4IEPA

Unliganded cysteine dioxygenase at ph 4.5 in the presence of cys
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
186
structure length
186
Chain Sequence
ELLKPRTLADLIRILHELFAGDEVNVEEVQAVLEAYESNPAEWALYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTDSHCFLKLLQGNLKETLFDWPDKKSNEMIKKSERTLRENQCAYINDSIGLHRVENVSHTEPAVSLHLYSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cysteine Dioxygenase Structures from pH4 to 9: Consistent Cys-Persulfenate Formation at Intermediate pH and a Cys-Bound Enzyme at Higher pH.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
molecule keywords Cysteine dioxygenase type 1
total genus 56
structure length 186
sequence length 186
ec nomenclature ec 1.13.11.20: Cysteine dioxygenase.
pdb deposition date 2012-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05995 CDO_I Cysteine dioxygenase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4iepA00
3SHRA 3FX3A 2GZWA 1Y3TA 4L2NA 3OCPA 4I3PA 3USSA 3DV8A 2FMYA 4KWLA 4MGZE 3NJZA 1LB2A 2V09A 4E2QA 2XLGA 4XEZA 4J1XA 3FE5A 3H1MA 3NW4A 1XE7A 1WGPA 4KWJA 1H1IA 1J3PA 4QXKA 2OZ6A 3UKNA 2MNGA 3L2HA 1UIKA 3HT1A 4ZU7A 1J58A 3ACLA 2UYBA 1UW8A 2ETEA 1RL3A 4MUVA 1J59A 3LA7A 4H7LA 5LEKA 1RUNA 1Q43A 3HQXA 1ZRRA 4D7TA 1WLTA 3GYDA 5JSOA 3KGLA 2K0GA 3OGJA 4HVOA 2ZCWA 3BPZA 2FQPA 3SCFA 4XFFA 1RGSA 4N9HA 1HW5A 2GC1A 5BV6A 1J1LA 2PHDA 4UBGA 3PNAA 4META 2HKXA 2IXJA 1O7FA 4IEXA 4BYYA 2O1QA 2OZJA 4LLOA 2OPKA 4B29A 1OMIA 3KGZA 1IPJA 1ZNPA 3LOIA 4E2SA 5I8YA 4GULA 2KXLA 2D93A 2WFPA 3H8UA 1XE8A 3OTFA 2BGCA 2GC2A 4YRDA 3O14A 3FZ3A 1OFNA 4PIZA 1YFXA 2XKOA 4PJYA 3LA2A 4IEZA 1X7NA 2Q1ZB 1OI6A 1FT9A 4L11A 1WA4A 4EWEA 5KHJA 4KWKA 4QX5A 2XL7A 4XF3A 4XFIA 5KHGA 3QOPA 4LTAA 3DL3A 4MV2A 2Z2SB 1SQ4A 2IXKA 2QDRA 2CAUA 1NYWA 5CADA 1X82A 4JTOA 4XF9A 1VJ2A 3S7EA 4XFCA 4FAGA 4HSJA 4BH9A 3KMHA 3E5XA 3ES4A 2Z69A 4AQ6A 1QY4A 1CAUB 2I45A 3NKTA 2ATFA 2BYVE 1YFWA 3G7DA 2PAMA 3WW3A 1O3TA 3E97A 3QACA 4LUKA 2XGXA 4Z07A 5FLHA 3MYXA 1QXJA 2P17A 5EZWA 3HT2A 1GQHA 1CAWB 4UBHA 1ZZ9A 2QNKA 4IEOA 1UCXA 2D5FA 4Q29A 4KL1A 4OLLA 3SMHA 5F1RA 3CO2A 3ES1A 4AVAA 4N9IA 4QGMA 4Q0VA 4HSLA 2UY9A 4XF4A 1EYBA 2CV6A 4JVAA 4XF1A 1NE6A 5I0UA 3GBFA 3IDCB 4IEPA 2CAVA 4HN0A 3U11A 3MDPA 3NL1A 1O5LA 5FLJA 3RDIA 5FQ0A 3JZVA 1O3RA 4MZUA 1NE4A 1OD5A 1YLLA 2PQQA 3E5QA 2IXIA 1V70A 5FPZA 3NVCA 4EV0A 2PHLA 2IXLA 4QMAA 2QVSB 2GAUA 4XFBA 3WW2A 4R52A 4LA3A 4UXAA 5FQ0B 3H3ZA 2PYTA 3M70A 1CAWA 3IWZA 3I54A 4ZU5A 2PAKA 3NSTA 1J3RA 4MGKE 1Q5OA 2XKPA 3OD0A 4EROA 3CL1A 3DKWA 5C8WA 4NVPA 4P9GA 5AVPA 3SCGA 1L3JA 3MZHA 2ET1A 2PTMA 1RUOA 3U10A 4J1WA 3UKTA 2E9QA 2CGPA 2PFWA 1YUDA 5KBFA 3DN7A 1QWRA 4HVRA 5LRSA 4K8FA 2H6CA 3EBRA 2H0VA 5KHHA 3ELNA 1O3QA 3M3IA 5JAXA 5J7MA 1LR5A 2IC1A 4YARA 4XETA 4QM8A 4F7ZA 4XFHA 3H50A 2UYAA 4I0AA 4LA2A 4QM9A 3H3UA 3E6BA 4MGYE 2D40A 2QJVA 2VECA 1ZZCA 3CJXA 2UY8A 1CAUA 3I7DA 2K9ZA 5FCCA 1I5ZA 5LEJA 2H6BA 4JTNA 4QGLA 1ZRCA 4BIFA 2IXHA 4XFGA 4X6RB 1ZRFA 3ETQA 2Q4SA 2XHKA 1DZRA 1CGPA 4KU7A 1SFNA 1ZREA 1VP6A 5K8SA 1ZZBA 5I0SA 1PMIA 4ZU4A 4XF0A 5J3UA 2GU9A 3BU7A 3CF6E 5JR7B 3TNPB 4OFGA 4ONUA 5BPXA 4I09A 2N7GA 4IERA 3CLPA 3LA3A 4A2UA 4E2GA 1X8EA 3HIFA 3H9AA 2ZKLA 1ZX5A 2MHFA 2XL9A 3PLQA 4HVQA 4Q0SA 4O9GA 3OF1A 3U0ZA 5KHIA 1Y9QA 4QGNA 4HN1A 3CEWA 1ZVFA 2B5HA 1YFYA 4Q0QA 4AVBA 2Q0AA 2OA2A 3I59B 3EHKA 3FHIB 3C3VA 5HI0A 3R6SA 5I93A 5CU1A 5I0RA 4KU8A 1J3QA 3D0SA 1NXMA 1ZRDA 1DGRA 3SCHA 1ZZ8A 5CVRA 1CAVB 4AXOA 1VR3A 2GC3A 4LEJA 5D1IA 4D7SA 5FPXA 1DZTA 2QCSB 2XLFA 1LRHA 1RTVA 1NZCA 2Y0OA 1UD1A 3D0JA 2BNOA 1LKNA 3RYPA 2VQAA 3RZZA 1U12A 3IBMA 4I02A 3S0MA 4IEUA 3ROUA 1RC6A 3RPQA 3FFQA 4HMZA 3UKVA 3ZDSA 4PIYA 1IPKA 4Z82A 4LULA 4DINB 5BY5A 4HZFA 5JSRA 3RYRA 5C6CA 2EA7A 2MPFA 3D82A 1EY2A 2DCTA 1O4TA 2PAEA 4CYDA 4Q0PA 1UIJA 5E1RA 3ST7A 4FBFA 4FAHA 3E5UA 2WC2A 3KCCA 3LZZA 5JCTA 4MGIE 3SXWA 2B9UA 4IESA 3S7IA 3RYKA 1YHFA 3EQEA 3PVBB 2BNNA 4XFAA 4YNIA 3B02A 5I8TA 2B8MA 5EFUA 3FWEA 2C0ZA 3BALA 3IIAA 4WVZA 3I59A 4I2OA 1Q3EA 4AVCA 4YYOA 5FDBA 4FT8A 2D5HA 5KHKA 1EP0A 1EPZA 3TNQA 5BXXA 2OYZA 1DGWA 1I6XA 4AQ2A 4EWAA 2GH2A 3H1YA 1UPIA 2Q30A 4Q0UA 3VHRA 5FLIA 1CAXB 1SEFA 1GQGA 2O8QA 3H7JA 1TQ5A 3MPBA 5LRRA 1ZZ6A 4WBBA 4TLFA 5T3NA 4YSFA 4IEYA 2F4PA 3H7YA 3BB6A 4MX3A 3EJKA 4F8AA 4BHPA 4IEVA 4IEQA 1CX4A 2PA7A 4PIXA 1QXRA 1FI2A 3E6CC 2EVXA 4WZCA 3WW1A 4ORFA 1YWKA 4MH0E 5I8SA 1CAXA 1CAVA 3WW4A 4HLTA 3RNSA 2EAAA 4R8HA 1JUHA 4LUMA 5I0TA 1O3SA 2XLAA 1X8MA 5J48A 4O9EA 1H1MA 3FJSA 3N4MA 1XRUA 4RD7A 2HJIA 4IEWA 1ZZ7A 4X6QB 3KSCA 1O5UA 4EWDA 2BNMA 3BCWA 5E16A 1PM7A 4JV4A 2BEOA 4HBNA 2VPVA 3LAGA 4I01A 2ET7A 4IETA 3IDBB 3E6DA 1YFUA 3H1WA 1G6NA 3LWCA 5BUVA 2IXCA 5JSPA 3EO6A 4I0BA 5I91A 1FXZA 2GC0A
chains in the Genus database with same CATH superfamily
4DXRA 1RHI2 4FPKA 3SHRA 2R061 3WR0A 3VBUB 2CY6A 2CDOA 3FX3A 4XJAA 1G8WA 1IHMA 2G1MA 1MS4A 2BFUS 5IHRA 2DU1A 5FBJA 5CNAA 3O0WA 1HXS2 5F6LB 1W6PA 3SNMA 2QQPA 2GNTA 2VXJA 4B1MA 2G9GA 5KXEA 2FMYA 4KWLA 5J98B 3T1MA 4QHBA 1UY1A 2JICA 2VZ1A 2CWSA 3PU8A 2VCAA 2EXKA 3AP7A 1B35C 1EV12 4NN0A 4E2QA 4XEZA 4Y20A 5DXDA 3FE5A 5ACA1 3WHTA 2EIBA 3NW4A 4CP1A 1REEA 4JKLA 2W92A 4YGDA 4FCAA 5L9BA 2HWD1 4DXZA 2W68A 1D4M1 3WSOA 1UIKA 1SLIA 1ODMA 4FO9A 1UYPA 3KT1A 3M1HA 1JYNA 5CKMA 1MS0A 3EYPA 1F35A 4WM7B 1W8TA 1AJOA 3HN1A 1UXZA 1N3OA 2IUWA 1RUC1 3VN4A 1YJKA 1ASJ1 3LA7A 3JQXA 5IVBA 2VMGA 1UO9A 5FYVA 2WNUC 1HQNA 2VBPA 2YGMA 4DXTA 3OYWB 1RUD1 5LASA 1ACCA 2R1BA 1WLTA 3Q8EA 4D7TA 1SLAA 4IGQA 3LIHA 1IOAA 2K0GA 4BQWA 3HPNA 3OGJA 4NE9A 1COV3 1UKRA 4OHWA 1MEC3 1HRI3 1BHGA 2JDNA 4LKEA 4XFFA 5A33A 4CEWC 1AL0G 4UW4A 3LEKA 2LROA 4N9HA 1HW5A 2GC1A 3NNJA 3T0AA 1GFF2 2PHDA 5IJRA 1JZ2A 2DVDA 3PNAA 3WX5A 2WLQA 1QU0A 3IPVA 4AYUA 4HKOA 2XJSA 2D97A 5A6ZA 1JBCA 1GV9A 4IEXA 4BYYA 2WS91 2ZJCA 4YVWA 2BDRA 4BQ2A 2VOWA 3ZIWA 4DMIA 5L7OB 2OPKA 1OLME 4QKDA 5A1LA 3BKZA 3NQHA 3KGZA 4AF9A 1IPJA 4E4SA 2ZBJA 1NQJA 2KXLA 4CEYC 2V72A 2WFPA 1D2QA 3WZ1A 4OQ8A 2HBUA 1GANA 1VBA2 4LHLA 4QWNA 5C3OA 3AM2A 1UPSA 1R64A 1WZXA 2RR12 3O14A 1TEIA 4Y33A 1H0BA 5H9QA 1JHNA 3N3HA 3VBUA 5FZ8A 1RUJ3 1XQNA 2XKOA 1T6GC 3DPRB 3KB5A 4PJYA 1G9BA 1S0DA 4AEDC 2EIEA 5J37A 3POYA 4L11A 4EWEA 3EB7A 2VZUA 1GMMA 2AH2A 3J4UH 3JCIA 1C5HA 1POV3 1E5SA 2XL7A 3K3NA 4NPLA 4XFIA 3R4SA 1CESA 4A6OA 3ZXEA 4IE5A 4IGPA 5JMOA 3V0BA 1UMIA 4BE3A 3BIEA 1BXHA 2YPJA 4QPGC 5T5LA 3W21A 3DL3A 4MV2A 2BPA2 5I0DA 4BZ4A 2Z2SB 4ZY9A 1SQ4A 2FDJA 2IXKA 1W9SA 2EXHA 5FUPA 2CAUA 5LBFA 1UY3A 4QPIA 5GLZA 1RVF2 1AXZA 2RMU2 4IV1A 1PIV3 2A3XA 4GH4C 5FPAA 3OPWA 3UETA 4P00B 3RI8A 3ZN5A 3AP4A 4D94A 5CADA 1X82A 4JTOA 2YB7A 3S7EA 1EAH1 1OD3A 2HEWF 3OYWA 3SH4A 1LGNA 2W46A 3E5XA 4XZUG 3RSJA 3VBSB 2VQUA 2J1RA 1IKQA 3I2FA 4WM7A 3ABZA 5A7SA 2I45A 3GJAA 5B4XA 5TSWA 2ATFA 2XQRA 4NRQA 1FOD3 2QTWB 3R4DB 2PAMA 3KZ4C 4YW6A 1N47A 3E97A 1VLNA 4LUKA 4H55A 4Z07A 3VBSC 1K3IA 3MYXA 3WLUA 4AVVA 1QXJA 5EZWA 4B4PA 3HT2A 4C91A 1CAWB 3M7AA 3LOBA 3KV4A 3D3AA 4LBQA 1DLCA 1WCUA 4IEOA 4Y4RA 1UCXA 3K4DA 4ZS2A 5JLVA 4EE2A 1PK6C 4YVWB 3N7MA 3AYAA 4GMP0 5D21A 2A3YA 5FZAA 5LBEA 3BTZA 4H14A 1H8VA 5CFDC 3NJVA 4P5HA 3MIDA 5SV5A 4CCMA 5FMOL 1LODA 4NAMA 3ZSMA 2W1WA 2OXBA 1A34A 2B9VA 3ZN4A 2FCVA 4XVHA 5ACA2 3H8XA 4YFWA 1IS3A 3KLSA 2XBO3 1FPN3 3CJIB 2IFWA 3F95A 3MHZA 5K4LA 5FK7A 5DUUA 1EV13 4Y5TA 2WNVC 2HWE3 1NE6A 4UW5A 5DDJ2 1KRIA 1AHSA 4O61A 3IDCB 4PLMA 5EWSA 2QQIA 2R30A 1O4YA 3BTXA 5DDJ1 4ASMB 3NL1A 1OKQA 5C8CA 5FLJA 1IS4A 4N7UA 1UQXA 2XWBB 5EJZB 3WNPA 1O3RA 1ZRIA 4Z8BA 4AQTA 4IE7A 1NE4A 5FFOC 4IE0A 3POSA 1JYXA 2PQQA 3WNOA 4HK8A 1XU2A 1ULCA 1MPXA 1PZ7A 4KQ7A 2ZGMA 4EV0A 2J1SA 1DGRN 1HDKA 2FDHA 4NHXA 2YV8A 4BQ5A 4YZ2A 4N43C 4L99A 4CCNA 3T4HB 4Q4W1 1LEMA 1Z7S2 1W03A 4GWJA 4R52A 2Q1FA 1LEDA 4KGGA 4P9YA 1QJX3 5FMDA 5EP9A 1H2MA 4NPMA 5HPOA 4K1ZA 3M70A 4GIQA 3I54A 1NA1B 2PAKA 3NSTA 4OQ9A 1PK6A 4WVMA 1J3RA 1IZ3A 2DFCA 1COV2 2X09A 3OUIA 5BYNA 4HKLA 1OH4A 4JDOA 4FI9A 3OD0A 4QX1A 4YGBA 3WDYA 4LKFA 4ATEA 4P9GA 3OEAA 4FFHA 2YXSA 3NNFA 4FOQA 5A3OA 3SCGA 5FUIA 1HQLA 4RSUA 3WG3A 3KVAA 2C24A 4LBQB 1QGLA 5A32A 2E7TA 3A22A 4A7ZA 3MI8A 2E9QA 1QQP1 1YUDA 2IFRA 3G6JB 1QWRA 3OEBA 4CDUB 1DQ4A 3GDBA 1CZSA 1IPSA 3CMGA 4P9XA 2H6CA 4DO0A 1RVF1 1W6MA 4NHYA 3HD8B 5C8CC 5GLUA 3HEIA 1LR5A 4FQ4A 5A7OA 5J7MA 3M4FA 3JBG3 4CP9B 4LITA 4QM8A 4M0NA 4RS5B 1PVC3 3EXUA 1Z7S3 2D6PA 1H8TA 1YC61 2C9AA 2UYAA 4I0AA 4ITCA 4H3WA 1DHKB 4MGYE 1L7QA 3K75B 1HRV3 2DVFA 5JPMB 3RI9A 1AYN1 5FRAA 3U78A 1DF0A 2YFUA 3CJXA 5F3EA 5FZ1A 2UY8A 4URTA 4JGYC 1MZEA 1OOPB 3I3DA 1SFPA 4Q4X1 3LEMA 5F5CA 2D7FA 2H6BA 1KDMA 2ILMA 3ZYRA 4JTNA 4MVTA 4QGLA 1ZRCA 2HYXA 4QQPA 1SBDA 2WZR3 2J22A 5IWFA 1KDKA 5BNOB 3PUSA 1GP6A 4RR3A 2VO5A 3BVCA 5BNPC 3ETQA 2Q4SA 1DZRA 1CGPA 2AEYA 1LNSA 2WNVB 1POQA 2UWAA 2GP3A 2VGDA 5DG1A 5CFDA 2YC0A 1M4WA 4EN0A 1H2NA 1AR92 1BYHA 5JI7A 1OFSA 4CPBD 1ZZBA 1VBA3 3LCPA 5I0SA 3ACGA 4XF0A 2WT2A 1XNKA 3CF6E 5JR7B 1XNTA 3AL5A 2UURA 1V9U3 5AC91 4OFGA 4BIOA 1OF3A 4E4DX 2FBEA 4IV3C 4FSJA 4BK5A 1VBB2 3NNMA 4A2UA 2R1DA 3HIFA 5A7WA 5JXHA 5FZOA 4UI9L 3RG0A 3ALQA 3MF9A 3MFAA 1W6NA 4RHV1 3AKTA 3WP4A 1ZX5A 1GICA 2XL9A 3IN9A 3N7LA 3PLQA 5L9RA 5LW9A 1SLBA 3CZJA 4Q0SA 4O9GA 1P8JA 4XCBA 2RMU1 3SH5A 3UGFA 1K5MC 1UOGA 1W6QA 4QGNA 5LZ6A 1Y43B 3QCWA 1ZVFA 2B5HA 5AFBA 4GAZA 2HWE2 4Q0QA 2BWAA 3GZUC 4CEWA 2Q8OA 4LBQD 2D43A 5AC92 4XDOA 1BK0A 4K7JA 3UK9A 4BXFA 4FP3A 1Y4WA 1SHWB 1UZYA 5BNNB 4XBNA 5CU1A 1JW6A 3AZXA 3D8CA 4KU8A 2QZ3A 5GLVA 3DKQA 3VZOA 4YFZA 1ZRDA 3UJOA 1W9YA 1K42A 2ZX3A 4I3GA 2JB4A 2PQSA 3P3PA 5C5TA 5F6KA 2JX9A 2QQLA 1HN0A 3HAGA 3J7HA 3ZFEC 3ZKYA 5CVRA 2D3PA 2R073 2XJVA 1VR3A 2GC3A 4LIUA 2WZPP 3VBUC 2CU5A 1VB2A 3FFZA 1OXCA 1YJLA 2QBXA 2RR11 2XLFA 3J8F2 1ULDA 5FZ9A 1O6UA 1GNZA 3D0JA 2V4AA 4G9SB 5C7GA 4UFIA 1SCRA 4Q4V1 3RYPA 4NIIA 4C8DA 2VQAA 2ZHMA 1V0AA 3RZZA 3IBMA 4EN8B 2BZDA 3GHMA 3QH7A 2XXZA 3B9CA 3ZXKA 2D6NA 3HQRA 2ZX0A 3ZDSA 3AFKA 1YQ8A 4NWWA 2DVBA 3JD72 4AFMA 4AHXA 4DINB 4AOCA 4HZFA 1MZFA 4P5YA 2WYFA 2EA7A 3JD71 4LHNA 1CVNA 4XMIA 1MR5A 1EY2A 2VZQA 3AJZA 3RGBA 2DCTA 1WD3A 3C7GA 1AR63 1ULPA 5LK5A 2WIIB 5AVAA 3ST7A 4CCJA 4FBFA 4GKXA 3DPRA 2XVKA 4Q4V2 2WA3A 4IE4A 3KCCA 1MQTA 4XTPA 1RUG2 4UFLA 4JKMA 1RUD2 3PMEA 4AWDA 1U5XA 4MGIE 4LO6B 3MPPG 3S7IA 4Y4YA 2ZZJA 4A7KA 3RYKA 3THTA 1RUI2 3WNMA 3ZN6B 5I8TA 1JS9A 4S2HA 4YW1A 3WVJA 1B35B 2CWMA 3BALA 4NUBA 4AE2A 5DMYA 2R7EB 3WINE 3R05A 1Q3EA 5A7WB 4WM8A 4LO4B 3D4KA 1R081 2BOJA 2A6XA 4YYOA 4AFBA 5KXBA 1EP0A 3NAPC 3SISA 2RR13 3RWKX 5FKCA 4HONA 1DYOA 4OMCA 4AAXA 4AQ2A 2WO2A 4COYA 1VALA 4FPFA 1DQ2A 3BOPA 3M3CA 5KC5A 1HN1A 1YQ2A 1WD4A 3ZXFA 2XPJA 1B09A 2QQOA 3OY8B 1S55A 1SDDB 2OX0A 2OVUA 4HG6B 4KBBA 3TEXA 1QH6A 2P6CA 3POBA 4YSFA 4XHBA 2GN7A 3AMNA 1PGL1 4CU7A 2WUHA 1NX9A 1HKDA 2DU0A 4RHV2 1CD3G 5GM0A 1BBT2 3IT8A 3AFGA 1YCIA 4BWOA 4EJRA 4UW6A 4Q5OA 1V9U2 1W9FA 2Y6KA 4JDNA 2TEPA 1OPMA 1C8M2 2VULA 2ZHLA 3VHOA 3VL9A 1UY0A 1AL23 5ANNA 3WCSA 3ZXDA 5G05L 3T2QA 3WW4A 3T0DA 2RM22 2RMU3 2WZR2 4M3CF 3ILRA 2JIGA 4RQPB 3VKOA 1RUJ2 4RHV3 2QQNA 2XLAA 2DURA 3DGTA 3N7JA 1X8MA 4H2AA 3NV2A 3M2MA 1H1MA 3FJSA 2BGPA 3MIBA 3PJQA 4FFGA 4O9EA 4RD7A 3RZLA 5H9PA 1ZZ7A 3IKWA 2ZX1A 2OIIA 1W3VA 3WW3A 5IVVA 4Y1VA 1WWYA 1CQ9A 1MS1A 2WFF2 5E16A 2WNUA 3HJRA 2SBAA 3GJBA 1VBA1 2YBKA 4GKYA 4JV4A 4LKDA 1DZQA 2PN5A 2BEOA 2P37A 3BN6A 4XPVA 4Y1ZA 4ZZ5A 1XYPA 5KR7A 3HNYM 1DQ6A 3IDBB 4XIOA 2VE1A 4QX8A 2A73B 1NZIA 3IDAA 2BVBA 3LWCA 2WZR1 5FMBA 2WS92 4QU2A 4XXPA 1QMJA 1CIWA 4RFT0 3KF3A 2AUYA 1FXZA 2GC0A 1NYWA 3BYWA 2IVIB 4FXKB 2YGLA 4LR4A 4GWNA 4AEDB 4L2NA 5LBCA 2Z4FA 1HRV1 4DY5A 4UF0B 2WAOA 1XC6A 3BUCA 1AVBA 2ZXQA 4XHXA 1TME3 3UV9A 1HQWA 1QIQA 4AG4A 3VBOC 5FZKA 1F2NA 1PVC1 1H2LA 4GQ7A 2PHFA 4JRAA 2KR2A 3JBG1 4TLGA 1SLTA 4UWDA 1PK6B 2GSYA 1GNHA 2XLGA 1J83A 4J1XA 4W8JA 3VKLA 4CUCA 1H1IA 3GZAA 1VBC2 2ARBA 4ATFA 1ND2C 1J3PA 1QQP3 2Q5TA 4IDZA 4A4AA 1IG3A 4PDWC 1RMU3 2Y60A 3LKJA 3VD7A 2VL4A 2X5IA 5FYBA 3ACLA 4JGZB 1DGWX 1XNDA 4A7YA 2ZPXA 4XBQA 2JE8A 2W95A 3IDEA 3O0XA 1ULGA 2UYBA 2PMWB 2ETEA 1CZTA 2HYKA 1RL3A 3ZXAC 3OUHA 2JXAA 4FPHA 4W6XA 2VUCA 1KJLA 4JAAA 3HVDA 4BA6A 2YU2A 2XB6C 3SQOA 2X05A 1XSRA 4H7LA 3VGIA 1UY4A 2ARCA 2VM9A 2E7QA 1A8DA 5CFCB 4PBPA 3Q8BA 1WCDJ 3GYDA 5E88A 4ARYA 5JSOA 3KGLA 4NR1A 2Y6JA 4OHYA 2X53S 4UW3A 2W1UA 1NT0A 2D3SA 2FQPA 2VAUA 4DFSA 1UY2A 4Q4W3 4I30A 3OGVA 1JZ7A 3NJXA 4A44A 4LOTA 4MGSA 3LD8A 5JUVA 1VBD3 1QEXA 2A1XA 5BV6A 1J1LA 2NN8A 4IL7A 3T2TA 4IW3A 4R9AA 1H9PA 1NOVA 2YC4A 3GGLA 3PTRB 4META 2YC2A 4QD2A 1IQDC 1MEC2 5HCAA 2B39A 1O7FA 3VBRB 2VCCA 1N3QA 1GUIA 2O1QA 5IAVA 2OZJA 4LLOA 3THCA 2ZGRA 1OMIA 2MEV3 4PF5A 3T09A 1GP5A 4XTMA 4GA9A 5C9AA 5I8YA 2J1VA 4GULA 1S0EA 5L7OC 2ZZQA 4GB31 1QH7A 2D93A 2Y6LA 4UFKA 3P6BA 3DXTA 1VB4A 1XE8A 2JENA 4Q4Y2 5FXZA 2DDUA 1W90A 4BM8A 4BLIA 1NA1A 5FK8A 5K7PA 4OULA 2XBO1 5JXJA 4CP0A 3TEZA 2XVLA 1XE0A 1Y9MA 1A3KA 2DVGA 2WWUA 2WBKA 2D6MA 2YBSA 5L36A 2DBNA 2Q1ZB 1OI6A 3WP3A 1FT9A 2PLV2 3UL2A 4CDWB 2C9KA 2H0BA 4DNYA 3CNAA 4Q4W2 4FPJA 4QX5A 5A3MA 3POJA 5KHGA 2EXIA 1AYM2 1LJ7A 2O14A 4RA0A 2VTFA 1JYVA 4C1WA 3BU0A 1G86A 1VAVA 2FMDA 1F4HA 2VR4A 3BPSA 1H2KA 1EAH2 4LTAA 3WXPA 4ARXA 4QQHA 1IKPA 2RS32 3LDKA 1AX0A 3ILNA 4EZHA 1W2NA 3ACHA 5DAPA 1GOFA 4YW2A 2FDIA 4XJ8A 5JIUA 5C3RA 1CN1A 3D5OA 1LHVA 3O1SA 4YGCA 4XFCA 2VMEA 4AR2A 3BTYA 1QJEA 2YG0A 1AX2A 4HSJA 4J6GA 4BH9A 5A3WA 3KMHA 2PHWA 4PBOA 3ES4A 2JWPA 1KS5A 4CUAA 4YLZA 3RJRA 2E32A 3CKHA 4OHZA 1N3PA 5FZFA 4CU8A 4K1YA 3G7DA 5A1AA 2D6KA 1YNAA 3QACA 4YM2A 5FLHA 1OUSA 4DXSA 4GWMA 1V6KA 3WCRA 3AMMA 4UBHA 4AEKA 2NMOA 3BODA 4COZA 4IQPA 2ORZA 2WLPA 2YYOA 2WSUA 4MSVA 3RJ2X 4Q29A 3MEPA 5JZGA 1POV1 2W5FA 4CDXC 3T0BA 2XJQA 3ETPA 1WKYA 2YMZA 4Q8LA 3ZXGA 5F2WA 2R49A 1YIFA 2EIGA 4NROA 1WLDA 5FWEA 4QGMA 4E27A 1RUJ1 1QJY2 4PDWB 1SFYA 2TNFA 4HFSA 3VDDA 2QZ2A 2XWJB 3I3QA 4QT6A 3WY6A 2GMMA 5CAZA 4ISQA 1EYBA 3WG2A 5FZOB 5E8AA 1KD7A 3KVBA 4JVAA 1C1FA 2BOIA 4URAA 4WV8A 3RMYA 1JZ5A 3Q8FA 5F3IA 5I0UA 3GBFA 4QXCA 1LHUA 3N9PA 4IEPA 4A3XA 3IAQA 2R6QA 1PO23 2CAVA 4R9CA 3U11A 3JB8A 3H8RA 4ZS3A 5FZ4A 1O5LA 2NYYA 2D3RA 2W2IA 3AMPA 3VBHA 2IZWA 1KS4A 4QPYA 4XABA 1PGSA 2E26A 1OD5A 1YLLA 2DUPA 2ZAAA 2ZMKA 1B35A 2A6ZA 5ISLA 5FPZA 3NVCA 3TN93 5A3TA 2IXLA 2YHJA 4BLJA 3W5NA 3V64A 5IUQA 3DXUA 1ZM1A 1NY72 2OPWA 4XFBA 1BK1A 4CDWA 4U2AA 4LA3A 1COV1 5FO8B 3MV11 1JU3A 1FMD3 4FVVA 1H4HA 2ZAHA 5FQ0B 1UOBA 3NV1A 3WQ0A 4B4QA 3FBYA 4N90A 2HWF2 5APAA 1W3XA 1FNZA 3H3ZA 2OW4A 1OH3A 2PYTA 3LF7A 1W8HA 3TN92 2E31A 2WWJA 1LTEA 2FZ2A 4CDUA 1ASJ3 1Q8PA 1RUE1 4CCLA 1RUH3 1W39A 1GNYA 1QOSA 4QU1A 5GZDA 1YIPA 2RDSA 4YG3A 3DKWA 1OLMA 4NVPA 4CP9A 3CQOA 1J84A 1L3JA 3VL8A 3U07A 2I07B 1YQCA 5IVCA 3RZKA 1PNGA 3K2OA 1DU3D 4BQ1A 4RL7A 1C8NA 3UKTA 1V6OA 4RQPA 3LGRA 2JEMA 1R092 3DN7A 4HVRA 5C71A 2WO1A 3FHAA 1TMF3 1W8UA 4K8FA 4XXAA 5GKAC 4CXXA 1G7YA 1CWPA 5C3QA 5IK4A 5KHHA 4JZRA 4W50A 4CVUA 5ACA3 2JE9A 2VNRA 4BU2A 1O3QA 2IC1A 1G9DA 1UL9A 1UZWA 1X9PA 4YARA 2WAAA 4R4XA 4Q4Y3 4XBLA 1RUI3 3VDDB 4F7ZA 2A6YA 2P3YA 4UT5A 5BNOA 1Q8QA 3FBMA 4QM9A 4RGAA 4Y1UA 2YUEA 1PO12 4LBOA 2I74A 2W9XA 4PQQA 5EPAA 3CIHA 4XJUA 5LB6A 5DUWA 2BFUL 3MF6A 1ND2A 2WYSA 3L9JT 4MG2A 4MLOA 4NRPA 4FFFA 3I7DA 2ZMNA 1RITA 1BZWA 5BNOC 2K9ZA 4NIAA 3UYJA 1I5ZA 5FMOS 1GU3A 4WVMB 1IG0A 2YDEA 3ECQA 3NO8A 5G04L 5C70A 4X6RB 1BEV1 2SLIA 1ZRFA 4V2WA 4LHSA 5FREA 4Z1VA 4QQ2A 2HWF1 2FD8A 3DUIA 1W6NB 2DUOA 3P3NA 1SFNA 3ZPYA 1LOCA 1YI9A 3WHUA 5LA9A 2HWD2 5GZGA 4D7YA 1BBT3 3OY8A 1N1TA 3NV4A 4EYUA 2R0FA 1H6XA 4BJ0A 1A78A 5ABJC 3HN3A 1AR71 2B7YA 3BI3A 1OLRA 1DBNA 2GU9A 2RS51 2CGOA 4CEWB 3LSDA 1GLHA 1N1SA 4ONUA 1LULA 5BPXA 4K6BA 2ES3A 4I09A 3I2OA 4QKNA 1K45A 3LA3A 4I0WB 1PMHX 5A6YA 1X8EA 2XR4A 1K12A 1UXXX 3THDA 5BNNA 2G9ZA 2UWCA 3ZFFB 3ZFGC 4HVQA 4BXSV 2P3KA 5LWBA 3JUUA 3OF1A 3U0ZA 5KHIA 3P1IA 1X36A 4OVEA 1O4ZA 4CZSA 3C7OA 1WMDA 1YFYA 1S2BA 2BUKA 3VBFA 5KWRA 5J96B 1VMHA 2GALA 2ZACA 1IQAA 2DV9A 5K9YA 2E33A 2R062 4M4PA 1HRI2 1DIWA 3ZYFA 1OQ1A 2F4LA 2ZEYA 5A6XA 4KBZA 3NWKA 1DP0A 3R6SA 1TE1B 2G19A 4OI4A 3EMRA 1CIYA 4LE4A 4PLOA 4V2VA 2JD9A 1NXMA 1OURA 1QJY3 1R1A1 2V5DA 2HEVF 3DPRC 3ILFA 2RDRA 5FPLA 4ZHNA 1DGRA 2VZPA 3O12A 4QX7A 3T2PA 3O0VA 1ZZ8A 5JVVA 1BVVA 4N53C 1ZBE2 4AXOA 1UU4A 3SKJE 5FPXA 3ZSKA 2RS12 2WL1A 3PIGA 1OVSA 1ALYA 4F83A 1LRHA 3QBQA 2Y0OA 3OGGA 4XQ4A 2YZ4A 4CSWA 4AGVA 5EIYB 4YW5A 1GBGA 3HMYA 2BNOA 2ORXA 1FAYA 5EV7A 3WUDA 3ZXJA 4QX2A 1VMJA 3VDDC 3S0MA 5F37A 3ROUA 1RC6A 5C3PA 5L9VA 2CSGA 3RPQA 2R043 4S2FA 4QXHA 5DUVA 3ZMOA 4UF0A 1LOFC 4LULA 2PELA 1JHJA 2JG9B 4N7IA 1VBC3 2ZABA 3VDCA 2WQZC 5C4WA 5IT6A 2VTXJ 3FN9A 3D82A 1YI7A 4CUBA 1TZOA 2WINB 3N7KA 4CXWA 1R093 5IAXA 1ULOA 3NNLA 3GF6A 4LO8A 1RJ7A 5E1RA 1HXS3 5FR3A 4XUTA 4OHVA 1VBB3 5SV8A 4FPLA 2A71A 3U37A 3ZSJA 2GMPA 3OUJA 4FPOB 4WM7C 3LZZA 3GXUA 5JIAA 1ASJ2 4M00A 3FLRA 1WBFA 3IIIA 4BPZA 3SXWA 3T30A 3MICA 1KEXA 3FMGA 4UOJA 3PVBB 4MGQA 3A7QA 4XFAA 5L73A 4CDQC 1UX6A 3FWEA 2C0ZA 4WVWA 5J09A 1PZ9A 3AC0A 1W2AX 3AL6A 4GMP3 1SLLA 2D5HA 4YZ5A 4Y5SA 5FDBA 3SEPA 1EPZA 4CTEA 5BXXA 3RZJA 1DGWA 1FMD2 1ONAA 2QQWA 3PVNA 1DQ5A 2YROA 4CCOA 1BQPA 4GB32 4CDXB 4DB5A 1SCSA 3H1YA 2Q1MA 3PMSA 1S2EA 2VMIA 4Q0UA 4GWIA 1MVQA 4YW7A 2OQ7A 5JR2A 4AVTA 3MW3A 3VHRA 5EXOA 5FUNA 2R072 3T2OA 2VVEA 5FAXA 2X8KA 2E53A 2DWRA 3GCXA 3ZOIA 5FP8A 3A0KA 1AR81 3J8F3 5EHDA 1O91A 3H7YA 1MS5A 2GMEA 5FZHA 3Q8CA 1JOBA 4QX0A 3WG1A 3OB8A 1LOFA 3EJKA 4MX3A 2ZGLA 5FYSA 3ZR6A 1KFXL 2QKDA 4C0BA 2PA7A 1QXRA 4LT5A 1IS5A 2D44A 4XCAA 1FPN2 1W28A 5FO9B 3A0NA 4ORFA 2WN3A 5FY8A 3M3QA 1Q8OA 3SC7X 1CAXA 2XJUA 3LDRA 3LB9A 1C1LA 5JZGB 4KG8A 1XNCA 2Z5WA 2A3WA 3RNSA 1HLCA 2EAAA 2WZ8A 5LK7B 4R8HA 3K48A 3B00A 1LHNA 1O59A 1RXFA 1NQDA 4Y22A 1UU6A 2LTNA 2YU1A 3N4MA 4LIVA 3JU9A 4IEWA 4D6SA 1LGCA 1NAEA 4X6QB 3KSCA 1SPPA 3HQUA 4AI8A 2PHRA 3PJYA 4EWDA 1OPOA 2TBVA 3GZEA 3BCWA 1APNA 1JH5A 3GCWA 2EALA 5DZEA 4KG0A 5HCFA 1DQ1A 4NO4A 2P34A 1CR7A 4YWAA 2VPVA 4PHZA 2VXRA 5FZ7A 3E6DA 4L0PA 1QJX2 1MS9A 5K0UA 4CU9A 2IXCA 1VBC1 3WG4A 1QOTA 3K46A 5I91A 1YO8A 3I3EA 3CZUA 1M06G 1TVGA 4N53B 2XJPA 3Q9OA 4XAAA 3NJYA 3MLLA 2R041 4G3YC 4AHYA 3OOXA 3MV01 1G9AA 1HB4A 3OBRA 1S0IA 3SKVA 3HBKA 4BISA 5GJ6A 1LECA 2JG8C 1IS6A 2A7AA 3POFA 1QF3A 1R1ZA 3OGSA 4Q2FA 4XUQA 4AFDA 2GP5A 3AB0A 3WDXA 1UMZA 1PHMA 5FZCA 4CEYA 2RE9A 3NJZA 2VJXA 2ZGTA 3I2DA 4M3CB 4QPGB 4K21A 4CE8A 2V09A 4AGGA 4COWA 4XYXA 2DVAA 2EF6A 3LQCA 1ENSA 1ZA7A 4DUXA 1URXA 3AKPA 1UNBA 5LATA 4E9KA 1XNBA 1XE7A 3ZFEA 1WGPA 4KWJA 1CONA 1RUF2 2LUWA 4BDVB 5FY4A 1QJY1 5T50A 2OZ6A 3O1TA 3UKNA 2AC1A 2MNGA 3V56A 5J1XA 3ZDVA 3TYJA 5JOYA 4ZU7A 1H4GA 1W9TA 1WMXA 1MS8A 2VCMA 4C90A 1OF4A 5D8AC 1H1AA 1ENRA 1UW8A 1VRBA 1ZA4A 1NXD1 4Z92B 3JXSA 2HWC2 5F32A 4CUGA 1R1A2 2Q8EA 5BNPB 1RUNA 4GALA 3B9IA 2HEYF 2WT0A 3HQXA 2ZHKA 2AR6A 5FO7B 2PHXA 3QLQA 1ODNA 2GNBA 2Y34A 1ND3C 1RUH2 1W6OB 3WOGA 3IB3A 4D3WA 4OI0A 4HVOA 2ZCWA 3IM0A 1S0FA 4XUNA 4CU6A 4U36A 3KF5A 3SCFA 5A7NA 2JDKA 3PHMA 1CZVA 3FC0A 1AR93 1AR73 2VCBA 3WNLA 4SBVA 1W8FA 2VMHA 1BBT1 1SPPB 2ZEXA 3UNPA 5CISA 2CTVA 4EN6B 3CJIC 2HKXA 2IXJA 2VG9A 1UOJA 3ZYJB 1JUIA 2B42B 2FZ1A 1JU4A 4F3JA 4P9IA 4AHZA 1VRH3 3ZVXA 1NA1C 1Z78A 3U75A 5C3SA 5FV3A 1UWWA 2RS52 2VU9A 4A45A 5F5QA 1K5MA 1US2A 4V1PA 2VNGA 3LOIA 2VOXA 2D6OX 3H8UA 1IGOA 2XVGA 3TOJA 5FYUA 5FPBA 3PUAA 3I2GA 1PVXA 4YRDA 2O8OA 5A3UA 1KITA 2VZTA 3FZ3A 4N53A 1V00A 3OJBA 3B5LB 3QD6A 4XE9A 1ZBA1 2F6BA 2LRPA 3BOWA 3ENRA 4LMFA 4PIZA 2GN3A 5FZ6A 1D4M2 4CDWC 2XBO2 1FX5A 4B7KA 5FMCA 3S57A 3LA2A 5FY0A 4L9BA 1X7NA 1D0HA 3ZFEB 1RUI1 1HJGA 4Q4Y1 3POIA 1WA4A 3M3EA 2WQ4A 4R4ZA 5KHJA 2J1AA 2DCZA 1AXKA 2VNOA 2PHTA 4LQRA 3MW4A 3VD3A 2WQ8A 4E8CA 5A3LA 1TMF1 1UMHA 4QPGA 3VDAA 3QOPA 2RDQA 1JYWA 3ZKUA 1ST8A 3KWVA 3RFRA 3OD4A 5FP9A 1LHOA 2QDRA 5A3NA 2JD4A 4HT1T 2J1TA 4QXBA 2FDFA 2GNDA 3HWJA 2DTYA 2VOTA 4P9WA 1DLLA 3WDUA 3AKQA 3H0OA 4QAWA 2JKXA 2YFZA 2ZGQA 4CCKA 3LSEA 5BNQA 1VJ2A 3V65A 2JDAA 4FAGA 3DYMA 2OS2A 3PUIA 5HV4A 1RUH1 1SG3A 1RUE3 2VUDA 4K40A 4J25A 5FBZA 3KCYA 1JYTA 1J1TA 4AQ6A 5F39A 4YZ1A 4KGQA 4GH4A 2X5IC 4HOOA 2JDHA 1QY4A 4LKSA 5JI9A 2VBDA 2RHPA 3NKTA 4HPKA 2BYVE 4OHXA 4QB2A 3FHQA 2VD7A 2RVAA 2A70A 3OBZA 5CZKA 3BTAA 4TTGA 1O3TA 2WO7A 2Y6FA 2DYCA 2JG8B 1FMD1 2XHNA 3AVSA 3WDWA 2JDZA 1OUXA 1GQHA 2BWCA 2EIDA 1VMFA 1XNAA 5B2GB 3AZZA 1BCXA 2XUMA 3KM5A 5JMCA 2A5ZA 4FPYA 1A8MA 1CPNA 4ET7A 1BLZA 1PO13 2D5FA 1GZCA 2W1SA 2J42A 4JX0A 3TN91 4LBLA 4AK3A 1RUG3 1UKGA 2JDMA 3DEMA 4SLIA 4OLLA 1GOGA 4LBNA 5F1RA 3CHXA 1EUUA 1QDCA 1REFA 1MACA 3CO2A 3ES1A 3NRUA 2HWB2 2JG9A 4AVAA 4LOSA 3ZFFC 1RUF1 4N9IA 4MXWB 1YYNA 1XU1A 3RZMA 1PO21 5F3CA 4XF4A 1CPMA 1QNYA 3LPGA 4PCRA 2RJ2A 3NAPA 1F31A 4TWTA 5DZGA 4CCEA 4AI2A 2V73A 4S2GA 3BGAA 2VVDA 1S4CA 1CJPA 1XJAA 1XYOA 1PMJX 1CX1A 4W65A 3U4XA 1WMEA 4HN0A 3RMXA 4ZONA 3MDPA 2QQMA 4QPIB 3RDIA 4AW7A 5FQ0A 1OBNA 2CNAA 1HRV2 1LHWA 2FHRA 1OA3A 4RQPC 1KXGA 5FXWA 4B4RA 1UZ0A 4P14A 1I5PA 1KGYA 3OPTA 4O7XA 4PQ9A 3O1OA 1V70A 2DCYA 5EJ3A 4FXGB 4QDQA 2PHLA 1ENQA 3PU3A 4QMAA 4D0QA 2XUEA 2GAUA 3ZFGB 2WABA 5JZGC 3WNKA 3N9QA 4XZPA 4AI1A 5IVJA 1BEV2 2C26A 4UXAA 1QJU1 5F3GA 4NMIA 1MQTC 5GZCA 3USUA 1CAWA 3I2JA 4JCKA 2JECA 4CA9A 4ZU5A 1ULFA 5IVYA 5IVFA 2Y0IA 3T3YA 1SBEA 1WBLA 3VD9A 5CG8A 4MGKE 4QHZA 4QQLA 1NCQC 4C1XA 1Q5OA 3KV9A 4HPKB 2NP0A 2R0HA 2XKPA 3KCXA 4EN7B 2BV4A 3O1RA 4IV3A 1FYUA 5C8WA 1JZ3A 2EXJA 2BQPA 2QQVA 1EUTA 2BBAA 3ME2A 2ET1A 2UWBA 4AEDA 3ZX7A 1RUOA 3LE0A 4J1WA 1HV0A 2VZ3A 4LORA 1ZYBA 2CGPA 3J7MA 1GWMA 2HWC3 3KHBA 5LRSA 4NIDA 3NV3A 1RXGA 3U4SA 4ASKA 1AX1A 4M01A 5C4WB 1C8M1 1WW5A 2H0VA 1QJZA 4ZKTB 4MGTA 4PI0A 3ELNA 2A6WA 5JAXA 4AFAA 2W91A 3PVOA 2ZEZA 2E6VA 3R0RA 3A21A 3ACFA 1GWKA 5C8CB 1QQP2 4XFHA 4LA2A 1S2KA 3O5SA 1D2SA 4YVWC 3E6BA 2XDVA 5JDBA 2D40A 2VECA 4RGGA 1ZZCA 1W0NA 1UYYA 2ADEA 3MIEA 4LO5B 1RINA 1CAUA 1PX4A 2ZGNA 1AR62 5FYMA 5K0UB 1GSLA 1H8TC 4JDMA 2AEZA 4GB33 3MO4A 5LEJA 4OUEA 1DCSA 3LPFA 2Y6GA 1QJFA 2CHHA 2IXHA 2C6SA 2MEV1 3RVHA 1OOPC 4ES9A 3AX4A 2VTXA 3J26N 2Q8CA 4WVVA 1X50A 3LDBA 4YGEA 2XHKA 5JXGA 5FOJB 3JB4C 4KU7A 1SMVA 2EAKA 3ZFFA 2W3JA 1ZREA 1YQ5A 3WF2A 1RMU2 5K8SA 3GBWA 1PMIA 1OLQA 2G9FA 2ZGOA 4R9BA 5CG9A 4YM0A 3VBFB 1VBD1 2V5YA 3BU7A 3KD4A 5FY9A 4CDQB 3C7EA 2I2SA 4Q27A 2XMLA 3USUB 4AI0A 4E8DA 2HWB3 3B3QE 2N7GA 5FZBA 1V6JA 1W2OA 5FYZA 4EQVA 4Y5Z0 5EJ1B 1LU1A 3O7OA 5FZ3A 1AYM3 4KWUA 3ASIA 1VAMA 2BGOA 2MHFA 4IV3B 5A33B 3S5AA 2J1UA 1Y9QA 3AK0A 2V4VA 4HN1A 3DF0A 5FKBA 2Q8DA 4YVSA 2WO3A 4QDRA 4JGYA 1NCRA 1MQTB 5JXIA 5BNNC 4UFJA 1C28A 1W8OA 3EHKA 5C9AB 4RS5A 1SZBA 4P08A 3ZO0B 3W9AA 2J1EA 3B01A 3C3VA 5HI0A 5JWPA 4TXWA 3AP9A 4ASLA 1AF9A 5L7OA 5I93A 2OUHA 3AP5A 4AZZA 3ZYBA 5C9AC 3TBDA 5I0RA 1RMU1 5FIXA 4JQTA 2NM1A 1ZBE1 3WP6A 1FV3A 2EICA 3OSDA 4NAOA 5J36A 3Q8AA 1QOOA 1VBE1 2AACA 2VC9A 5D1IA 4D7SA 4CXYA 2E63A 1DZTA 2QCSB 3PTYA 5IATA 1UZVA 1TME1 5CBLA 2DTWA 3B93A 4CCCA 1FNYA 1W8WA 1LKNA 1Q8SA 5T54A 5F5IA 3AMHA 2RM21 1U12A 4YM1A 1KJRA 1SLCA 2ARAA 2R16A 3M8LA 4IEUA 4OI1A 3QH6A 4RFRB 1VE0A 3VHPA 4HMZA 1ULEA 2VQ0A 3UKVA 2P5BA 3A23A 1DFQA 1DGLA 1QXPA 3KV5A 4NHMA 4PIYA 1WW6A 3FUQA 4YVSC 1PVC2 3VZKA 3V0BB 4TZDA 3WNNA 2Y33A 2OUJA 3AZYA 5F2SA 5BY5A 3RYRA 3K3OA 3FLPA 1EPWA 3MW2A 2O0OA 1GZWA 2RS31 3OGRA 5FY7A 1SACA 4WZFA 5IK7A 3TRSB 4IV1B 1O4TA 2PAEA 4CYDA 2G4IA 5ERLA 1UIJA 5C33A 4JHZA 3PURA 4AI9A 2RS33 3LFIA 1PO22 1V6LA 4TN7A 4CPBA 3DYOA 4FAHA 2OT7A 2BW8A 1F5FA 1NLSA 2DCKA 3NNGA 5FY5A 5B4NA 1JZ4A 1H9WA 2E51A 4XUOA 4L97A 5FP4A 5JCTA 2J7MA 1R082 2B9UA 3MBWA 4BCUA 4DQAA 4JRLA 3I2KA 4LBKA 1YHFA 1WLWA 2WNUB 3A4UA 1PX3A 3EQEA 3GALA 4MADA 3VKNA 4YNIA 3AXDA 3B02A 4RN5A 5F5AA 2RM23 4LE3A 2QFEA 4FFIA 1YRZA 2WN2A 3OPZA 2VOKA 1I9RA 5FZEA 4X8NA 5A70A 5DABA 1KQRA 5E6HA 4PDWA 1AL21 1QHDA 4AVCA 5JOWA 2ZEWA 4Q4X2 5KHKA 3PUHA 1JZ6A 4P9JA 3TNQA 4HKWA 1DG6A 2WDBA 3GHNA 2CDPA 2XH6A 2OYZA 3SH3A 3VD4A 2YBPA 1VBE3 2GH2A 4KMQA 4AEJA 1UPIA 4YW3A 2ZS6B 5KXDA 3AKRA 4FOVA 4JGZC 3DYPA 4K20A 1NG0A 1CAXB 5FLIA 1GQGA 1ZBE3 4COUA 4C0HA 3TEYA 5LRRA 2ZGKA 4WBBA 4TLFA 5T3NA 1VRH2 3VBOA 4IEYA 2F4PA 5IVEA 4ZZ8A 3GZTB 4F8AA 4BHPA 3NKGA 2KM2A 1CX4A 4L92A 2JG8A 2AYHA 2JDPA 3MFCA 1ND3A 4M4RA 4PIXA 1FI2A 3VBHC 3ZMNA 4DS0A 3KHCA 2W08A 3B7MA 2EVXA 3ZYGA 4WZCA 3WW1A 1SBFA 3ITQA 1YWKA 4LK6A 3ACIA 4O65A 1R083 1TMF2 5FYHA 5FZLA 5I8SA 3CU7A 1O8SA 2ZGUA 5C5UA 4XUPA 1AYM1 5I0TA 1O3SA 3AMQA 5FP7A 3TEWA 3WQBA 3VZMA 5J48A 2FDKA 1XRUA 2ID4A 3RZGA 1S0JA 1MVEA 1RUC2 3KV6A 1I3HA 2HWB1 1D7PM 2ZGPA 1O5UA 4UFHA 2HBTA 1PNFA 1WCKA 2BERA 1E57A 2MEV2 4ES8A 3C7FA 5E89A 4BQYA 2VW1A 4LHKA 3LEGA 5LA2A 4NIHA 3ZN6A 2HLEA 4DEVA 4ZXEA 4CDXA 1AR61 1OA4A 4QQOA 4HBNA 4XC9A 3C8XA 5FYIA 2ET7A 1AJKA 4IETA 5FYYA 3X29B 5CFCA 3CDZB 4WM8B 3BIWE 4N8MA 5FP3A 2B4KA 3JD73 4RGKA 4IUGA 4JKKA 2OKXA 1OHFA 5BUVA 1F4AA 4OCTA 3WDTA 5JSPA 3EO6A 2VBBA 3K4AA 4TYSA 1UN1A 4FP2A 5GLWA 2GZWA 1F15A 1Y3TA 5A32B 2QUOA 2DF7A 3OCPA 4QHOA 4LNVA 3OBAA 4I3PA 5KXCA 1JMUB 2CL2A 4Q4V3 3USSA 3N36A 1LESA 2DCJA 5GALA 5C4WC 3DV8A 5FZDA 5FZ0A 4MGZE 2RJLA 1LB2A 1AR82 4AI3A 3AJYA 1FATA 1ND2B 1WMFA 4KI5M 3ON7A 5D2AA 3AZWA 4D6RA 5GZFA 5F9TA 2GNMA 3POEA 2R071 4OZOA 3VBOB 5CA6A 3H1MA 2QDNA 1W99A 5DAXA 3V0AA 1C8M3 1YQ6A 3H8OA 1C4RA 4RR3C 1W6PB 5BNPA 4Q1PA 1AL22 4QXKA 2HWC1 4XQWA 2DBIA 3L2HA 3KQ4B 2VUAA 5M0TA 1Z0HA 3HT1A 3ORJA 5A3PA 1J58A 4JHTA 4MXVA 5FZMA 1US3A 1S0CA 2WKKA 1QJU2 3WF3A 5K0UC 1MS3A 1ZBA2 4OUMA 5HV0A 3ZSEA 3TAYA 3GBGA 1X33A 5F7UA 4OZXA 1XB9A 3W58A 3E1F1 2BBVA 3URFA 5CFCC 5CYYA 1STMA 5FYTA 4MUVA 4ISRA 2Y6HA 1J59A 2XG3A 1ND3B 5LEKA 5CEHA 1Q43A 1ZRRA 3IMMA 4HL0A 2Y26A 3TB0A 3W5MA 4M0HA 1QJU3 4A3ZA 1L7RA 1W9WA 4FPEA 4AVSA 4FQZA 3WQ7A 1UU5A 2FDGA 3I49A 2WSVA 4BMEA 3BPZA 1HB1A 3JBG2 2ERFA 5HCBA 5ABJB 5IFTA 3FUOA 4M3CE 5LCWL 5A6QA 4DIQA 1V9U1 1W8NA 3HNMA 1K5MB 1RGSA 2DFBA 5AC93 3O1VA 4NHKA 1QKQA 4YZ4A 3POGA 3ZR5A 4UBGA 5HBAA 4YM3A 5CIRA 3L2YA 3O1MA 2XJRA 4K3UA 3UJQA 1XYNA 4KNCA 3RZHA 4AQSA 2RDNA 4XW3A 2VZRA 3INAA 1HV1A 1BKZA 4QB6A 2VMCA 4B29A 5A1FA 3WF1A 2XQXA 2YPDA 2ZHNA 2VZSA 1ZNPA 4E2SA 4AL9A 4OMDA 4Q4X3 3UESA 5DN2A 4OUSA 2C5DA 3UGHA 3OTFA 5LA1A 1S0BA 1VBE2 2VZOA 3IPVB 2BGCA 3T08A 2GC2A 1AYN3 3WP5A 1JXNA 5CKQA 3PVEA 4XACA 5HCHA 2JDUA 1OFNA 1NKGA 1YFXA 1LOBA 5JPNB 1RUF3 4IEZA 1JOJA 1GZ9A 1QNWA 1Z7S1 3V0AB 1JYCA 3FL7A 3I8TA 4UFMA 5GLTA 4LK7A 2ZOEB 4Y1XA 4IXLA 3H3LA 1RUG1 4KWKA 5HXVA 4XF3A 1E5RA 1PO11 2GH8A 4YVSB 3ZSLA 1LGBA 1RVF3 4IE6A 1W05A 3PDQA 2NMNA 1OKOA 1RJ8A 2IWGB 2WZEA 5IK8A 5EQUA 4GH4B 2WR9A 3CJIA 4DRVA 1K5JA 1W2UA 4QPWA 1WCSA 1XOYA 3T1LA 4OYUA 3VZLA 4EN9B 1W8ZA 4XF9A 1W06A 4Y26A 4NJ4A 2QQJA 4FPCA 1GKBA 1PGL2 1X9TA 2A75A 3K77A 2B46X 1LOEA 1NCRC 1UF2C 3WT3A 2Z69A 4LLFA 4Y3OA 5LBBA 2RG4A 4XOGA 1CAUB 3VBRA 1MZ5A 3GM8A 1AR72 3VZJA 4CP2A 5KC6A 1YFWA 4MXWA 4XAEA 1QJX1 1RUE2 2XGXA 4A6SA 1AUYA 2P17A 4AEMA 1C5IA 1PM4A 1ZZ9A 1GZTA 3NMBA 2QNKA 4E4ZA 1OQEA 5L19A 5DQ0A 2ADDA 3NAPB 1C3HA 4N43A 5ABJA 2LS6A 4KL1A 2RV9A 1XBFA 1A6CA 3UGGA 1JN2P 3SMHA 5A80A 1WUVA 4W6YA 1F9KA 2BRTA 1H6YA 2K2SA 4ZPIA 1WLCA 4Q0VA 1JZ8A 3POWA 1HB3A 2W0XA 2CGNA 5DDJ3 1ZBA3 4HSLA 2ZX4A 3N9LA 2UY9A 5FXXA 2LW8A 4QKBA 3U1XA 2HWE1 3MIGA 1UAIA 3AYEA 1EV11 2QE3A 2WT1A 3H42B 2CV6A 4W4ZA 4IGOA 2VY0A 3VV1A 4Y1YA 2Y64A 4QPIC 4W6WA 3N9MA 4XF1A 2VQTA 2JE7A 4AFCA 1FPN1 2FCTA 3RRDA 1LOAA 3I97A 2VH9A 1HB2A 5FJKA 4A41A 2L9LA 3AP6A 4GJYA 1VRH1 3F2ZA 3JZVA 2FCUA 3O1PA 4JQRA 3VBFC 1YEWA 2YY1A 3M3OA 2W1QA 4MZUA 3SEEA 4LJHA 4KH9A 2DUQA 4DPNA 5T5PA 3E5QA 1OA2A 4NHLA 2IXIA 4DZGA 1G9FA 5FTTC 3I2HA 1GOHA 3ZYHA 2AGSA 3JQWA 1GQPA 1AR91 2QVSB 3B94A 4Z2AA 3WV6A 3ATGA 3VB9A 2WRAA 1VAKA 4DY3A 3WW2A 3ZIXA 1DYPA 4XJ9A 1U5ZA 4LXLA 4PI2A 3O1UA 1U5IA 2D98A 3PUQA 1XSQA 4PT6A 1FOD1 5ANQA 4MYEA 2ZA9A 1T2XA 1T6BX 3ZYIB 2JKBA 4FOWA 3W20A 2VZVA 1D4VB 3ZYPA 3IWZA 1REDA 3B69A 3N9NA 4WM8C 4HANA 2VMFA 5T5OA 1O8PA 4BK4A 1S0GA 1OT5A 1AYN2 1EAH3 4EROA 1OC1A 3CL1A 4XDPA 2ZX2A 4AAPA 5A7QA 4H7MA 2WNVA 2ZMLA 3J7NA 5T52A 1PIV1 5HXMA 3SLIA 1C57A 2WNOA 4GJZA 4QX3A 1Y9GA 2PTMA 3UT0A 4Q8KA 3MZHA 2AREA 3U10A 1I1EA 3U14A 2QQUA 1UYZA 4NPRA 2PFWA 5JOZA 5KBFA 3I2IA 4B8EA 2A6VA 5AFEA 3WUCA 3EBRA 3AZVA 4BQXA 2VW0A 3M3IA 5FZIA 1ENXA 2NLRA 2W87A 2Z79A 1UYXA 1SDWA 2R042 4INDA 1JODA 1JTZX 2AENA 1GR3A 4XETA 4K8RB 3AYDA 3WQ1A 3WNXA 1DQ0A 1G9CA 4BB3A 2C1FA 5H9SA 3H50A 4R9DA 4YW4A 2VVFA 3H3UA 4DOUA 4GZ9A 5T55A 1RYYA 1W2TA 4RS5C 2QJVA 1TME2 3IAPA 1NLQA 3VBSA 1PIV2 1RB8G 1W6MB 2CYFA 3KT7A 4AGRA 3GNEA 1NUKA 3P5BA 1S1AA 4FTEA 3MLJA 4XQDA 5FCCA 4RYDA 3MIHA 2HH9A 1F5JA 3WF0A 5JOXA 2ENRA 4BIFA 2NPIA 4HXCA 3CBNA 1H8TB 2E7AA 2P4EA 4XFGA 2X5IB 4CCDA 2WS93 4ZXKA 5D8AA 1Y7BA 4LBJA 3MGUA 1GP4A 3WF4A 3KS7A 5DAWA 4GD4A 1VP6A 3I4IA 3LEIA 5DAVA 2K46A 4MHUA 4NIGA 2OQ6A 1W6OA 1WCQA 4ZU4A 4MHRA 2JIJA 5J3UA 2W52A 4P02B 5DPNA 1WA6X 4TSVA 5DUXA 4DRRA 1HRI1 1MEC1 3TNPB 5CKNA 4AHWA 2F17A 4XDQA 2WNEA 3CLPA 4IERA 5A7PA 3WEZA 4B1LA 4CRQA 3S6PA 4E2GA 1JI6A 3H9AA 5DG2A 1W0PA 1D0GA 2ZKLA 2WA4A 1RUD3 1VIWB 1Q8VA 1HX6A 5F8PA 1V6NA 1RUC3 3MUY1 3CEWA 4YPJA 4B3NA 1LCLA 1N1YA 3VKFC 1UX7A 2Q0AA 1VBD2 2OA2A 4S2DA 1BVP1 3I59B 4AVBA 2Y8KA 3FHIB 1TNRA 3FLTA 4LO7A 3N9OA 3HBZA 3S5QA 2VW2A 3C7HA 3ZPOA 4BOWA 1N1VA 4DUWA 2W94A 1NLRA 4A42A 1D4M3 1VPHA 1AR83 2KA3A 2NZ9A 3J8F1 1J3QA 2HWD3 2VUJA 3D0SA 1W0OA 3S30A 2D6LX 2LM3A 1W6QB 3DCQA 3IZOA 2QQKA 4XIKA 4XURA 4FOYA 5FY1A 5T5JA 2B45X 3LIGA 3SCHA 5FWJA 1XPWA 2TUNA 1BMV2 1E5HA 1CAVB 4BQ3A 4LEJA 1BMV1 4B7EA 1JOPA 1FV2A 2ZTNA 3KQRA 1RTVA 2JB8A 1NZCA 1NY71 2ARXA 4GMP1 1UD1A 4Q26A 2R32A 1OVPA 5FPUA 1WW4A 2LALA 3ZLIA 4CDQA 1GZWB 3K4ZA 4I02A 2X10A 4XJZA 1NCQA 1V6MA 1KFUL 4NWVA 3FFQA 2JG9C 5FZGA 4LBMA 2BP6A 1UZZA 3AVRA 2BJSA 2W39A 4XILA 2R063 4YG0A 3PL0A 1IPKA 1XXNA 4Z82A 3WDVA 1AZDA 2P3JA 1WW7A 2UU8A 3HOBA 4PLNA 4D69A 5JSRA 4OI2A 5C6CA 4EZ4A 3THPA 3OBTA 1U5YA 2BU9A 1CJDA 1NCRB 1MZ6A 1VBB1 2MPFA 4JGYB 3VHNA 3VKMA 1HXS1 1PZ8A 1R091 2PHUA 3APBA 3PIJA 4Q0PA 2KD7A 1JYIA 2WFF3 2XJTA 1RHI1 4Y22B 3E5UA 2X29A 3R4UA 2WC2A 5D8AB 2AZ5A 4YZ3A 4FTSA 1DYKA 3VDBA 1GYKA 2RS13 1GWLA 2P1BA 3ZXLA 4D6QA 1OSGA 1PGW2 4IESA 3RQ0A 2VNVA 4COVA 4FTBA 3J7LA 4PF1A 1LU2A 1W04A 4BQ4A 4Z2WA 2BNNA 3W59A 2PLV3 2XONA 2B8MA 3MIFA 5EFUA 4HETA 3D6EA 3IIAA 4WVZA 3I59A 4I2OA 2JDYA 4FPGA 2ZKNA 5EYYA 3VLBB 4Y20B 3LFMA 1UOFA 2P2KA 1OQDA 1PGW1 2PXJA 4UAPA 4FT8A 4K9SA 4RR3B 5FPVA 5LY2A 1I6XA 3C2UA 5IYYA 4EWAA 5EYXA 3SITA 4LPLA 5FYCA 1YXWA 5FOBB 4Y24A 2Q30A 5CFDB 5H9RA 4G4FA 4XMAA 2XOMA 3N35A 3ZM8A 2O8QA 1SEFA 2W47A 4X8PA 5DZFA 1R1A3 3H7JA 1TQ5A 3MPBA 2WJSA 1ZZ6A 3AXEA 2WWSA 5DAQA 4D8MA 3AKSA 3BB6A 4YG6A 4QB1A 4P9LA 4E4HA 4IEVA 4IEQA 3K51A 4CEYB 2P6HA 3VZNA 1E5IA 1TG7A 3AYCA 3IMNA 4M3CA 5CB7A 3TWIA 4DUVA 1Q56A 2NQYA 3VUOA 3E6CC 4XJWA 1LENA 3MLKA 5LA0A 4QKFA 4MH0E 3DECA 3HNBM 1HIXA 1CAVA 4GXLA 4N43B 1DDLA 1HJFA 3VBHB 4HLTA 3ZFGA 1JUHA 1V6IA 2Z42A 4LUMA 2PLV1 3WD5A 4BMBA 3RS6A 3I3BA 4NOTA 2RJKA 2IVJA 4UYBA 5LY1A 3I3MA 3MUZ1 1H30A 2HJIA 3T4VA 3J9SA 5IFPA 1U0AA 4QDSA 3KT4A 1LOGA 2JJ6A 3HR9A 4MO3M 2RS53 1L7LA 1POV0 2BNMA 2RS11 3VBRC 1NCQB 2ZGSA 1TNFA 5FXVA 5IK5A 1PM7A 1RHI3 2GDFA 2VOVA 2WFF1 3OG2A 4JGZA 5GZEA 1F8VA 2BVVA 2C4XA 4MOAA 5IW0A 3LAGA 1FOD2 4I01A 4L8QA 1LAJA 2HWF3 3RWNA 1RIRA 2BTVC 1YFUA 1BEV3 3H1WA 4HK9A 4Q1RA 1G6NA 1OOPA 2P3IA 2Y38A 2VMDA 4NRMA 3VD5A 4DEQA 1AXYA 4JC1A 1BJQA 4I0BA 4IV1C 4CDUC 5FJHA 1QDOA 5AVPA
chains in the Genus database with same CATH topology
1RHI2 4FPKA 3SHRA 2R061 3WR0A 3VBUB 2CY6A 3FX3A 4XJAA 1G8WA 1IHMA 1MS4A 2BFUS 2DU1A 5CNAA 3O0WA 1HXS2 5F6LB 1W6PA 3SNMA 2QQPA 2GNTA 2G9GA 5KXEA 2FMYA 4KWLA 5J98B 3T1MA 4QHBA 2JICA 2CWSA 3AP7A 2EXKA 1B35C 1EV12 4NN0A 4E2QA 4XEZA 4Y20A 5DXDA 3FE5A 5ACA1 3WHTA 3NW4A 4CP1A 1REEA 4YGDA 4FCAA 2HWD1 4DXZA 2W68A 1D4M1 1UIKA 1SLIA 4FO9A 3KT1A 3M1HA 1MS0A 4WM7B 1AJOA 3HN1A 1N3OA 1RUC1 3VN4A 1YJKA 1ASJ1 3LA7A 3JQXA 2VMGA 2WNUC 1HQNA 2YGMA 3OYWB 1RUD1 2R1BA 4D7TA 1WLTA 1SLAA 1IOAA 2K0GA 3OGJA 1COV3 1UKRA 4OHWA 1MEC3 1HRI3 4XFFA 5A33A 4CEWC 1AL0G 4UW4A 4N9HA 1HW5A 2GC1A 1GFF2 2PHDA 2DVDA 3PNAA 3WX5A 2WLQA 1QU0A 3IPVA 4AYUA 4HKOA 2XJSA 2D97A 1JBCA 1GV9A 4IEXA 4BYYA 2WS91 2ZJCA 4YVWA 4DMIA 5L7OB 2VOWA 3ZIWA 2OPKA 4AF9A 3KGZA 1IPJA 4E4SA 2ZBJA 1NQJA 2KXLA 4CEYC 2WFPA 1D2QA 3WZ1A 1GANA 1VBA2 4LHLA 3AM2A 1UPSA 2RR12 3O14A 1TEIA 5H9QA 1H0BA 1JHNA 3N3HA 3VBUA 1RUJ3 1XQNA 2XKOA 1T6GC 3DPRB 3KB5A 4PJYA 1G9BA 1S0DA 4AEDC 5J37A 3POYA 4L11A 4EWEA 2AH2A 3J4UH 3JCIA 1C5HA 1POV3 4XFIA 2XL7A 3R4SA 1CESA 3ZXEA 3V0BA 4BE3A 1BXHA 2YPJA 4QPGC 5T5LA 3DL3A 4MV2A 2BPA2 4BZ4A 2Z2SB 1SQ4A 2IXKA 2EXHA 2CAUA 4QPIA 5GLZA 1RVF2 1AXZA 2RMU2 4IV1A 1PIV3 2A3XA 4GH4C 4D94A 3RI8A 3ZN5A 3AP4A 5CADA 1X82A 4JTOA 3S7EA 1EAH1 2HEWF 3OYWA 3SH4A 1LGNA 3E5XA 3RSJA 3VBSB 1IKQA 4WM7A 2I45A 5TSWA 2ATFA 1FOD3 3R4DB 2PAMA 3KZ4C 3VBSC 1N47A 3E97A 1VLNA 4LUKA 4H55A 4Z07A 3WLUA 3MYXA 4AVVA 4B4PA 1QXJA 5EZWA 3HT2A 4C91A 1CAWB 3M7AA 3LOBA 4LBQA 4IEOA 1UCXA 5JLVA 1PK6C 4YVWB 3N7MA 3AYAA 4GMP0 2A3YA 4H14A 1H8VA 5CFDC 4P5HA 3MIDA 5SV5A 5FMOL 1LODA 3ZSMA 3ZN4A 5ACA2 4YFWA 1IS3A 3KLSA 2XBO3 1FPN3 3CJIB 2IFWA 5DUUA 1EV13 2WNVC 2HWE3 1NE6A 4UW5A 5DDJ2 1KRIA 1AHSA 3IDCB 4PLMA 5EWSA 2R30A 1O4YA 5DDJ1 4ASMB 3NL1A 1OKQA 5C8CA 5FLJA 1IS4A 4N7UA 2XWBB 1O3RA 4Z8BA 4AQTA 1NE4A 5FFOC 3POSA 2PQQA 4HK8A 1XU2A 1ULCA 1PZ7A 4KQ7A 2ZGMA 4EV0A 1DGRN 1HDKA 2YV8A 4YZ2A 4N43C 4L99A 4Q4W1 1LEMA 1Z7S2 4R52A 1LEDA 4KGGA 4P9YA 1QJX3 1H2MA 4K1ZA 3M70A 4GIQA 3I54A 1NA1B 2PAKA 3NSTA 1PK6A 4WVMA 1J3RA 1IZ3A 2DFCA 1COV2 5BYNA 4HKLA 4JDOA 3OD0A 4YGBA 3WDYA 4ATEA 4P9GA 2YXSA 4FOQA 3SCGA 1HQLA 4RSUA 3WG3A 4LBQB 1QGLA 5A32A 2E7TA 4A7ZA 3MI8A 2E9QA 1QQP1 1YUDA 2IFRA 3G6JB 1QWRA 4CDUB 1DQ4A 4P9XA 2H6CA 1RVF1 1W6MA 3HD8B 5C8CC 5GLUA 5J7MA 1LR5A 4FQ4A 3M4FA 3JBG3 4QM8A 4M0NA 4RS5B 1PVC3 3EXUA 1Z7S3 2D6PA 1H8TA 2C9AA 2UYAA 4I0AA 4ITCA 4H3WA 1DHKB 4MGYE 1HRV3 2DVFA 5JPMB 3RI9A 1AYN1 5FRAA 1DF0A 3CJXA 2UY8A 4URTA 4JGYC 1MZEA 1OOPB 4Q4X1 2D7FA 2H6BA 1KDMA 2ILMA 3ZYRA 4JTNA 4MVTA 4QGLA 1ZRCA 4QQPA 1SBDA 2WZR3 5BNOB 1KDKA 4RR3A 5BNPC 3ETQA 2Q4SA 1DZRA 1CGPA 2WNVB 2UWAA 2VGDA 5DG1A 5CFDA 2YC0A 1M4WA 4EN0A 1H2NA 1AR92 1BYHA 5JI7A 1OFSA 1ZZBA 1VBA3 3LCPA 5I0SA 4XF0A 2WT2A 1XNKA 3CF6E 5JR7B 2UURA 1V9U3 5AC91 4OFGA 4BIOA 4E4DX 2FBEA 4IV3C 4FSJA 1VBB2 4A2UA 2R1DA 3HIFA 3RG0A 3ALQA 3MF9A 3MFAA 1W6NA 4RHV1 3AKTA 3WP4A 1ZX5A 1GICA 2XL9A 3IN9A 3N7LA 3PLQA 1SLBA 4Q0SA 4O9GA 3SH5A 2RMU1 1K5MC 1W6QA 4QGNA 1Y43B 3QCWA 1ZVFA 2B5HA 5AFBA 2HWE2 4Q0QA 2BWAA 3GZUC 4CEWA 2Q8OA 4LBQD 2D43A 5AC92 4K7JA 3UK9A 4FP3A 1UZYA 5BNNB 4XBNA 5CU1A 1JW6A 3AZXA 3D8CA 4KU8A 2QZ3A 5GLVA 3VZOA 4YFZA 1ZRDA 3UJOA 2ZX3A 4I3GA 3P3PA 5F6KA 2JX9A 3HAGA 3ZFEC 5CVRA 2D3PA 2R073 2XJVA 1VR3A 2GC3A 2WZPP 3VBUC 1VB2A 3FFZA 1YJLA 2RR11 2XLFA 3J8F2 1ULDA 1GNZA 3D0JA 4G9SB 1SCRA 4Q4V1 3RYPA 2VQAA 2ZHMA 3RZZA 3IBMA 4EN8B 3GHMA 3QH7A 3B9CA 3ZXKA 2D6NA 2ZX0A 3ZDSA 3AFKA 4NWWA 2DVBA 3JD72 4AFMA 4AHXA 4DINB 4HZFA 1MZFA 2EA7A 3JD71 4LHNA 1CVNA 4XMIA 1MR5A 1EY2A 3AJZA 2DCTA 1WD3A 1AR63 5LK5A 2WIIB 5AVAA 3ST7A 4FBFA 4GKXA 3DPRA 2XVKA 4Q4V2 2WA3A 3KCCA 1MQTA 4XTPA 1RUG2 1RUD2 3PMEA 4AWDA 1U5XA 4MGIE 4LO6B 3MPPG 3S7IA 4Y4YA 2ZZJA 4A7KA 3RYKA 3THTA 1RUI2 3ZN6B 5I8TA 4S2HA 4YW1A 3WVJA 1B35B 2CWMA 3BALA 4AE2A 3WINE 3R05A 1Q3EA 4WM8A 4LO4B 3D4KA 1R081 5KXBA 2A6XA 4YYOA 4AFBA 1EP0A 3NAPC 3SISA 2RR13 4AQ2A 4COYA 1VALA 4FPFA 1DQ2A 3BOPA 3M3CA 5KC5A 3ZXFA 1WD4A 2XPJA 1B09A 3OY8B 1S55A 2OVUA 4KBBA 1QH6A 4YSFA 4XHBA 2GN7A 3AMNA 1PGL1 1HKDA 2DU0A 4RHV2 1CD3G 5GM0A 1BBT2 3IT8A 3AFGA 1YCIA 4BWOA 4EJRA 4UW6A 1V9U2 4JDNA 2TEPA 1OPMA 1C8M2 2VULA 2ZHLA 3VHOA 3VL9A 1AL23 3WCSA 3ZXDA 3WW4A 2RM22 2RMU3 2WZR2 4M3CF 3ILRA 4RQPB 3VKOA 1RUJ2 4RHV3 2XLAA 2DURA 3DGTA 3N7JA 1X8MA 3NV2A 3M2MA 1H1MA 3FJSA 3PJQA 3MIBA 4O9EA 4RD7A 5H9PA 1ZZ7A 3IKWA 2ZX1A 2OIIA 3WW3A 4Y1VA 1CQ9A 1MS1A 2WFF2 5E16A 2WNUA 2SBAA 4GKYA 1VBA1 4JV4A 1DZQA 2PN5A 2BEOA 2P37A 4XPVA 4Y1ZA 1XYPA 3IDBB 1DQ6A 4XIOA 2A73B 2BVBA 3LWCA 2WZR1 2WS92 4QU2A 4XXPA 1QMJA 1CIWA 4RFT0 2AUYA 1FXZA 2GC0A 1NYWA 4FXKB 2YGLA 4LR4A 4GWNA 4AEDB 4L2NA 1HRV1 4DY5A 1AVBA 4XHXA 1TME3 3UV9A 1HQWA 4AG4A 3VBOC 1F2NA 1PVC1 1H2LA 4GQ7A 2PHFA 4JRAA 3JBG1 1SLTA 1PK6B 2GSYA 1GNHA 2XLGA 4J1XA 3VKLA 1H1IA 3GZAA 1VBC2 2ARBA 4ATFA 1ND2C 1J3PA 1QQP3 2Q5TA 4PDWC 1RMU3 3LKJA 2X5IA 3ACLA 4JGZB 1DGWX 1XNDA 4A7YA 2ZPXA 4XBQA 3IDEA 3O0XA 1ULGA 2UYBA 2ETEA 2HYKA 1RL3A 3ZXAC 2JXAA 4FPHA 4W6XA 1KJLA 4JAAA 4BA6A 2XB6C 4H7LA 3VGIA 2E7QA 1A8DA 5CFCB 4PBPA 1WCDJ 3GYDA 5E88A 5JSOA 4OHYA 3KGLA 4NR1A 2X53S 4UW3A 4DFSA 2D3SA 2FQPA 4Q4W3 4I30A 1VBD3 5BV6A 1J1LA 2NN8A 4IL7A 3T2TA 4R9AA 1H9PA 1NOVA 4META 4QD2A 1MEC2 5HCAA 2B39A 1O7FA 3VBRB 1N3QA 2O1QA 2OZJA 4LLOA 2ZGRA 1OMIA 2MEV3 4PF5A 4XTMA 4GA9A 5C9AA 5I8YA 4GULA 1S0EA 5L7OC 2ZZQA 4GB31 1QH7A 2D93A 1VB4A 1XE8A 2JENA 4Q4Y2 4BM8A 4BLIA 1NA1A 5K7PA 4OULA 2XBO1 4CP0A 2XVLA 1A3KA 2DVGA 2D6MA 5L36A 2Q1ZB 1OI6A 3WP3A 1FT9A 2PLV2 3UL2A 4CDWB 2H0BA 4DNYA 3CNAA 4Q4W2 4FPJA 4QX5A 5A3MA 5KHGA 2EXIA 1AYM2 1LJ7A 4RA0A 4C1WA 1G86A 1VAVA 2FMDA 4LTAA 1H2KA 1EAH2 3WXPA 4QQHA 1IKPA 2RS32 1AX0A 3ILNA 4YW2A 4XJ8A 5JIUA 1CN1A 3D5OA 1LHVA 4YGCA 4XFCA 1AX2A 4HSJA 4J6GA 4BH9A 3KMHA 2PHWA 4PBOA 3ES4A 1KS5A 4YLZA 3RJRA 4OHZA 1N3PA 4K1YA 3G7DA 2D6KA 1YNAA 3QACA 4YM2A 5FLHA 4GWMA 1V6KA 3WCRA 3AMMA 4UBHA 4AEKA 2NMOA 3BODA 4COZA 4IQPA 2WLPA 2YYOA 2WSUA 4MSVA 3RJ2X 4Q29A 3MEPA 5JZGA 1POV1 4CDXC 2XJQA 2YMZA 4Q8LA 3ZXGA 2R49A 1YIFA 2EIGA 1WLDA 4QGMA 4E27A 1RUJ1 1QJY2 4PDWB 1SFYA 2TNFA 4HFSA 3VDDA 2QZ2A 2XWJB 4QT6A 3WY6A 5CAZA 2GMMA 4ISQA 1EYBA 3WG2A 5E8AA 1KD7A 4JVAA 1C1FA 4WV8A 3RMYA 5I0UA 3GBFA 4A3XA 1LHUA 4IEPA 2R6QA 1PO23 2CAVA 4R9CA 3U11A 3JB8A 1O5LA 2NYYA 2D3RA 3AMPA 3VBHA 2IZWA 1KS4A 4QPYA 1PGSA 1OD5A 1YLLA 2DUPA 2ZAAA 2ZMKA 1B35A 2A6ZA 5FPZA 3NVCA 3TN93 2IXLA 2YHJA 4BLJA 3V64A 5IUQA 1ZM1A 1NY72 4XFBA 4CDWA 1BK1A 4U2AA 4LA3A 1COV1 5FO8B 1FMD3 4FVVA 1H4HA 2ZAHA 5FQ0B 3NV1A 3WQ0A 4B4QA 3FBYA 4N90A 2HWF2 1FNZA 3H3ZA 2OW4A 2PYTA 3TN92 1LTEA 2FZ2A 4CDUA 1ASJ3 1Q8PA 1RUE1 1RUH3 1W39A 1QOSA 5GZDA 1YIPA 4YG3A 3DKWA 4NVPA 1L3JA 3VL8A 3U07A 2I07B 1PNGA 1DU3D 4BQ1A 4RL7A 1C8NA 3UKTA 1V6OA 4RQPA 3LGRA 2JEMA 1R092 3DN7A 4HVRA 5GKAC 1TMF3 4K8FA 4XXAA 1G7YA 5IK4A 5KHHA 1O3QA 5ACA3 2JE9A 2VNRA 2IC1A 1G9DA 1UL9A 4YARA 4R4XA 4XBLA 4Q4Y3 1RUI3 3VDDB 4F7ZA 2A6YA 5BNOA 1Q8QA 3FBMA 4QM9A 4RGAA 4Y1UA 2YUEA 1PO12 4LBOA 2I74A 4XJUA 5DUWA 2BFUL 3MF6A 1ND2A 3L9JT 4MLOA 3I7DA 2ZMNA 1RITA 1BZWA 5BNOC 2K9ZA 1I5ZA 5FMOS 4WVMB 2YDEA 3ECQA 3NO8A 4X6RB 1BEV1 2SLIA 1ZRFA 5FREA 4Z1VA 4QQ2A 2HWF1 3DUIA 1W6NB 2DUOA 3P3NA 1SFNA 3ZPYA 1LOCA 1YI9A 3WHUA 2HWD2 5GZGA 4D7YA 1BBT3 3OY8A 1N1TA 3NV4A 2R0FA 5ABJC 1A78A 1AR71 2B7YA 1OLRA 1DBNA 2GU9A 2RS51 2CGOA 4CEWB 3LSDA 1GLHA 1N1SA 4ONUA 1LULA 5BPXA 4K6BA 2ES3A 4I09A 3LA3A 4I0WB 1X8EA 5BNNA 3ZFFB 2UWCA 3ZFGC 4HVQA 2P3KA 3JUUA 3OF1A 3U0ZA 5KHIA 1X36A 4OVEA 1O4ZA 4CZSA 1WMDA 1YFYA 1S2BA 2BUKA 3VBFA 5KWRA 5J96B 2GALA 2ZACA 1IQAA 2DV9A 5K9YA 2R062 1HRI2 1DIWA 1OQ1A 3NWKA 3R6SA 1TE1B 4OI4A 4LE4A 4PLOA 1NXMA 1R1A1 1QJY3 3M3QA 2HEVF 3DPRC 3ILFA 1DGRA 3O12A 3O0VA 1ZZ8A 5JVVA 1BVVA 4N53C 1ZBE2 4AXOA 1UU4A 5FPXA 3ZSKA 2RS12 2WL1A 1ALYA 4F83A 1LRHA 3QBQA 2Y0OA 3OGGA 4XQ4A 2YZ4A 4AGVA 4YW5A 1GBGA 3HMYA 2BNOA 5EV7A 1FAYA 3WUDA 3ZXJA 3VDDC 3S0MA 3ROUA 1RC6A 3RPQA 2R043 4S2FA 3ZMOA 5DUVA 1LOFC 4LULA 2PELA 2JG9B 4N7IA 1VBC3 2ZABA 2WQZC 5C4WA 5IT6A 3D82A 1YI7A 2WINB 3N7KA 1R093 3GF6A 4LO8A 1RJ7A 5E1RA 1HXS3 4OHVA 1VBB3 5SV8A 4FPLA 2A71A 3ZSJA 2GMPA 4WM7C 4FPOB 5JIAA 3LZZA 1ASJ2 4M00A 3FLRA 1WBFA 4BPZA 3SXWA 3MICA 3FMGA 3PVBB 4XFAA 5L73A 4CDQC 1UX6A 3FWEA 2C0ZA 4WVWA 5J09A 1PZ9A 4GMP3 1SLLA 2D5HA 4YZ5A 5FDBA 1EPZA 4CTEA 5BXXA 1DGWA 1FMD2 1ONAA 3PVNA 1DQ5A 2YROA 4CDXB 1BQPA 4GB32 4DB5A 1SCSA 3H1YA 2Q1MA 3PMSA 2VMIA 4Q0UA 1MVQA 4AVTA 3MW3A 3VHRA 5EXOA 2R072 2VVEA 5FAXA 2X8KA 2E53A 2DWRA 3A0KA 1AR81 3J8F3 1O91A 3H7YA 1MS5A 2GMEA 3WG1A 1LOFA 3EJKA 4MX3A 2ZGLA 1KFXL 2QKDA 4C0BA 2PA7A 1QXRA 4LT5A 1IS5A 2D44A 1FPN2 5FO9B 3A0NA 4ORFA 1Q8OA 1CAXA 2XJUA 5JZGB 3LB9A 1C1LA 4KG8A 1XNCA 2Z5WA 2A3WA 3RNSA 1HLCA 2EAAA 5LK7B 4R8HA 3K48A 3B00A 1LHNA 1NQDA 4Y22A 1UU6A 2LTNA 3N4MA 3JU9A 4IEWA 1LGCA 4X6QB 3KSCA 4AI8A 2PHRA 3PJYA 4EWDA 1OPOA 2TBVA 3BCWA 1APNA 1JH5A 2EALA 5DZEA 4KG0A 5HCFA 1DQ1A 4NO4A 2P34A 1CR7A 2VPVA 2VXRA 3E6DA 1QJX2 1MS9A 5K0UA 2IXCA 1VBC1 3WG4A 1QOTA 5I91A 1YO8A 1M06G 4N53B 2XJPA 3Q9OA 3MLLA 2R041 4G3YC 4AHYA 1G9AA 3OBRA 1S0IA 5GJ6A 1LECA 2JG8C 1IS6A 2A7AA 1QF3A 1R1ZA 4Q2FA 4AFDA 3AB0A 3WDXA 1UMZA 1PHMA 4CEYA 2RE9A 3NJZA 2ZGTA 3I2DA 4M3CB 4QPGB 4K21A 2V09A 4AGGA 4COWA 4XYXA 2DVAA 2EF6A 1ENSA 1URXA 3AKPA 4E9KA 1XNBA 1XE7A 3ZFEA 1WGPA 4KWJA 1CONA 1RUF2 2LUWA 1QJY1 5T50A 2OZ6A 3UKNA 2MNGA 3V56A 3TYJA 5JOYA 4ZU7A 1H4GA 1MS8A 4C90A 5D8AC 1H1AA 1ENRA 1UW8A 1ZA4A 1NXD1 4Z92B 2HWC2 1R1A2 5BNPB 1RUNA 4GALA 3B9IA 2HEYF 2WT0A 3HQXA 2ZHKA 2AR6A 5FO7B 2PHXA 3QLQA 2GNBA 1ND3C 1RUH2 1W6OB 3WOGA 4D3WA 4OI0A 4HVOA 2ZCWA 3IM0A 1S0FA 4U36A 3SCFA 3PHMA 3FC0A 1AR93 1AR73 4SBVA 2VMHA 1BBT1 2CTVA 4EN6B 3CJIC 2HKXA 2IXJA 2VG9A 3ZYJB 4F3JA 1JUIA 2B42B 2FZ1A 4P9IA 4AHZA 1VRH3 3ZVXA 1NA1C 1Z78A 2RS52 2VU9A 5F5QA 1K5MA 4V1PA 2VNGA 3LOIA 2VOXA 2D6OX 3H8UA 1IGOA 2XVGA 3TOJA 1PVXA 4YRDA 2O8OA 1KITA 3FZ3A 4N53A 1V00A 3OJBA 3B5LB 3QD6A 4XE9A 1ZBA1 2F6BA 3BOWA 3ENRA 4PIZA 2GN3A 4CDWC 1D4M2 2XBO2 1FX5A 4B7KA 3LA2A 4L9BA 1X7NA 1D0HA 3ZFEB 1RUI1 4Q4Y1 1WA4A 3M3EA 2WQ4A 4R4ZA 5KHJA 2DCZA 1AXKA 2VNOA 2PHTA 3MW4A 5A3LA 1TMF1 4QPGA 3QOPA 3OD4A 1LHOA 2QDRA 2JD4A 4HT1T 2GNDA 3HWJA 2DTYA 4P9WA 1DLLA 3WDUA 3AKQA 3H0OA 2ZGQA