2WDBA

A family 32 carbohydrate-binding module, from the mu toxin produced by clostridium perfringens, in complex with beta-d-glcnac-beta(1,2) mannose
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
139
structure length
139
Chain Sequence
NPSLIRSESWQVYEGNEANLLDGDDNTGVWYKTLNGDTSLAGEFIGLDLGKEIKLDGIRFVIGKNGGGSSDKWNKFKLEYSLDNESWTTIKEYDKTGAPAGKDVIEESFETPISAKYIRLTNMENINKWLTFSEFAIVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HYALURONOGLUCOSAMINIDASE
publication title N-Acetylglucosamine Recognition by a Family 32 Carbohydrate-Binding Module from Clostridium Perfringens Nagh.
pubmed doi rcsb
source organism Clostridium perfringens
molecule tags Hydrolase
total genus 38
structure length 139
sequence length 139
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.35: Hyaluronoglucosaminidase.
pdb deposition date 2009-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2wdbA00
3A23A 1JZ3A 3WF4A 3I2IA 2WBKA 3WNLA 2Z4FA 2VZRA 4E8CA 4KI5M 2XONA 4BXSV 2EIBA 2Y6KA 1UZ0A 3CMGA 2VMCA 4QB2A 2E31A 2J1TA 2WN2A 2WAAA 1CZVA 1UMIA 4QPWA 2Y8KA 2KD7A 3SEPA 2WAOA 2VZPA 3ACFA 1PX4A 2DCJA 3T09A 5IFTA 2VZOA 1KGYA 1MPXA 2W87A 1UWWA 4DUWA 2BERA 4XVHA 1CZSA 4GWIA 2CDOA 5B4XA 1K12A 3FHAA 2YC4A 1JZ5A 1JZ8A 4JKKA 3WF0A 1US2A 2VOTA 4DUVA 3K77A 2BGPA 4QB6A 1JU3A 5HXMA 3VDAA 3HJRA 2JD9A 1T2XA 1OH4A 4CUCA 3UESA 1W8NA 3OGVA 3LEGA 1US3A 3LEKA 1KEXA 5IHRA 2VZSA 4KWUA 2J1EA 2QQJA 3NRUA 5FUIA 4RYDA 3VD7A 2W9XA 3IDAA 3PUHA 1OD3A 4LQRA 5EJZB 3MBWA 4AG4A 4JKMA 4ZZ5A 3WNNA 5B4NA 2VZ1A 3HNMA 3ZM8A 2W92A 3GDBA 4P02B 1OF3A 3SKVA 2W1UA 2BBAA 5DPNA 4CUBA 1PMHX 3VDBA 3K75B 1UX7A 2W47A 2WQ8A 5IYYA 4QAWA 3K4AA 2J1UA 2W94A 4M4RA 2Y6GA 2W91A 3I97A 1NUKA 1J84A 3I2FA 3MV01 2VTFA 5LA0A 3T2PA 2L9LA 3WF1A 2YG0A 1TG7A 3T0DA 1JZ7A 4ZXEA 1PMJX 1ULOA 2W95A 1JI6A 3I2GA 4QDRA 1W99A 2VO5A 3WSOA 1OT5A 5EIYB 2VCBA 2W5FA 1TVGA 1I5PA 1O59A 1K42A 1P8JA 3NNGA 3MUY1 1F4AA 4PT6A 2C26A 4CU7A 2VZUA 2WO2A 2OKXA 1UY2A 1JU4A 3C7FA 2R7EB 3THDA 1JYVA 4QDSA 3DECA 4UOJA 4CU9A 3DYMA 1JZ4A 5HPOA 2VZ3A 1UY4A 3F2ZA 3SEEA 2QQOA 5LCWL 3HOBA 1NKGA 3IIIA 4DXTA 2ZEZA 2YC2A 2ZXQA 3GXUA 4IUGA 2JKXA 4BK4A 4MOAA 2Y6JA 4UI9L 2ORZA 1UYXA 3T08A 4L0PA 4PF1A 4W8JA 1W0NA 2CDPA 4OMCA 3SKJE 4GZ9A 1GUIA 1L7QA 3I2KA 3I3BA 2ZEYA 3GGLA 2QQNA 1R64A 1PX3A 4HG6B 2J7MA 2W3JA 2VZQA 1OF4A 1EUUA 2VMDA 4MGQA 3IB3A 3UNPA 4RN5A 1UXXX 3LEIA 4DEVA 1GNYA 2VQTA 2VM9A 5LA2A 3ACHA 2X10A 2VJXA 5J1XA 2RJ2A 1L7RA 2E26A 2VQUA 5I0DA 3VD3A 3MO4A 4GWJA 1NAEA 3HN3A 4A42A 4MADA 1DYOA 4XUOA 4A41A 4A44A 2RV9A 2QQKA 1DLCA 3T0BA 4ET7A 4DXSA 1CIYA 5DN2A 1F4HA 1XNTA 4LKSA 3W5MA 2W46A 2ZEXA 3CZUA 1W9WA 2WDBA 2Y6LA 1DP0A 3IAQA 1JZ6A 2HLEA 2J1SA 4CU8A 3P6BA 4QB1A 2HYXA 4TTGA 1W8OA 4MGSA 2BZDA 2WO1A 4CVUA 1W9SA 1JHJA 2C9KA 2J1AA 1K3IA 3OEBA 3I3DA 1GOFA 1XNAA 4ZZ8A 1IQDC 2WN3A 2YB7A 1HN1A 3OB8A 4QX2A 3HPNA 2ORXA 3DYOA 3NJVA 3C7OA 4XUNA 4P00B 4QX0A 2BGOA 3MV11 2VMFA 2WO3A 4YPJA 4PQQA 3BN6A 5CZKA 3E1F1 1BHGA 1GQPA 2V4VA 4A4AA 5F7UA 2B4KA 1LNSA 3OEAA 4QDQA 2LW8A 3WF2A 3T2QA 1GOGA 2J22A 3C8XA 4OUEA 4A3ZA 3D3AA 3P1IA 4BDVB 3A7QA 1JYWA 1JYXA 3J7HA 2JE8A 5EJ1B 2VMEA 1UYZA 2E32A 1SDDB 4D0QA 4ARXA 3PUIA 2B9VA 3ETPA 1W9TA 4BJ0A 5JXHA 2V5DA 2QBXA 3C7EA 3K4DA 1XPWA 2QQIA 3GM8A 1WKYA 2ID4A 3WNKA 2WZEA 4P08A 1GMMA 2W1SA 2ZEWA 1H6XA 1UXZA 2Y64A 3A21A 3EYPA 3W5NA 3OGSA 2VCCA 2XHNA 3DYPA 4TXWA 4E8DA 3WNPA 2J1RA 2X09A 3LQCA 3FHQA 2C4XA 3NJXA 4AAXA 1O8PA 2W1QA 1J83A 3EB7A 3LE0A 5IJRA 2WABA 4JKLA 5DQ0A 1EUTA 4LHSA 3JXSA 1UY0A 2V72A 5G05L 4LPLA 2EIEA 5JXGA 4Z2AA 1CX1A 3ECQA 3LPGA 2XOMA 3A22A 4P5YA 1JZ2A 3T2OA 5LA1A 1SHWB 4ZY9A 4OMDA 3WNMA 3UETA 4DXRA 4MO3M 3K4ZA 2EICA 4M4PA 1O8SA 1ULPA 1UY1A 3HEIA 1JYNA 4DUXA 4A45A 3C7HA 3WNOA 3C7GA 3ACGA 5JXJA 5C7GA 3CDZB 5JUVA 3HNBM 4XUPA 1YQ2A 4CUAA 4JHZA 4XUTA 4BK5A 2VCAA 2Y6HA 2E33A 2PQSA 1UYYA 4CU6A 1UMHA 3U37A 4OZOA 2RVAA 3VDCA 2YFZA 2DCKA 5JR2A 2VC9A 4ARYA 3VD5A 3ABZA 2LS6A 2WZ8A 3OBAA 3BGAA 4XZUG 2VZTA 4A6OA 2J1VA 4OYUA 4QX1A 5JXIA 5IFPA 5JMOA 3MUZ1 3HNYM 5A1AA 1GU3A 3CKHA 2VL4A 3AC0A 3T0AA 2WUHA 3WF3A 4QX3A 1WCQA 3VD4A 3FN9A 4W50A 1D7PM 4DEQA 1SG3A 2YFUA 3K46A 3LPFA 3OG2A 5DMYA 3I3EA 3WQBA 1XC6A 2VZVA 3CIHA 3THCA 3OGRA 3ACIA 3FL7A 5CYYA 3CQOA 2DDUA 1K45A 1NX9A 4W4ZA 4FI9A 1GOHA 5C70A 2VR4A 4KMQA 5G04L 4JX0A 2X05A 4UAPA 3IAPA 4D8MA 4XURA 3VD9A 1H6YA 3I2JA 2QQMA 4XUQA 2XQXA 3I2HA 3WEZA 3NQHA 2WYSA 1RYYA 5C71A 1UY3A 3CZJA 2JDAA 2EIDA 1CZTA 2QQLA 2W1WA
chains in the Genus database with same CATH superfamily
2P1BA 4AOCA 4UFJA 2FD8A 2DVGA 3VZLA 2XONA 2VOKA 2BDRA 2EIBA 1ENQA 4XBQA 3M7AA 4QB2A 3E6DA 3UKVA 3FZ3A 3H0OA 5FWJA 4Y1XA 4Y1VA 4W65A 5L73A 4YW5A 3WX5A 4AGVA 3NNJA 4Z8BA 4Y3OA 2VNVA 1BMV1 1S55A 2RDQA 1PX4A 2H6CA 4BCUA 5CEHA 1KGYA 5EQUA 1Y3TA 3R4SA 1UWWA 3RYRA 4JDOA 1UZZA 4GWIA 5DUXA 2PHUA 4E4ZA 3PU8A 5CAZA 3FHAA 3WLUA 1ULGA 3BPZA 4RR3C 4QQLA 1SZBA 3WHTA 4LXLA 2Q1MA 4Q4X2 1OA2A 3VBFC 4CZSA 1L7LA 4FP2A 3SNMA 5LW9A 1US2A 1QJFA 1ND3A 1UF2C 3K77A 1PVXA 4DUVA 4QHZA 4Y5TA 2BGPA 3OUJA 4QKBA 5DAXA 2PFWA 4BE3A 4UW6A 3J26N 1Q8VA 1STMA 4HK8A 3VDAA 4IV3A 1ZRCA 1UKGA 5DUWA 3IDCB 4DNYA 3FWEA 1OLQA 2IFRA 2JD9A 5FYYA 1T2XA 4MVTA 4D69A 3RNSA 1OH4A 4TLGA 3T4VA 3UESA 1ACCA 2PAEA 3B02A 3OGVA 1IGOA 5A6XA 4YARA 3PUSA 4NIDA 2IXIA 2RM22 1VMHA 2OVUA 1OSGA 3QH6A 4KWUA 1JOBA 1EAH3 3NRUA 4MUVA 5HCBA 1HJFA 4O9EA 3MYXA 1AR83 3IDAA 5K0UC 1AZDA 1DLLA 3ZYBA 4ZS2A 3TEXA 3ZLIA 1ULCA 5EJZB 5GLTA 4JKMA 2P34A 4NPLA 4AQ2A 4XFCA 1VBD2 3AKSA 4Q4V3 4IEQA 3HNMA 3USSA 5FJHA 1ZA7A 5FO7B 4INDA 4DMIA 1Y7BA 1LULA 3ZYGA 2IVIB 4ATFA 1S2KA 2Z69A 3IN9A 1HXS1 4Z1VA 1XBFA 3AZXA 2BOJA 3K75B 1UX7A 2W47A 5L7OC 3WQ0A 2WQ8A 1CONA 3H1WA 2WYFA 4QAWA 5E89A 5GZEA 3J7LA 1ZBE2 1HRI1 3RYPA 3OYWA 4LMFA 4Z07A 1J84A 2ZHKA 2ZGLA 5LA0A 1WLWA 4NHLA 4TN7A 4IQPA 2YG0A 1TG7A 3WF1A 1ODMA 4DXZA 2LTNA 3JBG3 4EN7B 5A3PA 1COV3 4QGMA 3GZAA 1JI6A 4LE4A 4B3NA 1VAMA 4XDPA 4QDRA 5E88A 5AFEA 1H30A 2VO5A 4BQYA 1U5IA 3ILNA 2DUPA 1VBC2 4NPMA 5T5PA 4JGYB 4AVCA 3VBHB 2ZS6B 2JECA 1GP5A 4CPBA 1I1EA 2ETEA 1MEC3 2WT2A 1GP4A 2Y0OA 3NV4A 5I0UA 4XBNA 1P8JA 2MNGA 3OY8B 4AYUA 2TUNA 3CLPA 1WZXA 3AMHA 5DG2A 1DF0A 4H55A 3WP4A 4PT6A 2NMOA 5T55A 1R093 1XJAA 2EA7A 4CU7A 3ATGA 5BNOC 4WZFA 2BRTA 3V0AB 2HWF2 2GN7A 1UY2A 1JU4A 2HWB2 3Q8EA 4GALA 3ZXLA 1BXHA 3ACLA 3E5UA 1ASJ1 1CJPA 5FAXA 3RI8A 3ROUA 1E5IA 3DECA 3NJYA 2D6LX 1HJGA 4UOJA 5C33A 1VBA1 3LF7A 3GZTB 1J3QA 3JQXA 1TMF1 1JMUB 5C8CA 1KD7A 2NPIA 3AJYA 2D6NA 1GWMA 1UY4A 4YVWC 2VNRA 3F2ZA 1RUG3 2QQOA 1PZ7A 4N53C 4A3XA 2FQPA 3HOBA 2IXHA 5FZLA 4BB3A 2ZEZA 3ZFGA 3ZN5A 4D3WA 5BNOA 1SBFA 4S2GA 3AJZA 2A3YA 3N7KA 4YVSB 3ST7A 4JRAA 3AVRA 4UI9L 2AACA 1YNAA 2R073 3QOPA 4LA3A 4JDMA 3BOPA 5A7SA 1RVF3 5IVYA 3T08A 4XTMA 2RR12 3ITQA 2D93A 4GH4C 2PQQA 4L0PA 5IVBA 2CDPA 3IMMA 2PTMA 1QJZA 2NYYA 4UW4A 5IW0A 2XLGA 3UV9A 4N90A 4BQWA 3SKJE 2BV4A 4CSWA 3RZHA 3VHRA 1SQ4A 3DKWA 1VJ2A 2PAKA 2ZCWA 3Q9OA 5A1FA 3GYDA 4JGZC 1CQ9A 1R64A 4L8QA 1YIPA 1LEMA 3UYJA 3APBA 3VBOC 2XVLA 2VZQA 5LBEA 4CP2A 2XDVA 1OF4A 1EUUA 2VMDA 3PHMA 3ZYIB 1OOPB 1HB1A 1YI9A 5C4WB 4KH9A 1UO9A 5EYXA 5JAXA 2FZ2A 3MW4A 1RITA 1UXXX 1XNKA 3MFAA 5JZGA 1DGWA 2NM1A 4AI0A 4N43A 4N9HA 2VBBA 1RUI1 3BI3A 1L3JA 1GNYA 1RJ7A 1FATA 3HR9A 1N1VA 4CDUA 1DU3D 5F32A 3VBSC 3ACHA 2R043 4L92A 3MIEA 4YGCA 3UL2A 4QWNA 4E27A 2RJ2A 3HIFA 3RG0A 5KXEA 4XBLA 1AYN1 1L7RA 1HQWA 1FPN1 1OH3A 2E26A 3PVBB 4IV1A 5DZEA 5I0DA 3MO4A 4Y1ZA 4LBQA 4GWJA 1W2OA 3WNPA 5IT6A 1OLME 1EPZA 4NHYA 4A41A 3MEPA 4A44A 1QNYA 3T0BA 2PN5A 3NAPC 2A3XA 2RS51 1BKZA 2WWJA 3I8TA 2WC2A 4Y22B 4ET7A 3WINE 3KCYA 1WCKA 3OPTA 1YWKA 2EXHA 4UBGA 1H2KA 2WQ4A 3R4DB 2VBDA 2W46A 3Q8FA 4QXHA 4UFIA 4Y1UA 5KHHA 3T1LA 4DINB 2HWC1 2VUDA 1WCUA 4Z92B 1QY4A 3KZ4C 1DP0A 4OHXA 4HPKB 3RYKA 2JKBA 1YQ6A 2ZGUA 2G9FA 2HYXA 2VPVA 3PVNA 1AYM1 4QB1A 4UF0B 2XGXA 1QJX3 4KGGA 5FK8A 2QQWA 1LODA 5M0TA 2G1MA 5I0TA 3AB0A 3S0MA 1R1ZA 5FP3A 3BTZA 1JHJA 2C9KA 3AYDA 3H1YA 4NVPA 2WFF2 1BBT1 1D2SA 1PVC3 5FZMA 3U14A 3WW2A 1COV1 1K3IA 1ZBA2 2XWJB 5FXXA 2VD7A 2W39A 1OPMA 2ZGKA 4EZ4A 3KVAA 1MZEA 2YB7A 4YM1A 1BLZA 2P3IA 1KQRA 1MQTB 2DVFA 2R0FA 2VXJA 3FMGA 2E53A 3OD4A 4QX2A 5F2SA 3HBKA 1AR71 4B1LA 5LK7B 1RHI1 1VBB3 5KHJA 2ZGQA 3DPRA 4PBOA 3OPZA 1R083 1HRV1 4LIVA 4HKOA 4P00B 4XUNA 2QNKA 2BGOA 1TNFA 2WFPA 1S0GA 5J96B 2XHKA 1ONAA 5JIUA 2VUAA 1RXGA 1HRI2 2PA7A 1PO22 5D8AC 1BHGA 1GQPA 4AEMA 5FZ8A 3NVCA 1AR61 1R091 4AEDB 3WDYA 1J3PA 1RMU1 4PHZA 4PLMA 4XOGA 4XFFA 2QQVA 3FX3A 4GMP1 4P5HA 1NA1B 3P1IA 4Y4RA 1ZZ9A 2XVGA 1HKDA 1NLQA 1W8HA 4IETA 3J7HA 4X6RB 1O4TA 4CEYA 4OI4A 1W8FA 1U5ZA 2Z42A 3FLRA 4AFCA 4CRQA 4XEZA 4LE3A 2WZPP 2VMEA 3MIGA 1ND2B 2E32A 2AEZA 4D0QA 3B69A 3PUIA 2RS11 3ETPA 2WT0A 2A6ZA 4HFSA 4YM2A 2WWUA 1W9TA 1RUC3 5I0SA 3AXDA 5BXXA 2OQ7A 2R16A 1VE0A 2PHLA 2ZMNA 5EZWA 4COZA 2ZHLA 5A7WA 4A2UA 1WUVA 4BA6A 1DGRA 1CAVA 5K4LA 2NP0A 3LA3A 3WD5A 3U1XA 4BPZA 1UYPA 3EMRA 5FJKA 3WP3A 2WNUA 1WA4A 1WD4A 4XFBA 2RMU1 2QQIA 5FPBA 1W8ZA 1LR5A 3GM8A 1WKYA 5BNNC 5J37A 1KFUL 3KHBA 2ID4A 5JLVA 2RDNA 1BVP1 3WNKA 1ASJ2 2WZEA 4P08A 1GMMA 4MYEA 2XJQA 1AJKA 1HB4A 2W1SA 4YW3A 3VKFC 3DKQA 1H6XA 1W8UA 1VBA2 4XFGA 4MXWB 2XMLA 2JXAA 3LCPA 2HEYF 5HV0A 1TMF2 1ENSA 3OGSA 3BIWE 2VCCA 4R8HA 1NCQA 2A70A 3J7MA 3QCWA 3O5SA 4O61A 4XFIA 2BNNA 2QQUA 4Q4X3 3FHQA 5FPZA 2CL2A 1OFSA 1V00A 4K8FA 2C4XA 5F1RA 4K6BA 1O8PA 2W1QA 4YNIA 2W2IA 1NCRC 3WDXA 2BFUS 4G9SB 3B93A 2HWD1 4JKLA 5DQ0A 1EUTA 3J7NA 3T4HB 2V72A 3SQOA 4YW7A 5EPAA 5CU1A 4QQHA 4YW2A 4XJ9A 2JX9A 1CAUB 1C5IA 2XOMA 3O1VA 4FPGA 2A6WA 2WWSA 3A22A 1BJQA 1JZ2A 2B46X 1HDKA 4QU2A 1SHWB 2VE1A 4KBZA 2RM23 3WY6A 3DL3A 3K4ZA 4FTEA 4LO7A 1O8SA 5HCFA 1UY1A 2C0ZA 4QPIA 3KV5A 2XJVA 1W6PA 1SEFA 1XOYA 1C28A 5FBZA 2FDIA 1F2NA 4BIFA 3C7GA 2XPJA 5FPXA 2D5FA 4PDWC 5C7GA 3HNBM 3WOGA 3HMYA 1APNA 2FCVA 2ZX4A 4JHZA 2WZR2 1TME1 1VBD3 1V9U1 3JUUA 3V0BB 4LOSA 1GZCA 2BW8A 3ZMOA 5L9RA 5A7NA 2Q8OA 3WHUA 1RUI2 3T1MA 2BEOA 1WA6X 1UYYA 3IBMA 2WNVC 3S30A 1BEV1 1UAIA 4LORA 4HSLA 4OZOA 2RVAA 5SV5A 1IS5A 5LK5A 2JDNA 2PHRA 5EHDA 3WUDA 3VZOA 1R1A1 1AYN2 1ZBE3 4C0BA 1FPN2 4YZ1A 2ATFA 4IEXA 2YBSA 2VC9A 1DQ2A 1DZRA 3ABZA 3MF9A 4AFDA 4C1XA 1RUD1 5FR3A 1RUE1 3W21A 4EWAA 1ZZ6A 2VUJA 5LRSA 2RS52 4YG0A 1WMEA 1WW4A 3AKRA 4A6OA 1Q3EA 1JTZX 1YI7A 3KCXA 4W6WA 3HNYM 3BTYA 4Q1RA 5H9QA 1GU3A 5KHKA 3SHRA 2Q5TA 5HCAA 2JG9B 1IQAA 2BOIA 2HWC2 4HT1T 4CEWB 2BNOA 2GP5A 2Q1FA 4OI2A 1VBC3 1WCQA 2CV6A 4HN1A 3ZMNA 2HBTA 2JDHA 4W50A 3ZXFA 5HV4A 3AZZA 4DEQA 5E8AA 4D6QA 1AYM2 2HYKA 1YQCA 3AZYA 4JC1A 4JHTA 5FZCA 1NE6A 5DMYA 3WT3A 3ZYHA 1Z7S1 2RJKA 3WQBA 1VB2A 3ACIA 3O1TA 5CYYA 3CQOA 4H7LA 3K48A 4IE0A 5C3OA 5A6ZA 3WCRA 4ASLA 2DDUA 1OUSA 2HWF3 2GH2A 2HWB3 1BCXA 4AQ6A 2FDFA 2ZBJA 1QOOA 1AR72 1QMJA 2ARAA 2JIJA 2X5IA 4C0HA 4HN0A 1RHI2 1C4RA 1CPNA 1HRV2 1OLMA 2OX0A 4KMQA 4JX0A 1V70A 4COUA 4PQ9A 3TEYA 3E6BA 4MHRA 1QJEA 4JGYA 5TSWA 3VBHA 3LFMA 1UIKA 1H2MA 5A3MA 5KWRA 1S0BA 4QKNA 1OQEA 4Y1YA 1AR62 1OVPA 2DUQA 4XUQA 1RMU2 2ADEA 5FZGA 3RWNA 2VNOA 4S2HA 4XAEA 2Q30A 3I2HA 1QJY1 3ETQA 3NQHA 4FSJA 3W9AA 1GICA 1FV2A 2Y34A 4N7UA 4SLIA 5CIRA 5T5LA 3ELNA 5C71A 1UY3A 5A32B 2XWBB 5FYVA 1QHDA 1MS0A 4FPKA 4ZHNA 1O5LA 5EP9A 2R061 2HJIA 1UW8A 3OOXA 5FDBA 2RR13 4BYYA 5HCHA 1HQNA 3I3QA 5T52A 3I2IA 3VDDB 3WF4A 2WBKA 3P3PA 3WNLA 1XYNA 1GNHA 5BNPC 2Y6KA 2RS12 4RL7A 4Y20A 3CMGA 5LBCA 2Y33A 1K5MB 2QJVA 3AX4A 4CCMA 1O3QA 5FYTA 1XXNA 4IEWA 3K2OA 3UGHA 3AXEA 4CDQB 2WN2A 1XE7A 4M3CA 2WAAA 4QPWA 4WVZA 4NHKA 1OVSA 4WM7B 2RMU2 1J58A 2VZPA 2G4IA 4F7ZA 4YVSA 2YZ4A 4RFT0 3T09A 1MPXA 2CWMA 2W87A 2ZAAA 3I2DA 4K20A 4DUWA 4RD7A 3ZSJA 4M0NA 2D3RA 1LCLA 1DGWX 4CDXC 5IVEA 3T30A 5FLHA 1JZ5A 2ENRA 4R9AA 1PGW1 1JZ8A 2GMPA 5FZKA 2D7FA 2EVXA 2GC3A 4JKKA 3WF0A 3VBRB 5JOZA 5AC91 2HH9A 3PDQA 4CXXA 2R49A 4NRPA 1D0HA 1WLDA 2XLAA 2PLV1 1UMZA 3KV4A 3MIDA 4QB6A 4QM9A 5FYUA 1JU3A 2A3WA 2Y60A 4GH4B 4IE6A 5FRAA 2HWD2 4AI8A 5C4WA 3WVJA 1OOPA 1Q43A 1MVQA 1W8TA 4ZU7A 4P9LA 1MACA 3D5OA 5FMOL 3W59A 4JVAA 4YZ5A 4P9GA 4CP0A 1US3A 1JUIA 4OI1A 2PELA 4YGEA 4OVEA 4YZ2A 1G9FA 1KEXA 1KJLA 3FBYA 3RRDA 1UD1A 1XSRA 4CDWB 4KWLA 2J1EA 3QACA 5H9SA 5FUIA 4RYDA 2I07B 1H9WA 1FOD1 2QUOA 5LZ6A 1QNWA 3BOWA 3AFGA 1XNBA 1SFYA 1E5HA 2B8MA 4WVWA 3LGRA 2ET1A 1CESA 4XDQA 4ZZ5A 4ONUA 2JDYA 2P2KA 4AW7A 3KSCA 1URXA 4RGAA 3VBSB 5JCTA 1C3HA 1TME2 1V9U2 1LGBA 4I0WB 4P02B 4P9JA 4Y22A 2ZA9A 4YW1A 3H3ZA 1WWYA 5AVAA 1QEXA 2XJUA 3G7DA 2FZ1A 3NNFA 3VBUB 5JI7A 4GULA 1OUXA 5LY1A 4EJRA 2D6PA 3K4AA 3VL8A 4QPYA 2J1UA 2EF6A 2CHHA 4FTSA 4URAA 4IE7A 4K1YA 4M4RA 2Y6GA 1KRIA 2GN3A 2PHXA 3I97A 1SLCA 1KDMA 4UF0A 1R1A2 4DIQA 3JQWA 3THTA 1HRI3 1OD5A 2VTFA 2L9LA 3DF0A 4B7KA 4NIHA 4PI2A 1LECA 1RUD2 4XW3A 3OPWA 5DAPA 4ZXEA 1RUE2 3QH7A 1ULOA 4UFKA 4DFSA 3I2GA 1PK6B 2YUEA 1CGPA 3ZPOA 3SXWA 4WVVA 1LHOA 1Y43B 4Y4YA 2GNDA 1LRHA 1MQTA 4QKFA 5GZGA 5ANNA 1NT0A 5EIYB 1I9RA 1B35B 2FCUA 4V2VA 2W5FA 3OBZA 4FVVA 1TVGA 5FPLA 5FYSA 1YJKA 3HQRA 1W3XA 3MUY1 5FV3A 3FJSA 4ISRA 5A3TA 1Z7S2 3ILRA 4CYDA 4OULA 4LO4B 4LBLA 3IKWA 2FDGA 3POWA 4KL1A 2UWCA 1SACA 5FPAA 3WP5A 5A70A 4FQ4A 3THDA 4CA9A 4QDSA 5FCCA 1NY71 1ASJ3 1W6MA 2GMMA 1NA1A 4PLNA 3WP6A 1W2TA 4OHZA 5FZFA 4HOOA 1SLBA 1E57A 4AHXA 5HPOA 1VBA3 4OCTA 1VBE1 2IZWA 2R1BA 2VZ3A 3CEWA 3OGGA 2YV8A 1TMF3 3SEEA 1REEA 3HN1A 3B9CA 3RDIA 1DG6A 1ND2A 2D6OX 3CO2A 4DXTA 2YC2A 3M3QA 3RPQA 3GXUA 2ZX0A 1OC1A 2JD4A 4IUGA 2BNMA 1ND3C 1W2UA 2QCSB 4DPNA 4E4DX 1NQJA 1PMIA 3LSDA 3RZLA 4MOAA 4O65A 1QJY2 2ZGMA 4NJ4A 5IK4A 1UIJA 2BVBA 5BYNA 3H8RA 4IV3C 1WBLA 5GJ6A 1H4GA 2D98A 1W0NA 1JBCA 2R062 2VW0A 4XYXA 3WDVA 4I3PA 3EQEA 4OMCA 4AI3A 1A34A 1YEWA 4MXWA 3MHZA 3CF6E 1GV9A 3AM2A 4CCJA 1O4ZA 4GZ9A 1GUIA 3I2KA 4XXPA 3N4MA 3BYWA 4RSUA 4UW5A 1CPMA 5BNNB 3L2YA 1O3SA 1PX3A 4QM8A 3KV9A 4HG6B 3M3CA 4RS5A 4UFHA 3EBRA 4LBKA 2DFCA 1IHMA 4OHYA 1PM7A 5JSOA 1ENXA 2YGLA 5I8YA 1X9PA 1QJU1 4IL7A 3PUQA 5JIAA 3LEIA 3PTYA 3MICA 4NHXA 1HQLA 4CP9A 2JB4A 1WMFA 5D1IA 4A6SA 4QT6A 3ALQA 1G9AA 1RUNA 2B5HA 4NPRA 5LA2A 2DCZA 1RUI3 4MGZE 3NNLA 4NN0A 4YZ4A 5DZFA 4DY5A 2NLRA 1PGW2 3NW4A 3POGA 2DWRA 2P3KA 1K5JA 3WQ7A 5AC92 2VQUA 4XF9A 3TEZA 1J59A 3ZN6B 1AYN3 1HB3A 2PLV2 1FPN3 1NAEA 4LT5A 2WFF1 3HN3A 4OHWA 4A42A 4XUOA 1ZBA1 2JWPA 2Q1ZB 4D7TA 2ZTNA 5ABJB 4DXSA 3RZJA 3LEMA 2Z2SB 3SISA 5DN2A 3VKLA 1F4HA 2RS53 1EV11 4XF1A 4FFIA 4LR4A 3CJIA 2HWE1 2VMIA 5FZ3A 1JS9A 1O91A 2Y6LA 1W6QB 3V0BA 1M06G 4IE5A 4XILA 3P5BA 1N1YA 3WG4A 2HWC3 3NKTA 4CU8A 3CL1A 1RUF1 2W52A 4MGSA 3PLQA 5FOJB 2BZDA 1HB2A 2WO1A 4HKLA 5FP8A 4LIUA 1O3TA 1PO21 1AYM3 3NJZA 1YQ5A 1FOD2 4XJUA 3GHNA 3O0XA 5A7PA 4P9WA 3BVCA 4XETA 3AZWA 4BQ5A 1POV1 1T6GC 1QU0A 1W03A 2DU1A 2ZGPA 4XPVA 1BBT3 1ZRFA 4AVVA 1IQDC 1LOEA 1CWPA 3BUCA 4FPCA 2VW1A 3N7MA 3FUOA 4A7ZA 2YBPA 3HPNA 2VECA 2OYZA 2XL9A 5FREA 1W28A 2ORXA 4IEZA 1AXZA 4FO9A 3TWIA 1AR73 2Q8CA 1IPKA 2VMHA 1XYPA 1Q56A 5C3RA 4RQPB 1RHI3 5FXZA 3M1HA 3MV11 4MXVA 4CEWA 1HRV3 4J1WA 4XIKA 4BQXA 4AVTA 4D7YA 4PQQA 2WINB 3V64A 5C8CC 5CZKA 2C5DA 4PI0A 1UU5A 3OEAA 3IM0A 2WLPA 3LIGA 5A3OA 1AR63 3ZFGC 1MS4A 1TE1B 2LW8A 3WF2A 4BZ4A 3WNXA 3RZZA 1RMU3 2G9ZA 3OGJA 3T2QA 2PHFA 1S4CA 3WW3A 2JDUA 1GOGA 1ZRRA 5HI0A 5J98B 1PGL1 1NXMA 1YCIA 4HANA 3D3AA 1DQ0A 1PGSA 2D3SA 4LITA 3A7QA 4N9IA 4A3ZA 4FAGA 4GMP3 2B7YA 5JOWA 1W06A 3B00A 3I3MA 4AHWA 2JE8A 1W0OA 5D2AA 3ZDVA 4CCLA 3OD0A 3H7JA 3RGBA 3ZXEA 5F9TA 4L9BA 1UYZA 1V6IA 4XC9A 3TNPB 1IG3A 2RJLA 1SDWA 2XJRA 2OZJA 2C9AA 1IS4A 2RS13 1RUOA 4NRMA 2CY6A 2ZZQA 3C7EA 2DV9A 1MZ5A 3K4DA 3LDRA 4R9CA 5IATA 3H3UA 1V6NA 1QDCA 1O6UA 3PVEA 5FYBA 5C5TA 5K8SA 1AF9A 4COWA 2GAUA 1UKRA 2RMU3 2JDMA 1O4YA 3GBGA 1VLNA 1NY72 2UU8A 1HV1A 1LOBA 5SV8A 5JZGC 2D44A 3I59A 3ZXGA 1X8EA 1WW6A 3ZXJA 1KJRA 1SLLA 4N43C 3W5NA 1DQ6A 5LWBA 1PHMA 1VBE2 2XHNA 1Y9QA 3L2HA 3VDDA 3IDBB 1O7FA 4E8DA 3T2TA 1H8TB 1SLIA 4FCAA 4CDUC 4LOTA 3LQCA 5E16A 3TB0A 3E6CC 1FXZA 1K5MA 4AAXA 2R30A 1J83A 1J3RA 2D6MA 3EB7A 4WM8B 4BLIA 3LE0A 1D4VB 2XVKA 4IV1C 2WABA 4LBNA 4Q27A 1KXGA 4CDQA 3E5XA 4LHSA 4J1XA 3RWKX 4KWJA 3J8F1 4XHXA 3U0ZA 2HWD3 2EIEA 3GBWA 4WM7A 5JXGA 4Z2AA 5BNPB 2WZR1 3ECQA 3LPGA 1N3OA 2X53S 1AUYA 2R1DA 1YXWA 4MGKE 4P5YA 2OPKA 3GJAA 1QKQA 1XYOA 1OA3A 4YFWA 3RJ2X 5ANQA 4ZY9A 2XBO1 1ZZBA 1RC6A 2BU9A 4AWDA 1OURA 1ULPA 2PYTA 1SFNA 1W3VA 2A1XA 2E7QA 2YROA 2JEMA 4XAAA 4DUXA 1MR5A 3P3NA 5FZDA 3C7HA 4ATEA 3VBRA 3RZMA 1FI2A 4GB31 1X8MA 1WW7A 3JD71 1UZVA 1X82A 3VZJA 3CDZB 1H8VA 3S7IA 1S1AA 2GSYA 3IZOA 2E51A 1QJU2 2ZX2A 4M0HA 4CUAA 4XUTA 5CFCB 4BK5A 2Y6HA 4YM3A 1WD3A 1C8M1 2E33A 3LDBA 4QPGB 1TME3 5FZHA 1V9U3 5FZ7A 3OCPA 2RHPA 2PQSA 3D82A 1GZWB 4HVOA 1S0IA 4JDNA 1IS6A 1W6OB 2G9GA 4YYOA 5F39A 4UYBA 4BM8A 3AKPA 2BWCA 3DPRC 4Q1PA 4Q5OA 1N47A 1VAKA 4E4SA 4FAHA 1BEV3 3N3HA 4AGGA 2YFZA 2XUMA 1A3KA 4RA0A 3KVBA 1W6NB 5K7PA 3ZFEB 4CDWA 2Y6FA 3ZKUA 5JR2A 2W0XA 2MEV1 4ARYA 3MLKA 1R1A3 4XQWA 3HT2A 1F15A 3IMNA 5IAVA 4LO8A 1S0DA 1W0PA 4GA9A 2ILMA 1N3QA 4TZDA 1RUD3 1UNBA 5JXIA 5A3NA 5IFPA 1RUE3 2YYOA 5FOBB 1OXCA 1DFQA 1EV12 1PM4A 1C8NA 4D94A 1D0GA 2VAUA 2HWE2 2D5HA 3AC0A 3PIJA 5FY1A 3FFQA 3ZFFB 2V4AA 5A6QA 5IVFA 3VBUA 1IS3A 4CEYC 4GJYA 4JCKA 2VUCA 1RUF2 5FTTC 1D7PM 3I7DA 5E1RA 1I5ZA 4F83A 1VMJA 4IEOA 3AYEA 3OG2A 3POIA 2DBNA 3I3EA 3KQ4B 5DAQA 2ZGOA 3ZSEA 3Q8BA 3CIHA 3THCA 3ZSKA 3OGRA 2UURA 5A7QA 1Z7S3 1W2AX 4KG0A 4P9IA 3B5LB 5DDJ2 2QZ3A 2PHDA 4D6SA 5CA6A 2QTWB 2WNUC 4E2GA 3UJQA 1DYPA 3HWJA 3OBRA 2IVJA 2UYAA 5C9AB 5CFDB 1PK6A 1C5HA 4FI9A 3ZOIA 1UQXA 3HT1A 5KR7A 5A33B 4NR1A 1AHSA 4B7EA 3N9QA 4KWKA 4CTEA 1GWKA 2E7AA 4UAPA 2X05A 1JODA 1CN1A 1B35A 2AEYA 5CG8A 4TYSA 4D8MA 4EN8B 1IG0A 1LHWA 2VTXA 3ASIA 3M3IA 5FUPA 3GNEA 3AYCA 1S0JA 1NCQC 2UYBA 1H6YA 4QXBA 3AP5A 4Q4Y1 3I2JA 3A0KA 2JG8B 2E9QA 3AKTA 2DF7A 5LATA 4GQ7A 5FMBA 3VL9A 2AENA 2QE3A 5F2WA 2DCTA 3M3EA 2BVVA 2CSGA 4FPJA 4Q4W1 4AAPA 3ZR5A 4B4QA 1RYYA 2FBEA 5J3UA 2QQPA 5DUUA 1PGL2 1QJY3 2EIDA 2WS91 3ZIWA 5L19A 1EY2A 4HMZA 3Q8CA 1DGRN 4UBHA 1JH5A 5FFOC 1KS5A 2KR2A 1J1LA 2Z79A 1JZ3A 4FXKB 3V65A 1U5YA 2N7GA 5H9PA 4ES9A 2R063 4ZONA 2Z4FA 2VZRA 5FZOB 4E8CA 3NMBA 4BXSV 5CKMA 4JQTA 3NV2A 2VMCA 4AFMA 2D40A 2BQPA 3KCCA 1UOBA 3VZKA 4HONA 4WBBA 1TEIA 2E31A 2J1TA 4K3UA 4AEKA 5CB7A 3CJXA 3T3YA 4QPIC 2BGCA 5FQ0B 1RUJ1 3ZIXA 3PJQA 4AHZA 1YC61 2Y8KA 2KD7A 4LEJA 4BQ3A 3KGLA 3KQRA 4EZHA 4DY3A 4IEYA 2DCJA 5F6KA 5FZIA 2VZOA 3BU7A 5H9RA 3WCSA 4BOWA 3AMPA 2BERA 3WQ1A 3ON7A 4S2FA 1CZSA 4O7XA 2CDOA 2JE7A 1K12A 2ZACA 3H3LA 4OLLA 5B4XA 4A7YA 2P3JA 5LA9A 4H3WA 2QZ2A 4ZU4A 1YJLA 2LUWA 2DVAA 2YC4A 4E9KA 5KC5A 3EHKA 2ZGRA 4I2OA 3RQ0A 3HAGA 4HL0A 3BU0A 1CR7A 1LESA 3LAGA 4Y26A 5FY0A 1C1FA 4BIOA 4IXLA 5FLIA 3INAA 3ZR6A 5AC93 2YPJA 1D2QA 5AFBA 2O8QA 2PLV3 4K8RB 5HXMA 3AP9A 1LENA 1X50A 4UXAA 4B29A 3J8F2 4PF5A 4RR3B 2XJSA 4CUCA 1NG0A 4EN9B 2GDFA 3LEGA 3JB8A 3VBFB 4M3CF 3H8UA 4XFHA 4DO0A 3B9IA 4LLFA 1XSQA 4H2AA 5FY5A 2EXJA 2XBO2 4QMAA 5IHRA 1IOAA 2VZSA 1W39A 4AK3A 4EE2A 1CVNA 4HETA 1QQP1 5LEJA 4XQ4A 1H1AA 1OA4A 4CCKA 2W68A 1MS5A 1S0FA 2YY1A 3PUHA 3ZDSA 2PMWB 4GB32 1FOD3 3JD72 4XF3A 1OD3A 3BODA 4GWMA 3ZN6A 2QDRA 3KGZA 1RUH1 4IGPA 3WNNA 3ZM8A 3ZKYA 5EJ3A 1A78A 3GDBA 1AXYA 5ABJA 3NWKA 4PBPA 5A6YA 1C8M2 1LB2A 1OF3A 2W1UA 2VCMA 5IK8A 4CUBA 1KFXL 1PMHX 4AFBA 4D6RA 2X5IC 1GANA 5K0UB 4QGNA 5IYYA 1ODNA 2AREA 1W6QA 4IEVA 1PO11 3KT7A 3IPVB 2W94A 1VRBA 3TRSB 1FNZA 1ZRDA 3MV01 2B39A 3C3VA 4JGYC 2VXRA 4NO4A 3VBHC 3T2PA 2MEV2 3T0DA 3AP7A 2IFWA 3U4XA 1XU1A 4UW3A 4FFGA 5A3LA 4OI0A 1PMJX 3I2OA 4RHV1 4META 2GMEA 3ZPYA 4XE9A 5L7OB 1AX1A 3FC0A 1W99A 3AL6A 5FZ4A 1V6KA 4G4FA 1UOJA 1OT5A 1YUDA 2BUKA 4QQ2A 3O1SA 4Z2WA 3S5QA 5C3PA 4Q2FA 3RI9A 1X9TA 5CKQA 1QH6A 2VH9A 3OBTA 3AL5A 3Q8AA 2YC0A 5FIXA 1I5PA 1VP6A 4RQPA 2IXCA 1K42A 1XNDA 1I6XA 2JENA 3NNGA 2C6SA 2VG9A 3KT4A 3DXUA 1F4AA 5ERLA 5FZ6A 2C26A 2RE9A 3OY8A 4NRQA 3WUCA 1W8WA 1AL21 2WO2A 4HZFA 4J6GA 2OKXA 5A3UA 4UWDA 4L2NA 3D6EA 4BMEA 1YLLA 2EAKA 2PHTA 3OUIA 4UFMA 1JYVA 3V0AA 2Z5WA 4R4ZA 4YVSC 1LTEA 4CU9A 3DYMA 5I0RA 1ZA4A 3RJRA 1JZ4A 5HXVA 2VNGA 1CAXB 1W04A 3BALA 4K40A 4XTPA 5DUVA 1LEDA 1LJ7A 2I74A 3WR0A 1G86A 3ES4A 3ZXDA 5BNOB 2WNEA 1VBE3 3WW1A 3J9SA 3O1RA 4OZXA 4BWOA 2ZXQA 1U0AA 4Q4Y2 4WVMB 2YU1A 5EV7A 1G6NA 4BK4A 5F5IA 2Y6JA 4Q4W2 1H0BA 3RZGA 1NLSA 4FPOB 1SPPB 3R05A 1UYXA 4ES8A 3M8LA 5ACA1 5C4WC 1OOPC 4FOVA 4YVWB 2WS92 3ZYFA 4N53B 3NKGA 1MS1A 2Y38A 4L97A 2EXKA 3DXTA 4HSJA 2WA3A 3O12A 1WMXA 1L7QA 1NZCA 3I3BA 3GGLA 3D8CA 4TSVA 1AX2A 1H8TA 3N9MA 2W08A 4XCAA 4MGQA 1RUJ2 3IB3A 1FMD1 3ILFA 1VRH1 4WM8A 3VN4A 1W2NA 1YRZA 4N43B 4RN5A 3VKNA 2ZX3A 1FV3A 4FPFA 4M01A 4ZS3A 3UT0A 3B7MA 1DDLA 1QJU3 3KHCA 4I0BA 4CDUB 4DEVA 1DGLA 1C57A 1CJDA 3U10A 1V0AA 4JGZB 2VQTA 3N7JA 2IUWA 3K51A 4ISQA 2V09A 4IEUA 4JTOA 2A6VA 4CP1A 1GBGA 2K46A 4IV1B 4O9GA 2X10A 4QGLA 2VJXA 3D4KA 3O0VA 5J1XA 1OKQA 4GD4A 4FXGB 1GKBA 1CD3G 1PIV1 3VD3A 4BH9A 2YHJA 4AI2A 4L99A 4JQRA 2VGDA 1H4HA 1DYOA 3H1MA 1MZ6A 3SCGA 2RV9A 2QQKA 5FLJA 3U4SA 2WFF3 3O0WA 5T5OA 4FPLA 1CIYA 1ZBA3 2TBVA 5KXCA 1XNTA 4YRDA 2ZEXA 4LA2A 1PZ8A 1LHUA 2F17A 1W9WA 1IKPA 2WDBA 1NXD1 3HBZA 1NYWA 1EV13 3FUQA 3URFA 2R042 3WXPA 4GKXA 3TN91 2HWE3 3PL0A 4QPGA 1MQTC 1X7NA 2J1SA 4C91A 1JZ6A 1XE8A 1PNFA 2LRPA 4HKWA 5F5CA 4HPKA 3TNQA 1RUF3 3MIHA 4QKDA 3NAPB 5FXVA 5GZFA 1QQP2 1REFA 2ZGTA 3TYJA 2X8KA 1W9SA 4CVUA 2WR9A 1ALYA 1OKOA 2J1AA 1PO23 1W6NA 3MPBA 3NL1A 2ZAHA 3E97A 3ZFEA 3OEBA 3PTRB 1GYKA 3S5AA 1NLRA 3IT8A 4ZZ8A 1RJ8A 1RUH2 2WRAA 5J48A 1POV3 1W90A 5DDJ3 2VOXA 4YLZA 1HN1A 3FFZA 3SCHA 1MVEA 2A75A 2SBAA 3RS6A 5BY5A 2ZJCA 3LKJA 3NJVA 3C7OA 4RFRB 5A3WA 4BMBA 3MPPG 2CNAA 1NA1C 3LSEA 3PU3A 5F8PA 4NROA 1YQ8A 3ZFFA 3G6JB 2VMFA 2WO3A 5LY2A 1PO12 4QU1A 1E5SA 4ORFA 2V4VA 4Q0PA 4XJ8A 4AE2A 1VIWB 2B4KA 2D43A 2P3YA 5I91A 4XIOA 1ND2C 2YU2A 2JDPA 4LKDA 1GZTA 2ZZJA 3J4UH 2Q8EA 5JOYA 4AEDA 2G19A 1LGCA 4RHV2 2LROA 3C8XA 1OHFA 4Q8LA 4GAZA 3CBNA 1VBB2 3DEMA 5JR7B 1SCRA 4LBOA 2E7TA 2WSUA 3LOIA 4QX5A 1V6MA 3KS7A 1TQ5A 2XJPA 4FFHA 1JYWA 2FDKA 3KMHA 1D4M1 4LKEA 5CFDA 1BYHA 1QWRA 5D8AB 1LHVA 1LKNA 5EJ1B 2DU0A 4LKFA 4XMAA 5FYZA 4EN0A 1SDDB 4XQDA 2OQ6A 4EV0A 4AZZA 2B9VA 1Y9GA 1DIWA 1W9FA 4AGRA 1YFUA 5FY8A 3EJKA 4B8EA 2AC1A 1T6BX 3VBOB 4HVQA 2RS31 5IK7A 5JXHA 3MIBA 5IUQA 4MH0E 1LOFC 2IWGB 2QBXA 5EFUA 4IESA 1Y4WA 1LOAA 2JICA 5J36A 1H2LA 3VUOA 1XPWA 2WO7A 1AL22 2FDJA 2ZMLA 4RS5C 5GZDA 2JG8A 4AFAA 3S6PA 5CISA 3LZZA 5FKBA 5FWEA 4TWTA 4NOTA 2ZEWA 2HEWF 2FDHA 1NCQB 1A8MA 1UXZA 2Y64A 3HD8B 2WIIB 2A71A 3A21A 3K3NA 2AUYA 3WDWA 1Q8PA 1RUC2 1BK0A 4YM0A 5CG9A 1JHNA 2UWBA 4OUSA 1KITA 2B45X 4TXWA 5APAA 2JDKA 1YFXA 1OMIA 2RDSA 3AMMA 2XG3A 1LOFA 1WLCA 5FZOA 1ZZ8A 2X09A 4XJZA 3HVDA 2IC1A 5FO8B 2A7AA 5T50A 3SITA 2VBPA 3ZVXA 4EWEA 1QOSA 5FY4A 4FFFA 1XQNA 4XFAA 1VR3A 3POSA 4Y5SA 5BPXA 4I30A 5FQ0A 1UY0A 1QF3A 4LPLA 5G05L 4EROA 5F3GA 1F9KA 3CNAA 1CX1A 4FOQA 3J8F3 1S2EA 1ZZCA 4U2AA 3VKMA 5ACA2 2O0OA 1DQ5A 1C1LA 2WZR3 4CCCA 1OQ1A 5LA1A 3CJIC 2I2SA 4MLOA 1CAUA 3ZSLA 3PNAA 4QPIB 4FBFA 1Q8OA 1W6PB 3UETA 2P4EA 1Q8QA 1NCRB 2GNMA 1SLAA 4MO3M 4CCEA 2B9UA 2XBO3 2VULA 4M4PA 4QQPA 4GWNA 3HEIA 5GKAC 1JYNA 3BTXA 3GF6A 4A45A 1ZM1A 4V2WA 3KT1A 1JN2P 1N1SA 1NZIA 3O1MA 4I0AA 3N7LA 2DUOA 3POJA 2D3PA 5LBBA 2XLFA 4K1ZA 4GB33 1TNRA 1FMD2 1FAYA 2IXJA 4OQ9A 3JD73 3SC7X 4BHPA 5A1LA 1VRH2 5JUVA 2OZ6A 4P14A 1AR91 3MI8A 5FZBA 2KA3A 2VCAA 2KXLA 5FZ0A 1I3HA 2R32A 3AP4A 2ZX1A 4HVRA 4RR3A 3LIHA 4DB5A 1N1TA 1C8M3 1WCDJ 3VBFA 3PVOA 1UMHA 3U37A 5JPNB 4LO5B 1JUHA 4NWWA 1KS4A 4I01A 3SCFA 4AVBA 3VV1A 3GJBA 1RXFA 3JCIA 2JG9C 3VDCA 4DS0A 5IAXA 4CEWC 2DTYA 2K9ZA 4PDWB 4I3GA 2XR4A 2GH8A 1PIV2 3VB9A 3W20A 4NMIA 1SFPA 5FXWA 4FOWA 4AI1A 5K9YA 2VTXJ 3VD5A 2OIIA 4YW4A 2EIGA 2WZ8A 4XDOA 2MEV3 3BGAA 3OBAA 2GU9A 3KF3A 5LB6A 5DDJ1 2VZTA 4OYUA 1DZQA 2WNVB 5FY9A 5JMOA 5FZ9A 4CPBD 3MUZ1 3FBMA 5A1AA 4NAOA 2O8OA 5C3QA 4QHOA 2P5BA 4EN6B 3GBFA 2VL4A 2WUHA 1RINA 3ZYPA 3TN92 1MS3A 4OUMA 3WF3A 4C90A 3KF5A 2JG9A 3EO6A 3FN9A 1LAJA 5FYHA 1UOFA 5CNAA 1SG3A 5K0UA 2YFUA 1Q8SA 2DVDA 1KDKA 4R4XA 3PMEA 3IPVA 2OUJA 2QVSB 2VZVA 3WG2A 2ZGNA 1X36A 4FPYA 3FL7A 4YFZA 3LDKA 3B3QE 5FZAA 3GHMA 2X5IB 4Q8KA 1VAVA 3USUB 3DV8A 5EXOA 2DURA 1MS8A 1GP6A 1NX9A 4W6YA 2EXIA 1AJOA 1GLHA 5L7OA 1XB9A 4AR2A 5C70A 3AVSA 2BYVE 2CYFA 2VR4A 1ZVFA 2WKKA 1ZRIA 3BPSA 3MF6A 3TOJA 5BUVA 4AXOA 4JZRA 4AL9A 1RL3A 1G9BA 1ZZ7A 4FPEA 4Z82A 2K2SA 3VDDC 3KV6A 4IGQA 4YG6A 5CKNA 4KBBA 1IPSA 2EALA 4YZ3A 3POEA 3MZHA 4KNCA 4Q0UA 3ZYJB 1JOJA 4Q4Y3 2QDNA 4R52A 1K5MC 2TNFA 4QX8A 4QHBA 1X33A 2WYSA 3JZVA 1UCXA 2H0BA 3L9JT 2GNTA 5FPVA 4Q4W3 2JDAA 5DZGA 4CDQC 3GZUC 3LFIA 3WDTA 2ZABA 2O1QA 2D6KA 2RDRA 1D4M2 1WGPA 4WM7C 5F3IA 5A32A 1Z0HA 4YWAA 4HK9A 2WS93 1YHFA 3A23A 4FOYA 4RGKA 4Y20B 4XF4A 5JXJA 2X29A 2YGMA 5FZEA 3H42B 1B09A 1BQPA 2HBUA 2OXBA 4KI5M 4YGBA 3MLLA 1CAXA 5FP4A 4MGIE 1HW5A 1UZ0A 1FYUA 4M3CB 5A7OA 3U11A 2GC0A 5KHGA 2RS32 4Y5Z0 1NOVA 3VHNA 2OUHA 4YW6A 4ZPIA 1CZVA 1UMIA 3NO8A 3SEPA 3VBRC 4WVMA 1VPHA 2WAOA 5FBJA 2P37A 3FHIB 4G3YC 1RUJ3 2P17A 1BK1A 1ULEA 2VMGA 3ACFA 3MGUA 3QBQA 4NHMA 5FUNA 5IFTA 3HQUA 2VOVA 5T54A 4LBJA 5EYYA 4XVHA 1SPPA 2NMNA 3K3OA 3WZ1A 2GC2A 4YVWA 4LBQD 4ZKTB 3S7EA 4M00A 2XXZA 4N53A 2DVBA 3I54A 4PJYA 3O1OA 5JVVA 4N7IA 4KU7A 4LO6B 2JB8A 4X8NA 5FK7A 2C1FA 4QXCA 3A0NA 1LOCA 2VOTA 4L11A 1ULFA 3BIEA 1VALA 2ES3A 3U78A 2CU5A 2XKOA 1BMV2 2BJSA 4CDWC 1TZOA 3EXUA 3VLBB 5DAWA 5JWPA 4MSVA 3HJRA 3FE5A 4HXCA 3R4UA 4JTNA 4ASKA 4C1WA 4CDXB 5F37A 5D21A 4GH4A 2OT7A 1QXPA 1F5FA 4MZUA 1GR3A 3AP6A 4X8PA 4E2SA 4MGYE 2QQLA 4DZGA 1V6OA 3ZSMA 1DYKA 2VW2A 3KD4A 3LEKA 4OQ8A 5DABA 4KGQA 4BQ1A 3O14A 4B4PA 1EAH1 5F5QA 5KC6A 2BBVA 4JGZA 3GCXA 3VBOA 3VBUC 1AR81 3N9LA 2QQJA 2ZHMA 1CAWB 3VD7A 2W9XA 1G7YA 4XMIA 3U75A 1HV0A 1SBDA 3M2MA 5FKCA 3B94A 1QQP3 2HKXA 1ULDA 4AVAA 4Q4V1 4LQRA 3MBWA 4AG4A 2WLQA 1YIFA 3MW2A 1JYCA 5B4NA 2VZ1A 1DQ1A 3UK9A 2OW4A 2WNOA 2W92A 3WV6A 1G9DA 1MZFA 1RUH3 1AR92 3O1UA 4UT5A 1LOGA 3SKVA 5DPNA 2BBAA 3LD8A 1WCSA 4CUGA 3VBSA 5JDBA 5C3SA 3VDBA 1PK6C 2AH2A 2ZMKA 3O1PA 5J09A 2A5ZA 3N9NA 4XCBA 5C5UA 3KB5A 3AK0A 2XQRA 4H7MA 3MDPA 5GLWA 4CXWA 1B35C 2W91A 1NUKA 1PO13 3I2FA 5F5AA 3JBG1 3NAPA 3IIAA 5T5JA 5KXBA 4XXAA 1H2NA 3BKZA 4XF0A 1JZ7A 1GQGA 2CGOA 4NWVA 2W95A 3SH4A 3PMSA 3M4FA 3VZMA 1PZ9A 5F3CA 4RHV3 3ZX7A 4DRRA 2WQZC 3WSOA 4DRVA 3LOBA 4M3CE 1HXS2 2GC1A 4E4HA 5CVRA 1OI6A 2VCBA 2H0VA 1MEC1 5HBAA 2WA4A 1NQDA 1YO8A 1XU2A 2K0GA 3POYA 2LALA 1O59A 3TEWA 3DN7A 5FYIA 4P9XA 3H50A 5GZCA 5L36A 4JAAA 1YYNA 1HLCA 5FZ1A 3THPA 1WBFA 5KHIA 3OSDA 1ST8A 3KWVA 2BP6A 2E6VA 2VZUA 2VU9A 5IVJA 3NNMA 3DUIA 4GXLA 2CGNA 4N8MA 5FMDA 4NIGA 3C7FA 1AL23 1W6MB 2AYHA 2AZ5A 2R7EB 3N35A 3UKTA 5KXDA 5LRRA 3PIGA 5BV6A 4NUBA 2ET7A 4AQTA 3PUAA 2DTWA 3AKQA 3N9PA 4AVSA 2XL7A 3PJYA 1N3PA 4A7KA 2VOWA 4LBMA 1RUG1 3MFCA 2PHWA 5D8AA 1J1TA 4BQ2A 4DQAA 1VB4A 2ARCA 5LCWL 3N36A 1EPWA 1NKGA 3IIIA 3VHPA 2XH6A 4COVA 4EWDA 4KU8A 2JKXA 4J25A 1O5UA 2Q8DA 2R071 2SLIA 1UZWA 4URTA 2QFEA 5LEKA 1V6LA 2Y26A 1GNZA 1RVF1 5JOXA 4EQVA 2ORZA 2ZHNA 3ME2A 1UU6A 4B4RA 1W9YA 3RVHA 4H14A 4F8AA 4PF1A 4W8JA 4XJWA 5ACA3 3E5QA 3POBA 2BTVC 5FMOS 4S2DA 2ARXA 3C2UA 3POFA 5A80A 3WG3A 1G9CA 3N9OA 1ND3B 3KLSA 4RS5B 1FNYA 2ZEYA 2IXKA 2F4LA 5C6CA 2QQNA 4QD2A 5GLZA 3M3OA 3D0SA 3VGIA 2YMZA 3LB9A 3SH5A 1SMVA 2J7MA 2W3JA 5FYCA 3IDEA 3ZN4A 4P9YA 4IV3B 1FX5A 5BNNA 5ISLA 2LM3A 3UNPA 4K9SA 4CP9B 1LU2A 4IE4A 4TLFA 1FMD3 4LUKA 4MHUA 4CCNA 1VRH3 2ZOEB 3KM5A 2PXJA 5CFCA 2YPDA 1BVVA 2ZKNA 3BB6A 3VHOA 5ABJC 4XJAA 2J42A 3LA2A 2R041 2O14A 2DFBA 2Q0AA 2VM9A 1QXJA 2CWSA 2KM2A 5L9VA 1RB8G 1ZX5A 5BNQA 2DYCA 4AI9A 3JU9A 3TBDA 5IVCA 3A4UA 3I49A 1U12A 1NCRA 1HIXA 2EAAA 2XUEA 5IWFA 3UGFA 2NN8A 1H1IA 1PIV3 4MADA 1UPIA 5GALA 1POV0 2A6XA 1DLCA 1HN0A 3UGGA 3CJIB 4D7SA 2VQ0A 4LKSA 3W5MA 4V1PA 3CZUA 1A6CA 4QX7A 3H9AA 3SMHA 1S0EA 1E5RA 2Q4SA 2UWAA 4Q29A 3IAQA 3S57A 2D97A 2HLEA 3H7YA 3U07A 1QJX1 3OYWB 4E2QA 5FP9A 3P6BA 1H1MA 4FT8A 1EAH2 3PURA 4K21A 4PCRA 1W8OA 3TN93 4K7JA 4TTGA 1GQHA 5FY7A 1AR82 2F4PA 5I8TA 1PVC1 4RQPC 1DQ4A 1NE4A 3F95A 4PDWA 2QKDA 1DZTA 3VKOA 5I93A 2TEPA 3I3DA 4Q4V2 4NAMA 1GOFA 1XNAA 4LLOA 3RZKA 2WN3A 1IPJA 3QD6A 1UL9A 2OS2A 3OB8A 1VBB1 1ZNPA 1R081 3O7OA 1LU1A 2WNVA 3FLPA 3VZNA 3DYOA 3AMQA 5JSRA 4Q0QA 1S0CA 2Y0IA 3BTAA 4LTAA 1SBEA 4QX0A 2AR6A 4CXYA 3GZEA 3CHXA 4YPJA 5GLVA 2XKPA 3BN6A 3E1F1 1UU4A 2VVDA 4A4AA 1JXNA 3LA7A 5F7UA 1LNSA 4MX3A 2YDEA 2JJ6A 1BBT2 3JBG2 4IDZA 1Q5OA 4QDQA 3SLIA 1COV2 3WW4A 3NV3A 5JMCA 4UFLA 3R0RA 2VY0A 5FMCA 5L9BA 2XB6C 2C24A 2JE9A 2WSVA 3I4IA 4LNVA 2J22A 4C8DA 2MHFA 4XHBA 4OUEA 1AL0G 1QH7A 4Y24A 4BDVB 2ADDA 2UY8A 3USUA 1OFNA 3AZVA 1JYXA 1LHNA 1WMDA 3R6SA 5C8CB 2ARBA 2OPWA 3DCQA 4FP3A 5DXDA 2R0HA 2A6YA 4PLOA 4QQOA 5JI9A 1D4M3 1MEC2 1QIQA 4Q26A 1YFYA 3ZYRA 1RUC1 2FHRA 1CIWA 5E6HA 4ASMB 4ARXA 5FYMA 2F6BA 4LULA 3ZFGB 1CX4A 2UY9A 4MG2A 1V6JA 4I02A 4LUMA 4BJ0A 5T3NA 1H9PA 1R092 1RGSA 2V5DA 5DAVA 2RS33 2XJTA 3TAYA 1POQA 1ZREA 4LHNA 2E63A 1W05A 1H8TC 4FQZA 4GIQA 5J7MA 2CAVA 4Q0VA 2B42B 4LHLA 4OFGA 3LWCA 3I59B 4WM8C 4COYA 1A8DA 4JRLA 1IZ3A 4YSFA 1QXRA 2P6HA 3W58A 3WDUA 1OLRA 1UZYA 2CTVA 1AX0A 3EYPA 1RUG2 4IGOA 3DYPA 2IXLA 2CGPA 2OA2A 4Q4X1 1MS9A 4OHVA 2J1RA 1YFWA 5JSPA 5EWSA 3NJXA 3D0JA 1WW5A 5IJRA 4FTBA 4YGDA 1OPOA 2CAUA 2R072 4IERA 1BZWA 5JZGB 1ZYBA 3AMNA 3JXSA 5AVPA 1SLTA 1UOGA 2NQYA 1RVF2 3ENRA 3V56A 4LK6A 4IW3A 2GZWA 4XACA 1GZ9A 4NE9A 3QLQA 2AGSA 1XRUA 4GJZA 5BNPA 2RM21 1JOPA 3T2OA 3NV1A 2VVFA 4PIXA 4Q0SA 2A73B 1WLTA 5CFCC 4OMDA 3ES1A 3WNMA 4B1MA 2ERFA 4YG3A 1OQDA 4QPGC 1REDA 2EICA 4I09A 4Y33A 4AHYA 4DXRA 4LBQB 4XABA 3OF1A 1F35A 1UPSA 2BFUL 2H6BA 4LK7A 1Z78A 2P6CA 3RMXA 3WNOA 4CCOA 1SCSA 2ZPXA 4DOUA 2MPFA 3ZXAC 3ACGA 4ZXKA 5GLUA 1OBNA 1M4WA 4IEPA 5IVVA 1VBD1 4ITCA 4U36A 4XUPA 3ZFEC 1PNGA 1Y9MA 1YQ2A 3UJOA 1UN1A 3UKNA 3FLTA 4W6XA 1RTVA 4CDXA 2GP3A 2YBKA 2BPA2 1JW6A 5JPMB 1AR93 4LHKA 4KG8A 1EP0A 1QOTA 1S2BA 4CU6A 5C8WA 4AF9A 2FCTA 4R9DA 2WT1A 1ZBE1 1LGNA 1GZWA 4PIZA 4R9BA 3RMYA 1W6OA 2DCKA 3MIFA 4WZCA 3ZXKA 3GALA 3ZFFC 4FPHA 2VVEA 1GWLA 1RIRA 5DG1A 1CAWA 1HX6A 1UX6A 2GNBA 1AVBA 4AQSA 2I45A 2LS6A 2BWAA 3HQXA 4XZUG 2J1VA 4QX1A 5CADA 3OTFA 5FPUA 3CU7A 4AEDC 3DPRB 4GMP0 3AFKA 1AXKA 2V5YA 3CKHA 5LBFA 5FO9B 1VBC1 3T0AA 1F31A 1BEV2 2PAMA 3AYAA 3BCWA 1HXS3 4RGGA 4QX3A 1QGLA 3VD4A 5CFDC 1ENRA 4BLJA 1QJX2 3RSJA 5C9AC 2VQAA 1GFF2 1O3RA 4JV4A 3NSTA 4SBVA 3K46A 2WL1A 1DBNA 2R6QA 3LPFA 1PVC2 2RG4A 4MGTA 3ORJA 1XC6A 2NZ9A 3ZO0B 5CBLA 1G8WA 3JB4C 1DHKB 4X6QB 3MW3A 3RFRA 3WG1A 2HWF1 4PIYA 2HWB1 4CE8A 2GALA 3M70A 1IKQA 4WV8A 1K45A 1XNCA 4CEYB 4W4ZA 2JG8C 3OUHA 4GKYA 1F8VA 3GCWA 3IWZA 1R082 1GOHA 3MLJA 1VMFA 1JYTA 5IK5A 1U5XA 4BU2A 5G04L 5C9AA 4F3JA 5F6LB 2DCYA 4CCDA 4BQ4A 1GSLA 3IAPA 4MV2A 3X29B 4XURA 5A33A 2JDZA 3OJBA 4ZU5A 5A7WB 4KQ7A 1EYBA 1CAVB 2V73A 5F3EA 2FMDA 4BISA 1F5JA 3VD9A 2DBIA 2WNUB 4QXKA 5I8SA 5KBFA 5LASA 4LJHA 4NIIA 2QQMA 2FMYA 3H8OA 5GM0A 2XQXA 4NIAA 3SH3A 3WEZA 3DGTA 3B01A 4EYUA 4XZPA 5B2GB 2ZGSA 4HBNA 3H8XA 2JIGA 5FP7A 2HEVF 3CZJA 4HLTA 1CZTA 4AEJA 2WJSA 1XE0A 2RR11 2YXSA 1QDOA 2ZKLA 1FT9A 1DCSA 1JYIA 1W8NA 4BXFA 2W1WA
chains in the Genus database with same CATH topology
3A23A 1JZ3A 3WF4A 3I2IA 2WBKA 3WNLA 2Z4FA 2VZRA 4E8CA 4KI5M 2XONA 4BXSV 2EIBA 2Y6KA 1UZ0A 3CMGA 2VMCA 4QB2A 2E31A 2J1TA 2WN2A 2WAAA 1CZVA 1UMIA 4QPWA 2Y8KA 2KD7A 3SEPA 2WAOA 2VZPA 3ACFA 1PX4A 2DCJA 3T09A 5IFTA 2VZOA 1KGYA 1MPXA 2W87A 1UWWA 4DUWA 2BERA 4XVHA 1CZSA 4GWIA 2CDOA 5B4XA 1K12A 3FHAA 2YC4A 1JZ5A 1JZ8A 4JKKA 3WF0A 1US2A 2VOTA 4DUVA 3K77A 2BGPA 4QB6A 1JU3A 5HXMA 3VDAA 3HJRA 2JD9A 1T2XA 1OH4A 4CUCA 3UESA 1W8NA 3OGVA 3LEGA 1US3A 3LEKA 1KEXA 5IHRA 2VZSA 4KWUA 2J1EA 2QQJA 3NRUA 5FUIA 4RYDA 3VD7A 2W9XA 3IDAA 3PUHA 1OD3A 4LQRA 5EJZB 3MBWA 4AG4A 4JKMA 4ZZ5A 3WNNA 5B4NA 2VZ1A 3HNMA 3ZM8A 2W92A 3GDBA 4P02B 1OF3A 3SKVA 2W1UA 2BBAA 5DPNA 4CUBA 1PMHX 3VDBA 3K75B 1UX7A 2W47A 2WQ8A 5IYYA 4QAWA 3K4AA 2J1UA 2W94A 4M4RA 2Y6GA 2W91A 3I97A 1NUKA 1J84A 3I2FA 3MV01 2VTFA 5LA0A 3T2PA 2L9LA 3WF1A 2YG0A 1TG7A 3T0DA 1JZ7A 4ZXEA 1PMJX 1ULOA 2W95A 1JI6A 3I2GA 4QDRA 1W99A 2VO5A 3WSOA 1OT5A 5EIYB 2VCBA 2W5FA 1TVGA 1I5PA 1O59A 1K42A 1P8JA 3NNGA 3MUY1 1F4AA 4PT6A 2C26A 4CU7A 2VZUA 2WO2A 2OKXA 1UY2A 1JU4A 3C7FA 2R7EB 3THDA 1JYVA 4QDSA 3DECA 4UOJA 4CU9A 3DYMA 1JZ4A 5HPOA 2VZ3A 1UY4A 3F2ZA 3SEEA 2QQOA 5LCWL 3HOBA 1NKGA 3IIIA 4DXTA 2ZEZA 2YC2A 2ZXQA 3GXUA 4IUGA 2JKXA 4BK4A 4MOAA 2Y6JA 4UI9L 2ORZA 1UYXA 3T08A 4L0PA 4PF1A 4W8JA 1W0NA 2CDPA 4OMCA 3SKJE 4GZ9A 1GUIA 1L7QA 3I2KA 3I3BA 2ZEYA 3GGLA 2QQNA 1R64A 1PX3A 4HG6B 2J7MA 2W3JA 2VZQA 1OF4A 1EUUA 2VMDA 4MGQA 3IB3A 3UNPA 4RN5A 1UXXX 3LEIA 4DEVA 1GNYA 2VQTA 2VM9A 5LA2A 3ACHA 2X10A 2VJXA 5J1XA 2RJ2A 1L7RA 2E26A 2VQUA 5I0DA 3VD3A 3MO4A 4GWJA 1NAEA 3HN3A 4A42A 4MADA 1DYOA 4XUOA 4A41A 4A44A 2RV9A 2QQKA 1DLCA 3T0BA 4ET7A 4DXSA 1CIYA 5DN2A 1F4HA 1XNTA 4LKSA 3W5MA 2W46A 2ZEXA 3CZUA 1W9WA 2WDBA 2Y6LA 1DP0A 3IAQA 1JZ6A 2HLEA 2J1SA 4CU8A 3P6BA 4QB1A 2HYXA 4TTGA 1W8OA 4MGSA 2BZDA 2WO1A 4CVUA 1W9SA 1JHJA 2C9KA 2J1AA 1K3IA 3OEBA 3I3DA 1GOFA 1XNAA 4ZZ8A 1IQDC 2WN3A 2YB7A 1HN1A 3OB8A 4QX2A 3HPNA 2ORXA 3DYOA 3NJVA 3C7OA 4XUNA 4P00B 4QX0A 2BGOA 3MV11 2VMFA 2WO3A 4YPJA 4PQQA 3BN6A 5CZKA 3E1F1 1BHGA 1GQPA 2V4VA 4A4AA 5F7UA 2B4KA 1LNSA 3OEAA 4QDQA 2LW8A 3WF2A 3T2QA 1GOGA 2J22A 3C8XA 4OUEA 4A3ZA 3D3AA 3P1IA 4BDVB 3A7QA 1JYWA 1JYXA 3J7HA 2JE8A 5EJ1B 2VMEA 1UYZA 2E32A 1SDDB 4D0QA 4ARXA 3PUIA 2B9VA 3ETPA 1W9TA 4BJ0A 5JXHA 2V5DA 2QBXA 3C7EA 3K4DA 1XPWA 2QQIA 3GM8A 1WKYA 2ID4A 3WNKA 2WZEA 4P08A 1GMMA 2W1SA 2ZEWA 1H6XA 1UXZA 2Y64A 3A21A 3EYPA 3W5NA 3OGSA 2VCCA 2XHNA 3DYPA 4TXWA 4E8DA 3WNPA 2J1RA 2X09A 3LQCA 3FHQA 2C4XA 3NJXA 4AAXA 1O8PA 2W1QA 1J83A 3EB7A 3LE0A 5IJRA 2WABA 4JKLA 5DQ0A 1EUTA 4LHSA 3JXSA 1UY0A 2V72A 5G05L 4LPLA 2EIEA 5JXGA 4Z2AA 1CX1A 3ECQA 3LPGA 2XOMA 3A22A 4P5YA 1JZ2A 3T2OA 5LA1A 1SHWB 4ZY9A 4OMDA 3WNMA 3UETA 4DXRA 4MO3M 3K4ZA 2EICA 4M4PA 1O8SA 1ULPA 1UY1A 3HEIA 1JYNA 4DUXA 4A45A 3C7HA 3WNOA 3C7GA 3ACGA 5JXJA 5C7GA 3CDZB 5JUVA 3HNBM 4XUPA 1YQ2A 4CUAA 4JHZA 4XUTA 4BK5A 2VCAA 2Y6HA 2E33A 2PQSA 1UYYA 4CU6A 1UMHA 3U37A 4OZOA 2RVAA 3VDCA 2YFZA 2DCKA 5JR2A 2VC9A 4ARYA 3VD5A 3ABZA 2LS6A 2WZ8A 3OBAA 3BGAA 4XZUG 2VZTA 4A6OA 2J1VA 4OYUA 4QX1A 5JXIA 5IFPA 5JMOA 3MUZ1 3HNYM 5A1AA 1GU3A 3CKHA 2VL4A 3AC0A 3T0AA 2WUHA 3WF3A 4QX3A 1WCQA 3VD4A 3FN9A 4W50A 1D7PM 4DEQA 1SG3A 2YFUA 3K46A 3LPFA 3OG2A 5DMYA 3I3EA 3WQBA 1XC6A 2VZVA 3CIHA 3THCA 3OGRA 3ACIA 3FL7A 5CYYA 3CQOA 2DDUA 1K45A 1NX9A 4W4ZA 4FI9A 1GOHA 5C70A 2VR4A 4KMQA 5G04L 4JX0A 2X05A 4UAPA 3IAPA 4D8MA 4XURA 3VD9A 1H6YA 3I2JA 2QQMA 4XUQA 2XQXA 3I2HA 3WEZA 3NQHA 2WYSA 1RYYA 5C71A 1UY3A 3CZJA 2JDAA 2EIDA 1CZTA 2QQLA 2W1WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A23 A;  1JZ3 A;  3WF4 A;  3I2I A;  2WBK A;  3WNL A;  2Z4F A;  2VZR A;  4E8C A;  4KI5 M;  2XON A;  4BXS V;  2EIB A;  2Y6K A;  1UZ0 A;  3CMG A;  2VMC A;  4QB2 A;  2E31 A;  2J1T A;  2WN2 A;  2WAA A;  1CZV A;  1UMI A;  4QPW A;  2Y8K A;  2KD7 A;  3SEP A;  2WAO A;  2VZP A;  3ACF A;  1PX4 A;  2DCJ A;  3T09 A;  5IFT A;  2VZO A;  1KGY A;  1MPX A;  2W87 A;  1UWW A;  4DUW A;  2BER A;  4XVH A;  1CZS A;  4GWI A;  2CDO A;  5B4X A;  1K12 A;  3FHA A;  2YC4 A;  1JZ5 A;  1JZ8 A;  4JKK A;  3WF0 A;  1US2 A;  2VOT A;  4DUV A;  3K77 A;  2BGP A;  4QB6 A;  1JU3 A;  5HXM A;  3VDA A;  3HJR A;  2JD9 A;  1T2X A;  1OH4 A;  4CUC A;  3UES A;  1W8N A;  3OGV A;  3LEG A;  1US3 A;  3LEK A;  1KEX A;  5IHR A;  2VZS A;  4KWU A;  2J1E A;  2QQJ A;  3NRU A;  5FUI A;  4RYD A;  3VD7 A;  2W9X A;  3IDA A;  3PUH A;  1OD3 A;  4LQR A;  5EJZ B;  3MBW A;  4AG4 A;  4JKM A;  4ZZ5 A;  3WNN A;  5B4N A;  2VZ1 A;  3HNM A;  3ZM8 A;  2W92 A;  3GDB A;  4P02 B;  1OF3 A;  3SKV A;  2W1U A;  2BBA A;  5DPN A;  4CUB A;  1PMH X;  3VDB A;  3K75 B;  1UX7 A;  2W47 A;  2WQ8 A;  5IYY A;  4QAW A;  3K4A A;  2J1U A;  2W94 A;  4M4R A;  2Y6G A;  2W91 A;  3I97 A;  1NUK A;  1J84 A;  3I2F A;  3MV0 1;  2VTF A;  5LA0 A;  3T2P A;  2L9L A;  3WF1 A;  2YG0 A;  1TG7 A;  3T0D A;  1JZ7 A;  4ZXE A;  1PMJ X;  1ULO A;  2W95 A;  1JI6 A;  3I2G A;  4QDR A;  1W99 A;  2VO5 A;  3WSO A;  1OT5 A;  5EIY B;  2VCB A;  2W5F A;  1TVG A;  1I5P A;  1O59 A;  1K42 A;  1P8J A;  3NNG A;  3MUY 1;  1F4A A;  4PT6 A;  2C26 A;  4CU7 A;  2VZU A;  2WO2 A;  2OKX A;  1UY2 A;  1JU4 A;  3C7F A;  2R7E B;  3THD A;  1JYV A;  4QDS A;  3DEC A;  4UOJ A;  4CU9 A;  3DYM A;  1JZ4 A;  5HPO A;  2VZ3 A;  1UY4 A;  3F2Z A;  3SEE A;  2QQO A;  5LCW L;  3HOB A;  1NKG A;  3III A;  4DXT A;  2ZEZ A;  2YC2 A;  2ZXQ A;  3GXU A;  4IUG A;  2JKX A;  4BK4 A;  4MOA A;  2Y6J A;  4UI9 L;  2ORZ A;  1UYX A;  3T08 A;  4L0P A;  4PF1 A;  4W8J A;  1W0N A;  2CDP A;  4OMC A;  3SKJ E;  4GZ9 A;  1GUI A;  1L7Q A;  3I2K A;  3I3B A;  2ZEY A;  3GGL A;  2QQN A;  1R64 A;  1PX3 A;  4HG6 B;  2J7M A;  2W3J A;  2VZQ A;  1OF4 A;  1EUU A;  2VMD A;  4MGQ A;  3IB3 A;  3UNP A;  4RN5 A;  1UXX X;  3LEI A;  4DEV A;  1GNY A;  2VQT A;  2VM9 A;  5LA2 A;  3ACH A;  2X10 A;  2VJX A;  5J1X A;  2RJ2 A;  1L7R A;  2E26 A;  2VQU A;  5I0D A;  3VD3 A;  3MO4 A;  4GWJ A;  1NAE A;  3HN3 A;  4A42 A;  4MAD A;  1DYO A;  4XUO A;  4A41 A;  4A44 A;  2RV9 A;  2QQK A;  1DLC A;  3T0B A;  4ET7 A;  4DXS A;  1CIY A;  5DN2 A;  1F4H A;  1XNT A;  4LKS A;  3W5M A;  2W46 A;  2ZEX A;  3CZU A;  1W9W A;  2WDB A;  2Y6L A;  1DP0 A;  3IAQ A;  1JZ6 A;  2HLE A;  2J1S A;  4CU8 A;  3P6B A;  4QB1 A;  2HYX A;  4TTG A;  1W8O A;  4MGS A;  2BZD A;  2WO1 A;  4CVU A;  1W9S A;  1JHJ A;  2C9K A;  2J1A A;  1K3I A;  3OEB A;  3I3D A;  1GOF A;  1XNA A;  4ZZ8 A;  1IQD C;  2WN3 A;  2YB7 A;  1HN1 A;  3OB8 A;  4QX2 A;  3HPN A;  2ORX A;  3DYO A;  3NJV A;  3C7O A;  4XUN A;  4P00 B;  4QX0 A;  2BGO A;  3MV1 1;  2VMF A;  2WO3 A;  4YPJ A;  4PQQ A;  3BN6 A;  5CZK A;  3E1F 1;  1BHG A;  1GQP A;  2V4V A;  4A4A A;  5F7U A;  2B4K A;  1LNS A;  3OEA A;  4QDQ A;  2LW8 A;  3WF2 A;  3T2Q A;  1GOG A;  2J22 A;  3C8X A;  4OUE A;  4A3Z A;  3D3A A;  3P1I A;  4BDV B;  3A7Q A;  1JYW A;  1JYX A;  3J7H A;  2JE8 A;  5EJ1 B;  2VME A;  1UYZ A;  2E32 A;  1SDD B;  4D0Q A;  4ARX A;  3PUI A;  2B9V A;  3ETP A;  1W9T A;  4BJ0 A;  5JXH A;  2V5D A;  2QBX A;  3C7E A;  3K4D A;  1XPW A;  2QQI A;  3GM8 A;  1WKY A;  2ID4 A;  3WNK A;  2WZE A;  4P08 A;  1GMM A;  2W1S A;  2ZEW A;  1H6X A;  1UXZ A;  2Y64 A;  3A21 A;  3EYP A;  3W5N A;  3OGS A;  2VCC A;  2XHN A;  3DYP A;  4TXW A;  4E8D A;  3WNP A;  2J1R A;  2X09 A;  3LQC A;  3FHQ A;  2C4X A;  3NJX A;  4AAX A;  1O8P A;  2W1Q A;  1J83 A;  3EB7 A;  3LE0 A;  5IJR A;  2WAB A;  4JKL A;  5DQ0 A;  1EUT A;  4LHS A;  3JXS A;  1UY0 A;  2V72 A;  5G05 L;  4LPL A;  2EIE A;  5JXG A;  4Z2A A;  1CX1 A;  3ECQ A;  3LPG A;  2XOM A;  3A22 A;  4P5Y A;  1JZ2 A;  3T2O A;  5LA1 A;  1SHW B;  4ZY9 A;  4OMD A;  3WNM A;  3UET A;  4DXR A;  4MO3 M;  3K4Z A;  2EIC A;  4M4P A;  1O8S A;  1ULP A;  1UY1 A;  3HEI A;  1JYN A;  4DUX A;  4A45 A;  3C7H A;  3WNO A;  3C7G A;  3ACG A;  5JXJ A;  5C7G A;  3CDZ B;  5JUV A;  3HNB M;  4XUP A;  1YQ2 A;  4CUA A;  4JHZ A;  4XUT A;  4BK5 A;  2VCA A;  2Y6H A;  2E33 A;  2PQS A;  1UYY A;  4CU6 A;  1UMH A;  3U37 A;  4OZO A;  2RVA A;  3VDC A;  2YFZ A;  2DCK A;  5JR2 A;  2VC9 A;  4ARY A;  3VD5 A;  3ABZ A;  2LS6 A;  2WZ8 A;  3OBA A;  3BGA A;  4XZU G;  2VZT A;  4A6O A;  2J1V A;  4OYU A;  4QX1 A;  5JXI A;  5IFP A;  5JMO A;  3MUZ 1;  3HNY M;  5A1A A;  1GU3 A;  3CKH A;  2VL4 A;  3AC0 A;  3T0A A;  2WUH A;  3WF3 A;  4QX3 A;  1WCQ A;  3VD4 A;  3FN9 A;  4W50 A;  1D7P M;  4DEQ A;  1SG3 A;  2YFU A;  3K46 A;  3LPF A;  3OG2 A;  5DMY A;  3I3E A;  3WQB A;  1XC6 A;  2VZV A;  3CIH A;  3THC A;  3OGR A;  3ACI A;  3FL7 A;  5CYY A;  3CQO A;  2DDU A;  1K45 A;  1NX9 A;  4W4Z A;  4FI9 A;  1GOH A;  5C70 A;  2VR4 A;  4KMQ A;  5G04 L;  4JX0 A;  2X05 A;  4UAP A;  3IAP A;  4D8M A;  4XUR A;  3VD9 A;  1H6Y A;  3I2J A;  2QQM A;  4XUQ A;  2XQX A;  3I2H A;  3WEZ A;  3NQH A;  2WYS A;  1RYY A;  5C71 A;  1UY3 A;  3CZJ A;  2JDA A;  2EID A;  1CZT A;  2QQL A;  2W1W A; 
#chains in the Genus database with same CATH topology
 2P1B A;  4AOC A;  4UFJ A;  2FD8 A;  2DVG A;  3VZL A;  2XON A;  2VOK A;  2BDR A;  2EIB A;  1ENQ A;  4XBQ A;  3M7A A;  4QB2 A;  3E6D A;  3UKV A;  3FZ3 A;  3H0O A;  5FWJ A;  4Y1X A;  4Y1V A;  4W65 A;  5L73 A;  4YW5 A;  3WX5 A;  4AGV A;  3NNJ A;  4Z8B A;  4Y3O A;  2VNV A;  1BMV 1;  1S55 A;  2RDQ A;  1PX4 A;  2H6C A;  4BCU A;  5CEH A;  1KGY A;  5EQU A;  1Y3T A;  3R4S A;  1UWW A;  3RYR A;  4JDO A;  1UZZ A;  4GWI A;  5DUX A;  2PHU A;  4E4Z A;  3PU8 A;  5CAZ A;  3FHA A;  3WLU A;  1ULG A;  3BPZ A;  4RR3 C;  4QQL A;  1SZB A;  3WHT A;  4LXL A;  2Q1M A;  4Q4X 2;  1OA2 A;  3VBF C;  4CZS A;  1L7L A;  4FP2 A;  3SNM A;  5LW9 A;  1US2 A;  1QJF A;  1ND3 A;  1UF2 C;  3K77 A;  1PVX A;  4DUV A;  4QHZ A;  4Y5T A;  2BGP A;  3OUJ A;  4QKB A;  5DAX A;  2PFW A;  4BE3 A;  4UW6 A;  3J26 N;  1Q8V A;  1STM A;  4HK8 A;  3VDA A;  4IV3 A;  1ZRC A;  1UKG A;  5DUW A;  3IDC B;  4DNY A;  3FWE A;  1OLQ A;  2IFR A;  2JD9 A;  5FYY A;  1T2X A;  4MVT A;  4D69 A;  3RNS A;  1OH4 A;  4TLG A;  3T4V A;  3UES A;  1ACC A;  2PAE A;  3B02 A;  3OGV A;  1IGO A;  5A6X A;  4YAR A;  3PUS A;  4NID A;  2IXI A;  2RM2 2;  1VMH A;  2OVU A;  1OSG A;  3QH6 A;  4KWU A;  1JOB A;  1EAH 3;  3NRU A;  4MUV A;  5HCB A;  1HJF A;  4O9E A;  3MYX A;  1AR8 3;  3IDA A;  5K0U C;  1AZD A;  1DLL A;  3ZYB A;  4ZS2 A;  3TEX A;  3ZLI A;  1ULC A;  5EJZ B;  5GLT A;  4JKM A;  2P34 A;  4NPL A;  4AQ2 A;  4XFC A;  1VBD 2;  3AKS A;  4Q4V 3;  4IEQ A;  3HNM A;  3USS A;  5FJH A;  1ZA7 A;  5FO7 B;  4IND A;  4DMI A;  1Y7B A;  1LUL A;  3ZYG A;  2IVI B;  4ATF A;  1S2K A;  2Z69 A;  3IN9 A;  1HXS 1;  4Z1V A;  1XBF A;  3AZX A;  2BOJ A;  3K75 B;  1UX7 A;  2W47 A;  5L7O C;  3WQ0 A;  2WQ8 A;  1CON A;  3H1W A;  2WYF A;  4QAW A;  5E89 A;  5GZE A;  3J7L A;  1ZBE 2;  1HRI 1;  3RYP A;  3OYW A;  4LMF A;  4Z07 A;  1J84 A;  2ZHK A;  2ZGL A;  5LA0 A;  1WLW A;  4NHL A;  4TN7 A;  4IQP A;  2YG0 A;  1TG7 A;  3WF1 A;  1ODM A;  4DXZ A;  2LTN A;  3JBG 3;  4EN7 B;  5A3P A;  1COV 3;  4QGM A;  3GZA A;  1JI6 A;  4LE4 A;  4B3N A;  1VAM A;  4XDP A;  4QDR A;  5E88 A;  5AFE A;  1H30 A;  2VO5 A;  4BQY A;  1U5I A;  3ILN A;  2DUP A;  1VBC 2;  4NPM A;  5T5P A;  4JGY B;  4AVC A;  3VBH B;  2ZS6 B;  2JEC A;  1GP5 A;  4CPB A;  1I1E A;  2ETE A;  1MEC 3;  2WT2 A;  1GP4 A;  2Y0O A;  3NV4 A;  5I0U A;  4XBN A;  1P8J A;  2MNG A;  3OY8 B;  4AYU A;  2TUN A;  3CLP A;  1WZX A;  3AMH A;  5DG2 A;  1DF0 A;  4H55 A;  3WP4 A;  4PT6 A;  2NMO A;  5T55 A;  1R09 3;  1XJA A;  2EA7 A;  4CU7 A;  3ATG A;  5BNO C;  4WZF A;  2BRT A;  3V0A B;  2HWF 2;  2GN7 A;  1UY2 A;  1JU4 A;  2HWB 2;  3Q8E A;  4GAL A;  3ZXL A;  1BXH A;  3ACL A;  3E5U A;  1ASJ 1;  1CJP A;  5FAX A;  3RI8 A;  3ROU A;  1E5I A;  3DEC A;  3NJY A;  2D6L X;  1HJG A;  4UOJ A;  5C33 A;  1VBA 1;  3LF7 A;  3GZT B;  1J3Q A;  3JQX A;  1TMF 1;  1JMU B;  5C8C A;  1KD7 A;  2NPI A;  3AJY A;  2D6N A;  1GWM A;  1UY4 A;  4YVW C;  2VNR A;  3F2Z A;  1RUG 3;  2QQO A;  1PZ7 A;  4N53 C;  4A3X A;  2FQP A;  3HOB A;  2IXH A;  5FZL A;  4BB3 A;  2ZEZ A;  3ZFG A;  3ZN5 A;  4D3W A;  5BNO A;  1SBF A;  4S2G A;  3AJZ A;  2A3Y A;  3N7K A;  4YVS B;  3ST7 A;  4JRA A;  3AVR A;  4UI9 L;  2AAC A;  1YNA A;  2R07 3;  3QOP A;  4LA3 A;  4JDM A;  3BOP A;  5A7S A;  1RVF 3;  5IVY A;  3T08 A;  4XTM A;  2RR1 2;  3ITQ A;  2D93 A;  4GH4 C;  2PQQ A;  4L0P A;  5IVB A;  2CDP A;  3IMM A;  2PTM A;  1QJZ A;  2NYY A;  4UW4 A;  5IW0 A;  2XLG A;  3UV9 A;  4N90 A;  4BQW A;  3SKJ E;  2BV4 A;  4CSW A;  3RZH A;  3VHR A;  1SQ4 A;  3DKW A;  1VJ2 A;  2PAK A;  2ZCW A;  3Q9O A;  5A1F A;  3GYD A;  4JGZ C;  1CQ9 A;  1R64 A;  4L8Q A;  1YIP A;  1LEM A;  3UYJ A;  3APB A;  3VBO C;  2XVL A;  2VZQ A;  5LBE A;  4CP2 A;  2XDV A;  1OF4 A;  1EUU A;  2VMD A;  3PHM A;  3ZYI B;  1OOP B;  1HB1 A;  1YI9 A;  5C4W B;  4KH9 A;  1UO9 A;  5EYX A;  5JAX A;  2FZ2 A;  3MW4 A;  1RIT A;  1UXX X;  1XNK A;  3MFA A;  5JZG A;  1DGW A;  2NM1 A;  4AI0 A;  4N43 A;  4N9H A;  2VBB A;  1RUI 1;  3BI3 A;  1L3J A;  1GNY A;  1RJ7 A;  1FAT A;  3HR9 A;  1N1V A;  4CDU A;  1DU3 D;  5F32 A;  3VBS C;  3ACH A;  2R04 3;  4L92 A;  3MIE A;  4YGC A;  3UL2 A;  4QWN A;  4E27 A;  2RJ2 A;  3HIF A;  3RG0 A;  5KXE A;  4XBL A;  1AYN 1;  1L7R A;  1HQW A;  1FPN 1;  1OH3 A;  2E26 A;  3PVB B;  4IV1 A;  5DZE A;  5I0D A;  3MO4 A;  4Y1Z A;  4LBQ A;  4GWJ A;  1W2O A;  3WNP A;  5IT6 A;  1OLM E;  1EPZ A;  4NHY A;  4A41 A;  3MEP A;  4A44 A;  1QNY A;  3T0B A;  2PN5 A;  3NAP C;  2A3X A;  2RS5 1;  1BKZ A;  2WWJ A;  3I8T A;  2WC2 A;  4Y22 B;  4ET7 A;  3WIN E;  3KCY A;  1WCK A;  3OPT A;  1YWK A;  2EXH A;  4UBG A;  1H2K A;  2WQ4 A;  3R4D B;  2VBD A;  2W46 A;  3Q8F A;  4QXH A;  4UFI A;  4Y1U A;  5KHH A;  3T1L A;  4DIN B;  2HWC 1;  2VUD A;  1WCU A;  4Z92 B;  1QY4 A;  3KZ4 C;  1DP0 A;  4OHX A;  4HPK B;  3RYK A;  2JKB A;  1YQ6 A;  2ZGU A;  2G9F A;  2HYX A;  2VPV A;  3PVN A;  1AYM 1;  4QB1 A;  4UF0 B;  2XGX A;  1QJX 3;  4KGG A;  5FK8 A;  2QQW A;  1LOD A;  5M0T A;  2G1M A;  5I0T A;  3AB0 A;  3S0M A;  1R1Z A;  5FP3 A;  3BTZ A;  1JHJ A;  2C9K A;  3AYD A;  3H1Y A;  4NVP A;  2WFF 2;  1BBT 1;  1D2S A;  1PVC 3;  5FZM A;  3U14 A;  3WW2 A;  1COV 1;  1K3I A;  1ZBA 2;  2XWJ B;  5FXX A;  2VD7 A;  2W39 A;  1OPM A;  2ZGK A;  4EZ4 A;  3KVA A;  1MZE A;  2YB7 A;  4YM1 A;  1BLZ A;  2P3I A;  1KQR A;  1MQT B;  2DVF A;  2R0F A;  2VXJ A;  3FMG A;  2E53 A;  3OD4 A;  4QX2 A;  5F2S A;  3HBK A;  1AR7 1;  4B1L A;  5LK7 B;  1RHI 1;  1VBB 3;  5KHJ A;  2ZGQ A;  3DPR A;  4PBO A;  3OPZ A;  1R08 3;  1HRV 1;  4LIV A;  4HKO A;  4P00 B;  4XUN A;  2QNK A;  2BGO A;  1TNF A;  2WFP A;  1S0G A;  5J96 B;  2XHK A;  1ONA A;  5JIU A;  2VUA A;  1RXG A;  1HRI 2;  2PA7 A;  1PO2 2;  5D8A C;  1BHG A;  1GQP A;  4AEM A;  5FZ8 A;  3NVC A;  1AR6 1;  1R09 1;  4AED B;  3WDY A;  1J3P A;  1RMU 1;  4PHZ A;  4PLM A;  4XOG A;  4XFF A;  2QQV A;  3FX3 A;  4GMP 1;  4P5H A;  1NA1 B;  3P1I A;  4Y4R A;  1ZZ9 A;  2XVG A;  1HKD A;  1NLQ A;  1W8H A;  4IET A;  3J7H A;  4X6R B;  1O4T A;  4CEY A;  4OI4 A;  1W8F A;  1U5Z A;  2Z42 A;  3FLR A;  4AFC A;  4CRQ A;  4XEZ A;  4LE3 A;  2WZP P;  2VME A;  3MIG A;  1ND2 B;  2E32 A;  2AEZ A;  4D0Q A;  3B69 A;  3PUI A;  2RS1 1;  3ETP A;  2WT0 A;  2A6Z A;  4HFS A;  4YM2 A;  2WWU A;  1W9T A;  1RUC 3;  5I0S A;  3AXD A;  5BXX A;  2OQ7 A;  2R16 A;  1VE0 A;  2PHL A;  2ZMN A;  5EZW A;  4COZ A;  2ZHL A;  5A7W A;  4A2U A;  1WUV A;  4BA6 A;  1DGR A;  1CAV A;  5K4L A;  2NP0 A;  3LA3 A;  3WD5 A;  3U1X A;  4BPZ A;  1UYP A;  3EMR A;  5FJK A;  3WP3 A;  2WNU A;  1WA4 A;  1WD4 A;  4XFB A;  2RMU 1;  2QQI A;  5FPB A;  1W8Z A;  1LR5 A;  3GM8 A;  1WKY A;  5BNN C;  5J37 A;  1KFU L;  3KHB A;  2ID4 A;  5JLV A;  2RDN A;  1BVP 1;  3WNK A;  1ASJ 2;  2WZE A;  4P08 A;  1GMM A;  4MYE A;  2XJQ A;  1AJK A;  1HB4 A;  2W1S A;  4YW3 A;  3VKF C;  3DKQ A;  1H6X A;  1W8U A;  1VBA 2;  4XFG A;  4MXW B;  2XML A;  2JXA A;  3LCP A;  2HEY F;  5HV0 A;  1TMF 2;  1ENS A;  3OGS A;  3BIW E;  2VCC A;  4R8H A;  1NCQ A;  2A70 A;  3J7M A;  3QCW A;  3O5S A;  4O61 A;  4XFI A;  2BNN A;  2QQU A;  4Q4X 3;  3FHQ A;  5FPZ A;  2CL2 A;  1OFS A;  1V00 A;  4K8F A;  2C4X A;  5F1R A;  4K6B A;  1O8P A;  2W1Q A;  4YNI A;  2W2I A;  1NCR C;  3WDX A;  2BFU S;  4G9S B;  3B93 A;  2HWD 1;  4JKL A;  5DQ0 A;  1EUT A;  3J7N A;  3T4H B;  2V72 A;  3SQO A;  4YW7 A;  5EPA A;  5CU1 A;  4QQH A;  4YW2 A;  4XJ9 A;  2JX9 A;  1CAU B;  1C5I A;  2XOM A;  3O1V A;  4FPG A;  2A6W A;  2WWS A;  3A22 A;  1BJQ A;  1JZ2 A;  2B46 X;  1HDK A;  4QU2 A;  1SHW B;  2VE1 A;  4KBZ A;  2RM2 3;  3WY6 A;  3DL3 A;  3K4Z A;  4FTE A;  4LO7 A;  1O8S A;  5HCF A;  1UY1 A;  2C0Z A;  4QPI A;  3KV5 A;  2XJV A;  1W6P A;  1SEF A;  1XOY A;  1C28 A;  5FBZ A;  2FDI A;  1F2N A;  4BIF A;  3C7G A;  2XPJ A;  5FPX A;  2D5F A;  4PDW C;  5C7G A;  3HNB M;  3WOG A;  3HMY A;  1APN A;  2FCV A;  2ZX4 A;  4JHZ A;  2WZR 2;  1TME 1;  1VBD 3;  1V9U 1;  3JUU A;  3V0B B;  4LOS A;  1GZC A;  2BW8 A;  3ZMO A;  5L9R A;  5A7N A;  2Q8O A;  3WHU A;  1RUI 2;  3T1M A;  2BEO A;  1WA6 X;  1UYY A;  3IBM A;  2WNV C;  3S30 A;  1BEV 1;  1UAI A;  4LOR A;  4HSL A;  4OZO A;  2RVA A;  5SV5 A;  1IS5 A;  5LK5 A;  2JDN A;  2PHR A;  5EHD A;  3WUD A;  3VZO A;  1R1A 1;  1AYN 2;  1ZBE 3;  4C0B A;  1FPN 2;  4YZ1 A;  2ATF A;  4IEX A;  2YBS A;  2VC9 A;  1DQ2 A;  1DZR A;  3ABZ A;  3MF9 A;  4AFD A;  4C1X A;  1RUD 1;  5FR3 A;  1RUE 1;  3W21 A;  4EWA A;  1ZZ6 A;  2VUJ A;  5LRS A;  2RS5 2;  4YG0 A;  1WME A;  1WW4 A;  3AKR A;  4A6O A;  1Q3E A;  1JTZ X;  1YI7 A;  3KCX A;  4W6W A;  3HNY M;  3BTY A;  4Q1R A;  5H9Q A;  1GU3 A;  5KHK A;  3SHR A;  2Q5T A;  5HCA A;  2JG9 B;  1IQA A;  2BOI A;  2HWC 2;  4HT1 T;  4CEW B;  2BNO A;  2GP5 A;  2Q1F A;  4OI2 A;  1VBC 3;  1WCQ A;  2CV6 A;  4HN1 A;  3ZMN A;  2HBT A;  2JDH A;  4W50 A;  3ZXF A;  5HV4 A;  3AZZ A;  4DEQ A;  5E8A A;  4D6Q A;  1AYM 2;  2HYK A;  1YQC A;  3AZY A;  4JC1 A;  4JHT A;  5FZC A;  1NE6 A;  5DMY A;  3WT3 A;  3ZYH A;  1Z7S 1;  2RJK A;  3WQB A;  1VB2 A;  3ACI A;  3O1T A;  5CYY A;  3CQO A;  4H7L A;  3K48 A;  4IE0 A;  5C3O A;  5A6Z A;  3WCR A;  4ASL A;  2DDU A;  1OUS A;  2HWF 3;  2GH2 A;  2HWB 3;  1BCX A;  4AQ6 A;  2FDF A;  2ZBJ A;  1QOO A;  1AR7 2;  1QMJ A;  2ARA A;  2JIJ A;  2X5I A;  4C0H A;  4HN0 A;  1RHI 2;  1C4R A;  1CPN A;  1HRV 2;  1OLM A;  2OX0 A;  4KMQ A;  4JX0 A;  1V70 A;  4COU A;  4PQ9 A;  3TEY A;  3E6B A;  4MHR A;  1QJE A;  4JGY A;  5TSW A;  3VBH A;  3LFM A;  1UIK A;  1H2M A;  5A3M A;  5KWR A;  1S0B A;  4QKN A;  1OQE A;  4Y1Y A;  1AR6 2;  1OVP A;  2DUQ A;  4XUQ A;  1RMU 2;  2ADE A;  5FZG A;  3RWN A;  2VNO A;  4S2H A;  4XAE A;  2Q30 A;  3I2H A;  1QJY 1;  3ETQ A;  3NQH A;  4FSJ A;  3W9A A;  1GIC A;  1FV2 A;  2Y34 A;  4N7U A;  4SLI A;  5CIR A;  5T5L A;  3ELN A;  5C71 A;  1UY3 A;  5A32 B;  2XWB B;  5FYV A;  1QHD A;  1MS0 A;  4FPK A;  4ZHN A;  1O5L A;  5EP9 A;  2R06 1;  2HJI A;  1UW8 A;  3OOX A;  5FDB A;  2RR1 3;  4BYY A;  5HCH A;  1HQN A;  3I3Q A;  5T52 A;  3I2I A;  3VDD B;  3WF4 A;  2WBK A;  3P3P A;  3WNL A;  1XYN A;  1GNH A;  5BNP C;  2Y6K A;  2RS1 2;  4RL7 A;  4Y20 A;  3CMG A;  5LBC A;  2Y33 A;  1K5M B;  2QJV A;  3AX4 A;  4CCM A;  1O3Q A;  5FYT A;  1XXN A;  4IEW A;  3K2O A;  3UGH A;  3AXE A;  4CDQ B;  2WN2 A;  1XE7 A;  4M3C A;  2WAA A;  4QPW A;  4WVZ A;  4NHK A;  1OVS A;  4WM7 B;  2RMU 2;  1J58 A;  2VZP A;  2G4I A;  4F7Z A;  4YVS A;  2YZ4 A;  4RFT 0;  3T09 A;  1MPX A;  2CWM A;  2W87 A;  2ZAA A;  3I2D A;  4K20 A;  4DUW A;  4RD7 A;  3ZSJ A;  4M0N A;  2D3R A;  1LCL A;  1DGW X;  4CDX C;  5IVE A;  3T30 A;  5FLH A;  1JZ5 A;  2ENR A;  4R9A A;  1PGW 1;  1JZ8 A;  2GMP A;  5FZK A;  2D7F A;  2EVX A;  2GC3 A;  4JKK A;  3WF0 A;  3VBR B;  5JOZ A;  5AC9 1;  2HH9 A;  3PDQ A;  4CXX A;  2R49 A;  4NRP A;  1D0H A;  1WLD A;  2XLA A;  2PLV 1;  1UMZ A;  3KV4 A;  3MID A;  4QB6 A;  4QM9 A;  5FYU A;  1JU3 A;  2A3W A;  2Y60 A;  4GH4 B;  4IE6 A;  5FRA A;  2HWD 2;  4AI8 A;  5C4W A;  3WVJ A;  1OOP A;  1Q43 A;  1MVQ A;  1W8T A;  4ZU7 A;  4P9L A;  1MAC A;  3D5O A;  5FMO L;  3W59 A;  4JVA A;  4YZ5 A;  4P9G A;  4CP0 A;  1US3 A;  1JUI A;  4OI1 A;  2PEL A;  4YGE A;  4OVE A;  4YZ2 A;  1G9F A;  1KEX A;  1KJL A;  3FBY A;  3RRD A;  1UD1 A;  1XSR A;  4CDW B;  4KWL A;  2J1E A;  3QAC A;  5H9S A;  5FUI A;  4RYD A;  2I07 B;  1H9W A;  1FOD 1;  2QUO A;  5LZ6 A;  1QNW A;  3BOW A;  3AFG A;  1XNB A;  1SFY A;  1E5H A;  2B8M A;  4WVW A;  3LGR A;  2ET1 A;  1CES A;  4XDQ A;  4ZZ5 A;  4ONU A;  2JDY A;  2P2K A;  4AW7 A;  3KSC A;  1URX A;  4RGA A;  3VBS B;  5JCT A;  1C3H A;  1TME 2;  1V9U 2;  1LGB A;  4I0W B;  4P02 B;  4P9J A;  4Y22 A;  2ZA9 A;  4YW1 A;  3H3Z A;  1WWY A;  5AVA A;  1QEX A;  2XJU A;  3G7D A;  2FZ1 A;  3NNF A;  3VBU B;  5JI7 A;  4GUL A;  1OUX A;  5LY1 A;  4EJR A;  2D6P A;  3K4A A;  3VL8 A;  4QPY A;  2J1U A;  2EF6 A;  2CHH A;  4FTS A;  4URA A;  4IE7 A;  4K1Y A;  4M4R A;  2Y6G A;  1KRI A;  2GN3 A;  2PHX A;  3I97 A;  1SLC A;  1KDM A;  4UF0 A;  1R1A 2;  4DIQ A;  3JQW A;  3THT A;  1HRI 3;  1OD5 A;  2VTF A;  2L9L A;  3DF0 A;  4B7K A;  4NIH A;  4PI2 A;  1LEC A;  1RUD 2;  4XW3 A;  3OPW A;  5DAP A;  4ZXE A;  1RUE 2;  3QH7 A;  1ULO A;  4UFK A;  4DFS A;  3I2G A;  1PK6 B;  2YUE A;  1CGP A;  3ZPO A;  3SXW A;  4WVV A;  1LHO A;  1Y43 B;  4Y4Y A;  2GND A;  1LRH A;  1MQT A;  4QKF A;  5GZG A;  5ANN A;  1NT0 A;  5EIY B;  1I9R A;  1B35 B;  2FCU A;  4V2V A;  2W5F A;  3OBZ A;  4FVV A;  1TVG A;  5FPL A;  5FYS A;  1YJK A;  3HQR A;  1W3X A;  3MUY 1;  5FV3 A;  3FJS A;  4ISR A;  5A3T A;  1Z7S 2;  3ILR A;  4CYD A;  4OUL A;  4LO4 B;  4LBL A;  3IKW A;  2FDG A;  3POW A;  4KL1 A;  2UWC A;  1SAC A;  5FPA A;  3WP5 A;  5A70 A;  4FQ4 A;  3THD A;  4CA9 A;  4QDS A;  5FCC A;  1NY7 1;  1ASJ 3;  1W6M A;  2GMM A;  1NA1 A;  4PLN A;  3WP6 A;  1W2T A;  4OHZ A;  5FZF A;  4HOO A;  1SLB A;  1E57 A;  4AHX A;  5HPO A;  1VBA 3;  4OCT A;  1VBE 1;  2IZW A;  2R1B A;  2VZ3 A;  3CEW A;  3OGG A;  2YV8 A;  1TMF 3;  3SEE A;  1REE A;  3HN1 A;  3B9C A;  3RDI A;  1DG6 A;  1ND2 A;  2D6O X;  3CO2 A;  4DXT A;  2YC2 A;  3M3Q A;  3RPQ A;  3GXU A;  2ZX0 A;  1OC1 A;  2JD4 A;  4IUG A;  2BNM A;  1ND3 C;  1W2U A;  2QCS B;  4DPN A;  4E4D X;  1NQJ A;  1PMI A;  3LSD A;  3RZL A;  4MOA A;  4O65 A;  1QJY 2;  2ZGM A;  4NJ4 A;  5IK4 A;  1UIJ A;  2BVB A;  5BYN A;  3H8R A;  4IV3 C;  1WBL A;  5GJ6 A;  1H4G A;  2D98 A;  1W0N A;  1JBC A;  2R06 2;  2VW0 A;  4XYX A;  3WDV A;  4I3P A;  3EQE A;  4OMC A;  4AI3 A;  1A34 A;  1YEW A;  4MXW A;  3MHZ A;  3CF6 E;  1GV9 A;  3AM2 A;  4CCJ A;  1O4Z A;  4GZ9 A;  1GUI A;  3I2K A;  4XXP A;  3N4M A;  3BYW A;  4RSU A;  4UW5 A;  1CPM A;  5BNN B;  3L2Y A;  1O3S A;  1PX3 A;  4QM8 A;  3KV9 A;  4HG6 B;  3M3C A;  4RS5 A;  4UFH A;  3EBR A;  4LBK A;  2DFC A;  1IHM A;  4OHY A;  1PM7 A;  5JSO A;  1ENX A;  2YGL A;  5I8Y A;  1X9P A;  1QJU 1;  4IL7 A;  3PUQ A;  5JIA A;  3LEI A;  3PTY A;  3MIC A;  4NHX A;  1HQL A;  4CP9 A;  2JB4 A;  1WMF A;  5D1I A;  4A6S A;  4QT6 A;  3ALQ A;  1G9A A;  1RUN A;  2B5H A;  4NPR A;  5LA2 A;  2DCZ A;  1RUI 3;  4MGZ E;  3NNL A;  4NN0 A;  4YZ4 A;  5DZF A;  4DY5 A;  2NLR A;  1PGW 2;  3NW4 A;  3POG A;  2DWR A;  2P3K A;  1K5J A;  3WQ7 A;  5AC9 2;  2VQU A;  4XF9 A;  3TEZ A;  1J59 A;  3ZN6 B;  1AYN 3;  1HB3 A;  2PLV 2;  1FPN 3;  1NAE A;  4LT5 A;  2WFF 1;  3HN3 A;  4OHW A;  4A42 A;  4XUO A;  1ZBA 1;  2JWP A;  2Q1Z B;  4D7T A;  2ZTN A;  5ABJ B;  4DXS A;  3RZJ A;  3LEM A;  2Z2S B;  3SIS A;  5DN2 A;  3VKL A;  1F4H A;  2RS5 3;  1EV1 1;  4XF1 A;  4FFI A;  4LR4 A;  3CJI A;  2HWE 1;  2VMI A;  5FZ3 A;  1JS9 A;  1O91 A;  2Y6L A;  1W6Q B;  3V0B A;  1M06 G;  4IE5 A;  4XIL A;  3P5B A;  1N1Y A;  3WG4 A;  2HWC 3;  3NKT A;  4CU8 A;  3CL1 A;  1RUF 1;  2W52 A;  4MGS A;  3PLQ A;  5FOJ B;  2BZD A;  1HB2 A;  2WO1 A;  4HKL A;  5FP8 A;  4LIU A;  1O3T A;  1PO2 1;  1AYM 3;  3NJZ A;  1YQ5 A;  1FOD 2;  4XJU A;  3GHN A;  3O0X A;  5A7P A;  4P9W A;  3BVC A;  4XET A;  3AZW A;  4BQ5 A;  1POV 1;  1T6G C;  1QU0 A;  1W03 A;  2DU1 A;  2ZGP A;  4XPV A;  1BBT 3;  1ZRF A;  4AVV A;  1IQD C;  1LOE A;  1CWP A;  3BUC A;  4FPC A;  2VW1 A;  3N7M A;  3FUO A;  4A7Z A;  2YBP A;  3HPN A;  2VEC A;  2OYZ A;  2XL9 A;  5FRE A;  1W28 A;  2ORX A;  4IEZ A;  1AXZ A;  4FO9 A;  3TWI A;  1AR7 3;  2Q8C A;  1IPK A;  2VMH A;  1XYP A;  1Q56 A;  5C3R A;  4RQP B;  1RHI 3;  5FXZ A;  3M1H A;  3MV1 1;  4MXV A;  4CEW A;  1HRV 3;  4J1W A;  4XIK A;  4BQX A;  4AVT A;  4D7Y A;  4PQQ A;  2WIN B;  3V64 A;  5C8C C;  5CZK A;  2C5D A;  4PI0 A;  1UU5 A;  3OEA A;  3IM0 A;  2WLP A;  3LIG A;  5A3O A;  1AR6 3;  3ZFG C;  1MS4 A;  1TE1 B;  2LW8 A;  3WF2 A;  4BZ4 A;  3WNX A;  3RZZ A;  1RMU 3;  2G9Z A;  3OGJ A;  3T2Q A;  2PHF A;  1S4C A;  3WW3 A;  2JDU A;  1GOG A;  1ZRR A;  5HI0 A;  5J98 B;  1PGL 1;  1NXM A;  1YCI A;  4HAN A;  3D3A A;  1DQ0 A;  1PGS A;  2D3S A;  4LIT A;  3A7Q A;  4N9I A;  4A3Z A;  4FAG A;  4GMP 3;  2B7Y A;  5JOW A;  1W06 A;  3B00 A;  3I3M A;  4AHW A;  2JE8 A;  1W0O A;  5D2A A;  3ZDV A;  4CCL A;  3OD0 A;  3H7J A;  3RGB A;  3ZXE A;  5F9T A;  4L9B A;  1UYZ A;  1V6I A;  4XC9 A;  3TNP B;  1IG3 A;  2RJL A;  1SDW A;  2XJR A;  2OZJ A;  2C9A A;  1IS4 A;  2RS1 3;  1RUO A;  4NRM A;  2CY6 A;  2ZZQ A;  3C7E A;  2DV9 A;  1MZ5 A;  3K4D A;  3LDR A;  4R9C A;  5IAT A;  3H3U A;  1V6N A;  1QDC A;  1O6U A;  3PVE A;  5FYB A;  5C5T A;  5K8S A;  1AF9 A;  4COW A;  2GAU A;  1UKR A;  2RMU 3;  2JDM A;  1O4Y A;  3GBG A;  1VLN A;  1NY7 2;  2UU8 A;  1HV1 A;  1LOB A;  5SV8 A;  5JZG C;  2D44 A;  3I59 A;  3ZXG A;  1X8E A;  1WW6 A;  3ZXJ A;  1KJR A;  1SLL A;  4N43 C;  3W5N A;  1DQ6 A;  5LWB A;  1PHM A;  1VBE 2;  2XHN A;  1Y9Q A;  3L2H A;  3VDD A;  3IDB B;  1O7F A;  4E8D A;  3T2T A;  1H8T B;  1SLI A;  4FCA A;  4CDU C;  4LOT A;  3LQC A;  5E16 A;  3TB0 A;  3E6C C;  1FXZ A;  1K5M A;  4AAX A;  2R30 A;  1J83 A;  1J3R A;  2D6M A;  3EB7 A;  4WM8 B;  4BLI A;  3LE0 A;  1D4V B;  2XVK A;  4IV1 C;  2WAB A;  4LBN A;  4Q27 A;  1KXG A;  4CDQ A;  3E5X A;  4LHS A;  4J1X A;  3RWK X;  4KWJ A;  3J8F 1;  4XHX A;  3U0Z A;  2HWD 3;  2EIE A;  3GBW A;  4WM7 A;  5JXG A;  4Z2A A;  5BNP B;  2WZR 1;  3ECQ A;  3LPG A;  1N3O A;  2X53 S;  1AUY A;  2R1D A;  1YXW A;  4MGK E;  4P5Y A;  2OPK A;  3GJA A;  1QKQ A;  1XYO A;  1OA3 A;  4YFW A;  3RJ2 X;  5ANQ A;  4ZY9 A;  2XBO 1;  1ZZB A;  1RC6 A;  2BU9 A;  4AWD A;  1OUR A;  1ULP A;  2PYT A;  1SFN A;  1W3V A;  2A1X A;  2E7Q A;  2YRO A;  2JEM A;  4XAA A;  4DUX A;  1MR5 A;  3P3N A;  5FZD A;  3C7H A;  4ATE A;  3VBR A;  3RZM A;  1FI2 A;  4GB3 1;  1X8M A;  1WW7 A;  3JD7 1;  1UZV A;  1X82 A;  3VZJ A;  3CDZ B;  1H8V A;  3S7I A;  1S1A A;  2GSY A;  3IZO A;  2E51 A;  1QJU 2;  2ZX2 A;  4M0H A;  4CUA A;  4XUT A;  5CFC B;  4BK5 A;  2Y6H A;  4YM3 A;  1WD3 A;  1C8M 1;  2E33 A;  3LDB A;  4QPG B;  1TME 3;  5FZH A;  1V9U 3;  5FZ7 A;  3OCP A;  2RHP A;  2PQS A;  3D82 A;  1GZW B;  4HVO A;  1S0I A;  4JDN A;  1IS6 A;  1W6O B;  2G9G A;  4YYO A;  5F39 A;  4UYB A;  4BM8 A;  3AKP A;  2BWC A;  3DPR C;  4Q1P A;  4Q5O A;  1N47 A;  1VAK A;  4E4S A;  4FAH A;  1BEV 3;  3N3H A;  4AGG A;  2YFZ A;  2XUM A;  1A3K A;  4RA0 A;  3KVB A;  1W6N B;  5K7P A;  3ZFE B;  4CDW A;  2Y6F A;  3ZKU A;  5JR2 A;  2W0X A;  2MEV 1;  4ARY A;  3MLK A;  1R1A 3;  4XQW A;  3HT2 A;  1F15 A;  3IMN A;  5IAV A;  4LO8 A;  1S0D A;  1W0P A;  4GA9 A;  2ILM A;  1N3Q A;  4TZD A;  1RUD 3;  1UNB A;  5JXI A;  5A3N A;  5IFP A;  1RUE 3;  2YYO A;  5FOB B;  1OXC A;  1DFQ A;  1EV1 2;  1PM4 A;  1C8N A;  4D94 A;  1D0G A;  2VAU A;  2HWE 2;  2D5H A;  3AC0 A;  3PIJ A;  5FY1 A;  3FFQ A;  3ZFF B;  2V4A A;  5A6Q A;  5IVF A;  3VBU A;  1IS3 A;  4CEY C;  4GJY A;  4JCK A;  2VUC A;  1RUF 2;  5FTT C;  1D7P M;  3I7D A;  5E1R A;  1I5Z A;  4F83 A;  1VMJ A;  4IEO A;  3AYE A;  3OG2 A;  3POI A;  2DBN A;  3I3E A;  3KQ4 B;  5DAQ A;  2ZGO A;  3ZSE A;  3Q8B A;  3CIH A;  3THC A;  3ZSK A;  3OGR A;  2UUR A;  5A7Q A;  1Z7S 3;  1W2A X;  4KG0 A;  4P9I A;  3B5L B;  5DDJ 2;  2QZ3 A;  2PHD A;  4D6S A;  5CA6 A;  2QTW B;  2WNU C;  4E2G A;  3UJQ A;  1DYP A;  3HWJ A;  3OBR A;  2IVJ A;  2UYA A;  5C9A B;  5CFD B;  1PK6 A;  1C5H A;  4FI9 A;  3ZOI A;  1UQX A;  3HT1 A;  5KR7 A;  5A33 B;  4NR1 A;  1AHS A;  4B7E A;  3N9Q A;  4KWK A;  4CTE A;  1GWK A;  2E7A A;  4UAP A;  2X05 A;  1JOD A;  1CN1 A;  1B35 A;  2AEY A;  5CG8 A;  4TYS A;  4D8M A;  4EN8 B;  1IG0 A;  1LHW A;  2VTX A;  3ASI A;  3M3I A;  5FUP A;  3GNE A;  3AYC A;  1S0J A;  1NCQ C;  2UYB A;  1H6Y A;  4QXB A;  3AP5 A;  4Q4Y 1;  3I2J A;  3A0K A;  2JG8 B;  2E9Q A;  3AKT A;  2DF7 A;  5LAT A;  4GQ7 A;  5FMB A;  3VL9 A;  2AEN A;  2QE3 A;  5F2W A;  2DCT A;  3M3E A;  2BVV A;  2CSG A;  4FPJ A;  4Q4W 1;  4AAP A;  3ZR5 A;  4B4Q A;  1RYY A;  2FBE A;  5J3U A;  2QQP A;  5DUU A;  1PGL 2;  1QJY 3;  2EID A;  2WS9 1;  3ZIW A;  5L19 A;  1EY2 A;  4HMZ A;  3Q8C A;  1DGR N;  4UBH A;  1JH5 A;  5FFO C;  1KS5 A;  2KR2 A;  1J1L A;  2Z79 A;  1JZ3 A;  4FXK B;  3V65 A;  1U5Y A;  2N7G A;  5H9P A;  4ES9 A;  2R06 3;  4ZON A;  2Z4F A;  2VZR A;  5FZO B;  4E8C A;  3NMB A;  4BXS V;  5CKM A;  4JQT A;  3NV2 A;  2VMC A;  4AFM A;  2D40 A;  2BQP A;  3KCC A;  1UOB A;  3VZK A;  4HON A;  4WBB A;  1TEI A;  2E31 A;  2J1T A;  4K3U A;  4AEK A;  5CB7 A;  3CJX A;  3T3Y A;  4QPI C;  2BGC A;  5FQ0 B;  1RUJ 1;  3ZIX A;  3PJQ A;  4AHZ A;  1YC6 1;  2Y8K A;  2KD7 A;  4LEJ A;  4BQ3 A;  3KGL A;  3KQR A;  4EZH A;  4DY3 A;  4IEY A;  2DCJ A;  5F6K A;  5FZI A;  2VZO A;  3BU7 A;  5H9R A;  3WCS A;  4BOW A;  3AMP A;  2BER A;  3WQ1 A;  3ON7 A;  4S2F A;  1CZS A;  4O7X A;  2CDO A;  2JE7 A;  1K12 A;  2ZAC A;  3H3L A;  4OLL A;  5B4X A;  4A7Y A;  2P3J A;  5LA9 A;  4H3W A;  2QZ2 A;  4ZU4 A;  1YJL A;  2LUW A;  2DVA A;  2YC4 A;  4E9K A;  5KC5 A;  3EHK A;  2ZGR A;  4I2O A;  3RQ0 A;  3HAG A;  4HL0 A;  3BU0 A;  1CR7 A;  1LES A;  3LAG A;  4Y26 A;  5FY0 A;  1C1F A;  4BIO A;  4IXL A;  5FLI A;  3INA A;  3ZR6 A;  5AC9 3;  2YPJ A;  1D2Q A;  5AFB A;  2O8Q A;  2PLV 3;  4K8R B;  5HXM A;  3AP9 A;  1LEN A;  1X50 A;  4UXA A;  4B29 A;  3J8F 2;  4PF5 A;  4RR3 B;  2XJS A;  4CUC A;  1NG0 A;  4EN9 B;  2GDF A;  3LEG A;  3JB8 A;  3VBF B;  4M3C F;  3H8U A;  4XFH A;  4DO0 A;  3B9I A;  4LLF A;  1XSQ A;  4H2A A;  5FY5 A;  2EXJ A;  2XBO 2;  4QMA A;  5IHR A;  1IOA A;  2VZS A;  1W39 A;  4AK3 A;  4EE2 A;  1CVN A;  4HET A;  1QQP 1;  5LEJ A;  4XQ4 A;  1H1A A;  1OA4 A;  4CCK A;  2W68 A;  1MS5 A;  1S0F A;  2YY1 A;  3PUH A;  3ZDS A;  2PMW B;  4GB3 2;  1FOD 3;  3JD7 2;  4XF3 A;  1OD3 A;  3BOD A;  4GWM A;  3ZN6 A;  2QDR A;  3KGZ A;  1RUH 1;  4IGP A;  3WNN A;  3ZM8 A;  3ZKY A;  5EJ3 A;  1A78 A;  3GDB A;  1AXY A;  5ABJ A;  3NWK A;  4PBP A;  5A6Y A;  1C8M 2;  1LB2 A;  1OF3 A;  2W1U A;  2VCM A;  5IK8 A;  4CUB A;  1KFX L;  1PMH X;  4AFB A;  4D6R A;  2X5I C;  1GAN A;  5K0U B;  4QGN A;  5IYY A;  1ODN A;  2ARE A;  1W6Q A;  4IEV A;  1PO1 1;  3KT7 A;  3IPV B;  2W94 A;  1VRB A;  3TRS B;  1FNZ A;  1ZRD A;  3MV0 1;  2B39 A;  3C3V A;  4JGY C;  2VXR A;  4NO4 A;  3VBH C;  3T2P A;  2MEV 2;  3T0D A;  3AP7 A;  2IFW A;  3U4X A;  1XU1 A;  4UW3 A;  4FFG A;  5A3L A;  4OI0 A;  1PMJ X;  3I2O A;  4RHV 1;  4MET A;  2GME A;  3ZPY A;  4XE9 A;  5L7O B;  1AX1 A;  3FC0 A;  1W99 A;  3AL6 A;  5FZ4 A;  1V6K A;  4G4F A;  1UOJ A;  1OT5 A;  1YUD A;  2BUK A;  4QQ2 A;  3O1S A;  4Z2W A;  3S5Q A;  5C3P A;  4Q2F A;  3RI9 A;  1X9T A;  5CKQ A;  1QH6 A;  2VH9 A;  3OBT A;  3AL5 A;  3Q8A A;  2YC0 A;  5FIX A;  1I5P A;  1VP6 A;  4RQP A;  2IXC A;  1K42 A;  1XND A;  1I6X A;  2JEN A;  3NNG A;  2C6S A;  2VG9 A;  3KT4 A;  3DXU A;  1F4A A;  5ERL A;  5FZ6 A;  2C26 A;  2RE9 A;  3OY8 A;  4NRQ A;  3WUC A;  1W8W A;  1AL2 1;  2WO2 A;  4HZF A;  4J6G A;  2OKX A;  5A3U A;  4UWD A;  4L2N A;  3D6E A;  4BME A;  1YLL A;  2EAK A;  2PHT A;  3OUI A;  4UFM A;  1JYV A;  3V0A A;  2Z5W A;  4R4Z A;  4YVS C;  1LTE A;  4CU9 A;  3DYM A;  5I0R A;  1ZA4 A;  3RJR A;  1JZ4 A;  5HXV A;  2VNG A;  1CAX B;  1W04 A;  3BAL A;  4K40 A;  4XTP A;  5DUV A;  1LED A;  1LJ7 A;  2I74 A;  3WR0 A;  1G86 A;  3ES4 A;  3ZXD A;  5BNO B;  2WNE A;  1VBE 3;  3WW1 A;  3J9S A;  3O1R A;  4OZX A;  4BWO A;  2ZXQ A;  1U0A A;  4Q4Y 2;  4WVM B;  2YU1 A;  5EV7 A;  1G6N A;  4BK4 A;  5F5I A;  2Y6J A;  4Q4W 2;  1H0B A;  3RZG A;  1NLS A;  4FPO B;  1SPP B;  3R05 A;  1UYX A;  4ES8 A;  3M8L A;  5ACA 1;  5C4W C;  1OOP C;  4FOV A;  4YVW B;  2WS9 2;  3ZYF A;  4N53 B;  3NKG A;  1MS1 A;  2Y38 A;  4L97 A;  2EXK A;  3DXT A;  4HSJ A;  2WA3 A;  3O12 A;  1WMX A;  1L7Q A;  1NZC A;  3I3B A;  3GGL A;  3D8C A;  4TSV A;  1AX2 A;  1H8T A;  3N9M A;  2W08 A;  4XCA A;  4MGQ A;  1RUJ 2;  3IB3 A;  1FMD 1;  3ILF A;  1VRH 1;  4WM8 A;  3VN4 A;  1W2N A;  1YRZ A;  4N43 B;  4RN5 A;  3VKN A;  2ZX3 A;  1FV3 A;  4FPF A;  4M01 A;  4ZS3 A;  3UT0 A;  3B7M A;  1DDL A;  1QJU 3;  3KHC A;  4I0B A;  4CDU B;  4DEV A;  1DGL A;  1C57 A;  1CJD A;  3U10 A;  1V0A A;  4JGZ B;  2VQT A;  3N7J A;  2IUW A;  3K51 A;  4ISQ A;  2V09 A;  4IEU A;  4JTO A;  2A6V A;  4CP1 A;  1GBG A;  2K46 A;  4IV1 B;  4O9G A;  2X10 A;  4QGL A;  2VJX A;  3D4K A;  3O0V A;  5J1X A;  1OKQ A;  4GD4 A;  4FXG B;  1GKB A;  1CD3 G;  1PIV 1;  3VD3 A;  4BH9 A;  2YHJ A;  4AI2 A;  4L99 A;  4JQR A;  2VGD A;  1H4H A;  1DYO A;  3H1M A;  1MZ6 A;  3SCG A;  2RV9 A;  2QQK A;  5FLJ A;  3U4S A;  2WFF 3;  3O0W A;  5T5O A;  4FPL A;  1CIY A;  1ZBA 3;  2TBV A;  5KXC A;  1XNT A;  4YRD A;  2ZEX A;  4LA2 A;  1PZ8 A;  1LHU A;  2F17 A;  1W9W A;  1IKP A;  2WDB A;  1NXD 1;  3HBZ A;  1NYW A;  1EV1 3;  3FUQ A;  3URF A;  2R04 2;  3WXP A;  4GKX A;  3TN9 1;  2HWE 3;  3PL0 A;  4QPG A;  1MQT C;  1X7N A;  2J1S A;  4C91 A;  1JZ6 A;  1XE8 A;  1PNF A;  2LRP A;  4HKW A;  5F5C A;  4HPK A;  3TNQ A;  1RUF 3;  3MIH A;  4QKD A;  3NAP B;  5FXV A;  5GZF A;  1QQP 2;  1REF A;  2ZGT A;  3TYJ A;  2X8K A;  1W9S A;  4CVU A;  2WR9 A;  1ALY A;  1OKO A;  2J1A A;  1PO2 3;  1W6N A;  3MPB A;  3NL1 A;  2ZAH A;  3E97 A;  3ZFE A;  3OEB A;  3PTR B;  1GYK A;  3S5A A;  1NLR A;  3IT8 A;  4ZZ8 A;  1RJ8 A;  1RUH 2;  2WRA A;  5J48 A;  1POV 3;  1W90 A;  5DDJ 3;  2VOX A;  4YLZ A;  1HN1 A;  3FFZ A;  3SCH A;  1MVE A;  2A75 A;  2SBA A;  3RS6 A;  5BY5 A;  2ZJC A;  3LKJ A;  3NJV A;  3C7O A;  4RFR B;  5A3W A;  4BMB A;  3MPP G;  2CNA A;  1NA1 C;  3LSE A;  3PU3 A;  5F8P A;  4NRO A;  1YQ8 A;  3ZFF A;  3G6J B;  2VMF A;  2WO3 A;  5LY2 A;  1PO1 2;  4QU1 A;  1E5S A;  4ORF A;  2V4V A;  4Q0P A;  4XJ8 A;  4AE2 A;  1VIW B;  2B4K A;  2D43 A;  2P3Y A;  5I91 A;  4XIO A;  1ND2 C;  2YU2 A;  2JDP A;  4LKD A;  1GZT A;  2ZZJ A;  3J4U H;  2Q8E A;  5JOY A;  4AED A;  2G19 A;  1LGC A;  4RHV 2;  2LRO A;  3C8X A;  1OHF A;  4Q8L A;  4GAZ A;  3CBN A;  1VBB 2;  3DEM A;  5JR7 B;  1SCR A;  4LBO A;  2E7T A;  2WSU A;  3LOI A;  4QX5 A;  1V6M A;  3KS7 A;  1TQ5 A;  2XJP A;  4FFH A;  1JYW A;  2FDK A;  3KMH A;  1D4M 1;  4LKE A;  5CFD A;  1BYH A;  1QWR A;  5D8A B;  1LHV A;  1LKN A;  5EJ1 B;  2DU0 A;  4LKF A;  4XMA A;  5FYZ A;  4EN0 A;  1SDD B;  4XQD A;  2OQ6 A;  4EV0 A;  4AZZ A;  2B9V A;  1Y9G A;  1DIW A;  1W9F A;  4AGR A;  1YFU A;  5FY8 A;  3EJK A;  4B8E A;  2AC1 A;  1T6B X;  3VBO B;  4HVQ A;  2RS3 1;  5IK7 A;  5JXH A;  3MIB A;  5IUQ A;  4MH0 E;  1LOF C;  2IWG B;  2QBX A;  5EFU A;  4IES A;  1Y4W A;  1LOA A;  2JIC A;  5J36 A;  1H2L A;  3VUO A;  1XPW A;  2WO7 A;  1AL2 2;  2FDJ A;  2ZML A;  4RS5 C;  5GZD A;  2JG8 A;  4AFA A;  3S6P A;  5CIS A;  3LZZ A;  5FKB A;  5FWE A;  4TWT A;  4NOT A;  2ZEW A;  2HEW F;  2FDH A;  1NCQ B;  1A8M A;  1UXZ A;  2Y64 A;  3HD8 B;  2WII B;  2A71 A;  3A21 A;  3K3N A;  2AUY A;  3WDW A;  1Q8P A;  1RUC 2;  1BK0 A;  4YM0 A;  5CG9 A;  1JHN A;  2UWB A;  4OUS A;  1KIT A;  2B45 X;  4TXW A;  5APA A;  2JDK A;  1YFX A;  1OMI A;  2RDS A;  3AMM A;  2XG3 A;  1LOF A;  1WLC A;  5FZO A;  1ZZ8 A;  2X09 A;  4XJZ A;  3HVD A;  2IC1 A;  5FO8 B;  2A7A A;  5T50 A;  3SIT A;  2VBP A;  3ZVX A;  4EWE A;  1QOS A;  5FY4 A;  4FFF A;  1XQN A;  4XFA A;  1VR3 A;  3POS A;  4Y5S A;  5BPX A;  4I30 A;  5FQ0 A;  1UY0 A;  1QF3 A;  4LPL A;  5G05 L;  4ERO A;  5F3G A;  1F9K A;  3CNA A;  1CX1 A;  4FOQ A;  3J8F 3;  1S2E A;  1ZZC A;  4U2A A;  3VKM A;  5ACA 2;  2O0O A;  1DQ5 A;  1C1L A;  2WZR 3;  4CCC A;  1OQ1 A;  5LA1 A;  3CJI C;  2I2S A;  4MLO A;  1CAU A;  3ZSL A;  3PNA A;  4QPI B;  4FBF A;  1Q8O A;  1W6P B;  3UET A;  2P4E A;  1Q8Q A;  1NCR B;  2GNM A;  1SLA A;  4MO3 M;  4CCE A;  2B9U A;  2XBO 3;  2VUL A;  4M4P A;  4QQP A;  4GWN A;  3HEI A;  5GKA C;  1JYN A;  3BTX A;  3GF6 A;  4A45 A;  1ZM1 A;  4V2W A;  3KT1 A;  1JN2 P;  1N1S A;  1NZI A;  3O1M A;  4I0A A;  3N7L A;  2DUO A;  3POJ A;  2D3P A;  5LBB A;  2XLF A;  4K1Z A;  4GB3 3;  1TNR A;  1FMD 2;  1FAY A;  2IXJ A;  4OQ9 A;  3JD7 3;  3SC7 X;  4BHP A;  5A1L A;  1VRH 2;  5JUV A;  2OZ6 A;  4P14 A;  1AR9 1;  3MI8 A;  5FZB A;  2KA3 A;  2VCA A;  2KXL A;  5FZ0 A;  1I3H A;  2R32 A;  3AP4 A;  2ZX1 A;  4HVR A;  4RR3 A;  3LIH A;  4DB5 A;  1N1T A;  1C8M 3;  1WCD J;  3VBF A;  3PVO A;  1UMH A;  3U37 A;  5JPN B;  4LO5 B;  1JUH A;  4NWW A;  1KS4 A;  4I01 A;  3SCF A;  4AVB A;  3VV1 A;  3GJB A;  1RXF A;  3JCI A;  2JG9 C;  3VDC A;  4DS0 A;  5IAX A;  4CEW C;  2DTY A;  2K9Z A;  4PDW B;  4I3G A;  2XR4 A;  2GH8 A;  1PIV 2;  3VB9 A;  3W20 A;  4NMI A;  1SFP A;  5FXW A;  4FOW A;  4AI1 A;  5K9Y A;  2VTX J;  3VD5 A;  2OII A;  4YW4 A;  2EIG A;  2WZ8 A;  4XDO A;  2MEV 3;  3BGA A;  3OBA A;  2GU9 A;  3KF3 A;  5LB6 A;  5DDJ 1;  2VZT A;  4OYU A;  1DZQ A;  2WNV B;  5FY9 A;  5JMO A;  5FZ9 A;  4CPB D;  3MUZ 1;  3FBM A;  5A1A A;  4NAO A;  2O8O A;  5C3Q A;  4QHO A;  2P5B A;  4EN6 B;  3GBF A;  2VL4 A;  2WUH A;  1RIN A;  3ZYP A;  3TN9 2;  1MS3 A;  4OUM A;  3WF3 A;  4C90 A;  3KF5 A;  2JG9 A;  3EO6 A;  3FN9 A;  1LAJ A;  5FYH A;  1UOF A;  5CNA A;  1SG3 A;  5K0U A;  2YFU A;  1Q8S A;  2DVD A;  1KDK A;  4R4X A;  3PME A;  3IPV A;  2OUJ A;  2QVS B;  2VZV A;  3WG2 A;  2ZGN A;  1X36 A;  4FPY A;  3FL7 A;  4YFZ A;  3LDK A;  3B3Q E;  5FZA A;  3GHM A;  2X5I B;  4Q8K A;  1VAV A;  3USU B;  3DV8 A;  5EXO A;  2DUR A;  1MS8 A;  1GP6 A;  1NX9 A;  4W6Y A;  2EXI A;  1AJO A;  1GLH A;  5L7O A;  1XB9 A;  4AR2 A;  5C70 A;  3AVS A;  2BYV E;  2CYF A;  2VR4 A;  1ZVF A;  2WKK A;  1ZRI A;  3BPS A;  3MF6 A;  3TOJ A;  5BUV A;  4AXO A;  4JZR A;  4AL9 A;  1RL3 A;  1G9B A;  1ZZ7 A;  4FPE A;  4Z82 A;  2K2S A;  3VDD C;  3KV6 A;  4IGQ A;  4YG6 A;  5CKN A;  4KBB A;  1IPS A;  2EAL A;  4YZ3 A;  3POE A;  3MZH A;  4KNC A;  4Q0U A;  3ZYJ B;  1JOJ A;  4Q4Y 3;  2QDN A;  4R52 A;  1K5M C;  2TNF A;  4QX8 A;  4QHB A;  1X33 A;  2WYS A;  3JZV A;  1UCX A;  2H0B A;  3L9J T;  2GNT A;  5FPV A;  4Q4W 3;  2JDA A;  5DZG A;  4CDQ C;  3GZU C;  3LFI A;  3WDT A;  2ZAB A;  2O1Q A;  2D6K A;  2RDR A;  1D4M 2;  1WGP A;  4WM7 C;  5F3I A;  5A32 A;  1Z0H A;  4YWA A;  4HK9 A;  2WS9 3;  1YHF A;  3A23 A;  4FOY A;  4RGK A;  4Y20 B;  4XF4 A;  5JXJ A;  2X29 A;  2YGM A;  5FZE A;  3H42 B;  1B09 A;  1BQP A;  2HBU A;  2OXB A;  4KI5 M;  4YGB A;  3MLL A;  1CAX A;  5FP4 A;  4MGI E;  1HW5 A;  1UZ0 A;  1FYU A;  4M3C B;  5A7O A;  3U11 A;  2GC0 A;  5KHG A;  2RS3 2;  4Y5Z 0;  1NOV A;  3VHN A;  2OUH A;  4YW6 A;  4ZPI A;  1CZV A;  1UMI A;  3NO8 A;  3SEP A;  3VBR C;  4WVM A;  1VPH A;  2WAO A;  5FBJ A;  2P37 A;  3FHI B;  4G3Y C;  1RUJ 3;  2P17 A;  1BK1 A;  1ULE A;  2VMG A;  3ACF A;  3MGU A;  3QBQ A;  4NHM A;  5FUN A;  5IFT A;  3HQU A;  2VOV A;  5T54 A;  4LBJ A;  5EYY A;  4XVH A;  1SPP A;  2NMN A;  3K3O A;  3WZ1 A;  2GC2 A;  4YVW A;  4LBQ D;  4ZKT B;  3S7E A;  4M00 A;  2XXZ A;  4N53 A;  2DVB A;  3I54 A;  4PJY A;  3O1O A;  5JVV A;  4N7I A;  4KU7 A;  4LO6 B;  2JB8 A;  4X8N A;  5FK7 A;  2C1F A;  4QXC A;  3A0N A;  1LOC A;  2VOT A;  4L11 A;  1ULF A;  3BIE A;  1VAL A;  2ES3 A;  3U78 A;  2CU5 A;  2XKO A;  1BMV 2;  2BJS A;  4CDW C;  1TZO A;  3EXU A;  3VLB B;  5DAW A;  5JWP A;  4MSV A;  3HJR A;  3FE5 A;  4HXC A;  3R4U A;  4JTN A;  4ASK A;  4C1W A;  4CDX B;  5F37 A;  5D21 A;  4GH4 A;  2OT7 A;  1QXP A;  1F5F A;  4MZU A;  1GR3 A;  3AP6 A;  4X8P A;  4E2S A;  4MGY E;  2QQL A;  4DZG A;  1V6O A;  3ZSM A;  1DYK A;  2VW2 A;  3KD4 A;  3LEK A;  4OQ8 A;  5DAB A;  4KGQ A;  4BQ1 A;  3O14 A;  4B4P A;  1EAH 1;  5F5Q A;  5KC6 A;  2BBV A;  4JGZ A;  3GCX A;  3VBO A;  3VBU C;  1AR8 1;  3N9L A;  2QQJ A;  2ZHM A;  1CAW B;  3VD7 A;  2W9X A;  1G7Y A;  4XMI A;  3U75 A;  1HV0 A;  1SBD A;  3M2M A;  5FKC A;  3B94 A;  1QQP 3;  2HKX A;  1ULD A;  4AVA A;  4Q4V 1;  4LQR A;  3MBW A;  4AG4 A;  2WLQ A;  1YIF A;  3MW2 A;  1JYC A;  5B4N A;  2VZ1 A;  1DQ1 A;  3UK9 A;  2OW4 A;  2WNO A;  2W92 A;  3WV6 A;  1G9D A;  1MZF A;  1RUH 3;  1AR9 2;  3O1U A;  4UT5 A;  1LOG A;  3SKV A;  5DPN A;  2BBA A;  3LD8 A;  1WCS A;  4CUG A;  3VBS A;  5JDB A;  5C3S A;  3VDB A;  1PK6 C;  2AH2 A;  2ZMK A;  3O1P A;  5J09 A;  2A5Z A;  3N9N A;  4XCB A;  5C5U A;  3KB5 A;  3AK0 A;  2XQR A;  4H7M A;  3MDP A;  5GLW A;  4CXW A;  1B35 C;  2W91 A;  1NUK A;  1PO1 3;  3I2F A;  5F5A A;  3JBG 1;  3NAP A;  3IIA A;  5T5J A;  5KXB A;  4XXA A;  1H2N A;  3BKZ A;  4XF0 A;  1JZ7 A;  1GQG A;  2CGO A;  4NWV A;  2W95 A;  3SH4 A;  3PMS A;  3M4F A;  3VZM A;  1PZ9 A;  5F3C A;  4RHV 3;  3ZX7 A;  4DRR A;  2WQZ C;  3WSO A;  4DRV A;  3LOB A;  4M3C E;  1HXS 2;  2GC1 A;  4E4H A;  5CVR A;  1OI6 A;  2VCB A;  2H0V A;  1MEC 1;  5HBA A;  2WA4 A;  1NQD A;  1YO8 A;  1XU2 A;  2K0G A;  3POY A;  2LAL A;  1O59 A;  3TEW A;  3DN7 A;  5FYI A;  4P9X A;  3H50 A;  5GZC A;  5L36 A;  4JAA A;  1YYN A;  1HLC A;  5FZ1 A;  3THP A;  1WBF A;  5KHI A;  3OSD A;  1ST8 A;  3KWV A;  2BP6 A;  2E6V A;  2VZU A;  2VU9 A;  5IVJ A;  3NNM A;  3DUI A;  4GXL A;  2CGN A;  4N8M A;  5FMD A;  4NIG A;  3C7F A;  1AL2 3;  1W6M B;  2AYH A;  2AZ5 A;  2R7E B;  3N35 A;  3UKT A;  5KXD A;  5LRR A;  3PIG A;  5BV6 A;  4NUB A;  2ET7 A;  4AQT A;  3PUA A;  2DTW A;  3AKQ A;  3N9P A;  4AVS A;  2XL7 A;  3PJY A;  1N3P A;  4A7K A;  2VOW A;  4LBM A;  1RUG 1;  3MFC A;  2PHW A;  5D8A A;  1J1T A;  4BQ2 A;  4DQA A;  1VB4 A;  2ARC A;  5LCW L;  3N36 A;  1EPW A;  1NKG A;  3III A;  3VHP A;  2XH6 A;  4COV A;  4EWD A;  4KU8 A;  2JKX A;  4J25 A;  1O5U A;  2Q8D A;  2R07 1;  2SLI A;  1UZW A;  4URT A;  2QFE A;  5LEK A;  1V6L A;  2Y26 A;  1GNZ A;  1RVF 1;  5JOX A;  4EQV A;  2ORZ A;  2ZHN A;  3ME2 A;  1UU6 A;  4B4R A;  1W9Y A;  3RVH A;  4H14 A;  4F8A A;  4PF1 A;  4W8J A;  4XJW A;  5ACA 3;  3E5Q A;  3POB A;  2BTV C;  5FMO S;  4S2D A;  2ARX A;  3C2U A;  3POF A;  5A80 A;  3WG3 A;  1G9C A;  3N9O A;  1ND3 B;  3KLS A;  4RS5 B;  1FNY A;  2ZEY A;  2IXK A;  2F4L A;  5C6C A;  2QQN A;  4QD2 A;  5GLZ A;  3M3O A;  3D0S A;  3VGI A;  2YMZ A;  3LB9 A;  3SH5 A;  1SMV A;  2J7M A;  2W3J A;  5FYC A;  3IDE A;  3ZN4 A;  4P9Y A;  4IV3 B;  1FX5 A;  5BNN A;  5ISL A;  2LM3 A;  3UNP A;  4K9S A;  4CP9 B;  1LU2 A;  4IE4 A;  4TLF A;  1FMD 3;  4LUK A;  4MHU A;  4CCN A;  1VRH 3;  2ZOE B;  3KM5 A;  2PXJ A;  5CFC A;  2YPD A;  1BVV A;  2ZKN A;  3BB6 A;  3VHO A;  5ABJ C;  4XJA A;  2J42 A;  3LA2 A;  2R04 1;  2O14 A;  2DFB A;  2Q0A A;  2VM9 A;  1QXJ A;  2CWS A;  2KM2 A;  5L9V A;  1RB8 G;  1ZX5 A;  5BNQ A;  2DYC A;  4AI9 A;  3JU9 A;  3TBD A;  5IVC A;  3A4U A;  3I49 A;  1U12 A;  1NCR A;  1HIX A;  2EAA A;  2XUE A;  5IWF A;  3UGF A;  2NN8 A;  1H1I A;  1PIV 3;  4MAD A;  1UPI A;  5GAL A;  1POV 0;  2A6X A;  1DLC A;  1HN0 A;  3UGG A;  3CJI B;  4D7S A;  2VQ0 A;  4LKS A;  3W5M A;  4V1P A;  3CZU A;  1A6C A;  4QX7 A;  3H9A A;  3SMH A;  1S0E A;  1E5R A;  2Q4S A;  2UWA A;  4Q29 A;  3IAQ A;  3S57 A;  2D97 A;  2HLE A;  3H7Y A;  3U07 A;  1QJX 1;  3OYW B;  4E2Q A;  5FP9 A;  3P6B A;  1H1M A;  4FT8 A;  1EAH 2;  3PUR A;  4K21 A;  4PCR A;  1W8O A;  3TN9 3;  4K7J A;  4TTG A;  1GQH A;  5FY7 A;  1AR8 2;  2F4P A;  5I8T A;  1PVC 1;  4RQP C;  1DQ4 A;  1NE4 A;  3F95 A;  4PDW A;  2QKD A;  1DZT A;  3VKO A;  5I93 A;  2TEP A;  3I3D A;  4Q4V 2;  4NAM A;  1GOF A;  1XNA A;  4LLO A;  3RZK A;  2WN3 A;  1IPJ A;  3QD6 A;  1UL9 A;  2OS2 A;  3OB8 A;  1VBB 1;  1ZNP A;  1R08 1;  3O7O A;  1LU1 A;  2WNV A;  3FLP A;  3VZN A;  3DYO A;  3AMQ A;  5JSR A;  4Q0Q A;  1S0C A;  2Y0I A;  3BTA A;  4LTA A;  1SBE A;  4QX0 A;  2AR6 A;  4CXY A;  3GZE A;  3CHX A;  4YPJ A;  5GLV A;  2XKP A;  3BN6 A;  3E1F 1;  1UU4 A;  2VVD A;  4A4A A;  1JXN A;  3LA7 A;  5F7U A;  1LNS A;  4MX3 A;  2YDE A;  2JJ6 A;  1BBT 2;  3JBG 2;  4IDZ A;  1Q5O A;  4QDQ A;  3SLI A;  1COV 2;  3WW4 A;  3NV3 A;  5JMC A;  4UFL A;  3R0R A;  2VY0 A;  5FMC A;  5L9B A;  2XB6 C;  2C24 A;  2JE9 A;  2WSV A;  3I4I A;  4LNV A;  2J22 A;  4C8D A;  2MHF A;  4XHB A;  4OUE A;  1AL0 G;  1QH7 A;  4Y24 A;  4BDV B;  2ADD A;  2UY8 A;  3USU A;  1OFN A;  3AZV A;  1JYX A;  1LHN A;  1WMD A;  3R6S A;  5C8C B;  2ARB A;  2OPW A;  3DCQ A;  4FP3 A;  5DXD A;  2R0H A;  2A6Y A;  4PLO A;  4QQO A;  5JI9 A;  1D4M 3;  1MEC 2;  1QIQ A;  4Q26 A;  1YFY A;  3ZYR A;  1RUC 1;  2FHR A;  1CIW A;  5E6H A;  4ASM B;  4ARX A;  5FYM A;  2F6B A;  4LUL A;  3ZFG B;  1CX4 A;  2UY9 A;  4MG2 A;  1V6J A;  4I02 A;  4LUM A;  4BJ0 A;  5T3N A;  1H9P A;  1R09 2;  1RGS A;  2V5D A;  5DAV A;  2RS3 3;  2XJT A;  3TAY A;  1POQ A;  1ZRE A;  4LHN A;  2E63 A;  1W05 A;  1H8T C;  4FQZ A;  4GIQ A;  5J7M A;  2CAV A;  4Q0V A;  2B42 B;  4LHL A;  4OFG A;  3LWC A;  3I59 B;  4WM8 C;  4COY A;  1A8D A;  4JRL A;  1IZ3 A;  4YSF A;  1QXR A;  2P6H A;  3W58 A;  3WDU A;  1OLR A;  1UZY A;  2CTV A;  1AX0 A;  3EYP A;  1RUG 2;  4IGO A;  3DYP A;  2IXL A;  2CGP A;  2OA2 A;  4Q4X 1;  1MS9 A;  4OHV A;  2J1R A;  1YFW A;  5JSP A;  5EWS A;  3NJX A;  3D0J A;  1WW5 A;  5IJR A;  4FTB A;  4YGD A;  1OPO A;  2CAU A;  2R07 2;  4IER A;  1BZW A;  5JZG B;  1ZYB A;  3AMN A;  3JXS A;  5AVP A;  1SLT A;  1UOG A;  2NQY A;  1RVF 2;  3ENR A;  3V56 A;  4LK6 A;  4IW3 A;  2GZW A;  4XAC A;  1GZ9 A;  4NE9 A;  3QLQ A;  2AGS A;  1XRU A;  4GJZ A;  5BNP A;  2RM2 1;  1JOP A;  3T2O A;  3NV1 A;  2VVF A;  4PIX A;  4Q0S A;  2A73 B;  1WLT A;  5CFC C;  4OMD A;  3ES1 A;  3WNM A;  4B1M A;  2ERF A;  4YG3 A;  1OQD A;  4QPG C;  1RED A;  2EIC A;  4I09 A;  4Y33 A;  4AHY A;  4DXR A;  4LBQ B;  4XAB A;  3OF1 A;  1F35 A;  1UPS A;  2BFU L;  2H6B A;  4LK7 A;  1Z78 A;  2P6C A;  3RMX A;  3WNO A;  4CCO A;  1SCS A;  2ZPX A;  4DOU A;  2MPF A;  3ZXA C;  3ACG A;  4ZXK A;  5GLU A;  1OBN A;  1M4W A;  4IEP A;  5IVV A;  1VBD 1;  4ITC A;  4U36 A;  4XUP A;  3ZFE C;  1PNG A;  1Y9M A;  1YQ2 A;  3UJO A;  1UN1 A;  3UKN A;  3FLT A;  4W6X A;  1RTV A;  4CDX A;  2GP3 A;  2YBK A;  2BPA 2;  1JW6 A;  5JPM B;  1AR9 3;  4LHK A;  4KG8 A;  1EP0 A;  1QOT A;  1S2B A;  4CU6 A;  5C8W A;  4AF9 A;  2FCT A;  4R9D A;  2WT1 A;  1ZBE 1;  1LGN A;  1GZW A;  4PIZ A;  4R9B A;  3RMY A;  1W6O A;  2DCK A;  3MIF A;  4WZC A;  3ZXK A;  3GAL A;  3ZFF C;  4FPH A;  2VVE A;  1GWL A;  1RIR A;  5DG1 A;  1CAW A;  1HX6 A;  1UX6 A;  2GNB A;  1AVB A;  4AQS A;  2I45 A;  2LS6 A;  2BWA A;  3HQX A;  4XZU G;  2J1V A;  4QX1 A;  5CAD A;  3OTF A;  5FPU A;  3CU7 A;  4AED C;  3DPR B;  4GMP 0;  3AFK A;  1AXK A;  2V5Y A;  3CKH A;  5LBF A;  5FO9 B;  1VBC 1;  3T0A A;  1F31 A;  1BEV 2;  2PAM A;  3AYA A;  3BCW A;  1HXS 3;  4RGG A;  4QX3 A;  1QGL A;  3VD4 A;  5CFD C;  1ENR A;  4BLJ A;  1QJX 2;  3RSJ A;  5C9A C;  2VQA A;  1GFF 2;  1O3R A;  4JV4 A;  3NST A;  4SBV A;  3K46 A;  2WL1 A;  1DBN A;  2R6Q A;  3LPF A;  1PVC 2;  2RG4 A;  4MGT A;  3ORJ A;  1XC6 A;  2NZ9 A;  3ZO0 B;  5CBL A;  1G8W A;  3JB4 C;  1DHK B;  4X6Q B;  3MW3 A;  3RFR A;  3WG1 A;  2HWF 1;  4PIY A;  2HWB 1;  4CE8 A;  2GAL A;  3M70 A;  1IKQ A;  4WV8 A;  1K45 A;  1XNC A;  4CEY B;  4W4Z A;  2JG8 C;  3OUH A;  4GKY A;  1F8V A;  3GCW A;  3IWZ A;  1R08 2;  1GOH A;  3MLJ A;  1VMF A;  1JYT A;  5IK5 A;  1U5X A;  4BU2 A;  5G04 L;  5C9A A;  4F3J A;  5F6L B;  2DCY A;  4CCD A;  4BQ4 A;  1GSL A;  3IAP A;  4MV2 A;  3X29 B;  4XUR A;  5A33 A;  2JDZ A;  3OJB A;  4ZU5 A;  5A7W B;  4KQ7 A;  1EYB A;  1CAV B;  2V73 A;  5F3E A;  2FMD A;  4BIS A;  1F5J A;  3VD9 A;  2DBI A;  2WNU B;  4QXK A;  5I8S A;  5KBF A;  5LAS A;  4LJH A;  4NII A;  2QQM A;  2FMY A;  3H8O A;  5GM0 A;  2XQX A;  4NIA A;  3SH3 A;  3WEZ A;  3DGT A;  3B01 A;  4EYU A;  4XZP A;  5B2G B;  2ZGS A;  4HBN A;  3H8X A;  2JIG A;  5FP7 A;  2HEV F;  3CZJ A;  4HLT A;  1CZT A;  4AEJ A;  2WJS A;  1XE0 A;  2RR1 1;  2YXS A;  1QDO A;  2ZKL A;  1FT9 A;  1DCS A;  1JYI A;  1W8N A;  4BXF A;  2W1W A; 
#chains in the Genus database with same CATH homology
 3A23 A;  1JZ3 A;  3WF4 A;  3I2I A;  2WBK A;  3WNL A;  2Z4F A;  2VZR A;  4E8C A;  4KI5 M;  2XON A;  4BXS V;  2EIB A;  2Y6K A;  1UZ0 A;  3CMG A;  2VMC A;  4QB2 A;  2E31 A;  2J1T A;  2WN2 A;  2WAA A;  1CZV A;  1UMI A;  4QPW A;  2Y8K A;  2KD7 A;  3SEP A;  2WAO A;  2VZP A;  3ACF A;  1PX4 A;  2DCJ A;  3T09 A;  5IFT A;  2VZO A;  1KGY A;  1MPX A;  2W87 A;  1UWW A;  4DUW A;  2BER A;  4XVH A;  1CZS A;  4GWI A;  2CDO A;  5B4X A;  1K12 A;  3FHA A;  2YC4 A;  1JZ5 A;  1JZ8 A;  4JKK A;  3WF0 A;  1US2 A;  2VOT A;  4DUV A;  3K77 A;  2BGP A;  4QB6 A;  1JU3 A;  5HXM A;  3VDA A;  3HJR A;  2JD9 A;  1T2X A;  1OH4 A;  4CUC A;  3UES A;  1W8N A;  3OGV A;  3LEG A;  1US3 A;  3LEK A;  1KEX A;  5IHR A;  2VZS A;  4KWU A;  2J1E A;  2QQJ A;  3NRU A;  5FUI A;  4RYD A;  3VD7 A;  2W9X A;  3IDA A;  3PUH A;  1OD3 A;  4LQR A;  5EJZ B;  3MBW A;  4AG4 A;  4JKM A;  4ZZ5 A;  3WNN A;  5B4N A;  2VZ1 A;  3HNM A;  3ZM8 A;  2W92 A;  3GDB A;  4P02 B;  1OF3 A;  3SKV A;  2W1U A;  2BBA A;  5DPN A;  4CUB A;  1PMH X;  3VDB A;  3K75 B;  1UX7 A;  2W47 A;  2WQ8 A;  5IYY A;  4QAW A;  3K4A A;  2J1U A;  2W94 A;  4M4R A;  2Y6G A;  2W91 A;  3I97 A;  1NUK A;  1J84 A;  3I2F A;  3MV0 1;  2VTF A;  5LA0 A;  3T2P A;  2L9L A;  3WF1 A;  2YG0 A;  1TG7 A;  3T0D A;  1JZ7 A;  4ZXE A;  1PMJ X;  1ULO A;  2W95 A;  1JI6 A;  3I2G A;  4QDR A;  1W99 A;  2VO5 A;  3WSO A;  1OT5 A;  5EIY B;  2VCB A;  2W5F A;  1TVG A;  1I5P A;  1O59 A;  1K42 A;  1P8J A;  3NNG A;  3MUY 1;  1F4A A;  4PT6 A;  2C26 A;  4CU7 A;  2VZU A;  2WO2 A;  2OKX A;  1UY2 A;  1JU4 A;  3C7F A;  2R7E B;  3THD A;  1JYV A;  4QDS A;  3DEC A;  4UOJ A;  4CU9 A;  3DYM A;  1JZ4 A;  5HPO A;  2VZ3 A;  1UY4 A;  3F2Z A;  3SEE A;  2QQO A;  5LCW L;  3HOB A;  1NKG A;  3III A;  4DXT A;  2ZEZ A;  2YC2 A;  2ZXQ A;  3GXU A;  4IUG A;  2JKX A;  4BK4 A;  4MOA A;  2Y6J A;  4UI9 L;  2ORZ A;  1UYX A;  3T08 A;  4L0P A;  4PF1 A;  4W8J A;  1W0N A;  2CDP A;  4OMC A;  3SKJ E;  4GZ9 A;  1GUI A;  1L7Q A;  3I2K A;  3I3B A;  2ZEY A;  3GGL A;  2QQN A;  1R64 A;  1PX3 A;  4HG6 B;  2J7M A;  2W3J A;  2VZQ A;  1OF4 A;  1EUU A;  2VMD A;  4MGQ A;  3IB3 A;  3UNP A;  4RN5 A;  1UXX X;  3LEI A;  4DEV A;  1GNY A;  2VQT A;  2VM9 A;  5LA2 A;  3ACH A;  2X10 A;  2VJX A;  5J1X A;  2RJ2 A;  1L7R A;  2E26 A;  2VQU A;  5I0D A;  3VD3 A;  3MO4 A;  4GWJ A;  1NAE A;  3HN3 A;  4A42 A;  4MAD A;  1DYO A;  4XUO A;  4A41 A;  4A44 A;  2RV9 A;  2QQK A;  1DLC A;  3T0B A;  4ET7 A;  4DXS A;  1CIY A;  5DN2 A;  1F4H A;  1XNT A;  4LKS A;  3W5M A;  2W46 A;  2ZEX A;  3CZU A;  1W9W A;  2WDB A;  2Y6L A;  1DP0 A;  3IAQ A;  1JZ6 A;  2HLE A;  2J1S A;  4CU8 A;  3P6B A;  4QB1 A;  2HYX A;  4TTG A;  1W8O A;  4MGS A;  2BZD A;  2WO1 A;  4CVU A;  1W9S A;  1JHJ A;  2C9K A;  2J1A A;  1K3I A;  3OEB A;  3I3D A;  1GOF A;  1XNA A;  4ZZ8 A;  1IQD C;  2WN3 A;  2YB7 A;  1HN1 A;  3OB8 A;  4QX2 A;  3HPN A;  2ORX A;  3DYO A;  3NJV A;  3C7O A;  4XUN A;  4P00 B;  4QX0 A;  2BGO A;  3MV1 1;  2VMF A;  2WO3 A;  4YPJ A;  4PQQ A;  3BN6 A;  5CZK A;  3E1F 1;  1BHG A;  1GQP A;  2V4V A;  4A4A A;  5F7U A;  2B4K A;  1LNS A;  3OEA A;  4QDQ A;  2LW8 A;  3WF2 A;  3T2Q A;  1GOG A;  2J22 A;  3C8X A;  4OUE A;  4A3Z A;  3D3A A;  3P1I A;  4BDV B;  3A7Q A;  1JYW A;  1JYX A;  3J7H A;  2JE8 A;  5EJ1 B;  2VME A;  1UYZ A;  2E32 A;  1SDD B;  4D0Q A;  4ARX A;  3PUI A;  2B9V A;  3ETP A;  1W9T A;  4BJ0 A;  5JXH A;  2V5D A;  2QBX A;  3C7E A;  3K4D A;  1XPW A;  2QQI A;  3GM8 A;  1WKY A;  2ID4 A;  3WNK A;  2WZE A;  4P08 A;  1GMM A;  2W1S A;  2ZEW A;  1H6X A;  1UXZ A;  2Y64 A;  3A21 A;  3EYP A;  3W5N A;  3OGS A;  2VCC A;  2XHN A;  3DYP A;  4TXW A;  4E8D A;  3WNP A;  2J1R A;  2X09 A;  3LQC A;  3FHQ A;  2C4X A;  3NJX A;  4AAX A;  1O8P A;  2W1Q A;  1J83 A;  3EB7 A;  3LE0 A;  5IJR A;  2WAB A;  4JKL A;  5DQ0 A;  1EUT A;  4LHS A;  3JXS A;  1UY0 A;  2V72 A;  5G05 L;  4LPL A;  2EIE A;  5JXG A;  4Z2A A;  1CX1 A;  3ECQ A;  3LPG A;  2XOM A;  3A22 A;  4P5Y A;  1JZ2 A;  3T2O A;  5LA1 A;  1SHW B;  4ZY9 A;  4OMD A;  3WNM A;  3UET A;  4DXR A;  4MO3 M;  3K4Z A;  2EIC A;  4M4P A;  1O8S A;  1ULP A;  1UY1 A;  3HEI A;  1JYN A;  4DUX A;  4A45 A;  3C7H A;  3WNO A;  3C7G A;  3ACG A;  5JXJ A;  5C7G A;  3CDZ B;  5JUV A;  3HNB M;  4XUP A;  1YQ2 A;  4CUA A;  4JHZ A;  4XUT A;  4BK5 A;  2VCA A;  2Y6H A;  2E33 A;  2PQS A;  1UYY A;  4CU6 A;  1UMH A;  3U37 A;  4OZO A;  2RVA A;  3VDC A;  2YFZ A;  2DCK A;  5JR2 A;  2VC9 A;  4ARY A;  3VD5 A;  3ABZ A;  2LS6 A;  2WZ8 A;  3OBA A;  3BGA A;  4XZU G;  2VZT A;  4A6O A;  2J1V A;  4OYU A;  4QX1 A;  5JXI A;  5IFP A;  5JMO A;  3MUZ 1;  3HNY M;  5A1A A;  1GU3 A;  3CKH A;  2VL4 A;  3AC0 A;  3T0A A;  2WUH A;  3WF3 A;  4QX3 A;  1WCQ A;  3VD4 A;  3FN9 A;  4W50 A;  1D7P M;  4DEQ A;  1SG3 A;  2YFU A;  3K46 A;  3LPF A;  3OG2 A;  5DMY A;  3I3E A;  3WQB A;  1XC6 A;  2VZV A;  3CIH A;  3THC A;  3OGR A;  3ACI A;  3FL7 A;  5CYY A;  3CQO A;  2DDU A;  1K45 A;  1NX9 A;  4W4Z A;  4FI9 A;  1GOH A;  5C70 A;  2VR4 A;  4KMQ A;  5G04 L;  4JX0 A;  2X05 A;  4UAP A;  3IAP A;  4D8M A;  4XUR A;  3VD9 A;  1H6Y A;  3I2J A;  2QQM A;  4XUQ A;  2XQX A;  3I2H A;  3WEZ A;  3NQH A;  2WYS A;  1RYY A;  5C71 A;  1UY3 A;  3CZJ A;  2JDA A;  2EID A;  1CZT A;  2QQL A;  2W1W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...