1OH4A

Structural and thermodynamic dissection of specific mannan recognition by a carbohydrate-binding module
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
174
structure length
174
Chain Sequence
ARYVLAEEVDFSSPEEVKNWWNSGTWQAEFGSPDIEWNGEVGNGALQLNVKLPGKSDWEEVRVARKFERLSECEILEYDIYIPNVEGLKGRLRPYAVLNPGWVKIGLDMNNANVESAEIITFGGKEYRRFHVRIEFDRTAGVKELHIGVVGDHLRYDGPIFIDNVRLYKRTGGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Thermodynamic Dissection of Specific Mannan Recognition by a Carbohydrate Binding Module, Tmcbm27
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
molecule keywords BETA-MANNOSIDASE
total genus 38
structure length 174
sequence length 174
ec nomenclature
pdb deposition date 2003-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09212 CBM27 Carbohydrate binding module 27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 1oh4A00
2E26A 2WN2A 4YPJA 1DP0A 3FN9A 2WQ8A 4BDVB 4DUVA 5DN2A 3MUZ1 1UYZA 2V5DA 2WAAA 4MGSA 4IUGA 2W1QA 4QDQA 3VD3A 3MV11 5F7UA 4QB2A 2QQJA 3FHAA 2QQLA 4LKSA 3GXUA 2WO3A 4GZ9A 2RV9A 3A7QA 1HN1A 1OF4A 2EIBA 4BXSV 1JZ4A 3EYPA 3WF2A 3HOBA 1KGYA 2ORXA 2VO5A 2ZEXA 2W1SA 4Z2AA 2QQKA 4JKLA 2ID4A 3NJXA 4CU9A 3CKHA 3HJRA 4XUTA 5EIYB 3IIIA 3I3BA 4XVHA 5J1XA 3GDBA 5JXJA 2E32A 3MO4A 3T09A 3U37A 3I2FA 2WN3A 3EB7A 4UAPA 2VCAA 3CQOA 1UWWA 5IFPA 2Y6KA 3CZJA 2W1WA 1CX1A 4XUNA 3UETA 1GQPA 2ZEWA 1PMJX 4ET7A 3FL7A 2YC4A 2C4XA 5C7GA 3I2KA 4XUPA 1UMHA 2B9VA 3T0DA 3LEGA 1JZ5A 3OEBA 1SHWB 4KMQA 2LW8A 2VCBA 2YFZA 3WNMA 4XUQA 4M4RA 1US3A 3VD9A 2VM9A 2QQNA 2J1AA 2W1UA 2X05A 4D0QA 3A21A 1JHJA 5CYYA 2Y64A 2YC2A 3GGLA 2C9KA 3LPFA 4P00B 1K3IA 1W0NA 3VDBA 1JYWA 4FI9A 3WQBA 4GWIA 2L9LA 4PF1A 1JYVA 2V72A 4E8DA 2VCCA 4OYUA 5LA1A 5LA0A 4DUWA 2XHNA 2Y6JA 1JU4A 4XURA 1J83A 5DMYA 1JU3A 2VQTA 2VZVA 3WNOA 2XQXA 2VQUA 1CIYA 2J7MA 5A1AA 2VL4A 5B4NA 1CZSA 2B4KA 2RVAA 1T2XA 1UY0A 4LHSA 4JX0A 5CZKA 2BZDA 5IHRA 1NUKA 2W46A 3K46A 4XZUG 1XPWA 3T0BA 2KD7A 4XUOA 4P5YA 3ZM8A 4MADA 1K45A 2WAOA 1DYOA 4AG4A 2WO2A 3I2JA 1W9TA 2VC9A 3PUIA 3DECA 3AC0A 1GMMA 1WCQA 1RYYA 5LA2A 1W99A 3CZUA 5JR2A 4L0PA 5JUVA 2QBXA 3T08A 3T2PA 3A23A 3WEZA 3T0AA 3BN6A 4MOAA 3NJVA 5IFTA 3HNBM 4QX1A 2E31A 4DEQA 4BJ0A 4JKKA 1UZ0A 2QQOA 2W5FA 1O59A 1OT5A 1OH4A 4M4PA 2DCJA 1DLCA 3WF4A 1JZ8A 4ARXA 4LQRA 3UESA 1OD3A 3OBAA 2W91A 2EICA 2W3JA 3SKVA 2DDUA 4QX2A 4ARYA 3T2QA 1D7PM 4OZOA 2Y8KA 3IAPA 2CDOA 5EJZB 4DXTA 2VZPA 3LE0A 1JZ7A 3VDAA 3LEKA 2VZQA 3OB8A 1JYNA 4RN5A 3VD4A 4A4AA 5JMOA 2DCKA 3WNNA 3WNLA 4A44A 1UYXA 1O8SA 4TXWA 3C7HA 3J7HA 4RYDA 2E33A 2BGPA 3IDAA 4JHZA 4QDRA 4QX3A 5C70A 2W87A 3JXSA 1PMHX 4A45A 2ORZA 2WZEA 5DPNA 2J1RA 2CDPA 1KEXA 3WNPA 2EIEA 4HG6B 3VDCA 3WSOA 1JZ6A 1NKGA 1GU3A 1EUTA 1L7QA 4ZXEA 1UXXX 2VZ3A 1IQDC 3K75B 3CIHA 2RJ2A 3HNYM 1XNTA 2J1TA 1H6XA 3WF0A 4W4ZA 4CU6A 2Y6GA 2WO1A 1JZ3A 1K42A 4QB1A 4QDSA 2YG0A 4KWUA 1UY4A 2X09A 2W92A 1CZVA 1PX3A 1YQ2A 2HLEA 3C7FA 2X10A 1UMIA 1W8OA 2WABA 1UY1A 5JXHA 3DYOA 3NNGA 4MO3M 3SEEA 1UY2A 1SDDB 1GNYA 2Z4FA 3ACFA 4CU8A 3WF3A 4KI5M 3VD5A 1US2A 1WKYA 2Y6LA 2ZEYA 2VZUA 2YB7A 1SG3A 5DQ0A 4D8MA 2V4VA 4ZZ5A 1CZTA 1W9WA 2BERA 2XOMA 2QQIA 4A3ZA 4OMDA 1XC6A 5IJRA 3FHQA 3HNMA 2J1EA 1J84A 2VOTA 4W50A 4MGQA 1I5PA 3T2OA 2W9XA 5C71A 2VJXA 2J1SA 2QQMA 2W47A 2WZ8A 5FUIA 4JKMA 1H6YA 4ZZ8A 3ACGA 1TG7A 4AAXA 3ETPA 3IAQA 4TTGA 3K77A 3ACHA 4BK5A 3K4ZA 3I3EA 4W8JA 5G04L 3THCA 1GOHA 3K4AA 3I3DA 3P6BA 2VZRA 4A41A 3OGVA 3D3AA 1K12A 2JE8A 3ABZA 5G05L 1GUIA 3GM8A 3HPNA 2C26A 3HN3A 4DXSA 1UXZA 3CDZB 3A22A 3P1IA 2XONA 4CUCA 2VMEA 3W5MA 1OF3A 5LCWL 3VD7A 3ACIA 3I2IA 3ECQA 4PQQA 4BK4A 1W9SA 1O8PA 4P08A 3NRUA 3BGAA 4UI9L 2JD9A 2ZEZA 4CUAA 3CMGA 2VMCA 4CU7A 3LEIA 3K4DA 3F2ZA 1NX9A 4UOJA 3C7GA 3OG2A 2VZ1A 2OKXA 1R64A 3LQCA 1P8JA 2HYXA 2R7EB 1MPXA 2YFUA 4OMCA 4PT6A 2LS6A 5HPOA 2J22A 4LPLA 3MUY1 1GOFA 4CVUA 4DUXA 1JYXA 3SEPA 3PUHA 1L7RA 3I2HA 3MBWA 1UY3A 2W94A 2JDAA 1GOGA 3WF1A 4OUEA 4DXRA 1EUUA 2PQSA 2BBAA 2VTFA 2VR4A 3DYMA 1PX4A 5JXIA 2ZXQA 1ULPA 2VMFA 1NAEA 3NQHA 2VZSA 2WDBA 3I97A 3OGRA 4QPWA 3C8XA 5B4XA 3MV01 1UYYA 3C7EA 3THDA 2JKXA 2BGOA 4GWJA 4A42A 1JZ2A 1TVGA 4ZY9A 2W95A 1UX7A 3IB3A 2EIDA 1ULOA 3DYPA 4E8CA 3E1F1 5HXMA 4QB6A 4P02B 4QAWA 1JI6A 1W8NA 4QX0A 2WYSA 2VZOA 3SKJE 5I0DA 3LPGA 1XNAA 3WNKA 2WUHA 2J1VA 4A6OA 4CUBA 3W5NA 2J1UA 5EJ1B 3UNPA 2Y6HA 3OGSA 5IYYA 5JXGA 3HEIA 1F4AA 1BHGA 2VMDA 4DEVA 3OEAA 2VZTA 2WBKA 1LNSA 1F4HA 3I2GA 3C7OA
chains in the Genus database with same CATH superfamily
2HWE3 2PHRA 2WN2A 3HBKA 4YPJA 5J36A 4YW7A 1DP0A 2H6BA 4ES8A 1VR3A 2XPJA 1LHOA 3J4UH 5FZDA 2VXJA 5A3LA 2YBPA 2WQ8A 3QD6A 4HPKB 4BDVB 4DUVA 3VL9A 1ND3C 2Y0OA 3DXTA 4XFAA 5DN2A 2JDYA 1ZZCA 5FZMA 3UKTA 1RGSA 2CL2A 2CU5A 2WAAA 1FPN3 2DUOA 2W1QA 1WA4A 4QDQA 3NO8A 3GZAA 2R32A 3MV11 2XH6A 3OPZA 4E4HA 2ENRA 1A8MA 1YI9A 3PVOA 1BK0A 3L9JT 4N43A 4LKSA 1QQP1 3WW2A 2ZACA 1TE1B 1YYNA 1OC1A 2WNUC 3GXUA 2Q8OA 1JOPA 3JUUA 4LBQD 3O1PA 1ZBE1 3A7QA 1H2MA 1JUIA 1W9YA 3POEA 4IDZA 1O3SA 4KQ7A 4MV2A 2NP0A 1AJOA 1PO22 3HOBA 4XTPA 2EAKA 2WNUB 1CPMA 1FI2A 1KGYA 4WVWA 4D94A 1UOJA 4Z2AA 1VJ2A 3VZNA 1X8MA 4EN6B 3LDKA 4NIAA 2ZA9A 3HBZA 3CKHA 5FMBA 1W04A 2DBIA 2D6LX 5DXDA 1NY72 1RMU1 1ULEA 5D8AA 3H1YA 1CAXA 5APAA 3N7LA 1I3HA 1DQ2A 5E16A 3WW1A 5J1XA 1SBFA 4YGBA 1ZA7A 3U4XA 2ARCA 2NZ9A 3ZX7A 2E32A 4Y5TA 3MO4A 4O65A 4RR3A 1RHI1 5C6CA 4IL7A 3I2FA 4YVWB 1W0OA 3UGFA 4UAPA 4LBJA 4RD7A 1OVSA 2BDRA 1IOAA 5H9SA 4D7SA 1VBD1 1WGPA 5IFPA 2RS31 1YIPA 5C3OA 2ZX4A 2XLAA 5FXVA 1NLRA 3WDVA 3Q8AA 2W1WA 4N43B 3UETA 3O1MA 1YFYA 2P37A 4QKFA 4HL0A 1DYPA 3SH3A 2AC1A 1PGL1 4K21A 2P2KA 1D4VB 3UL2A 4MUVA 1YI7A 1FYUA 4PIZA 4XUPA 3NW4A 2RS13 3B01A 1OBNA 3EMRA 4AEKA 1VLNA 2UY9A 5A1LA 3LEGA 4LA3A 1H8TC 1S0GA 2PTMA 2ZGUA 4YM2A 4DPNA 1A8DA 4YSFA 3VKFC 2IFWA 1SHWB 4PBOA 5C4WB 1NQDA 3ZYHA 1L7LA 2YFZA 4RQPA 1ND3A 1OFSA 4W6YA 4PF5A 1PZ8A 5B2GB 1N1SA 4B4PA 4M4RA 5AC92 3EXUA 1PGW1 3RWNA 3PVEA 2AENA 2NM1A 2W1UA 2I45A 2J1AA 2QQNA 1FX5A 4XW3A 5FZEA 4D0QA 5T50A 4UFHA 1JHJA 1ENXA 1H9PA 4AVCA 3MFAA 1IS3A 1XE0A 4H55A 3M8LA 4YFWA 1BEV2 2CAUA 3RJ2X 5J37A 1UN1A 1AXZA 2Y64A 1UU6A 3GGLA 1WUVA 4CEYA 4I01A 4Q1RA 4AFDA 5T5JA 1ZRIA 5C9AC 4FBFA 2JB8A 1H9WA 1J58A 4XILA 2JG8A 1S0CA 1AR81 2FBEA 4Q0PA 3RVHA 3PU8A 4RFRB 4XAEA 5C4WA 4D7YA 5AC93 1JYWA 1XE7A 5JIAA 4CDXA 2PA7A 2UYBA 2V72A 1Q8SA 3LDRA 4YW2A 1SZBA 3UT0A 1EV12 1VE0A 4CEWA 5LA1A 2VXRA 3ZO0B 2G4IA 4AFBA 5GZDA 2GNTA 2VOWA 4EWAA 1OLQA 1CJDA 4PLMA 2HWC2 5A1AA 2VL4A 3NV1A 3L2HA 1QQP2 2P5BA 1PGW2 2JJ6A 2Y33A 3H1WA 3HT1A 4IEZA 2PAKA 1CAXB 3I7DA 5C5UA 2BZDA 5IHRA 1JMUB 2XXZA 4LORA 2R0HA 1VBB2 4O61A 1RUE3 4XZUG 4CDXC 1NG0A 1DGRA 4XUOA 4E4SA 3GJAA 4P5YA 1AXYA 2A3WA 3OSDA 3KV4A 3LGRA 2WZR2 3ZXDA 4AHXA 5JDBA 4LUMA 4BQXA 1ODMA 5FPBA 1X9PA 1W9TA 2IZWA 1NT0A 2XJRA 4IGQA 1WMXA 2PHUA 2WWUA 4ITCA 1TEIA 3PUIA 2VU9A 5FWEA 4WZFA 1XYNA 3DECA 4XEZA 4ZU4A 4FXKB 5J48A 1ENSA 3S0MA 1RYYA 1QJY2 4TLGA 2E51A 4D6SA 5LA2A 5FQ0B 4H3WA 1YQ6A 2D3RA 1AR71 1A78A 4NPLA 4XIOA 1V00A 4L0PA 1LOFA 3POIA 3SITA 1I6XA 5HCBA 3U1XA 4JDNA 4PLNA 4DS0A 4BQ4A 3BN6A 1IHMA 3ZFFA 1LODA 2VQAA 5FOJB 5FR3A 1PIV3 1DCSA 2OW4A 4GIQA 1XOYA 4Q4W2 3IDEA 1WA6X 1QDOA 2D93A 2WWSA 2XJSA 1REDA 3E5XA 3LB9A 5LB6A 3VHPA 5KXEA 4LO4B 4BMBA 5D21A 5A6XA 2GC1A 4M4PA 1DLCA 2D6KA 1JZ8A 1QXJA 4ARXA 1C1LA 2B5HA 1OD3A 4OHZA 2PHLA 3AMHA 3PUQA 2PHXA 2W3JA 1ZRDA 5EQUA 4S2HA 3ZN6B 1Q56A 1MEC3 4R9AA 1FNZA 2KR2A 3FC0A 2CV6A 3MZHA 1CAVA 1G8WA 2JDUA 3ZFGC 4NN0A 3J8F1 2CDOA 3D82A 4DXTA 5D1IA 4A3XA 3I54A 1M06G 4XCBA 5F5CA 3MIFA 1PNGA 5T5OA 1SLBA 1AL0G 1TQ5A 3TN92 3TN91 2XUMA 5F5AA 1JZ7A 4PIXA 3V0BA 3VBOB 1CGPA 1ND2B 2VZQA 4DY3A 4AVVA 5FO9B 3OB8A 1YHFA 1JYNA 5I93A 1R1ZA 3L2YA 4Y5SA 3Q8BA 2DCKA 3RRDA 5LBFA 3ORJA 1OKQA 3PDQA 1Z7S2 4TXWA 4WVZA 5F3EA 3POSA 4B4QA 3J7HA 3KT4A 1XQNA 4JHZA 3TN93 4Y22B 3FHIB 5A32B 4QDRA 4QX3A 2W87A 1AYN1 1H1MA 3WDYA 3O1SA 3JZVA 3ZYBA 1M4WA 4JTOA 3VBSB 2PAEA 2R30A 3KF3A 4XF0A 2ORZA 2WZEA 3TEWA 1DGWA 3VBOA 1V9U3 1JYIA 4LKDA 1KQRA 4Z2WA 4N53B 1K5MA 1Y9MA 1OLMA 2XVKA 3BYWA 1RUD2 4GULA 1QNYA 1NKGA 3O0VA 1D0HA 2QDNA 4ZXEA 2YHJA 4LO7A 1R082 1UXXX 2VZ3A 2WT2A 1IQDC 1JOJA 1STMA 1X36A 4BLJA 5DABA 3LA7A 3WF0A 4CU6A 3OPTA 2TUNA 1ND3B 2WO1A 3FBYA 3J9SA 1JZ3A 5JAXA 2R49A 3JD73 3H9AA 2WNVA 2YG0A 1UY4A 1OA3A 4QMAA 1CZVA 1PX3A 1YQ2A 4XIKA 5FY5A 2JDPA 2X10A 4UW5A 1ZZBA 1SPPB 2WABA 4MVTA 3VKOA 5JXHA 3VBHC 4EE2A 5J3UA 2VVDA 1VBE1 5A3WA 5T3NA 1RVF1 4XF1A 1CR7A 4A7YA 3HMYA 5FFOC 1N3QA 1RXGA 5FZBA 1EAH2 5FK8A 4CU8A 4HKWA 1RUG2 4X8PA 4FPCA 5HCHA 2A73B 1F9KA 2Y6LA 3LD8A 2W08A 3MICA 5FZLA 2IXHA 4Q26A 4AYUA 5DQ0A 2JXAA 3NNMA 4LR4A 2V4VA 4D8MA 2WNVB 1CZTA 4Y1ZA 5T54A 5HV0A 1X33A 4OHXA 4OMDA 1URXA 3U11A 5ISLA 1EV13 4U36A 3HNMA 3WUDA 4AL9A 2J1EA 5JIUA 4XXAA 2VOTA 4FOQA 1MQTC 1ULCA 2WQZC 3UGGA 1YJKA 4Q4Y3 1SACA 5C71A 1LECA 2FZ1A 2QQMA 4COVA 1D2SA 2DCZA 3IMNA 2VBPA 3TAYA 1C4RA 2RJKA 2W47A 3OCPA 2WZ8A 4OI4A 5FUIA 4CP9B 1PVC3 4AVBA 4LBNA 1GFF2 1H6YA 4QQPA 3H8RA 1RMU3 1ZZ7A 4TYSA 5CBLA 1UCXA 4IESA 4JDOA 3K4ZA 2YGLA 3MHZA 5IVVA 3QLQA 1ZZ8A 2VUJA 4QT6A 1UIJA 4DNYA 3VBRA 1EY2A 1W8TA 3T1MA 2WC2A 2HWB1 3ILFA 5A7WB 1W39A 5LATA 3AZXA 5FOBB 5EWSA 3VDDA 4Y20B 2XWJB 4L11A 3TEYA 5FZ8A 3WHUA 3ABZA 2RHPA 4B8EA 5A3OA 4UFIA 4G4FA 4NUBA 4XJUA 1BCXA 4Q29A 3VL8A 2ZGSA 4DXSA 4A7ZA 1KJLA 1UXZA 1HQNA 2JD4A 3A22A 4TWTA 5DDJ2 4OVEA 4J1WA 4DRRA 2HWF2 4WM7C 4A7KA 4CDUC 4HXCA 3Q8FA 4QD2A 5F6KA 4Q4W3 5J7MA 1WMFA 4S2DA 4QPYA 4PQQA 4QXHA 4JQRA 4ZONA 4AVTA 4BK4A 3WXPA 1HV1A 1SFNA 4I30A 5I0UA 2ZHNA 1GWLA 3OBRA 3ZXJA 4Q27A 1RIRA 3R0RA 3J26N 4YZ2A 5AFEA 4FPLA 1MZFA 5FZOB 1TME2 3CMGA 4IV1B 3K4DA 1VBD3 4ASKA 4OI2A 3F2ZA 5FREA 3SXWA 1DQ6A 4N53C 4UOJA 5E1RA 2MPFA 3I8TA 3ZVXA 3IPVA 4JGZB 1F15A 1S2KA 4LE4A 2UYAA 1NZCA 1RXFA 2X5IA 1VIWB 2XHKA 4YVSA 2FDFA 1S2BA 3RZZA 3RYKA 4CDQB 3M4FA 5BNOB 1P8JA 2D5HA 2RR13 3DF0A 2HYXA 3VBFA 1MPXA 2VOKA 2QFEA 3KGLA 5FV3A 3OY8B 2NLRA 4OFGA 1VMJA 3O1VA 3DUIA 5BNNC 1LHVA 2EXKA 3J8F3 5F2SA 5F2WA 1H2LA 3GBGA 2GH8A 2A5ZA 2A6YA 2EA7A 2ET7A 1L7RA 1MEC1 4QPIB 3G7DA 5TSWA 1XYOA 2W94A 2GMPA 1VBA3 2WS91 1GOGA 3WF1A 4LIVA 1Y7BA 2BOIA 4MH0E 1EUUA 4XJAA 5JSOA 4EN9B 2H0VA 1PX4A 4PJYA 5HCAA 3H1MA 3MFCA 4CP2A 4LNVA 3W21A 3J8F2 5CG8A 5EP9A 2W39A 1AX2A 1W8FA 4O9EA 5A6ZA 5J09A 4HKOA 4WM8C 3NQHA 2WDBA 4NPRA 1RL3A 2GP3A 1O5UA 3U4SA 4Q4X2 1AYM3 2WO7A 1FMD2 2ZABA 1BMV2 3BOWA 4A42A 5C3QA 1JZ2A 5LEKA 1TVGA 2XGXA 2YV8A 2W95A 5A32A 1NCRB 1GZCA 2JECA 1HRI2 4LK6A 5LBBA 5C4WC 2D7FA 1HRI1 2NPIA 3AM2A 5FYSA 3LIGA 4RQPB 2IXCA 2K46A 2ZAAA 4L2NA 3KWVA 4D69A 1W8ZA 4CXWA 1CD3G 4W65A 2DVDA 3KCXA 3BVCA 3LWCA 1AVBA 1JH5A 5A7PA 1F5FA 1H4GA 2XB6C 2OUHA 4UFLA 1AR61 2E63A 2B8MA 2X5IC 1BLZA 2QDRA 2UWCA 2Y34A 3WNKA 5K0UC 2WUHA 5FMOS 2J1VA 2GU9A 3I4IA 1HRV1 4KWJA 4CUBA 3W5NA 4GB31 4GWNA 5EJ1B 1MS4A 4YZ4A 2A6WA 2VW0A 5FAXA 2VNOA 1UQXA 4GA9A 4K20A 1DQ4A 4QM8A 1GWMA 3OGSA 4YW3A 1WLTA 3RI8A 2WT1A 3BIWE 3AKTA 4EROA 1UAIA 2GN3A 4F3JA 3ZYJB 3O1RA 4YW5A 1HRV3 5FY7A 1GZWB 2WL1A 3PTYA 4R4ZA 5E89A 3UGHA 4C1XA 3ILNA 5CU1A 5K0UA 3WQ1A 4OZXA 2EXIA 3LOIA 4PCRA 5FJHA 3VD3A 2E26A 2VNVA 4S2GA 2ZHMA 2B46X 4OUSA 1AYM1 1JW6A 1CAWA 1R1A3 4CDWB 1AYM2 1WLDA 2CWSA 4IE0A 2ZGMA 1QOSA 3MYXA 1W03A 4YGCA 5FYHA 3ZYPA 1UYZA 1JBCA 1U5XA 2HEVF 2PYTA 4WM8A 3MI8A 1HRI3 4MGSA 5C3PA 1HRV2 4BQ3A 1ND2C 1W6NB 2RS12 1QH6A 3T3YA 4GQ7A 5FYUA 3RI9A 2O14A 5FLJA 1H8TB 3D0SA 3KD4A 5IUQA 1RITA 2HEWF 3MIBA 5L73A 5I8YA 4P9IA 2ZTNA 1QXRA 4LLFA 4YW4A 2IWGB 4IGOA 1VBA1 2CGOA 4L99A 3AMQA 4CXXA 3WCRA 5C9AA 1F8VA 1BKZA 4GZ9A 1GP5A 4QQ2A 4JHTA 3TNPB 2ZGKA 1OF4A 2EIBA 4JV4A 2VE1A 3H8XA 3GZEA 3I59A 5FZAA 1RUI3 3EYPA 4ZS3A 5JOZA 4QHZA 1KRIA 3MLJA 2ORXA 2FQPA 2W1SA 2QQKA 4JKLA 2WNUA 2ID4A 2WSUA 3JQWA 2ZX1A 3NJXA 4CU9A 3PMSA 4PI0A 5CFCB 2RM23 2WA4A 3HJRA 4I02A 2FDHA 4KG0A 1NA1C 3TEXA 3BTXA 3D5OA 3ZMNA 2WZR3 4Q5OA 3FBMA 2BEOA 1UIKA 3CU7A 4RS5C 5L7OA 4XVHA 4Q0VA 2BNMA 1PNFA 1LHNA 1QJU3 4FTSA 3QH7A 5KBFA 4E2QA 1X8EA 1Z78A 4P9XA 5JXJA 1Y4WA 3I3QA 3I2OA 5F8PA 1LEDA 2HWC1 2IC1A 2MHFA 2A3YA 2ZGTA 2V4AA 3V0AB 1EAH1 2WN3A 1VAVA 3GZTB 3H3UA 3EB7A 5JCTA 4BISA 2VCAA 3CQOA 1LCLA 4BHPA 3DKWA 3FLPA 5GLZA 1SFPA 1VAKA 2HWC3 2WIIB 1YFXA 1UZVA 2ZZQA 4HVRA 3RYPA 2WA3A 4NAOA 1VP6A 3ZFGB 1GQPA 3O5SA 1PZ9A 1PMJX 1PM4A 4ET7A 3LKJA 1VBB3 5GZEA 2D44A 4FPEA 5C8CC 2A70A 4XJWA 3FUOA 3I2KA 5IVFA 2OPWA 1O91A 2OIIA 3BCWA 2MNGA 4K3UA 1UW8A 4RHV2 3N36A 4JZRA 4FFHA 4FCAA 1ZBA1 3AVSA 2Q5TA 3UKNA 4Y26A 1SLTA 4CDXB 5CKNA 1RUI1 1J59A 3BIEA 4IW3A 4AOCA 2JX9A 4YGEA 3SC7X 1QJY3 4CCMA 3KCCA 2B7YA 4AF9A 4IV1A 5F37A 2YMZA 1W2TA 3WP5A 3P5BA 3VD9A 4HMZA 2VM9A 3VBSA 4CRQA 3PNAA 1QWRA 3WVJA 3A21A 3M3OA 4HANA 1TME1 3B9IA 1QJU2 3UK9A 3PVBB 5CYYA 4HBNA 1IS4A 1FNYA 4IV3C 4TSVA 1T6BX 1IGOA 4V2WA 4LBOA 4ZU5A 2ZPXA 3LPFA 4LUKA 1TNRA 1ZBA3 3URFA 1PGL2 3ZYGA 1K3IA 4CEYB 1IS6A 1YIFA 4RSUA 5DZGA 3I49A 2GMEA 1A6CA 3WHTA 4BQ1A 3NVCA 3H3ZA 5FXZA 3WQBA 4GWIA 2OA2A 4IE7A 4PF1A 5FYZA 4CP1A 5F3CA 4B3NA 1NQJA 3D0JA 1O4ZA 2VCCA 2WWJA 2DCTA 5LA0A 3M2MA 2DV9A 4DUWA 1ENRA 1JU4A 2R16A 4BQWA 1J83A 1JU3A 1QEXA 4CPBA 4AFAA 2VZVA 1CAVB 5FP3A 1XBFA 2VQUA 2XQXA 1OI6A 2C24A 5EXOA 5LY2A 4YARA 1W3VA 2PN5A 4ASLA 2JICA 4YW6A 4LHSA 4IEPA 3AYDA 3WD5A 3WP3A 5JWPA 1NUKA 1W2AX 2W46A 3MIDA 5KXBA 3MGUA 4XYXA 3VBUA 1UF2C 2CHHA 4FT8A 1IQAA 1WCDJ 3B3QE 2HWB2 4AQ2A 2JIJA 2AH2A 3P3PA 1K45A 2RMU1 3ASIA 5M0TA 3I2JA 1AR63 5CISA 5FYCA 3VUOA 2WZR1 3ZIXA 5GLTA 3ZXEA 2WFF1 4AQ6A 1DDLA 2IFRA 5CFDB 2R042 3AZVA 4FPYA 3AJZA 1CWPA 1H0BA 5HCFA 5FJKA 3GZUC 3CZUA 4YG0A 1ZRCA 2WNVC 2Z42A 2VW2A 4GB32 1WWYA 3MPPG 1NYWA 4IEYA 4QX5A 4Y24A 4D6QA 4NWWA 1X82A 2QBXA 5IVYA 1SQ4A 3T08A 3MF9A 4FFGA 2RE9A 1QGLA 4HSLA 3AFKA 3USUA 3K48A 3O0WA 5FZGA 2WR9A 4MOAA 4QWNA 3T0AA 5LK7B 3DGTA 3ELNA 1G7YA 4YG3A 3BPSA 1RVF3 1RUNA 3WP4A 4PDWB 4XABA 1BXHA 4DEQA 3VKLA 2Y60A 4Q8LA 3POYA 4JKKA 5BV6A 5KXDA 3FLRA 4GKYA 1GKBA 4NROA 1O59A 1OT5A 1YQ5A 3NNFA 1ONAA 4X6RB 1DFQA 1LGNA 3QOPA 3WF4A 1BBT2 4N7UA 1KS5A 2XBO1 2X8KA 3OBAA 2EICA 2VOVA 4LK7A 3SKVA 4M3CA 4W6XA 2WQ4A 4IEQA 4ARYA 5FYBA 5DZFA 3ZSKA 1BQPA 3KM5A 4LBMA 2AEYA 2DTWA 2UY8A 3TRSB 1NZIA 4COYA 2VCMA 5K0UB 2HWD1 3THTA 4RA0A 1GICA 4GD4A 2H0BA 1RUG1 3VDAA 1W6PA 1LOEA 1BBT3 1S4CA 2R043 2ZKNA 3LEKA 5LK5A 4MG2A 2RR11 1POQA 2EXJA 1VRH1 1S0IA 1W6MA 4BIFA 2CTVA 1MS3A 3H50A 2Z2SB 4FOWA 4LOSA 4A44A 1UYXA 3MLLA 2VUDA 3ZFGA 4QPGA 3VHRA 3ZPYA 3GCWA 4JGYC 4CEYC 3OD0A 1PMHX 2WLQA 3PHMA 5A70A 2OPKA 4FP3A 2P17A 4XJZA 1VRH3 1PVXA 4MXWA 2CDPA 4AVSA 3NAPA 4IV3B 1OOPC 2P6CA 2ZGPA 1C8M1 1QDCA 3I2DA 4KWKA 1JZ6A 3RGBA 5JLVA 4TZDA 1UO9A 3GCXA 4Y1UA 1EUTA 4HK8A 4OULA 2D6NA 1W2UA 2XMLA 2DFCA 4HETA 1OLME 5KR7A 3NMBA 1AXKA 5JPNB 3V0BB 4KL1A 2NQYA 1HJGA 1ZZ9A 4P9JA 4MHRA 5FZ3A 5BYNA 3HNYM 1K5MC 2J1TA 3WG2A 2A7AA 3M3CA 1XU2A 2P3YA 1JYCA 3NKTA 3ZFFC 4GMP1 1QQP3 3ES4A 4QDSA 2JE9A 3ZR6A 4CPBD 5C5TA 3GNEA 4LT5A 2WS93 4RGGA 5SV5A 4AEDC 1G9FA 5CVRA 2HLEA 3C7FA 1UPSA 5FKBA 1AZDA 3R4UA 5IK4A 5GJ6A 3NV2A 2AEZA 3SEEA 1FOD2 1CJPA 3HVDA 4UW3A 3DPRA 3ACFA 3GJBA 1UZWA 1S0EA 2JDZA 4BOWA 3NV4A 1CAUB 4DRVA 5C8CB 5IK7A 2B9UA 4OLLA 1US2A 1WKYA 2BWCA 5CFDC 3ENRA 5F3IA 4C91A 4COUA 1O3QA 4IE4A 5EYYA 4ATFA 4ZZ5A 4FP2A 2R073 2XOMA 4DOUA 1A3KA 2QQUA 3WUCA 2RJLA 3ZXGA 3WY6A 1XC6A 4SLIA 2NYYA 2F6BA 1RUD3 1U5ZA 3JBG1 4B7EA 3ZXLA 1J84A 2BNNA 2HBUA 3GALA 5BNOC 4CEWC 4XZPA 1HN0A 5IVBA 3WQ0A 3RNSA 4LE3A 2K9ZA 4XE9A 1W8WA 1G9CA 2W0XA 1JYTA 1LOGA 1UX6A 2J1SA 4HPKA 3UJQA 2A1XA 2JG8C 4JGZC 1O7FA 5GM0A 5JR7B 2YGMA 2F4PA 4KNCA 3IMMA 4CDQA 3ACGA 2YC0A 4UWDA 3JD72 2A3XA 2RDSA 4BQYA 5FCCA 5AC91 4QU2A 3ES1A 1S0DA 4TTGA 1ZX5A 3HD8B 3K77A 4BK5A 1IKPA 5EHDA 3HQUA 3VN4A 3I3EA 3PLQA 1JHNA 2XJVA 3THCA 3ZXAC 2DWRA 3TWIA 3VBHB 1RUH1 3CEWA 2RS32 3K4AA 2FCTA 3P6BA 4LTAA 2VZRA 4COWA 5A6QA 1SLLA 5DAQA 5FZOA 1NOVA 1LEMA 2PHFA 3M7AA 3HPNA 3BKZA 1QJEA 2X53S 1OD5A 2JG9C 2DF7A 4RQPC 3CDZB 1UU4A 4JDMA 4GH4C 1RUC1 4LHKA 3ZMOA 5CEHA 4QQHA 2VMEA 2VUAA 1FOD1 3AB0A 2QJVA 3DPRC 3FX3A 3H42B 4FQ4A 4N8MA 4YG6A 2VMHA 3WZ1A 1RVF2 1YFUA 5LCWL 5BY5A 3FMGA 1GZ9A 1F35A 3FWEA 1POV0 5IVJA 4G9SB 1V0AA 4YM1A 2RS11 3VD7A 2PXJA 3ACIA 1FATA 3I2IA 4N90A 4B1MA 4CCKA 1MQTB 3H8OA 1W9SA 4YZ1A 4E9KA 4MSVA 3RZKA 4LBQB 1W6PB 3BGAA 1LB2A 5IVEA 3KT7A 4UI9L 3J7MA 1N47A 2GC3A 4NHKA 1NXMA 1POV1 2JENA 3LEIA 4I3GA 1C8NA 1S2EA 4Q4Y1 2GALA 4XETA 3ZLIA 4XTMA 3IDCB 4Q0QA 1QY4A 2ARAA 3BTAA 4RR3C 1EV11 2GZWA 5BNPB 5CG9A 1BZWA 3SQOA 2RMU3 1WW4A 3H3LA 1HQLA 4DQAA 3KF5A 4H7LA 4ES9A 5E88A 1RTVA 2VZ1A 4YM0A 2OKXA 5IVCA 4AHYA 4KBZA 2IXLA 3LQCA 2R7EB 5F32A 4PT6A 5FZ1A 4MGTA 2TBVA 2Z69A 4NIGA 2TEPA 3RMYA 1OUSA 3QACA 3VBRC 3IZOA 3WG3A 4HVQA 3AMPA 5FY0A 2Y0IA 5JZGC 3TEZA 4NOTA 4Y1YA 1QXPA 3DCQA 5DG2A 4S2FA 4UBHA 4BLIA 5F39A 4J6GA 1WD3A 4H14A 3SEPA 1UYPA 3PUHA 1L3JA 1OHFA 1GZTA 1CIWA 3MBWA 3V0AA 3D4KA 1D4M2 4OUEA 3S30A 4LBQA 4LKFA 5FZIA 1BYHA 4JRLA 1RUC2 2VR4A 3HT2A 3WLUA 5FZKA 3ITQA 2YROA 4Q4V2 3CO2A 3BTYA 4CZSA 4BM8A 3K3NA 1KDMA 1ULPA 4WVMB 2QNKA 4UF0B 3AKRA 1TME3 4CCLA 1FXZA 1REFA 5DAVA 4AI9A 1AUYA 3LSDA 3W9AA 2VTXJ 4XCAA 4BIOA 3POWA 1BMV1 3MV01 1JOBA 3C7EA 3F95A 3M3EA 3ZN5A 4DO0A 2OQ7A 2AR6A 1ST8A 2BTVC 2ZX2A 5FUPA 4GWJA 1VB4A 5GLWA 3B00A 1GYKA 2PAMA 3WW3A 4WM7B 4AZZA 2JDMA 3LIHA 5FYIA 1UX7A 2Y26A 3CJXA 4Z82A 2EIDA 3ZDVA 5T55A 2BWAA 1C28A 4FPOB 2D43A 3HWJA 2JG9A 1RMU2 3KS7A 5F5QA 4FOYA 3VBRB 4XF3A 4XDQA 3ZSJA 2WYSA 1ULGA 2VZOA 1SDWA 4Y22A 3SLIA 4QX7A 4XBLA 4IQPA 3ZYIB 4TLFA 1XNAA 3AMNA 5IW0A 4A6OA 1RHI2 4E2GA 4AE2A 2BVVA 2DYCA 4F7ZA 3BOPA 4CDWC 4LOTA 3O12A 5ABJC 4LMFA 3INAA 5L19A 3C3VA 3ZYFA 1W9FA 2ZGLA 4UT5A 1BHGA 1W05A 2D6OX 5F9TA 5KWRA 5EFUA 3HIFA 4DEVA 1ZBE2 2VZTA 4YVSC 2WBKA 2HWF3 2PMWB 2P3KA 3ZOIA 1TMF1 2XKOA 1C5HA 1DIWA 1MS9A 5BNPC 5FY1A 1F4HA 5A3UA 1QJZA 2BFUL 1Q5OA 1GV9A 2R041 2O1QA 4Q4X3 3HAGA 2JIGA 3FN9A 5IAXA 3RYRA 2JDKA 1AX0A 2WZPP 2HWD3 1N3OA 5ANNA 3MUZ1 2JKBA 1AL23 3WDUA 2ZZJA 2V5DA 4XQWA 4UW6A 3N9LA 5FY9A 3LF7A 4AGGA 4XDPA 1J1TA 1VAMA 2QQJA 1DYKA 4HFSA 4QB2A 2OX0A 3FHAA 3B7MA 3HQXA 1HB3A 1PIV1 2Q8EA 2YYOA 1VB2A 3LSEA 4EV0A 4NPMA 4C1WA 3CNAA 2OT7A 4XDOA 4XFCA 1W6QB 3EHKA 4GXLA 3WW4A 4Y33A 4WVMA 4FO9A 2PELA 1S0FA 2DU0A 1WCUA 3USUB 2OQ6A 4BXSV 1H30A 1JZ4A 4E2SA 3OTFA 1GQHA 4CE8A 2BV4A 4MHUA 5ACA3 5GLUA 1YC61 2VO5A 4QQOA 2ZEXA 2G9FA 3AZYA 3PL0A 1TNFA 5LZ6A 1UKGA 3MLKA 2A6XA 1JS9A 2AYHA 4BA6A 4XUTA 3WCSA 1ZBA2 5D8AB 5EIYB 1CAWB 1AR62 3IIIA 2QTWB 2HWF1 1MVQA 2DU1A 3GDBA 2ETEA 4XBNA 4MZUA 3B69A 3T09A 5FYMA 5DAWA 2O8OA 5HV4A 1GP6A 3TB0A 5FY4A 4M0HA 4XJ9A 3U37A 1W6NA 1RUJ1 2YZ4A 3GBFA 4CEWB 4M0NA 3FE5A 2NMNA 2WSVA 3KT1A 4KH9A 1UWWA 4BQ5A 4B29A 1OOPA 2V5YA 3VZOA 4LIUA 1BEV1 1LGBA 1MS0A 4K8RB 5AVPA 4BYYA 5C8CA 3X29B 1CX1A 2E6VA 4R8HA 5A3MA 1XNDA 4LA2A 1B35C 1QU0A 3O1TA 2YC4A 1VMFA 2HKXA 3VBOC 5GKAC 1D2QA 2XUEA 1VBC2 2I07B 4HN0A 4NR1A 3S6PA 4AGRA 1QKQA 2B9VA 3T0DA 5IWFA 1U5IA 3OOXA 3WG1A 2R061 1JZ5A 1W06A 5T52A 4E4ZA 3OEBA 4QPGB 4KMQA 1DZTA 4I09A 1PO13 2YDEA 5CFCC 1US3A 3OYWA 1YRZA 4FPGA 4GMP3 2X05A 3WG4A 4F8AA 4EN7B 4EYUA 1D4M3 1H2NA 5C3RA 1FPN1 3GF6A 2YC2A 1LULA 3C2UA 2OS2A 1IS5A 2C9KA 4BWOA 4I0AA 3AJYA 3VBSC 4KGQA 1OMIA 1W0NA 2C1FA 1UZYA 2YXSA 1C1FA 5FP7A 2OVUA 1LESA 2L9LA 1U5YA 4OQ8A 3EJKA 4CDUB 4O7XA 4QPIC 1JYVA 4E8DA 3KQRA 4OYUA 3WDWA 4YVWA 3OYWB 1UOGA 2QKDA 2E7TA 2XHNA 2Y6JA 3DV8A 4WVVA 1W3XA 2R1BA 4XURA 4Q0SA 2VQTA 3MW4A 3NSTA 1SBDA 3WNOA 3AXEA 4NIDA 5A3TA 4FTBA 2RDQA 5EPAA 1VBC3 5B4NA 1V6IA 1T2XA 1GR3A 1UY0A 1XU1A 2RVAA 3N7JA 1HKDA 4JX0A 5EJ3A 3SCFA 4DY5A 4AGVA 3S5AA 3PIJA 3K46A 1XPWA 2KD7A 2OXBA 4CSWA 1W8UA 4GAZA 4KBBA 1ALYA 3LFIA 5JZGB 2IVJA 2WAOA 3S7IA 4RS5B 3VZJA 4LBKA 2WO2A 2XLGA 4P9GA 1Q8QA 4L8QA 4URAA 2QQVA 4NVPA 3BTZA 1IZ3A 1GLHA 3RG0A 1FV3A 4FVVA 5KHGA 1FV2A 3AC0A 1GMMA 2ZGNA 1O5LA 1W28A 1H8VA 2JDNA 1WCKA 5FK7A 5FMCA 3ZN4A 1BVP1 1LOAA 1LKNA 5L7OB 1ULFA 2DUPA 1W99A 1QJX3 2CSGA 5LRSA 4KU7A 5FZFA 2I74A 5JR2A 1RUI2 3FFQA 4YZ5A 5GZGA 1MZEA 4YM3A 3HN1A 1KITA 2ZCWA 1ZBE3 1PIV2 3NNJA 4FAHA 4QKBA 3ETQA 4YNIA 3NKGA 3M3QA 2YPJA 2QUOA 3NJVA 1UOFA 1R081 2TNFA 3HNBM 1RUF1 4Q4W1 3VLBB 4QX1A 2CWMA 1FOD3 2E31A 4PIYA 3ZFEC 1S0BA 1DU3D 2N7GA 4MGZE 2HYKA 1H8TA 2XL7A 3POFA 5ABJA 1QOTA 2XQRA 2QQOA 3BB6A 1EPWA 2DBNA 5DUWA 2BRTA 4FOVA 1IG0A 2DCJA 2E7AA 4KWLA 2GSYA 4LQRA 4A2UA 3UESA 2ZHKA 3WDTA 4JC1A 1F31A 3DL3A 2EAAA 4Q4V1 4XF4A 2ZKLA 4WM8B 2DDUA 2HWB3 3E97A 3T2QA 4R9CA 1AR91 3ZFEB 2BPA2 1D7PM 5LRRA 4OZOA 3OBTA 1SFYA 4ZHNA 3DEMA 1LHWA 1WCSA 2YU2A 1REEA 3IAPA 5EJZB 2E7QA 2VD7A 5L9RA 2HBTA 5BNOA 4NMIA 4IERA 2VW1A 2XG3A 4FPHA 1KFXL 2WNEA 4ISRA 4I0WB 1PHMA 1CESA 4P5HA 5FUNA 5JI7A 1AHSA 2RS52 5FZ9A 4RN5A 4XFGA 1NE6A 4GB33 4YLZA 4AK3A 5JOWA 3VD4A 4A4AA 5A7QA 2J42A 3NNLA 4AW7A 3EQEA 3PIGA 4AI3A 2W2IA 3WNNA 5JMOA 1J3QA 1MS5A 3WNLA 3AZZA 2ZMNA 3DN7A 2PQQA 1O8SA 5D8AC 5FXXA 2GN7A 1WBLA 3C7HA 4RYDA 2E33A 1N1TA 1VBC1 2Y38A 4PBPA 2ARXA 5C70A 3JXSA 3OUJA 3POBA 1Z7S3 4QU1A 5FBZA 5FO8B 5FPXA 3G6JB 5IK5A 1ASJ3 5IATA 3ILRA 3FZ3A 5DPNA 2VUCA 3VZLA 5K7PA 5CKMA 1ODNA 5KHKA 1KEXA 2Z5WA 3AL5A 3CLPA 2YU1A 3RMXA 4GALA 1E5HA 4QKNA 2WKKA 5LASA 2EIEA 3E6BA 3WSOA 4MXVA 4NO4A 1EYBA 4ZXKA 4IXLA 5BXXA 1CAUA 3ZFFB 3BUCA 2BVBA 5DZEA 2D3PA 2ERFA 1SCSA 5A33B 3CIHA 2RJ2A 1XNBA 4GH4B 2YUEA 4WZCA 4K6BA 3VV1A 2PLV2 1H6XA 4EQVA 3RZHA 2PLV1 2VMIA 1PO21 1R083 3PJYA 3LCPA 1LU1A 1K42A 2DUQA 3M70A 4QB1A 4CYDA 3KVAA 1KJRA 2W92A 4LO6B 2YPDA 1HB1A 1PO12 5FP4A 5DAPA 1PO11 3H0OA 1QJY1 3RZGA 1UMIA 1W8OA 4Z1VA 2R6QA 2F4LA 1YQ8A 1MS8A 4QXKA 1GSLA 1W6OA 4G3YC 4QGNA 3MPBA 3VKNA 1DZRA 1UY2A 2BYVE 2I2SA 1J3PA 1UKRA 1SDDB 5FMDA 2Z4FA 2UWAA 1SLAA 2XJUA 1YO8A 4Q4X1 1JXNA 4XFHA 4JGYB 4KI5M 1VRBA 4UF0A 5FPAA 2VZUA 4XACA 4ASMB 2YB7A 5FPLA 1VBB1 4YRDA 5H9PA 4Y5Z0 4HSJA 3AXDA 4WV8A 3T2TA 1W9WA 3MDPA 4RGAA 1A34A 1UOBA 1XE8A 2EVXA 4Z92B 2XJQA 4Q4Y2 5IJRA 4F83A 3FHQA 2VQ0A 4Q8KA 1MACA 4M3CF 4LEJA 4LBLA 4PHZA 4W50A 4MGQA 1BK1A 1I5PA 4OI0A 4UW4A 3T2OA 2W9XA 1PGSA 2GAUA 1YJLA 2G9ZA 2XR4A 2EIGA 2VY0A 2Q0AA 1AR72 1O6UA 1O4YA 4HONA 3D6EA 3RFRA 2O8QA 4ZZ8A 3FLTA 4IE5A 3OGJA 1QOOA 1UNBA 2Z79A 3KV9A 1GANA 1QMJA 5KHJA 2ZAHA 3ETPA 2V09A 4ISQA 1I1EA 2FDIA 2YBSA 3W58A 3ALQA 2E53A 5I0TA 4YFZA 1NLSA 5F5IA 3MW2A 1MQTA 4CCJA 1HLCA 1COV3 5G04L 4IEVA 1GOHA 4CDUA 2C0ZA 3UYJA 3ME2A 2MEV3 1DGRN 3I3DA 4AI8A 1WLCA 3AYEA 2G19A 3LZZA 4QGMA 4Y20A 4QM9A 3NAPC 5KHHA 3E6DA 4A41A 4AEDB 3OGVA 3D3AA 1K12A 2JE8A 1S55A 1VMHA 2BFUS 4N9HA 4NWVA 2Q30A 1NLQA 1Q8OA 2Q1ZB 4MGYE 5LEJA 2C26A 1LRHA 1QNWA 2B42B 2BGCA 4FFIA 2NN8A 3OPWA 3Q9OA 1UL9A 3P1IA 3WP6A 2VNGA 5CB7A 2RDRA 2R072 4HK9A 4PQ9A 1RUC3 3E5QA 2DVFA 1OF3A 3W5MA 1DQ0A 4IE6A 1IPKA 1LENA 4L92A 2JG9B 3KCYA 1XNKA 5DDJ3 2IXIA 4D6RA 1I5ZA 4OQ9A 3ECQA 1EP0A 1O3TA 1W8HA 2VGDA 4YGDA 4K9SA 4P9WA 1V6LA 1DQ5A 1NCRA 1O8PA 1WD4A 1W2OA 1CQ9A 5J98B 1VBD2 2WFPA 4CCEA 4EZHA 3NRUA 4C0HA 1W0PA 1ENQA 1G9AA 2ZEZA 1VRH2 3V64A 2BNOA 4JVAA 4D7TA 1QHDA 1W90A 2ADEA 3VDDB 1X9TA 1OH3A 5I91A 1YCIA 3T4HB 3VZMA 4AI0A 5CKQA 1LOBA 2GNBA 1E57A 4ONUA 1HXS3 3PMEA 5T5PA 3ROUA 5CFDA 5FPZA 1IKQA 4AVAA 4Q0UA 5CFCA 1RUE1 2C5DA 3RQ0A 1R64A 3KVBA 2RS53 3LFMA 1HXS1 2DFBA 2HWD2 2P3JA 2X5IB 4IETA 4NAMA 2BJSA 4CP9A 2ILMA 2YFUA 4OMCA 4FAGA 3KMHA 2LS6A 4AEJA 4UFKA 2EXHA 5I0RA 4Y1XA 1RHI3 2Q1MA 4PLOA 2J22A 2BP6A 4NE9A 3A0KA 1WLWA 4V1PA 1POV3 4NIIA 2RR12 3PTRB 4P9LA 4B4RA 2RDNA 4FTEA 5CIRA 5KC5A 5AFBA 1GOFA 1VBE3 1ZYBA 3DPRB 5F6LB 4CVUA 4C8DA 3GBWA 1JYXA 2HJIA 4EZ4A 3I2HA 3RSJA 1ASJ2 2ATFA 4QPIA 5DAXA 3ZSMA 4NRPA 2JDAA 2A6VA 5H9QA 2ZGRA 4MLOA 1OFNA 2OZJA 1SPPA 4WBBA 4AXOA 2FMDA 3WX5A 3AYCA 4DXRA 3WV6A 2PQSA 2VTFA 5DDJ1 3Q8EA 5CNAA 1MZ6A 2A71A 4XQDA 3JU9A 5F3GA 2D98A 4K1ZA 5JXIA 1E5IA 2ZXQA 2VMFA 5AVAA 1K5MB 3KHBA 4MX3A 2WLPA 1FMD3 4N9IA 5BPXA 2VZSA 1AL21 3I97A 5FYTA 1AL22 4L9BA 2PHDA 3OGRA 1RUF3 4QPWA 1C3HA 1JN2P 1CPNA 1UPIA 3C8XA 1UYYA 1FAYA 3R05A 4O9GA 3RPQA 2GNMA 4ZKTB 5LWBA 4LHLA 2JKXA 1XJAA 2XL9A 1UU5A 1ACCA 5K8SA 4KGGA 4C90A 1ZZ6A 2WRAA 1ZREA 1V6MA 5CADA 5F1RA 3RZMA 2GDFA 4BH9A 4AFMA 1N1VA 1V9U1 2GMMA 3IB3A 4KG8A 3OJBA 4JTNA 4M01A 4QPGC 5GZCA 1ULOA 4AQTA 3CBNA 3DYPA 3N7KA 3SH4A 4E8CA 3E1F1 5HXMA 4YZ3A 4JAAA 4QB6A 2XWBB 1WMDA 1DZQA 1PMIA 2HH9A 2XBO2 1JI6A 4P02B 1C5IA 4QAWA 4XJ8A 4HT1T 1S0JA 5J96B 4QX0A 1WW7A 4CCCA 3RZJA 2CNAA 3SKJE 1KFUL 5FP8A 3RJRA 3NV3A 4DINB 1VBE2 1MZ5A 2RS33 2Q8CA 3VB9A 3ZKYA 2J1UA 1HIXA 2D6PA 1I9RA 5KXCA 3UNPA 4E27A 1GQGA 2P6HA 2CAVA 1PM7A 3IM0A 5A7WA 1IPSA 5IYYA 5CAZA 5JXGA 2FCVA 3HEIA 4LHNA 1F4AA 5A3NA 2DVGA 3LEMA 4AAPA 2VMDA 2D97A 1XRUA 4IEWA 1QJU1 4UYBA 5A3PA 2QZ2A 4EWDA 2GC0A 1K5JA 1LNSA 2VH9A 3OUHA 5EYXA 1LHUA 1DQ1A 2XVLA 3C7OA 4JQTA 1T6GC 5A7SA 4Y1VA 3WR0A 4CCNA 4IV1C 4V2VA 5SV8A 1PZ7A 3AYAA 1LGCA 3ZN6A 3N9QA 2IVIB 3KB5A 5FY8A 1XSQA 3R4SA 2FCUA 4IUGA 4R4XA 1ZA4A 3SCHA 4EN0A 5BUVA 3I3MA 5DG1A 4UBGA 2JWPA 5F7UA 4RGKA 4EN8B 1OSGA 1H1AA 1SLCA 3B93A 4DIQA 1COV2 2QQLA 4RL7A 2D3SA 2XJTA 3TOJA 2AREA 1ULDA 2XBO3 3BODA 3MIGA 4P14A 5FZHA 5C9AB 1DHKB 5L9VA 4HLTA 1W6QA 2WO3A 1FMD1 1CN1A 1WMEA 2QVSB 2RV9A 2XJPA 3N9PA 1HN1A 4DZGA 1O3RA 2BU9A 4EWEA 3WF2A 4AFCA 5C8WA 2B39A 5IK8A 4E4DX 2C9AA 3KLSA 2ZS6B 2OYZA 4XFIA 2KXLA 1F2NA 3UJOA 2OUJA 5A7NA 4AQSA 4R9BA 1DBNA 1JTZX 1V6JA 2LROA 3J7NA 3WDXA 1RB8G 5GZFA 4N7IA 1Q43A 4A6SA 3VBUC 4ORFA 4JCKA 5FO7B 2VECA 4R9DA 3ATGA 4Y4RA 3W59A 1NA1A 3I3BA 3FUQA 1UZZA 1J3RA 3M3IA 4CP0A 4H2AA 1BEV3 1Q3EA 1ZM1A 3AKSA 4RS5A 3W20A 3WOGA 3A0NA 4MXWB 5FZCA 5IT6A 5L36A 4K8FA 1GZWA 3LA2A 4QHOA 3KV5A 5FLIA 1YNAA 2ZMKA 2PHTA 4H7MA 2ET1A 4X6QB 1KXGA 1C8M2 5JVVA 5BNQA 1G9DA 2Y6KA 3CZJA 4LXLA 5FLHA 1ZVFA 3ST7A 5K9YA 4XUNA 3QH6A 1TMF2 3UV9A 5L7OC 4NHLA 3KHCA 2ZEWA 1XB9A 4BPZA 3FL7A 3IIAA 2UU8A 1NCRC 1BVVA 2C4XA 2GNDA 2O0OA 1XSRA 3FJSA 5FPVA 4K1YA 1OURA 5C7GA 4XMAA 3IKWA 2VBBA 2AGSA 2ZJCA 4K40A 4XQ4A 1GP4A 3BPZA 3K51A 1UMHA 3LAGA 4XHXA 5H9RA 3S5QA 1CVNA 1UD1A 4XFFA 1BJQA 4B1LA 2LTNA 1RUE2 4Q2FA 5ACA2 1TZOA 2VBDA 5ACA1 4NIHA 2PHWA 2QQWA 2LW8A 4NRQA 3SMHA 2XVGA 2VCBA 5IAVA 4BCUA 3J7LA 5JOXA 1GBGA 2XDVA 3WNMA 3KSCA 4XUQA 3MIHA 4XHBA 3P3NA 4M00A 1YUDA 2WYFA 4QX8A 5FZ6A 3RS6A 3NWKA 2DTYA 2ZX0A 3KV6A 1ND2A 4I0BA 4FSJA 1WZXA 1OUXA 4DMIA 3IN9A 2P34A 1GNHA 2VVEA 4XFBA 3AP9A 1CX4A 1OA4A 2P3IA 3THPA 4P00B 5HXVA 1DLLA 1HQWA 3LDBA 5BNNB 3AKQA 3CJIC 2WFF2 4PDWA 4BZ4A 5JSRA 4IEOA 3VDBA 1C8M3 4FI9A 3N9NA 3PVNA 3TNQA 2MEV1 5E6HA 2AUYA 3APBA 4I3PA 5FYYA 4N43C 1TMF3 5FP9A 1HW5A 3BALA 5FXWA 5DMYA 2B45X 1Y43B 4ZS2A 2GC2A 5FTTC 4XXPA 1NCQA 4X8NA 1AYN3 1CIYA 2J7MA 3WINE 4BXFA 3ZR5A 4SBVA 1CZSA 2IXKA 2B4KA 2WFF3 4LO8A 4XC9A 1NCQC 1NE4A 1SLIA 4NRMA 5CZKA 4CA9A 1Q8PA 3S57A 3T0BA 1B09A 3EO6A 2VPVA 2SLIA 5C33A 5FZ4A 1HB2A 2WINB 4GMP0 4MADA 3ZM8A 3K2OA 1MR5A 2AACA 1DYOA 1G6NA 4LLOA 5FKCA 4UFMA 3DXUA 4AG4A 5JZGA 2BQPA 2DURA 5ABJB 1RC6A 4RR3B 4CTEA 2VC9A 1LU2A 1LTEA 1EAH3 1IPJA 2ZOEB 3OF1A 3SCGA 1RUG3 1ZRRA 5JSPA 1WCQA 5HI0A 1HV0A 3AKPA 4QGLA 4MGIE 4MGKE 3U78A 3N35A 3RZLA 3JB8A 3JQXA 1YFWA 4RFT0 4P9YA 3VHNA 3NL1A 1RUOA 2LM3A 1V6OA 3ZPOA 1H1IA 3T2PA 2SBAA 3A23A 3WEZA 1ZNPA 1OPOA 3H8UA 1OQEA 5L9BA 5IFTA 3Q8CA 4AI2A 3B02A 4OHVA 3VKMA 3O1UA 3ZSEA 4INDA 2G9GA 1X50A 3T1LA 3NJYA 4AEMA 4BJ0A 5FZ7A 1UZ0A 1O4TA 1V9U2 3EBRA 2W5FA 4GH4A 2ZHLA 1OH4A 1OQDA 2VVFA 3CF6E 2W68A 5LBCA 3E5UA 3T4VA 4I2OA 4IGPA 3RWKX 1YQCA 4FPJA 2PLV3 2W91A 1VPHA 2NMOA 3IPVB 1Z0HA 4QX2A 1XXNA 1V70A 4N53A 4PDWC 4XOGA 5BNNA 2Y8KA 1E5SA 1RUJ2 1MVEA 1QH7A 5FBJA 2WT0A 5FIXA 2UURA 4BU2A 4B7KA 2VZPA 2YY1A 3LE0A 5LW9A 4FQZA 3MEPA 2HWE1 3BU7A 1GNZA 4CDQC 4GJZA 5ANQA 2YBKA 3IDBB 1QJX2 1R091 3PURA 4QXCA 3BI3A 1YEWA 4NJ4A 2G1MA 4JGZA 3SNMA 1RUH2 1PK6B 3CJIA 3V56A 1ZRFA 3SHRA 2QZ3A 1NCQB 2IXJA 1UMZA 3H7JA 3AL6A 3ZSLA 5JMCA 1BBT1 2BGPA 3ACLA 1Y9GA 2JDHA 3AP4A 3IDAA 3JCIA 4AWDA 4XBQA 5JI9A 4UXAA 3KQ4B 4ZU7A 4HOOA 5A80A 4A45A 3N3HA 4GJYA 3N9OA 1HX6A 4OCTA 2J1RA 2JB4A 3SISA 1WW5A 4CCDA 1G9BA 4Y3OA 2VTXA 4CXYA 4L97A 3VGIA 5T5LA 4GKXA 5KC6A 2RM21 3AP7A 3WNPA 4HG6B 3VDCA 1PK6A 3CJIB 3ZIWA 1OVPA 3U07A 1SCRA 1AR83 1HJFA 3ZFEA 1GU3A 2F17A 1L7QA 4JGYA 4U2AA 3PUAA 2DVAA 4WM7A 4LKEA 5D2AA 3K75B 1Q8VA 3OBZA 1AJKA 5JOYA 4HN1A 3MW3A 1XNTA 2RG4A 2WS92 1AX1A 4W4ZA 2Y6GA 2BW8A 4TN7A 4Q1PA 1OA2A 4AEDA 2Y6FA 1MEC2 2GP5A 5A1FA 2KA3A 4COZA 5KHIA 4KWUA 3AVRA 2X09A 1AR82 2JE7A 1LOCA 3O1OA 2FD8A 5FWJA 1DF0A 2PFWA 5EV7A 5C3SA 2D6MA 1UY1A 1JUHA 1RUH3 2Q1FA 3DYOA 1RJ7A 3MIEA 4W6WA 5ERLA 3NNGA 2CGNA 4MO3M 1COV1 1F5JA 4BMEA 4YVSB 3AMMA 1GNYA 1RJ8A 2UWBA 5LBEA 3R4DB 3WF3A 4NHYA 4BE3A 1SEFA 3VD5A 2ZEYA 2ARBA 1B35A 3OY8A 1LAJA 1SG3A 2RS51 1GWKA 1G86A 4OHYA 2VG9A 2FDGA 1QJX1 1R092 1KS4A 1W2NA 2BERA 1QF3A 3U14A 2QQIA 2KM2A 1D0GA 3CL1A 3UKVA 3ZXFA 4QXBA 4A3ZA 4QQLA 3WQ7A 3IWZA 4QKDA 2OZ6A 4LO5B 2CY6A 2VOXA 1Y3TA 5E8AA 4YVWC 5A33A 2Q4SA 2FZ2A 2GH2A 2ZX3A 3M1HA 1AYN2 3AFGA 4DB5A 2VJXA 2D5FA 1NY71 4AR2A 2R071 1OLRA 2R062 3GHMA 3MF6A 3N4MA 3O0XA 1H4HA 1R093 1NXD1 1HXS2 3CHXA 2LRPA 4NHXA 4JKMA 3ZDSA 2W52A 2LALA 3B5LB 4PI2A 1TG7A 3VDDC 3T30A 4LITA 4DFSA 1JODA 4J25A 4AAXA 3IAQA 1W6OB 3ON7A 3N9MA 3ACHA 1SBEA 3BU0A 3HR9A 4W8JA 4FXGB 1WBFA 3PJQA 1RUF2 1RINA 1HDKA 5DUVA 5FPUA 2P1BA 3NJZA 4KU8A 1D4M1 4HKLA 4BB3A 5JPMB 5G05L 1GUIA 3GM8A 3AX4A 5FDBA 4Y4YA 1LOFC 1PO23 3HN3A 3D8CA 3U0ZA 4EJRA 5A7OA 2XONA 4CUCA 2V73A 1EPZA 1S1AA 1U12A 5FZ0A 3DKQA 4XPVA 2P4EA 3ZKUA 1DGWX 1IG3A 3QCWA 3AZWA 1QIQA 2XKPA 1VBA2 2E9QA 3NAPB 3O7OA 2VAUA 3A4UA 3AP6A 4IV3A 2EALA 4FPFA 3OUIA 4XF9A 4P08A 1AR73 4J1XA 2XLFA 2R063 2JD9A 4DXZA 3U10A 1YWKA 1X7NA 4Z07A 5A6YA 4META 2ZGQA 1XYPA 2K2SA 4CUAA 2VMCA 4CU7A 1ASJ1 1H2KA 1QJFA 2DCYA 5JUVA 2RMU2 4XAAA 4IEXA 4GWMA 5GALA 4CUGA 1NX9A 4M3CE 3S7EA 4UFJA 1XNCA 1RUJ3 4OUMA 2WJSA 1OXCA 2X29A 3C7GA 2K0GA 4M3CB 3U75A 1B35B 5FYVA 3OG2A 4URTA 3VHOA 5EZWA 2ZGOA 2H6CA 5GLVA 1YXWA 3TYJA 1E5RA 5HBAA 2JEMA 1OKOA 4LULA 4FPKA 1V6NA 4YYOA 3I59B 1NA1B 3WT3A 2EF6A 3K3OA 3VBUB 5HPOA 3POJA 4NHMA 1V6KA 3RDIA 4LPLA 5LY1A 3MUY1 4HVOA 4ZPIA 3B94A 4AI1A 3TBDA 2FHRA 2BOJA 4AHWA 1HB4A 1AR93 3KZ4C 4DUXA 1YLLA 5LA9A 1OQ1A 3LOBA 5CA6A 2VULA 4IEUA 2BUKA 1UY3A 2ADDA 2C6SA 4Q4V3 3FFZA 3N7MA 4RHV1 2CYFA 2FDJA 3PU3A 2BBAA 3IBMA 3GHNA 3DYMA 2WNOA 4MYEA 4YWAA 4Z8BA 1PVC2 2QQPA 3V65A 4YW1A 4CCOA 4D3WA 4QHBA 3O14A 1KD7A 1AR92 3VBFB 1C57A 1NAEA 3ZXKA 4XMIA 2FDKA 1OPMA 4K7JA 2HWE2 3E6CC 1CONA 5B4XA 3JD71 4OHWA 4BQ2A 1KDKA 1SMVA 1R1A1 1MS1A 3THDA 3AP5A 3ZYRA 1R1A2 3HQRA 4RHV3 2BGOA 3R6SA 5FQ0A 3KGZA 4ZY9A 1APNA 1N3PA 3OGGA 2BBVA 5I8SA 1FPN2 3GYDA 2AZ5A 5FRAA 2JG8B 3WNXA 3PUSA 5DUUA 4CDWA 2IUWA 1DG6A 1Z7S1 5I0SA 2HEYF 5K4LA 2D40A 3JBG2 4JRAA 1W8NA 4HZFA 3POGA 1PVC1 4C0BA 2A6ZA 5I8TA 2R0FA 3SH5A 2VNRA 3LA3A 5I0DA 3LPGA 3VZKA 4ATEA 5BNPA 4LJHA 2VMGA 3IT8A 1PK6C 1LR5A 2MEV2 2QCSB 2ZBJA 3JB4C 2FMYA 1DGLA 2CGPA 1U0AA 5FMOL 2Y6HA 1Y9QA 2R1DA 1RUD1 3JBG3 1FT9A 1N1YA 3VBHA 1OOPB 2ZMLA 2RM22 3H7YA 1AF9A 2A75A 4AHZA 1LJ7A 5DUXA 1W6MB 3OEAA 1WW6A 3AK0A 2ES3A 3USSA 2DVBA 4R52A 2QE3A 4OI1A 3VBFC 1VALA 3OD4A 2Q8DA 3B9CA 3I2GA 3QBQA 1J1LA 4FFFA 2LUWA
chains in the Genus database with same CATH topology
2E26A 2WN2A 4YPJA 1DP0A 3FN9A 2WQ8A 4BDVB 4DUVA 5DN2A 3MUZ1 1UYZA 2V5DA 2WAAA 4MGSA 4IUGA 2W1QA 4QDQA 3VD3A 3MV11 5F7UA 4QB2A 2QQJA 3FHAA 2QQLA 4LKSA 3GXUA 2WO3A 4GZ9A 2RV9A 3A7QA 1HN1A 1OF4A 2EIBA 4BXSV 1JZ4A 3EYPA 3WF2A 3HOBA 1KGYA 2ORXA 2VO5A 2ZEXA 2W1SA 4Z2AA 2QQKA 4JKLA 2ID4A 3NJXA 4CU9A 3CKHA 3HJRA 4XUTA 5EIYB 3IIIA 3I3BA 4XVHA 5J1XA 3GDBA 5JXJA 2E32A 3MO4A 3T09A 3U37A 3I2FA 2WN3A 3EB7A 4UAPA 2VCAA 3CQOA 1UWWA 5IFPA 2Y6KA 3CZJA 2W1WA 1CX1A 4XUNA 3UETA 1GQPA 2ZEWA 1PMJX 4ET7A 3FL7A 2YC4A 2C4XA 5C7GA 3I2KA 4XUPA 1UMHA 2B9VA 3T0DA 3LEGA 1JZ5A 3OEBA 1SHWB 4KMQA 2LW8A 2VCBA 2YFZA 3WNMA 4XUQA 4M4RA 1US3A 3VD9A 2VM9A 2QQNA 2J1AA 2W1UA 2X05A 4D0QA 3A21A 1JHJA 5CYYA 2Y64A 2YC2A 3GGLA 2C9KA 3LPFA 4P00B 1K3IA 1W0NA 3VDBA 1JYWA 4FI9A 3WQBA 4GWIA 2L9LA 4PF1A 1JYVA 2V72A 4E8DA 2VCCA 4OYUA 5LA1A 5LA0A 4DUWA 2XHNA 2Y6JA 1JU4A 4XURA 1J83A 5DMYA 1JU3A 2VQTA 2VZVA 3WNOA 2XQXA 2VQUA 1CIYA 2J7MA 5A1AA 2VL4A 5B4NA 1CZSA 2B4KA 2RVAA 1T2XA 1UY0A 4LHSA 4JX0A 5CZKA 2BZDA 5IHRA 1NUKA 2W46A 3K46A 4XZUG 1XPWA 3T0BA 2KD7A 4XUOA 4P5YA 3ZM8A 4MADA 1K45A 2WAOA 1DYOA 4AG4A 2WO2A 3I2JA 1W9TA 2VC9A 3PUIA 3DECA 3AC0A 1GMMA 1WCQA 1RYYA 5LA2A 1W99A 3CZUA 5JR2A 4L0PA 5JUVA 2QBXA 3T08A 3T2PA 3A23A 3WEZA 3T0AA 3BN6A 4MOAA 3NJVA 5IFTA 3HNBM 4QX1A 2E31A 4DEQA 4BJ0A 4JKKA 1UZ0A 2QQOA 2W5FA 1O59A 1OT5A 1OH4A 4M4PA 2DCJA 1DLCA 3WF4A 1JZ8A 4ARXA 4LQRA 3UESA 1OD3A 3OBAA 2W91A 2EICA 2W3JA 3SKVA 2DDUA 4QX2A 4ARYA 3T2QA 1D7PM 4OZOA 2Y8KA 3IAPA 2CDOA 5EJZB 4DXTA 2VZPA 3LE0A 1JZ7A 3VDAA 3LEKA 2VZQA 3OB8A 1JYNA 4RN5A 3VD4A 4A4AA 5JMOA 2DCKA 3WNNA 3WNLA 4A44A 1UYXA 1O8SA 4TXWA 3C7HA 3J7HA 4RYDA 2E33A 2BGPA 3IDAA 4JHZA 4QDRA 4QX3A 5C70A 2W87A 3JXSA 1PMHX 4A45A 2ORZA 2WZEA 5DPNA 2J1RA 2CDPA 1KEXA 3WNPA 2EIEA 4HG6B 3VDCA 3WSOA 1JZ6A 1NKGA 1GU3A 1EUTA 1L7QA 4ZXEA 1UXXX 2VZ3A 1IQDC 3K75B 3CIHA 2RJ2A 3HNYM 1XNTA 2J1TA 1H6XA 3WF0A 4W4ZA 4CU6A 2Y6GA 2WO1A 1JZ3A 1K42A 4QB1A 4QDSA 2YG0A 4KWUA 1UY4A 2X09A 2W92A 1CZVA 1PX3A 1YQ2A 2HLEA 3C7FA 2X10A 1UMIA 1W8OA 2WABA 1UY1A 5JXHA 3DYOA 3NNGA 4MO3M 3SEEA 1UY2A 1SDDB 1GNYA 2Z4FA 3ACFA 4CU8A 3WF3A 4KI5M 3VD5A 1US2A 1WKYA 2Y6LA 2ZEYA 2VZUA 2YB7A 1SG3A 5DQ0A 4D8MA 2V4VA 4ZZ5A 1CZTA 1W9WA 2BERA 2XOMA 2QQIA 4A3ZA 4OMDA 1XC6A 5IJRA 3FHQA 3HNMA 2J1EA 1J84A 2VOTA 4W50A 4MGQA 1I5PA 3T2OA 2W9XA 5C71A 2VJXA 2J1SA 2QQMA 2W47A 2WZ8A 5FUIA 4JKMA 1H6YA 4ZZ8A 3ACGA 1TG7A 4AAXA 3ETPA 3IAQA 4TTGA 3K77A 3ACHA 4BK5A 3K4ZA 3I3EA 4W8JA 5G04L 3THCA 1GOHA 3K4AA 3I3DA 3P6BA 2VZRA 4A41A 3OGVA 3D3AA 1K12A 2JE8A 3ABZA 5G05L 1GUIA 3GM8A 3HPNA 2C26A 3HN3A 4DXSA 1UXZA 3CDZB 3A22A 3P1IA 2XONA 4CUCA 2VMEA 3W5MA 1OF3A 5LCWL 3VD7A 3ACIA 3I2IA 3ECQA 4PQQA 4BK4A 1W9SA 1O8PA 4P08A 3NRUA 3BGAA 4UI9L 2JD9A 2ZEZA 4CUAA 3CMGA 2VMCA 4CU7A 3LEIA 3K4DA 3F2ZA 1NX9A 4UOJA 3C7GA 3OG2A 2VZ1A 2OKXA 1R64A 3LQCA 1P8JA 2HYXA 2R7EB 1MPXA 2YFUA 4OMCA 4PT6A 2LS6A 5HPOA 2J22A 4LPLA 3MUY1 1GOFA 4CVUA 4DUXA 1JYXA 3SEPA 3PUHA 1L7RA 3I2HA 3MBWA 1UY3A 2W94A 2JDAA 1GOGA 3WF1A 4OUEA 4DXRA 1EUUA 2PQSA 2BBAA 2VTFA 2VR4A 3DYMA 1PX4A 5JXIA 2ZXQA 1ULPA 2VMFA 1NAEA 3NQHA 2VZSA 2WDBA 3I97A 3OGRA 4QPWA 3C8XA 5B4XA 3MV01 1UYYA 3C7EA 3THDA 2JKXA 2BGOA 4GWJA 4A42A 1JZ2A 1TVGA 4ZY9A 2W95A 1UX7A 3IB3A 2EIDA 1ULOA 3DYPA 4E8CA 3E1F1 5HXMA 4QB6A 4P02B 4QAWA 1JI6A 1W8NA 4QX0A 2WYSA 2VZOA 3SKJE 5I0DA 3LPGA 1XNAA 3WNKA 2WUHA 2J1VA 4A6OA 4CUBA 3W5NA 2J1UA 5EJ1B 3UNPA 2Y6HA 3OGSA 5IYYA 5JXGA 3HEIA 1F4AA 1BHGA 2VMDA 4DEVA 3OEAA 2VZTA 2WBKA 1LNSA 1F4HA 3I2GA 3C7OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E26 A;  2WN2 A;  4YPJ A;  1DP0 A;  3FN9 A;  2WQ8 A;  4BDV B;  4DUV A;  5DN2 A;  3MUZ 1;  1UYZ A;  2V5D A;  2WAA A;  4MGS A;  4IUG A;  2W1Q A;  4QDQ A;  3VD3 A;  3MV1 1;  5F7U A;  4QB2 A;  2QQJ A;  3FHA A;  2QQL A;  4LKS A;  3GXU A;  2WO3 A;  4GZ9 A;  2RV9 A;  3A7Q A;  1HN1 A;  1OF4 A;  2EIB A;  4BXS V;  1JZ4 A;  3EYP A;  3WF2 A;  3HOB A;  1KGY A;  2ORX A;  2VO5 A;  2ZEX A;  2W1S A;  4Z2A A;  2QQK A;  4JKL A;  2ID4 A;  3NJX A;  4CU9 A;  3CKH A;  3HJR A;  4XUT A;  5EIY B;  3III A;  3I3B A;  4XVH A;  5J1X A;  3GDB A;  5JXJ A;  2E32 A;  3MO4 A;  3T09 A;  3U37 A;  3I2F A;  2WN3 A;  3EB7 A;  4UAP A;  2VCA A;  3CQO A;  1UWW A;  5IFP A;  2Y6K A;  3CZJ A;  2W1W A;  1CX1 A;  4XUN A;  3UET A;  1GQP A;  2ZEW A;  1PMJ X;  4ET7 A;  3FL7 A;  2YC4 A;  2C4X A;  5C7G A;  3I2K A;  4XUP A;  1UMH A;  2B9V A;  3T0D A;  3LEG A;  1JZ5 A;  3OEB A;  1SHW B;  4KMQ A;  2LW8 A;  2VCB A;  2YFZ A;  3WNM A;  4XUQ A;  4M4R A;  1US3 A;  3VD9 A;  2VM9 A;  2QQN A;  2J1A A;  2W1U A;  2X05 A;  4D0Q A;  3A21 A;  1JHJ A;  5CYY A;  2Y64 A;  2YC2 A;  3GGL A;  2C9K A;  3LPF A;  4P00 B;  1K3I A;  1W0N A;  3VDB A;  1JYW A;  4FI9 A;  3WQB A;  4GWI A;  2L9L A;  4PF1 A;  1JYV A;  2V72 A;  4E8D A;  2VCC A;  4OYU A;  5LA1 A;  5LA0 A;  4DUW A;  2XHN A;  2Y6J A;  1JU4 A;  4XUR A;  1J83 A;  5DMY A;  1JU3 A;  2VQT A;  2VZV A;  3WNO A;  2XQX A;  2VQU A;  1CIY A;  2J7M A;  5A1A A;  2VL4 A;  5B4N A;  1CZS A;  2B4K A;  2RVA A;  1T2X A;  1UY0 A;  4LHS A;  4JX0 A;  5CZK A;  2BZD A;  5IHR A;  1NUK A;  2W46 A;  3K46 A;  4XZU G;  1XPW A;  3T0B A;  2KD7 A;  4XUO A;  4P5Y A;  3ZM8 A;  4MAD A;  1K45 A;  2WAO A;  1DYO A;  4AG4 A;  2WO2 A;  3I2J A;  1W9T A;  2VC9 A;  3PUI A;  3DEC A;  3AC0 A;  1GMM A;  1WCQ A;  1RYY A;  5LA2 A;  1W99 A;  3CZU A;  5JR2 A;  4L0P A;  5JUV A;  2QBX A;  3T08 A;  3T2P A;  3A23 A;  3WEZ A;  3T0A A;  3BN6 A;  4MOA A;  3NJV A;  5IFT A;  3HNB M;  4QX1 A;  2E31 A;  4DEQ A;  4BJ0 A;  4JKK A;  1UZ0 A;  2QQO A;  2W5F A;  1O59 A;  1OT5 A;  1OH4 A;  4M4P A;  2DCJ A;  1DLC A;  3WF4 A;  1JZ8 A;  4ARX A;  4LQR A;  3UES A;  1OD3 A;  3OBA A;  2W91 A;  2EIC A;  2W3J A;  3SKV A;  2DDU A;  4QX2 A;  4ARY A;  3T2Q A;  1D7P M;  4OZO A;  2Y8K A;  3IAP A;  2CDO A;  5EJZ B;  4DXT A;  2VZP A;  3LE0 A;  1JZ7 A;  3VDA A;  3LEK A;  2VZQ A;  3OB8 A;  1JYN A;  4RN5 A;  3VD4 A;  4A4A A;  5JMO A;  2DCK A;  3WNN A;  3WNL A;  4A44 A;  1UYX A;  1O8S A;  4TXW A;  3C7H A;  3J7H A;  4RYD A;  2E33 A;  2BGP A;  3IDA A;  4JHZ A;  4QDR A;  4QX3 A;  5C70 A;  2W87 A;  3JXS A;  1PMH X;  4A45 A;  2ORZ A;  2WZE A;  5DPN A;  2J1R A;  2CDP A;  1KEX A;  3WNP A;  2EIE A;  4HG6 B;  3VDC A;  3WSO A;  1JZ6 A;  1NKG A;  1GU3 A;  1EUT A;  1L7Q A;  4ZXE A;  1UXX X;  2VZ3 A;  1IQD C;  3K75 B;  3CIH A;  2RJ2 A;  3HNY M;  1XNT A;  2J1T A;  1H6X A;  3WF0 A;  4W4Z A;  4CU6 A;  2Y6G A;  2WO1 A;  1JZ3 A;  1K42 A;  4QB1 A;  4QDS A;  2YG0 A;  4KWU A;  1UY4 A;  2X09 A;  2W92 A;  1CZV A;  1PX3 A;  1YQ2 A;  2HLE A;  3C7F A;  2X10 A;  1UMI A;  1W8O A;  2WAB A;  1UY1 A;  5JXH A;  3DYO A;  3NNG A;  4MO3 M;  3SEE A;  1UY2 A;  1SDD B;  1GNY A;  2Z4F A;  3ACF A;  4CU8 A;  3WF3 A;  4KI5 M;  3VD5 A;  1US2 A;  1WKY A;  2Y6L A;  2ZEY A;  2VZU A;  2YB7 A;  1SG3 A;  5DQ0 A;  4D8M A;  2V4V A;  4ZZ5 A;  1CZT A;  1W9W A;  2BER A;  2XOM A;  2QQI A;  4A3Z A;  4OMD A;  1XC6 A;  5IJR A;  3FHQ A;  3HNM A;  2J1E A;  1J84 A;  2VOT A;  4W50 A;  4MGQ A;  1I5P A;  3T2O A;  2W9X A;  5C71 A;  2VJX A;  2J1S A;  2QQM A;  2W47 A;  2WZ8 A;  5FUI A;  4JKM A;  1H6Y A;  4ZZ8 A;  3ACG A;  1TG7 A;  4AAX A;  3ETP A;  3IAQ A;  4TTG A;  3K77 A;  3ACH A;  4BK5 A;  3K4Z A;  3I3E A;  4W8J A;  5G04 L;  3THC A;  1GOH A;  3K4A A;  3I3D A;  3P6B A;  2VZR A;  4A41 A;  3OGV A;  3D3A A;  1K12 A;  2JE8 A;  3ABZ A;  5G05 L;  1GUI A;  3GM8 A;  3HPN A;  2C26 A;  3HN3 A;  4DXS A;  1UXZ A;  3CDZ B;  3A22 A;  3P1I A;  2XON A;  4CUC A;  2VME A;  3W5M A;  1OF3 A;  5LCW L;  3VD7 A;  3ACI A;  3I2I A;  3ECQ A;  4PQQ A;  4BK4 A;  1W9S A;  1O8P A;  4P08 A;  3NRU A;  3BGA A;  4UI9 L;  2JD9 A;  2ZEZ A;  4CUA A;  3CMG A;  2VMC A;  4CU7 A;  3LEI A;  3K4D A;  3F2Z A;  1NX9 A;  4UOJ A;  3C7G A;  3OG2 A;  2VZ1 A;  2OKX A;  1R64 A;  3LQC A;  1P8J A;  2HYX A;  2R7E B;  1MPX A;  2YFU A;  4OMC A;  4PT6 A;  2LS6 A;  5HPO A;  2J22 A;  4LPL A;  3MUY 1;  1GOF A;  4CVU A;  4DUX A;  1JYX A;  3SEP A;  3PUH A;  1L7R A;  3I2H A;  3MBW A;  1UY3 A;  2W94 A;  2JDA A;  1GOG A;  3WF1 A;  4OUE A;  4DXR A;  1EUU A;  2PQS A;  2BBA A;  2VTF A;  2VR4 A;  3DYM A;  1PX4 A;  5JXI A;  2ZXQ A;  1ULP A;  2VMF A;  1NAE A;  3NQH A;  2VZS A;  2WDB A;  3I97 A;  3OGR A;  4QPW A;  3C8X A;  5B4X A;  3MV0 1;  1UYY A;  3C7E A;  3THD A;  2JKX A;  2BGO A;  4GWJ A;  4A42 A;  1JZ2 A;  1TVG A;  4ZY9 A;  2W95 A;  1UX7 A;  3IB3 A;  2EID A;  1ULO A;  3DYP A;  4E8C A;  3E1F 1;  5HXM A;  4QB6 A;  4P02 B;  4QAW A;  1JI6 A;  1W8N A;  4QX0 A;  2WYS A;  2VZO A;  3SKJ E;  5I0D A;  3LPG A;  1XNA A;  3WNK A;  2WUH A;  2J1V A;  4A6O A;  4CUB A;  3W5N A;  2J1U A;  5EJ1 B;  3UNP A;  2Y6H A;  3OGS A;  5IYY A;  5JXG A;  3HEI A;  1F4A A;  1BHG A;  2VMD A;  4DEV A;  3OEA A;  2VZT A;  2WBK A;  1LNS A;  1F4H A;  3I2G A;  3C7O A; 
#chains in the Genus database with same CATH topology
 2HWE 3;  2PHR A;  2WN2 A;  3HBK A;  4YPJ A;  5J36 A;  4YW7 A;  1DP0 A;  2H6B A;  4ES8 A;  1VR3 A;  2XPJ A;  1LHO A;  3J4U H;  5FZD A;  2VXJ A;  5A3L A;  2YBP A;  2WQ8 A;  3QD6 A;  4HPK B;  4BDV B;  4DUV A;  3VL9 A;  1ND3 C;  2Y0O A;  3DXT A;  4XFA A;  5DN2 A;  2JDY A;  1ZZC A;  5FZM A;  3UKT A;  1RGS A;  2CL2 A;  2CU5 A;  2WAA A;  1FPN 3;  2DUO A;  2W1Q A;  1WA4 A;  4QDQ A;  3NO8 A;  3GZA A;  2R32 A;  3MV1 1;  2XH6 A;  3OPZ A;  4E4H A;  2ENR A;  1A8M A;  1YI9 A;  3PVO A;  1BK0 A;  3L9J T;  4N43 A;  4LKS A;  1QQP 1;  3WW2 A;  2ZAC A;  1TE1 B;  1YYN A;  1OC1 A;  2WNU C;  3GXU A;  2Q8O A;  1JOP A;  3JUU A;  4LBQ D;  3O1P A;  1ZBE 1;  3A7Q A;  1H2M A;  1JUI A;  1W9Y A;  3POE A;  4IDZ A;  1O3S A;  4KQ7 A;  4MV2 A;  2NP0 A;  1AJO A;  1PO2 2;  3HOB A;  4XTP A;  2EAK A;  2WNU B;  1CPM A;  1FI2 A;  1KGY A;  4WVW A;  4D94 A;  1UOJ A;  4Z2A A;  1VJ2 A;  3VZN A;  1X8M A;  4EN6 B;  3LDK A;  4NIA A;  2ZA9 A;  3HBZ A;  3CKH A;  5FMB A;  1W04 A;  2DBI A;  2D6L X;  5DXD A;  1NY7 2;  1RMU 1;  1ULE A;  5D8A A;  3H1Y A;  1CAX A;  5APA A;  3N7L A;  1I3H A;  1DQ2 A;  5E16 A;  3WW1 A;  5J1X A;  1SBF A;  4YGB A;  1ZA7 A;  3U4X A;  2ARC A;  2NZ9 A;  3ZX7 A;  2E32 A;  4Y5T A;  3MO4 A;  4O65 A;  4RR3 A;  1RHI 1;  5C6C A;  4IL7 A;  3I2F A;  4YVW B;  1W0O A;  3UGF A;  4UAP A;  4LBJ A;  4RD7 A;  1OVS A;  2BDR A;  1IOA A;  5H9S A;  4D7S A;  1VBD 1;  1WGP A;  5IFP A;  2RS3 1;  1YIP A;  5C3O A;  2ZX4 A;  2XLA A;  5FXV A;  1NLR A;  3WDV A;  3Q8A A;  2W1W A;  4N43 B;  3UET A;  3O1M A;  1YFY A;  2P37 A;  4QKF A;  4HL0 A;  1DYP A;  3SH3 A;  2AC1 A;  1PGL 1;  4K21 A;  2P2K A;  1D4V B;  3UL2 A;  4MUV A;  1YI7 A;  1FYU A;  4PIZ A;  4XUP A;  3NW4 A;  2RS1 3;  3B01 A;  1OBN A;  3EMR A;  4AEK A;  1VLN A;  2UY9 A;  5A1L A;  3LEG A;  4LA3 A;  1H8T C;  1S0G A;  2PTM A;  2ZGU A;  4YM2 A;  4DPN A;  1A8D A;  4YSF A;  3VKF C;  2IFW A;  1SHW B;  4PBO A;  5C4W B;  1NQD A;  3ZYH A;  1L7L A;  2YFZ A;  4RQP A;  1ND3 A;  1OFS A;  4W6Y A;  4PF5 A;  1PZ8 A;  5B2G B;  1N1S A;  4B4P A;  4M4R A;  5AC9 2;  3EXU A;  1PGW 1;  3RWN A;  3PVE A;  2AEN A;  2NM1 A;  2W1U A;  2I45 A;  2J1A A;  2QQN A;  1FX5 A;  4XW3 A;  5FZE A;  4D0Q A;  5T50 A;  4UFH A;  1JHJ A;  1ENX A;  1H9P A;  4AVC A;  3MFA A;  1IS3 A;  1XE0 A;  4H55 A;  3M8L A;  4YFW A;  1BEV 2;  2CAU A;  3RJ2 X;  5J37 A;  1UN1 A;  1AXZ A;  2Y64 A;  1UU6 A;  3GGL A;  1WUV A;  4CEY A;  4I01 A;  4Q1R A;  4AFD A;  5T5J A;  1ZRI A;  5C9A C;  4FBF A;  2JB8 A;  1H9W A;  1J58 A;  4XIL A;  2JG8 A;  1S0C A;  1AR8 1;  2FBE A;  4Q0P A;  3RVH A;  3PU8 A;  4RFR B;  4XAE A;  5C4W A;  4D7Y A;  5AC9 3;  1JYW A;  1XE7 A;  5JIA A;  4CDX A;  2PA7 A;  2UYB A;  2V72 A;  1Q8S A;  3LDR A;  4YW2 A;  1SZB A;  3UT0 A;  1EV1 2;  1VE0 A;  4CEW A;  5LA1 A;  2VXR A;  3ZO0 B;  2G4I A;  4AFB A;  5GZD A;  2GNT A;  2VOW A;  4EWA A;  1OLQ A;  1CJD A;  4PLM A;  2HWC 2;  5A1A A;  2VL4 A;  3NV1 A;  3L2H A;  1QQP 2;  2P5B A;  1PGW 2;  2JJ6 A;  2Y33 A;  3H1W A;  3HT1 A;  4IEZ A;  2PAK A;  1CAX B;  3I7D A;  5C5U A;  2BZD A;  5IHR A;  1JMU B;  2XXZ A;  4LOR A;  2R0H A;  1VBB 2;  4O61 A;  1RUE 3;  4XZU G;  4CDX C;  1NG0 A;  1DGR A;  4XUO A;  4E4S A;  3GJA A;  4P5Y A;  1AXY A;  2A3W A;  3OSD A;  3KV4 A;  3LGR A;  2WZR 2;  3ZXD A;  4AHX A;  5JDB A;  4LUM A;  4BQX A;  1ODM A;  5FPB A;  1X9P A;  1W9T A;  2IZW A;  1NT0 A;  2XJR A;  4IGQ A;  1WMX A;  2PHU A;  2WWU A;  4ITC A;  1TEI A;  3PUI A;  2VU9 A;  5FWE A;  4WZF A;  1XYN A;  3DEC A;  4XEZ A;  4ZU4 A;  4FXK B;  5J48 A;  1ENS A;  3S0M A;  1RYY A;  1QJY 2;  4TLG A;  2E51 A;  4D6S A;  5LA2 A;  5FQ0 B;  4H3W A;  1YQ6 A;  2D3R A;  1AR7 1;  1A78 A;  4NPL A;  4XIO A;  1V00 A;  4L0P A;  1LOF A;  3POI A;  3SIT A;  1I6X A;  5HCB A;  3U1X A;  4JDN A;  4PLN A;  4DS0 A;  4BQ4 A;  3BN6 A;  1IHM A;  3ZFF A;  1LOD A;  2VQA A;  5FOJ B;  5FR3 A;  1PIV 3;  1DCS A;  2OW4 A;  4GIQ A;  1XOY A;  4Q4W 2;  3IDE A;  1WA6 X;  1QDO A;  2D93 A;  2WWS A;  2XJS A;  1RED A;  3E5X A;  3LB9 A;  5LB6 A;  3VHP A;  5KXE A;  4LO4 B;  4BMB A;  5D21 A;  5A6X A;  2GC1 A;  4M4P A;  1DLC A;  2D6K A;  1JZ8 A;  1QXJ A;  4ARX A;  1C1L A;  2B5H A;  1OD3 A;  4OHZ A;  2PHL A;  3AMH A;  3PUQ A;  2PHX A;  2W3J A;  1ZRD A;  5EQU A;  4S2H A;  3ZN6 B;  1Q56 A;  1MEC 3;  4R9A A;  1FNZ A;  2KR2 A;  3FC0 A;  2CV6 A;  3MZH A;  1CAV A;  1G8W A;  2JDU A;  3ZFG C;  4NN0 A;  3J8F 1;  2CDO A;  3D82 A;  4DXT A;  5D1I A;  4A3X A;  3I54 A;  1M06 G;  4XCB A;  5F5C A;  3MIF A;  1PNG A;  5T5O A;  1SLB A;  1AL0 G;  1TQ5 A;  3TN9 2;  3TN9 1;  2XUM A;  5F5A A;  1JZ7 A;  4PIX A;  3V0B A;  3VBO B;  1CGP A;  1ND2 B;  2VZQ A;  4DY3 A;  4AVV A;  5FO9 B;  3OB8 A;  1YHF A;  1JYN A;  5I93 A;  1R1Z A;  3L2Y A;  4Y5S A;  3Q8B A;  2DCK A;  3RRD A;  5LBF A;  3ORJ A;  1OKQ A;  3PDQ A;  1Z7S 2;  4TXW A;  4WVZ A;  5F3E A;  3POS A;  4B4Q A;  3J7H A;  3KT4 A;  1XQN A;  4JHZ A;  3TN9 3;  4Y22 B;  3FHI B;  5A32 B;  4QDR A;  4QX3 A;  2W87 A;  1AYN 1;  1H1M A;  3WDY A;  3O1S A;  3JZV A;  3ZYB A;  1M4W A;  4JTO A;  3VBS B;  2PAE A;  2R30 A;  3KF3 A;  4XF0 A;  2ORZ A;  2WZE A;  3TEW A;  1DGW A;  3VBO A;  1V9U 3;  1JYI A;  4LKD A;  1KQR A;  4Z2W A;  4N53 B;  1K5M A;  1Y9M A;  1OLM A;  2XVK A;  3BYW A;  1RUD 2;  4GUL A;  1QNY A;  1NKG A;  3O0V A;  1D0H A;  2QDN A;  4ZXE A;  2YHJ A;  4LO7 A;  1R08 2;  1UXX X;  2VZ3 A;  2WT2 A;  1IQD C;  1JOJ A;  1STM A;  1X36 A;  4BLJ A;  5DAB A;  3LA7 A;  3WF0 A;  4CU6 A;  3OPT A;  2TUN A;  1ND3 B;  2WO1 A;  3FBY A;  3J9S A;  1JZ3 A;  5JAX A;  2R49 A;  3JD7 3;  3H9A A;  2WNV A;  2YG0 A;  1UY4 A;  1OA3 A;  4QMA A;  1CZV A;  1PX3 A;  1YQ2 A;  4XIK A;  5FY5 A;  2JDP A;  2X10 A;  4UW5 A;  1ZZB A;  1SPP B;  2WAB A;  4MVT A;  3VKO A;  5JXH A;  3VBH C;  4EE2 A;  5J3U A;  2VVD A;  1VBE 1;  5A3W A;  5T3N A;  1RVF 1;  4XF1 A;  1CR7 A;  4A7Y A;  3HMY A;  5FFO C;  1N3Q A;  1RXG A;  5FZB A;  1EAH 2;  5FK8 A;  4CU8 A;  4HKW A;  1RUG 2;  4X8P A;  4FPC A;  5HCH A;  2A73 B;  1F9K A;  2Y6L A;  3LD8 A;  2W08 A;  3MIC A;  5FZL A;  2IXH A;  4Q26 A;  4AYU A;  5DQ0 A;  2JXA A;  3NNM A;  4LR4 A;  2V4V A;  4D8M A;  2WNV B;  1CZT A;  4Y1Z A;  5T54 A;  5HV0 A;  1X33 A;  4OHX A;  4OMD A;  1URX A;  3U11 A;  5ISL A;  1EV1 3;  4U36 A;  3HNM A;  3WUD A;  4AL9 A;  2J1E A;  5JIU A;  4XXA A;  2VOT A;  4FOQ A;  1MQT C;  1ULC A;  2WQZ C;  3UGG A;  1YJK A;  4Q4Y 3;  1SAC A;  5C71 A;  1LEC A;  2FZ1 A;  2QQM A;  4COV A;  1D2S A;  2DCZ A;  3IMN A;  2VBP A;  3TAY A;  1C4R A;  2RJK A;  2W47 A;  3OCP A;  2WZ8 A;  4OI4 A;  5FUI A;  4CP9 B;  1PVC 3;  4AVB A;  4LBN A;  1GFF 2;  1H6Y A;  4QQP A;  3H8R A;  1RMU 3;  1ZZ7 A;  4TYS A;  5CBL A;  1UCX A;  4IES A;  4JDO A;  3K4Z A;  2YGL A;  3MHZ A;  5IVV A;  3QLQ A;  1ZZ8 A;  2VUJ A;  4QT6 A;  1UIJ A;  4DNY A;  3VBR A;  1EY2 A;  1W8T A;  3T1M A;  2WC2 A;  2HWB 1;  3ILF A;  5A7W B;  1W39 A;  5LAT A;  3AZX A;  5FOB B;  5EWS A;  3VDD A;  4Y20 B;  2XWJ B;  4L11 A;  3TEY A;  5FZ8 A;  3WHU A;  3ABZ A;  2RHP A;  4B8E A;  5A3O A;  4UFI A;  4G4F A;  4NUB A;  4XJU A;  1BCX A;  4Q29 A;  3VL8 A;  2ZGS A;  4DXS A;  4A7Z A;  1KJL A;  1UXZ A;  1HQN A;  2JD4 A;  3A22 A;  4TWT A;  5DDJ 2;  4OVE A;  4J1W A;  4DRR A;  2HWF 2;  4WM7 C;  4A7K A;  4CDU C;  4HXC A;  3Q8F A;  4QD2 A;  5F6K A;  4Q4W 3;  5J7M A;  1WMF A;  4S2D A;  4QPY A;  4PQQ A;  4QXH A;  4JQR A;  4ZON A;  4AVT A;  4BK4 A;  3WXP A;  1HV1 A;  1SFN A;  4I30 A;  5I0U A;  2ZHN A;  1GWL A;  3OBR A;  3ZXJ A;  4Q27 A;  1RIR A;  3R0R A;  3J26 N;  4YZ2 A;  5AFE A;  4FPL A;  1MZF A;  5FZO B;  1TME 2;  3CMG A;  4IV1 B;  3K4D A;  1VBD 3;  4ASK A;  4OI2 A;  3F2Z A;  5FRE A;  3SXW A;  1DQ6 A;  4N53 C;  4UOJ A;  5E1R A;  2MPF A;  3I8T A;  3ZVX A;  3IPV A;  4JGZ B;  1F15 A;  1S2K A;  4LE4 A;  2UYA A;  1NZC A;  1RXF A;  2X5I A;  1VIW B;  2XHK A;  4YVS A;  2FDF A;  1S2B A;  3RZZ A;  3RYK A;  4CDQ B;  3M4F A;  5BNO B;  1P8J A;  2D5H A;  2RR1 3;  3DF0 A;  2HYX A;  3VBF A;  1MPX A;  2VOK A;  2QFE A;  3KGL A;  5FV3 A;  3OY8 B;  2NLR A;  4OFG A;  1VMJ A;  3O1V A;  3DUI A;  5BNN C;  1LHV A;  2EXK A;  3J8F 3;  5F2S A;  5F2W A;  1H2L A;  3GBG A;  2GH8 A;  2A5Z A;  2A6Y A;  2EA7 A;  2ET7 A;  1L7R A;  1MEC 1;  4QPI B;  3G7D A;  5TSW A;  1XYO A;  2W94 A;  2GMP A;  1VBA 3;  2WS9 1;  1GOG A;  3WF1 A;  4LIV A;  1Y7B A;  2BOI A;  4MH0 E;  1EUU A;  4XJA A;  5JSO A;  4EN9 B;  2H0V A;  1PX4 A;  4PJY A;  5HCA A;  3H1M A;  3MFC A;  4CP2 A;  4LNV A;  3W21 A;  3J8F 2;  5CG8 A;  5EP9 A;  2W39 A;  1AX2 A;  1W8F A;  4O9E A;  5A6Z A;  5J09 A;  4HKO A;  4WM8 C;  3NQH A;  2WDB A;  4NPR A;  1RL3 A;  2GP3 A;  1O5U A;  3U4S A;  4Q4X 2;  1AYM 3;  2WO7 A;  1FMD 2;  2ZAB A;  1BMV 2;  3BOW A;  4A42 A;  5C3Q A;  1JZ2 A;  5LEK A;  1TVG A;  2XGX A;  2YV8 A;  2W95 A;  5A32 A;  1NCR B;  1GZC A;  2JEC A;  1HRI 2;  4LK6 A;  5LBB A;  5C4W C;  2D7F A;  1HRI 1;  2NPI A;  3AM2 A;  5FYS A;  3LIG A;  4RQP B;  2IXC A;  2K46 A;  2ZAA A;  4L2N A;  3KWV A;  4D69 A;  1W8Z A;  4CXW A;  1CD3 G;  4W65 A;  2DVD A;  3KCX A;  3BVC A;  3LWC A;  1AVB A;  1JH5 A;  5A7P A;  1F5F A;  1H4G A;  2XB6 C;  2OUH A;  4UFL A;  1AR6 1;  2E63 A;  2B8M A;  2X5I C;  1BLZ A;  2QDR A;  2UWC A;  2Y34 A;  3WNK A;  5K0U C;  2WUH A;  5FMO S;  2J1V A;  2GU9 A;  3I4I A;  1HRV 1;  4KWJ A;  4CUB A;  3W5N A;  4GB3 1;  4GWN A;  5EJ1 B;  1MS4 A;  4YZ4 A;  2A6W A;  2VW0 A;  5FAX A;  2VNO A;  1UQX A;  4GA9 A;  4K20 A;  1DQ4 A;  4QM8 A;  1GWM A;  3OGS A;  4YW3 A;  1WLT A;  3RI8 A;  2WT1 A;  3BIW E;  3AKT A;  4ERO A;  1UAI A;  2GN3 A;  4F3J A;  3ZYJ B;  3O1R A;  4YW5 A;  1HRV 3;  5FY7 A;  1GZW B;  2WL1 A;  3PTY A;  4R4Z A;  5E89 A;  3UGH A;  4C1X A;  3ILN A;  5CU1 A;  5K0U A;  3WQ1 A;  4OZX A;  2EXI A;  3LOI A;  4PCR A;  5FJH A;  3VD3 A;  2E26 A;  2VNV A;  4S2G A;  2ZHM A;  2B46 X;  4OUS A;  1AYM 1;  1JW6 A;  1CAW A;  1R1A 3;  4CDW B;  1AYM 2;  1WLD A;  2CWS A;  4IE0 A;  2ZGM A;  1QOS A;  3MYX A;  1W03 A;  4YGC A;  5FYH A;  3ZYP A;  1UYZ A;  1JBC A;  1U5X A;  2HEV F;  2PYT A;  4WM8 A;  3MI8 A;  1HRI 3;  4MGS A;  5C3P A;  1HRV 2;  4BQ3 A;  1ND2 C;  1W6N B;  2RS1 2;  1QH6 A;  3T3Y A;  4GQ7 A;  5FYU A;  3RI9 A;  2O14 A;  5FLJ A;  1H8T B;  3D0S A;  3KD4 A;  5IUQ A;  1RIT A;  2HEW F;  3MIB A;  5L73 A;  5I8Y A;  4P9I A;  2ZTN A;  1QXR A;  4LLF A;  4YW4 A;  2IWG B;  4IGO A;  1VBA 1;  2CGO A;  4L99 A;  3AMQ A;  4CXX A;  3WCR A;  5C9A A;  1F8V A;  1BKZ A;  4GZ9 A;  1GP5 A;  4QQ2 A;  4JHT A;  3TNP B;  2ZGK A;  1OF4 A;  2EIB A;  4JV4 A;  2VE1 A;  3H8X A;  3GZE A;  3I59 A;  5FZA A;  1RUI 3;  3EYP A;  4ZS3 A;  5JOZ A;  4QHZ A;  1KRI A;  3MLJ A;  2ORX A;  2FQP A;  2W1S A;  2QQK A;  4JKL A;  2WNU A;  2ID4 A;  2WSU A;  3JQW A;  2ZX1 A;  3NJX A;  4CU9 A;  3PMS A;  4PI0 A;  5CFC B;  2RM2 3;  2WA4 A;  3HJR A;  4I02 A;  2FDH A;  4KG0 A;  1NA1 C;  3TEX A;  3BTX A;  3D5O A;  3ZMN A;  2WZR 3;  4Q5O A;  3FBM A;  2BEO A;  1UIK A;  3CU7 A;  4RS5 C;  5L7O A;  4XVH A;  4Q0V A;  2BNM A;  1PNF A;  1LHN A;  1QJU 3;  4FTS A;  3QH7 A;  5KBF A;  4E2Q A;  1X8E A;  1Z78 A;  4P9X A;  5JXJ A;  1Y4W A;  3I3Q A;  3I2O A;  5F8P A;  1LED A;  2HWC 1;  2IC1 A;  2MHF A;  2A3Y A;  2ZGT A;  2V4A A;  3V0A B;  1EAH 1;  2WN3 A;  1VAV A;  3GZT B;  3H3U A;  3EB7 A;  5JCT A;  4BIS A;  2VCA A;  3CQO A;  1LCL A;  4BHP A;  3DKW A;  3FLP A;  5GLZ A;  1SFP A;  1VAK A;  2HWC 3;  2WII B;  1YFX A;  1UZV A;  2ZZQ A;  4HVR A;  3RYP A;  2WA3 A;  4NAO A;  1VP6 A;  3ZFG B;  1GQP A;  3O5S A;  1PZ9 A;  1PMJ X;  1PM4 A;  4ET7 A;  3LKJ A;  1VBB 3;  5GZE A;  2D44 A;  4FPE A;  5C8C C;  2A70 A;  4XJW A;  3FUO A;  3I2K A;  5IVF A;  2OPW A;  1O91 A;  2OII A;  3BCW A;  2MNG A;  4K3U A;  1UW8 A;  4RHV 2;  3N36 A;  4JZR A;  4FFH A;  4FCA A;  1ZBA 1;  3AVS A;  2Q5T A;  3UKN A;  4Y26 A;  1SLT A;  4CDX B;  5CKN A;  1RUI 1;  1J59 A;  3BIE A;  4IW3 A;  4AOC A;  2JX9 A;  4YGE A;  3SC7 X;  1QJY 3;  4CCM A;  3KCC A;  2B7Y A;  4AF9 A;  4IV1 A;  5F37 A;  2YMZ A;  1W2T A;  3WP5 A;  3P5B A;  3VD9 A;  4HMZ A;  2VM9 A;  3VBS A;  4CRQ A;  3PNA A;  1QWR A;  3WVJ A;  3A21 A;  3M3O A;  4HAN A;  1TME 1;  3B9I A;  1QJU 2;  3UK9 A;  3PVB B;  5CYY A;  4HBN A;  1IS4 A;  1FNY A;  4IV3 C;  4TSV A;  1T6B X;  1IGO A;  4V2W A;  4LBO A;  4ZU5 A;  2ZPX A;  3LPF A;  4LUK A;  1TNR A;  1ZBA 3;  3URF A;  1PGL 2;  3ZYG A;  1K3I A;  4CEY B;  1IS6 A;  1YIF A;  4RSU A;  5DZG A;  3I49 A;  2GME A;  1A6C A;  3WHT A;  4BQ1 A;  3NVC A;  3H3Z A;  5FXZ A;  3WQB A;  4GWI A;  2OA2 A;  4IE7 A;  4PF1 A;  5FYZ A;  4CP1 A;  5F3C A;  4B3N A;  1NQJ A;  3D0J A;  1O4Z A;  2VCC A;  2WWJ A;  2DCT A;  5LA0 A;  3M2M A;  2DV9 A;  4DUW A;  1ENR A;  1JU4 A;  2R16 A;  4BQW A;  1J83 A;  1JU3 A;  1QEX A;  4CPB A;  4AFA A;  2VZV A;  1CAV B;  5FP3 A;  1XBF A;  2VQU A;  2XQX A;  1OI6 A;  2C24 A;  5EXO A;  5LY2 A;  4YAR A;  1W3V A;  2PN5 A;  4ASL A;  2JIC A;  4YW6 A;  4LHS A;  4IEP A;  3AYD A;  3WD5 A;  3WP3 A;  5JWP A;  1NUK A;  1W2A X;  2W46 A;  3MID A;  5KXB A;  3MGU A;  4XYX A;  3VBU A;  1UF2 C;  2CHH A;  4FT8 A;  1IQA A;  1WCD J;  3B3Q E;  2HWB 2;  4AQ2 A;  2JIJ A;  2AH2 A;  3P3P A;  1K45 A;  2RMU 1;  3ASI A;  5M0T A;  3I2J A;  1AR6 3;  5CIS A;  5FYC A;  3VUO A;  2WZR 1;  3ZIX A;  5GLT A;  3ZXE A;  2WFF 1;  4AQ6 A;  1DDL A;  2IFR A;  5CFD B;  2R04 2;  3AZV A;  4FPY A;  3AJZ A;  1CWP A;  1H0B A;  5HCF A;  5FJK A;  3GZU C;  3CZU A;  4YG0 A;  1ZRC A;  2WNV C;  2Z42 A;  2VW2 A;  4GB3 2;  1WWY A;  3MPP G;  1NYW A;  4IEY A;  4QX5 A;  4Y24 A;  4D6Q A;  4NWW A;  1X82 A;  2QBX A;  5IVY A;  1SQ4 A;  3T08 A;  3MF9 A;  4FFG A;  2RE9 A;  1QGL A;  4HSL A;  3AFK A;  3USU A;  3K48 A;  3O0W A;  5FZG A;  2WR9 A;  4MOA A;  4QWN A;  3T0A A;  5LK7 B;  3DGT A;  3ELN A;  1G7Y A;  4YG3 A;  3BPS A;  1RVF 3;  1RUN A;  3WP4 A;  4PDW B;  4XAB A;  1BXH A;  4DEQ A;  3VKL A;  2Y60 A;  4Q8L A;  3POY A;  4JKK A;  5BV6 A;  5KXD A;  3FLR A;  4GKY A;  1GKB A;  4NRO A;  1O59 A;  1OT5 A;  1YQ5 A;  3NNF A;  1ONA A;  4X6R B;  1DFQ A;  1LGN A;  3QOP A;  3WF4 A;  1BBT 2;  4N7U A;  1KS5 A;  2XBO 1;  2X8K A;  3OBA A;  2EIC A;  2VOV A;  4LK7 A;  3SKV A;  4M3C A;  4W6X A;  2WQ4 A;  4IEQ A;  4ARY A;  5FYB A;  5DZF A;  3ZSK A;  1BQP A;  3KM5 A;  4LBM A;  2AEY A;  2DTW A;  2UY8 A;  3TRS B;  1NZI A;  4COY A;  2VCM A;  5K0U B;  2HWD 1;  3THT A;  4RA0 A;  1GIC A;  4GD4 A;  2H0B A;  1RUG 1;  3VDA A;  1W6P A;  1LOE A;  1BBT 3;  1S4C A;  2R04 3;  2ZKN A;  3LEK A;  5LK5 A;  4MG2 A;  2RR1 1;  1POQ A;  2EXJ A;  1VRH 1;  1S0I A;  1W6M A;  4BIF A;  2CTV A;  1MS3 A;  3H50 A;  2Z2S B;  4FOW A;  4LOS A;  4A44 A;  1UYX A;  3MLL A;  2VUD A;  3ZFG A;  4QPG A;  3VHR A;  3ZPY A;  3GCW A;  4JGY C;  4CEY C;  3OD0 A;  1PMH X;  2WLQ A;  3PHM A;  5A70 A;  2OPK A;  4FP3 A;  2P17 A;  4XJZ A;  1VRH 3;  1PVX A;  4MXW A;  2CDP A;  4AVS A;  3NAP A;  4IV3 B;  1OOP C;  2P6C A;  2ZGP A;  1C8M 1;  1QDC A;  3I2D A;  4KWK A;  1JZ6 A;  3RGB A;  5JLV A;  4TZD A;  1UO9 A;  3GCX A;  4Y1U A;  1EUT A;  4HK8 A;  4OUL A;  2D6N A;  1W2U A;  2XML A;  2DFC A;  4HET A;  1OLM E;  5KR7 A;  3NMB A;  1AXK A;  5JPN B;  3V0B B;  4KL1 A;  2NQY A;  1HJG A;  1ZZ9 A;  4P9J A;  4MHR A;  5FZ3 A;  5BYN A;  3HNY M;  1K5M C;  2J1T A;  3WG2 A;  2A7A A;  3M3C A;  1XU2 A;  2P3Y A;  1JYC A;  3NKT A;  3ZFF C;  4GMP 1;  1QQP 3;  3ES4 A;  4QDS A;  2JE9 A;  3ZR6 A;  4CPB D;  5C5T A;  3GNE A;  4LT5 A;  2WS9 3;  4RGG A;  5SV5 A;  4AED C;  1G9F A;  5CVR A;  2HLE A;  3C7F A;  1UPS A;  5FKB A;  1AZD A;  3R4U A;  5IK4 A;  5GJ6 A;  3NV2 A;  2AEZ A;  3SEE A;  1FOD 2;  1CJP A;  3HVD A;  4UW3 A;  3DPR A;  3ACF A;  3GJB A;  1UZW A;  1S0E A;  2JDZ A;  4BOW A;  3NV4 A;  1CAU B;  4DRV A;  5C8C B;  5IK7 A;  2B9U A;  4OLL A;  1US2 A;  1WKY A;  2BWC A;  5CFD C;  3ENR A;  5F3I A;  4C91 A;  4COU A;  1O3Q A;  4IE4 A;  5EYY A;  4ATF A;  4ZZ5 A;  4FP2 A;  2R07 3;  2XOM A;  4DOU A;  1A3K A;  2QQU A;  3WUC A;  2RJL A;  3ZXG A;  3WY6 A;  1XC6 A;  4SLI A;  2NYY A;  2F6B A;  1RUD 3;  1U5Z A;  3JBG 1;  4B7E A;  3ZXL A;  1J84 A;  2BNN A;  2HBU A;  3GAL A;  5BNO C;  4CEW C;  4XZP A;  1HN0 A;  5IVB A;  3WQ0 A;  3RNS A;  4LE3 A;  2K9Z A;  4XE9 A;  1W8W A;  1G9C A;  2W0X A;  1JYT A;  1LOG A;  1UX6 A;  2J1S A;  4HPK A;  3UJQ A;  2A1X A;  2JG8 C;  4JGZ C;  1O7F A;  5GM0 A;  5JR7 B;  2YGM A;  2F4P A;  4KNC A;  3IMM A;  4CDQ A;  3ACG A;  2YC0 A;  4UWD A;  3JD7 2;  2A3X A;  2RDS A;  4BQY A;  5FCC A;  5AC9 1;  4QU2 A;  3ES1 A;  1S0D A;  4TTG A;  1ZX5 A;  3HD8 B;  3K77 A;  4BK5 A;  1IKP A;  5EHD A;  3HQU A;  3VN4 A;  3I3E A;  3PLQ A;  1JHN A;  2XJV A;  3THC A;  3ZXA C;  2DWR A;  3TWI A;  3VBH B;  1RUH 1;  3CEW A;  2RS3 2;  3K4A A;  2FCT A;  3P6B A;  4LTA A;  2VZR A;  4COW A;  5A6Q A;  1SLL A;  5DAQ A;  5FZO A;  1NOV A;  1LEM A;  2PHF A;  3M7A A;  3HPN A;  3BKZ A;  1QJE A;  2X53 S;  1OD5 A;  2JG9 C;  2DF7 A;  4RQP C;  3CDZ B;  1UU4 A;  4JDM A;  4GH4 C;  1RUC 1;  4LHK A;  3ZMO A;  5CEH A;  4QQH A;  2VME A;  2VUA A;  1FOD 1;  3AB0 A;  2QJV A;  3DPR C;  3FX3 A;  3H42 B;  4FQ4 A;  4N8M A;  4YG6 A;  2VMH A;  3WZ1 A;  1RVF 2;  1YFU A;  5LCW L;  5BY5 A;  3FMG A;  1GZ9 A;  1F35 A;  3FWE A;  1POV 0;  5IVJ A;  4G9S B;  1V0A A;  4YM1 A;  2RS1 1;  3VD7 A;  2PXJ A;  3ACI A;  1FAT A;  3I2I A;  4N90 A;  4B1M A;  4CCK A;  1MQT B;  3H8O A;  1W9S A;  4YZ1 A;  4E9K A;  4MSV A;  3RZK A;  4LBQ B;  1W6P B;  3BGA A;  1LB2 A;  5IVE A;  3KT7 A;  4UI9 L;  3J7M A;  1N47 A;  2GC3 A;  4NHK A;  1NXM A;  1POV 1;  2JEN A;  3LEI A;  4I3G A;  1C8N A;  1S2E A;  4Q4Y 1;  2GAL A;  4XET A;  3ZLI A;  4XTM A;  3IDC B;  4Q0Q A;  1QY4 A;  2ARA A;  3BTA A;  4RR3 C;  1EV1 1;  2GZW A;  5BNP B;  5CG9 A;  1BZW A;  3SQO A;  2RMU 3;  1WW4 A;  3H3L A;  1HQL A;  4DQA A;  3KF5 A;  4H7L A;  4ES9 A;  5E88 A;  1RTV A;  2VZ1 A;  4YM0 A;  2OKX A;  5IVC A;  4AHY A;  4KBZ A;  2IXL A;  3LQC A;  2R7E B;  5F32 A;  4PT6 A;  5FZ1 A;  4MGT A;  2TBV A;  2Z69 A;  4NIG A;  2TEP A;  3RMY A;  1OUS A;  3QAC A;  3VBR C;  3IZO A;  3WG3 A;  4HVQ A;  3AMP A;  5FY0 A;  2Y0I A;  5JZG C;  3TEZ A;  4NOT A;  4Y1Y A;  1QXP A;  3DCQ A;  5DG2 A;  4S2F A;  4UBH A;  4BLI A;  5F39 A;  4J6G A;  1WD3 A;  4H14 A;  3SEP A;  1UYP A;  3PUH A;  1L3J A;  1OHF A;  1GZT A;  1CIW A;  3MBW A;  3V0A A;  3D4K A;  1D4M 2;  4OUE A;  3S30 A;  4LBQ A;  4LKF A;  5FZI A;  1BYH A;  4JRL A;  1RUC 2;  2VR4 A;  3HT2 A;  3WLU A;  5FZK A;  3ITQ A;  2YRO A;  4Q4V 2;  3CO2 A;  3BTY A;  4CZS A;  4BM8 A;  3K3N A;  1KDM A;  1ULP A;  4WVM B;  2QNK A;  4UF0 B;  3AKR A;  1TME 3;  4CCL A;  1FXZ A;  1REF A;  5DAV A;  4AI9 A;  1AUY A;  3LSD A;  3W9A A;  2VTX J;  4XCA A;  4BIO A;  3POW A;  1BMV 1;  3MV0 1;  1JOB A;  3C7E A;  3F95 A;  3M3E A;  3ZN5 A;  4DO0 A;  2OQ7 A;  2AR6 A;  1ST8 A;  2BTV C;  2ZX2 A;  5FUP A;  4GWJ A;  1VB4 A;  5GLW A;  3B00 A;  1GYK A;  2PAM A;  3WW3 A;  4WM7 B;  4AZZ A;  2JDM A;  3LIH A;  5FYI A;  1UX7 A;  2Y26 A;  3CJX A;  4Z82 A;  2EID A;  3ZDV A;  5T55 A;  2BWA A;  1C28 A;  4FPO B;  2D43 A;  3HWJ A;  2JG9 A;  1RMU 2;  3KS7 A;  5F5Q A;  4FOY A;  3VBR B;  4XF3 A;  4XDQ A;  3ZSJ A;  2WYS A;  1ULG A;  2VZO A;  1SDW A;  4Y22 A;  3SLI A;  4QX7 A;  4XBL A;  4IQP A;  3ZYI B;  4TLF A;  1XNA A;  3AMN A;  5IW0 A;  4A6O A;  1RHI 2;  4E2G A;  4AE2 A;  2BVV A;  2DYC A;  4F7Z A;  3BOP A;  4CDW C;  4LOT A;  3O12 A;  5ABJ C;  4LMF A;  3INA A;  5L19 A;  3C3V A;  3ZYF A;  1W9F A;  2ZGL A;  4UT5 A;  1BHG A;  1W05 A;  2D6O X;  5F9T A;  5KWR A;  5EFU A;  3HIF A;  4DEV A;  1ZBE 2;  2VZT A;  4YVS C;  2WBK A;  2HWF 3;  2PMW B;  2P3K A;  3ZOI A;  1TMF 1;  2XKO A;  1C5H A;  1DIW A;  1MS9 A;  5BNP C;  5FY1 A;  1F4H A;  5A3U A;  1QJZ A;  2BFU L;  1Q5O A;  1GV9 A;  2R04 1;  2O1Q A;  4Q4X 3;  3HAG A;  2JIG A;  3FN9 A;  5IAX A;  3RYR A;  2JDK A;  1AX0 A;  2WZP P;  2HWD 3;  1N3O A;  5ANN A;  3MUZ 1;  2JKB A;  1AL2 3;  3WDU A;  2ZZJ A;  2V5D A;  4XQW A;  4UW6 A;  3N9L A;  5FY9 A;  3LF7 A;  4AGG A;  4XDP A;  1J1T A;  1VAM A;  2QQJ A;  1DYK A;  4HFS A;  4QB2 A;  2OX0 A;  3FHA A;  3B7M A;  3HQX A;  1HB3 A;  1PIV 1;  2Q8E A;  2YYO A;  1VB2 A;  3LSE A;  4EV0 A;  4NPM A;  4C1W A;  3CNA A;  2OT7 A;  4XDO A;  4XFC A;  1W6Q B;  3EHK A;  4GXL A;  3WW4 A;  4Y33 A;  4WVM A;  4FO9 A;  2PEL A;  1S0F A;  2DU0 A;  1WCU A;  3USU B;  2OQ6 A;  4BXS V;  1H30 A;  1JZ4 A;  4E2S A;  3OTF A;  1GQH A;  4CE8 A;  2BV4 A;  4MHU A;  5ACA 3;  5GLU A;  1YC6 1;  2VO5 A;  4QQO A;  2ZEX A;  2G9F A;  3AZY A;  3PL0 A;  1TNF A;  5LZ6 A;  1UKG A;  3MLK A;  2A6X A;  1JS9 A;  2AYH A;  4BA6 A;  4XUT A;  3WCS A;  1ZBA 2;  5D8A B;  5EIY B;  1CAW B;  1AR6 2;  3III A;  2QTW B;  2HWF 1;  1MVQ A;  2DU1 A;  3GDB A;  2ETE A;  4XBN A;  4MZU A;  3B69 A;  3T09 A;  5FYM A;  5DAW A;  2O8O A;  5HV4 A;  1GP6 A;  3TB0 A;  5FY4 A;  4M0H A;  4XJ9 A;  3U37 A;  1W6N A;  1RUJ 1;  2YZ4 A;  3GBF A;  4CEW B;  4M0N A;  3FE5 A;  2NMN A;  2WSV A;  3KT1 A;  4KH9 A;  1UWW A;  4BQ5 A;  4B29 A;  1OOP A;  2V5Y A;  3VZO A;  4LIU A;  1BEV 1;  1LGB A;  1MS0 A;  4K8R B;  5AVP A;  4BYY A;  5C8C A;  3X29 B;  1CX1 A;  2E6V A;  4R8H A;  5A3M A;  1XND A;  4LA2 A;  1B35 C;  1QU0 A;  3O1T A;  2YC4 A;  1VMF A;  2HKX A;  3VBO C;  5GKA C;  1D2Q A;  2XUE A;  1VBC 2;  2I07 B;  4HN0 A;  4NR1 A;  3S6P A;  4AGR A;  1QKQ A;  2B9V A;  3T0D A;  5IWF A;  1U5I A;  3OOX A;  3WG1 A;  2R06 1;  1JZ5 A;  1W06 A;  5T52 A;  4E4Z A;  3OEB A;  4QPG B;  4KMQ A;  1DZT A;  4I09 A;  1PO1 3;  2YDE A;  5CFC C;  1US3 A;  3OYW A;  1YRZ A;  4FPG A;  4GMP 3;  2X05 A;  3WG4 A;  4F8A A;  4EN7 B;  4EYU A;  1D4M 3;  1H2N A;  5C3R A;  1FPN 1;  3GF6 A;  2YC2 A;  1LUL A;  3C2U A;  2OS2 A;  1IS5 A;  2C9K A;  4BWO A;  4I0A A;  3AJY A;  3VBS C;  4KGQ A;  1OMI A;  1W0N A;  2C1F A;  1UZY A;  2YXS A;  1C1F A;  5FP7 A;  2OVU A;  1LES A;  2L9L A;  1U5Y A;  4OQ8 A;  3EJK A;  4CDU B;  4O7X A;  4QPI C;  1JYV A;  4E8D A;  3KQR A;  4OYU A;  3WDW A;  4YVW A;  3OYW B;  1UOG A;  2QKD A;  2E7T A;  2XHN A;  2Y6J A;  3DV8 A;  4WVV A;  1W3X A;  2R1B A;  4XUR A;  4Q0S A;  2VQT A;  3MW4 A;  3NST A;  1SBD A;  3WNO A;  3AXE A;  4NID A;  5A3T A;  4FTB A;  2RDQ A;  5EPA A;  1VBC 3;  5B4N A;  1V6I A;  1T2X A;  1GR3 A;  1UY0 A;  1XU1 A;  2RVA A;  3N7J A;  1HKD A;  4JX0 A;  5EJ3 A;  3SCF A;  4DY5 A;  4AGV A;  3S5A A;  3PIJ A;  3K46 A;  1XPW A;  2KD7 A;  2OXB A;  4CSW A;  1W8U A;  4GAZ A;  4KBB A;  1ALY A;  3LFI A;  5JZG B;  2IVJ A;  2WAO A;  3S7I A;  4RS5 B;  3VZJ A;  4LBK A;  2WO2 A;  2XLG A;  4P9G A;  1Q8Q A;  4L8Q A;  4URA A;  2QQV A;  4NVP A;  3BTZ A;  1IZ3 A;  1GLH A;  3RG0 A;  1FV3 A;  4FVV A;  5KHG A;  1FV2 A;  3AC0 A;  1GMM A;  2ZGN A;  1O5L A;  1W28 A;  1H8V A;  2JDN A;  1WCK A;  5FK7 A;  5FMC A;  3ZN4 A;  1BVP 1;  1LOA A;  1LKN A;  5L7O B;  1ULF A;  2DUP A;  1W99 A;  1QJX 3;  2CSG A;  5LRS A;  4KU7 A;  5FZF A;  2I74 A;  5JR2 A;  1RUI 2;  3FFQ A;  4YZ5 A;  5GZG A;  1MZE A;  4YM3 A;  3HN1 A;  1KIT A;  2ZCW A;  1ZBE 3;  1PIV 2;  3NNJ A;  4FAH A;  4QKB A;  3ETQ A;  4YNI A;  3NKG A;  3M3Q A;  2YPJ A;  2QUO A;  3NJV A;  1UOF A;  1R08 1;  2TNF A;  3HNB M;  1RUF 1;  4Q4W 1;  3VLB B;  4QX1 A;  2CWM A;  1FOD 3;  2E31 A;  4PIY A;  3ZFE C;  1S0B A;  1DU3 D;  2N7G A;  4MGZ E;  2HYK A;  1H8T A;  2XL7 A;  3POF A;  5ABJ A;  1QOT A;  2XQR A;  2QQO A;  3BB6 A;  1EPW A;  2DBN A;  5DUW A;  2BRT A;  4FOV A;  1IG0 A;  2DCJ A;  2E7A A;  4KWL A;  2GSY A;  4LQR A;  4A2U A;  3UES A;  2ZHK A;  3WDT A;  4JC1 A;  1F31 A;  3DL3 A;  2EAA A;  4Q4V 1;  4XF4 A;  2ZKL A;  4WM8 B;  2DDU A;  2HWB 3;  3E97 A;  3T2Q A;  4R9C A;  1AR9 1;  3ZFE B;  2BPA 2;  1D7P M;  5LRR A;  4OZO A;  3OBT A;  1SFY A;  4ZHN A;  3DEM A;  1LHW A;  1WCS A;  2YU2 A;  1REE A;  3IAP A;  5EJZ B;  2E7Q A;  2VD7 A;  5L9R A;  2HBT A;  5BNO A;  4NMI A;  4IER A;  2VW1 A;  2XG3 A;  4FPH A;  1KFX L;  2WNE A;  4ISR A;  4I0W B;  1PHM A;  1CES A;  4P5H A;  5FUN A;  5JI7 A;  1AHS A;  2RS5 2;  5FZ9 A;  4RN5 A;  4XFG A;  1NE6 A;  4GB3 3;  4YLZ A;  4AK3 A;  5JOW A;  3VD4 A;  4A4A A;  5A7Q A;  2J42 A;  3NNL A;  4AW7 A;  3EQE A;  3PIG A;  4AI3 A;  2W2I A;  3WNN A;  5JMO A;  1J3Q A;  1MS5 A;  3WNL A;  3AZZ A;  2ZMN A;  3DN7 A;  2PQQ A;  1O8S A;  5D8A C;  5FXX A;  2GN7 A;  1WBL A;  3C7H A;  4RYD A;  2E33 A;  1N1T A;  1VBC 1;  2Y38 A;  4PBP A;  2ARX A;  5C70 A;  3JXS A;  3OUJ A;  3POB A;  1Z7S 3;  4QU1 A;  5FBZ A;  5FO8 B;  5FPX A;  3G6J B;  5IK5 A;  1ASJ 3;  5IAT A;  3ILR A;  3FZ3 A;  5DPN A;  2VUC A;  3VZL A;  5K7P A;  5CKM A;  1ODN A;  5KHK A;  1KEX A;  2Z5W A;  3AL5 A;  3CLP A;  2YU1 A;  3RMX A;  4GAL A;  1E5H A;  4QKN A;  2WKK A;  5LAS A;  2EIE A;  3E6B A;  3WSO A;  4MXV A;  4NO4 A;  1EYB A;  4ZXK A;  4IXL A;  5BXX A;  1CAU A;  3ZFF B;  3BUC A;  2BVB A;  5DZE A;  2D3P A;  2ERF A;  1SCS A;  5A33 B;  3CIH A;  2RJ2 A;  1XNB A;  4GH4 B;  2YUE A;  4WZC A;  4K6B A;  3VV1 A;  2PLV 2;  1H6X A;  4EQV A;  3RZH A;  2PLV 1;  2VMI A;  1PO2 1;  1R08 3;  3PJY A;  3LCP A;  1LU1 A;  1K42 A;  2DUQ A;  3M70 A;  4QB1 A;  4CYD A;  3KVA A;  1KJR A;  2W92 A;  4LO6 B;  2YPD A;  1HB1 A;  1PO1 2;  5FP4 A;  5DAP A;  1PO1 1;  3H0O A;  1QJY 1;  3RZG A;  1UMI A;  1W8O A;  4Z1V A;  2R6Q A;  2F4L A;  1YQ8 A;  1MS8 A;  4QXK A;  1GSL A;  1W6O A;  4G3Y C;  4QGN A;  3MPB A;  3VKN A;  1DZR A;  1UY2 A;  2BYV E;  2I2S A;  1J3P A;  1UKR A;  1SDD B;  5FMD A;  2Z4F A;  2UWA A;  1SLA A;  2XJU A;  1YO8 A;  4Q4X 1;  1JXN A;  4XFH A;  4JGY B;  4KI5 M;  1VRB A;  4UF0 A;  5FPA A;  2VZU A;  4XAC A;  4ASM B;  2YB7 A;  5FPL A;  1VBB 1;  4YRD A;  5H9P A;  4Y5Z 0;  4HSJ A;  3AXD A;  4WV8 A;  3T2T A;  1W9W A;  3MDP A;  4RGA A;  1A34 A;  1UOB A;  1XE8 A;  2EVX A;  4Z92 B;  2XJQ A;  4Q4Y 2;  5IJR A;  4F83 A;  3FHQ A;  2VQ0 A;  4Q8K A;  1MAC A;  4M3C F;  4LEJ A;  4LBL A;  4PHZ A;  4W50 A;  4MGQ A;  1BK1 A;  1I5P A;  4OI0 A;  4UW4 A;  3T2O A;  2W9X A;  1PGS A;  2GAU A;  1YJL A;  2G9Z A;  2XR4 A;  2EIG A;  2VY0 A;  2Q0A A;  1AR7 2;  1O6U A;  1O4Y A;  4HON A;  3D6E A;  3RFR A;  2O8Q A;  4ZZ8 A;  3FLT A;  4IE5 A;  3OGJ A;  1QOO A;  1UNB A;  2Z79 A;  3KV9 A;  1GAN A;  1QMJ A;  5KHJ A;  2ZAH A;  3ETP A;  2V09 A;  4ISQ A;  1I1E A;  2FDI A;  2YBS A;  3W58 A;  3ALQ A;  2E53 A;  5I0T A;  4YFZ A;  1NLS A;  5F5I A;  3MW2 A;  1MQT A;  4CCJ A;  1HLC A;  1COV 3;  5G04 L;  4IEV A;  1GOH A;  4CDU A;  2C0Z A;  3UYJ A;  3ME2 A;  2MEV 3;  1DGR N;  3I3D A;  4AI8 A;  1WLC A;  3AYE A;  2G19 A;  3LZZ A;  4QGM A;  4Y20 A;  4QM9 A;  3NAP C;  5KHH A;  3E6D A;  4A41 A;  4AED B;  3OGV A;  3D3A A;  1K12 A;  2JE8 A;  1S55 A;  1VMH A;  2BFU S;  4N9H A;  4NWV A;  2Q30 A;  1NLQ A;  1Q8O A;  2Q1Z B;  4MGY E;  5LEJ A;  2C26 A;  1LRH A;  1QNW A;  2B42 B;  2BGC A;  4FFI A;  2NN8 A;  3OPW A;  3Q9O A;  1UL9 A;  3P1I A;  3WP6 A;  2VNG A;  5CB7 A;  2RDR A;  2R07 2;  4HK9 A;  4PQ9 A;  1RUC 3;  3E5Q A;  2DVF A;  1OF3 A;  3W5M A;  1DQ0 A;  4IE6 A;  1IPK A;  1LEN A;  4L92 A;  2JG9 B;  3KCY A;  1XNK A;  5DDJ 3;  2IXI A;  4D6R A;  1I5Z A;  4OQ9 A;  3ECQ A;  1EP0 A;  1O3T A;  1W8H A;  2VGD A;  4YGD A;  4K9S A;  4P9W A;  1V6L A;  1DQ5 A;  1NCR A;  1O8P A;  1WD4 A;  1W2O A;  1CQ9 A;  5J98 B;  1VBD 2;  2WFP A;  4CCE A;  4EZH A;  3NRU A;  4C0H A;  1W0P A;  1ENQ A;  1G9A A;  2ZEZ A;  1VRH 2;  3V64 A;  2BNO A;  4JVA A;  4D7T A;  1QHD A;  1W90 A;  2ADE A;  3VDD B;  1X9T A;  1OH3 A;  5I91 A;  1YCI A;  3T4H B;  3VZM A;  4AI0 A;  5CKQ A;  1LOB A;  2GNB A;  1E57 A;  4ONU A;  1HXS 3;  3PME A;  5T5P A;  3ROU A;  5CFD A;  5FPZ A;  1IKQ A;  4AVA A;  4Q0U A;  5CFC A;  1RUE 1;  2C5D A;  3RQ0 A;  1R64 A;  3KVB A;  2RS5 3;  3LFM A;  1HXS 1;  2DFB A;  2HWD 2;  2P3J A;  2X5I B;  4IET A;  4NAM A;  2BJS A;  4CP9 A;  2ILM A;  2YFU A;  4OMC A;  4FAG A;  3KMH A;  2LS6 A;  4AEJ A;  4UFK A;  2EXH A;  5I0R A;  4Y1X A;  1RHI 3;  2Q1M A;  4PLO A;  2J22 A;  2BP6 A;  4NE9 A;  3A0K A;  1WLW A;  4V1P A;  1POV 3;  4NII A;  2RR1 2;  3PTR B;  4P9L A;  4B4R A;  2RDN A;  4FTE A;  5CIR A;  5KC5 A;  5AFB A;  1GOF A;  1VBE 3;  1ZYB A;  3DPR B;  5F6L B;  4CVU A;  4C8D A;  3GBW A;  1JYX A;  2HJI A;  4EZ4 A;  3I2H A;  3RSJ A;  1ASJ 2;  2ATF A;  4QPI A;  5DAX A;  3ZSM A;  4NRP A;  2JDA A;  2A6V A;  5H9Q A;  2ZGR A;  4MLO A;  1OFN A;  2OZJ A;  1SPP A;  4WBB A;  4AXO A;  2FMD A;  3WX5 A;  3AYC A;  4DXR A;  3WV6 A;  2PQS A;  2VTF A;  5DDJ 1;  3Q8E A;  5CNA A;  1MZ6 A;  2A71 A;  4XQD A;  3JU9 A;  5F3G A;  2D98 A;  4K1Z A;  5JXI A;  1E5I A;  2ZXQ A;  2VMF A;  5AVA A;  1K5M B;  3KHB A;  4MX3 A;  2WLP A;  1FMD 3;  4N9I A;  5BPX A;  2VZS A;  1AL2 1;  3I97 A;  5FYT A;  1AL2 2;  4L9B A;  2PHD A;  3OGR A;  1RUF 3;  4QPW A;  1C3H A;  1JN2 P;  1CPN A;  1UPI A;  3C8X A;  1UYY A;  1FAY A;  3R05 A;  4O9G A;  3RPQ A;  2GNM A;  4ZKT B;  5LWB A;  4LHL A;  2JKX A;  1XJA A;  2XL9 A;  1UU5 A;  1ACC A;  5K8S A;  4KGG A;  4C90 A;  1ZZ6 A;  2WRA A;  1ZRE A;  1V6M A;  5CAD A;  5F1R A;  3RZM A;  2GDF A;  4BH9 A;  4AFM A;  1N1V A;  1V9U 1;  2GMM A;  3IB3 A;  4KG8 A;  3OJB A;  4JTN A;  4M01 A;  4QPG C;  5GZC A;  1ULO A;  4AQT A;  3CBN A;  3DYP A;  3N7K A;  3SH4 A;  4E8C A;  3E1F 1;  5HXM A;  4YZ3 A;  4JAA A;  4QB6 A;  2XWB B;  1WMD A;  1DZQ A;  1PMI A;  2HH9 A;  2XBO 2;  1JI6 A;  4P02 B;  1C5I A;  4QAW A;  4XJ8 A;  4HT1 T;  1S0J A;  5J96 B;  4QX0 A;  1WW7 A;  4CCC A;  3RZJ A;  2CNA A;  3SKJ E;  1KFU L;  5FP8 A;  3RJR A;  3NV3 A;  4DIN B;  1VBE 2;  1MZ5 A;  2RS3 3;  2Q8C A;  3VB9 A;  3ZKY A;  2J1U A;  1HIX A;  2D6P A;  1I9R A;  5KXC A;  3UNP A;  4E27 A;  1GQG A;  2P6H A;  2CAV A;  1PM7 A;  3IM0 A;  5A7W A;  1IPS A;  5IYY A;  5CAZ A;  5JXG A;  2FCV A;  3HEI A;  4LHN A;  1F4A A;  5A3N A;  2DVG A;  3LEM A;  4AAP A;  2VMD A;  2D97 A;  1XRU A;  4IEW A;  1QJU 1;  4UYB A;  5A3P A;  2QZ2 A;  4EWD A;  2GC0 A;  1K5J A;  1LNS A;  2VH9 A;  3OUH A;  5EYX A;  1LHU A;  1DQ1 A;  2XVL A;  3C7O A;  4JQT A;  1T6G C;  5A7S A;  4Y1V A;  3WR0 A;  4CCN A;  4IV1 C;  4V2V A;  5SV8 A;  1PZ7 A;  3AYA A;  1LGC A;  3ZN6 A;  3N9Q A;  2IVI B;  3KB5 A;  5FY8 A;  1XSQ A;  3R4S A;  2FCU A;  4IUG A;  4R4X A;  1ZA4 A;  3SCH A;  4EN0 A;  5BUV A;  3I3M A;  5DG1 A;  4UBG A;  2JWP A;  5F7U A;  4RGK A;  4EN8 B;  1OSG A;  1H1A A;  1SLC A;  3B93 A;  4DIQ A;  1COV 2;  2QQL A;  4RL7 A;  2D3S A;  2XJT A;  3TOJ A;  2ARE A;  1ULD A;  2XBO 3;  3BOD A;  3MIG A;  4P14 A;  5FZH A;  5C9A B;  1DHK B;  5L9V A;  4HLT A;  1W6Q A;  2WO3 A;  1FMD 1;  1CN1 A;  1WME A;  2QVS B;  2RV9 A;  2XJP A;  3N9P A;  1HN1 A;  4DZG A;  1O3R A;  2BU9 A;  4EWE A;  3WF2 A;  4AFC A;  5C8W A;  2B39 A;  5IK8 A;  4E4D X;  2C9A A;  3KLS A;  2ZS6 B;  2OYZ A;  4XFI A;  2KXL A;  1F2N A;  3UJO A;  2OUJ A;  5A7N A;  4AQS A;  4R9B A;  1DBN A;  1JTZ X;  1V6J A;  2LRO A;  3J7N A;  3WDX A;  1RB8 G;  5GZF A;  4N7I A;  1Q43 A;  4A6S A;  3VBU C;  4ORF A;  4JCK A;  5FO7 B;  2VEC A;  4R9D A;  3ATG A;  4Y4R A;  3W59 A;  1NA1 A;  3I3B A;  3FUQ A;  1UZZ A;  1J3R A;  3M3I A;  4CP0 A;  4H2A A;  1BEV 3;  1Q3E A;  1ZM1 A;  3AKS A;  4RS5 A;  3W20 A;  3WOG A;  3A0N A;  4MXW B;  5FZC A;  5IT6 A;  5L36 A;  4K8F A;  1GZW A;  3LA2 A;  4QHO A;  3KV5 A;  5FLI A;  1YNA A;  2ZMK A;  2PHT A;  4H7M A;  2ET1 A;  4X6Q B;  1KXG A;  1C8M 2;  5JVV A;  5BNQ A;  1G9D A;  2Y6K A;  3CZJ A;  4LXL A;  5FLH A;  1ZVF A;  3ST7 A;  5K9Y A;  4XUN A;  3QH6 A;  1TMF 2;  3UV9 A;  5L7O C;  4NHL A;  3KHC A;  2ZEW A;  1XB9 A;  4BPZ A;  3FL7 A;  3IIA A;  2UU8 A;  1NCR C;  1BVV A;  2C4X A;  2GND A;  2O0O A;  1XSR A;  3FJS A;  5FPV A;  4K1Y A;  1OUR A;  5C7G A;  4XMA A;  3IKW A;  2VBB A;  2AGS A;  2ZJC A;  4K40 A;  4XQ4 A;  1GP4 A;  3BPZ A;  3K51 A;  1UMH A;  3LAG A;  4XHX A;  5H9R A;  3S5Q A;  1CVN A;  1UD1 A;  4XFF A;  1BJQ A;  4B1L A;  2LTN A;  1RUE 2;  4Q2F A;  5ACA 2;  1TZO A;  2VBD A;  5ACA 1;  4NIH A;  2PHW A;  2QQW A;  2LW8 A;  4NRQ A;  3SMH A;  2XVG A;  2VCB A;  5IAV A;  4BCU A;  3J7L A;  5JOX A;  1GBG A;  2XDV A;  3WNM A;  3KSC A;  4XUQ A;  3MIH A;  4XHB A;  3P3N A;  4M00 A;  1YUD A;  2WYF A;  4QX8 A;  5FZ6 A;  3RS6 A;  3NWK A;  2DTY A;  2ZX0 A;  3KV6 A;  1ND2 A;  4I0B A;  4FSJ A;  1WZX A;  1OUX A;  4DMI A;  3IN9 A;  2P34 A;  1GNH A;  2VVE A;  4XFB A;  3AP9 A;  1CX4 A;  1OA4 A;  2P3I A;  3THP A;  4P00 B;  5HXV A;  1DLL A;  1HQW A;  3LDB A;  5BNN B;  3AKQ A;  3CJI C;  2WFF 2;  4PDW A;  4BZ4 A;  5JSR A;  4IEO A;  3VDB A;  1C8M 3;  4FI9 A;  3N9N A;  3PVN A;  3TNQ A;  2MEV 1;  5E6H A;  2AUY A;  3APB A;  4I3P A;  5FYY A;  4N43 C;  1TMF 3;  5FP9 A;  1HW5 A;  3BAL A;  5FXW A;  5DMY A;  2B45 X;  1Y43 B;  4ZS2 A;  2GC2 A;  5FTT C;  4XXP A;  1NCQ A;  4X8N A;  1AYN 3;  1CIY A;  2J7M A;  3WIN E;  4BXF A;  3ZR5 A;  4SBV A;  1CZS A;  2IXK A;  2B4K A;  2WFF 3;  4LO8 A;  4XC9 A;  1NCQ C;  1NE4 A;  1SLI A;  4NRM A;  5CZK A;  4CA9 A;  1Q8P A;  3S57 A;  3T0B A;  1B09 A;  3EO6 A;  2VPV A;  2SLI A;  5C33 A;  5FZ4 A;  1HB2 A;  2WIN B;  4GMP 0;  4MAD A;  3ZM8 A;  3K2O A;  1MR5 A;  2AAC A;  1DYO A;  1G6N A;  4LLO A;  5FKC A;  4UFM A;  3DXU A;  4AG4 A;  5JZG A;  2BQP A;  2DUR A;  5ABJ B;  1RC6 A;  4RR3 B;  4CTE A;  2VC9 A;  1LU2 A;  1LTE A;  1EAH 3;  1IPJ A;  2ZOE B;  3OF1 A;  3SCG A;  1RUG 3;  1ZRR A;  5JSP A;  1WCQ A;  5HI0 A;  1HV0 A;  3AKP A;  4QGL A;  4MGI E;  4MGK E;  3U78 A;  3N35 A;  3RZL A;  3JB8 A;  3JQX A;  1YFW A;  4RFT 0;  4P9Y A;  3VHN A;  3NL1 A;  1RUO A;  2LM3 A;  1V6O A;  3ZPO A;  1H1I A;  3T2P A;  2SBA A;  3A23 A;  3WEZ A;  1ZNP A;  1OPO A;  3H8U A;  1OQE A;  5L9B A;  5IFT A;  3Q8C A;  4AI2 A;  3B02 A;  4OHV A;  3VKM A;  3O1U A;  3ZSE A;  4IND A;  2G9G A;  1X50 A;  3T1L A;  3NJY A;  4AEM A;  4BJ0 A;  5FZ7 A;  1UZ0 A;  1O4T A;  1V9U 2;  3EBR A;  2W5F A;  4GH4 A;  2ZHL A;  1OH4 A;  1OQD A;  2VVF A;  3CF6 E;  2W68 A;  5LBC A;  3E5U A;  3T4V A;  4I2O A;  4IGP A;  3RWK X;  1YQC A;  4FPJ A;  2PLV 3;  2W91 A;  1VPH A;  2NMO A;  3IPV B;  1Z0H A;  4QX2 A;  1XXN A;  1V70 A;  4N53 A;  4PDW C;  4XOG A;  5BNN A;  2Y8K A;  1E5S A;  1RUJ 2;  1MVE A;  1QH7 A;  5FBJ A;  2WT0 A;  5FIX A;  2UUR A;  4BU2 A;  4B7K A;  2VZP A;  2YY1 A;  3LE0 A;  5LW9 A;  4FQZ A;  3MEP A;  2HWE 1;  3BU7 A;  1GNZ A;  4CDQ C;  4GJZ A;  5ANQ A;  2YBK A;  3IDB B;  1QJX 2;  1R09 1;  3PUR A;  4QXC A;  3BI3 A;  1YEW A;  4NJ4 A;  2G1M A;  4JGZ A;  3SNM A;  1RUH 2;  1PK6 B;  3CJI A;  3V56 A;  1ZRF A;  3SHR A;  2QZ3 A;  1NCQ B;  2IXJ A;  1UMZ A;  3H7J A;  3AL6 A;  3ZSL A;  5JMC A;  1BBT 1;  2BGP A;  3ACL A;  1Y9G A;  2JDH A;  3AP4 A;  3IDA A;  3JCI A;  4AWD A;  4XBQ A;  5JI9 A;  4UXA A;  3KQ4 B;  4ZU7 A;  4HOO A;  5A80 A;  4A45 A;  3N3H A;  4GJY A;  3N9O A;  1HX6 A;  4OCT A;  2J1R A;  2JB4 A;  3SIS A;  1WW5 A;  4CCD A;  1G9B A;  4Y3O A;  2VTX A;  4CXY A;  4L97 A;  3VGI A;  5T5L A;  4GKX A;  5KC6 A;  2RM2 1;  3AP7 A;  3WNP A;  4HG6 B;  3VDC A;  1PK6 A;  3CJI B;  3ZIW A;  1OVP A;  3U07 A;  1SCR A;  1AR8 3;  1HJF A;  3ZFE A;  1GU3 A;  2F17 A;  1L7Q A;  4JGY A;  4U2A A;  3PUA A;  2DVA A;  4WM7 A;  4LKE A;  5D2A A;  3K75 B;  1Q8V A;  3OBZ A;  1AJK A;  5JOY A;  4HN1 A;  3MW3 A;  1XNT A;  2RG4 A;  2WS9 2;  1AX1 A;  4W4Z A;  2Y6G A;  2BW8 A;  4TN7 A;  4Q1P A;  1OA2 A;  4AED A;  2Y6F A;  1MEC 2;  2GP5 A;  5A1F A;  2KA3 A;  4COZ A;  5KHI A;  4KWU A;  3AVR A;  2X09 A;  1AR8 2;  2JE7 A;  1LOC A;  3O1O A;  2FD8 A;  5FWJ A;  1DF0 A;  2PFW A;  5EV7 A;  5C3S A;  2D6M A;  1UY1 A;  1JUH A;  1RUH 3;  2Q1F A;  3DYO A;  1RJ7 A;  3MIE A;  4W6W A;  5ERL A;  3NNG A;  2CGN A;  4MO3 M;  1COV 1;  1F5J A;  4BME A;  4YVS B;  3AMM A;  1GNY A;  1RJ8 A;  2UWB A;  5LBE A;  3R4D B;  3WF3 A;  4NHY A;  4BE3 A;  1SEF A;  3VD5 A;  2ZEY A;  2ARB A;  1B35 A;  3OY8 A;  1LAJ A;  1SG3 A;  2RS5 1;  1GWK A;  1G86 A;  4OHY A;  2VG9 A;  2FDG A;  1QJX 1;  1R09 2;  1KS4 A;  1W2N A;  2BER A;  1QF3 A;  3U14 A;  2QQI A;  2KM2 A;  1D0G A;  3CL1 A;  3UKV A;  3ZXF A;  4QXB A;  4A3Z A;  4QQL A;  3WQ7 A;  3IWZ A;  4QKD A;  2OZ6 A;  4LO5 B;  2CY6 A;  2VOX A;  1Y3T A;  5E8A A;  4YVW C;  5A33 A;  2Q4S A;  2FZ2 A;  2GH2 A;  2ZX3 A;  3M1H A;  1AYN 2;  3AFG A;  4DB5 A;  2VJX A;  2D5F A;  1NY7 1;  4AR2 A;  2R07 1;  1OLR A;  2R06 2;  3GHM A;  3MF6 A;  3N4M A;  3O0X A;  1H4H A;  1R09 3;  1NXD 1;  1HXS 2;  3CHX A;  2LRP A;  4NHX A;  4JKM A;  3ZDS A;  2W52 A;  2LAL A;  3B5L B;  4PI2 A;  1TG7 A;  3VDD C;  3T30 A;  4LIT A;  4DFS A;  1JOD A;  4J25 A;  4AAX A;  3IAQ A;  1W6O B;  3ON7 A;  3N9M A;  3ACH A;  1SBE A;  3BU0 A;  3HR9 A;  4W8J A;  4FXG B;  1WBF A;  3PJQ A;  1RUF 2;  1RIN A;  1HDK A;  5DUV A;  5FPU A;  2P1B A;  3NJZ A;  4KU8 A;  1D4M 1;  4HKL A;  4BB3 A;  5JPM B;  5G05 L;  1GUI A;  3GM8 A;  3AX4 A;  5FDB A;  4Y4Y A;  1LOF C;  1PO2 3;  3HN3 A;  3D8C A;  3U0Z A;  4EJR A;  5A7O A;  2XON A;  4CUC A;  2V73 A;  1EPZ A;  1S1A A;  1U12 A;  5FZ0 A;  3DKQ A;  4XPV A;  2P4E A;  3ZKU A;  1DGW X;  1IG3 A;  3QCW A;  3AZW A;  1QIQ A;  2XKP A;  1VBA 2;  2E9Q A;  3NAP B;  3O7O A;  2VAU A;  3A4U A;  3AP6 A;  4IV3 A;  2EAL A;  4FPF A;  3OUI A;  4XF9 A;  4P08 A;  1AR7 3;  4J1X A;  2XLF A;  2R06 3;  2JD9 A;  4DXZ A;  3U10 A;  1YWK A;  1X7N A;  4Z07 A;  5A6Y A;  4MET A;  2ZGQ A;  1XYP A;  2K2S A;  4CUA A;  2VMC A;  4CU7 A;  1ASJ 1;  1H2K A;  1QJF A;  2DCY A;  5JUV A;  2RMU 2;  4XAA A;  4IEX A;  4GWM A;  5GAL A;  4CUG A;  1NX9 A;  4M3C E;  3S7E A;  4UFJ A;  1XNC A;  1RUJ 3;  4OUM A;  2WJS A;  1OXC A;  2X29 A;  3C7G A;  2K0G A;  4M3C B;  3U75 A;  1B35 B;  5FYV A;  3OG2 A;  4URT A;  3VHO A;  5EZW A;  2ZGO A;  2H6C A;  5GLV A;  1YXW A;  3TYJ A;  1E5R A;  5HBA A;  2JEM A;  1OKO A;  4LUL A;  4FPK A;  1V6N A;  4YYO A;  3I59 B;  1NA1 B;  3WT3 A;  2EF6 A;  3K3O A;  3VBU B;  5HPO A;  3POJ A;  4NHM A;  1V6K A;  3RDI A;  4LPL A;  5LY1 A;  3MUY 1;  4HVO A;  4ZPI A;  3B94 A;  4AI1 A;  3TBD A;  2FHR A;  2BOJ A;  4AHW A;  1HB4 A;  1AR9 3;  3KZ4 C;  4DUX A;  1YLL A;  5LA9 A;  1OQ1 A;  3LOB A;  5CA6 A;  2VUL A;  4IEU A;  2BUK A;  1UY3 A;  2ADD A;  2C6S A;  4Q4V 3;  3FFZ A;  3N7M A;  4RHV 1;  2CYF A;  2FDJ A;  3PU3 A;  2BBA A;  3IBM A;  3GHN A;  3DYM A;  2WNO A;  4MYE A;  4YWA A;  4Z8B A;  1PVC 2;  2QQP A;  3V65 A;  4YW1 A;  4CCO A;  4D3W A;  4QHB A;  3O14 A;  1KD7 A;  1AR9 2;  3VBF B;  1C57 A;  1NAE A;  3ZXK A;  4XMI A;  2FDK A;  1OPM A;  4K7J A;  2HWE 2;  3E6C C;  1CON A;  5B4X A;  3JD7 1;  4OHW A;  4BQ2 A;  1KDK A;  1SMV A;  1R1A 1;  1MS1 A;  3THD A;  3AP5 A;  3ZYR A;  1R1A 2;  3HQR A;  4RHV 3;  2BGO A;  3R6S A;  5FQ0 A;  3KGZ A;  4ZY9 A;  1APN A;  1N3P A;  3OGG A;  2BBV A;  5I8S A;  1FPN 2;  3GYD A;  2AZ5 A;  5FRA A;  2JG8 B;  3WNX A;  3PUS A;  5DUU A;  4CDW A;  2IUW A;  1DG6 A;  1Z7S 1;  5I0S A;  2HEY F;  5K4L A;  2D40 A;  3JBG 2;  4JRA A;  1W8N A;  4HZF A;  3POG A;  1PVC 1;  4C0B A;  2A6Z A;  5I8T A;  2R0F A;  3SH5 A;  2VNR A;  3LA3 A;  5I0D A;  3LPG A;  3VZK A;  4ATE A;  5BNP A;  4LJH A;  2VMG A;  3IT8 A;  1PK6 C;  1LR5 A;  2MEV 2;  2QCS B;  2ZBJ A;  3JB4 C;  2FMY A;  1DGL A;  2CGP A;  1U0A A;  5FMO L;  2Y6H A;  1Y9Q A;  2R1D A;  1RUD 1;  3JBG 3;  1FT9 A;  1N1Y A;  3VBH A;  1OOP B;  2ZML A;  2RM2 2;  3H7Y A;  1AF9 A;  2A75 A;  4AHZ A;  1LJ7 A;  5DUX A;  1W6M B;  3OEA A;  1WW6 A;  3AK0 A;  2ES3 A;  3USS A;  2DVB A;  4R52 A;  2QE3 A;  4OI1 A;  3VBF C;  1VAL A;  3OD4 A;  2Q8D A;  3B9C A;  3I2G A;  3QBQ A;  1J1L A;  4FFF A;  2LUW A; 
#chains in the Genus database with same CATH homology
 2E26 A;  2WN2 A;  4YPJ A;  1DP0 A;  3FN9 A;  2WQ8 A;  4BDV B;  4DUV A;  5DN2 A;  3MUZ 1;  1UYZ A;  2V5D A;  2WAA A;  4MGS A;  4IUG A;  2W1Q A;  4QDQ A;  3VD3 A;  3MV1 1;  5F7U A;  4QB2 A;  2QQJ A;  3FHA A;  2QQL A;  4LKS A;  3GXU A;  2WO3 A;  4GZ9 A;  2RV9 A;  3A7Q A;  1HN1 A;  1OF4 A;  2EIB A;  4BXS V;  1JZ4 A;  3EYP A;  3WF2 A;  3HOB A;  1KGY A;  2ORX A;  2VO5 A;  2ZEX A;  2W1S A;  4Z2A A;  2QQK A;  4JKL A;  2ID4 A;  3NJX A;  4CU9 A;  3CKH A;  3HJR A;  4XUT A;  5EIY B;  3III A;  3I3B A;  4XVH A;  5J1X A;  3GDB A;  5JXJ A;  2E32 A;  3MO4 A;  3T09 A;  3U37 A;  3I2F A;  2WN3 A;  3EB7 A;  4UAP A;  2VCA A;  3CQO A;  1UWW A;  5IFP A;  2Y6K A;  3CZJ A;  2W1W A;  1CX1 A;  4XUN A;  3UET A;  1GQP A;  2ZEW A;  1PMJ X;  4ET7 A;  3FL7 A;  2YC4 A;  2C4X A;  5C7G A;  3I2K A;  4XUP A;  1UMH A;  2B9V A;  3T0D A;  3LEG A;  1JZ5 A;  3OEB A;  1SHW B;  4KMQ A;  2LW8 A;  2VCB A;  2YFZ A;  3WNM A;  4XUQ A;  4M4R A;  1US3 A;  3VD9 A;  2VM9 A;  2QQN A;  2J1A A;  2W1U A;  2X05 A;  4D0Q A;  3A21 A;  1JHJ A;  5CYY A;  2Y64 A;  2YC2 A;  3GGL A;  2C9K A;  3LPF A;  4P00 B;  1K3I A;  1W0N A;  3VDB A;  1JYW A;  4FI9 A;  3WQB A;  4GWI A;  2L9L A;  4PF1 A;  1JYV A;  2V72 A;  4E8D A;  2VCC A;  4OYU A;  5LA1 A;  5LA0 A;  4DUW A;  2XHN A;  2Y6J A;  1JU4 A;  4XUR A;  1J83 A;  5DMY A;  1JU3 A;  2VQT A;  2VZV A;  3WNO A;  2XQX A;  2VQU A;  1CIY A;  2J7M A;  5A1A A;  2VL4 A;  5B4N A;  1CZS A;  2B4K A;  2RVA A;  1T2X A;  1UY0 A;  4LHS A;  4JX0 A;  5CZK A;  2BZD A;  5IHR A;  1NUK A;  2W46 A;  3K46 A;  4XZU G;  1XPW A;  3T0B A;  2KD7 A;  4XUO A;  4P5Y A;  3ZM8 A;  4MAD A;  1K45 A;  2WAO A;  1DYO A;  4AG4 A;  2WO2 A;  3I2J A;  1W9T A;  2VC9 A;  3PUI A;  3DEC A;  3AC0 A;  1GMM A;  1WCQ A;  1RYY A;  5LA2 A;  1W99 A;  3CZU A;  5JR2 A;  4L0P A;  5JUV A;  2QBX A;  3T08 A;  3T2P A;  3A23 A;  3WEZ A;  3T0A A;  3BN6 A;  4MOA A;  3NJV A;  5IFT A;  3HNB M;  4QX1 A;  2E31 A;  4DEQ A;  4BJ0 A;  4JKK A;  1UZ0 A;  2QQO A;  2W5F A;  1O59 A;  1OT5 A;  1OH4 A;  4M4P A;  2DCJ A;  1DLC A;  3WF4 A;  1JZ8 A;  4ARX A;  4LQR A;  3UES A;  1OD3 A;  3OBA A;  2W91 A;  2EIC A;  2W3J A;  3SKV A;  2DDU A;  4QX2 A;  4ARY A;  3T2Q A;  1D7P M;  4OZO A;  2Y8K A;  3IAP A;  2CDO A;  5EJZ B;  4DXT A;  2VZP A;  3LE0 A;  1JZ7 A;  3VDA A;  3LEK A;  2VZQ A;  3OB8 A;  1JYN A;  4RN5 A;  3VD4 A;  4A4A A;  5JMO A;  2DCK A;  3WNN A;  3WNL A;  4A44 A;  1UYX A;  1O8S A;  4TXW A;  3C7H A;  3J7H A;  4RYD A;  2E33 A;  2BGP A;  3IDA A;  4JHZ A;  4QDR A;  4QX3 A;  5C70 A;  2W87 A;  3JXS A;  1PMH X;  4A45 A;  2ORZ A;  2WZE A;  5DPN A;  2J1R A;  2CDP A;  1KEX A;  3WNP A;  2EIE A;  4HG6 B;  3VDC A;  3WSO A;  1JZ6 A;  1NKG A;  1GU3 A;  1EUT A;  1L7Q A;  4ZXE A;  1UXX X;  2VZ3 A;  1IQD C;  3K75 B;  3CIH A;  2RJ2 A;  3HNY M;  1XNT A;  2J1T A;  1H6X A;  3WF0 A;  4W4Z A;  4CU6 A;  2Y6G A;  2WO1 A;  1JZ3 A;  1K42 A;  4QB1 A;  4QDS A;  2YG0 A;  4KWU A;  1UY4 A;  2X09 A;  2W92 A;  1CZV A;  1PX3 A;  1YQ2 A;  2HLE A;  3C7F A;  2X10 A;  1UMI A;  1W8O A;  2WAB A;  1UY1 A;  5JXH A;  3DYO A;  3NNG A;  4MO3 M;  3SEE A;  1UY2 A;  1SDD B;  1GNY A;  2Z4F A;  3ACF A;  4CU8 A;  3WF3 A;  4KI5 M;  3VD5 A;  1US2 A;  1WKY A;  2Y6L A;  2ZEY A;  2VZU A;  2YB7 A;  1SG3 A;  5DQ0 A;  4D8M A;  2V4V A;  4ZZ5 A;  1CZT A;  1W9W A;  2BER A;  2XOM A;  2QQI A;  4A3Z A;  4OMD A;  1XC6 A;  5IJR A;  3FHQ A;  3HNM A;  2J1E A;  1J84 A;  2VOT A;  4W50 A;  4MGQ A;  1I5P A;  3T2O A;  2W9X A;  5C71 A;  2VJX A;  2J1S A;  2QQM A;  2W47 A;  2WZ8 A;  5FUI A;  4JKM A;  1H6Y A;  4ZZ8 A;  3ACG A;  1TG7 A;  4AAX A;  3ETP A;  3IAQ A;  4TTG A;  3K77 A;  3ACH A;  4BK5 A;  3K4Z A;  3I3E A;  4W8J A;  5G04 L;  3THC A;  1GOH A;  3K4A A;  3I3D A;  3P6B A;  2VZR A;  4A41 A;  3OGV A;  3D3A A;  1K12 A;  2JE8 A;  3ABZ A;  5G05 L;  1GUI A;  3GM8 A;  3HPN A;  2C26 A;  3HN3 A;  4DXS A;  1UXZ A;  3CDZ B;  3A22 A;  3P1I A;  2XON A;  4CUC A;  2VME A;  3W5M A;  1OF3 A;  5LCW L;  3VD7 A;  3ACI A;  3I2I A;  3ECQ A;  4PQQ A;  4BK4 A;  1W9S A;  1O8P A;  4P08 A;  3NRU A;  3BGA A;  4UI9 L;  2JD9 A;  2ZEZ A;  4CUA A;  3CMG A;  2VMC A;  4CU7 A;  3LEI A;  3K4D A;  3F2Z A;  1NX9 A;  4UOJ A;  3C7G A;  3OG2 A;  2VZ1 A;  2OKX A;  1R64 A;  3LQC A;  1P8J A;  2HYX A;  2R7E B;  1MPX A;  2YFU A;  4OMC A;  4PT6 A;  2LS6 A;  5HPO A;  2J22 A;  4LPL A;  3MUY 1;  1GOF A;  4CVU A;  4DUX A;  1JYX A;  3SEP A;  3PUH A;  1L7R A;  3I2H A;  3MBW A;  1UY3 A;  2W94 A;  2JDA A;  1GOG A;  3WF1 A;  4OUE A;  4DXR A;  1EUU A;  2PQS A;  2BBA A;  2VTF A;  2VR4 A;  3DYM A;  1PX4 A;  5JXI A;  2ZXQ A;  1ULP A;  2VMF A;  1NAE A;  3NQH A;  2VZS A;  2WDB A;  3I97 A;  3OGR A;  4QPW A;  3C8X A;  5B4X A;  3MV0 1;  1UYY A;  3C7E A;  3THD A;  2JKX A;  2BGO A;  4GWJ A;  4A42 A;  1JZ2 A;  1TVG A;  4ZY9 A;  2W95 A;  1UX7 A;  3IB3 A;  2EID A;  1ULO A;  3DYP A;  4E8C A;  3E1F 1;  5HXM A;  4QB6 A;  4P02 B;  4QAW A;  1JI6 A;  1W8N A;  4QX0 A;  2WYS A;  2VZO A;  3SKJ E;  5I0D A;  3LPG A;  1XNA A;  3WNK A;  2WUH A;  2J1V A;  4A6O A;  4CUB A;  3W5N A;  2J1U A;  5EJ1 B;  3UNP A;  2Y6H A;  3OGS A;  5IYY A;  5JXG A;  3HEI A;  1F4A A;  1BHG A;  2VMD A;  4DEV A;  3OEA A;  2VZT A;  2WBK A;  1LNS A;  1F4H A;  3I2G A;  3C7O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...