;  3A22 A;  1W9W A;  2W9X A;  4CU7 A;  4DEQ A;  4DEV A;  3HNY M;  2VTF A;  3VD9 A;  1JZ8 A;  4BDV B;  5IYY A;  4A3Z A;  3F2Z A;  3THC A;  1JZ6 A;  2DCK A;  1PMJ X;  4A44 A;  4DXT A;  2R7E B;  2DCJ A;  3VD5 A;  1P8J A;  3WNO A;  5B4N A;  1K3I A;  1BHG A;  1JYW A;  4XUN A;  3IAP A;  3III A;  4JKL A;  4MGQ A;  4ARX A;  2VZO A;  5HXM A;  1JHJ A;  2J1E A;  4M4R A;  1L7Q A;  5CYY A;  4A41 A;  1O8P A;  3C7F A;  3PUI A;  2VZV A;  3LE0 A;  4PT6 A;  2KD7 A;  3I2F A;  2RJ2 A;  4MOA A;  2VR4 A;  3D3A A;  4CU6 A;  3IAQ A;  4ZXE A;  4KI5 M;  3OBA A;  2WZ8 A;  2WO2 A;  2ZEX A;  3MBW A;  4QDR A;  1O8S A;  4A42 A;  4DXR A;  2W1W A;  1GUI A;  3OGR A;  3GDB A;  2Y6H A;  3MV1 1;  3WF4 A;  1KGY A;  2LS6 A;  3K77 A;  1JI6 A;  1EUU A;  3IB3 A;  2WO3 A;  4ZY9 A;  2QQK A;  2PQS A;  4JKM A;  4XUP A;  4QB1 A;  4MGS A;  1WCQ A;  1UMI A;  3T2Q A;  5JMO A;  3FL7 A;  4GWI A;  4OMD A;  2OKX A;  1F4A A;  3WQB A;  2YC2 A;  1GNY A;  3DYM A;  5C71 A;  2BGP A;  4M4P A;  4QB2 A;  1EUT A;  4W8J A;  1UYY A;  2VZS A;  4FI9 A;  2J1T A;  1JZ7 A;  2Y64 A;  3HN3 A;  4UAP A;  3NRU A;  2Y6J A;  3T08 A;  5LA2 A;  2QBX A;  3ZM8 A;  1OH4 A;  1XNT A;  3MUZ 1;  1LNS A;  1J83 A;  3C8X A;  2QQN A;  4OYU A;  4W50 A;  3I2I A;  5DN2 A;  2CDP A;  3EB7 A;  2YG0 A;  4QX2 A;  5A1A A;  5JR2 A;  2XQX A;  5CZK A;  2WN3 A;  1UZ0 A;  3NJV A;  3EYP A;  2WYS A;  3SEP A;  4ARY A;  1JZ3 A;  2VQU A;  4QPW A;  2YB7 A;  2WAO A;  2BGO A;  1NUK A;  3WF1 A;  5DPN A;  2C26 A;  3SEE A;  3BN6 A;  3K4A A;  3OB8 A;  4P02 B;  3LEI A;  4GWJ A;  4QX1 A;  3CIH A;  2XHN A;  1GU3 A;  3WNP A;  2Y6G A;  5F7U A;  3T0A A;  5G05 L;  2W95 A;  4AAX A;  3HNM A;  4RYD A;  1W9T A;  3GM8 A;  3WF3 A;  2J1A A;  3C7O A;  4UOJ A;  2HLE A;  2ZEW A;  3LPG A;  2J1R A;  4HG6 B;  3MUY 1;  2W46 A;  4BXS V;  3T0D A;  5IFP A;  1I5P A;  3LQC A;  1W0N A;  3CKH A;  4QX0 A;  2E31 A;  2JDA A;  1HN1 A;  5J1X A;  3VD7 A;  1H6Y A;  3WNM A;  3WEZ A;  4IUG A;  1L7R A;  4D0Q A;  1CZV A;  4UI9 L;  1W99 A;  3K75 B;  3UNP A;  1RYY A;  4GZ9 A;  3NQH A;  1XPW A;  2E26 A;  1K42 A;  4XZU G;  3K46 A;  4QB6 A;  3VDA A;  3WF0 A;  1PMH X;  4JKK A;  2W1U A;  1ULP A;  2RVA A;  1J84 A;  1CIY A;  2W1S A;  2Y8K A;  4XUR A;  3E1F 1;  5G04 L;  1XNA A;  4Z2A A;  1UY0 A;  3LEK A;  3UET A;  3LPF A;  4QDS A;  1US2 A;  2J1U A;  3K4Z A;  4JX0 A;  2EIE A;  2ZEY A;  2VMF A;  2VMC A;  4DUX A;  5JXJ A;  1SDD B;  2XON A;  3OG2 A;  3OGS A;  1UY2 A;  2W87 A;  3UES A;  2WZE A;  2VCB A;  5JXG A;  1JYN A;  2JKX A;  1JZ4 A;  3C7E A;  5JXI A;  4KWU A;  3DEC A;  1DP0 A;  2QQJ A;  3CZU A;  4QDQ A;  2V72 A;  4RN5 A;  2VL4 A;  3I3B A;  3MV0 1;  2WO1 A;  5IHR A;  4ET7 A;  5IFT A;  1D7P M;  2EIC A;  3NNG A;  3CZJ A;  2HYX A;  3ABZ A;  4P00 B;  4TXW A;  1OD3 A;  4ZZ5 A;  5JXH A;  4P5Y A;  2V4V A;  2W47 A;  4LQR A;  1JYV A;  1K45 A;  2DDU A;  3A23 A;  1NAE A;  4L0P A;  2WUH A;  5C70 A;  3P6B A;  1OT5 A;  4QX3 A;  3GGL A;  2E33 A;  2WAB A;  3J7H A;  1NKG A;  1K12 A;  2W91 A;  1SHW B;  1DLC A;  1UX7 A;  2BER A;  2RV9 A;  1GOF A;  3HPN A;  2V5D A;  2XOM A;  4CU9 A;  3W5N A;  1CZS A;  2ZEZ A;  4BK4 A;  2QQM A;  2X05 A;  2VZ1 A;  2JD9 A;  4TTG A;  2YFZ A;  4A4A A;  1W9S A;  2VM9 A;  3C7H A;  5C7G A;  4XUO A;  3HOB A;  2ORZ A;  3HEI A;  1CX1 A;  4CVU A;  2EID A;  1JYX A;  3CQO A;  1UXZ A;  2B4K A;  4KMQ A;  2C9K A;  2C4X A;  2VZU A;  1PX3 A;  2J1V A;  2YC4 A;  2VZ3 A;  5FUI A;  2VZP A;  1UY4 A;  1GOH A;  3AC0 A;  3FHA A;  1US3 A;  3CMG A;  1UYZ A;  3P1I A;  2X10 A;  3ACI A;  3WNL A;  4A45 A;  2WAA A;  1TVG A;  4OMC A;  1T2X A;  4MAD A;  2W92 A;  4D8M A;  4BK5 A;  4PQQ A;  2EIB A;  3IDA A;  1JU4 A;  2J7M A;  2B9V A;  2ID4 A;  3I3E A;  2VME A;  2W3J A;  1UY1 A;  4DXS A;  4E8C A;  1GQP A;  5LA1 A;  2J1S A;  1XC6 A;  1JZ5 A;  3FN9 A;  1KEX A;  4YPJ A;  1JZ2 A;  5IJR A;  4ZZ8 A;  5DMY A;  3C7G A;  3I3D A;  4CUC A;  5LCW L;  3SKJ E;  1JU3 A;  3U37 A;  3DYO A;  3I2H A;  2LW8 A;  3T2O A;  4LHS A;  2CDO A;  2VZT A;  4MO3 M;  3WF2 A;  5EIY B;  3GXU A;  1YQ2 A;  4W4Z A;  2X09 A;  5I0D A;  1DYO A;  1UXX X;  2WN2 A;  3A7Q A; 
#chains in the Genus database with same CATH topology
 4GH4 B;  3SMH A;  2X53 S;  1S0G A;  3HNB M;  5IK7 A;  2ERF A;  1CQ9 A;  4D6R A;  4CDX B;  4XJ8 A;  4Q1P A;  4NHX A;  2DF7 A;  2ZCW A;  4OUE A;  5FBZ A;  1RXF A;  1W6N B;  3NKT A;  4LIV A;  4DO0 A;  3FUQ A;  2HYK A;  2V73 A;  4PQ9 A;  1GZT A;  4CUG A;  2ORX A;  2VMD A;  3A0K A;  3GAL A;  5A6Q A;  3RZK A;  3VBR A;  2GND A;  1STM A;  1X36 A;  2ARC A;  1OH3 A;  2XJR A;  1AYN 3;  1HV1 A;  2ZOE B;  2ZTN A;  1H9P A;  3DL3 A;  4HOO A;  4QAW A;  3AXE A;  4XFH A;  2RDN A;  3GZU C;  4H55 A;  4BYY A;  2XKP A;  4UFK A;  3ZFE C;  5C5T A;  1J1L A;  1H2N A;  1OUR A;  1OA3 A;  3CBN A;  1MEC 3;  2VZQ A;  3VBR B;  2HEW F;  1W8H A;  3GF6 A;  4FPY A;  4RHV 2;  4FTE A;  1NCR C;  2XLG A;  4LKS A;  3FC0 A;  1ULG A;  5C3O A;  4AVC A;  4KL1 A;  3MYX A;  3SKV A;  3I2J A;  4OUS A;  3ZYG A;  1AR9 1;  2VC9 A;  2RR1 1;  5FO9 B;  4H7L A;  5D8A B;  1ULE A;  2DBI A;  1CAW B;  4CZS A;  1HDK A;  2PTM A;  3K4D A;  4LPL A;  5JI7 A;  4LE4 A;  4QKF A;  5K8S A;  2A6V A;  4DUV A;  5FZL A;  3BVC A;  3WP6 A;  4FOW A;  1ULO A;  4XMI A;  1R1A 2;  2W1Q A;  1E5R A;  1QJZ A;  3UKV A;  1AR8 1;  1SCS A;  2AH2 A;  3M2M A;  2AGS A;  1NX9 A;  4XQD A;  4XUT A;  3TEX A;  4HSJ A;  4JZR A;  4XAE A;  2WNV C;  4XUQ A;  4OQ8 A;  1OF3 A;  3WSO A;  2ZHM A;  1MZ5 A;  3T09 A;  1U5I A;  4P14 A;  1AL0 G;  1WLT A;  4QPI C;  4PLO A;  5FZF A;  2PFW A;  1CPN A;  4RGA A;  4FSJ A;  1GOG A;  1JOJ A;  1C8M 1;  3ILR A;  5HPO A;  2ZAB A;  4EWD A;  4MZU A;  2GP3 A;  1AX2 A;  3NL1 A;  5JSP A;  3WDT A;  1LU2 A;  1TG7 A;  2WDB A;  3B93 A;  2SLI A;  3N4M A;  2O8O A;  5FY8 A;  1DQ2 A;  2VMH A;  2QQL A;  3MO4 A;  3LEG A;  1UF2 C;  1ZZB A;  3M70 A;  2Q4S A;  5EJ1 B;  2EXH A;  3PHM A;  1IPJ A;  5FP3 A;  2W68 A;  1OOP C;  4AG4 A;  4O9G A;  1PX4 A;  4XHX A;  4BA6 A;  4AED A;  1QJU 3;  1B35 B;  1VBA 3;  3AM2 A;  5L19 A;  1BLZ A;  4N9I A;  3OBT A;  2ZPX A;  3EBR A;  3VB9 A;  2KXL A;  5M0T A;  1NCQ A;  4HLT A;  2YHJ A;  4LUL A;  1V6K A;  4YNI A;  1SLA A;  5B4X A;  2HBT A;  1YI9 A;  3LF7 A;  4AED B;  4DMI A;  3ST7 A;  3VBF C;  1FT9 A;  2W9X A;  1OD5 A;  2PAE A;  4PLN A;  1W28 A;  3VD9 A;  2VTF A;  4NN0 A;  1JZ8 A;  3RJR A;  1FNY A;  4UBG A;  5JMC A;  2D5H A;  1IQA A;  4M3C B;  4N53 B;  5LEK A;  2KR2 A;  1LUL A;  1N47 A;  1JZ6 A;  1I6X A;  1VMF A;  1NLR A;  1VBC 3;  1TME 3;  4M00 A;  5C8W A;  1RUG 2;  5JOY A;  5LZ6 A;  1RIT A;  1MQT A;  3WR0 A;  1OQ1 A;  2H6B A;  1BVV A;  3ZXF A;  5KC6 A;  1ZRD A;  3VD5 A;  1P8J A;  5CBL A;  3CNA A;  1K3I A;  1PVC 1;  4Y3O A;  4CCN A;  5B4N A;  4ASK A;  4HZF A;  2JEM A;  1WWY A;  3IAP A;  5J37 A;  2XR4 A;  3PUQ A;  4C91 A;  4EYU A;  4ES8 A;  1YCI A;  1G8W A;  1JBC A;  3IN9 A;  1BZW A;  5CYY A;  1N1S A;  2HWD 1;  3S6P A;  3UKN A;  4HPK A;  1JW6 A;  2PLV 3;  1SBE A;  5CAD A;  1SLL A;  4BQW A;  3BTZ A;  1UOJ A;  3K48 A;  2CWS A;  2VZV A;  4FFH A;  3ZIW A;  2VCM A;  1ENS A;  2RDS A;  2VUJ A;  1FPN 3;  3OCP A;  4Q2F A;  5F6K A;  1MS0 A;  4UF0 B;  3I2F A;  4NID A;  1AJO A;  5I93 A;  3D3A A;  3O1P A;  4CU6 A;  1LU1 A;  4ZXE A;  3OBA A;  3KHC A;  2ZEX A;  4XEZ A;  3VBU C;  5BYN A;  2HEY F;  1AYN 2;  5FMO S;  5ANQ A;  1GUI A;  2TEP A;  2JDK A;  1LOB A;  3GDB A;  1O91 A;  3UJO A;  3LKJ A;  1MEC 2;  5BNO C;  1UAI A;  5BNQ A;  3ZSM A;  1R08 3;  2QJV A;  4HVO A;  4IE6 A;  1EUU A;  2VNV A;  1T6G C;  3AMH A;  3WDU A;  4YW2 A;  2WSV A;  2PQS A;  4BXF A;  3ZYJ B;  5F5C A;  4JKM A;  4AFD A;  4QB1 A;  4JHT A;  2BUK A;  1Q8S A;  3APB A;  5FYY A;  4IXL A;  1U5Y A;  5DUW A;  3ELN A;  5BNN A;  2Z69 A;  1AYM 1;  3FL7 A;  1ULF A;  2JDY A;  2YYO A;  4UW4 A;  3AFG A;  4JGY C;  4LKE A;  4AGG A;  5JOX A;  4CXX A;  3DYM A;  4IEX A;  1WME A;  4J6G A;  4QB2 A;  1EUT A;  3O1S A;  4E4H A;  3GJA A;  1UYY A;  4FI9 A;  4GJZ A;  4YZ4 A;  2A3W A;  3VZM A;  3WP3 A;  5BNN B;  5FPX A;  5BPX A;  3MGU A;  4MHR A;  1RJ8 A;  1YFY A;  2Y64 A;  5F5I A;  3OTF A;  2JG9 A;  3FMG A;  2A6W A;  1RUC 1;  3VKM A;  3B00 A;  1AF9 A;  1Z0H A;  3UK9 A;  2YV8 A;  1HXS 3;  2PHX A;  1O4Y A;  3ZM8 A;  5GKA C;  3AP4 A;  5ABJ B;  1DIW A;  5K0U C;  3KVB A;  2JG9 B;  4AI3 A;  4XJA A;  1J83 A;  1DZT A;  1YO8 A;  3C8X A;  4YG6 A;  2RS5 1;  1UD1 A;  1Q5O A;  2UY9 A;  3S7E A;  4AHZ A;  2QE3 A;  1TEI A;  2DWR A;  2ZHN A;  3FBY A;  5DN2 A;  5GLW A;  4NIA A;  3LSE A;  3U14 A;  3ZR6 A;  1KS5 A;  4OHZ A;  3VBO C;  1BMV 2;  1H2L A;  2YG0 A;  3FHI B;  4QX2 A;  5A1A A;  2DUQ A;  2WFF 1;  3NJV A;  2RM2 3;  3EYP A;  2B8M A;  3QAC A;  3A0N A;  1NZI A;  4FQ4 A;  1UZV A;  3OYW A;  4PI2 A;  1AX1 A;  1JUH A;  1L3J A;  1MQT C;  5LWB A;  1QJU 2;  5C4W B;  1VBA 2;  4MGK E;  2NLR A;  1X9P A;  1CVN A;  5HCA A;  3X29 B;  1WLW A;  2JD4 A;  1QJY 1;  1NLS A;  3LEI A;  3N9O A;  4Q0Q A;  4Q1R A;  3WNP A;  2GNM A;  1IZ3 A;  3M3I A;  5F7U A;  4GB3 1;  1OFS A;  2NYY A;  4AAX A;  4P9L A;  3LA7 A;  4CP2 A;  3D6E A;  4YZ3 A;  5FOJ B;  4PDW C;  5AVP A;  3GM8 A;  3WF3 A;  3BCW A;  1LRH A;  3M8L A;  3ASI A;  2HLE A;  3PDQ A;  5FPL A;  1SEF A;  1WCK A;  2E7Q A;  5F6L B;  2J1R A;  5DAV A;  5JPN B;  3PU8 A;  4PBO A;  4SLI A;  1JS9 A;  1TME 2;  4BXS V;  5E8A A;  2SBA A;  1YQ8 A;  3U78 A;  2RR1 3;  5KHH A;  4XF0 A;  4AE2 A;  5FY0 A;  5F37 A;  3RMX A;  1REF A;  3WLU A;  1KFX L;  1V6L A;  3PNA A;  4QU1 A;  3VDD B;  4DRR A;  3R05 A;  5A3U A;  4YZ5 A;  3I59 A;  4ZPI A;  3USS A;  1UOF A;  2RJK A;  2LM3 A;  5A6Y A;  5FK7 A;  3VD7 A;  3KGL A;  4YVW B;  2HKX A;  2E63 A;  4UYB A;  1FAT A;  4D0Q A;  4WBB A;  2OYZ A;  2GMP A;  2PLV 2;  1ZZ8 A;  1W99 A;  3RYR A;  3RRD A;  3I59 B;  1W9Y A;  4NRQ A;  3A4U A;  1V9U 1;  4GZ9 A;  1LB2 A;  3NQH A;  5GZE A;  1X7N A;  1XPW A;  4ZS3 A;  1BBT 1;  2E26 A;  3ZFF A;  1LHV A;  2R1D A;  3U10 A;  4HVR A;  3WW4 A;  4YW5 A;  1BEV 3;  3WVJ A;  1O3S A;  1FPN 2;  4LBK A;  1YNA A;  1RUJ 3;  4QB6 A;  5I0U A;  4QKB A;  1PZ8 A;  2P3Y A;  5FZH A;  1F15 A;  5CVR A;  4C0B A;  4NOT A;  5BUV A;  4AVB A;  3GZT B;  2W52 A;  2NMO A;  4IL7 A;  4BOW A;  5HI0 A;  1A34 A;  1ULP A;  1RUN A;  2CSG A;  2DTY A;  3D0J A;  4QD2 A;  4HKO A;  1JMU B;  1UOG A;  3SNM A;  1DFQ A;  2ZGR A;  3I4I A;  3ETQ A;  3AXD A;  1I5Z A;  1CAV A;  1CAU A;  4F83 A;  2FDH A;  2D6N A;  4N43 B;  4Q4W 3;  3UYJ A;  1S1A A;  1ASJ 1;  5AC9 1;  2R0H A;  2PHT A;  2OPK A;  1R08 2;  1UY0 A;  2HBU A;  1LED A;  2CV6 A;  3LOI A;  1EV1 3;  1US2 A;  2D43 A;  2V5Y A;  2WT2 A;  3K4Z A;  4L11 A;  1CAV B;  5DAW A;  1CAU B;  3KLS A;  3D5O A;  1LAJ A;  2VMF A;  1SDD B;  5A6X A;  2ENR A;  3B01 A;  2QNK A;  2E6V A;  3OG2 A;  4QM9 A;  1JN2 P;  2Q8O A;  2FMD A;  1FXZ A;  5J7M A;  1A6C A;  4N8M A;  2WZE A;  4IE7 A;  5BNP A;  2HWF 1;  3WG1 A;  3O1M A;  2JDM A;  1W9F A;  3K3O A;  3IKW A;  2A6Z A;  5HBA A;  5A7P A;  5JXI A;  4M0N A;  3JUU A;  2F4L A;  2QQJ A;  4KWU A;  3TNQ A;  1W6P A;  4IEQ A;  4QDQ A;  5CA6 A;  5C8C C;  4GWN A;  5F1R A;  3O1R A;  4RR3 B;  4RN5 A;  4ONU A;  3I3B A;  4LLO A;  1AL2 3;  1WW6 A;  3RZM A;  2Y0I A;  4AFC A;  1W2T A;  1D7P M;  4HSL A;  3ZDS A;  5I0R A;  5FZ0 A;  3DPR A;  4TLF A;  1HXS 2;  3ABZ A;  2DCT A;  4MG2 A;  3NKG A;  4P00 B;  3BIE A;  1ZBE 1;  1ENQ A;  1OD3 A;  1PVC 3;  3AMP A;  4YAR A;  1Q8O A;  4LOR A;  3EXU A;  3S7I A;  3AZW A;  3AZX A;  2AUY A;  2OT7 A;  1QQP 1;  3KT1 A;  1J1T A;  4IV3 A;  2RDQ A;  5CFC A;  1CGP A;  3DPR B;  1DGW X;  3SQO A;  4HMZ A;  4KGG A;  4L0P A;  5C70 A;  2YZ4 A;  1YRZ A;  1OT5 A;  1URX A;  1E5H A;  2Z2S B;  3KSC A;  2WAB A;  1EAH 1;  1OA4 A;  3J7H A;  1S2E A;  2RM2 2;  2WS9 1;  3VL8 A;  3W20 A;  5CFC B;  1N3Q A;  3KV9 A;  2VOX A;  1CWP A;  1G9C A;  4CU9 A;  1CZS A;  1YYN A;  5F2W A;  4B1L A;  2VQ0 A;  1W03 A;  5FPU A;  3TBD A;  2QQM A;  3G6J B;  4DS0 A;  4LR4 A;  1QOT A;  2YFZ A;  4L2N A;  1S0B A;  2ZML A;  5FMB A;  3N36 A;  5C7G A;  1Z7S 1;  3NJZ A;  2IXJ A;  3WCS A;  2NMN A;  3FZ3 A;  1PGS A;  3FX3 A;  1NYW A;  4QMA A;  3KMH A;  1ZA7 A;  3B9I A;  1CX4 A;  1HW5 A;  3ZFG B;  2RJL A;  4DXZ A;  1UXZ A;  4JGZ C;  3ZFF C;  3AYC A;  4LUK A;  2JIG A;  4DRV A;  1K5M A;  1QOS A;  2A71 A;  2YC4 A;  2RR1 2;  1GZ9 A;  3POB A;  3ACL A;  1AYM 3;  3KCC A;  3SCH A;  4Y24 A;  4CP1 A;  4OFG A;  3AC0 A;  3FHA A;  4D69 A;  1GLH A;  3MLK A;  1LOE A;  1VIW B;  3M3Q A;  1YQ6 A;  2W2I A;  1UYZ A;  2EVX A;  5FZK A;  1JYC A;  1OFN A;  3POY A;  3P1I A;  3IIA A;  1XRU A;  1XNK A;  5IK4 A;  3AKP A;  4K9S A;  2VXR A;  4D7S A;  2YU2 A;  4FOY A;  4K40 A;  2JIJ A;  2WLQ A;  2W92 A;  4DY5 A;  4YW6 A;  1T6B X;  2EIB A;  4TWT A;  1LES A;  1W2U A;  1RUC 3;  3ME2 A;  3E6B A;  2WR9 A;  1JU4 A;  4PI0 A;  4AVT A;  2ADD A;  4CEW C;  2ID4 A;  5F39 A;  4RD7 A;  3GBG A;  4QGL A;  3B94 A;  3MFC A;  4NUB A;  1XE0 A;  1V0A A;  1BEV 2;  1RUH 1;  1VMJ A;  3M1H A;  1RUJ 2;  3CJI C;  4R9D A;  1HB3 A;  5A3L A;  1ND2 A;  4M3C F;  2J1S A;  1ZBA 3;  3FN9 A;  4NRP A;  3ZKY A;  3KZ4 C;  4YPJ A;  1JZ2 A;  5A3W A;  2VW1 A;  4LT5 A;  1XBF A;  2O1Q A;  2EF6 A;  1BQP A;  3MPP G;  2XWJ B;  4XQ4 A;  3U4S A;  4LUM A;  1Q56 A;  4YW7 A;  1YJK A;  1Y9M A;  3KV6 A;  5LEJ A;  1K5J A;  4CDU B;  5DMY A;  1ND3 A;  2RDR A;  1AR6 1;  1DLL A;  3JD7 3;  3ENR A;  2Y60 A;  4QPG C;  3IM0 A;  4FPE A;  4Q4W 2;  4UXA A;  2GDF A;  4XYX A;  1ENX A;  3CHX A;  5DUV A;  5CB7 A;  2UY8 A;  3SKJ E;  1JU3 A;  3J4U H;  2WT1 A;  3AP5 A;  3DYO A;  1OLQ A;  3TAY A;  4LHS A;  4XDQ A;  1G9A A;  5ACA 3;  1RMU 1;  4XAB A;  1KD7 A;  4BCU A;  4NHY A;  4W4Z A;  2WWJ A;  4LBQ B;  4PIX A;  1BYH A;  4LNV A;  1MS9 A;  4QQL A;  1H4H A;  2LRP A;  3OBR A;  4OVE A;  5FAX A;  3OPT A;  4UFH A;  1OF4 A;  3VUO A;  4L8Q A;  4F3J A;  1BK0 A;  3CDZ B;  3TRS B;  2VJX A;  1PO1 3;  4OZO A;  3PUH A;  1QWR A;  4KQ7 A;  2ZMN A;  3ETP A;  3FBM A;  3RNS A;  4C0H A;  3N9Q A;  3TN9 3;  4GWM A;  4NAM A;  1J58 A;  2ADE A;  3H3L A;  4QU2 A;  3J8F 3;  4BJ0 A;  3VBS B;  2BPA 2;  4U2A A;  1AL2 2;  1SFP A;  3DGT A;  1POQ A;  4JTO A;  5EJZ B;  3AJY A;  3ZN6 A;  2R32 A;  4NWV A;  1GYK A;  4X6R B;  1ALY A;  2VCC A;  4LKF A;  4NPR A;  3I2K A;  1PVC 2;  5FZE A;  3V64 A;  4P08 A;  1R64 A;  1WLC A;  3PIJ A;  4CDQ C;  3BGA A;  3JCI A;  3J7M A;  1OQE A;  3J9S A;  3MW4 A;  4OUM A;  4QXK A;  4V1P A;  1ULC A;  3ZN6 B;  2X5I A;  2CNA A;  4FBF A;  1F35 A;  4JV4 A;  4NMI A;  4I3G A;  1IQD C;  1QJF A;  4OLL A;  3RZL A;  5GLZ A;  2KA3 A;  1QDC A;  3DXT A;  3D4K A;  4NIG A;  1HB1 A;  4AHX A;  5J48 A;  3NNM A;  5DAX A;  2JEN A;  1BBT 3;  4FFF A;  3P5B A;  3POW A;  3IMM A;  3SHR A;  1SQ4 A;  1JUI A;  2VO5 A;  5GZG A;  1UY3 A;  3D82 A;  3DYP A;  2ZJC A;  3OD0 A;  3ZKU A;  2A3X A;  5FCC A;  5EYX A;  4BQ2 A;  4URA A;  4LA2 A;  1W8N A;  2QDN A;  3M3C A;  2OII A;  2PXJ A;  4BQ5 A;  3M3E A;  1UMH A;  4R9C A;  3JBG 1;  1QNW A;  5H9S A;  5LK7 B;  5DG2 A;  3WG2 A;  3ON7 A;  2O8Q A;  3OPZ A;  4KG8 A;  5CKQ A;  1SLI A;  4E8D A;  2BBA A;  5A3M A;  1ASJ 3;  1YQC A;  3RFR A;  3NAP C;  3ACG A;  2KM2 A;  3BOD A;  4DUW A;  5KWR A;  3VDB A;  1A8D A;  3T2P A;  4IEZ A;  3T0B A;  3O0V A;  1HKD A;  5LA0 A;  3N7K A;  5IVF A;  3QLQ A;  3B7M A;  1OPM A;  3IT8 A;  2ET7 A;  1AYM 2;  5CFD C;  2IXK A;  3RZJ A;  4P9J A;  3R4D B;  4KGQ A;  2PYT A;  3ZN5 A;  5F3C A;  1ZVF A;  2FBE A;  4AYU A;  3EMR A;  1W8O A;  1LEC A;  2IVI B;  4IET A;  4D7T A;  3NNL A;  5EPA A;  4XC9 A;  5JZG A;  4FAH A;  2D7F A;  2W94 A;  4S2D A;  1ND3 C;  1REE A;  1UWW A;  3V65 A;  4CUB A;  5A7W A;  4O9E A;  3FHQ A;  4CU8 A;  2Z4F A;  2DUO A;  2A1X A;  1RUC 2;  5IK8 A;  2RHP A;  3USU A;  1XQN A;  2A75 A;  1O5U A;  4PBP A;  5JZG B;  5JOW A;  4LKD A;  4EWA A;  3ES4 A;  1SLT A;  3AKS A;  5HCF A;  2ZGO A;  1KXG A;  1YXW A;  3ZFE B;  3I97 A;  3LOB A;  2PQQ A;  1Q8Q A;  3WHT A;  1OUS A;  1QXR A;  1V6J A;  4BIF A;  4CRQ A;  4IQP A;  1G9F A;  1HQL A;  2FCU A;  3QD6 A;  2CGN A;  1MS5 A;  3USU B;  2Y6K A;  1QH6 A;  1CZT A;  1RVF 1;  3ES1 A;  4XF1 A;  1QQP 3;  4ZU7 A;  2BNN A;  3VBH C;  4EWE A;  3U1X A;  3V0A A;  3ZSK A;  3HNY M;  2X8K A;  3FFZ A;  4EV0 A;  2YMZ A;  3IPV B;  5IYY A;  5J3U A;  3KWV A;  1OBN A;  2QVS B;  1EAH 3;  4G9S B;  3F2Z A;  1QJX 1;  3JD7 2;  5FXW A;  2WNU A;  2DCK A;  5JPM B;  2D97 A;  1PMJ X;  4FPF A;  4A44 A;  4DXT A;  2ATF A;  1HJF A;  2RE9 A;  3FLT A;  4FO9 A;  1WD3 A;  5E16 A;  3AP6 A;  5JSO A;  1VRH 1;  3WCR A;  4EN0 A;  2B39 A;  1CR7 A;  1LGN A;  1V70 A;  2BFU L;  3WNO A;  3ZLI A;  5ACA 2;  1BHG A;  4XUN A;  2QQU A;  1MS3 A;  1Y4W A;  1C5H A;  2VVF A;  1LOF A;  1RUD 1;  2LRO A;  2G9G A;  2R49 A;  3DKQ A;  2VUC A;  3III A;  3NVC A;  4GH4 A;  4IND A;  4ORF A;  4QHO A;  3ZO0 B;  2VZO A;  2GAL A;  1D0H A;  2J1E A;  1WZX A;  4XBN A;  4AVA A;  4ARX A;  3ZMN A;  1OI6 A;  3LIG A;  4AR2 A;  4IV1 A;  3SC7 X;  3U75 A;  1PO1 2;  4RQP C;  4XHB A;  4Z07 A;  1C5I A;  1S0I A;  4ASM B;  1LR5 A;  2YXS A;  4CPB A;  4XXP A;  1PGW 1;  3S5A A;  1VBB 1;  3MLJ A;  2FCV A;  3C7F A;  4LBN A;  3TN9 2;  3LE0 A;  2PEL A;  1XE8 A;  4J25 A;  2PN5 A;  3J8F 2;  1UCX A;  4PT6 A;  5A80 A;  2JG8 C;  1J3Q A;  1J3R A;  4BE3 A;  1VLN A;  2NZ9 A;  1IGO A;  4LK7 A;  4IV1 B;  4HET A;  2ZGP A;  2UWC A;  2XJP A;  3NJY A;  2CAU A;  5SV8 A;  1C57 A;  2VUL A;  3PVB B;  4FT8 A;  2WIN B;  3WHU A;  2B9U A;  1IS6 A;  1PK6 C;  2ZGL A;  2VGD A;  4A42 A;  2WZR 3;  3H8R A;  2R30 A;  4NRM A;  3AX4 A;  5FJK A;  1G9D A;  2ZGU A;  3MV1 1;  1U5X A;  4AI1 A;  3UGG A;  4KWL A;  2JE9 A;  5IVJ A;  1KGY A;  3K77 A;  2R1B A;  1H8T A;  1MAC A;  1NT0 A;  1W06 A;  3IB3 A;  4ZY9 A;  1PIV 1;  4IEP A;  4XUP A;  1BBT 2;  4E2Q A;  1GBG A;  1WCQ A;  1UMI A;  3T2Q A;  5D8A A;  3HN1 A;  1HRI 1;  1JZ3 A;  5CAZ A;  1RUH 3;  2ZGS A;  5LA9 A;  2Q8C A;  1H8T B;  1CAW A;  3TEZ A;  2RS3 1;  4H7M A;  3PUR A;  3TB0 A;  1FI2 A;  1IHM A;  1NG0 A;  3OGJ A;  2JJ6 A;  2BGP A;  4M4P A;  2BP6 A;  2HJI A;  2R04 1;  4JRL A;  3PU3 A;  1G86 A;  1WMF A;  2BDR A;  2J1T A;  3UGF A;  4Q0S A;  1TZO A;  2QCS B;  3WW2 A;  1GP4 A;  2ARA A;  3GBW A;  4UW3 A;  3WG3 A;  4AWD A;  5C9A B;  4GD4 A;  1HIX A;  1ASJ 2;  5AC9 2;  1NE6 A;  2Y6J A;  4WM8 A;  2XJS A;  4S2F A;  1H2M A;  3GNE A;  4GXL A;  3T08 A;  2E7T A;  5D2A A;  1Y7B A;  5FO8 B;  5CKM A;  3WUC A;  3POS A;  1LNS A;  5E88 A;  4EN8 B;  2B7Y A;  1JHN A;  4WM8 B;  3MID A;  1AR7 3;  4W50 A;  2Q1Z B;  1COV 1;  2RMU 1;  1BXH A;  4UT5 A;  2CDP A;  1I9R A;  3EB7 A;  3PVO A;  2DTW A;  1X8E A;  3ITQ A;  3IWZ A;  3URF A;  3LZZ A;  5CG8 A;  2WN3 A;  1NA1 C;  3PVN A;  3I2O A;  1FOD 3;  4QHB A;  5LBF A;  3W58 A;  3M4F A;  3KT4 A;  3NST A;  3L9J T;  4FPL A;  1AZD A;  4ARY A;  2GH8 A;  4CP9 A;  4Q4Y 3;  1B35 A;  1VMH A;  2P37 A;  2YC0 A;  3DV8 A;  5AVA A;  4OI0 A;  1YEW A;  2C1F A;  1NUK A;  1VRB A;  3BOP A;  5DPN A;  1W8T A;  3AK0 A;  3RS6 A;  1RHI 3;  4LTA A;  1DZQ A;  3MEP A;  4LE3 A;  4YW1 A;  4XQW A;  4CP9 B;  4HN1 A;  5AFE A;  4LHK A;  5BNO B;  4GH4 C;  5KHJ A;  4K1Z A;  5G05 L;  2W95 A;  5L9B A;  4MGI E;  1QQP 2;  4RYD A;  2A6X A;  4CDX C;  3LEM A;  1W9T A;  5K9Y A;  2J1A A;  4I01 A;  1VE0 A;  4UOJ A;  3O1T A;  4Q4X 1;  1X8M A;  2FD8 A;  4M3C A;  4N53 A;  3LPG A;  2F17 A;  1ULD A;  4XCB A;  1LOG A;  1EAH 2;  4BMB A;  2W46 A;  5EJ3 A;  5FQ0 A;  4Z82 A;  4I0W B;  1CJP A;  1XB9 A;  2VMG A;  2XVK A;  1RUF 3;  2D40 A;  3NV2 A;  3PUS A;  4YGB A;  3B02 A;  5FO7 B;  4OQ9 A;  2QDR A;  1WA4 A;  2BQP A;  4XJ9 A;  4HXC A;  5FQ0 B;  3NO8 A;  4B1M A;  1W3V A;  4Q4V 1;  1DYK A;  1W8Z A;  2HWB 3;  4AEJ A;  4EE2 A;  1ZRF A;  4UFJ A;  3VKO A;  1H6Y A;  1FNZ A;  1IS4 A;  3VBR C;  4Z2W A;  4YG3 A;  1L7R A;  1CZV A;  3E5Q A;  5FYS A;  2HWC 3;  1WD4 A;  4Y1V A;  2IFW A;  4RFR B;  2Y0O A;  3EJK A;  4D94 A;  5K0U B;  2GU9 A;  2ZKN A;  2VH9 A;  5LK5 A;  1K42 A;  1IG0 A;  4QQ2 A;  4UF0 A;  3EQE A;  5D8A C;  4DQA A;  5EHD A;  2WWS A;  4IEY A;  3RPQ A;  2I2S A;  3VBO B;  3M3O A;  4JDM A;  4OI1 A;  4CXY A;  3NV3 A;  2W1U A;  5TSW A;  3EO6 A;  4S2G A;  2K9Z A;  4EN7 B;  4BWO A;  3HMY A;  2RVA A;  4P9Y A;  4AI2 A;  4PF5 A;  2WZP P;  3KV5 A;  2WZR 2;  2ZZQ A;  3NNF A;  1NZC A;  2ZS6 B;  4YVS A;  2W1S A;  2Y8K A;  4YM1 A;  4WVM A;  1V00 A;  4GMP 1;  1AXK A;  2QFE A;  3BTY A;  1GZW A;  1GR3 A;  4YM0 A;  3THP A;  3MDP A;  5FLJ A;  1PGL 1;  2CY6 A;  2DU1 A;  3MF6 A;  1V6N A;  3DN7 A;  3T2T A;  2WJS A;  4YVS B;  3SCF A;  3LPF A;  1GNZ A;  5E1R A;  3GHN A;  4WVM B;  2EIE A;  2P3J A;  5FYB A;  2PHU A;  2VMC A;  1GZW B;  3GZA A;  1PZ7 A;  4XMA A;  3I2D A;  1RUH 2;  4HK8 A;  1RUI 1;  1BJQ A;  1VPH A;  4AFM A;  3JB4 C;  1UY2 A;  2R06 1;  1JYI A;  1R09 1;  3UES A;  3UET A;  2Q1M A;  3AYD A;  2BGC A;  3AL6 A;  1JYN A;  2FDK A;  1D4M 1;  3MIB A;  1GV9 A;  3BTA A;  4AXO A;  4IE0 A;  5CU1 A;  5BV6 A;  4ES9 A;  4UFM A;  5DAP A;  2XQR A;  3WD5 A;  1QJX 3;  4N90 A;  2Y26 A;  4CCO A;  4YFZ A;  3PL0 A;  5IHR A;  2A70 A;  1OKO A;  1IG3 A;  1VRH 3;  1OC1 A;  2OX0 A;  3NNG A;  5ABJ A;  2HYX A;  3LGR A;  3TNP B;  4OCT A;  1SBD A;  4JCK A;  4QQP A;  4MGT A;  1H1A A;  1N3O A;  4P5Y A;  5FZ7 A;  4AED C;  1LOC A;  2V4V A;  1UIJ A;  3VLB B;  1C4R A;  1D2S A;  2YPJ A;  3ZYH A;  3BB6 A;  4RS5 B;  1K45 A;  1AR7 2;  2VEC A;  1NCQ C;  2XBO 3;  3A23 A;  4JQR A;  5EFU A;  1NAE A;  4BQ1 A;  1O4T A;  1JYT A;  1E5I A;  3OD4 A;  4N53 C;  2VE1 A;  3GGL A;  2E33 A;  4P9G A;  4FAG A;  2W91 A;  1FOD 2;  3AMM A;  1VBB 3;  1XND A;  1UX7 A;  2EA7 A;  3HQR A;  1UN1 A;  2CU5 A;  2ZKL A;  2V5D A;  3HPN A;  2XOM A;  3W5N A;  4Q4Y 2;  5C4W A;  2ZAC A;  1WMD A;  2X05 A;  4GUL A;  1CAX B;  1POV 1;  1RHI 2;  1W9S A;  2VVE A;  2ZGK A;  1OLR A;  2DCZ A;  1IKQ A;  3OUJ A;  5F3I A;  2TBV A;  2YGL A;  1DGR N;  1YIF A;  2D93 A;  4XJW A;  3WV6 A;  3HOB A;  3PMS A;  2WA3 A;  3IZO A;  3HEI A;  1TE1 B;  5DDJ 1;  1OSG A;  2GME A;  2IWG B;  1S4C A;  4CPB D;  1WA6 X;  4CVU A;  3VV1 A;  3WQ7 A;  1CX1 A;  2Z42 A;  2I74 A;  1Q3E A;  4CCD A;  2EID A;  4DB5 A;  1JYX A;  3MFA A;  2B4K A;  2HWE 1;  2O14 A;  3LA2 A;  4A6S A;  2IC1 A;  3Q8B A;  4AL9 A;  2QQW A;  2C9K A;  2DCY A;  2C4X A;  4XAC A;  3H50 A;  1RUF 2;  2CYF A;  3MIH A;  5FUI A;  4XFG A;  3VDD A;  4JQT A;  5FZB A;  4ZON A;  3S5Q A;  1WCU A;  2QZ3 A;  1GOH A;  5F2S A;  2R07 1;  3B5L B;  1OQD A;  2MEV 1;  2RS1 1;  2OQ6 A;  3CMG A;  5DUU A;  1AR9 3;  1DQ5 A;  4YVW A;  4W65 A;  2HWB 2;  1W6M B;  2X10 A;  3WNL A;  2VD7 A;  5LRR A;  1Y3T A;  4A45 A;  5C8C B;  4LOS A;  4X8P A;  3WUD A;  3ALQ A;  2JKB A;  5IVE A;  4YLZ A;  1GWL A;  5IUQ A;  4BK5 A;  1W3X A;  4PQQ A;  4YSF A;  2HWC 2;  4ISQ A;  1HB2 A;  3FE5 A;  2MNG A;  4FFG A;  4GMP 0;  4MX3 A;  1ZRR A;  1AR8 3;  2AYH A;  1F31 A;  1VBD 1;  5FRA A;  3I3E A;  4BU2 A;  1D0G A;  3ROU A;  5GLV A;  3R4S A;  1LKN A;  4A7Z A;  4Y22 A;  4DXS A;  4E8C A;  2WSU A;  2WII B;  4AW7 A;  2P2K A;  2ZA9 A;  1IKP A;  2ARE A;  3RYP A;  2RMU 3;  3MF9 A;  1PNF A;  5IJR A;  4QQO A;  2XDV A;  3Q8F A;  5BNN C;  1C8M 3;  1C8N A;  3SH5 A;  1RUO A;  2CWM A;  4NRO A;  4YWA A;  1OXC A;  4Y22 B;  5EQU A;  1ODM A;  1XNC A;  4N43 A;  5FPB A;  3O0X A;  4R9B A;  4ZZ8 A;  1S0D A;  2WT0 A;  3C7G A;  3I3D A;  2ETE A;  1UOB A;  1W6O B;  5GZD A;  3AKT A;  3U37 A;  1W0P A;  3HIF A;  3I2H A;  4XXA A;  5HCB A;  3K2O A;  1W6Q B;  1CES A;  2PHR A;  2BWC A;  4PJY A;  2CDO A;  5B2G B;  2VZT A;  2JG9 C;  5EIY B;  1XYP A;  3RVH A;  2XUM A;  1YQ2 A;  2VTX J;  3P3P A;  2X09 A;  4RHV 1;  3H8X A;  1GFF 2;  4JC1 A;  4Q26 A;  1DYO A;  2RG4 A;  3TOJ A;  2WNO A;  5FZ3 A;  5JVV A;  1NOV A;  4FFI A;  4X8N A;  5LY2 A;  3SIS A;  1C28 A;  3I49 A;  4FVV A;  3ZSL A;  3DKW A;  4JVA A;  4V2W A;  1VB4 A;  5T54 A;  4Q4X 3;  3LSD A;  2BVB A;  2VCA A;  4IEW A;  4DZG A;  4OHW A;  2LTN A;  4RR3 A;  1CN1 A;  1FX5 A;  3G7D A;  3VD4 A;  3H0O A;  2YBS A;  1QJX 2;  3T30 A;  5HV0 A;  4K7J A;  5A7S A;  4EQV A;  4CUA A;  2GC2 A;  4ATF A;  2IVJ A;  4PLM A;  4YM2 A;  3ZXJ A;  1GQG A;  1VRH 2;  5JIA A;  1HRV 1;  1H6X A;  2ZAA A;  5FZI A;  1TNR A;  4MYE A;  1G6N A;  5C3R A;  1POV 0;  1F9K A;  4P9X A;  4XVH A;  4K20 A;  1SMV A;  1SPP B;  2G9Z A;  2Q8E A;  1JXN A;  2GNB A;  3BOW A;  4YYO A;  2E51 A;  2AEN A;  2XBO 2;  2D6M A;  4HAN A;  2GH2 A;  4AHW A;  5JAX A;  1PNG A;  1SDW A;  3R0R A;  4V2V A;  4CEW B;  1G9B A;  3Q8C A;  2Y34 A;  3W5M A;  1YC6 1;  1GZC A;  1X50 A;  2Z5W A;  3INA A;  4IEU A;  1VBB 2;  2DUP A;  2FCT A;  2HWD 3;  5JCT A;  2XUE A;  4JHZ A;  3VD3 A;  5LAT A;  5JDB A;  1F4H A;  3POG A;  1QXP A;  4Y1X A;  5KBF A;  3JQX A;  3FUO A;  4HK9 A;  4PF1 A;  1NQD A;  2VOV A;  3KT7 A;  4M01 A;  4MH0 E;  3HJR A;  4QX7 A;  4YVW C;  1JTZ X;  1GIC A;  3PTR B;  1GAN A;  2JDH A;  3VDC A;  2J42 A;  5DQ0 A;  1O59 A;  4A6O A;  4DPN A;  1WKY A;  4NIH A;  3RI8 A;  2QQI A;  3R4U A;  1XYO A;  1DCS A;  3ZXK A;  1ENR A;  2ZGN A;  5J96 B;  3ZFG A;  4GAZ A;  4LK6 A;  2BOI A;  2XJV A;  5DZE A;  2OPW A;  2Y6L A;  4O61 A;  4G4F A;  1VJ2 A;  2YFU A;  3MIF A;  4FPO B;  4I2O A;  1LGB A;  1H30 A;  1IPK A;  4P9W A;  4R8H A;  1RUI 3;  5IK5 A;  4HKW A;  4J1W A;  4MGZ E;  5F5A A;  1Q43 A;  1GKB A;  4URT A;  1OMI A;  2R06 3;  4I3P A;  1R09 3;  2BZD A;  1DGL A;  1AR9 2;  3AL5 A;  3N9M A;  3M7A A;  1D4M 3;  4N43 C;  5I0S A;  1QH7 A;  4Y5S A;  4NHL A;  1PMI A;  4E4Z A;  2G9F A;  1AXY A;  1HQN A;  4MV2 A;  2D3S A;  2VQT A;  3CJX A;  5FPA A;  2XVL A;  3WNN A;  4MUV A;  3I8T A;  5T3N A;  3JXS A;  3TEY A;  2E32 A;  3WW1 A;  1AR8 2;  2QTW B;  3A21 A;  4XJU A;  3THD A;  4CDQ B;  5JUV A;  5J36 A;  2WBK A;  4OHV A;  3CF6 E;  4L97 A;  3RQ0 A;  4FP3 A;  3OGG A;  1EYB A;  3GZE A;  3OY8 A;  1WMX A;  2WYF A;  4XF9 A;  2IXC A;  4GQ7 A;  5FYI A;  3CL1 A;  3T4V A;  2DVB A;  2G1M A;  2RMU 2;  3BTX A;  4DEQ A;  1F5F A;  4DEV A;  1C8M 2;  1VP6 A;  4IDZ A;  1N3P A;  1HV0 A;  5LB6 A;  4CDU A;  4BDV B;  1Y9G A;  2RS5 3;  4IER A;  3FJS A;  3OY8 B;  3QH6 A;  5FV3 A;  1S0E A;  5BNP C;  1XSQ A;  2BEO A;  4LO5 B;  5FK8 A;  3THC A;  5FKB A;  1O5L A;  3POE A;  2DFB A;  4TYS A;  2JWP A;  5H9Q A;  2R7E B;  4XBL A;  2NPI A;  4WVV A;  2P17 A;  5CNA A;  3KCX A;  4CEY A;  4D7Y A;  3O12 A;  2WFF 3;  3SIT A;  1DG6 A;  2OW4 A;  4YGD A;  4LBQ A;  1UU4 A;  1WBF A;  3N3H A;  1MS1 A;  1S2K A;  4AEK A;  5H9R A;  2CGO A;  4LO7 A;  5DUX A;  2FDF A;  2Q0A A;  4JKL A;  3TWI A;  1AJK A;  5GM0 A;  4MGQ A;  5FYM A;  1DQ4 A;  3DPR C;  4OI4 A;  4WM7 A;  4CEY B;  1O3R A;  4M4R A;  1L7Q A;  3O1O A;  4LO6 B;  3AVR A;  3KCY A;  4LJH A;  4EN9 B;  1TMF 1;  5JR7 B;  3WP4 A;  1QJY 3;  1UPS A;  3S57 A;  1O4Z A;  1O7F A;  3E6C C;  4Q4X 2;  1KFU L;  3AKR A;  4GB3 3;  2H6C A;  2P6H A;  2ZX2 A;  3PUI A;  4IV3 C;  1ZZ9 A;  4WM7 B;  2C0Z A;  3VBS A;  5C5U A;  5CFC C;  2Y6F A;  5KHG A;  2HWE 3;  3AB0 A;  3WNX A;  5FZ6 A;  2KD7 A;  4JDO A;  2CGP A;  2RJ2 A;  2YU1 A;  5EXO A;  2DV9 A;  3I54 A;  1IOA A;  4MOA A;  2VR4 A;  2BWA A;  5FTT C;  3ZVX A;  1UU5 A;  2DBN A;  4UW6 A;  4KI5 M;  4Y1Z A;  2WO2 A;  3BPZ A;  1ZRC A;  1XU1 A;  2Z79 A;  3MBW A;  4QDR A;  1O8S A;  4QWN A;  2FZ1 A;  2RS1 3;  5FR3 A;  1DU3 D;  4K6B A;  2W1W A;  3OGR A;  1ST8 A;  4XTP A;  2BTV C;  3WG4 A;  2Y6H A;  4KBB A;  4YRD A;  3MW3 A;  2EXI A;  3MIE A;  4CDW B;  2ZZJ A;  4YZ1 A;  1H0B A;  4MVT A;  4XOG A;  2LS6 A;  4KG0 A;  3ZXD A;  4ATE A;  2XML A;  3ZDV A;  1W8F A;  3RZH A;  2QQK A;  2D3R A;  3WY6 A;  2JB4 A;  2B42 B;  4P5H A;  4QKD A;  2HWD 2;  4UFL A;  5FMD A;  4MGS A;  1WW7 A;  1BMV 1;  1VBD 3;  5T5L A;  5IVY A;  5FZD A;  3T1M A;  1V9U 3;  4GWI A;  4NR1 A;  5FYU A;  3VBH B;  4OMD A;  1CON A;  1V6M A;  1F4A A;  4AAP A;  2YC2 A;  5F3E A;  4CTE A;  1GNY A;  4AQ6 A;  1K5M C;  2O0O A;  4XDO A;  3WQ1 A;  5C71 A;  2B46 X;  4QGN A;  5T52 A;  3RI9 A;  3DXU A;  4W8J A;  1M06 G;  2IFR A;  3ZPO A;  3POJ A;  1QJU 1;  5FYT A;  1VBA 1;  5L7O A;  1JZ7 A;  3J26 N;  5FZG A;  4GKY A;  2X29 A;  2Q30 A;  5A7O A;  5EYY A;  4B7K A;  3SH3 A;  4UAP A;  1X33 A;  4D6S A;  3I7D A;  1FAY A;  3TEW A;  5FMO L;  1Y43 B;  3UV9 A;  5L7O B;  3KGZ A;  5LA2 A;  2QBX A;  3ZYR A;  3WDW A;  4SBV A;  4AF9 A;  1XNT A;  3MUZ 1;  3POF A;  5AC9 3;  1W8W A;  1QNY A;  4AZZ A;  4AEM A;  4XCA A;  2QQN A;  3KHB A;  4FXK B;  2VQA A;  1RGS A;  3S30 A;  5K7P A;  1RUI 2;  4OYU A;  2BYV E;  2WKK A;  3I2I A;  4XET A;  4CCK A;  5I91 A;  2R06 2;  1VBC 1;  1HLC A;  1OPO A;  1R09 2;  1TME 1;  3MW2 A;  3ZYB A;  5KHI A;  1LHN A;  4BLJ A;  1MS4 A;  3ZXE A;  4CDU C;  3RGB A;  2XQX A;  4NPL A;  2JG8 B;  1ND2 C;  3FFQ A;  3N7J A;  5CZK A;  5FY1 A;  1UZ0 A;  1D4M 2;  5IVV A;  4W6X A;  1OA2 A;  2WYS A;  5FP7 A;  1DBN A;  2BNM A;  2HWF 3;  1E5S A;  2VQU A;  2YGM A;  4GAL A;  4QPW A;  4LMF A;  5ANN A;  3VKN A;  3KB5 A;  1AUY A;  1UIK A;  3ZFE A;  3U4X A;  3JB8 A;  4Y4Y A;  5DAQ A;  3SEE A;  1HRV 3;  3MIC A;  3K4A A;  3VL9 A;  3NV1 A;  2PLV 1;  4GWJ A;  4QX1 A;  3WX5 A;  5IAV A;  2XHN A;  1GU3 A;  3ORJ A;  2W39 A;  3ZOI A;  5KC5 A;  2XL7 A;  3T0A A;  4ZS2 A;  3UL2 A;  4LA3 A;  2VU9 A;  2D6L X;  1ZBE 3;  3E5U A;  1TQ5 A;  2YBP A;  1FPN 1;  3C7O A;  3IPV A;  4LIT A;  4LBJ A;  3U11 A;  4AK3 A;  4CXW A;  1TNF A;  1S55 A;  2ZEW A;  1RJ7 A;  3LB9 A;  4XPV A;  5FP4 A;  2RS5 2;  1LEN A;  1NCR B;  1BVP 1;  2PA7 A;  5I8S A;  4B4Q A;  2VBP A;  2LAL A;  3T0D A;  5IFP A;  5JLV A;  1I5P A;  2I07 B;  3LQC A;  3UT0 A;  3AYA A;  1RL3 A;  3LFM A;  3RWN A;  3KS7 A;  1RXG A;  2WFF 2;  2D6P A;  3C3V A;  2WS9 3;  2QZ2 A;  3PUA A;  5GLU A;  2P1B A;  2WNV A;  1R08 1;  5J1X A;  4AI0 A;  2BBV A;  2I45 A;  2OZJ A;  3WNM A;  3AP9 A;  2XJQ A;  3WEZ A;  4QPI A;  2OVU A;  5BY5 A;  5ERL A;  5KXD A;  1QU0 A;  4QKN A;  5DDJ 2;  3K75 B;  3RWK X;  1QJY 2;  4ITC A;  1CIW A;  1Z7S 3;  1RYY A;  1H8V A;  1SCR A;  2WNV B;  3DEM A;  3HQU A;  2X5I C;  1QHD A;  4GB3 2;  3E5X A;  4C1W A;  5ISL A;  1FMD 1;  2VOW A;  1MVQ A;  4TN7 A;  2DVD A;  2HWE 2;  2IZW A;  3H1Y A;  4QPI B;  4UBH A;  5IAX A;  3J7N A;  2GN3 A;  1KDM A;  5DZF A;  2HEV F;  4FP2 A;  3UGH A;  3BYW A;  3VDA A;  3E6D A;  4YW3 A;  4N7I A;  5H9P A;  3T1L A;  2GC1 A;  3UJQ A;  4BM8 A;  4JKK A;  5FOB B;  4MXV A;  1S0J A;  1I1E A;  2BOJ A;  4NHM A;  1W0O A;  2JIC A;  2PAK A;  2ZGT A;  2C24 A;  2RS1 2;  1LOD A;  4TLG A;  1CIY A;  2D6K A;  1UPI A;  1OOP A;  4E4S A;  1UKG A;  2XG3 A;  4Q5O A;  4XUR A;  1QIQ A;  5DG1 A;  3E1F 1;  3BAL A;  1XNA A;  1HXS 1;  2ZGQ A;  4GIQ A;  4BHP A;  2JDP A;  1VAL A;  2YY1 A;  4Z2A A;  5FXV A;  2GMM A;  1GNH A;  1W2A X;  3LEK A;  3HBZ A;  1NE4 A;  5F8P A;  1OOP B;  4Q27 A;  4HFS A;  1CJD A;  5FYC A;  4NWW A;  4XJZ A;  1SLB A;  2J1U A;  4JX0 A;  4XW3 A;  1UL9 A;  2ZEY A;  3Q9O A;  1QF3 A;  2BNO A;  3N9N A;  4MGY E;  1VBD 2;  4XFB A;  5CIR A;  5DZG A;  5A3N A;  5FY4 A;  4C90 A;  4BH9 A;  4R52 A;  1V9U 2;  1ACC A;  1QEX A;  3OGS A;  2RM2 1;  3OUI A;  2VCB A;  3VHR A;  5JXG A;  3VBF B;  4M3C E;  1QJE A;  2BW8 A;  3B3Q E;  4O7X A;  4MXW A;  4BQY A;  2JKX A;  2AEY A;  3J7L A;  3C7E A;  5D1I A;  2OZ6 A;  1WCD J;  1DP0 A;  3CZU A;  2PMW B;  3DEC A;  5C9A A;  2A6Y A;  1XNB A;  2V72 A;  3RDI A;  1DDL A;  3LIH A;  4ZHN A;  3POI A;  2WO1 A;  5JZG C;  1LOA A;  5FZM A;  4WVW A;  4ET7 A;  4MXW B;  5IFT A;  2VW2 A;  2QQV A;  3ILN A;  1AR6 3;  2ZAH A;  1MS8 A;  2AAC A;  4ZZ5 A;  1BKZ A;  4KH9 A;  3HVD A;  5L73 A;  3IDC B;  3ZIX A;  3VBF A;  4LQR A;  4YGE A;  3UKT A;  4XFI A;  1VAV A;  1RMU 3;  4IGP A;  1LHW A;  2ZX1 A;  5FY5 A;  4W6Y A;  4KU7 A;  3BIW E;  1TMF 3;  2WUH A;  2VVD A;  2B45 X;  4YGC A;  4QX3 A;  1QOO A;  2EXJ A;  3I3Q A;  1NXD 1;  1SHW B;  5C3Q A;  2XPJ A;  1DLC A;  2RV9 A;  5GLT A;  4E9K A;  4TZD A;  1GOF A;  2HWF 2;  2ZMK A;  3IDE A;  3VBU A;  3H3Z A;  3ATG A;  4BK4 A;  1H4G A;  2XWB B;  4LBQ D;  2VZ1 A;  3C2U A;  4TTG A;  3MPB A;  2FDJ A;  4HON A;  1KQR A;  2XVG A;  2WNU C;  4AQS A;  4A4A A;  1ZZ6 A;  4IE4 A;  1HRV 2;  2VM9 A;  3H9A A;  4AOC A;  3C7H A;  1ONA A;  4LLF A;  5BNO A;  4CCM A;  3KF3 A;  3VBU B;  4LHN A;  2A73 B;  1AHS A;  5FBJ A;  5JI9 A;  4L92 A;  2YUE A;  3GCW A;  4OHY A;  1ZBE 2;  1BEV 1;  4PIZ A;  3R6S A;  1LOF C;  1YFX A;  1RUJ 1;  5L36 A;  1WUV A;  1NY7 1;  4IW3 A;  1AVB A;  4YFW A;  4XFF A;  4RGK A;  4B4P A;  4JGY A;  4XE9 A;  3V56 A;  2VBB A;  4IV1 C;  3W9A A;  2VZU A;  2J1V A;  4S2H A;  4CA9 A;  2VZ3 A;  4NHK A;  1HQW A;  1UY4 A;  2ES3 A;  1VBE 1;  2WS9 2;  3VGI A;  3BPS A;  3OUH A;  4AQ2 A;  4Q4W 1;  4JGY B;  4QX8 A;  3ZR5 A;  3ACI A;  2WAA A;  1EV1 1;  4H3W A;  3ZXG A;  3OOX A;  2VXJ A;  2AC1 A;  1T2X A;  2UYB A;  4OMC A;  4D8M A;  4FOQ A;  2WRA A;  5K0U A;  3JBG 3;  1Z7S 2;  1JOB A;  5C3P A;  4IEO A;  5FP8 A;  5FIX A;  2B9V A;  2UWB A;  1QDO A;  4FPH A;  4DY3 A;  1H1M A;  4AFB A;  1G7Y A;  2GN7 A;  1FV3 A;  2W3J A;  1H8T C;  1UY1 A;  4IE5 A;  4XFA A;  3VBO A;  4XF3 A;  1NCQ B;  1LEM A;  2K0G A;  4R4Z A;  5FZA A;  4L9B A;  4OI2 A;  1KEX A;  2ZGM A;  3TYJ A;  4E4D X;  1DF0 A;  2P5B A;  4QXB A;  2VTX A;  4FTS A;  1SZB A;  1AL2 1;  4B7E A;  3K3N A;  2DVA A;  1W90 A;  5DXD A;  1EPW A;  5E89 A;  2GNT A;  5C9A C;  5FMC A;  1RIN A;  3LDK A;  5L9R A;  1YUD A;  5HXV A;  5BXX A;  5K4L A;  1RUE 1;  2G4I A;  5EV7 A;  1GQH A;  4M0H A;  5T5P A;  4FPG A;  3LWC A;  3T2O A;  1MQT B;  3D0S A;  2XGX A;  4CYD A;  1RB8 G;  5SV5 A;  4UWD A;  5JR2 A;  1O6U A;  1Q8V A;  4PDW A;  2A3Y A;  3WDX A;  4BLI A;  2FDG A;  1DGR A;  5LBE A;  5I0D A;  2WQ4 A;  3MIG A;  4WM8 C;  3KQ4 B;  2W08 A;  4LO4 B;  5DAB A;  3A7Q A;  4FXG B;  1OVS A;  2PAM A;  2AEZ A;  4HPK B;  4PDW B;  2WNE A;  3RZG A;  1WW5 A;  3OGV A;  4ERO A;  4QGM A;  1RED A;  2OXB A;  2E7A A;  4AVS A;  4Q8L A;  2FZ2 A;  1RVF 3;  2EXK A;  2IXI A;  3N7L A;  5FWE A;  3K51 A;  3LCP A;  5FWJ A;  1O3Q A;  1SG3 A;  2K2S A;  2P34 A;  3AP7 A;  4I30 A;  2QQO A;  3JQW A;  1AR6 2;  1B35 C;  2ZX4 A;  4PHZ A;  3SCG A;  4RS5 A;  3ACH A;  1PM7 A;  2ZXQ A;  5T50 A;  3RJ2 X;  5FUP A;  3B9C A;  1LCL A;  2VUD A;  4IEV A;  1OLM E;  4NJ4 A;  3BKZ A;  1KS4 A;  2WQ8 A;  1RIR A;  5FYV A;  1RMU 2;  1TMF 2;  1PO2 1;  4ZXK A;  3WDV A;  3AZV A;  4DOU A;  1RUD 3;  1DYP A;  4AQT A;  2R0F A;  2W5F A;  4XBQ A;  4W6W A;  4MET A;  1FMD 3;  4XFC A;  4Y20 A;  1LTE A;  3OEA A;  4Y1Y A;  5CEH A;  1CAX A;  3AZZ A;  3L2Y A;  5KR7 A;  5FRE A;  3OEB A;  1GMM A;  2WFP A;  3AMQ A;  4XAA A;  4Q0U A;  2Y33 A;  4XF4 A;  1UYX A;  3I2G A;  4Y20 B;  1ZX5 A;  4IGQ A;  1QGL A;  1X82 A;  1OKQ A;  3DUI A;  5A7Q A;  4CE8 A;  3N35 A;  1J59 A;  1YQ5 A;  1Q8P A;  3ACF A;  5A3T A;  3D8C A;  1QY4 A;  5FLH A;  1ZRI A;  2JDU A;  3PLQ A;  1UYP A;  2FQP A;  4IGO A;  4R4X A;  1YWK A;  3NWK A;  4AVV A;  4Y5Z 0;  1ZBA 1;  4GJY A;  4LHL A;  1KRI A;  1MPX A;  2D3P A;  2VOT A;  5IWF A;  4J1X A;  5A7N A;  4OUL A;  3WOG A;  4ZU4 A;  3NJX A;  5FYZ A;  3ZMO A;  3LDR A;  1W05 A;  1YI7 A;  1PIV 3;  1UQX A;  2TNF A;  3PJQ A;  2VZR A;  4PIY A;  2DVG A;  2OUH A;  2DYC A;  3JD7 1;  5FZ8 A;  5JSR A;  3PJY A;  1W6M A;  5C8C A;  4LBM A;  2D6O X;  1HRI 3;  2J22 A;  4P9I A;  1EY2 A;  2WC2 A;  3ZYP A;  4AFA A;  2BFU S;  4N7U A;  4CSW A;  2NM1 A;  3WP5 A;  1SAC A;  2RS3 3;  5FY9 A;  3I3M A;  5ACA 1;  2NN8 A;  4HT1 T;  1W8U A;  2L9L A;  1VAM A;  2GP5 A;  2R04 3;  4QHZ A;  4LEJ A;  3JBG 2;  4YVS C;  2XHK A;  1UZY A;  3OYW B;  3N7M A;  1OLM A;  3WW3 A;  5IW0 A;  4WVZ A;  2VAU A;  1EP0 A;  5CKN A;  4Z8B A;  5LY1 A;  5FZ1 A;  1BCX A;  5AFB A;  4NPM A;  2JE8 A;  1PO1 1;  1VAK A;  3WNK A;  5EWS A;  2WA4 A;  3VN4 A;  3VZK A;  1WBL A;  3LDB A;  5IVB A;  3ECQ A;  3TN9 1;  3PTY A;  2VNR A;  1W9W A;  3A22 A;  3J8F 1;  4RFT 0;  4CU7 A;  5IVC A;  3U0Z A;  3WZ1 A;  3PME A;  3VZJ A;  1VBC 2;  2E53 A;  3QBQ A;  3DCQ A;  2D98 A;  5F9T A;  1COV 3;  4A3Z A;  1W6O A;  3P3N A;  4G3Y C;  3BUC A;  2ZX0 A;  5J09 A;  4QT6 A;  1XOY A;  3CLP A;  1W6Q A;  4IES A;  4BQ4 A;  3WT3 A;  2VBD A;  1O3T A;  2DCJ A;  2NP0 A;  2ZX3 A;  1H9W A;  1C1F A;  3GJB A;  4RGG A;  2DFC A;  1JOD A;  4BME A;  4NAO A;  2EAL A;  4BQ3 A;  1JYW A;  1UU6 A;  5CIS A;  4RS5 C;  2IUW A;  4COY A;  4H14 A;  5FZ9 A;  3AYE A;  5ABJ C;  5HXM A;  2B5H A;  1JHJ A;  4Y5T A;  4JGZ A;  4EN6 B;  2UYA A;  4A41 A;  5FZC A;  1A78 A;  1O8P A;  1J3P A;  1ZM1 A;  3AVS A;  3KM5 A;  4DIN B;  3FLR A;  4E2G A;  5KHK A;  2MHF A;  1DGW A;  1VR3 A;  1YFW A;  1SBF A;  1V6I A;  4QX5 A;  1YFU A;  2ARB A;  1RVF 2;  1PM4 A;  4D6Q A;  3RG0 A;  2CTV A;  4JGZ B;  4LO8 A;  3ZFF B;  3HBK A;  4HL0 A;  1OHF A;  4KWK A;  1V6O A;  1GSL A;  4QXC A;  1UO9 A;  2F6B A;  1NLQ A;  4CUC A;  2JEC A;  5FDB A;  3N9P A;  1RTV A;  3IAQ A;  4EZH A;  4GA9 A;  3T3Y A;  2WZ8 A;  1APN A;  1VBE 3;  2FMY A;  4KU8 A;  4MHU A;  5E6H A;  3W21 A;  3ZSJ A;  5C4W C;  4D3W A;  1SPP A;  4DXR A;  1R1A 1;  4B4R A;  3PVE A;  5F32 A;  1LGC A;  3VZN A;  3H1M A;  2V09 A;  4JDN A;  1PZ9 A;  2BU9 A;  4Y33 A;  2PHD A;  1ZYB A;  5GAL A;  3ZPY A;  4CEW A;  5LW9 A;  2PHL A;  3WF4 A;  3VHP A;  1RC6 A;  1UMZ A;  2VNO A;  4K1Y A;  4EZ4 A;  4Q4V 3;  1JI6 A;  3LD8 A;  1RUD 2;  2Q8D A;  4E2S A;  2WO3 A;  5F5Q A;  3CJI A;  1SLC A;  3QCW A;  4CCL A;  4HN0 A;  2YBK A;  5FP9 A;  1LHO A;  1YLL A;  4AGV A;  3OPW A;  5IAT A;  1FMD 2;  3NNJ A;  4QQH A;  5JMO A;  4L99 A;  3LFI A;  4YG0 A;  1PGW 2;  2OA2 A;  2OKX A;  3HAG A;  3CJI B;  3WQB A;  5LBC A;  4LBO A;  4BIS A;  4RSU A;  4A7K A;  3WQ0 A;  1YIP A;  3IMN A;  1KJR A;  3NMB A;  4Q0P A;  2BJS A;  2P6C A;  4QPG A;  2K46 A;  1HJG A;  5BNP B;  3RMY A;  3VDD C;  2VZS A;  4Z1V A;  2C9A A;  2GAU A;  4DIQ A;  1YHF A;  4C1X A;  5LRS A;  1X9T A;  1ZA4 A;  3H7Y A;  3HN3 A;  1B09 A;  1W6P B;  3QOP A;  1W04 A;  4JAA A;  4QPG B;  3NRU A;  1RUE 3;  4C8D A;  3O7O A;  5FZO A;  3LA3 A;  4Y26 A;  4UFI A;  4DFS A;  1HN0 A;  1YJL A;  4GMP 3;  4ASL A;  5JWP A;  5GZF A;  1OH4 A;  1H2K A;  1U5Z A;  5I8T A;  4CCC A;  1OVP A;  2UU8 A;  3JU9 A;  1PIV 2;  3H42 B;  2CL2 A;  5FZO B;  4IV3 B;  1HRI 2;  4I02 A;  2JXA A;  2GC0 A;  3KVA A;  2WWU A;  2YPD A;  1IPS A;  2RS3 2;  4K8F A;  1ZZ7 A;  3SEP A;  2XXZ A;  4O65 A;  1RUG 1;  3VHN A;  1A3K A;  2R04 2;  2YB7 A;  3AKQ A;  2WAO A;  2JDN A;  1MVE A;  3ZN4 A;  4CDQ A;  2BGO A;  3WF1 A;  2Q5T A;  2C26 A;  3BN6 A;  3DF0 A;  2Q1F A;  3OB8 A;  4P02 B;  5A33 A;  2UWA A;  3Q8E A;  3CIH A;  2P3K A;  5KXB A;  1DQ0 A;  3QH7 A;  2Y6G A;  5EP9 A;  5A1L A;  4KNC A;  5IT6 A;  2PHW A;  2XJT A;  3EHK A;  3O14 A;  4NVP A;  1M4W A;  3HNM A;  3B69 A;  3O5S A;  4NO4 A;  4XIO A;  3MZH A;  1UKR A;  2ILM A;  3ZXL A;  5A33 B;  2VMI A;  1C3H A;  3H8U A;  4EJR A;  1PO2 3;  4GKX A;  1F5J A;  3KF5 A;  4HG6 B;  3MUY 1;  1COV 2;  3HT2 A;  2WLP A;  3GYD A;  3CO2 A;  2CAV A;  1W0N A;  1XXN A;  2A5Z A;  2WZR 1;  2ZBJ A;  1K5M B;  3CKH A;  4I0B A;  4A7Y A;  2FDI A;  1PVX A;  4RR3 C;  4CCJ A;  2VOK A;  4QX0 A;  2E31 A;  2JDA A;  1HN1 A;  4LXL A;  4U36 A;  4FTB A;  1AYN 1;  4JRA A;  5C33 A;  3IBM A;  2VNG A;  4RA0 A;  3IDB B;  4PCR A;  2YDE A;  3NAP A;  4BIO A;  3VHO A;  1POV 3;  5JOZ A;  1MEC 1;  4IUG A;  2P3I A;  5KXC A;  1N1Y A;  3AFK A;  3SH4 A;  3OSD A;  1EPZ A;  3WDY A;  3WXP A;  2BVV A;  4UI9 L;  4Z92 B;  1ZRE A;  3F95 A;  5C6C A;  3MI8 A;  4HKL A;  5GJ6 A;  3UNP A;  2AZ5 A;  2LUW A;  1SFN A;  3NAP B;  1NY7 2;  4FPC A;  1D4V B;  5CFD A;  3GHM A;  2PHF A;  2TUN A;  3KQR A;  3HT1 A;  1S0F A;  3GBF A;  3K46 A;  4XZU G;  5DDJ 3;  5LBB A;  3N9L A;  4N9H A;  2IXL A;  3O1U A;  1IS3 A;  3NV4 A;  3MLL A;  2OQ7 A;  5FUN A;  3Q8A A;  1CD3 G;  3ZXA C;  1XE7 A;  5FPZ A;  2H0B A;  3WF0 A;  1UZZ A;  1PMH X;  5A70 A;  4TSV A;  4BQX A;  2VPV A;  3BI3 A;  2WQZ C;  4QM8 A;  1VBE 2;  1ND2 B;  3HWJ A;  5CFD B;  4ZU5 A;  2JDZ A;  2JE7 A;  2XB6 C;  3GCX A;  3SLI A;  4BB3 A;  3W59 A;  1J84 A;  3E97 A;  2EAA A;  4UW5 A;  3NW4 A;  2XLF A;  1PHM A;  5HV4 A;  2P4E A;  3HR9 A;  5FKC A;  4CP0 A;  4K3U A;  5G04 L;  4CDW A;  4BZ4 A;  1EV1 2;  3FLP A;  2VW0 A;  2R07 3;  3ZSE A;  1DHK B;  1ND3 B;  2MEV 3;  5HCH A;  4K21 A;  1N1V A;  1Y9Q A;  4Q4V 2;  1UW8 A;  4HVQ A;  2W0X A;  4F7Z A;  4A3X A;  4MSV A;  1AR7 1;  3AZY A;  5EZW A;  4QDS A;  1D2Q A;  4WZC A;  4LIU A;  2H0V A;  1BK1 A;  1KJL A;  2BRT A;  4FPJ A;  2D5F A;  1WCS A;  1MR5 A;  3LAG A;  4XIK A;  3VBH A;  3ZFG C;  4DUX A;  4X6Q B;  5JXJ A;  4JTN A;  1SFY A;  2XH6 A;  2XON A;  4NII A;  2UUR A;  1UZW A;  1FOD 1;  3RSJ A;  1CPM A;  2W87 A;  2GSY A;  4QXH A;  3RZZ A;  1WGP A;  2GC3 A;  4Q4Y 1;  1IS5 A;  5GZC A;  2AR6 A;  5LAS A;  1JZ4 A;  1HX6 A;  1NXM A;  1WLD A;  4LBL A;  1W2N A;  2DVF A;  3O0W A;  1RHI 1;  3O1V A;  2VL4 A;  1QXJ A;  1S0C A;  3H7J A;  3MV0 1;  4LOT A;  5F3G A;  5FY7 A;  5A1F A;  5I0T A;  1RUE 2;  1JOP A;  1WW4 A;  2EIC A;  4CCE A;  1XU2 A;  3CZJ A;  5CG9 A;  1VB2 A;  2G19 A;  2EIG A;  2OS2 A;  4TXW A;  5FJH A;  4B3N A;  5JXH A;  1R1Z A;  3H8O A;  2N7G A;  1PGL 2;  4OZX A;  2XKO A;  4RQP A;  2W47 A;  1JYV A;  3V0B B;  2DDU A;  2ET1 A;  1GP6 A;  1MZF A;  1ZZC A;  2X5I B;  5A3P A;  2JG8 A;  2D44 A;  1RUF 1;  3JZV A;  4RHV 3;  2C5D A;  2NQY A;  2XL9 A;  1LJ7 A;  3P6B A;  5T55 A;  3ZYI B;  4RQP B;  1NKG A;  1K12 A;  2GZW A;  4B29 A;  2R16 A;  1KIT A;  2BER A;  2XLA A;  3H3U A;  4NE9 A;  5A3O A;  2ZHK A;  4WZF A;  1W2O A;  3KD4 A;  1PK6 A;  2V4A A;  2HWB 1;  3AJZ A;  2ZEZ A;  3VKF C;  5I8Y A;  4XTM A;  2Y38 A;  4AI9 A;  2JD9 A;  3FWE A;  3ZYF A;  5FFO C;  1AXZ A;  4FQZ A;  5KXE A;  3V0B A;  4Q29 A;  1Z78 A;  5FZ4 A;  4COW A;  5L9V A;  2FHR A;  2JX9 A;  3VZL A;  1AX0 A;  2HWC 1;  1HB4 A;  3KV4 A;  4ISR A;  3ILF A;  5FXZ A;  1PK6 B;  4CEY C;  1N1T A;  1MZE A;  2OUJ A;  3L2H A;  5D21 A;  1R1A 3;  1XYN A;  4XUO A;  4ZKT B;  4Q8K A;  1W39 A;  2A7A A;  2ORZ A;  4K8R B;  4WV8 A;  2DU0 A;  4Y4R A;  1DZR A;  1NCR A;  1PO2 2;  3CQO A;  1UX6 A;  2CHH A;  3MHZ A;  4WM7 C;  5C3S A;  1F8V A;  5A6Z A;  4YZ2 A;  4KMQ A;  3T4H B;  1JH5 A;  5J98 B;  4COZ A;  1UNB A;  1PX3 A;  3VZO A;  4E27 A;  4XZP A;  2VZP A;  3VBS C;  4B8E A;  1GP5 A;  1GWK A;  1S2B A;  2MPF A;  5T5O A;  4Q0V A;  1KDK A;  2DUR A;  4AGR A;  4F8A A;  1US3 A;  4DNY A;  3VKL A;  1DQ1 A;  1QKQ A;  5APA A;  3HQX A;  5FLI A;  3OBZ A;  1MZ6 A;  1TVG A;  3PIG A;  4FOV A;  4CDW C;  4QPY A;  2EAK A;  4MAD A;  2BV4 A;  2F4P A;  4XIL A;  2ARX A;  1OUX A;  2E9Q A;  3THT A;  4MLO A;  3IDA A;  3S0M A;  5A7W B;  2VUA A;  4FPK A;  4I09 A;  3RYK A;  2HH9 A;  2VG9 A;  3H1W A;  2J7M A;  4H2A A;  2C6S A;  1LHU A;  2XJU A;  4HBN A;  4YM3 A;  1ZBA 2;  1E57 A;  1F2N A;  5T5J A;  1U0A A;  1FV2 A;  2VME A;  4KWJ A;  1I3H A;  1C1L A;  1ODN A;  1NQJ A;  1XSR A;  1GQP A;  1ZNP A;  2QUO A;  4RL7 A;  5LA1 A;  1XJA A;  1U12 A;  1NA1 A;  1XC6 A;  1JZ5 A;  3WIN E;  4FCA A;  4COU A;  2VY0 A;  4YW4 A;  3HD8 B;  2QKD A;  1H1I A;  4COV A;  4KBZ A;  5FPV A;  2WO7 A;  3SXW A;  5A32 A;  3AMN A;  3V0A B;  1FYU A;  3OJB A;  3BU0 A;  1NA1 B;  2R07 2;  5JIU A;  2MEV 2;  2WL1 A;  5LCW L;  5FXX A;  3U07 A;  1QMJ A;  2WNU B;  1RUG 3;  3CEW A;  4R9A A;  5FYH A;  2ZHL A;  5A32 B;  4AI8 A;  5L7O C;  1A8M A;  2LW8 A;  1GWM A;  4I0A A;  3BU7 A;  1DQ6 A;  2IXH A;  4MO3 M;  2XBO 1;  3WF2 A;  3GXU A;  4CDX A;  2YRO A;  4BPZ A;  4OHX A;  3CU7 A;  4Y1U A;  4XDP A;  3ZX7 A;  2JB8 A;  2R6Q A;  1UXX X;  2QQP A;  4AHY A;  2WN2 A;  3OF1 A;  4A2U A;  1W6N A;  1L7L A; 
#chains in the Genus database with same CATH homology
 3HNB M;  3CDZ B;  2VJX A;  3OGV A;  4OZO A;  3PUH A;  3ETP A;  4OUE A;  2VCA A;  3VD4 A;  4BJ0 A;  1SG3 A;  1OF4 A;  4CUA A;  5EJZ B;  2ORX A;  2VMD A;  2QQO A;  2VCC A;  1H6X A;  3I2K A;  4QAW A;  4P08 A;  1R64 A;  3ACH A;  2ZXQ A;  3BGA A;  4XVH A;  2WQ8 A;  1IQD C;  2VZQ A;  4LKS A;  3W5M A;  2W5F A;  3SKV A;  3I2J A;  4JHZ A;  2VO5 A;  3VD3 A;  1UY3 A;  2VC9 A;  3OEA A;  3DYP A;  1F4H A;  3OEB A;  4PF1 A;  1GMM A;  1W8N A;  1UYX A;  3HJR A;  3K4D A;  3I2G A;  4LPL A;  1UMH A;  4DUV A;  3VDC A;  1ULO A;  2W1Q A;  1O59 A;  5DQ0 A;  4A6O A;  1WKY A;  2QQI A;  4XUT A;  1NX9 A;  4XUQ A;  3ACF A;  1OF3 A;  3WSO A;  4E8D A;  2BBA A;  3T09 A;  3ACG A;  3VDB A;  4DUW A;  2Y6L A;  3T2P A;  3T0B A;  2YFU A;  1GOG A;  1MPX A;  2VOT A;  5LA0 A;  5HPO A;  3NJX A;  2VZR A;  1TG7 A;  2WDB A;  2BZD A;  2J22 A;  1W8O A;  2QQL A;  3MO4 A;  3LEG A;  2W94 A;  1UWW A;  2L9L A;  5EJ1 B;  4CUB A;  3FHQ A;  4CU8 A;  2VQT A;  2Z4F A;  4AG4 A;  1PX4 A;  3WNN A;  3JXS A;  2E32 A;  5JUV A;  3A21 A;  3THD A;  3I97 A;  2WBK A;  2JE8 A;  3WNK A;  5B4X A;  3ECQ A;  2Y6K A;  1CZT A;  3A22 A;  1W9W A;  2W9X A;  4CU7 A;  4DEQ A;  4DEV A;  3HNY M;  2VTF A;  3VD9 A;  1JZ8 A;  4BDV B;  5IYY A;  4A3Z A;  3F2Z A;  3THC A;  1JZ6 A;  2DCK A;  1PMJ X;  4A44 A;  4DXT A;  2R7E B;  2DCJ A;  3VD5 A;  1P8J A;  3WNO A;  5B4N A;  1K3I A;  1BHG A;  1JYW A;  4XUN A;  3IAP A;  3III A;  4JKL A;  4MGQ A;  4ARX A;  2VZO A;  5HXM A;  1JHJ A;  2J1E A;  4M4R A;  1L7Q A;  5CYY A;  4A41 A;  1O8P A;  3C7F A;  3PUI A;  2VZV A;  3LE0 A;  4PT6 A;  2KD7 A;  3I2F A;  2RJ2 A;  4MOA A;  2VR4 A;  3D3A A;  4CU6 A;  3IAQ A;  4ZXE A;  4KI5 M;  3OBA A;  2WZ8 A;  2WO2 A;  2ZEX A;  3MBW A;  4QDR A;  1O8S A;  4A42 A;  4DXR A;  2W1W A;  1GUI A;  3OGR A;  3GDB A;  2Y6H A;  3MV1 1;  3WF4 A;  1KGY A;  2LS6 A;  3K77 A;  1JI6 A;  1EUU A;  3IB3 A;  2WO3 A;  4ZY9 A;  2QQK A;  2PQS A;  4JKM A;  4XUP A;  4QB1 A;  4MGS A;  1WCQ A;  1UMI A;  3T2Q A;  5JMO A;  3FL7 A;  4GWI A;  4OMD A;  2OKX A;  1F4A A;  3WQB A;  2YC2 A;  1GNY A;  3DYM A;  5C71 A;  2BGP A;  4M4P A;  4QB2 A;  1EUT A;  4W8J A;  1UYY A;  2VZS A;  4FI9 A;  2J1T A;  1JZ7 A;  2Y64 A;  3HN3 A;  4UAP A;  3NRU A;  2Y6J A;  3T08 A;  5LA2 A;  2QBX A;  3ZM8 A;  1OH4 A;  1XNT A;  3MUZ 1;  1LNS A;  1J83 A;  3C8X A;  2QQN A;  4OYU A;  4W50 A;  3I2I A;  5DN2 A;  2CDP A;  3EB7 A;  2YG0 A;  4QX2 A;  5A1A A;  5JR2 A;  2XQX A;  5CZK A;  2WN3 A;  1UZ0 A;  3NJV A;  3EYP A;  2WYS A;  3SEP A;  4ARY A;  1JZ3 A;  2VQU A;  4QPW A;  2YB7 A;  2WAO A;  2BGO A;  1NUK A;  3WF1 A;  5DPN A;  2C26 A;  3SEE A;  3BN6 A;  3K4A A;  3OB8 A;  4P02 B;  3LEI A;  4GWJ A;  4QX1 A;  3CIH A;  2XHN A;  1GU3 A;  3WNP A;  2Y6G A;  5F7U A;  3T0A A;  5G05 L;  2W95 A;  4AAX A;  3HNM A;  4RYD A;  1W9T A;  3GM8 A;  3WF3 A;  2J1A A;  3C7O A;  4UOJ A;  2HLE A;  2ZEW A;  3LPG A;  2J1R A;  4HG6 B;  3MUY 1;  2W46 A;  4BXS V;  3T0D A;  5IFP A;  1I5P A;  3LQC A;  1W0N A;  3CKH A;  4QX0 A;  2E31 A;  2JDA A;  1HN1 A;  5J1X A;  3VD7 A;  1H6Y A;  3WNM A;  3WEZ A;  4IUG A;  1L7R A;  4D0Q A;  1CZV A;  4UI9 L;  1W99 A;  3K75 B;  3UNP A;  1RYY A;  4GZ9 A;  3NQH A;  1XPW A;  2E26 A;  1K42 A;  4XZU G;  3K46 A;  4QB6 A;  3VDA A;  3WF0 A;  1PMH X;  4JKK A;  2W1U A;  1ULP A;  2RVA A;  1J84 A;  1CIY A;  2W1S A;  2Y8K A;  4XUR A;  3E1F 1;  5G04 L;  1XNA A;  4Z2A A;  1UY0 A;  3LEK A;  3UET A;  3LPF A;  4QDS A;  1US2 A;  2J1U A;  3K4Z A;  4JX0 A;  2EIE A;  2ZEY A;  2VMF A;  2VMC A;  4DUX A;  5JXJ A;  1SDD B;  2XON A;  3OG2 A;  3OGS A;  1UY2 A;  2W87 A;  3UES A;  2WZE A;  2VCB A;  5JXG A;  1JYN A;  2JKX A;  1JZ4 A;  3C7E A;  5JXI A;  4KWU A;  3DEC A;  1DP0 A;  2QQJ A;  3CZU A;  4QDQ A;  2V72 A;  4RN5 A;  2VL4 A;  3I3B A;  3MV0 1;  2WO1 A;  5IHR A;  4ET7 A;  5IFT A;  1D7P M;  2EIC A;  3NNG A;  3CZJ A;  2HYX A;  3ABZ A;  4P00 B;  4TXW A;  1OD3 A;  4ZZ5 A;  5JXH A;  4P5Y A;  2V4V A;  2W47 A;  4LQR A;  1JYV A;  1K45 A;  2DDU A;  3A23 A;  1NAE A;  4L0P A;  2WUH A;  5C70 A;  3P6B A;  1OT5 A;  4QX3 A;  3GGL A;  2E33 A;  2WAB A;  3J7H A;  1NKG A;  1K12 A;  2W91 A;  1SHW B;  1DLC A;  1UX7 A;  2BER A;  2RV9 A;  1GOF A;  3HPN A;  2V5D A;  2XOM A;  4CU9 A;  3W5N A;  1CZS A;  2ZEZ A;  4BK4 A;  2QQM A;  2X05 A;  2VZ1 A;  2JD9 A;  4TTG A;  2YFZ A;  4A4A A;  1W9S A;  2VM9 A;  3C7H A;  5C7G A;  4XUO A;  3HOB A;  2ORZ A;  3HEI A;  1CX1 A;  4CVU A;  2EID A;  1JYX A;  3CQO A;  1UXZ A;  2B4K A;  4KMQ A;  2C9K A;  2C4X A;  2VZU A;  1PX3 A;  2J1V A;  2YC4 A;  2VZ3 A;  5FUI A;  2VZP A;  1UY4 A;  1GOH A;  3AC0 A;  3FHA A;  1US3 A;  3CMG A;  1UYZ A;  3P1I A;  2X10 A;  3ACI A;  3WNL A;  4A45 A;  2WAA A;  1TVG A;  4OMC A;  1T2X A;  4MAD A;  2W92 A;  4D8M A;  4BK5 A;  4PQQ A;  2EIB A;  3IDA A;  1JU4 A;  2J7M A;  2B9V A;  2ID4 A;  3I3E A;  2VME A;  2W3J A;  1UY1 A;  4DXS A;  4E8C A;  1GQP A;  5LA1 A;  2J1S A;  1XC6 A;  1JZ5 A;  3FN9 A;  1KEX A;  4YPJ A;  1JZ2 A;  5IJR A;  4ZZ8 A;  5DMY A;  3C7G A;  3I3D A;  4CUC A;  5LCW L;  3SKJ E;  1JU3 A;  3U37 A;  3DYO A;  3I2H A;  2LW8 A;  3T2O A;  4LHS A;  2CDO A;  2VZT A;  4MO3 M;  3WF2 A;  5EIY B;  3GXU A;  1YQ2 A;  4W4Z A;  2X09 A;  5I0D A;  1DYO A;  1UXX X;  2WN2 A;  3A7Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...