1QJX3

Human rhinovirus 16 coat protein in complex with antiviral compound win68934
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
238
structure length
238
Chain Sequence
b'GLPVYVTPGSGQFMTTDDMQSPCALPWYHPTKEIFIPGEVKNLIEMCQVDTLIPINSTQSNIGNVSMYTVTLSPQTKLAEEIFAIKVDIASHPLATTLIGEIASYFTHWTGSLRFSFMFCGTANTTLKVLLAYTPPGIGKPRSRKEAMLGTHVVWDVGLQSTVSLVVPWISASQYRFTTPDTYSSAGYITCWYQTNFVVPPNTPNTAEMLCFVSGCKDFCLRMARDTDLHKQTGPITQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN VP1
molecule tags Virus
publication title Analysis of Three Structurally Related Antiviral Compounds in Complex with Human Rhinovirus 16
pubmed doi rcsb
total genus 41
structure length 238
sequence length 238
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1999-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1qjx300
2HWF3 5FMOS 4GH4C 1ND2B 3VBFB 4CDUC 1RVF1 2WZR1 1ZBA2 1EV11 2HWB3 3J8F2 4RQPA 1VB4A 2R073 4Q4W2 3VDDA 4JGZB 5C8CC 1TMF3 1F2NA 2RS51 1AYM3 4CDUA 2R043 4SBVA 4IV3A 4GMP0 2ZZQA 4AEDB 5A32A 4Q4W3 1HRI1 4PDWB 1FOD1 1C8M3 1RUC1 4CEYA 1QJX2 1RUH3 3VBSC 1ZBA1 1PGW1 3VBOB 5ACA3 1ASJ1 1PO11 1HXS2 3CJIB 1COV2 4FSJA 4AEDC 1K5MC 1C8M2 5AC92 4Q4X2 1QJU3 3HAGA 1OOPB 5FMOL 2FZ1A 1VBB2 4IV1A 5CFCB 1RB8G 1EV12 2WS91 1K5MB 4NWVA 2X5IA 5K0UB 3VBHA 1EAH2 1OHFA 1H8TA 1RMU1 1RUD2 3CJIC 1DDLA 1QJY2 5LK7B 1RUH1 3VBOC 2HWB1 1MQTB 2MEV1 4CEWA 1RUI3 4RR3A 5ABJC 1PO23 1COV1 3ZFEA 1TMF2 3TN91 1POV3 1IHMA 4WM8A 1RUJ2 2RS32 1VBC3 1VBE3 5D8AB 5CFDA 1NCQA 1QQP3 1VBB1 5BNPC 1MEC1 1BEV2 1HRV2 1MEC2 1ZBE1 1R1A3 1C8M1 1FOD3 1EAH1 1RMU2 1NY72 1VAKA 4WM7A 2VQ0A 1OOPC 2HWD1 1RVF3 3DPRA 3NAPC 5C9AB 4YVWC 4QPGB 5A33B 4GH4B 2GSYA 3VBFC 2RS53 1VRH3 3VBRA 2GH8A 2HWC3 4CDXA 2HWE3 1D4M1 3ZFGB 1ASJ2 1PO12 5L7OB 1PVC2 4CEYC 3TN92 2HWF1 2TBVA 1V9U1 1R093 4YVWB 1VBA3 3VBFA 1ND3A 1RUF1 2WLPA 4CDQC 3VDDB 4GMP1 5BNPB 4CDUB 1PGL1 1AR91 2HWB2 1AR63 4IV3B 2MEV2 4QPIC 5A32B 1PVC1 2WS92 2XBO3 1R081 2R042 4CEWC 1VBA1 5K0UC 1BMV1 1TME2 1BMV2 5BNNA 2WFF2 4FTSA 1RUF3 1CD3G 1POV1 2BFUS 1V9U2 3VBHC 2HWF2 1HX6A 1QQP2 1FMD3 1OOPA 5CFCA 4N53A 1MEC3 4IV1C 3J8F1 5C4WB 4RHV3 4Q4V2 1K5MA 2X5IB 5K0UA 1H8TB 3VBSB 1PGL2 2RS13 2ZTNA 1EV13 4PDWC 1RUI1 3LOBA 1AYN3 1D4M2 1MQTA 1RUC3 4RS5A 3VBUA 4WM8C 5DDJ3 1BBT2 3ZFEB 4RR3C 5ACA1 4JGYA 1RUE3 5D8AA 2BUKA 5CFDB 1NCQB 3JB4C 2R041 1QJZA 2RMU2 1TME1 1NCRB 1FPN2 1R1A1 4CDXC 3ZFFB 4Q4V1 2HWD3 1NG0A 3VBRC 2RR13 4WM7B 3JD73 1AR92 4QPGA 1B35B 2WFF3 4LLFA 5A33A 3ZXAC 3NAPA 4WM7C 3VBRB 2HWE1 4CDXB 3ZFGA 1NCRC 2QQPA 2WS93 4Q4Y3 5ACA2 1NCQC 1R082 3DPRC 2RMU1 1ND3B 1AL23 4Q4X3 1RUF2 4GB33 4FTBA 1FPN1 2WFF1 1AR71 1ZBE2 2RM22 4RQPC 5AC93 4YVSA 1RHI3 2R071 5BNPA 2X5IC 1QQP1 4CDQA 1VBD2 1AL22 1VB2A 5BNOB 4CDWC 1ZBE3 4Q4V3 4QPGC 2PLV3 1AR82 1AR81 4JGYC 2HWE2 1POV0 1ASJ3 1PO13 3VBUC 1RUI2 5BNNB 1RUG2 1ZBA3 1AR73 2R072 2R063 1HXS3 4QPIA 1PIV2 1NA1C 1VBB3 4N43B 5D8AC 4CDWB 1TME3 1M06G 4N53B 4RHV1 3JB8A 5J98B 1A6CA 5C4WA 1R1A2 4Q4Y1 4Q4Y2 1NA1B 2RS11 5JZGC 3VBSA 3ZFFC 1AR62 1ND3C 2IZWA 5DDJ1 1F8VA 2MEV3 1PO22 4RS5B 2WZR3 3VBUB 1BBT1 1RUJ3 2WWSA 5CFCC 1QJX3 4JGYB 2HWC1 1PIV1 3M8LA 2BFUL 5ABJA 1VBE1 1VBC2 5JZGB 1NCRA 2ZAHA 4YVSC 1GFF2 2RM21 4Q4W1 3ZFFA 1QJU2 4N53C 5J96B 2RMU3 1EAH3 1RMU3 1B35A 4N43C 1RUG3 4EJRA 2R061 3NAPB 2R062 5BNNC 1AYN2 1D4M3 2XBO2 3JBG2 1VBE2 1VBC1 5DDJ2 4JGZC 5C8CB 1PGW2 1Z7S1 1NOVA 1Z7S2 3IDEA 4Z92B 1SMVA 3ZFEC 1ND2C 5BNOC 1C8NA 1V9U3 1ND2A 1FPN3 1WCDJ 3JD71 1FMD2 1H8TC 1RUG1 4RQPB 4GMP3 4JGZA 1PIV3 4YVSB 1QJU1 5FOJB 1AR61 1VRH2 4CDQB 1RUH2 1HQNA 5BNOA 2PLV1 3S6PA 4AEDA 2RM23 2HWC2 1PVC3 4PDWA 1AYN1 2XBO1 4CEYB 2BPA2 1VBD3 1X36A 1PO21 5L7OC 3TN93 3VBOA 1BEV1 1HRV1 1HXS1 4NWWA 1AUYA 3CJIA 4RFT0 4GB31 1RUE2 4BCUA 4QPIB 4CDWA 1B35C 4N43A 5AC91 1AYM1 2HWD2 1AYM2 5C4WC 1QJY3 4IV1B 4RHV2 1FMD1 3JD72 1AR93 1AR72 5C9AC 2Y26A 1HRI2 1NA1A 1OPOA 3VBHB 1R091 2RS33 1RUD1 5CFDC 1VBD1 1AL21 2FZ2A 2PLV2 4FTEA 2DF7A 4CEWB 4RR3B 1BEV3 1HRV3 1RUE1 1E57A 4WM8B 3ZFGC 3JBG3 1FOD2 4Y4YA 5ABJB 2WZR2 1RVF2 5JZGA 1Z7S3 1MQTC 2RR12 1W39A 2RR11 4GB32 2RS52 3VDDC 2XPJA 4Q4X1 1RUD3 3DPRB 5C9AA 5GKAC 3FBMA 1RHI1 4GH4A 1RHI2 1TMF1 1COV3 4RS5C 1AL0G 2RS12 1BBT3 1RUJ1 1R092 1RUC2 1QJX1 3JBG1 1QJY1 1VRH1 1X33A 1VBA2 5C8CA 1CJDA 5L7OA 1AR83 3J8F3 1R083 1HRI3 4Y5Z0 2BBVA 4YVWA 1NY71 2RS31 4IV3C
chains in the Genus database with same CATH superfamily
3ZM8A 4XZPA 3UL2A 3VBFB 1ND2B 4R9DA 5A6XA 4UW5A 3INAA 2FDJA 2VE1A 2FCTA 4LBNA 2E9QA 3OD0A 2XHKA 2NLRA 4G9SB 4IEXA 2I2SA 2OXBA 4M01A 5CYYA 4LQRA 1ZM1A 1AYM3 2Q1FA 3OPZA 4QB2A 4CCLA 1W6NA 4FXGB 2ZGSA 1S0DA 2BNOA 4I3PA 2ETEA 3HQRA 4SBVA 3GZTB 1X50A 3LF7A 2PAKA 4HMZA 2JG9A 2A75A 1JZ2A 2RDNA 2VQTA 3MV11 5AFEA 2JKBA 4Y1UA 1DF0A 4PDWB 3ZVXA 1ZZ6A 3GBFA 2ZKLA 1CVNA 3PMSA 1QJX2 2CDPA 4C0HA 2VZVA 2VG9A 1PGW1 3VBOB 3O1OA 4DEQA 2JDZA 3OF1A 4CCEA 4LT5A 4NIHA 2ZGPA 5FYIA 1G7YA 1GR3A 1K5MC 2G19A 4YNIA 4M4RA 4UYBA 3SHRA 3S57A 3GCXA 4ZY9A 4ZU4A 1UXXX 4M3CF 1KJLA 4CP9B 5CFCB 2CWMA 3RGBA 4R9CA 4BB3A 1NXMA 1XE0A 4QXHA 2W87A 1W28A 1GOFA 2P3JA 2QQVA 2Y60A 3PU8A 5FIXA 3MFCA 1EUTA 4AGGA 1TEIA 5K0UB 1ALYA 1XYNA 1YJLA 4A44A 1H8TA 1RUD2 4HANA 4MUVA 1DZRA 2OW4A 3A0NA 2J42A 2JB4A 4QX8A 5LK7B 1PMHX 3VBOC 2HWB1 3AZVA 4YFZA 2CWSA 1OKQA 3H9AA 1ULPA 1T2XA 3RRDA 5ABJC 1COV1 2B46X 4NRPA 1GQHA 2Z4FA 2VJXA 5FBJA 3IPVB 5HCBA 5SV8A 2RS32 1VBE3 1NZCA 1IS4A 1L7QA 1GZTA 3VZMA 3C8XA 4Z82A 4MOAA 1DLCA 4IGOA 2ZGQA 1QU0A 2VNOA 4PBPA 3V56A 1OKOA 3WXPA 2I07B 1MEC1 5A7QA 1OVSA 3TRSB 4BQ3A 3AL6A 2XOMA 3FL7A 4F83A 4DUXA 3U1XA 1NKGA 5CIRA 3ZN6A 2Y6HA 4FPFA 2JDUA 5C5UA 1C8M1 3IZOA 1VAKA 1W2NA 4IEVA 5FKCA 2VCCA 2YBKA 3CLPA 3KF3A 2J1SA 1URXA 4KQ7A 1H6XA 5FOBB 4QQPA 2JENA 3T0BA 3ZMOA 2ERFA 1LHUA 1S4CA 2GH8A 2HWC3 3A23A 4IEQA 2DBIA 1N1SA 2GMMA 4IE6A 4JRLA 5FZAA 1PO12 5L7OB 1WD3A 4XJAA 1PVC2 1S0CA 4H14A 5J37A 4P9WA 4CEYC 4GAZA 4FOWA 1UF2C 2E7QA 2HWF1 3LA3A 4OZXA 5FPUA 5J09A 4LO4B 1K3IA 5FYZA 3ITQA 4BISA 3SXWA 3PHMA 4YZ5A 2CAVA 2J7MA 3AMQA 2VUJA 4JCKA 2D6LX 4GKXA 4BZ4A 3HN1A 3VDDB 5DZFA 2VOVA 1O91A 4GMP1 2D5HA 2P5BA 1MS4A 1CR7A 4GIQA 5FY0A 4NMIA 4XTMA 3CZUA 4S2HA 5L9BA 2ZGNA 3KM5A 5LB6A 3ZXDA 1ZREA 2AH2A 2MEV2 1APNA 2YG0A 4XABA 4XJZA 1LODA 2G9ZA 2D43A 2WS92 4HXCA 1OLQA 4JHTA 3LEIA 2VGDA 1DZTA 3PJYA 4RL7A 3OCPA 2E51A 4C8DA 5IWFA 4O9GA 2OZ6A 4LKFA 5LBFA 1SCRA 4BIFA 1BMV2 2XJQA 3GHNA 5BNNA 1KDKA 3BALA 1RUF3 1FAYA 1WA6X 1CD3G 3CNAA 2XG3A 3C7GA 1CAUA 5DG1A 1GNYA 1GWLA 2IVJA 4CCNA 4BXSV 3KWVA 3DYPA 4LMFA 2JDPA 2JICA 4HN1A 4FPEA 2GP5A 3BB6A 1OOPA 3E6BA 4FAGA 4URTA 5KHKA 4XF4A 4I0WB 4I01A 1MEC3 1KD7A 3WG1A 2Y6FA 3WNLA 1PK6B 4DINB 2LUWA 4Q8KA 2Q8CA 4YZ3A 2G9GA 4Q4V2 1JYXA 3AP6A 1H4GA 4GJZA 2J1EA 2ZS6B 1PGL2 3U4SA 5KHJA 4BU2A 4K1YA 1RL3A 1EV13 4PDWC 4OI4A 4CU9A 1D4M2 3ZYJB 2AYHA 3A0KA 4R4XA 4JX0A 2XB6C 1J3PA 2WRAA 1YUDA 2VUDA 2ZEYA 3I2HA 3IDBB 3V0AA 4NHLA 2W3JA 1UU6A 2BUKA 1XC6A 2X09A 4QWNA 2R041 1UMHA 1UY4A 1X7NA 4EWAA 2RMU2 5BNQA 2EVXA 3KMHA 4E8DA 4JDMA 3WP5A 3MEPA 1W0PA 4ASMB 4LBMA 3O1PA 4NIDA 4JTOA 1T6GC 4KMQA 1NG0A 3PDQA 5DAPA 4EQVA 2YV8A 3KB5A 2XLFA 2ZX3A 2JJ6A 2RDQA 4Y26A 1ULCA 4HKLA 1AR92 4UFJA 2YHJA 4XFIA 4BDVB 1DLLA 1YQ6A 2DCZA 2VMEA 3VZKA 4QB6A 4BQ5A 1LAJA 3C7FA 1REFA 4K8FA 4Q8LA 4ZU7A 3NAPA 2ATFA 1BK1A 4WM7C 3Q8CA 5F5AA 1Y3TA 4D6QA 1E5SA 4ONUA 3VBRB 5DAQA 4S2DA 4H55A 5FZ1A 1OURA 3GZEA 3ZOIA 4EN0A 1N3OA 2IUWA 1R64A 4H3WA 5I0SA 1VRBA 4LIVA 4M0HA 4N9HA 1NCRC 3IDAA 3E5XA 2QQPA 4Y5SA 4KWUA 2KR2A 1IS5A 3T2OA 1UOFA 1NCQC 3ACIA 1KDMA 5HCFA 3AYEA 4HN0A 3OEBA 3VZOA 1U5YA 1UPIA 3DPRC 1WZXA 1OF3A 1U5IA 2BGCA 1W9FA 2E7TA 1W6PA 3HBKA 4YZ2A 2B8MA 1ND3B 1N47A 3MW3A 5SV5A 1TG7A 5A3NA 2J1AA 1AL23 4Q4X3 4CVUA 4OMDA 2UYBA 2VZPA 2QQOA 3ZPOA 1ZBE2 3LFMA 3N7JA 5DPNA 5FZ6A 3VL8A 2W68A 4AGVA 2OKXA 4YVSA 4D69A 2ZA9A 2EIEA 1YQ2A 3MBWA 1TQ5A 4ZS3A 4O65A 1WCKA 4Q27A 4YGDA 1OLRA 2RV9A 1VBD2 5DUWA 1AL22 3LPFA 4WVWA 5BNOB 3RZKA 2BW8A 2Y6JA 4Q0SA 1IQAA 4NUBA 3SH5A 3AKSA 4XOGA 5FQ0B 4CDWC 4XJ8A 1GZ9A 4QXKA 3HOBA 1UNBA 2A6WA 2GNMA 3O1RA 5A7WA 4CP2A 3SEPA 1BZWA 1ASJ3 3HWJA 3TEYA 1XNKA 4OLLA 4V2WA 1RUI2 2VCMA 3E6CC 3WF1A 3WG3A 1DGRN 3LSEA 4XURA 1ZBA3 4AHZA 3NNGA 1KGYA 4KI5M 3OUIA 1NA1C 1VBB3 2EIGA 3ABZA 4N43B 3GYDA 4CCDA 4XQ4A 2EALA 3IBMA 3K4DA 5LRSA 3LSDA 2QQLA 3USUB 3U14A 1LEMA 2Q8EA 1SLLA 5LCWL 3QACA 1A6CA 2F4PA 4COZA 2FDHA 4OFGA 1R1A2 4EN9B 4CSWA 3RG0A 3O7OA 5JOZA 3AM2A 3OG2A 2WT0A 4QHBA 1YO8A 1NLRA 2CAUA 1CAWA 4RGKA 3ZFFC 2GALA 2MEV3 5FZOB 4BA6A 2Q0AA 4RS5B 2Z79A 4BMEA 5FDBA 1J83A 4MGZE 3TEWA 5D21A 1BBT1 3KV6A 1GNZA 3LIHA 5FZHA 4CPBD 4AZZA 1F31A 2F6BA 2A70A 1QJX3 4JGYB 1UOJA 2HWC1 4W6XA 1CIYA 1A3KA 1VLNA 3NRUA 4YW5A 2R7EB 2DUOA 4IEYA 3UK9A 1C5IA 5FR3A 1QH6A 4AI1A 3ON7A 4CXXA 1DGWX 2QKDA 2AUYA 2HKXA 1LTEA 1VBE1 3MHZA 3UYJA 1MS1A 1NCRA 2ZAHA 3C2UA 3PNAA 4LK7A 1SLBA 4JV4A 4BYYA 4YM0A 4IESA 3N3HA 4CTEA 5HV4A 1SBDA 2QE3A 1IGOA 1XSRA 3OY8A 3PUAA 2RMU3 4TSVA 3S0MA 1EAH3 1K5JA 1W6MB 3CHXA 3M7AA 4MH0E 5GZDA 5CBLA 1B35A 4N43C 5HCHA 1RUG3 5LA0A 4FOYA 4PBOA 4WVMB 1F5FA 2GAUA 1RJ7A 1XNDA 3MIHA 2A6YA 2D6NA 2XL7A 2R061 1SHWB 3LQCA 3AP9A 1JMUB 1LNSA 3VZLA 2E53A 1D4M3 1VBE2 5DDJ2 1UPSA 1H1MA 4CXWA 2LS6A 2VZTA 2XH6A 2WO7A 1NOVA 4NAOA 2YBPA 4ZZ8A 3IDEA 2R32A 1SMVA 5FZEA 3ZYRA 4W8JA 3BODA 1JYIA 1G9DA 3ZFEC 3B3QE 4LOTA 1PM4A 5BNOC 1W9SA 1C8NA 4L11A 1S55A 5GZGA 1MS0A 3FJSA 1HN1A 5FKBA 1FPN3 2BU9A 3WNXA 1WCDJ 3EJKA 1V00A 2P34A 5JSRA 1YNAA 1FMD2 4ORFA 3W5NA 2CNAA 1VAVA 5EXOA 1JI6A 2Q1MA 2ZX1A 5FP4A 1WCQA 2JECA 2P3KA 1AF9A 4UF0B 5A3UA 1PIV3 2XXZA 5EPAA 4HZFA 3ZXKA 1OQDA 1W2AX 4O7XA 5IVCA 4BWOA 5FOJB 2PHFA 3I59A 3DV8A 4CDQB 3WNNA 4RGAA 1HQNA 3KS7A 1FV2A 2W2IA 1OH4A 4AEDA 1CAXA 3D6EA 1H30A 1W8ZA 4UXAA 1DHKB 4YZ4A 5LA1A 3ETPA 3ZLIA 1PVC3 2V73A 4DXTA 5LA9A 2FDKA 1W6QA 1RTVA 5A7NA 1VBD3 2NMNA 4XTPA 4Y1VA 1BJQA 1JOPA 1NE6A 3P1IA 1X36A 3RZGA 2JIGA 5EYYA 5L7OC 5FZLA 3TN93 4G4FA 4CP1A 1AUYA 1J1LA 2CL2A 3G6JB 4LHSA 4C0BA 1D2QA 2ZX2A 1LOFA 1QMJA 4QPIB 4CDWA 3O1TA 3KF5A 2VAUA 4D3WA 2X10A 2HWD2 3L2YA 1AYM2 2XJPA 3THDA 1TZOA 4MXWB 4IV1B 4NROA 1YI9A 4RHV2 3JD72 2P2KA 2AZ5A 4I3GA 2LRPA 4QM9A 1AR72 5IVJA 5C9AC 1UY0A 5DZEA 2RJLA 3AMMA 4TTGA 2VTFA 3A21A 3D4KA 1N1TA 1D0GA 3O12A 2K9ZA 4Z2AA 3KVBA 3B01A 3I3MA 5CEHA 3OD4A 1ENRA 1VBD1 2VCBA 4NVPA 4ARYA 2GNTA 2VW0A 1SQ4A 2PLV2 1ZRRA 4FTEA 4CEWB 2VOTA 4RR3B 1OUXA 4AYUA 1RUE1 4I0BA 3WG2A 4OUEA 3P3PA 5J1XA 3L2HA 2DWRA 4YW1A 1KXGA 2FMDA 2VTXJ 4FPCA 4WZCA 1SLAA 3JBG3 3PVNA 4Y4YA 1I5PA 1XE7A 3D82A 4AGRA 4AF9A 1NXD1 2A6ZA 2WZR2 1RVF2 3MDPA 5LATA 1MQTC 5JCTA 3T4HB 3DXUA 3GXUA 3MICA 1GP4A 1ZRFA 3OEAA 3GNEA 4IDZA 4Q4X1 4OI1A 4IEPA 5JIUA 2XPJA 5FPBA 3RWNA 5C9AA 2JIJA 5GKAC 3FBMA 1K42A 4EYUA 1SPPA 1UCXA 4E4ZA 4JHZA 3A4UA 2VU9A 1RHI1 4GH4A 3I2KA 1TMF1 2XJTA 1WWYA 1U5ZA 1YQ5A 1H0BA 4RS5C 3ZIWA 4XETA 4IQPA 4LHNA 3R4SA 2DTYA 3ZXFA 3R4DB 5FYTA 4B1LA 1H1AA 1R092 2WNOA 5C3QA 4JDNA 3IDCB 5FO9B 1MR5A 4CZSA 1VBA2 1OC1A 2ZX4A 5C8CA 1RGSA 1T6BX 4QX5A 3BVCA 3ES4A 1HRI3 2GU9A 1EY2A 4CPBA 4FFHA 4L92A 1RXFA 2RS31 3J7MA 2YU2A 4B7KA 2O1QA 2BZDA 5GALA 2CTVA 4CDUC 3K77A 4COUA 5I0TA 2WZR1 5HPOA 5FK8A 4AHYA 2JEMA 2NM1A 3T08A 1UX7A 1LGNA 3DKWA 1W90A 1O8SA 3J26N 2R073 4QAWA 3E1F1 3O0VA 4JGZB 3WV6A 5GZEA 1F2NA 2C6SA 5FREA 1GLHA 4AI2A 2RS51 5KHGA 2VW2A 1D0HA 4CDUA 4MGTA 3A7QA 2R043 2WQ8A 2OUJA 1DIWA 3PUQA 4IV3A 4GMP0 4DQAA 2V5DA 3TNPB 1NE4A 2JG8C 1TE1B 2ZHLA 3FLPA 3I2DA 1QNYA 4XF1A 1AJKA 1OLMA 2IXHA 3BKZA 5A3PA 5FZ4A 1HRI1 1QJFA 4RFRB 1JYTA 1V0AA 2JB8A 2WQZC 2XVGA 1O8PA 3C7OA 4UFKA 5GLVA 3PVEA 3ZSKA 4CEYA 1ZBA1 3Q8FA 1UYPA 5T3NA 1CWPA 1PO11 3THTA 1TNRA 1UOGA 1VIWB 1COV2 2PA7A 2ZBJA 4PLNA 4Y3OA 1OA3A 5AVPA 5FO7B 4XYXA 2PYTA 2FMYA 5FLJA 3OGJA 3PJQA 4AEDC 3NVCA 2GNDA 1W3VA 4XILA 3RYPA 3ZXJA 5AC92 1VMJA 4XQWA 2Q4SA 5FY1A 1PX3A 5GZFA 4D8MA 2FZ1A 1VBB2 4OVEA 4BXFA 2VC9A 3N4MA 2QDNA 1RB8G 3HT2A 4QKBA 5FUPA 3WCRA 2H0VA 2W46A 2YB7A 1UAIA 4PJYA 3HPNA 4Q2FA 1DFQA 2WS91 3W9AA 2VM9A 2X5IA 2ZHMA 4OUSA 1DDLA 1WUVA 1JYNA 1UOBA 1QJY2 3VKMA 1RUH1 2E32A 2ZGRA 1OSGA 1MQTB 1AXYA 2MEV1 5KXEA 2DVDA 3ZFEA 2QQWA 3H1YA 1TMF2 5EJ1B 3TN91 1IHMA 3OGGA 2ILMA 3PLQA 4FAHA 1VBC3 1UD1A 4UT5A 4AOCA 4LBQA 2JX9A 2GP3A 3AP4A 5D8AB 2XJUA 1NCQA 1QQP3 2OX0A 4HONA 1VBB1 4OHXA 5FZ0A 3C3VA 3PTRB 3RI8A 3OPTA 1CONA 1MEC2 1V6OA 3LDKA 5GLTA 4ET7A 1WLCA 4FPLA 4C91A 5CISA 1R1A3 2JD9A 4OHWA 1FOD3 2PQSA 4QGMA 5GM0A 1UIJA 4C1WA 4WM7A 2I45A 1H2NA 2C4XA 1RVF3 3CL1A 1UYXA 1C57A 4HVOA 3UJOA 1P8JA 1L7LA 3ZXGA 1STMA 2QFEA 4OHZA 5I93A 5I8SA 2GSYA 3GGLA 3RVHA 4CA9A 4CXYA 2J22A 2WNVA 3AMPA 4IEZA 1VRH3 4BOWA 1FI2A 2TEPA 3WHTA 4F8AA 4UW3A 3VB9A 2C0ZA 2WAAA 5EIYB 4QX0A 1LR5A 1WMFA 1YYNA 3TOJA 4EN6B 2CGPA 1O5LA 5IVBA 3S30A 1Y7BA 2TBVA 1V9U1 2HEVF 2CGOA 1R093 5LBBA 3RI9A 1DQ1A 1QWRA 1CX1A 4CE8A 4XJ9A 2BNMA 2VNRA 1J3QA 1M4WA 1VBA3 3VBFA 2XKOA 3FHAA 3POEA 2YFZA 2HH9A 2ORZA 5A1AA 3TEZA 3USSA 4P00B 3WVJA 4LHKA 2DV9A 4CDQC 3GZUC 4JVAA 2UWCA 3WT3A 4WVZA 3TAYA 3WDVA 2GH2A 3NV2A 1GOGA 1UO9A 1YFWA 4XACA 4QKFA 1W6NB 1EPWA 4UBHA 4COWA 3K3NA 1LULA 2C26A 2WLQA 3POJA 4LXLA 5FXWA 3CEWA 3NV3A 4XBLA 4A45A 4XEZA 2W1UA 1PVXA 2D6MA 1GWMA 2ARBA 4IEWA 2WBKA 4HT1T 3ACLA 2JXAA 3HJRA 3BPZA 3DECA 3W20A 4GJYA 1H6YA 3AYDA 4QHOA 4E4SA 3BTXA 4CEWC 2Y0OA 2DDUA 2UWAA 4XF0A 2WZPP 1R1ZA 4AEKA 1CZSA 1TME2 1SBEA 1YRZA 3S7IA 5DN2A 4BLJA 1SFNA 1S0BA 2Z69A 1JTZX 5CB7A 4ITCA 1HJFA 2VECA 3NNMA 3VBHC 4M3CB 2HWF2 1W9YA 4LORA 5FBZA 4CUGA 3ACFA 4W4ZA 1FMD3 3ZSLA 5GLUA 3QBQA 1LOCA 1GSLA 3MLJA 5C3SA 4FFFA 4XE9A 5CFCA 4ZZ5A 3P3NA 4AFCA 1WBLA 2BWCA 3OGVA 5C4WB 1GQPA 2C5DA 4RHV3 4FVVA 4B29A 1QXJA 1HW5A 1DGWA 3ZR5A 4Y1ZA 3E5QA 5K0UA 2W9XA 2DU0A 1H8TB 3R0RA 3VBSB 4Y22A 2RS13 4XHXA 1YWKA 2ZTNA 1CIWA 1RUI1 3LD8A 4GULA 3T09A 4FFIA 5FY5A 4URAA 1GBGA 3O5SA 5EJZB 4JZRA 3WUCA 4XVHA 5ACA1 3B02A 4GWJA 5BY5A 2W1QA 5ANNA 2ARAA 3H8RA 2A3WA 4GWIA 3QOPA 5BV6A 1QJZA 4YG6A 3EYPA 4EWEA 2WDBA 3GJAA 1R1A1 4GQ7A 4Q5OA 1GYKA 2ZGLA 3IN9A 3WUDA 5E8AA 2J1RA 3ZFFB 3LA2A 2HWD3 3OOXA 3VBRC 3SLIA 1QOOA 1W8WA 4UW4A 5DAXA 1AVBA 3ZYPA 3Q9OA 1ACCA 3KV5A 4IEOA 2CU5A 4PHZA 4AR2A 3OYWB 1XPWA 2BVVA 1F4HA 2XVLA 3B94A 3LDRA 3N9NA 4OCTA 2WFF3 3M3EA 5FP7A 4BHPA 4CCKA 2XWBB 3DL3A 2JKXA 3ACGA 3FE5A 3O14A 1MZ6A 3NWKA 2D40A 2YPDA 1O59A 3I2FA 2VOXA 4IXLA 5FO8B 4PCRA 3WP6A 3CQOA 3ZYHA 1V6MA 2WS93 1GUIA 2Q30A 3MF6A 3MV01 3IMMA 4ZKTB 2VMGA 4FOQA 2XJRA 1XU1A 1W06A 3ES1A 3SITA 2GN3A 2ZGMA 4S2FA 3WQ7A 1JHNA 1I5ZA 2V5YA 5EV7A 3RZMA 1RUF2 4JC1A 4BK4A 2ADDA 1GZWA 4XHBA 4EZHA 1A78A 1V6NA 4IGPA 4P14A 1TNFA 4HVRA 2BVBA 3O0WA 4KU7A 3JU9A 4NAMA 4NRMA 2A73B 4B1MA 1HJGA 4PQ9A 1NQJA 5FPVA 3WOGA 4AVTA 5JOXA 2VY0A 1S0EA 2W08A 2BWAA 2ZGTA 4BIOA 1G9CA 5H9PA 2FDIA 1HB4A 4GWMA 5FPXA 1VB2A 3V64A 2R1DA 1B09A 1ONAA 3W59A 4QPGC 5FLHA 4YWAA 4NOTA 4OQ9A 1AR81 1I9RA 3IMNA 3OBRA 4JGYC 3MW2A 4XZUG 2ZEZA 3GM8A 4FFGA 1OFNA 2Q8DA 1JZ4A 1LRHA 1UQXA 1NZIA 4BLIA 5J3UA 3ALQA 2I74A 2BTVC 3RDIA 4HLTA 3MF9A 3WNMA 5BUVA 5IVFA 3MLKA 5BNNB 1RUG2 5I8TA 2BNNA 1S1AA 1GOHA 4BQWA 4K20A 1CAUB 4UI9L 4A3ZA 1Q8QA 2FCUA 3IKWA 5F6LB 5FV3A 3AKQA 4WVVA 2KM2A 1YXWA 2DCTA 5FYCA 4Q0UA 4E9KA 3AZZA 1OD3A 2EXHA 1CX4A 4LHLA 1ZRCA 3W58A 1PK6A 4QX7A 2QQKA 4Q0QA 1HIXA 2UURA 4Q4Y1 3RYRA 1GP5A 1Y9MA 5ISLA 2RS11 1G6NA 1GZCA 5JMOA 1WBFA 1ND3C 5J48A 1F8VA 1LOBA 1SLCA 2AEYA 2QQUA 4FPKA 1PO22 1UL9A 1XB9A 2VZRA 3SQOA 2ID4A 3NNLA 2AREA 4FPHA 1KEXA 2WUHA 2WWSA 4FP2A 4R9AA 3WEZA 4YGBA 4D6RA 5CFCC 4GKYA 1X9TA 3EQEA 3FZ3A 1Q8VA 1LU1A 2QNKA 4W65A 2GC0A 4KG8A 5LK5A 4LO5B 3HEIA 5ABJA 5BPXA 1VBC2 3ZDSA 5JZGB 4YVSC 5F39A 5IW0A 1WD4A 2R0FA 2XONA 5D1IA 3L9JT 5T54A 2GC1A 1XU2A 2DCYA 2NZ9A 2RM21 4LO7A 1N1VA 1LOAA 3ME2A 5C71A 4MGYE 4L9BA 5JPNB 1V6LA 4IE5A 4N53C 1YJKA 2PHLA 1OVPA 5EJ3A 5J96B 3UKVA 3BTZA 4AAXA 1RMU3 2PHTA 4AHWA 3WW4A 1JZ3A 2IXKA 3AL5A 1AXZA 3W21A 4EJRA 4LOSA 3AMNA 5EYXA 4O9EA 3NAPB 2PHWA 2R062 3TYJA 3VD9A 1OI6A 1X8MA 3HNYM 4KU8A 4XUPA 4W6YA 4OZOA 1JOJA 1UIKA 4HPKB 3UETA 1AYN2 2YXSA 2XBO2 3WDTA 1DGLA 1CPNA 3MPPG 1VBC1 3ZMNA 4E27A 3G7DA 1JZ6A 2YYOA 2F4LA 3VGIA 2Y0IA 3IAQA 2ZMKA 4PF1A 3NW4A 1W04A 2B9VA 5FMBA 5G05L 4A6SA 1HKDA 4QQOA 5A6ZA 4FQ4A 3WG4A 1JYCA 1HB3A 4JDOA 1V9U3 1W6PB 3WNKA 4A6OA 4H7MA 3FUQA 2YFUA 2R1BA 2ZHNA 4V1PA 1YIPA 1GV9A 2D6KA 5FYVA 4ZPIA 3WLUA 5FPLA 1RUG1 4RQPB 4GMP3 4DFSA 2O8QA 1K12A 4EROA 1BVVA 1OA2A 4YVSB 2JE9A 1FNZA 4M0NA 3VZJA 2WNUA 4KWKA 1KS4A 1ODNA 4K1ZA 2KA3A 2W94A 4AAPA 4AI3A 5BNOA 5FAXA 1NQDA 4Y5TA 1JBCA 1LJ7A 5FQ0A 1F9KA 4QQLA 1RXGA 3ATGA 3H3ZA 2WO3A 2PHUA 2EXJA 5IATA 5A7WB 4EWDA 1A8MA 2WYFA 3N9QA 4A7ZA 3K46A 2YGMA 3ELNA 1PO21 3BGAA 5FK7A 2WNVC 3HNMA 4K21A 4W50A 5F8PA 5F3IA 1NUKA 5IHRA 2WWJA 3DCQA 3CJIA 4YGCA 1RUE2 4BCUA 2JDAA 5I8YA 2HBTA 1CGPA 3B9CA 1B35C 1JW6A 1O4YA 4N43A 2X29A 1PK6C 4KGGA 4YSFA 1FMD1 4TWTA 5E1RA 1F15A 3IAPA 4L8QA 1V6KA 1CQ9A 2PXJA 3RS6A 2WFPA 2XLGA 3J7HA 1HRI2 4R9BA 5IYYA 2DVBA 2XR4A 1YQCA 3VBHB 5A70A 2VBPA 1NX9A 1RUD1 3H7JA 4E2GA 1W9TA 5L9VA 5BXXA 1AL21 2O14A 3DN7A 3LWCA 2DFCA 3AVRA 4NHYA 3RQ0A 3U75A 4P08A 3M1HA 2YC4A 5L73A 5FWEA 3ZN5A 4E2SA 4CUCA 5CKNA 4MHUA 5JR7B 1E57A 2Y8KA 3POWA 2O8OA 4KWLA 5E88A 4WM8B 2RHPA 5EQUA 3WF0A 1SBFA 3AXEA 3R6SA 3ZFGC 1FX5A 3DYMA 4FT8A 4AVBA 1UYZA 3K4AA 3WCSA 1MS3A 2VULA 4RN5A 4NO4A 3BI3A 1J58A 2CSGA 4ZXEA 3ENRA 5A6QA 2D98A 2ZZJA 4L0PA 4XUOA 2VCAA 5CA6A 2RR12 4HSJA 1W39A 5FY9A 2XHNA 1UZZA 3CF6E 1W8NA 3IIAA 2D3RA 2XUMA 3OY8B 4Q0PA 1QF3A 4D7TA 3DPRB 5JDBA 4ISQA 3H8OA 3ZSJA 3BIEA 1RINA 2NP0A 5IVYA 4HK9A 3FC0A 4WVMA 3ZIXA 3T1MA 2FDGA 2VMDA 3EHKA 2DCKA 2VMFA 2RS12 3U11A 1BBT3 2UY9A 1O5UA 1PMJX 3I2IA 1DQ4A 3MI8A 4UWDA 1RUC2 3VHOA 4XMAA 3JBG1 4P9JA 2G4IA 1JZ8A 1ZZ9A 1DQ0A 4PQQA 1W0NA 3AXDA 3K51A 4HFSA 2WQ4A 5H9QA 3ZO0B 3UGFA 4XF3A 4XFGA 4FXKB 4AQ2A 2WABA 4NPMA 3IT8A 2BBVA 5IT6A 5L19A 3K4ZA 5FJHA 3MZHA 4YVWA 3QCWA 4QMAA 5IFPA 2JE8A 3AX4A 2V4AA 3EXUA 3KT7A 4JKLA 1RVF1 2PHDA 3IWZA 1ZBA2 1EV11 2JG8B 5KC6A 2HWB3 2YDEA 3HQXA 4BQXA 4XQDA 2WIIB 1EUUA 2XGXA 4PF5A 4ZS2A 4AG4A 5C8CC 1TMF3 1A34A 4CU7A 4NPRA 1LB2A 4OULA 5D2AA 3JQXA 3POIA 2CV6A 1CZTA 2RE9A 4GD4A 2VUAA 2ZCWA 4Q26A 4PLMA 2ZOEB 3LIGA 3S7EA 1OUSA 1CAXB 4QGNA 2VH9A 4AEDB 5A32A 1DG6A 4QB1A 4HG6B 2WKKA 4XFCA 4HBNA 1UU4A 3IB3A 1LHOA 4CRQA 2H6CA 1FOD1 1W6QB 2XLAA 1NLQA 1WMEA 1QKQA 1RUC1 4U36A 1RUH3 3VBSC 5F9TA 4YGEA 4QKDA 1SLIA 4Y20B 3T2QA 1HXS2 5HXVA 4MLOA 4E8CA 1JU3A 2OZJA 1UYYA 2QQMA 3B7MA 3UNPA 2P6HA 3SH3A 5JSPA 4FSJA 2VOKA 1ZZCA 2VVEA 3A22A 3KVAA 4NE9A 2K0GA 1VPHA 3I49A 1XSQA 4HL0A 4X6QB 2PN5A 1QJU3 1VJ2A 3I3QA 5DUXA 4IV1A 3ZYBA 5DG2A 4N7UA 1EV12 2BJSA 4IE0A 5FP9A 4AVCA 5LWBA 3PUHA 1XNBA 3PURA 2MHFA 1PZ8A 1K5MB 2YZ4A 2N7GA 1DYOA 3I3BA 1EAH2 1OHFA 3PIJA 5LASA 3ZYIB 3CJIC 1AX2A 3I2GA 3ILFA 3K2OA 2R16A 3VDBA 3HQUA 4IERA 5C33A 4P9GA 5FYMA 4N9IA 3DEMA 4CEWA 3LPGA 4RR3A 1PO23 2VW1A 4KH9A 3VD7A 4DY5A 1POV3 3NV4A 5KXCA 3AFGA 4GALA 4KGQA 4EN7B 1OFSA 2LW8A 2YBSA 5CFDA 2ORXA 2YROA 5A3TA 5A3WA 5CADA 3QH6A 5BNPC 3EB7A 2D3PA 3N9MA 1QXPA 4XJWA 2D93A 3KT4A 4ASLA 4BM8A 3J7LA 1OLME 4CCJA 3D0SA 3Q8EA 2JDNA 5FMDA 3NQHA 4FPOB 3MIGA 2D97A 1EAH1 1NY72 4XUTA 2VQ0A 1OOPC 2HWD1 4MGIE 1HQWA 3NAPC 2Z42A 2G1MA 5I91A 1J3RA 3NJXA 5C9AB 1JH5A 4QPGB 1SPPB 1LOFC 5A33B 5JXHA 3SCHA 4UBGA 3OBTA 4GH4B 2W1WA 3C7EA 3FN9A 4LULA 1UY3A 2IFRA 4QX2A 2ET1A 5F2WA 3M4FA 2HEWF 2RS53 3D3AA 5DABA 1HLCA 3H1WA 1LEDA 3PMEA 5CG8A 1OT5A 2A3XA 3PTYA 4NHKA 4B7EA 4CDXA 4BE3A 4Z1VA 1D4M1 1Y9QA 3ZFGB 2QBXA 1ASJ2 5I0DA 1ULGA 1RITA 5B2GB 1CAVB 3P5BA 3SMHA 4IETA 5C6CA 2FZ2A 3RMXA 3TN92 1W8OA 1ODMA 4LEJA 3LZZA 1LU2A 4AEJA 2Y33A 5IK5A 1VMHA 1H2LA 3N36A 4QX1A 4XMIA 5IAVA 5LY2A 3AK0A 1PNGA 4A7YA 3ACHA 2P4EA 3B00A 4Y1XA 5FFOC 1DYPA 2EIBA 4AQ6A 1V6JA 3WR0A 2IC1A 2VZUA 2CY6A 2WLPA 4P9XA 5EHDA 3LFIA 2EAKA 2WNEA 4Q1PA 3WY6A 4L2NA 4XBNA 4HSLA 3LKJA 5CKQA 1PHMA 2QUOA 3NSTA 5BNPB 4LTAA 4CDUB 2GMEA 3CO2A 4DOUA 1PGL1 3MIBA 1AR91 4JRAA 2HWB2 2BOJA 2VNVA 4IV3B 1WMXA 3KCCA 1IPSA 3BN6A 2TNFA 3LAGA 4DMIA 1ZVFA 4I0AA 5JLVA 4AI8A 2XBO3 4K7JA 3V65A 4H7LA 2ZACA 4P5YA 3LOIA 4XFAA 1VBA1 1RYYA 2WO2A 4PI0A 1J1TA 4YG3A 3K3OA 2WFF2 5F1RA 2VUCA 4IW3A 2YMZA 1POV1 2GC2A 1YQ8A 1D4VB 2YUEA 4PIZA 4YG0A 1V9U2 2W0XA 3E6DA 3I4IA 3NMBA 1L3JA 4YW4A 5JAXA 1NT0A 2FQPA 1QQP2 3PVOA 5IK8A 3HMYA 1PNFA 4N53A 1LCLA 4XIKA 4I09A 4LK6A 2VZ3A 3LB9A 3AB0A 2WT2A 4B4PA 4A42A 1JZ7A 4XXPA 1ZZBA 2DVFA 4COYA 5GJ6A 4DRRA 3PU3A 2X5IB 2ENRA 3I3DA 2XJSA 3URFA 2LALA 3LOBA 1MQTA 3AMHA 4XFHA 4UFLA 3VBUA 2ZMNA 5DDJ3 1WW5A 3VD3A 1JZ5A 1JU4A 4HETA 3ZFEB 4K8RB 5IK4A 1UXZA 2B42B 4NJ4A 1IG3A 5JOWA 3GALA 2R30A 4QX3A 3SEEA 2VL4A 4RA0A 5JXIA 1RUE3 4AXOA 2ZPXA 4MHRA 2OPWA 1WLWA 5D8AA 3RWKX 4DO0A 1NCQB 3JB4C 2VNGA 2IFWA 3HN3A 2G9FA 1TME1 2K2SA 1MS8A 2WSVA 1FPN2 4P9IA 1W8TA 3CJXA 4ES8A 3E97A 3CBNA 2C9KA 2QQIA 3J7NA 3B5LB 2ZGKA 2XMLA 4INDA 3ZPYA 2RR13 4WM7B 4KBZA 3FHQA 3M70A 1FXZA 4GA9A 3RNSA 3I3EA 4LE4A 4DUWA 4Y33A 1IPKA 1QOSA 3OTFA 4LPLA 1ZZ8A 1QJEA 4N90A 2WSUA 2WC2A 4X6RB 3ZXAC 2AEZA 5F3GA 3VLBB 1Q43A 3D5OA 2WNVB 5JI7A 4BQ1A 4FBFA 2HWE1 4QXBA 2CHHA 3VKNA 2EIDA 2DFBA 3JQWA 5A7OA 1VP6A 2X8KA 4YZ1A 1LKNA 2C9AA 5A3OA 4ATFA 3F95A 4Q4Y3 5ACA2 2YY1A 5FP3A 5T5PA 3UKTA 1R082 1YFUA 4LNVA 4UOJA 3MIDA 5KXDA 3J4UH 2RMU1 2PFWA 5FZBA 4TLFA 4GB33 3DXTA 5LRRA 2RDSA 2HEYF 1FPN1 3VV1A 2WFF1 4FTBA 5F3CA 1H1IA 5FUNA 5FZFA 5A7PA 2RM22 2PHRA 4XDQA 2LTNA 5AC93 4F3JA 2W95A 4KL1A 5HXMA 2X5IC 3RFRA 1QQP1 2H6BA 4AK3A 3H3LA 5BYNA 2TUNA 1SG3A 2VPVA 3WDYA 1PM7A 4AW7A 3CIHA 2DUPA 1YI7A 2BGOA 2A6XA 2EXIA 3POGA 3OUJA 3VN4A 2YC2A 4MSVA 2RG4A 1ZBE3 2PLV3 2D6OX 3H3UA 5LEJA 2BGPA 4K3UA 3ZKYA 2R6QA 1JUHA 2E7AA 5GLZA 1SACA 1POV0 3KV4A 1REDA 3BPSA 4JTNA 1PO13 4ASKA 5FZ3A 3VBUC 3VUOA 2AENA 2BDRA 3BYWA 1I6XA 2PELA 4O61A 3POBA 1WA4A 1NYWA 2ARCA 3T1LA 2R49A 1AR73 5A6YA 1MACA 1UKGA 2IXLA 4M3CA 5KR7A 2R063 1HXS3 4LKDA 3IIIA 4MGKE 1GNHA 4OHVA 1ULFA 5D8AC 4JAAA 5EWSA 3Q8AA 4UFMA 1XJAA 1UZWA 1Q56A 1W6OA 3J9SA 1U5XA 4LO8A 4RHV1 3DGTA 4MXVA 3JB8A 1ZX5A 5J98B 3TBDA 3ZKUA 1IPJA 2OQ7A 2A6VA 3LA7A 5LBCA 5C4WA 2RJKA 1ENXA 3ZR6A 4LA2A 3KGLA 3RJRA 5EP9A 1NA1B 4BH9A 1VR3A 4QPYA 1VAMA 5JZGC 1KS5A 3VBSA 4Y22B 2IZWA 2Z5WA 3ZYFA 4ATEA 2WZR3 3TWIA 3NNFA 1RUJ3 1UKRA 1XRUA 4LBJA 1AX1A 2BYVE 2WA3A 3JZVA 1ULOA 4IUGA 2BRTA 2AC1A 5KBFA 5AVAA 2E63A 1HN0A 1SLTA 1SDDB 3BU7A 1HDKA 3LEMA 1LENA 4MV2A 2BQPA 4AVSA 1BYHA 1UY2A 2W92A 3DUIA 3OGRA 5CG9A 3SH4A 1E5HA 3RZZA 4Q4W1 4HKOA 3ZFFA 1QJU2 3OSDA 4EV0A 5FJKA 1XE8A 4YW7A 4NR1A 3WP3A 4TLGA 4FP3A 5B4XA 4OI0A 5FXZA 2JD4A 1QY4A 1HV0A 1OQEA 1TVGA 3O1SA 4X8NA 3OYWA 5FUIA 4LBOA 3RJ2X 2B45X 1Q8OA 3B69A 5JWPA 4XW3A 4MO3M 3KSCA 1ENSA 4WBBA 4DIQA 1G9AA 1G9BA 4YFWA 1ZNPA 3WINE 1WKYA 5J36A 5JUVA 5FZKA 1JHJA 2WNUC 4AFAA 2WT1A 3RZLA 3AFKA 4J6GA 4J25A 1YEWA 3M3QA 2A7AA 3UESA 3KD4A 3V0BB 1VE0A 4JGZC 1RC6A 1W9WA 3KCXA 2PTMA 3OB8A 4Q0VA 1PGW2 1Z7S1 2H0BA 4Z92B 1XXNA 2QZ2A 1VMFA 1WLDA 5FY7A 3MPBA 1XBFA 3HVDA 4LUMA 2MPFA 4LBLA 5TSWA 3VDAA 3MYXA 4DS0A 2IWGB 3BTYA 3H42B 3H7YA 5JPMB 1KRIA 2C1FA 2YU1A 2EICA 4RSUA 1ND2A 1X9PA 1UW8A 2HLEA 3WF2A 5ERLA 3I8TA 2A71A 1H8TC 2E6VA 5FY8A 3T2PA 4ZXKA 3TEXA 3E5UA 5K4LA 1GZWB 1S0IA 2CGNA 4Q1RA 2J1UA 3D0JA 3NO8A 1QJU1 1QHDA 4FPYA 1BK0A 4XXAA 1C1FA 1AR61 5FPAA 1BXHA 4AHXA 2EA7A 5KHHA 4Y4RA 5JOYA 3S6PA 1CESA 4V2VA 2RM23 2JG9B 4PT6A 4OHYA 1UWWA 3D8CA 1Z0HA 4QXCA 4LBQD 5M0TA 2HWC2 3JUUA 4PDWA 5DUUA 3AP5A 1U0AA 1ENQA 5EZWA 5F2SA 4AL9A 4DXSA 1DZQA 1IG0A 1UY1A 1WW4A 2XBO1 2BPA2 4CUAA 4Z8BA 2Z2SB 5T55A 3BCWA 4N8MA 1Q5OA 2HYXA 2VZOA 3SCFA 3VBOA 5F3EA 2GMPA 1BEV1 1C28A 1HRV1 3I97A 3KHBA 3N7LA 3HIFA 4GWNA 3VD5A 2YC0A 3AJYA 4NIIA 2JE7A 3U37A 5LEKA 1S2EA 1XNAA 1FT9A 2W52A 5T5JA 2A3YA 1AYM1 5CAZA 4FI9A 4LLOA 4DXRA 5C4WC 4TXWA 2E26A 1QJY3 4CP9A 1QGLA 1KQRA 1UN1A 1LHVA 4XDOA 2PHXA 2Y26A 3KZ4C 1OPOA 3T0AA 4IEUA 3VKFC 2BOIA 1JN2P 2WAOA 1BQPA 5IUQA 1MZ5A 4AWDA 5CFDC 5T5LA 5DQ0A 4MGQA 2XDVA 1O7FA 4XCAA 4CP0A 1CN1A 1POQA 2PAMA 1H4HA 3HD8B 3MFAA 1LHNA 4PIXA 2DF7A 3ZSEA 3HBZA 3U0ZA 1BEV3 1HRV3 3N9PA 2DURA 3IPVA 5IVEA 1AZDA 1RIRA 2HJIA 3LE0A 1FOD2 5FZMA 5LBEA 2KXLA 4B4QA 1F5JA 5ABJB 1D7PM 5JZGA 3K48A 4P9YA 1Z7S3 4BK5A 4QHZA 4F7ZA 5FCCA 4QD2A 4YPJA 3AKRA 4BPZA 5IVVA 2XJVA 3O0XA 3ZN6B 1Y9GA 3OPWA 1LGCA 2DVAA 3R05A 5JSOA 4QGLA 4FPJA 3VDDC 1AHSA 4RD7A 4BMBA 1RUD3 2BEOA 1FNYA 2BV4A 1ULEA 2IXCA 3X29B 3ETQA 1GQGA 2K46A 3R4UA 2W39A 2D6PA 4D94A 4XFBA 1RHI2 3MGUA 3KQ4B 4MADA 2NN8A 1AL0G 2VVDA 4Y1YA 3WF4A 3ZXEA 4FO9A 3AVSA 3VKOA 2XVKA 2E33A 2W1SA 1O4TA 1QJX1 4HPKA 5A80A 2X05A 3WW1A 4XFFA 1QJY1 4ZU5A 3ZX7A 4D7SA 1IKQA 5K8SA 1VALA 5APAA 2VMIA 1CJDA 3U10A 4QT6A 2WZEA 5L7OA 1WW6A 3CKHA 3GBWA 3IM0A 1CPMA 1AR83 3J8F3 1WCUA 3SC7X 5C3RA 1I3HA 2DU1A 3WQ1A 4FQZA 3WDXA 2QQJA 1NY71 4P9LA 2HWF3 5FMOS 4GH4C 3BOPA 3LGRA 3GZAA 2FHRA 3F2ZA 1ZRIA 2ZHKA 1YHFA 3NV1A 3WDUA 3J8F2 4RQPA 1VB4A 4Q4W2 3QD6A 4XF9A 3VDDA 2ET7A 4UW6A 2P17A 2Y6KA 5JXJA 4OMCA 1Q8SA 2WNUB 1N3QA 3AZWA 1FATA 2WJSA 2ZZQA 5F5QA 2JDHA 5AFBA 1C1LA 4XC9A 4I02A 2UYAA 4Q4W3 2PMWB 3WW2A 3BIWE 3P6BA 5T5OA 5HBAA 3U4XA 3AC0A 4TYSA 3S5QA 1C8M3 2NYYA 2VBBA 3AJZA 4L99A 2KD7A 2ZABA 4CUBA 2GNBA 1GICA 4PIYA 5ACA3 4FCAA 1F35A 1ASJ1 1MZEA 1W03A 3LEGA 4QDQA 3CJIB 4YYOA 1W3XA 3QLQA 4R4ZA 4LO6B 3OGSA 1C8M2 1DCSA 4JQRA 5C8WA 5C7GA 4Q4X2 1O6UA 3HAGA 1OOPB 5FMOL 3CDZB 4YW2A 1J59A 1ZRDA 2AGSA 1C5HA 3AKTA 4XDPA 4DEVA 5G04L 5IK7A 3FX3A 4LA3A 1QOTA 1W2OA 3UGHA 5JR2A 5T52A 3M3OA 3VDCA 3AYAA 3WZ1A 4NIGA 1SFYA 4NWVA 2JDKA 4XAAA 3EO6A 3VBHA 1RMU1 3T0DA 4P02B 3LEKA 5JIAA 1X8EA 5IJRA 4NHXA 3O1VA 4AFDA 3GBGA 4KG0A 2WR9A 4R8HA 1RUI3 3RMYA 2RVAA 1O3TA 2WZ8A 5JMCA 4LBKA 1KITA 4WM8A 1RUJ2 2GDFA 5CVRA 3V0AB 3THCA 5GZCA 2GN7A 5LY1A 1UX6A 4QKNA 4D6SA 3RSJA 4AQTA 4A7KA 2ZEWA 1H8VA 1BEV2 1HRV2 1YFYA 1PZ7A 2XKPA 1ZBE1 3TB0A 1Z78A 4DUVA 4M4PA 2DVGA 1XYPA 2O0OA 4PLOA 1JXNA 1RMU2 4J1XA 1UZVA 3DPRA 3I2JA 3SCGA 4YVWC 1KFUL 2AACA 2A5ZA 5FYBA 1PMIA 3ORJA 1JUIA 2A1XA 4GXLA 3VBFC 4BQ2A 5A3LA 3AZXA 3ZN4A 1O3SA 1RJ8A 4HKWA 5DAWA 4YW3A 4K6BA 3VBRA 1OXCA 2HYKA 1ST8A 2FBEA 2FDFA 2HWE3 4E2QA 1BKZA 3EMRA 4M3CE 2OA2A 4D7YA 2LROA 1XNTA 1V70A 3APBA 3KGZA 4OI2A 1LECA 4YVWB 3H8XA 2P3YA 3PUIA 3OBAA 2YGLA 1ND3A 2JG8A 4QDSA 5I0UA 1RUF1 3NJYA 1DQ5A 1REEA 2R0HA 3NJZA 4MYEA 5JVVA 1QEXA 3KQRA 3NKTA 1O3QA 2WN3A 2XUEA 1OA4A 3VKLA 3BU0A 4I30A 4QDRA 3GCWA 1OQ1A 4YM1A 4LR4A 5F32A 4I2OA 1NLSA 3POFA 4A4AA 5F37A 1AR63 3ZSMA 1W2UA 4QPWA 2B39A 3KLSA 2D5FA 5FTTC 5T50A 1QDCA 4QPIC 2V09A 5A32B 1PVC1 3UGGA 1U12A 2VZSA 3H50A 3KHCA 2VO5A 1BLZA 2WN2A 3MUZ1 4YW6A 2HBUA 5FLIA 1R081 3ST7A 3AYCA 4LUKA 2ARXA 2R042 2UY8A 2W47A 5A3MA 1ULDA 5K0UC 1FV3A 3MW4A 1YLLA 3AZYA 3WSOA 4HVQA 3UKNA 5C3PA 3N9LA 1BMV1 4Y20A 4FTSA 5KXBA 2VQAA 3ILRA 2LM3A 1H2KA 1HB2A 4FPGA 2OYZA 4EN8B 2BFUS 1O3RA 4TN7A 2ZGUA 3AP7A 1HX6A 4PI2A 1US3A 2DUQA 2Y6LA 4QQ2A 5CU1A 1LESA 1OF4A 3KCYA 1OMIA 1YFXA 5FYUA 4AFMA 5LZ6A 2OVUA 1RUNA 2XQRA 2Q5TA 3B9IA 4LKSA 2W5FA 5FXXA 1O4ZA 4IV1C 3USUA 2P6CA 4AVVA 3J8F1 3PVBB 4DB5A 2OPKA 3M3IA 2ZGOA 4Q29A 1F4AA 5FMCA 1K5MA 4NN0A 2ZMLA 4AEMA 2B7YA 3VHNA 1PX4A 2E31A 5JI9A 1CAWB 1EYBA 2DYCA 2B5HA 5CNAA 5ANQA 5FZOA 3N7MA 1AYN3 4RS5A 1RUC3 4BJ0A 3SNMA 4WM8C 4QQHA 3W5MA 1BBT2 3SKJE 3UJQA 4RR3C 3FUOA 4JGYA 3K75B 2VZ1A 1I1EA 4IGQA 1SFPA 3RPQA 5CFDB 2QQNA 5DUVA 3ROUA 4XPVA 3N9OA 4YM2A 2SBAA 1H2MA 1EPZA 3FBYA 1NCRB 3QH7A 4LJHA 3T2TA 4CDXC 2RDRA 4Q4V1 4ZONA 2GZWA 3PL0A 4M00A 3TNQA 4DZGA 3EBRA 3JD73 2JDMA 4QM8A 2B9UA 1D2SA 5KHIA 3BOWA 1W6MA 3KV9A 1AX0A 1YCIA 3OBZA 1B35B 1GWKA 1IZ3A 2VMHA 1HB1A 3GF6A 4QPGA 2JWPA 4LLFA 5F5CA 4L97A 5A33A 3WNPA 4N7IA 4C1XA 5F7UA 4IE7A 1DGRA 5CZKA 2WL1A 1LOEA 1NAEA 4BQ4A 2AR6A 2QJVA 3H8UA 4D0QA 1DBNA 4YRDA 4CDXB 4CU6A 2VTXA 3OJBA 1WGPA 1YIFA 4XUQA 3ZFGA 4DXZA 4COVA 3POSA 1AJOA 1CAVA 5FZ7A 1W99A 4MX3A 3WX5A 4R52A 1MS9A 2WO1A 4OUMA 4C90A 3AKPA 1W8UA 5FZIA 2VMCA 4MVTA 3WW3A 5A1LA 3FFQA 1JS9A 1UMIA 4JKKA 5HI0A 1XOYA 4LIUA 4AFBA 4WZFA 1UZYA 2VBDA 1IQDC 4XUNA 1S2BA 3VHRA 1AR71 1QIQA 4X8PA 1MZFA 3I2OA 4LITA 1ZZ7A 1LGBA 2C24A 4RQPC 3PUSA 4UF0A 1HQLA 1RHI3 2R071 4ZHNA 5BNPA 2VQUA 5GLWA 2SLIA 3I59B 4AVAA 5C70A 1HV1A 1OBNA 3I7DA 2CYFA 3MLLA 4CDQA 5FZCA 2BP6A 3BTAA 1LHWA 5F5IA 2VXJA 4RYDA 2J1TA 4S2GA 2IXJA 3BUCA 2X53S 1US2A 2CDOA 4IE4A 4Q4V3 2QZ3A 2WWUA 2XQXA 1AR82 4XAEA 2GC3A 2IVIB 2JDYA 2HWE2 4K40A 4HOOA 4AI0A 4E4HA 3MIEA 1WCSA 3ZDVA 4HK8A 3CU7A 4LKEA 1XNCA 3OUHA 2Q8OA 3WD5A 3ZYGA 4DY3A 5KWRA 5L36A 2R072 1Y4WA 4LE3A 2UWBA 4QPIA 1PIV2 4Y24A 4XCBA 1OPMA 5FRAA 4A3XA 4CDWB 3DYOA 3H1MA 1Q3EA 3RZHA 2OIIA 1BVP1 3VD4A 5KC5A 1TME3 4MXWA 1M06G 4N53B 4ARXA 4G3YC 3LDBA 1K45A 2F17A 3POYA 3M3CA 4UFIA 2ZX0A 4KWJA 1GP6A 4Q4Y2 4XIOA 5E16A 1CZVA 1AR62 5DDJ1 3O1UA 5E89A 2VVFA 5K7PA 2Y38A 4J1WA 2Y34A 3VBUB 3FWEA 5EFUA 2JG9C 2MNGA 1Q8PA 3N7KA 3VHPA 1S2KA 5B4NA 1PIV1 2Q1ZB 3M8LA 5DAVA 2ZJCA 1ZA7A 5LA2A 2DTWA 2BFUL 2ADEA 3WP4A 1XYOA 1QDOA 4JQTA 1MS5A 3I54A 1GFF2 1V6IA 2Y6GA 5F6KA 1DU3D 3JXSA 3DKQA 3FHIB 3WQBA 3MO4A 1XQNA 1JOBA 4NPLA 2VOWA 4NIAA 2ZXQA 3JCIA 1Y43B 1W2TA 1W05A 2QCSB 1DYKA 2DCJA 3GHMA 4B3NA 4CCCA 1DQ6A 2VD7A 2DBNA 2XL9A 3T4VA 3U78A 1GKBA 2QTWB 3ILNA 2NMOA 3WHUA 2WYSA 5L9RA 2UU8A 1OD5A 5BNNC 3M2MA 2XWJB 2OS2A 5J7MA 1N1YA 3WQ0A 1DQ2A 4K9SA 2QDRA 3JBG2 2BBAA 1QXRA 4SLIA 3NJVA 1MVEA 5C8CB 2ZKNA 2D3SA 1N3PA 4MGSA 4KBBA 2QVSB 2WA4A 1Z7S2 1KFXL 1W8HA 1DP0A 4EE2A 4P5HA 5FZ9A 1ND2C 4Z2WA 1IOAA 3MUY1 1RUOA 1UZ0A 1IKPA 4FOVA 3U07A 1WMDA 4UFHA 1WLTA 3FLTA 3JD71 4QU1A 3MIFA 1GANA 4JGZA 4W6WA 4AQSA 1A8DA 1G9FA 1OH3A 1QNWA 4GZ9A 2PAEA 5FY4A 3Q8BA 1ZA4A 1G8WA 1VRH2 2V72A 2PQQA 4MZUA 4CYDA 1RUH2 5A1FA 1IS3A 2FCVA 2ZEXA 2PLV1 1MVQA 4B4RA 1UU5A 3FLRA 4A41A 4H2AA 2EAAA 4E4DX 1WW7A 4WV8A 5HV0A 3FMGA 1ZYBA 1E5RA 3SISA 3SKVA 1AYN1 2EXKA 4CEYB 1J84A 3NL1A 3ECQA 1S0JA 2Y64A 2NQYA 3T3YA 4CU8A 1YC61 2YPJA 4AE2A 3DF0A 4NRQA 3S5AA 1CJPA 3GDBA 4QU2A 5IFTA 4NHMA 4NWWA 1HXS1 1BHGA 4RFT0 2RJ2A 4GB31 4TZDA 1QH7A 3THPA 3WDWA 5H9RA 1JYWA 2IXIA 5AC91 1UMZA 1MPXA 2WINB 1GMMA 4U2AA 5FYYA 1W6OB 3UT0A 5FWJA 5IAXA 5CKMA 5C5TA 1AR93 3NNJA 3C7HA 3N35A 2B4KA 2P1BA 3HNBM 3FFZA 1SDWA 4ES9A 5DXDA 2EF6A 3ASIA 5K9YA 1NA1A 3KT1A 3NKGA 1FYUA 2ES3A 4OQ8A 3UV9A 1PZ9A 1R091 1PGSA 2RS33 2P37A 4RGGA 4MG2A 3HT1A 4KNCA 5HCAA 2W91A 4IL7A 4UAPA 4DPNA 2VR4A 1C4RA 5A7SA 1SEFA 1S0FA 2ZAAA 4BQYA 4CCOA 5FZ8A 3RYKA 1EP0A 5FXVA 5FYSA 4LBQB 1H9PA 1KJRA 1W8FA 2BERA 3O1MA 2D7FA 1X82A 3VZNA 3ZXLA 5DMYA 1IS6A 1JODA 3RZJA 1W0OA 4B8EA 2OT7A 2RR11 2P3IA 3CMGA 4GB32 4ISRA 4A2UA 3WNOA 2RS52 5FPZA 1H9WA 2VXRA 4DNYA 4Z07A 3WF3A 2OUHA 4DRVA 5LW9A 4XBQA 1E5IA 3GJBA 4XJUA 3VL9A 3HR9A 1G86A 5DZGA 2V4VA 5FYHA 1COV3 1RUJ1 5H9SA 1LOGA 3B93A 4YARA 2NPIA 4YLZA 5FZGA 4YM3A 4JKMA 1SCSA 1SZBA 2D44A 2L9LA 5FP8A 1VRH1 1X33A 4AI9A 3V0BA 2FD8A 1GU3A 1S0GA 3PIGA 1BCXA 4OYUA 3CZJA 4CCMA 2VZQA 5JXGA 1L7RA 3H0OA 1R083 4Y5Z0 1AXKA 3T30A 5E6HA 5C3OA 1C3HA 5I0RA 1JYVA 3LCPA 2OQ6A 4IV3C 5FZDA 4META 2J1VA 4EZ4A
chains in the Genus database with same CATH topology
4XZPA 3UL2A 3VBFB 1ND2B 4R9DA 4UW5A 3INAA 4LBNA 2E9QA 3OD0A 2XHKA 2NLRA 4G9SB 4IEXA 2I2SA 4M01A 1ZM1A 1AYM3 3OPZA 1W6NA 4FXGB 2ZGSA 1S0DA 2BNOA 4I3PA 2ETEA 4SBVA 3GZTB 1X50A 4HMZA 2PAKA 2JG9A 2A75A 5AFEA 2JKBA 4Y1UA 1DF0A 4PDWB 3ZVXA 1ZZ6A 3GBFA 2ZKLA 1CVNA 3PMSA 1QJX2 4C0HA 2VG9A 1PGW1 3VBOB 2JDZA 3OF1A 4LT5A 2ZGPA 1G7YA 1GR3A 1K5MC 4YNIA 3SHRA 4ZU4A 4M3CF 1KJLA 5CFCB 2CWMA 4R9CA 1NXMA 2P3JA 3MFCA 4AGGA 1TEIA 5K0UB 1ALYA 1XYNA 1YJLA 1H8TA 1RUD2 4HANA 4MUVA 1DZRA 2OW4A 3A0NA 5LK7B 3VBOC 2HWB1 3AZVA 4YFZA 2CWSA 1OKQA 3H9AA 3RRDA 5ABJC 1COV1 2B46X 1GQHA 3IPVB 5HCBA 5SV8A 2RS32 1VBE3 1NZCA 1IS4A 3VZMA 4Z82A 3WXPA 2ZGQA 1QU0A 2VNOA 4PBPA 3V56A 2I07B 1MEC1 3TRSB 4F83A 3ZN6A 5CIRA 4FPFA 1C8M1 1VAKA 4IEVA 3CLPA 1URXA 4KQ7A 5FOBB 4QQPA 2JENA 3ZMOA 2ERFA 1LHUA 2GH8A 2HWC3 4IEQA 1N1SA 2GMMA 4JRLA 1PO12 5L7OB 1WD3A 4XJAA 1PVC2 1S0CA 4H14A 5J37A 4P9WA 4CEYC 4FOWA 1UF2C 2E7QA 2HWF1 3LA3A 4OZXA 5J09A 4LO4B 3SXWA 3PHMA 4YZ5A 2CAVA 3AMQA 4JCKA 2VUJA 2D6LX 4GKXA 4BZ4A 3HN1A 3VDDB 5DZFA 2VOVA 1O91A 4GMP1 2D5HA 1MS4A 1CR7A 4GIQA 4XTMA 4S2HA 2ZGNA 3KM5A 3ZXDA 1ZREA 2AH2A 2MEV2 1APNA 4XJZA 1LODA 2D43A 2WS92 1OLQA 2VGDA 1DZTA 3PJYA 4RL7A 3OCPA 2E51A 4O9GA 2OZ6A 1SCRA 4BIFA 1BMV2 2XJQA 3GHNA 5BNNA 1KDKA 3BALA 1RUF3 3CNAA 1FAYA 1CD3G 2XG3A 1CAUA 5DG1A 2JICA 4HN1A 4FPEA 3BB6A 3E6BA 1OOPA 4FAGA 4URTA 5KHKA 4XF4A 4I0WB 4I01A 1MEC3 1KD7A 3WG1A 1PK6B 4DINB 2LUWA 4Q8KA 4YZ3A 2G9GA 4Q4V2 3AP6A 1H4GA 2ZS6B 1PGL2 5KHJA 4K1YA 1RL3A 1EV13 4PDWC 4OI4A 1D4M2 3ZYJB 2AYHA 3A0KA 4R4XA 2XB6C 1J3PA 1YUDA 3IDBB 3V0AA 4NHLA 1UU6A 2BUKA 2R041 1X7NA 4EWAA 2RMU2 5BNQA 2EVXA 3KMHA 4JDMA 3WP5A 3MEPA 1W0PA 4ASMB 4LBMA 4JTOA 1T6GC 1NG0A 2YV8A 3KB5A 2XLFA 2ZX3A 2JJ6A 4Y26A 1ULCA 4HKLA 1AR92 2YHJA 4XFIA 1DLLA 2DCZA 3VZKA 4Q8LA 1REFA 4K8FA 4ZU7A 3NAPA 2ATFA 1BK1A 4WM7C 1Y3TA 4ONUA 3VBRB 4S2DA 4H55A 4EN0A 1N3OA 5I0SA 4H3WA 4M0HA 4N9HA 1NCRC 3E5XA 2QQPA 1IS5A 1NCQC 1KDMA 5HCFA 3AYEA 4HN0A 3VZOA 1U5YA 1UPIA 3DPRC 2BGCA 4YZ2A 1U5IA 2E7TA 1W6PA 2B8MA 1ND3B 1N47A 3MW3A 5SV5A 1AL23 4Q4X3 2UYBA 1ZBE2 3N7JA 3VL8A 4AGVA 2W68A 4YVSA 4D69A 2ZA9A 1TQ5A 1WCKA 4Q27A 4YGDA 1OLRA 1VBD2 5DUWA 1AL22 4WVWA 5BNOB 2BW8A 4Q0SA 3SH5A 1IQAA 3AKSA 4XOGA 5FQ0B 4CDWC 4XJ8A 1GZ9A 4QXKA 2A6WA 2GNMA 4CP2A 1BZWA 1ASJ3 3HWJA 1XNKA 4OLLA 1RUI2 3E6CC 3WG3A 1DGRN 3LSEA 1ZBA3 4AHZA 1NA1C 1VBB3 2EIGA 4N43B 3GYDA 4XQ4A 2EALA 3IBMA 5LRSA 3LSDA 3USUB 1LEMA 1SLLA 3QACA 1A6CA 2F4PA 4COZA 4OFGA 1R1A2 4EN9B 5JOZA 3RG0A 3O7OA 3AM2A 2WT0A 4QHBA 1YO8A 1NLRA 2CAUA 1CAWA 3ZFFC 2GALA 2MEV3 4BA6A 2Q0AA 4RS5B 2Z79A 4BMEA 5FDBA 4MGZE 1BBT1 1GNZA 1F31A 2A70A 2F6BA 1QJX3 4JGYB 4W6XA 2HWC1 5JMCA 1A3KA 1VLNA 4YW5A 3UK9A 2DUOA 4IEYA 1C5IA 1QH6A 4AI1A 1DGWX 2QKDA 2AUYA 2HKXA 1LTEA 1VBE1 1MS1A 1NCRA 2ZAHA 3C2UA 3PNAA 4BYYA 1SLBA 4JV4A 4YM0A 4IESA 3N3HA 4CTEA 1SBDA 2QE3A 1IGOA 3OY8A 2RMU3 4TSVA 3S0MA 1EAH3 1W6MB 3M7AA 5CBLA 5GZDA 4MH0E 1B35A 4N43C 1RUG3 4FOYA 4PBOA 4WVMB 1F5FA 2GAUA 1RJ7A 1XNDA 3MIHA 2A6YA 2D6NA 2XL7A 2R061 3AP9A 3VZLA 2E53A 1D4M3 1VBE2 5DDJ2 1UPSA 1H1MA 2XH6A 1NOVA 3IDEA 2R32A 1SMVA 3ZYRA 1JYIA 3BODA 1G9DA 3ZFEC 3B3QE 5BNOC 1C8NA 4L11A 1S55A 5GZGA 1MS0A 3FJSA 3WNXA 1FPN3 1WCDJ 3EJKA 1V00A 2P34A 5JSRA 1YNAA 1FMD2 4ORFA 2CNAA 1VAVA 5EXOA 2Q1MA 2ZX1A 2JECA 2P3KA 1AF9A 1PIV3 3ZXKA 4HZFA 1OQDA 4BWOA 5FOJB 2PHFA 3I59A 3DV8A 4CDQB 4RGAA 1HQNA 3KS7A 1FV2A 4AEDA 1CAXA 3D6EA 1H30A 4UXAA 1DHKB 4YZ4A 1PVC3 2V73A 1W6QA 1RTVA 1VBD3 2NMNA 4XTPA 4Y1VA 1BJQA 1NE6A 1X36A 5L7OC 5EYYA 3TN93 4G4FA 4CP1A 1AUYA 1J1LA 2CL2A 3G6JB 4C0BA 1D2QA 2ZX2A 1LOFA 1QMJA 4QPIB 4CDWA 4D3WA 2HWD2 3L2YA 1AYM2 2XJPA 4MXWB 4IV1B 4RHV2 1YI9A 3JD72 2P2KA 2AZ5A 4I3GA 4QM9A 1AR72 5C9AC 5DZEA 2RJLA 3AMMA 3D4KA 1N1TA 1D0GA 3O12A 2K9ZA 3B01A 3OD4A 1ENRA 1VBD1 4NVPA 2GNTA 2VW0A 1SQ4A 2PLV2 1ZRRA 4FTEA 4CEWB 4RR3B 4AYUA 1RUE1 4I0BA 3WG2A 3P3PA 3L2HA 2DWRA 4YW1A 1KXGA 2FMDA 4FPCA 4WZCA 1SLAA 3JBG3 3PVNA 4Y4YA 1XE7A 3D82A 4AGRA 4AF9A 1NXD1 2A6ZA 2WZR2 1RVF2 3MDPA 1MQTC 5JCTA 3MICA 1ZRFA 3GNEA 4Q4X1 4OI1A 5JIUA 4IEPA 2XPJA 3RWNA 5C9AA 5GKAC 3FBMA 1UCXA 4E4ZA 3A4UA 2VU9A 1RHI1 4GH4A 1TMF1 2XJTA 3ZIWA 1U5ZA 1H0BA 4RS5C 4XETA 4IQPA 4LHNA 3R4SA 2DTYA 3ZXFA 3R4DB 1H1AA 1R092 4JDNA 3IDCB 5FO9B 1MR5A 4CZSA 1VBA2 2ZX4A 5C8CA 1RGSA 4QX5A 3ES4A 1HRI3 2GU9A 1EY2A 4L92A 2RS31 4B7KA 2O1QA 5GALA 2CTVA 4CDUC 4COUA 5I0TA 2WZR1 4AHYA 2JEMA 2NM1A 1LGNA 3DKWA 3J26N 2R073 3O0VA 4JGZB 3WV6A 5GZEA 1F2NA 5FREA 1GLHA 4AI2A 2RS51 5KHGA 2VW2A 1D0HA 4CDUA 2R043 4DQAA 2OUJA 1DIWA 4IV3A 4GMP0 3TNPB 1NE4A 2JG8C 1TE1B 2ZHLA 3FLPA 3I2DA 1QNYA 4XF1A 1AJKA 2IXHA 1HRI1 2WQZC 2XVGA 5GLVA 4CEYA 3PVEA 3ZSKA 1ZBA1 5T3NA 1PO11 3THTA 1TNRA 1VIWB 1COV2 2PA7A 2ZBJA 4PLNA 5AVPA 1OA3A 5FO7B 4XYXA 2PYTA 2FMYA 5FLJA 3OGJA 3PJQA 4AEDC 3NVCA 2GNDA 4XILA 3ZXJA 3RYPA 5AC92 4XQWA 2Q4SA 5GZFA 2FZ1A 1VBB2 4OVEA 3N4MA 2QDNA 1RB8G 3HT2A 3WCRA 2H0VA 1UAIA 4PJYA 4Q2FA 1DFQA 2WS91 3W9AA 2X5IA 2ZHMA 4OUSA 1DDLA 1WUVA 1QJY2 3VKMA 1RUH1 2ZGRA 1OSGA 1MQTB 1AXYA 2MEV1 5KXEA 2DVDA 3ZFEA 3H1YA 1TMF2 3TN91 1IHMA 3OGGA 2ILMA 3PLQA 4FAHA 1VBC3 1UD1A 4LBQA 2JX9A 3AP4A 5D8AB 2XJUA 1NCQA 1QQP3 1VBB1 4OHXA 3C3VA 3RI8A 1CONA 1MEC2 1V6OA 5GLTA 1WLCA 4FPLA 4C91A 1R1A3 4OHWA 1FOD3 4QGMA 5GM0A 1UIJA 4C1WA 4WM7A 2I45A 1H2NA 3CL1A 1RVF3 4HVOA 3UJOA 1C57A 3ZXGA 2QFEA 4OHZA 5I93A 5I8SA 2GSYA 2WNVA 3AMPA 4IEZA 1VRH3 4BOWA 1FI2A 2TEPA 3WHTA 4F8AA 4UW3A 2C0ZA 4EN6B 1LR5A 1WMFA 1YYNA 3TOJA 2CGPA 1O5LA 3S30A 1Y7BA 2TBVA 1V9U1 2HEVF 2CGOA 1R093 3RI9A 1DQ1A 1QWRA 4XJ9A 2BNMA 2VNRA 1J3QA 1M4WA 1VBA3 3VBFA 2XKOA 3USSA 3WVJA 4LHKA 2DV9A 4CDQC 3GZUC 4JVAA 2UWCA 3WT3A 4WVZA 3TAYA 3WDVA 2GH2A 3NV2A 1YFWA 1W6NB 1EPWA 4UBHA 4COWA 1LULA 2WLQA 3CEWA 3NV3A 4XBLA 4XEZA 1PVXA 2D6MA 2ARBA 4IEWA 4HT1T 3ACLA 2JXAA 3BPZA 3AYDA 4E4SA 4CEWC 2Y0OA 2UWAA 4XF0A 2WZPP 1R1ZA 4AEKA 1TME2 1SBEA 1YRZA 3S7IA 4BLJA 1SFNA 1S0BA 2Z69A 1JTZX 5CB7A 4ITCA 2VECA 3VBHC 4M3CB 2HWF2 5FBZA 1FMD3 3ZSLA 5GLUA 3QBQA 1LOCA 1GSLA 3MLJA 4XE9A 5CFCA 3P3NA 4AFCA 1WBLA 2BWCA 5C4WB 2C5DA 4RHV3 4FVVA 4B29A 1QXJA 1HW5A 1DGWA 4Y1ZA 3E5QA 5K0UA 2DU0A 1H8TB 3R0RA 3VBSB 4Y22A 2RS13 4XHXA 1YWKA 2ZTNA 1CIWA 1RUI1 4GULA 1GBGA 3O5SA 3WUCA 5BY5A 5ACA1 3B02A 2A3WA 3QOPA 5BV6A 1QJZA 4YG6A 4EWEA 4GQ7A 1R1A1 1GYKA 2ZGLA 3IN9A 3WUDA 5E8AA 3ZFFB 3LA2A 2HWD3 3VBRC 3SLIA 1QOOA 4UW4A 1AVBA 3ZYPA 3Q9OA 4IEOA 3OYWB 2BVVA 3B94A 2XVLA 2WFF3 3M3EA 4BHPA 2XWBB 3DL3A 3FE5A 3O14A 1MZ6A 3NWKA 2D40A 2VOXA 4IXLA 5FO8B 4PCRA 3WP6A 1V6MA 2WS93 2Q30A 3MF6A 4ZKTB 2VMGA 4FOQA 2XJRA 1XU1A 3ES1A 3SITA 2GN3A 2ZGMA 4S2FA 3WQ7A 1JHNA 1I5ZA 2V5YA 5EV7A 1RUF2 4JC1A 1GZWA 4XHBA 1A78A 1V6NA 4P14A 1TNFA 4HVRA 2BVBA 3O0WA 4KU7A 3JU9A 2A73B 4PQ9A 1NQJA 3WOGA 5JOXA 4AVTA 2VY0A 1S0EA 2W08A 2BWAA 2ZGTA 4BIOA 1G9CA 5H9PA 4GWMA 5FPXA 1VB2A 3V64A 2R1DA 1B09A 1ONAA 3W59A 4QPGC 5FLHA 4NOTA 1AR81 1I9RA 3IMNA 3OBRA 4JGYC 3MW2A 4EN8B 1OFNA 1LRHA 4BLIA 5J3UA 3ALQA 2I74A 2BTVC 3RDIA 4HLTA 3MF9A 5BUVA 3MLKA 5BNNB 1RUG2 5I8TA 2BNNA 1S1AA 4K20A 1CAUB 1Q8QA 3IKWA 5F6LB 3AKQA 4WVVA 2KM2A 1YXWA 2DCTA 4Q0UA 4E9KA 3AZZA 2EXHA 1CX4A 4LHLA 1ZRCA 3W58A 1PK6A 4Q0QA 1HIXA 2UURA 4Q4Y1 3RYRA 2RS11 1G6NA 1GZCA 1WBFA 1ND3C 5J48A 1F8VA 1LOBA 1SLCA 4FPKA 1PO22 1UL9A 2AREA 4FPHA 2WWSA 4FP2A 4R9AA 4YGBA 5CFCC 4GKYA 3FZ3A 3EQEA 1Q8VA 1LU1A 2QNKA 4W65A 2GC0A 4KG8A 5LK5A 4LO5B 5ABJA 5BPXA 1VBC2 3ZDSA 5JZGB 4YVSC 1WD4A 2R0FA 5D1IA 5T54A 3L9JT 2GC1A 1XU2A 2DCYA 2NZ9A 2RM21 4LO7A 1N1VA 1LOAA 3ME2A 4MGYE 4L9BA 5JPNB 1V6LA 4N53C 1YJKA 2PHLA 5EJ3A 5J96B 3UKVA 1RMU3 2PHTA 4AHWA 3WW4A 2IXKA 1AXZA 4EJRA 3AMNA 4O9EA 3NAPB 2PHWA 2R062 3TYJA 1OI6A 1X8MA 4KU8A 4W6YA 1JOJA 1UIKA 4HPKB 3WDTA 1AYN2 2YXSA 2XBO2 3ZMNA 1DGLA 1CPNA 3MPPG 1VBC1 4E27A 3G7DA 2YYOA 3VGIA 2Y0IA 2ZMKA 3NW4A 1HKDA 4QQOA 4FQ4A 3WG4A 1JYCA 4JDOA 1V9U3 1W6PB 4H7MA 3FUQA 2ZHNA 2R1BA 4V1PA 1YIPA 1GV9A 2D6KA 3WLUA 1RUG1 4RQPB 4GMP3 4DFSA 2O8QA 4EROA 1BVVA 1OA2A 4YVSB 2JE9A 1FNZA 4M0NA 3VZJA 2WNUA 4KWKA 1KS4A 4K1ZA 2KA3A 4AI3A 5BNOA 5FAXA 1NQDA 1JBCA 1LJ7A 5FQ0A 1F9KA 4QQLA 3ATGA 3H3ZA 2PHUA 2EXJA 4EWDA 1A8MA 4A7ZA 2YGMA 3ELNA 1PO21 2WNVC 4K21A 3CJIA 4YGCA 1RUE2 4BCUA 1CGPA 5I8YA 3B9CA 1B35C 1JW6A 1O4YA 4N43A 2X29A 1PK6C 4KGGA 4YSFA 1FMD1 4TWTA 5E1RA 4L8QA 1V6KA 1CQ9A 3RS6A 2WFPA 2XLGA 1HRI2 4R9BA 2DVBA 3VBHB 1RUD1 3H7JA 4E2GA 5BXXA 1AL21 3LWCA 3DN7A 2DFCA 3RQ0A 4E2SA 2FZ2A 3M1HA 5L73A 3ZN5A 5JR7B 1E57A 4KWLA 3POWA 2O8OA 5E88A 4WM8B 2RHPA 1SBFA 3AXEA 3R6SA 3ZFGC 1FX5A 4FT8A 4AVBA 3WCSA 1MS3A 2VULA 4NO4A 1J58A 3ENRA 2D98A 2ZZJA 5CA6A 2RR12 4HSJA 1W39A 1UZZA 3CF6E 3IIAA 2D3RA 2XUMA 3OY8B 4Q0PA 1QF3A 4D7TA 3DPRB 5JDBA 4ISQA 3ZSJA 1RINA 2NP0A 4HK9A 3FC0A 4WVMA 3ZIXA 3T1MA 3EHKA 2DCKA 2RS12 3U11A 1BBT3 2UY9A 1O5UA 1DQ4A 3MI8A 1RUC2 3VHOA 4XMAA 3JBG1 4P9JA 2G4IA 1ZZ9A 1DQ0A 3AXDA 3K51A 4HFSA 2WQ4A 5H9QA 3ZO0B 4XF3A 4XFGA 4FXKB 4AQ2A 3IT8A 2BBVA 5IT6A 5L19A 3MZHA 4YVWA 3QCWA 4QMAA 3AX4A 3KT7A 3EXUA 1RVF1 2PHDA 3IWZA 1ZBA2 1EV11 2JG8B 5KC6A 2HWB3 2YDEA 3HQXA 4XQDA 2WIIB 2XGXA 4PF5A 5C8CC 4AG4A 1TMF3 4NPRA 1LB2A 4OULA 3JQXA 2CV6A 2RE9A 2VUAA 2ZCWA 4Q26A 4PLMA 2ZOEB 3S7EA 4AEDB 5A32A 1CAXB 4QGNA 2VH9A 1DG6A 4XFCA 2WKKA 4HBNA 1UU4A 1LHOA 4CRQA 2H6CA 1FOD1 1W6QB 2XLAA 1WMEA 1QKQA 1RUC1 4U36A 1RUH3 3VBSC 5F9TA 4YGEA 1SLIA 4Y20B 1HXS2 5HXVA 4MLOA 2OZJA 3B7MA 3SH3A 4FSJA 5JSPA 2VOKA 1ZZCA 2VVEA 2K0GA 4X6QB 4HL0A 2PN5A 1QJU3 1VJ2A 5DUXA 4IV1A 5DG2A 4N7UA 1EV12 4AVCA 1XNBA 2MHFA 1PZ8A 1K5MB 2YZ4A 2N7GA 1EAH2 1OHFA 3ZYIB 3CJIC 1AX2A 3ILFA 2R16A 4IERA 5C33A 4P9GA 4N9IA 4CEWA 4RR3A 1PO23 2VW1A 4KH9A 4DY5A 1POV3 3NV4A 5KXCA 3AFGA 4GALA 4KGQA 4EN7B 1OFSA 5CFDA 2YROA 5CADA 3QH6A 5BNPC 2D3PA 1QXPA 4XJWA 2D93A 3KT4A 4ASLA 4BM8A 3D0SA 4FPOB 3MIGA 2D97A 1EAH1 1NY72 2VQ0A 1OOPC 2HWD1 4MGIE 1HQWA 3NAPC 2Z42A 5I91A 1J3RA 5C9AB 1JH5A 4QPGB 1LOFC 5A33B 3SCHA 4UBGA 3OBTA 4GH4B 4LULA 2IFRA 2ET1A 3M4FA 2HEWF 2RS53 1HLCA 3H1WA 1LEDA 3PMEA 5CG8A 2A3XA 3PTYA 4NHKA 4B7EA 4CDXA 4BE3A 4Z1VA 1D4M1 1Y9QA 3ZFGB 1ASJ2 1ULGA 1RITA 5B2GB 1CAVB 3SMHA 5C6CA 4IETA 3RMXA 3TN92 4LEJA 3LZZA 1LU2A 4AEJA 5IK5A 3N36A 1H2LA 4XMIA 3AK0A 1PNGA 4A7YA 3B00A 4Y1XA 5FFOC 1DYPA 4AQ6A 1V6JA 3WR0A 2IC1A 2CY6A 2WLPA 4P9XA 2EAKA 2WNEA 4Q1PA 3WY6A 4L2NA 4XBNA 4HSLA 3LKJA 1PHMA 2QUOA 3NSTA 5BNPB 4LTAA 4CDUB 2GMEA 3CO2A 4DOUA 1PGL1 3MIBA 1AR91 4JRAA 2HWB2 4IV3B 3KCCA 2TNFA 3LAGA 4DMIA 1ZVFA 4I0AA 5JLVA 4AI8A 2XBO3 4K7JA 3V65A 4H7LA 2ZACA 3LOIA 4XFAA 1VBA1