3HQUA

Phd2:fe:un9:partial hif1-alpha substrate complex
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
215
structure length
215
Chain Sequence
LPALKLALEYIVPCMNKHGICVVDDFLGKETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCNGKLGSYKINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/transcription
molecule keywords Egl nine homolog 1
publication title Structural basis for binding of hypoxia-inducible factor to the oxygen-sensing prolyl hydroxylases
pubmed doi rcsb
source organism Homo sapiens
total genus 63
structure length 215
sequence length 215
ec nomenclature ec 1.14.11.29: Hypoxia-inducible factor-proline dioxygenase.
pdb deposition date 2009-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13640 2OG-FeII_Oxy_3 2OG-Fe(II) oxygenase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 3hquA00
5LBBA 2V4AA 4NHYA 3GJBA 2RDRA 3HQUA 2RDNA 5A3UA 4Q5OA 4XCAA 3NNFA 3OUJA 3GZEA 4Y5TA 4ZONA 5EP9A 4XC9A 3EMRA 3KT7A 5LASA 3NNMA 3MGUA 5DAWA 3KT1A 3W21A 3PL0A 4XCBA 5LATA 5LA9A 4NHLA 4NHXA 5HV0A 3ITQA 5LB6A 5IAXA 2OPWA 2RDQA 2HBUA 3W20A 2A1XA 4UWDA 3OBZA 5DAPA 4MHUA 4BQXA 3NNJA 5DAQA 3KT4A 5LBCA 3BVCA 5L9RA 5DAVA 5IATA 5EPAA 2RDSA 5L9BA 3HQRA 5HV4A 2FCUA 5DAXA 4XAAA 2G19A 2G1MA 3OUIA 5ERLA 4NHMA 4XACA 5C5TA 2HBTA 4XABA 4BQWA 2RG4A 4NAOA 5M0TA 4Y5SA 2JIJA 4JZRA 5LBEA 5EQUA 4MHRA 3DKQA 4J25A 2JIGA 5IAVA 4BQYA 4IW3A 2FCVA 4KBZA 2Y34A 3GJAA 3NNLA 5L9VA 4ZPIA 2Y33A 5LBFA 3OUHA 2FCTA 4NMIA 5C5UA 4NHKA
chains in the Genus database with same CATH superfamily
4QB1A 3WNXA 1V9U3 3ACLA 3BPZA 2FZ2A 3HEIA 2LTNA 1VB2A 2V4AA 4IEOA 3AVRA 1W6NB 2P3YA 4RN5A 3GJBA 2RS12 2W94A 2ZGSA 2C9KA 2QZ3A 4RR3A 4YM0A 1GP5A 2L9LA 1A78A 2W5FA 2RE9A 2ZX0A 3UKNA 3VLBB 3OYWB 1VBE2 3MLJA 2PQQA 1FOD1 3WW1A 1R092 3VKMA 5AFEA 3HNYM 4V2VA 1JYCA 5FYIA 3ZN6A 3GZEA 1PMJX 2ZACA 2IWGB 3CZJA 4XPVA 4CDWB 2B4KA 1NA1B 3FWEA 5F5CA 4W65A 1RHI2 2BRTA 2VBPA 3SKVA 4CEYC 1D2SA 5FZGA 1JODA 1QXRA 2MNGA 4AI0A 3B01A 2YFUA 4LKFA 1Q43A 3I2KA 3B00A 5F2WA 1UXZA 3ZSKA 1IS3A 3ZXLA 4QB2A 3ZLIA 3UETA 1OQEA 2E53A 2VD7A 3I2GA 4XZPA 2JDZA 1W04A 2RDQA 4PLOA 1JU4A 2RJKA 4V1PA 3ZN4A 2HWF1 3ZYJB 1HRV3 4WM8C 3MF9A 3VBFA 4AFAA 5C4WA 5I8YA 1RUJ3 5FZ7A 3GCXA 3WY6A 4YFZA 1F31A 4JCKA 4HBNA 5GJ6A 1AR72 4QKDA 2VZSA 5FP8A 5FYZA 2VTXJ 2ZMNA 4OQ8A 2BNMA 5F7UA 4UT5A 1W8OA 2PXJA 5DAQA 2ORXA 5FCCA 4BMBA 1JZ4A 1X8MA 4MYEA 3BIWE 1GFF2 4PIZA 4P5HA 2XBO2 1LOFC 1B09A 1QNYA 4Z82A 2HWE1 2XPJA 5E88A 4YZ4A 3BPSA 2ZMLA 2RDSA 3MO4A 4M3CE 1OD3A 3FHIB 3IKWA 3A4UA 3MBWA 2ARBA 1YCIA 1IKQA 2JKBA 4YZ2A 4GXLA 5CFCC 2JE9A 2DVAA 4IETA 4SLIA 4XQDA 1NLSA 2ZEXA 1RUOA 3FBMA 4E2SA 2JDAA 3FN9A 3PMEA 4XFFA 2OZJA 2XVKA 5FO7B 3LF7A 4H7MA 1U5IA 4E4DX 1LU1A 1AR92 3CLPA 1F8VA 4FPEA 4FOYA 2P3IA 3C2UA 2XG3A 2QKDA 1LNSA 3OCPA 4Y26A 4AWDA 2ZKLA 1OURA 3ZXJA 4WVZA 2Y6GA 1RUE1 1MEC3 3E6BA 4PIXA 3CBNA 3HIFA 2JE7A 5FZ4A 4C8DA 1I6XA 1GR3A 2KXLA 3K46A 1K12A 1WMEA 2W1QA 2P5BA 3PDQA 5AC92 1PVC2 1UU5A 4IW3A 5FIXA 3WF3A 4HKWA 1UOBA 5T52A 1D0GA 2Y26A 1ZZ7A 3EJKA 4HOOA 4IGQA 3T0BA 2R7EB 3VD7A 2IZWA 3MV01 5TSWA 1YQ5A 1C5HA 3OGJA 1VALA 1K5MC 1WKYA 1NLQA 2A75A 5EYXA 1PO12 3F95A 1LECA 4E8CA 2FCTA 3RQ0A 3VL8A 1VBD3 4BB3A 1NZIA 5CG8A 1Q8SA 3VBOC 2IXJA 3I2DA 4O61A 1EV13 5DG2A 4D7TA 2RMU1 3DPRA 5FZ8A 5I8TA 1CZSA 1Q56A 4DXSA 3PVOA 3B5LB 5LY1A 5JLVA 1L3JA 3AZZA 1DGWX 4RFT0 4RGKA 1DBNA 4HG6B 4K20A 1BVVA 1XYOA 4Y4RA 2D44A 5K7PA 3AKPA 5FYYA 4CSWA 3RMYA 1BEV1 2YPDA 1NY71 1IG0A 2WZR1 4LQRA 2P3JA 5CNAA 4JHZA 5A6QA 3S5AA 4P9XA 5EP9A 4CA9A 4G3YC 1PO22 3OGSA 5C3SA 2Y6HA 3J26N 5JZGA 4JKKA 1BK1A 4M0HA 3GF6A 3ME2A 1NE6A 4RQPB 3KCYA 3MHZA 2WYSA 3SC7X 4EN0A 4IV1C 1JI6A 2VUAA 1HRI2 3PL0A 4OHXA 5LA9A 1EYBA 3AZWA 4CP9A 2FMDA 1POV1 2VZVA 1WCDJ 1J58A 3KHBA 3OPZA 3UGHA 2R061 1FMD3 3VDDC 3R4SA 3H3UA 5DUXA 2MHFA 1UZWA 5FY1A 2WA3A 3LDKA 4IE7A 4D7SA 2WQ8A 4LORA 1REDA 2OQ6A 4NR1A 1J3RA 3WNKA 3ZFEC 1FOD2 2JX9A 1KS4A 2N7GA 2WNVC 4RS5C 1SEFA 2ZX2A 1LEMA 1LU2A 2I45A 4FFFA 3WDVA 1DGLA 2QBXA 3BVCA 2XQXA 2CNAA 4UBHA 3LZZA 4GA9A 4NE9A 5GKAC 1UX6A 5CEHA 1H1AA 1N1TA 3EYPA 1XNDA 2XHKA 1VIWB 5DQ0A 1ULFA 4NPLA 1CGPA 1ZREA 5FV3A 4UW4A 2V4VA 4RGGA 4CDUC 4DOUA 4CUCA 4OLLA 3BTYA 4BH9A 2CGNA 2JDPA 5F32A 4EWAA 1HJFA 2WO7A 5FYTA 5FZLA 2WZEA 2HWF2 2JB8A 4CU8A 4WBBA 1HB2A 3H8RA 1Q5OA 3MLKA 2WUHA 3PUAA 4I0WB 1ASJ3 1FAYA 4R9BA 3NJVA 4R9AA 2RM23 4FP3A 1UYZA 3B7MA 4RA0A 5I0UA 3VBRA 4BXSV 2WNUC 1GZTA 1H8TB 3NAPC 2V09A 5CBLA 1QJY3 3WD5A 3PLQA 1H4HA 1V6OA 3TN91 1H9WA 2JIJA 5FYVA 4W8JA 3IDAA 4QPWA 1W8FA 3H1WA 4MZUA 3BODA 2VMFA 5A3WA 4MHRA 3QCWA 5A7OA 1UKRA 3IMMA 1XOYA 4AI8A 5FPUA 2HWE2 2ZGRA 3OY8A 1BXHA 1J3PA 3POIA 1A8MA 4XF3A 4KBZA 2IC1A 2JD9A 2XLGA 3SKJE 5L7OC 3RG0A 4IDZA 4A41A 2C24A 2XLFA 2YBPA 2IXCA 1V0AA 1V9U2 4X8PA 5EZWA 3FL7A 3RZZA 1SLBA 1XU1A 4AEDB 2Y8KA 3OUHA 5C33A 1TZOA 1WCSA 3I3MA 2RR11 4QD2A 4O9EA 4CEWA 1S2BA 5LBBA 1SLIA 1PK6C 1UN1A 1SACA 4QXKA 1LOGA 2BPA2 3PJQA 3KGLA 3U11A 1G9DA 4AVVA 2WSUA 5JSOA 2JWPA 2RDRA 3CZUA 3HQUA 4X6RB 5FOBB 1REEA 3AJYA 2WWSA 3N9MA 5D1IA 4FPKA 4EYUA 5BV6A 3T2OA 1RUE2 1W2UA 5CIRA 1SMVA 2JG9C 3NKTA 1K42A 1NCRA 2A71A 1X7NA 1OPOA 4JGYA 3VBFB 3O0VA 5C4WB 2J1VA 4EQVA 1ZBE1 3VHRA 4Z07A 1OOPB 1VBC3 4URTA 1JOBA 1TME1 2I07B 4M4PA 1RINA 1MVEA 3NV3A 5FO9B 3T2PA 4ZKTB 1F15A 4BA6A 4XVHA 4B7KA 4D7YA 4BE3A 1C8M3 2NM1A 5FXWA 4A3XA 2RM21 4NHLA 2R043 4IEUA 4NHXA 5GLWA 2JDUA 1XE7A 2C6SA 1YQ2A 2B9UA 3WF0A 4BIOA 4BM8A 3O1TA 1EPZA 2RMU2 2W2IA 3K3NA 1GP6A 3M7AA 4XF9A 5HCAA 2EAKA 5IW0A 1O3RA 5JIAA 4LLFA 1N1VA 4YG0A 1XBFA 4YM2A 3UNPA 1UQXA 3O1RA 1BYHA 3N36A 2HEVF 3AJZA 2W3JA 3R0RA 4C0HA 1XNTA 3TOJA 5C9AC 2Z42A 3RYKA 3R6SA 1BEV2 4LPLA 3UV9A 2WZR2 3KB5A 5F8PA 4JTNA 1WLTA 4H14A 3UK9A 3JBG1 5C8WA 2B8MA 3I97A 1UOGA 1AYM1 1OMIA 3ES1A 5CFDB 3RMXA 5HXVA 1V6LA 3VZOA 3PUHA 2WFPA 4IUGA 1VLNA 3MEPA 4XAAA 1W3VA 2G19A 3IDEA 5LEJA 1Z7S3 3OUIA 4ZU4A 4CU9A 1LAJA 1WCQA 2R062 4F3JA 3KS7A 3AP5A 5FR3A 2WQZC 3FMGA 4W50A 2GMMA 5FKCA 3OSDA 3WT3A 1JZ5A 4FTBA 2VAUA 2SBAA 4FO9A 4YLZA 1UZYA 1QH7A 3J7NA 1LHOA 3NV2A 4Y5Z0 3WDUA 4CYDA 4D6RA 4NAOA 4JQRA 5LA0A 2LROA 1XE8A 1Y4WA 4LJHA 2ZX3A 2CAUA 4AZZA 1FI2A 1AXZA 1KJLA 1W06A 5FPXA 1EAH1 3DL3A 4QU1A 2Q8EA 3DPRB 2HH9A 2VXJA 1G9BA 1PNFA 2NZ9A 3A21A 4I0AA 1SBDA 2WO2A 5A6XA 1JH5A 1RUG3 1PGL1 4HMZA 3BYWA 3OPWA 1S0JA 2HWD1 2VZUA 4OI2A 4MXWA 3A7QA 2ZZQA 5LA1A 1AF9A 1W6MA 1WLDA 4PBOA 3TAYA 3O14A 4UI9L 1W0NA 3ZMOA 1ALYA 1AUYA 5E89A 5JZGB 4XURA 1LTEA 2EA7A 4R52A 5JOXA 3TN92 3KZ4C 2J1TA 5F2SA 1RUI1 3O7OA 2E6VA 2AREA 2D3SA 4AVSA 4CP9B 3OTFA 1JOPA 1OFNA 2G9FA 1OT5A 5E8AA 4AEKA 4AI9A 1D0HA 2Q1ZB 4XTMA 2PHRA 1I1EA 1CAXA 2A6ZA 1G86A 3D82A 3U1XA 4JV4A 1C8NA 2R6QA 4LA3A 1OQDA 3NV1A 4MXVA 3VD5A 3OBTA 1W8WA 1YXWA 1KEXA 5JIUA 3ZPOA 1GP4A 2WAOA 4BLJA 4FXKB 2ZXQA 1MS4A 1N1YA 1L7LA 4NIAA 3POFA 3VBHA 3L2YA 2GNMA 1O5LA 4UAPA 1RUC1 1DHKB 1OLMA 4EN8B 1OLQA 5KXEA 4AQSA 1X82A 2RR12 2JDHA 4OI1A 3V65A 4C1WA 5HV0A 3SQOA 1YNAA 1GQGA 3HMYA 4FCAA 3NNGA 4JAAA 3ZKUA 1ZNPA 4MUVA 3AP9A 4CCMA 4XHBA 2RS31 4OHYA 1HX6A 3VKLA 5A1AA 1LOAA 1Y9GA 2BP6A 3MIFA 5FY0A 4YPJA 4K1YA 2ZBJA 3DGTA 1SHWB 3JB8A 4RGAA 1QDOA 3IDCB 2IFWA 3JCIA 3MIEA 5IFTA 1W6QA 1VBE3 3W58A 3M2MA 5FMOS 5FZOA 4Z2WA 4FPGA 1R093 5FZ3A 4E2QA 1DCSA 1SZBA 4FT8A 3S30A 4FOQA 1Y43B 4YW6A 1OLRA 1YC61 4LUKA 1ZBE2 4QGNA 2PELA 3VBRB 5J7MA 1TME2 1CJDA 1VE0A 4P02B 4XXAA 4XJ9A 2ZMKA 1JTZX 2PFWA 3ILNA 5FZ1A 5LK7B 3DYMA 4QKBA 4BISA 2FCUA 2OYZA 1LHWA 1UY3A 2CGPA 3MW4A 2RM22 3IMNA 4J1WA 3NJZA 5FXXA 1SLTA 4WM8A 3JZVA 3O1SA 2EXIA 3OY8B 4NHMA 5JSRA 2JDKA 3GGLA 2OS2A 2VJXA 2XJSA 3G7DA 3SH5A 3ZYBA 5K0UC 5EHDA 2YFZA 3E5QA 1SCSA 4B8EA 1D2QA 1HLCA 4OHWA 3RI9A 3AKSA 2GMEA 3I2FA 1RVF1 1AR73 1O3QA 4LHKA 2VCAA 1BJQA 4JZRA 3ZFFC 1LOFA 5LBEA 2WS93 5CVRA 4CEWB 1ZBA1 3LE0A 1N1SA 1V6IA 3RNSA 3UT0A 1S2EA 1QF3A 3JBG2 1AYM2 2PHFA 2XBO3 3DXUA 3FUQA 3E6DA 4DEVA 5A3OA 3Q8CA 3VL9A 4UFLA 5CFCA 3TB0A 3W5NA 3NSTA 2ZX4A 4XJUA 2E9QA 2VTFA 3B9CA 4BHPA 4XFAA 4KU8A 3VUOA 1ULOA 1JBCA 3CL1A 2VG9A 1CAVA 1PIV3 1NCRB 5EJ1B 1COV1 2VPVA 4Q29A 4QKNA 3GHNA 4PQQA 4JGYB 3WQ0A 4P9LA 1E5SA 2Y6KA 3THPA 3DKWA 2D6MA 2J1RA 4UFJA 5JXHA 2UY8A 3WQ7A 1SG3A 4JDNA 1S0DA 1BBT1 2VZ1A 3WF4A 3ZXAC 2RV9A 4CUBA 1EY2A 1W6OA 5FZMA 1YQCA 2ARAA 4FQZA 4XXPA 3T30A 3WVJA 3NJXA 1MACA 4QX3A 3P5BA 3SH4A 1J84A 4XJZA 4YVWC 2VECA 1U5YA 4Z8BA 5ABJC 1LCLA 4XQ4A 1HW5A 1JS9A 1IKPA 1EAH2 4HFSA 4CCOA 4E4ZA 1F5JA 4LO5B 3ZSJA 5C8CB 4YVSC 5AC93 1PVC3 4M3CA 2PHXA 3SNMA 4CP0A 4XC9A 4BK4A 1K5MA 2DCZA 1MS1A 2BNNA 4OHVA 1PGL2 4XF4A 2HWD2 5C3QA 2D6OX 4BPZA 5A6ZA 2CTVA 2PMWB 4HSJA 3VBOA 1DF0A 3PTYA 5A7SA 1SCRA 2D6PA 1VMFA 2A7AA 3MIGA 4XOGA 3C7EA 4DUXA 1KDKA 2QQVA 1PO13 2RVAA 2DVDA 1AX1A 1IG3A 1HN1A 5A7QA 4IEQA 5D8AC 3KD4A 4DXTA 4LOTA 2QQNA 2DUOA 2GC0A 3IT8A 3D0SA 3PIJA 3H42B 3S5QA 3KQRA 1PHMA 4CPBA 4G9SB 1SDDB 2D93A 1RUI2 4UW3A 5FAXA 3B02A 5FY8A 3UGFA 1W2NA 2X5IC 4NROA 4AVTA 5IK8A 2QJVA 1UPSA 1GZ9A 4E27A 5FZDA 3W5MA 1UZVA 1V6KA 2VZPA 4OQ9A 4I2OA 2WJSA 2YYOA 3MF6A 3I2JA 2C1FA 5HCHA 1CONA 2J42A 1RJ7A 4YG3A 4FQ4A 4AFDA 5KHJA 2DWRA 3AMMA 4IV1A 5C70A 3V0AA 1H1MA 1PIV1 1PO23 2VZOA 3N7KA 3NVCA 1VP6A 4KH9A 4Y1XA 1CESA 2J22A 5L9BA 4AFCA 3MUY1 1H2KA 1RUC2 1ST8A 3IM0A 5A80A 2YU1A 1W05A 3LD8A 4FP2A 4DS0A 3VDDA 4TXWA 1TEIA 1X50A 4COVA 1QHDA 2G1MA 2HWB1 3UGGA 1JYVA 4IV3C 2X29A 2KD7A 1MQTC 3C7GA 4QX2A 1ZRDA 1KITA 1RUD1 2RS32 3I8TA 4IEXA 4XACA 4Y22A 3ACHA 2PHLA 3I2IA 4HVRA 2WNVA 2E7QA 4Q4W1 3WNPA 3ZFEA 4AI3A 4DPNA 5J1XA 4CCKA 4IGPA 1DP0A 3ZOIA 1C4RA 1MZEA 1O7FA 4BLIA 3Q8EA 3POGA 5FYMA 5I0DA 2J1EA 3IN9A 4MXWB 3J7MA 1FOD3 4A2UA 4EN6B 3I2HA 5F6LB 3ACGA 4HONA 1W6MB 5T3NA 5IT6A 3AYDA 5K4LA 3WF2A 1STMA 1D4VB 1HQLA 5DUUA 2MEV1 4CP2A 2AUYA 2W08A 1IHMA 3NMBA 4IEPA 1OLME 3GJAA 4ARYA 2BU9A 5HXMA 1OHFA 1CD3G 5LA2A 5BYNA 4RSUA 3ORJA 4QMAA 5FPVA 1O91A 4XJ8A 1GZCA 1VMJA 1KDMA 3KQ4B 3WP3A 1GANA 4ZPIA 4ZXEA 1UIKA 1CQ9A 2BBAA 3R4DB 1CIYA 3AM2A 2ZEYA 4P9YA 1CAXB 2WSVA 4ATEA 1DGRN 2WNUA 3A22A 3MZHA 2YU2A 3C7HA 1OD5A 3AMQA 4D69A 5BNNB 1W8HA 1TG7A 2PQSA 1H0BA 4Q0UA 3RSJA 3ZX7A 5DUWA 1W2OA 3MUZ1 4FPFA 2ATFA 1RVF2 5A7NA 4Q0SA 3VBHB 2H0VA 4TN7A 4A6SA 5FJHA 1DQ4A 1ZBA2 2Q4SA 2OKXA 2W47A 1W0PA 4YYOA 5L7OA 5I0TA 3V64A 2NYYA 2Y38A 2GC3A 1UAIA 5FP3A 3RVHA 5JMOA 4XQWA 4LBQA 2YY1A 5IVBA 2B42B 4X8NA 1HB1A 3MPBA 3MI8A 3RJ2X 1JUHA 2OQ7A 3KWVA 2ZGNA 1W6QB 4S2FA 1U0AA 1PK6A 1PX4A 1COV2 5FZOB 5HCFA 4BK5A 3ZSLA 1TVGA 1VBA1 2OW4A 4QU2A 5BPXA 3GBGA 5A3NA 4CEYB 4E2GA 1BHGA 2GZWA 3WG1A 4BQ5A 5J36A 1YJLA 3CU7A 1BBT2 1EPWA 3LOBA 5EXOA 4X6QB 4Y24A 2IFRA 4INDA 4AEDA 5T5LA 3WDXA 2V5YA 2JG9A 4UW6A 3D8CA 5IUQA 5FK7A 1UY0A 2WINB 5LEKA 4WM8B 1TQ5A 1APNA 2H6BA 4MHUA 4OULA 1AJKA 1RUE3 3B94A 3QD6A 4COUA 2C26A 3GYDA 5L9RA 4OCTA 4A3ZA 1NE4A 3QH6A 4AVAA 4O9GA 2FZ1A 4XFCA 3URFA 1UD1A 1KGYA 4DINB 4P5YA 3POSA 1H4GA 2BOJA 2HKXA 2R1BA 2XJTA 4JGZC 4NRQA 3T4HB 3WEZA 1MS3A 1ZRIA 2AR6A 4WM7C 1TNFA 4BYYA 3JD71 3RWKX 3P3PA 4DEQA 2J1AA 3VZMA 1S0BA 1UMZA 5FLHA 2PAMA 3AZXA 4BIFA 4HKLA 3SLIA 4FPHA 1OOPA 3ON7A 1H1IA 5LW9A 2WO3A 1WLCA 4DO0A 5C5TA 5CFCB 2W9XA 1AR81 2RMU3 2WS92 3AL6A 4Q4X1 3B3QE 4PT6A 4OHZA 4LBMA 1ZX5A 1P8JA 1NLRA 2A6XA 5KXBA 5C3OA 2ZTNA 3KVBA 4JKLA 4NAMA 3M3IA 5FYHA 3RGBA 1O8PA 1CAVB 4D0QA 4LOSA 5FZAA 1BCXA 2PAKA 3FE5A 3J7HA 2YC4A 2E51A 2A70A 2JENA 2YG0A 2JIGA 4GB33 1BEV3 4CCNA 2WZR3 2DTYA 3CKHA 2P1BA 5FP7A 2GH8A 2Y64A 3LSDA 4QQLA 4GKYA 4HL0A 1PIV2 2QQIA 2ZGKA 4YSFA 1W6OB 2Y60A 1O5UA 3PVNA 4LXLA 5FBJA 3BI3A 4MADA 4OZXA 3WR0A 3W9AA 1UU4A 4FOWA 4RHV1 5T5JA 2EIEA 3LCPA 2ZZJA 1UNBA 4EN7B 5LZ6A 3QOPA 2HWB2 3PUIA 4N53C 2YDEA 1VMHA 4COWA 2OUHA 1POV3 1JYXA 3R4UA 4E9KA 3DCQA 5FQ0A 1URXA 3A0KA 2R063 5CFDA 3S6PA 2ENRA 4M3CB 2DVGA 2XVGA 3NV4A 5EIYB 1K5MB 2QE3A 1NYWA 2VCMA 3WINE 1JUIA 2VR4A 4TZDA 2RHPA 3VBUC 3E5UA 2W92A 3ETPA 4GH4C 2O8OA 4QXCA 2JB4A 1FV3A 4MOAA 3VBOB 4A6OA 2BNOA 4CDQC 4BXFA 3KCXA 1ZM1A 4DY3A 4GIQA 2DV9A 4V2WA 2MEV2 4ISRA 3RPQA 4O7XA 1HJGA 4ZONA 3VD9A 1PM4A 2B45X 3KV9A 1X33A 1UIJA 1DZQA 4LR4A 5FZ6A 3A23A 5KHGA 1JZ7A 3PMSA 2ZEWA 5DZEA 1GYKA 4HLTA 3MGUA 1DU3D 1TE1B 4UFIA 5LRSA 4FTEA 5J48A 1W6PA 4N7IA 4LLOA 4YRDA 5I93A 4AGRA 2DU0A 3P1IA 1OKOA 3VDBA 2CYFA 5JSPA 4ASLA 2W39A 3CMGA 4DXRA 4IV1B 3ROUA 2J1UA 3CQOA 5JI7A 3V0AB 4HVOA 4DUVA 3AFKA 4F8AA 4WVVA 5A32A 4P9IA 2XXZA 4BWOA 5IVEA 3TN93 1IS6A 1WZXA 4GD4A 1MVQA 2ZPXA 4GB31 4JTOA 4N43C 4Q27A 4UWDA 4WVWA 3VDDB 3KV5A 3I3DA 1GNYA 2Q0AA 4H55A 1JU3A 4QXBA 1FPN1 2EAAA 4Y22B 1DGWA 1QOOA 1R64A 2ZGMA 3M3CA 3AP7A 3ZFEB 1HIXA 1ND2C 1YUDA 2WNVB 4RS5B 1CPNA 3EXUA 5APAA 3U37A 2VH9A 2WBKA 4EJRA 4FPJA 4COZA 2Y6JA 4YGBA 3ZR5A 2W1SA 1PMIA 2XKPA 2D40A 5BNPC 2FD8A 1XB9A 1QXJA 1VBA2 1YFYA 3HBZA 3IPVB 5DG1A 3K4DA 4AE2A 5A3MA 1K5JA 2RR13 3H7JA 5ERLA 1QJEA 4W6WA 2W0XA 2A3XA 4LULA 2ZA9A 4CDUB 5JWPA 1LOBA 1OA3A 2NN8A 1GQPA 5IJRA 2D43A 4HN1A 3T3YA 1DG6A 5LCWL 2WLQA 5DZFA 5SV8A 1WW4A 4QX5A 4QX7A 3PJYA 4XUOA 3ACIA 4UFKA 3TYJA 2QQPA 4QB6A 2RS51 2WNUB 2JJ6A 2R30A 3A0NA 1W8UA 1ACCA 2JDNA 1GMMA 1V6MA 4J25A 1DQ2A 4BQYA 4QXHA 2BJSA 5EJZB 3W59A 1ZBE3 2GC2A 1Y9MA 4QDQA 3TEZA 1J83A 2WC2A 1HV1A 1TME3 1XYPA 2K46A 3GZAA 3GDBA 1YQ8A 1IS5A 1EUUA 3JD72 3JQWA 4GMP1 4XUNA 4YGDA 3S0MA 4QAWA 4Q0VA 4QHZA 1X9PA 3PU3A 3IB3A 2Y33A 1QJU1 5K0UA 5KHKA 2UYAA 5L7OB 3RZMA 4MSVA 1BQPA 3WP6A 4I0BA 1RXGA 2CV6A 4GJYA 4OVEA 1FNZA 1F35A 1XPWA 1ENXA 2O8QA 2ZGUA 3DF0A 2P4EA 3LB9A 1AR82 4LBQB 4NPRA 4Q4X2 2YB7A 1HB3A 3RRDA 3U07A 5A70A 1PX3A 3LEMA 1E5RA 4NHYA 1IPSA 3ZFFA 4S2DA 4FPOB 5IWFA 1ZZ9A 2ETEA 3T2TA 5C7GA 2GDFA 5EV7A 4D6SA 1OC1A 3TRSB 3DYOA 2QVSB 5F5IA 4MGTA 1MS9A 3PNAA 1PK6B 1UXXX 5AFBA 1IGOA 4CXXA 3N9OA 4Y1UA 2O14A 1DIWA 1XSRA 4ZZ8A 4YZ1A 1RUH1 3FJSA 4LHLA 5DABA 5FJKA 3ZMNA 2DCTA 1Q8VA 3N9LA 3ZFGC 3Q9OA 4HK9A 2JICA 3L2HA 3JBG3 3AZYA 4MGIE 1UU6A 4A7YA 1AYM3 4W6XA 2YROA 2JG9B 3NNMA 4RHV2 4LKEA 4P9JA 1PGSA 2PAEA 3HD8B 4KGGA 3POBA 1W9YA 2HWC1 1H6YA 2QDRA 4Y20A 4FTSA 4FBFA 1OPMA 3ITQA 5LB6A 3WNMA 4PDWC 1L7QA 4KQ7A 3LIHA 2PA7A 2E63A 4LIUA 1W0OA 3WNOA 4L8QA 2HBUA 5F3IA 1U12A 4XIOA 2WT0A 4Q8LA 2TNFA 3U75A 3OD4A 4QQPA 4YVWA 4Q8KA 4Q1RA 5FKBA 4A42A 5I0SA 2IXHA 2GSYA 5GZCA 1OQ1A 3IDBB 3U4SA 2DBNA 3HNMA 5F39A 3WOGA 1WCKA 2P6CA 2VOXA 3ASIA 3N7LA 4U36A 4XEZA 5FXVA 4YVSA 4AXOA 4UYBA 5CKMA 5JXGA 1S0CA 1MZ5A 4EWDA 1LGCA 2NMOA 3LA3A 4C1XA 3D3AA 1EAH3 1RMU1 1J59A 1DYKA 3HVDA 5EPAA 5IVFA 2HYKA 2YXSA 1QJX1 4KGQA 1QJZA 4RR3C 3HOBA 4AEMA 4CRQA 1MZFA 4Y33A 1LHNA 2HWD3 1WW5A 2WABA 3C7OA 3E5XA 1UO9A 5D8AA 3H0OA 3JB4C 3WF1A 5JR7B 2ZGTA 3USSA 4O65A 5C8CA 2CWMA 2UURA 2DCKA 3WXPA 2GN3A 2QTWB 4XUPA 1AHSA 2XH6A 1UMIA 2X5IA 3ETQA 3I49A 1J1LA 4XETA 3VV1A 1KXGA 5T54A 2VBDA 4XABA 2WFF1 3U4XA 1YIPA 1JN2P 3H9AA 4GB32 4PQ9A 1QKQA 1NY72 1RUI3 3AXDA 5FPLA 2C4XA 1XU2A 5A7WA 4OUSA 3VBSC 3O1UA 1S0EA 2GALA 1REFA 1KFUL 4H2AA 2NP0A 2D5FA 5FZFA 4DRRA 1NCQC 1FPN2 4FPLA 5FQ0B 1AL21 5G04L 1US2A 3DXTA 5C4WC 1UYPA 3OF1A 2ARXA 4OMDA 3U0ZA 3KF5A 4WZCA 2Q1MA 5J3UA 4XILA 1E57A 1TMF3 1YI9A 4IESA 5IVCA 4ZY9A 1W8ZA 4IV3A 1MQTA 4NJ4A 1GUIA 1PZ7A 4JRLA 1KD7A 5FZCA 4EROA 4EV0A 1RUC3 3JQXA 4YWAA 1FNYA 1DYOA 1MPXA 5DMYA 5L9VA 1W03A 5LBFA 2BW8A 4PI2A 1C3HA 2Y0OA 4DQAA 3K77A 4PF1A 1GKBA 1LB2A 3KHCA 5KXDA 1B35C 3SEEA 4URAA 5FMOL 4RFRB 3LFIA 5FZEA 2RS33 3AMPA 3INAA 4LHSA 4JRAA 1SQ4A 3LA2A 1CWPA 3CJIC 4Q26A 3ES4A 3U14A 4BQ3A 3DYPA 2WZPP 5BNOC 5A3UA 1WA6X 1H8VA 2NQYA 1AX0A 4BQ4A 3GXUA 2RS52 1ZRCA 1W6PB 1NXD1 3VHNA 3ZVXA 3VD3A 2YBSA 2BERA 2WAAA 3LEKA 4KU7A 1XC6A 2VMEA 1O8SA 4Q1PA 4OZOA 1A8DA 4LTAA 2GP3A 5GZEA 5A32B 3KT7A 2IXKA 3OB8A 3RZJA 1I3HA 1OFSA 4I01A 1OSGA 3WNLA 1VBB1 5DAWA 4H3WA 3TWIA 2VY0A 4CVUA 1QJU2 2SLIA 3BU0A 1N3QA 4M0NA 2YGMA 2VQTA 1LESA 3MIDA 3ZDVA 1WGPA 4CE8A 3NRUA 3I2OA 1UCXA 2UWAA 3SCHA 3J9SA 4AYUA 3N7MA 2O0OA 2VMHA 3EHKA 1CN1A 4GJZA 3H50A 5JPMB 2XJPA 4QT6A 2YUEA 3VN4A 2VUJA 4IE0A 4HXCA 1WMFA 5GZGA 3UKTA 4FFIA 1RVF3 4AHXA 4NIDA 3BCWA 5C5UA 3ZYPA 1RUH2 3O1OA 1HB4A 1TMF1 5AVAA 4KL1A 1ZBA3 5BNNA 1RUNA 1H2MA 2Z5WA 5T5PA 5IK5A 3I7DA 4YM3A 1CAUB 1LR5A 2BTVC 3FUOA 4YNIA 4LBOA 5A33A 3U10A 1OUSA 2W46A 1XNAA 2D6LX 2ORZA 4NPMA 2AYHA 2YMZA 4OI0A 3AX4A 4M00A 2TEPA 2WR9A 1LRHA 1QIQA 1G9FA 1NAEA 2ERFA 2EVXA 2HWC2 4YGEA 4B4RA 5C3RA 4LNVA 5CU1A 4C90A 4CXWA 3T0DA 2VL4A 1SPPA 1COV3 1G7YA 5F1RA 1JYNA 3PUQA 3WCSA 1RIRA 2JG8C 5F5AA 4AFBA 3JXSA 5JZGC 1G9AA 1KS5A 3BTZA 2WIIB 4NRMA 1BBT3 4XFIA 3FZ3A 4BQWA 2FDIA 2E33A 3KM5A 2XLAA 4DZGA 3TNQA 2XGXA 1LULA 2NPIA 2BFUS 2XR4A 3VZNA 5JVVA 1HKDA 2B46X 5K0UB 3AFGA 2AACA 3HJRA 4JDOA 4B7EA 1XNBA 1F5FA 1YYNA 2PYTA 5E1RA 1RMU2 1YHFA 5IAVA 1I9RA 4BCUA 3KLSA 1AXYA 2DBIA 1QJX2 3J8F1 1OA4A 4OUEA 3ZFFB 1X8EA 1PNGA 4Y1VA 4QGLA 1SFYA 3SISA 4ASMB 1BK0A 2W91A 2Q5TA 1G9CA 1GBGA 4TWTA 3KV4A 4GKXA 3HBKA 1AJOA 2D6KA 5LRRA 4ET7A 4YZ5A 2PHDA 1UZ0A 5FYUA 3VHPA 2YC0A 5ACA1 1AX2A 1IZ3A 4NHKA 2GN7A 3WW3A 4IXLA 4RD7A 5F3GA 1A34A 2WFF2 3T1MA 1DQ5A 3K75B 3N7JA 4YARA 3OBRA 3OGVA 4KG0A 4PF5A 4Y1YA 4Y1ZA 4RYDA 1S2KA 3ZIXA 2VNRA 1XE0A 5JOZA 4XCAA 4FSJA 3GHMA 3LPFA 4Y20B 2BQPA 2HLEA 2HJIA 1ENRA 2P17A 4QGMA 1ENQA 1AL22 1PZ8A 3AL5A 2JD4A 3FX3A 4LK7A 1M06G 3T2QA 3M3EA 2A6VA 3OBAA 3I4IA 1UF2C 4Y5TA 1OA2A 3BOPA 4YVWB 2GU9A 5ABJB 4N53A 1OF3A 2DVBA 1JZ8A 1UOJA 5I0RA 2VCCA 2B9VA 1CX4A 1LKNA 1R081 3HQXA 2R0HA 4IEZA 4YVSB 3KT1A 2LUWA 5KC6A 1UW8A 3I59A 4MVTA 4JDMA 1OI6A 5L36A 2HWB3 2VULA 2GC1A 3LSEA 3N9PA 3MV11 3WG4A 2WT2A 3RYPA 2MPFA 3Q8FA 3VBUA 3ZSMA 1RUD3 1R1A1 2ZAHA 4GH4A 1E5HA 4FXGB 1M4WA 4Q4W3 2BDRA 4CDQA 1QGLA 3UL2A 1Q8QA 5FMCA 3B9IA 1EP0A 2VOVA 5D8AB 3AYAA 4FFGA 4L99A 5GZFA 3SMHA 4QPGC 2DYCA 1HXS1 3RDIA 3M70A 4XDOA 5J96B 2GNDA 2DUPA 2VNGA 3VKNA 2ZGLA 4MGSA 3MDPA 2X5IB 3K51A 1T6BX 2JEMA 5BUVA 1XSQA 2MEV3 2PTMA 5I8SA 4P14A 1G6NA 3FLPA 3VB9A 4AAPA 2FBEA 1Y3TA 3BB6A 5FY9A 1VBB2 3EBRA 4LMFA 5F9TA 3K2OA 5FXZA 4CU7A 5A7WB 1NOVA 2WA4A 4BJ0A 2WWJA 4LA2A 3I3BA 1FX5A 4N7UA 4U2AA 2R1DA 4R4ZA 1OXCA 5T50A 3VKOA 3HAGA 1J3QA 2UY9A 2OT7A 2EXJA 3POEA 1ZRRA 5DUVA 5J09A 3EO6A 3H8XA 3I54A 4N43A 2DDUA 2VVDA 5FP9A 2NLRA 5C3PA 4IV3B 3VZKA 3D6EA 4NOTA 4LE3A 3N35A 4WVMA 1MQTB 3S7IA 5KWRA 3ZXEA 3S7EA 3BTAA 4QX0A 3CHXA 3IBMA 1TMF2 3OEAA 1ND2A 3IWZA 4B29A 4BDVB 1F4AA 2XHNA 1IOAA 1US3A 3ABZA 3POJA 3NKGA 1PGW1 3LIGA 5FZBA 3V0BA 2FDJA 1UWWA 1S0GA 1EUTA 3H3LA 2CHHA 5BNQA 2RJ2A 5BNPA 2QDNA 1VRBA 2XJVA 3KVAA 4EE2A 1GICA 3AKRA 2VNOA 3MFAA 1WW7A 4UFMA 4XHXA 1RL3A 2GNBA 2LALA 3Q8BA 1MS5A 4XIKA 3RJRA 2WYFA 1W9WA 1S1AA 1VBA3 2ZS6B 4RS5A 1TNRA 2VNVA 4K21A 1IQDC 1U5ZA 4ORFA 1GOFA 4M3CF 2XDVA 1G8WA 1YLLA 2QQJA 1PVXA 5IYYA 3ACFA 2DF7A 1QMJA 4BOWA 3IPVA 1AL0G 5HBAA 1GQHA 1YO8A 2RDNA 4PBPA 5FUNA 1W2AX 4ASKA 3V56A 4KWKA 1H6XA 2K2SA 2WNEA 1AR61 2D97A 4CDUA 2BUKA 4XUQA 3SXWA 2ZGPA 2TUNA 2Z69A 3J8F2 4FVVA 2QQWA 1BMV1 1ZZ8A 4PCRA 3AC0A 3ILRA 1HQWA 1DFQA 4Q4V1 2VVFA 4AQ2A 1H30A 1Z78A 3PU8A 2Y6LA 3BU7A 4HVQA 2YC2A 1ULEA 1J1TA 2DURA 3NAPA 3JD73 4COYA 1GOHA 1NUKA 4NN0A 2GAUA 4N9HA 4Q4Y1 3W21A 2ZHLA 4JHTA 3GZUC 5ACA2 4QPIC 3RWNA 1C57A 5IAXA 1CJPA 2KR2A 4AQ6A 2P34A 5FZKA 5A33B 1LEDA 1C5IA 3KCCA 3NWKA 4Y4YA 1AR83 1AYN1 4Q4X3 3ZN5A 4CDXC 5IK7A 1Y7BA 3WDWA 1W28A 2A1XA 4HSLA 2D98A 5B2GB 5CKNA 4XFHA 1QQP1 3HN3A 3PIGA 3ZFGA 5KC5A 1GOGA 4NUBA 1SPPB 1W3XA 4TTGA 4JKMA 5JAXA 1ZYBA 5JR2A 4R8HA 1O6UA 2W1WA 3BUCA 5EYYA 5IATA 5HPOA 4EZHA 1ULPA 2ZHNA 3UKVA 3GZTB 2XVLA 1R082 4TSVA 5FYSA 4RHV3 2XJUA 1DQ6A 1FYUA 1ZZCA 3HQRA 4FPCA 2B5HA 2JXAA 5L73A 3BIEA 4AGVA 2R071 2XWJB 2AZ5A 2H6CA 2ZGOA 3CNAA 4JGZB 5FLJA 2XJQA 2XKOA 4KG8A 4A7KA 1R1A2 4ITCA 4WM7B 5IK4A 1NKGA 1W9FA 2ZABA 5CISA 3ZXGA 1U5XA 1BZWA 1H2LA 3NL1A 1JHNA 4JX0A 4BQ1A 2VW1A 3DECA 2DCYA 5SV5A 2VC9A 2CAVA 4FAHA 4L9BA 1SDWA 4IEWA 4MH0E 5KHHA 3VDCA 4NWWA 3QACA 4IL7A 5LK5A 1IS4A 1HXS2 4YM1A 2XUMA 1RTVA 1QOSA 5EQUA 4QM8A 2XB6C 3JUUA 3RZHA 2CSGA 1MS8A 1ND3C 4GWNA 1ONAA 4LKDA 1XNKA 2ZKNA 4KWJA 5FZIA 4NVPA 3VKFC 1HV0A 2VOWA 1RB8G 2Q1FA 3ALQA 1F2NA 1YWKA 1W39A 1GWLA 1NXMA 2Y34A 1DZRA 3OD0A 4D3WA 4DMIA 3K4AA 3NNLA 4AI1A 4QKFA 2EF6A 1JYIA 1UPIA 1GNHA 2BGCA 2QUOA 1YIFA 5F37A 1YEWA 4OUMA 1UMHA 5DDJ1 2QZ2A 5IVYA 4AW7A 2AH2A 2OZ6A 2BVBA 5C9AA 1W2TA 3AP4A 5JXJA 1D4M1 3D5OA 3MLLA 1QDCA 4ZHNA 4N53B 3VBSA 2P37A 4IEVA 4IGOA 1NCQA 1VRH1 3ZXKA 2YBKA 1QOTA 4NRPA 3HT1A 4MO3M 2B7YA 4CDWC 5FWEA 3I59B 1NA1C 2JKXA 3AYCA 1GSLA 1S0FA 2PLV1 1PGW2 3LDBA 3SHRA 4HZFA 1LOEA 4QX1A 1FPN3 3VBUB 1WLWA 4G4FA 1L7RA 4K7JA 1WCUA 4GH4B 5FOJB 4LIVA 3ZYRA 4CDQB 3IAPA 1LGNA 2F4LA 3PVEA 3EMRA 4N90A 2CDOA 4QHOA 4YFWA 4UBGA 4L97A 2ADDA 1RUD2 2DU1A 3APBA 5FZ0A 3HN1A 2VUDA 4NO4A 4Q0PA 1B35A 4Q4W2 1YJKA 3KMHA 4LHNA 1CVNA 4CUAA 2EIDA 3CJIA 2FMYA 1ULDA 3KF3A 1V9U1 5DN2A 4GAZA 5BNOA 4UXAA 4AI2A 2AGSA 3GBFA 2E7TA 2XMLA 3IIIA 1RYYA 3RFRA 3W20A 4FI9A 1QNWA 2AEYA 5GZDA 3HPNA 3LEGA 5HCBA 1QH6A 4ES9A 1WWYA 1W8NA 1AR62 1VPHA 1KFXL 1F9KA 3VDAA 4XDPA 2RS53 5FZHA 2X8KA 5EWSA 3NW4A 1BMV2 1RXFA 4AVBA 4N43B 2UU8A 4Q4V2 1GNZA 5H9SA 4YW5A 3WCRA 4WVMB 3K4ZA 4PLNA 2VM9A 3VD4A 1JYTA 2FDKA 1GWKA 4GMP3 1QWRA 4XUTA 5HV4A 4Q4Y2 1ND2B 1D7PM 3FFQA 5DAXA 1Q3EA 2BBVA 1QJU3 4I09A 3V0BB 4K6BA 4FPYA 4KMQA 3WX5A 4EZ4A 1BKZA 5BNPB 5F5QA 3C3VA 1H2NA 3D0JA 1AYN2 1HRV1 3O12A 5JPNB 5JI9A 1SBEA 1OKQA 2HBTA 1RUJ1 3FC0A 3T09A 4R4XA 2YGLA 1JZ2A 1WMDA 1VB4A 2RG4A 3SH3A 1QQP2 1T2XA 2J7MA 3OJBA 1HQNA 4S2GA 5K8SA 3MPPG 3LGRA 1RGSA 1RUH3 4E4HA 1UY4A 5D2AA 2G4IA 2K0GA 2WKKA 3ZYIB 2VCBA 5BY5A 3FLRA 1S4CA 2YHJA 2YPJA 4I3PA 5KHIA 3OGRA 4DB5A 1SLLA 1JOJA 3POYA 1S55A 4B4PA 1ZA7A 2R072 3LKJA 1O3SA 2JG8A 5GALA 4N9IA 1YI7A 2HWC3 1CAUA 1WBFA 4K9SA 3H8OA 1K3IA 1MZ6A 2WRAA 3H7YA 1IQAA 2VU9A 4FFHA 3LEIA 1ENSA 1ZA4A 3WG2A 3O0WA 4AR2A 5DPNA 4DIQA 1OF4A 2A73B 3RYRA 1RUF3 2VBBA 3P6BA 4HETA 4AG4A 4J6GA 5JMCA 2ILMA 2IUWA 3NAPB 4AGGA 5A1FA 4Q5OA 4Z2AA 4AAXA 3NO8A 4K8RB 3ZR6A 1MEC1 4YG6A 3ZDSA 2ZHKA 3DN7A 3OUJA 1DLLA 2D5HA 2QQMA 4I02A 2UWCA 3FFZA 4RQPC 3B69A 2VQAA 1RMU3 1O4YA 4ZXKA 2DVFA 5EJ3A 3ST7A 1QJX3 5GLVA 2EIBA 4LKSA 3UESA 3ZYGA 5JCTA 1JHJA 1QEXA 3P3NA 5F3EA 5F6KA 4I30A 3AMHA 3ZFGB 5CKQA 3CF6E 4QQOA 5DDJ2 2X05A 2FDFA 5H9QA 3WNNA 2VO5A 2DUQA 4GWIA 4AL9A 1FXZA 1W90A 3ZIWA 4GQ7A 3S57A 1D4M2 1VBD1 1KQRA 1RITA 3N4MA 3HNBM 3ELNA 1EV11 3UJQA 1E5IA 3LOIA 1VRH2 2XOMA 1LHVA 2WFF3 2Z79A 4B1MA 2F17A 2WO1A 4PDWB 5FYBA 1I5PA 4CUGA 2PLV2 1IPJA 5A1LA 2UYBA 1YQ6A 3H1MA 3NNJA 3K48A 3O5SA 2O1QA 5JOYA 3MFCA 1AL23 2VW0A 3WW2A 1CAWA 2QQOA 2VMIA 1F4HA 3SEPA 1GLHA 3UYJA 3BN6A 3H3ZA 4D94A 1NT0A 2P3KA 4HANA 4HT1T 5FP4A 5J98B 3N9NA 2QNKA 3WQBA 4A44A 5HI0A 1CIWA 1LODA 4LO7A 4UOJA 3WP4A 3PHMA 3J4UH 4XBLA 3AXEA 5CB7A 2WWUA 4RR3B 4FAGA 3RI8A 1RUF1 5A6YA 4P9GA 5AVPA 1H8TC 2A6YA 5ABJA 3AKTA 4Z1VA 3LFMA 2F4PA 1UY1A 1FMD1 1NQJA 2VW2A 1UOFA 3IZOA 4A7ZA 3POWA 3ZN6B 4QPGA 3ZSEA 3ZXFA 5D21A 4BMEA 4QDSA 2ZX1A 5M0TA 4XW3A 4YW1A 4CXYA 2BGOA 2OIIA 1WUVA 2P2KA 3SCGA 3PVBB 2WLPA 4R9CA 5C9AB 3WP5A 4QQHA 2XONA 5FLIA 2XL7A 4KWUA 4K3UA 4DY5A 4QX8A 1WA4A 4K8FA 4E4SA 2AENA 3VBSB 4AEDC 2W52A 1QJFA 1BVP1 5C71A 4S2HA 1NCQB 3BKZA 4MGYE 1N3OA 3QH7A 2IXIA 1LENA 2ZGQA 2JECA 2IXLA 4IE6A 5GLUA 2IVIB 1ODMA 4YW7A 1VBB3 1XXNA 1DZTA 4AHZA 1GZWA 4IEYA 5FBZA 4CPBD 4NWVA 2PHTA 3CIHA 5L19A 2Z2SB 1SLAA 1XRUA 2G9GA 3CEWA 4KBBA 4UF0A 3ZO0B 2LM3A 3OOXA 2J1SA 3J7LA 5JDBA 2Q8OA 3G6JB 2BGPA 1Y9QA 1HRV2 4B3NA 1VAKA 5LY2A 1WD3A 1RUJ2 1CR7A 1ASJ1 1C1FA 1JXNA 2HYXA 2QQKA 4L11A 3MICA 2I74A 4CCJA 3AK0A 5FY5A 1QJY1 1B35B 2IVJA 3VBFC 2ES3A 5A3PA 1LOCA 4MG2A 1A6CA 4LITA 1OOPC 3CJIB 2QFEA 2K9ZA 5IFPA 3N3HA 5BNOB 5CYYA 2C9AA 5B4NA 1QY4A 5CZKA 3AP6A 4CEYA 4LBLA 1ODNA 4LT5A 4XF0A 2W87A 2VXRA 2KA3A 5LASA 3T0AA 2V5DA 1AXKA 5IVVA 3HWJA 3VGIA 1O59A 1OH4A 4XMIA 3M3QA 4AHYA 2BWCA 1O4ZA 1UL9A 4XCBA 1VJ2A 5B4XA 2VOTA 4CTEA 2BFUL 5CG9A 3N9QA 3GNEA 4NIGA 1SFNA 2OPWA 1FV2A 1LGBA 2A3YA 1LJ7A 1SBFA 4AOCA 2R49A 4K40A 2X10A 5IVJA 1OBNA 2WNOA 4HPKA 2VUCA 3DEMA 3THDA 3USUA 4PLMA 2Z4FA 2D7FA 1DDLA 1YFWA 4MGKE 2W1UA 4CCCA 2GMPA 3LPGA 4LO8A 4YW4A 3CJXA 5FMBA 5DAPA 1MEC2 2BYVE 4B4QA 4XYXA 3MIBA 1ZRFA 3UJOA 2VTXA 4ZU5A 3BOWA 4CCEA 5CFDC 4XFGA 5LBCA 1DQ1A 2OXBA 4A4AA 4LBNA 3MIHA 3ZKYA 1XJAA 3TEXA 1C28A 3E1F1 3J8F3 2D3PA 4Y3OA 2D3RA 4AFMA 4ARXA 1PM7A 3M8LA 4XTPA 1VBC1 5JOWA 3D4KA 4MGZE 4SBVA 1WMXA 5FPBA 1Q8OA 3WUDA 4QPIA 4GZ9A 4L2NA 2AEZA 4XMAA 5EFUA 4EWEA 3T4VA 4ZS2A 2KM2A 1C8M1 2R32A 4BQ2A 1VBD2 2JDMA 1FT9A 2R041 1XQNA 4CDXA 5ACA3 3OEBA 3LAGA 1EV12 2PHWA 4ZU7A 2H0BA 4ZZ5A 2GH2A 2VZTA 1NG0A 1GV9A 4XJAA 1JW6A 2XQRA 4PJYA 2OPKA 5FRAA 3I3EA 5FMDA 4XBQA 2V72A 3WW4A 4LBQD 2ZEZA 2JG8B 4GWJA 2BV4A 3DPRC 2E32A 3O0XA 3WV6A 3LWCA 2JE8A 3ZPYA 1UX7A 4IQPA 4C0BA 5C6CA 3L9JT 4XZUG 1CZTA 3IIAA 1T6GC 2OUJA 4JC1A 1DYPA 3DKQA 5K9YA 4A45A 2I2SA 2ZAAA 4IE5A 2ET1A 2G9ZA 4PIYA 5T5OA 3M1HA 2X53S 4FOVA 3TEYA 4N8MA 1KJRA 5FO8B 4J1XA 1ZZBA 4KNCA 3KV6A 1R083 1PZ9A 2HEWF 2VQUA 3WG3A 1RUF2 1Z7S1 2CL2A 4Q2FA 1ZVFA 5LWBA 1GU3A 4RL7A 1FMD2 4OYUA 3WHTA 4AHWA 4BZ4A 2YV8A 2Q30A 5FYCA 2FQPA 1JMUB 1R1A3 1RJ8A 1CPMA 4KI5M 2CY6A 1HN0A 2JDYA 2W68A 3QBQA 4XFBA 2EIGA 3OG2A 3PUSA 3PURA 4MX3A 2VZQA 3GALA 3CDZB 1HDKA 2WN2A 4W4ZA 1W9SA 4JGZA 2VE1A 2Q8CA 4P00B 4META 1ND3A 1ULGA 3MW3A 4DFSA 3EQEA 4P9WA 5FFOC 4WM7A 4F7ZA 2BEOA 2NMNA 1HXS3 3BGAA 3RZKA 2RS13 4IERA 4DRVA 4CZSA 2BVVA 4LEJA 4WV8A 2B39A 4TLFA 3HT2A 5DXDA 1W6NA 4LUMA 4QHBA 1RUG1 1FATA 4QPYA 5FDBA 4P08A 4XE9A 5FUIA 3O1MA 5LATA 4OI4A 3WUCA 3HR9A 3OYWA 2OVUA 4LBJA 4XBNA 3ENRA 1CAWB 1OVSA 1RHI3 3WSOA 1AVBA 1ASJ2 1DQ0A 4CDWA 1Z0HA 1NA1A 3AKQA 1QJY2 2EXHA 5E6HA 4YGCA 3CO2A 5H9PA 3RZLA 1X9TA 3OBZA 4XJWA 3NJYA 1UY2A 2ADEA 3VBRC 3ZXDA 4ATFA 2WL1A 1W8TA 4BQXA 2A5ZA 4W6YA 3WDYA 3KT4A 3FHAA 2ZHMA 2A3WA 5CA6A 5DAVA 4R9DA 2VZRA 2CDPA 1V00A 3M3OA 4QPGB 1QU0A 2XJRA 3QLQA 5A3LA 3JU9A 2CGOA 3FBYA 4F83A 5CAZA 5CADA 5I91A 1CZVA 4TLGA 3TBDA 2WZ8A 1DLCA 1VAMA 4OFGA 3Q8AA 1WW6A 5GM0A 1SFPA 5FZ9A 1OVPA 4YW3A 1POV0 4GULA 3THCA 4AEJA 4D6QA 2ARCA 3B93A 3O1VA 2D6NA 4IE4A 5IHRA 4LE4A 3VZLA 2ZOEB 1RC6A 1AZDA 3AZVA 4CEWC 3T08A 5KXCA 2RS11 1VAVA 3SITA 2QCSB 4CCLA 1GZWB 1VR3A 5FTTC 1SLCA 4Y5SA 5GLZA 1DGRA 4AQTA 5G05L 5ISLA 2ZJCA 5FY4A 1VBE1 4UF0B 1V70A 2QQUA 2VZ3A 1AR63 5A3TA 2C0ZA 1KRIA 1ZZ6A 2C5DA 1AR93 2LRPA 1R091 3KGZA 4LBKA 1V6NA 4DUWA 2DTWA 2FHRA 2WQ4A 1BLZA 5A7PA 5ANQA 4D8MA 4MGQA 3T1LA 4KWLA 3ZM8A 1VBC2 2BWAA 2LW8A 3KSCA 1NCRC 4UW5A 4Q4V3 1O4TA 1WD4A 2DFCA 2VGDA 4ZS3A 3ZYFA 4YZ3A 2XWBB 2P6HA 4JGYC 5JXIA 5KR7A 1RHI1 2EICA 3FLTA 1PMHX 2E26A 2GP5A 3LQCA 4ONUA 1C8M2 1MR5A 4Q0QA 5J37A 2BZDA 4I3GA 4Q4Y3 1NQDA 2R042 5FWJA 2WT1A 3E6CC 4CP1A 2DFBA 4NMIA 4AVCA 4GMP0 3LDRA 3FHQA 3R05A 2R16A 1V6JA 4QDRA 3WDTA 4M4RA 3AYEA 5FY7A 1AYN3 2F6BA 2E7AA 2EALA 1JYWA 5FK8A 2YZ4A 5FREA 5F3CA 1AR71 5C8CC 3O1PA 1QQP3 2Y6FA 3GM8A 3I3QA 3K3OA 4HK8A 2AC1A 2ET7A 2WS91 3NNFA 3OGGA 4LO4B 3TNPB 3VHOA 1OH3A 1XNCA 3DV8A 2UWBA 1JZ6A 4ISQA 3PTRB 3M4FA 5KBFA 2XBO1 4HPKB 2HEYF 2FDGA 4NIHA 3USUB 3ECQA 2GNTA 4Z92B 3THTA 5JUVA 1JZ3A 3BTXA 4L92A 5BXXA 1Q8PA 1Z7S2 3RZGA 4HKOA 2X09A 4DNYA 2R073 2QQLA 4DXZA 4ES8A 4LK6A 3C8XA 3WZ1A 4UFHA 4XF1A 2VVEA 2R0FA 2FDHA 4MV2A 4WZFA 5GLTA 3WHUA 4JVAA 1HRI3 3OPTA 4AK3A 5DZGA 4QPIB 2LS6A 2VQ0A 2Y0IA 1AR91 1WBLA 1YFUA 1N3PA 1OUXA 2TBVA 3ATGA 2W95A 4GWMA 2Q8DA 4BU2A 2OA2A 1X36A 1I5ZA 4RQPA 1UYXA 2VOKA 1UYYA 4GALA 3MYXA 1W99A 4B1LA 4H7LA 3LA7A 5FPAA 4CDXB 2PHUA 4QQ2A 4CCDA 4OMCA 3SCFA 2EXKA 2VMGA 4QM9A 3U78A 2CWSA 2CU5A 5AC91 3BALA 1H9PA 1PVC1 3GBWA 1XYNA 2XL9A 3H8UA 1RUG2 1POQA 1LHUA 3ZYHA 4CU6A 2ZCWA 5DDJ3 1W9TA 1IPKA 3F2ZA 1PO11 3WLUA 1MS0A 2PN5A 4MLOA 4TYSA 1D4M3 4C91A 3X29B 1K45A 3ILFA 1NZCA 3DUIA 5H9RA 2A6WA 3RS6A 1GWMA 2BOIA 5E16A 1ULCA 1VRH3 2XUEA 3AVSA 3EB7A 1C1LA 3WQ1A 2HWF3 5FPZA 3E97A 2ID4A 3H1YA 1S0IA 4M01A 2VMDA 4XAEA 4YW2A 4QWNA 4AF9A 2PLV3 1UKGA 3TEWA 4JQTA 4L0PA 2RJLA 1NX9A 5FUPA 2OX0A 4LO6B 4E8DA 3AMNA 3NQHA 2VMCA 4XDQA 4PHZA 4NIIA 1YRZA 4PDWA 2FCVA 1R1ZA 1N47A 2V73A 1PO21 5ANNA 5T55A 1YFXA 3MW2A 1QXPA 2DCJA 1UZZA 3IAQA 3GCWA 1ND3B 3AB0A 1H8TA 2WDBA 1CX1A 2HWE3 4HN0A 3C7FA 3VZJA 5BNNC 2E31A 1O3TA 1A3KA 1HRI1 4K1ZA 4PI0A 3VBHC 2WN3A 4EN9B
chains in the Genus database with same CATH topology
5LBBA 2V4AA 4NHYA 3GJBA 2RDRA 3HQUA 2RDNA 5A3UA 4Q5OA 4XCAA 3NNFA 3OUJA 3GZEA 4Y5TA 4ZONA 5EP9A 4XC9A 3EMRA 3KT7A 5LASA 3NNMA 3MGUA 5DAWA 3KT1A 3W21A 3PL0A 4XCBA 5LATA 5LA9A 4NHLA 4NHXA 5HV0A 3ITQA 5LB6A 5IAXA 2OPWA 2RDQA 2HBUA 3W20A 2A1XA 4UWDA 3OBZA 5DAPA 4MHUA 4BQXA 3NNJA 5DAQA 3KT4A 5LBCA 3BVCA 5L9RA 5DAVA 5IATA 5EPAA 2RDSA 5L9BA 3HQRA 5HV4A 2FCUA 5DAXA 4XAAA 2G19A 2G1MA 3OUIA 5ERLA 4NHMA 4XACA 5C5TA 2HBTA 4XABA 4BQWA 2RG4A 4NAOA 5M0TA 4Y5SA 2JIJA 4JZRA 5LBEA 5EQUA 4MHRA 3DKQA 4J25A 2JIGA 5IAVA 4BQYA 4IW3A 2FCVA 4KBZA 2Y34A 3GJAA 3NNLA 5L9VA 4ZPIA 2Y33A 5LBFA 3OUHA 2FCTA 4NMIA 5C5UA 4NHKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LBB A;  2V4A A;  4NHY A;  3GJB A;  2RDR A;  3HQU A;  2RDN A;  5A3U A;  4Q5O A;  4XCA A;  3NNF A;  3OUJ A;  3GZE A;  4Y5T A;  4ZON A;  5EP9 A;  4XC9 A;  3EMR A;  3KT7 A;  5LAS A;  3NNM A;  3MGU A;  5DAW A;  3KT1 A;  3W21 A;  3PL0 A;  4XCB A;  5LAT A;  5LA9 A;  4NHL A;  4NHX A;  5HV0 A;  3ITQ A;  5LB6 A;  5IAX A;  2OPW A;  2RDQ A;  2HBU A;  3W20 A;  2A1X A;  4UWD A;  3OBZ A;  5DAP A;  4MHU A;  4BQX A;  3NNJ A;  5DAQ A;  3KT4 A;  5LBC A;  3BVC A;  5L9R A;  5DAV A;  5IAT A;  5EPA A;  2RDS A;  5L9B A;  3HQR A;  5HV4 A;  2FCU A;  5DAX A;  4XAA A;  2G19 A;  2G1M A;  3OUI A;  5ERL A;  4NHM A;  4XAC A;  5C5T A;  2HBT A;  4XAB A;  4BQW A;  2RG4 A;  4NAO A;  5M0T A;  4Y5S A;  2JIJ A;  4JZR A;  5LBE A;  5EQU A;  4MHR A;  3DKQ A;  4J25 A;  2JIG A;  5IAV A;  4BQY A;  4IW3 A;  2FCV A;  4KBZ A;  2Y34 A;  3GJA A;  3NNL A;  5L9V A;  4ZPI A;  2Y33 A;  5LBF A;  3OUH A;  2FCT A;  4NMI A;  5C5U A;  4NHK A; 
#chains in the Genus database with same CATH topology
 4QB1 A;  3WNX A;  1V9U 3;  3ACL A;  3BPZ A;  2FZ2 A;  3HEI A;  2LTN A;  1VB2 A;  2V4A A;  4IEO A;  3AVR A;  1W6N B;  2P3Y A;  4RN5 A;  3GJB A;  2RS1 2;  2W94 A;  2ZGS A;  2C9K A;  2QZ3 A;  4RR3 A;  4YM0 A;  1GP5 A;  2L9L A;  1A78 A;  2W5F A;  2RE9 A;  2ZX0 A;  3UKN A;  3VLB B;  3OYW B;  1VBE 2;  3MLJ A;  2PQQ A;  1FOD 1;  3WW1 A;  1R09 2;  3VKM A;  5AFE A;  3HNY M;  4V2V A;  1JYC A;  5FYI A;  3ZN6 A;  3GZE A;  1PMJ X;  2ZAC A;  2IWG B;  3CZJ A;  4XPV A;  4CDW B;  2B4K A;  1NA1 B;  3FWE A;  5F5C A;  4W65 A;  1RHI 2;  2BRT A;  2VBP A;  3SKV A;  4CEY C;  1D2S A;  5FZG A;  1JOD A;  1QXR A;  2MNG A;  4AI0 A;  3B01 A;  2YFU A;  4LKF A;  1Q43 A;  3I2K A;  3B00 A;  5F2W A;  1UXZ A;  3ZSK A;  1IS3 A;  3ZXL A;  4QB2 A;  3ZLI A;  3UET A;  1OQE A;  2E53 A;  2VD7 A;  3I2G A;  4XZP A;  2JDZ A;  1W04 A;  2RDQ A;  4PLO A;  1JU4 A;  2RJK A;  4V1P A;  3ZN4 A;  2HWF 1;  3ZYJ B;  1HRV 3;  4WM8 C;  3MF9 A;  3VBF A;  4AFA A;  5C4W A;  5I8Y A;  1RUJ 3;  5FZ7 A;  3GCX A;  3WY6 A;  4YFZ A;  1F31 A;  4JCK A;  4HBN A;  5GJ6 A;  1AR7 2;  4QKD A;  2VZS A;  5FP8 A;  5FYZ A;  2VTX J;  2ZMN A;  4OQ8 A;  2BNM A;  5F7U A;  4UT5 A;  1W8O A;  2PXJ A;  5DAQ A;  2ORX A;  5FCC A;  4BMB A;  1JZ4 A;  1X8M A;  4MYE A;  3BIW E;  1GFF 2;  4PIZ A;  4P5H A;  2XBO 2;  1LOF C;  1B09 A;  1QNY A;  4Z82 A;  2HWE 1;  2XPJ A;  5E88 A;  4YZ4 A;  3BPS A;  2ZML A;  2RDS A;  3MO4 A;  4M3C E;  1OD3 A;  3FHI B;  3IKW A;  3A4U A;  3MBW A;  2ARB A;  1YCI A;  1IKQ A;  2JKB A;  4YZ2 A;  4GXL A;  5CFC C;  2JE9 A;  2DVA A;  4IET A;  4SLI A;  4XQD A;  1NLS A;  2ZEX A;  1RUO A;  3FBM A;  4E2S A;  2JDA A;  3FN9 A;  3PME A;  4XFF A;  2OZJ A;  2XVK A;  5FO7 B;  3LF7 A;  4H7M A;  1U5I A;  4E4D X;  1LU1 A;  1AR9 2;  3CLP A;  1F8V A;  4FPE A;  4FOY A;  2P3I A;  3C2U A;  2XG3 A;  2QKD A;  1LNS A;  3OCP A;  4Y26 A;  4AWD A;  2ZKL A;  1OUR A;  3ZXJ A;  4WVZ A;  2Y6G A;  1RUE 1;  1MEC 3;  3E6B A;  4PIX A;  3CBN A;  3HIF A;  2JE7 A;  5FZ4 A;  4C8D A;  1I6X A;  1GR3 A;  2KXL A;  3K46 A;  1K12 A;  1WME A;  2W1Q A;  2P5B A;  3PDQ A;  5AC9 2;  1PVC 2;  1UU5 A;  4IW3 A;  5FIX A;  3WF3 A;  4HKW A;  1UOB A;  5T52 A;  1D0G A;  2Y26 A;  1ZZ7 A;  3EJK A;  4HOO A;  4IGQ A;  3T0B A;  2R7E B;  3VD7 A;  2IZW A;  3MV0 1;  5TSW A;  1YQ5 A;  1C5H A;  3OGJ A;  1VAL A;  1K5M C;  1WKY A;  1NLQ A;  2A75 A;  5EYX A;  1PO1 2;  3F95 A;  1LEC A;  4E8C A;  2FCT A;  3RQ0 A;  3VL8 A;  1VBD 3;  4BB3 A;  1NZI A;  5CG8 A;  1Q8S A;  3VBO C;  2IXJ A;  3I2D A;  4O61 A;  1EV1 3;  5DG2 A;  4D7T A;  2RMU 1;  3DPR A;  5FZ8 A;  5I8T A;  1CZS A;  1Q56 A;  4DXS A;  3PVO A;  3B5L B;  5LY1 A;  5JLV A;  1L3J A;  3AZZ A;  1DGW X;  4RFT 0;  4RGK A;  1DBN A;  4HG6 B;  4K20 A;  1BVV A;  1XYO A;  4Y4R A;  2D44 A;  5K7P A;  3AKP A;  5FYY A;  4CSW A;  3RMY A;  1BEV 1;  2YPD A;  1NY7 1;  1IG0 A;  2WZR 1;  4LQR A;  2P3J A;  5CNA A;  4JHZ A;  5A6Q A;  3S5A A;  4P9X A;  5EP9 A;  4CA9 A;  4G3Y C;  1PO2 2;  3OGS A;  5C3S A;  2Y6H A;  3J26 N;  5JZG A;  4JKK A;  1BK1 A;  4M0H A;  3GF6 A;  3ME2 A;  1NE6 A;  4RQP B;  3KCY A;  3MHZ A;  2WYS A;  3SC7 X;  4EN0 A;  4IV1 C;  1JI6 A;  2VUA A;  1HRI 2;  3PL0 A;  4OHX A;  5LA9 A;  1EYB A;  3AZW A;  4CP9 A;  2FMD A;  1POV 1;  2VZV A;  1WCD J;  1J58 A;  3KHB A;  3OPZ A;  3UGH A;  2R06 1;  1FMD 3;  3VDD C;  3R4S A;  3H3U A;  5DUX A;  2MHF A;  1UZW A;  5FY1 A;  2WA3 A;  3LDK A;  4IE7 A;  4D7S A;  2WQ8 A;  4LOR A;  1RED A;  2OQ6 A;  4NR1 A;  1J3R A;  3WNK A;  3ZFE C;  1FOD 2;  2JX9 A;  1KS4 A;  2N7G A;  2WNV C;  4RS5 C;  1SEF A;  2ZX2 A;  1LEM A;  1LU2 A;  2I45 A;  4FFF A;  3WDV A;  1DGL A;  2QBX A;  3BVC A;  2XQX A;  2CNA A;  4UBH A;  3LZZ A;  4GA9 A;  4NE9 A;  5GKA C;  1UX6 A;  5CEH A;  1H1A A;  1N1T A;  3EYP A;  1XND A;  2XHK A;  1VIW B;  5DQ0 A;  1ULF A;  4NPL A;  1CGP A;  1ZRE A;  5FV3 A;  4UW4 A;  2V4V A;  4RGG A;  4CDU C;  4DOU A;  4CUC A;  4OLL A;  3BTY A;  4BH9 A;  2CGN A;  2JDP A;  5F32 A;  4EWA A;  1HJF A;  2WO7 A;  5FYT A;  5FZL A;  2WZE A;  2HWF 2;  2JB8 A;  4CU8 A;  4WBB A;  1HB2 A;  3H8R A;  1Q5O A;  3MLK A;  2WUH A;  3PUA A;  4I0W B;  1ASJ 3;  1FAY A;  4R9B A;  3NJV A;  4R9A A;  2RM2 3;  4FP3 A;  1UYZ A;  3B7M A;  4RA0 A;  5I0U A;  3VBR A;  4BXS V;  2WNU C;  1GZT A;  1H8T B;  3NAP C;  2V09 A;  5CBL A;  1QJY 3;  3WD5 A;  3PLQ A;  1H4H A;  1V6O A;  3TN9 1;  1H9W A;  2JIJ A;  5FYV A;  4W8J A;  3IDA A;  4QPW A;  1W8F A;  3H1W A;  4MZU A;  3BOD A;  2VMF A;  5A3W A;  4MHR A;  3QCW A;  5A7O A;  1UKR A;  3IMM A;  1XOY A;  4AI8 A;  5FPU A;  2HWE 2;  2ZGR A;  3OY8 A;  1BXH A;  1J3P A;  3POI A;  1A8M A;  4XF3 A;  4KBZ A;  2IC1 A;  2JD9 A;  2XLG A;  3SKJ E;  5L7O C;  3RG0 A;  4IDZ A;  4A41 A;  2C24 A;  2XLF A;  2YBP A;  2IXC A;  1V0A A;  1V9U 2;  4X8P A;  5EZW A;  3FL7 A;  3RZZ A;  1SLB A;  1XU1 A;  4AED B;  2Y8K A;  3OUH A;  5C33 A;  1TZO A;  1WCS A;  3I3M A;  2RR1 1;  4QD2 A;  4O9E A;  4CEW A;  1S2B A;  5LBB A;  1SLI A;  1PK6 C;  1UN1 A;  1SAC A;  4QXK A;  1LOG A;  2BPA 2;  3PJQ A;  3KGL A;  3U11 A;  1G9D A;  4AVV A;  2WSU A;  5JSO A;  2JWP A;  2RDR A;  3CZU A;  3HQU A;  4X6R B;  5FOB B;  1REE A;  3AJY A;  2WWS A;  3N9M A;  5D1I A;  4FPK A;  4EYU A;  5BV6 A;  3T2O A;  1RUE 2;  1W2U A;  5CIR A;  1SMV A;  2JG9 C;  3NKT A;  1K42 A;  1NCR A;  2A71 A;  1X7N A;  1OPO A;  4JGY A;  3VBF B;  3O0V A;  5C4W B;  2J1V A;  4EQV A;  1ZBE 1;  3VHR A;  4Z07 A;  1OOP B;  1VBC 3;  4URT A;  1JOB A;  1TME 1;  2I07 B;  4M4P A;  1RIN A;  1MVE A;  3NV3 A;  5FO9 B;  3T2P A;  4ZKT B;  1F15 A;  4BA6 A;  4XVH A;  4B7K A;  4D7Y A;  4BE3 A;  1C8M 3;  2NM1 A;  5FXW A;  4A3X A;  2RM2 1;  4NHL A;  2R04 3;  4IEU A;  4NHX A;  5GLW A;  2JDU A;  1XE7 A;  2C6S A;  1YQ2 A;  2B9U A;  3WF0 A;  4BIO A;  4BM8 A;  3O1T A;  1EPZ A;  2RMU 2;  2W2I A;  3K3N A;  1GP6 A;  3M7A A;  4XF9 A;  5HCA A;  2EAK A;  5IW0 A;  1O3R A;  5JIA A;  4LLF A;  1N1V A;  4YG0 A;  1XBF A;  4YM2 A;  3UNP A;  1UQX A;  3O1R A;  1BYH A;  3N36 A;  2HEV F;  3AJZ A;  2W3J A;  3R0R A;  4C0H A;  1XNT A;  3TOJ A;  5C9A C;  2Z42 A;  3RYK A;  3R6S A;  1BEV 2;  4LPL A;  3UV9 A;  2WZR 2;  3KB5 A;  5F8P A;  4JTN A;  1WLT A;  4H14 A;  3UK9 A;  3JBG 1;  5C8W A;  2B8M A;  3I97 A;  1UOG A;  1AYM 1;  1OMI A;  3ES1 A;  5CFD B;  3RMX A;  5HXV A;  1V6L A;  3VZO A;  3PUH A;  2WFP A;  4IUG A;  1VLN A;  3MEP A;  4XAA A;  1W3V A;  2G19 A;  3IDE A;  5LEJ A;  1Z7S 3;  3OUI A;  4ZU4 A;  4CU9 A;  1LAJ A;  1WCQ A;  2R06 2;  4F3J A;  3KS7 A;  3AP5 A;  5FR3 A;  2WQZ C;  3FMG A;  4W50 A;  2GMM A;  5FKC A;  3OSD A;  3WT3 A;  1JZ5 A;  4FTB A;  2VAU A;  2SBA A;  4FO9 A;  4YLZ A;  1UZY A;  1QH7 A;  3J7N A;  1LHO A;  3NV2 A;  4Y5Z 0;  3WDU A;  4CYD A;  4D6R A;  4NAO A;  4JQR A;  5LA0 A;  2LRO A;  1XE8 A;  1Y4W A;  4LJH A;  2ZX3 A;  2CAU A;  4AZZ A;  1FI2 A;  1AXZ A;  1KJL A;  1W06 A;  5FPX A;  1EAH 1;  3DL3 A;  4QU1 A;  2Q8E A;  3DPR B;  2HH9 A;  2VXJ A;  1G9B A;  1PNF A;  2NZ9 A;  3A21 A;  4I0A A;  1SBD A;  2WO2 A;  5A6X A;  1JH5 A;  1RUG 3;  1PGL 1;  4HMZ A;  3BYW A;  3OPW A;  1S0J A;  2HWD 1;  2VZU A;  4OI2 A;  4MXW A;  3A7Q A;  2ZZQ A;  5LA1 A;  1AF9 A;  1W6M A;  1WLD A;  4PBO A;  3TAY A;  3O14 A;  4UI9 L;  1W0N A;  3ZMO A;  1ALY A;  1AUY A;  5E89 A;  5JZG B;  4XUR A;  1LTE A;  2EA7 A;  4R52 A;  5JOX A;  3TN9 2;  3KZ4 C;  2J1T A;  5F2S A;  1RUI 1;  3O7O A;  2E6V A;  2ARE A;  2D3S A;  4AVS A;  4CP9 B;  3OTF A;  1JOP A;  1OFN A;  2G9F A;  1OT5 A;  5E8A A;  4AEK A;  4AI9 A;  1D0H A;  2Q1Z B;  4XTM A;  2PHR A;  1I1E A;  1CAX A;  2A6Z A;  1G86 A;  3D82 A;  3U1X A;  4JV4 A;  1C8N A;  2R6Q A;  4LA3 A;  1OQD A;  3NV1 A;  4MXV A;  3VD5 A;  3OBT A;  1W8W A;  1YXW A;  1KEX A;  5JIU A;  3ZPO A;  1GP4 A;  2WAO A;  4BLJ A;  4FXK B;  2ZXQ A;  1MS4 A;  1N1Y A;  1L7L A;  4NIA A;  3POF A;  3VBH A;  3L2Y A;  2GNM A;  1O5L A;  4UAP A;  1RUC 1;  1DHK B;  1OLM A;  4EN8 B;  1OLQ A;  5KXE A;  4AQS A;  1X82 A;  2RR1 2;  2JDH A;  4OI1 A;  3V65 A;  4C1W A;  5HV0 A;  3SQO A;  1YNA A;  1GQG A;  3HMY A;  4FCA A;  3NNG A;  4JAA A;  3ZKU A;  1ZNP A;  4MUV A;  3AP9 A;  4CCM A;  4XHB A;  2RS3 1;  4OHY A;  1HX6 A;  3VKL A;  5A1A A;  1LOA A;  1Y9G A;  2BP6 A;  3MIF A;  5FY0 A;  4YPJ A;  4K1Y A;  2ZBJ A;  3DGT A;  1SHW B;  3JB8 A;  4RGA A;  1QDO A;  3IDC B;  2IFW A;  3JCI A;  3MIE A;  5IFT A;  1W6Q A;  1VBE 3;  3W58 A;  3M2M A;  5FMO S;  5FZO A;  4Z2W A;  4FPG A;  1R09 3;  5FZ3 A;  4E2Q A;  1DCS A;  1SZB A;  4FT8 A;  3S30 A;  4FOQ A;  1Y43 B;  4YW6 A;  1OLR A;  1YC6 1;  4LUK A;  1ZBE 2;  4QGN A;  2PEL A;  3VBR B;  5J7M A;  1TME 2;  1CJD A;  1VE0 A;  4P02 B;  4XXA A;  4XJ9 A;  2ZMK A;  1JTZ X;  2PFW A;  3ILN A;  5FZ1 A;  5LK7 B;  3DYM A;  4QKB A;  4BIS A;  2FCU A;  2OYZ A;  1LHW A;  1UY3 A;  2CGP A;  3MW4 A;  2RM2 2;  3IMN A;  4J1W A;  3NJZ A;  5FXX A;  1SLT A;  4WM8 A;  3JZV A;  3O1S A;  2EXI A;  3OY8 B;  4NHM A;  5JSR A;  2JDK A;  3GGL A;  2OS2 A;  2VJX A;  2XJS A;  3G7D A;  3SH5 A;  3ZYB A;  5K0U C;  5EHD A;  2YFZ A;  3E5Q A;  1SCS A;  4B8E A;  1D2Q A;  1HLC A;  4OHW A;  3RI9 A;  3AKS A;  2GME A;  3I2F A;  1RVF 1;  1AR7 3;  1O3Q A;  4LHK A;  2VCA A;  1BJQ A;  4JZR A;  3ZFF C;  1LOF A;  5LBE A;  2WS9 3;  5CVR A;  4CEW B;  1ZBA 1;  3LE0 A;  1N1S A;  1V6I A;  3RNS A;  3UT0 A;  1S2E A;  1QF3 A;  3JBG 2;  1AYM 2;  2PHF A;  2XBO 3;  3DXU A;  3FUQ A;  3E6D A;  4DEV A;  5A3O A;  3Q8C A;  3VL9 A;  4UFL A;  5CFC A;  3TB0 A;  3W5N A;  3NST A;  2ZX4 A;  4XJU A;  2E9Q A;  2VTF A;  3B9C A;  4BHP A;  4XFA A;  4KU8 A;  3VUO A;  1ULO A;  1JBC A;  3CL1 A;  2VG9 A;  1CAV A;  1PIV 3;  1NCR B;  5EJ1 B;  1COV 1;  2VPV A;  4Q29 A;  4QKN A;  3GHN A;  4PQQ A;  4JGY B;  3WQ0 A;  4P9L A;  1E5S A;  2Y6K A;  3THP A;  3DKW A;  2D6M A;  2J1R A;  4UFJ A;  5JXH A;  2UY8 A;  3WQ7 A;  1SG3 A;  4JDN A;  1S0D A;  1BBT 1;  2VZ1 A;  3WF4 A;  3ZXA C;  2RV9 A;  4CUB A;  1EY2 A;  1W6O A;  5FZM A;  1YQC A;  2ARA A;  4FQZ A;  4XXP A;  3T30 A;  3WVJ A;  3NJX A;  1MAC A;  4QX3 A;  3P5B A;  3SH4 A;  1J84 A;  4XJZ A;  4YVW C;  2VEC A;  1U5Y A;  4Z8B A;  5ABJ C;  1LCL A;  4XQ4 A;  1HW5 A;  1JS9 A;  1IKP A;  1EAH 2;  4HFS A;  4CCO A;  4E4Z A;  1F5J A;  4LO5 B;  3ZSJ A;  5C8C B;  4YVS C;  5AC9 3;  1PVC 3;  4M3C A;  2PHX A;  3SNM A;  4CP0 A;  4XC9 A;  4BK4 A;  1K5M A;  2DCZ A;  1MS1 A;  2BNN A;  4OHV A;  1PGL 2;  4XF4 A;  2HWD 2;  5C3Q A;  2D6O X;  4BPZ A;  5A6Z A;  2CTV A;  2PMW B;  4HSJ A;  3VBO A;  1DF0 A;  3PTY A;  5A7S A;  1SCR A;  2D6P A;  1VMF A;  2A7A A;  3MIG A;  4XOG A;  3C7E A;  4DUX A;  1KDK A;  2QQV A;  1PO1 3;  2RVA A;  2DVD A;  1AX1 A;  1IG3 A;  1HN1 A;  5A7Q A;  4IEQ A;  5D8A C;  3KD4 A;  4DXT A;  4LOT A;  2QQN A;  2DUO A;  2GC0 A;  3IT8 A;  3D0S A;  3PIJ A;  3H42 B;  3S5Q A;  3KQR A;  1PHM A;  4CPB A;  4G9S B;  1SDD B;  2D93 A;  1RUI 2;  4UW3 A;  5FAX A;  3B02 A;  5FY8 A;  3UGF A;  1W2N A;  2X5I C;  4NRO A;  4AVT A;  5IK8 A;  2QJV A;  1UPS A;  1GZ9 A;  4E27 A;  5FZD A;  3W5M A;  1UZV A;  1V6K A;  2VZP A;  4OQ9 A;  4I2O A;  2WJS A;  2YYO A;  3MF6 A;  3I2J A;  2C1F A;  5HCH A;  1CON A;  2J42 A;  1RJ7 A;  4YG3 A;  4FQ4 A;  4AFD A;  5KHJ A;  2DWR A;  3AMM A;  4IV1 A;  5C70 A;  3V0A A;  1H1M A;  1PIV 1;  1PO2 3;  2VZO A;  3N7K A;  3NVC A;  1VP6 A;  4KH9 A;  4Y1X A;  1CES A;  2J22 A;  5L9B A;  4AFC A;  3MUY 1;  1H2K A;  1RUC 2;  1ST8 A;  3IM0 A;  5A80 A;  2YU1 A;  1W05 A;  3LD8 A;  4FP2 A;  4DS0 A;  3VDD A;  4TXW A;  1TEI A;  1X50 A;  4COV A;  1QHD A;  2G1M A;  2HWB 1;  3UGG A;  1JYV A;  4IV3 C;  2X29 A;  2KD7 A;  1MQT C;  3C7G A;  4QX2 A;  1ZRD A;  1KIT A;  1RUD 1;  2RS3 2;  3I8T A;  4IEX A;  4XAC A;  4Y22 A;  3ACH A;  2PHL A;  3I2I A;  4HVR A;  2WNV A;  2E7Q A;  4Q4W 1;  3WNP A;  3ZFE A;  4AI3 A;  4DPN A;  5J1X A;  4CCK A;  4IGP A;  1DP0 A;  3ZOI A;  1C4R A;  1MZE A;  1O7F A;  4BLI A;  3Q8E A;  3POG A;  5FYM A;  5I0D A;  2J1E A;  3IN9 A;  4MXW B;  3J7M A;  1FOD 3;  4A2U A;  4EN6 B;  3I2H A;  5F6L B;  3ACG A;  4HON A;  1W6M B;  5T3N A;  5IT6 A;  3AYD A;  5K4L A;  3WF2 A;  1STM A;  1D4V B;  1HQL A;  5DUU A;  2MEV 1;  4CP2 A;  2AUY A;  2W08 A;  1IHM A;  3NMB A;  4IEP A;  1OLM E;  3GJA A;  4ARY A;  2BU9 A;  5HXM A;  1OHF A;  1CD3 G;  5LA2 A;  5BYN A;  4RSU A;  3ORJ A;  4QMA A;  5FPV A;  1O91 A;  4XJ8 A;  1GZC A;  1VMJ A;  1KDM A;  3KQ4 B;  3WP3 A;  1GAN A;  4ZPI A;  4ZXE A;  1UIK A;  1CQ9 A;  2BBA A;  3R4D B;  1CIY A;  3AM2 A;  2ZEY A;  4P9Y A;  1CAX B;  2WSV A;  4ATE A;  1DGR N;  2WNU A;  3A22 A;  3MZH A;  2YU2 A;  3C7H A;  1OD5 A;  3AMQ A;  4D69 A;  5BNN B;  1W8H A;  1TG7 A;  2PQS A;  1H0B A;  4Q0U A;  3RSJ A;  3ZX7 A;  5DUW A;  1W2O A;  3MUZ 1;  4FPF A;  2ATF A;  1RVF 2;  5A7N A;  4Q0S A;  3VBH B;  2H0V A;  4TN7 A;  4A6S A;  5FJH A;  1DQ4 A;  1ZBA 2;  2Q4S A;  2OKX A;  2W47 A;  1W0P A;  4YYO A;  5L7O A;  5I0T A;  3V64 A;  2NYY A;  2Y38 A;  2GC3 A;  1UAI A;  5FP3 A;  3RVH A;  5JMO A;  4XQW A;  4LBQ A;  2YY1 A;  5IVB A;  2B42 B;  4X8N A;  1HB1 A;  3MPB A;  3MI8 A;  3RJ2 X;  1JUH A;  2OQ7 A;  3KWV A;  2ZGN A;  1W6Q B;  4S2F A;  1U0A A;  1PK6 A;  1PX4 A;  1COV 2;  5FZO B;  5HCF A;  4BK5 A;  3ZSL A;  1TVG A;  1VBA 1;  2OW4 A;  4QU2 A;  5BPX A;  3GBG A;  5A3N A;  4CEY B;  4E2G A;  1BHG A;  2GZW A;  3WG1 A;  4BQ5 A;  5J36 A;  1YJL A;  3CU7 A;  1BBT 2;  1EPW A;  3LOB A;  5EXO A;  4X6Q B;  4Y24 A;  2IFR A;  4IND A;  4AED A;  5T5L A;  3WDX A;  2V5Y A;  2JG9 A;  4UW6 A;  3D8C A;  5IUQ A;  5FK7 A;  1UY0 A;  2WIN B;  5LEK A;  4WM8 B;  1TQ5 A;  1APN A;  2H6B A;  4MHU A;  4OUL A;  1AJK A;  1RUE 3;  3B94 A;  3QD6 A;  4COU A;  2C26 A;  3GYD A;  5L9R A;  4OCT A;  4A3Z A;  1NE4 A;  3QH6 A;  4AVA A;  4O9G A;  2FZ1 A;  4XFC A;  3URF A;  1UD1 A;  1KGY A;  4DIN B;  4P5Y A;  3POS A;  1H4G A;  2BOJ A;  2HKX A;  2R1B A;  2XJT A;  4JGZ C;  4NRQ A;  3T4H B;  3WEZ A;  1MS3 A;  1ZRI A;  2AR6 A;  4WM7 C;  1TNF A;  4BYY A;  3JD7 1;  3RWK X;  3P3P A;  4DEQ A;  2J1A A;  3VZM A;  1S0B A;  1UMZ A;  5FLH A;  2PAM A;  3AZX A;  4BIF A;  4HKL A;  3SLI A;  4FPH A;  1OOP A;  3ON7 A;  1H1I A;  5LW9 A;  2WO3 A;  1WLC A;  4DO0 A;  5C5T A;  5CFC B;  2W9X A;  1AR8 1;  2RMU 3;  2WS9 2;  3AL6 A;  4Q4X 1;  3B3Q E;  4PT6 A;  4OHZ A;  4LBM A;  1ZX5 A;  1P8J A;  1NLR A;  2A6X A;  5KXB A;  5C3O A;  2ZTN A;  3KVB A;  4JKL A;  4NAM A;  3M3I A;  5FYH A;  3RGB A;  1O8P A;  1CAV B;  4D0Q A;  4LOS A;  5FZA A;  1BCX A;  2PAK A;  3FE5 A;  3J7H A;  2YC4 A;  2E51 A;  2A70 A;  2JEN A;  2YG0 A;  2JIG A;  4GB3 3;  1BEV 3;  4CCN A;  2WZR 3;  2DTY A;  3CKH A;  2P1B A;  5FP7 A;  2GH8 A;  2Y64 A;  3LSD A;  4QQL A;  4GKY A;  4HL0 A;  1PIV 2;  2QQI A;  2ZGK A;  4YSF A;  1W6O B;  2Y60 A;  1O5U A;  3PVN A;  4LXL A;  5FBJ A;  3BI3 A;  4MAD A;  4OZX A;  3WR0 A;  3W9A A;  1UU4 A;  4FOW A;  4RHV 1;  5T5J A;  2EIE A;  3LCP A;  2ZZJ A;  1UNB A;  4EN7 B;  5LZ6 A;  3QOP A;  2HWB 2;  3PUI A;  4N53 C;  2YDE A;  1VMH A;  4COW A;  2OUH A;  1POV 3;  1JYX A;  3R4U A;  4E9K A;  3DCQ A;  5FQ0 A;  1URX A;  3A0K A;  2R06 3;  5CFD A;  3S6P A;  2ENR A;  4M3C B;  2DVG A;  2XVG A;  3NV4 A;  5EIY B;  1K5M B;  2QE3 A;  1NYW A;  2VCM A;  3WIN E;  1JUI A;  2VR4 A;  4TZD A;  2RHP A;  3VBU C;  3E5U A;  2W92 A;  3ETP A;  4GH4 C;  2O8O A;  4QXC A;  2JB4 A;  1FV3 A;  4MOA A;  3VBO B;  4A6O A;  2BNO A;  4CDQ C;  4BXF A;  3KCX A;  1ZM1 A;  4DY3 A;  4GIQ A;  2DV9 A;  4V2W A;  2MEV 2;  4ISR A;  3RPQ A;  4O7X A;  1HJG A;  4ZON A;  3VD9 A;  1PM4 A;  2B45 X;  3KV9 A;  1X33 A;  1UIJ A;  1DZQ A;  4LR4 A;  5FZ6 A;  3A23 A;  5KHG A;  1JZ7 A;  3PMS A;  2ZEW A;  5DZE A;  1GYK A;  4HLT A;  3MGU A;  1DU3 D;  1TE1 B;  4UFI A;  5LRS A;  4FTE A;  5J48 A;  1W6P A;  4N7I A;  4LLO A;  4YRD A;  5I93 A;  4AGR A;  2DU0 A;  3P1I A;  1OKO A;  3VDB A;  2CYF A;  5JSP A;  4ASL A;  2W39 A;  3CMG A;  4DXR A;  4IV1 B;  3ROU A;  2J1U A;  3CQO A;  5JI7 A;  3V0A B;  4HVO A;  4DUV A;  3AFK A;  4F8A A;  4WVV A;  5A32 A;  4P9I A;  2XXZ A;  4BWO A;  5IVE A;  3TN9 3;  1IS6 A;  1WZX A;  4GD4 A;  1MVQ A;  2ZPX A;  4GB3 1;  4JTO A;  4N43 C;  4Q27 A;  4UWD A;  4WVW A;  3VDD B;  3KV5 A;  3I3D A;  1GNY A;  2Q0A A;  4H55 A;  1JU3 A;  4QXB A;  1FPN 1;  2EAA A;  4Y22 B;  1DGW A;  1QOO A;  1R64 A;  2ZGM A;  3M3C A;  3AP7 A;  3ZFE B;  1HIX A;  1ND2 C;  1YUD A;  2WNV B;  4RS5 B;  1CPN A;  3EXU A;  5APA A;  3U37 A;  2VH9 A;  2WBK A;  4EJR A;  4FPJ A;  4COZ A;  2Y6J A;  4YGB A;  3ZR5 A;  2W1S A;  1PMI A;  2XKP A;  2D40 A;  5BNP C;  2FD8 A;  1XB9 A;  1QXJ A;  1VBA 2;  1YFY A;  3HBZ A;  3IPV B;  5DG1 A;  3K4D A;  4AE2 A;  5A3M A;  1K5J A;  2RR1 3;  3H7J A;  5ERL A;  1QJE A;  4W6W A;  2W0X A;  2A3X A;  4LUL A;  2ZA9 A;  4CDU B;  5JWP A;  1LOB A;  1OA3 A;  2NN8 A;  1GQP A;  5IJR A;  2D43 A;  4HN1 A;  3T3Y A;  1DG6 A;  5LCW L;  2WLQ A;  5DZF A;  5SV8 A;  1WW4 A;  4QX5 A;  4QX7 A;  3PJY A;  4XUO A;  3ACI A;  4UFK A;  3TYJ A;  2QQP A;  4QB6 A;  2RS5 1;  2WNU B;  2JJ6 A;  2R30 A;  3A0N A;  1W8U A;  1ACC A;  2JDN A;  1GMM A;  1V6M A;  4J25 A;  1DQ2 A;  4BQY A;  4QXH A;  2BJS A;  5EJZ B;  3W59 A;  1ZBE 3;  2GC2 A;  1Y9M A;  4QDQ A;  3TEZ A;  1J83 A;  2WC2 A;  1HV1 A;  1TME 3;  1XYP A;  2K46 A;  3GZA A;  3GDB A;  1YQ8 A;  1IS5 A;  1EUU A;  3JD7 2;  3JQW A;  4GMP 1;  4XUN A;  4YGD A;  3S0M A;  4QAW A;  4Q0V A;  4QHZ A;  1X9P A;  3PU3 A;  3IB3 A;  2Y33 A;  1QJU 1;  5K0U A;  5KHK A;  2UYA A;  5L7O B;  3RZM A;  4MSV A;  1BQP A;  3WP6 A;  4I0B A;  1RXG A;  2CV6 A;  4GJY A;  4OVE A;  1FNZ A;  1F35 A;  1XPW A;  1ENX A;  2O8Q A;  2ZGU A;  3DF0 A;  2P4E A;  3LB9 A;  1AR8 2;  4LBQ B;  4NPR A;  4Q4X 2;  2YB7 A;  1HB3 A;  3RRD A;  3U07 A;  5A70 A;  1PX3 A;  3LEM A;  1E5R A;  4NHY A;  1IPS A;  3ZFF A;  4S2D A;  4FPO B;  5IWF A;  1ZZ9 A;  2ETE A;  3T2T A;  5C7G A;  2GDF A;  5EV7 A;  4D6S A;  1OC1 A;  3TRS B;  3DYO A;  2QVS B;  5F5I A;  4MGT A;  1MS9 A;  3PNA A;  1PK6 B;  1UXX X;  5AFB A;  1IGO A;  4CXX A;  3N9O A;  4Y1U A;  2O14 A;  1DIW A;  1XSR A;  4ZZ8 A;  4YZ1 A;  1RUH 1;  3FJS A;  4LHL A;  5DAB A;  5FJK A;  3ZMN A;  2DCT A;  1Q8V A;  3N9L A;  3ZFG C;  3Q9O A;  4HK9 A;  2JIC A;  3L2H A;  3JBG 3;  3AZY A;  4MGI E;  1UU6 A;  4A7Y A;  1AYM 3;  4W6X A;  2YRO A;  2JG9 B;  3NNM A;  4RHV 2;  4LKE A;  4P9J A;  1PGS A;  2PAE A;  3HD8 B;  4KGG A;  3POB A;  1W9Y A;  2HWC 1;  1H6Y A;  2QDR A;  4Y20 A;  4FTS A;  4FBF A;  1OPM A;  3ITQ A;  5LB6 A;  3WNM A;  4PDW C;  1L7Q A;  4KQ7 A;  3LIH A;  2PA7 A;  2E63 A;  4LIU A;  1W0O A;  3WNO A;  4L8Q A;  2HBU A;  5F3I A;  1U12 A;  4XIO A;  2WT0 A;  4Q8L A;  2TNF A;  3U75 A;  3OD4 A;  4QQP A;  4YVW A;  4Q8K A;  4Q1R A;  5FKB A;  4A42 A;  5I0S A;  2IXH A;  2GSY A;  5GZC A;  1OQ1 A;  3IDB B;  3U4S A;  2DBN A;  3HNM A;  5F39 A;  3WOG A;  1WCK A;  2P6C A;  2VOX A;  3ASI A;  3N7L A;  4U36 A;  4XEZ A;  5FXV A;  4YVS A;  4AXO A;  4UYB A;  5CKM A;  5JXG A;  1S0C A;  1MZ5 A;  4EWD A;  1LGC A;  2NMO A;  3LA3 A;  4C1X A;  3D3A A;  1EAH 3;  1RMU 1;  1J59 A;  1DYK A;  3HVD A;  5EPA A;  5IVF A;  2HYK A;  2YXS A;  1QJX 1;  4KGQ A;  1QJZ A;  4RR3 C;  3HOB A;  4AEM A;  4CRQ A;  1MZF A;  4Y33 A;  1LHN A;  2HWD 3;  1WW5 A;  2WAB A;  3C7O A;  3E5X A;  1UO9 A;  5D8A A;  3H0O A;  3JB4 C;  3WF1 A;  5JR7 B;  2ZGT A;  3USS A;  4O65 A;  5C8C A;  2CWM A;  2UUR A;  2DCK A;  3WXP A;  2GN3 A;  2QTW B;  4XUP A;  1AHS A;  2XH6 A;  1UMI A;  2X5I A;  3ETQ A;  3I49 A;  1J1L A;  4XET A;  3VV1 A;  1KXG A;  5T54 A;  2VBD A;  4XAB A;  2WFF 1;  3U4X A;  1YIP A;  1JN2 P;  3H9A A;  4GB3 2;  4PQ9 A;  1QKQ A;  1NY7 2;  1RUI 3;  3AXD A;  5FPL A;  2C4X A;  1XU2 A;  5A7W A;  4OUS A;  3VBS C;  3O1U A;  1S0E A;  2GAL A;  1REF A;  1KFU L;  4H2A A;  2NP0 A;  2D5F A;  5FZF A;  4DRR A;  1NCQ C;  1FPN 2;  4FPL A;  5FQ0 B;  1AL2 1;  5G04 L;  1US2 A;  3DXT A;  5C4W C;  1UYP A;  3OF1 A;  2ARX A;  4OMD A;  3U0Z A;  3KF5 A;  4WZC A;  2Q1M A;  5J3U A;  4XIL A;  1E57 A;  1TMF 3;  1YI9 A;  4IES A;  5IVC A;  4ZY9 A;  1W8Z A;  4IV3 A;  1MQT A;  4NJ4 A;  1GUI A;  1PZ7 A;  4JRL A;  1KD7 A;  5FZC A;  4ERO A;  4EV0 A;  1RUC 3;  3JQX A;  4YWA A;  1FNY A;  1DYO A;  1MPX A;  5DMY A;  5L9V A;  1W03 A;  5LBF A;  2BW8 A;  4PI2 A;  1C3H A;  2Y0O A;  4DQA A;  3K77 A;  4PF1 A;  1GKB A;  1LB2 A;  3KHC A;  5KXD A;  1B35 C;  3SEE A;  4URA A;  5FMO L;  4RFR B;  3LFI A;  5FZE A;  2RS3 3;  3AMP A;  3INA A;  4LHS A;  4JRA A;  1SQ4 A;  3LA2 A;  1CWP A;  3CJI C;  4Q26 A;  3ES4 A;  3U14 A;  4BQ3 A;  3DYP A;  2WZP P;  5BNO C;  5A3U A;  1WA6 X;  1H8V A;  2NQY A;  1AX0 A;  4BQ4 A;  3GXU A;  2RS5 2;  1ZRC A;  1W6P B;  1NXD 1;  3VHN A;  3ZVX A;  3VD3 A;  2YBS A;  2BER A;  2WAA A;  3LEK A;  4KU7 A;  1XC6 A;  2VME A;  1O8S A;  4Q1P A;  4OZO A;  1A8D A;  4LTA A;  2GP3 A;  5GZE A;  5A32 B;  3KT7 A;  2IXK A;  3OB8 A;  3RZJ A;  1I3H A;  1OFS A;  4I01 A;  1OSG A;  3WNL A;  1VBB 1;  5DAW A;  4H3W A;  3TWI A;  2VY0 A;  4CVU A;  1QJU 2;  2SLI A;  3BU0 A;  1N3Q A;  4M0N A;  2YGM A;  2VQT A;  1LES A;  3MID A;  3ZDV A;  1WGP A;  4CE8 A;  3NRU A;  3I2O A;  1UCX A;  2UWA A;  3SCH A;  3J9S A;  4AYU A;  3N7M A;  2O0O A;  2VMH A;  3EHK A;  1CN1 A;  4GJZ A;  3H50 A;  5JPM B;  2XJP A;  4QT6 A;  2YUE A;  3VN4 A;  2VUJ A;  4IE0 A;  4HXC A;  1WMF A;  5GZG A;  3UKT A;  4FFI A;  1RVF 3;  4AHX A;  4NID A;  3BCW A;  5C5U A;  3ZYP A;  1RUH 2;  3O1O A;  1HB4 A;  1TMF 1;  5AVA A;  4KL1 A;  1ZBA 3;  5BNN A;  1RUN A;  1H2M A;  2Z5W A;  5T5P A;  5IK5 A;  3I7D A;  4YM3 A;  1CAU B;  1LR5 A;  2BTV C;  3FUO A;  4YNI A;  4LBO A;  5A33 A;  3U10 A;  1OUS A;  2W46 A;  1XNA A;  2D6L X;  2ORZ A;  4NPM A;  2AYH A;  2YMZ A;  4OI0 A;  3AX4 A;  4M00 A;  2TEP A;  2WR9 A;  1LRH A;  1QIQ A;  1G9F A;  1NAE A;  2ERF A;  2EVX A;  2HWC 2;  4YGE A;  4B4R A;  5C3R A;  4LNV A;  5CU1 A;  4C90 A;  4CXW A;  3T0D A;  2VL4 A;  1SPP A;  1COV 3;  1G7Y A;  5F1R A;  1JYN A;  3PUQ A;  3WCS A;  1RIR A;  2JG8 C;  5F5A A;  4AFB A;  3JXS A;  5JZG C;  1G9A A;  1KS5 A;  3BTZ A;  2WII B;  4NRM A;  1BBT 3;  4XFI A;  3FZ3 A;  4BQW A;  2FDI A;  2E33 A;  3KM5 A;  2XLA A;  4DZG A;  3TNQ A;  2XGX A;  1LUL A;  2NPI A;  2BFU S;  2XR4 A;  3VZN A;  5JVV A;  1HKD A;  2B46 X;  5K0U B;  3AFG A;  2AAC A;  3HJR A;  4JDO A;  4B7E A;  1XNB A;  1F5F A;  1YYN A;  2PYT A;  5E1R A;  1RMU 2;  1YHF A;  5IAV A;  1I9R A;  4BCU A;  3KLS A;  1AXY A;  2DBI A;  1QJX 2;  3J8F 1;  1OA4 A;  4OUE A;  3ZFF B;  1X8E A;  1PNG A;  4Y1V A;  4QGL A;  1SFY A;  3SIS A;  4ASM B;  1BK0 A;  2W91 A;  2Q5T A;  1G9C A;  1GBG A;  4TWT A;  3KV4 A;  4GKX A;  3HBK A;  1AJO A;  2D6K A;  5LRR A;  4ET7 A;  4YZ5 A;  2PHD A;  1UZ0 A;  5FYU A;  3VHP A;  2YC0 A;  5ACA 1;  1AX2 A;  1IZ3 A;  4NHK A;  2GN7 A;  3WW3 A;  4IXL A;  4RD7 A;  5F3G A;  1A34 A;  2WFF 2;  3T1M A;  1DQ5 A;  3K75 B;  3N7J A;  4YAR A;  3OBR A;  3OGV A;  4KG0 A;  4PF5 A;  4Y1Y A;  4Y1Z A;  4RYD A;  1S2K A;  3ZIX A;  2VNR A;  1XE0 A;  5JOZ A;  4XCA A;  4FSJ A;  3GHM A;  3LPF A;  4Y20 B;  2BQP A;  2HLE A;  2HJI A;  1ENR A;  2P17 A;  4QGM A;  1ENQ A;  1AL2 2;  1PZ8 A;  3AL5 A;  2JD4 A;  3FX3 A;  4LK7 A;  1M06 G;  3T2Q A;  3M3E A;  2A6V A;  3OBA A;  3I4I A;  1UF2 C;  4Y5T A;  1OA2 A;  3BOP A;  4YVW B;  2GU9 A;  5ABJ B;  4N53 A;  1OF3 A;  2DVB A;  1JZ8 A;  1UOJ A;  5I0R A;  2VCC A;  2B9V A;  1CX4 A;  1LKN A;  1R08 1;  3HQX A;  2R0H A;  4IEZ A;  4YVS B;  3KT1 A;  2LUW A;  5KC6 A;  1UW8 A;  3I59 A;  4MVT A;  4JDM A;  1OI6 A;  5L36 A;  2HWB 3;  2VUL A;  2GC1 A;  3LSE A;  3N9P A;  3MV1 1;  3WG4 A;  2WT2 A;  3RYP A;  2MPF A;  3Q8F A;  3VBU A;  3ZSM A;  1RUD 3;  1R1A 1;  2ZAH A;  4GH4 A;  1E5H A;  4FXG B;  1M4W A;  4Q4W 3;  2BDR A;  4CDQ A;  1QGL A;  3UL2 A;  1Q8Q A;  5FMC A;  3B9I A;  1EP0 A;  2VOV A;  5D8A B;  3AYA A;  4FFG A;  4L99 A;  5GZF A;  3SMH A;  4QPG C;  2DYC A;  1HXS 1;  3RDI A;  3M70 A;  4XDO A;  5J96 B;  2GND A;  2DUP A;  2VNG A;  3VKN A;  2ZGL A;  4MGS A;  3MDP A;  2X5I B;  3K51 A;  1T6B X;  2JEM A;  5BUV A;  1XSQ A;  2MEV 3;  2PTM A;  5I8S A;  4P14 A;  1G6N A;  3FLP A;  3VB9 A;  4AAP A;  2FBE A;  1Y3T A;  3BB6 A;  5FY9 A;  1VBB 2;  3EBR A;  4LMF A;  5F9T A;  3K2O A;  5FXZ A;  4CU7 A;  5A7W B;  1NOV A;  2WA4 A;  4BJ0 A;  2WWJ A;  4LA2 A;  3I3B A;  1FX5 A;  4N7U A;  4U2A A;  2R1D A;  4R4Z A;  1OXC A;  5T50 A;  3VKO A;  3HAG A;  1J3Q A;  2UY9 A;  2OT7 A;  2EXJ A;  3POE A;  1ZRR A;  5DUV A;  5J09 A;  3EO6 A;  3H8X A;  3I54 A;  4N43 A;  2DDU A;  2VVD A;  5FP9 A;  2NLR A;  5C3P A;  4IV3 B;  3VZK A;  3D6E A;  4NOT A;  4LE3 A;  3N35 A;  4WVM A;  1MQT B;  3S7I A;  5KWR A;  3ZXE A;  3S7E A;  3BTA A;  4QX0 A;  3CHX A;  3IBM A;  1TMF 2;  3OEA A;  1ND2 A;  3IWZ A;  4B29 A;  4BDV B;  1F4A A;  2XHN A;  1IOA A;  1US3 A;  3ABZ A;  3POJ A;  3NKG A;  1PGW 1;  3LIG A;  5FZB A;  3V0B A;  2FDJ A;  1UWW A;  1S0G A;  1EUT A;  3H3L A;  2CHH A;  5BNQ A;  2RJ2 A;  5BNP A;  2QDN A;  1VRB A;  2XJV A;  3KVA A;  4EE2 A;  1GIC A;  3AKR A;  2VNO A;  3MFA A;  1WW7 A;  4UFM A;  4XHX A;  1RL3 A;  2GNB A;  2LAL A;  3Q8B A;  1MS5 A;  4XIK A;  3RJR A;  2WYF A;  1W9W A;  1S1A A;  1VBA 3;  2ZS6 B;  4RS5 A;  1TNR A;  2VNV A;  4K21 A;  1IQD C;  1U5Z A;  4ORF A;  1GOF A;  4M3C F;  2XDV A;  1G8W A;  1YLL A;  2QQJ A;  1PVX A;  5IYY A;  3ACF A;  2DF7 A;  1QMJ A;  4BOW A;  3IPV A;  1AL0 G;  5HBA A;  1GQH A;  1YO8 A;  2RDN A;  4PBP A;  5FUN A;  1W2A X;  4ASK A;  3V56 A;  4KWK A;  1H6X A;  2K2S A;  2WNE A;  1AR6 1;  2D97 A;  4CDU A;  2BUK A;  4XUQ A;  3SXW A;  2ZGP A;  2TUN A;  2Z69 A;  3J8F 2;  4FVV A;  2QQW A;  1BMV 1;  1ZZ8 A;  4PCR A;  3AC0 A;  3ILR A;  1HQW A;  1DFQ A;  4Q4V 1;  2VVF A;  4AQ2 A;  1H30 A;  1Z78 A;  3PU8 A;  2Y6L A;  3BU7 A;  4HVQ A;  2YC2 A;  1ULE A;  1J1T A;  2DUR A;  3NAP A;  3JD7 3;  4COY A;  1GOH A;  1NUK A;  4NN0 A;  2GAU A;  4N9H A;  4Q4Y 1;  3W21 A;  2ZHL A;  4JHT A;  3GZU C;  5ACA 2;  4QPI C;  3RWN A;  1C57 A;  5IAX A;  1CJP A;  2KR2 A;  4AQ6 A;  2P34 A;  5FZK A;  5A33 B;  1LED A;  1C5I A;  3KCC A;  3NWK A;  4Y4Y A;  1AR8 3;  1AYN 1;  4Q4X 3;  3ZN5 A;  4CDX C;  5IK7 A;  1Y7B A;  3WDW A;  1W28 A;  2A1X A;  4HSL A;  2D98 A;  5B2G B;  5CKN A;  4XFH A;  1QQP 1;  3HN3 A;  3PIG A;  3ZFG A;  5KC5 A;  1GOG A;  4NUB A;  1SPP B;  1W3X A;  4TTG A;  4JKM A;  5JAX A;  1ZYB A;  5JR2 A;  4R8H A;  1O6U A;  2W1W A;  3BUC A;  5EYY A;  5IAT A;  5HPO A;  4EZH A;  1ULP A;  2ZHN A;  3UKV A;  3GZT B;  2XVL A;  1R08 2;  4TSV A;  5FYS A;  4RHV 3;  2XJU A;  1DQ6 A;  1FYU A;  1ZZC A;  3HQR A;  4FPC A;  2B5H A;  2JXA A;  5L73 A;  3BIE A;  4AGV A;  2R07 1;  2XWJ B;  2AZ5 A;  2H6C A;  2ZGO A;  3CNA A;  4JGZ B;  5FLJ A;  2XJQ A;  2XKO A;  4KG8 A;  4A7K A;  1R1A 2;  4ITC A;  4WM7 B;  5IK4 A;  1NKG A;  1W9F A;  2ZAB A;  5CIS A;  3ZXG A;  1U5X A;  1BZW A;  1H2L A;  3NL1 A;  1JHN A;  4JX0 A;  4BQ1 A;  2VW1 A;  3DEC A;  2DCY A;  5SV5 A;  2VC9 A;  2CAV A;  4FAH A;  4L9B A;  1SDW A;  4IEW A;  4MH0 E;  5KHH A;  3VDC A;  4NWW A;  3QAC A;  4IL7 A;  5LK5 A;  1IS4 A;  1HXS 2;  4YM1 A;  2XUM A;  1RTV A;  1QOS A;  5EQU A;  4QM8 A;  2XB6 C;  3JUU A;  3RZH A;  2CSG A;  1MS8 A;  1ND3 C;  4GWN A;  1ONA A;  4LKD A;  1XNK A;  2ZKN A;  4KWJ A;  5FZI A;  4NVP A;  3VKF C;  1HV0 A;  2VOW A;  1RB8 G;  2Q1F A;  3ALQ A;  1F2N A;  1YWK A;  1W39 A;  1GWL A;  1NXM A;  2Y34 A;  1DZR A;  3OD0 A;  4D3W A;  4DMI A;  3K4A A;  3NNL A;  4AI1 A;  4QKF A;  2EF6 A;  1JYI A;  1UPI A;  1GNH A;  2BGC A;  2QUO A;  1YIF A;  5F37 A;  1YEW A;  4OUM A;  1UMH A;  5DDJ 1;  2QZ2 A;  5IVY A;  4AW7 A;  2AH2 A;  2OZ6 A;  2BVB A;  5C9A A;  1W2T A;  3AP4 A;  5JXJ A;  1D4M 1;  3D5O A;  3MLL A;  1QDC A;  4ZHN A;  4N53 B;  3VBS A;  2P37 A;  4IEV A;  4IGO A;  1NCQ A;  1VRH 1;  3ZXK A;  2YBK A;  1QOT A;  4NRP A;  3HT1 A;  4MO3 M;  2B7Y A;  4CDW C;  5FWE A;  3I59 B;  1NA1 C;  2JKX A;  3AYC A;  1GSL A;  1S0F A;  2PLV 1;  1PGW 2;  3LDB A;  3SHR A;  4HZF A;  1LOE A;  4QX1 A;  1FPN 3;  3VBU B;  1WLW A;  4G4F A;  1L7R A;  4K7J A;  1WCU A;  4GH4 B;  5FOJ B;  4LIV A;  3ZYR A;  4CDQ B;  3IAP A;  1LGN A;  2F4L A;  3PVE A;  3EMR A;  4N90 A;  2CDO A;  4QHO A;  4YFW A;  4UBG A;  4L97 A;  2ADD A;  1RUD 2;  2DU1 A;  3APB A;  5FZ0 A;  3HN1 A;  2VUD A;  4NO4 A;  4Q0P A;  1B35 A;  4Q4W 2;  1YJK A;  3KMH A;  4LHN A;  1CVN A;  4CUA A;  2EID A;  3CJI A;  2FMY A;  1ULD A;  3KF3 A;  1V9U 1;  5DN2 A;  4GAZ A;  5BNO A;  4UXA A;  4AI2 A;  2AGS A;  3GBF A;  2E7T A;  2XML A;  3III A;  1RYY A;  3RFR A;  3W20 A;  4FI9 A;  1QNW A;  2AEY A;  5GZD A;  3HPN A;  3LEG A;  5HCB A;  1QH6 A;  4ES9 A;  1WWY A;  1W8N A;  1AR6 2;  1VPH A;  1KFX L;  1F9K A;  3VDA A;  4XDP A;  2RS5 3;  5FZH A;  2X8K A;  5EWS A;  3NW4 A;  1BMV 2;  1RXF A;  4AVB A;  4N43 B;  2UU8 A;  4Q4V 2;  1GNZ A;  5H9S A;  4YW5 A;  3WCR A;  4WVM B;  3K4Z A;  4PLN A;  2VM9 A;  3VD4 A;  1JYT A;  2FDK A;  1GWK A;  4GMP 3;  1QWR A;  4XUT A;  5HV4 A;  4Q4Y 2;  1ND2 B;  1D7P M;  3FFQ A;  5DAX A;  1Q3E A;  2BBV A;  1QJU 3;  4I09 A;  3V0B B;  4K6B A;  4FPY A;  4KMQ A;  3WX5 A;  4EZ4 A;  1BKZ A;  5BNP B;  5F5Q A;  3C3V A;  1H2N A;  3D0J A;  1AYN 2;  1HRV 1;  3O12 A;  5JPN B;  5JI9 A;  1SBE A;  1OKQ A;  2HBT A;  1RUJ 1;  3FC0 A;  3T09 A;  4R4X A;  2YGL A;  1JZ2 A;  1WMD A;  1VB4 A;  2RG4 A;  3SH3 A;  1QQP 2;  1T2X A;  2J7M A;  3OJB A;  1HQN A;  4S2G A;  5K8S A;  3MPP G;  3LGR A;  1RGS A;  1RUH 3;  4E4H A;  1UY4 A;  5D2A A;  2G4I A;  2K0G A;  2WKK A;  3ZYI B;  2VCB A;  5BY5 A;  3FLR A;  1S4C A;  2YHJ A;  2YPJ A;  4I3P A;  5KHI A;  3OGR A;  4DB5 A;  1SLL A;  1JOJ A;  3POY A;  1S55 A;  4B4P A;  1ZA7 A;  2R07 2;  3LKJ A;  1O3S A;  2JG8 A;  5GAL A;  4N9I A;  1YI7 A;  2HWC 3;  1CAU A;  1WBF A;  4K9S A;  3H8O A;  1K3I A;  1MZ6 A;  2WRA A;  3H7Y A;  1IQA A;  2VU9 A;  4FFH A;  3LEI A;  1ENS A;  1ZA4 A;  3WG2 A;  3O0W A;  4AR2 A;  5DPN A;  4DIQ A;  1OF4 A;  2A73 B;  3RYR A;  1RUF 3;  2VBB A;  3P6B A;  4HET A;  4AG4 A;  4J6G A;  5JMC A;  2ILM A;  2IUW A;  3NAP B;  4AGG A;  5A1F A;  4Q5O A;  4Z2A A;  4AAX A;  3NO8 A;  4K8R B;  3ZR6 A;  1MEC 1;  4YG6 A;  3ZDS A;  2ZHK A;  3DN7 A;  3OUJ A;  1DLL A;  2D5H A;  2QQM A;  4I02 A;  2UWC A;  3FFZ A;  4RQP C;  3B69 A;  2VQA A;  1RMU 3;  1O4Y A;  4ZXK A;  2DVF A;  5EJ3 A;  3ST7 A;  1QJX 3;  5GLV A;  2EIB A;  4LKS A;  3UES A;  3ZYG A;  5JCT A;  1JHJ A;  1QEX A;  3P3N A;  5F3E A;  5F6K A;  4I30 A;  3AMH A;  3ZFG B;  5CKQ A;  3CF6 E;  4QQO A;  5DDJ 2;  2X05 A;  2FDF A;  5H9Q A;  3WNN A;  2VO5 A;  2DUQ A;  4GWI A;  4AL9 A;  1FXZ A;  1W90 A;  3ZIW A;  4GQ7 A;  3S57 A;  1D4M 2;  1VBD 1;  1KQR A;  1RIT A;  3N4M A;  3HNB M;  3ELN A;  1EV1 1;  3UJQ A;  1E5I A;  3LOI A;  1VRH 2;  2XOM A;  1LHV A;  2WFF 3;  2Z79 A;  4B1M A;  2F17 A;  2WO1 A;  4PDW B;  5FYB A;  1I5P A;  4CUG A;  2PLV 2;  1IPJ A;  5A1L A;  2UYB A;  1YQ6 A;  3H1M A;  3NNJ A;  3K48 A;  3O5S A;  2O1Q A;  5JOY A;  3MFC A;  1AL2 3;  2VW0 A;  3WW2 A;  1CAW A;  2QQO A;  2VMI A;  1F4H A;  3SEP A;  1GLH A;  3UYJ A;  3BN6 A;  3H3Z A;  4D94 A;  1NT0 A;  2P3K A;  4HAN A;  4HT1 T;  5FP4 A;  5J98 B;  3N9N A;  2QNK A;  3WQB A;  4A44 A;  5HI0 A;  1CIW A;  1LOD A;  4LO7 A;  4UOJ A;  3WP4 A;  3PHM A;  3J4U H;  4XBL A;  3AXE A;  5CB7 A;  2WWU A;  4RR3 B;  4FAG A;  3RI8 A;  1RUF 1;  5A6Y A;  4P9G A;  5AVP A;  1H8T C;  2A6Y A;  5ABJ A;  3AKT A;  4Z1V A;  3LFM A;  2F4P A;  1UY1 A;  1FMD 1;  1NQJ A;  2VW2 A;  1UOF A;  3IZO A;  4A7Z A;  3POW A;  3ZN6 B;  4QPG A;  3ZSE A;  3ZXF A;  5D21 A;  4BME A;  4QDS A;  2ZX1 A;  5M0T A;  4XW3 A;  4YW1 A;  4CXY A;  2BGO A;  2OII A;  1WUV A;  2P2K A;  3SCG A;  3PVB B;  2WLP A;  4R9C A;  5C9A B;  3WP5 A;  4QQH A;  2XON A;  5FLI A;  2XL7 A;  4KWU A;  4K3U A;  4DY5 A;  4QX8 A;  1WA4 A;  4K8F A;  4E4S A;  2AEN A;  3VBS B;  4AED C;  2W52 A;  1QJF A;  1BVP 1;  5C71 A;  4S2H A;  1NCQ B;  3BKZ A;  4MGY E;  1N3O A;  3QH7 A;  2IXI A;  1LEN A;  2ZGQ A;  2JEC A;  2IXL A;  4IE6 A;  5GLU A;  2IVI B;  1ODM A;  4YW7 A;  1VBB 3;  1XXN A;  1DZT A;  4AHZ A;  1GZW A;  4IEY A;  5FBZ A;  4CPB D;  4NWV A;  2PHT A;  3CIH A;  5L19 A;  2Z2S B;  1SLA A;  1XRU A;  2G9G A;  3CEW A;  4KBB A;  4UF0 A;  3ZO0 B;  2LM3 A;  3OOX A;  2J1S A;  3J7L A;  5JDB A;  2Q8O A;  3G6J B;  2BGP A;  1Y9Q A;  1HRV 2;  4B3N A;  1VAK A;  5LY2 A;  1WD3 A;  1RUJ 2;  1CR7 A;  1ASJ 1;  1C1F A;  1JXN A;  2HYX A;  2QQK A;  4L11 A;  3MIC A;  2I74 A;  4CCJ A;  3AK0 A;  5FY5 A;  1QJY 1;  1B35 B;  2IVJ A;  3VBF C;  2ES3 A;  5A3P A;  1LOC A;  4MG2 A;  1A6C A;  4LIT A;  1OOP C;  3CJI B;  2QFE A;  2K9Z A;  5IFP A;  3N3H A;  5BNO B;  5CYY A;  2C9A A;  5B4N A;  1QY4 A;  5CZK A;  3AP6 A;  4CEY A;  4LBL A;  1ODN A;  4LT5 A;  4XF0 A;  2W87 A;  2VXR A;  2KA3 A;  5LAS A;  3T0A A;  2V5D A;  1AXK A;  5IVV A;  3HWJ A;  3VGI A;  1O59 A;  1OH4 A;  4XMI A;  3M3Q A;  4AHY A;  2BWC A;  1O4Z A;  1UL9 A;  4XCB A;  1VJ2 A;  5B4X A;  2VOT A;  4CTE A;  2BFU L;  5CG9 A;  3N9Q A;  3GNE A;  4NIG A;  1SFN A;  2OPW A;  1FV2 A;  1LGB A;  2A3Y A;  1LJ7 A;  1SBF A;  4AOC A;  2R49 A;  4K40 A;  2X10 A;  5IVJ A;  1OBN A;  2WNO A;  4HPK A;  2VUC A;  3DEM A;  3THD A;  3USU A;  4PLM A;  2Z4F A;  2D7F A;  1DDL A;  1YFW A;  4MGK E;  2W1U A;  4CCC A;  2GMP A;  3LPG A;  4LO8 A;  4YW4 A;  3CJX A;  5FMB A;  5DAP A;  1MEC 2;  2BYV E;  4B4Q A;  4XYX A;  3MIB A;  1ZRF A;  3UJO A;  2VTX A;  4ZU5 A;  3BOW A;  4CCE A;  5CFD C;  4XFG A;  5LBC A;  1DQ1 A;  2OXB A;  4A4A A;  4LBN A;  3MIH A;  3ZKY A;  1XJA A;  3TEX A;  1C28 A;  3E1F 1;  3J8F 3;  2D3P A;  4Y3O A;  2D3R A;  4AFM A;  4ARX A;  1PM7 A;  3M8L A;  4XTP A;  1VBC 1;  5JOW A;  3D4K A;  4MGZ E;  4SBV A;  1WMX A;  5FPB A;  1Q8O A;  3WUD A;  4QPI A;  4GZ9 A;  4L2N A;  2AEZ A;  4XMA A;  5EFU A;  4EWE A;  3T4V A;  4ZS2 A;  2KM2 A;  1C8M 1;  2R32 A;  4BQ2 A;  1VBD 2;  2JDM A;  1FT9 A;  2R04 1;  1XQN A;  4CDX A;  5ACA 3;  3OEB A;  3LAG A;  1EV1 2;  2PHW A;  4ZU7 A;  2H0B A;  4ZZ5 A;  2GH2 A;  2VZT A;  1NG0 A;  1GV9 A;  4XJA A;  1JW6 A;  2XQR A;  4PJY A;  2OPK A;  5FRA A;  3I3E A;  5FMD A;  4XBQ A;  2V72 A;  3WW4 A;  4LBQ D;  2ZEZ A;  2JG8 B;  4GWJ A;  2BV4 A;  3DPR C;  2E32 A;  3O0X A;  3WV6 A;  3LWC A;  2JE8 A;  3ZPY A;  1UX7 A;  4IQP A;  4C0B A;  5C6C A;  3L9J T;  4XZU G;  1CZT A;  3IIA A;  1T6G C;  2OUJ A;  4JC1 A;  1DYP A;  3DKQ A;  5K9Y A;  4A45 A;  2I2S A;  2ZAA A;  4IE5 A;  2ET1 A;  2G9Z A;  4PIY A;  5T5O A;  3M1H A;  2X53 S;  4FOV A;  3TEY A;  4N8M A;  1KJR A;  5FO8 B;  4J1X A;  1ZZB A;  4KNC A;  3KV6 A;  1R08 3;  1PZ9 A;  2HEW F;  2VQU A;  3WG3 A;  1RUF 2;  1Z7S 1;  2CL2 A;  4Q2F A;  1ZVF A;  5LWB A;  1GU3 A;  4RL7 A;  1FMD 2;  4OYU A;  3WHT A;  4AHW A;  4BZ4 A;  2YV8 A;  2Q30 A;  5FYC A;  2FQP A;  1JMU B;  1R1A 3;  1RJ8 A;  1CPM A;  4KI5 M;  2CY6 A;  1HN0 A;  2JDY A;  2W68 A;  3QBQ A;  4XFB A;  2EIG A;  3OG2 A;  3PUS A;  3PUR A;  4MX3 A;  2VZQ A;  3GAL A;  3CDZ B;  1HDK A;  2WN2 A;  4W4Z A;  1W9S A;  4JGZ A;  2VE1 A;  2Q8C A;  4P00 B;  4MET A;  1ND3 A;  1ULG A;  3MW3 A;  4DFS A;  3EQE A;  4P9W A;  5FFO C;  4WM7 A;  4F7Z A;  2BEO A;  2NMN A;  1HXS 3;  3BGA A;  3RZK A;  2RS1 3;  4IER A;  4DRV A;  4CZS A;  2BVV A;  4LEJ A;  4WV8 A;  2B39 A;  4TLF A;  3HT2 A;  5DXD A;  1W6N A;  4LUM A;  4QHB A;  1RUG 1;  1FAT A;  4QPY A;  5FDB A;  4P08 A;  4XE9 A;  5FUI A;  3O1M A;  5LAT A;  4OI4 A;  3WUC A;  3HR9 A;  3OYW A;  2OVU A;  4LBJ A;  4XBN A;  3ENR A;  1CAW B;  1OVS A;  1RHI 3;  3WSO A;  1AVB A;  1ASJ 2;  1DQ0 A;  4CDW A;  1Z0H A;  1NA1 A;  3AKQ A;  1QJY 2;  2EXH A;  5E6H A;  4YGC A;  3CO2 A;  5H9P A;  3RZL A;  1X9T A;  3OBZ A;  4XJW A;  3NJY A;  1UY2 A;  2ADE A;  3VBR C;  3ZXD A;  4ATF A;  2WL1 A;  1W8T A;  4BQX A;  2A5Z A;  4W6Y A;  3WDY A;  3KT4 A;  3FHA A;  2ZHM A;  2A3W A;  5CA6 A;  5DAV A;  4R9D A;  2VZR A;  2CDP A;  1V00 A;  3M3O A;  4QPG B;  1QU0 A;  2XJR A;  3QLQ A;  5A3L A;  3JU9 A;  2CGO A;  3FBY A;  4F83 A;  5CAZ A;  5CAD A;  5I91 A;  1CZV A;  4TLG A;  3TBD A;  2WZ8 A;  1DLC A;  1VAM A;  4OFG A;  3Q8A A;  1WW6 A;  5GM0 A;  1SFP A;  5FZ9 A;  1OVP A;  4YW3 A;  1POV 0;  4GUL A;  3THC A;  4AEJ A;  4D6Q A;  2ARC A;  3B93 A;  3O1V A;  2D6N A;  4IE4 A;  5IHR A;  4LE4 A;  3VZL A;  2ZOE B;  1RC6 A;  1AZD A;  3AZV A;  4CEW C;  3T08 A;  5KXC A;  2RS1 1;  1VAV A;  3SIT A;  2QCS B;  4CCL A;  1GZW B;  1VR3 A;  5FTT C;  1SLC A;  4Y5S A;  5GLZ A;  1DGR A;  4AQT A;  5G05 L;  5ISL A;  2ZJC A;  5FY4 A;  1VBE 1;  4UF0 B;  1V70 A;  2QQU A;  2VZ3 A;  1AR6 3;  5A3T A;  2C0Z A;  1KRI A;  1ZZ6 A;  2C5D A;  1AR9 3;  2LRP A;  1R09 1;  3KGZ A;  4LBK A;  1V6N A;  4DUW A;  2DTW A;  2FHR A;  2WQ4 A;  1BLZ A;  5A7P A;  5ANQ A;  4D8M A;  4MGQ A;  3T1L A;  4KWL A;  3ZM8 A;  1VBC 2;  2BWA A;  2LW8 A;  3KSC A;  1NCR C;  4UW5 A;  4Q4V 3;  1O4T A;  1WD4 A;  2DFC A;  2VGD A;  4ZS3 A;  3ZYF A;  4YZ3 A;  2XWB B;  2P6H A;  4JGY C;  5JXI A;  5KR7 A;  1RHI 1;  2EIC A;  3FLT A;  1PMH X;  2E26 A;  2GP5 A;  3LQC A;  4ONU A;  1C8M 2;  1MR5 A;  4Q0Q A;  5J37 A;  2BZD A;  4I3G A;  4Q4Y 3;  1NQD A;  2R04 2;  5FWJ A;  2WT1 A;  3E6C C;  4CP1 A;  2DFB A;  4NMI A;  4AVC A;  4GMP 0;  3LDR A;  3FHQ A;  3R05 A;  2R16 A;  1V6J A;  4QDR A;  3WDT A;  4M4R A;  3AYE A;  5FY7 A;  1AYN 3;  2F6B A;  2E7A A;  2EAL A;  1JYW A;  5FK8 A;  2YZ4 A;  5FRE A;  5F3C A;  1AR7 1;  5C8C C;  3O1P A;  1QQP 3;  2Y6F A;  3GM8 A;  3I3Q A;  3K3O A;  4HK8 A;  2AC1 A;  2ET7 A;  2WS9 1;  3NNF A;  3OGG A;  4LO4 B;  3TNP B;  3VHO A;  1OH3 A;  1XNC A;  3DV8 A;  2UWB A;  1JZ6 A;  4ISQ A;  3PTR B;  3M4F A;  5KBF A;  2XBO 1;  4HPK B;  2HEY F;  2FDG A;  4NIH A;  3USU B;  3ECQ A;  2GNT A;  4Z92 B;  3THT A;  5JUV A;  1JZ3 A;  3BTX A;  4L92 A;  5BXX A;  1Q8P A;  1Z7S 2;  3RZG A;  4HKO A;  2X09 A;  4DNY A;  2R07 3;  2QQL A;  4DXZ A;  4ES8 A;  4LK6 A;  3C8X A;  3WZ1 A;  4UFH A;  4XF1 A;  2VVE A;  2R0F A;  2FDH A;  4MV2 A;  4WZF A;  5GLT A;  3WHU A;  4JVA A;  1HRI 3;  3OPT A;  4AK3 A;  5DZG A;  4QPI B;  2LS6 A;  2VQ0 A;  2Y0I A;  1AR9 1;  1WBL A;  1YFU A;  1N3P A;  1OUX A;  2TBV A;  3ATG A;  2W95 A;  4GWM A;  2Q8D A;  4BU2 A;  2OA2 A;  1X36 A;  1I5Z A;  4RQP A;  1UYX A;  2VOK A;  1UYY A;  4GAL A;  3MYX A;  1W99 A;  4B1L A;  4H7L A;  3LA7 A;  5FPA A;  4CDX B;  2PHU A;  4QQ2 A;  4CCD A;  4OMC A;  3SCF A;  2EXK A;  2VMG A;  4QM9 A;  3U78 A;  2CWS A;  2CU5 A;  5AC9 1;  3BAL A;  1H9P A;  1PVC 1;  3GBW A;  1XYN A;  2XL9 A;  3H8U A;  1RUG 2;  1POQ A;  1LHU A;  3ZYH A;  4CU6 A;  2ZCW A;  5DDJ 3;  1W9T A;  1IPK A;  3F2Z A;  1PO1 1;  3WLU A;  1MS0 A;  2PN5 A;  4MLO A;  4TYS A;  1D4M 3;  4C91 A;  3X29 B;  1K45 A;  3ILF A;  1NZC A;  3DUI A;  5H9R A;  2A6W A;  3RS6 A;  1GWM A;  2BOI A;  5E16 A;  1ULC A;  1VRH 3;  2XUE A;  3AVS A;  3EB7 A;  1C1L A;  3WQ1 A;  2HWF 3;  5FPZ A;  3E97 A;  2ID4 A;  3H1Y A;  1S0I A;  4M01 A;  2VMD A;  4XAE A;  4YW2 A;  4QWN A;  4AF9 A;  2PLV 3;  1UKG A;  3TEW A;  4JQT A;  4L0P A;  2RJL A;  1NX9 A;  5FUP A;  2OX0 A;  4LO6 B;  4E8D A;  3AMN A;  3NQH A;  2VMC A;  4XDQ A;  4PHZ A;  4NII A;  1YRZ A;  4PDW A;  2FCV A;  1R1Z A;  1N47 A;  2V73 A;  1PO2 1;  5ANN A;  5T55 A;  1YFX A;  3MW2 A;  1QXP A;  2DCJ A;  1UZZ A;  3IAQ A;  3GCW A;  1ND3 B;  3AB0 A;  1H8T A;  2WDB A;  1CX1 A;  2HWE 3;  4HN0 A;  3C7F A;  3VZJ A;  5BNN C;  2E31 A;  1O3T A;  1A3K A;  1HRI 1;  4K1Z A;  4PI0 A;  3VBH C;  2WN3 A;  4EN9 B; 
#chains in the Genus database with same CATH homology
 5LBB A;  2V4A A;  4NHY A;  3GJB A;  2RDR A;  3HQU A;  2RDN A;  5A3U A;  4Q5O A;  4XCA A;  3NNF A;  3OUJ A;  3GZE A;  4Y5T A;  4ZON A;  5EP9 A;  4XC9 A;  3EMR A;  3KT7 A;  5LAS A;  3NNM A;  3MGU A;  5DAW A;  3KT1 A;  3W21 A;  3PL0 A;  4XCB A;  5LAT A;  5LA9 A;  4NHL A;  4NHX A;  5HV0 A;  3ITQ A;  5LB6 A;  5IAX A;  2OPW A;  2RDQ A;  2HBU A;  3W20 A;  2A1X A;  4UWD A;  3OBZ A;  5DAP A;  4MHU A;  4BQX A;  3NNJ A;  5DAQ A;  3KT4 A;  5LBC A;  3BVC A;  5L9R A;  5DAV A;  5IAT A;  5EPA A;  2RDS A;  5L9B A;  3HQR A;  5HV4 A;  2FCU A;  5DAX A;  4XAA A;  2G19 A;  2G1M A;  3OUI A;  5ERL A;  4NHM A;  4XAC A;  5C5T A;  2HBT A;  4XAB A;  4BQW A;  2RG4 A;  4NAO A;  5M0T A;  4Y5S A;  2JIJ A;  4JZR A;  5LBE A;  5EQU A;  4MHR A;  3DKQ A;  4J25 A;  2JIG A;  5IAV A;  4BQY A;  4IW3 A;  2FCV A;  4KBZ A;  2Y34 A;  3GJA A;  3NNL A;  5L9V A;  4ZPI A;  2Y33 A;  5LBF A;  3OUH A;  2FCT A;  4NMI A;  5C5U A;  4NHK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...