4OUMA

Crystal structure of human caprin-2 c1q domain
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
132
structure length
132
Chain Sequence
MRVAFSAARTSNLAPGTLDQPIVFDLLLNNLGETFDLQLGRFNCPVNGTYVFIFHMLKLAVNVPLYVNLMKNEEVLVSAYANAGAPDHATASNHAILQLFQGDQIWLRLHRGAIYGSSWKYSTFSGYLLYQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural insights into the C1q domain of Caprin-2 in canonical Wnt signaling
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Caprin-2
total genus 30
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2014-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00386 C1q C1q domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4oumA00
3B93A 4D7YA 4TWTA 4QQOA 1DG6A 2QE3A 1IQAA 4MXWB 5TSWA 1C3HA 2HEYF 5L19A 3WD5A 1U5YA 2JG9C 3K48A 1OSGA 4QQLA 1PK6C 1JH5A 4E4DX 4MXVA 4KGQA 5L36A 2WNVA 3URFA 5BNQA 2WNVB 4F3JA 2RJKA 2HEWF 4QQ2A 1RJ7A 4MSVA 5HBAA 1S55A 1D2QA 1XU2A 4G4FA 4OUMA 2X29A 2WNUB 4HT1T 1XU1A 2E7AA 4G3YC 4GIQA 3IT8A 1U5ZA 1KXGA 1D0GA 1A8MA 2JG9B 2WNUA 1GR3A 1D4VB 1RJ8A 5KC5A 1C28A 3V56A 4E4SA 5KWRA 1TNFA 4N90A 1JTZX 1DU3D 2AZ5A 4TSVA 2QDNA 2TNFA 4J6GA 2JG8C 2R30A 3FC0A 2ZPXA 1TNRA 2KA3A 3QD6A 4KGGA 1OQDA 3LKJA 2RE9A 2TUNA 4QPYA 2OIIA 5KC6A 2O0OA 1I9RA 4RSUA 3ALQA 1U5XA 4KG8A 2Q1MA 2R6QA 2Z5WA 3B94A 3ME2A 4NN0A 4QQHA 2WNUC 2HEVF 3TWIA 2R32A 4DB5A 4MXWA 3B9IA 1O91A 3K51A 4QQPA 2Q8OA 1OQEA 2RJLA 4DOUA 1PK6A 2ZJCA 2JG8A 2WNVC 1ALYA 1KD7A 5CIRA 3AB0A 4OUSA 3L9JT 4OULA 3QBQA 1WCKA 3MI8A 3TYJA 2JG8B 4EN0A 2JG9A 1PK6B
chains in the Genus database with same CATH superfamily
3J4UH 4DRRA 4NIDA 5FY5A 1W8ZA 2UYBA 3WP5A 4FPKA 5FZOB 4NHKA 1E5HA 2R49A 1POV0 3L2HA 3ZFGB 3NKGA 4LPLA 3RWNA 3ZSEA 5F5AA 2KXLA 3GM8A 1ZRIA 4PLMA 2R061 1NCQC 5E1RA 1PVXA 3ZXJA 3N7MA 1TME1 4B7KA 1QJU1 3GHNA 4QPGB 3WD5A 1DLCA 4JGZC 2AH2A 5C3PA 2IXLA 5IAXA 3LA3A 4Q29A 2VBPA 1V6LA 1JH5A 2HJIA 2PHTA 2WDBA 5FYYA 1W28A 3POIA 1VRH1 2DU1A 1POV1 1WA6X 4GJYA 3ACIA 1NCQA 1O4TA 3VKLA 1MEC1 3ZFEB 1F8VA 4XURA 1TMF2 3URFA 4BQ4A 1RMU3 2VW2A 4FOVA 1LENA 1S0DA 5KHJA 2WNVB 3GNEA 1PNFA 2HEWF 4WZFA 2P6CA 2PHWA 2CL2A 1YNAA 4XF1A 1QDCA 3DYPA 3A22A 3BTZA 3PDQA 4QHBA 4XETA 3LPFA 4PT6A 4XFFA 4E2GA 1ZZ7A 2YBSA 4A4AA 1RUC2 2JDZA 1DGWA 2P1BA 1KJLA 4DY3A 1NQJA 4GIQA 3T09A 3DGTA 3BI3A 4YPJA 1ULGA 3HT2A 4BLJA 2E53A 2W1SA 2QVSB 3U78A 5H9RA 2GC1A 3WP3A 1DFQA 3AP7A 4CP2A 1OOPC 1C8M2 1NE4A 3PHMA 1A8MA 1OA3A 1YXWA 4IEWA 4YZ3A 1B35A 5FAXA 2VBBA 4WVMA 3LIHA 1LODA 3JD71 3LB9A 4FI9A 3ILNA 3POJA 3FL7A 3A4UA 5DG2A 2K9ZA 1PGL2 2FZ2A 3O1TA 1IKQA 1DU3D 3LAGA 4YW7A 5AFBA 2HBUA 1ASJ2 3D0SA 3O12A 4Y24A 2CDOA 1AR91 1DQ2A 4WM7B 3C3VA 5IVEA 1ND2A 2EF6A 1ZRCA 5DZFA 1QQP1 3THDA 1UXXX 4K6BA 2PHLA 2RS31 3N35A 4CCJA 1RB8G 4IEXA 1AR63 5EYXA 1O5UA 4EN6B 5FZ8A 5FP3A 4CCCA 3H3ZA 1RMU1 5JR7B 4YFWA 5FUPA 1J1LA 3I8TA 4FPGA 4RL7A 4Y1ZA 2IVIB 4CE8A 5I0TA 5J98B 2GH2A 3AKSA 4MGSA 1J58A 2JE9A 2G9ZA 2HWF1 1ACCA 1V0AA 4ET7A 4N9IA 5F7UA 3AYAA 4M01A 4JGYB 2ZX4A 3Q8AA 3O0VA 1HIXA 5FPAA 3I4IA 1JZ6A 1GNZA 2QQVA 3V0BB 3M3QA 4AXOA 4LHKA 4DNYA 1RYYA 2Y38A 2JB8A 3T4HB 4QD2A 1GUIA 2BTVC 2OX0A 4B7EA 3ZKYA 1JODA 2W95A 3U1XA 4UXAA 4HONA 4ONUA 3U10A 5H9SA 1WLTA 1FYUA 1CX4A 3MW3A 3LGRA 4KWUA 4N53C 1DDLA 5CADA 1GNYA 3JD73 5EIYB 1QY4A 1H30A 1QJX3 1G8WA 1SPPA 2UY8A 2W1UA 4MXWB 5FXZA 4AHYA 2EIBA 4CDQB 2FDIA 2JXAA 1HW5A 4BOWA 1JI6A 3JB4C 2BV4A 1MS5A 4FQZA 1UYYA 5GZCA 3H8RA 2NMOA 1HB3A 2C24A 2JWPA 1CESA 4XUPA 1QQP3 3NMBA 4FPYA 2BFUL 2OXBA 1BVVA 1POV3 5CVRA 3IIIA 3ZXFA 2PHXA 2RS33 3ZFFC 3UNPA 1CX1A 4QHOA 1X9TA 2RR12 2OW4A 2VY0A 3RYPA 3SEPA 4F3JA 3R05A 1LHUA 3JCIA 1IS3A 3MIBA 4Q4X2 5F32A 3OYWA 3SMHA 4GAZA 5CZKA 3PUAA 4COUA 5FZIA 3PUIA 5KXEA 3ACGA 1MS0A 2YC2A 5FP9A 3AXDA 2BNMA 4QU1A 2VECA 2HWD3 4MLOA 3UV9A 2DUOA 4PCRA 2WZR2 2VQUA 1ND2C 2YPDA 3M2MA 1JYTA 2FMDA 2ZGKA 3BN6A 3LD8A 1SCRA 4GMP0 2JDMA 2WYFA 2WNEA 5KBFA 1TMF3 5CBLA 1RUG3 4OVEA 5FZDA 3WY6A 5H9PA 5DAPA 1FNZA 4Q0SA 1W2TA 1OUSA 3WNXA 2VGDA 1W06A 2HWC1 3GZAA 3I59A 3WT3A 1ZVFA 2YROA 4Q1RA 4IERA 3WDWA 2VCBA 3T2QA 1VBB2 3E1F1 2ZX1A 4LA3A 4MHUA 1OH4A 4PF1A 5CB7A 4BHPA 5JXGA 3IB3A 3OYWB 3DV8A 4YWAA 4NHMA 1UYPA 2RDRA 4CCLA 4OQ9A 1HXS3 4B8EA 3DEMA 5IVJA 3PL0A 2YU2A 5C8WA 1EPWA 4GH4B 5A7QA 4JRLA 1V6MA 5FZ7A 2YDEA 2BERA 5LBBA 4LLOA 3TB0A 3ZFGC 2AR6A 4Y33A 2WFF2 2ORXA 3OSDA 1W8NA 4MX3A 4FPLA 3ACLA 3SCHA 3T2TA 3WHUA 5LEKA 2PHRA 3GBWA 1GZ9A 2NN8A 3O1RA 3JZVA 4M4RA 1UIJA 3N9LA 2ADEA 1DQ0A 1W3VA 3VGIA 4WVVA 3H8UA 4CUGA 1JYVA 2QQJA 1SLBA 1O8SA 2HEVF 2VXRA 4MG2A 2VMDA 2ZZQA 2R32A 4Y20B 4I02A 3W59A 3O1SA 2NQYA 2J42A 3OJBA 5C9AA 4BCUA 2HWF3 4CCDA 2RM23 1M4WA 1CONA 1VBC3 3GYDA 2R0FA 4EQVA 4A44A 4WM7A 4TZDA 2Y64A 2R062 3LDBA 3PUQA 4UFMA 2W92A 2WZPP 4YG6A 3D0JA 1HRI2 3KV4A 5CIRA 3QBQA 4LULA 2P34A 4XF4A 5I0DA 1PIV2 1V6NA 3AX4A 4GALA 4PDWA 3V0BA 3ZYPA 4RHV3 1E57A 5HV0A 1VRH2 3R6SA 1KDKA 3AMNA 5JXJA 2BOJA 2JX9A 3ENRA 3DYMA 3T0BA 4S2GA 3O7OA 4FOWA 5FXVA 2D6KA 3VBHA 1ZBA2 4RR3B 2X05A 2YV8A 5F9TA 1PO13 1QJY3 5L19A 2E31A 5I8SA 3WF3A 3I3MA 1ENSA 3AJYA 5APAA 2X09A 5FDBA 2XWBB 1CQ9A 2DUQA 3OUIA 1QKQA 1GYKA 3GJBA 3NV2A 1I3HA 1SEFA 3GZUC 4AZZA 4BMBA 5LY1A 5EFUA 2IUWA 1VBA2 3ASIA 5L36A 4AI0A 3PVEA 5DAXA 1O3RA 2WNVA 4AFAA 2HH9A 5FZ3A 2OYZA 3N9MA 1VBB1 1LOBA 4EWEA 5LCWL 1Y9GA 1SDWA 4LUKA 5JI9A 1OFSA 3FZ3A 3HN1A 1F5FA 1NX9A 5FPLA 2WAAA 3VZOA 3LIGA 4LOTA 4DRVA 5BY5A 1LOCA 3H0OA 4GWJA 4QKBA 1X8MA 3POEA 5LZ6A 1HB2A 4W6XA 4UT5A 1O3TA 1B35B 3A23A 2RDNA 2BOIA 4G3YC 5F3EA 5AFEA 2FBEA 1H1AA 5FBZA 4AW7A 1KS4A 4JGZA 3IT8A 5ACA2 3T08A 3RZGA 3RI8A 1L7QA 2MEV3 5FV3A 1C5HA 1TMF1 2NLRA 5IK8A 1RUG1 1AUYA 4C91A 4ASLA 1GZWB 1XE7A 2BFUS 4QT6A 1GBGA 4XPVA 3DYOA 5JPNB 3A0NA 3M4FA 2DTYA 2WNUA 2QQPA 4HK8A 3TRSB 2JB4A 1WBLA 5FZ9A 3H7YA 1Y9MA 4Y5Z0 1KGYA 1L7LA 2E7QA 2G4IA 4ZHNA 4DZGA 2X5IB 3KLSA 3R4SA 3ZXAC 5K0UA 5JCTA 1NOVA 4KI5M 3VHNA 4AHZA 5A3OA 4N53B 2BVVA 5F2WA 2FDJA 4DXSA 3IN9A 1PMJX 2PA7A 4OZOA 4BQ2A 2D98A 2YHJA 3D82A 3NV3A 3KZ4C 5IAVA 3WG2A 1W6NA 4EWAA 2J1AA 1OD3A 4OHVA 4A45A 4FBFA 5BV6A 1U12A 2RS12 4QXKA 5BNPC 2BBAA 4RSUA 4L97A 1K12A 1IKPA 1Q8SA 3OBRA 4LKEA 1GQHA 4NJ4A 3WW2A 2QJVA 1W2UA 4JHTA 1ZBA1 2YGLA 4KU7A 1WLCA 1FPN3 3HNMA 1J83A 1NLQA 4G9SB 2QFEA 4RQPA 4YW5A 3TWIA 1VBE1 1X7NA 4A3XA 4RD7A 3TEZA 4H14A 1WWYA 2WN2A 2Q8OA 5T5LA 1CJPA 3C7OA 1S0CA 4BZ4A 4BQWA 3ZYFA 3BKZA 4A3ZA 2VD7A 4BQYA 4KWJA 2HWD2 3AVSA 1QMJA 2ATFA 3A21A 3ES1A 1QNYA 4LLFA 3SCGA 5JPMB 3P6BA 3I7DA 2D6OX 1UU6A 4E27A 2VTFA 1ULDA 3K2OA 1DGRA 4COVA 4QDQA 5HPOA 3INAA 2QNKA 3SLIA 3ZXDA 1DBNA 5CAZA 5DDJ3 5ABJC 3OY8A 4AHWA 2WFPA 1URXA 4D7YA 2WT1A 5FP4A 2RR11 4MHRA 4D94A 2VUJA 5AC92 4COWA 2QQMA 5FPBA 3WCSA 1SQ4A 4Z8BA 1RUC1 1VMJA 3O0XA 2A1XA 3E5XA 1UPIA 5DUUA 4QX2A 3PMEA 4HKLA 2I2SA 2PQSA 3VBOA 2Z4FA 3ZXGA 3J7HA 2XQXA 1OURA 4Z07A 1AR83 3S5AA 4O9GA 1U5IA 3OB8A 3IIAA 3M3IA 4BB3A 2G9GA 4KBBA 2D6MA 4UFLA 1K5MC 5IVFA 1ND3C 2CGNA 1NY72 3NJXA 5DUVA 3WF2A 4ZU7A 4L8QA 4GH4C 3KWVA 2FMYA 5KR7A 4GKYA 1PZ7A 3HT1A 3I2JA 3VBOC 3VZJA 2V5DA 2JDPA 4ZU4A 2ZKNA 3J8F3 1NUKA 3ZIXA 2ZAHA 4JDNA 2J1UA 1OPMA 1FPN1 2J1VA 4KG0A 1ND3A 1RJ7A 1QNWA 3W20A 3ITQA 2HWC2 4C0HA 1RUI1 1DZTA 3CQOA 3SISA 3TNQA 4NRMA 3MIGA 3A7QA 4JDOA 4OLLA 5DAVA 4CDWB 5EXOA 5T5PA 2RM22 2VMCA 1MR5A 1VAKA 1V00A 2P6HA 4XF9A 3WW1A 4OZXA 3VBOB 1JS9A 2NZ9A 2VQ0A 4YVWA 5B4XA 5AC93 1N3PA 4MGTA 5T55A 3LEKA 4PBPA 2OA2A 1PNGA 2NYYA 2ZGTA 5LK5A 2A7AA 1ULOA 3ZDSA 2A6XA 1HRV2 4R9DA 5CU1A 4QB2A 3MF9A 4RHV2 1GR3A 3NNGA 2YGMA 2RR13 1N1VA 2WA4A 1R092 1IPSA 4RQPC 3WW3A 3I2DA 4AWDA 3OGRA 1NCRC 2WZR1 3WXPA 2VCAA 4LT5A 1AR71 1ENQA 1RUE1 4XZPA 4OYUA 4CDXA 2P3IA 1GP5A 3ZYGA 5JSOA 5IK4A 2D3PA 1S0FA 1XNBA 3LQCA 3ZYRA 2UU8A 3ZXKA 3O1UA 2HWE1 5T3NA 1LOFC 4R4XA 4AQSA 4XJZA 2UWAA 1NT0A 4J25A 4CU9A 5BNOC 3GXUA 4CDUB 4WV8A 3NVCA 1BEV3 2BVBA 4AQ6A 1TVGA 3NJZA 2E51A 5BUVA 4YYOA 2A6YA 2Q1ZB 4INDA 1D4M3 1W9SA 5GLUA 3DXUA 4DPNA 1UCXA 4O65A 3FHIB 4NHLA 4K8FA 1NZCA 1JN2P 1Q56A 2XR4A 3E97A 1K5JA 3WQ7A 5A6YA 2RMU2 2LRPA 1OQEA 4H7MA 1UNBA 1H1MA 3K3NA 2WNVC 2X5IA 5FZBA 2BW8A 1ODNA 4XFCA 2L9LA 4LOSA 4XMIA 2WN3A 2ZHKA 3UKTA 5K9YA 4EE2A 4NPMA 1ZZBA 4EN0A 1G9FA 4MV2A 2EIEA 5BNNB 4AFBA 1AJOA 1JBCA 1IPJA 5J48A 1EYBA 3UETA 2W1WA 1CIYA 2RDQA 2Y6FA 3EXUA 1CAVB 5KHKA 1RUNA 2OUJA 2PLV2 1GQGA 4M3CA 1OA4A 2HWB2 1DQ1A 4WVWA 5EWSA 4B4QA 3EB7A 1FOD3 3GJAA 3CMGA 3MUZ1 4HOOA 4FTSA 3AZXA 1GMMA 2J1RA 3ZYHA 4RS5A 2AC1A 4AEDB 4MADA 5F5QA 2Q0AA 1CWPA 4KWLA 3AZVA 1S2BA 3RZHA 1CAXA 3P5BA 4IXLA 1VRBA 1HV0A 4IV1A 4L0PA 4YM3A 2HWE3 3AP4A 1MZ5A 3RJ2X 3FE5A 3WNOA 4N53A 2VU9A 1CAWB 5FIXA 2IXJA 3CF6E 1N1SA 4N43C 2R041 5C4WB 4XUOA 2BJSA 1QJU2 4BM8A 3I49A 2ZXQA 3KS7A 3ZR5A 3USUA 1PX4A 4XXPA 4AVVA 1D0HA 1F35A 2OUHA 5A33B 2QDRA 4HT1T 4NIAA 4Q4W1 4GWNA 4FSJA 4NIIA 2VNOA 2OPWA 5A3NA 2ADDA 2XVLA 1KFUL 4OHWA 3H8OA 2G19A 2HLEA 3HBKA 3KT7A 1FAYA 4QXBA 1XPWA 3ZFFA 5JMCA 1YWKA 2W94A 4WM7C 1W2AX 1ZYBA 3NNJA 4BQ5A 3WF1A 2WR9A 3SHRA 1CGPA 2ZGUA 1X82A 4WZCA 3Q8BA 4YVSB 1YUDA 3GCWA 2VMGA 4MH0E 5FYUA 1VIWB 3IMNA 4N90A 3WF0A 1QJFA 1S0EA 1N47A 1LGBA 4P02B 1GWMA 2DVFA 5FMOL 1DGLA 3LSEA 3TEWA 3BPSA 4ORFA 3AZZA 4FP3A 1JZ3A 1PIV1 1HX6A 2FDGA 1TZOA 2JDYA 2Y33A 3B9CA 2WWJA 2RVAA 3OUJA 2Q8DA 3RYRA 2OIIA 3H3UA 3WQ1A 1HLCA 2VOKA 4V2WA 5LWBA 3LDRA 4XBQA 1U5XA 2WAOA 3B94A 4QWNA 3ZMNA 4NN0A 2VZTA 1RUF1 5GLVA 3F2ZA 2PFWA 4QX7A 1VBD2 2R043 4NPLA 4QMAA 3VBHB 4U2AA 3HEIA 3CZJA 5CA6A 3MW2A 5C8CC 1PO22 1AYM2 3VBRC 1V6JA 3PVOA 4QGNA 1OQ1A 1ZBE1 4RN5A 3EBRA 3HBZA 4KWKA 3AP5A 4MYEA 5BYNA 2BGCA 1UOGA 3POGA 1D7PM 2BWAA 3WDTA 4XEZA 2P5BA 3U11A 2WS91 3M7AA 4LXLA 3C7GA 1Q8QA 1H9WA 4NMIA 3E6CC 4ZY9A 4CEWB 3KCXA 1P8JA 3B7MA 4OULA 1F4HA 2PMWB 2W87A 2O1QA 4XCBA 5CKQA 2F17A 4QDSA 5A7PA 1LGNA 3KV6A 4CU7A 2A3XA 1BZWA 2VCMA 3C8XA 3FWEA 2D97A 4MGYE 3LFIA 2ID4A 3NAPC 4BDVB 5EJZB 2JE7A 1DG6A 4J1XA 4S2HA 4AR2A 1FPN2 5CG9A 5A3MA 4LBQB 1YFYA 2V4VA 5GZDA 4EYUA 3WUDA 5ERLA 2XVGA 3ACHA 3N9PA 5FY7A 2W9XA 4QQLA 1W90A 1Z7S1 1C1FA 2PAMA 1VB2A 1PK6C 3CJIA 3TEXA 3WQ0A 4E4DX 5D1IA 5IUQA 4LMFA 3VV1A 5A7OA 4DO0A 3SH4A 1XSRA 4I3PA 1OOPA 4FXKB 3HQUA 2A75A 4IGOA 1SFNA 1BMV1 5FZCA 2NPIA 4IGQA 4E2QA 1EV12 3POYA 1WMXA 5J7MA 2BUKA 1W6OB 4P9WA 1ZRRA 1UX7A 5A7SA 2FDHA 4Q4Y2 3ILRA 4LJHA 1D4M2 3WNPA 3CJIB 5EHDA 5CISA 2P3JA 1ZRFA 5FY9A 4Q4W3 2P37A 4M0NA 4NAOA 1XE8A 1GNHA 3B5LB 4YW1A 1VALA 3GBFA 1TE1B 4FFIA 2XVKA 1ULCA 4EWDA 4PQQA 1W2OA 2VZVA 2CV6A 3IWZA 1C8NA 1POQA 4FAGA 1RXFA 4FCAA 5LEJA 5E88A 4V1PA 1UYXA 3VD9A 3TEYA 2VTXA 4JKLA 4YM1A 3I2OA 2Q4SA 1VBD1 1JOBA 2W3JA 5FXWA 1RVF1 5I8YA 1X50A 4R9AA 1UZ0A 1EUTA 1UD1A 1JHNA 1F15A 2EICA 5DABA 4WM8B 1EUUA 3ELNA 1JOPA 2D43A 4K9SA 3Q8CA 3ZOIA 2ZGLA 2XLAA 1UZYA 4P9GA 4N9HA 5GZGA 2R7EB 2AGSA 3RMYA 4KGGA 1A3KA 1WLDA 2GH8A 2CGOA 1JUHA 2Y6JA 1HRV1 3ETPA 3ZPYA 5LA1A 4PF5A 4ZPIA 1W99A 4XW3A 4JHZA 5A3TA 5IK5A 1OHFA 2GP3A 1RUF3 4QX3A 1MZFA 2ZGNA 1ST8A 5DAQA 5B4NA 2IXIA 2QBXA 2ET7A 4QHZA 3HOBA 2QQWA 2FDKA 4P5HA 4XFAA 4IEUA 3KSCA 4FO9A 4S2DA 3IDBB 1SG3A 2HWE2 3M3CA 4UW5A 1YC61 4OUSA 1OKOA 3L9JT 1FV3A 4DUXA 1BMV2 3J7LA 3LA7A 4TYSA 4YVSA 4AOCA 4M3CE 4IEZA 4A42A 1LHVA 2Y0IA 1BKZA 4XACA 4KL1A 4JGYA 5FKCA 1H2MA 1V6OA 1PM4A 4IE0A 1LEMA 4D3WA 4JX0A 3O0WA 2W5FA 4AL9A 2WSUA 4OCTA 5FKBA 3MIFA 5LBEA 1N3OA 2LW8A 1W0PA 2ZX3A 5I93A 3ATGA 1Z7S3 1A8DA 1COV1 3DF0A 4UYBA 1NLSA 1SZBA 3OG2A 4D6SA 5HV4A 4GWIA 4M00A 4GMP1 2I74A 4KMQA 1W0OA 1ND2B 5FOBB 2V72A 3VN4A 4BQ3A 1ZA4A 5FPZA 1GFF2 5HCFA 3BPZA 2CAVA 2BP6A 2HWB1 1AR62 1JZ2A 2JECA 1I1EA 5FYVA 1RITA 4PLNA 2JD4A 4EN8B 1OPOA 3J7NA 3KT1A 4CSWA 3RDIA 1LULA 2A73B 2Y6GA 1HJGA 2PLV3 3JQXA 4AFCA 4RS5B 2QQNA 3SH3A 1OLME 4QPGA 2F6BA 5F3IA 4CPBD 1OFNA 5M0TA 3KT4A 4FQ4A 4XZUG 5LBCA 5C8CB 1GQPA 1XSQA 1R1A3 2WQ4A 3WVJA 2QZ2A 3SCFA 1RUH2 1CAVA 4Z82A 1D0GA 4XAEA 1XXNA 4BJ0A 5C3RA 1VBD3 2R042 4YG3A 5G04L 1GICA 3MGUA 4QPGC 5A33A 5JIUA 1M06G 3HMYA 2R1BA 4LHNA 2Y6LA 2DU0A 4RFRB 3USUB 5LRSA 1K5MB 2EIDA 1LOEA 4Q4W2 5J36A 2XJVA 1RL3A 2AZ5A 2CYFA 1NA1B 2RJ2A 3VDBA 4LO5B 1MVEA 2VUDA 5KHHA 1RUI2 2ZPXA 2JENA 3OUHA 4K40A 3QH7A 3PJYA 2D6PA 2ZABA 3PUSA 2HYKA 1IQDC 5L9RA 1FNYA 5I91A 5IFTA 5JDBA 2R071 1HN1A 2VZ3A 3LKJA 2JDUA 3ZN6A 4FPCA 4L11A 3AP6A 4FFFA 4RR3C 4GWMA 2E63A 1DQ4A 5F37A 5K0UC 2H6BA 4PDWC 4CDUA 3FFZA 2Y8KA 2YMZA 5JI7A 1LKNA 3LZZA 3VHRA 2WWUA 1RUD3 2B42B 3AYDA 1FATA 3N7KA 1KFXL 1W8TA 4Q0VA 1OBNA 4LKDA 4DB5A 3B9IA 3J8F2 1TEIA 5IJRA 5FPXA 3MIEA 5JR2A 5JXHA 3MF6A 2XWJB 1US3A 1SLCA 1DIWA 2SBAA 4DOUA 1PK6A 1IHMA 3MLJA 1H8TB 4CUCA 1AR93 1UN1A 1KEXA 2BPA2 1KD7A 2FDFA 3S7EA 4YZ5A 2PXJA 5K8SA 1GWLA 1LU1A 3SNMA 2SLIA 3NNFA 4C8DA 1UF2C 4H3WA 2ZAAA 2VM9A 5FWEA 5I0UA 2GMMA 3MI8A 4N8MA 1MQTA 1VR3A 3JXSA 1XBFA 1KS5A 2HYXA 1AYN3 2PHDA 3BALA 4FVVA 4HZFA 4P9XA 5T5OA 4LBLA 2YXSA 3W9AA 4ATFA 1S0JA 4ZS2A 4H7LA 2ZACA 4JRAA 1BJQA 5FYZA 5FP8A 4NRQA 4ZS3A 2QE3A 4YRDA 1IQAA 2WT2A 4IEVA 1C3HA 1EV11 5A7WA 3HPNA 1UXZA 4BMEA 4UFHA 2YG0A 4YNIA 4AQ2A 4LE3A 2GN3A 4DQAA 2LTNA 3NO8A 1COV3 4R9BA 1JZ4A 3KVBA 1YI7A 1QJEA 4GZ9A 4Q4V1 4EV0A 1JZ8A 5LK7B 2QCSB 5FMDA 3VL9A 1LOAA 2IVJA 4HXCA 1BBT3 3WOGA 4TTGA 3PIGA 4RFT0 4I30A 5LBFA 4AVBA 3ZVXA 1AX1A 1US2A 3MW4A 4QGMA 5FJKA 1AHSA 3AKQA 4KBZA 3N3HA 1Q43A 1XYPA 3MV01 4W8JA 2LM3A 2WYSA 1R083 3VUOA 4AEMA 4FXGB 3I54A 1YFWA 1RVF2 2E26A 2QTWB 1UOBA 2JE8A 4LIUA 3WR0A 2B45X 2X29A 1UY3A 2PLV1 1LGCA 3LCPA 3A0KA 4Q0QA 1J3QA 1UU4A 1LHOA 1SHWB 1UOFA 3AYCA 3CNAA 4QU2A 4Z2AA 2C26A 1JYWA 1JYCA 2GDFA 1UKGA 3BCWA 4CCMA 1R1A1 3ZO0B 3UJOA 3KD4A 2BDRA 1S2KA 1O59A 4C1WA 2IFWA 4YVWB 1H4HA 2W91A 3DPRA 4M4PA 5KXDA 5GLTA 3AMHA 2WWSA 2VNVA 5C3SA 5LB6A 4AI1A 5F6KA 1BK0A 1W9FA 4CDWA 3W5MA 1D4VB 1PO21 1SACA 1UZZA 3UESA 3UGFA 1ZBE2 4E4SA 4ISQA 3N7JA 1WMFA 1UY0A 2Y0OA 1YO8A 4MGIE 3VBUB 4XHXA 4EN7B 4DS0A 2QDNA 1J84A 4JC1A 2W2IA 2XLFA 4CEYB 5I0RA 4F8AA 2ARCA 1H2NA 5FFOC 2LUWA 4ZKTB 2B5HA 1ZZ8A 4OHZA 1YLLA 5CNAA 4GULA 4JZRA 5DZGA 4YLZA 3I2FA 1H0BA 4XCAA 4AYUA 4QPYA 1W2NA 4SLIA 1LNSA 1MACA 5A32B 4XFIA 2W47A 1GV9A 2ZMKA 1E5RA 1SLTA 2D40A 4FFGA 4QX1A 3UT0A 3IPVA 3EMRA 2GAUA 1B35C 1X36A 5DPNA 4YARA 2LROA 2B4KA 3WDXA 3ZN6B 2G9FA 4LBQD 5A7WB 2R16A 1MZEA 1REDA 1CZVA 2YPJA 4JTNA 1UYZA 4XXAA 1XB9A 1O91A 1DQ6A 3K51A 5FR3A 5IYYA 5FZGA 4Q4V2 3H50A 4XYXA 4Y5SA 1T6GC 2DCJA 1HXS1 3AKRA 4IE4A 5FLIA 1HV1A 3AFKA 4YM2A 4NAMA 2CY6A 3IBMA 5FYHA 5GLZA 1TME2 1MQTB 2D5FA 2XJQA 2GMEA 3M3EA 5FBJA 3UK9A 1NA1A 2CWMA 1QIQA 2C4XA 2YFZA 2ZHMA 2RG4A 4Y1UA 4D6QA 5B2GB 2VZQA 1JUIA 3ZX7A 1C1LA 1CIWA 1LR5A 3Q8FA 4BLIA 2BBVA 4QKDA 1MEC3 5ANQA 4W6WA 1AYN1 1O4ZA 2MEV2 2AEYA 5FXXA 2EXKA 2PN5A 2BGOA 3MHZA 4C1XA 4NIHA 5G05L 1YHFA 3POBA 3U14A 1RC6A 1AYM3 1GSLA 4D8MA 3CDZB 1MVQA 1ZZ9A 5TSWA 5C3QA 3ST7A 2KM2A 3ZYJB 5T52A 2VCCA 5C8CA 1VBC1 2AEZA 4DUWA 4Q4Y3 5JOWA 1U5YA 1UMHA 1YFXA 3MLKA 1UL9A 1LEDA 2YUEA 2ZX2A 4YW6A 4EZ4A 3VZNA 2XXZA 3LEGA 4E8CA 4Y1YA 4QDRA 4ZZ8A 1O4YA 3WX5A 1F4AA 3T1MA 2CSGA 3KM5A 1UIKA 1BVP1 3O1OA 1MS1A 3FX3A 3WDVA 2RS13 1ULFA 2WQZC 2ZOEB 4XFHA 2TBVA 2DCKA 1AL0G 2XKPA 2J1TA 1R081 1JXNA 4YFZA 4XMAA 3LF7A 1UW8A 1NCRA 4CP1A 4MSVA 4Y22B 2ARBA 1G86A 1OA2A 3RYKA 4IV1C 1OF3A 1XU2A 2WO1A 2WBKA 2XMLA 3O14A 4G4FA 2K0GA 5FQ0A 4LR4A 3D6EA 5A80A 3RFRA 3RVHA 4QPIA 5J96B 2H6CA 1W04A 1UWWA 2E7AA 1JOJA 3HJRA 3U75A 2LS6A 4M3CF 3AMPA 1Z0HA 2ZCWA 4XVHA 4CU6A 5CG8A 1V9U2 2VVFA 1VRH3 1Z7S2 1MPXA 4AF9A 5EJ1B 1NLRA 1J3RA 4XFBA 2R072 1AR61 4GKXA 2P4EA 3AYEA 1AVBA 5GZEA 3TNPB 4I2OA 3MO4A 5DMYA 4IV3C 2A5ZA 3C7FA 3BVCA 3HQRA 3MV11 3WNKA 2WRAA 3M8LA 1OLQA 3OCPA 1FOD2 4K1ZA 4AGGA 2XHKA 1XNDA 2D93A 2FCVA 5FZ0A 3EJKA 3T0AA 1QH7A 4LE4A 4HVQA 4LUMA 4HBNA 2PQQA 4Q4Y1 1REFA 2VVEA 5ANNA 2ZGSA 1PMIA 5F1RA 2DVDA 3GGLA 5FYIA 2YYOA 4N7IA 2E6VA 5IWFA 4EZHA 4YSFA 5CFCC 2QQIA 1OF4A 1WA4A 2O14A 2ZZJA 3ROUA 1I9RA 3ECQA 5T50A 3ZSKA 1EAH2 3JD72 4XQDA 4AK3A 1IS6A 1ZA7A 2Z5WA 3JB8A 4AFMA 1RUJ1 2VOXA 1ULEA 4D0QA 3EQEA 3N36A 1C5IA 5DUXA 1PGL1 5FYSA 2JICA 2XL7A 1HQWA 1IPKA 1RGSA 4AHXA 1Q8PA 2PHFA 2WQ8A 4OI4A 4M0HA 4UF0A 5D2AA 1A6CA 2XB6C 2C0ZA 5FUNA 2DDUA 5BPXA 3K77A 1ENXA 1NQDA 2DTWA 4GH4A 2XJTA 2Y26A 3NQHA 4ISRA 1V70A 4HVRA 1NAEA 3KCCA 1A78A 3H42B 3AB0A 4CUAA 3WINE 4QM8A 4ZU5A 4ATEA 4B3NA 3VBUC 3TYJA 4XJ8A 1R082 4D7TA 1AL22 3OD0A 4JQRA 2DF7A 3VKFC 1BYHA 2IXHA 1NZIA 3ZLIA 1AYM1 4JV4A 3I3BA 1VAMA 3HNBM 4MGQA 3ZDVA 5C9AB 4D7SA 5FPVA 1BK1A 1R64A 2XKOA 2YZ4A 5JVVA 5K7PA 3V0AB 3SKVA 1OKQA 3RPQA 3MPPG 3BTYA 1CR7A 4MO3M 1QJZA 3F95A 1QXPA 1OT5A 1WW5A 4JQTA 4Q1PA 3N9QA 3BOPA 3VZKA 1CAUA 2WZEA 4O61A 2ZGPA 1HRI3 2IXKA 4AQTA 3SQOA 1C57A 2K2SA 4AEKA 5JUVA 2GC3A 1AX2A 2EXIA 4K20A 3M70A 4MXVA 5F5IA 1MS9A 1RHI3 3K4ZA 1R1A2 1SLAA 1WW7A 3QLQA 1OH3A 4I01A 3VBRB 5DDJ1 3E5QA 5EQUA 2RJKA 3VBSC 2XBO3 1PGW2 1OOPB 4R8HA 3NWKA 5KHGA 1QJX1 5LATA 1DLLA 1BEV2 4A6SA 1MQTC 4L2NA 4XIKA 4XUTA 3WNLA 1DYKA 1Q8VA 2A71A 4K7JA 3G6JB 5C5TA 5FZ1A 4NO4A 2ET1A 2YU1A 3RSJA 4K3UA 3VZLA 4QX0A 4TXWA 3QH6A 3ZN5A 2GALA 2Z2SB 1KXGA 3NRUA 4HSLA 4XUNA 3GBGA 4AG4A 4TLFA 1W0NA 3W21A 1WW4A 3KGZA 3BU0A 5HXVA 3D5OA 5A6XA 4FTBA 2ENRA 2JEMA 2RHPA 2WFF1 3HD8B 3RZKA 3KVAA 5F39A 3VDAA 2WJSA 4F7ZA 1TQ5A 1RUH3 4A2UA 2UYAA 3KGLA 2ZGQA 1YJKA 3VDCA 3QACA 3ACFA 1OUXA 4Y4RA 3FBYA 4AEJA 3V56A 3VLBB 4BH9A 2XJRA 3IKWA 4CP9B 1LRHA 4CEWA 3AXEA 5LW9A 3FLPA 5ABJB 1UOJA 4K8RB 2BWCA 4XABA 3AK0A 5JWPA 1UY2A 1WBFA 2DVGA 3VBRA 4UBGA 2VJXA 3APBA 3MBWA 3BODA 5C9AC 1NG0A 4FPJA 4KH9A 3FLRA 2ZHLA 3KV9A 3O1MA 3OPTA 4RGGA 1W9WA 5K4LA 3ZXEA 4A7ZA 2XONA 2VNRA 1AL21 4XF0A 4JTOA 1TG7A 4Z2WA 1EY2A 3AP9A 1YJLA 1RUJ3 2DFBA 3WQBA 1RUH1 3AKPA 3D8CA 1OVPA 2GZWA 3S30A 2HWC3 3AZWA 4LO4B 2G1MA 3DCQA 2B39A 2OQ6A 2WUHA 3WV6A 4CTEA 3HIFA 4UW6A 1FI2A 5A6QA 1S1AA 3PU3A 4DXZA 3V0AA 4MXWA 1SPPB 1QOSA 4OMDA 1QJU3 1WCDJ 1PO11 1QJY1 1LAJA 5SV5A 5FZ4A 3MFCA 3I3EA 4LBKA 5BNPB 4CP0A 1G9AA 1UKRA 1NXMA 2DVBA 2JG8A 2FD8A 3V65A 1H9PA 1BHGA 1Y3TA 3CJIC 3BYWA 3P3PA 2H0BA 3UGGA 2DVAA 3KCYA 3DN7A 4IEPA 1W9YA 1IOAA 4HKWA 5DQ0A 3POFA 3Q8EA 2QQOA 1QU0A 3CBNA 1W05A 3MIDA 4XQWA 4Y3OA 5GLWA 3IMMA 4LQRA 4NE9A 1XE0A 2RS32 3MYXA 4HANA 3OTFA 4HETA 5L7OB 1UMIA 4Q26A 4CCEA 4J1WA 1SDDB 1VBB3 1W39A 3T1LA 2VW1A 4V2VA 4XILA 3ZFFB 4IEYA 4DFSA 5JSRA 3U0ZA 4QQOA 2WO2A 1DCSA 4UW3A 3TN92 1GOGA 4F83A 4PQ9A 3TAYA 5JZGA 2HEYF 2VUAA 2WNOA 1WGPA 4AAXA 5FMCA 1W8FA 4NROA 1HRI1 2V4AA 5FTTC 3KB5A 2GSYA 4QPIB 4A41A 2A3WA 4QGLA 1XC6A 3WHTA 3CHXA 2VZ1A 1XYNA 2J22A 1RHI1 3LE0A 2MEV1 1GOHA 5ACA1 1AL23 1NCRB 4ARXA 4RHV1 4ZZ5A 1Y4WA 1O3SA 5HI0A 4UWDA 2E9QA 1JW6A 2GC0A 1ULPA 2XBO1 3RI9A 2OQ7A 5A3WA 4HLTA 5CFCB 3NJYA 1H8TC 2YFUA 4CXWA 1EPZA 4EROA 3Q9OA 4CEWC 3KQRA 1RUD2 4QAWA 4PJYA 5FZLA 3AMQA 2A6VA 5FREA 4CXXA 1YI9A 4PLOA 5H9QA 3R4DB 5FLJA 3VHPA 4IUGA 2QQLA 2VO5A 2RV9A 2XLGA 3K75B 2WFF3 5L73A 3SH5A 1XNAA 4CCNA 5C4WC 1UX6A 5FZOA 1QH6A 1CVNA 4L9BA 2D3RA 5LASA 2JIJA 2DV9A 1H1IA 3CZUA 5BNNA 3FBMA 3P1IA 4QB6A 3NV1A 3I3QA 1EP0A 2E33A 2BNNA 1Q8OA 2JDKA 1C28A 1GU3A 1PO12 1QJY2 3ABZA 4IEOA 2C6SA 3OOXA 3OD4A 5CFDC 4Y22A 5KHIA 1UPSA 4XTMA 5JSPA 3GHMA 2CDPA 3GF6A 2XJSA 4FAHA 2WSVA 4UFKA 3VD7A 3BTXA 1CAWA 2WKKA 3ZM8A 4P9LA 5DN2A 5E16A 3MIHA 3VBSA 4HKOA 3ZFEA 2W68A 3QD6A 3T2PA 4IV1B 1B09A 4JKKA 1OQDA 5LRRA 4YGBA 4LA2A 1AYN2 3KQ4B 4HK9A 1CAXB 1XQNA 2ES3A 2B9UA 1I5PA 4IEQA 5AVPA 5ACA3 2HKXA 1QEXA 4MZUA 2BQPA 2Q1MA 3M1HA 4AEDA 4BXFA 4CDWC 3DPRC 3H1WA 3UJQA 1LECA 2MNGA 1APNA 4Y26A 4LK7A 4LHLA 1WKYA 3OBTA 4W4ZA 1XNCA 3CLPA 3VKOA 1RUC3 3H7JA 4MUVA 5FY1A 4LHSA 1XNTA 4W50A 4CDXC 4E9KA 3OGSA 3MICA 3AFGA 3PMSA 4HSJA 2F4LA 1GP6A 2ZEZA 1SFYA 1PMHX 5D8AB 1SFPA 2B7YA 2XGXA 1OI6A 4N7UA 3B01A 1W3XA 3IZOA 4X8NA 4YG0A 5JIAA 2P3YA 1OC1A 1ENRA 3JBG2 2XH6A 4AVCA 2YB7A 4WM8C 3SC7X 2XBO2 4QPIC 1NY71 4W65A 4B29A 5DAWA 3B93A 3OGVA 1VBE2 2H0VA 3RG0A 2X53S 3J8F1 3NNLA 3ZR6A 4EJRA 3RZJA 1JYNA 4Z92B 4S2FA 4OI1A 5A6ZA 4URTA 4Q0PA 5FZMA 3U4XA 1PGW1 2Y34A 4QM9A 4XF3A 4JKMA 1WUVA 3T4VA 1RXGA 2HWD1 3CKHA 3THTA 3KF5A 3WLUA 3FLTA 4JAAA 1WMEA 2JG9C 5FYBA 3IPVB 3WUCA 1OSGA 4ARYA 1LB2A 1BLZA 5LA9A 1YQ2A 5T54A 3BB6A 3PTYA 1HXS2 5AC91 2X5IC 2Q1FA 2Z69A 1DGWX 3FN9A 1V9U3 2A3YA 3AM2A 2WA3A 4AI9A 1WCQA 1KITA 1VMFA 4GQ7A 5FO9B 5BNQA 5CEHA 4CDXB 3PIJA 4RA0A 4BQXA 1S0IA 2IZWA 3WZ1A 3RQ0A 3KHBA 1GOFA 3U4SA 4Y5TA 1S55A 1HB4A 2BEOA 5CFDA 3UKNA 2CWSA 1UY1A 2VZUA 1HQLA 2JKXA 2VMIA 1DYOA 2EALA 2A6ZA 5FK7A 1LHNA 1Q5OA 3LA2A 5EPAA 1RUE2 4E4HA 3VDDB 3CEWA 4YZ4A 4NOTA 5FCCA 1OLRA 1W6PA 3UL2A 5SV8A 3C7HA 1IG0A 1CPMA 1QJX2 2JG9B 1EAH3 4XJUA 3S0MA 2E7TA 5E8AA 3GCXA 5DXDA 4C90A 5KC5A 4IE7A 3VKMA 3WF4A 2VE1A 2RM21 3VZMA 1BQPA 1ND3B 2ARXA 1W6QB 1STMA 1ZZCA 2R30A 3FC0A 4YM0A 1E5SA 1VB4A 2DCZA 1Q3EA 3FUQA 1Z78A 3JBG1 2YBPA 3UYJA 2RMU1 4CYDA 2VAUA 4U36A 5FZHA 2GU9A 2XDVA 3NNMA 4LKFA 4PHZA 1IS5A 3PVNA 2TUNA 1G9DA 1V9U1 4XAAA 4RQPB 3WCRA 4QX8A 1WD3A 2WINB 4B1LA 4LORA 3TN93 1H8VA 5FK8A 3VB9A 4L92A 3V64A 4BIFA 2EXJA 5IVYA 4CZSA 1AR72 2I45A 5A70A 2WZR3 1O6UA 3J26N 4QKFA 3PUHA 3DKQA 1RUE3 2YC4A 2DCYA 1FOD1 4OHYA 3VBSB 1V6IA 4YGEA 2W0XA 3OY8B 2W1QA 3D3AA 5JAXA 2VH9A 2VOWA 2ZJCA 4LBMA 4GXLA 5JLVA 2ZS6B 1J1TA 1UY4A 4DEVA 2O8OA 1UQXA 2OT7A 2VXJA 1SLIA 5FLHA 3GDBA 3IM0A 1H8TA 1RHI2 2VBDA 5D8AA 5L9BA 5CKNA 2BZDA 4OUMA 3WP4A 5C71A 4FOQA 4PIYA 4UAPA 1EAH1 1YEWA 5BXXA 1DQ5A 3BU7A 3KF3A 3OGGA 1D4M1 4BA6A 1JU3A 3SEEA 4LO7A 2GNDA 2VG9A 2PAEA 3I2IA 3S7IA 2J1EA 2R1DA 4TN7A 5F6LB 4YW4A 2EAKA 1Y43B 3WG3A 1AJKA 2VUCA 4I09A 1W6MA 4OHXA 1JZ5A 1UU5A 4R52A 5A1AA 3M3OA 2VC9A 3LDKA 1F31A 3O1VA 2TEPA 1JZ7A 4NWWA 4QX5A 1W8UA 3EYPA 4NUBA 1QHDA 1ZM1A 1W6NB 4MOAA 1H6XA 3ZSLA 4LITA 1S0BA 1MS4A 2J7MA 3LSDA 3TBDA 4A7YA 1AXYA 3MEPA 4GB32 1YQ6A 5GZFA 3CJXA 5HCAA 1PVC2 1JMUB 1SCSA 4FFHA 3TN91 5A3LA 1GANA 4XDPA 3GALA 3EHKA 3L2YA 4QQ2A 2O8QA 5EYYA 3E6DA 4LNVA 3O5SA 1VBC2 5AVAA 1AXKA 1UZVA 3LEIA 1J3PA 4Y1XA 4OQ8A 1D2QA 1YQ5A 4LO6B 4QXHA 1R093 5L7OC 2ZEYA 5C33A 2WNUB 4LBNA 2BGPA 1PZ8A 3WG1A 2CAUA 1GLHA 3POWA 1VP6A 1MS8A 5GM0A 3VBHC 1UO9A 2NMNA 4RGAA 3UKVA 1U5ZA 1GZWA 3THCA 1PIV3 3WW4A 4RR3A 2JDAA 3WNMA 5JZGB 3OBAA 4NVPA 5EJ3A 4FP2A 2GMPA 4UBHA 5FRAA 2ZGRA 4HN0A 4JGZB 1JU4A 4XJWA 3WG4A 4CRQA 1SLLA 1W8HA 1I6XA 1ZBA3 2VNGA 5FPUA 5L7OA 3HQXA 4XJ9A 3DL3A 4UFIA 4OI0A 3LOBA 2HWB3 1VBE3 2A6WA 2C9AA 3PVBB 5DDJ2 5F5CA 1JTZX 4JDMA 3WDYA 5CFCA 5FY0A 4H2AA 4B4PA 2P3KA 5FY8A 5LA0A 3B00A 1H4GA 2TNFA 2WL1A 4ASMB 2BYVE 3B69A 4COYA 3JBG3 5J09A 1FMD2 4H55A 4CUBA 2RMU3 4LBOA 3RZLA 1TNRA 2KA3A 2D7FA 1LTEA 2OZ6A 2WS93 2ZBJA 3CU7A 5LA2A 5JOXA 1IS4A 1YQ8A 1RINA 2W52A 2VL4A 2RE9A 3NAPB 1QDOA 1W03A 2Q30A 5GKAC 5D8AC 4AGRA 3VD4A 1BBT2 1F9KA 2WLQA 2UURA 2R6QA 1ZZ6A 3ALQA 5FY4A 1QOOA 4O7XA 4NHYA 5FP7A 4YGDA 5T5JA 1DGRN 1GKBA 2CU5A 1OD5A 2LALA 4PI0A 3T2OA 3ZSMA 1PGSA 1NXD1 3SITA 3AMMA 4BXSV 4A6OA 4A7KA 3USSA 1CJDA 1DHKB 2JDNA 3OBZA 4BK4A 1GWKA 1R091 4BIOA 3THPA 1QGLA 1QOTA 1AR81 2B9VA 4E4ZA 3AJZA 3NSTA 2N7GA 2OKXA 4NIGA 4PDWB 3VHOA 4N43B 4BK5A 3PU8A 4JCKA 2VZSA 4CP9A 4Q8KA 2R073 2MHFA 1RUJ2 2VTXJ 3G7DA 5J37A 3FHQA 2XHNA 3IDEA 2JG8B 3CIHA 1FX5A 1QXJA 1RUF2 1DZRA 2OPKA 5CKMA 1DF0A 4E2SA 2XL9A 5BNPA 2UWCA 3GZTB 2I07B 3BIWE 2DFCA 3E5UA 5F8PA 5IK7A 1ZREA 1CPNA 2PELA 5FJHA 3H1MA 4GD4A 3RWKX 5IVVA 1RUD1 2WIIB 1RUI3 4Y20A 4B1MA 5HCHA 1ZBE3 3H1YA 2DYCA 3U37A 2VMFA 2EAAA 3OEBA 2WS92 4AGVA 1JYIA 2GN7A 3K48A 4Q0UA 2AENA 1KQRA 1XNKA 3IDAA 4KNCA 4Q27A 2WO7A 3BTAA 1E5IA 1C8M1 1K3IA 3HNYM 1LESA 4K1YA 4QXCA 4YVSC 1FV2A 3MLLA 2OZJA 4L99A 3KHCA 1W6OA 4CEYC 4NRPA 2YBKA 1ODMA 1HDKA 1OMIA 4FPFA 1XRUA 3H8XA 4YGCA 1O7FA 5A7NA 2D44A 4AE2A 1HB1A 4WM8A 5DG1A 5FOJB 5ABJA 1CN1A 2PAKA 1SMVA 2JJ6A 5DUWA 4RGKA 4XIOA 1RIRA 5ISLA 1O3QA 1AR73 2FCUA 4I0BA 1AR92 2EVXA 2GP5A 3I59B 4OMCA 4XQ4A 5EZWA 1IZ3A 3IAPA 4YZ2A 5C6CA 1AXZA 4HFSA 3ZPOA 2IC1A 2D6NA 4DXRA 4WBBA 5JXIA 3PURA 4ES9A 1ONAA 2PYTA 4CCKA 2OVUA 1GZCA 2D5HA 4LEJA 1AX0A 3K4AA 2ZEXA 2DURA 3AZYA 1Y9QA 3ETQA 2XPJA 3HWJA 1J59A 4ZONA 3T0DA 1OXCA 2W46A 4IESA 3T30A 1LHWA 1BEV1 1MEC2 4XFGA 2P17A 1G9BA 3I2HA 3FHAA 1JHJA 1TNFA 2ZA9A 4HG6B 3MFAA 5C3OA 5IT6A 1XYOA 2QUOA 2RDSA 4NR1A 3RRDA 2E32A 3MZHA 2JD9A 4TSVA 4DXTA 1GP4A 4J6GA 2Z79A 4C0BA 4K21A 3KV5A 1PZ9A 4P00B 4YZ1A 2GNTA 4I0WB 2IXCA 3WDUA 2C5DA 3LWCA 2VQAA 4B4RA 4PIZA 3I2GA 3FJSA 1V6KA 1N1TA 3VKNA 4CDQC 1C8M3 1WD4A 4UF0B 1KRIA 4FOYA 3DUIA 4OI2A 4DEQA 2IWGB 2R0HA 4HL0A 4HMZA 1CAUB 1T6BX 2B8MA 1RVF3 3CL1A 3ME2A 1NE6A 4FPHA 2ETEA 4LBQA 2WNUC 3PLQA 5E6HA 4CDQA 3H3LA 1YFUA 3ILFA 5IATA 1W8WA 5C7GA 3NAPA 2Z42A 4QQPA 5F3CA 2WO3A 3AKTA 1WZXA 3K3OA 2RJLA 4D6RA 4BISA 5HCBA 1QF3A 1YIPA 4XHBA 5FMOS 3R0RA 4XDQA 5FUIA 2W39A 3JUUA 3RGBA 4DUVA 4P9YA 1ALYA 1S4CA 2F4PA 1HJFA 4BU2A 4BWOA 1F2NA 1HRV3 1WCKA 2WLPA 2ZMLA 2A70A 3E6BA 4LO8A 4N43A 4X6QB 5FZ6A 2WC2A 5IW0A 2MPFA 4WVMB 3UGHA 2D3SA 2VZOA 1VBA1 2OS2A 4URAA 4UFJA 2ZTNA 2ERFA 3JU9A 1YYNA 5A1FA 1H2LA 2VQTA 1PVC1 2V73A 5HXMA 3ORJA 1VMHA 1H6YA 1X9PA 4P08A 2EA7A 3NKTA 4R9CA 4FTEA 3C2UA 1UAIA 5IVCA 2HWF2 4BYYA 5FYCA 2FQPA 2RS52 2GNMA 2XUMA 5CYYA 3ZKUA 5FQ0B 4P9JA 3QOPA 4JVAA 1K45A 5F2SA 2QZ3A 2ZX0A 4PBOA 1REEA 5FYTA 2YC0A 4AVTA 4UI9L 1GZTA 4KGQA 1AF9A 3J7MA 2Y6HA 4FT8A 5GJ6A 3MDPA 1D2SA 1FT9A 2XJPA 4P9IA 5FO8B 2XQRA 3WNNA 1G9CA 1NA1C 5FZKA 5JMOA 4IDZA 4CXYA 2ZHNA 3VD5A 5L9VA 4Q8LA 4COZA 5FMBA 2CNAA 3BUCA 4ASKA 4P14A 3N9NA 5D21A 1QWRA 2VZRA 1UZWA 1BXHA 5FYMA 4XE9A 4KU8A 4CA9A 3WP6A 1ZRDA 1L3JA 1N3QA 3TOJA 2QQKA 1W8OA 4IQPA 4ZXEA 5BNNC 1S0GA 1NKGA 4ES8A 1VJ2A 3SKJE 1ASJ1 2B46X 1FMD1 4GMP3 4M3CB 4R4ZA 2UY9A 2PTMA 4MGZE 3ZFGA 2X10A 3LFMA 2D6LX 1VE0A 4Y1VA 4KQ7A 2DUPA 3RZMA 3AL6A 1WCSA 3PTRB 4XUQA 1LOGA 1DZQA 2RS11 3ZXLA 1VBA3 3OPZA 4D69A 4PI2A 1VLNA 3N4MA 1X8EA 1RMU2 4XTPA 4AEDC 4DINB 3LOIA 3ZYIB 3ZYBA 3PNAA 1OVSA 3B3QE 5C4WA 1Y7BA 2C1FA 2KR2A 3FUOA 4BE3A 2UWBA 2J1SA 3S6PA 2XUEA 3OPWA 3AVRA 4FPOB 2JIGA 4YVWC 2K46A 2KD7A 4EN9B 5FWJA 1AR82 1NCQB 4TLGA 2Y6KA 2ORZA 2CTVA 3VBFB 1MS3A 1SBFA 1ZX5A 4HPKB 3D4KA 5KC6A 4UOJA 1PM7A 4BPZA 5I8TA 4KG8A 1WLWA 4I3GA 4RS5C 1I5ZA 1T2XA 3OF1A 4AFDA 4SBVA 1OLMA 1W6MB 2QQUA 3IAQA 2VMEA 4LK6A 4CU8A 3QCWA 5JZGC 2P2KA 2AACA 2CHHA 3R4UA 3ZSJA 4AI8A 1LU2A 1G7YA 2FCTA 1SBDA 4IETA 4W6YA 3RJRA 3ZFEC 1MZ6A 4XOGA 3BIEA 1EV13 4XDOA 2RS51 4OFGA 1NYWA 2BNOA 1H2KA 2BU9A 1A34A 2XJUA 4E8DA 2WABA 3RZZA 1DYPA 4CEYA 4P5YA 4XC9A 5C5UA 5FZEA 1W6QA 1YRZA 2FZ1A 4LKSA 1ZNPA 1R1ZA 4CDUC 5EV7A 4AVSA 4QB1A 1ASJ3 1FMD3 3B02A 4XJAA 4CCOA 5A3PA 1S2EA 1RUOA 3HN3A 2Q8EA 5BNOA 1UMZA 5F3GA 3S5QA 4IL7A 3DXTA 4OUEA 4Q4X3 3POSA 3KMHA 2JG9A 4IW3A 3ZN4A 1FXZA 3VD3A 4AVAA 4WVZA 2ZEWA 1CD3G 4GB33 4TWTA 1WW6A 1PVC3 2VW0A 3DECA 3N9OA 1LJ7A 1HKDA 4LIVA 1N1YA 4MGKE 4AAPA 2HBTA 4ITCA 5EP9A 5FO7B 3VBFC 3VDDA 5IHRA 3RMXA 5IVBA 4XBNA 1TME3 2XOMA 3H9AA 4IV3B 4DIQA 5KXCA 1LCLA 3P3NA 4NWVA 5GALA 1F5JA 1RUG2 4Y4YA 2DWRA 5A32A 5CFDB 3AL5A 3LEMA 4GA9A 4CPBA 4I0AA 5C70A 3RNSA 2EIGA 1KJRA 2AYHA 4X8PA 2W08A 5JOZA 4UW4A 2JKBA 2PHUA 1W9TA 1JYXA 5JOYA 5J3UA 4YW3A 3ZIWA 4DMIA 1O5LA 4HVOA 1PHMA 5A1LA 4YW2A 3W5NA 2VMHA 4IE6A 1PO23 1YQCA 2X8KA 3VBUA 1IGOA 5HBAA 2ZGMA 2Y60A 1PX3A 3I97A 3W58A 5A3UA 4ZXKA 2CGPA 1SBEA 2XG3A 4Q2FA 3BGAA 2V09A 1K42A 3NL1A 2RS53 3J9SA 1VPHA 2FHRA 1XU1A 3I3DA 4QPWA 3WSOA 3NV4A 4AI3A 4Z1VA 4Q4V3 5LY2A 3DPRB 2WT0A 4X6RB 5I0SA 1W6PB 2ZGOA 4RYDA 2IFRA 1BBT1 2GC2A 3S57A 1COV2 1HN0A 4QKNA 3CO2A 1C4RA 3PJQA 4XBLA 2AUYA 5FZFA 4NPRA 4Q4X1 2ARAA 2NM1A 3HR9A 2NP0A 1RJ8A 3ON7A 4GB31 3JQWA 3AC0A 4META 2DCTA 1QXRA 5KWRA 5FZAA 2R063 3BOWA 4DY5A 2Q5TA 3RS6A 1LOFA 2YY1A 5E89A 3O1PA 2Q8CA 2VULA 4IE5A 2ZKLA 4LBJA 3ES4A 4LTAA 1IG3A 2JG8C 3LPGA 4Q5OA 1CZSA 3SXWA 3T3YA 2ILMA 3K4DA 4MVTA 2WZ8A 3WEZA 4HN1A 1X33A 3U07A 3N7LA 4PIXA 4JGYC 1DP0A 1L7RA 1RTVA 1YCIA 2VPVA 2VOVA 2O0OA 1CZTA 2VR4A 2ZMNA 5KXBA 4GJZA 3C7EA 3HVDA 3VL8A 1HQNA 3NW4A 3K46A 3HAGA 1KDMA 2DBNA 4IV3A 3I2KA 2C9KA 4QQHA 3OGJA 3MUY1 4HPKA 1XOYA 1BCXA 3NJVA 2EXHA 3VDDC 3VBFA 1VAVA 3X29B 1G6NA 2VVDA 2VZPA 2JDHA 3IDCB 1O8PA 1WCUA 3EO6A 3OEAA 1U0AA 2QKDA 4CVUA 5J1XA 4FPEA 1XJAA 1YIFA 2VOTA 3ZMOA 4BQ1A 2V5YA 4AI2A 5IFPA 5K0UB 5BNOB 3MPBA 1WMDA 1K5MA 2BRTA 3GZEA 3FFQA 2GNBA 5DZEA 4NHXA 1QQP2 4O9EA 3FMGA 3DKWA 2DBIA 4IGPA 1PK6B 1AZDA 2AREA
chains in the Genus database with same CATH topology
3J4UH 4DRRA 2UYBA 3WP5A 4FPKA 4NHKA 2R49A 1POV0 3L2HA 3ZFGB 3NKGA 3RWNA 3ZSEA 2KXLA 4PLMA 2R061 1NCQC 5E1RA 1PVXA 3ZXJA 3N7MA 1TME1 4B7KA 1QJU1 3GHNA 4QPGB 3WD5A 4JGZC 2AH2A 2IXLA 3LA3A 4Q29A 1V6LA 1JH5A 2HJIA 2PHTA 1VRH1 2DU1A 1POV1 1NCQA 1O4TA 1MEC1 3ZFEB 1F8VA 1TMF2 3URFA 1RMU3 2VW2A 4FOVA 1LENA 1S0DA 5KHJA 2WNVB 3GNEA 1PNFA 2HEWF 4WZFA 2PHWA 2CL2A 1YNAA 4XF1A 1QDCA 4XETA 4QHBA 4XFFA 4E2GA 1ZZ7A 1RUC2 2JDZA 1DGWA 1KJLA 4DY3A 1NQJA 4GIQA 3DGTA 1ULGA 3HT2A 4BLJA 2E53A 2QVSB 3WP3A 5H9RA 2GC1A 1DFQA 3AP7A 4CP2A 1OOPC 1C8M2 1NE4A 3PHMA 1A8MA 1OA3A 1YXWA 4IEWA 4YZ3A 1B35A 5FAXA 4WVMA 1LODA 3JD71 3LB9A 3ILNA 3A4UA 5DG2A 2K9ZA 1PGL2 2FZ2A 1IKQA 1DU3D 3LAGA 5AFBA 1ASJ2 3D0SA 3O12A 4Y24A 1AR91 1DQ2A 4WM7B 3C3VA 1ZRCA 1ND2A 2EF6A 5DZFA 1QQP1 4K6BA 2PHLA 2RS31 3N35A 1RB8G 4IEXA 1AR63 5EYXA 1O5UA 4EN6B 3H3ZA 1RMU1 5JR7B 4YFWA 1J1LA 3I8TA 4FPGA 4RL7A 4Y1ZA 5I0TA 5J98B 2GH2A 3AKSA 1J58A 2JE9A 2HWF1 4N9IA 3AYAA 4M01A 4JGYB 2ZX4A 3O0VA 1HIXA 3I4IA 1GNZA 3V0BB 3M3QA 4AXOA 4LHKA 4DNYA 2Y38A 4B7EA 4QD2A 2BTVC 4UXAA 4ONUA 3U10A 5H9SA 1WLTA 1FYUA 1CX4A 3MW3A 3LGRA 1DDLA 4N53C 5CADA 3JD73 1QY4A 1H30A 1QJX3 1G8WA 4MXWB 2UY8A 4AHYA 4CDQB 2JXAA 1HW5A 4BOWA 3JB4C 1MS5A 4FQZA 5GZCA 2NMOA 1CESA 1QQP3 4FPYA 2BFUL 5CVRA 1BVVA 1POV3 3ZXFA 2PHXA 2RS33 3ZFFC 2RR12 2OW4A 2VY0A 3RYPA 4F3JA 3R05A 1LHUA 3JCIA 1IS3A 3MIBA 4Q4X2 3OYWA 3SMHA 4COUA 5KXEA 1MS0A 3AXDA 2BNMA 2VECA 2HWD3 4MLOA 3UV9A 2DUOA 4PCRA 2WZR2 1ND2C 3M2MA 2FMDA 2ZGKA 4GMP0 1SCRA 2WNEA 5KBFA 1TMF3 5CBLA 1RUG3 4OVEA 3WY6A 5H9PA 1FNZA 4Q0SA 3WNXA 2VGDA 2HWC1 3GZAA 3I59A 3WT3A 1ZVFA 2YROA 4Q1RA 4IERA 3WDWA 1VBB2 2ZX1A 4LA3A 5CB7A 4BHPA 3OYWB 3DV8A 4NHMA 1HXS3 4B8EA 5C8WA 1EPWA 4GH4B 4JRLA 1V6MA 2YDEA 3TB0A 4LLOA 3ZFGC 2AR6A 2WFF2 4MX3A 4FPLA 3ACLA 3SCHA 3T2TA 3WHUA 5LEKA 2PHRA 3GBWA 1GZ9A 2NN8A 3JZVA 1UIJA 1DQ0A 3VGIA 4WVVA 3H8UA 1SLBA 2HEVF 2VXRA 2ZZQA 2R32A 4Y20B 4I02A 3W59A 2NQYA 3OJBA 5C9AA 4BCUA 2HWF3 2RM23 1M4WA 1CONA 1VBC3 3GYDA 2R0FA 4WM7A 4TZDA 2R062 2WZPP 4YG6A 3D0JA 1HRI2 5CIRA 3QBQA 4LULA 2P34A 4XF4A 1PIV2 1V6NA 3AX4A 4GALA 4PDWA 3V0BA 3ZYPA 4RHV3 1E57A 1VRH2 3R6SA 1KDKA 3AMNA 2JX9A 3ENRA 4S2GA 3O7OA 4FOWA 2D6KA 3VBHA 1ZBA2 4RR3B 5F9TA 2YV8A 1PO13 1QJY3 5L19A 5I8SA 1ENSA 3AJYA 5FDBA 2XWBB 1CQ9A 2DUQA 1QKQA 1GYKA 3NV2A 1I3HA 1SEFA 3GZUC 4BMBA 5EFUA 3ASIA 1VBA2 5L36A 4AI0A 3PVEA 1O3RA 2WNVA 4AFAA 2OYZA 1VBB1 1LOBA 4EWEA 1SDWA 4LUKA 5JI9A 1OFSA 3FZ3A 3HN1A 1F5FA 3VZOA 4DRVA 5BY5A 1LOCA 3H0OA 1X8MA 4W6XA 1O3TA 1B35B 4G3YC 5AFEA 2FBEA 1H1AA 5FBZA 4AW7A 1KS4A 4JGZA 3IT8A 5ACA2 3RI8A 2MEV3 1C5HA 1TMF1 2NLRA 5IK8A 1RUG1 1AUYA 4C91A 4ASLA 1GZWB 1XE7A 2BFUS 4QT6A 1GBGA 4XPVA 5JPNB 3A0NA 3M4FA 2DTYA 2WNUA 2QQPA 4HK8A 3TRSB 1WBLA 3H7YA 4Y5Z0 2E7QA 2G4IA 4DZGA 2X5IB 3KLSA 3R4SA 3ZXAC 5K0UA 5JCTA 1NOVA 3VHNA 4AHZA 4N53B 2BVVA 3IN9A 2PA7A 2D98A 2YHJA 3D82A 3NV3A 3KZ4C 3WG2A 1W6NA 4EWAA 4OHVA 5BV6A 4FBFA 1U12A 2RS12 4QXKA 5BNPC 4RSUA 4L97A 1Q8SA 1IKPA 3OBRA 3WW2A 1GQHA 2QJVA 1W2UA 1ZBA1 2YGLA 4KU7A 1WLCA 1FPN3 4G9SB 4RQPA 4YW5A 3TWIA 2QFEA 1VBE1 1X7NA 4A3XA 4RD7A 4H14A 2Q8OA 5T5LA 1CJPA 1S0CA 4BZ4A 4KWJA 2HWD2 1QMJA 2ATFA 3ES1A 4LLFA 1QNYA 3SCGA 5JPMB 3I7DA 2D6OX 1UU6A 4E27A 1ULDA 1DGRA 4COVA 3INAA 2QNKA 3SLIA 3ZXDA 1DBNA 5CAZA 5DDJ3 5ABJC 3OY8A 4AHWA 2WFPA 1URXA 4D7YA 2WT1A 2RR11 4D94A 2VUJA 4COWA 3WCSA 1SQ4A 4Z8BA 1RUC1 3O0XA 3E5XA 1UPIA 5DUUA 3PMEA 4HKLA 2I2SA 3VBOA 3ZXGA 4Z07A 1AR83 4O9GA 1U5IA 3IIAA 3M3IA 2G9GA 4KBBA 2D6MA 1K5MC 1ND3C 2CGNA 1NY72 5DUVA 4ZU7A 4L8QA 4GH4C 2FMYA 4GKYA 1PZ7A 3HT1A 3VBOC 3VZJA 4ZU4A 2ZKNA 3J8F3 3ZIXA 2ZAHA 4JDNA 1OPMA 1FPN1 4KG0A 1ND3A 1RJ7A 1QNWA 2HWC2 4C0HA 1RUI1 1DZTA 3SISA 3TNQA 3MIGA 4JDOA 4OLLA 4CDWB 5EXOA 5T5PA 2RM22 1MR5A 1VAKA 1V00A 4XF9A 3WW1A 4OZXA 3VBOB 2NZ9A 2VQ0A 4YVWA 5AC93 1N3PA 5T55A 4PBPA 2OA2A 1PNGA 2NYYA 2ZGTA 5LK5A 2A7AA 3ZDSA 2A6XA 1HRV2 4R9DA 5CU1A 3MF9A 4RHV2 1GR3A 2YGMA 2RR13 1N1VA 2WA4A 1R092 4RQPC 3WW3A 4AWDA 3I2DA 1NCRC 2WZR1 3WXPA 4LT5A 1AR71 1ENQA 1RUE1 4XZPA 4CDXA 2P3IA 3ZYGA 5JSOA 2D3PA 1S0FA 1XNBA 3ZYRA 2UU8A 3ZXKA 2HWE1 5T3NA 1LOFC 4R4XA 4AQSA 4XJZA 2UWAA 5BNOC 4CDUB 4WV8A 3NVCA 1BEV3 2BVBA 4AQ6A 3NJZA 2E51A 5BUVA 4YYOA 2A6YA 2Q1ZB 4INDA 1D4M3 4DPNA 5GLUA 1UCXA 3FHIB 4NHLA 4K8FA 1NZCA 1JN2P 1Q56A 3E97A 3WQ7A 2RMU2 1OQEA 4H7MA 1H1MA 2WNVC 2X5IA 2BW8A 4XFCA 4XMIA 5K9YA 2ZHKA 3UKTA 1ZZBA 4EN0A 1G9FA 4MV2A 5BNNB 4AFBA 1AJOA 1JBCA 1IPJA 5J48A 1EYBA 3EXUA 5KHKA 1CAVB 1RUNA 2OUJA 2PLV2 1GQGA 4M3CA 1OA4A 2HWB2 1DQ1A 4WVWA 5EWSA 4B4QA 1FOD3 4FTSA 3AZXA 4RS5A 4AEDB 5F5QA 2Q0AA 4KWLA 3AZVA 1S2BA 1CAXA 4IXLA 1HV0A 4IV1A 4YM3A 2HWE3 3AP4A 1MZ5A 3RJ2X 3FE5A 4N53A 2VU9A 1CAWB 2IXJA 3CF6E 1N1SA 4N43C 2R041 5C4WB 1QJU2 4BM8A 3KS7A 3USUA 4XXPA 4AVVA 1D0HA 2OUHA 5A33B 2QDRA 4HT1T 4Q4W1 4GWNA 4FSJA 2VNOA 2XVLA 1KFUL 4OHWA 3KT7A 1FAYA 5JMCA 3ZFFA 1YWKA 4WM7C 1ZYBA 3SHRA 1CGPA 2ZGUA 1X82A 4WZCA 4YVSB 1YUDA 2VMGA 4MH0E 1VIWB 3IMNA 4N90A 1S0EA 1N47A 1LGBA 2DVFA 5FMOL 1DGLA 3LSEA 4ORFA 3AZZA 4FP3A 1PIV1 1HX6A 3B9CA 3RYRA 2OIIA 3H3UA 3WQ1A 1HLCA 2VOKA 4XBQA 1U5XA 3B94A 3ZMNA 4NN0A 1RUF1 5GLVA 2PFWA 1VBD2 2R043 4QMAA 3VBHB 4U2AA 5CA6A 3MW2A 5C8CC 1PO22 1AYM2 3VBRC 1V6JA 3PVOA 4QGNA 1OQ1A 1ZBE1 3EBRA 3HBZA 4KWKA 3AP5A 4MYEA 5BYNA 2BGCA 3WDTA 2BWAA 4XEZA 3U11A 2WS91 3M7AA 1Q8QA 1H9WA 3E6CC 4CEWB 3KCXA 3B7MA 4OULA 2O1QA 1LGNA 2A3XA 1BZWA 3FWEA 2D97A 4MGYE 3NAPC 2JE7A 1DG6A 4J1XA 4S2HA 1FPN2 5CG9A 5A3MA 4LBQB 1YFYA 5GZDA 3WUDA 2XVGA 4QQLA 1Z7S1 1C1FA 2PAMA 1VB2A 1PK6C 3CJIA 3WQ0A 4E4DX 5D1IA 5IUQA 3VV1A 3SH4A 4I3PA 1OOPA 4FXKB 2A75A 1SFNA 1BMV1 2NPIA 4E2QA 1EV12 3POYA 5J7MA 2BUKA 1W6OB 4P9WA 1ZRRA 4Q4Y2 3ILRA 1D4M2 1ZRFA 3CJIB 2P3JA 4Q4W3 2P37A 4M0NA 1XE8A 1GNHA 3B5LB 4YW1A 1VALA 3GBFA 1TE1B 2XVKA 1ULCA 4EWDA 2CV6A 3IWZA 1C8NA 4FAGA 4FCAA 5LEJA 5E88A 4V1PA 4YM1A 2Q4SA 1VBD1 1RVF1 5I8YA 1X50A 4R9AA 1UD1A 1JHNA 4WM8B 3ELNA 2D43A 4K9SA 2ZGLA 2XLAA 1UZYA 4P9GA 4N9HA 5GZGA 2AGSA 3RMYA 4KGGA 1A3KA 1WLDA 2GH8A 2CGOA 1JUHA 1HRV1 3ZPYA 4PF5A 4XW3A 5IK5A 1OHFA 1RUF3 1MZFA 2ZGNA 2IXIA 2ET7A 4P5HA 4XFAA 4IEUA 3KSCA 4FO9A 4S2DA 3IDBB 2HWE2 3M3CA 4UW5A 4OUSA 3L9JT 1FV3A 1BMV2 3LA7A 4TYSA 4YVSA 4M3CE 4IEZA 1LHVA 2Y0IA 1BKZA 4KL1A 4JGYA 1H2MA 1V6OA 1LEMA 4D3WA 3O0WA 2WSUA 3MIFA 1N3OA 1W0PA 2ZX3A 5I93A 3ATGA 1Z7S3 1A8DA 1COV1 3DF0A 1NLSA 4M00A 4GMP1 2I74A 1W0OA 1ND2B 5FOBB 3VN4A 1ZA4A 5FPZA 1GFF2 5HCFA 3BPZA 2CAVA 2HWB1 1AR62 2JECA 1I1EA 1RITA 4PLNA 2JD4A 4EN8B 1OPOA 3KT1A 3RDIA 1LULA 2A73B 2PLV3 3JQXA 4AFCA 4RS5B 3SH3A 4QPGA 2F6BA 1OFNA 3KT4A 4FQ4A 5C8CB 2WQ4A 3WVJA 1R1A3 2QZ2A 3SCFA 1RUH2 1CAVA 4Z82A 1D0GA 1XXNA 1VBD3 2R042 4YG3A 1GICA 3MGUA 4QPGC 5A33A 5JIUA 1M06G 3HMYA 2R1BA 4LHNA 2DU0A 3USUB 5LRSA 1K5MB 1LOEA 4Q4W2 5J36A 2XJVA 1RL3A 2AZ5A 2CYFA 1NA1B 4LO5B 1MVEA 5KHHA 1RUI2 2ZPXA 2JENA 4K40A 3QH7A 3PJYA 2D6PA 2ZABA 2HYKA 1FNYA 5I91A 5JDBA 2R071 3LKJA 3ZN6A 4FPCA 4L11A 3AP6A 4RR3C 4GWMA 2E63A 1DQ4A 5K0UC 2H6BA 4PDWC 4CDUA 3FFZA 2YMZA 5JI7A 1LKNA 3LZZA 3VHRA 3N7KA 1RUD3 2B42B 3AYDA 1FATA 4Q0VA 1KFXL 5IK4A 4DB5A 3B9IA 3J8F2 1TEIA 5FPXA 3MIEA 3MF6A 2XWJB 1SLCA 1DIWA 2SBAA 4DOUA 1PK6A 1IHMA 3MLJA 1H8TB 1AR93 1UN1A 2BPA2 1KD7A 3S7EA 4YZ5A 5K8SA 1LU1A 3SNMA 2SLIA 1UF2C 4H3WA 2ZAAA 5I0UA 2GMMA 3MI8A 1MQTA 1VR3A 1KS5A 2PHDA 1AYN3 3BALA 4HZFA 4FVVA 4P9XA 5T5OA 4LBLA 2YXSA 3W9AA 4ATFA 1S0JA 4H7LA 2ZACA 4JRAA 1BJQA 2QE3A 4YRDA 1IQAA 2WT2A 4IEVA 1C3HA 1EV11 4BMEA 4YNIA 4AQ2A 4LE3A 2GN3A 4DQAA 2LTNA 3NO8A 1COV3 4R9BA 1YI7A 4Q4V1 4EV0A 5LK7B 2QCSB 3VL9A 1LOAA 3WOGA 1BBT3 4RFT0 4I30A 4AVBA 3ZVXA 1AX1A 3MW4A 4QGMA 1AHSA 3AKQA 3N3HA 1Q43A 1XYPA 2LM3A 1R083 3VUOA 4AEMA 4FXGB 3I54A 1YFWA 1RVF2 3WR0A 2B45X 2X29A 2PLV1 3LCPA 1LGCA 3A0KA 4Q0QA 1J3QA 1UU4A 1LHOA 3AYCA 3CNAA 4QU2A 1JYCA 2GDFA 1UKGA 3BCWA 1R1A1 3ZO0B 3UJOA 3KD4A 1S2KA 4C1WA 2IFWA 4YVWB 1H4HA 5KXDA 3DPRA 5GLTA 3AMHA 2WWSA 4AI1A 5F6KA 4CDWA 1D4VB 1PO21 1SACA 1UZZA 4E4SA 1ZBE2 4ISQA 3N7JA 1WMFA 2Y0OA 1YO8A 4MGIE 3VBUB 4XHXA 4EN7B 4DS0A 2QDNA 4JC1A 2XLFA 4CEYB 5I0RA 4F8AA 1H2NA 5FFOC 2LUWA 4ZKTB 2B5HA 1ZZ8A 4OHZA 1YLLA 5CNAA 4GULA 5DZGA 4YLZA 1H0BA 4AYUA 4QPYA 4SLIA 1MACA 5A32B 4XFIA 1GV9A 2ZMKA 1SLTA 2D40A 3IPVA 2GAUA 1B35C 1X36A 4YARA 3WDXA 3ZN6B 2G9FA 4LBQD 2R16A 1MZEA 1REDA 2YPJA 4JTNA 4XXAA 1O91A 1DQ6A 3K51A 4Q4V2 3H50A 4XYXA 1T6GC 2DCJA 1HXS1 3AKRA 5FLIA 5AC92 1HV1A 3AFKA 4YM2A 5GLZA 2CY6A 3IBMA 1TME2 1MQTB 2D5FA 2XJQA 2GMEA 3M3EA 3UK9A 1NA1A 2CWMA 2ZHMA 4Y1UA 5B2GB 1JUIA 3ZX7A 1C1LA 1CIWA 1LR5A 4BLIA 2BBVA 1MEC3 4W6WA 1AYN1 1O4ZA 2MEV2 2EXKA 2PN5A 4C1XA 1YHFA 1RC6A 1AYM3 1GSLA 1MVQA 1ZZ9A 5TSWA 3ST7A 2KM2A 3ZYJB 5T52A 5C8CA 1VBC1 4Q4Y3 5JOWA 1U5YA 1YFXA 3MLKA 1UL9A 1LEDA 2YUEA 2ZX2A 3VZNA 4Y1YA 1O4YA 3WX5A 3T1MA 3KM5A 1UIKA 1BVP1 1MS1A 3FX3A 3WDVA 2RS13 1ULFA 2ZOEB 2WQZC 4XFHA 2TBVA 2DCKA 1AL0G 2XKPA 1R081 1JXNA 4YFZA 4XMAA 1UW8A 1NCRA 4CP1A 4MSVA 4Y22B 2ARBA 1G86A 1OA2A 3RYKA 4IV1C 1XU2A 3O14A 4G4FA 2K0GA 5FQ0A 4LR4A 3D6EA 5J96B 4QPIA 2H6CA 2E7AA 1JOJA 4M3CF 3AMPA 1Z0HA 2ZCWA 5CG8A 1V9U2 2VVFA 1VRH3 1Z7S2 4AF9A 1NLRA 1J3RA 4XFBA 2R072 1AR61 4GKXA 3AYEA 5GZEA 1AVBA 3TNPB 4I2OA 4IV3C 2A5ZA 3M8LA 1OLQA 3OCPA 1FOD2 4K1ZA 4AGGA 2XHKA 1XNDA 2D93A 3EJKA 1QH7A 4LE4A 4HVQA 4LUMA 4HBNA 2PQQA 4Q4Y1 1REFA 2VVEA 2ZGSA 1PMIA 5F1RA 2DVDA 2YYOA 4N7IA 2E6VA 4YSFA 5CFCC 2ZZJA 1WA4A 3ROUA 1I9RA 3ECQA 5T50A 3ZSKA 1EAH2 3JD72 4XQDA 4AK3A 1IS6A 2Z5WA 3JB8A 4AFMA 1RUJ1 2VOXA 1ULEA 3EQEA 3N36A 1C5IA 5DUXA 1PGL1 2JICA 2XL7A 1HQWA 1IPKA 1RGSA 4AHXA 1Q8PA 2PHFA 4OI4A 4M0HA 1A6CA 2XB6C 2C0ZA 5BPXA 1ENXA 1NQDA 2DTWA 4GH4A 2XJTA 2Y26A 4ISRA 1V70A 4HVRA 3KCCA 1A78A 3AB0A 3WINE 4QM8A 4ZU5A 4ATEA 4B3NA 3VBUC 3TYJA 4XJ8A 1R082 4D7TA 1AL22 3OD0A 4JQRA 2DF7A 3VKFC 1BYHA 2IXHA 1AYM1 4JV4A 1VAMA 5C9AB 4D7SA 5K7PA 1BK1A 2XKOA 2YZ4A 5JVVA 3V0AB 1OKQA 3RPQA 3MPPG 1CR7A 1QJZA 4Q1PA 1QXPA 1WW5A 3BOPA 3VZKA 1CAUA 2ZGPA 1HRI3 2IXKA 4AQTA 1C57A 2K2SA 4AEKA 2GC3A 1AX2A 2EXIA 4K20A 3M70A 4MXVA 1MS9A 1RHI3 1R1A2 1SLAA 1WW7A 3QLQA 4I01A 3VBRB 5DDJ1 3E5QA 2RJKA 3VBSC 2XBO3 1PGW2 1OOPB 4R8HA 3NWKA 5KHGA 1QJX1 1DLLA 1BEV2 1MQTC 4L2NA 4XIKA 1DYKA 1Q8VA 2A71A 4K7JA 3G6JB 4NO4A 2ET1A 3RSJA 4K3UA 3VZLA 3QH6A 3ZN5A 2GALA 2Z2SB 1KXGA 4HSLA 4AG4A 3GBGA 4TLFA 1WW4A 3KGZA 5HXVA 3D5OA 4FTBA 2ENRA 2JEMA 2RHPA 2WFF1 3HD8B 2WJSA 4F7ZA 1TQ5A 1RUH3 4A2UA 2UYAA 3KGLA 2ZGQA 1YJKA 3QACA 4AEJA 3FBYA 3V56A 3VLBB 4BH9A 2XJRA 3IKWA 1LRHA 4CEWA 3AXEA 3FLPA 5ABJB 2BWCA 3AK0A 5JWPA 1WBFA 2DVGA 3VBRA 4UBGA 3APBA 3BODA 5C9AC 1NG0A 4FPJA 4KH9A 3FLRA 2ZHLA 3ZXEA 4RGGA 4A7ZA 2VNRA 1AL21 4XF0A 4JTOA 4Z2WA 1EY2A 3AP9A 1YJLA 1RUJ3 2DFBA 1RUH1 3AKPA 3D8CA 2GZWA 3S30A 2HWC3 3AZWA 4LO4B 2B39A 4CTEA 3WV6A 3HIFA 4UW6A 1FI2A 1S1AA 3V0AA 4DXZA 4MXWA 1QOSA 1QJU3 1WCDJ 1PO11 1QJY1 5SV5A 3MFCA 4LBKA 5BNPB 4CP0A 1G9AA 1UKRA 1NXMA 2DVBA 2JG8A 3V65A 1H9PA 1Y3TA 3CJIC 3P3PA 2H0BA 2DVAA 3KCYA 3DN7A 4IEPA 1IOAA 4HKWA 5GLWA 1QU0A 3MIDA 4XQWA 2RS32 3MYXA 4HANA 4HETA 3OTFA 5L7OB 4Q26A 4J1WA 1VBB3 1W39A 3T1LA 2VW1A 4XILA 5JSRA 3ZFFB 4IEYA 4DFSA 3U0ZA 4QQOA 4UW3A 3TN92 4F83A 5JZGA 4PQ9A 3TAYA 2HEYF 2VUAA 1WGPA 1HRI1 5FTTC 3KB5A 2GSYA 4QPIB 2A3WA 4QGLA 3WHTA 1XYNA 1RHI1 2MEV1 5ACA1 1AL23 1NCRB 4RHV1 1O3SA 5HI0A 2E9QA 1JW6A 2GC0A 2XBO1 3RI9A 4HLTA 5CFCB 1H8TC 1EPZA 4EROA 3Q9OA 4CEWC 3KQRA 1RUD2 4PJYA 3AMQA 2A6VA 5FREA 1YI9A 4PLOA 5H9QA 3R4DB 5FLJA 3VHPA 2XLGA 5L73A 2WFF3 3SH5A 5C4WC 1UX6A 1QH6A 1CVNA 4L9BA 2D3RA 2DV9A 1H1IA 5BNNA 3FBMA 3NV1A 1EP0A 2BNNA 1Q8OA 1C28A 1PO12 1QJY2 4IEOA 3OD4A 5CFDC 4Y22A 5KHIA 1UPSA 4XTMA 5JSPA 3GHMA 3GF6A 2XJSA 4FAHA 2WSVA 1CAWA 2WKKA 4P9LA 5E16A 3MIHA 3VBSA 4HKOA 3ZFEA 2W68A 3QD6A 4IV1B 1B09A 5LRRA 1OQDA 3VKLA 4YGBA 4LA2A 1AYN2 4IEQA 4HK9A 1CAXB 1XQNA 2ES3A 2B9UA 5AVPA 5ACA3 2HKXA 4MZUA 2BQPA 2Q1MA 3M1HA 4AEDA 4CDWC 3DPRC 3H1WA 3UJQA 1LECA 2MNGA 1APNA 4Y26A 4LHLA 3OBTA 1XNCA 3CLPA 3VKOA 1RUC3 3H7JA 4MUVA 4E9KA 4CDXC 3MICA 3AFGA 3PMSA 4HSJA 1SFYA 5D8AB 2XGXA 2B7YA 1OI6A 4N7UA 3B01A 4X8NA 4YG0A 5JIAA 1ENRA 3JBG2 2XH6A 4AVCA 4WM8C 2XBO2 4QPIC 1NY71 4W65A 4B29A 3B93A 3RG0A 1VBE2 2H0VA 2X53S 3J8F1 4EJRA 4Z92B 4S2FA 4OI1A 4URTA 4Q0PA 3U4XA 1PGW1 4QM9A 4XF3A 1WUVA 2HWD1 3THTA 3WLUA 3FLTA 4JAAA 1WMEA 2JG9C 3WUCA 3IPVB 1OSGA 1LB2A 5T54A 3BB6A 3PTYA 1HXS2 5AC91 2X5IC 2Z69A 1DGWX 1V9U3 2A3YA 3AM2A 2WA3A 1KITA 4GQ7A 5FO9B 5BNQA 4CDXB 4RA0A 1S0IA 2IZWA 3WZ1A 3RQ0A 1S55A 2BEOA 5CFDA 3UKNA 2CWSA 1HQLA 2VMIA 2EALA 2A6ZA 1LHNA 1Q5OA 3LA2A 1RUE2 3VDDB 3CEWA 4YZ4A 4NOTA 5FCCA 1OLRA 1W6PA 3UL2A 5SV8A 1CPMA 1QJX2 2JG9B 1EAH3 4XJUA 3S0MA 2E7TA 5E8AA 5DXDA 4C90A 5KC5A 3VKMA 2RM21 3VZMA 1BQPA 1ND3B 2ARXA 1W6QB 1ZZCA 2R30A 3FC0A 4YM0A 1VB4A 2DCZA 3FUQA 1Q3EA 1Z78A 3JBG1 2RMU1 4CYDA 4U36A 2GU9A 1IS5A 3PVNA 2TUNA 1G9DA 1V9U1 3WCRA 4RQPB 1WD3A 2WINB 3TN93 1H8VA 4L92A 3V64A 4BIFA 2EXJA 4CZSA 1AR72 2I45A 2WZR3 3J26N 1RUE3 2DCYA 1FOD1 4OHYA 3VBSB 1V6IA 4YGEA 2W0XA 3OY8B 5JAXA 2VH9A 2VOWA 2ZJCA 4LBMA 4GXLA 5JLVA 2ZS6B 1J1TA 2O8OA 1SLIA 5FLHA 3IM0A 1H8TA 1RHI2 5D8AA 4OUMA 3WP4A 4FOQA 4PIYA 1EAH1 5BXXA 1DQ5A 3BU7A 3OGGA 4BA6A 1D4M1 4LO7A 2GNDA 2VG9A 2PAEA 3S7IA 2R1DA 5F6LB 4YW4A 2EAKA 1Y43B 3WG3A 1AJKA 4I09A 1W6MA 4OH