1OH4A

Structural and thermodynamic dissection of specific mannan recognition by a carbohydrate-binding module
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
174
structure length
174
Chain Sequence
ARYVLAEEVDFSSPEEVKNWWNSGTWQAEFGSPDIEWNGEVGNGALQLNVKLPGKSDWEEVRVARKFERLSECEILEYDIYIPNVEGLKGRLRPYAVLNPGWVKIGLDMNNANVESAEIITFGGKEYRRFHVRIEFDRTAGVKELHIGVVGDHLRYDGPIFIDNVRLYKRTGGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Thermodynamic Dissection of Specific Mannan Recognition by a Carbohydrate Binding Module, Tmcbm27
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
molecule keywords BETA-MANNOSIDASE
total genus 38
structure length 174
sequence length 174
ec nomenclature
pdb deposition date 2003-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09212 CBM27 Carbohydrate binding module 27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 1oh4A00
1CZVA 4PT6A 1TVGA 1CX1A 2ZEWA 2DCJA 3WNNA 3HEIA 1J83A 2ZEZA 1WCQA 1YQ2A 3LPFA 1LNSA 2W1QA 1P8JA 2W1WA 2Y64A 4A4AA 3WF2A 4D8MA 2EIBA 3C7GA 4A41A 3I2FA 1W8OA 2E32A 2WAAA 3A21A 4QX0A 5J1XA 2W1SA 3UETA 3OGSA 3C7HA 1CZSA 2RJ2A 2EICA 3WSOA 2VZ3A 5JXIA 4A3ZA 1T2XA 1UY4A 5G05L 4TXWA 2HLEA 4A44A 3WNLA 3OGRA 2QQNA 5JR2A 3F2ZA 1NUKA 1JZ8A 1JZ3A 1H6YA 2QQIA 2VZVA 4A45A 1JZ4A 3I2JA 2JDAA 4CU6A 2J1RA 3CQOA 5I0DA 2VJXA 1OF4A 2W95A 2LW8A 2Y6HA 2W92A 5JMOA 3GGLA 4ZZ5A 1UYYA 1IQDC 3D3AA 2Y8KA 1GOFA 2BGPA 2DDUA 3HNYM 4ARYA 2VOTA 3DYMA 5IFPA 2YG0A 5JXJA 2VCBA 2ZXQA 3JXSA 3HJRA 3IAPA 3T08A 1JZ5A 2DCKA 4PF1A 4XUQA 5EJZB 4ARXA 3LEKA 3GDBA 3ACFA 2QBXA 3NJVA 1XNAA 2W3JA 4GWJA 2X10A 2QQKA 3PUIA 2ID4A 1NKGA 2VMEA 1OH4A 1UY2A 3I3EA 4QX1A 3ABZA 4RYDA 3DYOA 3W5NA 1NX9A 3K77A 1JYWA 4JKMA 1GOHA 2B4KA 2E26A 2W94A 4AG4A 4TTGA 3K4DA 3C7OA 4XVHA 4CU7A 4DUXA 3T0BA 1US3A 3WF0A 1UY1A 2BBAA 1SDDB 2C9KA 4L0PA 3SEPA 3UNPA 1I5PA 1GMMA 5A1AA 3C8XA 2QQJA 1XNTA 1L7QA 1ULPA 3K4ZA 4HG6B 2YC4A 1DP0A 3WF1A 3VD7A 2ORZA 3CKHA 1K3IA 5HPOA 5FUIA 4GWIA 4A6OA 4DEQA 1UMHA 1GNYA 3ETPA 4RN5A 4CU8A 4M4PA 4XUOA 4ZZ8A 1UY3A 2VZTA 1OF3A 3VD3A 4MGQA 4AAXA 3HNMA 4QB2A 2VZOA 1UMIA 3NNGA 1EUTA 2VZUA 5C70A 3W5MA 4BK5A 3SKJE 1F4HA 2EIEA 4E8CA 2VMDA 3LEGA 4OMCA 3U37A 3CZUA 3CDZB 2KD7A 3GM8A 2VQUA 4JHZA 2WDBA 5JUVA 1L7RA 1PX4A 3I3BA 4BK4A 3BN6A 2Y6JA 2ZEXA 5IYYA 2VCCA 4QDQA 3VDBA 4KMQA 5LA1A 3C7FA 4CU9A 1JYXA 4CUCA 5DMYA 1D7PM 2QQLA 3T0DA 4DUWA 4M4RA 2L9LA 5LCWL 2VL4A 3ECQA 2W47A 2Y6GA 3BGAA 3I97A 3MUZ1 5LA2A 4QX2A 4UI9L 4KWUA 3T09A 3WNOA 3J7HA 2J1EA 1H6XA 2BZDA 4UOJA 1OT5A 3I2KA 3WNPA 1O8PA 3MO4A 1GU3A 2VQTA 2RVAA 3SKVA 1GQPA 2X05A 3WQBA 1SHWB 2VZSA 1JYNA 2V72A 3K46A 4QB6A 2CDOA 3CMGA 2J1AA 3OEBA 3VD9A 5CZKA 1KGYA 1UX7A 3EB7A 5B4XA 2VC9A 3I2IA 4W8JA 2YC2A 2WBKA 3MV11 2VMCA 1UY0A 3IDAA 4P5YA 4A42A 3T2OA 1SG3A 1JU4A 2WN3A 3CZJA 3A23A 1CIYA 5IJRA 3ACIA 3WF4A 4DXSA 1K45A 4LKSA 4P08A 4CUAA 3MBWA 3K75B 1K12A 3WNKA 1JI6A 3HOBA 3I2HA 3FHQA 1JYVA 4W4ZA 4MOAA 3FHAA 3LQCA 4XZUG 1O59A 3MV01 1UZ0A 1R64A 1UYXA 2XOMA 5DPNA 4OZOA 2E33A 3WNMA 4BDVB 3HN3A 3P1IA 2V4VA 1EUUA 4LQRA 2JE8A 3T2PA 5C71A 1UXZA 4MGSA 3NQHA 3PUHA 4E8DA 2VZPA 5B4NA 1BHGA 4GZ9A 3HNBM 4ZXEA 3DECA 1UYZA 1W8NA 4XURA 1HN1A 3IB3A 5DQ0A 2WAOA 2WO2A 4QPWA 2WO3A 5F7UA 1XC6A 2VZ1A 3VDAA 1KEXA 3A7QA 2J1UA 4LHSA 3OG2A 1RYYA 3A22A 3THDA 1JZ7A 1W0NA 1GOGA 1DLCA 5IHRA 4BJ0A 4YPJA 5EJ1B 3ACGA 2CDPA 2VR4A 4QAWA 4DUVA 4PQQA 2W5FA 1O8SA 1WKYA 2WABA 4OYUA 3ZM8A 2XHNA 2YFUA 2W87A 4MADA 1XPWA 2W91A 4QX3A 2VTFA 2QQOA 5CYYA 5G04L 4DXTA 3OEAA 4IUGA 2BERA 2J22A 3NJXA 4QDRA 2PQSA 2HYXA 2VO5A 2Y6KA 3OB8A 4QB1A 2J1SA 3WF3A 5EIYB 2X09A 4OMDA 4JKKA 3LPGA 2W46A 1OD3A 4XUNA 3T2QA 4BXSV 2VZQA 2WZ8A 3THCA 4QDSA 3LE0A 4XUPA 3FL7A 4XUTA 5JXHA 3P6BA 2WYSA 1GUIA 2Z4FA 3I2GA 5LA0A 2OKXA 3VD5A 3VD4A 4LPLA 3VDCA 3OBAA 3DYPA 3IAQA 2ZEYA 1US2A 3IIIA 1K42A 2J7MA 1J84A 3C7EA 2LS6A 2RV9A 3I3DA 4JKLA 2J1TA 1JZ6A 2WQ8A 1MPXA 3GXUA 5HXMA 5JXGA 2W9XA 1JZ2A 3CIHA 1DYOA 4DXRA 2R7EB 2WO1A 3MUY1 4MO3M 2J1VA 5IFTA 2BGOA 2C4XA 3SEEA 2VCAA 3HPNA 1W9WA 1PMHX 2VMFA 3UESA 4ET7A 2EIDA 1PMJX 3NRUA 2XQXA 3E1F1 4D0QA 4Z2AA 2QQMA 1NAEA 1JHJA 4P00B 3OGVA 2WUHA 2C26A 4KI5M 4CVUA 1UXXX 2JD9A 1W9TA 2B9VA 2E31A 5C7GA 2VZRA 1ULOA 1W9SA 4UAPA 3T0AA 1F4AA 2V5DA 4ZY9A 3LEIA 5DN2A 4P02B 2VM9A 2WN2A 1CZTA 2JKXA 1UWWA 2YFZA 4CUBA 3FN9A 3WEZA 2Y6LA 2XONA 2W1UA 1JU3A 3ACHA 4OUEA 2WZEA 4FI9A 1PX3A 3AC0A 1TG7A 3EYPA 3K4AA 4DEVA 1W99A 4JX0A 4W50A 2ORXA 2YB7A
chains in the Genus database with same CATH superfamily
2QDNA 5KC5A 3NSTA 1DZTA 3IN9A 2CSGA 1RHI2 2D3PA 4I0BA 1NE6A 2DCJA 2ZEWA 3WY6A 3V0BB 3HEIA 5LB6A 1UNBA 2PAEA 5A70A 5CISA 4IQPA 4MUVA 2MEV2 2LALA 4Q4V1 2JJ6A 3W20A 2RDQA 3LPFA 1TMF1 1UZVA 2GNMA 4LIVA 2ET1A 4N53A 2HH9A 4DZGA 3J7MA 3CNAA 5FXXA 2Y64A 1YEWA 3WF2A 4A4AA 4AHWA 5E16A 1DGWA 3C7GA 1PGW2 1IZ3A 1BXHA 2JE9A 4YZ5A 4IDZA 1XBFA 3VBSA 3I2FA 4R9CA 3E6CC 1IS5A 3AKSA 4EWDA 2WAAA 4QX0A 1HB3A 5J1XA 1HXS1 4Q1PA 3VL8A 4ASMB 3FX3A 2MNGA 4D6RA 3VLBB 2FDFA 5FLIA 2W1SA 3UETA 4HK8A 4WZFA 5C8CC 5FMOL 1DQ2A 1PHMA 3BCWA 3J4UH 1HXS3 4GJZA 5L9RA 2R32A 4LITA 4NAOA 4Y1VA 2VZ3A 3WSOA 4XEZA 3IMNA 4QQHA 3TEXA 1SFPA 1HN0A 3RZGA 4X6RB 1N1VA 4IE6A 3GBGA 4A44A 2R6QA 4W6WA 1AJKA 2CAVA 1AJOA 5DAPA 3AFKA 3LDBA 3F2ZA 5FRAA 1RUE1 1RGSA 4DIQA 2KM2A 3VL9A 5CG8A 1H6YA 2QQIA 2VZVA 4PHZA 4C0BA 5SV8A 4CPBA 4BQ2A 2WT0A 5DZEA 4K21A 5FPXA 3OBTA 3B7MA 3J8F1 4XJ9A 2I2SA 3NNFA 4Y5Z0 2XQRA 1S4CA 1GNHA 1XE8A 2JXAA 2LW8A 1NCRA 5T3NA 1R1A2 3TWIA 3D0JA 3WR0A 4D3WA 1J1LA 3D82A 2BNOA 2XVLA 3VBSC 3UJQA 3LCPA 2DCYA 4BOWA 1IGOA 5FPZA 2HWB3 3ZXFA 5ABJB 2PA7A 5IFPA 2ZX2A 4QHZA 5JXJA 4YFZA 4JGZC 3IAPA 3T08A 2CL2A 1W3XA 3JD72 1YWKA 3WG3A 3VZMA 4HMZA 4IEWA 5EJZB 3N9LA 1LKNA 4EN9B 4RHV2 4TYSA 3NJVA 4FOWA 1W6QB 2HWE1 2W3JA 3LA7A 2WZR1 1RUNA 2X10A 5C4WB 3O1TA 4XJ8A 5DG1A 5FYUA 1E5SA 4H7MA 2VW0A 5BNPC 2ID4A 4CDUB 1N1TA 1UY2A 1H8TA 4P9GA 2VOXA 3USSA 4BQ4A 2R0HA 3ACLA 5F2WA 4LBKA 2P1BA 4QPGA 3DYOA 3ZSJA 3W5NA 2DBIA 3BVCA 3HVDA 3VV1A 3SH4A 1NCQC 1BJQA 1RUH1 3CLPA 2E26A 3MLJA 4NPRA 4XQ4A 2WR9A 3C7OA 3VUOA 2MEV1 1LGNA 4XF1A 5AFEA 1VBA3 1VB4A 3T0BA 3VHPA 4AEDB 1IHMA 1GFF2 1YFWA 4Y4YA 4W6XA 2YGLA 4YZ1A 5FYVA 1UIJA 2C9KA 3UNPA 1SPPB 5L9BA 1I5PA 5A1AA 2EXKA 2QQJA 4WV8A 2LUWA 2RE9A 4PLNA 1ULPA 4ZU5A 3V56A 3I3QA 2YC4A 4E4DX 1C57A 1RVF3 3FLRA 3NV4A 5BXXA 2ORZA 3VD7A 5FQ0A 5FZIA 1S0FA 2F4LA 3OOXA 1FPN2 2A5ZA 5F3GA 2XDVA 5ISLA 1TME1 5FP7A 3DEMA 2O8OA 5J98B 2D6LX 4CP0A 4XJZA 2DCZA 4RN5A 2BOJA 4N9HA 2NZ9A 4M4PA 4XUOA 1C3HA 2YGMA 3T30A 2RS31 3BPZA 1ZRIA 4M3CF 5FZ4A 1OLME 3VD3A 4AFBA 1V9U2 2A6VA 3AJYA 4NHXA 3KF5A 2BRTA 3HNMA 3POSA 1R081 1H1IA 4CEYA 2FDKA 1ND2B 3EJKA 3KT4A 5C9AC 3RYRA 1XQNA 5GKAC 5JSRA 1AYM1 1CAUB 1UZWA 1A8DA 1ZBA3 3PUQA 4I0AA 2K9ZA 3VKFC 4PDWB 5C70A 5A7OA 4BK5A 5IK8A 1FMD1 3KCCA 3D6EA 2GP5A 4FOYA 1DCSA 3BIEA 3KHCA 2YHJA 4LEJA 4OVEA 1AXYA 2A73B 2VMDA 4L11A 1LOEA 1YUDA 4JCKA 5FZMA 1OOPC 2KA3A 4LLFA 5C3PA 2IUWA 1DQ0A 3U37A 3CZUA 1N3OA 2X5IC 3O1OA 1QJX1 4WM8A 2GSYA 1E5RA 3ORJA 1V9U3 4GMP0 2WDBA 4M0NA 5DAWA 3WG4A 5FYCA 1TEIA 4RR3A 3N4MA 5FXVA 3CO2A 2WS91 3NNLA 4KG0A 2GC2A 1GKBA 3MDPA 3ZSEA 3I3BA 1C8M2 1VR3A 2ZHKA 2XJRA 1PO21 4BK4A 1NCQB 3VZOA 2WNEA 3ZO0B 1NA1A 1D0HA 1K5MC 3DF0A 1PNFA 1LGBA 4JGYC 4OFGA 4QDQA 1LRHA 4KMQA 4I09A 4YGDA 4FTEA 5I8SA 3BPSA 1SEFA 2ARCA 2PHWA 3M7AA 2ARAA 4OI1A 1MS3A 4XFFA 5T54A 1LTEA 4E4SA 2QQLA 4M4RA 4Y33A 4ITCA 3RS6A 2A6ZA 1MS8A 2VL4A 2AEZA 5C4WA 3Q8EA 3O14A 4AR2A 4NJ4A 2D43A 2VH9A 3H7YA 2JG8B 1MACA 5F3EA 5IAVA 3ZOIA 1FOD2 2G9ZA 1YIPA 1WD3A 4I02A 2JD4A 1ZZ9A 4Q8KA 1T6BX 2DVAA 4QGNA 5A3OA 3O12A 2VXRA 4UI9L 2NM1A 2HYKA 3SITA 1IKPA 4NAMA 1UO9A 3J7HA 1O7FA 2WWUA 4HK9A 1ENRA 3OSDA 5BNQA 2QKDA 2ZX1A 2AH2A 3CU7A 3UV9A 1ND2A 2JKBA 2LRPA 4IEVA 4L99A 4NROA 1CAWB 3RPQA 2R063 1N1SA 3B00A 1D4M2 1JODA 5A3MA 3MW2A 1UU6A 3MIGA 1DLLA 3PUAA 4YFWA 2RVAA 3ZFFB 3SKVA 1OFSA 2OQ6A 1ZRFA 2VZSA 1W90A 4CDQB 3I54A 1Z7S3 3VDDC 1H2KA 1ULEA 2RS32 4QB6A 2CDOA 1BK0A 1XOYA 4AGVA 2IZWA 1ULFA 2O8QA 1U5ZA 5BNNB 2BVBA 2A7AA 4EZHA 5A3TA 4R4ZA 1JS9A 1VMFA 1W04A 3MF6A 1HRV2 3GHMA 4F7ZA 1REFA 5B4XA 1OD5A 3I2IA 4IGQA 1AX2A 2EXHA 4MV2A 1HXS2 4JGZB 4YVSB 2VMCA 2BGCA 2BNNA 2CYFA 2WNOA 4OHXA 1NT0A 1JYIA 5GLWA 4BZ4A 1AHSA 1ZBE1 2VQ0A 4B8EA 5D8AC 5ABJC 1JU4A 1SPPA 2A70A 2WN3A 4C8DA 1QQP3 4Q0VA 4K8RB 4DXSA 5IJRA 3ACIA 3WF4A 4PI0A 1LOAA 3RZKA 3LOBA 4Q4Y1 4UT5A 2H6CA 4ISRA 3VDDB 1DBNA 2VMHA 3D8CA 4LKSA 4NOTA 3K75B 4NIHA 5JCTA 1CN1A 1JI6A 2ENRA 4RD7A 1G7YA 1C5IA 3N9NA 3JUUA 4PI2A 4P14A 5GALA 5C3RA 3FHQA 1JYVA 3QH7A 3RWKX 1VLNA 1RUC1 2ZX4A 1IPJA 1POV1 1GZCA 5KHGA 2P6CA 4DY5A 4P9WA 1NCQA 1AX0A 3ENRA 3WCSA 2Y26A 4Y1YA 3PVNA 3DGTA 1UU4A 2E33A 1VRH2 5FZBA 1AXZA 4C0HA 1F5JA 1LOGA 4QT6A 1OA2A 1AYN3 3SCHA 2WZR2 2ZGOA 4P9YA 1A8MA 4DQAA 4IV1A 3NQHA 4E8DA 2VZPA 4LKDA 2DU0A 5FY7A 1BEV1 1UYZA 1FV3A 1W8NA 3AK0A 4LXLA 2QE3A 4XURA 5AVPA 3RJ2X 4NIGA 2BWCA 4D7SA 1PVC1 1K5MA 4R9AA 3O1PA 1W6OA 2VBPA 5AC92 2XBO1 2RR13 1MEC3 2WNVA 1X82A 4JDOA 2OUHA 3VDAA 1KEXA 1UL9A 4LHSA 3OPZA 2RS12 2X8KA 2A1XA 2ZOEB 3O1UA 1FYUA 2SBAA 2UYBA 3H3LA 5F8PA 2GU9A 1XNDA 4N7IA 3THDA 1DQ1A 3IZOA 5FZ1A 2FHRA 1YLLA 5FZOB 3ON7A 5EJ1B 4YW5A 2K2SA 4FSJA 5LW9A 2ZHNA 2HEYF 4FVVA 4AGGA 4R9DA 1D2QA 1Q3EA 1WMEA 1UZYA 4K40A 3UL2A 1DGRN 1OH3A 1XSRA 3K51A 3O7OA 3WP4A 3WVJA 4RGGA 2XUMA 4N8MA 1AR62 2FDJA 1O8SA 1VALA 1WKYA 1FPN3 2IVIB 4URTA 4OYUA 4WM7B 2XHNA 5A7NA 4AW7A 4A7ZA 2WT2A 2W87A 2OXBA 3H0OA 1XPWA 2W91A 2R1DA 2WKKA 3ZFGC 1EV13 4KWJA 2Q1MA 1CGPA 2CGPA 2DFCA 2DVGA 4AVSA 3JBG3 1OSGA 5GLTA 3Q8BA 3OEAA 3WT3A 4M00A 2BERA 4RS5A 5JI9A 3MGUA 1CAWA 2PQSA 3URFA 3OB8A 3WP3A 4BQ1A 1B35C 2Q4SA 2VU9A 2WZR3 3AFGA 4QB1A 4S2HA 5GZEA 4P9XA 5EIYB 1WW6A 4OMDA 4QU1A 4AGRA 3B9CA 3TBDA 1OMIA 4UFKA 1QWRA 1JUIA 3IM0A 5FKCA 3SNMA 1GANA 4CCOA 1COV1 4QDSA 5GZCA 2LROA 5D8AA 3DUIA 4BWOA 2A3XA 3FL7A 4XUTA 1PVC2 4Q1RA 4QKNA 4BPZA 1VRH1 2ZGSA 1YFYA 4AL9A 1E5HA 2WWSA 1VBD2 3AKTA 5CKMA 4NWVA 1RUC3 2B42B 1UW8A 5A32A 3S5AA 1JH5A 5DDJ2 3LZZA 3B02A 3GJBA 3J8F3 2K0GA 3M3EA 1GSLA 2YROA 4W6YA 3JQXA 2GH2A 4XCBA 2RMU3 2G9FA 2UYAA 4Y1UA 1RB8G 2WFF2 3H8XA 2J7MA 5FZ7A 3KS7A 5K0UA 4Q4Y2 4XFGA 4KBBA 4MZUA 1YIFA 1KJRA 4AEKA 2WLQA 4RS5B 3LEMA 2VOKA 3TEZA 1UF2C 1PO23 2A3YA 5FPVA 1GQGA 4JKLA 4YG3A 1UPIA 4I3PA 4UWDA 4LJHA 3POYA 2R073 4LO6B 5A33A 5LATA 1S0EA 5IK5A 4BMEA 3O5SA 1DYOA 4LK6A 2IFRA 5F39A 5EQUA 4PIZA 4Y24A 1JOJA 1V9U1 2WO1A 2C24A 4WM7A 5FBJA 3RYKA 3ZKYA 4MO3M 1HB4A 2ERFA 2Y60A 2ZGUA 3AZZA 3I59A 4HVOA 2WINB 1COV3 2VCAA 1GYKA 2Q1ZB 3HPNA 4J6GA 3AP5A 4ONUA 5ANQA 4FXKB 3LA2A 4EN7B 1VAKA 3UKVA 1GR3A 4FO9A 2RR12 1DQ6A 1HDKA 3JCIA 4XF3A 4CEYB 3U78A 2EIDA 3KHBA 3WHTA 1UKRA 1FT9A 5APAA 5FZ8A 4X8PA 4D0QA 2TUNA 4IEXA 1UCXA 3AYAA 3KGLA 4FFIA 1YHFA 4QHBA 4XTPA 4P00B 1VBC1 3WW4A 2WUHA 1UXXX 1WMXA 4YSFA 2B9VA 4TLGA 2E31A 5FBZA 4EN0A 5C6CA 1FNZA 1YI9A 1BKZA 2JDZA 4UAPA 2A71A 5FO7B 4UFMA 3UT0A 3SMHA 4IGPA 4QX5A 2V09A 4BA6A 4E4ZA 5ACA2 4XPVA 1IPKA 4J25A 3MFCA 3PU8A 1EV11 2P3JA 4P02B 3SCFA 2VM9A 4QXBA 5FMCA 4CYDA 2JKXA 2P4EA 1ZZCA 2BVVA 4MXVA 4MXWA 3WP5A 3FN9A 4HVQA 2H0BA 4KG8A 3PDQA 2Q0AA 3ACHA 2B5HA 4OUEA 2CTVA 4IE5A 4PF5A 3I8TA 4UW5A 5T5JA 5JIUA 2CWMA 3WOGA 5C9AB 4N90A 1W2TA 1PX3A 1O3SA 2PHFA 2BDRA 4ZHNA 2PYTA 5I0UA 4BM8A 3K4AA 4DMIA 4QX7A 1FOD1 2TNFA 4ZKTB 4IXLA 5CADA 4FFHA 2IXIA 1COV2 5T5PA 3L2YA 3QBQA 3POIA 1CWPA 1J83A 4L97A 5DAXA 1H2MA 4GMP3 1DQ4A 3O1RA 1CZVA 2JDUA 1QH6A 3OYWB 4PT6A 1CX1A 4XJWA 5JMCA 1EAH1 3T1LA 4LO7A 1MS9A 5C3SA 1V6LA 1DFQA 1D4M3 2FBEA 2R0FA 2JENA 2WS92 5J36A 1BVP1 2W39A 5IUQA 2QNKA 2ZKNA 2IXLA 2XBO3 4B7KA 1LCLA 2EIBA 4B4PA 4D8MA 1CJDA 4P9IA 5A3WA 4JAAA 3APBA 4KGGA 4INDA 5FZ3A 1NE4A 2Y38A 4K8FA 1HQNA 3RRDA 1W6PB 1W3VA 1WMDA 4YVSA 3KQ4B 4COYA 5A1LA 5FOJB 1IG3A 5FZDA 3OGSA 3C7HA 1CZSA 2DVBA 2RJ2A 1AYN1 4N43A 5FMOS 2EICA 3AMPA 4D94A 5LEJA 2A6WA 3OUHA 1JMUB 1V6JA 4IW3A 4RQPA 4EWAA 4TXWA 2HLEA 5KHIA 3WV6A 3WNLA 5GJ6A 4NR1A 4DS0A 2XBO2 3MICA 3U11A 2DTYA 4LR4A 3LA3A 2WL1A 3VBRB 1JZ4A 1NZIA 5FMDA 1PNGA 1NQDA 1RTVA 2J1RA 2VCMA 3AP6A 3BOPA 4HANA 2EIGA 1KRIA 2W68A 2ZAAA 1V0AA 2B8MA 1BLZA 2W95A 1C8M3 4UFJA 4GKXA 4ZZ5A 5GZDA 5FUPA 5J09A 2W0XA 2BGPA 3N7MA 4ARYA 4AEMA 1BZWA 4DFSA 1ZREA 3N35A 2Q30A 4EYUA 1DF0A 4IV3A 4MGKE 5JOXA 1W6PA 1LEMA 1RXGA 1F31A 3JXSA 1OOPA 1JZ5A 1BEV2 5FY5A 2JEMA 1QOOA 4PF1A 1QOSA 3L2HA 4PCRA 4XUQA 3LEKA 3ACFA 1QGLA 3BB6A 4EV0A 2QBXA 2JG9B 3VBUB 3VBSB 1BBT1 5EP9A 3ZFGA 2R043 3P3PA 3ZFGB 2VUJA 4X6QB 5LK5A 3PUIA 2VMEA 3AKRA 4LE3A 3M3OA 4I0WB 4LO8A 4KQ7A 3VBOC 1RUF3 3I3EA 1TE1B 1W8TA 2PAKA 3ABZA 3JB4C 4LBQA 5FPLA 3GZUC 3KM5A 4AQ2A 4JKMA 1B35B 5KWRA 1WA4A 3K4DA 2JE7A 4XVHA 3CBNA 5CEHA 1RJ8A 1US3A 2GP3A 1CQ9A 3AL6A 3WF0A 4LIUA 4P9LA 2QQWA 4O7XA 3KB5A 4L0PA 1Y4WA 3JU9A 1POQA 4GH4B 1GMMA 1VIWB 4RHV1 1KS5A 4WM8B 3C8XA 4ZU4A 4FOVA 5T5OA 4AZZA 1XNTA 3U10A 3N7JA 3K4ZA 3N36A 1ODMA 3WF1A 1V6IA 4BYYA 3NAPC 5LASA 4XXAA 4YGBA 1XJAA 4ZONA 1W9FA 2AYHA 4GWIA 2XLFA 1WCUA 4A6OA 1W6NA 4CRQA 2R071 1GNYA 4CCNA 3MW3A 4QHOA 3ETPA 4CU8A 4ZZ8A 1RMU1 5FYMA 1UD1A 1UY3A 4QQ2A 2YBKA 1CAXB 4TSVA 1AYN2 4YVSC 5FZOA 1OURA 1C8NA 3EXUA 3RVHA 5FZCA 5IK7A 4AAXA 1QXPA 1YC61 2JDPA 2D3SA 5FWEA 1CPNA 2BOIA 2F4PA 3A0KA 5KXEA 1UMIA 4J1XA 3WDUA 1W6MB 1W03A 3NNGA 1EUTA 3FJSA 3FFQA 2GC3A 5BNPA 3FBMA 3PTYA 2Q8CA 2K46A 4BE3A 1TQ5A 4Q8LA 4B4QA 4XIOA 1LENA 5FXZA 2C1FA 4YVWC 3LKJA 2EIEA 3LFIA 4NWWA 1VRH3 2CNAA 5C8WA 1OVPA 3H7JA 5HCFA 1MEC1 5KXCA 4CEWC 1QJU2 1U5YA 2EALA 5I93A 1AVBA 2PQQA 2ARXA 3N9QA 4ZU7A 2KD7A 2C5DA 3GM8A 4CPBD 3VBFC 1SACA 5F1RA 5JUVA 1BEV3 5H9RA 4EWEA 1AYM3 3VBOB 5JZGC 1SBDA 2OX0A 3CJIB 1L7RA 2F6BA 2NPIA 1PX4A 2EVXA 5FUNA 1H4HA 4F8AA 2XJPA 3BALA 2YU1A 2ZJCA 3C3VA 2ZMNA 1CONA 4YW6A 4BIFA 1RUI1 2ZEXA 5FFOC 5IYYA 2VCCA 3RZHA 1WBLA 4TLFA 2R30A 4JRLA 1O3RA 2RS33 1OA3A 3Q8FA 2ZGRA 5JLVA 3K2OA 1AF9A 3AMNA 4CDWB 1HB2A 3P3NA 4DUWA 4CCMA 3LB9A 5LCWL 2VULA 5D8AB 2WLPA 2VXJA 1AR71 1AR61 2VW2A 2W47A 3I97A 4RS5C 2WNUB 3QH6A 3OD4A 1N1YA 2F17A 2XVGA 5FPUA 2V5YA 5LZ6A 1W28A 1GZWB 1Y9GA 1QQP1 4XZPA 1FOD3 2P37A 4ASLA 4D69A 5BNNA 4UF0A 3FFZA 5J96B 5CB7A 2J1EA 2XH6A 4Y20A 4LKFA 3VZJA 1SMVA 1YXWA 5CFDB 2RM22 1NCRB 1O8PA 3MO4A 4NO4A 4UYBA 2D6PA 3B3QE 3VHRA 1GU3A 2OS2A 4WZCA 1VBD3 1G6NA 1NQJA 1QKQA 3ZYRA 5HBAA 2WFPA 4ZS2A 4AFDA 3ZDSA 2QCSB 4GA9A 2E9QA 5DG2A 1OVSA 1LOFC 4K7JA 2VMGA 1XYPA 2BFUL 4LBOA 3K46A 1WCKA 3UYJA 4AI9A 2RHPA 3ALQA 2Z2SB 2J1AA 3OEBA 2PHDA 5FR3A 1MR5A 1UX7A 5IVVA 2UWCA 1VAMA 5IK4A 3I59B 3NJZA 4LTAA 4LOSA 3AP9A 2J42A 2KR2A 4MHUA 2VC9A 4NHYA 2DTWA 2P3IA 4BLJA 1Y43B 2WBKA 3UGFA 1DGLA 4U2AA 3JQWA 4N53C 5FTTC 5JDBA 1SG3A 2ZGMA 4RGAA 5FY9A 1LHVA 1TME2 3CZJA 4H55A 2Z5WA 4XFBA 2DUQA 3A23A 3SH3A 3H3ZA 4B29A 3H8RA 3OUJA 4CE8A 3GCXA 1WLDA 4P08A 4WVZA 3MBWA 5I0SA 1RC6A 3ASIA 3WNKA 2JWPA 3V0AA 4PIXA 2HWF3 5FO8B 3HOBA 4FFFA 5ACA3 1KFUL 2CGOA 1K5MB 2ZGPA 2VVFA 5JWPA 4W4ZA 2EXIA 4MOAA 2VD7A 4HBNA 4CCDA 4M3CA 2RM23 1LOBA 1C1LA 3MV01 4XZUG 2AENA 1GLHA 1UZ0A 5DDJ1 1FNYA 3INAA 2E63A 5A7QA 2XJSA 3HT2A 3V65A 3DL3A 1QJU1 5L36A 3SC7X 4FPEA 4OZOA 4AK3A 3ELNA 1Q8QA 3GZEA 4QXKA 3WNMA 5FOBB 2VOVA 3DXTA 4XETA 5FREA 3HN3A 3P1IA 1J1TA 2V4VA 3AYEA 3VKNA 1AL21 2GC0A 4JQRA 4LQRA 3T2PA 2D7FA 2RMU1 3J7NA 4MGSA 3A4UA 4ZXEA 2WQZC 3DECA 1JBCA 1HN1A 1MEC2 2TEPA 3IB3A 4LHNA 4AI1A 1O4ZA 2JB8A 2XMLA 5T50A 1ENXA 4IV3B 2WO2A 1Z7S1 2WO3A 5F7UA 3NWKA 2V4AA 3H1MA 1V6KA 4YNIA 3AVRA 4R52A 1XC6A 3FHIB 2VZ1A 1EYBA 1PIV3 2VPVA 3IBMA 2ZAHA 3BTZA 1QJY2 1X9TA 3CJIA 3U0ZA 2WA3A 4A2UA 4XAAA 2HWC2 2VQAA 2LTNA 1KDKA 5KR7A 2QJVA 1MVQA 5D21A 2JDNA 1W8WA 4A7YA 5EYYA 4YPJA 2DUOA 5FP3A 5L7OA 2MPFA 1HRI1 4QXHA 2CDPA 3UKTA 4JDMA 4MVTA 4QAWA 2OPWA 2XKPA 3D5OA 2VVDA 4JHTA 3ZFEC 1UN1A 2LM3A 2V73A 4C1WA 1PVXA 4Y20B 3PJYA 2W08A 4P9JA 2DWRA 2WNVB 4YG6A 3S6PA 4CCJA 1YRZA 5KC6A 5FQ0B 3BUCA 2IXHA 3ZPYA 1FAYA 4YLZA 1WZXA 2FMDA 1YJLA 2YFUA 5FZLA 3LOIA 4MADA 3KZ4C 1R1ZA 4DXZA 5CYYA 5FZ9A 5HXVA 4S2DA 1PIV1 4DXTA 5LY1A 3H1WA 3ZN6A 1IKQA 1MZEA 2OQ7A 5IAXA 5I8TA 4AI0A 5BNOC 3NJXA 4QDRA 1STMA 3H42B 2PMWB 2H6BA 4FPHA 2JDKA 2Y6KA 3WDXA 4Q5OA 1H2LA 1GWLA 4Y22B 4Z82A 1ZZ6A 3RI8A 5JI7A 3LFMA 4LBQB 4COWA 2JG8C 2IFWA 3Q9OA 4QQOA 1ASJ3 1PM7A 3FC0A 1OD3A 1W6OB 2XLGA 2ARBA 5FYTA 1QJY3 2VG9A 2YPDA 1F15A 4KWKA 2HWB2 3AP4A 3K48A 5DUUA 2VVEA 4GKYA 4GB31 3TB0A 3JBG2 2WZ8A 3GALA 3THCA 2JX9A 2YUEA 1ND3B 1EV12 5JXHA 5A7WA 2AR6A 4XDQA 1G9DA 2B46X 1OHFA 2R062 2D44A 4LE4A 1VRBA 2CY6A 3GBWA 4IEUA 4HKOA 4WBBA 4HPKA 2Z4FA 2WT1A 3J9SA 4CCCA 1AR63 4AEJA 5LBFA 3WHUA 3VD4A 4LPLA 4UBHA 3VZLA 3WLUA 4QPYA 4AI8A 4JQTA 3AYCA 3DKQA 5JR7B 4YRDA 3IAQA 3O0WA 4NUBA 5AVAA 3WG2A 3POJA 4KH9A 4BB3A 4UBGA 5EJ3A 3USUB 2ZMLA 1HJGA 4XOGA 1YYNA 3FMGA 3RI9A 1X9PA 2HJIA 2ZTNA 5FYZA 1HLCA 5JIAA 4CA9A 2Y0IA 1KDMA 3GYDA 3NMBA 2LS6A 4HN1A 1OC1A 3BTXA 1OLQA 4NPMA 1U0AA 1RUI3 2HBUA 5EXOA 1QJZA 1KD7A 5HXMA 4URAA 4LOTA 1F8VA 1S0CA 3RG0A 4AFCA 1Q43A 3WQ7A 5AC93 1Q8OA 2B9UA 2NLRA 2PHTA 1AUYA 2J1VA 1F9KA 5IVCA 1V6NA 1L3JA 2OW4A 4YM3A 1FXZA 1RUJ2 4FXGB 1URXA 2AUYA 1W9WA 1WMFA 5EYXA 1ZBE3 5FZAA 1QJY1 1ZVFA 2P6HA 3OBRA 4XILA 1ASJ1 3NRUA 1EAH3 1PMJX 4OLLA 4QPIC 1QF3A 4XDPA 3E1F1 4FBFA 3O0VA 2MEV3 1NAEA 2VUDA 2WIIB 4YM0A 3H3UA 1W2NA 2GC1A 4NPLA 4N53B 4HN0A 2OIIA 2JD9A 1W9TA 2VNOA 4B1MA 1G9CA 5C3QA 2HKXA 2BU9A 3TEYA 2V5DA 4ZY9A 1WLWA 3ZMOA 3POWA 2ZGTA 3ATGA 1H9WA 4GH4C 5DN2A 5C8CA 1EAH2 4CCLA 4PDWC 2KXLA 5JSOA 1G9FA 4GWNA 1WW7A 3EMRA 1UWWA 1Y9QA 4CUBA 1MQTB 2Y6LA 2XONA 4PIYA 3WDVA 4BIOA 5F5QA 1GZWA 3JD71 3BKZA 1YQ8A 2IWGB 2WNUA 1FV2A 4O61A 5FZKA 3VZNA 3KT1A 1QU0A 5F2SA 1TG7A 3KVAA 4ATFA 1RINA 3FZ3A 2NP0A 3FUOA 4AI3A 4UFIA 4DEVA 1W99A 2MHFA 2GMEA 1LEDA 3NKGA 1IPSA 1ST8A 2ORXA 3LWCA 4CEWA 1GP6A 3KD4A 2RJKA 3J26N 3WNNA 4YZ2A 4OHYA 2XJVA 1LR5A 2RDRA 2ZEZA 1WCQA 3I2DA 3PJQA 4AVTA 4P5HA 1CAUA 2W1QA 3IMMA 1C5HA 4O9EA 3RWNA 2W1WA 3DXUA 1DQ5A 4UW4A 2NMOA 1XNCA 5IVYA 2OUJA 4A41A 5DAVA 3ZXGA 4Q4W1 2O0OA 3VBRA 4QKFA 1QXJA 1SCRA 3AKQA 1UU5A 3MEPA 5I0TA 5FK8A 4GQ7A 3A21A 1MQTA 3O1SA 3AL5A 2FCVA 3OF1A 4AQ6A 3RNSA 3FLTA 1AL23 4XIKA 4CCEA 3NV3A 4UW3A 5CFDA 1F2NA 2DURA 2FCTA 3WCRA 3AKPA 3AJZA 1QJU3 4A3ZA 1Q8VA 3KWVA 1T2XA 4UF0B 1W9YA 4XW3A 4DOUA 4LNVA 1O4TA 1TNFA 5G05L 1LJ7A 2RM21 1V6OA 3TN91 3OGRA 3L9JT 1F5FA 4FT8A 1HRV1 5AC91 1JZ3A 1LU1A 3I2JA 3N7KA 1AL0G 5J7MA 5K0UC 3MIDA 4Y26A 1A6CA 3VKOA 2JDYA 1HKDA 2FDHA 4FAHA 2A75A 2R16A 4D7TA 1S0BA 2C0ZA 4Q4X2 1OF4A 2ADEA 1E5IA 1I9RA 2W92A 2XPJA 4GULA 4AYUA 4J1WA 1UYYA 1NY71 3D3AA 4LUMA 1LOCA 1OBNA 1IQAA 1S0JA 5CA6A 4BQYA 5K9YA 2ZACA 2DVDA 4QGLA 4OULA 2YG0A 5BV6A 3W21A 4RHV3 1L7LA 2VCBA 2ZXQA 2NQYA 5FP9A 1H8TB 4PBOA 3WD5A 2DCKA 1UOJA 3ETQA 2UWBA 1OXCA 4RFT0 4ARXA 5FPAA 4JGYB 5F6KA 1T6GC 1XNAA 4OI2A 3ZDVA 2HWD3 2A6YA 4CDXC 3WUCA 1J3QA 2WFF1 3M3IA 1AZDA 5LBCA 3VHOA 1NKGA 1Q56A 1RUF1 2JIGA 3JBG1 1OFNA 4NRQA 2YV8A 4QX1A 3SXWA 3KV4A 4OI0A 2RS13 4I3GA 3WDTA 3K77A 1JYWA 3JB8A 1KXGA 3QCWA 2B4KA 5FZ0A 3VGIA 2W94A 2D97A 4XJAA 5IVFA 4CU7A 4FQ4A 4RFRB 3WW1A 4KU8A 4M0HA 1GZTA 2Y34A 2DF7A 1LGCA 1VBA1 1W6MA 2BBAA 2E51A 2OA2A 3KMHA 3PIGA 4CZSA 2EAKA 4OUSA 2JG9A 2ZGLA 4HXCA 4O9GA 1ULGA 1J58A 3SEPA 3WP6A 2JECA 1LECA 1S1AA 3FUQA 1VBE2 1L7QA 1CPMA 5FK7A 3J8F2 4GAZA 1S2BA 4K6BA 4K1ZA 4RQPC 2DFBA 3RMYA 4BQ5A 5CFCB 1DP0A 2FDIA 4ISQA 2ZZJA 1G8WA 2ZBJA 3HR9A 3NAPA 1C8M1 2OT7A 1K3IA 2JICA 5LRSA 1JW6A 4YZ4A 4Z1VA 1R1A1 3ZXLA 4DEQA 5FZGA 5IWFA 1JTZX 1VPHA 3DKWA 1QIQA 5L7OC 4IESA 2X53S 2HWC1 4FP3A 5E8AA 3ZR5A 2D6KA 2VZTA 1NOVA 4D6QA 4YARA 1OF3A 5A6ZA 3POFA 2BYVE 4R4XA 1RUE2 2VAUA 3VZKA 4CDXB 3HQXA 4XMAA 3VBRC 4JRAA 3ZFFA 5F6LB 1GNZA 2VZOA 5FY1A 2OYZA 2XGXA 5BPXA 4XFAA 1O5UA 2XJTA 3RYPA 1AR93 4DINB 1HB1A 2Q8EA 2YPJA 2GZWA 3AB0A 4NIDA 1MZ6A 2CGNA 4XACA 4IL7A 3T2TA 3S30A 4HFSA 4N43B 5FMBA 1AL22 1HRV3 1F4HA 4IE0A 5LRRA 4BCUA 4V1PA 2VOWA 3LDRA 4I01A 4CCKA 1RMU2 5GM0A 3IWZA 4HPKB 4AHYA 2RS53 5A7WB 1HJFA 2VQUA 5F9TA 2Q8OA 2R072 2W52A 3LDKA 3QLQA 2Y33A 2QDRA 3UJOA 4AVBA 5KHJA 5FZFA 1OKOA 4FPYA 1C4RA 4XQWA 1PO11 2BBVA 4A6SA 3GJAA 2Y6JA 5GZFA 1ULDA 1BBT2 4LO5B 3DPRB 1ACCA 4FPOB 3PUSA 2PHUA 3C7FA 3HT1A 4QPIB 1JYXA 2XL7A 2Q1FA 5DMYA 1YQ5A 3UGGA 3T0DA 3GNEA 5ACA1 1LHWA 3KV6A 4XE9A 1CAVB 2L9LA 1FMD2 4H7LA 3ECQA 1NG0A 5F3IA 3UKNA 4IV3C 5C9AA 4CSWA 1NY72 3B9IA 5I0RA 5SV5A 1GICA 4FPLA 1RUC2 4K20A 4AXOA 1RL3A 2TBVA 2Y6GA 5BNOA 2ZKLA 2EXJA 1HX6A 4QPIA 3VHNA 2D6NA 3Q8CA 2OPKA 3ILRA 1MQTC 4DRVA 2I45A 4I2OA 3SCGA 3MHZA 4KWUA 4WM8C 5IVBA 4FOQA 3WNOA 1C1FA 4IEPA 4CP1A 3QD6A 5DZGA 1H6XA 1RIRA 2P3YA 3T3YA 3GCWA 4UOJA 5DUXA 1OT5A 3I2KA 4XFCA 1DU3D 3NL1A 1V70A 1ONAA 3R4UA 4K3UA 1IS3A 4RGKA 3KT7A 3THTA 3ZIXA 4C1XA 3BU7A 1ZBE2 1H1MA 2VQTA 2YZ4A 4HETA 2YYOA 3ILNA 5FP4A 4E2QA 4LT5A 3WQBA 1W2OA 1PK6B 1SHWB 3IT8A 3MYXA 2V72A 4OHVA 4E9KA 2B7YA 3I49A 1DDLA 4FTSA 2Y0OA 1QNWA 5IVJA 5L9VA 1X8MA 1QQP2 3CMGA 1RHI3 3R4DB 1CJPA 3VD9A 1NLRA 1KGYA 4GXLA 1DZQA 2R1BA 4Q4W2 3VBFA 4AWDA 1GWMA 3I3MA 1O6UA 4KU7A 2ZS6B 2YC2A 1Q8PA 3H50A 1KITA 2Q5TA 2QQVA 1W8ZA 4CDQA 5CFCA 2PELA 4FTBA 5E89A 4P5YA 3T2OA 4JTNA 2P2KA 1JOPA 1ZA4A 4G4FA 1YFXA 3RZJA 1Q8SA 2AEYA 5FKBA 3MW4A 3AVSA 1O91A 1X50A 1UIKA 3KQRA 1CIYA 4XF4A 3MFAA 1K45A 1PO13 4CP9B 1S55A 4CUAA 1AR73 1RUG2 4PQ9A 3W9AA 1PO22 2G4IA 5K0UB 2ZABA 2HEWF 2PLV1 3N9MA 4META 1YJKA 1B35A 1PGW1 3ZN5A 3FHAA 4BQXA 3LQCA 3TYJA 3EO6A 1I3HA 3MPBA 2FZ1A 2D40A 5F32A 2D6OX 3ZXJA 4B4RA 1PZ7A 1R64A 1IG0A 1FI2A 1W0OA 3OBZA 5DPNA 2ATFA 4CDUA 4PLMA 3PMEA 3ES1A 4HONA 1FMD3 5BYNA 2ZHMA 5JPMB 1PGL1 4OUMA 4BDVB 4MGIE 2PHXA 3ZXEA 4HT1T 1ZBA1 1JYTA 1SLTA 1UQXA 1NYWA 1RUD2 1Z0HA 2RS52 2VNGA 1ZRCA 3LSEA 2RMU2 3PL0A 3PUHA 1OPOA 1ZM1A 3CL1A 1RUF2 3HNBM 3I4IA 4GZ9A 3BYWA 3AZVA 5FXWA 4WVWA 1D0GA 3AP7A 4XMIA 5DQ0A 5ABJA 1LB2A 4XBLA 4QPWA 3ZSKA 3WQ0A 3E6DA 5KHKA 4CXXA 5GLUA 3A7QA 4K9SA 3MIBA 4G9SB 1R092 3AZWA 5JZGA 1RYYA 4COVA 1JZ7A 4C91A 3DPRC 5F37A 1GOGA 1WUVA 3NO8A 3I7DA 3ZYPA 3P5BA 4GMP1 3V64A 5A6QA 3ZYHA 5JOZA 3OGJA 4XFHA 4HVRA 4OQ8A 1JN2P 3WW3A 5FO9B 3ACGA 1OQEA 4PJYA 1DGWX 2GH8A 2VBDA 2VR4A 4Q4X1 3TN92 1EY2A 4AHXA 5EWSA 5JZGB 4DUVA 1XYNA 5DZFA 4Y4RA 2P34A 2W5FA 1JOBA 2VE1A 1SZBA 4AOCA 5HV0A 2CV6A 2BEOA 3KF3A 3ZFEB 3ZM8A 1TMF2 2AACA 2FQPA 4EN8B 4LBNA 4F3JA 2D6MA 5BNOB 5FWJA 3TAYA 4B3NA 5FV3A 2YBSA 4TZDA 4HSJA 2VTFA 3ZMNA 2BP6A 2QQOA 1SLAA 2N7GA 1RHI1 1AR81 1IOAA 5H9PA 1U5XA 1CAXA 2GNBA 4CDWA 3ZVXA 4S2FA 2WWJA 4XF9A 2WRAA 3M3CA 2HYXA 3HBZA 2P3KA 3VBHC 5F5IA 1H30A 2HWE3 2J1SA 3WF3A 4QPGB 2R061 1PGSA 2X09A 4LBMA 4O65A 2XKOA 4JKKA 3LPGA 1QJFA 3R05A 3RZZA 4AVCA 3OYWA 4CUGA 2G19A 5L19A 4YGEA 4OHZA 3ZR6A 3AYDA 2HWB1 2VZQA 5A6XA 4XCAA 3IPVB 4LHLA 4CP9A 1RUI2 2VNRA 1NA1C 4LUKA 1SBEA 1J3RA 4IV1C 5CKQA 4XTMA 3ST7A 2WO7A 3X29B 5C5TA 1YNAA 2XUEA 4A7KA 3FWEA 1XNKA 1H1AA 1V00A 1V6MA 2BWAA 2UURA 1RUD1 3C2UA 3ZN4A 1W39A 2XJQA 4LO4B 3LIHA 5CNAA 5LA0A 1YQ6A 3VD5A 4KBZA 3MIFA 1VP6A 2DU1A 3BODA 3N7LA 5FY8A 3WG1A 2GNDA 4MXWB 5IW0A 1PGL2 3G6JB 3OBAA 5IATA 1DIWA 1ZRDA 2PLV2 2ILMA 1REEA 2XVKA 2XL9A 3B5LB 3WZ1A 5KXBA 1US2A 1K42A 3PVBB 2ZGKA 1ENSA 5FLHA 3ZYIB 1ODNA 4WM7C 1OLRA 1J84A 1HQWA 5FLJA 1BVVA 4MG2A 2HWD2 2RV9A 3THPA 2QFEA 1W6QA 2PHRA 2RDNA 4Q0SA 4CDXA 1RXFA 4AQTA 4BMBA 1LULA 3ZN6B 4A3XA 1QH7A 3SQOA 5E6HA 1WLCA 2J1TA 2YBPA 4XQDA 5FZEA 3GXUA 5JXGA 1JZ6A 5DABA 3MZHA 1E57A 1QY4A 3IKWA 4GJYA 1W8UA 2AREA 2W9XA 1JZ2A 1ZX5A 1ASJ2 2BW8A 1SLCA 3GZTB 1W06A 4IEYA 4MYEA 1ND2C 3NNJA 5DUWA 3H1YA 2R7EB 3AMMA 4DXRA 1QDCA 2RJLA 2D98A 4JGZA 3W59A 5CVRA 3MUY1 2H0VA 2OZJA 3FBYA 3HBKA 1A34A 3R6SA 1R093 4Q0QA 2IXCA 5L73A 3VN4A 1OPMA 1PMHX 1XYOA 1W2AX 5BNPB 2OZ6A 3UESA 3RZMA 3AZYA 1SLIA 3H8OA 5A7SA 1H4GA 5GZGA 2ADDA 1MZFA 2PAMA 3ZX7A 2I07B 2JDMA 2XG3A 1O3TA 4IEOA 5A6YA 1DYKA 3N9OA 4IETA 2DV9A 3E5XA 4KI5M 5CU1A 4CEYC 4CVUA 1LAJA 3MIHA 3ITQA 1M06G 2R49A 4JC1A 1VBB2 4PBPA 5JOYA 4XJUA 5C7GA 1W9SA 1O3QA 1GV9A 1HW5A 3WINE 2PTMA 1VBB3 3LEIA 4COZA 1Z7S2 5K4LA 4N43C 1XB9A 2SLIA 1GP4A 2ZGQA 3RJRA 1AR83 5EZWA 4B1LA 5FY4A 2YXSA 5I8YA 4YG0A 3M3QA 1MS4A 1LESA 2YFZA 3BTAA 4QQPA 5CBLA 2W1UA 2VECA 4FAGA 1JU3A 2WZEA 1ENQA 3ME2A 4E2SA 2WNUC 1FPN1 3S7EA 3DV8A 4ASKA 5FPBA 3AC0A 4GD4A 4NE9A 5A32B 4BHPA 3WW2A 3RSJA 4IGOA 3VBUA 2Z79A 3ZKUA 3K3OA 4KWLA 4JX0A 4FCAA 4W50A 2GAUA 3AXEA 3D4KA 3NV1A 3OGGA 4XBNA 4OCTA 3J7LA 5E1RA 5KXDA 4HL0A 3MPPG 2YB7A 3ZYFA 4GALA 4EZ4A 3ZIWA 2PFWA 1EP0A 2NYYA 3RGBA 1TVGA 4QD2A 1A3KA 3S0MA 2ET7A 1YQ2A 1UYPA 1FATA 2ETEA 2CU5A 3V0AB 1LNSA 2I74A 1P8JA 2GN3A 4YWAA 2E6VA 2RR11 4WVMB 2QUOA 2GMPA 5A80A 5AFBA 5EV7A 4IE4A 1I1EA 1RUOA 2FMYA 1PZ9A 2CWSA 2G9GA 4XC9A 1W8OA 4Y5SA 2E32A 4HKLA 1O5LA 5FYYA 3T1MA 2ZMKA 1S0IA 1WLTA 1OOPB 1W8HA 3R0RA 2XJUA 5A3LA 5A3NA 1SLBA 4HLTA 2ZPXA 4NHLA 1EPZA 4LULA 2WJSA 3WUDA 1IS6A 2E7AA 1LHUA 1PIV2 2HWF2 2WNVC 4LA2A 4QQLA 4BH9A 4L2NA 5JXIA 1VJ2A 3S7IA 2DCTA 1UY4A 1R091 4FQZA 3A0NA 2EF6A 3B01A 2Z42A 1OA4A 5F5AA 2QQNA 5JR2A 5D2AA 1QHDA 4XDOA 4XBQA 1NUKA 4CXYA 1JZ8A 2YC0A 1D4M1 2JG8A 5FZ6A 3KLSA 4A45A 2BNMA 2JDAA 2IVJA 4CU6A 1YI7A 3OUIA 1DHKB 2QZ2A 3CQOA 2PLV3 4QKBA 3HAGA 2PN5A 3OPTA 4RA0A 1WCSA 2A3WA 3VKLA 4F83A 5I0DA 2VJXA 5CIRA 1KFXL 1H9PA 2Y6HA 5JMOA 1OLMA 3GGLA 4QKDA 3PHMA 1IQDC 2DYCA 2WZPP 3GZAA 4MGTA 2Y8KA 5GLZA 1GOFA 4BQWA 5JAXA 4UFHA 2DDUA 3HNYM 2VOTA 2GALA 3DYMA 5IT6A 1YQCA 4DY3A 4JDNA 1HV0A 4QU2A 2CAUA 3HJRA 4WVVA 1RMU3 1QDOA 2WA4A 4TWTA 3U4SA 4D7YA 3GDBA 3E5UA 4IV1B 1VMJA 2BUKA 1WWYA 2PXJA 4BQ3A 1ZBA2 4GWJA 1QOTA 2VUAA 3TNQA 1PMIA 1NZCA 3VB9A 5BY5A 2QQKA 4JGYA 4DPNA 1DG6A 1CIWA 1H2NA 2YDEA 1VAVA 3ILFA 3M2MA 1ZZ8A 4ORFA 2YU2A 4EROA 1OH4A 1NLQA 1S2EA 3E5QA 1G9AA 1W8FA 4DB5A 3IDEA 1BK1A 4RYDA 5FDBA 1NX9A 5LA9A 3LAGA 3DPRA 3U1XA 3RZLA 5FAXA 1GOHA 1TMF3 2DBNA 1VBC3 5A3PA 4AG4A 4TTGA 4I30A 4DUXA 2R042 2EAAA 1UY1A 1SDDB 3VDDA 1OUSA 3ZLIA 5HCHA 4YM1A 1XU2A 1AX1A 1QXRA 5T55A 5M0TA 3R4SA 4IE7A 4OQ9A 4YVWA 2DVFA 3PIJA 2FDGA 4NHMA 2IC1A 3O1MA 4HG6B 1H0BA 3AZXA 2BTVC 3UGHA 4AEDC 3PVOA 5LK7B 4LBJA 4QM9A 5LBBA 1A78A 3CKHA 4Q27A 4XHBA 5HPOA 5FUIA 4Z92B 4LA3A 3ZFEA 4XXPA 3AMHA 1UMHA 3DN7A 3HWJA 4N9IA 1JXNA 1H8VA 3HMYA 5BNNC 2B39A 4BLIA 1RUJ1 4AAPA 4CDUC 1N47A 4E4HA 1YO8A 3SHRA 3OTFA 4CDWC 5A33B 2JB4A 4YW4A 1POV0 3E6BA 4Y3OA 3RFRA 4COUA 2A6XA 4MGZE 4MGQA 1NLSA 2VUCA 3QOPA 4QB2A 4ES8A 5T5LA 4D6SA 4HKWA 4Z8BA 1X36A 3GHNA 4WVMA 4NIAA 3H9AA 2BV4A 3FE5A 3N3HA 5D1IA 3BIWE 2VY0A 1UAIA 4V2WA 4R8HA 2WS93 1J59A 2VZUA 4ES9A 1RUD3 3W5MA 2P5BA 3SKJE 2X5IB 3W58A 3NAPB 4E8CA 5JSPA 1QJX3 1Z78A 5C33A 3LEGA 3Q8AA 1ZYBA 4OMCA 4BXFA 3GBFA 3KV9A 1ULCA 2RDSA 4MH0E 4GIQA 3RMXA 3CDZB 5J37A 1MVEA 4JHZA 4SBVA 5FZHA 4QMAA 1RUG3 4Q0UA 1AR91 4M3CE 4CXWA 4HOOA 1PZ8A 3CHXA 3IIAA 1JUHA 1PO12 3ZXAC 2O1QA 3PMSA 1S0DA 3MI8A 2UWAA 4OHWA 3S57A 1R083 2ZGNA 3BN6A 3HQRA 4G3YC 2HWE2 2UY8A 3VDBA 4AVVA 5C8CB 3GF6A 2ZCWA 3V0BA 1XE7A 1SCSA 5LA1A 4KGQA 1VMHA 4CU9A 5HCBA 4FP2A 3NW4A 3PNAA 4H3WA 4CUCA 2QVSB 4FPCA 1D7PM 3RDIA 4RR3B 2G1MA 2IXKA 4LMFA 1SDWA 1WW4A 2W2IA 2CHHA 4JTOA 1SFYA 4LLOA 1BCXA 2XWBB 5C5UA 4AF9A 1U5IA 1TME3 3POEA 2E53A 2C9AA 3VBHB 3BGAA 4CTEA 1ND3A 2WC2A 2AGSA 3B93A 1MS1A 1OI6A 4BU2A 5EFUA 1RVF1 3MUZ1 5LA2A 1MZ5A 1SBFA 1OUXA 4UW6A 4H14A 4QX2A 4RQPB 3KGZA 3SISA 4AI2A 3WXPA 3T09A 3LGRA 3LSDA 3T4HB 3BU0A 5KHHA 1CESA 2WQ4A 4PDWA 2BZDA 4KNCA 3WNPA 5J3UA 4M01A 4JVAA 4Y22A 1PK6C 1C28A 2ZX0A 3POBA 5FJHA 1OQ1A 3AM2A 1CD3G 2NMNA 3OCPA 3KSCA 3E97A 3MIEA 1RUH3 3EBRA 3I2OA 1WW5A 2DUPA 5CG9A 4LHKA 1GQPA 2BJSA 2X05A 5A7PA 4L8QA 2QQUA 1RJ7A 1VBB1 1JYNA 1J3PA 3PURA 1UX6A 5CFDC 1K5JA 4IERA 1M4WA 3U75A 4XFIA 1W2UA 2PHLA 2QZ3A 5CZKA 3BTYA 2HWD1 2X29A 3OD0A 3PTRB 4QM8A 3VBUC 1BMV2 4U36A 4LK7A 2WFF3 1KQRA 3EB7A 3M8LA 4FFGA 5LWBA 1SLLA 3SH5A 4QPGC 1ND3C 4W8JA 3MV11 1UY0A 3IDAA 4XF0A 1H8TC 1CR7A 1RITA 2AC1A 3WQ1A 4A42A 4AQSA 2Z69A 1QEXA 3CJIC 3EHKA 5GLVA 4DNYA 4GH4A 3MLLA 3M4FA 4MLOA 1POV3 1VBE1 4EE2A 5B2GB 5DAQA 2UY9A 2HBTA 3AMQA 3CF6E 1U12A 4AVAA 1F35A 1WGPA 3LD8A 1ZRRA 4Q4V2 3NJYA 2GMMA 1K12A 2XHKA 1RUG1 1RVF2 3I2HA 4Y1XA 4RSUA 3ZFFC 3D0SA 3HQUA 4NRPA 4SLIA 5EPAA 1AR92 3WDWA 4YW7A 3TN93 5F5CA 1RUE3 1WCDJ 1O59A 1NCRC 1ZZ7A 2VMIA 3QACA 4Y1ZA 1QMJA 1UYXA 2XOMA 1XRUA 1XE0A 4JZRA 3VBHA 4GWMA 3TRSB 3U07A 4AFMA 5IVEA 1BQPA 2XR4A 1S0GA 3POGA 5C4WC 3PLQA 2FD8A 1GQHA 4OZXA 4YW3A 2WYFA 3ZXDA 1EUUA 5C71A 1O4YA 2JE8A 1UXZA 2XLAA 4QX8A 2B45X 3AX4A 5B4NA 2GDFA 2D3RA 3HN1A 5HI0A 1BHGA 1UZZA 2QQPA 1AYM2 1UOFA 1VE0A 4K1YA 4XABA 2FZ2A 3HIFA 4Q4W3 3F95A 2XB6C 2WAOA 2C6SA 1LU2A 4B7EA 1OKQA 3KCYA 2EA7A 2GNTA 5LY2A 4HZFA 1X33A 2BFUS 3TNPB 5LEKA 2J1UA 5T52A 1I6XA 1RUJ3 5JPNB 3H8UA 3JZVA 2WSUA 3OG2A 2E7QA 3A22A 5FYIA 1W0NA 5CFCC 4Q4V3 1XU1A 2IXJA 1ZA7A 2O14A 4PLOA 1DLCA 2HWF1 5HV4A 3WNXA 5IHRA 4LBQD 1R082 4BJ0A 4N7UA 4UXAA 4DO0A 2JDHA 4RR3C 3ZYBA 5FYSA 5I91A 4Y5TA 3N9PA 4XYXA 4Z07A 2OVUA 3OY8B 4FPFA 3BI3A 2QTWB 1VBE3 2X5IA 2P17A 4DRRA 4XHXA 5FCCA 3U4XA 1Y9MA 4PQQA 5EHDA 3VBFB 3ZXKA 1HRI3 2HWC3 4YW2A 3O0XA 4LKEA 1MS0A 3JD73 1AR72 4EJRA 5FJKA 1D2SA 2WABA 4AFAA 1AXKA 1ZNPA 3RQ0A 4FPJA 4UFLA 2VW1A 4YVWB 4QX3A 2JIJA 4YGCA 1BMV1 5FY0A 3EQEA 5BUVA 1G86A 1UOBA 1W05A 2ES3A 4W65A 5G04L 1WD4A 1B09A 5FYBA 2XWJB 1FX5A 4IUGA 1HRI2 3VKMA 2J22A 5ERLA 3SLIA 1DGRA 3AXDA 3NNMA 1IS4A 5C3OA 2VO5A 1GZ9A 2R041 1X8EA 4Q4X3 1WBFA 3BOWA 4X8NA 2YMZA 4FPGA 2ZX3A 1ZZBA 1BBT3 3ZPOA 2GN7A 1GP5A 2AZ5A 1KS4A 1VBD1 2UU8A 4M3CB 1NA1B 2VNVA 4V2VA 3ZSMA 1DYPA 1I5ZA 2W46A 1GBGA 1TZOA 4HSLA 4Q2FA 2Y6FA 4XUNA 4YYOA 3T2QA 3FLPA 2RS51 3HD8B 4BXSV 3T4VA 3LE0A 1VBA2 5TSWA 4XUPA 4YW1A 1UMZA 5DDJ3 1QNYA 3ZSLA 2JG9C 2XXZA 3NKTA 1CAVA 4NN0A 3KCXA 3P6BA 4E2GA 1YCIA 3IPVA 5A1FA 4ATEA 4YZ3A 5H9QA 2WSVA 3ROUA 3TEWA 1PVC3 2WYSA 1UPSA 1GUIA 1XXNA 3I2GA 5FIXA 3O1VA 4Q0PA 1JHNA 3B69A 1Y7BA 3ZYGA 4RL7A 2FCUA 2OKXA 3IDBB 1DZRA 4CDQC 2ZA9A 4YM2A 3VDCA 3LIGA 4LORA 3DCQA 3NV2A 3DYPA 4NMIA 1OQDA 1S2KA 4L9BA 4Q26A 3B94A 2D5HA 5JOWA 2ZEYA 4EQVA 3ES4A 3IIIA 4LBLA 4R9BA 1X7NA 4H2AA 1N3PA 2E7TA 3M70A 4MX3A 5LBEA 3C7EA 4NHKA 5CKNA 1APNA 3OY8A 1EPWA 4KL1A 1BYHA 2NN8A 1LHNA 1PK6A 3MF9A 4OI4A 5DUVA 3I3DA 4ZXKA 4ZS3A 1Q5OA 5E88A 2WQ8A 1MPXA 4QWNA 4CP2A 5KBFA 2VGDA 5F3CA 1R1A3 2VBBA 1KJLA 2ZHLA 3CJXA 3PU3A 4C90A 3CIHA 1CX4A 4MHRA 5DXDA 5K8SA 1PM4A 4QXCA 2HEVF 4Q4Y3 1W0PA 5FYHA 1QJX2 1VBC2 5K7PA 1SFNA 5IFTA 3NVCA 1AR82 3KVBA 1UOGA 3PVEA 1D4VB 2BGOA 2C4XA 3IDCB 1NXMA 4S2GA 5JVVA 3SEEA 1XSQA 3U14A 4GB33 5HCAA 4QGMA 1QJEA 2BPA2 2VMFA 4Z2WA 2Q8DA 1G9BA 1MS5A 1SQ4A 1VB2A 3S5QA 4IEZA 4JV4A 5L7OB 4ET7A 3TOJA 4TN7A 4AHZA 2XQXA 4Z2AA 2QQMA 4EN6B 1UKGA 1JHJA 4L92A 3OGVA 1LOFA 2C26A 5H9SA 4MGYE 4NIIA 3LF7A 4MSVA 3UK9A 4AEDA 5CAZA 2D93A 2RS11 1CVNA 4Q29A 5FP8A 3K3NA 2VZRA 1ULOA 2YY1A 3T0AA 1F4AA 3OPWA 5ANNA 1W6NB 1XNBA 1JYCA 1WA6X 4IEQA 3M1HA 1REDA 2VTXJ 1CZTA 2WN2A 3OJBA 3WX5A 2D5FA 3ZYJB 4FPKA 1LODA 1Y3TA 3WEZA 4GB32 5J48A 3KV5A 4CEWB 3CEWA 5A3UA 4AE2A 1HIXA 2ZZQA 4FI9A 1HQLA 1LHOA 2RG4A 1NXD1 1TNRA 3VBOA 3WDYA 3EYPA 1RUH2 4BISA 1HV1A 1GWKA 2VTXA 1N3QA 3G7DA 4E27A 4NVPA 4ZPIA 3USUA 4XAEA 1YFUA 2BQPA 4NRMA 1ALYA 3MLKA
chains in the Genus database with same CATH topology
1CZVA 4PT6A 1TVGA 1CX1A 2ZEWA 2DCJA 3WNNA 3HEIA 1J83A 2ZEZA 1WCQA 1YQ2A 3LPFA 1LNSA 2W1QA 1P8JA 2W1WA 2Y64A 4A4AA 3WF2A 4D8MA 2EIBA 3C7GA 4A41A 3I2FA 1W8OA 2E32A 2WAAA 3A21A 4QX0A 5J1XA 2W1SA 3UETA 3OGSA 3C7HA 1CZSA 2RJ2A 2EICA 3WSOA 2VZ3A 5JXIA 4A3ZA 1T2XA 1UY4A 5G05L 4TXWA 2HLEA 4A44A 3WNLA 3OGRA 2QQNA 5JR2A 3F2ZA 1NUKA 1JZ8A 1JZ3A 1H6YA 2QQIA 2VZVA 4A45A 1JZ4A 3I2JA 2JDAA 4CU6A 2J1RA 3CQOA 5I0DA 2VJXA 1OF4A 2W95A 2LW8A 2Y6HA 2W92A 5JMOA 3GGLA 4ZZ5A 1UYYA 1IQDC 3D3AA 2Y8KA 1GOFA 2BGPA 2DDUA 3HNYM 4ARYA 2VOTA 3DYMA 5IFPA 2YG0A 5JXJA 2VCBA 2ZXQA 3JXSA 3HJRA 3IAPA 3T08A 1JZ5A 2DCKA 4PF1A 4XUQA 5EJZB 4ARXA 3LEKA 3GDBA 3ACFA 2QBXA 3NJVA 1XNAA 2W3JA 4GWJA 2X10A 2QQKA 3PUIA 2ID4A 1NKGA 2VMEA 1OH4A 1UY2A 3I3EA 4QX1A 3ABZA 4RYDA 3DYOA 3W5NA 1NX9A 3K77A 1JYWA 4JKMA 1GOHA 2B4KA 2E26A 2W94A 4AG4A 4TTGA 3K4DA 3C7OA 4XVHA 4CU7A 4DUXA 3T0BA 1US3A 3WF0A 1UY1A 2BBAA 1SDDB 2C9KA 4L0PA 3SEPA 3UNPA 1I5PA 1GMMA 5A1AA 3C8XA 2QQJA 1XNTA 1L7QA 1ULPA 3K4ZA 4HG6B 2YC4A 1DP0A 3WF1A 3VD7A 2ORZA 3CKHA 1K3IA 5HPOA 5FUIA 4GWIA 4A6OA 4DEQA 1UMHA 1GNYA 3ETPA 4RN5A 4CU8A 4M4PA 4XUOA 4ZZ8A 1UY3A 2VZTA 1OF3A 3VD3A 4MGQA 4AAXA 3HNMA 4QB2A 2VZOA 1UMIA 3NNGA 1EUTA 2VZUA 5C70A 3W5MA 4BK5A 3SKJE 1F4HA 2EIEA 4E8CA 2VMDA 3LEGA 4OMCA 3U37A 3CZUA 3CDZB 2KD7A 3GM8A 2VQUA 4JHZA 2WDBA 5JUVA 1L7RA 1PX4A 3I3BA 4BK4A 3BN6A 2Y6JA 2ZEXA 5IYYA 2VCCA 4QDQA 3VDBA 4KMQA 5LA1A 3C7FA 4CU9A 1JYXA 4CUCA 5DMYA 1D7PM 2QQLA 3T0DA 4DUWA 4M4RA 2L9LA 5LCWL 2VL4A 3ECQA 2W47A 2Y6GA 3BGAA 3I97A 3MUZ1 5LA2A 4QX2A 4UI9L 4KWUA 3T09A 3WNOA 3J7HA 2J1EA 1H6XA 2BZDA 4UOJA 1OT5A 3I2KA 3WNPA 1O8PA 3MO4A 1GU3A 2VQTA 2RVAA 3SKVA 1GQPA 2X05A 3WQBA 1SHWB 2VZSA 1JYNA 2V72A 3K46A 4QB6A 2CDOA 3CMGA 2J1AA 3OEBA 3VD9A 5CZKA 1KGYA 1UX7A 3EB7A 5B4XA 2VC9A 3I2IA 4W8JA 2YC2A 2WBKA 3MV11 2VMCA 1UY0A 3IDAA 4P5YA 4A42A 3T2OA 1SG3A 1JU4A 2WN3A 3CZJA 3A23A 1CIYA 5IJRA 3ACIA 3WF4A 4DXSA 1K45A 4LKSA 4P08A 4CUAA 3MBWA 3K75B 1K12A 3WNKA 1JI6A 3HOBA 3I2HA 3FHQA 1JYVA 4W4ZA 4MOAA 3FHAA 3LQCA 4XZUG 1O59A 3MV01 1UZ0A 1R64A 1UYXA 2XOMA 5DPNA 4OZOA 2E33A 3WNMA 4BDVB 3HN3A 3P1IA 2V4VA 1EUUA 4LQRA 2JE8A 3T2PA 5C71A 1UXZA 4MGSA 3NQHA 3PUHA 4E8DA 2VZPA 5B4NA 1BHGA 4GZ9A 3HNBM 4ZXEA 3DECA 1UYZA 1W8NA 4XURA 1HN1A 3IB3A 5DQ0A 2WAOA 2WO2A 4QPWA 2WO3A 5F7UA 1XC6A 2VZ1A 3VDAA 1KEXA 3A7QA 2J1UA 4LHSA 3OG2A 1RYYA 3A22A 3THDA 1JZ7A 1W0NA 1GOGA 1DLCA 5IHRA 4BJ0A 4YPJA 5EJ1B 3ACGA 2CDPA 2VR4A 4QAWA 4DUVA 4PQQA 2W5FA 1O8SA 1WKYA 2WABA 4OYUA 3ZM8A 2XHNA 2YFUA 2W87A 4MADA 1XPWA 2W91A 4QX3A 2VTFA 2QQOA 5CYYA 5G04L 4DXTA 3OEAA 4IUGA 2BERA 2J22A 3NJXA 4QDRA 2PQSA 2HYXA 2VO5A 2Y6KA 3OB8A 4QB1A 2J1SA 3WF3A 5EIYB 2X09A 4OMDA 4JKKA 3LPGA 2W46A 1OD3A 4XUNA 3T2QA 4BXSV 2VZQA 2WZ8A 3THCA 4QDSA 3LE0A 4XUPA 3FL7A 4XUTA 5JXHA 3P6BA 2WYSA 1GUIA 2Z4FA 3I2GA 5LA0A 2OKXA 3VD5A 3VD4A 4LPLA 3VDCA 3OBAA 3DYPA 3IAQA 2ZEYA 1US2A 3IIIA 1K42A 2J7MA 1J84A 3C7EA 2LS6A 2RV9A 3I3DA 4JKLA 2J1TA 1JZ6A 2WQ8A 1MPXA 3GXUA 5HXMA 5JXGA 2W9XA 1JZ2A 3CIHA 1DYOA 4DXRA 2R7EB 2WO1A 3MUY1 4MO3M 2J1VA 5IFTA 2BGOA 2C4XA 3SEEA 2VCAA 3HPNA 1W9WA 1PMHX 2VMFA 3UESA 4ET7A 2EIDA 1PMJX 3NRUA 2XQXA 3E1F1 4D0QA 4Z2AA 2QQMA 1NAEA 1JHJA 4P00B 3OGVA 2WUHA 2C26A 4KI5M 4CVUA 1UXXX 2JD9A 1W9TA 2B9VA 2E31A 5C7GA 2VZRA 1ULOA 1W9SA 4UAPA 3T0AA 1F4AA 2V5DA 4ZY9A 3LEIA 5DN2A 4P02B 2VM9A 2WN2A 1CZTA 2JKXA 1UWWA 2YFZA 4CUBA 3FN9A 3WEZA 2Y6LA 2XONA 2W1UA 1JU3A 3ACHA 4OUEA 2WZEA 4FI9A 1PX3A 3AC0A 1TG7A 3EYPA 3K4AA 4DEVA 1W99A 4JX0A 4W50A 2ORXA 2YB7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CZV A;  4PT6 A;  1TVG A;  1CX1 A;  2ZEW A;  2DCJ A;  3WNN A;  3HEI A;  1J83 A;  2ZEZ A;  1WCQ A;  1YQ2 A;  3LPF A;  1LNS A;  2W1Q A;  1P8J A;  2W1W A;  2Y64 A;  4A4A A;  3WF2 A;  4D8M A;  2EIB A;  3C7G A;  4A41 A;  3I2F A;  1W8O A;  2E32 A;  2WAA A;  3A21 A;  4QX0 A;  5J1X A;  2W1S A;  3UET A;  3OGS A;  3C7H A;  1CZS A;  2RJ2 A;  2EIC A;  3WSO A;  2VZ3 A;  5JXI A;  4A3Z A;  1T2X A;  1UY4 A;  5G05 L;  4TXW A;  2HLE A;  4A44 A;  3WNL A;  3OGR A;  2QQN A;  5JR2 A;  3F2Z A;  1NUK A;  1JZ8 A;  1JZ3 A;  1H6Y A;  2QQI A;  2VZV A;  4A45 A;  1JZ4 A;  3I2J A;  2JDA A;  4CU6 A;  2J1R A;  3CQO A;  5I0D A;  2VJX A;  1OF4 A;  2W95 A;  2LW8 A;  2Y6H A;  2W92 A;  5JMO A;  3GGL A;  4ZZ5 A;  1UYY A;  1IQD C;  3D3A A;  2Y8K A;  1GOF A;  2BGP A;  2DDU A;  3HNY M;  4ARY A;  2VOT A;  3DYM A;  5IFP A;  2YG0 A;  5JXJ A;  2VCB A;  2ZXQ A;  3JXS A;  3HJR A;  3IAP A;  3T08 A;  1JZ5 A;  2DCK A;  4PF1 A;  4XUQ A;  5EJZ B;  4ARX A;  3LEK A;  3GDB A;  3ACF A;  2QBX A;  3NJV A;  1XNA A;  2W3J A;  4GWJ A;  2X10 A;  2QQK A;  3PUI A;  2ID4 A;  1NKG A;  2VME A;  1OH4 A;  1UY2 A;  3I3E A;  4QX1 A;  3ABZ A;  4RYD A;  3DYO A;  3W5N A;  1NX9 A;  3K77 A;  1JYW A;  4JKM A;  1GOH A;  2B4K A;  2E26 A;  2W94 A;  4AG4 A;  4TTG A;  3K4D A;  3C7O A;  4XVH A;  4CU7 A;  4DUX A;  3T0B A;  1US3 A;  3WF0 A;  1UY1 A;  2BBA A;  1SDD B;  2C9K A;  4L0P A;  3SEP A;  3UNP A;  1I5P A;  1GMM A;  5A1A A;  3C8X A;  2QQJ A;  1XNT A;  1L7Q A;  1ULP A;  3K4Z A;  4HG6 B;  2YC4 A;  1DP0 A;  3WF1 A;  3VD7 A;  2ORZ A;  3CKH A;  1K3I A;  5HPO A;  5FUI A;  4GWI A;  4A6O A;  4DEQ A;  1UMH A;  1GNY A;  3ETP A;  4RN5 A;  4CU8 A;  4M4P A;  4XUO A;  4ZZ8 A;  1UY3 A;  2VZT A;  1OF3 A;  3VD3 A;  4MGQ A;  4AAX A;  3HNM A;  4QB2 A;  2VZO A;  1UMI A;  3NNG A;  1EUT A;  2VZU A;  5C70 A;  3W5M A;  4BK5 A;  3SKJ E;  1F4H A;  2EIE A;  4E8C A;  2VMD A;  3LEG A;  4OMC A;  3U37 A;  3CZU A;  3CDZ B;  2KD7 A;  3GM8 A;  2VQU A;  4JHZ A;  2WDB A;  5JUV A;  1L7R A;  1PX4 A;  3I3B A;  4BK4 A;  3BN6 A;  2Y6J A;  2ZEX A;  5IYY A;  2VCC A;  4QDQ A;  3VDB A;  4KMQ A;  5LA1 A;  3C7F A;  4CU9 A;  1JYX A;  4CUC A;  5DMY A;  1D7P M;  2QQL A;  3T0D A;  4DUW A;  4M4R A;  2L9L A;  5LCW L;  2VL4 A;  3ECQ A;  2W47 A;  2Y6G A;  3BGA A;  3I97 A;  3MUZ 1;  5LA2 A;  4QX2 A;  4UI9 L;  4KWU A;  3T09 A;  3WNO A;  3J7H A;  2J1E A;  1H6X A;  2BZD A;  4UOJ A;  1OT5 A;  3I2K A;  3WNP A;  1O8P A;  3MO4 A;  1GU3 A;  2VQT A;  2RVA A;  3SKV A;  1GQP A;  2X05 A;  3WQB A;  1SHW B;  2VZS A;  1JYN A;  2V72 A;  3K46 A;  4QB6 A;  2CDO A;  3CMG A;  2J1A A;  3OEB A;  3VD9 A;  5CZK A;  1KGY A;  1UX7 A;  3EB7 A;  5B4X A;  2VC9 A;  3I2I A;  4W8J A;  2YC2 A;  2WBK A;  3MV1 1;  2VMC A;  1UY0 A;  3IDA A;  4P5Y A;  4A42 A;  3T2O A;  1SG3 A;  1JU4 A;  2WN3 A;  3CZJ A;  3A23 A;  1CIY A;  5IJR A;  3ACI A;  3WF4 A;  4DXS A;  1K45 A;  4LKS A;  4P08 A;  4CUA A;  3MBW A;  3K75 B;  1K12 A;  3WNK A;  1JI6 A;  3HOB A;  3I2H A;  3FHQ A;  1JYV A;  4W4Z A;  4MOA A;  3FHA A;  3LQC A;  4XZU G;  1O59 A;  3MV0 1;  1UZ0 A;  1R64 A;  1UYX A;  2XOM A;  5DPN A;  4OZO A;  2E33 A;  3WNM A;  4BDV B;  3HN3 A;  3P1I A;  2V4V A;  1EUU A;  4LQR A;  2JE8 A;  3T2P A;  5C71 A;  1UXZ A;  4MGS A;  3NQH A;  3PUH A;  4E8D A;  2VZP A;  5B4N A;  1BHG A;  4GZ9 A;  3HNB M;  4ZXE A;  3DEC A;  1UYZ A;  1W8N A;  4XUR A;  1HN1 A;  3IB3 A;  5DQ0 A;  2WAO A;  2WO2 A;  4QPW A;  2WO3 A;  5F7U A;  1XC6 A;  2VZ1 A;  3VDA A;  1KEX A;  3A7Q A;  2J1U A;  4LHS A;  3OG2 A;  1RYY A;  3A22 A;  3THD A;  1JZ7 A;  1W0N A;  1GOG A;  1DLC A;  5IHR A;  4BJ0 A;  4YPJ A;  5EJ1 B;  3ACG A;  2CDP A;  2VR4 A;  4QAW A;  4DUV A;  4PQQ A;  2W5F A;  1O8S A;  1WKY A;  2WAB A;  4OYU A;  3ZM8 A;  2XHN A;  2YFU A;  2W87 A;  4MAD A;  1XPW A;  2W91 A;  4QX3 A;  2VTF A;  2QQO A;  5CYY A;  5G04 L;  4DXT A;  3OEA A;  4IUG A;  2BER A;  2J22 A;  3NJX A;  4QDR A;  2PQS A;  2HYX A;  2VO5 A;  2Y6K A;  3OB8 A;  4QB1 A;  2J1S A;  3WF3 A;  5EIY B;  2X09 A;  4OMD A;  4JKK A;  3LPG A;  2W46 A;  1OD3 A;  4XUN A;  3T2Q A;  4BXS V;  2VZQ A;  2WZ8 A;  3THC A;  4QDS A;  3LE0 A;  4XUP A;  3FL7 A;  4XUT A;  5JXH A;  3P6B A;  2WYS A;  1GUI A;  2Z4F A;  3I2G A;  5LA0 A;  2OKX A;  3VD5 A;  3VD4 A;  4LPL A;  3VDC A;  3OBA A;  3DYP A;  3IAQ A;  2ZEY A;  1US2 A;  3III A;  1K42 A;  2J7M A;  1J84 A;  3C7E A;  2LS6 A;  2RV9 A;  3I3D A;  4JKL A;  2J1T A;  1JZ6 A;  2WQ8 A;  1MPX A;  3GXU A;  5HXM A;  5JXG A;  2W9X A;  1JZ2 A;  3CIH A;  1DYO A;  4DXR A;  2R7E B;  2WO1 A;  3MUY 1;  4MO3 M;  2J1V A;  5IFT A;  2BGO A;  2C4X A;  3SEE A;  2VCA A;  3HPN A;  1W9W A;  1PMH X;  2VMF A;  3UES A;  4ET7 A;  2EID A;  1PMJ X;  3NRU A;  2XQX A;  3E1F 1;  4D0Q A;  4Z2A A;  2QQM A;  1NAE A;  1JHJ A;  4P00 B;  3OGV A;  2WUH A;  2C26 A;  4KI5 M;  4CVU A;  1UXX X;  2JD9 A;  1W9T A;  2B9V A;  2E31 A;  5C7G A;  2VZR A;  1ULO A;  1W9S A;  4UAP A;  3T0A A;  1F4A A;  2V5D A;  4ZY9 A;  3LEI A;  5DN2 A;  4P02 B;  2VM9 A;  2WN2 A;  1CZT A;  2JKX A;  1UWW A;  2YFZ A;  4CUB A;  3FN9 A;  3WEZ A;  2Y6L A;  2XON A;  2W1U A;  1JU3 A;  3ACH A;  4OUE A;  2WZE A;  4FI9 A;  1PX3 A;  3AC0 A;  1TG7 A;  3EYP A;  3K4A A;  4DEV A;  1W99 A;  4JX0 A;  4W50 A;  2ORX A;  2YB7 A; 
#chains in the Genus database with same CATH topology
 2QDN A;  5KC5 A;  3NST A;  1DZT A;  3IN9 A;  2CSG A;  1RHI 2;  2D3P A;  4I0B A;  1NE6 A;  2DCJ A;  2ZEW A;  3WY6 A;  3V0B B;  3HEI A;  5LB6 A;  1UNB A;  2PAE A;  5A70 A;  5CIS A;  4IQP A;  4MUV A;  2MEV 2;  2LAL A;  4Q4V 1;  2JJ6 A;  3W20 A;  2RDQ A;  3LPF A;  1TMF 1;  1UZV A;  2GNM A;  4LIV A;  2ET1 A;  4N53 A;  2HH9 A;  4DZG A;  3J7M A;  3CNA A;  5FXX A;  2Y64 A;  1YEW A;  3WF2 A;  4A4A A;  4AHW A;  5E16 A;  1DGW A;  3C7G A;  1PGW 2;  1IZ3 A;  1BXH A;  2JE9 A;  4YZ5 A;  4IDZ A;  1XBF A;  3VBS A;  3I2F A;  4R9C A;  3E6C C;  1IS5 A;  3AKS A;  4EWD A;  2WAA A;  4QX0 A;  1HB3 A;  5J1X A;  1HXS 1;  4Q1P A;  3VL8 A;  4ASM B;  3FX3 A;  2MNG A;  4D6R A;  3VLB B;  2FDF A;  5FLI A;  2W1S A;  3UET A;  4HK8 A;  4WZF A;  5C8C C;  5FMO L;  1DQ2 A;  1PHM A;  3BCW A;  3J4U H;  1HXS 3;  4GJZ A;  5L9R A;  2R32 A;  4LIT A;  4NAO A;  4Y1V A;  2VZ3 A;  3WSO A;  4XEZ A;  3IMN A;  4QQH A;  3TEX A;  1SFP A;  1HN0 A;  3RZG A;  4X6R B;  1N1V A;  4IE6 A;  3GBG A;  4A44 A;  2R6Q A;  4W6W A;  1AJK A;  2CAV A;  1AJO A;  5DAP A;  3AFK A;  3LDB A;  3F2Z A;  5FRA A;  1RUE 1;  1RGS A;  4DIQ A;  2KM2 A;  3VL9 A;  5CG8 A;  1H6Y A;  2QQI A;  2VZV A;  4PHZ A;  4C0B A;  5SV8 A;  4CPB A;  4BQ2 A;  2WT0 A;  5DZE A;  4K21 A;  5FPX A;  3OBT A;  3B7M A;  3J8F 1;  4XJ9 A;  2I2S A;  3NNF A;  4Y5Z 0;  2XQR A;  1S4C A;  1GNH A;  1XE8 A;  2JXA A;  2LW8 A;  1NCR A;  5T3N A;  1R1A 2;  3TWI A;  3D0J A;  3WR0 A;  4D3W A;  1J1L A;  3D82 A;  2BNO A;  2XVL A;  3VBS C;  3UJQ A;  3LCP A;  2DCY A;  4BOW A;  1IGO A;  5FPZ A;  2HWB 3;  3ZXF A;  5ABJ B;  2PA7 A;  5IFP A;  2ZX2 A;  4QHZ A;  5JXJ A;  4YFZ A;  4JGZ C;  3IAP A;  3T08 A;  2CL2 A;  1W3X A;  3JD7 2;  1YWK A;  3WG3 A;  3VZM A;  4HMZ A;  4IEW A;  5EJZ B;  3N9L A;  1LKN A;  4EN9 B;  4RHV 2;  4TYS A;  3NJV A;  4FOW A;  1W6Q B;  2HWE 1;  2W3J A;  3LA7 A;  2WZR 1;  1RUN A;  2X10 A;  5C4W B;  3O1T A;  4XJ8 A;  5DG1 A;  5FYU A;  1E5S A;  4H7M A;  2VW0 A;  5BNP C;  2ID4 A;  4CDU B;  1N1T A;  1UY2 A;  1H8T A;  4P9G A;  2VOX A;  3USS A;  4BQ4 A;  2R0H A;  3ACL A;  5F2W A;  4LBK A;  2P1B A;  4QPG A;  3DYO A;  3ZSJ A;  3W5N A;  2DBI A;  3BVC A;  3HVD A;  3VV1 A;  3SH4 A;  1NCQ C;  1BJQ A;  1RUH 1;  3CLP A;  2E26 A;  3MLJ A;  4NPR A;  4XQ4 A;  2WR9 A;  3C7O A;  3VUO A;  2MEV 1;  1LGN A;  4XF1 A;  5AFE A;  1VBA 3;  1VB4 A;  3T0B A;  3VHP A;  4AED B;  1IHM A;  1GFF 2;  1YFW A;  4Y4Y A;  4W6X A;  2YGL A;  4YZ1 A;  5FYV A;  1UIJ A;  2C9K A;  3UNP A;  1SPP B;  5L9B A;  1I5P A;  5A1A A;  2EXK A;  2QQJ A;  4WV8 A;  2LUW A;  2RE9 A;  4PLN A;  1ULP A;  4ZU5 A;  3V56 A;  3I3Q A;  2YC4 A;  4E4D X;  1C57 A;  1RVF 3;  3FLR A;  3NV4 A;  5BXX A;  2ORZ A;  3VD7 A;  5FQ0 A;  5FZI A;  1S0F A;  2F4L A;  3OOX A;  1FPN 2;  2A5Z A;  5F3G A;  2XDV A;  5ISL A;  1TME 1;  5FP7 A;  3DEM A;  2O8O A;  5J98 B;  2D6L X;  4CP0 A;  4XJZ A;  2DCZ A;  4RN5 A;  2BOJ A;  4N9H A;  2NZ9 A;  4M4P A;  4XUO A;  1C3H A;  2YGM A;  3T30 A;  2RS3 1;  3BPZ A;  1ZRI A;  4M3C F;  5FZ4 A;  1OLM E;  3VD3 A;  4AFB A;  1V9U 2;  2A6V A;  3AJY A;  4NHX A;  3KF5 A;  2BRT A;  3HNM A;  3POS A;  1R08 1;  1H1I A;  4CEY A;  2FDK A;  1ND2 B;  3EJK A;  3KT4 A;  5C9A C;  3RYR A;  1XQN A;  5GKA C;  5JSR A;  1AYM 1;  1CAU B;  1UZW A;  1A8D A;  1ZBA 3;  3PUQ A;  4I0A A;  2K9Z A;  3VKF C;  4PDW B;  5C70 A;  5A7O A;  4BK5 A;  5IK8 A;  1FMD 1;  3KCC A;  3D6E A;  2GP5 A;  4FOY A;  1DCS A;  3BIE A;  3KHC A;  2YHJ A;  4LEJ A;  4OVE A;  1AXY A;  2A73 B;  2VMD A;  4L11 A;  1LOE A;  1YUD A;  4JCK A;  5FZM A;  1OOP C;  2KA3 A;  4LLF A;  5C3P A;  2IUW A;  1DQ0 A;  3U37 A;  3CZU A;  1N3O A;  2X5I C;  3O1O A;  1QJX 1;  4WM8 A;  2GSY A;  1E5R A;  3ORJ A;  1V9U 3;  4GMP 0;  2WDB A;  4M0N A;  5DAW A;  3WG4 A;  5FYC A;  1TEI A;  4RR3 A;  3N4M A;  5FXV A;  3CO2 A;  2WS9 1;  3NNL A;  4KG0 A;  2GC2 A;  1GKB A;  3MDP A;  3ZSE A;  3I3B A;  1C8M 2;  1VR3 A;  2ZHK A;  2XJR A;  1PO2 1;  4BK4 A;  1NCQ B;  3VZO A;  2WNE A;  3ZO0 B;  1NA1 A;  1D0H A;  1K5M C;  3DF0 A;  1PNF A;  1LGB A;  4JGY C;  4OFG A;  4QDQ A;  1LRH A;  4KMQ A;  4I09 A;  4YGD A;  4FTE A;  5I8S A;  3BPS A;  1SEF A;  2ARC A;  2PHW A;  3M7A A;  2ARA A;  4OI1 A;  1MS3 A;  4XFF A;  5T54 A;  1LTE A;  4E4S A;  2QQL A;  4M4R A;  4Y33 A;  4ITC A;  3RS6 A;  2A6Z A;  1MS8 A;  2VL4 A;  2AEZ A;  5C4W A;  3Q8E A;  3O14 A;  4AR2 A;  4NJ4 A;  2D43 A;  2VH9 A;  3H7Y A;  2JG8 B;  1MAC A;  5F3E A;  5IAV A;  3ZOI A;  1FOD 2;  2G9Z A;  1YIP A;  1WD3 A;  4I02 A;  2JD4 A;  1ZZ9 A;  4Q8K A;  1T6B X;  2DVA A;  4QGN A;  5A3O A;  3O12 A;  2VXR A;  4UI9 L;  2NM1 A;  2HYK A;  3SIT A;  1IKP A;  4NAM A;  1UO9 A;  3J7H A;  1O7F A;  2WWU A;  4HK9 A;  1ENR A;  3OSD A;  5BNQ A;  2QKD A;  2ZX1 A;  2AH2 A;  3CU7 A;  3UV9 A;  1ND2 A;  2JKB A;  2LRP A;  4IEV A;  4L99 A;  4NRO A;  1CAW B;  3RPQ A;  2R06 3;  1N1S A;  3B00 A;  1D4M 2;  1JOD A;  5A3M A;  3MW2 A;  1UU6 A;  3MIG A;  1DLL A;  3PUA A;  4YFW A;  2RVA A;  3ZFF B;  3SKV A;  1OFS A;  2OQ6 A;  1ZRF A;  2VZS A;  1W90 A;  4CDQ B;  3I54 A;  1Z7S 3;  3VDD C;  1H2K A;  1ULE A;  2RS3 2;  4QB6 A;  2CDO A;  1BK0 A;  1XOY A;  4AGV A;  2IZW A;  1ULF A;  2O8Q A;  1U5Z A;  5BNN B;  2BVB A;  2A7A A;  4EZH A;  5A3T A;  4R4Z A;  1JS9 A;  1VMF A;  1W04 A;  3MF6 A;  1HRV 2;  3GHM A;  4F7Z A;  1REF A;  5B4X A;  1OD5 A;  3I2I A;  4IGQ A;  1AX2 A;  2EXH A;  4MV2 A;  1HXS 2;  4JGZ B;  4YVS B;  2VMC A;  2BGC A;  2BNN A;  2CYF A;  2WNO A;  4OHX A;  1NT0 A;  1JYI A;  5GLW A;  4BZ4 A;  1AHS A;  1ZBE 1;  2VQ0 A;  4B8E A;  5D8A C;  5ABJ C;  1JU4 A;  1SPP A;  2A70 A;  2WN3 A;  4C8D A;  1QQP 3;  4Q0V A;  4K8R B;  4DXS A;  5IJR A;  3ACI A;  3WF4 A;  4PI0 A;  1LOA A;  3RZK A;  3LOB A;  4Q4Y 1;  4UT5 A;  2H6C A;  4ISR A;  3VDD B;  1DBN A;  2VMH A;  3D8C A;  4LKS A;  4NOT A;  3K75 B;  4NIH A;  5JCT A;  1CN1 A;  1JI6 A;  2ENR A;  4RD7 A;  1G7Y A;  1C5I A;  3N9N A;  3JUU A;  4PI2 A;  4P14 A;  5GAL A;  5C3R A;  3FHQ A;  1JYV A;  3QH7 A;  3RWK X;  1VLN A;  1RUC 1;  2ZX4 A;  1IPJ A;  1POV 1;  1GZC A;  5KHG A;  2P6C A;  4DY5 A;  4P9W A;  1NCQ A;  1AX0 A;  3ENR A;  3WCS A;  2Y26 A;  4Y1Y A;  3PVN A;  3DGT A;  1UU4 A;  2E33 A;  1VRH 2;  5FZB A;  1AXZ A;  4C0H A;  1F5J A;  1LOG A;  4QT6 A;  1OA2 A;  1AYN 3;  3SCH A;  2WZR 2;  2ZGO A;  4P9Y A;  1A8M A;  4DQA A;  4IV1 A;  3NQH A;  4E8D A;  2VZP A;  4LKD A;  2DU0 A;  5FY7 A;  1BEV 1;  1UYZ A;  1FV3 A;  1W8N A;  3AK0 A;  4LXL A;  2QE3 A;  4XUR A;  5AVP A;  3RJ2 X;  4NIG A;  2BWC A;  4D7S A;  1PVC 1;  1K5M A;  4R9A A;  3O1P A;  1W6O A;  2VBP A;  5AC9 2;  2XBO 1;  2RR1 3;  1MEC 3;  2WNV A;  1X82 A;  4JDO A;  2OUH A;  3VDA A;  1KEX A;  1UL9 A;  4LHS A;  3OPZ A;  2RS1 2;  2X8K A;  2A1X A;  2ZOE B;  3O1U A;  1FYU A;  2SBA A;  2UYB A;  3H3L A;  5F8P A;  2GU9 A;  1XND A;  4N7I A;  3THD A;  1DQ1 A;  3IZO A;  5FZ1 A;  2FHR A;  1YLL A;  5FZO B;  3ON7 A;  5EJ1 B;  4YW5 A;  2K2S A;  4FSJ A;  5LW9 A;  2ZHN A;  2HEY F;  4FVV A;  4AGG A;  4R9D A;  1D2Q A;  1Q3E A;  1WME A;  1UZY A;  4K40 A;  3UL2 A;  1DGR N;  1OH3 A;  1XSR A;  3K51 A;  3O7O A;  3WP4 A;  3WVJ A;  4RGG A;  2XUM A;  4N8M A;  1AR6 2;  2FDJ A;  1O8S A;  1VAL A;  1WKY A;  1FPN 3;  2IVI B;  4URT A;  4OYU A;  4WM7 B;  2XHN A;  5A7N A;  4AW7 A;  4A7Z A;  2WT2 A;  2W87 A;  2OXB A;  3H0O A;  1XPW A;  2W91 A;  2R1D A;  2WKK A;  3ZFG C;  1EV1 3;  4KWJ A;  2Q1M A;  1CGP A;  2CGP A;  2DFC A;  2DVG A;  4AVS A;  3JBG 3;  1OSG A;  5GLT A;  3Q8B A;  3OEA A;  3WT3 A;  4M00 A;  2BER A;  4RS5 A;  5JI9 A;  3MGU A;  1CAW A;  2PQS A;  3URF A;  3OB8 A;  3WP3 A;  4BQ1 A;  1B35 C;  2Q4S A;  2VU9 A;  2WZR 3;  3AFG A;  4QB1 A;  4S2H A;  5GZE A;  4P9X A;  5EIY B;  1WW6 A;  4OMD A;  4QU1 A;  4AGR A;  3B9C A;  3TBD A;  1OMI A;  4UFK A;  1QWR A;  1JUI A;  3IM0 A;  5FKC A;  3SNM A;  1GAN A;  4CCO A;  1COV 1;  4QDS A;  5GZC A;  2LRO A;  5D8A A;  3DUI A;  4BWO A;  2A3X A;  3FL7 A;  4XUT A;  1PVC 2;  4Q1R A;  4QKN A;  4BPZ A;  1VRH 1;  2ZGS A;  1YFY A;  4AL9 A;  1E5H A;  2WWS A;  1VBD 2;  3AKT A;  5CKM A;  4NWV A;  1RUC 3;  2B42 B;  1UW8 A;  5A32 A;  3S5A A;  1JH5 A;  5DDJ 2;  3LZZ A;  3B02 A;  3GJB A;  3J8F 3;  2K0G A;  3M3E A;  1GSL A;  2YRO A;  4W6Y A;  3JQX A;  2GH2 A;  4XCB A;  2RMU 3;  2G9F A;  2UYA A;  4Y1U A;  1RB8 G;  2WFF 2;  3H8X A;  2J7M A;  5FZ7 A;  3KS7 A;  5K0U A;  4Q4Y 2;  4XFG A;  4KBB A;  4MZU A;  1YIF A;  1KJR A;  4AEK A;  2WLQ A;  4RS5 B;  3LEM A;  2VOK A;  3TEZ A;  1UF2 C;  1PO2 3;  2A3Y A;  5FPV A;  1GQG A;  4JKL A;  4YG3 A;  1UPI A;  4I3P A;  4UWD A;  4LJH A;  3POY A;  2R07 3;  4LO6 B;  5A33 A;  5LAT A;  1S0E A;  5IK5 A;  4BME A;  3O5S A;  1DYO A;  4LK6 A;  2IFR A;  5F39 A;  5EQU A;  4PIZ A;  4Y24 A;  1JOJ A;  1V9U 1;  2WO1 A;  2C24 A;  4WM7 A;  5FBJ A;  3RYK A;  3ZKY A;  4MO3 M;  1HB4 A;  2ERF A;  2Y60 A;  2ZGU A;  3AZZ A;  3I59 A;  4HVO A;  2WIN B;  1COV 3;  2VCA A;  1GYK A;  2Q1Z B;  3HPN A;  4J6G A;  3AP5 A;  4ONU A;  5ANQ A;  4FXK B;  3LA2 A;  4EN7 B;  1VAK A;  3UKV A;  1GR3 A;  4FO9 A;  2RR1 2;  1DQ6 A;  1HDK A;  3JCI A;  4XF3 A;  4CEY B;  3U78 A;  2EID A;  3KHB A;  3WHT A;  1UKR A;  1FT9 A;  5APA A;  5FZ8 A;  4X8P A;  4D0Q A;  2TUN A;  4IEX A;  1UCX A;  3AYA A;  3KGL A;  4FFI A;  1YHF A;  4QHB A;  4XTP A;  4P00 B;  1VBC 1;  3WW4 A;  2WUH A;  1UXX X;  1WMX A;  4YSF A;  2B9V A;  4TLG A;  2E31 A;  5FBZ A;  4EN0 A;  5C6C A;  1FNZ A;  1YI9 A;  1BKZ A;  2JDZ A;  4UAP A;  2A71 A;  5FO7 B;  4UFM A;  3UT0 A;  3SMH A;  4IGP A;  4QX5 A;  2V09 A;  4BA6 A;  4E4Z A;  5ACA 2;  4XPV A;  1IPK A;  4J25 A;  3MFC A;  3PU8 A;  1EV1 1;  2P3J A;  4P02 B;  3SCF A;  2VM9 A;  4QXB A;  5FMC A;  4CYD A;  2JKX A;  2P4E A;  1ZZC A;  2BVV A;  4MXV A;  4MXW A;  3WP5 A;  3FN9 A;  4HVQ A;  2H0B A;  4KG8 A;  3PDQ A;  2Q0A A;  3ACH A;  2B5H A;  4OUE A;  2CTV A;  4IE5 A;  4PF5 A;  3I8T A;  4UW5 A;  5T5J A;  5JIU A;  2CWM A;  3WOG A;  5C9A B;  4N90 A;  1W2T A;  1PX3 A;  1O3S A;  2PHF A;  2BDR A;  4ZHN A;  2PYT A;  5I0U A;  4BM8 A;  3K4A A;  4DMI A;  4QX7 A;  1FOD 1;  2TNF A;  4ZKT B;  4IXL A;  5CAD A;  4FFH A;  2IXI A;  1COV 2;  5T5P A;  3L2Y A;  3QBQ A;  3POI A;  1CWP A;  1J83 A;  4L97 A;  5DAX A;  1H2M A;  4GMP 3;  1DQ4 A;  3O1R A;  1CZV A;  2JDU A;  1QH6 A;  3OYW B;  4PT6 A;  1CX1 A;  4XJW A;  5JMC A;  1EAH 1;  3T1L A;  4LO7 A;  1MS9 A;  5C3S A;  1V6L A;  1DFQ A;  1D4M 3;  2FBE A;  2R0F A;  2JEN A;  2WS9 2;  5J36 A;  1BVP 1;  2W39 A;  5IUQ A;  2QNK A;  2ZKN A;  2IXL A;  2XBO 3;  4B7K A;  1LCL A;  2EIB A;  4B4P A;  4D8M A;  1CJD A;  4P9I A;  5A3W A;  4JAA A;  3APB A;  4KGG A;  4IND A;  5FZ3 A;  1NE4 A;  2Y38 A;  4K8F A;  1HQN A;  3RRD A;  1W6P B;  1W3V A;  1WMD A;  4YVS A;  3KQ4 B;  4COY A;  5A1L A;  5FOJ B;  1IG3 A;  5FZD A;  3OGS A;  3C7H A;  1CZS A;  2DVB A;  2RJ2 A;  1AYN 1;  4N43 A;  5FMO S;  2EIC A;  3AMP A;  4D94 A;  5LEJ A;  2A6W A;  3OUH A;  1JMU B;  1V6J A;  4IW3 A;  4RQP A;  4EWA A;  4TXW A;  2HLE A;  5KHI A;  3WV6 A;  3WNL A;  5GJ6 A;  4NR1 A;  4DS0 A;  2XBO 2;  3MIC A;  3U11 A;  2DTY A;  4LR4 A;  3LA3 A;  2WL1 A;  3VBR B;  1JZ4 A;  1NZI A;  5FMD A;  1PNG A;  1NQD A;  1RTV A;  2J1R A;  2VCM A;  3AP6 A;  3BOP A;  4HAN A;  2EIG A;  1KRI A;  2W68 A;  2ZAA A;  1V0A A;  2B8M A;  1BLZ A;  2W95 A;  1C8M 3;  4UFJ A;  4GKX A;  4ZZ5 A;  5GZD A;  5FUP A;  5J09 A;  2W0X A;  2BGP A;  3N7M A;  4ARY A;  4AEM A;  1BZW A;  4DFS A;  1ZRE A;  3N35 A;  2Q30 A;  4EYU A;  1DF0 A;  4IV3 A;  4MGK E;  5JOX A;  1W6P A;  1LEM A;  1RXG A;  1F31 A;  3JXS A;  1OOP A;  1JZ5 A;  1BEV 2;  5FY5 A;  2JEM A;  1QOO A;  4PF1 A;  1QOS A;  3L2H A;  4PCR A;  4XUQ A;  3LEK A;  3ACF A;  1QGL A;  3BB6 A;  4EV0 A;  2QBX A;  2JG9 B;  3VBU B;  3VBS B;  1BBT 1;  5EP9 A;  3ZFG A;  2R04 3;  3P3P A;  3ZFG B;  2VUJ A;  4X6Q B;  5LK5 A;  3PUI A;  2VME A;  3AKR A;  4LE3 A;  3M3O A;  4I0W B;  4LO8 A;  4KQ7 A;  3VBO C;  1RUF 3;  3I3E A;  1TE1 B;  1W8T A;  2PAK A;  3ABZ A;  3JB4 C;  4LBQ A;  5FPL A;  3GZU C;  3KM5 A;  4AQ2 A;  4JKM A;  1B35 B;  5KWR A;  1WA4 A;  3K4D A;  2JE7 A;  4XVH A;  3CBN A;  5CEH A;  1RJ8 A;  1US3 A;  2GP3 A;  1CQ9 A;  3AL6 A;  3WF0 A;  4LIU A;  4P9L A;  2QQW A;  4O7X A;  3KB5 A;  4L0P A;  1Y4W A;  3JU9 A;  1POQ A;  4GH4 B;  1GMM A;  1VIW B;  4RHV 1;  1KS5 A;  4WM8 B;  3C8X A;  4ZU4 A;  4FOV A;  5T5O A;  4AZZ A;  1XNT A;  3U10 A;  3N7J A;  3K4Z A;  3N36 A;  1ODM A;  3WF1 A;  1V6I A;  4BYY A;  3NAP C;  5LAS A;  4XXA A;  4YGB A;  1XJA A;  4ZON A;  1W9F A;  2AYH A;  4GWI A;  2XLF A;  1WCU A;  4A6O A;  1W6N A;  4CRQ A;  2R07 1;  1GNY A;  4CCN A;  3MW3 A;  4QHO A;  3ETP A;  4CU8 A;  4ZZ8 A;  1RMU 1;  5FYM A;  1UD1 A;  1UY3 A;  4QQ2 A;  2YBK A;  1CAX B;  4TSV A;  1AYN 2;  4YVS C;  5FZO A;  1OUR A;  1C8N A;  3EXU A;  3RVH A;  5FZC A;  5IK7 A;  4AAX A;  1QXP A;  1YC6 1;  2JDP A;  2D3S A;  5FWE A;  1CPN A;  2BOI A;  2F4P A;  3A0K A;  5KXE A;  1UMI A;  4J1X A;  3WDU A;  1W6M B;  1W03 A;  3NNG A;  1EUT A;  3FJS A;  3FFQ A;  2GC3 A;  5BNP A;  3FBM A;  3PTY A;  2Q8C A;  2K46 A;  4BE3 A;  1TQ5 A;  4Q8L A;  4B4Q A;  4XIO A;  1LEN A;  5FXZ A;  2C1F A;  4YVW C;  3LKJ A;  2EIE A;  3LFI A;  4NWW A;  1VRH 3;  2CNA A;  5C8W A;  1OVP A;  3H7J A;  5HCF A;  1MEC 1;  5KXC A;  4CEW C;  1QJU 2;  1U5Y A;  2EAL A;  5I93 A;  1AVB A;  2PQQ A;  2ARX A;  3N9Q A;  4ZU7 A;  2KD7 A;  2C5D A;  3GM8 A;  4CPB D;  3VBF C;  1SAC A;  5F1R A;  5JUV A;  1BEV 3;  5H9R A;  4EWE A;  1AYM 3;  3VBO B;  5JZG C;  1SBD A;  2OX0 A;  3CJI B;  1L7R A;  2F6B A;  2NPI A;  1PX4 A;  2EVX A;  5FUN A;  1H4H A;  4F8A A;  2XJP A;  3BAL A;  2YU1 A;  2ZJC A;  3C3V A;  2ZMN A;  1CON A;  4YW6 A;  4BIF A;  1RUI 1;  2ZEX A;  5FFO C;  5IYY A;  2VCC A;  3RZH A;  1WBL A;  4TLF A;  2R30 A;  4JRL A;  1O3R A;  2RS3 3;  1OA3 A;  3Q8F A;  2ZGR A;  5JLV A;  3K2O A;  1AF9 A;  3AMN A;  4CDW B;  1HB2 A;  3P3N A;  4DUW A;  4CCM A;  3LB9 A;  5LCW L;  2VUL A;  5D8A B;  2WLP A;  2VXJ A;  1AR7 1;  1AR6 1;  2VW2 A;  2W47 A;  3I97 A;  4RS5 C;  2WNU B;  3QH6 A;  3OD4 A;  1N1Y A;  2F17 A;  2XVG A;  5FPU A;  2V5Y A;  5LZ6 A;  1W28 A;  1GZW B;  1Y9G A;  1QQP 1;  4XZP A;  1FOD 3;  2P37 A;  4ASL A;  4D69 A;  5BNN A;  4UF0 A;  3FFZ A;  5J96 B;  5CB7 A;  2J1E A;  2XH6 A;  4Y20 A;  4LKF A;  3VZJ A;  1SMV A;  1YXW A;  5CFD B;  2RM2 2;  1NCR B;  1O8P A;  3MO4 A;  4NO4 A;  4UYB A;  2D6P A;  3B3Q E;  3VHR A;  1GU3 A;  2OS2 A;  4WZC A;  1VBD 3;  1G6N A;  1NQJ A;  1QKQ A;  3ZYR A;  5HBA A;  2WFP A;  4ZS2 A;  4AFD A;  3ZDS A;  2QCS B;  4GA9 A;  2E9Q A;  5DG2 A;  1OVS A;  1LOF C;  4K7J A;  2VMG A;  1XYP A;  2BFU L;  4LBO A;  3K46 A;  1WCK A;  3UYJ A;  4AI9 A;  2RHP A;  3ALQ A;  2Z2S B;  2J1A A;  3OEB A;  2PHD A;  5FR3 A;  1MR5 A;  1UX7 A;  5IVV A;  2UWC A;  1VAM A;  5IK4 A;  3I59 B;  3NJZ A;  4LTA A;  4LOS A;  3AP9 A;  2J42 A;  2KR2 A;  4MHU A;  2VC9 A;  4NHY A;  2DTW A;  2P3I A;  4BLJ A;  1Y43 B;  2WBK A;  3UGF A;  1DGL A;  4U2A A;  3JQW A;  4N53 C;  5FTT C;  5JDB A;  1SG3 A;  2ZGM A;  4RGA A;  5FY9 A;  1LHV A;  1TME 2;  3CZJ A;  4H55 A;  2Z5W A;  4XFB A;  2DUQ A;  3A23 A;  3SH3 A;  3H3Z A;  4B29 A;  3H8R A;  3OUJ A;  4CE8 A;  3GCX A;  1WLD A;  4P08 A;  4WVZ A;  3MBW A;  5I0S A;  1RC6 A;  3ASI A;  3WNK A;  2JWP A;  3V0A A;  4PIX A;  2HWF 3;  5FO8 B;  3HOB A;  4FFF A;  5ACA 3;  1KFU L;  2CGO A;  1K5M B;  2ZGP A;  2VVF A;  5JWP A;  4W4Z A;  2EXI A;  4MOA A;  2VD7 A;  4HBN A;  4CCD A;  4M3C A;  2RM2 3;  1LOB A;  1C1L A;  3MV0 1;  4XZU G;  2AEN A;  1GLH A;  1UZ0 A;  5DDJ 1;  1FNY A;  3INA A;  2E63 A;  5A7Q A;  2XJS A;  3HT2 A;  3V65 A;  3DL3 A;  1QJU 1;  5L36 A;  3SC7 X;  4FPE A;  4OZO A;  4AK3 A;  3ELN A;  1Q8Q A;  3GZE A;  4QXK A;  3WNM A;  5FOB B;  2VOV A;  3DXT A;  4XET A;  5FRE A;  3HN3 A;  3P1I A;  1J1T A;  2V4V A;  3AYE A;  3VKN A;  1AL2 1;  2GC0 A;  4JQR A;  4LQR A;  3T2P A;  2D7F A;  2RMU 1;  3J7N A;  4MGS A;  3A4U A;  4ZXE A;  2WQZ C;  3DEC A;  1JBC A;  1HN1 A;  1MEC 2;  2TEP A;  3IB3 A;  4LHN A;  4AI1 A;  1O4Z A;  2JB8 A;  2XML A;  5T50 A;  1ENX A;  4IV3 B;  2WO2 A;  1Z7S 1;  2WO3 A;  5F7U A;  3NWK A;  2V4A A;  3H1M A;  1V6K A;  4YNI A;  3AVR A;  4R52 A;  1XC6 A;  3FHI B;  2VZ1 A;  1EYB A;  1PIV 3;  2VPV A;  3IBM A;  2ZAH A;  3BTZ A;  1QJY 2;  1X9T A;  3CJI A;  3U0Z A;  2WA3 A;  4A2U A;  4XAA A;  2HWC 2;  2VQA A;  2LTN A;  1KDK A;  5KR7 A;  2QJV A;  1MVQ A;  5D21 A;  2JDN A;  1W8W A;  4A7Y A;  5EYY A;  4YPJ A;  2DUO A;  5FP3 A;  5L7O A;  2MPF A;  1HRI 1;  4QXH A;  2CDP A;  3UKT A;  4JDM A;  4MVT A;  4QAW A;  2OPW A;  2XKP A;  3D5O A;  2VVD A;  4JHT A;  3ZFE C;  1UN1 A;  2LM3 A;  2V73 A;  4C1W A;  1PVX A;  4Y20 B;  3PJY A;  2W08 A;  4P9J A;  2DWR A;  2WNV B;  4YG6 A;  3S6P A;  4CCJ A;  1YRZ A;  5KC6 A;  5FQ0 B;  3BUC A;  2IXH A;  3ZPY A;  1FAY A;  4YLZ A;  1WZX A;  2FMD A;  1YJL A;  2YFU A;  5FZL A;  3LOI A;  4MAD A;  3KZ4 C;  1R1Z A;  4DXZ A;  5CYY A;  5FZ9 A;  5HXV A;  4S2D A;  1PIV 1;  4DXT A;  5LY1 A;  3H1W A;  3ZN6 A;  1IKQ A;  1MZE A;  2OQ7 A;  5IAX A;  5I8T A;  4AI0 A;  5BNO C;  3NJX A;  4QDR A;  1STM A;  3H42 B;  2PMW B;  2H6B A;  4FPH A;  2JDK A;  2Y6K A;  3WDX A;  4Q5O A;  1H2L A;  1GWL A;  4Y22 B;  4Z82 A;  1ZZ6 A;  3RI8 A;  5JI7 A;  3LFM A;  4LBQ B;  4COW A;  2JG8 C;  2IFW A;  3Q9O A;  4QQO A;  1ASJ 3;  1PM7 A;  3FC0 A;  1OD3 A;  1W6O B;  2XLG A;  2ARB A;  5FYT A;  1QJY 3;  2VG9 A;  2YPD A;  1F15 A;  4KWK A;  2HWB 2;  3AP4 A;  3K48 A;  5DUU A;  2VVE A;  4GKY A;  4GB3 1;  3TB0 A;  3JBG 2;  2WZ8 A;  3GAL A;  3THC A;  2JX9 A;  2YUE A;  1ND3 B;  1EV1 2;  5JXH A;  5A7W A;  2AR6 A;  4XDQ A;  1G9D A;  2B46 X;  1OHF A;  2R06 2;  2D44 A;  4LE4 A;  1VRB A;  2CY6 A;  3GBW A;  4IEU A;  4HKO A;  4WBB A;  4HPK A;  2Z4F A;  2WT1 A;  3J9S A;  4CCC A;  1AR6 3;  4AEJ A;  5LBF A;  3WHU A;  3VD4 A;  4LPL A;  4UBH A;  3VZL A;  3WLU A;  4QPY A;  4AI8 A;  4JQT A;  3AYC A;  3DKQ A;  5JR7 B;  4YRD A;  3IAQ A;  3O0W A;  4NUB A;  5AVA A;  3WG2 A;  3POJ A;  4KH9 A;  4BB3 A;  4UBG A;  5EJ3 A;  3USU B;  2ZML A;  1HJG A;  4XOG A;  1YYN A;  3FMG A;  3RI9 A;  1X9P A;  2HJI A;  2ZTN A;  5FYZ A;  1HLC A;  5JIA A;  4CA9 A;  2Y0I A;  1KDM A;  3GYD A;  3NMB A;  2LS6 A;  4HN1 A;  1OC1 A;  3BTX A;  1OLQ A;  4NPM A;  1U0A A;  1RUI 3;  2HBU A;  5EXO A;  1QJZ A;  1KD7 A;  5HXM A;  4URA A;  4LOT A;  1F8V A;  1S0C A;  3RG0 A;  4AFC A;  1Q43 A;  3WQ7 A;  5AC9 3;  1Q8O A;  2B9U A;  2NLR A;  2PHT A;  1AUY A;  2J1V A;  1F9K A;  5IVC A;  1V6N A;  1L3J A;  2OW4 A;  4YM3 A;  1FXZ A;  1RUJ 2;  4FXG B;  1URX A;  2AUY A;  1W9W A;  1WMF A;  5EYX A;  1ZBE 3;  5FZA A;  1QJY 1;  1ZVF A;  2P6H A;  3OBR A;  4XIL A;  1ASJ 1;  3NRU A;  1EAH 3;  1PMJ X;  4OLL A;  4QPI C;  1QF3 A;  4XDP A;  3E1F 1;  4FBF A;  3O0V A;  2MEV 3;  1NAE A;  2VUD A;  2WII B;  4YM0 A;  3H3U A;  1W2N A;  2GC1 A;  4NPL A;  4N53 B;  4HN0 A;  2OII A;  2JD9 A;  1W9T A;  2VNO A;  4B1M A;  1G9C A;  5C3Q A;  2HKX A;  2BU9 A;  3TEY A;  2V5D A;  4ZY9 A;  1WLW A;  3ZMO A;  3POW A;  2ZGT A;  3ATG A;  1H9W A;  4GH4 C;  5DN2 A;  5C8C A;  1EAH 2;  4CCL A;  4PDW C;  2KXL A;  5JSO A;  1G9F A;  4GWN A;  1WW7 A;  3EMR A;  1UWW A;  1Y9Q A;  4CUB A;  1MQT B;  2Y6L A;  2XON A;  4PIY A;  3WDV A;  4BIO A;  5F5Q A;  1GZW A;  3JD7 1;  3BKZ A;  1YQ8 A;  2IWG B;  2WNU A;  1FV2 A;  4O61 A;  5FZK A;  3VZN A;  3KT1 A;  1QU0 A;  5F2S A;  1TG7 A;  3KVA A;  4ATF A;  1RIN A;  3FZ3 A;  2NP0 A;  3FUO A;  4AI3 A;  4UFI A;  4DEV A;  1W99 A;  2MHF A;  2GME A;  1LED A;  3NKG A;  1IPS A;  1ST8 A;  2ORX A;  3LWC A;  4CEW A;  1GP6 A;  3KD4 A;  2RJK A;  3J26 N;  3WNN A;  4YZ2 A;  4OHY A;  2XJV A;  1LR5 A;  2RDR A;  2ZEZ A;  1WCQ A;  3I2D A;  3PJQ A;  4AVT A;  4P5H A;  1CAU A;  2W1Q A;  3IMM A;  1C5H A;  4O9E A;  3RWN A;  2W1W A;  3DXU A;  1DQ5 A;  4UW4 A;  2NMO A;  1XNC A;  5IVY A;  2OUJ A;  4A41 A;  5DAV A;  3ZXG A;  4Q4W 1;  2O0O A;  3VBR A;  4QKF A;  1QXJ A;  1SCR A;  3AKQ A;  1UU5 A;  3MEP A;  5I0T A;  5FK8 A;  4GQ7 A;  3A21 A;  1MQT A;  3O1S A;  3AL5 A;  2FCV A;  3OF1 A;  4AQ6 A;  3RNS A;  3FLT A;  1AL2 3;  4XIK A;  4CCE A;  3NV3 A;  4UW3 A;  5CFD A;  1F2N A;  2DUR A;  2FCT A;  3WCR A;  3AKP A;  3AJZ A;  1QJU 3;  4A3Z A;  1Q8V A;  3KWV A;  1T2X A;  4UF0 B;  1W9Y A;  4XW3 A;  4DOU A;  4LNV A;  1O4T A;  1TNF A;  5G05 L;  1LJ7 A;  2RM2 1;  1V6O A;  3TN9 1;  3OGR A;  3L9J T;  1F5F A;  4FT8 A;  1HRV 1;  5AC9 1;  1JZ3 A;  1LU1 A;  3I2J A;  3N7K A;  1AL0 G;  5J7M A;  5K0U C;  3MID A;  4Y26 A;  1A6C A;  3VKO A;  2JDY A;  1HKD A;  2FDH A;  4FAH A;  2A75 A;  2R16 A;  4D7T A;  1S0B A;  2C0Z A;  4Q4X 2;  1OF4 A;  2ADE A;  1E5I A;  1I9R A;  2W92 A;  2XPJ A;  4GUL A;  4AYU A;  4J1W A;  1UYY A;  1NY7 1;  3D3A A;  4LUM A;  1LOC A;  1OBN A;  1IQA A;  1S0J A;  5CA6 A;  4BQY A;  5K9Y A;  2ZAC A;  2DVD A;  4QGL A;  4OUL A;  2YG0 A;  5BV6 A;  3W21 A;  4RHV 3;  1L7L A;  2VCB A;  2ZXQ A;  2NQY A;  5FP9 A;  1H8T B;  4PBO A;  3WD5 A;  2DCK A;  1UOJ A;  3ETQ A;  2UWB A;  1OXC A;  4RFT 0;  4ARX A;  5FPA A;  4JGY B;  5F6K A;  1T6G C;  1XNA A;  4OI2 A;  3ZDV A;  2HWD 3;  2A6Y A;  4CDX C;  3WUC A;  1J3Q A;  2WFF 1;  3M3I A;  1AZD A;  5LBC A;  3VHO A;  1NKG A;  1Q56 A;  1RUF 1;  2JIG A;  3JBG 1;  1OFN A;  4NRQ A;  2YV8 A;  4QX1 A;  3SXW A;  3KV4 A;  4OI0 A;  2RS1 3;  4I3G A;  3WDT A;  3K77 A;  1JYW A;  3JB8 A;  1KXG A;  3QCW A;  2B4K A;  5FZ0 A;  3VGI A;  2W94 A;  2D97 A;  4XJA A;  5IVF A;  4CU7 A;  4FQ4 A;  4RFR B;  3WW1 A;  4KU8 A;  4M0H A;  1GZT A;  2Y34 A;  2DF7 A;  1LGC A;  1VBA 1;  1W6M A;  2BBA A;  2E51 A;  2OA2 A;  3KMH A;  3PIG A;  4CZS A;  2EAK A;  4OUS A;  2JG9 A;  2ZGL A;  4HXC A;  4O9G A;  1ULG A;  1J58 A;  3SEP A;  3WP6 A;  2JEC A;  1LEC A;  1S1A A;  3FUQ A;  1VBE 2;  1L7Q A;  1CPM A;  5FK7 A;  3J8F 2;  4GAZ A;  1S2B A;  4K6B A;  4K1Z A;  4RQP C;  2DFB A;  3RMY A;  4BQ5 A;  5CFC B;  1DP0 A;  2FDI A;  4ISQ A;  2ZZJ A;  1G8W A;  2ZBJ A;  3HR9 A;  3NAP A;  1C8M 1;  2OT7 A;  1K3I A;  2JIC A;  5LRS A;  1JW6 A;  4YZ4 A;  4Z1V A;  1R1A 1;  3ZXL A;  4DEQ A;  5FZG A;  5IWF A;  1JTZ X;  1VPH A;  3DKW A;  1QIQ A;  5L7O C;  4IES A;  2X53 S;  2HWC 1;  4FP3 A;  5E8A A;  3ZR5 A;  2D6K A;  2VZT A;  1NOV A;  4D6Q A;  4YAR A;  1OF3 A;  5A6Z A;  3POF A;  2BYV E;  4R4X A;  1RUE 2;  2VAU A;  3VZK A;  4CDX B;  3HQX A;  4XMA A;  3VBR C;  4JRA A;  3ZFF A;  5F6L B;  1GNZ A;  2VZO A;  5FY1 A;  2OYZ A;  2XGX A;  5BPX A;  4XFA A;  1O5U A;  2XJT A;  3RYP A;  1AR9 3;  4DIN B;  1HB1 A;  2Q8E A;  2YPJ A;  2GZW A;  3AB0 A;  4NID A;  1MZ6 A;  2CGN A;  4XAC A;  4IL7 A;  3T2T A;  3S30 A;  4HFS A;  4N43 B;  5FMB A;  1AL2 2;  1HRV 3;  1F4H A;  4IE0 A;  5LRR A;  4BCU A;  4V1P A;  2VOW A;  3LDR A;  4I01 A;  4CCK A;  1RMU 2;  5GM0 A;  3IWZ A;  4HPK B;  4AHY A;  2RS5 3;  5A7W B;  1HJF A;  2VQU A;  5F9T A;  2Q8O A;  2R07 2;  2W52 A;  3LDK A;  3QLQ A;  2Y33 A;  2QDR A;  3UJO A;  4AVB A;  5KHJ A;  5FZF A;  1OKO A;  4FPY A;  1C4R A;  4XQW A;  1PO1 1;  2BBV A;  4A6S A;  3GJA A;  2Y6J A;  5GZF A;  1ULD A;  1BBT 2;  4LO5 B;  3DPR B;  1ACC A;  4FPO B;  3PUS A;  2PHU A;  3C7F A;  3HT1 A;  4QPI B;  1JYX A;  2XL7 A;  2Q1F A;  5DMY A;  1YQ5 A;  3UGG A;  3T0D A;  3GNE A;  5ACA 1;  1LHW A;  3KV6 A;  4XE9 A;  1CAV B;  2L9L A;  1FMD 2;  4H7L A;  3ECQ A;  1NG0 A;  5F3I A;  3UKN A;  4IV3 C;  5C9A A;  4CSW A;  1NY7 2;  3B9I A;  5I0R A;  5SV5 A;  1GIC A;  4FPL A;  1RUC 2;  4K20 A;  4AXO A;  1RL3 A;  2TBV A;  2Y6G A;  5BNO A;  2ZKL A;  2EXJ A;  1HX6 A;  4QPI A;  3VHN A;  2D6N A;  3Q8C A;  2OPK A;  3ILR A;  1MQT C;  4DRV A;  2I45 A;  4I2O A;  3SCG A;  3MHZ A;  4KWU A;  4WM8 C;  5IVB A;  4FOQ A;  3WNO A;  1C1F A;  4IEP A;  4CP1 A;  3QD6 A;  5DZG A;  1H6X A;  1RIR A;  2P3Y A;  3T3Y A;  3GCW A;  4UOJ A;  5DUX A;  1OT5 A;  3I2K A;  4XFC A;  1DU3 D;  3NL1 A;  1V70 A;  1ONA A;  3R4U A;  4K3U A;  1IS3 A;  4RGK A;  3KT7 A;  3THT A;  3ZIX A;  4C1X A;  3BU7 A;  1ZBE 2;  1H1M A;  2VQT A;  2YZ4 A;  4HET A;  2YYO A;  3ILN A;  5FP4 A;  4E2Q A;  4LT5 A;  3WQB A;  1W2O A;  1PK6 B;  1SHW B;  3IT8 A;  3MYX A;  2V72 A;  4OHV A;  4E9K A;  2B7Y A;  3I49 A;  1DDL A;  4FTS A;  2Y0O A;  1QNW A;  5IVJ A;  5L9V A;  1X8M A;  1QQP 2;  3CMG A;  1RHI 3;  3R4D B;  1CJP A;  3VD9 A;  1NLR A;  1KGY A;  4GXL A;  1DZQ A;  2R1B A;  4Q4W 2;  3VBF A;  4AWD A;  1GWM A;  3I3M A;  1O6U A;  4KU7 A;  2ZS6 B;  2YC2 A;  1Q8P A;  3H50 A;  1KIT A;  2Q5T A;  2QQV A;  1W8Z A;  4CDQ A;  5CFC A;  2PEL A;  4FTB A;  5E89 A;  4P5Y A;  3T2O A;  4JTN A;  2P2K A;  1JOP A;  1ZA4 A;  4G4F A;  1YFX A;  3RZJ A;  1Q8S A;  2AEY A;  5FKB A;  3MW4 A;  3AVS A;  1O91 A;  1X50 A;  1UIK A;  3KQR A;  1CIY A;  4XF4 A;  3MFA A;  1K45 A;  1PO1 3;  4CP9 B;  1S55 A;  4CUA A;  1AR7 3;  1RUG 2;  4PQ9 A;  3W9A A;  1PO2 2;  2G4I A;  5K0U B;  2ZAB A;  2HEW F;  2PLV 1;  3N9M A;  4MET A;  1YJK A;  1B35 A;  1PGW 1;  3ZN5 A;  3FHA A;  4BQX A;  3LQC A;  3TYJ A;  3EO6 A;  1I3H A;  3MPB A;  2FZ1 A;  2D40 A;  5F32 A;  2D6O X;  3ZXJ A;  4B4R A;  1PZ7 A;  1R64 A;  1IG0 A;  1FI2 A;  1W0O A;  3OBZ A;  5DPN A;  2ATF A;  4CDU A;  4PLM A;  3PME A;  3ES1 A;  4HON A;  1FMD 3;  5BYN A;  2ZHM A;  5JPM B;  1PGL 1;  4OUM A;  4BDV B;  4MGI E;  2PHX A;  3ZXE A;  4HT1 T;  1ZBA 1;  1JYT A;  1SLT A;  1UQX A;  1NYW A;  1RUD 2;  1Z0H A;  2RS5 2;  2VNG A;  1ZRC A;  3LSE A;  2RMU 2;  3PL0 A;  3PUH A;  1OPO A;  1ZM1 A;  3CL1 A;  1RUF 2;  3HNB M;  3I4I A;  4GZ9 A;  3BYW A;  3AZV A;  5FXW A;  4WVW A;  1D0G A;  3AP7 A;  4XMI A;  5DQ0 A;  5ABJ A;  1LB2 A;  4XBL A;  4QPW A;  3ZSK A;  3WQ0 A;  3E6D A;  5KHK A;  4CXX A;  5GLU A;  3A7Q A;  4K9S A;  3MIB A;  4G9S B;  1R09 2;  3AZW A;  5JZG A;  1RYY A;  4COV A;  1JZ7 A;  4C91 A;  3DPR C;  5F37 A;  1GOG A;  1WUV A;  3NO8 A;  3I7D A;  3ZYP A;  3P5B A;  4GMP 1;  3V64 A;  5A6Q A;  3ZYH A;  5JOZ A;  3OGJ A;  4XFH A;  4HVR A;  4OQ8 A;  1JN2 P;  3WW3 A;  5FO9 B;  3ACG A;  1OQE A;  4PJY A;  1DGW X;  2GH8 A;  2VBD A;  2VR4 A;  4Q4X 1;  3TN9 2;  1EY2 A;  4AHX A;  5EWS A;  5JZG B;  4DUV A;  1XYN A;  5DZF A;  4Y4R A;  2P34 A;  2W5F A;  1JOB A;  2VE1 A;  1SZB A;  4AOC A;  5HV0 A;  2CV6 A;  2BEO A;  3KF3 A;  3ZFE B;  3ZM8 A;  1TMF 2;  2AAC A;  2FQP A;  4EN8 B;  4LBN A;  4F3J A;  2D6M A;  5BNO B;  5FWJ A;  3TAY A;  4B3N A;  5FV3 A;  2YBS A;  4TZD A;  4HSJ A;  2VTF A;  3ZMN A;  2BP6 A;  2QQO A;  1SLA A;  2N7G A;  1RHI 1;  1AR8 1;  1IOA A;  5H9P A;  1U5X A;  1CAX A;  2GNB A;  4CDW A;  3ZVX A;  4S2F A;  2WWJ A;  4XF9 A;  2WRA A;  3M3C A;  2HYX A;  3HBZ A;  2P3K A;  3VBH C;  5F5I A;  1H30 A;  2HWE 3;  2J1S A;  3WF3 A;  4QPG B;  2R06 1;  1PGS A;  2X09 A;  4LBM A;  4O65 A;  2XKO A;  4JKK A;  3LPG A;  1QJF A;  3R05 A;  3RZZ A;  4AVC A;  3OYW A;  4CUG A;  2G19 A;  5L19 A;  4YGE A;  4OHZ A;  3ZR6 A;  3AYD A;  2HWB 1;  2VZQ A;  5A6X A;  4XCA A;  3IPV B;  4LHL A;  4CP9 A;  1RUI 2;  2VNR A;  1NA1 C;  4LUK A;  1SBE A;  1J3R A;  4IV1 C;  5CKQ A;  4XTM A;  3ST7 A;  2WO7 A;  3X29 B;  5C5T A;  1YNA A;  2XUE A;  4A7K A;  3FWE A;  1XNK A;  1H1A A;  1V00 A;  1V6M A;  2BWA A;  2UUR A;  1RUD 1;  3C2U A;  3ZN4 A;  1W39 A;  2XJQ A;  4LO4 B;  3LIH A;  5CNA A;  5LA0 A;  1YQ6 A;  3VD5 A;  4KBZ A;  3MIF A;  1VP6 A;  2DU1 A;  3BOD A;  3N7L A;  5FY8 A;  3WG1 A;  2GND A;  4MXW B;  5IW0 A;  1PGL 2;  3G6J B;  3OBA A;  5IAT A;  1DIW A;  1ZRD A;  2PLV 2;  2ILM A;  1REE A;  2XVK A;  2XL9 A;  3B5L B;  3WZ1 A;  5KXB A;  1US2 A;  1K42 A;  3PVB B;  2ZGK A;  1ENS A;  5FLH A;  3ZYI B;  1ODN A;  4WM7 C;  1OLR A;  1J84 A;  1HQW A;  5FLJ A;  1BVV A;  4MG2 A;  2HWD 2;  2RV9 A;  3THP A;  2QFE A;  1W6Q A;  2PHR A;  2RDN A;  4Q0S A;  4CDX A;  1RXF A;  4AQT A;  4BMB A;  1LUL A;  3ZN6 B;  4A3X A;  1QH7 A;  3SQO A;  5E6H A;  1WLC A;  2J1T A;  2YBP A;  4XQD A;  5FZE A;  3GXU A;  5JXG A;  1JZ6 A;  5DAB A;  3MZH A;  1E57 A;  1QY4 A;  3IKW A;  4GJY A;  1W8U A;  2ARE A;  2W9X A;  1JZ2 A;  1ZX5 A;  1ASJ 2;  2BW8 A;  1SLC A;  3GZT B;  1W06 A;  4IEY A;  4MYE A;  1ND2 C;  3NNJ A;  5DUW A;  3H1Y A;  2R7E B;  3AMM A;  4DXR A;  1QDC A;  2RJL A;  2D98 A;  4JGZ A;  3W59 A;  5CVR A;  3MUY 1;  2H0V A;  2OZJ A;  3FBY A;  3HBK A;  1A34 A;  3R6S A;  1R09 3;  4Q0Q A;  2IXC A;  5L73 A;  3VN4 A;  1OPM A;  1PMH X;  1XYO A;  1W2A X;  5BNP B;  2OZ6 A;  3UES A;  3RZM A;  3AZY A;  1SLI A;  3H8O A;  5A7S A;  1H4G A;  5GZG A;  2ADD A;  1MZF A;  2PAM A;  3ZX7 A;  2I07 B;  2JDM A;  2XG3 A;  1O3T A;  4IEO A;  5A6Y A;  1DYK A;  3N9O A;  4IET A;  2DV9 A;  3E5X A;  4KI5 M;  5CU1 A;  4CEY C;  4CVU A;  1LAJ A;  3MIH A;  3ITQ A;  1M06 G;  2R49 A;  4JC1 A;  1VBB 2;  4PBP A;  5JOY A;  4XJU A;  5C7G A;  1W9S A;  1O3Q A;  1GV9 A;  1HW5 A;  3WIN E;  2PTM A;  1VBB 3;  3LEI A;  4COZ A;  1Z7S 2;  5K4L A;  4N43 C;  1XB9 A;  2SLI A;  1GP4 A;  2ZGQ A;  3RJR A;  1AR8 3;  5EZW A;  4B1L A;  5FY4 A;  2YXS A;  5I8Y A;  4YG0 A;  3M3Q A;  1MS4 A;  1LES A;  2YFZ A;  3BTA A;  4QQP A;  5CBL A;  2W1U A;  2VEC A;  4FAG A;  1JU3 A;  2WZE A;  1ENQ A;  3ME2 A;  4E2S A;  2WNU C;  1FPN 1;  3S7E A;  3DV8 A;  4ASK A;  5FPB A;  3AC0 A;  4GD4 A;  4NE9 A;  5A32 B;  4BHP A;  3WW2 A;  3RSJ A;  4IGO A;  3VBU A;  2Z79 A;  3ZKU A;  3K3O A;  4KWL A;  4JX0 A;  4FCA A;  4W50 A;  2GAU A;  3AXE A;  3D4K A;  3NV1 A;  3OGG A;  4XBN A;  4OCT A;  3J7L A;  5E1R A;  5KXD A;  4HL0 A;  3MPP G;  2YB7 A;  3ZYF A;  4GAL A;  4EZ4 A;  3ZIW A;  2PFW A;  1EP0 A;  2NYY A;  3RGB A;  1TVG A;  4QD2 A;  1A3K A;  3S0M A;  2ET7 A;  1YQ2 A;  1UYP A;  1FAT A;  2ETE A;  2CU5 A;  3V0A B;  1LNS A;  2I74 A;  1P8J A;  2GN3 A;  4YWA A;  2E6V A;  2RR1 1;  4WVM B;  2QUO A;  2GMP A;  5A80 A;  5AFB A;  5EV7 A;  4IE4 A;  1I1E A;  1RUO A;  2FMY A;  1PZ9 A;  2CWS A;  2G9G A;  4XC9 A;  1W8O A;  4Y5S A;  2E32 A;  4HKL A;  1O5L A;  5FYY A;  3T1M A;  2ZMK A;  1S0I A;  1WLT A;  1OOP B;  1W8H A;  3R0R A;  2XJU A;  5A3L A;  5A3N A;  1SLB A;  4HLT A;  2ZPX A;  4NHL A;  1EPZ A;  4LUL A;  2WJS A;  3WUD A;  1IS6 A;  2E7A A;  1LHU A;  1PIV 2;  2HWF 2;  2WNV C;  4LA2 A;  4QQL A;  4BH9 A;  4L2N A;  5JXI A;  1VJ2 A;  3S7I A;  2DCT A;  1UY4 A;  1R09 1;  4FQZ A;  3A0N A;  2EF6 A;  3B01 A;  2Z42 A;  1OA4 A;  5F5A A;  2QQN A;  5JR2 A;  5D2A A;  1QHD A;  4XDO A;  4XBQ A;  1NUK A;  4CXY A;  1JZ8 A;  2YC0 A;  1D4M 1;  2JG8 A;  5FZ6 A;  3KLS A;  4A45 A;  2BNM A;  2JDA A;  2IVJ A;  4CU6 A;  1YI7 A;  3OUI A;  1DHK B;  2QZ2 A;  3CQO A;  2PLV 3;  4QKB A;  3HAG A;  2PN5 A;  3OPT A;  4RA0 A;  1WCS A;  2A3W A;  3VKL A;  4F83 A;  5I0D A;  2VJX A;  5CIR A;  1KFX L;  1H9P A;  2Y6H A;  5JMO A;  1OLM A;  3GGL A;  4QKD A;  3PHM A;  1IQD C;  2DYC A;  2WZP P;  3GZA A;  4MGT A;  2Y8K A;  5GLZ A;  1GOF A;  4BQW A;  5JAX A;  4UFH A;  2DDU A;  3HNY M;  2VOT A;  2GAL A;  3DYM A;  5IT6 A;  1YQC A;  4DY3 A;  4JDN A;  1HV0 A;  4QU2 A;  2CAU A;  3HJR A;  4WVV A;  1RMU 3;  1QDO A;  2WA4 A;  4TWT A;  3U4S A;  4D7Y A;  3GDB A;  3E5U A;  4IV1 B;  1VMJ A;  2BUK A;  1WWY A;  2PXJ A;  4BQ3 A;  1ZBA 2;  4GWJ A;  1QOT A;  2VUA A;  3TNQ A;  1PMI A;  1NZC A;  3VB9 A;  5BY5 A;  2QQK A;  4JGY A;  4DPN A;  1DG6 A;  1CIW A;  1H2N A;  2YDE A;  1VAV A;  3ILF A;  3M2M A;  1ZZ8 A;  4ORF A;  2YU2 A;  4ERO A;  1OH4 A;  1NLQ A;  1S2E A;  3E5Q A;  1G9A A;  1W8F A;  4DB5 A;  3IDE A;  1BK1 A;  4RYD A;  5FDB A;  1NX9 A;  5LA9 A;  3LAG A;  3DPR A;  3U1X A;  3RZL A;  5FAX A;  1GOH A;  1TMF 3;  2DBN A;  1VBC 3;  5A3P A;  4AG4 A;  4TTG A;  4I30 A;  4DUX A;  2R04 2;  2EAA A;  1UY1 A;  1SDD B;  3VDD A;  1OUS A;  3ZLI A;  5HCH A;  4YM1 A;  1XU2 A;  1AX1 A;  1QXR A;  5T55 A;  5M0T A;  3R4S A;  4IE7 A;  4OQ9 A;  4YVW A;  2DVF A;  3PIJ A;  2FDG A;  4NHM A;  2IC1 A;  3O1M A;  4HG6 B;  1H0B A;  3AZX A;  2BTV C;  3UGH A;  4AED C;  3PVO A;  5LK7 B;  4LBJ A;  4QM9 A;  5LBB A;  1A78 A;  3CKH A;  4Q27 A;  4XHB A;  5HPO A;  5FUI A;  4Z92 B;  4LA3 A;  3ZFE A;  4XXP A;  3AMH A;  1UMH A;  3DN7 A;  3HWJ A;  4N9I A;  1JXN A;  1H8V A;  3HMY A;  5BNN C;  2B39 A;  4BLI A;  1RUJ 1;  4AAP A;  4CDU C;  1N47 A;  4E4H A;  1YO8 A;  3SHR A;  3OTF A;  4CDW C;  5A33 B;  2JB4 A;  4YW4 A;  1POV 0;  3E6B A;  4Y3O A;  3RFR A;  4COU A;  2A6X A;  4MGZ E;  4MGQ A;  1NLS A;  2VUC A;  3QOP A;  4QB2 A;  4ES8 A;  5T5L A;  4D6S A;  4HKW A;  4Z8B A;  1X36 A;  3GHN A;  4WVM A;  4NIA A;  3H9A A;  2BV4 A;  3FE5 A;  3N3H A;  5D1I A;  3BIW E;  2VY0 A;  1UAI A;  4V2W A;  4R8H A;  2WS9 3;  1J59 A;  2VZU A;  4ES9 A;  1RUD 3;  3W5M A;  2P5B A;  3SKJ E;  2X5I B;  3W58 A;  3NAP B;  4E8C A;  5JSP A;  1QJX 3;  1Z78 A;  5C33 A;  3LEG A;  3Q8A A;  1ZYB A;  4OMC A;  4BXF A;  3GBF A;  3KV9 A;  1ULC A;  2RDS A;  4MH0 E;  4GIQ A;  3RMX A;  3CDZ B;  5J37 A;  1MVE A;  4JHZ A;  4SBV A;  5FZH A;  4QMA A;  1RUG 3;  4Q0U A;  1AR9 1;  4M3C E;  4CXW A;  4HOO A;  1PZ8 A;  3CHX A;  3IIA A;  1JUH A;  1PO1 2;  3ZXA C;  2O1Q A;  3PMS A;  1S0D A;  3MI8 A;  2UWA A;  4OHW A;  3S57 A;  1R08 3;  2ZGN A;  3BN6 A;  3HQR A;  4G3Y C;  2HWE 2;  2UY8 A;  3VDB A;  4AVV A;  5C8C B;  3GF6 A;  2ZCW A;  3V0B A;  1XE7 A;  1SCS A;  5LA1 A;  4KGQ A;  1VMH A;  4CU9 A;  5HCB A;  4FP2 A;  3NW4 A;  3PNA A;  4H3W A;  4CUC A;  2QVS B;  4FPC A;  1D7P M;  3RDI A;  4RR3 B;  2G1M A;  2IXK A;  4LMF A;  1SDW A;  1WW4 A;  2W2I A;  2CHH A;  4JTO A;  1SFY A;  4LLO A;  1BCX A;  2XWB B;  5C5U A;  4AF9 A;  1U5I A;  1TME 3;  3POE A;  2E53 A;  2C9A A;  3VBH B;  3BGA A;  4CTE A;  1ND3 A;  2WC2 A;  2AGS A;  3B93 A;  1MS1 A;  1OI6 A;  4BU2 A;  5EFU A;  1RVF 1;  3MUZ 1;  5LA2 A;  1MZ5 A;  1SBF A;  1OUX A;  4UW6 A;  4H14 A;  4QX2 A;  4RQP B;  3KGZ A;  3SIS A;  4AI2 A;  3WXP A;  3T09 A;  3LGR A;  3LSD A;  3T4H B;  3BU0 A;  5KHH A;  1CES A;  2WQ4 A;  4PDW A;  2BZD A;  4KNC A;  3WNP A;  5J3U A;  4M01 A;  4JVA A;  4Y22 A;  1PK6 C;  1C28 A;  2ZX0 A;  3POB A;  5FJH A;  1OQ1 A;  3AM2 A;  1CD3 G;  2NMN A;  3OCP A;  3KSC A;  3E97 A;  3MIE A;  1RUH 3;  3EBR A;  3I2O A;  1WW5 A;  2DUP A;  5CG9 A;  4LHK A;  1GQP A;  2BJS A;  2X05 A;  5A7P A;  4L8Q A;  2QQU A;  1RJ7 A;  1VBB 1;  1JYN A;  1J3P A;  3PUR A;  1UX6 A;  5CFD C;  1K5J A;  4IER A;  1M4W A;  3U75 A;  4XFI A;  1W2U A;  2PHL A;  2QZ3 A;  5CZK A;  3BTY A;  2HWD 1;  2X29 A;  3OD0 A;  3PTR B;  4QM8 A;  3VBU C;  1BMV 2;  4U36 A;  4LK7 A;  2WFF 3;  1KQR A;  3EB7 A;  3M8L A;  4FFG A;  5LWB A;  1SLL A;  3SH5 A;  4QPG C;  1ND3 C;  4W8J A;  3MV1 1;  1UY0 A;  3IDA A;  4XF0 A;  1H8T C;  1CR7 A;  1RIT A;  2AC1 A;  3WQ1 A;  4A42 A;  4AQS A;  2Z69 A;  1QEX A;  3CJI C;  3EHK A;  5GLV A;  4DNY A;  4GH4 A;  3MLL A;  3M4F A;  4MLO A;  1POV 3;  1VBE 1;  4EE2 A;  5B2G B;  5DAQ A;  2UY9 A;  2HBT A;  3AMQ A;  3CF6 E;  1U12 A;  4AVA A;  1F35 A;  1WGP A;  3LD8 A;  1ZRR A;  4Q4V 2;  3NJY A;  2GMM A;  1K12 A;  2XHK A;  1RUG 1;  1RVF 2;  3I2H A;  4Y1X A;  4RSU A;  3ZFF C;  3D0S A;  3HQU A;  4NRP A;  4SLI A;  5EPA A;  1AR9 2;  3WDW A;  4YW7 A;  3TN9 3;  5F5C A;  1RUE 3;  1WCD J;  1O59 A;  1NCR C;  1ZZ7 A;  2VMI A;  3QAC A;  4Y1Z A;  1QMJ A;  1UYX A;  2XOM A;  1XRU A;  1XE0 A;  4JZR A;  3VBH A;  4GWM A;  3TRS B;  3U07 A;  4AFM A;  5IVE A;  1BQP A;  2XR4 A;  1S0G A;  3POG A;  5C4W C;  3PLQ A;  2FD8 A;  1GQH A;  4OZX A;  4YW3 A;  2WYF A;  3ZXD A;  1EUU A;  5C71 A;  1O4Y A;  2JE8 A;  1UXZ A;  2XLA A;  4QX8 A;  2B45 X;  3AX4 A;  5B4N A;  2GDF A;  2D3R A;  3HN1 A;  5HI0 A;  1BHG A;  1UZZ A;  2QQP A;  1AYM 2;  1UOF A;  1VE0 A;  4K1Y A;  4XAB A;  2FZ2 A;  3HIF A;  4Q4W 3;  3F95 A;  2XB6 C;  2WAO A;  2C6S A;  1LU2 A;  4B7E A;  1OKQ A;  3KCY A;  2EA7 A;  2GNT A;  5LY2 A;  4HZF A;  1X33 A;  2BFU S;  3TNP B;  5LEK A;  2J1U A;  5T52 A;  1I6X A;  1RUJ 3;  5JPN B;  3H8U A;  3JZV A;  2WSU A;  3OG2 A;  2E7Q A;  3A22 A;  5FYI A;  1W0N A;  5CFC C;  4Q4V 3;  1XU1 A;  2IXJ A;  1ZA7 A;  2O14 A;  4PLO A;  1DLC A;  2HWF 1;  5HV4 A;  3WNX A;  5IHR A;  4LBQ D;  1R08 2;  4BJ0 A;  4N7U A;  4UXA A;  4DO0 A;  2JDH A;  4RR3 C;  3ZYB A;  5FYS A;  5I91 A;  4Y5T A;  3N9P A;  4XYX A;  4Z07 A;  2OVU A;  3OY8 B;  4FPF A;  3BI3 A;  2QTW B;  1VBE 3;  2X5I A;  2P17 A;  4DRR A;  4XHX A;  5FCC A;  3U4X A;  1Y9M A;  4PQQ A;  5EHD A;  3VBF B;  3ZXK A;  1HRI 3;  2HWC 3;  4YW2 A;  3O0X A;  4LKE A;  1MS0 A;  3JD7 3;  1AR7 2;  4EJR A;  5FJK A;  1D2S A;  2WAB A;  4AFA A;  1AXK A;  1ZNP A;  3RQ0 A;  4FPJ A;  4UFL A;  2VW1 A;  4YVW B;  4QX3 A;  2JIJ A;  4YGC A;  1BMV 1;  5FY0 A;  3EQE A;  5BUV A;  1G86 A;  1UOB A;  1W05 A;  2ES3 A;  4W65 A;  5G04 L;  1WD4 A;  1B09 A;  5FYB A;  2XWJ B;  1FX5 A;  4IUG A;  1HRI 2;  3VKM A;  2J22 A;  5ERL A;  3SLI A;  1DGR A;  3AXD A;  3NNM A;  1IS4 A;  5C3O A;  2VO5 A;  1GZ9 A;  2R04 1;  1X8E A;  4Q4X 3;  1WBF A;  3BOW A;  4X8N A;  2YMZ A;  4FPG A;  2ZX3 A;  1ZZB A;  1BBT 3;  3ZPO A;  2GN7 A;  1GP5 A;  2AZ5 A;  1KS4 A;  1VBD 1;  2UU8 A;  4M3C B;  1NA1 B;  2VNV A;  4V2V A;  3ZSM A;  1DYP A;  1I5Z A;  2W46 A;  1GBG A;  1TZO A;  4HSL A;  4Q2F A;  2Y6F A;  4XUN A;  4YYO A;  3T2Q A;  3FLP A;  2RS5 1;  3HD8 B;  4BXS V;  3T4V A;  3LE0 A;  1VBA 2;  5TSW A;  4XUP A;  4YW1 A;  1UMZ A;  5DDJ 3;  1QNY A;  3ZSL A;  2JG9 C;  2XXZ A;  3NKT A;  1CAV A;  4NN0 A;  3KCX A;  3P6B A;  4E2G A;  1YCI A;  3IPV A;  5A1F A;  4ATE A;  4YZ3 A;  5H9Q A;  2WSV A;  3ROU A;  3TEW A;  1PVC 3;  2WYS A;  1UPS A;  1GUI A;  1XXN A;  3I2G A;  5FIX A;  3O1V A;  4Q0P A;  1JHN A;  3B69 A;  1Y7B A;  3ZYG A;  4RL7 A;  2FCU A;  2OKX A;  3IDB B;  1DZR A;  4CDQ C;  2ZA9 A;  4YM2 A;  3VDC A;  3LIG A;  4LOR A;  3DCQ A;  3NV2 A;  3DYP A;  4NMI A;  1OQD A;  1S2K A;  4L9B A;  4Q26 A;  3B94 A;  2D5H A;  5JOW A;  2ZEY A;  4EQV A;  3ES4 A;  3III A;  4LBL A;  4R9B A;  1X7N A;  4H2A A;  1N3P A;  2E7T A;  3M70 A;  4MX3 A;  5LBE A;  3C7E A;  4NHK A;  5CKN A;  1APN A;  3OY8 A;  1EPW A;  4KL1 A;  1BYH A;  2NN8 A;  1LHN A;  1PK6 A;  3MF9 A;  4OI4 A;  5DUV A;  3I3D A;  4ZXK A;  4ZS3 A;  1Q5O A;  5E88 A;  2WQ8 A;  1MPX A;  4QWN A;  4CP2 A;  5KBF A;  2VGD A;  5F3C A;  1R1A 3;  2VBB A;  1KJL A;  2ZHL A;  3CJX A;  3PU3 A;  4C90 A;  3CIH A;  1CX4 A;  4MHR A;  5DXD A;  5K8S A;  1PM4 A;  4QXC A;  2HEV F;  4Q4Y 3;  1W0P A;  5FYH A;  1QJX 2;  1VBC 2;  5K7P A;  1SFN A;  5IFT A;  3NVC A;  1AR8 2;  3KVB A;  1UOG A;  3PVE A;  1D4V B;  2BGO A;  2C4X A;  3IDC B;  1NXM A;  4S2G A;  5JVV A;  3SEE A;  1XSQ A;  3U14 A;  4GB3 3;  5HCA A;  4QGM A;  1QJE A;  2BPA 2;  2VMF A;  4Z2W A;  2Q8D A;  1G9B A;  1MS5 A;  1SQ4 A;  1VB2 A;  3S5Q A;  4IEZ A;  4JV4 A;  5L7O B;  4ET7 A;  3TOJ A;  4TN7 A;  4AHZ A;  2XQX A;  4Z2A A;  2QQM A;  4EN6 B;  1UKG A;  1JHJ A;  4L92 A;  3OGV A;  1LOF A;  2C26 A;  5H9S A;  4MGY E;  4NII A;  3LF7 A;  4MSV A;  3UK9 A;  4AED A;  5CAZ A;  2D93 A;  2RS1 1;  1CVN A;  4Q29 A;  5FP8 A;  3K3N A;  2VZR A;  1ULO A;  2YY1 A;  3T0A A;  1F4A A;  3OPW A;  5ANN A;  1W6N B;  1XNB A;  1JYC A;  1WA6 X;  4IEQ A;  3M1H A;  1RED A;  2VTX J;  1CZT A;  2WN2 A;  3OJB A;  3WX5 A;  2D5F A;  3ZYJ B;  4FPK A;  1LOD A;  1Y3T A;  3WEZ A;  4GB3 2;  5J48 A;  3KV5 A;  4CEW B;  3CEW A;  5A3U A;  4AE2 A;  1HIX A;  2ZZQ A;  4FI9 A;  1HQL A;  1LHO A;  2RG4 A;  1NXD 1;  1TNR A;  3VBO A;  3WDY A;  3EYP A;  1RUH 2;  4BIS A;  1HV1 A;  1GWK A;  2VTX A;  1N3Q A;  3G7D A;  4E27 A;  4NVP A;  4ZPI A;  3USU A;  4XAE A;  1YFU A;  2BQP A;  4NRM A;  1ALY A;  3MLK A; 
#chains in the Genus database with same CATH homology
 1CZV A;  4PT6 A;  1TVG A;  1CX1 A;  2ZEW A;  2DCJ A;  3WNN A;  3HEI A;  1J83 A;  2ZEZ A;  1WCQ A;  1YQ2 A;  3LPF A;  1LNS A;  2W1Q A;  1P8J A;  2W1W A;  2Y64 A;  4A4A A;  3WF2 A;  4D8M A;  2EIB A;  3C7G A;  4A41 A;  3I2F A;  1W8O A;  2E32 A;  2WAA A;  3A21 A;  4QX0 A;  5J1X A;  2W1S A;  3UET A;  3OGS A;  3C7H A;  1CZS A;  2RJ2 A;  2EIC A;  3WSO A;  2VZ3 A;  5JXI A;  4A3Z A;  1T2X A;  1UY4 A;  5G05 L;  4TXW A;  2HLE A;  4A44 A;  3WNL A;  3OGR A;  2QQN A;  5JR2 A;  3F2Z A;  1NUK A;  1JZ8 A;  1JZ3 A;  1H6Y A;  2QQI A;  2VZV A;  4A45 A;  1JZ4 A;  3I2J A;  2JDA A;  4CU6 A;  2J1R A;  3CQO A;  5I0D A;  2VJX A;  1OF4 A;  2W95 A;  2LW8 A;  2Y6H A;  2W92 A;  5JMO A;  3GGL A;  4ZZ5 A;  1UYY A;  1IQD C;  3D3A A;  2Y8K A;  1GOF A;  2BGP A;  2DDU A;  3HNY M;  4ARY A;  2VOT A;  3DYM A;  5IFP A;  2YG0 A;  5JXJ A;  2VCB A;  2ZXQ A;  3JXS A;  3HJR A;  3IAP A;  3T08 A;  1JZ5 A;  2DCK A;  4PF1 A;  4XUQ A;  5EJZ B;  4ARX A;  3LEK A;  3GDB A;  3ACF A;  2QBX A;  3NJV A;  1XNA A;  2W3J A;  4GWJ A;  2X10 A;  2QQK A;  3PUI A;  2ID4 A;  1NKG A;  2VME A;  1OH4 A;  1UY2 A;  3I3E A;  4QX1 A;  3ABZ A;  4RYD A;  3DYO A;  3W5N A;  1NX9 A;  3K77 A;  1JYW A;  4JKM A;  1GOH A;  2B4K A;  2E26 A;  2W94 A;  4AG4 A;  4TTG A;  3K4D A;  3C7O A;  4XVH A;  4CU7 A;  4DUX A;  3T0B A;  1US3 A;  3WF0 A;  1UY1 A;  2BBA A;  1SDD B;  2C9K A;  4L0P A;  3SEP A;  3UNP A;  1I5P A;  1GMM A;  5A1A A;  3C8X A;  2QQJ A;  1XNT A;  1L7Q A;  1ULP A;  3K4Z A;  4HG6 B;  2YC4 A;  1DP0 A;  3WF1 A;  3VD7 A;  2ORZ A;  3CKH A;  1K3I A;  5HPO A;  5FUI A;  4GWI A;  4A6O A;  4DEQ A;  1UMH A;  1GNY A;  3ETP A;  4RN5 A;  4CU8 A;  4M4P A;  4XUO A;  4ZZ8 A;  1UY3 A;  2VZT A;  1OF3 A;  3VD3 A;  4MGQ A;  4AAX A;  3HNM A;  4QB2 A;  2VZO A;  1UMI A;  3NNG A;  1EUT A;  2VZU A;  5C70 A;  3W5M A;  4BK5 A;  3SKJ E;  1F4H A;  2EIE A;  4E8C A;  2VMD A;  3LEG A;  4OMC A;  3U37 A;  3CZU A;  3CDZ B;  2KD7 A;  3GM8 A;  2VQU A;  4JHZ A;  2WDB A;  5JUV A;  1L7R A;  1PX4 A;  3I3B A;  4BK4 A;  3BN6 A;  2Y6J A;  2ZEX A;  5IYY A;  2VCC A;  4QDQ A;  3VDB A;  4KMQ A;  5LA1 A;  3C7F A;  4CU9 A;  1JYX A;  4CUC A;  5DMY A;  1D7P M;  2QQL A;  3T0D A;  4DUW A;  4M4R A;  2L9L A;  5LCW L;  2VL4 A;  3ECQ A;  2W47 A;  2Y6G A;  3BGA A;  3I97 A;  3MUZ 1;  5LA2 A;  4QX2 A;  4UI9 L;  4KWU A;  3T09 A;  3WNO A;  3J7H A;  2J1E A;  1H6X A;  2BZD A;  4UOJ A;  1OT5 A;  3I2K A;  3WNP A;  1O8P A;  3MO4 A;  1GU3 A;  2VQT A;  2RVA A;  3SKV A;  1GQP A;  2X05 A;  3WQB A;  1SHW B;  2VZS A;  1JYN A;  2V72 A;  3K46 A;  4QB6 A;  2CDO A;  3CMG A;  2J1A A;  3OEB A;  3VD9 A;  5CZK A;  1KGY A;  1UX7 A;  3EB7 A;  5B4X A;  2VC9 A;  3I2I A;  4W8J A;  2YC2 A;  2WBK A;  3MV1 1;  2VMC A;  1UY0 A;  3IDA A;  4P5Y A;  4A42 A;  3T2O A;  1SG3 A;  1JU4 A;  2WN3 A;  3CZJ A;  3A23 A;  1CIY A;  5IJR A;  3ACI A;  3WF4 A;  4DXS A;  1K45 A;  4LKS A;  4P08 A;  4CUA A;  3MBW A;  3K75 B;  1K12 A;  3WNK A;  1JI6 A;  3HOB A;  3I2H A;  3FHQ A;  1JYV A;  4W4Z A;  4MOA A;  3FHA A;  3LQC A;  4XZU G;  1O59 A;  3MV0 1;  1UZ0 A;  1R64 A;  1UYX A;  2XOM A;  5DPN A;  4OZO A;  2E33 A;  3WNM A;  4BDV B;  3HN3 A;  3P1I A;  2V4V A;  1EUU A;  4LQR A;  2JE8 A;  3T2P A;  5C71 A;  1UXZ A;  4MGS A;  3NQH A;  3PUH A;  4E8D A;  2VZP A;  5B4N A;  1BHG A;  4GZ9 A;  3HNB M;  4ZXE A;  3DEC A;  1UYZ A;  1W8N A;  4XUR A;  1HN1 A;  3IB3 A;  5DQ0 A;  2WAO A;  2WO2 A;  4QPW A;  2WO3 A;  5F7U A;  1XC6 A;  2VZ1 A;  3VDA A;  1KEX A;  3A7Q A;  2J1U A;  4LHS A;  3OG2 A;  1RYY A;  3A22 A;  3THD A;  1JZ7 A;  1W0N A;  1GOG A;  1DLC A;  5IHR A;  4BJ0 A;  4YPJ A;  5EJ1 B;  3ACG A;  2CDP A;  2VR4 A;  4QAW A;  4DUV A;  4PQQ A;  2W5F A;  1O8S A;  1WKY A;  2WAB A;  4OYU A;  3ZM8 A;  2XHN A;  2YFU A;  2W87 A;  4MAD A;  1XPW A;  2W91 A;  4QX3 A;  2VTF A;  2QQO A;  5CYY A;  5G04 L;  4DXT A;  3OEA A;  4IUG A;  2BER A;  2J22 A;  3NJX A;  4QDR A;  2PQS A;  2HYX A;  2VO5 A;  2Y6K A;  3OB8 A;  4QB1 A;  2J1S A;  3WF3 A;  5EIY B;  2X09 A;  4OMD A;  4JKK A;  3LPG A;  2W46 A;  1OD3 A;  4XUN A;  3T2Q A;  4BXS V;  2VZQ A;  2WZ8 A;  3THC A;  4QDS A;  3LE0 A;  4XUP A;  3FL7 A;  4XUT A;  5JXH A;  3P6B A;  2WYS A;  1GUI A;  2Z4F A;  3I2G A;  5LA0 A;  2OKX A;  3VD5 A;  3VD4 A;  4LPL A;  3VDC A;  3OBA A;  3DYP A;  3IAQ A;  2ZEY A;  1US2 A;  3III A;  1K42 A;  2J7M A;  1J84 A;  3C7E A;  2LS6 A;  2RV9 A;  3I3D A;  4JKL A;  2J1T A;  1JZ6 A;  2WQ8 A;  1MPX A;  3GXU A;  5HXM A;  5JXG A;  2W9X A;  1JZ2 A;  3CIH A;  1DYO A;  4DXR A;  2R7E B;  2WO1 A;  3MUY 1;  4MO3 M;  2J1V A;  5IFT A;  2BGO A;  2C4X A;  3SEE A;  2VCA A;  3HPN A;  1W9W A;  1PMH X;  2VMF A;  3UES A;  4ET7 A;  2EID A;  1PMJ X;  3NRU A;  2XQX A;  3E1F 1;  4D0Q A;  4Z2A A;  2QQM A;  1NAE A;  1JHJ A;  4P00 B;  3OGV A;  2WUH A;  2C26 A;  4KI5 M;  4CVU A;  1UXX X;  2JD9 A;  1W9T A;  2B9V A;  2E31 A;  5C7G A;  2VZR A;  1ULO A;  1W9S A;  4UAP A;  3T0A A;  1F4A A;  2V5D A;  4ZY9 A;  3LEI A;  5DN2 A;  4P02 B;  2VM9 A;  2WN2 A;  1CZT A;  2JKX A;  1UWW A;  2YFZ A;  4CUB A;  3FN9 A;  3WEZ A;  2Y6L A;  2XON A;  2W1U A;  1JU3 A;  3ACH A;  4OUE A;  2WZE A;  4FI9 A;  1PX3 A;  3AC0 A;  1TG7 A;  3EYP A;  3K4A A;  4DEV A;  1W99 A;  4JX0 A;  4W50 A;  2ORX A;  2YB7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...