4IEPA

Unliganded cysteine dioxygenase at ph 4.5 in the presence of cys
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
186
structure length
186
Chain Sequence
ELLKPRTLADLIRILHELFAGDEVNVEEVQAVLEAYESNPAEWALYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTDSHCFLKLLQGNLKETLFDWPDKKSNEMIKKSERTLRENQCAYINDSIGLHRVENVSHTEPAVSLHLYSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cysteine dioxygenase type 1
publication title Cysteine Dioxygenase Structures from pH4 to 9: Consistent Cys-Persulfenate Formation at Intermediate pH and a Cys-Bound Enzyme at Higher pH.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 56
structure length 186
sequence length 186
ec nomenclature ec 1.13.11.20: Cysteine dioxygenase.
pdb deposition date 2012-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05995 CDO_I Cysteine dioxygenase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4iepA00
3H7JA 2EA7A 3ROUA 5J48A 3ETQA 1TQ5A 4QM8A 3EHKA 3H50A 3LZZA 5I0SA 4ZU4A 1QY4A 2MHFA 3BCWA 3IDBB 1ZRCA 1X8EA 3BB6A 3PNAA 1UCXA 4N9IA 2GC0A 3OF1A 4L11A 4XFFA 3DV8A 4O9GA 2OZ6A 3VHRA 4IETA 1VR3A 2D5HA 2N7GA 5I0TA 2Q0AA 5FPZA 1I5ZA 3I54A 1YWKA 1J58A 2XKPA 4LEJA 4KU7A 4XEZA 5FLHA 5I0RA 5LEJA 1WLTA 2VECA 4ORFA 2QJVA 1J59A 1O5UA 2ET1A 4I2OA 3MYXA 3KCCA 3OCPA 3LA3A 4IEUA 2O1QA 2GC2A 4KWLA 3RPQA 2QNKA 4KL1A 4IERA 4IEQA 2I45A 2OPKA 4HN1A 4F8AA 2Z2SB 3D0SA 3LWCA 4E2GA 3DKWA 4ZU7A 2GU9A 4JTNA 4MGKE 3FE5A 1QXJA 5JSRA 3E6CC 4I09A 4AVCA 4JV4A 1JUHA 5I91A 4I0AA 2WC2A 3ACLA 4QGLA 4HVQA 2XLGA 4FBFA 4IESA 5T3NA 3GBFA 3MPBA 5FLJA 1RC6A 3CF6E 1NXMA 3D82A 4MZUA 4JVAA 2D40A 5KBFA 3NVCA 2BEOA 3JZVA 5FCCA 3HT1A 2Y0OA 3OGJA 5KHKA 4Q0UA 5LRRA 1CAVB 4XFIA 3OTFA 4PIYA 1X82A 3GYDA 2B5HA 1UIJA 4QM9A 4R52A 1RTVA 4UBGA 5KHGA 2C0ZA 2XL9A 2CAUA 2EAAA 4R8HA 3SXWA 4WZCA 1NZCA 3B02A 2E9QA 1ZZ8A 4HVOA 2HJIA 3MZHA 1Q43A 1LRHA 4BYYA 2ZCWA 4MH0E 1Y9QA 2UYAA 2PFWA 4PIZA 5J3UA 1FT9A 3L2HA 3SCFA 1O3SA 3H3ZA 3HT2A 4HLTA 2EVXA 4IEVA 5I93A 1RUNA 3LAGA 3NJZA 1UD1A 1VJ2A 3RYRA 1CAXA 4HBNA 4META 5EZWA 4BH9A 2Q1ZB 4WBBA 5BY5A 5JSPA 5K8SA 4QGMA 5JR7B 2FMYA 3ES4A 3ZDSA 1ZX5A 1J3QA 3LA7A 4N9HA 4PJYA 5HI0A 2MNGA 2PHDA 1O5LA 4X6QB 3D0JA 3BU7A 4MGYE 2IXKA 1DGWA 1LKNA 5BXXA 4YNIA 3FX3A 3H7YA 3CJXA 4AXOA 3RYPA 3LOIA 4XF9A 2OA2A 3EJKA 2VQAA 3NW4A 1HW5A 3CO2A 1ZZ9A 1EY2A 1G6NA 3FFQA 3CEWA 4J1XA 3CLPA 4XFBA 2V09A 2O8QA 4LA2A 1YFXA 2QVSB 2UYBA 3FWEA 5CU1A 1Q3EA 4ONUA 4IEOA 5I8TA 3H9AA 2IXJA 1CAUA 2GZWA 2H6BA 3M3IA 4FT8A 4KWKA 4UXAA 4YYOA 1CAXB 3EBRA 1QXRA 3KMHA 4A2UA 5BUVA 4IEWA 2OZJA 2VPVA 4LLOA 4AVAA 3FZ3A 1DGRA 3WW4A 2XKOA 3H1WA 2HKXA 4QXKA 1Q5OA 4Z07A 3DN7A 2BYVE 2D5FA 1RUOA 3ELNA 3C3VA 3KGZA 3IWZA 1LR5A 4Q0SA 3E6DA 4AVBA 2IXHA 3RNSA 2K0GA 1O3TA 3U0ZA 2PQQA 2XHKA 3ES1A 4AQ6A 1NYWA 2XLFA 2IC1A 1EYBA 1RL3A 5I8SA 1CAWA 1YFWA 4MGIE 3EQEA 3H8UA 5CVRA 4Z82A 4BIFA 2GC1A 4QX5A 4HZFA 1CAUB 4I0BA 4B29A 3RDIA 4MGZE 5C6CA 4XETA 2Z69A 4GULA 4XFAA 5AVPA 4I01A 1I6XA 2MPFA 1IPJA 2QDRA 1UW8A 3E6BA 3UKTA 1EP0A 3M70A 2PA7A 3UKVA 2ET7A 2H6CA 3HQXA 4QMAA 1DZRA 1SQ4A 5JSOA 1CX4A 3OD0A 4KU8A 2PYTA 2PHLA 4LTAA 3UKNA 1ZREA 2BNNA 4PIXA 3FJSA 5J7MA 1O3QA 3N4MA 1UIKA 4HSLA 4MV2A 5JAXA 2PTMA 5FDBA 1V70A 4I02A 4HN0A 4XFHA 3TNQA 2KXLA 3IIAA 2H0VA 5FQ0A 1CAWB 5F1RA 3DL3A 5D1IA 3KSCA 3PLQA 4XF3A 3NSTA 3SCGA 4EV0A 5EFUA 3IBMA 1CGPA 4FAHA 3SHRA 1ZRRA 1L3JA 3NL1A 2P17A 1J3PA 4EWEA 2UY8A 4D7TA 1X7NA 4FAGA 1YUDA 4HSJA 3E5UA 4X6RB 4BHPA 3S7EA 1ZZCA 3LA2A 3FHIB 5KHHA 1RGSA 4EROA 1YFYA 4JTOA 1OMIA 2B9UA 4EWAA 3S7IA 5E16A 3EO6A 4HMZA 4IEZA 2PAKA 5CADA 1WA4A 4LUKA 2PAEA 3U11A 1ZZ7A 1OI6A 4UBHA 2CAVA 3NKTA 3KGLA 3I7DA 5E1RA 3IDCB 3E5QA 4XFCA 4E2SA 3E97A 3H1MA 4YSFA 2PAMA 1ZZ6A 3QACA 1GQGA 4XF0A 1GQHA 4XF4A 4OFGA 3USSA 1CAVA 5FPXA 1FXZA 3BALA 5FQ0B 1O4TA 3I59A 1SEFA 2OYZA 3QOPA 1YHFA 2XLAA 4DINB 2IXCA 4K8FA 1Y3TA 1J1LA 4MX3A 1SFNA 5KHJA 2UY9A 2ATFA 4MUVA 1EPZA 2K9ZA 1UPIA 4IEYA 2XL7A 4YRDA 1ZRDA 1NE4A 1YFUA 4Q29A 4RD7A 1X8MA 3BPZA 2Q30A 1J3RA 2XGXA 1O3RA 1ZNPA 3HIFA 3MDPA 2GH2A 1FI2A 3G7DA 5BPXA 4H7LA 3R6SA 3WW1A 3WW3A 1XE7A 1IPKA 1O7FA 2ZKLA 1XRUA 4NVPA 3S0MA 5LEKA 4IEXA 3U10A 1YLLA 2IXLA 4YARA 4O9EA 1LB2A 4TLFA 5I0UA 4XFGA 4AQ2A 4HVRA 4I3PA 1QWRA 2IXIA 4KWJA 3SMHA 4ZU5A 4J1WA 3I59B 2BGCA 5BV6A 4Q0VA 3WW2A 4P9GA 5KHIA 4Q0PA 4XF1A 1VP6A 2WFPA 2Q4SA 4Q0QA 1OFNA 1OD5A 5I8YA 1NE6A 2DCTA 2GC3A 4CYDA 2CGPA 4L2NA 3CL1A 1XE8A 2B8MA 3PVBB 2FQPA 3ST7A 1H1MA 3H3UA 1PMIA 5LRSA 2BNMA 4LA3A 3TNPB 3E5XA 4LULA 1ZVFA 5C8WA 1ZZBA 2F4PA 5JCTA 1H1IA 3SCHA 1ZRFA 2QCSB 2ETEA 5FLIA 1PM7A 1U12A 3RYKA 4OLLA 4LUMA 2D93A 3O14A 4F7ZA 4IEPA 4WVZA 3RZZA 4D7SA 2BNOA 4QGNA 4E2QA 1WGPA 2GAUA 4EWDA 3H1YA 2CV6A 1DZTA
chains in the Genus database with same CATH superfamily
4XURA 1VBC3 2FDKA 2EA7A 4FO9A 4IQPA 4XXPA 3V64A 3UT0A 3GXUA 5J48A 3CNAA 3ETQA 5F32A 1TQ5A 5GKAC 3ILNA 1HB4A 2EIDA 2WO7A 1O8SA 2HWC2 4FPJA 1ACCA 4K3UA 2O0OA 1QY4A 4IE5A 4DB5A 4OUSA 4P9YA 3UJOA 1KRIA 1X8EA 4RHV2 2ZGPA 3LEMA 1NLRA 3ZMNA 1RUI1 2BWAA 5FMDA 4TYSA 1R1A3 2B45X 3HOBA 1Q8PA 1TME3 4L11A 5FYSA 5L7OA 3MV01 1BHGA 3DV8A 4O9GA 3AM2A 4AAXA 5A33A 4CP9B 1IG3A 2D5HA 2J1SA 2J1RA 2Q0AA 2YC4A 5FPZA 1I5ZA 3GCWA 2VH9A 3I54A 1YIFA 2C24A 3O1VA 2VZPA 5LASA 1S55A 1IPSA 1J58A 3IT8A 5FY8A 2HWD3 4LEJA 4COZA 2XB6C 4COYA 4XEZA 1JYVA 3A4UA 1FPN2 5IVYA 1QH7A 5G04L 1QMJA 5LEJA 3KCYA 1U5IA 2VECA 5FUIA 3CDZB 3UNPA 2IWGB 2RM23 3T09A 1J59A 4RQPA 3POEA 3KT7A 4PDWB 4I2OA 4AW7A 3OCPA 5DAXA 2QQLA 5H9RA 5JWPA 4CUBA 4IEUA 2D6KA 4W6YA 2GC2A 4CCMA 5ANNA 3LEIA 3W5MA 3RPQA 2LRPA 2NM1A 4IERA 4PI2A 4IV1B 3NV4A 4F8AA 2Z2SB 3LWCA 3TN93 3SISA 2AGSA 2Y6HA 3J7NA 3MICA 4K1ZA 1N3PA 4ZU7A 2ZPXA 1N1TA 4M4RA 1WCUA 1QXJA 2W87A 3KLSA 4K7JA 3LEKA 4DNYA 4AVCA 5I91A 2DYCA 3UETA 1N3QA 3O0XA 4DRRA 3IB3A 2VVFA 1XXNA 2I07B 2WNVB 3ACLA 2A71A 2D44A 1JU3A 1W6PA 2QZ3A 3TRSB 2D6MA 3VHPA 4XDPA 1UY3A 4AFAA 5FLJA 1XC6A 4GZ9A 5T52A 3RZJA 2D6PA 3K3NA 1XNCA 3D82A 2VCMA 2D40A 4WV8A 2VZTA 3B5LB 3NVCA 4L92A 4WVVA 5FWJA 1SCRA 2HWE3 2Y0OA 1VB2A 3ZSEA 4QU2A 1X33A 4NE9A 2VOKA 5CIRA 1PGW2 2D43A 1AXZA 2OQ6A 5LATA 5AC91 3NAPA 5LRRA 5A6XA 4OHYA 1MZFA 3VHOA 1KITA 1BBT1 1HRV3 4A41A 1XQNA 4D8MA 2BQPA 1AR62 4XDQA 2BRTA 2WKKA 4LE3A 3TWIA 2D6OX 2DF7A 4BK4A 5BNOA 2XL9A 1PX3A 2ZGMA 4A7ZA 1K5MC 2EAAA 2RMU1 3N35A 1UXZA 4R8HA 4XIKA 3W9AA 1JYTA 4D69A 5E89A 2YPJA 4XHXA 5FZFA 1T2XA 1HN0A 1ALYA 1CZVA 5HPOA 1HN1A 2R0FA 2RJKA 2WZR1 4CCEA 3AX4A 3KV5A 4MH0E 4YZ2A 1Y9QA 2WWJA 5LBEA 5LBFA 5J3UA 5LA2A 4OMDA 2C1FA 2P3KA 1W39A 4IV1C 2YFZA 3C7HA 3HT2A 5FTTC 1NY72 3N9LA 2EVXA 1G7YA 4JKKA 5FZKA 5BNNB 2A3YA 2R32A 3W20A 4DIQA 2VAUA 1RVF3 1RUD2 3O1TA 4HBNA 2WT2A 4IW3A 1DLCA 1S1AA 1XNTA 2Q1ZB 1HXS1 1QKQA 2X53S 4JGZA 4XAAA 3MUY1 4YW4A 1PMJX 5JR7B 3BODA 3ZDSA 3PUSA 1C4RA 1ZX5A 3LA7A 3WZ1A 4N9HA 1O59A 2A6YA 2RS52 1BYHA 3KVBA 1PGSA 4JGYB 5EJ1B 4IV3C 1PNGA 2MNGA 3PL0A 2W5FA 3T2TA 4X6QB 3PUQA 5EJZB 1NLSA 1RHI3 3BU7A 2OT7A 3MUZ1 3HN1A 2IXKA 5IK5A 5IVEA 2YU2A 1DGWA 4LPLA 5BXXA 4LHKA 2VU9A 3WCSA 3AZVA 4M00A 2G19A 2R7EB 1VBE3 2QKDA 4FFIA 3WF0A 3ZXFA 4AEDB 3LOIA 2OA2A 3QBQA 2AEZA 3EJKA 3AB0A 4EZ4A 3NW4A 5LA9A 2EICA 1XNDA 3VZMA 4Q4W2 3WNXA 4GD4A 5LK5A 3N9OA 1AR72 2DBNA 1D2QA 2VBPA 5A7WB 1ZZ9A 3AC0A 4Y33A 3O1MA 2XDVA 3K4AA 2YZ4A 3CLPA 2VUDA 2ZOEB 3VHNA 2O8QA 4GB33 5CFCA 4O61A 1F15A 2D6NA 1DBNA 5CU1A 4IEOA 2WO1A 3VB9A 5I8TA 3AKTA 2IXJA 3HQRA 4Y26A 1WBFA 1JH5A 1HRI1 1MS0A 3DXTA 2VZ1A 3M3IA 5F6LB 2OKXA 1W03A 4KWKA 4JQRA 4UXAA 3N9PA 5IT6A 2ZGLA 3JXSA 4C1XA 1UYZA 4JX0A 1PX4A 1J84A 1JS9A 4XZUG 1A6CA 4YFZA 3BKZA 3GZTB 3WDTA 1AX0A 4AOCA 1BVVA 4Q26A 3VBHB 3FZ3A 1CESA 3NJXA 3WW4A 1Z7S1 2G1MA 1WCSA 1Q8OA 1REEA 2VZSA 4CZSA 1EUTA 3ZXJA 3I2IA 3ZN6B 1OHFA 4INDA 3HNBM 1C8M1 1HV0A 1NAEA 2BYVE 2D5FA 2ERFA 4YVSA 1RUOA 4UFHA 2VMIA 1BLZA 1KS4A 1PHMA 3RMYA 3U14A 3ZFFB 1QJY1 3IWZA 4FXKB 4JGYC 5FZCA 2FBEA 3VL8A 3ZYRA 4LO4B 1ZBA1 4AVBA 1MR5A 4XIOA 3RNSA 1JZ7A 3DPRA 5FIXA 3U0ZA 2A1XA 3WUCA 2PQQA 1DLLA 1GSLA 2YMZA 2OS2A 2DFCA 4Q1RA 5IJRA 5ABJC 5FP8A 3T08A 1L7LA 1EV13 2JB4A 4AEDC 1OD3A 4QQLA 3H0OA 5IHRA 1RL3A 4XUTA 4QPGA 1CAWA 5A3LA 2UU8A 3RJRA 1YFWA 4MGIE 2EIEA 3SKVA 3WW1A 2WQ8A 3GZUC 3KT1A 4U36A 2R062 3H8UA 3MIHA 4M01A 4BIFA 4CCOA 3BTYA 4QPIA 3ZSJA 2A7AA 1CAUB 3KF3A 4I0BA 4DEQA 1H8TB 2DV9A 4BZ4A 2HH9A 1VPHA 4K1YA 3WDVA 1ZA4A 1H4HA 3I8TA 5C4WB 1OOPC 3LGRA 1GZCA 5FYBA 1RUG2 3I3DA 1JI6A 2BOJA 3OGGA 2QDRA 2V73A 1OF3A 1B35B 4SLIA 1KXGA 1RUC3 5JXJA 1S0IA 4AWDA 2A5ZA 5IFPA 5FY4A 5CISA 2ENRA 2C6SA 2ET7A 3MIFA 5FZEA 4I30A 1SLIA 4LLFA 2H6CA 3HQXA 1URXA 3VBSB 4AL9A 1RINA 1DZRA 2P6HA 2TNFA 3VDDC 4Y22A 1SQ4A 1VALA 1OSGA 1SLBA 4KU8A 3TEXA 1QJEA 2A73B 3NKGA 4NHLA 4R4XA 2WS92 1ZREA 1BXHA 4UFMA 4Y24A 1R092 4PIXA 2ARBA 3THPA 3OBTA 3V0BA 3AJZA 5JXHA 2BFUS 2NYYA 3D8CA 2DVDA 1UIKA 3HMYA 2RS12 4HSLA 1A8MA 3ZFFC 5JAXA 2PTMA 2JB8A 3TEZA 4E8DA 2CWSA 2D6LX 4I02A 1U5YA 1XPWA 4JDMA 2JD4A 1AR91 2YXSA 3TNQA 2X29A 2DVFA 3IIAA 5DMYA 5FQ0A 1G86A 3NNFA 1MPXA 3DL3A 3PVEA 3L9JT 3SH4A 3KSCA 1PVC1 2VMDA 1KFXL 1B09A 1GNHA 2XBO3 3N9QA 4CDWA 5EFUA 5T5LA 1OVPA 1AYM3 1FMD3 1H6XA 4QDQA 1AL21 1W6NB 1ZRRA 5JZGA 4XVHA 2E7AA 2P17A 3NL1A 3GJBA 2XJQA 4GAZA 3NJVA 4FPCA 5D8AB 1AYN2 3GGLA 3T4HB 4D7TA 4EWEA 2K46A 1LENA 1YUDA 4P08A 4UW5A 1H8TC 4X6RB 4BHPA 3I3MA 5DAPA 3GZAA 3KVAA 5H9PA 5C4WC 1C8M3 1KD7A 1LOEA 2OUHA 3FHIB 5KHHA 1RGSA 1YFYA 1OMIA 5GLVA 3VBUA 1VRH3 1QOOA 3S7IA 4JDOA 1PO13 4A6OA 1RUE1 4HMZA 4IDZA 3O7OA 1B35C 2EAKA 1CIWA 2CGNA 4KI5M 1CZSA 1E5SA 1ULFA 1WA4A 2E7QA 4LUKA 3K46A 2WA3A 4YWAA 4EJRA 3U11A 1ZZ7A 3ZSLA 1OI6A 4S2DA 5FZ6A 5H9QA 2CAVA 3V0AB 1UMIA 3Q8FA 3OUJA 5E1RA 5C9AA 5JXGA 2W1UA 3DYMA 3E97A 3VBRB 3WDXA 5J37A 4CEYB 5JIAA 3AP9A 4QX2A 1W9SA 2EF6A 2JDZA 2KM2A 4TXWA 1POV0 1V0AA 2J1VA 4RSUA 2WAOA 1GQGA 3AFGA 3WNKA 4HKLA 2WBKA 1BCXA 2JG9C 4XF4A 4NPMA 4OFGA 4XILA 5HXVA 5JPMB 2PHTA 4Y4YA 2B42B 3BALA 1VBB1 3HAGA 4KBBA 3I59A 1SEFA 1MQTC 1NCQA 3AZWA 3UV9A 1TMF2 2WN3A 4RR3B 4NRQA 3ZPOA 2XJSA 3ZYFA 2JDMA 2TEPA 1UOGA 5F37A 4HK8A 1UZVA 2RR11 2HEWF 5IYYA 3WUDA 2CNAA 5FZIA 3WNOA 5DAWA 2WFF2 4ZS3A 3H8RA 2OPWA 1OH4A 4LBJA 1K3IA 1QQP1 1BMV2 3ZMOA 2XJRA 3VBFC 2PHXA 3AMMA 3KCXA 4QX3A 1GOFA 1VBD1 3ZOIA 2J1AA 2YDEA 3M3OA 4M4PA 5HCHA 4CDXC 3R4SA 3I49A 2ZHNA 4G9SB 5FYMA 1G8WA 3HIFA 1KS5A 3K4ZA 4LKSA 4WM8B 3IMMA 3ASIA 2ZGNA 4Z8BA 3ZYBA 1DQ6A 3MO4A 1FI2A 2VQTA 3G7DA 5CZKA 3J8F2 2ZEZA 1JOBA 4JRAA 1YCIA 1FOD2 5BPXA 3N7LA 2GP3A 4PLMA 4SBVA 2B39A 3VKOA 1YJKA 4CU9A 4ATFA 2RHPA 4L97A 5T55A 1AR93 4OZOA 1R083 5LEKA 1WKYA 3U75A 2IVJA 4XCAA 1W8NA 1N3OA 1VE0A 3ZR5A 4BQ2A 1MS5A 4YARA 4EYUA 4Q5OA 3GHMA 1PVC3 4MHUA 2Y6KA 5I0UA 4XFGA 3VBRC 4AQ2A 1J1TA 3JBG1 4UF0A 3BI3A 1NA1B 4I3PA 2OXBA 2P37A 2ZHKA 3SMHA 4ZU5A 4CA9A 4YVWA 3WOGA 1W8WA 2FCUA 2ZMKA 4J1WA 4OULA 4OI1A 3WQ7A 1BEV1 2VMCA 4W6WA 4MXWA 3LCPA 4QB6A 1W04A 1VP6A 3WNLA 2QUOA 1OD5A 2DDUA 2XG3A 3W59A 3FLRA 3ZYIB 4E4DX 2DCTA 1PK6B 1C1FA 2GC3A 4RR3C 4LITA 4CYDA 4E27A 4S2HA 3ZSMA 2DUQA 3CL1A 3ETPA 1XE8A 1JZ5A 4AYUA 5FY7A 1ZBE2 3LDBA 4AI2A 2VL4A 2WT0A 5EXOA 3ZXKA 1DYPA 1UY0A 2ZHLA 5CAZA 3ZPYA 3TNPB 5DDJ2 5DUUA 1ZZBA 4FOVA 2F4PA 3BVCA 5FZDA 1H1IA 1G9AA 3POFA 1ZRFA 1RUH3 1SPPA 4GQ7A 2QCSB 4HETA 2R0HA 4W6XA 5FP9A 2VULA 5DZGA 5A6QA 4ISRA 4ZZ5A 4OLLA 2XH6A 5HBAA 3DYPA 1W8HA 2D93A 1DGWX 1V6IA 4EN7B 1W2TA 3KT4A 4WVZA 1SDWA 2IFWA 1JBCA 4E2QA 5C3PA 4YW3A 4AAPA 2Q8OA 1DFQA 1Q8VA 2AREA 4ZKTB 3J26N 4AG4A 1DZTA 2RS32 3H7JA 4Q4X1 4ARXA 1GP6A 3ROUA 3ACFA 3BOPA 3I2HA 1OURA 1K42A 3ZVXA 3C7FA 3P3NA 4CDQB 1FYUA 4QAWA 1AR81 1N47A 5FZ4A 2R041 1H2NA 4NROA 2MHFA 3W21A 1LEMA 2E26A 2HEYF 3IDBB 1ZRCA 1NA1C 4KG0A 1GFF2 1HB3A 1RMU1 2DCYA 4WM7A 5DG1A 2WNOA 1ENSA 1UCXA 1LAJA 4D0QA 1MEC3 3AZYA 4R9AA 3KD4A 3OF1A 4A44A 3WX5A 1OPOA 1GOGA 4FPGA 1LHWA 1ASJ3 1VBD3 2W1SA 3OY8B 1NCRA 4IETA 4NHMA 1VR3A 4RQPC 3CHXA 3POIA 4PI0A 2N7GA 4TZDA 2Y60A 5T5OA 4Q4V1 2V72A 5IK8A 4N43B 5B2GB 2WL1A 3IPVA 2XKPA 5GLZA 5FLHA 3LB9A 2R30A 4GH4B 1VBC1 4S2GA 1WLTA 2B9VA 2HWC3 1OPMA 4ORFA 1Q8QA 4ASKA 2A6VA 1UY1A 3J7MA 1O5UA 4FPHA 1H9WA 2BOIA 1JYCA 2X5IB 3MYXA 5GZFA 4BQ5A 2JDAA 4RHV3 5FFOC 1LU2A 1W90A 5LA0A 4HL0A 4KL1A 1I3HA 2HWB1 4KWUA 2JKBA 2I45A 5FY9A 2Z4FA 2YYOA 4CUCA 2FZ1A 3T0BA 4E2GA 3DKWA 4AHXA 2R1BA 2R16A 3VUOA 2F6BA 1TME1 1ND3A 4MGKE 3FE5A 3JB8A 4AEMA 3ABZA 1W6MB 5JSRA 3NV1A 1W3XA 2J1TA 4I09A 1YNAA 4ISQA 3E6CC 1HX6A 1JUHA 2ZGOA 3PURA 2VTXJ 1L7RA 4DPNA 2WC2A 4QGLA 1UQXA 4HVQA 1MZEA 1H2LA 2AR6A 4F3JA 1V9U2 2A75A 5CFDA 2HWD1 4GJYA 3NAPC 1IS4A 1XE0A 2WJSA 3RVHA 3KV6A 3BOWA 3CF6E 1QJFA 4MZUA 2DUPA 1DGLA 1FAYA 2RM21 1P8JA 2JD9A 3OGRA 5LB6A 2BEOA 2V4AA 3JZVA 2E31A 2OIIA 3HT1A 3WHTA 4CPBD 4B8EA 2WZ8A 1POQA 5B4NA 4CP1A 3NQHA 5KHKA 3I2OA 2V5DA 1KEXA 5A7OA 1ZM1A 2ZS6B 5SV5A 3TN91 5FZOA 1PZ8A 4PIYA 4FOQA 1LESA 1DQ2A 2B5HA 1UIJA 5JR2A 1M06G 4QM9A 4R52A 1RTVA 3AYAA 4UBGA 4A7KA 3T2PA 3WF1A 3JD72 2Y6FA 2CGOA 5CEHA 4AVVA 1JODA 1K12A 2VW0A 3PIGA 5F3EA 5F5QA 1FV2A 5GALA 3SXWA 4WZCA 5DUVA 1NZCA 2E9QA 4HVOA 2FMDA 4XPVA 2X05A 4CU8A 4DZGA 3VZKA 2X5IC 3WNPA 1ULCA 5CKQA 5A7QA 1W05A 4PIZA 4ITCA 1ULOA 1PO21 1BZWA 5EP9A 5L9VA 1BQPA 3FL7A 1JZ8A 3OEBA 4QX0A 1HDKA 2BUKA 3VKFC 5FJHA 3OBRA 4JGZC 3VDBA 2MEV2 2WYSA 4CXYA 1GUIA 3AL6A 1O3SA 1F5JA 2ZKNA 2HWE1 4IEVA 3SNMA 5I93A 3KWVA 4GIQA 3V0AA 3LAGA 3M3EA 1UD1A 3JCIA 4PHZA 4XBNA 1W06A 4ZXKA 1AR63 3DGTA 3EXUA 4LKDA 1VBA2 1YRZA 2H0BA 4OI4A 2G9ZA 5D21A 3RZGA 3NRUA 4CUAA 5GZEA 2DURA 1HRV1 1I1EA 5GLUA 2BGOA 2EXKA 4D7YA 3ZM8A 2QQPA 2XHNA 5K8SA 1CR7A 5JSPA 2FZ2A 3F2ZA 1NX9A 4U2AA 1HQNA 3QH6A 4FTSA 4AI1A 1DZQA 4GALA 5HI0A 4FCAA 5KC6A 5J96B 1UAIA 3TOJA 2PHDA 1O5LA 4KQ7A 2XJPA 5T54A 3SQOA 2JG8A 4W65A 2ZGTA 4NRMA 3T2OA 1IS5A 4LORA 5HV0A 4DO0A 1SLLA 4XBQA 4XZPA 2HWB3 1O91A 2X10A 2GALA 4YNIA 1Q8SA 5CFCC 4XW3A 3CJXA 3B69A 5FPLA 4Y1XA 4AXOA 4XF9A 2CWMA 3CU7A 3UK9A 4P9LA 2BJSA 1RUD3 3BPSA 1ND2A 1HW5A 3CO2A 4IE4A 2BBVA 2E53A 2Y64A 4YW5A 4CRQA 5AFBA 3GCXA 1RVF1 4QD2A 1EY2A 1WLWA 5IAVA 3C2UA 3USUB 3ZDVA 1G6NA 3CEWA 4XCBA 3GALA 4LE4A 2QQUA 2V09A 1RUJ2 3I97A 2RS53 3INAA 3TEWA 5EYXA 2QVSB 4LXLA 1DQ1A 2VR4A 1K5MB 1IS3A 2YROA 3O12A 3KV4A 3T4VA 1OVSA 3H9AA 3U1XA 3AMHA 3NV3A 1QJU2 4PCRA 4AEKA 2GZWA 1CD3G 3ZXAC 1V6KA 2WNUB 3VZNA 1L7QA 4YYOA 4AFMA 1CAXB 5BNQA 4PF1A 2VW1A 4XMAA 1RHI1 2IFRA 3I3EA 4YGBA 1C5IA 1RUF2 2ZEYA 2AYHA 4CDUC 2ZX4A 3KMHA 4M3CF 4A2UA 1SHWB 5BUVA 2OZJA 5CG9A 1W99A 3IAQA 4LOSA 4Q4W3 1DGRA 1VBE1 3D5OA 4D6QA 2XKOA 4XQ4A 2W1WA 1UU5A 3H1WA 1SFYA 1ZYBA 1QNYA 2HKXA 2LALA 3DPRC 4AI8A 4UW6A 3MFCA 1LGCA 2BZDA 4EN8B 3SLIA 4BK5A 5C8CA 2HWF2 1PM4A 3A23A 3ELNA 3JQWA 3CJIA 4Y1ZA 3KGZA 3ON7A 5C5UA 4Q0SA 4GB31 5K0UB 1PK6A 2FHRA 5J09A 5GLWA 4CCJA 1A78A 4QPIC 3EMRA 4Q27A 1PO23 3IIIA 1O3TA 4NJ4A 4IV3B 4Y20B 1UPSA 2UWAA 3DECA 4OHVA 1AJKA 3ES1A 4A6SA 3ORJA 3ZFEA 1RYYA 3PMEA 2DCJA 4FPKA 4HKWA 4JKMA 3C7GA 5FPAA 5JI9A 5FJKA 4ZY9A 2Y38A 4B7EA 2V5YA 5ACA2 4AFDA 4Z92B 4R4ZA 5CA6A 2PXJA 1WCKA 5F9TA 1CONA 2ORXA 1SBDA 3M8LA 5L36A 1TVGA 4RFRB 4QX5A 1M4WA 2UWBA 5FXVA 1QJX2 4HZFA 4RGAA 2HYKA 4ZZ8A 2EIGA 5A32B 4LT5A 3UGGA 2DTYA 2NN8A 4GULA 2W9XA 3AP6A 5JXIA 5AVPA 4I01A 4NO4A 5C71A 2VJXA 1I6XA 4H2AA 5FYZA 1IPJA 5A70A 3WP4A 1QJZA 3SEEA 4ASMB 5FWEA 4AK3A 1YI9A 3PJQA 1Y4WA 1UW8A 1GICA 2WNUC 3DYOA 3HEIA 4K6BA 4LR4A 2JECA 3UKTA 4YM1A 3RWKX 4XMIA 1EP0A 2AENA 2WQ4A 3ACGA 4BMBA 4B4RA 2DCZA 5C3SA 1PIV2 4CDQA 1Y9GA 2W46A 3BTXA 1REFA 3H8OA 2VNRA 5JSOA 1KJRA 4N53B 1X9PA 2C9KA 2R072 1EV11 2XJUA 3LKJA 4NMIA 3TB0A 4AE2A 3MIGA 2PHLA 4FQ4A 2J1UA 3WF4A 4A4AA 1W6OB 1T6GC 3B3QE 2OX0A 3WSOA 4LNVA 5K7PA 4WZFA 1O3QA 1U5ZA 4QQOA 5FPUA 1YC61 4CDWC 3FBMA 3VV1A 2XVKA 3WQ1A 2C5DA 3WDUA 4QHBA 5K0UC 1CX1A 1HIXA 4XOGA 4EZHA 1UY2A 1NQJA 4Q4Y2 3PTRB 4YZ1A 4WVWA 4AHYA 3ZFGA 3K2OA 5F1RA 4R9DA 1KDKA 3U4SA 5C33A 5LZ6A 1VAKA 1W8TA 1RUC1 3WDWA 5ANQA 2VC9A 3NNMA 2VY0A 1R1A2 4RL7A 1Y7BA 5BNNC 2VUCA 1UYXA 3ZIXA 3AVSA 3VBOB 2WS93 3A0KA 1J3PA 1Q56A 1R093 5ABJB 1PGL1 1AJOA 5JI7A 4C1WA 2WSUA 2PQSA 3T1LA 4FAGA 1QOTA 4LBQA 4HSJA 1EAH2 1W2OA 3E5UA 4M3CE 1ZZCA 3FUQA 4R9BA 4Z2AA 1TEIA 4L8QA 1W9FA 4DS0A 3T0DA 1H0BA 3FUOA 3W58A 3WQ0A 5JOZA 2B9UA 5E16A 1COV2 1UYPA 2CL2A 3EO6A 2Q8DA 4YZ3A 4IEZA 4ATEA 4P9WA 4KMQA 3AZXA 1JZ4A 1OOPB 4DXTA 5CBLA 2G4IA 1WW5A 3J7LA 4D6SA 2VG9A 1W2UA 3OB8A 4GWNA 4M3CB 4UBHA 4ZHNA 2ZMLA 3KGLA 1JXNA 3IDCB 1NQDA 5CYYA 4XFCA 4BE3A 3H1MA 2P1BA 4N53C 3THCA 1MS9A 2VOWA 2XBO1 3PDQA 5A3UA 1W28A 2JIJA 3ATGA 2PAMA 5LA1A 1FMD1 1AYM1 1GR3A 1QU0A 1AYN3 1YQ8A 3EB7A 1PZ9A 1WCDJ 3VDDB 2WSVA 4XF0A 2GN3A 1VAVA 1C57A 1FNZA 1G9CA 1OQEA 2B7YA 3J9SA 4O65A 3KQ4B 5FPXA 3URFA 1OUSA 1OQDA 3Q9OA 3K3OA 3SC7X 4AI9A 2OYZA 3QOPA 1AXKA 1ULEA 1YHFA 3D6EA 4DINB 2JIGA 3M1HA 5A3OA 1Y3TA 2XWJB 1OA2A 5FMOS 3FLPA 3UESA 1J1LA 1VRH1 4UFKA 1ENQA 1PO11 2WN2A 4JCKA 3WEZA 4BQ1A 1CIYA 2F4LA 4RS5A 3FHAA 1JMUB 3ZXDA 2ATFA 3THDA 5AFEA 1LTEA 3ITQA 5IATA 1TNFA 1EPZA 1VAMA 4QKNA 1SBEA 3VBOC 2FDFA 3WNMA 1VMJA 4BM8A 1QH6A 1GKBA 1G9DA 4DFSA 2K2SA 3T0AA 5JIUA 4B7KA 4E9KA 1YFUA 2P2KA 4Q29A 4RD7A 3IMNA 1X8MA 5FZ8A 1SFPA 4XTMA 2BVBA 2Q30A 3IDEA 2VOTA 1LOFC 4XE9A 1D4M2 1ULDA 2WA4A 4AHWA 4AI3A 1TMF3 4LBLA 2C4XA 2GH2A 3BTZA 5B4XA 4YVWC 3WW3A 5BNPA 1OKQA 4QWNA 1IPKA 3I3QA 2ZKLA 2NMOA 1XRUA 1OLRA 4NVPA 4CU6A 4W8JA 2GNBA 3O1RA 2D3SA 3KV9A 4DUWA 3U10A 3PUIA 3SH5A 4WVMB 2IXLA 4PBPA 1XBFA 3ALQA 4TLFA 3NNLA 5EWSA 1RXGA 2VVEA 2RDQA 5FO7B 5KXDA 1ODMA 2WDBA 5FZ3A 4CCCA 1DDLA 1RUI2 2Z79A 2Z5WA 3WP3A 3IZOA 4MGTA 5BV6A 4Q0VA 4C90A 2Q1MA 1YXWA 3CBNA 4P9IA 4PF5A 1OC1A 3WW2A 4TTGA 2A70A 5FZHA 2JE8A 5KHIA 4Q0QA 2VVDA 4UI9L 2VO5A 1A3KA 3RZHA 4I3GA 1NE6A 2VQ0A 4XQWA 3PJYA 3J8F3 4NWVA 1FOD3 2JG9B 2J42A 3O5SA 5FREA 2CGPA 4RGKA 5DAQA 4CP9A 1LOBA 1AXYA 1MQTB 3J7HA 4FPOB 3H42B 2VMFA 4IGPA 1QOSA 5LRSA 1PMIA 1R081 4B1MA 4HXCA 1YQCA 3AXEA 5C8WA 3UGFA 2I74A 4BLIA 3SEPA 2D7FA 2VZVA 1NT0A 1JN2P 4K20A 1JYIA 3CMGA 4MADA 2ETEA 4PDWA 3I3BA 3OYWB 1YIPA 2SLIA 2J7MA 3N7MA 3WCRA 3RYKA 1GZWB 2W39A 4LUMA 3P3PA 4CTEA 4IEPA 2A3XA 4D7SA 4Y1VA 3VBFB 2R49A 2RDSA 4QQPA 1WGPA 3ZSKA 2YY1A 3HVDA 4IV1A 3UGHA 4WM7C 3MEPA 4XJ8A 4CDXB 1YQ6A 3S5AA 4YW6A 3KS7A 1OF4A 1TE1B 4Q2FA 1ZBE3 2VZ3A 4HFSA 2WWUA 4QM8A 5A3MA 5F3CA 3B00A 4JHTA 3LEGA 1LHOA 3OBAA 5I0SA 3TYJA 2BDRA 4JC1A 1GNYA 1SCSA 3M7AA 5DDJ3 1UYYA 2A3WA 2RDNA 2WNVA 3L2YA 4MSVA 4QKDA 5FZ0A 4URAA 4IUGA 4A7YA 3BB6A 3N36A 2WABA 4AZZA 3WQBA 2P5BA 4N9IA 3RFRA 2YUEA 5FY1A 5AC92 2ZMNA 3LD8A 1OLME 1RUH1 4GMP0 4AQTA 5F5CA 1MS4A 3N7KA 3K51A 4LBNA 1CWPA 1BBT2 2QTWB 2PMWB 1YQ5A 4LIUA 4LO8A 4OCTA 4CXXA 2RS33 3WF3A 2ZABA 2RMU2 4Y1YA 1QIQA 4KU7A 4CVUA 1BK0A 2QE3A 2OW4A 5A6YA 2NQYA 2BGPA 5JMCA 4B1LA 2WZR2 1I5PA 3IDAA 1ND3C 2QJVA 1F8VA 1BK1A 1VMFA 3RWNA 2ET1A 4CCLA 4M0HA 3RGBA 4P02B 4KWLA 3MIEA 4COUA 4K21A 5IW0A 2R1DA 1UMZA 2OPKA 1E5RA 2UWCA 4HN1A 3D0SA 4CEWB 5FKBA 1MEC1 3BU0A 1AVBA 4EN6B 1ASJ1 3GJAA 2PN5A 3ECQA 4QDSA 1UOBA 3B9CA 4R9CA 1HXS2 3N9MA 1OT5A 1XU2A 5A6ZA 1HQWA 5BNNA 1W6QB 4YG3A 1JZ2A 3ZXGA 4BLJA 4IESA 3MPBA 5JPNB 2ZX3A 5IVCA 2WO2A 3ENRA 3N7JA 1RC6A 3ACHA 3VKNA 4ES8A 4ZS2A 1NXMA 2HWC1 4BWOA 3LE0A 5L7OB 3NWKA 3V56A 1NOVA 4YGEA 5FCCA 1WUVA 1XYPA 4NN0A 1YJLA 3NV2A 4RHV1 5A33B 2VTFA 4QKBA 4JGYA 1WLDA 1WBLA 2ZX2A 3HPNA 2DVBA 4FOYA 3MIBA 1POV1 4NWWA 2ZAHA 1CAVB 1JUIA 1MVQA 1NXD1 3B9IA 3OTFA 1Y9MA 4J6GA 3AL5A 4CCNA 4DOUA 1GZTA 1ONAA 1REDA 2RVAA 1PMHX 2C0ZA 2QQNA 4RQPB 1RXFA 1S0JA 3MLKA 1XJAA 1V9U3 3MI8A 3R05A 5FP3A 4AEDA 5HCAA 3T30A 4BPZA 3LDKA 2WAAA 4BQXA 2WRAA 1FPN1 1VRBA 4AGRA 1XNKA 1K45A 2BW8A 1W8ZA 1LRHA 4BYYA 2FCVA 2ZCWA 3ILRA 5A7WA 3CZJA 1HRI2 2UYAA 3NMBA 2SBAA 3RJ2X 1SDDB 4CUGA 4PBOA 4QQHA 5FMBA 3BIWE 1ST8A 3G6JB 4GKXA 4LKFA 4P00B 4X8NA 1J83A 2ARAA 1LHVA 3MLLA 1W0PA 4CEWC 1ODNA 4GWMA 1HJGA 4UYBA 3RZKA 3LIGA 1RUNA 4J25A 5EQUA 4OI2A 1LGNA 1VJ2A 1W6PB 2C9AA 3S57A 1GYKA 2E6VA 1Z7S2 3AYEA 2YFUA 3GM8A 3JD73 4FOWA 4BMEA 3WG1A 4CP2A 5AVAA 3WT3A 3H3LA 4N7UA 4FQZA 5FK8A 3CKHA 2GNDA 5EZWA 4BH9A 4ARYA 2VZOA 4D94A 5FKCA 1C8M2 5C3QA 1MS3A 3VBHA 4QGMA 2FMYA 3WV6A 2WIIB 3CQOA 4CXWA 5LW9A 1QJY2 1J3QA 3UYJA 3OSDA 1OLQA 4N90A 2CHHA 4G4FA 1ZBA2 4IE7A 5L7OC 3ZN6A 3NNJA 1ND2C 1AUYA 1WLCA 2VMEA 3NAPB 4XHBA 4LK6A 3WVJA 4OHZA 3LFIA 4MXVA 3ZFFA 4NIDA 2CDPA 1SACA 5JDBA 3MW2A 2WWSA 5C3RA 1MACA 2BERA 5BNOB 3AMQA 1PGW1 3H7YA 4QXCA 2WZPP 3U07A 1VBA3 4DUVA 3QLQA 4RA0A 3A7QA 1JYXA 1AR61 4DQAA 4PLNA 1TNRA 1JZ6A 3RZLA 2Y6JA 2E63A 5DUWA 4EE2A 3T2QA 1W0NA 2GP5A 3OBZA 3IKWA 1F31A 3TBDA 5J36A 1AL0G 1DU3D 4J1XA 1IZ3A 2AC1A 3U37A 1WW6A 3HNYM 4Q8LA 4MGSA 1CJDA 3TAYA 4LA2A 5J1XA 1YFXA 1W9YA 3FWEA 3VZJA 3WNNA 4ONUA 2ZGRA 4AHZA 1CAUA 2EIBA 3AMPA 5JMOA 1H8TA 4HKOA 2G9FA 2GSYA 2GDFA 3MFAA 1TG7A 4DMIA 1E5IA 2ADEA 4LOTA 5LY1A 1HJFA 4HPKB 2YHJA 4XJ9A 5C4WA 4YPJA 3EBRA 3ZO0B 4A3XA 5FO8B 2VM9A 5GLTA 5DQ0A 5C8CC 4DRVA 2ZX0A 4GMP3 4XYXA 2ADDA 4GWJA 2VPVA 1NY71 2QQOA 1B35A 2TBVA 5K4LA 4NIIA 4JGZB 1POV3 1WD3A 3WDYA 1UO9A 1K5JA 4JDNA 1QNWA 3DXUA 4AQSA 4AR2A 1XSQA 5FYVA 3I2DA 1W3VA 3VBSA 1RUD1 3CZUA 4BQYA 1Q5OA 2VZUA 4BDVB 3ZFEC 1RUJ3 3DN7A 4KGQA 4OVEA 4Y1UA 5HCFA 4E4ZA 5TSWA 1OA4A 5DG2A 5A7SA 3C3VA 5L9BA 3LSEA 1FPN3 3ZXLA 2RS51 1AR92 2FDHA 3E6DA 5F3IA 4KBZA 3ZYJB 1DQ5A 3GNEA 3K4DA 3SKJE 2GMEA 3ILFA 1PVC2 3FBYA 1T6BX 1NYWA 5EV7A 1IHMA 2XLFA 2ARCA 1WMEA 1UU4A 3GBWA 5FZMA 5BNOC 2AH2A 4MG2A 1UU6A 1AL22 1EYBA 3BYWA 4TWTA 5DN2A 5I8SA 2DWRA 2XJVA 3C7OA 1W2NA 1IG0A 4XDOA 5CFCB 2Q1FA 5CVRA 4Q4W1 2GC1A 3ZIWA 1F9KA 5FZGA 2J1EA 1AR71 2HWF3 4NPRA 1W6NA 4LBOA 2V4VA 4MGZE 5FP7A 4ZONA 2Z69A 3QH7A 4XFAA 4QDRA 5FUNA 5D8AA 2JWPA 2YBKA 1DF0A 3BIEA 2XUMA 2FDGA 2MPFA 2KD7A 1RUE2 1JW6A 2Y0IA 4K40A 3O1OA 1KGYA 4NHKA 3GZEA 3PUAA 2ZBJA 3M70A 2BV4A 5FK7A 2PA7A 3VD5A 5SV8A 4DEVA 5ACA3 3POJA 1XNBA 1LGBA 1CX4A 1HKDA 3OD0A 5I0DA 3LFMA 4YVSB 5GZDA 4CDUB 3BN6A 4BA6A 2VCAA 3AYDA 1NZIA 1QJX3 3ZFGC 3VBRA 2W92A 4CEYA 1JHNA 1UOJA 2GN7A 1VBB2 5JOXA 2Z42A 3DPRB 5A3TA 4GA9A 1S0EA 3ZR6A 4HN0A 1JZ3A 4XFHA 1CZTA 2RR12 4LHSA 4D3WA 1QGLA 4RN5A 1C1LA 2WR9A 5JUVA 2YGLA 1GWKA 2E32A 1CAWB 1QEXA 2QQMA 4QPGB 5DZFA 5A7PA 3S6PA 5IVVA 1PIV3 2D3RA 3LDRA 3W5NA 3PLQA 4XF3A 5C7GA 4RR3A 4CP0A 1F5FA 2NZ9A 4NOTA 1UKRA 3JU9A 4EV0A 3VGIA 4QPIB 4BISA 1CGPA 4NRPA 1QQP2 1KDMA 4MVTA 2ZACA 5FO9B 4NIGA 5FYIA 5LWBA 1VBD2 1QDOA 2O14A 2UY8A 3VN4A 2PHRA 3OOXA 4B4PA 2R061 1X7NA 1YQ2A 1BVP1 3C8XA 4V1PA 1SZBA 1WA6X 1XYNA 3LF7A 4D6RA 5T5PA 5GM0A 4FI9A 1W9WA 3J4UH 4EROA 4LO7A 3T1MA 1US3A 1F4HA 1UZZA 2OVUA 1AX1A 2QQIA 4BCUA 4XACA 2JDUA 4Q4Y3 4BIOA 1RUG1 1C5HA 5C5TA 3NJYA 5CADA 4Y22B 3THTA 1W6QA 2LW8A 2WNEA 4WM8A 2VCCA 4FPYA 3RRDA 4YM3A 3PIJA 1XSRA 3U4XA 3O1SA 4Z2WA 5EHDA 3VD7A 3AKPA 5JOYA 3NKTA 4AGVA 1H1AA 3I7DA 3Q8EA 5DUXA 3JBG2 4FPFA 4PLOA 4Y4RA 4E2SA 2VOVA 3V0BB 4YSFA 3S30A 5IVJA 3AYCA 1A34A 2BFUL 3K75B 4YFWA 4FVVA 4LMFA 3HD8B 4YVSC 5F3GA 1RB8G 1BEV2 4LBKA 2WS91 4EN9B 2VMGA 1EAH3 2XVLA 1R091 1R64A 4RS5C 3K77A 1NA1A 1R1ZA 4IE0A 1AR73 4CCDA 1CAVA 1EPWA 4DXZA 5E88A 4N7IA 4BU2A 1RJ7A 1US2A 1LCLA 2QQKA 2RS11 4QXBA 1WMXA 1O4TA 5FQ0B 5FZAA 1OKOA 4DY5A 1COV3 1VLNA 4ASLA 2VZRA 2XXZA 1DYOA 3ME2A 1W0OA 2IXCA 1S2EA 4K8FA 4CDWB 5FYYA 3JQXA 3RZMA 1SFNA 4QPGC 5JZGB 3PU3A 2EXIA 3M4FA 3PMSA 4BQ4A 3WG2A 4AF9A 3ACIA 4C91A 1N1SA 4RGGA 4CSWA 2YV8A 1DYKA 4H55A 1UY4A 2K9ZA 3A22A 1UPIA 4XUOA 3X29B 3ZYPA 5BNPC 2XL7A 4YRDA 2CDOA 4OQ9A 2PLV2 1GP4A 1ZRDA 1GMMA 4NIAA 2YGMA 3WG3A 1NE4A 4E4SA 1AYN1 4KNCA 1UZWA 3AKQA 3VBUB 4QKFA 3ZN4A 1ULGA 1O3RA 1O8PA 1ZNPA 4W4ZA 4JRLA 3I2GA 4E8CA 3DEMA 2WZEA 4Q4X2 4H7LA 4TSVA 1XNAA 3R6SA 3VDAA 5C9AB 5IVBA 1O7FA 2A6WA 3S0MA 5FOBB 5IWFA 3H8XA 4IEXA 1KFUL 1AR82 5C70A 2R042 1YLLA 2WINB 4O9EA 1Z78A 1LB2A 4XABA 3GF6A 4A3ZA 1PZ7A 5L19A 2E33A 1RMU2 1DCSA 4HVRA 1G9BA 3TEYA 1D7PM 4NUBA 1QWRA 2I2SA 2IXIA 4KWJA 3I4IA 2EXJA 2VXRA 1I9RA 3I59B 3MPPG 4G3YC 1IQAA 5F5IA 1NCQB 4QQ2A 4P9GA 1D4M3 4Q0PA 2R063 2W47A 2B4KA 3OPZA 2ZXQA 4YM2A 3FMGA 1OFNA 4Q4V2 1JTZX 5FPBA 5I8YA 3DCQA 3POGA 2D97A 2W95A 1H2MA 5CNAA 4C0HA 1TMF1 1QDCA 3OY8A 2VGDA 5JLVA 1VBC2 1V6NA 4L2NA 4PDWC 3BUCA 1DP0A 1RUG3 2JDYA 2KR2A 4UW4A 2B8MA 4YGCA 3PVBB 5F8PA 3ST7A 4BXFA 5JZGC 4HOOA 4N43A 4OI0A 5T5JA 2IVIB 2W2IA 1H1MA 3H3UA 4HK9A 3RI8A 2WFF1 3E5XA 5E6HA 1ENXA 1ZVFA 2XR4A 1EUUA 1RUI3 2UURA 3HWJA 4GH4A 4IXLA 5JCTA 3VL9A 4QXHA 2HWB2 3O1PA 1X9TA 5A1LA 2NMNA 1O4YA 4UT5A 2WUHA 4HPKA 1BMV1 1UOFA 4BJ0A 2X5IA 1U12A 1TME2 3VBUC 1WMDA 1ZA7A 3IAPA 1UX7A 1UX6A 5FYCA 2BU9A 2ZGUA 2BNOA 2WNVC 1YI7A 3KHBA 4QGNA 5DZEA 5GZGA 1UXXX 3HJRA 2GAUA 3LSDA 1LECA 2QQVA 2ILMA 3ZKYA 4EWDA 2RS13 1LOGA 3J8F1 5C9AC 2ES3A 1FOD1 4XJUA 2HWD2 1ZRIA 1W6MA 1W9TA 3DF0A 4UF0B 3RG0A 4B3NA 1LHUA 3EHKA 1GP5A 2GMMA 3H50A 3LZZA 4YVWB 3POSA 3C7EA 5GJ6A 2RM22 4ZU4A 1HB1A 3RMXA 2WLPA 4MXWB 2Y8KA 3BCWA 2BPA2 3PNAA 1QHDA 5E8AA 1SLCA 2GC0A 3APBA 3OGSA 1NCQC 1FX5A 4XFFA 4UFLA 4OHWA 3AKSA 4A42A 2QQWA 1GANA 3TN92 2OZ6A 3VHRA 1O4ZA 4TLGA 4JQTA 4JZRA 3HBKA 5I0TA 2GNTA 1H8VA 1YWKA 4BQ3A 1PVXA 4NHXA 3QCWA 3AKRA 2R6QA 1IOAA 4OYUA 4W50A 5I0RA 5LBCA 3WR0A 2RV9A 2JDHA 5FMCA 4FP3A 1JYNA 1ZBE1 1SPPB 3A21A 1QF3A 5A1AA 3PUHA 2VZQA 3MBWA 3OG2A 4BOWA 1PO22 3KCCA 3LA3A 4CCKA 1GV9A 2DU0A 5FY0A 2O1QA 5DDJ1 2VD7A 2IZWA 2W0XA 4YZ5A 2JENA 4C0BA 2ARXA 3MIDA 4LQRA 1H6YA 2QNKA 4COWA 1OUXA 3O0VA 4IEQA 4YZ4A 5AC93 2XMLA 2NP0A 1OA3A 2HWE2 2CSGA 2HYXA 5L73A 1F2NA 3NNGA 2ZX1A 1BBT3 2XUEA 4NR1A 2GU9A 1AHSA 4JTNA 1CN1A 2HLEA 2XQRA 3E1F1 4QPWA 4JV4A 4BQWA 4EQVA 1HRV2 2RMU3 3P5BA 4CDUA 4I0AA 5A3NA 3N3HA 5EIYB 5IUQA 2XLGA 2RS31 4AVSA 4FBFA 5T3NA 3GBFA 3OPTA 2WZR3 4WM7B 1JOJA 1UN1A 4OUMA 4UFJA 1IS6A 1UKGA 2AUYA 4K9SA 1V6OA 4JVAA 4LHLA 4CPBA 4YW1A 5KBFA 5FOJB 2WFF3 1NCRB 2P34A 1F4AA 1ENRA 3K48A 2ZGQA 4RFT0 4URTA 2JE7A 2LM3A 2LUWA 3OGJA 4P5HA 3LPGA 2LTNA 2RJLA 4QU1A 5CG8A 4Q0UA 3DKQA 3HQUA 3WG4A 3IPVB 4XFIA 2HBUA 1SMVA 3OPWA 1X82A 3GYDA 2VCBA 3R4UA 2E51A 3WXPA 1C8NA 4FP2A 2IUWA 1S0DA 2JX9A 5KHGA 1HXS3 1XOYA 1RVF2 1W8UA 1LULA 1DIWA 4N8MA 2CAUA 4FFHA 4GKYA 3MGUA 3B02A 1ZZ8A 4XQDA 2HJIA 3MZHA 2JXAA 1RIRA 1IKPA 1Q43A 4K8RB 1OFSA 3LIHA 3EYPA 3VKMA 1XB9A 2PFWA 4JAAA 5FZ9A 3USUA 3WLUA 2Y33A 3IM0A 4LKEA 4XUPA 1ND3B 5BYNA 1AF9A 1FT9A 3L2HA 1RHI2 2G9GA 2ZJCA 3SCFA 1K5MA 5LCWL 2FDIA 3H3ZA 2RDRA 3VBHC 1SLAA 1E57A 5D2AA 1S4CA 2W68A 3MLJA 4HLTA 4XUNA 3AZZA 5EJ3A 1IQDC 2NPIA 4XJWA 3NJZA 4QT6A 2WNUA 2GH8A 4YW7A 1VBE2 3RYRA 1CAXA 2AEYA 1WZXA 2DVAA 5CFDB 1S0FA 2VUAA 1FV3A 2CY6A 2EALA 4QX8A 3MF6A 2DU1A 4META 5FV3A 1GZ9A 4PQ9A 2CTVA 4MO3M 1NLQA 2KA3A 4WBBA 5J98B 5BY5A 5FR3A 2JJ6A 4XC9A 1LOAA 3ES4A 1V9U1 2JICA 2YG0A 3KHCA 5FZBA 4PJYA 5FYTA 4DXSA 1DG6A 4GB32 5FZLA 1HRI3 1VMHA 1O6UA 3Q8CA 4L99A 5IAXA 3D3AA 3OUIA 3D0JA 4Y3OA 3VLBB 3LOBA 1OXCA 4XUQA 1NCRC 4LO6B 5FZOB 4NHYA 5IK7A 4MGYE 4JKLA 4GWIA 1IKQA 1LKNA 1LODA 3OGVA 4YW2A 5K0UA 3ZYGA 3KM5A 3FX3A 4EN0A 2Q8EA 5KWRA 2ZTNA 1VB4A 3GDBA 4BB3A 1Z7S3 2ZGKA 3RYPA 4NIHA 4IV3A 4Y20A 2VQAA 4ZPIA 5FXWA 4LK7A 1E5HA 1GWMA 1HV1A 1S2BA 3JD71 3VD4A 2WLQA 5FBZA 3HN3A 4FFGA 3UJQA 5KC5A 3FFQA 1GQPA 1QJY3 1MVEA 5FZ1A 4XFBA 4MHRA 3V65A 4AGGA 1D0GA 4S2FA 1RJ8A 1ZBA3 2P6CA 2UYBA 2Y6LA 2YPDA 1Q3EA 3JB4C 1TZOA 5DXDA 5ERLA 2X8KA 4BXSV 2HBTA 2H6BA 4FT8A 5A32A 2DUOA 3AK0A 1GNZA 1AX2A 2QFEA 3VBSC 1N1VA 2YC0A 5FP4A 2ID4A 2P3YA 1JYWA 1QXRA 1N1YA 2MEV1 5GZCA 4QHZA 4IEWA 2W1QA 1CVNA 1XYOA 4HANA 2A6ZA 3M2MA 4LLOA 4Y5SA 3RS6A 4AVAA 1D2SA 4Q8KA 4LIVA 1EV12 3OUHA 5CFDC 1UF2C 5KR7A 2EXHA 1V6JA 2W3JA 1YO8A 2X09A 1VBA1 4LBMA 4QXKA 4IE6A 3OJBA 4OMCA 4N53A 3VD3A 3B94A 2GNMA 4Z07A 2JG8B 5HXMA 3WF2A 1JHJA 4UOJA 1W6OA 3O0WA 2FDJA 1LR5A 1YEWA 1UZ0A 4DUXA 3ZKUA 3OD4A 2PELA 2IXHA 1CJPA 2K0GA 2NLRA 1H2KA 5F2WA 4P9XA 1MZ6A 4FXGB 4XXAA 2VNVA 1RUC2 1CQ9A 2XHKA 4AQ6A 1ND2B 5F39A 3ZXEA 4IGQA 2VNOA 2BVVA 2DVGA 1JU4A 1SG3A 2Y26A 3AVRA 5D8AC 2IC1A 1CPNA 1H30A 2CU5A 1LHNA 4GMP1 2ZAAA 3ZYHA 5T50A 3A0NA 3I2KA 3IN9A 2JKXA 1PGL2 2FD8A 5APAA 3EQEA 2JDPA 4Z82A 5FXZA 2CYFA 4MYEA 4B29A 3PVOA 4FPEA 3RDIA 4XJZA 1UNBA 1X36A 5HV4A 3VBOA 5C6CA 1C3HA 1GU3A 4XETA 1HB2A 1SLTA 2VQUA 5ABJA 1RUJ1 5DABA 4Y5TA 1LEDA 5F5AA 3WP6A 5A3PA 4OHXA 4Y5Z0 4JHZA 2AACA 3MW3A 4H7MA 1QJU1 4GXLA 1LOFA 3E6BA 1MS1A 4KGGA 4CEYC 5KXCA 1GWLA 3UKVA 1PNFA 2W08A 4QX1A 1NUKA 3AFKA 1RUF1 1AL23 3NO8A 3Q8BA 4XBLA 2ZZQA 4QMAA 4YG6A 1D0HA 2XBO2 4KH9A 3RI9A 1OOPA 2ZEXA 5F6KA 1AYM2 1FMD2 5C8CB 2GMPA 4M3CA 3CJIB 2PYTA 2OQ7A 4LTAA 4UW3A 3UKNA 2VNGA 2BNNA 1V6LA 3I2FA 4FPLA 2BBAA 4OQ8A 3FJSA 1C28A 1W8FA 2DCKA 2W94A 4NPLA 1CPMA 4OUEA 5J7MA 1IGOA 2JG8C 2P3IA 3N4MA 2RJ2A 4MV2A 2VMHA 2HWF1 3AMNA 5FYHA 2QBXA 5FDBA 2ORZA 4ZXEA 1RUE3 5H9SA 3VDDA 1V70A 2VTXA 3BGAA 3HR9A 1GBGA 4H3WA 5JVVA 1OH3A 1HLCA 1LU1A 4L0PA 3ZFEB 4NAOA 5K9YA 1VRH2 5LBBA 2KXLA 2H0VA 1PO12 2WYFA 3HNMA 3POBA 5A3WA 1WMFA 5D1IA 5LY2A 3P1IA 4GJZA 3NSTA 2XJTA 4COVA 4MLOA 5G05L 3SCGA 3F95A 4PQQA 2MEV3 3IBMA 2PLV1 4FAHA 3SHRA 4YLZA 1WW4A 3OEAA 5ACA1 1ULPA 4H14A 2YBSA 1L3JA 2W52A 4QPYA 2BTVC 3MV11 4FTEA 4WM8C 1VIWB 2BP6A 3S5QA 3VZOA 5IFTA 1VBB3 2B46X 2JDKA 1QJX1 3ZX7A 3S7EA 1NKGA 1UZYA 4I0WB 4FFFA 3LA2A 3FC0A 3I2JA 4LBQD 4YGDA 4C8DA 4UWDA 4JTOA 3AP5A 1MZ5A 2RR13 3AP4A 3DUIA 2JDNA 4AFBA 4DY3A 4EWAA 4TN7A 2ZGSA 5DAVA 5IVFA 5FZ7A 2PAKA 3LPFA 2WQZC 3MW4A 2RE9A 4QB1A 2VE1A 3SH3A 5CB7A 1MS8A 3PU8A 2PAEA 3ZLIA 1D4VB 3U78A 1RITA 3KQRA 3B93A 1OBNA 4AEJA 2LS6A 1PIV1 3AP7A 2YB7A 3E5QA 1QQP3 2XVGA 4MOAA 1DGRN 4FTBA 3PVNA 2P3JA 2D3PA 4P5YA 4QB2A 1ZZ6A 2YU1A 2HEVF 1FNYA 4OZXA 2R071 3CJIC 3BTAA 3QACA 4RYDA 2QZ2A 4WVMA 3WINE 4AVTA 2XPJA 1GOHA 1U0AA 1UWWA 3KZ4C 4Q1PA 1GQHA 1PK6C 4P9JA 4PT6A 4YG0A 2ZEWA 4IGOA 3MF9A 3USSA 3WD5A 1FXZA 1UMHA 1LOCA 2ZHMA 5CKNA 3ZFGB 4NAMA 2ZA9A 2YBPA 2A6XA 5CKMA 3SITA 2DBIA 2XLAA 1S2KA 2Y34A 2YC2A 3UL2A 1OQ1A 2WT1A 4IL7A 4Z1VA 2VBDA 2D98A 3KB5A 4A45A 4MX3A 4Q4Y1 4V2VA 5F7UA 1QJU3 1R082 1SBFA 3PHMA 2JG9A 2VBBA 5KHJA 1QXPA 1LNSA 2UY9A 3JBG3 4MUVA 3RQ0A 5EYYA 1AZDA 2QDNA 1RUF3 4LBQB 5A1FA 4YM0A 1MQTA 5FRAA 4HONA 1R1A1 1Y43B 4IEYA 4M0NA 2F17A 4XJAA 1BEV3 5ISLA 2PHFA 3FLTA 3MHZA 5A7NA 4FSJA 3D4KA 3POWA 5FAXA 2RG4A 1DQ0A 2JEMA 3FHQA 3BPZA 2J22A 2O8OA 1J3RA 2W91A 4LO5B 3M3CA 2XGXA 1BKZA 1EAH1 2QQJA 3QD6A 5C3OA 5LK7B 3AXDA 3Q8AA 5FYUA 4AI0A 3VDCA 2E7TA 1XU1A 3MDPA 3OYWA 1H4GA 4V2WA 2LROA 3CIHA 1GZWA 4CDQC 3WY6A 3JUUA 5FBJA 1XE7A 3FN9A 1COV1 5EPAA 4E4HA 3VBFA 4QX7A 1WW7A 3GHNA 4X8PA 5HCBA 3WP5A 3FFZA 4L9BA 4KG8A 4F83A 4CDXA 3VD9A 1NG0A 1W8OA 4XTPA 1FATA 3O1UA 5FUPA 4MGQA 4AFCA 3GBGA 2XOMA 2ZZJA 3B7MA 1WCQA 5DPNA 1KJLA 1BJQA 2BWCA 2PLV3 2XONA 2VUJA 3N9NA 2VXJA 3ZN5A 5KXBA 1RUH2 1U5XA 3AJYA 2BGCA 2C26A 3R4DB 3WHUA 4ET7A 5FY5A 5M0TA 2VOXA 5FXXA 2DFBA 4N43C 3VZLA 4B4QA 4XF1A 3RSJA 2WFPA 2Q4SA 1LJ7A 1F35A 3M3QA 2FCTA 4LHNA 4UFIA 5FMOL 5IK4A 4GH4C 1S0BA 4O7XA 4Q4X3 2TUNA 3POYA 4RS5B 2OUJA 4HT1T 1S0GA 4XAEA 1DQ4A 3B01A 4UAPA 1V6MA 5JOWA 4P14A 1UL9A 2DTWA 1AR83 2FQPA 1APNA 2R043 1S0CA 1YYNA 1H9PA 1STMA 2PHUA 3LQCA 4QHOA 2BNMA 4LA3A 1WWYA 1RMU3 4LULA 1KQRA 1G9FA 1Z0HA 3P6BA 1OLMA 3HBZA 5L9RA 4CE8A 2VW2A 2WO3A 2XWBB 2Q5TA 3SCHA 2P4EA 1MEC2 5FLIA 1PM7A 1WD4A 3T3YA 1V00A 1JOPA 2R073 2XQXA 4ES9A 2JE9A 2AZ5A 2L9LA 3R0RA 5BNPB 5KXEA 3O14A 1GLHA 4CU7A 4F7ZA 4Q4V3 1ASJ2 3KF5A 5F2SA 1W2AX 3RZZA 1DHKB 2PHWA 4LJHA 3PTYA 4DXRA 1D4M1 1X50A 1A8DA 4HG6B 4CEWA 1HQLA 2Y6GA 5A80A 5FPVA 3H1YA 3VKLA 2Q8CA 2CV6A
chains in the Genus database with same CATH topology
1VBC3 2EA7A 4FO9A 4IQPA 4XXPA 3V64A 5J48A 3CNAA 3ETQA 5GKAC 1TQ5A 3ILNA 2HWC2 4FPJA 4K3UA 2O0OA 1QY4A 4DB5A 4OUSA 4P9YA 3UJOA 1KRIA 1X8EA 4RHV2 2ZGPA 3ZMNA 1NLRA 1RUI1 2BWAA 4TYSA 1R1A3 2B45X 1Q8PA 1TME3 4L11A 5L7OA 3DV8A 4O9GA 3AM2A 5A33A 2D5HA 2Q0AA 5FPZA 1I5ZA 2VH9A 3I54A 1YIFA 1S55A 1J58A 3IT8A 2HWD3 4LEJA 4COZA 2XB6C 4COYA 4XEZA 3A4UA 1FPN2 1QH7A 1QMJA 5LEJA 3KCYA 1U5IA 2VECA 2IWGB 2RM23 1J59A 4RQPA 3KT7A 4PDWB 4I2OA 4AW7A 3OCPA 5JWPA 5H9RA 4IEUA 2D6KA 4W6YA 2GC2A 3RPQA 2NM1A 4IERA 4IV1B 3NV4A 4F8AA 2Z2SB 3LWCA 3TN93 3SISA 2AGSA 4K1ZA 3MICA 1N3PA 4ZU7A 2ZPXA 1N1TA 1QXJA 3KLSA 4K7JA 4DNYA 4AVCA 5I91A 2DYCA 1N3QA 3O0XA 4DRRA 2VVFA 1XXNA 2I07B 2WNVB 3ACLA 2A71A 2D44A 2QZ3A 1W6PA 3TRSB 2D6MA 3VHPA 4AFAA 5FLJA 5T52A 2D6PA 1XNCA 3D82A 2D40A 4WV8A 3B5LB 3NVCA 4L92A 4WVVA 1SCRA 2HWE3 2Y0OA 1VB2A 3ZSEA 4QU2A 1X33A 2VOKA 5CIRA 1PGW2 2D43A 1AXZA 5AC91 3NAPA 5LRRA 4OHYA 1MZFA 3VHOA 1KITA 1BBT1 1HRV3 1AR62 1XQNA 2BQPA 4XDQA 2WKKA 4LE3A 3TWIA 2D6OX 2DF7A 5BNOA 2XL9A 2ZGMA 4A7ZA 1K5MC 2EAAA 2RMU1 3N35A 4R8HA 4XIKA 3W9AA 4D69A 5E89A 2YPJA 4XHXA 1ALYA 2R0FA 2RJKA 2WZR1 3AX4A 4YZ2A 4MH0E 1Y9QA 5J3UA 2C1FA 2P3KA 1W39A 4IV1C 3HT2A 5FTTC 1NY72 2EVXA 1G7YA 5BNNB 2A3YA 2R32A 1RVF3 1RUD2 4HBNA 2WT2A 1S1AA 2Q1ZB 1HXS1 1QKQA 2X53S 4JGZA 4YW4A 5JR7B 3BODA 3ZDSA 1C4RA 1ZX5A 3LA7A 3WZ1A 4N9HA 2A6YA 2RS52 1BYHA 1PGSA 4JGYB 4IV3C 1PNGA 2MNGA 3T2TA 4X6QB 1NLSA 1RHI3 3BU7A 3HN1A 2IXKA 5IK5A 1DGWA 5BXXA 4LHKA 2VU9A 3WCSA 3AZVA 4M00A 1VBE3 2QKDA 4AEDB 3ZXFA 3LOIA 2OA2A 3QBQA 3EJKA 3AB0A 3NW4A 1XNDA 3VZMA 4Q4W2 3WNXA 5LK5A 1AR72 1D2QA 1ZZ9A 2YZ4A 3CLPA 2ZOEB 3VHNA 2O8QA 4GB33 5CFCA 2D6NA 5CU1A 1DBNA 4IEOA 5I8TA 3AKTA 2IXJA 4Y26A 1WBFA 1JH5A 1HRI1 1MS0A 3M3IA 5F6LB 4KWKA 4JQRA 4UXAA 5IT6A 2ZGLA 4C1XA 1A6CA 4YFZA 3GZTB 3WDTA 1AX0A 1BVVA 4Q26A 3VBHB 3FZ3A 1CESA 3WW4A 1Z7S1 1WCSA 1Q8OA 1REEA 4CZSA 3ZXJA 3ZN6B 1OHFA 4INDA 1C8M1 1HV0A 2BYVE 2D5FA 2ERFA 4YVSA 1RUOA 3RMYA 2VMIA 1KS4A 1PHMA 3ZFFB 1QJY1 3IWZA 4FXKB 4JGYC 3ZYRA 2FBEA 3VL8A 4LO4B 1ZBA1 4AVBA 1MR5A 4XIOA 3RNSA 3DPRA 3U0ZA 3WUCA 2PQQA 1DLLA 1GSLA 2YMZA 2DFCA 4Q1RA 5ABJC 1EV13 4AEDC 4QQLA 3H0OA 1RL3A 4QPGA 1CAWA 5A3LA 2UU8A 3RJRA 1YFWA 4MGIE 3GZUC 3KT1A 4U36A 2R062 3H8UA 3MIHA 4M01A 4BIFA 4QPIA 3ZSJA 2A7AA 1CAUB 4I0BA 1H8TB 2DV9A 4BZ4A 4K1YA 3WDVA 1ZA4A 1H4HA 3I8TA 5C4WB 1OOPC 3LGRA 1GZCA 1RUG2 3OGGA 2QDRA 2V73A 1B35B 4SLIA 1KXGA 1RUC3 1S0IA 4AWDA 2A5ZA 2ENRA 2ET7A 3MIFA 4I30A 1SLIA 4LLFA 2H6CA 3HQXA 1URXA 3VBSB 1RINA 1DZRA 3VDDC 2TNFA 4Y22A 1SQ4A 1VALA 1OSGA 1SLBA 4KU8A 2A73B 4NHLA 3NKGA 4R4XA 2WS92 1ZREA 1BXHA 4Y24A 1R092 4PIXA 2ARBA 3THPA 3OBTA 3V0BA 3AJZA 2BFUS 2NYYA 3D8CA 2DVDA 1UIKA 3HMYA 2RS12 4HSLA 1A8MA 3ZFFC 5JAXA 2PTMA 2CWSA 2D6LX 4I02A 1U5YA 4JDMA 2JD4A 1AR91 2YXSA 3TNQA 2X29A 2DVFA 3IIAA 5FQ0A 1G86A 3DL3A 3PVEA 3L9JT 3SH4A 3KSCA 1PVC1 1KFXL 1B09A 1GNHA 2XBO3 4CDWA 5EFUA 5T5LA 1AYM3 1FMD3 1AL21 1W6NB 1ZRRA 5JZGA 2E7AA 2P17A 3NL1A 2XJQA 4EWEA 5D8AB 4FPCA 1AYN2 4D7TA 1LENA 1YUDA 4UW5A 1H8TC 4X6RB 4BHPA 3GZAA 5H9PA 5C4WC 1C8M3 1KD7A 1LOEA 2OUHA 3FHIB 5KHHA 1RGSA 1YFYA 1OMIA 5GLVA 3VBUA 1VRH3 1QOOA 3S7IA 4JDOA 1PO13 1RUE1 4HMZA 3O7OA 1B35C 2EAKA 1CIWA 2CGNA 3ZYPA 1ULFA 1WA4A 2E7QA 4LUKA 2WA3A 4EJRA 3U11A 1ZZ7A 3ZSLA 1OI6A 4S2DA 5H9QA 2CAVA 3V0AB 5E1RA 5C9AA 3E97A 3VBRB 3WDXA 5J37A 4CEYB 5JIAA 3AP9A 2EF6A 2JDZA 2KM2A 1POV0 4RSUA 1GQGA 3AFGA 4HKLA 1BCXA 2JG9C 4XF4A 4OFGA 4XILA 5HXVA 5JPMB 2PHTA 4Y4YA 2B42B 3BALA 1VBB1 3HAGA 4KBBA 3I59A 1SEFA 1MQTC 1NCQA 3AZWA 3UV9A 1TMF2 4RR3B 2XJSA 2TEPA 4HK8A 2RR11 2HEWF 3WUDA 2CNAA 2WFF2 4LBJA 1QQP1 1BMV2 3ZMOA 2XJRA 3VBFC 2PHXA 3AMMA 3KCXA 1VBD1 3M3OA 2YDEA 4CDXC 3R4SA 2ZHNA 4G9SB 1G8WA 3HIFA 1KS5A 4WM8B 4Z8BA 3ASIA 2ZGNA 1DQ6A 1FI2A 3G7DA 5BPXA 3J8F2 3WW1A 4JRAA 1YCIA 1FOD2 3VKOA 3N7LA 4SBVA 4PLMA 2B39A 1YJKA 4ATFA 2RHPA 4L97A 5T55A 1AR93 1R083 5LEKA 1N3OA 1MS5A 4YARA 3GHMA 1PVC3 5I0UA 4XFGA 3VBRC 4AQ2A 1J1TA 3JBG1 1NA1B 4I3PA 2P37A 2ZHKA 3SMHA 4ZU5A 4YVWA 3WOGA 2ZMKA 4J1WA 4OULA 4OI1A 3WQ7A 1BEV1 4W6WA 4MXWA 3LCPA 1VP6A 2QUOA 1OD5A 2XG3A 3W59A 3FLRA 3ZYIB 4E4DX 2DCTA 1PK6B 1C1FA 2GC3A 4RR3C 4CYDA 4E27A 4S2HA 3ZSMA 2DUQA 3CL1A 1XE8A 4AYUA 1ZBE2 4AI2A 2WT0A 5EXOA 3ZXKA 1DYPA 2ZHLA 5CAZA 3ZPYA 3TNPB 5DDJ2 5DUUA 1ZZBA 4FOVA 2F4PA 1H1IA 1G9AA 1ZRFA 1RUH3 4GQ7A 2QCSB 4HETA 2R0HA 4W6XA 2VULA 5DZGA 4ISRA 4OLLA 2XH6A 5HBAA 1DGWX 1V6IA 2D93A 4EN7B 3KT4A 4WVZA 1SDWA 2IFWA 1JBCA 4E2QA 4YW3A 2Q8OA 1DFQA 1Q8VA 2AREA 4ZKTB 3J26N 4AG4A 1DZTA 2RS32 3H7JA 4Q4X1 3ROUA 3BOPA 3ZVXA 3P3NA 4CDQB 1FYUA 1AR81 1N47A 2R041 1H2NA 2MHFA 1LEMA 2HEYF 3IDBB 1ZRCA 1NA1C 4KG0A 1GFF2 1RMU1 2DCYA 4WM7A 5DG1A 1ENSA 1UCXA 1MEC3 3AZYA 4R9AA 3KD4A 3OF1A 3WX5A 1OPOA 4FPGA 1LHWA 1ASJ3 1VBD3 3OY8B 1NCRA 4IETA 4NHMA 1VR3A 4RQPC 2N7GA 4TZDA 5T5OA 4Q4V1 5IK8A 4N43B 5B2GB 2WL1A 3IPVA 2XKPA 5GLZA 5FLHA 3LB9A 2R30A 4GH4B 1VBC1 4S2GA 1WLTA 2HWC3 1OPMA 4ORFA 1Q8QA 2A6VA 1O5UA 4FPHA 1H9WA 1JYCA 2X5IB 3MYXA 5GZFA 4RHV3 5FFOC 1LU2A 4HL0A 4KL1A 1I3HA 2HWB1 2JKBA 2I45A 2YYOA 2FZ1A 4E2GA 3DKWA 4AHXA 2R1BA 2R16A 3VUOA 2F6BA 1TME1 1ND3A 4MGKE 3FE5A 3JB8A 4AEMA 1W6MB 5JSRA 3NV1A 4I09A 4ISQA 3E6CC 1YNAA 1HX6A 1JUHA 2ZGOA 4DPNA 2WC2A 4QGLA 4HVQA 1MZEA 1H2LA 2AR6A 4F3JA 1V9U2 2A75A 5CFDA 2HWD1 3NAPC 1IS4A 2WJSA 3BOWA 3CF6E 4MZUA 2DUPA 1DGLA 1FAYA 2RM21 2BEOA 3JZVA 2OIIA 3HT1A 3WHTA 4B8EA 4CP1A 5KHKA 1ZM1A 2ZS6B 5SV5A 3TN91 1PZ8A 4PIYA 4FOQA 1LESA 1DQ2A 2B5HA 1UIJA 1M06G 4QM9A 4R52A 1RTVA 3AYAA 4UBGA 4A7KA 3JD72 2CGOA 4AVVA 5F5QA 2VW0A 5GALA 1FV2A 3SXWA 4WZCA 5DUVA 1NZCA 2E9QA 4HVOA 2FMDA 4XPVA 4DZGA 3VZKA 2X5IC 1ULCA 4PIZA 4ITCA 1PO21 1BZWA 1BQPA 1HDKA 2BUKA 3VKFC 3OBRA 4JGZC 1O3SA 2MEV2 1F5JA 2ZKNA 2HWE1 4IEVA 3SNMA 5I93A 4GIQA 3V0AA 3LAGA 3M3EA 1UD1A 3JCIA 4XBNA 4ZXKA 1AR63 3DGTA 3EXUA 1VBA2 1YRZA 2H0BA 4OI4A 5GZEA 2DURA 1HRV1 1I1EA 5GLUA 2EXKA 4D7YA 2QQPA 5K8SA 1CR7A 5JSPA 2FZ2A 4U2AA 1HQNA 3QH6A 4FTSA 4AI1A 1DZQA 4GALA 5HI0A 4FCAA 5KC6A 5J96B 1UAIA 3TOJA 2PHDA 1O5LA 4KQ7A 2XJPA 5T54A 2JG8A 4W65A 2ZGTA 1IS5A 1SLLA 4XBQA 4XZPA 2HWB3 1O91A 2GALA 4YNIA 1Q8SA 5CFCC 4XW3A 3CJXA 3B69A 4Y1XA 4AXOA 4XF9A 2CWMA 3CU7A 3UK9A 4P9LA 1RUD3 1ND2A 1HW5A 3CO2A 2BBVA 2E53A 4YW5A 4CRQA 5AFBA 1RVF1 4QD2A 1EY2A 1WLWA 3C2UA 3USUB 1G6NA 3CEWA 3GALA 4LE4A 2V09A 1RUJ2 3INAA 2RS53 5EYXA 2QVSB 1DQ1A 2YROA 1K5MB 1IS3A 3O12A 3H9AA 3AMHA 3NV3A 1QJU2 4PCRA 4AEKA 2GZWA 1CD3G 3ZXAC 1V6KA 2WNUB 3VZNA 4AFMA 4YYOA 1CAXB 5BNQA 2VW1A 4XMAA 1RHI1 2IFRA 4YGBA 1C5IA 1RUF2 2AYHA 4CDUC 2ZX4A 3KMHA 4M3CF 4A2UA 5BUVA 2OZJA 5CG9A 4Q4W3 1DGRA 1VBE1 3D5OA 2XKOA 4XQ4A 3H1WA 1UU5A 1SFYA 1ZYBA 1QNYA 2HKXA 2LALA 3DPRC 4AI8A 4UW6A 3MFCA 1LGCA 4EN8B 3SLIA 5C8CA 2HWF2 3JQWA 3ELNA 3CJIA 4Y1ZA 3KGZA 4Q0SA 4GB31 5K0UB 1PK6A 2FHRA 5J09A 5GLWA 1A78A 4QPIC 4Q27A 1O3TA 1PO23 4IV3B 4Y20B 1UPSA 2UWAA 4OHVA 1AJKA 3ES1A 3ZFEA 3PMEA 2DCJA 4FPKA 4HKWA 5JI9A 2Y38A 4B7EA 2V5YA 5ACA2 4AFDA 4Z92B 4R4ZA 5CA6A 1WCKA 5F9TA 1CONA 1SBDA 3M8LA 5L36A 4QX5A 1M4WA 2UWBA 1QJX2 4HZFA 4RGAA 2HYKA 2EIGA 5A32B 4LT5A 2DTYA 2NN8A 4GULA 3AP6A 5AVPA 4I01A 4NO4A 1I6XA 1IPJA 3WP4A 1QJZA 4ASMB 4AK3A 1YI9A 3PJQA 1UW8A 1GICA 2WNUC 4K6BA 4LR4A 2JECA 3UKTA 4YM1A 4XMIA 1EP0A 2AENA 2WQ4A 4BMBA 4B4RA 2DCZA 1PIV2 4CDQA 1REFA 2VNRA 5JSOA 1KJRA 4N53B 2R072 2XJUA 1EV11 3LKJA 3TB0A 4AE2A 3MIGA 2PHLA 4FQ4A 1W6OB 1T6GC 3B3QE 4LNVA 5K7PA 4WZFA 1O3QA 1U5ZA 4QQOA 4CDWC 3FBMA 3VV1A 2XVKA 3WQ1A 2C5DA 3WDUA 4QHBA 5K0UC 1HIXA 4XOGA 1NQJA 4Q4Y2 4YZ1A 4WVWA 4AHYA 3ZFGA 5F1RA 4R9DA 1KDKA 5C33A 1VAKA 3WDWA 1RUC1 2VY0A 1R1A2 4RL7A 1Y7BA 3ZIXA 3VBOB 2WS93 3A0KA 1J3PA 1Q56A 1R093 5ABJB 1PGL1 1AJOA 5JI7A 4C1WA 2WSUA 3T1LA 4FAGA 1QOTA 4LBQA 4HSJA 1EAH2 3E5UA 4M3CE 1ZZCA 3FUQA 4R9BA 1TEIA 4L8QA 4DS0A 1H0BA 3FUOA 3W58A 3WQ0A 5JOZA 2B9UA 5E16A 1COV2 3EO6A 2CL2A 4YZ3A 4IEZA 4ATEA 4P9WA 3AZXA 1OOPB 5CBLA 2G4IA 1WW5A 2VG9A 1W2UA 4M3CB 4GWNA 4UBHA 2ZMLA 3KGLA 1JXNA 3IDCB 1NQDA 4BE3A 4XFCA 3H1MA 4N53C 1MS9A 2VOWA 2XBO1 3ATGA 2PAMA 1FMD1 1AYM1 1GR3A 1QU0A 1AYN3 1PZ9A 1WCDJ 3VDDB 2WSVA 4XF0A 2GN3A 1VAVA 1C57A 1FNZA 1G9CA 1OQEA 2B7YA 3J9SA 5FPXA 3URFA 1OQDA 3Q9OA 2OYZA 3QOPA 1AXKA 1ULEA 1YHFA 3D6EA 4DINB 3M1HA 1Y3TA 2XWJB 1OA2A 5FMOS 3FLPA 1J1LA 1VRH1 1ENQA 1PO11 4JCKA 4BQ1A 4RS5A 3ZXDA 2ATFA 5AFEA 1LTEA 1TNFA 1EPZA 1VAMA 1SBEA 3VBOC 4BM8A 1QH6A 1GKBA 1G9DA 4DFSA 2K2SA 5JIUA 4B7KA 4E9KA 1YFUA 2P2KA 4Q29A 4RD7A 3IMNA 1X8MA 4XTMA 2BVBA 2Q30A 3IDEA 1LOFC 4XE9A 1D4M2 1ULDA 2WA4A 4AHWA 4AI3A 1TMF3 4LBLA 2GH2A 4YVWC 3WW3A 5BNPA 1OKQA 1IPKA 2ZKLA 2NMOA 1XRUA 1OLRA 4NVPA 2GNBA 2D3SA 3U10A 3SH5A 4WVMB 2IXLA 4PBPA 3ALQA 4TLFA 5EWSA 2VVEA 5FO7B 5KXDA 1DDLA 1RUI2 2Z79A 2Z5WA 3WP3A 5BV6A 4Q0VA 4C90A 2Q1MA 1YXWA 4P9IA 4PF5A 3WW2A 2A70A 5KHIA 4Q0QA 2VVDA 1A3KA 4I3GA 1NE6A 2VQ0A 4XQWA 3PJYA 3J8F3 4NWVA 1FOD3 2JG9B 3O5SA 2CGPA 5FREA 1LOBA 1AXYA 1MQTB 4FPOB 1QOSA 5LRSA 1PMIA 1R081 3AXEA 5C8WA 2I74A 4BLIA 2D7FA 1JN2P 4K20A 1JYIA 2ETEA 4PDWA 3OYWB 3WCRA 1YIPA 2SLIA 3N7MA 3RYKA 1GZWB 2W39A 4LUMA 3P3PA 4CTEA 4IEPA 2A3XA 4D7SA 4Y1VA 3VBFB 2R49A 4QQPA 3ZSKA 1WGPA 2YY1A 4IV1A 4WM7C 3MEPA 4XJ8A 4CDXB 3KS7A 1TE1B 4Q2FA 1ZBE3 4HFSA 4QM8A 5A3MA 3B00A 1LHOA 5I0SA 3TYJA 4JC1A 1SCSA 3M7AA 5DDJ3 2A3WA 2WNVA 3L2YA 4MSVA 4A7YA 3BB6A 3N36A 4N9IA 2YUEA 5AC92 2ZMNA 1RUH1 4GMP0 4AQTA 1MS4A 3N7KA 3K51A 4LBNA 1BBT2 4LO8A 2RS33 2ZABA 2RMU2 4Y1YA 4KU7A 2QE3A 2OW4A 2NQYA 5JMCA 2WZR2 1ND3C 2QJVA 1F8VA 1BK1A 3RWNA 2ET1A 4M0HA 4KWLA 3MIEA 4COUA 4K21A 2R1DA 1UMZA 2OPKA 2UWCA 4HN1A 3D0SA 4CEWB 1MEC1 1AVBA 4EN6B 1ASJ1 2PN5A 3ECQA 3B9CA 4R9CA 1HXS2 5BNNA 1XU2A 1HQWA 1W6QB 4YG3A 3ZXGA 4BLJA 4IESA 3MPBA 5JPNB 2ZX3A 3N7JA 3ENRA 1RC6A 3VKNA 4ES8A 1NXMA 2HWC1 4BWOA 5L7OB 3NWKA 3V56A 1NOVA 4YGEA 5FCCA 1WUVA 1XYPA 4NN0A 1YJLA 3NV2A 4RHV1 5A33B 4JGYA 1WLDA 1WBLA 2ZX2A 2DVBA 4FOYA 3MIBA 1POV1 4NWWA 2ZAHA 1CAVB 1JUIA 1MVQA 1NXD1 3B9IA 3OTFA 4J6GA 4DOUA 1ONAA 1REDA 2C0ZA 4RQPB 1S0JA 3MLKA 3R05A 1V9U3 3MI8A 4AEDA 5HCAA 4BPZA 1FPN1 4AGRA 1XNKA 2BW8A 1LRHA 4BYYA 2ZCWA 3ILRA 1HRI2 2UYAA 3RJ2X 2SBAA 4PBOA 4QQHA 3BIWE 3G6JB 4GKXA 4X8NA 1LHVA 3MLLA 1W0PA 4CEWC 4GWMA 1RUNA 4OI2A 1LGNA 1VJ2A 1W6PB