2O14A

X-ray crystal structure of protein yxim_bacsu from bacillus subtilis. northeast structural genomics consortium target sr595
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
354
structure length
354
Chain Sequence
KVYQFDFGSGSMEPGYIGVRASDRYDRSKGYGFQTPENMRDVAASGAGVKSDAVEFLAYGTKSNNTFNVDLPNGLYEVKVTLGNTARASVAAEGVFQVINMTGDGAEDTFQIPVTDGQLNLLVTEGKAGTAFTLSALKIKKLSDQPVTNRTIYVGGDSTVCNYYPLNSSKQAGWGQMLPHYIDKHTFQVRNMASGGQIARGFRNDGQLEAILKYIKPGDYFMLQLGINDTNPKHKESEAEFKEVMRDMIRQVKAKGADVILSTPQGRATDFTSEGIHSSVNRWYRASILALAEEEKTYLIDLNVLSSAYFTSIGPERTLGLYMDGDTLHPNRAGADALARLAVQELKRQGIAGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein yxiM
publication title X-Ray structure of the hypothetical protein YXIM_BACsu from Bacillus subtilis.
rcsb
source organism Bacillus subtilis
total genus 110
structure length 354
sequence length 354
ec nomenclature
pdb deposition date 2006-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13472 Lipase_GDSL_2 GDSL-like Lipase/Acylhydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 2o14A01
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 2o14A02
2VXJA 2WAAA 2C24A 2APJA 4K7JA 4JJ4A 2HSJA 2WAOA 1W9FA 4Q7QA 4OAOA 5HOEA 1GWKA 1GWLA 2K46A 4JKOA 4LK6A 2LROA 1JRLA 4CP9B 4HF7A 4BQ3A 1OKOA 1W8TA 3F95A 3UT0A 4LKDA 1BWRA 1WMXA 1W90A 1ZMBA 1L7LA 1ESDA 2Q0QA 4RW0A 4S1PA 4LHSA 3SLRA 4M8KA 4RSHA 5D21A 1WCUA 3DT6A 1OH3A 1ES9A 3C1UA 4YW7A 4LJHA 3U37A 3DCIA 1W8WA 3KVNA 1FXWA 1K7CA 3BZWA 3SKVA 1VYHA 4YWAA 4LKFA 3MILA 1VJGA 2O14A 4PPYA 1W8ZA 2WYFA 1PP4A 1IVNA 3DT9A 2VPTA 1FXWF 4A6SA 1V2GA 5CD9A 4CP9A 4K9SA 1HN0A 4K3UA 3DT8A 1BWQA 5BN1A 1UOJA 3W7VA 4LK7A 3ZYFA 4DEVA 4BQ2A 1GWMA 1DEXA 2LRPA 4CPBA 4H08A 5JD3A 1WZXA 3PT5A 4BQ4A 4JJ6A 5B5SA 3ORJA 5A4AA 1WABA 1ESEA 4HYQA 1ESCA 1J00A 3P94A 3RJTA 4OAPA 1V0AA 2Q1FA 1U8UA 4TX1A 4XVHA 3DC7A 2W9XA 4JHLA 1BWPA 4YW6A 4LKEA 4K40A 4NRDA 2WABA 4Q9AA 4BQ5A 3HP4A 3ZYHA 2JWPA 1W8UA 4AL9A 4CPBD 1DEOA 1YZFA 1Z8HA 4I8IA 3ZYBA 4JGGA 4IYJA 2KR2A 2Q0SA
chains in the Genus database with same CATH superfamily
1VSQA 4O33A 3A9SA 4DARA 1R0YA 4II3A 5T4BA 2FP3A 2LZ0A 4F21A 4FPLA 1OKOA 2VF4X 3FCAA 3BH0A 5JUVA 1JAZA 3OM8A 3EF1A 4HLCA 3R74A 3BBPA 4WK2B 3ET5A 2FOIA 4MR7B 5JVDF 4YONB 1J4AA 2ZXFA 4L11A 2D5CA 2V6JA 5ITSA 3G8CA 1MEC2 4EGFA 2VYNA 2Y38A 1B6RA 4O4IA 3ESXA 1KRWA 3MWKA 2JKXA 1DAIA 2PEZA 4BZXA 4LJSA 4RPJA 4AQDA 3ABZA 2EA7A 2VW0A 3HVIA 2ERXA 3F90A 3ZHRA 3TI7A 1RRKA 1QIGA 3NMBA 5FV3A 1ALYA 2GUGA 3LH5A 1Y8RA 1W7AA 2W6MA 5JH7F 4IMPA 1WW6A 5K20A 2HIHA 4COWA 3ROEA 4CDUA 4N65A 1FCJA 4FXOA 1QGLA 3JR3A 3PHBE 4EQZA 1E9EA 3O0VA 3S27A 4DLLA 4OGFA 1W6OA 4L92A 2UUBB 1ZIXA 1RNLA 1UBNA 1CVLA 2B1JA 2RAPA 1KDOA 4TWTA 3BHJA 1G8JA 2CHVA 3JCIA 2JI4A 3VBSB 4B1FA 3H4MA 5KJ1A 4YAEA 2W11A 4Q37A 2Y1GA 4HNVA 2PHWA 4LJ4A 3K2BA 2P1ZA 3F7TA 4KNYA 3IAXA 3GX1A 4C3VA 5JZGB 3AFNA 4KH9A 1WZNA 3RU7A 1Q83A 1AV6A 5A7PA 1VLLA 4V0KA 1G8WA 4CLOA 1T26A 4I9NA 4C30A 1AYN3 1PSZA 1CZLA 3K05A 1W85A 4K46A 3PL1A 2CDNA 1QXPA 3WNDA 3SYLA 1N3QA 1V7PC 1YIAA 1DEOA 1SG0A 4E30A 1Z4QA 2CHFA 3JZMA 2Y2VA 3AF0A 3OM0A 4FMCB 1F2VA 4LHKA 4XUQA 4BWVA 4MEJA 5EVJA 4GMP3 3OGJA 3JW8A 2IXHA 2Y6FA 3RFUA 1ULHA 4KRXA 4NBKA 2P2SA 1F0YA 4HBGA 3FWKA 4NZ9A 3OWXA 1TGVA 3AEUB 3GCZA 4QB2A 5FZKA 1D2AA 4JI6B 3HV2A 1M6VB 1TZOA 2P5UA 4HFJA 4I66A 3DPUA 3EPLA 2VOXA 4IFEA 5A05A 1M2VB 4MA0A 4A7PA 5ANNA 4C03A 2X15A 2Z3WA 1GCUA 3TYXA 1T35A 2R60A 2XRZA 2Q3LA 2ODAA 3U7QB 4XJZA 2QTCA 3UMJA 1XJAA 1CX4A 2XSZD 3HXKA 1UANA 5EMKA 3H5AA 3EPRA 4KQJA 2Y1FA 3T9BA 3FTDA 1XE0A 3ROQA 3CUYA 1OFGA 4HWSA 3ODPA 1P4JA 3OX1A 5K9YA 3SKXA 3TG8A 3K70D 3CQ9A 4EJSA 1AX1A 2RJOA 4N9WA 1E5XA 5C8XA 1DLLA 3V55A 3ZD7A 3D4PA 3HWRA 1AMNA 1T5OA 3RT9A 4ZN6A 4O59O 2DMRA 1Z0FA 4L99A 5LP6A 3BXOA 2XWJB 1QGUA 2IXTA 1O97C 2Z57A 4L5CA 5EY5B 4XSVA 1JG1A 1V6KA 1FPN3 1V7CA 3ZK9A 3UW1A 2AOWA 3UMSA 4K9DA 2BHNA 3C6XA 4MK4A 2O8QA 3MYXA 2OPBA 2V9CA 1SCDA 3H84A 1LRHA 4YPJA 2J4CA 2B5OA 3IQIX 1PW7A 3CF6E 3IZOA 3NWBA 2PQ2A 5TT0A 3BMQB 4KQ1A 1CAVB 1DG6A 3FSJX 1W96A 3HH8A 5JHHB 4JMPA 4RQPA 2VZTA 3NUQA 3LCRA 4OV6B 2NO1A 3QOPA 2ZQZA 3SFTA 5H9RA 1J23A 3UMCA 4M8SA 4DG8A 5D8AC 2OQ2A 4R8SA 3UOAB 4IQ4A 1Q20A 2BPOA 2OFWA 2V1UA 1R16A 4ZHNA 4W6QA 4DLNA 2SLIA 4XIKA 3FGPA 1RQRA 4NPAA 1MV5A 1W9FA 3FMGA 4IJVA 4Q48A 1WA4A 4BE7B 1HE2A 2CE2X 3HG7A 1OBOA 2R8XA 3WHTA 4HSLA 3ZE9A 1KR2A 3M6IA 4ETIA 5AHOA 4WXYB 2VOEA 2IW3A 4BYGA 3E81A 5FH9A 4MPJA 1YS6A 4GL2A 2WT9A 4J3NA 2FWNA 3W5BA 2EW2A 3CWQA 4LY3A 3ROXA 3LX4A 2CXNA 4K2HA 3JALB 4AX4A 2HBQA 1W5FA 2BZSA 2HMVA 1QXJA 1WABA 1WB4A 2HO5A 3OH8A 4L0DA 5F5QA 2MOKA 4H35A 2HU8A 3WHIA 4RH1A 3MLBA 4YT4A 3QU4A 1PR5A 1YVUA 4AVAA 4WCFA 4ZOBA 3ZCRA 4LJAA 1ABFA 1L8AA 1FS4A 2P3OA 3W5DA 3I12A 3N2IA 2Q7OE 3WWCA 4YVWB 4FKZA 3L8FA 4Z4EA 1DQ4A 1GUZA 1Z74A 4X3CA 3WP0A 1XDSA 3OBAA 4RK6A 2PH5A 4CNQA 1I5ZA 3X1XA 2G7MC 3KUKA 1RC8A 3OUHA 4PXYA 1OXKB 5EJ3A 3MIEA 4KQGA 4TS9A 1X70A 1GTZA 1XKLA 3VPCA 3H42B 1W2WB 4D3WA 3NKFA 2JJQA 2PUHA 4HFSA 4RZXA 3IAQA 1QQP1 4RR3B 2PTHA 2DJ5A 1N6OA 3EVGA 1RHUA 4NVRA 1OUMA 3LA7A 1IM5A 5AM3A 4FOQA 4EN9B 1YFYA 1RBYA 4EPWA 4ZCRA 4JSTA 3DEMA 3H1MA 3FRHA 3W8FA 3E9YA 2ZB2A 2WV9A 3JTMA 2JCYA 1R5OA 1W4BA 4G3YC 3CLTD 3IE1A 1ZK2A 2AXPA 4L02A 4UAUA 4TTVA 1GTSA 2QMUA 2VAMA 1R9NA 1OU0A 4Y5SA 3GLIB 3CJIC 1HEYA 1RLOA 2YN0A 2AMYA 1M83A 1W36D 1M6NA 3WIOA 3AVPA 3DMYA 3GNLA 3H1BA 1P3Y1 1Q0HA 4MRAA 2VGDA 4BB5A 2BFFB 3EVFA 3HBJA 3I9JA 1DOAA 4I3GA 2MDTA 1UXOA 1GRRA 1TD9A 4UZSA 3E6CC 4NICA 4XWOA 4INOA 4WJKB 4EE2A 3T9AA 2D5LA 2WUHA 3ZFFA 3UH1A 4AZ0A 4UTRA 3KS9A 1LBIA 1H94A 1WD3A 2O8OA 4IXMA 2HZ7A 3IS3A 4WLEA 1FYFA 1DIWA 3G1WA 3GGOA 2IY7A 4ITUA 4RJJA 1ZZ7A 3E97A 4A8JA 3A1CA 5AC91 1C1LA 2JLQA 4R1QA 2RHTA 2G70A 4B3SB 4FONA 3VKFA 1C3JA 2PFKA 4RZIA 4BNDB 1JHRA 5CB4B 4UUOA 4L0PA 4H1WA 4KGXA 1D2SA 4TKMA 1MA3A 3E05A 4J0EA 1W581 4YJ3F 4UU7A 4KJXA 3Q8CA 4I1PA 1SCUB 1UZZA 3KYJB 3KWFA 1ZRCA 3C8UA 2Q2NA 3DAGA 4KIUA 2WQ6A 1YR7A 1V8OA 1J7JA 2MSKA 2V3CC 2ZRHA 2C59A 2I6SA 4B2YA 3F5QA 1I4EB 5CNJA 1HDZA 4COYA 3TE7A 3EFHA 1EDOA 2GLXA 3DJFA 4MW2A 1EV12 5FO1A 4WXEA 2WI8A 1CESA 2BDUA 2EYQA 3WR5A 4ZO6A 1DJPA 1QC5B 1S96A 1G21B 4LBWA 4OQPA 2PDAA 5FOJB 4PLFA 3RM3A 3Q4GA 5B1IA 3KC2A 2MIIA 2WWWA 4U7PB 4D26A 3VGJA 2XMPA 2JAXA 5L7TA 4RMIA 3C3JA 4IO1A 2X05A 2FUG1 1E8NA 2C3PA 3CLPA 3G0GA 4CFZA 4ACBA 3ZZUA 1UBKS 3GXBA 1NX6A 1CN1A 2EYUA 4QXAA 1KSJA 3N53A 4NHKA 3IAM1 3J7NA 1WKYA 3FRIA 2VIIA 4LW8A 2HWKA 4CL3A 3T99A 1K7EB 2AMFA 1IKQA 2AEZA 3F7OA 4Q7EA 1PWEA 2WIDA 3B9CA 3CZCA 4FCWA 2CHHA 1IKPA 3QPCA 1GCIA 1ZL0A 4WOBA 2GK7A 2C9MA 3OO0A 4QECA 4WGFA 1U2GC 4DAOA 3FLBA 4S1WA 2BGKA 2D3TA 2QJFA 3WGKA 1T5HX 4I09A 5J4HA 3VTFA 4PLMA 1H0BA 3OPYB 4LGCA 2QI9C 4EG6A 3HJUA 2GN1A 4XCAA 1HQLA 1RHJA 3IDQA 2QAJA 2R6GA 5F6KA 1YFLA 2J59A 4JLWA 3SCZA 2H5JA 3MEPA 3ZFGB 3L6RA 5B6JA 1OQ1A 3QLQA 3ENQA 4M3CF 2WTXA 2R9VA 2K6GA 2EL9A 1ODIA 2ZTSA 1RM4A 1NY5A 4GMXA 2QVBA 2ZTHA 2PXHA 4DMFA 4HNHA 4L6CA 3GJAA 4BYMA 1X38A 1DDLA 3FCEA 2X0EA 5DH9A 4G1BA 4QTZA 4JYPA 1Y6RA 3W6OA 1RXFA 5IJAA 3A3OA 3A2KA 1F51E 2X1VA 4DR6B 5CJPA 4CR7A 5JXWA 4P5HA 8OHMA 3VZLA 4XM1A 2QV0A 1CT9A 1F2UA 2WTMA 4B9AA 3N59A 4L85A 3AI7A 1GAXA 1FNSA 3M4ZA 1Q1ZA 1QGYA 4S04A 2XCRB 3VC2A 4RHFA 1FFGA 4GM0A 2CL7X 4WW0A 3THXA 1FVHA 2GFIA 4EGQA 4KO8A 1B8NA 2WNUC 2PHUA 4JLJA 1W87A 3NRUA 4IIYA 3FN9A 4UBOA 4PJYA 3QKRB 4P22A 3B6IA 1W5AA 3JQEA 3STVA 3BB1A 3PIRA 2BERA 4E21A 2ZYRA 2PAEA 2Z08A 1D5CA 3BMNA 4QLBA 5EZ6B 3M5PA 4HLTA 4DWVA 1OAKA 3TIVA 5FBHA 1NCRA 2XF2A 4JJGA 1N3OA 4GIBA 1JA0A 2PSJA 1C7RA 3KQSA 4MX8A 1E69A 5F35A 1XYYA 4NEHB 5JSKA 4IDFA 1PG2A 1NFQA 1ZGZA 1Y4DE 4X20B 1XC6A 4QPIB 2VDLB 3BFJA 4EWDA 421PA 3Q7EA 4CKEA 5LA6F 3HVUA 4ZYWA 2CB9A 2F6BA 2NZ9A 1Z7S3 4ZOQI 4WZBE 1U0JA 3LECA 2WT0A 1E18A 4GXNA 1QKKA 4DTIA 4WI1A 1DJQA 3A6LA 3EJWA 1JKMA 2CKMA 3TNYA 1XMSA 3MTIA 3NTXA 3RLIA 1W6PA 1Z5VA 4F4DA 1ZUHA 3LLSA 3MEQA 4BX0A 4IIBA 3PSHA 3CLSC 4Q4AA 5FXWA 2JG8B 2HHJA 3VPSA 1FOEB 4YP5A 2I2WA 5E8AA 1O3RA 2WPDA 5CADA 3SYTA 1G38A 1JG2A 2DWPA 3U4QA 3BB6A 1V6MA 4ZK6A 4NR1A 3U1BA 3DAPA 3FE2A 2ODBA 1V48A 1KY3A 5DUVA 2A3WA 3JQAB 3WDTA 4PC1A 1PMJX 4XQEA 4UD6A 3KSCA 1KK0A 4P5PA 3WGNA 2W6PA 3TFWA 3V00A 2IHVA 1FT9A 1OSGA 3B1ZA 2CTVA 1AXEA 5LBUA 2Q7DA 2J3JA 2VXYA 5FDFA 1UC4B 1SVIA 2Z9BA 3ZQJA 2PJDA 4NBLA 3LPCA 2RR11 2P5TB 2HK8A 1NJ8A 3LFIA 1U2DC 4ZEXA 4JHXA 2DZDA 1G5HA 5KAPA 1MDFA 3FVRA 1PT6A 3WLOA 4LWPA 1G16A 2ZZMA 1Q95A 2X4DA 4DC1A 4UCXA 4BMCA 4J43A 4HGYA 1MJFA 3NBAA 2P9YA 1BGVA 5CCDA 1VZ3A 5CG8A 1Z5GA 5F3CA 3CZ4A 2XDYA 1HRI1 3JAMA 3I6YA 3L4SO 4LYAA 4ON9A 2WYIA 3TR6A 3QD6A 4KUHA 3ZS8A 3G13A 4FC7A 3FPSA 3KV9A 5KX5A 3OGVA 3ZHTA 3O0TA 3EGXA 4YRZA 4F5EA 2XUGA 4P80A 5LBCA 1VIAA 4N0PA 2OESA 1W5TA 1MH1A 1T4CB 3M7IA 2FSSA 2ORIA 3O4RA 4RJIA 3NHFA 4HPJB 3A9CA 3D6FA 1DVRA 1G9XA 3LUFA 1VGQA 1KZ6A 3LVBA 2RAVA 2XKBA 5EZYA 3MHTA 3POGA 1VCMA 1T8PA 5KU1A 1N5OX 1K8YB 3W77A 1M4WA 3APBA 2CMFA 4R8HA 3HNYM 2AH2A 2YOFA 3ESRA 1I36A 1JA1A 4TTPA 5FK7A 3K8YA 1QMJA 3USES 2JCGA 4QGBA 4XUNA 3HP1A 4OQDA 1IFXA 1RRMA 3KYIB 2FEWB 3Q3CA 1I7DA 1NGSA 4Y6PA 2XQGA 4FDVA 1IOZA 2QY6A 3EIFA 3SIWA 3WHKA 1LBTA 5HQ3A 3V5NA 2GH8A 3QITA 3ECQA 2VMGA 3UJ6A 4W6XA 3IBGA 1IY0A 3P5BA 4PQEA 4AVSA 3EVBA 2CFTA 4YUVA 4FDMA 1OTXA 3Q6MA 1BHQ1 2PQ0A 4BPRA 1IUPA 3BIOA 2A0WA 4K8FA 4ZZ8A 2VTBB 1IQAA 3ZXUB 4QRDA 2I55A 3HLTA 1Q14A 3QGMA 8ADHA 2D2VA 4GJYA 5K45A 2VNSA 3T7IA 2XVGA 4Q15A 4JTOA 1I7NA 4N8SA 2Y64A 1CIPA 1BYUA 2ZW9A 4N7IA 2WTNA 1WA6X 2Q3JA 1L8XA 5H02A 1P1RA 2O2HA 4B5KA 5EJ2A 4US1R 1GPJA 3H3ZA 4YM2A 2KHZA 3H6GA 5K3FB 2VQEB 1WU8A 4NYIR 5ISMA 4YBRA 4TUYF 3LZZA 4Q1CA 5HW0A 4AY3A 3TOXA 4QATA 2CWWA 3CT6A 3DLCA 4BUCA 2BU9A 2R86A 3ACGA 1QJX2 2W6IA 1MZEA 1JYTA 1LHVA 3M2PA 5FUPA 4DLWA 4GPTA 3BHNA 3H2YA 3QOYA 3D1LA 3FMVA 4CV2A 2F9MA 1LPOA 4D42A 4EELA 3WHPA 4E1BA 1W8NA 2R073 1N1TA 5K99A 3GG2A 5T5LA 3ESAA 4UFJA 1ZREA 1P0CA 3VZOA 4FEEA 4BGUA 3COPA 3KD4A 4RY2A 4KYUA 3K09A 3QYJA 2WHEA 1L7QA 1QH6A 2D62A 2ETVA 1XAJA 5DYNA 2GAOA 2ZB3A 4AJ2A 4QTYA 1ZJZA 2ADDA 4EK9A 4UWDA 3N07A 2O57A 1G9FA 3DUFA 3T5BA 4Z4FA 3RV3A 5IFTA 2XBLA 1W48A 1VMDA 2W4QA 3CNQS 1SOVA 3BTVA 4AKHA 2Q1YA 3EPHA 1DC8A 1G8HA 1NURA 5J4KA 2GHIA 2A9QA 2SECE 5JUWA 4NZPA 2X0DA 2Y6HA 4RGQA 4R5HA 2IW1A 4ZYLA 1BWRA 3R09A 3Q3JB 3ZCXA 5DM1A 4PNZA 3RSHA 5IFPA 2KMLA 3SYMA 1JR3E 5HV0A 2VD7A 2PSHA 3D3NA 5CFPA 1ZA7A 1FF9A 4GYKA 1VKNA 3OCVA 1VMJA 3FOBA 3RS5A 2OKXA 1O4VA 5B6PA 1YR6A 1UCFA 2CMGA 2ZB7A 4S05A 2XXAB 1DBRA 3HPRA 1Q11A 1GFZA 4ESVA 1F6DA 2CV0A 4QDTA 1CJPA 3HR8A 5K1ZA 3LC2O 2ZBQA 1KS9A 2PAKA 1B8VA 1VRCA 3B2EA 3IXQA 4CU2A 3MCZA 4M98A 2GFQA 3EMDA 1H2AS 3C5VA 4ZU3A 2VJAA 4WOPA 4F8JA 5CCXA 5LVAA 3K1ZA 1Z56C 2JFGA 4OXKA 1ZVQA 3PTYA 6PFKA 2HRZA 3DFZA 1YKGA 4BWYA 2P3LA 1Z25A 3VPXA 1VJCA 5JCOA 2ZSIA 5BWBA 1RAGA 1G1MA 1KH1A 3S5UA 2V0CA 1NZJA 3KHUA 4YJ2B 3K9HA 4ALNA 3FSRA 1LDNA 3TD9A 1BA3A 2PS1A 2HMWA 1RYEA 3B00A 4EABA 3NJRA 2R1ZA 4P32A 4AKEA 1MIOA 1LVUA 4ZEVA 4PCAA 1X77A 5K0FA 3GPLA 4G9BA 3CHYA 3QVXA 1RQ2A 2PD3A 5JZVA 2PU5A 5PGMA 2C5BA 3IAS1 1Z3IX 1EWVA 1GTL1 1ZINA 3HQRA 1Y6QA 4EA6A 2CMKA 4XMAA 4DG9A 2D7JA 3FTQA 1M5TA 1F38A 5FREA 4Z3KA 3ZSJA 4RNDB 5AVXA 5TDHA 5C8ZA 2Z0MA 5BQOA 4CM4A 3DN7A 2ZYGA 3NBUA 4LJ9A 4AURA 4I3FA 4B40A 1Y6GA 1AKQA 1Z2AA 3KOXA 4EYUA 1QRTA 3BWMA 4QASA 1G19A 1ND3C 2F3RA 4C2AA 5IPFA 2VSXA 4K1YA 4H7FA 2QM0A 3FETA 2WF5A 1P9LA 3LQRA 4DB4A 4WKCA 1Y3AA 5CVVA 1UIJA 4CCMA 2R6ZA 5C8YA 4P9GA 3CPSA 3I83A 3VI4B 2XTMA 3LCCA 2F1IA 1KJQA 2XUIA 1NJ6A 1EM8A 3H5RA 2CSGA 4NJEA 1W76A 2OORC 1SCRA 3PF8A 1PHMA 1VL5A 1CVNA 1M1NA 3CPEA 5A32B 1H22A 2ZCJA 4BJ5A 1VP6A 2WVGA 2WS92 3BFXA 4FYHA 4EUKA 5TS2A 1U90A 3O93A 4RF2A 5ISLA 5IC4A 3DE0X 3K32A 3W90A 4OLJA 3R7WA 2POCA 3IVGA 2ZEYA 2BQPA 4NAOA 8LDHA 1KZHA 5JRDS 3D5TA 2PUDA 1GR1A 2ECPA 1CD5A 5FQNA 1NLRA 3PNOA 2ZSBA 3ILRA 2V6IA 3MQFA 4D82A 2O3QA 1KQFA 2VO5A 3W6PA 2W6OA 2P0AA 4RV5A 2G9FA 4AU1A 1QPZA 3FKQA 3RRBA 3DL7A 2GCIA 1LTEA 1FYUA 3VZSA 1J5EB 5AXBA 3DZIA 2EZ8A 1UYZA 3WG1A 3JARB 3QHQA 3MIIA 4OUSA 1B0ZA 2BFWA 4JLPA 3OLXA 1U65A 2W2KB 3FTPA 4EPRA 4TTQA 4WA7A 2IFTA 3B9QA 4H27A 3AYDA 1DBNA 1NJFA 3ONVA 4TXWA 3PXCX 2J42A 2OCXA 4PCVA 2O1EA 2EC5A 3HI4A 1XD9A 1C4RA 1Z5WA 1FP4B 2H5EA 2AA3A 3PX2A 2Z2KA 5EHNA 4OFGA 3RJ2X 1EFPB 1R0LA 4MV4A 2P9TA 2Z9DA 5GVRA 1ORRA 1LS6A 5EP3A 2Y6UA 2ZWOA 2NUTA 2IEYA 1PZHA 2R1TB 5CLHA 1RUNA 4G41A 2ZVDA 4E2WA 4XAAA 3ILSA 2G67A 5AKJA 5SYNA 3V8MA 2CLSA 1NMSA 4HSGA 5FKJA 3AP4A 2ZHLA 3QFRA 1I2AA 3ZGNA 5TMDA 1X14A 4DUVA 1NG9A 3ETPA 4X8NA 4ES6A 4QG3A 2UYBA 1XFDA 3N39C 1AN9A 3Q8XB 1Z29A 3CZRA 4AGVA 1RAHA 1JVNA 2NUPB 5K8IA 1XZJA 3RK1A 4KAAA 3LX6A 3QLUC 4FDLA 1DRJA 3PWSA 3B2QA 4G01B 4CMGA 2R751 1KC3A 2I9KA 3GIWA 2WWGA 4EKYA 3NHJA 1BBT3 2FOLA 3FX2A 2COKA 3ETHA 3LAGA 2WJWA 3NYIA 2QCSB 3ANSA 3H65A 3U3ZA 4UFNA 2ZIZA 4P81A 1N2CA 4XJUA 3U7EB 1X82A 1H2YA 3AU9A 3FFQA 4Q16A 1FQWA 3BJZA 3UC5A 3DV8A 2BT4A 3RARA 2JC3A 4FUTA 4YP6A 1WZEA 2QQIA 4TXNA 3VUOA 2XOMA 3P19A 4I9HA 2XKPA 3LWCA 2H59A 1O3TA 3HL0A 4AYUA 2DWRA 5BNTA 1OOPB 5A1LA 5CLLA 5FO0A 1U2EA 5C5DA 2OZ6A 2ZX1A 1GYRA 3IGFA 2GB4A 4JY7A 3UTDA 3EVEA 5I8WA 4IW3B 3TB6A 5DXAA 2OO5A 3WBKA 1X7WA 1M2GA 5BOSB 1XXHB 3SLRA 3B6ZA 3T7EA 5BYKA 1BZYA 3H3FA 1PVVA 2V7WA 4NHLA 1A76A 3HCPA 1DYPA 2AYXA 2W7TA 1V9U3 4U6NA 3IESA 2RKWA 1O94C 1Q7TA 3KLSA 4L8GA 3RYKA 5EJ5A 4H3WA 5A33B 3BWBA 4Z54A 1EQ2A 1WTCA 4XYLA 4B2PA 3S28A 3K3NA 2HEIA 3L1JA 4A6OA 3SEAA 3ZH9B 2O5RA 2N1BA 2NIPA 3KCQA 5AK4A 3BN3A 3GCDA 2I91A 1XSEA 4M0EA 2YVKA 4BTEA 4XM2A 1YB7A 3D6AA 4ND3A 5B57C 3AUAA 1HDCA 3PQEA 1RYBA 4BNZA 1RKXA 2FZ5A 3RMXA 4CXWA 3CRVA 4LBJA 2NQ2C 1XNTA 1W6MA 4BOWA 4OK3A 3LL4A 1X7ZA 4G09A 2Y0OA 2P9ZA 2XW6A 2PBLA 3P9CA 5K7PA 4LPLA 3URKA 2PLV2 3EWSA 4XX1A 5K3OA 1YEWA 4M9CA 1UD1A 1MS4A 4D0SA 1ASJ3 5CNAA 3G0IA 2V7PA 3KZNA 2QTHA 2K0GA 1OBVA 1MIHA 4H59A 4M1OA 2Q5FA 3WK8A 4NY1A 2FWJA 1SEPA 2XWQA 2RGXA 2ZATA 2Z4RA 4BO8A 3UHPA 2VJPA 5ECGC 2W2PA 1PGNA 1Y1PA 1H1AA 1G60A 1VPHA 2H4WA 3M2MA 3L7JA 2PXCA 1PD1A 1SO8A 3EHDA 2WJHA 4MICA 4L50A 2PWZA 4ARZB 1E1YA 1CNMA 4AMGA 3PB3A 2IHUA 3OBRA 2BEJA 4M9QA 1E1RD 3BJIC 4MSVA 4NABA 4JI0B 4KSCA 3ZKAA 2WN2A 3X43A 3EXUA 4X1IB 4EI9A 4M60A 1JHMA 2WC2A 2AX4A 2GZDA 4Q1RA 1A8MA 3VBHA 4F6LA 3PE4A 1JDUA 1K2WA 2HK6A 2XBMA 1UAYA 3MZ0A 3U9TA 1BZWA 3GFGA 1EJBA 4IEIA 1PEDA 2Q8QA 2XNHA 5IJ0A 3R6SA 5HVNA 2W91A 1VKOA 1LDYA 2IQ5A 1LHNA 3K0FA 1WVMA 1JR4A 3GRFA 4KI7A 2W93A 1Z4JA 1AMOA 4MUBA 1T34A 3C4VA 5FOVA 4W7HA 3B9IA 3HT1A 5FAXA 5C5CA 2QYTA 1DKRA 5FP8A 4UW9A 4AYXA 4Q3BA 1A7KA 3K2QA 1BMFD 1MPXA 5AVPA 1U0EA 5HP4A 4WKGA 4OXNA 1QO7A 1VBC1 4OGWA 3PT5A 1ZRSA 3LRPA 1M2OB 1PZ9A 4JN6B 1TA0A 1N75A 4D3SA 5SY9A 2W39A 1OLQA 1USWA 1LESA 2CVOA 4W6YA 1EVQA 4RCZA 5FXZA 3RAGA 1H8EA 1E2NA 3ZYRA 1BKSB 3MTQA 3HOBA 1GOGA 1JN2P 3T3MB 4DJ5X 4D3XA 2FMXA 2HWF2 1VBE1 2QP9X 4Q3KA 3VX3A 1EDEA 2B8JA 3WLRA 4RD7A 1SLAA 2VHZA 2V7VA 3GD7A 1H5NA 2J22A 3QHPA 1MJ5A 5DP2A 4UEKA 5IT0A 3OUJA 2QX6A 2V0NA 1QBKC 1XQWA 1RJ9B 5DEOA 1U0FA 1RI3A 4WZBA 4EF6A 3ZDVA 3NEJA 2PGXA 2ZGQA 2XECA 4ESOA 3H8JA 1KBQA 4PN7A 3QW4B 3PX7A 4NCJA 2VBDA 4IV1C 2VJYA 3ZI4A 4TPKA 2J7PA 3E3AA 1DBSA 3HNOA 3ESQA 3RK4A 4DMGA 2DBIA 2R68A 3U1VA 1D3AA 5AVJA 1NQAO 2VZSA 5FP7A 1GEEA 2ERYA 4ZT6A 2XITA 1IHMA 1X7XB 5HIMA 2Q27A 1Z6XA 2WZCA 3P2JA 4HAOA 3ICVA 1LPPA 1JTFA 3EE6A 3K7EA 4U2FA 4X1KA 1C4XA 3G2NA 3JQRA 1Q1AA 1X3SA 3ED5A 1PR1A 4QGLA 2X14A 1L8OA 5HSGA 2I1WA 3D5EA 3ALQA 1E0SA 5AVOA 4EZIA 1YQCA 2A0FA 3GF4A 3KT1A 2JXAA 3A7QA 3S1AA 5EXTA 3M83A 1VAVA 1TT5B 4IIUA 1CBUA 4NL4H 1QNLA 5A7WA 3THYB 4URXR 1FMTA 3C3AA 3ONEA 4FYPA 3WGQA 5CZKA 2ZRBA 4JC1A 3NDRA 4JQSA 5K8LA 3HNRA 4ZU4A 3AFHA 4D96A 1NT4A 1DGWA 3CNOA 4AZTA 4ASMB 4MEAA 4ENRA 3ACDA 5IYZB 3IQWA 5ITWA 1FDTA 2AW3A 2GCOB 4PPGA 3IEUA 4RTRA 4B31A 3C1AA 2ET7A 4KH0A 1KITA 4M76B 1RUG3 4MMZB 4QNRA 5AKGA 4CCYB 3HKDA 1GPNA 4F2PA 3AERA 4QPJC 3LPLA 3HWWA 4IQFA 5LNK6 1BVUA 2DULA 3EIOA 4AXBA 1E6EA 3SC2B 3W5CA 3COJA 4LC9A 3DV9A 5IZCC 5J43A 1AHNA 2JE8A 2GPWA 4XQ0A 1F4HA 3TNJA 4IEZA 5FNVA 3UJPA 4LWOA 5K6TA 4NYIQ 3BMCB 4BDSA 1RLJA 4QU2A 3VC1A 1H1TA 5I7AA 1Y80A 4EH1A 4E4HA 3G0DA 2C0ZA 3WHUA 3IR6A 2Z3VA 2JIRA 4MVCA 3URMA 2QM3A 1P4SA 2H65A 1PBTA 3L46A 3MYYA 1YQUA 2ZUVA 1TL7C 1MD9A 2DE0X 2AUTA 1ODLA 3QU2A 3WI7A 2YUIA 3R24A 4UAJA 1I10A 5FD8A 3FL7A 2SCUB 1UMCB 1UZWA 2RM22 1S7GA 4EA9A 3GP3A 4IX1A 4RL7A 3P97A 3UAVA 2NU8A 3BORA 1EJ2A 3WAJA 1PR2A 4DCUA 5A3QA 4K1XA 1CERA 1PFWA 5JMWA 3WL4A 3H4TA 3KALA 4D3YA 4AQ2A 5I7OA 4PLVA 4BHPA 3L43A 4BVHA 3OZCA 4GLJA 5F37A 1C1DB 1Z35A 4CCDA 3D02A 3KX2A 1XJQA 4P3OA 2QE3A 3V7WA 4C21A 4B48A 3O1TA 4F84A 1CAUA 1CIVA 4KWKA 3EO6A 1ENXA 3D8RA 4F2HA 3AEKB 2BGCA 3UPTA 1VIDA 4C4OA 3AV3A 4HEHA 3LE0A 2D5HA 5SY6A 5J98B 1K4MA 2IGTA 2VBIA 4COUA 3ZWPA 3VZQA 1OR8A 1YWKA 2JD1A 2VH1A 4OM8A 4JKMA 1FMLA 2RHOA 3WL5A 1NN0A 5MN5A 1KH3A 3H5IA 4MYCA 4OQXA 2CCGA 2GDJA 4Q9DA 3JQ7A 1GFSA 1UOQA 4UJ5A 5A4AA 2ZBUA 1V16B 2HB6A 3GUHA 4RQTA 4RJLA 1QJY3 3GM8A 4TXLA 1DQNA 3U11A 1IVYA 3SBXA 1ZUNA 3HPNA 4U8GA 3OZGA 2G71A 4J1TA 1CY4A 1AXGA 3EIXA 3EN0A 5HCFA 3GEIA 1B35C 2NQTA 1OQAA 1IUNA 1UN1A 2XOEA 2W8ZA 4YMUA 3ZNNA 5CYPA 4Z9BA 3HUTA 2C2YA 3OETA 4JZRA 4FX5A 1H1LB 4JYBA 3RLFA 2GBLC 4HQOA 3R5KA 4LNAA 2QRQA 1A9XB 3DXYA 1EUUA 3EBPA 3ZWWA 1NYQA 2W43A 4B76A 1QWSA 1QJU1 4ENUA 2NU6A 1O3SA 3ICEA 3TTWA 1SUPA 2NMNA 3ZLBA 5JJCA 4UUPA 2YWGA 3CO5A 5JAOA 2EDCA 3C7EA 2QUAA 1JR3A 2WVJA 2X8JB 3BSYA 5TARA 4FMPA 4ER6A 3IPRA 1QFYA 5KVQA 1KI6B 2ZVPX 3R8FA 2PYTA 1RXVA 3I3SR 4P4NA 4L5AA 2WZR3 2C7OA 2I80A 2OAP1 3TPFA 3W5MA 4UU8A 5CFLA 5T57A 4JI5B 4G4SP 1XVIA 1U7XA 5B3KA 3AW8A 9ATCA 1UW8A 4KK4A 2HQSA 4CXYA 4FFVA 3TTTA 5A7OA 1G7SA 1M5UA 1IY2A 2DETA 3WO1A 1JYWA 1DUIA 3CY6A 5KINB 4IE0A 3I6MA 3JVIA 3KB6A 3JX9A 1PX3A 4IFIA 5M7EA 4C4SA 3P2MA 1RJ8A 2QJRA 5FYYA 4X64B 1E1NA 2X09A 4OUDA 5JNTA 1JLKA 1FFSA 3VR3A 4A3SA 5JISA 2RB5A 4GI2A 4KQ6A 2GSWA 3G85A 3UHAA 3L04A 4RZSA 2WDZA 5DXJA 5HK8A 5C3QA 1ZJ5A 2WZEA 2H7VA 4RTSA 4M4RA 1QONA 4NESA 4EO9A 3AVYA 5I7RA 1OAOC 3AVQA 3RI8A 5ALIA 2E4YA 1WLDA 1NXTA 3WWZA 2LRPA 3UJNA 5LOVA 1K5MC 5FZ6A 4BCDA 3ZKWB 3GJ6A 4URUR 3EDRA 1OVMA 4IOKA 2MYNA 3T9CA 3ZIAD 2MSCB 4TV8F 1ZX1A 2A5FA 5A7QA 6GPBA 2EBHX 5AW3A 5LB4A 1T6BX 1Z7GA 3MT9A 4DLVA 5DIFA 3CMCO 2D7FA 3WX5A 5A62A 4H14A 3ORSA 4G07A 4XDHA 1YQ9A 2DXIA 1KPIA 1G20E 1WLSA 1MKYA 1VBB1 3H4VA 3CZUA 1RLIA 1XUOA 3OZUA 4POAA 1YOBA 4DPNA 1RUH2 3HZOA 2ILVA 2UZAA 3ACFA 3DYOA 1K8QA 2QRHA 1C8M1 5K0BA 3D82A 3NBMA 4LRSB 3AOEC 4B4WA 2B7BA 3NUZA 4OB7A 1MORA 2MSEB 4IWYA 2P6UA 3LB9A 3UV9A 1PS0A 1ZCZA 1QU3A 1VL2A 1P6QA 1HGXA 2CLFB 5DN6D 4TXJA 1DU4A 3PA8A 2SBAA 2DDUA 4DUGD 3R4SA 3GK3A 1KI4A 3HJGA 1XDBA 5F4BA 5KXEA 1K08A 3PC6A 3GY0A 3PCTA 4CUKA 2G28A 1ZHFA 2BEUA 1SK9A 2NSDA 3IX7A 1Y4WA 5KJEA 4YJGB 4IDDA 4XDPA 1UMBB 4QYTA 1V8PA 3QF7A 5IAGA 4W6WA 1RKQA 4D46A 3TRFA 4DS3A 2I6XA 1OYYA 1UJNA 1FP7A 3TCXB 1S0CA 2C9YA 2JJ8A 2GJ8A 3FYCA 5B4UA 3HU5A 3D3JA 1Z4MA 5GMOA 8ATCA 1OFIA 4GALA 1UY0A 3OEHD 3SU8A 3BZBA 3PVCA 3O1OA 3UGKA 1OU4A 2CLDX 3DTVB 1ZRRA 2O0JA 4LGYA 5EIWA 3K53A 1D6SA 4DR2B 3L05A 4JXXA 1TXGA 2X9NA 1NI4B 3VKOA 4W8JA 3A1TA 4ZY9A 5CMLA 4CM8B 1CG6A 3I37X 4E2QA 3GRYA 1N2JA 3CX8A 4EWAA 1UU5A 1GRVA 5FOBB 3OE7D 5EOVA 3OX4A 1KJIA 5KMGA 2NTEA 4WRRA 1ZNYA 2B2XA 4BEVA 2OGWA 3QHAA 2OKCA 3OPYI 2FFQA 2P5SA 4DWWA 3H3JA 4UNSA 1JHNA 4BX9A 1QNYA 3ZHOA 2I3ZA 4QX6A 1HYGA 2OK7A 3ITKA 5A0FA 3D0JA 2E32A 1VI5A 2ZRGA 2VEOA 3K75B 3KJIA 3EXIB 1ODSA 3PVOA 4GMKA 1FBNA 3CRNA 2ZEWA 2OXCA 3MS2A 2WFF1 3BWEA 1FP1D 3LTNC 2GJKA 1DYKA 2C1FA 2KBEA 5KDDA 2IK8A 3PRHA 1SVLA 4XLTA 2QQOA 4Q1EA 1CZOA 4B6RA 5C8CB 3K9BA 3THPA 2IHTA 1HC7A 1P0PA 3GV0A 3HAGA 1WM1A 3RZLA 1RM0A 3I9OA 3LW8A 3H8UA 5LZ2A 4NU0A 5KSOA 3BWXA 2I6GA 3K1YA 2IYEA 1YC2A 1AQ6A 5ALYA 1NULA 2E3JA 1JHVA 3UB3A 3GDFA 2DY1A 1KI8A 2XVXA 4YFVA 3CDZB 1PE0A 1KJLA 1DDGA 3EIHA 3DAYA 2OGSA 4FYJA 2C7GA 4Y2UA 4DXRA 4NAUA 2IHKA 2H0BA 2UWAA 3TRHA 2CFRA 2ZBJA 3QF4A 3V4FA 3DE6X 1ZOOA 1JILA 1JPNA 3E70C 4AQ7A 3ZDFA 1MAHA 2ABWA 2JI9A 2NO9A 1Q1EA 4LRWA 4ZHQA 3NV3A 4N7UA 3SVLA 1D1TA 4SLIA 4RJKA 4IIHA 4Z86A 4URYR 1CP3A 2LCIA 4IQ8A 4YLYA 4RS5C 4KQ7A 5DYGA 1YRAA 3ETJA 2G06A 5DHPA 4HN9A 2PN1A 4YMVA 4LDQA 3TZBA 3V56A 1JWBB 3PXAA 1R2QA 3HMQA 4ZCTA 3JQXA 2CC2A 5IVBA 1TMGE 4BAUA 3A32A 4QD2A 4GQBA 2J45A 4PBPA 5I4BA 2OFXA 1YQXA 3HBLA 3J7MA 1B6TA 4YG6A 2P1RA 2X3FA 5HXAA 1ZKDA 4MV8A 1F4LA 3DDSA 2Y60A 2WDBA 2GXSA 1CZKA 1TTQB 3WIVA 3IT8A 5FZAA 3MTEA 3OJ0A 5EIFA 2XQIA 3E22A 2RB4A 3LW7A 4CDWB 4PWYA 1NQTA 3LKZA 3G82C 2VRBA 1N6KA 1NLZA 1IK6A 2CL5A 3AM4A 1TCBA 2GRJA 4G36A 4WVWA 4EECA 1QRDA 3OY7A 2JGFA 5BO5A 1WBFA 3TXAA 2Z4FA 1I94B 4LG1A 3IIAA 2BCJQ 3L79A 5BRAA 3ZV4A 1VPEA 3SSMA 2VP5A 1P91A 3H1YA 4YGEA 2YBDA 4F4HA 3OPWA 2PUVA 3R9XA 1G18A 4LSGA 4E32A 4R9VA 2CVZA 4HFNA 4CT0A 1RE1A 5DYTA 3VPBA 3NBZC 2PNFA 2HBUA 1P39A 4XQCA 1L5OA 1Q1BA 3QLVA 1O87A 1UPFA 4HSJA 1KE1A 5C7LO 2ZE7A 2X8LA 3WV5A 4FZ3A 3TKYA 3I4FA 3VDDA 5KHKA 3SZRA 1ENYA 3FD8A 1WBJB 4LR4A 2BOJA 4P5YA 5BMVB 4DJAA 2REOA 1TW2A 4BKOA 2ESRA 5H4GA 5M29A 3DZJA 1EFRD 3BT7A 2B9VA 4P7KA 5GLUA 4IESA 2VKQA 3NYQA 3WP6A 2P3JA 1SBNE 1IG0A 5EINA 1Y43B 1O4WA 1DNPA 3ZR5A 3TF5A 5GINE 4QWNA 4WM8C 4G0UA 4NTZA 2OYRA 3CTPA 4H2AA 4D7TA 3ROMA 1MZ6A 4OUEA 1UPAA 1TJ5A 2FR8A 4TN5A 4XCQA 2QMQA 4TLDA 2Z2ZA 1LSSA 3JQBA 5EHZA 3QE2A 4AB1A 1EGMB 1Z0JA 3M4YA 3LY5A 2EX1A 3L18A 4HMOA 3A1DA 5AKYA 2WSBA 2CU5A 1BS1A 4HGOA 4C0AC 1XEWX 2JL1A 1VYVA 4U3JA 1X8KA 1JMKC 4LOAA 3G6JB 1FEZA 5FXXA 3HMKA 5KBFA 3NETA 4B8WA 2OA2A 4FEAA 3N9MA 1LI4A 3UXHA 4L3VA 1X19A 2OYCA 1X0VA 2AN5A 1C0IA 1Z7EA 2FWPA 4NMIA 4A82A 1Z34A 2R30A 4ZI7F 3TQFA 2YU1A 1I0LA 2ZJ1A 2IPMA 4URHA 4B6SA 5A3SA 3A2NA 4IIEA 1V2HE 1RPTA 3RBXA 1VKJA 1DIRA 4GB33 3H1WA 1KJRA 1VAKA 4R2LA 4CKCA 5HCAA 3RYHA 4XVHA 3VO2A 5F5CA 3K20A 1JYSA 2PIAA 2DUMA 4N12A 1EVZA 1M1XB 1XG5A 4RFLA 1DKOA 3WDYA 2YNMD 1NY71 1DKNA 3O90A 1UJ6A 1NF9A 3D3WA 3SXUA 4CFSA 3UNXA 1NRIA 4PZDA 3ELBA 3CKMA 1CR1A 5JQGF 4MEBA 3ZDBA 7ABPA 1PKXA 3IFSA 5BNNA 4LXLA 3H9QA 2VNKA 4POOA 1P2GA 1BHO1 2WWSA 5LA2A 4DY3A 1YS9A 3OCYA 1Q8VA 3IUEA 2HWE3 5JPCA 4TYYA 5IKOA 2YXEA 3G9XA 3HCCA 4PFKA 2KPOA 1PX2A 3ZCUA 1RYFA 1AN0A 4HKLA 1CV2A 1OX5A 4L9RA 5ED4A 3NAPA 5F3GA 1KGDA 4RY9A 4BVEA 1HTTA 1T2AA 4EO4A 2FGJA 3IUQA 1XDGA 2QNRA 2PUJA 3BFKA 1QTQA 5JU6A 2XKJE 4QTUB 3FMPB 2WFZA 2R6QA 2HSWA 1C3OB 2WO7A 3NIBA 1V11B 3ZU4A 3CB2A 4CUJA 1AGXA 3VTAA 3C6MA 3LFHA 4TKUA 2ADFA 4J0KA 1G4HA 4FHFA 1KPHA 1BTOA 3OIDA 3QEOA 1T2NA 2CSUA 1TJNA 3H9UA 1JH5A 3AFOA 5FWYA 3VBRA 3FMIA 3H1AA 1C1YA 4IV5A 2FMHA 2IZ5A 1CR7A 2JJ6A 2P4UA 1VMFA 2CDOA 1RE0A 2BFAA 2VVTA 3HA2A 1AYM2 2QX9A 4MSUA 2ZULA 1DO8A 2GM9A 1JYFA 2HUPA 4YO7A 2PWBA 3UFXA 2IEDA 4K9KA 2I1LA 4BAZA 2P2LA 2QUZA 1EINA 5BQXA 1J2TA 1DZIA 5FEUA 2JB9A 1UKAA 4RM2A 2PX8A 4CR6A 1LLUA 2C0PA 1SHWB 1XZBA 5JD4A 1X9IA 1K6EA 3SZUA 3WAGA 2J1TA 4RHV2 4G8CA 3DOUA 2WFMA 2FSGA 2QVXX 1EAMA 3I5AA 2WA4A 4IXNA 2ZJ3A 2GTPA 3JXEA 1W9HA 5L36A 3CLKA 4KJZA 1UOEA 5LB2A 4QBHA 1XV5A 3NORA 2R1BA 5GAJA 5EJMA 4FFOA 3S57A 1U5AA 3IPVA 2CJPA 1LBQA 4AJEA 2VJXA 1UQTA 4FCVA 4S1PA 2QYOA 1FMCA 2Q1WA 2E7QA 3LYUA 3AYAA 3AKSA 1X74A 4PHGA 4YRDA 1VB3A 2OK8A 1TIKA 3WNQA 1H2KA 3HYCA 2JJ2D 3ILFA 7MHTA 1IRIA 3HU1A 2VHYA 5FIUA 3VDXA 2Q4TA 5BSUA 2OBYA 5CFDB 2XQJA 1EVEA 5GJ6A 1TZKA 5EIAA 2R1VB 4DXZA 4JL5A 2I4TA 3LYHA 2FQPA 1GGKA 2EALA 2ZE5A 4QA9A 1X0XA 2X8BA 2YFHA 5TPWA 4DDHA 3H97A 4L2IA 3G17A 1N2SA 4TVBA 2ZJ5A 3B1YA 2G5TA 3BMOA 5AW9A 4BVAA 4AMZA 3RSOA 4OXXA 4G9SB 1IM2A 1G5QA 1Z37A 1R0RE 1E2PA 4NCNA 4G63A 2E55A 1MO3A 5J3JA 1VRH3 1GQRA 5KYUA 1N5DA 3V2UA 2GEUA 2J31A 1S7CA 4CDMA 4E4TA 5C2JB 4YRLA 2JGJA 3LWNA 1TEXA 1PR4A 3PI6A 5JW6A 5EUBA 4C01A 2GJ4A 5IUJC 2O8BA 4TS4A 4J4HA 4P0PB 4PPNA 2NGRA 3FLRA 5ECYA 1SRRA 5CJ2A 1SBZA 3E9QA 4QQNA 4KL1A 1KWKA 3J80A 4RF5A 4XX0B 4LJ5A 1H4GA 1RGSA 3L0BA 2Q0AA 2VTXJ 3HJAA 3KQNA 3OIGA 3RU9A 1UC5B 2QT1A 3IYLW 3CW8X 2CY6A 4Q5IA 1QZXA 2YDEA 2ZTMA 4CKYA 4X44A 1P60A 4HDSB 3D4NA 1OBNA 1GU7A 1OXSC 5P8WA 2BC9A 3O31A 3B1KA 2XAAA 3ENWA 4RPGA 5HR5A 4JVMA 1P7CA 4L8QA 4QOSA 1LKZA 5GIPE 2HD4A 2NTVA 3Q8KA 2VUUA 2RJ2A 5G0VA 3DP7A 2VUSA 4OYYA 4WV3A 2Y67A 3MMPA 4QYSA 4Y2VA 4F3KA 1HBJA 4Y6RA 2X1HA 4OFXA 3TX6A 1Z6YA 4L28A 1JUDA 1BYIA 4Z92B 1W93A 4GH4B 1JQ5A 2W68A 1P2SA 4MVJI 1K27A 3RZHA 1JP7A 2IWGB 2D97A 1AHPA 4YJFA 1XRPA 5DNDA 5LM3A 1S0UA 3GBGA 3S99A 4G81A 2V54A 1JDBC 1A34A 1UP4A 2ORED 3HVHA 4V3BA 3HVKA 4EVSA 5T3UA 4GMFA 2ZWPA 2QKDA 4KIFA 2AFHB 5DYWA 2RCYA 3KEFA 1RCTE 2XB6C 4N8MA 4ZVSA 4CQNA 1BFDA 1JEQB 2IYSA 5CIRA 3CUVA 4DY6A 4WVLA 4TX1A 3OPNA 4LAFA 2PZLA 4RA6B 3N8NA 3FPHA 1JHOA 2KXLA 4Q0PA 2YYOA 3QNWA 3DB2A 1HTBA 5I8YA 1Y8QA 2CHQA 1SWVA 1F5SA 4KL8S 4CT4B 3IQEA 3OPMA 2GPAA 1GZHB 3ND9A 1KVUA 2JH8A 2FSVC 2X5XA 4DQVA 2B0CA 4EEKA 2K2SA 2CJWA 2VHCA 2YMPA 4GGOA 1X8XA 3LMKA 4J7AA 2LD4A 1EP1B 2GWRA 3B1VA 1BW9B 2ZITA 2Y6VA 3R0QA 2GVDC 3F6BX 4ADSG 3I72A 4QFDA 2GCEA 2D6FA 1POWA 3D6HA 2R8EA 4G5QA 4OQEA 1MC1A 5A3LA 4CRQA 3VKLA 1OOEA 3ZY4A 1MP0A 5AHXA 3I45A 1X9TA 2AYHA 4GP7A 2JGAA 3IB6A 5FOTA 3QU9A 3QIAA 2KWIA 4OG2A 5E1DA 1SZJG 2A14A 5CM2Z 1KK1A 4HN4B 5EGSA 1ZM2A 2XSZA 1MEOA 4DT1B 1Q3TA 4EJRA 4DLRA 3PMEA 3RCBA 1T29A 1VBA1 4K6CA 3X0DA 1T1EA 4U2AA 1U5YA 3IHWA 3VDMA 1A96A 2NU7B 5DPMA 4QEDA 5F3IA 5C1DA 5CFMA 1CEXA 4F45A 4GR9A 3S8EA 2Z5GA 1YFJA 1DOHA 1KDMA 2XAUA 3L01A 3ER6A 1V3VA 1MQSA 2GZSA 4CM1A 1QQBA 1EP0A 4H7MA 1M73E 2WRAA 1L4BA 3WP1B 3AF1A 2ZT8A 3SITA 1JZ2A 3SCGA 1W8DA 3ZXXA 3H6HA 4BU0A 1XOYA 1YI7A 1FK8A 2BBWA 3DOCA 1WQ1R 1OWLA 3IR5A 5LA6A 1VPLA 3TFOA 3FLEA 3WMXA 4YZ2A 1I24A 4V1CB 1QH1A 2MYUA 2I54A 1K6IA 5D00A 1G20A 4ONUA 4BQEA 4G5FA 1RUJ2 1PIV1 1F8XA 1P1JA 2ZE6A 1E92A 1GL7A 4JLDA 5A4KA 1KI7A 3KUUA 3B60A 5HMMA 4QT0A 4FMDB 2O2SA 3IDZA 4FM9A 4KU7A 3A1UA 1H8VA 1W8OA 5F98A 1V26A 3RROA 4ED9A 3LZDA 2YV5A 4LJKA 3ZV7A 4JP5A 4RACA 4DEVA 5EV7A 1IZ3A 1DQSA 1NJ2A 1QF3A 1ECPA 4XQGA 4I36A 2O1WA 1KFJB 3VBUB 3CQOA 3KO8A 4HLNA 5DLYA 4TMVA 4RTQA 1XZPA 4B09A 1B26A 4FFGA 3EDMA 3OY8A 4BGDA 2X6RA 3T2OA 5DNEA 1W94A 3MERA 3OHSX 2DF8A 3D6JA 3FI9A 3U4HA 1Z73A 3T5GA 3K1TA 4O5OA 4CBVA 4G4IA 4R98A 2K46A 4FWIB 4KVAA 2WINB 2P3QA 5A3VA 2BV4A 1GADO 1XGKA 1VGRA 2B1IA 5B2GB 4I2VA 3ZHXA 3FDJA 4LE3A 1TYZA 2VSQA 2RS51 1DC4A 1XXNA 4CMEC 5IK5A 3BCUA 4ZRDA 1OTHA 1STOA 5U9CA 1EGQA 2AHOA 4AFAA 2H0RA 4AAYA 3GLKA 2A2ZA 3DP9A 5M5BA 1KDPA 1RTKA 2ZR9A 1IB6A 2R7KA 2XDAA 4KQCA 1DCKA 3VFDA 2BGMA 5A70A 1PQ4A 4AJ4A 3GZUC 3NRBA 4MS1A 4R9SA 5DM2A 4S0XA 5J96B 3W1VA 3IH5A 2QUOA 1JZ3A 1L4LA 3NNGA 1R5JA 5HBGA 1R081 3C6QA 2RMU2 4OK5A 3GJ7A 3PCXA 3MF9A 3D8BA 5JMPA 4KC0A 1C9DB 2A9VA 3K15A 1JKJB 1KSFX 3MV01 1M72A 2Z6AA 2WZ8A 4OQQA 3BKWA 2BGJA 4JVNA 1Y3CE 4FPGA 4TT3D 2PZGA 4WM7B 3ZHCA 2O7RA 1Z17A 2EFGA 4HLUA 3DE7X 2C9DA 1ZIOA 1I2BA 4FVTA 1YA4A 3JQCA 3GPBA 4C6RA 1G2PA 4MWCA 2OXBA 2WD8A 3W58A 3D31A 1ISRA 3V33A 4QXKA 4PCUA 3KRTA 1E3IA 4DNOA 2WNIA 3BTZA 1E2LA 3CR8A 4UHKA 6REQA 4BRZA 2Y77A 4H1HA 4ZWNA 1UBUS 4KMOA 3HR7A 2BP7B 2AOTB 4PX5A 3QH7A 4CDQB 2J9RA 3V32A 4JHZA 1UDBA 3GFPA 1JXAA 3PNYA 3ZTWA 2Q2VA 4GOKA 5C1BA 1ND2B 1U4OA 2VTKA 4QOIA 3LA8A 4RVHA 3AG5A 2X0NA 1T24A 1VL0A 2A86A 4FOVA 1G4UR 5ALPA 3SD7A 1AL21 4J8PA 3AP7A 2O3RA 4PXSA 3Q0EA 1NZIA 3CU5A 2O2DA 4WDQA 1BD4A 1K6MA 1SBHA 3V8QA 1YJ5A 4PR0A 1XEAA 4FI3C 3HNBM 4K9RA 1JODA 5AVKA 4IE7A 1TM3E 4B2LA 2ZJ8A 4P0TA 4U63A 5JCJD 1L7EA 1BN7A 5E8JA 4LYFA 2E7AA 3DZKA 4EJMA 3F8SA 4J91A 2AD1A 1RQXA 3SSAA 3ID6C 1OKKD 5A2GA 1DLCA 4BY9E 2A0YA 1SQSA 3PNKA 3AUUA 1CWPA 4U7TB 3WW1A 2Q0HA 3DYMA 1RDFA 5DX1A 1VG9B 3EZ9A 1UYXA 3LNCA 4EY5A 1W0JD 4IJ5A 3U48A 2FFHA 1WUJS 3QVUA 3BTXA 1JSZA 2BFOA 2BF4A 5CXSA 4IEVA 2DJIA 2W2NA 2GBGA 2RJ3A 2XNDD 4B73A 4QGGA 3ROTA 1TQDA 4LWZA 3JSAA 7ADHA 3MV11 3E6DA 1OIWA 2FRVA 3C8ZA 3L93A 2OWEA 3ONFA 3QVGB 5FP9A 1PF7E 4DIDA 1MAAA 4HH3C 4MS4B 2XYQA 4JI4B 2VPIA 2OKGA 2QQ0A 4EDFA 3NAQA 1ULUA 2EG5A 5EXPA 5GLVA 5I93A 3M82A 2GMEA 1S8AA 3I58A 1W46A 5FTWA 1VL8A 7YASA 1SVMA 2ONKA 2GF2A 2WFLB 1ENQA 4YAIA 1ISGA 5C34B 1LPAB 3K4ZA 3V6MA 3ELWA 1FNYA 5JNUA 3SR0A 4YARA 4ZT5A 3TVTA 3CF6R 5B4XA 2WZBA 2ZMNA 3EQEA 3IPYA 1UBOS 3AR9A 4IUCS 1WP4A 3CLRC 3KG2A 1XZGA 1UKEA 3VL8A 4N90A 2IYYA 4OUMA 3B1FA 2Y6LA 4LXTA 4RPKA 4FAGA 2NWQA 1GCAA 2W2LD 4I1IA 2BGPA 1SFPA 2O5CA 5U1PA 2BGIA 1KJ8A 3SS8A 2BFBA 1CJVC 1Q8OA 5KNCD 2B83A 3BD9A 3IBMA 3KAQA 4EFKA 3HR9A 3I2FA 1R6UA 2NX2A 4ZJZA 4MB0A 3WYDA 4BO0A 3WK7A 3WMEA 3Q6IA 4E5SA 5HJEA 1YC61 3QBVA 3K5IA 4XC9A 5IAXA 2WIJA 10MHA 3IMCA 4M01A 1PWXA 2ZQ5A 5DTRA 2BZGA 5CBPA 2E53A 4QB6A 3KSUA 3H8WA 4D5GA 3D8NA 4PHTA 1J84A 5G41A 4EMBA 1NUKA 5K0LA 4Q4X1 3IELA 2NP7A 4H7LA 4NOJA 4EI7A 3CSSA 5GGXA 4AJOA 5CFCA 4LCBA 2R6CA 3BSSA 2E7TA 3LUPA 2X9LA 2R87A 2G4VA 2YTZA 4H31A 2G17A 1A9ZA 2G5PA 4XWYA 3OE1A 2WM8A 3RRJA 1XZFA 1E2DA 4XOIA 3LI2A 2YFYA 1P7YA 1QPGA 2C4MA 2PYIA 1WV1A 4MGZR 2ZU6A 1AUPA 4EYQA 1TG7A 2REQA 4IL7A 1T3HA 1U3DA 1PNTA 1W2AX 2X86A 3R0ZA 5DCLA 3DMTA 2AJTA 1B15A 4CEJA 4HD8A 3SCHA 3DXZA 1Z3CA 4I8XA 1UYYA 1OLUA 2K7ZA 1C1FA 5UKDA 3LHDA 4KGDA 4LMRA 3BRWD 1GU3A 1YMQA 2WUFA 1RLMA 2VULA 3LDAA 1M34E 3IEPA 3EFOA 5FUWA 4N3NA 4MXVA 1ZRIA 2AKAB 2XZOA 1N3BA 2FJ0A 4DBLC 1LS1A 1KOJA 2Z69A 1KQ3A 5KXCA 1THTA 4RTLA 1T4MA 16PKA 3PPVA 4QFBA 5K8TA 4YZ1A 2VC2B 3LDGA 3L40A 1SBYA 1V5GA 1QOQB 1GKYA 2OCYC 2HK7A 1O7FA 1V9CA 2VI5A 5EMLA 2OD7A 3U3OA 2WZDA 1HRV2 5MFZA 2GPYA 4JH0A 1ECCA 4KV9A 2JD0A 4WDRA 2DCZA 4Z07A 2A35A 5JZMA 1JGTA 1UZAA 4Q27A 2C2OA 1U5CA 2XE4A 4RIEA 3ESCA 1ZBA1 5ICGA 3DOIA 4QOHA 4FIDA 5FWJA 4Y33A 1RWWA 2PT7A 3K96A 2YXNA 3GLHB 3I5YA 1KH2A 5EWMB 1CRWG 1GPBA 4CLHA 2IH4A 4II7A 1QH8B 1F9AA 1F48A 3PR2B 2BTVC 3KD2A 1CIYA 4MO3M 3OLQA 4ZEWA 5FWNA 3JD71 4MQEA 1L9XA 1ZRNA 3UBMA 3QLTA 3C43A 3WMRA 4EB8A 2VCAA 1PVXA 1DLIA 3G1UA 5CR9A 3GJ8A 3ASIA 1HYEA 2QT0A 1M2WA 1QDCA 2I74A 3ZFEB 1LPBB 3X1YA 2J7MA 2OBNA 4B4DA 2J0EA 4EKGA 1EDZA 3IRUA 5CX1B 2HA0A 4LOLA 4Y4YA 1DRUA 5F5LA 5TQJA 1I3KA 4I5DA 2O2EA 4KE8A 1O5OA 4IUYA 1SFYA 2C2XA 2VP9A 2J33A 2WZQA 2Q8DA 3SQNA 2W8BA 2C9CA 4MVJH 3KT0A 4EA7A 2PKQP 1A8HA 3PJEA 3H3UA 4RVNA 4RX1A 4Q0MA 4D9HA 1I5PA 3LXXA 1PK6A 4K8OA 2IPAB 4G4FA 3OT1B 4U2DA 3W4KA 5AVAA 2DYCA 2XUJA 3FPBA 2W08A 4E8CA 3ZQKA 4N39A 3SISA 4PLNA 2QQFA 2PKQO 4JWTA 1H8HD 4V2IA 4IXLA 5DI9A 1QQAA 3WYNA 1E1KA 5LMZA 3FPGA 3CHXA 2QG9A 5LLSA 2ZBVA 3O1VA 2LCFA 1NBEA 4LXHA 4M00A 4UATA 2GQ0A 1XRQA 4QZVA 1CJKC 4ZT2A 1EX1A 2NZVG 2C7QA 3PFHA 4BCUA 5GY7A 1VPTA 5TGDA 4A9AA 5KJ6A 2Q8NA 1SG9A 4JT4A 4PGFA 3DVAA 4OIFA 3FBGA 4Y6LA 1PGSA 4ZMRA 5IANA 1L5SA 4BXOA 2XCQA 2G07A 1ZIPA 2WKWA 1RLTA 5G3YA 2NV0A 1DPFA 3PLRA 5CXQA 1NUUA 1L6IA 1MQTC 4QSMA 2XLFA 3FNQA 4XW2A 3M33A 3K71B 1JAYA 3P32A 3LQCA 3WQQA 3NIGB 1NRJB 3ZNQA 5FORA 3WLSA 3K0KA 4YW4A 4C4RA 1N1VA 2DP4E 3CF0A 3RRZA 5JSUA 4DV6B 2WLQA 1HQKA 3SPXA 2D3PA 3ND7A 4CCEA 4LE2A 2J85A 2ZMLA 4DSOA 1KS2A 1XMOB 4LYYA 4IHKA 5HXMA 5E6RB 2OS2A 3O83A 1ZH0A 3ZDEA 3DOHA 4KFRA 2Q3DA 5EZWA 2BMFA 3U07A 3GBVA 1NUPA 1MENA 1ZONA 4P7JA 1BH2A 4JEUA 5FPHA 1REQB 1RVF3 1BKYA 3L7CA 1U0LA 1SACA 1G64A 1UK8A 3VZPA 1HM5A 4X85A 2QVGA 2II6A 5FKCA 3BGWA 1QS0A 4M0PA 5EKXA 3CG4A 4IHJB 2FJUA 2BNOA 1AIPA 1V5WA 3GFSA 2GR9A 4FT8A 4N9HA 3NASA 3EZGA 2W1UA 5KTYA 2DSNA 3ETQA 2CZCA 3WRXA 1LODA 3DSRA 4DLUA 3KWVA 5EHGA 2ZDQA 1GVNB 4WXRA 2BR5A 3WOVA 3U60B 4YVFA 2Z56A 4BNJA 5L9RA 1HOTA 2P2GA 1HFEL 4N8EA 2X2EA 2IVJA 2I76A 1JLLB 4F3NA 4JAVC 4IVNA 4EITA 4CVUA 1TYCA 4AI9A 1U98A 2H6CA 4CL2A 3P45A 2JIJA 4RKQA 2A9PA 3LVQE 1VHLA 2FZ2A 3KELA 3ZC3A 3AUTA 4BO9A 1ESCA 1XYPA 3OUIA 1EP3B 2X7XA 4QUEA 1DWPA 3O1LA 4K3VA 4WACA 2CGNA 4Q1AA 3LM8A 4IIJA 1NMYA 3P8ZA 3AU8A 2XWJI 5FI3A 1RTVA 3ICCA 2DFBA 5A3TA 4LN1A 1DTEA 3VBOC 1FFEA 3L0CA 2QSJA 2WQ4A 1XPRA 3J8F1 1RYYA 4P82A 1CY6A 1S2LA 1UWLA 2FUKA 4XB6B 3NOVA 4IJ6A 4ECEA 3I2OA 1ZDMA 3BTAA 4D7AA 4CKWB 1JL3A 1YAJA 4ENTA 4LVUA 5IK2D 1Z68A 3I8XA 1MU0A 3CU7A 5HKLA 3PQ8A 3KU1A 2UUOA 2QUKA 2XA2A 3T3NA 3T95A 2O3TA 5JHGB 2B6NA 4UUAA 4G56A 5CFNA 4I9FA 1X3LA 1T5SA 5FZOA 3RRXA 4P14A 5D1IA 4HPKB 3MC1A 1W2GA 2SKCA 3EOZA 1J39A 2QL7A 4N9QA 1KI1A 3IBCA 1IATA 4HNRA 3LQ1A 2XOKD 4QXPA 3QE3A 2OCKA 1FBTA 2FSHA 2RVAA 5FPLA 4AVYA 4NS4A 3MUEA 5HIKA 1N4AA 2ZEXA 4LMPA 1VBD2 2C6SA 1KERA 5AQEA 3GN2A 4IV3C 3HP4A 2Q5IA 1LOFC 3ZWVA 4R2JA 4KPFC 1Q5OA 3TFQA 3PGXA 1G7YA 3L6OO 2UYCA 2NXCA 3QCWA 3NBQA 2X1MA 1XE8A 5IT4A 1T9KA 3SYKA 4Q01A 3Q85A 3PIGA 1LY1A 5JO9A 3JQWA 5FDBA 3MW8A 1D0IA 2V6FA 3U40A 4XR4A 1P4GA 1UK6A 4RTJA 3IDAA 1ZU4A 4BNFA 3JRNA 1ULAA 4W9NA 1SBQA 3BUCA 4NVPA 3JBG1 2GBIA 5D3KA 2B1QA 3TGLA 2ZFUA 1F15A 1P44A 3AUFA 5I48A 4K3UA 3CNLA 1ZK4A 4A3ZA 2VHWA 3T4UA 2WYSA 2HC9A 1MMFB 4XQDA 4CCNA 2X10A 4ZIRA 3O47A 1XA0A 2NADA 1EDDA 4L5YA 1TNFA 4J49A 4O2AA 5GV7A 3SJAA 4P9JA 5C4MA 1T9AA 2WRZA 3ILHA 3A6PC 4CF7A 1XLTA 1GPWB 4H3HB 1SOUA 2IOFA 5EJ6A 1QYXA 3UT6A 2H4FA 2WNOA 3VOBA 3HQUA 3ZXIA 2P67A 1F8UA 5IF9A 3UCEA 2C5EA 2UZ4A 5KC6A 4EYSA 4XSHA 4RA9A 1WW2A 1GSIA 1EFHA 5IFLA 2VHJA 1FYDA 1UU4A 4LKDA 4DDKA 3DGFC 1JYNA 2E5FA 5FZ0A 5FV4A 3K8OE 1P4RA 1NSTA 1CTQA 5AKLA 1IUKA 2HWC2 4K2AA 3O38A 4M3CE 4H1TA 1ZSNA 1P5ZB 4H7PA 5K4HA 4NENA 1G8MA 4J0GA 1W5EA 3KAPA 4JBHA 4CP9A 5JSYA 4AOCA 3JD2A 4X65B 1Q43A 2EXJA 2AHRA 5K3EA 2C29D 5LBEA 1EWKA 3FCSB 3F5FA 4A73A 4D6XA 1F9KA 1TME3 2ID7A 2OHGA 1CR0A 3F7NA 3VSBA 2HNBA 4G4SO 4REQA 4R9AA 4PZPA 3DBOB 1FP2A 1R6AA 4YLEA 1M3SA 1FUYB 3HUDA 5GOZA 4H55A 1O6ZA 4LXUA 2RMKA 5C3RA 5CVJA 2GT1A 1RUD1 4MIEA 2XL7A 4ARSA 4BZQA 3D8SA 3V3KA 1RUE3 1W19A 3RYCA 3T06B 1Z47A 4DNQA 4YN3A 5SV5A 4OCZA 2YL2A 2G1JA 3GT7A 4TLAA 1RM5A 5A06A 3QIVA 1R0ZA 2RS31 1AKUA 1W5SA 1Q6YA 1J3RA 4LIPD 4GXLA 2YV1A 3QY9A 1MGPA 2YVUA 4P84A 4REMA 4TVSA 3LDKA 1RUC3 2AQIA 4V0SA 3H17A 1XI2A 1NA1B 4ER0A 1YRBA 5CGQB 5K0UC 3ZCSA 1OAAA 5JPNB 4YAFA 3GFRA 4S35A 1E96A 4RADA 3BD7A 1HORA 4HAWA 4KTVE 3QWAA 5DBIA 5H3LA 4DL9A 3ADBA 1HDKA 3DS8A 1NOJA 3U4XA 1A77A 4C3ZA 1B8UA 3LP5A 2PO5A 1C4OA 5FYZA 3BL6A 3EH1A 3G2JA 4PC3A 4Y5Z0 4ZVPA 3UANA 2IOYA 3AR8A 2POQX 3ZXAC 2C78A 5HQTA 4UXJA 1OVGA 3UC9A 2GZAA 4ZJUA 1Y5IA 4URVR 1BKDR 3PVZA 4ARYA 5FJKA 3KQYA 4WUTA 4KBGA 2VOJA 2QMEA 3E9MA 1V96A 5D87A 5SV2A 4BQSA 3BE6A 1HDGO 2OL4A 3UJDA 3FCCA 4FNMA 5KBYA 1L7RA 3IIEA 4I81A 2BJHA 1CE8A 2E21A 2JBAB 4YIKA 1U02A 1WCQA 1F06A 2R6R1 2XYHA 5C5UA 5I9NA 4H16A 4L22A 2R7MA 3ZGOA 4YM0A 4LUKA 2F1HA 5DGDA 2ZGVA 4O4JF 1VE9A 4FQ5A 4G0XA 1UH5A 1SUAA 3UMYA 2Q8CA 1L4KA 1ISSA 3EXEB 3R44A 4HVAA 1EE9A 1O6BA 1P6XA 3B13B 2BGLA 1XD8A 2R8RA 2IYZA 4RMNA 2K4MA 2F8TA 5LYJB 4C6HA 5FJIA 1DGLA 3PD0A 3RREA 4BECA 5J48A 4IV1B 2VPQA 3I9V6 2WWXA 2HCJB 2ZRNA 1SIBE 1J9EA 5JS8A 4LJLA 4N18A 4PYOA 2QRLA 5F1YA 4ZANA 3KT7A 4MRMB 2RHPA 1SOAA 1CC1S 1AXYA 3H2IA 1URPA 3R0RA 2XVAA 1SQ4A 4QDKA 4Q4W1 5BV0A 1J2UA 3AZPA 1OUSA 3J7LA 1BJTA 1CDZA 4TMWA 1GTJ1 1H4TA 1XX6A 3KXLA 3K0EA 1Z45A 2X42A 3O84A 2J6BA 4C04A 3WMFA 5EKSA 3MM4A 2JG9A 5J4LA 4J9UE 4FYWA 4OI1A 2RE9A 2ZKLA 3DE1X 1XROA 4PEVA 4C4PA 3VC3A 4BM8A 1D2CA 4ZYZA 5D3MB 2Q41A 2O8FA 4CXMA 2AXQA 1U0AA 2VR4A 2QPOA 3LHIA 4WAUA 3NP9A 3UV7A 4B3NA 3K1AA 4BP1A 2ZGKA 2P34A 3KEOA 3N35A 3CONA 2ODTX 1GDDA 3VKMA 1CD3G 5FYVA 2G76A 1P45A 1Y3IA 4I1OA 4YAWA 5KKCA 3BGSA 1UY3A 5F9MA 3KUCA 5JVDA 3G2OA 4DIKA 4GFDA 1YZQA 5H3HA 1A5BB 5ICSA 1AHIA 2GH2A 1NVVR 4PRYA 4TMFA 2D1RA 1ZFNA 2QVLA 2K2WA 1YJQA 3M6UA 1EK1A 3C24A 4YACA 4MW6A 2VYVD 1J0CA 1MW9X 5JY6A 5JSRA 1QHFA 3D6UA 4AZ3A 3C7TA 3ZCVA 2G09A 1QE0A 1GGNA 2ZGRA 3BKXA 2QNIA 3ASZA 3B6KA 4BNUA 4L8WB 1UP6A 3G8YA 1W03A 1GNRA 1YFKA 4F7DA 3E5MA 3JASB 5KVAA 3TSWA 1QE5A 3MTJA 5KUTA 3DD1A 2R32A 4WECA 1AU9A 5JH7A 1ULBA 3K0AB 5F7UA 1DIHA 1CB7A 1A69A 3UYJA 1E1RA 2FPKA 3H9CA 3WLIA 1OLME 2V5YA 4OO3A 2AJBA 2QMOA 3HFSA 4N48A 3QJYA 5TQ0A 1Y9GA 4TV8A 4QPPA 4EX7A 4NJOA 1AR62 4QXQA 2QXTA 4LDAA 3SLIA 4M1EA 3AZZA 1WUTA 1GZWA 3KYCA 3WSVA 3ZBQA 2PLWA 2VOWA 1Y1SA 1D1PA 5J9FA 4JYCA 3CKYA 3PRKE 2BFUS 1DSSG 2JGNA 3COZA 3UK9A 2R041 4IGAA 1GZTA 1TMYA 3ESDA 1GNHA 1O0CA 3WK6A 1MN6A 3VKGA 5MFPA 1ORDA 4WZAE 1Q6ZA 3UAGA 4EGSA 1GQFA 1AD2A 4UCQA 4J07A 2JECA 5FEMA 3RKSA 4CNBA 4M1SA 1PVC2 3IVCA 5BNWA 4GPD1 3UV3A 4Q4Y2 3U14A 2A70A 3RF7A 4G6ZA 2BFDB 2VDVE 5LMUB 1FW8A 3VU0A 1A4IA 1M34A 5MGNA 2WE8A 2NT4A 3LUJA 1BVRA 3BL8A 4MUIA 1QCZA 1ZCJA 2QM8A 4OZOA 4TZTA 1FTSA 5FOQA 1Q0SA 1AJKA 1E58A 5BUSA 1AG9A 3C3XA 4DNYA 3F5SA 1QU0A 4I19A 3L0SA 4AJKA 3ACLA 1Y7HA 2XMDA 1L3CA 2P65A 5K9ZA 4P4SB 1RMQA 3QFHA 4DIFA 4CEWC 3FYTA 4ND4A 2WF9A 3LU1A 3ZU2A 2IHNA 5K8JB 5DNYB 1F7UA 2IBTA 3BIJA 3LQQA 2HYDA 4PO1A 4XGIA 3KDAA 4KMQA 1FXUA 1E2IA 2PL5A 3EB7A 3PE6A 1YR9A 2ACVA 3NH6A 4ZYYA 5J23A 3W6NA 3IKLA 5AWFC 2EU8A 3LLCA 1F2TB 4E0BA 1T5DX 3VBFA 4P9XA 3KT3A 1GL3A 4W5OA 1M0EA 2C8LA 1C9JA 1AS2A 1BVHA 3KE8A 5SV8A 4MV0A 1C1XA 1Y1KE 2Q5LA 3R3WA 1NXQA 2C07A 3IP3A 4COVA 4GUDA 4BRWA 2I3BA 2GNBA 4B9EA 1NL3A 1PJ3A 1C5IA 1N3PA 4YLGA 3E3NA 4IEUA 3UY4A 3K5WA 3M4JA 4BXSV 2AV6A 4P7BA 4BQ4A 4JD5A 5CDFE 2ZYVX 2PZFA 3GLQA 1UX7A 2GZWA 2V6BA 3FWNA 1MJNA 1U8UA 2M2IA 1DE0A 1X1AA 1XE3A 4CE8A 2H52A 2EQAA 1C8NA 5FRDA 1A1SA 3FIUA 4HBNA 2B3DA 2HWB1 3ZWXA 3H5VA 1ARZA 4GIQA 4YNIA 3KVVA 4WFQA 5AESA 2W0XA 4TV9B 3JQ6A 4ZAXA 3F71A 4DM3A 5A4FS 1UPUA 2EHDA 5KTRA 5C7OO 4R0NA 1R093 4IUGA 3SR4A 3EDCA 3THCA 2AR6A 3AP3A 4BK4A 5LK7B 4HDAA 1EE1A 1R6BX 2AXEA 3KQMA 1H4VB 3ETLA 3EVZA 5D51S 2PRKA 2XQKA 3I53A 3FR7A 2AEMA 3OTFA 1EFTA 3U19A 4C7JA 2DTEA 1MZVA 3WXBA 2GO1A 2X3UA 5IAEA 1WHSB 4OLFA 3KVRA 3B8EA 2BOVA 1YUDA 5FZ4A 2WHXA 3W5UA 4LDPA 4X1YB 2AFIB 4ARCA 4D7YA 2I66A 1PJ4A 4DRRA 2J48A 5G53C 1GRCA 3QVSA 5LJLA 3R6GA 4UMFA 3S30A 1PO13 4KXUA 1EX9A 2YWBA 4CIXA 1MBZA 3RBZA 4HJRA 4JU9A 2ZBDA 4V1CI 3DPSA 2IHBA 5BN5A 9LDBA 4XJTA 4YTEA 3FHIB 1RIRA 4FUQA 2RH8A 5FP0A 2RGCA 2BTEA 4V24A 2VL7A 3AKTA 3V2HA 3R3HA 1J2RA 1CS0B 1C7QA 1GAQA 2DLNA 3PUXA 4Y1EA 1JZTA 2UUCB 1W9SA 3FCXA 2I7TA 5U4QA 2G4LA 5INTA 2P3KA 3USZA 3RFVA 4WSOA 1G2QA 4EATA 5AW6A 2ZPAA 4M3NA 3PHIA 4C5BA 1ZOLA 1T0PA 1AR71 5KC9A 3THWA 5AJTA 3AL2A 4JEIA 4RSRA 2W95A 3JVUA 1KR5A 4F8YA 1RIIA 1NRWA 1BDMA 5JWOA 1P81A 4I7EA 3LOBA 3H9EO 4F2GA 5JARA 1OHHD 3HCFA 1G6OA 4B47A 3MW2A 3OJXA 3F8WA 4NHYA 4TLFA 4Z1MD 4WEOA 3RTAA 1UZLA 1QP4A 3PPWA 4UMEA 4UE3S 5KQSA 1RRCA 4XUPA 3QYPA 5D8DA 1FTYA 4JOCA 2CDBA 1ADJA 1BYHA 1Q50A 3IBTA 3LDBA 1I5RA 4PC6A 3AZWA 2OZKA 2ZAGA 1YQWA 3PC4A 4B6JA 3KYDB 4MUVA 1QIMA 4ETWA 2AZMA 1S5PA 4RA0A 3DL2A 4YW5A 3CUSA 1SXJC 4FYMA 1P61B 1PWZA 3H86A 3GEMA 2QQUA 1L4NA 1JSRA 3RWKX 2ODEA 2Y92A 5CB0A 1GKUB 4JZKA 2V8BA 1D0SA 1W29A 2OZEA 2V5DA 2BMAA 1MEC3 2YS7A 1QKJA 3GA7A 3AL0C 2V58A 5EPEA 4B33A 2CDCA 2CZQA 3LUBA 5FUYA 2P9BA 1A27A 5LATA 1GPYA 2WZPP 3I64A 2OZJA 2WAAA 4YCAA 3C3BA 3VNRA 1K92A 4JKLA 5FUNA 3NT4A 4I1RA 1SWWA 1U5ZA 3UT0A 1A5ZA 2VK2A 2QTLA 1FOD1 5E0OA 1PJBA 3NR2A 5ABJC 4MWSA 3RQIA 1FJHA 1P9OA 1UMDB 3UATA 4HSEA 1L3BA 3O1IC 2Q45A 4QYIB 4BDVB 4KDFA 2OHIA 4PIPA 1XMVA 4B35A 2AR0A 3HEBA 4Y7DA 1IVNA 5HGJA 4DRYA 3WRYC 2QVYX 2XCOA 4JVOA 4LLFA 4KLRA 3ZSKA 1NN1A 3KV3O 3DLPX 2YIVX 3L1VA 3S70A 4W1SA 5HBRA 3AHFA 2V7QD 1HETA 2NYAA 1L8LA 3LHSA 1UOOA 1ZPDA 3IAAA 4R3WA 2WKQA 1Z5UA 4YJ3A 1R3DA 3KKMA 2G7ZA 4IEPA 4RK4A 1RPJA 2XEXA 4BNTA 4P92A 3TRJA 4JQCA 5D8AB 1P17A 3MG9A 1AZSC 3O1SA 1GP2A 3U4CA 3POFA 1PNQA 3DEYX 5IKPA 1QRAA 1KETA 3L9JT 4AEDC 2WJVA 2JDID 3QMWA 4L4RA 3DXXA 3U0VA 4C7OA 1JLSA 1LULA 1ZBE2 2YBPA 2Y1CA 2QTZA 4Z7OB 4XOGA 1X80B 4G85A 3GP8A 4RS5B 1EUTA 3CV3A 4QNMA 4J0DA 1JQEA 2XJ4A 1K5HA 2I45A 4MW5A 1T9GS 4QPWA 1D4M2 5EE0A 1EDBA 3BH6A 3FDXA 3WG3A 3HJTA 2FQYA 2AKYA 1IEXA 2YPDA 2F55A 4FEYA 1VG1A 3BTSA 4G0OA 4KLCA 4L4XA 3ZIAA 4MVXA 1SA0A 4UUQA 1R7RA 4BNYA 5IX8A 5KYKA 5MDHA 4Z5XA 1DAHA 4FOWA 1JZ5A 3RRYA 1ZHOA 1RMU2 1PJQA 3BD8A 5EJ4A 3AVOA 4AGRA 1T4DA 1XPWA 4RD1A 5JYCA 3ZDXB 1UFQA 1RYZA 3GHMA 1SPPA 3DG9A 3KZCA 4B3HA 1KP9A 4LBQD 4X6XA 4KSBA 3PHMA 4PAWA 2TMDA 3C0KA 4ZVQA 4TYNA 1F8YA 2XBO1 4D3DA 2FPGA 2PMEA 4FDUA 2J07A 2QAGA 2YJ4A 4DABA 2D6PA 2QF7A 2ZGMA 2HLDD 2AX3A 1SKYB 4DUGA 1XAHA 2H3EA 1KI2A 3U81A 5KYXB 2AEJA 3IHTA 4JX0A 3R6DA 2ZRMA 4QPGA 4L4UA 3WGHA 3EGCA 2GC0A 1TUBA 3O8LA 5JOQA 3PUVA 2ZRAA 2YYZA 4B1MA 4JDPA 5ALWA 1N6IA 4M3CA 4BJ1A 5L9BA 1P74A 3WXPA 4Y1UA 4JQYA 1Y7PA 4M0KA 3U9LA 1S2MA 2B42B 1ULZA 1VCHA 4JGIA 4QPCA 1KP2A 3EZ2A 4W5HA 4LTNA 4NIHA 2H51A 4BVJA 1NY6A 3ROPA 2VQTA 2WMOB 3PT9A 2R96A 1Y9MA 3OZSA 1EGVB 3FZEA 1YNOA 4FW9A 3ZZ1A 4UVEA 4AULA 4IEOA 1OXMA 5BWMA 2XLGA 2EBFX 3O3MB 2PGAA 4LOTA 1OF4A 1QWRA 4X7MA 2DUJA 5BR7A 1NYRA 4R7GA 4U4AA 1P7WA 3T7SA 5BYNA 1JB9A 3NVDA 5BYJA 3NV7A 3CJIB 2HXYA 3GGSA 1MACA 3P1IA 3BJMA 2HMTA 4Q3OA 1O57A 4ZI5A 1ORIA 4OQYA 4CU8A 4UM5A 2MYTA 2FX3A 2P40A 2ZUUA 2VPZA 1UBTS 1H8TA 4PZYA 4BO1A 3EBOA 4Y1FA 4BU1A 1HMPA 3BQMB 4MGEA 1X15A 1PMHX 1V5EA 3KVBA 1WEKA 3LEIA 1BE0A 2HOQA 3TN92 1M2EA 4EB0A 1RWQA 2C9AA 1RTTA 4O2RA 2BHSA 5ALEA 3B7PA 4Y0AA 3N3HA 5L9AA 2OEPA 4EBBA 1EEXB 1NVAA 4WKNA 3FUCA 4NE7A 5CB4F 4CI9A 5FXMA 3DE2X 3GZJA 1YHNA 4FYKA 1POXA 2FPSA 1PO22 4UDYX 4RV9A 4OQNA 4QEKA 3AM5A 3PJYA 4TYPA 2C1ZA 4CDXA 1DGWX 4IOJA 4BEWA 1N5MA 4OBEA 3I92A 2AMJA 2C4NA 1E5QA 3ORHA 2O0KA 2IPXA 4FLMA 2E0IA 3THTA 3S29A 5C3OA 4UF0B 3UMMA 2FCUA 4AAXA 4UUBA 4D79A 2GHQA 3KTAB 2AFVA 5GV8A 5B7NA 3COWA 4FB4A 3B7GA 5J4YA 3TLZA 4NRMA 2QLFA 3O5SA 3ASVA 1Z12A 2WWVD 3EZYA 3ZIDA 2JFXA 1BQ3A 3R76A 1HT1E 1STMA 1OPMA 5FMDA 2J5QA 3AVVA 3FNGA 5GM2A 2JATA 4OH1A 3SNKA 3WFZA 5IUQA 2Z5VA 1VMHA 4WESB 1T8RA 4GA9A 3Q3HA 3U0ZA 3HEMA 1GPMA 1L7AA 4ZXKA 4PLYA 3WGLA 1I1EA 2FPIA 2W5UA 2ZK7A 4KU4A 1R8SA 2E18A 4HAIA 3HCAA 3NM5A 2Y66A 4ENQA 2YXBA 1YS2X 4AN1A 5IDWA 2Y27A 1II0A 1XMXA 2O1XA 2IYNA 3O9VA 2MINA 4JI8B 4JGZA 5DCYA 5TT1A 3J7AC 1P8JA 1CU1A 1AV7A 5BSKA 1NQXA 4JI1B 4R68A 1T4BA 1Y9EA 3B69A 4BQ3A 2FVYA 3FF1A 1CJCA 3RUEA 3PDWA 2YJGA 1KJ9A 1WOYA 3DHVA 1WMXA 4C7MA 4C07A 3MYRA 1C2TA 2A71A 1YFUA 4EYOA 1JHJA 2VMCA 1UKZA 4F4UA 4LHVA 3NW4A 1RUI1 1EG7A 2REBA 1NVVQ 5LXTB 1ID1A