2O14A

X-ray crystal structure of protein yxim_bacsu from bacillus subtilis. northeast structural genomics consortium target sr595
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
354
structure length
354
Chain Sequence
KVYQFDFGSGSMEPGYIGVRASDRYDRSKGYGFQTPENMRDVAASGAGVKSDAVEFLAYGTKSNNTFNVDLPNGLYEVKVTLGNTARASVAAEGVFQVINMTGDGAEDTFQIPVTDGQLNLLVTEGKAGTAFTLSALKIKKLSDQPVTNRTIYVGGDSTVCNYYPLNSSKQAGWGQMLPHYIDKHTFQVRNMASGGQIARGFRNDGQLEAILKYIKPGDYFMLQLGINDTNPKHKESEAEFKEVMRDMIRQVKAKGADVILSTPQGRATDFTSEGIHSSVNRWYRASILALAEEEKTYLIDLNVLSSAYFTSIGPERTLGLYMDGDTLHPNRAGADALARLAVQELKRQGIAGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-Ray structure of the hypothetical protein YXIM_BACsu from Bacillus subtilis.
rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein yxiM
total genus 110
structure length 354
sequence length 354
ec nomenclature
pdb deposition date 2006-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13472 Lipase_GDSL_2 GDSL-like Lipase/Acylhydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 2o14A01
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 2o14A02
1ESEA 1IVNA 4JJ6A 1VYHA 5D21A 1J00A 3SLRA 4CP9B 1DEXA 4JKOA 1GWLA 2VPTA 1WMXA 4NRDA 1ESCA 4K3UA 2APJA 3F95A 1WZXA 2Q0SA 4M8KA 4YW7A 2Q0QA 1V2GA 4JJ4A 5BN1A 1W8UA 1GWMA 4JHLA 1UOJA 1OKOA 3DT8A 3DCIA 4LKDA 3DT6A 2VXJA 1YZFA 4Q9AA 4AL9A 3KVNA 5B5SA 1W90A 4LKFA 3ZYBA 3SKVA 1BWPA 4JGGA 1W8WA 4OAOA 5JD3A 2C24A 3BZWA 2LRPA 4Q7QA 3ZYHA 1DEOA 4RW0A 1WABA 1OH3A 1L7LA 1VJGA 4HF7A 1ES9A 3P94A 4BQ5A 4BQ4A 2WAAA 5A4AA 2HSJA 4K9SA 1FXWA 2WAOA 1Z8HA 4CPBA 4LHSA 3PT5A 4CPBD 4TX1A 3UT0A 1ZMBA 1V0AA 4PPYA 1FXWF 1WCUA 4CP9A 1W8TA 4YWAA 3DT9A 4H08A 1U8UA 4K7JA 1HN0A 3C1UA 2K46A 3RJTA 1BWRA 4K40A 3ORJA 2O14A 2Q1FA 2LROA 1K7CA 4LKEA 4LK6A 3DC7A 2JWPA 3MILA 4A6SA 1W8ZA 4RSHA 2WABA 4LK7A 1PP4A 2WYFA 4YW6A 5CD9A 1W9FA 4XVHA 4DEVA 4BQ2A 4IYJA 3HP4A 1JRLA 3U37A 5HOEA 1GWKA 4HYQA 3W7VA 1ESDA 4OAPA 4LJHA 2KR2A 2W9XA 4BQ3A 3ZYFA 4I8IA 4S1PA 1BWQA
chains in the Genus database with same CATH superfamily
5HR5A 1QBGA 3AKSA 5EINA 2X05A 1R64A 5DAWA 4CPDA 3H4TA 2SICE 4EBBA 1SZPA 3GJQA 4O1MA 3F6CA 4Z0HO 5E88A 1SULA 4ZYYA 1WB9A 4B3MB 2UVQA 2CMGA 3L41A 1V7CA 2XECA 1YR1A 1X1EA 5I7AA 1CJTC 4PIPA 4BOYA 5IKEA 4ZVQA 1SBIA 1UKRA 3UEOA 1XEWY 1XGKA 3L06A 1SG0A 2RKBA 5JXIA 4MH0R 2NO7A 4MHOA 1ZSNA 2B46X 4KG8A 4X6UA 1O0BA 4AUKA 2W2OA 1EAH2 2ZPUA 1T9GR 4N9QA 1BKSB 1TVKB 3WW4A 2O14A 2E7QA 2VUTA 1AHPA 4FR2A 4QLBA 4KO4S 2HCRA 3KXKA 2GETA 1PGJA 5LR6A 1RZRD 2QM3A 2QNIA 4IMRA 2WPDA 1HE8B 3PNSA 4E30A 3N7KA 2AJDA 4JVSB 2LCFA 2WAXA 5EKSA 3M6XA 2OYSA 2G63A 3GGJA 4IV3A 3TOSA 3KD4A 4MGZR 2RAPA 3UJDA 1WA4A 1ZREA 4RTJA 4BX9A 1MR5A 5E3JA 5B57C 2TECE 3D0JA 1Z12A 4IDOA 4WI1A 1UBFA 3GZTB 3OCXA 2GM3A 1NDHA 4BRWA 4RZ2A 2RS51 1PJ3A 3M7IA 2PHFA 1G0OA 1L9KA 3RBVA 3MICA 3F6PA 3OEHA 3C6MA 4HGPA 5BPFA 2JLVA 5FBVB 3T38A 2JKBA 4BMEA 4A9AA 3IILA 4FFLA 3D9QX 4RLSA 1FYFA 5F7XA 3BMQA 3VPAA 3KVOA 1DDIA 1NXSA 4ZZ0A 1GNSA 1C5KA 2ZFUA 3H2IA 2C4UA 4I81A 3P26A 3B70A 1RHI2 3GRRA 1ZMBA 2AW5A 3HCWA 2XB9A 1FSPA 3O7MA 3SY8A 4S3MA 1MG0A 1RQ2A 4NFLA 3A32A 4RWEA 1QIEA 3ONFA 3RJMA 4BP1A 3UJ6A 3B1VA 1ZICA 4LKEA 5A0FA 3N2LA 4PLNA 2Q3BA 4H6XA 3V48A 3KM5A 1I3NA 4JJGA 2QK4A 1RHKA 1GG5A 2CEAA 4BFXA 4L8LA 2C4VA 1MABB 1NYRA 5D21A 4C6RA 2OBBA 1ZD2P 4HFSA 3KSZO 4LVCA 3QA3E 3G5MA 3FE5A 5CDUA 4ITVA 1YMQA 1ZNQO 1HIXA 1QDOA 2BJHA 1UN1A 4FSDA 2GN6A 2FQPA 2OGZA 3RTCA 1QJY2 2C1XA 4HG2A 1S0JA 1IXYA 2J9FA 2P4EA 2A9PA 2QAJA 4H6VA 4BAGA 4LHKA 3KPWA 1NN3A 1W2TA 4OXNA 4Z4CA 4PG4A 2ZTUA 4UTVA 2B4YA 3G79A 5B4XA 3LEMA 3MNFA 1YIPA 5KNDA 3IPLA 1XNQB 1KJJA 1GPH1 2OHVA 4F3TA 1XVAA 4Y1RA 1O4YA 2R1VA 5FWJA 1RSZA 3J9SA 2DWRA 2H92A 3PNMA 2ENWA 4U3JB 4G5XA 1V1RB 1HDXA 4IDPA 4MVJI 4LHVA 2NNWB 3A23A 2Y4OA 2VDKB 4WBBA 3OTQA 4P82A 1OZAA 3PIGA 4F46A 3PQCA 3LXMA 2YBPA 3VBOA 4LMRA 2FE1A 2V6BA 4GR5A 2FUCA 4LFAB 1RJ7A 3QF4B 1VBA1 1NUKA 1YDFA 2C78A 3MF9A 2LUOA 5JOYA 4WOBA 1SG3A 4M0UA 2JF0A 3EOZA 5BSRA 3LDRA 3ESRA 4DV5B 4B7EA 2COEA 4R8RA 1CVLA 3I2DA 4EFLA 5IUQA 2ZRMA 1QRAA 2NUBA 3GRFA 4UE6A 1KFXL 3ZFGA 1TQ5A 1HXS2 1KJYA 1SRQA 2CFOA 4AN1A 1D4M2 3Q88A 3ZGNA 3BL5A 1OZ0A 3OGRA 1NN5A 5L6MB 4HQ6A 5CB0A 2F3TA 1ZZ7A 2RJOA 3IV9A 1Y3IA 3NYIA 2IV7A 1DTWB 4Q19A 4MQBA 4MS1A 3FBMA 3QYPA 1VMDA 4PIVA 4DM7A 4M0MA 2AJTA 3HJNA 1GQYA 3WYCA 2GRAA 3DQPA 4BYMA 2YFZA 4G2NA 4MXVA 1GLVA 3KT1A 4J0QA 2GBLA 4I02A 2I99A 4EN0A 2F43A 3GFRA 3BF8A 2YJGA 2OYCA 4HNSA 2WI8A 4XJVA 5SY4A 3EVAA 4IUCS 2QU8A 1YASA 1LB1B 2X7JA 4J0CA 4XTPA 3ZD8A 5CLJA 2X3YA 1XVTA 4MQ5A 3PKJA 3EAQA 4P5PA 3IA2A 3KLPX 4BTLA 1JYTA 1T8TA 5EHIA 4C76A 2GZDA 5AI8A 2WSMA 3O2JA 2ZGQA 2GD1O 1F4VA 1AB5A 3WY6A 2X42A 2OFXA 1XRJA 1ICIA 2ONYA 3HUTA 3HVUA 3RK4A 1IUOA 4YFZA 1YR9A 2IRWA 4EK9A 5IDVA 1D2SA 2Y1GA 3PUWA 5EN4A 3U75A 2B5VA 4QPNA 2F8MA 4AHZA 3TLYA 3DHVA 2F4PA 1X7WA 2QUJA 3C7EA 4XAEA 2C31A 1OQDA 4I5EA 3IEUA 4B7ZA 1M6NA 4PF1A 4YMUA 5KNBD 3HXKA 3X44A 1RKBA 2HJSA 3WXBA 4OQ8A 3E9YA 2FFHA 3FTCA 2ZITA 3N6RA 1USVA 4BQFA 4PBOA 1QV7A 2H0VA 4L02A 1MB9A 5DDJ1 3RFUA 5DRTA 4BTEA 3EQ9A 2DUQA 4D6SA 3SJCA 1EXWA 1V9U1 4JHLA 5CCXA 3A1NA 2OORC 1ODTC 4BMSA 1RRFA 2Z8YA 2HIHA 3P5SA 3TSCA 3U0VA 1TZBA 3ZW9A 4J4BA 1XE7A 2AC2A 2G28A 2E48A 1T35A 3WSOA 3EBPA 2C54A 2HDWA 2C9AA 4X1KB 2PRJA 4ZQIA 1ZMRA 4BQEA 2OMKA 4C2TA 2KHZA 5LA6A 2ZI4A 4ZEOA 4U9IS 3OHSX 1XPRA 4LDNA 4TTAA 4M1QA 4F4DA 2O1QA 5JADA 5JUVA 2ZPTX 5DLPA 4ZHQF 3E3MA 3PC7A 2DLCX 1JZ8A 4LITA 2FDFA 1YR2A 1HV1A 4UHFA 3Q8LA 4UTNA 4I46A 2GCEA 1G9DA 5E7QA 2BWCA 5KC6A 1HFKA 3G5UA 2WJZB 3M2PA 3ICEA 5D3ZA 4HKOA 4XYGA 1QQP3 1PO13 5H81A 1KSGA 4JHTA 1ZK0A 2AKYA 4TL6A 4KSCA 1C81A 3RTBA 1V5EA 4MGTA 1S2MA 3KVBA 1O0SA 2E21A 4Y2UA 1XIVA 3T9CA 5JISA 4PCLA 2O2EA 3DPUA 5BSGA 1VHLA 4JT9A 2QZ9A 2YYAA 3RARA 1JR6A 4ZHSA 5AOAA 4QXMA 3LHIA 4L50A 4GL4A 4H4CA 5HXVA 3MW8A 1N3IA 1K0UA 4Y1YA 2CD7A 5L51A 5L3VA 4BB5A 2ZRPA 1JB1A 5AI6A 3AP1A 2ACEA 1VL0A 4IE7A 4QODA 4ZI7A 2DX7A 5FZAA 2NT4A 1FMD2 2AK3A 4ER0A 2A2ZA 2B4QA 3WL3A 3JWIA 1T3TA 4V1CI 1V8PA 4R9BA 3PS9A 1QJ4A 2UYGA 3EZYA 2C7QA 5D3MB 5HCUA 1T4MA 1GA1A 1Y8RA 5DI9A 3DEAA 2NU6B 3A25A 4DIDA 3ITEA 1WXHA 1TL7C 1D9XA 3OPMA 3IP1A 2EZ8A 4PRZA 4QOEA 1GARA 4JJEA 3ADOA 2I2FA 4TV8F 1XPOA 4JGIA 1LOBA 2OWEA 1RC0A 4Q0MA 2C5EA 5KSZA 3HBAA 5BNOA 5HZKA 3G85A 2YBSA 2C3YA 1FIUA 2IC1A 3PU6A 1GT91 2XITA 2H2DA 1PJZA 1RRCA 4X1YA 5AUQA 5AJHA 3ZXUB 1CUWA 4DADA 4D57A 4YRLA 4M1SA 1JFTA 1FPN1 1CETA 2I4IA 3I23A 4UFMA 1WDTA 1BMV2 4BQ5A 1Y89A 3V1LA 2BW0A 4DV6B 1GNYA 4AQ7A 3MW4A 2PMDA 4NH0A 3H84A 3PUVA 5IC6A 3QMVA 2BW8A 1CUIA 4LSMA 4BE7B 4GXLA 3E8SA 5B4NA 3LCPA 2RM21 4EN6B 3WTCA 4K20A 4LJRA 1E9RA 4ZU5A 4AWAA 2A9OA 1WY5A 4TSFA 2VK1A 1X1DA 2P9TA 3AJ8A 4M0EA 3ZU5A 2NXWA 1E5QA 2QUAA 4P4UA 4L99A 3RS3A 3WYFA 4AG6A 3DGEC 4ATNA 4F9TA 1ABFA 3KCCA 3S5UA 5CFZA 1LLUA 5EUMA 3VJLA 1N1GA 2EAAA 5BPHA 3QVVA 3VDBA 1IH8A 1CF2O 4F93B 1EK1A 4ZVTA 1U3VA 3L7OA 1HXHA 4EG5A 5BT8A 2YY6A 4D26A 1Z0SA 5JS2A 2EZ9A 2R071 4C4ZA 3DS8A 4Y1FA 4CIWA 4QUIA 4Y22B 3DMTA 2DP4E 4MVJH 2IGBA 3DO6A 3QELB 2YY7A 3FHCB 3GQVA 4F6RB 1OB5A 1V6LA 2ZGPA 4E27A 4PLTA 3L1UA 2PLV2 1R37A 1YNSA 4G5FA 4LZWA 1B35C 1M2OB 4EE2A 3GGOA 3O4VA 4PO8A 1YNOA 1DXHA 1JEDA 2H54A 5EEGA 4XI9A 4XB2A 3QYJA 3HUUA 5FK8A 3DUFA 1V8DA 5TJHA 4EY6A 2CLMB 4BLUA 1Y9ZA 4GH5A 1TAGA 4IVRA 2W2XA 1H6YA 1BEV1 2EF1A 4GOLD 1M8GA 2CZQA 1U9ZA 1V39A 4PHFA 3OP1A 2HDNB 3UWOA 3EW9A 2D74A 4P5YA 4N5HX 2ZVPX 4AZ0A 1DQ1A 4NRPA 4DUWA 1RAFA 2UYOA 2GNPA 2BISA 3UG6A 1WA6X 1WP9A 2FN4A 1DC8A 3WJ7A 1A9ZA 4UFHA 4KI5M 2GAAA 5GADl 4MUNA 4DJTA 2XDYA 4G65A 2J08A 2D6PA 3U48A 4RGAA 4XYEA 4GWMA 1A2KC 2VJPA 4BNVA 5FYCA 3I34X 5FL7A 4BV3A 2HC9A 4KVFA 2X0EA 3KTOA 3DFKA 2A6YA 3KSCA 2FR8A 5D51S 4UVGA 1NLZA 2IIBA 1A9QA 2GNDA 1PWZA 5CNAA 1M74A 3F5FA 4B6OA 4L9RA 4TT3D 2FAXA 3C7KA 3RTEA 2HWB2 2MIIA 5C8CA 1WMXA 4Y9SA 2YINC 5EYXA 1P7WA 4Y2RA 1OXSC 5CB6A 2OO5C 4BM8A 1EWRA 3U1BA 4IVQA 3GARA 2PZLA 4OA8A 3CZCA 4U7WA 4MLOA 1PYGA 3IUPA 3BD7A 1LRLA 4K87A 4P4SB 1Z7S2 5IDWA 2QSYA 5KNDH 4LBNA 3K20A 4GOXA 4DDVA 4JYMA 4O63O 1UIRA 2HPVA 2C0PA 2XDQB 1RUJ1 3T9FA 2XPCA 3LYLA 4P00B 4B29A 2FF5A 4HVQA 2RDSA 4IX9A 3I45A 2PX5A 3ZR6A 3ZDZB 1SBEA 1OH4A 3LT5A 1HRDA 2BR3A 3FC0A 5K3EA 4QGMA 4ZALA 3K0HA 1FP2A 3LF7A 4MGZE 1R7RA 4UUAA 5CT5A 3S2IA 4LBQA 4ZOLF 3P19A 1N32B 5HZGA 4UHEA 1JLKA 2GCPA 3C5HA 4O4HB 3QUSA 1NP7A 1RTTA 3NETA 3MWLA 5ER6A 2PHXA 1IRXA 2QTVA 3DVAA 3RNSA 3VBCA 4WNIA 2I54A 3HOBA 4KNVA 3DUFB 5FP3A 1WB6A 3JV7A 3QTLA 3O1IC 3JATA 1K27A 3SC2B 5DM4A 4DW8A 2R063 4F5DA 2OUJA 3V8RA 3RC3A 3TPCA 4B9EA 4P9YA 1S0UA 3QKWA 2ZZJA 3ZCSA 1R1A3 4DMLA 3U3ZA 1QH6A 1LBQA 1EDZA 1YBVA 3QRWA 3MAGA 3PFKA 2G4CA 4X8MA 1WZUA 4EHIA 5E3IA 3WGOA 4GEKA 5BP7A 3LQFA 2WKWA 3EQZA 2W11A 3W3AH 1XZBA 3B1FA 3T35A 1LEMA 4JI7B 4HDKB 3PPYA 3T54A 2H9IA 5KCMA 1L4HA 2ATEA 4NG4A 4CLRA 1Q83A 2CNNA 5B12A 1XLUA 1BDBA 1KS2A 1TM1E 5ES3A 3C6BA 1NA1A 4IS3A 1CIYA 2P67A 2IYOA 4NMHA 3KQOA 3LC0A 2B8MA 1VHDA 1HWYA 4UPVA 3SX2A 3GRYA 1K5PA 5IAEA 1FATA 3AL0C 1Z45A 5DSTA 1YVRA 1KMQA 1DC6A 1BSVA 1CUJA 4Y0VA 2FPPA 4Q39A 4G84A 2Q9CA 1M8PA 5AJWA 3ZIUA 1FDRA 3GP3A 1RKQA 3H50A 2EJBA 3GT0A 1UOEA 3BJEA 1GPDG 2P68A 3CQ9A 1KYIA 3ZWDA 2ZSIA 3I05A 3U26A 1C4RA 1XTBA 2HT1A 3I4IA 3UJAA 3B9PA 3THYB 2PSHA 4LJAA 1Z74A 2H59A 4Z3DA 1UXGA 3UV9A 4QYXA 5HM8A 1XTPA 5TC4A 2X0NA 1KMMA 4QE3A 3OU7A 3FSEA 1NF9A 1ZBA2 1QC5B 1E94E 1T0BA 4YK7A 2V3CC 5JZGB 4I50B 5EMMA 4ND5A 1HG1A 1WWYA 1JUDA 1ZN2A 3D6MA 4P4SA 5ALZA 5TMBA 2EC5A 1RYHA 4GX1A 2NU7B 3AMMA 4QXBA 3P9NA 4WFJA 4M8NE 5AVUA 1Z0ZA 1BHO1 4ND4A 3R6DA 2ZRAA 3H3UA 3SG0A 3OX4A 5KCZA 3DMRA 2JBAB 3MGCA 3RYIA 1NOKA 1MV5A 1L8XA 1SZDA 3I8SA 5FEMA 4UTRA 4BZPA 5CISA 5ILGA 1G5RA 2PA7A 4J3FA 1LPNA 3RZJA 4NJEA 4ZCQA 3BIFA 3QTBA 3W06A 4PANA 1T6ZA 4TYNA 4OQMA 4FFBB 2F67A 2FQ1A 1XZEA 1LX6A 1FXWA 5BOSB 1HFEL 1TM2A 2C7OA 3I53A 4LRWA 1QOQB 1IVSA 3GMIA 4EY4A 1THTA 3W3AD 5LMCA 4F2PA 2GCOA 4MQ6A 1TYBE 1Y7TA 2CNLA 4L28A 1MLDA 1H42A 3UHOA 1AQYA 4C6TB 4FGJA 2WTXA 4D92A 4ZCLA 3ZWKA 1HEUA 1GM5A 3IUJA 3LVFO 4MGHA 3QH4A 1V7ZA 2KMLA 2W6ZA 3IJRA 1ESZA 4EA9A 3RHFA 1ULOA 1I5ZA 3ZS9A 2SCUA 3RKSA 1QIQA 1KTIA 1NT0A 1Q8VA 5C5CA 3M5CA 3K16A 3H6HA 1PKXA 2C9DA 1MN6A 1Z88A 4DEQA 3TFQA 3T4HB 1JHPA 1CV2A 1D7AA 3IGFA 3QU7A 2R6ZA 2VAMA 3P20A 4KTTE 5J1XA 2PBRA 3F98A 1GPMA 3W9YA 3NXSA 3Q0EA 4AJKA 5FD8A 2W94A 2B20A 4GLOA 3AF5A 2GEUA 3RZZA 3QFFA 3U09A 5KX5B 1RMYA 3TX6A 1A9TA 2YUIA 1KOGA 2CLSA 3P96A 2MWMA 1L7DA 4QT0A 2IYLD 3CB2A 2QQ5A 4QTUB 4BVGA 2Z1NA 1F15A 1Y3TA 4YW6A 3PC8A 2GN9A 3ROXA 1H8ED 3WKEA 2I0FA 1M9NA 3Q1KA 4N5DA 2XMQA 4R05A 4EW6A 3M4YA 1Z2PX 4CDXC 4LSWA 4WACA 1KI3A 5LBCA 1LH0A 5IN4A 4OJQA 1CNEA 3Q8XB 5F23A 4NXNB 4CCJA 1IQAA 1QF6A 4DR4B 1JI0A 1AS3A 4RKQA 3PEVA 3EYAA 1YACA 1NXMA 4H14A 1TMOA 2O2XA 2ZTMA 2MMGA 3QVGB 1MU0A 1E1KA 3FYTA 5D3KA 4YREA 3HYLA 5JZOA 1A8HA 1SFNA 3GUHA 5JBIA 3IJPA 2X5IC 3SVLA 2VI5A 2PVPA 1A3KA 4G1EB 3TGPA 1L5SA 3ET5A 4FS8A 1JOPA 2ZM6B 2PSJA 5DTIA 5FCDA 3PXBA 1H22A 2X22A 3UH0A 3UGFA 4WBNF 1UQUA 4NCJA 3OBTA 4ZT6A 3Q7QA 3BK2A 4H3WA 4L3OA 1RVF1 1VG1A 2V65A 3EO6A 4AY4A 1MRZA 4BIMA 1F4HA 2LS6A 3AB8A 2QLMA 2AYZA 5JJIA 1ATIA 4H9GA 3OBAA 3KJGA 1W0JA 1WL8A 2YJZA 2CF6A 5IWAB 1CAVA 2HMUA 2QP4A 4RZIA 3VZQA 3U44B 2PVCA 2QW0X 1ENXA 3KX2A 4L4SA 1YOVA 1BHJA 4L4XA 2RHMA 3IE0A 1KEXA 4URYR 2AR6A 5TPWA 1Y9QA 2HRRA 2G1AA 1Q0HA 3L8YA 1WDLA 1V71A 1XXHA 1EM8B 4MZDA 2CXTA 2F3SA 3H9EO 5FWDA 4FX5A 3PITA 2EGGA 3PVOA 3QUQA 1CRPA 4CN9A 4LJ4A 4O0MA 3U1XA 1KI2A 2IHKA 4EO9A 1PK6B 3E6AA 3C8XA 3R3WA 5AVJA 2PZBA 3OQIB 5DUXA 2GKGA 3DR3A 2FMFA 4BHPA 4WFQA 3RU2A 4DA9A 5LQUA 2A75A 4I8XA 1RQ7A 3U39A 1ODCA 2AV6A 4EFDA 3TTYA 3H1AA 1KKLA 4JSRA 4IE6A 1PMJX 2ID7A 4W9NC 1IQPA 4LBVA 3F49S 2PRIA 4P2BA 1H2XA 5ITZA 4YT8A 5LN1A 3OIDA 1BMTA 3CEHA 2GUGA 3MSXA 2LW7A 4DUXA 4GVPA 5JDCA 2CYCA 1U3WA 3T9EA 4FDAA 3AETA 3QWBA 2QD3A 4BVHA 2XYVA 4YQYA 2O8FB 5I01A 5C53B 5DK4A 4LV6A 3UK6A 2AGVA 3I49A 4QM9A 2I3DA 1XT6A 4FGZA 2FPUA 2XBO3 3FI0A 5JS8A 3G02A 1GPAA 1QTRA 3DPSA 1YU6A 1SUEA 3WYEA 5JPDA 3ZV7A 5F5AA 3R3VA 2HNKA 1AKQA 1H1IA 2Y6GA 4NSNA 3TRJA 1N2EA 3WAJA 3R5HA 1C3JA 3WDWA 3STYA 2ZBJA 2KXLA 3PMSA 3OUHA 1H6XA 4DA6A 1U0JA 4GD4A 2YNMA 4MQLA 1H85A 4JQRA 3VH1A 1W93A 3DGTA 1E62A 1P2FA 2XWJI 1M67A 2WU4A 3A3PA 1B14A 3I9OA 2JDKA 3W8DA 4FI3C 2WIDA 3H87A 2V4VA 5I4KA 2RI1A 4B7CA 1NI5A 5LLSA 3KQWA 5CDFA 4HMPA 3AVWA 4A7PA 1PR1A 3VSCA 3BWBA 3L7MA 3QPCA 3NX4A 4P92A 4QSHA 2BT4A 4CM8A 4ZCPA 3TO5A 5C0OE 2XW6A 4JU9A 3ZQ4A 1IBLB 4IEEA 521PA 3I4LA 1FTNA 3C39A 2BTVC 3ZDCA 3UPDA 3ZCTA 3SZRA 5D8AB 5FX2A 3OM8A 3QPVA 2H9AA 4GX2A 4NIHA 4CQNA 3FA2A 3N28A 5KSOA 1RYZA 1KK3A 1WKVA 2I4RA 2HIMA 5TV2A 1N6HA 4MH0E 2DBQA 3BKZA 1DKRA 1KQGA 2WKQA 3CCCA 1R1ZA 2W2LA 5FBKA 2B8WA 4PZEA 4OMFG 1JFFA 6PFKA 1ZRFA 4YNBA 3Q3IA 3L7NA 4HGYA 4I09A 1C8LA 2QZSA 2G71A 1B41A 4JWTA 4LORA 3JU9A 4LRQA 3K6RA 3EXHC 1FX0B 1CR7A 1SHJA 3EA4A 4KB5A 1UPSA 4WDRA 4GPAA 4QGNA 4I9HA 2D2XA 1QS0B 3W5SA 3I42A 2IW3A 1E4OA 3U7QB 3P2KA 3QOXA 1Z7S3 2OXRA 1U0BB 3EY4A 3JVEA 4C7BA 1H0RA 2FGKA 4W8GA 2MEV1 2FEAA 2LPMA 3N7AA 3FPHA 1PL8A 3A0NA 4EI2A 4BCBA 2BMFA 4C4AA 2ZATA 1QG6A 1QVVA 5EXTA 3VO1A 2Y1CA 3FUTA 1W06A 1BGWA 3H0EA 3HCNA 1H1DA 3EAGA 3O12A 4HLNA 1Y37A 2F7SA 2GK4A 1TC2A 1ZS9A 2EIDA 1UJ5A 1ATZA 1F4AA 5BRNA 1TADA 4DJ5X 4C6HA 4FNMA 3B5JA 5CVEA 1QB8A 1CUYA 2J7KA 5FZ3A 4HLQB 1E2DA 1WW2A 3CU5A 4ESVA 3MBWA 2OP1A 3O8NA 2NU7A 5CM9C 3CNAA 5ESRA 4DMRA 1D4VB 4KNWA 5CBPA 2P3QA 1CX9B 2BRUA 4R1LA 2GJSA 4W6ZA 2POCA 3K4ZA 4DNPA 2RJ2A 1EFUA 1PJAA 1P80A 1XKTA 1OF3A 4B47A 1YR6A 2X5NA 3LQRA 1QYWA 3WK9A 1EFKA 3X29B 1HQLA 1FSSA 3Q3CA 3D4BA 3LFTA 3V8EA 2FCAA 5IBPA 3P4XA 4BAUA 9ABPA 4II7A 3IVXA 4G0MA 2CHGA 4QYIB 4XYXA 4J1WA 5CYYA 4YWAA 3FOFC 1CFZA 2EP5A 4JMLA 4DQKA 5C5IA 4EO4A 4K40A 3KYIB 3VZLA 2P65A 1YGYA 2XUEA 2ZSAA 1S3IA 5AVAA 2POQX 2WLPA 2DU0A 4IXDA 2BVNA 4ZWNA 3P0FA 1JDBB 4RPGA 4GMP1 2YH2A 4URUR 3ZQKA 3NIBA 5ABJC 4YRIA 2IZZA 1BHQ1 2WTAA 1T6XA 2CXQA 5E2BA 1LGBA 3BMCA 1G16A 5FWXA 4ZQFA 5FBWB 3BXXA 4UQOA 1IN5A 4LF6B 4RFT0 3IDSA 5DYTA 2P9JA 4CQLB 3VZKA 3HFGA 1AD2A 3UHAA 4NKRA 3LLSA 3B1JA 1KFCB 3SVTA 1CUCA 1ZOPA 1FS5A 3HCBA 3IP3A 4YMWA 4XD7D 2F6BA 3WF1A 3KSMA 3KOMA 1RLUA 1SOMA 1U7OA 2X0IA 3LA7A 3RASA 3A1CA 1XZAA 3S8EA 1WZEA 4FFRA 1VCMA 4ORFA 5CH3A 3E3NA 2VR1A 2PWYA 4R2XA 2J1EA 2QVZX 4BX3A 4PDWB 1N5DA 5DMHA 5TEVA 4QDXA 4YJKA 3L8DA 4MZUA 3RYCB 1B0ZA 5EG5A 4LA3A 2GAJA 3AHJA 1FDUA 2AH2A 5IHPA 3W9SA 1NYLA 1C1FA 1CQJB 1FDSA 5BMOA 2CL0X 4OAPA 3QU9A 4BATA 5IVVA 1A8IA 3MT8A 4MWGA 4CF4A 5K4LA 3I9FA 5A7WB 4GKYA 2A3NA 2WIGA 1W2AX 3GK3A 1VBD2 1XCGB 2X6QA 4U2KA 3DA8A 3FNHA 3RREA 3RIEA 1DWQA 5LQDA 4N0PA 3T1LA 4B3FX 2BIFA 2BD0A 3U61B 1CWUA 2R2AA 3HNRA 2VQSA 2WYIA 3UFXA 3Q5GA 1XZ8A 3NVAA 1RUI1 5EJ7A 2QN2A 2ZJ2A 3PRYA 1JIVA 3FTPA 1PK8A 2J0UB 4RSRA 3ZQJA 3P7MA 4DG5A 4ZVNA 1ZH4A 1Q57A 1XSQA 2EWWA 3ICWA 4WM7C 4F45A 1YRBA 2JAQA 4G4FA 3AZXA 5BR1A 4F3KA 2NX2A 4JGYC 1W8TA 5GLUA 4KI7A 3IBMA 1N2JA 4FFHA 2JHFA 3FDFA 4KR6A 5KWSA 3GLFB 3L82B 3BHNA 5IVHA 4W82A 1KL7A 1SO8A 4CNBA 2BNMA 4RC9A 1PJ2A 2WS91 4DR5B 1S1CA 2I78A 4LVNA 1NVFA 5FZHA 2QRVB 2WNVB 4RD3A 3OPQA 3GBSA 3PSHA 1H6BA 3KPYA 1GTMA 4DLRA 5AESA 1GYRA 1DXQA 3MQ2A 3UA4A 1SA0B 5GQSA 3BQMB 1W8IA 5EJMA 2QWXA 4HOYA 5DWDA 3ORYA 1E2KA 4GP6A 1E3LA 2YPDA 3CR8A 5LL6P 4X6XA 5I7VA 4W5JA 1QDUA 4X1IB 5JR7B 3F2IA 4QECA 1BK1A 2R8YA 2A0UA 5A3NA 1DU4A 2NZ9A 4YTEA 3JWHA 2JE8A 5LXTF 5ADWA 4KJXA 4U2FA 4ENPA 2OCGA 4YZ3A 3KQ4B 1VRH1 3RRJA 2DFPA 2BL4A 1FNMA 5J2UF 1QPBA 2JDZA 4DDTA 3MHZA 3K73O 3FGZA 3BIWE 3L04A 1L4LA 3PEFA 2WYFA 5C34B 4NV1A 4OH1A 5K0JA 2PXHA 3JB8A 3PL0A 1K7FB 3L4BC 1R6XA 3H0CA 1U6IA 4AQSA 4DA7A 1IZ0A 3GB9A 1PNGA 2GTHA 2TMKA 3TSWA 2E4XA 2OXTA 5EZ5A 4ZRMA 3F6RA 5FPVA 3VR1A 2W6OA 4P7GA 4RY9A 4OSPA 1S01A 1OCEA 3GRVA 3J7NA 1CY4A 3O03A 4QUGA 1D5WA 1Q7EA 5A4MS 4UDYX 2AWNA 1MQ8B 2WFAA 2ZVDA 3A6ZA 5J37A 2WIAA 4KGGA 1GPWB 4FZ3A 3THXA 2HJVA 5KVAA 4HDCA 4A1FA 4WK4B 3H19A 3TIVA 3UAYA 3KR9A 4XFJA 4F0JA 2JFPA 5IVYA 1ZAKA 2HSJA 4YDSA 1CS4C 4PSVA 5JAHA 4MQMA 2QMZA 1FPQA 1Z38A 3GPIA 2BY4A 3EOBI 3K5IA 1ZQ1A 3WRXA 3M6MD 4I3HA 1ENSA 2VP6A 1SXJB 3J26N 3HUEA 4E03A 3DE6X 1NF2A 3WWDA 1SR8A 4FTBA 4IJ6A 5ICSA 5A32A 3WL7A 1BHSA 4Q9IA 2VH5R 3HR8A 3P5BA 2ODPA 4N6GA 1H1TA 5I9MA 2QQPA 2UAGA 1SQ5A 4FFSA 4KRYA 4V1CB 1IVNA 4JTOA 4NJMB 1WCV1 4RE5A 2J1LA 1RYBA 4LXUA 2P34A 4BX2A 1PWYE 1JR3A 4EQVA 2DG2A 4B4KA 3C0KA 2ZGNA 5IRCD 1VIDA 2ENRA 4JU8A 1VGQA 3FNFA 3QEJA 2ZS6B 3THYA 1W0PA 2E7TA 2A1IA 1R3UA 4BMXA 5ANRB 4WZ6A 2AW3A 4I19A 4QJIA 5H16A 3GLKA 3T09A 3OJBA 1SXJC 3C3CA 4FSHA 5CJ2A 5F4BA 4JC8A 4LV5B 1IK6A 4EB6B 4BUCA 1OH3A 1Z5GA 1AXYA 3A6JA 3B1KA 4RR3B 4IINA 1L4GA 2N0SA 4AVSA 3F8TA 1GCIA 4NQZA 2PPVA 2AR0A 1WF3A 4WXMA 3CLUD 3A7DA 1F3OA 3PC4A 4J9VA 4P33A 1POQA 5C37A 5E89A 1HRI3 4LX0A 5DASA 3HKEB 5HF6A 2B1JA 1UBLS 1H8EA 2CTVA 5J96B 1A9XB 2FPRA 3U78A 1E9VA 3IIJA 3AK4A 3OA0A 1I9CA 2Q27A 2ZOSA 2OV1A 5E4FA 5BNOB 3LBYA 4IIGA 5A4KA 4AKEA 3B20A 2HHAA 2NUPB 3PDIB 1G18A 4RF4A 1RMTA 3V00A 3LPFA 3BTZA 4RE6A 5EEHA 2VL4A 1E4VA 5FTMA 2HLHA 4WSOA 1UX7A 2AEFA 2VW2A 4OMDA 5I0UA 5K99A 4J7AA 2HV9A 5DM0A 1JYCA 3TTUA 1QONA 5D2AA 1BVUA 2P4SA 2HK9A 1JUIA 3Q98A 3C70A 5G0WA 1QRSA 4KFCA 2O8DB 1FSZA 4DV1B 1VLZA 3UPTA 1GP4A 1IXRC 2VF2A 2IYVA 3IB6A 1L3JA 1MQAA 4GZ6A 2I1VB 3TKYA 4NMXB 2QMYA 4F21A 2TNFA 4JA2A 2HQOA 2WAMA 3PRJA 4WFIA 1YHZA 4TMFA 5THQA 3ZQ6A 1WU7A 2GD6A 2O0JA 4XQ9A 1KZ9A 3EZ6A 3MEQA 2OGTA 1UPUA 1JTVA 1W2OA 3IBTA 3ADBA 1YI7A 1GPBA 2JDID 5DHSA 5CA6A 2IZ6A 2WG2A 1UBCA 4HXEB 5LYJA 3LXUX 5MHTA 5JR3A 4L0CA 4I14A 3L1KA 1GV1A 1ND3A 3CUKA 3FOCA 5G4LA 1CNFA 1NBAA 5FQ0A 3Q15C 2GFHA 2GHIA 4E8DA 1SHKA 5EPEA 1I2BA 3ULKA 1XDZA 1IMJA 4BVBA 2E4YA 2O57A 3GJBA 5A2GA 4AYTA 2YBDA 1AYN2 3RC7A 3ZWOA 1CIPA 3EBLA 1B6TA 3AZYA 4ENRA 1MZ5A 4XE9A 1N1SA 3NKLA 4QX3A 5JJCA 3NOXA 5A3MA 3T3OA 2I65A 3KJEA 1RVF2 1FYDA 1MAWA 3TZCA 1M2HA 4OHWA 2XYQA 3Q2KA 3CNBA 4M36A 3HR4A 4YW2A 4J0GA 5DNCA 1A4XA 3LMKA 3SBDA 3MC1A 2NVOA 4EQ6A 2H1RA 3PDQA 3NP7A 3USCS 2UVDA 4M86A 3UESA 4ZO9A 1CD5A 1C1DB 4LHYA 4JV4A 1OXUA 1ZITA 5E9AA 2P9QA 2JX9A 2HRCA 4C0BA 1T8YA 1T3LA 2F1KA 5F1PA 4F3RA 2XR4A 4ZXPA 3P9SA 2PX4A 3R3ZA 2PHLA 2C5GA 1O4ZA 4LNAA 3UKTA 1RHMA 1CIJA 1CDZA 1XZCA 2XVMA 3PXDA 1OZFA 1QQTA 1VMFA 4CMGA 3LLCA 3AJAA 1CR4A 3H5LA 4XHXA 3NC1C 4GSYA 1GNTA 1TME3 2FV8A 1P7PA 1YR8A 4WLVA 3L7YA 2GAOA 2PSEA 2WE7A 1ZC3A 1E7SA 1J0BA 3CV3A 4MKIA 3GYDA 2RAVA 1S9DA 4G89A 4E8CA 4HUTA 2FHPA 3KZCA 1YL7A 4Q26A 5CLFA 3NHPA 2VC9A 3V32A 4QPIC 3AYAA 3STUA 1BD4A 2RGBA 4YRNA 1P2BA 1DQSA 3AZQA 3P2YA 2W6PA 3HXTA 3Q3JB 2AOUA 5JVDB 3AUSA 1JVBA 1HE1C 3NHLA 2G80A 3GN1A 2HPZA 4KQHA 2ZHLA 1NP6A 3K0FA 3IQWA 3IAM6 1ZAYA 1DJMA 1YE5A 2E32A 3BMNB 3H8XA 1EJ6A 1NYTA 1XTJA 3C6KA 3DYIA 4XARA 4R9DA 4R2KA 2NZUG 3RRNA 2VFAA 1NM5C 2FQXA 4GQ7A 3DLCA 4L08A 4B34A 1SKUA 2ZX4A 3S0MA 2GO1A 1CD3G 4ETMA 4Y2GA 3USZA 1NG1A 4TX1A 4UEQA 3EZXA 3IC5A 1SWVA 2ZSKA 3HHEA 1QHFA 1PJCA 2YROA 2B7YA 5GALA 2WZ8A 4W65A 3L0YA 3MFYA 2DAPA 4EA8A 4JQCA 2RHRA 4GR4A 3VO9A 5TPZD 3VI4B 3VBHA 1OH7A 5A3OA 3B9RA 1T15A 2VVTA 3A28A 3U44A 4Z2WA 4X9XA 5JSYA 4YRTA 3RI3A 1PG5A 3UAZA 4RTLA 3RD5A 1LV7A 4CU6A 1NIPA 2I66A 3NAMA 3THPA 5JC8A 1H23A 1UWKA 5ESDA 3WSTA 4NMWA 2VPYA 4KG0A 5HK8A 4DMCA 1QXJA 1N78A 1CSEE 2F8SA 2YVKA 4AXBA 3PXXA 5F73A 2XF2A 4ZJZA 3QWHA 2YTZA 1NA1B 2HBYA 4DGQA 4HZGA 1FLDA 4PYMA 4GPD1 3GLIE 3EXHB 1HMPA 1HDZA 2GF9A 4CU8A 4QXOA 3ENQA 3WDVA 1J2UA 4W1RA 1W4RA 5CBKA 1ULDA 1ZCJA 3H13A 4JI4B 2CY6A 1CRWG 4E7PA 3VHOA 5B30A 3AP7A 4G1CA 4BO8A 5EI5A 5JMOA 3QH6A 1JTEA 4J25A 4CCYB 2TUNA 2GEKA 4EKEA 4E4RA 4GFDA 3UWDA 3V7YA 1YFWA 1BCRB 4UARA 3X2EA 1KD7A 1WSBA 2D2FA 3D3NA 4Z5XA 1ONPA 4KPFC 1IJBA 1KEPA 4WTOA 3T30A 1NA1C 2DQYA 5ED0A 2G9QA 5F5CA 4QOJA 2E33A 5EE9A 3U7IA 2ZYGA 1EFPB 3QVMA 4B46A 3VAAA 3G8DA 3RH0A 5BSWA 3MBOA 3RO7A 1JJ7A 4MV6A 1LLFA 1Z34A 4JYBA 3GLGB 5HI0A 4MLZA 4NP6A 1ETUA 3VU0A 5AW8A 1Z63A 4TN5A 3PUIA 1PGL2 2EXIA 2YFUA 3FJSA 4IWYA 4TMVA 1L5MA 3PNBA 4X91A 2Q4OA 4AOCA 4LJKA 2JFYA 3LI2A 3KGLA 4B87A 5LCWL 2XKJE 2OG2A 5LW9A 2VRWA 2ZJ4A 3CNHA 3HE3A 4YMTA 1H6AA 4HANA 1FSGA 3NH6A 4XDOA 1AMUA 1TA4A 3GFPA 4CE6A 3T9BA 1QBKC 4XUOA 1PVC1 1UIKA 1O3RA 1Q2UA 2OCYC 3G7UA 1DZIA 2O5CA 3MWDB 2JFWA 4G5SA 1SPPA 4FDLA 4JGZB 3WNOA 2DTYA 4DTIA 3T1NA 3HXMA 2VXBA 1I3MA 2W4MA 4HEQA 1I1HA 2OV3A 1LU2A 5AYVA 5G4KA 2G06A 3OE5A 4I9FA 4RJJA 4QWNA 2G09A 1UF2C 5CM2Z 1KXGA 2DHQA 5EESA 5A1TA 4D6QA 2QYTA 1F0KA 4UBLA 5DGTA 4BNGA 3IOEA 1E89A 3DCYA 5CH5A 3UT6A 2ZHKA 1U99A 2BHRA 1JH5A 2W0SA 1SCIA 4W7SA 3AY3A 2B39A 1MZFA 3PIJA 4V0QA 4WLOA 3R3JA 1ADYA 3CPHA 2XTJA 2VF5X 4KGDA 4YT4A 5ICMA 3HVHA 1I33A 2VH9A 3R4SA 5BSEA 1G8GA 2PG3A 1DOHA 4N43A 1ZGJA 2OW4A 2BFFB 2G4VA 4LO4B 4FW9A 1P7CA 3CRZA 3S7IA 2CMDA 3CWQA 2JGDA 1Z8NA 3MJTA 4AVAA 1QTNA 4DY6A 3EBRA 5GJVC 2L82A 3J7MA 4DCMA 2J30A 5A4IS 2V7QD 1Z7GA 4ZMRA 1X94A 1PL0A 1Q0SA 2UZ1A 4BJ5A 1WBDA 1NAHA 3U14A 1W44A 2W9XA 3JCZA 3ICCA 4DC9A 1QOPB 2DUUA 3ADPA 4HEHA 4H0FA 4V38A 2AMYA 3KWLA 5FTLA 4UUPA 4TV8A 1YLLA 4D9HA 1EYZA 4AEKA 4YJ3A 3ACIA 1M6VA 3KT0A 2IPLA 2Y33A 4R0NA 4IUDS 1Z13A 5FPBA 3TG8A 4NPRA 3HG7A 1Y4SA 2PNJA 5K0SA 4AULA 2JAXA 3QFSA 1SUFA 2Z79A 4LRSB 4RKFA 1U3GA 1R0WA 3WNZA 3AOEA 3BIOA 3MBKA 2JB9A 2O8NA 4DBLE 2B6HA 5J58A 1K3IA 2ZR8A 1V37A 2EIBA 1OI7A 4RS5C 5GM0A 1Y1QA 1DBNA 3E5MA 1M6VB 4PC7A 5DP1A 2DTDA 3GJ0A 1Q0ZA 4FPJA 5EZWA 1FMTA 3ACCA 1T6NA 2QSJA 1RRGA 4LUKA 1YQCA 3BREA 3ZX5A 1R0CA 3ELWA 5E0KB 3TINA 2BTQA 2ILTA 1T6YA 1B0UA 3LHKA 2UUBB 4HGRA 3DWFA 3PRKE 3AI1A 3DEZA 1KIFA 3IR6A 4YJHA 1PTJC 1G66A 4MGIE 4M60A 3RU3A 3DF9A 1B74A 2Q1TA 2WHXA 1L7VC 3O0VA 2R97A 3WOHA 1E1RA 1NLUA 1Z17A 1V41E 4HPJB 1CUAA 4YW4A 3JTMA 5A9SA 2ARBA 1AHIA 1KHHA 1MT3A 4COWA 1TFRA 1WEKA 4UUQA 4WA8A 1G6Q1 1ZUIA 3PDIA 3QIVA 5B7PA 1Z9BA 3CPEA 2OHOA 3OD4A 1X7GA 4LBYA 3H5AA 2C2YA 2XKOA 1DX4A 2YBKA 1GU1A 3RS8A 1NFRA 3IR5A 2IYRA 2YWEA 1MS5A 1R3DA 1DO2A 2A78A 4MQEA 2MR6A 3L18A 4JS0A 2O8BA 4J91A 1PQWA 1XTKA 1V16B 2C92A 1OLUA 3A6HA 5JOQA 3GRCA 2O6LA 4HN4B 3QITA 4NOLA 3GEBA 2JIZA 5THXA 3MJ4A 4NHMA 4O4HA 3AHGA 2RGDA 4BNWA 2W52A 1PTKA 3NWEA 4AGRA 3MAJA 4P4LA 1VL6A 4CUGA 1AKYA 2XMDA 3UWSA 2B37A 4JCKA 5SZKB 5EFUA 1DFHA 2XMZA 1P7ZA 5IW8A 4IF4A 4OQ9A 4LO8A 5T8KC 5DN6D 3ZYHA 2IYFA 4F91B 1JIUA 4MUKA 4XA8A 4KHPB 2GP5A 4UMFA 1OX5A 2GGSA 1X2EA 4M7PA 2VIIA 3FNBA 1K45A 4BFVA 1VJRA 2GKSA 2UUPA 4NFHA 1AA9A 1AQIA 5KMGB 1L5RA 2QM0A 1OGJA 1OYWA 3LC1O 3BFPA 3O7WA 1PUJA 4CLRB 2TSYB 2ZUEA 1F2UB 4TRMA 2EJTA 5J1SB 1TQ6A 2HZBA 2VOKA 4WNCA 2X23A 4NAVA 2F3RA 5LA6F 2FCTA 2PCLA 2HWE2 1UF9A 3GG2A 3DSRA 4BV9A 3ZUGA 4PIXA 1XLTC 4TTQA 1KJNA 2H4XA 4UAVA 1A04A 3SZUA 4IDQA 1UXZA 4QPZA 2WBKA 3CS3A 3EZ9A 3WL6A 5FI3A 1RQPA 1NBEA 4Z49A 2VQ3A 1KFKB 1EZ1A 1OWNA 3FPLA 2WF8A 2ZTNA 3PGKA 3WWZA 3LU1A 5DBIA 1A9XA 1GOHA 1CQZA 4B6GA 2C3OA 2XZLA 1YRWA 1ECPA 2OV4A 3IQGX 3ANLA 3ND7A 3S44A 4FHCA 3AP2A 2CCJA 5LZ7A 2AHOA 3UGHA 4HQLA 3TVYA 4DDWA 2WYSA 4Z0NA 2YS6A 5KO2A 3N7JA 1WXFA 4IRXA 1S1MA 4LFBB 1C29B 5E7MA 4C0WA 5EKUA 3KOXA 4XDGA 4PCVA 2VT7A 4RS4A 4H7EA 3D1VA 3CGGA 4FKZA 2E4UA 2J5KA 1LPPA 1W87A 4HAWA 1ZR4A 1I5EA 2W3JA 1C7EA 5LQNA 3PZBA 3CSSA 5ALHA 4NN0A 1EXMA 4HLCA 4QPGB 3L4SO 3OMXA 1T13A 3GZ4A 5EVCA 3ZV3A 4I8DA 4YMIA 2Q0HA 1F9AA 1QQ7A 2VPVA 2X8JA 2P1DA 3WWCA 1HNNA 3L0SA 5T55A 3TWIA 3WLMA 3L01A 1P44A 1AX2A 4TV9B 3HFSA 3GJAA 4FFBA 2Z5GA 3HQUA 3E7DA 3GY0A 3KKEA 2NU9B 1DQ0A 4HBNA 4QHBA 4Q4Y2 4GGMX 4YRQA 2SECE 1PJQA 1OXCA 1D0SA 2DY1A 1PO12 1FFGA 5CVJA 3OOYA 2WUWE 3MUNA 3A26A 1UYYA 5K3BA 1T5SA 1QGLA 1XPWA 4E6PA 1U2SA 3QU5A 4MWOA 3AILA 1DG3A 2NO9A 2IF0A 1NJ1A 1T5OA 1M72A 4M0LA 1ZX1A 2JI6A 4OYRA 2X2PA 3RVSA 4B2PA 2IXFA 2JCYA 3ID6C 4EJSA 3H99A 3HAGA 5AW3A 5EJ5A 1VFNA 4X66B 3JWPA 1C3OB 1UMDA 4R2WA 2C2HA 3AKYA 4KQIA 2Q3CA 1Z75A 4HB2A 3PB3A 4LMFA 5FIUA 4OHFA 2XWJB 4U7JA 1MO2A 4KUEA 2DTXA 1PZXA 2YU2A 5HQJA 2HI0A 1IS6A 1COWD 4R1NA 5ARBA 3WGGA 1CEEA 3N3AC 3AETB 1BS1A 1T10A 2FDHA 1LEHA 5GKAC 4EJSC 3VPHA 2OR3A 2EZ4A 2GCIA 2HEGA 4NFSA 2Q8CA 4EWLA 1KE1A 1GNLA 1U2DA 4MROA 1OT3A 5K3FA 3UKDA 4GI5A 4BFCA 1WXXA 4YR9A 1CAWB 1N2CA 3BKXA 3WG4A 1GDTA 2OGUA 4C03A 4MUJA 2XNKA 4WVMB 3GD7A 2FWNA 3H9JA 1JLHA 1XYGA 3B52X 5H70A 1WHSB 1LW6E 5A4JA 4WBSA 3MMPA 2GVZC 1K7CA 4B1LA 3I73A 3DM9B 4CUZA 4HVRA 3IYLW 4HB4A 5LK7B 1Y3BE 1SLAA 3TJZA 2YZKA 5LWQA 3ZXEA 4R83A 4RQAA 6GPBA 1YI9A 4ML3A 2P6UA 3E6CC 2I76A 1Z0KA 5D1HA 4JXZA 1C3EA 1TG7A 2A1TS 2WQ6A 3KD2A 5JI2E 1BKYA 2CUZA 1SXQA 3KQVA 3SXWA 3SJBA 4QYIA 4LK2A 3KOUA 4BQSA 1EB8A 4G9GA 4UZEA 5KBYA 2QQGA 4F4FA 1O96A 5FZOA 4LNUA 2HWF2 3R09A 4A73A 1TDJA 4HEA1 2RJLA 1RUE3 5L9AA 2QX9A 2XVXA 3TKAA 5G40A 1QFXA 2GXQA 2AN9A 3TNFA 2DT8A 2CFIA 2NQTA 3V1NA 2E0IA 4LYDA 3B1ZA 5K6AA 2P9EA 2MYNA 4PN7A 1L8AA 4AX8A 1NQTA 3EGXA 3SCZA 4C14A 4L3WA 2BJSA 1LGNA 4AMUA 5DV9A 1L4UA 2HIGA 4QU1A 1N3OA 3EQEA 1E3JA 3FUOA 2JDIA 2Y64A 3OB8A 1ULFA 4F2DA 4ALLA 5FYUA 2ZAMA 2ATXA 2E5FA 4OYYA 4ODIA 4BYYA 4QVIA 4WOCA 3RVLA 3K77A 3KHTA 2QPOA 3SM9A 4DSAA 1BXRB 1IXZA 2FFQA 1LDMA 1HUQA 1E1QD 4PZDA 3SLRA 1VIMA 3VVLA 1J33A 4JHXA 5FV4A 2O7SA 4U7GA 2QQJA 4B6JA 3OQIA 1TZ2A 1XYYA 1N5JA 1YZFA 3QWFA 1N8TA 1PR9A 5IFLA 2R8ZA 2JG3A 4LIVA 1DC5A 1SQ4A 3KALA 5LQKA 1R0BA 3NNSA 4YDHB 4RACA 4KR2A 1BXKA 4HAVA 1V6IA 2VK2A 5IBCA 1IY8A 2YDEA 1YCHA 2QD4A 1VRWA 2WYWA 3BE8A 1ISHA 5JNSA 1QHEA 2CNDA 3B48A 3UHJA 3SDSA 3DFZA 1T4GA 3CT4A 2G07A 1YQDA 4LBJA 2YV2A 3VBUC 2XVGA 3RV3A 2PFWA 3R8FA 2VJLA 4OUMA 1BJQA 1YJAA 1B8VA 1XXHE 1E64A 2DPHA 5KVSA 1IPHA 4KX3A 1SAYA 5CFNA 5LDDC 5KU7A 3JZIA 3DOIA 3KQLA 3D1JA 4CUAA 1QMJA 4XILA 1JFLA 3T95A 5GZGA 2RI0A 3HP1A 1UFOA 1F12A 4IIJF 2IGTA 1L0BA 2UYCA 4LKDA 4G9EA 4AVVA 3K3OA 2ZIFA 1DAEA 4CKZA 5L7WA 1DT5A 2GC0A 3W5MA 1SKYB 4ZHQB 4PM4A 1FW6A 3AHEA 5K8SA 1MZ6A 2DXIA 5DQ0A 3QY0A 4Z1VA 4PLGA 2VQUA 1JQDA 2D3SA 1AT1A 1KIMA 3HBMA 2WAYA 2JAUA 1UW8A 2GC1A 4D9MA 3L0BA 2I71A 5KJFA 4TXHA 4XBQA 3KK0A 4IJUA 3WFZA 2Z09A 4WLFA 1U81A 2W6MA 3ZE2B 3UWPA 4B2LA 4FHGA 1RCUA 3PXGA 1GEGA 3EVZA 1P4JA 1U2EA 4HK8A 1GGHA 2FWJA 2PWPA 4ZJUA 5CX1A 3Q7IA 4V03A 5DU2A 3ZHBA 5C9AA 1MFZA 1QFSA 1JG7A 3SXUB 5JO0A 4PCRA 4I8IA 4S1PA 3RAEC 2B4AA 1K86A 2WD9A 1GZ7A 5LZ8A 1Q1EA 3HGQA 3UUEA 2EZUA 1DSSG 1NR1A 3KL4A 4OGWA 3SFVA 1FRVA 2M9MA 1OVGA 1E5SA 1W1WA 5GVSA 2I33A 4MI3A 3RVDA 1PK9A 4GKBA 2Q5LA 5AP9A 1HDGO 3BICA 3EMRA 3V56A 1YT5A 1F0PA 4FPLA 3AJEA 2WO7A 4DRRA 5FI5A 5I91A 4Y4RA 1GRVA 4NAUA 1H5UA 3AFHA 1UDXA 4IG9A 2WN3A 3D3QA 5LBTA 3CUVA 1W8FA 2EX4A 4MCHA 1WHTA 1JBKA 1DFIA 4YM2A 3VPXA 3L4KA 4RESA 3TVTA 1JALA 4DE5A 3R6SA 3QLVC 2VBFA 3U4XA 1AKMA 4ENQA 4NESA 1X2BA 3VHXA 1H0KA 1EHYA 4C6SA 5KOJA 3OTFA 3RFXA 5FOSA 1OMIA 3GH1A 4RUKA 1XFDA 1R2QA 1KRXA 3A4NA 5HCHA 2WWWA 4FZJA 3GFFA 3REQB 2I80A 4D99A 3MWEB 1E9FA 1ZOIA 1GP5A 5JCTA 1Z25A 5D84A 4XWWA 5BUQA 4RDIA 1GLGA 3S27A 3O7OA 1J8QA 4E70A 1T26A 5JE8A 1GOFA 4Y2VA 1W8HA 2N42A 2GLTA 1GQRA 1JXMA 1O6BA 3CNNA 3ASIA 1UZVA 4FZ5A 1CY8A 1MGPA 3VDNB 4CV1A 4BMYA 1KH1A 3ZXYA 221PA 3K30A 3H4MA 1CY7A 2JD0A 3WLRA 1NBME 4GWGA 2QR5A 3E2IA 3W20A 2SKCA 4ZYZA 3L6DA 2H1FA 2ZJFA 1YQXA 3UVEA 3OJOA 1PZEA 2QJFA 4UW9A 1UU4A 3FYUB 4Q4W3 2ASEA 4OOEA 1XMXA 2VDWA 3UGJA 2PKQP 2GBLC 1B7GO 3FHIB 2D5AA 1J2TA 3CC8A 3QBEA 3SXJA 2ODNA 4KRGA 5I0RA 1AZDA 1EFVA 3IV7A 1QQBA 4DMIA 1P0FA 1HX6A 2QMUA 2ET7A 3I0ZA 3HZZA 1YV9A 1HSZA 1O58A 2A9RA 1SEPA 5FTNA 4A27A 1MG5A 5J3UA 2WYVA 4YROA 4FAHA 3H83A 1TAQA 4KO8A 2OLJA 2O06A 4Z2AA 4H7KA 2Q6TA 4CEYB 3TSOA 3AMNA 2I67A 4AB1A 1D07A 4H0CA 1KBQA 4KIGA 1ACJA 1N47A 1DDGA 2WP0A 4L5IA 1K92A 4LQ4A 1FDVA 3OGSA 5IT6A 1UK6A 3KVNA 1QPZA 2OTCA 3ITQA 2GK6A 5JSPA 1OPRA 2QZPA 1T0HB 3NKTA 4J03A 4R7GA 4GOND 4JP5A 1QU3A 4JP1A 1IWBB 3GZUC 2FY8A 1PDWA 1OKKD 5AXAA 3AL6A 3K94A 5F8PA 5KSPA 3RMXA 3VZPA 1FDTA 4Z9FA 4A6XA 4ZPJA 1DAGA 4KQCA 2D5IA 2FOXA 4PSDA 1O94C 2P69A 4DJAA 3MS2A 2HQ1A 4RK5A 3D7MA 4PNPA 1P18A 4E21A 1YS7A 1XCLA 2ZGUA 4YJ3F 3AX6A 4Q1FA 5J4VA 1OA1A 4AXXA 1V1RA 3BRCA 1Y4WA 4UNSA 3MCTA 4H0NA 2C07A 3DEMA 1ZW6A 4RGQA 3BGWA 3P32A 4XD7A 2PKWA 2VZLA 3K0FB 3CUSA 3IV6A 3I64A 4NIAA 2XWBF 2XZOA 4C04A 3HGMA 2HZ7A 1PR2A 2VBGA 3WCSA 1ZPDA 4LLOA 4Q1EA 2UV8A 1QUEA 1DIRA 1TFUA 4YUWA 5IFTA 3QVLA 3QY9A 5ALOA 1DOZA 1MTZA 2JKZA 3N0WA 3BGAA 1YZUA 3ETDA 4HYTA 4DIQA 4JBHA 2I6XA 1C0PA 1M34E 4LC9A 2VEDA 1HSOA 1G6OA 3SQDA 3UOAB 3VPGA 4ZQEA 1EFHA 4EB3A 1DV2A 5L3QA 4NNOA 1Z5UA 1DRWA 3HSKA 2YZMA 1ONSA 5IKXA 3DN7A 5DI3B 5AJVB 2XL9A 5KX5A 4Q4V3 1N5LA 1V6MA 2WWXA 3DEIA 3VR5H 3WOGA 1YR3A 4XM0A 4K46A 4Q02A 5F4ZA 1NCRB 3OX2A 3RYKA 2JJ1A 4DREA 1P9OA 4GWLA 4YUYA 4WKNA 5JQGA 3HBKA 2WV9A 3ZNNA 3WK4A 2MR5A 1K2VN 3S2GA 5T5PA 4E32A 4Z53A 2HBQA 4NBRA 3MDPA 5E6RB 1QF7A 1WW5A 3WLNA 1VE0A 3EBOA 1GPNA 3PXCX 3PCXA 3HC7A 3MGGA 1EK2A 4QFDA 5JH7B 4DPLA 3I3SR 2JLWA 4RIIA 4DB4A 4FONA 3ZTWA 5B2ZA 3MTBA 1WQ3A 1DIGA 2WNVC 5KKNB 3HNYM 1QLWA 1A50B 3Q85A 3QOYA 1H3EA 3VR4D 4QGFA 4QQ2A 3PJYA 4QYWA 2CBXA 4PNEA 2ZZNA 5ICCA 2OESA 2GC2A 1SOAA 2BRTA 4HTFB 2CL7X 2ZVQX 1EAH3 4O6VA 4BMNA 2WSBA 1V95A 1W2GA 2GILA 1UPXA 3GLFE 5AHKA 4YGDA 4RTOA 2ID4A 1MUUA 1KO1A 5G0VA 3FHJA 3OHMA 3JSAA 3B3QA 4JJFA 1W4BA 3SR4A 4JX8A 1KJLA 5CU1A 2OA0A 3HLYA 4ZU4A 4AHWA 1JX6A 2BV4A 2PN1A 4NZNA 4MDFA 2Y8KA 3O8BA 4TXMA 4B6RA 1GSHA 5LU9A 1D4AA 1U0GA 5F2NA 2R16A 4C0AC 2B4RO 1CQXA 1BJKA 3O1JC 1UMKA 4IPTA 1JEOA 1LPBB 8OHMA 3WRYA 4LTAA 3RYPA 4ILKA 1ZLYA 1OY1A 2LZ0A 2WOJA 1H8HD 3V0AA 3I39X 3IODA 5DYYA 4C0KA 1VPLA 4MB6A 4UTZA 1W36B 2ORYA 4BEJA 3LQ1A 2FPWA 4AJ4A 1W0OA 3OE7D 4YBZA 2XQIA 3QGMA 2JG9B 4EZEA 3QZUA 3NCHA 3UB2A 4BJ0A 5JWPA 4KXMA 1SBHA 1D8TA 3WHTA 4G8DA 4IKEA 1VL2A 2VZOA 2EFYA 2PFGA 3L6CA 1SXHA 4AMZA 5K8LA 1V16A 1KPGA 5FPTA 3T5BA 2AFVA 1X3SA 2X4LA 4AMBA 4HUQB 1NJ5A 4JP3A 3RJ5A 5LYJB 4FNGA 3L4JA 4LXLA 4Z3OA 1CF9A 5I8YA 1WUTA 4BE4A 2L69A 1FOD3 4B17A 3CVJA 4MB2A 1W03A 1Y5MA 3TW0A 3WZMA 3ENVA 1ZDMA 4AI8A 1VKHA 4QQPA 3VTKA 1Q1ZA 3RIHA 2XJTA 1XYPA 3ECAA 3DHEA 2J3HA 4WZBA 3L7IA 4IIEA 3ED1A 3E9MA 3HCCA 4G0ZA 1FXZA 5FORA 4EX6A 1QH1A 3TEJA 4DIFA 1PT8A 3VDCA 2CZGA 3M81A 4V0SA 3H2JA 1KGDA 5BYNA 1T9BA 1VYUA 1THZA 2RGXA 2FMDA 1MOQA 3FYCA 1KEKA 4UULA 1C1XB 4YCDA 3BMXA 4TMXA 3ES1A 1GVNB 3INTA 1N33B 5KMGA 3BU0A 3DL2A 5DAXA 1EE9A 4FKBA 4PZ0A 2BP7B 3TW8A 3TNPB 5JCOA 4J76A 1U5ZA 2EXKA 4W6YA 3OQNA 2D59A 3OFKA 1R8SA 1T9CA 1L6RA 1NI4A 1Z26A 3PVNA 4XM2A 4N41A 2NV2B 2E18A 2ZYTX 4K6HA 4RCZA 4MYRA 3FDIA 3PEUA 4BLWA 2BMJA 3TR5A 2FHRA 1QNLA 2E2WA 3CUUA 4G26A 1J8YF 3WKDA 4JQSA 3WF4A 4Z8YA 3NSTA 2GKOA 3WF0A 1LWOA 4YW7A 5IDXA 5A9TA 1HFWA 5DWVA 1W85A 2O8CB 3K0AB 5A05A 4WOJA 4N54A 4IZHA 4Y9RA 3FMGA 4GJYA 2H06A 3DAYA 5JD3A 5DM60 1GGKA 1CERA 1FFCA 2PD3A 4PGMA 5KSWB 1D0GA 5K8JB 2DUJA 3INYA 1PO7A 5SV2A 1NL3A 2FFRA 1J3PA 3V3TA 1NSTA 1AZLA 2YMQA 5EHDA 2H9YA 4QDZA 4CFZA 3ZBUA 4MV5A 2V5VA 3RQSA 2BEKA 2PHRA 2XZTA 3ZFFA 1P3Y1 3RVRA 3WUCA 3I9V6 3F9CA 4IV3C 3LB9A 1TUGA 2WPDD 4HRYA 1L7AA 1ZI8A 2RBKA 4BFLA 1TIBA 2UYHA 5EIAA 1ZCFA 3AVXA 2EERA 1UWCA 3C87A 4EECA 2CGOA 3CVUA 4KKVA 3CCFA 4TV9A 2PS3A 1TGYA 3BSFA 3VD9A 4C0SA 3IDAA 1GUFA 1E7YA 4XTRA 4IEZA 4LRUA 1RUI3 1PL7A 4LRTB 3UETA 4Q66C 2Y1FA 1AF7A 2J31A 3CRVA 3TD9A 1NZIA 3VXKA 4JLBA 4E2QA 2QN6A 3AU9A 4B2YA 2AXQA 3A6KA 3G8BA 5FV7A 1X50A 4BKMA 3HYNA 5LWBA 3TJMA 2YC4A 2JAPA 5K3CA 4RADA 1SXJE 3PU8A 2VYQA 1RRPA 3K31A 1RUH1 2WJAA 4C06A 1HKUA 1UIJA 3PYXA 4CQMB 3DOCA 4AT1A 2IFWA 4ARCA 5FZ8A 1DWPA 1H2ZA 3OLWA 2YCBA 5JV5A 4BNDA 3EXIB 1ISSA 2ZRHA 3M4XA 3H86A 1GLNA 1TZCA 4GYKA 3MV01 1CVIA 1WLDA 2COKA 1T5LA 3VKMA 2D8MA 4WCDA 2F1IA 3BJIC 3OYWB 4HLUC 3SX4A 2ZSDA 3NS7A 1FZQA 4N12A 3MUEA 4WZCA 5F9FA 1DG1G 1CJBA 2CHQA 1K42A 3I9LA 1J2YA 2IDMA 4RENA 3J8F2 3C7GA 4TXNA 1EVLA 5JW6A 2NU8A 1SVWA 1FVHA 1OVMA 3OF1A 4QYSA 1TVKA 5LM3A 4IHJF 3VO8A 4EMTA 4PAQA 2CWSA 4X7PA 4BLVA 4R68A 4ALMA 3IO3A 3IBCA 2XUDA 5NLLA 1K8ZB 1XG5A 2X5IB 2BGCA 3QLJA 2WMDA 1FOD2 3JW8A 3F5QA 4FP9A 4E5DA 4BNYA 2RHOA 3AFMA 2EW1A 4YW5A 4ER7A 4M49A 1HQCA 1Q1AA 4UNQA 2WNEA 3OSZA 4PIMA 4XUEA 2R062 3NM4A 1GGVA 2C26A 4K1ZA 1ZK2A 9ATCA 1E6UA 5THKA 1KFJB 4FXPA 4W5QA 3FDJA 3ZXLA 3ZKYA 4JLKA 3DE0X 3JQWA 2FLVA 3RBXA 4Q27A 3TS1A 5FZ6A 1WSWA 2IK8A 3RHSA 1W4LA 1IIBA 1IQ0A 5KX5F 2RVAA 2VEOA 1FDOA 3WXMA 1AH2A 5ACA1 3HKEA 1HLGA 4EGJA 4NONA 5ILQA 5H1YA 1U0NA 1A78A 5CNIA 4LC1A 2QTZA 3ZFGC 3HU2A 1DBPA 1RXIA 1XMJA 4Z1MD 3MIIA 3U4SA 1IATA 3U07A 4YCCA 2VQEB 3MIGA 1BEEA 3BIJA 3DPRC 1D0HA 2XB4A 3DV9A 4LHXA 1J4AA 4QVKA 2VO5A 1E8NA 3JYHA 2XT9A 4AW7A 4Q0VA 1IBMB 4OHPA 5I93A 3MERA 1IMOA 1I30A 3ZCUA 3FMIA 4K7JA 4M3CB 1A9SA 3G1UA 3PUZA 4IV8A 2V8OA 5E4JA 1HT3A 5FXMA 3LW8A 3SN6A 2JEMA 2WWHA 3I30X 4M9SA 1M2VA 3HBNA 1XA3A 4UAGA 3OIWA 1QGOA 3KLNA 3SJZA 3PFNA 3W7VA 1KI7A 1E0DA 4KWEA 4GMP0 4RQBA 3UY4A 3E9QA 3NRJA 4CM6A 2V6IA 2D6MA 1WZCA 3UK2A 4GXNA 3NTLA 1LODA 3WHPA 3OJ0A 5EWSA 5M7EA 2BSAA 1V00A 4PZCA 5IJAA 3AUYA 1OF1A 2JD1A 5J2TF 1QE3A 3DZFA 1CAXA 3KQQA 3WA7A 4RF5A 4P9LA 3DT6A 2PUAA 4J3NA 1WBFA 4ZTZB 1RBMA 4ASKA 1O5IA 4G5RA 3VYSB 1BEUB 1X9TA 1P29A 4AR2A 4TYSA 2D0PB 3KEQA 1U6JA 5G41A 2YXBA 2H11A 2SKDA 3AERB 3FPKA 3W2EA 2A5DA 4CJXA 3U4CA 1VB4A 4YRDA 2RKWA 1XJCA 3OKFA 4Q48A 1E0JA 1JG4A 3KYBA 3DECA 1GP2A 3D2AA 3CHXA 3UKNA 1XEAA 4QKNA 2EHJA 1G60A 3AUAA 1Z2DA 2HEYF 3H6GA 3O2QB 3V97A 3GEPA 4EUEA 1E2PA 2VU9A 3ME5A 1N0WA 4AGVA 5CEFA 2KA3A 4YLZA 1CZTA 4XLZA 1O6ZA 1L8OA 4D25A 4Y2XA 3DB1A 2PUBA 1AK2A 4XBLA 2JLUA 2X2OA 4WY8A 2WT4A 1D2GA 3DOUA 2D5CA 5EZYA 4ZVLA 3LCUA 3GJ3A 4K1LA 5A3SA 4UWDA 3R0IA 2RJNA 1CYDA 4AS2A 2G6TA 3JWGA 4AKHA 3IP5A 2XLBA 3LLVA 3EPKA 4LKFA 5C1PA 5ITZB 1FXSA 3LIIA 4X3PA 2DVDA 4PZLA 2W2MA 5T6BA 3F5SA 1AR73 4Q1BA 3I9V1 4RNDB 3LVQE 3UA3A 5TSDA 3HA7A 3KMHA 4XEHA 4AE2A 3I5MA 5CYOA 3K9WA 2ZRKA 3CTPA 3GA7A 1IN7A 3NB0A 2NO4A 1VPDA 1F51E 3M3EA 3SISA 2IXEA 3TFOA 4KXNA 5JH7F 2BUAA 1KTVA 2OM6A 2IV3A 1MOSA 2HCFA 5HMMA 4JI3B 3I01A 2C9CA 4BNZA 2XUMA 5AFEA 1FUYB 2IY9A 3OT5A 3T3GA 2C88A 5AI9A 4IUYA 5C8CB 1RDFA 5FZIA 3HD8B 1N92A 2PGOA 4QQHA 2OCPA 4FO9A 2BEVA 2D6LX 2DE0X 1X33A 1ZEMA 4NPHA 3V2IA 1HQWA 5EE5B 2JFVA 1FMCA 1AYM3 2XZDA 3QFTA 4ZI5A 4X65B 1KI6B 3ITNA 2PT9A 2ZWPA 1Q84A 4EKGA 4DJDC 4DLAA 5SZHB 5A6ZA 5ITVA 3N7MA 3SHOA 1EQAA 3VNVA 1Q3EA 4JDMA 1K08A 2VQFB 5CB4A 2MU1A 3I04A 2IYYA 3WLPA 4CWAA 2B99A 2K2SA 2YYSA 5AR1A 5FFMA 1BMFA 2DV9A 3TLGB 1EUDA 5ALMA 3ATGA 4TL8A 2OXFA 1JILA 2I87A 2QL9A 2M6LA 2YWHA 4EAAA 2UZ1B 1U2ZA 5EP3A 3ABZA 1F6BA 4V1PA 2FEXA 1SFPA 4R1TA 4KWTA 1YD7A 5JFTA 5IVIA 2JECA 1BDJA 4L4UA 5GZEA 1S7CA 4RSGA 1GWLA 1YI8A 1XE0A 2GERA 3WB9A 1AR83 3NFRA 1SD5A 4Q1VA 3ZO0B 4XPIB 1NFFA 1X9IA 4G67A 2HCJB 3IKTA 1PWEA 4BL5A 1VBKA 4RDCA 1KMNA 3DB2A 1YB1A 2PZ8A 3STWA 3ZXFA 3NBKA 5ETJA 3OAAA 5AKIA 4AWBA 4J1XA 1AXZA 2DR2A 2LV8A 5CA1A 1BKDR 3IAUA 5HVNA 4M9UA 1FQKA 2V8BA 1ARZA 1E9AA 3KOZA 3UZUA 3ND8A 3KHCA 3KLBA 3ZY4A 4ZRNA 1PZMA 1KDOA 3PC2A 2R6CA 4JODA 3SGLA 1F8GA 3T7IA 3I7DA 2YHAA 3IVMA 3FCCA 2R4UA 4FGSA 2AJCA 4G3XA 5LD2B 1AK1A 4IETA 2HSZA 2VSFA 4CTJA 1NQDA 2NW6A 2W5UA 2X4DA 5BXYA 5KYYB 4TSKA 2JGDB 5B6PA 1VPEA 2NYRA 2ZYWX 4OX9B 3I2HA 1VCOA 3TZKA 3ZDFA 4G97A 1XPJA 1GA6A 4OB8A 2R8EA 4X20A 5IPFA 3VVMA 3D8CA 2GLXA 4UEWA 3EXFA 4C5AA 3IMCA 3VJKA 3LZ6A 1MJNA 2C8VA 4MIEA 2OILA 3HBFA 4TQAA 4F11A 3OPVA 1PZ9A 2UXDB 2CN1A 3C3AA 2XR1A 3TRDA 3GDBA 1MB4A 2Q7OE 1ZO8A 4RD7A 1KJQA 2OA2A 1WNTA 5IJ9B 4X8NA 3OE4A 3VTFA 1JPJA 2LKDA 4KAJA 4CMEC 4GXQA 2AD5A 4KYVA 2J9FB 3WMRA 3LCMA 1CX4A 1QZZA 3ZU3A 3DOEA 3K9GA 4PRYA 5K0UB 3TE7A 3OD0A 2D6KA 1DJLA 2OAP1 4N3AA 4PVCA 3DV0B 3PD0A 4AI2A 3NI2A 3BMOA 3EZLA 3B6JA 3ES9A 3OTOB 1EK0A 2BBVA 2Z9CA 1B35A 2Z6QA 2PKXA 4Q9NA 2XUAA 2IP2A 1Y1PA 4KK4A 2WF9A 3F6SA 3E7XA 2Z30A 3GLTA 1QHGA 3WRWA 1IM5A 2WWJA 4FEGA 4Q01A 3KQYA 1X77A 2J9GA 4L75A 3KQUA 5KDLA 3AYDA 3F78A 3IBSA 3OQPA 1HT1E 4BQIA 2A7QA 4A26A 3UBTA 3E3OA 5H83A 1WMSA 2R9VA 3VV3A 1X1TA 4NS4A 5CVRA 2O0KA 2A33A 4L15A 3GZNB 4TTSA 1ULZA 3L93A 4ID3A 4X8PA 2YXEA 3IIAA 1B1CA 5FDBA 2X77A 3M9LA 3VI3B 3T0AA 4UAJA 2VTKA 3OUJA 1ES9A 1LNSA 5GLTA 4BPZA 1DTWA 2ZSUA 3SCFA 1BVRA 3NGMA 5J40A 2WHYA 3SEQA 2FRDC 3KJNA 3ACDA 3DMFA 2PKRA 2BUBA 5AUNB 2QLJA 1E1CB 4QM7A 3G0IA 1R0LA 3BXOA 1QS0A 1RQGA 1JIKA 4XABA 2RC6A 2ZJ5A 1AUOA 4BIOA 5EHGA 4EGCB 1QPGA 4L9SA 3TI7A 4KEAA 1DCFA 2H7YA 1XO1A 1Y42X 4B44A 3LYAA 4NI5A 2BI7A 2PT6A 4IBOA 2W98A 3JY6A 1Z8DA 5KHIA 1J56A 5KI6A 2EJUA 4OIFA 1FV2A 4X71A 1G21E 2WUGA 1JKXA 4NE7A 5DKFA 1CT9A 1JMKC 2JGNA 1X82A 1T34A 1IN6A 3EDQA 2XMPA 3P9RA 4GYWA 4DV0B 1J7JA 5C4WA 5K4HA 5BWCA 2LM3A 1RMU2 5DTRA 5KYWB 1KRIA 1UJMA 2HLDD 1IB6A 1K8RA 3G2IA 5JAPA 5L4SA 1W49A 3LGRA 3RI9A 1RUOA 2HUNA 3P2MA 3JRWA 3NHYA 3II6X 5H7XA 3ND5A 1BE8A 2XKBA 3GZJA 1UCXA 4UDOA 1OT5A 4UU1A 3T08A 4L8YA 1UXOA 1QO0D 3J7AC 2QE7A 3SJ7A 2O1XA 3RJRA 2NMOA 1SXGA 3S68A 3JQAD 4ZDWA 1DEKA 4KVAA 5GTDA 5AKHA 1HV0A 1JQEA 2C42A 2WDZA 3GLFA 4RZSA 2P6RA 1HJFA 3HYTA 1VBB2 4LF9B 3ZDEA 5K8CA 2D1QA 2DURA 4HYQA 4A8JC 4NBSA 1ESDA 3OCVA 4IFEA 4KDRA 4J16C 3AF4A 4X97A 2QNRA 3ZKWA 1S2GA 1BA3A 4RJ2A 2BZ1A 5CU7A 3LFIA 4QL3A 5JVVA 2UXCB 1KSJA 1MJ5A 4AP5A 3RUFA 1AKVA 4EPWA 5CEJA 3K2QA 4Y2HA 3OJLA 5FOWA 1TLLA 4IS2A 3N4MA 5IWFA 4EHLA 4Y5TA 3EPJA 4AI1A 2VNSA 4RPIA 2D00A 1XRSB 2ZS8A 1V6AA 5BQ3A 1ZGGA 4QUBA 3M3QA 2ZUSA 1P7VA 3HNPA 4XWGA 4GPTA 2WFF1 1J9GA 3UOWA 3SR0A 5JZSA 4GLJA 1BBT2 1ADCA 2B8NA 5DOZA 2PLV3 4LGMA 2OEPA 1FUIA 1GGMA 3WNMA 5IM5A 4MW6A 1XELA 4Q5IA 5G02A 5T4EA 4IIFA 1D0VA 3AR7A 4RMGA 4A91A 5IVDA 2C2GA 3UGQA 2Q6IA 1UIMA 3CR7A 3CLRD 4KOEC 1WMDA 4X6YA 3W6OA 3UYJA 4QPCA 1NAEA 3AXDA 3ADDA 4EHKA 1DBRA 3NHMA 2XUIA 4NR1A 1E2QA 1Y6GA 1DNPA 5EP4A 4PC2A 3QHAA 3BC1A 3T7CA 1AUQA 1VP9A 1Z7EA 1IULA 4RH1A 4JZYA 3TQFA 5HZMA 1RYMA 3C43A 4FLMA 2JBAA 4CR7A 2Z3WA 2GCOB 3ITDA 1T91A 2Y8EA 2XTZA 1RUC3 1JHRA 3MJRA 2I91A 2CDBA 1UZMA 1DGLA 1GANA 2F6RA 1TKAA 2GN1A 2AL7A 4ZMBA 3SCHA 1DTEA 4R9CA 4FBLA 3N0RA 3WBKA 4TTIA 2Q4RA 3LKJA 1E7RA 3B1XA 4LGVA 4LYAA 4NPLA 1NW5A 5BPXA 2PQ6A 4A0SA 2OE2A 4YQFA 2WFF2 3BJRA 1S0GA 3OZEA 4CUKA 4HUJA 2QRNA 3QUBA 2BGOA 2DCUA 3RVBA 4CMKA 2JRLA 7REQB 4RS5A 4NDAA 3H2SA 1BXGB 4FOYA 5AVSA 3A9UA 3HN7A 2PO7A 3I8XA 2YY5A 1H0SA 3IL2A 2CBZA 1SH7A 3CF6R 3DMNA 4AYWA 1JG2A 3ZZNA 5A3QA 4QBFA 2AUYA 4WKPA 2D13A 4NF2A 2IVZA 1RUF1 4DFSA 1J5EB 3U4HA 5BW8A 2D4AA 4BMOB 1I32A 3SPXA 4KNCA 5IK2A 3NJ8A 4PCAA 4D8MA 3DKWA 3DPRA 4D8VA 2R11A 2H2WA 5AI4A 1Y4ZA 3F3SA 3O4GA 5BYAA 4RYLA 2CBGA 1GOTA 2HU2A 1FMD1 3C1TA 5JCJA 3EEOA 3W5CA 5JS6A 3M6LA 2UWCA 3T2QA 3OZWA 3RVNA 1FP4B 2QRLA 3DXXA 4K9RA 4RULA 4A23A 4BGEA 5C52B 1Z4IA 1DO0A 1NUSA 3T15A 1FCJA 1UY4A 5JYBA 4TGLA 1V9SA 3WLQA 3AF6A 1IDN1 3DYMA 1NUUA 4AJJA 3GJYA 3LPGA 4CLEA 4JVAA 4QPDA 4HPKA 2CXUA 4IOMA 4OI1A 2WILA 2QBXA 4IGFA 4BQWA 1EVYA 2RIRA 2RDQA 4LXXA 5ULLA 3LWDA 2CHUA 4L8QA 2DHRA 1UC5B 4FOPA 1YO6A 3ZKAA 2BM0A 1GSIA 3NW4A 3DYPA 1PIV3 1Y80A 3R5SA 3L7LA 3TSZA 3TLKA 2BBAA 1SBYA 2HTEA 4C05A 3S7TA 1KJRA 4JIGA 2AC4A 4O08A 3KYCB 2VDJA 5LFAA 2HREA 2VZEA 2HBZA 4AFCA 4JC0A 3S0JA 3R6LA 3QOWA 4Q9KA 5EJEA 3KUXA 4LOTA 5FMCA 4RA6A 5CDFE 3DXYA 3LUGA 2NPIA 3H04A 3O1TA 4POOA 2J3MA 4Q4JB 1ZBQA 5A06A 3B9QA 1N1VA 3MMXA 1JFSA 2RS12 3AMPA 1A4UA 3ON5A 5DGIA 1E1NA 3W5DA 1NF3A 3W4JA 1NUPA 2PQMA 4XGNA 3IMFA 2XVKA 4AZWA 1E60A 5E8RA 3LSTA 1E2IA 3E48A 2BOJA 3TGLA 3RS9A 2R7AA 2IUSA 4DUZB 1JZ6A 3PDWA 3POJA 3H9QA 1SKMA 1K5JA 4HMQA 1AA6A 1KO4A 1Y8CA 2Z4TA 2XI4A 2NSYA 3BK7A 3NTVA 2P1ZA 1EFTA 4DDKA 1LDGA 3ESBA 3T4VA 7YASA 5C80A 5C1BA 1OLOA 4TLAA 1ORWA 4YJFA 5EJ6A 1ZH2A 2JZCA 2LE0A 3EIWA 1L9XA 1EM6A 5BMVB 3M83A 4F7WA 4LBZA 3NGLA 3E6DA 3FGPA 4Z1OA 3VKUA 5DDJ2 3LWCA 4HC4A 3HBZA 3JBG3 1QUFA 5DNYB 1GN9A 2AI3A 1ESCA 2ZSHA 2BH9A 4IFTA 3UXYA 5KB3A 3D6JA 4PCUA 1GSLA 2FJPA 5ISMA 1YH3A 1R10A 4FNAA 4RXMA 5LBBA 3VHXB 3PQ4A 2LTNA 1DO8A 3JUUA 3ZN6B 4OVEA 1LLQA 4Y1GA 2H0BA 2O3SA 1V8ZA 3W8NA 2AZDA 2Q9BA 4Q4HB 4ZHNA 3RUEA 3BRWD 3IOBA 4M37A 1F38A 4XC9A 3F8SA 4OFXA 1PW7A 1IQDC 1MAVA 2VQ0A 4MMYB 4RBNA 1Q50A 1XALA 1RPNA 3AR6A 1C1YA 2NU8B 2BNNA 1FPN2 1YJLA 1LECA 1QVAA 5LDGA 4URAA 4XBNA 5ACA2 4RTKA 4BQ2A 3R3YA 5AT1A 2D98A 4E9KA 1YIFA 1Z4JA 4HEA6 2PDAA 4OK5A 3E5QA 2BTOA 1GQSA 3OI7A 3K75B 3RSQA 2RS33 4ZHQA 1GQFA 3RW9A 2G08A 4E5KA 1QP7A 3LE0A 2PL5A 3DUIA 4AFAA 1DX6A 3F96A 2CB0A 4D81A 2NQ2C 3CJIB 1C3LA 2NLRA 1E1MA 3UYLA 1XDWA 4NU8X 1HZZC 5FUNA 3T7RA 4OHCA 4M55A 4FMDF 1QC5A 4YASA 1NY72 4LN1A 4B3IA 4HAXA 3R24A 2L2QA 2QVXX 1JHDA 5I8PA 3HMYA 1PT7A 1X1CA 2YMMA 1W2WB 3AESA 2R00A 4CNQA 1YL6A 2C7GA 4FPHA 2GBPA 3QVJA 4OU4A 3VC2A 3DDCA 4FK8A 3AXEA 4P4TA 1QH9A 1SA0A 2IY7A 2XMGA 5AJZA 4XAAA 4BQYA 3RANA 4X1OA 4PYIA 1YULA 2QRGA 4FOTA 4ISQA 3P9QA 2R6AA 2JFBA 4MARA 3OZTA 2AOXA 4HSGA 1EFPA 1JXQA 1U5CA 2PMCA 2ETVA 3MUY1 2LCIA 1JWBB 3JQEA 3SYRA 1RUG3 3C3JA 2REBA 4YUAA 4FYXA 4YAIA 2NAFA 2QDNA 2JGAA 1Z15A 5J4YA 4KDFA 3OCYA 1O1YA 2PT5A 3VQTA 2P1RA 2OAQ1 3NT2A 1U9YA 1SQGA 1ZNZA 4DG8A 5FKBA 1CJPA 2IH2A 4XUNA 5KNDD 3IAPA 5KHOC 4JA0A 1UZUA 4BDSA 3RT9A 1PFYA 4RLQA 3G2OA 3M49A 3ZDAA 2JG8B 4FPKA 2PXAA 1OKQA 2IYEA 4D42A 3IQDB 1IOLA 2H29A 3O1UA 3DMTC 3DWGA 5HF5A 1RWOA 1P9LA 5DZGA 3TCKA 3A2KA 3U37A 4LULA 5JQGF 3CA8A 1GBGA 3WIOA 2PH1A 4QPYA 2ZJZA 3SC3A 4CYMA 3FH0A 3ZCXA 2VUAA 4MQEB 4K8OA 5L7OA 3BSWA 1KIAA 1SEFA 2ECOA 2Q1WA 2Q0QA 5HP4A 4E6EA 1UFQA 1H8HA 4EATA 4E51A 1ZFNA 2OLKA 3ELUA 4MW7A 4S12A 3D0KA 4G0OA 3U56A 1PEAA 2Z43A 1TKRA 1GZCA 4Y0AA 2A0WA 3WQBA 1QYCA 3GCGA 2D5HA 2YJNA 2C5HA 1HYQA 3KPUA 5GZ3A 2VJOA 1CQIB 1XC7A 1EFRA 4G0WA 2IH4A 2GXSA 3P2EA 2ZYIA 5LOVF 1R16A 1PQYA 3JD2A 3NU1A 2QYOA 5HKKA 1Z2AA 3NAPC 1TA0A 4WV8A 3DF7A 4A3ZA 2A6PA 3OBBA 2W58A 2R44A 1W36C 4RJTA 1FTGA 1QVZA 2HYKA 3R7DA 1PL6A 5LA2A 3CNOA 2J8ZA 4IO0A 1BWSA 1N2CE 2GNOA 1WY7A 1PGL1 1UKGA 2BHSA 5TE9A 3K2OA 2R49A 1G2OA 1Q19A 3AY0A 1BO6A 5TVGA 1MXFA 3NDJA 2VOXA 2OZ6A 4WXHA 1BK0A 4K28A 1JLRA 4BQOA 4FVVA 5BXQC 4WZFA 1MR3F 1L7QA 4BXOB 4V0KA 1EAMA 1SKAA 4KFUA