2O14A

X-ray crystal structure of protein yxim_bacsu from bacillus subtilis. northeast structural genomics consortium target sr595
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
354
structure length
354
Chain Sequence
b'KVYQFDFGSGSMEPGYIGVRASDRYDRSKGYGFQTPENMRDVAASGAGVKSDAVEFLAYGTKSNNTFNVDLPNGLYEVKVTLGNTARASVAAEGVFQVINMTGDGAEDTFQIPVTDGQLNLLVTEGKAGTAFTLSALKIKKLSDQPVTNRTIYVGGDSTVCNYYPLNSSKQAGWGQMLPHYIDKHTFQVRNMASGGQIARGFRNDGQLEAILKYIKPGDYFMLQLGINDTNPKHKESEAEFKEVMRDMIRQVKAKGADVILSTPQGRATDFTSEGIHSSVNRWYRASILALAEEEKTYLIDLNVLSSAYFTSIGPERTLGLYMDGDTLHPNRAGADALARLAVQELKRQGIAGF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein yxiM
publication title X-Ray structure of the hypothetical protein YXIM_BACsu from Bacillus subtilis.
rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
total genus 110
structure length 354
sequence length 354
ec nomenclature
pdb deposition date 2006-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13472 Lipase_GDSL_2 GDSL-like Lipase/Acylhydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 2o14A01
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 2o14A02
4DEVA 1HN0A 4A6SA 4K9SA 1WCUA 4LHSA 4YW7A 4LKDA 1ZMBA 1BWPA 5A4AA 3F95A 1YZFA 1K7CA 4BQ5A 2Q1FA 2LROA 4OAPA 4BQ2A 1W90A 1ESCA 4YW6A 5JD3A 2WYFA 4JGGA 1WABA 3ORJA 4XVHA 5BN1A 1WZXA 1GWKA 3DCIA 4HYQA 3ZYHA 3W7VA 1UOJA 4K3UA 4AL9A 1VJGA 1PP4A 1Z8HA 3SKVA 5B5SA 5D21A 4OAOA 4RSHA 4K7JA 1W8TA 4CPBA 1JRLA 1DEOA 4CP9B 3C1UA 4CPBD 3SLRA 4JJ4A 1W8ZA 2APJA 1ES9A 1FXWF 5CD9A 4YWAA 4Q9AA 4LK6A 2C24A 2VPTA 4CP9A 3DC7A 4HF7A 2LRPA 4NRDA 1OH3A 1GWMA 2WABA 1GWLA 4Q7QA 3KVNA 4LJHA 2K46A 1VYHA 3P94A 4RW0A 4S1PA 1L7LA 3MILA 4K40A 2JWPA 5HOEA 3RJTA 2Q0QA 4BQ3A 1FXWA 3DT8A 3U37A 2HSJA 1BWRA 1U8UA 1J00A 2KR2A 1V2GA 1DEXA 3BZWA 2VXJA 3ZYBA 3UT0A 1OKOA 1W8WA 4M8KA 4LK7A 4JKOA 1ESEA 3PT5A 2WAOA 1ESDA 3DT9A 1IVNA 2W9XA 1V0AA 2O14A 4PPYA 2Q0SA 4I8IA 3DT6A 1W8UA 4JJ6A 4LKFA 1BWQA 4IYJA 4LKEA 3ZYFA 1W9FA 4BQ4A 4TX1A 3HP4A 2WAAA 1WMXA 4JHLA 4H08A
chains in the Genus database with same CATH superfamily
3N9MA 2OD9A 3NVDA 1VRWA 2OCGA 1ZCBA 3STXA 4EWAA 5DAVA 2BGJA 3G5UA 4LFBB 3ZH9B 4MR8B 5I0UA 4NIIA 5CPBA 4A6PA 1ZQ1A 1TLLA 4LG1A 5KCZA 3VV3A 4UBNA 2VXBA 4WT7A 2YC4C 5CT5A 2V09A 2GXAA 3WZ2A 4IJQA 2WFMA 1GM5A 3T2OA 2XRYA 2VATA 2VTDA 4M0CA 1RJ7A 2C4VA 4NZMA 1Z15A 8AT1A 1S2BA 4FE3A 1CDZA 3KV9A 4ZOLB 3S2IA 3QLEA 5SICE 5FWEA 4UBKA 4ZRDA 1EXNA 5BXYA 3PLQA 2Z2XA 4Y1EA 2FFJA 4JLUA 1GBGA 3LT4A 2DQSA 3OESA 4M9CA 2RMU2 2V4UA 4FP2A 4F1KA 3BDIA 3HKCB 1R0KA 4YG0A 1GQHA 1HKDA 5I7VA 4CQJA 2FDRA 3KJIA 3GPIA 1E2QA 2QRLA 3O95A 2ZACA 2VDNB 2AGVA 2FW9A 5LK7B 3UFBA 2VF5X 2XJSA 1WUHS 4CP9A 1CQZA 4PNPA 1RPZA 1QUFA 2WJJA 2JRLA 1M74A 5CA0B 1WW2A 1PX4A 1P91A 3PJQA 5DXAA 1RXSA 2JIPA 1BVRA 2OZKA 2VT3A 3RHFA 4FBMA 1TGVA 2ZCWA 2XWJB 1TE1B 4L0QA 5IC4A 4RHEA 4BKPA 1MVLA 1F6WA 4O25A 3CHYA 4YLGA 2FG6C 1TGYA 1MHTA 4OKIA 2B9UA 1NI3A 3AJ8A 1Z12A 4DCMA 5A3OA 1XZHA 1G19A 4WVWA 1Z2OX 4E27A 4BB0A 2AL7A 1X1DA 5H9PA 4DREA 3WBBA 5C7OO 3EGVA 5JD3A 4AHZA 2FN4A 3EO6A 2BUBA 4IDCA 1PD0A 2COUA 1GPMA 1JQEA 2FUG6 3I30X 4DXTA 2YUEA 1Z22A 2ZGTA 2APJA 2NSJA 4AE2A 1IN5A 2WN3A 4YRLA 2C4MA 1WDWB 5EMJA 1OLOA 4MAMA 3VBFC 1H22A 2WU0A 2A5FA 3A31A 1G9DA 1XSRA 4DUGA 5FJIA 1GZDA 4C05A 2VAWA 3PJEA 3VSBA 3LUAA 2UDPA 1VIDA 3UUFA 3KV6A 3LQYA 2LVBA 2Y9PB 5H16A 2B20A 5LWQA 1UJBA 4GMKA 1ISPA 1H9PA 4GB31 1I3HA 4ZI5A 1JWAB 4E8CA 3NCTA 5D1NA 2C2MA 4XI9A 4TVSA 4OHVA 2Q2WA 3QOYA 2IIQA 5EUQB 5JNTA 1O54A 3LIHA 4X3PA 4IS3A 1WULS 3I2DA 4NU5A 3CQ9A 4KKVA 4L9AA 2JGDA 2C2YA 4Q4W3 3GG9A 1O5IA 3MPBA 1ULCA 1Y3IA 4J16A 2P9BA 2DWCA 4QREA 4HSLA 3UHAA 2FGJA 3LW7A 1H4QA 1K5GA 1FFDA 4CP9B 4YYOA 3Q2KA 3UWDA 2P79A 3JQWA 2YFQA 3EJWA 3BTYA 4LYDA 3AP7A 1FT9A 4LWQA 5B4NA 2V8BA 4KYVA 2GN1A 1VE3A 2HCRA 2IW3A 3AWDA 1AO3A 3KV5A 1W4ZA 4W8OA 3ZWXA 2BMAA 1N9GA 1WZNA 1RWMA 3Q7EA 1KGSA 1J97A 1VA4A 3TW8A 1BO6A 1UH5A 3PTYA 4UFPA 3IHTA 5TQ2A 2VZEA 2ID9A 1LJUA 3WWCA 3ZGLA 3MINB 3PJFA 4YJDA 1GZVA 1EHIA 2ERCA 2WTUA 3ICWA 4WESA 1UQTA 3WLPA 4FYXA 2B5HA 3N75A 4NCNA 4YLZA 1DZIA 1ZW1A 3NM4A 4NE9A 1BVVA 3WBKA 1VL8A 1DGLA 2NVWA 1WCKA 2GQ0A 3RHZA 1H4VB 3FNQA 5J4LA 1T5OA 2YCLA 2H52A 1VSBA 2IH2A 4CIVA 4GI5A 1QQBA 4IHJF 2I6UA 2NWQA 2COEA 3DC7A 1GNSA 4XWTA 3MB5A 1SXGA 2IVIB 1RVV1 1RC6A 1ST2A 1F9KA 1W0OA 2BFUL 1AL23 4O2BA 5DHAA 5DRTA 1F2TA 5JWHA 4UHDA 4CDGA 4E5PA 2VCYA 2AXEA 4PICA 2MCFA 1GDHA 1RWBA 3CCBA 5GZDA 3OWHA 1KOLA 4YZ4A 5CB6A 3MGAA 3CIHA 4JI2B 3TN93 4R1OA 4BNXA 3AB8A 1XGKA 5EKUA 3ZGYA 1SKUA 2ONJA 4PHZA 3LCUA 1XBFA 1QS0A 4BFZA 3UFXA 3NAQA 4N41A 2WT2A 2CCGA 3U7EB 3DNMA 3C3PA 4DJJA 1T1SA 2UWCA 5DABA 2OBMA 1LHWA 2WYHA 1K98A 4XBNA 4F4JA 1UK7A 4L85A 4V3CA 4DFSA 3VKFA 4XD7A 5K6TA 1J0XO 5FTNA 5JLVA 1I0ZA 2NUBA 1F3LA 1SA0A 2OQIA 1UXHA 4G0ZA 1XZKA 1M2GA 2VSFA 3GZAA 5H9WA 4Q9AA 4DCCA 1RYEA 4LE1A 4GWNA 1LEDA 2VTXA 1T3HA 1O5LA 3IQXA 1TU3A 2PBLA 4D9CA 1HQWA 3ZV3A 2FQXA 4JYPA 4WXPA 2OQ7A 5FD8A 3SK0A 4I2VA 1T4GA 3TW8B 1Y6ZA 3TQSA 5EMMA 4ETWA 2JVJA 2AQHA 3WCSA 2R30A 1JW9B 4CWAA 4HDSB 1XF9A 4GD3Q 3WK4A 2CLMB 3IP9A 1JX6A 4TRMA 3I5YA 1Z6AA 1SEPA 1KNXA 1CUJA 4MEJA 4BDTA 1STOA 1XDGA 1X1QA 4TM7A 3CLSC 1PGW2 3TINA 1XU1A 4MI9A 3MYYA 3VPFA 2RAFA 5C5DA 3L1JA 1CZSA 5C1PA 2ZSIA 2JHGA 1W06A 1EYBA 4QQHA 3OBAA 2OAP1 2R7AA 5EHQA 1G18A 4WZBA 3AQIA 2B69A 3NHAA 3OHPA 2XMGA 2O5EA 5L3QB 1Z17A 3OJCA 3WGOA 4C88A 4E12A 3ZY6A 1ZYUA 3D6UA 2VBBA 2CLIB 5GKAC 4OQ8A 3GPBA 4N3CA 1Q0HA 1UZUA 4O2BB 3ACFA 3VD7A 1CIPA 1F2TB 1XAHA 3B53X 1LWOA 5L8VA 3M2PA 5CXQA 1C8BA 2I8CA 4PBSA 1C7RA 3HCRA 5EZYA 2YHIA 4B9EA 2W47A 2Z30A 1DO0A 3X29B 3QOFA 3IHWA 3HVIA 5BN4A 3SG0A 4IIHA 5CEJA 1R6VA 4YBZA 1O1YA 4IXDA 3IILA 4UD2A 4G67A 2P2NA 3RROA 2ES4A 3TRIA 4INPA 3ZK9A 1PYGA 4EHJA 1FPN2 4LF9B 3NKTA 4PYNA 1R0XA 1RIRA 1SFRA 2F9LA 4OUKX 2WAXA 2GBLA 5TVKA 1VL1A 3INRA 2JICA 1IZ3A 1O91A 4ZXKA 4PAOA 1R9JA 1PO21 2XZOA 2YU1A 5EC8A 1TPYA 5HVNA 1Q6ZA 2L18A 2WBKA 1QRRA 1OLSA 1VXRA 3P6BA 3DTVD 4XIYA 4AI8A 2G1AA 5FOXA 2Q4SA 3UMGA 5K3OA 5JOWA 4NROA 1F2UA 2WA2A 2CL5A 5FWAA 3L7DA 3PGXA 4M37A 2WG0A 4UOQA 2Z3WA 3UC9A 1POXA 4XF0A 1YUBA 3ESDA 5CCXA 4BV9A 1JB1A 4B3TB 1U1DA 3ZD6A 2ZBVA 3PBKA 3KG2A 3HR9A 3MAAC 2IPMA 5TDHA 2PUGA 1P9RA 2O0KA 4KP7A 4A0QA 4S3MA 3IKMB 1YB4A 1PO13 1RWPA 3CF2A 3CTPA 4P4TA 1NXVA 5F39A 3M6UA 1DJPA 1PFUA 3GA0A 4KO2S 1B6TA 4PCAA 1AN0A 4F86A 5KC9A 2R8OA 2RKWA 2WM9B 4C14A 4WZBB 3Q85A 5TARA 3TL2A 2BEVA 1XVUA 3NQHA 4CTKA 4N5IX 3G5TA 4FFLA 1ATZA 2ARXA 2P6OA 2ZUBA 2N9UA 3WRWA 2HBTA 3LS2A 4QM9A 5JH7A 3T38A 1XYVA 4LJHA 3FLPA 2BP7B 3NRBA 3TCXB 3UHPA 4M9UA 1HJGA 4OJKA 3H9CA 1CDOA 2IPAB 5HZHA 2NT3A 3D7MA 1RXEA 3PTRB 3WVNA 5JVDF 3AB0A 3AKPA 1PZGA 2Z1NA 5EZYB 4YBRA 3O4RA 2YHIB 2GEDA 3UOGA 2DQZA 2R85A 1TECE 1TTQB 4C08A 1AGXA 1BGXT 1K86A 5BN4B 2WDZA 3ZQ6A 4NBTA 5A6ZA 1SWWA 2Q41A 2OCDA 3AEKA 1HQKA 1LU1A 3UJOA 4ZT4A 2EGUA 1XNKA 2R6JA 2GDFA 1HJFA 1WBFA 3GFOA 4KYIB 1J06A 4WTOA 4YFVA 4BNKA 3T7DA 2Q5EA 4Q2FA 1XU4A 3ONWA 3EVNA 6YASA 1KFJB 1PZFA 4M4SA 2WRZA 4TYSA 2PTMA 4M1OA 2JCYA 3WO1A 3FSGA 4MA0A 3J4UH 2BM9A 2HA7A 4BMSA 4FVVA 3ZK8A 1RCFA 3N5KA 1JMYA 3S2GA 5F8PA 3D54D 5IM5A 5E95A 4XKJA 1ZW6A 5H3CA 2ZP1A 3K71B 5CNIA 1D4AA 4ZALA 2ZYIA 3MGCA 4YTEA 1G5QA 4DJFC 1ZU4A 3GXOA 3DBIA 4FFOA 4OFZA 1RRPA 1F0KA 3TIXB 1BOFA 1G21E 1THZA 1HYQA 3KJEA 1QM5A 4GUAA 1QQ7A 3EQ7A 4BLVA 3CLUD 1OF1A 2OHIA 1XHFA 3PB3A 2X8JA 1QJY3 4MQBA 2BGCA 2OCPA 3WG1A 2OL4A 3SYTA 1YU6A 1UZAA 1BHGA 1DVRA 4MIYA 1G41A 3HPQA 3UMJA 2DU0A 3RI9A 3DE7X 3BG5A 3JATB 4MKFA 5HEKA 2QD1A 1DGQA 5DBGA 5BR4A 1SLCA 4RDCA 1E3JA 2IGBA 2YXDA 3P26A 5DAXA 5K3FB 5A03A 2X1HA 5F5IA 2QUJA 5C1OA 4ZCMA 2D3SA 2I2BA 1R6AA 4QA9A 3ETJA 3G0OA 3PV0A 4ZAZA 5JAQA 2ZU6A 3UG6A 5JH7B 1RHKA 2DCUA 3T8YA 1XZFA 1R6BX 1EY2A 1V6SA 1S8AA 2OMEA 3Q7TA 2W2MA 2J7PD 4NX2A 3GWGA 2QBYA 1NYTA 3RYIA 4YNIA 3RCBA 4CDXA 5CKNA 5IVVA 3ZHUA 3TZLA 3OAAA 4DY5A 2O2HA 5DI3A 1QP0A 4BRSA 4GJZA 2WSSA 1MEC1 4GG1A 4MVJD 1PVC3 3T1HB 3HGTA 4CMEA 2H8KA 4B2IA 1IS4A 2O7SA 4UCQA 1I6KA 1W96A 5FP9A 3AEKB 1TCUA 1TZKA 1QTNA 1PO22 1JAXA 4RTJA 2ASVA 3L49A 4UQLA 2X2OA 1C3OB 4BWOA 1BS1A 3IPYA 3BXHA 1XMVA 1QHHA 3FFZA 1CY6A 3CG4A 2PWPA 3GVCA 3WR0A 1DGWA 1JSXA 2JS7A 4MJLA 2W6ID 1SXPA 5CFCB 1E1MA 1RRVA 3RIHA 1DP4A 4JWTA 2W0XA 2CL2A 3O83A 1QH0A 4KVFA 3EIXA 1H6AA 4YWJA 2UZIR 3LGAA 4NPRA 1EX6A 1Z83A 1Z33A 2EAAA 3PWZA 1D7PM 2XEXA 4L8LA 5AW8A 1D8AA 4INAA 2HQRA 3TLCA 3V6MA 1W39A 4BO6A 4UWDA 2D2FA 2N42A 2Z4RA 4KPYA 1FFBA 5HIJA 3PUWA 1P4GA 1X1SA 2X0DA 3EVTA 4ER7A 1M2VB 5DDIP 4PF1A 1P7ZA 3FWZA 2XWPA 1O4VA 3EEBA 4CYDA 3G7NA 4K6HA 2GMMA 4LNAA 4JZRA 3HY4A 2BC9A 3MS2A 2ABWA 4AECA 1TJNA 4NH4A 4IH4A 3SYNA 5NULA 1K12A 1W0CA 1FUUA 1GUFA 3F5QA 2XVMA 2XSZD 2JBAA 3T3NA 4MZXA 5SY6A 2XPJA 5FO7B 3IP8A 4RQAA 4UNQA 1HNZB 4D3XA 2ODPA 2WAYA 4BU0A 3MTGA 2XJ9A 1RSZA 4E2YA 2C5BA 2G9UA 1IATA 4OVKA 5CDHA 4LKSA 2HEIA 2HRRA 3TQQA 4OHWA 3NXKA 3EVZA 2VHQA 1HXHA 1I1QB 3KKOA 5KYWB 1GGJA 1U2GA 3KSAC 2FZCA 2FEPA 2VJOA 5EXDA 4K8OA 1BYUA 5EIOA 4DMRA 5DI3B 4IUDS 1U5CA 1M33A 1SBQA 5EZWA 2CWDA 2OBBA 3ZGVA 5A1AA 1Q1EA 5I0SA 2H4FA 4HS9A 3RAPR 3ROEA 1D4M3 1E79D 1SKMA 3A3YA 3G79A 1BOOA 3WQRA 5I9MA 1UM9A 5EUBA 2GZWA 2W46A 4LFAB 1CULC 3GLVA 4L50A 2SHKA 2VBFA 3QU9A 1KIFA 3URFA 1SBEA 2A70A 2WNOA 5HK9A 1W3XA 4MK4A 2TMKA 5JUWA 1JSLA 3CE9A 1GADO 4JI7B 3RVDA 1H94A 5DISB 4JTOA 4NHXA 4YZ5A 3OICA 3C87A 1GQFA 5JWOA 1HLCA 3BMNA 2H4JA 4FSHA 4QXAA 2PA3A 4DV0B 3EIOA 1NXQA 4X6YA 3EIEA 2Y60A 1NY72 5TF4A 9MHTA 4GI7A 3Q6IA 2CLOB 2C4HA 3L2OB 1JYEA 2IELA 2FG5A 1JQAA 1LPSA 4J0CA 3QYJA 3ANLA 1D9ZA 2BGPA 4EIWA 2D5LA 2X2EA 4C4XA 2D7FA 1K75A 3FRIA 1P3DA 2GN8A 1Y3TA 4QYWA 4QPIA 1AK9A 5T7BA 4AXXA 3ZPXA 1TJ3A 1GKYA 2YDEA 2MSDB 1T91A 3W06A 3MUFA 5BYAA 1JL3A 3ZG6A 1A9OA 1EFRD 1XXHA 2MU1A 1OWNA 3SM3A 4XZ3A 2QQGA 3H65A 5DRYA 2JIZA 2AFHE 4LGMA 3WWYA 3AL0C 3FYTA 4FDLA 3KD4A 5FA8A 1CEEA 821PA 1ZNXA 1UBJS 1XXLA 4LJ9A 2QTMA 3O84A 4N43A 1CJVC 4L9RA 5HQJA 4AEDA 1MS9A 4YFWA 4CBVA 4JT8A 3O1HB 4B8YA 3VD5A 2VQFB 1WXDA 5DEIA 2DG2A 1QAMA 1RUC1 5LYJF 2HWKA 4HF7A 4Q0PA 2LRPA 5IJXA 2BFWA 3OMLA 4MINA 4CSWA 2C2HA 1Q0TA 3BZUA 4TYPA 4DBVO 1EINA 1FMLA 1YRAA 5F1OA 5E6HA 3TRJA 3DECA 3MWLA 3VH2A 3ZIWA 3ZEAA 4CG1A 3A70A 4DCNA 4CM5A 1L5ZA 4EKIA 4N8SA 4ZV9A 1QU3A 3O8NA 4X63A 2OCKA 1XMJA 4I81A 1T8UA 1ZP6A 2O1WA 4PZ0A 5IZ4A 3EQ2A 1TLTA 2AC2A 1XU2A 4GR9A 5DYGA 4ZTZB 2VTEA 4G2TA 1ZESA 5F2NA 4ROSA 3TZ6A 5BP7A 2Z3VA 3FC0A 4ND2A 4AJLA 3PQFA 4YAWA 1COWD 1R6DA 1UWLA 1XRMA 1ZM1A 3BMNB 4YM0A 3ZDQA 1ZU5A 3MTIA 4BWGA 4HMZA 1LW7A 5D3KA 4O2AA 5BN5A 1CY7A 1VE7A 3S2SA 3EK2A 4HQ6A 1WA5A 1OXUA 3UV9A 3CF4G 2HCBA 3EFEA 2GI4A 1BSVA 5JCZA 5AI0A 2RS11 1ECCA 4G5QA 3NP9A 2ZXFA 4D9HA 4WVMA 1ZVKA 3BFJA 3NHRA 4AN4A 4R01A 1FBNA 4ZQHA 1E3WA 1NLQA 4PBOA 3PNMA 4GSLA 4M1WA 4R9NA 1UBRS 3DXFA 2NP7A 3H1GA 4BNWA 4QPIB 2IW1A 1XYOA 1U63A 2GHRA 4IOLA 5FAXA 3UWMA 2VSYA 1GDTA 1NFRA 5F2KA 4FHDA 2PXHA 5JOXA 4ZQFA 1U5YA 1RQ2A 5FHQA 2C2GA 3Q0IA 1Z74A 3I9JA 4IJMA 2J22A 4KWTA 3FUUA 5BYJA 4PVDA 3QV1A 2Q7DA 3BWEA 5JFTA 3CX6A 1OGYA 3PR3A 2GCIA 4RHV2 4FX2A 3FNBA 5CJJA 3IKVA 3OZ7A 4QKQA 4TTPA 5EWSA 4CA9A 5A3NA 4AEDB 3A11A 4ACAA 5K2MA 4MCIA 3HZZA 1KI6A 3VV1A 1GPYA 1JDUA 5FUYA 3WGMA 1NYWA 1G0OA 1JWBB 1IOVA 2VZQA 4TZKA 5C9AB 3SXPA 3MT8A 1N8KA 3EDMA 3QEMA 1UXJA 4BMNA 1PLKA 5DBEX 4PPQA 1RXVA 4GL2A 5CLFA 4AY5A 5AICA 1GPKA 1SXJA 1HQLA 5LYYA 2GEVA 1JSZA 3PEWA 1SKQA 1DTSA 2C1ZA 2O50A 3EODA 4R2JA 1L5KA 2WF6A 3FYCA 3JBG1 4AS1A 3M1AA 4OKSA 1T1JA 1XRSB 2Y1OA 4K1YA 1X38A 3IOCA 1IAVA 1LS6A 3FR7A 3LDKA 4K2AA 4OIMA 4WXYB 5EMKA 4PNHA 3LZ6A 4MV5A 4AMZA 2JFPA 3MT9A 3MIGA 4BNJA 1BC5A 1S02A 5HKOA 1G9AA 1ZGCA 2CEAA 4PY2A 5FZEA 5BN5B 2WICA 3RSHA 2QUIA 3WZLA 1CDDA 4ARBA 1KS4A 3SQOA 1ONOA 1RQXA 2IZ1A 2TMDA 2JE8A 2VSXA 1HXS2 1F0YA 2A1UA 1CZLA 4QOGA 3H1AA 4C01A 4N6GA 2PLFA 3DUIA 3K96A 3J7LA 4XYBA 2P2SA 3IVXA 5CDTA 1NATA 2PH7A 5KNLA 3WQSB 1DJNA 3E5QA 4CLEA 2HF7A 1WB4A 4EQVA 3QE3A 2YBPA 4YCJA 2R1UA 3ZHZA 3DHNA 4GMP1 2WSBA 2Z9CA 1AF9A 1M76A 2Z6AA 4IQ8A 4OZOA 1OA0A 2WNSA 4JITA 1MR3F 1HLDA 4M0DA 5CNKA 1M5RA 3T12A 1AKUA 3T95A 3EQ9A 5A6XA 4C1WA 3K5HA 3BWCA 5JXGA 4KIJA 4QX7A 1N1MA 5A9TA 3L7MA 2X53S 1D04A 2PKCA 5JCPA 1H2ZA 3UT5A 2BWAA 1KFKB 4PYOA 5FWYA 3U7FB 2GARA 2P4UA 1NZJA 2KQUA 2XAUA 3AL2A 2V9CA 1KH3A 4B5LA 1ILEA 1N5IA 1S7GA 3HJRA 2ZIAA 3RGWS 3V2GA 1U0SY 1A82A 3USUA 1DQZA 1WCIA 1JIKA 4XCXA 3ZU2A 5F98A 4XJWA 1SXJB 3WYNA 3OLXA 5JXJA 3HG7A 1W4RA 4AUNA 3MO4A 4QB2A 3P45A 2WLQA 3ZGXA 1VDMA 3FBGA 2WO3A 3X1ZA 4PFKA 1QOTA 4UBHA 1J99A 2OR3A 3ITKA 4G36A 3ZE6A 3QFTA 3A2NA 2CY0A 1M2HA 3KEQA 1R9NA 1OI6A 4DUYB 3SNKA 3X2SA 1IK6A 2HPHA 4D9KA 1IFXA 4LQCA 4B33A 5F5XA 1LTHR 3OZFA 2HO4A 2WFF3 1N5LA 2AK3A 3D82A 4AHYA 2X0EA 1X94A 1U8ZA 3H6GA 4JVMA 2VMIA 3KVAA 2YXSA 3MUNA 3RWMB 1TJYA 4HN1A 1JPJA 2CXPA 3WLNA 4B46A 4GNKA 4B2PA 1WUYA 1WHTA 4LS3A 3OA2A 2V7BA 1AOXA 4IFEA 1EYZA 1UBUS 1IYZA 2B21A 2RS12 1QH1A 1RYNA 1MKYA 3UGHA 1X1AA 4DW8A 1B76A 2I22A 3UMRA 1U7ZA 5KYNA 4DLLA 5JNUA 4JX8A 1E7RA 3IMNA 2GAIA 3JD0A 1OLXA 3K1YA 4GQBA 4PQGA 3D81A 4L2IA 4DUWA 4QFDA 1XWIA 5FLEX 1FOD3 2PMEA 2CU5A 3RRMA 3QKRA 4O59O 2ZCVA 3PPIA 2ONYA 1NVGA 3BJEA 1YZTA 3Q9UA 1UBGA 2ODWA 2Y4OA 4D0LB 5TMDA 3PURA 1GEEA 2OLKA 5P21A 1JOPA 1P81A 3N8GA 1I5ZA 1I3OA 5LQDA 3K48A 1EG7A 4LK7A 5BSEA 3U3JA 4AU1A 1VP3A 2ID7A 3OQIA 1H8TA 1VHQA 1J3RA 2EJUA 2FMDA 3TX6A 5L40A 3OPYA 3DV0A 4ZT3A 1VBB1 4ZI7F 2ZYRA 3K73O 3P0JA 1XDUA 3IE1A 3RVQA 3UT5B 5SV2A 2IPXA 2XOEA 5KVCA 4A6SA 1SCUB 4FSJA 3AHGA 2VJDA 2IYQA 3A0RB 5A7PA 4U63A 4PFSA 3GX1A 3J81A 2AC7A 1XTPA 5A0VA 2DFCA 1D1TA 3L2YA 4Q4HA 3KETA 4TSVA 4PAMA 1SBDA 5AW9A 4D9NA 3MUEA 5HV4A 2G08A 2Y0OA 1K3FA 3EDQA 3IXQA 2RR13 3UAOA 1YCDA 2WUDA 1HRI1 4N8DA 1C7EA 4OUDA 2UYYA 1UPCA 4LEIA 4KWIA 5IKPA 5BWLA 3GJXC 3VDRA 2I1VB 4Z3KA 3I0ZA 3HBNA 4RKEA 3QVKA 5IU6A 1AQIA 4ZTBA 3QU7A 1OIVA 4A8TA 2BOVA 4WFKA 4ALNA 1J2JA 3F6RA 3M3CA 2XMLA 1D0SA 3ISJA 3E9ZA 3WDMA 4KLCA 4OA5A 3K2IA 1TD1A 3HH8A 5FZ9A 3H8OA 1VMJA 1EVEA 3NM6B 2H2HA 4B3DA 5CPFA 5IYZF 3RUPA 4NMHA 1VJ5A 3RC1A 2XKOA 3IAM6 1E94E 1YS1X 2QQPA 3I0MA 2I91A 3K9CA 1S8OA 3DDCA 2DU8A 3ITNA 4G5GA 1OLXB 1VE1A 2JI9A 1ZVMA 2WV9A 1F2DA 3I1FA 1K6MA 2PRSA 3W8EA 1X1RA 1EXMA 1Z2CA 4CKBA 1KI9A 4CPBD 4ZVLA 3QELB 5I7RA 1NJ6A 5DB4A 4AZWA 3QKRB 1WNTA 4MVJI 2OCAA 3IIJA 1Q8OA 1RWVA 5AXCA 3PC6A 2ZZQA 2OHFA 2W7TA 3CZ4A 3GGOA 3NALA 3KCQA 1FBTA 1I5RA 4EG1A 2FEKA 4J0KA 4CUJA 1HT2E 3AESA 1WR8A 3NYRA 2VZ1A 2EAUA 3D2CA 3OQIB 4JDMA 2GUGA 3DV8A 3VZMA 4TTGA 1G9BA 3TYXA 5F2SA 2NSDA 5L3ZA 3KDAA 3OPYB 4OLAA 2DB3A 3MMPA 1ZGHA 4Z2WA 2BQPA 2I78A 5C5EA 2UVDA 5BWMA 1WY7A 2BFAA 1KJ8A 4C0BA 3ND8A 2X6QA 3POWA 3H9JA 4MSUA 3E5XA 2XXBA 4TV8A 2I71A 3E6CC 4P9IA 1TZMA 1CVLA 2R751 3BIWA 3DF9A 4FJ2A 1Z26A 2R32A 4LBVA 3IUBA 1RHI2 1HY3A 3ZVLA 4KYUA 5B6JA 6PFKA 4CLOB 2ZTUA 3LG2A 1WXWA 4IV3C 1EBBA 1FFYA 3JU9A 4OFGA 1UWKA 2G06A 2ZULA 4GD4A 2F6RA 3K9FC 4DUXA 4P33A 1QIJA 4M7PA 3K9LA 1QJFA 3HNPA 1WZ2A 3S0MA 4LE3A 1JMKC 4QQRA 1V8OA 3MILA 5ABPA 3P2IA 4YXWA 2IXKA 5JSZB 4CDUC 2NZXA 4ZYYA 4RL4A 2VHEA 1CUYA 1D2RA 2Q0XA 3L40A 3A1TA 2SLIA 3EMDA 4MRRA 1EP3B 4AWBA 3T1TA 2YC2A 4OVEA 3N7JA 2JHCA 3AX6A 3AYCA 4B1MA 2C4WA 1T6BY 5AKEA 2A3NA 2OPKA 4BDVB 4XDZA 5JI3E 2G25A 2IYWA 2GGSA 3SXJA 2M1ZA 3VH4A 2BRTA 3NHLA 4HBGA 4E88A 1K5HA 4FOPA 1PL8A 5EE5B 3CM0A 4HZFA 5SZHB 2FW6A 4BE3A 3WIEA 1NDHA 2I6XA 3IMGA 1DHTA 1EB8A 3U19A 4R83A 3HU2A 4M9QA 5FOWA 1YA4A 3EH1A 4NK4A 2LRHA 1K06A 2GBGA 5IXJA 2ACWA 3D7LA 4B74A 3G5AA 1JXQA 4XIKA 4URUR 3KR0A 4EFDA 3PMSA 3H0CA 4DEYA 1R083 1ZBE3 3VZCA 4MADA 3RG8A 4HSJA 5G0SA 5BY2A 5DPMA 4MKGA 5E3HA 4EWDA 4MICA 3GNQA 3MIBA 1NF8A 2QUKA 3O4HA 3LAGA 5A7GA 1UAYA 4Q01A 2GALA 1GGVA 4YYEA 3TOZA 4EGJA 5CB4A 5ALRA 1VOTA 1W8HA 3KKZA 5JCXA 4RKQA 1PT6A 2FPRA 4C3VA 1Z7S1 2YYOA 5EXSA 4F21A 3EFHA 3K1AA 3HMYA 4RZUA 3H3ZA 2HT1A 1RPTA 3E70C 4IEXA 4PGAA 1RKXA 3WRVA 3EXFA 2KSQA 5KSWB 1TAUA 4XJ8A 3KCXA 1WEKA 1CAXB 1G5PA 3HL0A 5DWDA 3QLVC 1Z4QA 2WJSA 2J5QA 1X7WB 4ZZ8A 5GOTA 2YV1A 4AWDA 3HPNA 3ZWPA 3IDFA 1N6LA 1PGQA 1HG1A 3IUQA 5FL3A 5BW5A 1KE1A 2YRXA 2FEOA 3PIIA 2HDWA 4OHMA 5ADUS 1BEV1 3C7EA 5A71A 5HZKA 3UXHA 1N6HA 5AKIA 1XZBA 4BBPA 1T6BX 3AFGA 4US2R 3DZGA 3IEIA 3FBTA 4GPBA 3LCMA 1LBQA 3WWDA 1QE0A 2JB9A 5KQMA 1P9NA 1ONPA 2O2EA 3WBFA 3V33A 1Q14A 3HNBM 4CN9A 3MLJA 1V9CA 4JOQA 4QVIA 1ONSA 1LEMA 1KDMA 5J63A 2JEZA 3FPSA 5GIPE 1LDGA 1QSGA 1S4QA 1V26A 4WV3A 3MJCA 2GEKA 5FUVA 5B58C 2GO1A 1VGRA 3O75A 2EKLA 4LPLA 2IHJA 2HJIA 2Q8PA 2V5DA 4GWJA 4NYIQ 1U3TA 4GOLD 4WEOA 2PT5A 2UXBB 3U75A 2XJPA 2QP4A 5AJHA 4AN1A 1C8M3 4JYCA 3FJSA 1VYVA 4WKBA 2K87A 4CCEA 3K30A 3BICA 4Z86A 4Q9KA 4RHXA 4D3WA 3UA4A 1D5CA 4B5KA 4AMUA 1WPXA 4PC7A 1FS5A 4EJ6A 4E14A 5DAWA 2BMVA 3IERA 3JXEA 1FYDA 4MXVA 1GA6A 1NT2A 4UBLA 1CIWA 4QT6A 3MWGA 2ILMA 3PC4A 2HJGA 4WFJA 4TROA 4QM7A 2BGGA 1IKPA 2OYCA 5TV2A 2EXXA 2W6JD 2GEFA 3EF0A 2G5TA 2GJKA 4CZ2A 2XGOA 5HS4A 1PSZA 2ECPA 5U9CA 1WJGA 2MOKA 4UMDA 1WCUA 2PX2A 3PNPA 1FYXA 2HKXA 3KZCA 3Q98A 3OBTA 1WV0A 4LBMA 4XPVA 4GQAA 3LA3A 1SUWA 2HWYA 2C5DA 4AXBA 1WLWA 4DXHA 5DG1A 3I2GA 3UJ8A 4R9BA 2O48X 3LHKA 1XZDA 1NVTA 1GG5A 4HAYA 4XDQA 1U9IA 5A06A 4X8PA 1EWTA 1SEFA 1RWOA 5HOEA 1HRV3 3GJQA 3QRWA 3IAUA 4AHWA 1S2GA 3IHKA 2GN3A 4MW0A 1PZNA 2VA8A 5EYPA 5BR8B 4PLTA 4RTQA 4R1PA 5JSFA 5AC91 1EZ1A 4HN2A 2VRBA 4LE4A 4LF7B 1PU2A 2ZCUA 1IZ7A 2E3JA 2GH1A 1SGWA 3ASYA 3GDFA 2CV0A 1RKVA 2R6R1 2WIAA 3D7SA 3W5SA 1JOBA 4CVUA 5FLXA 2PYTA 3KB5A 1I6LA 1W6MA 4YT8A 1OD3A 1ZL2A 2P5BA 1EVLA 2WF8A 5FRDA 3LUKA 1ULHA 3V8QA 4OK6A 2DOKA 5M29A 2NXCA 1G86A 1WABA 3R6LA 5GLVA 3AEXA 4M98A 1YU9A 4ZP1A 5LDDC 4J0FA 1GTL1 4DLWA 1QBKC 8OHMA 1B73A 5IJRA 5DHTA 1OH3A 4F1WA 4PT6A 2J45A 3WGKA 4BMZA 1FDOA 2Q5CA 4IV0A 3HDJA 3W5UA 1AQNA 1PJ8A 4MUJA 1XRLA 2P6CA 4NAOA 3L8HA 1WDKA 1A69A 2PKRA 2C7QA 1SN7A 1XZEA 4L2NA 3MPOA 1ML3A 2AHOA 1ENPA 2PX5A 2CAUA 1MGOA 3AVSA 4N54A 4YAOA 3SVLA 1X15A 3F6PA 3JTEA 4AG4A 5DWQA 2GM3A 2FETA 3L0PA 2J4FA 2ZX1A 5KBYA 1FDRA 3DDWA 4XYLA 2C8VA 3HB5X 5COBA 1Z56C 1ZC4A 3D5EA 5DASA 5F7UA 2B83A 1JDSA 3F90A 1BEV2 4ZO4A 1K6IA 4TQUS 1W90A 1CPMA 5JZVA 3JQXA 2RHMA 2ID8A 4XILA 4PXAA 1CUDA 5ECWA 1UBNA 1BCXA 3L7LA 5CJPA 3A58B 1TQDA 3FNHA 1RR6A 2EATA 2G67A 4Y30A 4HI0E 2IPLA 4PF5A 5EJFA 3INYA 3WKAA 2I4LA 4YPJA 1E5XA 3K4AA 3AHEA 1OMOA 4UM9B 3NOOA 5EJAA 1GSHA 4E2GA 4JT4A 3URMA 1MO6A 3H84A 3LAWA 3RVOA 1NRXA 4X97A 2YJZA 4OI4A 5EYPB 4C4TA 1LR5A 5TF0A 2P11A 4NV3A 1VJCA 4KN8A 3BL5A 2F55A 2ZWMA 4LOKA 2CFCA 4ZEVA 1FDVA 1L0BA 1IRXA 2FVXA 1E62A 4BYGA 4URYR 3RC7A 4ZOEA 4PQ9A 2GCNA 1KWKA 4NHLA 3KS7A 2W98A 3VGJA 4CU6A 1W6MB 3A37A 2RS31 1VLZA 3EXG2 1BMFD 2X05A 4UBIA 3KKLA 4MITA 5E2AA 1N25A 2WG1A 5ELLA 4E3WA 1I1OA 3EWAA 5HCUA 5KREA 4RPJA 5C8CA 4JBIA 4PSAA 3GBVA 2EFYA 2F48A 3SSNA 1D4VB 1KTIA 4FPHA 2BV4A 1DIAA 2DBRA 1TVGA 2XUOA 3G23A 3DLTA 1QNFA 3DZHA 3RREA 2WT1A 1TUBA 4NYJQ 3PJGA 2Z2ZA 4R2XA 1GN9A 3VR0A 1Y9GA 3FAKA 1MO5A 1RQRA 4CU9A 5KTNA 4ZOCA 1YBVA 3RSFA 2OPWA 1M7GA 1UMIA 3NC4A 3GNEA 1HDZA 3CUYA 1P4RA 3OZTA 1GGNA 1K4KA 1CNFA 4IHJA 1Z0KA 2ZGKA 4RCVA 3GMIA 2FDIA 4N48A 1OKOA 5LJLA 3BGOS 4TXLA 3OTHA 2XA2A 1SZBA 2I7XA 2OFFA 3U26A 2G0AA 3QTLA 3TMKA 1ECBA 4BKUA 1E2FA 2X41A 3PC7A 4BFVA 1ZGZA 4OG2A 3JALA 3H5TA 4FXPA 4DSNA 3A6JA 1PFKA 3DHVA 4B4RA 3OZXA 3P4UA 4UCFA 1K8ZB 5H3LA 2HBZA 2YXEA 3WL5A 3U7GA 4AF8A 5CYPA 4EY8A 4M49A 1DBQA 4LDJA 1IWPB 1T5BA 1N33B 3FPFA 1JYVA 5EKTA 1W28A 4H0NA 3VQTA 4P81A 3JQ9A 5JQWA 2DECA 3D3JA 1P1IA 5A3JA 1W94A 3F2ZA 4GWMA 3I9KA 5HFNA 2H1OA 5AC92 1CDEA 3FFBA 3KQPA 1FMD1 3C70A 3N39C 1V9SA 4IVNA 5TIIA 4Q27A 4BNYA 3PEEA 1VMHA 4QGGA 2ZSDA 3CNNA 4RV5A 2DUWA 1FXUA 4PNZA 1S4CA 2HMAA 1C0IA 1RKBA 2FQWA 4WLNA 5TY0A 4C7BA 4J16C 1HQNA 2P2CA 1J2RA 3CNOA 2B45X 2H5JA 2PUHA 4B8EA 3BTSA 3QVTA 2A1TS 3Q4GA 4PYLA 3ZNQA 2OG2A 1XCLA 2WR9A 2H9IA 2FK7A 4ZAVA 3EOAI 4E07A 5KTMA 5FBZA 4QXBA 3W3AD 2A2ZA 1USGA 4KO1S 2Z8YM 3FR8A 1I9GA 3TPFA 3TK1A 1LF5A 4NZZA 4JVOA 3D4KA 3E61A 3ZOIA 3G7DA 1TUBB 2QD4A 3JVEA 1KJJA 5AW2A 4EEKA 1FK8A 1O0BA 5B3KA 3NORA 1JMUB 5C3QA 4IINA 1XO1A 1W52X 3AZQA 3FVWA 4AZSA 2AXPA 1A71A 3ZU4A 4AKSA 4Q4V1 2B61A 5BUCA 4ESOA 1X70A 1UKVY 5IEJA 2JFZA 2OO7A 1Z6GA 4BIFA 3INTA 4FFFA 1X92A 2PMKA 4N9HA 4LJRA 3P3PA 4GWLA 1EPWA 2IITA 4R1MA 5AW7A 4LHKA 3ESYA 1E32A 2OV6A 1PNTA 2XXZA 3ZFFA 4GUDA 3C2QA 5FPYA 1B0AA 2XUDA 3VJRA 4MO2A 3LFMA 2OD7A 2GDZA 2FW0A 2JGDB 2REXB 5FO9B 2XZLA 3AP9A 3JALB 3KTOA 1I30A 4IHKA 1YASA 3GNTA 1NVMB 5G1NA 3W5AA 3OEBA 4CQNA 4U7TB 3UYKA 5IBCA 5FZLA 4NBLA 1KF0A 5B2ZA 4BQ5A 3KE9A 3LQFA 3IMFA 4LXGA 4PM4A 5A9RA 4LYGA 2J3MA 2GNBA 4J1TA 3WJAA 2BZSA 3EGXA 2QUAA 3ZD9A 4NKRA 4LRWA 3FRHA 2BTQA 5CXXA 1N9GB 3V2IA 1TEZA 4A7YA 1PEAA 3R24A 1PGNA 2X14A 2XL7A 3TNJA 2H1IA 4ZQIA 4U2AA 2XOKA 2DP4E 3LUDA 3MA0A 3NPAA 4B3RB 2BFPA 3EGOA 1R9MA 5TQ2B 2HEYF 3RC2A 2X42A 1NBME 2QN3A 3AZPA 2PUDA 1ZJJA 5EQFA 3CBGA 3IQGX 1SB9A 1A1VA 4K81B 5ED4A 3ISTA 4I1YA 1XPWA 2RS32 1Y5IA 4WESB 4K9QA 4X44A 5F6KA 3TTTA 4BN4A 5CFLA 2WC2A 1KI4A 2I34A 4NCBA 1NJFA 2HBRA 3F6CA 3FKSD 2O5VA 5CB8A 2CL6X 1R093 2OA2A 1NY5A 4K1LA 5EI5A 3PPXA 4MUAA 2JLYA 1PIV1 3U7JA 5KTKA 4QDUA 1OA1A 4LYAA 3SMQA 5TE9A 5ARCA 1W04A 2V7PA 1MJ5A 4GO1A 5B4VA 3T9AA 3MJHA 5DTMA 1RUJ1 4RZIA 2PYIA 1STMA 4DLYA 3HR7A 3KVVA 4P7KA 3ZX7A 2Z56A 4YP1A 3PNOA 2RSLA 2A8YA 5E3JA 4UNRA 1H9CA 3FSRA 1YLLA 4GB32 1DOHA 5FYMA 1E63A 2A9JA 1R0WA 3LCRA 3RSQA 3GJ0A 1L4LA 3D6TB 2W94A 1E9VA 2CXTA 1IWOA 1JR4A 2O3SA 5C3SA 1QS0B 2XUMA 3O93A 1EK1A 5GM2A 3UFXB 3K3NA 3WC4A 2GN9A 1H2RS 2RG1A 2GRAA 2HF8A 1QG6A 2MMCA 3GDOA 2WWWA 5DH9A 2FEWB 2WA1A 3NV9A 2NV0A 1QGDA 1D0HA 2QN2A 3N8DA 1NOVA 5JCOC 3T5GA 3RVHA 4KWCA 1MC1A 3O2QB 4I9FA 2WJPA 5JVDA 1WLDA 4M1TA 4GMP0 3N6VA 2GA8A 4MUNA 2VULA 1SA0B 4EI9A 4AVYA 3CLTD 1G7RA 1HB1A 5LNK6 4DEQA 3QEKA 1T3LA 3WL3A 3EGXB 2Q27A 1FMD2 5EIHA 5AQEA 5HFJA 4NUBA 2BTQB 5K6RA 4PEVA 3AZWA 3N9OA 1NPTO 1KEWA 4AJEA 4RPIA 2QIOA 5AJZA 5IJ0A 3ML1A 4BAGA 2VUHB 3H8XA 1E9DA 1U8AA 3W1EA 5BNTA 4KNVA 4DXAA 1O96A 4P02B 3MHTA 1MX1A 3QW2A 5E9AA 1JZQA 3ZZ1A 3FCOA 2VUTA 3QK7A 2BFDA 4Q9JA 4RLFA 3LHIA 1ZRMA 2DQYA 4BO9A 2GBLC 1L4KA 2RGUA 4DV2B 2YRWA 2OT3B 3LT1A 1JB9A 5IT4A 2OQVA 1KAEA 4RY0A 5AHOA 5JBNA 3PGLA 4KQIA 5L51A 1QJEA 2V65A 4GGOA 5KSZA 2R8RA 5FWXA 1V6MA 4H2DA 3DYIA 4NCKA 3OIGA 4JI4B 2WINB 4DIBA 3QPCA 2C9ZA 5BT8A 4QVKA 3B7MA 1X7XA 1WLTA 3W1VA 1QTQA 1L6RA 4Q4V2 2OHJA 3ZTTA 3AMPA 1SCJA 2ZGVA 3W6ZA 1ESCA 2EQ5A 4LBWA 5JXHA 4QTYA 1SOMA 4GAEA 4NI5A 4PZ9A 2AS0A 1ZICA 2O0JA 4UEQA 1MJFA 2JW5A 1V3VA 1S0GA 3JCIA 1JLKA 2ZI9A 3P7MA 4XQ9A 1D1SA 1VBE3 1Z0AA 3PHHA 3HWSA 1WAMA 3T6KA 4EG6A 1ZSYA 4OP3A 3PUYA 5BN3A 3C3XA 2DV9A 3Q40A 1VBD3 4J94A 4ALJA 4DLXA 2PFWA 3Q9SA 3LDAA 3I39X 3A6EA 2PKEA 4BNMA 4DS3A 5KIAA 2JJ6A 3PIGA 4UEOA 1Y3AA 5C7IO 5JVDB 4UM7A 2L19A 1DUSA 2XECA 4QMAA 2HU2A 3OG2A 4DLSA 3CUWA 2WYOA 1MFZA 1OLSB 2IE8A 4JQSA 1ZZ6A 2ILVA 2BVVA 1P0QA 2AKYA 1OVPA 3FMVA 5FYCA 5IKXA 4QX5A 1F2UB 2C42A 1J59A 2JJ1D 4W9NA 2CMFA 4YZ3A 1Q20A 5G1OA 2JHFA 3W8FA 1XSEA 3G82C 4JZYA 1W05A 1W8TA 5IJ0B 3PU8A 3QLUA 4F12A 1KPHA 5CKQA 4ZVPA 1OQ1A 1COV1 2QTTA 4A41A 1O96B 1UQXA 3EIUA 3QV2A 3IVRA 4Z4FA 1GEGA 4EX7A 2BFDB 5E4YA 1C7FA 1MQ9A 3PUJA 4DQ0A 2D8MA 1RE0A 3DOOA 3AWIA 3JQPA 3RD5A 1VZ2A 2PK3A 5LZ8A 3FN4A 4RSUA 3G1UA 1ZZ7A 3TZQA 3SCFA 4DE5A 3R7LA 2WUHA 5EPOA 2CDPA 3DMTA 3LNCA 3F8WA 1AKTA 3TSWA 5CFCC 4MQ6A 3NWBA 4PYIA 4S2UA 4UC0A 4CU8A 4WCFA 1NHWA 2BEVB 3WA7A 4QOJA 2QG6A 2HRBA 4XB6B 4Z49A 1AMUA 1CE8A 2CB9A 4L0CA 4KLRA 4DLZA 1NJ5A 2F1RA 4EA8A 2DZDA 2ZWIA 3DDOA 1KDOA 3ILYA 2BOJA 4IDPA 4KQHA 2BERA 4YRJA 2JE9A 4UOEA 2P1RA 4MO3M 2XLCA 4FK8A 4U9HS 4JYZA 2K7ZA 5H59A 1XHLA 1OXCA 5DLYA 1LPBB 3TLJA 4YUXA 1ZD4A 1H6DA 4AVTA 2JI6A 2WYWA 5BN3B 2CGOA 2ZUEA 4UFOA 1U5AA 5EMLA 5HFAA 1Z6XA 4JBYA 5EAIA 2JDPA 3QX7A 1YQXA 3C8HA 5FXXA 2H2WA 1WD5A 4FPGA 3II6X 1Q1AA 3U3OA 5I9IA 2BYVE 4L8QA 4UU0A 3UOWA 5FMOS 4MG2A 1ETHA 1RM0A 2BZ0A 2W2LD 1XRRA 2WNVA 2LNDA 4GMHA 4I02A 1EUCA 3K16A 5B3JA 4LI0A 1L5VA 2VJXA 3AW9A 4PYKA 1REDA 1HSOA 3RS2A 4HZUA 4ZCPA 3LH5A 3TL6A 2VDWA 1G7YA 3NKVA 5G2OA 3SQDA 2NV6A 2VQ6A 1QHDA 1U5IA 1KTVA 2ORWA 3UB3A 4FYHA 2WILA 4AW7A 3STUA 2DQ4A 1UPXA 2WT9A 1IQ0A 3GP3A 2CLHB 2Q8CA 2X8JB 5DM60 3Q8AA 3DD1A 1ENYA 1VPLA 4KUHA 5IBPA 1A2QA 1II0A 2WSLA 3Q3GE 3DP7A 4NWWA 2HRZA 3PDQA 3WGTA 4QXQA 4A6DA 4OGWA 3K0SA 4ERXA 3Q3IA 2AYZA 1MOSA 1RCTE 2C0ZA 3JWJA 1U5XA 5F7XA 2W0MA 1KS2A 3B7PA 3HV2A 2DVAA 4FGZA 3CLKA 3GN2A 2ZE5A 4DMMA 2H2IA 3IAPA 2BV3A 1CE8B 1Q0PA 4US0R 4JHXA 5ADWA 4HEA6 3HCCA 3DMGA 1LDBA 5F3CA 2ODEA 4RUKA 3IZOA 2QQLA 3U3DA 5LQUA 4XUGB 3BRCA 1I5PA 3LBYA 2R3SA 3R7WA 2ZIFA 4UHBA 4J2OA 1EWRA 4FDAA 2LM3A 3H17A 3A6FA 1CONA 2WV7A 2QBYB 2E6VA 3I92A 3RYIB 3ULKA 4I46A 1W6OA 2R1VA 4CDXB 2ZJ3A 4LHLA 1XPRA 4TSKA 1DFQA 1QMGA 4CUBA 5HSGA 2YIVX 5A2QA 4LO5B 3V2UA 3OY8A 4XIGS 4KWHA 1NUAA 2VGDA 3PYLA 3NIGB 4MGTA 3NTQA 1DWOA 1SUCA 4N1AA 1DG6A 4KL1A 3JYQA 3KZOA 1XIVA 3T06B 4BCBA 3VKOA 1V6OA 5LYJA 4C0XA 3V0AA 3AHHA 3CA8A 3PJDA 2ZAYA 1QHHB 4DQAA 3M3PA 5AIAA 4RL7A 4FN5A 5LWHA 3HAGA 5GZCA 4IG4A 2WJAA 1K8XB 3ZXIA 3GVIA 3QXSA 4G0OA 1Q5OA 5FYSA 4EK9A 4RYLA 1EUCB 1SQSA 1XNDA 2JJ2A 2QW0X 2FSGA 4UUAA 1IY8A 1VPTA 3RG0A 4W82A 2VDWB 4QKBA 4CL2A 3ZIAD 1ID8A 4K46A 1COV2 4NOKA 4Z9XA 4CUZA 1EH5A 5KTOA 3K6RA 2IP4A 2BELA 4X66B 3A9WA 3PHGA 3RT9A 4JJZA 4BQYA 1JZ5A 4A5OA 1UIJA 4S12A 1BROA 3B9RA 5AVAA 2OXIA 4Y26A 3OPWA 4JELA 2YU2A 3KEFA 2I74A 4E6PA 2NGRA 3FPJA 4LORA 3PEFA 2A1IA 2QYHA 3TSCA 4AEMA 3L3BA 2JBAB 4OQMA 2FW8A 4BOYA 2ZHKA 4R5MA 3D6FA 4U6NA 2OSVA 3DLCA 5FOQA 4ALIA 2XYRA 1M0TA 1J2EA 4ZS2A 3Q8LA 5EIBD 3RRFA 4V24A 5HM8A 1E4OA 2YJ3A 1RUG3 2PXCA 1ADBA 5HZGA 4JHTA 3R7WB 5JG7A 1JT2A 2VWHA 5UKDA 4AJ4A 1MEC2 4GECA 5DGIA 5GZ6A 4AF7A 2AYYA 2VZPA 3D6EA 4M7RA 1W6OB 5A7OA 1X36A 2R1VB 4HC4A 5KVSA 3H8WA 2XVGA 4QPIC 3V32A 4H35A 4PYRA 3D8TA 3OY8B 3P9YA 3GYBA 2A6ZA 1OHFA 2A5YB 4IUYA 1EUQA 4OQEA 2QIPA 1JJIA 4MWDA 2XNDA 1F1JA 2MPFA 4HPWA 3S7EA 1UMKA 3OWOA 1UM9B 5LYJB 2PGAA 5HIMA 4TUYF 2NAFA 2C8JA 3T7EA 2YGMA 2NTVA 2D6MA 2ZGRA 5FZFA 4GNRA 4UZEA 3WK7A 1NNI1 1VECA 4Z3OA 3NYIA 5ISLA 4JQRA 4AEDC 2SBTA 1AZSC 2AN1A 3HADA 2VJMA 4IV1A 3QOWA 4HFSA 3E9EA 1PEKE 1D4FA 1CB0A 2EP8A 3CFYA 1RYZA 3F47A 4YGCA 3DB2A 1BCRA 1UN1A 2B1IA 1WA4A 2JFFA 4OUSA 5C9AC 2P8SA 3HBFA 2IZ6A 3OC0A 4BV8A 2F9MA 5CDYA 4WK2B 2BI4A 3PGA1 1MF7A 3EHKA 3CH6A 1ZMOA 4B35A 4LF4B 3LD8A 2WU3A 1EFLA 2R7MA 3HN3A 3Q8XB 4B6PA 2P69A 5HV0A 1TX4B 4OAOA 3R5FA 2P2LA 4MVYA 3NW9A 4GX5A 1JIJA 4NAHA 1NOKA 1XNCA 1PR1A 1S01A 5JD4A 2KM2A 5FX2A 2D3RA 5A3VA 3CVOA 2X8WA 1XXHB 3N6XA 3ZHTA 4HAXA 2OW4A 1XOYA 1HE4A 1RLMA 3VHNA 1ECGA 1OFHA 2RG7A 1KQNA 4OGLA 4Q3KA 1KDKA 2Y2VA 1EDZA 1EXVA 3LA7A 5EL0A 2WPDD 2EF0A 3U5TA 4C43A 3B1JA 2WSVA 3GCWA 2ZKNA 3MYRA 4DZGA 3QJYA 3A1WA 4N43B 1NOJA 1ZH0A 3WKBA 1EE2A 4NCHA 4QGNA 4N53A 5JRDS 2PZ8A 2C84A 4TX1A 5D1HA 1FFWA 4B4PA 4C21A 1VSUA 5AHWA 4DNFA 1BA3A 1EBFA 3L5OA 3FNFA 2PT9A 2LDBA 3E3AA 1NXTA 2QU8A 3GGDA 4LNVA 3OCCA 2UYQA 1Z25A 2A5DA 1C3EA 3PQ8A 3HI6A 1U8FO 1OLMA 4LZWA 5ILQA 3P2YA 4RJJA 1MC4A 3HKDA 3LIIA 3I62A 3AP5A 3RU2A 1G4AE 4UE6A 1AZDA 2QDRA 3C7GA 5FYVA 3GJ8A 2WJYA 1YZYA 3WYDA 1GPLA 3KJHA 2PO5A 1PKEA 3U5ZB 4V0SA 1W73A 2ARBA 2ERXA 2VJMB 1RQ7A 3ZCVA 2OV2A 3I8SA 2X09A 4FE7A 1F7VA 2CJYA 4FSDA 4BIMA 3MJTA 2VPPA 4O2AB 1BCRB 2WFF1 3KYIB 4J6GA 4META 3CLVA 4FR2A 3RFRA 2G40A 1T6XA 1YI8A 1E7MA 4H55A 2HLDD 1SXJC 5G0TA 5KCMA 3H7AA 4PHTA 3VZRA 2Q21A 3FBWA 2WU4A 3OUZA 2WNIA 1F6DA 4WVMB 3RRYA 4HQRA 4TMWA 3IKTA 5LPNA 3ZYZA 1E3WB 4OQFA 1SVWA 1AT1A 4BRUA 3FIUA 4FMCF 4Q19A 3UMVA 5GONF 2HSEA 5EZQA 1UPUA 4EJ2A 3K70D 1HEYA 3WXMA 3FHIB 1TU4A 3JQAA 3U4HA 5DGXA 2UUCB 2OO5A 5JZOA 1DAPA 3M6IA 5IAVA 5ICSA 3VD4A 1FTQA 2PSDA 3AYDA 1CRPA 2MEV3 3RLFA 4J0QA 4UZFA 3WISA 3HLKA 4A2QA 5LBBA 2N3ZA 2FLVA 3BE5A 2IEZA 4QU8A 1FCJA 1RUC2 3B8EA 1WCSA 1NJGA 3BJRA 2CMDA 2HHCA 5M34A 4G5OA 4N53B 1KI6B 2CNBA 2JLWA 1VE0A 5D51S 6NULA 1X0XA 3EZYA 4LMFA 2X1VA 1T5IA 1Y6RA 3QEMB 2O19A 4Y1YA 1EFDN 4D2IA 5BV1A 1L8LA 4ZI7A 3T52A 4ML3A 4D9FA 1G5RA 3PFIA 1TA4A 1ZUD1 1T26A 4Q1DA 4AI6A 1MEJA 1B26A 1RWQA 2O52A 4ALKA 4JBNA 3MTAA 4DA8A 5C8XA 5A05A 1QNYA 3JX9A 4C4PA 4ZU3A 3BXEA 4J4BA 4XWOA 3IT3A 4HPXB 3DV9A 3E48A 1JR3E 4IEOA 1W35A 2HMVA 2RR11 2E48A 3IULA 1A8UA 3ZKUA 5KSPA 1XC7A 1OC2A 1CP2A 5TEVA 4XGRA 1QYDA 4EPTA 3INNA 3V4ZA 4MP6A 1ZN8A 4BMEA 3G6WA 3UHJA 4KU8A 5F3EA 1M6YA 3ZWQA 2CFIA 1AGRA 4XR4A 1NUTA 3DA8A 1UOFA 4ZT5A 1Y7PA 2IKQA 3I52A 10MHA 3UK6A 4C5AA 3V42A 1MORA 2Y64A 1LGNA 3WMFA 3HXOA 2A1UB 5T4EA 4MA5A 4INJA 1OF4A 3OTFA 3LW8A 2EXHA 2R6FA 5B12A 4MQUA 3IDZA 3OKCA 3RRNA 3KQTA 1O77A 2R87A 1FDUA 1EAYA 5M5BA 1H4TA 1U99A 3EZNA 4BQ2A 3MJFA 1ZONA 3BUCA 3EXIA 1FTNA 1J84A 4QD2A 3RUAA 1BMDA 1QFXA 5IYZA 4I55F 5FBJA 2VWQA 4JLBA 5BNNA 4AJ1A 5FPHA 3E18A 3C7CB 2HHJA 4YP7A 5FBKA 2B99A 2YVUA 4NRDA 2WP8J 3QUAA 2Z83A 5KB3A 1XE7A 3T5TA 4KMMA 1E2DA 1KS9A 1BK0A 1T6YA 1K3IA 1H8HD 1O97C 4WQMA 3W21A 4DV3B 3D31A 3ASZA 2RGAA 1LPPA 4LQDA 4C0JA 2VAXA 4GLFA 5FWYB 2V4VA 2V9ZA 4N0PA 1C4RA 1PWHA 4UAUA 4NZPA 4PYQA 5BWBA 2PLRA 1JTZX 2PQQA 5JD5A 1X7YA 2X77A 2WYVA 3M6MD 3TXYA 1SQ4A 3G0DA 4QXOA 1Z8FA 2C61A 3PPVA 2IY9A 3USUB 4OI2A 1WCIB 3H11A 2F1IA 3LHDA 4IZ6A 4KH0A 2JGFA 3OUJA 2OPBA 5FBVB 3W59A 5HUJA 2ZYAA 4L22A 4ARXA 3JBG2 1PJBA 5FOTA 3QBQA 5F7OA 5AM4A 1OZGA 3G2HA 1GVHA 1NRWA 3L7OA 1REFA 2AZXA 1AR71 3WV5A 3ZGNA 3KJNA 5IW0A 3IH5A 3B7GA 4XFCA 1GUAA 1YDWA 2IDMA 3JWHA 4E6EA 4ZRNA 4X92A 3PHJA 1GRCA 1TO2E 2UYHA 1XP8A 2UU9B 1N8SA 1KVTA 4II2A 4Q0VA 4EABA 2EJVA 3H3JA 5B2GB 1QGZA 3LKVA 3GLFE 3GQVA 4M2LA 4B6OA 3VAAA 3CU7A 1WHTB 1C0KA 4ZXPA 1P17A 4MZDA 3BGDA 3ZU3A 1QH1B 1UX7A 5MHTA 4A45A 3JQGA 3U4MA 1W59A 1JHYA 2BLNA 1CUAA 2ADMA 1DQ1A 5TNXA 3TAYA 1V70A 1VP9A 3AKDA 3O7WA 1UMZA 3URKA 5A02A 2CE2X 1CIYA 1QV7A 1CRLA 4QT0A 2YW2A 4YXFA 3BA6A 3NNGA 1I80A 1GG8A 4QGSA 1IVYA 3G2QA 1IMOA 5H8WA 4L2IB 3VKLA 4OHRA 4BFWA 2XCRB 5JALA 3RQIA 1NBIA 4LEJA 1ZBDA 4DJDC 1KJRA 2VYVD 2GC1A 4RNDB 5CA6A 5ULLA 5DUVA 2ZR0A 2XBLA 2QJRA 5J3JA 3TQOA 2O8EA 2ZTNA 1W8IA 4D26A 3TNFA 5C3MA 1ENZA 2OGWA 4A7PA 1H8TB 2X4LA 1B14A 3K0AA 3HCDA 3MHPA 3KLBA 1LGYA 1QHYA 3J7TA 3DV0B 4HGZA 2G88A 3RS5A 2P9EA 1R081 4CIXA 1X1TA 3R5XA 2GJAA 3OWXA 2XWQA 1MAVA 4RH0A 5L4NA 2O6LA 4EKEA 4G0WA 1JS9A 2JHAA 3V1KA 4ZVVA 1HB4A 4ZPIA 1CYDA 1DBSA 5TMEA 1HSZA 3FDZA 1FYEA 4KXNA 4UNIA 1ASJ3 5GZGA 3VR4H 4Q4HB 3H11B 1OZFA 1E4YA 1MVOA 3NAGA 4OXKA 3K0FA 4GBMA 3TX2A 2VP0A 3P0HA 3IBTA 4CDWA 2JIRA 4OUDB 1E77A 1J2YA 3ZMOA 1KS5A 2DBZA 2C1FA 5CFQA 2EEZA 2AW3A 3E3NA 2D43A 1U8YA 4BPRA 3S0JA 4KXXA 1W8FA 3J8F3 4WZFA 4MUFA 3U1TA 1P6XA 4TLAA 2GCEA 3COJA 4KITB 4NFHA 4JP3A 2OWDA 1F35A 4UUBA 4D46A 1JALA 3PJRA 3NBXX 2C3MA 4UZSA 1X0VA 3ZWOA 3IT1A 3LTEA 3ZCSA 4JC0A 1KI3A 4MMXB 3M5PA 3CN9A 3F7TA 5KXDA 3JQGB 2B46X 1L4GA 2MSCB 2EU8A 2IXGA 2VPIA 3GGPA 3DT9A 2VNRA 1UZMA 2IXEA 2DU1A 3N3BC 5DCUA 1KMIY 5FZ4A 2CNAA 3WNKA 2W5FA 4BIIA 1ISFA 3PFKA 1UPTA 2WT4A 3G68A 3CJXA 5TQJA 4DIUA 3PXXA 5JPNB 1DAHA 1ZR2A 3AQ4A 4AJHA 4CKBB 4QGBA 3RVMA 4RVFA 2XUJA 5HF5A 3PNBA 3C3DA 4BVBA 3FBMA 1N75A 3MRVA 4JUBA 1VMFA 2G9RA 4UFJA 4QDSA 3A6PC 4S2HA 5I7EA 3WLJA 4ZYTA 3B3QE 1PGJA 2E33A 4CF7A 1LNZA 3DEMA 1GVNB 1DDIA 3L2HA 4ZV7A 1R1ZA 3THOA 4YQYA 3AESB 1VBB2 1VE9A 2IBTA 3NDPA 2R2GA 3WIBA 4H59A 2YC2C 3ZGZA 4XCAA 2FLKA 5KXBA 1O3YA 1UU6A 2R0HA 5FYBA 4ENQA 2E1RA 5KTSA 3A9TA 2D1YA 1VMEA 1QCYA 1U6IA 2ACKA 2ZKLA 1E0SA 4Y2HA 3EQ6A 5ICEA 4JIMA 3N28A 3WL4A 4DR7B 1G6KA 5L73A 4MPRA 3IR6A 2ZRMA 5FO0A 1JKFA 2PQMA 2WO7A 1E9RA 1E0AA 4BUZA 4TV8B 3FDZB 2Q5TA 2P17A 4G8CA 3AB7A 1HRI2 3NEAA 4FPJA 4YM1A 4I8IA 4IDGA 3GWZA 1O94A 3KAKA 1RXFA 1LTEA 3ANYB 3OFJA 3AHIA 1EAH3 1YDEA 1U4SA 2WS93 1Z2NX 1GTVA 4DSUA 2ZWPA 4M55A 2QQNA 2SCUA 3TZKA 2CV2A 2JFVA 3ENKA 4MRMA 2NO9A 3T7RA 1U3DA 5THQA 4JNCA 2WM8A 2ZEJA 2Y1XA 1MO3A 1T25A 3QNWA 2BRUC 2Z6VA 3UK2A 1S2IA 2NMNA 4X1YA 4Q3EA 4Q4Y1 4MYRA 1C0LA 4RULA 1J42A 1C29B 4DEXA 3IQFA 1ODTC 3BRQA 2RDSA 3WF4A 4IW3A 3FOBA 1IOWA 2QZ2A 3WOVA 3VPSA 2NO6A 3KTDA 4ALLA 2JAXA 4KQ9A 2VCBA 1JF8A 3J7MA 4JKOA 4LXUA 2QJFA 1LDYA 3T3IA 4Z4IA 5J1SB 1AQ6A 2CKDA 1RMU3 2XY4A 5T55A 3ME2A 2INGX 4KE8A 1XTVA 1DQRA 4ZZIA 4Q1FA 4Q0QA 3CKKA 1L5QA 3V8VA 4FONA 3AXSA 5IYYA 5G02A 5DXJA 4BATA 2PD4A 1WLCA 4EGSA 2NSLA 4XVHA 4AD8A 4M54A 3CY6A 2FSVA 4MWCA 3OTIA 1SCRA 1MOPA 1SCQA 3ZXEA 2FMUA 3GOHA 3NHKA 4I0WB 4CCMA 2FEMA 5CB4B 3IPCA 5ALEA 4U2BA 4MR9A 1JI3A 3GGCA 3VR4A 2ZAMA 2WI8A 5A5DA 4EN6B 5TSDA 2QMEA 1QE3A 4FYKA 4I5FA 3K1AB 2PZKA 1ZCAA 2PYDA 3ETPA 2EHJA 3CF6R 3EXFB 3ZZNA 3D64A 2OGTA 2WHXA 3THDA 3IKLA 4J6FA 2H1VA 4E4YA 3IAM1 1R66A 3B51X 5FZOA 1KIMA 2E2WA 2XWBF 2GJ9A 4PSDA 3KZNA 4B3FX 3ZXDA 5BNOA 2OK8A 4AQSA 4B3XA 2Y99A 2SCUB 4GC9A 1I2BA 2R0FA 4MRMB 3HVKA 4V0ME 1V96A 5F1YA 3ZXFA 3A6LA 3UWSA 4B4WA 2A9QA 4RORA 3TUJC 2YY5A 1N1SA 4QBHA 2DGDA 2O06A 1SUPA 4NOTA 4UVIA 2HBQA 4IW3B 2ZJ1A 1T4BA 3WYAA 4ZHNA 3A1EA 5HNKA 4OYHA 3NXSA 1EFHA 2IWRA 5TB5A 2EZTA 5D3ZA 5BWCA 4RK1A 2G9GA 1KQPA 3H5AA 1EK6A 4DUPA 1GQQA 4OU5A 5T64A 2VXJA 1PI3A 2FCVA 4KBGA 2P2KA 4UTXA 3E8MA 2JGRA 3FTEA 1KP3A 1VI6A 1U2DC 1G8SA 5KQLA 4CEHA 1OI7A 2RONA 4B7EA 1RAAA 3GUUA 2CUTA 5E88A 3A4TA 1KYZA 5GPBA 5HRAA 1O4WA 3NWOA 2V5YA 3A4YA 4RV4A 2W11A 5LWBA 5AJTA 1OXBB 4IQ0A 3SNMA 2JPDA 3LSYA 1XALA 3CLRD 5SZJA 4UREA 2ZJAA 3U80A 3ANSA 1GZHB 1Z7S2 1O7FA 5IDVA 1Q1BA 3JYPA 2YDYA 1E4EA 3NT4A 3ACHA 4AI3A 3ZLBA 4DMHA 3K8QA 4HB3A 2JNWA 2I2DA 1ISMA 5F21A 4QUHA 3ETEA 1XU7A 2QP9X 4CR6A 3JYOA 5LASA 3ZNPA 4AQ2A 5SZKB 3SVZA 1EVZA 2O2JA 3SH4A 4CFYA 3OFNA 5DO9A 4BZZA 2NZ9A 5MF6A 2LCFA 5GM1A 3MBWA 2ZFUA 2XJ4A 1FQJA 5BNOB 2O6HA 1L3BA 2BH2A 5CW2A 4YUYA 2ZA9A 4IG9A 4BHTA 4RMJA 5K8LA 3CONA 2A0KA 5DTJA 4GQIA 1QH8A 1WZUA 4Q4W1 3JSAA 3ABQB 5C8WA 4WHMA 3PITA 4DTCA 3RTDA 2IEYA 5KQSA 2FEXA 1A8IA 2DHEA 5IMSA 3BJIC 4FW8A 3WB9A 2IYVA 3MBKA 3RRXA 4BVGA 2FBEA 3T0IA 3KCYA 3S99A 4WD3A 4U0JA 4W63A 3ORQA 2H63A 2QL7A 4P5DA 2O0HA 1K9SA 2NU8A 3QFRA 1XTUA 1NKTA 3KK0A 1QX3A 5IASA 4DG5A 1S3FA 1N6RA 4LTDA 1K7YA 4PG4A 3ZIUA 4RPHA 2H07A 4JLOA 4URHA 2BPOA 4F8YA 2YV3A 3QOPA 3LFTA 2JD9A 1WBJB 3GUZA 2B4RO 1MR5A 3MIEA 3CNBA 5CH3A 1U0NA 5MN6A 2EFEB 1GGFA 3PUKA 1ZL0A 5JXWA 5H3HA 1CLUA 4CKWA 5FYHA 2RHDA 4RPGA 4ES6A 1F5SA 1JV2B 1HK7A 1CETA 1OHHD 2PEYA 4A0HA 1ZZGA 4BP3A 1HETA 5ALGA 3Q3CA 4UTZA 1JPNA 3W2EA 1ZNWA 4O3FA 1JKJA 1OQDA 1YQ8A 1SKYE 2YX1A 3HSYA 3DOIA 4IGPA 3R6SA 1MAUA 1B35A 4MDFA 3B12A 1E4EB 1YBHA 1P4HA 1P1HA 5DG2A 5TRTA 3BWYA 5JZBA 2IXDA 2R8EA 4XAQA 1AL21 3KKPA 4DKXA 4OY3A 3FH0A 4TWBA 4OK3A 3KQYA 2D3TA 1UQUA 2YNMA 5DJ5A 5TT1A 3HEIA 3DW3X 1Z0UA 5FI5A 2R7EB 3QOXA 2VMHA 5JDIA 2V8OA 5ENZA 1GOFA 1IK4A 3GAAA 3BOWA 2JDYA 1V0JA 3TN91 1UAAA 5FZ7A 1O87A 3P5SA 4DKJA 4ZODA 4YGBA 1XJ5A 1V6NA 4JQYA 2EG9A 3LVRE 3UZUA 3U1XA 4A10A 1EK2A 1VKHA 4IE5A 1TO6A 2FPOA 2AC1A 4QTZA 3UKJA 1DT3A 3O2SB 3WSWA 3IA7A 2I2SA 4ZO6A 3ENVA 3T5BA 4Q34A 5T4BA 4JI0B 4ARSA 2Y4NA 2GM9A 2G9FA 3BKZA 4K9PA 3KOUA 4MI6A 4WERA 3R4UA 4ZYLA 1V3UA 1V48A 4JLAA 4Q7QA 4NR1A 1W5TA 4W6ZA 3CJQA 1Q83A 4R31A 6AT1A 1EVIA 3K72B 4FFVA 1ZRSA 1E6EA 1V7ZA 2R5FA 2GMWA 3VJLA 2J7KA 2YYZA 2C57A 3H1BA 3NEJA 5LIRA 5C8CB 4Y9TA 1X87A 3NAPA 2XCLA 4UKDA 4KIGA 4HONA 1MENA 4WIAA 4L4RA 2JGJA 3ZVRA 3CNQS 1UUFA 2GPJA 4EOGA 1KYQA 2AN4A 4FZRA 4D6YA 3BH7A 4Y0VA 2A7QA 2J9RA 3ZKAA 3THWA 4K6FA 5FPPA 4MEBA 1V8DA 2P9ZA 4OFBA 1T0UA 2K6GA 2I6QA 4EV0A 2DM6A 3KLSA 4QU9A 5CG9A 1E2LA 3NRJA 4KXFB 4EW6A 1G7TA 3G8BA 3VKGA 3DO6A 2VR4A 3KKNA 1JKJB 2FRDA 1QIGA 2DKFA 3DXZA 2CBXA 3ABIA 1B35B 4A82A 2GTHA 4BP8A 1KZ9A 2XBMA 2GVDC 1G20A 1GTSA 1UX6A 2VBDA 5IVEA 4IHJB 3K4ZA 4CIBA 2I3DA 2VPVA 2V1XA 1L5HA 1XZ8A 2GWHA 5KHGA 2UZAA 2I3BA 3BS4A 3T0DA 3V65A 4NZNA 4GI2A 2YY7A 2I6SA 3KHUA 3N2GA 2DCKA 1JEQA 1T2VA 1OYVA 4F4HA 2QVSB 3EVDA 3TI7A 1JS1X 4KKXB 1YVDA 4ASMB 4HX5A 4LOHA 1WVIA 2W37A 4BX0A 2HK6A 2V6GA 4LSGA 4O9GA 1SC3A 1SULA 1Q0ZA 5D7NA 4X95A 1Z5ZA 2FF7A 3V1MA 1KQRA 2IOYA 1F8YA 2VPYA 1JIVA 2WWFA 3DGFC 1IG3A 4P4SA 1XEWY 2QGFA 1UJ6A 3UMBA 1CV2A 4WGFA 3VR1A 4J4HA 3DXUA 5IKEA 2P1ZA 3DBLA 4XF9A 5JR7B 4ANFA 2ETXA 3BIJA 5E4TA 2OM6A 4ODIA 5DT9A 3GGJA 4L11A 2R68A 4LLOA 5A4MS 4RMGA 1JZ8A 2VBCA 1YFKA 3A4VA 3E9MA 4EPVA 4KAFA 3SC3A 3JPYA 5HRCA 5LVAA 2UURA 2VPXA 4HUQA 2QTNA 1PWYE 4CP1A 2PUFA 4E08A 3G8DA 5I93A 1LK0A 2PMWB 3A4UA 1GMMA 3WOHA 4PCUA 1ZX5A 2PTGA 1C0PA 2QY6A 3WNQA 1J56A 5EJGA 1SLLA 4Q3OA 2XD4A 1YOBA 1B8PA 3VKFC 2JGNA 2NVOA 2F4PA 1W2WB 3PHBE 2WVHA 1PJAA 5G4LA 2F3SA 2BGWA 3LUPA 4HDOB 3GPLA 4BJHB 4XZUG 2KYRA 1AV7A 4YDSA 5EJ9A 4GPD1 3VO8A 3IN9A 2W93A 2C0QA 4QLAA 4MUBA 2F59A 5FL7D 1U2TA 1Y9ZA 4WACA 1L4MA 1YJAA 3NAPB 1PO11 3WL8A 2DWQA 2JAHA 4JBGA 1GPWB 1JMVA 1KITA 1FZQA 1P7VA 1NC3A 2LGJA 2BEOA 3T0BA 1J7JA 4WRRA 1R0RE 1WG8A 2LV8A 3PR2B 4ZQBA 1Z36A 1U1IA 4LVCA 2PKYX 3THWB 4MV7A 2X1LA 1CLEA 1S1MA 2VP6A 4MQ5A 1B0PA 2I3AA 3GJSA 4BMPB 3LQCA 1IIRA 3KPYA 3V8NA 2IPOA 3LPGA 4XTMA 2POQX 5BV0A 1KE2A 1IN7A 3WQQA 1Z9BA 3VSDA 1L5HB 2NVBA 5LP6F 1BJRE 1NU6A 1ILWA 1WMEA 2E21A 2YICA 4ZV4A 3IIIA 1FP6A 3ZFFB 4LHZA 1JFTA 3OCXA 2DTWA 2QEQA 3HEAA 3EEQA 3VZKA 4QPYA 1XEWX 5JJBA 1NW5A 2QNRA 1VBE1 1C81A 1YTUA 4IRUB 1QVRA 1ICEA 5C52B 2FUG1 5K01A 4UYBA 2PHXA 1ETUA 1YS9A 4U7PB 3W5DA 1AR63 2FZGA 1VBD1 1JWLA 3HWWA 1H0RA 5JRJA 4IQ4A 3Q41A 2NTYC 3KF5A 1QIHA 4EO7A 4BXFA 5KNDH 5L7TA 3DBLB 5EYXA 4FQ5A 5FK7A 3PCXA 3HN6A 4RESA 3BFPA 1PR3A 3NC1C 3IIKA 5GGYA 3T15A 4QJ3A 3DPSA 2NZ2A 3EDCA 4YAUA 3TJRA 4PONA 3DFFA 2VMGA 1A50B 1J4AA 3LGXA 4LZAA 3L5KA 1PWEA 4RVNA 5FV7A 3I05A 3GDHA 2IXFA 1D3AA 2IFWA 2VF2A 3MTJA 4IXLA 4ITVA 1Y7BA 3OZDA 3SQXA 3AW8A 1D8TA 3ROTA 4X1IA 3PHIA 2EXJA 3ZSLA 4AUEA 1LLQA 2GN6A 4X6RB 4V0OA 5L19A 3AP4A 4Z4QA 3LXRA 2CGEA 4XZPA 3VR2A 1QJY1 1G7SA 4F0JA 3K20A 3T3HA 4XGNA 1JR3D 1U5BA 2YV8A 2NLRA 1U94A 1WD7A 4KMOA 1L9KA 1XN1A 2VS1A 4L6CA 2P2GA 1TK2A 2H2AA 4N7IA 3FGNA 1LHOA 3RBZA 1U0OC 1PQWA 2WWXA 2XVYA 1XNTA 3HCBA 2Y0EA 1ISJA 4A73A 2NU9A 3H0OA 3O0DA 4EVSA 3BVPA 4FKZA 4DNPA 3TQIA 5JLAA 4BVEA 3L8MA 3U11A 5AOCA 1L5SA 3VDDA 2WF9A 4H6WA 1Z5GA 3LDRA 1PV1A 4Z1VA 2HYIC 4K7JA 5LZ7A 4B76A 4F3RA 4C30A 4LC1A 3F78A 5LQKA 3B6JA 3TL3A 3BGAA 2I65A 2D97A 4O4LF 1I10A 4KQ6A 4QTXA 1XMQB 2QNIA 3FLBA 1MVNA 1U8CB 3P2MA 1NW7A 1PVC1 2ZPXA 4L07A 2M98A 2WYUA 3KQRA 2ARKA 1U8UA 5EJIA 1W8DA 3ECQA 3UT0A 5H68A 5HBGA 4ENWA 4CEWA 4DZZA 1LBSA 5CFNA 1X2EA 2AX3A 3BIFA 2W95A 3SXUA 4DIDA 5B55A 1O4YA 1OUSA 3PX3A 2X0FA 1DAFA 1TYBE 4JNKA 1P1RA 1OGJA 4EZ4A 4DDMA 3L1UA 1LI7A 2B1GA 1U3CA 2J6CA 4HHEA 3I5AA 2C83A 1T4DA 2A5ZA 1ADYA 4LO4B 2UWAA 3VNBA 2PRYA 3QPAA 1VBA3 3CRMA 4IDBA 2RKOA 2P3QA 2QPTA 1MS1A 3IP6A 2GH8A 2B8NA 3L9WA 4MWTA 1QLWA 4FQ7A 5JTUA 1SC6A 2C7VA 4MGYE 3ZD8A 4XSHA 2BFFA 4IWXA 3V1TC 2NYAA 4DIMA 4FPYA 5CT8A 4OPMA 1A4XA 3OA0A 5FPKA 2JAPA 2AZDA 4Y22A 4QDOA 1PIV2 1NQXA 3D9QX 4B44A 2XTAA 4N5HX 4B2LA 1KAGA 3GGGA 1JHDA 1RUJ2 3VUOA 4YV2A 2EALA 1N2BA 1YZ3A 2Y38A 5KTPA 2E55A 3RJTA 1QO0D 5CG1A 5FWXB 4G4SO 1GPH1 1O6CA 4HWKA 4DR5B 3UATA 2O20A 1VR3A 2PDAA 4YHHB 5KVQA 2PCJA 1OILA 3GIDA 4JC8A 3T4EA 2WFPA 3LEMA 1L7EA 1W9WA 5DNYB 1X7XB 4ZPXA 1SXQA 4FAHA 2ZYVX 3W5BA 2C59A 4NPMA 3H7JA 4RIFA 1EFPA 1U28A 3IRUA 3H5IA 2E6KA 4Z9YA 3NOQA 3VR6H 4HYTA 3K7EA 4ZWNA 4EDHA 3OX2A 1XV5A 3L6DA 1YS6A 1EUTA 2PRJA 3HU1A 1CY0A 5AVZA 1T2AA 2NU9B 4KXMA 1ODSA 1Y8ZA 1ZEJA 3KC2A 4EUSA 3EJ6A 1XJQA 4RWZA 5JNLA 4X45A 3VDDB 3ETNA 3ZHOA 4PS1A 4Y4YA 5BSKA 1HKUA 4H7MA 2NU7A 4QBTA 3I1YA 1SFYA 3AF6A 4BGVA 3ZYJB 1XEXA 3NNJA 3T54A 3M5WA 4XABA 3LBFA 3P32A 4RBNA 3L9JT 3TAHA 5KNDA 1C7JA 4GH5A 5GJVC 3ETQA 4PC2A 1PN3A 2IEDA 4DNYA 1S55A 3KWLA 4D4GA 3ZEIA 2X5IA 2GKSA 3D8NA 3WHIA 3VHQA 1D4M1 1LESA 1TYCA 5BRNA 2DYKA 3F9RA 4HG6B 4IUCS 3SXUB 3HJGA 1NX9A 1K3UB 3EB7A 1I9CA 2H65A 1VM6A 4F5WA 3KO8A 4CDXC 3OQHA 2I7CA 4B31A 3AHDA 5IT0A 4W6YA 2GAAA 3ROPA 2OECA 3PA8A 1ACJA 3LSTA 4CMEC 4Q4LA 3PIJA 3E7XA 4LQRA 1DAIA 1C9EA 2PTHA 3E23A 4CR7A 2C4KA 1FSFA 3DAHA 3OP1A 5AFBA 1FTGA 1E5RA 1EFAA 1W29A 3MJEA 5DUWA 1PRYA 1RUI3 4KQXA 4L95C 2QPLA 1MIHA 1UU5A 3DULA 1VKNA 1W0KA 4TTIA 3VPHA 3DL2A 2ZVQX 3VNVA 2B4AA 3PC8A 3ZY3A 2BKAA 5LQAA 2EEPA 3TEJA 3RYCA 1W9TA 1LXCA 6LDHA 4X64B 3S57A 4IDDA 3U7IA 3TKAA 2D6KA 2QRVA 4KXUA 1VG9B 3N7LA 1A3KA 4WCFB 1QHEA 1DC6A 3PX2A 2VHUA 3QP9A 4LC9A 2V7WA 1JG4A 3U37A 4HAZA 4HVTA 5GV7A 3COZA 5SV8A 1WQ4A 4Q15A 4BJ0A 5JWRA 4RHFA 3NYWA 2IEGA 1Q16A 1J1IA 2GASA 1S0JA 3DQZA 3ER6A 5LNK1 5AK0A 1EFPB 1FMFA 2A4MA 2QM0A 1P18A 4H1TA 2R073 4PZDA 3JR3A 3SIXA 1P4AA 2EAKA 2O2CA 4ZOBA 1D4ZA 1RCUA 2AUTA 1M2JA 1ICIA 1WMDA 3R0ZA 5LMZA 2W1QA 3L9XA 3B7WA 2HU8A 4AJ9A 2NU7B 3AUUA 3BN6A 4I5IA 4QOFA 3BJZA 1GKBA 1PVC2 2PX6A 4I9HA 1BVHA 1NBEA 3LXXA 4NMMA 1WRBA 3SDSA 3KQQA 3L0CA 1V3QE 2PX4A 2WB2A 1DLLA 3C7KA 2Q1UA 4GKAA 3LYUA 1JGTA 1B1CA 2ZVDA 4H7EA 2FPGA 3HDQA 3KQSA 4KFSA 5HIKA 2Q5QA 4B6GA 2X5IB 2IJGX 1A7AA 5A3SA 2ZVPX 2QRUA 1PWZA 4ZYWA 3ZE9A 4YR9A 5F3WB 3UGFA 2WNVB 5ESDA 1ML4A 1E2EA 1VB5A 3B9BA 1M2KA 1GOHA 2JJ8A 4I7EA 1ABBA 3DUFA 1U2GC 3LC1O 5ANRB 2HEWF 4HZUB 2R8YA 3V00A 3ONEA 4TUYA 5IN4A 4Z51A 4DY3A 1P62B 1W8OA 3M9LA 5AUPB 4LGCA 3W3ZB 2VNJA 4Z92B 2VOTA 2RK6A 1EA7A 2J0VA 3LUCA 1E3LA 3G2NA 5CITA 2QQEA 2FDKA 3SKYA 3HACA 2ONZA 1R5OA 2A9KA 5F4ZA 1L3IA 4Q03A 3HHEA 1S0FA 4QVGA 4B40A 1WUJS 5ES3A 2YFKA 4Q39A 2BP6A 6ADHA 3RK4A 1GA4A 1CESA 3SOPA 1SR8A 4XACA 1L7MA 2QRVB 4QUKA 5B4XA 4KMSA 1R10A 3VR6A 4JCKA 4DGSA 2HWB3 3M8LA 1N0HA 4NESA 4Q8LA 3I3MA 1XK6A 3FFTA 3DXYA 3WXPA 1F06A 4YVSA 4GC5A 3DN7A 2RH5A 4KQEA 4PI2A 4TTRA 2B7LA 3LIPA 3QPUA 4MS4A 4P31A 3CR3C 3FOWA 2R1BA 5I9BA 4J2TA 1NMQA 4EVIA 3HV0A 1M6EX 1TE2A 4I1IA 1CHDA 4MR7A 4YW4A 5IAEA 5J36A 4R8RA 1LQUA 1JFLA 3LF2A 2B37A 4DCSA 2A3YA 1BCSA 2R84A 2XYGA 4YRBA 3UTDA 3ALQA 1SIBE 1JAZA 3DCNA 1DS6A 4I3PA 1C3XA 4PSVA 2BMJA 5A4KA 1EWYA 4NCAA 4YW5A 4CE8A 4R98A 5KHHA 1E2JA 1GV1A 3CLPA 2WJHA 1ZYBA 2C2WA 1AXZA 3A3OA 1D4M2 1P73A 4HKWA 3V0AB