5L9VA

Hif prolyl hydroxylase 2 (phd2-r281c/p317c) cross-linked to hif-1alpha nodd-l397c/d412c and n-oxalylglycine (nog) (complex-1)
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
215
structure length
215
Chain Sequence
PALKLALEYIVPAMNKHGICVVDDFLGKETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLICHCNGKLGSYKINGRTKAMVACYPGNGTGYVRHVDNCNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERAAAKVKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Egl nine homolog 1
publication title Structural basis for oxygen degradation domain selectivity of the HIF prolyl hydroxylases.
pubmed doi rcsb
source organism Homo sapiens
total genus 65
structure length 215
sequence length 215
chains with identical sequence B
ec nomenclature ec 1.14.11.29: Hypoxia-inducible factor-proline dioxygenase.
pdb deposition date 2016-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13640 2OG-FeII_Oxy_3 2OG-Fe(II) oxygenase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 5l9vA00
5L9VA 2JIGA 5LATA 2RDQA 5LASA 2JIJA 3W20A 5EQUA 3NNLA 3PL0A 4Q5OA 5HV4A 5IAXA 4NHXA 5DAQA 4XCAA 5M0TA 3HQUA 3OUJA 3HQRA 2RDSA 5ERLA 2Y34A 4Y5TA 2FCUA 4NHYA 4BQWA 5EPAA 3GJAA 4IW3A 2HBTA 3NNFA 4XCBA 5L9BA 3W21A 4ZPIA 5IAVA 5DAXA 3DKQA 3ITQA 4XACA 2A1XA 2FCVA 5LBBA 2RDNA 4Y5SA 4KBZA 3OUHA 5LBEA 3GZEA 4NAOA 4XABA 3EMRA 4NHKA 4BQXA 5LA9A 5LBCA 4NMIA 2FCTA 3GJBA 5L9RA 5A3UA 4XAAA 2G19A 4XC9A 2RDRA 3NNMA 4BQYA 4MHRA 3KT7A 5HV0A 4UWDA 5LBFA 4MHUA 3BVCA 5DAPA 2RG4A 3KT4A 3OUIA 3MGUA 3KT1A 5DAVA 5C5UA 5DAWA 4NHMA 5IATA 2OPWA 4J25A 5LB6A 4ZONA 3NNJA 2V4AA 2G1MA 2HBUA 4NHLA 2Y33A 5EP9A 4JZRA 5C5TA 3OBZA
chains in the Genus database with same CATH superfamily
3TB0A 4RN5A 4RR3A 1S0IA 4GWJA 5FOJB 2EXKA 2VNOA 3I54A 4HL0A 2IXJA 3AKRA 4JQRA 5KXCA 2Z69A 1RUE1 2B9UA 1H4GA 3MZHA 5BY5A 4DUWA 2R043 1WGPA 2Q1ZB 3N3HA 2BPA2 4NIDA 5A7OA 4NHXA 1ZBA3 1GWMA 1UOBA 3VBRC 2Y6JA 1D4M3 4M00A 5FLJA 3E6DA 1XE7A 5FY7A 5C9AC 2VMFA 3ON7A 1KXGA 3AFGA 4HONA 1O3QA 5CFDB 4I01A 4PIZA 1XOYA 4JKLA 2FDKA 1W6NA 2VCMA 4NO4A 5FZBA 1KJRA 1QQP1 4ZPIA 1YFXA 3D0SA 4P9JA 4AQ6A 4N9HA 4RL7A 3POWA 3U0ZA 3W5MA 1Y9GA 3H9AA 2OQ6A 4B4PA 5E88A 1WCUA 2OZ6A 2GNDA 4Y1VA 2WAOA 3BALA 3LOIA 2LS6A 4R9BA 3N7LA 3VD3A 4AZZA 4B1LA 1KGYA 3BIEA 2CU5A 1GSLA 4JC1A 5A7SA 2ZMLA 3WEZA 4A7ZA 5IVBA 3DPRA 1FPN1 2VECA 3CJXA 2P3YA 1DZRA 4AGVA 4QM8A 2W47A 4MOAA 3GZEA 4QKDA 3OYWB 4XABA 4OFGA 4YM0A 3VKMA 4NUBA 4BDVB 1Y7BA 4MGIE 4HVOA 1EAH1 4CDXC 4I3GA 1BEV2 3C7OA 1I5ZA 2ES3A 1W2OA 4E2SA 5L9RA 1LOEA 1E5HA 3NKGA 3A4UA 1J1LA 3APBA 2Q8CA 4L2NA 4YVWC 1CAVA 3CIHA 5KHIA 3GXUA 1AR92 1SDDB 1TQ5A 2JG9C 3KGZA 3O0WA 4LNVA 4LOSA 5GJ6A 4QT6A 1HXS1 1PO23 2JECA 2A6WA 1ALYA 1ZZ7A 3HBZA 5DUVA 2C9KA 4Y1XA 3J8F3 3USUB 3VDAA 5A3OA 1ULOA 4Q0QA 3WLUA 1EPZA 4LO5B 5DAPA 1OVPA 2FMYA 2VZPA 4IV3A 4Q4X1 2HJIA 5I8YA 3HQXA 1W9WA 4FPKA 2VQUA 4LKFA 4I0WB 4NE9A 1POV3 4LO6B 1NCQA 4Y4RA 5FMOS 5JXJA 3BKZA 4QAWA 5I0TA 5IK7A 1AUYA 1GR3A 2RM22 5BNNB 4LORA 2XKOA 4DIQA 1NG0A 1QMJA 1SLLA 4IEOA 4IE6A 2BDRA 2D3SA 4FFFA 1S2EA 1W9FA 2WFF1 4IV1C 3CU7A 1R092 1YIPA 5A33A 3CLPA 1STMA 4ZONA 3BCWA 1HRI3 4COUA 4OVEA 1WUVA 5H9PA 4FPFA 4HKOA 4DEQA 1QNYA 3NAPC 4LBJA 5CA6A 1VBE3 1WBLA 2IWGB 4UW6A 1CJPA 2NLRA 4RGGA 5JSRA 2Y33A 2QQMA 5C33A 3ZSMA 3WX5A 2Y8KA 4QXBA 4Z92B 2QBXA 5JAXA 1W8TA 1W8NA 4OHVA 5DQ0A 2BP6A 2PHUA 3D5OA 3OBZA 5HBAA 5GLWA 1RUG3 1OQEA 1UOFA 1RUF1 2H6BA 1C28A 3OEAA 1RYYA 4YFWA 5DUWA 4CP2A 1OLRA 5JOYA 2X8KA 4LA2A 4NROA 5A3MA 1ZBE3 1EUTA 1M4WA 3Q8EA 1D0HA 2VM9A 3WZ1A 4RSUA 1ZZCA 2FDIA 2E7QA 2BTVC 1LOFC 1Q56A 2DU0A 1UXZA 1RB8G 3HT2A 1LTEA 3UYJA 1UZ0A 4OLLA 4XCAA 3ZPOA 3O1OA 3ATGA 4H55A 4ZY9A 4UBHA 2VH9A 2W1SA 1OUXA 1US3A 4K20A 3D4KA 1X7NA 2JKXA 2IXIA 5IT6A 1NUKA 4YSFA 2LUWA 2O14A 4AVAA 2C5DA 5L7OC 4WM7A 5FZOA 4Y33A 4XCBA 3MV11 4XJUA 2BGOA 5L9BA 1AL0G 2V73A 1U5XA 3I2JA 3TNQA 4BPZA 4NR1A 3HD8B 1DBNA 1LODA 1K42A 3VDDA 2JB4A 2D6KA 5FPZA 3Q8FA 4CCNA 4QKFA 1YCIA 4MXWA 5I8SA 2XHNA 3WNOA 4UF0A 5BPXA 2FD8A 1AHSA 4MSVA 1UQXA 1RIRA 5A1AA 1QJU2 4RHV1 4A7KA 3ZYIB 5DABA 1JHNA 3EHKA 4S2FA 1R082 1V9U1 1TNFA 4IL7A 1RJ7A 1EV11 2WWJA 3V56A 4BQ1A 3O1VA 3QACA 2GDFA 5D1IA 4R8HA 5D8AB 1VBB3 1NZIA 3P6BA 5TSWA 5KHJA 2ZPXA 2J1UA 2AR6A 2IXCA 5GLVA 2WLPA 2X5IA 1PNFA 5CISA 3RFRA 1PMHX 2VUDA 4CVUA 1GZCA 1GOGA 1TG7A 1VJ2A 5FK7A 5C8CA 2VBPA 4KNCA 4QX5A 1LGBA 1OI6A 4W6YA 1AYN2 1TME1 2J1AA 4R4ZA 4CU8A 5FMOL 4GA9A 2RMU1 2TNFA 3H8XA 3MBWA 3MUY1 1ZVFA 3MPPG 1CR7A 2XXZA 2P6HA 1J1TA 4PDWC 1X36A 3E97A 2HWC2 4LKDA 1EUUA 3BVCA 3ZFFB 2ZX1A 4GB31 4XUTA 1LEMA 2ZGNA 1QJX3 3LEGA 3VBFA 1FV3A 3MGUA 2PFWA 3GNEA 2XMLA 3R6SA 1Y3TA 3T2PA 4ATEA 2P2KA 3KD4A 3LFMA 4GH4C 2PMWB 4AXOA 5C5UA 3TOJA 2R062 4OUEA 3CKHA 4ZU7A 1UMIA 1C1FA 5FYBA 1C5IA 1YXWA 4D3WA 3CJIA 3NKTA 1AF9A 2PHWA 3Q9OA 3AKQA 5FZGA 3RWKX 2VZ1A 2FZ2A 4LBQB 2EIEA 2VZSA 4COYA 1C8M2 1L7RA 2WS93 4QGMA 1HB2A 3BUCA 3LGRA 1LHWA 3WQ1A 1OOPC 3LIGA 3MIBA 4QB2A 1XNBA 4XETA 4YG6A 4XJZA 1REFA 1XXNA 2EA7A 1NE4A 1VE0A 3VZKA 1CAWB 4CE8A 5JXIA 5GM0A 2Q30A 5J48A 1BJQA 1HRV3 4QDSA 1C4RA 2LM3A 2Q5TA 5JIAA 3WHUA 4CDUB 1T2XA 1UF2C 5DZFA 1PHMA 2PLV1 3LOBA 1PNGA 2VW1A 2YHJA 1PK6C 4BZ4A 1OA3A 4Y26A 1UX7A 1US2A 3SKVA 2HWF3 4Z1VA 3ETPA 4XE9A 3VB9A 2ZX2A 4XTPA 4AEKA 4YM3A 3ZDVA 5FZFA 5EFUA 5A7WA 3OUJA 3U10A 4B8EA 1FNYA 4JDMA 2CSGA 4CP9A 4HETA 5IK8A 4E4HA 5FP8A 3SMHA 3OBRA 4QX0A 3DUIA 4WZFA 1DF0A 1NCRC 1UO9A 2OPKA 2WYSA 1Q8OA 4R52A 5G05L 3T30A 2BFUL 5FR3A 4MZUA 2CWMA 2PHTA 3B69A 4P9XA 4RQPB 1IKPA 2QZ3A 3D0JA 3POYA 5FO8B 1UY4A 2TBVA 5FV3A 1X82A 5A32B 1SPPB 1HB1A 1GYKA 1VAVA 1VLNA 3MUZ1 2GNTA 3HJRA 5G04L 3ITQA 4EN9B 5KC6A 4ATFA 4UW4A 4NWVA 4CEYB 2QNKA 1BK0A 5FBJA 1AL22 2VQAA 1EP0A 4Z8BA 4QXHA 4IESA 2VG9A 4HVQA 4Q0VA 3CNAA 2XG3A 3CHXA 1VBD2 2PN5A 3KCCA 3UGFA 1YQ2A 2XPJA 2R0FA 3H8OA 3H8RA 3KWVA 1OSGA 2DBIA 4P9IA 3IMNA 1ND2A 1RUH2 1AX2A 2CDOA 1AVBA 2J1RA 5DG2A 2NP0A 4XBNA 2XJPA 3IIAA 4YVSA 1GUIA 3WINE 2K2SA 3JU9A 1IOAA 4FPLA 3GZTB 4URTA 2BZDA 3VBSC 4M3CE 3VKLA 3FL7A 3PU3A 4C0BA 2RS31 1OXCA 1UU5A 5C9AB 1NA1A 3B94A 4TN7A 2BBVA 1PGW1 4IGPA 4MHUA 5ACA1 2VC9A 1RUE3 5F2WA 2WSVA 5FZKA 1UYZA 3HN3A 5FZLA 5CFCA 3J7LA 4PBOA 3B7MA 1WCKA 2DV9A 2XWBB 1WWYA 5FWEA 5FP3A 3VBUB 2VGDA 4BYYA 2Q1FA 3ZFGC 3LDBA 1D4M2 1H4HA 2V72A 2P34A 5F5AA 5FZCA 4OHXA 4JHTA 1UXXX 2QQOA 2QDRA 3QH6A 3IZOA 3LDKA 3THPA 5DZEA 3LSDA 1IZ3A 4CXXA 2CYFA 2WO2A 5H9RA 2B5HA 5C4WC 5KHGA 2XLGA 3O1TA 3A7QA 5JLVA 1SLAA 1QQP3 1Q8PA 1XNKA 4RS5C 4WV8A 2A5ZA 4Z82A 4M3CF 2VMGA 2GNMA 3VZLA 5CG9A 4NWWA 4AL9A 3VLBB 3WW2A 4NPMA 4IERA 1O91A 3THTA 1A6CA 2UU8A 5I8TA 1NY71 2QQLA 3UKVA 4CCOA 4JGZC 3BOWA 1LAJA 3A0NA 4GJYA 5FK8A 3OF1A 4IE0A 2I45A 4CDXB 2X53S 4CDWA 1L7QA 3GZUC 4KU7A 1FPN3 4N43A 2XBO1 3LDRA 1ZNPA 2ZCWA 1X9TA 1ZZ6A 4GWMA 4BK4A 2VCBA 4YVWB 5JZGB 2ZACA 3BPZA 3KF5A 5IFTA 4GWNA 1D2QA 3NNLA 4IGOA 3UKTA 2K46A 1R1A1 1GMMA 1TMF1 2R072 1QNWA 1VP6A 4XDQA 4YGEA 4LBNA 3WNKA 1UPIA 1DCSA 3FHIB 1SLBA 3SITA 2XOMA 2A75A 3VHOA 3OTFA 2BEOA 4H7MA 1YQ8A 3VZMA 1KRIA 1JW6A 2CDPA 2WT0A 3H42B 5C8WA 1HXS3 1NOVA 1FMD2 3DPRC 2VNRA 4JTNA 1NZCA 2C9AA 4B4RA 3ILFA 5C3SA 3K3OA 4LEJA 4IV1B 4GJZA 3ILRA 1URXA 1Z7S2 2YFUA 3J8F2 4QGNA 2D6LX 1RMU1 5DAXA 2K0GA 3BTZA 1PM4A 4I30A 4Q4X3 4UYBA 1LJ7A 4BU2A 3ES1A 1OD5A 1OPOA 2GP3A 1PGL2 4XACA 3NAPB 1V6NA 5A70A 1SFNA 2E32A 2C0ZA 5CADA 3RS6A 2Y6LA 3LKJA 4L8QA 4WM8C 4UXAA 1I1EA 3U4SA 4GKYA 3QCWA 2EIDA 1VMHA 4OMCA 5FYIA 2AH2A 1J3PA 5FY4A 5LA9A 4DXTA 1ZRIA 2XDVA 1REEA 3OGVA 4DEVA 4QPGA 2VCCA 1VBE2 2WQZC 2Z79A 3FHQA 4FFIA 5F3EA 1GKBA 2QQNA 3B00A 1OA4A 1LEDA 1TZOA 3ZXFA 1LGNA 5F32A 5T52A 1VBA2 2WR9A 4X6RB 2RDRA 5JDBA 2WAAA 4EZ4A 2Y38A 3WG4A 4A6OA 4R4XA 1RUF3 5HCFA 3RMYA 2AENA 3RSJA 3TN91 4QQOA 3WW3A 4NJ4A 4XFCA 1DGRA 2XL9A 4ET7A 1VRH1 5HI0A 4LE4A 4S2HA 3MEPA 2XLFA 4DXZA 3BGAA 4J1WA 2HWD1 3UJOA 2WUHA 4K40A 4PT6A 3H50A 3BODA 4J1XA 3POEA 3ZN6A 4X6QB 5F39A 1N1SA 1QDOA 2JDNA 4WVWA 5CKQA 2VW0A 5FMDA 1FATA 3AP6A 1SLCA 3MLKA 4P14A 1BBT2 5E6HA 1O3SA 3N9QA 2W3JA 4BM8A 2VOVA 3MFCA 2ZA9A 4K8FA 3M2MA 4V2VA 2DF7A 1JYWA 4COVA 5AFEA 3O0VA 3LWCA 1G8WA 5CVRA 1PGSA 1UYPA 3NV4A 4GQ7A 2YMZA 1ZX5A 3FZ3A 4YW3A 3KMHA 4QWNA 4CPBD 2P4EA 4FOVA 2WNVA 2JICA 2WZR2 4KWLA 4QXCA 4RHV3 1UIJA 1G9FA 4IEYA 2WNEA 1V9U3 1OLME 4IDZA 1EV13 2GC1A 2NMOA 4C1XA 5BNOA 1H1AA 4FPJA 1TEIA 3LEKA 5LATA 2MNGA 4ASMB 4QQHA 4IEWA 1V6MA 5LASA 3R05A 4AEDC 4DUVA 2WN3A 4PLOA 4NIGA 1GQHA 5BNQA 2W2IA 1ENSA 1XQNA 4XQDA 1AR61 1B09A 1YEWA 4O9GA 5M0TA 4PDWB 3MYXA 2RDSA 1SBDA 5ERLA 4NRMA 1MACA 3LIHA 2Y34A 4AE2A 1JBCA 2DFBA 3H7YA 4QXKA 3OGJA 4IEPA 2DUQA 1QJY2 4Y5TA 4O9EA 4AG4A 1S2BA 3PUSA 5LA0A 4L99A 4LLOA 1TME3 4OQ8A 4ONUA 2VL4A 2AZ5A 4E9KA 3GBGA 4UFLA 1W6OA 2RMU3 4BXSV 1BKZA 1PZ7A 2ZABA 4D6QA 3Q8CA 3M3CA 4YYOA 4Y4YA 4YLZA 4C91A 5KXBA 2CTVA 4JAAA 4MGKE 4G9SB 2LRPA 2OVUA 2P5BA 2VJXA 2X5IC 4GB33 2DTWA 1J3QA 1K45A 4S2DA 3E6CC 1A8DA 1QXRA 4WVVA 3VKFC 1AXZA 5AVPA 1RUD2 1QJX2 1S0JA 5CKNA 1VBC1 1BVVA 4M4RA 1Y9QA 3ZMOA 2ADDA 4DXRA 2ATFA 1OFNA 4XJ9A 5F8PA 1OOPB 4JQTA 4Y22A 3VBOC 3KQ4B 3SC7X 2DCZA 2ZGMA 3T0DA 3CL1A 1RTVA 1W06A 3LA2A 1ND3A 1DGRN 1RUC1 4XXPA 2YC2A 2WDBA 3G6JB 3JD71 4AI1A 1PIV2 4HANA 3FX3A 1WMEA 2WT1A 2OKXA 1PK6B 3CEWA 3K46A 4OZOA 1AXYA 1GZWA 5EYYA 4EN7B 3UGGA 1FOD2 3AZXA 1XC6A 1RUJ1 4FTSA 1CPMA 3AMQA 1U5IA 4LT5A 1JYTA 2RS52 3JB4C 1IPSA 5JOZA 1PO11 2BU9A 4FCAA 1V6JA 4W6XA 4MO3M 2JDYA 1UOGA 2PLV3 4BXFA 3A21A 4GULA 1PVC1 3WNMA 2ORXA 3EXUA 4DY3A 1W6PA 2ARCA 5C6CA 5IYYA 3IIIA 1NCRB 4AQSA 1X8EA 4IXLA 4HXCA 1ZZ8A 4DINB 2HWF2 4AWDA 4TXWA 3THCA 2VUAA 3U11A 4CUBA 4KL1A 4WVZA 4QPIC 4JGYA 2VZ3A 1H6XA 4MUVA 2WQ8A 4LBMA 4ORFA 4AHXA 5A3LA 4XUNA 3I2OA 3BOPA 3ELNA 3EO6A 5SV8A 2G1MA 2HBUA 2VOTA 1N1YA 3IT8A 4CDQC 1HQLA 1P8JA 1F9KA 1OFSA 2ZGKA 2VMCA 3BIWE 3ZFEB 4XW3A 1IQAA 2RR12 4BIOA 5FPUA 4CCMA 3KCYA 2NN8A 4KG0A 3ZDSA 4DPNA 1LCLA 4QU1A 3ZIXA 4N53B 3PUAA 2ZKLA 5FMBA 1ASJ2 2O8OA 2PAKA 3OPWA 1QH7A 4UFHA 4LO8A 2YBKA 2PHRA 5IVFA 5FQ0A 1ZRRA 1W90A 2VUJA 3N7JA 2DDUA 2JDKA 1LB2A 4IEUA 2EIGA 4RYDA 5DDJ2 2FMDA 4Z07A 4Y20B 5E16A 3PUHA 4HK9A 4CPBA 3AM2A 2SBAA 3VBSB 2I74A 2L9LA 4AAPA 5FP7A 1JUHA 1QHDA 2A3YA 1UWWA 4QB1A 4XMAA 1WMFA 1JU3A 3IKWA 5FKCA 3HQUA 5FZIA 1K5MA 1YQCA 3RZZA 4Z2WA 3ZYGA 5C3OA 4XUQA 2XVKA 1AR72 2X29A 4CEWA 3AMNA 3I49A 1VB4A 1D7PM 4W65A 3S7IA 5JOXA 3JBG2 4META 5KXDA 4JCKA 1G6NA 3R4SA 5K7PA 4FAGA 2GH2A 2RS33 3RDIA 3RQ0A 1W9TA 1CAUB 3VBHA 5JUVA 1W2UA 5ACA3 3IDEA 4AVVA 3WQ0A 4K1YA 3N9PA 3LD8A 2AREA 4LTAA 3AP4A 1RUE2 1BMV2 5FPXA 3S7EA 4EV0A 2G9GA 2A1XA 2YZ4A 4RS5B 2FCVA 5AVAA 4I09A 4NVPA 3ZM8A 1JODA 1MEC2 4AVSA 1JZ2A 4YW5A 3R4DB 1WA4A 1H8TC 1JZ4A 2HWE1 1IGOA 2WNUB 2PHXA 4ZU4A 4JGZB 4NHKA 3W9AA 5HPOA 2DURA 1H8VA 3I2IA 3VDCA 4UAPA 1NA1C 1QKQA 5FIXA 4EWAA 4ITCA 2GAUA 1QQP2 3C7GA 2Q0AA 2QQPA 1G9BA 5EJ1B 1LOAA 2BERA 1DU3D 2JD9A 1MQTC 2IXKA 4CA9A 4BQ4A 5A3NA 2GZWA 1CD3G 2OW4A 2DBNA 4BQYA 2PQQA 5CFDA 4BIFA 3LFIA 3N4MA 4BE3A 3KSCA 3OPZA 5ABJC 1AYM1 3IAPA 2QQVA 2SLIA 1H9PA 2ZAAA 4FPCA 2ZGTA 4H7LA 1LGCA 1TVGA 2XBO3 2XL7A 1LOBA 4PF5A 4UWDA 4DY5A 5HV0A 1QF3A 2GC3A 4FOYA 5FOBB 3RNSA 3POGA 1UYXA 4Y5Z0 3RI9A 3RI8A 1R1A3 2HWB1 5FLHA 1TE1B 3ZN4A 1MS4A 1U12A 2GC2A 4PIYA 3I2HA 1ULDA 1J83A 1TMF3 4JDOA 3M3OA 2PAMA 3WF3A 2D44A 3LPGA 3ZXAC 4FPYA 2JJ6A 3OGSA 2BRTA 3S6PA 1C5HA 4AQTA 1YI9A 3NJXA 3MIFA 2IVJA 1LU2A 5E1RA 1ULGA 5LWBA 3KGLA 3LA7A 3OYWA 4FXGB 1KS5A 1W2TA 3H8UA 4N43C 5J36A 2D3RA 4OI2A 3JZVA 4HLTA 1GLHA 4XIOA 5DPNA 3KZ4C 4WM8B 1YO8A 1DLLA 1RMU3 3MI8A 4XDPA 2OYZA 3GYDA 1AR82 1AX0A 4JVAA 5FZ6A 2Y6GA 3IDBB 2D97A 4W50A 4B3NA 4KWKA 3RMXA 3BB6A 2BOIA 4FXKB 1F15A 2JENA 2XQXA 2HYXA 5DG1A 1RUI2 2ZMKA 5SV5A 5KWRA 4CUAA 3USUA 3DKWA 3ZR6A 2WO3A 4FPGA 4FPOB 2Y60A 2JG8C 3K51A 4Q5OA 1CZVA 4CXWA 5HV4A 3N9OA 1GOFA 4JDNA 4LBQD 2R16A 4OI0A 4G3YC 1OH4A 1H2MA 2VD7A 1POQA 5BNNA 4YRDA 2N7GA 1ULPA 3G7DA 5FKBA 2W5FA 3M4FA 3ZMNA 4C0HA 4FTEA 1NXMA 3PMEA 1W05A 5F1RA 4CU6A 4A44A 3FFQA 3WT3A 1VRH3 2QE3A 2RM21 3AVSA 4ISQA 1LKNA 2B45X 1MS0A 1R091 5F6LB 2HWD3 3ZXGA 3UESA 1W9SA 3I3QA 4OZXA 1LHUA 1XNDA 5F3IA 4DQAA 2J1EA 4LHKA 3SCGA 1GNHA 4QPGC 1HKDA 3FUOA 1DQ1A 4XF1A 2IFRA 4Q29A 1PMIA 4HVRA 3GF6A 2YU2A 4O61A 5CYYA 2YBPA 4ISRA 5I0SA 4L0PA 2ZZQA 4XXAA 4KGGA 4XF9A 1E5IA 2V5DA 1SHWB 2W87A 3DYOA 1EPWA 1O59A 4HZFA 1XB9A 2E51A 2E7TA 2D3PA 2E63A 2WZ8A 4KI5M 2VVDA 3WF1A 5LRRA 2CAUA 4FPEA 3OSDA 1HB3A 1H9WA 4AEDB 1ONAA 2Y6HA 1I5PA 3D6EA 1OC1A 1F31A 2C26A 2WT2A 3WG1A 4NIIA 1KEXA 3E6BA 3KB5A 1SACA 5D2AA 4P00B 1DZQA 3CZUA 1V9U2 3KT7A 2Y26A 3W5NA 3ACLA 1VIWB 2UWAA 3AKPA 3KVBA 1HN0A 2C24A 4DUXA 1FX5A 2EVXA 4P08A 2AUYA 4C90A 2WRAA 3AB0A 3LPFA 4YZ3A 5FY8A 2RG4A 3WR0A 3P3PA 4LBLA 1ENRA 5L19A 1RHI2 3ACIA 4I2OA 1AR63 1XRUA 2DVFA 1CESA 3ZPYA 3DECA 5IFPA 2YV8A 5CKMA 3U78A 1LULA 4HKWA 2PAEA 3NJVA 1JOJA 4R9DA 3T1MA 4UFMA 3MIHA 1OKQA 1LHOA 2IC1A 1QJU1 5D8AA 2YGLA 1W0OA 1D0GA 4AK3A 1IS5A 3MIGA 1R081 5BNOC 3RPQA 3KLSA 2BWAA 3GM8A 3OOXA 2UYBA 4F7ZA 4D6RA 1W2NA 4XURA 2CAVA 4N7IA 4DNYA 5IVYA 2W52A 3AZWA 3GZAA 1GBGA 3MW3A 3ZYPA 4TSVA 1CWPA 4LK7A 3PUIA 1IG3A 3AVRA 2IXLA 3H3LA 3UL2A 5BV6A 2OQ7A 2B9VA 1RVF2 2CGNA 2BV4A 2UWBA 1VBC3 2JIGA 5CIRA 4YG0A 1ZYBA 4QD2A 1C8NA 1S0GA 1GZTA 2PA7A 3K48A 2RDQA 1F2NA 2OX0A 1KITA 1V6LA 3AYCA 4FO9A 2IUWA 4LKSA 3ZFFA 4HMZA 2QZ2A 1XSRA 4M3CB 1RUC3 3IAQA 3CDZB 3WW1A 2VBDA 5C7GA 4FQZA 5IVVA 2RS12 2WO1A 3JD73 3IB3A 1NT0A 2HWC1 2VQTA 2MEV1 4LA3A 3INAA 2WFPA 3FBYA 4PF1A 1RUJ3 4K1ZA 4H2AA 4PCRA 5A6ZA 4QPIB 5LZ6A 4OUMA 2D6OX 2VR4A 3S57A 1PO13 4XQ4A 2HYKA 1OMIA 5FUIA 4HG6B 1ODNA 5DXDA 1FNZA 2CWSA 2JDZA 4LBQA 4LLFA 2KA3A 2R061 3WSOA 1OD3A 1PVC3 1JYVA 1YJLA 3VD5A 4QX1A 3DXUA 1YQ5A 4QX2A 2CNAA 3POBA 2F4PA 5FY9A 4AYUA 3HNMA 1ND3C 4CDQB 5K0UC 4Q4Y1 1CAWA 1C8M1 1UZYA 2VAUA 4U2AA 3HVDA 4FPHA 5A3WA 1GICA 3GCXA 4N90A 5AFBA 4A42A 2O1QA 4GKXA 3DYMA 2OZJA 4CDUA 2XUEA 1ULFA 2DTYA 5FZDA 1B35C 3ETQA 1KS4A 1N3OA 2VZUA 4BCUA 1JZ5A 4NMIA 3O1MA 4BQ2A 1GOHA 1SLIA 1GWLA 1F8VA 2FDFA 4FAHA 1W9YA 2FDHA 5FZ8A 4TLFA 4XJ8A 4W8JA 2XJSA 1O4ZA 4P9GA 4P9LA 4C8DA 3PJYA 1OKOA 1N47A 4N9IA 2HEVF 1YUDA 2D40A 1F5JA 1VALA 2FHRA 2HEYF 3MHZA 2J1TA 3FBMA 4HKLA 4MGSA 2XKPA 3AYDA 3H7JA 5FZ1A 3ZSEA 4HPKB 5E8AA 1UMHA 3ZXJA 2WKKA 5FZ7A 3PLQA 3BPSA 4LUMA 3V0AB 2ZGLA 4RQPA 4Q4V2 2VVEA 3DXTA 3NO8A 3ZOIA 3GBFA 5FO9B 5LY2A 2FDJA 5A32A 1SPPA 5JVVA 4PI2A 4XOGA 1WMXA 4CP1A 4Q26A 2YFZA 4ARYA 1W3XA 2XLAA 2LALA 4YM1A 3RRDA 1O3TA 4CEYA 1AX1A 5C3RA 1V00A 1VRBA 2OPWA 4UFJA 1N3PA 5I0DA 3ZLIA 4LHLA 4GWIA 1TNRA 4AGGA 3O1UA 3M3EA 4IEVA 1VPHA 2V4AA 3WNLA 5DN2A 4BQ3A 3ABZA 5CBLA 2JD4A 2RV9A 5FYYA 4K3UA 1JXNA 3VBRB 1WW7A 1AL21 1BK1A 2EAAA 1PX4A 2C6SA 2WA4A 3AXDA 4TTGA 1H8TB 3D3AA 2GP5A 3WDUA 5BNPC 1SFPA 2I07B 1VBD1 2O0OA 3IPVB 3F2ZA 2JE7A 2R042 2OUHA 2WSUA 1Y9MA 2H0BA 4CSWA 5HCHA 3B5LB 1S0CA 4FBFA 3KCXA 4Q4W1 1ZBA2 1RUH1 2KR2A 3U07A 1JYNA 1SCSA 4MGZE 5FMCA 4CEWC 1MQTB 3AX4A 5C9AA 1OURA 2HWE3 1U5ZA 1UAIA 1WLWA 2V4VA 4L9BA 1NKGA 3UT0A 2ZX3A 5ABJB 2F6BA 4QHOA 4RR3C 4EJRA 5IAXA 4ZHNA 5FPVA 5DAQA 3UNPA 4HT1T 1WKYA 1DQ6A 1MS5A 1SMVA 2EICA 3NJYA 3QLQA 3VBUA 3POSA 4DRRA 4YZ5A 3L2YA 3NJZA 3HT1A 3P5BA 1W8FA 3GJAA 2YPJA 3PVNA 1AYM3 4GALA 4IEXA 1D4M1 1NLRA 1UPSA 3N7KA 5LRSA 2XVGA 4XFBA 3WQ7A 3DKQA 1QJZA 4MYEA 1UY2A 2RJKA 1LOGA 2HWB3 2JG9B 4N7UA 1H2LA 4EWEA 4XUOA 4DMIA 1QJFA 1EAH3 2BOJA 3EJKA 1UD1A 3OG2A 1CX1A 1RL3A 2HKXA 5EJZB 3W58A 1LHVA 4CDXA 5C71A 4B4QA 2BJSA 3OUHA 3NW4A 4D6SA 1L7LA 3S30A 2DU1A 1UZZA 3SISA 4MX3A 5F37A 1DGWA 1DIWA 1T6GC 2GU9A 2VOKA 4YVWA 2DWRA 1W3VA 1YWKA 2VXRA 3E5XA 4HN0A 5JXHA 3MF6A 1YQ6A 4GXLA 2PTMA 3KM5A 4EN8B 2R0HA 4HSJA 3AK0A 4NPLA 1HLCA 1PMJX 4DS0A 1PO22 5EYXA 1O4TA 4BMEA 2F4LA 1RMU2 4AW7A 2PHFA 3K75B 4QU2A 3I3MA 2W08A 4EZHA 1ODMA 2JDMA 1UOJA 2QUOA 4YM2A 1Z78A 1DGWX 4LMFA 4QX7A 3TEXA 1YYNA 5HXMA 3A22A 3IDAA 2R071 4X8PA 3SHRA 1LOCA 3M7AA 3FE5A 5FUNA 3NV3A 1RGSA 3AP9A 1JI6A 2EXJA 4CUCA 2WFF3 4IV1A 5FXWA 3JXSA 3LZZA 2UY8A 3TRSB 3T08A 5I0RA 1OF4A 4YGBA 3B9CA 1KDKA 3WP6A 1FMD1 1QXPA 1H1IA 1HRI2 1OPMA 3FC0A 5L36A 2ARAA 5APAA 3NAPA 4FFHA 3I2KA 1Z7S1 4UI9L 1V70A 1O5LA 2WL1A 3L9JT 3IBMA 5DAWA 3AKTA 4NHMA 3SH5A 1BHGA 4IV3C 2G9FA 3QBQA 5FWJA 3OY8B 1PGL1 2D43A 4PI0A 3FN9A 3OBAA 5LK5A 2ZBJA 1NCQC 1POV1 3DEMA 5T5PA 5KC5A 3KHCA 3KV6A 2RM23 1RUG2 5FJHA 1VRH2 1UY0A 3SKJE 3VHNA 4CCKA 1R093 1W6MB 1IS3A 2B39A 5F5QA 1W8ZA 3KV4A 1ZBE2 2HWD2 4EN6B 2G9ZA 3V0BB 2OS2A 5JI9A 4W6WA 1JH5A 1W2AX 5J37A 1WZXA 1PX3A 2D5HA 2KXLA 4KWUA 1I9RA 4CP0A 5L7OB 3PVEA 4NRPA 2BGPA 2EIBA 5DAVA 3URFA 4XJWA 5FZ0A 1ACCA 3O7OA 5BNNC 1OQDA 3HOBA 2Q8DA 3K3NA 3WVJA 5LW9A 1CAXB 1JOPA 2D6NA 1VBA1 4WZCA 1HDKA 2WINB 4FP2A 1Q8SA 4FT8A 5JPNB 1D2SA 4BISA 3ST7A 3M3QA 3OEBA 4JRAA 4LBOA 1K3IA 3NQHA 2DVGA 5KHHA 3HWJA 4XFFA 5GKAC 4XF0A 3BTXA 2Z4FA 3BU0A 1VB2A 4W4ZA 1V6OA 2GNBA 4MXVA 3VHRA 1O4YA 1YFWA 4LE3A 1V6KA 4U36A 1E5SA 1QH6A 2DUOA 5CU1A 4F3JA 4KWJA 1H1MA 4KG8A 1BBT1 2ETEA 1JS9A 4QHBA 4OI1A 3U75A 1EY2A 2XUMA 4A4AA 1VBB2 2A71A 4XMIA 3LB9A 1XPWA 4WM7C 3ZYFA 2WWSA 4EROA 2R1BA 3AJZA 2C4XA 2GMMA 1FI2A 3HNBM 1AR62 3N9MA 3VDDC 3MFAA 1SLTA 2IFWA 4XFHA 1K5JA 1WW4A 4OCTA 1QJEA 2A6XA 5JSPA 1H30A 1QJU3 2WZR1 2JXAA 4YW2A 1POV0 1IS6A 2NYYA 4PIXA 1R083 1MZ5A 2VZTA 2XGXA 3BYWA 1RXGA 3HNYM 3MO4A 2XWJB 3OBTA 4MADA 2FCTA 3LEIA 2WQ4A 5FFOC 1DGLA 5GLTA 5F7UA 4GH4B 3PUQA 2VMIA 2Y64A 1CN1A 4PDWA 4A3XA 4COZA 3WP3A 3KVAA 2JX9A 4R9AA 4XC9A 1JZ3A 2VUCA 3TWIA 3W59A 2ZHNA 2AEYA 4UOJA 5C8CC 4MGYE 4H3WA 4AAXA 5LY1A 3RZJA 3ZYBA 2WLQA 5FYVA 1JYIA 5T3NA 3VZJA 3AMHA 5IWFA 3ES4A 1QJY1 2ZX4A 3AL6A 5LK7B 1JOBA 1Q43A 3VD4A 3KT4A 1HQWA 4JV4A 5A3TA 4MVTA 2QFEA 5FCCA 4GIQA 5FTTC 1RUC2 3WUDA 5F9TA 4AI0A 2HWC3 4YZ1A 2WS92 2MEV3 4P02B 1ZREA 4AQ2A 2ID4A 5IATA 1G7YA 1KDMA 1OOPA 2YG0A 4HSLA 3VBFC 5LEJA 1RUD1 5K0UB 4A45A 3ZSKA 2WIIB 2W39A 5EV7A 5FPBA 2B46X 2BQPA 1JMUB 1YLLA 3BU7A 4GMP1 2R063 4Q1PA 1HRV2 4JKMA 2OUJA 2W91A 3I2FA 3OPTA 1F4AA 3TEWA 2YGMA 2JE9A 2H0VA 4JZRA 4LXLA 1PK6A 3CJIC 3O1PA 1B35B 2JEMA 4Q4Y3 1YIFA 2VY0A 3MDPA 4FP3A 2KM2A 4EQVA 4DB5A 1PIV1 3M70A 1WCSA 4AFBA 3ZX7A 4JTOA 4XFIA 3VZOA 4M0NA 1JZ7A 5F5IA 2ZGRA 2WO7A 2Y0OA 1FOD1 2JIJA 4HK8A 3AZVA 2FQPA 1PZ8A 2DCTA 2ZHKA 5EQUA 2Y6KA 4Q0PA 1S55A 2RS51 1NCRA 3PL0A 3RYKA 1FT9A 4GZ9A 3TEYA 3M3IA 2XJRA 4Y1ZA 5GZFA 2TEPA 4CCCA 1DHKB 1NQDA 3CF6E 3R0RA 2A3WA 2E31A 2Q8EA 5I91A 3HN1A 5FYSA 1W39A 4CCDA 5A6YA 1JUIA 1HX6A 5BYNA 3AC0A 3DF0A 1W0PA 3A23A 3OJBA 3HEIA 3J7MA 4QPYA 2W1WA 1KD7A 5LBCA 1OBNA 4BHPA 5B4XA 5GLUA 4EN0A 5T54A 5F3CA 2Z42A 1MPXA 3NNFA 4DOUA 2VNVA 3IN9A 4ARXA 5J96B 4CDUC 4XF3A 3I59B 2D6PA 4WVMB 4LUKA 1YNAA 2ZEZA 3NMBA 1GQPA 3WHTA 3ZFEA 3QH7A 4Q2FA 4D7YA 2W1QA 4M4PA 4DXSA 2ZEWA 3LCPA 4N53A 2RDNA 2WNOA 3WV6A 4A6SA 5FJKA 2VZQA 2RR11 4HN1A 2BW8A 4QKNA 1MS9A 5BNPB 3HR9A 2W0XA 3SEPA 2RJLA 3OD4A 1SDWA 2X10A 4YNIA 5F3GA 5A7QA 1ASJ1 1QOOA 2F17A 2YY1A 3JUUA 1A3KA 4GMP0 2QDNA 4Y20A 4E2GA 3DL3A 3MIEA 1UU4A 4RQPC 5AC91 3VBSA 3LA3A 1JHJA 2LTNA 1W03A 3ZFGB 3HPNA 5JR2A 1QY4A 1IPJA 3VV1A 1COV1 4LBKA 2GH8A 5DDJ1 3T4VA 1VBD3 1NYWA 4I0BA 3PHMA 3H1WA 5C4WB 1HB4A 4YGDA 3EYPA 4Q4W3 1RUH3 1ND2C 1GZ9A 3NSTA 3T09A 4BLIA 1AR71 2FZ1A 3FJSA 4XHXA 1CAUA 3ZFGA 4YVSC 4A41A 3ACHA 2ZHMA 5HCBA 2HWE2 1WD4A 2KD7A 2ZS6B 4OQ9A 3T2TA 3ZKYA 2GALA 3JBG1 5JOWA 3EB7A 2Z2SB 1S0EA 5C4WA 4M01A 3JB8A 3SXWA 3B02A 5IK5A 2R7EB 2X09A 4YW7A 2AYHA 4FQ4A 4ASLA 5HCAA 4RS5A 2A6ZA 1FAYA 5F5CA 4LK6A 3E5QA 3WQBA 2BNMA 2ENRA 5FREA 2CHHA 1YRZA 5FYZA 1Y43B 1BMV1 3N9NA 4YZ4A 3ECQA 5LB6A 3MW2A 1O6UA 1W6NB 1QEXA 2D98A 3AFKA 3LEMA 3MLLA 5CFCC 2VMDA 4PBPA 2WNUA 2VO5A 4JGZA 1G86A 4AEJA 4IEQA 1OUSA 2B7YA 1UMZA 1AYM2 3K4DA 4AVBA 1MEC1 4P9WA 1UZVA 3I3DA 1ST8A 3THDA 1UKGA 1FPN2 3ASIA 3PNAA 2VNGA 2VQ0A 3WF2A 1U5YA 2XONA 5DZGA 4ES9A 2YROA 5A3PA 2RJ2A 1LU1A 5HXVA 1GU3A 1NLQA 1R1ZA 1H2NA 3ZYJB 4NN0A 5FXVA 4AFDA 1XNTA 2HWB2 3W21A 1QIQA 4AHYA 5KBFA 3SEEA 5B2GB 3DPRB 4XYXA 4KQ7A 1EAH2 4G4FA 3ZR5A 2MPFA 1H0BA 2XR4A 3RZKA 3VBUC 3CQOA 3ZIWA 3POJA 1J58A 2YU1A 3L2HA 4H14A 5IW0A 3O5SA 3H3UA 1Q8VA 5BUVA 5EIYB 1OVSA 4INDA 3PDQA 2ADEA 3T2OA 4P5YA 2VTXJ 2UYAA 2QCSB 5IVJA 4BQ5A 1LENA 4CDWC 4D69A 3B9IA 2WJSA 1HXS2 3H0OA 5GZCA 3NNGA 4XZPA 4LIVA 4ZZ8A 1JYCA 2Z5WA 1CAVB 4V1PA 2WWUA 2E7AA 4LO4B 4EYUA 3USSA 3JQXA 1UU6A 2K9ZA 3O0XA 1LHNA 4R9CA 4Q4X2 3D82A 1YI7A 4LHNA 5EZWA 3WNNA 2R073 3J26N 1QU0A 2HBTA 1ZA7A 2GMPA 1UKRA 4AI8A 1BEV1 4BK5A 4RFT0 5IHRA 4ASKA 5KXEA 4IV3B 4B29A 5JZGC 1ENQA 4WM8A 1WA6X 2WFF2 1AR91 4QDQA 5EHDA 3WCRA 5LCWL 2NZ9A 1WLCA 1FMD3 1NCQB 3J4UH 1W28A 5LEKA 1GNZA 2FDGA 1HN1A 1Z7S3 4UFKA 2VPVA 3ZYHA 2C1FA 1XU2A 1W6QB 1XYPA 3IM0A 4SLIA 5A33B 5F6KA 1DP0A 3WDTA 5JMCA 1EYBA 1XU1A 1AR81 4K7JA 4BQXA 1HQNA 1BLZA 2FBEA 3KV5A 2PHDA 3TN93 3AYAA 3VN4A 3DYPA 1RUF2 2D7FA 2Y6FA 4QQLA 4KH9A 1XE8A 1WW6A 1RUI1 1W6QA 3PVOA 3I3BA 3IWZA 1W8OA 3RYRA 2VCAA 4XTMA 1SQ4A 3ZKUA 1DQ0A 2ARBA 4AF9A 4BOWA 3KV9A 1RUOA 5JSOA 4E4SA 1SG3A 3UK9A 2NM1A 1GWKA 4UW5A 2ZJCA 3U4XA 4IETA 3LSEA 1S4CA 4AI9A 1VBA3 1H6YA 3PVBB 2E53A 5FP4A 2XJUA 1KJLA 3C2UA 2D6MA 2JWPA 1JN2P 2QQWA 2DVAA 3TNPB 1LNSA 3WP5A 3RYPA 4CCEA 3ZN5A 5KHKA 2QTWB 1ULEA 1MR5A 1JZ8A 4P9YA 2E26A 1V0AA 2WBKA 1ZA4A 2XVLA 3C7FA 3MF9A 1Z0HA 3RG0A 1GANA 1PM7A 4Q0UA 5FBZA 4YW1A 4QX8A 2HEWF 2WZPP 3TEZA 2VTFA 1MS8A 4WM7B 5FZOB 4TWTA 3NNJA 4RHV2 2DYCA 3ZXKA 1IQDC 3FUQA 3VDDB 5FPLA 1WLTA 4AVCA 3JCIA 1XJAA 1EV12 4CRQA 4MXWB 1BBT3 3SH4A 3WNXA 4UF0B 1S2KA 3WW4A 3ZVXA 4LITA 3I4IA 1UIKA 1UYYA 3AJYA 1KFXL 3VL8A 3SCHA 4AEDA 3C7EA 1E57A 2LW8A 1N3QA 1WCDJ 3VDBA 1G9AA 1E5RA 3BI3A 5LA2A 4JX0A 3PJQA 4BJ0A 1Q5OA 1S1AA 3T4HB 2ZHLA 1VMJA 4OYUA 3WXPA 3CO2A 1HW5A 1PVXA 5DUUA 1LRHA 1A34A 5E89A 2XB6C 4OMDA 4D7SA 3RJRA 2X5IB 1HJGA 2WZR3 2WNVC 1SCRA 1UN1A 3Q8AA 1DFQA 2J42A 2V5YA 5JIUA 1TME2 4EWDA 5C8CB 2BFUS 2RMU2 1BVP1 1NX9A 2A6VA 4GD4A 5H9QA 5ISLA 5FLIA 2UURA 3FLRA 1G9CA 1VMFA 4PQ9A 4UBGA 3NWKA 1XNCA 3MW4A 3VBOB 4BA6A 4CCJA 1YJKA 2FCUA 4AI3A 3EBRA 4FTBA 1AZDA 1CJDA 4GB32 5FY1A 5EPAA 1RHI1 2HH9A 4P5HA 3B3QE 1HV0A 4XEZA 3UKNA 3AL5A 2GC0A 4XAEA 1XBFA 4B1MA 3QD6A 5IAVA 1ZRFA 4K6BA 2AGSA 3O14A 1CX4A 1QJY3 1CGPA 1L3JA 1UZWA 3DGTA 2WZEA 3VBFB 1MVEA 3ZSLA 4K8RB 1AYN1 3VBOA 4ZS3A 4RD7A 3I3EA 3PIGA 2H6CA 2ZMNA 1HIXA 4OHZA 1XE0A 4IE4A 2DVBA 4YG3A 4RGAA 4Y5SA 3S0MA 4HFSA 1CIWA 3BTYA 1Q3EA 2MEV2 4IGQA 5LBEA 1ZRCA 1NQJA 4EE2A 1RVF1 3CJIB 4DO0A 1UW8A 1RUD3 3GGLA 3V65A 2BWCA 5CAZA 1YFUA 5CZKA 3T0BA 3GALA 1ULCA 4GMP3 4M3CA 4QB6A 3AZZA 3LF7A 2YXSA 3P3NA 4F8AA 1N1TA 4D7TA 2QQJA 1AXKA 4A2UA 2CGPA 1XNAA 2O8QA 3PMSA 5FYMA 3VHPA 3SQOA 2ZTNA 3SH3A 2PLV2 3VUOA 3VD7A 4XAAA 2G19A 1WBFA 1WW5A 4IE5A 3PIJA 3C3VA 5EXOA 4AFCA 4Q4Y2 3FLTA 2RS11 1PIV3 4E4DX 4QPIA 1OF3A 1GP5A 1YC61 5D21A 3MV01 1CZSA 4OI4A 1FOD3 1UY3A 3DV8A 3C7HA 3N35A 4CTEA 3PTYA 2RS53 1ZZBA 4BLJA 2VVFA 3IMMA 5A7WB 2BGCA 2VULA 2GSYA 4CDQA 4ES8A 1BYHA 4YARA 1JU4A 3PTRB 4XFAA 4CP9B 1CONA 3MLJA 4DFSA 4JHZA 5FZAA 5FY5A 1KQRA 2RHPA 3ACGA 4FI9A 4LHSA 3AYEA 2JKBA 3ORJA 4NAMA 3ROUA 2VMHA 5T5LA 2CGOA 4FSJA 3WUCA 1F5FA 2EF6A 2VZOA 2VZVA 4HOOA 4QHZA 1UL9A 4AHWA 1DYPA 3WDYA 3I2GA 4JGYC 4RFRB 4XUPA 1CPNA 4Y24A 2Q8OA 1DZTA 1UX6A 5K9YA 5FXXA 2W92A 2HLEA 2YYOA 4QM9A 3K4ZA 3U1XA 5EP9A 3KQRA 1MZFA 4YGCA 3WCSA 2MHFA 3SNMA 5C5TA 5L73A 5LA1A 1T6BX 2AC1A 4Q27A 4ZS2A 4NIAA 4AVTA 5FO7B 2JDAA 5K4LA 1X33A 2RE9A 2W9XA 2RR13 2DCJA 2W1UA 2XJTA 4HPKA 4D94A 4FVVA 2B8MA 1W8UA 2R49A 3V0AA 3N36A 3VGIA 3C8XA 2W68A 1ASJ3 2PQSA 4KBBA 4XQWA 5AC93 4Q0SA 1FV2A 1RXFA 2EXHA 3AKSA 5JMOA 1ND2B 2JDPA 1X8MA 2RS32 4Q4V1 4XVHA 1O7FA 2ZX0A 4YVSB 1COV3 1LECA 1PGW2 3A0KA 2Q1MA 3HIFA 5DDJ3 3ZFEC 5ACA2 1SEFA 1KFUL 1OLQA 2W46A 1BZWA 4NHYA 2VBBA 4N53C 1NA1B 1NLSA 1U0AA 4Y3OA 1K5MC 5C3PA 4Q4W2 3M1HA 1AR73 4I0AA 3VBRA 3GCWA 4Q8KA 5CFCB 5T5JA 1H8TA 4BWOA 3JBG3 4ZU5A 1UY1A 2E9QA 2BUKA 4QDRA 3H1MA 5T50A 1ZRDA 4Z2AA 3WDXA 3IPVA 4XPVA 2VXJA 1J3RA 3WDWA 2QVSB 2WA3A 3VBHC 4OHYA 4K9SA 5FRAA 2WN2A 3LQCA 3HBKA 4Q8LA 4QPWA 4CU9A 2JE8A 3VKOA 1IKQA 2BNOA 3AMMA 4XFGA 1NAEA 4YPJA 4GAZA 3QOPA 1MQTA 3OGGA 5J3UA 1NY72 2XHKA 5A80A 3EQEA 2R041 3CMGA 1AJKA 2VTXA 1O5UA 1MVQA 3BTAA 3UJQA 1MEC3 1ZBA1 5ABJA 1QGLA 4UT5A 1W04A 3SLIA 1V6IA 2XBO2 4Q1RA 3TAYA 5A7PA 5J1XA 1XSQA 1J84A 1FYUA 1I3HA 1MS3A 2P3IA 3M8LA 4O7XA 4PHZA 5J7MA 1WD3A 2A7AA 3AP7A 5IK4A 4RGKA 4CDWB 4ZKTB 2VMEA 2QQKA 4PJYA 1X50A 4N43B 3WY6A 4J6GA 1R1A2 4IUGA 1F35A 2Y0IA 2YPDA 1TMF2 4KMQA 1RUNA 5I0UA 2ZGSA 3NV2A 3K4AA 2WNUC 3UV9A 3T1LA 2UY9A 3VKNA 5CFDC 4L97A 3K77A 1SBEA 2XQRA 4LULA 3X29B 1GQGA 4ZXKA 3RZMA 1OQ1A 3OB8A 2JG9A 5FZHA 1S0FA 3WF4A 3HMYA 4D0QA 2VW2A 4OULA 4XHBA 1F4HA 4I02A 4IQPA 4LJHA 3WG3A 2ZOEB 3N7MA 4CUGA 4PLMA 3WD5A 2BNNA 2JG8B 2PXJA 3AZYA 1BEV3 1OLMA 2DVDA 3ALQA 4XIKA 3I2DA 5FUPA 4MV2A 5A7NA 5CB7A 4K21A 2VE1A 2XJQA 5FY0A 3J7HA 4E4ZA 3O1SA 1AR93 3ILNA 3ZXLA 2RVAA 4MH0E 3CZJA 5B4NA 4MG2A 2ILMA 1G9DA 2ARXA 2R30A 1D4VB 4UW3A 3J9SA 2VU9A 5L9VA 2JG8A 2BVVA 1PO21 4FOQA 1ENXA 1QOTA 3AP5A 4Y1UA 5JR7B 3HAGA 4BMBA 4D8MA 4YW4A 3J8F1 1CZTA 3T0AA 3V64A 5GLZA 1AR83 3DCQA 3W20A 1OT5A 2ZEYA 1FXZA 5BXXA 1RITA 4QPGB 3FFZA 3O12A 3TN92 1YFYA 3B01A 5CNAA 3HQRA 1VR3A 4XILA 1RUI3 2W95A 4TYSA 3ZXEA 4BH9A 1DDLA 1AJOA 1SBFA 1NE6A 1WCQA 1OHFA 2PHLA 3FLPA 1HRI1 1RINA 2J1VA 2JDUA 1DLCA 1ZM1A 3OY8A 4IW3A 4COWA 5GZEA 4UFIA 3WP4A 4XBLA 1LOFA 4QQ2A 1VBE1 4E2QA 3J7NA 2QQUA 1DG6A 3RZLA 5H9SA 1W6MA 5CG8A 2XJVA 1RC6A 3NL1A 3ZN6B 4AOCA 1C57A 5T55A 1WLDA 3ZYRA 3TYJA 3RGBA 2R32A 3T3YA 3U14A 3WDVA 3V0BA 1CIYA 1RUG1 2PYTA 5FZ9A 2ZGQA 4LR4A 5JXGA 2ET1A 5LBBA 3GDBA 5L7OA 1C3HA 2EXIA 2WC2A 3POFA 4KBZA 4QMAA 3Q8BA 2I2SA 2P17A 2P3JA 1RJ8A 2TUNA 2ZEXA 4QX3A 1ZBE1 4DZGA 3AXEA 4E27A 4AHZA 4C1WA 4NAOA 1A78A 1CAXA 3EMRA 1YHFA 3I97A 4JRLA 1A8MA 1UCXA 3PU8A 5IJRA 2E6VA 3JQWA 3WG2A 3NVCA 4X8NA 5A1LA 2YC4A 3E1F1 1DYKA 3AMPA 3GJBA 1H2KA 5A6QA 5C70A 2WNVB 4QKBA 4E8CA 3PURA 5A3UA 3NNMA 4AI2A 4JKKA 3ZSJA 4MHRA 5BNOB 4CXYA 4NIHA 4AFAA 1MS1A 3ZO0B 5JWPA 4LOTA 4HBNA 1QXJA 3RVHA 3VD9A 1O8SA 2IVIB 2EAKA 3GBWA 1W8WA 4YFZA 3ACFA 5FYUA 4TZDA 5GALA 4AEMA 4CCLA 3OUIA 4L92A 5ANNA 1QDCA 2A6YA 5J09A 1J59A 3MIDA 1I6XA 4SBVA 4IEZA 4FFGA 4XDOA 2DUPA 3VL9A 4NPRA 1JTZX 1VBB1 4J25A 4RA0A 1W6OB 3D8CA 1RHI3 2G4IA 4LO7A 2YDEA 2X05A 5JPMB 4V2WA 1DQ2A 5FAXA 2A73B 3E5UA 2QQIA 1QWRA 1VBC2 1IHMA 4B7KA 3MICA 4M0HA 4XZUG 3UGHA 4GH4A 1PZ9A 1W99A 3BN6A 1AYN3 2R6QA 3FMGA 5D8AC 4MGTA 2GMEA 2AEZA 3O1RA 3VZNA 5FZ4A 2D93A 2ORZA 5K8SA 1GP6A 3WOGA 4Y22B 1GNYA 3P1IA 5FXZA 3WNPA 1GFF2 3B93A 3JD72 3K2OA 2VOXA 2GN3A 3LE0A 2WYFA 3ME2A 5FYCA 1W8HA 4I3PA 1UNBA 1RVF3 3DN7A 4N8MA 4S2GA 3OCPA 4TLGA 4WBBA 2IZWA 4BB3A 2YBSA 1C1LA 3H1YA 2DCKA 3RJ2X 1ND3B 1QJX1 1VAMA 1RUJ2 2QJVA 2YUEA 4F83A 2B4KA 5EWSA 2E33A 4MLOA 3U37A 3IDCB 3FWEA 3R4UA 2ZGUA 2V09A 2DCYA 1HV1A 1PO12 1BCXA 1GZWB 5IVEA 4NRQA 1PVC2 1ZZ9A 2EALA 3GHNA 3T2QA 1XYOA 4IE7A 3KHBA 1S0BA 1LR5A 4OHWA 3ZFFC 1CQ9A 4BQWA 1S0DA 1K12A 1MZ6A 4OUSA 2RS13 3RWNA 1C8M3 5K0UA 4DRVA 5DMYA 3RZGA 2PELA 2WS91 2OXBA 2BVBA 4LPLA 3FHAA 1W6PB 4MGQA 4QQPA 2XH6A 1HJFA 2WABA 1DQ5A 2ET7A 1APNA 3UETA 4YWAA 2CL2A 3F95A 1BQPA 4URAA 1IG0A 2UWCA 2VOWA 4JGYB 5EJ3A 2OIIA 1B35A 1IS4A 4CYDA 3ZXDA 2ZZJA 1GV9A 1HRV1 5A6XA 1O3RA 1O8PA 3S5QA 1VAKA 1WMDA 3CBNA 4FOWA 1BXHA 3WF0A 1REDA 4YW6A 3S5AA 1M06G 2BBAA 1N1VA 2A3XA 2HWF1 2J22A 4QGLA 4XF4A 1Y4WA 3KS7A 4LKEA 4XBQA 5FYTA 2P3KA 4CZSA 3H3ZA 4E8DA 3MPBA 2YB7A 2JB8A 2QKDA 4A3ZA 2ERFA 3RZHA 1JZ6A 2BYVE 4YZ2A 4PQQA 1R64A 5J98B 3I7DA 2R1DA 5JZGA 5JI7A 5JCTA 5FYHA 4Y1YA 2ZGOA 2JDHA 1XYNA 5IVCA 5FQ0B 2NQYA 4NOTA 4XJAA 5LBFA 5IUQA 2CY6A 4AFMA 5FZ3A 1IPKA 1NXD1 3NRUA 2NMNA 5GZDA 1OA2A 3I59A 5T5OA 2VZRA 3TBDA 1DQ4A 5CEHA 4WVMA 4O65A 1Q8QA 5DUXA 3SCFA 5FZEA 2ZGPA 5FP9A 5C3QA 3GHMA 1LESA 3I8TA 3KF3A 4L11A 1K5MB 3KT1A 2ZAHA 5AC92 4KU8A 2B42B 4Q4V3 1AL23 2W94A 4CEWB 4B7EA 2Q4SA 2D5FA 1COV2 2DFCA 4ZXEA 1MZEA 5FPAA 1CVNA 4KGQA 5A1FA 5BNPA 5GZGA 1DYOA 2CV6A 2A70A 3OGRA 2AACA 5I93A 3ENRA 2J1SA 1X9PA 2P1BA 1OH3A 2IXHA 4RR3B 5F2SA 3VBHB 2P6CA 2YC0A 5FZMA 4CEYC 2LROA 2OA2A 4AR2A 4LIUA 4CU7A 1W0NA 1SFYA 4LQRA 3N9LA 2GN7A 4NHLA 5FDBA 3NV1A 4AGRA 3POIA 4A7YA 1GP4A 1QOSA 2NPIA 2ZKNA 3LAGA 3OD0A 2J7MA 4ZZ5A 2ZXQA 5KR7A 1JYXA 5ANQA 1SZBA 2OT7A 2P37A 4PLNA
chains in the Genus database with same CATH topology
5L9VA 2JIGA 5LATA 2RDQA 5LASA 2JIJA 3W20A 5EQUA 3NNLA 3PL0A 4Q5OA 5HV4A 5IAXA 4NHXA 5DAQA 4XCAA 5M0TA 3HQUA 3OUJA 3HQRA 2RDSA 5ERLA 2Y34A 4Y5TA 2FCUA 4NHYA 4BQWA 5EPAA 3GJAA 4IW3A 2HBTA 3NNFA 4XCBA 5L9BA 3W21A 4ZPIA 5IAVA 5DAXA 3DKQA 3ITQA 4XACA 2A1XA 2FCVA 5LBBA 2RDNA 4Y5SA 4KBZA 3OUHA 5LBEA 3GZEA 4NAOA 4XABA 3EMRA 4NHKA 4BQXA 5LA9A 5LBCA 4NMIA 2FCTA 3GJBA 5L9RA 5A3UA 4XAAA 2G19A 4XC9A 2RDRA 3NNMA 4BQYA 4MHRA 3KT7A 5HV0A 4UWDA 5LBFA 4MHUA 3BVCA 5DAPA 2RG4A 3KT4A 3OUIA 3MGUA 3KT1A 5DAVA 5C5UA 5DAWA 4NHMA 5IATA 2OPWA 4J25A 5LB6A 4ZONA 3NNJA 2V4AA 2G1MA 2HBUA 4NHLA 2Y33A 5EP9A 4JZRA 5C5TA 3OBZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5L9V A;  2JIG A;  5LAT A;  2RDQ A;  5LAS A;  2JIJ A;  3W20 A;  5EQU A;  3NNL A;  3PL0 A;  4Q5O A;  5HV4 A;  5IAX A;  4NHX A;  5DAQ A;  4XCA A;  5M0T A;  3HQU A;  3OUJ A;  3HQR A;  2RDS A;  5ERL A;  2Y34 A;  4Y5T A;  2FCU A;  4NHY A;  4BQW A;  5EPA A;  3GJA A;  4IW3 A;  2HBT A;  3NNF A;  4XCB A;  5L9B A;  3W21 A;  4ZPI A;  5IAV A;  5DAX A;  3DKQ A;  3ITQ A;  4XAC A;  2A1X A;  2FCV A;  5LBB A;  2RDN A;  4Y5S A;  4KBZ A;  3OUH A;  5LBE A;  3GZE A;  4NAO A;  4XAB A;  3EMR A;  4NHK A;  4BQX A;  5LA9 A;  5LBC A;  4NMI A;  2FCT A;  3GJB A;  5L9R A;  5A3U A;  4XAA A;  2G19 A;  4XC9 A;  2RDR A;  3NNM A;  4BQY A;  4MHR A;  3KT7 A;  5HV0 A;  4UWD A;  5LBF A;  4MHU A;  3BVC A;  5DAP A;  2RG4 A;  3KT4 A;  3OUI A;  3MGU A;  3KT1 A;  5DAV A;  5C5U A;  5DAW A;  4NHM A;  5IAT A;  2OPW A;  4J25 A;  5LB6 A;  4ZON A;  3NNJ A;  2V4A A;  2G1M A;  2HBU A;  4NHL A;  2Y33 A;  5EP9 A;  4JZR A;  5C5T A;  3OBZ A; 
#chains in the Genus database with same CATH topology
 3TB0 A;  4RN5 A;  4RR3 A;  1S0I A;  4GWJ A;  5FOJ B;  2EXK A;  2VNO A;  3I54 A;  4HL0 A;  2IXJ A;  3AKR A;  4JQR A;  5KXC A;  2Z69 A;  1RUE 1;  2B9U A;  1H4G A;  3MZH A;  5BY5 A;  4DUW A;  2R04 3;  1WGP A;  2Q1Z B;  3N3H A;  2BPA 2;  4NID A;  5A7O A;  4NHX A;  1ZBA 3;  1GWM A;  1UOB A;  3VBR C;  2Y6J A;  1D4M 3;  4M00 A;  5FLJ A;  3E6D A;  1XE7 A;  5FY7 A;  5C9A C;  2VMF A;  3ON7 A;  1KXG A;  3AFG A;  4HON A;  1O3Q A;  5CFD B;  4I01 A;  4PIZ A;  1XOY A;  4JKL A;  2FDK A;  1W6N A;  2VCM A;  4NO4 A;  5FZB A;  1KJR A;  1QQP 1;  4ZPI A;  1YFX A;  3D0S A;  4P9J A;  4AQ6 A;  4N9H A;  4RL7 A;  3POW A;  3U0Z A;  3W5M A;  1Y9G A;  3H9A A;  2OQ6 A;  4B4P A;  5E88 A;  1WCU A;  2OZ6 A;  2GND A;  4Y1V A;  2WAO A;  3BAL A;  3LOI A;  2LS6 A;  4R9B A;  3N7L A;  3VD3 A;  4AZZ A;  4B1L A;  1KGY A;  3BIE A;  2CU5 A;  1GSL A;  4JC1 A;  5A7S A;  2ZML A;  3WEZ A;  4A7Z A;  5IVB A;  3DPR A;  1FPN 1;  2VEC A;  3CJX A;  2P3Y A;  1DZR A;  4AGV A;  4QM8 A;  2W47 A;  4MOA A;  3GZE A;  4QKD A;  3OYW B;  4XAB A;  4OFG A;  4YM0 A;  3VKM A;  4NUB A;  4BDV B;  1Y7B A;  4MGI E;  4HVO A;  1EAH 1;  4CDX C;  4I3G A;  1BEV 2;  3C7O A;  1I5Z A;  2ES3 A;  1W2O A;  4E2S A;  5L9R A;  1LOE A;  1E5H A;  3NKG A;  3A4U A;  1J1L A;  3APB A;  2Q8C A;  4L2N A;  4YVW C;  1CAV A;  3CIH A;  5KHI A;  3GXU A;  1AR9 2;  1SDD B;  1TQ5 A;  2JG9 C;  3KGZ A;  3O0W A;  4LNV A;  4LOS A;  5GJ6 A;  4QT6 A;  1HXS 1;  1PO2 3;  2JEC A;  2A6W A;  1ALY A;  1ZZ7 A;  3HBZ A;  5DUV A;  2C9K A;  4Y1X A;  3J8F 3;  3USU B;  3VDA A;  5A3O A;  1ULO A;  4Q0Q A;  3WLU A;  1EPZ A;  4LO5 B;  5DAP A;  1OVP A;  2FMY A;  2VZP A;  4IV3 A;  4Q4X 1;  2HJI A;  5I8Y A;  3HQX A;  1W9W A;  4FPK A;  2VQU A;  4LKF A;  4I0W B;  4NE9 A;  1POV 3;  4LO6 B;  1NCQ A;  4Y4R A;  5FMO S;  5JXJ A;  3BKZ A;  4QAW A;  5I0T A;  5IK7 A;  1AUY A;  1GR3 A;  2RM2 2;  5BNN B;  4LOR A;  2XKO A;  4DIQ A;  1NG0 A;  1QMJ A;  1SLL A;  4IEO A;  4IE6 A;  2BDR A;  2D3S A;  4FFF A;  1S2E A;  1W9F A;  2WFF 1;  4IV1 C;  3CU7 A;  1R09 2;  1YIP A;  5A33 A;  3CLP A;  1STM A;  4ZON A;  3BCW A;  1HRI 3;  4COU A;  4OVE A;  1WUV A;  5H9P A;  4FPF A;  4HKO A;  4DEQ A;  1QNY A;  3NAP C;  4LBJ A;  5CA6 A;  1VBE 3;  1WBL A;  2IWG B;  4UW6 A;  1CJP A;  2NLR A;  4RGG A;  5JSR A;  2Y33 A;  2QQM A;  5C33 A;  3ZSM A;  3WX5 A;  2Y8K A;  4QXB A;  4Z92 B;  2QBX A;  5JAX A;  1W8T A;  1W8N A;  4OHV A;  5DQ0 A;  2BP6 A;  2PHU A;  3D5O A;  3OBZ A;  5HBA A;  5GLW A;  1RUG 3;  1OQE A;  1UOF A;  1RUF 1;  2H6B A;  1C28 A;  3OEA A;  1RYY A;  4YFW A;  5DUW A;  4CP2 A;  1OLR A;  5JOY A;  2X8K A;  4LA2 A;  4NRO A;  5A3M A;  1ZBE 3;  1EUT A;  1M4W A;  3Q8E A;  1D0H A;  2VM9 A;  3WZ1 A;  4RSU A;  1ZZC A;  2FDI A;  2E7Q A;  2BTV C;  1LOF C;  1Q56 A;  2DU0 A;  1UXZ A;  1RB8 G;  3HT2 A;  1LTE A;  3UYJ A;  1UZ0 A;  4OLL A;  4XCA A;  3ZPO A;  3O1O A;  3ATG A;  4H55 A;  4ZY9 A;  4UBH A;  2VH9 A;  2W1S A;  1OUX A;  1US3 A;  4K20 A;  3D4K A;  1X7N A;  2JKX A;  2IXI A;  5IT6 A;  1NUK A;  4YSF A;  2LUW A;  2O14 A;  4AVA A;  2C5D A;  5L7O C;  4WM7 A;  5FZO A;  4Y33 A;  4XCB A;  3MV1 1;  4XJU A;  2BGO A;  5L9B A;  1AL0 G;  2V73 A;  1U5X A;  3I2J A;  3TNQ A;  4BPZ A;  4NR1 A;  3HD8 B;  1DBN A;  1LOD A;  1K42 A;  3VDD A;  2JB4 A;  2D6K A;  5FPZ A;  3Q8F A;  4CCN A;  4QKF A;  1YCI A;  4MXW A;  5I8S A;  2XHN A;  3WNO A;  4UF0 A;  5BPX A;  2FD8 A;  1AHS A;  4MSV A;  1UQX A;  1RIR A;  5A1A A;  1QJU 2;  4RHV 1;  4A7K A;  3ZYI B;  5DAB A;  1JHN A;  3EHK A;  4S2F A;  1R08 2;  1V9U 1;  1TNF A;  4IL7 A;  1RJ7 A;  1EV1 1;  2WWJ A;  3V56 A;  4BQ1 A;  3O1V A;  3QAC A;  2GDF A;  5D1I A;  4R8H A;  5D8A B;  1VBB 3;  1NZI A;  3P6B A;  5TSW A;  5KHJ A;  2ZPX A;  2J1U A;  2AR6 A;  2IXC A;  5GLV A;  2WLP A;  2X5I A;  1PNF A;  5CIS A;  3RFR A;  1PMH X;  2VUD A;  4CVU A;  1GZC A;  1GOG A;  1TG7 A;  1VJ2 A;  5FK7 A;  5C8C A;  2VBP A;  4KNC A;  4QX5 A;  1LGB A;  1OI6 A;  4W6Y A;  1AYN 2;  1TME 1;  2J1A A;  4R4Z A;  4CU8 A;  5FMO L;  4GA9 A;  2RMU 1;  2TNF A;  3H8X A;  3MBW A;  3MUY 1;  1ZVF A;  3MPP G;  1CR7 A;  2XXZ A;  2P6H A;  1J1T A;  4PDW C;  1X36 A;  3E97 A;  2HWC 2;  4LKD A;  1EUU A;  3BVC A;  3ZFF B;  2ZX1 A;  4GB3 1;  4XUT A;  1LEM A;  2ZGN A;  1QJX 3;  3LEG A;  3VBF A;  1FV3 A;  3MGU A;  2PFW A;  3GNE A;  2XML A;  3R6S A;  1Y3T A;  3T2P A;  4ATE A;  2P2K A;  3KD4 A;  3LFM A;  4GH4 C;  2PMW B;  4AXO A;  5C5U A;  3TOJ A;  2R06 2;  4OUE A;  3CKH A;  4ZU7 A;  1UMI A;  1C1F A;  5FYB A;  1C5I A;  1YXW A;  4D3W A;  3CJI A;  3NKT A;  1AF9 A;  2PHW A;  3Q9O A;  3AKQ A;  5FZG A;  3RWK X;  2VZ1 A;  2FZ2 A;  4LBQ B;  2EIE A;  2VZS A;  4COY A;  1C8M 2;  1L7R A;  2WS9 3;  4QGM A;  1HB2 A;  3BUC A;  3LGR A;  1LHW A;  3WQ1 A;  1OOP C;  3LIG A;  3MIB A;  4QB2 A;  1XNB A;  4XET A;  4YG6 A;  4XJZ A;  1REF A;  1XXN A;  2EA7 A;  1NE4 A;  1VE0 A;  3VZK A;  1CAW B;  4CE8 A;  5JXI A;  5GM0 A;  2Q30 A;  5J48 A;  1BJQ A;  1HRV 3;  4QDS A;  1C4R A;  2LM3 A;  2Q5T A;  5JIA A;  3WHU A;  4CDU B;  1T2X A;  1UF2 C;  5DZF A;  1PHM A;  2PLV 1;  3LOB A;  1PNG A;  2VW1 A;  2YHJ A;  1PK6 C;  4BZ4 A;  1OA3 A;  4Y26 A;  1UX7 A;  1US2 A;  3SKV A;  2HWF 3;  4Z1V A;  3ETP A;  4XE9 A;  3VB9 A;  2ZX2 A;  4XTP A;  4AEK A;  4YM3 A;  3ZDV A;  5FZF A;  5EFU A;  5A7W A;  3OUJ A;  3U10 A;  4B8E A;  1FNY A;  4JDM A;  2CSG A;  4CP9 A;  4HET A;  5IK8 A;  4E4H A;  5FP8 A;  3SMH A;  3OBR A;  4QX0 A;  3DUI A;  4WZF A;  1DF0 A;  1NCR C;  1UO9 A;  2OPK A;  2WYS A;  1Q8O A;  4R52 A;  5G05 L;  3T30 A;  2BFU L;  5FR3 A;  4MZU A;  2CWM A;  2PHT A;  3B69 A;  4P9X A;  4RQP B;  1IKP A;  2QZ3 A;  3D0J A;  3POY A;  5FO8 B;  1UY4 A;  2TBV A;  5FV3 A;  1X82 A;  5A32 B;  1SPP B;  1HB1 A;  1GYK A;  1VAV A;  1VLN A;  3MUZ 1;  2GNT A;  3HJR A;  5G04 L;  3ITQ A;  4EN9 B;  5KC6 A;  4ATF A;  4UW4 A;  4NWV A;  4CEY B;  2QNK A;  1BK0 A;  5FBJ A;  1AL2 2;  2VQA A;  1EP0 A;  4Z8B A;  4QXH A;  4IES A;  2VG9 A;  4HVQ A;  4Q0V A;  3CNA A;  2XG3 A;  3CHX A;  1VBD 2;  2PN5 A;  3KCC A;  3UGF A;  1YQ2 A;  2XPJ A;  2R0F A;  3H8O A;  3H8R A;  3KWV A;  1OSG A;  2DBI A;  4P9I A;  3IMN A;  1ND2 A;  1RUH 2;  1AX2 A;  2CDO A;  1AVB A;  2J1R A;  5DG2 A;  2NP0 A;  4XBN A;  2XJP A;  3IIA A;  4YVS A;  1GUI A;  3WIN E;  2K2S A;  3JU9 A;  1IOA A;  4FPL A;  3GZT B;  4URT A;  2BZD A;  3VBS C;  4M3C E;  3VKL A;  3FL7 A;  3PU3 A;  4C0B A;  2RS3 1;  1OXC A;  1UU5 A;  5C9A B;  1NA1 A;  3B94 A;  4TN7 A;  2BBV A;  1PGW 1;  4IGP A;  4MHU A;  5ACA 1;  2VC9 A;  1RUE 3;  5F2W A;  2WSV A;  5FZK A;  1UYZ A;  3HN3 A;  5FZL A;  5CFC A;  3J7L A;  4PBO A;  3B7M A;  1WCK A;  2DV9 A;  2XWB B;  1WWY A;  5FWE A;  5FP3 A;  3VBU B;  2VGD A;  4BYY A;  2Q1F A;  3ZFG C;  3LDB A;  1D4M 2;  1H4H A;  2V72 A;  2P34 A;  5F5A A;  5FZC A;  4OHX A;  4JHT A;  1UXX X;  2QQO A;  2QDR A;  3QH6 A;  3IZO A;  3LDK A;  3THP A;  5DZE A;  3LSD A;  1IZ3 A;  4CXX A;  2CYF A;  2WO2 A;  5H9R A;  2B5H A;  5C4W C;  5KHG A;  2XLG A;  3O1T A;  3A7Q A;  5JLV A;  1SLA A;  1QQP 3;  1Q8P A;  1XNK A;  4RS5 C;  4WV8 A;  2A5Z A;  4Z82 A;  4M3C F;  2VMG A;  2GNM A;  3VZL A;  5CG9 A;  4NWW A;  4AL9 A;  3VLB B;  3WW2 A;  4NPM A;  4IER A;  1O91 A;  3THT A;  1A6C A;  2UU8 A;  5I8T A;  1NY7 1;  2QQL A;  3UKV A;  4CCO A;  4JGZ C;  3BOW A;  1LAJ A;  3A0N A;  4GJY A;  5FK8 A;  3OF1 A;  4IE0 A;  2I45 A;  4CDX B;  2X53 S;  4CDW A;  1L7Q A;  3GZU C;  4KU7 A;  1FPN 3;  4N43 A;  2XBO 1;  3LDR A;  1ZNP A;  2ZCW A;  1X9T A;  1ZZ6 A;  4GWM A;  4BK4 A;  2VCB A;  4YVW B;  5JZG B;  2ZAC A;  3BPZ A;  3KF5 A;  5IFT A;  4GWN A;  1D2Q A;  3NNL A;  4IGO A;  3UKT A;  2K46 A;  1R1A 1;  1GMM A;  1TMF 1;  2R07 2;  1QNW A;  1VP6 A;  4XDQ A;  4YGE A;  4LBN A;  3WNK A;  1UPI A;  1DCS A;  3FHI B;  1SLB A;  3SIT A;  2XOM A;  2A75 A;  3VHO A;  3OTF A;  2BEO A;  4H7M A;  1YQ8 A;  3VZM A;  1KRI A;  1JW6 A;  2CDP A;  2WT0 A;  3H42 B;  5C8W A;  1HXS 3;  1NOV A;  1FMD 2;  3DPR C;  2VNR A;  4JTN A;  1NZC A;  2C9A A;  4B4R A;  3ILF A;  5C3S A;  3K3O A;  4LEJ A;  4IV1 B;  4GJZ A;  3ILR A;  1URX A;  1Z7S 2;  2YFU A;  3J8F 2;  4QGN A;  2D6L X;  1RMU 1;  5DAX A;  2K0G A;  3BTZ A;  1PM4 A;  4I30 A;  4Q4X 3;  4UYB A;  1LJ7 A;  4BU2 A;  3ES1 A;  1OD5 A;  1OPO A;  2GP3 A;  1PGL 2;  4XAC A;  3NAP B;  1V6N A;  5A70 A;  1SFN A;  2E32 A;  2C0Z A;  5CAD A;  3RS6 A;  2Y6L A;  3LKJ A;  4L8Q A;  4WM8 C;  4UXA A;  1I1E A;  3U4S A;  4GKY A;  3QCW A;  2EID A;  1VMH A;  4OMC A;  5FYI A;  2AH2 A;  1J3P A;  5FY4 A;  5LA9 A;  4DXT A;  1ZRI A;  2XDV A;  1REE A;  3OGV A;  4DEV A;  4QPG A;  2VCC A;  1VBE 2;  2WQZ C;  2Z79 A;  3FHQ A;  4FFI A;  5F3E A;  1GKB A;  2QQN A;  3B00 A;  1OA4 A;  1LED A;  1TZO A;  3ZXF A;  1LGN A;  5F32 A;  5T52 A;  1VBA 2;  2WR9 A;  4X6R B;  2RDR A;  5JDB A;  2WAA A;  4EZ4 A;  2Y38 A;  3WG4 A;  4A6O A;  4R4X A;  1RUF 3;  5HCF A;  3RMY A;  2AEN A;  3RSJ A;  3TN9 1;  4QQO A;  3WW3 A;  4NJ4 A;  4XFC A;  1DGR A;  2XL9 A;  4ET7 A;  1VRH 1;  5HI0 A;  4LE4 A;  4S2H A;  3MEP A;  2XLF A;  4DXZ A;  3BGA A;  4J1W A;  2HWD 1;  3UJO A;  2WUH A;  4K40 A;  4PT6 A;  3H50 A;  3BOD A;  4J1X A;  3POE A;  3ZN6 A;  4X6Q B;  5F39 A;  1N1S A;  1QDO A;  2JDN A;  4WVW A;  5CKQ A;  2VW0 A;  5FMD A;  1FAT A;  3AP6 A;  1SLC A;  3MLK A;  4P14 A;  1BBT 2;  5E6H A;  1O3S A;  3N9Q A;  2W3J A;  4BM8 A;  2VOV A;  3MFC A;  2ZA9 A;  4K8F A;  3M2M A;  4V2V A;  2DF7 A;  1JYW A;  4COV A;  5AFE A;  3O0V A;  3LWC A;  1G8W A;  5CVR A;  1PGS A;  1UYP A;  3NV4 A;  4GQ7 A;  2YMZ A;  1ZX5 A;  3FZ3 A;  4YW3 A;  3KMH A;  4QWN A;  4CPB D;  2P4E A;  4FOV A;  2WNV A;  2JIC A;  2WZR 2;  4KWL A;  4QXC A;  4RHV 3;  1UIJ A;  1G9F A;  4IEY A;  2WNE A;  1V9U 3;  1OLM E;  4IDZ A;  1EV1 3;  2GC1 A;  2NMO A;  4C1X A;  5BNO A;  1H1A A;  4FPJ A;  1TEI A;  3LEK A;  5LAT A;  2MNG A;  4ASM B;  4QQH A;  4IEW A;  1V6M A;  5LAS A;  3R05 A;  4AED C;  4DUV A;  2WN3 A;  4PLO A;  4NIG A;  1GQH A;  5BNQ A;  2W2I A;  1ENS A;  1XQN A;  4XQD A;  1AR6 1;  1B09 A;  1YEW A;  4O9G A;  5M0T A;  4PDW B;  3MYX A;  2RDS A;  1SBD A;  5ERL A;  4NRM A;  1MAC A;  3LIH A;  2Y34 A;  4AE2 A;  1JBC A;  2DFB A;  3H7Y A;  4QXK A;  3OGJ A;  4IEP A;  2DUQ A;  1QJY 2;  4Y5T A;  4O9E A;  4AG4 A;  1S2B A;  3PUS A;  5LA0 A;  4L99 A;  4LLO A;  1TME 3;  4OQ8 A;  4ONU A;  2VL4 A;  2AZ5 A;  4E9K A;  3GBG A;  4UFL A;  1W6O A;  2RMU 3;  4BXS V;  1BKZ A;  1PZ7 A;  2ZAB A;  4D6Q A;  3Q8C A;  3M3C A;  4YYO A;  4Y4Y A;  4YLZ A;  4C91 A;  5KXB A;  2CTV A;  4JAA A;  4MGK E;  4G9S B;  2LRP A;  2OVU A;  2P5B A;  2VJX A;  2X5I C;  4GB3 3;  2DTW A;  1J3Q A;  1K45 A;  4S2D A;  3E6C C;  1A8D A;  1QXR A;  4WVV A;  3VKF C;  1AXZ A;  5AVP A;  1RUD 2;  1QJX 2;  1S0J A;  5CKN A;  1VBC 1;  1BVV A;  4M4R A;  1Y9Q A;  3ZMO A;  2ADD A;  4DXR A;  2ATF A;  1OFN A;  4XJ9 A;  5F8P A;  1OOP B;  4JQT A;  4Y22 A;  3VBO C;  3KQ4 B;  3SC7 X;  2DCZ A;  2ZGM A;  3T0D A;  3CL1 A;  1RTV A;  1W06 A;  3LA2 A;  1ND3 A;  1DGR N;  1RUC 1;  4XXP A;  2YC2 A;  2WDB A;  3G6J B;  3JD7 1;  4AI1 A;  1PIV 2;  4HAN A;  3FX3 A;  1WME A;  2WT1 A;  2OKX A;  1PK6 B;  3CEW A;  3K46 A;  4OZO A;  1AXY A;  1GZW A;  5EYY A;  4EN7 B;  3UGG A;  1FOD 2;  3AZX A;  1XC6 A;  1RUJ 1;  4FTS A;  1CPM A;  3AMQ A;  1U5I A;  4LT5 A;  1JYT A;  2RS5 2;  3JB4 C;  1IPS A;  5JOZ A;  1PO1 1;  2BU9 A;  4FCA A;  1V6J A;  4W6X A;  4MO3 M;  2JDY A;  1UOG A;  2PLV 3;  4BXF A;  3A21 A;  4GUL A;  1PVC 1;  3WNM A;  2ORX A;  3EXU A;  4DY3 A;  1W6P A;  2ARC A;  5C6C A;  5IYY A;  3III A;  1NCR B;  4AQS A;  1X8E A;  4IXL A;  4HXC A;  1ZZ8 A;  4DIN B;  2HWF 2;  4AWD A;  4TXW A;  3THC A;  2VUA A;  3U11 A;  4CUB A;  4KL1 A;  4WVZ A;  4QPI C;  4JGY A;  2VZ3 A;  1H6X A;  4MUV A;  2WQ8 A;  4LBM A;  4ORF A;  4AHX A;  5A3L A;  4XUN A;  3I2O A;  3BOP A;  3ELN A;  3EO6 A;  5SV8 A;  2G1M A;  2HBU A;  2VOT A;  1N1Y A;  3IT8 A;  4CDQ C;  1HQL A;  1P8J A;  1F9K A;  1OFS A;  2ZGK A;  2VMC A;  3BIW E;  3ZFE B;  4XW3 A;  1IQA A;  2RR1 2;  4BIO A;  5FPU A;  4CCM A;  3KCY A;  2NN8 A;  4KG0 A;  3ZDS A;  4DPN A;  1LCL A;  4QU1 A;  3ZIX A;  4N53 B;  3PUA A;  2ZKL A;  5FMB A;  1ASJ 2;  2O8O A;  2PAK A;  3OPW A;  1QH7 A;  4UFH A;  4LO8 A;  2YBK A;  2PHR A;  5IVF A;  5FQ0 A;  1ZRR A;  1W90 A;  2VUJ A;  3N7J A;  2DDU A;  2JDK A;  1LB2 A;  4IEU A;  2EIG A;  4RYD A;  5DDJ 2;  2FMD A;  4Z07 A;  4Y20 B;  5E16 A;  3PUH A;  4HK9 A;  4CPB A;  3AM2 A;  2SBA A;  3VBS B;  2I74 A;  2L9L A;  4AAP A;  5FP7 A;  1JUH A;  1QHD A;  2A3Y A;  1UWW A;  4QB1 A;  4XMA A;  1WMF A;  1JU3 A;  3IKW A;  5FKC A;  3HQU A;  5FZI A;  1K5M A;  1YQC A;  3RZZ A;  4Z2W A;  3ZYG A;  5C3O A;  4XUQ A;  2XVK A;  1AR7 2;  2X29 A;  4CEW A;  3AMN A;  3I49 A;  1VB4 A;  1D7P M;  4W65 A;  3S7I A;  5JOX A;  3JBG 2;  4MET A;  5KXD A;  4JCK A;  1G6N A;  3R4S A;  5K7P A;  4FAG A;  2GH2 A;  2RS3 3;  3RDI A;  3RQ0 A;  1W9T A;  1CAU B;  3VBH A;  5JUV A;  1W2U A;  5ACA 3;  3IDE A;  4AVV A;  3WQ0 A;  4K1Y A;  3N9P A;  3LD8 A;  2ARE A;  4LTA A;  3AP4 A;  1RUE 2;  1BMV 2;  5FPX A;  3S7E A;  4EV0 A;  2G9G A;  2A1X A;  2YZ4 A;  4RS5 B;  2FCV A;  5AVA A;  4I09 A;  4NVP A;  3ZM8 A;  1JOD A;  1MEC 2;  4AVS A;  1JZ2 A;  4YW5 A;  3R4D B;  1WA4 A;  1H8T C;  1JZ4 A;  2HWE 1;  1IGO A;  2WNU B;  2PHX A;  4ZU4 A;  4JGZ B;  4NHK A;  3W9A A;  5HPO A;  2DUR A;  1H8V A;  3I2I A;  3VDC A;  4UAP A;  1NA1 C;  1QKQ A;  5FIX A;  4EWA A;  4ITC A;  2GAU A;  1QQP 2;  3C7G A;  2Q0A A;  2QQP A;  1G9B A;  5EJ1 B;  1LOA A;  2BER A;  1DU3 D;  2JD9 A;  1MQT C;  2IXK A;  4CA9 A;  4BQ4 A;  5A3N A;  2GZW A;  1CD3 G;  2OW4 A;  2DBN A;  4BQY A;  2PQQ A;  5CFD A;  4BIF A;  3LFI A;  3N4M A;  4BE3 A;  3KSC A;  3OPZ A;  5ABJ C;  1AYM 1;  3IAP A;  2QQV A;  2SLI A;  1H9P A;  2ZAA A;  4FPC A;  2ZGT A;  4H7L A;  1LGC A;  1TVG A;  2XBO 3;  2XL7 A;  1LOB A;  4PF5 A;  4UWD A;  4DY5 A;  5HV0 A;  1QF3 A;  2GC3 A;  4FOY A;  5FOB B;  3RNS A;  3POG A;  1UYX A;  4Y5Z 0;  3RI9 A;  3RI8 A;  1R1A 3;  2HWB 1;  5FLH A;  1TE1 B;  3ZN4 A;  1MS4 A;  1U12 A;  2GC2 A;  4PIY A;  3I2H A;  1ULD A;  1J83 A;  1TMF 3;  4JDO A;  3M3O A;  2PAM A;  3WF3 A;  2D44 A;  3LPG A;  3ZXA C;  4FPY A;  2JJ6 A;  3OGS A;  2BRT A;  3S6P A;  1C5H A;  4AQT A;  1YI9 A;  3NJX A;  3MIF A;  2IVJ A;  1LU2 A;  5E1R A;  1ULG A;  5LWB A;  3KGL A;  3LA7 A;  3OYW A;  4FXG B;  1KS5 A;  1W2T A;  3H8U A;  4N43 C;  5J36 A;  2D3R A;  4OI2 A;  3JZV A;  4HLT A;  1GLH A;  4XIO A;  5DPN A;  3KZ4 C;  4WM8 B;  1YO8 A;  1DLL A;  1RMU 3;  3MI8 A;  4XDP A;  2OYZ A;  3GYD A;  1AR8 2;  1AX0 A;  4JVA A;  5FZ6 A;  2Y6G A;  3IDB B;  2D97 A;  4W50 A;  4B3N A;  4KWK A;  3RMX A;  3BB6 A;  2BOI A;  4FXK B;  1F15 A;  2JEN A;  2XQX A;  2HYX A;  5DG1 A;  1RUI 2;  2ZMK A;  5SV5 A;  5KWR A;  4CUA A;  3USU A;  3DKW A;  3ZR6 A;  2WO3 A;  4FPG A;  4FPO B;  2Y60 A;  2JG8 C;  3K51 A;  4Q5O A;  1CZV A;  4CXW A;  5HV4 A;  3N9O A;  1GOF A;  4JDN A;  4LBQ D;  2R16 A;  4OI0 A;  4G3Y C;  1OH4 A;  1H2M A;  2VD7 A;  1POQ A;  5BNN A;  4YRD A;  2N7G A;  1ULP A;  3G7D A;  5FKB A;  2W5F A;  3M4F A;  3ZMN A;  4C0H A;  4FTE A;  1NXM A;  3PME A;  1W05 A;  5F1R A;  4CU6 A;  4A44 A;  3FFQ A;  3WT3 A;  1VRH 3;  2QE3 A;  2RM2 1;  3AVS A;  4ISQ A;  1LKN A;  2B45 X;  1MS0 A;  1R09 1;  5F6L B;  2HWD 3;  3ZXG A;  3UES A;  1W9S A;  3I3Q A;  4OZX A;  1LHU A;  1XND A;  5F3I A;  4DQA A;  2J1E A;  4LHK A;  3SCG A;  1GNH A;  4QPG C;  1HKD A;  3FUO A;  1DQ1 A;  4XF1 A;  2IFR A;  4Q29 A;  1PMI A;  4HVR A;  3GF6 A;  2YU2 A;  4O61 A;  5CYY A;  2YBP A;  4ISR A;  5I0S A;  4L0P A;  2ZZQ A;  4XXA A;  4KGG A;  4XF9 A;  1E5I A;  2V5D A;  1SHW B;  2W87 A;  3DYO A;  1EPW A;  1O59 A;  4HZF A;  1XB9 A;  2E51 A;  2E7T A;  2D3P A;  2E63 A;  2WZ8 A;  4KI5 M;  2VVD A;  3WF1 A;  5LRR A;  2CAU A;  4FPE A;  3OSD A;  1HB3 A;  1H9W A;  4AED B;  1ONA A;  2Y6H A;  1I5P A;  3D6E A;  1OC1 A;  1F31 A;  2C26 A;  2WT2 A;  3WG1 A;  4NII A;  1KEX A;  3E6B A;  3KB5 A;  1SAC A;  5D2A A;  4P00 B;  1DZQ A;  3CZU A;  1V9U 2;  3KT7 A;  2Y26 A;  3W5N A;  3ACL A;  1VIW B;  2UWA A;  3AKP A;  3KVB A;  1HN0 A;  2C24 A;  4DUX A;  1FX5 A;  2EVX A;  4P08 A;  2AUY A;  4C90 A;  2WRA A;  3AB0 A;  3LPF A;  4YZ3 A;  5FY8 A;  2RG4 A;  3WR0 A;  3P3P A;  4LBL A;  1ENR A;  5L19 A;  1RHI 2;  3ACI A;  4I2O A;  1AR6 3;  1XRU A;  2DVF A;  1CES A;  3ZPY A;  3DEC A;  5IFP A;  2YV8 A;  5CKM A;  3U78 A;  1LUL A;  4HKW A;  2PAE A;  3NJV A;  1JOJ A;  4R9D A;  3T1M A;  4UFM A;  3MIH A;  1OKQ A;  1LHO A;  2IC1 A;  1QJU 1;  5D8A A;  2YGL A;  1W0O A;  1D0G A;  4AK3 A;  1IS5 A;  3MIG A;  1R08 1;  5BNO C;  3RPQ A;  3KLS A;  2BWA A;  3GM8 A;  3OOX A;  2UYB A;  4F7Z A;  4D6R A;  1W2N A;  4XUR A;  2CAV A;  4N7I A;  4DNY A;  5IVY A;  2W52 A;  3AZW A;  3GZA A;  1GBG A;  3MW3 A;  3ZYP A;  4TSV A;  1CWP A;  4LK7 A;  3PUI A;  1IG3 A;  3AVR A;  2IXL A;  3H3L A;  3UL2 A;  5BV6 A;  2OQ7 A;  2B9V A;  1RVF 2;  2CGN A;  2BV4 A;  2UWB A;  1VBC 3;  2JIG A;  5CIR A;  4YG0 A;  1ZYB A;  4QD2 A;  1C8N A;  1S0G A;  1GZT A;  2PA7 A;  3K48 A;  2RDQ A;  1F2N A;  2OX0 A;  1KIT A;  1V6L A;  3AYC A;  4FO9 A;  2IUW A;  4LKS A;  3ZFF A;  4HMZ A;  2QZ2 A;  1XSR A;  4M3C B;  1RUC 3;  3IAQ A;  3CDZ B;  3WW1 A;  2VBD A;  5C7G A;  4FQZ A;  5IVV A;  2RS1 2;  2WO1 A;  3JD7 3;  3IB3 A;  1NT0 A;  2HWC 1;  2VQT A;  2MEV 1;  4LA3 A;  3INA A;  2WFP A;  3FBY A;  4PF1 A;  1RUJ 3;  4K1Z A;  4H2A A;  4PCR A;  5A6Z A;  4QPI B;  5LZ6 A;  4OUM A;  2D6O X;  2VR4 A;  3S57 A;  1PO1 3;  4XQ4 A;  2HYK A;  1OMI A;  5FUI A;  4HG6 B;  1ODN A;  5DXD A;  1FNZ A;  2CWS A;  2JDZ A;  4LBQ A;  4LLF A;  2KA3 A;  2R06 1;  3WSO A;  1OD3 A;  1PVC 3;  1JYV A;  1YJL A;  3VD5 A;  4QX1 A;  3DXU A;  1YQ5 A;  4QX2 A;  2CNA A;  3POB A;  2F4P A;  5FY9 A;  4AYU A;  3HNM A;  1ND3 C;  4CDQ B;  5K0U C;  4Q4Y 1;  1CAW A;  1C8M 1;  1UZY A;  2VAU A;  4U2A A;  3HVD A;  4FPH A;  5A3W A;  1GIC A;  3GCX A;  4N90 A;  5AFB A;  4A42 A;  2O1Q A;  4GKX A;  3DYM A;  2OZJ A;  4CDU A;  2XUE A;  1ULF A;  2DTY A;  5FZD A;  1B35 C;  3ETQ A;  1KS4 A;  1N3O A;  2VZU A;  4BCU A;  1JZ5 A;  4NMI A;  3O1M A;  4BQ2 A;  1GOH A;  1SLI A;  1GWL A;  1F8V A;  2FDF A;  4FAH A;  1W9Y A;  2FDH A;  5FZ8 A;  4TLF A;  4XJ8 A;  4W8J A;  2XJS A;  1O4Z A;  4P9G A;  4P9L A;  4C8D A;  3PJY A;  1OKO A;  1N47 A;  4N9I A;  2HEV F;  1YUD A;  2D40 A;  1F5J A;  1VAL A;  2FHR A;  2HEY F;  3MHZ A;  2J1T A;  3FBM A;  4HKL A;  4MGS A;  2XKP A;  3AYD A;  3H7J A;  5FZ1 A;  3ZSE A;  4HPK B;  5E8A A;  1UMH A;  3ZXJ A;  2WKK A;  5FZ7 A;  3PLQ A;  3BPS A;  4LUM A;  3V0A B;  2ZGL A;  4RQP A;  4Q4V 2;  2VVE A;  3DXT A;  3NO8 A;  3ZOI A;  3GBF A;  5FO9 B;  5LY2 A;  2FDJ A;  5A32 A;  1SPP A;  5JVV A;  4PI2 A;  4XOG A;  1WMX A;  4CP1 A;  4Q26 A;  2YFZ A;  4ARY A;  1W3X A;  2XLA A;  2LAL A;  4YM1 A;  3RRD A;  1O3T A;  4CEY A;  1AX1 A;  5C3R A;  1V00 A;  1VRB A;  2OPW A;  4UFJ A;  1N3P A;  5I0D A;  3ZLI A;  4LHL A;  4GWI A;  1TNR A;  4AGG A;  3O1U A;  3M3E A;  4IEV A;  1VPH A;  2V4A A;  3WNL A;  5DN2 A;  4BQ3 A;  3ABZ A;  5CBL A;  2JD4 A;  2RV9 A;  5FYY A;  4K3U A;  1JXN A;  3VBR B;  1WW7 A;  1AL2 1;  1BK1 A;  2EAA A;  1PX4 A;  2C6S A;  2WA4 A;  3AXD A;  4TTG A;  1H8T B;  3D3A A;  2GP5 A;  3WDU A;  5BNP C;  1SFP A;  2I07 B;  1VBD 1;  2O0O A;  3IPV B;  3F2Z A;  2JE7 A;  2R04 2;  2OUH A;  2WSU A;  1Y9M A;  2H0B A;  4CSW A;  5HCH A;  3B5L B;  1S0C A;  4FBF A;  3KCX A;  4Q4W 1;  1ZBA 2;  1RUH 1;  2KR2 A;  3U07 A;  1JYN A;  1SCS A;  4MGZ E;  5FMC A;  4CEW C;  1MQT B;  3AX4 A;  5C9A A;  1OUR A;  2HWE 3;  1U5Z A;  1UAI A;  1WLW A;  2V4V A;  4L9B A;  1NKG A;  3UT0 A;  2ZX3 A;  5ABJ B;  2F6B A;  4QHO A;  4RR3 C;  4EJR A;  5IAX A;  4ZHN A;  5FPV A;  5DAQ A;  3UNP A;  4HT1 T;  1WKY A;  1DQ6 A;  1MS5 A;  1SMV A;  2EIC A;  3NJY A;  3QLQ A;  3VBU A;  3POS A;  4DRR A;  4YZ5 A;  3L2Y A;  3NJZ A;  3HT1 A;  3P5B A;  1W8F A;  3GJA A;  2YPJ A;  3PVN A;  1AYM 3;  4GAL A;  4IEX A;  1D4M 1;  1NLR A;  1UPS A;  3N7K A;  5LRS A;  2XVG A;  4XFB A;  3WQ7 A;  3DKQ A;  1QJZ A;  4MYE A;  1UY2 A;  2RJK A;  1LOG A;  2HWB 3;  2JG9 B;  4N7U A;  1H2L A;  4EWE A;  4XUO A;  4DMI A;  1QJF A;  1EAH 3;  2BOJ A;  3EJK A;  1UD1 A;  3OG2 A;  1CX1 A;  1RL3 A;  2HKX A;  5EJZ B;  3W58 A;  1LHV A;  4CDX A;  5C71 A;  4B4Q A;  2BJS A;  3OUH A;  3NW4 A;  4D6S A;  1L7L A;  3S30 A;  2DU1 A;  1UZZ A;  3SIS A;  4MX3 A;  5F37 A;  1DGW A;  1DIW A;  1T6G C;  2GU9 A;  2VOK A;  4YVW A;  2DWR A;  1W3V A;  1YWK A;  2VXR A;  3E5X A;  4HN0 A;  5JXH A;  3MF6 A;  1YQ6 A;  4GXL A;  2PTM A;  3KM5 A;  4EN8 B;  2R0H A;  4HSJ A;  3AK0 A;  4NPL A;  1HLC A;  1PMJ X;  4DS0 A;  1PO2 2;  5EYX A;  1O4T A;  4BME A;  2F4L A;  1RMU 2;  4AW7 A;  2PHF A;  3K75 B;  4QU2 A;  3I3M A;  2W08 A;  4EZH A;  1ODM A;  2JDM A;  1UOJ A;  2QUO A;  4YM2 A;  1Z78 A;  1DGW X;  4LMF A;  4QX7 A;  3TEX A;  1YYN A;  5HXM A;  3A22 A;  3IDA A;  2R07 1;  4X8P A;  3SHR A;  1LOC A;  3M7A A;  3FE5 A;  5FUN A;  3NV3 A;  1RGS A;  3AP9 A;  1JI6 A;  2EXJ A;  4CUC A;  2WFF 3;  4IV1 A;  5FXW A;  3JXS A;  3LZZ A;  2UY8 A;  3TRS B;  3T08 A;  5I0R A;  1OF4 A;  4YGB A;  3B9C A;  1KDK A;  3WP6 A;  1FMD 1;  1QXP A;  1H1I A;  1HRI 2;  1OPM A;  3FC0 A;  5L36 A;  2ARA A;  5APA A;  3NAP A;  4FFH A;  3I2K A;  1Z7S 1;  4UI9 L;  1V70 A;  1O5L A;  2WL1 A;  3L9J T;  3IBM A;  5DAW A;  3AKT A;  4NHM A;  3SH5 A;  1BHG A;  4IV3 C;  2G9F A;  3QBQ A;  5FWJ A;  3OY8 B;  1PGL 1;  2D43 A;  4PI0 A;  3FN9 A;  3OBA A;  5LK5 A;  2ZBJ A;  1NCQ C;  1POV 1;  3DEM A;  5T5P A;  5KC5 A;  3KHC A;  3KV6 A;  2RM2 3;  1RUG 2;  5FJH A;  1VRH 2;  1UY0 A;  3SKJ E;  3VHN A;  4CCK A;  1R09 3;  1W6M B;  1IS3 A;  2B39 A;  5F5Q A;  1W8Z A;  3KV4 A;  1ZBE 2;  2HWD 2;  4EN6 B;  2G9Z A;  3V0B B;  2OS2 A;  5JI9 A;  4W6W A;  1JH5 A;  1W2A X;  5J37 A;  1WZX A;  1PX3 A;  2D5H A;  2KXL A;  4KWU A;  1I9R A;  4CP0 A;  5L7O B;  3PVE A;  4NRP A;  2BGP A;  2EIB A;  5DAV A;  3URF A;  4XJW A;  5FZ0 A;  1ACC A;  3O7O A;  5BNN C;  1OQD A;  3HOB A;  2Q8D A;  3K3N A;  3WVJ A;  5LW9 A;  1CAX B;  1JOP A;  2D6N A;  1VBA 1;  4WZC A;  1HDK A;  2WIN B;  4FP2 A;  1Q8S A;  4FT8 A;  5JPN B;  1D2S A;  4BIS A;  3ST7 A;  3M3Q A;  3OEB A;  4JRA A;  4LBO A;  1K3I A;  3NQH A;  2DVG A;  5KHH A;  3HWJ A;  4XFF A;  5GKA C;  4XF0 A;  3BTX A;  2Z4F A;  3BU0 A;  1VB2 A;  4W4Z A;  1V6O A;  2GNB A;  4MXV A;  3VHR A;  1O4Y A;  1YFW A;  4LE3 A;  1V6K A;  4U36 A;  1E5S A;  1QH6 A;  2DUO A;  5CU1 A;  4F3J A;  4KWJ A;  1H1M A;  4KG8 A;  1BBT 1;  2ETE A;  1JS9 A;  4QHB A;  4OI1 A;  3U75 A;  1EY2 A;  2XUM A;  4A4A A;  1VBB 2;  2A71 A;  4XMI A;  3LB9 A;  1XPW A;  4WM7 C;  3ZYF A;  2WWS A;  4ERO A;  2R1B A;  3AJZ A;  2C4X A;  2GMM A;  1FI2 A;  3HNB M;  1AR6 2;  3N9M A;  3VDD C;  3MFA A;  1SLT A;  2IFW A;  4XFH A;  1K5J A;  1WW4 A;  4OCT A;  1QJE A;  2A6X A;  5JSP A;  1H30 A;  1QJU 3;  2WZR 1;  2JXA A;  4YW2 A;  1POV 0;  1IS6 A;  2NYY A;  4PIX A;  1R08 3;  1MZ5 A;  2VZT A;  2XGX A;  3BYW A;  1RXG A;  3HNY M;  3MO4 A;  2XWJ B;  3OBT A;  4MAD A;  2FCT A;  3LEI A;  2WQ4 A;  5FFO C;  1DGL A;  5GLT A;  5F7U A;  4GH4 B;  3PUQ A;  2VMI A;  2Y64 A;  1CN1 A;  4PDW A;  4A3X A;  4COZ A;  3WP3 A;  3KVA A;  2JX9 A;  4R9A A;  4XC9 A;  1JZ3 A;  2VUC A;  3TWI A;  3W59 A;  2ZHN A;  2AEY A;  4UOJ A;  5C8C C;  4MGY E;  4H3W A;  4AAX A;  5LY1 A;  3RZJ A;  3ZYB A;  2WLQ A;  5FYV A;  1JYI A;  5T3N A;  3VZJ A;  3AMH A;  5IWF A;  3ES4 A;  1QJY 1;  2ZX4 A;  3AL6 A;  5LK7 B;  1JOB A;  1Q43 A;  3VD4 A;  3KT4 A;  1HQW A;  4JV4 A;  5A3T A;  4MVT A;  2QFE A;  5FCC A;  4GIQ A;  5FTT C;  1RUC 2;  3WUD A;  5F9T A;  4AI0 A;  2HWC 3;  4YZ1 A;  2WS9 2;  2MEV 3;  4P02 B;  1ZRE A;  4AQ2 A;  2ID4 A;  5IAT A;  1G7Y A;  1KDM A;  1OOP A;  2YG0 A;  4HSL A;  3VBF C;  5LEJ A;  1RUD 1;  5K0U B;  4A45 A;  3ZSK A;  2WII B;  2W39 A;  5EV7 A;  5FPB A;  2B46 X;  2BQP A;  1JMU B;  1YLL A;  3BU7 A;  4GMP 1;  2R06 3;  4Q1P A;  1HRV 2;  4JKM A;  2OUJ A;  2W91 A;  3I2F A;  3OPT A;  1F4A A;  3TEW A;  2YGM A;  2JE9 A;  2H0V A;  4JZR A;  4LXL A;  1PK6 A;  3CJI C;  3O1P A;  1B35 B;  2JEM A;  4Q4Y 3;  1YIF A;  2VY0 A;  3MDP A;  4FP3 A;  2KM2 A;  4EQV A;  4DB5 A;  1PIV 1;  3M70 A;  1WCS A;  4AFB A;  3ZX7 A;  4JTO A;  4XFI A;  3VZO A;  4M0N A;  1JZ7 A;  5F5I A;  2ZGR A;  2WO7 A;  2Y0O A;  1FOD 1;  2JIJ A;  4HK8 A;  3AZV A;  2FQP A;  1PZ8 A;  2DCT A;  2ZHK A;  5EQU A;  2Y6K A;  4Q0P A;  1S55 A;  2RS5 1;  1NCR A;  3PL0 A;  3RYK A;  1FT9 A;  4GZ9 A;  3TEY A;  3M3I A;  2XJR A;  4Y1Z A;  5GZF A;  2TEP A;  4CCC A;  1DHK B;  1NQD A;  3CF6 E;  3R0R A;  2A3W A;  2E31 A;  2Q8E A;  5I91 A;  3HN1 A;  5FYS A;  1W39 A;  4CCD A;  5A6Y A;  1JUI A;  1HX6 A;  5BYN A;  3AC0 A;  3DF0 A;  1W0P A;  3A23 A;  3OJB A;  3HEI A;  3J7M A;  4QPY A;  2W1W A;  1KD7 A;  5LBC A;  1OBN A;  4BHP A;  5B4X A;  5GLU A;  4EN0 A;  5T54 A;  5F3C A;  2Z42 A;  1MPX A;  3NNF A;  4DOU A;  2VNV A;  3IN9 A;  4ARX A;  5J96 B;  4CDU C;  4XF3 A;  3I59 B;  2D6P A;  4WVM B;  4LUK A;  1YNA A;  2ZEZ A;  3NMB A;  1GQP A;  3WHT A;  3ZFE A;  3QH7 A;  4Q2F A;  4D7Y A;  2W1Q A;  4M4P A;  4DXS A;  2ZEW A;  3LCP A;  4N53 A;  2RDN A;  2WNO A;  3WV6 A;  4A6S A;  5FJK A;  2VZQ A;  2RR1 1;  4HN1 A;  2BW8 A;  4QKN A;  1MS9 A;  5BNP B;  3HR9 A;  2W0X A;  3SEP A;  2RJL A;  3OD4 A;  1SDW A;  2X10 A;  4YNI A;  5F3G A;  5A7Q A;  1ASJ 1;  1QOO A;  2F17 A;  2YY1 A;  3JUU A;  1A3K A;  4GMP 0;  2QDN A;  4Y20 A;  4E2G A;  3DL3 A;  3MIE A;  1UU4 A;  4RQP C;  5AC9 1;  3VBS A;  3LA3 A;  1JHJ A;  2LTN A;  1W03 A;  3ZFG B;  3HPN A;  5JR2 A;  1QY4 A;  1IPJ A;  3VV1 A;  1COV 1;  4LBK A;  2GH8 A;  5DDJ 1;  3T4V A;  1VBD 3;  1NYW A;  4I0B A;  3PHM A;  3H1W A;  5C4W B;  1HB4 A;  4YGD A;  3EYP A;  4Q4W 3;  1RUH 3;  1ND2 C;  1GZ9 A;  3NST A;  3T09 A;  4BLI A;  1AR7 1;  2FZ1 A;  3FJS A;  4XHX A;  1CAU A;  3ZFG A;  4YVS C;  4A41 A;  3ACH A;  2ZHM A;  5HCB A;  2HWE 2;  1WD4 A;  2KD7 A;  2ZS6 B;  4OQ9 A;  3T2T A;  3ZKY A;  2GAL A;  3JBG 1;  5JOW A;  3EB7 A;  2Z2S B;  1S0E A;  5C4W A;  4M01 A;  3JB8 A;  3SXW A;  3B02 A;  5IK5 A;  2R7E B;  2X09 A;  4YW7 A;  2AYH A;  4FQ4 A;  4ASL A;  5HCA A;  4RS5 A;  2A6Z A;  1FAY A;  5F5C A;  4LK6 A;  3E5Q A;  3WQB A;  2BNM A;  2ENR A;  5FRE A;  2CHH A;  1YRZ A;  5FYZ A;  1Y43 B;  1BMV 1;  3N9N A;  4YZ4 A;  3ECQ A;  5LB6 A;  3MW2 A;  1O6U A;  1W6N B;  1QEX A;  2D98 A;  3AFK A;  3LEM A;  3MLL A;  5CFC C;  2VMD A;  4PBP A;  2WNU A;  2VO5 A;  4JGZ A;  1G86 A;  4AEJ A;  4IEQ A;  1OUS A;  2B7Y A;  1UMZ A;  1AYM 2;  3K4D A;  4AVB A;  1MEC 1;  4P9W A;  1UZV A;  3I3D A;  1ST8 A;  3THD A;  1UKG A;  1FPN 2;  3ASI A;  3PNA A;  2VNG A;  2VQ0 A;  3WF2 A;  1U5Y A;  2XON A;  5DZG A;  4ES9 A;  2YRO A;  5A3P A;  2RJ2 A;  1LU1 A;  5HXV A;  1GU3 A;  1NLQ A;  1R1Z A;  1H2N A;  3ZYJ B;  4NN0 A;  5FXV A;  4AFD A;  1XNT A;  2HWB 2;  3W21 A;  1QIQ A;  4AHY A;  5KBF A;  3SEE A;  5B2G B;  3DPR B;  4XYX A;  4KQ7 A;  1EAH 2;  4G4F A;  3ZR5 A;  2MPF A;  1H0B A;  2XR4 A;  3RZK A;  3VBU C;  3CQO A;  3ZIW A;  3POJ A;  1J58 A;  2YU1 A;  3L2H A;  4H14 A;  5IW0 A;  3O5S A;  3H3U A;  1Q8V A;  5BUV A;  5EIY B;  1OVS A;  4IND A;  3PDQ A;  2ADE A;  3T2O A;  4P5Y A;  2VTX J;  2UYA A;  2QCS B;  5IVJ A;  4BQ5 A;  1LEN A;  4CDW C;  4D69 A;  3B9I A;  2WJS A;  1HXS 2;  3H0O A;  5GZC A;  3NNG A;  4XZP A;  4LIV A;  4ZZ8 A;  1JYC A;  2Z5W A;  1CAV B;  4V1P A;  2WWU A;  2E7A A;  4LO4 B;  4EYU A;  3USS A;  3JQX A;  1UU6 A;  2K9Z A;  3O0X A;  1LHN A;  4R9C A;  4Q4X 2;  3D82 A;  1YI7 A;  4LHN A;  5EZW A;  3WNN A;  2R07 3;  3J26 N;  1QU0 A;  2HBT A;  1ZA7 A;  2GMP A;  1UKR A;  4AI8 A;  1BEV 1;  4BK5 A;  4RFT 0;  5IHR A;  4ASK A;  5KXE A;  4IV3 B;  4B29 A;  5JZG C;  1ENQ A;  4WM8 A;  1WA6 X;  2WFF 2;  1AR9 1;  4QDQ A;  5EHD A;  3WCR A;  5LCW L;  2NZ9 A;  1WLC A;  1FMD 3;  1NCQ B;  3J4U H;  1W28 A;  5LEK A;  1GNZ A;  2FDG A;  1HN1 A;  1Z7S 3;  4UFK A;  2VPV A;  3ZYH A;  2C1F A;  1XU2 A;  1W6Q B;  1XYP A;  3IM0 A;  4SLI A;  5A33 B;  5F6K A;  1DP0 A;  3WDT A;  5JMC A;  1EYB A;  1XU1 A;  1AR8 1;  4K7J A;  4BQX A;  1HQN A;  1BLZ A;  2FBE A;  3KV5 A;  2PHD A;  3TN9 3;  3AYA A;  3VN4 A;  3DYP A;  1RUF 2;  2D7F A;  2Y6F A;  4QQL A;  4KH9 A;  1XE8 A;  1WW6 A;  1RUI 1;  1W6Q A;  3PVO A;  3I3B A;  3IWZ A;  1W8O A;  3RYR A;  2VCA A;  4XTM A;  1SQ4 A;  3ZKU A;  1DQ0 A;  2ARB A;  4AF9 A;  4BOW A;  3KV9 A;  1RUO A;  5JSO A;  4E4S A;  1SG3 A;  3UK9 A;  2NM1 A;  1GWK A;  4UW5 A;  2ZJC A;  3U4X A;  4IET A;  3LSE A;  1S4C A;  4AI9 A;  1VBA 3;  1H6Y A;  3PVB B;  2E53 A;  5FP4 A;  2XJU A;  1KJL A;  3C2U A;  2D6M A;  2JWP A;  1JN2 P;  2QQW A;  2DVA A;  3TNP B;  1LNS A;  3WP5 A;  3RYP A;  4CCE A;  3ZN5 A;  5KHK A;  2QTW B;  1ULE A;  1MR5 A;  1JZ8 A;  4P9Y A;  2E26 A;  1V0A A;  2WBK A;  1ZA4 A;  2XVL A;  3C7F A;  3MF9 A;  1Z0H A;  3RG0 A;  1GAN A;  1PM7 A;  4Q0U A;  5FBZ A;  4YW1 A;  4QX8 A;  2HEW F;  2WZP P;  3TEZ A;  2VTF A;  1MS8 A;  4WM7 B;  5FZO B;  4TWT A;  3NNJ A;  4RHV 2;  2DYC A;  3ZXK A;  1IQD C;  3FUQ A;  3VDD B;  5FPL A;  1WLT A;  4AVC A;  3JCI A;  1XJA A;  1EV1 2;  4CRQ A;  4MXW B;  1BBT 3;  3SH4 A;  3WNX A;  4UF0 B;  1S2K A;  3WW4 A;  3ZVX A;  4LIT A;  3I4I A;  1UIK A;  1UYY A;  3AJY A;  1KFX L;  3VL8 A;  3SCH A;  4AED A;  3C7E A;  1E57 A;  2LW8 A;  1N3Q A;  1WCD J;  3VDB A;  1G9A A;  1E5R A;  3BI3 A;  5LA2 A;  4JX0 A;  3PJQ A;  4BJ0 A;  1Q5O A;  1S1A A;  3T4H B;  2ZHL A;  1VMJ A;  4OYU A;  3WXP A;  3CO2 A;  1HW5 A;  1PVX A;  5DUU A;  1LRH A;  1A34 A;  5E89 A;  2XB6 C;  4OMD A;  4D7S A;  3RJR A;  2X5I B;  1HJG A;  2WZR 3;  2WNV C;  1SCR A;  1UN1 A;  3Q8A A;  1DFQ A;  2J42 A;  2V5Y A;  5JIU A;  1TME 2;  4EWD A;  5C8C B;  2BFU S;  2RMU 2;  1BVP 1;  1NX9 A;  2A6V A;  4GD4 A;  5H9Q A;  5ISL A;  5FLI A;  2UUR A;  3FLR A;  1G9C A;  1VMF A;  4PQ9 A;  4UBG A;  3NWK A;  1XNC A;  3MW4 A;  3VBO B;  4BA6 A;  4CCJ A;  1YJK A;  2FCU A;  4AI3 A;  3EBR A;  4FTB A;  1AZD A;  1CJD A;  4GB3 2;  5FY1 A;  5EPA A;  1RHI 1;  2HH9 A;  4P5H A;  3B3Q E;  1HV0 A;  4XEZ A;  3UKN A;  3AL5 A;  2GC0 A;  4XAE A;  1XBF A;  4B1M A;  3QD6 A;  5IAV A;  1ZRF A;  4K6B A;  2AGS A;  3O14 A;  1CX4 A;  1QJY 3;  1CGP A;  1L3J A;  1UZW A;  3DGT A;  2WZE A;  3VBF B;  1MVE A;  3ZSL A;  4K8R B;  1AYN 1;  3VBO A;  4ZS3 A;  4RD7 A;  3I3E A;  3PIG A;  2H6C A;  2ZMN A;  1HIX A;  4OHZ A;  1XE0 A;  4IE4 A;  2DVB A;  4YG3 A;  4RGA A;  4Y5S A;  3S0M A;  4HFS A;  1CIW A;  3BTY A;  1Q3E A;  2MEV 2;  4IGQ A;  5LBE A;  1ZRC A;  1NQJ A;  4EE2 A;  1RVF 1;  3CJI B;  4DO0 A;  1UW8 A;  1RUD 3;  3GGL A;  3V65 A;  2BWC A;  5CAZ A;  1YFU A;  5CZK A;  3T0B A;  3GAL A;  1ULC A;  4GMP 3;  4M3C A;  4QB6 A;  3AZZ A;  3LF7 A;  2YXS A;  3P3N A;  4F8A A;  1N1T A;  4D7T A;  2QQJ A;  1AXK A;  4A2U A;  2CGP A;  1XNA A;  2O8Q A;  3PMS A;  5FYM A;  3VHP A;  3SQO A;  2ZTN A;  3SH3 A;  2PLV 2;  3VUO A;  3VD7 A;  4XAA A;  2G19 A;  1WBF A;  1WW5 A;  4IE5 A;  3PIJ A;  3C3V A;  5EXO A;  4AFC A;  4Q4Y 2;  3FLT A;  2RS1 1;  1PIV 3;  4E4D X;  4QPI A;  1OF3 A;  1GP5 A;  1YC6 1;  5D21 A;  3MV0 1;  1CZS A;  4OI4 A;  1FOD 3;  1UY3 A;  3DV8 A;  3C7H A;  3N35 A;  4CTE A;  3PTY A;  2RS5 3;  1ZZB A;  4BLJ A;  2VVF A;  3IMM A;  5A7W B;  2BGC A;  2VUL A;  2GSY A;  4CDQ A;  4ES8 A;  1BYH A;  4YAR A;  1JU4 A;  3PTR B;  4XFA A;  4CP9 B;  1CON A;  3MLJ A;  4DFS A;  4JHZ A;  5FZA A;  5FY5 A;  1KQR A;  2RHP A;  3ACG A;  4FI9 A;  4LHS A;  3AYE A;  2JKB A;  3ORJ A;  4NAM A;  3ROU A;  2VMH A;  5T5L A;  2CGO A;  4FSJ A;  3WUC A;  1F5F A;  2EF6 A;  2VZO A;  2VZV A;  4HOO A;  4QHZ A;  1UL9 A;  4AHW A;  1DYP A;  3WDY A;  3I2G A;  4JGY C;  4RFR B;  4XUP A;  1CPN A;  4Y24 A;  2Q8O A;  1DZT A;  1UX6 A;  5K9Y A;  5FXX A;  2W92 A;  2HLE A;  2YYO A;  4QM9 A;  3K4Z A;  3U1X A;  5EP9 A;  3KQR A;  1MZF A;  4YGC A;  3WCS A;  2MHF A;  3SNM A;  5C5T A;  5L73 A;  5LA1 A;  1T6B X;  2AC1 A;  4Q27 A;  4ZS2 A;  4NIA A;  4AVT A;  5FO7 B;  2JDA A;  5K4L A;  1X33 A;  2RE9 A;  2W9X A;  2RR1 3;  2DCJ A;  2W1U A;  2XJT A;  4HPK A;  4D94 A;  4FVV A;  2B8M A;  1W8U A;  2R49 A;  3V0A A;  3N36 A;  3VGI A;  3C8X A;  2W68 A;  1ASJ 3;  2PQS A;  4KBB A;  4XQW A;  5AC9 3;  4Q0S A;  1FV2 A;  1RXF A;  2EXH A;  3AKS A;  5JMO A;  1ND2 B;  2JDP A;  1X8M A;  2RS3 2;  4Q4V 1;  4XVH A;  1O7F A;  2ZX0 A;  4YVS B;  1COV 3;  1LEC A;  1PGW 2;  3A0K A;  2Q1M A;  3HIF A;  5DDJ 3;  3ZFE C;  5ACA 2;  1SEF A;  1KFU L;  1OLQ A;  2W46 A;  1BZW A;  4NHY A;  2VBB A;  4N53 C;  1NA1 B;  1NLS A;  1U0A A;  4Y3O A;  1K5M C;  5C3P A;  4Q4W 2;  3M1H A;  1AR7 3;  4I0A A;  3VBR A;  3GCW A;  4Q8K A;  5CFC B;  5T5J A;  1H8T A;  4BWO A;  3JBG 3;  4ZU5 A;  1UY1 A;  2E9Q A;  2BUK A;  4QDR A;  3H1M A;  5T50 A;  1ZRD A;  4Z2A A;  3WDX A;  3IPV A;  4XPV A;  2VXJ A;  1J3R A;  3WDW A;  2QVS B;  2WA3 A;  3VBH C;  4OHY A;  4K9S A;  5FRA A;  2WN2 A;  3LQC A;  3HBK A;  4Q8L A;  4QPW A;  4CU9 A;  2JE8 A;  3VKO A;  1IKQ A;  2BNO A;  3AMM A;  4XFG A;  1NAE A;  4YPJ A;  4GAZ A;  3QOP A;  1MQT A;  3OGG A;  5J3U A;  1NY7 2;  2XHK A;  5A80 A;  3EQE A;  2R04 1;  3CMG A;  1AJK A;  2VTX A;  1O5U A;  1MVQ A;  3BTA A;  3UJQ A;  1MEC 3;  1ZBA 1;  5ABJ A;  1QGL A;  4UT5 A;  1W04 A;  3SLI A;  1V6I A;  2XBO 2;  4Q1R A;  3TAY A;  5A7P A;  5J1X A;  1XSQ A;  1J84 A;  1FYU A;  1I3H A;  1MS3 A;  2P3I A;  3M8L A;  4O7X A;  4PHZ A;  5J7M A;  1WD3 A;  2A7A A;  3AP7 A;  5IK4 A;  4RGK A;  4CDW B;  4ZKT B;  2VME A;  2QQK A;  4PJY A;  1X50 A;  4N43 B;  3WY6 A;  4J6G A;  1R1A 2;  4IUG A;  1F35 A;  2Y0I A;  2YPD A;  1TMF 2;  4KMQ A;  1RUN A;  5I0U A;  2ZGS A;  3NV2 A;  3K4A A;  2WNU C;  3UV9 A;  3T1L A;  2UY9 A;  3VKN A;  5CFD C;  4L97 A;  3K77 A;  1SBE A;  2XQR A;  4LUL A;  3X29 B;  1GQG A;  4ZXK A;  3RZM A;  1OQ1 A;  3OB8 A;  2JG9 A;  5FZH A;  1S0F A;  3WF4 A;  3HMY A;  4D0Q A;  2VW2 A;  4OUL A;  4XHB A;  1F4H A;  4I02 A;  4IQP A;  4LJH A;  3WG3 A;  2ZOE B;  3N7M A;  4CUG A;  4PLM A;  3WD5 A;  2BNN A;  2JG8 B;  2PXJ A;  3AZY A;  1BEV 3;  1OLM A;  2DVD A;  3ALQ A;  4XIK A;  3I2D A;  5FUP A;  4MV2 A;  5A7N A;  5CB7 A;  4K21 A;  2VE1 A;  2XJQ A;  5FY0 A;  3J7H A;  4E4Z A;  3O1S A;  1AR9 3;  3ILN A;  3ZXL A;  2RVA A;  4MH0 E;  3CZJ A;  5B4N A;  4MG2 A;  2ILM A;  1G9D A;  2ARX A;  2R30 A;  1D4V B;  4UW3 A;  3J9S A;  2VU9 A;  5L9V A;  2JG8 A;  2BVV A;  1PO2 1;  4FOQ A;  1ENX A;  1QOT A;  3AP5 A;  4Y1U A;  5JR7 B;  3HAG A;  4BMB A;  4D8M A;  4YW4 A;  3J8F 1;  1CZT A;  3T0A A;  3V64 A;  5GLZ A;  1AR8 3;  3DCQ A;  3W20 A;  1OT5 A;  2ZEY A;  1FXZ A;  5BXX A;  1RIT A;  4QPG B;  3FFZ A;  3O12 A;  3TN9 2;  1YFY A;  3B01 A;  5CNA A;  3HQR A;  1VR3 A;  4XIL A;  1RUI 3;  2W95 A;  4TYS A;  3ZXE A;  4BH9 A;  1DDL A;  1AJO A;  1SBF A;  1NE6 A;  1WCQ A;  1OHF A;  2PHL A;  3FLP A;  1HRI 1;  1RIN A;  2J1V A;  2JDU A;  1DLC A;  1ZM1 A;  3OY8 A;  4IW3 A;  4COW A;  5GZE A;  4UFI A;  3WP4 A;  4XBL A;  1LOF A;  4QQ2 A;  1VBE 1;  4E2Q A;  3J7N A;  2QQU A;  1DG6 A;  3RZL A;  5H9S A;  1W6M A;  5CG8 A;  2XJV A;  1RC6 A;  3NL1 A;  3ZN6 B;  4AOC A;  1C57 A;  5T55 A;  1WLD A;  3ZYR A;  3TYJ A;  3RGB A;  2R32 A;  3T3Y A;  3U14 A;  3WDV A;  3V0B A;  1CIY A;  1RUG 1;  2PYT A;  5FZ9 A;  2ZGQ A;  4LR4 A;  5JXG A;  2ET1 A;  5LBB A;  3GDB A;  5L7O A;  1C3H A;  2EXI A;  2WC2 A;  3POF A;  4KBZ A;  4QMA A;  3Q8B A;  2I2S A;  2P17 A;  2P3J A;  1RJ8 A;  2TUN A;  2ZEX A;  4QX3 A;  1ZBE 1;  4DZG A;  3AXE A;  4E27 A;  4AHZ A;  4C1W A;  4NAO A;  1A78 A;  1CAX A;  3EMR A;  1YHF A;  3I97 A;  4JRL A;  1A8M A;  1UCX A;  3PU8 A;  5IJR A;  2E6V A;  3JQW A;  3WG2 A;  3NVC A;  4X8N A;  5A1L A;  2YC4 A;  3E1F 1;  1DYK A;  3AMP A;  3GJB A;  1H2K A;  5A6Q A;  5C70 A;  2WNV B;  4QKB A;  4E8C A;  3PUR A;  5A3U A;  3NNM A;  4AI2 A;  4JKK A;  3ZSJ A;  4MHR A;  5BNO B;  4CXY A;  4NIH A;  4AFA A;  1MS1 A;  3ZO0 B;  5JWP A;  4LOT A;  4HBN A;  1QXJ A;  3RVH A;  3VD9 A;  1O8S A;  2IVI B;  2EAK A;  3GBW A;  1W8W A;  4YFZ A;  3ACF A;  5FYU A;  4TZD A;  5GAL A;  4AEM A;  4CCL A;  3OUI A;  4L92 A;  5ANN A;  1QDC A;  2A6Y A;  5J09 A;  1J59 A;  3MID A;  1I6X A;  4SBV A;  4IEZ A;  4FFG A;  4XDO A;  2DUP A;  3VL9 A;  4NPR A;  1JTZ X;  1VBB 1;  4J25 A;  4RA0 A;  1W6O B;  3D8C A;  1RHI 3;  2G4I A;  4LO7 A;  2YDE A;  2X05 A;  5JPM B;  4V2W A;  1DQ2 A;  5FAX A;  2A73 B;  3E5U A;  2QQI A;  1QWR A;  1VBC 2;  1IHM A;  4B7K A;  3MIC A;  4M0H A;  4XZU G;  3UGH A;  4GH4 A;  1PZ9 A;  1W99 A;  3BN6 A;  1AYN 3;  2R6Q A;  3FMG A;  5D8A C;  4MGT A;  2GME A;  2AEZ A;  3O1R A;  3VZN A;  5FZ4 A;  2D93 A;  2ORZ A;  5K8S A;  1GP6 A;  3WOG A;  4Y22 B;  1GNY A;  3P1I A;  5FXZ A;  3WNP A;  1GFF 2;  3B93 A;  3JD7 2;  3K2O A;  2VOX A;  2GN3 A;  3LE0 A;  2WYF A;  3ME2 A;  5FYC A;  1W8H A;  4I3P A;  1UNB A;  1RVF 3;  3DN7 A;  4N8M A;  4S2G A;  3OCP A;  4TLG A;  4WBB A;  2IZW A;  4BB3 A;  2YBS A;  1C1L A;  3H1Y A;  2DCK A;  3RJ2 X;  1ND3 B;  1QJX 1;  1VAM A;  1RUJ 2;  2QJV A;  2YUE A;  4F83 A;  2B4K A;  5EWS A;  2E33 A;  4MLO A;  3U37 A;  3IDC B;  3FWE A;  3R4U A;  2ZGU A;  2V09 A;  2DCY A;  1HV1 A;  1PO1 2;  1BCX A;  1GZW B;  5IVE A;  4NRQ A;  1PVC 2;  1ZZ9 A;  2EAL A;  3GHN A;  3T2Q A;  1XYO A;  4IE7 A;  3KHB A;  1S0B A;  1LR5 A;  4OHW A;  3ZFF C;  1CQ9 A;  4BQW A;  1S0D A;  1K12 A;  1MZ6 A;  4OUS A;  2RS1 3;  3RWN A;  1C8M 3;  5K0U A;  4DRV A;  5DMY A;  3RZG A;  2PEL A;  2WS9 1;  2OXB A;  2BVB A;  4LPL A;  3FHA A;  1W6P B;  4MGQ A;  4QQP A;  2XH6 A;  1HJF A;  2WAB A;  1DQ5 A;  2ET7 A;  1APN A;  3UET A;  4YWA A;  2CL2 A;  3F95 A;  1BQP A;  4URA A;  1IG0 A;  2UWC A;  2VOW A;  4JGY B;  5EJ3 A;  2OII A;  1B35 A;  1IS4 A;  4CYD A;  3ZXD A;  2ZZJ A;  1GV9 A;  1HRV 1;  5A6X A;  1O3R A;  1O8P A;  3S5Q A;  1VAK A;  1WMD A;  3CBN A;  4FOW A;  1BXH A;  3WF0 A;  1RED A;  4YW6 A;  3S5A A;  1M06 G;  2BBA A;  1N1V A;  2A3X A;  2HWF 1;  2J22 A;  4QGL A;  4XF4 A;  1Y4W A;  3KS7 A;  4LKE A;  4XBQ A;  5FYT A;  2P3K A;  4CZS A;  3H3Z A;  4E8D A;  3MPB A;  2YB7 A;  2JB8 A;  2QKD A;  4A3Z A;  2ERF A;  3RZH A;  1JZ6 A;  2BYV E;  4YZ2 A;  4PQQ A;  1R64 A;  5J98 B;  3I7D A;  2R1D A;  5JZG A;  5JI7 A;  5JCT A;  5FYH A;  4Y1Y A;  2ZGO A;  2JDH A;  1XYN A;  5IVC A;  5FQ0 B;  2NQY A;  4NOT A;  4XJA A;  5LBF A;  5IUQ A;  2CY6 A;  4AFM A;  5FZ3 A;  1IPK A;  1NXD 1;  3NRU A;  2NMN A;  5GZD A;  1OA2 A;  3I59 A;  5T5O A;  2VZR A;  3TBD A;  1DQ4 A;  5CEH A;  4WVM A;  4O65 A;  1Q8Q A;  5DUX A;  3SCF A;  5FZE A;  2ZGP A;  5FP9 A;  5C3Q A;  3GHM A;  1LES A;  3I8T A;  3KF3 A;  4L11 A;  1K5M B;  3KT1 A;  2ZAH A;  5AC9 2;  4KU8 A;  2B42 B;  4Q4V 3;  1AL2 3;  2W94 A;  4CEW B;  4B7E A;  2Q4S A;  2D5F A;  1COV 2;  2DFC A;  4ZXE A;  1MZE A;  5FPA A;  1CVN A;  4KGQ A;  5A1F A;  5BNP A;  5GZG A;  1DYO A;  2CV6 A;  2A70 A;  3OGR A;  2AAC A;  5I93 A;  3ENR A;  2J1S A;  1X9P A;  2P1B A;  1OH3 A;  2IXH A;  4RR3 B;  5F2S A;  3VBH B;  2P6C A;  2YC0 A;  5FZM A;  4CEY C;  2LRO A;  2OA2 A;  4AR2 A;  4LIU A;  4CU7 A;  1W0N A;  1SFY A;  4LQR A;  3N9L A;  2GN7 A;  4NHL A;  5FDB A;  3NV1 A;  4AGR A;  3POI A;  4A7Y A;  1GP4 A;  1QOS A;  2NPI A;  2ZKN A;  3LAG A;  3OD0 A;  2J7M A;  4ZZ5 A;  2ZXQ A;  5KR7 A;  1JYX A;  5ANQ A;  1SZB A;  2OT7 A;  2P37 A;  4PLN A; 
#chains in the Genus database with same CATH homology
 5L9V A;  2JIG A;  5LAT A;  2RDQ A;  5LAS A;  2JIJ A;  3W20 A;  5EQU A;  3NNL A;  3PL0 A;  4Q5O A;  5HV4 A;  5IAX A;  4NHX A;  5DAQ A;  4XCA A;  5M0T A;  3HQU A;  3OUJ A;  3HQR A;  2RDS A;  5ERL A;  2Y34 A;  4Y5T A;  2FCU A;  4NHY A;  4BQW A;  5EPA A;  3GJA A;  4IW3 A;  2HBT A;  3NNF A;  4XCB A;  5L9B A;  3W21 A;  4ZPI A;  5IAV A;  5DAX A;  3DKQ A;  3ITQ A;  4XAC A;  2A1X A;  2FCV A;  5LBB A;  2RDN A;  4Y5S A;  4KBZ A;  3OUH A;  5LBE A;  3GZE A;  4NAO A;  4XAB A;  3EMR A;  4NHK A;  4BQX A;  5LA9 A;  5LBC A;  4NMI A;  2FCT A;  3GJB A;  5L9R A;  5A3U A;  4XAA A;  2G19 A;  4XC9 A;  2RDR A;  3NNM A;  4BQY A;  4MHR A;  3KT7 A;  5HV0 A;  4UWD A;  5LBF A;  4MHU A;  3BVC A;  5DAP A;  2RG4 A;  3KT4 A;  3OUI A;  3MGU A;  3KT1 A;  5DAV A;  5C5U A;  5DAW A;  4NHM A;  5IAT A;  2OPW A;  4J25 A;  5LB6 A;  4ZON A;  3NNJ A;  2V4A A;  2G1M A;  2HBU A;  4NHL A;  2Y33 A;  5EP9 A;  4JZR A;  5C5T A;  3OBZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...