5L9VA

Hif prolyl hydroxylase 2 (phd2-r281c/p317c) cross-linked to hif-1alpha nodd-l397c/d412c and n-oxalylglycine (nog) (complex-1)
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
215
structure length
215
Chain Sequence
PALKLALEYIVPAMNKHGICVVDDFLGKETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLICHCNGKLGSYKINGRTKAMVACYPGNGTGYVRHVDNCNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERAAAKVKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Egl nine homolog 1
publication title Structural basis for oxygen degradation domain selectivity of the HIF prolyl hydroxylases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 65
structure length 215
sequence length 215
chains with identical sequence B
ec nomenclature ec 1.14.11.29: Hypoxia-inducible factor-proline dioxygenase.
pdb deposition date 2016-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13640 2OG-FeII_Oxy_3 2OG-Fe(II) oxygenase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 5l9vA00
4MHUA 5C5TA 3DKQA 4XABA 2HBUA 4KBZA 3OUHA 5HV4A 3KT7A 2FCVA 2RDRA 4IW3A 3W21A 5IATA 3EMRA 5ERLA 3OBZA 4NHYA 4XCAA 2RDQA 4XC9A 2RDNA 2JIJA 3NNJA 2RG4A 3BVCA 5LBBA 4XAAA 5EQUA 5L9VA 5DAXA 5DAWA 3PL0A 3HQRA 4NMIA 4BQWA 2G1MA 5L9BA 4NHLA 3KT4A 5EP9A 2JIGA 3NNLA 4Y5SA 5IAXA 4NAOA 2A1XA 4J25A 5DAVA 4BQYA 4BQXA 2FCUA 3GJAA 4XACA 3NNFA 4JZRA 5M0TA 2HBTA 4ZONA 3KT1A 4XCBA 5HV0A 4Y5TA 3MGUA 2OPWA 5IAVA 5A3UA 2FCTA 4UWDA 4ZPIA 3HQUA 2G19A 4NHKA 5L9RA 3OUJA 5C5UA 2V4AA 5LA9A 5DAQA 5LBEA 3GJBA 2RDSA 4MHRA 4NHXA 5LBCA 5LASA 3ITQA 5LATA 3W20A 2Y34A 4Q5OA 5DAPA 5LB6A 5EPAA 5LBFA 3GZEA 3OUIA 2Y33A 4NHMA 3NNMA
chains in the Genus database with same CATH superfamily
4V1PA 3CJIC 4FPEA 4QAWA 3VBOA 5GLTA 3VZNA 1BQPA 2AC1A 1W04A 1CZVA 2W08A 1HIXA 1VBA2 2DCKA 5D21A 1NZCA 2OUJA 5DG2A 1J1LA 3VB9A 2QQUA 3M3EA 2DBNA 3VHRA 3ZYHA 2SLIA 1BK0A 4AEDC 2WJSA 5FJHA 2NN8A 2OW4A 2WT0A 3HIFA 3HNYM 2KA3A 2YC0A 1WW4A 2VY0A 3M2MA 4XQ4A 1AJKA 4AK3A 4E4DX 1AL23 1GZTA 1HRV3 2IVIB 1WA4A 2XBO2 5JLVA 1VAMA 4ONUA 2W9XA 1G9FA 4QQ2A 5I0TA 3U10A 4CDXB 3WR0A 1U0AA 3VN4A 1G9AA 4OHWA 4IETA 3FHIB 3LDRA 1YI9A 5BPXA 4YM2A 1KRIA 4DRRA 5LBBA 1NKGA 4XJZA 1XYPA 3WSOA 3JD71 2Y0IA 3IMMA 2JDMA 3KV4A 2JX9A 2IFRA 3LEGA 5A7WA 5IJRA 1XPWA 3EQEA 3I2IA 3IB3A 5FLIA 4P5YA 5A32B 1RB8G 2VMFA 1MPXA 2OIIA 1M06G 2J1RA 4IE7A 2EIBA 4NWWA 4QQHA 4XHXA 3FZ3A 3IIIA 5CG9A 5FFOC 4HK9A 4IGOA 3ZSMA 1W6OA 2Q1MA 1Q8QA 5IAXA 2XUMA 4LO5B 3T2QA 2EVXA 3I54A 3T4HB 4YW4A 3ZFGB 1CPMA 3CBNA 4LHKA 3SITA 3QOPA 3ROUA 4Y4YA 3VDCA 2VOWA 4LJHA 4CCLA 2ADEA 3IPVA 4OZXA 4M3CE 4PIXA 4ZS2A 1BKZA 2ZKLA 1PO22 3HEIA 2C4XA 1NAEA 5EFUA 5L19A 2JWPA 1C4RA 4FAGA 1OQEA 1WW6A 1HRV1 2X5IB 2WABA 2EIDA 3IN9A 2CWSA 2J1EA 3I4IA 4A2UA 2ID4A 1VBC2 1GYKA 2DFCA 2ZMKA 3KQ4B 5JOYA 4LBOA 1OOPA 2RR13 4LUKA 1DQ0A 5IAVA 1WBFA 4AW7A 2VL4A 4FO9A 4AAXA 4YVWC 3AMPA 1POQA 5F39A 3NL1A 4AF9A 4JDOA 4XW3A 1F8VA 1TEIA 3VZMA 1A8MA 4GAZA 4XXAA 1S0BA 3BI3A 5FP3A 1Z7S1 4D7TA 2D93A 2E53A 5FPVA 1UOGA 2P3JA 1LU2A 4AHYA 5BUVA 3ZYJB 2BPA2 2EAKA 4YW6A 1C8M2 1XE0A 5KC6A 1XNDA 3WQ7A 3IT8A 2WAOA 2L9LA 3TOJA 1WMEA 5F2SA 1AYN3 3ELNA 3HN1A 3UKTA 2ZGQA 1UIJA 5CB7A 1HB1A 1NCQA 3AKPA 2Q1ZB 4ZU5A 4XJUA 5JMOA 2VZRA 1KEXA 3J7NA 2ERFA 4CEWB 1G9CA 1W8WA 2W1SA 1S0FA 1NUKA 1W8FA 3VZLA 1O4ZA 5C33A 1HX6A 1EUUA 1WW7A 5HXMA 3RYPA 4CZSA 2VW1A 4LHNA 5E89A 4AQ2A 1JYNA 4QGMA 4R4ZA 1OFSA 2FHRA 2RR11 1W8UA 2ZGRA 2VQ0A 5LK7B 1C1LA 4A3ZA 3U14A 1N1YA 1POV1 3KWVA 4M0NA 2MEV3 5KHHA 4OFGA 4BMBA 2D43A 2VPVA 1W8ZA 5CADA 1CWPA 3KF5A 1AYM2 4BA6A 3I3EA 1G7YA 4EYUA 1BHGA 5IUQA 3WG3A 4GQ7A 1S55A 5CKNA 4FPJA 2LALA 4MZUA 1PGW1 4N53A 4PLNA 4EV0A 1WD4A 1IPJA 2A73B 4GWJA 3W21A 1I5ZA 3DXTA 4Z92B 1UY4A 2PMWB 2HJIA 2JE9A 1RL3A 2YV8A 5H9SA 1PNFA 2VVDA 2P17A 4GD4A 1AXKA 1DHKB 3N9OA 4QDQA 4CU9A 3T0BA 2ZX2A 1RUC3 1FOD2 3SCFA 3ILRA 4CCJA 1I9RA 1ULOA 1AYN1 1VBB3 4LORA 4NROA 3PDQA 3T2OA 4UBGA 1HQWA 2QUOA 2HWB2 4RFT0 2WYFA 4ZS3A 2WNVA 4CDXA 5IHRA 2B39A 1RUG1 3B69A 2VQTA 5FZEA 1K42A 4QPGB 1Q8OA 2ORXA 3J4UH 4Y5Z0 5A7SA 4D6SA 1W39A 2G1MA 3SCHA 3KT4A 2FDIA 4YFZA 2W91A 3ZDSA 4IEZA 4YSFA 1RVF3 2OVUA 1ZRFA 2ZGNA 3CL1A 3MEPA 3U1XA 3P5BA 5A32A 5C8CC 2PHRA 1DIWA 3ZR6A 4AAPA 3ZFFC 4HPKB 3GXUA 1ZZ7A 3I49A 3O5SA 1RUH1 3AZVA 4G4FA 1W8NA 4E8DA 3KGLA 1LR5A 3ILNA 3ZFGA 4OUSA 4AXOA 5JSOA 1S0EA 1Q56A 1POV0 3ZPYA 5HV0A 3NKTA 4H7MA 2O8QA 1XYOA 1RUC1 1UWWA 1XNBA 2E51A 5KHIA 4DOUA 1R1A3 4XQWA 3DYPA 3Q8AA 3J8F2 2ZGUA 5CKMA 3PJQA 3FWEA 5ANNA 4PJYA 5DZFA 5KR7A 1ZRDA 5A1LA 1H8TC 4DS0A 2X5IA 2RS32 5FUIA 4NWVA 3UGGA 5IK7A 2BGOA 1NLRA 3SCGA 2BNOA 3FMGA 4BIFA 4YG3A 4D7SA 5FR3A 5I93A 3H1MA 2KXLA 1XNCA 2GC0A 5B4XA 5LEKA 4MGYE 4P9WA 4OI2A 4YVSB 3ZSEA 2W0XA 1CZSA 5J98B 5J1XA 5C5UA 3ST7A 3LOBA 4FBFA 3AZZA 3MIFA 2HWD1 4JRLA 3BPZA 1BBT3 3N4MA 1Q3EA 3A21A 3DXUA 3N7JA 3OGVA 5B4NA 4AI1A 4JGZC 5T52A 2JDYA 4YW5A 4XQDA 3OD0A 4XJAA 4EN8B 1AR73 2QFEA 1KDMA 2R7EB 5FZDA 3KZ4C 3URFA 1AR92 3MO4A 1WLDA 3M3CA 4AI3A 2BZDA 5FV3A 3NNGA 5FK8A 2VZPA 3RJRA 3RQ0A 3S5QA 1QQP3 1MACA 1QWRA 1V6MA 1XBFA 5A3TA 3N7MA 2CAUA 4BCUA 4BMEA 2CGPA 1QDOA 1KS4A 1R1A1 1ULDA 4GKYA 3VZKA 4CEWA 4HBNA 4ARXA 4RL7A 1QXPA 1LENA 3HBZA 4AVBA 4BISA 4MH0E 2QZ3A 4IE6A 1KJLA 4Y1VA 5KHJA 3ZIWA 1N47A 1SDDB 1AR62 4OHVA 3IDAA 3SISA 5FO9B 5L7OB 5HCHA 4GWIA 1PGSA 4E4HA 2YC2A 1ASJ3 2WS93 3ZYBA 5IATA 1QOTA 3BKZA 3VHPA 3ZO0B 5GZGA 1ZRIA 2DWRA 3H1WA 2ZACA 5I0UA 5JAXA 3JUUA 1OKQA 5FPZA 4XJWA 5B2GB 2ZZJA 2PLV3 1BBT1 4JKMA 5GLVA 2VH9A 2DU1A 1VBD2 1S1AA 3FUQA 3T3YA 1QNWA 5J37A 2WUHA 1FMD2 5F9TA 1AR71 4GWMA 2JD9A 3B9CA 1HQNA 4FPFA 3ZKUA 1ZRRA 4U2AA 1OPMA 2B46X 1CAVB 4QT6A 1QQP1 5E8AA 1NY71 1VPHA 2F4LA 3R4SA 3T09A 1D2SA 1NOVA 2ZMNA 1NQJA 2W2IA 1G86A 2VU9A 1OUSA 2OZ6A 3OJBA 3QCWA 3NV3A 3Q8FA 5E1RA 1K12A 3WNOA 4NAOA 5GLUA 3UV9A 1RUD3 4GZ9A 3CKHA 1BEV3 3VHOA 4QPGA 1Q8VA 1OKOA 3THTA 2UURA 3VBFA 4QXBA 2A3YA 2R32A 2FCUA 2N7GA 2YY1A 4FQ4A 1Y43B 4AEKA 1IS6A 5J36A 3MIEA 1ASJ1 4XACA 4Y1XA 1E5SA 5DN2A 4K8RB 5CNAA 4NE9A 1HJFA 3SMHA 2GMPA 1Y9QA 1W6PB 1NE6A 2ZXQA 1GWMA 4X8PA 2YPJA 3VD4A 4LKSA 1QDCA 1GLHA 4HPKA 2PLV1 4O61A 1LEDA 4IV3B 3WF2A 4FP2A 3MZHA 1HRI1 5G04L 1UQXA 3S7IA 2D40A 1ZBE2 2LROA 2B8MA 1DQ4A 4KG0A 3ZIXA 2WN2A 4XDOA 5C70A 1RXGA 3RPQA 4WM7A 4J1XA 3T2TA 5JXHA 4Y20A 1MEC2 2R043 4IEPA 4UFKA 2FMYA 1QJX3 4NUBA 5AVPA 2TUNA 3ZPOA 5F8PA 5SV8A 1B35C 3W5NA 5FP7A 3RWNA 1JYIA 1WBLA 2YUEA 3AFKA 5EIYB 4EZ4A 4IEVA 3I3DA 1PZ8A 3TEZA 4YZ3A 4KI5M 5DAQA 1UL9A 1AZDA 1JOPA 4N90A 3RZGA 2BGPA 3LEIA 3VD5A 3ZSJA 4LR4A 3SQOA 2QQWA 2WLQA 5HPOA 1RMU2 1HXS1 2G9ZA 4YVSA 4ATEA 4JVAA 5J3UA 2WNEA 4YW3A 3W20A 3GHMA 3P1IA 1IQDC 1YQ8A 2IFWA 2RJKA 4NOTA 4HSLA 4I0AA 2GAUA 2AZ5A 5C3SA 1DLCA 2BRTA 3FLTA 3ZXEA 5JXIA 2RMU1 2W95A 3DGTA 3AK0A 4MV2A 4OVEA 5FZLA 5IVCA 5FY0A 2ZGOA 2XH6A 5FMOS 3UJOA 1SBFA 3NSTA 5FWEA 2FQPA 1YJKA 4JX0A 2VW2A 4QKDA 4OHZA 3NW4A 1UCXA 5FZCA 4B3NA 4HXCA 1QJX1 2D6LX 1GZ9A 1ENQA 2ZGTA 4OI0A 4HETA 5FBZA 4ZHNA 5BNQA 4OI1A 3A22A 4DUWA 4OHXA 5FXZA 3ZN4A 2QQVA 3H42B 1SEFA 4MXVA 2WQ4A 3I2OA 1OT5A 2W68A 1ZBA1 4CYDA 1OXCA 2WDBA 1GWKA 4L99A 4XCAA 3H8XA 5CIRA 2GNBA 1PIV2 4DY3A 3VBOC 1D4M2 4IEOA 5T50A 1C5IA 2B42B 4AHZA 3WG1A 2DYCA 3GDBA 4JGYB 4Z1VA 1TG7A 4XFHA 2WFPA 1N1TA 2ZCWA 1IS4A 1K5MB 2JXAA 2VZVA 5FYCA 3A4UA 3PUAA 2KR2A 3H8RA 1R083 4CCDA 5C9AB 2I2SA 3B00A 3K4AA 3TAYA 4K3UA 3AL6A 1ZZCA 3VV1A 2BGCA 2YU1A 1DGWA 1QJY2 2ZS6B 4JTOA 4IV1A 4QQLA 3GBWA 4AQSA 2D97A 4J25A 5LY2A 1CAVA 2JENA 1BMV1 5FPUA 4CUBA 1GKBA 5C4WB 1OA2A 3NWKA 4QGNA 1CD3G 1REDA 3E6BA 3M70A 3FC0A 5EXOA 4R8HA 1VBE1 3RNSA 5FTTC 3MV01 3GBFA 1UPIA 4MADA 1XYNA 4N43B 2W47A 4UFJA 1CVNA 1RUF3 1NXD1 1V6IA 1O3RA 3C7EA 2YGLA 4FQZA 5FZ0A 2ZX4A 1UU4A 1N1SA 4RHV3 3D82A 1Y9GA 4XVHA 4MGZE 1SFYA 1J59A 1WW5A 4MXWB 5BNOC 1MZEA 1OD3A 1REEA 2ETEA 2DVFA 4W6XA 5FY8A 4FTSA 1W2AX 5K9YA 1VB4A 2NM1A 2PA7A 4WV8A 2HWF3 1XXNA 2Q1FA 4Y22A 2YBKA 2C9KA 4UT5A 2IXHA 1ND2B 3LIHA 1AX2A 5BNPB 2FMDA 3QD6A 3S0MA 2BBVA 4IV3A 4FPKA 4A6OA 4Q4X2 3KCCA 4NHKA 4B4RA 4CXXA 2ET1A 2VOVA 3KB5A 4LBKA 5A3PA 3RZLA 4QX0A 1ODNA 1IGOA 1K3IA 4Z82A 4YGCA 3QH6A 3E97A 5FAXA 1COV3 1F5JA 5FRAA 2E7QA 4FPGA 1KITA 2C9AA 1W9WA 3O1MA 4UOJA 5FZ4A 1LTEA 3WG4A 5GKAC 5LW9A 3WP6A 4CUCA 1X7NA 4XFCA 4AVSA 3R4UA 5LRRA 4E27A 5A1FA 4CDUB 3WDVA 4E2SA 1CONA 3AYDA 4HVRA 4N7UA 2WWUA 4CCEA 1V6NA 3AFGA 1SFNA 3PVOA 4DIQA 4EE2A 3I3BA 2PXJA 1JZ8A 1DZRA 1O5UA 1XQNA 4QX5A 5FUNA 1LOBA 3AZYA 3ZXJA 5FO7B 1MQTC 3G6JB 4IUGA 2DUOA 3C8XA 4YARA 5C5TA 2UYAA 1DFQA 1QF3A 3NJVA 1YCIA 3HT2A 3ZYGA 1PZ7A 1UMZA 2HWC3 4CEYC 5JDBA 1UZYA 3BODA 4BHPA 2XXZA 1MVEA 3KMHA 3QLQA 5FMOL 3PURA 4AQTA 4E4SA 4TN7A 5BNNB 1W6MB 4PQQA 4RGKA 5FKCA 3VBSA 4AFDA 3T4VA 4YRDA 2R061 3DPRC 1X50A 3LB9A 1UXXX 4NHYA 4BLJA 5TSWA 2DUPA 1COV1 4U36A 2RDQA 3G7DA 2WQ8A 5CYYA 2DTYA 1WCUA 3RMXA 3EBRA 2AGSA 3AZWA 5FZFA 1JODA 3MICA 4Y1YA 1NLSA 2WFF2 4QDRA 3OY8A 3KD4A 4JDNA 3CF6E 2D6NA 5DAXA 4CUGA 2RM21 4B4QA 3WDTA 1F9KA 2CGOA 3POWA 3P3PA 2W1QA 3CDZB 3PU8A 5DZEA 4C1WA 4DMIA 1JYWA 3PMEA 4LTAA 1K5MA 4OI4A 3WX5A 1VIWB 1TMF1 4GH4C 4XF4A 5I8SA 3CJXA 2NMOA 3LPFA 3SH4A 3VBUB 1VAVA 5C9AA 1NQDA 4I2OA 1ULPA 1EYBA 2B9VA 3DYMA 4JKLA 5A7WB 1PGL1 4AOCA 3C2UA 3AM2A 4L0PA 3WDWA 2VXJA 4LBLA 3JQXA 3AZXA 4N53B 3ZMOA 1MS8A 2E6VA 4CDXC 4K21A 5FQ0B 1JUHA 1RXFA 4Q8KA 4DZGA 5T5LA 4LBNA 2ZAHA 1Q8SA 2BW8A 2BP6A 3O0XA 4RD7A 3SLIA 4DXZA 4GB33 3V56A 4QB1A 5C4WA 1NA1B 1NLQA 3UK9A 3MF9A 2WSVA 4LA3A 1JU4A 4LKFA 3THPA 3BUCA 1AVBA 3WF4A 1FV2A 5FZHA 2VXRA 4L8QA 3S5AA 3IPVB 1BXHA 1SDWA 4N43A 2OA2A 2IZWA 1RTVA 4LHLA 1MVQA 2JDZA 2RS53 3PNAA 2XKPA 4QB6A 2P5BA 3TN93 2WSUA 2XHNA 2X10A 3DEMA 4O65A 4MXWA 4NRMA 3ZN6A 2Y6KA 1E5IA 2XQRA 3AVRA 1OOPB 1QJEA 2JG9C 2ORZA 2AR6A 4A7YA 1QY4A 3H7YA 4W4ZA 5DZGA 5KXEA 1PVXA 1UU6A 4K9SA 1NCRB 1IPKA 1UYYA 5LBEA 1ND2A 4ZZ8A 1EUTA 5C3PA 1DYKA 2ZX3A 2VVFA 2HEVF 4XFIA 4KU8A 1UOBA 3H3UA 3L2HA 2JDPA 3I97A 3PVNA 5KHKA 2B9UA 4ATFA 2Y6HA 1BLZA 1OLMA 1VR3A 5CZKA 3E5QA 4W50A 5GLWA 3KVAA 3RGBA 4LK6A 4Y26A 5C8WA 4C91A 3KV6A 4F83A 2XVGA 2ZX0A 1D4VB 1EP0A 2ZGPA 2OX0A 4XUOA 3NRUA 4GMP1 2Y33A 4HT1T 4LOSA 1DZQA 1VBA1 3UKNA 5CEHA 3ORJA 4CDUA 5AFBA 1CJDA 1F5FA 2IUWA 1LOGA 2BWCA 3PJYA 3RYKA 3TRSB 4CUAA 5FP4A 1UOJA 2VM9A 2IVJA 1MZ5A 4YWAA 2RS51 3L2YA 1D0GA 2HWE2 3N36A 1I1EA 3TN91 2W92A 5FBJA 4EN7B 4YM0A 4WVZA 3VD9A 2IWGB 2XBO1 4IW3A 5T3NA 3LPGA 4LO4B 4UXAA 5GZCA 1PO12 1Z78A 2VO5A 3GCWA 3JD73 3ZFEC 1MS5A 4BYYA 4CEWC 1LHOA 2UWBA 4MGQA 2JIJA 2P6HA 2GC3A 1XJAA 2H6CA 1HKDA 4D94A 3NJZA 1W6MA 4TLGA 5FZAA 3O1PA 1H0BA 3ZX7A 2PFWA 2ZJCA 1CAUA 4XEZA 4B4PA 2OKXA 4MGKE 4O9GA 3ES1A 2F17A 2PAKA 1LJ7A 4QMAA 2A6VA 3GZUC 4PLMA 3ZM8A 1QJFA 3OSDA 3NKGA 1NG0A 2XJTA 1XU1A 1B09A 4ZU4A 1VRH2 1UMHA 4Y5SA 2RS12 1JYTA 1TME2 2WNVB 3EYPA 4BQ2A 2D3PA 4XTPA 4CE8A 1PO21 3AP6A 5FYVA 4M4RA 1GOHA 1W05A 2E32A 1RUJ2 1GOGA 2H0VA 4BH9A 1H9WA 5ACA3 1SFPA 1JYCA 4BU2A 3IWZA 4GMP0 1SCSA 1Y9MA 3VBUA 1VBC1 2WC2A 4MSVA 2XLAA 3KSCA 2AUYA 5EZWA 3P3NA 1QU0A 2RHPA 5FY5A 1H6YA 1ZA4A 2GNDA 1ND3C 2V09A 2WNOA 1Z7S3 4XMAA 5FQ0A 3GNEA 1H2LA 2XL7A 5A3UA 2Y64A 4DRVA 2ZABA 4S2HA 2EF6A 2BWAA 4K20A 3WY6A 3VDAA 3Q8BA 1FPN2 5J09A 4Q1PA 1NA1A 3I2GA 2O14A 5CFCA 3J7MA 2JG8B 4XFFA 1YO8A 3PUIA 5ABJC 1C8M1 5A6YA 5KXCA 1W9SA 1VAKA 1OC1A 2RV9A 4LQRA 4LO7A 5F6LB 1LB2A 1UO9A 2OYZA 4W6YA 3WQ0A 1NX9A 3VDDA 2QKDA 4EN9B 5LA9A 2BNNA 4M3CF 3SEPA 1WLCA 4QX7A 4AVTA 4C0BA 4E2GA 4M3CB 3USUA 1GUIA 1QXRA 4NIDA 4BXSV 4NAMA 4XUQA 1XE8A 5ACA1 4A42A 3LWCA 3DECA 2OQ6A 1NCRA 1POV3 2R1BA 3HVDA 1APNA 2P2KA 3CMGA 1VE0A 4WM8A 2YBPA 1IS5A 2AREA 3CNAA 1J3RA 4P9JA 5GALA 2VCMA 5A3WA 1ALYA 3NJYA 1AF9A 1JYVA 2Q8DA 2VUCA 1ZNPA 1O8PA 3O1OA 1UAIA 3U11A 4DXTA 3BTXA 4PDWB 3VKFC 1SBEA 3K3OA 4WVMB 1RUNA 1GQGA 3C7GA 3LSEA 3WNKA 1AXZA 3MFAA 2QCSB 3THCA 4CSWA 1U12A 1YFWA 1C1FA 2K9ZA 1J3PA 5ERLA 5F5IA 2VMHA 1QJU2 4PQ9A 3LA3A 1OQ1A 1OHFA 1DGWX 1RUG3 1JN2P 2DVGA 3KV9A 5IK4A 4O9EA 3C3VA 3LGRA 4IEQA 4TLFA 4AI9A 4QD2A 2WZR3 3BVCA 4R9DA 2XPJA 3VL8A 4CTEA 5FPXA 1UX7A 3SHRA 4KQ7A 4CP9B 3RZJA 3V64A 3KS7A 1NXMA 2JDKA 4NMIA 2Z42A 4RYDA 1AL22 1HRV2 5L9BA 3RWKX 1SLLA 2W87A 4XDPA 3VBRC 2R073 4OQ8A 1RUH3 4D3WA 1VB2A 2PHDA 3WF0A 1AJOA 1R64A 5L7OC 3ZVXA 3DKWA 3B9IA 5CA6A 5DAVA 5FLJA 1GBGA 4FXGB 1WCDJ 2WNUC 4WZCA 1DQ1A 1XNAA 5KHGA 3W9AA 4P9IA 1H9PA 3UJQA 4EWDA 1RITA 1W2TA 3H8OA 5M0TA 1YI7A 4BOWA 5F3IA 3GHNA 3O0WA 1PVC3 4P02B 3J8F1 4RQPB 2WO7A 2EALA 5F6KA 3GZTB 1YQCA 3VBFB 2FBEA 2C1FA 1PNGA 4OMCA 1LGNA 2QQLA 2RS31 4YM1A 5JCTA 3E6CC 2WZR1 3HNMA 1LKNA 3KM5A 4XXPA 3FJSA 4Q4Y3 4CP1A 1JXNA 4OQ9A 3WT3A 2RVAA 2HWD3 4IEUA 3PIGA 3ZYPA 3OEAA 4GXLA 4BQ5A 1O4TA 1PK6C 1W9TA 3DV8A 2CWMA 1BVVA 4I3GA 2V4VA 1HW5A 1LOFC 4YPJA 1I5PA 2R071 1YYNA 5D1IA 1CGPA 4OLLA 5L9RA 3OUJA 3APBA 3KF3A 2BJSA 2RR12 4QHOA 1DZTA 4XTMA 2XJPA 3CHXA 3EJKA 2PHLA 3TWIA 2PN5A 2JG8A 1F35A 3QACA 4LBQB 5LWBA 3V0AA 4WM7B 3ZN5A 3A0KA 5IFTA 3O0VA 4Y20B 2EIEA 1AR91 1UY0A 4XBQA 3OPZA 4QHBA 1CJPA 4QWNA 1W9YA 4D6QA 2Q4SA 2Y34A 4BIOA 1VRBA 1GR3A 3ACIA 3Q8CA 4IV3C 5LZ6A 2D6MA 3AVSA 4M3CA 1N1VA 2Z69A 4S2GA 4WVVA 5FMDA 5FXVA 1PVC1 4AE2A 2PELA 4IE5A 4QPWA 4RS5C 4YZ4A 3J26N 5K0UA 3OGGA 1AYN2 3IKWA 5FP8A 1LECA 5CFDA 3U37A 2A5ZA 5JOXA 4Q4Y1 4JCKA 4QKBA 5EJZB 4P9XA 3K77A 1K45A 3WDXA 3FFZA 2ET7A 4BPZA 2VUAA 4C8DA 4COUA 4HSJA 4NR1A 4ASLA 1WWYA 2RDRA 1R093 2H0BA 4OHYA 4H14A 4PDWA 2UYBA 3RI8A 4QPIC 4WVMA 2VZ1A 3K4DA 4CDWC 4QPYA 5EHDA 1JS9A 3VZJA 4DNYA 5IYYA 1VBD1 2V73A 2J1AA 1FNZA 4P9GA 3RZMA 3A7QA 4P00B 1FMD1 1SLBA 2C6SA 2MEV2 1IS3A 4AI2A 1W0OA 4XF3A 4Y1ZA 2QQIA 5FMCA 5JI9A 5JZGC 2AEYA 1J84A 3M3IA 1SLTA 4Q27A 2UWCA 1JTZX 3JU9A 2ZZQA 2YZ4A 2TBVA 3BU7A 2PQQA 2JDNA 5FZOB 2KD7A 3FLPA 4CU7A 2RE9A 1W6QB 1RUC2 1E57A 1WGPA 5T54A 1VBB2 4R52A 2GSYA 3T08A 1N3QA 2O8OA 4IL7A 5CG8A 4NIAA 4CP9A 4LT5A 1G9DA 3H7JA 5JXGA 2UWAA 2WA3A 4ZZ5A 1T6GC 3CLPA 4XJ8A 5DUVA 3SXWA 5DPNA 2DCZA 4CDQB 1HRI3 1K5JA 1R091 3TEWA 4BB3A 1E5RA 1V6KA 4I01A 4JGYC 2XG3A 2IXLA 3BOPA 1SHWB 4BQ1A 2W46A 4IV1B 1O91A 5F3GA 3ZXAC 3CJIA 3W59A 1RVF2 3K48A 4IESA 4QKFA 2FDKA 4JRAA 4X6QB 3CIHA 1ZX5A 1REFA 1CIYA 4BDVB 1JZ6A 1W03A 2GC2A 2C26A 3ACGA 2ES3A 3D8CA 4QB2A 2FCTA 2MNGA 3MIGA 5APAA 2I45A 2YXSA 5HXVA 2XJRA 2J1VA 4D0QA 2E31A 4GALA 4RQPA 4YLZA 1QXJA 2DVDA 2ARXA 3VKNA 5KBFA 4FOWA 4SLIA 1HXS3 3MW3A 1CAWB 1X9PA 1ZZ9A 2ZTNA 3OF1A 3M8LA 3MLLA 3PVEA 4AFBA 4QXHA 1V9U3 4HOOA 5F7UA 1V6LA 1W3VA 1R1A2 1RUE3 1YIPA 3GBGA 5DUUA 4BLIA 1H1IA 3MW2A 1L7LA 2BU9A 1WMXA 3KLSA 1PMIA 2RMU3 4Y22B 2ARBA 4DUXA 4TTGA 1EAH3 5CVRA 2QTWB 1I3HA 2LM3A 5D8AB 3NVCA 5IK8A 4AEJA 5LATA 4A7KA 5FXWA 4CPBA 3INAA 3Q8EA 2BYVE 3HJRA 2VMCA 3VKMA 3ZXFA 2QZ2A 5GJ6A 4LMFA 4LBQA 2YC4A 4AVVA 2P3IA 2GP5A 4P5HA 2VVEA 1GANA 4MOAA 5LBFA 4F3JA 5LY1A 1MS1A 2QQMA 4XUTA 4NVPA 2Y6JA 2YMZA 5EWSA 4YZ5A 1JHJA 1BBT2 1GQHA 2P3YA 5FZ8A 5BNPC 1W8HA 5A80A 4K40A 1CZTA 2R0FA 1LOEA 1ZBA3 2J1TA 2JKXA 2YFZA 1PHMA 4EWAA 1AR72 5I0SA 1CIWA 5A3LA 3HWJA 5BV6A 3N9NA 4YG0A 3BPSA 4P9LA 5GZEA 4XILA 1CR7A 2ZBJA 3IDEA 3W58A 3WHUA 2E63A 4NPRA 1QQP2 1MS9A 2GH8A 3VD7A 3JBG3 4NO4A 5A7QA 5JIAA 2NLRA 2HLEA 1N3OA 1V9U1 2ZAAA 3E5UA 5KXDA 1OF3A 1RUE1 2YG0A 2GZWA 4HKWA 4AL9A 1UKGA 3AKRA 4YVWA 4CDUC 4FCAA 2OQ7A 4DB5A 3MV11 3NNJA 1EAH1 5JSPA 3RZKA 1RYYA 4ITCA 4K6BA 1W99A 1PM7A 3LKJA 4TXWA 3UKVA 1JZ5A 3IBMA 2GALA 1DU3D 3ZKYA 3VBSB 4AWDA 4COWA 1WLWA 2JDHA 1ASJ2 4JGZB 2WS92 1EPZA 5E16A 4FSJA 3IM0A 4UW4A 1QJY1 5H9RA 2ZEXA 3LSDA 4XE9A 2ZEYA 4M0HA 3AP7A 2JB4A 1W2OA 1A78A 3CO2A 5F5QA 3RFRA 2QQJA 4AFCA 1JU3A 1VBE3 2VULA 2PLV2 5EP9A 3KV5A 2BUKA 3NNLA 3WF1A 4XF1A 5BNNC 4Q4V3 2A1XA 1HB4A 3AKTA 5FZOA 3CEWA 3OY8B 1GICA 4XFGA 4QGLA 1O6UA 3H9AA 2YPDA 4BQYA 2BQPA 3LFIA 1W9FA 2DCYA 5A7NA 3WHTA 4IERA 2DCJA 1W6QA 4RR3B 3NV4A 4CU8A 3AP5A 2DURA 1IZ3A 1X82A 3LEMA 1LRHA 2NYYA 3JBG1 4YNIA 3ZSLA 2CSGA 5JMCA 1XSQA 1EV13 1GFF2 2JDUA 3JQWA 1W28A 3FBYA 5IVFA 3RRDA 4KWUA 3HNBM 2G9FA 3AYEA 1RUD2 4DXSA 4CDQA 1BEV2 1I6XA 3W5MA 2QDNA 4LOTA 2PHTA 2PHWA 5A6XA 3RMYA 1FYUA 2GH2A 5FZ3A 1AHSA 1GNHA 1V6JA 3ACFA 4MGIE 4Q4X1 5DDJ2 3GCXA 5FZMA 1C5HA 3HQUA 2ENRA 3VBUC 5T5PA 4DFSA 3H3LA 4GULA 4DPNA 2QQPA 5C3RA 2CU5A 4EN6B 1E5HA 4Q4W3 1OPOA 4HK8A 5L73A 2PHFA 3T1MA 5LA1A 1TVGA 2OS2A 4Q4V1 4LPLA 3N9LA 4Q26A 1A8DA 1ENRA 1FNYA 1GNZA 2BOJA 2RDSA 3UESA 1XOYA 4A6SA 2ZMLA 1CAWA 1AR83 5LBCA 5F3EA 3MFCA 1NA1C 2R042 1KJRA 2ZHMA 1QJX2 2FDHA 3ZN6B 3GM8A 4FOYA 2JDAA 4FP3A 5G05L 4AVAA 4AFMA 1F2NA 1RC6A 1LGCA 4CXWA 1EV11 2XUEA 5F32A 3ASIA 4IQPA 3S57A 4TSVA 5D8AA 3GZEA 4D6RA 3IZOA 3OUIA 2XJQA 4D8MA 4FAHA 1LULA 3I3QA 3POGA 3WP5A 1ONAA 1SMVA 3CZJA 4UFIA 5FOJB 1JH5A 5C8CA 2JICA 2WO3A 5FOBB 1RHI3 2R063 2E26A 3DKQA 5FZ6A 3ZFFA 3AKSA 1D7PM 4QX8A 4M00A 1OOPC 4CCMA 5AC93 1W8TA 1KXGA 1WCQA 2DVAA 2P3KA 4LLOA 2Q5TA 4OCTA 1SPPB 2W1UA 3ACHA 3WW2A 1IKPA 5C3QA 4NIGA 2SBAA 4IE0A 4Q4W1 2P1BA 2EXJA 1TE1B 5CBLA 5FK7A 4Y33A 4B1LA 1J83A 4W8JA 4I30A 2RM23 5F3CA 1H30A 3BU0A 1J3QA 1MR5A 3GALA 1T2XA 4GA9A 1H8TA 5JR7B 4EN0A 1BMV2 1PMJX 2OT7A 5DMYA 3I2KA 1AR81 2AENA 4Z8BA 1RUOA 3FHAA 4NIIA 1TMF3 4PF5A 1T6BX 5FYZA 2XVLA 3N7KA 1KGYA 4DEVA 4I02A 3HR9A 3LIGA 1AL0G 2VD7A 2QNKA 4ES9A 1NCQC 3H0OA 1S2KA 1UIKA 3NV1A 2FDJA 2ZEWA 3B3QE 1BYHA 3V0BA 2ZKNA 3ILFA 3JXSA 3TB0A 4W6WA 5FPBA 3JZVA 3WXPA 1UY2A 1YFUA 2NPIA 2R49A 3OG2A 4R4XA 4KGGA 4B7EA 4LEJA 4MO3M 4BZ4A 5JIUA 1LAJA 1RHI1 1RUI3 1X8MA 2F6BA 2A70A 4FFGA 4JGZA 2JJ6A 3JB8A 5A7OA 1CAUB 1S2BA 2B4KA 1DDLA 1CAXB 4ES8A 3HD8B 4XPVA 1URXA 1R082 2KM2A 5AC91 2OUHA 2TEPA 2XL9A 3V65A 3AMNA 1CPNA 1GSLA 3HT1A 1D2QA 4HKOA 5A3NA 2VOXA 3LA7A 1F4AA 3I2JA 3UGHA 2HBTA 1VMJA 4NN0A 1YFYA 2VMDA 4N53C 4NRPA 2A6WA 3FN9A 3WQBA 4BWOA 2R0HA 4RR3A 1OFNA 1UZZA 3POFA 1S0IA 1F4HA 3MGUA 2WKKA 3FLRA 2OPWA 4LBJA 3AYAA 3I2HA 2BFUS 3AP9A 3BYWA 4MLOA 4FOQA 4JC1A 3DCQA 3J9SA 5JI7A 3WD5A 2W5FA 1J1TA 4INDA 2Y6GA 3MW4A 3HAGA 3NAPB 3C7FA 3ZYRA 3AXDA 4GJZA 2Z79A 4XFAA 1RUF2 3PHMA 1ZA7A 2K2SA 2PQSA 2W3JA 3M1HA 1GV9A 2WNVC 1NE4A 3K2OA 5LK5A 4RHV2 3VBHB 5F5AA 1JMUB 3AB0A 4HVOA 1RUI1 1RIRA 1US2A 5D2AA 3M3QA 1W06A 1MS0A 1U5YA 4GJYA 5EJ1B 3O1RA 2WQZC 2HWF2 4ZXKA 4GMP3 2F4PA 5CFCB 1O3SA 4PI0A 1PMHX 1L7QA 1VBA3 2Y8KA 2GU9A 2VBDA 4YGBA 1V00A 4HL0A 4M4PA 5HBAA 2X05A 3WNXA 3VDDB 4L9BA 5FJKA 2JEMA 1HV1A 4FPCA 3OBRA 4IEYA 5FYBA 1M4WA 3R05A 1COV2 2K0GA 3USUB 1XNKA 4AEMA 3ZFGC 1TZOA 2XBO3 4GWNA 3OBTA 4EWEA 2D6KA 5FMBA 4HFSA 4XYXA 3IIAA 2DUQA 2HWE1 4UW3A 4DQAA 3AJYA 4UFMA 2W1WA 3NO8A 5BNOB 3U0ZA 1OF4A 2E9QA 3N9QA 2BEOA 4WM8B 2CY6A 2VTFA 2QDRA 2VNGA 4FPOB 2NQYA 3ALQA 5HV4A 5KWRA 1PO11 5DG1A 1FXZA 1QKQA 2X5IC 1DG6A 3OPTA 4LULA 4M01A 4AZZA 1GWLA 4H3WA 3S7EA 5JWPA 2X53S 2ZEZA 2DV9A 3THDA 1GZWB 2A6ZA 2VUDA 1JZ7A 1BZWA 3ME2A 1LOCA 2HH9A 3LOIA 4K1YA 5BXXA 1DQ2A 4XF9A 1VP6A 3WNPA 1DYPA 4B1MA 1SPPA 1S0GA 5I0DA 2W39A 2HWC2 3SNMA 1YWKA 2Y6FA 1GZCA 2GC1A 2Q0AA 2VQUA 1GP4A 1VLNA 1O5LA 2HEYF 1G9BA 1YFXA 1WA6X 3PL0A 5DABA 2XJSA 3N9MA 1PO23 2Q8OA 1VRH1 2RS11 3T0AA 4JHZA 1O3QA 1TME1 1X8EA 2CAVA 4AYUA 1YJLA 1VALA 1HQLA 3ZYIB 1VBC3 4URAA 3OGJA 4ZKTB 5FYHA 1OI6A 2V72A 1MQTB 2XJVA 5FPAA 1YRZA 2DDUA 1JYXA 2WR9A 4QXCA 1LNSA 2JE8A 3KCYA 4XETA 4CEYB 2WZ8A 1PX3A 2MPFA 3MPBA 4QQPA 2XMLA 2VZQA 1CAXA 1GNYA 1SQ4A 4BE3A 2IC1A 3K75B 1F31A 3DPRB 4AI8A 1Y3TA 2CYFA 1C8M3 2RJ2A 1MZFA 2D98A 4ISQA 2WYSA 4MX3A 3OOXA 1FPN1 2A3XA 3S30A 5JPMB 2E7AA 2Q8EA 3FBMA 2JB8A 2J1SA 2K46A 4OMDA 3VL9A 3D3AA 2XLGA 2WA4A 3I2DA 2ARAA 2BTVC 4UWDA 1SLAA 4FFIA 2VTXA 2NMNA 1W0PA 2FZ1A 4GB32 1QHDA 1S4CA 4X6RB 4N9HA 2BFUL 1LHUA 1XU2A 4CP0A 2CDOA 5FCCA 3LEKA 3U4XA 3IAQA 2VECA 3NAPA 4UYBA 1H1AA 1WMDA 3K51A 1DBNA 5KXBA 1OQDA 4LNVA 1GU3A 3KHCA 1C28A 4GH4B 1PX4A 1US3A 1IHMA 3D5OA 1Q8PA 3O14A 2UY8A 3ENRA 2RS52 4RQPC 3VBHA 2Z5WA 2XKOA 1L3JA 4QPGC 5GLZA 1H2KA 4Q0VA 5EJ3A 1AYM3 3TN92 5A6QA 3VBFC 5K7PA 1UX6A 1XSRA 4LLFA 2PAEA 3MPPG 3UYJA 3JB4C 3TEYA 2IXIA 5I0RA 4YG6A 5EPAA 3N35A 1JW6A 1H2MA 3U4SA 2BBAA 5KC5A 3V0AB 1H8VA 5F2WA 1YQ5A 4COZA 2YROA 4JQRA 4TWTA 1QOSA 4AG4A 4XABA 1WUVA 1FOD3 1UNBA 3FX3A 1N3PA 2XGXA 4MGSA 1OH4A 4LK7A 1JOJA 2HBUA 3H8UA 4E4ZA 4G9SB 4RFRB 5IT6A 2ARCA 2WWSA 4XBLA 1CESA 2FCVA 2HWB3 3AMHA 1HDKA 4JV4A 1ZREA 1QJU1 4WM7C 4FOVA 2YU2A 2VBBA 4PIZA 5K0UB 5T5JA 3WNNA 2E33A 3LA2A 3WF3A 3WZ1A 2DVBA 2AACA 5CFDB 3QBQA 5BNOA 5C6CA 2B45X 2ILMA 2WWJA 3AMQA 2JG9B 4NPMA 4QU1A 2RDNA 2FDGA 1DGRA 1VJ2A 1IPSA 3LF7A 2CGNA 4JQTA 4MUVA 5DXDA 1QIQA 5FZBA 2DTWA 3WUDA 4KG8A 1ENSA 4URTA 4XUPA 1H4HA 1KDKA 1AYM1 1GZWA 1AL21 1UZ0A 3QH7A 4YVSC 2YBSA 3PIJA 3JD72 3I59B 3RI9A 3HQRA 2VR4A 4KL1A 2YYOA 1W3XA 4ZU7A 4PT6A 2DFBA 3VGIA 1YEWA 3I2FA 2V5DA 3F95A 4KGQA 3WW3A 1OMIA 1RINA 3GGLA 1L7RA 1FOD1 4JAAA 3SEEA 4LIVA 4BK5A 3LDKA 1ZVFA 4YZ1A 1MS4A 1WLTA 3J8F3 4BJ0A 3GJAA 4KBBA 1BCXA 2HWB1 3TYJA 4O7XA 2GN7A 3EHKA 4XAEA 2JKBA 2C0ZA 2RS33 4XIOA 4W65A 5FZ1A 3U07A 4Z2AA 4P14A 1SCRA 2GNMA 2WO1A 3SKJE 4IDZA 3PLQA 1Q43A 2BV4A 3E5XA 4AR2A 1OA4A 5JSRA 1MQTA 3BTYA 3L9JT 5FPLA 3WINE 1XB9A 1XC6A 3KVBA 4Y5TA 3ZFEB 2VNVA 4IGQA 1C57A 2Y60A 4PF1A 4CEYA 4LHSA 5CU1A 3MLKA 3RJ2X 1ST8A 1KFXL 2VZ3A 3E1F1 3TNPB 3WDUA 5ACA2 2YB7A 2QQNA 4FPLA 5E88A 3DPRA 2CL2A 3CJIB 1DGRN 1AR93 2VBPA 1S0JA 1X9TA 4A41A 4AQ6A 1QH7A 2A6YA 4XJ9A 3RYRA 1OBNA 3ATGA 2H6BA 1Z7S2 3VKLA 4CDQC 2QE3A 5JUVA 3GF6A 3ETQA 1H4GA 1GP5A 2BERA 3GJBA 4AEDB 3WQ1A 1BK1A 3RZHA 2DF7A 3M7AA 2XLFA 2CDPA 3K46A 3RSJA 1LESA 4IV1C 4QKNA 1H2NA 1YHFA 3ABZA 3O12A 5A33B 5I91A 2D7FA 2X8KA 1S2EA 2PAMA 1AR63 1ULEA 2D6PA 4YGDA 2JE7A 1UXZA 1LOAA 1W2UA 1U5ZA 5IVBA 2O0OA 2EICA 4GH4A 2VTXJ 4YW2A 5FZ7A 5FYSA 2CV6A 2VMIA 1LCLA 4NHMA 1YXWA 1CX4A 5T55A 3NNMA 5A3OA 3K4ZA 4TYSA 4CCOA 4CU6A 1UMIA 5F37A 5HI0A 1ND3B 4SBVA 1JHNA 3RS6A 4L2NA 1DLLA 1VBD3 4Q8LA 5CAZA 3IDCB 4P08A 4E8CA 1Y4WA 1FMD3 1YNAA 2DU0A 4HZFA 5HCBA 1FAYA 1PM4A 1LU1A 1S0DA 2VCBA 4XHBA 3D6EA 3M3OA 4PI2A 5D8AC 3OPWA 4Y3OA 1PGW2 2MEV1 4DUVA 2GN3A 3A0NA 4FXKB 3VKOA 5ABJB 4XF0A 2JECA 3FL7A 4XC9A 3WVJA 4I0WB 1V0AA 4QXKA 3PUQA 4Y24A 5CISA 4MG2A 5ISLA 2WINB 3ECQA 3MIDA 3OCPA 1UKRA 3ETPA 5LA0A 1GMMA 1X36A 2PHXA 2VZTA 2A75A 3F2ZA 1WCKA 1AR61 1JI6A 2VE1A 3VDBA 1O59A 2P37A 2JG9A 1HLCA 4I09A 1AUYA 5AFEA 3AX4A 4KNCA 4YVWB 3ZDVA 1VBB1 1F15A 1CX1A 2WRAA 4Q0PA 2WLPA 2VGDA 1RUG2 2VOKA 3POYA 3J7HA 2I07B 2J7MA 2OZJA 5J48A 3O1SA 4QM9A 1HN0A 4WBBA 2WZR2 3B02A 3PTRB 5FYIA 3AMMA 4E9KA 3I59A 2UY9A 4BQ4A 1ZBE3 1ZZ6A 4ASKA 4YGEA 4R9AA 3WLUA 2ZGSA 4EQVA 4LO6B 3B94A 5FZIA 4AVCA 3AP4A 1ZZ8A 3BALA 2VG9A 1MEC3 1W2NA 1RVF1 1FV3A 1O7FA 3BOWA 1JBCA 1UD1A 1ULFA 4A44A 2R072 1RUH2 3SH3A 1ULCA 3KT1A 4NJ4A 1DQ6A 2QBXA 4XCBA 4AGRA 1GOFA 2A3WA 1UY3A 2VC9A 4V2WA 2VZUA 3VBSC 3HPNA 4L97A 2Y6LA 3BIEA 1LGBA 1SG3A 2IXCA 4QX1A 5IVVA 4H7LA 3O1TA 2XQXA 4DXRA 5GZFA 4UAPA 3CZUA 1O8SA 3AYCA 1G6NA 4PBPA 4QDSA 3WUCA 1RMU3 2Q8CA 2XVKA 3WEZA 1YUDA 2P6CA 4XZUG 4KWLA 5FLHA 4F8AA 5A3MA 2D5HA 3KGZA 1W0NA 4IEXA 3ZFEA 2X09A 2G19A 3ZMNA 1PVC2 3OGRA 5HCAA 5IVEA 4RR3C 3EO6A 1DP0A 4LE3A 3ZOIA 2PYTA 2ZPXA 4JHTA 1HV0A 1VMFA 2B5HA 2R30A 3T2PA 3VBRB 3WCRA 1OH3A 1R1ZA 1K5MC 4Q4Y2 3WW1A 3MYXA 1ZBE1 4CRQA 4YM3A 5T5OA 4D7YA 3LDBA 2HWD2 2ZGKA 3B01A 3MF6A 3SH5A 5C9AC 2WIIB 2EIGA 4A3XA 4P9YA 1MEC1 2WNUB 4Q5OA 2GMEA 4Y1UA 5A7PA 3VHNA 4BK4A 4HKLA 2LTNA 1UW8A 4AEDA 1UN1A 4RGAA 3WNLA 5HCFA 1UZVA 5A33A 4QQOA 2DBIA 3UGFA 3MI8A 4CPBD 3BGAA 2FD8A 4MHUA 5C4WC 1PIV3 2BVVA 4UBHA 1D4M3 1OLQA 4EROA 3E6DA 4LBQD 3SKVA 2ADDA 1LHVA 1RMU1 4Z07A 5LA2A 2RJLA 2LW8A 4N43C 1CN1A 1C3HA 1PZ9A 2VQAA 1IG0A 3HQXA 4BXFA 4CA9A 1JZ4A 1YQ2A 2WZEA 1ND3A 1PK6B 5C8CB 3POEA 5F1RA 3ZFFB 4FFFA 3BN6A 4HG6B 2PHUA 1QJY3 5FWJA 2EXHA 2MHFA 3D0JA 3HBKA 4ASMB 1JZ3A 3H3ZA 4N9IA 2AH2A 1QMJA 4DY5A 3WNMA 1ND2C 2RG4A 1LHNA 2WS91 5DDJ3 5SV5A 3D0SA 5FZKA 5ABJA 1R092 3P6BA 5EQUA 1LEMA 1QJZA 3B7MA 2ZA9A 4XOGA 2Y26A 4CCCA 1YC61 5DAWA 5BY5A 5IFPA 4AGGA 5EYYA 5IK5A 2EA7A 3DYOA 4V2VA 1JOBA 2P4EA 1XE7A 2QQKA 5FYMA 3OEBA 3PVBB 1ZM1A 5L36A 2ZOEB 3DUIA 1H8TB 2VW0A 4LUMA 3AXEA 4LBMA 2A7AA 1NY72 4CXYA 1DYOA 1PIV1 2VJXA 1D4M1 3U78A 4BM8A 2G9GA 1SLIA 3POBA 4RS5B 2Y0OA 3KCXA 4ZY9A 3ZR5A 4BQXA 4XURA 4LA2A 2E7TA 1D0HA 4IEWA 4EJRA 3K3NA 5FIXA 4XDQA 3V0BB 1UZWA 3DN7A 2XDVA 3NNFA 3S6PA 2AYHA 4HVQA 3MIBA 2Z2SB 3MBWA 1RUD1 2P34A 2VCAA 1BEV1 5FYUA 4Q4X3 1H6XA 4E2QA 4UW5A 3OBAA 4A45A 4QPIB 1ZZBA 3LFMA 2VUJA 4GIQA 1JUIA 3C7HA 3FUOA 2D44A 3HMYA 5FUPA 4CDWB 2WBKA 3ZXDA 4XMIA 3ZLIA 2GDFA 5DDJ1 5FY7A 4KH9A 1O4YA 1RJ7A 1HRI2 1DCSA 1S0CA 4HONA 5DQ0A 4COVA 5JZGB 3MLJA 2D6OX 1RGSA 3R4DB 1MS3A 4I0BA 3ON7A 1H1MA 4J1WA 4N7IA 4Q2FA 4MVTA 1NZIA 4FT8A 2VOTA 1YQ6A 4RSUA 2NP0A 1J58A 1WD3A 4G3YC 2QJVA 1IKQA 3FFQA 4AFAA 2R041 1UOFA 2WAAA 3WDYA 5J96B 1OUXA 4MGTA 2OPKA 2BOIA 4MHRA 4AHWA 3RG0A 2XHKA 3GZAA 2BNMA 2EAAA 3VD3A 4NHXA 4R9BA 4NIHA 4Q29A 3T0DA 3ITQA 4Q0SA 1DQ5A 2D5FA 5FY4A 3H50A 1HXS2 5IVYA 2JD4A 4S2FA 5DAPA 3VBRA 4R9CA 2HEWF 1FATA 2GP3A 5LB6A 4Q0UA 1C8NA 2FZ2A 1RJ8A 1V9U2 2LUWA 4OUEA 5L7OA 4X8NA 4J6GA 1RUE2 4KWJA 4LO8A 3NAPC 2WT2A 2OXBA 3WP4A 3ZSKA 3LD8A 2RMU2 5FYYA 5EYXA 5GZDA 5FZGA 3ZXGA 2WNUA 1EAH2 3AL5A 3WG2A 3DL3A 3NMBA 4PCRA 4I3PA 3VBHC 4B8EA 4CVUA 4KBZA 1ACCA 5FZ9A 1UY1A 2WFF3 2WO2A 1OSGA 3HOBA 3POSA 4JDMA 3UETA 4UI9L 1X33A 1EPWA 3VUOA 2FDFA 5CFCC 1YLLA 1IG3A 2C24A 2VAUA 4PBOA 1KQRA 5A1AA 3OBZA 4KMQA 5JPNB 2A71A 2ZHKA 5ANQA 3I3MA 1GQPA 4XBNA 3R6SA 1ZBA2 5A70A 1WCSA 5FXXA 3VDDC 5LCWL 4AHXA 3WV6A 3LZZA 2I74A 2XR4A 2YHJA 2XWBB 2VNOA 3OGSA 1PK6A 2DCTA 3NQHA 4Z2WA 4XAAA 4EZHA 1FX5A 1A6CA 4YYOA 2GNTA 5H9QA 1TQ5A 4LKEA 1LOFA 3MUY1 1JZ2A 3JBG2 4ARYA 4LXLA 1WMFA 5I8TA 5LEJA 1NCRC 4BQWA 4C0HA 3PU3A 1ZYBA 2LS6A 4NHLA 4XZPA 4WM8C 4ISRA 3ZXKA 4XUNA 3O1VA 4DINB 2JIGA 4B29A 4B7KA 5A6ZA 3RVHA 1KFUL 4META 1SZBA 1W6PA 5DUXA 1R081 1B35B 4QHZA 2YGMA 1LHWA 4L92A 4A7ZA 1UPSA 1WKYA 2R16A 4NPLA 1OLME 3LCPA 1OD5A 3R0RA 4IE4A 1O3TA 1UU5A 2XOMA 2WFF1 2X29A 4UF0B 1QOOA 1GP6A 2ZGLA 4OULA 3ES4A 2XB6C 3LE0A 3SC7X 3ZXLA 1Z0HA 4JZRA 4UW6A 2HYKA 3I7DA 4RS5A 4LKDA 3WOGA 2WT1A 1VBE2 3BB6A 5J7MA 1XNTA 2J1UA 5JOZA 4HN0A 1BVP1 4FTBA 3A23A 2QQOA 4Q4V2 2UU8A 2VNRA 3PUSA 1OA3A 5IWFA 1IQAA 4K7JA 3POIA 1HB2A 1OURA 5FY9A 1AX0A 2AEZA 4ET7A 4HN1A 1OVPA 4LE4A 1RUF1 5C7GA 4WVWA 2ZHLA 5E6HA 1UYPA 4UFLA 2V5YA 3PTYA 4QPIA 1QEXA 4QX2A 2J22A 3M4FA 3OYWB 4YZ2A 3CQOA 4RHV1 1V6OA 5LRSA 1EV12 1KD7A 4CDWA 1HN1A 4KWKA 2CNAA 3O7OA 1LODA 2IXJA 2PTMA 3RDIA 4C90A 3PUHA 4QX3A 3D4KA 2B7YA 5FYTA 2HWF1 3PMSA 4YFWA 3MIHA 5IW0A 5JZGA 1U5IA 5JVVA 2XWJB 3IMNA 5H9PA 3TNQA 2YDEA 1DGLA 4KU7A 1W6NB 2WN3A 2HKXA 1DF0A 1G8WA 3OB8A 3ACLA 2W52A 4HANA 3VBOB 4A4AA 4QM8A 2HWE3 1XRUA 5JXJA 1BJQA 4LIUA 4NRQA 1AX1A 3VZOA 4Q4W2 4OUMA 1SBDA 2Y38A 4ZXEA 1PO13 1Y7BA 5DUWA 1U5XA 4C1XA 3T30A 2ATFA 4DO0A 2WZPP 5I8YA 3O1UA 1HJGA 4N8MA 3AKQA 1AR82 3UNPA 3POJA 3HN3A 3N7LA 4K8FA 3IDBB 4RA0A 4AGVA 1TNFA 3MUZ1 2LRPA 2GMMA 4HMZA 2NZ9A 3OUHA 4JGYA 3OTFA 4IXLA 3KT7A 5EV7A 3B93A 4FI9A 5FDBA 1IOAA 4RN5A 4UFHA 4F7ZA 1TNRA 3T1LA 4BQ3A 2CHHA 3EMRA 1OLRA 2HYXA 4H55A 3MHZA 2VZOA 1RHI2 2HWC1 2R062 3KQRA 4FPYA 2J42A 2XONA 4XFBA 4RGGA 1VRH3 2EXIA 4OYUA 4JTNA 2RS13 2ZGMA 4PIYA 3FE5A 2JG8C 1TME3 2R6QA 2VMEA 1UYZA 5AC92 1NYWA 3I8TA 1W6OB 2C5DA 2BDRA 2BVBA 2O1QA 4L11A 3NV2A 3TEXA 1Q5OA 3WW4A 5L9VA 1RUJ3 2ZHNA 3UL2A 4QU2A 3CU7A 4TZDA 2VZSA 3FHQA 4CCKA 5BYNA 1QGLA 1NT0A 2RM22 2Q30A 4FPHA 1UYXA 3IAPA 5JOWA 3BTZA 2G4IA 5FREA 1FI2A 4Y4RA 1SLCA 5FKBA 1TMF2 2D3SA 3Q9OA 4FFHA 4H2AA 4OZOA 2YFUA 4DEQA 1QH6A 3EB7A 5K0UC 4S2DA 4K1ZA 3WCSA 1V70A 3WP3A 5CFDC 1PGL2 4CP2A 1FPN3 1ULGA 3ZYFA 4IGPA 3BTAA 2VMGA 1B35A 5BNPA 4ZONA 1QNYA 5FP9A 4JKKA 3EXUA 1W8OA 4PDWC 1RUI2 4YW7A 4UF0A 4PHZA 4ORFA 2TNFA 5C71A 2Z4FA 2IXKA 3J7LA 3OD4A 1STMA 5K4LA 3TBDA 2QVSB 3C7OA 5JR2A 2EXKA 3X29B 1EY2A 5AVAA 5FY1A 5K8SA 3N3HA 4GB31 1A34A 2D3RA 5F5CA 4WZFA 2W94A 3BCWA 1RUJ1 4Q1RA 3B5LB 1ODMA 4ZPIA 3USSA 4HLTA 1AXYA 1FT9A 3KHBA 3NJXA 1NCQB 2R1DA 3LAGA 5GM0A 4FVVA 4MYEA 2V4AA 3GYDA 4COYA 3LQCA 1UF2C 1VMHA 3MDPA 3DF0A 4GKXA 3OYWA 4Q0QA 4AI0A 3UT0A 2WL1A 1OVSA 5IVJA 1MZ6A 1CQ9A 2XJUA 5C3OA 1KS5A 1P8JA 4PLOA 5FO8B 5LASA 1SACA 3AC0A 2CTVA 2VCCA 4LITA 4YW1A 1WZXA 1ENXA 4FTEA 1YIFA 3U75A 4XIKA 3BIWE 3JCIA 4CCNA 3H1YA 3RZZA 1ZRCA 3AJZA 3VLBB 2A6XA 5CKQA 3N9PA 1W6NA 1HB3A 5BNNA 2ZX1A 4D69A 1QJU3 1W90A 1A3KA
chains in the Genus database with same CATH topology
4MHUA 5C5TA 3DKQA 4XABA 2HBUA 4KBZA 3OUHA 5HV4A 3KT7A 2FCVA 2RDRA 4IW3A 3W21A 5IATA 3EMRA 5ERLA 3OBZA 4NHYA 4XCAA 2RDQA 4XC9A 2RDNA 2JIJA 3NNJA 2RG4A 3BVCA 5LBBA 4XAAA 5EQUA 5L9VA 5DAXA 5DAWA 3PL0A 3HQRA 4NMIA 4BQWA 2G1MA 5L9BA 4NHLA 3KT4A 5EP9A 2JIGA 3NNLA 4Y5SA 5IAXA 4NAOA 2A1XA 4J25A 5DAVA 4BQYA 4BQXA 2FCUA 3GJAA 4XACA 3NNFA 4JZRA 5M0TA 2HBTA 4ZONA 3KT1A 4XCBA 5HV0A 4Y5TA 3MGUA 2OPWA 5IAVA 5A3UA 2FCTA 4UWDA 4ZPIA 3HQUA 2G19A 4NHKA 5L9RA 3OUJA 5C5UA 2V4AA 5LA9A 5DAQA 5LBEA 3GJBA 2RDSA 4MHRA 4NHXA 5LBCA 5LASA 3ITQA 5LATA 3W20A 2Y34A 4Q5OA 5DAPA 5LB6A 5EPAA 5LBFA 3GZEA 3OUIA 2Y33A 4NHMA 3NNMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MHU A;  5C5T A;  3DKQ A;  4XAB A;  2HBU A;  4KBZ A;  3OUH A;  5HV4 A;  3KT7 A;  2FCV A;  2RDR A;  4IW3 A;  3W21 A;  5IAT A;  3EMR A;  5ERL A;  3OBZ A;  4NHY A;  4XCA A;  2RDQ A;  4XC9 A;  2RDN A;  2JIJ A;  3NNJ A;  2RG4 A;  3BVC A;  5LBB A;  4XAA A;  5EQU A;  5L9V A;  5DAX A;  5DAW A;  3PL0 A;  3HQR A;  4NMI A;  4BQW A;  2G1M A;  5L9B A;  4NHL A;  3KT4 A;  5EP9 A;  2JIG A;  3NNL A;  4Y5S A;  5IAX A;  4NAO A;  2A1X A;  4J25 A;  5DAV A;  4BQY A;  4BQX A;  2FCU A;  3GJA A;  4XAC A;  3NNF A;  4JZR A;  5M0T A;  2HBT A;  4ZON A;  3KT1 A;  4XCB A;  5HV0 A;  4Y5T A;  3MGU A;  2OPW A;  5IAV A;  5A3U A;  2FCT A;  4UWD A;  4ZPI A;  3HQU A;  2G19 A;  4NHK A;  5L9R A;  3OUJ A;  5C5U A;  2V4A A;  5LA9 A;  5DAQ A;  5LBE A;  3GJB A;  2RDS A;  4MHR A;  4NHX A;  5LBC A;  5LAS A;  3ITQ A;  5LAT A;  3W20 A;  2Y34 A;  4Q5O A;  5DAP A;  5LB6 A;  5EPA A;  5LBF A;  3GZE A;  3OUI A;  2Y33 A;  4NHM A;  3NNM A; 
#chains in the Genus database with same CATH topology
 4V1P A;  3CJI C;  4FPE A;  4QAW A;  3VBO A;  5GLT A;  3VZN A;  1BQP A;  2AC1 A;  1W04 A;  1CZV A;  2W08 A;  1HIX A;  1VBA 2;  2DCK A;  5D21 A;  1NZC A;  2OUJ A;  5DG2 A;  1J1L A;  3VB9 A;  2QQU A;  3M3E A;  2DBN A;  3VHR A;  3ZYH A;  2SLI A;  1BK0 A;  4AED C;  2WJS A;  5FJH A;  2NN8 A;  2OW4 A;  2WT0 A;  3HIF A;  3HNY M;  2KA3 A;  2YC0 A;  1WW4 A;  2VY0 A;  3M2M A;  4XQ4 A;  1AJK A;  4AK3 A;  4E4D X;  1AL2 3;  1GZT A;  1HRV 3;  2IVI B;  1WA4 A;  2XBO 2;  5JLV A;  1VAM A;  4ONU A;  2W9X A;  1G9F A;  4QQ2 A;  5I0T A;  3U10 A;  4CDX B;  3WR0 A;  1U0A A;  3VN4 A;  1G9A A;  4OHW A;  4IET A;  3FHI B;  3LDR A;  1YI9 A;  5BPX A;  4YM2 A;  1KRI A;  4DRR A;  5LBB A;  1NKG A;  4XJZ A;  1XYP A;  3WSO A;  3JD7 1;  2Y0I A;  3IMM A;  2JDM A;  3KV4 A;  2JX9 A;  2IFR A;  3LEG A;  5A7W A;  5IJR A;  1XPW A;  3EQE A;  3I2I A;  3IB3 A;  5FLI A;  4P5Y A;  5A32 B;  1RB8 G;  2VMF A;  1MPX A;  2OII A;  1M06 G;  2J1R A;  4IE7 A;  2EIB A;  4NWW A;  4QQH A;  4XHX A;  3FZ3 A;  3III A;  5CG9 A;  5FFO C;  4HK9 A;  4IGO A;  3ZSM A;  1W6O A;  2Q1M A;  1Q8Q A;  5IAX A;  2XUM A;  4LO5 B;  3T2Q A;  2EVX A;  3I54 A;  3T4H B;  4YW4 A;  3ZFG B;  1CPM A;  3CBN A;  4LHK A;  3SIT A;  3QOP A;  3ROU A;  4Y4Y A;  3VDC A;  2VOW A;  4LJH A;  4CCL A;  2ADE A;  3IPV A;  4OZX A;  4M3C E;  4PIX A;  4ZS2 A;  1BKZ A;  2ZKL A;  1PO2 2;  3HEI A;  2C4X A;  1NAE A;  5EFU A;  5L19 A;  2JWP A;  1C4R A;  4FAG A;  1OQE A;  1WW6 A;  1HRV 1;  2X5I B;  2WAB A;  2EID A;  3IN9 A;  2CWS A;  2J1E A;  3I4I A;  4A2U A;  2ID4 A;  1VBC 2;  1GYK A;  2DFC A;  2ZMK A;  3KQ4 B;  5JOY A;  4LBO A;  1OOP A;  2RR1 3;  4LUK A;  1DQ0 A;  5IAV A;  1WBF A;  4AW7 A;  2VL4 A;  4FO9 A;  4AAX A;  4YVW C;  3AMP A;  1POQ A;  5F39 A;  3NL1 A;  4AF9 A;  4JDO A;  4XW3 A;  1F8V A;  1TEI A;  3VZM A;  1A8M A;  4GAZ A;  4XXA A;  1S0B A;  3BI3 A;  5FP3 A;  1Z7S 1;  4D7T A;  2D93 A;  2E53 A;  5FPV A;  1UOG A;  2P3J A;  1LU2 A;  4AHY A;  5BUV A;  3ZYJ B;  2BPA 2;  2EAK A;  4YW6 A;  1C8M 2;  1XE0 A;  5KC6 A;  1XND A;  3WQ7 A;  3IT8 A;  2WAO A;  2L9L A;  3TOJ A;  1WME A;  5F2S A;  1AYN 3;  3ELN A;  3HN1 A;  3UKT A;  2ZGQ A;  1UIJ A;  5CB7 A;  1HB1 A;  1NCQ A;  3AKP A;  2Q1Z B;  4ZU5 A;  4XJU A;  5JMO A;  2VZR A;  1KEX A;  3J7N A;  2ERF A;  4CEW B;  1G9C A;  1W8W A;  2W1S A;  1S0F A;  1NUK A;  1W8F A;  3VZL A;  1O4Z A;  5C33 A;  1HX6 A;  1EUU A;  1WW7 A;  5HXM A;  3RYP A;  4CZS A;  2VW1 A;  4LHN A;  5E89 A;  4AQ2 A;  1JYN A;  4QGM A;  4R4Z A;  1OFS A;  2FHR A;  2RR1 1;  1W8U A;  2ZGR A;  2VQ0 A;  5LK7 B;  1C1L A;  4A3Z A;  3U14 A;  1N1Y A;  1POV 1;  3KWV A;  4M0N A;  2MEV 3;  5KHH A;  4OFG A;  4BMB A;  2D43 A;  2VPV A;  1W8Z A;  5CAD A;  1CWP A;  3KF5 A;  1AYM 2;  4BA6 A;  3I3E A;  1G7Y A;  4EYU A;  1BHG A;  5IUQ A;  3WG3 A;  4GQ7 A;  1S55 A;  5CKN A;  4FPJ A;  2LAL A;  4MZU A;  1PGW 1;  4N53 A;  4PLN A;  4EV0 A;  1WD4 A;  1IPJ A;  2A73 B;  4GWJ A;  3W21 A;  1I5Z A;  3DXT A;  4Z92 B;  1UY4 A;  2PMW B;  2HJI A;  2JE9 A;  1RL3 A;  2YV8 A;  5H9S A;  1PNF A;  2VVD A;  2P17 A;  4GD4 A;  1AXK A;  1DHK B;  3N9O A;  4QDQ A;  4CU9 A;  3T0B A;  2ZX2 A;  1RUC 3;  1FOD 2;  3SCF A;  3ILR A;  4CCJ A;  1I9R A;  1ULO A;  1AYN 1;  1VBB 3;  4LOR A;  4NRO A;  3PDQ A;  3T2O A;  4UBG A;  1HQW A;  2QUO A;  2HWB 2;  4RFT 0;  2WYF A;  4ZS3 A;  2WNV A;  4CDX A;  5IHR A;  2B39 A;  1RUG 1;  3B69 A;  2VQT A;  5FZE A;  1K42 A;  4QPG B;  1Q8O A;  2ORX A;  3J4U H;  4Y5Z 0;  5A7S A;  4D6S A;  1W39 A;  2G1M A;  3SCH A;  3KT4 A;  2FDI A;  4YFZ A;  2W91 A;  3ZDS A;  4IEZ A;  4YSF A;  1RVF 3;  2OVU A;  1ZRF A;  2ZGN A;  3CL1 A;  3MEP A;  3U1X A;  3P5B A;  5A32 A;  5C8C C;  2PHR A;  1DIW A;  3ZR6 A;  4AAP A;  3ZFF C;  4HPK B;  3GXU A;  1ZZ7 A;  3I49 A;  3O5S A;  1RUH 1;  3AZV A;  4G4F A;  1W8N A;  4E8D A;  3KGL A;  1LR5 A;  3ILN A;  3ZFG A;  4OUS A;  4AXO A;  5JSO A;  1S0E A;  1Q56 A;  1POV 0;  3ZPY A;  5HV0 A;  3NKT A;  4H7M A;  2O8Q A;  1XYO A;  1RUC 1;  1UWW A;  1XNB A;  2E51 A;  5KHI A;  4DOU A;  1R1A 3;  4XQW A;  3DYP A;  3Q8A A;  3J8F 2;  2ZGU A;  5CKM A;  3PJQ A;  3FWE A;  5ANN A;  4PJY A;  5DZF A;  5KR7 A;  1ZRD A;  5A1L A;  1H8T C;  4DS0 A;  2X5I A;  2RS3 2;  5FUI A;  4NWV A;  3UGG A;  5IK7 A;  2BGO A;  1NLR A;  3SCG A;  2BNO A;  3FMG A;  4BIF A;  4YG3 A;  4D7S A;  5FR3 A;  5I93 A;  3H1M A;  2KXL A;  1XNC A;  2GC0 A;  5B4X A;  5LEK A;  4MGY E;  4P9W A;  4OI2 A;  4YVS B;  3ZSE A;  2W0X A;  1CZS A;  5J98 B;  5J1X A;  5C5U A;  3ST7 A;  3LOB A;  4FBF A;  3AZZ A;  3MIF A;  2HWD 1;  4JRL A;  3BPZ A;  1BBT 3;  3N4M A;  1Q3E A;  3A21 A;  3DXU A;  3N7J A;  3OGV A;  5B4N A;  4AI1 A;  4JGZ C;  5T52 A;  2JDY A;  4YW5 A;  4XQD A;  3OD0 A;  4XJA A;  4EN8 B;  1AR7 3;  2QFE A;  1KDM A;  2R7E B;  5FZD A;  3KZ4 C;  3URF A;  1AR9 2;  3MO4 A;  1WLD A;  3M3C A;  4AI3 A;  2BZD A;  5FV3 A;  3NNG A;  5FK8 A;  2VZP A;  3RJR A;  3RQ0 A;  3S5Q A;  1QQP 3;  1MAC A;  1QWR A;  1V6M A;  1XBF A;  5A3T A;  3N7M A;  2CAU A;  4BCU A;  4BME A;  2CGP A;  1QDO A;  1KS4 A;  1R1A 1;  1ULD A;  4GKY A;  3VZK A;  4CEW A;  4HBN A;  4ARX A;  4RL7 A;  1QXP A;  1LEN A;  3HBZ A;  4AVB A;  4BIS A;  4MH0 E;  2QZ3 A;  4IE6 A;  1KJL A;  4Y1V A;  5KHJ A;  3ZIW A;  1N47 A;  1SDD B;  1AR6 2;  4OHV A;  3IDA A;  3SIS A;  5FO9 B;  5L7O B;  5HCH A;  4GWI A;  1PGS A;  4E4H A;  2YC2 A;  1ASJ 3;  2WS9 3;  3ZYB A;  5IAT A;  1QOT A;  3BKZ A;  3VHP A;  3ZO0 B;  5GZG A;  1ZRI A;  2DWR A;  3H1W A;  2ZAC A;  5I0U A;  5JAX A;  3JUU A;  1OKQ A;  5FPZ A;  4XJW A;  5B2G B;  2ZZJ A;  2PLV 3;  1BBT 1;  4JKM A;  5GLV A;  2VH9 A;  2DU1 A;  1VBD 2;  1S1A A;  3FUQ A;  3T3Y A;  1QNW A;  5J37 A;  2WUH A;  1FMD 2;  5F9T A;  1AR7 1;  4GWM A;  2JD9 A;  3B9C A;  1HQN A;  4FPF A;  3ZKU A;  1ZRR A;  4U2A A;  1OPM A;  2B46 X;  1CAV B;  4QT6 A;  1QQP 1;  5E8A A;  1NY7 1;  1VPH A;  2F4L A;  3R4S A;  3T09 A;  1D2S A;  1NOV A;  2ZMN A;  1NQJ A;  2W2I A;  1G86 A;  2VU9 A;  1OUS A;  2OZ6 A;  3OJB A;  3QCW A;  3NV3 A;  3Q8F A;  5E1R A;  1K12 A;  3WNO A;  4NAO A;  5GLU A;  3UV9 A;  1RUD 3;  4GZ9 A;  3CKH A;  1BEV 3;  3VHO A;  4QPG A;  1Q8V A;  1OKO A;  3THT A;  2UUR A;  3VBF A;  4QXB A;  2A3Y A;  2R32 A;  2FCU A;  2N7G A;  2YY1 A;  4FQ4 A;  1Y43 B;  4AEK A;  1IS6 A;  5J36 A;  3MIE A;  1ASJ 1;  4XAC A;  4Y1X A;  1E5S A;  5DN2 A;  4K8R B;  5CNA A;  4NE9 A;  1HJF A;  3SMH A;  2GMP A;  1Y9Q A;  1W6P B;  1NE6 A;  2ZXQ A;  1GWM A;  4X8P A;  2YPJ A;  3VD4 A;  4LKS A;  1QDC A;  1GLH A;  4HPK A;  2PLV 1;  4O61 A;  1LED A;  4IV3 B;  3WF2 A;  4FP2 A;  3MZH A;  1HRI 1;  5G04 L;  1UQX A;  3S7I A;  2D40 A;  1ZBE 2;  2LRO A;  2B8M A;  1DQ4 A;  4KG0 A;  3ZIX A;  2WN2 A;  4XDO A;  5C70 A;  1RXG A;  3RPQ A;  4WM7 A;  4J1X A;  3T2T A;  5JXH A;  4Y20 A;  1MEC 2;  2R04 3;  4IEP A;  4UFK A;  2FMY A;  1QJX 3;  4NUB A;  5AVP A;  2TUN A;  3ZPO A;  5F8P A;  5SV8 A;  1B35 C;  3W5N A;  5FP7 A;  3RWN A;  1JYI A;  1WBL A;  2YUE A;  3AFK A;  5EIY B;  4EZ4 A;  4IEV A;  3I3D A;  1PZ8 A;  3TEZ A;  4YZ3 A;  4KI5 M;  5DAQ A;  1UL9 A;  1AZD A;  1JOP A;  4N90 A;  3RZG A;  2BGP A;  3LEI A;  3VD5 A;  3ZSJ A;  4LR4 A;  3SQO A;  2QQW A;  2WLQ A;  5HPO A;  1RMU 2;  1HXS 1;  2G9Z A;  4YVS A;  4ATE A;  4JVA A;  5J3U A;  2WNE A;  4YW3 A;  3W20 A;  3GHM A;  3P1I A;  1IQD C;  1YQ8 A;  2IFW A;  2RJK A;  4NOT A;  4HSL A;  4I0A A;  2GAU A;  2AZ5 A;  5C3S A;  1DLC A;  2BRT A;  3FLT A;  3ZXE A;  5JXI A;  2RMU 1;  2W95 A;  3DGT A;  3AK0 A;  4MV2 A;  4OVE A;  5FZL A;  5IVC A;  5FY0 A;  2ZGO A;  2XH6 A;  5FMO S;  3UJO A;  1SBF A;  3NST A;  5FWE A;  2FQP A;  1YJK A;  4JX0 A;  2VW2 A;  4QKD A;  4OHZ A;  3NW4 A;  1UCX A;  5FZC A;  4B3N A;  4HXC A;  1QJX 1;  2D6L X;  1GZ9 A;  1ENQ A;  2ZGT A;  4OI0 A;  4HET A;  5FBZ A;  4ZHN A;  5BNQ A;  4OI1 A;  3A22 A;  4DUW A;  4OHX A;  5FXZ A;  3ZN4 A;  2QQV A;  3H42 B;  1SEF A;  4MXV A;  2WQ4 A;  3I2O A;  1OT5 A;  2W68 A;  1ZBA 1;  4CYD A;  1OXC A;  2WDB A;  1GWK A;  4L99 A;  4XCA A;  3H8X A;  5CIR A;  2GNB A;  1PIV 2;  4DY3 A;  3VBO C;  1D4M 2;  4IEO A;  5T50 A;  1C5I A;  2B42 B;  4AHZ A;  3WG1 A;  2DYC A;  3GDB A;  4JGY B;  4Z1V A;  1TG7 A;  4XFH A;  2WFP A;  1N1T A;  2ZCW A;  1IS4 A;  1K5M B;  2JXA A;  2VZV A;  5FYC A;  3A4U A;  3PUA A;  2KR2 A;  3H8R A;  1R08 3;  4CCD A;  5C9A B;  2I2S A;  3B00 A;  3K4A A;  3TAY A;  4K3U A;  3AL6 A;  1ZZC A;  3VV1 A;  2BGC A;  2YU1 A;  1DGW A;  1QJY 2;  2ZS6 B;  4JTO A;  4IV1 A;  4QQL A;  3GBW A;  4AQS A;  2D97 A;  4J25 A;  5LY2 A;  1CAV A;  2JEN A;  1BMV 1;  5FPU A;  4CUB A;  1GKB A;  5C4W B;  1OA2 A;  3NWK A;  4QGN A;  1CD3 G;  1RED A;  3E6B A;  3M70 A;  3FC0 A;  5EXO A;  4R8H A;  1VBE 1;  3RNS A;  5FTT C;  3MV0 1;  3GBF A;  1UPI A;  4MAD A;  1XYN A;  4N43 B;  2W47 A;  4UFJ A;  1CVN A;  1RUF 3;  1NXD 1;  1V6I A;  1O3R A;  3C7E A;  2YGL A;  4FQZ A;  5FZ0 A;  2ZX4 A;  1UU4 A;  1N1S A;  4RHV 3;  3D82 A;  1Y9G A;  4XVH A;  4MGZ E;  1SFY A;  1J59 A;  1WW5 A;  4MXW B;  5BNO C;  1MZE A;  1OD3 A;  1REE A;  2ETE A;  2DVF A;  4W6X A;  5FY8 A;  4FTS A;  1W2A X;  5K9Y A;  1VB4 A;  2NM1 A;  2PA7 A;  4WV8 A;  2HWF 3;  1XXN A;  2Q1F A;  4Y22 A;  2YBK A;  2C9K A;  4UT5 A;  2IXH A;  1ND2 B;  3LIH A;  1AX2 A;  5BNP B;  2FMD A;  3QD6 A;  3S0M A;  2BBV A;  4IV3 A;  4FPK A;  4A6O A;  4Q4X 2;  3KCC A;  4NHK A;  4B4R A;  4CXX A;  2ET1 A;  2VOV A;  3KB5 A;  4LBK A;  5A3P A;  3RZL A;  4QX0 A;  1ODN A;  1IGO A;  1K3I A;  4Z82 A;  4YGC A;  3QH6 A;  3E97 A;  5FAX A;  1COV 3;  1F5J A;  5FRA A;  2E7Q A;  4FPG A;  1KIT A;  2C9A A;  1W9W A;  3O1M A;  4UOJ A;  5FZ4 A;  1LTE A;  3WG4 A;  5GKA C;  5LW9 A;  3WP6 A;  4CUC A;  1X7N A;  4XFC A;  4AVS A;  3R4U A;  5LRR A;  4E27 A;  5A1F A;  4CDU B;  3WDV A;  4E2S A;  1CON A;  3AYD A;  4HVR A;  4N7U A;  2WWU A;  4CCE A;  1V6N A;  3AFG A;  1SFN A;  3PVO A;  4DIQ A;  4EE2 A;  3I3B A;  2PXJ A;  1JZ8 A;  1DZR A;  1O5U A;  1XQN A;  4QX5 A;  5FUN A;  1LOB A;  3AZY A;  3ZXJ A;  5FO7 B;  1MQT C;  3G6J B;  4IUG A;  2DUO A;  3C8X A;  4YAR A;  5C5T A;  2UYA A;  1DFQ A;  1QF3 A;  3NJV A;  1YCI A;  3HT2 A;  3ZYG A;  1PZ7 A;  1UMZ A;  2HWC 3;  4CEY C;  5JDB A;  1UZY A;  3BOD A;  4BHP A;  2XXZ A;  1MVE A;  3KMH A;  3QLQ A;  5FMO L;  3PUR A;  4AQT A;  4E4S A;  4TN7 A;  5BNN B;  1W6M B;  4PQQ A;  4RGK A;  5FKC A;  3VBS A;  4AFD A;  3T4V A;  4YRD A;  2R06 1;  3DPR C;  1X50 A;  3LB9 A;  1UXX X;  4NHY A;  4BLJ A;  5TSW A;  2DUP A;  1COV 1;  4U36 A;  2RDQ A;  3G7D A;  2WQ8 A;  5CYY A;  2DTY A;  1WCU A;  3RMX A;  3EBR A;  2AGS A;  3AZW A;  5FZF A;  1JOD A;  3MIC A;  4Y1Y A;  1NLS A;  2WFF 2;  4QDR A;  3OY8 A;  3KD4 A;  4JDN A;  3CF6 E;  2D6N A;  5DAX A;  4CUG A;  2RM2 1;  4B4Q A;  3WDT A;  1F9K A;  2CGO A;  3POW A;  3P3P A;  2W1Q A;  3CDZ B;  3PU8 A;  5DZE A;  4C1W A;  4DMI A;  1JYW A;  3PME A;  4LTA A;  1K5M A;  4OI4 A;  3WX5 A;  1VIW B;  1TMF 1;  4GH4 C;  4XF4 A;  5I8S A;  3CJX A;  2NMO A;  3LPF A;  3SH4 A;  3VBU B;  1VAV A;  5C9A A;  1NQD A;  4I2O A;  1ULP A;  1EYB A;  2B9V A;  3DYM A;  4JKL A;  5A7W B;  1PGL 1;  4AOC A;  3C2U A;  3AM2 A;  4L0P A;  3WDW A;  2VXJ A;  4LBL A;  3JQX A;  3AZX A;  4N53 B;  3ZMO A;  1MS8 A;  2E6V A;  4CDX C;  4K21 A;  5FQ0 B;  1JUH A;  1RXF A;  4Q8K A;  4DZG A;  5T5L A;  4LBN A;  2ZAH A;  1Q8S A;  2BW8 A;  2BP6 A;  3O0X A;  4RD7 A;  3SLI A;  4DXZ A;  4GB3 3;  3V56 A;  4QB1 A;  5C4W A;  1NA1 B;  1NLQ A;  3UK9 A;  3MF9 A;  2WSV A;  4LA3 A;  1JU4 A;  4LKF A;  3THP A;  3BUC A;  1AVB A;  3WF4 A;  1FV2 A;  5FZH A;  2VXR A;  4L8Q A;  3S5A A;  3IPV B;  1BXH A;  1SDW A;  4N43 A;  2OA2 A;  2IZW A;  1RTV A;  4LHL A;  1MVQ A;  2JDZ A;  2RS5 3;  3PNA A;  2XKP A;  4QB6 A;  2P5B A;  3TN9 3;  2WSU A;  2XHN A;  2X10 A;  3DEM A;  4O65 A;  4MXW A;  4NRM A;  3ZN6 A;  2Y6K A;  1E5I A;  2XQR A;  3AVR A;  1OOP B;  1QJE A;  2JG9 C;  2ORZ A;  2AR6 A;  4A7Y A;  1QY4 A;  3H7Y A;  4W4Z A;  5DZG A;  5KXE A;  1PVX A;  1UU6 A;  4K9S A;  1NCR B;  1IPK A;  1UYY A;  5LBE A;  1ND2 A;  4ZZ8 A;  1EUT A;  5C3P A;  1DYK A;  2ZX3 A;  2VVF A;  2HEV F;  4XFI A;  4KU8 A;  1UOB A;  3H3U A;  3L2H A;  2JDP A;  3I97 A;  3PVN A;  5KHK A;  2B9U A;  4ATF A;  2Y6H A;  1BLZ A;  1OLM A;  1VR3 A;  5CZK A;  3E5Q A;  4W50 A;  5GLW A;  3KVA A;  3RGB A;  4LK6 A;  4Y26 A;  5C8W A;  4C91 A;  3KV6 A;  4F83 A;  2XVG A;  2ZX0 A;  1D4V B;  1EP0 A;  2ZGP A;  2OX0 A;  4XUO A;  3NRU A;  4GMP 1;  2Y33 A;  4HT1 T;  4LOS A;  1DZQ A;  1VBA 1;  3UKN A;  5CEH A;  3ORJ A;  4CDU A;  5AFB A;  1CJD A;  1F5F A;  2IUW A;  1LOG A;  2BWC A;  3PJY A;  3RYK A;  3TRS B;  4CUA A;  5FP4 A;  1UOJ A;  2VM9 A;  2IVJ A;  1MZ5 A;  4YWA A;  2RS5 1;  3L2Y A;  1D0G A;  2HWE 2;  3N36 A;  1I1E A;  3TN9 1;  2W92 A;  5FBJ A;  4EN7 B;  4YM0 A;  4WVZ A;  3VD9 A;  2IWG B;  2XBO 1;  4IW3 A;  5T3N A;  3LPG A;  4LO4 B;  4UXA A;  5GZC A;  1PO1 2;  1Z78 A;  2VO5 A;  3GCW A;  3JD7 3;  3ZFE C;  1MS5 A;  4BYY A;  4CEW C;  1LHO A;  2UWB A;  4MGQ A;  2JIJ A;  2P6H A;  2GC3 A;  1XJA A;  2H6C A;  1HKD A;  4D94 A;  3NJZ A;  1W6M A;  4TLG A;  5FZA A;  3O1P A;  1H0B A;  3ZX7 A;  2PFW A;  2ZJC A;  1CAU A;  4XEZ A;  4B4P A;  2OKX A;  4MGK E;  4O9G A;  3ES1 A;  2F17 A;  2PAK A;  1LJ7 A;  4QMA A;  2A6V A;  3GZU C;  4PLM A;  3ZM8 A;  1QJF A;  3OSD A;  3NKG A;  1NG0 A;  2XJT A;  1XU1 A;  1B09 A;  4ZU4 A;  1VRH 2;  1UMH A;  4Y5S A;  2RS1 2;  1JYT A;  1TME 2;  2WNV B;  3EYP A;  4BQ2 A;  2D3P A;  4XTP A;  4CE8 A;  1PO2 1;  3AP6 A;  5FYV A;  4M4R A;  1GOH A;  1W05 A;  2E32 A;  1RUJ 2;  1GOG A;  2H0V A;  4BH9 A;  1H9W A;  5ACA 3;  1SFP A;  1JYC A;  4BU2 A;  3IWZ A;  4GMP 0;  1SCS A;  1Y9M A;  3VBU A;  1VBC 1;  2WC2 A;  4MSV A;  2XLA A;  3KSC A;  2AUY A;  5EZW A;  3P3N A;  1QU0 A;  2RHP A;  5FY5 A;  1H6Y A;  1ZA4 A;  2GND A;  1ND3 C;  2V09 A;  2WNO A;  1Z7S 3;  4XMA A;  5FQ0 A;  3GNE A;  1H2L A;  2XL7 A;  5A3U A;  2Y64 A;  4DRV A;  2ZAB A;  4S2H A;  2EF6 A;  2BWA A;  4K20 A;  3WY6 A;  3VDA A;  3Q8B A;  1FPN 2;  5J09 A;  4Q1P A;  1NA1 A;  3I2G A;  2O14 A;  5CFC A;  3J7M A;  2JG8 B;  4XFF A;  1YO8 A;  3PUI A;  5ABJ C;  1C8M 1;  5A6Y A;  5KXC A;  1W9S A;  1VAK A;  1OC1 A;  2RV9 A;  4LQR A;  4LO7 A;  5F6L B;  1LB2 A;  1UO9 A;  2OYZ A;  4W6Y A;  3WQ0 A;  1NX9 A;  3VDD A;  2QKD A;  4EN9 B;  5LA9 A;  2BNN A;  4M3C F;  3SEP A;  1WLC A;  4QX7 A;  4AVT A;  4C0B A;  4E2G A;  4M3C B;  3USU A;  1GUI A;  1QXR A;  4NID A;  4BXS V;  4NAM A;  4XUQ A;  1XE8 A;  5ACA 1;  4A42 A;  3LWC A;  3DEC A;  2OQ6 A;  1NCR A;  1POV 3;  2R1B A;  3HVD A;  1APN A;  2P2K A;  3CMG A;  1VE0 A;  4WM8 A;  2YBP A;  1IS5 A;  2ARE A;  3CNA A;  1J3R A;  4P9J A;  5GAL A;  2VCM A;  5A3W A;  1ALY A;  3NJY A;  1AF9 A;  1JYV A;  2Q8D A;  2VUC A;  1ZNP A;  1O8P A;  3O1O A;  1UAI A;  3U11 A;  4DXT A;  3BTX A;  4PDW B;  3VKF C;  1SBE A;  3K3O A;  4WVM B;  1RUN A;  1GQG A;  3C7G A;  3LSE A;  3WNK A;  1AXZ A;  3MFA A;  2QCS B;  3THC A;  4CSW A;  1U12 A;  1YFW A;  1C1F A;  2K9Z A;  1J3P A;  5ERL A;  5F5I A;  2VMH A;  1QJU 2;  4PQ9 A;  3LA3 A;  1OQ1 A;  1OHF A;  1DGW X;  1RUG 3;  1JN2 P;  2DVG A;  3KV9 A;  5IK4 A;  4O9E A;  3C3V A;  3LGR A;  4IEQ A;  4TLF A;  4AI9 A;  4QD2 A;  2WZR 3;  3BVC A;  4R9D A;  2XPJ A;  3VL8 A;  4CTE A;  5FPX A;  1UX7 A;  3SHR A;  4KQ7 A;  4CP9 B;  3RZJ A;  3V64 A;  3KS7 A;  1NXM A;  2JDK A;  4NMI A;  2Z42 A;  4RYD A;  1AL2 2;  1HRV 2;  5L9B A;  3RWK X;  1SLL A;  2W87 A;  4XDP A;  3VBR C;  2R07 3;  4OQ8 A;  1RUH 3;  4D3W A;  1VB2 A;  2PHD A;  3WF0 A;  1AJO A;  1R64 A;  5L7O C;  3ZVX A;  3DKW A;  3B9I A;  5CA6 A;  5DAV A;  5FLJ A;  1GBG A;  4FXG B;  1WCD J;  2WNU C;  4WZC A;  1DQ1 A;  1XNA A;  5KHG A;  3W9A A;  4P9I A;  1H9P A;  3UJQ A;  4EWD A;  1RIT A;  1W2T A;  3H8O A;  5M0T A;  1YI7 A;  4BOW A;  5F3I A;  3GHN A;  3O0W A;  1PVC 3;  4P02 B;  3J8F 1;  4RQP B;  2WO7 A;  2EAL A;  5F6K A;  3GZT B;  1YQC A;  3VBF B;  2FBE A;  2C1F A;  1PNG A;  4OMC A;  1LGN A;  2QQL A;  2RS3 1;  4YM1 A;  5JCT A;  3E6C C;  2WZR 1;  3HNM A;  1LKN A;  3KM5 A;  4XXP A;  3FJS A;  4Q4Y 3;  4CP1 A;  1JXN A;  4OQ9 A;  3WT3 A;  2RVA A;  2HWD 3;  4IEU A;  3PIG A;  3ZYP A;  3OEA A;  4GXL A;  4BQ5 A;  1O4T A;  1PK6 C;  1W9T A;  3DV8 A;  2CWM A;  1BVV A;  4I3G A;  2V4V A;  1HW5 A;  1LOF C;  4YPJ A;  1I5P A;  2R07 1;  1YYN A;  5D1I A;  1CGP A;  4OLL A;  5L9R A;  3OUJ A;  3APB A;  3KF3 A;  2BJS A;  2RR1 2;  4QHO A;  1DZT A;  4XTM A;  2XJP A;  3CHX A;  3EJK A;  2PHL A;  3TWI A;  2PN5 A;  2JG8 A;  1F35 A;  3QAC A;  4LBQ B;  5LWB A;  3V0A A;  4WM7 B;  3ZN5 A;  3A0K A;  5IFT A;  3O0V A;  4Y20 B;  2EIE A;  1AR9 1;  1UY0 A;  4XBQ A;  3OPZ A;  4QHB A;  1CJP A;  4QWN A;  1W9Y A;  4D6Q A;  2Q4S A;  2Y34 A;  4BIO A;  1VRB A;  1GR3 A;  3ACI A;  3Q8C A;  4IV3 C;  5LZ6 A;  2D6M A;  3AVS A;  4M3C A;  1N1V A;  2Z69 A;  4S2G A;  4WVV A;  5FMD A;  5FXV A;  1PVC 1;  4AE2 A;  2PEL A;  4IE5 A;  4QPW A;  4RS5 C;  4YZ4 A;  3J26 N;  5K0U A;  3OGG A;  1AYN 2;  3IKW A;  5FP8 A;  1LEC A;  5CFD A;  3U37 A;  2A5Z A;  5JOX A;  4Q4Y 1;  4JCK A;  4QKB A;  5EJZ B;  4P9X A;  3K77 A;  1K45 A;  3WDX A;  3FFZ A;  2ET7 A;  4BPZ A;  2VUA A;  4C8D A;  4COU A;  4HSJ A;  4NR1 A;  4ASL A;  1WWY A;  2RDR A;  1R09 3;  2H0B A;  4OHY A;  4H14 A;  4PDW A;  2UYB A;  3RI8 A;  4QPI C;  4WVM A;  2VZ1 A;  3K4D A;  4CDW C;  4QPY A;  5EHD A;  1JS9 A;  3VZJ A;  4DNY A;  5IYY A;  1VBD 1;  2V73 A;  2J1A A;  1FNZ A;  4P9G A;  3RZM A;  3A7Q A;  4P00 B;  1FMD 1;  1SLB A;  2C6S A;  2MEV 2;  1IS3 A;  4AI2 A;  1W0O A;  4XF3 A;  4Y1Z A;  2QQI A;  5FMC A;  5JI9 A;  5JZG C;  2AEY A;  1J84 A;  3M3I A;  1SLT A;  4Q27 A;  2UWC A;  1JTZ X;  3JU9 A;  2ZZQ A;  2YZ4 A;  2TBV A;  3BU7 A;  2PQQ A;  2JDN A;  5FZO B;  2KD7 A;  3FLP A;  4CU7 A;  2RE9 A;  1W6Q B;  1RUC 2;  1E57 A;  1WGP A;  5T54 A;  1VBB 2;  4R52 A;  2GSY A;  3T08 A;  1N3Q A;  2O8O A;  4IL7 A;  5CG8 A;  4NIA A;  4CP9 A;  4LT5 A;  1G9D A;  3H7J A;  5JXG A;  2UWA A;  2WA3 A;  4ZZ5 A;  1T6G C;  3CLP A;  4XJ8 A;  5DUV A;  3SXW A;  5DPN A;  2DCZ A;  4CDQ B;  1HRI 3;  1K5J A;  1R09 1;  3TEW A;  4BB3 A;  1E5R A;  1V6K A;  4I01 A;  4JGY C;  2XG3 A;  2IXL A;  3BOP A;  1SHW B;  4BQ1 A;  2W46 A;  4IV1 B;  1O91 A;  5F3G A;  3ZXA C;  3CJI A;  3W59 A;  1RVF 2;  3K48 A;  4IES A;  4QKF A;  2FDK A;  4JRA A;  4X6Q B;  3CIH A;  1ZX5 A;  1REF A;  1CIY A;  4BDV B;  1JZ6 A;  1W03 A;  2GC2 A;  2C26 A;  3ACG A;  2ES3 A;  3D8C A;  4QB2 A;  2FCT A;  2MNG A;  3MIG A;  5APA A;  2I45 A;  2YXS A;  5HXV A;  2XJR A;  2J1V A;  4D0Q A;  2E31 A;  4GAL A;  4RQP A;  4YLZ A;  1QXJ A;  2DVD A;  2ARX A;  3VKN A;  5KBF A;  4FOW A;  4SLI A;  1HXS 3;  3MW3 A;  1CAW B;  1X9P A;  1ZZ9 A;  2ZTN A;  3OF1 A;  3M8L A;  3MLL A;  3PVE A;  4AFB A;  4QXH A;  1V9U 3;  4HOO A;  5F7U A;  1V6L A;  1W3V A;  1R1A 2;  1RUE 3;  1YIP A;  3GBG A;  5DUU A;  4BLI A;  1H1I A;  3MW2 A;  1L7L A;  2BU9 A;  1WMX A;  3KLS A;  1PMI A;  2RMU 3;  4Y22 B;  2ARB A;  4DUX A;  4TTG A;  1EAH 3;  5CVR A;  2QTW B;  1I3H A;  2LM3 A;  5D8A B;  3NVC A;  5IK8 A;  4AEJ A;  5LAT A;  4A7K A;  5FXW A;  4CPB A;  3INA A;  3Q8E A;  2BYV E;  3HJR A;  2VMC A;  3VKM A;  3ZXF A;  2QZ2 A;  5GJ6 A;  4LMF A;  4LBQ A;  2YC4 A;  4AVV A;  2P3I A;  2GP5 A;  4P5H A;  2VVE A;  1GAN A;  4MOA A;  5LBF A;  4F3J A;  5LY1 A;  1MS1 A;  2QQM A;  4XUT A;  4NVP A;  2Y6J A;  2YMZ A;  5EWS A;  4YZ5 A;  1JHJ A;  1BBT 2;  1GQH A;  2P3Y A;  5FZ8 A;  5BNP C;  1W8H A;  5A80 A;  4K40 A;  1CZT A;  2R0F A;  1LOE A;  1ZBA 3;  2J1T A;  2JKX A;  2YFZ A;  1PHM A;  4EWA A;  1AR7 2;  5I0S A;  1CIW A;  5A3L A;  3HWJ A;  5BV6 A;  3N9N A;  4YG0 A;  3BPS A;  4P9L A;  5GZE A;  4XIL A;  1CR7 A;  2ZBJ A;  3IDE A;  3W58 A;  3WHU A;  2E63 A;  4NPR A;  1QQP 2;  1MS9 A;  2GH8 A;  3VD7 A;  3JBG 3;  4NO4 A;  5A7Q A;  5JIA A;  2NLR A;  2HLE A;  1N3O A;  1V9U 1;  2ZAA A;  3E5U A;  5KXD A;  1OF3 A;  1RUE 1;  2YG0 A;  2GZW A;  4HKW A;  4AL9 A;  1UKG A;  3AKR A;  4YVW A;  4CDU C;  4FCA A;  2OQ7 A;  4DB5 A;  3MV1 1;  3NNJ A;  1EAH 1;  5JSP A;  3RZK A;  1RYY A;  4ITC A;  4K6B A;  1W99 A;  1PM7 A;  3LKJ A;  4TXW A;  3UKV A;  1JZ5 A;  3IBM A;  2GAL A;  1DU3 D;  3ZKY A;  3VBS B;  4AWD A;  4COW A;  1WLW A;  2JDH A;  1ASJ 2;  4JGZ B;  2WS9 2;  1EPZ A;  5E16 A;  4FSJ A;  3IM0 A;  4UW4 A;  1QJY 1;  5H9R A;  2ZEX A;  3LSD A;  4XE9 A;  2ZEY A;  4M0H A;  3AP7 A;  2JB4 A;  1W2O A;  1A78 A;  3CO2 A;  5F5Q A;  3RFR A;  2QQJ A;  4AFC A;  1JU3 A;  1VBE 3;  2VUL A;  2PLV 2;  5EP9 A;  3KV5 A;  2BUK A;  3NNL A;  3WF1 A;  4XF1 A;  5BNN C;  4Q4V 3;  2A1X A;  1HB4 A;  3AKT A;  5FZO A;  3CEW A;  3OY8 B;  1GIC A;  4XFG A;  4QGL A;  1O6U A;  3H9A A;  2YPD A;  4BQY A;  2BQP A;  3LFI A;  1W9F A;  2DCY A;  5A7N A;  3WHT A;  4IER A;  2DCJ A;  1W6Q A;  4RR3 B;  3NV4 A;  4CU8 A;  3AP5 A;  2DUR A;  1IZ3 A;  1X82 A;  3LEM A;  1LRH A;  2NYY A;  3JBG 1;  4YNI A;  3ZSL A;  2CSG A;  5JMC A;  1XSQ A;  1EV1 3;  1GFF 2;  2JDU A;  3JQW A;  1W28 A;  3FBY A;  5IVF A;  3RRD A;  4KWU A;  3HNB M;  2G9F A;  3AYE A;  1RUD 2;  4DXS A;  4CDQ A;  1BEV 2;  1I6X A;  3W5M A;  2QDN A;  4LOT A;  2PHT A;  2PHW A;  5A6X A;  3RMY A;  1FYU A;  2GH2 A;  5FZ3 A;  1AHS A;  1GNH A;  1V6J A;  3ACF A;  4MGI E;  4Q4X 1;  5DDJ 2;  3GCX A;  5FZM A;  1C5H A;  3HQU A;  2ENR A;  3VBU C;  5T5P A;  4DFS A;  3H3L A;  4GUL A;  4DPN A;  2QQP A;  5C3R A;  2CU5 A;  4EN6 B;  1E5H A;  4Q4W 3;  1OPO A;  4HK8 A;  5L73 A;  2PHF A;  3T1M A;  5LA1 A;  1TVG A;  2OS2 A;  4Q4V 1;  4LPL A;  3N9L A;  4Q26 A;  1A8D A;  1ENR A;  1FNY A;  1GNZ A;  2BOJ A;  2RDS A;  3UES A;  1XOY A;  4A6S A;  2ZML A;  1CAW A;  1AR8 3;  5LBC A;  5F3E A;  3MFC A;  1NA1 C;  2R04 2;  1KJR A;  2ZHM A;  1QJX 2;  2FDH A;  3ZN6 B;  3GM8 A;  4FOY A;  2JDA A;  4FP3 A;  5G05 L;  4AVA A;  4AFM A;  1F2N A;  1RC6 A;  1LGC A;  4CXW A;  1EV1 1;  2XUE A;  5F32 A;  3ASI A;  4IQP A;  3S57 A;  4TSV A;  5D8A A;  3GZE A;  4D6R A;  3IZO A;  3OUI A;  2XJQ A;  4D8M A;  4FAH A;  1LUL A;  3I3Q A;  3POG A;  3WP5 A;  1ONA A;  1SMV A;  3CZJ A;  4UFI A;  5FOJ B;  1JH5 A;  5C8C A;  2JIC A;  2WO3 A;  5FOB B;  1RHI 3;  2R06 3;  2E26 A;  3DKQ A;  5FZ6 A;  3ZFF A;  3AKS A;  1D7P M;  4QX8 A;  4M00 A;  1OOP C;  4CCM A;  5AC9 3;  1W8T A;  1KXG A;  1WCQ A;  2DVA A;  2P3K A;  4LLO A;  2Q5T A;  4OCT A;  1SPP B;  2W1U A;  3ACH A;  3WW2 A;  1IKP A;  5C3Q A;  4NIG A;  2SBA A;  4IE0 A;  4Q4W 1;  2P1B A;  2EXJ A;  1TE1 B;  5CBL A;  5FK7 A;  4Y33 A;  4B1L A;  1J83 A;  4W8J A;  4I30 A;  2RM2 3;  5F3C A;  1H30 A;  3BU0 A;  1J3Q A;  1MR5 A;  3GAL A;  1T2X A;  4GA9 A;  1H8T A;  5JR7 B;  4EN0 A;  1BMV 2;  1PMJ X;  2OT7 A;  5DMY A;  3I2K A;  1AR8 1;  2AEN A;  4Z8B A;  1RUO A;  3FHA A;  4NII A;  1TMF 3;  4PF5 A;  1T6B X;  5FYZ A;  2XVL A;  3N7K A;  1KGY A;  4DEV A;  4I02 A;  3HR9 A;  3LIG A;  1AL0 G;  2VD7 A;  2QNK A;  4ES9 A;  1NCQ C;  3H0O A;  1S2K A;  1UIK A;  3NV1 A;  2FDJ A;  2ZEW A;  3B3Q E;  1BYH A;  3V0B A;  2ZKN A;  3ILF A;  3JXS A;  3TB0 A;  4W6W A;  5FPB A;  3JZV A;  3WXP A;  1UY2 A;  1YFU A;  2NPI A;  2R49 A;  3OG2 A;  4R4X A;  4KGG A;  4B7E A;  4LEJ A;  4MO3 M;  4BZ4 A;  5JIU A;  1LAJ A;  1RHI 1;  1RUI 3;  1X8M A;  2F6B A;  2A70 A;  4FFG A;  4JGZ A;  2JJ6 A;  3JB8 A;  5A7O A;  1CAU B;  1S2B A;  2B4K A;  1DDL A;  1CAX B;  4ES8 A;  3HD8 B;  4XPV A;  1URX A;  1R08 2;  2KM2 A;  5AC9 1;  2OUH A;  2TEP A;  2XL9 A;  3V65 A;  3AMN A;  1CPN A;  1GSL A;  3HT1 A;  1D2Q A;  4HKO A;  5A3N A;  2VOX A;  3LA7 A;  1F4A A;  3I2J A;  3UGH A;  2HBT A;  1VMJ A;  4NN0 A;  1YFY A;  2VMD A;  4N53 C;  4NRP A;  2A6W A;  3FN9 A;  3WQB A;  4BWO A;  2R0H A;  4RR3 A;  1OFN A;  1UZZ A;  3POF A;  1S0I A;  1F4H A;  3MGU A;  2WKK A;  3FLR A;  2OPW A;  4LBJ A;  3AYA A;  3I2H A;  2BFU S;  3AP9 A;  3BYW A;  4MLO A;  4FOQ A;  4JC1 A;  3DCQ A;  3J9S A;  5JI7 A;  3WD5 A;  2W5F A;  1J1T A;  4IND A;  2Y6G A;  3MW4 A;  3HAG A;  3NAP B;  3C7F A;  3ZYR A;  3AXD A;  4GJZ A;  2Z79 A;  4XFA A;  1RUF 2;  3PHM A;  1ZA7 A;  2K2S A;  2PQS A;  2W3J A;  3M1H A;  1GV9 A;  2WNV C;  1NE4 A;  3K2O A;  5LK5 A;  4RHV 2;  3VBH B;  5F5A A;  1JMU B;  3AB0 A;  4HVO A;  1RUI 1;  1RIR A;  1US2 A;  5D2A A;  3M3Q A;  1W06 A;  1MS0 A;  1U5Y A;  4GJY A;  5EJ1 B;  3O1R A;  2WQZ C;  2HWF 2;  4ZXK A;  4GMP 3;  2F4P A;  5CFC B;  1O3S A;  4PI0 A;  1PMH X;  1L7Q A;  1VBA 3;  2Y8K A;  2GU9 A;  2VBD A;  4YGB A;  1V00 A;  4HL0 A;  4M4P A;  5HBA A;  2X05 A;  3WNX A;  3VDD B;  4L9B A;  5FJK A;  2JEM A;  1HV1 A;  4FPC A;  3OBR A;  4IEY A;  5FYB A;  1M4W A;  3R05 A;  1COV 2;  2K0G A;  3USU B;  1XNK A;  4AEM A;  3ZFG C;  1TZO A;  2XBO 3;  4GWN A;  3OBT A;  4EWE A;  2D6K A;  5FMB A;  4HFS A;  4XYX A;  3IIA A;  2DUQ A;  2HWE 1;  4UW3 A;  4DQA A;  3AJY A;  4UFM A;  2W1W A;  3NO8 A;  5BNO B;  3U0Z A;  1OF4 A;  2E9Q A;  3N9Q A;  2BEO A;  4WM8 B;  2CY6 A;  2VTF A;  2QDR A;  2VNG A;  4FPO B;  2NQY A;  3ALQ A;  5HV4 A;  5KWR A;  1PO1 1;  5DG1 A;  1FXZ A;  1QKQ A;  2X5I C;  1DG6 A;  3OPT A;  4LUL A;  4M01 A;  4AZZ A;  1GWL A;  4H3W A;  3S7E A;  5JWP A;  2X53 S;  2ZEZ A;  2DV9 A;  3THD A;  1GZW B;  2A6Z A;  2VUD A;  1JZ7 A;  1BZW A;  3ME2 A;  1LOC A;  2HH9 A;  3LOI A;  4K1Y A;  5BXX A;  1DQ2 A;  4XF9 A;  1VP6 A;  3WNP A;  1DYP A;  4B1M A;  1SPP A;  1S0G A;  5I0D A;  2W39 A;  2HWC 2;  3SNM A;  1YWK A;  2Y6F A;  1GZC A;  2GC1 A;  2Q0A A;  2VQU A;  1GP4 A;  1VLN A;  1O5L A;  2HEY F;  1G9B A;  1YFX A;  1WA6 X;  3PL0 A;  5DAB A;  2XJS A;  3N9M A;  1PO2 3;  2Q8O A;  1VRH 1;  2RS1 1;  3T0A A;  4JHZ A;  1O3Q A;  1TME 1;  1X8E A;  2CAV A;  4AYU A;  1YJL A;  1VAL A;  1HQL A;  3ZYI B;  1VBC 3;  4URA A;  3OGJ A;  4ZKT B;  5FYH A;  1OI6 A;  2V72 A;  1MQT B;  2XJV A;  5FPA A;  1YRZ A;  2DDU A;  1JYX A;  2WR9 A;  4QXC A;  1LNS A;  2JE8 A;  3KCY A;  4XET A;  4CEY B;  2WZ8 A;  1PX3 A;  2MPF A;  3MPB A;  4QQP A;  2XML A;  2VZQ A;  1CAX A;  1GNY A;  1SQ4 A;  4BE3 A;  2IC1 A;  3K75 B;  1F31 A;  3DPR B;  4AI8 A;  1Y3T A;  2CYF A;  1C8M 3;  2RJ2 A;  1MZF A;  2D98 A;  4ISQ A;  2WYS A;  4MX3 A;  3OOX A;  1FPN 1;  2A3X A;  3S30 A;  5JPM B;  2E7A A;  2Q8E A;  3FBM A;  2JB8 A;  2J1S A;  2K46 A;  4OMD A;  3VL9 A;  3D3A A;  2XLG A;  2WA4 A;  3I2D A;  2ARA A;  2BTV C;  4UWD A;  1SLA A;  4FFI A;  2VTX A;  2NMN A;  1W0P A;  2FZ1 A;  4GB3 2;  1QHD A;  1S4C A;  4X6R B;  4N9H A;  2BFU L;  1LHU A;  1XU2 A;  4CP0 A;  2CDO A;  5FCC A;  3LEK A;  3U4X A;  3IAQ A;  2VEC A;  3NAP A;  4UYB A;  1H1A A;  1WMD A;  3K51 A;  1DBN A;  5KXB A;  1OQD A;  4LNV A;  1GU3 A;  3KHC A;  1C28 A;  4GH4 B;  1PX4 A;  1US3 A;  1IHM A;  3D5O A;  1Q8P A;  3O14 A;  2UY8 A;  3ENR A;  2RS5 2;  4RQP C;  3VBH A;  2Z5W A;  2XKO A;  1L3J A;  4QPG C;  5GLZ A;  1H2K A;  4Q0V A;  5EJ3 A;  1AYM 3;  3TN9 2;  5A6Q A;  3VBF C;  5K7P A;  1UX6 A;  1XSR A;  4LLF A;  2PAE A;  3MPP G;  3UYJ A;  3JB4 C;  3TEY A;  2IXI A;  5I0R A;  4YG6 A;  5EPA A;  3N35 A;  1JW6 A;  1H2M A;  3U4S A;  2BBA A;  5KC5 A;  3V0A B;  1H8V A;  5F2W A;  1YQ5 A;  4COZ A;  2YRO A;  4JQR A;  4TWT A;  1QOS A;  4AG4 A;  4XAB A;  1WUV A;  1FOD 3;  1UNB A;  3FX3 A;  1N3P A;  2XGX A;  4MGS A;  1OH4 A;  4LK7 A;  1JOJ A;  2HBU A;  3H8U A;  4E4Z A;  4G9S B;  4RFR B;  5IT6 A;  2ARC A;  2WWS A;  4XBL A;  1CES A;  2FCV A;  2HWB 3;  3AMH A;  1HDK A;  4JV4 A;  1ZRE A;  1QJU 1;  4WM7 C;  4FOV A;  2YU2 A;  2VBB A;  4PIZ A;  5K0U B;  5T5J A;  3WNN A;  2E33 A;  3LA2 A;  3WF3 A;  3WZ1 A;  2DVB A;  2AAC A;  5CFD B;  3QBQ A;  5BNO A;  5C6C A;  2B45 X;  2ILM A;  2WWJ A;  3AMQ A;  2JG9 B;  4NPM A;  4QU1 A;  2RDN A;  2FDG A;  1DGR A;  1VJ2 A;  1IPS A;  3LF7 A;  2CGN A;  4JQT A;  4MUV A;  5DXD A;  1QIQ A;  5FZB A;  2DTW A;  3WUD A;  4KG8 A;  1ENS A;  4URT A;  4XUP A;  1H4H A;  1KDK A;  1AYM 1;  1GZW A;  1AL2 1;  1UZ0 A;  3QH7 A;  4YVS C;  2YBS A;  3PIJ A;  3JD7 2;  3I59 B;  3RI9 A;  3HQR A;  2VR4 A;  4KL1 A;  2YYO A;  1W3X A;  4ZU7 A;  4PT6 A;  2DFB A;  3VGI A;  1YEW A;  3I2F A;  2V5D A;  3F95 A;  4KGQ A;  3WW3 A;  1OMI A;  1RIN A;  3GGL A;  1L7R A;  1FOD 1;  4JAA A;  3SEE A;  4LIV A;  4BK5 A;  3LDK A;  1ZVF A;  4YZ1 A;  1MS4 A;  1WLT A;  3J8F 3;  4BJ0 A;  3GJA A;  4KBB A;  1BCX A;  2HWB 1;  3TYJ A;  4O7X A;  2GN7 A;  3EHK A;  4XAE A;  2JKB A;  2C0Z A;  2RS3 3;  4XIO A;  4W65 A;  5FZ1 A;  3U07 A;  4Z2A A;  4P14 A;  1SCR A;  2GNM A;  2WO1 A;  3SKJ E;  4IDZ A;  3PLQ A;  1Q43 A;  2BV4 A;  3E5X A;  4AR2 A;  1OA4 A;  5JSR A;  1MQT A;  3BTY A;  3L9J T;  5FPL A;  3WIN E;  1XB9 A;  1XC6 A;  3KVB A;  4Y5T A;  3ZFE B;  2VNV A;  4IGQ A;  1C57 A;  2Y60 A;  4PF1 A;  4CEY A;  4LHS A;  5CU1 A;  3MLK A;  3RJ2 X;  1ST8 A;  1KFX L;  2VZ3 A;  3E1F 1;  3TNP B;  3WDU A;  5ACA 2;  2YB7 A;  2QQN A;  4FPL A;  5E88 A;  3DPR A;  2CL2 A;  3CJI B;  1DGR N;  1AR9 3;  2VBP A;  1S0J A;  1X9T A;  4A41 A;  4AQ6 A;  1QH7 A;  2A6Y A;  4XJ9 A;  3RYR A;  1OBN A;  3ATG A;  2H6B A;  1Z7S 2;  3VKL A;  4CDQ C;  2QE3 A;  5JUV A;  3GF6 A;  3ETQ A;  1H4G A;  1GP5 A;  2BER A;  3GJB A;  4AED B;  3WQ1 A;  1BK1 A;  3RZH A;  2DF7 A;  3M7A A;  2XLF A;  2CDP A;  3K46 A;  3RSJ A;  1LES A;  4IV1 C;  4QKN A;  1H2N A;  1YHF A;  3ABZ A;  3O12 A;  5A33 B;  5I91 A;  2D7F A;  2X8K A;  1S2E A;  2PAM A;  1AR6 3;  1ULE A;  2D6P A;  4YGD A;  2JE7 A;  1UXZ A;  1LOA A;  1W2U A;  1U5Z A;  5IVB A;  2O0O A;  2EIC A;  4GH4 A;  2VTX J;  4YW2 A;  5FZ7 A;  5FYS A;  2CV6 A;  2VMI A;  1LCL A;  4NHM A;  1YXW A;  1CX4 A;  5T55 A;  3NNM A;  5A3O A;  3K4Z A;  4TYS A;  4CCO A;  4CU6 A;  1UMI A;  5F37 A;  5HI0 A;  1ND3 B;  4SBV A;  1JHN A;  3RS6 A;  4L2N A;  1DLL A;  1VBD 3;  4Q8L A;  5CAZ A;  3IDC B;  4P08 A;  4E8C A;  1Y4W A;  1FMD 3;  1YNA A;  2DU0 A;  4HZF A;  5HCB A;  1FAY A;  1PM4 A;  1LU1 A;  1S0D A;  2VCB A;  4XHB A;  3D6E A;  3M3O A;  4PI2 A;  5D8A C;  3OPW A;  4Y3O A;  1PGW 2;  2MEV 1;  4DUV A;  2GN3 A;  3A0N A;  4FXK B;  3VKO A;  5ABJ B;  4XF0 A;  2JEC A;  3FL7 A;  4XC9 A;  3WVJ A;  4I0W B;  1V0A A;  4QXK A;  3PUQ A;  4Y24 A;  5CIS A;  4MG2 A;  5ISL A;  2WIN B;  3ECQ A;  3MID A;  3OCP A;  1UKR A;  3ETP A;  5LA0 A;  1GMM A;  1X36 A;  2PHX A;  2VZT A;  2A75 A;  3F2Z A;  1WCK A;  1AR6 1;  1JI6 A;  2VE1 A;  3VDB A;  1O59 A;  2P37 A;  2JG9 A;  1HLC A;  4I09 A;  1AUY A;  5AFE A;  3AX4 A;  4KNC A;  4YVW B;  3ZDV A;  1VBB 1;  1F15 A;  1CX1 A;  2WRA A;  4Q0P A;  2WLP A;  2VGD A;  1RUG 2;  2VOK A;  3POY A;  3J7H A;  2I07 B;  2J7M A;  2OZJ A;  5J48 A;  3O1S A;  4QM9 A;  1HN0 A;  4WBB A;  2WZR 2;  3B02 A;  3PTR B;  5FYI A;  3AMM A;  4E9K A;  3I59 A;  2UY9 A;  4BQ4 A;  1ZBE 3;  1ZZ6 A;  4ASK A;  4YGE A;  4R9A A;  3WLU A;  2ZGS A;  4EQV A;  4LO6 B;  3B94 A;  5FZI A;  4AVC A;  3AP4 A;  1ZZ8 A;  3BAL A;  2VG9 A;  1MEC 3;  1W2N A;  1RVF 1;  1FV3 A;  1O7F A;  3BOW A;  1JBC A;  1UD1 A;  1ULF A;  4A44 A;  2R07 2;  1RUH 2;  3SH3 A;  1ULC A;  3KT1 A;  4NJ4 A;  1DQ6 A;  2QBX A;  4XCB A;  4AGR A;  1GOF A;  2A3W A;  1UY3 A;  2VC9 A;  4V2W A;  2VZU A;  3VBS C;  3HPN A;  4L97 A;  2Y6L A;  3BIE A;  1LGB A;  1SG3 A;  2IXC A;  4QX1 A;  5IVV A;  4H7L A;  3O1T A;  2XQX A;  4DXR A;  5GZF A;  4UAP A;  3CZU A;  1O8S A;  3AYC A;  1G6N A;  4PBP A;  4QDS A;  3WUC A;  1RMU 3;  2Q8C A;  2XVK A;  3WEZ A;  1YUD A;  2P6C A;  4XZU G;  4KWL A;  5FLH A;  4F8A A;  5A3M A;  2D5H A;  3KGZ A;  1W0N A;  4IEX A;  3ZFE A;  2X09 A;  2G19 A;  3ZMN A;  1PVC 2;  3OGR A;  5HCA A;  5IVE A;  4RR3 C;  3EO6 A;  1DP0 A;  4LE3 A;  3ZOI A;  2PYT A;  2ZPX A;  4JHT A;  1HV0 A;  1VMF A;  2B5H A;  2R30 A;  3T2P A;  3VBR B;  3WCR A;  1OH3 A;  1R1Z A;  1K5M C;  4Q4Y 2;  3WW1 A;  3MYX A;  1ZBE 1;  4CRQ A;  4YM3 A;  5T5O A;  4D7Y A;  3LDB A;  2HWD 2;  2ZGK A;  3B01 A;  3MF6 A;  3SH5 A;  5C9A C;  2WII B;  2EIG A;  4A3X A;  4P9Y A;  1MEC 1;  2WNU B;  4Q5O A;  2GME A;  4Y1U A;  5A7P A;  3VHN A;  4BK4 A;  4HKL A;  2LTN A;  1UW8 A;  4AED A;  1UN1 A;  4RGA A;  3WNL A;  5HCF A;  1UZV A;  5A33 A;  4QQO A;  2DBI A;  3UGF A;  3MI8 A;  4CPB D;  3BGA A;  2FD8 A;  4MHU A;  5C4W C;  1PIV 3;  2BVV A;  4UBH A;  1D4M 3;  1OLQ A;  4ERO A;  3E6D A;  4LBQ D;  3SKV A;  2ADD A;  1LHV A;  1RMU 1;  4Z07 A;  5LA2 A;  2RJL A;  2LW8 A;  4N43 C;  1CN1 A;  1C3H A;  1PZ9 A;  2VQA A;  1IG0 A;  3HQX A;  4BXF A;  4CA9 A;  1JZ4 A;  1YQ2 A;  2WZE A;  1ND3 A;  1PK6 B;  5C8C B;  3POE A;  5F1R A;  3ZFF B;  4FFF A;  3BN6 A;  4HG6 B;  2PHU A;  1QJY 3;  5FWJ A;  2EXH A;  2MHF A;  3D0J A;  3HBK A;  4ASM B;  1JZ3 A;  3H3Z A;  4N9I A;  2AH2 A;  1QMJ A;  4DY5 A;  3WNM A;  1ND2 C;  2RG4 A;  1LHN A;  2WS9 1;  5DDJ 3;  5SV5 A;  3D0S A;  5FZK A;  5ABJ A;  1R09 2;  3P6B A;  5EQU A;  1LEM A;  1QJZ A;  3B7M A;  2ZA9 A;  4XOG A;  2Y26 A;  4CCC A;  1YC6 1;  5DAW A;  5BY5 A;  5IFP A;  4AGG A;  5EYY A;  5IK5 A;  2EA7 A;  3DYO A;  4V2V A;  1JOB A;  2P4E A;  1XE7 A;  2QQK A;  5FYM A;  3OEB A;  3PVB B;  1ZM1 A;  5L36 A;  2ZOE B;  3DUI A;  1H8T B;  2VW0 A;  4LUM A;  3AXE A;  4LBM A;  2A7A A;  1NY7 2;  4CXY A;  1DYO A;  1PIV 1;  2VJX A;  1D4M 1;  3U78 A;  4BM8 A;  2G9G A;  1SLI A;  3POB A;  4RS5 B;  2Y0O A;  3KCX A;  4ZY9 A;  3ZR5 A;  4BQX A;  4XUR A;  4LA2 A;  2E7T A;  1D0H A;  4IEW A;  4EJR A;  3K3N A;  5FIX A;  4XDQ A;  3V0B B;  1UZW A;  3DN7 A;  2XDV A;  3NNF A;  3S6P A;  2AYH A;  4HVQ A;  3MIB A;  2Z2S B;  3MBW A;  1RUD 1;  2P34 A;  2VCA A;  1BEV 1;  5FYU A;  4Q4X 3;  1H6X A;  4E2Q A;  4UW5 A;  3OBA A;  4A45 A;  4QPI B;  1ZZB A;  3LFM A;  2VUJ A;  4GIQ A;  1JUI A;  3C7H A;  3FUO A;  2D44 A;  3HMY A;  5FUP A;  4CDW B;  2WBK A;  3ZXD A;  4XMI A;  3ZLI A;  2GDF A;  5DDJ 1;  5FY7 A;  4KH9 A;  1O4Y A;  1RJ7 A;  1HRI 2;  1DCS A;  1S0C A;  4HON A;  5DQ0 A;  4COV A;  5JZG B;  3MLJ A;  2D6O X;  1RGS A;  3R4D B;  1MS3 A;  4I0B A;  3ON7 A;  1H1M A;  4J1W A;  4N7I A;  4Q2F A;  4MVT A;  1NZI A;  4FT8 A;  2VOT A;  1YQ6 A;  4RSU A;  2NP0 A;  1J58 A;  1WD3 A;  4G3Y C;  2QJV A;  1IKQ A;  3FFQ A;  4AFA A;  2R04 1;  1UOF A;  2WAA A;  3WDY A;  5J96 B;  1OUX A;  4MGT A;  2OPK A;  2BOI A;  4MHR A;  4AHW A;  3RG0 A;  2XHK A;  3GZA A;  2BNM A;  2EAA A;  3VD3 A;  4NHX A;  4R9B A;  4NIH A;  4Q29 A;  3T0D A;  3ITQ A;  4Q0S A;  1DQ5 A;  2D5F A;  5FY4 A;  3H50 A;  1HXS 2;  5IVY A;  2JD4 A;  4S2F A;  5DAP A;  3VBR A;  4R9C A;  2HEW F;  1FAT A;  2GP3 A;  5LB6 A;  4Q0U A;  1C8N A;  2FZ2 A;  1RJ8 A;  1V9U 2;  2LUW A;  4OUE A;  5L7O A;  4X8N A;  4J6G A;  1RUE 2;  4KWJ A;  4LO8 A;  3NAP C;  2WT2 A;  2OXB A;  3WP4 A;  3ZSK A;  3LD8 A;  2RMU 2;  5FYY A;  5EYX A;  5GZD A;  5FZG A;  3ZXG A;  2WNU A;  1EAH 2;  3AL5 A;  3WG2 A;  3DL3 A;  3NMB A;  4PCR A;  4I3P A;  3VBH C;  4B8E A;  4CVU A;  4KBZ A;  1ACC A;  5FZ9 A;  1UY1 A;  2WFF 3;  2WO2 A;  1OSG A;  3HOB A;  3POS A;  4JDM A;  3UET A;  4UI9 L;  1X33 A;  1EPW A;  3VUO A;  2FDF A;  5CFC C;  1YLL A;  1IG3 A;  2C24 A;  2VAU A;  4PBO A;  1KQR A;  5A1A A;  3OBZ A;  4KMQ A;  5JPN B;  2A71 A;  2ZHK A;  5ANQ A;  3I3M A;  1GQP A;  4XBN A;  3R6S A;  1ZBA 2;  5A70 A;  1WCS A;  5FXX A;  3VDD C;  5LCW L;  4AHX A;  3WV6 A;  3LZZ A;  2I74 A;  2XR4 A;  2YHJ A;  2XWB B;  2VNO A;  3OGS A;  1PK6 A;  2DCT A;  3NQH A;  4Z2W A;  4XAA A;  4EZH A;  1FX5 A;  1A6C A;  4YYO A;  2GNT A;  5H9Q A;  1TQ5 A;  4LKE A;  1LOF A;  3MUY 1;  1JZ2 A;  3JBG 2;  4ARY A;  4LXL A;  1WMF A;  5I8T A;  5LEJ A;  1NCR C;  4BQW A;  4C0H A;  3PU3 A;  1ZYB A;  2LS6 A;  4NHL A;  4XZP A;  4WM8 C;  4ISR A;  3ZXK A;  4XUN A;  3O1V A;  4DIN B;  2JIG A;  4B29 A;  4B7K A;  5A6Z A;  3RVH A;  1KFU L;  4MET A;  1SZB A;  1W6P A;  5DUX A;  1R08 1;  1B35 B;  4QHZ A;  2YGM A;  1LHW A;  4L92 A;  4A7Z A;  1UPS A;  1WKY A;  2R16 A;  4NPL A;  1OLM E;  3LCP A;  1OD5 A;  3R0R A;  4IE4 A;  1O3T A;  1UU5 A;  2XOM A;  2WFF 1;  2X29 A;  4UF0 B;  1QOO A;  1GP6 A;  2ZGL A;  4OUL A;  3ES4 A;  2XB6 C;  3LE0 A;  3SC7 X;  3ZXL A;  1Z0H A;  4JZR A;  4UW6 A;  2HYK A;  3I7D A;  4RS5 A;  4LKD A;  3WOG A;  2WT1 A;  1VBE 2;  3BB6 A;  5J7M A;  1XNT A;  2J1U A;  5JOZ A;  4HN0 A;  1BVP 1;  4FTB A;  3A23 A;  2QQO A;  4Q4V 2;  2UU8 A;  2VNR A;  3PUS A;  1OA3 A;  5IWF A;  1IQA A;  4K7J A;  3POI A;  1HB2 A;  1OUR A;  5FY9 A;  1AX0 A;  2AEZ A;  4ET7 A;  4HN1 A;  1OVP A;  4LE4 A;  1RUF 1;  5C7G A;  4WVW A;  2ZHL A;  5E6H A;  1UYP A;  4UFL A;  2V5Y A;  3PTY A;  4QPI A;  1QEX A;  4QX2 A;  2J22 A;  3M4F A;  3OYW B;  4YZ2 A;  3CQO A;  4RHV 1;  1V6O A;  5LRS A;  1EV1 2;  1KD7 A;  4CDW A;  1HN1 A;  4KWK A;  2CNA A;  3O7O A;  1LOD A;  2IXJ A;  2PTM A;  3RDI A;  4C90 A;  3PUH A;  4QX3 A;  3D4K A;  2B7Y A;  5FYT A;  2HWF 1;  3PMS A;  4YFW A;  3MIH A;  5IW0 A;  5JZG A;  1U5I A;  5JVV A;  2XWJ B;  3IMN A;  5H9P A;  3TNQ A;  2YDE A;  1DGL A;  4KU7 A;  1W6N B;  2WN3 A;  2HKX A;  1DF0 A;  1G8W A;  3OB8 A;  3ACL A;  2W52 A;  4HAN A;  3VBO B;  4A4A A;  4QM8 A;  2HWE 3;  1XRU A;  5JXJ A;  1BJQ A;  4LIU A;  4NRQ A;  1AX1 A;  3VZO A;  4Q4W 2;  4OUM A;  1SBD A;  2Y38 A;  4ZXE A;  1PO1 3;  1Y7B A;  5DUW A;  1U5X A;  4C1X A;  3T30 A;  2ATF A;  4DO0 A;  2WZP P;  5I8Y A;  3O1U A;  1HJG A;  4N8M A;  3AKQ A;  1AR8 2;  3UNP A;  3POJ A;  3HN3 A;  3N7L A;  4K8F A;  3IDB B;  4RA0 A;  4AGV A;  1TNF A;  3MUZ 1;  2LRP A;  2GMM A;  4HMZ A;  2NZ9 A;  3OUH A;  4JGY A;  3OTF A;  4IXL A;  3KT7 A;  5EV7 A;  3B93 A;  4FI9 A;  5FDB A;  1IOA A;  4RN5 A;  4UFH A;  4F7Z A;  1TNR A;  3T1L A;  4BQ3 A;  2CHH A;  3EMR A;  1OLR A;  2HYX A;  4H55 A;  3MHZ A;  2VZO A;  1RHI 2;  2HWC 1;  2R06 2;  3KQR A;  4FPY A;  2J42 A;  2XON A;  4XFB A;  4RGG A;  1VRH 3;  2EXI A;  4OYU A;  4JTN A;  2RS1 3;  2ZGM A;  4PIY A;  3FE5 A;  2JG8 C;  1TME 3;  2R6Q A;  2VME A;  1UYZ A;  5AC9 2;  1NYW A;  3I8T A;  1W6O B;  2C5D A;  2BDR A;  2BVB A;  2O1Q A;  4L11 A;  3NV2 A;  3TEX A;  1Q5O A;  3WW4 A;  5L9V A;  1RUJ 3;  2ZHN A;  3UL2 A;  4QU2 A;  3CU7 A;  4TZD A;  2VZS A;  3FHQ A;  4CCK A;  5BYN A;  1QGL A;  1NT0 A;  2RM2 2;  2Q30 A;  4FPH A;  1UYX A;  3IAP A;  5JOW A;  3BTZ A;  2G4I A;  5FRE A;  1FI2 A;  4Y4R A;  1SLC A;  5FKB A;  1TMF 2;  2D3S A;  3Q9O A;  4FFH A;  4H2A A;  4OZO A;  2YFU A;  4DEQ A;  1QH6 A;  3EB7 A;  5K0U C;  4S2D A;  4K1Z A;  3WCS A;  1V70 A;  3WP3 A;  5CFD C;  1PGL 2;  4CP2 A;  1FPN 3;  1ULG A;  3ZYF A;  4IGP A;  3BTA A;  2VMG A;  1B35 A;  5BNP A;  4ZON A;  1QNY A;  5FP9 A;  4JKK A;  3EXU A;  1W8O A;  4PDW C;  1RUI 2;  4YW7 A;  4UF0 A;  4PHZ A;  4ORF A;  2TNF A;  5C71 A;  2Z4F A;  2IXK A;  3J7L A;  3OD4 A;  1STM A;  5K4L A;  3TBD A;  2QVS B;  3C7O A;  5JR2 A;  2EXK A;  3X29 B;  1EY2 A;  5AVA A;  5FY1 A;  5K8S A;  3N3H A;  4GB3 1;  1A34 A;  2D3R A;  5F5C A;  4WZF A;  2W94 A;  3BCW A;  1RUJ 1;  4Q1R A;  3B5L B;  1ODM A;  4ZPI A;  3USS A;  4HLT A;  1AXY A;  1FT9 A;  3KHB A;  3NJX A;  1NCQ B;  2R1D A;  3LAG A;  5GM0 A;  4FVV A;  4MYE A;  2V4A A;  3GYD A;  4COY A;  3LQC A;  1UF2 C;  1VMH A;  3MDP A;  3DF0 A;  4GKX A;  3OYW A;  4Q0Q A;  4AI0 A;  3UT0 A;  2WL1 A;  1OVS A;  5IVJ A;  1MZ6 A;  1CQ9 A;  2XJU A;  5C3O A;  1KS5 A;  1P8J A;  4PLO A;  5FO8 B;  5LAS A;  1SAC A;  3AC0 A;  2CTV A;  2VCC A;  4LIT A;  4YW1 A;  1WZX A;  1ENX A;  4FTE A;  1YIF A;  3U75 A;  4XIK A;  3BIW E;  3JCI A;  4CCN A;  3H1Y A;  3RZZ A;  1ZRC A;  3AJZ A;  3VLB B;  2A6X A;  5CKQ A;  3N9P A;  1W6N A;  1HB3 A;  5BNN A;  2ZX1 A;  4D69 A;  1QJU 3;  1W90 A;  1A3K A; 
#chains in the Genus database with same CATH homology
 4MHU A;  5C5T A;  3DKQ A;  4XAB A;  2HBU A;  4KBZ A;  3OUH A;  5HV4 A;  3KT7 A;  2FCV A;  2RDR A;  4IW3 A;  3W21 A;  5IAT A;  3EMR A;  5ERL A;  3OBZ A;  4NHY A;  4XCA A;  2RDQ A;  4XC9 A;  2RDN A;  2JIJ A;  3NNJ A;  2RG4 A;  3BVC A;  5LBB A;  4XAA A;  5EQU A;  5L9V A;  5DAX A;  5DAW A;  3PL0 A;  3HQR A;  4NMI A;  4BQW A;  2G1M A;  5L9B A;  4NHL A;  3KT4 A;  5EP9 A;  2JIG A;  3NNL A;  4Y5S A;  5IAX A;  4NAO A;  2A1X A;  4J25 A;  5DAV A;  4BQY A;  4BQX A;  2FCU A;  3GJA A;  4XAC A;  3NNF A;  4JZR A;  5M0T A;  2HBT A;  4ZON A;  3KT1 A;  4XCB A;  5HV0 A;  4Y5T A;  3MGU A;  2OPW A;  5IAV A;  5A3U A;  2FCT A;  4UWD A;  4ZPI A;  3HQU A;  2G19 A;  4NHK A;  5L9R A;  3OUJ A;  5C5U A;  2V4A A;  5LA9 A;  5DAQ A;  5LBE A;  3GJB A;  2RDS A;  4MHR A;  4NHX A;  5LBC A;  5LAS A;  3ITQ A;  5LAT A;  3W20 A;  2Y34 A;  4Q5O A;  5DAP A;  5LB6 A;  5EPA A;  5LBF A;  3GZE A;  3OUI A;  2Y33 A;  4NHM A;  3NNM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...