1QJX3

Human rhinovirus 16 coat protein in complex with antiviral compound win68934
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
238
structure length
238
Chain Sequence
GLPVYVTPGSGQFMTTDDMQSPCALPWYHPTKEIFIPGEVKNLIEMCQVDTLIPINSTQSNIGNVSMYTVTLSPQTKLAEEIFAIKVDIASHPLATTLIGEIASYFTHWTGSLRFSFMFCGTANTTLKVLLAYTPPGIGKPRSRKEAMLGTHVVWDVGLQSTVSLVVPWISASQYRFTTPDTYSSAGYITCWYQTNFVVPPNTPNTAEMLCFVSGCKDFCLRMARDTDLHKQTGPITQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords PROTEIN VP1
publication title Analysis of Three Structurally Related Antiviral Compounds in Complex with Human Rhinovirus 16
pubmed doi rcsb
total genus 41
structure length 238
sequence length 238
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1999-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1qjx300
2HWD3 5C4WC 5J98B 3CJIB 4Y5Z0 4RFT0 1BEV3 3ZFFB 5BNNC 1AUYA 1COV1 5C4WA 1FMD1 1PO11 2HWB3 2BFUL 2WWSA 3JBG1 4Q4W1 1Z7S2 4RR3A 2R042 5BNNA 1V9U1 1RVF2 1ND3C 2RMU2 5CFDC 2WZR2 4CDQA 4CDUB 1RUD2 1COV3 3TN92 1FMD3 3NAPC 1PO13 3JBG3 4N53B 4Q4W3 5D8AC 3VDDC 1RUE1 1OHFA 1V9U3 1PVC2 1AYM3 5ACA1 5D8AA 3VDDA 1NCQB 3FBMA 2WFF1 5FMOL 4RS5B 2R061 1RB8G 5DDJ2 2XPJA 4CEWC 1AR72 2R071 1K5MA 5L7OA 1NOVA 1CD3G 4GH4A 1VRH1 1RUE3 4FSJA 2MEV2 4CEWA 5AC92 5ACA3 3ZXAC 1VBD2 3IDEA 1QJU2 1TME1 1FOD1 2WFF3 4Q4X1 5C9AB 2BUKA 1AYN2 1H8TA 2X5IC 1NCRB 2XBO2 2R073 1PGW1 2RS51 4N43B 2GSYA 2WS92 2RS11 1PGL2 3VBOB 1VRH3 2RS31 2X5IA 3J8F1 1QJZA 5C8CC 1RUF2 1NY72 1TME3 4QPGC 3VBSA 1FOD3 4CEYC 1NA1A 4Q4X3 1AR92 4JGZB 1SMVA 2PLV1 1HRI1 4GMP0 2RR11 2WLPA 2RS53 4IV1C 4QPGA 2RS13 1ND2B 2RS33 4PDWC 4YVSA 3J8F3 1HRV1 1RUH2 1BBT2 4IV1A 1ASJ1 3VBFA 5BNPB 1POV1 1HX6A 4JGYB 4PDWA 2PLV3 1HRI3 4CDWC 2HWD2 2RR13 5GKAC 1ND3B 2FZ1A 5CFDB 1QJX1 4CDWA 2HWB2 4FTEA 3NAPB 1ASJ3 1VBA2 4YVWA 5LK7B 1POV3 1F2NA 3M8LA 1EAH1 5A33A 2BFUS 5K0UB 5CFCC 1PO21 3DPRB 1FPN1 5JZGB 1EV11 1B35C 1OOPB 1QJX3 3ZFEC 1BMV1 1COV2 5CFCA 1FMD2 1PO12 1RUG1 1AL0G 3JBG2 1QJY1 4Q4W2 4RR3C 1B35A 5BNOC 3VBRA 3ZFEA 1EAH3 3ZFGB 1AR61 3JB8A 4AEDB 1PO23 1ZBE2 5BNOA 1FPN3 1EV13 4CDQC 1AYM1 3VBUB 5FMOS 4RQPB 1PIV1 1VBE2 1AL21 1RUG3 1QJY3 1RUE2 1NG0A 5ACA2 1R081 1AR63 1RHI1 1MQTA 2R062 1GFF2 1K5MC 5L7OC 2R072 1PIV3 4Q4V1 1AL23 2HWF1 4GH4C 3VBHB 2R041 1VBB1 1C8M2 4BCUA 1R083 1RHI3 1RUC1 1TME2 4LLFA 1RUJ1 2RM21 1FOD2 5ABJA 1AR81 4WM7A 1H8TC 1RUD1 3TN91 1PGW2 2HWF3 2RS52 4Q4V3 1VB4A 2R043 4CDXB 1VBB3 2RS32 5A32B 3CJIC 3J8F2 1RUC3 2ZZQA 3VBSC 1MEC1 2FZ2A 1NA1C 1RUJ3 4QPIA 2RM23 2HWC2 1AR83 4RHV2 1RUD3 2PLV2 3CJIA 3TN93 4IV3B 2RR12 4FTSA 3ZFFA 4WM8B 3S6PA 4YVSC 4Q4Y1 1VBD1 1HRV2 5C4WB 3VBFC 1ASJ2 1MEC3 4RR3B 5BNNB 1AYN1 2DF7A 4N53C 2HWE1 4Y4YA 4CDUA 1QJX2 1QQP1 1R091 4Q4Y3 4CDQB 5J96B 4N53A 1VBD3 4GMP1 2BPA2 1NY71 4YVWC 1BEV2 4RS5C 1EAH2 5FOJB 1AYN3 2IZWA 1VBC1 1D4M1 2HWE3 1NCQA 1W39A 1PO22 4RS5A 3VBHA 5D8AB 3VDDB 4GB31 1FPN2 1EV12 1QQP3 1BMV2 1R093 1F8VA 1BBT1 4GMP3 5L7OB 5C9AC 3VBRC 1QJY2 4GH4B 1NCRC 4EJRA 1TMF1 4CEWB 2Y26A 1HXS1 1VBC3 1RUI1 1D4M3 3JD71 1AR62 1C8NA 5C9AA 1RMU1 4GB33 1V9U2 1IHMA 1NCRA 1AYM2 4N43A 1BBT3 3VBOA 1VBA1 1AL22 1X36A 1R1A1 1TMF3 1HXS3 1ZBA1 1RUI3 2X5IB 3JD73 1MQTC 1R082 1RHI2 3JB4C 4WM8A 4JGZA 1ND2C 1RMU3 3VBSB 1NA1B 2ZAHA 5BNPC 5C8CB 4JGYC 1VBA3 2HWF2 4Q4V2 2WFF2 1ND2A 4QPGB 1VAKA 1VBB2 4CEYB 3LOBA 1R1A3 4YVSB 1ZBA3 5BNPA 1RUC2 4JGYA 1Z7S1 1ZBE1 2BBVA 4IV1B 3VBFB 1VRH2 4NWVA 1RUJ2 4WM7C 2RM22 5ABJC 1RVF1 1AR82 4PDWB 1VBE1 2RMU1 1ND3A 1X33A 5CFDA 2WZR1 5K0UC 4Q4X2 3DPRC 4CDWB 3NAPA 5JZGC 1E57A 1OOPC 1Z7S3 1ZBE3 2RS12 4QPIC 4Z92B 5K0UA 1MEC2 4YVWB 1PVC1 1RVF3 5A33B 2ZTNA 3DPRA 1VBE3 2RMU3 5JZGA 3ZFFC 2QQPA 1OOPA 2WZR3 5DDJ1 1C8M1 1AR71 3ZFGC 1HRI2 4Q4Y2 4AEDC 4SBVA 5CFCB 3HAGA 2MEV1 3VBUC 1B35B 1PVC3 2R063 3VBRB 3ZFGA 5AC91 4RQPC 3ZFEB 4AEDA 1QJU1 2HWE2 4CDUC 3VBUA 5DDJ3 5BNOB 1C8M3 1AR73 1OPOA 2XBO1 4RQPA 1QQP2 1R092 2WS91 1POV0 4NWWA 1PGL1 1A6CA 2MEV3 2HWC1 4RHV1 5AC93 1RUF1 1QJU3 1NCQC 1VBC2 5C8CA 1D4M2 3VBHC 1MQTB 2TBVA 1AR91 4CEYA 4GB32 2XBO3 1M06G 2WS93 1VB2A 2HWC3 4RHV3 1DDLA 1RUH1 1TMF2 1RUF3 1HQNA 1HXS2 1K5MB 1RUI2 1RUG2 3JD72 4CDXC 1CJDA 1AR93 1RMU2 2GH8A 2VQ0A 5ABJB 2HWD1 4N43C 4WM7B 1HRV3 3VBOC 1BEV1 1WCDJ 4CDXA 4FTBA 5A32A 4IV3C 1H8TB 1R1A2 1RUH3 2HWB1 1PIV2 1ZBA2 4WM8C 4JGZC 4QPIB 4IV3A
chains in the Genus database with same CATH superfamily
2HWD3 5J98B 1OA3A 4XJAA 1SBEA 3VHNA 4GWJA 3RYKA 2P5BA 4NUBA 3GCXA 1AUYA 3VZOA 1MS4A 2VZOA 1Q43A 1XSRA 4P5YA 2JXAA 2B42B 2I2SA 1COV1 4XYXA 3ZSLA 3J4UH 1QH7A 1PO11 2EVXA 2HWB3 5FY5A 3AP4A 3JBG1 3SCGA 5CBLA 1HIXA 1PK6B 3KT7A 2Q4SA 1KXGA 4DB5A 2AYHA 1JS9A 4FOVA 4XABA 4BQXA 3NNJA 1A8MA 1SZBA 5F9TA 4UFLA 3VKLA 4CCJA 2VZ1A 2JG9B 4KGQA 1GOFA 1UL9A 2PHXA 3T4HB 3U11A 2PXJA 4J1WA 4EZHA 3ES4A 1CWPA 4JTNA 2JICA 4YW6A 5GLZA 1UPIA 4OMCA 4CDUB 1H2MA 1RUD2 1JN2P 4I09A 4EZ4A 3TN92 5JOXA 3POWA 4XJZA 3PU3A 3C7GA 3VDAA 2Q30A 4LR4A 1RXGA 3FHQA 1JZ7A 1RUE1 1QDCA 1PVC2 5L9BA 4XCAA 3T2QA 5ACA1 3IWZA 1XNAA 5FY9A 2G9GA 1X8EA 2GNDA 1MS5A 1AX1A 2JIGA 2O0OA 3M3EA 4FAGA 2EALA 5F5QA 2WNUB 2ZHMA 5FMOL 2QTWB 2H0BA 4CXXA 2R061 3I49A 2YG0A 3GYDA 5FPBA 3WDTA 4MV2A 5CKNA 4BOWA 1QOTA 2OQ7A 2W5FA 4Q5OA 4UFHA 1QOOA 1S4CA 1NXMA 3RVHA 1VRH1 1IPJA 5D1IA 5AC92 4EWAA 3ZXAC 3SKVA 1GYKA 4QM9A 1CPNA 2VOXA 1TME1 3S7IA 4EN9B 3B9IA 2PAMA 2BUKA 2G9ZA 1H8TA 4Q2FA 3ZYHA 4CP2A 1UX6A 4BB3A 3RZLA 1H9PA 1PGW1 2BNOA 2DYCA 1AXKA 2WS92 2XHNA 2ZAAA 4FBFA 2CSGA 4Z8BA 3C7OA 1US3A 3K4DA 1SLBA 4IEUA 5H9PA 2RS31 4B4PA 4CUCA 2JJ6A 3CNAA 3WG4A 2QQIA 3FX3A 1H0BA 4CZSA 2FQPA 5C8CC 3EO6A 1R1ZA 5FYTA 1JBCA 3TEWA 5DAPA 4CEYC 1SPPA 3KD4A 2WZPP 3ZIWA 4BYYA 5C70A 1AR92 4JGZB 4AI1A 4YW7A 3T1MA 1SMVA 4TZDA 3J9SA 4ISRA 4PLMA 5FP4A 2RR11 1KITA 4LMFA 2WDBA 2ZGRA 5IW0A 1VP6A 4IV1C 4DY5A 3ES1A 1UU6A 5F3EA 3N4MA 2RS13 2VL4A 4QGMA 2VOTA 5KXCA 3H8UA 4YVSA 3J7NA 1JUHA 1Z0HA 3ZYBA 2CL2A 2JKXA 1HRV1 1RUH2 1ZM1A 4AQ2A 1XNBA 4BA6A 1BBT2 1J84A 4IV1A 5KXDA 1GZWB 2Y0IA 4XBQA 3S5AA 1EUUA 1E5HA 1OSGA 3NJXA 2ARXA 3ZVXA 4AG4A 4YGCA 1HLCA 2GC3A 4NHLA 2A6VA 4BISA 2D6MA 1WLTA 3W20A 2Y60A 3WQ0A 5T52A 1ND3B 1UY0A 4FPYA 3CHXA 5LBFA 5IYYA 5JXHA 1QWRA 1QJX1 5CFDB 1H2LA 1V6JA 2ZBJA 1ZRIA 5HXVA 5JSOA 1POQA 4P9XA 4YM1A 3ZN4A 1WKYA 3NNGA 3UGHA 3O0XA 1N3QA 1VPHA 1ASJ3 1VBA2 3NAPB 4YVWA 1POV3 4FTEA 3AZWA 5A33A 2VUCA 2BFUS 2O8QA 4MO3M 4A6OA 1PZ8A 4LO7A 4DUXA 5LWBA 2IXKA 2Y6GA 2RV9A 1Y3TA 2QDRA 2YHJA 1Y9GA 4YG6A 5H9QA 4W6YA 1IS4A 5FYCA 3DPRB 3OPTA 1FPN1 3WNPA 5JZGB 3WF3A 4FFHA 2HEWF 3KF3A 3EJKA 4LKDA 2HJIA 2XKOA 1GQPA 4LBKA 3HN1A 1COV2 4FPJA 4GULA 4HPKA 4IGOA 2ORXA 2D97A 2LW8A 1DFQA 1PO12 4J6GA 3U10A 4IL7A 1OQEA 3JBG2 4NN0A 3A4UA 4TXWA 5GM0A 2HEVF 5JWPA 3OGSA 5DAVA 5F5CA 1EAH3 4LIVA 4QAWA 4S2FA 5FPXA 1T2XA 3ILRA 3ZFGB 5FZEA 4AEDB 5C3QA 3RYPA 1W2OA 1ZBE2 2VTFA 3LEIA 5I0RA 5GZCA 1EV13 4CDQC 1NLSA 5A1LA 4CU9A 4KG8A 4CE8A 2YY1A 4XCBA 4OHYA 5C5TA 1VBE2 1OQ1A 1LODA 3AVSA 2FMDA 4IV3A 4RA0A 5FZ6A 1AVBA 5TSWA 2QE3A 3NNFA 4BXFA 4FP2A 4QQ2A 1RUE2 2UYBA 1SCRA 3AKTA 4HG6B 4HONA 4PIZA 2R0FA 3E97A 5ACA2 2ZMKA 1AR63 1RHI1 3O7OA 4LKEA 1HB2A 4XF4A 3ZN5A 3TNPB 2AUYA 1PZ7A 2VCCA 3FMGA 1HQWA 1H1AA 2OZJA 2EXHA 2NYYA 4OFGA 2R062 3WP6A 2VOKA 3WQ7A 5LASA 2VQUA 1DQ1A 3V0BA 5I8YA 5FP9A 5BUVA 5A70A 3LWCA 2ZMNA 3SHRA 4I2OA 3S7EA 2W52A 1O3RA 1KQRA 2G19A 3PMSA 5IVVA 3OBTA 5LZ6A 1T6GC 1RUC1 1SDWA 1EP0A 3OF1A 3OPWA 3T08A 1OQDA 3POEA 1TME2 4LLFA 1F4HA 1RUJ1 2RM21 2XONA 3MPPG 1ODMA 1AR81 3D4KA 5LATA 4LOSA 4AGRA 2ADEA 4R52A 4TWTA 1O5LA 2C1FA 2X8KA 2IXHA 1PGW2 3PIJA 3KLSA 3WW3A 2PHWA 5LW9A 1UN1A 4UBGA 2IXJA 2RS32 1ZZCA 5FPUA 4JQRA 1YYNA 1DQ6A 1O6UA 2GP3A 2JDUA 3ROUA 2PHLA 3VBSC 2PELA 4COZA 5JR7B 5FLHA 4ZS3A 4QPIA 5FZFA 2ZJCA 2QQLA 5L9VA 2JEMA 4OMDA 1C1LA 1VAVA 4MZUA 4F83A 2W1QA 2RR12 4EYUA 1PK6C 1DZTA 4BIOA 4G4FA 1IS6A 3LPGA 1BK1A 1NLQA 2AREA 2QQJA 1UAIA 4DXZA 4HVRA 3ZXEA 3HVDA 1QDOA 2JG9C 4TLFA 4OI4A 1HRV2 3AZVA 3BTAA 4CXWA 5C4WB 1PK6A 5ISLA 3POJA 4RR3B 2ZEXA 2R49A 5LBCA 1ULOA 2JG9A 2AZ5A 3W58A 5FBJA 1WW4A 1XB9A 2J1RA 2VZVA 4IEYA 3NVCA 1XXNA 2B9UA 3FJSA 4PI0A 2KR2A 4WVMB 4XFIA 1QJFA 1RITA 3ZXFA 4DMIA 4CDUA 4CU8A 4DINB 1QJX2 3AKQA 2HH9A 1W6OB 2FCVA 3RZKA 3BPSA 3OYWA 1VBD3 4XIKA 1QNWA 4ZS2A 4D8MA 3NSTA 4KH9A 1V00A 2WNUC 1UY4A 3WF0A 5CB7A 3WEZA 4GJZA 5FLJA 2D93A 4AXOA 4OHXA 3QCWA 1AYN3 1VALA 4QGNA 3RWKX 2VJXA 4UFKA 4UW4A 1VBC1 2E32A 5FO7B 1D4M1 3ZN6B 4BPZA 1LECA 2HWE3 4BJ0A 2JWPA 2WNUA 5JMOA 1DU3D 1JOBA 2A75A 2WZ8A 4OUMA 2GH2A 4GB31 1FPN2 4D7SA 1SFPA 1ENXA 2GAUA 4LE4A 1DYPA 2P6HA 4W6WA 4YFWA 3WNOA 4LULA 3VD9A 2NMOA 4MGYE 4BQYA 3SNMA 3KGZA 2WAOA 2ADDA 4QDRA 4QKBA 1DGWA 5KXBA 5IUQA 2OS2A 2W1WA 4DS0A 1E5RA 4D6RA 3OTFA 2YZ4A 4AFMA 4GH4B 1OKQA 4UXAA 5HCHA 1TMF1 2OA2A 4NE9A 4PBPA 5F3CA 1XBFA 4MGSA 3N9OA 4DQAA 2ARAA 1FNZA 1YIFA 3HNYM 1C8NA 3MICA 2FCTA 4H55A 4IE7A 5FCCA 3FE5A 1GUIA 3ETQA 1CAVB 1YCIA 3I2JA 5LA9A 1JZ5A 4ZONA 2GMPA 3ACFA 4H14A 2QDNA 5IK8A 2ZHKA 5JR2A 3BTXA 2IFRA 2CV6A 4A2UA 5FYUA 5SV8A 1YQ2A 2LROA 4DEVA 3Q8AA 4Y4YA 1JZ6A 3BI3A 2YYOA 3MLLA 3KHCA 2VULA 1X36A 1PX3A 4I02A 3HIFA 4XJ9A 1ZBA1 1OFNA 2X5IB 3DXUA 3RYRA 1MQTC 4OQ9A 3HBZA 1RHI2 2RE9A 1RJ7A 4MHUA 4QKFA 3RSJA 1JTZX 4JGZA 5GJ6A 3FLRA 4UBHA 1UZYA 2ZAHA 1F5JA 3OGVA 1IQAA 3TB0A 4AVVA 1N47A 1PVXA 3NRUA 1KFXL 3ATGA 4I3PA 1QY4A 5DPNA 1B09A 4H2AA 3NJZA 1F35A 1OUXA 2FDIA 2GDFA 2P37A 2RVAA 2VU9A 1YXWA 5ERLA 3ILNA 1UYXA 1O3TA 4AQSA 1GZWA 1GLHA 1RUC2 1UU4A 1Z7S1 2LUWA 3EB7A 3LD8A 3Q8EA 1Q56A 4UFIA 5FJHA 1ULGA 4AW7A 5EJZB 4NWVA 1RUJ2 5ABJC 2RM22 2WWUA 2VQAA 1VAMA 1AR82 4GKYA 4WBBA 4PDWB 4AE2A 1ZZ6A 3LIHA 1TEIA 4NRPA 5A1AA 3OJBA 1ND3A 2VNGA 1X33A 4NHMA 4X6QB 5CFDA 3O14A 2VPVA 1RIRA 4FPCA 1AHSA 2WJSA 3FFQA 4Q0PA 4L0PA 4BM8A 2ZGMA 4JX0A 3DPRC 4JHTA 1NAEA 3NAPA 4CDWB 1SACA 1WA6X 5JZGC 1E57A 1PMJX 3RI9A 4EN7B 3RZMA 2OYZA 2PHUA 1W8OA 2RS12 1W6NB 1UYPA 3PTYA 5IJRA 3CKHA 3AM2A 5GLVA 4O9EA 4OZXA 4DRVA 2Y33A 2A3YA 3DPRA 3SH3A 1REEA 3UJQA 3I2GA 3IIIA 5JZGA 3KHBA 2GZWA 3POSA 4CUBA 1JYTA 3I7DA 1AR71 3WNMA 3ZFGC 4HN0A 1X9PA 3FN9A 4NVPA 3WXPA 2FD8A 4AEDC 2PQSA 4BMEA 3LZZA 1C3HA 4JKLA 2D5HA 3HAGA 1YI9A 4UW3A 1N1SA 2P17A 3ZXGA 4E4SA 1B35B 1PVC3 2ATFA 1JMUB 3ZFGA 2GU9A 5KHIA 4E8CA 4AEDA 1MS1A 1W0NA 5FYIA 3T0AA 3BKZA 2BOIA 5C3PA 3AMQA 2VNVA 4IXLA 5JSPA 2BNNA 3ACIA 3GXUA 3C7FA 2WO3A 4PI2A 5FZ0A 1C8M3 1W28A 3UGGA 2V4VA 1OPOA 5HCAA 4I01A 5A80A 2RJLA 4ASLA 3O12A 2C4XA 3K75B 4LBOA 3DXTA 4D6QA 4JDMA 1W2NA 3AZXA 1W8NA 3FWEA 5F6KA 2BV4A 3VZJA 1PGL1 4FFFA 3VZKA 2HYXA 1A6CA 3HN3A 4U36A 4LQRA 4HVQA 1O4YA 1ZX5A 5AC93 3E6DA 2WC2A 4HBNA 1LOFA 5K8SA 2WA3A 2ERFA 3B93A 3GBFA 3GNEA 1VBC2 1D4M2 4IEZA 3WQ1A 4N90A 4ZY9A 5C3RA 1YC61 4QX2A 1JOPA 3ZPOA 4GB32 4LHSA 1FX5A 3HNMA 1RL3A 3ZM8A 1DP0A 4XF0A 1ZVFA 1UZWA 1W9FA 1LOCA 4IEVA 1O91A 2WS93 4IERA 2Y6LA 3AMPA 3DCQA 1KS4A 1VB2A 3J7HA 3LAGA 3SISA 1DQ0A 5LBEA 4BXSV 1X82A 5AVPA 4CPBA 1G9BA 4RHV3 2VTXJ 3K3NA 1G86A 2QQUA 1TMF2 1V70A 2NN8A 2ZOEB 1MVQA 4NJ4A 3KF5A 3MUZ1 3KT1A 1MZEA 1DGWX 1AR93 2XLGA 4FXGB 1I5PA 4XURA 1U12A 2VQ0A 3D82A 2YFUA 4IDZA 2ES3A 2ZGNA 2A5ZA 4QX8A 1GBGA 1WCDJ 2GN7A 5DAQA 3MGUA 2UWBA 1K3IA 1PM4A 1W04A 2ID4A 3LQCA 3U4XA 1H8TB 1RUH3 2GMMA 3UESA 2AGSA 5EHDA 5GLUA 1ZBA2 1OFSA 3VUOA 1L7LA 4B1MA 2GALA 2ZGTA 2YGMA 4L11A 3WNNA 4FPEA 5FIXA 4B7KA 3BODA 4OI1A 3W21A 4LNVA 5C4WC 3W5MA 2XJVA 5E88A 4Y5Z0 4RFT0 4CPBD 1BEV3 1C28A 2QKDA 3MLJA 4QX0A 2JD4A 3S30A 1WGPA 2WT1A 4EQVA 2VW0A 4M3CE 5GZGA 5KR7A 2AENA 4AFAA 1MS3A 2GMEA 2ZZJA 1Y7BA 4QX5A 4XXPA 2UY8A 5C4WA 5FMCA 3T09A 3O1UA 2WWSA 4CYDA 5JUVA 3ZPYA 2Y6JA 1Z7S2 4RR3A 5JOZA 1V9U1 1ZZ7A 1UCXA 2XQXA 1O7FA 4OUEA 5F6LB 2VH9A 3HT2A 3B3QE 2VE1A 3OB8A 1TZOA 3SCFA 1Y4WA 4DPNA 5FO8B 2B9VA 3HPNA 3IAQA 4WVVA 4WVMA 3ZYRA 5IVCA 3DEMA 4LK7A 3HR9A 2GP5A 5L9RA 1W6OA 2QCSB 3ZSEA 1V6IA 4AYUA 1COV3 4COYA 5F2SA 4AHZA 1PO13 4HFSA 4CSWA 3I3MA 3JBG3 3ZKYA 1H6YA 1BZWA 1UD1A 3OGJA 2OQ6A 4YM2A 3UT0A 5F7UA 1J1LA 3ZN6A 1YWKA 5DZEA 1G9CA 4QHZA 2YGLA 1G9FA 3IM0A 5CKQA 2DCZA 4M3CB 2AC1A 1KRIA 3AKRA 4RS5B 3T2OA 1RB8G 3ZKUA 3Q8CA 1AR72 1DIWA 2R071 4D7TA 3OD0A 5D21A 3ZXLA 4E2SA 3WF1A 1SLLA 1NLRA 1CD3G 3WCRA 1ENSA 5FYHA 5LRSA 4GH4A 1RUE3 4HKOA 2K46A 3UYJA 3WX5A 2JDYA 4AZZA 1JHNA 2E26A 1LR5A 5ACA3 4ATFA 1RUOA 2VMGA 1MS9A 1VBD2 3PLQA 4KU8A 4NAOA 3VL9A 4AFDA 1WMEA 2R1DA 5FZMA 4N9IA 1FOD1 3HEIA 4XF1A 1CAVA 4XF3A 4Q4X1 3RDIA 3RI8A 3USSA 3VN4A 4YSFA 5C9AB 1CX1A 5DMYA 1AYN2 3PUAA 2X5IC 1NCRB 3RG0A 2YBPA 2RS51 4N43B 2XG3A 1SLAA 1J3QA 2ET1A 3WOGA 3O0WA 3HNBM 1PGL2 1QH6A 1VRH3 3IZOA 5DAWA 1H30A 2PYTA 4E8DA 5FQ0B 5H9RA 4C1WA 4Z2WA 3OEAA 1HN1A 2VMHA 2X5IA 3J8F1 4EN8B 4QU2A 3WDUA 5FYVA 1UMZA 5IWFA 1LULA 2J1UA 1TME3 4KMQA 4P14A 2EXKA 3B69A 3T4VA 2JD9A 1VR3A 1M4WA 3MHZA 4YG0A 2H0VA 4DFSA 1OLME 4E4DX 5FP7A 4YNIA 4GZ9A 5HCFA 3U07A 2OVUA 1R64A 2CGOA 2J1VA 2WA4A 4W50A 2GC2A 1ND2B 2RS33 3NO8A 2RDRA 4PDWC 1U5ZA 4GWIA 4V2VA 5C8WA 5JOWA 3CBNA 4L9BA 1LOAA 1ULFA 2Q1ZB 5LB6A 5FY8A 5FV3A 1DQ5A 3A22A 3N7LA 4X8PA 5BNPB 3ZXDA 5I8SA 4BMBA 3THTA 4D7YA 3P3NA 4PDWA 1CAUB 4FAHA 3S57A 4DOUA 4CDWC 5T54A 1FYUA 1ACCA 3GCWA 4KI5M 2RR13 1CONA 2Q0AA 1XC6A 3POBA 4QXKA 2DVDA 4NRQA 4XTMA 3TEYA 1LGNA 4B7EA 4NIDA 3LEMA 5J7MA 5KHJA 5F32A 1O3SA 3MF9A 4C0HA 4QX3A 2W47A 4QXHA 4CDWA 3AYEA 3BIWE 3WR0A 1GZTA 1LGBA 3D8CA 2CY6A 5FJKA 1W6NA 2WNVC 1UIKA 5EYXA 4BK5A 2QQMA 3TBDA 4XJUA 5IAXA 2JE9A 1JHJA 4KWKA 3HD8B 1PO21 1DGRN 5FMBA 2V4AA 4MGKE 3J7MA 4LA3A 1B35C 1O8PA 1QJX3 5FOBB 5FZIA 3M3CA 4AEKA 2K9ZA 3WW4A 2FHRA 4GWMA 3CL1A 2YC2A 4LHKA 2WQ4A 5EPAA 1SCSA 1VJ2A 3MUY1 3WNKA 1QJY1 3ZYFA 3T30A 1B35A 3GZUC 4XBLA 3BPZA 3K51A 2VD7A 1HV0A 4XUPA 3PJQA 4QGLA 4M4RA 1SBDA 2BDRA 1FPN3 4XQDA 5BXXA 2P3KA 1GSLA 3PVNA 1LJ7A 5A3OA 1H6XA 3RWNA 1GP5A 2B7YA 3GZTB 1QOSA 3H1MA 4GKXA 4MGIE 4RQPB 1PIV1 4NHYA 1AL21 4M0HA 1Y9MA 1EYBA 1FV2A 2YXSA 3H1WA 4OLLA 1GZ9A 3SH5A 3H7YA 3EXUA 1NG0A 2L9LA 2VVFA 1R081 3ITQA 4JZRA 3OYWB 3OPZA 3I3DA 4QPWA 3TOJA 2Y6HA 3ACLA 5FFOC 2PMWB 1OMIA 1YEWA 3WUDA 3M7AA 1MZ6A 4QB2A 2SLIA 1CIWA 3M3IA 1N1YA 2R072 2Q8CA 5IVEA 5FWEA 1QU0A 5T5JA 2HWF1 1GWKA 1AZDA 1DQ4A 2XQRA 3H42B 3I4IA 2R041 2FDFA 4COUA 2Z42A 4KWLA 1REFA 2B45X 1C8M2 1HV1A 3H3ZA 3LFIA 1GZCA 1G9AA 1U5IA 3MW2A 4DXRA 4P5HA 4GXLA 2YC0A 4LIUA 1RHI3 4RL7A 3SH4A 3ZYGA 1WCUA 3N35A 3SMHA 5IHRA 1YLLA 2Q1MA 4IE6A 1FOD2 2JDHA 3C7HA 3EHKA 2F6BA 2X10A 1H8TC 3L2HA 1UPSA 3LDRA 3K48A 2YFZA 2E7TA 4XVHA 3D0JA 3MIEA 2XGXA 2QNKA 2RS52 1MZ5A 2N7GA 3LA3A 4XZUG 3RGBA 3TNQA 4CDXB 1J59A 4MXVA 3UKTA 2W91A 3J8F2 4D94A 4Q8KA 1DGRA 1Z78A 1RUC3 2VW1A 4YZ4A 3PUQA 2ZZQA 4AAPA 2CHHA 3VL8A 1WBLA 4ZU5A 1RUJ3 4BLJA 2RM23 4CVUA 4MGZE 1AR83 1RYYA 4RHV2 3I54A 5M0TA 5CG9A 2D3PA 2OXBA 2ZGPA 4K1ZA 5HCBA 5LK5A 1RXFA 3AKPA 4ES9A 3V64A 4FTSA 4EWDA 1SFYA 2EF6A 4LXLA 2DFBA 3E5XA 2OUJA 1LHOA 3MW3A 3NMBA 4QT6A 3ZIXA 4YVSC 4OHWA 2DVFA 5E16A 2UWAA 3B00A 1CN1A 1BKZA 2HBUA 1Q5OA 3ZX7A 4TLGA 1OC1A 1JI6A 1JU3A 3N9NA 3FUQA 4IGPA 2JENA 1OLRA 3ETPA 3FL7A 4LOTA 2I45A 1JOJA 4OHZA 5BNNB 1N3OA 2CGNA 3LEKA 1JYWA 4KNCA 3MBWA 3AL6A 1XQNA 2CNAA 4AOCA 4Q27A 1DZRA 4QQHA 4XJ8A 2IXLA 2QVSB 1ULCA 3K3OA 4DY3A 1V6KA 1EPWA 1R091 2AEZA 4P9JA 3WUCA 3H9AA 3I3QA 2BPA2 1NY71 2PHRA 4YVWC 1BEV2 4RS5C 1FV3A 1LRHA 1OBNA 4I0BA 4C0BA 3DUIA 1WCQA 3VZNA 4JVAA 1UW8A 2XWJB 3RZJA 2PAEA 2C0ZA 5DG2A 3TRSB 4BQ2A 2IZWA 3K4ZA 3KV6A 4M3CA 2BYVE 2DVGA 2VNOA 2ZA9A 1GANA 1W05A 2QUOA 2ARCA 3JU9A 4LUMA 3WNXA 5J48A 1PO22 4RS5A 3VBHA 2GNBA 1HKDA 4R8HA 2JDZA 5D8AB 3RQ0A 5JXJA 3VZLA 4EE2A 2Y64A 4NIGA 1UXXX 1IKPA 3EMRA 4TYSA 4S2GA 4JC1A 3BYWA 2EIGA 2XUMA 4ORFA 4KWUA 5L7OB 1BJQA 1KDMA 2ZPXA 4M01A 5C9AC 1QJY2 3UV9A 1HW5A 1NCRC 5FYMA 1YFUA 2AACA 5K7PA 1VBC3 1RUI1 2CYFA 1D4M3 2W1SA 3JD71 3KQRA 3WG1A 1YFXA 4QX7A 5C9AA 1G8WA 1LHNA 2HKXA 1RMU1 4GB33 2YROA 3FHIB 1NCRA 3LF7A 2ZXQA 1FATA 5K4LA 5FZBA 2G9FA 1AX2A 4INDA 2IFWA 1AJKA 4N43A 2VZ3A 2GNMA 2WNOA 5L19A 1UF2C 3PURA 4AI0A 1N1TA 3B7MA 4QHOA 1AL22 4COWA 3SITA 5FQ0A 4UAPA 3ZMNA 1SQ4A 5A3LA 5IK4A 4ZPIA 1R1A1 3K2OA 1TMF3 4Y22B 1YO8A 1Q8OA 1R082 3APBA 4GQ7A 3LIGA 5FBZA 5DN2A 2QQWA 4H7LA 1ND2C 2OT7A 5FZ8A 1ULPA 1O5UA 4OI2A 3I2FA 3EBRA 1NA1B 3S5QA 4AFCA 4K8FA 2P34A 2A71A 1ZYBA 4GWNA 5BNPC 3CO2A 4LO5B 2HWF2 1ND2A 1O4ZA 1W8TA 5L36A 2ARBA 4CA9A 5FY0A 3Q8BA 4Z1VA 1X8MA 3LOBA 5KWRA 1Y9QA 3MW4A 1JUIA 1ZBA3 5BNPA 2B5HA 3CQOA 2VVDA 3B01A 3KV4A 3V65A 1LNSA 3JCIA 1CAUA 1VRH2 3VBFB 5BPXA 1CPMA 4AFBA 3ACHA 2A70A 5E8AA 3P1IA 2RMU1 3ZOIA 4XUQA 4YW2A 4DUVA 2X09A 2BP6A 2WZR1 2QZ2A 2ILMA 1OH3A 2YU1A 3R6SA 1AXZA 4UOJA 4FO9A 2XOMA 1LEDA 2VR4A 1Z7S3 4JTOA 4QPIC 1U5YA 4Y4RA 4HANA 3WD5A 4EN0A 2W92A 1GWMA 2WSUA 4ZU4A 1QXRA 5F3IA 1LENA 4XXAA 4YZ1A 1ZRCA 3M2MA 5A7WB 4C8DA 2QQPA 5FXXA 2E7QA 5FUIA 2VTXA 2J7MA 5F2WA 1F15A 3WDXA 3POIA 1J1TA 3ENRA 4QHBA 3HWJA 3WG2A 1UO9A 4OYUA 3IDAA 2C5DA 2JB8A 2D6LX 4XW3A 2A73B 4SBVA 5CFCB 5BV6A 1SDDB 3VBRB 3FFZA 1OLQA 2H6CA 4RQPC 3BIEA 3ZFEB 5FPVA 3ALQA 1NZCA 3PIGA 3UKNA 1LHUA 4MG2A 4XFHA 2ZX1A 3KS7A 4ASKA 5EJ3A 3AZZA 3LCPA 4CDUC 1S2KA 2D3SA 5BNOB 2MPFA 1AR73 4E2QA 4RQPA 2XBO1 5IT6A 1UKRA 5F5AA 1GNHA 1R092 2LALA 3ZSKA 4A45A 1UOGA 1S0DA 2YB7A 1MACA 5EZWA 5FY1A 3UETA 5JOYA 3JQWA 1NXD1 5EQUA 3OUIA 2QBXA 2A6XA 4FPOB 3NJYA 3PU8A 5IVBA 2HWC1 2OX0A 2ENRA 5FYZA 2XVLA 3WP3A 4G3YC 2D3RA 4DNYA 5A7OA 1W6MB 1WCSA 4MYEA 2TBVA 1S0GA 4RGGA 5IFPA 4BK4A 5KXEA 1OA4A 4AI3A 3ZYJB 4AEMA 1JZ3A 4OZOA 1M06G 4RFRB 2EIEA 4AI8A 1LKNA 4A44A 4JHZA 3KB5A 2Z69A 1VE0A 3DF0A 1JH5A 3H3LA 4K7JA 1UQXA 3ECQA 4IEOA 1I5ZA 3MFCA 1S0JA 4P08A 1LTEA 1SBFA 3KT4A 4LBJA 3VKMA 1UWWA 3MLKA 4O7XA 4XPVA 4Q0SA 1D2SA 1RUI2 2J42A 3X29B 3JD72 3BVCA 3FBYA 4CDXC 5FO9B 3LEGA 5JCTA 1CJDA 2KM2A 4LE3A 3VKNA 1RMU2 3PUSA 5FPLA 3KV5A 1D4VB 3TYJA 5FTTC 1TE1B 2W87A 4WM7B 5HV0A 1U0AA 4B8EA 3W5NA 5CADA 3AYCA 1QJEA 4M0NA 4CDXA 4FTBA 4BIFA 1NX9A 3WSOA 1WLCA 3WG3A 2DV9A 4CCLA 3VD3A 4NO4A 1W2AX 4EN6B 1W8HA 2X29A 1R1A2 1YQCA 2ZX2A 2VBPA 3V56A 2CAUA 3VDCA 1J83A 1CZVA 3AKSA 4JGZC 3SEEA 4S2DA 3PTRB 3KVBA 2LRPA 3AMHA 1APNA 4HK9A 4H3WA 2JE7A 2RDQA 4D3WA 3CJIB 4P9YA 3V0AB 3KWVA 1KEXA 5FXWA 1L7RA 2DUPA 3ZFFB 5BNNC 2P1BA 3A0KA 3POFA 3AXDA 4W65A 1FMD1 1ENQA 2W1UA 2WAAA 2BFUL 4PF1A 1ENRA 4Q4W1 4ARYA 2IVJA 1IS3A 2D6PA 5FZDA 1W03A 5LA2A 5BNNA 5C7GA 3O1OA 3L9JT 1JYIA 3NJVA 2VUAA 4MHRA 1H1IA 2C6SA 4LO8A 1ND3C 1YFYA 1XRUA 2RMU2 4M4PA 5CFDC 5FLIA 2HEYF 3DL3A 3NNMA 4AQ6A 4AL9A 3DYOA 5CKMA 1IPKA 1GMMA 2WZR2 1UOJA 3WQBA 3VHOA 3LOIA 3NAPC 5EYYA 3BUCA 3KCCA 2MNGA 4Q0VA 5D8AC 2QQOA 2JDMA 4W8JA 2XMLA 2TUNA 1OHFA 1V9U3 3VKOA 2YDEA 3SC7X 3RMXA 3CLPA 4H7MA 4B4RA 5FZLA 2R1BA 4AVCA 1UOFA 5D8AA 2VVEA 5IAVA 3RFRA 1NCQB 2VBBA 3FBMA 4UF0B 2WFF1 4A4AA 1HN0A 1A8DA 4XDPA 4LO4B 3O1MA 1QNYA 5ANQA 4YW5A 1MZFA 2UU8A 4MLOA 4NHKA 4AWDA 1K5MA 4UFJA 5IVJA 5L7OA 1NOVA 1DGLA 4Q1RA 4C91A 2I74A 4AHYA 4CXYA 4AVAA 3EQEA 4KL1A 2YBSA 4LBNA 5A6YA 1LHVA 4FSJA 2FDJA 3RZZA 5FWJA 2WYFA 2JKBA 4LEJA 4BLIA 3TEZA 3SXWA 1OF4A 3THCA 4Y1XA 2WN3A 3B5LB 2BGCA 4YW1A 2JX9A 3H3UA 4ITCA 3T1LA 1XYNA 3LFMA 4A41A 3IPVB 2IXIA 4CRQA 2NZ9A 4RD7A 2XBO2 2R073 4WZFA 2KXLA 3BU7A 3UK9A 5EJ1B 4D0QA 1IG3A 1XNTA 3O1PA 3RS6A 3M1HA 3O1SA 5HBAA 2ZGOA 4YRDA 3VBOB 2JB4A 3I3BA 2V5DA 4Y22A 1LAJA 1LOFC 4WZCA 5JIUA 1LU2A 1QJZA 1YI7A 3RJRA 3H8OA 4Q0QA 1CAXB 2BBAA 2RDNA 3OY8B 4Y1UA 3VHPA 2ZHLA 4G9SB 3LPFA 3SQOA 1FOD3 4CCOA 1NA1A 4D6SA 3BU0A 4Q4X3 4WVZA 4ZHNA 5AFBA 1W6QB 1NQJA 2D43A 2PLV1 3K77A 1HRI1 2B46X 4W6XA 2W95A 2ZKLA 2JG8B 5EP9A 3GM8A 1H4HA 2WLPA 1Q8VA 1HB3A 2RS53 5IVYA 3DYPA 1W0PA 1GU3A 3WDVA 4DRRA 1STMA 2IC1A 4JRLA 3J8F3 1OURA 4IESA 4A3ZA 5APAA 1LHWA 5JPMB 3TWIA 4BQ3A 2DDUA 3VBFA 4YGBA 4META 4MUVA 1PNFA 1W06A 4JGYB 3CF6E 1S2EA 2WZEA 5LEKA 3ILFA 1MS8A 1W9TA 3RJ2X 1DLCA 2DCJA 1DZQA 1FXZA 2XJQA 4LBQD 3T0DA 1WMFA 2P4EA 5FUNA 5GKAC 2D6KA 1JW6A 1WCKA 1WW6A 1RUNA 5G04L 2IVIB 3KGLA 2D6NA 4UW5A 2PHDA 4RGAA 1QMJA 3ZMOA 1RGSA 5LK7B 2B39A 4FPKA 5C6CA 3GALA 1GOGA 2P3JA 3GDBA 1H9WA 3M8LA 5CZKA 3HQRA 4LITA 2DU1A 1C5HA 4QXCA 1O4TA 4ASMB 3TAYA 5A3PA 1I3HA 2Y0OA 5K0UB 1ALYA 5FXVA 1D7PM 5A7WA 4MGTA 1XSQA 3JZVA 5CFCC 4FT8A 3MYXA 4J25A 2A7AA 5JXIA 3ZFEC 1BMV1 4LHLA 5LA0A 2Y6FA 2Y6KA 1S0EA 3WW1A 1DLLA 2WKKA 4QM8A 4R9DA 4XEZA 5CFCA 1FMD2 2VUJA 5LRRA 1RUG1 1AL0G 4Q4W2 4RR3C 4BH9A 5BNOC 3VBRA 3CMGA 2VQTA 3QOPA 4KG0A 3ZFEA 4B4QA 1O8SA 3ZR6A 1WWYA 2F4LA 3U14A 1TNRA 1J58A 3AZYA 3NV2A 3HMYA 3JB8A 1GP6A 1PO23 2FMYA 1GOHA 1OKOA 4GJYA 4C90A 1CJPA 5BNOA 4MH0E 2LM3A 2E53A 2C9KA 2RJ2A 1W3XA 3N36A 4IEXA 3VBUB 4K20A 1GP4A 5FMOS 2OZ6A 1UIJA 4LKFA 4XUNA 2HYKA 3R4DB 3WHUA 3N7KA 3I2HA 4ES8A 1WLDA 4SLIA 1N3PA 1QJY3 3AP6A 4CU7A 1C5IA 1OVSA 1ZRRA 3ZDSA 3D3AA 4XMAA 3WHTA 1PZ9A 1OA2A 4XOGA 3U1XA 1ZZ9A 1ONAA 1W6MA 3G6JB 4XFFA 2NM1A 1G7YA 5CEHA 3PHMA 1GFF2 4P9IA 3PL0A 1WMDA 5C71A 4FI9A 1PIV3 4Q4V1 1AL23 2DBNA 2A1XA 4GH4C 3VBHB 2YBKA 4KU7A 4AVBA 1VBB1 4YW3A 2XJPA 4IGQA 2XL9A 3FLTA 3N7MA 4BCUA 2I07B 3CJXA 1LOEA 4AAXA 5F3GA 2PFWA 1R083 5FZHA 3FC0A 1GNZA 2FDKA 5A3NA 1WD4A 5A3TA 2BJSA 1E5IA 2WO1A 4S2HA 3IDCB 1QF3A 4WM7A 5A3WA 3GZAA 1RUD1 2QFEA 3TN91 3ON7A 5H9SA 2VUDA 3MO4A 3R0RA 1NYWA 4ISQA 2LTNA 5FK8A 2HWF3 1FAYA 2HLEA 2VZUA 1VB4A 2R043 1PMIA 3FZ3A 5DUUA 1MS0A 1CZTA 1V6OA 2WN2A 1SHWB 5FPAA 5A32B 3CJIC 3QLQA 4PF5A 3E6CC 4XHXA 4K21A 4UI9L 2WFPA 1MEC1 4CUAA 1UKGA 4DIQA 5J09A 2J1TA 3OSDA 3VD5A 2EA7A 4CP9A 2PLV2 3CJIA 3V0AA 3OBAA 3VD4A 3ZFFA 2ZGKA 4HOOA 3LDBA 3VLBB 3BB6A 1CQ9A 4NHXA 3OBRA 4KQ7A 4Q4Y1 4L92A 3DECA 1YNAA 4IUGA 4F8AA 4NIIA 3MZHA 1OUSA 2VGDA 4AI2A 3D0SA 5FZ9A 3OD4A 2FCUA 5CYYA 3OOXA 4PHZA 5FZAA 3AP7A 4E4HA 5KHHA 4YZ5A 2BWAA 1WD3A 2VZQA 2B4KA 1MPXA 2XB6C 4LBLA 4A7YA 1OT5A 3OUHA 4FPHA 1S1AA 1W9SA 4HL0A 1XYPA 4HZFA 1QQP1 4IEWA 4ZXKA 2XLFA 5DZFA 4CDQB 1UXZA 5J96B 4GMP1 1N1VA 3VB9A 5IATA 2ZHNA 2EXJA 4RYDA 1VMJA 3NKTA 5FZ4A 4BWOA 2KD7A 1K5JA 3P6BA 5FOJB 1UYZA 1W90A 2RDSA 3B02A 5CVRA 1NCQA 4UF0A 5JXGA 4AQTA 5AVAA 3PVBB 5GZEA 2ZABA 2VXJA 1V6LA 4XF9A 3VDDB 4OVEA 1ZZ8A 2A3WA 5E1RA 4NOTA 4P02B 1CGPA 2F4PA 5JVVA 3IT8A 1KS5A 3I2IA 1JZ8A 3A21A 1BMV2 1R093 2E9QA 4NR1A 4QB1A 2DCTA 1OI6A 1E5SA 4N9HA 4CUGA 1BBT1 1VMHA 3DV8A 5FREA 4PLOA 3N3HA 5JPNB 4JDNA 4MXWB 2BGPA 4GD4A 4TTGA 1DHKB 3BOPA 1W8FA 5FZKA 2UURA 4CEWB 1ZA7A 1ZA4A 1HXS1 2Y26A 1QXJA 1W9YA 2DTYA 3U78A 3A0NA 4FCAA 1X50A 2JDAA 2Z4FA 3IPVA 3NNLA 3ZR5A 2W39A 2Y38A 4A6SA 4DZGA 3CEWA 5KHKA 1V9U2 3O1TA 1YUDA 2PTMA 3AP9A 5HV4A 2AEYA 1DCSA 5F8PA 4NRMA 4J1XA 3UNPA 4QQLA 4A7ZA 4E27A 4IE4A 3VKFC 3VBOA 1AF9A 1VBA1 1GNYA 3MV11 2A6ZA 4YZ2A 1FT9A 2VZSA 4X6RB 1URXA 2D44A 4E9KA 2JG8C 3C7EA 3GBWA 3BCWA 4WV8A 4YLZA 1CAXA 1LESA 3OY8A 3ZYPA 5C33A 1RUI3 5JSRA 2G4IA 3JD73 4JDOA 4WM8A 3PNAA 2Y8KA 2A6WA 1W6QA 1RMU3 4JCKA 2J1AA 3VBSB 4RSUA 5B2GB 4BQ4A 2JG8A 4COVA 1UY3A 3BOWA 2FDHA 2XH6A 3ACGA 2QQKA 4JGYC 4Q4V2 2XKPA 1D2QA 1EY2A 3C2UA 1S0CA 4Y5SA 2QZ3A 4QPGB 2ZMLA 1UZ0A 1VAKA 1VBB2 1X7NA 2WT2A 1R1A3 1ULEA 4FQZA 4XDOA 3RNSA 2V5YA 4HMZA 4FPGA 1JYCA 1W0OA 2A6YA 1OF3A 4FXKB 4JGYA 1ZBE1 2YMZA 3USUB 2PN5A 4OI0A 3VD7A 1W6PB 3A23A 1RVF1 4UYBA 3T3YA 5EWSA 4BHPA 3R4UA 4RN5A 4YZ3A 5F37A 1VBE1 3WCSA 3ZLIA 5T5OA 5EIYB 3IB3A 4PQQA 5HPOA 4XFAA 2W68A 4PLNA 5DUWA 1IG0A 3B94A 4HKLA 2D6OX 3LE0A 4Q4X2 5K0UC 3DKQA 4Q26A 2ETEA 4XFGA 1HJFA 4XC9A 5GALA 4NMIA 1GR3A 4Z92B 2CTVA 1MEC2 1PX4A 2WQZC 1UY1A 3E5QA 5K0UA 1Q8SA 2VO5A 4AVSA 4HVOA 4UW6A 4ET7A 2EAAA 3AMMA 2RMU3 2D40A 4EROA 4BU2A 3WF4A 5FXZA 5FRAA 4YM3A 5F5IA 3O1VA 3WLUA 2WZR3 4R9BA 5DDJ1 4KGGA 4LO6B 1J3RA 3M4FA 4L97A 5LCWL 4Q4Y2 3AXEA 4HN1A 2R16A 2HBTA 2J1SA 2CGPA 5LA1A 2MEV1 3JQXA 5FYBA 3VBUC 2Z5WA 4XFCA 3BALA 2D98A 2DFCA 2VW2A 1QJU1 2J22A 2UWCA 2ZX4A 1KJRA 3LSEA 1XYOA 4B3NA 4K8RB 3JUUA 3RZGA 3VBUA 3OG2A 2O1QA 3MEPA 3WZ1A 1QQP2 2XVGA 1PM7A 5CU1A 4NWWA 4L8QA 2NP0A 3GJAA 1XNCA 4GA9A 2D5FA 3AJYA 2BVVA 1RUF1 3IKWA 1NE4A 2DBIA 2P3IA 3HOBA 4XZPA 5C8CA 2WL1A 1CAWB 3VBHC 4XE9A 3AYDA 3E1F1 1RC6A 1MQTB 3N9PA 5ANNA 4CEYA 1K45A 2ET7A 1PHMA 2V73A 4Z07A 5FZGA 1YJKA 3I97A 2XBO3 1CESA 5LEJA 1S55A 3U4SA 3MIBA 3N7JA 4JRAA 3D5OA 4FQ4A 1XNKA 4CTEA 1ODNA 5GZFA 4LKSA 3I2OA 1SFNA 2HWC3 4NPRA 4E4ZA 1DDLA 4IW3A 4OCTA 2YC4A 4AR2A 3KCYA 3KQ4B 1HXS2 1K5MB 3A7QA 3QH7A 2TEPA 4HLTA 4MVTA 4AF9A 1XE8A 2PAKA 5FR3A 1V6NA 3WY6A 1TVGA 4FOWA 2WO7A 2GH8A 4CU6A 1LU1A 2HWD1 3IN9A 4N43C 4R9AA 4XIOA 5ABJB 4PIYA 3DYMA 4PBOA 5JLVA 3K4AA 4MX3A 1KDKA 1V6MA 2BW8A 4KBBA 3UL2A 2XXZA 5A32A 2DCKA 2WUHA 3RRDA 3MIFA 1KFUL 5A6XA 3VV1A 1LCLA 2JIJA 4V2WA 2HWB1 4XUOA 4LT5A 1PIV2 4Y24A 3LA7A 2K0GA 3NQHA 2VZTA 1JXNA 1GQGA 3I2KA 4DXTA 4Y1VA 2ZACA 4LBQB 3G7DA 1O3QA 2Q5TA 4N7IA 1PNGA 1D0HA 4QD2A 5KC6A 1ZRDA 4EWEA 3M3QA 4QKDA 4QX1A 4BDVB 4P9LA 3I59B 4XFBA 4R4ZA 2E6VA 1GWLA 4JQTA 4NPMA 1A34A 1LEMA 3I8TA 3HBKA 1WUVA 3N9MA 4HETA 2Q8DA 2R0HA 2EIBA 4XMIA 2WO2A 3POGA 3INAA 4XUTA 3MDPA 1UX7A 2YPJA 4HSJA 5DQ0A 3BTYA 3AL5A 2R042 5JI7A 2C9AA 4AVTA 5FUPA 4Y20B 3OBZA 2R6QA 4MGQA 3WNLA 1RVF2 4CP0A 5DUXA 4YWAA 5IFTA 2BZDA 5FYSA 4AHXA 4UT5A 1W99A 4O65A 2BRTA 1Q8PA 1RINA 3C3VA 4YARA 3RMYA 4CDQA 3MIHA 2EIDA 4GALA 2O14A 2IXCA 3KMHA 1FMD3 1JYXA 2VM9A 4N53B 4YG3A 2NPIA 4Q4W3 3VDDC 1SLIA 1QIQA 4ZZ5A 1UZZA 2Q8EA 1OD5A 2WNEA 2W2IA 1US2A 3ASIA 5HXMA 1IS5A 1AYM3 2XUEA 4YFZA 5LY2A 3KV9A 4YGEA 1S0BA 2G1MA 5FZ7A 1MVEA 5A1FA 3HQXA 5FZ3A 3VDDA 1OLMA 4PJYA 4LORA 1IOAA 4X8NA 2JE8A 2VMIA 4R4XA 5DDJ2 4CEWC 2XPJA 3F2ZA 3QBQA 1DBNA 2WSVA 3E5UA 1GICA 4YGDA 2D7FA 1T6BX 2VC9A 5JIAA 3PMEA 4MXWA 5FKBA 2XJUA 5DXDA 3GGLA 2NQYA 2LS6A 4PCRA 2MEV2 4CEWA 3GHMA 4B1LA 4XHBA 4URAA 5IK7A 1BLZA 2VMEA 2DCYA 4QDQA 3SCHA 3IDEA 1QJU2 5L73A 4LA2A 3T2TA 4JKKA 2W9XA 3M70A 3MI8A 2WFF3 4ONUA 2CDOA 1OVPA 3KVAA 1KGYA 3IDBB 5KHGA 3N9LA 5J3UA 1H2KA 5I0TA 2BERA 2BWCA 2PHTA 1UMHA 2GSYA 3DGTA 5GLTA 5T5LA 2RS11 2ZEYA 1QXPA 3R4SA 3WP4A 4FPFA 1CX4A 4YM0A 1NT0A 4B29A 4K40A 3UJOA 3KSCA 2V72A 1RUF2 2A3XA 5I0SA 1NY72 1OH4A 3P5BA 1TQ5A 4XTPA 4QPGC 5FZ1A 3VBSA 1YRZA 1LGCA 1WW7A 4FFGA 4LUKA 4WVWA 3WW2A 2CU5A 4N8MA 2XJRA 3C8XA 4GMP0 3KZ4C 4Q29A 4F7ZA 3MFAA 1WA4A 3ABZA 3WINE 3CZJA 1O59A 3THPA 2VOVA 4QPGA 1XU2A 3K46A 2RHPA 1ST8A 4YPJA 2JDNA 3J26N 3R05A 5B4NA 1H4GA 2XL7A 2XWBB 4RGKA 5CISA 1I1EA 3AP5A 3Q8FA 2XVKA 2WLQA 3F95A 3CU7A 3N9QA 3RZHA 3D6EA 2WT0A 3USUA 1ASJ1 1POV1 3TEXA 1I6XA 1HX6A 1W6PA 2CWMA 5FP3A 2XJTA 4ZU7A 2PLV3 2ZEWA 3WV6A 1HRI3 2AR6A 1HB1A 2HWD2 5C3SA 3UGFA 3RPQA 2QQVA 2W94A 3PDQA 1S0FA 4NPLA 4A3XA 2FZ1A 2XHKA 1UOBA 3J7LA 1XE0A 4FOYA 4PQ9A 2FDGA 2OPKA 2TNFA 2WINB 2X53S 2XDVA 5DUVA 2XR4A 4I0WB 2HWB2 2WR9A 5JMCA 5I0UA 3ZXJA 2E51A 5IVFA 1F2NA 4LBMA 1EAH1 2EXIA 2JECA 1G9DA 5FP8A 5FK7A 1VMFA 1GV9A 1DF0A 3MPBA 5CIRA 1EV11 4Y1ZA 4OULA 1OOPB 1SLTA 3PUHA 4CCCA 5A6QA 2UYAA 2VOWA 3LA2A 4LLOA 2DVBA 3WF2A 3LB9A 4CP9B 2BVBA 3P3PA 4FFIA 2BTVC 4LK6A 3ST7A 3THDA 1QGLA 2Z79A 2ZX0A 4IETA 5FZOB 3ZSJA 3U37A 5K9YA 4MOAA 1W2UA 4M00A 5A7QA 5LY1A 2F17A 3T0BA 1AR61 2OW4A 2WIIB 5FAXA 5FY4A 3PUIA 1P8JA 5FY7A 1S2BA 4Y3OA 1AYM1 2DVAA 2GN3A 3ZXKA 1CR7A 3O1RA 1IKQA 4FP3A 3QD6A 3AB0A 1RUG3 1ZNPA 4K9SA 2AH2A 2QQNA 1SLCA 4CCEA 3GHNA 1CAWA 1W9WA 1WW5A 2WABA 1MQTA 3VZMA 4E2GA 4I30A 1W2TA 1FNYA 5BY5A 5KC5A 1K5MC 3NWKA 5L7OC 1YFWA 4Q8LA 3OUJA 2VMFA 5EV7A 2YPDA 1NQDA 3MIDA 4FOQA 4OUSA 2NLRA 1QEXA 1HQLA 4IEQA 4BZ4A 4AI9A 5D2AA 3WT3A 1KD7A 4N7UA 1L3JA 2C24A 3UKVA 2E7AA 3OGGA 5DZGA 3LKJA 3GBGA 1CVNA 2VECA 2VY0A 4MSVA 2VMDA 5ABJA 3H8XA 1X9TA 4O61A 4QMAA 2Y34A 4QQPA 1DYOA 1BVVA 3H0OA 4Q4V3 5GLWA 1BVP1 5FPZA 1V0AA 2DUQA 4QQOA 1VBB3 2ZKNA 5I8TA 4OHVA 2RG4A 3U0ZA 2VZPA 2CAVA 4R9CA 1DYKA 2V09A 2X05A 3CDZB 3O0VA 1BK0A 4FPLA 2FZ2A 3HT1A 1NA1C 4I3GA 4LBQA 4XAAA 5JAXA 1YQ5A 2GC0A 2HWC2 2WNVB 4P00B 5J36A 5A7NA 1RUD3 4D69A 3TN93 4IV3B 2R7EB 3NV1A 3I59A 4QKNA 2RJKA 3I3EA 1TG7A 3AK0A 4AGVA 4WM8B 2W46A 3S6PA 1HDKA 4YYOA 2W08A 2VBDA 2WWJA 4DEQA 1Y43B 2DUOA 4IEPA 5A6ZA 5KBFA 2BOJA 3E6BA 4Y1YA 3AJZA 1VBD1 4CCMA 4Z2AA 1YQ6A 2EICA 1BHGA 3AYAA 3VBFC 3VHRA 1ASJ2 1MEC3 4Y20A 5I91A 4AEJA 4GAZA 1AYN1 3NL1A 1XOYA 2ZCWA 2DF7A 4N53C 2HWE1 4K6BA 5CNAA 1NE6A 4F3JA 1BYHA 3SKJE 2WBKA 5T3NA 1VLNA 4HXCA 5FDBA 4Q4Y3 2ZEZA 1I9RA 3QH6A 3NKGA 4N53A 4QXBA 5E89A 4DXSA 2ZGSA 4ZXEA 1S0IA 4LPLA 1K12A 5I93A 1VIWB 1WBFA 4LJHA 1EAH2 1DQ2A 5T50A 4ZZ8A 4TSVA 5J1XA 5CG8A 5I0DA 2BEOA 1UNBA 5JDBA 3IIAA 1W3VA 3BN6A 1QKQA 1W39A 2VG9A 4XILA 3URFA 1OPMA 1YQ8A 4LHNA 2KA3A 4HSLA 1ZZBA 4UFMA 1EV12 4XACA 3Q9OA 3AX4A 1H8VA 2OPWA 4IE5A 4QDSA 1AX0A 1QQP3 1AXYA 2DURA 4CCKA 3OCPA 2P3YA 3FUOA 1F8VA 3ORJA 4GMP3 3I2DA 4MADA 2R32A 3ELNA 3IMMA 3VBRC 3ZO0B 1PMHX 4CP1A 1F4AA 4EV0A 1JODA 1HB4A 1L7QA 4EJRA 1CZSA 3KCXA 4CCDA 3MF6A 4P9GA 1KJLA 1RJ8A 2VAUA 4LTAA 5C3OA 2DWRA 1H1MA 3MV01 1AR62 5G05L 1ULDA 2FBEA 1G6NA 4OQ8A 2ZX3A 1IHMA 2CDPA 4NAMA 4ARXA 1AYM2 3S0MA 1JZ2A 3WDWA 3W59A 3ZYIB 2ZS6B 1BBT3 1K42A 4P9WA 2MHFA 2BQPA 4AHWA 1OD3A 3IBMA 4O9GA 4AGGA 3ZDVA 4QU1A 2EAKA 2PHFA 1GKBA 1J3PA 3U75A 5CAZA 1GQHA 1XPWA 1HXS3 2PQQA 4Q1PA 4DUWA 3JB4C 3FLPA 3MIGA 4HK8A 4C1XA 1YHFA 4K3UA 3GF6A 4FVVA 4UWDA 2BU9A 1SPPB 3EYPA 5A7SA 1IZ3A 5IK5A 4Z82A 2VXRA 1JU4A 5DAXA 1NKGA 5DG1A 4L99A 2W0XA 5A7PA 2OIIA 2ORZA 4NIAA 5C8CB 2E33A 1VBA3 1VRBA 3OEBA 2WFF2 3HJRA 4QB6A 5BNQA 4CEYB 2VCAA 4L2NA 4YVSB 2GC1A 2BGOA 4ZKTB 2VNRA 1LOBA 3H1YA 4IE0A 4A42A 5SV5A 2R30A 5CA6A 4IV1B 2BBVA 2XLAA 4WM7C 1LOGA 1CIYA 3CIHA 2DTWA 3SEPA 3H7JA 4KBZA 1XNDA 2VCMA 4PT6A 1ZREA 1HJGA 2C26A 3NW4A 4PIXA 4W4ZA 3BTZA 3SLIA 5EXOA 1XU1A 4CCNA 4NROA 2Q8OA 1SG3A 2GNTA 1QHDA 1JYNA 2J1EA 3AFKA 1OOPC 3O5SA 1ZBE3 1NUKA 1UY2A 1BCXA 1EUTA 2JDPA 4YVWB 5FZCA 1PVC1 1A78A 2K2SA 2P6CA 3AC0A 1BXHA 2PA7A 1RVF3 5A33B 2W3JA 2ZTNA 1XE7A 2B8MA 3AMNA 1VBE3 1MR5A 5A3MA 1AJOA 1WLWA 1OOPA 3LDKA 3ZFFC 2QJVA 4M3CF 4BQ1A 1PGSA 2WRAA 4HKWA 2E31A 5LBBA 5BYNA 3GZEA 1C8M1 1C1FA 4GIQA 4IQPA 5B4XA 4XAEA 1HRI2 2DU0A 2JDKA 3WDYA 5T55A 3PJYA 3POYA 5AFEA 1A3KA 2CWSA 4HPKB 2UY9A 4XDQA 5FZOA 1UZVA 1W8WA 3LSDA 4AK3A 1ZRFA 2E63A 1W8UA 3IAPA 2R063 5AC91 3BGAA 2XJSA 5FYYA 1IQDC 2P2KA 3QACA 3AFGA 1JZ4A 1WZXA 2HWE2 5DABA 1TNFA 2Q1FA 3WVJA 1Q8QA 5DDJ3 1NZIA 3PVEA 2WQ8A 4JAAA 4BE3A 1XJAA 5EFUA 1JYVA 3GJBA 2IWGB 2WS91 3L2YA 1POV0 4Q0UA 4U2AA 3FHAA 4V1PA 5F39A 2YUEA 4A7KA 3T2PA 4NIHA 4XQWA 2MEV3 2OUHA 1IPSA 4RHV1 5FKCA 1OXCA 1F9KA 3B9CA 1YJLA 3H50A 3WP5A 1QJU3 1NCQC 5HI0A 1IGOA 4DO0A 2ZGUA 4URTA 4BQWA 4K1YA 4JKMA 1REDA 2YV8A 1AR91 5J37A 3NV4A 1D0GA 2BNMA 4BQ5A 3CZUA 3HQUA 3V0BB 1U5XA 5F1RA 3IMNA 2OKXA 1BQPA 2ZGLA 2Z2SB 4KWJA 4Y5TA 3AVRA 1RUH1 1UYYA 3DKWA 4I0AA 2H6BA 4YW4A 1RUF3 1HQNA 1EPZA 1RUG2 3LGRA 4QWNA 1RTVA 4XQ4A 3VDBA 1UMIA 2IUWA 1F31A 4QPYA 5T5PA 3H8RA 1C57A 3M3OA 4TN7A 1WMXA 1YIPA 1SEFA 3JXSA 4HT1T 1HRV3 2O8OA 1F5FA 2YU2A 4XETA 3VBOC 4Y33A 1BEV1 5E6HA 5GZDA 3NV3A 5A3UA 2WYSA 5FMDA 4ATEA 1C4RA 1DG6A 3ZSMA 2VMCA 4XJWA 1LB2A 1UU5A 3VGIA 1FI2A 4Y26A 4IV3C 2VZRA 2VCBA 3W9AA 3ME2A 2SBAA 4XBNA 3OGRA 3DN7A 4WM8C 5C5UA 5JI9A 3KM5A 1Q3EA 3PVOA 2WNVA 4JV4A 1W8ZA 2NMNA 4QPIB 1H2NA 2ZGQA
chains in the Genus database with same CATH topology
2HWD3 5J98B 1OA3A 4XJAA 1SBEA 3VHNA 3RYKA 1AUYA 3VZOA 1MS4A 1Q43A 2JXAA 2B42B 2I2SA 1COV1 4XYXA 3ZSLA 3J4UH 1QH7A 1PO11 2EVXA 2HWB3 3AP4A 3JBG1 3SCGA 5CBLA 1HIXA 1PK6B 3KT7A 2Q4SA 1KXGA 4DB5A 2AYHA 4FOVA 1A8MA 5F9TA 3VKLA 2JG9B 4KGQA 1UL9A 2PHXA 3U11A 4J1WA 3ES4A 4JTNA 2JICA 5GLZA 1UPIA 4CDUB 1H2MA 1RUD2 1JN2P 4I09A 3TN92 5JOXA 3POWA 4XJZA 2Q30A 4LR4A 1RUE1 1QDCA 1PVC2 5ACA1 3IWZA 2G9GA 1X8EA 2GNDA 1MS5A 1AX1A 2O0OA 3M3EA 4FAGA 2EALA 5F5QA 2WNUB 2ZHMA 5FMOL 2H0BA 2R061 3GYDA 3WDTA 4MV2A 4BOWA 1QOTA 1QOOA 1NXMA 1VRH1 1IPJA 5D1IA 5AC92 4EWAA 3ZXAC 1GYKA 4QM9A 1CPNA 2VOXA 1TME1 3S7IA 4EN9B 3B9IA 2PAMA 2BUKA 4Q2FA 1H8TA 4CP2A 1UX6A 1H9PA 1PGW1 2BNOA 2DYCA 1AXKA 2WS92 2ZAAA 4FBFA 4Z8BA 1SLBA 4IEUA 5H9PA 2RS31 4B4PA 2JJ6A 3CNAA 3WG4A 3FX3A 1H0BA 4CZSA 2FQPA 5C8CC 3EO6A 1R1ZA 1JBCA 4CEYC 3KD4A 2WZPP 3ZIWA 4BYYA 1AR92 4JGZB 4AI1A 3T1MA 1SMVA 4TZDA 3J9SA 4ISRA 4PLMA 2RR11 1KITA 2ZGRA 1VP6A 4IV1C 4DY5A 3ES1A 1UU6A 3N4MA 2RS13 4QGMA 5KXCA 3H8UA 4YVSA 1JUHA 1Z0HA 2CL2A 1HRV1 1RUH2 1ZM1A 4AQ2A 1XNBA 4BA6A 1BBT2 4IV1A 5KXDA 1GZWB 2Y0IA 4XBQA 1OSGA 2ARXA 3ZVXA 4AG4A 4YGCA 1HLCA 2GC3A 4NHLA 2A6VA 2D6MA 1WLTA 3WQ0A 5T52A 1ND3B 4FPYA 1QWRA 1QJX1 5CFDB 1H2LA 1V6JA 2ZBJA 5HXVA 5JSOA 4P9XA 4YM1A 3ZN4A 4FTEA 3O0XA 1N3QA 3NAPB 1ASJ3 1VBA2 4YVWA 1POV3 3AZWA 5A33A 2BFUS 2O8QA 1PZ8A 4LO7A 2IXKA 1Y3TA 2QDRA 2YHJA 4YG6A 5H9QA 4W6YA 1IS4A 3DPRB 1FPN1 5JZGB 2HEWF 3EJKA 2HJIA 2XKOA 4LBKA 3HN1A 1COV2 4FPJA 4GULA 4HPKA 4J6GA 2D97A 3U10A 1DFQA 1PO12 4IL7A 1OQEA 3JBG2 4NN0A 3A4UA 5GM0A 2HEVF 5JWPA 1EAH3 4S2FA 5FPXA 3ILRA 3ZFGB 4AEDB 3RYPA 1ZBE2 5I0RA 5GZCA 1EV13 4CDQC 1NLSA 4KG8A 2YY1A 4OHYA 1VBE2 1OQ1A 1LODA 4IV3A 2FMDA 4RA0A 5TSWA 3V56A 1AVBA 4LT5A 2QE3A 4FP2A 4QQ2A 1RUE2 2UYBA 1SCRA 3AKTA 4PIZA 2R0FA 3E97A 5ACA2 2ZMKA 1AR63 1RHI1 3O7OA 4XF4A 3ZN5A 3TNPB 2AUYA 1PZ7A 3FMGA 1HQWA 1H1AA 2OZJA 2EXHA 2NYYA 4OFGA 2R062 3WP6A 2VOKA 3WQ7A 3V0BA 1DQ1A 5I8YA 5BUVA 3LWCA 2ZMNA 3SHRA 4I2OA 3S7EA 2W52A 1O3RA 1KQRA 3PMSA 3OBTA 1T6GC 1RUC1 1SDWA 1EP0A 3OF1A 1OQDA 1TME2 4LLFA 1RUJ1 2RM21 3MPPG 1AR81 3D4KA 4AGRA 4R52A 4TWTA 1O5LA 2C1FA 2X8KA 2IXHA 1PGW2 3KLSA 3WW3A 2PHWA 1UN1A 4UBGA 2IXJA 2RS32 1ZZCA 4JQRA 1YYNA 1DQ6A 3ROUA 2PHLA 3VBSC 2PELA 4COZA 5JR7B 5FLHA 4QPIA 2ZJCA 2JEMA 1C1LA 1VAVA 4MZUA 4F83A 2RR12 1PK6C 1DZTA 4BIOA 4G4FA 1IS6A 1BK1A 2AREA 1UAIA 4DXZA 4HVRA 3ZXEA 1QDOA 2JG9C 4TLFA 4OI4A 1HRV2 3AZVA 3BTAA 5C4WB 1PK6A 4RR3B 2R49A 2JG9A 2AZ5A 3W58A 1WW4A 4IEYA 3NVCA 1XXNA 2B9UA 3FJSA 4XFIA 4WVMB 4Y4YA 3ZXFA 1RITA 4DRVA 4DMIA 4CDUA 4DINB 1QJX2 3AKQA 1W6OB 3OYWA 1VBD3 4XIKA 1QNWA 3NSTA 4KH9A 1V00A 2WNUC 5CB7A 5FLJA 2D93A 4AXOA 4OHXA 3QCWA 1AYN3 1VALA 4QGNA 4C90A 4UW4A 1VBC1 5FO7B 3ZN6B 1D4M1 4BPZA 1LECA 2HWE3 2WNUA 1DU3D 2A75A 4OUMA 2GH2A 4GB31 1FPN2 4D7SA 2GAUA 1ENXA 4YFWA 4LE4A 1DYPA 4W6WA 4LULA 2NMOA 4MGYE 3SNMA 3KGZA 1DGWA 5KXBA 5IUQA 4DS0A 3OTFA 2YZ4A 4AFMA 4GH4B 1OKQA 4UXAA 1TMF1 2OA2A 4PBPA 4DQAA 1FNZA 1YIFA 1C8NA 3MICA 4H55A 5FCCA 3FE5A 3ETQA 1CAVB 1YCIA 2GMPA 4H14A 5IK8A 2QDNA 2ZHKA 2IFRA 2CV6A 4A2UA 5SV8A 2YYOA 3MLLA 2VULA 1X36A 4I02A 3HIFA 4XJ9A 1ZBA1 1OFNA 2X5IB 3RYRA 1MQTC 3HBZA 1RHI2 2RE9A 1RJ7A 3RSJA 1JTZX 4JGZA 5GJ6A 3FLRA 4UBHA 1UZYA 2ZAHA 1F5JA 3TB0A 1IQAA 4AVVA 1N47A 1PVXA 1KFXL 3ATGA 4I3PA 1QY4A 1B09A 3NJZA 2GDFA 2P37A 2VU9A 1YXWA 3ILNA 1O3TA 4AQSA 1GZWA 1GLHA 1RUC2 1UU4A 1Z7S1 2LUWA 1Q56A 1ULGA 4AW7A 4NWVA 1RUJ2 5ABJC 2RM22 2VQAA 1VAMA 1AR82 4GKYA 4WBBA 4PDWB 4AE2A 1ZZ6A 1TEIA 3OJBA 1ND3A 2VNGA 1X33A 4NHMA 4X6QB 5CFDA 3O14A 2VPVA 1RIRA 4FPCA 1AHSA 2WJSA 3FFQA 4Q0PA 4BM8A 2ZGMA 3DPRC 4CDWB 3NAPA 1SACA 5JZGC 1E57A 3RI9A 4EN7B 2OYZA 2PHUA 2RS12 1W6NB 3PTYA 3AM2A 5GLVA 4O9EA 4OZXA 2A3YA 3DPRA 3SH3A 1REEA 3UJQA 5JZGA 2GZWA 3POSA 3I7DA 1AR71 3ZFGC 4HN0A 4NVPA 3WXPA 4AEDC 4BMEA 3LZZA 1C3HA 2D5HA 3HAGA 1YI9A 4UW3A 1N1SA 2P17A 3ZXGA 4E4SA 1B35B 1PVC3 2ATFA 3ZFGA 2GU9A 5KHIA 4AEDA 1MS1A 3AMQA 4IXLA 5JSPA 2BNNA 1C8M3 1OPOA 5HCAA 4I01A 2RJLA 4ASLA 3O12A 4LBOA 4JDMA 3AZXA 5F6KA 3FWEA 3VZJA 1PGL1 3VZKA 1A6CA 4U36A 4HVQA 1O4YA 1ZX5A 5AC93 3E6DA 2WC2A 4HBNA 1LOFA 5K8SA 2WA3A 2ERFA 3B93A 3GBFA 3GNEA 1VBC2 1D4M2 4IEZA 3WQ1A 4N90A 4GB32 1FX5A 1RL3A 4XF0A 1ZVFA 1LOCA 4IEVA 1O91A 2WS93 4IERA 3AMPA 1KS4A 1VB2A 3LAGA 3SISA 1DQ0A 1X82A 5AVPA 1G9BA 4RHV3 1G86A 1TMF2 1V70A 2NN8A 2ZOEB 1MVQA 3KT1A 1MZEA 1DGWX 1AR93 2XLGA 4FXGB 1U12A 2VQ0A 3D82A 2ES3A 2ZGNA 2A5ZA 1GBGA 1WCDJ 2GN7A 3MGUA 2UWBA 3U4XA 1H8TB 1RUH3 2GMMA 2AGSA 5GLUA 1ZBA2 1OFSA 3VUOA 2GALA 2ZGTA 2YGMA 4L11A 4FPEA 4B7KA 3BODA 4OI1A 4LNVA 5C4WC 2XJVA 5E88A 4Y5Z0 4RFT0 1BEV3 1C28A 2QKDA 3MLJA 2JD4A 3S30A 1WGPA 2WT1A 2VW0A 4M3CE 5GZGA 2AENA 4AFAA 1MS3A 2GMEA 2ZZJA 1Y7BA 4QX5A 4XXPA 2UY8A 5C4WA 2WWSA 4CYDA 3ZPYA 1Z7S2 4RR3A 5JOZA 1V9U1 1ZZ7A 1UCXA 1O7FA 5F6LB 2VH9A 3HT2A 3B3QE 3SCFA 5FO8B 4DPNA 4WVVA 4WVMA 3ZYRA 3HR9A 1W6OA 2QCSB 3ZSEA 1V6IA 4AYUA 1COV3 4COYA 4AHZA 1PO13 4HFSA 3JBG3 1BZWA 1UD1A 3OGJA 4YM2A 1J1LA 3ZN6A 1YWKA 5DZEA 1G9CA 2YGLA 1G9FA 3IM0A 2DCZA 4M3CB 1KRIA 3AKRA 4RS5B 1RB8G 1AR72 1DIWA 2R071 4D7TA 3OD0A 3ZXLA 4E2SA 1SLLA 1NLRA 1CD3G 3WCRA 1ENSA 5LRSA 4GH4A 1RUE3 4HKOA 3WX5A 1JHNA 1LR5A 5ACA3 4ATFA 1RUOA 2VMGA 1MS9A 1VBD2 3PLQA 4KU8A 3VL9A 4AFDA 1WMEA 2R1DA 4N9IA 1FOD1 4XF1A 4XF3A 1CAVA 3RI8A 4Q4X1 3RDIA 3USSA 3VN4A 4YSFA 5C9AB 1AYN2 2X5IC 1NCRB 3RG0A 2RS51 4N43B 2XG3A 1SLAA 1J3QA 2ET1A 3WOGA 3O0WA 1PGL2 1QH6A 1VRH3 1H30A 2PYTA 5FQ0B 5H9RA 4C1WA 4Z2WA 2VMHA 2X5IA 3J8F1 4EN8B 4QU2A 3WDUA 1UMZA 1LULA 1TME3 4P14A 2EXKA 3B69A 1VR3A 1M4WA 4YG0A 4DFSA 2H0VA 4E4DX 4YNIA 5HCFA 3U07A 2OVUA 2WA4A 2CGOA 2GC2A 1ND2B 2RS33 3NO8A 4PDWC 5C8WA 1U5ZA 5JOWA 4L9BA 1LOAA 1ULFA 2Q1ZB 1DQ5A 3N7LA 4X8PA 5BNPB 3ZXDA 5I8SA 4BMBA 3THTA 4D7YA 3P3NA 4PDWA 1CAUB 4FAHA 4DOUA 4CDWC 5T54A 1FYUA 2RR13 1CONA 2Q0AA 4QXKA 2DVDA 4XTMA 1LGNA 4B7EA 5J7MA 5KHJA 1O3SA 3MF9A 4C0HA 4CDWA 3AYEA 3BIWE 3WR0A 1LGBA 3D8CA 2CY6A 1W6NA 2WNVC 1UIKA 5EYXA 3TBDA 4XJUA 2JE9A 4KWKA 3HD8B 1PO21 1DGRN 4MGKE 4LA3A 1B35C 1QJX3 5FOBB 3M3CA 4AEKA 2K9ZA 3WW4A 2FHRA 4GWMA 3CL1A 4LHKA 2WQ4A 1SCSA 1VJ2A 1QJY1 1B35A 3GZUC 4XBLA 3BPZA 3K51A 1HV0A 3PJQA 4QGLA 4XQDA 1SBDA 1FPN3 5BXXA 2P3KA 1GSLA 3PVNA 1LJ7A 3RWNA 2B7YA 3GZTB 1QOSA 3H1MA 4GKXA 4MGIE 4RQPB 1PIV1 1AL21 4M0HA 1EYBA 1FV2A 2YXSA 3H1WA 4OLLA 1GZ9A 3SH5A 3H7YA 3EXUA 1NG0A 2VVFA 1R081 3OYWB 3OPZA 3TOJA 3ACLA 5FFOC 1OMIA 3WUDA 3M7AA 1MZ6A 2SLIA 1CIWA 3M3IA 1N1YA 2R072 1QU0A 5T5JA 2HWF1 1AZDA 1DQ4A 3I4IA 2R041 4COUA 2Z42A 4KWLA 1REFA 2B45X 1C8M2 1HV1A 3H3ZA 1GZCA 1G9AA 1U5IA 3MW2A 4P5HA 4GXLA 2YC0A 1RHI3 4RL7A 3SH4A 3ZYGA 3N35A 3SMHA 1YLLA 2Q1MA 1FOD2 3EHKA 2F6BA 1H8TC 3L2HA 1UPSA 3K48A 2E7TA 3D0JA 3MIEA 2XGXA 2QNKA 2RS52 1MZ5A 2N7GA 3LA3A 3TNQA 4CDXB 1J59A 4MXVA 3UKTA 3J8F2 4D94A 4Q8KA 1DGRA 1Z78A 1RUC3 2VW1A 4YZ4A 2ZZQA 3VL8A 1WBLA 4ZU5A 1RUJ3 4BLJA 2RM23 4MGZE 1AR83 4RHV2 3I54A 5CG9A 2D3PA 2ZGPA 4K1ZA 5HCBA 5LK5A 3AKPA 4ES9A 3V64A 4FTSA 4EWDA 1SFYA 2EF6A 2DFBA 3E5XA 2OUJA 1LHOA 3MW3A 4QT6A 3ZIXA 4YVSC 4OHWA 2DVFA 5E16A 2UWAA 3B00A 1CN1A 1BKZA 3ZX7A 1Q5OA 3FUQA 2JENA 1OLRA 2I45A 1JOJA 4OHZA 5BNNB 1N3OA 2CGNA 4KNCA 1XQNA 2CNAA 4Q27A 1DZRA 4QQHA 4XJ8A 2IXLA 2QVSB 1ULCA 4DY3A 1V6KA 1EPWA 1R091 4P9JA 3WUCA 3H9AA 2BPA2 1NY71 2PHRA 4YVWC 1BEV2 4RS5C 1FV3A 1LRHA 4I0BA 4C0BA 3DUIA 3VZNA 4JVAA 1UW8A 2XWJB 2PAEA 2C0ZA 5DG2A 3TRSB 2IZWA 4M3CA 2BYVE 2DVGA 2VNOA 2ZA9A 1GANA 2QUOA 4LUMA 3WNXA 3JU9A 5J48A 1PO22 4RS5A 3VBHA 2GNBA 1HKDA 4R8HA 2JDZA 5D8AB 3RQ0A 3VZLA 1IKPA 4TYSA 4S2GA 4JC1A 2EIGA 2XUMA 4ORFA 5L7OB 1BJQA 1KDMA 2ZPXA 4M01A 5C9AC 1QJY2 3UV9A 1HW5A 1NCRC 1YFUA 5K7PA 1VBC3 1RUI1 2CYFA 1D4M3 3JD71 3KQRA 3WG1A 1YFXA 5C9AA 1G8WA 1LHNA 2HKXA 1RMU1 4GB33 2YROA 3FHIB 1NCRA 1FATA 2G9FA 1AX2A 4INDA 2IFWA 1AJKA 4N43A 5L19A 2GNMA 1UF2C 4AI0A 1N1TA 3B7MA 4COWA 1AL22 3SITA 5FQ0A 3ZMNA 1SQ4A 5A3LA 5IK4A 1R1A1 1TMF3 4Y22B 1YO8A 1Q8OA 1R082 3APBA 4GQ7A 5FBZA 4H7LA 1ND2C 1O5UA 4OI2A 3EBRA 1NA1B 4AFCA 4K8FA 2P34A 2A71A 1ZYBA 4GWNA 5BNPC 3CO2A 4LO5B 2HWF2 1ND2A 1O4ZA 5L36A 2ARBA 4Z1VA 1X8MA 3LOBA 5KWRA 1Y9QA 3MW4A 1JUIA 1ZBA3 5BNPA 2B5HA 2VVDA 3B01A 3V65A 3JCIA 1CAUA 1VRH2 3VBFB 5BPXA 1CPMA 4AFBA 2A70A 5E8AA 2RMU1 4YW2A 2WZR1 2QZ2A 2ILMA 3R6SA 1AXZA 4FO9A 1LEDA 1Z7S3 4JTOA 4QPIC 1U5YA 4HANA 3WD5A 4EN0A 2WSUA 4ZU4A 1QXRA 1LENA 4XXAA 4YZ1A 1ZRCA 3M2MA 2QQPA 2E7QA 3WDXA 1J1TA 3ENRA 4QHBA 3HWJA 3WG2A 2C5DA 2D6LX 4XW3A 2A73B 4SBVA 5CFCB 5BV6A 3VBRB 3FFZA 1OLQA 2H6CA 4RQPC 3ZFEB 3ALQA 1NZCA 3UKNA 1LHUA 4XFHA 2ZX1A 3KS7A 4CDUC 5EJ3A 3AZZA 3LCPA 1S2KA 2D3SA 5BNOB 2MPFA 1AR73 4E2QA 4RQPA 2XBO1 5IT6A 1UKRA 1GNHA 1R092 2LALA 3ZSKA 1S0DA 1MACA 5EZWA 5JOYA 3JQWA 1NXD1 2A6XA 4FPOB 2HWC1 2ENRA 2XVLA 3WP3A 4G3YC 2D3RA 4DNYA 1W6MB 1WCSA 4MYEA 2TBVA 1S0GA 4RGGA 5KXEA 1OA4A 4AI3A 3ZYJB 4AEMA 1M06G 4AI8A 1LKNA 3KB5A 2Z69A 3DF0A 1JH5A 4K7JA 3ECQA 4IEOA 1I5ZA 3MFCA 1S0JA 1LTEA 1SBFA 3KT4A 4LBJA 3VKMA 3MLKA 4XPVA 4Q0SA 1D2SA 1RUI2 3X29B 3JD72 3FBYA 4CDXC 5FO9B 5JCTA 1CJDA 2KM2A 4LE3A 3VKNA 1RMU2 1D4VB 3TYJA 5FTTC 1TE1B 4WM7B 1U0AA 4B8EA 5CADA 3AYCA 4M0NA 4CDXA 4FTBA 4BIFA 1WLCA 3WG3A 2DV9A 4NO4A 4EN6B 2X29A 1R1A2 2ZX2A 2CAUA 3AKSA 4JGZC 4S2DA 3AMHA 1APNA 4HK9A 4H3WA 2JE7A 4D3WA 3CJIB 4P9YA 3V0AB 2DUPA 3ZFFB 5BNNC 3A0KA 3AXDA 4W65A 1FMD1 1ENQA 2BFUL 1ENRA 4Q4W1 1IS3A 2D6PA 5BNNA 3L9JT 1JYIA 2VUAA 1H1IA 4LO8A 1ND3C 1YFYA 1XRUA 2RMU2 5CFDC 5FLIA 2HEYF 3DL3A 4AQ6A 1IPKA 2WZR2 3VHOA 3LOIA 3NAPC 5EYYA 3KCCA 2MNGA 4Q0VA 5D8AC 2TUNA 1OHFA 1V9U3 3VKOA 2YDEA 3RMXA 3CLPA 4H7MA 4B4RA 2R1BA 4AVCA 5D8AA 2VVEA 1NCQB 3FBMA 2WFF1 1A8DA 4LO4B 1QNYA 4YW5A 1MZFA 2UU8A 4MLOA 4NHKA 4AWDA 1K5MA 5L7OA 1NOVA 1DGLA 4Q1RA 4C91A 2I74A 4AHYA 4AVAA 3EQEA 4KL1A 4LBNA 1LHVA 4FSJA 3RZZA 2JKBA 4LEJA 4BLIA 3SXWA 4Y1XA 4YW1A 3B5LB 2BGCA 3T1LA 2JX9A 3H3UA 4ITCA 1XYNA 3IPVB 2IXIA 4CRQA 2NZ9A 4RD7A 2XBO2 2R073 4WZFA 2KXLA 3BU7A 3UK9A 3RS6A 3M1HA 5HBAA 2ZGOA 4YRDA 3VBOB 4Y22A 1LOFC 4WZCA 5JIUA 1LU2A 1QJZA 1YI7A 3RJRA 4Q0QA 1CAXB 3OY8B 4Y1UA 3VHPA 2ZHLA 4G9SB 1FOD3 1NA1A 4Q4X3 4WVZA 5AFBA 1W6QB 1NQJA 2D43A 2PLV1 4W6XA 1HRI1 2B46X 2ZKLA 2JG8B 1H4HA 2WLPA 1Q8VA 2RS53 1W0PA 3WDVA 4DRRA 2IC1A 4JRLA 3J8F3 4IESA 5JPMB 1LHWA 3TWIA 3VBFA 4YGBA 4META 4MUVA 1PNFA 4JGYB 3CF6E 5LEKA 3ILFA 1MS8A 3RJ2X 2DCJA 1DZQA 1FXZA 2XJQA 4LBQD 1WMFA 5GKAC 2D6KA 1JW6A 1WCKA 1WW6A 1RUNA 3KGLA 2D6NA 4UW5A 2PHDA 4RGAA 1QMJA 3ZMOA 1RGSA 5LK7B 2B39A 4FPKA 5C6CA 3GALA 2P3JA 1H9WA