2O14A

X-ray crystal structure of protein yxim_bacsu from bacillus subtilis. northeast structural genomics consortium target sr595
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
354
structure length
354
Chain Sequence
KVYQFDFGSGSMEPGYIGVRASDRYDRSKGYGFQTPENMRDVAASGAGVKSDAVEFLAYGTKSNNTFNVDLPNGLYEVKVTLGNTARASVAAEGVFQVINMTGDGAEDTFQIPVTDGQLNLLVTEGKAGTAFTLSALKIKKLSDQPVTNRTIYVGGDSTVCNYYPLNSSKQAGWGQMLPHYIDKHTFQVRNMASGGQIARGFRNDGQLEAILKYIKPGDYFMLQLGINDTNPKHKESEAEFKEVMRDMIRQVKAKGADVILSTPQGRATDFTSEGIHSSVNRWYRASILALAEEEKTYLIDLNVLSSAYFTSIGPERTLGLYMDGDTLHPNRAGADALARLAVQELKRQGIAGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein yxiM
publication title X-Ray structure of the hypothetical protein YXIM_BACsu from Bacillus subtilis.
rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
total genus 110
structure length 354
sequence length 354
ec nomenclature
pdb deposition date 2006-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13472 Lipase_GDSL_2 GDSL-like Lipase/Acylhydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 2o14A01
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 2o14A02
4BQ4A 4Q9AA 1WMXA 4XVHA 1W8ZA 2WAOA 1W8WA 3SLRA 1ESEA 5HOEA 1BWRA 1U8UA 5D21A 1DEXA 3SKVA 4LKFA 1FXWF 1UOJA 4AL9A 4BQ5A 1PP4A 3DCIA 4YW6A 1W8TA 2K46A 1IVNA 2WABA 4DEVA 4LJHA 4YW7A 2KR2A 2LRPA 1OH3A 4BQ2A 2HSJA 2VPTA 3DT9A 3MILA 1DEOA 1ESCA 1WABA 2Q0QA 4LKDA 4CPBA 2VXJA 4RW0A 3ORJA 4PPYA 3F95A 1V2GA 4LK6A 4S1PA 4M8KA 4CP9A 4LKEA 3ZYBA 2APJA 1J00A 4I8IA 2WAAA 1WCUA 1HN0A 4JKOA 1W90A 1FXWA 3RJTA 3ZYFA 1L7LA 1ZMBA 1W9FA 1VYHA 1GWKA 3P94A 4Q7QA 5JD3A 3W7VA 4LK7A 4IYJA 5A4AA 4HYQA 2W9XA 3ZYHA 1GWMA 5B5SA 3UT0A 1BWQA 1JRLA 4H08A 1YZFA 4LHSA 3HP4A 4JJ4A 4OAPA 1ESDA 2O14A 4JGGA 4RSHA 1V0AA 1K7CA 4TX1A 4K40A 2Q1FA 1Z8HA 5CD9A 3U37A 4YWAA 1ES9A 4K3UA 3DC7A 2LROA 5BN1A 2C24A 4K9SA 1WZXA 4CPBD 3PT5A 3DT6A 3DT8A 1GWLA 2Q0SA 4OAOA 3KVNA 1W8UA 4A6SA 2WYFA 4CP9B 4HF7A 2JWPA 3C1UA 4K7JA 1OKOA 4JJ6A 4BQ3A 1BWPA 1VJGA 4NRDA 4JHLA 3BZWA
chains in the Genus database with same CATH superfamily
4GL4A 3DECA 3WNXA 2JLZA 3WJ1A 4KYTA 3KUCA 3DDSA 1YI1A 3QELA 3V8QA 3PXDA 3BC1A 2FP4A 1JXQA 1RBMA 2QD5A 3OUTA 3N9PA 2ZGPA 2QMUA 2W0MA 4MR7B 1NAHA 4O3FA 2GBCA 2Q30A 1KZGB 1V9U3 5CPFA 4KNYA 1X7NA 5I45A 3KV1A 5AC93 4Y2XA 3M81A 4F2GA 3G68A 2WQZA 2QYTA 5JSPA 1ZVKA 1NULA 2ILVA 5L6MB 4C05A 5AW0A 1B1CA 4YMGA 5IVVA 1VCIA 1JDSA 1WB6A 4G9EA 2ZU0C 1NJ8A 2XOXA 3W04A 3EG9B 3N7UA 1N6NA 3QZUA 3FWEA 3P9ZA 2Z9CA 4DLPA 5WRFA 5B1EA 3MS4A 2ZK7A 3FJYA 1RJ7A 4F4FA 4RA9A 3U44B 4L5BA 4F6RB 4WZAB 1CR2A 2XZPA 2DLNA 3LKZA 1YDEA 4ITRC 2UXCB 1YRLA 4DR7B 5FORA 3WL8A 2QMYA 2JKZA 3VRHA 2F43A 1V37A 2HWE2 4EJSB 3X44A 4WBSA 1HDIA 3RCBA 5LATA 3KT4A 2B39A 2FWPA 3FCXA 3AJDA 1N2ZA 4XFIA 3RVLA 1YI8A 3NBZC 3PGA1 4LE2A 3ER6A 1PJ3A 1QK4A 3CXUA 3TSYA 1QHNA 1KC3A 2IYLD 2ZZJA 1SBCA 4UAGA 4E31A 4EDFA 5AW5A 3SC2B 3VAAA 2FEXA 2D6LX 4QG3A 4RV4A 3RYIB 5C81A 1S9DA 3D6UA 5BUVA 1ZD4A 2Y3IA 1NQ5A 1JJVA 2WMYA 9LDBA 3D0JA 3U4AA 4JLNA 2YY7A 3E5RA 3C5VA 3DZIA 4HBZA 2OWDA 2QL5A 1FP4A 1ZM1A 5DTIA 3TIVA 1WPQA 3VDDB 3TIFA 2D5LA 3ABRB 1ND6A 5JAPA 4CMIB 2PA0A 1N2IA 4AICA 3FETA 3OIYA 4D79A 4LHXA 1KFXL 4HRYA 1ZW6A 1J23A 4ZMRA 2WD7B 3E4DA 2HSGA 4QBIA 2WO2A 3IP3A 2QLFA 4BLWA 2PVCA 1SUEA 4Q8LA 3IB6A 1WKBA 1XNCA 4E5DA 2E31A 2HV9A 1BVRA 4JN6B 2JJMA 5ANNA 1XEXB 3LSEA 2VE1A 1T35A 2CXXA 3WIBA 3G2QA 5C3MA 4HAUA 1M67A 4ZU5A 5C1DA 4AAPA 3BKWA 2VZ1A 1QHHA 1C5HA 1YC5A 4RPKA 1A8UA 4X41A 1UMCB 4INZA 1JIIA 1G8AA 3ZJTA 3Q8CA 3NEAA 4QQLA 1XRNA 3ER9A 4IUCS 5T50A 2XOEA 2AJTA 5C18A 3JYPA 5JZGB 4H77A 5BUCA 3RVBA 4PHHA 2FUNB 1RBQA 4RIIA 4NOMA 5A32A 1X8LA 2ZRNA 1VL1A 4DADA 1CS0B 4Q1BA 1RP7A 3ZWWA 4B6OA 1FJXA 3GEDA 1RUC3 4W5WA 3E15A 4PHGA 4YT8A 1EP0A 5JMPA 4RJKA 1YZ3A 2HMTA 3UT5A 2FJUA 3VC1A 2NU7B 3U7HB 2A9PA 2CXHA 4IDHA 3LQ4A 2QNIA 3AMHA 2H9IA 3V8RA 2F48A 4IR7A 1Q6YA 4LG1A 1JHOA 2R6AA 2I34A 4RSRA 2X5IC 1IDOA 3C6YA 4ZEXA 2PS0A 3QXXA 1GR3A 4O2AB 3L6EA 5IUQA 3WF1A 4AF6A 4B32A 4N5LA 1X7XB 1CUSA 2CHVA 1H3EA 4QODA 3HOBA 2EIBA 1AMNA 4X7PA 4J1SA 4MR7A 2O8OA 4KFSA 3IOYA 5D5PA 3LDHA 2DH6A 3GCGA 3ZD9A 3AL5A 3ACLA 1Y8RB 2W70A 2NSYA 3PR2B 1JZ7A 1UMDA 5I9BA 4Z7OB 1EGQA 1RLIA 1BOOA 1SZCA 1OASA 4B7XA 2IHNA 4INAA 5E4YA 1XMOB 4ZDIA 1VMEA 4DSNA 4B3MB 3EG9A 3STYA 1N1SA 2ZABA 4HQOA 1VB5A 2GN0A 3MPPG 2YS7A 1QQ6A 1QJY2 2A3NA 3PXGA 1MQAA 3EF0A 3CUVA 3U7QB 1NVUQ 2BJHA 1VL0A 2PHLA 4F6RA 4WZAA 3DCNA 2FKAA 4LBWA 1NVWQ 5FLJA 3WY9A 1Q1AA 4JJ8A 1LH0A 5KHLB 3MINB 1BG6A 4EJSA 1S02A 4LZPA 2IPXA 3C6ZA 4BGIA 2R063 3OEHA 4OQ8A 3TLGB 2A6XA 4U2KA 3ZWVA 2Y68A 3KB6A 2DVBA 1OX4B 2FZWA 4MYCA 2G25A 4TMZA 2I07B 4I0BA 2I62A 2FRDC 3ROEA 1DYOA 3O91A 1LRLA 4ZV7A 5JVDB 3IAUA 3P9XA 3HVJA 5IUKC 3WBFA 1O94A 3GUUA 3F7OA 1TU3A 1OILA 3PUZA 2CWDA 4BIOA 4G56A 5FK7A 1R64A 2O7NA 4YYZA 1AOXA 1NRXA 5ALIA 1PVOA 5LNK6 2O9JA 3WV5A 5IAAA 3ROTA 4K6BA 3WTBA 5H9SA 1S4QA 2A3RA 4BNGA 1DGQA 4HNRA 3VDDA 5EZYB 4CKXA 1JXMA 3FDZB 3VO1A 4CMIA 1FNMA 3BXOA 4PAGA 1KC1A 1BZWA 2CHUA 3ME2A 4C7KA 5C3UA 1F5NA 2BWJA 4QUDA 2RK4A 2F1IA 3FDXA 2XB6A 4LWQA 3P71T 4WUTA 5JSYA 1BAPA 1YFKA 4IZOA 5ECDA 1LK5A 3SJAA 3ZV4A 2R84A 4FFBB 3EZGA 2GXQA 4X0EA 4ARAA 4YUYA 3DZHA 5DLEA 4CCYB 4I5FA 1U5YA 4LF7B 4II3A 5T4HA 3FFWA 1L5HA 3U3XA 4JYBA 3B8EA 4SLIA 3COWA 1WCSA 1ZN8A 3JZFA 2IDMA 1IHXA 1T0HB 4IEYA 1YR9A 3AOEA 5F1YA 3MWEA 3ZOZA 1X1DA 1L5KA 5FB3A 4C08A 3K77A 1QRTA 2J9ZB 4HEHA 3RYFA 1C8VB 3WRXC 3E7DA 1SCNE 1GN8A 4LEIA 3C3DA 1SBDA 5HJEA 1A7KA 3EEIA 4EJRA 1BGWA 5JZVA 4WNIA 1WKYA 4YAFA 1Z56C 1LOCA 1AO3A 1CRPA 5IULC 2XZLA 4IQPA 2ZCVA 5IVJA 1HLPA 1DLLA 1JW6A 1HE5A 1ONPA 5ALVA 1BOFA 5LQJA 4CCMA 3K4HA 4XVCA 3HRIA 2TSYB 4LHZA 2NYRA 1CS0A 1ULTA 1O8SA 3P3NA 4UTZA 3L8EA 3I5MA 1SG9A 4CDWB 4M9CA 1X9TA 5FPZA 3LEMA 1IS5A 1UX7A 4ALMA 4ND7A 2WJYA 4D02A 4A6DA 3OPXA 2P2YA 2NU7A 3CH4B 2ZR8A 4ILKA 1YTUA 3JS5A 3B5LB 3DE3X 3IQZA 1PT8A 2JLQA 4TV9B 3TMKA 3C3BA 5SZJA 4FGZA 2ZRBA 2FUCA 5MGBA 5BQXA 3JZMA 2PFWA 4WCDA 1RUE3 3N05A 1KDRA 4TTRA 4O2AA 2OAGA 3FL7A 4RPCA 4I4TB 1UX6A 2HM7A 3TDKA 1N6IA 1X7XA 2L0XA 1KAOA 3PDCA 3HVRA 1VHQA 2X86A 2C0ZA 1J22A 4ZCIA 1HKHA 3CZRA 2IYVA 4O2LA 1I2AA 3PIRA 3I8OA 1QOOA 1B35B 1W5TA 2DWOA 4IJMA 1ZNXA 2OVFA 3VR6D 1NNLA 4DUWA 1V6CA 3QLUC 4DQUA 4H2AA 3RROA 1Y1PA 3KB8A 2HEWF 3IRUA 4J03A 4OEHA 2IFRA 3U16A 2W2IA 3K6KA 4WMLA 1TMYA 4HVRA 1JB1A 2F59A 1G8YA 1J1LA 1G7SA 1LGCA 4HLUA 3LVFO 2XJSA 3V9PA 3K4ZA 3O4IA 2RHWA 3WYDA 3M1HA 2O1SA 3O1OA 1N1GA 4MTCA 1HK7A 1OLXA 3LP5A 4M76B 4TTIA 3L8FA 4QBTA 4AJ2A 1ZMXA 4RNCA 4X6LA 3O8DA 3OCCA 3S55A 1AZSC 1WLCA 4BFUA 1R8SA 4Q37A 2V7UA 3U7QA 2VK2A 3A7QA 1TA0A 5ERLA 5LBEA 1BWRA 2HBYA 4IIDA 3WQ0A 3PRHA 3WGNA 4P1ZA 1GPBA 2EKQA 5E6HA 1DARA 5K2MA 3MINA 1UAAA 3HEAA 1NSTA 3T06B 3TLGA 3MSXA 5HNKA 4Q9KA 1HXS3 2NSJA 1OX4A 2WIBA 1P1KA 4M8NE 1XO1A 4Y7CA 4L4RA 2EXIA 1U8EA 3GROA 5FUVA 3LBIA 1Z0UA 1TZMA 3OFNA 1FQOA 4XACA 1T9HA 1EBBA 2OV8A 4AKHA 2Q7OE 3ADDA 3N3BC 3U3OA 3VNBA 4OBEA 3CKKA 1XYYA 2OFPA 1JHUA 2PHXA 4JVLA 3T12A 5ER9A 2REBA 1KEEB 1JFVA 3BJMA 2E6UX 1RZ3A 3VBHA 5JCTA 3BU0A 4CT4B 5IMBA 4ZARA 2R4TA 4NCAA 4LY0A 2H92A 1NDUA 5TRTA 2FMFA 3FDZA 4ESVA 1YZGA 2YFYA 3WHLA 4R9SA 3UWPA 5AXAA 1TI7A 4IGKA 3SS8A 4OHYA 1DQPA 1Q7BA 3IBYA 4AMBA 3OZGA 2P2DA 4BN4A 5EQTA 3DMFA 2G63A 2DBZA 1F5SA 1S8OA 3OIUA 3DOOA 2XF8A 4EHHA 4FFRA 4H4DA 2FPGB 4P9WA 4UNRA 4OH7A 3Q2KA 1G41A 3ESXA 4FFBA 2XUPA 1QDUA 4PCVA 4QYIA 1CFJA 3ECQA 5AOCA 4UUAA 1IY0A 3TKLA 2R071 5L9VA 3IVAA 3GFSA 5T6BA 3ETGA 1LESA 1RACA 1X74A 5E7QA 5E38A 1BEV1 1QYWA 4AFMA 1R4AA 3ILNA 4W6ZA 5FO9B 1W88B 5CVEA 3JZIA 2ZGMA 2QMOA 1PVC1 1CSEE 2VF2A 2IH5A 1AF9A 5FUYA 3ZMNA 1JA1A 1CQ9A 1KQ3A 4HQFA 1B14A 3WSOA 2YJZA 2GHIA 1CAUB 1KI3A 3U3ZA 3CTPA 1Z45A 1QOZA 4ZU1X 2AN4A 3CLUD 1QG2A 2GPAA 5C4WB 1YL5A 1KD7A 3V2UA 1NC3A 5BT9A 3DW3X 4R3UC 3K6SA 3PEYA 3TAXA 1YA6A 4M0EA 3BMOA 2J3HA 2YV3A 4TTVA 1DCFA 5CA1F 5K8VA 4IS2A 2UUAB 4OP1A 1MO2A 1U0BB 2VF8A 3FUVA 5BQ3A 4NPRA 4JGZC 3F95A 4PIYA 3GAZA 4JUCA 4LK6A 3BK1A 1PIV1 4ZQFA 1B15A 1F5FA 1HQWA 2WOOA 4TV9A 1AIPA 1ZM2A 4FQZA 1DP0A 2OM2A 3MZ0A 4NN0A 4NIAA 1WDLA 3I1JA 2RB4A 2I6GA 4OHWA 3PSAA 3HJTA 2FB9A 4YFWA 1E61A 3HJAA 2NO5A 1CP3A 1XTBA 4EN0A 4CLEA 1CQXA 3QTTA 4I4TA 4RK1A 4IKEA 3WWEA 4AJIA 3SHOA 3VBEA 5C8YF 4HPKB 4IIFA 2RCNA 2WD9A 3R6TA 3IT3A 4HFNA 4TLCA 2WYFA 3I7DA 4EARA 5AM2A 4MQMA 2ALJA 4O7XA 2D3PA 1QNYA 4DAEA 1PJLA 4Y3UA 2HZBA 5TVGA 4YRBA 2PAAA 3AWDA 1TNFA 1Q84A 4URXR 2OB2A 4GWKA 1B35A 4LS3A 1E3LA 1Z5OA 3VC7A 2H31A 1XZNA 1JYWA 4EJ6A 1I4TD 3JAKB 1TU0A 3FJSA 3GRUA 3BRWA 3PQ2A 4P4SA 2C2BA 3RBVA 1YS6A 4BVKA 5JBIA 1KYWA 1YBVA 2PSJA 4M54A 3GCZA 3H16A 1EHYA 2A4MA 3HPRA 2DUUA 3FZEA 5DEIA 4KMSA 5FL7A 3KGLA 1N2EA 2JIOA 1UEIA 1NOKA 2I7CA 3QW4B 4BB0A 4YALA 1GT91 3NJYA 1ZIYA 2C54A 3N3AC 3IOEA 1YI9A 2WSYB 1KIMA 4RVUA 2HJGA 2FLVA 4GFDA 4Y1RA 3LA6A 4ZRDA 1PLJA 3WYCA 3TLMA 4DQVA 3TNFA 3IUEA 3UT0A 4DN6A 1WXGA 3THOA 2QQFA 3PWTA 3NS7A 4RPGA 1F20A 3UJPA 1DYPA 1ILWA 2ZREA 1OC1A 4QYMA 4RTLA 4KXMA 4F38A 3OE7A 3MJDA 3SZMA 3ECCA 4IRMA 3A0KA 4ZT7A 3AP7A 5KU7A 3WD5A 1NVBA 3ZWXA 4YI3A 2HFJA 1PFWA 2YVUA 3VHXB 1KIAA 1JH8A 1LF0A 4YH1A 2YHJA 1UPSA 1KFUL 4AZZA 5F8PA 1ZDMA 2WFAA 1AN0A 2WZ8A 2QJRA 4WDQA 4EABA 2ZTSA 6AT1A 2OFFA 1US2A 4RR3A 4CG3A 3LDGA 5JWRA 4DPLA 1ORWA 3X1YA 3FSEA 2V96A 3F96A 1XD2A 3VOBA 3HEMA 1XKLA 5ITSA 1L7MA 2GVNA 1KEEA 2X0DA 3GT4A 1X8MA 2CDOA 3VKLA 4NWIA 4D46A 4JQCA 1CY4A 1Q0LA 3LO8A 3DZ8A 1QJX2 4ICIA 2P9YA 1M1YE 4ZO7A 3STWA 3WDKA 3MJFA 3PFFA 3OEED 1HWYA 1W5FA 5EWJA 2WDBA 4IL5A 3KVAA 3OICA 4LVCA 2PMFA 3CZCA 4OL9A 1VL8A 3TQCA 5B7PA 3PC8C 1LQUA 1XV5A 4NFHA 3OGSA 4PG8A 5A0VA 2IVZA 3ZDQA 2FPGA 1SC6A 1I6LA 5GZDA 1R082 5JRDS 1OBFO 1KPHA 2G9NA 4HFMA 3WG9A 1FDSA 3AEZA 1XNAA 3TSAA 3DP9A 3HEBA 1Y89A 2C1XA 3VDNB 5HKKD 3QIVA 3H5VA 1NMSA 1W8WA 3M1IA 4NY1A 4UHDA 5AJZA 3UWSA 2IPMA 1N5IA 5JIAA 4WFKA 1ZL0A 4QM8A 2FFHA 4YGYA 4MV6A 3L1JA 3JYQA 1PYGA 4RKRA 4HQRA 3DLCA 5KREA 2PZJA 2OC9A 3VNAA 4FDVA 2Z57A 2C58A 2IHYA 1F4LA 3C3KA 3V5NA 2FW0A 4BKOA 1HBJA 2ISSD 2Q8PA 4AVTA 2B9EA 4S35A 3M6UA 3WDXA 4X90A 2CK3D 1CAUA 5FR3A 3WKBA 4O1IA 4P3XA 3OETA 3I8TA 4QLAA 1BWQA 1CLEA 3PNAA 2ZWOA 4J4HA 3H5LA 2H2DA 4OUDB 4MA4A 4DSUA 3B1ZA 4XUDA 5K4GA 5C4WA 4OBXA 1TO1E 3SQDA 1E1QD 1OZAA 3I92A 2E9SA 5CAEB 3R0RA 3AR8A 4FS3A 2GN3A 5IU6A 3L8DA 4AQSA 1G19A 3O03A 3KDPA 1JECA 2JFBA 1RWBA 3RDPA 1A4RA 4B3CA 5LASA 1DKPA 4EGJA 5EHZA 3R7NA 4AYUA 3T3HA 4BX8A 2JGKA 1OYVA 1VHWA 1EE9A 3UMFA 3O0TA 5CYYA 3ZSKA 4WOCA 4RACA 5GV7A 2AOXA 1LPPA 1CP2A 3NHBA 4L5IA 1XTVA 4C3UA 5BRJA 4EO9A 4ZOAA 1HRV2 2H8GA 3GZAA 1TMF2 4UDXX 4QPIC 2V7WA 4K3VA 4XZUG 3ZWPA 4Z4QA 2X4GA 2HMYB 1NBAA 1E5LA 1VGVA 1SXJB 1GQGA 3LKJA 5A4IS 3G9XA 5LU9A 2BGMA 4KAJA 1CUZA 4D74A 4FLMA 1MVNA 4MMYB 4LHEA 1W1IA 3AB7A 1NQTA 1O95A 3WLEA 4Y1YA 4HYQA 3CVJA 3JAKA 2HA2A 1S2GA 2CLFB 3GLIB 4MROA 4ZHSA 4PZDA 1DTSA 1EESA 2ORED 2WICA 1C8M3 1ZMRA 4JI0B 2RI0A 3LKDA 2Y1FA 1GARA 3R4SA 2HIMA 1APBA 4BCBA 3IVRA 4IP0A 3TQFA 4QX3A 4I5DA 1IDN1 5HUJA 2HRRA 3WQRA 3V6MA 4CFZA 3P5BA 2WHRA 1KNQA 5EXSA 3VTKA 4UM9B 2AT1A 5C7YA 4KPFC 4ZDJA 4PLNA 1LDYA 4BVHA 3MJ4A 1ZHOA 2VR1A 3KPUA 4BQ2A 4MRAA 2BRTA 3GUYA 2EF0A 2QEQA 3CX6A 3UGFA 2CVOA 5J1XA 1QJZA 2W4QA 4FMDF 4K9NA 1ECFA 1ARZA 1LTKA 4MR9B 3PQ6A 4AF9A 2BVBA 3J7TA 5JSKA 3OQIA 1WV0A 3H6GA 2DWQA 3VHXA 4NR0A 2QB5A 1M7HA 1G5PA 5HM6A 2GSDA 5B55A 2VDWB 5CFRA 3MLKA 4BMYA 1ZIPA 1U1DA 3W2FA 1LTQA 3MTGA 2LIVA 5GJ6A 4HRXA 1QZZA 2E48A 1HOXA 4FYPA 1T3TA 1CDEA 5AHKA 1GV9A 1UC9A 4BMEA 3R7SA 3Q5EA 2NTYC 1MABB 2B7CA 4ZD6A 3TW0A 4GXQA 5FNZA 4LE4A 1LBIA 2HWF1 1WKVA 3MIZA 2QTMA 1E5IA 2J3EA 2Q9BA 4ND1A 3VTAA 3GV0A 1W1WA 2NX2A 4JR1A 5C1IA 2O4CA 2Z08A 3R9KA 1Q22A 1MJGM 4R2WA 1P4GA 2P2KA 4J3FA 3K72B 2UYBA 5EE9A 3RAEC 5EP3A 4WN3A 1AKNA 4OSPA 2XJUA 2WE8A 3MW8A 1W8DA 2DT8A 2B2CA 4CSWA 1S0FA 4YPVA 5DUVA 4NXNB 4CUAA 1OH6A 2VAMA 4JLSA 4M46A 3T3YA 4MV0A 4FEYA 4C88A 3M3PA 2G5TA 5AI4A 3R0VA 3SQWA 5P8WA 2H85A 3KK0A 4LFBB 3I3SR 3LC1O 4LKOA 1WBBA 5H70A 2Q41A 4RHCA 3O1PA 3CONA 1H69A 2ZJ4A 2FUEA 3MNFA 5AVKA 5C5UA 2RCYA 4EG5A 2RD2A 1QO7A 2WJZB 2BM8A 4YAIA 2SKCA 1ONNA 4ND6A 3WYNA 2I2WA 4U2FA 1V2HE 1TLTA 3LC0A 2ZUTA 3R5HA 3D0QA 3K0EA 1GIAA 2DSNA 3LQ1A 3ROFA 1IQRA 5I7OA 4OUDA 3NRUA 3SCFA 3VPXA 1KO7A 1F9EA 1NKVA 3NONA 4HDSB 5HV4A 1YBAA 1JLMA 4WX2B 5CAEA 4B76A 2DMRA 1Z7S1 4CMJA 4TYNA 2PKQO 4I6EA 4J07A 4H2DA 4UBOA 1HC7A 5L7OA 3FC0A 3AB8A 3HBZA 4TSFA 4L7QA 3MQ2A 1CZVA 4HQLA 1QIQA 3ZV7A 4FT8A 3GDOA 3SCZA 3NCHA 1QHYA 4QAJA 4YAWA 4NDNE 1A7AA 4CBVA 3NHLA 3L1VA 1C8BA 1YS7A 4U2DA 3QOXA 2I6QA 1RXVA 3WICA 4KTTE 3O8CA 5BYBA 1DOAA 4ND4A 4C0AC 3OURA 5IBPA 4WOKA 1AKVA 2O8DB 3IBTA 4Z2YA 3EASA 2QGNA 1Y1SA 3A2KA 1SXJA 1OC4A 4IERA 3W5AA 2JK1A 2NUAA 4ZV4A 3FOAA 5A1LA 3OIGA 2YHBA 4G84A 1I5PA 2GNPA 4KG7A 2YICA 2C2GA 4HXFB 2VZRA 3DE6X 3IEUA 2EV9A 5ENDA 3F1KA 1WRBA 1AMOA 5GVSA 3ZDBA 4OIMA 5FTMA 3CW2A 3QXJA 4BMVA 4HWSA 4FBLA 3MQ4A 5DM0A 1N25A 4YG3A 3IV6A 2JB9A 4Q7KA 2GC1A 1DRVA 1N7IA 4O4JA 3DULA 5JD6A 2PAFA 2YBKA 4QM9A 2OUHA 2CHHA 1CEQA 4YM0A 2WC1A 3CPJB 2Y0OA 3HNRA 1IG0A 2R7LA 1UKGA 1KNXA 4M7PA 2FFQA 5I7WA 5JCZA 3NT2A 3MTDA 4FYHA 4BFTA 1MV5A 1BJRE 1E2HA 2LD4A 2O8EA 4GRIA 2EFCB 3D6JA 4MWTA 4BLVA 1CERA 2PR2A 1CJKC 3OKPA 3D0KA 4RLSA 5JSZB 3K2EA 4M37A 5EQDA 2R7NA 2Q7XA 2RG7A 3CF0A 1DVRA 1THMA 2BEVB 3QEKA 3TN93 2JC3A 2JCXA 5JY6A 1Y6QA 3I64A 5LQMA 3R4UA 3T4VA 1XHEA 1UFQA 2VDWA 4PZPA 3DEJA 2XONA 3NBQA 5DOZA 4BRUA 1FFXB 1Q7GA 4I9FA 3HRKA 3AFOA 3U3KA 3OFND 2VCAA 2C4XA 2XW6A 2KW5A 3OEWA 1JODA 5EKXA 1T6GC 1YQ2A 3N35A 3P2JA 3TMAA 4IDEA 4TT3A 4J0DA 1JI6A 1VJ2A 4A0GA 4A45A 2NV6A 3KM5A 4N53B 5KYXB 3L7MA 5F4BA 4UBKA 2AYXA 3SBEA 1Z74A 2EKZA 2QV7A 3I1FA 3FR7A 3QHQA 3ZX4A 3H11B 3EVZA 2R2AA 4QUBA 4EUHA 4EHIA 3ROPA 4IDBA 3AKPA 5COAA 2WN3A 1DPFA 3JPWA 5CDHA 4Y8VA 3F4BA 3GRPA 2AWOA 3EDQA 2CVFA 5FWYB 4F3TA 4AW9A 1QP7A 3F98A 3TD2A 1Z5VA 5AW1A 1VXOA 1UJ4A 2AHRA 4IH4A 1CK4A 1YRWA 3P4YA 5JZSA 5E95A 2TECE 1RRVA 4PBSA 2CB0A 3W6PA 1JLRA 3V4LA 1QP0A 3HWSA 5A0TA 3VYTB 4L8GA 1D7PM 4I3GA 5A3JA 3FHLA 5CX1B 1DKUA 3MJHA 2X1HA 3R3JA 4YAUA 4PF5A 2QTCA 4ZK2A 1ZIOA 4QOFA 1EGMB 2G9FA 5FZFA 5A9TA 2YDXA 3WRYA 4J1QA 1YFZA 2BMEA 2ISCA 5CEEA 5DCLA 3A36A 5ILQA 1KI8A 3GJ0A 3QEMB 4DRYA 2JKVA 5DLQC 5EJ2A 3EOZA 2A9KA 4CL8A 3LV8A 1NE6A 1ZBA3 4X66B 3W9SA 1XTIA 4B35A 3NTUA 4UE3S 1YUNA 5J4VA 4BNLA 2JI6A 3P0JA 3DGTA 3NXSA 1Z16A 4RHUA 1RIRA 3TNQA 1AC5A 5C8ZA 5EIEA 5BRAA 1S6YA 4NZZA 3GBSA 2XRFA 3LA7A 2ZRMA 3FPCA 5K8IA 3HLTA 3AR7A 3T7KA 3HA7A 1JYVA 5CCDA 1JVNA 2GS9A 2RMU2 3F74A 2WWJA 2J3MA 3Q9OA 1ZCZA 2K2QB 3SVZA 4CZ2A 1D09A 4YRCA 3SHTA 3TUZC 4QRHA 1F0KA 4YV2A 3PDWA 1HQDA 1JKXA 4P9GA 4NXMB 2O8DA 5AI6A 2VZ9A 5CFOA 4DLRA 2BY4A 3NHKA 1X7ZB 4TSVA 3V4RA 1N3LA 3MVEA 5DLDA 4Y9DA 2VYQA 4KO8A 1P5ZB 2OD9A 4BATA 2AZTA 5GZ6A 3N2ZB 4TN1A 3GARA 3QG1A 3QBQA 1ZK0A 3TOSA 1MG5A 2GA8A 4D3WA 1DV2A 1AO0A 4P5PA 1F3LA 2C2YA 4OXQA 4C4AA 3VKVA 1AR62 2LZ0A 4KOAA 3MFQA 4LCJA 5HKLA 3FMOB 1SXGA 2V59A 5M5BA 3BRWD 1G55A 4V0LA 3IS3A 2AI1A 2H2FA 2C3UA 3NBKA 5FZLA 4I8DA 4N3CA 3RPEA 2CY6A 2NXJA 4DCOA 1CX4A 3L01A 4RANA 1ZMOA 5A7WB 2FETA 2XUIA 1GICA 5J2UA 2YJ5A 3Q6MA 1NBMA 4E07A 1IZ3A 4N5HX 4JQSA 3K4AA 5B4XA 2ZIWB 1JQAA 4G0NA 4J8PA 2OIIA 4KN8A 3D8NA 1HT1E 3UXMA 5FLXA 4DLAA 3O4GA 3Q0TA 4JKYA 3KT1A 3HUUA 3VUEA 2O06A 2X5XA 1M5TA 3A6JA 3DBOB 2A92A 5G3ZA 4L97A 5TQVA 1NQJA 1R2QA 2EG9A 3OE7D 1CVRA 3ZJVA 2BEVA 2H17A 4D96A 2FMDA 3TNJA 1QE0A 1W35A 1VI2A 1Z73A 1VHDA 4UT5A 1SH7A 1FFXA 2FSVA 3AGQA 1W19A 3I37X 1O58A 1CG6A 1O5TA 2PVPA 4RHXA 1M0TA 5BNOC 4IDGA 1ENYA 1R9GA 4OQFA 4MW0A 1MP0A 1E9RA 3C1TA 2JIZA 2Q5FA 1J49A 5HPOA 4D9NA 1QC5B 1Y3BE 4G4IA 5EWMA 3R0XA 4R4XA 3LUAA 1SU8A 1W87A 4N53A 5KYXA 1FNZA 2PKYX 1HA3A 2WIDA 1H4HA 4A2UA 4UAUA 1UFRA 2QT0A 5BSMA 2OK7A 3H11A 4C90A 2LGJA 3PGKA 2WZQA 2J0QA 1GILA 1OPRA 2TMYA 1BIFA 1XL0A 4JLWA 1RDFA 4P5EA 2EG5A 4AFDA 2A78A 1ZKMA 5FHQA 5CU1A 5FZHA 5FWYA 2VNRA 4GBJA 1MEC2 1WQ4A 1RUG1 1DEHA 1XZEA 2LTAA 4H6VA 3IMCA 3BK2A 3NX4A 4E5UA 4LULA 2QRNA 1P1FA 3NMBA 1CDZA 2Q1FA 4KAFA 1TJYA 3ZSEA 3BTSA 1SOAA 4UW3A 4AG3A 3TQTA 3ICEA 1TVKB 5HE9A 3LQFA 2D62A 3ZHQA 4B6QA 4A0QA 4DV2B 4KXQA 3ZPOA 5FMOL 1ND3B 2AXQA 3R5TA 3CVWA 5ERGB 3D59A 3B6ZA 3QEMA 1Q8OA 2OS2A 1A76A 5IVPA 3HDGA 2OHJA 4QEDA 3C2UA 3JAMA 3GD7A 4EKGA 1K98A 2FLKA 2QL9A 3BD9A 5FWJA 2ROQA 3KOWA 3PUVA 4RD6A 3Q2OA 3HT2A 4LKRA 3RUHA 2BF7A 4BO9A 4AX4A 1PQUA 3JD2A 2RDQA 3G5AA 2NP0A 1T36A 2ODEA 5KNDD 5FAXA 2VF7A 2YC4C 3MF6A 4N6OA 5DPMA 4S3MA 1UXZA 3TOZA 5B12A 1Z0SA 1QGLA 4QWMA 1RSZA 3R44A 4RPIA 1FP4B 5FXMA 1GNSA 1M66A 1YJ5A 1U9ZA 1FNDA 2VHTA 4M0PA 3WB0A 1OREA 3R9WA 5FPAA 4S1NA 4MV8A 1MS3A 5HQ3B 1X7ZA 5LL6P 2BFCB 3HJCA 3MCTA 5FZMA 1T8PA 5KS2A 2TNFA 5AJYA 3KC2A 2OQIA 1VPLA 5F2EA 3H13A 3UMCA 4CTJA 4X8LA 1T9ZA 3JARB 1F1BA 1LFDB 3ZNPA 4DNQA 4EDHA 1KSGA 4D4JA 2I6XA 1UODA 4D9GA 2VHXA 4BMSA 5D1IA 3ZY3A 1M2OA 3FZ3A 3RVSA 5I01A 3COPA 4KREA 3ZLUA 3BHNA 2IYWA 2HLPA 5K0GA 3C1AA 2OKXA 3SZGA 3PUWA 3TZBA 2PEZA 5FP7A 3ZC3A 1SVLA 4W82A 2AFHE 1W04A 1QHHB 3RT1A 1ADBA 2XZOA 5A7WA 2IOFA 3HFSA 4TYYA 3I12A 3RVPA 4ZO9A 4AFCA 2PRSA 2ZE6A 4LBZA 1DLJA 3HQRA 4YRRA 3HYSA 2V0GA 1GP4A 2FPXA 1LI4A 3GDBA 2PQ2A 3H6HA 3B53X 3SZOA 2PUBA 4O29A 4BQFA 2PHWA 1OYYA 1N9GA 3T0BA 1FBNA 3JXSA 1ZA1A 1YTLA 5JCOA 5D8DA 1I0ZA 3OU7A 3L04A 2L9LA 2M6LA 4JQYA 3K0FA 3V46A 4FYWA 3KZOA 2AX3A 5CJ2A 3DONA 1V41E 4WVLA 3GP8A 2F55A 5JV5A 4WOJA 4PV7A 3K8OE 3UT5B 1O4YA 1CUJA 4BHPA 5DTEA 2FG5A 4YTEA 1CAXB 2QQWA 3LCUA 4DREA 3S7IA 3DV0B 4A8TA 1J0BA 4F97A 1F8UA 3JZAA 3AUYA 2EW2A 3CLVA 2K2WA 3S81A 4Q0QA 2PGNA 3H9EO 3U37A 4BYYA 3WHPA 2CXRA 3KP1A 5I9MA 1LPBB 3PHLA 4I19A 2AG0A 2HQOA 4Y2JA 4D42A 4RESA 3MTJA 4NJEB 3T5DA 4ARUA 1UDRA 2J7PA 1NVMB 3UYKA 4NJ4A 1QZTA 1ZOIA 4NAVA 1Y9ZA 4B3RB 4YYEA 4PCAA 2IBMA 1UMDB 4QGSA 2GAJA 2AMJA 3CURA 3K4QA 1YR3A 4L0QA 4OVEA 2C96A 1Q50A 1J84A 5FBZA 1CRLA 1DJOA 2ZUUA 4FZ5A 3EFHA 3N53A 1TVKA 2XJVA 3K9HA 3QUQA 3PA8A 3JATB 2O07A 4J4BA 1J3QA 2HJSA 2R1VB 4E0BA 1XN4A 3VAYA 1RS0A 5G1NA 2R0QC 2VECA 5LRSA 2YWFA 1ND3A 4FX2A 4IDQA 3MWKA 4E21A 2XVXA 2VP5A 1Q3KA 3WJ2A 4KO2S 3ROGA 2IZ6A 4PIZA 4BLJA 4M6WB 4NCNA 2IYZA 4O02B 3JQBC 2I3GA 3MQFA 2WJIA 4P02B 3L7YA 2HWD2 3TZHA 4QXKA 3ESZA 4K3UA 3IMNA 2YFQA 5EP1A 2EHJA 1QONA 3T3DA 4WGFA 3TM5A 2IGTA 4Q7LA 1W28A 3W0LB 3ZWCA 1OUMA 3OU6A 5G0TA 3TPZA 4JXJA 3U7GA 4GJYA 4D97A 5A7GA 3D1JA 2QS9A 3NJ4A 5KOYA 2W6MA 2PIDA 5ICMA 2GAAA 1Y9EA 3TI7A 3IDFA 2J87A 1AYM1 4TSFD 4ZEMA 3PNYA 3SJZA 4AC9A 3VBRB 2H7CA 5HZGA 1INLA 3WBKA 3CIOA 2ZRGA 3T0AA 5SZHB 1UXJA 5FYMA 3OB8A 4UMVA 1X3SA 3GEHA 3IZOA 1IQ0A 1DIRA 5IYZA 4WCFC 2EBFX 1QUEA 1V1MA 4FGLA 4P98A 2WWGA 2R79A 4Q7QA 4LE3A 4UE6A 3PGVA 2I67A 5HQ3A 5EYYA 2P9HA 4DEXA 2K6GA 3L93A 2BFCA 4C04A 2NZ8A 3V7WA 1AR71 3LTNC 5CXXA 2QU8A 1AM4D 1OSNA 1NWCA 3JARA 1HLCA 3BGAA 3CVXA 4QMAA 1X92A 1W2OA 1QCDA 1NUSA 1W4CA 1O77A 3NDIA 4F45A 1CR7A 2WZPP 1TTPB 4KNVA 1Y5RA 1H3NA 1EE2A 2OFOA 1AY0A 5DF1A 5JS8A 3CR3C 1L5HB 1P77A 3LFMA 2VNVA 4IUGA 4XE5A 2W6ZA 5CYFA 5JAMA 1OH3A 4B6GA 3MWEB 3C7FA 2EBHX 2VWPA 1XK6A 3RQIA 2HWC3 4X00A 5DCWA 1MEEA 3AR4A 1QIIA 3RYFB 4ATEA 1ZX5A 2OO5C 2WNEA 2JL1A 1I3LA 2BELA 2H8KA 3PNLA 1PM4A 4KR6A 1XQ6A 2ZHMA 2MDTA 1I7PA 2BR3A 1I0LA 5TDHA 3H75A 3EOBI 1I4EB 1YSCA 1CRZA 1WX1A 2VJYA 1FYVA 3WLSA 3WY6A 1WG8A 2XZTA 2Q1ZB 5AKIA 2JRLA 3G2KA 2MSEB 4GULA 4F5EA 2Y1KA 1U81A 3SCGA 3EJKA 5SZKB 3WDWA 1KJLA 1R6BX 3AK4A 2WG2A 1DBIA 4A6OA 2WIAA 3SF0A 2A8YA 1Z0FA 1RWMA 2FSFA 4RSMA 5AIBA 4D7YA 1W8ZA 1OSGA 1E9AA 3AONB 4AVAA 2P35A 1IC6A 1LX7A 1CAXA 2XUJA 3ZK7A 3UGQA 2C2WA 3DV0A 2Q6OA 1HYHA 4JTNA 5DNCA 2WFMA 4KJZA 3VAZA 1XYNA 3VC2A 4RS4A 3RS4A 3QK7A 2V9CA 1GR1A 3AMMA 2IS2A 1Y0BA 4L50A 4AG5A 4UJ3A 3OOEA 3H2GA 1X8XA 4QDZA 3EMBA 2HWE1 1HQKA 2QAIA 4NJEA 1Y1LA 1Y6RA 3SIWA 1CD3G 1GSAA 4RVSA 4CIVA 3II6X 3AL6A 1UDXA 3D6VA 3E3MA 5FYCA 5DAWA 1NFFA 5EHDA 4G23A 1L5WA 1K3TA 3R8XA 1KRIA 4O4LF 3O9ZA 2FZEA 1A9YA 5DM60 1FYUA 4J7AA 3FGOA 3T9AA 2JG8C 3K48A 1SHZA 4BAZA 4MKRA 2W6NA 3KLBA 2B9UA 4J0EA 3EZXA 2V03A 1N33B 4PYNA 4RU1A 1EJ6A 2PQSA 1Z4QA 4NRPA 4HXGA 1JKJA 1ZS9A 3ENKA 3QTLA 4KPUB 3JATA 3RHSA 4L9AA 4NK5A 4UHFA 2R1VA 4NS4A 4RGQA 1OLXB 4J94A 4OLJA 3HY6A 3E9YA 2ARXA 1D2MA 1FDIA 5HIAA 3ZGLA 3GMDA 3SLGA 4MGHA 2RDNA 3GH3A 5LKRA 4OCTA 2GJSA 2VI5A 2Q6TA 3NIFB 1UEXC 2GZ3A 3DDCA 2PX5A 2PL1A 1HYEA 1T5TA 4M6WA 1D9XA 5LSAA 2R7MA 1NG9A 1RWPA 1O97D 3LBYA 3W5VA 3AZWA 4FTEA 1V6LA 1TPYA 5KC8A 3OBAA 1G7YA 4NU0A 4Q1FA 4MSVA 3CU7A 4GB31 4HD8A 1WBDA 3B2QA 4TV8B 1H0KA 2D0PB 4DIQA 1GAWA 4M0MA 2DVMA 2RH8A 3W6OA 4F5ZA 4BIFA 4GH4C 3QI7A 2WTBA 4N9IA 3AEXA 1PK8A 3UVEA 2DUWA 2PWBA 3ATGA 3R0JA 3VBRA 2O23A 4WE3A 4MLCA 5AVYA 3OCYA 1RIIA 1Z5ZA 2V7TA 1AZTA 2YBDA 2ZJYA 1OH4A 4AHZA 2I7VA 1CETA 2GNDA 3ZOKA 3VBHB 2A33A 1SU4A 3A1UA 4MKIA 1P1IA 3LX8A 3NV2A 5JUVA 2EF1A 5J48A 5UKDA 1XEWY 3CRVA 1KAHA 2H6EA 4EHJA 4BWGA 2R9VA 4ZAXA 1N5JA 4YW6A 2J3DA 1JZ4A 5BSEA 1P45A 3E82A 5IH3A 2QQ5A 3ZIAD 1XVLA 3EYPA 1F7UA 2BBTA 2D44A 4G4SO 1N5MA 3WG2A 4FN4A 2X13A 3H3JA 5A7OA 2JLUA 4WXYB 1NTRA 1B93A 1PFVA 3M4FA 1FXWA 2BEWB 4G5QA 1FCJA 3SZRA 3N9LA 1K4YA 4MEBA 3ZCPA 1E5VA 3EQ7A 3V0BB 5EUCA 5D1NA 2XUZA 2G8NA 4R3WA 4FXKB 1K3FA 2ZXFA 4U7FA 1UIKA 4Q4Y1 4QYIB 1UIMA 1KK1A 2HO5A 1QRDA 3LIIA 5IJXA 3Q5GA 5F3RA 2ZYSA 3IJRA 2RV9A 3Q7SA 1E1YA 2QOEA 5GY7A 1MJHA 1NBMD 4MCIA 2XQFA 4MKHA 3DDOA 3Q10A 1X13A 1AJOA 4H7EA 3POEA 2JW5A 3OIFA 5KJ6A 3AFKA 1Y1RA 3HDYA 4DRRA 2HEVF 2Q3HA 3JB4C 2PGOA 3JQPA 3QYFA 3BCSA 1NVKA 4MW1A 1N8KA 2Y2UA 5BSTA 3P5SA 3GHYA 1C4KA 3RRNA 1X1SA 3U3RA 2ZQYA 4H1UA 1HZZC 2NWQA 3QE2A 3E2MA 2BC9A 4XIJA 2A6PA 3K6SB 1ZN2A 5A6ZA 3BMOB 3A9TA 1QHXA 3HAGA 4E4ZA 2FPKA 4Y6OA 2BU9A 4XA8A 5MDHA 1TAGA 2AG8A 3RYPA 1F6BA 3OQHA 5CGZA 5CNIA 1C0LA 2JIZD 2DFDA 2GCIA 3SKYA 4X24A 1C8NA 4BBJA 2CU5A 2DLCX 3EVFA 1ZNYA 2IDKA 5JAQA 4R9BA 1J0AA 5DN6A 2WJSA 4GWJA 2ADOA 1VPEA 2GN8A 2C9YA 4IFBA 1BW9B 1XVVA 4L0MA 1UWWA 1Y8CA 4WDRA 3CJTA 4Z0NA 2Y2VA 4H7LA 1RVF2 1AR82 1NMQA 2RGNA 1DX6A 1GV0A 5E89A 3Q8EA 1ONOA 2CGNA 1BEV3 4R1PA 3HCRA 3PUKA 5IZ4A 4GMP0 1W6OA 4JLMA 3T5BA 2ZWIA 3RC3A 1AX0A 3A0UA 1PVC3 1WDMA 2IYOA 4PX2A 2W42A 4P4SB 4I09A 5F6KA 1BX1A 3V2IA 2BCGY 3VR5D 4ZT3A 1M2FA 4EJ2A 2HRBA 1IUNA 3FUWA 4KPUA 1MAWA 3I39X 2JFFA 3OTGA 1W2HA 4ISCA 3M5WA 5M04A 4OFBA 3W6ZA 1S9HA 4BV3A 4N90A 3N58A 5E6RA 4Y1RB 2W1WA 1OVSA 4D0RA 5T55A 1WTCA 3OT1A 4QPGC 1Z25A 1HX7A 5F1PA 4GVPA 2WA2A 1RUF1 2G0NA 3CLHA 4FUTA 2E51A 2XMSA 3UUFA 3H1PA 1L5QA 1VI6A 4PS1A 4R4JA 2W68A 3M5PA 3T3PB 2WVGA 5FEUA 4Q4CA 1XXLA 2X40A 2P68A 5FMBA 4DQKA 1JQKA 1E6LA 5CFMA 4TV8A 2P3IA 5AH0A 4HTAA 3WMWA 1JVSA 5HF9A 1AQJA 1GZUA 4OX9Y 3BUCA 1DC4A 2FMYA 4ZGBA 2X0IA 3ZYRA 1D1PA 1XAGA 1CULC 4RR3B 4GO1A 4URYR 4FJ1A 3VPHA 3EHDA 3H5AA 4OJMX 3ILSA 3T8YA 2HYIC 1XD2B 4IZHA 3TFQA 4EVIA 5IDVA 3AV0B 1RXFA 4JEHA 1Y33E 1ZZ7A 2X0RA 3R6LA 4Y30A 4F9GA 2QU7A 5EZWA 2ZIAA 4D9IA 2HUPA 3E22B 3HFRA 1WW7A 4D5GA 1VIAA 3UG7A 4GMFA 5EWJB 1UBMS 1DYKA 2ZETA 2O3JA 2VP3A 2YJ3A 2VF5X 2ZSFA 1MRZA 5FZKA 2BGOA 3OLWA 2OO3A 1EMDA 1GL6A 5FOXA 2J41A 2W00A 3TUIC 2H1OA 4RVHA 4EPTA 1WW2A 2BEWA 5HOEA 4FYXA 5BXYA 3V0BA 1SOWA 2NVUA 1IZYA 2C97A 4QDUA 2PMWB 3R7BA 3QWBA 1E2IA 2NYAA 1MVOA 3ITNA 1H4QA 3RFVA 1KMNA 3TNYA 2OAP1 2C0CA 3TDMA 2H0BA 2YH2A 3A58B 3DV2A 2FGJA 5EIBD 3VBCA 3PYMA 2CVZA 3GJ8A 1VRBA 3O7MA 1V16A 4P54A 5AVJA 4Z07A 3ZFGC 2AR7A 1C1YA 4J1TC 1MQTC 3KM0A 4QBKA 2IOYA 4UTPA 2GF2A 4N5NA 1TRKA 3VR4D 4E8CA 4LI3X 4F6CA 4KQXA 1SZBA 1W4BA 5FA6A 3SQNA 4X8MA 4P36A 1QH1B 1IAQA 2P2LA 2VRCA 1GGHA 5FPKA 3Q7TA 3WS7A 1II0A 5KTPA 2PR7A 4L0DA 1GTSA 1UMKA 5JI3E 1RWXA 3KTOA 3P97A 3LGRA 3EXHB 3AZVA 2QLLA 3DPRC 3K0CC 3K7EA 1U7TA 5TY0A 1RUH2 3FVVA 3WB1A 4AXBA 3KZ4C 3EC2A 5CT8A 1N47A 4TPKA 4WK0B 1VKJA 3C41J 5LU8A 2H65A 1ZC3A 1G6OA 2CKMA 1CDDA 4NJOA 4YGEA 1GCUA 1RYDA 1KY5A 2P65A 3EQ6A 4PANA 4FO9A 1WW4A 4KMRA 1QX4A 2VS1A 2XTAA 4X6QB 2ZUDA 1BW9A 3PE4A 1C9DB 2HC9A 1V00A 4GLLA 2W4MA 1N1YA 3I6BA 5FEMA 3A3YA 2AXEA 3L7IA 3REOA 2ZJBA 1NV8A 1CESA 2Y0CA 3LE0A 2F67A 7MDHA 1TDJA 2FWBA 4LYGA 2XYRA 2WO7A 4AF7A 4UDOA 5BVGA 1MS9A 1L7RA 3OCVA 3UJ6A 1WULS 2J7PD 5TSWA 4RZ3A 4Y0VA 3O1MA 1NY72 2E32A 3JQ6A 1H2FA 5CDUA 3FNEA 4HWPA 1PZEA 4M1SA 1TKAA 3TG8A 2ZYVX 2GCEA 3MIFA 1M74A 2DGDA 2BRUA 3QLVA 2TRSB 5L4SA 2NU8B 5BPFA 2FXIA 1YWKA 4P3NA 3WGOA 2BHSA 5AKXA 1HY3A 5CXSA 5AT1A 2DTDA 3Q0EA 4J0QA 2GPSA 2J8ZA 2BMVA 5A3NA 2H1RA 2A57A 2FPIA 2BGCA 5CB6A 4QPJC 3KCQA 4CMKA 3RIGA 3IMFA 4LVNA 2NQYA 1ORVA 3BORA 3GHHA 2QRPA 4NECA 2PMBA 3FSGA 3GGCA 4MQLA 4RWEA 2WHYA 1QMJA 5K0ZA 1VRVA 2J0SA 4KL1A 4Y20A 3EWIA 2B8EA 4BKRA 3WWZA 1ECGA 4G85A 4DTCA 1WW5A 1I24A 1OROA 4JMLA 2CYAA 5GPBA 1JALA 3A1CA 2JAOA 3T94A 5TMDA 3OQIB 5KYNA 4L99A 1BDBA 5KQSA 4ZDWA 4ZKTB 4DCTA 4GOMD 2WB4A 3D3KA 4NBSA 1A9PA 2AUNA 4QHTA 1DQ5A 4MICA 4AJNA 4KQCA 1KYQA 4AEDC 2RM22 5TMBA 1WL8A 1DT5A 3H9CA 3QMMA 2R3SA 4GPBA 3EDMA 2GEBA 5IVKA 3K70C 4ENTA 4IETA 4I81A 1UXGA 1JQDA 1I2MA 1JIVA 4PNHA 1WCYA 3WGGA 3W8RA 5FDFA 5IS2A 3VBOA 4D8MA 4UHKA 3LD9A 3OJOA 3E22A 1TIBA 2P34A 4XJTA 4IIJF 3GLGA 2V72A 3J8F1 4IWXA 1SCSA 1ZAYA 3GJYA 3IXQA 2PGIA 4CTNA 5E7MA 2Z3VA 1EH5A 1JS9A 5A6SA 3HNMA 4ALNA 5KQGA 3OM9A 1WQ3A 3L79A 1DLIA 5LXTF 4Q3NA 3CY6A 1WSWA 1ADFA 5DI3A 3W9BA 4C4SA 4D6XA 3TRKA 3HN3A 4S2FA 4FFHA 4N8MA 3LS2A 1XZPA 1M2HA 5D1HA 3Q1KA 4AI8A 2DVGA 2VY0A 4IVNA 2QPLA 3RNOA 1W05A 1RHMA 2H06A 4A0FA 2QRMA 4X8HA 4UU0A 4OI4A 2CC2A 4H4CA 3VVBA 5D3QA 1LLUA 2WPDA 3ILXA 3NGMA 3PTAA 2PZBA 2BEKA 4QU5A 1LDGA 3AWIA 1D2AA 3AXTA 3QVXA 4PQYA 2VDNB 3H99A 3H97A 3NATA 2JDUA 16PKA 3KPYA 1NOIA 3ISJA 1T8UA 5EJZB 2CUTA 4IMPA 4BMOB 5KC6A 1UP7A 1JHZA 1BU5A 4L07A 1AX9A 3WSTA 3H9BA 5FOWA 1QH1A 4BB3A 4LR4A 4ZCSA 5B3KA 4JY7A 5FPSA 2ID7A 1K08A 4BQRA 1J00A 2J3JA 4U2AA 4TVOA 1GPWB 1X0VA 1EB9A 2HWF3 4XFDA 1EV12 3AP2A 4AZ3B 4PYLA 3A6ZA 4LXHA 1LY1A 1H6CA 3EXHA 4LC9A 1NR1A 1UBSB 2ACWA 1Z06A 1PU2A 5L7OB 2GRJA 4JVSB 1XZJA 2CSUA 3KVYA 3EEQA 2PT7A 5E1RA 2VN8A 3VHQA 2R8BA 3DTTA 4GBMA 2B61A 1MEOA 4AI1A 5JIUA 5C34B 4KQIA 2JGFA 2GR9A 1XEAA 3SNKA 4ZXFA 3VJRA 4UWDA 4U7HA 1Y4WA 1TQ2A 1Z37A 1IHYA 4C21A 3CZQA 3EFOA 5JNLA 3KQKA 3FWYA 1N2CB 5ISLA 1PDVA 3E97A 4KQHA 3HXOA 2ERCA 2WSIA 1OMOA 2Q1XA 4NEGA 2WMDA 1L5LA 2I78A 2PFSA 3RU2A 3ESCA 2NUAB 4Q0VA 1Z36A 5JR2A 4UW9A 4MCAA 1Z7WA 2X10A 2WYOA 4EY8A 1CZLA 1MS0A 2D1TA 3CWQA 2IH2A 1R091 1P3Y1 4OP3A 5EMLA 4FW8A 1CY8A 5J43A 5JAZA 3DE4X 1N8TA 2WWUA 1I14A 2FP3A 5ABJA 5BSHA 3AHJA 3O90A 5DTQA 2WKKA 1VJTA 2NU8A 4MGEA 4DG9A 3QKSB 2QVGA 2GC3A 1EP2B 2XDYA 3OG9A 1T0PA 4ZK6A 3SDSA 5LDHA 5HFAA 3V7NA 3CR8A 1TK2A 3WBJA 2P0AA 4O4JB 1PZ7A 3A1VA 4X93A 4C0KA 1U4NA 3MSCA 1J70A 3KOMA 3HNYM 3DNPA 2Y0BA 1FPN1 1NYQA 4L9WA 1POV1 3P2OA 4E94A 2VTEA 3AETA 1Z7S3 2W83A 1PBNA 1VHJA 1OF3A 4F9FA 2H1IA 3E7XA 2O8EB 1Z6XA 2G72A 1VMAA 5U4XA 2OFXA 3FNFA 5F7ZA 4B5KA 5KX5F 3X3HA 3UV3A 4J1XA 1CUEA 1R081 3BE8A 3OEHD 3J80A 1I3OA 1RI5A 4YCBA 1L3BA 2CHEA 5FLEX 2HZ7A 4QDQA 1ZBE2 5HI0A 1AB5A 2CFOA 4A8JA 4I4CA 1R12A 1S1MA 4WV3A 5DAQA 2X14A 2HN9A 1G21E 1P4AA 5K3OA 1PO11 4G81A 1GZ6A 1HKDA 4DC1A 3X29B 2CMFA 1O94D 4LK7A 2XX3A 1DKMA 2Z2XA 4I50F 4BLPA 1ZGAA 1JRLA 1MCZA 5FFFA 2Y34A 3VV3A 4Q0MA 1RMU2 1EY2A 2IYEA 3O2QB 5IH7A 4DCGA 3ETPA 2QHXA 3F0TA 5AXDA 2ZPTX 3UNXA 5EMHA 1W1UA 3VHPA 3LBHA 1HDOA 2QDKA 3SE7A 3C7CB 3VDMA 3F7MA 2ZDQA 1NVGA 4BM8A 2A9VA 1Q16A 1E2FA 1YVDA 3IAM1 5FNVB 2QZ3A 1AXRA 5M29A 5F5CA 3S5QA 2AN5A 2X19A 4JP1A 3HGMA 2AEFA 3Q0IA 4LF8B 4XGKA 3OH8A 3AR6A 1R5JA 3VZNA 4MEAA 1OQEA 3MJRA 4CWAA 2IDJA 5FQOA 4AD8A 2R86A 1D4FA 5JJLA 2ZROA 2Q5OA 4MQFB 2WWYA 1LWNA 3H2SA 1V96A 3MLAA 2R5NA 3PL0A 2XDQA 3CF6E 2BN4A 1XEFA 2FDXA 3QUSA 4D8TA 4MGQA 2O5RA 3PD1A 2C5FA 1X87A 3CM0A 1OI7A 4LRQA 4PTLA 4XQGA 5E9AA 1RQNA 2O2XA 4HDAA 1BCRA 3W9UA 5BYNA 4Z7QB 4JBYA 3ZD7A 4KTVE 5DTRA 1ID8A 2WV9A 4B46A 1Z4LA 4BEVA 4JC4A 2QQEA 2G1AA 1LHWA 2E4ZA 1OA1A 5IP5A 2A3XA 2HV8A 3T99A 4KLRA 4RYLA 4WM8B 3EVDA 3LUJA 1Y5NA 2D5BA 2PUWA 5EGSA 3ZW7A 1NCQA 3TJMA 2FSGA 4AZ3A 4BRWA 1KYXA 3PFWO 3HGQA 2IC1A 3QQPA 4GI3A 2QR2A 3JY6A 2X4IA 1Y7TA 1Q7TA 2NADA 2WAXA 1GNVA 1W85A 1Q91A 3F5DA 4XQ9A 1AUVA 2YXSA 1T6BY 2HHJA 1HB2A 1N2CA 3A3PA 5GJBA 1LDEA 4NP6A 1QQ5A 1T6YA 1XDZA 1UKEA 3PR1A 1C81A 3SIPA 2Q99A 4Q21A 4W8GA 4RGBA 4MW2A 1ZRIA 3S0JA 2X5JO 1JHMA 1GKLA 1Q14A 1SUSA 1BHSA 4Y5Z0 2J9XB 5TE9A 1VBA1 1Y5IA 2H2AA 3LY8A 3N7AA 3RRYA 4B4QA 2HEGA 2JBHA 1O5UA 2GHQA 3VHOA 3LHSA 1X7YB 5FDBA 2ZGNA 4FD2A 4KMOA 4GRDA 2PD4A 3PCXA 2A1XA 4OQ4A 1P2TA 3GN2A 5E9JA 3KKLA 3PC3A 3MTQA 2NXEA 5TQ0B 3QKSA 1TFUA 3CMGA 1UMIA 4DTIA 3NNFA 3FTDA 1XYGA 3KUDA 2J1UA 3D1VA 4QDJA 1EK6A 4J7CA 4R6XA 4G01B 4EW3A 3BXGA 4L3WA 3U4HA 5GZ1A 1UCXA 2R5WA 2R8OA 4YP0A 3RTAA 3K8QA 5J2UB 4CXWA 2GP3A 4WV8A 4B71A 5IYYA 4BLRA 1E2PA 4YUAA 2ZI4A 4R9NA 3WIOA 5AJHA 2JEMA 5EHQA 2I1WA 1T2DA 4Y0AA 3HWX1 4K6KA 1YR8A 3RFRA 4ENQA 4H08A 2A2ZA 1YJKA 2J5XA 2VVTA 5DNVA 4UHBA 3ZGYA 3I9FA 3IODA 2PXAA 4GGMX 3WOHA 2WS91 5KVCA 1GKKA 4B6EA 3SZ3A 4ER5A 4UCXA 4GZMA 2HWWA 4CGYA 4G36A 3D8SA 3JQ9A 1ZUNB 1K8XB 1M10A 3D4IA 1HDGO 3DKVA 1RQGA 3LC7O 1NE4A 3A3NA 1KJNA 5D2CA 5DYTA 3DYOA 1LOEA 5IXJA 3AZQA 3GVCA 3EIEA 5EWMB 1QIEA 4KXWA 5F2SA 1XBFA 4MOWA 1DXQA 5C9AC 3KOUA 3LHKA 5EUQB 1GTL1 4CDRA 4KDEA 1AQIA 5E3JA 5H8WA 4ORFA 2D97A 1KVTA 1TUGA 2Q1SA 5FNVA 4D3DA 1VCHA 3T41A 5KWSA 1SWVA 4DC9A 4RPHA 3RDIA 5IKXA 1QDOA 2VLBA 1V1RB 2ZATA 5HGJA 4BIMA 2VWHA 2V74B 3GLQA 4YHBA 4BRZA 4N76A 721PA 2GAIA 3N8NA 4YHHB 2B2XA 3TXXA 6YASA 1M1UA 3GELA 3M6XA 3VBUC 2VT3A 1ZP6A 2N46A 2WIJA 4MQFA 3MA0A 4C3VA 3S6JA 4JWKA 2WB2A 1E9FA 2WT0A 2YTZA 1QG6A 4HX9A 3LSYA 1PN3A 1ZY2A 3PMSA 1POWA 3ROUA 1SGWA 3BGSA 1H6XA 3G5UA 1G6NA 3ZI0A 1U0JA 3CZUA 3NIGB 5AWFC 4YQZA 4IHAA 4IL7A 4XPIB 2D6NA 2GTIA 4G9SB 1UAIA 4JX0A 3D6NB 5AXCA 1R5OA 4I9HA 5DYYA 2W2PA 2E33A 2IYNA 3VSAA 2JG3A 4JJIA 5A6XA 4X3CA 1OV6A 4UFHA 4MVJM 2VRCD 4GLOA 4AS1A 4WM8A 5HKBA 1VLMA 3M9XA 1RXCA 1MS5A 1R0SA 3AG6A 1RUOA 5FWXA 2D98A 4B4WA 4I1OA 2JASA 5J36A 4GU5A 4HJXA 3RRZA 2V6IA 4ETWA 4UUOA 3RFUA 1O54A 1ULOA 3BGDA 2FZ2A 1YHNA 1T36B 4H55A 5AXBA 2OD2A 5EEGA 3DCYA 4NYMQ 4DZTA 3HP7A 2PX0A 4RJ2A 3E5HA 3SYTA 3PVNA 1OFTA 4AVBA 3AC0A 3OQPA 2P3SA 1C4WA 1RUG3 4CXXA 3JQ8B 2BGTA 2E55A 3U78A 1PEAA 5BUZA 3NG1A 4D3SA 2WWXA 1UADA 1HRI1 1VFPA 1K0FA 1MKYA 4I1UA 3L06A 2HYKA 2OV4A 4KWJA 1OZHA 3SI7A 4Q9DA 3CXRA 3ZXEA 1X7YA 3ZV5A 2RB5A 1VIWB 7REQA 4OJQA 1SCDA 2UZIR 1AA6A 3J26N 5LW9A 4BJ5A 3AKEA 1W2NA 1BQPA 2PD3A 1M2OB 5TQ0A 4HGOA 1EDEA 1K7CA 4JI5B 3FRJA 2GXUA 5GONB 2R6R1 5K4HA 1R7RA 1AQUA 5FL7D 2FKNA 4E5NA 4BZPA 5AUPB 2I74A 4GH5A 2CLCX 4Q4W2 2VAUA 1E94E 2BWCA 3VR3A 2P9QA 1EAH1 3QM1A 4JP8A 3KQYA 3LYLA 4FGWA 3G7DA 2WHPB 4QNRA 3FSGD 1KGDA 4DQLA 1E2UA 3P0EA 4NBLA 3DE7X 3RUEA 1ZIDA 5LQKA 4ZFNA 1QH8A 4PTYA 1LW7A 1N9GB 3C3XA 3STXA 3BOPA 1FFWA 4JUAA 1O3QA 4GXTA 1WLSA 3CH7A 3F67A 4XTRA 1KH3A 2QUIA 3BDAA 3KBBA 3UA3A 2ZAHA 2C7QA 4L75A 3K0FB 3LDKA 2BNNA 1SRRA 1R74A 2BMDA 3UIEA 3I2FA 1ZUNA 1DEAA 3MW2A 5C52B 4W1RA 2I03A 1OHFA 4Z6KA 1G1AA 1DGLA 1WVMA 1U0TA 2GH1A 2H2WA 4DR4B 4CGZA 5L7YA 5I0TA 3V1LA 1ZA4A 4RDHA 3V0AA 1IXYA 4Q3KA 1NASA 1EYZA 4WZBA 4XSVA 2IXFA 1XRRA 1E2QA 5IVBA 1PGL1 5KINB 4Q3DA 2ZTVA 2YWEA 1JYSA 4D99A 5KVAA 3CZMA 4XIIA 2YHUA 2VJOA 2PRKA 1AKUA 3ZV3A 2RJNA 1V1RA 4LY9A 4O3MA 2OYRA 1F8XA 2C9DA 4H7MA 1GP2A 1E1LA 5ACA2 4LZOA 1Z39A 3B1VA 1S2IA 3AERB 3Q7EA 1GSIA 3HXPA 4EZHA 3CPHA 5CVJA 3NEYA 3ZJYA 2QF7A 1RZUA 3E0XA 1Y7BA 1MTOA 3WDSA 4FTBA 3QNWA 1WW8A 1O9HA 4FWBA 2L19A 2ADEA 4XCQA 2JCBA 4LO7A 3HUDA 5FXVA 1ASJ2 5F51A 5D8AA 3ROMA 1IHOA 4KGXA 1N1MA 4FOOA 5A9SA 1E7WA 1O6UA 1I32A 4XPIA 5C4MA 1RKXA 3E53A 1NXVA 1NPYA 4U7JA 3CRZA 1V4VA 4R2HA 1XNRB 4QGAA 1HEIA 4Z8YA 5EE3A 4LYAA 3LDUA 1QQP1 2Z9BA 2VHWA 1K7YA 4AQDA 4P93A 2O5CA 3PQEA 1AR61 1JGTA 1L4BA 5F23A 5CLFA 4N3NA 2YC2C 4ARYA 2H51A 1IVNA 1S89A 3ORSA 5LK7B 2HI0A 4P86A 3HQXA 2QD2A 2CL0X 1VJDA 1J1IA 2IHVA 3LFIA 2OQVA 2PXXA 4BKMA 1F2VA 1XA4A 5IKPA 4Y2SA 3A4MA 4JSYA 4BVEA 3T1YB 2GKSA 1W6UA 2F8TA 1ML3A 3NP9A 4JWTA 3SXUB 1L9KA 4KGVA 2W2MA 5JTTA 4DNYA 3DLIA 3QHAA 5IYZB 3P26A 1V1MB 1VFNA 3JQ8A 4F4JA 2Q45A 4HOOA 2J7KA 1NQAO 1W49A 5E7IA 1ZRCA 4MUHA 2CNNA 4NI5A 4G1VA 3BU7A 5JS7A 1CQJA 1YF3A 1NM5C 2H4YA 1XZFA 4XIYA 1O95D 2IGBA 1RRKA 2EW1A 3FW1A 1ZH8A 1OA3A 2PMCA 3DMRA 4FZVA 3CX8A 3M7AA 1PJCA 1TJNA 1VB2A 4TS3A 4NPHA 3WL6A 4P4GA 5EXPA 5GONA 3P9QA 2NVWA 5JNVA 5JIBA 5K6AA 1X7WA 5JZ9A 4Z7NB 5HCFA 1PAUA 4A4DA 4RNDB 1DBVO 3A1WA 2QRVA 1SO8A 4H60A 1R16A 4J76A 4W7SA 3WLNA 4HAYA 3G0OA 5GTDA 1KIFA 3HBNA 1PK6B 5FUMA 4Z54A 2WHPA 1AGNA 5AUOB 2VOXA 1QGZA 4KWLA 3A1NA 1L5ZA 2V7BA 2O2CA 1T25A 3LX5A 4H1HA 1AYM3 1DQ2A 1S0BA 1W30A 3B6JA 2MSNA 4IMIB 2XWBF 3OOJA 2H1VA 2P41A 5EJ4A 4MPDA 3OBRA 1KERA 3UUWA 2QKYA 1BS2A 2W6JA 2DBQA 1MEC1 3TCXB 3MBKA 3L8HA 4GPAA 4LGMA 1T5SA 3V2GA 3A1TA 4HZUB 4MWEA 2YQ4A 1PUJA 5F5LA 3HKEB 1C1XA 3UAOA 4KKVA 2EDAA 2PE5A 4GUAA 1UYPA 1QNLA 2RC6A 1W8TA 3AMPA 1W9HA 5AVZA 4FFMA 3VH2A 5B3JA 1BHQ1 1AR73 1NI4B 1IHDA 4QIHA 1OYOA 2LNDA 2H5EA 1DF0A 3W8NA 4B84A 1ND5A 1FSZA 1CY7A 4P3KA 4YCDA 3KB5A 4PPFA 4XUCA 5FBLB 2P17A 4Q02A 3UFBA 1GAQA 3U62A 3W5IA 4CKWB 5F98A 4PXYA 4A23A 1WPXA 1TJ3A 3CUTA 4KQ9A 1G6Q1 2DV9A 4CNQA 2ZUFA 1UZAA 1R5BA 3OWXA 1Q0HA 5LM3A 1T6XA 4BP3A 2JAHA 3DDHA 1SEFA 3KYDB 2Z1NA 1DAMA 4ZU6X 4ES6A 1ANKA 3RTBA 1UN1A 4EZIA 2D2XA 1YNOA 3L6DA 1EIZA 2XVLA 3ITKA 1F48A 1WU7A 1H2MA 3QVKA 3AERA 3ZDCA 1JYCA 2N9UA 1SOMA 3TVDA 3M3HA 4RDXA 3BVCA 4Q1VA 3DE0X 1JKJB 2OQ2A 3LBFA 4JRLA 4EG0A 2H63A 1S3SA 3D2LA 3EMRA 5FWAA 2HK9A 4HDRB 5HXAA 3UO8B 3G5LA 3H2ZA 3BHJA 4YFVA 4A2WA 1QAMA 4WNYA 1VKZA 1D0GA 3LWDA 1B2RA 1FFDA 2NM0A 5JNUA 5IDXA 2B5WA 2PTHA 4OHCA 4B6JA 4X45A 4HYTA 3HLKA 1GXSA 5F7UA 4BO0A 2ZGSA 1IATA 2QZ2A 1MXHA 1J8QA 4AIRA 3O93A 3ONWA 2WM8A 1F38A 2VQ3A 3NHZA 3L1UA 2XB4A 1JKMA 2QN2A 3PXUA 2XECA 2XH6A 2XVGA 1DP4A 2OXRA 4HEJA 1YUBA 3IIMA 4RM2A 2H11A 1GA6A 3VZCA 1Y3AA 2RDRA 1TG7A 1EWRA 1KSFX 5BW5A 3KQQA 1E7YA 3TFWA 3SXUA 1JDBC 3G49A 2FR8C 3TH5A 2NM1A 1ZVJA 2G6BA 3HJHA 4A82A 5J37A 1HSOA 1EX6A 3HB9A 4R1MA 3VM6A 3RT9A 1XTTA 5FHRA 2ZYUX 4CG0A 1TJPB 2IYQA 4JOQA 1FXUA 5GJVC 3A27A 3EGVA 1AUYA 2WTNA 1SXJD 4FFPA 4FUQA 4WJLA 4XETA 1H9CA 4EUNA 4PAOA 4LTAA 4IRXA 2JLWA 1XNHA 4RQTA 1Z34A 1VBB2 5B7GA 1ZONA 1Y5MA 2KM1A 4HK8A 2HTEA 4K5QA 4QVKA 3NV4A 2FPWA 4P92A 4PX9A 1D4VB 1DBQA 3PUSA 1JAXA 2WJ3A 3NBXX 3ZO0B 2UYHA 4LZAA 2Z8YM 5F7OA 1RYEA 1P8AA 2PYDA 2V6GA 5KCMA 2KPOA 4H9GA 1R6UA 3RG0A 4M3CE 1RAGA 5BWOA 1K97A 4UM9D 3E18A 3KZXA 3WNVA 2EX1A 2ZBUA 2DF7A 4GB33 3OLYA 3FN9A 1JIQA 3S2GA 4IE7A 1PK6A 5FK8A 2PLWA 4HAXA 5G05L 4DT1A 4EWLA 1HG0A 1MENA 3B9CA 2IK8A 4U4AA 5K3DA 1B1AA 4F04A 4IDCA 4ONEA 3POJA 1QG4A 4YREA 3W4JA 4F12A 3QEJA 5JSHA 2Y27A 4C5BA 2PT5A 1RL3A 3EF3A 2VK4A 2OORC 2J5RA 1GU0A 2OXIA 3TQIA 4RTKA 3OY8B 4HZUA 3P9PA 5JOQA 4BH9A 3HKEA 2X6QA 4FZ3A 3P8ZA 4AWDA 1QDEA 1YUDA 4PBOA 4WT7A 2FMUA 3UW1A 3FMPB 1RJ9A 1OFHA 4Y7DA 3L84A 2PQQA 2VMEA 1NI4A 3D3NA 1KBZA 3M3DA 4FDTA 4Z3KA 2PRZA 2D6MA 2JIPA 4TT3D 1TD9A 4BC0A 2PZLA 4WVWA 4OQLA 4CKWA 3KSUA 4NE7A 1RVV1 5G02A 1XTKA 5ECWA 4Z7JA 1AS2A 4RDIA 1TNRA 3LWCA 1TAHA 2XNSA 4AQ2A 4A9AA 3JQFC 2A70A 2QD4A 3E81A 3REFA 3T4EA 1AQNA 4Q4Y3 4FHFA 2RARA 2JH8A 4Q5IA 1M34A 4EHFA 3EIHA 2AF3C 3TE7A 1Q17A 4KR3A 3GLTA 3KYDA 2ILTA 4YRKA 1RM3A 1A27A 3B85A 2N7GA 4CPDA 4OYRA 4G0UA 2XCLA 1W6OB 3TOCA 2O1EA 3I6IA 3W34A 5BSFA 1ZREA 5ECYA 1IXZA 1N8SA 2ASVA 2IYPA 3OJBA 3RSOA 3VKFC 1PQWA 2FRVA 1KMQA 1P0CA 3I4LA 1T3GA 3MLEA 3KWJA 4XOGA 2H4XA 4I2VA 1SHUX 2VUIB 1BD3A 1X50A 2VULA 2OPBA 1PTKA 1BXKA 2B5VA 3DNFA 1NAEA 2BKLA 4NVRA 4HDRA 4E51A 4KXVA 3VZSA 3ZDZB 3G0IA 5E6RB 4MGIE 3NORA 4MV2A 1JIKA 3NAPC 4UCQA 3FZNA 3NM4A 3OT1B 4LNUA 4Q1CA 2BHTA 4JI2B 4MUIA 1BVUA 1VJCA 3ZU3A 4M83A 1PUIA 3ZE6A 3LVBA 4JYMA 1Y43B 4FFWA 3UYJA 4G07A 4UDNA 2PSDA 4KOEC 5EMKA 3ILRA 4FSDA 2JS7A 1XXHE 2Q8EA 4DZRA 3TL3A 4ZQGA 1M6WA 4OTZA 4P2BA 3DJYA 1EFDN 1G8HA 4DG5A 2I4MA 3MGGA 4RA6A 4TTGA 3K32A 3RH0A 1DQRA 4LBLA 1J8MF 1QLHA 4LHVA 2C5BA 4E27A 4LK3A 1FP2A 5AVXA 3T7RA 3HBFA 4HGZA 4CE8A 4ASKA 3C3JA 3HSYA 4HPWA 4NBWA 3GT3A 3N87A 1DIOB 4FINA 3L8CA 2QTNA 3X1WA 1JFTA 3WNNA 1X19A 2WU4A 1PL6A 2YWGA 1TCBA 1E62A 4XF1A 1O6ZA 2Q4OA 3U80A 2HBRA 4U02A 1LRJA 2KHZA 1BS9A 1UY2A 1PR9A 3YASA 2FMXA 1TMGE 3AW8A 3WG3A 4ZYWA 1I51A 2JEOA 4BNHA 2YYSA 2XD4A 4FHZA 4FI3F 4RMHA 2XMLA 3U1TA 1Y1KE 3O1JC 3KLNA 5TEVA 5JDCA 2B7BA 4LYYA 4YG0A 1K6EA 1IRXA 3HCBA 1H5NA 2NVUB 3CZPA 2ZRIA 3KF3A 1SURA 5DI9A 3C1OA 2PZAA 1C9YA 4XRGA 1RUF3 1E8MA 3PHJA 3PGJA 2BAGA 3DFFA 3DG9A 5ALMA 1YB1A 2MYUA 1DGRN 2YFKA 3GIDA 1E60A 2BMJA 1QF9A 3UJQA 5CLJA 1IE3A 4O9GA 4MZDA 4COWA 1V16B 1KITA 4YP7A 2ZX0A 3PPVA 2NZVG 2ZJ8A 2BI4A 4AQ6A 3PEEA 3EXAA 1JMYA 2PX3A 3AG5A 1US8A 3HY4A 4FVVA 3GZNA 3RSHA 3DMTC 3NANA 2YIDA 3EY9A 5CH5A 1QIJA 4B09A 4YQYA 3WCSA 1B74A 3FZQA 5JSQA 3F4KA 4HAWA 2UU8A 2VA8A 5K6TA 3TLXA 3CISA 3IX7A 5K3BA 3OY8A 2O2ZA 2ID9A 3AJ8A 4OM7A 4P3YA 4D98A 1OLME 3T1VA 1NXPA 1VAVA 1XDDA 2GT1A 1U4OA 1TEZA 4B7CA 4CCJA 5SYAA 1UP6A 2QAGB 1ZO8A 5FUWA 1GQOA 4AYTA 3AILA 4FXGB 4IV3A 4FZRA 1QJY1 1SBNE 2B92A 3OOYA 1DQ6A 1H4VB 5E7JA 3ORFA 4B80A 3PP8A 1PGQA 3UJBA 2AH5A 3FCYA 3M5DA 1AR92 2QTRA 1F0NA 1PO7A 2FVXA 4NFSA 3AFIA 8ADHA 5IAXA 1SQFA 4IAOA 4F8YA 3NCTA 4BWYA 2D7CA 1TO2E 1JDNA 4U00A 3U7FB 2XIQA 4GI7A 1BHGA 1JXNA 4TTJA 1FMLA 3WGKA 2WTAA 3CUWA 4P3PA 2R073 5BVGB 4RD7A 2ONZA 1PNRA 3BCHA 5EJ1B 3GT7A 3ASVA 4BFYA 2VYVA 2NYYA 4O65A 3AFMA 2Q1MA 1SLTA 2OV6A 3IUJA 3ZW8A 2Z09A 4G1BA 4WKGA 3NH9A 2VOWA 4N0EA 4EG4A 5JXHA 1XCLA 5L51A 5F9MA 3AHEA 4L85A 3ENVA 4V39A 1H2KA 1U2SA 3FCEA 4OLAA 5DMYA 3RSFA 1P0MA 4IEZA 1ZOSA 4TWZA 1QK5A 4AY2A 2Q0QA 3N1UA 1C3OB 5CVDA 3ACFA 1ZRFA 2VBDA 5K4AA 1P3JA 2HF7A 4FE4A 2D5FA 1E3QA 3OQVA 3SS7X 1X8KA 3C7AA 4PZEA 1TCAA 5IFLA 4WLNA 1QOQB 2FPIB 3Q3JB 4U7GA 3PI7A 2V65A 5IM4F 3T54A 3L0IB 3WCRA 3C15C 5LQCA 3HQUA 3Q98A 4K9PA 4L9RA 5IK8A 5EJ7A 4Y20B 3Q3EA 2IXTA 4XOIA 1DIHA 1YDFA 4KSBA 2BZ1A 1PIV3 4CUGA 1ES9A 1U7DA 3IFSA 1N5OX 3C74A 2PU5A 1DDGA 4KU4A 2V6MA 4NCXA 2P5SA 1T2EA 1BWSA 2PKWA 4W9MC 5ANQA 4XWOA 1VL6A 1NLQA 4OM8A 1SCKA 2Y9PB 3GOHA 4C7OA 2VMGA 1ZLYA 3KNZA 2Q3EA 5BR1A 3QU2A 4TLLB 1QGUA 1WABA 3O1VA 3CSSA 1GZCA 3VBOB 1CAVB 3SQOA 1VG8A 2CDRA 4XFGA 2FYTA 2RAVA 3GLIE 4XHBA 2X8KA 1RINA 3GLGB 4YIKA 1X1BA 4O0LA 2VJPA 1WLYA 1QSGA 1QJEA 7GPBA 4WINA 4H7FA 5IJRA 3ZDEA 4D9KA 5HUQA 1M2KA 2C82A 5AK6A 1UK6A 4AMGA 3DFZA 5A6SB 4IXWA 2PJZA 1FPQA 2VMCA 1X15A 4JJKA 4R51A 4ZOLF 4R9UC 2PFKA 1O5IA 1EZ1A 2JJ1A 2Z95A 2HJ9A 2MMGA 5DI3B 1AF7A 2DZDA 1RZRA 1FF9A 2FXVA 2RJLA 4YW5A 5BVHB 1UT6A 4WXEA 3A04A 3T7TA 4OULA 3TRHA 4FP2A 5AQEA 2IZOA 3SM3A 1PNOA 4KDFA 5DE3A 1JEAA 1QWOA 4WW0A 3HN7A 3SHRA 1G0NA 1ZI8A 3LLMA 3AU8A 1TYDE 5FZ8A 2AYZA 3M6LA 1S2NA 3JXEA 1QK3A 1WV1A 1KMIY 2Z3ZA 4PHZA 2Y6JA 3CRNA 3A2MA 4YACA 2YV8A 2GOYA 2BERA 3DEMA 2YJGA 3ZDYB 3N3HA 3AESB 3GR6A 4BISA 5AM4A 1DDLA 4JTOA 1JJBA 5NULA 4EROA 4BASA 3R4DB 3EMVA 5FZGA 3B93A 3RJ5A 4UBNA 2VATA 5L7TA 4Q4X2 1QF3A 2W4IA 4LRTB 4FKZA 4UFKA 4UNNA 4DIDA 3DF7A 1UK7A 2W6JD 4LYFA 1FNSA 2RE9A 4KC0A 2JEYA 2NO6A 2HMSA 2C8KA 2BTQB 3J8F3 1A1VA 2X0EA 3MTEA 1XC6A 4HDQB 2QAGA 1GU1A 1V8ZA 4D26A 1J2UA 3K3NA 5LOVF 3L7LA 5A02A 3UM9A 5K0UA 1VLQA 2AACA 5ESRA 3D6MA 1WW6A 4BJ3A 3OT4A 2VCMA 2DHEA 4QM7A 2VHCA 3EFOB 1TEVA 3Q9LA 1IQAA 5IZCA 1HUQA 1NNUA 1YB2A 3RYRA 4NICA 2YDEA 2F1OA 2DFLA 1FNYA 1A5SB 1FV3A 4HXYA 2Q6VA 2ZB2A 2XCIA 3D3QA 4I46A 2PT6A 5C5CA 4K6HA 1RPJA 1U6KA 3BJZA 3IT8A 4TMYA 4WM7C 4ER0A 1XJWA 2MIIA 1O6GA 4QDTA 5G0VA 2Y4OA 1D8TA 5IDYA 1E4VA 1GGKA 5K05A 1NW9B 3HRHA 1MT0A 3BIWA 4XGQA 4DIMA 1C7IA 4XHXA 3KYJB 2RS32 1S8FA 5ABJB 1BNCA 1FJGB 2ATXA 3OTWA 2QTAA 1GANA 4CP1A 1C3OA 4PRYA 4FFOA 3O7OA 5SV8A 3KVNA 3DXTA 2FWJA 5E1MA 3R6GA 2VIIA 1MOQA 4BTLA 2P91A 3HBAA 1OCEA 1N3OA 4E13A 2W2XA 4LV8B 1QB7A 1W0PA 5ICCA 4YCMA 3N9QA 1FW8A 4BNZA 3U4GA 5D86A 3TR6A 2CY0A 3FZYA 2D5HA 3IHWA 3AETB 3DCJA 3ANLA 3I72A 3HB4X 3V4SA 3DEZA 1U3UA 5AVOA 1CNEA 2R00C 4DF3A 4I3HA 4W5HA 1JSCA 3ABZA 2OMEA 4M1QA 1Z2DA 1EVLA 4QBGB 4ZMSA 4B7ZA 1MDFA 1YB4A 2D0DA 1R88A 4MAAA 2AGVA 4DY6A 3IV9A 2AI3A 3RBXA 1TRHA 3P3PA 1T0IA 4A8JB 1SLAA 2HSEA 1ELOA 4MRPA 2YZ7A 1C8KA 4JI4B 5GZFA 3A1FA 5TT0A 3IB3A 3DV9A 2Q46A 3QSGA 4D9EA 4P6VF 1HSZA 3E84A 4CETA 1T91A 1J8DA 1XDWA 2XA1A 5KYYB 4GX5A 2EX4A 1AGPA 4ZHQB 1K92A 1OFGA 1CAVA 1LBSA 4NMLA 1EXMA 2WC2A 2XHZA 3C48A 4L76A 4MQUA 4CHTA 1RWNA 4Q9AA 2C3PA 3LF1A 3H8VA 3CV3A 3AVWA 2ZSKA 4WUVA 3HEIA 1VDZA 3RKRA 3EE6A 3O0VA 1XNTA 5DM4A 3B94A 1L4NA 4IEEA 1NXOA 4EKDA 4FKMA 5A71A 4X3PA 2PUEA 3AKRA 1SCRA 4A91A 4MVTA 5BVHA 5FZIA 2YZKA 3ADBA 2ZX3A 1II9A 5JDIA 1FPN3 1POV3 3T7SA 5BN4A 2JI7A 2HRDA 1MO4A 3ECAA 2HCTA 1XKXA 2M1XA 3P6BA 4NLLA 3HZHA 1JQBA 4GXRA 4XF4A 1HE4A 1L6RA 1WEKA 2BGRA 3OCWA 3BXHA 2VW0A 3D3WA 5LYJF 1FLVA 2BDUA 1ECCA 3KKKA 4E2FA 5AM1A 4BMNA 1SAYA 2I7XA 4D6SA 2QORA 2XDQB 4ZZ5A 1RQPA 2SNIE 4URAA 2IEZA 2B4QA 5HFJA 5CAZA 4HXCA 4KVGA 3VYVA 2LUWA 3VYRB 1WZEA 1DG3A 2VQUA 1C7ZA 1HT0A 3AESA 1BCRB 5I3ZA 2XG3A 1KJRA 1KJYA 1GGJA 1ETUA 4K0RA 5ALRA 3CQ9A 4JA0A 1RLJA 5J9FA 3OLCX 5CHEA 3AIIA 2DCMA 1PO13 2G71A 4A03A 5AKKA 2HQBA 3I9MA 4GT1A 2PXJA 1XPOA 4M7RA 1WZCA 3L4BA 3NNLA 4JKMA 4O59O 1RUI2 1YVPA 5FJJA 2FAXA 2O6HA 1NCQB 4DSTA 3NW4A 1KXZA 4ZT4A 2BTQA 1L0BA 1MJGA 1QF6A 2ZGRA 4FGSA 4GC5A 3WMGA 2IHBA 1QOTA 2D3WA 1E4YA 5BSKA 4UUPA 1E57A 1F2NA 1KH2A 1LBQA 2XJ4A 1YRYE 4FFSA 3ACBA 2DQKA 1W85B 2D3TA 3QNUA 2FCAA 4UFPA 3PXEA 1K66A 3VL8A 1W0JA 1H4SA 1AKTA 1YR1A 3AM1A 2W2QA 5C80A 1JZ8A 2JZNA 5GGYA 4LJAA 2WSLA 2WF7A 4RZ2A 1LJLA 4MDHA 3GBGA 3EFEA 2EICA 4RZSA 4FX5A 2QXTA 3WWPA 3EDCA 5CVUA 1LBHA 3ED5A 1ZZ9A 3G6WA 1QNWA 3ZE1B 4BVAA 2L42A 1JNYA 2ZZQA 5BP7A 4Z4CA 1MB2A 3E6BA 1XFDA 4DKXA 3ONEA 4DPKA 1ZJWA 2N1MA 4JRAA 2GK7A 4XZ3A 1KE1A 4LO4B 4OHZA 2HSJA 4L7VA 2Z04A 4BPRA 1L4FA 3I61A 3SK0A 2BZGA 3ENRA 1NJSA 2A73B 5FI3A 4Q3OA