3HQUA

Phd2:fe:un9:partial hif1-alpha substrate complex
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
215
structure length
215
Chain Sequence
LPALKLALEYIVPCMNKHGICVVDDFLGKETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCNGKLGSYKINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Egl nine homolog 1
publication title Structural basis for binding of hypoxia-inducible factor to the oxygen-sensing prolyl hydroxylases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/transcription
total genus 63
structure length 215
sequence length 215
ec nomenclature ec 1.14.11.29: Hypoxia-inducible factor-proline dioxygenase.
pdb deposition date 2009-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13640 2OG-FeII_Oxy_3 2OG-Fe(II) oxygenase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 3hquA00
4JZRA 5LATA 4XAAA 5L9BA 4Q5OA 2RDSA 4NAOA 3KT1A 3NNMA 4XCAA 5EP9A 4XC9A 3GZEA 5A3UA 3MGUA 5DAQA 3W20A 5HV0A 5IAVA 5LASA 4BQWA 4XABA 3HQUA 4BQXA 5M0TA 4ZONA 4J25A 4UWDA 4BQYA 2FCUA 5HV4A 4NHYA 5LBCA 3NNLA 2JIJA 3OUJA 4NHKA 3W21A 5LB6A 5L9VA 4Y5TA 5DAVA 4KBZA 3EMRA 2HBTA 2G1MA 2HBUA 3GJAA 2RDQA 5LA9A 3NNJA 5IAXA 5DAWA 2RG4A 3KT4A 3ITQA 3NNFA 3PL0A 3OUHA 4ZPIA 4IW3A 3GJBA 5EQUA 5LBBA 5DAPA 4MHUA 4NHXA 2A1XA 2FCVA 4NMIA 3DKQA 2JIGA 3HQRA 4MHRA 2FCTA 5EPAA 4NHLA 5L9RA 2RDNA 3OUIA 2G19A 3BVCA 2Y33A 2OPWA 4NHMA 4Y5SA 2RDRA 5C5TA 5IATA 5LBEA 5DAXA 5ERLA 3OBZA 5C5UA 4XCBA 3KT7A 5LBFA 4XACA 2Y34A 2V4AA
chains in the Genus database with same CATH superfamily
1SACA 2GMMA 4LKSA 5L9BA 5BYNA 3C7HA 2A71A 3J7MA 4Q5OA 1FATA 2DCYA 1U5YA 3WQBA 1N3OA 2DVDA 2RJKA 2DVGA 2Y6FA 4A7YA 3MYXA 1AR61 1MVEA 1ODNA 4JGYC 1UPIA 3LAGA 3N36A 1WGPA 4LO6B 4KL1A 2B7YA 4PLOA 5A3UA 2J1TA 3VD5A 1WCUA 2FDKA 3V56A 2QVSB 3UESA 4ES9A 1GLHA 5GZFA 3I49A 5A1AA 4E2SA 2DDUA 1ULDA 1XQNA 2RS13 5JPMB 1OOPB 4A41A 5IK7A 1QU0A 2XJVA 4I09A 3MUY1 2PHRA 1VBE3 3P5BA 2XKPA 1NCRB 4FP2A 2R071 1R1A1 2YG0A 4AFAA 2VGDA 1US3A 5GLVA 1HN0A 4MGZE 1IQAA 3H3UA 1W0OA 4FFHA 4AQ2A 4DPNA 3NO8A 3RYRA 3ZFEB 4EWDA 1R1A3 1UXZA 3KF3A 3V65A 4MGKE 2P3YA 5F3CA 1CAXB 3ZPOA 1AR92 4DQAA 4ES8A 1HX6A 3X29B 4LA2A 1QJY2 1CZTA 1RUJ3 4P00B 4QPIC 1TEIA 2ZX2A 3LGRA 4ASMB 5EHDA 3GNEA 1B35A 1SBFA 2ERFA 3WQ1A 3J7HA 5FV3A 5IVBA 4XVHA 4OMCA 1LR5A 3O1UA 2PHDA 3ZSLA 5LEKA 2E26A 5FYVA 1AL22 5FK8A 1X8MA 3DL3A 3ZDVA 3LFMA 4XOGA 1OFNA 4FAHA 4Z07A 3K46A 4LBQA 2ZXQA 4RS5C 3KGLA 4LBJA 4GB31 3JQXA 5D8AB 1RUF1 4GWMA 4HT1T 5DAWA 1ENSA 1RUG3 2YMZA 2IFWA 4LE3A 3O0WA 1S0GA 3SKVA 3ZR5A 3ZFGC 1W0PA 4OUEA 3EJKA 4A3ZA 2XMLA 5F6LB 3POSA 1S2KA 3ZIXA 1DZTA 4AXOA 5C7GA 1H8TB 4BIOA 2HEWF 4EN0A 3MO4A 3CIHA 2I07B 4Q1RA 3WR0A 4I0WB 4HKOA 4M4RA 1ZBE1 3NV2A 1RUI2 1RUE1 4O65A 3HPNA 1TQ5A 5B4XA 3BALA 1PGL1 4CU6A 3F2ZA 3BB6A 2IWGB 4PHZA 2VZPA 1YJKA 3ZYFA 1JYWA 3T1LA 1ZZCA 4LBOA 1RUE3 3T2PA 1D0HA 2ZGTA 3OUIA 3PMEA 1AR81 5FZMA 2VPVA 4AI3A 3DYPA 3I2OA 3IM0A 5IVFA 4BE3A 2BP6A 1C1LA 4UW5A 3VD4A 4MADA 5C5UA 5C8CA 1AXKA 2R7EB 4BLIA 3O1RA 1ND2C 4WM8B 3WDVA 1CR7A 4UF0B 5IVYA 1PK6C 4WBBA 2DVFA 4HZFA 1A34A 3WNOA 1AVBA 2JDHA 1RMU3 2KA3A 3BPSA 4LHLA 2WQ4A 5FUNA 2LRPA 4UFJA 3ZXEA 3CEWA 1OQDA 1OVSA 1QOOA 1W06A 1FMD2 3D5OA 3ILFA 1UYPA 4HG6B 1RUH2 3BTXA 3WUCA 4XUPA 1PO23 1XRUA 2WR9A 4BWOA 1YQ2A 1BBT2 3WF3A 2VTXJ 4JVAA 3RWKX 5CISA 1H30A 2KD7A 2ZGPA 4QPGC 4OI1A 1Q8PA 2XXZA 1IHMA 5DAQA 1XNDA 4HPKB 4JKLA 2XONA 4COVA 5KXBA 3MZHA 4CDWC 2JDYA 3W20A 3K4AA 2ARAA 1GP6A 1Z7S2 4URTA 1XYPA 5IAVA 5HV0A 1UMHA 3TAYA 5J09A 5EJ1B 3FX3A 3HD8B 4YG0A 2A3WA 2ZGLA 3FUQA 2FDFA 5CNAA 1OVPA 2MPFA 5DDJ2 3G6JB 1P8JA 4YM3A 1I1EA 4B4RA 3ZKYA 2Q8OA 4Z92B 1JN2P 3N9OA 3POFA 4YNIA 5F5CA 1W99A 4RQPA 1IG0A 1WLTA 4A7ZA 3B94A 2BGPA 3WDTA 4EQVA 4EV0A 1PGSA 2FZ1A 2J1VA 5FYMA 5JR7B 1OA3A 1I5PA 3AYCA 3OUJA 2IXLA 3AMQA 1YUDA 2WL1A 3B93A 2QQPA 4BQ4A 2VE1A 3I2KA 5DZGA 3T09A 4NHKA 4JTOA 1J83A 3MIFA 2AC1A 2YBPA 1BMV2 2QE3A 4C0HA 1VBC1 4Q2FA 3ORJA 3V0AA 3W5MA 4KBZA 4UT5A 5FOJB 4AI0A 3WT3A 3ZN4A 2WNVA 3FWEA 4RYDA 3ZKUA 5FYCA 2HWE2 2DBIA 2GAUA 1OBNA 2GN7A 3KCYA 2ZAAA 1MS5A 5FK7A 1GQGA 2VQTA 2VUCA 2VZSA 3GZAA 4NRPA 2C4XA 2RG4A 3LEIA 4DUVA 3H7YA 3PL0A 1CN1A 1WCKA 2QQOA 5IVJA 1HJGA 2JKBA 3ZSKA 5JOWA 2V5DA 1DG6A 3DXTA 2K9ZA 4IE0A 5LBBA 2WNOA 3T0BA 5JVVA 2VMIA 1UY2A 2VUAA 2FCVA 1F2NA 1W2OA 2OQ6A 3KV6A 1CJPA 4NMIA 2BBVA 4YVWA 1GNYA 4D94A 5JSPA 2BTVC 4DZGA 5KHKA 4M00A 4GMP1 4CCMA 4MHRA 2WQ8A 1FOD3 2JXAA 4Q0QA 5I8SA 3QCWA 1FNZA 5EPAA 1UL9A 4FFGA 3BTYA 3R6SA 1QNYA 2J1SA 4GMP3 3WNNA 2ZGNA 4HMZA 1SLAA 2NMNA 1RJ7A 1KDKA 1UX6A 2J42A 3IMMA 4MVTA 2OPWA 1N1YA 3H8UA 2PQQA 4PQQA 5FZAA 3WNLA 2WZEA 1H1AA 3BOWA 5KXEA 4CE8A 4PIXA 4E8CA 5IHRA 3RMYA 4M01A 1NG0A 2ADEA 4M3CF 3I59A 1TME2 1UX7A 2BU9A 4M3CA 5E1RA 2ZPXA 4A3XA 1MS3A 1LCLA 3CF6E 2XBO2 4F8AA 1CPNA 4B4PA 1EY2A 1RVF2 2W1QA 4XUQA 4CEWA 5CB7A 2CNAA 1LTEA 3V0BA 1RITA 4GH4C 1CX1A 1AUYA 1AL0G 1KDMA 1OPMA 1K45A 1H1MA 2IUWA 2CWSA 3E5UA 3I3QA 4CP1A 2VO5A 1H6YA 2O1QA 5FMBA 2VW2A 1ZBA2 4ISQA 5A3WA 3VBOA 5FZOB 3OPZA 2QQJA 5FAXA 1AR91 5LY2A 1JOBA 5C4WC 3WDXA 4FTEA 1KS5A 5ACA3 3BUCA 1HV0A 1G9FA 4UW4A 4YZ5A 3E6DA 4CDQC 2VAUA 1JU3A 3ZXJA 3KF5A 3FE5A 4O9GA 3HQXA 4HSLA 3FHIB 2GNBA 4CDUC 2YFZA 4NIIA 1AL21 3U4SA 1QJY3 3ZLIA 1EYBA 4W6WA 2D6OX 3WNXA 2A5ZA 1GZWA 3CKHA 5FY4A 4BQ2A 4Y22B 1YQ8A 3OGSA 5J1XA 4FFIA 3ZYPA 3SMHA 5FZ8A 5EFUA 4TLFA 2D6KA 3NNLA 3MF9A 2WZR2 2ZGOA 5IVEA 4NJ4A 3VHRA 2D97A 3JZVA 1UPSA 1O3RA 2RR12 3SCGA 2WABA 3J7NA 5L9VA 3VBUC 2UYBA 3PUQA 5K9YA 2R061 4N53A 3USSA 3OY8B 1UZ0A 1DCSA 2B8MA 3USUA 4RR3C 3LA2A 3AXEA 1CAUA 1BLZA 1MZ5A 3RYPA 2WAAA 5FP3A 1JYCA 1OH3A 1OI6A 1QQP2 5JOZA 2OPKA 1RUI3 3PMSA 2VQAA 1UU6A 2Q8EA 2WN2A 2CL2A 1PNFA 2D5FA 4JGZA 2AEYA 3VDDC 4AR2A 1N1TA 4ISRA 4QAWA 2ZEZA 2ZACA 1CIWA 2OUJA 1SZBA 5HXVA 3KHCA 3ZMNA 1KD7A 1I5ZA 2FDGA 2R6QA 2AEZA 2ZGRA 3DYMA 1XB9A 2Z79A 3U78A 1AZDA 5E89A 3HQRA 2RV9A 2NLRA 4FVVA 5JZGB 2B9UA 3R4SA 3THTA 3WDYA 4AHYA 3RS6A 1G6NA 2VR4A 3MV01 4C1XA 2BERA 4CXXA 2WS92 4QM8A 4LHSA 3RG0A 4PCRA 1FMD1 3ZFFA 2G9FA 1HRI1 1D4M1 3CL1A 1LHNA 2X09A 2ZX3A 4P9LA 2H0VA 1G8WA 4IV3A 3GYDA 2I45A 2Y33A 1BBT1 4QHZA 4RS5A 2HKXA 5BNPA 1COV1 3WSOA 1FNYA 4ARYA 2B45X 4R52A 1RUH3 2D6NA 1WA4A 2P37A 3ZFGA 1OUSA 3GXUA 3I2HA 5T3NA 1BBT3 3AKRA 2Y34A 3HN1A 4LBNA 4LR4A 3H8OA 3WV6A 1GNHA 2WRAA 2W91A 2MHFA 1LEMA 1LB2A 5JI9A 1SLCA 5FMOS 2JJ6A 2R1DA 5EV7A 2ZGSA 1UU5A 4Q4Y2 1DBNA 1ND3C 2PHLA 5CU1A 1DLLA 3VBFB 3H3ZA 3M70A 4BOWA 5DDJ1 1W9YA 3VKFC 1Z7S3 5FR3A 1WW5A 2XLAA 1JUIA 4LK6A 1NXD1 2XB6C 3KV4A 1UXXX 3UKVA 5CEHA 4MGTA 4LORA 4EE2A 1YFWA 4S2DA 4M4PA 1J3QA 1LGCA 4RL7A 4XCAA 2YYOA 1ENRA 5FYTA 1NA1C 4IERA 3K51A 4CEYA 4URAA 3TN93 5DZFA 1TZOA 4IEXA 4XYXA 4FPJA 1ZRCA 4YGEA 3AFGA 4O9EA 2ZMKA 3ETPA 4XXAA 5AC92 2W2IA 4JRLA 1XC6A 5JR2A 1BMV1 4CXYA 2WFPA 1ZRIA 2RMU2 2WNEA 3ZDSA 2PHFA 2HEYF 3KQRA 2WA3A 3LB9A 4HVRA 4RN5A 4YZ3A 4LBQD 3PUHA 3A22A 4EN6B 2OKXA 2VU9A 1LOCA 1H2MA 1REDA 1HQWA 1LESA 1UZZA 1FYUA 2HWE3 4YVSA 1CAWB 5LBCA 2JB4A 2ZKNA 4MZUA 3T1MA 1SCRA 3NJVA 3WNMA 3ACHA 4ARXA 1W28A 1B35C 1GOHA 5JSOA 3LEMA 1ULCA 1SFNA 5KC5A 4LBMA 2D40A 4MXWB 2ZA9A 4YG6A 5FQ0B 4CP9A 5JXHA 3ZSJA 3DEMA 2G1MA 4CCNA 4OVEA 3KB5A 4A44A 2D7FA 2XQRA 4EYUA 1E5SA 1PMHX 3O1OA 3KSCA 3KV5A 4PF5A 2W1UA 4XJAA 1SPPB 2D3SA 3THDA 1KFUL 1HRV2 1MZ6A 2K0GA 2RS52 5ANQA 3WP6A 1H6XA 1X7NA 4FOWA 4QHBA 2GH8A 5FCCA 5DG2A 2YXSA 3HNBM 2QDRA 4OUSA 1YFXA 1LJ7A 5T5JA 3NWKA 1JMUB 1AHSA 4YGBA 4S2HA 5GZCA 5HPOA 1GV9A 4AG4A 1TME1 5FYSA 3UYJA 5LWBA 1QJU2 4FOYA 3FLPA 2VCMA 5A1FA 1GOGA 2J7MA 2C5DA 4LMFA 5C9AA 3U11A 5EJ3A 1RVF1 4YZ2A 1RUC2 2ZCWA 3W59A 5A3OA 5HCHA 1WD3A 3POYA 5FZGA 5FPVA 3M7AA 1UNBA 3E5QA 3MV11 4KI5M 4LLOA 4TLGA 2BV4A 2XBO3 4DINB 1O7FA 2PA7A 4IV1B 5FZFA 3O1TA 3FC0A 3BVCA 3QACA 1OKOA 3VKLA 1DYOA 3KV9A 3BTAA 4OI4A 5C8CC 5LBEA 1RC6A 1CPMA 4GKYA 5DUUA 1ULGA 1F15A 5CKMA 4XHXA 3WCSA 4X6QB 1QJEA 4XF1A 2HWC1 1V6MA 5FBJA 4YW4A 4AEJA 4CUBA 3VZNA 2YROA 1ZBA3 3LEKA 2E32A 3DGTA 4LBQB 2JX9A 1RL3A 3APBA 2GNMA 4L99A 3WDWA 4BHPA 3WF2A 1RUG2 1PM7A 1W8FA 2NMOA 4E8DA 1VMHA 4UFMA 2ES3A 1CAVA 1I9RA 5HCFA 1UMIA 1SFPA 2EALA 4KU8A 2ZGKA 5JI7A 4XBQA 1S55A 1AX2A 5FLJA 1OLME 1R1ZA 3I8TA 4CP2A 1QKQA 3MFCA 4D6QA 3RGBA 2PELA 4CP0A 1ZYBA 5A3LA 3POIA 3GZEA 3WEZA 2FD8A 4IUGA 3JU9A 1UKRA 2EXIA 2HWD3 1W6OA 2FDIA 3R0RA 1L7QA 2CAUA 2RR11 4ONUA 1W2AX 4Y1UA 3CJIC 1ODMA 3O1VA 1OXCA 2WZR3 4HXCA 5DXDA 3NQHA 1UWWA 1LGNA 3KD4A 4GJZA 2GALA 3LDKA 4QU1A 4DNYA 1RINA 1RUOA 1DQ1A 2RR13 4JDMA 5FZ6A 4UAPA 3HNYM 1ULOA 3ILRA 3ES4A 4BQ3A 1QQP1 2QKDA 4IEYA 3ZXKA 4UOJA 2FCUA 3J9SA 2PN5A 4FPHA 4CDXC 2W1WA 4GH4A 5KHGA 2TNFA 3M2MA 1SQ4A 3NL1A 4IXLA 4OHXA 1MPXA 4QMAA 5D2AA 4BJ0A 1XYOA 1SFYA 3OGJA 4Q29A 1PM4A 2AH2A 1D2SA 5GLTA 3EYPA 1QQP3 2J1EA 4A42A 2DV9A 4QQPA 1RMU2 4AFBA 3BIEA 3PIGA 3A21A 2FDHA 5J7MA 4RHV2 2XH6A 1S0DA 4FFFA 1XE0A 1BEV2 1OFSA 4E9KA 4N43A 1QJFA 4WVWA 2PAEA 3NRUA 3ZIWA 4I0BA 4CDQA 1D7PM 2WS91 1W6MB 4CDUA 1IS5A 3AX4A 1MQTB 2VVDA 2XJRA 3OBTA 1CX4A 3ITQA 1K12A 3VDAA 2XUMA 1K5MA 5KXCA 2WO3A 3HEIA 4IW3A 2PQSA 3CQOA 1ZA7A 1ZZ8A 2XJPA 2BNOA 4YVWC 4D0QA 3N7KA 3A0NA 4Q26A 3VL8A 3U10A 1W05A 1AF9A 2R30A 1HJFA 5F2WA 4YW5A 4GWIA 2ARCA 5K8SA 1Q8VA 2JG8A 1UZVA 4AE2A 3VHOA 2CGOA 4NWVA 4XDOA 2XUEA 3VZKA 1QJZA 3SITA 4V1PA 5CFCA 4GZ9A 5KXDA 4Q4Y1 5A7PA 2J22A 2FMYA 3K4ZA 3LSEA 4WM7A 3E5XA 2HWB2 3VBHB 3VBUA 1HXS1 4CPBA 1LHUA 4XW3A 5F3IA 5E16A 1HB2A 5BNNB 1PNGA 2PAKA 4Q0VA 4CCLA 1VBA1 1YFYA 3K2OA 4XFFA 4CCCA 3FJSA 3C3VA 1FT9A 5DPNA 3MDPA 5A7WA 2W0XA 1O4YA 2OX0A 2QZ2A 5FRAA 3B69A 5DAXA 1H8VA 1OD3A 2VZUA 1WCSA 4B1LA 1K5JA 4L9BA 3VDDA 1A6CA 2D3RA 1VBD2 2E53A 3WG4A 5K0UB 1LOAA 1Q3EA 3AMHA 4CEWC 4XJZA 4NPRA 2LS6A 4Y20B 1PZ9A 4YSFA 4ZU4A 2D98A 1J59A 2RMU1 3WOGA 5DN2A 1SLLA 5EXOA 1L7LA 2X53S 3FMGA 4JX0A 4YW7A 1MS0A 3AM2A 2AREA 2X5IA 3AJYA 1LNSA 2FQPA 3O1PA 5AC93 1VB4A 4LJHA 2VW0A 2WNUA 2PLV2 5FWEA 1UZWA 2RMU3 3VBOC 4K3UA 4AQ6A 4NR1A 3KCCA 4Q4V2 5GJ6A 4AYUA 2OIIA 2EA7A 2BGOA 3ZMOA 1W39A 3P1IA 3Q9OA 1HKDA 2NM1A 5C3PA 1G9AA 3O1MA 3MGUA 1NUKA 1UOGA 2IC1A 5FKBA 2BZDA 3E6BA 1V9U1 4AI2A 2ADDA 1CIYA 4B3NA 1ULEA 3RQ0A 2CWMA 3S7IA 1FXZA 4GALA 2YPJA 4OHZA 1W9TA 3VL9A 2FBEA 2GSYA 2O8OA 4N8MA 4BK4A 3RI8A 1V0AA 3BPZA 1OLQA 1UD1A 1UN1A 2IVJA 4H3WA 4XURA 4W8JA 4X8PA 4A6OA 4LULA 2JG9B 2VBBA 1HRV1 1MEC2 3AK0A 3Q8BA 5EYXA 4AVBA 1ND3A 1J3RA 4JQRA 1PGW2 2HYKA 5FPXA 4XTPA 4QXHA 2VG9A 1TVGA 3MBWA 1TE1B 5DUXA 3ZFEC 3VHNA 5L7OA 4KNCA 4PDWB 2W5FA 3FHQA 4WVZA 4ZS3A 5FP8A 2RS11 2N7GA 5GLWA 1HRV3 2RS53 3BODA 4N53C 5GM0A 3WHTA 1VBE1 5JPNB 1NA1A 5T5LA 5FY7A 5LB6A 1REEA 3ZXFA 5ABJA 1EPWA 4UW3A 3HJRA 5J37A 3MIBA 4IETA 2C9KA 1RUC1 4K6BA 1L3JA 3VBSB 4EZ4A 3N9PA 5A3PA 3NJZA 4QKBA 1QJU3 1CONA 2R16A 3NAPB 4G3YC 4JGZC 3T4VA 3SCFA 4CCJA 3BKZA 2EAKA 3NJXA 1H1IA 2JICA 3DPRB 3I2IA 1RUC3 5CZKA 4C8DA 4K1ZA 4MG2A 1RUJ1 1HW5A 1KJLA 1UOJA 1UY4A 2JE9A 2XL9A 3N9QA 5ACA2 2WQZC 4LEJA 3ALQA 2PHUA 2VVEA 4MHUA 4AFDA 1HDKA 3AP5A 3K75B 1GKBA 4A4AA 3OF1A 2V5YA 3TOJA 3DKQA 4KWUA 4RA0A 5C70A 2GC2A 3WVJA 3CJXA 1RUD3 3NW4A 4QU2A 2BGCA 2F6BA 1RUG1 3ZFFC 2FCTA 4BYYA 1PVC2 4BPZA 3N9LA 4E27A 4IV3C 4GAZA 2PHTA 4AHWA 2BWCA 4JGYB 5BNPC 1ZVFA 3AJZA 3V64A 3PU3A 2D3PA 3NMBA 2WKKA 4AEDB 2WSVA 2QQIA 3HMYA 3AYAA 4CA9A 4XAEA 3ME2A 1OURA 3GALA 4L0PA 1SBEA 3N9NA 4UW6A 1OMIA 1W8UA 2O8QA 4EZHA 4HFSA 5IFPA 3KT7A 4P02B 2JKXA 4FPEA 1CAUB 1BQPA 1OLRA 2WZPP 1F4AA 4OI2A 5FY5A 3FHAA 1C5HA 2WLQA 2A70A 2I2SA 1KITA 3I2GA 5FZIA 2AZ5A 1W9FA 1DQ2A 4GD4A 4Z2WA 2Y60A 4QHOA 3UT0A 3ZSEA 2XVLA 4IE5A 3J7LA 3IAQA 3H42B 4LKDA 4LKFA 3VBRA 4DO0A 3ZYBA 4CEYC 3D4KA 2Q5TA 1YIPA 5DQ0A 2B9VA 4CVUA 1JZ7A 4GA9A 1YQ5A 4UFKA 4LOTA 2W94A 3K3OA 4QPIB 2ZGQA 3BIWE 3O0XA 1OQEA 1RMU1 3WX5A 4TTGA 1U12A 2OW4A 1MS8A 3WY6A 4ATEA 3RZGA 3OJBA 3OTFA 1VAVA 4SLIA 3UGFA 3HQUA 4QB2A 2DTWA 3A7QA 5JIAA 4V2WA 1PO21 1CESA 1IZ3A 4LPLA 1TG7A 4N7IA 4RS5B 2VMHA 4UFIA 1AJKA 1UOBA 4RHV3 4XTMA 4YVSC 2FDJA 3IWZA 3MI8A 3MLJA 4Q0PA 5JLVA 1BEV3 3L9JT 3D3AA 3LDRA 5BUVA 5CKNA 3ZFGB 5GZDA 4D8MA 4E4ZA 2VNGA 2OUHA 3S30A 1AXYA 1PX4A 3GBGA 2BEOA 2RVAA 2DURA 1SG3A 3ZPYA 2XG3A 2WJSA 3M3QA 2YUEA 3N7MA 5F7UA 5A80A 4Y24A 1LRHA 1V6IA 1JHNA 5IT6A 4XUTA 2P2KA 1QDOA 1QY4A 2ARBA 1M06G 4M3CE 5SV8A 1C5IA 3AL6A 3OD0A 4TN7A 3CJIA 4FTSA 3N9MA 4MSVA 2HWB1 4XQWA 3O12A 3PUIA 1W6NA 4W6XA 1OA4A 4O7XA 1PMJX 2VOVA 4GXLA 3KT4A 3NNFA 4X6RB 3T2TA 5B4NA 1HB4A 3TN92 1CD3G 2BWAA 3M3CA 3VDCA 5G04L 3GBFA 2HWB3 2ET1A 2A3XA 2WINB 2YC2A 3MPPG 3POJA 1N1VA 4MV2A 1LHWA 1UYXA 4CDXA 1YLLA 5C9AC 4NIHA 3HVDA 3FLTA 1ND2B 1O59A 1SDDB 3JB8A 3ZN6A 4TSVA 1J58A 2DCJA 4BZ4A 1O3SA 4I0AA 1PK6B 1NCQA 1O8PA 2H0BA 3I2DA 4NPMA 1G7YA 2DFBA 1BXHA 2YGLA 4MGYE 5FZLA 5IW0A 4K8FA 3ACFA 2HH9A 2WZ8A 4NHLA 1VBD3 3OBAA 4HK8A 4BXFA 4DEQA 2VTXA 2BNNA 3RNSA 1W6PB 3W58A 5A33B 5L9RA 4PBPA 4V2VA 4MYEA 3SISA 3HOBA 2J1AA 2D44A 4QXBA 2VCCA 3OGVA 5CAZA 1N1SA 1VE0A 4Q4W2 1WD4A 1A8DA 4QPGB 5EWSA 4A7KA 4ET7A 1ZRDA 1JYIA 1V6NA 5I0UA 2OXBA 1GICA 2PLV3 3GZUC 1FOD1 4CDWB 4Q4V3 1GR3A 4IDZA 1PO12 1ZZ9A 2VJXA 3RPQA 1DQ5A 4AEKA 3PLQA 4XJ8A 1PHMA 5KHJA 1AR73 1IPKA 4P9GA 2ZHNA 3C7FA 3E1F1 2VXJA 3FFQA 3KGZA 4D6RA 1GU3A 5F3GA 3ENRA 3WDUA 3EB7A 5DG1A 4YW6A 2PTMA 3RI9A 2PFWA 2LALA 3OPWA 5LW9A 1PGW1 3UJQA 5EP9A 4ATFA 1DYPA 4XF4A 1CJDA 5A6YA 5LK7B 1NQDA 2VNVA 3WQ0A 1W8OA 3B9CA 1MEC3 3SNMA 4C0BA 4OQ8A 1YYNA 1F35A 2DUOA 1TNRA 4H2AA 2H6CA 3VHPA 2J1UA 4LO7A 4J1XA 5LASA 4BQWA 5CYYA 4NIDA 2DF7A 2EIGA 2R043 1DIWA 2O0OA 4BH9A 4XABA 1V6OA 2W47A 4XFAA 4LIUA 4ZONA 4BCUA 2VZTA 1BCXA 1S0JA 1UO9A 1AX1A 5EJZB 2VZQA 1OUXA 1UOFA 2YB7A 5IUQA 3B00A 5BNOB 1W2NA 3OBRA 1ZZ7A 2RJLA 1KQRA 2WBKA 3MEPA 1Q8OA 2BOJA 3AVRA 5ACA1 2A6WA 1QEXA 1OF3A 3B02A 4XUNA 2PYTA 3AP6A 2WUHA 4BLJA 5FZ3A 4EROA 5FTTC 2R0FA 4COWA 1W6QB 4HN0A 4LO8A 3UKNA 4A45A 1STMA 1JYTA 5FO8B 3OOXA 4OHWA 3VZJA 1QJY1 2NYYA 3POEA 2JDPA 4JHTA 4N43C 4XHBA 2SBAA 4LBKA 3SCHA 1J1LA 4LT5A 2ZGUA 4XEZA 2IVIB 4G4FA 3O0VA 4JDOA 4R9BA 3L2YA 5SV5A 4OULA 4CUCA 4QKNA 4CPBD 3AYEA 4EN9B 3SH5A 1K5MC 4WVMB 1OOPA 3HIFA 3T4HB 3WF1A 3U75A 1LKNA 3H8RA 3IDCB 2IXIA 1WUVA 2HWD2 3SEPA 3A0KA 2GP5A 1W6OB 1YO8A 4YG3A 5B2GB 5L19A 1Q8SA 1NCRA 1PVC3 4PI2A 3RFRA 3Q8FA 3IB3A 3U07A 5CFDB 5CBLA 3EXUA 3PIJA 4JRAA 1WLCA 1YIFA 2Q8DA 1W3VA 2JG8C 3OPTA 4Q0UA 5FBZA 2G9GA 1H2LA 3S5QA 5CFCC 4DUXA 3ZFEA 4GQ7A 1GOFA 2AGSA 2WO7A 3Q8CA 3MW3A 2JIGA 2VQUA 4WM7C 3ZXGA 4W65A 5F9TA 5H9PA 3H8XA 3KM5A 5J48A 1RUI1 3AYDA 1PIV2 4LKEA 4GIQA 2QJVA 5K4LA 4P9JA 5CADA 3HAGA 3AKPA 2Y64A 1WBLA 3M4FA 4LO4B 4EWEA 2QQKA 4QQOA 4DXSA 3I3DA 1F31A 3VZLA 1PVXA 2VMDA 3LWCA 4IGOA 1LEDA 4JV4A 3SEEA 1XNCA 4B7KA 1JYVA 4XJ9A 3GBWA 5D8AA 1J84A 2EIDA 4YGCA 1IS4A 3ZYRA 2DCKA 2A7AA 4IE7A 5C4WB 4OQ9A 5KBFA 1CQ9A 4K40A 1RUNA 5DUWA 1DLCA 3AVSA 3ILNA 4HOOA 2BFUS 4XDPA 4FSJA 3D0SA 4DB5A 2CDOA 5JAXA 4YM2A 4XZUG 4CDUB 5FPLA 2X5IC 3E6CC 1RIRA 4YLZA 4K20A 2P5BA 1H8TA 5FP7A 4IL7A 4YYOA 2WNUC 1UMZA 3K48A 5F32A 1Z0HA 2Q30A 3T2QA 3AKTA 2RDSA 4BQ5A 2VC9A 3LIHA 4EWAA 4N7UA 5BPXA 1W9SA 1JU4A 2GMEA 1RUH1 3DV8A 5FP4A 2BW8A 2Y0IA 2XLGA 5LRRA 4XC9A 1RGSA 1NLRA 1F5FA 1X9TA 5FY8A 2E31A 5FYZA 4AWDA 1LOBA 3A4UA 4JHZA 1F9KA 3RJRA 2XVKA 1D0GA 4XQ4A 3DKWA 3RVHA 1XNAA 2A6ZA 1QF3A 2R1BA 5L36A 1E57A 3NKTA 4XFGA 3BI3A 1Z7S1 1WA6X 2LUWA 4RR3B 2UURA 5FY0A 4AI8A 1TNFA 3WD5A 1VJ2A 4WM8A 4YWAA 2V72A 5AVAA 4CUGA 5FPZA 1OHFA 4UF0A 3ZXDA 5LRSA 3VV1A 4I30A 3WCRA 1O4TA 1GNZA 1GP4A 3OSDA 4ZS2A 4OMDA 4R9AA 3TYJA 3WG2A 5L7OC 4KG0A 1D4VB 1Y9MA 3TN91 4MGSA 4HKWA 5F5QA 2X05A 2ZHMA 5FY9A 1NE6A 4B8EA 1APNA 5ABJC 1YHFA 5A3MA 1O3QA 1ASJ2 3WG3A 1GWLA 3IPVB 4Y3OA 2YY1A 4TZDA 4F7ZA 5FZ4A 4A6SA 1W8HA 1S1AA 1AX0A 1SEFA 1SLIA 5DAVA 5A7SA 2BFUL 4HPKA 1G9BA 3VDBA 4I2OA 3SXWA 3IN9A 1TMF2 2HWE1 3S57A 4DXRA 1LU2A 4FO9A 1E5IA 2BVVA 1T6GC 1WMDA 3HN3A 3I3BA 5F6KA 4W50A 2RS33 4NO4A 4K1YA 3T0DA 2VOKA 2UY8A 3TEZA 3KWVA 5C3SA 3NVCA 5A32B 1JOJA 2VUDA 2DVBA 5C33A 2YBSA 1PO11 4Q4W3 4HVQA 1X33A 3H7JA 3PJQA 4XPVA 2D93A 2MEV3 1DDLA 5J98B 4LUMA 1AJOA 1C8NA 5T50A 2R49A 2GNTA 4DXZA 1PO13 4AOCA 4MXVA 5DABA 3T3YA 5JXIA 2IZWA 3AZZA 2VOTA 5FMOL 4NRQA 2WAOA 3WQ7A 4QKFA 3WF4A 1W2TA 4XFIA 1EV13 2RE9A 1BK0A 1MZFA 4JDNA 4RGAA 1H4HA 2UWBA 2ZMLA 4I01A 2A6VA 2JB8A 4JKMA 4BU2A 4KGQA 2DVAA 2BVBA 2CHHA 2VL4A 2XJSA 4LXLA 4XACA 1EAH2 3DF0A 1O5UA 1XE7A 4HLTA 1YWKA 1DF0A 5LK5A 5JXJA 1BZWA 4EN7B 1CGPA 2XBO1 1DGRN 4R8HA 4BISA 5FYUA 1QXPA 3MPBA 3VKMA 3VBRC 2E7TA 4LHNA 1RYYA 4X8NA 4D6SA 1LOEA 2QQUA 1AR62 3UK9A 4LO5B 3C7GA 2VD7A 2VUJA 5A7OA 1QNWA 1LOFA 1ZBA1 2ORZA 1OF4A 1B35B 4HBNA 3AB0A 1FAYA 1RUD2 4FPLA 1DP0A 2AENA 4NE9A 2Y6LA 2E51A 4AEMA 2VH9A 3JUUA 2E6VA 1X8EA 4FPYA 3PDQA 3S5AA 3BGAA 1RJ8A 3MICA 2QQLA 3QD6A 5JCTA 2IXHA 3HBZA 4WZCA 1XYNA 1U5ZA 4QGNA 2XJUA 4WVVA 2C9AA 1AYM3 1H9PA 1ZX5A 1GBGA 2R072 2ZZQA 3MIDA 4J25A 5FLHA 4FAGA 1VR3A 4BQYA 1C57A 2WT2A 4N9IA 3ST7A 1G9CA 1UQXA 2JDMA 3ZR6A 2HWD1 3CMGA 3MLLA 5JMOA 4HETA 3KQ4B 4I3PA 5A6QA 5FZ9A 1XNKA 5CG8A 2ZZJA 4EN8B 4CXWA 3ZYIB 1GSLA 2WZR1 3DXUA 3JQWA 2EICA 2WO1A 2ZGMA 4QXCA 3ACIA 4K21A 1WCDJ 1IGOA 2YU1A 2W52A 3GM8A 5CVRA 3W21A 2GN3A 5I0RA 4OZXA 4QPWA 2A3YA 4MX3A 4DRRA 3GJAA 3POBA 1PIV1 1Q56A 4DFSA 3I7DA 5EZWA 4GB32 2ARXA 1S0EA 3OYWA 2V09A 1JH5A 2DYCA 3N35A 3WINE 4QDRA 3WW1A 4PIZA 3B5LB 3CHXA 3L2HA 3MLKA 5I0DA 1PIV3 5C8CB 1D2QA 1YEWA 3GCXA 1ENXA 1S2EA 4Y22A 2JDNA 1NCQC 4QX5A 4Y26A 4BK5A 1V6LA 4N90A 4IESA 4PI0A 5FZCA 5BXXA 4ZU5A 2IXKA 4IEPA 4OYUA 1SLTA 2KXLA 2Y38A 1XSQA 1UY1A 1ZBE2 4Q0SA 2EIEA 3LA7A 5C3QA 5F5IA 5TSWA 2WDBA 1GUIA 2A6YA 3JD72 3ZYJB 2W3JA 5DZEA 5T5OA 2AR6A 4CCKA 3OY8A 1SCSA 1WZXA 3PHMA 4QT6A 5C3OA 2C0ZA 1GWKA 1K3IA 1GYKA 2BJSA 3ZXLA 4AI9A 2XR4A 3MHZA 3OGRA 4QX7A 2VZ3A 4YW3A 2A6XA 4HK9A 2EAAA 3I3EA 3OBZA 1UY0A 2ZHLA 4BMEA 3F95A 5BY5A 1ST8A 3RZKA 3VKNA 1POV3 3CU7A 2WLPA 3RRDA 2V4AA 3WXPA 1U0AA 2GZWA 1KJRA 3LPFA 4L92A 3VZMA 1U5XA 3IBMA 4JZRA 1NY72 2CSGA 1UY3A 4ZXEA 2JWPA 3ABZA 4L8QA 4RQPB 2V4VA 2Y0OA 2VVFA 1ZNPA 3IDAA 2VMEA 4XMAA 3VLBB 4LE4A 2UU8A 5G05L 1JYNA 5JZGA 3M3OA 4IGPA 4E4DX 3HT1A 2EF6A 3KT1A 2Z69A 2XJTA 4WZFA 1DHKB 2C6SA 5GALA 1ZA4A 3PUAA 2G9ZA 4GWJA 2Q0AA 2BOIA 5K7PA 1ZRRA 4E2GA 1LHOA 4LIVA 4LNVA 3V0AB 5LA0A 5FUPA 1SBDA 2WNVB 3OEAA 1JUHA 2IXJA 2QNKA 1BHGA 4OFGA 1UKGA 5AC91 1JZ8A 3IDBB 1DGLA 2VNRA 2R0HA 1W0NA 1ASJ3 3GF6A 4AF9A 1PX3A 1E5HA 3QH6A 1HQLA 2J1RA 2XOMA 3PNAA 2XHNA 4FPKA 2B4KA 4DY3A 1DQ0A 5FXWA 2JG9C 2Y6KA 1QH7A 2PHWA 3LA3A 2X10A 2ZKLA 4QB1A 3VBFA 3I97A 4YVWB 1WLDA 1UAIA 1TMF3 3WZ1A 4XF0A 3HNMA 2TBVA 4Y1YA 2YBKA 4COYA 4H7MA 1RTVA 4AVTA 2GU9A 4KG8A 1AYN3 5IK4A 3CBNA 1AR72 1IOAA 1VRH2 4UYBA 1GZTA 4IEZA 4HVOA 1JZ5A 2OZ6A 3N7LA 2GDFA 4Y5TA 3EMRA 2HBTA 2ZABA 1OOPC 3WNPA 1QMJA 4YZ4A 2GC0A 3N4MA 2TUNA 1PZ7A 2Q1FA 4P9YA 1NCRC 2D6PA 4H14A 1YC61 3NV4A 4AGGA 1ULFA 3LCPA 1KFXL 1Y7BA 3GGLA 5T52A 4Y1ZA 4DOUA 2RS51 4CU9A 3I59B 1NYWA 4M3CB 4E4SA 3SHRA 2NP0A 1V6KA 3I2FA 5EQUA 4LLFA 1X82A 5LA1A 1V00A 4NHXA 2R042 5KWRA 3KLSA 1N3PA 4AZZA 2R32A 1QWRA 1R092 3ZSMA 4CEWB 1LENA 5D1IA 1CAWA 2VW1A 1BK1A 2VBPA 3V0BB 1XXNA 4DXTA 1QJU1 5FOBB 5JIUA 2ILMA 1WCQA 2VQ0A 2OVUA 2WWJA 5GKAC 4DY5A 3EHKA 3W5NA 1C8M2 4D3WA 3B7MA 4MXWA 1EAH3 3THCA 5FQ0A 2DU0A 4H7LA 3VBOB 1C3HA 3MFAA 3BCWA 5D8AC 4ASLA 3C7OA 2RM22 4AEDC 4Z82A 4NHMA 4QGMA 4BIFA 2RDRA 3SC7X 4QM9A 5IATA 5FYBA 1SPPA 4MH0E 1W9WA 3CO2A 4BM8A 1AR63 4HONA 1UW8A 1RUD1 3H1MA 3NNGA 5GZGA 4QX2A 4M0HA 4QB6A 4FCAA 5HCBA 1H8TC 1DGRA 3RMXA 2ID4A 1JHJA 4Q4X2 5I8YA 2A73B 1GZWB 5LA2A 2JE7A 1H2NA 1GANA 1V6JA 1S0FA 1XJAA 2K46A 2VCBA 2ZTNA 2WYSA 3A23A 3H3LA 5E8AA 3WUDA 1WMFA 4COZA 4U36A 2WO2A 5IK8A 4AHZA 2GC1A 5JSRA 4GWNA 3FLRA 4KMQA 2W1SA 4Q27A 5JUVA 4NIAA 2R073 2VMCA 4P08A 5FJHA 2JE8A 5F3EA 3LF7A 4IV1A 4PLMA 2OA2A 5FYYA 2E33A 4N53B 1X9PA 4HSJA 4L11A 3USUB 1PZ8A 1O6UA 2VMFA 4IGQA 4QQHA 3N7JA 1FV2A 4WM8C 4E2QA 1L7RA 4KBBA 1IS3A 4I02A 2YFUA 3LOIA 4I3GA 4AQSA 4DIQA 1EP0A 2Q8CA 4HKLA 3CNAA 3WHUA 4E4HA 4JGZB 1ZZ6A 1MS4A 1KXGA 1NZCA 4F83A 3ZXAC 4AVSA 3OCPA 5FUIA 2VXRA 2DUQA 2Y26A 1GMMA 1OD5A 2D6LX 1J3PA 5F2SA 4GB33 1RUF3 1VPHA 1I3HA 1DGWA 1O4ZA 3SH4A 3VN4A 3VKOA 1Y9QA 4NN0A 2PMWB 4RSUA 3AFKA 5JOXA 3P3PA 3C2UA 2R062 1JOPA 5D21A 4AGRA 1F5JA 1LU1A 2EXJA 4RHV1 3ZFFB 2DFCA 1S4CA 2DWRA 1BEV1 2Y6HA 1CZVA 3GHMA 4IV3B 4JAAA 1JBCA 1R64A 4LHKA 5LA9A 3HT2A 3PTYA 3JD71 1QH6A 1ENQA 1LHVA 2QQWA 3WP4A 3WNKA 5BNPB 1ZBE3 2P1BA 2P3KA 4FQ4A 2EVXA 1W03A 2Y6JA 5KC6A 3H1YA 4LBLA 2YHJA 4LK7A 1QJX2 3JD73 2W9XA 4B4QA 5FLIA 3KS7A 2Q4SA 3SLIA 3U0ZA 4UI9L 1HLCA 1W8ZA 2OS2A 4YW1A 4G9SB 4QGLA 3UJOA 1HB3A 1AR83 4D7TA 1JZ2A 3IAPA 3LPGA 1OH4A 5FO7B 1REFA 1DFQA 5FZ0A 4TXWA 3JBG2 4AVAA 2KM2A 1NY71 2WT0A 3H9AA 1URXA 5FXVA 4F3JA 2YC0A 4IEUA 1HRI2 4K9SA 1D4M2 3KHBA 4D7YA 2FZ2A 1Y4WA 3ECQA 4XIOA 2DTYA 4CEYB 3LSDA 1AXZA 4PBOA 1OSGA 3VZOA 3POWA 2XGXA 1COV2 1NOVA 1WMEA 3TBDA 5C5TA 3BTZA 4OI0A 1W6MA 1UIKA 2VZVA 3WW2A 1MQTA 5JDBA 5FZ1A 4DMIA 1FI2A 3ZO0B 5I93A 4D69A 5ERLA 2XPJA 2DCTA 3R4UA 2DUPA 4XCBA 1NT0A 5LBFA 3PTRB 2ZMNA 3INAA 1VBD1 4CSWA 2OQ7A 3BU0A 4Q8LA 2C26A 4XDQA 5A3TA 2CDPA 5FXZA 3CDZB 2A75A 3NJYA 2Z5WA 4KGGA 5LATA 2XWBB 1RXFA 2GMPA 4QDSA 3MIEA 1FPN2 2MNGA 2QTWB 5J36A 1ZRFA 2X8KA 2RS32 4YVSB 3LIGA 3I2JA 3H0OA 4INDA 2W92A 3ASIA 1LOFC 2PLV1 3WG1A 1F8VA 3VBHA 4Q4V1 4ZY9A 1IPJA 2F17A 1LODA 2WWSA 3AP7A 1A3KA 2VM9A 4FPGA 1A8MA 4OUMA 5BNNA 5F37A 5CKQA 2XDVA 2MEV2 3IMNA 4FPOB 4IEQA 4CP9B 1SLBA 1KS4A 2Q1ZB 5FJKA 1AR71 1VRH1 5FKCA 4OHYA 5FFOC 1EPZA 3P6BA 4XFHA 4XXPA 3W9AA 5K0UA 1BJQA 4U2AA 3J26N 1YNAA 2JD9A 2FMDA 4BXSV 5AFEA 4JC1A 4RGKA 1EV12 1VRH3 4Y20A 2BQPA 1VBC3 4PT6A 4AL9A 1H0BA 1OC1A 3SH3A 2YGMA 3H50A 1ONAA 1LULA 2QQMA 4R9DA 2CGPA 5BNOC 1NZIA 1MEC1 2B42B 3MIGA 1VRBA 1H9WA 3GHNA 2ORXA 2PAMA 5A70A 3RDIA 3UV9A 2BPA2 3TB0A 5C9AB 2E9QA 1POV0 2R041 1G86A 3M3EA 3QBQA 1JZ6A 2WA4A 1R091 4FQZA 5C3RA 1QGLA 2XLFA 1G9DA 3UKTA 2LROA 3LE0A 1SHWB 5C6CA 5IVVA 3NV1A 3AC0A 2DBNA 2OZJA 4FXKB 5FP9A 3ROUA 1R093 4P5HA 1C8M1 4P14A 1WBFA 4QKDA 1R082 3NNJA 1WW4A 4YZ1A 5A6XA 3S7EA 4XJUA 4LUKA 4QX8A 4BB3A 4CRQA 4H55A 5H9RA 3EBRA 4FPFA 3IIAA 4NUBA 1IKPA 1CVNA 2RM21 4ZPIA 1C8M3 3RZMA 1XNTA 1KEXA 4C91A 5FZBA 5CFDC 1YFUA 2JG9A 2IXCA 2G4IA 3M8LA 3T2OA 1JODA 1GQHA 2A1XA 3ACGA 3D8CA 4J6GA 4CZSA 3AL5A 1W3XA 2BDRA 2QZ3A 5FY1A 5A6ZA 2RM23 2RHPA 2XHKA 2YZ4A 1AYM2 2BRTA 4JQTA 5CA6A 2HLEA 4PDWA 1CAVB 2YU2A 3B9IA 5APAA 4AAXA 4OCTA 4JTNA 2YDEA 4Q4X1 3GZTB 4QXKA 1B09A 2ENRA 2PHXA 5FMCA 3ZM8A 4ZZ5A 3T08A 1PVC1 4MGIE 4ZXKA 2VZRA 4QQLA 3VBSA 4Q4X3 3OG2A 2B46X 4R9CA 5T54A 2VECA 4Q1PA 4Y4RA 2HYXA 4KH9A 3AP4A 5FZ7A 3NAPA 5ISLA 3K4DA 4RFRB 3DPRA 1YXWA 1JXNA 1X50A 2AYHA 3FL7A 4OZOA 5I8TA 2HWC2 3CZJA 5FZEA 1N47A 2PXJA 4Y33A 5BV6A 1U5IA 2ZX4A 4TWTA 3TWIA 2LTNA 1XBFA 3FBYA 3OYWB 4MO3M 4QX1A 4DS0A 5HBAA 5JXGA 1OA2A 1AR93 1CAXA 3B01A 4FTBA 4XF3A 3IIIA 1GQPA 3PUSA 1VAKA 2NN8A 1QIQA 5JZGC 3OEBA 4GH4B 3PURA 4WV8A 4QD2A 2P3JA 1NX9A 4AAPA 4XF9A 1MACA 2X29A 5HI0A 1RB8G 1VBB2 5E88A 3LZZA 1AL23 2VCAA 3NNMA 1O91A 2B39A 3DECA 2F4LA 3UGHA 4JGYA 1YCIA 1XSRA 3RZLA 3BU7A 4XQDA 1QOSA 4C1WA 2CU5A 4AEDA 3KMHA 1DZQA 1HV1A 2W87A 3Q8EA 2WN3A 4PJYA 4N43B 4BMBA 5A1LA 5FPUA 4YGDA 1VALA 3RZJA 2WT1A 3AZYA 4FI9A 5JWPA 1KGYA 4CDQB 1HN1A 1CZSA 1QXRA 3TEWA 4MUVA 3UGGA 4JCKA 2CGNA 2JENA 3N3HA 2D5HA 2QBXA 1T2XA 1IQDC 3TEXA 1K5MB 4OHVA 4RD7A 4QX0A 5FZKA 2R063 5KHHA 3LDBA 4XZPA 3VBFC 5GLUA 1S2BA 1VIWB 2C24A 2JDZA 1W8WA 2WFF2 1RHI2 3AKQA 4IE4A 4P9IA 1S0BA 2WC2A 1XNBA 2NQYA 3AMPA 3I54A 4KWKA 4NWWA 4IQPA 4P5YA 3ELNA 2DCZA 1UYZA 1YQCA 2CAVA 1N3QA 1QJX1 1IPSA 1UZYA 2JG8B 3EQEA 3KZ4C 4KWJA 4XJWA 2VY0A 5CG9A 2P3IA 2JIJA 4HN1A 3GDBA 2VNOA 5CFCB 1UF2C 2RJ2A 4CTEA 2AUYA 3IDEA 5IVCA 3LQCA 4LA3A 4WM7B 3LOBA 1QJX3 2QDNA 3VBUB 4GKXA 4UBHA 2P17A 2P6CA 3EO6A 2HWF2 4QPIA 4CU7A 2ZEYA 3JBG1 3IZOA 2HBUA 5IFTA 5T5PA 1LAJA 2ZX1A 5FO9B 3E97A 3J8F2 4UBGA 5AVPA 1GWMA 3SKJE 5A7WB 1QDCA 5FPBA 3JCIA 4DRVA 5A3NA 2QQNA 5CIRA 5FZHA 5LZ6A 3BYWA 2ZHKA 3JBG3 5IYYA 4IEOA 1NKGA 3KVAA 1JS9A 3OUHA 3VDDB 1Y3TA 1FMD3 3MW4A 1HRI3 4XBLA 1D4M3 3UNPA 5DAPA 4LITA 4COUA 3HWJA 2VZ1A 4AK3A 3B3QE 1YJLA 1COV3 1IS6A 4DEVA 2X5IB 1GFF2 2L9LA 3S6PA 4B7EA 1IKQA 4RFT0 2SLIA 2KR2A 2WNUB 2Q1MA 2E63A 3U4XA 2QQVA 1ACCA 1HXS2 3WP3A 1FPN1 4B1MA 3ZX7A 2RS31 2VZOA 3FN9A 3D6EA 2CYFA 2ZOEB 3OGGA 1Y43B 1VBA2 2YV8A 3NV3A 3QLQA 2GC3A 4L2NA 3ZVXA 4FPCA 1V70A 5J96B 1BYHA 3PJYA 1AYN2 2P4EA 1FPN3 2Z2SB 3TRSB 1Q5OA 5DDJ3 1DU3D 1NE4A 4Q4W1 2ZX0A 4LQRA 2MEV1 3O7OA 1H4GA 4BQ1A 4KU7A 4PQ9A 4ASKA 4CYDA 4FOVA 2Z4FA 4ORFA 3WP5A 1GZCA 3O1SA 1DQ4A 1YRZA 4XFBA 1O8SA 4FXGB 1OPOA 2NPIA 4M0NA 1US2A 3K77A 4XETA 4YW2A 1ALYA 1VLNA 3RJ2X 1ND2A 3SQOA 3ES1A 1MR5A 4Z1VA 1HB1A 1QXJA 1YQ6A 4RGGA 1PK6A 3HR9A 4XAAA 1ND3B 5GZEA 3VGIA 4ITCA 1NLQA 2UYAA 1EV11 1XU2A 3HBKA 2JEMA 4A2UA 2C1FA 5F1RA 1O3TA 3OB8A 3R4DB 5L7OB 2D6MA 3DYOA 4QWNA 2WWUA 5FZDA 4NAOA 2W68A 5FYHA 2ZS6B 4IV1C 1W6PA 5A33A 3D82A 5KHIA 1NA1B 2K2SA 1MZEA 1YI7A 2LW8A 2YC4A 3BN6A 3ON7A 4YM1A 5ABJB 1V9U2 4GJYA 1OT5A 2BBAA 1UYYA 4K7JA 2ET7A 1ZM1A 2AACA 5IJRA 1VB2A 4QPGA 3CZUA 4YFZA 4AVVA 3ETQA 1JZ3A 3ZN5A 2XQXA 4CDWA 3IKWA 3I3MA 3MIHA 4BQXA 3DCQA 4XIKA 3AZXA 3AMMA 1DZRA 1NAEA 2QFEA 4PIYA 1R081 1C4RA 3GCWA 4W6YA 3RYKA 3TNQA 2H6BA 1JTZX 2VULA 3C7EA 4HL0A 4QDQA 1M4WA 5FIXA 4NHYA 4QX3A 3AP9A 1FX5A 1R083 4YRDA 3U37A 5DMYA 4MLOA 3TEYA 2DU1A 2RS12 5IWFA 1Y9GA 2ATFA 5A7QA 1ZZBA 2ZAHA 1Q8QA 2LM3A 3ATGA 1BVP1 1VBE2 3AZVA 1AYM1 3K3NA 4R4XA 1XE8A 2BUKA 5L73A 1UU4A 2E7AA 1SMVA 3P3NA 1GP5A 3AXDA 2Z42A 3WW4A 1TME3 2GP3A 2RDQA 4D7SA 1NXMA 4DUWA 5JMCA 4NVPA 1R1A2 2WIIB 4Y4YA 4BA6A 1RVF3 4Q8KA 4XUOA 3G7DA 1W2UA 3DN7A 1A78A 1RUJ2 5DUVA 5F39A 4Z8BA 4K8RB 4MGQA 4YFWA 1J1TA 3ACLA 3QOPA 1T6BX 1WW6A 4AGVA 5BNOA 4YARA 2JECA 2JDAA 2E7QA 2VTFA 1F4HA 3VD7A 5FWJA 2QCSB 3PVNA 1C1FA 5FZOA 3WW3A 1W6QA 5FDBA 3PVEA 4FBFA 4AHXA 2TEPA 4UFHA 2YPDA 4QQ2A 4Y1VA 3POGA 2XL7A 2HWC3 4XMIA 5FREA 1QHDA 1SDWA 3QH7A 4LOSA 5LCWL 3VD9A 3VBRB 4TYSA 1MVQA 2JD4A 3T0AA 5E6HA 1RUF2 2B5HA 1VBB1 4W4ZA 4R4ZA 1DQ6A 3T30A 1MQTC 2V73A 1UIJA 2G19A 3THPA 1JYXA 2EXHA 2I74A 4Y5SA 4WVMA 1EUTA 1JI6A 5H9SA 1XU1A 2BYVE 1PMIA 3O14A 3RZZA 2XKOA 3LD8A 5H9QA 3RSJA 2XVGA 1VBB3 3CLPA 1QOTA 4EJRA 1ZREA 4KWLA 5F5AA 5CFDA 2HJIA 4IEVA 3KCXA 4S2GA 1VMJA 4NPLA 2ZBJA 4JKKA 3RWNA 3UL2A 2CTVA 1H2KA 1XPWA 2CV6A 1RUE2 2UY9A 3MF6A 3PVOA 5AFBA 4GMP0 2ZEWA 2XJQA 4LTAA 5J3UA 1PGL2 4RQPC 1BVVA 1X36A 2D43A 4QPYA 4CCEA 4CCDA 1C28A 1VAMA 3VBHC 4PF1A 1I6XA 2WFF1 2W39A 4AFMA 1HIXA 3ZYGA 1RHI1 2GH2A 1DYKA 4CCOA 5BNNC 3ZYHA 2WSUA 1AR82 1WW7A 4C90A 4ZHNA 3RZHA 2ZEXA 2OYZA 1POV1 4P9XA 4AVCA 1S0IA 1EUUA 2XWJB 1DGWX 2WFF3 4L97A 2CY6A 1RHI3 4B29A 4ZU7A 2JDKA 1YI9A 2WNVC 4YM0A 2W08A 3M1HA 3CJIB 3O5SA 3LEGA 1E5RA 4KQ7A 5K0UC 2QUOA 1W6NB 5C4WA 2HWF1 3JXSA 4CUAA 1MS9A 5FYIA 3FUOA 1PO22 5C71A 5LY1A 1LGBA 5M0TA 5EYYA 4Y1XA 2O14A 4HANA 4IE6A 3WLUA 5IK5A 1WMXA 3J8F1 5I0SA 3UETA 4UWDA 3C8XA 4UXAA 1LECA 1WLWA 4NOTA 2OT7A 4ZZ8A 2NZ9A 2HWF3 1VP6A 3FZ3A 5HXMA 3VUOA 1CWPA 4CDXB 5HV4A 3AKSA 3MUZ1 3ZN6B 5I0TA 2WS93 3J8F3 3PU8A 4XBNA 1NCQB 1XOYA 1K42A 1OQ1A 1WKYA 3ZOIA 5C8WA 2Y6GA 1NLSA 2P6HA 5ANNA 5T55A 1ASJ1 2WYFA 4GULA 1FV3A 1MS1A 1UCXA 3VB9A 3AZWA 4FOQA 1S0CA 3TNPB 1JW6A 2HEVF 3R05A 1HQNA 2VOWA 4S2FA 4UFLA 3J4UH 3H1WA 4FT8A 4META 5IAXA 1Z78A 3URFA 4Y5Z0 1OLMA 4BDVB 4RR3A 1TMF1 3U1XA 1VMFA 2ZJCA 3NSTA 3OD4A 2FHRA 1WWYA 3I4IA 4NRMA 4Q4Y3 5BNQA 1KRIA 2VMGA 2W95A 4PLNA 1AYN1 1HXS3 3GJBA 4AQTA 5I91A 4Z2AA 2BNMA 5FMDA 2Y8KA 3IT8A 3LFIA 5JOYA 5FPAA 4CU8A 1VBA3 2UWAA 4PDWC 4IEWA 2JDUA 3M3IA 5A7NA 4NIGA 3DUIA 2VOXA 3FBMA 1W90A 4NAMA 1W04A 5LEJA 2EXKA 1Q43A 5KR7A 1VBC2 1O5LA 3JB4C 4O61A 3D0JA 4ZKTB 4YPJA 1ULPA 1W8NA 5FXXA 3FFZA 3VD3A 3IPVA 4P9WA 4XFCA 3VBSC 4J1WA 1RXGA 1GZ9A 3WF0A 2UWCA 1BKZA 5EIYB 5HCAA 2RDNA 3U14A 3NAPC 3MW2A 4NROA 4FP3A 2IFRA 4MOAA 3DPRC 2P34A 1POQA 3Q8AA 4SBVA 2GNDA 3LKJA 2EIBA 3BOPA 3AMNA 4N9HA 4AFCA 4AI1A 2F4PA 1FOD2 5GLZA 4XILA 1IG3A 1OKQA 5F8PA 2VBDA 3NKGA 2W46A 2ETEA 1NQJA 3PVBB 4XE9A 1EAH1 3KVBA 4AW7A 1JZ4A 5A32A 3S0MA 1LOGA 1W8TA 4OLLA 1V9U3
chains in the Genus database with same CATH topology
4JZRA 5LATA 4XAAA 5L9BA 4Q5OA 2RDSA 4NAOA 3KT1A 3NNMA 4XCAA 5EP9A 4XC9A 3GZEA 5A3UA 3MGUA 5DAQA 3W20A 5HV0A 5IAVA 5LASA 4BQWA 4XABA 3HQUA 4BQXA 5M0TA 4ZONA 4J25A 4UWDA 4BQYA 2FCUA 5HV4A 4NHYA 5LBCA 3NNLA 2JIJA 3OUJA 4NHKA 3W21A 5LB6A 5L9VA 4Y5TA 5DAVA 4KBZA 3EMRA 2HBTA 2G1MA 2HBUA 3GJAA 2RDQA 5LA9A 3NNJA 5IAXA 5DAWA 2RG4A 3KT4A 3ITQA 3NNFA 3PL0A 3OUHA 4ZPIA 4IW3A 3GJBA 5EQUA 5LBBA 5DAPA 4MHUA 4NHXA 2A1XA 2FCVA 4NMIA 3DKQA 2JIGA 3HQRA 4MHRA 2FCTA 5EPAA 4NHLA 5L9RA 2RDNA 3OUIA 2G19A 3BVCA 2Y33A 2OPWA 4NHMA 4Y5SA 2RDRA 5C5TA 5IATA 5LBEA 5DAXA 5ERLA 3OBZA 5C5UA 4XCBA 3KT7A 5LBFA 4XACA 2Y34A 2V4AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JZR A;  5LAT A;  4XAA A;  5L9B A;  4Q5O A;  2RDS A;  4NAO A;  3KT1 A;  3NNM A;  4XCA A;  5EP9 A;  4XC9 A;  3GZE A;  5A3U A;  3MGU A;  5DAQ A;  3W20 A;  5HV0 A;  5IAV A;  5LAS A;  4BQW A;  4XAB A;  3HQU A;  4BQX A;  5M0T A;  4ZON A;  4J25 A;  4UWD A;  4BQY A;  2FCU A;  5HV4 A;  4NHY A;  5LBC A;  3NNL A;  2JIJ A;  3OUJ A;  4NHK A;  3W21 A;  5LB6 A;  5L9V A;  4Y5T A;  5DAV A;  4KBZ A;  3EMR A;  2HBT A;  2G1M A;  2HBU A;  3GJA A;  2RDQ A;  5LA9 A;  3NNJ A;  5IAX A;  5DAW A;  2RG4 A;  3KT4 A;  3ITQ A;  3NNF A;  3PL0 A;  3OUH A;  4ZPI A;  4IW3 A;  3GJB A;  5EQU A;  5LBB A;  5DAP A;  4MHU A;  4NHX A;  2A1X A;  2FCV A;  4NMI A;  3DKQ A;  2JIG A;  3HQR A;  4MHR A;  2FCT A;  5EPA A;  4NHL A;  5L9R A;  2RDN A;  3OUI A;  2G19 A;  3BVC A;  2Y33 A;  2OPW A;  4NHM A;  4Y5S A;  2RDR A;  5C5T A;  5IAT A;  5LBE A;  5DAX A;  5ERL A;  3OBZ A;  5C5U A;  4XCB A;  3KT7 A;  5LBF A;  4XAC A;  2Y34 A;  2V4A A; 
#chains in the Genus database with same CATH topology
 1SAC A;  2GMM A;  4LKS A;  5L9B A;  5BYN A;  3C7H A;  2A71 A;  3J7M A;  4Q5O A;  1FAT A;  2DCY A;  1U5Y A;  3WQB A;  1N3O A;  2DVD A;  2RJK A;  2DVG A;  2Y6F A;  4A7Y A;  3MYX A;  1AR6 1;  1MVE A;  1ODN A;  4JGY C;  1UPI A;  3LAG A;  3N36 A;  1WGP A;  4LO6 B;  4KL1 A;  2B7Y A;  4PLO A;  5A3U A;  2J1T A;  3VD5 A;  1WCU A;  2FDK A;  3V56 A;  2QVS B;  3UES A;  4ES9 A;  1GLH A;  5GZF A;  3I49 A;  5A1A A;  4E2S A;  2DDU A;  1ULD A;  1XQN A;  2RS1 3;  5JPM B;  1OOP B;  4A41 A;  5IK7 A;  1QU0 A;  2XJV A;  4I09 A;  3MUY 1;  2PHR A;  1VBE 3;  3P5B A;  2XKP A;  1NCR B;  4FP2 A;  2R07 1;  1R1A 1;  2YG0 A;  4AFA A;  2VGD A;  1US3 A;  5GLV A;  1HN0 A;  4MGZ E;  1IQA A;  3H3U A;  1W0O A;  4FFH A;  4AQ2 A;  4DPN A;  3NO8 A;  3RYR A;  3ZFE B;  4EWD A;  1R1A 3;  1UXZ A;  3KF3 A;  3V65 A;  4MGK E;  2P3Y A;  5F3C A;  1CAX B;  3ZPO A;  1AR9 2;  4DQA A;  4ES8 A;  1HX6 A;  3X29 B;  4LA2 A;  1QJY 2;  1CZT A;  1RUJ 3;  4P00 B;  4QPI C;  1TEI A;  2ZX2 A;  3LGR A;  4ASM B;  5EHD A;  3GNE A;  1B35 A;  1SBF A;  2ERF A;  3WQ1 A;  3J7H A;  5FV3 A;  5IVB A;  4XVH A;  4OMC A;  1LR5 A;  3O1U A;  2PHD A;  3ZSL A;  5LEK A;  2E26 A;  5FYV A;  1AL2 2;  5FK8 A;  1X8M A;  3DL3 A;  3ZDV A;  3LFM A;  4XOG A;  1OFN A;  4FAH A;  4Z07 A;  3K46 A;  4LBQ A;  2ZXQ A;  4RS5 C;  3KGL A;  4LBJ A;  4GB3 1;  3JQX A;  5D8A B;  1RUF 1;  4GWM A;  4HT1 T;  5DAW A;  1ENS A;  1RUG 3;  2YMZ A;  2IFW A;  4LE3 A;  3O0W A;  1S0G A;  3SKV A;  3ZR5 A;  3ZFG C;  1W0P A;  4OUE A;  3EJK A;  4A3Z A;  2XML A;  5F6L B;  3POS A;  1S2K A;  3ZIX A;  1DZT A;  4AXO A;  5C7G A;  1H8T B;  4BIO A;  2HEW F;  4EN0 A;  3MO4 A;  3CIH A;  2I07 B;  4Q1R A;  3WR0 A;  4I0W B;  4HKO A;  4M4R A;  1ZBE 1;  3NV2 A;  1RUI 2;  1RUE 1;  4O65 A;  3HPN A;  1TQ5 A;  5B4X A;  3BAL A;  1PGL 1;  4CU6 A;  3F2Z A;  3BB6 A;  2IWG B;  4PHZ A;  2VZP A;  1YJK A;  3ZYF A;  1JYW A;  3T1L A;  1ZZC A;  4LBO A;  1RUE 3;  3T2P A;  1D0H A;  2ZGT A;  3OUI A;  3PME A;  1AR8 1;  5FZM A;  2VPV A;  4AI3 A;  3DYP A;  3I2O A;  3IM0 A;  5IVF A;  4BE3 A;  2BP6 A;  1C1L A;  4UW5 A;  3VD4 A;  4MAD A;  5C5U A;  5C8C A;  1AXK A;  2R7E B;  4BLI A;  3O1R A;  1ND2 C;  4WM8 B;  3WDV A;  1CR7 A;  4UF0 B;  5IVY A;  1PK6 C;  4WBB A;  2DVF A;  4HZF A;  1A34 A;  3WNO A;  1AVB A;  2JDH A;  1RMU 3;  2KA3 A;  3BPS A;  4LHL A;  2WQ4 A;  5FUN A;  2LRP A;  4UFJ A;  3ZXE A;  3CEW A;  1OQD A;  1OVS A;  1QOO A;  1W06 A;  1FMD 2;  3D5O A;  3ILF A;  1UYP A;  4HG6 B;  1RUH 2;  3BTX A;  3WUC A;  4XUP A;  1PO2 3;  1XRU A;  2WR9 A;  4BWO A;  1YQ2 A;  1BBT 2;  3WF3 A;  2VTX J;  4JVA A;  3RWK X;  5CIS A;  1H30 A;  2KD7 A;  2ZGP A;  4QPG C;  4OI1 A;  1Q8P A;  2XXZ A;  1IHM A;  5DAQ A;  1XND A;  4HPK B;  4JKL A;  2XON A;  4COV A;  5KXB A;  3MZH A;  4CDW C;  2JDY A;  3W20 A;  3K4A A;  2ARA A;  1GP6 A;  1Z7S 2;  4URT A;  1XYP A;  5IAV A;  5HV0 A;  1UMH A;  3TAY A;  5J09 A;  5EJ1 B;  3FX3 A;  3HD8 B;  4YG0 A;  2A3W A;  2ZGL A;  3FUQ A;  2FDF A;  5CNA A;  1OVP A;  2MPF A;  5DDJ 2;  3G6J B;  1P8J A;  4YM3 A;  1I1E A;  4B4R A;  3ZKY A;  2Q8O A;  4Z92 B;  1JN2 P;  3N9O A;  3POF A;  4YNI A;  5F5C A;  1W99 A;  4RQP A;  1IG0 A;  1WLT A;  4A7Z A;  3B94 A;  2BGP A;  3WDT A;  4EQV A;  4EV0 A;  1PGS A;  2FZ1 A;  2J1V A;  5FYM A;  5JR7 B;  1OA3 A;  1I5P A;  3AYC A;  3OUJ A;  2IXL A;  3AMQ A;  1YUD A;  2WL1 A;  3B93 A;  2QQP A;  4BQ4 A;  2VE1 A;  3I2K A;  5DZG A;  3T09 A;  4NHK A;  4JTO A;  1J83 A;  3MIF A;  2AC1 A;  2YBP A;  1BMV 2;  2QE3 A;  4C0H A;  1VBC 1;  4Q2F A;  3ORJ A;  3V0A A;  3W5M A;  4KBZ A;  4UT5 A;  5FOJ B;  4AI0 A;  3WT3 A;  3ZN4 A;  2WNV A;  3FWE A;  4RYD A;  3ZKU A;  5FYC A;  2HWE 2;  2DBI A;  2GAU A;  1OBN A;  2GN7 A;  3KCY A;  2ZAA A;  1MS5 A;  5FK7 A;  1GQG A;  2VQT A;  2VUC A;  2VZS A;  3GZA A;  4NRP A;  2C4X A;  2RG4 A;  3LEI A;  4DUV A;  3H7Y A;  3PL0 A;  1CN1 A;  1WCK A;  2QQO A;  5IVJ A;  1HJG A;  2JKB A;  3ZSK A;  5JOW A;  2V5D A;  1DG6 A;  3DXT A;  2K9Z A;  4IE0 A;  5LBB A;  2WNO A;  3T0B A;  5JVV A;  2VMI A;  1UY2 A;  2VUA A;  2FCV A;  1F2N A;  1W2O A;  2OQ6 A;  3KV6 A;  1CJP A;  4NMI A;  2BBV A;  4YVW A;  1GNY A;  4D94 A;  5JSP A;  2BTV C;  4DZG A;  5KHK A;  4M00 A;  4GMP 1;  4CCM A;  4MHR A;  2WQ8 A;  1FOD 3;  2JXA A;  4Q0Q A;  5I8S A;  3QCW A;  1FNZ A;  5EPA A;  1UL9 A;  4FFG A;  3BTY A;  3R6S A;  1QNY A;  2J1S A;  4GMP 3;  3WNN A;  2ZGN A;  4HMZ A;  1SLA A;  2NMN A;  1RJ7 A;  1KDK A;  1UX6 A;  2J42 A;  3IMM A;  4MVT A;  2OPW A;  1N1Y A;  3H8U A;  2PQQ A;  4PQQ A;  5FZA A;  3WNL A;  2WZE A;  1H1A A;  3BOW A;  5KXE A;  4CE8 A;  4PIX A;  4E8C A;  5IHR A;  3RMY A;  4M01 A;  1NG0 A;  2ADE A;  4M3C F;  3I59 A;  1TME 2;  1UX7 A;  2BU9 A;  4M3C A;  5E1R A;  2ZPX A;  4A3X A;  1MS3 A;  1LCL A;  3CF6 E;  2XBO 2;  4F8A A;  1CPN A;  4B4P A;  1EY2 A;  1RVF 2;  2W1Q A;  4XUQ A;  4CEW A;  5CB7 A;  2CNA A;  1LTE A;  3V0B A;  1RIT A;  4GH4 C;  1CX1 A;  1AUY A;  1AL0 G;  1KDM A;  1OPM A;  1K45 A;  1H1M A;  2IUW A;  2CWS A;  3E5U A;  3I3Q A;  4CP1 A;  2VO5 A;  1H6Y A;  2O1Q A;  5FMB A;  2VW2 A;  1ZBA 2;  4ISQ A;  5A3W A;  3VBO A;  5FZO B;  3OPZ A;  2QQJ A;  5FAX A;  1AR9 1;  5LY2 A;  1JOB A;  5C4W C;  3WDX A;  4FTE A;  1KS5 A;  5ACA 3;  3BUC A;  1HV0 A;  1G9F A;  4UW4 A;  4YZ5 A;  3E6D A;  4CDQ C;  2VAU A;  1JU3 A;  3ZXJ A;  3KF5 A;  3FE5 A;  4O9G A;  3HQX A;  4HSL A;  3FHI B;  2GNB A;  4CDU C;  2YFZ A;  4NII A;  1AL2 1;  3U4S A;  1QJY 3;  3ZLI A;  1EYB A;  4W6W A;  2D6O X;  3WNX A;  2A5Z A;  1GZW A;  3CKH A;  5FY4 A;  4BQ2 A;  4Y22 B;  1YQ8 A;  3OGS A;  5J1X A;  4FFI A;  3ZYP A;  3SMH A;  5FZ8 A;  5EFU A;  4TLF A;  2D6K A;  3NNL A;  3MF9 A;  2WZR 2;  2ZGO A;  5IVE A;  4NJ4 A;  3VHR A;  2D97 A;  3JZV A;  1UPS A;  1O3R A;  2RR1 2;  3SCG A;  2WAB A;  3J7N A;  5L9V A;  3VBU C;  2UYB A;  3PUQ A;  5K9Y A;  2R06 1;  4N53 A;  3USS A;  3OY8 B;  1UZ0 A;  1DCS A;  2B8M A;  3USU A;  4RR3 C;  3LA2 A;  3AXE A;  1CAU A;  1BLZ A;  1MZ5 A;  3RYP A;  2WAA A;  5FP3 A;  1JYC A;  1OH3 A;  1OI6 A;  1QQP 2;  5JOZ A;  2OPK A;  1RUI 3;  3PMS A;  2VQA A;  1UU6 A;  2Q8E A;  2WN2 A;  2CL2 A;  1PNF A;  2D5F A;  4JGZ A;  2AEY A;  3VDD C;  4AR2 A;  1N1T A;  4ISR A;  4QAW A;  2ZEZ A;  2ZAC A;  1CIW A;  2OUJ A;  1SZB A;  5HXV A;  3KHC A;  3ZMN A;  1KD7 A;  1I5Z A;  2FDG A;  2R6Q A;  2AEZ A;  2ZGR A;  3DYM A;  1XB9 A;  2Z79 A;  3U78 A;  1AZD A;  5E89 A;  3HQR A;  2RV9 A;  2NLR A;  4FVV A;  5JZG B;  2B9U A;  3R4S A;  3THT A;  3WDY A;  4AHY A;  3RS6 A;  1G6N A;  2VR4 A;  3MV0 1;  4C1X A;  2BER A;  4CXX A;  2WS9 2;  4QM8 A;  4LHS A;  3RG0 A;  4PCR A;  1FMD 1;  3ZFF A;  2G9F A;  1HRI 1;  1D4M 1;  3CL1 A;  1LHN A;  2X09 A;  2ZX3 A;  4P9L A;  2H0V A;  1G8W A;  4IV3 A;  3GYD A;  2I45 A;  2Y33 A;  1BBT 1;  4QHZ A;  4RS5 A;  2HKX A;  5BNP A;  1COV 1;  3WSO A;  1FNY A;  4ARY A;  2B45 X;  4R52 A;  1RUH 3;  2D6N A;  1WA4 A;  2P37 A;  3ZFG A;  1OUS A;  3GXU A;  3I2H A;  5T3N A;  1BBT 3;  3AKR A;  2Y34 A;  3HN1 A;  4LBN A;  4LR4 A;  3H8O A;  3WV6 A;  1GNH A;  2WRA A;  2W91 A;  2MHF A;  1LEM A;  1LB2 A;  5JI9 A;  1SLC A;  5FMO S;  2JJ6 A;  2R1D A;  5EV7 A;  2ZGS A;  1UU5 A;  4Q4Y 2;  1DBN A;  1ND3 C;  2PHL A;  5CU1 A;  1DLL A;  3VBF B;  3H3Z A;  3M70 A;  4BOW A;  5DDJ 1;  1W9Y A;  3VKF C;  1Z7S 3;  5FR3 A;  1WW5 A;  2XLA A;  1JUI A;  4LK6 A;  1NXD 1;  2XB6 C;  3KV4 A;  1UXX X;  3UKV A;  5CEH A;  4MGT A;  4LOR A;  4EE2 A;  1YFW A;  4S2D A;  4M4P A;  1J3Q A;  1LGC A;  4RL7 A;  4XCA A;  2YYO A;  1ENR A;  5FYT A;  1NA1 C;  4IER A;  3K51 A;  4CEY A;  4URA A;  3TN9 3;  5DZF A;  1TZO A;  4IEX A;  4XYX A;  4FPJ A;  1ZRC A;  4YGE A;  3AFG A;  4O9E A;  2ZMK A;  3ETP A;  4XXA A;  5AC9 2;  2W2I A;  4JRL A;  1XC6 A;  5JR2 A;  1BMV 1;  4CXY A;  2WFP A;  1ZRI A;  2RMU 2;  2WNE A;  3ZDS A;  2PHF A;  2HEY F;  3KQR A;  2WA3 A;  3LB9 A;  4HVR A;  4RN5 A;  4YZ3 A;  4LBQ D;  3PUH A;  3A22 A;  4EN6 B;  2OKX A;  2VU9 A;  1LOC A;  1H2M A;  1RED A;  1HQW A;  1LES A;  1UZZ A;  1FYU A;  2HWE 3;  4YVS A;  1CAW B;  5LBC A;  2JB4 A;  2ZKN A;  4MZU A;  3T1M A;  1SCR A;  3NJV A;  3WNM A;  3ACH A;  4ARX A;  1W28 A;  1B35 C;  1GOH A;  5JSO A;  3LEM A;  1ULC A;  1SFN A;  5KC5 A;  4LBM A;  2D40 A;  4MXW B;  2ZA9 A;  4YG6 A;  5FQ0 B;  4CP9 A;  5JXH A;  3ZSJ A;  3DEM A;  2G1M A;  4CCN A;  4OVE A;  3KB5 A;  4A44 A;  2D7F A;  2XQR A;  4EYU A;  1E5S A;  1PMH X;  3O1O A;  3KSC A;  3KV5 A;  4PF5 A;  2W1U A;  4XJA A;  1SPP B;  2D3S A;  3THD A;  1KFU L;  1HRV 2;  1MZ6 A;  2K0G A;  2RS5 2;  5ANQ A;  3WP6 A;  1H6X A;  1X7N A;  4FOW A;  4QHB A;  2GH8 A;  5FCC A;  5DG2 A;  2YXS A;  3HNB M;  2QDR A;  4OUS A;  1YFX A;  1LJ7 A;  5T5J A;  3NWK A;  1JMU B;  1AHS A;  4YGB A;  4S2H A;  5GZC A;  5HPO A;  1GV9 A;  4AG4 A;  1TME 1;  5FYS A;  3UYJ A;  5LWB A;  1QJU 2;  4FOY A;  3FLP A;  2VCM A;  5A1F A;  1GOG A;  2J7M A;  2C5D A;  4LMF A;  5C9A A;  3U11 A;  5EJ3 A;  1RVF 1;  4YZ2 A;  1RUC 2;  2ZCW A;  3W59 A;  5A3O A;  5HCH A;  1WD3 A;  3POY A;  5FZG A;  5FPV A;  3M7A A;  1UNB A;  3E5Q A;  3MV1 1;  4KI5 M;  4LLO A;  4TLG A;  2BV4 A;  2XBO 3;  4DIN B;  1O7F A;  2PA7 A;  4IV1 B;  5FZF A;  3O1T A;  3FC0 A;  3BVC A;  3QAC A;  1OKO A;  3VKL A;  1DYO A;  3KV9 A;  3BTA A;  4OI4 A;  5C8C C;  5LBE A;  1RC6 A;  1CPM A;  4GKY A;  5DUU A;  1ULG A;  1F15 A;  5CKM A;  4XHX A;  3WCS A;  4X6Q B;  1QJE A;  4XF1 A;  2HWC 1;  1V6M A;  5FBJ A;  4YW4 A;  4AEJ A;  4CUB A;  3VZN A;  2YRO A;  1ZBA 3;  3LEK A;  2E32 A;  3DGT A;  4LBQ B;  2JX9 A;  1RL3 A;  3APB A;  2GNM A;  4L99 A;  3WDW A;  4BHP A;  3WF2 A;  1RUG 2;  1PM7 A;  1W8F A;  2NMO A;  4E8D A;  1VMH A;  4UFM A;  2ES3 A;  1CAV A;  1I9R A;  5HCF A;  1UMI A;  1SFP A;  2EAL A;  4KU8 A;  2ZGK A;  5JI7 A;  4XBQ A;  1S55 A;  1AX2 A;  5FLJ A;  1OLM E;  1R1Z A;  3I8T A;  4CP2 A;  1QKQ A;  3MFC A;  4D6Q A;  3RGB A;  2PEL A;  4CP0 A;  1ZYB A;  5A3L A;  3POI A;  3GZE A;  3WEZ A;  2FD8 A;  4IUG A;  3JU9 A;  1UKR A;  2EXI A;  2HWD 3;  1W6O A;  2FDI A;  3R0R A;  1L7Q A;  2CAU A;  2RR1 1;  4ONU A;  1W2A X;  4Y1U A;  3CJI C;  1ODM A;  3O1V A;  1OXC A;  2WZR 3;  4HXC A;  5DXD A;  3NQH A;  1UWW A;  1LGN A;  3KD4 A;  4GJZ A;  2GAL A;  3LDK A;  4QU1 A;  4DNY A;  1RIN A;  1RUO A;  1DQ1 A;  2RR1 3;  4JDM A;  5FZ6 A;  4UAP A;  3HNY M;  1ULO A;  3ILR A;  3ES4 A;  4BQ3 A;  1QQP 1;  2QKD A;  4IEY A;  3ZXK A;  4UOJ A;  2FCU A;  3J9S A;  2PN5 A;  4FPH A;  4CDX C;  2W1W A;  4GH4 A;  5KHG A;  2TNF A;  3M2M A;  1SQ4 A;  3NL1 A;  4IXL A;  4OHX A;  1MPX A;  4QMA A;  5D2A A;  4BJ0 A;  1XYO A;  1SFY A;  3OGJ A;  4Q29 A;  1PM4 A;  2AH2 A;  1D2S A;  5GLT A;  3EYP A;  1QQP 3;  2J1E A;  4A42 A;  2DV9 A;  4QQP A;  1RMU 2;  4AFB A;  3BIE A;  3PIG A;  3A21 A;  2FDH A;  5J7M A;  4RHV 2;  2XH6 A;  1S0D A;  4FFF A;  1XE0 A;  1BEV 2;  1OFS A;  4E9K A;  4N43 A;  1QJF A;  4WVW A;  2PAE A;  3NRU A;  3ZIW A;  4I0B A;  4CDQ A;  1D7P M;  2WS9 1;  1W6M B;  4CDU A;  1IS5 A;  3AX4 A;  1MQT B;  2VVD A;  2XJR A;  3OBT A;  1CX4 A;  3ITQ A;  1K12 A;  3VDA A;  2XUM A;  1K5M A;  5KXC A;  2WO3 A;  3HEI A;  4IW3 A;  2PQS A;  3CQO A;  1ZA7 A;  1ZZ8 A;  2XJP A;  2BNO A;  4YVW C;  4D0Q A;  3N7K A;  3A0N A;  4Q26 A;  3VL8 A;  3U10 A;  1W05 A;  1AF9 A;  2R30 A;  1HJF A;  5F2W A;  4YW5 A;  4GWI A;  2ARC A;  5K8S A;  1Q8V A;  2JG8 A;  1UZV A;  4AE2 A;  3VHO A;  2CGO A;  4NWV A;  4XDO A;  2XUE A;  3VZK A;  1QJZ A;  3SIT A;  4V1P A;  5CFC A;  4GZ9 A;  5KXD A;  4Q4Y 1;  5A7P A;  2J22 A;  2FMY A;  3K4Z A;  3LSE A;  4WM7 A;  3E5X A;  2HWB 2;  3VBH B;  3VBU A;  1HXS 1;  4CPB A;  1LHU A;  4XW3 A;  5F3I A;  5E16 A;  1HB2 A;  5BNN B;  1PNG A;  2PAK A;  4Q0V A;  4CCL A;  1VBA 1;  1YFY A;  3K2O A;  4XFF A;  4CCC A;  3FJS A;  3C3V A;  1FT9 A;  5DPN A;  3MDP A;  5A7W A;  2W0X A;  1O4Y A;  2OX0 A;  2QZ2 A;  5FRA A;  3B69 A;  5DAX A;  1H8V A;  1OD3 A;  2VZU A;  1WCS A;  4B1L A;  1K5J A;  4L9B A;  3VDD A;  1A6C A;  2D3R A;  1VBD 2;  2E53 A;  3WG4 A;  5K0U B;  1LOA A;  1Q3E A;  3AMH A;  4CEW C;  4XJZ A;  4NPR A;  2LS6 A;  4Y20 B;  1PZ9 A;  4YSF A;  4ZU4 A;  2D98 A;  1J59 A;  2RMU 1;  3WOG A;  5DN2 A;  1SLL A;  5EXO A;  1L7L A;  2X53 S;  3FMG A;  4JX0 A;  4YW7 A;  1MS0 A;  3AM2 A;  2ARE A;  2X5I A;  3AJY A;  1LNS A;  2FQP A;  3O1P A;  5AC9 3;  1VB4 A;  4LJH A;  2VW0 A;  2WNU A;  2PLV 2;  5FWE A;  1UZW A;  2RMU 3;  3VBO C;  4K3U A;  4AQ6 A;  4NR1 A;  3KCC A;  4Q4V 2;  5GJ6 A;  4AYU A;  2OII A;  2EA7 A;  2BGO A;  3ZMO A;  1W39 A;  3P1I A;  3Q9O A;  1HKD A;  2NM1 A;  5C3P A;  1G9A A;  3O1M A;  3MGU A;  1NUK A;  1UOG A;  2IC1 A;  5FKB A;  2BZD A;  3E6B A;  1V9U 1;  4AI2 A;  2ADD A;  1CIY A;  4B3N A;  1ULE A;  3RQ0 A;  2CWM A;  3S7I A;  1FXZ A;  4GAL A;  2YPJ A;  4OHZ A;  1W9T A;  3VL9 A;  2FBE A;  2GSY A;  2O8O A;  4N8M A;  4BK4 A;  3RI8 A;  1V0A A;  3BPZ A;  1OLQ A;  1UD1 A;  1UN1 A;  2IVJ A;  4H3W A;  4XUR A;  4W8J A;  4X8P A;  4A6O A;  4LUL A;  2JG9 B;  2VBB A;  1HRV 1;  1MEC 2;  3AK0 A;  3Q8B A;  5EYX A;  4AVB A;  1ND3 A;  1J3R A;  4JQR A;  1PGW 2;  2HYK A;  5FPX A;  4XTP A;  4QXH A;  2VG9 A;  1TVG A;  3MBW A;  1TE1 B;  5DUX A;  3ZFE C;  3VHN A;  5L7O A;  4KNC A;  4PDW B;  2W5F A;  3FHQ A;  4WVZ A;  4ZS3 A;  5FP8 A;  2RS1 1;  2N7G A;  5GLW A;  1HRV 3;  2RS5 3;  3BOD A;  4N53 C;  5GM0 A;  3WHT A;  1VBE 1;  5JPN B;  1NA1 A;  5T5L A;  5FY7 A;  5LB6 A;  1REE A;  3ZXF A;  5ABJ A;  1EPW A;  4UW3 A;  3HJR A;  5J37 A;  3MIB A;  4IET A;  2C9K A;  1RUC 1;  4K6B A;  1L3J A;  3VBS B;  4EZ4 A;  3N9P A;  5A3P A;  3NJZ A;  4QKB A;  1QJU 3;  1CON A;  2R16 A;  3NAP B;  4G3Y C;  4JGZ C;  3T4V A;  3SCF A;  4CCJ A;  3BKZ A;  2EAK A;  3NJX A;  1H1I A;  2JIC A;  3DPR B;  3I2I A;  1RUC 3;  5CZK A;  4C8D A;  4K1Z A;  4MG2 A;  1RUJ 1;  1HW5 A;  1KJL A;  1UOJ A;  1UY4 A;  2JE9 A;  2XL9 A;  3N9Q A;  5ACA 2;  2WQZ C;  4LEJ A;  3ALQ A;  2PHU A;  2VVE A;  4MHU A;  4AFD A;  1HDK A;  3AP5 A;  3K75 B;  1GKB A;  4A4A A;  3OF1 A;  2V5Y A;  3TOJ A;  3DKQ A;  4KWU A;  4RA0 A;  5C70 A;  2GC2 A;  3WVJ A;  3CJX A;  1RUD 3;  3NW4 A;  4QU2 A;  2BGC A;  2F6B A;  1RUG 1;  3ZFF C;  2FCT A;  4BYY A;  1PVC 2;  4BPZ A;  3N9L A;  4E27 A;  4IV3 C;  4GAZ A;  2PHT A;  4AHW A;  2BWC A;  4JGY B;  5BNP C;  1ZVF A;  3AJZ A;  3V64 A;  3PU3 A;  2D3P A;  3NMB A;  2WKK A;  4AED B;  2WSV A;  2QQI A;  3HMY A;  3AYA A;  4CA9 A;  4XAE A;  3ME2 A;  1OUR A;  3GAL A;  4L0P A;  1SBE A;  3N9N A;  4UW6 A;  1OMI A;  1W8U A;  2O8Q A;  4EZH A;  4HFS A;  5IFP A;  3KT7 A;  4P02 B;  2JKX A;  4FPE A;  1CAU B;  1BQP A;  1OLR A;  2WZP P;  1F4A A;  4OI2 A;  5FY5 A;  3FHA A;  1C5H A;  2WLQ A;  2A70 A;  2I2S A;  1KIT A;  3I2G A;  5FZI A;  2AZ5 A;  1W9F A;  1DQ2 A;  4GD4 A;  4Z2W A;  2Y60 A;  4QHO A;  3UT0 A;  3ZSE A;  2XVL A;  4IE5 A;  3J7L A;  3IAQ A;  3H42 B;  4LKD A;  4LKF A;  3VBR A;  4DO0 A;  3ZYB A;  4CEY C;  3D4K A;  2Q5T A;  1YIP A;  5DQ0 A;  2B9V A;  4CVU A;  1JZ7 A;  4GA9 A;  1YQ5 A;  4UFK A;  4LOT A;  2W94 A;  3K3O A;  4QPI B;  2ZGQ A;  3BIW E;  3O0X A;  1OQE A;  1RMU 1;  3WX5 A;  4TTG A;  1U12 A;  2OW4 A;  1MS8 A;  3WY6 A;  4ATE A;  3RZG A;  3OJB A;  3OTF A;  1VAV A;  4SLI A;  3UGF A;  3HQU A;  4QB2 A;  2DTW A;  3A7Q A;  5JIA A;  4V2W A;  1PO2 1;  1CES A;  1IZ3 A;  4LPL A;  1TG7 A;  4N7I A;  4RS5 B;  2VMH A;  4UFI A;  1AJK A;  1UOB A;  4RHV 3;  4XTM A;  4YVS C;  2FDJ A;  3IWZ A;  3MI8 A;  3MLJ A;  4Q0P A;  5JLV A;  1BEV 3;  3L9J T;  3D3A A;  3LDR A;  5BUV A;  5CKN A;  3ZFG B;  5GZD A;  4D8M A;  4E4Z A;  2VNG A;  2OUH A;  3S30 A;  1AXY A;  1PX4 A;  3GBG A;  2BEO A;  2RVA A;  2DUR A;  1SG3 A;  3ZPY A;  2XG3 A;  2WJS A;  3M3Q A;  2YUE A;  3N7M A;  5F7U A;  5A80 A;  4Y24 A;  1LRH A;  1V6I A;  1JHN A;  5IT6 A;  4XUT A;  2P2K A;  1QDO A;  1QY4 A;  2ARB A;  1M06 G;  4M3C E;  5SV8 A;  1C5I A;  3AL6 A;  3OD0 A;  4TN7 A;  3CJI A;  4FTS A;  3N9M A;  4MSV A;  2HWB 1;  4XQW A;  3O12 A;  3PUI A;  1W6N A;  4W6X A;  1OA4 A;  4O7X A;  1PMJ X;  2VOV A;  4GXL A;  3KT4 A;  3NNF A;  4X6R B;  3T2T A;  5B4N A;  1HB4 A;  3TN9 2;  1CD3 G;  2BWA A;  3M3C A;  3VDC A;  5G04 L;  3GBF A;  2HWB 3;  2ET1 A;  2A3X A;  2WIN B;  2YC2 A;  3MPP G;  3POJ A;  1N1V A;  4MV2 A;  1LHW A;  1UYX A;  4CDX A;  1YLL A;  5C9A C;  4NIH A;  3HVD A;  3FLT A;  1ND2 B;  1O59 A;  1SDD B;  3JB8 A;  3ZN6 A;  4TSV A;  1J58 A;  2DCJ A;  4BZ4 A;  1O3S A;  4I0A A;  1PK6 B;  1NCQ A;  1O8P A;  2H0B A;  3I2D A;  4NPM A;  1G7Y A;  2DFB A;  1BXH A;  2YGL A;  4MGY E;  5FZL A;  5IW0 A;  4K8F A;  3ACF A;  2HH9 A;  2WZ8 A;  4NHL A;  1VBD 3;  3OBA A;  4HK8 A;  4BXF A;  4DEQ A;  2VTX A;  2BNN A;  3RNS A;  1W6P B;  3W58 A;  5A33 B;  5L9R A;  4PBP A;  4V2V A;  4MYE A;  3SIS A;  3HOB A;  2J1A A;  2D44 A;  4QXB A;  2VCC A;  3OGV A;  5CAZ A;  1N1S A;  1VE0 A;  4Q4W 2;  1WD4 A;  1A8D A;  4QPG B;  5EWS A;  4A7K A;  4ET7 A;  1ZRD A;  1JYI A;  1V6N A;  5I0U A;  2OXB A;  1GIC A;  2PLV 3;  3GZU C;  1FOD 1;  4CDW B;  4Q4V 3;  1GR3 A;  4IDZ A;  1PO1 2;  1ZZ9 A;  2VJX A;  3RPQ A;  1DQ5 A;  4AEK A;  3PLQ A;  4XJ8 A;  1PHM A;  5KHJ A;  1AR7 3;  1IPK A;  4P9G A;  2ZHN A;  3C7F A;  3E1F 1;  2VXJ A;  3FFQ A;  3KGZ A;  4D6R A;  1GU3 A;  5F3G A;  3ENR A;  3WDU A;  3EB7 A;  5DG1 A;  4YW6 A;  2PTM A;  3RI9 A;  2PFW A;  2LAL A;  3OPW A;  5LW9 A;  1PGW 1;  3UJQ A;  5EP9 A;  4ATF A;  1DYP A;  4XF4 A;  1CJD A;  5A6Y A;  5LK7 B;  1NQD A;  2VNV A;  3WQ0 A;  1W8O A;  3B9C A;  1MEC 3;  3SNM A;  4C0B A;  4OQ8 A;  1YYN A;  1F35 A;  2DUO A;  1TNR A;  4H2A A;  2H6C A;  3VHP A;  2J1U A;  4LO7 A;  4J1X A;  5LAS A;  4BQW A;  5CYY A;  4NID A;  2DF7 A;  2EIG A;  2R04 3;  1DIW A;  2O0O A;  4BH9 A;  4XAB A;  1V6O A;  2W47 A;  4XFA A;  4LIU A;  4ZON A;  4BCU A;  2VZT A;  1BCX A;  1S0J A;  1UO9 A;  1AX1 A;  5EJZ B;  2VZQ A;  1OUX A;  1UOF A;  2YB7 A;  5IUQ A;  3B00 A;  5BNO B;  1W2N A;  3OBR A;  1ZZ7 A;  2RJL A;  1KQR A;  2WBK A;  3MEP A;  1Q8O A;  2BOJ A;  3AVR A;  5ACA 1;  2A6W A;  1QEX A;  1OF3 A;  3B02 A;  4XUN A;  2PYT A;  3AP6 A;  2WUH A;  4BLJ A;  5FZ3 A;  4ERO A;  5FTT C;  2R0F A;  4COW A;  1W6Q B;  4HN0 A;  4LO8 A;  3UKN A;  4A45 A;  1STM A;  1JYT A;  5FO8 B;  3OOX A;  4OHW A;  3VZJ A;  1QJY 1;  2NYY A;  3POE A;  2JDP A;  4JHT A;  4N43 C;  4XHB A;  2SBA A;  4LBK A;  3SCH A;  1J1L A;  4LT5 A;  2ZGU A;  4XEZ A;  2IVI B;  4G4F A;  3O0V A;  4JDO A;  4R9B A;  3L2Y A;  5SV5 A;  4OUL A;  4CUC A;  4QKN A;  4CPB D;  3AYE A;  4EN9 B;  3SH5 A;  1K5M C;  4WVM B;  1OOP A;  3HIF A;  3T4H B;  3WF1 A;  3U75 A;  1LKN A;  3H8R A;  3IDC B;  2IXI A;  1WUV A;  2HWD 2;  3SEP A;  3A0K A;  2GP5 A;  1W6O B;  1YO8 A;  4YG3 A;  5B2G B;  5L19 A;  1Q8S A;  1NCR A;  1PVC 3;  4PI2 A;  3RFR A;  3Q8F A;  3IB3 A;  3U07 A;  5CFD B;  5CBL A;  3EXU A;  3PIJ A;  4JRA A;  1WLC A;  1YIF A;  2Q8D A;  1W3V A;  2JG8 C;  3OPT A;  4Q0U A;  5FBZ A;  2G9G A;  1H2L A;  3S5Q A;  5CFC C;  4DUX A;  3ZFE A;  4GQ7 A;  1GOF A;  2AGS A;  2WO7 A;  3Q8C A;  3MW3 A;  2JIG A;  2VQU A;  4WM7 C;  3ZXG A;  4W65 A;  5F9T A;  5H9P A;  3H8X A;  3KM5 A;  5J48 A;  1RUI 1;  3AYD A;  1PIV 2;  4LKE A;  4GIQ A;  2QJV A;  5K4L A;  4P9J A;  5CAD A;  3HAG A;  3AKP A;  2Y64 A;  1WBL A;  3M4F A;  4LO4 B;  4EWE A;  2QQK A;  4QQO A;  4DXS A;  3I3D A;  1F31 A;  3VZL A;  1PVX A;  2VMD A;  3LWC A;  4IGO A;  1LED A;  4JV4 A;  3SEE A;  1XNC A;  4B7K A;  1JYV A;  4XJ9 A;  3GBW A;  5D8A A;  1J84 A;  2EID A;  4YGC A;  1IS4 A;  3ZYR A;  2DCK A;  2A7A A;  4IE7 A;  5C4W B;  4OQ9 A;  5KBF A;  1CQ9 A;  4K40 A;  1RUN A;  5DUW A;  1DLC A;  3AVS A;  3ILN A;  4HOO A;  2BFU S;  4XDP A;  4FSJ A;  3D0S A;  4DB5 A;  2CDO A;  5JAX A;  4YM2 A;  4XZU G;  4CDU B;  5FPL A;  2X5I C;  3E6C C;  1RIR A;  4YLZ A;  4K20 A;  2P5B A;  1H8T A;  5FP7 A;  4IL7 A;  4YYO A;  2WNU C;  1UMZ A;  3K48 A;  5F32 A;  1Z0H A;  2Q30 A;  3T2Q A;  3AKT A;  2RDS A;  4BQ5 A;  2VC9 A;  3LIH A;  4EWA A;  4N7U A;  5BPX A;  1W9S A;  1JU4 A;  2GME A;  1RUH 1;  3DV8 A;  5FP4 A;  2BW8 A;  2Y0I A;  2XLG A;  5LRR A;  4XC9 A;  1RGS A;  1NLR A;  1F5F A;  1X9T A;  5FY8 A;  2E31 A;  5FYZ A;  4AWD A;  1LOB A;  3A4U A;  4JHZ A;  1F9K A;  3RJR A;  2XVK A;  1D0G A;  4XQ4 A;  3DKW A;  3RVH A;  1XNA A;  2A6Z A;  1QF3 A;  2R1B A;  5L36 A;  1E57 A;  3NKT A;  4XFG A;  3BI3 A;  1Z7S 1;  1WA6 X;  2LUW A;  4RR3 B;  2UUR A;  5FY0 A;  4AI8 A;  1TNF A;  3WD5 A;  1VJ2 A;  4WM8 A;  4YWA A;  2V72 A;  5AVA A;  4CUG A;  5FPZ A;  1OHF A;  4UF0 A;  3ZXD A;  5LRS A;  3VV1 A;  4I30 A;  3WCR A;  1O4T A;  1GNZ A;  1GP4 A;  3OSD A;  4ZS2 A;  4OMD A;  4R9A A;  3TYJ A;  3WG2 A;  5L7O C;  4KG0 A;  1D4V B;  1Y9M A;  3TN9 1;  4MGS A;  4HKW A;  5F5Q A;  2X05 A;  2ZHM A;  5FY9 A;  1NE6 A;  4B8E A;  1APN A;  5ABJ C;  1YHF A;  5A3M A;  1O3Q A;  1ASJ 2;  3WG3 A;  1GWL A;  3IPV B;  4Y3O A;  2YY1 A;  4TZD A;  4F7Z A;  5FZ4 A;  4A6S A;  1W8H A;  1S1A A;  1AX0 A;  1SEF A;  1SLI A;  5DAV A;  5A7S A;  2BFU L;  4HPK A;  1G9B A;  3VDB A;  4I2O A;  3SXW A;  3IN9 A;  1TMF 2;  2HWE 1;  3S57 A;  4DXR A;  1LU2 A;  4FO9 A;  1E5I A;  2BVV A;  1T6G C;  1WMD A;  3HN3 A;  3I3B A;  5F6K A;  4W50 A;  2RS3 3;  4NO4 A;  4K1Y A;  3T0D A;  2VOK A;  2UY8 A;  3TEZ A;  3KWV A;  5C3S A;  3NVC A;  5A32 B;  1JOJ A;  2VUD A;  2DVB A;  5C33 A;  2YBS A;  1PO1 1;  4Q4W 3;  4HVQ A;  1X33 A;  3H7J A;  3PJQ A;  4XPV A;  2D93 A;  2MEV 3;  1DDL A;  5J98 B;  4LUM A;  1AJO A;  1C8N A;  5T50 A;  2R49 A;  2GNT A;  4DXZ A;  1PO1 3;  4AOC A;  4MXV A;  5DAB A;  3T3Y A;  5JXI A;  2IZW A;  3AZZ A;  2VOT A;  5FMO L;  4NRQ A;  2WAO A;  3WQ7 A;  4QKF A;  3WF4 A;  1W2T A;  4XFI A;  1EV1 3;  2RE9 A;  1BK0 A;  1MZF A;  4JDN A;  4RGA A;  1H4H A;  2UWB A;  2ZML A;  4I01 A;  2A6V A;  2JB8 A;  4JKM A;  4BU2 A;  4KGQ A;  2DVA A;  2BVB A;  2CHH A;  2VL4 A;  2XJS A;  4LXL A;  4XAC A;  1EAH 2;  3DF0 A;  1O5U A;  1XE7 A;  4HLT A;  1YWK A;  1DF0 A;  5LK5 A;  5JXJ A;  1BZW A;  4EN7 B;  1CGP A;  2XBO 1;  1DGR N;  4R8H A;  4BIS A;  5FYU A;  1QXP A;  3MPB A;  3VKM A;  3VBR C;  2E7T A;  4LHN A;  1RYY A;  4X8N A;  4D6S A;  1LOE A;  2QQU A;  1AR6 2;  3UK9 A;  4LO5 B;  3C7G A;  2VD7 A;  2VUJ A;  5A7O A;  1QNW A;  1LOF A;  1ZBA 1;  2ORZ A;  1OF4 A;  1B35 B;  4HBN A;  3AB0 A;  1FAY A;  1RUD 2;  4FPL A;  1DP0 A;  2AEN A;  4NE9 A;  2Y6L A;  2E51 A;  4AEM A;  2VH9 A;  3JUU A;  2E6V A;  1X8E A;  4FPY A;  3PDQ A;  3S5A A;  3BGA A;  1RJ8 A;  3MIC A;  2QQL A;  3QD6 A;  5JCT A;  2IXH A;  3HBZ A;  4WZC A;  1XYN A;  1U5Z A;  4QGN A;  2XJU A;  4WVV A;  2C9A A;  1AYM 3;  1H9P A;  1ZX5 A;  1GBG A;  2R07 2;  2ZZQ A;  3MID A;  4J25 A;  5FLH A;  4FAG A;  1VR3 A;  4BQY A;  1C57 A;  2WT2 A;  4N9I A;  3ST7 A;  1G9C A;  1UQX A;  2JDM A;  3ZR6 A;  2HWD 1;  3CMG A;  3MLL A;  5JMO A;  4HET A;  3KQ4 B;  4I3P A;  5A6Q A;  5FZ9 A;  1XNK A;  5CG8 A;  2ZZJ A;  4EN8 B;  4CXW A;  3ZYI B;  1GSL A;  2WZR 1;  3DXU A;  3JQW A;  2EIC A;  2WO1 A;  2ZGM A;  4QXC A;  3ACI A;  4K21 A;  1WCD J;  1IGO A;  2YU1 A;  2W52 A;  3GM8 A;  5CVR A;  3W21 A;  2GN3 A;  5I0R A;  4OZX A;  4QPW A;  2A3Y A;  4MX3 A;  4DRR A;  3GJA A;  3POB A;  1PIV 1;  1Q56 A;  4DFS A;  3I7D A;  5EZW A;  4GB3 2;  2ARX A;  1S0E A;  3OYW A;  2V09 A;  1JH5 A;  2DYC A;  3N35 A;  3WIN E;  4QDR A;  3WW1 A;  4PIZ A;  3B5L B;  3CHX A;  3L2H A;  3MLK A;  5I0D A;  1PIV 3;  5C8C B;  1D2Q A;  1YEW A;  3GCX A;  1ENX A;  1S2E A;  4Y22 A;  2JDN A;  1NCQ C;  4QX5 A;  4Y26 A;  4BK5 A;  1V6L A;  4N90 A;  4IES A;  4PI0 A;  5FZC A;  5BXX A;  4ZU5 A;  2IXK A;  4IEP A;  4OYU A;  1SLT A;  2KXL A;  2Y38 A;  1XSQ A;  1UY1 A;  1ZBE 2;  4Q0S A;  2EIE A;  3LA7 A;  5C3Q A;  5F5I A;  5TSW A;  2WDB A;  1GUI A;  2A6Y A;  3JD7 2;  3ZYJ B;  2W3J A;  5DZE A;  5T5O A;  2AR6 A;  4CCK A;  3OY8 A;  1SCS A;  1WZX A;  3PHM A;  4QT6 A;  5C3O A;  2C0Z A;  1GWK A;  1K3I A;  1GYK A;  2BJS A;  3ZXL A;  4AI9 A;  2XR4 A;  3MHZ A;  3OGR A;  4QX7 A;  2VZ3 A;  4YW3 A;  2A6X A;  4HK9 A;  2EAA A;  3I3E A;  3OBZ A;  1UY0 A;  2ZHL A;  4BME A;  3F95 A;  5BY5 A;  1ST8 A;  3RZK A;  3VKN A;  1POV 3;  3CU7 A;  2WLP A;  3RRD A;  2V4A A;  3WXP A;  1U0A A;  2GZW A;  1KJR A;  3LPF A;  4L92 A;  3VZM A;  1U5X A;  3IBM A;  4JZR A;  1NY7 2;  2CSG A;  1UY3 A;  4ZXE A;  2JWP A;  3ABZ A;  4L8Q A;  4RQP B;  2V4V A;  2Y0O A;  2VVF A;  1ZNP A;  3IDA A;  2VME A;  4XMA A;  3VLB B;  4LE4 A;  2UU8 A;  5G05 L;  1JYN A;  5JZG A;  3M3O A;  4IGP A;  4E4D X;  3HT1 A;  2EF6 A;  3KT1 A;  2Z69 A;  2XJT A;  4WZF A;  1DHK B;  2C6S A;  5GAL A;  1ZA4 A;  3PUA A;  2G9Z A;  4GWJ A;  2Q0A A;  2BOI A;  5K7P A;  1ZRR A;  4E2G A;  1LHO A;  4LIV A;  4LNV A;  3V0A B;  5LA0 A;  5FUP A;  1SBD A;  2WNV B;  3OEA A;  1JUH A;  2IXJ A;  2QNK A;  1BHG A;  4OFG A;  1UKG A;  5AC9 1;  1JZ8 A;  3IDB B;  1DGL A;  2VNR A;  2R0H A;  1W0N A;  1ASJ 3;  3GF6 A;  4AF9 A;  1PX3 A;  1E5H A;  3QH6 A;  1HQL A;  2J1R A;  2XOM A;  3PNA A;  2XHN A;  4FPK A;  2B4K A;  4DY3 A;  1DQ0 A;  5FXW A;  2JG9 C;  2Y6K A;  1QH7 A;  2PHW A;  3LA3 A;  2X10 A;  2ZKL A;  4QB1 A;  3VBF A;  3I97 A;  4YVW B;  1WLD A;  1UAI A;  1TMF 3;  3WZ1 A;  4XF0 A;  3HNM A;  2TBV A;  4Y1Y A;  2YBK A;  4COY A;  4H7M A;  1RTV A;  4AVT A;  2GU9 A;  4KG8 A;  1AYN 3;  5IK4 A;  3CBN A;  1AR7 2;  1IOA A;  1VRH 2;  4UYB A;  1GZT A;  4IEZ A;  4HVO A;  1JZ5 A;  2OZ6 A;  3N7L A;  2GDF A;  4Y5T A;  3EMR A;  2HBT A;  2ZAB A;  1OOP C;  3WNP A;  1QMJ A;  4YZ4 A;  2GC0 A;  3N4M A;  2TUN A;  1PZ7 A;  2Q1F A;  4P9Y A;  1NCR C;  2D6P A;  4H14 A;  1YC6 1;  3NV4 A;  4AGG A;  1ULF A;  3LCP A;  1KFX L;  1Y7B A;  3GGL A;  5T52 A;  4Y1Z A;  4DOU A;  2RS5 1;  4CU9 A;  3I59 B;  1NYW A;  4M3C B;  4E4S A;  3SHR A;  2NP0 A;  1V6K A;  3I2F A;  5EQU A;  4LLF A;  1X82 A;  5LA1 A;  1V00 A;  4NHX A;  2R04 2;  5KWR A;  3KLS A;  1N3P A;  4AZZ A;  2R32 A;  1QWR A;  1R09 2;  3ZSM A;  4CEW B;  1LEN A;  5D1I A;  1CAW A;  2VW1 A;  1BK1 A;  2VBP A;  3V0B B;  1XXN A;  4DXT A;  1QJU 1;  5FOB B;  5JIU A;  2ILM A;  1WCQ A;  2VQ0 A;  2OVU A;  2WWJ A;  5GKA C;  4DY5 A;  3EHK A;  3W5N A;  1C8M 2;  4D3W A;  3B7M A;  4MXW A;  1EAH 3;  3THC A;  5FQ0 A;  2DU0 A;  4H7L A;  3VBO B;  1C3H A;  3MFA A;  3BCW A;  5D8A C;  4ASL A;  3C7O A;  2RM2 2;  4AED C;  4Z82 A;  4NHM A;  4QGM A;  4BIF A;  2RDR A;  3SC7 X;  4QM9 A;  5IAT A;  5FYB A;  1SPP A;  4MH0 E;  1W9W A;  3CO2 A;  4BM8 A;  1AR6 3;  4HON A;  1UW8 A;  1RUD 1;  3H1M A;  3NNG A;  5GZG A;  4QX2 A;  4M0H A;  4QB6 A;  4FCA A;  5HCB A;  1H8T C;  1DGR A;  3RMX A;  2ID4 A;  1JHJ A;  4Q4X 2;  5I8Y A;  2A73 B;  1GZW B;  5LA2 A;  2JE7 A;  1H2N A;  1GAN A;  1V6J A;  1S0F A;  1XJA A;  2K46 A;  2VCB A;  2ZTN A;  2WYS A;  3A23 A;  3H3L A;  5E8A A;  3WUD A;  1WMF A;  4COZ A;  4U36 A;  2WO2 A;  5IK8 A;  4AHZ A;  2GC1 A;  5JSR A;  4GWN A;  3FLR A;  4KMQ A;  2W1S A;  4Q27 A;  5JUV A;  4NIA A;  2R07 3;  2VMC A;  4P08 A;  5FJH A;  2JE8 A;  5F3E A;  3LF7 A;  4IV1 A;  4PLM A;  2OA2 A;  5FYY A;  2E33 A;  4N53 B;  1X9P A;  4HSJ A;  4L11 A;  3USU B;  1PZ8 A;  1O6U A;  2VMF A;  4IGQ A;  4QQH A;  3N7J A;  1FV2 A;  4WM8 C;  4E2Q A;  1L7R A;  4KBB A;  1IS3 A;  4I02 A;  2YFU A;  3LOI A;  4I3G A;  4AQS A;  4DIQ A;  1EP0 A;  2Q8C A;  4HKL A;  3CNA A;  3WHU A;  4E4H A;  4JGZ B;  1ZZ6 A;  1MS4 A;  1KXG A;  1NZC A;  4F83 A;  3ZXA C;  4AVS A;  3OCP A;  5FUI A;  2VXR A;  2DUQ A;  2Y26 A;  1GMM A;  1OD5 A;  2D6L X;  1J3P A;  5F2S A;  4GB3 3;  1RUF 3;  1VPH A;  1I3H A;  1DGW A;  1O4Z A;  3SH4 A;  3VN4 A;  3VKO A;  1Y9Q A;  4NN0 A;  2PMW B;  4RSU A;  3AFK A;  5JOX A;  3P3P A;  3C2U A;  2R06 2;  1JOP A;  5D21 A;  4AGR A;  1F5J A;  1LU1 A;  2EXJ A;  4RHV 1;  3ZFF B;  2DFC A;  1S4C A;  2DWR A;  1BEV 1;  2Y6H A;  1CZV A;  3GHM A;  4IV3 B;  4JAA A;  1JBC A;  1R64 A;  4LHK A;  5LA9 A;  3HT2 A;  3PTY A;  3JD7 1;  1QH6 A;  1ENQ A;  1LHV A;  2QQW A;  3WP4 A;  3WNK A;  5BNP B;  1ZBE 3;  2P1B A;  2P3K A;  4FQ4 A;  2EVX A;  1W03 A;  2Y6J A;  5KC6 A;  3H1Y A;  4LBL A;  2YHJ A;  4LK7 A;  1QJX 2;  3JD7 3;  2W9X A;  4B4Q A;  5FLI A;  3KS7 A;  2Q4S A;  3SLI A;  3U0Z A;  4UI9 L;  1HLC A;  1W8Z A;  2OS2 A;  4YW1 A;  4G9S B;  4QGL A;  3UJO A;  1HB3 A;  1AR8 3;  4D7T A;  1JZ2 A;  3IAP A;  3LPG A;  1OH4 A;  5FO7 B;  1REF A;  1DFQ A;  5FZ0 A;  4TXW A;  3JBG 2;  4AVA A;  2KM2 A;  1NY7 1;  2WT0 A;  3H9A A;  1URX A;  5FXV A;  4F3J A;  2YC0 A;  4IEU A;  1HRI 2;  4K9S A;  1D4M 2;  3KHB A;  4D7Y A;  2FZ2 A;  1Y4W A;  3ECQ A;  4XIO A;  2DTY A;  4CEY B;  3LSD A;  1AXZ A;  4PBO A;  1OSG A;  3VZO A;  3POW A;  2XGX A;  1COV 2;  1NOV A;  1WME A;  3TBD A;  5C5T A;  3BTZ A;  4OI0 A;  1W6M A;  1UIK A;  2VZV A;  3WW2 A;  1MQT A;  5JDB A;  5FZ1 A;  4DMI A;  1FI2 A;  3ZO0 B;  5I93 A;  4D69 A;  5ERL A;  2XPJ A;  2DCT A;  3R4U A;  2DUP A;  4XCB A;  1NT0 A;  5LBF A;  3PTR B;  2ZMN A;  3INA A;  1VBD 1;  4CSW A;  2OQ7 A;  3BU0 A;  4Q8L A;  2C26 A;  4XDQ A;  5A3T A;  2CDP A;  5FXZ A;  3CDZ B;  2A75 A;  3NJY A;  2Z5W A;  4KGG A;  5LAT A;  2XWB B;  1RXF A;  2GMP A;  4QDS A;  3MIE A;  1FPN 2;  2MNG A;  2QTW B;  5J36 A;  1ZRF A;  2X8K A;  2RS3 2;  4YVS B;  3LIG A;  3I2J A;  3H0O A;  4IND A;  2W92 A;  3ASI A;  1LOF C;  2PLV 1;  3WG1 A;  1F8V A;  3VBH A;  4Q4V 1;  4ZY9 A;  1IPJ A;  2F17 A;  1LOD A;  2WWS A;  3AP7 A;  1A3K A;  2VM9 A;  4FPG A;  1A8M A;  4OUM A;  5BNN A;  5F37 A;  5CKQ A;  2XDV A;  2MEV 2;  3IMN A;  4FPO B;  4IEQ A;  4CP9 B;  1SLB A;  1KS4 A;  2Q1Z B;  5FJK A;  1AR7 1;  1VRH 1;  5FKC A;  4OHY A;  5FFO C;  1EPZ A;  3P6B A;  4XFH A;  4XXP A;  3W9A A;  5K0U A;  1BJQ A;  4U2A A;  3J26 N;  1YNA A;  2JD9 A;  2FMD A;  4BXS V;  5AFE A;  4JC1 A;  4RGK A;  1EV1 2;  1VRH 3;  4Y20 A;  2BQP A;  1VBC 3;  4PT6 A;  4AL9 A;  1H0B A;  1OC1 A;  3SH3 A;  2YGM A;  3H50 A;  1ONA A;  1LUL A;  2QQM A;  4R9D A;  2CGP A;  5BNO C;  1NZI A;  1MEC 1;  2B42 B;  3MIG A;  1VRB A;  1H9W A;  3GHN A;  2ORX A;  2PAM A;  5A70 A;  3RDI A;  3UV9 A;  2BPA 2;  3TB0 A;  5C9A B;  2E9Q A;  1POV 0;  2R04 1;  1G86 A;  3M3E A;  3QBQ A;  1JZ6 A;  2WA4 A;  1R09 1;  4FQZ A;  5C3R A;  1QGL A;  2XLF A;  1G9D A;  3UKT A;  2LRO A;  3LE0 A;  1SHW B;  5C6C A;  5IVV A;  3NV1 A;  3AC0 A;  2DBN A;  2OZJ A;  4FXK B;  5FP9 A;  3ROU A;  1R09 3;  4P5H A;  1C8M 1;  4P14 A;  1WBF A;  4QKD A;  1R08 2;  3NNJ A;  1WW4 A;  4YZ1 A;  5A6X A;  3S7E A;  4XJU A;  4LUK A;  4QX8 A;  4BB3 A;  4CRQ A;  4H55 A;  5H9R A;  3EBR A;  4FPF A;  3IIA A;  4NUB A;  1IKP A;  1CVN A;  2RM2 1;  4ZPI A;  1C8M 3;  3RZM A;  1XNT A;  1KEX A;  4C91 A;  5FZB A;  5CFD C;  1YFU A;  2JG9 A;  2IXC A;  2G4I A;  3M8L A;  3T2O A;  1JOD A;  1GQH A;  2A1X A;  3ACG A;  3D8C A;  4J6G A;  4CZS A;  3AL5 A;  1W3X A;  2BDR A;  2QZ3 A;  5FY1 A;  5A6Z A;  2RM2 3;  2RHP A;  2XHK A;  2YZ4 A;  1AYM 2;  2BRT A;  4JQT A;  5CA6 A;  2HLE A;  4PDW A;  1CAV B;  2YU2 A;  3B9I A;  5APA A;  4AAX A;  4OCT A;  4JTN A;  2YDE A;  4Q4X 1;  3GZT B;  4QXK A;  1B09 A;  2ENR A;  2PHX A;  5FMC A;  3ZM8 A;  4ZZ5 A;  3T08 A;  1PVC 1;  4MGI E;  4ZXK A;  2VZR A;  4QQL A;  3VBS A;  4Q4X 3;  3OG2 A;  2B46 X;  4R9C A;  5T54 A;  2VEC A;  4Q1P A;  4Y4R A;  2HYX A;  4KH9 A;  3AP4 A;  5FZ7 A;  3NAP A;  5ISL A;  3K4D A;  4RFR B;  3DPR A;  1YXW A;  1JXN A;  1X50 A;  2AYH A;  3FL7 A;  4OZO A;  5I8T A;  2HWC 2;  3CZJ A;  5FZE A;  1N47 A;  2PXJ A;  4Y33 A;  5BV6 A;  1U5I A;  2ZX4 A;  4TWT A;  3TWI A;  2LTN A;  1XBF A;  3FBY A;  3OYW B;  4MO3 M;  4QX1 A;  4DS0 A;  5HBA A;  5JXG A;  1OA2 A;  1AR9 3;  1CAX A;  3B01 A;  4FTB A;  4XF3 A;  3III A;  1GQP A;  3PUS A;  1VAK A;  2NN8 A;  1QIQ A;  5JZG C;  3OEB A;  4GH4 B;  3PUR A;  4WV8 A;  4QD2 A;  2P3J A;  1NX9 A;  4AAP A;  4XF9 A;  1MAC A;  2X29 A;  5HI0 A;  1RB8 G;  1VBB 2;  5E88 A;  3LZZ A;  1AL2 3;  2VCA A;  3NNM A;  1O91 A;  2B39 A;  3DEC A;  2F4L A;  3UGH A;  4JGY A;  1YCI A;  1XSR A;  3RZL A;  3BU7 A;  4XQD A;  1QOS A;  4C1W A;  2CU5 A;  4AED A;  3KMH A;  1DZQ A;  1HV1 A;  2W87 A;  3Q8E A;  2WN3 A;  4PJY A;  4N43 B;  4BMB A;  5A1L A;  5FPU A;  4YGD A;  1VAL A;  3RZJ A;  2WT1 A;  3AZY A;  4FI9 A;  5JWP A;  1KGY A;  4CDQ B;  1HN1 A;  1CZS A;  1QXR A;  3TEW A;  4MUV A;  3UGG A;  4JCK A;  2CGN A;  2JEN A;  3N3H A;  2D5H A;  2QBX A;  1T2X A;  1IQD C;  3TEX A;  1K5M B;  4OHV A;  4RD7 A;  4QX0 A;  5FZK A;  2R06 3;  5KHH A;  3LDB A;  4XZP A;  3VBF C;  5GLU A;  1S2B A;  1VIW B;  2C24 A;  2JDZ A;  1W8W A;  2WFF 2;  1RHI 2;  3AKQ A;  4IE4 A;  4P9I A;  1S0B A;  2WC2 A;  1XNB A;  2NQY A;  3AMP A;  3I54 A;  4KWK A;  4NWW A;  4IQP A;  4P5Y A;  3ELN A;  2DCZ A;  1UYZ A;  1YQC A;  2CAV A;  1N3Q A;  1QJX 1;  1IPS A;  1UZY A;  2JG8 B;  3EQE A;  3KZ4 C;  4KWJ A;  4XJW A;  2VY0 A;  5CG9 A;  2P3I A;  2JIJ A;  4HN1 A;  3GDB A;  2VNO A;  5CFC B;  1UF2 C;  2RJ2 A;  4CTE A;  2AUY A;  3IDE A;  5IVC A;  3LQC A;  4LA3 A;  4WM7 B;  3LOB A;  1QJX 3;  2QDN A;  3VBU B;  4GKX A;  4UBH A;  2P17 A;  2P6C A;  3EO6 A;  2HWF 2;  4QPI A;  4CU7 A;  2ZEY A;  3JBG 1;  3IZO A;  2HBU A;  5IFT A;  5T5P A;  1LAJ A;  2ZX1 A;  5FO9 B;  3E97 A;  3J8F 2;  4UBG A;  5AVP A;  1GWM A;  3SKJ E;  5A7W B;  1QDC A;  5FPB A;  3JCI A;  4DRV A;  5A3N A;  2QQN A;  5CIR A;  5FZH A;  5LZ6 A;  3BYW A;  2ZHK A;  3JBG 3;  5IYY A;  4IEO A;  1NKG A;  3KVA A;  1JS9 A;  3OUH A;  3VDD B;  1Y3T A;  1FMD 3;  3MW4 A;  1HRI 3;  4XBL A;  1D4M 3;  3UNP A;  5DAP A;  4LIT A;  4COU A;  3HWJ A;  2VZ1 A;  4AK3 A;  3B3Q E;  1YJL A;  1COV 3;  1IS6 A;  4DEV A;  2X5I B;  1GFF 2;  2L9L A;  3S6P A;  4B7E A;  1IKQ A;  4RFT 0;  2SLI A;  2KR2 A;  2WNU B;  2Q1M A;  2E63 A;  3U4X A;  2QQV A;  1ACC A;  1HXS 2;  3WP3 A;  1FPN 1;  4B1M A;  3ZX7 A;  2RS3 1;  2VZO A;  3FN9 A;  3D6E A;  2CYF A;  2ZOE B;  3OGG A;  1Y43 B;  1VBA 2;  2YV8 A;  3NV3 A;  3QLQ A;  2GC3 A;  4L2N A;  3ZVX A;  4FPC A;  1V70 A;  5J96 B;  1BYH A;  3PJY A;  1AYN 2;  2P4E A;  1FPN 3;  2Z2S B;  3TRS B;  1Q5O A;  5DDJ 3;  1DU3 D;  1NE4 A;  4Q4W 1;  2ZX0 A;  4LQR A;  2MEV 1;  3O7O A;  1H4G A;  4BQ1 A;  4KU7 A;  4PQ9 A;  4ASK A;  4CYD A;  4FOV A;  2Z4F A;  4ORF A;  3WP5 A;  1GZC A;  3O1S A;  1DQ4 A;  1YRZ A;  4XFB A;  1O8S A;  4FXG B;  1OPO A;  2NPI A;  4M0N A;  1US2 A;  3K77 A;  4XET A;  4YW2 A;  1ALY A;  1VLN A;  3RJ2 X;  1ND2 A;  3SQO A;  3ES1 A;  1MR5 A;  4Z1V A;  1HB1 A;  1QXJ A;  1YQ6 A;  4RGG A;  1PK6 A;  3HR9 A;  4XAA A;  1ND3 B;  5GZE A;  3VGI A;  4ITC A;  1NLQ A;  2UYA A;  1EV1 1;  1XU2 A;  3HBK A;  2JEM A;  4A2U A;  2C1F A;  5F1R A;  1O3T A;  3OB8 A;  3R4D B;  5L7O B;  2D6M A;  3DYO A;  4QWN A;  2WWU A;  5FZD A;  4NAO A;  2W68 A;  5FYH A;  2ZS6 B;  4IV1 C;  1W6P A;  5A33 A;  3D82 A;  5KHI A;  1NA1 B;  2K2S A;  1MZE A;  1YI7 A;  2LW8 A;  2YC4 A;  3BN6 A;  3ON7 A;  4YM1 A;  5ABJ B;  1V9U 2;  4GJY A;  1OT5 A;  2BBA A;  1UYY A;  4K7J A;  2ET7 A;  1ZM1 A;  2AAC A;  5IJR A;  1VB2 A;  4QPG A;  3CZU A;  4YFZ A;  4AVV A;  3ETQ A;  1JZ3 A;  3ZN5 A;  2XQX A;  4CDW A;  3IKW A;  3I3M A;  3MIH A;  4BQX A;  3DCQ A;  4XIK A;  3AZX A;  3AMM A;  1DZR A;  1NAE A;  2QFE A;  4PIY A;  1R08 1;  1C4R A;  3GCW A;  4W6Y A;  3RYK A;  3TNQ A;  2H6B A;  1JTZ X;  2VUL A;  3C7E A;  4HL0 A;  4QDQ A;  1M4W A;  5FIX A;  4NHY A;  4QX3 A;  3AP9 A;  1FX5 A;  1R08 3;  4YRD A;  3U37 A;  5DMY A;  4MLO A;  3TEY A;  2DU1 A;  2RS1 2;  5IWF A;  1Y9G A;  2ATF A;  5A7Q A;  1ZZB A;  2ZAH A;  1Q8Q A;  2LM3 A;  3ATG A;  1BVP 1;  1VBE 2;  3AZV A;  1AYM 1;  3K3N A;  4R4X A;  1XE8 A;  2BUK A;  5L73 A;  1UU4 A;  2E7A A;  1SMV A;  3P3N A;  1GP5 A;  3AXD A;  2Z42 A;  3WW4 A;  1TME 3;  2GP3 A;  2RDQ A;  4D7S A;  1NXM A;  4DUW A;  5JMC A;  4NVP A;  1R1A 2;  2WII B;  4Y4Y A;  4BA6 A;  1RVF 3;  4Q8K A;  4XUO A;  3G7D A;  1W2U A;  3DN7 A;  1A78 A;  1RUJ 2;  5DUV A;  5F39 A;  4Z8B A;  4K8R B;  4MGQ A;  4YFW A;  1J1T A;  3ACL A;  3QOP A;  1T6B X;  1WW6 A;  4AGV A;  5BNO A;  4YAR A;  2JEC A;  2JDA A;  2E7Q A;  2VTF A;  1F4H A;  3VD7 A;  5FWJ A;  2QCS B;  3PVN A;  1C1F A;  5FZO A;  3WW3 A;  1W6Q A;  5FDB A;  3PVE A;  4FBF A;  4AHX A;  2TEP A;  4UFH A;  2YPD A;  4QQ2 A;  4Y1V A;  3POG A;  2XL7 A;  2HWC 3;  4XMI A;  5FRE A;  1QHD A;  1SDW A;  3QH7 A;  4LOS A;  5LCW L;  3VD9 A;  3VBR B;  4TYS A;  1MVQ A;  2JD4 A;  3T0A A;  5E6H A;  1RUF 2;  2B5H A;  1VBB 1;  4W4Z A;  4R4Z A;  1DQ6 A;  3T30 A;  1MQT C;  2V73 A;  1UIJ A;  2G19 A;  3THP A;  1JYX A;  2EXH A;  2I74 A;  4Y5S A;  4WVM A;  1EUT A;  1JI6 A;  5H9S A;  1XU1 A;  2BYV E;  1PMI A;  3O14 A;  3RZZ A;  2XKO A;  3LD8 A;  5H9Q A;  3RSJ A;  2XVG A;  1VBB 3;  3CLP A;  1QOT A;  4EJR A;  1ZRE A;  4KWL A;  5F5A A;  5CFD A;  2HJI A;  4IEV A;  3KCX A;  4S2G A;  1VMJ A;  4NPL A;  2ZBJ A;  4JKK A;  3RWN A;  3UL2 A;  2CTV A;  1H2K A;  1XPW A;  2CV6 A;  1RUE 2;  2UY9 A;  3MF6 A;  3PVO A;  5AFB A;  4GMP 0;  2ZEW A;  2XJQ A;  4LTA A;  5J3U A;  1PGL 2;  4RQP C;  1BVV A;  1X36 A;  2D43 A;  4QPY A;  4CCE A;  4CCD A;  1C28 A;  1VAM A;  3VBH C;  4PF1 A;  1I6X A;  2WFF 1;  2W39 A;  4AFM A;  1HIX A;  3ZYG A;  1RHI 1;  2GH2 A;  1DYK A;  4CCO A;  5BNN C;  3ZYH A;  2WSU A;  1AR8 2;  1WW7 A;  4C90 A;  4ZHN A;  3RZH A;  2ZEX A;  2OYZ A;  1POV 1;  4P9X A;  4AVC A;  1S0I A;  1EUU A;  2XWJ B;  1DGW X;  2WFF 3;  4L97 A;  2CY6 A;  1RHI 3;  4B29 A;  4ZU7 A;  2JDK A;  1YI9 A;  2WNV C;  4YM0 A;  2W08 A;  3M1H A;  3CJI B;  3O5S A;  3LEG A;  1E5R A;  4KQ7 A;  5K0U C;  2QUO A;  1W6N B;  5C4W A;  2HWF 1;  3JXS A;  4CUA A;  1MS9 A;  5FYI A;  3FUO A;  1PO2 2;  5C71 A;  5LY1 A;  1LGB A;  5M0T A;  5EYY A;  4Y1X A;  2O14 A;  4HAN A;  4IE6 A;  3WLU A;  5IK5 A;  1WMX A;  3J8F 1;  5I0S A;  3UET A;  4UWD A;  3C8X A;  4UXA A;  1LEC A;  1WLW A;  4NOT A;  2OT7 A;  4ZZ8 A;  2NZ9 A;  2HWF 3;  1VP6 A;  3FZ3 A;  5HXM A;  3VUO A;  1CWP A;  4CDX B;  5HV4 A;  3AKS A;  3MUZ 1;  3ZN6 B;  5I0T A;  2WS9 3;  3J8F 3;  3PU8 A;  4XBN A;  1NCQ B;  1XOY A;  1K42 A;  1OQ1 A;  1WKY A;  3ZOI A;  5C8W A;  2Y6G A;  1NLS A;  2P6H A;  5ANN A;  5T55 A;  1ASJ 1;  2WYF A;  4GUL A;  1FV3 A;  1MS1 A;  1UCX A;  3VB9 A;  3AZW A;  4FOQ A;  1S0C A;  3TNP B;  1JW6 A;  2HEV F;  3R05 A;  1HQN A;  2VOW A;  4S2F A;  4UFL A;  3J4U H;  3H1W A;  4FT8 A;  4MET A;  5IAX A;  1Z78 A;  3URF A;  4Y5Z 0;  1OLM A;  4BDV B;  4RR3 A;  1TMF 1;  3U1X A;  1VMF A;  2ZJC A;  3NST A;  3OD4 A;  2FHR A;  1WWY A;  3I4I A;  4NRM A;  4Q4Y 3;  5BNQ A;  1KRI A;  2VMG A;  2W95 A;  4PLN A;  1AYN 1;  1HXS 3;  3GJB A;  4AQT A;  5I91 A;  4Z2A A;  2BNM A;  5FMD A;  2Y8K A;  3IT8 A;  3LFI A;  5JOY A;  5FPA A;  4CU8 A;  1VBA 3;  2UWA A;  4PDW C;  4IEW A;  2JDU A;  3M3I A;  5A7N A;  4NIG A;  3DUI A;  2VOX A;  3FBM A;  1W90 A;  4NAM A;  1W04 A;  5LEJ A;  2EXK A;  1Q43 A;  5KR7 A;  1VBC 2;  1O5L A;  3JB4 C;  4O61 A;  3D0J A;  4ZKT B;  4YPJ A;  1ULP A;  1W8N A;  5FXX A;  3FFZ A;  3VD3 A;  3IPV A;  4P9W A;  4XFC A;  3VBS C;  4J1W A;  1RXG A;  1GZ9 A;  3WF0 A;  2UWC A;  1BKZ A;  5EIY B;  5HCA A;  2RDN A;  3U14 A;  3NAP C;  3MW2 A;  4NRO A;  4FP3 A;  2IFR A;  4MOA A;  3DPR C;  2P34 A;  1POQ A;  3Q8A A;  4SBV A;  2GND A;  3LKJ A;  2EIB A;  3BOP A;  3AMN A;  4N9H A;  4AFC A;  4AI1 A;  2F4P A;  1FOD 2;  5GLZ A;  4XIL A;  1IG3 A;  1OKQ A;  5F8P A;  2VBD A;  3NKG A;  2W46 A;  2ETE A;  1NQJ A;  3PVB B;  4XE9 A;  1EAH 1;  3KVB A;  4AW7 A;  1JZ4 A;  5A32 A;  3S0M A;  1LOG A;  1W8T A;  4OLL A;  1V9U 3; 
#chains in the Genus database with same CATH homology
 4JZR A;  5LAT A;  4XAA A;  5L9B A;  4Q5O A;  2RDS A;  4NAO A;  3KT1 A;  3NNM A;  4XCA A;  5EP9 A;  4XC9 A;  3GZE A;  5A3U A;  3MGU A;  5DAQ A;  3W20 A;  5HV0 A;  5IAV A;  5LAS A;  4BQW A;  4XAB A;  3HQU A;  4BQX A;  5M0T A;  4ZON A;  4J25 A;  4UWD A;  4BQY A;  2FCU A;  5HV4 A;  4NHY A;  5LBC A;  3NNL A;  2JIJ A;  3OUJ A;  4NHK A;  3W21 A;  5LB6 A;  5L9V A;  4Y5T A;  5DAV A;  4KBZ A;  3EMR A;  2HBT A;  2G1M A;  2HBU A;  3GJA A;  2RDQ A;  5LA9 A;  3NNJ A;  5IAX A;  5DAW A;  2RG4 A;  3KT4 A;  3ITQ A;  3NNF A;  3PL0 A;  3OUH A;  4ZPI A;  4IW3 A;  3GJB A;  5EQU A;  5LBB A;  5DAP A;  4MHU A;  4NHX A;  2A1X A;  2FCV A;  4NMI A;  3DKQ A;  2JIG A;  3HQR A;  4MHR A;  2FCT A;  5EPA A;  4NHL A;  5L9R A;  2RDN A;  3OUI A;  2G19 A;  3BVC A;  2Y33 A;  2OPW A;  4NHM A;  4Y5S A;  2RDR A;  5C5T A;  5IAT A;  5LBE A;  5DAX A;  5ERL A;  3OBZ A;  5C5U A;  4XCB A;  3KT7 A;  5LBF A;  4XAC A;  2Y34 A;  2V4A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...