2WDBA

A family 32 carbohydrate-binding module, from the mu toxin produced by clostridium perfringens, in complex with beta-d-glcnac-beta(1,2) mannose
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
139
structure length
139
Chain Sequence
NPSLIRSESWQVYEGNEANLLDGDDNTGVWYKTLNGDTSLAGEFIGLDLGKEIKLDGIRFVIGKNGGGSSDKWNKFKLEYSLDNESWTTIKEYDKTGAPAGKDVIEESFETPISAKYIRLTNMENINKWLTFSEFAIVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords HYALURONOGLUCOSAMINIDASE
publication title N-Acetylglucosamine Recognition by a Family 32 Carbohydrate-Binding Module from Clostridium Perfringens Nagh.
pubmed doi rcsb
source organism Clostridium perfringens
total genus 38
structure length 139
sequence length 139
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.35: Hyaluronoglucosaminidase.
pdb deposition date 2009-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2wdbA00
4QDRA 3LQCA 4TXWA 2VZQA 3LEGA 3C7OA 2WAAA 2VR4A 3T2OA 3HNMA 1WKYA 2Y6KA 3UESA 2WN2A 1PMJX 1W8NA 4OUEA 2YG0A 1W9SA 4QX3A 2EICA 3A22A 5G04L 2L9LA 3OBAA 3WEZA 4QB2A 3GGLA 1UY2A 2J1UA 4A4AA 1NAEA 2W92A 3K4AA 3K46A 2VM9A 4GZ9A 3LPFA 2ZEXA 4DUXA 4CU9A 2VL4A 3K4ZA 3A23A 1DYOA 1SG3A 4JX0A 1DP0A 2WN3A 2VZSA 4MADA 3I2FA 3VDAA 3GM8A 1UMIA 3HJRA 5HXMA 4ARYA 4ZZ5A 2E32A 5DN2A 3I2IA 3IDAA 1GMMA 2QBXA 1TG7A 4MGQA 1NUKA 3AC0A 5JR2A 1UYYA 1JZ5A 1YQ2A 1CIYA 2QQIA 3I3EA 1SHWB 4QPWA 4DXTA 3PUHA 5LA0A 3HPNA 1JHJA 2W95A 3K77A 1GNYA 3NQHA 5C70A 2XOMA 3MV01 2C9KA 4M4PA 4JHZA 5DMYA 2EIEA 3C7HA 3SEEA 1UY0A 4PF1A 2DCJA 4KI5M 5JUVA 3IB3A 3ACFA 5G05L 4XUPA 2CDPA 1OT5A 4XURA 1IQDC 1PMHX 3HOBA 4OMDA 2VZUA 4A3ZA 4QB6A 1CZVA 4OMCA 2VC9A 2VQUA 2LW8A 2XONA 3C8XA 3UNPA 1CZTA 3A7QA 4AAXA 3VDBA 4DUWA 1GUIA 2VZTA 4XUTA 5JMOA 1I5PA 1JZ4A 1UWWA 1UYXA 4KWUA 5F7UA 3K4DA 3OEAA 4UAPA 3SKJE 3T2PA 1W8OA 5IFPA 2KD7A 3I2KA 2Y6GA 1DLCA 2ORZA 3T08A 1O8SA 2WDBA 4IUGA 3D3AA 4BDVB 5EJ1B 3DYMA 3I2JA 3VD9A 4OYUA 4E8CA 1H6YA 1CZSA 1PX3A 3MO4A 4W50A 1L7QA 2V4VA 2QQKA 5HPOA 5J1XA 1JYWA 3I2HA 1US2A 3SKVA 2BGPA 4UI9L 3EB7A 3EYPA 5JXIA 2PQSA 2WABA 3VD4A 3MUY1 2YC2A 3VDCA 4JKLA 2B4KA 3OEBA 3CKHA 2BZDA 2VMDA 2ZEWA 2QQNA 3DECA 1W9TA 3J7HA 3FN9A 1TVGA 4QDSA 3LPGA 3GXUA 3WNLA 3HEIA 2ORXA 4ZZ8A 3A21A 1GU3A 2QQJA 2QQLA 4CUAA 4P08A 4MGSA 1OF3A 3CMGA 3CZUA 2X05A 3WF3A 3IAQA 1UY1A 4QX1A 2YC4A 3WNPA 5IJRA 5JXJA 2BBAA 3WQBA 4A41A 2W1WA 4ARXA 3GDBA 3WNMA 3I97A 2WYSA 2V5DA 4P5YA 1O8PA 2XQXA 3CIHA 2WUHA 2W87A 5LA2A 3ACHA 3T0DA 3SEPA 3THDA 1UY4A 4QB1A 3F2ZA 4BK5A 1MPXA 4OZOA 4A45A 2YFZA 5A1AA 2E31A 3T0BA 3I3BA 1EUUA 2BERA 1K12A 3T09A 4JKMA 1GOFA 2VQTA 2X09A 3IIIA 4DEVA 5C71A 4CU8A 4A44A 2ZEYA 2J1SA 3C7GA 2C26A 4CU7A 4PQQA 3IAPA 1OH4A 2VZ3A 5DPNA 1US3A 2WO3A 5IFTA 1K42A 3VD5A 1XNTA 1XNAA 2EIBA 2JE8A 2VTFA 1XC6A 5I0DA 1W99A 1NKGA 2WBKA 2OKXA 3LE0A 1F4HA 3VD3A 2VO5A 4TTGA 1OD3A 1SDDB 1OF4A 3VD7A 2WZ8A 2W1QA 1JI6A 3NRUA 2J1TA 2J22A 2JD9A 3PUIA 4RYDA 4M4RA 5IYYA 2VMEA 3E1F1 4ZY9A 1GOHA 2VZRA 3K75B 4L0PA 1UXXX 1W9WA 5LA1A 2VMCA 4GWJA 2XHNA 4DEQA 1GQPA 3C7FA 1JZ8A 4KMQA 3P1IA 1UZ0A 3C7EA 3I2GA 2LS6A 2WO2A 1CX1A 1T2XA 3BN6A 2QQOA 2YB7A 2BGOA 4A6OA 2VMFA 1J83A 4RN5A 4CU6A 1ULPA 3ABZA 4Z2AA 2V72A 3WF4A 4GWIA 1WCQA 1UY3A 2Y6HA 2VZPA 2J1EA 4QAWA 2Y6JA 3HNYM 4XUNA 2W47A 3P6BA 2DDUA 3JXSA 4XUOA 3W5MA 1UX7A 1XPWA 2VCBA 4E8DA 2VZVA 4FI9A 1ULOA 5DQ0A 1J84A 2W1UA 4XUQA 2VCCA 3OG2A 1KEXA 2DCKA 2QQMA 4QDQA 4A42A 2CDOA 1JU4A 1H6XA 4HG6B 2WAOA 2W46A 3OB8A 2VJXA 5IHRA 1JZ2A 2B9VA 1JYXA 3NJXA 2Y64A 2VCAA 3CQOA 1L7RA 2WZEA 5JXHA 3FHAA 3I3DA 1W0NA 2VZOA 4MO3M 4CUBA 4ZXEA 3FL7A 2J1RA 1R64A 2Y6LA 4QX0A 2W5FA 4JKKA 4BJ0A 2J7MA 3LEIA 2J1VA 3OGRA 3NNGA 1EUTA 2RJ2A 3WNNA 3BGAA 4UOJA 2VOTA 5LCWL 2ID4A 2RVAA 3OGVA 5CZKA 1JYVA 3ZM8A 4DUVA 1NX9A 1JZ7A 4QX2A 4DXRA 1P8JA 5JXGA 1JZ3A 2C4XA 4CUCA 2R7EB 2YFUA 2W91A 4ET7A 2W3JA 3ECQA 3NJVA 4PT6A 3HNBM 2W1SA 1JU3A 1RYYA 4DXSA 2EIDA 4CVUA 3MBWA 3WF0A 4XVHA 1LNSA 2JKXA 4W8JA 1UXZA 3T0AA 3ETPA 3WNOA 3CDZB 2Z4FA 3DYPA 5B4XA 1HN1A 5EIYB 1O59A 3CZJA 3MUZ1 4P00B 3ACGA 2Y8KA 1UMHA 5CYYA 2E26A 1F4AA 2E33A 3DYOA 1UYZA 2X10A 4BXSV 2ZEZA 2RV9A 3T2QA 3LEKA 1BHGA 2J1AA 3WF1A 4LHSA 1K45A 1JYNA 3WF2A 2WQ8A 2WO1A 3THCA 5C7GA 2JDAA 3ACIA 5FUIA 2HLEA 4P02B 3FHQA 4MOAA 3WSOA 4AG4A 4XZUG 1KGYA 4D8MA 4YPJA 1PX4A 1JZ6A 3HN3A 4BK4A 2W94A 3UETA 3OGSA 3U37A 2W9XA 1GOGA 5B4NA 1K3IA 2VZ1A 4W4ZA 3WNKA 2ZXQA 1D7PM 4LQRA 4LKSA 4LPLA 3W5NA 2HYXA 5EJZB 3MV11 4D0QA
chains in the Genus database with same CATH superfamily
1XB9A 4LO6B 4QQOA 1GKBA 1SFNA 2LALA 4EV0A 5FZAA 5FY9A 1WW5A 1VR3A 5ANNA 2VW2A 4OQ9A 1RUI2 2PHUA 4CXXA 1RUI1 2D44A 1K5JA 1OBNA 1PMJX 1W8UA 3LWCA 1GFF2 4QQ2A 3OGGA 4OUEA 3ZN5A 5JIUA 2DUOA 3H9AA 1W9SA 4I2OA 1LULA 5G04L 3OBAA 1VMFA 2IXJA 1WA6X 3RQ0A 1UY2A 1C4RA 5IVEA 5J36A 2J1UA 2JECA 4NRMA 3ORJA 1NAEA 3AZYA 1MEC2 2W92A 3WW2A 1W6MA 3KCCA 4FP2A 4FPYA 3W9AA 1MEC1 3OPWA 4YG3A 5C5TA 4XZPA 2ZEXA 1DGRA 2DTWA 4L92A 1ENXA 2VL4A 4CP0A 3NO8A 3WCRA 2GN7A 5FZ9A 1YFUA 3H1WA 1R082 4OHWA 3LEMA 3AYAA 2WN3A 4XFHA 3MIHA 1VBA3 1VPHA 2KR2A 3RZZA 2VZSA 3VBOB 3SHRA 5BNOB 4LMFA 3RVHA 1VAKA 3CJIC 3MFAA 2V5YA 1GSLA 3AMMA 4RHV3 4D6QA 4ONUA 3WQ0A 5FWEA 4N53A 3BTXA 5DN2A 4GH4C 4LJHA 4MXVA 2ZKNA 3M3IA 4B7KA 3Q8AA 2ZTNA 3IDAA 2JDZA 3JBG3 2RR13 5C9AA 4CP2A 3SCGA 1TG7A 3KGLA 4IE5A 1F8VA 1UPSA 5JR2A 1ZX5A 2VCMA 1JZ5A 4FTBA 2QKDA 1OI6A 2R1BA 4OI1A 4CEWA 3WW1A 3POSA 1CIYA 2XVKA 3ZN6B 4PI2A 3DPRC 3PUHA 3S7IA 3BOPA 1PVC3 2WJSA 3E5XA 1EP0A 4KBBA 4QGLA 3HPNA 2NPIA 2WRAA 5EZWA 5A80A 5LA0A 3N9MA 5CBLA 2G19A 2Y0OA 2BUKA 4LXLA 2OS2A 2NYYA 3MV01 3OY8A 3WD5A 4AEMA 1IOAA 4F3JA 3FZ3A 3PDQA 4JHZA 2EIEA 3C7HA 4U2AA 3T2TA 1F5FA 2FCVA 4LO4B 4RFRB 2DCJA 1I6XA 4A7ZA 1UAIA 5FO8B 1F15A 1D0GA 3VBSB 4HXCA 4XDQA 2Y38A 1W04A 4KL1A 3WP3A 4YGEA 5KWRA 4EJRA 2R32A 1QIQA 2EA7A 2FHRA 4BMBA 4JGZA 4DMIA 1PGW2 1BCXA 1QEXA 1RC6A 1U12A 4LNVA 2P6CA 1RUH3 2XONA 3UNPA 2PHWA 3FJSA 3RI9A 4AAXA 3VDBA 4DUWA 3F95A 3J7MA 2XG3A 2B5HA 1I5PA 2VD7A 1EV12 2UURA 4PLOA 2PTMA 1LJ7A 2WNUA 3K48A 4QQHA 1YIPA 4IV3A 3O1RA 1J3QA 4N90A 5F7UA 1OQ1A 3KT7A 3R6SA 2XJRA 4Y26A 4NUBA 1KITA 3B94A 4WVVA 1VRH2 3D82A 4CYDA 4DFSA 5GZEA 1LB2A 1VRH1 4BDVB 4JZRA 1XE0A 3DYMA 3BKZA 3VD9A 4IEYA 4OYUA 4E8CA 4FOWA 4W50A 1PX3A 4SLIA 4E4DX 3U4SA 3HQUA 4CDWC 2YPDA 4ISRA 5T5LA 2QQKA 5BXXA 4QHBA 5IVVA 2E9QA 2IXHA 4B4RA 1JYWA 3S57A 3I2HA 4XYXA 5J98B 2BGPA 2TNFA 1YYNA 5JXIA 2JG8C 3KV9A 4NPRA 1HQWA 2WABA 5JVVA 4D7TA 4LBQD 1YIFA 4B1MA 2RM21 3WHTA 3TBDA 5GZGA 3MUY1 1E5SA 1AYM2 1W6PB 3GBGA 1AYM1 3CKHA 4LBOA 3NAPC 1H8VA 1WMXA 1XNBA 2DWRA 1MZ5A 1H4HA 2PYTA 2D40A 5FZBA 5FXWA 3BALA 3WNXA 4S2HA 1XYOA 5C8CB 2W39A 3WQ1A 1ZRIA 3GXUA 5CB7A 3HEIA 4LK7A 1RVF2 1VJ2A 2ORXA 5IVFA 4XPVA 1T6BX 3AP4A 1C8M2 3ZPYA 1QHDA 3VBRA 2QQJA 1RVF1 1WMEA 5DG1A 3M3EA 1C8M1 3NV1A 1DDLA 2JG9B 4XHBA 1AR73 4XABA 2G9FA 1AXKA 1CAWA 1O3TA 4WVMA 4AZZA 2YY1A 2MEV1 5FPUA 3AVRA 3O14A 3CMGA 3CZUA 1HJFA 2R30A 1HRI3 3B7MA 3FMGA 3IAQA 3OYWA 5CIRA 3OTFA 3WT3A 3DKWA 3E5UA 2D5HA 3WUCA 5IAVA 2UWCA 4KWKA 5J96B 3QD6A 4WV8A 3N9OA 5HV4A 2F4PA 5IK5A 4A41A 3D6EA 2JDNA 4Q4W3 1V6LA 3GDBA 2BEOA 1LTEA 3I97A 1C1FA 1JH5A 1PGSA 4XDOA 1PGL2 1WW7A 5K0UB 4FOVA 2V5DA 1AR93 2XQXA 1PGL1 5LA2A 2WNOA 3WW3A 3HMYA 4E4SA 1C3HA 4LE3A 1F31A 4FFGA 1QDCA 3OPTA 1ZBA3 4PIXA 4A45A 5A1AA 3T0BA 4PIZA 3B9CA 1PO23 3ALQA 3ZFFA 1YO8A 3SCHA 3FLPA 3HBZA 4JKMA 4JDOA 5DUWA 3ZX7A 3CNAA 1GP4A 4CA9A 1PNGA 2X09A 5DDJ1 4GB31 3KT1A 5BNNC 2OZ6A 4RS5B 4RHV2 2X29A 4RR3A 3POYA 5A6QA 1FPN2 1GR3A 4CU8A 3N7MA 1YQ6A 2YPJA 4A44A 1W28A 2XJTA 3H50A 3LSEA 3PL0A 4LBLA 4UW4A 1FPN1 2C26A 5FCCA 1SLTA 4NRQA 3V64A 2VUJA 3UV9A 1FATA 3J7NA 3N36A 4H7LA 1GWMA 5L9VA 5DPNA 3IT8A 4XQWA 1LOGA 3PTRB 1I5ZA 1US3A 2Q0AA 3BIWE 2ZHKA 2A6ZA 4AVBA 4ZS3A 3ZO0B 3UKTA 2VTXJ 3SCFA 1RUOA 1XNAA 3LIGA 4KGQA 2WZPP 3E5QA 1OOPC 4YW2A 2VTFA 5FR3A 1DQ1A 1XC6A 1HB4A 1ULDA 2OUJA 1STMA 2SLIA 3HN1A 1LR5A 5GKAC 5A7WB 5AC92 1DGWX 4YVWC 4COUA 2A5ZA 5BNNA 3HR9A 1HQLA 3LDKA 2W52A 5AC91 3LE0A 4Z2WA 1F4HA 3VD3A 2QCSB 2GU9A 3HT1A 4YARA 2OX0A 4QGMA 3DL3A 4QXKA 4BQ3A 1OD3A 1SDDB 4HOOA 4L9BA 3T1MA 3ATGA 4LLOA 4Y5Z0 1IPSA 4LT5A 2VQAA 3QLQA 1JI6A 2DBNA 3M3OA 1W6MB 2A70A 2J22A 5I0UA 1RTVA 4A7KA 4GWMA 4M4RA 5BYNA 4ZY9A 1GOHA 5M0TA 1PMIA 1RUH2 2WNVA 5FYYA 1W9WA 3TEYA 3H1MA 1H8TB 2D3SA 2VMCA 4ZU4A 1ODNA 4DEQA 3BTAA 3TOJA 4QU2A 2HWE2 4CDXB 1JZ8A 2DBIA 3U4XA 3P1IA 5DAVA 1CR7A 4MH0E 3RPQA 2HWE1 3U78A 5C5UA 4FOQA 4ISQA 4TLFA 1ZZ8A 3BN6A 5DZFA 1RUNA 1E5RA 1XE8A 3S5QA 1UZZA 1Y9QA 1HV1A 4CU6A 1DQ6A 1RITA 4PF5A 3GBFA 4XFGA 1DFQA 5F5QA 3MPPG 2QDNA 1HQNA 2PA7A 4HN1A 1QMJA 1B35C 4XDPA 5FDBA 2J1EA 4XUNA 3HNYM 3INAA 1H4GA 1YFWA 2E53A 3ZXAC 3ZYHA 5JPMB 4FVVA 1D0HA 1RUG3 3JXSA 3NJZA 3BIEA 2K9ZA 5DUXA 5HXVA 5A7PA 5GLZA 3AYCA 4ASKA 4AI2A 4FI9A 4AVAA 4C0BA 1ULOA 1JTZX 2W1UA 3ZR5A 4HKWA 3OG2A 4FPOB 2ARBA 2DCKA 1V9U2 2XJSA 2K2SA 4QKDA 3O1MA 1SDWA 1V9U1 5FZFA 1W6OA 4HG6B 4M3CE 1NYWA 2ZHLA 1D4VB 5A3UA 2W46A 3FFZA 5FZGA 5T5OA 2VAUA 1AJOA 1W8TA 5C4WA 4NOTA 1IPKA 4K40A 3UGGA 4IEQA 1J1LA 4CCEA 5EYXA 2DUPA 2CTVA 4PDWC 3VV1A 2Y64A 5A6YA 2VCAA 4M00A 3LSDA 2R072 1WLWA 1WGPA 3CQOA 4X8NA 4DRVA 2UY8A 4OFGA 4OI4A 4URAA 3S5AA 2R071 4FQZA 4UYBA 3FHAA 4H7MA 5ABJA 5D1IA 1BYHA 4XTMA 1OQEA 4XJWA 3T4HB 3VDDC 5JCTA 1QXRA 2QQUA 4YM2A 3OOXA 2OA2A 3U10A 3VZOA 4AQ2A 2P5BA 4WVWA 4BIFA 1VB2A 2ZX4A 3FL7A 1V6KA 1AR61 3VBFA 4XF1A 1N1TA 5IK8A 4HONA 1U5IA 4BJ0A 2J7MA 2WFF2 2UWAA 4CCLA 3ZSJA 2GDFA 1TNFA 1ZBE2 1DQ4A 2J1VA 2WLPA 5E89A 2WFF1 5FPAA 1MZ6A 2EAAA 1ZBE1 1IKQA 2PHFA 3N9QA 3O1OA 1M06G 3KD4A 2VW0A 5KR7A 1SLIA 1YJKA 3GNEA 4L2NA 4UBGA 1JYVA 3FFQA 4J6GA 1F2NA 1W9YA 1G9DA 1O4TA 3AJZA 3BTZA 1TMF2 1W6NA 2Q4SA 3WCSA 1TMF1 2BWAA 4QPYA 3WDXA 4G9SB 2B46X 4MSVA 4AI9A 4NPLA 4D6SA 2IXCA 4H2AA 2YHJA 2FDGA 1YQ5A 2ZMNA 2C9AA 5FYTA 3AZZA 3N9LA 1W9FA 2NP0A 3AM2A 4R9DA 2XWBB 1URXA 4CEYC 2WS92 3WF0A 4CVUA 1IS5A 4A6SA 2Y60A 1ULCA 5BNPA 2PLV3 2HWD3 2WS91 1GQHA 1UXZA 2P6HA 3ETPA 1W3VA 4COZA 2XXZA 3JQXA 5EIYB 1O59A 2VVDA 3HBKA 1QNYA 2Y33A 2ET1A 3CZJA 4M0HA 1WLDA 4P00B 4RS5C 3LA3A 1ASJ1 5ISLA 1NA1A 1WCKA 3UGFA 3W21A 1AL22 2WL1A 1UW8A 4I0BA 3ZFEA 2E33A 2MPFA 3POJA 4N43B 3UYJA 2ZS6B 3TEWA 3AXDA 1W8WA 1S0DA 2IFRA 1PO13 3OYWB 5GZCA 2BU9A 2DCYA 4COYA 1GBGA 3KLSA 1JYTA 4JRLA 5E88A 1JOBA 1MQTC 2PXJA 2XMLA 1WWYA 4R9CA 2JENA 4JQRA 1BHGA 4MV2A 1VBC3 3MHZA 5FYSA 3O0XA 4KWLA 1HKDA 2PAMA 3PMSA 2D97A 2CGOA 3P3PA 5T3NA 4AAPA 3K2OA 4Y1YA 4IE0A 5FZIA 5A7SA 3VHOA 3ACIA 5FUIA 1UF2C 2HLEA 5JOZA 4NRPA 3RMYA 4MG2A 1IHMA 3AZVA 4XJ9A 5A3LA 2GH2A 5I93A 2VVFA 1UOJA 4P9IA 3ZFFB 1VBB2 1PX4A 3HN3A 4LORA 4Y24A 1VBB1 5E1RA 5FY1A 4BK4A 2P37A 1PK6C 4LKDA 3RYRA 3U37A 1ZA7A 3VZJA 1W0PA 1HV0A 4XTPA 2XL9A 4B4PA 2NQYA 2ZHMA 4MGTA 3KF3A 4FAGA 1RUI3 3WNKA 1DGWA 2ZXQA 2X8KA 1D7PM 5CFDA 2QQWA 1G9FA 1MZFA 5I91A 5FLHA 3KHCA 4P5HA 3L2YA 5DXDA 4YW3A 1WBFA 4LLFA 4QHZA 5FPZA 1RGSA 4N53C 4HMZA 3RG0A 3SMHA 4AOCA 4CRQA 3LQCA 2Q5TA 2VZQA 1RUG2 1AYN1 1C5IA 1NOVA 1C1LA 2A6YA 3FWEA 1TNRA 3C7OA 3LEGA 4OHXA 4V2VA 4XACA 5C9AC 1MEC3 4FPLA 2XL7A 2VR4A 4Q8LA 3AXEA 4AQTA 5IT6A 3HNMA 1WKYA 2Y6KA 3LOIA 3MFCA 4YSFA 3FC0A 2FZ1A 4CEWC 2WN2A 3E6CC 2TEPA 4MHUA 4BZ4A 4DB5A 4PJYA 1R1ZA 3FUOA 3A22A 5H9QA 4YW4A 3WEZA 3GGLA 3V65A 3D0SA 5LW9A 3ZYGA 4P14A 4BA6A 5D8AA 2VUCA 3RS6A 4I01A 3TB0A 3IPVA 1CJPA 3ES1A 2XH6A 3H7YA 4XFAA 4GZ9A 3LPFA 3HAGA 4UFIA 1O3QA 4GJZA 1ZZ6A 2WNVB 4CU9A 2RS51 5HCBA 2E7AA 3A23A 3DPRB 2JB4A 1DYOA 2AEZA 1N1YA 4JX0A 4YFZA 3I2OA 2JICA 3PLQA 2GC2A 2ZX3A 4JDMA 1H1MA 2BV4A 4JGZC 4R9AA 4JHTA 3SLIA 3CU7A 2DYCA 4HSJA 1GICA 4AVCA 2QE3A 3HJRA 2XJVA 2RDSA 1UIKA 1AZDA 1WUVA 3ZMOA 2E32A 4OULA 1GWLA 1GLHA 1UU5A 3UGHA 5JOXA 4FSJA 2WT0A 2ADEA 5F3IA 2WNUC 4F8AA 2XJPA 4IV3C 1Y9GA 4OHYA 4DQAA 3VKOA 2BNOA 1VIWB 4P9GA 4LBNA 5GLTA 2BNMA 3NWKA 2QQIA 3AKSA 3FBMA 3I3EA 1SHWB 5F39A 3QBQA 4DXTA 1MS3A 1HW5A 4XBNA 1K5MA 1QF3A 2R0HA 3SQOA 2CAUA 5HCHA 1Q8QA 1YUDA 2B8MA 4XOGA 2W95A 2P1BA 3K77A 1GNYA 3N7KA 3NQHA 5C70A 1SLLA 2XB6C 2XOMA 3GHMA 3M8LA 5A1FA 2H6BA 3KV4A 3CJXA 4AYUA 3U75A 5FUNA 2GNTA 1RUJ2 1OA4A 4PLNA 4XETA 1RUJ1 2P3KA 4PF1A 3RJRA 4KI5M 4AVSA 5JUVA 3IB3A 5FMBA 3KZ4C 3T30A 2ENRA 4UW6A 4CDUA 2CDPA 5FBJA 2DFBA 3ZXJA 4FFIA 1MR5A 1QJY2 4OMDA 2VZUA 5AFBA 4JAAA 1WZXA 3JD71 3B9IA 2PHXA 1QJY1 2WINB 1CZVA 2UYAA 3GHNA 1YXWA 3HQRA 2ZOEB 3ITQA 3VN4A 3OF1A 2VQUA 4QM8A 1VRH3 1IS4A 4IEPA 2XLGA 4MGKE 3ZYPA 5BNQA 5C8WA 3O1TA 2QVSB 4K3UA 4WBBA 5FTTC 1YCIA 1GUIA 1Y3TA 5F6KA 5JIAA 3ZIXA 5EV7A 1L7LA 3IM0A 1UWWA 1XRUA 4KWUA 4C1WA 4IGQA 2DVDA 3OEAA 4UAPA 4Y5SA 3VBRC 3WVJA 5A6ZA 3I2KA 5FMDA 1DLCA 1VBC2 2ORZA 1O8SA 2WDBA 3ZFGA 3V0AB 3I8TA 4IUGA 1KJRA 1NCRA 1AHSA 4LITA 3N35A 2GC3A 2RM23 4Y22B 1EPWA 1TE1B 4MVTA 3VZNA 2JJ6A 1HXS2 1AYM3 1CZSA 1V6OA 2IXKA 3MO4A 3PUQA 4AEDA 2BPA2 1DIWA 2GNDA 3KT4A 4M3CA 1HXS1 5JWPA 2WZR2 3POEA 4XF3A 1Z0HA 1EPZA 2BRTA 2R49A 2WZR1 3SITA 1US2A 4D6RA 2FQPA 1OA2A 2JIGA 2WLQA 2YC0A 3EB7A 1CQ9A 3QOPA 4HN0A 4NIAA 3VL8A 3ZXEA 2K46A 3J9SA 4CUGA 3L9JT 4XC9A 1RVF3 1RMU2 1JHNA 5T5PA 3VD4A 1C8M3 1ENQA 1MQTA 3LOBA 1FX5A 1RMU1 1GZCA 2VOKA 5F5AA 1WBLA 3OEBA 4ES8A 5BNPB 2MEV3 5EJ3A 3LF7A 2BP6A 2C1FA 2OXBA 2VMDA 3T3YA 3UL2A 5T5JA 2H6CA 4I3GA 2QQNA 3ZFFC 1W9TA 4Q0VA 1TVGA 2AYHA 4BWOA 1LRHA 2RJLA 3WZ1A 4RR3C 3M3CA 5LEJA 4OI2A 3MIGA 1OVSA 1S0GA 3OGJA 3A21A 1GU3A 2W68A 2XUEA 4XHXA 2ES3A 2JB8A 1JMUB 5LK5A 2PHDA 2A3XA 3THPA 5F1RA 2GNMA 1C5HA 1W2AX 4MGSA 1WMDA 2Z79A 4AQSA 5FZHA 3KQRA 4Q1PA 2NLRA 4K7JA 5GZDA 1XNKA 1PK6A 1SFYA 1UIJA 3POWA 1S0JA 3B01A 4AL9A 3G7DA 1APNA 1OA3A 5FPXA 1LHNA 2B45X 3AMPA 3VBHA 5JXJA 3MEPA 4J25A 2BBAA 2DTYA 1BEV2 4XAEA 5FZKA 3WQBA 4B4QA 3IMMA 2C24A 1BEV1 3A0KA 1OMIA 4AHZA 2VTXA 1OKQA 2ZGPA 1GZWA 5CKMA 5AVPA 1UL9A 1YFXA 3AP5A 1PM4A 4P5YA 3ELNA 4N7IA 1VALA 3KV5A 1FPN3 3H1YA 1A6CA 2Z2SB 4XJ8A 5FK8A 3C3VA 5IATA 1NQJA 3GZUC 4LUKA 3T0DA 1OOPB 4QB1A 3T4VA 2FD8A 4BK5A 1MPXA 4OZOA 3B5LB 4YVWB 4LHKA 1E5HA 2BERA 1OFSA 4FTEA 3H8XA 4FT8A 1ENSA 1GOFA 3IIIA 2VMGA 3K3NA 2P2KA 2WNVC 3THTA 3DV8A 1DZQA 1NY72 3UKVA 2GC1A 4DEVA 5I0SA 1R1A1 3O5SA 5GLWA 2J1SA 1XU1A 5LATA 4DOUA 1NY71 3C7GA 3HT2A 4HL0A 5LBCA 5JR7B 2D6LX 1G7YA 2AACA 4IESA 5AC93 1I3HA 1AXYA 1S1AA 5HBAA 3JUUA 4YZ2A 4NHYA 5F6LB 5FO7B 4FO9A 2C0ZA 2HWF2 5IFTA 5IK4A 3I49A 3WDWA 4QX7A 2VUDA 3PVBB 1Z7S2 2HWF1 2IVJA 2R062 1W06A 1R092 4GMP3 1Z7S1 2R061 1HB3A 1R091 3B93A 4CXYA 1G9CA 4EN0A 2YZ4A 3MI8A 4HK9A 4YZ1A 1CAXB 1W99A 1ZZCA 4GQ7A 4R52A 3AMQA 4XIKA 5J37A 5C3QA 2R1DA 2FCUA 2DUQA 4ZU7A 3RZJA 1KXGA 3ZR6A 1QXPA 1LEDA 4GULA 4Q0SA 1QU0A 3VD7A 2FDHA 1BQPA 4AFDA 1DYPA 1DZRA 5KC6A 1WMFA 3BU7A 4HKOA 3S30A 2W1QA 4L99A 2H0VA 1BXHA 2OUHA 4Y1VA 2HWE3 2X53S 1FV2A 1B35B 4YVSA 2LROA 5IYYA 5LRSA 3E1F1 4NVPA 3R4DB 4YW5A 5LA9A 1O4YA 5CKQA 1G86A 4FPJA 3I7DA 4L0PA 3AKTA 1QJU2 1UXXX 2IWGB 2UY9A 2YU1A 5A3NA 5C4WC 2C6SA 2YROA 3IDEA 1QJU1 4Z82A 5F5IA 5GALA 2XHNA 2BVVA 2AREA 1RUD1 3C7FA 3O1VA 3TNPB 3B3QE 4L97A 2HEWF 1O91A 3I2GA 4S2DA 2LS6A 4Y20B 4MGZE 1OLMA 2YB7A 1S2EA 5ABJC 5JSRA 4A6OA 2VMFA 4RGKA 2Q8EA 4QPGA 2DU1A 3ABZA 1S0CA 2V72A 3PU3A 4Z2AA 2RM22 1UZWA 3WF4A 2RG4A 4GWIA 4PDWB 1WCQA 1DZTA 1S0IA 2XHKA 2BNNA 3I3QA 1GANA 1JUHA 1UY3A 3VBFC 4EE2A 2YGMA 4LEJA 1AVBA 1GP6A 1GWKA 1V9U3 4QAWA 2JDYA 1RUC2 3UK9A 3KWVA 3USUA 4LIUA 4Q26A 2RDRA 1YRZA 2W47A 4FBFA 1RUC1 1Y9MA 3PMEA 3VDDB 4CCNA 4XUOA 1RHI2 1UX7A 2VCBA 4E8DA 4E9KA 1ZVFA 2VZVA 1RHI1 3ZMNA 5GLUA 1NCQA 3U07A 4LO5B 4CCKA 2QJVA 4DPNA 1DGLA 2R073 1W6QA 1KEXA 2QQMA 4B1LA 4QDQA 4A42A 1JU4A 1WCSA 2MEV2 5KXCA 1JYIA 1H6XA 2WSVA 5IWFA 1E5IA 2WAOA 1HIXA 3R0RA 1Q8PA 1XOYA 2VMHA 1RINA 5T52A 2ZZJA 3KVAA 1BVP1 4CP9A 3H8UA 1AR63 5FY4A 1JZ2A 3VL9A 3NJXA 5HCAA 1W90A 1XSQA 1RL3A 2ARAA 5A32A 2TBVA 5EPAA 1L7RA 2WFF3 1W2OA 4DY5A 4QMAA 1ZBE3 2WZEA 3FHIB 1RUE2 4OHVA 5FQ0B 4FOYA 5BNPC 5JXHA 1ZYBA 2QDRA 1RUE1 4YG0A 1KDKA 4CE8A 1N3QA 4Q5OA 1H1AA 1OHFA 2J1RA 1R64A 1ZZ9A 1NA1C 5FAXA 2PAKA 3FE5A 3ZFEC 1TMF3 2Y6LA 4CEYB 1W8HA 4Q0PA 4E27A 4YRDA 5GJ6A 4BE3A 3WLUA 3WHUA 4HBNA 4XCBA 5FZ1A 3OGRA 1KS4A 1Q8SA 1Q3EA 1DBNA 3NNGA 3IBMA 2D6MA 1V0AA 5DDJ2 5FZ3A 4GB32 2ZHNA 3WDYA 4UOJA 2WWJA 2VOTA 5A7OA 3EQEA 4Q29A 4XF0A 3OD4A 3TEZA 4BQ4A 5LK7B 1CVNA 2P4EA 5CZKA 4M3CB 3M7AA 4E4ZA 3ZM8A 5J7MA 3KSCA 3ZPOA 1NX9A 2WS93 3GYDA 1OLQA 4AI8A 4DXRA 1P8JA 4YLZA 3ST7A 1KD7A 1A8DA 3W59A 1IG3A 4G3YC 2R7EB 3DKQA 3QCWA 5LWBA 1ASJ3 2XGXA 2W3JA 1MQTB 4YNIA 1HDKA 1UKRA 3ECQA 3NJVA 5JPNB 1MS8A 1AL23 1JU3A 1ZRRA 1PIV2 4GXLA 5APAA 1LHVA 4IW3A 2D6NA 1H0BA 3OUHA 1PIV1 3NKTA 5FIXA 4W8JA 3GZEA 5H9PA 3LB9A 1FV3A 1ND3A 3WNOA 2RHPA 3CDZB 2Z4FA 2JDMA 3DYPA 4E2SA 4IEUA 5CG9A 1GYKA 2VMIA 3D0JA 4BYYA 3SISA 3VHRA 4AVVA 2O1QA 1QJZA 2Q1FA 3KMHA 1UMHA 5C3RA 4X6RB 2E26A 3NMBA 4IQPA 3I54A 4S2GA 4YYOA 1F4AA 3MF9A 2ETEA 3DYOA 4ATEA 3RDIA 5L9BA 3DUIA 1VRBA 5CFDC 1O7FA 3UJOA 4BLIA 1GZ9A 4F7ZA 1PK6B 3J26N 3TAYA 5H9SA 1CPMA 3RFRA 1ST8A 1ODMA 4NWVA 1H2MA 3FUQA 3O0VA 4PBOA 3OSDA 2XBO2 4NN0A 3I4IA 3WDUA 3BB6A 4AHYA 4AW7A 1BBT2 3I59A 4MXWA 2XBO1 4JTNA 2J1AA 3WF1A 5DAWA 3X29B 4A3XA 4B7EA 1BBT1 1K45A 4KU8A 1VBB3 1VMHA 1GZWB 1I1EA 2DCTA 3CLPA 3RWKX 3VKNA 2I74A 1WD4A 3JB8A 2RS11 1QKQA 4N53B 4BQWA 4P02B 5KHJA 1QJX2 1Y43B 5JSOA 3U11A 4IGOA 3Q8EA 4UFMA 3WSOA 1QJX1 3M2MA 1WLTA 2QZ3A 2WNEA 5C9AB 3MIBA 4D8MA 1XYPA 1Q8VA 1H1IA 5D8AC 1QXJA 4QD2A 5EQUA 1QJFA 2CY6A 2EXJA 2VOVA 1VAVA 3KQ4B 1ZRFA 4CEWB 3D4KA 4I30A 4QT6A 4V1PA 4XJAA 5L9RA 3A4UA 1VE0A 4AGRA 2Q30A 1AYN3 2DVAA 2W9XA 4ITCA 5HCFA 1V70A 4SBVA 3MLJA 3BYWA 2VZ1A 4ZS2A 1FOD2 4EZHA 1AX2A 4GKXA 3MICA 2AENA 1FOD1 2ERFA 3GCWA 3OY8B 5LB6A 2AUYA 4NR1A 3AKRA 3ZYRA 3EMRA 4LOTA 1NQDA 4JDNA 3PJYA 4RL7A 5EJZB 4Z07A 3RZGA 4D0QA 2W0XA 4QDRA 5A70A 4TXWA 5FP9A 4OUMA 3ILNA 4KQ7A 2WSUA 4YW6A 2TUNA 3LD8A 1Y4WA 3H3UA 5C6CA 1N3OA 2WWUA 2YXSA 2WQZC 3BPSA 4JGZB 4HFSA 2ZX1A 2JDHA 2RS53 3UESA 3MZHA 5FZ0A 2BBVA 1U5XA 4QX3A 2BYVE 2EICA 3TN92 3WXPA 2XVGA 1K5MC 4HVOA 4QB2A 4NWWA 1YJLA 2WNUB 4X6QB 3TN91 4IV3B 1W3XA 4IGPA 1WCDJ 1Q56A 4YVSB 2F4LA 3MW4A 5L19A 1KDMA 3K4AA 5FP4A 1IGOA 1OPMA 1AR62 3K46A 1O5UA 2VM9A 1BZWA 4P9JA 5CKNA 1KFXL 1YQ8A 4O65A 1J58A 4YZ4A 4YM1A 1FMD2 4LR4A 2XKOA 2A6XA 1SG3A 3IN9A 3RYPA 5FZMA 2E63A 4CDUC 3ZXGA 1FMD1 1BJQA 5IVYA 4LO7A 4CCJA 3AP6A 1D2SA 4K21A 2ZMLA 4MADA 2QUOA 4U36A 5ANQA 3S7EA 3FBYA 1NLRA 1XYNA 3I2FA 3PVNA 4J1XA 3AMHA 4AWDA 5HXMA 2XLAA 1QQP2 4ZZ5A 4ORFA 1YNAA 3PUAA 4INDA 2ARXA 1QQP1 4IV1A 3EJKA 4QPGB 2VU9A 3AP7A 1ND2A 5FKBA 5A3TA 3HVDA 2EALA 2QBXA 2KM2A 4XJUA 1WCUA 5T50A 4MGQA 2HH9A 2RE9A 4RD7A 4D3WA 4Q4W1 1DLLA 1RUJ3 1SBDA 1UYYA 5JZGA 4JVAA 4WM7A 1YQ2A 3H8OA 4CPBA 4KG8A 2K0GA 3WY6A 3ZFGC 3G6JB 4NAOA 3SNMA 1NCRC 4NHMA 1XE7A 1FNYA 2V09A 4TWTA 3ZSLA 4DNYA 5J3UA 5KHGA 5KHKA 3BU0A 3ME2A 3NSTA 1ENRA 1B09A 2X5IA 2RS31 2ZGUA 3JD73 2Z42A 1MACA 4LULA 4W6XA 1QJY3 2R042 1ASJ2 2NM1A 2ZBJA 1S0EA 4X8PA 4Y4RA 1W6QB 5FZ6A 2I2SA 3VBRB 2R041 4AEDC 5C3OA 2C9KA 5J48A 4Q2FA 2QQPA 4P9LA 4E2QA 1BLZA 4Y4YA 5FZ8A 3PJQA 3AL5A 1CAWB 5DMYA 5LBEA 3SEEA 4WVMB 1UY0A 4UF0A 2Y0IA 1A3KA 4CP9B 1NE4A 3OUIA 5FMOS 1DG6A 3ACFA 1OUSA 1OT5A 4IERA 4XURA 1IQDC 2D43A 3HOBA 4META 4F83A 1IS3A 1OUXA 4QB6A 1MS1A 4QKNA 1UCXA 2V73A 2QZ2A 4I02A 4QQLA 3C8XA 4LO8A 2OT7A 3RJ2X 3WINE 1NG0A 1LOFA 2VZTA 5FWJA 2YDEA 1D4M2 2Z69A 3D8CA 4H14A 4ATFA 1JZ4A 4BB3A 1UYXA 5FYHA 5SV8A 4DY3A 4YGCA 3U14A 3VUOA 1D4M1 2VOXA 4CP1A 1HXS3 3K4DA 3T2PA 1W8OA 2XUMA 4LHLA 4YM3A 2G1MA 2WZR3 1TQ5A 3T1LA 1W0OA 2FMYA 2KD7A 5GZFA 2YGLA 1W39A 4IEZA 3T08A 1QOOA 1UPIA 2CGPA 1SPPA 3VB9A 1O5LA 1VP6A 4WM8A 3CF6E 5EJ1B 4CDQA 2A7AA 5A7QA 3I2JA 1NLSA 1UYPA 4JTOA 4JGYA 2Z5WA 4RR3B 1RMU3 4XCAA 1CAVA 2IUWA 2VGDA 3MPBA 2P3YA 4O9EA 4EZ4A 1H6YA 5FK7A 3VBOA 3VBHC 4AFCA 5BNOA 1L7QA 2V4VA 5HPOA 2RDQA 3NNFA 2HEYF 2IXLA 5L36A 5J1XA 4ZKTB 1TME2 3N7LA 3VZLA 5IK7A 2PN5A 1CAUA 5DAPA 2BTVC 4UI9L 1TME1 3EYPA 4AFBA 4DIQA 2W2IA 4XE9A 4BQ2A 2CSGA 2RMU1 3BODA 1CGPA 1AYN2 3AX4A 2YU2A 5FFOC 3TYJA 3VDCA 2VNGA 3PU8A 5CISA 2B4KA 2ZGTA 5FREA 2GMMA 4GA9A 1IS6A 1OLME 2ZKLA 3MW2A 1ZZBA 5BNNB 1IG0A 1MVEA 4Q4Y1 3TEXA 2ADDA 3ZN6A 3DECA 2EXKA 2LUWA 3DN7A 1DQ5A 1VBE1 1POV0 5FYIA 3ZIWA 4OLLA 2D6KA 4NHXA 4CCDA 4BQ1A 1A78A 4XW3A 4LA3A 4UWDA 1BEV3 1COV2 4P08A 5H9RA 4CXWA 2CWMA 1COV1 4K6BA 4BIOA 3M4FA 4YG6A 4TN7A 2GAUA 2GALA 4DZGA 2X05A 3WF3A 1LCLA 2WIIB 2RS52 5SV5A 1BK1A 3VBSA 1OSGA 1GP5A 4QX1A 1WW4A 2YC4A 3WNPA 4KNCA 2GP3A 5IJRA 3UT0A 3ZN4A 4NPMA 4OHZA 3H3LA 1MS4A 1XJAA 3R4SA 2OQ7A 4XXPA 3N4MA 2W1WA 2VNOA 5DAQA 3CBNA 4ARXA 4IE7A 3WV6A 3WNMA 5F5CA 2FZ2A 5A3MA 2JE7A 1OKOA 2YYOA 2FDJA 4NE9A 4HETA 4FPKA 4KBZA 1R1A3 1O8PA 3ZXKA 2WUHA 3MDPA 1FI2A 4EN7B 3SEPA 3D5OA 4Y1XA 3THDA 5A3WA 2RDNA 3F2ZA 3BVCA 4Q8KA 2UU8A 1T6GC 2E31A 1SZBA 2JEMA 2Y26A 5DZGA 1G8WA 4HKLA 4QQPA 4YVSC 3VKMA 1W8ZA 1NT0A 2BJSA 2HWF3 2MHFA 2PELA 3I2DA 2VQTA 3K51A 4OCTA 5BPXA 3BTYA 1Z7S3 2P17A 2R063 3BOWA 1R093 1SBEA 4Q4X2 2ZEYA 4RQPA 2HYKA 1NZCA 4ZXKA 3DF0A 4XAAA 4Q4X1 2OYZA 4CU7A 2HWB1 4PQQA 4AE2A 1XNCA 3IAPA 5K7PA 4W65A 4OQ8A 4ASMB 4M01A 1IQAA 3ON7A 1YEWA 1JODA 1LU1A 2VECA 3ROUA 1HB1A 1YWKA 4AHXA 3DXUA 4QPIA 2AH2A 1W6OB 4QKBA 2WR9A 5C4WB 1HLCA 2EIBA 1UQXA 2JDUA 4QPGC 4C91A 5F3CA 4K9SA 1ALYA 3WG2A 4XF9A 1CESA 3JD72 4O7XA 1V00A 3TRSB 1JW6A 1UO9A 2EXHA 5I0DA 1NKGA 2QFEA 1QOTA 1LHOA 1PM7A 4V2WA 2OKXA 1VAMA 2HBTA 4WZCA 4IEWA 5F3EA 1PZ8A 5C8CA 4EWDA 3VBUA 1QJU3 5ABJB 2NZ9A 2OZJA 4TTGA 1CWPA 3SH5A 4N9HA 3IIAA 1DQ0A 3POFA 1SCRA 3B02A 4FXKB 2Q8DA 1RUD3 2DF7A 3NNLA 5FZ7A 4O61A 4TLGA 1JOJA 2A6WA 3WR0A 3NRUA 3E97A 4LK6A 2VY0A 1NCQC 2BDRA 2J1TA 2JG9A 1RIRA 1LHWA 2JD9A 5T55A 3CHXA 3VBFB 3ZLIA 3KB5A 2ILMA 4L11A 1IPJA 1REEA 3K75B 1OD5A 1PZ9A 4BOWA 1UNBA 4FPEA 5A6XA 4GWJA 4AFAA 5LEKA 2ZPXA 2FBEA 1RUC3 1HB2A 1W6NB 2P3JA 3C7EA 4XQDA 1C57A 2O0OA 5K0UA 3W58A 4XQ4A 5DUUA 3GF6A 3BI3A 2O8OA 2QQOA 1X9TA 5F2WA 5GM0A 3JCIA 1RHI3 1ULPA 2F6BA 3URFA 1AR82 1X8EA 2HJIA 4QHOA 3J7LA 2WT2A 4Q4V2 1AR81 4UT5A 2CAVA 5LZ6A 2BVBA 4WM7B 5LY1A 4Q4V1 3LDRA 4DRRA 3AKPA 2H0BA 4P9WA 2VZPA 4K8FA 1YHFA 2HKXA 3P6BA 3VKFC 2DDUA 2XKPA 5FUPA 4COVA 1WLCA 2FMDA 1ZZ7A 3KF5A 5KHHA 1YI9A 2B7YA 4NHKA 5A33A 5ERLA 4IEXA 1QY4A 2E51A 5F37A 3N9PA 1NA1B 3ZXFA 5BY5A 1QNWA 1ACCA 3ZFEB 3MYXA 4FPHA 4XUQA 5AFEA 1X82A 2CU5A 1KFUL 1RUE3 1V6NA 2HWC2 2ZA9A 4JQTA 5EFUA 1QDOA 2CDOA 4UF0B 4BQYA 5CAZA 2HWC1 4D7YA 4R8HA 4HVRA 4YGBA 1YLLA 3LA2A 4QKFA 5KXBA 2LTNA 1QH6A 3OBRA 1HJGA 3M1HA 4LBKA 4QXBA 2IZWA 1Q43A 4HLTA 4I0AA 3VHPA 5IHRA 1JYXA 1OC1A 5A7WA 1AF9A 3H7JA 5K9YA 3KV6A 3OBTA 2XQRA 1W05A 4BM8A 3LCPA 1ND3C 5DDJ3 1J3RA 1FAYA 4GB33 3NKGA 1ZRCA 2YV8A 4ZXEA 2W08A 5FYVA 2DV9A 1RXGA 4XFBA 4BISA 3U1XA 2NMOA 4QX0A 2OIIA 3RZMA 4JKKA 3LEIA 1RUF2 3NV3A 4GMP0 4JRAA 1SPPB 4WM8B 2ZZQA 1RUF1 4CDQB 2RJ2A 1S2BA 4LBJA 4Y3OA 3WNNA 4NO4A 3IWZA 4JGYB 2EF6A 2Q8OA 1EYBA 1MVQA 3BGAA 3O12A 1CAVB 1H8TA 5DABA 5LCWL 1R081 1R1A2 2RVAA 3KHBA 1AX0A 3OGVA 4Q27A 4Q1RA 4C0HA 2ZAAA 3KGZA 1PNFA 1PIV3 4CDXA 3S0MA 1LGNA 4GALA 3ZSKA 3GJAA 5IVCA 1H9WA 2BWCA 1UKGA 4EWAA 4K1ZA 1CAUB 5CFDB 1XXNA 2GSYA 2C4XA 5HV0A 1JZ3A 3FLRA 1AX1A 2YFUA 4BPZA 2WQ4A 3QH7A 4GIQA 4PT6A 5IVJA 3HNBM 4KU7A 2W1SA 3MLLA 3FX3A 4DXSA 3SH3A 1BK0A 3MBWA 1BVVA 1POV1 4XVHA 2UYBA 2JKXA 1JUIA 4K20A 4AQ6A 1X8MA 4HVQA 1DF0A 5JLVA 5L73A 3ASIA 3Q8CA 5B4XA 1HN1A 5ACA2 3MF6A 1AL0G 3ZOIA 2JIJA 5ACA1 3MUZ1 1ZREA 2XBO3 5CFCA 3ACGA 4B3NA 2Y8KA 5D21A 1BBT3 4EQVA 2OVUA 3KM5A 1O3SA 3ILFA 1CJDA 5D8AB 3ZVXA 3IPVB 3KCXA 2RS13 1JN2P 4EN8B 2YBSA 5FZCA 2QNKA 2DURA 2X10A 5FXZA 4XMIA 1HN0A 1PZ7A 4BXSV 3DGTA 5HI0A 2GP5A 2VVEA 2GC0A 1X36A 2CL2A 5JOWA 4GKYA 3BPZA 4PLMA 1QJX3 2A6VA 1VB4A 5EHDA 1UD1A 2AR6A 3DEMA 2BFUL 1PGW1 1RUD2 2PHLA 1HRV2 4GWNA 2VOWA 3WF2A 3ENRA 4CTEA 1HRV1 2JXAA 5GLVA 4AHWA 2D6PA 3WDVA 1DYKA 3GBWA 3ZKUA 2VQ0A 4FFHA 1CN1A 1ZA4A 3THCA 3WG1A 2JDAA 3P5BA 1N1VA 1XQNA 1EV11 3N3HA 3V0BA 2XWJB 4S2FA 3FHQA 4MOAA 2BFUS 3ETQA 2WYFA 2RJKA 3H3ZA 4TYSA 1FOD3 3J8F2 4HPKA 4L8QA 4XZUG 3S6PA 4AG4A 5I8TA 3ES4A 3J8F1 4YPJA 1WW6A 4BU2A 5JDBA 3BUCA 1JZ6A 4N9IA 4GD4A 3HIFA 2LRPA 4CZSA 3RI8A 2PFWA 3OGSA 3UETA 3M3QA 1KQRA 3WG4A 3NNMA 3LKJA 1W8FA 1H9PA 4NHLA 1SFPA 3Q8BA 4RQPB 3ZDSA 1K5MB 5L7OA 5FP3A 5B4NA 5AVAA 4COWA 1K3IA 4RFT0 2YMZA 5E8AA 3WOGA 4MGYE 4MZUA 3AZXA 4BH9A 3H42B 4AVTA 5TSWA 1SLAA 4FPGA 1OFNA 4RA0A 4DS0A 2EXIA 4M3CF 2AGSA 1MZEA 3IMNA 4QPIB 4LPLA 3W5NA 2BOJA 3ZDVA 2MNGA 3VKLA 3TN93 2JWPA 4IV1C 4EROA 1ULEA 2ZJCA 1S55A 5FMOL 1ND2C 1OXCA 2JDPA 2ATFA 4LBQA 4CDUB 2BQPA 2OW4A 1EAH2 2WAAA 3AB0A 4MX3A 2OPKA 4ZONA 4Z92B 2BGCA 4Q0UA 4IL7A 1EAH1 3T2OA 1LENA 1VBD2 5JZGC 4WM7C 4PCRA 3ZXLA 1H30A 3VBUB 2IC1A 1VBD1 2EAKA 2WO7A 1W8NA 2YG0A 1POQA 3KVBA 1FMD3 4LBMA 5FY0A 5LBBA 3WX5A 3FLTA 2L9LA 4I3PA 4IE4A 1ULGA 2X5IC 4EN9B 3A0NA 2XLFA 3E6BA 4A4AA 3LFIA 1XNDA 1FXZA 4XEZA 1ZM1A 2FCTA 4N43A 1UZVA 5FP8A 5A3PA 4LTAA 3B00A 3GCXA 1QQP3 2XJUA 4QX5A 4P9XA 3ZFGB 4R4XA 3ZYJB 1LU2A 1NCRB 1UU4A 4DUXA 4NAMA 3K4ZA 1XU2A 4XXAA 1DP0A 2G9ZA 1BKZA 2PQQA 4IE6A 2R6QA 3NV4A 4AR2A 4AEDB 3I3MA 4E4HA 3VDAA 3GM8A 2O8QA 1H2NA 1UMIA 5FOBB 1GNHA 3NV2A 5IUQA 3RRDA 4ARYA 4B8EA 3MGUA 2RS33 5EWSA 1LOFC 1M4WA 2KXLA 4K8RB 3I2IA 2CYFA 2ZGOA 4FAHA 2R043 4C90A 1GMMA 5FZ4A 4H3WA 2BW8A 1VBA2 1J3PA 1NUKA 3LDBA 5JMCA 3AC0A 1VBA1 3WP4A 2WWSA 2ZAHA 3CL1A 2DVBA 4XBQA 3AYDA 1NXD1 2CWSA 5FV3A 3WP5A 1V6JA 2XR4A 4QPWA 3MLKA 4WM8C 4RHV1 4CDQC 2VXRA 1W2UA 2D98A 3POIA 5A33B 4JGYC 1QGLA 1JHJA 3PTYA 3JBG2 4H55A 4N8MA 5B2GB 1X50A 2RR12 2CGNA 5C3PA 3VBOC 3JBG1 5I8SA 5BNOC 2P3IA 2RR11 3AP9A 5FYZA 2A75A 4Y1ZA 4M4PA 1L3JA 2VPVA 3LFMA 3R05A 4KH9A 4W6WA 3AL6A 1EY2A 3O1PA 1D4M3 3LZZA 5FXXA 5G05L 4UW3A 1PVC2 4XUPA 1G9BA 1PMHX 1W2NA 2VBBA 3UKNA 4FTSA 1PVC1 1LHUA 3VBHB 4A3ZA 4DO0A 4OMCA 3CJIA 4UFJA 1RB8G 1SEFA 2VC9A 1UX6A 3E6DA 4UFLA 4HK8A 1JYCA 2LW8A 5CU1A 4EN6B 4EWEA 2GNBA 1CZTA 3A7QA 5LBFA 4GH4A 2RS12 4XUTA 5LASA 5JMOA 3O1UA 4P9YA 4GAZA 4GMP1 4MUVA 3SKJE 2ZGQA 4LHNA 5IFPA 4KWJA 2IVIB 3W20A 1F5JA 3DXTA 2Y6GA 1TME3 1CONA 2ZABA 4PI0A 3D3AA 1AUYA 3DPRA 1RUH1 1NZIA 3NVCA 1ZRDA 2RMU3 3VBSC 2J42A 2YBKA 4QX8A 4JV4A 4YW1A 2KA3A 3GJBA 2JE9A 3ILRA 4Q4Y3 4XJZA 5KHIA 5CEHA 1OVPA 4TZDA 2G4IA 2GMPA 1RXFA 2D93A 1VBE3 1V6MA 3HD8B 4IEVA 3SKVA 4RGAA 3NL1A 3POBA 4BHPA 5CA6A 2PQSA 1FNZA 4GJYA 5FJHA 4R9BA 1S0FA 1DQ2A 1PHMA 5I0TA 4AF9A 1YQCA 2VUAA 1Q8OA 5FRAA 3RSJA 2C5DA 2A73B 1IKPA 2AZ5A 1LGBA 2Y34A 2YC2A 4JKLA 4DXZA 4D94A 1COV3 3ZSEA 1DGRN 3EHKA 5FPBA 4NIDA 2BZDA 2UWBA 2FDKA 3UJQA 1J1TA 3LGRA 2ZEWA 4IETA 5FXVA 5E16A 3J7HA 5FPLA 4CCMA 4ES9A 1GNZA 3FN9A 1UOGA 3VZMA 2WA4A 2GH8A 4QDSA 4ZU5A 5CFCB 4CCCA 4FXGB 4NIGA 3LPGA 1CIWA 4JCKA 3WNLA 4RGGA 4LOSA 4ZZ8A 2DFCA 1REDA 4RQPC 2QQLA 3KCYA 1ONAA 3MW3A 4CUAA 4I09A 1SLBA 1OF3A 2D3PA 5EYYA 1Y7BA 1YI7A 1C8NA 3AKQA 3WG3A 2VE1A 4NIIA 1DHKB 3N9NA 1GV9A 5C33A 1LOEA 3CEWA 4QPIC 3OD0A 1UY1A 3SC7X 3IKWA 2JKBA 1RJ8A 1DU3D 1OQDA 1CD3G 2ZGRA 4AGGA 4NIHA 4XFIA 5JI7A 4B29A 4CDWA 1CPNA 5F2SA 4ZHNA 1O6UA 2PHTA 1UN1A 1AR72 5EP9A 2XDVA 4C8DA 2SBAA 1W03A 2GN3A 1OH3A 1AR71 2OQ6A 4PIYA 3O1SA 5FKCA 2JG8A 3V0BB 2WYSA 1KRIA 1HRI2 4HSLA 3CIHA 1SLCA 3PNAA 4TSVA 5C8CC 3VBUC 5F9TA 1H2LA 1SQ4A 2JD4A 2W87A 3ACHA 1GQGA 1HRI1 4IEOA 2HWB3 4Q4X3 2B9UA 4HPKB 1UY4A 4E2GA 4FCAA 3ZKYA 4AFMA 4C1XA 3H0OA 2YFZA 3JU9A 4I0WB 3RZHA 4Y33A 4UXAA 4BXFA 2JG9C 3NAPA 3I3BA 1EUUA 2XJQA 4Q4W2 1K12A 4CPBD 3T09A 3V0AA 3USUB 1TEIA 3OPZA 2JX9A 4Y22A 3VZKA 3PVOA 1AR92 2ARCA 2R16A 4BCUA 4EYUA 5C71A 5L7OB 3MIDA 4MLOA 1AR91 1C28A 2RS32 4XIOA 3WP6A 3B69A 3PIGA 3Q9OA 2DVFA 2EIGA 5FZOA 1X33A 1ZBA2 1NCQB 2R0FA 1OH4A 2VG9A 1J59A 4AK3A 3EXUA 3OUJA 1UMZA 1ZBA1 1YC61 1PO22 4YWAA 4OI0A 1ZNPA 1AJKA 2IFWA 2VNVA 2VZ3A 2WA3A 1OURA 2ZGKA 3LA7A 3PIJA 1KS5A 1PO21 4Z1VA 5K0UC 1UU6A 2WO3A 3RZKA 1K42A 3NJYA 5D2AA 3VD5A 1XNTA 1AXZA 3P3NA 1SACA 4LBQB 1VMJA 3HQXA 2JE8A 3NW4A 1MS5A 2DCZA 4QM9A 1TZOA 2ET7A 4YZ5A 4DINB 4MYEA 2ZX2A 3PHMA 5A32B 2QQVA 2WBKA 1REFA 2LM3A 4HT1T 1LGCA 2N7GA 3V56A 1OPOA 2VO5A 1LODA 4NMIA 3LIHA 2FDFA 5JAXA 1OF4A 3SXWA 3RYKA 5FO9B 4HANA 2WZ8A 4LIVA 2D5FA 5JSPA 3QACA 3GZAA 1AL21 5FZLA 2VXJA 4IXLA 1I9RA 4LA2A 4OZXA 3GZTB 1SBFA 4QXCA 3PUIA 4RYDA 2D7FA 1UZYA 4KG0A 1X9PA 3CO2A 2ZGLA 2VMEA 3PVEA 5FY7A 3POGA 4UFHA 2VZRA 5FOJB 4LKFA 4BLJA 3OBZA 4AI1A 4QXHA 2A3YA 2A3WA 5LA1A 1V6IA 1D2QA 1KJLA 3ZYBA 1AR83 5DG2A 4AEKA 1U5YA 2VBDA 3ZYFA 4A2UA 1IZ3A 1GQPA 4Q4V3 5FJKA 4AGVA 5FLIA 2IXIA 2PHRA 2YBPA 4UBHA 4KMQA 3K3OA 4LE4A 1UZ0A 5A7NA 3ZYIB 2WO2A 1CX1A 1T2XA 2WKKA 5FYCA 2E6VA 4FFFA 1LESA 2BGOA 1Z78A 2DVGA 5FZDA 1GZTA 4UW5A 1J83A 4RN5A 1OOPA 1O4ZA 3WUDA 4OVEA 2RMU2 3EO6A 4AI0A 4MGIE 4BQXA 5F8PA 5EXOA 4WZFA 4YVWA 1PVXA 2Q1ZB 5CVRA 2FDIA 1YFYA 2Y6HA 2HWC3 3TNQA 2QTWB 2Y6JA 4Q4Y2 1QH7A 5FPVA 3KS7A 4KGGA 2HBUA 1ND3B 2P34A 5CG8A 3WDTA 1WD3A 1F35A 3ZXDA 1Q5OA 1VBE2 2AEYA 4Y1UA 3TWIA 3W5MA 3N7JA 5LY2A 3VGIA 1XPWA 1H8TC 4ZPIA 2VULA 5FY5A 5K8SA 1E57A 1JBCA 3IDBB 3SH4A 1LKNA 1NXMA 1WA4A 5KC5A 5DQ0A 1J84A 4Q0QA 4QWNA 4CDXC 2VCCA 4LUMA 4N7UA 3RNSA 3APBA 3BCWA 2D6OX 3AZWA 3VHNA 3ACLA 3JQWA 5I8YA 3RWNA 1LOBA 2PMWB 3OJBA 5LRRA 4XBLA 3OB8A 4J1WA 4CSWA 5C3SA 5KXDA 1RUG1 2VJXA 5FYUA 4W6YA 5J09A 2B9VA 3R4UA 5BV6A 3RZLA 2D3RA 3I59B 4MXWB 3CJIB 4ASLA 1CAXA 3OCPA 4K1YA 4D7SA 3IDCB 1RUF3 2WFPA 4PHZA 4CCOA 3O0WA 3J4UH 3H8RA 4A7YA 4GH4B 3I3DA 1W0NA 2VZOA 2CV6A 4MO3M 1R083 5KBFA 1A8MA 5FZEA 4CUBA 1S0BA 1MS9A 5CFCC 1S4CA 4XF4A 4JC1A 1B35A 2ZX0A 2W5FA 1QWRA 3AK0A 4NJ4A 2PAEA 1OLRA 1N3PA 3ZSMA 2ZGMA 2A1XA 1MS0A 4PBPA 4XILA 4G4FA 1EUTA 2WC2A 3GALA 1QJEA 5FLJA 1LAJA 4FQ4A 4YZ3A 2ZMKA 5CNAA 4Y5TA 2ZGSA 5KXEA 4YM0A 3PURA 2ID4A 2XPJA 1XSRA 2I07B 1POV3 3U0ZA 2CNAA 2HWB2 4DUVA 4AI3A 1S2KA 4QX2A 2Q8CA 1JZ7A 4YGDA 5DAXA 1LOCA 4Y20A 5DUVA 5JXGA 3AYEA 4CUCA 2OPWA 3WW4A 5ACA3 1DCSA 1U0AA 2EVXA 2W91A 1N1SA 4ET7A 1FT9A 1JXNA 2E7TA 2B39A 2NMNA 1ULFA 4PQ9A 4FP3A 4YFWA 4PDWA 4URTA 5FYMA 1RYYA 2EIDA 4M0NA 1W6PA 3PUSA 1LNSA 1FYUA 2VNRA 1H2KA 1G9AA 3T0AA 2Q1MA 3VDDA 1JOPA 5JI9A 2GZWA 3MIEA 2B42B 4XFFA 2WT1A 2VW1A 2CHHA 2VH9A 2Y6FA 5IVBA 5L7OC 3JB4C 1XBFA 1UOFA 2O14A 3O7OA 3AFGA 5CYYA 1HRV3 1LEMA 1LECA 4FPFA 4HZFA 5K4LA 1UYZA 4BQ5A 2G9GA 3IZOA 2PLV2 1N47A 2HWD2 3C2UA 4R4ZA 3L2HA 1EV13 2PLV1 3RMXA 2HWD1 1W2TA 1RJ7A 3DCQA 5JOYA 3NNJA 4OUSA 2DU0A 1HX6A 4RSUA 5FP7A 4CDWB 5I0RA 3QH6A 2ZEZA 1VLNA 2RV9A 3T2QA 3J8F3 5FYBA 3LEKA 5IW0A 4LHSA 4MHRA 5T54A 5A1LA 3EBRA 1JYNA 3AJYA 5FQ0A 2NN8A 5FBZA 3USSA 2WQ8A 5BUVA 2WO1A 1BMV2 2JDKA 3MIFA 4UFKA 2JG8B 1QOSA 1BMV1 4AXOA 5F3GA 1PO12 2YUEA 3AFKA 4BMEA 5C7GA 2I45A 3HWJA 2A71A 1PO11 4IV1B 5DZEA 2VBPA 1SMVA 1ND2B 4D69A 1X7NA 3AMNA 3NAPB 4YW7A 1KGYA 4CEYA 2AC1A 1O3RA 1LOAA 3AVSA 2ZACA 1VBC1 4N43C 2F17A 5JZGB 1UOBA 2W94A 4FPCA 5F32A 2V4AA 1CX4A 2ZGNA 2E7QA 5FMCA 4QU1A 4AEJA 4XMAA 1GOGA 4RS5A 2HEVF 3JZVA 1A34A 5FZOB 2BOIA 2X5IB 1EAH3 5IAXA 2GMEA 1F9KA 5FY8A 4W4ZA 4WVZA 5E6HA 3VLBB 4O9GA 1NLQA 3Q8FA 5CADA 4Z8BA 1SCSA 1U5ZA 1VBD3 1JS9A 1NE6A 3LAGA 2ZCWA 4LQRA 2XVLA 4LKSA 4LKEA 3M70A 4XFCA 2HYXA 3RGBA 4NROA 4IDZA 5A3OA 4QGNA 3MV11 1G6NA 3WQ7A
chains in the Genus database with same CATH topology
4QDRA 3LQCA 4TXWA 2VZQA 3LEGA 3C7OA 2WAAA 2VR4A 3T2OA 3HNMA 1WKYA 2Y6KA 3UESA 2WN2A 1PMJX 1W8NA 4OUEA 2YG0A 1W9SA 4QX3A 2EICA 3A22A 5G04L 2L9LA 3OBAA 3WEZA 4QB2A 3GGLA 1UY2A 2J1UA 4A4AA 1NAEA 2W92A 3K4AA 3K46A 2VM9A 4GZ9A 3LPFA 2ZEXA 4DUXA 4CU9A 2VL4A 3K4ZA 3A23A 1DYOA 1SG3A 4JX0A 1DP0A 2WN3A 2VZSA 4MADA 3I2FA 3VDAA 3GM8A 1UMIA 3HJRA 5HXMA 4ARYA 4ZZ5A 2E32A 5DN2A 3I2IA 3IDAA 1GMMA 2QBXA 1TG7A 4MGQA 1NUKA 3AC0A 5JR2A 1UYYA 1JZ5A 1YQ2A 1CIYA 2QQIA 3I3EA 1SHWB 4QPWA 4DXTA 3PUHA 5LA0A 3HPNA 1JHJA 2W95A 3K77A 1GNYA 3NQHA 5C70A 2XOMA 3MV01 2C9KA 4M4PA 4JHZA 5DMYA 2EIEA 3C7HA 3SEEA 1UY0A 4PF1A 2DCJA 4KI5M 5JUVA 3IB3A 3ACFA 5G05L 4XUPA 2CDPA 1OT5A 4XURA 1IQDC 1PMHX 3HOBA 4OMDA 2VZUA 4A3ZA 4QB6A 1CZVA 4OMCA 2VC9A 2VQUA 2LW8A 2XONA 3C8XA 3UNPA 1CZTA 3A7QA 4AAXA 3VDBA 4DUWA 1GUIA 2VZTA 4XUTA 5JMOA 1I5PA 1JZ4A 1UWWA 1UYXA 4KWUA 5F7UA 3K4DA 3OEAA 4UAPA 3SKJE 3T2PA 1W8OA 5IFPA 2KD7A 3I2KA 2Y6GA 1DLCA 2ORZA 3T08A 1O8SA 2WDBA 4IUGA 3D3AA 4BDVB 5EJ1B 3DYMA 3I2JA 3VD9A 4OYUA 4E8CA 1H6YA 1CZSA 1PX3A 3MO4A 4W50A 1L7QA 2V4VA 2QQKA 5HPOA 5J1XA 1JYWA 3I2HA 1US2A 3SKVA 2BGPA 4UI9L 3EB7A 3EYPA 5JXIA 2PQSA 2WABA 3VD4A 3MUY1 2YC2A 3VDCA 4JKLA 2B4KA 3OEBA 3CKHA 2BZDA 2VMDA 2ZEWA 2QQNA 3DECA 1W9TA 3J7HA 3FN9A 1TVGA 4QDSA 3LPGA 3GXUA 3WNLA 3HEIA 2ORXA 4ZZ8A 3A21A 1GU3A 2QQJA 2QQLA 4CUAA 4P08A 4MGSA 1OF3A 3CMGA 3CZUA 2X05A 3WF3A 3IAQA 1UY1A 4QX1A 2YC4A 3WNPA 5IJRA 5JXJA 2BBAA 3WQBA 4A41A 2W1WA 4ARXA 3GDBA 3WNMA 3I97A 2WYSA 2V5DA 4P5YA 1O8PA 2XQXA 3CIHA 2WUHA 2W87A 5LA2A 3ACHA 3T0DA 3SEPA 3THDA 1UY4A 4QB1A 3F2ZA 4BK5A 1MPXA 4OZOA 4A45A 2YFZA 5A1AA 2E31A 3T0BA 3I3BA 1EUUA 2BERA 1K12A 3T09A 4JKMA 1GOFA 2VQTA 2X09A 3IIIA 4DEVA 5C71A 4CU8A 4A44A 2ZEYA 2J1SA 3C7GA 2C26A 4CU7A 4PQQA 3IAPA 1OH4A 2VZ3A 5DPNA 1US3A 2WO3A 5IFTA 1K42A 3VD5A 1XNTA 1XNAA 2EIBA 2JE8A 2VTFA 1XC6A 5I0DA 1W99A 1NKGA 2WBKA 2OKXA 3LE0A 1F4HA 3VD3A 2VO5A 4TTGA 1OD3A 1SDDB 1OF4A 3VD7A 2WZ8A 2W1QA 1JI6A 3NRUA 2J1TA 2J22A 2JD9A 3PUIA 4RYDA 4M4RA 5IYYA 2VMEA 3E1F1 4ZY9A 1GOHA 2VZRA 3K75B 4L0PA 1UXXX 1W9WA 5LA1A 2VMCA 4GWJA 2XHNA 4DEQA 1GQPA 3C7FA 1JZ8A 4KMQA 3P1IA 1UZ0A 3C7EA 3I2GA 2LS6A 2WO2A 1CX1A 1T2XA 3BN6A 2QQOA 2YB7A 2BGOA 4A6OA 2VMFA 1J83A 4RN5A 4CU6A 1ULPA 3ABZA 4Z2AA 2V72A 3WF4A 4GWIA 1WCQA 1UY3A 2Y6HA 2VZPA 2J1EA 4QAWA 2Y6JA 3HNYM 4XUNA 2W47A 3P6BA 2DDUA 3JXSA 4XUOA 3W5MA 1UX7A 1XPWA 2VCBA 4E8DA 2VZVA 4FI9A 1ULOA 5DQ0A 1J84A 2W1UA 4XUQA 2VCCA 3OG2A 1KEXA 2DCKA 2QQMA 4QDQA 4A42A 2CDOA 1JU4A 1H6XA 4HG6B 2WAOA 2W46A 3OB8A 2VJXA 5IHRA 1JZ2A 2B9VA 1JYXA 3NJXA 2Y64A 2VCAA 3CQOA 1L7RA 2WZEA 5JXHA 3FHAA 3I3DA 1W0NA 2VZOA 4MO3M 4CUBA 4ZXEA 3FL7A 2J1RA 1R64A 2Y6LA 4QX0A 2W5FA 4JKKA 4BJ0A 2J7MA 3LEIA 2J1VA 3OGRA 3NNGA 1EUTA 2RJ2A 3WNNA 3BGAA 4UOJA 2VOTA 5LCWL 2ID4A 2RVAA 3OGVA 5CZKA 1JYVA 3ZM8A 4DUVA 1NX9A 1JZ7A 4QX2A 4DXRA 1P8JA 5JXGA 1JZ3A 2C4XA 4CUCA 2R7EB 2YFUA 2W91A 4ET7A 2W3JA 3ECQA 3NJVA 4PT6A 3HNBM 2W1SA 1JU3A 1RYYA 4DXSA 2EIDA 4CVUA 3MBWA 3WF0A 4XVHA 1LNSA 2JKXA 4W8JA 1UXZA 3T0AA 3ETPA 3WNOA 3CDZB 2Z4FA 3DYPA 5B4XA 1HN1A 5EIYB 1O59A 3CZJA 3MUZ1 4P00B 3ACGA 2Y8KA 1UMHA 5CYYA 2E26A 1F4AA 2E33A 3DYOA 1UYZA 2X10A 4BXSV 2ZEZA 2RV9A 3T2QA 3LEKA 1BHGA 2J1AA 3WF1A 4LHSA 1K45A 1JYNA 3WF2A 2WQ8A 2WO1A 3THCA 5C7GA 2JDAA 3ACIA 5FUIA 2HLEA 4P02B 3FHQA 4MOAA 3WSOA 4AG4A 4XZUG 1KGYA 4D8MA 4YPJA 1PX4A 1JZ6A 3HN3A 4BK4A 2W94A 3UETA 3OGSA 3U37A 2W9XA 1GOGA 5B4NA 1K3IA 2VZ1A 4W4ZA 3WNKA 2ZXQA 1D7PM 4LQRA 4LKSA 4LPLA 3W5NA 2HYXA 5EJZB 3MV11 4D0QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QDR A;  3LQC A;  4TXW A;  2VZQ A;  3LEG A;  3C7O A;  2WAA A;  2VR4 A;  3T2O A;  3HNM A;  1WKY A;  2Y6K A;  3UES A;  2WN2 A;  1PMJ X;  1W8N A;  4OUE A;  2YG0 A;  1W9S A;  4QX3 A;  2EIC A;  3A22 A;  5G04 L;  2L9L A;  3OBA A;  3WEZ A;  4QB2 A;  3GGL A;  1UY2 A;  2J1U A;  4A4A A;  1NAE A;  2W92 A;  3K4A A;  3K46 A;  2VM9 A;  4GZ9 A;  3LPF A;  2ZEX A;  4DUX A;  4CU9 A;  2VL4 A;  3K4Z A;  3A23 A;  1DYO A;  1SG3 A;  4JX0 A;  1DP0 A;  2WN3 A;  2VZS A;  4MAD A;  3I2F A;  3VDA A;  3GM8 A;  1UMI A;  3HJR A;  5HXM A;  4ARY A;  4ZZ5 A;  2E32 A;  5DN2 A;  3I2I A;  3IDA A;  1GMM A;  2QBX A;  1TG7 A;  4MGQ A;  1NUK A;  3AC0 A;  5JR2 A;  1UYY A;  1JZ5 A;  1YQ2 A;  1CIY A;  2QQI A;  3I3E A;  1SHW B;  4QPW A;  4DXT A;  3PUH A;  5LA0 A;  3HPN A;  1JHJ A;  2W95 A;  3K77 A;  1GNY A;  3NQH A;  5C70 A;  2XOM A;  3MV0 1;  2C9K A;  4M4P A;  4JHZ A;  5DMY A;  2EIE A;  3C7H A;  3SEE A;  1UY0 A;  4PF1 A;  2DCJ A;  4KI5 M;  5JUV A;  3IB3 A;  3ACF A;  5G05 L;  4XUP A;  2CDP A;  1OT5 A;  4XUR A;  1IQD C;  1PMH X;  3HOB A;  4OMD A;  2VZU A;  4A3Z A;  4QB6 A;  1CZV A;  4OMC A;  2VC9 A;  2VQU A;  2LW8 A;  2XON A;  3C8X A;  3UNP A;  1CZT A;  3A7Q A;  4AAX A;  3VDB A;  4DUW A;  1GUI A;  2VZT A;  4XUT A;  5JMO A;  1I5P A;  1JZ4 A;  1UWW A;  1UYX A;  4KWU A;  5F7U A;  3K4D A;  3OEA A;  4UAP A;  3SKJ E;  3T2P A;  1W8O A;  5IFP A;  2KD7 A;  3I2K A;  2Y6G A;  1DLC A;  2ORZ A;  3T08 A;  1O8S A;  2WDB A;  4IUG A;  3D3A A;  4BDV B;  5EJ1 B;  3DYM A;  3I2J A;  3VD9 A;  4OYU A;  4E8C A;  1H6Y A;  1CZS A;  1PX3 A;  3MO4 A;  4W50 A;  1L7Q A;  2V4V A;  2QQK A;  5HPO A;  5J1X A;  1JYW A;  3I2H A;  1US2 A;  3SKV A;  2BGP A;  4UI9 L;  3EB7 A;  3EYP A;  5JXI A;  2PQS A;  2WAB A;  3VD4 A;  3MUY 1;  2YC2 A;  3VDC A;  4JKL A;  2B4K A;  3OEB A;  3CKH A;  2BZD A;  2VMD A;  2ZEW A;  2QQN A;  3DEC A;  1W9T A;  3J7H A;  3FN9 A;  1TVG A;  4QDS A;  3LPG A;  3GXU A;  3WNL A;  3HEI A;  2ORX A;  4ZZ8 A;  3A21 A;  1GU3 A;  2QQJ A;  2QQL A;  4CUA A;  4P08 A;  4MGS A;  1OF3 A;  3CMG A;  3CZU A;  2X05 A;  3WF3 A;  3IAQ A;  1UY1 A;  4QX1 A;  2YC4 A;  3WNP A;  5IJR A;  5JXJ A;  2BBA A;  3WQB A;  4A41 A;  2W1W A;  4ARX A;  3GDB A;  3WNM A;  3I97 A;  2WYS A;  2V5D A;  4P5Y A;  1O8P A;  2XQX A;  3CIH A;  2WUH A;  2W87 A;  5LA2 A;  3ACH A;  3T0D A;  3SEP A;  3THD A;  1UY4 A;  4QB1 A;  3F2Z A;  4BK5 A;  1MPX A;  4OZO A;  4A45 A;  2YFZ A;  5A1A A;  2E31 A;  3T0B A;  3I3B A;  1EUU A;  2BER A;  1K12 A;  3T09 A;  4JKM A;  1GOF A;  2VQT A;  2X09 A;  3III A;  4DEV A;  5C71 A;  4CU8 A;  4A44 A;  2ZEY A;  2J1S A;  3C7G A;  2C26 A;  4CU7 A;  4PQQ A;  3IAP A;  1OH4 A;  2VZ3 A;  5DPN A;  1US3 A;  2WO3 A;  5IFT A;  1K42 A;  3VD5 A;  1XNT A;  1XNA A;  2EIB A;  2JE8 A;  2VTF A;  1XC6 A;  5I0D A;  1W99 A;  1NKG A;  2WBK A;  2OKX A;  3LE0 A;  1F4H A;  3VD3 A;  2VO5 A;  4TTG A;  1OD3 A;  1SDD B;  1OF4 A;  3VD7 A;  2WZ8 A;  2W1Q A;  1JI6 A;  3NRU A;  2J1T A;  2J22 A;  2JD9 A;  3PUI A;  4RYD A;  4M4R A;  5IYY A;  2VME A;  3E1F 1;  4ZY9 A;  1GOH A;  2VZR A;  3K75 B;  4L0P A;  1UXX X;  1W9W A;  5LA1 A;  2VMC A;  4GWJ A;  2XHN A;  4DEQ A;  1GQP A;  3C7F A;  1JZ8 A;  4KMQ A;  3P1I A;  1UZ0 A;  3C7E A;  3I2G A;  2LS6 A;  2WO2 A;  1CX1 A;  1T2X A;  3BN6 A;  2QQO A;  2YB7 A;  2BGO A;  4A6O A;  2VMF A;  1J83 A;  4RN5 A;  4CU6 A;  1ULP A;  3ABZ A;  4Z2A A;  2V72 A;  3WF4 A;  4GWI A;  1WCQ A;  1UY3 A;  2Y6H A;  2VZP A;  2J1E A;  4QAW A;  2Y6J A;  3HNY M;  4XUN A;  2W47 A;  3P6B A;  2DDU A;  3JXS A;  4XUO A;  3W5M A;  1UX7 A;  1XPW A;  2VCB A;  4E8D A;  2VZV A;  4FI9 A;  1ULO A;  5DQ0 A;  1J84 A;  2W1U A;  4XUQ A;  2VCC A;  3OG2 A;  1KEX A;  2DCK A;  2QQM A;  4QDQ A;  4A42 A;  2CDO A;  1JU4 A;  1H6X A;  4HG6 B;  2WAO A;  2W46 A;  3OB8 A;  2VJX A;  5IHR A;  1JZ2 A;  2B9V A;  1JYX A;  3NJX A;  2Y64 A;  2VCA A;  3CQO A;  1L7R A;  2WZE A;  5JXH A;  3FHA A;  3I3D A;  1W0N A;  2VZO A;  4MO3 M;  4CUB A;  4ZXE A;  3FL7 A;  2J1R A;  1R64 A;  2Y6L A;  4QX0 A;  2W5F A;  4JKK A;  4BJ0 A;  2J7M A;  3LEI A;  2J1V A;  3OGR A;  3NNG A;  1EUT A;  2RJ2 A;  3WNN A;  3BGA A;  4UOJ A;  2VOT A;  5LCW L;  2ID4 A;  2RVA A;  3OGV A;  5CZK A;  1JYV A;  3ZM8 A;  4DUV A;  1NX9 A;  1JZ7 A;  4QX2 A;  4DXR A;  1P8J A;  5JXG A;  1JZ3 A;  2C4X A;  4CUC A;  2R7E B;  2YFU A;  2W91 A;  4ET7 A;  2W3J A;  3ECQ A;  3NJV A;  4PT6 A;  3HNB M;  2W1S A;  1JU3 A;  1RYY A;  4DXS A;  2EID A;  4CVU A;  3MBW A;  3WF0 A;  4XVH A;  1LNS A;  2JKX A;  4W8J A;  1UXZ A;  3T0A A;  3ETP A;  3WNO A;  3CDZ B;  2Z4F A;  3DYP A;  5B4X A;  1HN1 A;  5EIY B;  1O59 A;  3CZJ A;  3MUZ 1;  4P00 B;  3ACG A;  2Y8K A;  1UMH A;  5CYY A;  2E26 A;  1F4A A;  2E33 A;  3DYO A;  1UYZ A;  2X10 A;  4BXS V;  2ZEZ A;  2RV9 A;  3T2Q A;  3LEK A;  1BHG A;  2J1A A;  3WF1 A;  4LHS A;  1K45 A;  1JYN A;  3WF2 A;  2WQ8 A;  2WO1 A;  3THC A;  5C7G A;  2JDA A;  3ACI A;  5FUI A;  2HLE A;  4P02 B;  3FHQ A;  4MOA A;  3WSO A;  4AG4 A;  4XZU G;  1KGY A;  4D8M A;  4YPJ A;  1PX4 A;  1JZ6 A;  3HN3 A;  4BK4 A;  2W94 A;  3UET A;  3OGS A;  3U37 A;  2W9X A;  1GOG A;  5B4N A;  1K3I A;  2VZ1 A;  4W4Z A;  3WNK A;  2ZXQ A;  1D7P M;  4LQR A;  4LKS A;  4LPL A;  3W5N A;  2HYX A;  5EJZ B;  3MV1 1;  4D0Q A; 
#chains in the Genus database with same CATH topology
 1XB9 A;  4LO6 B;  4QQO A;  1GKB A;  1SFN A;  2LAL A;  4EV0 A;  5FZA A;  5FY9 A;  1WW5 A;  1VR3 A;  5ANN A;  2VW2 A;  4OQ9 A;  1RUI 2;  2PHU A;  4CXX A;  1RUI 1;  2D44 A;  1K5J A;  1OBN A;  1PMJ X;  1W8U A;  3LWC A;  1GFF 2;  4QQ2 A;  3OGG A;  4OUE A;  3ZN5 A;  5JIU A;  2DUO A;  3H9A A;  1W9S A;  4I2O A;  1LUL A;  5G04 L;  3OBA A;  1VMF A;  2IXJ A;  1WA6 X;  3RQ0 A;  1UY2 A;  1C4R A;  5IVE A;  5J36 A;  2J1U A;  2JEC A;  4NRM A;  3ORJ A;  1NAE A;  3AZY A;  1MEC 2;  2W92 A;  3WW2 A;  1W6M A;  3KCC A;  4FP2 A;  4FPY A;  3W9A A;  1MEC 1;  3OPW A;  4YG3 A;  5C5T A;  4XZP A;  2ZEX A;  1DGR A;  2DTW A;  4L92 A;  1ENX A;  2VL4 A;  4CP0 A;  3NO8 A;  3WCR A;  2GN7 A;  5FZ9 A;  1YFU A;  3H1W A;  1R08 2;  4OHW A;  3LEM A;  3AYA A;  2WN3 A;  4XFH A;  3MIH A;  1VBA 3;  1VPH A;  2KR2 A;  3RZZ A;  2VZS A;  3VBO B;  3SHR A;  5BNO B;  4LMF A;  3RVH A;  1VAK A;  3CJI C;  3MFA A;  2V5Y A;  1GSL A;  3AMM A;  4RHV 3;  4D6Q A;  4ONU A;  3WQ0 A;  5FWE A;  4N53 A;  3BTX A;  5DN2 A;  4GH4 C;  4LJH A;  4MXV A;  2ZKN A;  3M3I A;  4B7K A;  3Q8A A;  2ZTN A;  3IDA A;  2JDZ A;  3JBG 3;  2RR1 3;  5C9A A;  4CP2 A;  3SCG A;  1TG7 A;  3KGL A;  4IE5 A;  1F8V A;  1UPS A;  5JR2 A;  1ZX5 A;  2VCM A;  1JZ5 A;  4FTB A;  2QKD A;  1OI6 A;  2R1B A;  4OI1 A;  4CEW A;  3WW1 A;  3POS A;  1CIY A;  2XVK A;  3ZN6 B;  4PI2 A;  3DPR C;  3PUH A;  3S7I A;  3BOP A;  1PVC 3;  2WJS A;  3E5X A;  1EP0 A;  4KBB A;  4QGL A;  3HPN A;  2NPI A;  2WRA A;  5EZW A;  5A80 A;  5LA0 A;  3N9M A;  5CBL A;  2G19 A;  2Y0O A;  2BUK A;  4LXL A;  2OS2 A;  2NYY A;  3MV0 1;  3OY8 A;  3WD5 A;  4AEM A;  1IOA A;  4F3J A;  3FZ3 A;  3PDQ A;  4JHZ A;  2EIE A;  3C7H A;  4U2A A;  3T2T A;  1F5F A;  2FCV A;  4LO4 B;  4RFR B;  2DCJ A;  1I6X A;  4A7Z A;  1UAI A;  5FO8 B;  1F15 A;  1D0G A;  3VBS B;  4HXC A;  4XDQ A;  2Y38 A;  1W04 A;  4KL1 A;  3WP3 A;  4YGE A;  5KWR A;  4EJR A;  2R32 A;  1QIQ A;  2EA7 A;  2FHR A;  4BMB A;  4JGZ A;  4DMI A;  1PGW 2;  1BCX A;  1QEX A;  1RC6 A;  1U12 A;  4LNV A;  2P6C A;  1RUH 3;  2XON A;  3UNP A;  2PHW A;  3FJS A;  3RI9 A;  4AAX A;  3VDB A;  4DUW A;  3F95 A;  3J7M A;  2XG3 A;  2B5H A;  1I5P A;  2VD7 A;  1EV1 2;  2UUR A;  4PLO A;  2PTM A;  1LJ7 A;  2WNU A;  3K48 A;  4QQH A;  1YIP A;  4IV3 A;  3O1R A;  1J3Q A;  4N90 A;  5F7U A;  1OQ1 A;  3KT7 A;  3R6S A;  2XJR A;  4Y26 A;  4NUB A;  1KIT A;  3B94 A;  4WVV A;  1VRH 2;  3D82 A;  4CYD A;  4DFS A;  5GZE A;  1LB2 A;  1VRH 1;  4BDV B;  4JZR A;  1XE0 A;  3DYM A;  3BKZ A;  3VD9 A;  4IEY A;  4OYU A;  4E8C A;  4FOW A;  4W50 A;  1PX3 A;  4SLI A;  4E4D X;  3U4S A;  3HQU A;  4CDW C;  2YPD A;  4ISR A;  5T5L A;  2QQK A;  5BXX A;  4QHB A;  5IVV A;  2E9Q A;  2IXH A;  4B4R A;  1JYW A;  3S57 A;  3I2H A;  4XYX A;  5J98 B;  2BGP A;  2TNF A;  1YYN A;  5JXI A;  2JG8 C;  3KV9 A;  4NPR A;  1HQW A;  2WAB A;  5JVV A;  4D7T A;  4LBQ D;  1YIF A;  4B1M A;  2RM2 1;  3WHT A;  3TBD A;  5GZG A;  3MUY 1;  1E5S A;  1AYM 2;  1W6P B;  3GBG A;  1AYM 1;  3CKH A;  4LBO A;  3NAP C;  1H8V A;  1WMX A;  1XNB A;  2DWR A;  1MZ5 A;  1H4H A;  2PYT A;  2D40 A;  5FZB A;  5FXW A;  3BAL A;  3WNX A;  4S2H A;  1XYO A;  5C8C B;  2W39 A;  3WQ1 A;  1ZRI A;  3GXU A;  5CB7 A;  3HEI A;  4LK7 A;  1RVF 2;  1VJ2 A;  2ORX A;  5IVF A;  4XPV A;  1T6B X;  3AP4 A;  1C8M 2;  3ZPY A;  1QHD A;  3VBR A;  2QQJ A;  1RVF 1;  1WME A;  5DG1 A;  3M3E A;  1C8M 1;  3NV1 A;  1DDL A;  2JG9 B;  4XHB A;  1AR7 3;  4XAB A;  2G9F A;  1AXK A;  1CAW A;  1O3T A;  4WVM A;  4AZZ A;  2YY1 A;  2MEV 1;  5FPU A;  3AVR A;  3O14 A;  3CMG A;  3CZU A;  1HJF A;  2R30 A;  1HRI 3;  3B7M A;  3FMG A;  3IAQ A;  3OYW A;  5CIR A;  3OTF A;  3WT3 A;  3DKW A;  3E5U A;  2D5H A;  3WUC A;  5IAV A;  2UWC A;  4KWK A;  5J96 B;  3QD6 A;  4WV8 A;  3N9O A;  5HV4 A;  2F4P A;  5IK5 A;  4A41 A;  3D6E A;  2JDN A;  4Q4W 3;  1V6L A;  3GDB A;  2BEO A;  1LTE A;  3I97 A;  1C1F A;  1JH5 A;  1PGS A;  4XDO A;  1PGL 2;  1WW7 A;  5K0U B;  4FOV A;  2V5D A;  1AR9 3;  2XQX A;  1PGL 1;  5LA2 A;  2WNO A;  3WW3 A;  3HMY A;  4E4S A;  1C3H A;  4LE3 A;  1F31 A;  4FFG A;  1QDC A;  3OPT A;  1ZBA 3;  4PIX A;  4A45 A;  5A1A A;  3T0B A;  4PIZ A;  3B9C A;  1PO2 3;  3ALQ A;  3ZFF A;  1YO8 A;  3SCH A;  3FLP A;  3HBZ A;  4JKM A;  4JDO A;  5DUW A;  3ZX7 A;  3CNA A;  1GP4 A;  4CA9 A;  1PNG A;  2X09 A;  5DDJ 1;  4GB3 1;  3KT1 A;  5BNN C;  2OZ6 A;  4RS5 B;  4RHV 2;  2X29 A;  4RR3 A;  3POY A;  5A6Q A;  1FPN 2;  1GR3 A;  4CU8 A;  3N7M A;  1YQ6 A;  2YPJ A;  4A44 A;  1W28 A;  2XJT A;  3H50 A;  3LSE A;  3PL0 A;  4LBL A;  4UW4 A;  1FPN 1;  2C26 A;  5FCC A;  1SLT A;  4NRQ A;  3V64 A;  2VUJ A;  3UV9 A;  1FAT A;  3J7N A;  3N36 A;  4H7L A;  1GWM A;  5L9V A;  5DPN A;  3IT8 A;  4XQW A;  1LOG A;  3PTR B;  1I5Z A;  1US3 A;  2Q0A A;  3BIW E;  2ZHK A;  2A6Z A;  4AVB A;  4ZS3 A;  3ZO0 B;  3UKT A;  2VTX J;  3SCF A;  1RUO A;  1XNA A;  3LIG A;  4KGQ A;  2WZP P;  3E5Q A;  1OOP C;  4YW2 A;  2VTF A;  5FR3 A;  1DQ1 A;  1XC6 A;  1HB4 A;  1ULD A;  2OUJ A;  1STM A;  2SLI A;  3HN1 A;  1LR5 A;  5GKA C;  5A7W B;  5AC9 2;  1DGW X;  4YVW C;  4COU A;  2A5Z A;  5BNN A;  3HR9 A;  1HQL A;  3LDK A;  2W52 A;  5AC9 1;  3LE0 A;  4Z2W A;  1F4H A;  3VD3 A;  2QCS B;  2GU9 A;  3HT1 A;  4YAR A;  2OX0 A;  4QGM A;  3DL3 A;  4QXK A;  4BQ3 A;  1OD3 A;  1SDD B;  4HOO A;  4L9B A;  3T1M A;  3ATG A;  4LLO A;  4Y5Z 0;  1IPS A;  4LT5 A;  2VQA A;  3QLQ A;  1JI6 A;  2DBN A;  3M3O A;  1W6M B;  2A70 A;  2J22 A;  5I0U A;  1RTV A;  4A7K A;  4GWM A;  4M4R A;  5BYN A;  4ZY9 A;  1GOH A;  5M0T A;  1PMI A;  1RUH 2;  2WNV A;  5FYY A;  1W9W A;  3TEY A;  3H1M A;  1H8T B;  2D3S A;  2VMC A;  4ZU4 A;  1ODN A;  4DEQ A;  3BTA A;  3TOJ A;  4QU2 A;  2HWE 2;  4CDX B;  1JZ8 A;  2DBI A;  3U4X A;  3P1I A;  5DAV A;  1CR7 A;  4MH0 E;  3RPQ A;  2HWE 1;  3U78 A;  5C5U A;  4FOQ A;  4ISQ A;  4TLF A;  1ZZ8 A;  3BN6 A;  5DZF A;  1RUN A;  1E5R A;  1XE8 A;  3S5Q A;  1UZZ A;  1Y9Q A;  1HV1 A;  4CU6 A;  1DQ6 A;  1RIT A;  4PF5 A;  3GBF A;  4XFG A;  1DFQ A;  5F5Q A;  3MPP G;  2QDN A;  1HQN A;  2PA7 A;  4HN1 A;  1QMJ A;  1B35 C;  4XDP A;  5FDB A;  2J1E A;  4XUN A;  3HNY M;  3INA A;  1H4G A;  1YFW A;  2E53 A;  3ZXA C;  3ZYH A;  5JPM B;  4FVV A;  1D0H A;  1RUG 3;  3JXS A;  3NJZ A;  3BIE A;  2K9Z A;  5DUX A;  5HXV A;  5A7P A;  5GLZ A;  3AYC A;  4ASK A;  4AI2 A;  4FI9 A;  4AVA A;  4C0B A;  1ULO A;  1JTZ X;  2W1U A;  3ZR5 A;  4HKW A;  3OG2 A;  4FPO B;  2ARB A;  2DCK A;  1V9U 2;  2XJS A;  2K2S A;  4QKD A;  3O1M A;  1SDW A;  1V9U 1;  5FZF A;  1W6O A;  4HG6 B;  4M3C E;  1NYW A;  2ZHL A;  1D4V B;  5A3U A;  2W46 A;  3FFZ A;  5FZG A;  5T5O A;  2VAU A;  1AJO A;  1W8T A;  5C4W A;  4NOT A;  1IPK A;  4K40 A;  3UGG A;  4IEQ A;  1J1L A;  4CCE A;  5EYX A;  2DUP A;  2CTV A;  4PDW C;  3VV1 A;  2Y64 A;  5A6Y A;  2VCA A;  4M00 A;  3LSD A;  2R07 2;  1WLW A;  1WGP A;  3CQO A;  4X8N A;  4DRV A;  2UY8 A;  4OFG A;  4OI4 A;  4URA A;  3S5A A;  2R07 1;  4FQZ A;  4UYB A;  3FHA A;  4H7M A;  5ABJ A;  5D1I A;  1BYH A;  4XTM A;  1OQE A;  4XJW A;  3T4H B;  3VDD C;  5JCT A;  1QXR A;  2QQU A;  4YM2 A;  3OOX A;  2OA2 A;  3U10 A;  3VZO A;  4AQ2 A;  2P5B A;  4WVW A;  4BIF A;  1VB2 A;  2ZX4 A;  3FL7 A;  1V6K A;  1AR6 1;  3VBF A;  4XF1 A;  1N1T A;  5IK8 A;  4HON A;  1U5I A;  4BJ0 A;  2J7M A;  2WFF 2;  2UWA A;  4CCL A;  3ZSJ A;  2GDF A;  1TNF A;  1ZBE 2;  1DQ4 A;  2J1V A;  2WLP A;  5E89 A;  2WFF 1;  5FPA A;  1MZ6 A;  2EAA A;  1ZBE 1;  1IKQ A;  2PHF A;  3N9Q A;  3O1O A;  1M06 G;  3KD4 A;  2VW0 A;  5KR7 A;  1SLI A;  1YJK A;  3GNE A;  4L2N A;  4UBG A;  1JYV A;  3FFQ A;  4J6G A;  1F2N A;  1W9Y A;  1G9D A;  1O4T A;  3AJZ A;  3BTZ A;  1TMF 2;  1W6N A;  2Q4S A;  3WCS A;  1TMF 1;  2BWA A;  4QPY A;  3WDX A;  4G9S B;  2B46 X;  4MSV A;  4AI9 A;  4NPL A;  4D6S A;  2IXC A;  4H2A A;  2YHJ A;  2FDG A;  1YQ5 A;  2ZMN A;  2C9A A;  5FYT A;  3AZZ A;  3N9L A;  1W9F A;  2NP0 A;  3AM2 A;  4R9D A;  2XWB B;  1URX A;  4CEY C;  2WS9 2;  3WF0 A;  4CVU A;  1IS5 A;  4A6S A;  2Y60 A;  1ULC A;  5BNP A;  2PLV 3;  2HWD 3;  2WS9 1;  1GQH A;  1UXZ A;  2P6H A;  3ETP A;  1W3V A;  4COZ A;  2XXZ A;  3JQX A;  5EIY B;  1O59 A;  2VVD A;  3HBK A;  1QNY A;  2Y33 A;  2ET1 A;  3CZJ A;  4M0H A;  1WLD A;  4P00 B;  4RS5 C;  3LA3 A;  1ASJ 1;  5ISL A;  1NA1 A;  1WCK A;  3UGF A;  3W21 A;  1AL2 2;  2WL1 A;  1UW8 A;  4I0B A;  3ZFE A;  2E33 A;  2MPF A;  3POJ A;  4N43 B;  3UYJ A;  2ZS6 B;  3TEW A;  3AXD A;  1W8W A;  1S0D A;  2IFR A;  1PO1 3;  3OYW B;  5GZC A;  2BU9 A;  2DCY A;  4COY A;  1GBG A;  3KLS A;  1JYT A;  4JRL A;  5E88 A;  1JOB A;  1MQT C;  2PXJ A;  2XML A;  1WWY A;  4R9C A;  2JEN A;  4JQR A;  1BHG A;  4MV2 A;  1VBC 3;  3MHZ A;  5FYS A;  3O0X A;  4KWL A;  1HKD A;  2PAM A;  3PMS A;  2D97 A;  2CGO A;  3P3P A;  5T3N A;  4AAP A;  3K2O A;  4Y1Y A;  4IE0 A;  5FZI A;  5A7S A;  3VHO A;  3ACI A;  5FUI A;  1UF2 C;  2HLE A;  5JOZ A;  4NRP A;  3RMY A;  4MG2 A;  1IHM A;  3AZV A;  4XJ9 A;  5A3L A;  2GH2 A;  5I93 A;  2VVF A;  1UOJ A;  4P9I A;  3ZFF B;  1VBB 2;  1PX4 A;  3HN3 A;  4LOR A;  4Y24 A;  1VBB 1;  5E1R A;  5FY1 A;  4BK4 A;  2P37 A;  1PK6 C;  4LKD A;  3RYR A;  3U37 A;  1ZA7 A;  3VZJ A;  1W0P A;  1HV0 A;  4XTP A;  2XL9 A;  4B4P A;  2NQY A;  2ZHM A;  4MGT A;  3KF3 A;  4FAG A;  1RUI 3;  3WNK A;  1DGW A;  2ZXQ A;  2X8K A;  1D7P M;  5CFD A;  2QQW A;  1G9F A;  1MZF A;  5I91 A;  5FLH A;  3KHC A;  4P5H A;  3L2Y A;  5DXD A;  4YW3 A;  1WBF A;  4LLF A;  4QHZ A;  5FPZ A;  1RGS A;  4N53 C;  4HMZ A;  3RG0 A;  3SMH A;  4AOC A;  4CRQ A;  3LQC A;  2Q5T A;  2VZQ A;  1RUG 2;  1AYN 1;  1C5I A;  1NOV A;  1C1L A;  2A6Y A;  3FWE A;  1TNR A;  3C7O A;  3LEG A;  4OHX A;  4V2V A;  4XAC A;  5C9A C;  1MEC 3;  4FPL A;  2XL7 A;  2VR4 A;  4Q8L A;  3AXE A;  4AQT A;  5IT6 A;  3HNM A;  1WKY A;  2Y6K A;  3LOI A;  3MFC A;  4YSF A;  3FC0 A;  2FZ1 A;  4CEW C;  2WN2 A;  3E6C C;  2TEP A;  4MHU A;  4BZ4 A;  4DB5 A;  4PJY A;  1R1Z A;  3FUO A;  3A22 A;  5H9Q A;  4YW4 A;  3WEZ A;  3GGL A;  3V65 A;  3D0S A;  5LW9 A;  3ZYG A;  4P14 A;  4BA6 A;  5D8A A;  2VUC A;  3RS6 A;  4I01 A;  3TB0 A;  3IPV A;  1CJP A;  3ES1 A;  2XH6 A;  3H7Y A;  4XFA A;  4GZ9 A;  3LPF A;  3HAG A;  4UFI A;  1O3Q A;  4GJZ A;  1ZZ6 A;  2WNV B;  4CU9 A;  2RS5 1;  5HCB A;  2E7A A;  3A23 A;  3DPR B;  2JB4 A;  1DYO A;  2AEZ A;  1N1Y A;  4JX0 A;  4YFZ A;  3I2O A;  2JIC A;  3PLQ A;  2GC2 A;  2ZX3 A;  4JDM A;  1H1M A;  2BV4 A;  4JGZ C;  4R9A A;  4JHT A;  3SLI A;  3CU7 A;  2DYC A;  4HSJ A;  1GIC A;  4AVC A;  2QE3 A;  3HJR A;  2XJV A;  2RDS A;  1UIK A;  1AZD A;  1WUV A;  3ZMO A;  2E32 A;  4OUL A;  1GWL A;  1GLH A;  1UU5 A;  3UGH A;  5JOX A;  4FSJ A;  2WT0 A;  2ADE A;  5F3I A;  2WNU C;  4F8A A;  2XJP A;  4IV3 C;  1Y9G A;  4OHY A;  4DQA A;  3VKO A;  2BNO A;  1VIW B;  4P9G A;  4LBN A;  5GLT A;  2BNM A;  3NWK A;  2QQI A;  3AKS A;  3FBM A;  3I3E A;  1SHW B;  5F39 A;  3QBQ A;  4DXT A;  1MS3 A;  1HW5 A;  4XBN A;  1K5M A;  1QF3 A;  2R0H A;  3SQO A;  2CAU A;  5HCH A;  1Q8Q A;  1YUD A;  2B8M A;  4XOG A;  2W95 A;  2P1B A;  3K77 A;  1GNY A;  3N7K A;  3NQH A;  5C70 A;  1SLL A;  2XB6 C;  2XOM A;  3GHM A;  3M8L A;  5A1F A;  2H6B A;  3KV4 A;  3CJX A;  4AYU A;  3U75 A;  5FUN A;  2GNT A;  1RUJ 2;  1OA4 A;  4PLN A;  4XET A;  1RUJ 1;  2P3K A;  4PF1 A;  3RJR A;  4KI5 M;  4AVS A;  5JUV A;  3IB3 A;  5FMB A;  3KZ4 C;  3T30 A;  2ENR A;  4UW6 A;  4CDU A;  2CDP A;  5FBJ A;  2DFB A;  3ZXJ A;  4FFI A;  1MR5 A;  1QJY 2;  4OMD A;  2VZU A;  5AFB A;  4JAA A;  1WZX A;  3JD7 1;  3B9I A;  2PHX A;  1QJY 1;  2WIN B;  1CZV A;  2UYA A;  3GHN A;  1YXW A;  3HQR A;  2ZOE B;  3ITQ A;  3VN4 A;  3OF1 A;  2VQU A;  4QM8 A;  1VRH 3;  1IS4 A;  4IEP A;  2XLG A;  4MGK E;  3ZYP A;  5BNQ A;  5C8W A;  3O1T A;  2QVS B;  4K3U A;  4WBB A;  5FTT C;  1YCI A;  1GUI A;  1Y3T A;  5F6K A;  5JIA A;  3ZIX A;  5EV7 A;  1L7L A;  3IM0 A;  1UWW A;  1XRU A;  4KWU A;  4C1W A;  4IGQ A;  2DVD A;  3OEA A;  4UAP A;  4Y5S A;  3VBR C;  3WVJ A;  5A6Z A;  3I2K A;  5FMD A;  1DLC A;  1VBC 2;  2ORZ A;  1O8S A;  2WDB A;  3ZFG A;  3V0A B;  3I8T A;  4IUG A;  1KJR A;  1NCR A;  1AHS A;  4LIT A;  3N35 A;  2GC3 A;  2RM2 3;  4Y22 B;  1EPW A;  1TE1 B;  4MVT A;  3VZN A;  2JJ6 A;  1HXS 2;  1AYM 3;  1CZS A;  1V6O A;  2IXK A;  3MO4 A;  3PUQ A;  4AED A;  2BPA 2;  1DIW A;  2GND A;  3KT4 A;  4M3C A;  1HXS 1;  5JWP A;  2WZR 2;  3POE A;  4XF3 A;  1Z0H A;  1EPZ A;  2BRT A;  2R49 A;  2WZR 1;  3SIT A;  1US2 A;  4D6R A;  2FQP A;  1OA2 A;  2JIG A;  2WLQ A;  2YC0 A;  3EB7 A;  1CQ9 A;  3QOP A;  4HN0 A;  4NIA A;  3VL8 A;  3ZXE A;  2K46 A;  3J9S A;  4CUG A;  3L9J T;  4XC9 A;  1RVF 3;  1RMU 2;  1JHN A;  5T5P A;  3VD4 A;  1C8M 3;  1ENQ A;  1MQT A;  3LOB A;  1FX5 A;  1RMU 1;  1GZC A;  2VOK A;  5F5A A;  1WBL A;  3OEB A;  4ES8 A;  5BNP B;  2MEV 3;  5EJ3 A;  3LF7 A;  2BP6 A;  2C1F A;  2OXB A;  2VMD A;  3T3Y A;  3UL2 A;  5T5J A;  2H6C A;  4I3G A;  2QQN A;  3ZFF C;  1W9T A;  4Q0V A;  1TVG A;  2AYH A;  4BWO A;  1LRH A;  2RJL A;  3WZ1 A;  4RR3 C;  3M3C A;  5LEJ A;  4OI2 A;  3MIG A;  1OVS A;  1S0G A;  3OGJ A;  3A21 A;  1GU3 A;  2W68 A;  2XUE A;  4XHX A;  2ES3 A;  2JB8 A;  1JMU B;  5LK5 A;  2PHD A;  2A3X A;  3THP A;  5F1R A;  2GNM A;  1C5H A;  1W2A X;  4MGS A;  1WMD A;  2Z79 A;  4AQS A;  5FZH A;  3KQR A;  4Q1P A;  2NLR A;  4K7J A;  5GZD A;  1XNK A;  1PK6 A;  1SFY A;  1UIJ A;  3POW A;  1S0J A;  3B01 A;  4AL9 A;  3G7D A;  1APN A;  1OA3 A;  5FPX A;  1LHN A;  2B45 X;  3AMP A;  3VBH A;  5JXJ A;  3MEP A;  4J25 A;  2BBA A;  2DTY A;  1BEV 2;  4XAE A;  5FZK A;  3WQB A;  4B4Q A;  3IMM A;  2C24 A;  1BEV 1;  3A0K A;  1OMI A;  4AHZ A;  2VTX A;  1OKQ A;  2ZGP A;  1GZW A;  5CKM A;  5AVP A;  1UL9 A;  1YFX A;  3AP5 A;  1PM4 A;  4P5Y A;  3ELN A;  4N7I A;  1VAL A;  3KV5 A;  1FPN 3;  3H1Y A;  1A6C A;  2Z2S B;  4XJ8 A;  5FK8 A;  3C3V A;  5IAT A;  1NQJ A;  3GZU C;  4LUK A;  3T0D A;  1OOP B;  4QB1 A;  3T4V A;  2FD8 A;  4BK5 A;  1MPX A;  4OZO A;  3B5L B;  4YVW B;  4LHK A;  1E5H A;  2BER A;  1OFS A;  4FTE A;  3H8X A;  4FT8 A;  1ENS A;  1GOF A;  3III A;  2VMG A;  3K3N A;  2P2K A;  2WNV C;  3THT A;  3DV8 A;  1DZQ A;  1NY7 2;  3UKV A;  2GC1 A;  4DEV A;  5I0S A;  1R1A 1;  3O5S A;  5GLW A;  2J1S A;  1XU1 A;  5LAT A;  4DOU A;  1NY7 1;  3C7G A;  3HT2 A;  4HL0 A;  5LBC A;  5JR7 B;  2D6L X;  1G7Y A;  2AAC A;  4IES A;  5AC9 3;  1I3H A;  1AXY A;  1S1A A;  5HBA A;  3JUU A;  4YZ2 A;  4NHY A;  5F6L B;  5FO7 B;  4FO9 A;  2C0Z A;  2HWF 2;  5IFT A;  5IK4 A;  3I49 A;  3WDW A;  4QX7 A;  2VUD A;  3PVB B;  1Z7S 2;  2HWF 1;  2IVJ A;  2R06 2;  1W06 A;  1R09 2;  4GMP 3;  1Z7S 1;  2R06 1;  1HB3 A;  1R09 1;  3B93 A;  4CXY A;  1G9C A;  4EN0 A;  2YZ4 A;  3MI8 A;  4HK9 A;  4YZ1 A;  1CAX B;  1W99 A;  1ZZC A;  4GQ7 A;  4R52 A;  3AMQ A;  4XIK A;  5J37 A;  5C3Q A;  2R1D A;  2FCU A;  2DUQ A;  4ZU7 A;  3RZJ A;  1KXG A;  3ZR6 A;  1QXP A;  1LED A;  4GUL A;  4Q0S A;  1QU0 A;  3VD7 A;  2FDH A;  1BQP A;  4AFD A;  1DYP A;  1DZR A;  5KC6 A;  1WMF A;  3BU7 A;  4HKO A;  3S30 A;  2W1Q A;  4L99 A;  2H0V A;  1BXH A;  2OUH A;  4Y1V A;  2HWE 3;  2X53 S;  1FV2 A;  1B35 B;  4YVS A;  2LRO A;  5IYY A;  5LRS A;  3E1F 1;  4NVP A;  3R4D B;  4YW5 A;  5LA9 A;  1O4Y A;  5CKQ A;  1G86 A;  4FPJ A;  3I7D A;  4L0P A;  3AKT A;  1QJU 2;  1UXX X;  2IWG B;  2UY9 A;  2YU1 A;  5A3N A;  5C4W C;  2C6S A;  2YRO A;  3IDE A;  1QJU 1;  4Z82 A;  5F5I A;  5GAL A;  2XHN A;  2BVV A;  2ARE A;  1RUD 1;  3C7F A;  3O1V A;  3TNP B;  3B3Q E;  4L97 A;  2HEW F;  1O91 A;  3I2G A;  4S2D A;  2LS6 A;  4Y20 B;  4MGZ E;  1OLM A;  2YB7 A;  1S2E A;  5ABJ C;  5JSR A;  4A6O A;  2VMF A;  4RGK A;  2Q8E A;  4QPG A;  2DU1 A;  3ABZ A;  1S0C A;  2V72 A;  3PU3 A;  4Z2A A;  2RM2 2;  1UZW A;  3WF4 A;  2RG4 A;  4GWI A;  4PDW B;  1WCQ A;  1DZT A;  1S0I A;  2XHK A;  2BNN A;  3I3Q A;  1GAN A;  1JUH A;  1UY3 A;  3VBF C;  4EE2 A;  2YGM A;  4LEJ A;  1AVB A;  1GP6 A;  1GWK A;  1V9U 3;  4QAW A;  2JDY A;  1RUC 2;  3UK9 A;  3KWV A;  3USU A;  4LIU A;  4Q26 A;  2RDR A;  1YRZ A;  2W47 A;  4FBF A;  1RUC 1;  1Y9M A;  3PME A;  3VDD B;  4CCN A;  4XUO A;  1RHI 2;  1UX7 A;  2VCB A;  4E8D A;  4E9K A;  1ZVF A;  2VZV A;  1RHI 1;  3ZMN A;  5GLU A;  1NCQ A;  3U07 A;  4LO5 B;  4CCK A;  2QJV A;  4DPN A;  1DGL A;  2R07 3;  1W6Q A;  1KEX A;  2QQM A;  4B1L A;  4QDQ A;  4A42 A;  1JU4 A;  1WCS A;  2MEV 2;  5KXC A;  1JYI A;  1H6X A;  2WSV A;  5IWF A;  1E5I A;  2WAO A;  1HIX A;  3R0R A;  1Q8P A;  1XOY A;  2VMH A;  1RIN A;  5T52 A;  2ZZJ A;  3KVA A;  1BVP 1;  4CP9 A;  3H8U A;  1AR6 3;  5FY4 A;  1JZ2 A;  3VL9 A;  3NJX A;  5HCA A;  1W90 A;  1XSQ A;  1RL3 A;  2ARA A;  5A32 A;  2TBV A;  5EPA A;  1L7R A;  2WFF 3;  1W2O A;  4DY5 A;  4QMA A;  1ZBE 3;  2WZE A;  3FHI B;  1RUE 2;  4OHV A;  5FQ0 B;  4FOY A;  5BNP C;  5JXH A;  1ZYB A;  2QDR A;  1RUE 1;  4YG0 A;  1KDK A;  4CE8 A;  1N3Q A;  4Q5O A;  1H1A A;  1OHF A;  2J1R A;  1R64 A;  1ZZ9 A;  1NA1 C;  5FAX A;  2PAK A;  3FE5 A;  3ZFE C;  1TMF 3;  2Y6L A;  4CEY B;  1W8H A;  4Q0P A;  4E27 A;  4YRD A;  5GJ6 A;  4BE3 A;  3WLU A;  3WHU A;  4HBN A;  4XCB A;  5FZ1 A;  3OGR A;  1KS4 A;  1Q8S A;  1Q3E A;  1DBN A;  3NNG A;  3IBM A;  2D6M A;  1V0A A;  5DDJ 2;  5FZ3 A;  4GB3 2;  2ZHN A;  3WDY A;  4UOJ A;  2WWJ A;  2VOT A;  5A7O A;  3EQE A;  4Q29 A;  4XF0 A;  3OD4 A;  3TEZ A;  4BQ4 A;  5LK7 B;  1CVN A;  2P4E A;  5CZK A;  4M3C B;  3M7A A;  4E4Z A;  3ZM8 A;  5J7M A;  3KSC A;  3ZPO A;  1NX9 A;  2WS9 3;  3GYD A;  1OLQ A;  4AI8 A;  4DXR A;  1P8J A;  4YLZ A;  3ST7 A;  1KD7 A;  1A8D A;  3W59 A;  1IG3 A;  4G3Y C;  2R7E B;  3DKQ A;  3QCW A;  5LWB A;  1ASJ 3;  2XGX A;  2W3J A;  1MQT B;  4YNI A;  1HDK A;  1UKR A;  3ECQ A;  3NJV A;  5JPN B;  1MS8 A;  1AL2 3;  1JU3 A;  1ZRR A;  1PIV 2;  4GXL A;  5APA A;  1LHV A;  4IW3 A;  2D6N A;  1H0B A;  3OUH A;  1PIV 1;  3NKT A;  5FIX A;  4W8J A;  3GZE A;  5H9P A;  3LB9 A;  1FV3 A;  1ND3 A;  3WNO A;  2RHP A;  3CDZ B;  2Z4F A;  2JDM A;  3DYP A;  4E2S A;  4IEU A;  5CG9 A;  1GYK A;  2VMI A;  3D0J A;  4BYY A;  3SIS A;  3VHR A;  4AVV A;  2O1Q A;  1QJZ A;  2Q1F A;  3KMH A;  1UMH A;  5C3R A;  4X6R B;  2E26 A;  3NMB A;  4IQP A;  3I54 A;  4S2G A;  4YYO A;  1F4A A;  3MF9 A;  2ETE A;  3DYO A;  4ATE A;  3RDI A;  5L9B A;  3DUI A;  1VRB A;  5CFD C;  1O7F A;  3UJO A;  4BLI A;  1GZ9 A;  4F7Z A;  1PK6 B;  3J26 N;  3TAY A;  5H9S A;  1CPM A;  3RFR A;  1ST8 A;  1ODM A;  4NWV A;  1H2M A;  3FUQ A;  3O0V A;  4PBO A;  3OSD A;  2XBO 2;  4NN0 A;  3I4I A;  3WDU A;  3BB6 A;  4AHY A;  4AW7 A;  1BBT 2;  3I59 A;  4MXW A;  2XBO 1;  4JTN A;  2J1A A;  3WF1 A;  5DAW A;  3X29 B;  4A3X A;  4B7E A;  1BBT 1;  1K45 A;  4KU8 A;  1VBB 3;  1VMH A;  1GZW B;  1I1E A;  2DCT A;  3CLP A;  3RWK X;  3VKN A;  2I74 A;  1WD4 A;  3JB8 A;  2RS1 1;  1QKQ A;  4N53 B;  4BQW A;  4P02 B;  5KHJ A;  1QJX 2;  1Y43 B;  5JSO A;  3U11 A;  4IGO A;  3Q8E A;  4UFM A;  3WSO A;  1QJX 1;  3M2M A;  1WLT A;  2QZ3 A;  2WNE A;  5C9A B;  3MIB A;  4D8M A;  1XYP A;  1Q8V A;  1H1I A;  5D8A C;  1QXJ A;  4QD2 A;  5EQU A;  1QJF A;  2CY6 A;  2EXJ A;  2VOV A;  1VAV A;  3KQ4 B;  1ZRF A;  4CEW B;  3D4K A;  4I30 A;  4QT6 A;  4V1P A;  4XJA A;  5L9R A;  3A4U A;  1VE0 A;  4AGR A;  2Q30 A;  1AYN 3;  2DVA A;  2W9X A;  4ITC A;  5HCF A;  1V70 A;  4SBV A;  3MLJ A;  3BYW A;  2VZ1 A;  4ZS2 A;  1FOD 2;  4EZH A;  1AX2 A;  4GKX A;  3MIC A;  2AEN A;  1FOD 1;  2ERF A;  3GCW A;  3OY8 B;  5LB6 A;  2AUY A;  4NR1 A;  3AKR A;  3ZYR A;  3EMR A;  4LOT A;  1NQD A;  4JDN A;  3PJY A;  4RL7 A;  5EJZ B;  4Z07 A;  3RZG A;  4D0Q A;  2W0X A;  4QDR A;  5A70 A;  4TXW A;  5FP9 A;  4OUM A;  3ILN A;  4KQ7 A;  2WSU A;  4YW6 A;  2TUN A;  3LD8 A;  1Y4W A;  3H3U A;  5C6C A;  1N3O A;  2WWU A;  2YXS A;  2WQZ C;  3BPS A;  4JGZ B;  4HFS A;  2ZX1 A;  2JDH A;  2RS5 3;  3UES A;  3MZH A;  5FZ0 A;  2BBV A;  1U5X A;  4QX3 A;  2BYV E;  2EIC A;  3TN9 2;  3WXP A;  2XVG A;  1K5M C;  4HVO A;  4QB2 A;  4NWW A;  1YJL A;  2WNU B;  4X6Q B;  3TN9 1;  4IV3 B;  1W3X A;  4IGP A;  1WCD J;  1Q56 A;  4YVS B;  2F4L A;  3MW4 A;  5L19 A;  1KDM A;  3K4A A;  5FP4 A;  1IGO A;  1OPM A;  1AR6 2;  3K46 A;  1O5U A;  2VM9 A;  1BZW A;  4P9J A;  5CKN A;  1KFX L;  1YQ8 A;  4O65 A;  1J58 A;  4YZ4 A;  4YM1 A;  1FMD 2;  4LR4 A;  2XKO A;  2A6X A;  1SG3 A;  3IN9 A;  3RYP A;  5FZM A;  2E63 A;  4CDU C;  3ZXG A;  1FMD 1;  1BJQ A;  5IVY A;  4LO7 A;  4CCJ A;  3AP6 A;  1D2S A;  4K21 A;  2ZML A;  4MAD A;  2QUO A;  4U36 A;  5ANQ A;  3S7E A;  3FBY A;  1NLR A;  1XYN A;  3I2F A;  3PVN A;  4J1X A;  3AMH A;  4AWD A;  5HXM A;  2XLA A;  1QQP 2;  4ZZ5 A;  4ORF A;  1YNA A;  3PUA A;  4IND A;  2ARX A;  1QQP 1;  4IV1 A;  3EJK A;  4QPG B;  2VU9 A;  3AP7 A;  1ND2 A;  5FKB A;  5A3T A;  3HVD A;  2EAL A;  2QBX A;  2KM2 A;  4XJU A;  1WCU A;  5T50 A;  4MGQ A;  2HH9 A;  2RE9 A;  4RD7 A;  4D3W A;  4Q4W 1;  1DLL A;  1RUJ 3;  1SBD A;  1UYY A;  5JZG A;  4JVA A;  4WM7 A;  1YQ2 A;  3H8O A;  4CPB A;  4KG8 A;  2K0G A;  3WY6 A;  3ZFG C;  3G6J B;  4NAO A;  3SNM A;  1NCR C;  4NHM A;  1XE7 A;  1FNY A;  2V09 A;  4TWT A;  3ZSL A;  4DNY A;  5J3U A;  5KHG A;  5KHK A;  3BU0 A;  3ME2 A;  3NST A;  1ENR A;  1B09 A;  2X5I A;  2RS3 1;  2ZGU A;  3JD7 3;  2Z42 A;  1MAC A;  4LUL A;  4W6X A;  1QJY 3;  2R04 2;  1ASJ 2;  2NM1 A;  2ZBJ A;  1S0E A;  4X8P A;  4Y4R A;  1W6Q B;  5FZ6 A;  2I2S A;  3VBR B;  2R04 1;  4AED C;  5C3O A;  2C9K A;  5J48 A;  4Q2F A;  2QQP A;  4P9L A;  4E2Q A;  1BLZ A;  4Y4Y A;  5FZ8 A;  3PJQ A;  3AL5 A;  1CAW B;  5DMY A;  5LBE A;  3SEE A;  4WVM B;  1UY0 A;  4UF0 A;  2Y0I A;  1A3K A;  4CP9 B;  1NE4 A;  3OUI A;  5FMO S;  1DG6 A;  3ACF A;  1OUS A;  1OT5 A;  4IER A;  4XUR A;  1IQD C;  2D43 A;  3HOB A;  4MET A;  4F83 A;  1IS3 A;  1OUX A;  4QB6 A;  1MS1 A;  4QKN A;  1UCX A;  2V73 A;  2QZ2 A;  4I02 A;  4QQL A;  3C8X A;  4LO8 A;  2OT7 A;  3RJ2 X;  3WIN E;  1NG0 A;  1LOF A;  2VZT A;  5FWJ A;  2YDE A;  1D4M 2;  2Z69 A;  3D8C A;  4H14 A;  4ATF A;  1JZ4 A;  4BB3 A;  1UYX A;  5FYH A;  5SV8 A;  4DY3 A;  4YGC A;  3U14 A;  3VUO A;  1D4M 1;  2VOX A;  4CP1 A;  1HXS 3;  3K4D A;  3T2P A;  1W8O A;  2XUM A;  4LHL A;  4YM3 A;  2G1M A;  2WZR 3;  1TQ5 A;  3T1L A;  1W0O A;  2FMY A;  2KD7 A;  5GZF A;  2YGL A;  1W39 A;  4IEZ A;  3T08 A;  1QOO A;  1UPI A;  2CGP A;  1SPP A;  3VB9 A;  1O5L A;  1VP6 A;  4WM8 A;  3CF6 E;  5EJ1 B;  4CDQ A;  2A7A A;  5A7Q A;  3I2J A;  1NLS A;  1UYP A;  4JTO A;  4JGY A;  2Z5W A;  4RR3 B;  1RMU 3;  4XCA A;  1CAV A;  2IUW A;  2VGD A;  3MPB A;  2P3Y A;  4O9E A;  4EZ4 A;  1H6Y A;  5FK7 A;  3VBO A;  3VBH C;  4AFC A;  5BNO A;  1L7Q A;  2V4V A;  5HPO A;  2RDQ A;  3NNF A;  2HEY F;  2IXL A;  5L36 A;  5J1X A;  4ZKT B;  1TME 2;  3N7L A;  3VZL A;  5IK7 A;  2PN5 A;  1CAU A;  5DAP A;  2BTV C;  4UI9 L;  1TME 1;  3EYP A;  4AFB A;  4DIQ A;  2W2I A;  4XE9 A;  4BQ2 A;  2CSG A;  2RMU 1;  3BOD A;  1CGP A;  1AYN 2;  3AX4 A;  2YU2 A;  5FFO C;  3TYJ A;  3VDC A;  2VNG A;  3PU8 A;  5CIS A;  2B4K A;  2ZGT A;  5FRE A;  2GMM A;  4GA9 A;  1IS6 A;  1OLM E;  2ZKL A;  3MW2 A;  1ZZB A;  5BNN B;  1IG0 A;  1MVE A;  4Q4Y 1;  3TEX A;  2ADD A;  3ZN6 A;  3DEC A;  2EXK A;  2LUW A;  3DN7 A;  1DQ5 A;  1VBE 1;  1POV 0;  5FYI A;  3ZIW A;  4OLL A;  2D6K A;  4NHX A;  4CCD A;  4BQ1 A;  1A78 A;  4XW3 A;  4LA3 A;  4UWD A;  1BEV 3;  1COV 2;  4P08 A;  5H9R A;  4CXW A;  2CWM A;  1COV 1;  4K6B A;  4BIO A;  3M4F A;  4YG6 A;  4TN7 A;  2GAU A;  2GAL A;  4DZG A;  2X05 A;  3WF3 A;  1LCL A;  2WII B;  2RS5 2;  5SV5 A;  1BK1 A;  3VBS A;  1OSG A;  1GP5 A;  4QX1 A;  1WW4 A;  2YC4 A;  3WNP A;  4KNC A;  2GP3 A;  5IJR A;  3UT0 A;  3ZN4 A;  4NPM A;  4OHZ A;  3H3L A;  1MS4 A;  1XJA A;  3R4S A;  2OQ7 A;  4XXP A;  3N4M A;  2W1W A;  2VNO A;  5DAQ A;  3CBN A;  4ARX A;  4IE7 A;  3WV6 A;  3WNM A;  5F5C A;  2FZ2 A;  5A3M A;  2JE7 A;  1OKO A;  2YYO A;  2FDJ A;  4NE9 A;  4HET A;  4FPK A;  4KBZ A;  1R1A 3;  1O8P A;  3ZXK A;  2WUH A;  3MDP A;  1FI2 A;  4EN7 B;  3SEP A;  3D5O A;  4Y1X A;  3THD A;  5A3W A;  2RDN A;  3F2Z A;  3BVC A;  4Q8K A;  2UU8 A;  1T6G C;  2E31 A;  1SZB A;  2JEM A;  2Y26 A;  5DZG A;  1G8W A;  4HKL A;  4QQP A;  4YVS C;  3VKM A;  1W8Z A;  1NT0 A;  2BJS A;  2HWF 3;  2MHF A;  2PEL A;  3I2D A;  2VQT A;  3K51 A;  4OCT A;  5BPX A;  3BTY A;  1Z7S 3;  2P17 A;  2R06 3;  3BOW A;  1R09 3;  1SBE A;  4Q4X 2;  2ZEY A;  4RQP A;  2HYK A;  1NZC A;  4ZXK A;  3DF0 A;  4XAA A;  4Q4X 1;  2OYZ A;  4CU7 A;  2HWB 1;  4PQQ A;  4AE2 A;  1XNC A;  3IAP A;  5K7P A;  4W65 A;  4OQ8 A;  4ASM B;  4M01 A;  1IQA A;  3ON7 A;  1YEW A;  1JOD A;  1LU1 A;  2VEC A;  3ROU A;  1HB1 A;  1YWK A;  4AHX A;  3DXU A;  4QPI A;  2AH2 A;  1W6O B;  4QKB A;  2WR9 A;  5C4W B;  1HLC A;  2EIB A;  1UQX A;  2JDU A;  4QPG C;  4C91 A;  5F3C A;  4K9S A;  1ALY A;  3WG2 A;  4XF9 A;  1CES A;  3JD7 2;  4O7X A;  1V00 A;  3TRS B;  1JW6 A;  1UO9 A;  2EXH A;  5I0D A;  1NKG A;  2QFE A;  1QOT A;  1LHO A;  1PM7 A;  4V2W A;  2OKX A;  1VAM A;  2HBT A;  4WZC A;  4IEW A;  5F3E A;  1PZ8 A;  5C8C A;  4EWD A;  3VBU A;  1QJU 3;  5ABJ B;  2NZ9 A;  2OZJ A;  4TTG A;  1CWP A;  3SH5 A;  4N9H A;  3IIA A;  1DQ0 A;  3POF A;  1SCR A;  3B02 A;  4FXK B;  2Q8D A;  1RUD 3;  2DF7 A;  3NNL A;  5FZ7 A;  4O61 A;  4TLG A;  1JOJ A;  2A6W A;  3WR0 A;  3NRU A;  3E97 A;  4LK6 A;  2VY0 A;  1NCQ C;  2BDR A;  2J1T A;  2JG9 A;  1RIR A;  1LHW A;  2JD9 A;  5T55 A;  3CHX A;  3VBF B;  3ZLI A;  3KB5 A;  2ILM A;  4L11 A;  1IPJ A;  1REE A;  3K75 B;  1OD5 A;  1PZ9 A;  4BOW A;  1UNB A;  4FPE A;  5A6X A;  4GWJ A;  4AFA A;  5LEK A;  2ZPX A;  2FBE A;  1RUC 3;  1HB2 A;  1W6N B;  2P3J A;  3C7E A;  4XQD A;  1C57 A;  2O0O A;  5K0U A;  3W58 A;  4XQ4 A;  5DUU A;  3GF6 A;  3BI3 A;  2O8O A;  2QQO A;  1X9T A;  5F2W A;  5GM0 A;  3JCI A;  1RHI 3;  1ULP A;  2F6B A;  3URF A;  1AR8 2;  1X8E A;  2HJI A;  4QHO A;  3J7L A;  2WT2 A;  4Q4V 2;  1AR8 1;  4UT5 A;  2CAV A;  5LZ6 A;  2BVB A;  4WM7 B;  5LY1 A;  4Q4V 1;  3LDR A;  4DRR A;  3AKP A;  2H0B A;  4P9W A;  2VZP A;  4K8F A;  1YHF A;  2HKX A;  3P6B A;  3VKF C;  2DDU A;  2XKP A;  5FUP A;  4COV A;  1WLC A;  2FMD A;  1ZZ7 A;  3KF5 A;  5KHH A;  1YI9 A;  2B7Y A;  4NHK A;  5A33 A;  5ERL A;  4IEX A;  1QY4 A;  2E51 A;  5F37 A;  3N9P A;  1NA1 B;  3ZXF A;  5BY5 A;  1QNW A;  1ACC A;  3ZFE B;  3MYX A;  4FPH A;  4XUQ A;  5AFE A;  1X82 A;  2CU5 A;  1KFU L;  1RUE 3;  1V6N A;  2HWC 2;  2ZA9 A;  4JQT A;  5EFU A;  1QDO A;  2CDO A;  4UF0 B;  4BQY A;  5CAZ A;  2HWC 1;  4D7Y A;  4R8H A;  4HVR A;  4YGB A;  1YLL A;  3LA2 A;  4QKF A;  5KXB A;  2LTN A;  1QH6 A;  3OBR A;  1HJG A;  3M1H A;  4LBK A;  4QXB A;  2IZW A;  1Q43 A;  4HLT A;  4I0A A;  3VHP A;  5IHR A;  1JYX A;  1OC1 A;  5A7W A;  1AF9 A;  3H7J A;  5K9Y A;  3KV6 A;  3OBT A;  2XQR A;  1W05 A;  4BM8 A;  3LCP A;  1ND3 C;  5DDJ 3;  1J3R A;  1FAY A;  4GB3 3;  3NKG A;  1ZRC A;  2YV8 A;  4ZXE A;  2W08 A;  5FYV A;  2DV9 A;  1RXG A;  4XFB A;  4BIS A;  3U1X A;  2NMO A;  4QX0 A;  2OII A;  3RZM A;  4JKK A;  3LEI A;  1RUF 2;  3NV3 A;  4GMP 0;  4JRA A;  1SPP B;  4WM8 B;  2ZZQ A;  1RUF 1;  4CDQ B;  2RJ2 A;  1S2B A;  4LBJ A;  4Y3O A;  3WNN A;  4NO4 A;  3IWZ A;  4JGY B;  2EF6 A;  2Q8O A;  1EYB A;  1MVQ A;  3BGA A;  3O12 A;  1CAV B;  1H8T A;  5DAB A;  5LCW L;  1R08 1;  1R1A 2;  2RVA A;  3KHB A;  1AX0 A;  3OGV A;  4Q27 A;  4Q1R A;  4C0H A;  2ZAA A;  3KGZ A;  1PNF A;  1PIV 3;  4CDX A;  3S0M A;  1LGN A;  4GAL A;  3ZSK A;  3GJA A;  5IVC A;  1H9W A;  2BWC A;  1UKG A;  4EWA A;  4K1Z A;  1CAU B;  5CFD B;  1XXN A;  2GSY A;  2C4X A;  5HV0 A;  1JZ3 A;  3FLR A;  1AX1 A;  2YFU A;  4BPZ A;  2WQ4 A;  3QH7 A;  4GIQ A;  4PT6 A;  5IVJ A;  3HNB M;  4KU7 A;  2W1S A;  3MLL A;  3FX3 A;  4DXS A;  3SH3 A;  1BK0 A;  3MBW A;  1BVV A;  1POV 1;  4XVH A;  2UYB A;  2JKX A;  1JUI A;  4K20 A;  4AQ6 A;  1X8M A;  4HVQ A;  1DF0 A;  5JLV A;  5L73 A;  3ASI A;  3Q8C A;  5B4X A;  1HN1 A;  5ACA 2;  3MF6 A;  1AL0 G;  3ZOI A;  2JIJ A;  5ACA 1;  3MUZ 1;  1ZRE A;  2XBO 3;  5CFC A;  3ACG A;  4B3N A;  2Y8K A;  5D21 A;  1BBT 3;  4EQV A;  2OVU A;  3KM5 A;  1O3S A;  3ILF A;  1CJD A;  5D8A B;  3ZVX A;  3IPV B;  3KCX A;  2RS1 3;  1JN2 P;  4EN8 B;  2YBS A;  5FZC A;  2QNK A;  2DUR A;  2X10 A;  5FXZ A;  4XMI A;  1HN0 A;  1PZ7 A;  4BXS V;  3DGT A;  5HI0 A;  2GP5 A;  2VVE A;  2GC0 A;  1X36 A;  2CL2 A;  5JOW A;  4GKY A;  3BPZ A;  4PLM A;  1QJX 3;  2A6V A;  1VB4 A;  5EHD A;  1UD1 A;  2AR6 A;  3DEM A;  2BFU L;  1PGW 1;  1RUD 2;  2PHL A;  1HRV 2;  4GWN A;  2VOW A;  3WF2 A;  3ENR A;  4CTE A;  1HRV 1;  2JXA A;  5GLV A;  4AHW A;  2D6P A;  3WDV A;  1DYK A;  3GBW A;  3ZKU A;  2VQ0 A;  4FFH A;  1CN1 A;  1ZA4 A;  3THC A;  3WG1 A;  2JDA A;  3P5B A;  1N1V A;  1XQN A;  1EV1 1;  3N3H A;  3V0B A;  2XWJ B;  4S2F A;  3FHQ A;  4MOA A;  2BFU S;  3ETQ A;  2WYF A;  2RJK A;  3H3Z A;  4TYS A;  1FOD 3;  3J8F 2;  4HPK A;  4L8Q A;  4XZU G;  3S6P A;  4AG4 A;  5I8T A;  3ES4 A;  3J8F 1;  4YPJ A;  1WW6 A;  4BU2 A;  5JDB A;  3BUC A;  1JZ6 A;  4N9I A;  4GD4 A;  3HIF A;  2LRP A;  4CZS A;  3RI8 A;  2PFW A;  3OGS A;  3UET A;  3M3Q A;  1KQR A;  3WG4 A;  3NNM A;  3LKJ A;  1W8F A;  1H9P A;  4NHL A;  1SFP A;  3Q8B A;  4RQP B;  3ZDS A;  1K5M B;  5L7O A;  5FP3 A;  5B4N A;  5AVA A;  4COW A;  1K3I A;  4RFT 0;  2YMZ A;  5E8A A;  3WOG A;  4MGY E;  4MZU A;  3AZX A;  4BH9 A;  3H42 B;  4AVT A;  5TSW A;  1SLA A;  4FPG A;  1OFN A;  4RA0 A;  4DS0 A;  2EXI A;  4M3C F;  2AGS A;  1MZE A;  3IMN A;  4QPI B;  4LPL A;  3W5N A;  2BOJ A;  3ZDV A;  2MNG A;  3VKL A;  3TN9 3;  2JWP A;  4IV1 C;  4ERO A;  1ULE A;  2ZJC A;  1S55 A;  5FMO L;  1ND2 C;  1OXC A;  2JDP A;  2ATF A;  4LBQ A;  4CDU B;  2BQP A;  2OW4 A;  1EAH 2;  2WAA A;  3AB0 A;  4MX3 A;  2OPK A;  4ZON A;  4Z92 B;  2BGC A;  4Q0U A;  4IL7 A;  1EAH 1;  3T2O A;  1LEN A;  1VBD 2;  5JZG C;  4WM7 C;  4PCR A;  3ZXL A;  1H30 A;  3VBU B;  2IC1 A;  1VBD 1;  2EAK A;  2WO7 A;  1W8N A;  2YG0 A;  1POQ A;  3KVB A;  1FMD 3;  4LBM A;  5FY0 A;  5LBB A;  3WX5 A;  3FLT A;  2L9L A;  4I3P A;  4IE4 A;  1ULG A;  2X5I C;  4EN9 B;  3A0N A;  2XLF A;  3E6B A;  4A4A A;  3LFI A;  1XND A;  1FXZ A;  4XEZ A;  1ZM1 A;  2FCT A;  4N43 A;  1UZV A;  5FP8 A;  5A3P A;  4LTA A;  3B00 A;  3GCX A;  1QQP 3;  2XJU A;  4QX5 A;  4P9X A;  3ZFG B;  4R4X A;  3ZYJ B;  1LU2 A;  1NCR B;  1UU4 A;  4DUX A;  4NAM A;  3K4Z A;  1XU2 A;  4XXA A;  1DP0 A;  2G9Z A;  1BKZ A;  2PQQ A;  4IE6 A;  2R6Q A;  3NV4 A;  4AR2 A;  4AED B;  3I3M A;  4E4H A;  3VDA A;  3GM8 A;  2O8Q A;  1H2N A;  1UMI A;  5FOB B;  1GNH A;  3NV2 A;  5IUQ A;  3RRD A;  4ARY A;  4B8E A;  3MGU A;  2RS3 3;  5EWS A;  1LOF C;  1M4W A;  2KXL A;  4K8R B;  3I2I A;  2CYF A;  2ZGO A;  4FAH A;  2R04 3;  4C90 A;  1GMM A;  5FZ4 A;  4H3W A;  2BW8 A;  1VBA 2;  1J3P A;  1NUK A;  3LDB A;  5JMC A;  3AC0 A;  1VBA 1;  3WP4 A;  2WWS A;  2ZAH A;  3CL1 A;  2DVB A;  4XBQ A;  3AYD A;  1NXD 1;  2CWS A;  5FV3 A;  3WP5 A;  1V6J A;  2XR4 A;  4QPW A;  3MLK A;  4WM8 C;  4RHV 1;  4CDQ C;  2VXR A;  1W2U A;  2D98 A;  3POI A;  5A33 B;  4JGY C;  1QGL A;  1JHJ A;  3PTY A;  3JBG 2;  4H55 A;  4N8M A;  5B2G B;  1X50 A;  2RR1 2;  2CGN A;  5C3P A;  3VBO C;  3JBG 1;  5I8S A;  5BNO C;  2P3I A;  2RR1 1;  3AP9 A;  5FYZ A;  2A75 A;  4Y1Z A;  4M4P A;  1L3J A;  2VPV A;  3LFM A;  3R05 A;  4KH9 A;  4W6W A;  3AL6 A;  1EY2 A;  3O1P A;  1D4M 3;  3LZZ A;  5FXX A;  5G05 L;  4UW3 A;  1PVC 2;  4XUP A;  1G9B A;  1PMH X;  1W2N A;  2VBB A;  3UKN A;  4FTS A;  1PVC 1;  1LHU A;  3VBH B;  4A3Z A;  4DO0 A;  4OMC A;  3CJI A;  4UFJ A;  1RB8 G;  1SEF A;  2VC9 A;  1UX6 A;  3E6D A;  4UFL A;  4HK8 A;  1JYC A;  2LW8 A;  5CU1 A;  4EN6 B;  4EWE A;  2GNB A;  1CZT A;  3A7Q A;  5LBF A;  4GH4 A;  2RS1 2;  4XUT A;  5LAS A;  5JMO A;  3O1U A;  4P9Y A;  4GAZ A;  4GMP 1;  4MUV A;  3SKJ E;  2ZGQ A;  4LHN A;  5IFP A;  4KWJ A;  2IVI B;  3W20 A;  1F5J A;  3DXT A;  2Y6G A;  1TME 3;  1CON A;  2ZAB A;  4PI0 A;  3D3A A;  1AUY A;  3DPR A;  1RUH 1;  1NZI A;  3NVC A;  1ZRD A;  2RMU 3;  3VBS C;  2J42 A;  2YBK A;  4QX8 A;  4JV4 A;  4YW1 A;  2KA3 A;  3GJB A;  2JE9 A;  3ILR A;  4Q4Y 3;  4XJZ A;  5KHI A;  5CEH A;  1OVP A;  4TZD A;  2G4I A;  2GMP A;  1RXF A;  2D93 A;  1VBE 3;  1V6M A;  3HD8 B;  4IEV A;  3SKV A;  4RGA A;  3NL1 A;  3POB A;  4BHP A;  5CA6 A;  2PQS A;  1FNZ A;  4GJY A;  5FJH A;  4R9B A;  1S0F A;  1DQ2 A;  1PHM A;  5I0T A;  4AF9 A;  1YQC A;  2VUA A;  1Q8O A;  5FRA A;  3RSJ A;  2C5D A;  2A73 B;  1IKP A;  2AZ5 A;  1LGB A;  2Y34 A;  2YC2 A;  4JKL A;  4DXZ A;  4D94 A;  1COV 3;  3ZSE A;  1DGR N;  3EHK A;  5FPB A;  4NID A;  2BZD A;  2UWB A;  2FDK A;  3UJQ A;  1J1T A;  3LGR A;  2ZEW A;  4IET A;  5FXV A;  5E16 A;  3J7H A;  5FPL A;  4CCM A;  4ES9 A;  1GNZ A;  3FN9 A;  1UOG A;  3VZM A;  2WA4 A;  2GH8 A;  4QDS A;  4ZU5 A;  5CFC B;  4CCC A;  4FXG B;  4NIG A;  3LPG A;  1CIW A;  4JCK A;  3WNL A;  4RGG A;  4LOS A;  4ZZ8 A;  2DFC A;  1RED A;  4RQP C;  2QQL A;  3KCY A;  1ONA A;  3MW3 A;  4CUA A;  4I09 A;  1SLB A;  1OF3 A;  2D3P A;  5EYY A;  1Y7B A;  1YI7 A;  1C8N A;  3AKQ A;  3WG3 A;  2VE1 A;  4NII A;  1DHK B;  3N9N A;  1GV9 A;  5C33 A;  1LOE A;  3CEW A;  4QPI C;  3OD0 A;  1UY1 A;  3SC7 X;  3IKW A;  2JKB A;  1RJ8 A;  1DU3 D;  1OQD A;  1CD3 G;  2ZGR A;  4AGG A;  4NIH A;  4XFI A;  5JI7 A;  4B29 A;  4CDW A;  1CPN A;  5F2S A;  4ZHN A;  1O6U A;  2PHT A;  1UN1 A;  1AR7 2;  5EP9 A;  2XDV A;  4C8D A;  2SBA A;  1W03 A;  2GN3 A;  1OH3 A;  1AR7 1;  2OQ6 A;  4PIY A;  3O1S A;  5FKC A;  2JG8 A;  3V0B B;  2WYS A;  1KRI A;  1HRI 2;  4HSL A;  3CIH A;  1SLC A;  3PNA A;  4TSV A;  5C8C C;  3VBU C;  5F9T A;  1H2L A;  1SQ4 A;  2JD4 A;  2W87 A;  3ACH A;  1GQG A;  1HRI 1;  4IEO A;  2HWB 3;  4Q4X 3;  2B9U A;  4HPK B;  1UY4 A;  4E2G A;  4FCA A;  3ZKY A;  4AFM A;  4C1X A;  3H0O A;  2YFZ A;  3JU9 A;  4I0W B;  3RZH A;  4Y33 A;  4UXA A;  4BXF A;  2JG9 C;  3NAP A;  3I3B A;  1EUU A;  2XJQ A;  4Q4W 2;  1K12 A;  4CPB D;  3T09 A;  3V0A A;  3USU B;  1TEI A;  3OPZ A;  2JX9 A;  4Y22 A;  3VZK A;  3PVO A;  1AR9 2;  2ARC A;  2R16 A;  4BCU A;  4EYU A;  5C71 A;  5L7O B;  3MID A;  4MLO A;  1AR9 1;  1C28 A;  2RS3 2;  4XIO A;  3WP6 A;  3B69 A;  3PIG A;  3Q9O A;  2DVF A;  2EIG A;  5FZO A;  1X33 A;  1ZBA 2;  1NCQ B;  2R0F A;  1OH4 A;  2VG9 A;  1J59 A;  4AK3 A;  3EXU A;  3OUJ A;  1UMZ A;  1ZBA 1;  1YC6 1;  1PO2 2;  4YWA A;  4OI0 A;  1ZNP A;  1AJK A;  2IFW A;  2VNV A;  2VZ3 A;  2WA3 A;  1OUR A;  2ZGK A;  3LA7 A;  3PIJ A;  1KS5 A;  1PO2 1;  4Z1V A;  5K0U C;  1UU6 A;  2WO3 A;  3RZK A;  1K42 A;  3NJY A;  5D2A A;  3VD5 A;  1XNT A;  1AXZ A;  3P3N A;  1SAC A;  4LBQ B;  1VMJ A;  3HQX A;  2JE8 A;  3NW4 A;  1MS5 A;  2DCZ A;  4QM9 A;  1TZO A;  2ET7 A;  4YZ5 A;  4DIN B;  4MYE A;  2ZX2 A;  3PHM A;  5A32 B;  2QQV A;  2WBK A;  1REF A;  2LM3 A;  4HT1 T;  1LGC A;  2N7G A;  3V56 A;  1OPO A;  2VO5 A;  1LOD A;  4NMI A;  3LIH A;  2FDF A;  5JAX A;  1OF4 A;  3SXW A;  3RYK A;  5FO9 B;  4HAN A;  2WZ8 A;  4LIV A;  2D5F A;  5JSP A;  3QAC A;  3GZA A;  1AL2 1;  5FZL A;  2VXJ A;  4IXL A;  1I9R A;  4LA2 A;  4OZX A;  3GZT B;  1SBF A;  4QXC A;  3PUI A;  4RYD A;  2D7F A;  1UZY A;  4KG0 A;  1X9P A;  3CO2 A;  2ZGL A;  2VME A;  3PVE A;  5FY7 A;  3POG A;  4UFH A;  2VZR A;  5FOJ B;  4LKF A;  4BLJ A;  3OBZ A;  4AI1 A;  4QXH A;  2A3Y A;  2A3W A;  5LA1 A;  1V6I A;  1D2Q A;  1KJL A;  3ZYB A;  1AR8 3;  5DG2 A;  4AEK A;  1U5Y A;  2VBD A;  3ZYF A;  4A2U A;  1IZ3 A;  1GQP A;  4Q4V 3;  5FJK A;  4AGV A;  5FLI A;  2IXI A;  2PHR A;  2YBP A;  4UBH A;  4KMQ A;  3K3O A;  4LE4 A;  1UZ0 A;  5A7N A;  3ZYI B;  2WO2 A;  1CX1 A;  1T2X A;  2WKK A;  5FYC A;  2E6V A;  4FFF A;  1LES A;  2BGO A;  1Z78 A;  2DVG A;  5FZD A;  1GZT A;  4UW5 A;  1J83 A;  4RN5 A;  1OOP A;  1O4Z A;  3WUD A;  4OVE A;  2RMU 2;  3EO6 A;  4AI0 A;  4MGI E;  4BQX A;  5F8P A;  5EXO A;  4WZF A;  4YVW A;  1PVX A;  2Q1Z B;  5CVR A;  2FDI A;  1YFY A;  2Y6H A;  2HWC 3;  3TNQ A;  2QTW B;  2Y6J A;  4Q4Y 2;  1QH7 A;  5FPV A;  3KS7 A;  4KGG A;  2HBU A;  1ND3 B;  2P34 A;  5CG8 A;  3WDT A;  1WD3 A;  1F35 A;  3ZXD A;  1Q5O A;  1VBE 2;  2AEY A;  4Y1U A;  3TWI A;  3W5M A;  3N7J A;  5LY2 A;  3VGI A;  1XPW A;  1H8T C;  4ZPI A;  2VUL A;  5FY5 A;  5K8S A;  1E57 A;  1JBC A;  3IDB B;  3SH4 A;  1LKN A;  1NXM A;  1WA4 A;  5KC5 A;  5DQ0 A;  1J84 A;  4Q0Q A;  4QWN A;  4CDX C;  2VCC A;  4LUM A;  4N7U A;  3RNS A;  3APB A;  3BCW A;  2D6O X;  3AZW A;  3VHN A;  3ACL A;  3JQW A;  5I8Y A;  3RWN A;  1LOB A;  2PMW B;  3OJB A;  5LRR A;  4XBL A;  3OB8 A;  4J1W A;  4CSW A;  5C3S A;  5KXD A;  1RUG 1;  2VJX A;  5FYU A;  4W6Y A;  5J09 A;  2B9V A;  3R4U A;  5BV6 A;  3RZL A;  2D3R A;  3I59 B;  4MXW B;  3CJI B;  4ASL A;  1CAX A;  3OCP A;  4K1Y A;  4D7S A;  3IDC B;  1RUF 3;  2WFP A;  4PHZ A;  4CCO A;  3O0W A;  3J4U H;  3H8R A;  4A7Y A;  4GH4 B;  3I3D A;  1W0N A;  2VZO A;  2CV6 A;  4MO3 M;  1R08 3;  5KBF A;  1A8M A;  5FZE A;  4CUB A;  1S0B A;  1MS9 A;  5CFC C;  1S4C A;  4XF4 A;  4JC1 A;  1B35 A;  2ZX0 A;  2W5F A;  1QWR A;  3AK0 A;  4NJ4 A;  2PAE A;  1OLR A;  1N3P A;  3ZSM A;  2ZGM A;  2A1X A;  1MS0 A;  4PBP A;  4XIL A;  4G4F A;  1EUT A;  2WC2 A;  3GAL A;  1QJE A;  5FLJ A;  1LAJ A;  4FQ4 A;  4YZ3 A;  2ZMK A;  5CNA A;  4Y5T A;  2ZGS A;  5KXE A;  4YM0 A;  3PUR A;  2ID4 A;  2XPJ A;  1XSR A;  2I07 B;  1POV 3;  3U0Z A;  2CNA A;  2HWB 2;  4DUV A;  4AI3 A;  1S2K A;  4QX2 A;  2Q8C A;  1JZ7 A;  4YGD A;  5DAX A;  1LOC A;  4Y20 A;  5DUV A;  5JXG A;  3AYE A;  4CUC A;  2OPW A;  3WW4 A;  5ACA 3;  1DCS A;  1U0A A;  2EVX A;  2W91 A;  1N1S A;  4ET7 A;  1FT9 A;  1JXN A;  2E7T A;  2B39 A;  2NMN A;  1ULF A;  4PQ9 A;  4FP3 A;  4YFW A;  4PDW A;  4URT A;  5FYM A;  1RYY A;  2EID A;  4M0N A;  1W6P A;  3PUS A;  1LNS A;  1FYU A;  2VNR A;  1H2K A;  1G9A A;  3T0A A;  2Q1M A;  3VDD A;  1JOP A;  5JI9 A;  2GZW A;  3MIE A;  2B42 B;  4XFF A;  2WT1 A;  2VW1 A;  2CHH A;  2VH9 A;  2Y6F A;  5IVB A;  5L7O C;  3JB4 C;  1XBF A;  1UOF A;  2O14 A;  3O7O A;  3AFG A;  5CYY A;  1HRV 3;  1LEM A;  1LEC A;  4FPF A;  4HZF A;  5K4L A;  1UYZ A;  4BQ5 A;  2G9G A;  3IZO A;  2PLV 2;  1N47 A;  2HWD 2;  3C2U A;  4R4Z A;  3L2H A;  1EV1 3;  2PLV 1;  3RMX A;  2HWD 1;  1W2T A;  1RJ7 A;  3DCQ A;  5JOY A;  3NNJ A;  4OUS A;  2DU0 A;  1HX6 A;  4RSU A;  5FP7 A;  4CDW B;  5I0R A;  3QH6 A;  2ZEZ A;  1VLN A;  2RV9 A;  3T2Q A;  3J8F 3;  5FYB A;  3LEK A;  5IW0 A;  4LHS A;  4MHR A;  5T54 A;  5A1L A;  3EBR A;  1JYN A;  3AJY A;  5FQ0 A;  2NN8 A;  5FBZ A;  3USS A;  2WQ8 A;  5BUV A;  2WO1 A;  1BMV 2;  2JDK A;  3MIF A;  4UFK A;  2JG8 B;  1QOS A;  1BMV 1;  4AXO A;  5F3G A;  1PO1 2;  2YUE A;  3AFK A;  4BME A;  5C7G A;  2I45 A;  3HWJ A;  2A71 A;  1PO1 1;  4IV1 B;  5DZE A;  2VBP A;  1SMV A;  1ND2 B;  4D69 A;  1X7N A;  3AMN A;  3NAP B;  4YW7 A;  1KGY A;  4CEY A;  2AC1 A;  1O3R A;  1LOA A;  3AVS A;  2ZAC A;  1VBC 1;  4N43 C;  2F17 A;  5JZG B;  1UOB A;  2W94 A;  4FPC A;  5F32 A;  2V4A A;  1CX4 A;  2ZGN A;  2E7Q A;  5FMC A;  4QU1 A;  4AEJ A;  4XMA A;  1GOG A;  4RS5 A;  2HEV F;  3JZV A;  1A34 A;  5FZO B;  2BOI A;  2X5I B;  1EAH 3;  5IAX A;  2GME A;  1F9K A;  5FY8 A;  4W4Z A;  4WVZ A;  5E6H A;  3VLB B;  4O9G A;  1NLQ A;  3Q8F A;  5CAD A;  4Z8B A;  1SCS A;  1U5Z A;  1VBD 3;  1JS9 A;  1NE6 A;  3LAG A;  2ZCW A;  4LQR A;  2XVL A;  4LKS A;  4LKE A;  3M70 A;  4XFC A;  2HYX A;  3RGB A;  4NRO A;  4IDZ A;  5A3O A;  4QGN A;  3MV1 1;  1G6N A;  3WQ7 A; 
#chains in the Genus database with same CATH homology
 4QDR A;  3LQC A;  4TXW A;  2VZQ A;  3LEG A;  3C7O A;  2WAA A;  2VR4 A;  3T2O A;  3HNM A;  1WKY A;  2Y6K A;  3UES A;  2WN2 A;  1PMJ X;  1W8N A;  4OUE A;  2YG0 A;  1W9S A;  4QX3 A;  2EIC A;  3A22 A;  5G04 L;  2L9L A;  3OBA A;  3WEZ A;  4QB2 A;  3GGL A;  1UY2 A;  2J1U A;  4A4A A;  1NAE A;  2W92 A;  3K4A A;  3K46 A;  2VM9 A;  4GZ9 A;  3LPF A;  2ZEX A;  4DUX A;  4CU9 A;  2VL4 A;  3K4Z A;  3A23 A;  1DYO A;  1SG3 A;  4JX0 A;  1DP0 A;  2WN3 A;  2VZS A;  4MAD A;  3I2F A;  3VDA A;  3GM8 A;  1UMI A;  3HJR A;  5HXM A;  4ARY A;  4ZZ5 A;  2E32 A;  5DN2 A;  3I2I A;  3IDA A;  1GMM A;  2QBX A;  1TG7 A;  4MGQ A;  1NUK A;  3AC0 A;  5JR2 A;  1UYY A;  1JZ5 A;  1YQ2 A;  1CIY A;  2QQI A;  3I3E A;  1SHW B;  4QPW A;  4DXT A;  3PUH A;  5LA0 A;  3HPN A;  1JHJ A;  2W95 A;  3K77 A;  1GNY A;  3NQH A;  5C70 A;  2XOM A;  3MV0 1;  2C9K A;  4M4P A;  4JHZ A;  5DMY A;  2EIE A;  3C7H A;  3SEE A;  1UY0 A;  4PF1 A;  2DCJ A;  4KI5 M;  5JUV A;  3IB3 A;  3ACF A;  5G05 L;  4XUP A;  2CDP A;  1OT5 A;  4XUR A;  1IQD C;  1PMH X;  3HOB A;  4OMD A;  2VZU A;  4A3Z A;  4QB6 A;  1CZV A;  4OMC A;  2VC9 A;  2VQU A;  2LW8 A;  2XON A;  3C8X A;  3UNP A;  1CZT A;  3A7Q A;  4AAX A;  3VDB A;  4DUW A;  1GUI A;  2VZT A;  4XUT A;  5JMO A;  1I5P A;  1JZ4 A;  1UWW A;  1UYX A;  4KWU A;  5F7U A;  3K4D A;  3OEA A;  4UAP A;  3SKJ E;  3T2P A;  1W8O A;  5IFP A;  2KD7 A;  3I2K A;  2Y6G A;  1DLC A;  2ORZ A;  3T08 A;  1O8S A;  2WDB A;  4IUG A;  3D3A A;  4BDV B;  5EJ1 B;  3DYM A;  3I2J A;  3VD9 A;  4OYU A;  4E8C A;  1H6Y A;  1CZS A;  1PX3 A;  3MO4 A;  4W50 A;  1L7Q A;  2V4V A;  2QQK A;  5HPO A;  5J1X A;  1JYW A;  3I2H A;  1US2 A;  3SKV A;  2BGP A;  4UI9 L;  3EB7 A;  3EYP A;  5JXI A;  2PQS A;  2WAB A;  3VD4 A;  3MUY 1;  2YC2 A;  3VDC A;  4JKL A;  2B4K A;  3OEB A;  3CKH A;  2BZD A;  2VMD A;  2ZEW A;  2QQN A;  3DEC A;  1W9T A;  3J7H A;  3FN9 A;  1TVG A;  4QDS A;  3LPG A;  3GXU A;  3WNL A;  3HEI A;  2ORX A;  4ZZ8 A;  3A21 A;  1GU3 A;  2QQJ A;  2QQL A;  4CUA A;  4P08 A;  4MGS A;  1OF3 A;  3CMG A;  3CZU A;  2X05 A;  3WF3 A;  3IAQ A;  1UY1 A;  4QX1 A;  2YC4 A;  3WNP A;  5IJR A;  5JXJ A;  2BBA A;  3WQB A;  4A41 A;  2W1W A;  4ARX A;  3GDB A;  3WNM A;  3I97 A;  2WYS A;  2V5D A;  4P5Y A;  1O8P A;  2XQX A;  3CIH A;  2WUH A;  2W87 A;  5LA2 A;  3ACH A;  3T0D A;  3SEP A;  3THD A;  1UY4 A;  4QB1 A;  3F2Z A;  4BK5 A;  1MPX A;  4OZO A;  4A45 A;  2YFZ A;  5A1A A;  2E31 A;  3T0B A;  3I3B A;  1EUU A;  2BER A;  1K12 A;  3T09 A;  4JKM A;  1GOF A;  2VQT A;  2X09 A;  3III A;  4DEV A;  5C71 A;  4CU8 A;  4A44 A;  2ZEY A;  2J1S A;  3C7G A;  2C26 A;  4CU7 A;  4PQQ A;  3IAP A;  1OH4 A;  2VZ3 A;  5DPN A;  1US3 A;  2WO3 A;  5IFT A;  1K42 A;  3VD5 A;  1XNT A;  1XNA A;  2EIB A;  2JE8 A;  2VTF A;  1XC6 A;  5I0D A;  1W99 A;  1NKG A;  2WBK A;  2OKX A;  3LE0 A;  1F4H A;  3VD3 A;  2VO5 A;  4TTG A;  1OD3 A;  1SDD B;  1OF4 A;  3VD7 A;  2WZ8 A;  2W1Q A;  1JI6 A;  3NRU A;  2J1T A;  2J22 A;  2JD9 A;  3PUI A;  4RYD A;  4M4R A;  5IYY A;  2VME A;  3E1F 1;  4ZY9 A;  1GOH A;  2VZR A;  3K75 B;  4L0P A;  1UXX X;  1W9W A;  5LA1 A;  2VMC A;  4GWJ A;  2XHN A;  4DEQ A;  1GQP A;  3C7F A;  1JZ8 A;  4KMQ A;  3P1I A;  1UZ0 A;  3C7E A;  3I2G A;  2LS6 A;  2WO2 A;  1CX1 A;  1T2X A;  3BN6 A;  2QQO A;  2YB7 A;  2BGO A;  4A6O A;  2VMF A;  1J83 A;  4RN5 A;  4CU6 A;  1ULP A;  3ABZ A;  4Z2A A;  2V72 A;  3WF4 A;  4GWI A;  1WCQ A;  1UY3 A;  2Y6H A;  2VZP A;  2J1E A;  4QAW A;  2Y6J A;  3HNY M;  4XUN A;  2W47 A;  3P6B A;  2DDU A;  3JXS A;  4XUO A;  3W5M A;  1UX7 A;  1XPW A;  2VCB A;  4E8D A;  2VZV A;  4FI9 A;  1ULO A;  5DQ0 A;  1J84 A;  2W1U A;  4XUQ A;  2VCC A;  3OG2 A;  1KEX A;  2DCK A;  2QQM A;  4QDQ A;  4A42 A;  2CDO A;  1JU4 A;  1H6X A;  4HG6 B;  2WAO A;  2W46 A;  3OB8 A;  2VJX A;  5IHR A;  1JZ2 A;  2B9V A;  1JYX A;  3NJX A;  2Y64 A;  2VCA A;  3CQO A;  1L7R A;  2WZE A;  5JXH A;  3FHA A;  3I3D A;  1W0N A;  2VZO A;  4MO3 M;  4CUB A;  4ZXE A;  3FL7 A;  2J1R A;  1R64 A;  2Y6L A;  4QX0 A;  2W5F A;  4JKK A;  4BJ0 A;  2J7M A;  3LEI A;  2J1V A;  3OGR A;  3NNG A;  1EUT A;  2RJ2 A;  3WNN A;  3BGA A;  4UOJ A;  2VOT A;  5LCW L;  2ID4 A;  2RVA A;  3OGV A;  5CZK A;  1JYV A;  3ZM8 A;  4DUV A;  1NX9 A;  1JZ7 A;  4QX2 A;  4DXR A;  1P8J A;  5JXG A;  1JZ3 A;  2C4X A;  4CUC A;  2R7E B;  2YFU A;  2W91 A;  4ET7 A;  2W3J A;  3ECQ A;  3NJV A;  4PT6 A;  3HNB M;  2W1S A;  1JU3 A;  1RYY A;  4DXS A;  2EID A;  4CVU A;  3MBW A;  3WF0 A;  4XVH A;  1LNS A;  2JKX A;  4W8J A;  1UXZ A;  3T0A A;  3ETP A;  3WNO A;  3CDZ B;  2Z4F A;  3DYP A;  5B4X A;  1HN1 A;  5EIY B;  1O59 A;  3CZJ A;  3MUZ 1;  4P00 B;  3ACG A;  2Y8K A;  1UMH A;  5CYY A;  2E26 A;  1F4A A;  2E33 A;  3DYO A;  1UYZ A;  2X10 A;  4BXS V;  2ZEZ A;  2RV9 A;  3T2Q A;  3LEK A;  1BHG A;  2J1A A;  3WF1 A;  4LHS A;  1K45 A;  1JYN A;  3WF2 A;  2WQ8 A;  2WO1 A;  3THC A;  5C7G A;  2JDA A;  3ACI A;  5FUI A;  2HLE A;  4P02 B;  3FHQ A;  4MOA A;  3WSO A;  4AG4 A;  4XZU G;  1KGY A;  4D8M A;  4YPJ A;  1PX4 A;  1JZ6 A;  3HN3 A;  4BK4 A;  2W94 A;  3UET A;  3OGS A;  3U37 A;  2W9X A;  1GOG A;  5B4N A;  1K3I A;  2VZ1 A;  4W4Z A;  3WNK A;  2ZXQ A;  1D7P M;  4LQR A;  4LKS A;  4LPL A;  3W5N A;  2HYX A;  5EJZ B;  3MV1 1;  4D0Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...