5L9VA

Hif prolyl hydroxylase 2 (phd2-r281c/p317c) cross-linked to hif-1alpha nodd-l397c/d412c and n-oxalylglycine (nog) (complex-1)
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
215
structure length
215
Chain Sequence
b'PALKLALEYIVPAMNKHGICVVDDFLGKETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLICHCNGKLGSYKINGRTKAMVACYPGNGTGYVRHVDNCNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERAAAKVKY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Egl nine homolog 1
publication title Structural basis for oxygen degradation domain selectivity of the HIF prolyl hydroxylases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 65
structure length 215
sequence length 215
chains with identical sequence B
ec nomenclature ec 1.14.11.29: Hypoxia-inducible factor-proline dioxygenase.
pdb deposition date 2016-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13640 2OG-FeII_Oxy_3 2OG-Fe(II) oxygenase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 5l9vA00
3EMRA 5IAVA 3W20A 5ERLA 4XABA 5LBBA 5DAWA 5C5TA 5M0TA 4NHXA 4Q5OA 4XC9A 3PL0A 2A1XA 3NNMA 2RDSA 3GJBA 3HQRA 4XCBA 3W21A 2RDQA 2HBUA 5LASA 5HV4A 5DAXA 4BQXA 2RG4A 3OBZA 5LBEA 4XAAA 4XACA 5LBFA 4XCAA 4BQWA 5LBCA 5LA9A 3NNFA 5IAXA 5LATA 3BVCA 5HV0A 4JZRA 4J25A 2FCUA 4ZPIA 5DAPA 2RDRA 4Y5SA 4NHMA 5EQUA 4NHKA 4UWDA 5L9BA 3MGUA 3DKQA 5A3UA 5DAQA 3OUHA 5DAVA 2JIGA 2Y33A 2FCVA 3OUJA 2JIJA 4MHUA 3KT4A 4MHRA 4NHYA 2FCTA 3HQUA 3KT7A 4IW3A 2G19A 5LB6A 4BQYA 5EPAA 5IATA 2G1MA 4NAOA 3OUIA 2Y34A 4NHLA 4KBZA 3NNLA 2OPWA 3GZEA 3GJAA 4Y5TA 3NNJA 5EP9A 5C5UA 3ITQA 2V4AA 4NMIA 2HBTA 5L9VA 4ZONA 2RDNA 5L9RA 3KT1A
chains in the Genus database with same CATH superfamily
4IV1C 2ID4A 3I97A 3ILRA 4JX0A 5HBAA 5A3PA 5DMYA 2XWJB 3VHRA 1X7NA 1SPPA 1QWRA 3GDBA 3BTYA 3M3CA 5KXBA 5ERLA 1GZCA 2CGOA 2RM21 3WD5A 5FY5A 1OPMA 3MYXA 5C4WA 1XNDA 3AJZA 3ZX7A 5A80A 2Y26A 3AZYA 3IDAA 2OPKA 4IV1A 5F2WA 5T52A 4EWAA 1QJY1 4AI8A 1RL3A 3T0AA 5FPZA 3W5NA 1O6UA 2W95A 1DYKA 5FZ3A 5A7PA 2H6BA 3BGAA 4M00A 1GUIA 2HBUA 3Q8AA 3OF1A 1DHKB 5C3OA 3LWCA 4JQTA 5H9PA 1YLLA 3PHMA 3OEBA 2D43A 4NIHA 4Y1XA 5FIXA 4NWWA 3H1YA 2BYVE 3QCWA 2BGOA 4P9YA 2VXJA 5DDJ2 3WHUA 4D6RA 5F9TA 2XPJA 3NKTA 3MUZ1 4A41A 5FKCA 1T6BX 3THTA 3OYWB 5JIUA 2E51A 3O1TA 2MEV1 1PO13 1G9CA 2C26A 5FZ1A 1WLCA 1LGNA 3BYWA 4XMAA 1RUE1 4BLJA 1S0EA 3HT2A 3E6CC 5FP3A 5FKBA 3D0SA 3KWVA 4GZ9A 4JZRA 3RPQA 5JXJA 4JHTA 2VNGA 3KV4A 3PLQA 1NZIA 1DP0A 4M0NA 4XXAA 1JHNA 1FPN1 4AL9A 2W3JA 4MXWA 3WVJA 2K46A 3WNLA 2D3SA 5FJHA 1R092 1W2UA 1WW7A 2HWC3 5FWEA 1U5ZA 3ZYGA 4Z2WA 4MYEA 3MBWA 4JKMA 4XJWA 3ZXAC 2FMYA 4EN0A 5FV3A 3CZJA 1DQ2A 1OOPB 4LKSA 1W6QB 1YI9A 2WDBA 4NRQA 1OA3A 1BYHA 4L8QA 3VHPA 1VRBA 4DIQA 3WCRA 2IVIB 4OZXA 2I2SA 2Y33A 3OUJA 2ETEA 2ZAAA 4RHV1 3NL1A 1NOVA 4DINB 1LOFC 2WWJA 4ASMB 1XYOA 2IZWA 2R061 5CBLA 4EJRA 3ZSKA 3TEYA 3DYOA 4FPOB 2HWB3 2ET1A 3N7JA 3GCXA 4HVQA 1ULFA 2HH9A 2XXZA 5FO7B 5FYYA 5CG9A 4Y22A 1LOFA 2LUWA 3AZXA 1RXFA 4RSUA 1VAMA 3TBDA 1UW8A 3R05A 1VAKA 2IFWA 2VJXA 3AZZA 3DECA 1Y43B 1VBA1 5FY1A 5CKNA 2X09A 1YIFA 2GSYA 2WNOA 3AP6A 1IQAA 1H9WA 4AXOA 1H1AA 1FYUA 1HIXA 4R9AA 2A71A 1UZVA 2K0GA 3AYCA 1AR92 4NO4A 1DF0A 3VBHC 1T6GC 5E8AA 3WW3A 5KC6A 2VC9A 3B00A 4NIAA 1F5JA 2P1BA 4BE3A 1RUG3 5LEKA 3HPNA 2PAKA 4YG6A 3SXWA 1UF2C 2ZHNA 4O65A 2VMCA 1DZTA 3RI8A 4CYDA 4EN8B 3SCHA 1C1LA 3VBHA 4DUWA 2XUMA 1X36A 4LORA 4Q4Y1 1APNA 2WINB 2WO3A 4E4ZA 1XNCA 4QQPA 5CFCB 4Y24A 5IK7A 1ODMA 4SBVA 1GZ9A 1CAXA 1CAWB 3KV9A 2Y60A 5FO9B 4Q4X1 4R4XA 4FTSA 2AREA 4QKFA 1ULPA 1URXA 1HN1A 2PLV2 4OMDA 4Q0VA 5FZGA 1W2AX 2A75A 5LBBA 1SLCA 1S0CA 2D97A 4NVPA 5IVFA 3WP6A 1GKBA 1LGBA 2WLPA 4L99A 1ZRIA 5C9AC 3D4KA 3GZUC 4GAZA 4A4AA 4X6RB 4F8AA 1FV3A 1GBGA 5FYSA 4COUA 1GANA 1KJRA 2VAUA 3AVRA 2WIIB 4L11A 3P5BA 2A1XA 4A6OA 2C9KA 3PIJA 3OD4A 5C9AA 1SLIA 1BKZA 1LENA 4H3WA 4TLFA 4Q29A 3S7IA 4Q4V1 3AKQA 3U1XA 3SCFA 2VR4A 2RG4A 3LEGA 4GWIA 1BMV2 2PQQA 1NXMA 4FPEA 2O0OA 2YHJA 1GZTA 4IERA 1JBCA 2VBPA 3QACA 2A6WA 2JB4A 3MHZA 2WLQA 5F3IA 2WZR3 1RHI3 4FPKA 4XCAA 3T08A 2GH8A 1EPWA 3VBSC 2IXCA 2Q1ZB 2WUHA 3V64A 3FLRA 4CCNA 2ZHMA 1UXXX 3NNFA 1A34A 1J3RA 2AENA 1PMIA 2YBKA 4WVWA 2EICA 5DZFA 2QVSB 2ZABA 3BIWE 3O0VA 4JAAA 1POV0 1W6OB 1COV1 1QXPA 3VBSA 2YV8A 2VZRA 1Y9QA 2QTWB 5IK8A 2YU2A 2ZXQA 3J7LA 4Y20A 3JUUA 5GLVA 5T5PA 2QFEA 3WDUA 4URAA 2R062 4KBBA 4JKLA 3WF0A 3ENRA 1MQTB 1QNWA 2F4LA 2VOTA 3OBAA 3HIFA 4W65A 5FY8A 2CWSA 4AVCA 2DUPA 2B7YA 2YC4A 3SKJE 5CZKA 2UURA 4N8MA 4AEDB 5L7OB 1B35B 1UXZA 1QH7A 2AACA 4QXHA 4Q8KA 4R9BA 4LHNA 1S2EA 3IZOA 4HK8A 4JKKA 2D3RA 4KWUA 3BI3A 1V6MA 2ERFA 5AVPA 4O61A 5A6QA 1QHDA 2VTXJ 5ABJB 4EN6B 3HN1A 1GLHA 3FL7A 3LSDA 5FZDA 4BQYA 5A1LA 2CTVA 4CU6A 4NPLA 1QJU1 1PO21 2XJRA 1HW5A 2FZ1A 3LZZA 4IUGA 5J1XA 4HOOA 1UYXA 5AC91 5ACA1 1W06A 1UU5A 5FZIA 2UY9A 1ALYA 5K4LA 3SKVA 3ZDSA 4BPZA 3FX3A 4C0BA 3I2HA 1W6NA 1ZRFA 5FPBA 1LULA 1UN1A 4C1WA 4PHZA 5F37A 2VZVA 4RFRB 3WDWA 3PVOA 2RS53 2OPWA 4CDQC 1Y4WA 3ACGA 4HN1A 4KMQA 4AFMA 2ZGUA 3CO2A 4W6XA 2AR6A 2DDUA 3ZOIA 4Q4X2 5FQ0A 1TME3 2BGCA 1OXCA 2PYTA 3MPBA 4HONA 3UV9A 1RJ7A 4Y4RA 4AQSA 4BQ2A 2R043 2XBO3 2WZPP 4Y1YA 4CDQA 3D5OA 1LGCA 3NV3A 5GKAC 5FP7A 4EQVA 4S2GA 1HRI1 1RUH2 4P9XA 1HQNA 4CEYC 1YC61 4S2HA 3WP5A 3I7DA 1YFUA 2CL2A 2RDNA 2CGNA 3ALQA 1UZWA 3AMQA 3NV2A 2LALA 4LK7A 4XF4A 4DY5A 1CD3G 4R52A 3WCSA 4EZHA 2P3KA 5EWSA 2JG9C 2VE1A 3ABZA 5JOWA 5HCAA 3GALA 3KVAA 5FLHA 3H8XA 2A3WA 4CEYA 1UPSA 1H6XA 2YDEA 2DBNA 3HJRA 4LTAA 4DRVA 2VZ3A 3WP4A 3GHNA 3ZO0B 3K3NA 3ZN6A 5FLJA 2JG9A 3T0DA 5HCHA 3POFA 4WVMB 1AL23 5I0SA 4P9LA 4Q4W2 5IVBA 1RUD3 2VNRA 1OBNA 3J7HA 3R4SA 3GJBA 3OBRA 4CP2A 4PF5A 1MEC2 1NKGA 4LBQB 4D94A 3ZR6A 4UW3A 4OI2A 2RS33 4XAEA 3LEMA 4LKEA 4XUPA 2BZDA 4MG2A 1Y9GA 1O4ZA 1YYNA 2GMEA 2FMDA 3P6BA 1D7PM 2XBO2 1ZBA2 1F9KA 4F3JA 1Q3EA 2J7MA 2RJ2A 3SH5A 3WQ7A 1AX1A 2GNTA 3S0MA 3IWZA 3OCPA 4H2AA 5GLUA 2Q1FA 2B4KA 1Q56A 5F5QA 2D6LX 4XZPA 5HPOA 1YNAA 4LA3A 4YVWC 4PIYA 3FBYA 1ENQA 5FXWA 2D98A 1WW4A 2R30A 4YRDA 2FCUA 1TG7A 1CX1A 3HVDA 2KD7A 2VZTA 4BIFA 4LE3A 4Y26A 2VW2A 1G9AA 1GICA 3IAQA 4YVWA 1JXNA 2L9LA 4LE4A 3AMHA 4K21A 4NHMA 4K20A 1SLTA 3O5SA 4FPJA 3RZHA 5FZ8A 1AR63 1RUD2 4AAPA 4Z2AA 4NHKA 1GWKA 1UL9A 2EALA 4XHBA 1GQPA 4HFSA 1RMU1 3Q8FA 3OG2A 5AC92 2WZEA 3A7QA 4CDWC 4P9JA 4CRQA 1JU4A 2I45A 1LHNA 2XQXA 4FPHA 1W0OA 1AYM1 1ZX5A 2D7FA 1HB2A 2DTYA 4IEPA 3VD7A 1QMJA 2R073 4EWEA 1TMF3 4AGVA 1DCSA 1W39A 4CDWA 3ROUA 3AM2A 3RZZA 1SFYA 4XEZA 5JLVA 3MIDA 3OJBA 4TXWA 3LGRA 4ATEA 1UAIA 5FYMA 4DEQA 1VBE3 2UWAA 2BU9A 2FDIA 2WO1A 1C8M1 2V4VA 4A7KA 5HCFA 2Z79A 2JKBA 5BXXA 4E2QA 1BK0A 2VULA 5HXMA 5JSRA 1O5UA 1UU4A 4K6BA 3SCGA 1PK6B 2NQYA 4XOGA 4XILA 1SZBA 3P3NA 4JDNA 3VN4A 2HWD2 2A5ZA 1D0HA 3PVEA 3RVHA 3PUSA 3RYRA 2EXIA 3AL6A 4AG4A 3NMBA 4ZKTB 3M3OA 1G6NA 2ZGKA 1K3IA 3J8F2 4N43C 4NIDA 1RVF1 3ZXEA 3OTFA 2HWE1 4P9WA 1A78A 2CAVA 2PQSA 1WW6A 3R6SA 4IV3C 3AKRA 5GLZA 2YGLA 3OBTA 5CAZA 4N43A 4P08A 3FUQA 1V9U3 1JHJA 1OF4A 2VOVA 3RJ2X 5J96B 1FOD3 2QZ3A 3W20A 4B4PA 4IV3A 4D6SA 3VL8A 4SLIA 3U4XA 3VZOA 1ASJ3 1OFSA 1AR73 1LU2A 5IWFA 5A33A 1K12A 1VAVA 1H4HA 3KHBA 5FBJA 5M0TA 3NNGA 1Q5OA 3SEPA 3ZFEC 2VECA 4HN0A 3OGJA 3I2IA 3EQEA 3LE0A 4FPLA 1GZWB 3WZ1A 2Y64A 2DCYA 1W04A 1H1IA 2YZ4A 3HR9A 2RDQA 3ZFEA 1RIRA 4QMAA 1AUYA 3H9AA 3U4SA 1O8SA 1POQA 5LASA 3I8TA 1W6MB 4N53C 2Y6LA 2RVAA 3HT1A 4MSVA 1HJFA 4GKXA 3KS7A 4AHXA 5IK4A 2DV9A 3W59A 4W50A 1AYN3 2IWGB 4KQ7A 3ZXJA 3RS6A 1D4M1 4CP1A 2OKXA 5J37A 5FDBA 4N53A 3VD4A 1R081 4HSJA 5E89A 3ACHA 4IEWA 4AI1A 1DZRA 4XETA 2OQ6A 3UKTA 1YXWA 2JD9A 1L3JA 1VMHA 4XHXA 1SLAA 3MW3A 2PHFA 5A7OA 1BBT1 1SLLA 3MDPA 3ZXDA 2YFUA 1S0JA 2BOJA 1NY71 4FPYA 1ZNPA 1O91A 1AR72 3FLTA 2HWF2 2XWBB 5LRSA 2VPVA 1NA1B 4QPIC 3IDBB 2WC2A 4OHZA 4OUMA 2VQTA 4NE9A 3WF4A 1DQ4A 3WG3A 4QXBA 5ANNA 4WM7B 1WCKA 4QT6A 3PJYA 4LO7A 5FUIA 3DV8A 2EF6A 5ISLA 2ZEZA 4FT8A 4CP9A 4GH4C 4NRMA 3MLKA 1W6PB 2DTWA 1HDKA 1ULEA 1Z0HA 4QPIA 2W2IA 1HXS3 5FXVA 2O8OA 3AZVA 3WR0A 3T4VA 3IMMA 4MHRA 2BWAA 1IPJA 2GALA 1RUF3 1PM7A 4OULA 5JCTA 1UO9A 2Q0AA 4GH4A 4YVSB 2DBIA 1KXGA 4K40A 2X05A 3I2FA 4CCKA 2OQ7A 3H3LA 1JODA 1CIYA 1PGW1 3M8LA 4MLOA 1AJOA 4QQOA 4NAOA 4I0AA 4W8JA 2J1VA 2JKXA 4ARXA 1VRH3 4DB5A 2E53A 2HWE2 5CG8A 2RS12 3VDBA 3H8OA 2EAAA 4BU2A 1RUNA 1IG3A 5E16A 4YZ2A 3I2DA 2ARBA 1WLDA 4I30A 3BU7A 3HBKA 3POBA 1GOHA 4XIOA 3SMHA 1NXD1 4OCTA 1I1EA 1ZM1A 2D3PA 1UX6A 3GZEA 4UFLA 3GCWA 2DVAA 1VBD1 4OI4A 4FP3A 1XRUA 2BERA 4Q0SA 2WKKA 3EXUA 4BOWA 5BNNC 2HEWF 2RMU3 1R1A1 5FZCA 1UOGA 5FMBA 2FDKA 3MV01 3KGLA 2A3XA 1HXS2 4WVZA 1QQP3 4DS0A 3VB9A 2Q4SA 5BNNA 2JDPA 3ES1A 2C24A 3T4HB 2XG3A 2WT2A 3RYKA 1D4VB 1BCXA 1X33A 3TYJA 2BPA2 4UFJA 5DAWA 2E32A 2PELA 4NHXA 3U37A 1C8NA 3KV5A 1ZZ6A 5A7WA 4JRLA 1AX2A 4XC9A 4GB31 1VBC2 3NWKA 3T30A 2PHRA 3AP9A 3PVBB 1EV11 3VZJA 1CGPA 4MGZE 3AXDA 3V0AB 1VRH2 2ZGNA 2JECA 3GXUA 1W9TA 5AFEA 2Z42A 1XE7A 1PMJX 3APBA 3VZMA 5IYYA 3DGTA 4UW6A 3BTXA 2X5IC 1CAUA 1BBT2 3EYPA 2VBDA 3OBZA 1C1FA 2WFF3 3R4UA 4PQQA 4AI2A 1Y3TA 1V00A 2OUHA 5FZMA 3NQHA 3CL1A 2E9QA 2D5HA 4AQ6A 4XAAA 1M4WA 1G9BA 3NSTA 2X5IA 1IZ3A 3SC7X 1RUJ2 3ZKYA 1UYZA 2TBVA 2ZGLA 4Q1PA 2BV4A 2YC2A 1H1MA 3NAPB 2QKDA 1VBB3 1PHMA 1IOAA 1OQDA 1AR83 3MPPG 5FZ4A 1RUI2 4LJHA 4N7IA 3M70A 5FYCA 4K8RB 2XVKA 3JD73 4GMP1 1NE6A 3U14A 2MHFA 5EHDA 4IDZA 3WNXA 1BEV1 3LEIA 1B09A 4CEWB 4C8DA 4E2GA 1IPKA 1ST8A 2DWRA 4JTNA 1ZRDA 1PVXA 4L0PA 2G9GA 4IGOA 2GNDA 4YLZA 1SQ4A 5EJZB 1PVC2 3LPFA 5A3UA 1ZBE1 2ZHKA 4IE6A 3KMHA 4XBLA 3K4ZA 3RZLA 4O9GA 4YGEA 5D8AB 1FMD1 3VZLA 3DXUA 2QCSB 1HRV1 3H1MA 3ON7A 3L9JT 4LQRA 3LKJA 1XQNA 5JPMB 2EXKA 1GQGA 4Y5Z0 1H9PA 1DG6A 1QXRA 1PMHX 1YWKA 2ZA9A 1O3TA 1GNHA 5FZKA 5A3MA 1W8UA 1WBFA 4AOCA 1VBB2 2TEPA 3WF1A 4MVTA 1R1A2 2XL7A 3OYWA 2BEOA 1AR82 1NLSA 4J6GA 2R1DA 1JYNA 4FOYA 3JD72 2RR12 5FYBA 1QIQA 3GM8A 1I9RA 3WQBA 2R1BA 4KWLA 4AI3A 4OQ8A 2PAMA 2GC0A 4NPRA 4XW3A 2JG8B 4FOQA 1W05A 1KDKA 1UOJA 3JBG1 3MI8A 1PZ9A 1O59A 4FPFA 3WUDA 1OOPC 2V4AA 1LHOA 3POJA 3QD6A 4ES9A 1DGWX 1W9WA 5DZEA 1UKGA 2W91A 3THDA 3TRSB 3G7DA 1UU6A 2VY0A 3T2PA 4E27A 5K0UB 2JD4A 1PGSA 4KH9A 1WD3A 1OOPA 2ET7A 2LW8A 1OUSA 5IAVA 5A6ZA 1LAJA 1W6QA 2KA3A 5FYHA 3ES4A 4JGZB 2ZX3A 4IEUA 4DNYA 1W0NA 3BU0A 1J58A 1AXKA 4AFDA 5HCBA 4XBQA 3FBMA 2F4PA 3LAGA 5FFOC 1W28A 5DDJ3 2OYZA 2RDSA 4AFBA 2E7TA 2QDNA 3J7MA 1ZRRA 3SEEA 3QH7A 1LJ7A 3AP4A 3H3ZA 4B29A 4D3WA 1YJLA 5HV4A 4OHWA 3FJSA 1N1YA 2HEYF 4XIKA 3VD3A 1LECA 2DU0A 3WG2A 1G9DA 3WDVA 3DF0A 1SHWB 2FQPA 2VZPA 4GWJA 4QHOA 1Q43A 5BV6A 2P6CA 1PO11 2W0XA 2JE9A 2VMHA 3MLLA 1FXZA 1UCXA 2VTFA 3N9MA 1F5FA 1KDMA 1R093 2XL9A 5CA6A 5FWJA 4XVHA 3IAPA 4CCOA 1WW5A 3H3UA 2P3YA 4KG8A 4YZ1A 4CCMA 3FZ3A 4INDA 4LNVA 3LB9A 3WF2A 2BQPA 3HMYA 4A6SA 1FMD2 2ORXA 3S6PA 3WNKA 1CAWA 5C7GA 1NCRB 3BALA 1W8OA 3IN9A 3VKNA 5JAXA 2HWC1 2JDAA 4NROA 1NUKA 3Q9OA 3BKZA 2DF7A 3A4UA 3OGGA 4RQPB 3E5XA 4XZUG 2ZOEB 4WZFA 5JMOA 3CBNA 3K77A 2P5BA 5C8WA 4DXZA 2Y8KA 4OUSA 3J26N 2QDRA 3VBOB 1VB4A 4Q1RA 1WMDA 2NMOA 2JDYA 3I3BA 2QQMA 1HB4A 5LY2A 3RI9A 2G19A 4XF3A 1WCDJ 2J1RA 3AC0A 2HWB1 1YI7A 5TSWA 4O9EA 4IE4A 4YG3A 4QXKA 1J3QA 2Z69A 4HLTA 1AR93 2DCTA 3VHOA 1EAH2 1JOJA 2XJUA 3WG4A 1E5IA 3VHNA 3DYMA 2YU1A 3WNPA 3JBG2 2BFUL 4M3CB 1TE1B 4BK4A 3UL2A 2DCJA 2BOIA 2WSUA 4QB6A 5JDBA 1HLCA 4ZS3A 3UK9A 5FJKA 5IFTA 1SBEA 4OVEA 2BVVA 5FLIA 4B4QA 3WW1A 1S0IA 5T5JA 3V0BB 2F17A 3MUY1 3O1OA 3J4UH 1W6OA 1JZ6A 4RR3B 1MQTC 1RUG1 4WV8A 5CEHA 3QH6A 1QJX1 2HLEA 2PLV3 4K7JA 3N9LA 4ZS2A 5KBFA 4AEDC 1ZRCA 5FZOB 5L7OC 1B35C 1D2QA 3MF6A 1IS4A 5IVCA 3PTYA 4QPGB 4D0QA 1LB2A 3VBUB 2WT0A 4HK9A 4X8NA 4BWOA 3J9SA 3WOGA 1MQTA 1ENSA 2JDMA 4PI0A 1XNBA 2O14A 1RYYA 1VP6A 2W9XA 5A6XA 2YPJA 1KFXL 2ZPXA 5SV5A 1LRHA 4HETA 1UY0A 1LOAA 1B35A 3MLJA 4QX5A 3TB0A 1V70A 4AEDA 5L7OA 3TN91 5KHKA 3J7NA 2OVUA 2F6BA 2CDPA 1XC6A 2H0BA 4YZ3A 3LA7A 3POIA 4YARA 5ABJA 2W1SA 1PZ8A 1O3SA 4JDOA 1JZ7A 3W21A 3NO8A 2A7AA 3UGHA 2RM22 1NE4A 3VD5A 5FYTA 2VUDA 5K9YA 4AFCA 1V6JA 5BNOB 2BFUS 3QBQA 1QJY2 1W0PA 1YHFA 3CHXA 1H2MA 5DN2A 1S4CA 3AYEA 2ZBJA 2A3YA 4CTEA 5LY1A 4K3UA 3ZFFB 2QQNA 3WNNA 4V2WA 2WZR1 1RHI1 1IS5A 3GHMA 4NRPA 4TSVA 3I3MA 4UF0B 4RHV3 3MFAA 4NN0A 4DUXA 1SDDB 4ISQA 1K5MB 2R063 5FYVA 5GZDA 1ZA7A 3P3PA 3UT0A 2DU1A 3MF9A 4G4FA 4A2UA 4YPJA 2MEV2 2DUOA 3LIGA 1SACA 1A8MA 4IEZA 3IB3A 2QNKA 1QDCA 4CUGA 1CPNA 1RUE2 5KR7A 1JI6A 2ORZA 5KXEA 2XB6C 4CCCA 4FQ4A 4Z07A 3I54A 3KB5A 1POV3 4G9SB 1CPMA 2QQLA 1GV9A 3N7LA 1FPN2 3H0OA 1G86A 2VQUA 1LOCA 3RWNA 2BUKA 2C6SA 1NG0A 2YY1A 4AHWA 4WVMA 1QEXA 3ZYIB 1HJGA 1G7YA 3KT4A 4TLGA 1MZ5A 4J1XA 3RQ0A 4IL7A 4LBQA 4LXLA 4UOJA 2DVGA 1H8TB 1EYBA 5B4NA 4NJ4A 2XVGA 2EXHA 1N3PA 3KM5A 4RGAA 4QKBA 4QB2A 5GZFA 4KWKA 2D5FA 4B8EA 1ND3B 2XGXA 4KNCA 4RHV2 2PAEA 2WA4A 4K1YA 2ZX1A 4Q4X3 4AGRA 2ZEXA 4LBMA 1OQ1A 1N1TA 4A42A 2WN3A 3TNPB 4YZ5A 1W9FA 2RS51 2VGDA 1RUH3 3NJXA 2D6OX 5GLWA 5B4XA 3I2OA 2VMGA 4XJ9A 1VBA2 4XJZA 2B9UA 5EZWA 2VU9A 5FUNA 4YFZA 4BZ4A 5FZAA 2R041 4HKLA 4YM0A 3B9CA 5C5UA 2BWCA 1S0GA 4HKWA 1X9TA 2ZGMA 1MS4A 3PNAA 4NMIA 4FPCA 3UGGA 4FOVA 3O7OA 4KU8A 1UPIA 1UZZA 1BLZA 2G9ZA 4QGNA 1A8DA 4QKDA 3NJYA 3ZN4A 3JQXA 2ES3A 2XJQA 3KGZA 3M3QA 3C7OA 3OY8B 4Q4W3 4CDUB 4CPBA 3RNSA 1XE0A 3HNMA 4BH9A 1LHUA 1AHSA 4Q4Y2 3ZKUA 4ES8A 4GIQA 4FO9A 5C5TA 1MEC3 3RG0A 1BHGA 4D7SA 1FNYA 2QQVA 5F6KA 3S30A 2RV9A 4CEWA 1HQWA 5KWRA 1AL0G 4IEVA 1GP5A 2LS6A 1HKDA 3CJIB 3PL0A 2WQZC 4FVVA 4KU7A 3VBFB 3LFIA 5C8CB 2XR4A 4TN7A 4WBBA 4H7LA 2QQWA 4GULA 2IXJA 2VVEA 1COV3 3Q8BA 1ZBA3 4QDRA 2WN2A 1QJFA 4BCUA 2A6XA 5JIAA 1PK6C 1QXJA 2C1FA 1GQHA 1JOPA 2V09A 5KHHA 2YBSA 3IPVB 4I02A 3GZAA 4Y33A 2LTNA 4FFGA 2QBXA 4AEMA 5CU1A 2I07B 1RITA 1PK6A 3M3EA 2C0ZA 1WBLA 4J1WA 4UFKA 3U75A 2O1QA 4CUAA 3RWKX 4CUCA 3ZYJB 3PVNA 4ZU5A 4Q4V2 2VNOA 4ASLA 5BUVA 2D6NA 1DU3D 1YFXA 1ULDA 1VMJA 1TVGA 4DUVA 5IAXA 1LODA 1MVQA 4XXPA 5HV0A 2ADDA 4CU9A 2FD8A 2CAUA 2WA3A 3H8UA 1U12A 3LDBA 2WQ4A 3U11A 3USSA 1HX6A 1VJ2A 2VZQA 3HEIA 3CU7A 5DG1A 3B3QE 4ZXKA 4BQ1A 2IFRA 5AC93 1H2NA 4XFBA 3E6DA 5FPUA 3ASIA 2BBVA 2QQJA 3UJQA 2ZMNA 3AP7A 3E97A 2P2KA 1F4AA 1ONAA 1LKNA 3CMGA 4AYUA 4BISA 3O1SA 3ZYRA 1AR61 4I09A 1COV2 1NZCA 4YYOA 2O8QA 2PN5A 3KLSA 4A7YA 5F2SA 5L9BA 1BZWA 3DKQA 1WMEA 3OUHA 1RJ8A 1V6NA 3P1IA 2R6QA 1GZWA 4QU1A 2E7QA 3N35A 3AKPA 4WM8B 3B01A 1CIWA 5LA0A 1JW6A 1ZA4A 4Z92B 3KT7A 2R071 4XFHA 1DGLA 1TMF1 2VBBA 2FZ2A 1WUVA 1XPWA 2XJSA 2IVJA 2ZMKA 3PUQA 3WXPA 3RZJA 2Z5WA 1W6MA 3ORJA 1KD7A 4XUTA 2GP3A 3K46A 5EJ3A 1RUC1 4YW7A 4F7ZA 2WZ8A 3D0JA 2HWD3 4CUBA 2KR2A 2Y34A 3NV1A 4JHZA 1VBE1 4OQ9A 4DEVA 4DOUA 5CIRA 3ZN5A 3VKOA 2ZX4A 2ZGQA 1ZREA 1C4RA 2P34A 3J8F3 3PU8A 4DO0A 3LOBA 1QJU2 4N90A 4YNIA 1PO22 2VW0A 2VOKA 5JZGB 2P17A 5F5CA 1C28A 2VMDA 5ACA2 2W39A 4ISRA 4RGGA 1SCRA 3POGA 2VZUA 3NJZA 1NA1C 4QX7A 4FI9A 1N1SA 3NNJA 4WM7C 3LEKA 2UU8A 4QM8A 4G3YC 4I0WB 3UJOA 3C2UA 1W9SA 4UI9L 2NZ9A 3CKHA 1OVSA 2YYOA 1ZZBA 4HKOA 4LHLA 4O7XA 2VM9A 1NA1A 4FXGB 4OZOA 5L9VA 4JGYB 3FHIB 4COZA 1MPXA 4WM7A 2R7EB 2WO7A 4RS5B 1F2NA 1V9U1 1OLRA 4MOAA 1FOD1 4PF1A 4HANA 3HN3A 4Q0PA 5FZ9A 1GR3A 1HRI2 1W6PA 4YVSC 2HYXA 1ASJ1 1N3OA 3A21A 1VPHA 4R8HA 4XDOA 5DABA 2VD7A 4N9HA 3OPZA 4AVVA 5K7PA 2B46X 1WZXA 2LROA 2XH6A 4XJ8A 3RGBA 2JXAA 3DYPA 1XNKA 4YVSA 1GFF2 3VGIA 4AF9A 3DN7A 5I93A 4TZDA 3HQRA 2ZTNA 5G05L 4YW2A 4CDQB 3NV4A 1H2KA 1KEXA 2BGPA 4Y4YA 1JZ4A 5A7SA 1I5PA 2DYCA 3KD4A 3T1LA 3VBRB 2JX9A 4BQXA 5ANQA 5I0DA 3ZFGB 2QQUA 1NYWA 4XF0A 5J36A 5IK5A 1W8FA 4QHZA 4MGKE 1BVP1 1AYN1 1EUTA 2GZWA 2XHKA 3ETQA 3HNYM 5LBFA 1H8VA 1W2NA 1SDWA 2GMMA 4IETA 1NQDA 1ULOA 5T3NA 5CISA 4LPLA 2GAUA 2HWF3 4NWVA 1V6OA 4JCKA 2ZGOA 1AYM3 1S2KA 1DFQA 2UWBA 2GU9A 2HEVF 4I3GA 1UZYA 2ZHLA 4IESA 3BTAA 4PJYA 2OS2A 5I8SA 3IDCB 3RZKA 2BNOA 3BOWA 5JR7B 5EYXA 4AE2A 3ZM8A 1Q8SA 2GC3A 3PTRB 2Y6JA 1AJKA 3DCQA 2BJSA 5F6LB 5BNPB 3CIHA 2WO2A 3VLBB 2FDHA 1C8M3 1CJDA 1QOOA 3PUHA 2WS91 2J42A 3C7FA 4P9IA 1DQ6A 1XE8A 2YFZA 1GYKA 1O8PA 2VCBA 3ILNA 4LMFA 3AKTA 3S5AA 3ATGA 3B7MA 3MGUA 5FMDA 5KHGA 1RUC2 2FDGA 3KCXA 2XVLA 4AR2A 2AZ5A 1PZ7A 1XNTA 1Z7S1 3V0AA 2ILMA 4HL0A 2WQ8A 3KVBA 3ZPYA 3RSJA 1MR5A 1ODNA 4Z82A 3HQUA 1RUF1 1X8MA 2BRTA 2HWE3 3MIGA 5FYIA 5FZEA 2RS13 5J98B 3VD9A 3O0XA 1RMU2 3ZR5A 3WP3A 3O12A 4DQAA 2BW8A 1XOYA 2E31A 3JB4C 2FHRA 2SBAA 5A32B 3SH3A 3ZDVA 2VNVA 4TYSA 3VDCA 2WYSA 3QLQA 4UFHA 1AYM2 4WVVA 4FAHA 3N9NA 3W5MA 3NAPC 3I3DA 1LOGA 5LW9A 1S0DA 3LCPA 4XFFA 5DUXA 4OUEA 2NN8A 1BQPA 2ZX0A 1WKYA 2X29A 3AB0A 3NAPA 3OGVA 2Z2SB 4LBOA 5IHRA 5I91A 1W90A 4QX2A 2JE7A 1C8M2 1U5YA 4FPGA 4JV4A 4PQ9A 4CEWC 5L19A 5FY4A 1HV1A 3DKWA 4KI5M 4COWA 2OXBA 3RRDA 1LTEA 1WA6X 2RMU1 2HJIA 3EBRA 4B1LA 5FR3A 2WNUB 3W9AA 1AZDA 4CU7A 5CYYA 1V6KA 2UYBA 5D2AA 1LOEA 3FFZA 1MS3A 2EAKA 3MW2A 4FP2A 1GNZA 1O4TA 4Q2FA 4MUVA 4RL7A 4ZONA 5I0RA 3RMYA 1VBC3 4GD4A 4Z8BA 1QQP1 3MIHA 4IEQA 3VL9A 4MZUA 3WQ1A 1RVF2 5FZBA 3AKSA 4E9KA 4F83A 5D8AA 2WBKA 4RD7A 2BTVC 4FBFA 5LZ6A 4MGTA 1UMIA 2A73B 3WG1A 3ZYFA 2J1EA 3TEXA 5D8AC 4URTA 1BBT3 2ZKLA 4ONUA 4FFHA 3U78A 4ZHNA 2GH2A 3I59B 4XURA 3RMXA 3NJVA 2OW4A 4M01A 3DPRB 1VB2A 4BMBA 5C3PA 2Z4FA 3AL5A 4GJYA 2TUNA 2V73A 4M3CE 4QX3A 1RUJ3 1X82A 4LITA 2GN3A 3GBFA 4XPVA 3ZYHA 5A70A 1NAEA 2NYYA 4QX1A 2BVBA 4R4ZA 2JG8C 2W08A 2W52A 2V72A 1RUI3 1N3QA 1PIV1 2JEMA 4NIIA 1HN0A 3N3HA 5A6YA 2WS92 1G8WA 1GWLA 2JG8A 3JU9A 4NR1A 1YRZA 1RC6A 3D8CA 5FPLA 4L92A 5K0UC 2PMWB 4Q26A 1OT5A 1D4M2 4YWAA 5A3NA 1J59A 3FFQA 4OLLA 2QZ2A 4W6WA 1R082 1LEDA 3SHRA 1O3QA 1PVC3 1Z7S2 4JGZC 4ZPIA 4LUMA 1FV2A 1NLQA 1STMA 5K0UA 3MZHA 3LD8A 1JN2P 1NY72 2XLAA 4QKNA 4QDQA 5IVVA 4JGZA 4P02B 4Y3OA 2OUJA 3AMNA 2HYKA 3POSA 1G9FA 1JYIA 5KHIA 1MS5A 1XYNA 3FE5A 2VCCA 2VUCA 1CR7A 1XJAA 3TNQA 2JIGA 1W8ZA 1P8JA 1GP4A 1OLME 3H1WA 1OPOA 4QAWA 1OKQA 1CQ9A 3KHCA 4LHKA 4IW3A 2RJLA 1FATA 1NCQB 1R1A3 4Q8LA 5LB6A 3VKLA 4KWJA 5KXDA 5EPAA 4UXAA 2R16A 4YM1A 1XXNA 4Y1VA 4N9IA 2RR13 4DMIA 1KQRA 2QE3A 2VTXA 3POEA 4NHLA 2PHDA 3O14A 1PGL1 2X8KA 1IQDC 2QJVA 2WL1A 5LRRA 1PM4A 3CEWA 3AP5A 2D93A 1PGW2 1H2LA 4R9CA 1LCLA 1GWMA 2V5YA 1NCRC 3ACFA 3R4DB 1N1VA 1SFNA 3VZNA 4HSLA 1R1ZA 1BK1A 5DUUA 5FUPA 4MGSA 2AEYA 5AVAA 3B94A 1EUUA 4QX0A 1H30A 3U07A 5L73A 1UD1A 4MADA 1QOTA 2W87A 4OYUA 4RQPC 1HV0A 4XDPA 5FZ7A 1NCRA 4QQLA 4LBKA 3NW4A 4CXWA 2W5FA 2YMZA 4ASKA 4QB1A 4MXVA 3FHQA 5IJRA 3VBOC 2GNMA 1VBD2 5F5IA 4DY3A 4U36A 1OMIA 3EMRA 3CLPA 4RQPA 3NRUA 4DXTA 1OSGA 2EIBA 1V6IA 2EVXA 1MS9A 3JZVA 2ZJCA 4AQTA 1OH3A 2J1AA 4HPKB 3VBOA 5F1RA 3GBWA 3C3VA 2YUEA 5D21A 3UGFA 2VW1A 3GGLA 4FQZA 4LIUA 3URFA 3D82A 4RYDA 1PIV2 5DDJ1 1AVBA 1OD3A 3DL3A 1XU2A 5IW0A 2VQAA 3ETPA 3SITA 4EZ4A 5CKMA 3H50A 5FZ0A 1IKQA 4GB32 5FOBB 3LDRA 3LQCA 4Q27A 2Q8CA 1EV12 1NX9A 3PJQA 4M3CA 4XTPA 5I0UA 3VV1A 3CQOA 4ORFA 4A44A 1LOBA 3ACLA 4RR3C 2RJKA 5FCCA 3SQOA 3BIEA 3BPZA 4META 3I3EA 3IKWA 3WDXA 3WW4A 3JQWA 2W1QA 3VDDB 3FC0A 2B5HA 1FMD3 4XFGA 4GMP0 3UESA 1JZ5A 4M0HA 4QPGC 1HRV3 3VBUC 3V0BA 1YQ5A 4A7ZA 1XBFA 3NKGA 4RR3A 3EHKA 2B9VA 2WR9A 3AJYA 2CGPA 3PUIA 5FZOA 2JB8A 3ZSJA 2AUYA 5C3RA 5LK7B 4QPGA 5F3GA 3VBUA 3OPTA 4UW4A 2P3IA 1YJKA 2RDRA 3JXSA 1TZOA 4JDMA 2Y0IA 2JENA 4LO5B 5H9QA 4E4DX 1D0GA 1QH6A 4LKDA 4UWDA 3ZSLA 2ZEWA 5T5LA 5JI9A 1JYCA 2CYFA 3OPWA 4QPYA 1IGOA 1GP6A 1FNZA 3LSEA 4YFWA 5BNOC 3USUB 4FCAA 5DAVA 4P9GA 2QQPA 3I4IA 1BEV2 4GA9A 5A1FA 2ZKNA 5CFCC 2FCVA 1EAH3 4L97A 2AGSA 1J1LA 3QOPA 4NHYA 5GALA 1OLMA 3JBG3 5E6HA 4LLOA 4MGQA 4BQ3A 1W9YA 1UMZA 4YZ4A 5BNOA 5A3OA 3ZFFC 1S1AA 1WGPA 4QXCA 1ZBE2 1UOFA 2WNVB 4K9SA 5CFCA 5T55A 4A3XA 4LBJA 1CAVB 4QQ2A 1QNYA 2QUOA 1N47A 1AR91 1HRV2 1KS5A 4P5HA 2ARAA 3M7AA 2OZ6A 2Y38A 3IDEA 1K5MC 4BHPA 4BYYA 4QU2A 5FK8A 4FFFA 3ZFFA 4EWDA 5FXXA 5FAXA 5FYUA 3F2ZA 2RHPA 2ZGSA 2B42B 5FREA 4XFIA 4I01A 5JSPA 2MNGA 1S0BA 4UF0A 2PA7A 4AK3A 3MIEA 2EXJA 1K5MA 1YCIA 4NOTA 1ND2B 1WD4A 2IXHA 4S2FA 1UOBA 3ZXKA 3ZYPA 5T5OA 3KQ4B 4BA6A 1UQXA 1OHFA 2PLV1 3ITQA 3BUCA 1JU3A 5J3UA 4COYA 3IT8A 4D69A 1J3PA 4CZSA 2NPIA 1WWYA 1GMMA 2A70A 2CWMA 5CFDB 1S55A 1FX5A 1ZZ9A 1K5JA 3CJXA 1GOGA 4LBQD 3DUIA 1OA4A 1H8TC 3G6JB 3BTZA 2RM23 3LFMA 4LBLA 3Q8EA 4PDWB 4CXXA 1OI6A 4TTGA 2GMPA 1VMFA 3GBGA 3T2QA 3ECQA 3BODA 4Q5OA 5JUVA 1ND3C 4C1XA 1QJY3 1O4YA 1AX0A 1QJEA 1BMV1 1OVPA 3K51A 3TEWA 1H8TA 5LCWL 1WMXA 4MV2A 4XF1A 5DQ0A 5FRAA 1ND3A 2PHXA 2ZGPA 5G04L 3CZUA 5FOJB 4CDXB 4AVAA 1ULCA 3MEPA 1MZ6A 3UETA 5K8SA 4ARYA 2E26A 1QKQA 4OMCA 3UYJA 3KQRA 3SNMA 4H14A 5LBEA 3TEZA 3ZMNA 1UZ0A 5EXOA 5ABJC 3X29B 3O1MA 4PIZA 2TNFA 3TAYA 2WYFA 2MEV3 3FN9A 5FY0A 2ZS6B 1W8WA 4IE7A 4BLIA 2UYAA 2A6YA 1Y9MA 2J1TA 4HZFA 1UYYA 1IPSA 1RUE3 1QF3A 1KFUL 1JZ8A 3BVCA 4UFIA 2IXLA 4NIGA 3MW4A 4CDUC 2GP5A 3FLPA 4J25A 4CPBD 3N4MA 2DURA 4A45A 1AF9A 3AXEA 1FPN3 1PO12 4AZZA 1D2SA 4RN5A 5DAPA 2XLGA 2XUEA 2YGMA 1X9PA 4HT1T 3MV11 3AZWA 4YW6A 5GZGA 3VBFC 3LA3A 3CJIC 5C8CC 5T54A 4CDUA 1PX3A 1S2BA 3OY8A 2GC2A 3CNAA 2H0VA 3GZTB 3HQXA 2VUAA 4GQ7A 1POV1 1JOBA 4JRAA 4I2OA 1SPPB 1C3HA 4EV0A 3VBFA 1MS1A 2B8MA 3CJIA 5DAQA 5C8CA 1KS4A 2VL4A 3AVSA 4AEKA 5C4WB 2HWC2 4IV1B 2XMLA 3BB6A 1QJX3 2NMNA 2VVFA 4PIXA 1VALA 3M4FA 2VOWA 3IPVA 5CKQA 1LESA 4L9BA 5FXZA 5JR2A 1EY2A 3B9IA 3E5QA 1RGSA 3LDKA 2YBPA 1PNGA 3BN6A 1OD5A 5F3EA 1YUDA 4YGDA 1VBA3 1QU0A 1JTZX 3I2KA 1UNBA 1XB9A 3KCCA 3OOXA 1WMFA 2HWB2 1F35A 2JDNA 3AFGA 3NNLA 3HD8B 1WA4A 5FPVA 5FZLA 3TN93 4H7MA 4TWTA 5BNQA 3SH4A 2DUQA 1RUH1 2C5DA 2JICA 3PIGA 4XQDA 2NP0A 4OFGA 1NT0A 2VOXA 3GJAA 2EIEA 3WINE 3ZPOA 3KV6A 4E8CA 5CNAA 1K42A 1ZZ7A 2JDZA 1JYTA 5A1AA 1MS0A 4YW4A 4EYUA 1W3VA 1VR3A 2C4XA 1YQCA 4Q4Y3 1UWWA 1L7RA 5CVRA 4XMIA 5HXVA 4OHXA 3WNOA 2KXLA 3KF5A 3Q8CA 3FWEA 4MXWB 5L9RA 3KT1A 4WM8C 3ST7A 3AFKA 3OGRA 1RUG2 2CY6A 1QJX2 4Q4W1 1O7FA 2YG0A 3KSCA 1L7LA 1JUIA 5FZFA 1MEC1 4WM8A 1BXHA 1C5HA 4HG6B 4UT5A 1SCSA 4XJAA 2Q30A 1WLWA 1TME1 1JYWA 1UIKA 2XBO1 1YFYA 1ZBA1 3TN92 4EE2A 4FXKB 3L2YA 4GXLA 5F8PA 4E8DA 5JZGC 1W8TA 1I5ZA 3WHTA 3K75B 4Q4V3 5DAXA 5CB7A 4Q0QA 2J1UA 3THPA 1UMHA 1UY3A 1SEFA 4Y22B 4B3NA 5E88A 3WQ0A 1UX7A 2PHTA 5JZGA 1W2TA 1QY4A 3C8XA 1OH4A 4OHVA 3LIHA 4XACA 1JYXA 3S5QA 3WT3A 4BIOA 1OQEA 1XSQA 2VMFA 4BM8A 5LBCA 3A23A 3ZIXA 5LA9A 4ZZ5A 1VE0A 3T1MA 1QGLA 4JGYC 1X8EA 1K45A 1QJZA 1PNFA 2BNNA 5LATA 4RS5C 2VZ1A 1UY4A 3FHAA 4AW7A 4ZZ8A 3OD0A 1AL21 5FP9A 1XYPA 1RUD1 4CSWA 3R0RA 1GSLA 1OF3A 1RHI2 2WZR2 2OZJA 1A6CA 2R49A 4JGYA 5EFUA 1DLLA 3EB7A 5JI7A 1W8NA 4RS5A 3VBHB 5C70A 4UYBA 2RS31 2PHLA 1E5SA 2K2SA 4XBNA 1OLQA 2EIDA 5IVJA 1NLRA 2Q5TA 1CAXB 4P00B 3V56A 4W4ZA 4CP0A 3WDYA 4B7EA 5LA2A 3HOBA 1V6LA 5DUWA 1E57A 2R0FA 3H7YA 5F32A 5B2GB 3VBRC 2CHHA 2VZSA 3L2HA 3ZFGC 5J48A 1CZSA 4ATFA 4MHUA 1OFNA 2ARCA 3M3IA 4R9DA 1SBDA 4AGGA 2VCMA 3VUOA 5JWPA 3ZLIA 1QJU3 2XONA 1PO23 4LLFA 3LA2A 4OI1A 3VBRA 4C0HA 1RINA 1SMVA 3ZFGA 5C9AB 4EROA 4BQ5A 4YM3A 5ACA3 4HMZA 5BYNA 2WWSA 1DYOA 3WUCA 2HWD1 2VXRA 1DGRN 1T2XA 4PLNA 3PU3A 2DVDA 2PXJA 3AMMA 4QWNA 3ZXGA 3I2JA 4KBZA 3J8F1 2WABA 1O3RA 1DBNA 3JB8A 3RZMA 1ZZ8A 4S2DA 2GNBA 5FMOL 3VKFC 1JS9A 2WT1A 5FMCA 4FFIA 1EP0A 5BNPC 2J1SA 3RYPA 2XJVA 4AI0A 4QQHA 1SLBA 2AEZA 1TQ5A 4LIVA 5T50A 5APAA 3POWA 5EP9A 5A3LA 1OA2A 3F95A 2D6MA 2CSGA 2RS52 4FSJA 1HRI3 4YW1A 5BNPA 3SISA 3OGSA 4LEJA 5FK7A 4WZCA 3VBSB 4LK6A 3AMPA 5FTTC 1ZVFA 2DFBA 1TME2 5SV8A 5EIYB 4PT6A 3I49A 2R042 3UKVA 2CV6A 4Y20B 3PMEA 1TNFA 2UY8A 3T3YA 5KXCA 3O1PA 2IXIA 1F31A 3O0WA 3ZMOA 1MZEA 3K48A 3RJRA 3N9OA 3T0BA 5F39A 4NAMA 2BBAA 2VUJA 3IIIA 5HI0A 5H9SA 4FTBA 2X10A 4UW5A 4LT5A 3A0KA 3WNMA 4LA2A 3GNEA 5A32A 3IIAA 5AFBA 1J83A 3N9PA 2KM2A 1W2OA 3WDTA 1M06G 1IKPA 3KCYA 3PDQA 1AL22 3GF6A 3ZSMA 4D7YA 4KGGA 4E4HA 5FMOS 3TOJA 4FAGA 1W6NB 1LNSA 2DVFA 2QQKA 4GALA 2WNUC 4GJZA 2E63A 1GNYA 3S7EA 1AR71 2RS32 2HWF1 1CZTA 4HBNA 4XQ4A 3B93A 1PX4A 3ZIWA 5IFPA 4AVSA 1RB8G 2WNUA 5FQ0B 4QGLA 3WF3A 4ET7A 4K8FA 4LHSA 3BPSA 4A3ZA 5FP4A 2D6PA 1H4GA 1RUC3 1S0FA 1GU3A 2QQIA 2SLIA 3A0NA 1MACA 2BNMA 1CONA 4IE0A 4Y5SA 1YFWA 2JJ6A 2QQOA 1UIJA 2VVDA 5EQUA 5A3WA 2ADEA 2K9ZA 5IT6A 2Y6GA 1EPZA 1RMU3 3DPRC 3K4DA 4COVA 4D8MA 4DPNA 1US3A 2RE9A 4CEYB 5F7UA 1UYPA 4AI9A 1OC1A 5A3TA 4XYXA 4HVRA 1DZQA 2JIJA 2ZZJA 3B69A 2GC1A 4PBPA 1AR62 3I59A 1Q8PA 2FCTA 3ZN6B 2JG9B 4NPMA 4XUNA 4GKYA 5FPXA 3DPRA 5FY7A 5DXDA 1XU1A 2LRPA 2RS11 2W1WA 4XUOA 1CN1A 5D1IA 1A3KA 2E7AA 1JUHA 2P6HA 4LKFA 4XJUA 4OI0A 2V5DA 2H6CA 2G1MA 1ENRA 4X8PA 1WCUA 5JOYA 3T09A 4Z1VA 1SG3A 3OUIA 5JXIA 3S57A 3D3AA 3N36A 5C3SA 2W46A 5C71A 1DGWA 3V65A 1HQLA 4KGQA 3HBZA 4PBOA 2R072 3WV6A 1W99A 2ZGRA 1TMF2 3H7JA 4XE9A 1SFPA 3C7GA 4YW3A 3M1HA 4C90A 2Q8DA 2ARXA 2Q8OA 2PTMA 2W94A 4PI2A 1OUXA 3O1VA 2XLFA 5IVEA 1VBE2 4LULA 2XJPA 2G9FA 2A6ZA 3CF6E 1HXS1 4IE5A 5IUQA 2B39A 4UBGA 4B4RA 2DFCA 2IXKA 4ITCA 1J84A 1REFA 3B02A 5FPAA 1RVF3 2VH9A 2ZZQA 1JZ3A 1UKRA 1XNAA 2ZAHA 1C57A 5EV7A 3VDAA 1DGRA 2OIIA 2HBTA 1AXYA 1RUOA 5GM0A 1TNRA 1KJLA 5GZEA 4N7UA 4BDVB 4D7TA 4YVWB 5JXGA 1XSRA 3ZXLA 1R64A 1VBC1 4LBNA 2D40A 3VZKA 4CA9A 3D6EA 5FZHA 2Y6FA 4AVTA 5LWBA 1VRH1 4UAPA 1NCQC 4LO6B 1IS3A 5FYZA 1YIPA 1JMUB 5LK5A 1V0AA 5BY5A 2XDVA 3INAA 1OKOA 1V9U2 3OB8A 2I74A 2MPFA 1NCQA 1FOD2 2WAOA 3W58A 4AWDA 5GZCA 1HB3A 4H55A 5EJ1B 4XCBA 4W6YA 2E33A 1ASJ2 5IVYA 4DXRA 4PLMA 3IBMA 4L2NA 3E6BA 3ZSEA 4CDWB 1U5IA 5A7NA 3PUAA 2WS93 4UBHA 3SLIA 1RUJ1 2AC1A 2WAAA 5C33A 1F4HA 3B5LB 3UKNA 5F3CA 1JYVA 4XQWA 3RDIA 4OHYA 2FDJA 1ZZCA 4K1ZA 2WNEA 5JOZA 1F15A 2OX0A 2ZEYA 5FBZA 1D4M3 3ACIA 5JMCA 1Q8QA 1RUI1 4BQWA 4HXCA 1AXZA 1R083 2JDUA 1ZYBA 2D44A 2J22A 1Z7S3 4QX8A 2WFPA 5I0TA 3T2OA 1H6YA 2NLRA 1YQ2A 2Y6HA 2W1UA 3THCA 1AYN2 1MS8A 3DXTA 4V1PA 4AAXA 2XHNA 4RFT0 1IHMA 2XOMA 3E5UA 3K2OA 1IS6A 4AVBA 2A6VA 5JOXA 3C7EA 3LF7A 4YGBA 1PVC1 1Z78A 4XFCA 4PCRA 1Y7BA 2C9AA 4I3PA 3E1F1 4MX3A 4BXFA 4M4PA 1U5XA 2W92A 4IQPA 5DZGA 3U10A 3AK0A 4LO4B 2FDFA 5GLTA 3T2TA 4AFAA 2WFF1 3JCIA 1E5HA 2DCZA 4LO8A 1JZ2A 1X50A 4LOTA 4N43B 5E1RA 4ZU4A 3HWJA 4HPKA 4P14A 5JXHA 2Y6KA 4JVAA 4IV3B 2FBEA 2GN7A 1QDOA 5A33B 1J1TA 1FT9A 3MIBA 4KL1A 1YQ6A 3N7MA 4ZY9A 3WY6A 1FAYA 5C6CA 5CADA 3PURA 2XQRA 5JPNB 2ENRA 2E6VA 1VBB1 1DIWA 1W8HA 2AYHA 3I3QA 3K4AA 1AR81 4D6QA 2ZX2A 2PHUA 4DFSA 2WRAA 4IGQA 5IATA 3VDDC 2R32A 2IUWA 2VMIA 4LR4A 1SBFA 2LM3A 3ME2A 1UY1A 3ZFEB 2YXSA 1GOFA 2ZCWA 2RR11 3JD71 4HVOA 4AQ2A 4Q0UA 4YSFA 4MGIE 1RUF2 2IC1A 2ZACA 4EN9B 5LEJA 5F5AA 3VDDA 2P3JA 4XFAA 5J7MA 5KHJA 2XKOA 4U2AA 2AH2A 4DRRA 2YROA 3IMNA 3AYAA 3PMSA 4GWMA 5DPNA 1KITA 4I0BA 2HKXA 4MGYE 3WEZA 3MFCA 4BQ4A 4N53B 4CE8A 3U0ZA 1DQ1A 2N7GA 3DEMA 4P5YA 1FI2A 1VBD3 4RGKA 4X6QB 1ULGA 5FO8B 2VZOA 2PFWA 3KF3A 1DQ5A 1Q8OA 4QD2A 2JDHA 2W68A 2YC0A 3ELNA 1LR5A 5J09A 2BDRA 4CCLA 4QDSA 4CVUA 4XTMA 1US2A 1WLTA 4MO3M 4XUQA 1DYPA 1MVEA 4LOSA 4XF9A 4IEXA 1I3HA 1W3XA 2RMU2 4ZU7A 1PIV3 3N9QA 2YPDA 5A7QA 4DZGA 3USUA 4EN7B 1YQ8A 4XABA 4JC1A 5DG2A 5JVVA 2WNVC 3TWIA 5C3QA 3EO6A 4YM2A 2OT7A 4CP9B 4AHYA 3M2MA 5FY9A 4GB33 3NVCA 3ZYBA 1QQP2 2ATFA 1ACCA 1EV13 1HB1A 1KGYA 4QPIB 1IG0A 4CCEA 2WJSA 4V2VA 2WNVA 3NNMA 1JH5A 3H42B 1CAVA 2VCAA 4GH4B 3VKMA 1RXGA 4BK5A 1KRIA 3ILFA 3CDZB 4CCJA 3FMGA 1ND2C 3GYDA 1I6XA 4YW5A 5JSOA 4AEJA 3OSDA 5I8YA 2JWPA 1REDA 1ENXA 1DDLA 4RA0A 4AHZA 4B7KA 4E4SA 2CNAA 5FZ6A 3RFRA 1OURA 1ND2A 1TEIA 1F8VA 3BOPA 4QGMA 2GDFA 2EIGA 4CCDA 2XJTA 1WCSA 2WFF2 3BCWA 3ZVXA 5CFDC 1REEA 1U0AA 1CVNA 3O1UA 4JQRA 5BPXA 3OEAA 2W47A 1BJQA 3IM0A 1Q8VA 4E2SA 4LUKA 1MZFA 1QOSA 2CU5A 4PDWC 3O1RA 2ZGTA 3WW2A 1CX4A 1LU1A 1L7QA 4GMP3 1DLCA 1VIWB 2WWUA 3HNBM 4IEYA 4IGPA 5DUVA 5FP8A 3MICA 4ZXEA 5CFDA 4CU8A 1BEV3 5I8TA 5KC5A 5L36A 1RTVA 2XKPA 5GJ6A 3C7HA 2YB7A 4FOWA 4MH0E 5EYYA 4PDWA 1YO8A 4BMEA 2G4IA 4C91A 5BNNB 5LA1A 2DCKA 4YG0A 1ZBE3 4IXLA 4Y1UA 2Q1MA 4NUBA 5H9RA 4CDXC 1BVVA 3EJKA 2P37A 1LEMA 1EAH1 1CJPA 3KZ4C 2PHWA 3WX5A 4QM9A 5A7WB 4B1MA 4CXYA 3LOIA 1R091 1LHWA 2D6KA 2EA7A 4KG0A 3LPGA 4CDXA 2Q8EA 3POYA 1E5RA 4QHBA 4XDQA 2VG9A 3H8RA 2P4EA 2WSVA 3HAGA 1W03A 2DVBA 2X53S 3AX4A 1CAUB 3RZGA 3ZXFA 3WLUA 4FTEA 3N7KA 4BJ0A 1LHVA 2R0HA 3FUOA 4M4RA 3I2GA 3K3OA 2CDOA 4JTOA 4BB3A 4DXSA 2UWCA 1CWPA 2JDKA 1C5IA 3WSOA 1WCQA 2X5IB 4M3CF 2Y0OA 3AYDA 2VQ0A 1CZVA 1PGL2 1NQJA 3MO4A 4Y5TA 1UY2A 1DQ0A 2NM1A 4BXSV 3UNPA 4UFMA 1H0BA 1O5LA 2BP6A 1VLNA 2ZMLA 3MIFA 4Y1ZA 4PLOA 1YEWA 4GWNA 4QPWA 4YGCA 4IEOA 1CESA 2JE8A 2VMEA 2B45X 2OA2A 5C4WC 3A22A 2VO5A
chains in the Genus database with same CATH topology
3EMRA 5IAVA 3W20A 5ERLA 4XABA 5LBBA 5DAWA 5C5TA 5M0TA 4NHXA 4Q5OA 4XC9A 3PL0A 2A1XA 3NNMA 2RDSA 3GJBA 3HQRA 4XCBA 3W21A 2RDQA 2HBUA 5LASA 5HV4A 5DAXA 4BQXA 2RG4A 3OBZA 5LBEA 4XAAA 4XACA 5LBFA 4XCAA 4BQWA 5LBCA 5LA9A 3NNFA 5IAXA 5LATA 3BVCA 5HV0A 4JZRA 4J25A 2FCUA 4ZPIA 5DAPA 2RDRA 4Y5SA 4NHMA 5EQUA 4NHKA 4UWDA 5L9BA 3MGUA 3DKQA 5A3UA 5DAQA 3OUHA 5DAVA 2JIGA 2Y33A 2FCVA 3OUJA 2JIJA 4MHUA 3KT4A 4MHRA 4NHYA 2FCTA 3HQUA 3KT7A 4IW3A 2G19A 5LB6A 4BQYA 5EPAA 5IATA 2G1MA 4NAOA 3OUIA 2Y34A 4NHLA 4KBZA 3NNLA 2OPWA 3GZEA 3GJAA 4Y5TA 3NNJA 5EP9A 5C5UA 3ITQA 2V4AA 4NMIA 2HBTA 5L9VA 4ZONA 2RDNA 5L9RA 3KT1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EMR A;  5IAV A;  3W20 A;  5ERL A;  4XAB A;  5LBB A;  5DAW A;  5C5T A;  5M0T A;  4NHX A;  4Q5O A;  4XC9 A;  3PL0 A;  2A1X A;  3NNM A;  2RDS A;  3GJB A;  3HQR A;  4XCB A;  3W21 A;  2RDQ A;  2HBU A;  5LAS A;  5HV4 A;  5DAX A;  4BQX A;  2RG4 A;  3OBZ A;  5LBE A;  4XAA A;  4XAC A;  5LBF A;  4XCA A;  4BQW A;  5LBC A;  5LA9 A;  3NNF A;  5IAX A;  5LAT A;  3BVC A;  5HV0 A;  4JZR A;  4J25 A;  2FCU A;  4ZPI A;  5DAP A;  2RDR A;  4Y5S A;  4NHM A;  5EQU A;  4NHK A;  4UWD A;  5L9B A;  3MGU A;  3DKQ A;  5A3U A;  5DAQ A;  3OUH A;  5DAV A;  2JIG A;  2Y33 A;  2FCV A;  3OUJ A;  2JIJ A;  4MHU A;  3KT4 A;  4MHR A;  4NHY A;  2FCT A;  3HQU A;  3KT7 A;  4IW3 A;  2G19 A;  5LB6 A;  4BQY A;  5EPA A;  5IAT A;  2G1M A;  4NAO A;  3OUI A;  2Y34 A;  4NHL A;  4KBZ A;  3NNL A;  2OPW A;  3GZE A;  3GJA A;  4Y5T A;  3NNJ A;  5EP9 A;  5C5U A;  3ITQ A;  2V4A A;  4NMI A;  2HBT A;  5L9V A;  4ZON A;  2RDN A;  5L9R A;  3KT1 A; 
#chains in the Genus database with same CATH topology
 4IV1 C;  2ID4 A;  3I97 A;  3ILR A;  4JX0 A;  5HBA A;  5A3P A;  5DMY A;  2XWJ B;  3VHR A;  1X7N A;  1SPP A;  1QWR A;  3GDB A;  3BTY A;  3M3C A;  5KXB A;  5ERL A;  1GZC A;  2CGO A;  2RM2 1;  3WD5 A;  5FY5 A;  1OPM A;  3MYX A;  5C4W A;  1XND A;  3AJZ A;  3ZX7 A;  5A80 A;  2Y26 A;  3AZY A;  3IDA A;  2OPK A;  4IV1 A;  5F2W A;  5T52 A;  4EWA A;  1QJY 1;  4AI8 A;  1RL3 A;  3T0A A;  5FPZ A;  3W5N A;  1O6U A;  2W95 A;  1DYK A;  5FZ3 A;  5A7P A;  2H6B A;  3BGA A;  4M00 A;  1GUI A;  2HBU A;  3Q8A A;  3OF1 A;  1DHK B;  5C3O A;  3LWC A;  4JQT A;  5H9P A;  1YLL A;  3PHM A;  3OEB A;  2D43 A;  4NIH A;  4Y1X A;  5FIX A;  4NWW A;  3H1Y A;  2BYV E;  3QCW A;  2BGO A;  4P9Y A;  2VXJ A;  5DDJ 2;  3WHU A;  4D6R A;  5F9T A;  2XPJ A;  3NKT A;  3MUZ 1;  4A41 A;  5FKC A;  1T6B X;  3THT A;  3OYW B;  5JIU A;  2E51 A;  3O1T A;  2MEV 1;  1PO1 3;  1G9C A;  2C26 A;  5FZ1 A;  1WLC A;  1LGN A;  3BYW A;  4XMA A;  1RUE 1;  4BLJ A;  1S0E A;  3HT2 A;  3E6C C;  5FP3 A;  5FKB A;  3D0S A;  3KWV A;  4GZ9 A;  4JZR A;  3RPQ A;  5JXJ A;  4JHT A;  2VNG A;  3KV4 A;  3PLQ A;  1NZI A;  1DP0 A;  4M0N A;  4XXA A;  1JHN A;  1FPN 1;  4AL9 A;  2W3J A;  4MXW A;  3WVJ A;  2K46 A;  3WNL A;  2D3S A;  5FJH A;  1R09 2;  1W2U A;  1WW7 A;  2HWC 3;  5FWE A;  1U5Z A;  3ZYG A;  4Z2W A;  4MYE A;  3MBW A;  4JKM A;  4XJW A;  3ZXA C;  2FMY A;  4EN0 A;  5FV3 A;  3CZJ A;  1DQ2 A;  1OOP B;  4LKS A;  1W6Q B;  1YI9 A;  2WDB A;  4NRQ A;  1OA3 A;  1BYH A;  4L8Q A;  3VHP A;  1VRB A;  4DIQ A;  3WCR A;  2IVI B;  4OZX A;  2I2S A;  2Y33 A;  3OUJ A;  2ETE A;  2ZAA A;  4RHV 1;  3NL1 A;  1NOV A;  4DIN B;  1LOF C;  2WWJ A;  4ASM B;  1XYO A;  2IZW A;  2R06 1;  5CBL A;  4EJR A;  3ZSK A;  3TEY A;  3DYO A;  4FPO B;  2HWB 3;  2ET1 A;  3N7J A;  3GCX A;  4HVQ A;  1ULF A;  2HH9 A;  2XXZ A;  5FO7 B;  5FYY A;  5CG9 A;  4Y22 A;  1LOF A;  2LUW A;  3AZX A;  1RXF A;  4RSU A;  1VAM A;  3TBD A;  1UW8 A;  3R05 A;  1VAK A;  2IFW A;  2VJX A;  3AZZ A;  3DEC A;  1Y43 B;  1VBA 1;  5FY1 A;  5CKN A;  2X09 A;  1YIF A;  2GSY A;  2WNO A;  3AP6 A;  1IQA A;  1H9W A;  4AXO A;  1H1A A;  1FYU A;  1HIX A;  4R9A A;  2A71 A;  1UZV A;  2K0G A;  3AYC A;  1AR9 2;  4NO4 A;  1DF0 A;  3VBH C;  1T6G C;  5E8A A;  3WW3 A;  5KC6 A;  2VC9 A;  3B00 A;  4NIA A;  1F5J A;  2P1B A;  4BE3 A;  1RUG 3;  5LEK A;  3HPN A;  2PAK A;  4YG6 A;  3SXW A;  1UF2 C;  2ZHN A;  4O65 A;  2VMC A;  1DZT A;  3RI8 A;  4CYD A;  4EN8 B;  3SCH A;  1C1L A;  3VBH A;  4DUW A;  2XUM A;  1X36 A;  4LOR A;  4Q4Y 1;  1APN A;  2WIN B;  2WO3 A;  4E4Z A;  1XNC A;  4QQP A;  5CFC B;  4Y24 A;  5IK7 A;  1ODM A;  4SBV A;  1GZ9 A;  1CAX A;  1CAW B;  3KV9 A;  2Y60 A;  5FO9 B;  4Q4X 1;  4R4X A;  4FTS A;  2ARE A;  4QKF A;  1ULP A;  1URX A;  1HN1 A;  2PLV 2;  4OMD A;  4Q0V A;  5FZG A;  1W2A X;  2A75 A;  5LBB A;  1SLC A;  1S0C A;  2D97 A;  4NVP A;  5IVF A;  3WP6 A;  1GKB A;  1LGB A;  2WLP A;  4L99 A;  1ZRI A;  5C9A C;  3D4K A;  3GZU C;  4GAZ A;  4A4A A;  4X6R B;  4F8A A;  1FV3 A;  1GBG A;  5FYS A;  4COU A;  1GAN A;  1KJR A;  2VAU A;  3AVR A;  2WII B;  4L11 A;  3P5B A;  2A1X A;  4A6O A;  2C9K A;  3PIJ A;  3OD4 A;  5C9A A;  1SLI A;  1BKZ A;  1LEN A;  4H3W A;  4TLF A;  4Q29 A;  3S7I A;  4Q4V 1;  3AKQ A;  3U1X A;  3SCF A;  2VR4 A;  2RG4 A;  3LEG A;  4GWI A;  1BMV 2;  2PQQ A;  1NXM A;  4FPE A;  2O0O A;  2YHJ A;  1GZT A;  4IER A;  1JBC A;  2VBP A;  3QAC A;  2A6W A;  2JB4 A;  3MHZ A;  2WLQ A;  5F3I A;  2WZR 3;  1RHI 3;  4FPK A;  4XCA A;  3T08 A;  2GH8 A;  1EPW A;  3VBS C;  2IXC A;  2Q1Z B;  2WUH A;  3V64 A;  3FLR A;  4CCN A;  2ZHM A;  1UXX X;  3NNF A;  1A34 A;  1J3R A;  2AEN A;  1PMI A;  2YBK A;  4WVW A;  2EIC A;  5DZF A;  2QVS B;  2ZAB A;  3BIW E;  3O0V A;  4JAA A;  1POV 0;  1W6O B;  1COV 1;  1QXP A;  3VBS A;  2YV8 A;  2VZR A;  1Y9Q A;  2QTW B;  5IK8 A;  2YU2 A;  2ZXQ A;  3J7L A;  4Y20 A;  3JUU A;  5GLV A;  5T5P A;  2QFE A;  3WDU A;  4URA A;  2R06 2;  4KBB A;  4JKL A;  3WF0 A;  3ENR A;  1MQT B;  1QNW A;  2F4L A;  2VOT A;  3OBA A;  3HIF A;  4W65 A;  5FY8 A;  2CWS A;  4AVC A;  2DUP A;  2B7Y A;  2YC4 A;  3SKJ E;  5CZK A;  2UUR A;  4N8M A;  4AED B;  5L7O B;  1B35 B;  1UXZ A;  1QH7 A;  2AAC A;  4QXH A;  4Q8K A;  4R9B A;  4LHN A;  1S2E A;  3IZO A;  4HK8 A;  4JKK A;  2D3R A;  4KWU A;  3BI3 A;  1V6M A;  2ERF A;  5AVP A;  4O61 A;  5A6Q A;  1QHD A;  2VTX J;  5ABJ B;  4EN6 B;  3HN1 A;  1GLH A;  3FL7 A;  3LSD A;  5FZD A;  4BQY A;  5A1L A;  2CTV A;  4CU6 A;  4NPL A;  1QJU 1;  1PO2 1;  2XJR A;  1HW5 A;  2FZ1 A;  3LZZ A;  4IUG A;  5J1X A;  4HOO A;  1UYX A;  5AC9 1;  5ACA 1;  1W06 A;  1UU5 A;  5FZI A;  2UY9 A;  1ALY A;  5K4L A;  3SKV A;  3ZDS A;  4BPZ A;  3FX3 A;  4C0B A;  3I2H A;  1W6N A;  1ZRF A;  5FPB A;  1LUL A;  1UN1 A;  4C1W A;  4PHZ A;  5F37 A;  2VZV A;  4RFR B;  3WDW A;  3PVO A;  2RS5 3;  2OPW A;  4CDQ C;  1Y4W A;  3ACG A;  4HN1 A;  4KMQ A;  4AFM A;  2ZGU A;  3CO2 A;  4W6X A;  2AR6 A;  2DDU A;  3ZOI A;  4Q4X 2;  5FQ0 A;  1TME 3;  2BGC A;  1OXC A;  2PYT A;  3MPB A;  4HON A;  3UV9 A;  1RJ7 A;  4Y4R A;  4AQS A;  4BQ2 A;  2R04 3;  2XBO 3;  2WZP P;  4Y1Y A;  4CDQ A;  3D5O A;  1LGC A;  3NV3 A;  5GKA C;  5FP7 A;  4EQV A;  4S2G A;  1HRI 1;  1RUH 2;  4P9X A;  1HQN A;  4CEY C;  1YC6 1;  4S2H A;  3WP5 A;  3I7D A;  1YFU A;  2CL2 A;  2RDN A;  2CGN A;  3ALQ A;  1UZW A;  3AMQ A;  3NV2 A;  2LAL A;  4LK7 A;  4XF4 A;  4DY5 A;  1CD3 G;  4R52 A;  3WCS A;  4EZH A;  2P3K A;  5EWS A;  2JG9 C;  2VE1 A;  3ABZ A;  5JOW A;  5HCA A;  3GAL A;  3KVA A;  5FLH A;  3H8X A;  2A3W A;  4CEY A;  1UPS A;  1H6X A;  2YDE A;  2DBN A;  3HJR A;  4LTA A;  4DRV A;  2VZ3 A;  3WP4 A;  3GHN A;  3ZO0 B;  3K3N A;  3ZN6 A;  5FLJ A;  2JG9 A;  3T0D A;  5HCH A;  3POF A;  4WVM B;  1AL2 3;  5I0S A;  4P9L A;  4Q4W 2;  5IVB A;  1RUD 3;  2VNR A;  1OBN A;  3J7H A;  3R4S A;  3GJB A;  3OBR A;  4CP2 A;  4PF5 A;  1MEC 2;  1NKG A;  4LBQ B;  4D94 A;  3ZR6 A;  4UW3 A;  4OI2 A;  2RS3 3;  4XAE A;  3LEM A;  4LKE A;  4XUP A;  2BZD A;  4MG2 A;  1Y9G A;  1O4Z A;  1YYN A;  2GME A;  2FMD A;  3P6B A;  1D7P M;  2XBO 2;  1ZBA 2;  1F9K A;  4F3J A;  1Q3E A;  2J7M A;  2RJ2 A;  3SH5 A;  3WQ7 A;  1AX1 A;  2GNT A;  3S0M A;  3IWZ A;  3OCP A;  4H2A A;  5GLU A;  2Q1F A;  2B4K A;  1Q56 A;  5F5Q A;  2D6L X;  4XZP A;  5HPO A;  1YNA A;  4LA3 A;  4YVW C;  4PIY A;  3FBY A;  1ENQ A;  5FXW A;  2D98 A;  1WW4 A;  2R30 A;  4YRD A;  2FCU A;  1TG7 A;  1CX1 A;  3HVD A;  2KD7 A;  2VZT A;  4BIF A;  4LE3 A;  4Y26 A;  2VW2 A;  1G9A A;  1GIC A;  3IAQ A;  4YVW A;  1JXN A;  2L9L A;  4LE4 A;  3AMH A;  4K21 A;  4NHM A;  4K20 A;  1SLT A;  3O5S A;  4FPJ A;  3RZH A;  5FZ8 A;  1AR6 3;  1RUD 2;  4AAP A;  4Z2A A;  4NHK A;  1GWK A;  1UL9 A;  2EAL A;  4XHB A;  1GQP A;  4HFS A;  1RMU 1;  3Q8F A;  3OG2 A;  5AC9 2;  2WZE A;  3A7Q A;  4CDW C;  4P9J A;  4CRQ A;  1JU4 A;  2I45 A;  1LHN A;  2XQX A;  4FPH A;  1W0O A;  1AYM 1;  1ZX5 A;  2D7F A;  1HB2 A;  2DTY A;  4IEP A;  3VD7 A;  1QMJ A;  2R07 3;  4EWE A;  1TMF 3;  4AGV A;  1DCS A;  1W39 A;  4CDW A;  3ROU A;  3AM2 A;  3RZZ A;  1SFY A;  4XEZ A;  5JLV A;  3MID A;  3OJB A;  4TXW A;  3LGR A;  4ATE A;  1UAI A;  5FYM A;  4DEQ A;  1VBE 3;  2UWA A;  2BU9 A;  2FDI A;  2WO1 A;  1C8M 1;  2V4V A;  4A7K A;  5HCF A;  2Z79 A;  2JKB A;  5BXX A;  4E2Q A;  1BK0 A;  2VUL A;  5HXM A;  5JSR A;  1O5U A;  1UU4 A;  4K6B A;  3SCG A;  1PK6 B;  2NQY A;  4XOG A;  4XIL A;  1SZB A;  3P3N A;  4JDN A;  3VN4 A;  2HWD 2;  2A5Z A;  1D0H A;  3PVE A;  3RVH A;  3PUS A;  3RYR A;  2EXI A;  3AL6 A;  4AG4 A;  3NMB A;  4ZKT B;  3M3O A;  1G6N A;  2ZGK A;  1K3I A;  3J8F 2;  4N43 C;  4NID A;  1RVF 1;  3ZXE A;  3OTF A;  2HWE 1;  4P9W A;  1A78 A;  2CAV A;  2PQS A;  1WW6 A;  3R6S A;  4IV3 C;  3AKR A;  5GLZ A;  2YGL A;  3OBT A;  5CAZ A;  4N43 A;  4P08 A;  3FUQ A;  1V9U 3;  1JHJ A;  1OF4 A;  2VOV A;  3RJ2 X;  5J96 B;  1FOD 3;  2QZ3 A;  3W20 A;  4B4P A;  4IV3 A;  4D6S A;  3VL8 A;  4SLI A;  3U4X A;  3VZO A;  1ASJ 3;  1OFS A;  1AR7 3;  1LU2 A;  5IWF A;  5A33 A;  1K12 A;  1VAV A;  1H4H A;  3KHB A;  5FBJ A;  5M0T A;  3NNG A;  1Q5O A;  3SEP A;  3ZFE C;  2VEC A;  4HN0 A;  3OGJ A;  3I2I A;  3EQE A;  3LE0 A;  4FPL A;  1GZW B;  3WZ1 A;  2Y64 A;  2DCY A;  1W04 A;  1H1I A;  2YZ4 A;  3HR9 A;  2RDQ A;  3ZFE A;  1RIR A;  4QMA A;  1AUY A;  3H9A A;  3U4S A;  1O8S A;  1POQ A;  5LAS A;  3I8T A;  1W6M B;  4N53 C;  2Y6L A;  2RVA A;  3HT1 A;  4MSV A;  1HJF A;  4GKX A;  3KS7 A;  4AHX A;  5IK4 A;  2DV9 A;  3W59 A;  4W50 A;  1AYN 3;  2IWG B;  4KQ7 A;  3ZXJ A;  3RS6 A;  1D4M 1;  4CP1 A;  2OKX A;  5J37 A;  5FDB A;  4N53 A;  3VD4 A;  1R08 1;  4HSJ A;  5E89 A;  3ACH A;  4IEW A;  4AI1 A;  1DZR A;  4XET A;  2OQ6 A;  3UKT A;  1YXW A;  2JD9 A;  1L3J A;  1VMH A;  4XHX A;  1SLA A;  3MW3 A;  2PHF A;  5A7O A;  1BBT 1;  1SLL A;  3MDP A;  3ZXD A;  2YFU A;  1S0J A;  2BOJ A;  1NY7 1;  4FPY A;  1ZNP A;  1O91 A;  1AR7 2;  3FLT A;  2HWF 2;  2XWB B;  5LRS A;  2VPV A;  1NA1 B;  4QPI C;  3IDB B;  2WC2 A;  4OHZ A;  4OUM A;  2VQT A;  4NE9 A;  3WF4 A;  1DQ4 A;  3WG3 A;  4QXB A;  5ANN A;  4WM7 B;  1WCK A;  4QT6 A;  3PJY A;  4LO7 A;  5FUI A;  3DV8 A;  2EF6 A;  5ISL A;  2ZEZ A;  4FT8 A;  4CP9 A;  4GH4 C;  4NRM A;  3MLK A;  1W6P B;  2DTW A;  1HDK A;  1ULE A;  1Z0H A;  4QPI A;  2W2I A;  1HXS 3;  5FXV A;  2O8O A;  3AZV A;  3WR0 A;  3T4V A;  3IMM A;  4MHR A;  2BWA A;  1IPJ A;  2GAL A;  1RUF 3;  1PM7 A;  4OUL A;  5JCT A;  1UO9 A;  2Q0A A;  4GH4 A;  4YVS B;  2DBI A;  1KXG A;  4K40 A;  2X05 A;  3I2F A;  4CCK A;  2OQ7 A;  3H3L A;  1JOD A;  1CIY A;  1PGW 1;  3M8L A;  4MLO A;  1AJO A;  4QQO A;  4NAO A;  4I0A A;  4W8J A;  2J1V A;  2JKX A;  4ARX A;  1VRH 3;  4DB5 A;  2E53 A;  2HWE 2;  5CG8 A;  2RS1 2;  3VDB A;  3H8O A;  2EAA A;  4BU2 A;  1RUN A;  1IG3 A;  5E16 A;  4YZ2 A;  3I2D A;  2ARB A;  1WLD A;  4I30 A;  3BU7 A;  3HBK A;  3POB A;  1GOH A;  4XIO A;  3SMH A;  1NXD 1;  4OCT A;  1I1E A;  1ZM1 A;  2D3P A;  1UX6 A;  3GZE A;  4UFL A;  3GCW A;  2DVA A;  1VBD 1;  4OI4 A;  4FP3 A;  1XRU A;  2BER A;  4Q0S A;  2WKK A;  3EXU A;  4BOW A;  5BNN C;  2HEW F;  2RMU 3;  1R1A 1;  5FZC A;  1UOG A;  5FMB A;  2FDK A;  3MV0 1;  3KGL A;  2A3X A;  1HXS 2;  4WVZ A;  1QQP 3;  4DS0 A;  3VB9 A;  2Q4S A;  5BNN A;  2JDP A;  3ES1 A;  2C24 A;  3T4H B;  2XG3 A;  2WT2 A;  3RYK A;  1D4V B;  1BCX A;  1X33 A;  3TYJ A;  2BPA 2;  4UFJ A;  5DAW A;  2E32 A;  2PEL A;  4NHX A;  3U37 A;  1C8N A;  3KV5 A;  1ZZ6 A;  5A7W A;  4JRL A;  1AX2 A;  4XC9 A;  4GB3 1;  1VBC 2;  3NWK A;  3T30 A;  2PHR A;  3AP9 A;  3PVB B;  1EV1 1;  3VZJ A;  1CGP A;  4MGZ E;  3AXD A;  3V0A B;  1VRH 2;  2ZGN A;  2JEC A;  3GXU A;  1W9T A;  5AFE A;  2Z42 A;  1XE7 A;  1PMJ X;  3APB A;  3VZM A;  5IYY A;  3DGT A;  4UW6 A;  3BTX A;  2X5I C;  1CAU A;  1BBT 2;  3EYP A;  2VBD A;  3OBZ A;  1C1F A;  2WFF 3;  3R4U A;  4PQQ A;  4AI2 A;  1Y3T A;  1V00 A;  2OUH A;  5FZM A;  3NQH A;  3CL1 A;  2E9Q A;  2D5H A;  4AQ6 A;  4XAA A;  1M4W A;  1G9B A;  3NST A;  2X5I A;  1IZ3 A;  3SC7 X;  1RUJ 2;  3ZKY A;  1UYZ A;  2TBV A;  2ZGL A;  4Q1P A;  2BV4 A;  2YC2 A;  1H1M A;  3NAP B;  2QKD A;  1VBB 3;  1PHM A;  1IOA A;  1OQD A;  1AR8 3;  3MPP G;  5FZ4 A;  1RUI 2;  4LJH A;  4N7I A;  3M70 A;  5FYC A;  4K8R B;  2XVK A;  3JD7 3;  4GMP 1;  1NE6 A;  3U14 A;  2MHF A;  5EHD A;  4IDZ A;  3WNX A;  1BEV 1;  3LEI A;  1B09 A;  4CEW B;  4C8D A;  4E2G A;  1IPK A;  1ST8 A;  2DWR A;  4JTN A;  1ZRD A;  1PVX A;  4L0P A;  2G9G A;  4IGO A;  2GND A;  4YLZ A;  1SQ4 A;  5EJZ B;  1PVC 2;  3LPF A;  5A3U A;  1ZBE 1;  2ZHK A;  4IE6 A;  3KMH A;  4XBL A;  3K4Z A;  3RZL A;  4O9G A;  4YGE A;  5D8A B;  1FMD 1;  3VZL A;  3DXU A;  2QCS B;  1HRV 1;  3H1M A;  3ON7 A;  3L9J T;  4LQR A;  3LKJ A;  1XQN A;  5JPM B;  2EXK A;  1GQG A;  4Y5Z 0;  1H9P A;  1DG6 A;  1QXR A;  1PMH X;  1YWK A;  2ZA9 A;  1O3T A;  1GNH A;  5FZK A;  5A3M A;  1W8U A;  1WBF A;  4AOC A;  1VBB 2;  2TEP A;  3WF1 A;  4MVT A;  1R1A 2;  2XL7 A;  3OYW A;  2BEO A;  1AR8 2;  1NLS A;  4J6G A;  2R1D A;  1JYN A;  4FOY A;  3JD7 2;  2RR1 2;  5FYB A;  1QIQ A;  3GM8 A;  1I9R A;  3WQB A;  2R1B A;  4KWL A;  4AI3 A;  4OQ8 A;  2PAM A;  2GC0 A;  4NPR A;  4XW3 A;  2JG8 B;  4FOQ A;  1W05 A;  1KDK A;  1UOJ A;  3JBG 1;  3MI8 A;  1PZ9 A;  1O59 A;  4FPF A;  3WUD A;  1OOP C;  2V4A A;  1LHO A;  3POJ A;  3QD6 A;  4ES9 A;  1DGW X;  1W9W A;  5DZE A;  1UKG A;  2W91 A;  3THD A;  3TRS B;  3G7D A;  1UU6 A;  2VY0 A;  3T2P A;  4E27 A;  5K0U B;  2JD4 A;  1PGS A;  4KH9 A;  1WD3 A;  1OOP A;  2ET7 A;  2LW8 A;  1OUS A;  5IAV A;  5A6Z A;  1LAJ A;  1W6Q A;  2KA3 A;  5FYH A;  3ES4 A;  4JGZ B;  2ZX3 A;  4IEU A;  4DNY A;  1W0N A;  3BU0 A;  1J58 A;  1AXK A;  4AFD A;  5HCB A;  4XBQ A;  3FBM A;  2F4P A;  3LAG A;  5FFO C;  1W28 A;  5DDJ 3;  2OYZ A;  2RDS A;  4AFB A;  2E7T A;  2QDN A;  3J7M A;  1ZRR A;  3SEE A;  3QH7 A;  1LJ7 A;  3AP4 A;  3H3Z A;  4B29 A;  4D3W A;  1YJL A;  5HV4 A;  4OHW A;  3FJS A;  1N1Y A;  2HEY F;  4XIK A;  3VD3 A;  1LEC A;  2DU0 A;  3WG2 A;  1G9D A;  3WDV A;  3DF0 A;  1SHW B;  2FQP A;  2VZP A;  4GWJ A;  4QHO A;  1Q43 A;  5BV6 A;  2P6C A;  1PO1 1;  2W0X A;  2JE9 A;  2VMH A;  3MLL A;  1FXZ A;  1UCX A;  2VTF A;  3N9M A;  1F5F A;  1KDM A;  1R09 3;  2XL9 A;  5CA6 A;  5FWJ A;  4XVH A;  3IAP A;  4CCO A;  1WW5 A;  3H3U A;  2P3Y A;  4KG8 A;  4YZ1 A;  4CCM A;  3FZ3 A;  4IND A;  4LNV A;  3LB9 A;  3WF2 A;  2BQP A;  3HMY A;  4A6S A;  1FMD 2;  2ORX A;  3S6P A;  3WNK A;  1CAW A;  5C7G A;  1NCR B;  3BAL A;  1W8O A;  3IN9 A;  3VKN A;  5JAX A;  2HWC 1;  2JDA A;  4NRO A;  1NUK A;  3Q9O A;  3BKZ A;  2DF7 A;  3A4U A;  3OGG A;  4RQP B;  3E5X A;  4XZU G;  2ZOE B;  4WZF A;  5JMO A;  3CBN A;  3K77 A;  2P5B A;  5C8W A;  4DXZ A;  2Y8K A;  4OUS A;  3J26 N;  2QDR A;  3VBO B;  1VB4 A;  4Q1R A;  1WMD A;  2NMO A;  2JDY A;  3I3B A;  2QQM A;  1HB4 A;  5LY2 A;  3RI9 A;  2G19 A;  4XF3 A;  1WCD J;  2J1R A;  3AC0 A;  2HWB 1;  1YI7 A;  5TSW A;  4O9E A;  4IE4 A;  4YG3 A;  4QXK A;  1J3Q A;  2Z69 A;  4HLT A;  1AR9 3;  2DCT A;  3VHO A;  1EAH 2;  1JOJ A;  2XJU A;  3WG4 A;  1E5I A;  3VHN A;  3DYM A;  2YU1 A;  3WNP A;  3JBG 2;  2BFU L;  4M3C B;  1TE1 B;  4BK4 A;  3UL2 A;  2DCJ A;  2BOI A;  2WSU A;  4QB6 A;  5JDB A;  1HLC A;  4ZS3 A;  3UK9 A;  5FJK A;  5IFT A;  1SBE A;  4OVE A;  2BVV A;  5FLI A;  4B4Q A;  3WW1 A;  1S0I A;  5T5J A;  3V0B B;  2F17 A;  3MUY 1;  3O1O A;  3J4U H;  1W6O A;  1JZ6 A;  4RR3 B;  1MQT C;  1RUG 1;  4WV8 A;  5CEH A;  3QH6 A;  1QJX 1;  2HLE A;  2PLV 3;  4K7J A;  3N9L A;  4ZS2 A;  5KBF A;  4AED C;  1ZRC A;  5FZO B;  5L7O C;  1B35 C;  1D2Q A;  3MF6 A;  1IS4 A;  5IVC A;  3PTY A;  4QPG B;  4D0Q A;  1LB2 A;  3VBU B;  2WT0 A;  4HK9 A;  4X8N A;  4BWO A;  3J9S A;  3WOG A;  1MQT A;  1ENS A;  2JDM A;  4PI0 A;  1XNB A;  2O14 A;  1RYY A;  1VP6 A;  2W9X A;  5A6X A;  2YPJ A;  1KFX L;  2ZPX A;  5SV5 A;  1LRH A;  4HET A;  1UY0 A;  1LOA A;  1B35 A;  3MLJ A;  4QX5 A;  3TB0 A;  1V70 A;  4AED A;  5L7O A;  3TN9 1;  5KHK A;  3J7N A;  2OVU A;  2F6B A;  2CDP A;  1XC6 A;  2H0B A;  4YZ3 A;  3LA7 A;  3POI A;  4YAR A;  5ABJ A;  2W1S A;  1PZ8 A;  1O3S A;  4JDO A;  1JZ7 A;  3W21 A;  3NO8 A;  2A7A A;  3UGH A;  2RM2 2;  1NE4 A;  3VD5 A;  5FYT A;  2VUD A;  5K9Y A;  4AFC A;  1V6J A;  5BNO B;  2BFU S;  3QBQ A;  1QJY 2;  1W0P A;  1YHF A;  3CHX A;  1H2M A;  5DN2 A;  1S4C A;  3AYE A;  2ZBJ A;  2A3Y A;  4CTE A;  5LY1 A;  4K3U A;  3ZFF B;  2QQN A;  3WNN A;  4V2W A;  2WZR 1;  1RHI 1;  1IS5 A;  3GHM A;  4NRP A;  4TSV A;  3I3M A;  4UF0 B;  4RHV 3;  3MFA A;  4NN0 A;  4DUX A;  1SDD B;  4ISQ A;  1K5M B;  2R06 3;  5FYV A;  5GZD A;  1ZA7 A;  3P3P A;  3UT0 A;  2DU1 A;  3MF9 A;  4G4F A;  4A2U A;  4YPJ A;  2MEV 2;  2DUO A;  3LIG A;  1SAC A;  1A8M A;  4IEZ A;  3IB3 A;  2QNK A;  1QDC A;  4CUG A;  1CPN A;  1RUE 2;  5KR7 A;  1JI6 A;  2ORZ A;  5KXE A;  2XB6 C;  4CCC A;  4FQ4 A;  4Z07 A;  3I54 A;  3KB5 A;  1POV 3;  4G9S B;  1CPM A;  2QQL A;  1GV9 A;  3N7L A;  1FPN 2;  3H0O A;  1G86 A;  2VQU A;  1LOC A;  3RWN A;  2BUK A;  2C6S A;  1NG0 A;  2YY1 A;  4AHW A;  4WVM A;  1QEX A;  3ZYI B;  1HJG A;  1G7Y A;  3KT4 A;  4TLG A;  1MZ5 A;  4J1X A;  3RQ0 A;  4IL7 A;  4LBQ A;  4LXL A;  4UOJ A;  2DVG A;  1H8T B;  1EYB A;  5B4N A;  4NJ4 A;  2XVG A;  2EXH A;  1N3P A;  3KM5 A;  4RGA A;  4QKB A;  4QB2 A;  5GZF A;  4KWK A;  2D5F A;  4B8E A;  1ND3 B;  2XGX A;  4KNC A;  4RHV 2;  2PAE A;  2WA4 A;  4K1Y A;  2ZX1 A;  4Q4X 3;  4AGR A;  2ZEX A;  4LBM A;  1OQ1 A;  1N1T A;  4A42 A;  2WN3 A;  3TNP B;  4YZ5 A;  1W9F A;  2RS5 1;  2VGD A;  1RUH 3;  3NJX A;  2D6O X;  5GLW A;  5B4X A;  3I2O A;  2VMG A;  4XJ9 A;  1VBA 2;  4XJZ A;  2B9U A;  5EZW A;  2VU9 A;  5FUN A;  4YFZ A;  4BZ4 A;  5FZA A;  2R04 1;  4HKL A;  4YM0 A;  3B9C A;  5C5U A;  2BWC A;  1S0G A;  4HKW A;  1X9T A;  2ZGM A;  1MS4 A;  3PNA A;  4NMI A;  4FPC A;  3UGG A;  4FOV A;  3O7O A;  4KU8 A;  1UPI A;  1UZZ A;  1BLZ A;  2G9Z A;  4QGN A;  1A8D A;  4QKD A;  3NJY A;  3ZN4 A;  3JQX A;  2ES3 A;  2XJQ A;  3KGZ A;  3M3Q A;  3C7O A;  3OY8 B;  4Q4W 3;  4CDU B;  4CPB A;  3RNS A;  1XE0 A;  3HNM A;  4BH9 A;  1LHU A;  1AHS A;  4Q4Y 2;  3ZKU A;  4ES8 A;  4GIQ A;  4FO9 A;  5C5T A;  1MEC 3;  3RG0 A;  1BHG A;  4D7S A;  1FNY A;  2QQV A;  5F6K A;  3S30 A;  2RV9 A;  4CEW A;  1HQW A;  5KWR A;  1AL0 G;  4IEV A;  1GP5 A;  2LS6 A;  1HKD A;  3CJI B;  3PL0 A;  2WQZ C;  4FVV A;  4KU7 A;  3VBF B;  3LFI A;  5C8C B;  2XR4 A;  4TN7 A;  4WBB A;  4H7L A;  2QQW A;  4GUL A;  2IXJ A;  2VVE A;  1COV 3;  3Q8B A;  1ZBA 3;  4QDR A;  2WN2 A;  1QJF A;  4BCU A;  2A6X A;  5JIA A;  1PK6 C;  1QXJ A;  2C1F A;  1GQH A;  1JOP A;  2V09 A;  5KHH A;  2YBS A;  3IPV B;  4I02 A;  3GZA A;  4Y33 A;  2LTN A;  4FFG A;  2QBX A;  4AEM A;  5CU1 A;  2I07 B;  1RIT A;  1PK6 A;  3M3E A;  2C0Z A;  1WBL A;  4J1W A;  4UFK A;  3U75 A;  2O1Q A;  4CUA A;  3RWK X;  4CUC A;  3ZYJ B;  3PVN A;  4ZU5 A;  4Q4V 2;  2VNO A;  4ASL A;  5BUV A;  2D6N A;  1DU3 D;  1YFX A;  1ULD A;  1VMJ A;  1TVG A;  4DUV A;  5IAX A;  1LOD A;  1MVQ A;  4XXP A;  5HV0 A;  2ADD A;  4CU9 A;  2FD8 A;  2CAU A;  2WA3 A;  3H8U A;  1U12 A;  3LDB A;  2WQ4 A;  3U11 A;  3USS A;  1HX6 A;  1VJ2 A;  2VZQ A;  3HEI A;  3CU7 A;  5DG1 A;  3B3Q E;  4ZXK A;  4BQ1 A;  2IFR A;  5AC9 3;  1H2N A;  4XFB A;  3E6D A;  5FPU A;  3ASI A;  2BBV A;  2QQJ A;  3UJQ A;  2ZMN A;  3AP7 A;  3E97 A;  2P2K A;  1F4A A;  1ONA A;  1LKN A;  3CMG A;  4AYU A;  4BIS A;  3O1S A;  3ZYR A;  1AR6 1;  4I09 A;  1COV 2;  1NZC A;  4YYO A;  2O8Q A;  2PN5 A;  3KLS A;  4A7Y A;  5F2S A;  5L9B A;  1BZW A;  3DKQ A;  1WME A;  3OUH A;  1RJ8 A;  1V6N A;  3P1I A;  2R6Q A;  1GZW A;  4QU1 A;  2E7Q A;  3N35 A;  3AKP A;  4WM8 B;  3B01 A;  1CIW A;  5LA0 A;  1JW6 A;  1ZA4 A;  4Z92 B;  3KT7 A;  2R07 1;  4XFH A;  1DGL A;  1TMF 1;  2VBB A;  2FZ2 A;  1WUV A;  1XPW A;  2XJS A;  2IVJ A;  2ZMK A;  3PUQ A;  3WXP A;  3RZJ A;  2Z5W A;  1W6M A;  3ORJ A;  1KD7 A;  4XUT A;  2GP3 A;  3K46 A;  5EJ3 A;  1RUC 1;  4YW7 A;  4F7Z A;  2WZ8 A;  3D0J A;  2HWD 3;  4CUB A;  2KR2 A;  2Y34 A;  3NV1 A;  4JHZ A;  1VBE 1;  4OQ9 A;  4DEV A;  4DOU A;  5CIR A;  3ZN5 A;  3VKO A;  2ZX4 A;  2ZGQ A;  1ZRE A;  1C4R A;  2P34 A;  3J8F 3;  3PU8 A;  4DO0 A;  3LOB A;  1QJU 2;  4N90 A;  4YNI A;  1PO2 2;  2VW0 A;  2VOK A;  5JZG B;  2P17 A;  5F5C A;  1C28 A;  2VMD A;  5ACA 2;  2W39 A;  4ISR A;  4RGG A;  1SCR A;  3POG A;  2VZU A;  3NJZ A;  1NA1 C;  4QX7 A;  4FI9 A;  1N1S A;  3NNJ A;  4WM7 C;  3LEK A;  2UU8 A;  4QM8 A;  4G3Y C;  4I0W B;  3UJO A;  3C2U A;  1W9S A;  4UI9 L;  2NZ9 A;  3CKH A;  1OVS A;  2YYO A;  1ZZB A;  4HKO A;  4LHL A;  4O7X A;  2VM9 A;  1NA1 A;  4FXG B;  4OZO A;  5L9V A;  4JGY B;  3FHI B;  4COZ A;  1MPX A;  4WM7 A;  2R7E B;  2WO7 A;  4RS5 B;  1F2N A;  1V9U 1;  1OLR A;  4MOA A;  1FOD 1;  4PF1 A;  4HAN A;  3HN3 A;  4Q0P A;  5FZ9 A;  1GR3 A;  1HRI 2;  1W6P A;  4YVS C;  2HYX A;  1ASJ 1;  1N3O A;  3A21 A;  1VPH A;  4R8H A;  4XDO A;  5DAB A;  2VD7 A;  4N9H A;  3OPZ A;  4AVV A;  5K7P A;  2B46 X;  1WZX A;  2LRO A;  2XH6 A;  4XJ8 A;  3RGB A;  2JXA A;  3DYP A;  1XNK A;  4YVS A;  1GFF 2;  3VGI A;  4AF9 A;  3DN7 A;  5I93 A;  4TZD A;  3HQR A;  2ZTN A;  5G05 L;  4YW2 A;  4CDQ B;  3NV4 A;  1H2K A;  1KEX A;  2BGP A;  4Y4Y A;  1JZ4 A;  5A7S A;  1I5P A;  2DYC A;  3KD4 A;  3T1L A;  3VBR B;  2JX9 A;  4BQX A;  5ANQ A;  5I0D A;  3ZFG B;  2QQU A;  1NYW A;  4XF0 A;  5J36 A;  5IK5 A;  1W8F A;  4QHZ A;  4MGK E;  1BVP 1;  1AYN 1;  1EUT A;  2GZW A;  2XHK A;  3ETQ A;  3HNY M;  5LBF A;  1H8V A;  1W2N A;  1SDW A;  2GMM A;  4IET A;  1NQD A;  1ULO A;  5T3N A;  5CIS A;  4LPL A;  2GAU A;  2HWF 3;  4NWV A;  1V6O A;  4JCK A;  2ZGO A;  1AYM 3;  1S2K A;  1DFQ A;  2UWB A;  2GU9 A;  2HEV F;  4I3G A;  1UZY A;  2ZHL A;  4IES A;  3BTA A;  4PJY A;  2OS2 A;  5I8S A;  3IDC B;  3RZK A;  2BNO A;  3BOW A;  5JR7 B;  5EYX A;  4AE2 A;  3ZM8 A;  1Q8S A;  2GC3 A;  3PTR B;  2Y6J A;  1AJK A;  3DCQ A;  2BJS A;  5F6L B;  5BNP B;  3CIH A;  2WO2 A;  3VLB B;  2FDH A;  1C8M 3;  1CJD A;  1QOO A;  3PUH A;  2WS9 1;  2J42 A;  3C7F A;  4P9I A;  1DQ6 A;  1XE8 A;  2YFZ A;  1GYK A;  1O8P A;  2VCB A;  3ILN A;  4LMF A;  3AKT A;  3S5A A;  3ATG A;  3B7M A;  3MGU A;  5FMD A;  5KHG A;  1RUC 2;  2FDG A;  3KCX A;  2XVL A;  4AR2 A;  2AZ5 A;  1PZ7 A;  1XNT A;  1Z7S 1;  3V0A A;  2ILM A;  4HL0 A;  2WQ8 A;  3KVB A;  3ZPY A;  3RSJ A;  1MR5 A;  1ODN A;  4Z82 A;  3HQU A;  1RUF 1;  1X8M A;  2BRT A;  2HWE 3;  3MIG A;  5FYI A;  5FZE A;  2RS1 3;  5J98 B;  3VD9 A;  3O0X A;  1RMU 2;  3ZR5 A;  3WP3 A;  3O12 A;  4DQA A;  2BW8 A;  1XOY A;  2E31 A;  3JB4 C;  2FHR A;  2SBA A;  5A32 B;  3SH3 A;  3ZDV A;  2VNV A;  4TYS A;  3VDC A;  2WYS A;  3QLQ A;  4UFH A;  1AYM 2;  4WVV A;  4FAH A;  3N9N A;  3W5M A;  3NAP C;  3I3D A;  1LOG A;  5LW9 A;  1S0D A;  3LCP A;  4XFF A;  5DUX A;  4OUE A;  2NN8 A;  1BQP A;  2ZX0 A;  1WKY A;  2X29 A;  3AB0 A;  3NAP A;  3OGV A;  2Z2S B;  4LBO A;  5IHR A;  5I91 A;  1W90 A;  4QX2 A;  2JE7 A;  1C8M 2;  1U5Y A;  4FPG A;  4JV4 A;  4PQ9 A;  4CEW C;  5L19 A;  5FY4 A;  1HV1 A;  3DKW A;  4KI5 M;  4COW A;  2OXB A;  3RRD A;  1LTE A;  1WA6 X;  2RMU 1;  2HJI A;  3EBR A;  4B1L A;  5FR3 A;  2WNU B;  3W9A A;  1AZD A;  4CU7 A;  5CYY A;  1V6K A;  2UYB A;  5D2A A;  1LOE A;  3FFZ A;  1MS3 A;  2EAK A;  3MW2 A;  4FP2 A;  1GNZ A;  1O4T A;  4Q2F A;  4MUV A;  4RL7 A;  4ZON A;  5I0R A;  3RMY A;  1VBC 3;  4GD4 A;  4Z8B A;  1QQP 1;  3MIH A;  4IEQ A;  3VL9 A;  4MZU A;  3WQ1 A;  1RVF 2;  5FZB A;  3AKS A;  4E9K A;  4F83 A;  5D8A A;  2WBK A;  4RD7 A;  2BTV C;  4FBF A;  5LZ6 A;  4MGT A;  1UMI A;  2A73 B;  3WG1 A;  3ZYF A;  2J1E A;  3TEX A;  5D8A C;  4URT A;  1BBT 3;  2ZKL A;  4ONU A;  4FFH A;  3U78 A;  4ZHN A;  2GH2 A;  3I59 B;  4XUR A;  3RMX A;  3NJV A;  2OW4 A;  4M01 A;  3DPR B;  1VB2 A;  4BMB A;  5C3P A;  2Z4F A;  3AL5 A;  4GJY A;  2TUN A;  2V73 A;  4M3C E;  4QX3 A;  1RUJ 3;  1X82 A;  4LIT A;  2GN3 A;  3GBF A;  4XPV A;  3ZYH A;  5A70 A;  1NAE A;  2NYY A;  4QX1 A;  2BVB A;  4R4Z A;  2JG8 C;  2W08 A;  2W52 A;  2V72 A;  1RUI 3;  1N3Q A;  1PIV 1;  2JEM A;  4NII A;  1HN0 A;  3N3H A;  5A6Y A;  2WS9 2;  1G8W A;  1GWL A;  2JG8 A;  3JU9 A;  4NR1 A;  1YRZ A;  1RC6 A;  3D8C A;  5FPL A;  4L92 A;  5K0U C;  2PMW B;  4Q26 A;  1OT5 A;  1D4M 2;  4YWA A;  5A3N A;  1J59 A;  3FFQ A;  4OLL A;  2QZ2 A;  4W6W A;  1R08 2;  1LED A;  3SHR A;  1O3Q A;  1PVC 3;  1Z7S 2;  4JGZ C;  4ZPI A;  4LUM A;  1FV2 A;  1NLQ A;  1STM A;  5K0U A;  3MZH A;  3LD8 A;  1JN2 P;  1NY7 2;  2XLA A;  4QKN A;  4QDQ A;  5IVV A;  4JGZ A;  4P02 B;  4Y3O A;  2OUJ A;  3AMN A;  2HYK A;  3POS A;  1G9F A;  1JYI A;  5KHI A;  1MS5 A;  1XYN A;  3FE5 A;  2VCC A;  2VUC A;  1CR7 A;  1XJA A;  3TNQ A;  2JIG A;  1W8Z A;  1P8J A;  1GP4 A;  1OLM E;  3H1W A;  1OPO A;  4QAW A;  1OKQ A;  1CQ9 A;  3KHC A;  4LHK A;  4IW3 A;  2RJL A;  1FAT A;  1NCQ B;  1R1A 3;  4Q8L A;  5LB6 A;  3VKL A;  4KWJ A;  5KXD A;  5EPA A;  4UXA A;  2R16 A;  4YM1 A;  1XXN A;  4Y1V A;  4N9I A;  2RR1 3;  4DMI A;  1KQR A;  2QE3 A;  2VTX A;  3POE A;  4NHL A;  2PHD A;  3O14 A;  1PGL 1;  2X8K A;  1IQD C;  2QJV A;  2WL1 A;  5LRR A;  1PM4 A;  3CEW A;  3AP5 A;  2D93 A;  1PGW 2;  1H2L A;  4R9C A;  1LCL A;  1GWM A;  2V5Y A;  1NCR C;  3ACF A;  3R4D B;  1N1V A;  1SFN A;  3VZN A;  4HSL A;  1R1Z A;  1BK1 A;  5DUU A;  5FUP A;  4MGS A;  2AEY A;  5AVA A;  3B94 A;  1EUU A;  4QX0 A;  1H30 A;  3U07 A;  5L73 A;  1UD1 A;  4MAD A;  1QOT A;  2W87 A;  4OYU A;  4RQP C;  1HV0 A;  4XDP A;  5FZ7 A;  1NCR A;  4QQL A;  4LBK A;  3NW4 A;  4CXW A;  2W5F A;  2YMZ A;  4ASK A;  4QB1 A;  4MXV A;  3FHQ A;  5IJR A;  3VBO C;  2GNM A;  1VBD 2;  5F5I A;  4DY3 A;  4U36 A;  1OMI A;  3EMR A;  3CLP A;  4RQP A;  3NRU A;  4DXT A;  1OSG A;  2EIB A;  1V6I A;  2EVX A;  1MS9 A;  3JZV A;  2ZJC A;  4AQT A;  1OH3 A;  2J1A A;  4HPK B;  3VBO A;  5F1R A;  3GBW A;  3C3V A;  2YUE A;  5D21 A;  3UGF A;  2VW1 A;  3GGL A;  4FQZ A;  4LIU A;  3URF A;  3D82 A;  4RYD A;  1PIV 2;  5DDJ 1;  1AVB A;  1OD3 A;  3DL3 A;  1XU2 A;  5IW0 A;  2VQA A;  3ETP A;  3SIT A;  4EZ4 A;  5CKM A;  3H50 A;  5FZ0 A;  1IKQ A;  4GB3 2;  5FOB B;  3LDR A;  3LQC A;  4Q27 A;  2Q8C A;  1EV1 2;  1NX9 A;  3PJQ A;  4M3C A;  4XTP A;  5I0U A;  3VV1 A;  3CQO A;  4ORF A;  4A44 A;  1LOB A;  3ACL A;  4RR3 C;  2RJK A;  5FCC A;  3SQO A;  3BIE A;  3BPZ A;  4MET A;  3I3E A;  3IKW A;  3WDX A;  3WW4 A;  3JQW A;  2W1Q A;  3VDD B;  3FC0 A;  2B5H A;  1FMD 3;  4XFG A;  4GMP 0;  3UES A;  1JZ5 A;  4M0H A;  4QPG C;  1HRV 3;  3VBU C;  3V0B A;  1YQ5 A;  4A7Z A;  1XBF A;  3NKG A;  4RR3 A;  3EHK A;  2B9V A;  2WR9 A;  3AJY A;  2CGP A;  3PUI A;  5FZO A;  2JB8 A;  3ZSJ A;  2AUY A;  5C3R A;  5LK7 B;  4QPG A;  5F3G A;  3VBU A;  3OPT A;  4UW4 A;  2P3I A;  1YJK A;  2RDR A;  3JXS A;  1TZO A;  4JDM A;  2Y0I A;  2JEN A;  4LO5 B;  5H9Q A;  4E4D X;  1D0G A;  1QH6 A;  4LKD A;  4UWD A;  3ZSL A;  2ZEW A;  5T5L A;  5JI9 A;  1JYC A;  2CYF A;  3OPW A;  4QPY A;  1IGO A;  1GP6 A;  1FNZ A;  3LSE A;  4YFW A;  5BNO C;  3USU B;  4FCA A;  5DAV A;  4P9G A;  2QQP A;  3I4I A;  1BEV 2;  4GA9 A;  5A1F A;  2ZKN A;  5CFC C;  2FCV A;  1EAH 3;  4L97 A;  2AGS A;  1J1L A;  3QOP A;  4NHY A;  5GAL A;  1OLM A;  3JBG 3;  5E6H A;  4LLO A;  4MGQ A;  4BQ3 A;  1W9Y A;  1UMZ A;  4YZ4 A;  5BNO A;  5A3O A;  3ZFF C;  1S1A A;  1WGP A;  4QXC A;  1ZBE 2;  1UOF A;  2WNV B;  4K9S A;  5CFC A;  5T55 A;  4A3X A;  4LBJ A;  1CAV B;  4QQ2 A;  1QNY A;  2QUO A;  1N47 A;  1AR9 1;  1HRV 2;  1KS5 A;  4P5H A;  2ARA A;  3M7A A;  2OZ6 A;  2Y38 A;  3IDE A;  1K5M C;  4BHP A;  4BYY A;  4QU2 A;  5FK8 A;  4FFF A;  3ZFF A;  4EWD A;  5FXX A;  5FAX A;  5FYU A;  3F2Z A;  2RHP A;  2ZGS A;  2B42 B;  5FRE A;  4XFI A;  4I01 A;  5JSP A;  2MNG A;  1S0B A;  4UF0 A;  2PA7 A;  4AK3 A;  3MIE A;  2EXJ A;  1K5M A;  1YCI A;  4NOT A;  1ND2 B;  1WD4 A;  2IXH A;  4S2F A;  1UOB A;  3ZXK A;  3ZYP A;  5T5O A;  3KQ4 B;  4BA6 A;  1UQX A;  1OHF A;  2PLV 1;  3ITQ A;  3BUC A;  1JU3 A;  5J3U A;  4COY A;  3IT8 A;  4D69 A;  1J3P A;  4CZS A;  2NPI A;  1WWY A;  1GMM A;  2A70 A;  2CWM A;  5CFD B;  1S55 A;  1FX5 A;  1ZZ9 A;  1K5J A;  3CJX A;  1GOG A;  4LBQ D;  3DUI A;  1OA4 A;  1H8T C;  3G6J B;  3BTZ A;  2RM2 3;  3LFM A;  4LBL A;  3Q8E A;  4PDW B;  4CXX A;  1OI6 A;  4TTG A;  2GMP A;  1VMF A;  3GBG A;  3T2Q A;  3ECQ A;  3BOD A;  4Q5O A;  5JUV A;  1ND3 C;  4C1X A;  1QJY 3;  1O4Y A;  1AX0 A;  1QJE A;  1BMV 1;  1OVP A;  3K51 A;  3TEW A;  1H8T A;  5LCW L;  1WMX A;  4MV2 A;  4XF1 A;  5DQ0 A;  5FRA A;  1ND3 A;  2PHX A;  2ZGP A;  5G04 L;  3CZU A;  5FOJ B;  4CDX B;  4AVA A;  1ULC A;  3MEP A;  1MZ6 A;  3UET A;  5K8S A;  4ARY A;  2E26 A;  1QKQ A;  4OMC A;  3UYJ A;  3KQR A;  3SNM A;  4H14 A;  5LBE A;  3TEZ A;  3ZMN A;  1UZ0 A;  5EXO A;  5ABJ C;  3X29 B;  3O1M A;  4PIZ A;  2TNF A;  3TAY A;  2WYF A;  2MEV 3;  3FN9 A;  5FY0 A;  2ZS6 B;  1W8W A;  4IE7 A;  4BLI A;  2UYA A;  2A6Y A;  1Y9M A;  2J1T A;  4HZF A;  1UYY A;  1IPS A;  1RUE 3;  1QF3 A;  1KFU L;  1JZ8 A;  3BVC A;  4UFI A;  2IXL A;  4NIG A;  3MW4 A;  4CDU C;  2GP5 A;  3FLP A;  4J25 A;  4CPB D;  3N4M A;  2DUR A;  4A45 A;  1AF9 A;  3AXE A;  1FPN 3;  1PO1 2;  4AZZ A;  1D2S A;  4RN5 A;  5DAP A;  2XLG A;  2XUE A;  2YGM A;  1X9P A;  4HT1 T;  3MV1 1;  3AZW A;  4YW6 A;  5GZG A;  3VBF C;  3LA3 A;  3CJI C;  5C8C C;  5T54 A;  4CDU A;  1PX3 A;  1S2B A;  3OY8 A;  2GC2 A;  3CNA A;  2H0V A;  3GZT B;  3HQX A;  2VUA A;  4GQ7 A;  1POV 1;  1JOB A;  4JRA A;  4I2O A;  1SPP B;  1C3H A;  4EV0 A;  3VBF A;  1MS1 A;  2B8M A;  3CJI A;  5DAQ A;  5C8C A;  1KS4 A;  2VL4 A;  3AVS A;  4AEK A;  5C4W B;  2HWC 2;  4IV1 B;  2XML A;  3BB6 A;  1QJX 3;  2NMN A;  2VVF A;  4PIX A;  1VAL A;  3M4F A;  2VOW A;  3IPV A;  5CKQ A;  1LES A;  4L9B A;  5FXZ A;  5JR2 A;  1EY2 A;  3B9I A;  3E5Q A;  1RGS A;  3LDK A;  2YBP A;  1PNG A;  3BN6 A;  1OD5 A;  5F3E A;  1YUD A;  4YGD A;  1VBA 3;  1QU0 A;  1JTZ X;  3I2K A;  1UNB A;  1XB9 A;  3KCC A;  3OOX A;  1WMF A;  2HWB 2;  1F35 A;  2JDN A;  3AFG A;  3NNL A;  3HD8 B;  1WA4 A;  5FPV A;  5FZL A;  3TN9 3;  4H7M A;  4TWT A;  5BNQ A;  3SH4 A;  2DUQ A;  1RUH 1;  2C5D A;  2JIC A;  3PIG A;  4XQD A;  2NP0 A;  4OFG A;  1NT0 A;  2VOX A;  3GJA A;  2EIE A;  3WIN E;  3ZPO A;  3KV6 A;  4E8C A;  5CNA A;  1K42 A;  1ZZ7 A;  2JDZ A;  1JYT A;  5A1A A;  1MS0 A;  4YW4 A;  4EYU A;  1W3V A;  1VR3 A;  2C4X A;  1YQC A;  4Q4Y 3;  1UWW A;  1L7R A;  5CVR A;  4XMI A;  5HXV A;  4OHX A;  3WNO A;  2KXL A;  3KF5 A;  3Q8C A;  3FWE A;  4MXW B;  5L9R A;  3KT1 A;  4WM8 C;  3ST7 A;  3AFK A;  3OGR A;  1RUG 2;  2CY6 A;  1QJX 2;  4Q4W 1;  1O7F A;  2YG0 A;  3KSC A;  1L7L A;  1JUI A;  5FZF A;  1MEC 1;  4WM8 A;  1BXH A;  1C5H A;  4HG6 B;  4UT5 A;  1SCS A;  4XJA A;  2Q30 A;  1WLW A;  1TME 1;  1JYW A;  1UIK A;  2XBO 1;  1YFY A;  1ZBA 1;  3TN9 2;  4EE2 A;  4FXK B;  3L2Y A;  4GXL A;  5F8P A;  4E8D A;  5JZG C;  1W8T A;  1I5Z A;  3WHT A;  3K75 B;  4Q4V 3;  5DAX A;  5CB7 A;  4Q0Q A;  2J1U A;  3THP A;  1UMH A;  1UY3 A;  1SEF A;  4Y22 B;  4B3N A;  5E88 A;  3WQ0 A;  1UX7 A;  2PHT A;  5JZG A;  1W2T A;  1QY4 A;  3C8X A;  1OH4 A;  4OHV A;  3LIH A;  4XAC A;  1JYX A;  3S5Q A;  3WT3 A;  4BIO A;  1OQE A;  1XSQ A;  2VMF A;  4BM8 A;  5LBC A;  3A23 A;  3ZIX A;  5LA9 A;  4ZZ5 A;  1VE0 A;  3T1M A;  1QGL A;  4JGY C;  1X8E A;  1K45 A;  1QJZ A;  1PNF A;  2BNN A;  5LAT A;  4RS5 C;  2VZ1 A;  1UY4 A;  3FHA A;  4AW7 A;  4ZZ8 A;  3OD0 A;  1AL2 1;  5FP9 A;  1XYP A;  1RUD 1;  4CSW A;  3R0R A;  1GSL A;  1OF3 A;  1RHI 2;  2WZR 2;  2OZJ A;  1A6C A;  2R49 A;  4JGY A;  5EFU A;  1DLL A;  3EB7 A;  5JI7 A;  1W8N A;  4RS5 A;  3VBH B;  5C70 A;  4UYB A;  2RS3 1;  2PHL A;  1E5S A;  2K2S A;  4XBN A;  1OLQ A;  2EID A;  5IVJ A;  1NLR A;  2Q5T A;  1CAX B;  4P00 B;  3V56 A;  4W4Z A;  4CP0 A;  3WDY A;  4B7E A;  5LA2 A;  3HOB A;  1V6L A;  5DUW A;  1E57 A;  2R0F A;  3H7Y A;  5F32 A;  5B2G B;  3VBR C;  2CHH A;  2VZS A;  3L2H A;  3ZFG C;  5J48 A;  1CZS A;  4ATF A;  4MHU A;  1OFN A;  2ARC A;  3M3I A;  4R9D A;  1SBD A;  4AGG A;  2VCM A;  3VUO A;  5JWP A;  3ZLI A;  1QJU 3;  2XON A;  1PO2 3;  4LLF A;  3LA2 A;  4OI1 A;  3VBR A;  4C0H A;  1RIN A;  1SMV A;  3ZFG A;  5C9A B;  4ERO A;  4BQ5 A;  4YM3 A;  5ACA 3;  4HMZ A;  5BYN A;  2WWS A;  1DYO A;  3WUC A;  2HWD 1;  2VXR A;  1DGR N;  1T2X A;  4PLN A;  3PU3 A;  2DVD A;  2PXJ A;  3AMM A;  4QWN A;  3ZXG A;  3I2J A;  4KBZ A;  3J8F 1;  2WAB A;  1O3R A;  1DBN A;  3JB8 A;  3RZM A;  1ZZ8 A;  4S2D A;  2GNB A;  5FMO L;  3VKF C;  1JS9 A;  2WT1 A;  5FMC A;  4FFI A;  1EP0 A;  5BNP C;  2J1S A;  3RYP A;  2XJV A;  4AI0 A;  4QQH A;  1SLB A;  2AEZ A;  1TQ5 A;  4LIV A;  5T50 A;  5APA A;  3POW A;  5EP9 A;  5A3L A;  1OA2 A;  3F95 A;  2D6M A;  2CSG A;  2RS5 2;  4FSJ A;  1HRI 3;  4YW1 A;  5BNP A;  3SIS A;  3OGS A;  4LEJ A;  5FK7 A;  4WZC A;  3VBS B;  4LK6 A;  3AMP A;  5FTT C;  1ZVF A;  2DFB A;  1TME 2;  5SV8 A;  5EIY B;  4PT6 A;  3I49 A;  2R04 2;  3UKV A;  2CV6 A;  4Y20 B;  3PME A;  1TNF A;  2UY8 A;  3T3Y A;  5KXC A;  3O1P A;  2IXI A;  1F31 A;  3O0W A;  3ZMO A;  1MZE A;  3K48 A;  3RJR A;  3N9O A;  3T0B A;  5F39 A;  4NAM A;  2BBA A;  2VUJ A;  3III A;  5HI0 A;  5H9S A;  4FTB A;  2X10 A;  4UW5 A;  4LT5 A;  3A0K A;  3WNM A;  4LA2 A;  3GNE A;  5A32 A;  3IIA A;  5AFB A;  1J83 A;  3N9P A;  2KM2 A;  1W2O A;  3WDT A;  1M06 G;  1IKP A;  3KCY A;  3PDQ A;  1AL2 2;  3GF6 A;  3ZSM A;  4D7Y A;  4KGG A;  4E4H A;  5FMO S;  3TOJ A;  4FAG A;  1W6N B;  1LNS A;  2DVF A;  2QQK A;  4GAL A;  2WNU C;  4GJZ A;  2E63 A;  1GNY A;  3S7E A;  1AR7 1;  2RS3 2;  2HWF 1;  1CZT A;  4HBN A;  4XQ4 A;  3B93 A;  1PX4 A;  3ZIW A;  5IFP A;  4AVS A;  1RB8 G;  2WNU A;  5FQ0 B;  4QGL A;  3WF3 A;  4ET7 A;  4K8F A;  4LHS A;  3BPS A;  4A3Z A;  5FP4 A;  2D6P A;  1H4G A;  1RUC 3;  1S0F A;  1GU3 A;  2QQI A;  2SLI A;  3A0N A;  1MAC A;  2BNM A;  1CON A;  4IE0 A;  4Y5S A;  1YFW A;  2JJ6 A;  2QQO A;  1UIJ A;  2VVD A;  5EQU A;  5A3W A;  2ADE A;  2K9Z A;  5IT6 A;  2Y6G A;  1EPZ A;  1RMU 3;  3DPR C;  3K4D A;  4COV A;  4D8M A;  4DPN A;  1US3 A;  2RE9 A;  4CEY B;  5F7U A;  1UYP A;  4AI9 A;  1OC1 A;  5A3T A;  4XYX A;  4HVR A;  1DZQ A;  2JIJ A;  2ZZJ A;  3B69 A;  2GC1 A;  4PBP A;  1AR6 2;  3I59 A;  1Q8P A;  2FCT A;  3ZN6 B;  2JG9 B;  4NPM A;  4XUN A;  4GKY A;  5FPX A;  3DPR A;  5FY7 A;  5DXD A;  1XU1 A;  2LRP A;  2RS1 1;  2W1W A;  4XUO A;  1CN1 A;  5D1I A;  1A3K A;  2E7A A;  1JUH A;  2P6H A;  4LKF A;  4XJU A;  4OI0 A;  2V5D A;  2H6C A;  2G1M A;  1ENR A;  4X8P A;  1WCU A;  5JOY A;  3T09 A;  4Z1V A;  1SG3 A;  3OUI A;  5JXI A;  3S57 A;  3D3A A;  3N36 A;  5C3S A;  2W46 A;  5C71 A;  1DGW A;  3V65 A;  1HQL A;  4KGQ A;  3HBZ A;  4PBO A;  2R07 2;  3WV6 A;  1W99 A;  2ZGR A;  1TMF 2;  3H7J A;  4XE9 A;  1SFP A;  3C7G A;  4YW3 A;  3M1H A;  4C90 A;  2Q8D A;  2ARX A;  2Q8O A;  2PTM A;  2W94 A;  4PI2 A;  1OUX A;  3O1V A;  2XLF A;  5IVE A;  1VBE 2;  4LUL A;  2XJP A;  2G9F A;  2A6Z A;  3CF6 E;  1HXS 1;  4IE5 A;  5IUQ A;  2B39 A;  4UBG A;  4B4R A;  2DFC A;  2IXK A;  4ITC A;  1J84 A;  1REF A;  3B02 A;  5FPA A;  1RVF 3;  2VH9 A;  2ZZQ A;  1JZ3 A;  1UKR A;  1XNA A;  2ZAH A;  1C57 A;  5EV7 A;  3VDA A;  1DGR A;  2OII A;  2HBT A;  1AXY A;  1RUO A;  5GM0 A;  1TNR A;  1KJL A;  5GZE A;  4N7U A;  4BDV B;  4D7T A;  4YVW B;  5JXG A;  1XSR A;  3ZXL A;  1R64 A;  1VBC 1;  4LBN A;  2D40 A;  3VZK A;  4CA9 A;  3D6E A;  5FZH A;  2Y6F A;  4AVT A;  5LWB A;  1VRH 1;  4UAP A;  1NCQ C;  4LO6 B;  1IS3 A;  5FYZ A;  1YIP A;  1JMU B;  5LK5 A;  1V0A A;  5BY5 A;  2XDV A;  3INA A;  1OKO A;  1V9U 2;  3OB8 A;  2I74 A;  2MPF A;  1NCQ A;  1FOD 2;  2WAO A;  3W58 A;  4AWD A;  5GZC A;  1HB3 A;  4H55 A;  5EJ1 B;  4XCB A;  4W6Y A;  2E33 A;  1ASJ 2;  5IVY A;  4DXR A;  4PLM A;  3IBM A;  4L2N A;  3E6B A;  3ZSE A;  4CDW B;  1U5I A;  5A7N A;  3PUA A;  2WS9 3;  4UBH A;  3SLI A;  1RUJ 1;  2AC1 A;  2WAA A;  5C33 A;  1F4H A;  3B5L B;  3UKN A;  5F3C A;  1JYV A;  4XQW A;  3RDI A;  4OHY A;  2FDJ A;  1ZZC A;  4K1Z A;  2WNE A;  5JOZ A;  1F15 A;  2OX0 A;  2ZEY A;  5FBZ A;  1D4M 3;  3ACI A;  5JMC A;  1Q8Q A;  1RUI 1;  4BQW A;  4HXC A;  1AXZ A;  1R08 3;  2JDU A;  1ZYB A;  2D44 A;  2J22 A;  1Z7S 3;  4QX8 A;  2WFP A;  5I0T A;  3T2O A;  1H6Y A;  2NLR A;  1YQ2 A;  2Y6H A;  2W1U A;  3THC A;  1AYN 2;  1MS8 A;  3DXT A;  4V1P A;  4AAX A;  2XHN A;  4RFT 0;  1IHM A;  2XOM A;  3E5U A;  3K2O A;  1IS6 A;  4AVB A;  2A6V A;  5JOX A;  3C7E A;  3LF7 A;  4YGB A;  1PVC 1;  1Z78 A;  4XFC A;  4PCR A;  1Y7B A;  2C9A A;  4I3P A;  3E1F 1;  4MX3 A;  4BXF A;  4M4P A;  1U5X A;  2W92 A;  4IQP A;  5DZG A;  3U10 A;  3AK0 A;  4LO4 B;  2FDF A;  5GLT A;  3T2T A;  4AFA A;  2WFF 1;  3JCI A;  1E5H A;  2DCZ A;  4LO8 A;  1JZ2 A;  1X50 A;  4LOT A;  4N43 B;  5E1R A;  4ZU4 A;  3HWJ A;  4HPK A;  4P14 A;  5JXH A;  2Y6K A;  4JVA A;  4IV3 B;  2FBE A;  2GN7 A;  1QDO A;  5A33 B;  1J1T A;  1FT9 A;  3MIB A;  4KL1 A;  1YQ6 A;  3N7M A;  4ZY9 A;  3WY6 A;  1FAY A;  5C6C A;  5CAD A;  3PUR A;  2XQR A;  5JPN B;  2ENR A;  2E6V A;  1VBB 1;  1DIW A;  1W8H A;  2AYH A;  3I3Q A;  3K4A A;  1AR8 1;  4D6Q A;  2ZX2 A;  2PHU A;  4DFS A;  2WRA A;  4IGQ A;  5IAT A;  3VDD C;  2R32 A;  2IUW A;  2VMI A;  4LR4 A;  1SBF A;  2LM3 A;  3ME2 A;  1UY1 A;  3ZFE B;  2YXS A;  1GOF A;  2ZCW A;  2RR1 1;  3JD7 1;  4HVO A;  4AQ2 A;  4Q0U A;  4YSF A;  4MGI E;  1RUF 2;  2IC1 A;  2ZAC A;  4EN9 B;  5LEJ A;  5F5A A;  3VDD A;  2P3J A;  4XFA A;  5J7M A;  5KHJ A;  2XKO A;  4U2A A;  2AH2 A;  4DRR A;  2YRO A;  3IMN A;  3AYA A;  3PMS A;  4GWM A;  5DPN A;  1KIT A;  4I0B A;  2HKX A;  4MGY E;  3WEZ A;  3MFC A;  4BQ4 A;  4N53 B;  4CE8 A;  3U0Z A;  1DQ1 A;  2N7G A;  3DEM A;  4P5Y A;  1FI2 A;  1VBD 3;  4RGK A;  4X6Q B;  1ULG A;  5FO8 B;  2VZO A;  2PFW A;  3KF3 A;  1DQ5 A;  1Q8O A;  4QD2 A;  2JDH A;  2W68 A;  2YC0 A;  3ELN A;  1LR5 A;  5J09 A;  2BDR A;  4CCL A;  4QDS A;  4CVU A;  4XTM A;  1US2 A;  1WLT A;  4MO3 M;  4XUQ A;  1DYP A;  1MVE A;  4LOS A;  4XF9 A;  4IEX A;  1I3H A;  1W3X A;  2RMU 2;  4ZU7 A;  1PIV 3;  3N9Q A;  2YPD A;  5A7Q A;  4DZG A;  3USU A;  4EN7 B;  1YQ8 A;  4XAB A;  4JC1 A;  5DG2 A;  5JVV A;  2WNV C;  3TWI A;  5C3Q A;  3EO6 A;  4YM2 A;  2OT7 A;  4CP9 B;  4AHY A;  3M2M A;  5FY9 A;  4GB3 3;  3NVC A;  3ZYB A;  1QQP 2;  2ATF A;  1ACC A;  1EV1 3;  1HB1 A;  1KGY A;  4QPI B;  1IG0 A;  4CCE A;  2WJS A;  4V2V A;  2WNV A;  3NNM A;  1JH5 A;  3H42 B;  1CAV A;  2VCA A;  4GH4 B;  3VKM A;  1RXG A;  4BK5 A;  1KRI A;  3ILF A;  3CDZ B;  4CCJ A;  3FMG A;  1ND2 C;  3GYD A;  1I6X A;  4YW5 A;  5JSO A;  4AEJ A;  3OSD A;  5I8Y A;  2JWP A;  1RED A;  1ENX A;  1DDL A;  4RA0 A;  4AHZ A;  4B7K A;  4E4S A;  2CNA A;  5FZ6 A;  3RFR A;  1OUR A;  1ND2 A;  1TEI A;  1F8V A;  3BOP A;  4QGM A;  2GDF A;  2EIG A;  4CCD A;  2XJT A;  1WCS A;  2WFF 2;  3BCW A;  3ZVX A;  5CFD C;  1REE A;  1U0A A;  1CVN A;  3O1U A;  4JQR A;  5BPX A;  3OEA A;  2W47 A;  1BJQ A;  3IM0 A;  1Q8V A;  4E2S A;  4LUK A;  1MZF A;  1QOS A;  2CU5 A;  4PDW C;  3O1R A;  2ZGT A;  3WW2 A;  1CX4 A;  1LU1 A;  1L7Q A;  4GMP 3;  1DLC A;  1VIW B;  2WWU A;  3HNB M;  4IEY A;  4IGP A;  5DUV A;  5FP8 A;  3MIC A;  4ZXE A;  5CFD A;  4CU8 A;  1BEV 3;  5I8T A;  5KC5 A;  5L36 A;  1RTV A;  2XKP A;  5GJ6 A;  3C7H A;  2YB7 A;  4FOW A;  4MH0 E;  5EYY A;  4PDW A;  1YO8 A;  4BME A;  2G4I A;  4C91 A;  5BNN B;  5LA1 A;  2DCK A;  4YG0 A;  1ZBE 3;  4IXL A;  4Y1U A;  2Q1M A;  4NUB A;  5H9R A;  4CDX C;  1BVV A;  3EJK A;  2P37 A;  1LEM A;  1EAH 1;  1CJP A;  3KZ4 C;  2PHW A;  3WX5 A;  4QM9 A;  5A7W B;  4B1M A;  4CXY A;  3LOI A;  1R09 1;  1LHW A;  2D6K A;  2EA7 A;  4KG0 A;  3LPG A;  4CDX A;  2Q8E A;  3POY A;  1E5R A;  4QHB A;  4XDQ A;  2VG9 A;  3H8R A;  2P4E A;  2WSV A;  3HAG A;  1W03 A;  2DVB A;  2X53 S;  3AX4 A;  1CAU B;  3RZG A;  3ZXF A;  3WLU A;  4FTE A;  3N7K A;  4BJ0 A;  1LHV A;  2R0H A;  3FUO A;  4M4R A;  3I2G A;  3K3O A;  2CDO A;  4JTO A;  4BB3 A;  4DXS A;  2UWC A;  1CWP A;  2JDK A;  1C5I A;  3WSO A;  1WCQ A;  2X5I B;  4M3C F;  2Y0O A;  3AYD A;  2VQ0 A;  1CZV A;  1PGL 2;  1NQJ A;  3MO4 A;  4Y5T A;  1UY2 A;  1DQ0 A;  2NM1 A;  4BXS V;  3UNP A;  4UFM A;  1H0B A;  1O5L A;  2BP6 A;  1VLN A;  2ZML A;  3MIF A;  4Y1Z A;  4PLO A;  1YEW A;  4GWN A;  4QPW A;  4YGC A;  4IEO A;  1CES A;  2JE8 A;  2VME A;  2B45 X;  2OA2 A;  5C4W C;  3A22 A;  2VO5 A; 
#chains in the Genus database with same CATH homology
 3EMR A;  5IAV A;  3W20 A;  5ERL A;  4XAB A;  5LBB A;  5DAW A;  5C5T A;  5M0T A;  4NHX A;  4Q5O A;  4XC9 A;  3PL0 A;  2A1X A;  3NNM A;  2RDS A;  3GJB A;  3HQR A;  4XCB A;  3W21 A;  2RDQ A;  2HBU A;  5LAS A;  5HV4 A;  5DAX A;  4BQX A;  2RG4 A;  3OBZ A;  5LBE A;  4XAA A;  4XAC A;  5LBF A;  4XCA A;  4BQW A;  5LBC A;  5LA9 A;  3NNF A;  5IAX A;  5LAT A;  3BVC A;  5HV0 A;  4JZR A;  4J25 A;  2FCU A;  4ZPI A;  5DAP A;  2RDR A;  4Y5S A;  4NHM A;  5EQU A;  4NHK A;  4UWD A;  5L9B A;  3MGU A;  3DKQ A;  5A3U A;  5DAQ A;  3OUH A;  5DAV A;  2JIG A;  2Y33 A;  2FCV A;  3OUJ A;  2JIJ A;  4MHU A;  3KT4 A;  4MHR A;  4NHY A;  2FCT A;  3HQU A;  3KT7 A;  4IW3 A;  2G19 A;  5LB6 A;  4BQY A;  5EPA A;  5IAT A;  2G1M A;  4NAO A;  3OUI A;  2Y34 A;  4NHL A;  4KBZ A;  3NNL A;  2OPW A;  3GZE A;  3GJA A;  4Y5T A;  3NNJ A;  5EP9 A;  5C5U A;  3ITQ A;  2V4A A;  4NMI A;  2HBT A;  5L9V A;  4ZON A;  2RDN A;  5L9R A;  3KT1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...