2WDBA

A family 32 carbohydrate-binding module, from the mu toxin produced by clostridium perfringens, in complex with beta-d-glcnac-beta(1,2) mannose
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
139
structure length
139
Chain Sequence
NPSLIRSESWQVYEGNEANLLDGDDNTGVWYKTLNGDTSLAGEFIGLDLGKEIKLDGIRFVIGKNGGGSSDKWNKFKLEYSLDNESWTTIKEYDKTGAPAGKDVIEESFETPISAKYIRLTNMENINKWLTFSEFAIVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title N-Acetylglucosamine Recognition by a Family 32 Carbohydrate-Binding Module from Clostridium Perfringens Nagh.
pubmed doi rcsb
source organism Clostridium perfringens
molecule tags Hydrolase
molecule keywords HYALURONOGLUCOSAMINIDASE
total genus 38
structure length 139
sequence length 139
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.35: Hyaluronoglucosaminidase.
pdb deposition date 2009-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2wdbA00
1OH4A 5FUIA 3FL7A 1DYOA 4IUGA 1BHGA 3A7QA 1UMIA 1W9WA 3C8XA 3MBWA 1JZ4A 2VCAA 4CU6A 2YC4A 3D3AA 2E33A 4MGSA 3NNGA 2PQSA 3EYPA 1JZ8A 3I3BA 4RYDA 2VZVA 3K4ZA 4BXSV 2HLEA 2ZEZA 3CQOA 1J84A 1OD3A 1O8SA 3FHQA 4M4RA 4OMCA 3LEIA 3DYMA 5DPNA 1EUTA 3ETPA 3GDBA 5A1AA 2V72A 1JZ6A 2VZOA 4CUBA 1PMJX 2WZEA 4JKKA 4TXWA 2BZDA 3MV01 4JX0A 3K4AA 3I2FA 3E1F1 5I0DA 2W3JA 5DMYA 2JD9A 1PX3A 4JKLA 2E31A 2W91A 1JZ5A 2QQOA 5JXJA 2ZEWA 3BGAA 3T2PA 4ZZ5A 5JMOA 2VJXA 2X09A 3DECA 5LA2A 2WQ8A 3OBAA 1W9TA 3DYOA 3K46A 3PUHA 1O8PA 3WEZA 2J1EA 3I2JA 2YFUA 5JR2A 3HOBA 1K3IA 1GOFA 2WO2A 2QQNA 2EIEA 3WF4A 5DN2A 4JKMA 3ABZA 3C7FA 5IFPA 3K75B 4XVHA 1EUUA 2W95A 3OB8A 2LW8A 2YFZA 2XONA 3MUZ1 2Y6HA 3NQHA 5JXHA 3WNOA 3IDAA 3THCA 3ZM8A 4P02B 2XOMA 2W5FA 5C71A 2LS6A 2WBKA 3HNBM 5LCWL 4A4AA 3I97A 1L7RA 4LHSA 2WUHA 2C4XA 2J22A 4JHZA 2W87A 3P1IA 3OGRA 1JZ3A 3HPNA 2QQMA 2BBAA 2JDAA 2B4KA 1TG7A 4GZ9A 4DEQA 3CKHA 3SKVA 1H6XA 4E8CA 2WAOA 3IB3A 2W1WA 3WF3A 3WF0A 3SKJE 2VQTA 2VL4A 1JYVA 4BK4A 2ORZA 3ACHA 3IIIA 4QPWA 2EIDA 1UXZA 3P6BA 3LEGA 1SDDB 3GXUA 4A41A 1NUKA 1GQPA 1P8JA 2C9KA 4ET7A 3A21A 3WQBA 4A45A 4GWJA 4ARYA 1W0NA 4HG6B 4QDSA 4DEVA 2C26A 3THDA 3AC0A 4AAXA 3VD4A 5LA0A 1HN1A 4KWUA 2VZ1A 3K77A 4OYUA 1ULPA 1XC6A 3F2ZA 2XHNA 2DDUA 4DUVA 1OT5A 1JYWA 4PT6A 3GM8A 3WNMA 2OKXA 1D7PM 3PUIA 1UY4A 2RV9A 1W8NA 1YQ2A 2BGOA 5B4NA 1F4HA 2JKXA 3VDCA 2WZ8A 4QB2A 5G05L 2RVAA 4D8MA 3MO4A 1JZ7A 2VC9A 2BGPA 3HNYM 3OEAA 2Y6JA 3IAPA 2VO5A 2DCKA 2KD7A 5CYYA 3LE0A 1IQDC 4MADA 2Y8KA 4QX3A 2QBXA 4UOJA 2YG0A 4PF1A 3DYPA 1I5PA 2CDOA 1LNSA 2VMCA 3CMGA 5IFTA 4TTGA 3C7EA 2W92A 2VMEA 2W47A 3T2QA 5C7GA 1K42A 2YC2A 4CUCA 3I2GA 3UETA 4DXTA 3CIHA 3UESA 4DXRA 3W5NA 1GOHA 1US2A 2VM9A 3I3DA 3CDZB 3J7HA 4W4ZA 3CZUA 1UY0A 2J1RA 2WN3A 3VD7A 2RJ2A 1H6YA 2VZ3A 2QQJA 2WN2A 4XUPA 5IYYA 2E32A 4OZOA 2J1VA 4L0PA 4PQQA 3T0AA 4GWIA 4LPLA 2J7MA 3ACFA 1GU3A 4DUWA 2W1QA 1XNTA 3WNKA 1DP0A 1XNAA 2JE8A 3C7GA 3ECQA 3WNNA 2R7EB 3VD3A 1CX1A 1K12A 4Z2AA 5IHRA 1OF3A 1CIYA 2VMFA 2B9VA 1UX7A 2ID4A 2VOTA 2Y6LA 5C70A 1GOGA 5JUVA 2QQLA 3SEEA 4ZZ8A 3EB7A 1UZ0A 1UYZA 4QX1A 3WF1A 2Y64A 3IAQA 4M4PA 3BN6A 4QB6A 5F7UA 2ZEXA 3W5MA 2QQIA 3LEKA 5EIYB 4KMQA 2W1UA 2VCCA 2J1AA 3C7HA 3T2OA 2W1SA 2W9XA 1K45A 1W9SA 4P08A 1SG3A 4XURA 1JYXA 4QAWA 1PX4A 5LA1A 3WSOA 4BJ0A 2VZPA 2VZTA 2Y6KA 4YPJA 1JU3A 1JYNA 4BDVB 4QB1A 4D0QA 5EJ1B 3A23A 4XUQA 5J1XA 1GNYA 3NJVA 3OG2A 1NKGA 5B4XA 3C7OA 3SEPA 4CU9A 4P5YA 2VR4A 4XUTA 3ACIA 4XUNA 1KGYA 4OUEA 1MPXA 3JXSA 4MGQA 5JXIA 1GUIA 1T2XA 3LQCA 1US3A 1UXXX 2W46A 3U37A 1JI6A 1WKYA 4OMDA 3I2KA 2ORXA 2EICA 1CZTA 1CZSA 4ZXEA 4P00B 3NRUA 4QX2A 4CU7A 1JHJA 4A6OA 5HPOA 3FHAA 3GGLA 5DQ0A 1UY2A 3MUY1 2WAAA 1WCQA 2V5DA 5EJZB 4A3ZA 3I2IA 1J83A 3LPFA 1SHWB 2X05A 4A44A 2WO1A 4CUAA 2YB7A 3OGVA 3ACGA 1JU4A 4XUOA 3VD5A 4QDQA 2VZRA 3VD9A 1TVGA 2ZXQA 2J1UA 1O59A 2VZQA 2VZUA 4E8DA 2J1TA 1NX9A 4QDRA 2W94A 1R64A 1KEXA 2VMDA 2EIBA 4DXSA 3OGSA 1UYXA 4FI9A 2HYXA 1L7QA 4A42A 3I2HA 2Y6GA 1UY3A 1UWWA 2VQUA 3HNMA 4MO3M 3WNPA 3CZJA 1F4AA 2WDBA 3NJXA 5HXMA 4MOAA 2X10A 4ARXA 5JXGA 4QX0A 2J1SA 2VZSA 2L9LA 2E26A 2ZEYA 3MV11 3LPGA 4CU8A 3VDAA 2WYSA 4ZY9A 1XPWA 4AG4A 3HJRA 3WNLA 3WF2A 1OF4A 3OEBA 1NAEA 2BERA 4XZUG 3HEIA 1UYYA 2Z4FA 1ULOA 1RYYA 1DLCA 1GMMA 2VTFA 2DCJA 3A22A 4DUXA 1UMHA 3VDBA 3FN9A 3I3EA 3UNPA 2V4VA 3T08A 4W8JA 4RN5A 1CZVA 4BK5A 1W99A 2XQXA 4UAPA 3T09A 4CVUA 3K4DA 5CZKA 4KI5M 1PMHX 1UY1A 5G04L 2WO3A 3T0BA 2QQKA 4UI9L 2VCBA 4LQRA 2CDPA 4W50A 1W8OA 3T0DA 1JZ2A 4LKSA 3HN3A 2WABA 5IJRA
chains in the Genus database with same CATH superfamily
3H9AA 4FPYA 1WMXA 2JG8B 3ZLIA 4BPZA 1YFYA 4D3WA 5CG8A 2YY1A 1DYOA 2ZZJA 1QJFA 4IUGA 4P9GA 2UURA 3A7QA 3CJIA 3C8XA 3ZX7A 3OBTA 2YC4A 4Y22B 3VBUA 1O4ZA 5FZ0A 1FI2A 3EXUA 1HV0A 2VG9A 5GZGA 5I0TA 2UYAA 2VZVA 2WZR2 2R071 1LJ7A 3KV5A 3RGBA 1YXWA 5CKQA 2KA3A 3CQOA 4YZ3A 1AR73 4YM1A 3ZSLA 3WDWA 3PNAA 3KM5A 4GJYA 1WUVA 2G19A 5DPNA 3D8CA 3ETPA 1NE6A 2C1FA 5JPNB 4XJ9A 1UOJA 4QXBA 5FYTA 5H9SA 5BNNB 4UW3A 2WZEA 1F2NA 4CXWA 2P3YA 3MV01 1TZOA 2R062 3BVCA 4UF0A 2RR11 3HBZA 1AYM3 1DCSA 3BB6A 4LLFA 3M3CA 4DO0A 3OOXA 3KGLA 5EXOA 2W3JA 3WINE 2Y26A 1ASJ3 4AI2A 5HCAA 2B8MA 5DMYA 1VPHA 1O7FA 2JD9A 5A33B 1PX3A 3K3OA 3ZXDA 3HAGA 1QJU3 2ZOEB 2A75A 4EV0A 4FPFA 4N7UA 4UF0B 5C6CA 2PN5A 2DVFA 4YW1A 4NIIA 2ZEWA 3NO8A 4Q8KA 5JMOA 2VJXA 5LA2A 3BCWA 4COUA 2WQ8A 1A6CA 2YYOA 4IV1C 1W9TA 3DYOA 1TEIA 5I93A 3GHNA 4QWNA 2YFUA 2TBVA 5JR2A 1ND3C 3HOBA 4FPCA 4XDOA 5DDJ2 1H8VA 3QCWA 3ZN4A 4AQ6A 1GOFA 3MGUA 4AFMA 1AVBA 3RI8A 4YZ5A 5FZCA 1ENQA 3ROUA 3EHKA 4AVAA 3B7MA 5FLJA 1KQRA 5IFPA 5EV7A 3K75B 2WNUA 1HXS1 2CU5A 2X53S 3AP5A 4WM8C 2LTNA 2HWF2 3JU9A 1KJRA 4XF1A 4ASLA 1X33A 3MUZ1 1X50A 2VTXA 3WNOA 5JIAA 4QPGB 1C8M2 3ZM8A 1RUF2 4XXPA 3RRDA 3NL1A 4DRRA 1HW5A 4U2AA 4Z1VA 1Q8OA 4HSJA 2GAUA 4DXZA 3AVRA 4A4AA 1FOD3 4FPHA 2JDNA 4QPIA 4CCMA 1W8TA 1H4GA 1OSGA 4OULA 4M0NA 1SMVA 2RJKA 2W87A 4AI3A 1UAIA 2OUHA 4YFWA 4TLFA 5BXXA 4PHZA 2ZGMA 4K21A 5FYMA 1DGRA 3VZMA 4XMIA 5FBJA 2E51A 1PHMA 1Y43B 3GCXA 3WD5A 4HN0A 2WWUA 2J42A 1DBNA 4CEYB 4DOUA 3FLTA 4JGYC 3VBHB 1IZ3A 4XCAA 2BJSA 3AZZA 2XKOA 1G9CA 4FPJA 2E53A 4QKFA 4E8CA 1DQ2A 1JOBA 1QJY3 4IETA 3SKJE 4R9AA 2VQTA 1GICA 3J7MA 4OCTA 1O5LA 2BDRA 2NLRA 2VL4A 3ZN6A 3OSDA 2BWCA 5F9TA 4Y1UA 1JYVA 1CAUA 1JMUB 2ORZA 2EAAA 5T5JA 3E6DA 1JODA 4UYBA 4HETA 1SBDA 3IIIA 3KVAA 5F6LB 1Q8PA 1V0AA 3MI8A 5IW0A 1NLRA 5F3EA 4LNVA 5FLHA 1EPWA 4BQYA 5BYNA 5KXEA 3W20A 4XHBA 4AZZA 4Y5SA 3P6BA 4A41A 3LA3A 3NKTA 2E7TA 2JENA 2VOXA 2RMU2 4CDWB 2HBUA 3TNPB 4DNYA 2B45X 1WCDJ 1STMA 2A6WA 2BUKA 3OGGA 3WQBA 4O9GA 1FATA 3UT0A 4A45A 2RS13 4DB5A 1OQDA 1APNA 4C8DA 3VBRC 4ARYA 4B7EA 4CDXA 5J09A 1WLTA 2FMDA 4J25A 1NCRB 4HMZA 2AENA 4QDSA 1UKGA 5IVVA 2PHDA 2P5BA 3LWCA 3ZYPA 1Q43A 3VV1A 5KWRA 1BLZA 2R043 4CCDA 1U5YA 2K0GA 1VBC2 1LHOA 4KGQA 3AC0A 4XETA 3VD4A 3SCHA 2IXJA 4KWUA 3RI9A 3V64A 1XE8A 5A3NA 3H7YA 3SH5A 2PHWA 1LOFC 5FPLA 5FZDA 4E27A 4OYUA 2HJIA 1ULPA 2BVBA 2YGLA 3VBSC 5T5LA 1V00A 1JS9A 1UOFA 1HV1A 1OH3A 1TMF1 2DDUA 1S0FA 3LSDA 1DGLA 4IEQA 4IE6A 1XYNA 1JYWA 3PU3A 3Q9OA 4FFGA 4FCAA 1WW4A 1YQ8A 2WFF3 5J37A 3ZFGB 5FPUA 1QJZA 2RM23 4PLMA 5A3OA 1X9TA 1D7PM 5A70A 1UY4A 2DUPA 1ZRIA 1O5UA 1Y9MA 2BGOA 2WS93 4KU7A 2W08A 3RQ0A 2PHRA 5A7QA 1SBEA 3KT7A 5B4NA 3VHPA 1UF2C 3P3NA 3VDCA 5A7NA 5DUXA 3U11A 1K5JA 2XG3A 4AI9A 1H30A 4OHVA 5FY8A 2XH6A 4LBQD 1PGW2 1VBA2 3L9JT 2VVEA 4ZS3A 4E4SA 1COV2 1WMDA 1MZEA 2Y6JA 2WRAA 4JDMA 2VO5A 4MADA 2GN7A 4E2SA 1BEV2 3OD0A 3GCWA 4U36A 5GLUA 1C1LA 4BQ2A 2XUEA 1LESA 2CNAA 3MDPA 2UYBA 2QQWA 4LITA 5H9QA 3C7EA 2W92A 3RPQA 1CGPA 2W47A 2AACA 5IVJA 2D7FA 3AMPA 4D6QA 4BIFA 5FRAA 1OLME 5A6QA 5J36A 4LKDA 2ZX1A 5C8CA 1T6GC 1RXGA 3BKZA 5BY5A 1VMJA 1HX6A 4A7ZA 1QXPA 1N1VA 2CWSA 4UFLA 4JGZC 2VM9A 1UQXA 4B8EA 5A3TA 1IG3A 1RUOA 4W4ZA 3CZUA 5L9RA 3RWNA 2GMPA 3ZFEA 1OVSA 2J1RA 4Q29A 5D8AA 4P9LA 3VD7A 2ZCWA 3WV6A 4QXHA 3ZXLA 2A6ZA 2B7YA 2YUEA 1LHUA 5IYYA 1PO13 2E32A 1SFPA 5I0SA 3AKPA 4FOWA 2ZKLA 4PQQA 2Z79A 2PHFA 1Z7S1 4GWIA 4QQHA 3RJRA 1KFUL 4G3YC 2WLQA 1GU3A 3H8UA 1I3HA 3WOGA 5AC92 1XNTA 4DIQA 1RUE1 1ZZ9A 3UKVA 2WZPP 1W2AX 2JKBA 3MIHA 3ZFFC 1LHNA 3ECQA 1RB8G 3MIGA 5KHHA 4Z07A 2RS11 3WNNA 3P5BA 4X6RB 1NCQA 2DCTA 2AEYA 1KFXL 4IL7A 4MXVA 1QH7A 3RVHA 4Z2AA 1YFUA 2JDYA 2F17A 1W8WA 1VRH3 1CIYA 2D6KA 2LUWA 2VMFA 4LBJA 4AOCA 2VTXJ 1ZVFA 1XSRA 4NR1A 4HK9A 4LE3A 3TOJA 2VOTA 1H1AA 3NAPA 4P14A 1E5IA 1VB2A 4XTMA 2BFUS 1J58A 3NNJA 4Q4Y1 5F8PA 3WUDA 1UW8A 1I5ZA 3WDVA 2O1QA 5FPBA 3SEEA 2WR9A 4FFIA 4Q4Y2 1AYN1 3WQ1A 4A6SA 4L99A 3M7AA 3EB7A 5DDJ3 4LIVA 2XGXA 3UYJA 3AJYA 5IVFA 4QT6A 4QX1A 2ZGKA 3RZKA 4MYEA 3INAA 3SMHA 5FYIA 2WKKA 4Q0SA 2ZEXA 2ZGSA 1LECA 4NRPA 1R091 4CEWA 4ZU4A 5FIXA 4CUGA 4EROA 1OKQA 3B5LB 4TLGA 5EIYB 4I0BA 3SQOA 5CG9A 2NP0A 2ZMKA 1D4M3 2H0BA 4Q27A 5FZ4A 1W9YA 2FDKA 1GZTA 4HK8A 4Y1YA 5FZ3A 1Y7BA 1ULGA 2JG8A 1FT9A 3C7HA 4YM0A 3I54A 3T2OA 5LRSA 1W9SA 1Q8SA 4P08A 2NN8A 4B4RA 1V6MA 2QFEA 4JDNA 1YRZA 3CHXA 1JHNA 5LA1A 1KXGA 3WSOA 3KVBA 4BJ0A 4YZ1A 4YPJA 2P2KA 4IQPA 4YG0A 3OUIA 4J6GA 1VB4A 3HT1A 2D98A 2WS91 2YDEA 4XBNA 4XPVA 1VBE3 4D0QA 3FLPA 4QKNA 4XQ4A 2Q8DA 2ILMA 4TSVA 1CR7A 5IK5A 4LOSA 3AM2A 4QU1A 1XYOA 1LEDA 2NPIA 3C7OA 4EN6B 4I01A 4P5YA 1RUH3 1LRHA 5FZBA 3O1SA 1HXS3 4XUNA 5JOZA 2NQYA 3J4UH 3J8F2 5FWJA 1KGYA 4XIKA 4CDWA 4ATFA 2MEV2 3N9NA 2WT0A 4QX5A 1MPXA 1O4TA 2JDKA 4KH9A 3WQ7A 3MW3A 2BNOA 3NV4A 4XQDA 3LQCA 1SFNA 1NZIA 2AR6A 3HQXA 2Q0AA 3OBRA 4Y4YA 2BYVE 2OIIA 4UFIA 2ORXA 4H2AA 4XE9A 2EICA 4B7KA 1VMFA 1CZSA 2VNVA 4MGTA 4COZA 4P00B 2WZR3 2OT7A 1MZFA 1N47A 1GYKA 1OOPB 4GKYA 5CFCC 2WWJA 5L7OB 4QX2A 3WW3A 4CU7A 1JHJA 4Q4W1 4A6OA 1PVXA 3W9AA 2ET1A 3I49A 2VUDA 1UU5A 3MUY1 2KM2A 4S2FA 2RM21 5FJKA 1G86A 2VBBA 5FYZA 5FZ6A 2EA7A 3VL8A 1BJQA 1JW6A 2SBAA 4A44A 4AK3A 2A70A 2WO1A 4OHYA 1CX4A 3AZYA 5IVEA 3RZMA 3WP5A 1QXJA 1RUG3 3OGVA 1WGPA 5FZEA 1AR83 1QOTA 2HWD1 4PQ9A 3MF9A 5K7PA 4HVRA 2FHRA 4CCEA 3WY6A 3LB9A 2J1UA 4NROA 4RHV2 4YVSC 3VKNA 2N7GA 3ZSJA 4DRVA 2VZQA 1WLCA 4IE4A 4YSFA 1HB3A 1ZZ7A 4L2NA 3GZEA 5E88A 3O1UA 1BQPA 2XJVA 3LGRA 1R64A 1E57A 2C0ZA 4WZFA 5F6KA 1AR81 5A3UA 1JYIA 3DUIA 4LO7A 3I7DA 2LALA 2VMDA 1AR82 2EIBA 1IKPA 4P5HA 4YW5A 4GWMA 2HYXA 3E6BA 5IK4A 2NZ9A 3I2HA 5F39A 4EWAA 5C8CC 3VHNA 1W6NA 2ZX0A 1MS4A 1QGLA 1BKZA 3I4IA 3HN1A 3SXWA 1H2MA 1VIWB 1RJ8A 5A1LA 1AXKA 4BA6A 1LENA 1PVC1 4C90A 1ZRDA 3V0BA 2C6SA 1ZBA2 3RFRA 4CCCA 4HFSA 4MO3M 1W6MB 3WNPA 4IW3A 4Q1RA 5A3MA 2HWD2 3WQ0A 2WDBA 2RS31 3NJXA 4N53C 3IZOA 2XUMA 4WM7C 2X10A 4ARXA 2R6QA 1ZNPA 3CNAA 4S2GA 5B2GB 4QX0A 1ND3A 1QNWA 1O6UA 3U14A 4IE5A 3RZLA 1WCUA 2VZSA 4HVOA 5I91A 2E26A 4AGVA 3O1RA 3MV11 1J3PA 4W65A 2YPDA 1BK0A 1PMIA 1F35A 3U4XA 4AG4A 4NIHA 2HWE1 2RG4A 1AXZA 4QXKA 3AB0A 3ON7A 2JDUA 3QH6A 4XBQA 5F3IA 4O65A 1I9RA 1ODMA 2YBSA 1HN0A 5FKCA 2YU1A 2XJRA 1ZZ8A 2WWSA 4M00A 1UYPA 4HPKB 2GP3A 4N43C 1DQ1A 3FN9A 3OUJA 4AI1A 2OQ6A 4JDOA 3UNPA 3E97A 4AVTA 2V4VA 3QBQA 2UWCA 1H8TB 2OX0A 1DIWA 3IPVB 2P4EA 4I0WB 4W8JA 2C9AA 5A6XA 1AL21 1V9U2 3FFQA 3R6SA 1G7YA 1W99A 3CEWA 4R8HA 1MEC2 3FUQA 4UFHA 4WVWA 4IEUA 4CPBA 3B9IA 3K4DA 5F2SA 3S6PA 3WHTA 4CDUB 1IKQA 1Y4WA 2WO3A 5FCCA 4OHZA 3T0BA 4YVWB 4UI9L 1DFQA 2FCVA 1IS3A 2VCBA 1GANA 4IV3A 5EQUA 5BNPC 2D43A 1I6XA 1LODA 4GJZA 3K3NA 1MS3A 2IXCA 4RGGA 5JZGC 3T0DA 1DF0A 4IV1A 4LMFA 1H9WA 4V1PA 5FUIA 1Q8VA 3VBFA 3FL7A 1QOOA 2RDQA 3B01A 3CJIB 1BHGA 5LY1A 1VJ2A 1UMIA 4GB32 3MBWA 2DTYA 1JZ4A 2LM3A 1H0BA 1MEC3 3ZSKA 3U78A 1OVPA 2G1MA 4RS5C 4XDQA 3D3AA 2BBVA 1GBGA 1RITA 2PQSA 5SV5A 3PL0A 3EYPA 1SLBA 1XQNA 4ZU5A 3WCRA 1HRV3 1OBNA 2P3JA 2R30A 2EAKA 2DFBA 3ZFFA 5LZ6A 4V2VA 4AWDA 4OUMA 4LBQA 1YCIA 4Y5Z0 4UFKA 3C3VA 3VDDC 3UKNA 1H2LA 4AAPA 5ABJC 4SBVA 1O8SA 2VAUA 2ZGLA 2ZGPA 5T3NA 1DYKA 4OMCA 1ASJ2 2PLV2 4GB33 2H6CA 3FMGA 4GULA 5FP8A 5LK7B 3GDBA 3NAPC 2Q8OA 1JZ6A 2HWE2 3FJSA 4NPMA 2ZHKA 3VL9A 1AX1A 4A2UA 5ABJB 4TXWA 1QY4A 1RVF1 3DPRB 3H1WA 3VDDB 2CAUA 5CFDB 1VBB3 3MFAA 4JX0A 4CP0A 2D5FA 4C91A 3POFA 2FQPA 3K4AA 1OQ1A 2ZGOA 3I2FA 3M2MA 2YROA 3PHMA 1GZ9A 1MQTB 5FPVA 3NV3A 5CFCA 3CO2A 3FZ3A 2QKDA 1N1TA 4JKLA 1G6NA 2GP5A 2QQOA 1Y9GA 3MZHA 3FFZA 5JIUA 1VBE2 2HH9A 1S2EA 3KQRA 4FOVA 3WUCA 5GJ6A 1COV3 5CU1A 3OBAA 5FO7B 2VOKA 4RR3A 3WEZA 1GZWB 4XF0A 2J1EA 3CF6E 3T1LA 2PFWA 1JOJA 1UKRA 1NG0A 4IEZA 3H42B 1F5JA 4XJAA 1POQA 4YVWC 2WO2A 5FQ0A 4HKLA 3ZSMA 1V9U3 4IV3B 4EZHA 3WVJA 5FMBA 3ABZA 3VBHA 3AVSA 1PO22 2OXBA 2Q1FA 4JRLA 4XVHA 1EUUA 1ZBE1 5FO8B 3OB8A 3URFA 1OXCA 1RUD3 4Z82A 1OQEA 3OF1A 2V09A 1V6IA 4QU2A 1UU4A 2HWB1 3ILRA 3OPTA 3APBA 2WS92 4WVMB 5F5CA 5F5IA 4DQAA 4PDWC 4KG8A 1S0DA 1R1A1 4P02B 1NLQA 3B9CA 2XOMA 2JD4A 4MXWB 1NOVA 3T3YA 4R9DA 3HNBM 1BBT3 1L7RA 1HRI1 3AZVA 4BQXA 4CCOA 2ZACA 4JHZA 3OYWB 3LEMA 2K2SA 5T54A 1YQ5A 3P1IA 4EN8B 5KHGA 3X29B 4PDWB 2A3WA 3HPNA 2QQMA 4IV1B 2BBAA 3J8F3 3IDBB 4QHZA 5F3GA 5FZGA 1C8M3 3MEPA 2B5HA 2JG9C 4ES8A 2CAVA 2XLFA 1IHMA 4C1WA 1PK6A 4P9WA 3PMSA 3IB3A 2EVXA 2W1WA 4FXGB 1RUF1 2VE1A 3UJQA 2FDIA 3VKLA 3SNMA 4GALA 4YGEA 5L9VA 3TAYA 5EPAA 4YVSA 3ACHA 4FP2A 1OLRA 1R1A2 4WV8A 3HBKA 3GJBA 5FBZA 5J48A 1AYM2 1W6PA 4NIGA 1ND2B 1HRV1 1DQ4A 4FO9A 3ACLA 4NRQA 5APAA 2BTVC 3GXUA 3HD8B 5FMDA 2FDJA 1QWRA 2PXJA 1BK1A 1P8JA 1Q5OA 3H1MA 4QM8A 1POV3 2C9KA 1PGSA 1ZM1A 4AVVA 2ZMNA 4GWJA 3N3HA 5K0UC 3NMBA 5A3WA 3PIJA 1S4CA 3ITQA 2OYZA 1G8WA 4HG6B 5T50A 2ADDA 2V73A 3JD72 4OI2A 1OI6A 2Z42A 2NM1A 2R1DA 4UFJA 3UJOA 4AR2A 4MG2A 3G7DA 4ORFA 5FYVA 4BHPA 1W6OB 4OLLA 2ZGQA 3IMMA 5JI7A 5CFDC 2FZ2A 4NRMA 3B02A 2O14A 2H6BA 5KBFA 1QEXA 4R4ZA 4JVAA 1CAXB 1EV11 5FP9A 2XHNA 1AR91 1DG6A 4N9HA 5FWEA 4O61A 3O7OA 1OT5A 5GALA 5KC6A 2ARBA 5BNOC 3RNSA 1VBB2 4X6QB 4CTEA 1KITA 3M1HA 3N9OA 3OCPA 2ZBJA 2OKXA 5F5QA 4AE2A 1QNYA 3DKWA 5DAVA 1FOD1 5C33A 1RUH2 2RV9A 1W8NA 1W2TA 4UW4A 5CEHA 2ZAHA 1TNRA 5A80A 4TYSA 1F4HA 1YFWA 2FCTA 2Q4SA 1RUH1 4GH4C 1JN2P 1RUJ3 2WZ8A 3PLQA 4QB2A 2OW4A 1IPSA 3JBG3 5G05L 4D8MA 4YZ4A 1A8DA 1RHI3 5GKAC 1JZ7A 3LD8A 1ODNA 4H7MA 5C9AA 2YZ4A 1NCRA 4JC1A 1W03A 2BPA2 4GKXA 4K9SA 4UXAA 3U75A 1UL9A 3R4SA 4URTA 1LULA 3BIWE 2Y8KA 3KCXA 3PJYA 2YBPA 1A78A 3UGGA 4QX7A 2VGDA 5FXVA 1R093 1NA1B 4JGZA 4PI0A 1XB9A 3FUOA 1I5PA 4YW4A 4HT1T 1YFXA 1XRUA 3CMGA 4E4ZA 4TTGA 2R16A 3KD4A 2VMEA 1SCSA 2WINB 4M3CE 5A33A 1S2BA 3TN91 3RSJA 4ZKTB 1WCSA 4CP2A 4CUCA 2QJVA 3AFKA 3PJQA 3UETA 2PAMA 3POBA 2PHTA 1U12A 2VMGA 3KV9A 1MS8A 4PLNA 1US2A 1J3QA 4TN7A 5KXDA 4PCRA 1E5HA 2ZHMA 4N43B 1COV1 1DLLA 2QDNA 1AX0A 3KGZA 1WWYA 5BUVA 4CEYA 4BQ1A 2UU8A 5CNAA 4D94A 1BEV1 3JUUA 5A1FA 3ZXEA 3RMYA 1BBT2 3N35A 5F32A 4BWOA 4COVA 4OZOA 2J1VA 3N7KA 3AJZA 4R52A 2Y34A 2J7MA 4NAMA 3VDDA 5C3PA 5FPAA 4CDXB 4BZ4A 3CU7A 4XFHA 5J3UA 1JBCA 3WNKA 5CADA 1SPPB 4EN0A 1PIV2 4NE9A 3TN93 2IUWA 2R7EB 2GSYA 3U07A 3VD3A 1WA6X 1LCLA 2BGCA 4HZFA 3VB9A 3T30A 1QJY1 2ERFA 3N7LA 2IXHA 3ZR6A 5GLZA 1OF3A 5IHRA 2QZ2A 3IN9A 3VN4A 3U10A 4HPKA 1QJU1 5JMCA 2WQZC 3ZVXA 5C5UA 3V56A 3ZFFB 5FYBA 1D4M2 5DZFA 3AMMA 3C2UA 3ELNA 1ASJ1 4XABA 1OFNA 4JGYA 5LEKA 1RUC1 3N9PA 1QU0A 4GQ7A 4C0BA 5KHKA 3SISA 1PIV3 1W90A 2DUQA 2OQ7A 4MXWA 3WP4A 2W2IA 3POSA 2AREA 1UYZA 1PM7A 4GXLA 3WF1A 3MIDA 2VH9A 4M01A 4Q26A 4QB6A 5FZAA 3D0SA 3JBG2 1CONA 5F7UA 2E63A 3I2DA 3KHCA 1CAXA 3LEKA 5FYSA 3DPRA 3O0WA 3VKOA 1E5SA 4YNIA 2VCCA 4GB31 1UN1A 1RIRA 2XWJB 3HQRA 5DG2A 4AXOA 1J1LA 1RUD2 2W9XA 3N9MA 2HYKA 3S5AA 4BB3A 3AP7A 2QUOA 1SG3A 4XURA 1IGOA 5FREA 2G9ZA 4QAWA 4FPLA 4B4QA 3I2OA 1VBE1 3WW2A 4LO4B 5T5OA 4CDXC 1WMFA 1FXZA 1RTVA 3NJYA 5FV3A 1HQLA 1JU3A 3KWVA 4CCJA 1W6NB 1WCKA 1ZBA3 3NNLA 4Y24A 4COWA 4G9SB 1JYNA 5K8SA 1S0GA 1X8EA 3A0NA 5EJ3A 2Q30A 1Y3TA 4BDVB 1DGWX 1U5IA 1FYUA 3AKQA 2BQPA 2IZWA 4IERA 4MVTA 5J1XA 3OG2A 4XHXA 2WFF2 4N43A 4BCUA 2A3XA 3CL1A 4XOGA 5ANQA 4BE3A 4CYDA 1XSQA 5B4XA 4HXCA 5FYUA 3SEPA 3T4VA 4ASMB 4CU9A 4XUTA 4KU8A 3ASIA 3BUCA 3ACIA 2CGPA 1W0PA 3GJAA 3GZTB 1IPKA 1WZXA 3B00A 5AC91 3GBWA 3LFMA 4A3XA 3H7JA 3JXSA 1GFF2 1ZBE2 4CEWB 2Y0OA 3S30A 4XILA 5FXZA 1GUIA 1T2XA 4IV3C 1IG0A 1ONAA 3PDQA 1UXXX 2W46A 5CFDA 1QJY2 2A6YA 1WKYA 3D5OA 1DGRN 3SITA 4E2GA 5GZCA 1H2KA 1CZTA 5LATA 3VBOA 4JZRA 1W2OA 2JG9A 4D7TA 4FPGA 4CSWA 5JDBA 3VBFC 3WDXA 3NRUA 5FUPA 1FV3A 4YYOA 3ZFGC 4BXFA 5JCTA 4ZHNA 3NSTA 5LBFA 1YNAA 3FHAA 1SQ4A 3GGLA 1W06A 3LA7A 5HPOA 1MS5A 5DG1A 1RMU3 4AFAA 5DXDA 4HLTA 4LLOA 5IK7A 1OLQA 3LPFA 1XU2A 4I0AA 4XCBA 1HLCA 5ANNA 4GMP1 3ZXKA 5L7OA 2QTWB 1BXHA 3JB8A 2UWAA 2DU1A 4F3JA 4PJYA 2IXIA 4FPKA 1ND2A 2Q8CA 2WA3A 4ONUA 4CRQA 5JSOA 3ACGA 1GKBA 3T1MA 3TB0A 3HVDA 3VD5A 4QDQA 2VZRA 4ATEA 1ZZ6A 3MPPG 5GM0A 4YLZA 3H0OA 4BISA 1O59A 1ZYBA 1XNBA 3SC7X 2EXJA 3WCSA 5FYYA 1DDLA 2VZUA 2D44A 3UL2A 3O1TA 2J1TA 2R072 5E89A 1YJKA 2D5HA 3Q8AA 2HWB2 1FNYA 1RUNA 1K5MB 3AP9A 2NMNA 4FQZA 3AL5A 5A3LA 5CKMA 1RUG2 2ETEA 3WNXA 4FAHA 1WLWA 4NHYA 3OGSA 4FI9A 5HCBA 1OA3A 1PVC3 3NVCA 1OLMA 5JLVA 1V6NA 4BOWA 4L97A 1KD7A 2ZZQA 2RDNA 2VQUA 3R4DB 1H8TA 2JWPA 3KT1A 2IFWA 4YG3A 3JQWA 1JTZX 1OMIA 2PYTA 3H50A 2XWBB 3DV8A 2ENRA 2A3YA 4WBBA 3A0KA 3LKJA 4MOAA 3RMXA 1W8FA 1OA2A 3LFIA 1HIXA 1GNHA 4XYXA 1YWKA 5IT6A 4K1YA 4L8QA 1UZWA 3VZJA 1GZCA 1F5FA 5FXWA 1X8MA 1X82A 2WYSA 3POGA 5FZIA 1XPWA 1YI7A 3NNFA 3RZZA 5C4WC 3AXEA 1FNZA 2XVKA 3WLUA 5C9AC 2P6CA 2VUCA 3Q8BA 3MW2A 4UWDA 3AYEA 5EFUA 1NAEA 4Y26A 2R0HA 4AQTA 4Q4W3 1VAKA 4XZUG 1XE7A 3ZYIB 3KT4A 3MIBA 1G9BA 2WYFA 2XJPA 3I3MA 1VBD2 3ORJA 1Y9QA 3A22A 5GLVA 5A7OA 1I1EA 1UMHA 2ZMLA 4NVPA 4PDWA 4XDPA 3UV9A 3VHOA 2WL1A 3VDBA 4I02A 3OUHA 1N3OA 2Y60A 3WP6A 2XHKA 3PIGA 2Y0IA 4R4XA 1CZVA 1YI9A 4RN5A 3W59A 1GWKA 4Q8LA 2ZJCA 1H9PA 3OPWA 4BK5A 5F5AA 4AGGA 1RUC2 1H1MA 5CZKA 4RS5A 1UY1A 3O0VA 4AL9A 4AQSA 2QQKA 3ZN5A 4LQRA 2ZX3A 2XDVA 2YGMA 1AR61 3K48A 3QACA 2CDPA 4LK6A 5K4LA 1W8OA 5CAZA 5ACA2 2EIGA 3MLLA 1JZ2A 4LKSA 5KXCA 1FV2A 1AR62 1DQ5A 2FCUA 1AR92 1RVF2 1OH4A 2DV9A 1FAYA 4QMAA 2ZS6B 4QGLA 4CZSA 4N53B 2AGSA 4WM7B 1YYNA 4BIOA 2Q1MA 3GZUC 3P3PA 1C57A 1KS5A 2P1BA 2VCAA 5ERLA 1AR71 4CU6A 1R1ZA 4GA9A 1FOD2 5E8AA 3JZVA 1AYN3 1ZA7A 2EXIA 2HWB3 3NNGA 4IEPA 4XEZA 5KHJA 3RZGA 2MPFA 5JOYA 3BODA 5C8CB 3ZIWA 3CBNA 3FBYA 2AC1A 3K4ZA 2RS32 4LBQB 1NY71 2D93A 3AXDA 3WZ1A 5IWFA 4BXSV 5KR7A 2IWGB 4UW5A 5FP3A 2PLV1 2VBDA 4Q4Y3 1J84A 3TBDA 3TEZA 1QDOA 1IS5A 5HV0A 5JOXA 3POEA 2AYHA 1POV0 2RS52 2GC0A 2XJSA 4M4RA 1TMF2 5E16A 3LEIA 3DYMA 3GALA 2OZJA 3KF3A 5LB6A 1ZZCA 4XJ8A 2V72A 5K0UA 1VE0A 1KJLA 3ZYRA 1G9DA 3V0AB 4K20A 4XF9A 2R32A 4Q4V3 4AHXA 2BNNA 2FBEA 4JKKA 4EN9B 4PIXA 2IC1A 4MH0E 5D1IA 1R1A3 2W68A 5JSPA 2JICA 4NWVA 3RWKX 2DYCA 2WC2A 1TNFA 3NJZA 3IKWA 3VBOC 2E7QA 3E1F1 1VBD1 5JSRA 1IOAA 1TMF3 4RGAA 2QQPA 2VCMA 2Z5WA 4AF9A 3DPRC 5A6YA 5LY2A 1VRH2 4Q0UA 2GDFA 4ZU7A 1FPN3 4RA0A 2W91A 5LRRA 1W39A 5JXJA 2K9ZA 2VOVA 3BGAA 4ZZ5A 1IS4A 2EF6A 2X09A 3DECA 4HKOA 4UW6A 5FZ8A 5L73A 1UD1A 3WX5A 2DTWA 1UPSA 2R041 5HI0A 2HWF3 2VMHA 4GWNA 1O8PA 3WG1A 1VAMA 3ZXFA 4AFDA 3I2JA 1Z78A 1DYPA 2XLGA 4NPRA 1LOCA 3S0MA 1DU3D 2JDZA 2PQQA 4FTEA 4J1XA 5FMOL 5IK8A 3PUQA 2AZ5A 3EQEA 4NPLA 5JVVA 3MPBA 4CP1A 1JYCA 3AMHA 3EJKA 4OUSA 4HVQA 1FPN2 3IDCB 5DN2A 4JKMA 3AMQA 1NXD1 1H2NA 3DCQA 1GV9A 4UT5A 4MGKE 5FAXA 2PHLA 4F7ZA 1LU1A 2W95A 1W04A 1RC6A 2RDSA 5FZMA 4Z8BA 2WFPA 3CJIC 3IM0A 2H0VA 4S2HA 3N4MA 2XONA 3KCYA 2Y6HA 4Q4X1 3I59A 5L36A 1AR63 3NQHA 3POWA 1PGW1 1VBA1 2XJUA 2ZGRA 2ZX4A 3WXPA 4LT5A 1XE0A 1W6QA 5T52A 4N53A 4WM7A 4W6YA 1QH6A 1C5IA 1RUG1 1W8ZA 2W5FA 3POIA 4SLIA 2GMMA 4LUMA 4AI8A 4D6SA 2LS6A 3ST7A 1RHI2 2WUHA 5FMCA 1F31A 4CDUC 3OYWA 1LHVA 4DPNA 3ZFGA 1JUHA 2JB8A 4QKBA 4WVZA 3HR9A 1EYBA 4LBOA 3OGRA 2QZ3A 1FMD2 3JBG1 3E5UA 4BQ3A 4KWKA 2VMIA 4I3GA 1PO21 3EMRA 4CXXA 1JZ3A 1OPOA 1BMV1 1HQWA 1AL0G 1URXA 4PIZA 1OA4A 1QJX3 2JDAA 2Z69A 3LIHA 3POJA 3PUSA 2RS53 3S57A 1L3JA 3BPSA 4AEDC 3F95A 2V4AA 1LR5A 2Q1ZB 4DEQA 1OKOA 1X7NA 3SKVA 1H6XA 4Q4X3 2WT2A 1LGCA 3PUAA 3R0RA 3WF3A 4CP9A 4XQWA 3MFCA 4N90A 3WG3A 3H3UA 1Q56A 2YHJA 4BK4A 1LTEA 1EV12 1SLCA 1ZREA 1EPZA 1KDMA 2A7AA 2E9QA 1HB1A 2R042 3J26N 3SCGA 2OVUA 3ZFEB 1UPIA 3MLJA 3LEGA 1SDDB 3WR0A 1NUKA 2VNOA 3DL3A 5GLWA 1CAWA 1MZ5A 3RG0A 2PAKA 4BLJA 4ET7A 3V0BB 3KV4A 4EYUA 2XBO2 2ES3A 4R9CA 3ZFEC 1FPN1 2VBPA 5D8AC 1W0NA 4KL1A 4KNCA 1AJKA 4M3CB 1NZCA 2VECA 2EXHA 5H9PA 4OQ9A 4DEVA 5FZOB 4FPEA 2VNGA 4JRAA 3OJBA 4EZ4A 3THDA 4NJ4A 1HN1A 3BTAA 3ALQA 4LR4A 4MX3A 1DQ6A 3OTFA 3DGTA 2VZ1A 5F2WA 4CP9B 2JDPA 1JXNA 1HB2A 3HWJA 1XC6A 2IVJA 1YEWA 2OUJA 3NW4A 5ABJA 4KBZA 3PVBB 3DN7A 3N36A 4PT6A 4AW7A 3GM8A 1UZVA 2HKXA 1EAH2 1NA1A 1NYWA 1W6OA 2R063 1DHKB 3AK0A 4JGZB 4LBKA 2UY8A 4HANA 1RUI2 3BIEA 4LHKA 2Y6FA 2R1BA 3MF6A 3PUIA 1R092 1SLAA 1YQ2A 3UKTA 2VW0A 4DFSA 3Q8FA 3U0ZA 5FQ0B 2XBO1 5FYCA 2JKXA 2R49A 1SCRA 1XYPA 2LROA 5FJHA 2RVAA 5DZGA 3RYRA 3WDYA 2BEOA 2SLIA 2WT1A 3ZKYA 4LORA 1PM4A 3SLIA 4JQRA 3OEAA 1REEA 1K5MA 1IQDC 1U5XA 4XIOA 1NQJA 5CYYA 5JOWA 1BVVA 2PA7A 4Q4V1 4QX3A 5GZEA 2YG0A 5DAPA 4BQWA 4P9XA 1OOPC 2CGNA 4EWDA 2CDOA 4LO6B 1LNSA 2VMCA 2E7AA 2WFF1 5IFTA 2ZABA 2D3SA 1QIQA 5CBLA 2DVDA 3T2QA 3W58A 1K42A 1GQHA 2D40A 1RUE2 5HXVA 1ULEA 2WNOA 4W6WA 2MNGA 1ZRRA 1S0JA 2YC2A 4GMP3 4IEWA 2P6HA 4DXTA 3WT3A 2DCYA 1ENRA 2GALA 3UESA 4AHZA 4DXRA 1EV13 4NAOA 1POV1 1GOHA 2LRPA 4K1ZA 1W8UA 3I3DA 3H8XA 4IGOA 4Y22A 3CDZB 3J7HA 1QDCA 4LBNA 1O3QA 1UY0A 3WNMA 1RINA 2WN3A 4XFBA 1PNGA 2VZ3A 3LZZA 3PMEA 2RMU3 5FYHA 2WN2A 4XUPA 3IWZA 4Z2WA 4D69A 3NWKA 2X5IA 3J7NA 4L0PA 4Q4V2 3WG4A 5EWSA 2CWMA 3T0AA 4LPLA 3E5QA 4XACA 4AEJA 3ACFA 1C3HA 2W1QA 4LKEA 5I8TA 3MICA 2JJ6A 3D6EA 5LBCA 1DP0A 1XNAA 3UGHA 5IAXA 2JE8A 1VBB1 3C7GA 2TUNA 5DAWA 1QJX2 4EJRA 3LA2A 5CIRA 1W05A 3VUOA 5L9BA 5FPZA 4MUVA 3TEXA 5IVCA 4A7YA 5BNOB 4QKDA 1K12A 2VUAA 1V6LA 4TZDA 1QJU2 2P34A 3O1PA 3NKGA 2B9VA 2BOIA 4XJZA 3AZXA 4FXKB 4LJHA 4PBPA 5C70A 2Y6LA 2JDMA 5JPMB 1GOGA 2MHFA 3EBRA 3GYDA 1UIJA 2VVFA 3VGIA 4OI4A 2Z2SB 1J3RA 5JUVA 2QQVA 2QQLA 3MHZA 4IDZA 5FP4A 3B3QE 3J7LA 4ZZ8A 4JV4A 3PVEA 4BLIA 1A34A 2ZHNA 5A7SA 5AFEA 5KHIA 4M4PA 1AYM1 3BN6A 2R073 2HEWF 4RQPC 5EYYA 4YG6A 1X36A 4JGYB 4UFMA 5FXXA 3VBHC 3N7JA 3W5MA 2QQIA 2GC2A 1LOBA 2VQAA 3B94A 1ZRFA 2X8KA 4D7YA 2B39A 2J1AA 2G9FA 2RJLA 3AYDA 4YM3A 5C5TA 4AVBA 2DCZA 5JI9A 4CA9A 3O1OA 1V9U1 1ND2C 3JD73 1CVNA 4MHRA 5AVPA 1OD5A 1HXS2 4LUKA 3O14A 1DZQA 3MIEA 5FZFA 1JYXA 5DABA 4PIYA 2YPJA 4K3UA 4XFCA 2VZTA 1BZWA 1W28A 4MGIE 2WQ4A 1ZBE3 4XMAA 5CVRA 1NY72 2XR4A 1WBLA 2WNVB 4OHXA 3ZYJB 1N3QA 2YBKA 4JTNA 1LGBA 1WMEA 2I45A 4NHLA 1D0HA 3TNQA 3A23A 3ZYBA 4AFCA 5BPXA 4GIQA 1G9FA 1NKGA 1W6MA 2ZPXA 5FR3A 5FUNA 1B35A 1VLNA 5IAVA 1B35B 2VR4A 4BMEA 1AR93 2I74A 2QNKA 4H55A 4LULA 5HCFA 2D6LX 4GD4A 5HBAA 1PK6C 1N1SA 3BU7A 1S2KA 1JH5A 2G4IA 2W52A 1HJGA 1AXYA 4V2WA 1H4HA 4AHWA 1US3A 4D7SA 3AMNA 2Q5TA 3U37A 4OMDA 2ZX2A 1FX5A 4XW3A 3VZNA 2ZHLA 1EY2A 3QLQA 2FD8A 1QQP1 4ZXEA 5DAXA 5FZ9A 2IXLA 1MS9A 1ST8A 1XOYA 3RYPA 4BU2A 3BI3A 2AEZA 1S0BA 2ZGUA 2BU9A 4RHV3 5DQ0A 3WHUA 1HRI2 1WCQA 2WAAA 4XFFA 5I8SA 1R083 2NMOA 2PLV3 1J83A 1Z7S3 4YGDA 1W2UA 1SHWB 2X05A 5JAXA 5C4WA 2ARAA 5AVAA 1UU6A 2BW8A 2XBO3 3THTA 3RZHA 1F8VA 2D6PA 3FC0A 5C9AB 2RMU1 4ZPIA 1JUIA 3T2TA 5ACA3 4K40A 1JU4A 4XUOA 2V5YA 1AUYA 2ZXQA 4NOTA 1ZBA1 1VAVA 3TYJA 4FQ4A 4CE8A 1YC61 5BNPA 1K5MC 4YRDA 5FY0A 1R082 3CJXA 2XLAA 2TEPA 1GP4A 3KZ4C 3RDIA 5FK7A 2IVIB 2WNUB 4OFGA 5FFOC 5ISLA 2CTVA 4XJUA 5J96B 4BH9A 4OQ8A 1AYN2 1NX9A 4QDRA 4XAAA 1RXFA 2W94A 3T4HB 4O9EA 4L9BA 4LA2A 2A5ZA 5EYXA 4M3CF 1GWMA 3M70A 4XFGA 2ATFA 1MQTC 4CCLA 1CD3G 1L7QA 2JX9A 4A42A 2OZ6A 5A7WB 5LW9A 1AX2A 1UWWA 4Y1ZA 4WM8A 3USUA 4FTSA 2BP6A 2E6VA 5FZHA 4NHMA 1CQ9A 1KDKA 2ET7A 3LDKA 3LDRA 3OY8A 5H9RA 3IMNA 3WP3A 1VBA3 3S7IA 3JD71 1F4AA 3KLSA 4XBLA 3NAPB 4CDWC 4L11A 2JIGA 1SLLA 4Q0VA 1AL23 1PZ7A 4TWTA 4W6XA 5DUWA 5F37A 2JB4A 2L9LA 1QKQA 5A32B 1S0EA 2ZEYA 1A8MA 3VKMA 3O12A 4H3WA 2CHHA 4NO4A 1OUSA 3VDAA 4DY5A 3RZJA 1RUF3 2A1XA 3L2HA 2I2SA 3HT2A 3HJRA 3WF2A 1OHFA 1LAJA 5LEJA 1QOSA 4E4HA 2WNVA 3OEBA 1TME3 4DINB 2BERA 4JQTA 4IEOA 1QJX1 2TNFA 1YQ6A 1UYYA 2PMWB 2QVSB 3NV2A 3H3LA 4RSUA 1MR5A 4KGGA 1RYYA 1DLCA 1GMMA 2RHPA 2VTFA 2DCJA 1RGSA 4DUXA 4F83A 5GZDA 3I3EA 1QMJA 5FY1A 1UX6A 3EO6A 1W8HA 3VLBB 2CSGA 2Y38A 1C28A 1HRI3 1RUD1 3KB5A 3Q8CA 3T08A 3ZIXA 3ZO0B 4BQ4A 4D6RA 2VXJA 4XZPA 4AI0A 4CVUA 3T09A 3TEWA 3IIAA 5C3QA 4KI5M 1PMHX 2D3PA 4Q4W2 1LB2A 5G04L 2RR13 5FPXA 5KC5A 3FWEA 3PURA 4RQPA 3ZYFA 2HBTA 4W50A 3TWIA 1Q8QA 2C5DA 2F4PA 2OA2A 3ENRA 1HKDA 4QPGC 3HN3A 2VUJA 2ZKNA 1AHSA 1C4RA 3ZDSA 4YW2A 3VBRA 1AR72 1ULCA 5FZ7A 3AZWA 4Y5TA 1EAH1 1W9WA 2X5IC 3BALA 4LXLA 4AYUA 5BNNA 2GNBA 5IVBA 1ZRCA 5LA9A 5FDBA 3GBFA 1AJOA 5FY7A 1ULDA 1V6JA 1ZZBA 5CB7A 2E33A 4MGSA 3USSA 2BWAA 3WDUA 1BMV2 3H3ZA 3ZSEA 2RS12 1V6KA 4A7KA 2XPJA 1JZ8A 3BTZA 1W3XA 1LU2A 3I3BA 2JXAA 4IEYA 2VVDA 2EXKA 4RYDA 1WW6A 4Y3OA 3KF5A 4P9IA 3MLKA 2HLEA 2VNRA 3ILNA 2ZEZA 3CLPA 5FZOA 1LKNA 1OD3A 5D8AB 3FHQA 5FOJB 2UY9A 1H1IA 4YW7A 4FAGA 1DZRA 2P17A 3M4FA 5M0TA 3KCCA 4NUBA 1EUTA 2ADEA 3B69A 1HQNA 5A1AA 1W0OA 3SH4A 1AZDA 2VZOA 4CUBA 3SHRA 3JB4C 5FZ1A 1PMJX 4RGKA 2DWRA 4DMIA 2XKPA 4B4PA 1RMU1 3M3OA 4IE7A 3ATGA 2BZDA 3JQXA 1HJFA 1WA4A 4EQVA 4E4DX 1RUI3 1SPPA 5EHDA 4OI1A 5FTTC 1V6OA 2XL7A 2R061 5GLTA 2D3RA 3KS7A 2BV4A 3AKSA 3W21A 4QHBA 2ZGNA 4IGPA 5I8YA 5I0DA 1QQP3 1BVP1 2VW1A 2GU9A 4WVMA 1CPNA 1D2QA 3M3QA 1KS4A 4HKWA 4CDQC 3KV6A 3N9LA 5AFBA 1KRIA 1GLHA 2E31A 4AEDA 2HWE3 1GR3A 2WZR1 4AEDB 4YZ2A 5C3RA 1JZ5A 1CIWA 2P3KA 3T2PA 2XJQA 3QH7A 3H8RA 3AFGA 3K46A 3PUHA 4BM8A 4N9IA 4XC9A 1VBC3 1K3IA 4LTAA 1TE1B 1FMD1 1CAVB 3O0XA 2QQNA 2DF7A 2EIEA 2GH8A 1J59A 4QQ2A 1RUI1 2A6VA 3LF7A 3WF4A 1GZWA 1SDWA 3ES4A 3C7FA 3VZKA 1U5ZA 3ME2A 3VZLA 2RR12 3WG2A 3O1VA 1QF3A 4FSJA 1LOGA 3BOPA 4GAZA 2B9UA 1AL22 3ES1A 1VBC1 4Q0PA 4Y33A 2LW8A 4MLOA 5LBEA 2YFZA 1ENSA 2JG8C 4LOTA 5FY9A 3BYWA 1NXMA 3S5QA 5JXHA 1NQDA 2W39A 3IDAA 4FP3A 3THCA 2G9GA 1MQTA 5BNOA 3GNEA 5LWBA 4INDA 1DGWA 2CY6A 1E5RA 4K8RB 1SFYA 3ZXJA 4ZONA 1C8M1 1Z7S2 5C71A 2WBKA 5LCWL 1PZ9A 3I97A 4LHSA 4MV2A 4MGYE 4GMP0 4GH4B 5CA6A 2C4XA 4MSVA 3SCFA 2J22A 1VP6A 2NYYA 1NCQC 2GNMA 4K8FA 4AFBA 4RD7A 1LGNA 4IEVA 2GNTA 2GH2A 4B1LA 1NA1C 4HL0A 3PTRB 5FZLA 3IPVA 1ALYA 3TN92 2F6BA 1WD4A 2B4KA 4YW6A 5A6ZA 3ZXAC 1TG7A 4GZ9A 4NWWA 4N8MA 3M3IA 2VW2A 3CKHA 2HWF1 4QPIC 2WJSA 2WAOA 4FOQA 5T55A 3VBUC 3WF0A 1VRH1 2CL2A 2BFUL 3M3EA 4JCKA 1MEC1 4OZXA 3VBOB 2OS2A 1BYHA 4YW3A 3FHIB 4O7XA 4AHYA 4KWJA 4QPWA 2EIDA 4KBBA 1PGL2 4ITCA 1S0IA 1UXZA 2DU0A 2BOJA 5JR7B 4AEKA 3PU8A 1GQPA 4OVEA 1HB4A 1VALA 2WNUC 4Y1VA 2C24A 2JE7A 3A21A 3DXUA 1PO12 1WBFA 2DFCA 3D82A 2O8QA 4CCNA 5FOBB 3AX4A 2DURA 3LOIA 4C0HA 4YVWA 4RFRB 1S1AA 4HN1A 2D6NA 2VPVA 2DVAA 2JE9A 3AP6A 4CXYA 1O3SA 5A32A 1SBFA 2C26A 4CCKA 4ES9A 2X29A 3KMHA 3K2OA 4AAXA 2ARCA 4J1WA 4BQ5A 5LA0A 1LOEA 4QPGA 1CAVA 1U0AA 2GMEA 4YARA 1C5HA 3S7EA 2IFRA 2O8OA 2XVLA 5K0UB 3V0AA 1VRBA 3K77A 5SV8A 1UMZA 1W3VA 2GN3A 2PAEA 3F2ZA 4DUVA 1PO23 5LK5A 2JG9B 1XU1A 1X9PA 2XVGA 5TSWA 1RHI1 2JEMA 1NLSA 2RE9A 1W6PB 4FOYA 4QPYA 1MVEA 2K46A 2VOWA 2YU2A 4LIUA 3POYA 1XNCA 4AVCA 4BYYA 4MZUA 2ZGTA 3U1XA 3VHRA 2XJTA 1REDA 1CN1A 3LOBA 3KSCA 1C8NA 4FTBA 2CYFA 3O5SA 1WLDA 1UZYA 5JWPA 1CJPA 1SLIA 5DUUA 4FT8A 3RYKA 4DZGA 3PVOA 5J7MA 1PK6B 1ENXA 3MO4A 2WIIB 4FBFA 2VC9A 3LDBA 2BGPA 1WW7A 2P37A 1Z0HA 3HNYM 4ISQA 1JYTA 2X5IB 1B35C 3IAPA 4NMIA 2DCKA 2KD7A 1A3KA 2PHUA 3LE0A 3N9QA 4XJWA 4COYA 2P3IA 2QBXA 4UOJA 3LIGA 2D6MA 3MW4A 1N1YA 4PF1A 3VZOA 4AQ2A 1W9FA 4FFHA 3DYPA 4QXCA 2ZTNA 5DUVA 5FMOS 4H14A 1RUJ2 1RMU2 1UCXA 3B93A 3OGJA 2DBIA 1D4VB 1YHFA 2B42B 5I0RA 2WSUA 1GQGA 1LOAA 5C7GA 5C4WB 4N7IA 5DZEA 2PTMA 4XFAA 1HDKA 3E5XA 3WW4A 2WO7A 3I2GA 4IEXA 4C1XA 4I3PA 2A6XA 4PI2A 3CIHA 3PVNA 5EP9A 5A7WA 1YUDA 5FK8A 3I3QA 4HONA 4Q0QA 3W5NA 2OPWA 5FY4A 3KQ4B 4YGCA 4LBMA 3D0JA 4Q1PA 4UBHA 1S55A 4RR3B 2W0XA 4H7LA 2R0FA 1J1TA 2GC3A 1H6YA 2RJ2A 3VBSA 4XXAA 1D4M1 2F4LA 2QQJA 2ZAAA 1IQAA 1RUC3 3DF0A 3NV1A 2QDRA 4FPOB 3RS6A 4EWEA 2XXZA 1REFA 2XMLA 1UO9A 1DZTA 4AEMA 1YO8A 2WLPA 1ZX5A 1O4YA 4PBOA 3PTYA 2VXRA 4QM9A 1FMD3 3GF6A 4DUWA 2RDRA 2CV6A 2MEV1 3MYXA 3L2YA 4OI0A 5JZGA 4QQPA 1PVC2 2KXLA 3TEYA 4LHNA 2PHXA 2XB6C 5L19A 3I8TA 3ZPOA 5BNQA 1N3PA 1YIFA 5C3OA 5LBBA 3K51A 1W6QB 4LK7A 5E6HA 1CX1A 1UIKA 4DS0A 1B09A 5HV4A 1MVQA 1PZ8A 1UX7A 4XAEA 3IT8A 2ID4A 3VBSB 5CISA 5DAQA 1Q3EA 3DKQA 4META 3U4SA 3KHBA 3J9SA 1MS1A 5FP7A 3ZYGA 4DY3A 4XF4A 3LCPA 4GH4A 1BBT1 4EE2A 3THPA 1RJ7A 2RS33 4EN7B 1MACA 2YV8A 4QX8A 4XF3A 1NT0A 1SZBA 5E1RA 1UZZA 5C3SA 3R05A 1UZ0A 1G9AA 1NCRC 4I30A 5T5PA 2Y64A 1GP6A 3IAQA 4KWLA 4WVVA 3VKFC 4QPIB 4NIDA 4UBGA 4KG0A 4RS5B 3VBRB 5F3CA 1NE4A 4ISRA 4PLOA 4NHKA 5DDJ1 1QJEA 4XTPA 1RUJ1 1DQ0A 4X8NA 1LOFA 2VULA 5J98B 2JDHA 3UGFA 4M3CA 4KMQA 2HEYF 3J8F1 2W1UA 1D2SA 2FDGA 1YLLA 2XL9A 3VBFB 3ZMOA 2W1SA 3FLRA 3FX3A 5JZGB 1K45A 2I07B 4IE0A 3ZPYA 1CAUB 1NCQB 3H1YA 3WDTA 4OHWA 1GP5A 1PX4A 4YWAA 2FDFA 1YQCA 2GNDA 2VZPA 3HMYA 2Y6KA 5FLIA 3HQUA 2QE3A 4YGBA 5A3PA 4L92A 2AH2A 3ZMNA 5A7PA 1O91A 2FZ1A 4CEWC 1MS0A 2UWBA 4CDUA 4B3NA 2HWD3 1PGL1 1RUE3 4IGQA 5EZWA 1H8TC 4QB1A 5EJ1B 4ASKA 4XUQA 1GNYA 3NJVA 1EAH3 2D97A 4CEYC 4LHLA 4F8AA 4JAAA 1YJLA 4RR3C 1VMHA 1PO11 2A71A 3WW1A 4QD2A 1PNFA 1UNBA 3LAGA 1IS6A 5FY5A 2XQRA 1OURA 4OUEA 5IUQA 3FE5A 3ZYHA 2JECA 5C8WA 4I2OA 2BRTA 2VQ0A 5BNPB 4MGQA 4ZS2A 5JXIA 5CKNA 2ARXA 1SACA 2HWC1 3DXTA 2GC1A 3ZKUA 3BOWA 1XNDA 1ULFA 4Q2FA 2IXKA 3GBGA 1M4WA 1JI6A 4NIAA 3I2KA 4QGMA 4B1MA 4QQLA 2RS51 1XBFA 3QOPA 4NHXA 5AC93 1SEFA 2YXSA 3FBMA 3H8OA 3HIFA 4QGNA 2D6OX 1L7LA 2MEV3 1UY2A 1D0GA 1F9KA 2PELA 2V5DA 5EJZB 2DBNA 3IBMA 4A3ZA 3I2IA 4WM8B 3USUB 2VU9A 4B29A 3OPZA 4PF5A 3QD6A 2DVGA 3GHMA 4YFZA 3R4UA 4CDQB 1UOGA 4G4FA 4JHTA 2WNVC 1O3TA 3AYAA 4ZXKA 5K9YA 4LEJA 4CUAA 5BV6A 2YB7A 1IPJA 1QXRA 4Q5OA 1TME1 4K7JA 4LE4A 3JCIA 4K6BA 1VR3A 2KR2A 4S2DA 3BU0A 3VD9A 1TVGA 3ZR5A 1ND3B 3AYCA 2YC0A 1MZ6A 1RL3A 2B46X 1QQP2 1W2NA 1TQ5A 5FO9B 1OUXA 2BNMA 4E8DA 1GNZA 4AVSA 3DEMA 1OC1A 3ETQA 4IXLA 4BMBA 2VD7A 1CESA 4RQPB 1CAWB 1KEXA 2OPKA 4RL7A 4YVSB 4URAA 3AKRA 5IATA 5FZKA 4Z92B 1M06G 2A73B 1XJAA 4LKFA 4DXSA 3OY8B 4Y20B 1UYXA 2RM22 4P9YA 2AUYA 3NNMA 4YM2A 3BTYA 2Y6GA 1UY3A 3BPZA 3V65A 1LEMA 5I0UA 1UOBA 3AKTA 4E9KA 2O0OA 1YIPA 1CWPA 1EP0A 4MHUA 1XNKA 3E6CC 2WSVA 3LSEA 3Q8EA 3HNMA 4KQ7A 3O1MA 3G6JB 1PIV1 1ZA4A 2GZWA 4I09A 1TME2 1C1FA 5BNNC 5GZFA 3CZJA 1R081 4QQOA 4RFT0 2JIJA 1ACCA 2BVVA 4P9JA 4QHOA 4HSLA 5HXMA 3IDEA 4RHV1 4LA3A 2HWC2 5JXGA 1OPMA 1SLTA 2J1SA 5F1RA 1VBD3 3M8LA 4X8PA 3BTXA 1BEV3 2QCSB 2HEVF 4R9BA 1OOPA 3LPGA 1JOPA 4CU8A 1QHDA 4Y20A 4ZY9A 2EALA 3AP4A 2DUOA 3WNLA 3OD4A 1OF4A 4Y1XA 3SH3A 1WW5A 3TRSB 1V70A 3ZDVA 2ZA9A 3VBUB 3A4UA 5ACA1 4M0HA 4HBNA 2WA4A 3MIFA 4WZCA 3AL6A 5IVYA 5KXBA 3HEIA 2Q8EA 1T6BX 3ILFA 2Z4FA 2HWC3 3OBZA 1CJDA 1LHWA 1ULOA 2DVBA 5LASA 4HOOA 4IESA 3I59B 4AGRA 3RJ2X 4E2QA 2YMZA 2CGOA 2FMYA 1RVF3 3ZOIA 5CFCB 4XFIA 2VY0A 5L7OC 5FKBA 1S0CA 3UK9A 4CPBD 1GSLA 4NN0A 5D21A 2XQXA 1CPMA 4UAPA 1OFSA 3D4KA 3ZXGA 1AF9A 4JTOA 4Q4X2 4CDQA 1O3RA 2WNEA 4FVVA 4LO8A 4LBLA 1HRV2 2Y33A 1BCXA 3GZAA 3ZN6B 1F15A 1WD3A 4LO5B 5D2AA 5HCHA 4Y4RA 4FFFA 2QQUA 3N7MA 1GWLA 2FDHA 4MGZE 2WABA 1XXNA 5IJRA
chains in the Genus database with same CATH topology
1OH4A 5FUIA 3FL7A 1DYOA 4IUGA 1BHGA 3A7QA 1UMIA 1W9WA 3C8XA 3MBWA 1JZ4A 2VCAA 4CU6A 2YC4A 3D3AA 2E33A 4MGSA 3NNGA 2PQSA 3EYPA 1JZ8A 3I3BA 4RYDA 2VZVA 3K4ZA 4BXSV 2HLEA 2ZEZA 3CQOA 1J84A 1OD3A 1O8SA 3FHQA 4M4RA 4OMCA 3LEIA 3DYMA 5DPNA 1EUTA 3ETPA 3GDBA 5A1AA 2V72A 1JZ6A 2VZOA 4CUBA 1PMJX 2WZEA 4JKKA 4TXWA 2BZDA 3MV01 4JX0A 3K4AA 3I2FA 3E1F1 5I0DA 2W3JA 5DMYA 2JD9A 1PX3A 4JKLA 2E31A 2W91A 1JZ5A 2QQOA 5JXJA 2ZEWA 3BGAA 3T2PA 4ZZ5A 5JMOA 2VJXA 2X09A 3DECA 5LA2A 2WQ8A 3OBAA 1W9TA 3DYOA 3K46A 3PUHA 1O8PA 3WEZA 2J1EA 3I2JA 2YFUA 5JR2A 3HOBA 1K3IA 1GOFA 2WO2A 2QQNA 2EIEA 3WF4A 5DN2A 4JKMA 3ABZA 3C7FA 5IFPA 3K75B 4XVHA 1EUUA 2W95A 3OB8A 2LW8A 2YFZA 2XONA 3MUZ1 2Y6HA 3NQHA 5JXHA 3WNOA 3IDAA 3THCA 3ZM8A 4P02B 2XOMA 2W5FA 5C71A 2LS6A 2WBKA 3HNBM 5LCWL 4A4AA 3I97A 1L7RA 4LHSA 2WUHA 2C4XA 2J22A 4JHZA 2W87A 3P1IA 3OGRA 1JZ3A 3HPNA 2QQMA 2BBAA 2JDAA 2B4KA 1TG7A 4GZ9A 4DEQA 3CKHA 3SKVA 1H6XA 4E8CA 2WAOA 3IB3A 2W1WA 3WF3A 3WF0A 3SKJE 2VQTA 2VL4A 1JYVA 4BK4A 2ORZA 3ACHA 3IIIA 4QPWA 2EIDA 1UXZA 3P6BA 3LEGA 1SDDB 3GXUA 4A41A 1NUKA 1GQPA 1P8JA 2C9KA 4ET7A 3A21A 3WQBA 4A45A 4GWJA 4ARYA 1W0NA 4HG6B 4QDSA 4DEVA 2C26A 3THDA 3AC0A 4AAXA 3VD4A 5LA0A 1HN1A 4KWUA 2VZ1A 3K77A 4OYUA 1ULPA 1XC6A 3F2ZA 2XHNA 2DDUA 4DUVA 1OT5A 1JYWA 4PT6A 3GM8A 3WNMA 2OKXA 1D7PM 3PUIA 1UY4A 2RV9A 1W8NA 1YQ2A 2BGOA 5B4NA 1F4HA 2JKXA 3VDCA 2WZ8A 4QB2A 5G05L 2RVAA 4D8MA 3MO4A 1JZ7A 2VC9A 2BGPA 3HNYM 3OEAA 2Y6JA 3IAPA 2VO5A 2DCKA 2KD7A 5CYYA 3LE0A 1IQDC 4MADA 2Y8KA 4QX3A 2QBXA 4UOJA 2YG0A 4PF1A 3DYPA 1I5PA 2CDOA 1LNSA 2VMCA 3CMGA 5IFTA 4TTGA 3C7EA 2W92A 2VMEA 2W47A 3T2QA 5C7GA 1K42A 2YC2A 4CUCA 3I2GA 3UETA 4DXTA 3CIHA 3UESA 4DXRA 3W5NA 1GOHA 1US2A 2VM9A 3I3DA 3CDZB 3J7HA 4W4ZA 3CZUA 1UY0A 2J1RA 2WN3A 3VD7A 2RJ2A 1H6YA 2VZ3A 2QQJA 2WN2A 4XUPA 5IYYA 2E32A 4OZOA 2J1VA 4L0PA 4PQQA 3T0AA 4GWIA 4LPLA 2J7MA 3ACFA 1GU3A 4DUWA 2W1QA 1XNTA 3WNKA 1DP0A 1XNAA 2JE8A 3C7GA 3ECQA 3WNNA 2R7EB 3VD3A 1CX1A 1K12A 4Z2AA 5IHRA 1OF3A 1CIYA 2VMFA 2B9VA 1UX7A 2ID4A 2VOTA 2Y6LA 5C70A 1GOGA 5JUVA 2QQLA 3SEEA 4ZZ8A 3EB7A 1UZ0A 1UYZA 4QX1A 3WF1A 2Y64A 3IAQA 4M4PA 3BN6A 4QB6A 5F7UA 2ZEXA 3W5MA 2QQIA 3LEKA 5EIYB 4KMQA 2W1UA 2VCCA 2J1AA 3C7HA 3T2OA 2W1SA 2W9XA 1K45A 1W9SA 4P08A 1SG3A 4XURA 1JYXA 4QAWA 1PX4A 5LA1A 3WSOA 4BJ0A 2VZPA 2VZTA 2Y6KA 4YPJA 1JU3A 1JYNA 4BDVB 4QB1A 4D0QA 5EJ1B 3A23A 4XUQA 5J1XA 1GNYA 3NJVA 3OG2A 1NKGA 5B4XA 3C7OA 3SEPA 4CU9A 4P5YA 2VR4A 4XUTA 3ACIA 4XUNA 1KGYA 4OUEA 1MPXA 3JXSA 4MGQA 5JXIA 1GUIA 1T2XA 3LQCA 1US3A 1UXXX 2W46A 3U37A 1JI6A 1WKYA 4OMDA 3I2KA 2ORXA 2EICA 1CZTA 1CZSA 4ZXEA 4P00B 3NRUA 4QX2A 4CU7A 1JHJA 4A6OA 5HPOA 3FHAA 3GGLA 5DQ0A 1UY2A 3MUY1 2WAAA 1WCQA 2V5DA 5EJZB 4A3ZA 3I2IA 1J83A 3LPFA 1SHWB 2X05A 4A44A 2WO1A 4CUAA 2YB7A 3OGVA 3ACGA 1JU4A 4XUOA 3VD5A 4QDQA 2VZRA 3VD9A 1TVGA 2ZXQA 2J1UA 1O59A 2VZQA 2VZUA 4E8DA 2J1TA 1NX9A 4QDRA 2W94A 1R64A 1KEXA 2VMDA 2EIBA 4DXSA 3OGSA 1UYXA 4FI9A 2HYXA 1L7QA 4A42A 3I2HA 2Y6GA 1UY3A 1UWWA 2VQUA 3HNMA 4MO3M 3WNPA 3CZJA 1F4AA 2WDBA 3NJXA 5HXMA 4MOAA 2X10A 4ARXA 5JXGA 4QX0A 2J1SA 2VZSA 2L9LA 2E26A 2ZEYA 3MV11 3LPGA 4CU8A 3VDAA 2WYSA 4ZY9A 1XPWA 4AG4A 3HJRA 3WNLA 3WF2A 1OF4A 3OEBA 1NAEA 2BERA 4XZUG 3HEIA 1UYYA 2Z4FA 1ULOA 1RYYA 1DLCA 1GMMA 2VTFA 2DCJA 3A22A 4DUXA 1UMHA 3VDBA 3FN9A 3I3EA 3UNPA 2V4VA 3T08A 4W8JA 4RN5A 1CZVA 4BK5A 1W99A 2XQXA 4UAPA 3T09A 4CVUA 3K4DA 5CZKA 4KI5M 1PMHX 1UY1A 5G04L 2WO3A 3T0BA 2QQKA 4UI9L 2VCBA 4LQRA 2CDPA 4W50A 1W8OA 3T0DA 1JZ2A 4LKSA 3HN3A 2WABA 5IJRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OH4 A;  5FUI A;  3FL7 A;  1DYO A;  4IUG A;  1BHG A;  3A7Q A;  1UMI A;  1W9W A;  3C8X A;  3MBW A;  1JZ4 A;  2VCA A;  4CU6 A;  2YC4 A;  3D3A A;  2E33 A;  4MGS A;  3NNG A;  2PQS A;  3EYP A;  1JZ8 A;  3I3B A;  4RYD A;  2VZV A;  3K4Z A;  4BXS V;  2HLE A;  2ZEZ A;  3CQO A;  1J84 A;  1OD3 A;  1O8S A;  3FHQ A;  4M4R A;  4OMC A;  3LEI A;  3DYM A;  5DPN A;  1EUT A;  3ETP A;  3GDB A;  5A1A A;  2V72 A;  1JZ6 A;  2VZO A;  4CUB A;  1PMJ X;  2WZE A;  4JKK A;  4TXW A;  2BZD A;  3MV0 1;  4JX0 A;  3K4A A;  3I2F A;  3E1F 1;  5I0D A;  2W3J A;  5DMY A;  2JD9 A;  1PX3 A;  4JKL A;  2E31 A;  2W91 A;  1JZ5 A;  2QQO A;  5JXJ A;  2ZEW A;  3BGA A;  3T2P A;  4ZZ5 A;  5JMO A;  2VJX A;  2X09 A;  3DEC A;  5LA2 A;  2WQ8 A;  3OBA A;  1W9T A;  3DYO A;  3K46 A;  3PUH A;  1O8P A;  3WEZ A;  2J1E A;  3I2J A;  2YFU A;  5JR2 A;  3HOB A;  1K3I A;  1GOF A;  2WO2 A;  2QQN A;  2EIE A;  3WF4 A;  5DN2 A;  4JKM A;  3ABZ A;  3C7F A;  5IFP A;  3K75 B;  4XVH A;  1EUU A;  2W95 A;  3OB8 A;  2LW8 A;  2YFZ A;  2XON A;  3MUZ 1;  2Y6H A;  3NQH A;  5JXH A;  3WNO A;  3IDA A;  3THC A;  3ZM8 A;  4P02 B;  2XOM A;  2W5F A;  5C71 A;  2LS6 A;  2WBK A;  3HNB M;  5LCW L;  4A4A A;  3I97 A;  1L7R A;  4LHS A;  2WUH A;  2C4X A;  2J22 A;  4JHZ A;  2W87 A;  3P1I A;  3OGR A;  1JZ3 A;  3HPN A;  2QQM A;  2BBA A;  2JDA A;  2B4K A;  1TG7 A;  4GZ9 A;  4DEQ A;  3CKH A;  3SKV A;  1H6X A;  4E8C A;  2WAO A;  3IB3 A;  2W1W A;  3WF3 A;  3WF0 A;  3SKJ E;  2VQT A;  2VL4 A;  1JYV A;  4BK4 A;  2ORZ A;  3ACH A;  3III A;  4QPW A;  2EID A;  1UXZ A;  3P6B A;  3LEG A;  1SDD B;  3GXU A;  4A41 A;  1NUK A;  1GQP A;  1P8J A;  2C9K A;  4ET7 A;  3A21 A;  3WQB A;  4A45 A;  4GWJ A;  4ARY A;  1W0N A;  4HG6 B;  4QDS A;  4DEV A;  2C26 A;  3THD A;  3AC0 A;  4AAX A;  3VD4 A;  5LA0 A;  1HN1 A;  4KWU A;  2VZ1 A;  3K77 A;  4OYU A;  1ULP A;  1XC6 A;  3F2Z A;  2XHN A;  2DDU A;  4DUV A;  1OT5 A;  1JYW A;  4PT6 A;  3GM8 A;  3WNM A;  2OKX A;  1D7P M;  3PUI A;  1UY4 A;  2RV9 A;  1W8N A;  1YQ2 A;  2BGO A;  5B4N A;  1F4H A;  2JKX A;  3VDC A;  2WZ8 A;  4QB2 A;  5G05 L;  2RVA A;  4D8M A;  3MO4 A;  1JZ7 A;  2VC9 A;  2BGP A;  3HNY M;  3OEA A;  2Y6J A;  3IAP A;  2VO5 A;  2DCK A;  2KD7 A;  5CYY A;  3LE0 A;  1IQD C;  4MAD A;  2Y8K A;  4QX3 A;  2QBX A;  4UOJ A;  2YG0 A;  4PF1 A;  3DYP A;  1I5P A;  2CDO A;  1LNS A;  2VMC A;  3CMG A;  5IFT A;  4TTG A;  3C7E A;  2W92 A;  2VME A;  2W47 A;  3T2Q A;  5C7G A;  1K42 A;  2YC2 A;  4CUC A;  3I2G A;  3UET A;  4DXT A;  3CIH A;  3UES A;  4DXR A;  3W5N A;  1GOH A;  1US2 A;  2VM9 A;  3I3D A;  3CDZ B;  3J7H A;  4W4Z A;  3CZU A;  1UY0 A;  2J1R A;  2WN3 A;  3VD7 A;  2RJ2 A;  1H6Y A;  2VZ3 A;  2QQJ A;  2WN2 A;  4XUP A;  5IYY A;  2E32 A;  4OZO A;  2J1V A;  4L0P A;  4PQQ A;  3T0A A;  4GWI A;  4LPL A;  2J7M A;  3ACF A;  1GU3 A;  4DUW A;  2W1Q A;  1XNT A;  3WNK A;  1DP0 A;  1XNA A;  2JE8 A;  3C7G A;  3ECQ A;  3WNN A;  2R7E B;  3VD3 A;  1CX1 A;  1K12 A;  4Z2A A;  5IHR A;  1OF3 A;  1CIY A;  2VMF A;  2B9V A;  1UX7 A;  2ID4 A;  2VOT A;  2Y6L A;  5C70 A;  1GOG A;  5JUV A;  2QQL A;  3SEE A;  4ZZ8 A;  3EB7 A;  1UZ0 A;  1UYZ A;  4QX1 A;  3WF1 A;  2Y64 A;  3IAQ A;  4M4P A;  3BN6 A;  4QB6 A;  5F7U A;  2ZEX A;  3W5M A;  2QQI A;  3LEK A;  5EIY B;  4KMQ A;  2W1U A;  2VCC A;  2J1A A;  3C7H A;  3T2O A;  2W1S A;  2W9X A;  1K45 A;  1W9S A;  4P08 A;  1SG3 A;  4XUR A;  1JYX A;  4QAW A;  1PX4 A;  5LA1 A;  3WSO A;  4BJ0 A;  2VZP A;  2VZT A;  2Y6K A;  4YPJ A;  1JU3 A;  1JYN A;  4BDV B;  4QB1 A;  4D0Q A;  5EJ1 B;  3A23 A;  4XUQ A;  5J1X A;  1GNY A;  3NJV A;  3OG2 A;  1NKG A;  5B4X A;  3C7O A;  3SEP A;  4CU9 A;  4P5Y A;  2VR4 A;  4XUT A;  3ACI A;  4XUN A;  1KGY A;  4OUE A;  1MPX A;  3JXS A;  4MGQ A;  5JXI A;  1GUI A;  1T2X A;  3LQC A;  1US3 A;  1UXX X;  2W46 A;  3U37 A;  1JI6 A;  1WKY A;  4OMD A;  3I2K A;  2ORX A;  2EIC A;  1CZT A;  1CZS A;  4ZXE A;  4P00 B;  3NRU A;  4QX2 A;  4CU7 A;  1JHJ A;  4A6O A;  5HPO A;  3FHA A;  3GGL A;  5DQ0 A;  1UY2 A;  3MUY 1;  2WAA A;  1WCQ A;  2V5D A;  5EJZ B;  4A3Z A;  3I2I A;  1J83 A;  3LPF A;  1SHW B;  2X05 A;  4A44 A;  2WO1 A;  4CUA A;  2YB7 A;  3OGV A;  3ACG A;  1JU4 A;  4XUO A;  3VD5 A;  4QDQ A;  2VZR A;  3VD9 A;  1TVG A;  2ZXQ A;  2J1U A;  1O59 A;  2VZQ A;  2VZU A;  4E8D A;  2J1T A;  1NX9 A;  4QDR A;  2W94 A;  1R64 A;  1KEX A;  2VMD A;  2EIB A;  4DXS A;  3OGS A;  1UYX A;  4FI9 A;  2HYX A;  1L7Q A;  4A42 A;  3I2H A;  2Y6G A;  1UY3 A;  1UWW A;  2VQU A;  3HNM A;  4MO3 M;  3WNP A;  3CZJ A;  1F4A A;  2WDB A;  3NJX A;  5HXM A;  4MOA A;  2X10 A;  4ARX A;  5JXG A;  4QX0 A;  2J1S A;  2VZS A;  2L9L A;  2E26 A;  2ZEY A;  3MV1 1;  3LPG A;  4CU8 A;  3VDA A;  2WYS A;  4ZY9 A;  1XPW A;  4AG4 A;  3HJR A;  3WNL A;  3WF2 A;  1OF4 A;  3OEB A;  1NAE A;  2BER A;  4XZU G;  3HEI A;  1UYY A;  2Z4F A;  1ULO A;  1RYY A;  1DLC A;  1GMM A;  2VTF A;  2DCJ A;  3A22 A;  4DUX A;  1UMH A;  3VDB A;  3FN9 A;  3I3E A;  3UNP A;  2V4V A;  3T08 A;  4W8J A;  4RN5 A;  1CZV A;  4BK5 A;  1W99 A;  2XQX A;  4UAP A;  3T09 A;  4CVU A;  3K4D A;  5CZK A;  4KI5 M;  1PMH X;  1UY1 A;  5G04 L;  2WO3 A;  3T0B A;  2QQK A;  4UI9 L;  2VCB A;  4LQR A;  2CDP A;  4W50 A;  1W8O A;  3T0D A;  1JZ2 A;  4LKS A;  3HN3 A;  2WAB A;  5IJR A; 
#chains in the Genus database with same CATH topology
 3H9A A;  4FPY A;  1WMX A;  2JG8 B;  3ZLI A;  4BPZ A;  1YFY A;  4D3W A;  5CG8 A;  2YY1 A;  1DYO A;  2ZZJ A;  1QJF A;  4IUG A;  4P9G A;  2UUR A;  3A7Q A;  3CJI A;  3C8X A;  3ZX7 A;  3OBT A;  2YC4 A;  4Y22 B;  3VBU A;  1O4Z A;  5FZ0 A;  1FI2 A;  3EXU A;  1HV0 A;  2VG9 A;  5GZG A;  5I0T A;  2UYA A;  2VZV A;  2WZR 2;  2R07 1;  1LJ7 A;  3KV5 A;  3RGB A;  1YXW A;  5CKQ A;  2KA3 A;  3CQO A;  4YZ3 A;  1AR7 3;  4YM1 A;  3ZSL A;  3WDW A;  3PNA A;  3KM5 A;  4GJY A;  1WUV A;  2G19 A;  5DPN A;  3D8C A;  3ETP A;  1NE6 A;  2C1F A;  5JPN B;  4XJ9 A;  1UOJ A;  4QXB A;  5FYT A;  5H9S A;  5BNN B;  4UW3 A;  2WZE A;  1F2N A;  4CXW A;  2P3Y A;  3MV0 1;  1TZO A;  2R06 2;  3BVC A;  4UF0 A;  2RR1 1;  3HBZ A;  1AYM 3;  1DCS A;  3BB6 A;  4LLF A;  3M3C A;  4DO0 A;  3OOX A;  3KGL A;  5EXO A;  2W3J A;  3WIN E;  2Y26 A;  1ASJ 3;  4AI2 A;  5HCA A;  2B8M A;  5DMY A;  1VPH A;  1O7F A;  2JD9 A;  5A33 B;  1PX3 A;  3K3O A;  3ZXD A;  3HAG A;  1QJU 3;  2ZOE B;  2A75 A;  4EV0 A;  4FPF A;  4N7U A;  4UF0 B;  5C6C A;  2PN5 A;  2DVF A;  4YW1 A;  4NII A;  2ZEW A;  3NO8 A;  4Q8K A;  5JMO A;  2VJX A;  5LA2 A;  3BCW A;  4COU A;  2WQ8 A;  1A6C A;  2YYO A;  4IV1 C;  1W9T A;  3DYO A;  1TEI A;  5I93 A;  3GHN A;  4QWN A;  2YFU A;  2TBV A;  5JR2 A;  1ND3 C;  3HOB A;  4FPC A;  4XDO A;  5DDJ 2;  1H8V A;  3QCW A;  3ZN4 A;  4AQ6 A;  1GOF A;  3MGU A;  4AFM A;  1AVB A;  3RI8 A;  4YZ5 A;  5FZC A;  1ENQ A;  3ROU A;  3EHK A;  4AVA A;  3B7M A;  5FLJ A;  1KQR A;  5IFP A;  5EV7 A;  3K75 B;  2WNU A;  1HXS 1;  2CU5 A;  2X53 S;  3AP5 A;  4WM8 C;  2LTN A;  2HWF 2;  3JU9 A;  1KJR A;  4XF1 A;  4ASL A;  1X33 A;  3MUZ 1;  1X50 A;  2VTX A;  3WNO A;  5JIA A;  4QPG B;  1C8M 2;  3ZM8 A;  1RUF 2;  4XXP A;  3RRD A;  3NL1 A;  4DRR A;  1HW5 A;  4U2A A;  4Z1V A;  1Q8O A;  4HSJ A;  2GAU A;  4DXZ A;  3AVR A;  4A4A A;  1FOD 3;  4FPH A;  2JDN A;  4QPI A;  4CCM A;  1W8T A;  1H4G A;  1OSG A;  4OUL A;  4M0N A;  1SMV A;  2RJK A;  2W87 A;  4AI3 A;  1UAI A;  2OUH A;  4YFW A;  4TLF A;  5BXX A;  4PHZ A;  2ZGM A;  4K21 A;  5FYM A;  1DGR A;  3VZM A;  4XMI A;  5FBJ A;  2E51 A;  1PHM A;  1Y43 B;  3GCX A;  3WD5 A;  4HN0 A;  2WWU A;  2J42 A;  1DBN A;  4CEY B;  4DOU A;  3FLT A;  4JGY C;  3VBH B;  1IZ3 A;  4XCA A;  2BJS A;  3AZZ A;  2XKO A;  1G9C A;  4FPJ A;  2E53 A;  4QKF A;  4E8C A;  1DQ2 A;  1JOB A;  1QJY 3;  4IET A;  3SKJ E;  4R9A A;  2VQT A;  1GIC A;  3J7M A;  4OCT A;  1O5L A;  2BDR A;  2NLR A;  2VL4 A;  3ZN6 A;  3OSD A;  2BWC A;  5F9T A;  4Y1U A;  1JYV A;  1CAU A;  1JMU B;  2ORZ A;  2EAA A;  5T5J A;  3E6D A;  1JOD A;  4UYB A;  4HET A;  1SBD A;  3III A;  3KVA A;  5F6L B;  1Q8P A;  1V0A A;  3MI8 A;  5IW0 A;  1NLR A;  5F3E A;  4LNV A;  5FLH A;  1EPW A;  4BQY A;  5BYN A;  5KXE A;  3W20 A;  4XHB A;  4AZZ A;  4Y5S A;  3P6B A;  4A41 A;  3LA3 A;  3NKT A;  2E7T A;  2JEN A;  2VOX A;  2RMU 2;  4CDW B;  2HBU A;  3TNP B;  4DNY A;  2B45 X;  1WCD J;  1STM A;  2A6W A;  2BUK A;  3OGG A;  3WQB A;  4O9G A;  1FAT A;  3UT0 A;  4A45 A;  2RS1 3;  4DB5 A;  1OQD A;  1APN A;  4C8D A;  3VBR C;  4ARY A;  4B7E A;  4CDX A;  5J09 A;  1WLT A;  2FMD A;  4J25 A;  1NCR B;  4HMZ A;  2AEN A;  4QDS A;  1UKG A;  5IVV A;  2PHD A;  2P5B A;  3LWC A;  3ZYP A;  1Q43 A;  3VV1 A;  5KWR A;  1BLZ A;  2R04 3;  4CCD A;  1U5Y A;  2K0G A;  1VBC 2;  1LHO A;  4KGQ A;  3AC0 A;  4XET A;  3VD4 A;  3SCH A;  2IXJ A;  4KWU A;  3RI9 A;  3V64 A;  1XE8 A;  5A3N A;  3H7Y A;  3SH5 A;  2PHW A;  1LOF C;  5FPL A;  5FZD A;  4E27 A;  4OYU A;  2HJI A;  1ULP A;  2BVB A;  2YGL A;  3VBS C;  5T5L A;  1V00 A;  1JS9 A;  1UOF A;  1HV1 A;  1OH3 A;  1TMF 1;  2DDU A;  1S0F A;  3LSD A;  1DGL A;  4IEQ A;  4IE6 A;  1XYN A;  1JYW A;  3PU3 A;  3Q9O A;  4FFG A;  4FCA A;  1WW4 A;  1YQ8 A;  2WFF 3;  5J37 A;  3ZFG B;  5FPU A;  1QJZ A;  2RM2 3;  4PLM A;  5A3O A;  1X9T A;  1D7P M;  5A70 A;  1UY4 A;  2DUP A;  1ZRI A;  1O5U A;  1Y9M A;  2BGO A;  2WS9 3;  4KU7 A;  2W08 A;  3RQ0 A;  2PHR A;  5A7Q A;  1SBE A;  3KT7 A;  5B4N A;  3VHP A;  1UF2 C;  3P3N A;  3VDC A;  5A7N A;  5DUX A;  3U11 A;  1K5J A;  2XG3 A;  4AI9 A;  1H30 A;  4OHV A;  5FY8 A;  2XH6 A;  4LBQ D;  1PGW 2;  1VBA 2;  3L9J T;  2VVE A;  4ZS3 A;  4E4S A;  1COV 2;  1WMD A;  1MZE A;  2Y6J A;  2WRA A;  4JDM A;  2VO5 A;  4MAD A;  2GN7 A;  4E2S A;  1BEV 2;  3OD0 A;  3GCW A;  4U36 A;  5GLU A;  1C1L A;  4BQ2 A;  2XUE A;  1LES A;  2CNA A;  3MDP A;  2UYB A;  2QQW A;  4LIT A;  5H9Q A;  3C7E A;  2W92 A;  3RPQ A;  1CGP A;  2W47 A;  2AAC A;  5IVJ A;  2D7F A;  3AMP A;  4D6Q A;  4BIF A;  5FRA A;  1OLM E;  5A6Q A;  5J36 A;  4LKD A;  2ZX1 A;  5C8C A;  1T6G C;  1RXG A;  3BKZ A;  5BY5 A;  1VMJ A;  1HX6 A;  4A7Z A;  1QXP A;  1N1V A;  2CWS A;  4UFL A;  4JGZ C;  2VM9 A;  1UQX A;  4B8E A;  5A3T A;  1IG3 A;  1RUO A;  4W4Z A;  3CZU A;  5L9R A;  3RWN A;  2GMP A;  3ZFE A;  1OVS A;  2J1R A;  4Q29 A;  5D8A A;  4P9L A;  3VD7 A;  2ZCW A;  3WV6 A;  4QXH A;  3ZXL A;  2A6Z A;  2B7Y A;  2YUE A;  1LHU A;  5IYY A;  1PO1 3;  2E32 A;  1SFP A;  5I0S A;  3AKP A;  4FOW A;  2ZKL A;  4PQQ A;  2Z79 A;  2PHF A;  1Z7S 1;  4GWI A;  4QQH A;  3RJR A;  1KFU L;  4G3Y C;  2WLQ A;  1GU3 A;  3H8U A;  1I3H A;  3WOG A;  5AC9 2;  1XNT A;  4DIQ A;  1RUE 1;  1ZZ9 A;  3UKV A;  2WZP P;  1W2A X;  2JKB A;  3MIH A;  3ZFF C;  1LHN A;  3ECQ A;  1RB8 G;  3MIG A;  5KHH A;  4Z07 A;  2RS1 1;  3WNN A;  3P5B A;  4X6R B;  1NCQ A;  2DCT A;  2AEY A;  1KFX L;  4IL7 A;  4MXV A;  1QH7 A;  3RVH A;  4Z2A A;  1YFU A;  2JDY A;  2F17 A;  1W8W A;  1VRH 3;  1CIY A;  2D6K A;  2LUW A;  2VMF A;  4LBJ A;  4AOC A;  2VTX J;  1ZVF A;  1XSR A;  4NR1 A;  4HK9 A;  4LE3 A;  3TOJ A;  2VOT A;  1H1A A;  3NAP A;  4P14 A;  1E5I A;  1VB2 A;  4XTM A;  2BFU S;  1J58 A;  3NNJ A;  4Q4Y 1;  5F8P A;  3WUD A;  1UW8 A;  1I5Z A;  3WDV A;  2O1Q A;  5FPB A;  3SEE A;  2WR9 A;  4FFI A;  4Q4Y 2;  1AYN 1;  3WQ1 A;  4A6S A;  4L99 A;  3M7A A;  3EB7 A;  5DDJ 3;  4LIV A;  2XGX A;  3UYJ A;  3AJY A;  5IVF A;  4QT6 A;  4QX1 A;  2ZGK A;  3RZK A;  4MYE A;  3INA A;  3SMH A;  5FYI A;  2WKK A;  4Q0S A;  2ZEX A;  2ZGS A;  1LEC A;  4NRP A;  1R09 1;  4CEW A;  4ZU4 A;  5FIX A;  4CUG A;  4ERO A;  1OKQ A;  3B5L B;  4TLG A;  5EIY B;  4I0B A;  3SQO A;  5CG9 A;  2NP0 A;  2ZMK A;  1D4M 3;  2H0B A;  4Q27 A;  5FZ4 A;  1W9Y A;  2FDK A;  1GZT A;  4HK8 A;  4Y1Y A;  5FZ3 A;  1Y7B A;  1ULG A;  2JG8 A;  1FT9 A;  3C7H A;  4YM0 A;  3I54 A;  3T2O A;  5LRS A;  1W9S A;  1Q8S A;  4P08 A;  2NN8 A;  4B4R A;  1V6M A;  2QFE A;  4JDN A;  1YRZ A;  3CHX A;  1JHN A;  5LA1 A;  1KXG A;  3WSO A;  3KVB A;  4BJ0 A;  4YZ1 A;  4YPJ A;  2P2K A;  4IQP A;  4YG0 A;  3OUI A;  4J6G A;  1VB4 A;  3HT1 A;  2D98 A;  2WS9 1;  2YDE A;  4XBN A;  4XPV A;  1VBE 3;  4D0Q A;  3FLP A;  4QKN A;  4XQ4 A;  2Q8D A;  2ILM A;  4TSV A;  1CR7 A;  5IK5 A;  4LOS A;  3AM2 A;  4QU1 A;  1XYO A;  1LED A;  2NPI A;  3C7O A;  4EN6 B;  4I01 A;  4P5Y A;  1RUH 3;  1LRH A;  5FZB A;  3O1S A;  1HXS 3;  4XUN A;  5JOZ A;  2NQY A;  3J4U H;  3J8F 2;  5FWJ A;  1KGY A;  4XIK A;  4CDW A;  4ATF A;  2MEV 2;  3N9N A;  2WT0 A;  4QX5 A;  1MPX A;  1O4T A;  2JDK A;  4KH9 A;  3WQ7 A;  3MW3 A;  2BNO A;  3NV4 A;  4XQD A;  3LQC A;  1SFN A;  1NZI A;  2AR6 A;  3HQX A;  2Q0A A;  3OBR A;  4Y4Y A;  2BYV E;  2OII A;  4UFI A;  2ORX A;  4H2A A;  4XE9 A;  2EIC A;  4B7K A;  1VMF A;  1CZS A;  2VNV A;  4MGT A;  4COZ A;  4P00 B;  2WZR 3;  2OT7 A;  1MZF A;  1N47 A;  1GYK A;  1OOP B;  4GKY A;  5CFC C;  2WWJ A;  5L7O B;  4QX2 A;  3WW3 A;  4CU7 A;  1JHJ A;  4Q4W 1;  4A6O A;  1PVX A;  3W9A A;  2ET1 A;  3I49 A;  2VUD A;  1UU5 A;  3MUY 1;  2KM2 A;  4S2F A;  2RM2 1;  5FJK A;  1G86 A;  2VBB A;  5FYZ A;  5FZ6 A;  2EA7 A;  3VL8 A;  1BJQ A;  1JW6 A;  2SBA A;  4A44 A;  4AK3 A;  2A70 A;  2WO1 A;  4OHY A;  1CX4 A;  3AZY A;  5IVE A;  3RZM A;  3WP5 A;  1QXJ A;  1RUG 3;  3OGV A;  1WGP A;  5FZE A;  1AR8 3;  1QOT A;  2HWD 1;  4PQ9 A;  3MF9 A;  5K7P A;  4HVR A;  2FHR A;  4CCE A;  3WY6 A;  3LB9 A;  2J1U A;  4NRO A;  4RHV 2;  4YVS C;  3VKN A;  2N7G A;  3ZSJ A;  4DRV A;  2VZQ A;  1WLC A;  4IE4 A;  4YSF A;  1HB3 A;  1ZZ7 A;  4L2N A;  3GZE A;  5E88 A;  3O1U A;  1BQP A;  2XJV A;  3LGR A;  1R64 A;  1E57 A;  2C0Z A;  4WZF A;  5F6K A;  1AR8 1;  5A3U A;  1JYI A;  3DUI A;  4LO7 A;  3I7D A;  2LAL A;  2VMD A;  1AR8 2;  2EIB A;  1IKP A;  4P5H A;  4YW5 A;  4GWM A;  2HYX A;  3E6B A;  5IK4 A;  2NZ9 A;  3I2H A;  5F39 A;  4EWA A;  5C8C C;  3VHN A;  1W6N A;  2ZX0 A;  1MS4 A;  1QGL A;  1BKZ A;  3I4I A;  3HN1 A;  3SXW A;  1H2M A;  1VIW B;  1RJ8 A;  5A1L A;  1AXK A;  4BA6 A;  1LEN A;  1PVC 1;  4C90 A;  1ZRD A;  3V0B A;  2C6S A;  1ZBA 2;  3RFR A;  4CCC A;  4HFS A;  4MO3 M;  1W6M B;  3WNP A;  4IW3 A;  4Q1R A;  5A3M A;  2HWD 2;  3WQ0 A;  2WDB A;  2RS3 1;  3NJX A;  4N53 C;  3IZO A;  2XUM A;  4WM7 C;  2X10 A;  4ARX A;  2R6Q A;  1ZNP A;  3CNA A;  4S2G A;  5B2G B;  4QX0 A;  1ND3 A;  1QNW A;  1O6U A;  3U14 A;  4IE5 A;  3RZL A;  1WCU A;  2VZS A;  4HVO A;  5I91 A;  2E26 A;  4AGV A;  3O1R A;  3MV1 1;  1J3P A;  4W65 A;  2YPD A;  1BK0 A;  1PMI A;  1F35 A;  3U4X A;  4AG4 A;  4NIH A;  2HWE 1;  2RG4 A;  1AXZ A;  4QXK A;  3AB0 A;  3ON7 A;  2JDU A;  3QH6 A;  4XBQ A;  5F3I A;  4O65 A;  1I9R A;  1ODM A;  2YBS A;  1HN0 A;  5FKC A;  2YU1 A;  2XJR A;  1ZZ8 A;  2WWS A;  4M00 A;  1UYP A;  4HPK B;  2GP3 A;  4N43 C;  1DQ1 A;  3FN9 A;  3OUJ A;  4AI1 A;  2OQ6 A;  4JDO A;  3UNP A;  3E97 A;  4AVT A;  2V4V A;  3QBQ A;  2UWC A;  1H8T B;  2OX0 A;  1DIW A;  3IPV B;  2P4E A;  4I0W B;  4W8J A;  2C9A A;  5A6X A;  1AL2 1;  1V9U 2;  3FFQ A;  3R6S A;  1G7Y A;  1W99 A;  3CEW A;  4R8H A;  1MEC 2;  3FUQ A;  4UFH A;  4WVW A;  4IEU A;  4CPB A;  3B9I A;  3K4D A;  5F2S A;  3S6P A;  3WHT A;  4CDU B;  1IKQ A;  1Y4W A;  2WO3 A;  5FCC A;  4OHZ A;  3T0B A;  4YVW B;  4UI9 L;  1DFQ A;  2FCV A;  1IS3 A;  2VCB A;  1GAN A;  4IV3 A;  5EQU A;  5BNP C;  2D43 A;  1I6X A;  1LOD A;  4GJZ A;  3K3N A;  1MS3 A;  2IXC A;  4RGG A;  5JZG C;  3T0D A;  1DF0 A;  4IV1 A;  4LMF A;  1H9W A;  4V1P A;  5FUI A;  1Q8V A;  3VBF A;  3FL7 A;  1QOO A;  2RDQ A;  3B01 A;  3CJI B;  1BHG A;  5LY1 A;  1VJ2 A;  1UMI A;  4GB3 2;  3MBW A;  2DTY A;  1JZ4 A;  2LM3 A;  1H0B A;  1MEC 3;  3ZSK A;  3U78 A;  1OVP A;  2G1M A;  4RS5 C;  4XDQ A;  3D3A A;  2BBV A;  1GBG A;  1RIT A;  2PQS A;  5SV5 A;  3PL0 A;  3EYP A;  1SLB A;  1XQN A;  4ZU5 A;  3WCR A;  1HRV 3;  1OBN A;  2P3J A;  2R30 A;  2EAK A;  2DFB A;  3ZFF A;  5LZ6 A;  4V2V A;  4AWD A;  4OUM A;  4LBQ A;  1YCI A;  4Y5Z 0;  4UFK A;  3C3V A;  3VDD C;  3UKN A;  1H2L A;  4AAP A;  5ABJ C;  4SBV A;  1O8S A;  2VAU A;  2ZGL A;  2ZGP A;  5T3N A;  1DYK A;  4OMC A;  1ASJ 2;  2PLV 2;  4GB3 3;  2H6C A;  3FMG A;  4GUL A;  5FP8 A;  5LK7 B;  3GDB A;  3NAP C;  2Q8O A;  1JZ6 A;  2HWE 2;  3FJS A;  4NPM A;  2ZHK A;  3VL9 A;  1AX1 A;  4A2U A;  5ABJ B;  4TXW A;  1QY4 A;  1RVF 1;  3DPR B;  3H1W A;  3VDD B;  2CAU A;  5CFD B;  1VBB 3;  3MFA A;  4JX0 A;  4CP0 A;  2D5F A;  4C91 A;  3POF A;  2FQP A;  3K4A A;  1OQ1 A;  2ZGO A;  3I2F A;  3M2M A;  2YRO A;  3PHM A;  1GZ9 A;  1MQT B;  5FPV A;  3NV3 A;  5CFC A;  3CO2 A;  3FZ3 A;  2QKD A;  1N1T A;  4JKL A;  1G6N A;  2GP5 A;  2QQO A;  1Y9G A;  3MZH A;  3FFZ A;  5JIU A;  1VBE 2;  2HH9 A;  1S2E A;  3KQR A;  4FOV A;  3WUC A;  5GJ6 A;  1COV 3;  5CU1 A;  3OBA A;  5FO7 B;  2VOK A;  4RR3 A;  3WEZ A;  1GZW B;  4XF0 A;  2J1E A;  3CF6 E;  3T1L A;  2PFW A;  1JOJ A;  1UKR A;  1NG0 A;  4IEZ A;  3H42 B;  1F5J A;  4XJA A;  1POQ A;  4YVW C;  2WO2 A;  5FQ0 A;  4HKL A;  3ZSM A;  1V9U 3;  4IV3 B;  4EZH A;  3WVJ A;  5FMB A;  3ABZ A;  3VBH A;  3AVS A;  1PO2 2;  2OXB A;  2Q1F A;  4JRL A;  4XVH A;  1EUU A;  1ZBE 1;  5FO8 B;  3OB8 A;  3URF A;  1OXC A;  1RUD 3;  4Z82 A;  1OQE A;  3OF1 A;  2V09 A;  1V6I A;  4QU2 A;  1UU4 A;  2HWB 1;  3ILR A;  3OPT A;  3APB A;  2WS9 2;  4WVM B;  5F5C A;  5F5I A;  4DQA A;  4PDW C;  4KG8 A;  1S0D A;  1R1A 1;  4P02 B;  1NLQ A;  3B9C A;  2XOM A;  2JD4 A;  4MXW B;  1NOV A;  3T3Y A;  4R9D A;  3HNB M;  1BBT 3;  1L7R A;  1HRI 1;  3AZV A;  4BQX A;  4CCO A;  2ZAC A;  4JHZ A;  3OYW B;  3LEM A;  2K2S A;  5T54 A;  1YQ5 A;  3P1I A;  4EN8 B;  5KHG A;  3X29 B;  4PDW B;  2A3W A;  3HPN A;  2QQM A;  4IV1 B;  2BBA A;  3J8F 3;  3IDB B;  4QHZ A;  5F3G A;  5FZG A;  1C8M 3;  3MEP A;  2B5H A;  2JG9 C;  4ES8 A;  2CAV A;  2XLF A;  1IHM A;  4C1W A;  1PK6 A;  4P9W A;  3PMS A;  3IB3 A;  2EVX A;  2W1W A;  4FXG B;  1RUF 1;  2VE1 A;  3UJQ A;  2FDI A;  3VKL A;  3SNM A;  4GAL A;  4YGE A;  5L9V A;  3TAY A;  5EPA A;  4YVS A;  3ACH A;  4FP2 A;  1OLR A;  1R1A 2;  4WV8 A;  3HBK A;  3GJB A;  5FBZ A;  5J48 A;  1AYM 2;  1W6P A;  4NIG A;  1ND2 B;  1HRV 1;  1DQ4 A;  4FO9 A;  3ACL A;  4NRQ A;  5APA A;  2BTV C;  3GXU A;  3HD8 B;  5FMD A;  2FDJ A;  1QWR A;  2PXJ A;  1BK1 A;  1P8J A;  1Q5O A;  3H1M A;  4QM8 A;  1POV 3;  2C9K A;  1PGS A;  1ZM1 A;  4AVV A;  2ZMN A;  4GWJ A;  3N3H A;  5K0U C;  3NMB A;  5A3W A;  3PIJ A;  1S4C A;  3ITQ A;  2OYZ A;  1G8W A;  4HG6 B;  5T50 A;  2ADD A;  2V73 A;  3JD7 2;  4OI2 A;  1OI6 A;  2Z42 A;  2NM1 A;  2R1D A;  4UFJ A;  3UJO A;  4AR2 A;  4MG2 A;  3G7D A;  4ORF A;  5FYV A;  4BHP A;  1W6O B;  4OLL A;  2ZGQ A;  3IMM A;  5JI7 A;  5CFD C;  2FZ2 A;  4NRM A;  3B02 A;  2O14 A;  2H6B A;  5KBF A;  1QEX A;  4R4Z A;  4JVA A;  1CAX B;  1EV1 1;  5FP9 A;  2XHN A;  1AR9 1;  1DG6 A;  4N9H A;  5FWE A;  4O61 A;  3O7O A;  1OT5 A;  5GAL A;  5KC6 A;  2ARB A;  5BNO C;  3RNS A;  1VBB 2;  4X6Q B;  4CTE A;  1KIT A;  3M1H A;  3N9O A;  3OCP A;  2ZBJ A;  2OKX A;  5F5Q A;  4AE2 A;  1QNY A;  3DKW A;  5DAV A;  1FOD 1;  5C33 A;  1RUH 2;  2RV9 A;  1W8N A;  1W2T A;  4UW4 A;  5CEH A;  2ZAH A;  1TNR A;  5A80 A;  4TYS A;  1F4H A;  1YFW A;  2FCT A;  2Q4S A;  1RUH 1;  4GH4 C;  1JN2 P;  1RUJ 3;  2WZ8 A;  3PLQ A;  4QB2 A;  2OW4 A;  1IPS A;  3JBG 3;  5G05 L;  4D8M A;  4YZ4 A;  1A8D A;  1RHI 3;  5GKA C;  1JZ7 A;  3LD8 A;  1ODN A;  4H7M A;  5C9A A;  2YZ4 A;  1NCR A;  4JC1 A;  1W03 A;  2BPA 2;  4GKX A;  4K9S A;  4UXA A;  3U75 A;  1UL9 A;  3R4S A;  4URT A;  1LUL A;  3BIW E;  2Y8K A;  3KCX A;  3PJY A;  2YBP A;  1A78 A;  3UGG A;  4QX7 A;  2VGD A;  5FXV A;  1R09 3;  1NA1 B;  4JGZ A;  4PI0 A;  1XB9 A;  3FUO A;  1I5P A;  4YW4 A;  4HT1 T;  1YFX A;  1XRU A;  3CMG A;  4E4Z A;  4TTG A;  2R16 A;  3KD4 A;  2VME A;  1SCS A;  2WIN B;  4M3C E;  5A33 A;  1S2B A;  3TN9 1;  3RSJ A;  4ZKT B;  1WCS A;  4CP2 A;  4CUC A;  2QJV A;  3AFK A;  3PJQ A;  3UET A;  2PAM A;  3POB A;  2PHT A;  1U12 A;  2VMG A;  3KV9 A;  1MS8 A;  4PLN A;  1US2 A;  1J3Q A;  4TN7 A;  5KXD A;  4PCR A;  1E5H A;  2ZHM A;  4N43 B;  1COV 1;  1DLL A;  2QDN A;  1AX0 A;  3KGZ A;  1WWY A;  5BUV A;  4CEY A;  4BQ1 A;  2UU8 A;  5CNA A;  4D94 A;  1BEV 1;  3JUU A;  5A1F A;  3ZXE A;  3RMY A;  1BBT 2;  3N35 A;  5F32 A;  4BWO A;  4COV A;  4OZO A;  2J1V A;  3N7K A;  3AJZ A;  4R52 A;  2Y34 A;  2J7M A;  4NAM A;  3VDD A;  5C3P A;  5FPA A;  4CDX B;  4BZ4 A;  3CU7 A;  4XFH A;  5J3U A;  1JBC A;  3WNK A;  5CAD A;  1SPP B;  4EN0 A;  1PIV 2;  4NE9 A;  3TN9 3;  2IUW A;  2R7E B;  2GSY A;  3U07 A;  3VD3 A;  1WA6 X;  1LCL A;  2BGC A;  4HZF A;  3VB9 A;  3T30 A;  1QJY 1;  2ERF A;  3N7L A;  2IXH A;  3ZR6 A;  5GLZ A;  1OF3 A;  5IHR A;  2QZ2 A;  3IN9 A;  3VN4 A;  3U10 A;  4HPK A;  1QJU 1;  5JMC A;  2WQZ C;  3ZVX A;  5C5U A;  3V56 A;  3ZFF B;  5FYB A;  1D4M 2;  5DZF A;  3AMM A;  3C2U A;  3ELN A;  1ASJ 1;  4XAB A;  1OFN A;  4JGY A;  5LEK A;  1RUC 1;  3N9P A;  1QU0 A;  4GQ7 A;  4C0B A;  5KHK A;  3SIS A;  1PIV 3;  1W90 A;  2DUQ A;  2OQ7 A;  4MXW A;  3WP4 A;  2W2I A;  3POS A;  2ARE A;  1UYZ A;  1PM7 A;  4GXL A;  3WF1 A;  3MID A;  2VH9 A;  4M01 A;  4Q26 A;  4QB6 A;  5FZA A;  3D0S A;  3JBG 2;  1CON A;  5F7U A;  2E63 A;  3I2D A;  3KHC A;  1CAX A;  3LEK A;  5FYS A;  3DPR A;  3O0W A;  3VKO A;  1E5S A;  4YNI A;  2VCC A;  4GB3 1;  1UN1 A;  1RIR A;  2XWJ B;  3HQR A;  5DG2 A;  4AXO A;  1J1L A;  1RUD 2;  2W9X A;  3N9M A;  2HYK A;  3S5A A;  4BB3 A;  3AP7 A;  2QUO A;  1SG3 A;  4XUR A;  1IGO A;  5FRE A;  2G9Z A;  4QAW A;  4FPL A;  4B4Q A;  3I2O A;  1VBE 1;  3WW2 A;  4LO4 B;  5T5O A;  4CDX C;  1WMF A;  1FXZ A;  1RTV A;  3NJY A;  5FV3 A;  1HQL A;  1JU3 A;  3KWV A;  4CCJ A;  1W6N B;  1WCK A;  1ZBA 3;  3NNL A;  4Y24 A;  4COW A;  4G9S B;  1JYN A;  5K8S A;  1S0G A;  1X8E A;  3A0N A;  5EJ3 A;  2Q30 A;  1Y3T A;  4BDV B;  1DGW X;  1U5I A;  1FYU A;  3AKQ A;  2BQP A;  2IZW A;  4IER A;  4MVT A;  5J1X A;  3OG2 A;  4XHX A;  2WFF 2;  4N43 A;  4BCU A;  2A3X A;  3CL1 A;  4XOG A;  5ANQ A;  4BE3 A;  4CYD A;  1XSQ A;  5B4X A;  4HXC A;  5FYU A;  3SEP A;  3T4V A;  4ASM B;  4CU9 A;  4XUT A;  4KU8 A;  3ASI A;  3BUC A;  3ACI A;  2CGP A;  1W0P A;  3GJA A;  3GZT B;  1IPK A;  1WZX A;  3B00 A;  5AC9 1;  3GBW A;  3LFM A;  4A3X A;  3H7J A;  3JXS A;  1GFF 2;  1ZBE 2;  4CEW B;  2Y0O A;  3S30 A;  4XIL A;  5FXZ A;  1GUI A;  1T2X A;  4IV3 C;  1IG0 A;  1ONA A;  3PDQ A;  1UXX X;  2W46 A;  5CFD A;  1QJY 2;  2A6Y A;  1WKY A;  3D5O A;  1DGR N;  3SIT A;  4E2G A;  5GZC A;  1H2K A;  1CZT A;  5LAT A;  3VBO A;  4JZR A;  1W2O A;  2JG9 A;  4D7T A;  4FPG A;  4CSW A;  5JDB A;  3VBF C;  3WDX A;  3NRU A;  5FUP A;  1FV3 A;  4YYO A;  3ZFG C;  4BXF A;  5JCT A;  4ZHN A;  3NST A;  5LBF A;  1YNA A;  3FHA A;  1SQ4 A;  3GGL A;  1W06 A;  3LA7 A;  5HPO A;  1MS5 A;  5DG1 A;  1RMU 3;  4AFA A;  5DXD A;  4HLT A;  4LLO A;  5IK7 A;  1OLQ A;  3LPF A;  1XU2 A;  4I0A A;  4XCB A;  1HLC A;  5ANN A;  4GMP 1;  3ZXK A;  5L7O A;  2QTW B;  1BXH A;  3JB8 A;  2UWA A;  2DU1 A;  4F3J A;  4PJY A;  2IXI A;  4FPK A;  1ND2 A;  2Q8C A;  2WA3 A;  4ONU A;  4CRQ A;  5JSO A;  3ACG A;  1GKB A;  3T1M A;  3TB0 A;  3HVD A;  3VD5 A;  4QDQ A;  2VZR A;  4ATE A;  1ZZ6 A;  3MPP G;  5GM0 A;  4YLZ A;  3H0O A;  4BIS A;  1O59 A;  1ZYB A;  1XNB A;  3SC7 X;  2EXJ A;  3WCS A;  5FYY A;  1DDL A;  2VZU A;  2D44 A;  3UL2 A;  3O1T A;  2J1T A;  2R07 2;  5E89 A;  1YJK A;  2D5H A;  3Q8A A;  2HWB 2;  1FNY A;  1RUN A;  1K5M B;  3AP9 A;  2NMN A;  4FQZ A;  3AL5 A;  5A3L A;  5CKM A;  1RUG 2;  2ETE A;  3WNX A;  4FAH A;  1WLW A;  4NHY A;  3OGS A;  4FI9 A;  5HCB A;  1OA3 A;  1PVC 3;  3NVC A;  1OLM A;  5JLV A;  1V6N A;  4BOW A;  4L97 A;  1KD7 A;  2ZZQ A;  2RDN A;  2VQU A;  3R4D B;  1H8T A;  2JWP A;  3KT1 A;  2IFW A;  4YG3 A;  3JQW A;  1JTZ X;  1OMI A;  2PYT A;  3H50 A;  2XWB B;  3DV8 A;  2ENR A;  2A3Y A;  4WBB A;  3A0K A;  3LKJ A;  4MOA A;  3RMX A;  1W8F A;  1OA2 A;  3LFI A;  1HIX A;  1GNH A;  4XYX A;  1YWK A;  5IT6 A;  4K1Y A;  4L8Q A;  1UZW A;  3VZJ A;  1GZC A;  1F5F A;  5FXW A;  1X8M A;  1X82 A;  2WYS A;  3POG A;  5FZI A;  1XPW A;  1YI7 A;  3NNF A;  3RZZ A;  5C4W C;  3AXE A;  1FNZ A;  2XVK A;  3WLU A;  5C9A C;  2P6C A;  2VUC A;  3Q8B A;  3MW2 A;  4UWD A;  3AYE A;  5EFU A;  1NAE A;  4Y26 A;  2R0H A;  4AQT A;  4Q4W 3;  1VAK A;  4XZU G;  1XE7 A;  3ZYI B;  3KT4 A;  3MIB A;  1G9B A;  2WYF A;  2XJP A;  3I3M A;  1VBD 2;  3ORJ A;  1Y9Q A;  3A22 A;  5GLV A;  5A7O A;  1I1E A;  1UMH A;  2ZML A;  4NVP A;  4PDW A;  4XDP A;  3UV9 A;  3VHO A;  2WL1 A;  3VDB A;  4I02 A;  3OUH A;  1N3O A;  2Y60 A;  3WP6 A;  2XHK A;  3PIG A;  2Y0I A;  4R4X A;  1CZV A;  1YI9 A;  4RN5 A;  3W59 A;  1GWK A;  4Q8L A;  2ZJC A;  1H9P A;  3OPW A;  4BK5 A;  5F5A A;  4AGG A;  1RUC 2;  1H1M A;  5CZK A;  4RS5 A;  1UY1 A;  3O0V A;  4AL9 A;  4AQS A;  2QQK A;  3ZN5 A;  4LQR A;  2ZX3 A;  2XDV A;  2YGM A;  1AR6 1;  3K48 A;  3QAC A;  2CDP A;  4LK6 A;  5K4L A;  1W8O A;  5CAZ A;  5ACA 2;  2EIG A;  3MLL A;  1JZ2 A;  4LKS A;  5KXC A;  1FV2 A;  1AR6 2;  1DQ5 A;  2FCU A;  1AR9 2;  1RVF 2;  1OH4 A;  2DV9 A;  1FAY A;  4QMA A;  2ZS6 B;  4QGL A;  4CZS A;  4N53 B;  2AGS A;  4WM7 B;  1YYN A;  4BIO A;  2Q1M A;  3GZU C;  3P3P A;  1C57 A;  1KS5 A;  2P1B A;  2VCA A;  5ERL A;  1AR7 1;  4CU6 A;  1R1Z A;  4GA9 A;  1FOD 2;  5E8A A;  3JZV A;  1AYN 3;  1ZA7 A;  2EXI A;  2HWB 3;  3NNG A;  4IEP A;  4XEZ A;  5KHJ A;  3RZG A;  2MPF A;  5JOY A;  3BOD A;  5C8C B;  3ZIW A;  3CBN A;  3FBY A;  2AC1 A;  3K4Z A;  2RS3 2;  4LBQ B;  1NY7 1;  2D93 A;  3AXD A;  3WZ1 A;  5IWF A;  4BXS V;  5KR7 A;  2IWG B;  4UW5 A;  5FP3 A;  2PLV 1;  2VBD A;  4Q4Y 3;  1J84 A;  3TBD A;  3TEZ A;  1QDO A;  1IS5 A;  5HV0 A;  5JOX A;  3POE A;  2AYH A;  1POV 0;  2RS5 2;  2GC0 A;  2XJS A;  4M4R A;  1TMF 2;  5E16 A;  3LEI A;  3DYM A;  3GAL A;  2OZJ A;  3KF3 A;  5LB6 A;  1ZZC A;  4XJ8 A;  2V72 A;  5K0U A;  1VE0 A;  1KJL A;  3ZYR A;  1G9D A;  3V0A B;  4K20 A;  4XF9 A;  2R32 A;  4Q4V 3;  4AHX A;  2BNN A;  2FBE A;  4JKK A;  4EN9 B;  4PIX A;  2IC1 A;  4MH0 E;  5D1I A;  1R1A 3;  2W68 A;  5JSP A;  2JIC A;  4NWV A;  3RWK X;  2DYC A;  2WC2 A;  1TNF A;  3NJZ A;  3IKW A;  3VBO C;  2E7Q A;  3E1F 1;  1VBD 1;  5JSR A;  1IOA A;  1TMF 3;  4RGA A;  2QQP A;  2VCM A;  2Z5W A;  4AF9 A;  3DPR C;  5A6Y A;  5LY2 A;  1VRH 2;  4Q0U A;  2GDF A;  4ZU7 A;  1FPN 3;  4RA0 A;  2W91 A;  5LRR A;  1W39 A;  5JXJ A;  2K9Z A;  2VOV A;  3BGA A;  4ZZ5 A;  1IS4 A;  2EF6 A;  2X09 A;  3DEC A;  4HKO A;  4UW6 A;  5FZ8 A;  5L73 A;  1UD1 A;  3WX5 A;  2DTW A;  1UPS A;  2R04 1;  5HI0 A;  2HWF 3;  2VMH A;  4GWN A;  1O8P A;  3WG1 A;  1VAM A;  3ZXF A;  4AFD A;  3I2J A;  1Z78 A;  1DYP A;  2XLG A;  4NPR A;  1LOC A;  3S0M A;  1DU3 D;  2JDZ A;  2PQQ A;  4FTE A;  4J1X A;  5FMO L;  5IK8 A;  3PUQ A;  2AZ5 A;  3EQE A;  4NPL A;  5JVV A;  3MPB A;  4CP1 A;  1JYC A;  3AMH A;  3EJK A;  4OUS A;  4HVQ A;  1FPN 2;  3IDC B;  5DN2 A;  4JKM A;  3AMQ A;  1NXD 1;  1H2N A;  3DCQ A;  1GV9 A;  4UT5 A;  4MGK E;  5FAX A;  2PHL A;  4F7Z A;  1LU1 A;  2W95 A;  1W04 A;  1RC6 A;  2RDS A;  5FZM A;  4Z8B A;  2WFP A;  3CJI C;  3IM0 A;  2H0V A;  4S2H A;  3N4M A;  2XON A;  3KCY A;  2Y6H A;  4Q4X 1;  3I59 A;  5L36 A;  1AR6 3;  3NQH A;  3POW A;  1PGW 1;  1VBA 1;  2XJU A;  2ZGR A;  2ZX4 A;  3WXP A;  4LT5 A;  1XE0 A;  1W6Q A;  5T52 A;  4N53 A;  4WM7 A;  4W6Y A;  1QH6 A;  1C5I A;  1RUG 1;  1W8Z A;  2W5F A;  3POI A;  4SLI A;  2GMM A;  4LUM A;  4AI8 A;  4D6S A;  2LS6 A;  3ST7 A;  1RHI 2;  2WUH A;  5FMC A;  1F31 A;  4CDU C;  3OYW A;  1LHV A;  4DPN A;  3ZFG A;  1JUH A;  2JB8 A;  4QKB A;  4WVZ A;  3HR9 A;  1EYB A;  4LBO A;  3OGR A;  2QZ3 A;  1FMD 2;  3JBG 1;  3E5U A;  4BQ3 A;  4KWK A;  2VMI A;  4I3G A;  1PO2 1;  3EMR A;  4CXX A;  1JZ3 A;  1OPO A;  1BMV 1;  1HQW A;  1AL0 G;  1URX A;  4PIZ A;  1OA4 A;  1QJX 3;  2JDA A;  2Z69 A;  3LIH A;  3POJ A;  3PUS A;  2RS5 3;  3S57 A;  1L3J A;  3BPS A;  4AED C;  3F95 A;  2V4A A;  1LR5 A;  2Q1Z B;  4DEQ A;  1OKO A;  1X7N A;  3SKV A;  1H6X A;  4Q4X 3;  2WT2 A;  1LGC A;  3PUA A;  3R0R A;  3WF3 A;  4CP9 A;  4XQW A;  3MFC A;  4N90 A;  3WG3 A;  3H3U A;  1Q56 A;  2YHJ A;  4BK4 A;  1LTE A;  1EV1 2;  1SLC A;  1ZRE A;  1EPZ A;  1KDM A;  2A7A A;  2E9Q A;  1HB1 A;  2R04 2;  3J26 N;  3SCG A;  2OVU A;  3ZFE B;  1UPI A;  3MLJ A;  3LEG A;  1SDD B;  3WR0 A;  1NUK A;  2VNO A;  3DL3 A;  5GLW A;  1CAW A;  1MZ5 A;  3RG0 A;  2PAK A;  4BLJ A;  4ET7 A;  3V0B B;  3KV4 A;  4EYU A;  2XBO 2;  2ES3 A;  4R9C A;  3ZFE C;  1FPN 1;  2VBP A;  5D8A C;  1W0N A;  4KL1 A;  4KNC A;  1AJK A;  4M3C B;  1NZC A;  2VEC A;  2EXH A;  5H9P A;  4OQ9 A;  4DEV A;  5FZO B;  4FPE A;  2VNG A;  4JRA A;  3OJB A;  4EZ4 A;  3THD A;  4NJ4 A;  1HN1 A;  3BTA A;  3ALQ A;  4LR4 A;  4MX3 A;  1DQ6 A;  3OTF A;  3DGT A;  2VZ1 A;  5F2W A;  4CP9 B;  2JDP A;  1JXN A;  1HB2 A;  3HWJ A;  1XC6 A;  2IVJ A;  1YEW A;  2OUJ A;  3NW4 A;  5ABJ A;  4KBZ A;  3PVB B;  3DN7 A;  3N36 A;  4PT6 A;  4AW7 A;  3GM8 A;  1UZV A;  2HKX A;  1EAH 2;  1NA1 A;  1NYW A;  1W6O A;  2R06 3;  1DHK B;  3AK0 A;  4JGZ B;  4LBK A;  2UY8 A;  4HAN A;  1RUI 2;  3BIE A;  4LHK A;  2Y6F A;  2R1B A;  3MF6 A;  3PUI A;  1R09 2;  1SLA A;  1YQ2 A;  3UKT A;  2VW0 A;  4DFS A;  3Q8F A;  3U0Z A;  5FQ0 B;  2XBO 1;  5FYC A;  2JKX A;  2R49 A;  1SCR A;  1XYP A;  2LRO A;  5FJH A;  2RVA A;  5DZG A;  3RYR A;  3WDY A;  2BEO A;  2SLI A;  2WT1 A;  3ZKY A;  4LOR A;  1PM4 A;  3SLI A;  4JQR A;  3OEA A;  1REE A;  1K5M A;  1IQD C;  1U5X A;  4XIO A;  1NQJ A;  5CYY A;  5JOW A;  1BVV A;  2PA7 A;  4Q4V 1;  4QX3 A;  5GZE A;  2YG0 A;  5DAP A;  4BQW A;  4P9X A;  1OOP C;  2CGN A;  4EWD A;  2CDO A;  4LO6 B;  1LNS A;  2VMC A;  2E7A A;  2WFF 1;  5IFT A;  2ZAB A;  2D3S A;  1QIQ A;  5CBL A;  2DVD A;  3T2Q A;  3W58 A;  1K42 A;  1GQH A;  2D40 A;  1RUE 2;  5HXV A;  1ULE A;  2WNO A;  4W6W A;  2MNG A;  1ZRR A;  1S0J A;  2YC2 A;  4GMP 3;  4IEW A;  2P6H A;  4DXT A;  3WT3 A;  2DCY A;  1ENR A;  2GAL A;  3UES A;  4AHZ A;  4DXR A;  1EV1 3;  4NAO A;  1POV 1;  1GOH A;  2LRP A;  4K1Z A;  1W8U A;  3I3D A;  3H8X A;  4IGO A;  4Y22 A;  3CDZ B;  3J7H A;  1QDC A;  4LBN A;  1O3Q A;  1UY0 A;  3WNM A;  1RIN A;  2WN3 A;  4XFB A;  1PNG A;  2VZ3 A;  3LZZ A;  3PME A;  2RMU 3;  5FYH A;  2WN2 A;  4XUP A;  3IWZ A;  4Z2W A;  4D69 A;  3NWK A;  2X5I A;  3J7N A;  4L0P A;  4Q4V 2;  3WG4 A;  5EWS A;  2CWM A;  3T0A A;  4LPL A;  3E5Q A;  4XAC A;  4AEJ A;  3ACF A;  1C3H A;  2W1Q A;  4LKE A;  5I8T A;  3MIC A;  2JJ6 A;  3D6E A;  5LBC A;  1DP0 A;  1XNA A;  3UGH A;  5IAX A;  2JE8 A;  1VBB 1;  3C7G A;  2TUN A;  5DAW A;  1QJX 2;  4EJR A;  3LA2 A;  5CIR A;  1W05 A;  3VUO A;  5L9B A;  5FPZ A;  4MUV A;  3TEX A;  5IVC A;  4A7Y A;  5BNO B;  4QKD A;  1K12 A;  2VUA A;  1V6L A;  4TZD A;  1QJU 2;  2P34 A;  3O1P A;  3NKG A;  2B9V A;  2BOI A;  4XJZ A;  3AZX A;  4FXK B;  4LJH A;  4PBP A;  5C70 A;  2Y6L A;  2JDM A;  5JPM B;  1GOG A;  2MHF A;  3EBR A;  3GYD A;  1UIJ A;  2VVF A;  3VGI A;  4OI4 A;  2Z2S B;  1J3R A;  5JUV A;  2QQV A;  2QQL A;  3MHZ A;  4IDZ A;  5FP4 A;  3B3Q E;  3J7L A;  4ZZ8 A;  4JV4 A;  3PVE A;  4BLI A;  1A34 A;  2ZHN A;  5A7S A;  5AFE A;  5KHI A;  4M4P A;  1AYM 1;  3BN6 A;  2R07 3;  2HEW F;  4RQP C;  5EYY A;  4YG6 A;  1X36 A;  4JGY B;  4UFM A;  5FXX A;  3VBH C;  3N7J A;  3W5M A;  2QQI A;  2GC2 A;  1LOB A;  2VQA A;  3B94 A;  1ZRF A;  2X8K A;  4D7Y A;  2B39 A;  2J1A A;  2G9F A;  2RJL A;  3AYD A;  4YM3 A;  5C5T A;  4AVB A;  2DCZ A;  5JI9 A;  4CA9 A;  3O1O A;  1V9U 1;  1ND2 C;  3JD7 3;  1CVN A;  4MHR A;  5AVP A;  1OD5 A;  1HXS 2;  4LUK A;  3O14 A;  1DZQ A;  3MIE A;  5FZF A;  1JYX A;  5DAB A;  4PIY A;  2YPJ A;  4K3U A;  4XFC A;  2VZT A;  1BZW A;  1W28 A;  4MGI E;  2WQ4 A;  1ZBE 3;  4XMA A;  5CVR A;  1NY7 2;  2XR4 A;  1WBL A;  2WNV B;  4OHX A;  3ZYJ B;  1N3Q A;  2YBK A;  4JTN A;  1LGB A;  1WME A;  2I45 A;  4NHL A;  1D0H A;  3TNQ A;  3A23 A;  3ZYB A;  4AFC A;  5BPX A;  4GIQ A;  1G9F A;  1NKG A;  1W6M A;  2ZPX A;  5FR3 A;  5FUN A;  1B35 A;  1VLN A;  5IAV A;  1B35 B;  2VR4 A;  4BME A;  1AR9 3;  2I74 A;  2QNK A;  4H55 A;  4LUL A;  5HCF A;  2D6L X;  4GD4 A;  5HBA A;  1PK6 C;  1N1S A;  3BU7 A;  1S2K A;  1JH5 A;  2G4I A;  2W52 A;  1HJG A;  1AXY A;  4V2W A;  1H4H A;  4AHW A;  1US3 A;  4D7S A;  3AMN A;  2Q5T A;  3U37 A;  4OMD A;  2ZX2 A;  1FX5 A;  4XW3 A;  3VZN A;  2ZHL A;  1EY2 A;  3QLQ A;  2FD8 A;  1QQP 1;  4ZXE A;  5DAX A;  5FZ9 A;  2IXL A;  1MS9 A;  1ST8 A;  1XOY A;  3RYP A;  4BU2 A;  3BI3 A;  2AEZ A;  1S0B A;  2ZGU A;  2BU9 A;  4RHV 3;  5DQ0 A;  3WHU A;  1HRI 2;  1WCQ A;  2WAA A;  4XFF A;  5I8S A;  1R08 3;  2NMO A;  2PLV 3;  1J83 A;  1Z7S 3;  4YGD A;  1W2U A;  1SHW B;  2X05 A;  5JAX A;  5C4W A;  2ARA A;  5AVA A;  1UU6 A;  2BW8 A;  2XBO 3;  3THT A;  3RZH A;  1F8V A;  2D6P A;  3FC0 A;  5C9A B;  2RMU 1;  4ZPI A;  1JUI A;  3T2T A;  5ACA 3;  4K40 A;  1JU4 A;  4XUO A;  2V5Y A;  1AUY A;  2ZXQ A;  4NOT A;  1ZBA 1;  1VAV A;  3TYJ A;  4FQ4 A;  4CE8 A;  1YC6 1;  5BNP A;  1K5M C;  4YRD A;  5FY0 A;  1R08 2;  3CJX A;  2XLA A;  2TEP A;  1GP4 A;  3KZ4 C;  3RDI A;  5FK7 A;  2IVI B;  2WNU B;  4OFG A;  5FFO C;  5ISL A;  2CTV A;  4XJU A;  5J96 B;  4BH9 A;  4OQ8 A;  1AYN 2;  1NX9 A;  4QDR A;  4XAA A;  1RXF A;  2W94 A;  3T4H B;  4O9E A;  4L9B A;  4LA2 A;  2A5Z A;  5EYX A;  4M3C F;  1GWM A;  3M70 A;  4XFG A;  2ATF A;  1MQT C;  4CCL A;  1CD3 G;  1L7Q A;  2JX9 A;  4A42 A;  2OZ6 A;  5A7W B;  5LW9 A;  1AX2 A;  1UWW A;  4Y1Z A;  4WM8 A;  3USU A;  4FTS A;  2BP6 A;  2E6V A;  5FZH A;  4NHM A;  1CQ9 A;  1KDK A;  2ET7 A;  3LDK A;  3LDR A;  3OY8 A;  5H9R A;  3IMN A;  3WP3 A;  1VBA 3;  3S7I A;  3JD7 1;  1F4A A;  3KLS A;  4XBL A;  3NAP B;  4CDW C;  4L11 A;  2JIG A;  1SLL A;  4Q0V A;  1AL2 3;  1PZ7 A;  4TWT A;  4W6X A;  5DUW A;  5F37 A;  2JB4 A;  2L9L A;  1QKQ A;  5A32 B;  1S0E A;  2ZEY A;  1A8M A;  3VKM A;  3O12 A;  4H3W A;  2CHH A;  4NO4 A;  1OUS A;  3VDA A;  4DY5 A;  3RZJ A;  1RUF 3;  2A1X A;  3L2H A;  2I2S A;  3HT2 A;  3HJR A;  3WF2 A;  1OHF A;  1LAJ A;  5LEJ A;  1QOS A;  4E4H A;  2WNV A;  3OEB A;  1TME 3;  4DIN B;  2BER A;  4JQT A;  4IEO A;  1QJX 1;  2TNF A;  1YQ6 A;  1UYY A;  2PMW B;  2QVS B;  3NV2 A;  3H3L A;  4RSU A;  1MR5 A;  4KGG A;  1RYY A;  1DLC A;  1GMM A;  2RHP A;  2VTF A;  2DCJ A;  1RGS A;  4DUX A;  4F83 A;  5GZD A;  3I3E A;  1QMJ A;  5FY1 A;  1UX6 A;  3EO6 A;  1W8H A;  3VLB B;  2CSG A;  2Y38 A;  1C28 A;  1HRI 3;  1RUD 1;  3KB5 A;  3Q8C A;  3T08 A;  3ZIX A;  3ZO0 B;  4BQ4 A;  4D6R A;  2VXJ A;  4XZP A;  4AI0 A;  4CVU A;  3T09 A;  3TEW A;  3IIA A;  5C3Q A;  4KI5 M;  1PMH X;  2D3P A;  4Q4W 2;  1LB2 A;  5G04 L;  2RR1 3;  5FPX A;  5KC5 A;  3FWE A;  3PUR A;  4RQP A;  3ZYF A;  2HBT A;  4W50 A;  3TWI A;  1Q8Q A;  2C5D A;  2F4P A;  2OA2 A;  3ENR A;  1HKD A;  4QPG C;  3HN3 A;  2VUJ A;  2ZKN A;  1AHS A;  1C4R A;  3ZDS A;  4YW2 A;  3VBR A;  1AR7 2;  1ULC A;  5FZ7 A;  3AZW A;  4Y5T A;  1EAH 1;  1W9W A;  2X5I C;  3BAL A;  4LXL A;  4AYU A;  5BNN A;  2GNB A;  5IVB A;  1ZRC A;  5LA9 A;  5FDB A;  3GBF A;  1AJO A;  5FY7 A;  1ULD A;  1V6J A;  1ZZB A;  5CB7 A;  2E33 A;  4MGS A;  3USS A;  2BWA A;  3WDU A;  1BMV 2;  3H3Z A;  3ZSE A;  2RS1 2;  1V6K A;  4A7K A;  2XPJ A;  1JZ8 A;  3BTZ A;  1W3X A;  1LU2 A;  3I3B A;  2JXA A;  4IEY A;  2VVD A;  2EXK A;  4RYD A;  1WW6 A;  4Y3O A;  3KF5 A;  4P9I A;  3MLK A;  2HLE A;  2VNR A;  3ILN A;  2ZEZ A;  3CLP A;  5FZO A;  1LKN A;  1OD3 A;  5D8A B;  3FHQ A;  5FOJ B;  2UY9 A;  1H1I A;  4YW7 A;  4FAG A;  1DZR A;  2P17 A;  3M4F A;  5M0T A;  3KCC A;  4NUB A;  1EUT A;  2ADE A;  3B69 A;  1HQN A;  5A1A A;  1W0O A;  3SH4 A;  1AZD A;  2VZO A;  4CUB A;  3SHR A;  3JB4 C;  5FZ1 A;  1PMJ X;  4RGK A;  2DWR A;  4DMI A;  2XKP A;  4B4P A;  1RMU 1;  3M3O A;  4IE7 A;  3ATG A;  2BZD A;  3JQX A;  1HJF A;  1WA4 A;  4EQV A;  4E4D X;  1RUI 3;  1SPP A;  5EHD A;  4OI1 A;  5FTT C;  1V6O A;  2XL7 A;  2R06 1;  5GLT A;  2D3R A;  3KS7 A;  2BV4 A;  3AKS A;  3W21 A;  4QHB A;  2ZGN A;  4IGP A;  5I8Y A;  5I0D A;  1QQP 3;  1BVP 1;  2VW1 A;  2GU9 A;  4WVM A;  1CPN A;  1D2Q A;  3M3Q A;  1KS4 A;  4HKW A;  4CDQ C;  3KV6 A;  3N9L A;  5AFB A;  1KRI A;  1GLH A;  2E31 A;  4AED A;  2HWE 3;  1GR3 A;  2WZR 1;  4AED B;  4YZ2 A;  5C3R A;  1JZ5 A;  1CIW A;  2P3K A;  3T2P A;  2XJQ A;  3QH7 A;  3H8R A;  3AFG A;  3K46 A;  3PUH A;  4BM8 A;  4N9I A;  4XC9 A;  1VBC 3;  1K3I A;  4LTA A;  1TE1 B;  1FMD 1;  1CAV B;  3O0X A;  2QQN A;  2DF7 A;  2EIE A;  2GH8 A;  1J59 A;  4QQ2 A;  1RUI 1;  2A6V A;  3LF7 A;  3WF4 A;  1GZW A;  1SDW A;  3ES4 A;  3C7F A;  3VZK A;  1U5Z A;  3ME2 A;  3VZL A;  2RR1 2;  3WG2 A;  3O1V A;  1QF3 A;  4FSJ A;  1LOG A;  3BOP A;  4GAZ A;  2B9U A;  1AL2 2;  3ES1 A;  1VBC 1;  4Q0P A;  4Y33 A;  2LW8 A;  4MLO A;  5LBE A;  2YFZ A;  1ENS A;  2JG8 C;  4LOT A;  5FY9 A;  3BYW A;  1NXM A;  3S5Q A;  5JXH A;  1NQD A;  2W39 A;  3IDA A;  4FP3 A;  3THC A;  2G9G A;  1MQT A;  5BNO A;  3GNE A;  5LWB A;  4IND A;  1DGW A;  2CY6 A;  1E5R A;  4K8R B;  1SFY A;  3ZXJ A;  4ZON A;  1C8M 1;  1Z7S 2;  5C71 A;  2WBK A;  5LCW L;  1PZ9 A;  3I97 A;  4LHS A;  4MV2 A;  4MGY E;  4GMP 0;  4GH4 B;  5CA6 A;  2C4X A;  4MSV A;  3SCF A;  2J22 A;  1VP6 A;  2NYY A;  1NCQ C;  2GNM A;  4K8F A;  4AFB A;  4RD7 A;  1LGN A;  4IEV A;  2GNT A;  2GH2 A;  4B1L A;  1NA1 C;  4HL0 A;  3PTR B;  5FZL A;  3IPV A;  1ALY A;  3TN9 2;  2F6B A;  1WD4 A;  2B4K A;  4YW6 A;  5A6Z A;  3ZXA C;  1TG7 A;  4GZ9 A;  4NWW A;  4N8M A;  3M3I A;  2VW2 A;  3CKH A;  2HWF 1;  4QPI C;  2WJS A;  2WAO A;  4FOQ A;  5T55 A;  3VBU C;  3WF0 A;  1VRH 1;  2CL2 A;  2BFU L;  3M3E A;  4JCK A;  1MEC 1;  4OZX A;  3VBO B;  2OS2 A;  1BYH A;  4YW3 A;  3FHI B;  4O7X A;  4AHY A;  4KWJ A;  4QPW A;  2EID A;  4KBB A;  1PGL 2;  4ITC A;  1S0I A;  1UXZ A;  2DU0 A;  2BOJ A;  5JR7 B;  4AEK A;  3PU8 A;  1GQP A;  4OVE A;  1HB4 A;  1VAL A;  2WNU C;  4Y1V A;  2C24 A;  2JE7 A;  3A21 A;  3DXU A;  1PO1 2;  1WBF A;  2DFC A;  3D82 A;  2O8Q A;  4CCN A;  5FOB B;  3AX4 A;  2DUR A;  3LOI A;  4C0H A;  4YVW A;  4RFR B;  1S1A A;  4HN1 A;  2D6N A;  2VPV A;  2DVA A;  2JE9 A;  3AP6 A;  4CXY A;  1O3S A;  5A32 A;  1SBF A;  2C26 A;  4CCK A;  4ES9 A;  2X29 A;  3KMH A;  3K2O A;  4AAX A;  2ARC A;  4J1W A;  4BQ5 A;  5LA0 A;  1LOE A;  4QPG A;  1CAV A;  1U0A A;  2GME A;  4YAR A;  1C5H A;  3S7E A;  2IFR A;  2O8O A;  2XVL A;  5K0U B;  3V0A A;  1VRB A;  3K77 A;  5SV8 A;  1UMZ A;  1W3V A;  2GN3 A;  2PAE A;  3F2Z A;  4DUV A;  1PO2 3;  5LK5 A;  2JG9 B;  1XU1 A;  1X9P A;  2XVG A;  5TSW A;  1RHI 1;  2JEM A;  1NLS A;  2RE9 A;  1W6P B;  4FOY A;  4QPY A;  1MVE A;  2K46 A;  2VOW A;  2YU2 A;  4LIU A;  3POY A;  1XNC A;  4AVC A;  4BYY A;  4MZU A;  2ZGT A;  3U1X A;  3VHR A;  2XJT A;  1RED A;  1CN1 A;  3LOB A;  3KSC A;  1C8N A;  4FTB A;  2CYF A;  3O5S A;  1WLD A;  1UZY A;  5JWP A;  1CJP A;  1SLI A;  5DUU A;  4FT8 A;  3RYK A;  4DZG A;  3PVO A;  5J7M A;  1PK6 B;  1ENX A;  3MO4 A;  2WII B;  4FBF A;  2VC9 A;  3LDB A;  2BGP A;  1WW7 A;  2P37 A;  1Z0H A;  3HNY M;  4ISQ A;  1JYT A;  2X5I B;  1B35 C;  3IAP A;  4NMI A;  2DCK A;  2KD7 A;  1A3K A;  2PHU A;  3LE0 A;  3N9Q A;  4XJW A;  4COY A;  2P3I A;  2QBX A;  4UOJ A;  3LIG A;  2D6M A;  3MW4 A;  1N1Y A;  4PF1 A;  3VZO A;  4AQ2 A;  1W9F A;  4FFH A;  3DYP A;  4QXC A;  2ZTN A;  5DUV A;  5FMO S;  4H14 A;  1RUJ 2;  1RMU 2;  1UCX A;  3B93 A;  3OGJ A;  2DBI A;  1D4V B;  1YHF A;  2B42 B;  5I0R A;  2WSU A;  1GQG A;  1LOA A;  5C7G A;  5C4W B;  4N7I A;  5DZE A;  2PTM A;  4XFA A;  1HDK A;  3E5X A;  3WW4 A;  2WO7 A;  3I2G A;  4IEX A;  4C1X A;  4I3P A;  2A6X A;  4PI2 A;  3CIH A;  3PVN A;  5EP9 A;  5A7W A;  1YUD A;  5FK8 A;  3I3Q A;  4HON A;  4Q0Q A;  3W5N A;  2OPW A;  5FY4 A;  3KQ4 B;  4YGC A;  4LBM A;  3D0J A;  4Q1P A;  4UBH A;  1S55 A;  4RR3 B;  2W0X A;  4H7L A;  2R0F A;  1J1T A;  2GC3 A;  1H6Y A;  2RJ2 A;  3VBS A;  4XXA A;  1D4M 1;  2F4L A;  2QQJ A;  2ZAA A;  1IQA A;  1RUC 3;  3DF0 A;  3NV1 A;  2QDR A;  4FPO B;  3RS6 A;  4EWE A;  2XXZ A;  1REF A;  2XML A;  1UO9 A;  1DZT A;  4AEM A;  1YO8 A;  2WLP A;  1ZX5 A;  1O4Y A;  4PBO A;  3PTY A;  2VXR A;  4QM9 A;  1FMD 3;  3GF6 A;  4DUW A;  2RDR A;  2CV6 A;  2MEV 1;  3MYX A;  3L2Y A;  4OI0 A;  5JZG A;  4QQP A;  1PVC 2;  2KXL A;  3TEY A;  4LHN A;  2PHX A;  2XB6 C;  5L19 A;  3I8T A;  3ZPO A;  5BNQ A;  1N3P A;  1YIF A;  5C3O A;  5LBB A;  3K51 A;  1W6Q B;  4LK7 A;  5E6H A;  1CX1 A;  1UIK A;  4DS0 A;  1B09 A;  5HV4 A;  1MVQ A;  1PZ8 A;  1UX7 A;  4XAE A;  3IT8 A;  2ID4 A;  3VBS B;  5CIS A;  5DAQ A;  1Q3E A;  3DKQ A;  4MET A;  3U4S A;  3KHB A;  3J9S A;  1MS1 A;  5FP7 A;  3ZYG A;  4DY3 A;  4XF4 A;  3LCP A;  4GH4 A;  1BBT 1;  4EE2 A;  3THP A;  1RJ7 A;  2RS3 3;  4EN7 B;  1MAC A;  2YV8 A;  4QX8 A;  4XF3 A;  1NT0 A;  1SZB A;  5E1R A;  1UZZ A;  5C3S A;  3R05 A;  1UZ0 A;  1G9A A;  1NCR C;  4I30 A;  5T5P A;  2Y64 A;  1GP6 A;  3IAQ A;  4KWL A;  4WVV A;  3VKF C;  4QPI B;  4NID A;  4UBG A;  4KG0 A;  4RS5 B;  3VBR B;  5F3C A;  1NE4 A;  4ISR A;  4PLO A;  4NHK A;  5DDJ 1;  1QJE A;  4XTP A;  1RUJ 1;  1DQ0 A;  4X8N A;  1LOF A;  2VUL A;  5J98 B;  2JDH A;  3UGF A;  4M3C A;  4KMQ A;  2HEY F;  3J8F 1;  2W1U A;  1D2S A;  2FDG A;  1YLL A;  2XL9 A;  3VBF B;  3ZMO A;  2W1S A;  3FLR A;  3FX3 A;  5JZG B;  1K45 A;  2I07 B;  4IE0 A;  3ZPY A;  1CAU B;  1NCQ B;  3H1Y A;  3WDT A;  4OHW A;  1GP5 A;  1PX4 A;  4YWA A;  2FDF A;  1YQC A;  2GND A;  2VZP A;  3HMY A;  2Y6K A;  5FLI A;  3HQU A;  2QE3 A;  4YGB A;  5A3P A;  4L92 A;  2AH2 A;  3ZMN A;  5A7P A;  1O91 A;  2FZ1 A;  4CEW C;  1MS0 A;  2UWB A;  4CDU A;  4B3N A;  2HWD 3;  1PGL 1;  1RUE 3;  4IGQ A;  5EZW A;  1H8T C;  4QB1 A;  5EJ1 B;  4ASK A;  4XUQ A;  1GNY A;  3NJV A;  1EAH 3;  2D97 A;  4CEY C;  4LHL A;  4F8A A;  4JAA A;  1YJL A;  4RR3 C;  1VMH A;  1PO1 1;  2A71 A;  3WW1 A;  4QD2 A;  1PNF A;  1UNB A;  3LAG A;  1IS6 A;  5FY5 A;  2XQR A;  1OUR A;  4OUE A;  5IUQ A;  3FE5 A;  3ZYH A;  2JEC A;  5C8W A;  4I2O A;  2BRT A;  2VQ0 A;  5BNP B;  4MGQ A;  4ZS2 A;  5JXI A;  5CKN A;  2ARX A;  1SAC A;  2HWC 1;  3DXT A;  2GC1 A;  3ZKU A;  3BOW A;  1XND A;  1ULF A;  4Q2F A;  2IXK A;  3GBG A;  1M4W A;  1JI6 A;  4NIA A;  3I2K A;  4QGM A;  4B1M A;  4QQL A;  2RS5 1;  1XBF A;  3QOP A;  4NHX A;  5AC9 3;  1SEF A;  2YXS A;  3FBM A;  3H8O A;  3HIF A;  4QGN A;  2D6O X;  1L7L A;  2MEV 3;  1UY2 A;  1D0G A;  1F9K A;  2PEL A;  2V5D A;  5EJZ B;  2DBN A;  3IBM A;  4A3Z A;  3I2I A;  4WM8 B;  3USU B;  2VU9 A;  4B29 A;  3OPZ A;  4PF5 A;  3QD6 A;  2DVG A;  3GHM A;  4YFZ A;  3R4U A;  4CDQ B;  1UOG A;  4G4F A;  4JHT A;  2WNV C;  1O3T A;  3AYA A;  4ZXK A;  5K9Y A;  4LEJ A;  4CUA A;  5BV6 A;  2YB7 A;  1IPJ A;  1QXR A;  4Q5O A;  1TME 1;  4K7J A;  4LE4 A;  3JCI A;  4K6B A;  1VR3 A;  2KR2 A;  4S2D A;  3BU0 A;  3VD9 A;  1TVG A;  3ZR5 A;  1ND3 B;  3AYC A;  2YC0 A;  1MZ6 A;  1RL3 A;  2B46 X;  1QQP 2;  1W2N A;  1TQ5 A;  5FO9 B;  1OUX A;  2BNM A;  4E8D A;  1GNZ A;  4AVS A;  3DEM A;  1OC1 A;  3ETQ A;  4IXL A;  4BMB A;  2VD7 A;  1CES A;  4RQP B;  1CAW B;  1KEX A;  2OPK A;  4RL7 A;  4YVS B;  4URA A;  3AKR A;  5IAT A;  5FZK A;  4Z92 B;  1M06 G;  2A73 B;  1XJA A;  4LKF A;  4DXS A;  3OY8 B;  4Y20 B;  1UYX A;  2RM2 2;  4P9Y A;  2AUY A;  3NNM A;  4YM2 A;  3BTY A;  2Y6G A;  1UY3 A;  3BPZ A;  3V65 A;  1LEM A;  5I0U A;  1UOB A;  3AKT A;  4E9K A;  2O0O A;  1YIP A;  1CWP A;  1EP0 A;  4MHU A;  1XNK A;  3E6C C;  2WSV A;  3LSE A;  3Q8E A;  3HNM A;  4KQ7 A;  3O1M A;  3G6J B;  1PIV 1;  1ZA4 A;  2GZW A;  4I09 A;  1TME 2;  1C1F A;  5BNN C;  5GZF A;  3CZJ A;  1R08 1;  4QQO A;  4RFT 0;  2JIJ A;  1ACC A;  2BVV A;  4P9J A;  4QHO A;  4HSL A;  5HXM A;  3IDE A;  4RHV 1;  4LA3 A;  2HWC 2;  5JXG A;  1OPM A;  1SLT A;  2J1S A;  5F1R A;  1VBD 3;  3M8L A;  4X8P A;  3BTX A;  1BEV 3;  2QCS B;  2HEV F;  4R9B A;  1OOP A;  3LPG A;  1JOP A;  4CU8 A;  1QHD A;  4Y20 A;  4ZY9 A;  2EAL A;  3AP4 A;  2DUO A;  3WNL A;  3OD4 A;  1OF4 A;  4Y1X A;  3SH3 A;  1WW5 A;  3TRS B;  1V70 A;  3ZDV A;  2ZA9 A;  3VBU B;  3A4U A;  5ACA 1;  4M0H A;  4HBN A;  2WA4 A;  3MIF A;  4WZC A;  3AL6 A;  5IVY A;  5KXB A;  3HEI A;  2Q8E A;  1T6B X;  3ILF A;  2Z4F A;  2HWC 3;  3OBZ A;  1CJD A;  1LHW A;  1ULO A;  2DVB A;  5LAS A;  4HOO A;  4IES A;  3I59 B;  4AGR A;  3RJ2 X;  4E2Q A;  2YMZ A;  2CGO A;  2FMY A;  1RVF 3;  3ZOI A;  5CFC B;  4XFI A;  2VY0 A;  5L7O C;  5FKB A;  1S0C A;  3UK9 A;  4CPB D;  1GSL A;  4NN0 A;  5D21 A;  2XQX A;  1CPM A;  4UAP A;  1OFS A;  3D4K A;  3ZXG A;  1AF9 A;  4JTO A;  4Q4X 2;  4CDQ A;  1O3R A;  2WNE A;  4FVV A;  4LO8 A;  4LBL A;  1HRV 2;  2Y33 A;  1BCX A;  3GZA A;  3ZN6 B;  1F15 A;  1WD3 A;  4LO5 B;  5D2A A;  5HCH A;  4Y4R A;  4FFF A;  2QQU A;  3N7M A;  1GWL A;  2FDH A;  4MGZ E;  2WAB A;  1XXN A;  5IJR A; 
#chains in the Genus database with same CATH homology
 1OH4 A;  5FUI A;  3FL7 A;  1DYO A;  4IUG A;  1BHG A;  3A7Q A;  1UMI A;  1W9W A;  3C8X A;  3MBW A;  1JZ4 A;  2VCA A;  4CU6 A;  2YC4 A;  3D3A A;  2E33 A;  4MGS A;  3NNG A;  2PQS A;  3EYP A;  1JZ8 A;  3I3B A;  4RYD A;  2VZV A;  3K4Z A;  4BXS V;  2HLE A;  2ZEZ A;  3CQO A;  1J84 A;  1OD3 A;  1O8S A;  3FHQ A;  4M4R A;  4OMC A;  3LEI A;  3DYM A;  5DPN A;  1EUT A;  3ETP A;  3GDB A;  5A1A A;  2V72 A;  1JZ6 A;  2VZO A;  4CUB A;  1PMJ X;  2WZE A;  4JKK A;  4TXW A;  2BZD A;  3MV0 1;  4JX0 A;  3K4A A;  3I2F A;  3E1F 1;  5I0D A;  2W3J A;  5DMY A;  2JD9 A;  1PX3 A;  4JKL A;  2E31 A;  2W91 A;  1JZ5 A;  2QQO A;  5JXJ A;  2ZEW A;  3BGA A;  3T2P A;  4ZZ5 A;  5JMO A;  2VJX A;  2X09 A;  3DEC A;  5LA2 A;  2WQ8 A;  3OBA A;  1W9T A;  3DYO A;  3K46 A;  3PUH A;  1O8P A;  3WEZ A;  2J1E A;  3I2J A;  2YFU A;  5JR2 A;  3HOB A;  1K3I A;  1GOF A;  2WO2 A;  2QQN A;  2EIE A;  3WF4 A;  5DN2 A;  4JKM A;  3ABZ A;  3C7F A;  5IFP A;  3K75 B;  4XVH A;  1EUU A;  2W95 A;  3OB8 A;  2LW8 A;  2YFZ A;  2XON A;  3MUZ 1;  2Y6H A;  3NQH A;  5JXH A;  3WNO A;  3IDA A;  3THC A;  3ZM8 A;  4P02 B;  2XOM A;  2W5F A;  5C71 A;  2LS6 A;  2WBK A;  3HNB M;  5LCW L;  4A4A A;  3I97 A;  1L7R A;  4LHS A;  2WUH A;  2C4X A;  2J22 A;  4JHZ A;  2W87 A;  3P1I A;  3OGR A;  1JZ3 A;  3HPN A;  2QQM A;  2BBA A;  2JDA A;  2B4K A;  1TG7 A;  4GZ9 A;  4DEQ A;  3CKH A;  3SKV A;  1H6X A;  4E8C A;  2WAO A;  3IB3 A;  2W1W A;  3WF3 A;  3WF0 A;  3SKJ E;  2VQT A;  2VL4 A;  1JYV A;  4BK4 A;  2ORZ A;  3ACH A;  3III A;  4QPW A;  2EID A;  1UXZ A;  3P6B A;  3LEG A;  1SDD B;  3GXU A;  4A41 A;  1NUK A;  1GQP A;  1P8J A;  2C9K A;  4ET7 A;  3A21 A;  3WQB A;  4A45 A;  4GWJ A;  4ARY A;  1W0N A;  4HG6 B;  4QDS A;  4DEV A;  2C26 A;  3THD A;  3AC0 A;  4AAX A;  3VD4 A;  5LA0 A;  1HN1 A;  4KWU A;  2VZ1 A;  3K77 A;  4OYU A;  1ULP A;  1XC6 A;  3F2Z A;  2XHN A;  2DDU A;  4DUV A;  1OT5 A;  1JYW A;  4PT6 A;  3GM8 A;  3WNM A;  2OKX A;  1D7P M;  3PUI A;  1UY4 A;  2RV9 A;  1W8N A;  1YQ2 A;  2BGO A;  5B4N A;  1F4H A;  2JKX A;  3VDC A;  2WZ8 A;  4QB2 A;  5G05 L;  2RVA A;  4D8M A;  3MO4 A;  1JZ7 A;  2VC9 A;  2BGP A;  3HNY M;  3OEA A;  2Y6J A;  3IAP A;  2VO5 A;  2DCK A;  2KD7 A;  5CYY A;  3LE0 A;  1IQD C;  4MAD A;  2Y8K A;  4QX3 A;  2QBX A;  4UOJ A;  2YG0 A;  4PF1 A;  3DYP A;  1I5P A;  2CDO A;  1LNS A;  2VMC A;  3CMG A;  5IFT A;  4TTG A;  3C7E A;  2W92 A;  2VME A;  2W47 A;  3T2Q A;  5C7G A;  1K42 A;  2YC2 A;  4CUC A;  3I2G A;  3UET A;  4DXT A;  3CIH A;  3UES A;  4DXR A;  3W5N A;  1GOH A;  1US2 A;  2VM9 A;  3I3D A;  3CDZ B;  3J7H A;  4W4Z A;  3CZU A;  1UY0 A;  2J1R A;  2WN3 A;  3VD7 A;  2RJ2 A;  1H6Y A;  2VZ3 A;  2QQJ A;  2WN2 A;  4XUP A;  5IYY A;  2E32 A;  4OZO A;  2J1V A;  4L0P A;  4PQQ A;  3T0A A;  4GWI A;  4LPL A;  2J7M A;  3ACF A;  1GU3 A;  4DUW A;  2W1Q A;  1XNT A;  3WNK A;  1DP0 A;  1XNA A;  2JE8 A;  3C7G A;  3ECQ A;  3WNN A;  2R7E B;  3VD3 A;  1CX1 A;  1K12 A;  4Z2A A;  5IHR A;  1OF3 A;  1CIY A;  2VMF A;  2B9V A;  1UX7 A;  2ID4 A;  2VOT A;  2Y6L A;  5C70 A;  1GOG A;  5JUV A;  2QQL A;  3SEE A;  4ZZ8 A;  3EB7 A;  1UZ0 A;  1UYZ A;  4QX1 A;  3WF1 A;  2Y64 A;  3IAQ A;  4M4P A;  3BN6 A;  4QB6 A;  5F7U A;  2ZEX A;  3W5M A;  2QQI A;  3LEK A;  5EIY B;  4KMQ A;  2W1U A;  2VCC A;  2J1A A;  3C7H A;  3T2O A;  2W1S A;  2W9X A;  1K45 A;  1W9S A;  4P08 A;  1SG3 A;  4XUR A;  1JYX A;  4QAW A;  1PX4 A;  5LA1 A;  3WSO A;  4BJ0 A;  2VZP A;  2VZT A;  2Y6K A;  4YPJ A;  1JU3 A;  1JYN A;  4BDV B;  4QB1 A;  4D0Q A;  5EJ1 B;  3A23 A;  4XUQ A;  5J1X A;  1GNY A;  3NJV A;  3OG2 A;  1NKG A;  5B4X A;  3C7O A;  3SEP A;  4CU9 A;  4P5Y A;  2VR4 A;  4XUT A;  3ACI A;  4XUN A;  1KGY A;  4OUE A;  1MPX A;  3JXS A;  4MGQ A;  5JXI A;  1GUI A;  1T2X A;  3LQC A;  1US3 A;  1UXX X;  2W46 A;  3U37 A;  1JI6 A;  1WKY A;  4OMD A;  3I2K A;  2ORX A;  2EIC A;  1CZT A;  1CZS A;  4ZXE A;  4P00 B;  3NRU A;  4QX2 A;  4CU7 A;  1JHJ A;  4A6O A;  5HPO A;  3FHA A;  3GGL A;  5DQ0 A;  1UY2 A;  3MUY 1;  2WAA A;  1WCQ A;  2V5D A;  5EJZ B;  4A3Z A;  3I2I A;  1J83 A;  3LPF A;  1SHW B;  2X05 A;  4A44 A;  2WO1 A;  4CUA A;  2YB7 A;  3OGV A;  3ACG A;  1JU4 A;  4XUO A;  3VD5 A;  4QDQ A;  2VZR A;  3VD9 A;  1TVG A;  2ZXQ A;  2J1U A;  1O59 A;  2VZQ A;  2VZU A;  4E8D A;  2J1T A;  1NX9 A;  4QDR A;  2W94 A;  1R64 A;  1KEX A;  2VMD A;  2EIB A;  4DXS A;  3OGS A;  1UYX A;  4FI9 A;  2HYX A;  1L7Q A;  4A42 A;  3I2H A;  2Y6G A;  1UY3 A;  1UWW A;  2VQU A;  3HNM A;  4MO3 M;  3WNP A;  3CZJ A;  1F4A A;  2WDB A;  3NJX A;  5HXM A;  4MOA A;  2X10 A;  4ARX A;  5JXG A;  4QX0 A;  2J1S A;  2VZS A;  2L9L A;  2E26 A;  2ZEY A;  3MV1 1;  3LPG A;  4CU8 A;  3VDA A;  2WYS A;  4ZY9 A;  1XPW A;  4AG4 A;  3HJR A;  3WNL A;  3WF2 A;  1OF4 A;  3OEB A;  1NAE A;  2BER A;  4XZU G;  3HEI A;  1UYY A;  2Z4F A;  1ULO A;  1RYY A;  1DLC A;  1GMM A;  2VTF A;  2DCJ A;  3A22 A;  4DUX A;  1UMH A;  3VDB A;  3FN9 A;  3I3E A;  3UNP A;  2V4V A;  3T08 A;  4W8J A;  4RN5 A;  1CZV A;  4BK5 A;  1W99 A;  2XQX A;  4UAP A;  3T09 A;  4CVU A;  3K4D A;  5CZK A;  4KI5 M;  1PMH X;  1UY1 A;  5G04 L;  2WO3 A;  3T0B A;  2QQK A;  4UI9 L;  2VCB A;  4LQR A;  2CDP A;  4W50 A;  1W8O A;  3T0D A;  1JZ2 A;  4LKS A;  3HN3 A;  2WAB A;  5IJR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...