5L9VA

Hif prolyl hydroxylase 2 (phd2-r281c/p317c) cross-linked to hif-1alpha nodd-l397c/d412c and n-oxalylglycine (nog) (complex-1)
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
215
structure length
215
Chain Sequence
PALKLALEYIVPAMNKHGICVVDDFLGKETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLICHCNGKLGSYKINGRTKAMVACYPGNGTGYVRHVDNCNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERAAAKVKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Egl nine homolog 1
publication title Structural basis for oxygen degradation domain selectivity of the HIF prolyl hydroxylases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 65
structure length 215
sequence length 215
chains with identical sequence B
ec nomenclature ec 1.14.11.29: Hypoxia-inducible factor-proline dioxygenase.
pdb deposition date 2016-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13640 2OG-FeII_Oxy_3 2OG-Fe(II) oxygenase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 5l9vA00
2V4AA 3W21A 3MGUA 5DAVA 2RDQA 3KT4A 4NHYA 3GJBA 4KBZA 4ZONA 5L9BA 4XABA 5LA9A 4XCBA 3NNFA 2RDNA 5DAWA 2JIJA 4NAOA 5DAQA 4UWDA 4NMIA 4BQYA 3HQUA 4XC9A 5EQUA 5LATA 3NNJA 4NHKA 2HBTA 2JIGA 4Y5TA 5HV4A 3OUHA 2Y34A 5A3UA 4Q5OA 3W20A 3OUJA 5IATA 5L9VA 4NHMA 3KT1A 4BQXA 4XACA 3KT7A 5IAXA 2G19A 5LBEA 2RDRA 3ITQA 3GJAA 5EP9A 4MHRA 2HBUA 3EMRA 4IW3A 3HQRA 5DAXA 3GZEA 5LASA 5M0TA 4NHXA 2FCVA 2FCUA 3BVCA 3OUIA 3OBZA 5C5UA 2A1XA 5IAVA 2RG4A 4BQWA 5LB6A 4NHLA 3DKQA 2Y33A 4ZPIA 5LBBA 3PL0A 4Y5SA 5LBCA 3NNLA 4J25A 2FCTA 4XAAA 2OPWA 4MHUA 4XCAA 2G1MA 5DAPA 5EPAA 3NNMA 5L9RA 5C5TA 5HV0A 5LBFA 5ERLA 4JZRA 2RDSA
chains in the Genus database with same CATH superfamily
4FFIA 3QOPA 1PVC3 3GALA 3H8XA 3NV2A 4HMZA 3K3NA 5A6QA 1W04A 4AXOA 3VL8A 5FUNA 4ASKA 1RUF3 2WIIB 2EIEA 1IPJA 1V6OA 2JEMA 5C6CA 3AYAA 4AG4A 4CUGA 1KQRA 3OOXA 2IC1A 1WWYA 1S55A 5KR7A 3MZHA 3PMEA 1NG0A 4N9HA 4MO3M 2ZZQA 3KD4A 5JDBA 1RUH3 5FPXA 2OX0A 2RM23 5FY0A 2OZJA 2D43A 2QQOA 4TZDA 1YFWA 5FZKA 4WVMB 3QACA 2WQ4A 3ZOIA 4Q4W1 3WINE 2WYFA 5FP4A 5A3OA 1PVC1 2VMGA 1FNYA 2IFRA 4IXLA 3AJYA 4ITCA 2D6LX 2AACA 4BPZA 2FBEA 3MLKA 1WW4A 4FCAA 3SLIA 3GDBA 3J7NA 4XPVA 1Q8OA 5SV5A 4QKFA 1XU2A 2JIGA 2YBPA 3GHNA 2D5FA 2PELA 4AAXA 2QQIA 4DEVA 3MI8A 3UV9A 3BN6A 4OLLA 1JYCA 5FKCA 4IL7A 3POSA 4DMIA 3MDPA 5C3OA 2YPDA 4QGNA 1ZRDA 2JE9A 1SLTA 5F5IA 2VZOA 3I2IA 3OGGA 1LGCA 4IV3B 1RUH1 2GSYA 2WSUA 3W20A 3ZX7A 2O8OA 2CWSA 3HNBM 3KS7A 5LW9A 4LULA 1W6MB 1AX1A 2ZPXA 3NV3A 2VNGA 3MPPG 1BEV3 5FBJA 5J7MA 3BTYA 1UX7A 1CJPA 2D5HA 5IAXA 1VMHA 1QMJA 2VU9A 1LHNA 1G9DA 4Q0QA 4WVZA 4LHKA 4D69A 2UWAA 3OSDA 5ACA2 2ZGRA 5FP8A 2R7EB 1AVBA 4QX5A 2GC3A 3H7JA 2P34A 2WSVA 3K77A 1JHJA 2B9VA 4MHRA 4NOTA 4W4ZA 4AHXA 1C8NA 2VUDA 5BXXA 1O59A 2ETEA 4CDUA 5FPVA 3EYPA 4FSJA 5FQ0B 2IXJA 1AJOA 2P2KA 2V73A 2YROA 3N9QA 1HB1A 4OI4A 4UYBA 4BLIA 2B45X 1QJX1 1ZBA2 1ZZ6A 4K6BA 1OKOA 1SFNA 2OW4A 2A6WA 1BEV1 4P08A 4QPYA 2ZEWA 4J1XA 1A8MA 1GR3A 1V6LA 1ZZBA 3W58A 3O5SA 2JG9C 2P6CA 2VTXA 2RG4A 3V64A 4QAWA 3N36A 2VG9A 5JCTA 1GQHA 4FPLA 4CU8A 4MSVA 3D3AA 4AFBA 3LB9A 1OOPA 1FI2A 3JXSA 5FOJB 4NO4A 3ZN4A 1GANA 4FP2A 2J1EA 2K2SA 3RNSA 4IE6A 1ZYBA 2FDFA 1RL3A 1TZOA 4BQ5A 3O1OA 4FTSA 4FPFA 1RUJ3 4J25A 3ZSMA 2YHJA 3K3OA 1AUYA 4EN7B 3ASIA 3POWA 2E26A 3NNMA 2LW8A 1UX6A 2Y6HA 5L9RA 4PDWA 3AXDA 2XL9A 3PU3A 2EXIA 3WNLA 4CUAA 5JSRA 5DUUA 3A22A 3K75B 3Q8CA 4K8FA 5K0UB 4OZOA 2Q1FA 4CRQA 2W39A 4JGYC 3V0BA 1PK6C 2DVFA 4BWOA 5LEJA 1PIV3 1W90A 4BU2A 5CKQA 1WKYA 1YEWA 3U0ZA 4E2QA 1BMV1 1R092 2B5HA 3WDTA 1RMU3 4QB2A 3LA2A 5BNNC 5CAZA 2HWB2 4LQRA 5E8AA 4R4XA 5A33B 2P3IA 1RUJ1 3CJIB 4GB32 5FY5A 5F37A 1CJDA 1NCRB 3D5OA 2VOVA 4YGDA 5IK7A 1ULOA 4QHZA 3BTZA 1AR82 2WO7A 1VMFA 3MLLA 3P5BA 2NYYA 4X8NA 1NCQA 2X5IB 2VZ1A 1ULDA 3NAPB 3UGGA 5GZCA 4XJUA 5T55A 4LOSA 4LORA 3MUY1 1PIV1 3UKNA 2VQUA 1NKGA 4IE4A 1QJZA 2ZGMA 4ZU7A 4A6OA 1OI6A 4BDVB 1C5IA 1UY3A 2PQQA 2RVAA 3HOBA 2HWD2 4NIAA 4RS5A 3PVOA 4MLOA 4CDQA 5LWBA 1T6BX 2G9ZA 3NW4A 1LGNA 2XJQA 4GMP3 4NE9A 1D4M3 1ZBE3 2WLQA 4AVVA 3ENRA 2HWC2 1DQ5A 4ATEA 5JI7A 1Z7S3 2J1SA 3ETQA 2W92A 3INAA 3KT7A 1W2OA 2D93A 1WMFA 2ZJCA 3OY8B 2QDRA 1JZ4A 1O91A 3MFAA 4GMP0 1HN0A 2C9AA 3U75A 4XBLA 3RWNA 2OXBA 4RQPA 1Z78A 3HAGA 4LKEA 3ZO0B 4AQ2A 4HLTA 2WABA 2PHXA 5FPAA 4O7XA 2VC9A 3RSJA 4A41A 3VBFC 2Y38A 3ZSLA 3OPWA 1FX5A 2R062 2B9UA 1H8TC 3AL6A 3QBQA 2J1RA 4R9AA 1DQ0A 4WM8C 2QQWA 1D4M1 1ZBE1 4LO8A 3VBHC 5GALA 3MF9A 5DUVA 2FCUA 1EP0A 3LQCA 4CPBA 5K7PA 5DXDA 5T5LA 1QNWA 5T3NA 1Z7S1 4LTAA 2JDYA 2QQMA 1DQ1A 2CAUA 3H0OA 5A80A 1R1A2 2B46X 3NV1A 4QQLA 2RMU3 2VBPA 3SISA 2IVJA 3H8RA 4FPGA 4X6QB 1AL0G 5LA2A 3JQXA 4AVBA 2Y33A 3TOJA 4IESA 1JUIA 1W2NA 1JI6A 2O1QA 2P1BA 4CEYA 2B39A 1S4CA 3PUQA 1MZ5A 4LO7A 4FOQA 4K40A 3VKOA 4AR2A 4Q4Y2 3WQBA 4M3CE 1LNSA 2UY8A 2AZ5A 3QH6A 1DHKB 1AYN2 1PM4A 1QJEA 2VZSA 4GWNA 2VCAA 4MXWA 4SBVA 2HWF2 4CCCA 3AM2A 1MS9A 4RR3B 3N3HA 4AI8A 4YM3A 2K46A 4HFSA 1HRI2 2Q8DA 3L9JT 4BMEA 1SPPA 3ELNA 3FC0A 1GFF2 1LB2A 1NXD1 4FFHA 4AI9A 4PLMA 3FFQA 1JHNA 3WHUA 3G7DA 1RVF2 1W6QA 2C6SA 2YBSA 2RMU1 4I0BA 1MQTC 3Q8BA 4C90A 2A5ZA 4Z07A 4Q0UA 3NJVA 4GA9A 3J7HA 5A7WA 2YZ4A 3IMMA 3S5AA 2FQPA 4M0NA 1XXNA 4TXWA 3A4UA 4M4PA 3T0AA 1HX6A 4P00B 4TN7A 3B3QE 4Y4RA 4PHZA 5C8WA 5HXVA 1BK1A 1IS4A 4COZA 5BNOA 4AE2A 1CESA 4E4HA 4KH9A 4LBNA 2NPIA 4NRMA 4UWDA 5FDBA 1KFUL 4WVWA 3HVDA 3J8F2 4BQYA 3PIJA 1O7FA 4CCNA 1NQJA 5FBZA 4E8CA 3ZYGA 3E97A 1AR63 2HEVF 5FK8A 3WDYA 4CCJA 2EAKA 3FE5A 1UMHA 4Q26A 2X8KA 4BIOA 3FWEA 4FQ4A 4EN0A 5J36A 1AL22 1K12A 3ECQA 5FMCA 3WDVA 3VV1A 4YVWC 1HB2A 3PURA 4DXSA 3IAQA 4CP1A 1OQDA 4AI0A 3VZLA 1PO23 2R0HA 2Y34A 2GNMA 1X50A 5B2GB 1ULGA 4DINB 1LTEA 1S2BA 1V6JA 4CCKA 1QOTA 3WNOA 2BJSA 4WBBA 3KF5A 1PNFA 3IWZA 1VAMA 5D1IA 5JZGA 5L9VA 1C8M3 1XE7A 5FMOS 4Q0VA 1XNTA 2WZPP 4HK8A 4A7KA 2TEPA 3KV6A 4UBHA 3JD72 1BJQA 4DRRA 2JDHA 1JYVA 1DGWA 1GNHA 2WC2A 1I9RA 1AR61 1FMD3 1WCUA 4DQAA 1NUKA 4Y5Z0 1EV12 3AVSA 3IZOA 4S2HA 1CVNA 3SCFA 4Y24A 3UJOA 4EQVA 3O0WA 4XXAA 3LIHA 3LGRA 4Y1YA 1R082 1CR7A 3X29B 1AX0A 1JZ7A 1OVPA 1XPWA 4RN5A 2JX9A 1C3HA 2PYTA 1COV2 4N8MA 2WZEA 4EWDA 1PO21 1ZRRA 1ND2A 1O4YA 5FYBA 2QBXA 3HQRA 4Q4X3 4QX3A 4OQ8A 4UOJA 2W1SA 3B94A 5DABA 5HXMA 2H6BA 4PI2A 1C8M1 3H50A 1X9TA 2GN7A 4N7IA 1YCIA 2WKKA 5A70A 1UPSA 5BYNA 1D0GA 1FMD1 4R9DA 4BQWA 3MO4A 1NE4A 4YG3A 1J3PA 2CSGA 5GLTA 1TG7A 1NOVA 4KU7A 1REFA 2ILMA 3H3LA 5LBBA 2FDHA 1ULPA 3NJZA 3ZXLA 1OLRA 3VBSC 4OI0A 3ES1A 4WVVA 4Q4X1 1EYBA 4FQZA 5EWSA 4LKFA 1UZVA 4RSUA 2IXIA 3PMSA 1Q56A 4XCAA 2W1QA 1WGPA 4K1YA 4XAEA 2RHPA 5CFCC 2WDBA 3PVNA 2DUPA 3KHBA 4RL7A 1BQPA 4GH4A 3M3EA 4HPKA 3IPVA 1K5MC 3VBOA 4A2UA 1V6IA 1S2KA 4ZZ5A 1W6PB 3HNMA 1BXHA 2QQPA 2RDQA 4NHYA 3I2JA 3WEZA 4QHBA 4ZONA 1AX2A 5G04L 4DXRA 1OHFA 2SLIA 3FMGA 1CN1A 3VZKA 3AYDA 3N7KA 2PN5A 4V2WA 3USSA 2LROA 1J59A 1FV3A 4JAAA 5A3WA 5FZCA 1EAH3 1W8NA 3AP6A 4OHWA 2ZCWA 4RHV2 3OBRA 4QXHA 1PGL2 3KV5A 4B8EA 2A6XA 3O1SA 4URAA 5J96B 4Z92B 2GC2A 3FLRA 4OFGA 1O8PA 2XJSA 2ZEXA 2XOMA 2WS92 5FP9A 1SPPB 4NPMA 3WP6A 2VMEA 2RR13 4W65A 2R32A 4JDMA 1AR93 4XF1A 3WF0A 2VZRA 2WZR3 1UN1A 3A23A 1DQ6A 1RUG3 2ZGOA 4LE3A 5DMYA 3GM8A 4FVVA 5BNPC 4LBLA 3HWJA 5A7WB 5GJ6A 4BE3A 4K8RB 4XUNA 5A3UA 2VOWA 3H7YA 3H42B 1KRIA 4W6YA 4DFSA 4KNCA 3BUCA 3N9NA 5JOXA 2QNKA 1VRH3 3UESA 4CU9A 3O14A 2XUEA 3SCGA 1CAUA 5BNOB 4D7YA 2EICA 2BW8A 4Q4V1 4CU6A 3K4AA 5FLIA 4B7EA 1JXNA 2C5DA 3OBTA 1X8MA 4CP9A 1CAVB 1Q3EA 3O1MA 1N1VA 2RR11 4FTBA 1PM7A 1AR91 2FZ1A 2A75A 1N3QA 1QJY2 3M3OA 4FP3A 2PHLA 2WZR1 1TNRA 4CXWA 5C4WB 3WG2A 2NLRA 4E8DA 4BXSV 4P9JA 4UI9L 3KCCA 4RA0A 2PLV2 5A7NA 3ZN6A 3WDXA 2BOJA 5K8SA 3HT1A 2UU8A 3L2HA 2XLFA 4DXZA 2O14A 1B35C 1O6UA 1OUXA 3SXWA 3O1UA 4XJ8A 1UXZA 2W2IA 4NHXA 2P3YA 4EN9B 4AAPA 3K2OA 2CTVA 5JXHA 1VP6A 4BHPA 5G05L 1S0FA 1YJKA 2ERFA 1W3XA 5DUWA 2MEV2 4NAMA 5LCWL 2A1XA 1CWPA 4Y1VA 3EHKA 3D82A 5IAVA 4LHSA 1STMA 3ZPYA 4CCDA 2VXRA 5GZEA 3DKQA 5JI9A 3U07A 3DXTA 4QU2A 4QPIC 4K3UA 3RMXA 3RZJA 4LUMA 3PL0A 4IE7A 1FOD2 2Y6JA 3ATGA 4KQ7A 3OYWA 4Y5SA 5JXGA 1KD7A 4R4ZA 2CGPA 4FPCA 4M4RA 4IEYA 4XFHA 3TRSB 2ZX2A 1O8SA 1WW7A 3OJBA 4LO6B 1XQNA 4MHUA 1N1YA 3ZYBA 4DIQA 2NMOA 5EPAA 1HQWA 3ZFFC 1J1LA 4CTEA 1AXYA 4ASMB 2RS31 1N1SA 4AQTA 4YGBA 2AC1A 2WFF3 1G9BA 5FZ1A 2QFEA 2V4AA 1UYXA 2UWBA 1DDLA 1YFUA 2D44A 4A45A 4UAPA 5J37A 2EIDA 3BCWA 3DYMA 2JB8A 1CPNA 1GNYA 2JG9A 2VW0A 3HN1A 4KBZA 4A7ZA 1UZYA 4BB3A 1W03A 2VGDA 5LA9A 2Z4FA 1VBA3 3AYEA 5DN2A 4JGZB 3DL3A 2VZ3A 4QPWA 1JZ8A 3S7EA 5GZGA 1VBB3 5T50A 5CFDB 2YG0A 1H30A 5L7OC 4F8AA 1Y9QA 2MHFA 3AMNA 2HKXA 3IMNA 3W5NA 3RYRA 3ZFGB 4BZ4A 3NRUA 3VD7A 1H9WA 2I74A 3WNNA 4BQ2A 5ISLA 4W8JA 4N53B 3V56A 1DZRA 3USUA 2WFF1 1BKZA 3DPRC 1AF9A 1HRV3 3MUZ1 5JIAA 2XBO3 4LEJA 1RHI2 4LBKA 1RUE2 1XNDA 4HANA 4C0HA 5A6XA 2BFUL 2DVDA 3GCWA 1L7QA 4JGYA 1FAYA 1CAWB 1PK6A 3ILRA 1RUD3 1QJU2 3IBMA 2YU1A 1VBA1 3P3PA 2Z79A 5LK5A 1PMIA 1M4WA 4XFAA 1VBB1 4YYOA 4QM9A 3MLJA 4XTPA 3WV6A 1F4HA 4OMDA 5D2AA 3ZMNA 4CP2A 2VMFA 1W9FA 2OZ6A 4P9IA 4M0HA 1UZWA 4GULA 4WM7B 4XZUG 4E2GA 5BNNA 5FZAA 1JUHA 1OF3A 3EO6A 2UYBA 1WA6X 3S6PA 4C91A 4XUOA 1PGW1 4CU7A 1CZTA 4AW7A 3SEPA 4URTA 3ETPA 3AX4A 1WD4A 4YZ1A 2CAVA 1LU1A 1TMF2 5FZFA 3VLBB 2XBO1 2QQVA 1GKBA 1ODNA 4OUEA 3SMHA 3ZPOA 3AKSA 4MGQA 4P5HA 4X8PA 3ZIXA 4SLIA 1RUD1 3RZZA 1W6OA 1ULCA 3T1MA 1HV0A 1LR5A 1ULEA 4IGQA 5H9SA 4MV2A 3ZDVA 2UURA 4GIQA 1BBT2 1PX3A 5LA1A 2ORXA 2CWMA 4JV4A 1WMXA 3CZJA 2XJUA 3MHZA 2QJVA 1SDWA 2WAAA 3IKWA 4JC1A 5I8YA 2GAUA 2YY1A 4XDOA 2ARBA 2EXJA 4RGGA 3OF1A 5E16A 2ZHKA 5KXDA 4NWVA 3UL2A 5SV8A 2EIBA 2VY0A 2R6QA 1US3A 3SH3A 2VL4A 1DGWX 4IEVA 2BGPA 4YW5A 1QXJA 3VZOA 3E5XA 1SLCA 2X10A 3LSEA 3WNKA 1REDA 2LUWA 2XKOA 1XNBA 3CO2A 4BIFA 2AH2A 1QGLA 5EYYA 5IWFA 4CP9B 1OD3A 2PHWA 3POJA 4UW5A 5DDJ1 1PNGA 4S2DA 5EJZB 2XR4A 3AMHA 2XUMA 1REEA 1XC6A 3QH7A 4DO0A 4MZUA 1ND3B 2VM9A 1GWKA 2ZA9A 1WCSA 3EJKA 2BGOA 5A32B 4FFFA 3VBFA 2HWE2 4WM8A 1H8TA 3ZN6B 2DFBA 3VBHA 2IWGB 3ZFEB 5CA6A 5HI0A 4OULA 2OVUA 4CXXA 2WQZC 3K51A 1DG6A 4XBNA 5K9YA 1W28A 5C9AC 1HB4A 2ARXA 4E4ZA 4NIGA 1FPN1 3A7QA 4LBQB 4KG0A 3THCA 5I93A 3GJBA 2BRTA 1UY2A 2D98A 4JCKA 4AI1A 1JOBA 2WN3A 4XJAA 3UNPA 3B9CA 5FPZA 2EVXA 3CDZB 5FZOA 3A21A 4AI2A 3CBNA 1ZBA3 1JYTA 3EBRA 1ASJ2 1LKNA 5FO9B 1OA4A 3S30A 4QKNA 2QE3A 5A1LA 5EJ3A 2QVSB 1BYHA 4Y1XA 4OCTA 2BTVC 5A3TA 4MXVA 5T52A 3MYXA 3Q8EA 3MBWA 4P9GA 4QPGC 4DS0A 2WFPA 3AZVA 3LEKA 5FZHA 4CE8A 4XW3A 2FMDA 1WW5A 4G4FA 2VNOA 1OT5A 5I0TA 4FI9A 2ZGSA 4PIYA 3GZUC 5CG8A 5F1RA 1RUI3 4OI2A 2XJPA 4NHKA 4UW6A 2A7AA 1MQTA 3ALQA 3LEIA 1P8JA 1XNKA 2WNUA 3GF6A 5E1RA 3IB3A 5FYVA 4HOOA 1DQ2A 3UYJA 4Y5TA 5I0DA 2ZGPA 5FR3A 4ZS2A 1QDCA 3VL9A 1XRUA 2BWAA 1LGBA 4JHZA 2VZPA 2W52A 1V9U2 5F6KA 2HJIA 3CL1A 3M8LA 4GWMA 4TSVA 4XF9A 5FY1A 3ZYRA 2R042 2ZAAA 1PMJX 2BWCA 3BGAA 4IV1B 1US2A 5GZFA 3K4ZA 1H1AA 1RXGA 2VMCA 5D8AB 2XLAA 4I2OA 3PVEA 1ZRIA 3J9SA 4XHBA 1R093 3J7MA 4DPNA 3ITQA 2JG8C 2PTMA 2HWB3 1G7YA 2VO5A 4LO5B 2D3SA 2ZXQA 5B4XA 1RUI1 1RUF1 4DUXA 3D4KA 2XONA 5JOYA 1E5IA 3WCSA 4DY5A 3ABZA 3IT8A 4GKYA 3C7HA 1AR83 2RS52 2WT0A 4YVWA 4JVAA 4XURA 3VBRB 2D6OX 1GU3A 1SCSA 3HT2A 2E33A 3WR0A 4YW3A 1JYWA 2OQ7A 2DDUA 1OLMA 3VBUC 3I54A 3ZYHA 4HSLA 3M3QA 3RFRA 2RM21 5FV3A 5BNNB 3BVCA 4AEKA 4D6RA 2ORZA 1GNZA 5JIUA 3OPZA 2ZMNA 4TLGA 1R091 4K20A 3NL1A 2DVBA 4XBQA 2PQSA 4CZSA 3H3ZA 2HWB1 2NMNA 3M7AA 2Y60A 3WSOA 4HETA 1VBE2 5GLZA 3FUQA 1CZVA 2HEWF 3ZSEA 1QEXA 3ZXKA 3ZXAC 1AR81 1F5FA 3MIDA 5FUPA 5JAXA 1LHWA 2WNEA 2ZX4A 2VVDA 3NWKA 1EPZA 4I09A 1Q8VA 1GOFA 4META 2JJ6A 1WD3A 3KCXA 4BOWA 1AR72 2NZ9A 2Z69A 4EROA 1ZZ8A 2E7QA 1DIWA 1MS1A 4LLFA 4JTOA 2JENA 1A6CA 1VE0A 2AEYA 3ES4A 1GWLA 1JYNA 3MEPA 4KI5M 1UAIA 3MIGA 2VNRA 2XWJB 4IEWA 4XJWA 1X8EA 2R063 1TVGA 2VJXA 1G9CA 1KITA 1RITA 1W9SA 5ABJC 2DVGA 5LZ6A 4QB6A 3ST7A 3HJRA 3VZJA 2PHUA 2ZAHA 5DAQA 2YGMA 1F9KA 2RV9A 1MS8A 1DU3D 1QWRA 3VBSA 3VUOA 3UGFA 3TEYA 1LESA 1R1A3 4LT5A 2AREA 3I97A 3F95A 1RTVA 5C71A 3RZGA 2LM3A 4R52A 5CFCA 1L3JA 5BNQA 4COYA 1YQ6A 4IERA 4LBQD 1MACA 3ZVXA 4XC9A 1H8TB 1HQLA 1DGRN 1K5MA 3T1LA 4GALA 4B1LA 3VBHB 3CJXA 4Q4Y3 1FXZA 5J48A 3DEMA 2GALA 1UOJA 1AYN3 1CX4A 1J3QA 1DQ4A 1XB9A 2XQRA 2YUEA 3EXUA 2HWF3 4H2AA 3MW3A 2R061 4OZXA 2OA2A 5IVBA 4LOTA 3AZWA 5IVCA 5FO7B 3M2MA 1JW6A 3QD6A 4TLFA 3ZYFA 4Y20A 4H14A 4RYDA 3B00A 4V1PA 4LJHA 4CCEA 2JWPA 3AP9A 4A6SA 3DECA 3E1F1 3THDA 1R1A1 1RVF3 1WCDJ 5LK7B 1W8TA 3LDRA 2HEYF 3KQ4B 1H4GA 5FZ6A 4BQXA 1VB4A 1MS5A 2JE7A 4GAZA 1L7LA 4Y22A 3VKFC 1M06G 2L9LA 1RUH2 2VVEA 3KZ4C 2C1FA 4AGVA 2ZGLA 1BZWA 1YI9A 1JMUB 1ZNPA 3D8CA 4PF1A 4CEWB 4CP0A 1RIRA 1AYN1 1UD1A 3HBZA 2BYVE 1RGSA 2HWF1 4IV3C 5GZDA 1DCSA 4DNYA 4PIXA 5F8PA 4AF9A 1LEDA 5JUVA 3WP5A 3J8F3 2AENA 2D40A 1W2TA 3AKRA 2D97A 1MQTB 1RMU1 3Q9OA 4AFDA 4QX1A 4XZPA 3NQHA 1UCXA 1UW8A 4KWKA 5BNPA 2FDGA 2WWJA 5DAXA 5KXEA 1LHUA 1Q43A 3RZHA 4GWJA 1RVF1 1YQ8A 2OS2A 2WBKA 1W0NA 5A1FA 1UO9A 5M0TA 5A3MA 4DEQA 1LEMA 4UW3A 2VZVA 2P5BA 1AL23 1UYZA 3MIEA 3SKJE 1PX4A 5F9TA 1QJX2 2VBDA 5FO8B 1NX9A 4NPLA 4Z82A 3NNGA 4H7LA 2IUWA 4AZZA 4LKSA 3ILFA 4YGEA 3VDDC 1SLBA 5FP3A 3VDCA 1UOFA 5EZWA 3J26N 3VGIA 3CMGA 5LEKA 4XIOA 3P6BA 3S7IA 3C8XA 1Z0HA 1KJRA 3WF2A 1I5PA 2Y0IA 2ZACA 2QZ2A 5LBCA 4JTNA 3JD73 1UU6A 3J4UH 2OUHA 1UF2C 1VBC2 2TUNA 1EV13 4GMP1 3E6DA 1B35A 4LXLA 4ZKTB 1YNAA 2C0ZA 2W5FA 4JZRA 1H6XA 3JCIA 4NIHA 1R083 1UU5A 3ZM8A 1TQ5A 4YM1A 4LHLA 5FXWA 1HJFA 5C3QA 3BU0A 1COV3 4V2VA 4PQ9A 1U12A 2WO1A 4MGSA 5JMCA 4CDXC 1S0IA 3MF6A 3VB9A 5FZDA 2JICA 4KWJA 3L2YA 1O4ZA 4L9BA 5C3RA 1U5XA 3AYCA 4QPIA 2Q8OA 3C7GA 4F83A 4AVSA 2V5DA 1MR5A 3B01A 2XL7A 1ZZ7A 2Q5TA 4ISQA 3JD71 5K0UC 1EY2A 1J58A 4NUBA 2FDKA 4ZXKA 5FY8A 4Q27A 4CDUB 4D6QA 1EV11 2YMZA 1CAXA 5IHRA 4NMIA 2W47A 1H8VA 5FYIA 3ZFFA 1FV2A 4MVTA 2BVVA 4XJZA 5FY9A 1NQDA 2UYAA 3DF0A 4Z2AA 4FXKB 3WP3A 3I7DA 4YVSC 1COV1 4LITA 1JH5A 3CJIC 1BK0A 2J22A 2JKBA 2WNUC 2C24A 1LOFC 4FO9A 4O65A 1SZBA 1RUC2 2YYOA 3IDCB 3KMHA 1AXKA 2Y0OA 5CG9A 2W08A 1OQEA 1POV3 2DFCA 1JZ3A 2VQTA 5L7OA 2ARCA 1GMMA 1OOPB 3Q8AA 4JQTA 1X7NA 1JU3A 3CKHA 4OHVA 1A8DA 5FUIA 3U37A 4UF0B 1GUIA 3GXUA 4R9CA 2A6VA 2JDAA 4NHMA 2D6PA 1CPMA 2ES3A 2BBVA 1POV0 4UW4A 3T2QA 1MZ6A 2G19A 3DPRA 1EUUA 1O3SA 4QQHA 4PDWB 5JXIA 2BU9A 1JYXA 3R4UA 1NY72 3THTA 1HIXA 1UKGA 1C1FA 4HKLA 4BXFA 5FYZA 3GJAA 1HJGA 4QX0A 1S0DA 2VOKA 1JU4A 3GCXA 1DF0A 1LOEA 4RHV3 2Y6GA 5F32A 3SKVA 5LRSA 4JDOA 3V0BB 3TAYA 2B42B 1POV1 4N9IA 4NR1A 5AFBA 4NROA 1JS9A 4TYSA 2XGXA 3UJQA 3QLQA 3O0XA 4MGIE 3K46A 2A3WA 4RGAA 2WS93 2VZUA 1IPKA 5HCBA 3ILNA 3BYWA 3H8UA 2KR2A 3ACIA 2R073 3RDIA 1RC6A 2AUYA 4S2GA 4OHXA 4W6WA 3VKMA 5LRRA 4BISA 3E5QA 4AVCA 1F8VA 5BUVA 1YFYA 3JBG2 3B7MA 1D4M2 3ORJA 5T5OA 4DXTA 1ENRA 4MG2A 4LA2A 4NHLA 1NCQB 5FREA 2ZZJA 1Y7BA 1R1ZA 2GNDA 4XDQA 1I1EA 4Y26A 4RHV1 3OGSA 5FYSA 4ZU5A 4QKDA 3S57A 2P17A 3LPFA 2VZQA 2WYSA 1ZVFA 1G6NA 2FCTA 2WUHA 2WS91 5ANQA 4QQOA 1OSGA 2G1MA 2JD9A 5JOZA 4EZ4A 1OPOA 2LRPA 1VAKA 2R071 4H3WA 1Q8SA 4RS5B 5I0UA 3VHRA 2BFUS 4CDQB 2UWCA 3ROUA 4YZ2A 2GZWA 2WA3A 5C3PA 3NVCA 5E88A 4ES8A 3KT4A 5DZEA 2PLV3 1Y4WA 5E6HA 1SCRA 1TME2 4YM0A 3ZMOA 1O3QA 2GMPA 2OIIA 2Z5WA 3N9PA 2YB7A 4RR3C 3I2FA 5CEHA 1RJ8A 1GQGA 4DZGA 4FPEA 4XMIA 2JIJA 1SBFA 1D2QA 3PJYA 1WMDA 2VXJA 3TN92 4RQPB 3K48A 2MEV3 4RGKA 3S5QA 1T6GC 1C4RA 4COUA 1YQCA 3VN4A 1DYKA 5A7QA 4K1ZA 3ZSKA 2H0VA 2F6BA 2VCCA 2X29A 3WW4A 3HQUA 4XVHA 5FAXA 4FPYA 1OA3A 4QD2A 1SLIA 5FZ4A 2V09A 4A44A 5C9AA 2PLV1 1LOAA 2IXHA 2BPA2 2X53S 4XQDA 3AXEA 1YJLA 4NVPA 4COWA 2DCTA 3FL7A 4QDRA 3BU7A 2ZKLA 4QXCA 3ZR5A 4CCMA 4JKMA 5DZGA 4PQQA 2G4IA 2ADEA 4H7MA 3V0AA 2MEV1 4QPIB 4CEYB 4YW6A 4G3YC 2DUQA 3OUJA 5IATA 3TBDA 1UY4A 1WW6A 2GMEA 4FAGA 1VMJA 3FUOA 4MXWB 4QPGA 1UWWA 3PLQA 4DRVA 5FZBA 2BERA 1SFPA 3GZTB 4XQ4A 1W0PA 1OF4A 2A3XA 4UFMA 4AEMA 1O3TA 3RZKA 3WT3A 2ID4A 5DPNA 3PTYA 2WT2A 4OUSA 1YO8A 5FYHA 1W6QB 3DYOA 5DZFA 4YW2A 3CZUA 1PVXA 3OD0A 4PBPA 3VD3A 2QKDA 4QKBA 2PHRA 4Z8BA 5C3SA 1GZ9A 4XYXA 1UPIA 5FRAA 1RHI3 1GOGA 5FZ3A 5F3CA 1EAH1 1RUE3 1OPMA 2DBNA 5L7OB 2F17A 1RUOA 2FCVA 4KMQA 3OUIA 1PO22 4JRAA 5AVPA 1QJU3 2H6CA 2DCZA 2P4EA 4PBOA 4XE9A 3ME2A 1AYM2 5FKBA 2ZGUA 1QNYA 2I45A 5I0RA 2VECA 4Y1UA 3HMYA 2E7TA 2RS12 2Z42A 4EN8B 2JG8A 4YFWA 3KHCA 5LY2A 4ONUA 1HXS2 2CYFA 4QXKA 4D94A 1VB2A 4GKXA 1YXWA 2ET1A 4PLNA 3I3MA 1RUG1 2YPJA 2VOTA 5I8TA 3WLUA 1W05A 4M3CA 2YXSA 5FLHA 1OH4A 1XOYA 1TMF3 2ENRA 5EYXA 2G9GA 2OPWA 3TEWA 3SQOA 4YARA 4MGYE 1RUE1 2D6KA 3VBUA 1ZA4A 3I2DA 5C5TA 5LBFA 1VRH1 2VCBA 3I3DA 2VULA 4HN0A 4XUPA 4A7YA 2DF7A 2JXAA 3CQOA 1J83A 3BOPA 3NO8A 4KGQA 5JZGB 4CDWC 5FZ0A 2QQNA 1PZ7A 2GP5A 3AP7A 2AR6A 5CU1A 5L36A 5A6ZA 3WNXA 1BBT3 4JRLA 1N3PA 2C9KA 3HR9A 3O0VA 3HNYM 2C4XA 5FIXA 1JYIA 1PO12 1FYUA 4BMBA 2ZMKA 2LS6A 1G9FA 1BVP1 3KSCA 3B9IA 4GZ9A 3WD5A 5DAWA 3F2ZA 3LPGA 1UOGA 1BCXA 3RZLA 2BNMA 1VLNA 3T2OA 1QH6A 1TMF1 2VOXA 1DYOA 3K4DA 1RB8G 3RYKA 2VMDA 4L97A 3U78A 2KM2A 4MGTA 4K21A 4EYUA 5I91A 3C2UA 3GBFA 4OHZA 4AGRA 1WBLA 1ND2B 5GLUA 1WUVA 2O0OA 3WDWA 4UFKA 4QQPA 1BLZA 2RJLA 2BOIA 5EQUA 4L0PA 4P9YA 4GWIA 3VHOA 1GZWA 2Z2SB 2J1TA 5FYCA 1BBT1 2R49A 4QX8A 5FZIA 3SCHA 4IGOA 5A3NA 3I2GA 2HWE3 5L19A 4TWTA 2Q1ZB 1S1AA 1YIPA 2PA7A 5ABJA 5HV4A 3T0DA 4EWAA 1O3RA 4QU1A 4QX7A 4R8HA 4MH0E 2MPFA 3BIEA 5IT6A 1A78A 4TTGA 5KBFA 4NPRA 2D6NA 4XF0A 1BHGA 2CU5A 5IVEA 5FYUA 1E5HA 1HKDA 5LBEA 4AOCA 5CIRA 4CPBD 3LF7A 4YPJA 1ASJ3 3J7LA 1D2SA 3U4XA 4BA6A 3VBOB 4GH4B 4HPKB 5T5PA 3IPVB 3IDEA 1CIWA 4Q4V2 5C9AB 1DFQA 4AEDC 5F7UA 5DQ0A 5KHIA 3UGHA 4FPKA 1F5JA 3MV11 2A73B 4QM8A 4WVMA 1TE1B 2Q1MA 1KS5A 3IIIA 4D7TA 5JR2A 4N7UA 2F4LA 1RXFA 2WZR2 3AFKA 5CVRA 4Q1RA 4YW1A 5JLVA 2NN8A 3N9LA 2Y8KA 5FZLA 3WW2A 4I02A 2XH6A 3RYPA 2LALA 1BVVA 4AQSA 4COVA 2ZGQA 4E4DX 4QHOA 5FK7A 3WUDA 1YLLA 3PUHA 3U4SA 1HRV1 5C4WC 4Q0PA 1SFYA 4FT8A 1ASJ1 1ZZ9A 3NKTA 2VUAA 4XEZA 4AFMA 4E2SA 4FAHA 2FD8A 4YG0A 2J1AA 1H2MA 3MW4A 3KV4A 4IUGA 1V9U3 3WY6A 2AGSA 1IHMA 2DTWA 1K3IA 1X36A 2UY9A 3NMBA 1UY0A 2R043 1XYNA 2WR9A 4INDA 4IV3A 2WNVC 5IVYA 5TSWA 3T09A 1W6MA 5CYYA 1SEFA 1V6NA 3I2KA 4HZFA 4AHZA 4XJ9A 4KBBA 1IQAA 1MS4A 1LHVA 1JOJA 2XHKA 3FHQA 1GV9A 1LENA 1JODA 1LHOA 1OUSA 1UQXA 4JDNA 2IZWA 1ONAA 1LODA 4E9KA 4L2NA 4LO4B 2KXLA 2RS53 5JWPA 2VZTA 3N7JA 2RS32 3GNEA 4FBFA 4FPOB 5L9BA 1CAUB 1O5UA 5J1XA 3MW2A 4MADA 4RFT0 1IQDC 4XUTA 1V9U1 3NJXA 1X82A 3VDDA 3NNFA 3BOWA 3DN7A 2ZGTA 5AC92 2R041 2RDNA 3VKNA 3VHPA 3IDAA 2WO2A 3N9OA 1F2NA 1S0CA 3NV4A 5C70A 4FOWA 3RZMA 2C26A 5FCCA 3ZR6A 1MEC2 2ZHLA 1ZREA 1U5YA 2A6YA 4A3ZA 1UYPA 5ACA3 1UXXX 2W1WA 4Y3OA 1QDOA 2WNOA 3BPZA 1VBE3 3ACFA 4JGZC 3LWCA 5BPXA 2YC4A 5CFDC 3VBUB 4Q2FA 4QB1A 2W95A 2RS51 1D4VB 2Y64A 5EFUA 5A7OA 2WFF2 4HT1T 1NLSA 4QXBA 5IK5A 4CDXA 1GLHA 3LOIA 4HKWA 4HONA 4N53C 1AR73 2D3PA 1KFXL 1ZRCA 4GJYA 2XPJA 2VQAA 2N7GA 1G9AA 1ZX5A 2PHFA 3WQ1A 1VBA2 4B1MA 5FP7A 1W99A 5K0UA 1WLTA 1H1MA 2J7MA 1F35A 3OYWB 1MS0A 4MGZE 4N43C 5ACA1 5JPMB 3SC7X 1NLQA 2E7AA 1VBD2 4XUQA 3KM5A 5FZ8A 4P9XA 2DTYA 1OC1A 5F3GA 2XHNA 1PGW2 3OGRA 3OD4A 4IEPA 1ENXA 2W68A 1YC61 4XQWA 5C8CC 3FN9A 1IKPA 4MX3A 2WJSA 4WM7C 3FLPA 2B7YA 2XMLA 5A3PA 2WO3A 4YVSA 1W06A 5A33A 1LOBA 1NE6A 2W94A 2Q0AA 2WZ8A 3CJIA 3OEAA 2BBAA 4QWNA 2HH9A 5T54A 1LOFA 2ZGNA 1GZWB 1XE8A 1G86A 1AR71 2HBUA 1ZBA1 2JD4A 1FNZA 1H2KA 2JG9B 2OUJA 3O12A 4K7JA 4LBMA 2A3YA 4XF4A 3W5MA 1ZRFA 4JX0A 2CDOA 1OXCA 2CGOA 2DUOA 2ZKNA 1SLAA 4ORFA 3M1HA 2ZX3A 3ZXJA 1YI7A 3I8TA 1MZFA 2K9ZA 2V72A 4DUWA 4IEOA 5GM0A 3OGJA 3KV9A 4IE0A 3OBZA 1NA1C 1UL9A 4QX2A 4UFLA 1KDMA 4XDPA 3P1IA 4AHWA 1Y9GA 1GQPA 1QXRA 2P6HA 3M3IA 2NM1A 1QOSA 5LB6A 3CU7A 2X05A 1QQP2 1U0AA 3LAGA 3USUB 5FMDA 2CL2A 5B4NA 3NKGA 4UFHA 3VD5A 4GB33 3ZN5A 2BDRA 3AZXA 2FZ2A 3N9MA 2QQKA 2GH2A 3R6SA 4JGYB 4QDSA 1PK6B 2QQJA 2Y26A 4WV8A 3I2HA 4O9GA 1L7RA 3NNLA 2EAAA 3LSDA 3WG1A 3GZAA 4M00A 4XHXA 4J1WA 2XWBB 3KF3A 5I0SA 1W3VA 1IOAA 1J1TA 3OY8A 5DDJ2 3WF1A 5HV0A 3R4SA 3ZXGA 1LULA 3LDBA 1QH7A 2RDSA 2AEZA 3WOGA 4MOAA 5CBLA 2CY6A 2J1VA 2YDEA 3POIA 4YW7A 2VAUA 1B09A 3M4FA 2XXZA 4P02B 3O1RA 3EQEA 1GICA 3LDKA 2HWD3 5KXCA 4XABA 1ND3C 5HCFA 3RJ2X 3TEXA 4XCBA 4A3XA 4C8DA 4GB31 3KB5A 4EJRA 2W9XA 3RGBA 3WW1A 4AFAA 2DCKA 4EWEA 1PZ8A 1S0BA 1H9PA 3JUUA 1FPN2 4BYYA 5JOWA 1NLRA 5EHDA 3ZFEC 4NRQA 5FPLA 4M3CF 2HWC3 4NAOA 4PI0A 1QU0A 3FBYA 1UZZA 4YWAA 1W6OB 2VW1A 2CV6A 2ARAA 3BB6A 4WZFA 3ZYIB 4F3JA 2A6ZA 1W6NA 2XJRA 3AFGA 1HN1A 1QJX3 3WZ1A 3OB8A 1NZCA 4RD7A 2E6VA 4FXGB 2IXKA 2W91A 5JVVA 2R0FA 1W9TA 4GQ7A 4IETA 4HVOA 4LBJA 4Q8LA 3RQ0A 5J09A 3H3UA 2E9QA 3POFA 4YGCA 2QQUA 4PLOA 2XVKA 3PVBB 3H1YA 1HQNA 4OYUA 2DU0A 1C57A 2DCJA 4KWLA 2YC2A 5IYYA 3NNJA 3T4HB 3UK9A 1W2UA 3V65A 2HWD1 3Q8FA 1UY1A 4L99A 3U11A 5IVVA 1DP0A 1VBC3 2A71A 4O61A 4RR3A 1MS3A 2W1UA 3UT0A 4NIDA 1G8WA 3DGTA 4P9WA 1KEXA 3ZYJB 4B4PA 3O1PA 2HWC1 3VDDB 1EUTA 5JSOA 3SHRA 4XETA 3T30A 5KHGA 1ALYA 1ENSA 5FZ7A 2WL1A 4CXYA 1PMHX 1W9YA 1ACCA 5F3EA 3KT1A 3WF4A 3I4IA 2VUCA 3VBFB 2JDKA 2RDRA 4D6SA 3I3EA 5T5JA 3G6JB 4WM8B 3R0RA 3LOBA 2ZTNA 4AEJA 4HSJA 1VR3A 1UZ0A 3M3CA 5JR7B 4CVUA 2PHDA 1MPXA 2ATFA 4Q4W2 1VBC1 1PVC2 4F7ZA 3I3QA 3KGZA 4IV1C 2VE1A 1VRBA 5CZKA 1JN2P 1HRI3 1RUI2 5D8AC 2PXJA 1RUF2 4I30A 3TWIA 4CDXB 1UMIA 2MNGA 3HBKA 4UXAA 5FZOB 1RINA 4AFCA 2R1DA 3GZEA 3HIFA 2AYHA 1ZZCA 3TNQA 1XNCA 4HG6B 4YM2A 4YG6A 3LEMA 5A3LA 3AJZA 2Y6FA 4AYUA 4IEQA 1RUC3 4E4SA 4IE5A 2RE9A 1HW5A 2RM22 2ZMLA 3HEIA 3VBRC 2WA4A 2DV9A 4Q4Y1 4UFIA 2J1UA 2D3RA 2WN2A 2E63A 4AVAA 2BZDA 5D21A 2ZX1A 3FBMA 3KVAA 3PUIA 2CDPA 1JBCA 2JKXA 2R30A 4LBOA 4YVSB 1S0EA 1XBFA 1HRI1 4GD4A 1TNFA 2ET7A 1HB3A 2HYXA 3GBWA 4XXPA 2HLEA 4LLOA 4S2FA 2WNUB 5DUXA 5FLJA 5C33A 4KGGA 3FX3A 4B3NA 3ON7A 3OPTA 5DG2A 5ERLA 5FJHA 1OLQA 2KD7A 3W21A 3MGUA 1RUC1 4YZ3A 2B8MA 4YZ5A 1QIQA 3WXPA 1VIWB 4YZ4A 5E89A 1QKQA 4Y1ZA 4AK3A 3AZZA 3VKLA 1W8OA 3MICA 2VMHA 1BEV2 1XYPA 1N3OA 1YHFA 2FHRA 2VUJA 3I59A 5A7PA 5GLVA 3WF3A 4ARYA 2D6MA 5KC5A 5FTTC 3AP5A 3N7LA 4I0WB 3AKTA 5LA0A 2PMWB 1V00A 3AZYA 3J8F1 3RS6A 5AVAA 4EV0A 4E27A 1IS5A 3RMYA 3JBG3 5F6LB 2R1BA 4YVWB 3UKTA 1NY71 1HDKA 4GXLA 4W6XA 3RWKX 4CSWA 3AMPA 1AL21 4HVRA 1OQ1A 4OVEA 4BQ4A 5F5QA 3T08A 5FY7A 3APBA 5DG1A 1DYPA 3N7MA 3R05A 3FJSA 1URXA 1POQA 1ENQA 4ZZ8A 3BALA 1H2LA 3LZZA 2GC0A 3B5LB 1C5HA 3FZ3A 3PTRB 3WX5A 2HBTA 3AKPA 3KVBA 4X6RB 3BTAA 4CDWA 3MFCA 4KU8A 4AI3A 2XJTA 2I2SA 1KXGA 4LR4A 3ZIWA 2CNAA 4NJ4A 3RI8A 4BQ3A 4NWWA 3DCQA 3HN3A 4I01A 3POGA 4A42A 4C0BA 1JTZX 3UKVA 1HLCA 3AK0A 2NQYA 2QQLA 4PJYA 1NAEA 1KS4A 3JBG1 1DGRA 3OEBA 4NRPA 4Q5OA 1E5RA 2YV8A 1W6PA 1BMV2 2IVIB 5L73A 1KDKA 3POBA 1TME3 4HVQA 1CGPA 4IQPA 3N4MA 1W6NB 2EA7A 2YGLA 3WVJA 4BK5A 5FY4A 1RUJ2 2OQ6A 3GHMA 5IK8A 1R081 1LJ7A 2BUKA 3TEZA 4P9LA 1O5LA 1UIKA 2DBIA 2VNVA 3WNPA 3ZXDA 3TN93 4D0QA 5C7GA 5EP9A 5FWEA 3VZMA 3CF6E 1NCRC 1LOGA 3T3YA 5HBAA 2ZOEB 5KXBA 1S2EA 3T2TA 1PIV2 3KQRA 4D7SA 2FDJA 2X5IC 4KWUA 1XYOA 1LAJA 4OHYA 1CX1A 1K45A 1ULFA 4CEWC 3NAPC 3RPQA 1C1LA 4YFZA 1RMU2 1F31A 1TME1 3FHIB 1AHSA 1W8WA 5CNAA 3I2OA 3VBSB 3VDAA 1SLLA 4CYDA 3S0MA 3AMMA 4ZY9A 2BV4A 5HPOA 4BJ0A 1JZ6A 1VJ2A 2WAOA 1RUNA 5CFCB 1FATA 3BIWE 4U36A 3TN91 4LNVA 3JZVA 1IZ3A 1K5MB 1CONA 5JMOA 4XILA 1DZQA 4DOUA 3AP4A 1H6YA 2BEOA 2VQ0A 3JU9A 4Q1PA 1IG0A 4AEDA 3CNAA 1FT9A 2GMMA 2VBBA 1OFSA 1IKQA 1H1IA 2EIGA 2PAMA 4U2AA 5FYMA 2HYKA 1WBFA 3C7OA 1XSRA 2Y6KA 3HPNA 3MIHA 1IG3A 1WLWA 1CAVA 4Y20B 5FYYA 4PF5A 3UETA 4PT6A 3M70A 2XLGA 2OYZA 4Z1VA 1CD3G 3VDBA 1E5SA 3PHMA 4I3PA 4J6GA 1PGSA 5C4WA 3BKZA 1ZBE2 3JB8A 2BNNA 4LKDA 4R9BA 4BLJA 3JB4C 2XDVA 4QGMA 1GWMA 1V6MA 4RFRB 4Y22B 2E32A 4Q29A 1Z7S2 1PZ9A 1D7PM 3PU8A 3E6CC 1MVEA 1PGL1 1IS3A 4G9SB 3WP4A 2BQPA 1F15A 2WNVA 3SEEA 3BODA 1AYM3 3D0SA 1JZ2A 5IFPA 1SBDA 3TB0A 1WA4A 1GP5A 1X33A 3P3NA 1IS6A 2RS13 2LTNA 5H9PA 3TNPB 4W50A 4QT6A 1GBGA 3LA3A 2J42A 3IDBB 2EF6A 1HXS3 2W46A 2WWUA 2ZEYA 3B69A 1GYKA 5BNPB 1MZEA 1QJY3 5H9RA 4FFGA 5ANNA 1W39A 1YFXA 2IFWA 1A34A 5J3UA 5HCHA 4AQ6A 4B29A 3T2PA 3WG4A 5LY1A 5LATA 5IW0A 5EIYB 4DUVA 5IVJA 2BNOA 2DVAA 5GLWA 4IEXA 3ACLA 4CDUC 4XIKA 1EPWA 2QUOA 2DU1A 1UNBA 5FXZA 3H1MA 1OH3A 1X9PA 1YRZA 2XVGA 3IAPA 2RMU2 1W9WA 3I59B 4ZU4A 5CISA 1LECA 3OUHA 1XSQA 1AYM1 1SQ4A 5JXJA 1W8HA 4A4AA 1WZXA 3OCPA 4JHTA 2VH9A 3ACHA 1JZ5A 1V0AA 1F4AA 2RS11 1R64A 4OMCA 5H9QA 1W2AX 4CUCA 1HXS1 1OFNA 1OMIA 1APNA 5BV6A 1PO13 1QJY1 2JDUA 4BM8A 4JGZA 3PDQA 1J3RA 2ZEZA 2JE8A 5CFDA 1B35B 1FOD3 1Q8PA 1DZTA 3LFIA 5KHHA 2OKXA 5AFEA 5CADA 1OOPC 2GH8A 2Y6LA 3IN9A 2ZHNA 1O4TA 2D7FA 4EE2A 3ZFGA 2DYCA 3CHXA 2VW2A 3E5UA 1JOPA 3B02A 5IFTA 1J84A 4ZHNA 3EMRA 3ZKUA 4CDWB 1GP6A 4N53A 4BK4A 1I3HA 4YRDA 1UKRA 3AMQA 3C7FA 1H4HA 3SH5A 1GOHA 3R4DB 2GDFA 2EALA 4PDWC 1IGOA 2VTFA 2ZX0A 4QQ2A 4XF3A 2F4PA 1LOCA 3IIAA 3LA7A 1CAWA 4N43A 4H55A 1TEIA 1PO11 1OA2A 1UYYA 5C5UA 4YNIA 1W8UA 1CAXB 3DKWA 1WCKA 3LD8A 5A6YA 1LRHA 5C8CA 1FOD1 4LMFA 3ZFFB 2KA3A 2VMIA 3WNMA 4WM7A 5F5AA 3ZKYA 4UFJA 4XMAA 1YWKA 4D3WA 5FFOC 1K42A 5FXXA 1DLLA 3SITA 1AR62 4XOGA 5F2SA 1VALA 3B93A 2PFWA 2Q8CA 3FFZA 2QCSB 5GKAC 4BH9A 1K5JA 2E31A 3DXUA 2Q8EA 2YBKA 2GNBA 5DAPA 2QZ3A 2I07B 3DUIA 3D6EA 4ARXA 4FOYA 1OD5A 2X09A 1NCQC 2O8QA 4JKKA 4N90A 4IEUA 2XVLA 4Q4V3 1NA1A 4FPHA 3C7EA 4AWDA 2NP0A 3WQ0A 2R072 1OKQA 2PAEA 1C8M2 5I8SA 4PCRA 3DPRB 5APAA 2BVBA 2E53A 1FMD2 1UIJA 4RS5C 5EV7A 2WWSA 4CDQC 3H9AA 2K0GA 2Q30A 4MYEA 1A3KA 1U5IA 1CZSA 4K9SA 3ZDSA 1YQ5A 4AEDB 1RHI1 1Y3TA 2JECA 3OG2A 2R16A 3OTFA 2YFUA 1QJU1 1W8ZA 1UOBA 3MIFA 4Q4X2 4ZXEA 5CB7A 2VPVA 3PIGA 5BY5A 1DBNA 2XB6C 4YSFA 1OVSA 1YYNA 4IEZA 4B4RA 2JDNA 4NN0A 3BPSA 3EB7A 4RQPC 4Y33A 2B4KA 4FTEA 1QXPA 1ND3A 3NSTA 4Z2WA 5A32A 3OBAA 5KHKA 2G9FA 5FMBA 5JSPA 3AC0A 3ZFEA 4FPJA 3KGLA 4LK7A 1CQ9A 1XNAA 2YU2A 3LFMA 4XFIA 5EXOA 4OQ9A 4B7KA 1WCQA 3URFA 2RS33 4LIUA 3SNMA 2WNVB 2Q4SA 1N1TA 4LBQA 1LU2A 5CKMA 4QGLA 1E57A 3OGVA 4Q0SA 4DB5A 4ET7A 1Y43B 1H2NA 5AC93 3VZNA 5FZEA 1GSLA 3DYPA 4LHNA 4M01A 4EN6B 3FHAA 4HN1A 3PUAA 4FOVA 5FPUA 1MEC3 3GYDA 4CEYC 4AVTA 2A70A 4L8QA 1AJKA 3WCRA 1YQ2A 3CLPA 3VHNA 2WQ8A 2TNFA 4GJZA 4L11A 4IW3A 2BP6A 4HL0A 3N35A 4QDQA 4UF0A 1PHMA 2VVFA 3A0KA 5LASA 1OLME 3VD9A 1IPSA 3ACGA 4L92A 5A7SA 2ZGKA 3HD8B 3KCYA 4MUVA 1Q8QA 2BGCA 5FZGA 2XQXA 5J98B 5FWJA 2CGNA 3O7OA 1ODMA 4I3GA 1VAVA 4JQRA 4C1XA 1EAH2 5AC91 2YFZA 4HK9A 5FMOL 1ZA7A 3U1XA 5IK4A 1V70A 1WMEA 3E6BA 4JKLA 4OUMA 3LIGA 2DCYA 4XTMA 4AGGA 1MEC1 4IGPA 2P3KA 4EZHA 4CCLA 3DV8A 2HWE1 3RVHA 2VD7A 3RI9A 1HV1A 1XE0A 4O9EA 1QF3A 1QHDA 1UMZA 1VBD3 1DGLA 4IV1A 5IUQA 2RR12 1W0OA 3RRDA 5BNOC 1AR92 1LCLA 3KWVA 5D8AA 3AB0A 5FXVA 5HCAA 1NXMA 4LA3A 2JDZA 4QMAA 1XU1A 1RUG2 4D8MA 3HQXA 5F2WA 2GN3A 2CHHA 5K4LA 4LUKA 1QJFA 5FZ9A 4B4QA 1SBEA 3V0AB 4HXCA 4PIZA 5FPBA 5DAVA 5FJKA 2QDNA 1NZIA 1VRH2 1Q5OA 2OT7A 4N43B 3WQ7A 4QPGB 3VBRA 3W9AA 3AL5A 3BTXA 3LEGA 3T4VA 3WW3A 4I0AA 1H0BA 2GP3A 3ZXEA 1C28A 2E51A 1AXZA 4CCOA 5C8CB 2P3JA 2PAKA 1AZDA 2WINB 4ZS3A 1VBD1 5FOBB 5JPNB 3LKJA 1GZCA 1SHWB 1NYWA 3JQWA 3AVRA 3QCWA 4LIVA 1GP4A 2WRAA 1SMVA 4P5YA 4ES9A 3LE0A 3RJRA 2JB4A 4NIIA 5JZGC 3U14A 1I5ZA 1QQP3 5CKNA 2IXLA 2V5YA 4XFBA 4LE4A 4CA9A 3VD4A 1VPHA 5A1AA 2FMYA 3ZXFA 5KWRA 2H0BA 2W0XA 5KHJA 1SACA 3I3BA 2P37A 1OBNA 5F3IA 3AKQA 3WHTA 1Y9MA 4DY3A 1W8FA 1NA1B 5FQ0A 1SG3A 2IXCA 4LPLA 1CIYA 3PJQA 4ISRA 3MPBA 4BQ1A 1ZM1A 5IJRA 5DDJ3 4Q8KA 3I49A 1SDDB 3IM0A 3PNAA 1ND2C 2JG8B 1V6KA 3TYJA 3BI3A 4ASLA 1NT0A 3GBGA 4MGKE 1S0GA 1YUDA 1KJLA 2EXKA 3POEA 2EXHA 2GU9A 1KGYA 3PUSA 1RJ7A 4M3CB 1QQP1 3ZSJA 4P14A 2YC0A 2DURA 1QOOA 2ZBJA 4XACA 3ZLIA 3GGLA 3LCPA 1WLDA 2ZABA 3WUCA 4XFCA 1FPN3 4OI1A 4AL9A 2WLPA 1XJAA 2W3JA 4HBNA 1QY4A 4ATFA 2WT1A 3C3VA 2VCMA 2RJKA 2FDIA 3ZFGC 1ST8A 1DLCA 2VR4A 4AHYA 4HKOA 2TBVA 3ZYPA 4IDZA 3FLTA 2W87A 3W59A 5IVFA 2V4VA 2ZHMA 4UT5A 3U10A 4XFFA 4C1WA 1U5ZA 5FYTA 1T2XA 5F5CA 1VBB2 3SH4A 2ZS6B 3VBOC 4GH4C 4BCUA 3CEWA 5FZMA 4Y4YA 1MVQA 1VBE1 4WZCA 2XKPA 3H8OA 2RJ2A 2GC1A 4XFGA 1D0HA 3A0NA 3WG3A 4YLZA 3MV01 4KL1A 3KLSA 3POYA 1WLCA 4LK6A 5KC6A 1GZTA 2ADDA 1N47A 1HRV2 4ZPIA 2DWRA 4YW4A 3D0JA 2XBO2 4UBGA 4KG8A 1NCRA 2JDPA 2JDMA 3H1WA 5F39A 1RYYA 2GNTA 2XJVA 1S0JA 1RUD2 3NJYA 4XAAA 2OPKA 2X5IA 1I6XA 4CUBA 3T0BA 1OURA 1UU4A 2SBAA 2QTWB 3CIHA 3WDUA 3NAPA 4CEWA 5ABJB 1YIFA 3O1VA 3MIBA 5EJ1B 2XG3A 2PHTA 3THPA 3O1TA 4Q4W3 2VTXJ 3RG0A
chains in the Genus database with same CATH topology
2V4AA 3W21A 3MGUA 5DAVA 2RDQA 3KT4A 4NHYA 3GJBA 4KBZA 4ZONA 5L9BA 4XABA 5LA9A 4XCBA 3NNFA 2RDNA 5DAWA 2JIJA 4NAOA 5DAQA 4UWDA 4NMIA 4BQYA 3HQUA 4XC9A 5EQUA 5LATA 3NNJA 4NHKA 2HBTA 2JIGA 4Y5TA 5HV4A 3OUHA 2Y34A 5A3UA 4Q5OA 3W20A 3OUJA 5IATA 5L9VA 4NHMA 3KT1A 4BQXA 4XACA 3KT7A 5IAXA 2G19A 5LBEA 2RDRA 3ITQA 3GJAA 5EP9A 4MHRA 2HBUA 3EMRA 4IW3A 3HQRA 5DAXA 3GZEA 5LASA 5M0TA 4NHXA 2FCVA 2FCUA 3BVCA 3OUIA 3OBZA 5C5UA 2A1XA 5IAVA 2RG4A 4BQWA 5LB6A 4NHLA 3DKQA 2Y33A 4ZPIA 5LBBA 3PL0A 4Y5SA 5LBCA 3NNLA 4J25A 2FCTA 4XAAA 2OPWA 4MHUA 4XCAA 2G1MA 5DAPA 5EPAA 3NNMA 5L9RA 5C5TA 5HV0A 5LBFA 5ERLA 4JZRA 2RDSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V4A A;  3W21 A;  3MGU A;  5DAV A;  2RDQ A;  3KT4 A;  4NHY A;  3GJB A;  4KBZ A;  4ZON A;  5L9B A;  4XAB A;  5LA9 A;  4XCB A;  3NNF A;  2RDN A;  5DAW A;  2JIJ A;  4NAO A;  5DAQ A;  4UWD A;  4NMI A;  4BQY A;  3HQU A;  4XC9 A;  5EQU A;  5LAT A;  3NNJ A;  4NHK A;  2HBT A;  2JIG A;  4Y5T A;  5HV4 A;  3OUH A;  2Y34 A;  5A3U A;  4Q5O A;  3W20 A;  3OUJ A;  5IAT A;  5L9V A;  4NHM A;  3KT1 A;  4BQX A;  4XAC A;  3KT7 A;  5IAX A;  2G19 A;  5LBE A;  2RDR A;  3ITQ A;  3GJA A;  5EP9 A;  4MHR A;  2HBU A;  3EMR A;  4IW3 A;  3HQR A;  5DAX A;  3GZE A;  5LAS A;  5M0T A;  4NHX A;  2FCV A;  2FCU A;  3BVC A;  3OUI A;  3OBZ A;  5C5U A;  2A1X A;  5IAV A;  2RG4 A;  4BQW A;  5LB6 A;  4NHL A;  3DKQ A;  2Y33 A;  4ZPI A;  5LBB A;  3PL0 A;  4Y5S A;  5LBC A;  3NNL A;  4J25 A;  2FCT A;  4XAA A;  2OPW A;  4MHU A;  4XCA A;  2G1M A;  5DAP A;  5EPA A;  3NNM A;  5L9R A;  5C5T A;  5HV0 A;  5LBF A;  5ERL A;  4JZR A;  2RDS A; 
#chains in the Genus database with same CATH topology
 4FFI A;  3QOP A;  1PVC 3;  3GAL A;  3H8X A;  3NV2 A;  4HMZ A;  3K3N A;  5A6Q A;  1W04 A;  4AXO A;  3VL8 A;  5FUN A;  4ASK A;  1RUF 3;  2WII B;  2EIE A;  1IPJ A;  1V6O A;  2JEM A;  5C6C A;  3AYA A;  4AG4 A;  4CUG A;  1KQR A;  3OOX A;  2IC1 A;  1WWY A;  1S55 A;  5KR7 A;  3MZH A;  3PME A;  1NG0 A;  4N9H A;  4MO3 M;  2ZZQ A;  3KD4 A;  5JDB A;  1RUH 3;  5FPX A;  2OX0 A;  2RM2 3;  5FY0 A;  2OZJ A;  2D43 A;  2QQO A;  4TZD A;  1YFW A;  5FZK A;  4WVM B;  3QAC A;  2WQ4 A;  3ZOI A;  4Q4W 1;  3WIN E;  2WYF A;  5FP4 A;  5A3O A;  1PVC 1;  2VMG A;  1FNY A;  2IFR A;  4IXL A;  3AJY A;  4ITC A;  2D6L X;  2AAC A;  4BPZ A;  2FBE A;  3MLK A;  1WW4 A;  4FCA A;  3SLI A;  3GDB A;  3J7N A;  4XPV A;  1Q8O A;  5SV5 A;  4QKF A;  1XU2 A;  2JIG A;  2YBP A;  3GHN A;  2D5F A;  2PEL A;  4AAX A;  2QQI A;  4DEV A;  3MI8 A;  3UV9 A;  3BN6 A;  4OLL A;  1JYC A;  5FKC A;  4IL7 A;  3POS A;  4DMI A;  3MDP A;  5C3O A;  2YPD A;  4QGN A;  1ZRD A;  2JE9 A;  1SLT A;  5F5I A;  2VZO A;  3I2I A;  3OGG A;  1LGC A;  4IV3 B;  1RUH 1;  2GSY A;  2WSU A;  3W20 A;  3ZX7 A;  2O8O A;  2CWS A;  3HNB M;  3KS7 A;  5LW9 A;  4LUL A;  1W6M B;  1AX1 A;  2ZPX A;  3NV3 A;  2VNG A;  3MPP G;  1BEV 3;  5FBJ A;  5J7M A;  3BTY A;  1UX7 A;  1CJP A;  2D5H A;  5IAX A;  1VMH A;  1QMJ A;  2VU9 A;  1LHN A;  1G9D A;  4Q0Q A;  4WVZ A;  4LHK A;  4D69 A;  2UWA A;  3OSD A;  5ACA 2;  2ZGR A;  5FP8 A;  2R7E B;  1AVB A;  4QX5 A;  2GC3 A;  3H7J A;  2P34 A;  2WSV A;  3K77 A;  1JHJ A;  2B9V A;  4MHR A;  4NOT A;  4W4Z A;  4AHX A;  1C8N A;  2VUD A;  5BXX A;  1O59 A;  2ETE A;  4CDU A;  5FPV A;  3EYP A;  4FSJ A;  5FQ0 B;  2IXJ A;  1AJO A;  2P2K A;  2V73 A;  2YRO A;  3N9Q A;  1HB1 A;  4OI4 A;  4UYB A;  4BLI A;  2B45 X;  1QJX 1;  1ZBA 2;  1ZZ6 A;  4K6B A;  1OKO A;  1SFN A;  2OW4 A;  2A6W A;  1BEV 1;  4P08 A;  4QPY A;  2ZEW A;  4J1X A;  1A8M A;  1GR3 A;  1V6L A;  1ZZB A;  3W58 A;  3O5S A;  2JG9 C;  2P6C A;  2VTX A;  2RG4 A;  3V64 A;  4QAW A;  3N36 A;  2VG9 A;  5JCT A;  1GQH A;  4FPL A;  4CU8 A;  4MSV A;  3D3A A;  4AFB A;  3LB9 A;  1OOP A;  1FI2 A;  3JXS A;  5FOJ B;  4NO4 A;  3ZN4 A;  1GAN A;  4FP2 A;  2J1E A;  2K2S A;  3RNS A;  4IE6 A;  1ZYB A;  2FDF A;  1RL3 A;  1TZO A;  4BQ5 A;  3O1O A;  4FTS A;  4FPF A;  1RUJ 3;  4J25 A;  3ZSM A;  2YHJ A;  3K3O A;  1AUY A;  4EN7 B;  3ASI A;  3POW A;  2E26 A;  3NNM A;  2LW8 A;  1UX6 A;  2Y6H A;  5L9R A;  4PDW A;  3AXD A;  2XL9 A;  3PU3 A;  2EXI A;  3WNL A;  4CUA A;  5JSR A;  5DUU A;  3A22 A;  3K75 B;  3Q8C A;  4K8F A;  5K0U B;  4OZO A;  2Q1F A;  4CRQ A;  2W39 A;  4JGY C;  3V0B A;  1PK6 C;  2DVF A;  4BWO A;  5LEJ A;  1PIV 3;  1W90 A;  4BU2 A;  5CKQ A;  1WKY A;  1YEW A;  3U0Z A;  4E2Q A;  1BMV 1;  1R09 2;  2B5H A;  3WDT A;  1RMU 3;  4QB2 A;  3LA2 A;  5BNN C;  5CAZ A;  2HWB 2;  4LQR A;  5E8A A;  4R4X A;  5A33 B;  2P3I A;  1RUJ 1;  3CJI B;  4GB3 2;  5FY5 A;  5F37 A;  1CJD A;  1NCR B;  3D5O A;  2VOV A;  4YGD A;  5IK7 A;  1ULO A;  4QHZ A;  3BTZ A;  1AR8 2;  2WO7 A;  1VMF A;  3MLL A;  3P5B A;  2NYY A;  4X8N A;  1NCQ A;  2X5I B;  2VZ1 A;  1ULD A;  3NAP B;  3UGG A;  5GZC A;  4XJU A;  5T55 A;  4LOS A;  4LOR A;  3MUY 1;  1PIV 1;  3UKN A;  2VQU A;  1NKG A;  4IE4 A;  1QJZ A;  2ZGM A;  4ZU7 A;  4A6O A;  1OI6 A;  4BDV B;  1C5I A;  1UY3 A;  2PQQ A;  2RVA A;  3HOB A;  2HWD 2;  4NIA A;  4RS5 A;  3PVO A;  4MLO A;  4CDQ A;  5LWB A;  1T6B X;  2G9Z A;  3NW4 A;  1LGN A;  2XJQ A;  4GMP 3;  4NE9 A;  1D4M 3;  1ZBE 3;  2WLQ A;  4AVV A;  3ENR A;  2HWC 2;  1DQ5 A;  4ATE A;  5JI7 A;  1Z7S 3;  2J1S A;  3ETQ A;  2W92 A;  3INA A;  3KT7 A;  1W2O A;  2D93 A;  1WMF A;  2ZJC A;  3OY8 B;  2QDR A;  1JZ4 A;  1O91 A;  3MFA A;  4GMP 0;  1HN0 A;  2C9A A;  3U75 A;  4XBL A;  3RWN A;  2OXB A;  4RQP A;  1Z78 A;  3HAG A;  4LKE A;  3ZO0 B;  4AQ2 A;  4HLT A;  2WAB A;  2PHX A;  5FPA A;  4O7X A;  2VC9 A;  3RSJ A;  4A41 A;  3VBF C;  2Y38 A;  3ZSL A;  3OPW A;  1FX5 A;  2R06 2;  2B9U A;  1H8T C;  3AL6 A;  3QBQ A;  2J1R A;  4R9A A;  1DQ0 A;  4WM8 C;  2QQW A;  1D4M 1;  1ZBE 1;  4LO8 A;  3VBH C;  5GAL A;  3MF9 A;  5DUV A;  2FCU A;  1EP0 A;  3LQC A;  4CPB A;  5K7P A;  5DXD A;  5T5L A;  1QNW A;  5T3N A;  1Z7S 1;  4LTA A;  2JDY A;  2QQM A;  1DQ1 A;  2CAU A;  3H0O A;  5A80 A;  1R1A 2;  2B46 X;  3NV1 A;  4QQL A;  2RMU 3;  2VBP A;  3SIS A;  2IVJ A;  3H8R A;  4FPG A;  4X6Q B;  1AL0 G;  5LA2 A;  3JQX A;  4AVB A;  2Y33 A;  3TOJ A;  4IES A;  1JUI A;  1W2N A;  1JI6 A;  2O1Q A;  2P1B A;  4CEY A;  2B39 A;  1S4C A;  3PUQ A;  1MZ5 A;  4LO7 A;  4FOQ A;  4K40 A;  3VKO A;  4AR2 A;  4Q4Y 2;  3WQB A;  4M3C E;  1LNS A;  2UY8 A;  2AZ5 A;  3QH6 A;  1DHK B;  1AYN 2;  1PM4 A;  1QJE A;  2VZS A;  4GWN A;  2VCA A;  4MXW A;  4SBV A;  2HWF 2;  4CCC A;  3AM2 A;  1MS9 A;  4RR3 B;  3N3H A;  4AI8 A;  4YM3 A;  2K46 A;  4HFS A;  1HRI 2;  2Q8D A;  3L9J T;  4BME A;  1SPP A;  3ELN A;  3FC0 A;  1GFF 2;  1LB2 A;  1NXD 1;  4FFH A;  4AI9 A;  4PLM A;  3FFQ A;  1JHN A;  3WHU A;  3G7D A;  1RVF 2;  1W6Q A;  2C6S A;  2YBS A;  2RMU 1;  4I0B A;  1MQT C;  3Q8B A;  4C90 A;  2A5Z A;  4Z07 A;  4Q0U A;  3NJV A;  4GA9 A;  3J7H A;  5A7W A;  2YZ4 A;  3IMM A;  3S5A A;  2FQP A;  4M0N A;  1XXN A;  4TXW A;  3A4U A;  4M4P A;  3T0A A;  1HX6 A;  4P00 B;  4TN7 A;  3B3Q E;  4Y4R A;  4PHZ A;  5C8W A;  5HXV A;  1BK1 A;  1IS4 A;  4COZ A;  5BNO A;  4AE2 A;  1CES A;  4E4H A;  4KH9 A;  4LBN A;  2NPI A;  4NRM A;  4UWD A;  5FDB A;  1KFU L;  4WVW A;  3HVD A;  3J8F 2;  4BQY A;  3PIJ A;  1O7F A;  4CCN A;  1NQJ A;  5FBZ A;  4E8C A;  3ZYG A;  3E97 A;  1AR6 3;  2HEV F;  5FK8 A;  3WDY A;  4CCJ A;  2EAK A;  3FE5 A;  1UMH A;  4Q26 A;  2X8K A;  4BIO A;  3FWE A;  4FQ4 A;  4EN0 A;  5J36 A;  1AL2 2;  1K12 A;  3ECQ A;  5FMC A;  3WDV A;  3VV1 A;  4YVW C;  1HB2 A;  3PUR A;  4DXS A;  3IAQ A;  4CP1 A;  1OQD A;  4AI0 A;  3VZL A;  1PO2 3;  2R0H A;  2Y34 A;  2GNM A;  1X50 A;  5B2G B;  1ULG A;  4DIN B;  1LTE A;  1S2B A;  1V6J A;  4CCK A;  1QOT A;  3WNO A;  2BJS A;  4WBB A;  3KF5 A;  1PNF A;  3IWZ A;  1VAM A;  5D1I A;  5JZG A;  5L9V A;  1C8M 3;  1XE7 A;  5FMO S;  4Q0V A;  1XNT A;  2WZP P;  4HK8 A;  4A7K A;  2TEP A;  3KV6 A;  4UBH A;  3JD7 2;  1BJQ A;  4DRR A;  2JDH A;  1JYV A;  1DGW A;  1GNH A;  2WC2 A;  1I9R A;  1AR6 1;  1FMD 3;  1WCU A;  4DQA A;  1NUK A;  4Y5Z 0;  1EV1 2;  3AVS A;  3IZO A;  4S2H A;  1CVN A;  3SCF A;  4Y24 A;  3UJO A;  4EQV A;  3O0W A;  4XXA A;  3LIH A;  3LGR A;  4Y1Y A;  1R08 2;  1CR7 A;  3X29 B;  1AX0 A;  1JZ7 A;  1OVP A;  1XPW A;  4RN5 A;  2JX9 A;  1C3H A;  2PYT A;  1COV 2;  4N8M A;  2WZE A;  4EWD A;  1PO2 1;  1ZRR A;  1ND2 A;  1O4Y A;  5FYB A;  2QBX A;  3HQR A;  4Q4X 3;  4QX3 A;  4OQ8 A;  4UOJ A;  2W1S A;  3B94 A;  5DAB A;  5HXM A;  2H6B A;  4PI2 A;  1C8M 1;  3H50 A;  1X9T A;  2GN7 A;  4N7I A;  1YCI A;  2WKK A;  5A70 A;  1UPS A;  5BYN A;  1D0G A;  1FMD 1;  4R9D A;  4BQW A;  3MO4 A;  1NE4 A;  4YG3 A;  1J3P A;  2CSG A;  5GLT A;  1TG7 A;  1NOV A;  4KU7 A;  1REF A;  2ILM A;  3H3L A;  5LBB A;  2FDH A;  1ULP A;  3NJZ A;  3ZXL A;  1OLR A;  3VBS C;  4OI0 A;  3ES1 A;  4WVV A;  4Q4X 1;  1EYB A;  4FQZ A;  5EWS A;  4LKF A;  1UZV A;  4RSU A;  2IXI A;  3PMS A;  1Q56 A;  4XCA A;  2W1Q A;  1WGP A;  4K1Y A;  4XAE A;  2RHP A;  5CFC C;  2WDB A;  3PVN A;  2DUP A;  3KHB A;  4RL7 A;  1BQP A;  4GH4 A;  3M3E A;  4HPK A;  3IPV A;  1K5M C;  3VBO A;  4A2U A;  1V6I A;  1S2K A;  4ZZ5 A;  1W6P B;  3HNM A;  1BXH A;  2QQP A;  2RDQ A;  4NHY A;  3I2J A;  3WEZ A;  4QHB A;  4ZON A;  1AX2 A;  5G04 L;  4DXR A;  1OHF A;  2SLI A;  3FMG A;  1CN1 A;  3VZK A;  3AYD A;  3N7K A;  2PN5 A;  4V2W A;  3USS A;  2LRO A;  1J59 A;  1FV3 A;  4JAA A;  5A3W A;  5FZC A;  1EAH 3;  1W8N A;  3AP6 A;  4OHW A;  2ZCW A;  4RHV 2;  3OBR A;  4QXH A;  1PGL 2;  3KV5 A;  4B8E A;  2A6X A;  3O1S A;  4URA A;  5J96 B;  4Z92 B;  2GC2 A;  3FLR A;  4OFG A;  1O8P A;  2XJS A;  2ZEX A;  2XOM A;  2WS9 2;  5FP9 A;  1SPP B;  4NPM A;  3WP6 A;  2VME A;  2RR1 3;  4W65 A;  2R32 A;  4JDM A;  1AR9 3;  4XF1 A;  3WF0 A;  2VZR A;  2WZR 3;  1UN1 A;  3A23 A;  1DQ6 A;  1RUG 3;  2ZGO A;  4LE3 A;  5DMY A;  3GM8 A;  4FVV A;  5BNP C;  4LBL A;  3HWJ A;  5A7W B;  5GJ6 A;  4BE3 A;  4K8R B;  4XUN A;  5A3U A;  2VOW A;  3H7Y A;  3H42 B;  1KRI A;  4W6Y A;  4DFS A;  4KNC A;  3BUC A;  3N9N A;  5JOX A;  2QNK A;  1VRH 3;  3UES A;  4CU9 A;  3O14 A;  2XUE A;  3SCG A;  1CAU A;  5BNO B;  4D7Y A;  2EIC A;  2BW8 A;  4Q4V 1;  4CU6 A;  3K4A A;  5FLI A;  4B7E A;  1JXN A;  2C5D A;  3OBT A;  1X8M A;  4CP9 A;  1CAV B;  1Q3E A;  3O1M A;  1N1V A;  2RR1 1;  4FTB A;  1PM7 A;  1AR9 1;  2FZ1 A;  2A75 A;  1N3Q A;  1QJY 2;  3M3O A;  4FP3 A;  2PHL A;  2WZR 1;  1TNR A;  4CXW A;  5C4W B;  3WG2 A;  2NLR A;  4E8D A;  4BXS V;  4P9J A;  4UI9 L;  3KCC A;  4RA0 A;  2PLV 2;  5A7N A;  3ZN6 A;  3WDX A;  2BOJ A;  5K8S A;  3HT1 A;  2UU8 A;  3L2H A;  2XLF A;  4DXZ A;  2O14 A;  1B35 C;  1O6U A;  1OUX A;  3SXW A;  3O1U A;  4XJ8 A;  1UXZ A;  2W2I A;  4NHX A;  2P3Y A;  4EN9 B;  4AAP A;  3K2O A;  2CTV A;  5JXH A;  1VP6 A;  4BHP A;  5G05 L;  1S0F A;  1YJK A;  2ERF A;  1W3X A;  5DUW A;  2MEV 2;  4NAM A;  5LCW L;  2A1X A;  1CWP A;  4Y1V A;  3EHK A;  3D82 A;  5IAV A;  4LHS A;  1STM A;  3ZPY A;  4CCD A;  2VXR A;  5GZE A;  3DKQ A;  5JI9 A;  3U07 A;  3DXT A;  4QU2 A;  4QPI C;  4K3U A;  3RMX A;  3RZJ A;  4LUM A;  3PL0 A;  4IE7 A;  1FOD 2;  2Y6J A;  3ATG A;  4KQ7 A;  3OYW A;  4Y5S A;  5JXG A;  1KD7 A;  4R4Z A;  2CGP A;  4FPC A;  4M4R A;  4IEY A;  4XFH A;  3TRS B;  2ZX2 A;  1O8S A;  1WW7 A;  3OJB A;  4LO6 B;  1XQN A;  4MHU A;  1N1Y A;  3ZYB A;  4DIQ A;  2NMO A;  5EPA A;  1HQW A;  3ZFF C;  1J1L A;  4CTE A;  1AXY A;  4ASM B;  2RS3 1;  1N1S A;  4AQT A;  4YGB A;  2AC1 A;  2WFF 3;  1G9B A;  5FZ1 A;  2QFE A;  2V4A A;  1UYX A;  2UWB A;  1DDL A;  1YFU A;  2D44 A;  4A45 A;  4UAP A;  5J37 A;  2EID A;  3BCW A;  3DYM A;  2JB8 A;  1CPN A;  1GNY A;  2JG9 A;  2VW0 A;  3HN1 A;  4KBZ A;  4A7Z A;  1UZY A;  4BB3 A;  1W03 A;  2VGD A;  5LA9 A;  2Z4F A;  1VBA 3;  3AYE A;  5DN2 A;  4JGZ B;  3DL3 A;  2VZ3 A;  4QPW A;  1JZ8 A;  3S7E A;  5GZG A;  1VBB 3;  5T50 A;  5CFD B;  2YG0 A;  1H30 A;  5L7O C;  4F8A A;  1Y9Q A;  2MHF A;  3AMN A;  2HKX A;  3IMN A;  3W5N A;  3RYR A;  3ZFG B;  4BZ4 A;  3NRU A;  3VD7 A;  1H9W A;  2I74 A;  3WNN A;  4BQ2 A;  5ISL A;  4W8J A;  4N53 B;  3V56 A;  1DZR A;  3USU A;  2WFF 1;  1BKZ A;  3DPR C;  1AF9 A;  1HRV 3;  3MUZ 1;  5JIA A;  2XBO 3;  4LEJ A;  1RHI 2;  4LBK A;  1RUE 2;  1XND A;  4HAN A;  4C0H A;  5A6X A;  2BFU L;  2DVD A;  3GCW A;  1L7Q A;  4JGY A;  1FAY A;  1CAW B;  1PK6 A;  3ILR A;  1RUD 3;  1QJU 2;  3IBM A;  2YU1 A;  1VBA 1;  3P3P A;  2Z79 A;  5LK5 A;  1PMI A;  1M4W A;  4XFA A;  1VBB 1;  4YYO A;  4QM9 A;  3MLJ A;  4XTP A;  3WV6 A;  1F4H A;  4OMD A;  5D2A A;  3ZMN A;  4CP2 A;  2VMF A;  1W9F A;  2OZ6 A;  4P9I A;  4M0H A;  1UZW A;  4GUL A;  4WM7 B;  4XZU G;  4E2G A;  5BNN A;  5FZA A;  1JUH A;  1OF3 A;  3EO6 A;  2UYB A;  1WA6 X;  3S6P A;  4C91 A;  4XUO A;  1PGW 1;  4CU7 A;  1CZT A;  4AW7 A;  3SEP A;  4URT A;  3ETP A;  3AX4 A;  1WD4 A;  4YZ1 A;  2CAV A;  1LU1 A;  1TMF 2;  5FZF A;  3VLB B;  2XBO 1;  2QQV A;  1GKB A;  1ODN A;  4OUE A;  3SMH A;  3ZPO A;  3AKS A;  4MGQ A;  4P5H A;  4X8P A;  3ZIX A;  4SLI A;  1RUD 1;  3RZZ A;  1W6O A;  1ULC A;  3T1M A;  1HV0 A;  1LR5 A;  1ULE A;  4IGQ A;  5H9S A;  4MV2 A;  3ZDV A;  2UUR A;  4GIQ A;  1BBT 2;  1PX3 A;  5LA1 A;  2ORX A;  2CWM A;  4JV4 A;  1WMX A;  3CZJ A;  2XJU A;  3MHZ A;  2QJV A;  1SDW A;  2WAA A;  3IKW A;  4JC1 A;  5I8Y A;  2GAU A;  2YY1 A;  4XDO A;  2ARB A;  2EXJ A;  4RGG A;  3OF1 A;  5E16 A;  2ZHK A;  5KXD A;  4NWV A;  3UL2 A;  5SV8 A;  2EIB A;  2VY0 A;  2R6Q A;  1US3 A;  3SH3 A;  2VL4 A;  1DGW X;  4IEV A;  2BGP A;  4YW5 A;  1QXJ A;  3VZO A;  3E5X A;  1SLC A;  2X10 A;  3LSE A;  3WNK A;  1RED A;  2LUW A;  2XKO A;  1XNB A;  3CO2 A;  4BIF A;  2AH2 A;  1QGL A;  5EYY A;  5IWF A;  4CP9 B;  1OD3 A;  2PHW A;  3POJ A;  4UW5 A;  5DDJ 1;  1PNG A;  4S2D A;  5EJZ B;  2XR4 A;  3AMH A;  2XUM A;  1REE A;  1XC6 A;  3QH7 A;  4DO0 A;  4MZU A;  1ND3 B;  2VM9 A;  1GWK A;  2ZA9 A;  1WCS A;  3EJK A;  2BGO A;  5A32 B;  4FFF A;  3VBF A;  2HWE 2;  4WM8 A;  1H8T A;  3ZN6 B;  2DFB A;  3VBH A;  2IWG B;  3ZFE B;  5CA6 A;  5HI0 A;  4OUL A;  2OVU A;  4CXX A;  2WQZ C;  3K51 A;  1DG6 A;  4XBN A;  5K9Y A;  1W28 A;  5C9A C;  1HB4 A;  2ARX A;  4E4Z A;  4NIG A;  1FPN 1;  3A7Q A;  4LBQ B;  4KG0 A;  3THC A;  5I93 A;  3GJB A;  2BRT A;  1UY2 A;  2D98 A;  4JCK A;  4AI1 A;  1JOB A;  2WN3 A;  4XJA A;  3UNP A;  3B9C A;  5FPZ A;  2EVX A;  3CDZ B;  5FZO A;  3A21 A;  4AI2 A;  3CBN A;  1ZBA 3;  1JYT A;  3EBR A;  1ASJ 2;  1LKN A;  5FO9 B;  1OA4 A;  3S30 A;  4QKN A;  2QE3 A;  5A1L A;  5EJ3 A;  2QVS B;  1BYH A;  4Y1X A;  4OCT A;  2BTV C;  5A3T A;  4MXV A;  5T52 A;  3MYX A;  3Q8E A;  3MBW A;  4P9G A;  4QPG C;  4DS0 A;  2WFP A;  3AZV A;  3LEK A;  5FZH A;  4CE8 A;  4XW3 A;  2FMD A;  1WW5 A;  4G4F A;  2VNO A;  1OT5 A;  5I0T A;  4FI9 A;  2ZGS A;  4PIY A;  3GZU C;  5CG8 A;  5F1R A;  1RUI 3;  4OI2 A;  2XJP A;  4NHK A;  4UW6 A;  2A7A A;  1MQT A;  3ALQ A;  3LEI A;  1P8J A;  1XNK A;  2WNU A;  3GF6 A;  5E1R A;  3IB3 A;  5FYV A;  4HOO A;  1DQ2 A;  3UYJ A;  4Y5T A;  5I0D A;  2ZGP A;  5FR3 A;  4ZS2 A;  1QDC A;  3VL9 A;  1XRU A;  2BWA A;  1LGB A;  4JHZ A;  2VZP A;  2W52 A;  1V9U 2;  5F6K A;  2HJI A;  3CL1 A;  3M8L A;  4GWM A;  4TSV A;  4XF9 A;  5FY1 A;  3ZYR A;  2R04 2;  2ZAA A;  1PMJ X;  2BWC A;  3BGA A;  4IV1 B;  1US2 A;  5GZF A;  3K4Z A;  1H1A A;  1RXG A;  2VMC A;  5D8A B;  2XLA A;  4I2O A;  3PVE A;  1ZRI A;  3J9S A;  4XHB A;  1R09 3;  3J7M A;  4DPN A;  3ITQ A;  2JG8 C;  2PTM A;  2HWB 3;  1G7Y A;  2VO5 A;  4LO5 B;  2D3S A;  2ZXQ A;  5B4X A;  1RUI 1;  1RUF 1;  4DUX A;  3D4K A;  2XON A;  5JOY A;  1E5I A;  3WCS A;  4DY5 A;  3ABZ A;  3IT8 A;  4GKY A;  3C7H A;  1AR8 3;  2RS5 2;  2WT0 A;  4YVW A;  4JVA A;  4XUR A;  3VBR B;  2D6O X;  1GU3 A;  1SCS A;  3HT2 A;  2E33 A;  3WR0 A;  4YW3 A;  1JYW A;  2OQ7 A;  2DDU A;  1OLM A;  3VBU C;  3I54 A;  3ZYH A;  4HSL A;  3M3Q A;  3RFR A;  2RM2 1;  5FV3 A;  5BNN B;  3BVC A;  4AEK A;  4D6R A;  2ORZ A;  1GNZ A;  5JIU A;  3OPZ A;  2ZMN A;  4TLG A;  1R09 1;  4K20 A;  3NL1 A;  2DVB A;  4XBQ A;  2PQS A;  4CZS A;  3H3Z A;  2HWB 1;  2NMN A;  3M7A A;  2Y60 A;  3WSO A;  4HET A;  1VBE 2;  5GLZ A;  3FUQ A;  1CZV A;  2HEW F;  3ZSE A;  1QEX A;  3ZXK A;  3ZXA C;  1AR8 1;  1F5F A;  3MID A;  5FUP A;  5JAX A;  1LHW A;  2WNE A;  2ZX4 A;  2VVD A;  3NWK A;  1EPZ A;  4I09 A;  1Q8V A;  1GOF A;  4MET A;  2JJ6 A;  1WD3 A;  3KCX A;  4BOW A;  1AR7 2;  2NZ9 A;  2Z69 A;  4ERO A;  1ZZ8 A;  2E7Q A;  1DIW A;  1MS1 A;  4LLF A;  4JTO A;  2JEN A;  1A6C A;  1VE0 A;  2AEY A;  3ES4 A;  1GWL A;  1JYN A;  3MEP A;  4KI5 M;  1UAI A;  3MIG A;  2VNR A;  2XWJ B;  4IEW A;  4XJW A;  1X8E A;  2R06 3;  1TVG A;  2VJX A;  1G9C A;  1KIT A;  1RIT A;  1W9S A;  5ABJ C;  2DVG A;  5LZ6 A;  4QB6 A;  3ST7 A;  3HJR A;  3VZJ A;  2PHU A;  2ZAH A;  5DAQ A;  2YGM A;  1F9K A;  2RV9 A;  1MS8 A;  1DU3 D;  1QWR A;  3VBS A;  3VUO A;  3UGF A;  3TEY A;  1LES A;  1R1A 3;  4LT5 A;  2ARE A;  3I97 A;  3F95 A;  1RTV A;  5C71 A;  3RZG A;  2LM3 A;  4R52 A;  5CFC A;  1L3J A;  5BNQ A;  4COY A;  1YQ6 A;  4IER A;  4LBQ D;  1MAC A;  3ZVX A;  4XC9 A;  1H8T B;  1HQL A;  1DGR N;  1K5M A;  3T1L A;  4GAL A;  4B1L A;  3VBH B;  3CJX A;  4Q4Y 3;  1FXZ A;  5J48 A;  3DEM A;  2GAL A;  1UOJ A;  1AYN 3;  1CX4 A;  1J3Q A;  1DQ4 A;  1XB9 A;  2XQR A;  2YUE A;  3EXU A;  2HWF 3;  4H2A A;  3MW3 A;  2R06 1;  4OZX A;  2OA2 A;  5IVB A;  4LOT A;  3AZW A;  5IVC A;  5FO7 B;  3M2M A;  1JW6 A;  3QD6 A;  4TLF A;  3ZYF A;  4Y20 A;  4H14 A;  4RYD A;  3B00 A;  4V1P A;  4LJH A;  4CCE A;  2JWP A;  3AP9 A;  4A6S A;  3DEC A;  3E1F 1;  3THD A;  1R1A 1;  1RVF 3;  1WCD J;  5LK7 B;  1W8T A;  3LDR A;  2HEY F;  3KQ4 B;  1H4G A;  5FZ6 A;  4BQX A;  1VB4 A;  1MS5 A;  2JE7 A;  4GAZ A;  1L7L A;  4Y22 A;  3VKF C;  1M06 G;  2L9L A;  1RUH 2;  2VVE A;  3KZ4 C;  2C1F A;  4AGV A;  2ZGL A;  1BZW A;  1YI9 A;  1JMU B;  1ZNP A;  3D8C A;  4PF1 A;  4CEW B;  4CP0 A;  1RIR A;  1AYN 1;  1UD1 A;  3HBZ A;  2BYV E;  1RGS A;  2HWF 1;  4IV3 C;  5GZD A;  1DCS A;  4DNY A;  4PIX A;  5F8P A;  4AF9 A;  1LED A;  5JUV A;  3WP5 A;  3J8F 3;  2AEN A;  2D40 A;  1W2T A;  3AKR A;  2D97 A;  1MQT B;  1RMU 1;  3Q9O A;  4AFD A;  4QX1 A;  4XZP A;  3NQH A;  1UCX A;  1UW8 A;  4KWK A;  5BNP A;  2FDG A;  2WWJ A;  5DAX A;  5KXE A;  1LHU A;  1Q43 A;  3RZH A;  4GWJ A;  1RVF 1;  1YQ8 A;  2OS2 A;  2WBK A;  1W0N A;  5A1F A;  1UO9 A;  5M0T A;  5A3M A;  4DEQ A;  1LEM A;  4UW3 A;  2VZV A;  2P5B A;  1AL2 3;  1UYZ A;  3MIE A;  3SKJ E;  1PX4 A;  5F9T A;  1QJX 2;  2VBD A;  5FO8 B;  1NX9 A;  4NPL A;  4Z82 A;  3NNG A;  4H7L A;  2IUW A;  4AZZ A;  4LKS A;  3ILF A;  4YGE A;  3VDD C;  1SLB A;  5FP3 A;  3VDC A;  1UOF A;  5EZW A;  3J26 N;  3VGI A;  3CMG A;  5LEK A;  4XIO A;  3P6B A;  3S7I A;  3C8X A;  1Z0H A;  1KJR A;  3WF2 A;  1I5P A;  2Y0I A;  2ZAC A;  2QZ2 A;  5LBC A;  4JTN A;  3JD7 3;  1UU6 A;  3J4U H;  2OUH A;  1UF2 C;  1VBC 2;  2TUN A;  1EV1 3;  4GMP 1;  3E6D A;  1B35 A;  4LXL A;  4ZKT B;  1YNA A;  2C0Z A;  2W5F A;  4JZR A;  1H6X A;  3JCI A;  4NIH A;  1R08 3;  1UU5 A;  3ZM8 A;  1TQ5 A;  4YM1 A;  4LHL A;  5FXW A;  1HJF A;  5C3Q A;  3BU0 A;  1COV 3;  4V2V A;  4PQ9 A;  1U12 A;  2WO1 A;  4MGS A;  5JMC A;  4CDX C;  1S0I A;  3MF6 A;  3VB9 A;  5FZD A;  2JIC A;  4KWJ A;  3L2Y A;  1O4Z A;  4L9B A;  5C3R A;  1U5X A;  3AYC A;  4QPI A;  2Q8O A;  3C7G A;  4F83 A;  4AVS A;  2V5D A;  1MR5 A;  3B01 A;  2XL7 A;  1ZZ7 A;  2Q5T A;  4ISQ A;  3JD7 1;  5K0U C;  1EY2 A;  1J58 A;  4NUB A;  2FDK A;  4ZXK A;  5FY8 A;  4Q27 A;  4CDU B;  4D6Q A;  1EV1 1;  2YMZ A;  1CAX A;  5IHR A;  4NMI A;  2W47 A;  1H8V A;  5FYI A;  3ZFF A;  1FV2 A;  4MVT A;  2BVV A;  4XJZ A;  5FY9 A;  1NQD A;  2UYA A;  3DF0 A;  4Z2A A;  4FXK B;  3WP3 A;  3I7D A;  4YVS C;  1COV 1;  4LIT A;  1JH5 A;  3CJI C;  1BK0 A;  2J22 A;  2JKB A;  2WNU C;  2C24 A;  1LOF C;  4FO9 A;  4O65 A;  1SZB A;  1RUC 2;  2YYO A;  3IDC B;  3KMH A;  1AXK A;  2Y0O A;  5CG9 A;  2W08 A;  1OQE A;  1POV 3;  2DFC A;  1JZ3 A;  2VQT A;  5L7O A;  2ARC A;  1GMM A;  1OOP B;  3Q8A A;  4JQT A;  1X7N A;  1JU3 A;  3CKH A;  4OHV A;  1A8D A;  5FUI A;  3U37 A;  4UF0 B;  1GUI A;  3GXU A;  4R9C A;  2A6V A;  2JDA A;  4NHM A;  2D6P A;  1CPM A;  2ES3 A;  2BBV A;  1POV 0;  4UW4 A;  3T2Q A;  1MZ6 A;  2G19 A;  3DPR A;  1EUU A;  1O3S A;  4QQH A;  4PDW B;  5JXI A;  2BU9 A;  1JYX A;  3R4U A;  1NY7 2;  3THT A;  1HIX A;  1UKG A;  1C1F A;  4HKL A;  4BXF A;  5FYZ A;  3GJA A;  1HJG A;  4QX0 A;  1S0D A;  2VOK A;  1JU4 A;  3GCX A;  1DF0 A;  1LOE A;  4RHV 3;  2Y6G A;  5F32 A;  3SKV A;  5LRS A;  4JDO A;  3V0B B;  3TAY A;  2B42 B;  1POV 1;  4N9I A;  4NR1 A;  5AFB A;  4NRO A;  1JS9 A;  4TYS A;  2XGX A;  3UJQ A;  3QLQ A;  3O0X A;  4MGI E;  3K46 A;  2A3W A;  4RGA A;  2WS9 3;  2VZU A;  1IPK A;  5HCB A;  3ILN A;  3BYW A;  3H8U A;  2KR2 A;  3ACI A;  2R07 3;  3RDI A;  1RC6 A;  2AUY A;  4S2G A;  4OHX A;  4W6W A;  3VKM A;  5LRR A;  4BIS A;  3E5Q A;  4AVC A;  1F8V A;  5BUV A;  1YFY A;  3JBG 2;  3B7M A;  1D4M 2;  3ORJ A;  5T5O A;  4DXT A;  1ENR A;  4MG2 A;  4LA2 A;  4NHL A;  1NCQ B;  5FRE A;  2ZZJ A;  1Y7B A;  1R1Z A;  2GND A;  4XDQ A;  1I1E A;  4Y26 A;  4RHV 1;  3OGS A;  5FYS A;  4ZU5 A;  4QKD A;  3S57 A;  2P17 A;  3LPF A;  2VZQ A;  2WYS A;  1ZVF A;  1G6N A;  2FCT A;  2WUH A;  2WS9 1;  5ANQ A;  4QQO A;  1OSG A;  2G1M A;  2JD9 A;  5JOZ A;  4EZ4 A;  1OPO A;  2LRP A;  1VAK A;  2R07 1;  4H3W A;  1Q8S A;  4RS5 B;  5I0U A;  3VHR A;  2BFU S;  4CDQ B;  2UWC A;  3ROU A;  4YZ2 A;  2GZW A;  2WA3 A;  5C3P A;  3NVC A;  5E88 A;  4ES8 A;  3KT4 A;  5DZE A;  2PLV 3;  1Y4W A;  5E6H A;  1SCR A;  1TME 2;  4YM0 A;  3ZMO A;  1O3Q A;  2GMP A;  2OII A;  2Z5W A;  3N9P A;  2YB7 A;  4RR3 C;  3I2F A;  5CEH A;  1RJ8 A;  1GQG A;  4DZG A;  4FPE A;  4XMI A;  2JIJ A;  1SBF A;  1D2Q A;  3PJY A;  1WMD A;  2VXJ A;  3TN9 2;  4RQP B;  3K48 A;  2MEV 3;  4RGK A;  3S5Q A;  1T6G C;  1C4R A;  4COU A;  1YQC A;  3VN4 A;  1DYK A;  5A7Q A;  4K1Z A;  3ZSK A;  2H0V A;  2F6B A;  2VCC A;  2X29 A;  3WW4 A;  3HQU A;  4XVH A;  5FAX A;  4FPY A;  1OA3 A;  4QD2 A;  1SLI A;  5FZ4 A;  2V09 A;  4A44 A;  5C9A A;  2PLV 1;  1LOA A;  2IXH A;  2BPA 2;  2X53 S;  4XQD A;  3AXE A;  1YJL A;  4NVP A;  4COW A;  2DCT A;  3FL7 A;  4QDR A;  3BU7 A;  2ZKL A;  4QXC A;  3ZR5 A;  4CCM A;  4JKM A;  5DZG A;  4PQQ A;  2G4I A;  2ADE A;  4H7M A;  3V0A A;  2MEV 1;  4QPI B;  4CEY B;  4YW6 A;  4G3Y C;  2DUQ A;  3OUJ A;  5IAT A;  3TBD A;  1UY4 A;  1WW6 A;  2GME A;  4FAG A;  1VMJ A;  3FUO A;  4MXW B;  4QPG A;  1UWW A;  3PLQ A;  4DRV A;  5FZB A;  2BER A;  1SFP A;  3GZT B;  4XQ4 A;  1W0P A;  1OF4 A;  2A3X A;  4UFM A;  4AEM A;  1O3T A;  3RZK A;  3WT3 A;  2ID4 A;  5DPN A;  3PTY A;  2WT2 A;  4OUS A;  1YO8 A;  5FYH A;  1W6Q B;  3DYO A;  5DZF A;  4YW2 A;  3CZU A;  1PVX A;  3OD0 A;  4PBP A;  3VD3 A;  2QKD A;  4QKB A;  2PHR A;  4Z8B A;  5C3S A;  1GZ9 A;  4XYX A;  1UPI A;  5FRA A;  1RHI 3;  1GOG A;  5FZ3 A;  5F3C A;  1EAH 1;  1RUE 3;  1OPM A;  2DBN A;  5L7O B;  2F17 A;  1RUO A;  2FCV A;  4KMQ A;  3OUI A;  1PO2 2;  4JRA A;  5AVP A;  1QJU 3;  2H6C A;  2DCZ A;  2P4E A;  4PBO A;  4XE9 A;  3ME2 A;  1AYM 2;  5FKB A;  2ZGU A;  1QNY A;  2I45 A;  5I0R A;  2VEC A;  4Y1U A;  3HMY A;  2E7T A;  2RS1 2;  2Z42 A;  4EN8 B;  2JG8 A;  4YFW A;  3KHC A;  5LY2 A;  4ONU A;  1HXS 2;  2CYF A;  4QXK A;  4D94 A;  1VB2 A;  4GKX A;  1YXW A;  2ET1 A;  4PLN A;  3I3M A;  1RUG 1;  2YPJ A;  2VOT A;  5I8T A;  3WLU A;  1W05 A;  4M3C A;  2YXS A;  5FLH A;  1OH4 A;  1XOY A;  1TMF 3;  2ENR A;  5EYX A;  2G9G A;  2OPW A;  3TEW A;  3SQO A;  4YAR A;  4MGY E;  1RUE 1;  2D6K A;  3VBU A;  1ZA4 A;  3I2D A;  5C5T A;  5LBF A;  1VRH 1;  2VCB A;  3I3D A;  2VUL A;  4HN0 A;  4XUP A;  4A7Y A;  2DF7 A;  2JXA A;  3CQO A;  1J83 A;  3BOP A;  3NO8 A;  4KGQ A;  5JZG B;  4CDW C;  5FZ0 A;  2QQN A;  1PZ7 A;  2GP5 A;  3AP7 A;  2AR6 A;  5CU1 A;  5L36 A;  5A6Z A;  3WNX A;  1BBT 3;  4JRL A;  1N3P A;  2C9K A;  3HR9 A;  3O0V A;  3HNY M;  2C4X A;  5FIX A;  1JYI A;  1PO1 2;  1FYU A;  4BMB A;  2ZMK A;  2LS6 A;  1G9F A;  1BVP 1;  3KSC A;  3B9I A;  4GZ9 A;  3WD5 A;  5DAW A;  3F2Z A;  3LPG A;  1UOG A;  1BCX A;  3RZL A;  2BNM A;  1VLN A;  3T2O A;  1QH6 A;  1TMF 1;  2VOX A;  1DYO A;  3K4D A;  1RB8 G;  3RYK A;  2VMD A;  4L97 A;  3U78 A;  2KM2 A;  4MGT A;  4K21 A;  4EYU A;  5I91 A;  3C2U A;  3GBF A;  4OHZ A;  4AGR A;  1WBL A;  1ND2 B;  5GLU A;  1WUV A;  2O0O A;  3WDW A;  4UFK A;  4QQP A;  1BLZ A;  2RJL A;  2BOI A;  5EQU A;  4L0P A;  4P9Y A;  4GWI A;  3VHO A;  1GZW A;  2Z2S B;  2J1T A;  5FYC A;  1BBT 1;  2R49 A;  4QX8 A;  5FZI A;  3SCH A;  4IGO A;  5A3N A;  3I2G A;  2HWE 3;  5L19 A;  4TWT A;  2Q1Z B;  1S1A A;  1YIP A;  2PA7 A;  5ABJ A;  5HV4 A;  3T0D A;  4EWA A;  1O3R A;  4QU1 A;  4QX7 A;  4R8H A;  4MH0 E;  2MPF A;  3BIE A;  5IT6 A;  1A78 A;  4TTG A;  5KBF A;  4NPR A;  2D6N A;  4XF0 A;  1BHG A;  2CU5 A;  5IVE A;  5FYU A;  1E5H A;  1HKD A;  5LBE A;  4AOC A;  5CIR A;  4CPB D;  3LF7 A;  4YPJ A;  1ASJ 3;  3J7L A;  1D2S A;  3U4X A;  4BA6 A;  3VBO B;  4GH4 B;  4HPK B;  5T5P A;  3IPV B;  3IDE A;  1CIW A;  4Q4V 2;  5C9A B;  1DFQ A;  4AED C;  5F7U A;  5DQ0 A;  5KHI A;  3UGH A;  4FPK A;  1F5J A;  3MV1 1;  2A73 B;  4QM8 A;  4WVM A;  1TE1 B;  2Q1M A;  1KS5 A;  3III A;  4D7T A;  5JR2 A;  4N7U A;  2F4L A;  1RXF A;  2WZR 2;  3AFK A;  5CVR A;  4Q1R A;  4YW1 A;  5JLV A;  2NN8 A;  3N9L A;  2Y8K A;  5FZL A;  3WW2 A;  4I02 A;  2XH6 A;  3RYP A;  2LAL A;  1BVV A;  4AQS A;  4COV A;  2ZGQ A;  4E4D X;  4QHO A;  5FK7 A;  3WUD A;  1YLL A;  3PUH A;  3U4S A;  1HRV 1;  5C4W C;  4Q0P A;  1SFY A;  4FT8 A;  1ASJ 1;  1ZZ9 A;  3NKT A;  2VUA A;  4XEZ A;  4AFM A;  4E2S A;  4FAH A;  2FD8 A;  4YG0 A;  2J1A A;  1H2M A;  3MW4 A;  3KV4 A;  4IUG A;  1V9U 3;  3WY6 A;  2AGS A;  1IHM A;  2DTW A;  1K3I A;  1X36 A;  2UY9 A;  3NMB A;  1UY0 A;  2R04 3;  1XYN A;  2WR9 A;  4IND A;  4IV3 A;  2WNV C;  5IVY A;  5TSW A;  3T09 A;  1W6M A;  5CYY A;  1SEF A;  1V6N A;  3I2K A;  4HZF A;  4AHZ A;  4XJ9 A;  4KBB A;  1IQA A;  1MS4 A;  1LHV A;  1JOJ A;  2XHK A;  3FHQ A;  1GV9 A;  1LEN A;  1JOD A;  1LHO A;  1OUS A;  1UQX A;  4JDN A;  2IZW A;  1ONA A;  1LOD A;  4E9K A;  4L2N A;  4LO4 B;  2KXL A;  2RS5 3;  5JWP A;  2VZT A;  3N7J A;  2RS3 2;  3GNE A;  4FBF A;  4FPO B;  5L9B A;  1CAU B;  1O5U A;  5J1X A;  3MW2 A;  4MAD A;  4RFT 0;  1IQD C;  4XUT A;  1V9U 1;  3NJX A;  1X82 A;  3VDD A;  3NNF A;  3BOW A;  3DN7 A;  2ZGT A;  5AC9 2;  2R04 1;  2RDN A;  3VKN A;  3VHP A;  3IDA A;  2WO2 A;  3N9O A;  1F2N A;  1S0C A;  3NV4 A;  5C70 A;  4FOW A;  3RZM A;  2C26 A;  5FCC A;  3ZR6 A;  1MEC 2;  2ZHL A;  1ZRE A;  1U5Y A;  2A6Y A;  4A3Z A;  1UYP A;  5ACA 3;  1UXX X;  2W1W A;  4Y3O A;  1QDO A;  2WNO A;  3BPZ A;  1VBE 3;  3ACF A;  4JGZ C;  3LWC A;  5BPX A;  2YC4 A;  5CFD C;  3VBU B;  4Q2F A;  4QB1 A;  2W95 A;  2RS5 1;  1D4V B;  2Y64 A;  5EFU A;  5A7O A;  2WFF 2;  4HT1 T;  1NLS A;  4QXB A;  5IK5 A;  4CDX A;  1GLH A;  3LOI A;  4HKW A;  4HON A;  4N53 C;  1AR7 3;  2D3P A;  1KFX L;  1ZRC A;  4GJY A;  2XPJ A;  2VQA A;  2N7G A;  1G9A A;  1ZX5 A;  2PHF A;  3WQ1 A;  1VBA 2;  4B1M A;  5FP7 A;  1W99 A;  5K0U A;  1WLT A;  1H1M A;  2J7M A;  1F35 A;  3OYW B;  1MS0 A;  4MGZ E;  4N43 C;  5ACA 1;  5JPM B;  3SC7 X;  1NLQ A;  2E7A A;  1VBD 2;  4XUQ A;  3KM5 A;  5FZ8 A;  4P9X A;  2DTY A;  1OC1 A;  5F3G A;  2XHN A;  1PGW 2;  3OGR A;  3OD4 A;  4IEP A;  1ENX A;  2W68 A;  1YC6 1;  4XQW A;  5C8C C;  3FN9 A;  1IKP A;  4MX3 A;  2WJS A;  4WM7 C;  3FLP A;  2B7Y A;  2XML A;  5A3P A;  2WO3 A;  4YVS A;  1W06 A;  5A33 A;  1LOB A;  1NE6 A;  2W94 A;  2Q0A A;  2WZ8 A;  3CJI A;  3OEA A;  2BBA A;  4QWN A;  2HH9 A;  5T54 A;  1LOF A;  2ZGN A;  1GZW B;  1XE8 A;  1G86 A;  1AR7 1;  2HBU A;  1ZBA 1;  2JD4 A;  1FNZ A;  1H2K A;  2JG9 B;  2OUJ A;  3O12 A;  4K7J A;  4LBM A;  2A3Y A;  4XF4 A;  3W5M A;  1ZRF A;  4JX0 A;  2CDO A;  1OXC A;  2CGO A;  2DUO A;  2ZKN A;  1SLA A;  4ORF A;  3M1H A;  2ZX3 A;  3ZXJ A;  1YI7 A;  3I8T A;  1MZF A;  2K9Z A;  2V72 A;  4DUW A;  4IEO A;  5GM0 A;  3OGJ A;  3KV9 A;  4IE0 A;  3OBZ A;  1NA1 C;  1UL9 A;  4QX2 A;  4UFL A;  1KDM A;  4XDP A;  3P1I A;  4AHW A;  1Y9G A;  1GQP A;  1QXR A;  2P6H A;  3M3I A;  2NM1 A;  1QOS A;  5LB6 A;  3CU7 A;  2X05 A;  1QQP 2;  1U0A A;  3LAG A;  3USU B;  5FMD A;  2CL2 A;  5B4N A;  3NKG A;  4UFH A;  3VD5 A;  4GB3 3;  3ZN5 A;  2BDR A;  3AZX A;  2FZ2 A;  3N9M A;  2QQK A;  2GH2 A;  3R6S A;  4JGY B;  4QDS A;  1PK6 B;  2QQJ A;  2Y26 A;  4WV8 A;  3I2H A;  4O9G A;  1L7R A;  3NNL A;  2EAA A;  3LSD A;  3WG1 A;  3GZA A;  4M00 A;  4XHX A;  4J1W A;  2XWB B;  3KF3 A;  5I0S A;  1W3V A;  1IOA A;  1J1T A;  3OY8 A;  5DDJ 2;  3WF1 A;  5HV0 A;  3R4S A;  3ZXG A;  1LUL A;  3LDB A;  1QH7 A;  2RDS A;  2AEZ A;  3WOG A;  4MOA A;  5CBL A;  2CY6 A;  2J1V A;  2YDE A;  3POI A;  4YW7 A;  2VAU A;  1B09 A;  3M4F A;  2XXZ A;  4P02 B;  3O1R A;  3EQE A;  1GIC A;  3LDK A;  2HWD 3;  5KXC A;  4XAB A;  1ND3 C;  5HCF A;  3RJ2 X;  3TEX A;  4XCB A;  4A3X A;  4C8D A;  4GB3 1;  3KB5 A;  4EJR A;  2W9X A;  3RGB A;  3WW1 A;  4AFA A;  2DCK A;  4EWE A;  1PZ8 A;  1S0B A;  1H9P A;  3JUU A;  1FPN 2;  4BYY A;  5JOW A;  1NLR A;  5EHD A;  3ZFE C;  4NRQ A;  5FPL A;  4M3C F;  2HWC 3;  4NAO A;  4PI0 A;  1QU0 A;  3FBY A;  1UZZ A;  4YWA A;  1W6O B;  2VW1 A;  2CV6 A;  2ARA A;  3BB6 A;  4WZF A;  3ZYI B;  4F3J A;  2A6Z A;  1W6N A;  2XJR A;  3AFG A;  1HN1 A;  1QJX 3;  3WZ1 A;  3OB8 A;  1NZC A;  4RD7 A;  2E6V A;  4FXG B;  2IXK A;  2W91 A;  5JVV A;  2R0F A;  1W9T A;  4GQ7 A;  4IET A;  4HVO A;  4LBJ A;  4Q8L A;  3RQ0 A;  5J09 A;  3H3U A;  2E9Q A;  3POF A;  4YGC A;  2QQU A;  4PLO A;  2XVK A;  3PVB B;  3H1Y A;  1HQN A;  4OYU A;  2DU0 A;  1C57 A;  2DCJ A;  4KWL A;  2YC2 A;  5IYY A;  3NNJ A;  3T4H B;  3UK9 A;  1W2U A;  3V65 A;  2HWD 1;  3Q8F A;  1UY1 A;  4L99 A;  3U11 A;  5IVV A;  1DP0 A;  1VBC 3;  2A71 A;  4O61 A;  4RR3 A;  1MS3 A;  2W1U A;  3UT0 A;  4NID A;  1G8W A;  3DGT A;  4P9W A;  1KEX A;  3ZYJ B;  4B4P A;  3O1P A;  2HWC 1;  3VDD B;  1EUT A;  5JSO A;  3SHR A;  4XET A;  3T30 A;  5KHG A;  1ALY A;  1ENS A;  5FZ7 A;  2WL1 A;  4CXY A;  1PMH X;  1W9Y A;  1ACC A;  5F3E A;  3KT1 A;  3WF4 A;  3I4I A;  2VUC A;  3VBF B;  2JDK A;  2RDR A;  4D6S A;  3I3E A;  5T5J A;  3G6J B;  4WM8 B;  3R0R A;  3LOB A;  2ZTN A;  4AEJ A;  4HSJ A;  1VR3 A;  1UZ0 A;  3M3C A;  5JR7 B;  4CVU A;  2PHD A;  1MPX A;  2ATF A;  4Q4W 2;  1VBC 1;  1PVC 2;  4F7Z A;  3I3Q A;  3KGZ A;  4IV1 C;  2VE1 A;  1VRB A;  5CZK A;  1JN2 P;  1HRI 3;  1RUI 2;  5D8A C;  2PXJ A;  1RUF 2;  4I30 A;  3TWI A;  4CDX B;  1UMI A;  2MNG A;  3HBK A;  4UXA A;  5FZO B;  1RIN A;  4AFC A;  2R1D A;  3GZE A;  3HIF A;  2AYH A;  1ZZC A;  3TNQ A;  1XNC A;  4HG6 B;  4YM2 A;  4YG6 A;  3LEM A;  5A3L A;  3AJZ A;  2Y6F A;  4AYU A;  4IEQ A;  1RUC 3;  4E4S A;  4IE5 A;  2RE9 A;  1HW5 A;  2RM2 2;  2ZML A;  3HEI A;  3VBR C;  2WA4 A;  2DV9 A;  4Q4Y 1;  4UFI A;  2J1U A;  2D3R A;  2WN2 A;  2E63 A;  4AVA A;  2BZD A;  5D21 A;  2ZX1 A;  3FBM A;  3KVA A;  3PUI A;  2CDP A;  1JBC A;  2JKX A;  2R30 A;  4LBO A;  4YVS B;  1S0E A;  1XBF A;  1HRI 1;  4GD4 A;  1TNF A;  2ET7 A;  1HB3 A;  2HYX A;  3GBW A;  4XXP A;  2HLE A;  4LLO A;  4S2F A;  2WNU B;  5DUX A;  5FLJ A;  5C33 A;  4KGG A;  3FX3 A;  4B3N A;  3ON7 A;  3OPT A;  5DG2 A;  5ERL A;  5FJH A;  1OLQ A;  2KD7 A;  3W21 A;  3MGU A;  1RUC 1;  4YZ3 A;  2B8M A;  4YZ5 A;  1QIQ A;  3WXP A;  1VIW B;  4YZ4 A;  5E89 A;  1QKQ A;  4Y1Z A;  4AK3 A;  3AZZ A;  3VKL A;  1W8O A;  3MIC A;  2VMH A;  1BEV 2;  1XYP A;  1N3O A;  1YHF A;  2FHR A;  2VUJ A;  3I59 A;  5A7P A;  5GLV A;  3WF3 A;  4ARY A;  2D6M A;  5KC5 A;  5FTT C;  3AP5 A;  3N7L A;  4I0W B;  3AKT A;  5LA0 A;  2PMW B;  1V00 A;  3AZY A;  3J8F 1;  3RS6 A;  5AVA A;  4EV0 A;  4E27 A;  1IS5 A;  3RMY A;  3JBG 3;  5F6L B;  2R1B A;  4YVW B;  3UKT A;  1NY7 1;  1HDK A;  4GXL A;  4W6X A;  3RWK X;  4CSW A;  3AMP A;  1AL2 1;  4HVR A;  1OQ1 A;  4OVE A;  4BQ4 A;  5F5Q A;  3T08 A;  5FY7 A;  3APB A;  5DG1 A;  1DYP A;  3N7M A;  3R05 A;  3FJS A;  1URX A;  1POQ A;  1ENQ A;  4ZZ8 A;  3BAL A;  1H2L A;  3LZZ A;  2GC0 A;  3B5L B;  1C5H A;  3FZ3 A;  3PTR B;  3WX5 A;  2HBT A;  3AKP A;  3KVB A;  4X6R B;  3BTA A;  4CDW A;  3MFC A;  4KU8 A;  4AI3 A;  2XJT A;  2I2S A;  1KXG A;  4LR4 A;  3ZIW A;  2CNA A;  4NJ4 A;  3RI8 A;  4BQ3 A;  4NWW A;  3DCQ A;  3HN3 A;  4I01 A;  3POG A;  4A42 A;  4C0B A;  1JTZ X;  3UKV A;  1HLC A;  3AK0 A;  2NQY A;  2QQL A;  4PJY A;  1NAE A;  1KS4 A;  3JBG 1;  1DGR A;  3OEB A;  4NRP A;  4Q5O A;  1E5R A;  2YV8 A;  1W6P A;  1BMV 2;  2IVI B;  5L73 A;  1KDK A;  3POB A;  1TME 3;  4HVQ A;  1CGP A;  4IQP A;  3N4M A;  1W6N B;  2EA7 A;  2YGL A;  3WVJ A;  4BK5 A;  5FY4 A;  1RUJ 2;  2OQ6 A;  3GHM A;  5IK8 A;  1R08 1;  1LJ7 A;  2BUK A;  3TEZ A;  4P9L A;  1O5L A;  1UIK A;  2DBI A;  2VNV A;  3WNP A;  3ZXD A;  3TN9 3;  4D0Q A;  5C7G A;  5EP9 A;  5FWE A;  3VZM A;  3CF6 E;  1NCR C;  1LOG A;  3T3Y A;  5HBA A;  2ZOE B;  5KXB A;  1S2E A;  3T2T A;  1PIV 2;  3KQR A;  4D7S A;  2FDJ A;  2X5I C;  4KWU A;  1XYO A;  1LAJ A;  4OHY A;  1CX1 A;  1K45 A;  1ULF A;  4CEW C;  3NAP C;  3RPQ A;  1C1L A;  4YFZ A;  1RMU 2;  1F31 A;  1TME 1;  3FHI B;  1AHS A;  1W8W A;  5CNA A;  3I2O A;  3VBS B;  3VDA A;  1SLL A;  4CYD A;  3S0M A;  3AMM A;  4ZY9 A;  2BV4 A;  5HPO A;  4BJ0 A;  1JZ6 A;  1VJ2 A;  2WAO A;  1RUN A;  5CFC B;  1FAT A;  3BIW E;  4U36 A;  3TN9 1;  4LNV A;  3JZV A;  1IZ3 A;  1K5M B;  1CON A;  5JMO A;  4XIL A;  1DZQ A;  4DOU A;  3AP4 A;  1H6Y A;  2BEO A;  2VQ0 A;  3JU9 A;  4Q1P A;  1IG0 A;  4AED A;  3CNA A;  1FT9 A;  2GMM A;  2VBB A;  1OFS A;  1IKQ A;  1H1I A;  2EIG A;  2PAM A;  4U2A A;  5FYM A;  2HYK A;  1WBF A;  3C7O A;  1XSR A;  2Y6K A;  3HPN A;  3MIH A;  1IG3 A;  1WLW A;  1CAV A;  4Y20 B;  5FYY A;  4PF5 A;  3UET A;  4PT6 A;  3M70 A;  2XLG A;  2OYZ A;  4Z1V A;  1CD3 G;  3VDB A;  1E5S A;  3PHM A;  4I3P A;  4J6G A;  1PGS A;  5C4W A;  3BKZ A;  1ZBE 2;  3JB8 A;  2BNN A;  4LKD A;  4R9B A;  4BLJ A;  3JB4 C;  2XDV A;  4QGM A;  1GWM A;  1V6M A;  4RFR B;  4Y22 B;  2E32 A;  4Q29 A;  1Z7S 2;  1PZ9 A;  1D7P M;  3PU8 A;  3E6C C;  1MVE A;  1PGL 1;  1IS3 A;  4G9S B;  3WP4 A;  2BQP A;  1F15 A;  2WNV A;  3SEE A;  3BOD A;  1AYM 3;  3D0S A;  1JZ2 A;  5IFP A;  1SBD A;  3TB0 A;  1WA4 A;  1GP5 A;  1X33 A;  3P3N A;  1IS6 A;  2RS1 3;  2LTN A;  5H9P A;  3TNP B;  4W50 A;  4QT6 A;  1GBG A;  3LA3 A;  2J42 A;  3IDB B;  2EF6 A;  1HXS 3;  2W46 A;  2WWU A;  2ZEY A;  3B69 A;  1GYK A;  5BNP B;  1MZE A;  1QJY 3;  5H9R A;  4FFG A;  5ANN A;  1W39 A;  1YFX A;  2IFW A;  1A34 A;  5J3U A;  5HCH A;  4AQ6 A;  4B29 A;  3T2P A;  3WG4 A;  5LY1 A;  5LAT A;  5IW0 A;  5EIY B;  4DUV A;  5IVJ A;  2BNO A;  2DVA A;  5GLW A;  4IEX A;  3ACL A;  4CDU C;  4XIK A;  1EPW A;  2QUO A;  2DU1 A;  1UNB A;  5FXZ A;  3H1M A;  1OH3 A;  1X9P A;  1YRZ A;  2XVG A;  3IAP A;  2RMU 2;  1W9W A;  3I59 B;  4ZU4 A;  5CIS A;  1LEC A;  3OUH A;  1XSQ A;  1AYM 1;  1SQ4 A;  5JXJ A;  1W8H A;  4A4A A;  1WZX A;  3OCP A;  4JHT A;  2VH9 A;  3ACH A;  1JZ5 A;  1V0A A;  1F4A A;  2RS1 1;  1R64 A;  4OMC A;  5H9Q A;  1W2A X;  4CUC A;  1HXS 1;  1OFN A;  1OMI A;  1APN A;  5BV6 A;  1PO1 3;  1QJY 1;  2JDU A;  4BM8 A;  4JGZ A;  3PDQ A;  1J3R A;  2ZEZ A;  2JE8 A;  5CFD A;  1B35 B;  1FOD 3;  1Q8P A;  1DZT A;  3LFI A;  5KHH A;  2OKX A;  5AFE A;  5CAD A;  1OOP C;  2GH8 A;  2Y6L A;  3IN9 A;  2ZHN A;  1O4T A;  2D7F A;  4EE2 A;  3ZFG A;  2DYC A;  3CHX A;  2VW2 A;  3E5U A;  1JOP A;  3B02 A;  5IFT A;  1J84 A;  4ZHN A;  3EMR A;  3ZKU A;  4CDW B;  1GP6 A;  4N53 A;  4BK4 A;  1I3H A;  4YRD A;  1UKR A;  3AMQ A;  3C7F A;  1H4H A;  3SH5 A;  1GOH A;  3R4D B;  2GDF A;  2EAL A;  4PDW C;  1IGO A;  2VTF A;  2ZX0 A;  4QQ2 A;  4XF3 A;  2F4P A;  1LOC A;  3IIA A;  3LA7 A;  1CAW A;  4N43 A;  4H55 A;  1TEI A;  1PO1 1;  1OA2 A;  1UYY A;  5C5U A;  4YNI A;  1W8U A;  1CAX B;  3DKW A;  1WCK A;  3LD8 A;  5A6Y A;  1LRH A;  5C8C A;  1FOD 1;  4LMF A;  3ZFF B;  2KA3 A;  2VMI A;  3WNM A;  4WM7 A;  5F5A A;  3ZKY A;  4UFJ A;  4XMA A;  1YWK A;  4D3W A;  5FFO C;  1K42 A;  5FXX A;  1DLL A;  3SIT A;  1AR6 2;  4XOG A;  5F2S A;  1VAL A;  3B93 A;  2PFW A;  2Q8C A;  3FFZ A;  2QCS B;  5GKA C;  4BH9 A;  1K5J A;  2E31 A;  3DXU A;  2Q8E A;  2YBK A;  2GNB A;  5DAP A;  2QZ3 A;  2I07 B;  3DUI A;  3D6E A;  4ARX A;  4FOY A;  1OD5 A;  2X09 A;  1NCQ C;  2O8Q A;  4JKK A;  4N90 A;  4IEU A;  2XVL A;  4Q4V 3;  1NA1 A;  4FPH A;  3C7E A;  4AWD A;  2NP0 A;  3WQ0 A;  2R07 2;  1OKQ A;  2PAE A;  1C8M 2;  5I8S A;  4PCR A;  3DPR B;  5APA A;  2BVB A;  2E53 A;  1FMD 2;  1UIJ A;  4RS5 C;  5EV7 A;  2WWS A;  4CDQ C;  3H9A A;  2K0G A;  2Q30 A;  4MYE A;  1A3K A;  1U5I A;  1CZS A;  4K9S A;  3ZDS A;  1YQ5 A;  4AED B;  1RHI 1;  1Y3T A;  2JEC A;  3OG2 A;  2R16 A;  3OTF A;  2YFU A;  1QJU 1;  1W8Z A;  1UOB A;  3MIF A;  4Q4X 2;  4ZXE A;  5CB7 A;  2VPV A;  3PIG A;  5BY5 A;  1DBN A;  2XB6 C;  4YSF A;  1OVS A;  1YYN A;  4IEZ A;  4B4R A;  2JDN A;  4NN0 A;  3BPS A;  3EB7 A;  4RQP C;  4Y33 A;  2B4K A;  4FTE A;  1QXP A;  1ND3 A;  3NST A;  4Z2W A;  5A32 A;  3OBA A;  5KHK A;  2G9F A;  5FMB A;  5JSP A;  3AC0 A;  3ZFE A;  4FPJ A;  3KGL A;  4LK7 A;  1CQ9 A;  1XNA A;  2YU2 A;  3LFM A;  4XFI A;  5EXO A;  4OQ9 A;  4B7K A;  1WCQ A;  3URF A;  2RS3 3;  4LIU A;  3SNM A;  2WNV B;  2Q4S A;  1N1T A;  4LBQ A;  1LU2 A;  5CKM A;  4QGL A;  1E57 A;  3OGV A;  4Q0S A;  4DB5 A;  4ET7 A;  1Y43 B;  1H2N A;  5AC9 3;  3VZN A;  5FZE A;  1GSL A;  3DYP A;  4LHN A;  4M01 A;  4EN6 B;  3FHA A;  4HN1 A;  3PUA A;  4FOV A;  5FPU A;  1MEC 3;  3GYD A;  4CEY C;  4AVT A;  2A70 A;  4L8Q A;  1AJK A;  3WCR A;  1YQ2 A;  3CLP A;  3VHN A;  2WQ8 A;  2TNF A;  4GJZ A;  4L11 A;  4IW3 A;  2BP6 A;  4HL0 A;  3N35 A;  4QDQ A;  4UF0 A;  1PHM A;  2VVF A;  3A0K A;  5LAS A;  1OLM E;  3VD9 A;  1IPS A;  3ACG A;  4L92 A;  5A7S A;  2ZGK A;  3HD8 B;  3KCY A;  4MUV A;  1Q8Q A;  2BGC A;  5FZG A;  2XQX A;  5J98 B;  5FWJ A;  2CGN A;  3O7O A;  1ODM A;  4I3G A;  1VAV A;  4JQR A;  4C1X A;  1EAH 2;  5AC9 1;  2YFZ A;  4HK9 A;  5FMO L;  1ZA7 A;  3U1X A;  5IK4 A;  1V70 A;  1WME A;  3E6B A;  4JKL A;  4OUM A;  3LIG A;  2DCY A;  4XTM A;  4AGG A;  1MEC 1;  4IGP A;  2P3K A;  4EZH A;  4CCL A;  3DV8 A;  2HWE 1;  3RVH A;  2VD7 A;  3RI9 A;  1HV1 A;  1XE0 A;  4O9E A;  1QF3 A;  1QHD A;  1UMZ A;  1VBD 3;  1DGL A;  4IV1 A;  5IUQ A;  2RR1 2;  1W0O A;  3RRD A;  5BNO C;  1AR9 2;  1LCL A;  3KWV A;  5D8A A;  3AB0 A;  5FXV A;  5HCA A;  1NXM A;  4LA3 A;  2JDZ A;  4QMA A;  1XU1 A;  1RUG 2;  4D8M A;  3HQX A;  5F2W A;  2GN3 A;  2CHH A;  5K4L A;  4LUK A;  1QJF A;  5FZ9 A;  4B4Q A;  1SBE A;  3V0A B;  4HXC A;  4PIZ A;  5FPB A;  5DAV A;  5FJK A;  2QDN A;  1NZI A;  1VRH 2;  1Q5O A;  2OT7 A;  4N43 B;  3WQ7 A;  4QPG B;  3VBR A;  3W9A A;  3AL5 A;  3BTX A;  3LEG A;  3T4V A;  3WW3 A;  4I0A A;  1H0B A;  2GP3 A;  3ZXE A;  1C28 A;  2E51 A;  1AXZ A;  4CCO A;  5C8C B;  2P3J A;  2PAK A;  1AZD A;  2WIN B;  4ZS3 A;  1VBD 1;  5FOB B;  5JPN B;  3LKJ A;  1GZC A;  1SHW B;  1NYW A;  3JQW A;  3AVR A;  3QCW A;  4LIV A;  1GP4 A;  2WRA A;  1SMV A;  4P5Y A;  4ES9 A;  3LE0 A;  3RJR A;  2JB4 A;  4NII A;  5JZG C;  3U14 A;  1I5Z A;  1QQP 3;  5CKN A;  2IXL A;  2V5Y A;  4XFB A;  4LE4 A;  4CA9 A;  3VD4 A;  1VPH A;  5A1A A;  2FMY A;  3ZXF A;  5KWR A;  2H0B A;  2W0X A;  5KHJ A;  1SAC A;  3I3B A;  2P37 A;  1OBN A;  5F3I A;  3AKQ A;  3WHT A;  1Y9M A;  4DY3 A;  1W8F A;  1NA1 B;  5FQ0 A;  1SG3 A;  2IXC A;  4LPL A;  1CIY A;  3PJQ A;  4ISR A;  3MPB A;  4BQ1 A;  1ZM1 A;  5IJR A;  5DDJ 3;  4Q8K A;  3I49 A;  1SDD B;  3IM0 A;  3PNA A;  1ND2 C;  2JG8 B;  1V6K A;  3TYJ A;  3BI3 A;  4ASL A;  1NT0 A;  3GBG A;  4MGK E;  1S0G A;  1YUD A;  1KJL A;  2EXK A;  3POE A;  2EXH A;  2GU9 A;  1KGY A;  3PUS A;  1RJ7 A;  4M3C B;  1QQP 1;  3ZSJ A;  4P14 A;  2YC0 A;  2DUR A;  1QOO A;  2ZBJ A;  4XAC A;  3ZLI A;  3GGL A;  3LCP A;  1WLD A;  2ZAB A;  3WUC A;  4XFC A;  1FPN 3;  4OI1 A;  4AL9 A;  2WLP A;  1XJA A;  2W3J A;  4HBN A;  1QY4 A;  4ATF A;  2WT1 A;  3C3V A;  2VCM A;  2RJK A;  2FDI A;  3ZFG C;  1ST8 A;  1DLC A;  2VR4 A;  4AHY A;  4HKO A;  2TBV A;  3ZYP A;  4IDZ A;  3FLT A;  2W87 A;  3W59 A;  5IVF A;  2V4V A;  2ZHM A;  4UT5 A;  3U10 A;  4XFF A;  4C1W A;  1U5Z A;  5FYT A;  1T2X A;  5F5C A;  1VBB 2;  3SH4 A;  2ZS6 B;  3VBO C;  4GH4 C;  4BCU A;  3CEW A;  5FZM A;  4Y4Y A;  1MVQ A;  1VBE 1;  4WZC A;  2XKP A;  3H8O A;  2RJ2 A;  2GC1 A;  4XFG A;  1D0H A;  3A0N A;  3WG3 A;  4YLZ A;  3MV0 1;  4KL1 A;  3KLS A;  3POY A;  1WLC A;  4LK6 A;  5KC6 A;  1GZT A;  2ADD A;  1N47 A;  1HRV 2;  4ZPI A;  2DWR A;  4YW4 A;  3D0J A;  2XBO 2;  4UBG A;  4KG8 A;  1NCR A;  2JDP A;  2JDM A;  3H1W A;  5F39 A;  1RYY A;  2GNT A;  2XJV A;  1S0J A;  1RUD 2;  3NJY A;  4XAA A;  2OPK A;  2X5I A;  1I6X A;  4CUB A;  3T0B A;  1OUR A;  1UU4 A;  2SBA A;  2QTW B;  3CIH A;  3WDU A;  3NAP A;  4CEW A;  5ABJ B;  1YIF A;  3O1V A;  3MIB A;  5EJ1 B;  2XG3 A;  2PHT A;  3THP A;  3O1T A;  4Q4W 3;  2VTX J;  3RG0 A; 
#chains in the Genus database with same CATH homology
 2V4A A;  3W21 A;  3MGU A;  5DAV A;  2RDQ A;  3KT4 A;  4NHY A;  3GJB A;  4KBZ A;  4ZON A;  5L9B A;  4XAB A;  5LA9 A;  4XCB A;  3NNF A;  2RDN A;  5DAW A;  2JIJ A;  4NAO A;  5DAQ A;  4UWD A;  4NMI A;  4BQY A;  3HQU A;  4XC9 A;  5EQU A;  5LAT A;  3NNJ A;  4NHK A;  2HBT A;  2JIG A;  4Y5T A;  5HV4 A;  3OUH A;  2Y34 A;  5A3U A;  4Q5O A;  3W20 A;  3OUJ A;  5IAT A;  5L9V A;  4NHM A;  3KT1 A;  4BQX A;  4XAC A;  3KT7 A;  5IAX A;  2G19 A;  5LBE A;  2RDR A;  3ITQ A;  3GJA A;  5EP9 A;  4MHR A;  2HBU A;  3EMR A;  4IW3 A;  3HQR A;  5DAX A;  3GZE A;  5LAS A;  5M0T A;  4NHX A;  2FCV A;  2FCU A;  3BVC A;  3OUI A;  3OBZ A;  5C5U A;  2A1X A;  5IAV A;  2RG4 A;  4BQW A;  5LB6 A;  4NHL A;  3DKQ A;  2Y33 A;  4ZPI A;  5LBB A;  3PL0 A;  4Y5S A;  5LBC A;  3NNL A;  4J25 A;  2FCT A;  4XAA A;  2OPW A;  4MHU A;  4XCA A;  2G1M A;  5DAP A;  5EPA A;  3NNM A;  5L9R A;  5C5T A;  5HV0 A;  5LBF A;  5ERL A;  4JZR A;  2RDS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...