2WDBA

A family 32 carbohydrate-binding module, from the mu toxin produced by clostridium perfringens, in complex with beta-d-glcnac-beta(1,2) mannose
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
139
structure length
139
Chain Sequence
b'NPSLIRSESWQVYEGNEANLLDGDDNTGVWYKTLNGDTSLAGEFIGLDLGKEIKLDGIRFVIGKNGGGSSDKWNKFKLEYSLDNESWTTIKEYDKTGAPAGKDVIEESFETPISAKYIRLTNMENINKWLTFSEFAIVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HYALURONOGLUCOSAMINIDASE
publication title N-Acetylglucosamine Recognition by a Family 32 Carbohydrate-Binding Module from Clostridium Perfringens Nagh.
pubmed doi rcsb
source organism Clostridium perfringens
molecule tags Hydrolase
total genus 38
structure length 139
sequence length 139
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.35: Hyaluronoglucosaminidase.
pdb deposition date 2009-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2wdbA00
4RYDA 4P02B 1UXXX 3A23A 4M4PA 1PMHX 2QQOA 3HEIA 2C26A 2WO2A 2VMCA 1SHWB 1F4HA 3WF3A 5B4NA 1JYVA 3WF4A 2HYXA 2VQTA 4LKSA 3T2PA 1CIYA 1O8SA 1XNTA 3I3BA 3SEEA 1UWWA 2C4XA 4A4AA 5HPOA 3I2FA 2VJXA 1K3IA 3VD7A 3GDBA 2VMEA 2E26A 2VZTA 3LE0A 3C7EA 2EIDA 4W8JA 3T2OA 1GOHA 3T09A 2X09A 3UNPA 2WAAA 2W9XA 3HN3A 3I2KA 3HNBM 3CIHA 1HN1A 3BGAA 4OMCA 1JYNA 1EUTA 4RN5A 1JZ2A 2JD9A 5DQ0A 3WNOA 5EIYB 2CDPA 3WNLA 3HNYM 1UMIA 1UY4A 1K12A 4QB6A 2E32A 4MO3M 2W1UA 4PT6A 2ZEWA 1GOFA 2ZEXA 1DYOA 2J1EA 2WUHA 4QX2A 2VCBA 1JU3A 2YG0A 3K4DA 1K42A 3OB8A 4CU8A 2W3JA 2XHNA 4JKMA 4A3ZA 1SG3A 4QX3A 2L9LA 3GXUA 1GMMA 3C8XA 2W92A 4MGQA 2VCCA 3NQHA 3ETPA 2J1AA 4XUPA 3ACHA 3ABZA 4XZUG 2DCKA 3LEGA 1ULOA 2RJ2A 4D8MA 3GGLA 2VCAA 2W91A 2J1SA 4AG4A 2X05A 5JXIA 1GOGA 3HPNA 3T2QA 3SEPA 2B9VA 2EIBA 2W1WA 3ECQA 4BXSV 2W47A 2ORZA 3D3AA 3E1F1 4JHZA 4LPLA 1GUIA 5FUIA 2VZUA 3IB3A 3EYPA 4XUOA 5EJZB 3NJVA 2XQXA 4E8CA 3OG2A 3K46A 3W5MA 1GNYA 1US2A 2Y64A 3U37A 2WQ8A 4QX0A 4DUVA 2W87A 2VZ3A 1UYZA 2VC9A 2WO3A 2VZRA 4CU7A 1OF4A 3IAPA 3K77A 3LEIA 2C9KA 3A21A 1UZ0A 5B4XA 3OGRA 2WZEA 5JR2A 1NUKA 2QQMA 1R64A 5J1XA 2W5FA 3PUHA 1DP0A 4A45A 1EUUA 2JDAA 3I2GA 1US3A 3JXSA 1I5PA 1PX4A 1ULPA 1CX1A 1W8OA 5JXJA 3FHQA 2ZEZA 4QB1A 2BERA 3LQCA 3VD5A 5IHRA 3WNNA 1UYYA 2W95A 4CU9A 1SDDB 4P00B 4Z2AA 2YFUA 4AAXA 5A1AA 4BK4A 1UMHA 3MV11 3THDA 1OT5A 3MUY1 3MUZ1 2KD7A 1W9WA 3OEBA 3C7GA 1UYXA 3WQBA 2WN2A 5DMYA 4ZY9A 1MPXA 1L7QA 3W5NA 2Y6HA 2W46A 3C7FA 2HLEA 4QAWA 2Y6JA 3ZM8A 2B4KA 5DPNA 4BDVB 4OZOA 4MADA 1JZ6A 2QQLA 2ORXA 4GWIA 2EICA 3SKJE 2LS6A 3VD9A 4QX1A 2PQSA 2VR4A 3NNGA 1JYXA 1WKYA 3DYPA 1UY1A 1OF3A 2QQNA 2QQIA 1NAEA 1UY3A 4QDRA 1W0NA 2W94A 3WF2A 5CYYA 3FL7A 4ARYA 2R7EB 4A42A 1K45A 3VDBA 2VL4A 1F4AA 2VZPA 2WAOA 2VZQA 2JKXA 3WNPA 3A7QA 3DECA 2ZXQA 3C7OA 1UXZA 5JXGA 4CUBA 3OGSA 3T0DA 1J83A 1T2XA 3FHAA 3I97A 3ACGA 2OKXA 4MGSA 4KI5M 4ZXEA 4TTGA 4YPJA 4W4ZA 4XVHA 4ET7A 3HOBA 2QQKA 1KGYA 3MO4A 3I2IA 2WDBA 3C7HA 4PF1A 1GU3A 1JZ3A 2YFZA 1JHJA 1H6YA 1UX7A 4BK5A 3CZUA 2BGPA 5IJRA 4ZZ8A 1O8PA 3HJRA 4GZ9A 3IIIA 2VTFA 5G05L 3CMGA 3DYMA 3K4AA 5DN2A 3NJXA 3CKHA 1JYWA 1PMJX 1KEXA 2JE8A 1WCQA 3WF0A 4XUNA 1XPWA 2VZ1A 2Y6LA 4ARXA 4M4RA 3T0AA 1CZVA 1CZTA 4DUXA 1L7RA 3SKVA 3MBWA 5IFPA 2YB7A 1NX9A 1TVGA 4D0QA 3OBAA 4IUGA 1TG7A 1W8NA 3MV01 1OD3A 4JX0A 2WYSA 2Y6GA 4HG6B 2VZOA 5C7GA 1XC6A 2Y6KA 1UY0A 1BHGA 1O59A 1P8JA 3I3EA 2V5DA 2VMDA 1JU4A 3THCA 2WN3A 2RV9A 4LHSA 5CZKA 4UOJA 1RYYA 4DUWA 3DYOA 3ACFA 4OMDA 2VMFA 4UAPA 5IYYA 3LPGA 3OEAA 3T0BA 2LW8A 1W99A 4QB2A 3VD4A 4QPWA 1YQ2A 1GQPA 2J1VA 3WNKA 4KWUA 4BJ0A 2VQUA 2J1RA 4JKKA 2ZEYA 2XOMA 4DXTA 2Y8KA 2WO1A 4KMQA 4P5YA 1NKGA 4OYUA 4P08A 5HXMA 2E33A 4QDSA 3EB7A 3IDAA 1W9TA 2V4VA 3LPFA 3CZJA 1PX3A 4XURA 3CDZB 4XUTA 3UESA 3WNMA 5LA1A 1J84A 2X10A 2W1SA 3I2HA 4OUEA 4CVUA 3LEKA 5C70A 5LA2A 2YC2A 3F2ZA 3CQOA 2E31A 4DXSA 3I3DA 1JZ4A 5EJ1B 2XONA 2J1TA 3BN6A 2BGOA 2CDOA 4LQRA 1XNAA 4MOAA 4DEVA 1H6XA 2VOTA 2VM9A 4A6OA 1IQDC 3P6BA 2ID4A 5LCWL 3UETA 1D7PM 2BBAA 3A22A 5F7UA 1W9SA 2DDUA 4JKLA 2WZ8A 2QQJA 5JXHA 3GM8A 2J1UA 2WABA 1DLCA 1JI6A 4UI9L 4A41A 3NRUA 3WEZA 3HNMA 5C71A 2VZSA 2QBXA 2WBKA 2J7MA 1OH4A 4DEQA 2DCJA 4GWJA 4E8DA 4A44A 2W1QA 4CUCA 3K75B 4FI9A 4TXWA 3PUIA 4L0PA 2V72A 3P1IA 3OGVA 4ZZ5A 5JMOA 4W50A 3FN9A 2J22A 3T08A 3WF1A 5I0DA 2YC4A 3IAQA 3VDCA 4CU6A 5G04L 4PQQA 3AC0A 1CZSA 2VO5A 4QDQA 3WSOA 1JZ5A 1LNSA 2VZVA 3K4ZA 1UY2A 3VDAA 2BZDA 1JZ8A 2RVAA 3VD3A 1JZ7A 3I2JA 3ACIA 5IFTA 4XUQA 3J7HA 2Z4FA 5JUVA 4DXRA 2EIEA 4CUAA 5LA0A
chains in the Genus database with same CATH superfamily
4CDXC 1G6NA 2WZR2 2HWB3 1POV3 5HV0A 4LO6B 4AAPA 4Z8BA 3ON7A 1WW7A 3W21A 1N1YA 1AR92 1H1AA 2EXIA 1PMHX 4M4PA 3H8RA 2K2SA 1DIWA 2QQOA 3ZYFA 3HEIA 4IV1A 4HVRA 5KHHA 1NYWA 3VZOA 3Q8CA 2IXLA 1XU2A 4CTEA 5CFDC 1JW6A 4OQ8A 2FDJA 1DQ2A 2VOVA 1W6QB 1LESA 3W58A 3K2OA 5JVVA 2P3JA 1DYKA 3ZDSA 2VOKA 4XETA 2VQTA 5JZGC 3SCHA 2JEMA 3WW2A 1CIYA 2OX0A 1OKQA 2YBKA 4H3WA 3I3BA 1F8VA 5FYCA 1UX6A 1UWWA 1PM4A 2D7FA 3VKNA 2R6QA 3MF9A 1YCIA 5GALA 4HKOA 1GWKA 4BLIA 4HVQA 1KJLA 3M3IA 3I2FA 1SLBA 5DZGA 5JIAA 4AHWA 4LORA 1QDCA 2Q8OA 4N43C 2Q8CA 3PHMA 3H8XA 2RS33 3VBHC 2LALA 3A0NA 3WP4A 4BQXA 4UFIA 4AQSA 1YO8A 2W9XA 4K20A 4XFFA 3DEMA 2A7AA 3VB9A 5FP9A 1RUJ1 3KF3A 1ULDA 4Q4W2 4JRLA 2PN5A 1QQP2 2ET7A 1MS8A 1Q8SA 3I8TA 4YSFA 3GALA 1EUTA 3V0BB 1D4M3 1GP5A 2JD9A 4YM0A 4YWAA 4CDWC 4FBFA 1PGL1 3KCYA 2QKDA 1T6GC 2VNGA 5FCCA 3O5SA 4AK3A 1UMIA 4QPGB 5CA6A 2Y33A 1UY4A 1VBE2 1AHSA 4A6SA 2CL2A 2W1UA 3NNFA 3PNAA 2MEV3 4WVMB 2R062 5A3WA 2GAUA 5LY2A 5T54A 4EROA 4RR3C 1NQDA 5IW0A 1U0AA 1UQXA 4N53B 2GC1A 2XLFA 5F32A 4MGYE 1W6PB 2ARBA 5FXZA 1NXMA 1MEC3 4JTNA 2D97A 3TB0A 1REFA 1WLDA 1K42A 4BA6A 2P5BA 2Q4SA 4OHVA 4BWOA 2I74A 2C0ZA 4MV2A 5A6QA 3CHXA 2QZ3A 4XMIA 3WY6A 1NLRA 4IV3C 4YGEA 3KT4A 1DYPA 2BNOA 2VVFA 4RQPA 4YGBA 3LAGA 2FZ2A 3RDIA 2RDNA 4WVVA 3PIJA 2L9LA 2VTXJ 1N3OA 4EN7B 1PZ8A 5FMOS 1CAWB 1E5HA 5BNNC 1JODA 4QXHA 5A3UA 1RVF2 4LKDA 3B94A 1VBA1 2X5IA 3B7MA 2J1AA 1PGW1 4OULA 4XUPA 3SHRA 4JVAA 2BEOA 1LULA 1HJFA 1ULOA 4KG8A 4R4ZA 3VBRC 3WHUA 2AR6A 4YW3A 1R092 2IXCA 4F83A 1JUHA 1G9FA 4KGGA 4CCDA 2DWRA 4CEWC 5L7OB 3GCWA 3ILRA 4NO4A 1W05A 2VTXA 3M70A 4V2WA 5C9AB 2ZZQA 2XHKA 5K0UB 2JDPA 1RUH1 4XC9A 1PGSA 2A75A 2VNRA 4NE9A 3FE5A 4Y33A 1EYBA 1GQHA 3U07A 1NT0A 4KNCA 3N9LA 2AENA 3IMMA 5I0UA 3D5OA 2JB4A 2R0HA 1V6KA 1VBB1 3OJBA 1FATA 3T1MA 1ZZ6A 1QH7A 4RFT0 2A70A 3BYWA 1I3HA 4TLGA 1COV3 5F9TA 3ZN5A 1DQ5A 3EXUA 5H9RA 3HQXA 1LODA 4GMP3 1H8VA 2D6MA 3HQRA 4FTEA 5FZAA 1MS9A 4UYBA 5FIXA 3MIEA 5ACA3 1LHOA 1QNYA 5L9VA 3R4SA 3SCFA 2UYBA 3HAGA 4N9HA 3AP9A 2XL7A 3PLQA 1RB8G 1CAVA 4IV1B 1VMFA 4Q1PA 5EWSA 2YXSA 3VDDC 3WCSA 3AFKA 1ENSA 1QGLA 3NNLA 1OFNA 2BOJA 4ZHNA 3VHPA 4WZFA 1FX5A 1F35A 5T3NA 1V6JA 2QQMA 3PU8A 2BW8A 3I4IA 5JOYA 5J1XA 2G4IA 3KF5A 4GMP0 2RM23 3VBSA 4CYDA 4CDQA 3UGGA 3WW4A 1X33A 3OYWB 4EWDA 1QJY1 4YG0A 4LKFA 1NCRB 1US3A 3I2GA 1A34A 2XJUA 1I5PA 3RZJA 5BUVA 1CX1A 3FUOA 1OI6A 2RR13 2W68A 4NHYA 3TOJA 4CCCA 4GWNA 4MUVA 4L99A 5FPAA 3VKFC 3N3HA 2P3YA 2PHWA 3VBFC 1KFUL 1SFPA 2PHTA 1C28A 1UOFA 2D3RA 2IXHA 4P9IA 3VD5A 1FT9A 2F6BA 1RUC2 1DU3D 1EAH2 3O0XA 1PM7A 3PVOA 4CU9A 1E5IA 3FMGA 2BYVE 3MIGA 4YZ4A 4AAXA 3LEMA 4IEQA 5FLIA 1UMHA 3THDA 2JDKA 4XW3A 3DF0A 1NE4A 2VU9A 3J9SA 4GJZA 4C91A 4M00A 4AQ6A 1ULGA 1LB2A 1B35C 1AYM2 3FWEA 5FYVA 4Y1YA 1QIQA 3C7GA 1UYXA 2P3IA 2BWCA 3NAPA 2ATFA 4Q4Y3 2D5FA 2W46A 4QAWA 1EV12 2ZGNA 2BTVC 3WT3A 4BDVB 3KQRA 3LSEA 4OZOA 5TSWA 1HJGA 5FZEA 4FTSA 1S0BA 5A3PA 1JZ6A 2QQLA 4BQ2A 1JN2P 2ORXA 5SV8A 1OA4A 4GWIA 3TNQA 5A32A 4DQAA 1RUF2 1BBT3 2WWJA 2PA7A 4QX1A 3APBA 5L36A 4RQPB 1WKYA 1YQ8A 2YU1A 4EZHA 1OF3A 3IBMA 1OOPA 4AEKA 4TYSA 3GZAA 5FPZA 5JMCA 4OCTA 1PO12 4XILA 1UPIA 4OVEA 4GXLA 3VZMA 2W94A 5JOWA 3HT1A 5CYYA 4NVPA 4ARYA 2R7EB 1R083 1IHMA 1YXWA 3KSCA 3GZTB 3VDBA 5HCHA 4Y20B 1AYN3 5F39A 5CVRA 5FZ0A 1C1FA 2XBO3 3CJIA 4NRQA 3KV9A 2VZQA 4GALA 4LE4A 2JKXA 3WNPA 3A7QA 3RWKX 4QHBA 4CDXA 2GSYA 3OGSA 4IESA 1APNA 2R0FA 5FP8A 2PLV2 3TEZA 4F8AA 2NZ9A 2W2IA 1JS9A 3DUIA 1RJ7A 3KMHA 4OQ9A 4EN9B 3JD73 4KI5M 1HRV1 1CWPA 2RMU2 1WLTA 4K8FA 1DGRA 5GLWA 4ET7A 2QQKA 1KGYA 5FZKA 2FCVA 2C1FA 4ATFA 1UKRA 4HL0A 5FDBA 1WCUA 3I2IA 2DVBA 4ZKTB 1TQ5A 2IFRA 5CFDA 5DDJ2 2WC2A 2VPVA 2VW2A 4BK5A 1W3XA 1WW4A 4GH4C 4XDQA 3AYCA 4W65A 2BGPA 3HVDA 2KA3A 5IJRA 3POYA 2ILMA 3CLPA 5A70A 5AC92 4RHV3 5JZGA 4ZZ8A 4KL1A 1W6MA 1HN0A 5FQ0A 3HJRA 3WQ7A 5GJ6A 1S0CA 3CMGA 5BV6A 2ZHMA 4LA2A 1AR91 1FYUA 1AXYA 5DN2A 3CKHA 4NN0A 3WG2A 1KEXA 3S57A 4N43A 2A6ZA 3WF0A 1J3RA 2VZ1A 1Z78A 5DAWA 5LZ6A 2XG3A 3T0AA 1C8M3 4R4XA 3VBHA 3EQEA 2KM2A 4CRQA 1LU1A 1QJU2 3ZN6A 1AXKA 3RZZA 1HW5A 2RS53 3KV5A 5C8CB 2DFBA 3BTAA 3CEWA 4LNVA 5FOJB 4LMFA 3VKLA 4URAA 4JAAA 5E89A 2YB7A 2OXBA 4L97A 1NX9A 3HBZA 3KM5A 5L73A 3RQ0A 4D0QA 4QKDA 3VBSB 4CDWA 5JSOA 1FOD2 2E6VA 4FAGA 5KC5A 5LK7B 3OBAA 4IUGA 2CGNA 3PIGA 2ENRA 4PF5A 4BB3A 4HG6B 4LIUA 1DQ4A 1S2EA 2VZOA 2WO7A 5BY5A 3KV4A 1GYKA 2Y6KA 4FPFA 4OFGA 5FY0A 5KHJA 1UY0A 5C3QA 5K0UC 1O59A 2Y60A 5SV5A 2GZWA 3I3EA 4RR3A 2VMDA 1JU4A 3THCA 4P9LA 1Q8VA 2Q1ZB 1WUVA 2RV9A 1PIV1 3VV1A 4LHSA 3POWA 5CZKA 1ZM1A 4NJ4A 3BU7A 1QQP1 1GNZA 4R9CA 3UL2A 4JTOA 4FOYA 4ATEA 3OUHA 1MS4A 2PXJA 4L9BA 3OEAA 3T0BA 1OC1A 3RMYA 2LW8A 3ACLA 1OPMA 3NV4A 4QB2A 3IPVA 2QCSB 4UW3A 4MXWA 5IATA 1YQ2A 4N8MA 1V00A 4NIGA 1SMVA 2J1VA 3ZFEC 1GZTA 4URTA 3WNKA 5JSRA 2R061 2VQUA 2BNNA 5LBBA 1LOGA 3V56A 4PBPA 1KFXL 1WA6X 3NAPB 1BQPA 1UZVA 2R32A 3LB9A 4D7YA 3WXPA 1I9RA 1RUD2 4EV0A 2WSUA 1XYPA 4DXTA 2ZCWA 4I01A 5IAVA 1VPHA 1NKGA 1YFYA 2HBUA 4IEYA 3RJRA 3VBRA 4P08A 5BPXA 4NR1A 1GSLA 2WL1A 3C3VA 4UFKA 4QDSA 1H1IA 1X36A 1G9BA 3AZWA 4J1WA 3FFZA 2YBPA 4XCAA 3MIBA 3IDAA 3OPWA 1RUJ2 4XURA 4CEWA 3AYEA 4KBBA 1DZTA 5FYBA 1BLZA 1DLLA 1SEFA 2RS13 3WD5A 1NCRC 1BCXA 1REDA 2OVUA 4B1LA 5FREA 5FYTA 1OOPB 4CCOA 1BZWA 2ZHLA 1LU2A 4CP1A 1STMA 1RVF1 2VW1A 3LEKA 4FFGA 4GB32 4PI2A 4XJUA 4CVUA 4TZDA 1LECA 1UOJA 1PZ7A 2W0XA 2E31A 1OMIA 3CQOA 3NV2A 4AGRA 3NNJA 2HWC2 4CPBD 3LWCA 2Q1FA 5FLHA 3M1HA 1JZ4A 5JPMB 4FPCA 1R091 1RHI3 2J1TA 3HR9A 1AR82 2CDOA 3QH6A 4LQRA 5CADA 4DEVA 2XJSA 4NROA 4FQ4A 3UJOA 4DRRA 5F3IA 1ZRFA 2DBIA 3CJIB 3NNMA 1KRIA 4LE3A 5BNOB 4R9AA 5T5LA 1LOEA 4ZPIA 4OI1A 5GZGA 1IQDC 2ZGOA 4OI4A 3P6BA 2D6KA 3AP6A 2AACA 4XFBA 5I93A 5F5CA 4LTAA 3A22A 1K5JA 2HWF1 4WVZA 2Q30A 3TN91 4J25A 4XEZA 4CDXB 1YIPA 2ADEA 1EPZA 2DDUA 2QQJA 2E7TA 4IEWA 3N7LA 4FPJA 4H2AA 1LHVA 1AL0G 5C8WA 1M4WA 5FP7A 1DLCA 5A3TA 5JSPA 4I09A 5C71A 5BXXA 3W59A 3VDDA 5D21A 5KC6A 4NHKA 4PHZA 1UYPA 5CFDB 4COZA 2GU9A 3RYKA 3W20A 1VBA2 3CBNA 4E8DA 3ZKUA 4UBGA 3WDUA 3NKGA 3K75B 5JZGB 3DXTA 2WWSA 1JYTA 3RI8A 3OGVA 3OOXA 5EPAA 4BHPA 4EWEA 2WR9A 3WF1A 5F3GA 4CU6A 1JH5A 3Q8AA 3VDCA 1RUG2 4QGMA 3VHNA 4N43B 4YFZA 5C3SA 1CPMA 2GN3A 1W9FA 3VBFA 3VBHB 1RUH2 3MIFA 3OY8A 5A33A 1WZXA 4ONUA 2CSGA 3ZN6B 4AI3A 4NWVA 3VDAA 5T5JA 2RVAA 2YGLA 1WCKA 4YG6A 2VNVA 4LUMA 4C0HA 1TME1 3ZFFB 1W39A 3ACIA 1OPOA 1BEV3 5JUVA 4CDWB 3IKWA 1RXGA 4CUAA 3UGFA 3MDPA 2V09A 4P02B 3GCXA 4RYDA 3OPZA 1YUDA 5EJ3A 1UXXX 2P37A 3S6PA 5CFCC 4G4FA 1UAIA 4PCRA 5JOXA 2J42A 5CU1A 1I6XA 4KQ7A 1V6MA 2O0OA 3HQUA 4RR3B 2CY6A 2ZOEB 2Y34A 3A4UA 2AUYA 1RUC1 1EAH1 2D6LX 2XJQA 4XPVA 5FUNA 3PURA 2VMCA 1HXS1 3UKVA 3E6CC 4META 2ZGUA 1Q56A 3M3CA 4HSLA 3N35A 3E5XA 5FZ8A 1ULCA 1ACCA 1HB1A 3KS7A 3MFCA 3R0RA 1JYVA 3S5AA 2H6CA 5L19A 2V4AA 2WWUA 4ZU4A 1A8MA 1O8SA 1TMF3 1AYM1 4P14A 3IPVB 4RGAA 4UW6A 3BKZA 2C4XA 1QJFA 1ZBA3 2Z2SB 1HRI3 1W8TA 4JQTA 2VJXA 4K21A 1Y9MA 3AP7A 2WNUC 3ZYHA 4BLJA 1QY4A 1EV11 1V6OA 2VMHA 2VMEA 2OYZA 3C7EA 1GOHA 1NCQB 3BUCA 4QHZA 5C6CA 4CZSA 3UNPA 3AZXA 4XF4A 5F5QA 2NMNA 3VBRB 4PQ9A 1RUF1 5C8CC 2GMMA 3AYDA 5LRSA 1MQTC 4OMCA 1XOYA 3KCXA 4FP2A 4AVBA 4BXFA 2ZZJA 1JZ2A 1ENXA 1UZYA 5DQ0A 2OZJA 2ZKNA 2WZPP 4Q1RA 3WNLA 3RZLA 1PVXA 3BODA 5A7OA 3WDWA 2NM1A 3ZMOA 4LHKA 1PO11 4BQ5A 3E6BA 3INAA 3VBOA 3DV8A 4D6QA 5EXOA 1J1TA 1K12A 3TRSB 4BCUA 1UF2C 2R073 1FXZA 4LO5B 4MO3M 1QJX1 3ZPOA 4KU7A 4XYXA 1MVEA 1IPSA 1X50A 2DCYA 4CDQC 2DUPA 2P17A 2ZEXA 5LA9A 1QXJA 2QDRA 3LA7A 1OSGA 2F4PA 4GH4A 1IGOA 1JU3A 3IT8A 4E4ZA 2EALA 4W6XA 3PMSA 2VQAA 1GP4A 1RUE2 2XMLA 2R30A 1UW8A 2VCMA 1R1ZA 1F31A 4FO9A 1MZ5A 2PLV1 1U5ZA 4A3ZA 2FDIA 3JZVA 2RMU1 4QGLA 3GXUA 5C5UA 1G86A 3B00A 4FPOB 2VCCA 3ZR5A 4HMZA 2UWCA 3O7OA 1OQEA 1J1LA 2UY8A 5FYMA 3T2TA 2WFF2 3AXDA 2Y0IA 1BBT1 4YVSC 3ZLIA 2QQPA 3VDDB 1W28A 3U14A 1BVP1 1WGPA 2ZHKA 3BPSA 1AVBA 3ITQA 3WNXA 1LHNA 1YHFA 1N3QA 2G9ZA 4PJYA 4C90A 4D8MA 1HIXA 1JOJA 3GGLA 2V73A 4H14A 1IOAA 4Q4V3 4LBJA 5FJHA 1DDLA 3HBKA 1WA4A 3U10A 2FMYA 4QU1A 5BYNA 1XSRA 3ASIA 4XABA 4JGZC 3FC0A 3AMHA 1D0HA 4BXSV 4PI0A 4AVSA 1IS5A 1U5YA 2BNMA 1OOPC 2ORZA 4LR4A 5K0UA 1HB4A 4BMEA 1SBDA 2WZR3 4LPLA 3AZYA 5C3PA 4B1MA 1LENA 1QJU1 1RUI1 3VBFB 5FZOA 3AZVA 5J96B 5DZEA 2VXRA 4V2VA 4BMBA 1UMZA 3OY8B 3EYPA 4XUOA 3O0WA 3NJVA 2XQXA 5B2GB 4M0NA 1O4ZA 2A6YA 5AFEA 4G9SB 4MHRA 3AKPA 1YEWA 1GNYA 1US2A 4Q4X3 4MHUA 4QM8A 5HV4A 1ALYA 3RYRA 4QX0A 1LGBA 1W04A 3PU3A 1UYZA 1XNBA 4XIKA 3BPZA 4CU7A 4DUVA 5BNOC 4ZU7A 5DG2A 2SBAA 5KBFA 4Z1VA 2DFCA 1QOTA 3ZFEA 3A21A 2ZBJA 4MGKE 5FKBA 3J7NA 2QUOA 5IVCA 2V5YA 1UZ0A 2IVJA 2P6CA 5B4XA 4RGGA 3BTXA 3PUQA 1H8TC 1VP6A 3RWNA 2H0VA 5LW9A 1HV1A 1GANA 3BOPA 1KITA 2BP6A 4KWLA 4EYUA 4GWMA 1D2QA 5E8AA 4AI1A 4E2SA 4XQ4A 1S2BA 1Y4WA 1R64A 1Y7BA 2UY9A 4B4RA 1Y43B 3WZ1A 4B4QA 2VY0A 3KB5A 2DTWA 3JQXA 1GQGA 5DUWA 1LCLA 4Q4W3 1W9YA 2F4LA 3OYWA 5LBFA 1ND3C 1NCRA 3OSDA 3ZSEA 1AR73 4SLIA 3BU0A 4MG2A 5F2WA 2FZ1A 3USSA 1A3KA 5IVEA 3POEA 2JDHA 1SLIA 5JXJA 5CG9A 1X8EA 2JWPA 1RUD1 2QNKA 2ZEZA 1XRUA 4BQWA 1VBD3 1X9PA 3V64A 2OA2A 2VULA 1RGSA 3B02A 3WQ0A 4AVTA 1VBE3 4LKEA 4QB1A 1KJRA 1OLMA 2ETEA 3EBRA 1K5MC 4XMAA 2A3WA 4ZS3A 3WNNA 1W2OA 4QQ2A 4P00B 1PIV2 1FMD3 2ZGTA 3H7YA 4B7KA 4Z2AA 3PUAA 5BNQA 2HKXA 5JOZA 5FXXA 3ZFGC 3VBUB 2XPJA 2HWB2 4NAOA 1MR5A 2CTVA 2K46A 2ZGKA 5IUQA 3ZFFC 5CAZA 3GF6A 2ADDA 4XQWA 1W8HA 1XJAA 4GB31 4QPYA 2PAKA 3DKWA 3P3PA 4XFHA 3VBOB 1GNHA 2HWC1 1F2NA 1PVC3 3NV1A 4LBQB 2WN2A 2VAUA 5DMYA 3USUA 2ZAAA 1V0AA 5L9RA 1AR81 3BI3A 4AHZA 4FPHA 3LKJA 3DPRC 2PAEA 5DPNA 5K7PA 2KXLA 1XB9A 3HD8B 2FBEA 4GH4B 3QH7A 4UXAA 3IWZA 4FOVA 2ZMKA 5D1IA 1XU1A 1E5RA 4C1XA 1RMU3 2BRTA 2LS6A 2CGPA 3VD9A 4YW2A 2PQSA 5E1RA 4LK7A 2DTYA 2VR4A 3NNGA 3H7JA 3POIA 4IDZA 3RJ2X 4DOUA 1G9CA 4KWJA 3DYPA 3MW4A 1VBC3 3VGIA 1H0BA 1FNYA 4YW1A 1UY3A 3D8CA 5IVJA 2RS32 3PJYA 5FK8A 3R4DB 1OLRA 1O91A 1W0NA 4PDWC 4NWWA 1CD3G 1GP6A 5GZEA 3ZO0B 2E63A 2YPDA 3LF7A 1W03A 1N47A 2BDRA 5LEKA 3SH4A 2B7YA 4Y1XA 2BOIA 1NCQC 1W2TA 5FV3A 3H42B 1LKNA 4ASMB 4Y20A 1D4M2 3ZSLA 1HB3A 1GZCA 1C8NA 1F4AA 3T4VA 1PO21 5GZFA 1U12A 5JPNB 1RL3A 1EP0A 3VLBB 4OHWA 4ZS2A 5CBLA 3DECA 4KBZA 4Q0SA 1J59A 4CUBA 1RUG1 4DINB 3T0DA 2D5HA 1ZVFA 2MEV2 3O14A 3FHAA 5ANNA 2OKXA 4MGSA 5FMBA 5CFCA 4EN6B 4TTGA 3F95A 4YPJA 1MS0A 2HWF2 3TN92 4XVHA 1MS1A 3O1SA 1DGLA 2GN7A 3KZ4C 2DUQA 3LDKA 3QLQA 3H50A 5FZOB 5DUVA 1LJ7A 3MO4A 1Z7S3 1UD1A 4PF1A 5LATA 5FPUA 1OA3A 1LAJA 2YFZA 1AL23 1JHJA 1VRH3 4U2AA 1QJZA 1IG3A 1GBGA 1G7YA 4GA9A 4AQTA 4IEXA 1X82A 2IXIA 3H0OA 1OHFA 3ZXFA 1O8PA 2IZWA 4GZ9A 5H9PA 3KLSA 1PK6C 2B39A 1AJOA 2NN8A 2VTFA 4ASKA 1QNWA 2Y0OA 1FPN3 2XJRA 3ZFEB 1YQ5A 2WNUA 4XBQA 4Y1VA 1ZRRA 2CNAA 5C4WC 1XPWA 3JBG3 4CCJA 3WUCA 4S2GA 5FZBA 2I2SA 4BYYA 3AP5A 1JOPA 1S0FA 2OT7A 2EXKA 1L7RA 3CO2A 4HT1T 5JLVA 3MBWA 4BOWA 5FPBA 5C8CA 5IFPA 1Q5OA 3AKTA 2R1BA 1B09A 1SDWA 2R043 5FYYA 2QQVA 3I49A 1MQTA 5FY1A 2VUDA 4B8EA 2Q0AA 2QDNA 4I30A 1TME2 2IWGB 2VW0A 3DGTA 1H9PA 3MV01 2A5ZA 2WYSA 2Y6GA 2LTNA 5IWFA 3Q9OA 1XC6A 2HYKA 1N1SA 1JMUB 5BNPB 5FZ7A 3AVSA 2HWE3 4HANA 2JJ6A 2WQZC 1R1A3 3S0MA 1COV2 3UT0A 3BTYA 4K40A 1RITA 4LOSA 2C24A 2XB6C 2Y26A 3ACFA 3DYOA 1HXS2 3G7DA 4JDNA 4OMDA 3ZXDA 3O1RA 1JHNA 3CU7A 3LPGA 3ZYIB 4Q0QA 1GZWA 3ES1A 4QQHA 4QPWA 4A3XA 2ZGQA 4AFAA 5LB6A 1KXGA 4A2UA 4YZ2A 3TEXA 1L7LA 2JXAA 3KHBA 2J1RA 5A7WA 4W6WA 4JKKA 3C2UA 2ZX0A 4YVSA 3USUB 1SPPA 2XOMA 3OBZA 2BWAA 3AXEA 3D6EA 4GKYA 2O14A 2Y8KA 5CKQA 4OHYA 1H2KA 2D6PA 1AR63 3FZ3A 1YQCA 4QKFA 4AOCA 1IS3A 2RM22 1RUE1 1ZBE3 2WS93 2CYFA 1OH3A 3ATGA 5HXMA 5JWPA 2NP0A 5A3NA 1TZOA 1D2SA 1DBNA 2WIIB 5CISA 4IXLA 3IMNA 1UZZA 4XFCA 1V9U3 3N9PA 2PHRA 2V4VA 4D7TA 2RR12 3MI8A 4JGZA 3ENRA 2E9QA 3LOIA 4C0BA 3IZOA 5HI0A 5IAXA 5FK7A 5GLVA 4HKLA 4YW6A 3ZN4A 2ARXA 1ZX5A 2HEYF 2AH2A 4OUEA 1IS4A 2DV9A 4NOTA 1LHUA 2WFF1 2DCTA 1HKDA 2YUEA 5GLZA 3RI9A 4YGCA 5C70A 4QXCA 2ZACA 5FYHA 2JDNA 3SMHA 1CJDA 4K1ZA 5A7NA 2DVAA 1KDKA 3WHTA 5JIUA 4NIIA 3N4MA 3K3NA 1QJX2 3PTRB 4QHOA 3POFA 1DF0A 2B46X 4EWAA 5IK8A 4MOAA 3WP6A 4QMAA 2Y6FA 2DUOA 4I3PA 2VOTA 1WCDJ 1S0DA 5DDJ3 1AXZA 2D93A 2VM9A 4Z92B 5BNOA 4A6OA 1ZREA 1CR7A 1GZ9A 1PNFA 3VBUC 4COWA 4Z82A 2ID4A 3U1XA 5AC93 3UETA 1C4RA 2IFWA 2MHFA 4FPLA 1F5FA 2JENA 4ES9A 4JKLA 1AUYA 1D4VB 3E5QA 5F8PA 4Q4Y2 5HCBA 5CFCB 4LT5A 2XLGA 3DL3A 4XF1A 4UBHA 1BK1A 1GWMA 3POGA 5AVPA 3VBOC 1H8TA 2EAAA 5ISLA 3ILNA 4AZZA 3AMPA 3PTYA 2D3SA 1RINA 2BV4A 2Q1MA 4UI9L 1OA2A 4GAZA 3HNMA 3LFMA 3D82A 4XBNA 4GIQA 2IUWA 3GBFA 5EFUA 2PAMA 4CEYC 4DEQA 3U0ZA 1BBT2 2BQPA 2XUEA 2DF7A 3GHNA 4GWJA 2ET1A 4G3YC 5EYXA 3G6JB 3LOBA 4FI9A 1ASJ3 4TXWA 2HWD3 1W6OB 4ZXKA 4MGTA 4PIZA 4HPKA 1DHKB 4LLOA 4MLOA 1ND3A 2I45A 4M3CF 2ZX4A 3CJXA 4W50A 2J22A 1SBEA 3ROUA 5I0DA 1CIWA 2WINB 3AJYA 1FOD3 2D3PA 4JQRA 3M7AA 3FLTA 2WNUB 1EPWA 1QOOA 1R082 1CZSA 4QDQA 1MS5A 4QX7A 1AYN2 2VGDA 3J8F3 3MF6A 3JUUA 4S2HA 4Q27A 2VZVA 1JZ5A 3FBMA 2XBO2 2XDVA 4LBOA 2PMWB 1K5MA 2VG9A 1RUI2 2CV6A 1HDKA 5FMCA 5FY8A 4XAAA 1L3JA 3WG1A 1YIFA 3VHOA 1MQTB 3RS6A 3K51A 3ZFGA 4AHYA 1SLLA 1UIKA 5CIRA 3ZFFA 1VMJA 2JECA 3J7HA 2JD4A 3ZYGA 3O1TA 5FUPA 3JD72 2EIEA 4R8HA 5FMDA 5LA0A 2ZGPA 5K4LA 4LO7A 1QHDA 3A0KA 2UWAA 3KVAA 3H3UA 2K0GA 1SBFA 1VB4A 4JV4A 3LDBA 3A23A 4OI2A 4K8RB 1AX1A 4Y1ZA 4AGGA 3K3OA 4LK6A 4MGIE 1WMXA 2C26A 1ZZ8A 2AGSA 3N7JA 3DPRA 2SLIA 4I0AA 5FR3A 1OUSA 1Q8PA 4RHV2 1F4HA 2YGMA 4PLNA 3WF3A 1X8MA 5HCAA 5FZGA 2R49A 2CU5A 4QKBA 1XE8A 2HWB1 1POV1 5LWBA 1XSQA 1LGCA 3HN1A 3WINE 4YM2A 3I2OA 3ZOIA 3T2PA 4L2NA 3MW3A 4R52A 4RFRB 2YROA 2GH2A 1XNTA 1GZWB 5LRRA 1N3PA 3RNSA 4JRAA 2OPKA 4NPMA 3SC7X 3SEEA 5K9YA 3MLKA 4LHNA 4P9YA 1RUJ3 4A4AA 4K9SA 1C8M2 1TNFA 1K3IA 1Y9GA 1S0EA 5J36A 4PDWA 3VD7A 4YRDA 5A7WB 1OLME 2RS52 1TEIA 2VZTA 3LE0A 4YVSB 2EIDA 1ODMA 1PZ9A 4FOQA 1SPPB 4W8JA 4RD7A 5A3LA 1NCQA 2WT0A 3SQOA 1CESA 2C5DA 2X09A 3T09A 2WAAA 3KVBA 5DAVA 5HCFA 3HN3A 1TNRA 3HNBM 3MFAA 3CIHA 3IDCB 5DABA 3DKQA 4CXYA 1JYNA 2FDKA 4RN5A 3P5BA 2D44A 3I3QA 3WNOA 5EIYB 4JGZB 4UFLA 2QFEA 3HMYA 5JDBA 1G8WA 2OZ6A 2HBTA 2RS31 3HNYM 4XJ8A 2ZMLA 1LOBA 3PVNA 4ORFA 2UWBA 3TEWA 2B42B 4EZ4A 5I91A 4QB6A 2XXZA 2E32A 2LROA 4TSVA 4I0WB 5T52A 1DQ0A 4K1YA 4IEPA 4K6BA 4PT6A 5FZHA 4CDUC 2ZEWA 3MW2A 2E7AA 5BNPC 1GOFA 1D4M1 1ODNA 2A1XA 2J1EA 4MX3A 4QX2A 2VCBA 3K4DA 5HXVA 3R4UA 4M3CA 2BJSA 1J58A 4AEMA 1CN1A 5LBEA 2YHJA 2VVEA 4CU8A 2UU8A 1JOBA 2XHNA 1ZRIA 4JC1A 1PK6A 4B4PA 2MEV1 3RVHA 1O5LA 2OQ7A 1UN1A 1NLQA 4QX3A 1S4CA 2JE7A 3ZYPA 1MEC1 3I3MA 5C4WA 2BBVA 4LITA 5J37A 2QVSB 1C3HA 1GV9A 1H8TB 4ISRA 4KWKA 4XDOA 3PVEA 2EIGA 1A78A 3ETPA 1S2KA 4IE4A 1N1VA 1H9WA 1OURA 2P3KA 1CQ9A 2ZX2A 1VBC1 3LEGA 1RUH3 2RJ2A 1NY72 1WLWA 1YQ6A 4HFSA 3WDYA 4UFHA 2J1SA 2RS12 2GNDA 2ZGSA 4M0HA 4XFAA 2FCTA 2F17A 1SLAA 5DAXA 5J98B 4AG4A 3HPNA 4HPKB 4X6RB 1BKZA 1ND3B 1PO22 2DU1A 4P9JA 1VBB3 2EIBA 2W1WA 1VLNA 2W52A 2D40A 4FFHA 1W6NA 4LULA 3J4UH 4IGOA 3U11A 5FYUA 2WNEA 2W47A 1VAMA 3Q8EA 3NSTA 1XQNA 4JHZA 5E88A 3QACA 1RHI2 3KGLA 1NZIA 2WQ4A 1ZZ7A 1GUIA 2E53A 1Q3EA 2X53S 2YMZA 5FYIA 3ZR6A 1QXRA 4UT5A 1WMEA 1K5MB 3RFRA 4QT6A 5EJZB 2BPA2 4OLLA 4OI0A 1C1LA 5A6ZA 3K46A 4JGYA 4QQOA 4YGDA 3W5MA 1VB2A 1ZA4A 3JU9A 3ZFGB 2Y64A 5DUUA 4IL7A 2P34A 4PIYA 4YNIA 3ZXLA 2ES3A 2WO3A 4NAMA 1NE6A 2VZRA 2GDFA 3BIEA 4ZU5A 3ZXAC 3K77A 3LEIA 2GH8A 5I8SA 3VHRA 4B7EA 2MNGA 4IEZA 3ZXGA 2BFUL 4DB5A 2PHXA 3RZKA 2OW4A 1CONA 3SITA 1QJY3 2FHRA 1COV1 3AJZA 5KR7A 5A6YA 1UO9A 3GZEA 1Z0HA 3DPRB 4IEOA 5JR2A 4MVTA 4GMP1 2WNOA 3ILFA 1NUKA 5GLUA 4D94A 1Q43A 3MLLA 4HN0A 3MLJA 1POQA 2P2KA 2DVFA 2W5FA 4WV8A 5FZCA 5ACA1 4HVOA 5GKAC 4A45A 1WD3A 2BVVA 2ARCA 2XWJB 4E2GA 2JDAA 2GALA 3WQ1A 3JXSA 4BZ4A 2XH6A 1DCSA 2ZHNA 5FMOL 1NXD1 1IZ3A 1CAUB 4GQ7A 4AFMA 2BU9A 4KU8A 5LK5A 5KXEA 1W8OA 3BALA 1ZRCA 2VOXA 4PDWB 3NMBA 5I8TA 4Y5TA 5CKMA 2WLQA 1SACA 5A6XA 4XHXA 2BERA 2RM21 3LQCA 1ENQA 3DN7A 5FP3A 1OQDA 2WNVC 1KS4A 4A7YA 1H4HA 1CJPA 1C5IA 2PHDA 3AX4A 3Q8FA 5J48A 2QQUA 1BEV2 3W9AA 2W95A 2ZMNA 2JDZA 4PLMA 4RA0A 3R6SA 1W3VA 3ALQA 2RR11 1CGPA 2WA3A 4BK4A 3WW1A 3OD0A 3URFA 3KT7A 3VBUA 4CE8A 4XTPA 3MUY1 4WM8A 4H55A 2W39A 3MUZ1 4AWDA 4COUA 1NZCA 1HX6A 2E7QA 2DBNA 3OEBA 3M3QA 3WP3A 1KQRA 4X6QB 4DFSA 4AE2A 3WQBA 2G9GA 3TYJA 4FCAA 1W90A 4LBQA 2YDEA 1ONAA 4HBNA 3C7FA 2HLEA 3ZM8A 2Y6JA 2B4KA 4CEYA 4HONA 4MADA 4O9EA 1XNCA 3VZLA 1TMF2 3SXWA 4XF0A 1OQ1A 4M3CB 3AFGA 3EMRA 3OPTA 5DG1A 4DPNA 1ZBA2 2EICA 3SKJE 3ZIXA 4XIOA 1HRI2 3RZGA 2WT1A 1PK6B 2G19A 3VKOA 3THPA 2C9AA 4Q4Y1 2JIGA 1UY1A 5KXCA 2D43A 2XR4A 2B45X 1NOVA 2QQIA 2QQNA 2VH9A 1NAEA 1F9KA 1YNAA 1ND2B 1URXA 5A3MA 2XJTA 5C4WB 3H9AA 3POBA 4UF0A 3IIAA 2ERFA 1MZFA 1JBCA 5FBJA 2WLPA 3RSJA 2VQ0A 1JYIA 4XDPA 2CWMA 1HRV3 4YFWA 1W2NA 1ZZCA 2JG8C 3ES4A 1RXFA 5GM0A 3TBDA 5KHKA 2VL4A 3NWKA 4HSJA 2Z5WA 4Y1UA 1VRBA 2D6NA 4LXLA 3FUQA 1H2NA 4E4HA 1VAVA 3AB0A 4AI9A 2ZXQA 3I2DA 1RC6A 3C7OA 5JXGA 1BVVA 1PMIA 1X9TA 3ZMNA 1J83A 1WWYA 1W6NB 2TBVA 3ACGA 1R081 4J1XA 4ZXEA 1AYN1 2XVKA 4W4ZA 1ST8A 3POSA 1H30A 2XBO1 2ZS6B 5IK7A 4TLFA 1QKQA 3KQ4B 5D8AB 1AR93 4CPBA 1GU3A 4JDOA 4AI8A 4Q8KA 1H6YA 5A1FA 1UX7A 4JGYB 2UYAA 2YV8A 4A7KA 5FY5A 5JAXA 2JX9A 3JD71 4QPIB 3QD6A 1AX0A 1DZQA 3OGGA 2JG9B 2ARAA 2E51A 2LRPA 2IXKA 1SFYA 4FXGB 2ZGMA 1O4TA 4LEJA 3IIIA 3PL0A 5EV7A 4P9XA 4YW4A 2O8QA 1WW6A 4L8QA 1SLCA 4CCMA 3GJAA 3LZZA 5I0TA 2JICA 3MZHA 1LOFC 1OUXA 2JE8A 4AVCA 2Y38A 4BH9A 4XF3A 4ARXA 2YPJA 2Y6LA 2QJVA 4ITCA 4ES8A 1LEMA 1NQJA 4FXKB 4H7MA 4M4RA 4XFIA 2H0BA 5KXDA 4RHV1 3LD8A 4ZONA 1CZVA 1CZTA 3EO6A 5FYSA 1NA1C 1O5UA 2D98A 2PELA 4Q8LA 4Y3OA 2IVIB 3RMXA 4LBNA 2HJIA 1MS3A 5FY7A 5A7PA 5AVAA 1TVGA 4HK9A 4ISQA 3AVRA 4B3NA 5IT6A 3B5LB 2Z79A 3LCPA 3T1LA 1PIV3 4FAHA 4RS5C 1C8M1 5LY1A 2Z69A 1OKOA 1QQP3 2OUJA 3OUJA 1OD3A 4I02A 3IN9A 5FZDA 4I0BA 4AFDA 4BISA 3K48A 2OQ6A 4WM7B 2RS51 4CP0A 5C7GA 3H3ZA 5ABJC 1GKBA 2VOWA 2AZ5A 5IVVA 5J3UA 1BHGA 3N9NA 4XXPA 5FTTC 4CDUA 5BNPA 4E2QA 4Y5Z0 2V5DA 5FZIA 1OD5A 2EAKA 2P4EA 1W8ZA 3ELNA 4EN0A 5J09A 1VR3A 4Q4X2 3ME2A 2XJVA 3MPBA 4QX5A 4UOJA 1RYYA 2R063 3THTA 4YW7A 1IPJA 4DUWA 4O9GA 2VMFA 4UAPA 2N7GA 5FO8B 4CP9B 5IVFA 4BIFA 4C1WA 3M3EA 1ENRA 3BB6A 3KGZA 3ZVXA 3VD4A 1POV0 4WM8B 1YFWA 3RGBA 1RUNA 4COYA 3L2YA 3AYAA 1GQPA 4D69A 1ZZBA 3EJKA 4CUGA 3E6DA 2XGXA 5KHIA 5T50A 3ZXJA 4Y26A 2ZEYA 2RJLA 4W6YA 3ZIWA 2K9ZA 3LA3A 1WW5A 2WO1A 3WDVA 4CEYB 4P5YA 5GZDA 4OYUA 3TWIA 1RVF3 1ZZ9A 4QD2A 4QQLA 4XXAA 2DURA 4IGPA 3D4KA 1WBFA 4LBMA 3WVJA 3BIWE 1U5IA 3JB4C 1AR72 4XHBA 1AX2A 3JQWA 3ORJA 4LIVA 4XUTA 5FWEA 3CDZB 4HN1A 1R093 1S0JA 4BQ1A 3T30A 4WBBA 1LGNA 1VBD2 4Y4YA 4LUKA 1J84A 3E97A 2X10A 1HB2A 3F2ZA 2BFUS 4UF0B 1IKPA 1DGRN 4CSWA 3JB8A 4DXSA 4NRPA 3TN93 2HWF3 1AF9A 5FO7B 5EJ1B 1FMD2 1CAXA 3JCIA 1NY71 5DAQA 5EZWA 5L9BA 3UKTA 4NHXA 2XONA 4M3CE 3UYJA 2RS11 2BGOA 3BN6A 5CG8A 1XNAA 5F6LB 1S0GA 3OD4A 1H6XA 4CCEA 1RIRA 3UGHA 2YY1A 3FJSA 3GZUC 5FXWA 3LA2A 5EQUA 1C5HA 1O3RA 4IE7A 4OZXA 1S0IA 1M06G 3DXUA 1PVC2 5F7UA 5KHGA 1G9AA 1I1EA 1QWRA 2QZ2A 2WZ8A 1HLCA 4IQPA 1RHI1 2Q5TA 3GM8A 4M01A 4QU2A 2WABA 4DRVA 2EVXA 2XVGA 4A41A 5CKNA 3NRUA 4MH0E 3VZKA 1GFF2 1MEC2 2XJPA 3WEZA 4GJYA 4DNYA 2QBXA 1SQ4A 2J7MA 1OH4A 3O1PA 3T4HB 1RMU2 2DCJA 4DY5A 1BMV2 1BXHA 2A3YA 3AK0A 1VMHA 4YM1A 2W1QA 4YYOA 1VBC2 3PUIA 2D6OX 2MPFA 4FP3A 1W6OA 2GC3A 4L0PA 3WV6A 2O1QA 4ZZ5A 4YVWC 2P6HA 2WFPA 3FN9A 3T08A 4GKXA 4EN8B 1ZNPA 5T5PA 3IAQA 1VJ2A 1TME3 2GP5A 2GMPA 2Q8EA 3MIHA 1ND2C 3IM0A 3J7MA 3AMQA 2JDMA 2TUNA 1LNSA 1VE0A 3WX5A 2WNVA 5FOBB 3B9IA 3S5QA 3M3OA 3K4ZA 4JDMA 2YYOA 1UY2A 3CF6E 2BZDA 4CXWA 1KD7A 2DU0A 4Q29A 4EE2A 4N7UA 1WMFA 4Y22B 3V0AA 2VVDA 3VD3A 1ZRDA 3MIDA 3N9QA 1RUC3 1EAH3 2Z4FA 4XUQA 4DXRA 2QTWB 1HXS3 2GC2A 4K7JA 5ERLA 5GZCA 2WA4A 1LOAA 5FZMA 1QOSA 3ZXEA 4LJHA 1Z7S2 4UW5A 3ZX7A 2NQYA 4P9WA 1AYM3 4AFBA 1AL22 4CDUB 1VRH2 5FY9A 5GLTA 5T55A 2WO2A 4ASLA 1BEV1 1DG6A 1YC61 2AC1A 4XJ9A 5D8AC 1X7NA 1SHWB 4GD4A 4XACA 4O61A 5A1LA 5B4NA 5JI9A 2XWBB 4DY3A 3DCQA 4MSVA 1EV13 3RYPA 4JGYC 5C3RA 3J26N 5F2SA 3WF4A 2HYXA 3ZSMA 3B93A 4LKSA 1FPN2 4OUMA 4QPIC 1RUOA 4FTBA 1UU6A 4R9DA 2JG9C 2KR2A 2OUHA 4AVAA 1QJEA 5ACA2 2VUCA 1W0OA 3FX3A 4LO4B 1RUF3 1H2MA 3JBG2 4D7SA 2FD8A 3WW3A 5HPOA 2DVDA 5A80A 2IC1A 2VUAA 1XXNA 2PHLA 3GBWA 3GDBA 3H1YA 3GJBA 1Q8OA 2E26A 3LFIA 4SBVA 1CX4A 2ZX3A 3T2OA 4LO8A 4BPZA 2R042 4AEDC 4DZGA 4AXOA 5KXBA 1XE0A 1PO13 4YLZA 3WCRA 1QXPA 1TMF1 4CP2A 2JG8A 4FFIA 3I2KA 4H7LA 1ZBA1 5I0RA 1QJX3 1BK0A 2LUWA 1HRI1 4QXBA 4AR2A 4AYUA 2FQPA 1HN1A 2GNBA 1DFQA 1O4YA 3BGAA 1HQLA 4XJAA 4INDA 2VNOA 4QX8A 4NRMA 1T6BX 2CDPA 5DAPA 4COVA 1RTVA 4N7IA 2HWE2 2ZGRA 1XNKA 4N9IA 3VN4A 4PIXA 4AHXA 1R1A2 4WM7C 2ZX1A 2PLV3 3O1OA 3H8UA 4UWDA 2RMU3 4XJWA 4CCNA 1CAXB 2WRAA 4KG0A 1DYOA 2YC0A 3H1WA 3FHIB 3M2MA 2WUHA 1RJ8A 3UJQA 2VBDA 2YG0A 1WD4A 4IGQA 3OB8A 3VL8A 5KWRA 1XYNA 2W3JA 3O0VA 3RRDA 5EYYA 1BJQA 2R071 2RE9A 3CL1A 4RSUA 4JKMA 2DVGA 1H4GA 2DYCA 3KT1A 5D2AA 4NIDA 1SG3A 5K8SA 1JTZX 2AEYA 4WM8C 3I54A 5FJKA 5F37A 4N90A 2CGOA 2WYFA 4XBLA 1GMMA 3C8XA 1LOFA 2W92A 4MGQA 4O65A 2GNMA 3IDEA 1CVNA 3NQHA 2DCZA 1AR62 1UZWA 2XQRA 2CAVA 3ZSKA 1FI2A 5FXVA 1ZBE2 2AEZA 2WS92 2X5IB 2XVLA 3KWVA 4LLFA 4XOGA 4XZPA 2CAUA 4CCKA 1NA1A 3ACHA 3AP4A 3ABZA 4XZUG 2DCKA 1V9U2 1S55A 4NIHA 1SCRA 2HEVF 2VCAA 2W91A 3PMEA 1QJU3 1RUI3 1XBFA 1V70A 3NO8A 1S1AA 2X05A 5JXIA 1GOGA 2QQWA 4RS5A 3T2QA 3WOGA 3SEPA 2B9VA 3ECQA 1DQ1A 5F6KA 5HBAA 2BUKA 3B69A 2JB8A 1YYNA 3NW4A 3WDXA 2PHFA 3O12A 4QPGC 2VMIA 5ABJA 5C5TA 3D3AA 3E1F1 5DUXA 2PHUA 2ZPXA 3OUIA 4QKNA 1ZA7A 3M4FA 1LRHA 4Q4V1 2XKOA 5C33A 1YI9A 2ZAHA 5FUIA 2I07B 2VZUA 3IB3A 4TN7A 2WNVB 4NMIA 3UV9A 4N53C 1UU4A 3MHZA 4YARA 4E8CA 1HQWA 2BGCA 1MACA 3OG2A 2CWSA 1J3QA 2LM3A 5FPLA 4BE3A 1W06A 2EF6A 4Q0UA 4YZ3A 4E4DX 3RZMA 4NHMA 4IE0A 1GR3A 2ZABA 4IEVA 1Q8QA 3I59A 3U37A 3V0AB 1ULEA 2GMEA 2WQ8A 3D0JA 2W87A 2VZ3A 2VC9A 2WZR1 2HH9A 3LGRA 3U78A 3RG0A 1OF4A 4D6RA 5C3OA 4AEJA 2OS2A 3IAPA 3S7IA 1YFXA 2R16A 1UNBA 3LSDA 2C9KA 1W8FA 2QE3A 3KHCA 5CB7A 1W0PA 4NPLA 3LDRA 3OGRA 4Q5OA 4FPEA 5FYZA 4TWTA 4D3WA 1VIWB 5FZLA 1YJKA 4YG3A 3VKMA 1CAVB 2G9FA 4Q4X1 4DMIA 4LA3A 2WZEA 4UFMA 4AGVA 4DXZA 1ASJ2 3OBTA 2HWD2 1WLCA 1RUD3 2PYTA 2VMGA 5A3OA 1HV0A 3PUHA 1SZBA 1H2LA 1YRZA 5FAXA 4CDQB 1DP0A 1EUUA 3O1VA 3OGJA 4LOTA 5L7OC 2A3XA 1PX4A 4OHZA 5FPXA 1ULPA 4LBQD 5JCTA 3J8F2 1FV2A 2VBBA 4NUBA 4AVVA 2FDGA 1CAUA 3BOWA 3OTFA 3N7KA 2AREA 4BQ4A 4YM3A 5C9AC 1C57A 1WMDA 5FZ1A 3N7MA 4D6SA 3FHQA 1UKGA 3R05A 3SH5A 2VBPA 1AZDA 4Q26A 3SH3A 3NKTA 4GB33 3WP5A 3HT2A 1LHWA 4CA9A 4Z07A 2WKKA 4HXCA 4LBKA 4Q4W1 4Y4RA 5IHRA 1XYOA 2JG8B 4FQZA 1UYYA 2HWC3 1SDDB 1AR71 1QF3A 4IV3A 2JIJA 3H8OA 2YFUA 3NV3A 5A1AA 1E5SA 4JZRA 1AR83 3MV11 3SLIA 2RHPA 1OT5A 2H6BA 1VBD1 3B3QE 4KGQA 5F5IA 3SISA 1MVQA 4XAEA 3POJA 1VBE1 4U36A 3BCWA 2A71A 2KD7A 3J7LA 1UPSA 1YWKA 3EHKA 4S2FA 1W9WA 5F3EA 1YLLA 5BNNA 1QH6A 4ZY9A 2CHHA 1FMD1 2TNFA 1MPXA 1L7QA 4XFGA 2Y6HA 3W5NA 3ETQA 1QDOA 4IV1C 3GHMA 1UU5A 4FSJA 4MYEA 1QMJA 4JHTA 5A32B 3V65A 4HKWA 4YZ1A 3ZYBA 1VBA3 1PVC1 2PTMA 4YVWA 2OIIA 3FBYA 1JYXA 2W08A 5ANQA 1PGL2 3AMMA 4QDRA 1PO23 1ND2A 5FP4A 2EA7A 2RDSA 2ZJCA 2UURA 2GC0A 3WF2A 2JDYA 1E57A 5FRAA 1CPNA 1RUG3 1BMV1 1RMU1 2NMOA 3FL7A 4A42A 4I2OA 1K45A 1NA1B 1ULFA 3FLPA 4K3UA 2R1DA 1W2UA 3GBGA 4Q0VA 2VZPA 2WAOA 5FFOC 5JI7A 1JUIA 2NYYA 4XTMA 3MICA 2WSVA 4O7XA 5I0SA 1W8WA 3N9MA 3RZHA 4RS5B 5H9QA 1F5JA 1JXNA 1UXZA 5DXDA 2A6WA 5EP9A 3O1MA 1J3PA 1DGWA 3OF1A 4HETA 1T2XA 3I97A 1V6NA 4HOOA 5FKCA 3RPQA 1W2AX 5E16A 1V6IA 4AFCA 4HLTA 5ABJB 3U4XA 4IE5A 4R9BA 3VUOA 2X8KA 3HOBA 1YJLA 5EHDA 1WCSA 1MZEA 1Y3TA 4Z2WA 3U4SA 1OVSA 1UIJA 2WDBA 1OLQA 3C7HA 4IW3A 5D8AA 4QGNA 1OVPA 4J6GA 1PHMA 4MGZE 1DZRA 1JZ3A 2HEWF 3ST7A 1PGW2 4XQDA 3N36A 4XJZA 1FV3A 1GWLA 1NG0A 1UCXA 3CZUA 3VZJA 3UK9A 1O3SA 5FO9B 2FDFA 1V6LA 1W6MB 3I59B 3ZSJA 5FQ0B 4QPIA 4DIQA 4LBLA 2JG9A 2C6SA 3AKRA 4RQPC 5G05L 3ZKYA 4EQVA 4F3JA 3DYMA 4NHLA 5FZFA 4QQPA 1Z7S1 3K4AA 3T3YA 5CEHA 3PJQA 4IE6A 2A6VA 3I7DA 3NJXA 4JCKA 3AL6A 1PMJX 4FVVA 1JYWA 3SNMA 1AL21 3TEYA 1VRH1 1WCQA 2EXJA 3MEPA 3MGUA 1YFUA 4XUNA 5T5OA 4CCLA 4GULA 3FLRA 4UW4A 4NIAA 3OBRA 5F5AA 4AEDA 2BVBA 3GYDA 2X5IC 2PQQA 1U5XA 3B9CA 5DZFA 3WG4A 4DUXA 3SKVA 3PDQA 4OHXA 4BQYA 4WZCA 1FPN1 2RG4A 4Y5SA 5FBZA 4A7ZA 2Z42A 4QM9A 1VBB2 1DGWX 4IEUA 4DS0A 1F15A 3M8LA 5FWJA 1N1TA 1KS5A 5A7QA 1A8DA 1XE7A 5J7MA 4I3GA 4FPGA 3JBG1 1TG7A 1B35A 2O8OA 1W8NA 3AM2A 4XE9A 5LEJA 3ZYJB 2VE1A 4JX0A 2P1BA 2TEPA 5CNAA 1GICA 4YW5A 2IXJA 4X8PA 3ZDVA 2RJKA 4WM7A 3L9JT 3MYXA 2R041 3AKSA 4PLOA 3BTZA 1P8JA 4XF9A 5IK4A 2OPWA 1GLHA 1UOGA 2FMDA 2RDQA 5FLJA 4RGKA 1REEA 2A6XA 2WN3A 3NVCA 1FNZA 4NPRA 1HQNA 3D0SA 3H1MA 4F7ZA 4AF9A 1W6QA 3ZPYA 2JKBA 2JDUA 4X8NA 4IV3B 3WG3A 4WVWA 4P9GA 5FZ4A 4DO0A 4AQ2A 1LTEA 4CP9A 5IYYA 1H1MA 2XL9A 2EXHA 4YZ5A 3VL9A 1SLTA 1W99A 3H3LA 2HWE1 3SCGA 3NL1A 4MXWB 1FAYA 1RUE3 3MPPG 1R1A1 1I5ZA 1QJY2 5E6HA 4KWUA 1LEDA 3WDTA 3P3NA 4BJ0A 5BNNB 1LR5A 4QWNA 1OBNA 3PVBB 5LASA 2A73B 2XUMA 4HK8A 2GP3A 4AW7A 4BIOA 5F1RA 2VD7A 2G1MA 2ZGLA 1A6CA 4XCBA 4KMQA 2X29A 3TNPB 4E9KA 4OUSA 4Q0PA 2WFF3 3FFQA 4L92A 3ZXKA 4V1PA 1LOCA 2E33A 3IDBB 5A7SA 5M0TA 5APAA 3X29B 4UFJA 4FOWA 3EB7A 1IG0A 4CEWB 3V0BA 1W9TA 3LPFA 4FPYA 3CZJA 1PX3A 2B5HA 4YVWB 3UESA 3VBSC 3VZNA 1NLSA 3E5UA 3WNMA 4FPKA 4AL9A 2RDRA 5LA1A 1YI7A 4Q2FA 4BQ3A 1AR61 2W1SA 3NJYA 3I2HA 4QPGA 2VXJA 5LA2A 1ZBE1 2WS91 2YC2A 4WVMA 3AL5A 3LIGA 5H9SA 1QU0A 1O3QA 1KDMA 3I3DA 1W8UA 4N53A 1V9U1 1IQAA 1W6PA 4LHLA 4P5HA 1EY2A 4KH9A 3PUSA 2PFWA 3L2HA 5JR7B 3OCPA 4C8DA 3WUDA 1IKQA 1ZYBA 4RL7A 2FCUA 2YU2A 5FZ9A 5IVBA 1VAKA 3AMNA 4E27A 3B01A 4BM8A 1UL9A 2GNTA 1SCSA 1PNGA 2ZA9A 3AZZA 4L11A 4BU2A 4E4SA 5LCWL 1OFSA 1VALA 1D7PM 2BBAA 1BYHA 1SFNA 3KV6A 1W9SA 2VECA 3S30A 2B8MA 2R072 5FZ6A 5JXHA 5FY4A 4IETA 1XNDA 4PBOA 5AFBA 3ZYRA 3WR0A 2J1UA 5FZ3A 2YBSA 1AJKA 1CAWA 2WT2A 5LBCA 4AI0A 3QOPA 1JI6A 3NAPC 3WLUA 5DDJ1 3TAYA 2ZTNA 3N9OA 3QBQA 2VUJA 2VZSA 3U75A 2WBKA 4EJRA 5AC91 3GNEA 4FFFA 4IERA 4S2DA 3O1UA 3HIFA 5F3CA 3AKQA 4A44A 2JE9A 1IPKA 1G9DA 3BVCA 1OXCA 4CUCA 2YZ4A 4CXXA 5I8YA 2FDHA 2V72A 3Q8BA 1WBLA 3P1IA 2AYHA 1IS6A 4Y24A 5JMOA 5IK5A 5L7OA 1O7FA 2XKPA 3HWJA 3LIHA 4MXVA 2YC4A 3UKNA 5C9AA 4FT8A 2NPIA 3QCWA 4HZFA 1Y9QA 4QXKA 5G04L 4PQQA 3KCCA 3AC0A 2VO5A 1HRV2 2WJSA 3WSOA 4AI2A 1ASJ1 4AEDB 2HWD1 2XLAA 4MZUA 3S7EA 5A33B 4Q4V2 1O3TA 1TE1B 1UOBA 5IVYA 1JZ8A 2Q8DA 3CNAA 1O6UA 1FOD1 2B9UA 1QEXA 2ZKLA 1MZ6A 3CJIC 1JZ7A 4Y22A 2NLRA 3I2JA 4B29A 1JYCA 5IFTA 3KD4A 1D0GA 1DQ6A 3J8F1 3NJZA 1B35B 5FPVA
chains in the Genus database with same CATH topology
4RYDA 4P02B 1UXXX 3A23A 4M4PA 1PMHX 2QQOA 3HEIA 2C26A 2WO2A 2VMCA 1SHWB 1F4HA 3WF3A 5B4NA 1JYVA 3WF4A 2HYXA 2VQTA 4LKSA 3T2PA 1CIYA 1O8SA 1XNTA 3I3BA 3SEEA 1UWWA 2C4XA 4A4AA 5HPOA 3I2FA 2VJXA 1K3IA 3VD7A 3GDBA 2VMEA 2E26A 2VZTA 3LE0A 3C7EA 2EIDA 4W8JA 3T2OA 1GOHA 3T09A 2X09A 3UNPA 2WAAA 2W9XA 3HN3A 3I2KA 3HNBM 3CIHA 1HN1A 3BGAA 4OMCA 1JYNA 1EUTA 4RN5A 1JZ2A 2JD9A 5DQ0A 3WNOA 5EIYB 2CDPA 3WNLA 3HNYM 1UMIA 1UY4A 1K12A 4QB6A 2E32A 4MO3M 2W1UA 4PT6A 2ZEWA 1GOFA 2ZEXA 1DYOA 2J1EA 2WUHA 4QX2A 2VCBA 1JU3A 2YG0A 3K4DA 1K42A 3OB8A 4CU8A 2W3JA 2XHNA 4JKMA 4A3ZA 1SG3A 4QX3A 2L9LA 3GXUA 1GMMA 3C8XA 2W92A 4MGQA 2VCCA 3NQHA 3ETPA 2J1AA 4XUPA 3ACHA 3ABZA 4XZUG 2DCKA 3LEGA 1ULOA 2RJ2A 4D8MA 3GGLA 2VCAA 2W91A 2J1SA 4AG4A 2X05A 5JXIA 1GOGA 3HPNA 3T2QA 3SEPA 2B9VA 2EIBA 2W1WA 3ECQA 4BXSV 2W47A 2ORZA 3D3AA 3E1F1 4JHZA 4LPLA 1GUIA 5FUIA 2VZUA 3IB3A 3EYPA 4XUOA 5EJZB 3NJVA 2XQXA 4E8CA 3OG2A 3K46A 3W5MA 1GNYA 1US2A 2Y64A 3U37A 2WQ8A 4QX0A 4DUVA 2W87A 2VZ3A 1UYZA 2VC9A 2WO3A 2VZRA 4CU7A 1OF4A 3IAPA 3K77A 3LEIA 2C9KA 3A21A 1UZ0A 5B4XA 3OGRA 2WZEA 5JR2A 1NUKA 2QQMA 1R64A 5J1XA 2W5FA 3PUHA 1DP0A 4A45A 1EUUA 2JDAA 3I2GA 1US3A 3JXSA 1I5PA 1PX4A 1ULPA 1CX1A 1W8OA 5JXJA 3FHQA 2ZEZA 4QB1A 2BERA 3LQCA 3VD5A 5IHRA 3WNNA 1UYYA 2W95A 4CU9A 1SDDB 4P00B 4Z2AA 2YFUA 4AAXA 5A1AA 4BK4A 1UMHA 3MV11 3THDA 1OT5A 3MUY1 3MUZ1 2KD7A 1W9WA 3OEBA 3C7GA 1UYXA 3WQBA 2WN2A 5DMYA 4ZY9A 1MPXA 1L7QA 3W5NA 2Y6HA 2W46A 3C7FA 2HLEA 4QAWA 2Y6JA 3ZM8A 2B4KA 5DPNA 4BDVB 4OZOA 4MADA 1JZ6A 2QQLA 2ORXA 4GWIA 2EICA 3SKJE 2LS6A 3VD9A 4QX1A 2PQSA 2VR4A 3NNGA 1JYXA 1WKYA 3DYPA 1UY1A 1OF3A 2QQNA 2QQIA 1NAEA 1UY3A 4QDRA 1W0NA 2W94A 3WF2A 5CYYA 3FL7A 4ARYA 2R7EB 4A42A 1K45A 3VDBA 2VL4A 1F4AA 2VZPA 2WAOA 2VZQA 2JKXA 3WNPA 3A7QA 3DECA 2ZXQA 3C7OA 1UXZA 5JXGA 4CUBA 3OGSA 3T0DA 1J83A 1T2XA 3FHAA 3I97A 3ACGA 2OKXA 4MGSA 4KI5M 4ZXEA 4TTGA 4YPJA 4W4ZA 4XVHA 4ET7A 3HOBA 2QQKA 1KGYA 3MO4A 3I2IA 2WDBA 3C7HA 4PF1A 1GU3A 1JZ3A 2YFZA 1JHJA 1H6YA 1UX7A 4BK5A 3CZUA 2BGPA 5IJRA 4ZZ8A 1O8PA 3HJRA 4GZ9A 3IIIA 2VTFA 5G05L 3CMGA 3DYMA 3K4AA 5DN2A 3NJXA 3CKHA 1JYWA 1PMJX 1KEXA 2JE8A 1WCQA 3WF0A 4XUNA 1XPWA 2VZ1A 2Y6LA 4ARXA 4M4RA 3T0AA 1CZVA 1CZTA 4DUXA 1L7RA 3SKVA 3MBWA 5IFPA 2YB7A 1NX9A 1TVGA 4D0QA 3OBAA 4IUGA 1TG7A 1W8NA 3MV01 1OD3A 4JX0A 2WYSA 2Y6GA 4HG6B 2VZOA 5C7GA 1XC6A 2Y6KA 1UY0A 1BHGA 1O59A 1P8JA 3I3EA 2V5DA 2VMDA 1JU4A 3THCA 2WN3A 2RV9A 4LHSA 5CZKA 4UOJA 1RYYA 4DUWA 3DYOA 3ACFA 4OMDA 2VMFA 4UAPA 5IYYA 3LPGA 3OEAA 3T0BA 2LW8A 1W99A 4QB2A 3VD4A 4QPWA 1YQ2A 1GQPA 2J1VA 3WNKA 4KWUA 4BJ0A 2VQUA 2J1RA 4JKKA 2ZEYA 2XOMA 4DXTA 2Y8KA 2WO1A 4KMQA 4P5YA 1NKGA 4OYUA 4P08A 5HXMA 2E33A 4QDSA 3EB7A 3IDAA 1W9TA 2V4VA 3LPFA 3CZJA 1PX3A 4XURA 3CDZB 4XUTA 3UESA 3WNMA 5LA1A 1J84A 2X10A 2W1SA 3I2HA 4OUEA 4CVUA 3LEKA 5C70A 5LA2A 2YC2A 3F2ZA 3CQOA 2E31A 4DXSA 3I3DA 1JZ4A 5EJ1B 2XONA 2J1TA 3BN6A 2BGOA 2CDOA 4LQRA 1XNAA 4MOAA 4DEVA 1H6XA 2VOTA 2VM9A 4A6OA 1IQDC 3P6BA 2ID4A 5LCWL 3UETA 1D7PM 2BBAA 3A22A 5F7UA 1W9SA 2DDUA 4JKLA 2WZ8A 2QQJA 5JXHA 3GM8A 2J1UA 2WABA 1DLCA 1JI6A 4UI9L 4A41A 3NRUA 3WEZA 3HNMA 5C71A 2VZSA 2QBXA 2WBKA 2J7MA 1OH4A 4DEQA 2DCJA 4GWJA 4E8DA 4A44A 2W1QA 4CUCA 3K75B 4FI9A 4TXWA 3PUIA 4L0PA 2V72A 3P1IA 3OGVA 4ZZ5A 5JMOA 4W50A 3FN9A 2J22A 3T08A 3WF1A 5I0DA 2YC4A 3IAQA 3VDCA 4CU6A 5G04L 4PQQA 3AC0A 1CZSA 2VO5A 4QDQA 3WSOA 1JZ5A 1LNSA 2VZVA 3K4ZA 1UY2A 3VDAA 2BZDA 1JZ8A 2RVAA 3VD3A 1JZ7A 3I2JA 3ACIA 5IFTA 4XUQA 3J7HA 2Z4FA 5JUVA 4DXRA 2EIEA 4CUAA 5LA0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RYD A;  4P02 B;  1UXX X;  3A23 A;  4M4P A;  1PMH X;  2QQO A;  3HEI A;  2C26 A;  2WO2 A;  2VMC A;  1SHW B;  1F4H A;  3WF3 A;  5B4N A;  1JYV A;  3WF4 A;  2HYX A;  2VQT A;  4LKS A;  3T2P A;  1CIY A;  1O8S A;  1XNT A;  3I3B A;  3SEE A;  1UWW A;  2C4X A;  4A4A A;  5HPO A;  3I2F A;  2VJX A;  1K3I A;  3VD7 A;  3GDB A;  2VME A;  2E26 A;  2VZT A;  3LE0 A;  3C7E A;  2EID A;  4W8J A;  3T2O A;  1GOH A;  3T09 A;  2X09 A;  3UNP A;  2WAA A;  2W9X A;  3HN3 A;  3I2K A;  3HNB M;  3CIH A;  1HN1 A;  3BGA A;  4OMC A;  1JYN A;  1EUT A;  4RN5 A;  1JZ2 A;  2JD9 A;  5DQ0 A;  3WNO A;  5EIY B;  2CDP A;  3WNL A;  3HNY M;  1UMI A;  1UY4 A;  1K12 A;  4QB6 A;  2E32 A;  4MO3 M;  2W1U A;  4PT6 A;  2ZEW A;  1GOF A;  2ZEX A;  1DYO A;  2J1E A;  2WUH A;  4QX2 A;  2VCB A;  1JU3 A;  2YG0 A;  3K4D A;  1K42 A;  3OB8 A;  4CU8 A;  2W3J A;  2XHN A;  4JKM A;  4A3Z A;  1SG3 A;  4QX3 A;  2L9L A;  3GXU A;  1GMM A;  3C8X A;  2W92 A;  4MGQ A;  2VCC A;  3NQH A;  3ETP A;  2J1A A;  4XUP A;  3ACH A;  3ABZ A;  4XZU G;  2DCK A;  3LEG A;  1ULO A;  2RJ2 A;  4D8M A;  3GGL A;  2VCA A;  2W91 A;  2J1S A;  4AG4 A;  2X05 A;  5JXI A;  1GOG A;  3HPN A;  3T2Q A;  3SEP A;  2B9V A;  2EIB A;  2W1W A;  3ECQ A;  4BXS V;  2W47 A;  2ORZ A;  3D3A A;  3E1F 1;  4JHZ A;  4LPL A;  1GUI A;  5FUI A;  2VZU A;  3IB3 A;  3EYP A;  4XUO A;  5EJZ B;  3NJV A;  2XQX A;  4E8C A;  3OG2 A;  3K46 A;  3W5M A;  1GNY A;  1US2 A;  2Y64 A;  3U37 A;  2WQ8 A;  4QX0 A;  4DUV A;  2W87 A;  2VZ3 A;  1UYZ A;  2VC9 A;  2WO3 A;  2VZR A;  4CU7 A;  1OF4 A;  3IAP A;  3K77 A;  3LEI A;  2C9K A;  3A21 A;  1UZ0 A;  5B4X A;  3OGR A;  2WZE A;  5JR2 A;  1NUK A;  2QQM A;  1R64 A;  5J1X A;  2W5F A;  3PUH A;  1DP0 A;  4A45 A;  1EUU A;  2JDA A;  3I2G A;  1US3 A;  3JXS A;  1I5P A;  1PX4 A;  1ULP A;  1CX1 A;  1W8O A;  5JXJ A;  3FHQ A;  2ZEZ A;  4QB1 A;  2BER A;  3LQC A;  3VD5 A;  5IHR A;  3WNN A;  1UYY A;  2W95 A;  4CU9 A;  1SDD B;  4P00 B;  4Z2A A;  2YFU A;  4AAX A;  5A1A A;  4BK4 A;  1UMH A;  3MV1 1;  3THD A;  1OT5 A;  3MUY 1;  3MUZ 1;  2KD7 A;  1W9W A;  3OEB A;  3C7G A;  1UYX A;  3WQB A;  2WN2 A;  5DMY A;  4ZY9 A;  1MPX A;  1L7Q A;  3W5N A;  2Y6H A;  2W46 A;  3C7F A;  2HLE A;  4QAW A;  2Y6J A;  3ZM8 A;  2B4K A;  5DPN A;  4BDV B;  4OZO A;  4MAD A;  1JZ6 A;  2QQL A;  2ORX A;  4GWI A;  2EIC A;  3SKJ E;  2LS6 A;  3VD9 A;  4QX1 A;  2PQS A;  2VR4 A;  3NNG A;  1JYX A;  1WKY A;  3DYP A;  1UY1 A;  1OF3 A;  2QQN A;  2QQI A;  1NAE A;  1UY3 A;  4QDR A;  1W0N A;  2W94 A;  3WF2 A;  5CYY A;  3FL7 A;  4ARY A;  2R7E B;  4A42 A;  1K45 A;  3VDB A;  2VL4 A;  1F4A A;  2VZP A;  2WAO A;  2VZQ A;  2JKX A;  3WNP A;  3A7Q A;  3DEC A;  2ZXQ A;  3C7O A;  1UXZ A;  5JXG A;  4CUB A;  3OGS A;  3T0D A;  1J83 A;  1T2X A;  3FHA A;  3I97 A;  3ACG A;  2OKX A;  4MGS A;  4KI5 M;  4ZXE A;  4TTG A;  4YPJ A;  4W4Z A;  4XVH A;  4ET7 A;  3HOB A;  2QQK A;  1KGY A;  3MO4 A;  3I2I A;  2WDB A;  3C7H A;  4PF1 A;  1GU3 A;  1JZ3 A;  2YFZ A;  1JHJ A;  1H6Y A;  1UX7 A;  4BK5 A;  3CZU A;  2BGP A;  5IJR A;  4ZZ8 A;  1O8P A;  3HJR A;  4GZ9 A;  3III A;  2VTF A;  5G05 L;  3CMG A;  3DYM A;  3K4A A;  5DN2 A;  3NJX A;  3CKH A;  1JYW A;  1PMJ X;  1KEX A;  2JE8 A;  1WCQ A;  3WF0 A;  4XUN A;  1XPW A;  2VZ1 A;  2Y6L A;  4ARX A;  4M4R A;  3T0A A;  1CZV A;  1CZT A;  4DUX A;  1L7R A;  3SKV A;  3MBW A;  5IFP A;  2YB7 A;  1NX9 A;  1TVG A;  4D0Q A;  3OBA A;  4IUG A;  1TG7 A;  1W8N A;  3MV0 1;  1OD3 A;  4JX0 A;  2WYS A;  2Y6G A;  4HG6 B;  2VZO A;  5C7G A;  1XC6 A;  2Y6K A;  1UY0 A;  1BHG A;  1O59 A;  1P8J A;  3I3E A;  2V5D A;  2VMD A;  1JU4 A;  3THC A;  2WN3 A;  2RV9 A;  4LHS A;  5CZK A;  4UOJ A;  1RYY A;  4DUW A;  3DYO A;  3ACF A;  4OMD A;  2VMF A;  4UAP A;  5IYY A;  3LPG A;  3OEA A;  3T0B A;  2LW8 A;  1W99 A;  4QB2 A;  3VD4 A;  4QPW A;  1YQ2 A;  1GQP A;  2J1V A;  3WNK A;  4KWU A;  4BJ0 A;  2VQU A;  2J1R A;  4JKK A;  2ZEY A;  2XOM A;  4DXT A;  2Y8K A;  2WO1 A;  4KMQ A;  4P5Y A;  1NKG A;  4OYU A;  4P08 A;  5HXM A;  2E33 A;  4QDS A;  3EB7 A;  3IDA A;  1W9T A;  2V4V A;  3LPF A;  3CZJ A;  1PX3 A;  4XUR A;  3CDZ B;  4XUT A;  3UES A;  3WNM A;  5LA1 A;  1J84 A;  2X10 A;  2W1S A;  3I2H A;  4OUE A;  4CVU A;  3LEK A;  5C70 A;  5LA2 A;  2YC2 A;  3F2Z A;  3CQO A;  2E31 A;  4DXS A;  3I3D A;  1JZ4 A;  5EJ1 B;  2XON A;  2J1T A;  3BN6 A;  2BGO A;  2CDO A;  4LQR A;  1XNA A;  4MOA A;  4DEV A;  1H6X A;  2VOT A;  2VM9 A;  4A6O A;  1IQD C;  3P6B A;  2ID4 A;  5LCW L;  3UET A;  1D7P M;  2BBA A;  3A22 A;  5F7U A;  1W9S A;  2DDU A;  4JKL A;  2WZ8 A;  2QQJ A;  5JXH A;  3GM8 A;  2J1U A;  2WAB A;  1DLC A;  1JI6 A;  4UI9 L;  4A41 A;  3NRU A;  3WEZ A;  3HNM A;  5C71 A;  2VZS A;  2QBX A;  2WBK A;  2J7M A;  1OH4 A;  4DEQ A;  2DCJ A;  4GWJ A;  4E8D A;  4A44 A;  2W1Q A;  4CUC A;  3K75 B;  4FI9 A;  4TXW A;  3PUI A;  4L0P A;  2V72 A;  3P1I A;  3OGV A;  4ZZ5 A;  5JMO A;  4W50 A;  3FN9 A;  2J22 A;  3T08 A;  3WF1 A;  5I0D A;  2YC4 A;  3IAQ A;  3VDC A;  4CU6 A;  5G04 L;  4PQQ A;  3AC0 A;  1CZS A;  2VO5 A;  4QDQ A;  3WSO A;  1JZ5 A;  1LNS A;  2VZV A;  3K4Z A;  1UY2 A;  3VDA A;  2BZD A;  1JZ8 A;  2RVA A;  3VD3 A;  1JZ7 A;  3I2J A;  3ACI A;  5IFT A;  4XUQ A;  3J7H A;  2Z4F A;  5JUV A;  4DXR A;  2EIE A;  4CUA A;  5LA0 A; 
#chains in the Genus database with same CATH topology
 4CDX C;  1G6N A;  2WZR 2;  2HWB 3;  1POV 3;  5HV0 A;  4LO6 B;  4AAP A;  4Z8B A;  3ON7 A;  1WW7 A;  3W21 A;  1N1Y A;  1AR9 2;  1H1A A;  2EXI A;  1PMH X;  4M4P A;  3H8R A;  2K2S A;  1DIW A;  2QQO A;  3ZYF A;  3HEI A;  4IV1 A;  4HVR A;  5KHH A;  1NYW A;  3VZO A;  3Q8C A;  2IXL A;  1XU2 A;  4CTE A;  5CFD C;  1JW6 A;  4OQ8 A;  2FDJ A;  1DQ2 A;  2VOV A;  1W6Q B;  1LES A;  3W58 A;  3K2O A;  5JVV A;  2P3J A;  1DYK A;  3ZDS A;  2VOK A;  4XET A;  2VQT A;  5JZG C;  3SCH A;  2JEM A;  3WW2 A;  1CIY A;  2OX0 A;  1OKQ A;  2YBK A;  4H3W A;  3I3B A;  1F8V A;  5FYC A;  1UX6 A;  1UWW A;  1PM4 A;  2D7F A;  3VKN A;  2R6Q A;  3MF9 A;  1YCI A;  5GAL A;  4HKO A;  1GWK A;  4BLI A;  4HVQ A;  1KJL A;  3M3I A;  3I2F A;  1SLB A;  5DZG A;  5JIA A;  4AHW A;  4LOR A;  1QDC A;  2Q8O A;  4N43 C;  2Q8C A;  3PHM A;  3H8X A;  2RS3 3;  3VBH C;  2LAL A;  3A0N A;  3WP4 A;  4BQX A;  4UFI A;  4AQS A;  1YO8 A;  2W9X A;  4K20 A;  4XFF A;  3DEM A;  2A7A A;  3VB9 A;  5FP9 A;  1RUJ 1;  3KF3 A;  1ULD A;  4Q4W 2;  4JRL A;  2PN5 A;  1QQP 2;  2ET7 A;  1MS8 A;  1Q8S A;  3I8T A;  4YSF A;  3GAL A;  1EUT A;  3V0B B;  1D4M 3;  1GP5 A;  2JD9 A;  4YM0 A;  4YWA A;  4CDW C;  4FBF A;  1PGL 1;  3KCY A;  2QKD A;  1T6G C;  2VNG A;  5FCC A;  3O5S A;  4AK3 A;  1UMI A;  4QPG B;  5CA6 A;  2Y33 A;  1UY4 A;  1VBE 2;  1AHS A;  4A6S A;  2CL2 A;  2W1U A;  3NNF A;  3PNA A;  2MEV 3;  4WVM B;  2R06 2;  5A3W A;  2GAU A;  5LY2 A;  5T54 A;  4ERO A;  4RR3 C;  1NQD A;  5IW0 A;  1U0A A;  1UQX A;  4N53 B;  2GC1 A;  2XLF A;  5F32 A;  4MGY E;  1W6P B;  2ARB A;  5FXZ A;  1NXM A;  1MEC 3;  4JTN A;  2D97 A;  3TB0 A;  1REF A;  1WLD A;  1K42 A;  4BA6 A;  2P5B A;  2Q4S A;  4OHV A;  4BWO A;  2I74 A;  2C0Z A;  4MV2 A;  5A6Q A;  3CHX A;  2QZ3 A;  4XMI A;  3WY6 A;  1NLR A;  4IV3 C;  4YGE A;  3KT4 A;  1DYP A;  2BNO A;  2VVF A;  4RQP A;  4YGB A;  3LAG A;  2FZ2 A;  3RDI A;  2RDN A;  4WVV A;  3PIJ A;  2L9L A;  2VTX J;  1N3O A;  4EN7 B;  1PZ8 A;  5FMO S;  1CAW B;  1E5H A;  5BNN C;  1JOD A;  4QXH A;  5A3U A;  1RVF 2;  4LKD A;  3B94 A;  1VBA 1;  2X5I A;  3B7M A;  2J1A A;  1PGW 1;  4OUL A;  4XUP A;  3SHR A;  4JVA A;  2BEO A;  1LUL A;  1HJF A;  1ULO A;  4KG8 A;  4R4Z A;  3VBR C;  3WHU A;  2AR6 A;  4YW3 A;  1R09 2;  2IXC A;  4F83 A;  1JUH A;  1G9F A;  4KGG A;  4CCD A;  2DWR A;  4CEW C;  5L7O B;  3GCW A;  3ILR A;  4NO4 A;  1W05 A;  2VTX A;  3M70 A;  4V2W A;  5C9A B;  2ZZQ A;  2XHK A;  5K0U B;  2JDP A;  1RUH 1;  4XC9 A;  1PGS A;  2A75 A;  2VNR A;  4NE9 A;  3FE5 A;  4Y33 A;  1EYB A;  1GQH A;  3U07 A;  1NT0 A;  4KNC A;  3N9L A;  2AEN A;  3IMM A;  5I0U A;  3D5O A;  2JB4 A;  2R0H A;  1V6K A;  1VBB 1;  3OJB A;  1FAT A;  3T1M A;  1ZZ6 A;  1QH7 A;  4RFT 0;  2A70 A;  3BYW A;  1I3H A;  4TLG A;  1COV 3;  5F9T A;  3ZN5 A;  1DQ5 A;  3EXU A;  5H9R A;  3HQX A;  1LOD A;  4GMP 3;  1H8V A;  2D6M A;  3HQR A;  4FTE A;  5FZA A;  1MS9 A;  4UYB A;  5FIX A;  3MIE A;  5ACA 3;  1LHO A;  1QNY A;  5L9V A;  3R4S A;  3SCF A;  2UYB A;  3HAG A;  4N9H A;  3AP9 A;  2XL7 A;  3PLQ A;  1RB8 G;  1CAV A;  4IV1 B;  1VMF A;  4Q1P A;  5EWS A;  2YXS A;  3VDD C;  3WCS A;  3AFK A;  1ENS A;  1QGL A;  3NNL A;  1OFN A;  2BOJ A;  4ZHN A;  3VHP A;  4WZF A;  1FX5 A;  1F35 A;  5T3N A;  1V6J A;  2QQM A;  3PU8 A;  2BW8 A;  3I4I A;  5JOY A;  5J1X A;  2G4I A;  3KF5 A;  4GMP 0;  2RM2 3;  3VBS A;  4CYD A;  4CDQ A;  3UGG A;  3WW4 A;  1X33 A;  3OYW B;  4EWD A;  1QJY 1;  4YG0 A;  4LKF A;  1NCR B;  1US3 A;  3I2G A;  1A34 A;  2XJU A;  1I5P A;  3RZJ A;  5BUV A;  1CX1 A;  3FUO A;  1OI6 A;  2RR1 3;  2W68 A;  4NHY A;  3TOJ A;  4CCC A;  4GWN A;  4MUV A;  4L99 A;  5FPA A;  3VKF C;  3N3H A;  2P3Y A;  2PHW A;  3VBF C;  1KFU L;  1SFP A;  2PHT A;  1C28 A;  1UOF A;  2D3R A;  2IXH A;  4P9I A;  3VD5 A;  1FT9 A;  2F6B A;  1RUC 2;  1DU3 D;  1EAH 2;  3O0X A;  1PM7 A;  3PVO A;  4CU9 A;  1E5I A;  3FMG A;  2BYV E;  3MIG A;  4YZ4 A;  4AAX A;  3LEM A;  4IEQ A;  5FLI A;  1UMH A;  3THD A;  2JDK A;  4XW3 A;  3DF0 A;  1NE4 A;  2VU9 A;  3J9S A;  4GJZ A;  4C91 A;  4M00 A;  4AQ6 A;  1ULG A;  1LB2 A;  1B35 C;  1AYM 2;  3FWE A;  5FYV A;  4Y1Y A;  1QIQ A;  3C7G A;  1UYX A;  2P3I A;  2BWC A;  3NAP A;  2ATF A;  4Q4Y 3;  2D5F A;  2W46 A;  4QAW A;  1EV1 2;  2ZGN A;  2BTV C;  3WT3 A;  4BDV B;  3KQR A;  3LSE A;  4OZO A;  5TSW A;  1HJG A;  5FZE A;  4FTS A;  1S0B A;  5A3P A;  1JZ6 A;  2QQL A;  4BQ2 A;  1JN2 P;  2ORX A;  5SV8 A;  1OA4 A;  4GWI A;  3TNQ A;  5A32 A;  4DQA A;  1RUF 2;  1BBT 3;  2WWJ A;  2PA7 A;  4QX1 A;  3APB A;  5L36 A;  4RQP B;  1WKY A;  1YQ8 A;  2YU1 A;  4EZH A;  1OF3 A;  3IBM A;  1OOP A;  4AEK A;  4TYS A;  3GZA A;  5FPZ A;  5JMC A;  4OCT A;  1PO1 2;  4XIL A;  1UPI A;  4OVE A;  4GXL A;  3VZM A;  2W94 A;  5JOW A;  3HT1 A;  5CYY A;  4NVP A;  4ARY A;  2R7E B;  1R08 3;  1IHM A;  1YXW A;  3KSC A;  3GZT B;  3VDB A;  5HCH A;  4Y20 B;  1AYN 3;  5F39 A;  5CVR A;  5FZ0 A;  1C1F A;  2XBO 3;  3CJI A;  4NRQ A;  3KV9 A;  2VZQ A;  4GAL A;  4LE4 A;  2JKX A;  3WNP A;  3A7Q A;  3RWK X;  4QHB A;  4CDX A;  2GSY A;  3OGS A;  4IES A;  1APN A;  2R0F A;  5FP8 A;  2PLV 2;  3TEZ A;  4F8A A;  2NZ9 A;  2W2I A;  1JS9 A;  3DUI A;  1RJ7 A;  3KMH A;  4OQ9 A;  4EN9 B;  3JD7 3;  4KI5 M;  1HRV 1;  1CWP A;  2RMU 2;  1WLT A;  4K8F A;  1DGR A;  5GLW A;  4ET7 A;  2QQK A;  1KGY A;  5FZK A;  2FCV A;  2C1F A;  4ATF A;  1UKR A;  4HL0 A;  5FDB A;  1WCU A;  3I2I A;  2DVB A;  4ZKT B;  1TQ5 A;  2IFR A;  5CFD A;  5DDJ 2;  2WC2 A;  2VPV A;  2VW2 A;  4BK5 A;  1W3X A;  1WW4 A;  4GH4 C;  4XDQ A;  3AYC A;  4W65 A;  2BGP A;  3HVD A;  2KA3 A;  5IJR A;  3POY A;  2ILM A;  3CLP A;  5A70 A;  5AC9 2;  4RHV 3;  5JZG A;  4ZZ8 A;  4KL1 A;  1W6M A;  1HN0 A;  5FQ0 A;  3HJR A;  3WQ7 A;  5GJ6 A;  1S0C A;  3CMG A;  5BV6 A;  2ZHM A;  4LA2 A;  1AR9 1;  1FYU A;  1AXY A;  5DN2 A;  3CKH A;  4NN0 A;  3WG2 A;  1KEX A;  3S57 A;  4N43 A;  2A6Z A;  3WF0 A;  1J3R A;  2VZ1 A;  1Z78 A;  5DAW A;  5LZ6 A;  2XG3 A;  3T0A A;  1C8M 3;  4R4X A;  3VBH A;  3EQE A;  2KM2 A;  4CRQ A;  1LU1 A;  1QJU 2;  3ZN6 A;  1AXK A;  3RZZ A;  1HW5 A;  2RS5 3;  3KV5 A;  5C8C B;  2DFB A;  3BTA A;  3CEW A;  4LNV A;  5FOJ B;  4LMF A;  3VKL A;  4URA A;  4JAA A;  5E89 A;  2YB7 A;  2OXB A;  4L97 A;  1NX9 A;  3HBZ A;  3KM5 A;  5L73 A;  3RQ0 A;  4D0Q A;  4QKD A;  3VBS B;  4CDW A;  5JSO A;  1FOD 2;  2E6V A;  4FAG A;  5KC5 A;  5LK7 B;  3OBA A;  4IUG A;  2CGN A;  3PIG A;  2ENR A;  4PF5 A;  4BB3 A;  4HG6 B;  4LIU A;  1DQ4 A;  1S2E A;  2VZO A;  2WO7 A;  5BY5 A;  3KV4 A;  1GYK A;  2Y6K A;  4FPF A;  4OFG A;  5FY0 A;  5KHJ A;  1UY0 A;  5C3Q A;  5K0U C;  1O59 A;  2Y60 A;  5SV5 A;  2GZW A;  3I3E A;  4RR3 A;  2VMD A;  1JU4 A;  3THC A;  4P9L A;  1Q8V A;  2Q1Z B;  1WUV A;  2RV9 A;  1PIV 1;  3VV1 A;  4LHS A;  3POW A;  5CZK A;  1ZM1 A;  4NJ4 A;  3BU7 A;  1QQP 1;  1GNZ A;  4R9C A;  3UL2 A;  4JTO A;  4FOY A;  4ATE A;  3OUH A;  1MS4 A;  2PXJ A;  4L9B A;  3OEA A;  3T0B A;  1OC1 A;  3RMY A;  2LW8 A;  3ACL A;  1OPM A;  3NV4 A;  4QB2 A;  3IPV A;  2QCS B;  4UW3 A;  4MXW A;  5IAT A;  1YQ2 A;  4N8M A;  1V00 A;  4NIG A;  1SMV A;  2J1V A;  3ZFE C;  1GZT A;  4URT A;  3WNK A;  5JSR A;  2R06 1;  2VQU A;  2BNN A;  5LBB A;  1LOG A;  3V56 A;  4PBP A;  1KFX L;  1WA6 X;  3NAP B;  1BQP A;  1UZV A;  2R32 A;  3LB9 A;  4D7Y A;  3WXP A;  1I9R A;  1RUD 2;  4EV0 A;  2WSU A;  1XYP A;  4DXT A;  2ZCW A;  4I01 A;  5IAV A;  1VPH A;  1NKG A;  1YFY A;  2HBU A;  4IEY A;  3RJR A;  3VBR A;  4P08 A;  5BPX A;  4NR1 A;  1GSL A;  2WL1 A;  3C3V A;  4UFK A;  4QDS A;  1H1I A;  1X36 A;  1G9B A;  3AZW A;  4J1W A;  3FFZ A;  2YBP A;  4XCA A;  3MIB A;  3IDA A;  3OPW A;  1RUJ 2;  4XUR A;  4CEW A;  3AYE A;  4KBB A;  1DZT A;  5FYB A;  1BLZ A;  1DLL A;  1SEF A;  2RS1 3;  3WD5 A;  1NCR C;  1BCX A;  1RED A;  2OVU A;  4B1L A;  5FRE A;  5FYT A;  1OOP B;  4CCO A;  1BZW A;  2ZHL A;  1LU2 A;  4CP1 A;  1STM A;  1RVF 1;  2VW1 A;  3LEK A;  4FFG A;  4GB3 2;  4PI2 A;  4XJU A;  4CVU A;  4TZD A;  1LEC A;  1UOJ A;  1PZ7 A;  2W0X A;  2E31 A;  1OMI A;  3CQO A;  3NV2 A;  4AGR A;  3NNJ A;  2HWC 2;  4CPB D;  3LWC A;  2Q1F A;  5FLH A;  3M1H A;  1JZ4 A;  5JPM B;  4FPC A;  1R09 1;  1RHI 3;  2J1T A;  3HR9 A;  1AR8 2;  2CDO A;  3QH6 A;  4LQR A;  5CAD A;  4DEV A;  2XJS A;  4NRO A;  4FQ4 A;  3UJO A;  4DRR A;  5F3I A;  1ZRF A;  2DBI A;  3CJI B;  3NNM A;  1KRI A;  4LE3 A;  5BNO B;  4R9A A;  5T5L A;  1LOE A;  4ZPI A;  4OI1 A;  5GZG A;  1IQD C;  2ZGO A;  4OI4 A;  3P6B A;  2D6K A;  3AP6 A;  2AAC A;  4XFB A;  5I93 A;  5F5C A;  4LTA A;  3A22 A;  1K5J A;  2HWF 1;  4WVZ A;  2Q30 A;  3TN9 1;  4J25 A;  4XEZ A;  4CDX B;  1YIP A;  2ADE A;  1EPZ A;  2DDU A;  2QQJ A;  2E7T A;  4IEW A;  3N7L A;  4FPJ A;  4H2A A;  1LHV A;  1AL0 G;  5C8W A;  1M4W A;  5FP7 A;  1DLC A;  5A3T A;  5JSP A;  4I09 A;  5C71 A;  5BXX A;  3W59 A;  3VDD A;  5D21 A;  5KC6 A;  4NHK A;  4PHZ A;  1UYP A;  5CFD B;  4COZ A;  2GU9 A;  3RYK A;  3W20 A;  1VBA 2;  3CBN A;  4E8D A;  3ZKU A;  4UBG A;  3WDU A;  3NKG A;  3K75 B;  5JZG B;  3DXT A;  2WWS A;  1JYT A;  3RI8 A;  3OGV A;  3OOX A;  5EPA A;  4BHP A;  4EWE A;  2WR9 A;  3WF1 A;  5F3G A;  4CU6 A;  1JH5 A;  3Q8A A;  3VDC A;  1RUG 2;  4QGM A;  3VHN A;  4N43 B;  4YFZ A;  5C3S A;  1CPM A;  2GN3 A;  1W9F A;  3VBF A;  3VBH B;  1RUH 2;  3MIF A;  3OY8 A;  5A33 A;  1WZX A;  4ONU A;  2CSG A;  3ZN6 B;  4AI3 A;  4NWV A;  3VDA A;  5T5J A;  2RVA A;  2YGL A;  1WCK A;  4YG6 A;  2VNV A;  4LUM A;  4C0H A;  1TME 1;  3ZFF B;  1W39 A;  3ACI A;  1OPO A;  1BEV 3;  5JUV A;  4CDW B;  3IKW A;  1RXG A;  4CUA A;  3UGF A;  3MDP A;  2V09 A;  4P02 B;  3GCX A;  4RYD A;  3OPZ A;  1YUD A;  5EJ3 A;  1UXX X;  2P37 A;  3S6P A;  5CFC C;  4G4F A;  1UAI A;  4PCR A;  5JOX A;  2J42 A;  5CU1 A;  1I6X A;  4KQ7 A;  1V6M A;  2O0O A;  3HQU A;  4RR3 B;  2CY6 A;  2ZOE B;  2Y34 A;  3A4U A;  2AUY A;  1RUC 1;  1EAH 1;  2D6L X;  2XJQ A;  4XPV A;  5FUN A;  3PUR A;  2VMC A;  1HXS 1;  3UKV A;  3E6C C;  4MET A;  2ZGU A;  1Q56 A;  3M3C A;  4HSL A;  3N35 A;  3E5X A;  5FZ8 A;  1ULC A;  1ACC A;  1HB1 A;  3KS7 A;  3MFC A;  3R0R A;  1JYV A;  3S5A A;  2H6C A;  5L19 A;  2V4A A;  2WWU A;  4ZU4 A;  1A8M A;  1O8S A;  1TMF 3;  1AYM 1;  4P14 A;  3IPV B;  4RGA A;  4UW6 A;  3BKZ A;  2C4X A;  1QJF A;  1ZBA 3;  2Z2S B;  1HRI 3;  1W8T A;  4JQT A;  2VJX A;  4K21 A;  1Y9M A;  3AP7 A;  2WNU C;  3ZYH A;  4BLJ A;  1QY4 A;  1EV1 1;  1V6O A;  2VMH A;  2VME A;  2OYZ A;  3C7E A;  1GOH A;  1NCQ B;  3BUC A;  4QHZ A;  5C6C A;  4CZS A;  3UNP A;  3AZX A;  4XF4 A;  5F5Q A;  2NMN A;  3VBR B;  4PQ9 A;  1RUF 1;  5C8C C;  2GMM A;  3AYD A;  5LRS A;  1MQT C;  4OMC A;  1XOY A;  3KCX A;  4FP2 A;  4AVB A;  4BXF A;  2ZZJ A;  1JZ2 A;  1ENX A;  1UZY A;  5DQ0 A;  2OZJ A;  2ZKN A;  2WZP P;  4Q1R A;  3WNL A;  3RZL A;  1PVX A;  3BOD A;  5A7O A;  3WDW A;  2NM1 A;  3ZMO A;  4LHK A;  1PO1 1;  4BQ5 A;  3E6B A;  3INA A;  3VBO A;  3DV8 A;  4D6Q A;  5EXO A;  1J1T A;  1K12 A;  3TRS B;  4BCU A;  1UF2 C;  2R07 3;  1FXZ A;  4LO5 B;  4MO3 M;  1QJX 1;  3ZPO A;  4KU7 A;  4XYX A;  1MVE A;  1IPS A;  1X50 A;  2DCY A;  4CDQ C;  2DUP A;  2P17 A;  2ZEX A;  5LA9 A;  1QXJ A;  2QDR A;  3LA7 A;  1OSG A;  2F4P A;  4GH4 A;  1IGO A;  1JU3 A;  3IT8 A;  4E4Z A;  2EAL A;  4W6X A;  3PMS A;  2VQA A;  1GP4 A;  1RUE 2;  2XML A;  2R30 A;  1UW8 A;  2VCM A;  1R1Z A;  1F31 A;  4FO9 A;  1MZ5 A;  2PLV 1;  1U5Z A;  4A3Z A;  2FDI A;  3JZV A;  2RMU 1;  4QGL A;  3GXU A;  5C5U A;  1G86 A;  3B00 A;  4FPO B;  2VCC A;  3ZR5 A;  4HMZ A;  2UWC A;  3O7O A;  1OQE A;  1J1L A;  2UY8 A;  5FYM A;  3T2T A;  2WFF 2;  3AXD A;  2Y0I A;  1BBT 1;  4YVS C;  3ZLI A;  2QQP A;  3VDD B;  1W28 A;  3U14 A;  1BVP 1;  1WGP A;  2ZHK A;  3BPS A;  1AVB A;  3ITQ A;  3WNX A;  1LHN A;  1YHF A;  1N3Q A;  2G9Z A;  4PJY A;  4C90 A;  4D8M A;  1HIX A;  1JOJ A;  3GGL A;  2V73 A;  4H14 A;  1IOA A;  4Q4V 3;  4LBJ A;  5FJH A;  1DDL A;  3HBK A;  1WA4 A;  3U10 A;  2FMY A;  4QU1 A;  5BYN A;  1XSR A;  3ASI A;  4XAB A;  4JGZ C;  3FC0 A;  3AMH A;  1D0H A;  4BXS V;  4PI0 A;  4AVS A;  1IS5 A;  1U5Y A;  2BNM A;  1OOP C;  2ORZ A;  4LR4 A;  5K0U A;  1HB4 A;  4BME A;  1SBD A;  2WZR 3;  4LPL A;  3AZY A;  5C3P A;  4B1M A;  1LEN A;  1QJU 1;  1RUI 1;  3VBF B;  5FZO A;  3AZV A;  5J96 B;  5DZE A;  2VXR A;  4V2V A;  4BMB A;  1UMZ A;  3OY8 B;  3EYP A;  4XUO A;  3O0W A;  3NJV A;  2XQX A;  5B2G B;  4M0N A;  1O4Z A;  2A6Y A;  5AFE A;  4G9S B;  4MHR A;  3AKP A;  1YEW A;  1GNY A;  1US2 A;  4Q4X 3;  4MHU A;  4QM8 A;  5HV4 A;  1ALY A;  3RYR A;  4QX0 A;  1LGB A;  1W04 A;  3PU3 A;  1UYZ A;  1XNB A;  4XIK A;  3BPZ A;  4CU7 A;  4DUV A;  5BNO C;  4ZU7 A;  5DG2 A;  2SBA A;  5KBF A;  4Z1V A;  2DFC A;  1QOT A;  3ZFE A;  3A21 A;  2ZBJ A;  4MGK E;  5FKB A;  3J7N A;  2QUO A;  5IVC A;  2V5Y A;  1UZ0 A;  2IVJ A;  2P6C A;  5B4X A;  4RGG A;  3BTX A;  3PUQ A;  1H8T C;  1VP6 A;  3RWN A;  2H0V A;  5LW9 A;  1HV1 A;  1GAN A;  3BOP A;  1KIT A;  2BP6 A;  4KWL A;  4EYU A;  4GWM A;  1D2Q A;  5E8A A;  4AI1 A;  4E2S A;  4XQ4 A;  1S2B A;  1Y4W A;  1R64 A;  1Y7B A;  2UY9 A;  4B4R A;  1Y43 B;  3WZ1 A;  4B4Q A;  2VY0 A;  3KB5 A;  2DTW A;  3JQX A;  1GQG A;  5DUW A;  1LCL A;  4Q4W 3;  1W9Y A;  2F4L A;  3OYW A;  5LBF A;  1ND3 C;  1NCR A;  3OSD A;  3ZSE A;  1AR7 3;  4SLI A;  3BU0 A;  4MG2 A;  5F2W A;  2FZ1 A;  3USS A;  1A3K A;  5IVE A;  3POE A;  2JDH A;  1SLI A;  5JXJ A;  5CG9 A;  1X8E A;  2JWP A;  1RUD 1;  2QNK A;  2ZEZ A;  1XRU A;  4BQW A;  1VBD 3;  1X9P A;  3V64 A;  2OA2 A;  2VUL A;  1RGS A;  3B02 A;  3WQ0 A;  4AVT A;  1VBE 3;  4LKE A;  4QB1 A;  1KJR A;  1OLM A;  2ETE A;  3EBR A;  1K5M C;  4XMA A;  2A3W A;  4ZS3 A;  3WNN A;  1W2O A;  4QQ2 A;  4P00 B;  1PIV 2;  1FMD 3;  2ZGT A;  3H7Y A;  4B7K A;  4Z2A A;  3PUA A;  5BNQ A;  2HKX A;  5JOZ A;  5FXX A;  3ZFG C;  3VBU B;  2XPJ A;  2HWB 2;  4NAO A;  1MR5 A;  2CTV A;  2K46 A;  2ZGK A;  5IUQ A;  3ZFF C;  5CAZ A;  3GF6 A;  2ADD A;  4XQW A;  1W8H A;  1XJA A;  4GB3 1;  4QPY A;  2PAK A;  3DKW A;  3P3P A;  4XFH A;  3VBO B;  1GNH A;  2HWC 1;  1F2N A;  1PVC 3;  3NV1 A;  4LBQ B;  2WN2 A;  2VAU A;  5DMY A;  3USU A;  2ZAA A;  1V0A A;  5L9R A;  1AR8 1;  3BI3 A;  4AHZ A;  4FPH A;  3LKJ A;  3DPR C;  2PAE A;  5DPN A;  5K7P A;  2KXL A;  1XB9 A;  3HD8 B;  2FBE A;  4GH4 B;  3QH7 A;  4UXA A;  3IWZ A;  4FOV A;  2ZMK A;  5D1I A;  1XU1 A;  1E5R A;  4C1X A;  1RMU 3;  2BRT A;  2LS6 A;  2CGP A;  3VD9 A;  4YW2 A;  2PQS A;  5E1R A;  4LK7 A;  2DTY A;  2VR4 A;  3NNG A;  3H7J A;  3POI A;  4IDZ A;  3RJ2 X;  4DOU A;  1G9C A;  4KWJ A;  3DYP A;  3MW4 A;  1VBC 3;  3VGI A;  1H0B A;  1FNY A;  4YW1 A;  1UY3 A;  3D8C A;  5IVJ A;  2RS3 2;  3PJY A;  5FK8 A;  3R4D B;  1OLR A;  1O91 A;  1W0N A;  4PDW C;  4NWW A;  1CD3 G;  1GP6 A;  5GZE A;  3ZO0 B;  2E63 A;  2YPD A;  3LF7 A;  1W03 A;  1N47 A;  2BDR A;  5LEK A;  3SH4 A;  2B7Y A;  4Y1X A;  2BOI A;  1NCQ C;  1W2T A;  5FV3 A;  3H42 B;  1LKN A;  4ASM B;  4Y20 A;  1D4M 2;  3ZSL A;  1HB3 A;  1GZC A;  1C8N A;  1F4A A;  3T4V A;  1PO2 1;  5GZF A;  1U12 A;  5JPN B;  1RL3 A;  1EP0 A;  3VLB B;  4OHW A;  4ZS2 A;  5CBL A;  3DEC A;  4KBZ A;  4Q0S A;  1J59 A;  4CUB A;  1RUG 1;  4DIN B;  3T0D A;  2D5H A;  1ZVF A;  2MEV 2;  3O14 A;  3FHA A;  5ANN A;  2OKX A;  4MGS A;  5FMB A;  5CFC A;  4EN6 B;  4TTG A;  3F95 A;  4YPJ A;  1MS0 A;  2HWF 2;  3TN9 2;  4XVH A;  1MS1 A;  3O1S A;  1DGL A;  2GN7 A;  3KZ4 C;  2DUQ A;  3LDK A;  3QLQ A;  3H50 A;  5FZO B;  5DUV A;  1LJ7 A;  3MO4 A;  1Z7S 3;  1UD1 A;  4PF1 A;  5LAT A;  5FPU A;  1OA3 A;  1LAJ A;  2YFZ A;  1AL2 3;  1JHJ A;  1VRH 3;  4U2A A;  1QJZ A;  1IG3 A;  1GBG A;  1G7Y A;  4GA9 A;  4AQT A;  4IEX A;  1X82 A;  2IXI A;  3H0O A;  1OHF A;  3ZXF A;  1O8P A;  2IZW A;  4GZ9 A;  5H9P A;  3KLS A;  1PK6 C;  2B39 A;  1AJO A;  2NN8 A;  2VTF A;  4ASK A;  1QNW A;  2Y0O A;  1FPN 3;  2XJR A;  3ZFE B;  1YQ5 A;  2WNU A;  4XBQ A;  4Y1V A;  1ZRR A;  2CNA A;  5C4W C;  1XPW A;  3JBG 3;  4CCJ A;  3WUC A;  4S2G A;  5FZB A;  2I2S A;  4BYY A;  3AP5 A;  1JOP A;  1S0F A;  2OT7 A;  2EXK A;  1L7R A;  3CO2 A;  4HT1 T;  5JLV A;  3MBW A;  4BOW A;  5FPB A;  5C8C A;  5IFP A;  1Q5O A;  3AKT A;  2R1B A;  1B09 A;  1SDW A;  2R04 3;  5FYY A;  2QQV A;  3I49 A;  1MQT A;  5FY1 A;  2VUD A;  4B8E A;  2Q0A A;  2QDN A;  4I30 A;  1TME 2;  2IWG B;  2VW0 A;  3DGT A;  1H9P A;  3MV0 1;  2A5Z A;  2WYS A;  2Y6G A;  2LTN A;  5IWF A;  3Q9O A;  1XC6 A;  2HYK A;  1N1S A;  1JMU B;  5BNP B;  5FZ7 A;  3AVS A;  2HWE 3;  4HAN A;  2JJ6 A;  2WQZ C;  1R1A 3;  3S0M A;  1COV 2;  3UT0 A;  3BTY A;  4K40 A;  1RIT A;  4LOS A;  2C24 A;  2XB6 C;  2Y26 A;  3ACF A;  3DYO A;  1HXS 2;  3G7D A;  4JDN A;  4OMD A;  3ZXD A;  3O1R A;  1JHN A;  3CU7 A;  3LPG A;  3ZYI B;  4Q0Q A;  1GZW A;  3ES1 A;  4QQH A;  4QPW A;  4A3X A;  2ZGQ A;  4AFA A;  5LB6 A;  1KXG A;  4A2U A;  4YZ2 A;  3TEX A;  1L7L A;  2JXA A;  3KHB A;  2J1R A;  5A7W A;  4W6W A;  4JKK A;  3C2U A;  2ZX0 A;  4YVS A;  3USU B;  1SPP A;  2XOM A;  3OBZ A;  2BWA A;  3AXE A;  3D6E A;  4GKY A;  2O14 A;  2Y8K A;  5CKQ A;  4OHY A;  1H2K A;  2D6P A;  1AR6 3;  3FZ3 A;  1YQC A;  4QKF A;  4AOC A;  1IS3 A;  2RM2 2;  1RUE 1;  1ZBE 3;  2WS9 3;  2CYF A;  1OH3 A;  3ATG A;  5HXM A;  5JWP A;  2NP0 A;  5A3N A;  1TZO A;  1D2S A;  1DBN A;  2WII B;  5CIS A;  4IXL A;  3IMN A;  1UZZ A;  4XFC A;  1V9U 3;  3N9P A;  2PHR A;  2V4V A;  4D7T A;  2RR1 2;  3MI8 A;  4JGZ A;  3ENR A;  2E9Q A;  3LOI A;  4C0B A;  3IZO A;  5HI0 A;  5IAX A;  5FK7 A;  5GLV A;  4HKL A;  4YW6 A;  3ZN4 A;  2ARX A;  1ZX5 A;  2HEY F;  2AH2 A;  4OUE A;  1IS4 A;  2DV9 A;  4NOT A;  1LHU A;  2WFF 1;  2DCT A;  1HKD A;  2YUE A;  5GLZ A;  3RI9 A;  4YGC A;  5C70 A;  4QXC A;  2ZAC A;  5FYH A;  2JDN A;  3SMH A;  1CJD A;  4K1Z A;  5A7N A;  2DVA A;  1KDK A;  3WHT A;  5JIU A;  4NII A;  3N4M A;  3K3N A;  1QJX 2;  3PTR B;  4QHO A;  3POF A;  1DF0 A;  2B46 X;  4EWA A;  5IK8 A;  4MOA A;  3WP6 A;  4QMA A;  2Y6F A;  2DUO A;  4I3P A;  2VOT A;  1WCD J;  1S0D A;  5DDJ 3;  1AXZ A;  2D93 A;  2VM9 A;  4Z92 B;  5BNO A;  4A6O A;  1ZRE A;  1CR7 A;  1GZ9 A;  1PNF A;  3VBU C;  4COW A;  4Z82 A;  2ID4 A;  3U1X A;  5AC9 3;  3UET A;  1C4R A;  2IFW A;  2MHF A;  4FPL A;  1F5F A;  2JEN A;  4ES9 A;  4JKL A;  1AUY A;  1D4V B;  3E5Q A;  5F8P A;  4Q4Y 2;  5HCB A;  5CFC B;  4LT5 A;  2XLG A;  3DL3 A;  4XF1 A;  4UBH A;  1BK1 A;  1GWM A;  3POG A;  5AVP A;  3VBO C;  1H8T A;  2EAA A;  5ISL A;  3ILN A;  4AZZ A;  3AMP A;  3PTY A;  2D3S A;  1RIN A;  2BV4 A;  2Q1M A;  4UI9 L;  1OA2 A;  4GAZ A;  3HNM A;  3LFM A;  3D82 A;  4XBN A;  4GIQ A;  2IUW A;  3GBF A;  5EFU A;  2PAM A;  4CEY C;  4DEQ A;  3U0Z A;  1BBT 2;  2BQP A;  2XUE A;  2DF7 A;  3GHN A;  4GWJ A;  2ET1 A;  4G3Y C;  5EYX A;  3G6J B;  3LOB A;  4FI9 A;  1ASJ 3;  4TXW A;  2HWD 3;  1W6O B;  4ZXK A;  4MGT A;  4PIZ A;  4HPK A;  1DHK B;  4LLO A;  4MLO A;  1ND3 A;  2I45 A;  4M3C F;  2ZX4 A;  3CJX A;  4W50 A;  2J22 A;  1SBE A;  3ROU A;  5I0D A;  1CIW A;  2WIN B;  3AJY A;  1FOD 3;  2D3P A;  4JQR A;  3M7A A;  3FLT A;  2WNU B;  1EPW A;  1QOO A;  1R08 2;  1CZS A;  4QDQ A;  1MS5 A;  4QX7 A;  1AYN 2;  2VGD A;  3J8F 3;  3MF6 A;  3JUU A;  4S2H A;  4Q27 A;  2VZV A;  1JZ5 A;  3FBM A;  2XBO 2;  2XDV A;  4LBO A;  2PMW B;  1K5M A;  2VG9 A;  1RUI 2;  2CV6 A;  1HDK A;  5FMC A;  5FY8 A;  4XAA A;  1L3J A;  3WG1 A;  1YIF A;  3VHO A;  1MQT B;  3RS6 A;  3K51 A;  3ZFG A;  4AHY A;  1SLL A;  1UIK A;  5CIR A;  3ZFF A;  1VMJ A;  2JEC A;  3J7H A;  2JD4 A;  3ZYG A;  3O1T A;  5FUP A;  3JD7 2;  2EIE A;  4R8H A;  5FMD A;  5LA0 A;  2ZGP A;  5K4L A;  4LO7 A;  1QHD A;  3A0K A;  2UWA A;  3KVA A;  3H3U A;  2K0G A;  1SBF A;  1VB4 A;  4JV4 A;  3LDB A;  3A23 A;  4OI2 A;  4K8R B;  1AX1 A;  4Y1Z A;  4AGG A;  3K3O A;  4LK6 A;  4MGI E;  1WMX A;  2C26 A;  1ZZ8 A;  2AGS A;  3N7J A;  3DPR A;  2SLI A;  4I0A A;  5FR3 A;  1OUS A;  1Q8P A;  4RHV 2;  1F4H A;  2YGM A;  4PLN A;  3WF3 A;  1X8M A;  5HCA A;  5FZG A;  2R49 A;  2CU5 A;  4QKB A;  1XE8 A;  2HWB 1;  1POV 1;  5LWB A;  1XSQ A;  1LGC A;  3HN1 A;  3WIN E;  4YM2 A;  3I2O A;  3ZOI A;  3T2P A;  4L2N A;  3MW3 A;  4R52 A;  4RFR B;  2YRO A;  2GH2 A;  1XNT A;  1GZW B;  5LRR A;  1N3P A;  3RNS A;  4JRA A;  2OPK A;  4NPM A;  3SC7 X;  3SEE A;  5K9Y A;  3MLK A;  4LHN A;  4P9Y A;  1RUJ 3;  4A4A A;  4K9S A;  1C8M 2;  1TNF A;  1K3I A;  1Y9G A;  1S0E A;  5J36 A;  4PDW A;  3VD7 A;  4YRD A;  5A7W B;  1OLM E;  2RS5 2;  1TEI A;  2VZT A;  3LE0 A;  4YVS B;  2EID A;  1ODM A;  1PZ9 A;  4FOQ A;  1SPP B;  4W8J A;  4RD7 A;  5A3L A;  1NCQ A;  2WT0 A;  3SQO A;  1CES A;  2C5D A;  2X09 A;  3T09 A;  2WAA A;  3KVB A;  5DAV A;  5HCF A;  3HN3 A;  1TNR A;  3HNB M;  3MFA A;  3CIH A;  3IDC B;  5DAB A;  3DKQ A;  4CXY A;  1JYN A;  2FDK A;  4RN5 A;  3P5B A;  2D44 A;  3I3Q A;  3WNO A;  5EIY B;  4JGZ B;  4UFL A;  2QFE A;  3HMY A;  5JDB A;  1G8W A;  2OZ6 A;  2HBT A;  2RS3 1;  3HNY M;  4XJ8 A;  2ZML A;  1LOB A;  3PVN A;  4ORF A;  2UWB A;  3TEW A;  2B42 B;  4EZ4 A;  5I91 A;  4QB6 A;  2XXZ A;  2E32 A;  2LRO A;  4TSV A;  4I0W B;  5T52 A;  1DQ0 A;  4K1Y A;  4IEP A;  4K6B A;  4PT6 A;  5FZH A;  4CDU C;  2ZEW A;  3MW2 A;  2E7A A;  5BNP C;  1GOF A;  1D4M 1;  1ODN A;  2A1X A;  2J1E A;  4MX3 A;  4QX2 A;  2VCB A;  3K4D A;  5HXV A;  3R4U A;  4M3C A;  2BJS A;  1J58 A;  4AEM A;  1CN1 A;  5LBE A;  2YHJ A;  2VVE A;  4CU8 A;  2UU8 A;  1JOB A;  2XHN A;  1ZRI A;  4JC1 A;  1PK6 A;  4B4P A;  2MEV 1;  3RVH A;  1O5L A;  2OQ7 A;  1UN1 A;  1NLQ A;  4QX3 A;  1S4C A;  2JE7 A;  3ZYP A;  1MEC 1;  3I3M A;  5C4W A;  2BBV A;  4LIT A;  5J37 A;  2QVS B;  1C3H A;  1GV9 A;  1H8T B;  4ISR A;  4KWK A;  4XDO A;  3PVE A;  2EIG A;  1A78 A;  3ETP A;  1S2K A;  4IE4 A;  1N1V A;  1H9W A;  1OUR A;  2P3K A;  1CQ9 A;  2ZX2 A;  1VBC 1;  3LEG A;  1RUH 3;  2RJ2 A;  1NY7 2;  1WLW A;  1YQ6 A;  4HFS A;  3WDY A;  4UFH A;  2J1S A;  2RS1 2;  2GND A;  2ZGS A;  4M0H A;  4XFA A;  2FCT A;  2F17 A;  1SLA A;  5DAX A;  5J98 B;  4AG4 A;  3HPN A;  4HPK B;  4X6R B;  1BKZ A;  1ND3 B;  1PO2 2;  2DU1 A;  4P9J A;  1VBB 3;  2EIB A;  2W1W A;  1VLN A;  2W52 A;  2D40 A;  4FFH A;  1W6N A;  4LUL A;  3J4U H;  4IGO A;  3U11 A;  5FYU A;  2WNE A;  2W47 A;  1VAM A;  3Q8E A;  3NST A;  1XQN A;  4JHZ A;  5E88 A;  3QAC A;  1RHI 2;  3KGL A;  1NZI A;  2WQ4 A;  1ZZ7 A;  1GUI A;  2E53 A;  1Q3E A;  2X53 S;  2YMZ A;  5FYI A;  3ZR6 A;  1QXR A;  4UT5 A;  1WME A;  1K5M B;  3RFR A;  4QT6 A;  5EJZ B;  2BPA 2;  4OLL A;  4OI0 A;  1C1L A;  5A6Z A;  3K46 A;  4JGY A;  4QQO A;  4YGD A;  3W5M A;  1VB2 A;  1ZA4 A;  3JU9 A;  3ZFG B;  2Y64 A;  5DUU A;  4IL7 A;  2P34 A;  4PIY A;  4YNI A;  3ZXL A;  2ES3 A;  2WO3 A;  4NAM A;  1NE6 A;  2VZR A;  2GDF A;  3BIE A;  4ZU5 A;  3ZXA C;  3K77 A;  3LEI A;  2GH8 A;  5I8S A;  3VHR A;  4B7E A;  2MNG A;  4IEZ A;  3ZXG A;  2BFU L;  4DB5 A;  2PHX A;  3RZK A;  2OW4 A;  1CON A;  3SIT A;  1QJY 3;  2FHR A;  1COV 1;  3AJZ A;  5KR7 A;  5A6Y A;  1UO9 A;  3GZE A;  1Z0H A;  3DPR B;  4IEO A;  5JR2 A;  4MVT A;  4GMP 1;  2WNO A;  3ILF A;  1NUK A;  5GLU A;  4D94 A;  1Q43 A;  3MLL A;  4HN0 A;  3MLJ A;  1POQ A;  2P2K A;  2DVF A;  2W5F A;  4WV8 A;  5FZC A;  5ACA 1;  4HVO A;  5GKA C;  4A45 A;  1WD3 A;  2BVV A;  2ARC A;  2XWJ B;  4E2G A;  2JDA A;  2GAL A;  3WQ1 A;  3JXS A;  4BZ4 A;  2XH6 A;  1DCS A;  2ZHN A;  5FMO L;  1NXD 1;  1IZ3 A;  1CAU B;  4GQ7 A;  4AFM A;  2BU9 A;  4KU8 A;  5LK5 A;  5KXE A;  1W8O A;  3BAL A;  1ZRC A;  2VOX A;  4PDW B;  3NMB A;  5I8T A;  4Y5T A;  5CKM A;  2WLQ A;  1SAC A;  5A6X A;  4XHX A;  2BER A;  2RM2 1;  3LQC A;  1ENQ A;  3DN7 A;  5FP3 A;  1OQD A;  2WNV C;  1KS4 A;  4A7Y A;  1H4H A;  1CJP A;  1C5I A;  2PHD A;  3AX4 A;  3Q8F A;  5J48 A;  2QQU A;  1BEV 2;  3W9A A;  2W95 A;  2ZMN A;  2JDZ A;  4PLM A;  4RA0 A;  3R6S A;  1W3V A;  3ALQ A;  2RR1 1;  1CGP A;  2WA3 A;  4BK4 A;  3WW1 A;  3OD0 A;  3URF A;  3KT7 A;  3VBU A;  4CE8 A;  4XTP A;  3MUY 1;  4WM8 A;  4H55 A;  2W39 A;  3MUZ 1;  4AWD A;  4COU A;  1NZC A;  1HX6 A;  2E7Q A;  2DBN A;  3OEB A;  3M3Q A;  3WP3 A;  1KQR A;  4X6Q B;  4DFS A;  4AE2 A;  3WQB A;  2G9G A;  3TYJ A;  4FCA A;  1W90 A;  4LBQ A;  2YDE A;  1ONA A;  4HBN A;  3C7F A;  2HLE A;  3ZM8 A;  2Y6J A;  2B4K A;  4CEY A;  4HON A;  4MAD A;  4O9E A;  1XNC A;  3VZL A;  1TMF 2;  3SXW A;  4XF0 A;  1OQ1 A;  4M3C B;  3AFG A;  3EMR A;  3OPT A;  5DG1 A;  4DPN A;  1ZBA 2;  2EIC A;  3SKJ E;  3ZIX A;  4XIO A;  1HRI 2;  3RZG A;  2WT1 A;  1PK6 B;  2G19 A;  3VKO A;  3THP A;  2C9A A;  4Q4Y 1;  2JIG A;  1UY1 A;  5KXC A;  2D43 A;  2XR4 A;  2B45 X;  1NOV A;  2QQI A;  2QQN A;  2VH9 A;  1NAE A;  1F9K A;  1YNA A;  1ND2 B;  1URX A;  5A3M A;  2XJT A;  5C4W B;  3H9A A;  3POB A;  4UF0 A;  3IIA A;  2ERF A;  1MZF A;  1JBC A;  5FBJ A;  2WLP A;  3RSJ A;  2VQ0 A;  1JYI A;  4XDP A;  2CWM A;  1HRV 3;  4YFW A;  1W2N A;  1ZZC A;  2JG8 C;  3ES4 A;  1RXF A;  5GM0 A;  3TBD A;  5KHK A;  2VL4 A;  3NWK A;  4HSJ A;  2Z5W A;  4Y1U A;  1VRB A;  2D6N A;  4LXL A;  3FUQ A;  1H2N A;  4E4H A;  1VAV A;  3AB0 A;  4AI9 A;  2ZXQ A;  3I2D A;  1RC6 A;  3C7O A;  5JXG A;  1BVV A;  1PMI A;  1X9T A;  3ZMN A;  1J83 A;  1WWY A;  1W6N B;  2TBV A;  3ACG A;  1R08 1;  4J1X A;  4ZXE A;  1AYN 1;  2XVK A;  4W4Z A;  1ST8 A;  3POS A;  1H30 A;  2XBO 1;  2ZS6 B;  5IK7 A;  4TLF A;  1QKQ A;  3KQ4 B;  5D8A B;  1AR9 3;  4CPB A;  1GU3 A;  4JDO A;  4AI8 A;  4Q8K A;  1H6Y A;  5A1F A;  1UX7 A;  4JGY B;  2UYA A;  2YV8 A;  4A7K A;  5FY5 A;  5JAX A;  2JX9 A;  3JD7 1;  4QPI B;  3QD6 A;  1AX0 A;  1DZQ A;  3OGG A;  2JG9 B;  2ARA A;  2E51 A;  2LRP A;  2IXK A;  1SFY A;  4FXG B;  2ZGM A;  1O4T A;  4LEJ A;  3III A;  3PL0 A;  5EV7 A;  4P9X A;  4YW4 A;  2O8Q A;  1WW6 A;  4L8Q A;  1SLC A;  4CCM A;  3GJA A;  3LZZ A;  5I0T A;  2JIC A;  3MZH A;  1LOF C;  1OUX A;  2JE8 A;  4AVC A;  2Y38 A;  4BH9 A;  4XF3 A;  4ARX A;  2YPJ A;  2Y6L A;  2QJV A;  4ITC A;  4ES8 A;  1LEM A;  1NQJ A;  4FXK B;  4H7M A;  4M4R A;  4XFI A;  2H0B A;  5KXD A;  4RHV 1;  3LD8 A;  4ZON A;  1CZV A;  1CZT A;  3EO6 A;  5FYS A;  1NA1 C;  1O5U A;  2D98 A;  2PEL A;  4Q8L A;  4Y3O A;  2IVI B;  3RMX A;  4LBN A;  2HJI A;  1MS3 A;  5FY7 A;  5A7P A;  5AVA A;  1TVG A;  4HK9 A;  4ISQ A;  3AVR A;  4B3N A;  5IT6 A;  3B5L B;  2Z79 A;  3LCP A;  3T1L A;  1PIV 3;  4FAH A;  4RS5 C;  1C8M 1;  5LY1 A;  2Z69 A;  1OKO A;  1QQP 3;  2OUJ A;  3OUJ A;  1OD3 A;  4I02 A;  3IN9 A;  5FZD A;  4I0B A;  4AFD A;  4BIS A;  3K48 A;  2OQ6 A;  4WM7 B;  2RS5 1;  4CP0 A;  5C7G A;  3H3Z A;  5ABJ C;  1GKB A;  2VOW A;  2AZ5 A;  5IVV A;  5J3U A;  1BHG A;  3N9N A;  4XXP A;  5FTT C;  4CDU A;  5BNP A;  4E2Q A;  4Y5Z 0;  2V5D A;  5FZI A;  1OD5 A;  2EAK A;  2P4E A;  1W8Z A;  3ELN A;  4EN0 A;  5J09 A;  1VR3 A;  4Q4X 2;  3ME2 A;  2XJV A;  3MPB A;  4QX5 A;  4UOJ A;  1RYY A;  2R06 3;  3THT A;  4YW7 A;  1IPJ A;  4DUW A;  4O9G A;  2VMF A;  4UAP A;  2N7G A;  5FO8 B;  4CP9 B;  5IVF A;  4BIF A;  4C1W A;  3M3E A;  1ENR A;  3BB6 A;  3KGZ A;  3ZVX A;  3VD4 A;  1POV 0;  4WM8 B;  1YFW A;  3RGB A;  1RUN A;  4COY A;  3L2Y A;  3AYA A;  1GQP A;  4D69 A;  1ZZB A;  3EJK A;  4CUG A;  3E6D A;  2XGX A;  5KHI A;  5T50 A;  3ZXJ A;  4Y26 A;  2ZEY A;  2RJL A;  4W6Y A;  3ZIW A;  2K9Z A;  3LA3 A;  1WW5 A;  2WO1 A;  3WDV A;  4CEY B;  4P5Y A;  5GZD A;  4OYU A;  3TWI A;  1RVF 3;  1ZZ9 A;  4QD2 A;  4QQL A;  4XXA A;  2DUR A;  4IGP A;  3D4K A;  1WBF A;  4LBM A;  3WVJ A;  3BIW E;  1U5I A;  3JB4 C;  1AR7 2;  4XHB A;  1AX2 A;  3JQW A;  3ORJ A;  4LIV A;  4XUT A;  5FWE A;  3CDZ B;  4HN1 A;  1R09 3;  1S0J A;  4BQ1 A;  3T30 A;  4WBB A;  1LGN A;  1VBD 2;  4Y4Y A;  4LUK A;  1J84 A;  3E97 A;  2X10 A;  1HB2 A;  3F2Z A;  2BFU S;  4UF0 B;  1IKP A;  1DGR N;  4CSW A;  3JB8 A;  4DXS A;  4NRP A;  3TN9 3;  2HWF 3;  1AF9 A;  5FO7 B;  5EJ1 B;  1FMD 2;  1CAX A;  3JCI A;  1NY7 1;  5DAQ A;  5EZW A;  5L9B A;  3UKT A;  4NHX A;  2XON A;  4M3C E;  3UYJ A;  2RS1 1;  2BGO A;  3BN6 A;  5CG8 A;  1XNA A;  5F6L B;  1S0G A;  3OD4 A;  1H6X A;  4CCE A;  1RIR A;  3UGH A;  2YY1 A;  3FJS A;  3GZU C;  5FXW A;  3LA2 A;  5EQU A;  1C5H A;  1O3R A;  4IE7 A;  4OZX A;  1S0I A;  1M06 G;  3DXU A;  1PVC 2;  5F7U A;  5KHG A;  1G9A A;  1I1E A;  1QWR A;  2QZ2 A;  2WZ8 A;  1HLC A;  4IQP A;  1RHI 1;  2Q5T A;  3GM8 A;  4M01 A;  4QU2 A;  2WAB A;  4DRV A;  2EVX A;  2XVG A;  4A41 A;  5CKN A;  3NRU A;  4MH0 E;  3VZK A;  1GFF 2;  1MEC 2;  2XJP A;  3WEZ A;  4GJY A;  4DNY A;  2QBX A;  1SQ4 A;  2J7M A;  1OH4 A;  3O1P A;  3T4H B;  1RMU 2;  2DCJ A;  4DY5 A;  1BMV 2;  1BXH A;  2A3Y A;  3AK0 A;  1VMH A;  4YM1 A;  2W1Q A;  4YYO A;  1VBC 2;  3PUI A;  2D6O X;  2MPF A;  4FP3 A;  1W6O A;  2GC3 A;  4L0P A;  3WV6 A;  2O1Q A;  4ZZ5 A;  4YVW C;  2P6H A;  2WFP A;  3FN9 A;  3T08 A;  4GKX A;  4EN8 B;  1ZNP A;  5T5P A;  3IAQ A;  1VJ2 A;  1TME 3;  2GP5 A;  2GMP A;  2Q8E A;  3MIH A;  1ND2 C;  3IM0 A;  3J7M A;  3AMQ A;  2JDM A;  2TUN A;  1LNS A;  1VE0 A;  3WX5 A;  2WNV A;  5FOB B;  3B9I A;  3S5Q A;  3M3O A;  3K4Z A;  4JDM A;  2YYO A;  1UY2 A;  3CF6 E;  2BZD A;  4CXW A;  1KD7 A;  2DU0 A;  4Q29 A;  4EE2 A;  4N7U A;  1WMF A;  4Y22 B;  3V0A A;  2VVD A;  3VD3 A;  1ZRD A;  3MID A;  3N9Q A;  1RUC 3;  1EAH 3;  2Z4F A;  4XUQ A;  4DXR A;  2QTW B;  1HXS 3;  2GC2 A;  4K7J A;  5ERL A;  5GZC A;  2WA4 A;  1LOA A;  5FZM A;  1QOS A;  3ZXE A;  4LJH A;  1Z7S 2;  4UW5 A;  3ZX7 A;  2NQY A;  4P9W A;  1AYM 3;  4AFB A;  1AL2 2;  4CDU B;  1VRH 2;  5FY9 A;  5GLT A;  5T55 A;  2WO2 A;  4ASL A;  1BEV 1;  1DG6 A;  1YC6 1;  2AC1 A;  4XJ9 A;  5D8A C;  1X7N A;  1SHW B;  4GD4 A;  4XAC A;  4O61 A;  5A1L A;  5B4N A;  5JI9 A;  2XWB B;  4DY3 A;  3DCQ A;  4MSV A;  1EV1 3;  3RYP A;  4JGY C;  5C3R A;  3J26 N;  5F2S A;  3WF4 A;  2HYX A;  3ZSM A;  3B93 A;  4LKS A;  1FPN 2;  4OUM A;  4QPI C;  1RUO A;  4FTB A;  1UU6 A;  4R9D A;  2JG9 C;  2KR2 A;  2OUH A;  4AVA A;  1QJE A;  5ACA 2;  2VUC A;  1W0O A;  3FX3 A;  4LO4 B;  1RUF 3;  1H2M A;  3JBG 2;  4D7S A;  2FD8 A;  3WW3 A;  5HPO A;  2DVD A;  5A80 A;  2IC1 A;  2VUA A;  1XXN A;  2PHL A;  3GBW A;  3GDB A;  3H1Y A;  3GJB A;  1Q8O A;  2E26 A;  3LFI A;  4SBV A;  1CX4 A;  2ZX3 A;  3T2O A;  4LO8 A;  4BPZ A;  2R04 2;  4AED C;  4DZG A;  4AXO A;  5KXB A;  1XE0 A;  1PO1 3;  4YLZ A;  3WCR A;  1QXP A;  1TMF 1;  4CP2 A;  2JG8 A;  4FFI A;  3I2K A;  4H7L A;  1ZBA 1;  5I0R A;  1QJX 3;  1BK0 A;  2LUW A;  1HRI 1;  4QXB A;  4AR2 A;  4AYU A;  2FQP A;  1HN1 A;  2GNB A;  1DFQ A;  1O4Y A;  3BGA A;  1HQL A;  4XJA A;  4IND A;  2VNO A;  4QX8 A;  4NRM A;  1T6B X;  2CDP A;  5DAP A;  4COV A;  1RTV A;  4N7I A;  2HWE 2;  2ZGR A;  1XNK A;  4N9I A;  3VN4 A;  4PIX A;  4AHX A;  1R1A 2;  4WM7 C;  2ZX1 A;  2PLV 3;  3O1O A;  3H8U A;  4UWD A;  2RMU 3;  4XJW A;  4CCN A;  1CAX B;  2WRA A;  4KG0 A;  1DYO A;  2YC0 A;  3H1W A;  3FHI B;  3M2M A;  2WUH A;  1RJ8 A;  3UJQ A;  2VBD A;  2YG0 A;  1WD4 A;  4IGQ A;  3OB8 A;  3VL8 A;  5KWR A;  1XYN A;  2W3J A;  3O0V A;  3RRD A;  5EYY A;  1BJQ A;  2R07 1;  2RE9 A;  3CL1 A;  4RSU A;  4JKM A;  2DVG A;  1H4G A;  2DYC A;  3KT1 A;  5D2A A;  4NID A;  1SG3 A;  5K8S A;  1JTZ X;  2AEY A;  4WM8 C;  3I54 A;  5FJK A;  5F37 A;  4N90 A;  2CGO A;  2WYF A;  4XBL A;  1GMM A;  3C8X A;  1LOF A;  2W92 A;  4MGQ A;  4O65 A;  2GNM A;  3IDE A;  1CVN A;  3NQH A;  2DCZ A;  1AR6 2;  1UZW A;  2XQR A;  2CAV A;  3ZSK A;  1FI2 A;  5FXV A;  1ZBE 2;  2AEZ A;  2WS9 2;  2X5I B;  2XVL A;  3KWV A;  4LLF A;  4XOG A;  4XZP A;  2CAU A;  4CCK A;  1NA1 A;  3ACH A;  3AP4 A;  3ABZ A;  4XZU G;  2DCK A;  1V9U 2;  1S55 A;  4NIH A;  1SCR A;  2HEV F;  2VCA A;  2W91 A;  3PME A;  1QJU 3;  1RUI 3;  1XBF A;  1V70 A;  3NO8 A;  1S1A A;  2X05 A;  5JXI A;  1GOG A;  2QQW A;  4RS5 A;  3T2Q A;  3WOG A;  3SEP A;  2B9V A;  3ECQ A;  1DQ1 A;  5F6K A;  5HBA A;  2BUK A;  3B69 A;  2JB8 A;  1YYN A;  3NW4 A;  3WDX A;  2PHF A;  3O12 A;  4QPG C;  2VMI A;  5ABJ A;  5C5T A;  3D3A A;  3E1F 1;  5DUX A;  2PHU A;  2ZPX A;  3OUI A;  4QKN A;  1ZA7 A;  3M4F A;  1LRH A;  4Q4V 1;  2XKO A;  5C33 A;  1YI9 A;  2ZAH A;  5FUI A;  2I07 B;  2VZU A;  3IB3 A;  4TN7 A;  2WNV B;  4NMI A;  3UV9 A;  4N53 C;  1UU4 A;  3MHZ A;  4YAR A;  4E8C A;  1HQW A;  2BGC A;  1MAC A;  3OG2 A;  2CWS A;  1J3Q A;  2LM3 A;  5FPL A;  4BE3 A;  1W06 A;  2EF6 A;  4Q0U A;  4YZ3 A;  4E4D X;  3RZM A;  4NHM A;  4IE0 A;  1GR3 A;  2ZAB A;  4IEV A;  1Q8Q A;  3I59 A;  3U37 A;  3V0A B;  1ULE A;  2GME A;  2WQ8 A;  3D0J A;  2W87 A;  2VZ3 A;  2VC9 A;  2WZR 1;  2HH9 A;  3LGR A;  3U78 A;  3RG0 A;  1OF4 A;  4D6R A;  5C3O A;  4AEJ A;  2OS2 A;  3IAP A;  3S7I A;  1YFX A;  2R16 A;  1UNB A;  3LSD A;  2C9K A;  1W8F A;  2QE3 A;  3KHC A;  5CB7 A;  1W0P A;  4NPL A;  3LDR A;  3OGR A;  4Q5O A;  4FPE A;  5FYZ A;  4TWT A;  4D3W A;  1VIW B;  5FZL A;  1YJK A;  4YG3 A;  3VKM A;  1CAV B;  2G9F A;  4Q4X 1;  4DMI A;  4LA3 A;  2WZE A;  4UFM A;  4AGV A;  4DXZ A;  1ASJ 2;  3OBT A;  2HWD 2;  1WLC A;  1RUD 3;  2PYT A;  2VMG A;  5A3O A;  1HV0 A;  3PUH A;  1SZB A;  1H2L A;  1YRZ A;  5FAX A;  4CDQ B;  1DP0 A;  1EUU A;  3O1V A;  3OGJ A;  4LOT A;  5L7O C;  2A3X A;  1PX4 A;  4OHZ A;  5FPX A;  1ULP A;  4LBQ D;  5JCT A;  3J8F 2;  1FV2 A;  2VBB A;  4NUB A;  4AVV A;  2FDG A;  1CAU A;  3BOW A;  3OTF A;  3N7K A;  2ARE A;  4BQ4 A;  4YM3 A;  5C9A C;  1C57 A;  1WMD A;  5FZ1 A;  3N7M A;  4D6S A;  3FHQ A;  1UKG A;  3R05 A;  3SH5 A;  2VBP A;  1AZD A;  4Q26 A;  3SH3 A;  3NKT A;  4GB3 3;  3WP5 A;  3HT2 A;  1LHW A;  4CA9 A;  4Z07 A;  2WKK A;  4HXC A;  4LBK A;  4Q4W 1;  4Y4R A;  5IHR A;  1XYO A;  2JG8 B;  4FQZ A;  1UYY A;  2HWC 3;  1SDD B;  1AR7 1;  1QF3 A;  4IV3 A;  2JIJ A;  3H8O A;  2YFU A;  3NV3 A;  5A1A A;  1E5S A;  4JZR A;  1AR8 3;  3MV1 1;  3SLI A;  2RHP A;  1OT5 A;  2H6B A;  1VBD 1;  3B3Q E;  4KGQ A;  5F5I A;  3SIS A;  1MVQ A;  4XAE A;  3POJ A;  1VBE 1;  4U36 A;  3BCW A;  2A71 A;  2KD7 A;  3J7L A;  1UPS A;  1YWK A;  3EHK A;  4S2F A;  1W9W A;  5F3E A;  1YLL A;  5BNN A;  1QH6 A;  4ZY9 A;  2CHH A;  1FMD 1;  2TNF A;  1MPX A;  1L7Q A;  4XFG A;  2Y6H A;  3W5N A;  3ETQ A;  1QDO A;  4IV1 C;  3GHM A;  1UU5 A;  4FSJ A;  4MYE A;  1QMJ A;  4JHT A;  5A32 B;  3V65 A;  4HKW A;  4YZ1 A;  3ZYB A;  1VBA 3;  1PVC 1;  2PTM A;  4YVW A;  2OII A;  3FBY A;  1JYX A;  2W08 A;  5ANQ A;  1PGL 2;  3AMM A;  4QDR A;  1PO2 3;  1ND2 A;  5FP4 A;  2EA7 A;  2RDS A;  2ZJC A;  2UUR A;  2GC0 A;  3WF2 A;  2JDY A;  1E57 A;  5FRA A;  1CPN A;  1RUG 3;  1BMV 1;  1RMU 1;  2NMO A;  3FL7 A;  4A42 A;  4I2O A;  1K45 A;  1NA1 B;  1ULF A;  3FLP A;  4K3U A;  2R1D A;  1W2U A;  3GBG A;  4Q0V A;  2VZP A;  2WAO A;  5FFO C;  5JI7 A;  1JUI A;  2NYY A;  4XTM A;  3MIC A;  2WSV A;  4O7X A;  5I0S A;  1W8W A;  3N9M A;  3RZH A;  4RS5 B;  5H9Q A;  1F5J A;  1JXN A;  1UXZ A;  5DXD A;  2A6W A;  5EP9 A;  3O1M A;  1J3P A;  1DGW A;  3OF1 A;  4HET A;  1T2X A;  3I97 A;  1V6N A;  4HOO A;  5FKC A;  3RPQ A;  1W2A X;  5E16 A;  1V6I A;  4AFC A;  4HLT A;  5ABJ B;  3U4X A;  4IE5 A;  4R9B A;  3VUO A;  2X8K A;  3HOB A;  1YJL A;  5EHD A;  1WCS A;  1MZE A;  1Y3T A;  4Z2W A;  3U4S A;  1OVS A;  1UIJ A;  2WDB A;  1OLQ A;  3C7H A;  4IW3 A;  5D8A A;  4QGN A;  1OVP A;  4J6G A;  1PHM A;  4MGZ E;  1DZR A;  1JZ3 A;  2HEW F;  3ST7 A;  1PGW 2;  4XQD A;  3N36 A;  4XJZ A;  1FV3 A;  1GWL A;  1NG0 A;  1UCX A;  3CZU A;  3VZJ A;  3UK9 A;  1O3S A;  5FO9 B;  2FDF A;  1V6L A;  1W6M B;  3I59 B;  3ZSJ A;  5FQ0 B;  4QPI A;  4DIQ A;  4LBL A;  2JG9 A;  2C6S A;  3AKR A;  4RQP C;  5G05 L;  3ZKY A;  4EQV A;  4F3J A;  3DYM A;  4NHL A;  5FZF A;  4QQP A;  1Z7S 1;  3K4A A;  3T3Y A;  5CEH A;  3PJQ A;  4IE6 A;  2A6V A;  3I7D A;  3NJX A;  4JCK A;  3AL6 A;  1PMJ X;  4FVV A;  1JYW A;  3SNM A;  1AL2 1;  3TEY A;  1VRH 1;  1WCQ A;  2EXJ A;  3MEP A;  3MGU A;  1YFU A;  4XUN A;  5T5O A;  4CCL A;  4GUL A;  3FLR A;  4UW4 A;  4NIA A;  3OBR A;  5F5A A;  4AED A;  2BVB A;  3GYD A;  2X5I C;  2PQQ A;  1U5X A;  3B9C A;  5DZF A;  3WG4 A;  4DUX A;  3SKV A;  3PDQ A;  4OHX A;  4BQY A;  4WZC A;  1FPN 1;  2RG4 A;  4Y5S A;  5FBZ A;  4A7Z A;  2Z42 A;  4QM9 A;  1VBB 2;  1DGW X;  4IEU A;  4DS0 A;  1F15 A;  3M8L A;  5FWJ A;  1N1T A;  1KS5 A;  5A7Q A;  1A8D A;  1XE7 A;  5J7M A;  4I3G A;  4FPG A;  3JBG 1;  1TG7 A;  1B35 A;  2O8O A;  1W8N A;  3AM2 A;  4XE9 A;  5LEJ A;  3ZYJ B;  2VE1 A;  4JX0 A;  2P1B A;  2TEP A;  5CNA A;  1GIC A;  4YW5 A;  2IXJ A;  4X8P A;  3ZDV A;  2RJK A;  4WM7 A;  3L9J T;  3MYX A;  2R04 1;  3AKS A;  4PLO A;  3BTZ A;  1P8J A;  4XF9 A;  5IK4 A;  2OPW A;  1GLH A;  1UOG A;  2FMD A;  2RDQ A;  5FLJ A;  4RGK A;  1REE A;  2A6X A;  2WN3 A;  3NVC A;  1FNZ A;  4NPR A;  1HQN A;  3D0S A;  3H1M A;  4F7Z A;  4AF9 A;  1W6Q A;  3ZPY A;  2JKB A;  2JDU A;  4X8N A;  4IV3 B;  3WG3 A;  4WVW A;  4P9G A;  5FZ4 A;  4DO0 A;  4AQ2 A;  1LTE A;  4CP9 A;  5IYY A;  1H1M A;  2XL9 A;  2EXH A;  4YZ5 A;  3VL9 A;  1SLT A;  1W99 A;  3H3L A;  2HWE 1;  3SCG A;  3NL1 A;  4MXW B;  1FAY A;  1RUE 3;  3MPP G;  1R1A 1;  1I5Z A;  1QJY 2;  5E6H A;  4KWU A;  1LED A;  3WDT A;  3P3N A;  4BJ0 A;  5BNN B;  1LR5 A;  4QWN A;  1OBN A;  3PVB B;  5LAS A;  2A73 B;  2XUM A;  4HK8 A;  2GP3 A;  4AW7 A;  4BIO A;  5F1R A;  2VD7 A;  2G1M A;  2ZGL A;  1A6C A;  4XCB A;  4KMQ A;  2X29 A;  3TNP B;  4E9K A;  4OUS A;  4Q0P A;  2WFF 3;  3FFQ A;  4L92 A;  3ZXK A;  4V1P A;  1LOC A;  2E33 A;  3IDB B;  5A7S A;  5M0T A;  5APA A;  3X29 B;  4UFJ A;  4FOW A;  3EB7 A;  1IG0 A;  4CEW B;  3V0B A;  1W9T A;  3LPF A;  4FPY A;  3CZJ A;  1PX3 A;  2B5H A;  4YVW B;  3UES A;  3VBS C;  3VZN A;  1NLS A;  3E5U A;  3WNM A;  4FPK A;  4AL9 A;  2RDR A;  5LA1 A;  1YI7 A;  4Q2F A;  4BQ3 A;  1AR6 1;  2W1S A;  3NJY A;  3I2H A;  4QPG A;  2VXJ A;  5LA2 A;  1ZBE 1;  2WS9 1;  2YC2 A;  4WVM A;  3AL5 A;  3LIG A;  5H9S A;  1QU0 A;  1O3Q A;  1KDM A;  3I3D A;  1W8U A;  4N53 A;  1V9U 1;  1IQA A;  1W6P A;  4LHL A;  4P5H A;  1EY2 A;  4KH9 A;  3PUS A;  2PFW A;  3L2H A;  5JR7 B;  3OCP A;  4C8D A;  3WUD A;  1IKQ A;  1ZYB A;  4RL7 A;  2FCU A;  2YU2 A;  5FZ9 A;  5IVB A;  1VAK A;  3AMN A;  4E27 A;  3B01 A;  4BM8 A;  1UL9 A;  2GNT A;  1SCS A;  1PNG A;  2ZA9 A;  3AZZ A;  4L11 A;  4BU2 A;  4E4S A;  5LCW L;  1OFS A;  1VAL A;  1D7P M;  2BBA A;  1BYH A;  1SFN A;  3KV6 A;  1W9S A;  2VEC A;  3S30 A;  2B8M A;  2R07 2;  5FZ6 A;  5JXH A;  5FY4 A;  4IET A;  1XND A;  4PBO A;  5AFB A;  3ZYR A;  3WR0 A;  2J1U A;  5FZ3 A;  2YBS A;  1AJK A;  1CAW A;  2WT2 A;  5LBC A;  4AI0 A;  3QOP A;  1JI6 A;  3NAP C;  3WLU A;  5DDJ 1;  3TAY A;  2ZTN A;  3N9O A;  3QBQ A;  2VUJ A;  2VZS A;  3U75 A;  2WBK A;  4EJR A;  5AC9 1;  3GNE A;  4FFF A;  4IER A;  4S2D A;  3O1U A;  3HIF A;  5F3C A;  3AKQ A;  4A44 A;  2JE9 A;  1IPK A;  1G9D A;  3BVC A;  1OXC A;  4CUC A;  2YZ4 A;  4CXX A;  5I8Y A;  2FDH A;  2V72 A;  3Q8B A;  1WBL A;  3P1I A;  2AYH A;  1IS6 A;  4Y24 A;  5JMO A;  5IK5 A;  5L7O A;  1O7F A;  2XKP A;  3HWJ A;  3LIH A;  4MXV A;  2YC4 A;  3UKN A;  5C9A A;  4FT8 A;  2NPI A;  3QCW A;  4HZF A;  1Y9Q A;  4QXK A;  5G04 L;  4PQQ A;  3KCC A;  3AC0 A;  2VO5 A;  1HRV 2;  2WJS A;  3WSO A;  4AI2 A;  1ASJ 1;  4AED B;  2HWD 1;  2XLA A;  4MZU A;  3S7E A;  5A33 B;  4Q4V 2;  1O3T A;  1TE1 B;  1UOB A;  5IVY A;  1JZ8 A;  2Q8D A;  3CNA A;  1O6U A;  1FOD 1;  2B9U A;  1QEX A;  2ZKL A;  1MZ6 A;  3CJI C;  1JZ7 A;  4Y22 A;  2NLR A;  3I2J A;  4B29 A;  1JYC A;  5IFT A;  3KD4 A;  1D0G A;  1DQ6 A;  3J8F 1;  3NJZ A;  1B35 B;  5FPV A; 
#chains in the Genus database with same CATH homology
 4RYD A;  4P02 B;  1UXX X;  3A23 A;  4M4P A;  1PMH X;  2QQO A;  3HEI A;  2C26 A;  2WO2 A;  2VMC A;  1SHW B;  1F4H A;  3WF3 A;  5B4N A;  1JYV A;  3WF4 A;  2HYX A;  2VQT A;  4LKS A;  3T2P A;  1CIY A;  1O8S A;  1XNT A;  3I3B A;  3SEE A;  1UWW A;  2C4X A;  4A4A A;  5HPO A;  3I2F A;  2VJX A;  1K3I A;  3VD7 A;  3GDB A;  2VME A;  2E26 A;  2VZT A;  3LE0 A;  3C7E A;  2EID A;  4W8J A;  3T2O A;  1GOH A;  3T09 A;  2X09 A;  3UNP A;  2WAA A;  2W9X A;  3HN3 A;  3I2K A;  3HNB M;  3CIH A;  1HN1 A;  3BGA A;  4OMC A;  1JYN A;  1EUT A;  4RN5 A;  1JZ2 A;  2JD9 A;  5DQ0 A;  3WNO A;  5EIY B;  2CDP A;  3WNL A;  3HNY M;  1UMI A;  1UY4 A;  1K12 A;  4QB6 A;  2E32 A;  4MO3 M;  2W1U A;  4PT6 A;  2ZEW A;  1GOF A;  2ZEX A;  1DYO A;  2J1E A;  2WUH A;  4QX2 A;  2VCB A;  1JU3 A;  2YG0 A;  3K4D A;  1K42 A;  3OB8 A;  4CU8 A;  2W3J A;  2XHN A;  4JKM A;  4A3Z A;  1SG3 A;  4QX3 A;  2L9L A;  3GXU A;  1GMM A;  3C8X A;  2W92 A;  4MGQ A;  2VCC A;  3NQH A;  3ETP A;  2J1A A;  4XUP A;  3ACH A;  3ABZ A;  4XZU G;  2DCK A;  3LEG A;  1ULO A;  2RJ2 A;  4D8M A;  3GGL A;  2VCA A;  2W91 A;  2J1S A;  4AG4 A;  2X05 A;  5JXI A;  1GOG A;  3HPN A;  3T2Q A;  3SEP A;  2B9V A;  2EIB A;  2W1W A;  3ECQ A;  4BXS V;  2W47 A;  2ORZ A;  3D3A A;  3E1F 1;  4JHZ A;  4LPL A;  1GUI A;  5FUI A;  2VZU A;  3IB3 A;  3EYP A;  4XUO A;  5EJZ B;  3NJV A;  2XQX A;  4E8C A;  3OG2 A;  3K46 A;  3W5M A;  1GNY A;  1US2 A;  2Y64 A;  3U37 A;  2WQ8 A;  4QX0 A;  4DUV A;  2W87 A;  2VZ3 A;  1UYZ A;  2VC9 A;  2WO3 A;  2VZR A;  4CU7 A;  1OF4 A;  3IAP A;  3K77 A;  3LEI A;  2C9K A;  3A21 A;  1UZ0 A;  5B4X A;  3OGR A;  2WZE A;  5JR2 A;  1NUK A;  2QQM A;  1R64 A;  5J1X A;  2W5F A;  3PUH A;  1DP0 A;  4A45 A;  1EUU A;  2JDA A;  3I2G A;  1US3 A;  3JXS A;  1I5P A;  1PX4 A;  1ULP A;  1CX1 A;  1W8O A;  5JXJ A;  3FHQ A;  2ZEZ A;  4QB1 A;  2BER A;  3LQC A;  3VD5 A;  5IHR A;  3WNN A;  1UYY A;  2W95 A;  4CU9 A;  1SDD B;  4P00 B;  4Z2A A;  2YFU A;  4AAX A;  5A1A A;  4BK4 A;  1UMH A;  3MV1 1;  3THD A;  1OT5 A;  3MUY 1;  3MUZ 1;  2KD7 A;  1W9W A;  3OEB A;  3C7G A;  1UYX A;  3WQB A;  2WN2 A;  5DMY A;  4ZY9 A;  1MPX A;  1L7Q A;  3W5N A;  2Y6H A;  2W46 A;  3C7F A;  2HLE A;  4QAW A;  2Y6J A;  3ZM8 A;  2B4K A;  5DPN A;  4BDV B;  4OZO A;  4MAD A;  1JZ6 A;  2QQL A;  2ORX A;  4GWI A;  2EIC A;  3SKJ E;  2LS6 A;  3VD9 A;  4QX1 A;  2PQS A;  2VR4 A;  3NNG A;  1JYX A;  1WKY A;  3DYP A;  1UY1 A;  1OF3 A;  2QQN A;  2QQI A;  1NAE A;  1UY3 A;  4QDR A;  1W0N A;  2W94 A;  3WF2 A;  5CYY A;  3FL7 A;  4ARY A;  2R7E B;  4A42 A;  1K45 A;  3VDB A;  2VL4 A;  1F4A A;  2VZP A;  2WAO A;  2VZQ A;  2JKX A;  3WNP A;  3A7Q A;  3DEC A;  2ZXQ A;  3C7O A;  1UXZ A;  5JXG A;  4CUB A;  3OGS A;  3T0D A;  1J83 A;  1T2X A;  3FHA A;  3I97 A;  3ACG A;  2OKX A;  4MGS A;  4KI5 M;  4ZXE A;  4TTG A;  4YPJ A;  4W4Z A;  4XVH A;  4ET7 A;  3HOB A;  2QQK A;  1KGY A;  3MO4 A;  3I2I A;  2WDB A;  3C7H A;  4PF1 A;  1GU3 A;  1JZ3 A;  2YFZ A;  1JHJ A;  1H6Y A;  1UX7 A;  4BK5 A;  3CZU A;  2BGP A;  5IJR A;  4ZZ8 A;  1O8P A;  3HJR A;  4GZ9 A;  3III A;  2VTF A;  5G05 L;  3CMG A;  3DYM A;  3K4A A;  5DN2 A;  3NJX A;  3CKH A;  1JYW A;  1PMJ X;  1KEX A;  2JE8 A;  1WCQ A;  3WF0 A;  4XUN A;  1XPW A;  2VZ1 A;  2Y6L A;  4ARX A;  4M4R A;  3T0A A;  1CZV A;  1CZT A;  4DUX A;  1L7R A;  3SKV A;  3MBW A;  5IFP A;  2YB7 A;  1NX9 A;  1TVG A;  4D0Q A;  3OBA A;  4IUG A;  1TG7 A;  1W8N A;  3MV0 1;  1OD3 A;  4JX0 A;  2WYS A;  2Y6G A;  4HG6 B;  2VZO A;  5C7G A;  1XC6 A;  2Y6K A;  1UY0 A;  1BHG A;  1O59 A;  1P8J A;  3I3E A;  2V5D A;  2VMD A;  1JU4 A;  3THC A;  2WN3 A;  2RV9 A;  4LHS A;  5CZK A;  4UOJ A;  1RYY A;  4DUW A;  3DYO A;  3ACF A;  4OMD A;  2VMF A;  4UAP A;  5IYY A;  3LPG A;  3OEA A;  3T0B A;  2LW8 A;  1W99 A;  4QB2 A;  3VD4 A;  4QPW A;  1YQ2 A;  1GQP A;  2J1V A;  3WNK A;  4KWU A;  4BJ0 A;  2VQU A;  2J1R A;  4JKK A;  2ZEY A;  2XOM A;  4DXT A;  2Y8K A;  2WO1 A;  4KMQ A;  4P5Y A;  1NKG A;  4OYU A;  4P08 A;  5HXM A;  2E33 A;  4QDS A;  3EB7 A;  3IDA A;  1W9T A;  2V4V A;  3LPF A;  3CZJ A;  1PX3 A;  4XUR A;  3CDZ B;  4XUT A;  3UES A;  3WNM A;  5LA1 A;  1J84 A;  2X10 A;  2W1S A;  3I2H A;  4OUE A;  4CVU A;  3LEK A;  5C70 A;  5LA2 A;  2YC2 A;  3F2Z A;  3CQO A;  2E31 A;  4DXS A;  3I3D A;  1JZ4 A;  5EJ1 B;  2XON A;  2J1T A;  3BN6 A;  2BGO A;  2CDO A;  4LQR A;  1XNA A;  4MOA A;  4DEV A;  1H6X A;  2VOT A;  2VM9 A;  4A6O A;  1IQD C;  3P6B A;  2ID4 A;  5LCW L;  3UET A;  1D7P M;  2BBA A;  3A22 A;  5F7U A;  1W9S A;  2DDU A;  4JKL A;  2WZ8 A;  2QQJ A;  5JXH A;  3GM8 A;  2J1U A;  2WAB A;  1DLC A;  1JI6 A;  4UI9 L;  4A41 A;  3NRU A;  3WEZ A;  3HNM A;  5C71 A;  2VZS A;  2QBX A;  2WBK A;  2J7M A;  1OH4 A;  4DEQ A;  2DCJ A;  4GWJ A;  4E8D A;  4A44 A;  2W1Q A;  4CUC A;  3K75 B;  4FI9 A;  4TXW A;  3PUI A;  4L0P A;  2V72 A;  3P1I A;  3OGV A;  4ZZ5 A;  5JMO A;  4W50 A;  3FN9 A;  2J22 A;  3T08 A;  3WF1 A;  5I0D A;  2YC4 A;  3IAQ A;  3VDC A;  4CU6 A;  5G04 L;  4PQQ A;  3AC0 A;  1CZS A;  2VO5 A;  4QDQ A;  3WSO A;  1JZ5 A;  1LNS A;  2VZV A;  3K4Z A;  1UY2 A;  3VDA A;  2BZD A;  1JZ8 A;  2RVA A;  3VD3 A;  1JZ7 A;  3I2J A;  3ACI A;  5IFT A;  4XUQ A;  3J7H A;  2Z4F A;  5JUV A;  4DXR A;  2EIE A;  4CUA A;  5LA0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...