2O14A

X-ray crystal structure of protein yxim_bacsu from bacillus subtilis. northeast structural genomics consortium target sr595
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
354
structure length
354
Chain Sequence
KVYQFDFGSGSMEPGYIGVRASDRYDRSKGYGFQTPENMRDVAASGAGVKSDAVEFLAYGTKSNNTFNVDLPNGLYEVKVTLGNTARASVAAEGVFQVINMTGDGAEDTFQIPVTDGQLNLLVTEGKAGTAFTLSALKIKKLSDQPVTNRTIYVGGDSTVCNYYPLNSSKQAGWGQMLPHYIDKHTFQVRNMASGGQIARGFRNDGQLEAILKYIKPGDYFMLQLGINDTNPKHKESEAEFKEVMRDMIRQVKAKGADVILSTPQGRATDFTSEGIHSSVNRWYRASILALAEEEKTYLIDLNVLSSAYFTSIGPERTLGLYMDGDTLHPNRAGADALARLAVQELKRQGIAGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-Ray structure of the hypothetical protein YXIM_BACsu from Bacillus subtilis.
rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein yxiM
total genus 110
structure length 354
sequence length 354
ec nomenclature
pdb deposition date 2006-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13472 Lipase_GDSL_2 GDSL-like Lipase/Acylhydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 2o14A01
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 2o14A02
1W8ZA 4LKEA 1DEXA 2Q0QA 4JGGA 2C24A 4LHSA 3C1UA 3UT0A 4XVHA 1W8UA 2HSJA 3BZWA 2O14A 1J00A 4CP9B 3PT5A 3ZYHA 4BQ5A 4Q9AA 3KVNA 4K40A 3DT9A 4LK7A 4M8KA 1WCUA 1W9FA 2WABA 4K3UA 4YW6A 2JWPA 4JJ6A 3W7VA 1L7LA 1GWLA 4LKDA 3DC7A 4RW0A 3DCIA 4TX1A 1W8WA 4K7JA 1K7CA 4YWAA 4CPBD 2LROA 4A6SA 1FXWA 1WZXA 1U8UA 3HP4A 2VPTA 1ES9A 1V0AA 1VJGA 2WAAA 2APJA 3RJTA 1W8TA 5BN1A 2KR2A 4OAPA 5B5SA 1HN0A 4S1PA 4LJHA 3U37A 4LKFA 3DT6A 4YW7A 4PPYA 1ZMBA 4Q7QA 1OKOA 4RSHA 3F95A 3DT8A 3ORJA 1WMXA 5JD3A 1UOJA 5CD9A 3ZYFA 3ZYBA 4LK6A 1V2GA 3SKVA 1IVNA 4JJ4A 2WYFA 5HOEA 1ESCA 4IYJA 2W9XA 1W90A 3MILA 4I8IA 1GWKA 4AL9A 1BWQA 3P94A 1GWMA 4HYQA 2WAOA 4CP9A 1YZFA 1ESDA 2Q1FA 3SLRA 2Q0SA 4BQ4A 4HF7A 1OH3A 1FXWF 1WABA 4K9SA 4CPBA 4BQ2A 2K46A 1VYHA 5A4AA 2VXJA 1Z8HA 4JKOA 1ESEA 2LRPA 4H08A 4NRDA 1PP4A 4BQ3A 4OAOA 5D21A 4DEVA 1BWPA 1JRLA 1DEOA 4JHLA 1BWRA
chains in the Genus database with same CATH superfamily
3KV3O 5TQ0A 1NM5C 5E6SB 4E70A 1E92A 2ZWPA 5U9CA 4O1IA 3EY4A 2WJZB 2G9RA 2DCJA 4YCAA 1DI0A 5K7PA 2H57A 4R98A 2AG6A 4JI6B 3H13A 4D98A 4DV7B 3OECA 4WMLA 2ZJ2A 4R52A 4YW2A 1NXWA 2Q5LA 3QQPA 3A9CA 2AYHA 4G63A 3QG1A 3UJAA 4L5JA 5CFDC 2HWYA 2UYYA 2DBVO 2JK1A 2QIPA 4KWLA 4H6VA 5E3JA 3ELDA 3ZD6A 3ZO0B 4WX2B 3QHAA 4JQSA 2J3KA 4CCAA 2DBQA 3O1RA 2JDHA 4DPKA 3DYPA 2C4UA 2NGRA 1REQB 2JC3A 4RPKA 3RJMA 4C7JA 2RBKA 1GP4A 4Q3DA 3LHKA 5DSXA 3WDWA 2NQ8A 2VK4A 2FEAA 3QEAZ 5KNDA 2ARCA 4ESEA 4ZONA 1W6NA 5EZYF 4U7FA 1D7PM 4CEWA 4LO7A 4QJBA 4OGLA 1RADA 4G9BA 1EUTA 2H2HA 3BB4A 1ZINA 3DFIA 2YXPX 3FNBA 3PC2A 2F3SA 4KL1A 3T08A 3SYLA 2ODNA 3WMFA 2PTHA 1AXGA 1JYTA 1VLHA 1P7PA 5JIBA 1WSWA 2DZDA 3UXEA 4DDHA 4XJAA 1N5JA 4P9GA 3OZDA 2C7RA 2AYXA 5LUBA 2V5AA 2GHQA 5IAXA 3RG0A 1UKAA 3THXA 2Q5TA 5KPJA 2LUOA 3BFVA 4CDNA 1ZGCA 2LWIA 1OLXA 5F9MA 3OFKA 2PL1A 1GKKA 3C5EA 4IG9A 1JAYA 3IAXA 1H65A 2I6SA 1BVVA 2X2FA 2GF0A 3L7NA 2M6RA 1XXNA 3DF0A 1YIPA 4W9RA 2OV3A 2GCPA 1G4UR 5AKGA 1E3SA 1NY6A 4XUQA 1RPJA 1JU9A 3M6UA 1FP4A 1JQ3A 3G0IA 3RU9A 4D9JA 3EHDA 1UQUA 4GOXA 1TA4A 1G9CA 1KK3A 1ZH0A 4KNCA 4WZCA 5GKAC 3H2ZA 3GQBA 3RLIA 3BRWA 5ALWA 3NUZA 4BO7A 3DMNA 1XCLA 2HWUA 3I34X 2WWUA 2VH9A 2H9IA 1PEKE 2WINI 1NFRA 3A26A 2R1DA 1JA0A 4M0FA 5KOHB 3E7DA 4DWOA 1EWQA 3EUFA 2NYUA 4A6EA 2AFRA 2YWRA 4JI2B 3WF4A 1F8UA 4E5YA 2ZEZA 3MJDA 4DXDA 2GFQA 1IXKA 1ASJ2 4RZ3A 4EI7A 1A8QA 4QM8A 3GY0A 4IVQA 3S81A 3ZOKA 2HA2A 2HADA 4Q5IA 4JBXA 4LCEA 1XAHA 5CVCA 4LF9B 4R8MA 1MOPA 1CJDA 2CHHA 3R5FA 2JG9A 1EK1A 1Q84A 3H5LA 5JCJA 3CBNA 1ZBDA 5IVIA 3QITA 4QB6A 3KKLA 1T5LA 2Z4RA 2J1LA 1SC1A 1VAVA 5CEJA 2XCRB 2R8BA 3Q8LA 3CLRC 3CUYA 3DYOA 1JZ7A 4QRIA 2I7CA 5DYGA 4QEDA 4OL0A 3PEEA 1P5ZB 1JEYB 1AKEA 3G8BA 3ZV5A 5TX7A 2IC1A 3QE4A 1PJRA 5LZ2A 4G3YC 1IQPA 1JIIA 1B0AA 3G7DA 4R8KA 5AJHA 4E4HA 1A76A 5JPNB 2R1TB 3OJBA 4DYVA 1Z4QA 1ADYA 3P27A 2VJKA 1DX6A 3ZPOA 4P00B 3IBTA 5DNDA 3CJIA 2K0GA 1E5VA 4IEIA 3ZOZA 5C53B 3RQ0A 1E6MA 2FYTA 4TOIA 3OC0A 5FIUA 1E8DA 1TK9A 4NCXA 3V64A 2JPDA 5L3QB 3J81k 1CPMA 2JNWA 1C4XA 3ZE8A 2PUJA 3TVTA 4MS4B 3IXQA 4UW3A 2VF4X 3DG9A 4C3VA 4BAZA 1F8XA 4HB0A 4JVAA 5LD2B 5TC4A 1EWKA 1HRI3 1LBHA 3IPVA 4PYNA 1YVDA 5JQGB 3GYBA 1PNRA 3PPWA 1LD3A 1NBHA 1H30A 3UHFA 5DXFA 3KVRA 1UWWA 4ZT2A 4HZGA 2XUZA 1VJDA 2I2WA 3THWA 3D2BA 3JARB 3NFYA 5JWOA 3H11A 2E82A 3VBSC 3I2KA 1X77A 2BMEA 3VKVA 2PGLA 3ZN6A 1K7YA 4D82A 3QFRA 2PZKA 2QJWA 4JHZA 1OKOA 1L1QA 4PC7A 2C4KA 3NO4A 4E5NA 4GVPA 3KAQA 2IIQA 1CTQA 1GYPA 1UKYA 3JQQA 2QS9A 3MILA 4KQFA 3O1VA 4Q0VA 1ZIPA 2OV8A 4GE0A 5I7HA 5K8LA 4LKSA 4A1FA 3FTNA 5AKIA 5AOAA 3LBIA 3FUUA 1ZM4A 2LNDA 4IVNA 3VZMA 4LSMA 1BYIA 1D2SA 4NYJR 5IJ0A 3UJ9A 5FZ9A 3SIPA 5BO5A 5H68A 1GO2A 3R6DA 1N4DA 5JAHA 2F55A 3H42B 1Q8QA 3RFTA 1U4OA 3DL2A 2RGYA 2IXLA 2W95A 1A9SA 1HFJA 4Q9JA 5LDDC 1M2EA 3M9XA 1L5SA 1JSZA 3WGYA 4HUTA 5D85A 1I5EA 3QMMA 3DC7A 2JFQA 3P0JA 5TPWB 1PS8A 4CCCA 3NAGA 4B3JA 5TPZA 1U8UA 2VNRA 1X9GA 5UKDA 4FJ2A 3JATB 3ZIXA 4CKCB 3EPRA 2IEAA 4DRZA 2HYKA 1CBUA 1WB4A 4A7ZA 2H8GA 4IQ0A 1E2IA 1DC8A 5FTNA 4KO2S 1B3RA 3ZZ0A 1WEHA 1ESMA 4FLEA 1B26A 4EO4A 4Q19A 1OJLA 1N8SA 3G7NA 5FA6A 2EP5A 1PL8A 1IXRC 3FFZA 2OGTA 1S2OA 2C2BA 4LZAA 3BWVA 3KEGA 5THKA 1AV6A 4EJFA 3I2IA 3L9JT 4UEOA 4OLJA 1QO9A 1V1MB 4FZ5A 5GV8A 5JTUA 3SCGA 3KV4A 3FLTA 3OB8A 4GWLA 1U3FA 2SLIA 5JMOA 4QM9A 1MDFA 2HU2A 3HYLA 5JAZA 1BE6A 3IAS1 1OLSA 3FZQA 1O08A 2WC2A 2AMLA 3LY8A 4PBSA 3EWAA 3AF2A 4CGZA 2NZWA 3AZQA 3HMQA 2CV6A 2QMUA 2JHGA 3U4SA 4KN5A 4I14A 2EZ4A 2G28A 4CIVA 2VQFB 3ZPXA 3G02A 2DPHA 4G24A 2GSDA 1LBQA 1FMTA 3WJ7A 4RHFA 2PQMA 3MI8A 2R6QA 4M53A 1NG1A 2QW1A 1DAMA 4JMPA 3LFMA 4V1CB 3O31A 3BGIA 3N9PA 1HBJA 4QB1A 4AUNA 1XZIA 3C3EA 1E1QA 1BC5A 4XCAA 1JQEA 2VTKA 4JBGA 4PAQA 4EECA 3P9YA 4NDAA 1L3CA 5ER9A 4L0PA 3R4VA 1PN3A 2WVAA 1DXYA 2QP4A 3N58A 2YWEA 3PC8A 4QBFA 5I8TA 1LV7A 3K9HA 5AJVB 2FZVA 2XLBA 3A06A 2VDQB 2P1RA 2XUQA 3GLHB 3ANTA 3N5KA 3NBUA 3B3AA 4ARCA 4RFLA 4BWOA 3U3DA 2O2YA 2NZUG 2HGZA 1BEUB 2C77A 3MS2A 3TOCA 4W9NC 4Y2JA 1XZBA 2CXPA 3RS4A 2ZRQA 4NJMA 4EMBA 5LYJB 1S8FA 2XB6C 1P91A 2H7YA 3U31A 4CKBB 3G5LA 3MS4A 5FZCA 2FSFA 4EIWA 2GGSA 1GVHA 5CHYA 1UR5A 3STVA 4U7JA 2YJGA 4BHTA 4MR9A 3S5JA 3WWYA 2C54A 1LPOA 2GUGA 4CCOA 2HTFA 1MFZA 3EOAI 3WLRA 4YY3B 1JODA 2V9PA 2P6OA 2CWMA 2AOTA 3V55A 3HYTA 4JKIA 2YZ2A 3PA6A 4FDAA 2GO7A 4CMKA 2IU4A 1ULTA 5KWJA 4QPPA 1DQ4A 3WNMA 3VV2A 4MP8A 2I2AA 2JGDB 2QQFA 2JW5A 3FMVA 3PKJA 3HQXA 1MA3A 2E32A 1R6AA 4L15A 1WLWA 1MACA 2UYOA 5DXAA 1ASJ1 1AZDA 3GT4A 4TMFA 2HJWA 4X1IB 2GCOA 1JHAA 3JZAA 1WTAA 1QDLB 2B92A 3GVPA 1RWPA 1IQUA 4K9KA 1DDOA 3LWNA 2QRUA 5LB4A 4NU8X 5J2TA 4I01A 5FOSA 5KC9A 3A6DA 3L7MA 3SE7A 5HK8A 1U5BA 2QORA 4ZCPA 1W0OA 3SJBA 1H94A 2JJ2D 3EXEB 3QW2A 3ZJ5A 1QO0A 1XZCA 4R9AA 1Y3HA 1HM5A 2AJ8A 1RW4A 4AI2A 2IYYA 2ZUFA 4FCTA 1U5ZA 1OSNA 3G9QA 4OHCA 3HEIA 3G8YA 1CP3A 3RPEA 4W1QA 3D7SA 1RYMA 3ZR6A 1Y6ZA 4RTRA 1YQ5A 1TO1E 5ACA2 5ECGC 4Q4Y2 4HMPA 4E46A 3IDAA 1MS8A 3QA9A 3WLPA 4RPIA 1ORDA 1VE5A 1SOWA 3C85A 2FSUA 1DGWA 3TNLA 1I1OA 5IBQA 5K8UA 1YB5A 4TYWA 5FOQA 1JDVA 1HE2A 1T9HA 3HY6A 1KJRA 4L5CA 3MDPA 1L1FA 3RRYA 3AVRA 3POGA 3IEIA 3BB1A 2MSCB 1PS0A 1WPGA 2C5BA 3R3XA 2R061 5KTTA 3TKYA 2X5KO 2HWD1 4CEYA 5LA0A 4AD8A 1KFKB 4BO3A 5LP6A 1YZQA 3H1WA 2GILA 4QQKA 1ODNA 1Q19A 3TX6A 3COPA 1C30B 1UJMA 5JARA 5BN4A 1EWRA 3CJQA 4H6PA 3PFBA 2J3IA 3RAFC 3SF8A 1QIDA 2ZIVB 3OO1A 2B8MA 3BGOS 4Q47A 2VHXA 4KRXA 4B2IA 3P2MA 3VNVA 1NT0A 1A4IA 5CFDA 3LDRA 4WLUA 4CTKA 1I7SB 1XC6A 4LV5B 1KQNA 4JI4B 4OSPA 1D4ZA 2FN7A 3PQ2A 3B1XA 1SQ0A 3VU1A 2O2SA 4G89A 4HNGA 2XJRA 3ONDA 4ZANA 3ND5A 2OAP1 3D31A 5CZKA 1DBQA 5A7WA 1TMF2 1MXHA 5I7SA 4X24A 1K5JA 3IR6A 4QO7A 3VAYA 2MHFA 4P4LA 4BVFA 3U3KA 2ZYSA 3SXPA 2F59A 3TSYA 5IUQA 2BCEA 3BKWA 1TYEB 2FD8A 1QGDA 5C3QA 1ZBA3 4CXMA 1GJRA 2IU6A 4MS1A 1FTYA 1XQXA 2C7PA 5EE1A 5AIBA 5AM0A 1DZ3A 1ZR4A 1V16B 4CLEA 4LJHA 3EGWA 1H6DA 2XWJB 3F6SA 1M6WA 3A6KA 4A0RA 3K0FA 4TKZA 2XMSA 2QG9A 5LQAA 1D6SA 1IGOA 4JLWA 2V8OA 3VSBA 2ZJYA 1NSFA 1XZPA 2NW6A 3A4NA 1K7XB 3SLRA 3T94A 1ZJ4A 4EPRA 3AEZA 3GT0A 3LU1A 1ZQ1A 2QN8A 3CR8A 2ZBEA 2D44A 1SQ5A 1V1RB 3WIVA 4FGZA 3JPWA 3OT1A 2BBWA 3ZVRA 2XJVA 1NF3A 3D3JA 3L8ZA 4M76B 2QVCA 2JGMA 4ZEOA 3OC6A 4MR7A 2VL4A 3BZBA 4QDJA 4H7KA 4AKSA 4LDRA 3Q3IA 2ADFA 4M4RA 4H3VA 2CEAA 3SHWA 2MMCA 1XTSA 1XE8A 2VK2A 1P1RA 3VBHA 3ZUGA 3EBOA 4KQ6A 1KH3A 2R30A 3BD8A 4B1MA 1OA3A 3IQFA 4CKZA 3D4PA 1J9EA 2IUSA 3QE2A 2R7AA 2FZ4A 4RD0A 3FLMA 1UMZA 4TXMA 1Z3CA 1Z82A 2RIRA 1JQJC 2V7TA 1EDBA 4QEKA 4LC1A 4DNXA 1UADA 5JAXA 2HYXA 4Y9RA 3ZX7A 1NYQA 3ZU6A 3L7AA 3EF1A 4NEGA 2ZSIA 4ARAA 2ATIA 2ADDA 5B1IA 4CMEC 3DL3A 3RS9A 2UUBB 2V1UA 4C5AA 2YMZA 2QX6A 3QU5A 1R8SA 2NQTA 2VHCA 3W9SA 2WD7A 2E9SA 5HDQA 5FWXB 1N5RA 2GZ2A 3QPBA 1A7UA 1Q7TA 1N2EA 2D13A 5J4LA 1ZI9A 1WQ1R 1HX6A 1GZCA 3MPOA 4BZWA 1BCRB 3P4XA 3RU7A 3UC9A 2JKXA 1ZA1A 4DB4A 1TJ3A 3LQ2A 2EFGA 2ZITA 2IHNA 2WHXA 4F7DA 4EE2A 1UK9A 2WYIA 3WK8A 4F4UA 1QH1A 4BO2A 1W6PB 4Y0VA 1IB0A 5DG1A 3AYZB 4YIHA 2HCBA 1HB2A 4O2BA 4MGHA 2J3MA 3FA2A 4KMOA 3KHUA 4P9LA 1KE2A 1XMQB 3RQIA 5DN9A 1RUJ1 3I28A 4TTSA 2E9QA 3L41A 5IYZF 5K5EA 2GHTA 4XF1A 4AAXA 1DX9A 3K9BA 2R1ZA 1G8WA 5DG2A 1H6XA 1H9AA 3ZLVA 4I4CA 4QHTA 3J8F3 5JLJA 2FWIA 4LEIA 3CCCA 2WYHA 4RIIA 4FFSA 4OXNA 4YCMA 2XHNA 5C4WA 1C3EA 1Y6JA 4XQGA 1F9AA 2B4KA 1UODA 1M8FA 3KPJA 4NYMR 2EOAA 1DIAA 3ED5A 3CUKA 3MINA 3ECQA 2VVEA 1GYRA 3AKDA 1CERA 1TEHA 3AFNA 3UKDA 4L74A 2VK8A 1VYTA 4RKQA 2Y6HA 1NASA 2KD7A 1PWHA 4G4GA 1E61A 2GK7A 4YRBA 3KWFA 5EE0A 3U0BA 3GFRA 3X0DA 4G0UA 2OUJA 4A6OA 3QXXA 1LPAB 4U7GA 4PBPA 3NKGA 5T3UA 5I9MA 2D97A 4IERA 3NNNA 2GXAA 2MIIA 3ERCA 4IGPA 3D1VA 3E1GA 4TXHA 1QZXA 3Q5DA 2AG5A 1UBJS 3LBNA 2JFNA 5C2JB 3R0XA 2GJSA 2K46A 3JQAA 4XOGA 2XDVA 4OATA 4HOOA 2GJKA 3H8RA 2FSVA 2V09A 1R3UA 3FR8A 4FSXA 5ICSA 4UI9L 4GQ7A 3ORHA 1WUTA 5HZMA 1AL22 4R71A 1KZ7B 3UJ7A 3RVPA 3QLTA 1NYRA 3K6JA 1OF4A 1L7LA 2PLRA 2MPFA 2PKRA 1C1LA 2D4AA 3HAGA 4K6CA 3ZBUA 4XETA 4CI0B 4YAWA 1YI9A 2WZ8A 4A8TA 1HH4A 2BNMA 1NUSA 2SBAA 3NBQA 2XVXA 3II6X 3Q7QA 1PLLA 1LVUA 2Y66A 3RYIA 4TRRA 4QX1A 4IPTA 1XPOA 1U0SY 2W4MA 2N7GA 3DYIA 1W87A 1GOGA 4P38A 1QTRA 5K0SA 2G3YA 4HNTA 4BLUA 3AL0C 3JASA 3ID6C 1T1RA 2ZWIA 3CH4B 3LCUA 2A0WA 2PUCA 2AZXA 2R65A 2WNSA 2R7EB 1LUAA 2A59A 4XWYA 3OM8A 3W8RA 1Y1SA 2YJ6A 1IOAA 5AJTA 5AKEA 3GUHA 3ISVA 1ZSVA 1SWWA 5A0VA 1CF9A 4DQAA 1Q20A 3WQHA 1OZ0A 1UZAA 3B38A 4INOA 4XVHA 2R66A 3OOHA 2PZBA 3NNMA 3OIVA 5G04L 3EW7A 3O90A 3WDTA 3FR7A 2CE7A 3H3UA 2WR9A 1L4UA 1YB6A 3TRIA 1KYVA 4GDMA 2Q5QA 3JV7A 5IS2A 3SJAA 4HVOA 1Y1TA 2NTVA 2B7BA 3P3NA 1M0TA 2OCBA 3MPBA 3O12A 3OOEA 2BKLA 2VXBA 5ICGA 2EZTA 4V0OA 4AZ0A 1G86A 1AX0A 2N1MA 1CETA 1SZBA 3EFOB 4N53B 4IICA 1LK5A 3ZQUA 4ZFNA 3HU5A 5DP2A 2WYSA 4K1LA 1Y89A 4ZYWA 4YI3A 4MPPA 4FFBB 5LLTA 5KUTA 4HEA1 1QU2A 5I47A 4W6XA 3AWDA 3IMFA 1Z63A 3A9SA 3KQRA 4AFNA 3CZPA 3E7PA 1ZL2A 4LVUA 3IDSA 4F9EA 2YVKA 3O91A 5AM4A 2DWRA 4O9EA 3R4UA 1VKZA 3A4VA 4HPKA 2Y93A 3GCXA 3CRNA 2RHOA 3VV1A 3E3LA 1KI1A 3SIXA 3TPCA 3IIEA 4JFRA 4NS4A 4OHZA 1BEEA 5A3RA 4QPDA 5H3CA 3CZ5A 4IUYA 3SJUA 2PCLA 3M6LA 3CNBA 5LRSA 4O4JF 2H2DA 3ZGOA 3S4YA 5HM8A 5LATA 4Y9TA 5DEOA 4P86A 2QQWA 5ESXA 3AM4A 3TEMA 1MGOA 3HHEA 4Q1PA 4NBUA 3IEVA 4FPGA 1J3QA 5LL6P 3LPLA 1R0SA 4CF4A 4XDHA 1UKRA 1JW6A 1YIOA 2OKCA 2OTCA 3RD5A 1JL3A 1QCZA 3E23A 1A9YA 1ST8A 5DFAA 3LC7O 4HWOA 1I94B 1W94A 1SCIA 1H8VA 3OPYI 3F8TA 1ZBA1 3UMYA 2H3HA 4DA6A 4QDZA 1JIJA 4Q93A 3UAZA 5JPMB 1A9OA 5FCCA 3PJYA 2GYUA 2O3SA 3AL3A 2X86A 1NJ2A 3KV9A 2VBCA 2QR3A 3VJMA 3X44A 3IQXA 4QKNA 4CV1A 1S3FA 1E9BA 3WIDA 1KY2A 4YACA 3N8NA 2ZBJA 2E7AA 2VGDA 2QRQA 1M8JA 2JDNA 1PK6B 5A02A 5FPUA 4DMLA 4MTCA 5EESA 2EC5A 1LPMA 3K8OE 5BN5A 3E8MA 4MPRA 2IJGX 2IHBA 3K2IA 4EPTA 5KHLB 3I8SA 5KJFA 1OXSC 1X8XA 2XCUA 1JFVA 4LF6B 3KTFA 1G8HA 1W19A 2IPAB 1FNYA 4Y20A 1P5JA 2B1GA 1QVVA 3RSGA 1I0LA 1EHCA 1Y48E 4K81B 4H08A 2DUUA 5AKZA 3FWZA 3G17A 4HVTA 2YIVX 3OSDA 3INRA 4IOMA 3B3FA 4XGRA 2XYVA 3N9QA 1ISHA 2Q6OA 3KUXA 3VISA 1I3CA 2VH5R 2I2FA 5FYQA 4BJ3A 1VRVA 3U11A 2OC4A 2RHJA 3SFVA 3PL1A 2B5WA 1U7DA 1EQ2A 1N3OA 1WHSB 1TCUA 4TZ6A 3NEPX 4YV1A 2R44A 2R6GA 3TOJA 4ETNA 4WXYB 1OBFO 4AKTA 2XSZD 1TAGA 4A8PA 2ZYWX 2QUIA 2Q1SA 5K0BA 3GJAA 1ZQ9A 2ZJ7A 3H3FA 2GZHA 3TZEA 5TV2A 3TUZC 3PHBE 1CY7A 3KTOA 3SC2B 3QELA 1DQNA 1O94A 3EIEA 4PWZA 2WQ8A 3IPLA 2YZNA 3COWA 1NLFA 4BQ4A 4NENA 4F4JA 2PAAA 3M6MD 4M3CE 4YRQA 2W6JD 3FTDA 3ZNQA 5F5AA 3WTBA 3KCCA 4E2XA 4AZ3A 2O2DA 1Z6ZA 3FE2A 3TLXA 1GDDA 1O3YA 5BSFA 1L7VC 4YM0A 2JGDA 4QPIC 3NTRA 4P0QB 1D0IA 1WQ4A 5FZGA 1YAHA 4BECA 4TSFA 1KSJA 3IA2A 4NWWA 2JCGA 3H2BA 4KWCA 1EVKA 2ZUCA 3DBIA 3SHOA 2MYNA 4WIAA 5K7SA 4U2DA 3GU3A 4HGQA 4FTWA 3BIWE 5EHZA 1ASJ3 2WD7B 3C4VA 4F04A 4FX2A 5DBGA 3T7EA 5BW8A 1FFWA 3HN6A 4J1TA 2I87A 2XUPA 2BEOA 4H15A 1NF8A 5AW8A 2FNAA 5ACA3 3TIGA 4H0CA 3PRHA 2IP4A 3M9WA 4N7IA 1EAH3 2PNJA 2YRWA 3MV11 1L7XA 2HRQA 4ZCRA 3KQLA 1KK0A 3ZDVA 4PYMA 2AG1A 4OUDA 3WQRA 5FPTA 4IVRA 3PWZA 3ZDAA 4GLJA 5FO0A 1RTKA 1ZOSA 1LV8A 3HHPA 3AOEC 4MQEB 3P1JA 1SXJD 4K5QA 2XI4A 2ZGPA 2ZAOA 2D1FA 2FOXA 3VKFC 1H6BA 4ER5A 5CB4A 2RM23 1JX6A 2P4UA 5DO9A 4AROA 3WA6A 1DKLA 2HGSA 2A6PA 1P6UA 2CXTA 4ZDJA 2OC9A 4HJXA 2IZ6A 3AR3A 3BIJA 4B7XA 4ZJPA 1T4MA 4TTRA 2BIFA 1XJ0A 2QTCA 4MUNA 1E2UA 4HTFB 5JC8A 3MA0A 5HNKA 3TEJA 2PLV1 2ZPUA 1NA5A 4JLBA 3AU8A 2FMFA 3CJXA 1R6XA 4Q9KA 2RVAA 1PRYA 4ZXEA 4RH3A 4IEUA 1OZAA 3CUVA 3ELUA 2NAPA 3VDQA 4UTOA 4ITVA 1EXWA 2RIPA 3SX2A 1SBQA 4KKXB 3V4ZA 3R6LA 1JIUA 2VRBA 2Q5OA 1SG6A 5IH7A 2BKXA 3O3OB 3BTAA 4NFHA 2IHTA 4PXSA 1THZA 3D4OA 4JVOA 4YG6A 3ORRA 1Z6GA 3ITQA 1ZG3A 2BHLA 1NUTA 2E0IA 1H1MA 2BY4A 4RGGA 4BISA 4QHSA 4MVJE 1TZKA 2HJSA 4P58A 4D9EA 1Q2XA 4HPXB 2EF6A 2ASVA 5FJIA 1U0OC 3KLOA 4Q9IA 4KXVA 2AG0A 3DAFA 1TCCA 3UHAA 1IQ0A 5ERYA 5ELMA 2CKDA 2HCFA 2OCKA 4XTMA 2QTMA 4RETA 3DFKA 3GRVA 1V0AA 4E6EA 1YDWA 4GIBA 1RXSA 1ENZA 1LA2A 5BYBA 4OLFA 1T4CB 5J5VA 4CDXC 3UT6A 2YXNA 4R9RA 5F21A 2YUEA 5J4VA 4N5IX 1EFKA 2VOEA 5GLTA 1RFLA 5JZMA 1IMOA 1PZEA 2C95A 4TLEA 1M2VA 2RH5A 4YQYA 2YH2A 1UKEA 3NGLA 3KUCA 1MEOA 3MJTA 1PV2A 4AKIA 4JI3B 3OG9A 3K4HA 1RJ8A 2E49A 5EYXA 2B98A 3C87A 1VSTA 4EK9A 2XBUA 5F7XA 1QIIA 1U28A 1WCKA 2CNWA 4CP1A 4BFTA 3SZMA 2HK6A 2Q3CA 4TMXA 1P9OA 4GI7A 3RS5A 4CTJA 4JLUA 1I51A 1V25A 2VMIA 1CR2A 2J9FA 4Y9DA 1XG5A 2PGXA 4IFIA 1AYN3 2ECOA 1D6JA 3FBYA 5A5VA 4P80A 1HE3A 3VDXA 4Q8LA 2DSNA 2LZ0A 1UW8A 1K6IA 4RJLA 4D0GA 1NZJA 1QDOA 5K9YA 1UT8A 1UD1A 4F85A 5AC91 4XWOA 2PD4A 4KAXA 1RQNA 3HCOA 3DXXA 3BN6A 1OFGA 1HE1C 4NXNB 3ON5A 1GFWA 2ZSJA 1BXRB 3LTEA 4EZEA 4XUTA 1VE9A 2Y0IA 2LW8A 1WBDA 3SH4A 5L7OB 3S1AB 5A3NA 1FU4A 2YHIA 1VRWA 1URPA 3ZN4A 4ZJUA 3BEDA 4ITUA 4WXPA 4ND4A 1PIV3 3DCNA 3ZEAA 5C5TA 2C03A 2WVGA 1WOMA 4CDRA 1EFTA 1Z36A 5FPYA 4Y67A 1RUI3 3AGPA 4B83A 4CEHB 4N01A 3N53A 4RAOA 1K68A 2VNOA 2D0IA 1O9HA 3ENQA 1DQ5A 1MMFB 2H1FA 3PCXA 4ND3A 3CEAA 1FMJA 3B60A 3G6WA 1W0JA 2VSOA 3UG6A 2XJ9A 1YQQA 4WY2A 4AJNA 4I5DA 2X22A 1YRQA 1H8TA 1AYN1 1CF2O 2AT1A 4R2LA 4Z4QA 3RYRA 1IN4A 4L57A 2JDKA 5HQJA 1CVNA 3NO8A 1D8TA 3WF0A 1KZYC 5FZHA 4FKZA 4U36A 1UOPA 5JZBA 3K4AA 2H9YA 3E6DA 1ZWKA 2J6BA 3GWGA 3KKEA 4KK4A 3NHFA 4MW4A 4HC4A 2Z1MA 5ICCA 3VX4A 4XSVA 4HAWA 1AX1A 3TXYA 1JI6A 5P8WA 1G60A 2PBLA 3CIHA 2O07A 3DZBA 1V9CA 3R5JA 3UAGA 1GL9B 4R8LA 5BYJA 3B1VA 1GXSB 2VKQA 3RSCA 2PX4A 1P4AA 3BHMA 4HLNA 2YXLA 4M1SA 2JIOA 5JI7A 4PCRA 2WLQA 3TF5A 3CSDA 1LCLA 1I7LA 2XRMA 3UUFA 1N78A 3ZXEA 4CEWC 1KAEA 5FP7A 1Z0AA 2O3QA 1Z0KA 3G8AA 1RIIA 4RF4A 4S2EA 4ZO4A 2XYGA 3BIEA 3UT5A 1A2BA 4K9OA 3DE0X 1MBZA 5E2BA 2V8BA 2QD3A 2PBZA 4M0KA 1QJX2 4Q12A 4R3WA 3GF6A 3OESA 5A2QA 3MF9A 1AMOA 3NQHA 5LM3A 2VYND 2A70A 4XYGA 1E57A 4R6XA 3K32A 1YJLA 2OLKA 3SH3A 1JPNA 4I4TB 2WFF3 1CC1S 2OBYA 5F1PA 2ZQZA 3AZWA 1AR62 2PH3A 4JKYA 4LOHA 1QUEA 4X20B 2GEUA 4G9EA 4Z7QB 3FPKA 2BGNA 1EP3B 2BEKA 1GSHA 2G06A 3OTQA 1AYN2 4ZP1A 2YHSA 1LC0A 4D80A 4P32A 1L3IA 3WNQA 1E3IA 5D1NA 3DFFA 1L8XA 2HWF2 5J43A 1GZ5A 2XHEA 3GBFA 3RI9A 3DZ8A 4ARBA 3N2KB 4URFA 3NIDB 1NW6A 1DQ6A 2PXXA 1KPIA 4TWJA 2IITA 4LUKA 3EYPA 2EATA 4MB2A 4LKDA 2HQRA 1GU1A 2ZAHA 1XCJA 3IOBA 4GYWA 3GLFE 3DPRC 4H7HA 3DYVA 1PO22 2CWWA 1KC1A 1QP8A 3FWPA 1DQ2A 4GBED 3FHQA 2A84A 4GLLA 5ALSA 1ANKA 2Y1XA 5GZCA 4QPIB 3JU9A 2CY6A 3KR9A 1JI3A 2W2XA 5C3MA 2CMHA 3KJXA 4JT4A 1XELA 2YFYA 5FBWB 1D0GA 5AMXA 2ZUUA 1Z39A 3RK1A 4OM7A 3ZHZA 2AYZA 3N2EA 3RABA 2P7HA 3ES4A 4ZALA 4UD6A 5BUCA 5EQJB 3P2YA 2XBMA 2R1VB 3HKCA 2JKZA 2XWPA 2NUTB 3L3BA 1N9KA 1DEOA 4MJ7A 1XJCA 3FDJA 3L79A 5EEGA 2W6CX 1P4HA 3D5EA 2OXBA 3ELNA 1YQXA 5BWOA 5M04A 1W5SA 1E79A 1LHOA 4UBHA 2Z8XA 1CUBA 3MOSA 5KHGA 3IUSA 4LSZA 1EYZA 4YMIA 4M37A 4LISA 1GNLA 2WKKA 3S28A 4C7XA 2Q2VA 1I3KA 2H54A 3NGXA 1JPJA 2ZATA 3LVFO 2DVMA 3OOWA 1AJEA 4YFZA 1VHQA 3B1YA 1R66A 1SH7A 4CQMD 3OLCX 1FVXA 2BPOA 4D8TA 2VWQA 3R0JA 4X61A 1F6DA 1W85B 3I6YA 4JRLA 1ID1A 4ZTUB 5DDIP 1QS0A 4II3A 5FP9A 3MHTA 1YO6A 4Q3KA 3EFOA 4O29A 3M5DA 4BZZA 3VGIA 1JUDA 4I5GA 1MW8X 5JAMA 1DBSA 3WCRA 3GWZA 5AOCA 1MB2A 2Y0DA 2FZCA 1A88A 4TSVA 5AD1A 1GZTA 2QZZA 2O20A 4DXTA 1WKBA 4KBFA 3DECA 3HZOA 4BA6A 5JC1A 5BT9A 3OZAA 3V7UA 4W7IA 4FQ7A 2GZSA 3G88A 3QBVA 9MHTA 2ERXA 3N0XA 3DJFA 2AJLI 3OOXA 4AW7A 1AH2A 2Z1DA 2VEOA 3EZYA 2BP7A 1QXSA 4NCNA 4B40A 3ON7A 5I7OA 3JZMA 4GMP3 1NULA 2QL6A 3C8HA 1A5TA 1OHHA 4GGMX 4QBKA 3BCHA 4A73A 1VKJA 3B1JA 4JGZA 4R9DA 4ERNA 3ZFEC 1ZJWA 4GUDA 1BMV2 5KYVA 1ADJA 3KEFA 3INAA 4CQJA 1AK1A 1K5DA 3KX2A 2WMOB 4BV3A 5ES3A 1KPHA 4GAEA 2EKDA 4QJ3A 3MEQA 4QGHA 3AR8A 3TFQA 1DJQA 4IDAA 4OH1A 1TVMA 1WB9A 4YRZA 2HLDA 3A7DA 3L8DA 2EXHA 5KBYA 3N8GA 5I7RA 3LKDA 4PIPA 3KVBA 3IAM1 4KXNA 1AYM1 3P1IA 3NHPA 2V96A 2IF2A 5DUXA 5IK7A 3NC1C 3PXCX 2QSZA 4ON9A 3HMYA 4BASA 4P2GA 1YD7A 2BV4A 2PFWA 2CAUA 2HHJA 5TVGA 3MIGA 4GFDA 1TZOA 3D3EA 4BN5A 4PDWB 1T34A 5HZHA 1JQ5A 4OK5A 2J3JA 2Z2SB 1J99A 2AOXA 1H2BA 1CY0A 4HZUB 3ULKA 2X13A 3PQ4A 2W48A 2FDXA 2WF7A 1QMPA 1TAQA 3HDGA 1SZPA 1TMYA 2WJAA 2JAHA 4AO8A 2IXDA 4TSRA 4XQ4A 4F2PA 4AI0A 3GRYA 3X1DA 5C8VA 2V7XA 3ESRA 4J9VA 5HGJA 5EY5B 1NLSA 2QUBA 2I2DA 5K8JB 2BFEB 3ZYCA 2QVGA 4UQOA 3W6UA 3I01A 3FETA 1XZJA 4XACA 2EBFX 4DWJA 2ZX2A 4JAAA 2CLOB 2FDCA 1A71A 4CYDA 1F6BA 1ZNWA 2G8LA 4ZN6A 3UH0A 4GMFA 2P91A 1O6ZA 2CB0A 2QPOA 5C3OA 5FL7A 1J0EA 3ASIA 4NSNA 1MOSA 1W76A 4QYIA 2ZX4A 4MGZE 3BT7A 3V5NA 2RKBA 2VC2B 3HSYA 1UL9A 3CLUC 4OJNA 4Q4DA 5A5EA 1VBA3 3I62A 2VZ8A 3DZJA 2ORED 2QRPA 3KYBA 4JLOA 3TB6A 1W88A 5H16A 5D3MB 3M33A 4JV4A 2Q5IA 3AI2A 1G8FA 4BEJA 3HCRA 5CB6A 3M5WA 3GPLA 4MPJA 3V8PA 3AUYA 3BK7A 5TB5A 2H0AA 5EQTA 4ZV4A 2ZBQA 5DZSA 4ZTZB 3ADKA 5K4GA 4AQ2A 1FSSA 2ZZQA 1MS3A 3UL2A 2WLPA 4DZZA 1PR5A 1SVNA 2CV2A 1PI3A 1WS6A 3FNRA 1MJNA 3T0BA 1P61B 3QEKA 3LC0A 3IQEA 4HFSA 4W7SA 1XFAA 3E5NA 5L7OC 1MR5A 1H66A 1PCXA 4G0QA 1RUG3 3OFSA 3KQTA 2DUWA 3R4DB 1O9BA 5C34B 4ZJYA 3UUWA 1N8KA 1K6MA 4H2DA 5BNPB 2C4VA 3BVPA 5IVJA 2Q8QA 1TMF1 1W9WA 1HORA 3IJRA 4IG4A 1O6GA 3WE7A 3HLTA 1DZTA 2O0OA 3TZ6A 5FRAA 3IDBB 2DTXA 2H1HA 5GY7A 1KDOA 4ER3A 4JLDA 4UVHA 1FI2A 1YNAA 4DEQA 1PSWA 3G0CA 1U3DA 1DP0A 1MB9A 3KTAB 3LWCA 1CY4A 4W5OA 2WSLA 2DFPA 1VBE3 4M83A 3AETB 3SC3A 1P0MA 3NOXA 2VLIA 4ZCTA 4CFSA 2HLNA 1Z8NA 2HRCA 2OO5A 1RVF1 4IYJA 1OFSA 4CEWB 2GCNA 4JWKA 4HFRA 1LOAA 1DDIA 4EATA 2Z2ZA 4MIOA 2R62A 3UUEA 2JJYA 3A1DA 3UQYS 1Y43B 4GMP1 1KJJA 2FEKA 1RMYA 4QREA 3B7MA 2NU6A 5COQA 2QM3A 4PTYA 2GD1O 3FAKA 2ATCA 3X1JA 4DUVA 3FI9A 2AC4A 1SKBA 4C3UA 2QGZA 1KH2A 5ALEA 3BGSA 3NALA 5G1PA 2EWMA 2W1SA 4HWTA 5JS1A 4YBRA 3KETA 5FBZA 1MAHA 2I03A 3EDOA 1ND6A 3IMCA 4DPLA 2VPVA 3TVDA 4UHHA 4Z4HA 3OHSX 5KEIA 4J0CA 3B3GA 3JQEA 4REMA 5B30A 2VY0A 4IOLA 1MP0A 5GZDA 3WLHA 5LLSA 2ZU0C 2JH3A 4QUAA 1RKUA 2VUTA 4BEVA 1Y8CA 1Q0TA 2BFWA 4H3KB 2JEZA 3AEYA 3I3OA 4EX6A 4IMRA 3KSBC 2GKSA 1S3SA 2A33A 4JLJA 2IHVA 4M7OA 4QWMA 3B89A 4JBWA 5EWLA 3F3YA 3TLCA 1EZ4A 1G8MA 4EPVA 1P81A 2YYYA 4GXLA 2C8LA 2W2PA 4OZXA 3U1XA 3UWPA 2WFF2 1V35A 3A11A 1NY5A 5A3SA 1REFA 1N6NA 3EBRA 1BHO1 1SB9A 4OBWA 4QPCA 4B3FX 2JDUA 1TZCA 3VVBA 2OCAA 5AVJA 4WBNA 4B4QA 5LWBA 3H9EO 4RIHA 3IYLW 1DU4A 2V3WA 4ZYLA 5DNCA 2FOIA 4LIPD 4JTNA 1Q6YA 3PZRA 1T3HA 1CDDA 4BTLA 3C39A 3CIOA 3DL7A 4YMGA 4CCSA 2EV9A 2H2FA 2VNSA 2Y99A 2ZRGA 4DLTA 4YAEA 4LRUA 4UATA 2X8KA 4DV5B 3JYPA 3VKFA 2Z9DA 4GI5A 4UMFA 5LOVB 1T6NA 1RQRA 3ZYBA 4B71A 4DLAA 1DTSA 5F77A 3DO5A 3W0LB 3T4EA 2FBEA 1T4CA 3PU6A 3AX4A 1H2KA 4GMDA 2BE7A 5I7WA 1E7QA 1UPAA 4XM0A 4DCNA 3A05A 1UO9A 1K0UA 3GARA 1S3IA 1GUBA 1ZMTA 3TEXA 2VJNA 4JDPA 4UCFA 3M3PA 1G8KA 4YCLA 3WD5A 2K87A 2D54A 3HVHA 1KJZA 1KSGA 4C90A 4CDWC 3LUBA 4FPJA 2GEJA 3IVRA 3EAFA 3A9UA 2ZPAA 2ZB7A 3E9RA 1DUIA 3KDAA 4ITRC 4XQ9A 5AI9A 5LQMA 4N40A 3RC1A 2OA2A 3EGXB 5EXDA 3P0IA 4MVJP 3O8RA 1ZRCA 3AJAA 2DFVA 4O2AB 3U4AA 5JSOA 2YWFA 3OPNA 4RJJA 4U8HA 1PIV2 1YGYA 2X9LA 1TNRA 2PJDA 4I50A 4KFTA 3EEQA 1AYM2 1O03A 1KQGA 3TOSA 1XNTA 1KY5A 3CLHA 3SEPA 2VZ0A 4J0HA 2BGWA 1DSSG 1XQ9A 2P2CA 4XMAA 3TSAA 3FPGA 1I6LA 3DVQX 4RPGA 3HN1A 4B3RB 1BD4A 3K2QA 4EUSA 3DMDA 4ML3A 1QIGA 4UEKA 3IPVB 1WEKA 2QMYA 1ULOA 1AC5A 3NDPA 5FA8A 4HFJA 2NG1A 5L3RA 3ZGNA 4TM8A 1NBMA 5GZFA 3WKAA 3PNMA 1XYOA 1CRQA 1H0KA 1W85A 4QD2A 4KL8S 3EDQA 3UGJA 3OKAA 1FJXA 1X39A 3H11B 3ZXAC 1CUFA 1RAFA 4AJHA 2BQPA 1GFSA 3BOSA 3C48A 4JP8A 1GQHA 4QPWA 1WPXA 3TW0A 1D09A 1P7VA 3V48A 4CR6A 4J6FA 1BXZA 4US1R 3P9CA 4N0DA 1ZZBA 2VHTA 3ZK9A 1CDZA 4OUDB 1IN6A 3D3NA 3M5CA 1IJBA 1DC4A 1GKIA 4RZSA 3RAPR 3MWYW 1STOA 1JUHA 3U9SA 2RI6A 1AY0A 1NR5A 4CETA 4YWHA 4IE5A 2IU3A 4KXUA 3F7NA 1TCVA 1E2FA 1GT91 1G2IA 4OXQA 3BE6A 4MGKR 1H0HA 1DBRA 3GJSA 4PT6A 3A1SA 5CA0A 1QSGA 5AW7A 1LOGA 1JUIA 1SEPA 2KPOA 5HBAA 3WWPA 1FRQA 3GZNA 3AB0A 1N1GA 3Q9OA 5LZ5A 4UPEA 3D9QX 4IEZA 1AUPA 2C24A 2W6MA 1JALA 2J3EA 5D00A 1YB2A 1A6CA 2HXSA 3V6MA 4WZBB 3AMMA 3W3AA 2PT9A 4P7KA 2P3JA 2YV8A 4EROA 3GCGA 2WRAA 1LAJA 1IDOA 3R0QA 3GEEA 3BMQB 2C3YA 1OGIA 5EVCA 3OX4A 3I2GA 3PPYA 4U2FA 4HH0A 5FR2A 4B8ZA 3BOWA 3MWGA 3L7CA 1PGL1 1Z0DA 4RM3A 1AXKA 3E22B 1QANA 4LXTA 1T0HB 3VSEA 5FZ6A 4PQ9A 3T7KA 3VYUB 1XKTA 1QHEA 4P33A 2ZIEA 3KLPX 1IHPA 1W4LA 3FCOA 3GLVA 4D9MA 5IK2D 3VPAA 4LMBA 2QQEA 5EP9A 1YA4A 5JCZA 4UHBA 5JY6A 3ZN5A 1BGXT 2IIPA 4V03A 5T41A 2D2XA 2V0CA 5JOQA 3MOGA 3RVSA 1BW9A 5AP9A 5FZ4A 1PQPA 5BVHB 4UBKA 3RREA 2ZGVA 3FPFA 3FUTA 1AHPA 3K9GA 1KA9H 3H8UA 4NTZA 2HFJA 5L7YA 4NBTA 4HLUC 1LGBA 3DZFA 1J2EA 4LJ6A 1CZVA 3RDIA 1R0CA 3B6JA 4CU6A 2WS92 3D43A 4LA3A 3U7RA 2JGJA 1J33A 4J1XA 4BX3A 2XQGA 1TUBA 1HRDA 4ZCQA 4CN8A 4LDNA 1V16A 2KLBA 3KR1A 3V7YA 4ONUA 3CYFA 3G5UA 4M88A 4X62B 1OLUB 2WDBA 4XW3A 1OILA 5GMOA 2QT1A 4P92A 4BVJA 2G9VA 4GOLD 1QJ4A 1AB5A 1QJX3 5ER6A 1WKYA 4ZOCA 4QEZA 4PIXA 1EK2A 1X74A 2Q3JA 5E9QA 2RGWA 1NQWA 3F95A 1PK8A 3O1LA 3HQUA 2Q3BA 4Q4W2 1ZAKA 3K70C 2HMVA 4OMFG 1GPKA 3L7BA 1Q92A 1MZ6A 4QWWA 4EMTA 1Q0QA 2B25A 3E9ZA 2HWB2 2PKYX 4A92A 1ESDA 1NGSA 2XGXA 1X1SA 4P08A 1XNJA 1DAFA 1FXUA 2NXNA 4B76A 3M6XA 3ZWAA 1EV11 4YO8A 4EMSA 1Q14A 1U6IA 4O1MA 1M6NA 3GFFA 2AFIE 3MGAA 1OR8A 1MS9A 3SISA 4BO6A 2Y1LA 3C8UA 1WG8A 3KXLA 1RJGA 1IK4A 5DGXA 1WMSA 4MPDA 4CMBA 1W5FA 3B02A 1W5EA 1I6MA 4W99A 2VI5A 1IUPA 4HWSA 3BH7A 7REQB 4LN1A 5DAVA 2PVSA 2GBLA 2OM2A 4K3VA 1ZNZA 1QFXA 1YIFA 4Z0PA 3ZWVA 1WUYA 3ROMA 5JSPA 3QFTA 3TSOA 3TTTA 1S3GA 3RJ9A 5ALGA 5D6OA 4A5SA 1PVDA 3WSOA 2YVAA 5CW1A 3AP4A 4MRMB 1YS7A 1FDSA 1LB1B 3BTSA 4MX3A 4BV8A 3TPZA 4CDQC 1R0WA 3WTCA 2I65A 2DDUA 4YQFA 1U94A 1U02A 5FEUA 2Y0OA 3LF1A 4EKEA 3SNHA 1UJ5A 2HI0A 3KB2A 1Z7GA 5B7GA 1JS1X 3AM1A 3UKJA 2VZLA 3NYIA 4JNCA 1CEEA 3IKJA 4F5ZA 4BIOA 5CNJA 3SIWA 3CRQA 3O4JA 4Z1MA 1NIJA 4QQ8A 5A0TA 1JYXA 2ZDQA 3W4KA 5AW4A 1S2DA 4AMVA 1DXHA 1QC5A 4LBMA 2JD1A 5L95A 1G5QA 3DAGA 1KJ8A 1LK0A 3NMUF 1HV1A 2P6CA 1T3SA 3R0IA 4OMUA 1E2PA 3TOXA 4CDGA 1MC5A 3Q88A 4WL0A 3AVOA 1CJKC 5AKLA 4MO2A 1K3IA 5LMNB 3T1NA 2K5UA 3WLAA 4AFDA 3GA5A 2XMBA 2GERA 4ENSA 4HPKB 3IKVA 4X45A 5BQOA 3M6AA 3BWBA 3W5NA 2ZJ4A 3RSLA 2F17A 2VSQA 3D0SA 1A2OA 1WUJS 4YX9A 3JWIA 2H5EA 3I9OA 1U3UA 4ZGGA 4GC9A 4PU0A 3H2SA 1FOD1 3ZI7A 1HSZA 3K0SA 2NSJA 3U4MA 1G7CA 1VLQA 2C07A 2BKAA 5IT5A 1XU7A 2R5NA 2WAXA 5FLYA 3OJWA 4BBJA 1FP2A 3CRMA 3NORA 3Q9UA 3HKDB 5DTQA 3CF4G 5IZCA 4OQ8A 5DNAA 1KJNA 4GJYA 3ZFGC 1NV9A 4JODA 4CJXA 2D59A 4LBZA 2FX2A 3AONB 1JI0A 3D6TB 3SSMA 1G6OA 4AAYA 3GHNA 1BROA 1UDWA 3H3XA 5JEEA 1QIQA 1W6QA 5DRTA 3SG0A 1AVBA 1JG3A 4YJHB 2VMDA 3FZYA 3NAMA 4QM6A 2UYQA 1E6LA 4MYHA 1AQJA 4AO7A 521PA 4KGXA 3ZCQA 1DGQA 1VBNA 4Y2QA 1H9BA 4HZUA 4CLXA 4D97A 2IFRA 5L4NA 1U99A 4XDQA 1YUMA 1E1RA 2J85A 2XMPA 5HF5A 3A4LA 3N0TA 5FUXA 5LXTF 3AEKA 4IW3B 2C9OA 5IT9A 1T2CA 3PE6A 1D3AA 1LNZA 4ZZ8A 2VMHA 4D2IA 4IDQA 5A7WB 3GPIA 4OVKA 3I0MA 5KYXB 4RIFA 3QEBZ 2G5CA 2MSNA 3KHTA 3DPIA 2O3JA 1ZD4A 3RHFA 1RLMA 2WWJA 4DEVA 3R3JA 4WY5A 3HR4A 1N5OX 2HT6A 1Z4KA 3OPXA 3A1CA 4MS1B 4KLRA 2DJ5A 1JZ2A 2ZETA 1QH8A 4FT8A 3IZOA 1CSEE 1S1CA 4DA0A 4E8CA 5CVEA 3JBG3 5EP4A 2QZ2A 4Q1RA 2WNVC 4FW9A 1X8MA 2VH1A 2FLVA 2O19A 4C0AC 1GNPA 2BF7A 3A0UA 4WVVA 1ZJZA 4RTQA 4TLLB 5TQ2A 1RYZA 1Y7BA 1BVYF 3KVOA 3K2OA 2JJ8A 1S01A 4GD3Q 3RASA 3WDUA 2VXCA 3M1HA 4BVKA 1W2HA 4F92B 2ZBRA 4K9MA 2C0ZA 3GT7A 4M8LA 5E4TA 4AMBA 4QUBA 1Y7LA 1E98A 1GUYA 1N1EA 5CIWA 2ZJAA 3DBHB 2HPHA 1JHXA 2HYDA 2JFXA 2RMU2 3KIPA 3O1MA 3DMFA 3CKYA 3OPZA 5IANA 1JF8A 2DPYA 1C3XA 1M1ZA 1IHUA 4B6GA 2ZR9A 2XUOA 2VMEA 2FZ2A 3AUXA 3EUEA 1SXJE 1X13A 5IEBA 4QYTA 2B8WA 2Z8YA 4Q27A 4AI3A 4HNAA 3VBHB 2J67A 4BO4A 3CX7A 1V3VA 2W2IA 4Z7NB 5CAEB 2WL1A 2CFOA 3JQ9C 3P0FA 2P7IA 5CKNA 1U9IA 4DM7A 1YAJA 4DCVA 4XCBA 4ZHQF 2CV0A 5C1PA 3MBIA 4M0PA 1FRFS 2IT1A 3CWQA 1O5OA 5C3PA 2C59A 4HDKA 3TB0A 4PTZA 2KSQA 3L4KA 1Q8OA 1QYXA 3SMHA 4AW9A 1A5SB 1MNQA 3PQCA 2GZAA 3G5AA 3HSKA 3U1TA 3L0OA 4PS0A 1WZNA 2WF5A 2J7KA 3UYLA 4KUEA 3L8EA 4G8DA 4GSLA 2D1SA 3GZEA 3W2TA 2AUTA 5T4HA 3JVUA 3ETPA 4WEQA 2I76A 1BAPA 3VHXB 3EAGA 3AMPA 3D5TA 4RWZA 2QQLA 4E8DA 5C1IA 4DV2B 2W8BB 1VYUA 1A3KA 3L1KA 3LFHA 1VKNA 4P4GA 3U49A 2CHUA 4HANA 2DUPA 5IXYA 2HBRA 1KIAA 3IAUA 3OBBA 1DJPA 1OZHA 1QWOA 4X3PA 2OBLA 1SOUA 3M4JA 2VT7A 5F98A 4A3ZA 5K8VA 4KTTE 3EGCA 1ZK0A 1VBA2 3D3WA 1A5AB 4US2R 4YRCA 2WLSA 3MW3A 3N7KA 3T7SA 4DCGA 3U1VA 1KDPA 4R2IA 4CCWA 2EIDA 4N39A 2W39A 3PDQA 3IV7A 4EY4A 1NX9A 3NBKA 2BR4A 3QX7A 4LQLA 1J49A 1N7GA 1R1A2 1HDCA 4Q4CA 2O8DA 4TM7A 5A4DA 3FYUB 1U11A 1HLPA 4S1OA 2PRKA 3NYWA 4HVLA 5JAPA 1RUD1 4A45A 2CTVA 1NJSA 2RGUA 4COZA 4RVGA 2CHFA 1RITA 1Y5NA 2O52A 4NMWA 3PTLA 2O5VA 4G65A 1U7OA 1JOJA 1YR2A 1JAIA 5KHOC 3FWKA 2ZRIA 3TRJA 3FB4A 4C4XA 4G07A 3I73A 1OGJA 1Q0ZA 2DT5A 2NZ2A 3EGDA 4EO9A 1NNSA 4IW3A 4EPXA 4DC9A 1E3LA 3A70A 4MGZR 4HVRA 1A82A 2CNOA 3DP9A 3BTYA 4CUBA 2Q6TA 2D2IA 5L51A 1EVLA 1FV3A 5EJ1B 4FXGB 2DU1A 3QW4B 4LWQA 1L5GB 1N2CA 1Y5LA 1RWNA 4NJ4A 1Y82A 1YZNA 1W2AX 4DLPA 4HDAA 4IEQA 2ZTNA 4NNJA 4TTQA 1CDEA 3RODA 3B9PA 2F90A 1BFKA 1I9CA 1DBVO 2ZBDA 3URFA 2YMQA 2R1BA 4AIIA 3OZBA 1CHNA 5BMOA 4MDEA 2QLTA 4YTEA 1GZ6A 1E9DA 3R09A 1V9U2 2BVBA 2RM21 1BEV1 1W88B 5KNBA 1U4SA 1Z4MA 1M0EA 4RLFA 4AK9A 4FW8A 2DQSA 2ZK7A 5TQ2B 4B3HA 4H77A 5I5EA 3OY2A 3O74A 4OQFA 3OQIB 4C04A 3Q3VA 4IJVA 4QU9A 3LBHA 4UNSA 4HUQA 1LPPA 3AJEA 1O87A 1UMCA 1OIVA 4A8JA 1U3CA 4OQ4A 4FFWA 4CXXA 3CH7A 2PDAA 1PR4A 5FI1B 1XVIA 4KO4S 5TJHA 2A3NA 2XA9A 1RHKA 3T7IA 2J0QA 5KTKA 2NU9A 4GLFA 5ALQA 2VHZA 4AGVA 4AUEA 1SHLA 4MIEA 1APBA 4M21A 4R8HA 2I3AA 1Z0FA 1ABEA 5DDJ1 5EIAA 2BW0A 2H0BA 1R8YA 1K2WA 4XJ8A 3L4BA 1HFKA 2FQ1A 5TS2A 2FDRA 3PEFA 1OC1A 2X42A 3JYHA 3ZH9B 2JFVA 4UPDA 4U7WA 3RUHA 1OVPA 4QUKA 1ZX5A 2YHIB 3GRFA 4TQUS 5F7ZA 3D7RA 1MU0A 2Q9BA 2IV7A 4EZ4A 2P2NA 2JVKA 2P2YA 4K8OA 3D0RA 4CUAA 4FMCB 3PC4A 1DIWA 1CUZA 2XQIA 4XEUA 2I5PO 1VPDA 5FB3A 4N0PA 3BCWA 3WNZA 3Q8AA 4W4ZA 4LBNA 4C14A 2Y2UA 4A6DA 3PUHA 3H16A 3GDBA 1E7WA 2Y77A 4I55B 5IJXA 4L6AA 4UFOA 3ONNA 2JIJA 1NN0A 2CFSA 1YJKA 5DGTA 4ENQA 3A1TA 1LLFA 3VO8A 3GNEA 4RSHA 3OJEA 2WN2A 1GNQA 3JALA 4Q0MA 3OM1A 4LMFA 2CWSA 2KB0A 4ESHA 3DBOB 3GCDA 2V0NA 1MT0A 3B1WA 1T1IA 5LQKA 5T7BA 4F06A 2ZHLA 4WZ6A 5JVDB 5CT8A 4FUTA 2UURA 3QUAA 3ZI4A 4DYHA 3RJ5A 1CY8A 1KR2A 4MA5A 4IO0A 2FSHA 3VSDA 4BQRA 5D3KA 1C9NA 4HKWA 4HQOA 5K3EA 4CL2A 2O8FA 2DLDA 4MGSA 1NXXA 4LNUA 4QGFA 2D7FA 2WZPP 1WB5A 3WYBA 4NFLA 1SHWB 1HEIA 1CUAA 1UIJA 1EGVB 2GSYA 3A1UA 1Q1QA 1D1PA 2C5FA 3TZBA 1UY4A 3FVTA 2XCSB 1NOJA 2RAFA 2POCA 1MEC2 3TN92 3NPAA 4Q6WA 3OIGA 3KQKA 3MK31 2BGCA 3OFND 1VPLA 3KSCA 4C9BA 4AVTA 4Q4AA 1U8EA 1E7RA 2ZM5A 4ZA2A 1RPTA 1AR83 2R0QC 4M22A 1PJCA 1XAIA 1G6NA 2GALA 4YFWA 4IIJF 3F2VA 1FOD2 1J90A 4W1SA 2ERFA 3NBFA 3ZV7A 4JLVA 1BHGA 1OWNA 4TXLA 2A5DA 1VL5A 4XB6B 1M2HA 2IXJA 4WVWA 1QGOA 3DXYA 3SLGA 3L02A 1RCTE 2DQZA 4MIKA 1Y6FA 2VRCA 2IS2A 1P1HA 1OIWA 2AOVA 3KBOA 2IYFA 4M55A 4KE6A 3OP4A 3NTQA 1EIZA 3WWDA 5FUWA 2UZ1A 2WNEA 2M1ZA 1W6NB 4HAXA 3KV5A 4OQ9A 4N0MA 4G0NA 3RBZA 4K9DA 4V38A 1HQYE 4QASA 1AUYA 1XOYA 4CTEA 3WMRA 1EWYA 3T09A 4MS3B 1UMHA 3VDBA 4AZTA 4X20A 4D8UA 3C7GA 4OXKA 1RRKA 2VRCD 3O5AA 4ZCSA 4X6RB 2HA4A 3WSWA 2WF6A 2OXRA 1D4M2 5IKOA 2IW1A 4C4PA 1KVRA 5FEMA 1OFUX 4LKRA 3VBRC 1FFBA 2YUTA 1SQ6A 1P74A 2H92A 4YJGA 3L9WA 1T4BA 5B6IA 2AXEA 1E66A 3WVNA 3VBUA 1ZH8A 3IT3A 4AICA 4TT8A 5DYYA 1NLMA 1Z6YA 3LK6A 3NT5A 4JA0A 3AR4A 2BJHA 2CL5A 4AC9A 1N2CB 3HV0A 3WDMA 3WMXA 4F8YA 3LD9A 4K28A 4CU9A 4OQDA 1XCGB 4GA9A 3N2GB 4XPZA 4TPKA 3N3BC 2HHAA 3ENWA 3LKJA 2QUKA 2XNJA 1WCDJ 3M3HA 4F93B 4TKMA 4A8JC 1TTPB 2PRSA 3AK4A 3KS9A 4AF7A 2I8LA 3A3YA 1DV1A 4KLCA 4RHUA 4AB1A 4EELA 3V33A 4A0QA 2B82A 4AWXA 3ZHTA 5GINE 1Y6RA 2OCDA 4UCWA 3BMNA 4BLOA 1RQPA 4XCVA 3ONVA 4AN4A 1YZUA 3K16A 1B3BA 4V0NA 4FGWA 4IEYA 1HE5A 5HKBA 5IM5A 3ZHRA 1J5EB 1I01A 1O0CA 4BQ5A 1B6GA 3IEUA 4JQOA 2W5FA 1E2EA 6CHYA 1OLME 4U63A 1F0NA 5MF6A 2AE2A 2OW4A 4P3XA 4YXWD 2ZDGA 4KWEA 4QFDA 4Y2UA 2EFEB 3TRDA 1CQXA 5AFSA 3UJ6A 4D3SA 4DKXA 2VJAA 5DYWA 4Q4JB 3VV3A 5JSUA 4R0NA 4TUYF 1BN6A 3SJZA 1P5RA 1VMJA 4UXHA 3GJ0A 2A5JA 3RSQA 2X0EA 5KTOA 5IVBA 3AVQA 3OVMA 1SBEA 1IEWA 4LDJA 2WV9A 5ALDA 5CYOA 3KCNA 2YNMA 3KGLA 3E9DA 4KQ2A 4RIEA 2OQIA 3OBIA 3IDZA 1A04A 4YPFA 3O4RA 4WTOA 2OYZA 1ZSNA 3BSSA 3N9LA 4LHXA 2NO9A 4G0OA 3NRJA 4XIKA 3C7EA 1MVLA 3PUKA 2HXYA 3J81A 1I32A 5IKMA 2R4UA 3DKKA 4PZLA 5DI3B 3W1WA 2PAEA 3EQ7A 3RSHA 2I22A 5IVVA 4R54A 1JMUB 3TAYA 5EWJB 1QPZA 3AW8A 3H5RA 1DC7A 4YJ2F 1MZFA 1SN7A 1L1EA 3VKUA 3DCIA 2E7TA 2CNNA 2OHOA 3TLZA 5BR1A 1V00A 1O6FA 3KQVA 3OQBA 5EI5A 1TEXA 4MVJI 3JQXA 2F3RA 3MT8A 4GS5A 2XBO3 4EVIA 4HWPA 2ZFUA 3OP1A 5JBQA 3FB1A 5EWSA 3T1HB 1M1NA 2YWBA 1UZWA 2WSUA 2ZJ5A 5C7IO 5CX1A 1E4EB 2HU5A 3P32A 1N92A 1ENRA 4KO1S 4EW1A 3AHEA 2B39A 3Q8XB 3RC7A 4QKQA 3EQEA 5F2WA 1EM6A 3GA7A 3AJYA 2WSYB 1APNA 4DMFA 3FPSA 1YJ8A 2QUAA 3AZZA 1FVFA 3QWHA 1GA4A 3CEPB 2BGPA 3O84A 1P73A 1GEEA 3KU4A 1Q7BA 4GG1A 1PG2A 3SDBA 2E53A 4G4FA 1S9HA 3OQHA 3WKDA 2Y6VA 4CEYB 2PM8A 1CPYA 4QNRA 3MUY1 4CM8B 5ENVA 3V2IA 5DH9A 4BLJA 4GKBA 1ZVVA 4TV9F 5HIJA 3N9NA 1SU7A 4IIFA 4DE5A 4Z2AA 3FYUA 1PJQA 4ZI5A 1BW9B 4IDZA 4OUSA 3SF8B 3R7WB 4YGDA 4FPYA 1DLLA 3QWBA 5B2FA 1QVAA 2E5LB 4OLBA 4PCUA 4BB5A 3HYNA 4QRHA 1ENPA 2XR4A 1HF3A 4RXTA 1X7ZA 4I2VA 3EZGA 5A1TA 2HA3A 3ZQJA 3DBLA 4IDFA 1ZC3A 4B7AA 3R76A 5DM60 4CQLA 1OWPA 2MINA 4Q4V1 4UDOA 3VU9B 1SA0A 3MYYA 4Q1AA 4JASB 1CVLA 2WM3A 4ZOLB 2RJNA 3K1AB 3ROUA 4HLQB 2OCLA 2MR6A 1IPSA 1FMD3 3NHRA 4C1NA 4M8NE 3KT3A 1KY3A 2Z4TA 5ELXA 2Q4DA 5KVQA 1QRDA 2I99A 3UO8B 1E2DA 3WX5A 2JLBA 5AR1A 3VDDB 1O5TA 3JQ7A 3TAUA 3THOA 1NY71 5LMCA 4A0FA 4HLCA 4QTZA 4J2HA 4UQLA 2HY7A 1WDTA 1E0SA 3ZY2A 5JPIA 1BSVA 3I53A 4QRDA 1KZ6A 3HXOA 2DB3A 5FZLA 4POAA 4F9FA 3THDA 2D6OX 2LPMA 2O8BB 1MRZA 1NI4B 4N7BA 5K8IA 4X94A 3FNFA 5HJEA 3L1HA 5FQ0B 1EVYA 4CKBA 1QHDA 4A2QA 4BRWA 3EMDA 2ZIUB 3RG8A 2QX7A 5BV6A 1ZL0A 1VHDA 4ZV9A 2VUIB 1GOFA 5F5QA 2W2NA 4LZPA 5C8XA 3WYNA 1Q0SA 3K4DA 1B73A 2VUHB 3E2IA 1O2DA 3REOA 4CP9A 2ATXA 3GLIB 3M1YA 3REQA 4FOYA 2X2EA 1I80A 4I1OA 1YR6A 3QU9A 4M01A 5B36A 4AVVA 5JJ5A 4PLMA 3QGMA 5ALUA 2JLQA 2AG8A 5FBVB 3MJRA 4OMCA 1CUEA 3BGAA 1GR1A 3DDWA 2FU5C 3U26A 5K0UA 5JZVA 5J58A 3QKRB 2R042 2AS0A 2JIZD 2JLVA 3M3OA 4RHV3 4U0JA 1JS9A 2W83A 3PFGA 1IQAA 4DKJA 1XF9A 1V4BA 1PW5A 4TTAA 2XNHA 4WUVA 3QF4B 3N9IA 5BPHA 4XMIA 3DXZA 1N2ZA 3GG9A 4PHHA 1Z45A 3CNOA 2GCOB 3KP1A 1M6VA 5ALXA 3VTKA 3O4VA 2ZSDA 2GH2A 1BX3A 4YCJA 2ONJA 5IN4A 2GZ1A 2NQ2C 5BNWA 1WY7A 2WWTA 4LXYA 2PEZA 3PXEA 1DCFA 1DIBA 2MJLA 1GCIA 3QVXA 3HEBA 1XZMA 1FU7A 2PUDA 3PDHA 4X97A 1QS0B 4KQKA 1JTEA 3BWYA 3EWNA 1A5BB 3IA7A 3NMBA 1LX6A 1NY72 2XEDA 3GFBA 5IAGA 2R8YA 3LA8A 4AUKA 2ST1A 2ZGTA 4MV1A 1NUPA 4Q18A 4IWNA 5ECYA 1AK9A 4GZLA 3E61A 3OTHA 1PHRA 1UQXA 1UMDA 4BV2A 4N5NA 3SS7X 2KBEA 1ULBA 1NXSA 4RQAA 4Z86A 2KI5A 5T52A 4R31A 4EG4A 3KMHA 3NX4A 3ZXLA 3U48A 1CUSA 2HO5A 3CVOA 1IHOA 1EUDB 3X2FA 2X5IC 3A3OA 3KVNA 4MW5A 2HD4A 1AGNA 3DDOA 4TTGA 4Z6KA 1BKSB 2VM9A 4RO0A 1YI1A 3PLQA 4NRMA 4RZQA 4ZAWA 1GTJ1 3KQQA 2WFLB 4KH0A 3QLUA 1E0AA 1PGNA 1TQ2A 1EVIA 1MNAA 1GGMA 4KV9A 3MJ4A 4DMRA 2ZEXA 3WKCA 3JATA 3WOVA 2KQUA 5KBFA 1Q43A 3ME5A 4MHOA 1XMOB 3E2MA 2OD9A 2VJXA 1DAIA 3ET5A 1PFGA 1PT6A 3OPYA 5KVCA 3OIYA 3CGWA 1EUYA 1ODSA 3F5FA 2P3SA 4G37A 1AHIA 3HFRA 4UJ3A 5ALYA 5EKTA 1O94C 2ZJBA 4FHDA 4FFDA 1OX4A 2BE9A 5A3LA 1CZOA 5E7IA 4MV3A 4HF7A 4ZT4A 4FC7A 4Q1BA 3NT4A 5B3LA 2EGHA 2UYCA 3TZKA 1OTHA 2FF7A 1RYFA 1C0PA 3AUUA 2GVZC 1EE1A 4HQ6A 2RD2A 4XXAA 1R9JA 4HV4A 5KTYA 3BF8A 5DAPA 4Q9HA 2WNUC 4LMPA 3RUCA 2YY7A 3R4CA 2IDJA 4FO9A 4AFBA 2PZFA 1WCUA 1EHYA 1SQ4A 1PVC2 4CRQA 1CEXA 4AMYA 1BDJA 3SAJA 5EQUA 4CNBA 4RHV1 1C1DA 1I1HA 1U7ZA 2HFKA 5T54A 3L5OA 4O2LA 5IDWA 4RA6B 3ZN2A 1ZBQA 2RS12 3ZDBA 3NP9A 1RUD3 3VZJA 1U8FO 2P30A 3GUCA 4R68A 5CU7A 2XJUA 2ACWA 4KPFC 3EXAA 4EI2A 5HQ3A 2IXCA 3ZGVA 3LF2A 2F48A 5HKLA 5F5CA 5E3IA 2C94A 2Y4OA 3CCFA 3NAZA 4C1WA 3M8LA 2FPGB 3F6EX 2P2DA 1BWSA 3Q0IA 2TBVA 3BPSA 1P9NA 1SFNA 3VLBB 2N3ZA 4O4IA 1WVMA 5G0WA 5DWVA 1VL2A 4ZHNA 3A0RB 4YASA 3R6TA 3T7JA 5A6YA 2JGIA 2QUZA 4JX8A 5CPBA 1NXTA 3B3QE 1QQP2 4YZ3A 2Y3IA 1RUF1 2IPXA 5BSHA 1NONA 3OFVA 4QDUA 3U07A 2VP2A 4DDMA 2CJWB 4RV5A 4AYUA 5CNKA 4WJZA 2JFOA 4YYZA 3ZD9A 4K7JA 2GR9A 4XEZA 2FJUA 2BFUL 4FZRA 3VBSA 3JQCA 1BMTA 4WM8C 2OENG 2G19A 4XYXA 4UVGA 2C6SA 2PU7A 4UZEA 3EZXA 1JIKA 1XXHA 3DH0A 1NA1C 2ALJA 2CUNA 5IVCA 2LW7A 3DSRA 2JFZA 3EOZA 2DVFA 2A92A 5FI5A 5FXVA 4B81A 4QUGA 4R1LA 2J1EA 4LX0A 5AI5A 5DN2A 4AQYB 4AI1A 2BOVA 3MTEA 1AE1A 3SCFA 4I8IA 1NLQA 1IOVA 1M1YB 1KI6A 2DY0A 4FWBA 4ICIA 4KQHA 4J3FA 5FUQA 3DFZA 2W92A 3EW9A 3TBHA 4BP9A 3NLLA 3RC3A 3AOGA 1XZHA 5REQA 2PRIA 1A69A 2AN1A 1II0A 4LXGA 4JHLA 3ZWDA 4IUGA 2A2ZA 1AXZA 1QF6A 4F56A 3DEHA 3PIDA 3VD5A 2NMOA 3I8OA 1MRNA 3OF3A 2W6IA 3GZTB 1KIFA 1POV3 3JAWA 2D00A 2RG1A 3EHKA 3RADC 5EIBD 1JPUA 3VO2A 4BX2A 4FEEA 5CW2A 4ZQHA 1D5WA 2GTIA 1IEVA 3B6KA 621PA 4XJUA 2XUJA 1DLJA 2ETXA 5CDTA 1D2QA 1WOYA 3I5AA 3LZCA 4DF3A 1O8SA 3EEBA 4PPNA 4V0SA 1CIVA 2VDRB 4UCXA 1U5BB 1K8RA 3DWIA 4AYTA 1DOAA 1PQYA 1R15A 3W2GA 1RI2A 4QARA 2XB8A 1TUIA 1E2KA 1X80B 3OOJA 1SUCA 3GAFA 5K09A 1QR6A 3N05A 4PF5A 5DBHX 1N2GA 1B2RA 4Z53A 4Z49A 3E5MA 4L7QA 5JSZB 1GZ4A 2CUZA 1Y9ZA 2H08A 4I9NA 5G1NA 2IP1A 2JDIA 3OQNA 1X70A 3EVGA 1PL7A 2RHPA 4O2BF 1IN8A 3AILA 4BLIA 1GWNA 4KPGA 2WTAA 2J5RA 1BBT3 4NR0A 4ARIA 1FAYA 4URTA 1SIBE 2WSSA 3PUXA 3QVKA 4GAZA 1L7BA 2ZS8A 3MIBA 1DZQA 1ZX1A 2JG9C 3ZXDA 1V6OA 2F9FA 1NC3A 1E6KA 2QN3A 1KO1A 2H4ZA 2WPDA 3IV6A 4DXHA 2SNIE 4OULA 1H2LA 3DGTA 5I7UA 2FEMA 1XPUA 3EULA 5FY5A 2GXQA 1T1JA 3ACDA 4N54A 1NR1A 4US0R 4MMZB 2RS52 1JWBB 3CG4A 4Y5Z0 1TME2 3S57A 4GI2A 5HYVA 4GKVA 2JAWA 4Z9XA 5BN4B 3D3QA 1RACA 4MVWA 3K48A 4RM2A 2E33A 1TF5A 4IY1A 2I07B 1DQRA 2R6DA 3LKZA 1DKMA 4XJTA 1I33A 1CR4A 1MQTA 1Z13A 1K92A 4JX9A 4HFMA 2CMGA 4S0XA 1XJWA 2FSGA 3UTCA 4FT4A 3W5UA 1KC3A 2JRCA 3LHSA 1HA3A 4YT8A 2WS91 3RGBA 1EFVA 4XWWA 2ZYHA 1WA5A 1QV9A 2H8KA 2XMCA 4B6PA 1TC2A 4RL7A 4KQWA 1JKMA 3DW3X 5E6RB 1JDUA 4LMAA 4RF2A 3SQMA 3K5HA 4EA8A 3AYXB 2RMU1 5K3DA 3KWJA 5BRJA 1KARA 1Q5PA 2WJVA 4BMXA 4V0LA 3S68A 2CFRA 2XYRA 3LJKA 5HXMA 1YVEI 1G5FA 3FCUB 4B8YA 5INTA 3WNXA 1EBBA 1ZXXA 3QWAA 1RD4A 3ORSA 1N6IA 3T0IA 4IXWA 5KNBD 4KIFA 4BIIA 2Q8EA 2H65A 1O95D 5KDDA 4NH0A 5F8PA 1IUKA 4GX2A 3OGSA 1O96B 3PVSA 2IUWA 1J7KA 1QGZA 1W96A 5DHPA 1N0HA 3FFWA 3ITDA 1QJU3 2BHNA 2VJMB 1ODLA 2BKUA 3UVEA 1PV4A 4PCVA 1H2NA 2WIIB 1OWLA 1CUYA 1DARA 2VU9A 3HWWA 1YV9A 3CLKA 2X6QA 2IU0A 5HRCA 1NVGA 3L4BC 4KIWA 4NWIA 2VZSA 2ETEA 3B48A 2IP2A 3F8SA 4AIRA 2AJTA 3GW8A 3SXUA 5C46F 1OX5A 3OKPA 5EKDA 3LPAA 1DRUA 5CYYA 4G4SO 2NV2B 3ZYHA 4R7ZA 4MYUA 2I91A 1HDIA 3HVJA 2P5SA 3NHYA 2IWGB 4Y3UA 2QUHA 2YW9A 2WJJA 1BG6A 2I29A 1AR93 3Q1LA 2PVPA 1L8OA 1TJNA 3UWDA 4GO1A 1QKKA 1VMFA 2ECPA 5JO0A 1U1CA 1WULS 3TTWA 2WEKA 4FGSA 3LGRA 3OTIA 3ZBPA 3SXWA 4GPZA 3HM2A 4I55F 4LYJA 5FRDA 4NYIQ 3OF2A 5KQRA 2XUGA 1T36B 2IOHA 4S2FA 2A75A 2M32A 4NO4A 2W90A 4UMEA 3LBAA 2GBGA 1SCKA 5KQSA 1SLIA 3CWCA 3A3NA 1XRNA 4EYQA 1CIYA 3RKRA 3WJ2A 4NC9A 1D4AA 5AVOA 5FZ0A 4XUCA 1B8UA 3VM6A 2FPIA 1FQWA 3LDGA 3R3HA 3WDXA 3ASZA 1FTGA 2OZLA 1IHDA 4ZS2A 2VNGA 1VLLA 4AE2A 1XX6A 3LT4A 1J84A 5JDBA 3WDLA 2NYYA 3BU7A 3VBOA 4XLZA 3FTPA 5AVYA 3EIHA 4V24A 1CX1A 5D1IA 3V7NA 3HJGA 1FSPA 1BVP1 2BBVA 3DE4X 2HBZA 3IOEA 4LHZA 4D8XA 3WG1A 2PX0A 2ZWVA 3E1SA 3G13A 3ICCA 1WBJB 1XWWA 5K20A 2L9LA 4Y30A 3DB2A 4UW4A 4F2WA 3MFQA 4PZ9A 5ITSA 3T3EA 1XNBA 1PJBA 4LBQD 3L82B 4GKXA 4ZS3A 1XNDA 1GSIA 1PDWA 3ZNOA 3THYA 3RIGA 2QRLA 5ITVA 1MZ5A 2R6HA 3MS7A 4IFBA 3GPDG 4RY0A 1QO7A 1JYIA 3HGTA 4ZO9A 3O2NA 4I1SA 1TPYA 4QG3A 3LT2A 2RAVA 2BGLA 2R8ZA 2V74B 3T15A 1F0PA 2Z2IA 2QN9A 5KKNB 1DKQA 4CBVA 4HNQA 3AMVA 3UV9A 5BY2A 5DXDA 5J40A 2GLXA 3W58A 1VG0B 1SD2A 1RKXA 1YQDA 4ZI7A 1U1DA 4GVLA 3ZXSA 2BVVA 4EP1A 1E5DA 4UNIA 3AVSA 3C7FA 3K5PA 5A6QA 3PSHA 3LDUA 1VGRA 3LP5A 4RULA 3M7AA 4P34A 2OCYC 2BZ1A 1PE0A 2EP8A 3TCXB 4HO1X 1I1NA 4QOFA 3B53X 3G49A 5EHQA 5F39A 4KNYA 2P78A 3DDHA 3HY4A 2JLXA 3C8DA 5ALJA 4H59A 3DMRA 4Q16A 5ARCA 3SKVA 3ZR5A 2CXXA 4ALNA 5EP2A 4IESA 2F9MA 5ADHA 4GOMD 4QXRA 3EXHB 2XE4A 3MBWA 4N9HA 3FHLA 1NIPA 2NIPA 3X1MA 4YJGB 4CMIA 3QKIA 1YJCA 1X1CA 1J0BA 1BKYA 5JECA 2PUVA 4Q1VA 4XUOA 3DVAA 4Z7OB 4AI9A 5KQLA 3K05A 2C9MA 1ESZA 1N1YA 2Q21A 4ZOLA 3EXUA 5K4AA 1LU9A 4NL4H 4Z8BA 3LHDA 5KKAA 1SG9A 3HU1A 2OZVA 4MXVA 3BG5A 2FWAA 4FFGA 1V71A 4CIDA 3I1FA 4EUFA 4Z9AA 3UESA 3LF7A 1RXFA 4JELA 5JSYA 3RLFA 3Q2OA 3MW8A 1VJTA 2R063 1TK3A 5CFRA 1RJ9A 2WHPB 4Z7JA 3VZOA 3O8OB 4U39A 2PH5A 2IYXA 2B30A 4IQFA 1V1RA 2QBXA 1D2RA 4NJOA 3DF9A 2QKDA 2WSSD 5BW5A 1P80A 3BX1A 1USIA 5EOVA 3VGPA 5K01A 4WXHA 2OCXA 4B7EA 4DG9A 3JWPA 1SVMA 5B58T 3AIMA 3S2IA 1GARA 2E4YA 4WPGA 3RGWS 4L3OA 4TKVA 1MQTC 4LULA 2FUEA 4QWNA 5ARBA 4PR0A 4MH0E 3PMEA 1RVF3 5C9AA 7REQA 1J8DA 3K9WA 3MM4A 4JQRA 1AX9A 4GPD1 4I4TF 4ZVMA 1ID8A 3L5KA 3T2QA 3PC7A 1D6NA 2WQZC 5A0FA 5G4KB 5CBPB 2C9YA 3E6CC 3FGPA 4XJVA 4KHZA 2ANCA 4F9TA 3JBG1 1LOFA 1UPTA 2H17A 2CCGA 4WERA 2HLDD 1TQ6A 3EF3A 3SCHA 3AT1A 4B3IA 2K2QB 2Q5CA 1UC5B 2DFKB 4E3WA 2ZJ0A 5ALVA 1QB8A 3O47A 2DSTA 1C57A 3L2YA 1J59A 2ZGMA 5AVSA 1VSQA 5JCOC 5CFNA 3AKQA 3GLGA 1Y4ZA 2CSXA 3CKKA 2XL9A 5EKXA 2FSPA 1ZYUA 3D2AA 2VQ6A 1G9XA 3BSWA 1BJQA 3FSJX 5LCWL 2FJPA 2GM5A 3U19A 3MIFA 3L0CA 3QX8A 3HT1A 3ZHBA 2CCKA 4CQNA 5A1LA 4CG3A 1H8TB 4FP9A 4OFWA 4GM1A 3KDPA 4GU5A 4Q9AA 1YQCA 3ZLUA 1SXQA 3D5OA 4N9IA 3T5GA 4NIAA 2QR5A 1DOHA 3CISA 1L9XA 4IO1A 3AXTA 1LQTA 1EV13 1IBMB 4BZXA 1S6YA 2QOEA 1KXJA 1EFRD 2QTBA 5CM8B 4YVWC 3EA4A 2XUAA 3MN1A 3RMYA 5L9AA 2V98A 4OXIA 5K0TA 4N5HX 4WFIA 4CZSA 4XWAA 3R05A 3BXGA 1OX6A 3RYFB 4TV9B 3M6IA 4DB5A 4PO1A 2QJOA 2R84A 2HJRA 3PE4A 4RHCA 1VIVA 2IZZA 4P81A 3FVWA 4WGGA 3Q1KA 4A2CA 3LVQE 2JDPA 1V6CA 5DTEA 1KWGA 3F5SA 3QX9A 5LMZA 1TADA 4Q9DA 4UBOA 1JHMA 1MRSA 5FUVA 1PP4A 3VNBA 4JLMA 5IJRA 4ARVA 1LC3A 1EFAA 4M89A 1DJMA 2JFUA 1KHHA 3PYLA 1JLMA 2VWHA 2OGZA 5DHAA 3S1SA 3GT3A 3KXPA 4PIVA 1OQDA 4FYJA 4ILKA 1IPFA 1L5RA 1P4RA 1FSGA 4DS3A 2XOKA 2YWJA 2W2LA 4ZMSA 4GBJA 2L17A 1EFVB 1EPZA 4IDPA 5J3UA 1KJLA 3EZ6A 2G1MA 4UTPA 1VJ1A 3IOCA 4RTPA 4OEHA 3E1F1 5A9RA 2Y1GA 4IR7A 1LPSA 4J0JA 4D26A 3RSSA 1ZO8A 4D0LB 3TL6A 4ZIRB 1Y1KE 1J2JA 3OEWA 1C4RA 2Q41A 5A4JA 1Z2CA 1OD3A 1H4GA 5LY2A 3KYDA 1Z5VA 3WZLA 3K20A 1DIGA 2D5LA 3N3HA 3MT0A 4OD0A 2XQKA 3VR5H 1V8DA 3GH1A 3UWMA 1UKBA 2EKPA 2C96A 1LTHR 5TDHA 1JJAA 3FMOB 5HA5A 5C1OA 3RYHA 4AQ7A 1B76A 4FFRA 5J63A 1QHGA 3N39C 3QOXA 2J08A 3PXUA 2R6AA 4A3SA 3LS2A 2DCMA 4RVFA 1ZJ5A 1SCUB 3KSMA 2OPWA 4JROA 1FX5A 1THMA 2C5SA 4UM5A 3I5XA 4HEA6 5IBCA 5DLYA 4PONA 1KS2A 1US8B 3FVRA 3PFNA 5C8CB 2PY6A 2J9ZB 2VHJA 1ODKA 3LLCA 4UHKA 2FCAA 1B09A 5E2AA 2L0XA 3GLIA 2YJNA 1Z25A 2MSKA 1HDGO 1MH1A 2IX9A 1ZOOA 2Z30A 2JI9A 4DA8A 1RJFA 4HDMB 2GYWA 5GM2A 1WPQA 3VR5D 2CYCA 1RUE1 5AT1A 1COWA 5BNNB 1W2OA 4K87A 2MSDB 2QTHA 4GPTA 4RVCA 4INAA 1EKXA 1ZWLA 3P9NA 2JANA 4XB2A 3H1BA 2TNFA 5LPNA 5CGZA 3AKEA 2DYCA 3SYKA 3OBRA 3D64A 5MN6A 4YLYA 1EQUA 3AUSA 4UVIA 4V2WA 2ZHKA 1QGED 4KDRA 2IVIB 4QXBA 3MD0A 2XG3A 5LQSA 2N42A 2JDZA 2YYOA 4L9SA 4IQ8A 4BVBA 4B3DA 4KIUA 1HMPA 1Z9BA 3A6FA 2ZI7A 3EODA 4H3HB 4DV1B 1FC0A 3E2PA 1FTSA 5IUNC 1ACJA 4FEGA 1RRMA 4XDYA 1QRRA 1J1TA 1Q3KA 3CEHA 2C42A 4U6QA 4XJSA 3A4YA 2OILA 3LFUA 4HRAA 5LRRA 1ML3A 3QNUA 1DQYA 1V9U3 5SYAA 3Q8FA 4Q7QA 4OP1A 2ZPXA 4QPYA 1UJ2A 3CRRA 3ZLBA 3FOAA 5EIFA 1KDKA 2QDNA 3VZLA 3HBAA 2XH6A 2BW8A 1XTPA 2HJGA 4HX9A 2ACKA 4LJKA 2YYZA 5T50A 2YFKA 4BIMA 5B57C 2QQKA 5JVDA 2ZIXA 3GZNB 5JNLA 3P9XA 2J6CA 3CINA 3O8CA 2FQYA 4CKYA 1HG1A 4A41A 5J37A 3ZE0B 1IM2A 4BNYA 3U6BA 4XRGA 1JE1A 1FS6A 1TEIA 1XNHA 4DR3B 3I6ZA 2VTXA 4AX4A 4NG5A 3ZV6A 2I3BA 2OFOA 3I3EA 4JGZB 3I42A 4UFNA 3AESB 4EGCB 3U6KA 2VCAA 1OB2A 3B3JA 3BTZA 3RAGA 4XTCS 1FMD1 2VT3A 4JGYB 4IV1A 4Q4AB 3SI7A 4C6TA 2WQ6A 3ZXKA 1R091 3N8DA 3Q9NA 1MT3A 2V73A 2GPBA 3C97A 1CESA 2FPUA