2O14A

X-ray crystal structure of protein yxim_bacsu from bacillus subtilis. northeast structural genomics consortium target sr595
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
354
structure length
354
Chain Sequence
KVYQFDFGSGSMEPGYIGVRASDRYDRSKGYGFQTPENMRDVAASGAGVKSDAVEFLAYGTKSNNTFNVDLPNGLYEVKVTLGNTARASVAAEGVFQVINMTGDGAEDTFQIPVTDGQLNLLVTEGKAGTAFTLSALKIKKLSDQPVTNRTIYVGGDSTVCNYYPLNSSKQAGWGQMLPHYIDKHTFQVRNMASGGQIARGFRNDGQLEAILKYIKPGDYFMLQLGINDTNPKHKESEAEFKEVMRDMIRQVKAKGADVILSTPQGRATDFTSEGIHSSVNRWYRASILALAEEEKTYLIDLNVLSSAYFTSIGPERTLGLYMDGDTLHPNRAGADALARLAVQELKRQGIAGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-Ray structure of the hypothetical protein YXIM_BACsu from Bacillus subtilis.
rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein yxiM
total genus 110
structure length 354
sequence length 354
ec nomenclature
pdb deposition date 2006-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13472 Lipase_GDSL_2 GDSL-like Lipase/Acylhydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 2o14A01
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 2o14A02
1DEXA 4DEVA 1WCUA 2Q1FA 3ZYFA 2Q0QA 2VPTA 1OKOA 2O14A 3ZYBA 1VJGA 1V2GA 2WYFA 3DC7A 3UT0A 4JHLA 4K3UA 3KVNA 4BQ4A 2C24A 4CPBA 4LK6A 4YW6A 1U8UA 4K7JA 1IVNA 4I8IA 4LKFA 4S1PA 2WAAA 1WABA 4CPBD 1W8UA 2JWPA 2HSJA 1VYHA 4IYJA 4JJ4A 4JJ6A 1V0AA 5D21A 3SKVA 4LHSA 1UOJA 1FXWA 3DT6A 5A4AA 4AL9A 1W8ZA 2WAOA 4LKEA 3ORJA 1DEOA 4OAOA 1J00A 3SLRA 4LK7A 3ZYHA 4JKOA 3PT5A 4Q7QA 1WMXA 2APJA 1K7CA 4HYQA 3P94A 1ZMBA 5B5SA 4HF7A 4M8KA 1W9FA 1ESDA 4TX1A 3U37A 4BQ5A 1HN0A 1ESCA 1W8WA 2LRPA 3DCIA 4BQ3A 1Z8HA 1FXWF 3W7VA 4K40A 4LKDA 4PPYA 3DT8A 4RSHA 1BWQA 1ESEA 2W9XA 2VXJA 1JRLA 1L7LA 3HP4A 1OH3A 1W8TA 1ES9A 4RW0A 1GWLA 5CD9A 1WZXA 1BWRA 3DT9A 4LJHA 4H08A 4XVHA 1GWKA 3C1UA 5HOEA 4YW7A 1BWPA 2WABA 3MILA 1GWMA 4OAPA 5JD3A 1W90A 2LROA 3RJTA 4BQ2A 4YWAA 1PP4A 3BZWA 2KR2A 2K46A 4K9SA 4A6SA 4CP9B 4CP9A 4Q9AA 3F95A 1YZFA 5BN1A 2Q0SA 4NRDA 4JGGA
chains in the Genus database with same CATH superfamily
4FPHA 2PBZA 3B2NA 2C59A 2JAPA 3NANA 1Y8QA 2WJIA 2OO7A 5FOWA 3T7TA 5AT1A 1NCQA 3RYIB 5LZ2A 5IVYA 3GGGA 4ZAXA 3RGGA 4C04A 1ZDMA 2ES3A 2FGKA 1PWZA 4FILA 2C8VA 3CCCA 4HPKB 3DEYX 3BM5A 3UN1A 1YRAA 3TN92 4GBJA 2P3IA 5LBFA 3H7IA 1XDUA 4ZO8A 2LV8A 4ZK2A 2VL4A 4UAGA 4QVGA 3LL7A 4D4MA 5CHEA 2WD8A 1LA2A 4MIKA 4CL2A 1RRMA 1N8NA 2UUPA 5G4KB 1U4OA 3GUCA 1RE0A 2AUYA 5FXZA 3DA8A 4IGKA 2W6PA 5HDQA 5KZMB 2CLCX 4PPNA 1YQDA 1WD4A 1MBZA 4PLNA 5BWBA 2FDIA 4DFSA 4U2CA 3CY6A 4G0UA 4P2BA 2I3BA 3CRRA 3IDSA 4UU7A 2XXJA 1B0PA 4A36A 4LC9A 1CULC 5FP9A 4FVTA 1P9NA 1OLUB 1VCNA 4UTOA 4DSNA 1FZQA 2ZVQX 1FFSA 2R7NA 3MUZ1 4H16A 4IDPA 1HQLA 4F2DA 3URKA 1DC6A 2QUJA 3S2SA 3K0FB 4ISBA 3FOWA 4CCLA 4YVWA 1G17A 5EP1A 1KEPA 1Y6JA 4WKPA 1VMHA 4CUZA 3C3MA 3QWHA 4ZV4A 3EBRA 4ZT4A 2R072 1ZM3A 3KKNA 2CB9A 3A2NA 1RUH3 4LJKA 1JYWA 1WU8A 4HWGA 5ETJA 4X61A 4GX5A 4OZXA 5J58A 4NAVA 3L1VA 5K4HA 5LOVF 1YDFA 3EF3A 2IYQA 3DYVA 1Z5VA 4UXJA 1Q7EA 4BCCA 1LDBA 3URMA 2ATIA 5AQEA 4XSGA 2PKEA 3S68A 4DXTA 4YVWC 2AOUB 3S8YA 5JXHA 1ZKDA 4HGZA 1D1PA 2O8VA 3AVSA 2ZKNA 3BTYA 3SP1A 3ZGOA 1J5XA 5CFDB 4J03A 3KVVA 2WIIB 3UT0A 2C24A 1IY2A 4W5NA 2FPPB 1OKQA 4F4FA 3CX3A 5FPAA 4XPVA 4R1NA 1PGQA 1IHXA 3VBHB 2C2YA 2Q8DA 4DGQA 2FEAA 1H42A 1CZOA 4IV3C 1Y1RA 3MWFA 1FFGA 3TEMA 5AXCA 5LDDC 2Z09A 1WPXA 2P9FA 1TXGA 1GVNB 1VSBA 2GBFA 3AV3A 3F78A 1RRFA 1J83A 1PL8A 4AZWA 1N0VC 2RAVA 4BJ0A 3MS4A 4UXIA 3DAFA 2R8XA 3NYRA 4DIDA 3MJHA 3BIOA 5D01A 4AM8A 1VMIA 1RUI1 4F7WA 1VQ1A 3P9RA 1MA3A 2JLCA 2QRVA 3T2TA 3LXMA 4BWFB 1IBKB 2ANBA 5GZGA 4RVNA 4Z8YA 3V1MA 4QPGA 4P7KA 3FFQA 1AHHA 2GHRA 4TS3A 1EQ2A 2VWQA 4N18A 2BF4A 3HB0A 2WHPB 4OLAA 1T2VA 2AR9A 3DDHA 4GC5A 2ZPTX 3FFBA 1W59A 3W6PA 3WX5A 1DKRA 4PW0A 4RY0A 1Z7S1 2AB0A 2J7PD 5LKAA 2FTKE 3EWNA 1MS3A 2TYSB 3GIWA 1QFSA 1MJNA 4J16C 3LVFO 4O4LF 4JC4A 1LV8A 3IQFA 4YRPA 2QPOA 2HK8A 4LLFA 5ALQA 3QVGB 4G0OA 5K3AA 1NPDA 5EHXA 4MIYA 4LKEA 2Q3HA 1Q1EA 4CKEB 3OEWA 3DMRA 1C2TA 4W65A 5CJ2A 3PIRA 4V1PA 2W2QA 3FRJA 1K8ZB 3EZFA 2IW3A 1JDJA 3AR7A 3FMOB 4EKNB 3R23A 5T5LA 2YY7A 3NTLA 2AJDA 1ID8A 3FGPA 4C6SA 3BKXA 1C0LA 1DFHA 4MJLA 4GPD1 3G9QA 3LDFA 3PFWO 1PS8A 4DLKA 3OVMA 1YL5A 4V24A 1ZH2A 3LO8A 1VBB1 5DEIA 1DXYA 4C0AC 2MSNA 3NEAA 1KEZA 1PYGA 4GZ9A 4G09A 4NK5A 3C7OA 4HB3A 5K0CA 4ROTA 3F1KA 4GOJA 1PZEA 5KTMA 3EGWA 4OB7A 1D6SA 4C1XA 4GVLA 4H1HA 3LEGA 4RHFA 3LX5A 4ILKA 3NTQA 1E0AA 4UJ5A 3WVNA 4HLQB 4G01B 4CXXA 2PIAA 3HD8B 3ZWPA 4N43A 4JOBA 3X29B 1IY0A 3VU1A 5DTEA 1UMDB 3O1OA 3C70A 2V1XA 4P5HA 1O58A 2P9QA 3UMGA 2ATVA 3U1BA 3LC2O 1WG8A 3CLVA 1P6XA 5ALPA 4ZK6A 2B61A 2IYXA 5DISB 3RU3A 5DGIA 4N7JA 5BV1A 3VU3A 4Y7DA 1U0EA 2VSOA 1PNQA 3PD0A 1UDRA 2RAFA 4ZAWA 5AOCA 3I3DA 5CH8A 2QWXA 4INPA 4NOJA 3CXRA 2XL7A 3AEQB 2XGSA 5COAA 4A7ZA 1E7WA 2C2KA 3EG5A 2CLSA 2ZTHA 1MGPA 5FIXA 4JQYA 1DLJA 3I1IA 2AVNA 2V5UA 1PU2A 1W30A 1JAXA 4MZUA 3K53A 2X1HA 1BJTA 1F5NA 5JPIA 3KVNA 3H2HA 3VC3A 1KZ9A 4BQPA 1VKRA 1E9EA 4OULA 1LPBB 3JYPA 3H8UA 5F98A 2JWPA 4WXYB 4KPEC 3BU7A 2VNSA 4JDPA 5AH0A 3INRA 3VYVA 2E6VA 3EJ6A 2YUIA 2IYZA 1PV4A 3HXLA 5BUSA 4FT4A 2JAHA 2DWRA 4QFBA 4B3FX 2V0GA 5A3NA 4QBGB 3H3JA 3R5JA 4NWVA 1EE2A 1JZ8A 4Y22A 4AI9A 4E2GA 1Y81A 2PS0A 2XXBA 3VDRA 1EKXA 1N9GB 4J25A 2R0FA 1XZDA 2BEUA 1AF7A 2WLSA 2PSJA 3QI2A 1FU4A 2DTEA 4M0DA 3TIGA 2FG6C 2I29A 1E2UA 5LBEA 4HDMA 3CZ4A 3K6SA 4A8JA 4M88A 5DYIA 1PFYA 3WUCA 4AQ2A 2JIDA 1TTPB 3SXPA 1RAFA 2O3SA 4AS2A 2Q0HA 4ZPJA 2EJUA 1BJQA 1U8YA 5HMLA 5CNAA 3BA1A 4QVIA 3UJ3X 5DG1A 4KEAA 4UHJA 1LW7A 4RJ2A 2XE6A 4Y26A 1CR2A 4YGDA 3MGUA 5FUPA 4NAMA 1TLTA 5FA8A 4RV5A 1UYXA 4WV8A 5D8AA 1MZVA 4AVAA 1UK6A 3RHZA 1CVIA 5FTKA 1D03A 4Z7JA 4LJ7A 2JLBA 2DV9A 5JATA 1PR6A 2D62A 5FBLB 5EG5A 1RWWA 1AKQA 1VHJA 3PX3A 1HY3A 4WZBA 1CRWG 3R7SA 1XCMA 4UHKA 1YOBA 1GGVA 3S2YA 1E1QD 3AYZB 3RFVA 2VJDA 5IW0A 3G7NA 3VKWA 4HL6A 3VR1A 1QKJA 1QHHB 4QGMA 4XLZA 4CCOA 1CS0A 4UU1A 2AFVA 4LF9B 4FC6A 1HSOA 2OBFA 3FZNA 2EKZA 5CLLA 3TSYA 1EWQA 1AYM2 3KT1A 1N0IA 2J4DA 4LRSB 4MKFA 5CFRA 4YIHA 4IWNA 3TUJC 5IK8A 1FE8A 1NCQB 3AUAA 3JZMA 3MFYA 1HE8B 2QMYA 1NC3A 2HF2A 4UTVA 3TPZA 4N0EA 2FETA 4R9UC 1QO7A 4E5KA 4IHJA 2TEPA 2BHTA 2QTGA 2ZBVA 2DETA 3VR6D 1E0KA 5FJHA 1NF2A 3VA7A 4Y4RA 1U9IA 3N1UA 4LHEA 1C9JA 1X9IA 1XMPA 1R1A1 1OOPC 1VHDA 2NU6A 4YROA 3SI7A 1P1CA 2NZYA 3C85A 2QZ3A 1G8PA 4PYRA 5C1IA 1X80A 3BT7A 1F51E 2RI0A 1A4IA 2W2PA 3QLUA 5EJIA 4RZ2A 2XXAA 1W93A 2XUKA 4FP9A 2YX1A 2I55A 2YHIB 2IEDA 2YIJA 2Q6OA 4CCDA 1KBOA 2XITA 1L7QA 3AUKA 4EABA 4DA6A 3U49A 1IAQA 2CNKA 1SLAA 3WVJA 4UBIA 3G6WA 1OI3A 4O7XA 2LCIA 1QLJA 2DVMA 1ZBE2 3FBTA 3I32A 5EQDA 3BXGA 2FPUA 2P6OA 4URHA 4YJ2F 2YXSA 2VJLA 3NBXX 2CEAA 1BXGA 2I3GA 3JTMA 4CKBB 1H22A 2BZ1A 2H31A 1XQWA 3FPCA 5EJ2A 4YASA 4H3VA 4JEMA 1M1YB 2NP7A 4WN9A 4L74A 1LULA 4COYA 3KOXA 1QIFA 1B16A 3NDRA 2J22A 4HNHA 1T0PA 3GPLA 3W2GA 3G85A 2JLSA 3O31A 4C88A 4E6PA 1G1MA 1BDMA 3EZLA 2XPCA 3HBZA 4BJ3A 1QZXA 2NOAA 3AO0B 1SHLA 4DUGA 3WK7A 1UFOA 4DPMA 3S0MA 1L2TA 4XD2A 3L92A 2V6JA 1TAGA 1VMFA 5FZ4A 3AFHA 1S89A 4M8SA 3ACDA 1REQA 2ZOSA 2IODA 5JIAA 2VOXA 5KNDA 2M98A 2R00A 4Y6GB 2PAEA 1N3OA 2GN2A 3HY4A 4ABTA 3IAM6 1NUKA 2X3FA 2QRJA 1L4KA 1R9MA 2ZK7A 4QGFA 3KAPA 4BCBA 5F5XA 1W34A 2R6ZA 1S9HA 3DAHA 2Q2WA 1TQ4A 4XYEA 3KZNA 3UJ7A 2W8BB 4GB32 1CS4C 2C2MA 4DJDC 4CU9A 3WZ1A 3OJWA 2EQAA 4MVJD 4UFKA 3MUOA 1JS1X 2QX8A 3BJRA 2OB2A 3VSDA 5CLHA 3KYJB 3UHAA 2Z4FA 1K5PA 2RJOA 5D51S 3VZKA 1CQIB 4ASKA 2NGRA 1U8XX 5I93A 1FJHA 2O2YA 4J6FA 3WLSA 3DTTA 2FW7A 4J0DA 1QF9A 4DB4A 2WM3A 5I9SA 2OZKA 2AUMA 3VKOA 2MT9A 4B3IA 1XTSA 3QJGA 1CDOA 1BWRA 1K97A 3Q8AA 4D81A 4CEJA 1Y7BA 1RT9A 1YQ5A 1Y3FE 4MW5A 3ZHUA 1RP7A 1MIHA 4UPDA 3O8LA 3KAKA 4I1PA 5JU6A 1UP4A 5DKFA 4XYMA 3C1OA 1P61B 2HU2A 1EDBA 4IS2A 1YLLA 2I6FA 1DGWX 5HIJA 1GTSA 2C98A 5TY0A 3ILSA 3D2AA 2EZTA 3AU8A 4HLTA 5K8LA 1GPJA 1TUIA 4YIKA 2GH2A 5DB4A 2C20A 1T4CB 5AKGA 2WM9B 3UENA 1ZGGA 1Q16A 1H0RA 3AJAA 4CDGA 1VLHA 4D6RA 2B7BA 1S0BA 3O26A 5AUOB 3ZXDA 4YQEA 1WXXA 4A7YA 4DYHA 3DPRC 4P98A 4Y0VA 3HBJA 4DIUA 3LLUA 4XYLA 4OSEA 2IY7A 1J8VA 5HRCA 4R8KA 5JH7A 1W36D 3FHLA 1ZCBA 3G6JB 1H4GA 1UIMA 4IV1A 3D7LA 4UBKA 3A36A 2VXCA 4BDTA 5A2QA 3IJPA 3W9BA 4D0RA 5I4CA 5D85A 5HQJA 4EY7A 5FLIA 4YG3A 3WP0A 4CQMD 2F7SA 3OZUA 1Z68A 5EXPA 4F6RB 4XUGB 2R042 1D6JA 1SBDA 1R15A 1F38A 2D13A 4QU9A 4OJNA 2QVSB 1YUDA 4CTOA 4Y24A 1OWNA 1F60A 1Q1ZA 1I80A 3C1AA 5AXAA 4AI0A 1NYRA 3T1VA 1SHTX 1Q8OA 2JGEA 2R8BA 2XZDA 2WS93 3JSAA 4IV1C 4D3WA 5DLQC 5AVRA 3VGIA 3ZY2A 3SLIA 1L7MA 3QEMA 3FNBA 5E6SA 4BVAA 2IHZA 3V3KA 2AZ4A 1XHEA 3GOQA 1GSLA 4MUGA 4LZOA 3MMXA 4RULA 4QQOA 1KQRA 3E48A 3EDCA 4QQNA 3VBEA 5HFNA 4QPJC 5EC8A 3HLYA 3S7IA 3EZ6A 3PE4A 2BFMA 2DUPA 5HPYB 1ND2C 2R1VB 1VHQA 5LZ7A 5BYNA 4WLNA 3POSA 4DMGA 5EUBA 2UYCA 1GV0A 1EIZA 4A6PA 5CFCB 4HAZA 3L0BA 4H15A 3PUHA 2XNSA 1VI2A 3B2QA 1AOXA 3RW9A 1HDOA 2ZAAA 4HRXA 2EDAA 3ZV3A 2D7FA 2YJTD 3AB7A 2GZSA 4ECEA 4R2HA 4OQ8A 4M98A 1RUE1 4WOCA 5EPUA 3EZ9A 3ZWXA 4YAIA 1M6HA 4HDRA 2Q9CA 3ZVLA 4KQ2A 1OFTA 1VPEA 1F4VA 4A42A 1GQPA 2IDKA 1E2IA 2XRYA 3DAOA 1RUI3 3CRZA 3A1TA 2VNOA 3OESA 4F21A 1OKKD 3BWYA 5EHNA 4OV6B 3GXUA 4F7DA 1T9DA 3OEED 2Q07A 2BEOA 3JQBC 3V8RA 4X8OA 3WK9A 2ZSFA 5HTOA 1FPN3 1B8NA 5DE3A 2VBCA 2QL9A 3EFOA 1Y3CE 5L40A 1GOHA 4YFWA 4PQGA 4DNQA 5I0UA 5CXSA 5EL0A 5H1YA 1XSQA 4NSNA 4MS3A 2YYYA 5I7OA 2JJQA 1US2A 2VKTA 3SVLA 4CGYA 2PE5A 1NRWA 3WR5A 3GLSA 1KJWA 1N0HA 1T91A 2WNOA 2Z2IA 4R9BA 4RHV3 3T7AA 2G4LA 1JVBA 4YJGA 3TGWA 2QBXA 4A7PA 3MBKA 2Y68A 3C6YA 1O8PA 5JJ5A 1VPDA 1MC1A 3HVJA 2I2DA 4LE3A 4IW3B 2JD9A 1EK0A 4WCFB 1DWUA 4MKIA 2H8GA 2H2DA 3O74A 3S8MA 4IXMA 1GGFA 1UC5B 4UDXX 3W6ZA 2ZX1A 1R0SA 4E4SA 1W99A 3P94A 2GJSA 4YONB 4LBQB 4H7KA 1G8KA 2I1LA 4IUBS 5CURA 2RI1A 1FUKA 1AUXA 2Z9BA 3VJMA 1JHAA 2WNVA 1XPOA 2Z5VA 4M46A 1E1MA 2WIKA 4KLCA 2R11A 3IHWA 4HTFB 4ALMA 1DZQA 1R4NB 5FQ0A 3S5QA 3ILFA 3JBG2 1ZL2A 3T95A 2QN3A 4Y9SA 5HXMA 1H9CA 4K21A 1CAXB 2XB4A 4UAJA 4IDFA 3H8VA 3LLSA 3SYKA 5C52B 4HP8A 4JDNA 5FBHA 1N3BA 1LENA 3EQ8A 2GZHA 1NVTA 3DKPA 4MQBA 3DZCA 4MW4A 4RXTA 4E1BA 2BNOA 2VHXA 4LMAA 4MZXA 4EQZA 3EPLA 1N6PA 4QT6A 2IIBA 1KXZA 1WVIA 4NX2A 4K2AA 5K03A 4OPMA 2CSUA 3E9RA 4Y20B 4CTMA 4EH1A 1Z15A 4D3DA 1EB9A 3VZQA 4B47A 3PUWA 1ZZBA 1W9TA 4UBJA 1BW9A 2ZYUX 2MEV2 3OZWA 1VI5A 1SCKA 4QTYA 3U19A 1SXPA 4R4XA 5ED4A 2P4UA 4YO7A 3IV9A 2VYVD 4N3CA 4AJIA 4IXLA 3L18A 4IVQA 3FJYA 4RKRA 5A4FS 3DEFA 2XECA 1UY3A 2JH8A 4NAUA 5LZ8A 5A6YA 1JZ7A 5F2EA 3IO5A 1WB6A 2VCHA 3IEKA 1LGBA 1A9SA 4EL0A 1YQWA 1S01A 5BNOC 1XPRA 3VPGA 1WPQA 3S57A 2BBWA 3M89A 3L4EA 4MV3A 4LISA 4LWOA 2V98A 5CDTA 2I8CA 4H60A 2YFKA 5ANRB 4NBSA 2MSWA 4XOIA 1JECA 4YYOA 5K1ZA 4FPOB 4YCNA 4P80A 1I9GA 3OZGA 4M0EA 4E7OA 2IPOA 5L9BA 3IRUA 4P3XA 3AP3A 4JI5B 3CEPB 2V6GA 3BTSA 1H8EA 4XQDA 3FVVA 5ALKA 4UMDA 1NY72 3ZX4A 4DCVA 3DHNA 4NZ9A 5BO5A 3OPWA 3Q7RA 4AQ7A 1OI6A 1Y3IA 2Q4EA 4KGVA 4EV0A 5LJIA 3K2OA 2OFWA 3UG7A 4ND1A 1X36A 3BGVA 2ZRMA 4Q0PA 4KU4A 1CVRA 3I6YA 1SY7A 2Z3WA 3B6IA 1VJTA 5E9AA 4IETA 3OOJA 2NU8A 4B43A 3QMPA 4ZV7A 4II7A 5HZHA 5C70A 2OZLB 4BLPA 4EA8A 1KDTA 1HDCA 5D8AB 2PH1A 2V7VA 4A6XA 1PL7A 1WO8A 2IELA 3ZFFA 2G09A 3IBCA 1N32B 2A9FA 1HO3A 2NACA 5ECYA 4QA9A 5IZCC 1MABA 3T4XA 1KJRA 4K9LA 5GOTA 3POYA 4BQYA 4O4HA 3X43A 1QP4A 3RDPA 3KWJA 4NZYA 3PUQA 3LBYA 4P35A 1R6VA 2CFRA 2DXIA 3ESRA 4X85A 1XCBA 1L4LA 3K1AA 4FFGA 3Q40A 2P1BA 3KQ4B 1V9U3 1WKCA 1CZHA 4X91A 5J2UF 4HVQA 3BSYA 4A7KA 1LDEA 4EQVA 2PUFA 1SUDA 1YQXA 1TIKA 2A84A 1YIPA 1LNQA 3CMMA 5EV7A 2W6IA 6CHYA 2DBNA 3C8UA 4P5DA 2PL9A 1XTBA 2UZ1B 1FMLA 5DCUA 4YWHA 2RDMA 4NCHA 5FZMA 1Z06A 3HV2A 1RUD1 1U02A 1OFVA 4D5GA 3RC1A 2HTEA 3QCWA 3L8ZA 3JYHA 3TLAA 3D3WA 3I4FA 3EXEB 1Y8AA 4AWXA 1ABEA 3RFTA 1T0HB 3CLPA 4UASA 5IK2D 1ZN9A 3VU9A 1Y3DE 4I50F 3USUA 4MXWB 2FRVA 1SXIA 5AW9A 4HHEA 1FJ2A 4IKOA 5AJUA 3ICVA 4LTNA 4D69A 1CRLA 4PDWB 3M1HA 3O5AA 1J00A 3N36A 5DAVA 2VCEA 3ICOA 4ATEA 1PZ8A 5ANNA 3R9XB 1HNXB 4HGYA 4QGSA 2A5GA 1ONAA 4NKRA 4MTLA 3LTEA 3K8QA 4D0SA 3M3QA 1P5HA 5CITA 1G98A 5HUJA 4NNPA 4LIVA 4YJDA 5A5GA 4DT1B 4YDRA 1PKEA 3NMBA 1T3HA 2HCJB 2WNVC 3BODA 3CLRD 4WZZA 5FWYB 4WA7A 2AOWA 2WUFA 1AB5A 1Q2XA 4DG9A 3PYXA 4G84A 2H0RA 2QE7A 1QOSA 3OOEA 4QB2A 1YWGO 2G0NA 1POV3 3VPAA 4YMHA 1EUTA 5JSHA 2AH2A 5TF4A 1I4EB 5EMNA 4RSMA 2KXLA 4FSHA 1JSRA 7AT1A 1V7PC 4UDYX 4EPRA 3T7KA 4IQGA 4AMYA 4MUIA 1R5NA 1Z82A 2WVJA 2VMGA 4MYTA 4A6OA 1S2KA 1FP1D 5A3RA 2GAOA 2FKNA 4TL8A 2PKQP 4FFNA 4MWBA 4PEVA 2I99A 1GUBA 1NFQA 3J26N 4GI2A 4OYUA 4CQLB 4AR2A 4XMAA 4NOLA 3HCCA 4ZQGA 4W7IA 1SXHA 2DYKA 4KGZA 1OOEA 2OGSA 2WM2A 3M33A 1RI5A 1E1RA 3H3UA 3OJOA 2FFQA 2WYOA 1IUKA 3E7FA 3U5ZB 3QVVA 1M34A 2MINB 4PLGA 1VBMA 3FM9A 1E5XA 3OU7A 4YMVA 1G63A 5DNEA 1U7DA 1AVTA 3SHTA 3LK6A 3I04A 5T3YA 1BWPA 4C43A 1XOIA 4FBLA 3P2OA 2HYKA 5B30A 1QYIA 3CTPA 3OJBA 1IEVA 1DP4A 5ESDA 1IHYA 1XEFA 5JBIA 1Z33A 5IXSA 2CFTA 4B5LA 3CQOA 2F8TA 3I61A 3AZWA 4U1RA 1C28A 2QTFA 1E2NA 2HLEA 4LDPA 4IJ5A 2B8JA 3O8RA 1E2LA 3NFYA 1TM3E 1U2SA 2FUCA 1E5IA 2W42A 2W94A 3PNKA 2C4MA 1AL21 4YJGB 2ZQZA 1MR3F 1ZOLA 1GPAA 2FPXA 2BOIA 1UYYA 2IXBA 4XTPA 3BRWD 4LY3A 2X7HA 4LEIA 3N9OA 1LTEA 4DSTA 3BYZA 4JGYC 3Q3EA 1CW2B 2ZE7A 2WD9A 4KLRA 4LNUB 4Q3CA 5E7QA 3ZIXA 1HQDA 2PN1A 5TJHA 3HUFA 1AKMA 1EG7A 2RBEA 3C3VA 4YG0A 4QOHA 1GYQA 3H5RA 1R50A 3EXFA 3T3GA 2HCFA 4EAAA 3PPXA 1R6AA 4C3OB 2FQPA 2VSQA 3IR6A 1TEXA 2IHVA 3HJTA 2WU3A 3ZXKA 2R25B 2SECE 5JJLA 2P0EA 3DBRA 3AVTA 3K6RA 1BYIA 5HK9A 4GBGA 1USVA 1UXJA 3NVMB 2GNBA 4YRQA 1OA4A 1WIWA 3KEFA 2HKIA 5KWIA 1E4VA 4OUDB 2AW3A 1A9XA 4OUMA 3SC2A 1KO1A 3J4UH 3ZJ4A 2VRNA 3WBFA 3AKDA 4K8RB 3HWWA 3SK0A 2ABWA 1ULOA 1C1HA 5JJKA 1UZUA 1TMGE 3CUYA 4CWAA 3KHCA 3E2IA 1N47A 2QMEA 4MXVA 3PYMA 4KQHA 4B35A 5BV8A 2IXCA 3U4IA 1PEAA 4YH1A 1O6GA 3F4BA 4XAEA 2ZSKA 1RBQA 2A0WA 5EYXA 3PP8A 1ZNPA 5DLPA 3QUSA 1QBGA 2NSLA 4E4YA 2BONA 3CLUD 2C3UA 3AQIA 3DMDA 3OUTA 2WNHA 2XTJA 4U7FA 4DY4A 1GNTA 1C7FA 3VUFA 4C7MA 2J0VA 3UKDA 1S5PA 1DKLA 4Q18A 4B84A 2OCKA 3OFKA 2C96A 1K75A 1M75A 4WVZA 3UTCA 3W6OA 3DDZX 2R751 4LF6B 2UAGA 2FUEA 1G42A 2ZI7A 1XVTA 3WYAA 5JYBA 3A06A 5D7BA 1I1HA 5ARBA 4A0RA 4R8VA 4R71A 1ZZ8A 4QKFA 4FFBB 5DI9A 5CX1A 3W4IA 3L43A 1DQ4A 3ACIA 3C41J 1ENPA 3KVRA 4LK6A 3FSRA 1UD1A 1Y7TA 1SHUX 1RD4A 4GLFA 1II0A 1YGPA 4F4JA 4DUWA 2VY0A 2DFKB 4FJ1A 2V54A 4EWLA 2H0AA 1MQTC 1XNKA 3NEPX 2GN6A 2LW8A 5DYGA 5D84A 1E79D 4TGLA 2HKXA 2BHLA 4D97A 1E2BA 3FJ1A 4IEVA 3DUWA 1TU0A 2SHKA 1G8GA 3DUFA 4JBHA 3THYA 3A14A 4NAHA 4U39A 1I2BA 4B8EA 3C7EA 4GX1A 1OUSA 4ZN6A 3MINA 4DY6A 1HIXA 2OUJA 2CNDA 4I08A 3H05A 3VTAA 2BWJA 2QV0A 4UVDA 4UNNA 1TKCA 3P52A 2BGRA 1W4ZA 4CCEA 5A7FA 3LECA 2JKXA 4L78A 5J7MA 2CNNA 3GZEA 4EY4A 2YZ7A 3NOOA 4XH9B 3ZFGA 4UQPA 1BVP1 2OYRA 4EG4A 4DR1B 3I1YA 5CR9A 1MZEA 1OV4A 1JZ6A 2BBSA 2O9JA 1JUDA 2EKLA 1RRVA 4PAGA 4DL9A 2BY4A 5CDGA 3G49A 1K8QA 3KT4A 3OEHD 1X86B 4KXVA 3TE6A 1F2UA 2KS6A 3K1YA 1KOGA 1KFJB 3I73A 3PT5A 4DJJA 5ICMA 1VBKA 2G1AA 3O38A 3N0WA 2GAFA 1XNBA 3F97A 4OGKA 4PZAA 1QX4A 2XMRA 3WDLA 4O4HB 5K3SA 1B15A 5DLDA 4CEYC 3ZVMA 2A6PA 2JCYA 4MS1A 3ELNA 4UHHA 1W2GA 2QNKA 2PUHA 2OESA 3SX0A 3K15A 2JJYA 3ULKA 1F8FA 3CCBA 4M7WA 4YX9A 4Z49A 1JG6A 4KAFA 1AX9A 3QX9A 1M6VA 2ACEA 1HNNA 5EKSA 1E18A 3FSGA 3QVKA 3DDSA 3QWFA 4DXZA 2O2HA 1F0KA 1YU9A 3RAPR 4TLEA 1GCIA 1GIAA 3CFYA 1C4KA 5IM4A 2LALA 4AJLA 3G1WA 1GG9A 2W6CX 4LHWA 3QE2A 5FH9A 1X33A 1N8SA 4J0JA 2VT2A 3NTOA 2G1KA 3KFXA 4I01A 1UBSB 5FFFA 1WA5A 4U6QA 3CUSA 3QE4A 1VBC3 1JTVA 2ZWIA 1L7BA 1IUPA 4QRHA 4ASUD 1BCRB 2DQKA 4LUCA 2UUAB 2FUG6 4J49A 2WC1A 2NO9A 2ARAA 2A2ZA 1Y4AE 4N47A 2PLAA 1ZBE1 3CG4A 4UC0A 2PUDA 4LO7A 1AR71 3VTFA 1RZUA 2BMWA 3UG6A 2GC0A 1UR5A 1YAJA 4NG5A 5BNOA 3ESAA 2DF7A 3GEHA 2J3IA 4JI4B 5C6CA 1W1UA 4RTRA 2X0KA 3AM3A 4QYIB 4JAVC 2PM8A 1XSEA 3FVTA 2PXAA 4L3WA 2J48A 1HH4A 1ZH6A 4EARA 4TSFA 3VJRA 1FP6A 1YUBA 1L7DA 3UAOA 3A22A 1H93A 4UKDA 4EMUA 1KVQA 2JBAB 3KQWA 4CG0A 4QUBA 2VCBA 1V3UA 2YCBA 2FN3A 3IB6A 3ROMA 3TXXA 4B09A 1SOMA 2V6BA 3DPUA 4AGRA 2BMEA 4OATA 5IF3A 3U17A 2EVWX 2LKDA 2HJIA 3RRZA 3UMSA 3BRWA 2CE7A 3DOFA 1BEV3 5A7GA 1L5FA 2Y2UA 4M9SA 1I7DA 4EMSA 3H9GA 1W85A 2P2NA 4Z1VA 4DW8A 2PTGA 1ODJA 3FHOA 1XEXB 5EPEA 3WLQA 3ANTA 2V3WA 3D0RA 3A9UA 3GJ5A 1OFIA 2B1QA 1FCJA 4OQQA 2Q1MA 2Q3JA 4K6OA 2W0SA 3G17A 2BGPA 1B76A 5CNMA 2W37A 4NPAA 2P5SA 4N9QA 2AUTA 4PBTA 2RHOA 3NM4A 2MNGA 2JJ2D 5FXXA 3CNOA 1NW4A 3A4MA 1XNQB 1A9RA 5I9LA 1NUAA 1L4YA 5FULA 3VVMA 3MQFA 1Y5NA 2VNAA 2XODA 2UXCB 1U5IA 2NMNA 3PCRB 3STXA 5FZLA 4U8GA 1K9SA 3MT7A 4A8JB 1F0YA 4M9XA 3P9NA 1UOOA 1OVGA 4MW2A 2F43B 3LWCA 1DEXA 2BE9A 3HYTA 2Y99A 4IMIB 3OEBA 4RL7A 3EVEA 5CT9A 4C76A 4R3WA 4PYNA 1OFNA 1WCV1 3A3NA 1EFUA 3UC5A 3ONEA 3ELWA 1N6HA 5E6RB 4UARA 3R6TA 1O4TA 2FFHA 1BC5A 3W3AH 2QL5A 2FGJA 5JNUA 1SUAA 3EZGA 1AKVA 2DQYA 2I78A 1R6BX 2EL7A 3QXGA 4JXZA 1UJNA 1YNOA 1Y5LA 5GPBA 3WA7A 1PR2A 5KOHA 2RHJA 4CLHA 4Q4Y1 5JROA 2QX7A 4PNZA 3AMNA 1LBTA 3TD2A 2EXXA 2I45A 1XTKA 4G89A 4RE6A 2R9VA 2WU0A 1RPJA 2PKXA 2AI3A 1JZSA 3TSOA 2CXRA 4DA0A 2DSTA 3VD3A 1Y6FA 3C6XA 5DT2A 1WDWB 5DNAA 4BYYA 3OUHA 1A4XA 5FNZA 3AP2A 5FI1B 1Z0HA 2FZ2A 5BQFA 3GUUA 4GI7A 1B1AA 5A62A 3OPYA 3B00A 3L9XA 1KZ6A 2COKA 4Q9NA 2C5GA 3ESCA 3FHTA 1IBRA 3L7IA 3P4XA 1IPHA 1VIMA 2PT9A 4BXFA 4FD2A 3KZ4C 4U8HA 1HLCA 2R062 1TM7E 3C8ZA 2BW0A 1BS9A 4I4IA 5EVJA 4H7DA 4XUQA 2TMKA 4WRRA 4TX1A 4BDVB 1BVYF 1LSOA 3EXFB 1WMAA 1Q3EA 2EFYA 4Y6OA 5AVOA 1OAOC 4QRDA 5CX4A 3ZDCA 5FY8A 5FYQA 1L1RA 3UGQA 3OWOA 1TVEA 1K3FA 1WPRA 3RGBA 4QGLA 1PDVA 2IXLA 4JHTA 3RWBA 3G23A 3DF9A 2AA3A 3C7AA 4IHKA 2RMKA 2PEZA 2WF7A 5ED0A 1APBA 4N5HX 2I80A 1PK7A 4YJ2A 3HGMA 5KNBH 2ZT6A 5IAJA 2AK3A 1EAH2 2ZRIA 1ZNQO 4V03A 1QQ7A 3TEXA 2GARA 3T9CA 1K6XA 3DPIA 3I2HA 1EFRA 3IILA 2I3AA 4JQSA 4XJWA 1V8OA 3CW9A 4PO9A 1TT5A 2EG5A 5FLHA 4RM3A 3T5MA 4PTZA 3HE3A 2GESA 3TDNA 1V2GA 3I0NA 2OPKA 3EB9A 3OT1B 1MX1A 3QPCA 1XYGA 3SZGA 3DZGA 2XV1A 4R0VA 3U7RA 3UATA 5IUQA 3NGLA 4ZHQF 2C4TA 4N5LA 4KFCA 3T08A 3U7EB 5F2KA 3L3BA 1F7VA 2W90A 4TTTS 5IN4A 2OCBA 1XZIA 1T9GS 2FSHA 3K3PA 1RFGE 3VZLA 5AKLA 5K2OA 2ZGOA 3M2MA 4CKZA 4F46A 3L05A 4LKDA 2NO6A 1NJ2A 3IE0A 5FOSA 4EGQA 2KLBA 5CCDA 3ROZA 3R7AA 1GQOA 3W8DA 4XF4A 2D6NA 4DILA 1Z63A 2JDYA 5TXGA 1STMA 5JMPA 5JVVA 1FLDA 3RG0A 1GICA 1U7UA 4XETA 4GAZA 4KMMA 3E2PA 1EDDA 3TTSA 4N5MA 4FPEA 3USES 2GR9A 3DXYA 1Q7RA 3F3SA 5E7MA 4TQ9A 1QWOA 1KS4A 3TMAA 4D8YA 4DV6B 4BQ4A 4JQCA 2P9TA 1E89A 3JYLA 1Q50A 2PZEA 1I1QB 5CIQA 4YAGA 2PWYA 4MVTA 2D6FA 4P3PA 3ONDA 5CGQB 3ZFGB 1T6GC 1CDEA 2LCQA 1T2DA 1KQNA 2J5RA 1AR91 3GNTA 5B57C 4P3KA 4N03A 2MR6A 4LGCA 2ZYAA 3H5NA 1KIMA 4H4CA 2JE8A 5I8PA 2Y71A 4ZVNA 4TN7A 1YUNA 4M9RA 2F3PA 4JU9A 2WSIA 4BLQA 1IN5A 2VJMB 3OFSA 3L82B 2DUNA 4CG2A 3VVCA 2PBRA 1GKYA 4Z82A 2YHJA 1RI3A 4NIMA 4JELA 1WBFA 3L40A 1LEMA 1NHGA 2X76A 3ZNQA 5ICSA 3SYNA 3R74A 4C4TA 3KKKA 5FR1A 1YVEI 3RIEA 4S0ZA 3WRYA 1UQRA 3H75A 4KQ1A 1K45A 4X97A 5CA0B 4QGHA 1OY1A 4CDUC 1QRAA 3PXBA 4EB0A 2JNWA 1XDGA 5KWEA 1N5KA 4PI0A 1XLVA 3JYOA 1ZCAA 3ZSMA 5AHWA 2W4IA 2YOGA 4BLSA 1D2MA 1M1NA 2LWIA 3EGEA 3B70A 4JASB 4QDOA 1XN4A 4PTYA 2OXTA 4IQ4A 1I30A 5JTTA 3AEZA 3OO0A 1L6IA 1X2BA 2PRIA 1U4NA 3K9QO 2XUGA 2IXEA 1U2QA 2V9ZA 4RXMA 3ND5A 4LITA 4BK4A 4ZQFA 3HJCA 1D2NA 3JBG3 4EHNA 2B99A 2WJYA 5FPKA 1U3CA 1PR5A 5IYZB 2BMVA 1F2VA 5JR2A 1SXJB 1GGHA 3O3NB 1R16A 4EELA 3OOXA 5E9JA 2GYUA 1ZINA 4NENA 1P31A 5FQOA 4NLLA 1CAXA 3JQAB 2VCMA 2XOKD 2NQ8A 4L27A 4O2BA 5ALZA 1NLSA 3FTDA 2IU4A 1VL8A 1DKOA 2QRNA 1DADA 1N3LA 3F98A 3QHAA 1WKVA 3SQWA 5CVJA 3AHCA 3OGRA 3UJCA 2I3DA 4H17A 1C41A 5FZAA 1G18A 1LQTA 4BZ4A 3WHUA 2Z8ZA 4BUZA 1RUJ1 1HB2A 3UQYS 4ZZ2A 2BQPA 3LX4A 3D43A 4C4AA 3QQPA 5KTKA 1QIGA 3D8UA 3P9YA 3VHXB 4BO5A 3TQHA 4MAFA 1XC7A 4M1YA 4GZ3A 4J8PA 2PA7A 1PR3A 4MB2A 1TYDE 1P8AA 2ORYA 3IB3A 1QG0A 3HM2A 3A1NA 4DLXA 1F1BA 4E4HA 1EVZA 3A7EA 4BKPA 3TNDA 2C77A 1D1SA 1P5JA 3RIMA 4UEKA 5I0SA 5CFCA 1FUIA 3BZWA 5DM1A 4F4HA 3EA0A 4HMPA 4KL8S 3C3DA 3ZN6A 5B2GB 2JFXA 1RINA 3OX4A 1GPYA 4K9RA 4C01A 5C31A 1NAIA 4Q3DA 2G9GA 1XU7A 2JLVA 1KQFA 2HX1A 3M82A 5CYYA 3N8IA 3O8DA 2ZR9A 1CY8A 2VZLA 1FU8A 4GPIB 1N2CB 2YXNA 2PK3A 3N53A 4QQRA 2FEXA 2KX7A 3RIHA 3C8HA 1KVUA 3T6KA 1X7YB 4HYQA 2Q7DA 5EQJB 4B79A 3BERA 1RM0A 5B1YA 4QQFA 4XDGA 1V6KA 1X8LA 5EKUA 3G9ZA 4ZYZA 3ZTTA 1W6PA 3FPBA 3U4HA 1Y33E 1O9GA 2XVZA 2Z2ZA 5DMXA 3KPWA 4Q0MA 4LORA 4XE9A 3RTEA 5EA2A 1F2NA 4MVJF 4YT8A 2R87A 4I9NA 2O8BB 1M6NA 3E23A 1NE2A 3ZFEB 4PIVA 2RS12 1XMXA 2OCGA 3NH6A 3T3YA 3I59A 4FIDA 1XZKA 2WJAA 1RWXA 3GEPA 3NP9A 5ANQA 1T1GA 1EYZA 4OBBA 5L6LB 3ZXFA 3PU8A 4GJYA 4RHV1 2VHYA 3JQ8B 3R9WA 1S4MA 4FOPA 1THMA 4TV9F 2JAUA 3F6RA 3DMPA 4FTSA 3A6EA 2A6ZA 1NTOA 3HB1A 2X13A 5SICE 4ZVKA 2W52A 1E98A 5FQNA 4D4KA 4M7RA 3ZHYA 3KWMA 2EBUA 4MS1B 1HT2E 2FDCA 1M9NA 4GICA 3J8F3 1OVPA 5G4KA 2W0MA 3R40A 3O21A 2G6BA 2YTZA 1WCXA 4MR8A 5CPBA 3CVOA 3NC4A 2A0YA 1T8WA 4JDMA 2K7ZA 3FZEA 3DFKA 2BZDA 5JHHB 4E33A 4LXIA 4LZWA 5SZKB 1H3NA 2O3UA 3HC7A 1OQDA 1T8UA 4BJHB 1JTEA 4PNHA 3CJIC 4KE6A 2X6QA 4XABA 3WQQA 1VBD1 3AUUA 5HIAA 1FFXA 2TS1A 4UPVA 4Q7LA 5DBOA 5AM3A 1X70A 4LHLA 2CLHB 3DC7A 2GO7A 2YXLA 5LIPA 3AKPA 1YKSA 2OCLA 4NMXB 2PS3A 5CB4B 3MW8A 5BPFA 1N78A 4L8LA 5FV4A 1LAJA 4XURA 3U13A 2W95A 4NK4A 3MGCA 2ATXA 1M2FA 3MEQA 2B8MA 2QZ2A 4D9MA 1G5IA 1PEDA 3I34X 2BZSA 2REQB 3A1UA 1BFKA 2FK8A 1RXYA 4ZEWA 2KMLA 2VQ0A 2JPDA 1XTUA 5ENDA 3TFQA 3O2SB 2UXBB 2C0QA 3AXSA 5F1PA 2ZAIA 4GOLD 4UPEA 3IIMA 3LL4A 3V6LA 2BJWA 5FPHA 2FG7C 3GDHA 3LTNC 4YYZA 3FF1A 2NZWA 2GA8A 4QT0A 5B7PA 5KI6A 5KYUB 1MAAA 3I6ZA 2AACA 5GZ3A 4K1XA 1K5DA 2QQNA 3LKVA 2OHFA 1B6TA 4TYNA 1CXZA 1XWWA 1EZ4A 2GZ2A 5AVPA 5BT8A 3KYCB 3H9BA 4FPFA 3PNOA 3HFRA 2PUVA 5KTSA 4IDEA 3K6JA 4GOMD 1GRNA 4DQUA 3QQ5A 4L57A 2FI1A 3HXMA 1DCFA 2FZ1A 1NMSA 2IV3A 2GASA 1LJUA 3ZPXA 2BAGA 4M1SA 4FYWA 3N9QA 2VGDA 2EHJA 2ZJ7A 3NIWA 1RRGA 1RCTE 2VZSA 1E1CA 1X7YA 1RMU1 5A1JA 3M3EA 1EPZA 3CKYA 1BQEA 3ZYRA 4AEDB 1QJ4A 2Y92A 4CMIB 2PFKA 2PLNA 3N87A 1VPWA 4CUKA 3DMFA 2NSJA 1WXWA 3MJFA 4M1ZA 1P2GA 3V1NA 2EIXA 1G5PA 1LOCA 2OCDA 4CDWC 4MYUA 2DFDA 1KKLA 3KHTA 1SFRA 1USUA 1ZG3A 4CQMB 2EW8A 4YP6A 4JJEA 3AX4A 1IZ9A 1AS0A 5FF9A 5E6RA 4C4OA 2J7PA 4MV7A 5JS7A 4AP9A 2VT3A 4HDCA 1LHOA 2WG2A 3W2FA 2EICA 4YPJA 2GN8A 2PQ2A 3RVKA 1H9WA 2F67A 1VMKA 4OAOA 1EA7A 1GADO 4MKRA 5CFMA 3VYUB 1H5NA 1LC3A 1M66A 2WLQA 4S2HA 5JXJA 1NBME 2RS31 5FYTA 1XU9A 4DR2B 1UK9A 5LOVB 4EUEA 5AYVA 2QY9A 1S7CA 1NXD1 4LYHA 2OXIA 4FSDA 4KW7A 5C37A 5BN4B 2H2HA 1OVSA 3CNNA 3STUA 1JWLA 3IBTA 4RU1A 3ADBA 3C8MA 3L8YA 1L0BA 2QW8A 1EFCA 1NCRC 4CU7A 1POV1 1ULEA 2GJ8A 2ZRFA 3VSCA 2BWCA 1Y3TA 4TSVA 5F5QA 5IDXA 3I9OA 3MMPA 3QLUC 4RLQA 2HWWA 1J8FA 1L7VC 5CXXA 4C4PA 3DEJA 1MAVA 4EB6A 2J32A 4LXLA 1UPIA 1E1NA 3TNYA 1UT6A 5CKMA 4F91B 4CV0A 5HXVA 4NICA 3VR5D 4C7VA 2IPXA 6REQB 2W2LD 2HBYA 4UUPA 1DHRA 1QWRA 4NNJA 2E4AA 3GMTA 3DL7A 3R0JA 2KB0A 5A2GA 4DNPA 2GLUA 1JILA 2YZKA 1Z34A 1U8EA 2GFHA 4LGYA 3TZBA 3U4CA 2HRCA 3LVQE 1YNSA 2P3YA 3LA7A 7MHTA 2QUAA 5EJFA 4BTEA 1TZMA 1DCSA 4PXAA 4MW0A 3QW2A 5B64A 4YVSC 1DDGA 1VB5A 5JAIA 4EGAA 1CUJA 2RJ2A 3V55A 3FDZA 2PRYA 5COQA 1H6BA 4AW9A 4Y2SA 4NVPA 4D6SA 2OZ6A 1FUUA 3W06A 3MOSA 4JTNA 3AR8A 5HILA 2DU8A 4M7OA 2R7KA 1QPGA 3D6JA 3MJDA 1EUDB 1GWKA 2R8YA 1MP0A 1QZTA 1Z7BA 3FA2A 2CTVA 1LHUA 4LNVA 1L8LA 4RQPA 1JTFA 2D2FA 1NNSA 4QHSA 4PC2A 3ENKA 1H1AA 4JA2A 4IOKA 5C4WC 5B3KA 1G8FA 3MCVA 2WVHA 3H19A 1I3KA 4FGWA 3ZN6B 3HYLA 2FOXA 3AXDA 4JOQA 1DOHA 1NU6A 4WADA 1P2DA 2VK4A 3RS6A 2V5YA 1ZM1A 3WKDA 1TVCA 4XR9A 3WTCA 1OHHA 2AI2A 1JR3D 5LW9A 1XMOB 1RKXA 1W52X 4C07A 1GQYA 3L0ZA 4A2CA 4UM7A 5DHUA 1RI4A 1KH1A 1ZOSA 3HPQA 4FDMA 1RXVA 1U1CA 3IOYA 3C5HA 2X8BA 3QH7A 1GWLA 1ZRRA 4B6EA 3NCHA 1TOAA 4Y6LA 1P8JA 4AC9A 5EWMA 1EP1B 3M6VA 4O08A 4CDXB 5HKBA 3TX6A 1MQTA 2P2YA 4LV8B 4Z4EA 5FMBA 2J1UA 4MUHA 1M6EX 4QTXA 1HZZA 4YZ3A 1YZFA 4AG5A 1RJDA 1C30A 4N40A 1E2PA 4LYGA 1CUWA 2F55A 1GRCA 2DPXA 3OQIB 2ZABA 4KWUA 5LYJF 1REFA 4QARA 1PWXA 4MPPA 3WIDA 3RVLA 3PUVA 1AMNA 3QBVA 4RESA 3ZY3A 3AB8A 3BF7A 5BUVA 3AERB 4FAGA 1Z2AA 3OG9A 3UJQA 3UO8B 2BDRA 2Y2VA 1GSHA 2LVBA 2XDYA 2QENA 2IW1A 2J5XA 4WI1A 2QLMA 1RTVA 3SLKA 2GSWA 1NGSA 3RLFA 5E0KB 2G5CA 5DN2A 1BHJA 2X5IB 3HQRA 3ESDA 3C7TA 1F6BA 4LPKA 5CVDA 1H4SA 3A58B 4LEJA 3PNVA 4A41A 4AJNA 3CWCA 1P1KA 1DI0A 2BTQA 4LY9A 1PIV3 1SBNE 5BN4A 3ZDQA 4RUKA 3T9BA 3LKDA 4B1MA 3WNOA 3H5VA 5B4TA 1E58A 4CDNA 3OX2A 1JYIA 5E89A 3EDRA 1Q6ZA 1HSZA 2MDTA 4O2AB 2K7FA 5ALHA 4BZWA 2J30A 3RYHA 4A8JC 4XTCS 2G40A 3MAGA 4AROA 4C0KA 3P27A 5L7TA 4RF2A 1V1RB 2AR7A 4HRAA 3P2EA 1R9NA 2DECA 2VK8A 2PX4A 5DOZA 3PDIB 5U4QA 2R68A 1XFDA 2PJDA 3SC2B 3WLOA 4FCVA 4ARBA 1JPUA 3W5VA 3X2FA 5KIAA 1DV2A 3DLPX 1XLWA 4WINA 2HA0A 3UMRA 5A3UA 1CRQA 4Q1PA 4CMGA 4ISCA 5IYZF 2RHPA 3WGKA 2FSFA 4YVWB 1T1EA 3FZ3A 4EMTA 4FGUA 4KDEA 4C91A 3VZBA 4Y5SA 3ABQB 4LO8A 2HREA 2CLKB 1LU9A 4Q9KA 2ESRA 1E7SA 5JC8A 2VK1A 1IE3A 1XQ1A 5DASA 3T7SA 4DA9A 2PZFA 1L7OA 1T24A 1W8FA 3PXXA 3IQIX 2C00A 3HU5A 3BN3A 4PIMA 1G2OA 2XUJA 2B37A 3I23A 1HYQA 4DCUA 4BUCA 3JALA 2FMIA 3QVJA 1Y9AA 3ND6A 4XI9A 4F4CA 3CZUA 2P4HX 1ZUNB 3NAGA 3MUY1 5JSYA 1S0UA 1OXVA 2ZITA 5EJ1B 5GKAC 2H1RA 2NUTB 4NMMA 1RUJ3 2XTZA 4FFBA 2B4TO 2UVDA 4RIGA 5K0ZA 4JEUA 4YALA 4G5XA 5F32A 1NQOA 1NKSA 2F1HA 1NQXA 5CEEA 1VL5A 4RQPC 4Q93A 1FX0B 2VCYA 3AW9A 2ZREA 3MELA 1Y4ZA 4QPIB 3TCKA 3LGXA 4CCWA 1UNBA 1E3LA 4FPXA 2HBQA 5BQOA 1VAKA 4RZUA 2X0FA 1Q1QA 1R5BA 3N75A 4EFKA 2UXDB 4DXSA 1U3DA 3UJ6A 4JODA 4QULA 1QXSA 2VDJA 3DQZA 1ZNWA 4DUGD 3YASA 1L4BA 2ERCA 1D2SA 5A04A 3TFOA 1IMOA 3A4UA 1X1TA 4JJKA 3NTVA 3TQOA 4QDJA 4G5OA 1SCJA 3N2ZB 4WDRA 2O8FA 4KQEA 1OJ7A 5KYWB 3IP9A 2W2LA 3ZKWA 3JB4C 3BMCB 2ZXQA 3MTJA 3QU2A 5KXBA 2CJXA 4B3DA 4ND8B 4KWIA 1FLAA 5REQB 3LUAA 1GPKA 5H68A 1ILWA 3NBZC 5CFDC 3VTZA 3SFTA 5HJ7A 3D5OA 2PD3A 3FTNA 1UWWA 4XE5A 4RAQA 1FPMA 5KHOC 4EWEA 2YASA 1VB3A 2O3QA 5AIBA 2I2BA 2Q6KA 1BXZA 4MEJA 3CVVA 4I4LA 5K6TA 4UNIA 4S35A 4AZ3A 3OZSA 5IS2A 2I07B 2F9MA 1H4TA 2XBMA 4N9HA 5J2UB 4RVSA 5C32A 4CU6A 1HZZC 2Z56A 1TYAE 2WL1A 3NYQA 1X82A 4M4SA 2UURA 1SU7A 2IYWA 1TGVA 5CP8A 5FL3A 2GKOA 2EZ4A 4QOEA 3U81A 4FGJA 4OQNA 2ZJOA 1DZRA 1KJ8A 2CJWB 2X15A 1E2FA 4X3PA 3UOWA 3I59B 3I72A 4R2KA 3TYXA 2A73B 3EVDA 1W87A 1BJKA 2R6HA 1LVHA 3AUYA 1R4ZA 3GUHA 1KJQA 3FXAA 3UKJA 2WZBA 2VMIA 3VKMA 2V4ZA 3D0QA 3JXEA 3VKNA 5EFOA 1X92A 1X3SA 2IF0A 4FJ0A 4Z7QB 2JLUA 2JECA 3AJ9A 4GP7A 1L1QA 4XCBA 2H92A 5BW4A 2K0GA 1UMKA 2NSHA 5CCBA 4AP5A 3TQTA 4HFJA 3AYDA 1DQYA 1JPJA 1JR3A 2QQ5A 3U7QA 1QHFA 1HFWA 1YI7A 1SIWA 2AFHE 3DV0B 4W99A 4CV3A 1EFKA 2PVPA 5C1OA 3FMFA 1WKBA 3I6MA 4BKOA 2JAXA 2H00A 3O95A 3SDBA 2WZR2 4FYYA 1TVKA 2EIHA 2G71A 3NIGB 2QGZA 4CIYA 1ATIA 4I30A 2AGSA 4LA3A 1GAXA 1EV12 2QT0A 2ZX4A 2WKWA 3NWOA 4PPFA 4LR4A 2HBZA 3IQEA 1Z8HA 4BC0A 4R9CA 1GAJA 4BB6A 5GV7A 1MXFA 1A9QA 2QORA 2W70A 3UWOA 2UYHA 2OT3B 1NBEA 4WNIA 1W581 1NTRA 2AFRA 3VC1A 5AJTA 2V8BA 5G0SA 4HONA 4RFSA 4MUNA 1KAGA 1PFUA 2WAMA 1J0EA 4KI7A 4EI7A 2C9YA 1QIQA 4Q7JB 3W5AA 1AN9A 2LROA 2EGHA 1VZ3A 2GD6A 2WKPA 4XDZA 1FDTA 5DH9A 4EVRA 4I2VA 2FFBA 4P9NA 3EXHA 4LE2A 4LKRA 2Y1XA 4G81A 2RE9A 3IYLW 1JFTA 3O8OA 2GN4A 4X00A 4D45A 2GS9A 1QHSA 9LDBA 5DLEA 3AR6A 2PV7A 4MMXB 2PLV1 4M1EA 1NYQA 1WZ2A 2ADEA 3JASB 4X1IA 2RG4A 5JZGC 3THXB 2JI6A 3ONNA 1XKLA 2A71A 1ULCA 4DZGA 1ULTA 2PSFA 3FZGA 3GLFA 2WJHA 1A9PA 1YJ5A 2JCXA 3CU5A 3PJRA 2VJAA 4N5DA 4DRXB 3LCPA 1TO6A 3DL4A 3CN9A 1YZQA 3RU7A 4YM1A 2TBVA 1ZICA 4RTNA 3Q6IA 1H2WA 1LGYA 5IFPA 1JKJB 1OUXA 4FAHA 1UMBB 3C3EA 4HH1A 1ZHOA 2GM4A 5EZYB 2FA9A 4YLGA 1SCIA 4UOJA 3IALA 4JFRA 1EPWA 2VZRA 2FMYA 4QEDA 3S3TA 1M1YE 4AVSA 5HI0A 2P91A 3O2QB 1ZXXA 2ID4A 1DF0A 1K68A 4GBED 1YQGA 2PBLA 3GAZA 1WOYA 4TUYA 4ARZA 3RUDA 3ZN5A 1XU2A 1J9GA 5E6UB 2K2SA 5KWSA 2BPOA 4MVWA 3OUIA 2ZACA 5I6DA 1RWKA 1ZC3A 2LUOA 1NIPA 4R8RA 5BVHB 4DXAA 4OEHA 4DWJA 3GXBA 1RDFA 4KJXA 5FUNA 5EJGA 2ZAOA 4GH4C 1K3IA 2ARCA 4CIVA 4HXCA 3FNHA 1EBUA 3NHJA 5B2EA 4L3OA 4JBNA 1L5QA 2WYIA 4CCNA 2VDUE 2HEVF 1RHMA 3UCXA 4CUGA 1I9CA 4DXDA 3WMFA 5GZ1A 2C7VA 5B12A 5HCNA 1YO8A 1SCQA 5TLSA 3AVPA 3QENA 2XYPA 3BRQA 3IERA 4A3SA 3SJAA 4B4PA 4MH0R 4WUVA 4RA0A 4IILA 1U9JA 2VNHA 5EWJB 4ZT3A 2I76A 2YQ4A 2FB9A 3E5NA 2R86A 2VPXA 3WB1A 4HX5A 3C0KA 2VZ3A 1XD8A 1ACLA 2F3UA 3K94A 3WLEA 2G1MA 2CHFA 5BN3A 3OPYB 2NAFA 1RI2A 2IHNA 5H9PA 1QSGA 1KI6B 2PKQO 4E9KA 1Z35A 3Q1KA 2F3TA 4LN1A 1HE2A 5KEIA 4FEGA 4FBMA 1MF7A 2Q3FA 4LGVA 1PJZA 2NT3A 4GEGA 3DBOB 5CMLA 3SOZA 3V8NA 1V3TA 4HN9A 4WPGA 4BLJA 3T3MB 2H4XA 5KC8A 3UJOA 4C3UA 2Q6LA 5EXSA 5CFPA 1XEWX 2D06A 1EGQA 5FQ0B 4MHOA 4JYAB 3AJEA 5CG9A 3VHLB 3VZOA 4YW1A 1JHQA 5AM2A 5GP1A 2PMWB 2QCSB 4KXWA 3DLIA 2XQVA 4FZJA 1NW8A 1DWQA 1E20A 3QX3A 1I1NA 3G5TA 4TWJA 4AF7A 1MGOA 1OMOA 3NAPA 1R27A 2FUNB 1P6QA 1E6KA 3KEGA 3LEIA 5JS6A 3E05A 1R6TA 4IIJA 3IJ5A 4H1UA 2R1ZA 1S0JA 4PS0A 2IHBA 5JLVA 5AJVB 5EMKA 4Q3EA 3THXA 1QNLA 1E9DA 2DC1A 5K9ZA 4PO3X 3ZR6A 4V39A 1UIRA 5FJJA 2H4FA 5EWLB 1NF9A 1YL7A 5IMBA 4GFDA 3OSUA 1FYXA 2QM0A 5M34A 5SV8A 3C5VA 3ZXLA 4E5MA 1WLTA 3ELYA 3IBGA 4Z9FA 4M3CF 3KXDA 2XSZA 2QE3A 1TNFA 5CEHA 1WU7A 5LB2A 5CA6A 1ZZGA 4YQFA 2QQGA 1Q12A 4LI0A 4EYKA 2NV6A 4IICA 1P9RA 4AO8A 1ONOA 3R3WA 1CB7A 3ABSB 1N75A 1OBHA 3AL2A 2PFSA 5IEJA 5BSMA 2PHXA 4AJPA 2YJ4A 4QBFA 4CLRA 3OF1A 4FMCB 4FMDF 4RELA 4QD3A 4NPMA 4RD3A 1U1IA 4TWRA 1OIVA 1N1EA 2XX3A 3GHHA 1B73A 2VJQA 3O1VA 1JQAA 2NUPA 3RVBA 3TW6A 4JGIA 1U80A 3E5MA 1LTKA 2X7JA 5SZHB 2ZTLA 3P4YA 1E9FA 2WKSA 4CGZA 2BIFA 4FYIA 5BVHA 4YLZA 4FNGA 2BM8A 1T43A 4IDNA 1ZX5A 3NV2A 2D4AA 3N86A 3M6WA 1OYOA 4KITB 3WGQA 4RW0A 4BZPA 4KZKA 1RU3A 1X6VA 4CUAA 2ZVPX 3MT0A 5IHXA 2CK3A 1W4RA 2KBEA 3CXUA 1TO1E 2BP6A 1V7CA 3NEJA 3FFTA 4ICIA 2ID9A 4ZXKA 5FWXB 3RARA 3MTDA 1XBTA 3PHCA 3LPLA 3S5AA 4IUYA 1Z38A 3EXG2 1NXSA 4HEHA 3V8PA 4JLDA 4KCGA 3AG6A 3HXOA 3BJZA 4FYVA 5K8CA 2P6CA 5FPBA 2XHEA 4DC9A 1FTWA 3I52A 3T94A 5DWVA 3CJTA 4Z8BA 1DINA 3NETA 4YCBA 4M1QA 1V6AA 2K2WA 3BF8A 4GWLA 2DWQA 3QVGA 3PVBB 2J3LA 4ILEA 4JL8A 5TPWA 4YP0A 1Q57A 1MQ9A 3LNCA 4ND5A 4Z4CA 4I5DA 3PPYA 1Z2OX 1SKAA 3FC0A 3JATB 2C84A 4Y2TA 4DA8A 1P4RA 1R0CA 3VR6A 4N0MA 1MC8A 3RYCB 3ZPYA 1M2KA 3AKCA 4MGYE 4MHTA 3E6BA 4N41A 3SIWA 1NG0A 1UPBA 4JCCA 4KNVA 2Y1FA 1W1WA 3P0EA 4MRMA 1Z6PA 3TBKA 4RA9B 4GMDA 4IJUA 1RLMA 2LTAA 1KEUA 1Q92A 3RYHB 3ZW7A 1FX5A 2FUKA 2WNUA 3TTYA 1N3PA 1TM5E 1OPXA 4Y2XA 1C7JA 1E3DA 1RWBA 2FEOA 2OM6A 3BD6A 1OFGA 3DN7A 3DBRB 1ZGBA 3P3PA 1KAHA 3KYIB 3HGTA 4P5PA 1LJLA 3K16A 4NE7A 3NHKA 3DDWA 2R5WA 3IKVA 2Q30A 3ER8A 2BZ0A 2XMGA 5L53A 4Z99A 3ZI0A 3HVUA 1V6OA 3IOBA 5IK2A 1P1HA 4YXWD 1NLFA 1H9PA 4QXRA 1CYEA 1YXWA 4BECA 1JL3A 3ROXA 4R01A 1P73A 2ZXFA 5AC91 4XJUA 3II6X 3NATA 1T5SA 3HO6A 4KMQA 2X0DA 1GZUA 2FX3A 3GA0A 3NDPA 1O97D 2UZAA 3SR0A 5KSZA 1N33B 2CSGA 4YVSA 1UZWA 3AHDA 5SV2A 2QE6A 3AP6A 1SD5A 2JVJA 3OGJA 3ACBA 2PKRA 2BFDA 4EY5A 1YDMA 1U1DA 2PHFA 3RYRA 4YDQA 4UD6A 1V5GA 2GD0A 3BE8A 3QXXA 3MWJA 2GRJA 4JQOA 1WXIA 3NRJA 2QOEA 1Z4OA 4O1IA 4YXFA 3RSSA 7REQB 1JDVA 5IM4F 3IT0A 5J3UA 3M4XA 5GLZA 1YHYA 1QJX2 3D3JA 1RL3A 1B8PA 5DYWA 2KR2A 5JD4A 1EP0A 3NVKI 5ALTA 3QKSB 4HGQA 4W5TA 4RFVA 2QNRA 4XPZA 3ZU3A 2D3PA 3ZYJB 2P3KA 3DEMA 2Y0DA 3HBMA 1QGED 3HWSA 3PPWA 1Q7GA 4CIDA 3H84A 3UJAA 5D3MB 4CLRB 3AK0A 2CLOB 3WKBA 2Q3LA 3OE1A 1OW3B 1JSZA 3VBFA 4PYMA 4CMAA 1L3IA 1GTMA 3GYBA 1GL7A 2AV6A 5T3NA 4I2OA 1OKKA 2RGRA 2GSDA 2FCVA 3GVHA 2HWD2 1SIUA 1J39A 1ISRA 1K7CA 4AK3A 5A7QA 3F0TA 3O1LA 4MQFB 2LW7A 3AM4A 3WOHA 1K5MA 3AOEC 3PTLA 1OD3A 2QTBA 2IVFA 3R7LA 4ZREA 2H7XA 3WWPA 2M6LA 1UMBA 4CTKA 1Z75A 2G9VA 3JYNA 3HZOA 1PLJA 1JB1A 4W9NC 3P9CA 4S2FA 3KUKA 2X58A 1BDBA 4BO9A 1THTA 4IEFB 1KEWA 3NT2A 4EGFA 2CJFA 4Q8KA 3CINA 1GNHA 4GKXA 1YA4A 4PQ9A 4TUYF 3RJTA 4QPPA 3RRNA 2HBUA 3NBMA 4Z3DA 4D8VA 4UM5A 2WWGA 5FJIA 1TLLA 4P14A 2PWPA 4HFSA 2G76A 4AZ0B 2C83A 1MB9A 2QBYA 4KH0A 4IY1A 2ZPXA 4EHLA 2HXGA 5DDJ1 2R60A 1U7WA 5I8SA 1YVUA 5JS2A 3ST7A 1FDRA 3E9YA 4HDOB 1QYWA 1Q91A 2GBPA 3DEKA 1DUSA 1JG1A 1QGAA 1UKAA 3RRMA 2HLNA 3JD4A 1FUEA 3C7GA 3FX2A 4ALIA 2HZBA 2Q4DA 3TGLA 2A1UB 3GRVA 1T2NA 4A15A 5BXYA 2D5AA 1UBEA 4I55B 4AGVA 3OH8A 5LQJA 1KI6A 2E7QA 4P9GA 5ADUS 3OD1A 1ULPA 1UP6A 4IPTA 4JZYA 2XDAA 1R18A 2O4UX 3ACHA 1LU1A 1MENA 3IIIA 1OGYA 4IF4A 1U3GA 2O48X 4E07A 4ZYVA 3KXKA 1V4VA 1C4XA 1CJPA 1Z22A 3JS5A 3D6AA 3PLRA 4D46A 2NYUA 3KPYA 5K3BA 3AHJA 3H8WA 1P0IA 1IG3A 3DOHA 3VDCA 1A9OA 3A9TA 1RUH2 4JP5A 3THRA 2EERA 4B6FA 1JAZA 1GOTA 1HE1C 4PRZA 3PU3A 1QRRA 3KT0A 3N39C 2WAAA 3V1LA 2ZGSA 4HGRA 1AG9A 4P54A 2YWCA 3JD1A 1DBNA 4H4DA 4G1BA 4YNBA 2ZBFA 2XUEA 4M54A 3GGOA 4MVJI 4J1NA 3RSQA 3A3YA 5FKCA 1CQXA 1QHXA 4MLDA 3IWZA 1UMCB 1ASJ2 2ZZQA 5FZKA 4HDQB 3B7WA 5BNOB 4RHCA 2JIRA 2IZ5A 2PELA 2OORA 1Z0DA 2WJ6A 4X71A 1ZK4A 4V1CA 3AESB 5A33A 4CODB 3IP8A 2ZMLA 2V0NA 3K5PA 2X0JA 1GBGA 4R0NA 1MH1A 1DT5A 2F1RA 1QGUA 3R3YA 3LBHA 4INOA 4JR1A 2W91A 3T0IA 2EFJA 4KE9A 1BCSB 4BNYA 4DYVA 1JQEA 5TARA 4QDXA 1CIWA 2L42A 2GFQA 2H1IA 1SXGA 3P9ZA 5DTQA 3F6BX 5IH3A 1IZ0A 2I34A 4OB8A 3VL9A 4RAOA 4BAGA 4Z3OA 4F1KA 5FUXA 1TPYA 4L5YA 4JGBA 1VMDA 4GR5A 1P18A 3JASA 4R2XA 1PAUA 2YUEA 2GZ1A 2GN9A 3HUTA 1Z0FA 3O1RA 1YAHA 1JJIA 3G88A 3RT1A 1KI2A 2JE9A 1T8TA 1UJ4A 2V7TA 1I0ZA 2XT9A 2BFCB 3EQEA 1HN0A 4FFOA 3V2HA 5H80A 1Z2DA 3K8YA 5K6AA 5KC9A 5EKTA 2AG1A 3DPRA 2RHHA 3UXMA 4JI2B 3VFDA 5IDVA 3E97A 2W08A 1LX7A 2O1QA 1JAHA 4WVWA 4BGEA 1JLLA 3QVLA 3IMFA 1XQYA 2LIVA 2IVIB 4BS9A 1HE4A 3TIVA 4RKYA 2GP5A 5HBGA 2JFFA 1G0OA 1PX0A 3I6QA 3KF3A 1OILA 3LG2A 2JFZA 3I8OA 2WT0A 3TLJA 2FDXA 4M1MA 1YUMA 3R20A 4XXAA 3OA2A 5FMDA 4RK6A 4RJIA 5EMHA 2R8RA 3ND8A 3O0VA 1ZWLA 3OJXA 1L5WA 3A70A 2F1OA 1LPPA 4XF0A 4E13A 5FZIA 5JYDA 1O6ZA 3H1YA 4D98A 3AEXA 4RSUA 1UJ2A 4K9DA 4EO9A 4FX5A 4MGHA 4YAKA 3PUIA 1FXZA 2C4KA 3EY9A 3OEHA 2V7BA 1QFZA 1T2UA 4HZIA 1D2CA 3TLEA 4NS4A 3IDEA 3LDGA 5BWCA 2BGJA 4FNMA 221PA 1JZ4A 2WY2D 4MUMA 1T25A 3ZH2A 2JGDA 2RR12 3QX8A 4RFT0 2YVAA 2IYUA 3QKTA 3T09A 2FRDC 1EK6A 3VH3A 5BNTA 4QBHA 4B83A 4JUIA 4ZO7A 4PG7A 4AL4A 4GZMA 4OVEA 1MFZA 4HGOA 3MJTA 3LQ4A 1FYFA 3V8MA 3WIOA 5DHTA 4HYTA 1COWD 1FA9A 4ZI2A 3EXG1 1JI0A 1IM2A 2I91A 1WUHS 4EB6B 2I6SA 4PX5A 3CB2A 4P0TA 3LQRA 1DX4A 3ZXEA 3EQZA 4ZV9A 1KAQA 3RG2A 1KJJA 1IJEA 3T5CA 4CLXA 2ACVA 4YRZA 4X8LA 3BXHA 2VZUA 2PYDA 3S1AB 2B39A 2G82A 3EN0A 5CB7A 3EZXA 2PMEA 1GZWA 2ZOEB 5FHQA 1GDTA 1C3JA 1NONA 2BLNA 3USUB 3VYSB 5FLYA 4IEZA 2GOYA 3SX4A 1HRDA 4RO0A 1JU4A 1R1A3 3C24A 3LDKA 4YW3A 4R8LA 3B9PA 1TVMA 4PZ9A 1PTJA 3L07A 2O8EB 1ES9A 4O0LA 1QQ5A 4FW9A 5BN5A 3UBTA 1YI0A 5D5HA 3GY0A 1SBEA 2FSUA 4MEBA 3H17A 3W1EA 2WWSA 2I4OA 2CNWD 1C8LA 5HRUA 1JQ5A 2X8KA 1LX6A 3IUSA 4BQ2A 2A5DA 2CNWA 4B6PA 1RQLA 1FDSA 1POXA 1RACA 2Y4NA 3S6JA 2C9BA 2YWJA 2WQ6A 4L8QA 1AKUA 1QJY2 4YGCA 1OXUA 4Z86A 4HMQA 4KSBA 2Y6FA 1G20A 2ZBRA 4UE6A 1E4EA 2JGKA 2F1JA 5EP3A 2RG7A 3OGGA 2X53S 4AZSA 2Q29A 4P02B 4FR0A 4XIGS 3GZAA 5LP6A 2REXB 5EWLA 2ZRHA 4MS4B 4HDKB 1XLTA 1E94E 1X2EA 5DJ5A 2Z5FA 1HW5A 4GH4B 3LGAA 4DR6B 3EEOA 3IXMA 4UULA 1U8TA 3SY8A 4ZVUA 1SUCA 2AMYA 3IURA 1K8RA 3RZJA 1WB4A 1KQPA 3UV7A 3F73A 3LOBA 3QUQA 1A76A 5A7OA 1A3KA 1MC5A 4COWA 1G2IA 3E27A 3ENQA 4JOCA 4TRJA 3F1LA 5CFDA 4YUXA 3RJZA 3FROA 3T34A 5K0UC 4ZCIA 4HB4A 4P7JA 1G19A 1NUUA 2H2AA 3WNLA 1VG1A 2OQ7A 1KY2A 3BE5A 4PC6A 4M01A 4PBOA 2BISA 3QEBZ 2RM21 2Q1SA 5HBAA 4QREA 3IBFA 3TEFA 3V1UA 1JH9A 1YDWA 3ZI7A 3KHSA 1SB9A 4WLUA 5CBPB 3FCCA 1I2ZA 3T99A 3EGOA 3WXPA 2IPMA 4MV5A 4BOWA 1UPUA 1BVUA 2R30A 2B0JA 3CVXA 4E0BA 4ZCSA 4AJJA 5GV8A 3NQHA 4UMVA 2JG9A 3LC7O 4NRMA 5IJ0A 1C4OA 4KIUA 3IUYA 1P17A 3PSHA 2VG9A 5J48A 1P3Y1 1FS6A 4QX0A 3JV7A 1FFHA 4DS0A 3INNA 5LL6P 5JJCA 2RVAA 1SLCA 3VR3D 1SEVA 1P1RA 1Q19A 4HFMA 1A72A 3WTBA 5IJWA 1DAKA 4LRQA 3U4DA 2WWFA 4BLVA 4XUPA 3HO1A 3ZV7A 3ZLUA 4QBKA 2KD7A 2QQOA 3DFFA 3QVWA 1EJBA 4C22A 3UA3A 3WOVA 2Q4RA 1NYLA 1U5AA 1ODNA 3GLHA 5ALVA 3F8TA 1R0KA 4DXHA 3N28A 1YC5A 4L0QA 2HRQA 1E79A 1ZSVA 3ORSA 1WDTA 1Q3TA 3O8NA 4ETMA 1AXGA 4NBUA 2XJRA 3D9QX 5JCOC 4NJEB 3MWEB 2OOSA 5BNZA 5SZJA 3PE3A 5IYYA 1YZYA 3M34A 2E9SA 5FPQA 2NM1A 2GVNA 2FJUA 1T8YA 4N0QA 3TOJA 3T41A 1N3QA 2PJUA 4BQEA 3QBEA 1BEZA 4L28A 1RCUA 2VRWA 4CV1A 1WAMA 1A5ZA 1YI8A 3L6DA 1PD0A 4I1RA 2UUCB 1ZH4A 2A94A 1Z2PX 2ZXUA 5KX5B 2R4UA 1QTIA 2DJ5A 5F5NA 5HOEA 4JT4A 4OXKA 1PKXA 4DUZB 1C1DB 4ARSA 3T7RA 1SC6A 1LNZA 3ZCRA 1Z5WA 1Q43A 4OHMA 5LN1A 4YGYA 1X7WA 3H99A 1N2SA 1WV1A 3SNKA 4TL6A 2Q8OA 4JNCA 3HQ4O 4BGDA 3B8EA 2XT6A 3VYWA 3RZGA 2J3MA 4AMZA 2ZROA 1NBAA 2UKDA 4A9AA 5FUVA 3CZRA 1I32A 3O7MA 3K9LA 1LPAB 2WJ3A 2ZJ8A 4EGCB 1XXHB 2R3SA 1HURA 4ARCA 4ER3A 2WVAA 3H1WA 2R79A 3FNIA 3HCWA 2EGUA 3ESBA 1BMQA 4WKNA 2FQYA 3M4JA 1RM3A 4UAPA 1RUNA 1VL6A 4D6QA 3SHVA 4RK4A 5FL7A 5A3VA 2NXEA 2GPAA 2HJHA 1ESZA 3LUJA 3SCHA 3Q0EA 4PAMA 3UW1A 1KORA 1NLRA 2LIPA 2P3SA 3S5JA 2X5JO 3AXEA 2QUKA 4DV2B 5CPFA 4R9SA 1XALA 1QONA 1N25A 5EE0A 3VISA 3N0TA 3QNWA 1OZFA 1G4AE 4A8TA 1F5SA 1UIJA 2AC4A 2PXJA 3LFHA 2OZVA 5L73A 4PHCA 1DGLA 4O25A 1DDLA 1ZX1A 4P4LA 3ZU4A 2JS7A 3GJ7A 3FI9A 3HHPA 3KVOA 5JNTA 1XZQA 3WSTA 2FOIA 1D09A 2Q0QA 2QUIA 3O94A 2JIZA 3KZOA 1ICEA 3MXTA 1PG2A 4AVVA 3GFSA 4EA9A 4NIIA 3WFIA 5IASA 3GNEA 4MA0A 3KKMA 3PF9A 4H59A 3DGFC 4NECA 3WL4A 3SEZA 2HSWA 1YBVA 5IVJA 3ISVA 2GNOA 2ZEXA 2PPLA 5C7YA 3CRW1 1YFKA 3LPFA 2VYVA 5E7IA 4F3CA 3ITEA 1NI3A 2J3EA 5KAMA 4LY6A 2ID7A 1RXUA 2C6SA 3RV4A 4RM2A 2WHPA 3P9KA 3NAQA 4XDOA 3WAJA 4WCDA 4DNXA 3I9JA 5BNNA 3LC1O 2FMHA 3KETA 2XXZA 3HVIA 1XK7A 3UV6A 3MSXA 3H4IA 3C45A 2R49A 2IZZA 3L49A 1FMD2 5LZ5A 4KI5M 4N01A 3QBTA 1N8KA 3NTUA 3L4SO 4X54A 1WX1A 3ILNA 3BD7A 4FDUA 3HNYM 4C0BA 3KOUA 4Z5XA 5IAKA 4QEZA 2JLZA 2YZGA 5AD1A 1ZD3A 4WASA 1UOFA 1HQCA 5KTYA 4GSKA 3JQ8A 1KNQA 1L4EA 4NBWA 5K8IA 5KQRA 2HWF2 4NRPA 2EXHA 3DR3A 5HF9A 4JN6B 3U7QB 4UTRA 2TUNA 1YNAA 2PUJA 4N65A 4DSUA 1PJRA 5FCCA 5FZOB 3MG9A 3WZ2A 5LSAA 2OY0A 2D6LX 4HOYA 5KYVA 1DIHA 3ZZ1A 4MWDA 2MMCA 2WT2A 4C4YA 3I9FA 1U0RA 1PZMA 4GD4A 1RMU3 4D82A 1XQXA 5CAEA 2NU9B 3ROFA 3EQ9A 2AD5A 4W1SA 3D3NA 2ZEJA 2GWHA 2A0XA 1LXCA 3WB0A 1T6YA 1QIEA 3KKEA 1SFPA 4CMEC 5JPCA 3G5MA 1YCGA 2DX7A 5L7OC 4FDAA 2OQ6A 4M36A 1Y48E 4HLDA 3RUHA 5A7SA 2HMVA 4IV8A 4HWTA 1NW3A 4O2LA 1XNJA 4XGRA 4NCBA 2A4KA 4TPKA 4R5HA 3KS7A 2AZDA 4Y30A 2GNPA 3QOXA 3D2BA 1GZWB 4KWKA 4IEXA 2X1MA 4YP1A 4DM7A 2P78A 1UY2A 1JFVA 1QGZA 1YGYA 2ECKA 2PLV3 3PUJA 5FFMA 2CVFA 1I9RA 2RGEA 2LZ0A 3FCYA 1PGL1 4CF3A 3FLAA 5C46F 3JARA 4P53A 2QTMA 4HKWA 3R77A 4UF0A 1F12A 1E2QA 1HFJA 1KDRA 4M9QA 3U09A 2A3WA 1H2MA 1WLCA 2BGKA 2OFXA 1HKHA 3OYWB 2FBEA 4KL1A 1EHYA 1RWOA 2ZRKA 3KQTA 1V45E 4FUQA 1BKSB 3WG4A 4UHCA 2G9RA 1R74A 3EIXA 2JKVA 5FUYA 3T4PA 4IUDS 5DBEX 5DSTA 2GF9A 2W6ID 3ZHTA 4TN1A 3K0KA 1ZK2A 3G0BA 3GQVA 4I9GA 2JJMA 4BL5A 1XZMA 2G9FA 3THYB 5TSWA 1ODKA 4ES6A 1W48A 2UV8A 2P4EA 2G5GX 3MLEA 4CKYA 2QD1A 2VOVA 4NYJR 2VQAA 2ZS6B 4EZ4A 2X2EA 2E4XA 4IRMA 1FNMA 4KR7A 4XCXA 2A3RA 1E9BA 2BFUS 1Q8SA 1N7GA 2F00A 4ZOQI 5DNWA 1VYUA 3FMVA 3OZXA 1WDLA 1PZGA 5HIKA 5KQMA 2P79A 2P2DA 3G8DA 3OURA 1M2OA 3ZR4B 1N9GA 5B5SA 2VQEB 3KMHA 1NV8A 3GLFE 1NZCA 3CR7A 3S0JA 4ZJPA 4L76A 1W0JA 1REQB 5LBCA 1BYUA 1U98A 1UFKA 1O54A 3IDCB 1ENXA 2XIQA 2UUBB 4IGIA 4RDXA 3OHPA 1JS9A 2EALA 4CG3A 3TMKA 2FSIA 1O3YA 3SN6A 2GMPA 3V46A 5FOJB 3ZE2B 2XA1A 3GRAA 1MB2A 5C9AC 3UXEA 3UKTA 4DDHA 3HNOA 3LZ6A 3P0IA 3WCRA 2V7QD 5KOHB 1JX6A 3UWMA 2A33A 4EW3A 1H4VB 1VR3A 1ACMA 4GS5A 3JRWA 1N34B 2NWQA 3IHKA 1Z29A 3KZCA 4BQIA 1NVVQ 4IJWA 4LWPA 3BIWA 4X7RA 4HFRA 2Q1WA 2DFVA 3H83A 4PZLA 3APBA 3O14A 3QSYA 4MR7B 3UK9A 3PHLA 2RS53 3IT2A 3N7KA 1KMHB 2R4TA 4TKUB 3ZHZA 3PE6A 3KLOA 3V4VB 1A8QA 3NT5A 4TMXA 1PWHA 3AFGA 3I4IA 5IFLA 3IAAA 3D0JA 4ZVPA 3OOSA 2AX4A 1TYZA 3RWOA 2CL0X 3AIKA 5ABJA 3GNSA 3UAWA 3S2EA 3WK5A 3LPAA 1O03A 4BBAA 3NHRA 2BVVA 3T5TA 4JUCA 3MPPG 1XYPA 1GNRA 4KVAA 1YHZA 1NL3A 2XB6A 5SV5A 5CB8A 5EQTA 4OM8A 2V7GA 4JBWA 5KX5A 3ABOB 1WMFA 4CP9B 2YNMD 3IP7A 2R1DA 4MGZE 2DFNA 1DXOA 5C1DA 5A3JA 3ZDYB 2VJKA 1C29B 2G4CA 4MDFA 3AMPA 2QIOA 3PTZA 2BDEA 1RPZA 3F7TA 4GXRA 2RGAA 1JDTA 3JRXA 4MQ4A 5LQKA 1TT5B 2C5SA 3KJXA 4DA7A 4QKNA 1OAAA 4KBZA 4W6XA 1WSAA 2VVDA 1V2HE 2ZGUA 4B7AA 4OYHA 4AYWA 3BCSA 4QDSA 3DOOA 3OQNA 3TFWA 3VBRB 1NW7A 1RUH1 2EFCB 1T5HX 3QLJA 4OH1A 3OQPA 1UX6A 3ACLA 4OGLA 5JALA 5J98B 5K0EA 4LBJA 4PC7A 4NCNA 4WBNA 2F4LA 4YPVA 4RSRA 4H6VA 4TT8A 2DVBA 4MINA 1GNVA 1KAOA 3WQ0A 2XRMA 2VF4X 1UY1A 1JIUA 3W1VA 3FH0A 5FXVA 4OXIA 4HPXB 2EARA 1K2WA 1QGYA 2J41A 4K1LA 2WPNA 3WGTA 1IZ7A 2DPHA 2ZBEA 4LV5B 4LDJA 5D3MA 1YHFA 5G04L 2Q9BA 2CGEA 3WNBA 2CMKA 5LD2C 2GN3A 2OXRA 5J5AA 5JZGB 1DBWA 3KLNA 1FOD3 2O05A 4KUEA 1H2YA 3L7NA 3RUAA 3HNPA 4DMHA 2RJKA 3ZX7A 5K4LA 1UKEA 5HFJA 1ZSYA 2DOKA 1HETA 1GU0A 1LOGA 4OXRA 2I6UA 2E6KA 4IDQA 4Q15A 3JQPA 1AJEA 3OSDA 1YDGA 2BR4A 4HATA 3L84A 1YB6A 4N12A 2H5EA 1T4GA 2HMSA 1EE1A 5ADVA 1QF3A 2OP0A 4NU6A 1QGLA 2ETEA 4J0FA 5IVFA 1JEOA 3KYDA 2EU8A 2IS6A 1D9ZA 4LJHA 3KD3A 5F78A 4EEXA 2XCQA 1K5MC 3AOEA 4X24A 3VHPA 4GOOD 1ZHFA 3A9VA 3ZK9A 4ENQA 2PHTA 4U9UA 2Y0EA 2E85A 1QK3A 4NNOA 1ELOA 4WLFA 2TSYB 2WU4A 3R7WB 4EM6A 1N2HA 1MEJA 4CQMA 1VSVA 4OXXA 2XD4A 1LDGA 1RMU2 2C3MA 1KOJA 5TQ0A 3CEMA 3M1AA 4EY3A 2A5YB 2ZVDA 3LT0A 3AFIA 1HUQA 2XLBA 2GZAA 4PE5B 3HYSA 3FJOA 2BSAA 2IXAA 3F6YA 5JQWA 1IHMA 2PS9A 4MRVA 3FHJA 4YT2A 4Z4FA 1C1FA 2G28A 3M0EA 1SGWA 2AOTA 3PMEA 3W2EA 3SQOA 4KFTA 2XNCA 4FQ7A 3WL7A 1Y5MA 2C9DA 2XE4A 2NU7A 3Q8EA 3ORFA 4CW7A 2C1XA 4AIRA 5LK5A 3DO8A 3K4QA 4TS9A 3GMIA 1BA3A 4B74A 5LCWL 2ADFA 3DGEC 1E6EA 2YMPA 3L46A 5HZMA 2AT1A 3RBXA 3V80A 1QHNA 4JHXA 1JE0A 2HIHA 3NYIA 4JQRA 3QA9A 3OPXA 5JDCC 2OUIA 4YJHB 3T8YA 3DDCA 4ON9A 3RNOA 4M55A 4ETNA 4MTCA 3BG5A 4MV8A 5T5PA 1OBNA 3UAXA 2EWVA 1YJKA 1IYZA 1QCZA 3H16A 4ZVSA 5GAJA 5B36A 3IIKA 3Q9LA 4JR2A 2JIQA 1BHO1 4IGFA 1XTTA 2RGUA 2AZ5A 4JLUA 3COYA 5CDUA 4F5WA 1KYZA 4WXPA 4H1WA