4IEPA

Unliganded cysteine dioxygenase at ph 4.5 in the presence of cys
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
186
structure length
186
Chain Sequence
ELLKPRTLADLIRILHELFAGDEVNVEEVQAVLEAYESNPAEWALYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTDSHCFLKLLQGNLKETLFDWPDKKSNEMIKKSERTLRENQCAYINDSIGLHRVENVSHTEPAVSLHLYSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cysteine dioxygenase type 1
publication title Cysteine Dioxygenase Structures from pH4 to 9: Consistent Cys-Persulfenate Formation at Intermediate pH and a Cys-Bound Enzyme at Higher pH.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
total genus 56
structure length 186
sequence length 186
ec nomenclature ec 1.13.11.20: Cysteine dioxygenase.
pdb deposition date 2012-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05995 CDO_I Cysteine dioxygenase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4iepA00
4JV4A 4KWKA 3PNAA 2CAVA 2XLFA 5BY5A 1I5ZA 4TLFA 3FHIB 3ST7A 3I59B 4N9IA 4FT8A 2PAKA 3N4MA 4IERA 2K9ZA 2CGPA 4HVOA 3LA2A 4WBBA 2IXCA 5FQ0B 2XL9A 3DL3A 5JAXA 1Q3EA 2QVSB 5KHGA 5FPZA 4XEZA 4KU7A 2Y0OA 2D40A 3IIAA 5BUVA 1GQHA 3LAGA 3ELNA 3KGZA 3LOIA 4MGIE 2UY9A 3ES4A 1I6XA 1DZRA 1FXZA 1YUDA 2O8QA 4EWAA 4MV2A 4QX5A 2HJIA 1J58A 3EQEA 4LTAA 3KCCA 4I09A 3SMHA 2BEOA 1NXMA 2N7GA 1YLLA 4MGZE 4OFGA 4IESA 4YRDA 4QM8A 3RNSA 3E5UA 1XE8A 1UPIA 1ZZCA 3D0JA 3I59A 3IDCB 3CF6E 3DV8A 4LULA 5I8SA 1IPJA 4J1XA 3U10A 1VP6A 2E9QA 4Q0QA 5FCCA 4FAGA 1NE6A 2OZJA 1O7FA 3NKTA 4L2NA 1DGRA 3ROUA 4H7LA 3TNPB 4BIFA 3FWEA 2GC2A 3U0ZA 4META 1QXRA 1LKNA 3L2HA 3ZDSA 3G7DA 1VR3A 4HVRA 2XKPA 1WLTA 4IEQA 1CAUB 1ZZ7A 4HBNA 2DCTA 4IEXA 1RUNA 2BNNA 2PAEA 2Q0AA 2I45A 4PIXA 4XFIA 2OA2A 4ZU7A 1UW8A 5JCTA 1ZREA 3HT2A 1RTVA 2IXKA 3E97A 1H1IA 3M70A 5LEJA 2MPFA 2QDRA 3TNQA 4AVAA 5KHIA 4HSLA 3HT1A 3KSCA 3BCWA 4AXOA 1QWRA 5T3NA 4HMZA 2KXLA 3RYPA 2GH2A 3ES1A 2MNGA 4I02A 2HKXA 5J48A 1YFYA 3R6SA 1YFXA 3RZZA 3H9AA 3LA3A 3WW1A 3KGLA 4XFFA 5I8TA 5FLJA 1GQGA 2QCSB 5J7MA 3RYRA 4BH9A 1DZTA 4MGYE 1CGPA 2H6BA 2BGCA 2F4PA 4MGKE 1DGWA 4QXKA 1XE7A 1QXJA 4HLTA 4BHPA 4LA2A 5K8SA 3I54A 4O9EA 4XF3A 2GU9A 3H1WA 4LA3A 4YNIA 4XF4A 2H6CA 5D1IA 4IEVA 2XL7A 1X7NA 3BPZA 2BYVE 2D93A 2B9UA 5F1RA 3S7IA 1OD5A 3E5QA 2D5FA 2XGXA 1J3QA 3CL1A 4HN0A 1ZRFA 3NSTA 4AQ2A 4IEOA 4K8FA 3CLPA 3UKNA 3NJZA 4PIZA 5KHHA 3IWZA 3VHRA 1YFWA 4R52A 1WGPA 5KHKA 4Q0VA 2Z2SB 2C0ZA 3RPQA 2OZ6A 5I0SA 4L11A 4ZU4A 3WW3A 2QNKA 1X8EA 3OD0A 1J3RA 3EHKA 4JTNA 2O1QA 1OI6A 3WW2A 5EFUA 3IBMA 3OF1A 4R8HA 2IC1A 4MH0E 2CV6A 1ZRCA 1QY4A 4Q0UA 1LB2A 1XRUA 4MX3A 1V70A 2PA7A 1SQ4A 2B5HA 4XFCA 4YYOA 1HW5A 4WZCA 1Q5OA 4D7SA 2XHKA 4XFBA 3SCGA 3E6DA 5FLIA 1UIJA 2VPVA 5I91A 1O5LA 4MUVA 1O3RA 2P17A 4I3PA 4B29A 3CO2A 1WA4A 2H0VA 1Y3TA 3H1MA 2D5HA 4KWJA 1EY2A 1PM7A 3FFQA 4IEWA 4HN1A 1Y9QA 3JZVA 4WVZA 4F7ZA 2WFPA 5CU1A 1OMIA 5BXXA 2Q30A 3RDIA 3FX3A 2ATFA 3LWCA 3NW4A 1J3PA 1NYWA 4D7TA 3E6BA 3OTFA 4LUKA 2XLGA 2WC2A 4E2GA 3H7JA 3IDBB 2BNMA 1RL3A 5CVRA 4QGMA 4IETA 4EV0A 1SFNA 2MHFA 5FPXA 3MPBA 3O14A 1IPKA 2CAUA 3MDPA 3H7YA 2PFWA 4A2UA 2IXJA 3FJSA 2QJVA 2FQPA 1NZCA 4XF9A 1TQ5A 3MZHA 3S7EA 3OCPA 4CYDA 3MYXA 4OLLA 1CAWB 5I0RA 2V09A 3FE5A 1UD1A 1ZZBA 4GULA 1LR5A 1FI2A 1NE4A 4N9HA 3EO6A 3RYKA 4YARA 1EP0A 3KMHA 4ORFA 3SCHA 5I93A 3S0MA 4UXAA 4Q29A 3SXWA 5BV6A 4KL1A 4XETA 5JR7B 5I0TA 1H1MA 2Q1ZB 3BB6A 3HQXA 4FAHA 1CX4A 5AVPA 4Z82A 3UKVA 3BALA 2PHLA 4JVAA 5C6CA 1ZRDA 4EWDA 4F8AA 4UBGA 1RGSA 4J1WA 1ZNPA 2BNOA 2PQQA 4P9GA 3B02A 4X6RB 2UYAA 2FMYA 1J1LA 1ZZ6A 3QACA 3PLQA 3GBFA 4AQ6A 4XFAA 3ETQA 1CAWA 4HVQA 1X82A 3OGJA 1O5UA 3EJKA 2OPKA 3ACLA 3H3UA 4DINB 4UBHA 4XF0A 1LRHA 4QMAA 5J3UA 1OFNA 3SHRA 1EYBA 4Q0SA 4LEJA 3PVBB 5KHJA 4EROA 2ET7A 1G6NA 1PMIA 1ZZ9A 5LRRA 2UY8A 2VQAA 5CADA 3E6CC 3DN7A 5BPXA 3D0SA 2OYZA 1YWKA 2GAUA 4Q0PA 2ET1A 1J59A 4LUMA 1YHFA 4AVBA 3HIFA 4QM9A 4PJYA 1EPZA 2Q4SA 5E1RA 4AVCA 5JSOA 2B8MA 2GC1A 4XFHA 5FLHA 4I0AA 3WW4A 1SEFA 1RUOA 3GYDA 3E5XA 4PIYA 1Q43A 4E2SA 3CJXA 1O3QA 1CAXB 1VJ2A 1X8MA 4O9GA 2GC3A 1JUHA 2PYTA 4IEPA 5FQ0A 5JSRA 2K0GA 3H1YA 2PAMA 4ZU5A 2EVXA 1ZX5A 1UIKA 5LEKA 3LA7A 3H50A 3SCFA 3NL1A 2PHDA 4MZUA 5C8WA 2ETEA 4Z07A 4HSJA 2EAAA 4JTOA 4HZFA 1YFUA 4I01A 2XLAA 2XKOA 5EZWA 1ZVFA 5JSPA 2ZKLA 4FBFA 5LRSA 3FZ3A 1RC6A 3NVCA 1CAVB 3U11A 4IEUA 4QGNA 2Z69A 4KWLA 5I8YA 2ZCWA 5HI0A 1U12A 1CAXA 3USSA 2IXHA 3LZZA 1ZRRA 4XFGA 3H8UA 5I0UA 4IEYA 3UKTA 5KBFA 1UCXA 4I0BA 1O3SA 4EWEA 2GZWA 3DKWA 3M3IA 5FDBA 3D82A 2UYBA 2EA7A 3I7DA 4RD7A 2VECA 1O4TA 4QGLA 1CAUA 3QOPA 4IEZA 3C3VA 4LLOA 1ZZ8A 3EBRA 3BU7A 4X6QB 1O3TA 4I2OA 1CAVA 1L3JA 4BYYA 4E2QA 4KU8A 4ONUA 1FT9A 2IXLA 2IXIA 3H3ZA 2GC0A 5E16A 2PTMA 3CEWA 4XF1A 4YSFA 4NVPA
chains in the Genus database with same CATH superfamily
4JV4A 4KWKA 2XLFA 1AYN1 3O7OA 1NA1A 1C3HA 1MS1A 3AKSA 1DBNA 2P5BA 2WKKA 5A32B 3D5OA 4P9JA 2JDUA 3FLTA 4AGVA 3N4MA 5A7WA 1W8OA 1AR62 2K9ZA 3LOBA 2CGPA 3R05A 3U07A 5HXMA 3AZWA 1JU3A 3RZKA 1Y4WA 3OY8B 4JQTA 2Q1FA 2IXCA 1OVPA 4A3ZA 2XL9A 2WNUC 3M7AA 4BPZA 1JMUB 3DL3A 3VDBA 3N7JA 4DUVA 2WZR1 2E53A 2WT2A 2RS53 2YYOA 1GNHA 2X05A 2C24A 1VBC1 2WWSA 2JIJA 1KJLA 5BUVA 1GQHA 1OQDA 5FWEA 3RRDA 2W95A 3U4XA 3B9CA 3ELNA 3MF6A 3N9QA 3GHMA 2W47A 4CEWC 5KXEA 2CY6A 1CN1A 1IS3A 4MGIE 2JG9C 3HJRA 1HB4A 1IOAA 4R9BA 3QCWA 2VCAA 4LKEA 4LR4A 5F6LB 3ZSKA 1DU3D 1YUDA 4DIQA 2WNUA 1S4CA 4XQDA 4FO9A 4MV2A 3PTRB 1MPXA 2HJIA 2ZHLA 5F3IA 4LTAA 1PO13 2C4XA 1K5JA 5ISLA 2ZHMA 4Q4V3 2ZGTA 3SNMA 5M0TA 1MS3A 1NXMA 1REFA 3VKOA 3WQBA 5E6HA 4OFGA 5A3NA 2YDEA 1GOGA 4IESA 4B3NA 1FYUA 1COV2 1L7LA 4B7EA 2W08A 3U14A 3E5UA 1XE8A 3Q8AA 5FY0A 1ZZCA 1C8M2 1MQTC 4OMCA 4BXSV 1ULCA 1X36A 2CL2A 4O7XA 3DECA 1JZ3A 5FBJA 3O0XA 3DV8A 1G7YA 1UYZA 1GBGA 4CDQB 3KD4A 2YHJA 1DQ0A 1YJLA 2GALA 3WDTA 3WHUA 1BMV1 2E7AA 5FUNA 1G9BA 1RUC3 5T5PA 4C1XA 4MOAA 1PK6B 4YM2A 2OZJA 1C1LA 5EYXA 1ULEA 1MQTA 1V6NA 4H7LA 3OEAA 2A3YA 2ZX2A 4XTMA 3P5BA 1NUKA 5FZ9A 5CA6A 1HV1A 3FMGA 4P9XA 3UNPA 4FPYA 4Z2AA 4BOWA 4XAEA 2NLRA 2DU0A 1MVQA 2DDUA 2OXBA 4FPEA 4ZS2A 4QDRA 4IEQA 3DYPA 3LCPA 3M1HA 4B1MA 4HK9A 2LUWA 4MADA 4P14A 5FPLA 2PAEA 1GR3A 4GMP3 4AI2A 1QMJA 4CVUA 1ZREA 4QQ2A 4CP0A 2FDHA 1DDLA 3BKZA 5DAVA 3WNNA 2MEV3 2VZVA 3E97A 3ZSJA 4COUA 1UL9A 1GKBA 4DRRA 5FOBB 1W6MB 4QPGB 2R16A 4AHXA 1LULA 1YQ8A 2QDRA 1QIQA 2VZ3A 1O4ZA 3DPRA 1WLDA 5SV5A 5KHIA 1E5IA 2DWRA 2JJ6A 1QQP2 3FC0A 3O1SA 3IM0A 3W5NA 3VD9A 1NA1B 2RHPA 5FXXA 5HV0A 5A80A 1UPSA 4S2GA 2RR12 5FZCA 5A7WB 5A33A 1NQJA 3RG0A 1RUF1 1VRH2 4COYA 5HPOA 2FCTA 2HKXA 1MEC1 5J48A 1V6MA 2ERFA 1BZWA 1D4VB 4XUQA 1YFXA 4C8DA 5K0UB 3ZXDA 3KGLA 4NIIA 2QCSB 5A7QA 1AL0G 3RYRA 1CGPA 5CG8A 2JE9A 3WNPA 1RUE1 3J7NA 4U36A 4W4ZA 1EUTA 3VKNA 3WG4A 2XMLA 4BIOA 2ZAAA 4CDWC 5L7OA 3IPVA 1SPPA 3UESA 1N1SA 4BHPA 4LA2A 2R0HA 2FDKA 1GZ9A 2YMZA 4Q4Y2 1FAYA 4LA3A 4FTBA 2ZGMA 3WQ7A 1MS0A 4NROA 4QDQA 2ZX4A 2Z42A 4IEVA 1F4HA 1U5IA 1AR73 3LGRA 3OUJA 4NE9A 5T5LA 3VBOC 3RJ2X 1EAH2 5A6QA 5JVVA 1SFYA 2BFUS 1OD5A 3E5QA 2XB6C 4COWA 2XGXA 3T1LA 4CDWA 4CEWB 1ZRFA 2JG9B 3POIA 3VZLA 3J7LA 5F5AA 3BODA 1JZ6A 3B01A 4LBLA 1DQ2A 4Q4X2 2WSVA 5F37A 2W91A 3RZJA 2WL1A 4V1PA 5L9VA 3UKNA 5LCWL 1QDOA 2F4LA 3AL5A 1QU0A 2W5FA 3USUA 3V0BA 4R52A 3JBG2 5FZBA 3EYPA 4TYSA 4B8EA 4AVVA 2HWF2 2C0ZA 5FP4A 4IUGA 1CPNA 2IWGB 2KD7A 4P9YA 1MQTB 2FDJA 5I0SA 4ZU4A 1OC1A 4QPIA 5C33A 1A8DA 2RJLA 5IUQA 3K48A 1SLTA 1XC6A 4UF0B 2G4IA 3CZUA 1JUIA 3HMYA 5EWSA 5FO7B 3CMGA 5EJ3A 3ZMOA 5FO9B 3OYWA 3WNMA 1OI6A 5F32A 3IT8A 1VB2A 1UOBA 5F6KA 4N8MA 5FYCA 4NRMA 2DVDA 1HRV3 3TN92 3WUCA 4BQWA 2XJVA 4JDOA 2IC1A 4MH0E 4AW7A 2WNOA 1I3HA 2WSUA 2NP0A 3TOJA 4Q0UA 4OULA 2WZPP 3JQWA 1KS5A 1V0AA 1DG6A 1ENRA 2Y6KA 3L2YA 4PLNA 3ZPYA 2VBDA 4DQAA 1OURA 1U5XA 3LSEA 3ZFFC 1WLWA 1UKGA 4L0PA 1W0PA 2XHKA 4BQ5A 5JZGC 1UZZA 1WW4A 2RJ2A 5AVPA 2WFF1 3E6DA 4QPYA 5FLIA 1RB8G 2VPVA 1LESA 5EYYA 4F3JA 5AC93 3O1MA 1V00A 5GJ6A 2VZTA 2J7MA 1OKQA 4QKBA 1WA4A 2WINB 3SEEA 3H1MA 3AJZA 3ZFFA 2VD7A 4QHOA 4YZ2A 2I2SA 3BN6A 4XHXA 2QTWB 1PM7A 1Y9QA 4Y5Z0 5BNQA 5L36A 4YW6A 1N1TA 1R1A2 2RMU1 3PU3A 4UW3A 5BXXA 2ZPXA 1DIWA 1HJGA 2JENA 2Y6FA 2ATFA 5KXDA 4MXVA 1ULPA 2JG8B 2VZRA 4TSVA 3C7HA 3OTFA 2EF6A 4AI3A 4QWNA 4G9SB 5A3WA 1XNCA 3PUAA 3WDXA 1W99A 4H55A 3POSA 4CDWB 5K9YA 4Y20A 1OF3A 1R083 1HX6A 2RS13 2JKBA 3HVDA 1LENA 4IE5A 2D98A 5B2GB 5KC6A 2BNMA 4XBNA 1BVP1 3WQ1A 2NQYA 2RS51 4EV0A 5FPXA 2CAUA 5B4XA 5FZOA 3O1TA 4FFHA 3VBOB 1ENQA 3UGGA 4A2UA 1QEXA 2HWC2 2YGLA 4GB32 4XPVA 1C57A 4XIKA 2QQLA 4YFZA 2YC4A 4EN6B 4AK3A 1POV0 4JGZA 3WR0A 3R4DB 3S7EA 4FFFA 3OCPA 3TEYA 5F5CA 3HAGA 1BYHA 1S0IA 1ACCA 4YVWC 2JKXA 4FPLA 1VMFA 1NAEA 4WV8A 4QX0A 4FPFA 3EXUA 1WZXA 3VGIA 5LK7B 5FJHA 5F5QA 2D6LX 3KMHA 4ZY9A 3SCHA 5I93A 2F17A 1TG7A 4Q29A 1MS9A 1RUC1 1OXCA 1NY72 1U0AA 1W8TA 2QQVA 2YBPA 3ME2A 4GKYA 3TAYA 4XETA 4AI1A 1W9WA 2Q1ZB 3MV01 3HQXA 2YV8A 4GXLA 1PO22 3UKVA 2WN2A 2AH2A 1WCQA 2QZ3A 4E8DA 2BPA2 4JC1A 5FMOL 5H9SA 4Q27A 3PUSA 4F8AA 2AEYA 4EQVA 2PLV2 4J1WA 1ZNPA 4P9GA 1VBB1 3S57A 2UYAA 4BQ1A 1YJKA 2FMYA 2DURA 2YFUA 5DAWA 4UI9L 4C0BA 4CEYC 3ACHA 3PLQA 5DAXA 5F8PA 4YPJA 3GJBA 4GJYA 1UWWA 4GMP1 2B39A 4XFAA 5FMCA 5CB7A 3ETQA 5JZGB 1CAWA 1VMJA 2WJSA 4HVQA 2W9XA 1BBT3 3I3QA 3NJVA 2MEV1 2OPKA 3ACLA 2Y0IA 3H3UA 4JKLA 4D6SA 4OQ8A 2HYXA 2R1DA 1BEV3 1W2AX 2ENRA 3OB8A 4Y1XA 3OSDA 2ZA9A 5ANNA 3WDVA 4CEYA 1XQNA 1OA3A 1QH7A 1ZBE2 2D6OX 1RUG2 3D3AA 2DV9A 1B09A 3MIFA 3PVBB 4URTA 1JZ5A 2X5IC 2ET7A 1RJ8A 2XJPA 2VQ0A 3WF1A 3RZLA 1HXS1 3W21A 4BCUA 2JX9A 4QXHA 5C9AC 3ZM8A 2J22A 3D0SA 4TLGA 4Y20B 1UKRA 1YWKA 1HB2A 3POBA 5LK5A 1CR7A 1LEMA 3N7LA 1S0EA 3ILFA 2ET1A 1DCSA 1NCRC 2H0BA 3HPNA 4LUMA 5DQ0A 3VB9A 5F9TA 3HIFA 1YXWA 5IWFA 2JD4A 4LO6B 1PMHX 2ZJCA 2KA3A 1UMZA 4AVCA 4COZA 5JDBA 5A3OA 1D0HA 3JB8A 5A6YA 1H0BA 2FDGA 1RUOA 3OBTA 5IVBA 4PIYA 5C9AA 4MGTA 1W2TA 4LBKA 4E2SA 5HCHA 3CJXA 1O3QA 3GZUC 2GC3A 2R072 1LHVA 2XJSA 4CA9A 3KVAA 4RR3B 1AXKA 4DY3A 4JQRA 4QQLA 1RUD3 1NXD1 2DFBA 2LW8A 2V72A 5AFBA 5FQ0A 5A1FA 2YUEA 4LOSA 4QX1A 2K0GA 4TWTA 2ZABA 1LOBA 5LY1A 2V5DA 4QQPA 2EVXA 2W52A 1ZX5A 3OGVA 3T0AA 5FREA 1W28A 4DEVA 3LA7A 3H50A 4M3CB 3AVRA 3B94A 5TSWA 3SCFA 4LHKA 4PHZA 4E8CA 1RUH1 2Y26A 1DYPA 5C8WA 4Z07A 4EJRA 4HSJA 4IV1A 3ZLIA 4JTOA 4NPMA 2JDHA 1VBC3 4I01A 1SDDB 4PLMA 1WWYA 4IGOA 1H2LA 1GQPA 4YVWB 5JSPA 1IPSA 1FPN2 3FBMA 4AVSA 3UYJA 3ZN6A 1UMIA 5IK4A 1H4GA 3FZ3A 4A6OA 1CAVB 2E63A 3OPZA 3VDDC 2WABA 2BUKA 5A1LA 2DBIA 3J7MA 2Z69A 1AR92 1UZYA 2BTVC 2VZ1A 2ZHNA 1I9RA 3MO4A 4AHYA 4MG2A 1F15A 1W8FA 1CAXA 3VZOA 5C3QA 2IXHA 3ZXLA 2QQIA 3J7HA 1D4M2 4FXGB 2O8OA 1W6PA 2VOWA 4PDWC 4AG4A 4E4HA 1HRV1 2F6BA 4KI5M 1RHI2 1UCXA 4UW5A 3VDDA 1SLLA 1RXGA 1MS5A 1R091 3RWKX 4EWEA 2G1MA 4AFDA 3W9AA 5IVVA 3I2HA 3VBFA 1IS4A 2WN3A 2WT0A 3C7FA 3R4SA 3M3IA 4EN9B 1OVSA 2PHFA 3WP4A 4NIAA 3MEPA 5APAA 5G04L 1RUI1 1ZRIA 1W2NA 3MBWA 4RD7A 5A6ZA 4XDPA 4HT1T 1O4TA 4PDWA 3WZ1A 4QGLA 1CAUA 3WP6A 2OKXA 2ARAA 3VBHC 3AZXA 3POJA 4HL0A 4I30A 4Y1VA 3A0NA 4Z8BA 3ZR5A 1ZZ8A 3BU7A 1GU3A 1GNYA 1QOOA 3O1RA 1TMF2 2OQ7A 1QQP3 4CCKA 5FP3A 1GICA 1JODA 2IXLA 3H3ZA 5GZDA 2RR13 1UQXA 2E32A 1WCDJ 2X5IB 1W6NA 3DYMA 4XJZA 1H4HA 2PTMA 3VBHA 4TZDA 4YZ1A 1STMA 1WUVA 2GNMA 3WG1A 3CEWA 3ZSEA 3WG3A 2XUEA 5FZ3A 1UOGA 1NX9A 1Z7S1 5C9AB 1GYKA 3PNAA 1J84A 3FL7A 4RGAA 4GWNA 4UT5A 5FZIA 3I59B 4N9IA 4FT8A 2PAKA 2QQOA 1NCRB 3JD71 4OMDA 2R062 3GXUA 3I2IA 4HVOA 2DCZA 2JICA 4WBBA 1OQEA 1XJAA 2VH9A 5FZGA 4A45A 2B45X 5FQ0B 4OI1A 4QX3A 1N47A 4QT6A 4ZZ8A 4TXWA 1YI9A 3W20A 2RS11 2YPJA 4P9LA 5FYUA 3LAGA 4E27A 4FCAA 2XHNA 3PUIA 4XQ4A 1MEC3 1OUSA 1XE0A 5DAQA 5DZGA 1X9TA 5LBBA 1HB1A 4LITA 3VHPA 3JB4C 5A3PA 3WHTA 1I6XA 1DZRA 4DS0A 2VZPA 4OI2A 3VBUB 2D3SA 3O0WA 5FR3A 1SFPA 3EQEA 4RGKA 1RUE3 4XE9A 4Q4X3 2Y6LA 3HNBM 1H8TC 4N53B 3ZN6B 4JDMA 1ZBA2 1LHWA 1S1AA 2N7GA 1YLLA 1CZTA 3T30A 1SBDA 4YW1A 4DEQA 3H8XA 3R4UA 4YRDA 4AFMA 3U75A 4QM8A 1SDWA 1NCQC 3RNSA 2HWF3 3VBRC 2BW8A 2DCYA 5A32A 4I0WB 2BGPA 4FTEA 5D2AA 4IW3A 5C3RA 1IPJA 4BDVB 3A4UA 3PTYA 4J1XA 3U10A 3POYA 1VRBA 1MVEA 2E31A 3ZXGA 2JDYA 4JHTA 3PJYA 2E9QA 3ACFA 4Q4W2 3ZPOA 1AR82 1TME2 5FP8A 1O7FA 3NKTA 2GDFA 3PMSA 2J1VA 2ID4A 1OLMA 2A70A 3VBRA 4NHXA 2VNGA 4BK5A 2GC2A 4FPJA 2Y6JA 1PVXA 1QXRA 1TZOA 1LKNA 3AYEA 4META 3L2HA 5A7OA 5LWBA 5LA1A 4FFIA 1JTZX 3CDZB 1PGW1 3G7DA 1VR3A 4HVRA 2WO2A 1F4AA 1CAUB 1IKPA 1Y7BA 2VNOA 1MACA 3ON7A 4P08A 3SISA 3BTAA 2XH6A 3ZXJA 2XVGA 3IIIA 4A7ZA 4XFIA 2VJXA 4N43C 4FP2A 1RITA 1UW8A 4Q5OA 5KR7A 2OS2A 3A22A 1PIV1 4UAPA 2BWAA 2R0FA 1IZ3A 1RTVA 1ZM1A 2ZGSA 3KT1A 1H1IA 1WCUA 4LO8A 5T5OA 4NWVA 2GNBA 4KH9A 1VBE1 4WM7C 1E5SA 3FN9A 2RDQA 1ZA7A 2BERA 2DCJA 3N9LA 1BBT1 3N9OA 4CDQA 5A3MA 3R0RA 3K46A 3NNJA 3HT1A 1URXA 2AC1A 5A70A 2AUYA 1QWRA 1BEV1 4N43A 3P3PA 3WY6A 1BKZA 2D7FA 2VQUA 4WVMB 5SV8A 3RYPA 5DUWA 3U1XA 2XQRA 1PK6A 1XSRA 2QQKA 2IZWA 2G19A 1W3VA 2GH2A 2A3XA 2RM21 4I02A 4JGYC 2J42A 3INAA 4AOCA 3O1OA 4XJWA 1R1A3 3R6SA 1UYYA 2WFF3 3H9AA 2Y64A 3RZZA 3WW1A 4UOJA 5FLJA 4QQHA 3PL0A 4BM8A 1TNRA 4MGYE 5FP7A 3C8XA 1XNKA 4GA9A 1C5IA 5GM0A 3KCXA 2WWUA 2BGCA 4DXTA 1QJX2 2VOTA 2ZKNA 1QXJA 5FZ6A 3AYAA 1AR61 5FZEA 2C1FA 2ZZQA 5K8SA 1POQA 2GU9A 2AZ5A 4E4DX 3GDBA 4P00B 2WAOA 4XF4A 2H6CA 1S0DA 2P3IA 2RM22 4HANA 1WLCA 4XC9A 5F5IA 4BQ3A 3KV4A 3SITA 5IVJA 1W6MA 2B9UA 1LCLA 2BVVA 4OYUA 1S0CA 3HBZA 3QH6A 3RMXA 5K0UC 4DXSA 5DUXA 1H9WA 5GALA 1S2KA 4O65A 1OLRA 5IW0A 2BDRA 3ZDVA 3NSTA 2VMDA 2HWC3 1QOSA 4EN0A 3LQCA 4HK8A 4AQ2A 3ZN4A 1HB3A 5GZFA 1S0JA 4E4ZA 5FZ0A 2WA4A 3NJZA 1RYYA 5LASA 4OI4A 2D6KA 1H8TB 3LIHA 1GNZA 1JZ2A 4AWDA 4NRPA 4FPCA 1WGPA 3M3CA 1GMMA 4Q0VA 4S2HA 3RPQA 5K0UA 3QD6A 1YQ2A 1UU5A 2CYFA 3WD5A 1YYNA 4IGPA 1SMVA 2VY0A 1NCQB 4KGGA 3VLBB 2K2SA 1COV1 2AREA 2R042 3HN1A 3VBRB 5JLVA 2PHTA 4XCBA 4L11A 5FY4A 5FXZA 1C8M1 2B42B 1LHOA 4BWOA 1XNAA 1AVBA 3AP5A 3H42B 1YC61 1JS9A 1S0GA 2A71A 2TNFA 3GNEA 4LHLA 4LO5B 2VUJA 1UO9A 3GHNA 3HD8B 4A7YA 4ARXA 5E88A 5JOZA 1FATA 3JQXA 2A7AA 4FOYA 1ULDA 5C5UA 1UU4A 1RINA 3POWA 1PO23 2EIEA 2V4AA 1JH5A 2QQJA 4BZ4A 5JXJA 4LMFA 1DF0A 4CEWA 4QKDA 1Q8PA 2W46A 2JG9A 1PVC2 5BNNC 1FMD2 2WS92 2PLV3 5IVFA 1RUJ2 4Y4RA 1KFXL 5FZAA 1LJ7A 3GJAA 3DEMA 3ZYFA 1HW5A 2O0OA 5A1AA 5IFPA 4TTGA 1Q5OA 4JKMA 1R64A 3ZYHA 1W06A 2YB7A 3KWVA 3A23A 1I5PA 3OGRA 4N43B 3MLLA 5FZDA 1XB9A 1NLQA 2UU8A 3ITQA 4ATFA 1O3RA 2P17A 3ZO0B 5BNNA 5IHRA 1JZ8A 4WM7B 1RVF2 2VNVA 4ISRA 2H0VA 2JIGA 4PLOA 4UF0A 2A5ZA 4JZRA 4MHUA 1QGLA 1QJFA 1VBA2 1EY2A 1VBB3 3C7GA 3SKVA 1ZBE3 3V56A 1RUG3 3TEWA 1QQP1 1G9DA 2OQ6A 3FFQA 4HN1A 4ZKTB 2WFPA 5EXOA 2RR11 2HBUA 2QQUA 3AP7A 2WBKA 3K2OA 3OD4A 4GH4C 4CUAA 3N9MA 3AXEA 1VRH1 4JGYB 1LGCA 1CVNA 1QNYA 4UFIA 2X10A 2GN3A 3FX3A 3NNLA 5ANQA 5C4WB 3M3OA 1J3PA 4D7TA 3E6BA 5FTTC 1EUUA 1O8SA 4M4RA 1M4WA 1GP5A 1X9PA 4HOOA 4J6GA 4BQ4A 1F5FA 2WC2A 4YM3A 2IFRA 1F5JA 4TN7A 4CCLA 3AP4A 2AEZA 4G4FA 3K51A 1Q8QA 1RL3A 1OPOA 3NNGA 4QGMA 1HXS3 1ZA4A 3VUOA 4Q4Y1 4XMIA 4OVEA 4RFT0 2R073 4NWWA 4OUEA 3LIGA 2W1UA 3DUIA 3MICA 4CDUC 2ZXQA 1EAH1 4DMIA 2EIGA 3NV1A 2JG8C 2QJVA 2VG9A 4S2DA 4LO4B 4M4PA 2GNTA 1TQ5A 1V9U2 5FPUA 3FFZA 5EJZB 2E26A 1S2BA 1CESA 4Q4X1 3DKQA 5A6XA 4CYDA 5ACA2 3I2JA 3MYXA 3LEIA 3MLJA 4OLLA 4PCRA 3TWIA 4Y22B 3NMBA 4UW4A 5I0RA 2V09A 5L7OB 3JBG1 3FE5A 2QQWA 2X09A 1UD1A 1QHDA 1VPHA 2J1UA 4GULA 2HWF1 5FZFA 4A4AA 1FI2A 1W9FA 1F2NA 2JG8A 1E5HA 2EALA 3EO6A 1EP0A 4LK6A 4F83A 3IDAA 4Y4YA 1LHUA 4QAWA 1SLBA 1TNFA 2SBAA 4W6YA 4W8JA 3KV9A 1AR93 3AKQA 5EV7A 2HLEA 5L73A 5BV6A 2BU9A 2JDAA 3WP5A 5JR7B 1OT5A 1RUH3 5JI9A 1UYXA 4CU6A 4NAOA 2TUNA 2RDSA 2A1XA 1PX4A 4PI0A 1JBCA 3PUQA 1CQ9A 4Z82A 3BALA 4BK4A 4BLJA 4JVAA 1VLNA 2ZX3A 3OPTA 2VMHA 3VBOA 1O8PA 3B69A 4KG0A 1RGSA 3TN91 4CTEA 4FOQA 1QJY2 4X6RB 2BNOA 5F2SA 1CZVA 3RS6A 2WYFA 5BNNB 1J1LA 3QACA 1DYKA 1SLIA 2RVAA 2DYCA 3VV1A 1OH3A 4IXLA 1ULOA 3KM5A 3LPGA 5I0DA 5LY2A 5GLVA 2CTVA 2B4KA 2ILMA 4D94A 5F2WA 1W04A 5FMOS 1GANA 3NV4A 2ZGPA 3EJKA 2XJTA 3OG2A 3OBAA 2OW4A 1OKOA 2JE7A 2QUOA 2XBO2 4XF0A 3MW4A 3RSJA 3GZTB 1JYIA 1OFNA 3K77A 4M0HA 3SHRA 1EYBA 4NHYA 1R093 4LEJA 2AR6A 5C7GA 1HRI2 4P5YA 1OFSA 1PMIA 4D0QA 4IE7A 3ZR6A 2UY8A 1ASJ2 3PUHA 1R1ZA 3M3QA 1RUI3 2ZGOA 2VQAA 4DB5A 3KF5A 4OHWA 1ND3B 2YY1A 2VQTA 3POEA 4GH4B 4Q0PA 1R1A1 1OD3A 2ARBA 1Y9GA 2X53S 3C7OA 5FWJA 4QM9A 2NMNA 4PJYA 1EPZA 3N9PA 5E1RA 4YFWA 5JSOA 1VE0A 1W2UA 2R063 4XFHA 1WW5A 5FOJB 3ZX7A 3GYDA 3CJIC 3E5XA 5FZHA 1OSGA 4HKLA 2VULA 3WINE 4AZZA 2P4EA 1SG3A 5JZGA 2ZGLA 4C1WA 2ZZJA 5IFTA 4K8RB 3AVSA 3I3BA 3POGA 4IEPA 4YZ5A 4PF1A 1Z7S3 3JU9A 2XPJA 3AZVA 1QKQA 2G9FA 1YQ5A 3A21A 3ZFEC 2QQMA 2ZGKA 3AM2A 3CJIA 3SH5A 4CDUB 5BNPC 3JD73 1P8JA 3FUOA 3DCQA 2HWC1 2VZUA 1IGOA 2LS6A 4GB31 4UFKA 1H2MA 5LATA 1ZBA3 3H0OA 4LQRA 2WO1A 2VMEA 3TYJA 3WF0A 3MIHA 4XURA 1UMHA 2JEMA 2WUHA 5KXCA 1SBFA 3FUQA 4QKFA 2BZDA 1HQLA 1ZVFA 4RR3C 2ZKLA 3VD7A 3ZKYA 5LRSA 4SLIA 1X33A 1RC6A 3NVCA 5GKAC 4RFRB 2PHWA 3ZVXA 1LOCA 4BQXA 1X50A 4IEUA 3O1PA 4QHZA 3AYCA 4Q1RA 5FRAA 3OGGA 3TEXA 3K3OA 2ZAHA 1KITA 2J1RA 4Q4W3 3UETA 5KWRA 3KHCA 1AR83 1TME3 3USSA 2GNDA 5DXDA 2ARXA 4RR3A 1NY71 1PZ9A 3SC7X 4XFGA 1YQ6A 4FAHA 5A3UA 2PXJA 3UKTA 4AL9A 2LTNA 2JDMA 1PO21 3W5MA 5KBFA 1NG0A 5JI7A 4HKOA 1Q8VA 4HPKB 2WQZC 3WX5A 4INDA 4X8PA 2ZX0A 1F9KA 3LKJA 4XBLA 5D8AC 4LKDA 4A41A 4M3CA 2PLV1 4AGGA 3UL2A 3D82A 1ULFA 1A3KA 2EA7A 2QFEA 3HNMA 4Z92B 4PF5A 2VECA 1GSLA 1N3QA 4E4SA 1AUYA 5D21A 4OQ9A 1DFQA 3NO8A 4LBQA 2OVUA 4BQ2A 1FX5A 2W1WA 2BFUL 2W1QA 4IEZA 4YVWA 1G9AA 3C3VA 4C91A 4XTPA 3VHOA 4ZONA 3I2FA 4X6QB 2D43A 4JRAA 2XXZA 3NRUA 1CAVA 2DVFA 1L3JA 2K46A 4ZS3A 4BYYA 3WF3A 3ZYBA 3I2KA 4ONUA 1JHNA 2A3WA 4RSUA 2GC0A 4ES9A 1ZBE1 1RUG1 2JB8A 4P5HA 1IKQA 3O0VA 2ORXA 3THCA 5HCFA 4AAPA 4N90A 2ZGRA 1V6KA 1PIV3 1MR5A 4MSVA 4K3UA 4SBVA 3I3DA 4FXKB 3UGFA 4CPBA 4YSFA 2CAVA 3RI8A 1I5ZA 1UY3A 1GFF2 1PO12 3FHIB 4TLFA 3WNKA 2TBVA 1AL22 1VBE3 4Q4V2 3ST7A 1LECA 2NMOA 4IERA 1QJEA 1HKDA 1B35C 3BOPA 3U4SA 2J1TA 3PVNA 4LT5A 1T6BX 2VTXJ 2EIBA 2YC0A 1UU6A 1QJX3 5T5JA 1POV1 1Q3EA 5FXWA 1H6XA 1XNDA 5KHGA 3CJIB 4YGBA 1DQ4A 4XEZA 1KXGA 4IE6A 2V73A 4AEMA 2RM23 2YBSA 4LIVA 5BYNA 5CFCC 1UOJA 3LOIA 2UY9A 2R071 4FVVA 1B35A 4RQPC 3BUCA 3ES4A 1AHSA 1DP0A 2O8QA 4EWAA 2FHRA 1JYCA 2C9AA 1J58A 3KCCA 2NM1A 3ZFEB 1PGSA 2A6VA 1O4YA 3G6JB 3SMHA 3UK9A 5BNOC 1QJU2 5BNPB 3VKMA 2X5IA 2HEWF 1AR63 1LNSA 4CP9B 3VHNA 5JR2A 4FP3A 3DYOA 4Z2WA 3CNAA 4M00A 4RQPA 1UPIA 3IDEA 4U2AA 2RV9A 2VO5A 3I59A 3AL6A 1YNAA 2R043 3O12A 5I8SA 1NCRA 4J25A 1YEWA 4JCKA 5EJ1B 4XDOA 1FPN1 1SZBA 1ND2C 3MI8A 4JHZA 5BNOA 1SACA 1V6LA 2ZEZA 3VBUC 5IK5A 5FCCA 5FV3A 5CZKA 2JDKA 3UJQA 4FAGA 2DF7A 2UWBA 2ZOEB 3LEKA 4N53C 1HV0A 1CZSA 3V65A 2P2KA 1XXNA 3NAPC 1NT0A 1AR91 1DGRA 4LBOA 3LDBA 1D2QA 3NNMA 5DUVA 2W1SA 4QDSA 1UX6A 4RS5C 1MS8A 2FDFA 3ZDSA 1XYOA 3LDKA 5DZEA 4XXAA 1D4M1 4V2VA 3ZYJB 5CISA 2XKPA 2RJKA 1COV3 2VVDA 3ETPA 4LBQB 1ZZ7A 3VBUA 1GUIA 5C3OA 5B4NA 4HBNA 1C8M3 1FMD3 2WS93 2YU1A 4COVA 1RUNA 1RHI1 1RUJ3 3DGTA 2Y38A 4IV3C 4N53A 4OCTA 4ATEA 2I45A 4NO4A 4QX8A 1VMHA 3S6PA 3NAPA 5D8AB 3V64A 4ZU7A 5FYBA 1F31A 5JIAA 5JCTA 2VUAA 2CDPA 4URAA 3HT2A 4RS5A 5H9QA 3ZYPA 3RFRA 2E33A 3M70A 1XNBA 2XG3A 3KCYA 2JDNA 5FXVA 2MPFA 3MGUA 4YWAA 2VZSA 1S0FA 1JYNA 1UAIA 4JX0A 2VMCA 1NZIA 4IV3A 3KSCA 3BCWA 4AXOA 2C5DA 2V5YA 3P3NA 1PNFA 1VAMA 2KXLA 4HMZA 4YW3A 1KFUL 5T3NA 1JOPA 1VBA3 1AR72 4ZZ5A 1TMF1 3CU7A 2ZX1A 4RGGA 3VN4A 2BOIA 2D44A 3ES1A 2W2IA 2JDPA 2MNGA 2OUHA 3LPFA 2PMWB 3T4HB 4D7YA 4ET7A 2VMFA 3LA3A 3BTYA 4IE4A 2VTFA 5I8TA 3BTZA 3PIJA 3J8F2 3WXPA 1GQGA 5J7MA 5H9RA 1DZTA 4RHV2 4MHRA 3LE0A 4BXFA 4XIOA 2H6BA 3J26N 4CCJA 3ALQA 3AZYA 3T09A 2F4PA 4MGKE 1XSQA 4QXKA 1XE7A 1B35B 3EB7A 4GJZA 4HLTA 2R061 4K9SA 2YXSA 4XAAA 3AB0A 5T55A 3I54A 4YW5A 1UNBA 1YCIA 3BYWA 3H1WA 3N7MA 1CX1A 2RS32 2FCUA 3C7EA 4CSWA 4X8NA 5FK7A 4CDXC 3BTXA 2VNRA 2VZOA 2XL7A 1X7NA 2ES3A 4A6SA 1S2EA 2E7QA 2QZ2A 1WBLA 1BVVA 1WD3A 1VRH3 1BK0A 2VBBA 3I3EA 4LBMA 5F1RA 5CIRA 3I2DA 5CFCB 5L9RA 4AEJA 4HN0A 4QD2A 4S2FA 4DNYA 2VM9A 4RQPB 3NV3A 5K4LA 5J1XA 2HWB2 4CCMA 4WVMA 5EPAA 4IEOA 4XYXA 4FPHA 4K8FA 1FNZA 1V9U3 2ZEXA 3MFAA 4PIZA 5KHHA 5JUVA 1SHWB 2VUCA 3THPA 3T2TA 4CUBA 5BNOB 1DLCA 2WWJA 5ACA3 1ZBA1 2Z2SB 1JOJA 2GMPA 4QX2A 2A75A 4ZHNA 1HN1A 1F8VA 4Q4Y3 1VBD2 2ZGUA 3K3NA 4QKNA 3WP3A 5DABA 1PNGA 2DU1A 4D69A 1CIWA 3WW3A 2QNKA 3T2OA 3SKJE 4EYUA 1KJRA 3NJYA 1J3RA 3ZYIB 3EHKA 4AEDC 1EAH3 1ND2B 1WBFA 2CU5A 4CP2A 5IVEA 5AC92 5DMYA 3D6EA 4OZOA 3AMQA 4LO7A 4Q4W1 4W50A 5FY8A 3VDAA 2XJRA 5FPAA 1AR81 1TME1 3VL8A 2VR4A 3ZXAC 1LU1A 4IQPA 1UZ0A 3AK0A 5FKCA 2DVGA 3NAPB 4CU9A 4R8HA 4QX7A 1BHGA 2CV6A 2P3KA 4CP1A 1ZRCA 3JBG3 1WMDA 1QY4A 4QB2A 4RS5B 3T2QA 1LB2A 3MUY1 1SLAA 4AEDA 2P1BA 3ACGA 4MX3A 4NRQA 4C90A 3S30A 3WQ0A 1ONAA 3ILRA 4FPOB 4AQTA 1SQ4A 4XFCA 4YYOA 4QB1A 2JE8A 3FLPA 4D7SA 1YIPA 4IV3B 1H8TA 2BP6A 4XFBA 1GV9A 4GQ7A 4AGRA 3PVEA 1DZQA 1UIJA 2WZ8A 2DTYA 5FZMA 5I91A 5J98B 1O5LA 1FOD2 1Q8SA 4MUVA 1NCQA 2ADDA 4I3PA 3VD5A 1CD3G 3CO2A 4B29A 1HLCA 2XWJB 2ADEA 1C8NA 1O59A 3WDYA 2ZTNA 2XBO3 2XJQA 5HXVA 3TN93 3MIGA 3BGAA 4KWJA 3GCWA 4CE8A 4ASLA 2R49A 5H9PA 2VCBA 4L8QA 5FPVA 4KBBA 3ECQA 3BIWE 4IEWA 4MLOA 1HRI3 3JZVA 4KGQA 5C3PA 1VALA 4Y33A 5CU1A 5AFEA 2HWE2 4RA0A 2LM3A 5FIXA 2XOMA 4ITCA 5FZ1A 5ABJC 3RWNA 3NW4A 4UFMA 3ZSMA 3AMNA 5F3CA 1N1YA 3I2GA 1TVGA 4BJ0A 1XOYA 2BJSA 4A44A 4LUKA 1UZVA 3ENRA 3PURA 4CXXA 3MIDA 3LF7A 3H7JA 3Q8CA 4L99A 3IDBB 5LZ6A 2NPIA 4E9KA 4B4RA 1AYM2 5FY1A 3MFCA 1W9SA 4EZHA 1AXZA 1QJX1 3KLSA 5T50A 3THDA 4UFLA 4GWJA 4LBQD 5F3EA 5ABJA 3ASIA 3QBQA 4IGQA 4K6BA 2D6NA 4XJ8A 4YW4A 2MHFA 4XCAA 4CDXB 3MPBA 3O14A 1IPKA 1IG0A 1DHKB 1KD7A 3AFKA 3FHAA 3H7YA 3URFA 2PFWA 4WM7A 3AZZA 3CQOA 3J9SA 2IXJA 2R1BA 4LHSA 4UWDA 5C4WC 3RZMA 3FJSA 3K4ZA 4R9DA 5FYMA 2FQPA 1NZCA 4ARYA 2WQ8A 4HETA 3IN9A 1WW7A 4HG6B 5CAZA 1EPWA 2YC2A 3T4VA 5T54A 4CCOA 2W39A 4KG8A 5IAVA 2WYSA 3S5QA 5FYTA 3I2OA 4CPBD 4NAMA 4JGYA 3VD3A 4XZPA 4AI8A 3GALA 1ZZBA 1YRZA 1HQWA 5C4WA 1LR5A 4UW6A 1NE4A 4N9HA 1H9PA 4YARA 1LGBA 2VW0A 2RDNA 1H2NA 1FNYA 5HV4A 2R041 1Q8OA 1AJOA 3S0MA 4UXAA 2AYHA 3SXWA 4AEDB 5J37A 1UY2A 4H2AA 4GB33 5FJKA 4KL1A 3D8CA 1GOHA 1H1MA 1K45A 4NMIA 3BB6A 2Z5WA 3H8OA 1CX4A 2ZHKA 1IQDC 1DQ1A 1L7QA 1OBNA 1SCSA 2WIIB 4KWUA 2WR9A 4UFHA 1OF4A 1LTEA 2Q5TA 2XVKA 3CIHA 5C6CA 4LHNA 1ZRDA 5IK7A 2OX0A 5HCAA 5C70A 4EWDA 4UBGA 2HEYF 2PQQA 3TBDA 3UGHA 3B02A 4K20A 2HBTA 3AKRA 3I3MA 4MVTA 1PVC1 4QQOA 1FMD1 2WS91 4AF9A 1RUJ1 2VOKA 4JKKA 2J1AA 3GBFA 1AX2A 3WOGA 4XUPA 5FY7A 5FYHA 4Y22A 4Q1PA 4MYEA 1DLLA 3EMRA 2ZMKA 3QLQA 5JOWA 1JZ4A 4DINB 3PVOA 1QNWA 4UBHA 3KB5A 1F35A 1LRHA 2JWPA 4M0NA 5JPNB 3I8TA 3ZFGC 5IK8A 1C4RA 3RJRA 5C3SA 4R4XA 5FBZA 5FYVA 4Q0SA 3MV11 5KHJA 4LBNA 1RVF1 4EROA 2VXJA 1CIYA 1G6NA 1XYPA 1RUD2 1OPMA 5IATA 3APBA 1WA6X 1VBA1 1LGNA 5GLWA 4CU7A 1W6QB 1JU4A 5LRRA 3F95A 5C71A 1AYN2 2Z79A 2L9LA 5CADA 3E6CC 5BPXA 2OYZA 3IB3A 1UY1A 1VAKA 4K7JA 4FSJA 1BQPA 1J59A 2WNVB 2Y6HA 1YHFA 1ZYBA 2DUQA 1XU1A 3ZFGA 1MZ5A 4AVBA 1AL23 2KM2A 5ABJB 3WCRA 3HOBA 4DXRA 1CJPA 1DYOA 1JXNA 3VBSC 1W0OA 4DFSA 2GC1A 2EAKA 2WZR2 2NYYA 5FLHA 3MHZA 4I0AA 5L9BA 3M3EA 3WW4A 2PHUA 1VBC2 1D0GA 3K75B 5LBFA 1H30A 3RZHA 1OOPB 1GLHA 1W05A 1Q43A 5DDJ1 3NQHA 4QPWA 4AHZA 4CZSA 1VJ2A 1X8MA 2CHHA 2W0XA 2ZEYA 1N3PA 1JUHA 2BOJA 3DF0A 4O9GA 4BISA 2PYTA 3BU0A 4FTSA 4PT6A 5FK8A 4QB6A 1ND3C 2DUOA 3VBSA 1AJKA 4WM8C 4YM0A 4MXWB 1GWMA 2IUWA 4Y3OA 4KQ7A 5AVAA 4ZU5A 2ZACA 2R30A 5LEKA 3SEPA 4PI2A 4H7MA 4LIUA 4AHWA 3NL1A 2FCVA 2PHDA 1JHJA 3TB0A 3HR9A 3ZYGA 1BCXA 1U5YA 5A7SA 5FZ8A 1QJU3 3AX4A 4MZUA 5JMOA 1POV3 3FHQA 1V9U1 5DDJ2 1H8VA 2DVAA 4AI0A 1PHMA 3GF6A 1YFUA 2OUJA 1ND3A 3GGLA 5GLZA 3JUUA 4GH4A 4LE3A 2GP3A 4WM8A 5ACA1 2DUPA 3DPRC 1OH4A 1KQRA 3AP9A 3GM8A 1OUXA 1HN0A 1BMV2 3V0AB 2SLIA 5DPNA 2DFCA 5J09A 2W68A 5LBCA 3U11A 3PMEA 3CHXA 2XDVA 3TEZA 1OHFA 4NPRA 4QGNA 4NR1A 4W65A 5I8YA 5HI0A 4DO0A 2YZ4A 3AKPA 3FLRA 4GKXA 4N7IA 1S0BA 3LZZA 2WNEA 3MIEA 1ZRRA 4XW3A 2WO3A 1UXXX 2P3YA 3T2PA 1JYTA 5J36A 2EXHA 3PDQA 3X29B 1O6UA 3H8UA 1UY0A 3E1F1 4LJHA 5I0UA 4IEYA 4K1ZA 4AFBA 5JWPA 3KT7A 4OZXA 2C9KA 5EIYB 5A3LA 2ARCA 1BLZA 2J1EA 4ASMB 1W8HA 5L7OC 2HH9A 2ORZA 2GZWA 4CDUA 3N3HA 3A0KA 1YO8A 4HFSA 1QJY1 3IKWA 3GZAA 1FPN3 1QXPA 2C6SA 3OOXA 3WVJA 3WSOA 4D6QA 3DXUA 1BXHA 5CFDC 3SQOA 2AGSA 4GAZA 2A6XA 2D3PA 1HQNA 3OUHA 2XJUA 1IHMA 3AC0A 3LFIA 4WZFA 4V2WA 4YG0A 2AENA 1QH6A 1KGYA 1W03A 2ZEWA 3EBRA 4Q8LA 4OHZA 4AVTA 4XHBA 2I07B 4AAXA 1O3TA 4AEKA 3N36A 1D4M3 4I2OA 5C8CC 2WNUB 2Y6GA 4QXCA 4LE4A 2XBO1 1RUF2 4IDZA 2GSYA 4E2QA 4ASKA 2QDNA 3I4IA 3ZFGB 5CFDA 4BE3A 1MEC2 2G9ZA 1WW6A 1RHI3 4LKFA 5FP9A 1H1AA 4AQSA 3W58A 5LW9A 3M2MA 4M3CF 4R9CA 3VL9A 1CPMA 4YZ4A 1HRI1 1SCRA 2YROA 2BRTA 3MLKA 2E7TA 2PN5A 4XDQA 3ZIWA 1ASJ1 5BY5A 3ABZA 1RUE2 3KV6A 4OUSA 1ODMA 2FBEA 4YG6A 3VZKA 5C8CA 3J8F3 4QPIC 2WLPA 2YFZA 3ZKUA 4WVVA 1RJ7A 2BWCA 1Q56A 4HPKA 3W59A 4RHV3 3ZIXA 3VKLA 5DG1A 2R7EB 3LA2A 1NQDA 3VBSB 4PBPA 1VAVA 5JAXA 2QVSB 1WMXA 1A6CA 1C5HA 2QQNA 4FQ4A 5JPMB 3NV2A 5FPZA 1TMF3 1UY4A 1W8UA 2A6YA 1PZ7A 2D40A 2RS33 2UURA 2Y0OA 3IIAA 4KU7A 4CCDA 4NIGA 5JXGA 4LBJA 4DUXA 3KGZA 2E51A 1DGLA 3RVHA 3LEGA 3WDUA 2CWSA 3OUIA 2NN8A 2FDIA 1W39A 1W9YA 2VXRA 1FXZA 3NJXA 3OPWA 3T0DA 4QX5A 4WM8B 5CG9A 4JRLA 4I09A 2HWB3 2XWBB 5LB6A 3AJYA 4FPGA 1XBFA 2BEOA 2B46X 2Y8KA 5C5TA 3WLUA 2CSGA 4MGZE 2BBVA 2KR2A 2HWD1 2GN7A 5LA2A 4ZXKA 2WZEA 4NPLA 3D0JA 4H3WA 3H3LA 4JAAA 2D6PA 5CBLA 4QXBA 1VBD3 5CKNA 3IDCB 3CF6E 1WCSA 3IMNA 4LULA 1MS4A 3DPRB 2BV4A 2GMEA 4R9AA 5FYSA 5FYYA 3SH3A 4A7KA 4CXYA 1KRIA 4Y1YA 3N9NA 1JN2P 1VP6A 1GZTA 5KXBA 3MW2A 4Q0QA 2WT1A 4NHKA 4BMBA 2FD8A 1NE6A 3GCXA 2LROA 5A33B 1LOEA 2WRAA 3Q8BA 1PGL1 1AZDA 3CBNA 4L2NA 4AYUA 4NHLA 3ROUA 3TNPB 4BIFA 1JI6A 3FWEA 4CXWA 2P37A 3U0ZA 2HWD2 1G9FA 1RMU1 1LODA 1XPWA 3MPPG 3KF3A 4HONA 4XQWA 4YGDA 5LA0A 2PHXA 2RE9A 3KQ4B 2IVIB 4C0HA 4EN7B 1WLTA 1W6OA 3ZFEA 2DCTA 1PM4A 4IEXA 4QU1A 2BNNA 2C26A 2VMGA 2WFF2 4XUNA 3IPVB 1SPPB 2Q0AA 4PIXA 3UT0A 4Z1VA 1EV11 5BNPA 5FZKA 2OA2A 4XJUA 4CP9A 3KS7A 1G9CA 3P1IA 4I3GA 1AX0A 4K40A 1TEIA 2D6MA 2VUDA 4LPLA 2IXKA 4DY5A 3T1MA 1W8NA 4B7KA 5CFDB 5LEJA 2ZGQA 3WNXA 4D6RA 2VGDA 1T6GC 1RMU2 1FOD3 3K4AA 3B5LB 5A3TA 2GH8A 1E57A 3TNQA 5IAXA 2UWCA 4AVAA 5KC5A 1ALYA 4HSLA 4P9WA 4NIDA 4DXZA 3P6BA 3B3QE 1W90A 1KEXA 2YG0A 4OUMA 3CZJA 3MIBA 3OEBA 5C8CB 3ZXEA 5GZGA 1GP6A 4JGZC 3ZYRA 2RMU2 4ISQA 3PHMA 3QH7A 1EV12 1ENSA 1H2KA 3LB9A 3KT4A 1WMFA 3D4KA 4GMP0 3USUB 3V0BB 3F2ZA 2Q8CA 1YFYA 1IG3A 1PMJX 2G9GA 2HWE3 5JIUA 3RMYA 4XFFA 4MGSA 1RIRA 2DTWA 1TE1B 2W87A 2Y60A 4BA6A 4BH9A 3RGBA 3VZMA 1JZ7A 2VTXA 1PO11 4QPIB 2HYKA 1KS4A 1AL21 4NJ4A 4Q4V1 2Q8EA 3M4FA 1DGWA 4A42A 2QE3A 5D8AA 3VZNA 1AXYA 4O9EA 4XF3A 2RS52 3OYWB 2Y34A 2ZMLA 1AYM3 4YNIA 3M8LA 5G05L 4FQZA 3OGSA 4YVSC 4BU2A 3N35A 4D3WA 1Z78A 1LHNA 5D1IA 1UZWA 5L19A 2EIDA 2E6VA 3BPZA 2BYVE 4XJ9A 2D93A 2HEVF 5GLTA 5JXHA 2JD9A 3S7IA 4AI9A 1JYXA 3THTA 3B9IA 2D5FA 4YG3A 1J3QA 1MZEA 1S55A 2CWMA 1A8MA 3CL1A 3NNFA 1Y43B 1NOVA 4PBOA 1JOBA 4UFJA 3NKGA 4CCEA 3CLPA 5FO8B 3KQRA 3MW3A 4YVSA 3VHRA 3IWZA 5EHDA 1JW6A 1YFWA 5CNAA 4B4PA 4XUTA 5KHKA 5GLUA 1QJU1 4L92A 5GZCA 1I1EA 5FMBA 3OBZA 2XQXA 4FOWA 4ZXEA 3TRSB 1PX3A 3WF4A 5FFOC 3T0BA 1D7PM 4CRQA 3WUDA 2OZ6A 2YGMA 4LK7A 4M01A 1WMEA 1X8EA 2AACA 3OD0A 4GALA 1RUC2 3ZFFB 1LOFC 1WKYA 4JTNA 3WEZA 1OLQA 4YGEA 2BBAA 2O1QA 4UYBA 4XMAA 2QKDA 5FZLA 4Q26A 1G86A 2JXAA 2QBXA 4CUGA 3I49A 3KV5A 1W6OB 3WW2A 2VCCA 5EFUA 5FY5A 3IBMA 3OF1A 4B1LA 5F3GA 5FMDA 4M3CE 4Y1ZA 1XYNA 3ZSLA 3RQ0A 1VBB2 4CCCA 2CGOA 1CWPA 1K12A 3PU8A 5CFCA 2B9VA 1XRUA 3LDRA 1LOFA 1CONA 3AXDA 4B4QA 2A6WA 1GZCA 1V70A 1DQ6A 4XILA 2PA7A 5FAXA 4NOTA 3JCIA 5FZ4A 2B5HA 3BPSA 3O1UA 1W0NA 1SBEA 2ZBJA 4WZCA 2EICA 2OT7A 4IL7A 1K42A 3SCGA 5CEHA 4AFAA 2MEV2 4K21A 1UF2C 2O14A 2P3JA 3WDWA 5FZOB 3BIEA 4XVHA 1XU2A 4G3YC 4FOVA 1Y3TA 2D5HA 1HXS2 4CUCA 1W9TA 3B7MA 1ND2A 3U37A 4OHYA 1OQ1A 3Q9OA 1PVC3 4NHMA 4IV1C 4JGZB 4WVZA 4HXCA 4F7ZA 1AR71 3BVCA 2FZ2A 5CKMA 2VE1A 3WCSA 1AYN3 2VVFA 1NKGA 1OMIA 5IVCA 5DAPA 3POFA 2Q30A 3RDIA 3O1VA 3O5SA 4O61A 4LNVA 3U78A 3HN3A 1M06G 4P9IA 4K1YA 2ZGNA 4RL7A 3LWCA 1NYWA 5IJRA 2VZQA 4GWMA 2WA3A 4A3XA 3J8F1 2XLGA 4RHV1 2WZR3 4E2GA 1K5MC 3ORJA 1RXFA 1REDA 1RVF3 2YBKA 1LAJA 1HIXA 1JYWA 5JOYA 3WF2A 5CVRA 1V6OA 2P6HA 1LU2A 4IETA 5FPBA 2OPWA 1QOTA 2RS31 4YVSB 4DZGA 1SFNA 3VDCA 5ERLA 3MDPA 1U5ZA 2RDRA 5T52A 3VKFC 5DUUA 5E89A 3IAQA 1A34A 4AR2A 1K5MA 1CJDA 1KDKA 1GOFA 2YPDA 3GZEA 3VBFC 4BQYA 1RUH2 1J83A 2I74A 4XF9A 3ZN5A 3MUZ1 1XNTA 4OHVA 4Y1UA 2QQPA 3KHBA 2HWB1 4EZ4A 2P34A 3MZHA 3L9JT 1ULGA 5J96B 1Y9MA 4Q8KA 5DDJ3 3RI9A 2A6ZA 1CAWB 1GZWA 3HNYM 1A78A 2BVBA 1Z0HA 2XVLA 2R6QA 2X29A 3ACIA 5EQUA 4FPKA 1G8WA 1AF9A 2DBNA 3RYKA 4GZ9A 2VCMA 1N3OA 1VBD1 2D3RA 4ORFA 3BI3A 4XJAA 2OIIA 4CEYB 4MO3M 3ATGA 2VOXA 1H6YA 1REEA 4LOTA 3LD8A 1O91A 5FYIA 5FUIA 3FBYA 2XUMA 4MGQA 2GMMA 5I0TA 2Q8DA 5AC91 1DGWX 1HRV2 1WD4A 2J1SA 4XABA 2VW2A 4CDXA 1W8ZA 2ZS6B 3ZMNA 2PHRA 2PHLA 4JDNA 3PJQA 3WV6A 1R092 4PQQA 4OI0A 4Y24A 3GBGA 4QHBA 1E5RA 1UOFA 5DN2A 2JECA 2ZMNA 1QF3A 1RUI2 1UXZA 2IFWA 2WLQA 3AMMA 4IE0A 1ZZ6A 5HBAA 1QJZA 2IVJA 4WVWA 4N7UA 4D8MA 4W6WA 4BB3A 1QDCA 1V6IA 5DZFA 1DGRN 1FV2A 4XZUG 3H8RA 1PZ8A 4AQ6A 2PQSA 4DUWA 3IMMA 3ZXKA 3VZJA 2WDBA 1X82A 2X8KA 3OBRA 3ILNA 1O5UA 3OGJA 2WQ4A 2Y33A 3WT3A 3VD4A 3DXTA 5GZEA 3RZGA 1ODNA 1FOD1 2Q1MA 1KDMA 3LFMA 4QMAA 5J3UA 5A7NA 5IVYA 2W3JA 3WNOA 1V6JA 1ST8A 4BLIA 1R081 3LEMA 1HJFA 1W3XA 1RUF3 5JMCA 4XXPA 2VOVA 4Q2FA 3Q8EA 1QJY3 4DRVA 3AMPA 1ZZ9A 2TEPA 3I97A 1Z7S2 4FFGA 1APNA 4PQ9A 2WO7A 1IS5A 3HBKA 4XBQA 4FI9A 3SH4A 4IV1B 3DN7A 4CCNA 5IYYA 2Z4FA 2GAUA 5F7UA 2W94A 3JD72 4L9BA 4AE2A 4HKWA 2HWE1 4XOGA 3B00A 3HQUA 4KMQA 1C28A 3NWKA 1IS6A 2Q4SA 2VU9A 3IAPA 2B8MA 3B93A 3PIGA 1US3A 1SEFA 1R082 2VW1A 2RS12 2XR4A 3LSDA 3Q8FA 2EXKA 1OA2A 3OJBA 1K5MB 1GWLA 1LEDA 2D97A 5JXIA 1CAXB 1N1VA 4YGCA 5E8AA 3ZXFA 1AYM1 4YLZA 1BJQA 4ZPIA 4BMEA 4NN0A 3K4DA 3OY8A 3KZ4C 1W6PB 5JSRA 2Q8OA 3T3YA 1ASJ3 4LLFA 1ENXA 2XONA 2WNVC 3H1YA 1GZWB 2PAMA 4GD4A 3VDDB 4YM1A 1WCKA 3J4UH 1UIKA 1W8WA 5FY9A 3T08A 3AKTA 4RYDA 3VBFB 1HDKA 3GBWA 1UN1A 2GP5A 2YU2A 3C2UA 1UYPA 1W6QA 2ETEA 2CNAA 1OOPC 2JB4A 1OA4A 4YZ3A 2EAAA 3AFGA 3UV9A 2VVEA 4HZFA 4Y5SA 4PDWB 3WG2A 4LXLA 2XLAA 3S5AA 2XKOA 4YW2A 2DCKA 2VBPA 5EZWA 1VB4A 2WNVA 3MF9A 4XACA 4CDQC 5FYZA 2FMDA 4W6XA 1FV3A 5HCBA 2EXIA 4FBFA 1LOAA 3AYDA 2CDOA 3BOWA 5LA9A 1US2A 4LORA 1PK6C 5CYYA 4P02B 3N7KA 1GP4A 4Y26A 1OOPA 4KWLA 2ZCWA 3UJOA 1U12A 1K3IA 1W6NB 4ES8A 2VL4A 3VBHB 1LOGA 5FZ7A 4CU8A 1L7RA 1PGW2 1T2XA 1IQAA 3AP6A 4NIHA 1GWKA 1YI7A 5CKQA 2HWD3 5IT6A 4EE2A 3A7QA 2NZ9A 4EN8B 4MXWA 4R4ZA 2LRPA 1C1FA 2BQPA 1BK1A 3HWJA 4I0BA 4QU2A 1O3SA 2CGNA 1NLSA 2BGOA 1PGL2 1SLCA 4KBZA 5LBEA 1PIV2 2V4VA 3DKWA 4KNCA 3SLIA 2JDZA 1JYVA 5FDBA 1OLME 2RG4A 2UYBA 1W2OA 1J1TA 1DQ5A 2FZ1A 2P6CA 2VC9A 3I7DA 3KVBA 1VBE2 3IZOA 1YQCA 4H14A 2B7YA 4QPGC 4XUOA 2UWAA 2WAAA 1BBT2 3CKHA 5K7PA 2VMIA 3QOPA 2EXJA 5EP9A 4L97A 1UX7A 1MZ6A 4GIQA 4LLOA 1YIFA 1RMU3 1BEV2 2DVBA 4LKSA 3V0AA 1NA1C 5FKBA 5A7PA 3HQRA 4AFCA 2A73B 4GWIA 2R32A 5JOXA 3JXSA 4KU8A 5F39A 5FUPA 4DPNA 1FT9A 1MZFA 2IXIA 4NUBA 1D2SA 1NLRA 5E16A 2RMU3 4QPGA 5DG2A 1VIWB 1AX1A 1EV13 2W92A 3HEIA 4RN5A 4Y5TA 3WNLA 3ZOIA 4DOUA 2VAUA 3AMHA 4YW7A 4OHXA 4XF1A 1RUD1 2PELA 2LALA 4NVPA
chains in the Genus database with same CATH topology
4JV4A 4KWKA 2XLFA 1AYN1 3O7OA 1NA1A 1C3HA 1MS1A 3AKSA 1DBNA 2WKKA 5A32B 3D5OA 4P9JA 3FLTA 4AGVA 3N4MA 1AR62 3LOBA 2K9ZA 2CGPA 3R05A 3U07A 3AZWA 3OY8B 2IXCA 4BPZA 2XL9A 2WNUC 3M7AA 3DL3A 3N7JA 2WZR1 2E53A 2WT2A 2RS53 2YYOA 1GNHA 1VBC1 2WWSA 1KJLA 5BUVA 1GQHA 1OQDA 3RRDA 3U4XA 3B9CA 3ELNA 3MF6A 3GHMA 4CEWC 5KXEA 2CY6A 1CN1A 1IS3A 4MGIE 2JG9C 1IOAA 4R9BA 3QCWA 3ZSKA 4LR4A 5F6LB 1DU3D 1YUDA 2WNUA 4XQDA 4FO9A 4MV2A 2ZHLA 2HJIA 4LTAA 1PO13 2ZHMA 4Q4V3 2ZGTA 3SNMA 1MS3A 1NXMA 1REFA 3VKOA 4OFGA 2YDEA 4IESA 4B3NA 1FYUA 1COV2 4B7EA 2W08A 3E5UA 1XE8A 1ZZCA 1C8M2 1MQTC 1ULCA 1X36A 2CL2A 3O0XA 3DV8A 1G7YA 1GBGA 4CDQB 3KD4A 2YHJA 1DQ0A 1YJLA 2GALA 3WDTA 3WHUA 1BMV1 2E7AA 1G9BA 1RUC3 5T5PA 4C1XA 1PK6B 4YM2A 2OZJA 1C1LA 5EYXA 1ULEA 1MQTA 1V6NA 4H7LA 2A3YA 2ZX2A 4XTMA 5CA6A 1HV1A 3FMGA 4P9XA 4FPYA 4BOWA 2NLRA 2DU0A 1MVQA 4FPEA 4IEQA 3LCPA 3M1HA 4HK9A 2LUWA 4P14A 2PAEA 1GR3A 4GMP3 4AI2A 1QMJA 1ZREA 4QQ2A 4CP0A 1DDLA 2MEV3 3E97A 4COUA 3ZSJA 1UL9A 1GKBA 4DRRA 5FOBB 1W6MB 4QPGB 2R16A 4AHXA 1LULA 2QDRA 3DPRA 1O4ZA 1WLDA 5SV5A 5KHIA 2DWRA 2JJ6A 1QQP2 3FC0A 3IM0A 1NA1B 2RHPA 1UPSA 4S2GA 2RR12 5A33A 1NQJA 3RG0A 1RUF1 1VRH2 4COYA 2HKXA 1MEC1 5J48A 1V6MA 2ERFA 1BZWA 1D4VB 1YFXA 5K0UB 3ZXDA 3KGLA 2QCSB 1AL0G 3RYRA 1CGPA 5CG8A 2JE9A 1RUE1 4U36A 4BIOA 3VKNA 3WG4A 4CDWC 2ZAAA 5L7OA 3IPVA 1N1SA 4BHPA 4LA2A 2R0HA 1GZ9A 2YMZA 4Q4Y2 1FAYA 4LA3A 4FTBA 2ZGMA 3WQ7A 1MS0A 2ZX4A 2Z42A 4IEVA 1U5IA 1AR73 3LGRA 5T5LA 3VBOC 3RJ2X 1EAH2 5JVVA 1SFYA 2BFUS 1OD5A 3E5QA 2XB6C 4COWA 2XGXA 3T1LA 4CDWA 4CEWB 1ZRFA 2JG9B 3VZLA 3BODA 3B01A 4LBLA 1DQ2A 4Q4X2 2WSVA 2WL1A 4V1PA 3UKNA 1QDOA 1QU0A 3USUA 3V0BA 4R52A 3JBG2 4B8EA 4TYSA 4AVVA 2HWF2 2C0ZA 1CPNA 2IWGB 4P9YA 1MQTB 5I0SA 4ZU4A 4QPIA 5C33A 1A8DA 2RJLA 5IUQA 3K48A 1SLTA 2G4IA 5FO7B 1JUIA 3HMYA 5EWSA 5EJ3A 3ZMOA 5FO9B 3OYWA 1OI6A 3IT8A 1VB2A 5F6KA 2DVDA 1HRV3 3TN92 3WUCA 2XJVA 4JDOA 2IC1A 4MH0E 4AW7A 1I3HA 2WSUA 2NP0A 3TOJA 4Q0UA 4OULA 2WZPP 3JQWA 1KS5A 1DG6A 1ENRA 3L2YA 4PLNA 3ZPYA 4DQAA 3LSEA 1U5XA 3ZFFC 1WLWA 1UKGA 1W0PA 2XHKA 5JZGC 1UZZA 1WW4A 2WFF1 3E6DA 4QPYA 5FLIA 1RB8G 2VPVA 1LESA 5EYYA 4F3JA 5AC93 1V00A 5GJ6A 1OKQA 1WA4A 2WINB 3H1MA 3AJZA 3ZFFA 4YZ2A 2I2SA 4XHXA 1PM7A 1Y9QA 4Y5Z0 5BNQA 5L36A 1N1TA 1R1A2 2RMU1 4UW3A 5BXXA 2ZPXA 1DIWA 2JENA 5KXDA 2ATFA 4MXVA 2JG8B 4TSVA 3OTFA 2EF6A 4AI3A 4G9SB 1XNCA 3WDXA 4H55A 5K9YA 3POSA 4CDWB 4Y20A 1R083 1HX6A 2RS13 2JKBA 1LENA 2D98A 5B2GB 5KC6A 2BNMA 4XBNA 1BVP1 3WQ1A 2NQYA 2RS51 4EV0A 5FPXA 2CAUA 3VBOB 1ENQA 4A2UA 2HWC2 2YGLA 4GB32 4XPVA 1C57A 4XIKA 4YFZA 4EN6B 4AK3A 1POV0 4JGZA 3WR0A 3R4DB 3S7EA 3OCPA 3HAGA 1BYHA 1S0IA 4YVWC 4FPLA 4WV8A 4FPFA 3EXUA 3VGIA 5LK7B 5F5QA 2D6LX 3KMHA 3SCHA 5I93A 4Q29A 1MS9A 1RUC1 1U0AA 1NY72 3ME2A 4GKYA 3TAYA 4XETA 4AI1A 2Q1ZB 3HQXA 2YV8A 4GXLA 1PO22 3UKVA 2AH2A 2BPA2 2QZ3A 4JC1A 5FMOL 5H9SA 4Q27A 4F8AA 2PLV2 4J1WA 1ZNPA 4P9GA 1VBB1 2UYAA 4BQ1A 1YJKA 2FMYA 2DURA 4C0BA 4CEYC 3PLQA 4GMP1 2B39A 4XFAA 5CB7A 3ETQA 5JZGB 1CAWA 2WJSA 4HVQA 1BBT3 2MEV1 2OPKA 3ACLA 2Y0IA 3H3UA 2R1DA 1BEV3 2ENRA 4Y1XA 3WDVA 2ZA9A 4CEYA 1XQNA 1OA3A 1QH7A 1ZBE2 1RUG2 2D6OX 3MIFA 2DV9A 1B09A 4URTA 3PVBB 2X5IC 2ET7A 1RJ8A 2XJPA 2VQ0A 1HXS1 4BCUA 2JX9A 5C9AC 3D0SA 4Y20B 5LK5A 1UKRA 1YWKA 1CR7A 1LEMA 3N7LA 1S0EA 3ILFA 2ET1A 1NCRC 2H0BA 4LUMA 5F9TA 3HIFA 1YXWA 2JD4A 4LO6B 2ZJCA 2KA3A 1UMZA 4AVCA 4COZA 5JDBA 1D0HA 3JB8A 1H0BA 1RUOA 3OBTA 4PIYA 5C9AA 4LBKA 4E2SA 3CJXA 1O3QA 3GZUC 2GC3A 2R072 1LHVA 2XJSA 4DY3A 4RR3B 1AXKA 4JQRA 4QQLA 1RUD3 1NXD1 2DFBA 5AFBA 5FQ0A 2YUEA 4TWTA 2K0GA 2ZABA 1LOBA 4QQPA 2EVXA 2W52A 1ZX5A 5FREA 3LA7A 3H50A 4M3CB 3B94A 5TSWA 3SCFA 4LHKA 1RUH1 2Y26A 1DYPA 5C8WA 4Z07A 4EJRA 4HSJA 4IV1A 4JTOA 1VBC3 4I01A 4PLMA 1H2LA 4YVWB 5JSPA 1FPN2 3FBMA 4AVSA 5IK4A 3ZN6A 1H4GA 3FZ3A 1CAVB 2E63A 3OPZA 3VDDC 2BUKA 2Z69A 1AR92 1UZYA 2BTVC 2ZHNA 4AHYA 1I9RA 1CAXA 3VZOA 2IXHA 3ZXLA 1D4M2 4FXGB 2O8OA 1W6PA 2VOWA 4PDWC 4AG4A 1HRV1 2F6BA 1RHI2 1UCXA 4UW5A 3VDDA 1SLLA 1MS5A 1R091 4EWEA 4AFDA 3W9AA 3VBFA 1IS4A 2WT0A 3R4SA 3M3IA 4EN9B 2PHFA 3WP4A 3MEPA 1RUI1 4RD7A 4HT1T 1O4TA 4PDWA 3WZ1A 4QGLA 1CAUA 3WP6A 3VBHC 3AZXA 4HL0A 4I30A 4Y1VA 3A0NA 4Z8BA 1ZZ8A 3BU7A 1QOOA 1TMF2 1QQP3 1GICA 2IXLA 3H3ZA 5GZDA 2RR13 1WCDJ 2X5IB 1W6NA 4XJZA 1H4HA 2PTMA 3VBHA 4TZDA 4YZ1A 1WUVA 2GNMA 3WG1A 3CEWA 3ZSEA 3WG3A 5C9AB 1Z7S1 1GYKA 3PNAA 4RGAA 4GWNA 3I59B 4N9IA 4FT8A 2PAKA 1NCRB 3JD71 2R062 4HVOA 2DCZA 2JICA 4WBBA 1OQEA 2VH9A 2B45X 5FQ0B 4OI1A 1N47A 4QT6A 1YI9A 2RS11 2YPJA 4P9LA 3LAGA 4E27A 4FCAA 4XQ4A 1MEC3 5DZGA 3VHPA 3JB4C 3WHTA 1I6XA 1DZRA 4DS0A 4OI2A 3VBUB 2D3SA 3O0WA 3EQEA 4XE9A 1RUE3 4Q4X3 1H8TC 4N53B 3ZN6B 4JDMA 1ZBA2 1LHWA 1S1AA 2N7GA 1YLLA 1SBDA 4YW1A 3R4UA 4YRDA 4AFMA 4QM8A 1SDWA 1NCQC 3RNSA 2HWF3 3VBRC 2BW8A 2DCYA 5A32A 4I0WB 4FTEA 1IPJA 3A4UA 3PTYA 4J1XA 3U10A 3POYA 1MVEA 3ZXGA 3PJYA 2E9QA 4Q4W2 1AR82 1TME2 1O7FA 3NKTA 2GDFA 3PMSA 2A70A 3VBRA 2VNGA 2GC2A 4FPJA 4META 1PVXA 1QXRA 3AYEA 1LKNA 3L2HA 1JTZX 1PGW1 3G7DA 1VR3A 4HVRA 1CAUB 1IKPA 1Y7BA 2VNOA 1MACA 3SISA 3BTAA 2XH6A 3ZXJA 2XVGA 4A7ZA 4XFIA 4N43C 4FP2A 1RITA 1UW8A 1PIV1 2BWAA 2R0FA 1IZ3A 1RTVA 1ZM1A 2ZGSA 3KT1A 1H1IA 4LO8A 5T5OA 4NWVA 2GNBA 4KH9A 1VBE1 4WM7C 2DCJA 1BBT1 4CDQA 5A3MA 3R0RA 3HT1A 1URXA 2AUYA 1QWRA 1BEV1 4N43A 3P3PA 3WY6A 1BKZA 2D7FA 4WVMB 5SV8A 3RYPA 5DUWA 1PK6A 2IZWA 2GH2A 2A3XA 2RM21 4I02A 4JGYC 3INAA 4XJWA 1R1A3 3R6SA 2WFF3 3H9AA 3RZZA 3WW1A 5FLJA 4QQHA 4BM8A 1TNRA 4MGYE 5GM0A 1XNKA 4GA9A 1C5IA 3KCXA 2BGCA 1QJX2 2ZKNA 1QXJA 3AYAA 1AR61 2C1FA 2ZZQA 5K8SA 2GU9A 2AZ5A 4E4DX 4XF4A 2H6CA 1S0DA 2P3IA 2RM22 4HANA 1WLCA 3SITA 1W6MA 2B9UA 1LCLA 2BVVA 5K0UC 1S0CA 3HBZA 3QH6A 3RMXA 5DUXA 1H9WA 5GALA 1S2KA 1OLRA 3NSTA 2HWC3 1QOSA 4EN0A 4HK8A 4AQ2A 3ZN4A 5GZFA 1S0JA 4E4ZA 2WA4A 3NJZA 4OI4A 2D6KA 1H8TB 1GNZA 4AWDA 4FPCA 1WGPA 3M3CA 4Q0VA 4S2HA 3RPQA 5K0UA 3QD6A 1UU5A 2CYFA 3WD5A 1YYNA 4KGGA 1SMVA 2VY0A 1NCQB 3VLBB 2K2SA 1COV1 2AREA 2R042 3HN1A 3VBRB 5JLVA 2PHTA 4L11A 1C8M1 2B42B 1LHOA 4BWOA 1AVBA 3AP5A 1S0GA 2A71A 2TNFA 3GNEA 4LHLA 4LO5B 2VUJA 3GHNA 3HD8B 4A7YA 5E88A 5JOZA 1FATA 3JQXA 2A7AA 4FOYA 1ULDA 1UU4A 1RINA 3POWA 1PO23 1JH5A 4BZ4A 1DF0A 4CEWA 1Q8PA 2JG9A 1PVC2 5BNNC 1FMD2 2WS92 2PLV3 1RUJ2 1KFXL 1LJ7A 1HW5A 2O0OA 1Q5OA 4N43B 3MLLA 2UU8A 1O3RA 4ATFA 2P17A 3ZO0B 5BNNA 4WM7B 1RVF2 4ISRA 2H0VA 4PLOA 2A5ZA 1QGLA 1VBA2 1EY2A 1VBB3 3V56A 1ZBE3 1RUG3 1QQP1 1G9DA 3FFQA 4HN1A 4ZKTB 2WFPA 5EXOA 2RR11 3AP7A 3OD4A 4GH4C 3AXEA 1VRH1 4JGYB 1LGCA 1CVNA 1QNYA 2GN3A 3FX3A 5C4WB 3M3OA 1J3PA 4D7TA 3E6BA 5FTTC 1M4WA 4J6GA 1F5FA 2WC2A 4YM3A 2IFRA 1F5JA 3AP4A 4G4FA 3K51A 1Q8QA 1RL3A 1OPOA 4QGMA 1HXS3 1ZA4A 3VUOA 4Q4Y1 4XMIA 4OVEA 4RFT0 2R073 4NWWA 3DUIA 3MICA 4CDUC 1EAH1 4DMIA 2EIGA 3NV1A 2JG8C 2QJVA 2VG9A 4S2DA 4LO4B 2GNTA 1TQ5A 1V9U2 3FFZA 1S2BA 1CESA 4Q4X1 4CYDA 5ACA2 3MYXA 3MLJA 4OLLA 4PCRA 3TWIA 4Y22B 4UW4A 5I0RA 2V09A 3JBG1 3FE5A 1UD1A 1QHDA 4GULA 2HWF1 1FI2A 1F2NA 2JG8A 2EALA 3EO6A 1EP0A 4F83A 4Y4YA 1LHUA 1SLBA 1TNFA 2SBAA 4W6YA 1AR93 3AKQA 5EV7A 5L73A 5BV6A 3WP5A 5JR7B 1RUH3 5JI9A 4FAHA 2TUNA 4Z82A 1JBCA 1CQ9A 3BALA 4BLJA 4JVAA 1VLNA 2ZX3A 2VMHA 3VBOA 3B69A 4KG0A 1RGSA 3TN91 4CTEA 4FOQA 1QJY2 4X6RB 2BNOA 3RS6A 5BNNB 1J1LA 3QACA 1DYKA 1SLIA 3VV1A 2DYCA 4IXLA 3KM5A 5GLVA 2CTVA 2ILMA 4D94A 5FMOS 1GANA 3NV4A 2ZGPA 3EJKA 2XJTA 2OW4A 2JE7A 2QUOA 2XBO2 4XF0A 3RSJA 3MW4A 3GZTB 1JYIA 1OFNA 4M0HA 3SHRA 1EYBA 1R093 4LEJA 2AR6A 1HRI2 1OFSA 1PMIA 2UY8A 1ASJ2 1R1ZA 3M3QA 1RUI3 2ZGOA 2VQAA 4DB5A 4OHWA 1ND3B 2YY1A 4GH4B 4Q0PA 1R1A1 2X53S 2ARBA 4QM9A 2NMNA 4PJYA 1EPZA 5E1RA 4YFWA 5JSOA 2R063 1W2UA 4XFHA 1WW5A 5FOJB 3ZX7A 3GYDA 3CJIC 3E5XA 1OSGA 4HKLA 2VULA 3WINE 5JZGA 2ZGLA 4C1WA 2ZZJA 4IEPA 4YZ5A 1Z7S3 3JU9A 2XPJA 3AZVA 1QKQA 2G9FA 3ZFEC 2ZGKA 3AM2A 3CJIA 3SH5A 4CDUB 5BNPC 3JD73 3FUOA 2HWC1 1IGOA 4GB31 1H2MA 1ZBA3 3H0OA 3TYJA 3MIHA 5KXCA 2JEMA 1SBFA 3FUQA 1HQLA 1ZVFA 4RR3C 2ZKLA 5LRSA 4SLIA 1X33A 1RC6A 3NVCA 5GKAC 2PHWA 3ZVXA 1LOCA 1PGL2 1X50A 4IEUA 3AYCA 4Q1RA 5FRAA 3OGGA 2ZAHA 1KITA 4Q4W3 5KWRA 1AR83 1TME3 3USSA 2GNDA 5DXDA 2ARXA 4RR3A 1NY71 1PZ9A 4XFGA 3UKTA 2LTNA 1PO21 5KBFA 1NG0A 5JI7A 4HKOA 1Q8VA 4HPKB 2WQZC 3WX5A 4INDA 4X8PA 2ZX0A 1F9KA 3LKJA 4XBLA 5D8AC 4M3CA 2PLV1 4AGGA 3UL2A 3D82A 1ULFA 1A3KA 2EA7A 2QFEA 4Z92B 4PF5A 2VECA 1GSLA 1N3QA 4E4SA 1AUYA 1DFQA 3NO8A 4LBQA 2OVUA 1FX5A 4IEZA 2BFUL 4YVWA 1G9AA 3C3VA 4C91A 4XTPA 3VHOA 4X6QB 2D43A 4JRAA 1CAVA 2DVFA 1L3JA 4BYYA 4ONUA 1JHNA 2A3WA 4RSUA 2GC0A 4ES9A 1ZBE1 1RUG1 4P5HA 1IKQA 3O0VA 5HCFA 4N90A 2ZGRA 1V6KA 1PIV3 1MR5A 4MSVA 4K3UA 4SBVA 4YSFA 4FXKB 2CAVA 3RI8A 1I5ZA 4TLFA 1GFF2 1PO12 3FHIB 2TBVA 1AL22 1VBE3 4Q4V2 3ST7A 1LECA 2NMOA 4IERA 1HKDA 1B35C 3BOPA 4LT5A 3PVNA 2YC0A 1UU6A 1QJX3 5T5JA 1POV1 1Q3EA 1XNDA 5KHGA 3CJIB 4YGBA 1DQ4A 4XEZA 1KXGA 2V73A 4AEMA 2RM23 5BYNA 5CFCC 3LOIA 2UY9A 2R071 4FVVA 1B35A 4RQPC 3ES4A 1AHSA 2O8QA 4EWAA 2FHRA 1JYCA 2C9AA 1J58A 3KCCA 2NM1A 3ZFEB 1PGSA 2A6VA 1O4YA 3G6JB 3SMHA 3UK9A 5BNOC 1QJU2 5BNPB 3VKMA 2X5IA 2HEWF 1AR63 3VHNA 4FP3A 4Z2WA 3CNAA 4M00A 4RQPA 1UPIA 3IDEA 4U2AA 3I59A 1YNAA 2R043 3O12A 5I8SA 1NCRA 4JCKA 1FPN1 1ND2C 3MI8A 5BNOA 1SACA 1V6LA 3VBUC 5IK5A 5FCCA 3UJQA 4FAGA 2DF7A 2UWBA 2ZOEB 4N53C 1HV0A 3V65A 2P2KA 1XXNA 3NAPC 1AR91 1DGRA 4LBOA 1D2QA 5DUVA 1UX6A 4RS5C 1MS8A 3ZDSA 1XYOA 5DZEA 4XXAA 1D4M1 3ZYJB 2XKPA 2RJKA 1COV3 2VVDA 4LBQB 1ZZ7A 3VBUA 4HBNA 1C8M3 1FMD3 2WS93 4COVA 1RUNA 1RHI1 1RUJ3 3DGTA 2Y38A 4IV3C 4N53A 4ATEA 2I45A 4NO4A 3S6PA 3NAPA 5D8AB 3V64A 4ZU7A 1F31A 5JIAA 5JCTA 2VUAA 3HT2A 4RS5A 5H9QA 3ZYPA 3M70A 1XNBA 2XG3A 3KCYA 2MPFA 3MGUA 1S0FA 1UAIA 4IV3A 3KSCA 3BCWA 4AXOA 2C5DA 2V5YA 3P3NA 1PNFA 1VAMA 2KXLA 4HMZA 4YW3A 1KFUL 5T3NA 1VBA3 1AR72 1TMF1 3CU7A 2ZX1A 4RGGA 3VN4A 2D44A 3ES1A 2MNGA 2OUHA 4D7YA 3LA3A 5I8TA 3J8F2 3WXPA 1GQGA 5J7MA 5H9RA 1DZTA 4RHV2 4XIOA 2H6BA 3J26N 3ALQA 3AZYA 2F4PA 4MGKE 4QXKA 1XE7A 1B35B 4HLTA 2R061 4K9SA 2YXSA 3AB0A 5T55A 3I54A 4YW5A 1YCIA 3H1WA 3N7MA 2RS32 4X8NA 4CDXC 2VNRA 2XL7A 1X7NA 2ES3A 2E7QA 2QZ2A 1WBLA 1BVVA 1WD3A 1VRH3 4LBMA 5F1RA 5CIRA 3I2DA 5CFCB 4AEJA 4HN0A 4QD2A 4S2FA 4DNYA 4RQPB 3NV3A 2HWB2 4WVMA 4IEOA