2O14A

X-ray crystal structure of protein yxim_bacsu from bacillus subtilis. northeast structural genomics consortium target sr595
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
354
structure length
354
Chain Sequence
KVYQFDFGSGSMEPGYIGVRASDRYDRSKGYGFQTPENMRDVAASGAGVKSDAVEFLAYGTKSNNTFNVDLPNGLYEVKVTLGNTARASVAAEGVFQVINMTGDGAEDTFQIPVTDGQLNLLVTEGKAGTAFTLSALKIKKLSDQPVTNRTIYVGGDSTVCNYYPLNSSKQAGWGQMLPHYIDKHTFQVRNMASGGQIARGFRNDGQLEAILKYIKPGDYFMLQLGINDTNPKHKESEAEFKEVMRDMIRQVKAKGADVILSTPQGRATDFTSEGIHSSVNRWYRASILALAEEEKTYLIDLNVLSSAYFTSIGPERTLGLYMDGDTLHPNRAGADALARLAVQELKRQGIAGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein yxiM
publication title X-Ray structure of the hypothetical protein YXIM_BACsu from Bacillus subtilis.
rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
total genus 110
structure length 354
sequence length 354
ec nomenclature
pdb deposition date 2006-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13472 Lipase_GDSL_2 GDSL-like Lipase/Acylhydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 2o14A01
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 2o14A02
3SLRA 4AL9A 4DEVA 4LKDA 4K7JA 4S1PA 4OAOA 1BWPA 4BQ4A 4LK7A 1L7LA 1ESCA 3DCIA 4K40A 1K7CA 1W8WA 3KVNA 3SKVA 3ZYFA 4OAPA 2HSJA 1WZXA 3HP4A 3DC7A 1U8UA 4LJHA 3C1UA 1ESEA 4JJ4A 4LHSA 2W9XA 4CP9B 2WAOA 5B5SA 3DT6A 1W8TA 1WMXA 2VPTA 4A6SA 4Q9AA 2WAAA 1Z8HA 1GWMA 1GWKA 3ZYBA 1JRLA 4NRDA 4CP9A 3MILA 1FXWF 2Q0QA 3BZWA 4YW7A 2Q1FA 1PP4A 1FXWA 5BN1A 4I8IA 1HN0A 1BWRA 4BQ2A 1DEOA 2C24A 5JD3A 1BWQA 4Q7QA 3DT9A 1W8UA 3P94A 5HOEA 1W9FA 1WABA 1OKOA 4YW6A 1W90A 3ZYHA 1ESDA 3W7VA 2Q0SA 1ES9A 4XVHA 4JKOA 1ZMBA 5A4AA 4HF7A 2WYFA 4LKEA 1UOJA 4RSHA 1WCUA 1W8ZA 3U37A 1V0AA 5D21A 4BQ3A 4RW0A 2JWPA 4CPBA 4LKFA 4HYQA 1V2GA 1VJGA 4LK6A 3ORJA 3UT0A 4M8KA 1GWLA 4K9SA 4JHLA 1J00A 2APJA 4K3UA 4YWAA 1OH3A 1DEXA 1IVNA 2O14A 4PPYA 4IYJA 2K46A 4H08A 3RJTA 1YZFA 2KR2A 4CPBD 3DT8A 4TX1A 2LRPA 4JJ6A 2LROA 5CD9A 3F95A 2VXJA 4JGGA 1VYHA 3PT5A 4BQ5A 2WABA
chains in the Genus database with same CATH superfamily
2OAEA 1OYWA 1GN9A 3JWHA 4JB2A 1NLQA 5CTJA 3Q6IA 4N76A 1YE5A 2PUJA 1NVBA 4C4SA 3LECA 3P9RA 2PQSA 1GGMA 2OK7A 1IOWA 1FUKA 3KJXA 4HAOA 2HWKA 4RZ3A 2OP0A 3WGVA 3QX8A 2ZJ6A 1V1JA 3AP3A 2HF7A 1XQ9A 4S2UA 2C2OA 2XT6A 2C24A 2B1GA 4KXLA 4BMOB 3ZVRA 4LJ7A 3M49A 3BMNA 5CXQA 1E0DA 5IKOA 2WS92 1F5NA 4OB7A 2ZIXB 1R5OA 4CM4B 2JG8C 1GQYA 1HE2A 3RHTA 2I2FA 1LLQA 4M6WA 3K2BA 2QU7A 1WXIA 3K1AA 4BGEA 2V4ZA 2IYRA 3HM2A 4P9IA 3F67A 3IJEB 4CM9A 2VDUE 1FNDA 4LBQB 4GXTA 2ID4A 2E4AA 4O63O 2MOKA 4FMDF 1TK2A 1YB7A 3CVXA 4MIYA 3CJQA 4M0KA 2FZGA 4FBMA 2HA7A 3I09A 4H7DA 4JBGA 5LN1A 2EIHA 4BISA 4JSTA 3PIDA 1H30A 1QJFA 3UG7A 1CFZA 1G59A 2VZRA 2X41A 1UADA 2H48A 2QUJA 4O65A 2DJ5A 3BEOA 4IIDA 4RLQA 5DOVA 4RK1A 1TB4A 2P4UA 3GWZA 5BMVF 5K0UB 1GPKA 4AWAA 2MSWA 1QIKA 1P73A 1WSDA 4D7TA 1U4SA 3SHOA 4I66A 2R1BA 3LOBA 3H2JA 1HF3A 3KDSE 2PNFA 1WLWA 4QELA 4B34A 4XHBA 3LA6A 1C1FA 2XX3A 3TPZA 4V2IA 1QOOA 2MR6A 1Y3DE 3QOPA 3BE4A 4A42A 4CIDA 4UOJA 4Y9RA 4PC3A 1ZRFA 5LA9A 3KT1A 1TVEA 1KDTA 1XZNA 3FZNA 4KLCA 2EL7A 4HG2A 3IQXA 3NEAA 4LS3A 1WMAA 1VDZA 3GZNA 3CRNA 4JMPA 4DR6B 5JSUA 3MA0A 2HSJA 2QGZA 5JSZA 2OHVA 1GGKA 5AQEA 2OB2A 4BAGA 4YARA 1N2GA 4NBKA 3AEUA 1CAWA 4E3WA 2PDAA 4NONA 1Z6XA 2TMGA 3SI7A 1GRCA 2RJOA 3QPBA 4CQJA 4BA6A 1SQ5A 1N1MA 3AEKB 4QHTA 3O4FA 3ZWQA 2O0OA 5KHAA 1VCOA 2P3SA 3ZUGA 4D6QA 4F46A 1PEKE 3I1JA 4DWVA 3CINA 1WTAA 4BN0A 1LQUA 1SHWB 1DADA 4N53B 4HQ0A 2PQ0A 3WCRA 3ZIDA 4IINA 2XVLA 5IK7A 2H29A 1S4QA 2ETXA 1XMVA 5GPBA 3B82A 2JAHA 5LWQA 1RJ8A 5F3WB 5JR3A 2RHMA 1E6KA 1Q91A 1PJ4A 4QVGA 2EZTA 1LCIA 5IEJA 5CDGA 4PLPA 4L2IB 1LS6A 2V6FA 2NXEA 3FWEA 3AK4A 1BEV3 2HFKA 2WJYA 1W04A 3H2SA 4PONA 4GT1A 3ROKA 1Q7BA 5CVTA 4N43C 2IIPA 4CT0A 2B3TA 5KBFA 4Q3OA 4C7JA 3TLKA 4ZOQI 4MDHA 3V80A 3LD8A 2PS3A 2R6GA 2JFQA 1OA3A 4BEWA 5LMZA 5E7MA 1VBE3 3SZGA 2JVIA 3N58A 3JD3A 3OY8B 1R4MB 4G56A 4LE3A 3ZDVA 1KQOA 1JRLA 4PZYA 3CLTD 4Q4Y2 1K3IA 1FXWF 1Z9BA 2J7MA 1DIRA 3FW1A 2E4ZA 4EN6B 4Y0VA 4F2HA 4M1WA 1JZ3A 4GALA 1OT5A 2RI1A 3CA8A 3BUSA 2WN3A 3IAS6 4IVNA 2XA9A 1U8TA 2CE2X 3FNGA 2W6ZA 3CE6A 5T3UA 2CV2A 2JLVA 1W1UA 2I6SA 2R072 2EU8A 4HONA 5H16A 3R7SA 5I7UA 1E2DA 5KNDD 4MZXA 3WZ2A 3QE9Y 4FEGA 2ZB3A 4PFKA 3NWPA 1DIHA 3EC7A 3UUFA 3K0CA 2YGLA 4XF4A 1Z0AA 2EXXA 4LNAA 5F12A 3T9FA 3TVYA 1CC1S 2D5BA 2IPOA 2WV9A 2CL6X 1QJZA 3T7KA 1MAAA 3FSJX 2CC2A 4Q03A 1I1EA 3BI3A 5ED4A 3Q0IA 3BQNB 4HB2A 1OD3A 1LCLA 5HUHA 4R68A 3AG5A 4M1QA 3OA0A 3QITA 1TZBA 1Y82A 3NGMA 2R8XA 5LBIA 5L7OB 2AZTA 2K2QB 2JIMA 4WLOA 4LQRA 3WQ1A 2FQWA 2ZBPA 4LSGA 3V0AB 2I3ZA 3LZCA 1PX0A 2OO7A 4G0MA 1SPXA 3DDOA 1GZ9A 1KYIA 4HPXB 3UC5A 3QX9A 2RE9A 3GXUA 2J1TA 5BT8A 1WXXA 5BV1A 5AM1A 1Z37A 2CCGA 3H5AA 3BF8A 3ROFA 4KXWA 1SD5A 2JLBA 4JGYA 1GTVA 3WQQA 3ZY4A 4YCJA 2VDNB 2C9ZA 4V0MA 2QKDA 3A36A 3LD9A 5GZCA 2XCLA 5FOSA 4YUAA 5KQGA 1PR5A 5FYDA 3GCGA 2RHHA 1WXQA 4BLWA 5FHQA 2VP0A 4K81B 4NJMA 1QOPB 4TZ6A 1ENQA 4TUYA 4CG0A 1GOGA 1B41A 3DAHA 4GU5A 6Q21A 1HRV3 1ND3C 1Q83A 5KYYB 1N7JA 5FQNA 1QLHA 2C9AA 1Q1BA 1AC5A 4H6VA 1GL7A 3CKKA 4EUKA 2OOKA 2P8SA 2C0ZA 4KAXA 1WCDJ 3SQOA 3OQ1A 3RM3A 4ZOEA 4K6KA 4BCBA 2CV0A 5I8WA 3PD0A 3H5OA 4FIZA 2H9IA 3DZJA 4URAA 4FT2A 5GOZA 1RRPA 1BE0A 1ZU4A 1DQ6A 3T5AA 2QN7A 1BGXT 2J3JA 2FMYA 4D9JA 3MRVA 4W4ZA 2GF2A 3S44A 4QM6A 4BO6A 1H0HA 3H8OA 3CCCA 1B8VA 2HQRA 2H31A 4MPRA 2GLUA 1SUCA 2B39A 3OX3A 5CCDA 3AFOA 2D06A 4COKA 5A1TA 1JN2P 4UMVA 4NCJA 3V1KA 5DN2A 4ENUA 3E0QA 3OKAA 1E9BA 2EGGA 4PCLA 2ZAMA 1M1YA 3D3WA 2KYRA 3HABA 2QQJA 3E7XA 1G20E 3G6WA 1TAQA 5B3KA 3KEMA 1SQ4A 2XUGA 1Q7TA 1OFIA 1COV3 1E5LA 1RYNA 1SLAA 2W2QA 3E9DA 1GBGA 2ZJYA 4CCWA 3CLPA 5AW5A 1UJ2A 1UMBA 4DMRA 1FFSA 4ASLA 1AGPA 5FYYA 4HS9A 1NA5A 1YFUA 1ENPA 1C57A 1EXMA 1YCIA 3G1TA 4XYBA 4B87A 4DDKA 2DUNA 4FFMA 3MC1A 1QNWA 3MCWA 3NONA 5BVHA 1K27A 1JWBB 1XGKA 2ZI7A 4LVCA 4CEIA 1Z08A 3L4KA 3F4LA 3TI9A 3JTEA 4JP2A 4AP6A 5IVPA 2WZR2 1ZSYA 5J5AA 2NO4A 2AZ5A 3FPJA 1UBTS 1MBZA 3E03A 3D8RA 4I30A 1T0JB 1W03A 4XVUA 3R0ZA 5GZ3A 2Y1LA 4LO4B 4YJ3B 5ADHA 3ZY5A 1NBMD 3G0DA 2IEBA 1KI4A 3QUAA 1JZQA 1R1ZA 1K63A 1QLJA 1G4AE 2VVEA 1B23P 4HDNA 5A5FA 9ATCA 1WULS 4XQCA 3TBKA 3NJ8A 5JSPA 5FK7A 2R8OA 4MR7A 2RVAA 5FIXA 5DMXA 3U4QA 2OBYA 3CF4A 2GT1A 3RVDA 1PTJC 3NUGA 2UU8A 2ZEWA 3EGDA 4Z9BA 3IUQA 4KXNA 1SEPA 1P4RA 2X5JO 3ZD8A 3NCTA 4JODA 2OWDA 4OUSA 5D8AB 5C3OA 4DAEA 4TYWA 2AMVA 4M0UA 3FUXA 3W7AA 3B6ZA 4IEVA 3VL8A 2PWYA 4MPTA 3IBYA 4XVRA 3MOSA 1L1RA 2O14A 5F5IA 1NW3A 3S2IA 3EYWA 4Q0PA 5DX1A 3K2EA 4XIFA 4HKWA 1VJDA 1TT7A 3TINA 4QUJA 3IHLA 4E70A 3F1KA 3B2QA 4JVNA 2BP7A 3FROA 4WFKA 1J06A 4F04A 1Y63A 2JFBA 2B46X 2VQ6A 3FHOA 4QD3A 3OPQA 1UOFA 4OYYA 1H4GA 3VU9A 2YC4C 4PSAA 2WMYA 2GC0A 4NS1A 1FMJA 2JDKA 2XKPA 1ZM9A 5BW4A 4R8SA 3MAAC 2D3SA 1T9GS 1YNAA 5C6CA 3Q2KA 4REMA 4FGSA 1JWAB 3L40A 2QMYA 2WY2D 4L9AA 2Y9MB 3M33A 4QTUB 1I6XA 1DOAA 4V1CI 1JKJA 3KVVA 2X5KO 3A1EA 5HMLA 1UX6A 1MB9A 4O25A 1ENOA 5MN5A 4AQ7A 4CQMA 1I3HA 4J0GA 1I4WA 2ZAOA 3PJRA 3PQFA 1XAHA 3HWX1 1AGXA 3GZTB 4X91A 3N7MA 3EQ6A 4O6VA 3G2LA 3JAKB 3SR0A 3B52X 1GVNB 4TLDA 4Y6SA 4KN8A 3T34A 2R60A 4WM7B 2OHJA 2GD1O 5DTEA 1U8YA 3LYHA 4HLUC 2OBLA 4J4HA 3DO5A 1FIUA 2VOEA 5E6SB 3L7BA 5D3QA 4QQLA 4YJKA 1SUWA 4E4RA 2VNRA 1RFGE 4MQLA 2MINB 5IK4A 5AXDA 3OURA 5EGNA 3LP6A 5JAPA 5AVXA 3DOFA 2ZBDA 3CSDA 2O8VA 4V1PA 2RR13 1R0KA 5CJPA 4UDYX 4JJEA 3P7MA 3OIVA 3EXHA 4C2TA 1Z8NA 3ZPXA 5CT4A 4Y0AA 1QFZA 1DC5A 4J91A 2WF9A 1G5PA 3UVEA 4D46A 1A77A 3EXEA 4B6SA 3ZS9A 4PI0A 1WUIS 4QNNA 1WP4A 3AUTA 3ITQA 4BVLA 2VHVA 3AF6A 3CQ9A 4TWZA 4YJ2F 3GLTA 3EQZA 3L2HA 1Z15A 3UV7A 3NMBA 3OZWA 3KYCA 1J1UA 3JVDA 4XXAA 4A41A 2QR5A 2BZ0A 3WIBA 5G4KA 3AXDA 4FLMA 4KU4A 2A67A 4QQNA 1E5TA 4R5MA 3ROPA 4CHGA 1CNFA 4B2LA 1DP4A 2AW3A 2WS93 3VO9A 3ZX7A 1MVEA 2GEVA 4UUMA 4OP1A 5FWEA 5HF6A 4RXUA 2ZJ5A 3R1IA 3FCUB 4NK4A 2EFCB 1LPBB 2VNIA 2FR0A 3BJZA 1OROA 3HN2A 4LDQA 2F62A 4RK4A 1BQ4A 2BERA 3UOGA 1DIAA 1ATZA 1SUSA 2ZQ5A 5JNRA 4F3CA 3NTOA 4NEQA 4MCAA 2C9DA 1N1YA 4XOUA 4U00A 3LE0A 3UT0A 5HXAA 4L0PA 1GT6A 3HP1A 2BRUC 3MJDA 4KIGA 2JGNA 1YKSA 4K87A 1DCTA 2QN8A 4FPEA 4K8RB 1U28C 1YJ5A 1XLTA 3PFHA 2R751 5DE3A 3LEIA 3HV2A 3GRCA 4CL8A 3CQOA 4JLPA 4E7OA 2A1IA 4L6IA 3LOQA 3TD6A 2PUBA 2SCUB 3MQFA 5AW1A 3BVPA 4NZNA 1O6CA 2XXAA 2VHZA 1CD5A 2V3VA 3VNRA 2FJUA 2CL2A 1OKKD 4DR3B 4NYIR 721PA 1LDBA 4C22A 1WCYA 1W2AX 1UZUA 1MZVA 2ECOA 3W5NA 3RRFA 4BP1A 2J5QA 2IVIB 5F9HA 2CY0A 2VHTA 3C45A 4XGKA 2PGLA 4MADA 4L08A 3H7YA 4QBHA 2ZI9A 4RTKA 1TYDE 1OI6A 1K7YA 2QRLA 1OVPA 4WE3A 4UFLA 3UWKA 3S55A 1VPDA 3CWCA 2VXBA 3B5LB 1OREA 3DPIA 3V4PB 1G9BA 5EE0A 2YUEA 1XR3A 2C5HA 1BN6A 3O2NA 5AW2A 5FZ3A 3F5DA 4GDFA 2OV2A 3NALA 1JKXA 4IIEA 1WY5A 2VT3A 1W0KA 2C4KA 4HQLA 1Q1AA 3IPVB 2XGMA 4P00B 2P3YA 1H23A 1SA0B 4DR1B 4ZT3A 2V4VA 4C90A 2VCMA 3MFCA 3RADC 4JVAA 3VBFC 4HAIA 5EWLB 1FP7A 1VBD1 1IBKB 4I3HA 1QRTA 3TN91 1J2YA 3VAAA 2WF5A 1QJEA 1Y4UA 4N3BA 4BRSA 4I4IA 5TGZA 3UQYS 4W6QA 2H5IA 1YXWA 1SXIA 4KQ6A 2F00A 1W0JA 1Z7BA 2A9KA 3FCYA 4RHFA 2AEMA 4EYOA 4UMDA 4J7XA 2OD7A 3H3XA 4E4TA 3QLQA 5KAPA 4GEGA 1DUIA 4INOA 2PFWA 1GZ6A 1SG9A 3QKRB 2WMDA 1TKRA 2PSHA 3J7MA 5EMJA 1EUUA 1KXJA 1AVTA 1N9GB 4NKRA 1H9BA 4PLHA 4I1PA 3NBQA 3C5HA 1KETA 3C6QA 2VMCA 4ZCPA 3PRJA 1QG4A 5EJGA 2J0SA 4IUBS 2W11A 2Q5TA 4HTAA 4QWWA 3D1LA 2Q5LA 1U7PA 1H1LB 4XQGA 5FZOA 4MAMA 2WTAA 4LWOA 1T24A 1C28A 2ENUA 1N7HA 2RHPA 1IHOA 1R10A 2XEXA 3L8MA 4QSMA 3NRUA 3ZYPA 3GUZA 1JH9A 5KB3A 5KU7A 5DHAA 4ZXEA 3IKTA 4PIPA 4ZY9A 3GRPA 3WK8A 4EY5A 4FPCA 4IQPA 4UM5A 2ZZJA 3GNEA 3OFJA 2VZOA 3P4XA 4FZ3A 4WJKB 2Y4OA 3LLSA 4PWYA 1L2TA 1WDMA 2J1LA 5JRJA 1AK1A 1QJCA 1AJKA 3LLCA 2R073 4KC0A 3A1WA 5KREA 1HT1E 4TZTA 2WYSA 1C5HA 1NC3A 3MWDA 1NLYA 3G8DA 5CH5A 2FF7A 1YF3A 5H3LA 3UM9A 3O4IA 3EWIA 4MW0A 1D2MA 3WLMA 4BRUA 1S3SA 5DB4A 3ZGNA 3H87A 2NSLA 3RSOA 4FDUA 4AQ2A 1VLLA 4JKLA 2IIVA 2W6MA 4AJ9A 3PNMA 3M5DA 3OQOA 5DTMA 2IEAA 1Z56C 1GFIA 2ZUBA 4KB5A 3ACFA 3UJHA 2PJZA 4ICIA 4AJ1A 5AW4A 3UA3A 4MB2A 4LIVA 1UKCA 2WZDA 2YU2A 2NT3A 3W04A 3GHYA 2NVBA 2CNNA 4QUIA 2VATA 3SQLA 3JAMA 1O7FA 2CXXA 2R6CA 4J25A 5FUMA 1QBGA 1V26A 2JIZA 1J20A 3LBYA 4PNEA 2VJNA 5B30A 3DQPA 3RVQA 2HWUA 1P5ZB 1J2JA 5C71A 2XWSA 1EX1A 1SCRA 5A7FA 2XUMA 1EPZA 1KEWA 5IYZF 3L8CA 4JGZC 2Y64A 1JE1A 5ALRA 3W5JA 4AL4A 5C4WB 2Q9UA 1SXQA 5CLQA 4KRFA 5JJKA 5AP9A 1Z33A 1W36C 3SIPA 3DAFA 4DGSA 4N9HA 3I3BA 1GU7A 4ER0A 1G5HA 2XHZA 4IL5A 3AZVA 1WZCA 2XZTA 5KYWA 1DDIA 2XUKA 4R9AA 4HI0E 4EUHA 2XA1A 1TM5E 1W2OA 1I2DA 3S7IA 3DM5A 4G9EA 3UKJA 4G5HA 3DEKA 4A26A 4UFJA 2HIHA 4KFUA 2VT6A 3M8KA 1HX7A 5HZMA 5IULC 4QEKA 3NNFA 3E97A 1SIBE 3KV4A 3FUUA 3VU8A 4NOMA 1J99A 2B8JA 3BUCA 3FDZB 4JA2A 3ZE8A 2X09A 2XCIA 2O5EA 3C1AA 4U7GA 1MOSA 4ZDIA 4C01A 3CUVA 2YINC 3O82A 4CUAA 3POSA 4JU9A 1HNXB 4NBLA 1S2IA 1FJHA 3ONNA 3VJMA 4JJ8A 4OBEA 2NUAA 4AT1A 5TPWA 4GMP3 2ZCWA 4YLEA 1BGWA 5BQ5A 3ED1A 3HY6A 4AD8A 2ZREA 3GCWA 4CEWB 3G3EA 5E3HA 2F8TA 4COUA 4H7PA 4BXOB 4LR4A 5FUVA 4QXPA 2PUAA 2G9NA 4BV9A 3ITEA 3J7AC 2AVNA 1FQOA 1KI7A 3HA5A 1NJ2A 4MV2A 1JQAA 2J9RA 4EJMA 4YRMA 1Z36A 3MWEB 4KK4A 3AKTA 2HWXA 1Z4OA 2R47A 4BJHB 4PWZA 2ZHMA 3SZRA 4I9UA 2ZIWB 5DN9A 2GNAA 1G0OA 2PLV1 3KQVA 5FYUA 3QF7A 3ZI4A 4HLQB 4G97A 3VKGA 3LCCA 3K0BA 3CWZA 4J7AA 1CY4A 5IVIA 4BMCA 3AIMA 4RN5A 3TQIA 2PH5A 4E94A 4G09A 3O8QA 1CB7A 1EP1B 1JIIA 4X7RA 3UETA 1G41A 1XZEA 3O4GA 3JYLA 4WZBE 3BMCA 2CFRA 2QEQA 1FMCA 4IVRA 2RG1A 3RVNA 5B1DA 1XTZA 1FP4B 5HFNA 3PNSA 2WZR3 3CLHA 3J7LA 4DNPA 3TTVA 1ZL2A 1F8GA 4KWEA 4CV3A 3I6QA 5GLZA 1QG6A 3U4HA 4B3GA 1RQXA 5TE9A 3U1VA 4DEYA 4GFDA 4NFLA 4JGIA 2YPDA 3KQWA 3EPHA 2XKBA 1Z0IA 10MHA 4QTYA 2ECKA 1PD0A 3P1IA 4PTZA 4AECA 1ML4A 3DOJA 1DQ2A 4YW5A 1DEXA 1XD2A 3ANYB 4KQIA 5DW3A 4D4MA 3O1RA 1VI5A 4G1FA 4DSZA 2RBGA 3DXYA 5FWYB 2GC3A 5FBKA 4UTPA 3UG6A 2ZI6A 5DFAA 2LKDA 4UEKA 2GRJA 2FCVA 3OCXA 1UQUA 3C7CB 4KIJA 3PGMA 3IE2A 5JATA 3JQGB 4UXAA 2J33A 1VIVA 2B8EA 1SOUA 4W5TA 1JAYA 2Y67A 3TEXA 2VJDA 3ELBA 3EOZA 1XLWA 3R8CA 1EIWA 2LM3A 3HQ4O 4PLTA 2FMHA 2A3YA 1RYFA 2BFDA 1ECLA 3RZHA 4OK5A 2XE6A 1UIJA 3SBDA 4PIXA 3GLVA 3O73A 4I0BA 4C88A 1W8ZA 1UMKA 2WYOA 4XUEA 4WK2B 3KUUA 3ZWPA 5LD2B 4AQTA 3FRIA 2I34A 1O5OA 4AI2A 5LWBA 3ABOB 4PZ0A 4ZHQB 2FR8A 5TMEA 5UKDA 2RE8A 1IS3A 4QNRA 5ICCA 4OBWA 2ALJA 3S7TA 3AT1A 2IOFK 2QTBA 1PJTA 2D40A 1RI5A 3WNVA 5C5DA 1M6YA 1ZUD1 3D1JA 3R6LA 4QGBA 5J1TB 3ZW8A 2J3KA 5JQWA 3U10A 2GBLC 3NHJA 5EA2A 2GSWA 3NXSA 1H6DA 3T3IA 5CRIA 1YFKA 1B0ZA 1FFXA 3K1JA 4QJ3A 3RSSA 4EB0A 5A3LA 4EG7A 1ZRHA 4FHZA 4QA9A 1M0WA 4HYYA 1PTKA 1W87A 2WWGA 2HAEA 4UM9D 4OGFA 2IXTA 1OURA 3UJQA 2R6JA 3IUPA 1L8LA 1I01A 3ZDQA 5I4IA 2C5AA 3DXZA 4XFJA 2CL0X 5IJWA 3IR7A 1EXVA 4P5DA 1SRRA 4HBZA 4QPZA 3LX8A 1K4KA 3OPVA 2ZRPA 3BMQB 4WASA 2X5IB 2NVOA 4CZ2A 3EZLA 4O2LA 4D02A 1YB5A 2ZSFA 1TQ4A 4L8WB 1YC2A 4Y6PA 3NL1A 3PCRB 1VSUA 3B8EA 2W08A 1W5EA 4FOLA 1XALA 1WSAA 1XXHB 4OQQA 4Q4CA 2XNHA 2XSZA 1ZD9A 1WKVA 1EWVA 5LLSA 2JJYA 3MTDA 2QI9F 2Z2IA 1L7PA 3ZFEA 2BKVA 3AMNA 2GX6A 5I7FA 4HH3C 3WL6A 4LXXA 2W2VA 3F5MA 4G07A 2FSVC 4G0XA 3HRKA 3WYEA 2WJZB 3WINE 1P1JA 1M1NA 3I2KA 2IHYA 1IMJA 3FWYA 3GFFA 2OEPA 5DX8A 5EZ5A 4FEEA 4QX5A 5DGCA 2BW0A 2WFZA 1QGOA 4EIWA 1G7RA 1IN7A 2R1DA 3VKVA 1TO2E 1NKGA 4BCCA 4C6RA 1FC0A 5A3JA 1VYUA 4KMOA 1PR9A 3I0MA 1T0UA 3UK1A 2XZPA 2JENA 3QOXA 1XDZA 4B17A 5FX2A 3VR5A 5FBWB 2JZOA 2XYQA 1LKZA 2QYSA 2XAUA 3SN6A 5IAAA 3T1TA 3DOOA 3RARA 2FFQA 2AG1A 2L18A 3UHFA 3LPNA 4GLOA 5C0OE 2VZ1A 4DCSA 1YIAA 3TIIA 3VLBB 1QQP3 1A4IA 3ESAA 2EOAA 2IH5A 3A4YA 2NMNA 2VH2A 4R2LA 5E6RB 5LBBA 3OCZA 1GZVA 4PXYA 1LPOA 2BJSA 2C7RA 4M0EA 1YGYA 3HPNA 3L8GA 3ER6A 1VPWA 1T35A 3T3YA 3RFTA 3GDBA 5IT0A 4RKRA 4DVGA 2TMYA 1H2ZA 3R74A 3CX3A 1I7PA 4EJ2A 3BFXA 1DHTA 1IDOA 2KS6A 2P35A 2NADA 4II2A 1A4XA 4XACA 3GLSA 1V1RB 5TQ2A 3NAPA 2WD7B 3OTIA 2PXJA 4ND1A 3DG9A 1RB8G 3EWNA 4I5FA 2JVJA 1OD6A 5BPHA 1ZD8A 5LZ5A 2LUWA 3LBHA 1XWFA 5KQLA 3U7JA 3JD4A 1N3BA 4NPAA 4URFA 2ZBVA 3FX2A 2G17A 4YMTA 3I4LA 2W94A 2R4QA 3LUFA 5THXA 4AEDC 2DRIA 1FRNA 3S29A 5ALQA 1PUJA 3ETHA 3OJFA 1FNNA 1QH1A 4BTVA 4MQEA 3DWGA 2QVGA 2X05A 1E94E 2O2DA 3VM6A 2E5FA 5IHPA 5TEWA 3TFQA 3E5UA 1W6QA 4P9NA 3RGWS 4YW1A 1WDWB 1YJ8A 3FFQA 3I61A 1LD3A 4DY3A 3GLHE 1U8FO 2EBHX 4BYGA 1Y9EA 1UU4A 1F6BA 3HMQA 4LMAA 221PA 2H51A 5LA0A 2XNCA 4UHJA 1Y9QA 1OF1A 3V5NA 4NIAA 1O6FA 3SHFA 4XUQA 5CFCB 1G3IA 2NYAA 1UYPA 1DFIA 5DO9A 3V4SA 3B5JA 4IIGA 5J5VA 2G5GX 1SFPA 5PGMA 1MR3F 4JP8A 3UH1A 4KXXA 4IIVA 3NS7A 1PUIA 3EMKA 1TTPB 3EXAA 4HDCA 3G89A 1TQ8A 2FG6C 4ISQA 3C8HA 2YVAA 3LIPA 2WDBA 3IA2A 4YV7A 3OU7A 2C84A 4MGSA 5FNVA 2PX8A 2CMDA 3TEYA 2GRAA 4RF4A 1UZ0A 5JFOA 5TQVA 2BT4A 3MG9A 2ZYGA 3OJBA 5K2MA 1U2SA 4R4JA 2GK4A 1GTJ1 4YRZA 4Y5SA 3PLAE 4NU0A 4MS3A 1O95C 1JQ3A 2RGYA 4QB6A 3ABQB 1CVRA 1TTHA 3RKRA 3B93A 3MGCA 4G25A 1U0OC 3BCHA 4NV0A 1U8UA 4AF7A 4RAQA 4O61A 4N7IA 2IGTA 3PBKA 5IC6A 2C2KA 2ERYA 1WXHA 4W6XA 1DO8A 4DPMA 1O8BA 2HPAA 3DEIA 4L85A 2VZLA 1L5GB 3D8HA 4MH0E 3LHIA 2JJ1D 4HVRA 3UYJA 1VPEA 3AZOA 5DKFA 1CR7A 3KVAA 3UICA 3PTYA 2EHJA 4QDRA 1ZG3A 1NBHA 4D94A 2GK3A 3NJRA 3U40A 2FN3A 3GCXA 5LM3A 3OE5A 1WXGA 4D4HA 1DX9A 1JT2A 2AUYA 1SFRA 1VE5A 3WZMA 5IKPA 4KK3A 1Z63A 2WBLC 3RRJA 1XRNA 1ZJYA 2BFMA 2OPKA 3B38A 1AYN2 2ZJ7A 5BSFA 2NO5A 3HBMA 2GILA 2AI1A 5EHIA 4EG4A 3WL4A 1ULTA 4RIFA 3UANA 1JHQA 2Q5OA 4G4JA 1QK4A 4E4HA 4GD4A 3I3OA 2P3LA 2CLFB 2XGXA 1Z8FA 3STXA 3VOSA 1PE0A 5BWNA 1QWRA 1YXMA 4TLCA 5C8CA 4AW7A 1QBKC 1X1CA 3ZD6A 1BMV1 1QIHA 4HZUA 5INTA 5LJIA 1QF6A 3RUEA 5BSGA 1YR2A 3UMRA 3IJPA 4DV1B 3KSBC 3BICA 4N0PA 4AICA 1XZPA 1T1JA 1I30A 3VPCA 1WBLA 4MA5A 3FD8A 1VMHA 3N3BC 3SIRA 1NLSA 1VBD2 1E0JA 1NN1A 1E96A 3TN92 4C8DA 1EESA 1ZOPA 1QDEA 1G8FA 3UB2A 1K98A 1KZGB 1V6IA 2J1AA 4CKBA 2OV6A 2RS12 4X45A 5JPNB 4TM7A 2F8MA 4U63A 3TTXA 1PZ8A 4B75A 4DWJA 1RRKA 4FPFA 1BD4A 2R66A 4BFCA 3JXSA 3MIHA 4QHZA 3VH1A 3Q9UA 1JEYB 3WWCA 5TJHA 1SZCA 1ZINA 2Q27A 1TK3A 3KJQA 4WZAE 3KJZA 4KAAA 2O3QA 4RACA 2I4RA 3REFA 1Q7GA 4BHTA 2QAGB 1I0LA 1VSTA 4NMLA 2SLIA 3PU3A 4IEEA 5K6AA 1R5JA 2PX3A 4LXHA 1VMAA 4P0PB 1GCOA 3RW9A 1HURA 7ADHA 2A6YA 2XDQB 3KPVA 2I1WA 1UFVA 5GONF 1OIVA 1FXWA 3IPRA 3ZLBA 1LPPA 4ITVA 4EP1A 1KSGA 4HNUA 2ZRMA 3SMQA 4H1WA 4J3FA 2D7CA 5HFJA 5L45A 1JG6A 3LCRA 2IHKA 5KPJA 3ES9A 1IZYA 1RE0A 1QF3A 2I2AA 4GI3A 2H2GA 4I55A 1FRZA 4U7WA 3APBA 3GT4A 2B7LA 2VBGA 1MVQA 3ESBA 1XYPA 4FONA 2PIAA 1ZHFA 4ADSG 1SU8A 3QVJA 4TYQA 1EM8A 1G7SA 4Q7LA 4H4CA 4IX1A 3T2QA 3CG4A 5HKOA 3H05A 3W8FA 5KTPA 4AJKA 3VHPA 4G65A 4UU7A 1PWZA 4BKOA 2BLLA 2YN2A 3O8OB 2FTKE 5D1HA 4LK7A 4Y1FA 1YBVA 4RUKA 5FLYA 1DBQA 1YR3A 3VDDA 3HE3A 1CUAA 4Q93A 3OKFA 5C3PA 1FFHA 2GN9A 4CNBA 5IT9A 3ND8A 2IZWA 3VPBA 4P5HA 3KLMX 1MJ5A 3GMTA 3PJDA 1A5BB 4EO9A 4BOYA 4G5FA 1FRVA 4ZEWA 4HX9A 5A06A 4V3CA 2X1HA 1E1CA 5JPDA 1F38A 4H1TA 2C9BA 3OBAA 4QT0A 3D2BA 5ILOA 3PJQA 3KUKA 4BXFA 1S0JA 2J6IA 3E7DA 3ZEAA 2EC5A 4MVJF 3OUUA 4N5LA 3P9SA 1JZ2A 3L0YA 2ZLBA 2IITA 5BYKA 3PC8C 1PL8A 5AVTA 4YLZA 2WWSA 5BSMA 1WP9A 4WVVA 1IQUA 3IV7A 4Y7DA 1KI1A 4JVOA 3KE8A 1YZKA 2D1FA 4DUWA 4ASUA 5CJJA 5F3DA 4XTPA 2REXB 1I24A 4MGZE 3UXHA 3EMRA 1MVLA 2O8FB 1D8TA 2CKDA 4B6JA 1EZ4A 1N6IA 2ZKIA 4BU1A 1PBTA 2QJTA 1ILEA 3SYNA 1RABA 4HVTA 3SH3A 3FF4A 4Q01A 4R69A 1USUA 4ZXKA 3LX6A 1SOMA 4CR6A 3SWWA 3O90A 1SD1A 4BQQA 3ZWWA 3BODA 2WZPP 3NASA 1R0SA 1CAXB 5TS2A 4IS3A 2BWAA 4I5GA 1UOBA 3HY3A 4KAJA 1UFKA 4OLLA 3FX3A 3L07A 5CK4A 4YT8A 5E9JA 2OB1A 3U4DA 3FB1A 5A4DA 1XTTA 2ATCA 4FNGA 4GYWA 4UHKA 4EELA 1L4NA 5L3VA 4W8GA 3JB4C 2RR12 2CSXA 1BX1A 4NU8X 1JPUA 2PH1A 3KPUA 4XYMA 3ZDBA 1C8NA 4IVPA 4EG1A 1YWKA 2AX3A 2QOEA 4XAQA 4KEAA 4AXOA 3GRZA 4Q1VA 2FFJA 1UOQA 3DL4A 2A73B 1RCUA 1QB8A 4BMPB 2QW8A 1XPUA 1NLRA 2WA4A 1KFJB 1HLPA 3N76A 4YUYA 3BIFA 2G5TA 2BDEA 4BBAA 3GDWA 5C8XA 5LK5A 4EGJA 2YHUA 1CTQA 1LJ7A 4PDWA 1J21A 4W7IA 4UARA 2RH8A 3WGTA 5F3RA 1KEUA 3A32A 2Q5HA 4YVSA 4QOGA 4NIMA 3OT1B 3LUCA 3REQB 2QUBA 2XJRA 3AP1A 5KKAA 3OKPA 4META 2IH2A 3OP1A 3A4MA 5SY4A 1FAYA 1AZLA 1MCZA 5HKKD 3VBSB 4KRGA 4MUNA 5CDFE 2JD1A 2IOYA 4DCUA 2MSDB 1LK0A 3RS0A 2WMNB 1KNQA 5HP4A 3NTUA 5ALOA 3BL8A 1W1IA 2JLRA 2X1LA 2JI8A 3SHQA 5KYTA 4JEMA 5LYJF 4OA8A 1MIOA 3BWXA 4ZAZA 1MX9A 1UAGA 4RESA 3OJCA 3UA4A 1SU6A 2BC9A 2GN4A 5E9AA 1NBAA 3POIA 3EZ9A 1CZOA 1NE6A 1JDJA 1WUTA 4NBSA 3GWGA 4LY0A 1H2RS 3ZXLA 3SLGA 2Z2XA 5DK6A 4NRPA 1M3SA 1U0TA 2CUTA 2OBMA 2G8NA 1DJMA 5A6ZA 2Z6AA 2HWWA 1QIMA 3JALB 1W4ZA 5F64A 4H7IA 1KMCA 2JGRA 3EQEA 1W52X 2ADFA 5HKAA 3TLJA 3PYLA 4LHLA 3KAPA 1DBPA 1K5JA 4BLOA 2AQIA 3IH5A 3SJZA 5B2GB 4MUHA 4NHYA 2IXAA 3T9BA 3BOPA 4LK3A 1R8SA 4UU8A 3I6BA 2AOUB 3SM9A 1SBYA 5LA1A 4NHEA 3DV8A 4ER6A 5FOJB 2WSSA 1GR3A 4HWSA 4UW4A 1QY4A 1DTWB 1O03A 3A3OA 1MJHA 1C8LA 4IR7A 4ZI5A 2FFHA 3X2FA 2XGJA 4P9GA 3UGGA 5CLJA 2K0GA 3FAKA 4MVYA 3P9KA 2AQ8A 1ST2A 4IF4A 1UT6A 3JD0A 3MRXA 3PIIA 3KZVA 1TNDA 5KOJA 2QMHA 2AMFA 4YMWA 2A5YB 3ESDA 4FIDA 3ZDCA 2ZS6B 3USES 1G17A 3MINB 4BO5A 4DIBA 3FCOA 4P9YA 5HCIA 5JO9A 1XU4A 1UPXA 4MV7A 4LF9B 3EPPA 4MWGA 4RD2A 4R8RA 5HEKA 4EJSB 1U3GA 1V5WA 4EHJA 2V97A 3ZR6A 4WOBA 1K88A 1R0XA 4O1IA 4DLPA 3E2IA 4W6ZA 2TUNA 1K06A 4MRPA 2BGCA 4KQ2A 3J8F1 3VKUA 4U2AA 1GLNA 3TAXA 5D3MB 1MEC1 5FMBA 1PNOA 2BMEA 4A2CA 4P4SB 4BLVA 2XCSB 1U9IA 4IFIA 3ZHOA 4EDFA 2I6QA 3VC7A 1GRVA 5FMDA 1V70A 1BO6A 2Z9DA 1TJ5A 2JDMA 4OIMA 1ZJJA 4BDTA 1XVAA 3NHBA 4QG7A 4Z49A 4PG5A 3E0XA 4XFIA 3BRSA 1N5KA 4LRTB 1EI9A 1X9IA 4LYHA 3QI2A 2YVQA 1PVXA 4D4JA 3IKJA 4LHKA 2Q3DA 3UKTA 1JH5A 1VKNA 1FUYB 1U0LA 2IYOA 4XR9A 3MN1A 1XDUA 2UYCA 3OPYA 1HDGO 3U7GA 1L5QA 5F76A 4P3XA 3Q10A 2ASVA 1CUFA 2X2PA 1QHNA 4D4GA 1K7FB 3PTZA 1QH8A 3HBNA 5FR2A 1ZXXA 1R9JA 1OX4A 1L8QA 1DQ5A 2X4DA 4CN8A 2WYWA 3A26A 2FG7C 4L9RA 3DF0A 4DCMA 4P08A 3P71T 4MOAA 4PLOA 3ELNA 3AMQA 4NAOA 5KHLB 4RQPB 2RAVA 1MG5A 5ECWA 3SE7A 5K9ZA 5CKQA 1NCRA 1J00A 4Z8XA 3TUIC 5IF3A 3NM6B 3FNBA 1DU3D 9LDTA 2Q50A 1QF9A 2ZGSA 4DHEA 4DTIA 3VR3A 4FPXA 4QGGA 3GJ7A 4UTRA 3F6RA 1P74A 1YR6A 4JROA 4H08A 1OU0A 3S5AA 1QKKA 2BNOA 2ZB2A 3A6JA 3FE5A 1ORVA 4YJ2A 3BKZA 1ZEJA 4CDUC 2QSYA 3NVAA 4GI2A 3N59A 4A8JC 4KI7A 3QZUA 4FFRA 3B9QA 1GOFA 3EZXA 5A4FS 4OHMA 1FJ2A 3BDAA 3R9KA 2CNWD 2ZCJA 2C29D 5DBOA 1BDHA 1LNZA 1J1TA 1S02A 5FTWA 3ZXKA 2WBKA 4D0SA 1N0WA 3LZ6A 3X3HA 1MJNA 1OH4A 1XMIA 3GO4A 1BHGA 1B35A 2R85A 1R8YA 3QP9A 2EX1A 4G5SA 4MV9A 3SS9X 4NJ4A 4KRYA 4LN1A 1M2VA 3HKEB 1BDBA 2VDWA 1GSLA 2CHQA 5JMCA 3VU0A 4KVZA 1U8ZA 3V48A 4PX3A 1O8CA 2GA9A 3KQHA 4O0LA 1PEYA 4ARVA 5JZBA 1C3LA 1YGPA 3L8ZA 3FZ3A 3U6BA 1BCRB 4K6HA 1SLBA 2KPOA 3HDYA 2JIOA 1EEXB 1N2SA 2BHTA 3TRKA 2GHRA 2GVNA 4V24A 1Z2NX 4G26A 2C8VA 5I51A 1E8MA 1K6IA 4KL1A 1Q16A 4C6TB 2OO5A 3EGEA 4YLYA 3NJVA 2DMRA 5E6UB 5AVSA 1G42A 2QPTA 3FTEA 2ZUDA 2V3CC 4MGHA 4URVR 2WSUA 1L7BA 3CF0A 3K71B 4BLPA 3ZPYA 4PF5A 1Y1RA 3SHVA 3KOYA 4B3JA 2VJLA 2RAFA 3DVLA 2G70A 1YNOA 5L9VA 4K9RA 2QN3A 4BTEA 1AYN3 3MLLA 3BIWA 4P14A 3CZ5A 5H9QA 3U4XA 2VZ0A 4HEHA 3WRXC 1KI3A 3AMHA 4KFTA 1BK1A 2NWQA 1JR2A 3HXKA 2IP1A 5CNAA 2Q2OA 3DPRC 3CY6A 5A3NA 4MKZA 1GG2A 3WSVA 3IUMA 4OXIA 1G3QA 3L6DA 3Q1KA 3AM4A 3F5SA 2XGOA 4RPGA 2AA3A 4Y1RB 5DM4A 1FSFA 4YCBA 5B7PA 1RDFA 3KSCA 2KWIA 2CEAA 2QHXA 5FPSA 3G0HA 4AZWA 3HDTA 1UKVY 2FSSA 4EK9A 4MMXB 4OMCA 4MKXA 4JFAA 3A23A 3OEYA 3KV5A 5KYVA 3BXZA 5JRZA 5CA1B 4ZK2A 3LZDA 3ONVA 4J7CA 2CAUA 2CE7A 2WTUA 1XRRA 5K7SA 1HRKA 4WZZA 1SVOA 2Q0QA 4B7XA 3UV3A 1VBD3 4Z3KA 4GKKB 2XKOA 1Y9DA 3TN93 3T38A 1TC2A 1Z6ZA 3C7HA 2AW5A 5HRUA 2ZGTA 5EVCA 3DYOA 4G2NA 1BXRB 3ZXYA 2EJCA 2RS13 2ZYRA 5K0BA 1MX1A 1UPFA 3A0RB 1POV1 2A75A 2ABWA 3ZTYA 1F6DA 4H7KA 4QPGB 4M98A 2HO4A 1WHSA 1XN1A 1CEEA 1X13A 1IPKA 2F6BA 4PF1A 1YQXA 3R3XA 1B93A 3CBNA 2GJ4A 2BJVA 3BMOB 4C7MA 1XMJA 1MQAA 2WTBA 2PMWB 3PE4A 1YRWA 3QEAZ 3EXIA 3D7SA 3ZHBA 1SCIA 3ZJTA 3LC2O 5T5LA 4M3CB 5CB4F 2G9ZA 3DCYA 4B81A 3AB7A 3ACGA 4E88A 1C8VB 2ZGOA 2HYKA 2A14A 2MEV1 2ACWA 2IEIA 4MI9A 3IPYA 5FPHA 1UZYA 1J49A 4ZDKA 2QLMA 1KS4A 3ZW7A 3H99A 1L7DA 4YJHB 1D3AA 1SM4A 2EFGA 4G4SP 4BIFA 1JIJA 5KOIA 1I36A 1L3CA 1T1SA 1GNLA 5TJ9A 5JJLA 4POAA 2QT0A 2D62A 2XR1A 4LGVA 1EVLA 2X53S 3IQZA 2TYSB 5L9BA 2DPXA 1N6KA 5EZYF 2NVWA 1F35A 3NTVA 2YZGA 1JR4A 2BJWA 4GRIA 4FU0A 1BMV2 1CLEA 2GN7A 1PKXA 3VH3A 2Q6LA 1ZCJA 1XK6A 1G7CA 1EX7A 2C8JA 5B36A 4EEXA 3OZFA 2J08A 1W35A 3SMHA 3G2IA 2VRCD 5C1IA 1RD4A 1P2SA 2V7QA 3TNQA 3WKEA 5JV5A 3KL4A 4JT2A 1O6GA 2BMFA 4L28A 3L7MA 4RS5C 4J9UE 3ZZTA 4L5JA 2WP8J 4C0JA 1K6XA 3K70C 3H3JA 3RU2A 1E6MA 1CHDA 5I47A 3TGLA 3ZFGB 2YXNA 3FKJA 3P4YA 4KE9A 4YZ5A 3NKVA 4BNUA 1CBUA 5B4UA 2OXBA 1KU6A 1Q0LA 3GFSA 2Q0AA 5ER6A 4MKIA 2XL9A 5BNFA 3NV4A 2IXDA 1KERA 2QAIA 2L42A 5LBEA 4RZUA 3R3SA 4PCRA 4LVUA 1JHVA 1GZDA 5CA6A 2WIJA 3AHIA 1QHHA 3RG8A 3K3PA 4UBLA 4AMYA 3JW8A 5CAEA 4BWOA 2ZHKA 1Z4LA 1P77A 5FUIA 3VBHB 4B83A 2E26A 4RR3B 4XVQA 1I4TD 8GPBA 3VVLA 4JP3A 5L6LB 1ZFNA 3QELB 2PVCA 4RTNA 1GVHA 4FC6A 5F51A 2EF6A 4XUPA 1YZHA 4RQUA 2A3WA 5F21A 1I2CA 1UL9A 3GEBA 2OGZA 2G19A 1ZX1A 2AACA 3OSDA 5AH0A 1D7OA 1NY71 1XVLA 4MGIE 5F1RA 3IJ5A 4L7QA 3FHIB 3A6GA 5C37A 2YJNA 4B44A 4CMIA 4XTRA 3PFKA 5A1LA 1I3NA 5DH9A 1OXVA 4X85A 1FXZA 1ABFA 3A2NA 1IJEA 4M7OA 4C6SA 4DYDA 5BNTA 1WBBA 1HLDA 2BFOA 3GUUA 3DM9B 3K48A 3K6SB 1Y98A 4G4FA 3TVTA 2HJVA 2ODWA 5EJ6A 3BA1A 3ABSB 1PK8A 3IVGA 1E1RA 3EODA 4BK5A 1K86A 2P9GA 2H1IA 3HN6A 4H3SA 1U7HA 1F2DA 4JRLA 4DQLA 3A1SA 4NIHA 1L4HA 2UV8A 1VIAA 1F9AA 4NTZA 4PSVA 3S4YA 1JPVA 3GLFA 3P96A 3KWJA 1QV9A 1M72A 2COKA 1PW5A 1G98A 1T6BX 1AUVA 2BE9A 3EDQA 3POGA 1NNSA 4OQ4A 2ZWOA 3CF2A 4XYLA 4TQUS 3VNSA 3WLQA 1I5EA 1BXGB 1JDZA 4OAQA 4XJTA 2IY8A 5F35A 1KAQA 3EVFA 1ZL0A 2JKVA 4BNZA 2B6NA 4LO8A 1QQP2 2RGUA 2YNMA 1U4OA 2VP2A 2WWFA 2OBNA 4P84A 4PSKA 2VRBA 2PLV3 3ENVA 5JNVA 1CY0A 4R1QA 4JVLA 4AKSA 5I45A 4F7DA 3LQQA 4HJXA 3QFSA 4NABA 3FYTA 2ZR0A 1RJ9A 4Q27A 2J09A 1QO0D 1V3UA 1VKOA 3NWOA 4ZALA 4V03A 2EG5A 3P0HA 4GH4B 1WA5A 1JR3E 3KOOA 3H7JA 5I8TA 2QRZA 3VR6A 5C8VA 5J2TA 3ENWA 2PRIA 1UXJA 4AUEA 5A6VA 1V47A 3O0VA 4H77A 4L9SA 3D4KA 5HE9A 5BNPC 3C3JA 2VF4X 3U7QB 3JQ9A 4HQRA 3KB5A 1STMA 2XWJI 4A92A 1N7GA 1EFKA 2AFHB 4J0HA 5CDUA 4OXXA 3LDKA 4JJ6A 2O0KA 3PT5A 1F2VA 5TPZA 1FLDA 5C7LO 4JL5A 1X2BA 2X5OA 4OK3A 3EAQA 5DM60 3P0IA 1V16A 1N75A 2V54A 1H2WA 2BTEA 1E5RA 1K5MB 4XAAA 1TM3E 1J0XO 5AM2A 5B58C 1XZMA 5EE5B 1XZCA 2ILVA 3WGLA 3D4OA 3ZKWB 3P52A 1D0HA 5TF0A 3EVBA 1OF3A 2ZJZA 5EJZB 2ZJ2A 5HUJA 1CJMA 4HGYA 2FWJA 3OOSA 2H65A 2R1ZA 4L6AA 2XVZA 3AETA 4ZYUA 1CX9B 1IJKA 2PZLA 4DLUA 2HK6A 5H7XA 2OT7A 5BMOA 3IPLA 3L7LA 1H1AA 4Q7EA 3JCZA 4DA7A 1J7KA 4N18A 1VG8A 5I6DA 1EBBA 4OGWA 5L6MB 1ZZBA 5KYUB 1PV4A 1XA3A 3I8SA 1G2IA 4HPWA 1CT9A 4KV7A 2Q46A 5DYTA 3O4VA 3IUEA 1Y0BA 1QJU1 2D54A 2HF9A 3UHPA 1A76A 1X19A 3RVMA 3QG1A 3GT0A 2O7QA 1GKUB 3LOIA 3SAJA 1VBA1 4D8WA 3LCMA 2EHDA 5CZKA 1XF9A 3KT3A 5AKJA 1KQRA 2QQKA 5IPFA 3PPWA 4IDBA 1TUEA 2WUDA 1SHTX 2F3RA 3ZIAA 4NVRA 5ICFA 3OX1A 3FVRA 4JMLA 3J7HA 1U2DC 5FPPA 4PXAA 3JQ8A 1XTIA 2RGNA 4PQRA 4UOEA 1KO4A 2WKPA 2OZVA 4GMHA 2IDMA 3O12A 5T6BA 5JROA 3K09A 4MYCA 3AO0B 4WCFC 1T6GC 3PPVA 2WZCA 3ZWNA 1YI9A 4NWIA 2ZJ8A 4ES9A 5BR4A 4XUOA 4HN9A 1YQQA 2KX7A 3RU9A 3DL3A 4DNYA 1K0UA 5F23A 4TYSA 1PU2A 2G77B 4JUCA 4MGQA 3PUXA 2B69A 4MUGA 4XF9A 1V0AA 1JDTA 3X1KA 2IZ0A 2Q8QA 2JX9A 5JR7B 4X1OA 3RV3A 1V6NA 5IH7A 3KO8A 4PQGA 4S0XA 4H4DA 3B3GA 3L7NA 3K6KA 1AKRA 4E4DX 1R6VA 2OHXA 3DBRA 3ZY2A 2XGSA 2J0UA 3OSUA 2GCEA 1H4QA 2GJ8A 4B7EA 1XELA 3TW8A 3C3WA 2YYSA 3TSWA 5FMOS 3DPUA 3E27A 1JLMA 2BONA 1PFUA 1FB5A 4Q3NA 5ALJA 2FMFA 5E6HA 2ISSD 3WAGA 3IT1A 4OHCA 4GMFA 4DMHA 2JIDA 5CUQA 2DPGA 2ZT8A 2Y1FA 3ES4A 1ULCA 3S30A 3H84A 1QO7A 1B8PA 4Q2FA 3AKQA 3VDBA 2OFWA 2FPWA 4EZEA 1OHHA 5CCEA 3F90A 5EJ4A 3HLKA 2PS9A 3P5BA 2EAUA 1ECFA 1DKNA 1IB0A 4HDSB 4IOJA 4LLFA 1FA9A 4KYIB 1XEXA 4YAEA 1E6WA 4Q29A 2W0SA 2FQQA 2HKIA 4X41A 1MOQA 4TRRA 4M4PA 1E32A 3RAFC 4QXMA 2XNDA 4XIIA 4S1WA 3T7DA 2C4VA 3TOXA 2DLNA 5ETJA 3TNJA 5CFRA 3SSNA 3A70A 3T3EA 4BU2A 1BIFA 4ZVTA 3W9AA 1KTVA 3U9TA 1GXSA 3NV9A 3ICQB 2UVPA 4EG8A 1ZM4A 4BZ4A 3F5QA 3FYCA 5JI9A 3WG9A 4ARYA 4AZ0B 1V6KA 1PGL1 1ODIA 1T9HA 1CW2B 1KEEA 3AL6A 2ADDA 4IRUB 3RCBA 3THYA 3RAGA 3LK6A 2NYVA 5DM70 5ECYA 1MHTA 1ZOLA 2DR0A 4LZJA 4I81A 2IHJA 1A71A 2NO1A 3D3NA 3NKLA 3NBYC 5L3SB 3T61A 1ZH8A 3Q3CA 3NV7A 2YYYA 1P0IA 3E9CA 5JZGA 1JB9A 1AT1A 4QARA 1VRCA 1JGTA 3QF4A 1GPJA 3JASB 1FYVA 2ZRJA 3CZAA 5A9TA 1MHPA 4IZIA 2V7XA 4QATA 1SPPB 4XASA 1D03A 3QEMB 2EKZA 2Y34A 5JAUA 3GBFA 2JFWA 4LK6A 3MTQA 4DUYB 3FA2A 1ULFA 4QRHA 2B4KA 3SU8A 1EUDA 4FZJA 3QD6A 2W6ID 3V4OA 1EGVB 1FDUA 3TTTA 3W9BA 2IUWA 4N3GA 1K5GA 1RVF1 1IWPB 5JXWA 1RVDA 5KWRA 4Z86A 3OJLA 3RS2A 3QU5A 1GZ5A 3C87A 1OXBB 2W68A 3U48A 4B2YA 4EVSA 3VD7A 1BE8A 4HKOA 1SVMA 4F5DA 1UK6A 1D6NA 3PQ3A 5KTMA 1NVUQ 5C51B 2ZS8A 5LATA 2BGJA 3FFTA 4HDAA 1JFFB 2G1MA 2NXWA 1HV0A 2ZSHA 1E2EA 1ZK3A 2YGMA 5JWPA 3ND7A 2JEZA 3ANNA 4GWGA 2A3RA 4XDGA 2ZX0A 4TVBA 4KPUA 5LU9A 4B6GA 3I2YX 5JXJA 2I1VB 1B16A 2UUAB 3QWIA 2FY8A 1ZUNB 2P34A 3T0BA 3ROZA 4YAIA 5CP8A 5H5JA 4ZRNA 2A1TR 3ZYJB 4ASKA 4IOKA 2DUWA 1Y7BA 1WMBA 4QM8A 1LVUA 1CQJA 1IRIA 3MJRA 2ZE8A 3TDKA 4JLWA 2P30A 4QXQA 4TSFA 1SCNE 3PGJA 3COYA 3PENA 4Z2YA 4ZCSA 3FNQA 1IS5A 1W2WB 2A2ZA 2PSJA 3WDTA 4N0QA 2GAAA 4LHNA 2QB5A 1PR3A 3JVUA 5JIUA 5CFOA 4BRZA 1IY0A 3O38A 1G5QA 3W5DA 3AZZA 2H5JA 5FORA 1IQAA 4K2HA 1RIRA 3EJWA 1VJ0A 4MHTA 1ZZ8A 4RE5A 1AU9A 2X4IA 2QTRA 3V6MA 1EVEA 2XL7A 4D6RA 4MW5A 3PHGA 2WINI 3S57A 4WY8A 2FPPA 4QKBA 5H0IA 2JE7A 3TQOA 3KL2A 1GL9B 4Z0NA 3D8SA 4J03A 4M9RA 4FMBB 3JWJA 3M9XA 3WXPA 3G5AA 2V3WA 3F96A 4B29A 3UAOA 4YJ3F 2VSNA 3U3DA 4B4PA 4NV3A 4I50B 1TG7A 2X9LA 2H0RA 2UWCA 1ESCA 2AJBA 2HSGA 2GXQA 4JB3A 4AU1A 1DC3A 5HX7A 4WERA 4B7CA 4AG5A 1ZYUA 4DLYA 2Q5QA 1N0HA 1XNAA 2E7TA 4BJ1A 1IULA 5BV2P 2HDOA 3DL7A 5DNVA 4FOYA 5DAXA 3CG0A 2BM0A 3OQIA 5HOQA 4G3YC 1AGNA 4HDOB 3UAVA 1ARZA 1C9EA 1IHPA 4TV9B 4DB5A 1F6WA 5E8RA 4RA0A 1Y3TA 5REQA 4YGBA 2I67A 4Z4QA 3KTAA 3B12A 3SJUA 2O5CA 1RWNA 2O8OA 4DMLA 3ZWBA 2PT6A 3H8JA 2C83A 1V43A 1FMD1 2I7VA 1EK0A 3AF1A 3QTBA 4DMFA 4NENB 1UDRA 2W1QA 1PZFA 4Z7OB 1WB6A 5BP7A 5JCOA 5JMTA 4B2IA 2E3JA 3MCAA 2ZATA 4X8LA 2G67A 2FUKA 3EB7A 1ZLYA 5JLJA 2AX4A 1XIVA 4X3CA 1F3LA 1QYWA 1TPZA 5BUCA 5FA5A 4YRPA 4UC0A 1G64A 4MIKA 3HN7A 1CUSA 3LO5A 3NWJA 5AHWA 3FSGA 3V0BA 5AI4A 1NDHA 1NLFA 3P27A 3C8ZA 3HEBA 1NMXA 3LPMA 4ZAYA 1JFTA 1I2BA 4OK6A 4YFWA 4EW6A 5A3RA 1QHIA 2D93A 2BOVA 1SXHA 4QYWA 3D0OA 4DA6A 5J5CA 1KI6A 4IIJB 1Z5NA 2YJZA 1V6SA 5B3JC 1QTQA 4NCNA 4DG8A 2PTMA 1V3VA 3AP9A 1L6IA 2AFIA 3T7TA 1OB2A 4BX3A 2E89A 2BFEB 3RROA 1MKYA 4OX9B 3B94A 1E9RA 5GAJA 1DLLA 2B1RA 1A9PA 4UNNA 3FJOA 3H1EA 2D0IA 5BURA 3I4CA 3QA9A 4LGMA 5J98B 4MV6A 2FWIA 2B5HA 3V2IA 4QE3A 1ULSA 4CKCA 4TWJA 5ULLA 3CLTC 2FN8A 4M1TA 1EDBA 1FFGA 2QTWB 4C07A 4P5EA 2HU8A 5F9MA 2CZQA 2Z69A 4WFJA 4G84A 2FSPA 2ZX2A 4OI4A 1Z7EA 2RD2A 2ZT5A 3F8TA 4WM8B 3COVA 4OHZA 5C3MA 1IUOA 3GOQA 3EXFB 1CRQA 5AT1A 2MYTA 3OZXA 2JICA 1C4OA 4LWZA 4BAUA 4CNQA 4D9HA 4U3JA 3HJNA 4R8HA 4QPIC 5KWIA 3ZDAA 4DM4A 2DCJA 3LCJA 4L8YA 4EGFA 5IZ4A 3P9ZA 4LHVA 1N36B 2ZU6A 2JDNA 2P9EA 4KUHA 1XQNA 4ZQGA 1L1EA 2D97A 2W91A 3NAGA 4CDWC 3C3MA 4UE2A 3NPMA 2D6LX 4IV3A 2B99A 3L1UA 1XROA 3INGA 2VAVA 3HJGA 4NG5A 3WL5A 2DTDA 3SXWA 1O57A 3DAGA 2N46A 1C1DA 4MVJA 5HE8A 2IZ5A 3CHYA 4UBIA 2XXZA 5GZDA 1II8A 4COWA 4RIEA 1YZFA 3WJ2A 4C1WA 5JDIC 1ADCA 1WVMA 2BHNA 1W2UA 1EINA 2WUGA 1H2FA 3PNVA 4QLBA 4E12A 2ZI4A 5A6YA 1HQLA 4R4XA 3QSGA 3Q5EA 2UYOA 3MUZ1 1QDUA 4Q16A 4UBHA 4PZCA 3N9PA 1OKQA 1U7UA 3LC0A 4W5HA 2H6BA 3QHPA 2CU5A 3PXBA 1H2BA 4ZVPA 1ANKA 3WYCA 1X0XA 2IY9A 4JQZA 1CWUA 2JAXA 2OGWA 3AF0A 3U13A 3KALA 3C6XA 3RE1A 2W87A 3S6JA 1KP3A 4EUSA 1IEXA 1VMDA 4FFBB 4P81A 2AC4A 2VNOA 2H1RA 3LDUA 4HFMA 3HBJA 1US8A 4IXDA 5FQ0B 5EJMA 3ACIA 3UH0A 2OAQ1 5CXSA 4DILA 5EXPA 1VP9A 3ZPOA 2WDZA 3DDUA 3G8BA 1UZWA 1YL7A 2PHTA 5IK2D 5DNEA 1AR61 2XMQA 2H2HA 3NHRA 2ZXQA 1VHWA 3KHSA 2OKCA 3VKOA 1NATA 2VP9A 3CT4A 4EG5A 5SV5A 2AD5A 2GXAA 3OHPA 3IBGA 2XUHA 3P0FA 2GZMA 4G85A 1E2KA 3QENA 1JECA 4NE2A 3AVYA 3VB9A 4XB6B 4HMPA 3K53A 1QEXA 3Q8MA 4EA6A 3PTRB 5FOQA 1FPMA 2R5WA 4W5WA 1U2ZA 4WY5A 5FAXA 3MI8A 3VSCA 1X7HA 3TEWA 1T36B 3KYDA 3G0IA 5HJEA 3S2GA 5LQJA 2LW8A 3A3PA 1REFA 4FDLA 4IS2A 5L3RA 2A7QA 1UP4A 1YIDA 2H16A 3ONWA 3FKQA 4FD3A 4BEBA 4BFXA 2UZ3A 2HLNA 1Y1LA 4F9TA 2AYXA 4KMRA 4XWOA 1L4UA 5FBVB 1QOTA 1QWSA 5KC9A 4KDCA 1WCIA 1ZRNA 2C3PA 4Z4CA 5LYJA 3C5EA 1XUOA 3O2QB 2B9EA 2R041 4GOND 1KJWA 1NJ8A 1NRIA 4U2CA 5FO9B 2IF0A 4OAOA 3J81A 2CB0A 3GEEA 2QL7A 5JSKA 3WFJA 3ABZA 3WWEA 3USUB 4FYWA 1OA1A 4F9EA 1O94D 4I5IA 1XVVA 5BMVA 2DFTA 2XT9A 1WA6X 2RV9A 3WW2A 1M6VA 1OFNA 3JQ6A 4E2FA 1AVBA 3EPLA 3I59A 2N1BA 1SG6A 2EZUA 4RJ2A 3OCWA 2WJVA 2ZROA 4LYDA 3FFXA 1Z6TA 1OOPA 4MOWA 1LV8A 3ZHQA 1GYKA 3ZFFB 1M33A 1II0A 3TD9A 1O3TA 5ALKA 2EIXA 1B6RA 5CIWA 1Y4DE 2VCEA 4Z1MA 2PS1A 2CNAA 3AP4A 2G4VA 4JBIA 4WL0A 1SWVA 1BZYA 2LTNA 4YJFB 2G25A 1NM5A 2VW2A 5F37A 4D41A 2DECA 2V7BA 2XCOA 4HMQA 3N0VA 2VEOA 1PS0A 4OUDA 1YKFA 2X14A 5BUZA 3THRA 2VBPA 5HV0A 4IKPA 3VYSB 2VUJA 2RK6A 3BB3A 1UAIA 3ENZA 4DBZA 4B6OA 2LCFA 2NN8A 1Q0QA 4Q4JA 1WDKA 1JKMA 2VMEA 1ZGHA 1HDIA 5F5NA 1SXJA 5CCXA 4JYBA 2ZIFA 3BCSA 5JDCA 1PJ8A 4ZU7A 2ZIEA 1KYTA 1GP5A 2HM7A 3R5HA 1LSUA 5KTSA 1MS0A 2WD8A 3VBOA 4CDXA 3K20A 2F17A 3FPSA 4UTNA 3KJNA 1QJU2 3DAYA 2NSJA 4H14A 1YZQA 3P2IA 1MQTA 4TV8B 3MICA 4DJAA 4UQOA 1X33A 4AYUA 4P33A 4UTZA 1NOIA 2PZEA 1JIQA 1B3BA 2HX1A 2HDHA 2RK3A 2IXKA 3SH5A 2RBKA 4FC7A 2ACKA 4AKIA 4PRYA 3A4NA 2CWMA 4EHNA 3J8F3 2O6LA 2YDEA 3OJEA 4RELA 1MH9A 4QG3A 1XZKA 4CM5A 3KVBA 4EWAA 4FOOA 4CEJA 1IM5A 1PR2A 3WKDA 1QHFA 2BFUS 1F0PA 2LKCA 4W6WA 1XLVA 1JHPA 5C4GB 1YLLA 2YYOA 4R1NA 2EL9A 2EXJA 3GUVA 4DE5A 2EX0A 3C1UA 3TNFA 3K4HA 4B8YA 2P37A 3M89A 1KEVA 3IAM1 1AS0A 1TA9A 4UE6A 3QPDA 3ZYBA 3UWOA 3EF1A 2IXIA 1KMHB 1X7YA 1GGHA 4DV3B 3EYAA 5G02A 1YVDA 4ACBA 4A16A 3M6UA 4TWAA 4TTPA 2IFTA 7GPBA 1CEQA 3HACA 2WQ6A 1Y9GA 3H1AA 2WPDA 2YBKA 2O1XA 4YAUA 2R7MA 4BQ3A 3I73A 2YMQA 4CDQA 3FZEA 3CSSA 1C7FA 2YIMA 5K3FA 4YW4A 5FEMA 1IN5A 3ATGA 5CXXA 3EDYA 2Q7XA 3ZR4B 1JHJA 4MROA 5G1PA 2PFKA 2VAMA 2JZCA 4FSJA 1UC9A 1IN8A 2OORC 5AXCA 5AXBA 5A2GA 3DP9A 3JAWA 4URZR 3SPXA 2ZRQA 5ICGA 2E1RA 3A9RA 3DKKA 4PFQA 5ICSA 4IV1A 3HVDA 2ATVA 3HKCB 3EXG1 1P44A 2Y76A 4WXRA 3QQ5A 3J9SA 4FKMA 2FA9A 3RTBA 2G28A 1MFZA 4LJ9A 2WNVB 4MKHA 3ZY6A 3F78A 4P93A 1FDTA 2FX3A 4Q0SA 3SG0A 4A0HA 1UMDB 1F7UA 3TNLA 1GAEO 2AN1A 5CGZA 4BKRA 1GQGA 4M00A 1KDVA 2Y71A 3N0XA 4IEXA 3S81A 1XRLA 2F4VB 3CW2A 5D5QA 1XQVA 4LY3A 4IGKA 3DUFA 1J3PA 4EBFA 4AWXA 4IIBA 2R1TB 5HRCA 1PGL2 1A2KC 3IP7A 3VHXA 3PNQA 4KACA 5K3EA 4GW3A 4D1YA 4YCLA 3PNYA 2PX0A 3S68A 5HUQA 1EFVA 1TO6A 3P9YA 2ZABA 3I49A 5HJ7A 4B71A 3OI7A 4CU5A 1UZMA 4Q24A 1CVLA 1Z17A 3TJMA 5FPXA 5CD9A 5C52B 3IN9A 2R4TA 2OC4A 2Z83A 2GXSA 3S27A 1H65A 4EF4A 3NNLA 3RC3A 2B45X 1RWKA 2ZM6B 5F1OA 3F1LA 4FYPA 5AO9A 5CD1A 3R5JA 1ZI8A 2PJDA 2A88A 4HWTA 2PGNA 3EIXA 1JUIA 1XYGA 4LA4A 5JANA 4BNXA 3C5VA 1OY1A 3WOVA 5A9SA 4JI0B 1R6UA 5A5GA 5EE9A 1G9DA 2VA9A 3KCNA 5E89A 1HSOA 3PGKA 4WZCA 2HIMA 3AF3A 3E84A 3G9UA 4L22A 3HQRA 5KI6A 1TX4B 1RVF2 2WO3A 3DAOA 2NQ2C 1H0SA 3WYFA 1NVKA 5EIFA 1XU2A 2VS1A 4EVQA 4KWKA 4BE7B 3G2OA 4HN2A 3MWGA 5A0FA 1WVGA 3SKYA 5KOHB 4GMP0 3ZSKA 1LVGA 5FBJA 4I2NA 1IQDC 4LISA 3C74A 5L51A 2DT8A 3ZV3A 3TSAA 2HFJA 3U9SA 1F2NA 2JG9A 2X2FA 4AN4A 3NDPA 4ROSA 4D2IA 3I4FA 4ESEA 2PAEA 3QE0A 5IVJA 5IKMA 3GVPA 2WWJA 4BN4A 4LQCA 2VJAA 5TX7A 2W58A 3TMYA 3O8BA 4N6NA 3E1SA 5BV6A 1V00A 1UKBA 5CT6A 3F6BX 4TTGA 1YRHA 1PT5A 4I1SA 4IEYA 1GPMA 3WEZA 3D4PA 4ENSA 3UK6A 4OQ9A 3HBKA 1DV2A 4I0WB 2IZZA 2PLV2 1JMKC 2XYRA 4IDEA 4EPTA 2CLOB 3GELA 4E30A 2O2JA 1YC61 4ESVA 3EARA 3BTOA 4EH1A 3LOUA 4YHHB 4WY2A 3B1KA 3DCJA 3QYPA 4C5AA 4L4ZA 5ALPA 4EHHA 2RK4A 5FTTC 1A72A 3N7UA 3WJ1A 4EG0A 3C4JA 4NCAA 1SXGA 1WLYA 2DVAA 5FFFA 1E2NA 1P60A 4X1KB 1IG3A 1NXXA 1YMQA 1G21A 4TVOA 3QMMA 1I80A 3GPIA 3GGJA 4ZAGA 1POV3 4ZHQF 2D00A 3B7WA 2YZ7A 3V32A 3WI7A 1LW7A 1W75A 4QKNA 4NCKA 1D1SA 2PTGA 4QOEA 2EF0A 2VCCA 2C2MA 5A4AA 3MW2A 1WCXA 5DLYA 4NPLA 1EE2A 4JI6B 4AZ3B 3HWSA 4IXNA 4RK6A 5F1YA 3N2LA 5AFBA 2J9XB 4Q1FA 5EIWA 1XBTA 4E15A 2PA3A 2LDBA 1FVXA 4HAWA 3HKBB 5CB4A 1XFDA 2RHDA 1O89A 4P7BA 5CVCA 2O20A 3PC3A 5BQPA 3HCDA 3TD2A 2GZ1A 1QOQB 2XJ9A 5E4JA 2TMKA 2VEDA 3CO5A 3N2ZB 5GZ1A 1X15A 3CZCA 4F8YA 2XUEA 4PGHA 2R8ZA 2W5FA 4ZYTA 3ZE0B 3RVSA 3LHDA 4FI3C 3WNCA 1X1SA 1N1GA 3AHGA 4KBFA 4GAEA 2Q4DA 5EZYA 3S1LA 2HPHA 2NUPA 3M3IA 5JO0A 5CG9A 4R7ZA 1HNNA 3UGJA 5C2JB 3AYDA 5BYAA 4YIHA 2QBXA 2I2BA 1Q3KA 1Q21A 5J9FA 4MH0R 5F3GA 4ZI3A 3OB8A 4CEYB 4D8TA 3Q2OA 5NLLA 1JHAA 2B8NA 2H3HA 3DE5X 3FVQA 4K7JA 4A0FA 1ORWA 3WLAA 3NWKA 4L3VA 4R8LA 2LIVA 2WJSA 4KG7A 2B1QA 3CLRD 4EHBA 1V9CA 5ADVA 2CLSA 2GF9A 4NARA 1MO3A 4QVKA 3T0FA 1LOEA 2W9XA 4OG2A 2XYPA 5IMBA 4D9FA 4LVOA 5C7OO 4ZVLA 5EINA 2G9GA 2JKBA 2R0FA 4X0EA 4B3CA 1NJFA 1W5TA 2JA1A 1J07A 1P2GA 2XWQA 1VAKA 4MB0A 3PQ7A 1JLSA 4PYKA 2B7BA 2C04A 4ZS3A 5CX1A 4KNCA 1D6MA 1GQFA 1X8JA 5DEOA 2DC1A 3KU1A 5CB6A 3ZLVA 2NP7A 5EP2A 1CJKC 3DBOB 1K2WA 4GKYA 3QNWA 4E2WA 2Q9BA 1QGYA 1JZSA 2NZ2A 1GNZA 5J47A 1RJGA 3NIWA 5DASA 2IDJA 1IB6A 1IVNA 5AVUA 3I9MA 4COVA 3AJZA 3W06A 2RMU1 3NVKI 1D2AA 2R9VA 4JR1A 1Q20A 3H83A 2E7ZA 1KEKA 4Y26A 1F8YA 3F4KA 1BNCA 1SBDA 1KKUA 3MRSA 2P0YA 3WB0A 4MWSA 2PUFA 1DTEA 6NULA 2A0UA 3E5HA 1NHWA 1AE1A 1C7IA 2ORIA 2D0DA 4XB1A 1EIZA 5IVHA 2MIIA 4IGOA 1QGUB 3K8ZA 2DHEA 3SQWA 1UPUA 2B2XA 2MNGA 1JR3D 4C3UA 1AN0A 1JYNA 2NVUB 1FYDA 2P90A 2YOFA 4F4CA 2CN1A 2HEGA 1ND3B 3POJA 1TF2A 5AQ1A 4A2PA 5BSWA 4A3SA 1OWOA 1VIYA 4RA6B 3H5WA 5LRRA 1EP3B 1WSWA 2GKOA 1APBA 5JCJD 1FVHA 2X6RA 1J84A 2P4SA 1F0KA 4QWNA 2VSOA 4JI2B 3K1TA 1QU2A 1ZZ7A 4HOOA 2ZQYA 2HEWF 4NDNE 3QACA 4XHXA 4Y2JA 1IK6A 1HEUA 3LPGA 3UYKA 2BISA 1ONNA 1JPNA 3TSYA 1H8TB 5IANA 3MCZA 3V9PA 5FO1A 2ZU0C 5C70A 2FE4A 5TARA 3HCBA 1DEHA 1Y34E 3M5CA 1EZ1A 1B73A 1FSGA 4Z2WA 2GZRA 4XJUA 1N47A 1OU4A 4MGYE 2OKGA 3CUKA 3PPYA 4MWZA 1JDBB 5JSFA 1J8DA 2XWBB 3Q9NA 2WFMA 3SSMA 1MH1A 1XNJA 2PX2A 4M1OA 2QZ3A 3ER8A 5DGTA 1QCZA 1ETUA 1GQSA 3VI4B 1DLIA 1HOTA 5JWHA 1VHTA 2HXYA 4WADA 3G7SA 1XCJA 4HDRB 3RC1A 2H8KA 1UJNA 1EPUA 2EZ8A 3KKMA 4QOSA 5JAOA 3WKCA 4CM4A 4ZCRA 2VT7A 1CZTA 3H8SA 3ZCQA 2GLXA 2FSGA 2C94A 4YAKA 4ZQBA 4KWJA 5FXWA 2VJYA 2BGWA 1EYBA 3RYHB 3DHYA 3K1YA 4OMUA 2ZIZA 3CO0S 2DBZA 3MLAA 1G19A 4B6RA 3THWB 3HEAA 1IN6A 4A0GA 1MPXA 2HB6A 3DLTA 4FNOA 5AJTA 1IXKA 4QTTB 5KNCH 2GBGA 3PA8A 3QRWA 4LBQA 4KPGA 4D3DA 5EP3A 3ZXDA 3QWAA 5GGXA 4D44A 2O3SA 5COAA 1KF0A 4JSRA 2JKYA 1V8FA 2QAJA 2XTMA 2QVSB 1QJ4A 4TL8A 4MW7A 3VZPA 3CUEF 4O8ZA 4B6FA 4M4SA 2QMQA 1R64A 4P4TA 3OFNA 1Z25A 1KP9A 2IA5A 2UDPA 3WB2A 1I0ZA 5D6OA 2HLEA 3L0PA 4LPKA 4FFWA 1RUJ1 3MBOA 1ZJZA 4WKPA 3E35A 4C87A 2WPNA 4RZIA 4BPZA 3L6OO 4MGZR 2IHTA 2YS6A 4PQEA 1RXWA 2LTAA 1G3UA 5FXXA 5ADUS 3EG9B 5K0UA 3VHRA 1PK7A 1YVPA 4DMGA 1LU2A 3QEKA 3EVNA 5FYZA 4YFVA 4OHRA 2YQ5A 1CD3G 4QB2A 1CIWA 3ECCA 2N1MA 2VDVE 3QBDA 5AUPB 2JAWA 3SC4A 3NDIA 1SFNA 2JDID 4ONUA 1ZVQA 4DUPA 3KJHA 2NMVA 1MS5A 2CFSA 1LC3A 1FJGB 4U9UA 2AG8A 4L0DA 4RHXA 2DU1A 4W9NC 3RQIA 2L2QA 2A5ZA 3DMGA 2QE6A 2XMDA 2P17A 1BQ3A 2OLJA 4LORA 1QJU3 1BN7A 3VHQA 5KDOA 3B70A 1IQPA 2FMDA 2QNRA 4HH1A 2GWRA 3KF3A 1VBA3 2E33A 1NF8A 4A0RA 1Z74A 4OIFA 4YXWA 3W20A 4Q6WA 3GRKA 1QE3A 2XMLA 1NW5A 4JJKA 2HJGA 3I6IA 2R042 3PJEA 2H1OA 2CL7X 3AEKA 1SFYA 3PWTA 1ALYA 2YMLA 1G8GA 3TQQA 3WY6A 3INTA 5KDDA 3DOHA 2VZ9A 4Q02A 1A9YA 5JI3E 1UBNA 4N53A 4JLJA 3KWVA 4E14A 3T0DA 4B8WA 2NQYA 2X6QA 1TCBA 4FMPA 3E15A 1PFKA 2QA5A 1AXRA 3KHKA 4RDHA 1AKVA 2WA1A 4CLRB 5ITWA 3I1IA 3SBOA 3WW1A 4L2IA 3Q88A 4C89A 4JDUA 4CT4B 4U8GA 2OG2A 5FO7B 3O5SA 1A9SA 1N2XA 2R2GA 5IUNC 5E0OA 3ZOZA 3WL8A 1TU3A 2ZE7A 1R6AA 3RLIA 4IOMA 4OHFA 2PD6A 1DI0A 4V0ME 2ZZNA 3I12A 1HTBA 5IBQA 5ALFA 4B3DA 1RBYA 2JRCA 1DPGA 3A1NA 1ISSA 1SHKA 1RJ7A 2D3PA 3NM5A 4JQOA 1K8ZB 3BBLA 2J9GA 3VNQA 1W0KD 4B40A 3QVGB 3O8CA 3OPTA 1XO1A 5MN6A 5A4IS 3DVAB 1AKWA 1O4WA 5CEJA 1T2FA 3GP5A 3WAJA 1DP0A 3C24A 1Z45A 2WKSA 1RUI1 1GITA 1CNMA 5HR5A 3PLRA 4GKJB 2G1AA 3T2PA 1QDOA 2Q4RA 1LI4A 1UWCA 5B6JA 1R0BA 1FNMA 3G85A 2AS0A 2F1OA 2GJKA 1F31A 2UVDA 4XJVA 8AT1A 1A7KA 1UQRA 2FG5A 4DIQA 3HJCA 4KODA 1E3QA 5DQ0A 4CCEA 1Z07A 5G04L 3FR8A 5E3IA 3NNSA 4QYMA 4CTKA 2IQIA 1PQUA 2QJVA 3VDCA 4AMZA 1P80A 4MWOA 4WA7A 2NXCA 3QJGA 5IYZA 2AWOA 1HGXA 4MIEA 4LF6B 4XGIA 4LG1A 3ZU5A 4RMIA 4AURA 3FGNA 1JHOA 1OWPA 4OPMA 4N7MA 1TF5A 1X74A 5L7OA 2Y2VA 3DKWA 1LSJA 1HL3A 1M1YE 1M6HA 1AV7A 2EKQA 3U61B 3U44B 5D84A 4G0ZA 1P39A 1PJQA 3P4UA 4CP2A 3V0AA 3WLHA 1AXEA 4R8VA 1PGNA 4UEQA 1TZOA 1PGPA 2VDKB 5H9WA 4NICA 4PFJA 4JKOA 3SJCA 4Z4EA 1JHYA 2IOQA 4P7GA 1CUXA 1G18A 3TPCA 3JYHA 1HWYA 4C1BA 5BNQA 4UXHA 4D74A 3SOPA 1UYZA 3D0KA 2IFWA 3QUCA 5JQGB 2DUMA 3R3JA 1DAKA 1U8AA 4XJSA 5EWMB 5ISMA 4AJ4A 1T5IA 4RDCA 1U0GA 4IDDA 4WSOA 2QU8A 4AZZA 1G16A 4ZT7A 3ZD9A 4QD2A 4RTSA 2PJRA 4ARUA 3ESQA 5KYYA 1A82A 4YBZA 4QGAA 3A31A 5KNCD 2IVJA 1RVF3 1NQDA 4CM1A 4BNLA 5LEKA 3NT5A 1THMA 2GYVA 3L3BA 5D1NA 1HDOA 3RHZA 4OYRA 3IAM6 3GLQA 1L9XA 1F5JA 4IIXA 2DCUA 2YWRA 2E82A 2AV6A 3P9NA 1K6JA 1G8YA 4NZYA 3V56A 2X15A 4B6EA 4P3KA 3UXEA 3GZAA 2J45A 2VZSA 5JSOA 5FZ7A 2H9YA 4BNKA 5G4LA 5BSRA 4X92A 2I5PO 1HI9A 2RDNA 5E8AA 1CPMA 2ZJAA 4LJRA 2NZ8A 3ED5A 1YDHA 5EKTA 2NT4A 4TMXA 4A15A 2X3FA 5CLFA 4NWWA 3U75A 4YCDA 3HDHA 4DV6B 1PSWA 1MVNA 2R1UA 2YRFA 1VLVA 5GJWC 3AVTA 4DRYA 2FPLA 4RS3A 4HDMB 2C3UA 3KUDA 4DEVA 4R16A 3IESA 3TW0A 1AKMA 3PICA 1SCBA 5J2UB 6AT1A 1N6HA 1Y6QA 4DEXA 3QIVA 5DU2A 4YP1A 5DIFA 3SJ7A 2BVBA 3QEBZ 4DXTA 1LSOA 3N2KB 1FY2A 3AHCA 2AUNA 1NW4A 3TK1A 4AHYA 1TUGA 3OH8A 5C9AB 2H1VA 1PL6A 2CW5A 2Y1CA 3CVOA 1P5FA 2O0HA 3BGOS 1DKRA 5K0GA 4V0NA 4ENTA 1QYIA 1ZMBA 1I4LD 2QRJA 2X2EA 3B1FA 5BYJA 2O7RA 1ZAYA 3BCUA 4PYQA 2GOYA 3PHIA 4R98A 5EPOA 1N1SA 1YS7A 4GECA 1M0SA 5IDXA 3M7AA 4GZ5A 5I9SA 3B20A 2VK2A 1NQAO 2XNJA 5FZCA 3RMYA 5SZKB 2PVPA 3B9BA 2AXQA 5FLEX 2C5LA 1W6OB 4YJ3A 5JBNA 3WL7A 1AYM1 3DSRA 4DZRA 2MTBA 2O05A 1OAOC 1ZKDA 2J5KA 1LY1A 1R6XA 5FNZA 1OH6A 1OC1A 3JX9A 5B1YA 4FR5A 1AHSA 2CVPA 2YUIA 1JLKA 2XD9A 3AR9A 3KOZA 2WUHA 2BNMA 3NUQA 3AQIA 3HDVA 2R79A 4B4UA 5EYPB 5LDHA 1J2RA 2XUIA 2JBAA 4OJQA 1AHHA 3RBVA 4E2QA 2YKGA 4B76A 2JJQA 3HJBA 4OF4A 4FR2A 2IF2A 2O8EB 3CBGA 1RJDA 2Z4RA 2I8LA 4TN7A 4YASA 3V7NA 3X1DA 3VYVA 1YZ3A 5D8AA 4KE6A 1IBMB 1P0MA 1YL5A 4LJ8A 2YBPA 2EW1A 3ZWOA 3EISA 2OQRA 3O14A 4YW2A 5JHHB 3CGWA 3HLYA 2NP0A 1G60A 5KSWB 2OA2A 3H0KA 3KQLA 3UN1A 4J3NA 3M1IA 1KY5A 3DQQA 2R2AA 1VXOA 3TG2A 2VOKA 1A69A 4N48A 4KMQA 1U04A 2Q07A 3IA7A 3WGIA 1D2QA 5CHYA 5L3QA 3FCAA 4I36A 1Z8DA 2BMVA 2PN1A 3WG1A 1CEXA 2FSIA 1WV1A 3MMSA 4DDHA 3KR2A 5HQ3B 5FADA 4GULA 1UDWA 5IFPA 2CWSA 3VUOA 4FFGA 5JCPA 2PZ8A 1KYVA 3PXEA 4R0MA 3RABA 3C3AA 2KA3A 4L0QA 1ONBA 2CZCA 3HO8A 4KOEC 3E6AA 1N92A 2HA5A 1AXKA 1DC4A 1A04A 1SULA 1S1MA 5JIAA 3ZGLA 4KITB 3WZ1A 5DWQA 2ZB7A 1AUXA 4K9NA 4DNFA 3VOAA 3MYXA 1LBIA 4JGZB 2C54A 4UCQA 4HETA 1Q95A 4FPGA 3C41J 1LDNA 3O6VA 1RAIA 3DWIA 1HKUA 2QZPA 1GZUA 4LBWA 3SLKA 3H4TA 3K4QA 1R5NA 3BALA 4JUAA 4FQ4A 1WMEA 4WM7A 2Y26A 1KQNA 2ZUVA 1EFRD 1E1NA 4R05A 2V74B 3HFGA 3PUYA 2P75A 5A4JA 4WK4B 5B4NA 3VBUC 5F7UA 5LW9A 2ZGQA 3TAYA 3QFRA 1DQSA 5E6SA 2C88A 4LRUA 2PYDA 3LOPA 3ESYA 5B12A 1PFGA 2MJLA 1ZI6A 2MINA 4WXYB 1TU4A 2VA8A 4QAQA 2PU5A 3IAFA 2PU7A 1WETA 3OM9A 1X1DA 3VZJA 5A1JA 3VKLA 1SLLA 2ZBUA 4B48A 3R7FA 3J8F2 1PFYA 2EERA 4MS1B 3T41A 1MEC2 1H6AA 1V8PA 3N9MA 2XIJA 2G76A 4PC7A 4F5EA 1QVZA 2XUFA 3U7IA 3MUFA 3OD5A 5PNTA 4R1OA 1A5TA 4X1IB 4OH7A 1CPYA 4R9SA 3SS7X 4EHDA 3Q6MA 4N39A 5JD4A 4DSTA 3P2YA 5I7OA 2HMAA 1HH4A 4BE9A 1DGWA 1VM6A 4KPEC 2BV4A 1GL6A 2M9MA 5G05L 4B4KA 2NV6A 4CIYA 4ZCTA 1GILA 3E1KA 5DVZA 4OHOA 2GM5A 4LJ6A 4U8HA 4HTFB 4NFHA 2GH1A 4YBRA 4M1MA 3LEGA