4QQOA

Crystal structure of c1ql3 mutant d205a
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
130
structure length
130
Chain Sequence
KIAFYAGLKRQHEGYEVLKFDDVVTNLGNHYDPTTGKFTCSIPGIYFFTYHVLMRGGDGTSMWADLCKNNQVRASAIAQAADQNYDYASNSVVLHLEPGDEVYIKLDGGKAHGGNNNKYSTFSGFIIYAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Complement C1q-like protein 3
publication title Structures of C1q-like Proteins Reveal Unique Features among the C1q/TNF Superfamily.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 25
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 2014-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00386 C1q C1q domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4qqoA00
1S55A 3L9JT 3ME2A 2X29A 2R6QA 2E7AA 1U5YA 1U5XA 2WNVC 4E4DX 4QQLA 1XU1A 2JG8C 5BNQA 2WNUA 1DG6A 1KD7A 4TSVA 1O91A 3B9IA 4E4SA 3QD6A 4KGGA 2KA3A 4TWTA 5CIRA 3TWIA 3V56A 1D2QA 2HEYF 2OIIA 2QE3A 2Q1MA 2R30A 3MI8A 1KXGA 4EN0A 2JG9C 2O0OA 1ALYA 5L19A 3LKJA 4MXVA 1PK6C 1JH5A 2RE9A 5L36A 4MXWB 4QQHA 1DU3D 4MSVA 4F3JA 3B93A 3AB0A 4QQPA 2WNVB 4DOUA 2JG8B 3WD5A 3FC0A 3K51A 1OSGA 2HEVF 4N90A 4MXWA 4D7YA 1C28A 1JTZX 4KGQA 2WNVA 2HEWF 2JG8A 5KC6A 2ZJCA 3URFA 1TNFA 5HBAA 2WNUC 1RJ7A 3TYJA 1TNRA 4OUSA 4DB5A 4G4FA 2ZPXA 5KWRA 5TSWA 2TUNA 1XU2A 2TNFA 2JG9B 4G3YC 4OUMA 1OQEA 2RJLA 1A8MA 4HT1T 1PK6B 4NN0A 4GIQA 1I9RA 4OULA 1D0GA 4RSUA 2JG9A 4QPYA 3B94A 3ALQA 4KG8A 5KC5A 1GR3A 2Q8OA 1D4VB 2AZ5A 1IQAA 1PK6A 3QBQA 4QQOA 1C3HA 1OQDA 1WCKA 2RJKA 3K48A 2R32A 4QQ2A 2QDNA 1U5ZA 4J6GA 1RJ8A 2Z5WA 3IT8A 2WNUB
chains in the Genus database with same CATH superfamily
2QZ2A 3LCPA 4JCKA 3ZSMA 4IUGA 3CIHA 4OFGA 1O3QA 4GWIA 1VLNA 2WFF3 5ABJA 5A3WA 2AENA 2WA4A 3LWCA 2AUYA 4CP1A 3VUOA 4MOAA 1JMUB 5DZGA 4Q0QA 4AVAA 4RD7A 1XNBA 4K20A 3MBWA 1UX6A 2WNVC 4Q4W2 1VAKA 2JJ6A 2ZACA 5B2GB 2WWUA 4YVWA 3SNMA 1DG6A 4ZY9A 5JOXA 3POFA 4I09A 4IE0A 2WZ8A 4WM8C 1POV3 3H0OA 3LB9A 1R1A3 1W6NA 1HQNA 4ZZ8A 2WA3A 2KA3A 4HN0A 1SG3A 3VN4A 1HXS1 1EPZA 1NXD1 4DQAA 4DY3A 1W2TA 1C8NA 4COYA 2VMCA 1HKDA 4YG6A 4XURA 5A7QA 4MGKE 3GHNA 1SCSA 3H8OA 4EE2A 4UFHA 2DBNA 2VW0A 2HWC3 4Z8BA 3ZXEA 1LR5A 3OGVA 5FZCA 3WNPA 1AL22 1OVPA 3LOBA 3DPRA 4AF9A 5IFTA 1OMIA 3MW2A 4RQPB 4BA6A 1G6NA 1C5HA 2BTVC 3AXDA 3WF2A 2R0FA 3MLJA 3G6JB 3SKJE 4CEWC 1TMF1 3WD5A 4E2QA 1AJKA 4HPKA 3FC0A 4C1XA 3CF6E 1QJU3 3AFKA 2W1QA 1KEXA 1NZCA 5T3NA 2E9QA 2WYFA 4YARA 1OSGA 5AVPA 4AI9A 2IZWA 3IMMA 5BNPB 1F4AA 2EIEA 1NLSA 2EXKA 2XLGA 2C26A 1MS1A 1DP0A 5T5OA 4NVPA 1JYWA 1PHMA 4GD4A 3WEZA 1RUH2 4X8NA 2J1AA 2RS11 3WCSA 2VTFA 5I0TA 5E16A 2CAVA 4OI1A 4OUSA 4IEUA 5IHRA 1W3XA 1JZ6A 3U11A 2Q5TA 2A6ZA 3AM2A 3SCGA 4LXLA 3LQCA 4N43A 2DYCA 2R49A 3H7JA 5A6ZA 1JZ7A 3ZOIA 3AYAA 3HAGA 4EZ4A 2VZ3A 2VMFA 1O4TA 2CNAA 4Z2WA 2E53A 1YQCA 2PAKA 2XL7A 3NVCA 4WVZA 1R64A 2DF7A 2YB7A 3VL8A 3OJBA 1I9RA 4FCAA 1ZRIA 3F95A 3WNKA 4LLFA 1X8MA 4I0AA 2FZ2A 5F2SA 3AMQA 1S0BA 1QJX1 2ZGKA 5B4NA 4SBVA 4DEVA 2D3SA 2XVLA 5JDBA 4P9WA 4FPFA 2PQQA 3WUDA 4ZXEA 1VBB1 2Y0OA 3FHQA 3VHOA 4MGTA 1X8EA 4ZU5A 2DFBA 1WZXA 5DABA 5LBEA 1E5IA 2R32A 2RS52 3B9CA 3B69A 3KS7A 4QQ2A 3T2QA 4ZZ5A 3BI3A 1EYBA 4KWJA 1UKGA 1VMHA 4YZ5A 2WNUB 3UNPA 1W0OA 2ZX3A 5L7OB 2CYFA 5EXOA 4SLIA 1C8M1 3KCXA 1F15A 3VD9A 1BEV3 4BLJA 3N7MA 4Y20A 1R092 4RQPC 3VZKA 4HOOA 2FHRA 5A3UA 3RJRA 4GALA 2ARAA 4QX8A 2QQMA 4DRVA 1C1FA 3IIAA 5KXEA 4XDQA 4V2WA 5FZ8A 5IVBA 4IEYA 3USUB 2GH2A 4ISRA 1VAMA 5BNPC 5LK7B 4Q4W3 1IPSA 3AZYA 3DV8A 3OYWB 1E5SA 3RZLA 3M1HA 4BU2A 1X9PA 4NPMA 3VHNA 4BWOA 3IAQA 3OPTA 3CQOA 1EAH1 2HWB3 4UFJA 1WUVA 4YM3A 1LJ7A 2OT7A 3VBOA 1FMD1 4XJ9A 5GLUA 1H0BA 3B01A 3S5QA 4AK3A 1RUNA 3HD8B 3RS6A 1GWMA 5BNNA 1NG0A 3WNOA 4AAXA 2V4VA 1US2A 4DXSA 4A3ZA 1ULDA 2HWE1 4PIZA 2DCTA 5FFOC 3SMHA 4Z07A 4AQSA 4NAOA 5K8SA 3O1RA 3ZIWA 2JD9A 3U14A 2JDYA 2MHFA 4QQHA 3IPVB 4OHVA 1ST8A 4B4RA 4XVHA 2C9AA 2QBXA 1XE0A 3VBRA 2P37A 4FPJA 3HJRA 3K3OA 3GZEA 1AL23 1W90A 4ATFA 3O14A 5I0SA 2PHDA 1CPMA 3IAPA 3K4ZA 3S6PA 1DHKB 4CDWA 1ODNA 4BXSV 1RVF2 2VMEA 1JYTA 1RUG1 4K1ZA 4D7YA 3ON7A 2RDQA 5A7PA 4RR3A 1C28A 1F5JA 4MZUA 2IWGB 1ZRFA 1UYPA 4N53A 1OLQA 4WVWA 4A42A 5I0RA 2DBIA 1GNHA 2YFUA 4YSFA 1O3RA 3N35A 4IGOA 3URFA 1L7LA 2WNUC 3M3QA 1GMMA 1QY4A 4BH9A 2FDJA 2EF6A 1MZFA 5A6XA 4L11A 4KL1A 4BB3A 5L7OC 1XC6A 3GBFA 2AC1A 3NNFA 4GJYA 5FK7A 2Y6KA 2A1XA 3VZJA 1EV12 1RUH3 4NMIA 3WQBA 4C90A 4IEPA 3BYWA 1S0GA 4YW6A 5IWFA 4AVSA 3I97A 1OXCA 1DGWX 3NKGA 1Q56A 2DUQA 5KHIA 4ZS3A 3TB0A 2P17A 3CEWA 4BQXA 3IZOA 4ES9A 3OD4A 1DYKA 3DEMA 1UXZA 1I3HA 3BU0A 4UWDA 4XBQA 3CL1A 3B00A 5A70A 5B4XA 1URXA 4J1XA 4NOTA 3A4UA 2R0HA 1OLME 4QMAA 1SBDA 2ZGSA 2NQYA 1GWKA 2OUHA 1OH3A 4CE8A 5ABJB 5AC91 2VUJA 4FPOB 4I01A 2D6PA 4Y5TA 1YFYA 1MS0A 2B39A 5ERLA 5C70A 3LD8A 3U0ZA 1DFQA 4FPLA 1LOCA 4YVWB 2XMLA 5FY1A 2WR9A 2EIBA 1S55A 4AEDA 3AMMA 1FX5A 3HN1A 2RS53 4OMCA 1CQ9A 2CHHA 5L9BA 1BXHA 1FV2A 2C9KA 2K2SA 2W1UA 3HNMA 3PUHA 3ZR5A 1GP6A 3NRUA 4ZS2A 5JCTA 2UU8A 1WA4A 1LCLA 2VGDA 4M00A 3DL3A 4ZKTB 2D6MA 1F8VA 3PVNA 1R093 2CGPA 3ZKUA 4XXPA 1QOSA 2JE8A 4X6RB 1JYCA 1UYYA 2D3PA 3WT3A 1CJDA 2UWCA 4IEVA 4DXZA 3N4MA 3VZMA 4B4QA 3TEZA 2ZGRA 4Q4Y1 1JS9A 4XFBA 3SISA 3DPRB 1AYM2 5DAVA 3WDYA 2ZX0A 4NWVA 1BMV2 4MH0E 1BK1A 4O61A 1NZIA 3TBDA 1R082 3N7LA 1QWRA 4BQ2A 4QDSA 3RZKA 4HPKB 4ASKA 2O0OA 1MZ6A 4Z92B 3POEA 1HV0A 4QKFA 4CU9A 5I8TA 3NV3A 3LDBA 1BBT1 3QOPA 1MPXA 4L92A 3K3NA 5DQ0A 1N1YA 5F5CA 3ZM8A 4DUVA 4UW5A 5G04L 2AEYA 3B7MA 3E5UA 5C5TA 3DCQA 3JQWA 4R4XA 5DPNA 2BFUL 1VRBA 1ONAA 1QXJA 1AL0G 3POJA 4QM9A 1YIFA 2PELA 2YFZA 2GMMA 3JXSA 4H3WA 4S2DA 5FZ9A 4C0BA 1UZVA 3KT1A 4N43B 2OYZA 4FTBA 2UWAA 4Z2AA 2HYKA 3MIFA 3VBSA 1RB8G 3HBKA 2WFPA 3O7OA 2VL4A 1RUF2 2XJRA 1RVF3 4GAZA 4S2HA 1W2OA 4MGSA 4NHMA 3ETQA 4YVWC 5HCHA 2P3YA 3A22A 1W3VA 1H6XA 3U07A 4Q1PA 4LKFA 1UY4A 3FBMA 3THDA 4CXYA 5IFPA 4QB1A 2RR12 4E4ZA 4CEYA 3GCWA 2VTXA 3PUAA 5DDJ2 4HKLA 1PIV1 1RC6A 1JYNA 2WJSA 1W05A 1A8DA 2W3JA 3E5QA 3POSA 1MS4A 4TYSA 1AUYA 1AX0A 1EV13 1XRUA 2ZX4A 3GDBA 1CPNA 4K7JA 4LBJA 1WCDJ 1VR3A 2JE7A 1ZZ6A 3D82A 4IETA 4LPLA 1DCSA 4WV8A 4XEZA 1D0GA 5LEJA 3O0VA 4L9BA 1QQP2 1ZBA2 4KG8A 2WWSA 4MG2A 2A70A 4R9AA 4JX0A 2VMDA 2AZ5A 2CTVA 1CAWA 4BIOA 5F5AA 1Q43A 1CONA 1S1AA 1JBCA 2D3RA 3DPRC 2BVBA 3OOXA 4FOQA 3WW4A 4Y20B 4LO5B 3RWKX 1ZBE2 1MR5A 1K12A 4AZZA 3AJZA 1SDWA 2CGNA 4FP3A 4Y5SA 2DTYA 1PGL1 1JI6A 1O4YA 5HXVA 4OI2A 4IL7A 2WKKA 3C3VA 1WD3A 5EJ1B 3FUQA 2VAUA 3O0WA 2R1DA 1UCXA 1AX1A 5A3LA 4AVTA 3BUCA 3TEWA 1SMVA 2BRTA 4LULA 4B4PA 3AL5A 4JQRA 4D69A 3LSDA 3OUJA 4DUWA 1QGLA 3SCHA 5CAZA 4IW3A 4NHLA 1I5PA 3WDXA 1N3QA 3VBOB 1UY0A 4GZ9A 4D3WA 5KBFA 3FLRA 2BDRA 5EYYA 2C0ZA 1H9PA 4XPVA 3R4SA 5BYNA 2Q4SA 5BNNB 4AEMA 1Y43B 2WZPP 4N43C 3T2PA 2MEV1 4HN1A 5CIRA 1NA1A 1TVGA 1POV1 4FXGB 3ZSLA 1K5MA 2D6LX 4Q0SA 3THTA 2GP5A 2Y38A 4LOSA 4E9KA 3KMHA 3PMSA 4WVMA 5FDBA 3VBRB 2B45X 1W8FA 5KXCA 3NSTA 4UFKA 2QTWB 5L9VA 1X36A 1AYM3 4HK9A 5F5IA 5LZ6A 4RHV1 2P5BA 3T4HB 1G9BA 3N36A 4CDWB 5ABJC 2BGOA 3ENRA 2HWD2 4H7LA 5EPAA 4LBNA 1GV9A 1JH5A 3O5SA 1R083 1S0IA 1KS4A 1ASJ2 2JKXA 3IIIA 5H9PA 3OY8A 4MSVA 4RR3B 1J1LA 4UBGA 4IEZA 1WA6X 4N53B 4XUNA 1MEC3 5JI9A 1X82A 2HBUA 2WS92 1OF4A 1VB2A 5FPVA 3T4VA 5KR7A 4D8MA 1NLRA 2VZVA 3I59A 4QPWA 3NJZA 4P9JA 4LUMA 3FE5A 3IB3A 5T55A 4J1WA 3AMPA 4LBQA 5A80A 5GM0A 1CZVA 3F2ZA 3I2FA 1GANA 1QJU1 4CVUA 4AQTA 3B3QE 3KCYA 1SBEA 2ZA9A 4FPKA 3TRSB 1UN1A 4E8CA 3PLQA 5FY5A 2EXJA 3RI9A 1VE0A 3TEXA 5C3QA 4WM7A 3ZYRA 5G05L 5LRSA 2Q30A 3S30A 5LW9A 2PA7A 2VO5A 1UKRA 1LECA 1RXFA 4XAEA 1RUF3 5EFUA 2Z4FA 3HT2A 2XPJA 4AI3A 3Q8EA 3N9PA 4ARYA 1HQLA 2P2KA 1JN2P 4BYYA 4BM8A 2A75A 5F3IA 3KT7A 4Z82A 4RFRB 3O1VA 2CWSA 3IWZA 3VBOC 4FP2A 2A7AA 3LEIA 5DAPA 5FY4A 2RR13 3JUUA 1MS5A 5H9QA 4XTPA 4JDNA 5DDJ3 5BNNC 3RMYA 2YU1A 4N7IA 3LEKA 2DUOA 3LIGA 3OEAA 4AEDB 4D6QA 1A6CA 4QQOA 3QBQA 4L2NA 1RUC2 1ZX5A 2VD7A 4A6SA 2EIGA 4IEXA 4AW7A 1AR62 3SH5A 4XHBA 4XE9A 1KFUL 2GSYA 5DZEA 2D5FA 1W9WA 1ZBA3 3HPNA 1PGW2 3VBRC 4C91A 1W0PA 4AI0A 5FP9A 1P8JA 1H9WA 4QX0A 2YG0A 4Y4YA 3OUIA 1ZBE3 3BN6A 4CDWC 2VZPA 2G9GA 4M3CE 3RYRA 4QX7A 4ZPIA 2DCKA 4LK7A 1YFWA 4E8DA 1A3KA 2ET7A 4RR3C 4HSLA 1AF9A 5FBJA 4N53C 1W2AX 2IUWA 3BTZA 1XU1A 1BEV1 4FBFA 3R4DB 4XIKA 1PO21 4ZHNA 4BQWA 4OUEA 5C3SA 1KD7A 3L2HA 1RINA 1FXZA 1W04A 4QX5A 4CDUA 2PHFA 1X33A 4XMAA 4P5HA 4PT6A 4CCCA 5T5JA 2IXCA 1A34A 4W6YA 4FPEA 3C7OA 3H50A 4XDOA 5EQUA 3RGBA 4Q4W1 3MFAA 3G7DA 4GJZA 3OF1A 3ZR6A 2GH8A 3H9AA 3JD72 4OYUA 5F32A 2FD8A 1DZQA 3VZLA 5F3EA 2HWB1 4EN0A 4LT5A 2AREA 3DYOA 3HWJA 5BPXA 5J36A 2WLQA 5ANNA 5JSRA 1UD1A 1SFNA 4CYDA 2VR4A 2AEZA 3OCPA 4LMFA 5FYYA 2VCMA 2G1MA 1W8TA 2NYYA 3E6DA 3RI8A 1HRV2 5T5PA 1OT5A 1ZYBA 1IS6A 1UO9A 1V9U2 3VBSB 4I0WB 5AVAA 5GJ6A 5FY7A 3ZYIB 1VBE1 2Y6GA 1PM4A 4GQ7A 1W6PA 2HWD3 2J42A 3CU7A 3MV01 4R9CA 3OTFA 1ASJ3 5FLIA 1YRZA 5ACA1 4FI9A 4AEDC 1UPSA 4CUBA 1AL21 1LU2A 1ZREA 1XSQA 3WP5A 2RMU2 2WN3A 2ZEYA 2A6YA 1DGRA 4YGEA 4CEYB 2Z42A 3J7MA 1W6OA 2WS93 1IHMA 4IE5A 4HFSA 3CKHA 1NAEA 5KHHA 1BK0A 2UY8A 4QXBA 5FP8A 1JOJA 5HBAA 3LA2A 4XFFA 2Y34A 5APAA 1SZBA 5DG1A 3SC7X 2W87A 3NJXA 1RMU2 4O9GA 1UMHA 2EAAA 5FYZA 2OPWA 4H2AA 2YY1A 3MW3A 4W8JA 4LOTA 1AR92 3FFZA 3WY6A 1H4GA 1ULPA 1CAWB 2IC1A 3M4FA 2B9UA 4EN9B 1LGNA 5CG9A 1RUH1 4WBBA 1LHOA 3RJ2X 4QU1A 4BXFA 1Z78A 3THCA 3AMNA 4AVCA 1KFXL 2RG4A 5HXMA 1EUUA 5CKMA 4AE2A 2FCTA 2YROA 2R071 1UL9A 2XBO2 2JG9A 5EV7A 1Z0HA 1LGCA 2WN2A 1H1AA 1LKNA 2WABA 3A7QA 4INDA 3S7IA 2PFWA 3VBFA 2DWRA 2QDRA 4YGBA 4P00B 5CISA 4HVOA 2ARXA 2VCBA 3OBTA 2XDVA 1VRH2 2XQXA 2G9FA 2VG9A 2Y6HA 3KD4A 3NNGA 1R1ZA 3VV1A 2V09A 5I91A 2EICA 2OA2A 1BKZA 2Z79A 2F6BA 4GMP0 4GA9A 3ZFFA 3ZYGA 1AR72 4C8DA 1QJY2 4CUCA 3WOGA 3J26N 1RUC3 3ZXFA 4AHZA 2KR2A 3LA3A 1AR63 2ES3A 4LO8A 4GWJA 3VZNA 3UT0A 1MS8A 2ZGQA 2FBEA 3H1YA 3WNLA 5FUIA 4CEWB 1OBNA 1C5IA 4CSWA 3VBSC 2PHTA 1NA1B 2VBDA 2RS51 2VNOA 3CJIA 3HNBM 3EO6A 3LPFA 2GNBA 5FYSA 4PBPA 1W03A 4PDWA 4BK4A 2J1UA 5FPUA 4WVMB 5BNOA 1J84A 4HMZA 4HVQA 5CNAA 1UXXX 1N47A 3MF9A 4H55A 3ZMOA 1BQPA 2XUEA 4AEJA 4E4HA 3WF1A 2A3XA 5A33A 4CEYC 4MADA 4BDVB 1K42A 3V56A 5J96B 4ET7A 2D93A 2XVGA 2ZGMA 2HYXA 2JWPA 3WW1A 4M4PA 2VVFA 3OY8B 4MGIE 5IVCA 3N7JA 2LRPA 2OIIA 2XXZA 4AWDA 5C6CA 1JYIA 5H9RA 2RDNA 4AHYA 4EJRA 5K7PA 4M0HA 4Q5OA 2WNOA 3AKRA 2DDUA 1WCQA 4N8MA 1CAUA 2VXRA 3I59B 4W4ZA 5F5QA 3BALA 2BZDA 2A3WA 5IK5A 3JD73 4DXRA 2VBBA 4BQYA 3I7DA 4LBQB 1AJOA 3MIHA 2D5HA 4AI2A 3VZOA 1YJKA 2PQSA 4Y4RA 2BOIA 2VMGA 3I2HA 1WCUA 2YBPA 3R4UA 4O7XA 4Q29A 3V0BA 1HRV3 3Q8FA 2AH2A 4WM7B 1OKQA 5DN2A 2VH9A 2HEVF 1AXYA 1RUE2 1SBFA 1V9U3 4Q0UA 4XF9A 4NO4A 2GNMA 1VMJA 1X9TA 3EMRA 3TEYA 4N9IA 4P02B 4JKLA 1H2LA 2E26A 1VALA 4FOVA 1DDLA 1HJFA 1KDKA 1NX9A 2YGMA 2XGXA 1UY3A 5FKBA 1QIQA 4IERA 5EJZB 5KXBA 1LOAA 1ULFA 3AC0A 1PVC2 1WLDA 2VZ1A 5DUWA 2C6SA 1YEWA 1OQEA 3USSA 4XFIA 2P6CA 2RS32 5FAXA 3ZLIA 3AZZA 2GMEA 4QXKA 1IS5A 3MW4A 1NA1C 2W39A 4FOYA 4YM0A 2RM22 4NN0A 4ASMB 1OLMA 1RMU3 1V6LA 1K5MC 3PDQA 2RVAA 2W0XA 2K0GA 3H42B 3HIFA 4K8FA 3WP3A 1AR93 2W52A 3H1WA 5JOWA 2GC2A 3RMXA 2WO7A 3OG2A 3WSOA 2UYAA 2A6WA 3WQ0A 1D7PM 1TE1B 1W8OA 2E33A 2ZGPA 4DUXA 5KC5A 1UPIA 4WZCA 4Q4V2 1LU1A 3RVHA 5A3PA 2LM3A 1LENA 3AL6A 2XHNA 3ACHA 4FFIA 1FNYA 4IDZA 4YW4A 2DVFA 1I5ZA 1AR81 2XBO3 4K3UA 1U5ZA 4J25A 3DYMA 2YPDA 5LBCA 1QNYA 2WLPA 2ZBJA 3FMGA 1COV2 4LKDA 3EXUA 2VNGA 5A1LA 2FCVA 1VRH3 3MIGA 2SLIA 5C4WA 4CDQA 4RS5A 3PMEA 4A2UA 4JHTA 3T0DA 2GMPA 4XTMA 1CD3G 4U36A 4G9SB 1AR73 4CDUB 3D0JA 3N9OA 1W6QA 4PLNA 1QJY3 4DS0A 3I49A 1OKOA 3VDBA 4N9HA 2ZZQA 4E4DX 1HRI2 4QQLA 4LIVA 1NE4A 5JUVA 1SLBA 2DU1A 1LTEA 4M4RA 1F4HA 5IVVA 3KV5A 3MICA 2UY9A 4WM7C 2PLV2 3KQ4B 3OD0A 2F4PA 3BPZA 4E4SA 1DGRN 4W6WA 4Y1VA 1HB1A 1C1LA 4A7ZA 1FPN2 4KNCA 1EY2A 2CGOA 4V2VA 1ND2A 1O5LA 2VQTA 5C8CA 1DZRA 1J3RA 3OEBA 4ATEA 1D2QA 1GQHA 4CP0A 1WW7A 1GSLA 3PU8A 4AR2A 2PHWA 2WT0A 4PJYA 3T09A 4LLOA 5A1FA 2R042 4FT8A 1IPJA 2WT1A 2WINB 2DUPA 4GB31 1KXGA 2VUCA 3I2JA 4IXLA 2R7EB 2VZUA 5DAQA 1W6PB 5C5UA 2WL1A 2Q1ZB 4XC9A 3O1PA 1G7YA 3RSJA 3QH6A 5T5LA 2RJ2A 4CRQA 1Z7S2 1UY1A 3HNYM 1WMEA 4LBKA 2E31A 1AYM1 4F7ZA 3B93A 4GH4A 1VPHA 1W6OB 3PL0A 2UURA 2GN3A 4ARXA 3T1MA 1R081 4QPGA 4UF0A 5JXGA 2XJQA 4JAAA 1LOFA 4QGMA 1OA2A 3CNAA 1FOD2 3W5NA 3JQXA 5FYTA 3ZVXA 2EXIA 4XZPA 1MEC1 3FWEA 3MIBA 4Y22A 3D4KA 3M3EA 4MXWA 3FBYA 2WRAA 2VULA 5C71A 1DQ1A 1AXZA 3MIEA 3ASIA 3PU3A 4LA3A 2QQLA 2JG8A 4AGRA 4AQ2A 3RZGA 1DQ5A 2ARCA 2CWMA 3AP9A 4RFT0 1TNFA 1JUHA 2VUAA 4TTGA 1RJ7A 1RUE3 2Z2SB 3ZPYA 4JTOA 5D2AA 5FMBA 1YXWA 4PLOA 1XU2A 5FMCA 4RGKA 1GZTA 1TG7A 4LO7A 1QEXA 1ZRRA 2I07B 2JG9B 1H30A 3SLIA 4OUMA 4CDUC 2WSVA 2YBKA 2I74A 2RJLA 1V6IA 4HLTA 2VOXA 3LA7A 4QX2A 2BNOA 1W06A 2Y6FA 3VBFB 1LULA 2X10A 2OPKA 3WW3A 4HETA 4C0HA 5F3GA 4UFLA 5C3RA 2Y60A 4LBOA 4I0BA 4QU2A 1O8SA 1RUF1 1YQ5A 2DCJA 4LIUA 4DFSA 4BOWA 1PVC3 4ITCA 2OQ6A 3AP5A 3ZFFB 2WAOA 2RS33 2DTWA 4OLLA 1UYZA 4FTSA 4LBMA 1SDDB 4M01A 1S2EA 5FYIA 4FTEA 2RM23 3ALQA 5M0TA 1GWLA 1W39A 2Q8OA 4LUKA 2ZEXA 2RR11 1IQAA 5LY1A 2QQUA 1YUDA 1OI6A 4KBBA 3ZYHA 2CL2A 2XJTA 3GF6A 1FI2A 2BWCA 4XF1A 1AHSA 1ACCA 3OB8A 4RGAA 3S57A 2XH6A 4D7TA 5FUPA 1ENRA 4Q4V3 1K45A 3CJIB 3H7YA 1RUOA 2V5YA 4FO9A 3UGFA 2O8QA 4PDWB 1BJQA 2OXBA 5A7NA 1H2KA 1OA4A 5BNOB 1UZZA 4GMP3 1TMF2 5JPNB 4UYBA 2WIIB 1KQRA 1RHI1 5AFEA 2TEPA 1VBC1 3HMYA 5JXHA 1COV3 5A33B 1PM7A 3GZTB 4JDMA 5LA1A 1G9DA 3BKZA 3HT1A 2VTXJ 3ATGA 4IE6A 5BNQA 3RZMA 4JC1A 2XLAA 1DF0A 3BTXA 4YFWA 3T0BA 3B9IA 1ENSA 4CA9A 2QQKA 2RS12 3BCWA 1LNSA 2W1SA 1HRI3 4Q4X1 5E6HA 2PXJA 5I0UA 4COUA 4XFAA 2VY0A 1NT0A 3HN3A 1CAUB 4TWTA 3RYPA 5FCCA 4XFHA 5IVEA 1PNGA 1YQ8A 2PLV3 3VGIA 1G9AA 4QGNA 3WVJA 5CBLA 4AOCA 1UOJA 1IPKA 2ZEZA 4HKWA 4DNYA 3UV9A 2VW1A 3HBZA 1S2BA 4XCBA 3VLBB 3WINE 4AI8A 3POBA 1TZOA 1W6NB 4NJ4A 4Y1YA 3M70A 1CJPA 2JG9C 3J7NA 3V0BB 1ALYA 1KITA 1JZ5A 3GZUC 4BISA 2Y8KA 3LF7A 1DGLA 3VBFC 2VC9A 5D8AA 1DQ6A 5SV8A 2XLFA 5GZDA 2R043 2RE9A 2VCAA 3SXWA 5FZ7A 3T2OA 2JB8A 3RYKA 4OMDA 4JV4A 4UOJA 1VBD2 2HLEA 3ZFFC 1VBB2 3D0SA 5FZEA 4AFBA 1Z7S3 2E6VA 3PTRB 2BERA 3UESA 4L0PA 4XQ4A 2WO3A 3WXPA 1CIYA 2NP0A 3CZJA 2HWD1 3AX4A 3ZKYA 1O4ZA 1WLWA 2BPA2 3WP4A 4EROA 1RL3A 1D4M2 1C8M2 1PZ7A 5IAVA 3VHPA 1LAJA 1FOD3 4R52A 3KF3A 3CJIC 1O5UA 2W94A 2DVGA 3MV11 3WF3A 1RUI2 3V64A 2JKBA 2A6XA 5GLWA 3BODA 4PDWC 2FQPA 4QWNA 1JZ2A 2NZ9A 1IOAA 4YVSA 5BNOC 3CJXA 1KRIA 2WQZC 4MUVA 5GLZA 4UW6A 3T1LA 4G3YC 4LBQD 3WLUA 4ES8A 3K46A 1BVVA 1LHUA 1SPPA 5FBZA 3A0KA 1I6XA 3I3BA 5BV6A 5LWBA 3WW2A 2BFUS 5FYCA 5FXZA 4MHRA 2V5DA 2P34A 4M0NA 3ZXAC 3ZFGA 1L3JA 5FY0A 2JDUA 2W68A 3SH3A 3ZXLA 5FO7B 2WZEA 1EAH2 1XSRA 4RSUA 2XJUA 4CPBA 4M3CF 3AP6A 3I3EA 3R6SA 5AFBA 5C4WB 1H1MA 3ZIXA 3DECA 4CDQB 1W2UA 1SACA 4GULA 4JQTA 2VPVA 4RS5B 5GZGA 2VZOA 3MLKA 5JIAA 2XHKA 1WCKA 4QKBA 4YG0A 1W6QB 2XONA 4M3CA 4B29A 3MGUA 3PUIA 3PIGA 4J6GA 1RJ8A 4P9YA 1LHWA 4YZ4A 5CG8A 1QMJA 1PMJX 1E5RA 1J3QA 1W8WA 1QH6A 4XIOA 3UGGA 1CWPA 1RXGA 1KS5A 3R0RA 5FXVA 5A3OA 5J98B 3VBUA 4MLOA 2J7MA 2WQ8A 4EZHA 5H9SA 2A5ZA 2ZHMA 2X09A 3L9JT 1CAXA 1UOFA 5F2WA 5F1RA 2OS2A 1AR61 1ND2B 2BVVA 4YZ3A 4BMEA 5C8CB 5FZBA 2FMYA 4P9LA 4DY5A 4LEJA 4XZUG 3KZ4C 5A7SA 1PGW1 2JDMA 1MVQA 2Y33A 5FZ6A 5IYYA 1Y7BA 2ZHLA 3ZDSA 5FZOA 1W9YA 4BQ4A 4D7SA 2FDKA 1UMZA 3UKTA 3VBHA 3VKLA 4A45A 3RRDA 3U4SA 3D5OA 1K5JA 1Q8OA 3LGRA 3ZO0B 4IESA 4JTNA 3U37A 2RS13 4I3PA 5FYBA 1W99A 1UOGA 1QHDA 4UAPA 5CFCA 3ZXDA 3HEIA 3HOBA 1UF2C 3I2IA 4GH4B 4K8RB 4XABA 1KJLA 1Y9GA 2JXAA 1G9FA 1UU5A 2W5FA 3KHBA 4QPGB 4UF0B 5FY9A 1G9CA 4FFFA 4FFGA 5CFDA 1LB2A 2F4LA 1HX6A 2WFF1 4A4AA 2PAMA 2KD7A 2V4AA 4Y22B 4MXWB 1S0EA 1XPWA 2B4KA 3FZ3A 1TME2 5EWSA 4ZU4A 4MX3A 4NPLA 4F3JA 5LBFA 1SFYA 5FZKA 2KM2A 3RG0A 2JG8B 3C8XA 5FYHA 4YZ2A 1ULCA 3JD71 2D40A 1O59A 1UNBA 4JHZA 4RGGA 5CKQA 4BPZA 5AC92 5A1AA 5GKAC 1XBFA 2ZX2A 3E1F1 4LHLA 5C4WC 4CDQC 1RUD2 4CZSA 3SITA 1STMA 5F9TA 4RS5C 1VBD3 1R1A1 4BZ4A 1W8NA 1GZCA 3GZAA 2VVEA 1JTZX 2QFEA 4XBNA 3VD3A 4DRRA 1IS3A 4CDXA 1OD5A 5J7MA 1SHWB 3BPSA 4LHKA 1VIWB 1V9U1 5EJ3A 1JYXA 3WQ7A 1E5HA 3PVBB 3PVEA 1UMIA 5JOZA 4Q8LA 4TN7A 2TUNA 2TNFA 3WF4A 1D4M3 1VBA2 2HWC1 3QACA 3NL1A 1CESA 4UBHA 4WZFA 4XOGA 3ZMNA 4BIFA 1RUI3 1A8MA 1ND2C 1DYPA 5C8CC 2ZX1A 1IG3A 1VP6A 2CSGA 2YC0A 2P3JA 2VZRA 4XJZA 1V6OA 5I0DA 4D0QA 4F83A 4LKSA 2VOTA 4RYDA 4YM1A 5GZEA 1T6BX 1RMU1 3ACFA 1BHGA 2QZ3A 3LEGA 3ZSEA 3GBGA 1CGPA 2Y6JA 4HBNA 4HK8A 3BVCA 2O14A 2HWF2 2PAEA 1AR91 3AZWA 3ZN6A 1XB9A 5CVRA 1GQPA 1QU0A 4ORFA 1EAH3 3OGGA 5BXXA 2VMHA 2YYOA 4GH4C 4Y24A 1Q5OA 2XVKA 5HPOA 1APNA 1GFF2 1BBT2 5LCWL 4W6XA 4QPGC 5CA6A 1OOPA 3GJBA 3IDAA 1JXNA 1LOFC 1GOHA 1YLLA 3HQRA 1JHNA 5C9AA 1BZWA 5LASA 3M7AA 3BOWA 2BWAA 1W9TA 2IXJA 3POGA 2BU9A 1VRH1 5K9YA 3MPPG 3POIA 2E7AA 4LHNA 3DUIA 4IEOA 4KU7A 5JMOA 2DV9A 5JXIA 2JG8C 3ZPOA 5FPZA 1AR71 5A3TA 2ATFA 1QJY1 3J8F2 3NKTA 5F6KA 4K6BA 1Q8PA 3PUQA 2BQPA 2BNNA 2YV8A 3MIDA 2BOJA 5JIUA 1UAIA 4K40A 4XJAA 1ZZ7A 1QQP3 2ZS6B 4PF1A 4YGDA 5LATA 1UW8A 1H8TA 1U12A 4HVRA 4P08A 5SV5A 2BEOA 1DQ4A 2JE9A 3LEMA 5D8AB 4YYOA 4BCUA 3KGZA 1I1EA 3UJQA 3ZXKA 3IM0A 4RL7A 1PX4A 1S0JA 1ZM1A 2HEYF 1LODA 2J1VA 4BQ1A 4OQ9A 2QKDA 3N9MA 2QE3A 3AKTA 1HJGA 3U75A 4I02A 4URAA 4DIQA 5FZHA 3NV1A 5CADA 5HV4A 1NE6A 1NOVA 1ULEA 2PHXA 1JZ3A 5L19A 4R9BA 4OHZA 4FPGA 2W1WA 5FZMA 3OPZA 3LIHA 1JOPA 4PLMA 5DUVA 5FRAA 3THPA 4XAAA 1WW4A 5ANQA 5BY5A 1MZEA 5J37A 3OGJA 3VDDA 3S5AA 3T2TA 3PIJA 3T0AA 3INAA 3ZSKA 4YM2A 3EBRA 4NRMA 2DVDA 1H4HA 1YJLA 3PNAA 5F7UA 1NYWA 3FN9A 3AFGA 3Q8CA 3NWKA 5DG2A 5IUQA 3VKMA 4AVVA 5A3NA 2D43A 1TME3 3NNJA 4P5YA 5FZGA 2H0BA 4YVSB 1EPWA 1V0AA 1KGYA 1W9FA 3P3NA 3SCFA 2LALA 2VXJA 3JB4C 3U10A 1SLCA 2K46A 5FPAA 5AC93 1UU4A 2IFRA 3EHKA 4ZONA 2B7YA 3RZZA 1SPPB 3ETPA 2FMDA 2JEMA 4IV1B 1RUD3 3WZ1A 4QDRA 1E57A 3NQHA 4RN5A 4QPIA 4NIGA 3B02A 2ZPXA 3K4DA 3KHCA 3ZFGB 4UXAA 3DKQA 3TNQA 1IZ3A 3E97A 1RUE1 3NW4A 4PIXA 3VB9A 1HLCA 3DN7A 2ETEA 1F31A 2ADEA 2ZCWA 3J7HA 5EIYB 4D6SA 5FK8A 2BBAA 2RDRA 4JDOA 5T50A 2Q8DA 3O1UA 3CHXA 5KHJA 3LFMA 1VBA3 2MEV2 4QXHA 1AXKA 4JGZA 4M3CB 2YBSA 1NCRA 3NV2A 4OULA 1FYUA 3QCWA 5FZLA 2YMZA 2L9LA 4O65A 3SHRA 4PI0A 1PVC1 2VZQA 1B35A 3I4IA 3VBUB 5FPXA 4YPJA 5D8AC 3ZX7A 4NIAA 3N9LA 1N3PA 1CAXB 2RM21 4RHV2 5JLVA 2YZ4A 1ZZ8A 3GYDA 4HXCA 4HL0A 5LA9A 1S0CA 4GKYA 1AVBA 1WW5A 2PYTA 2VUDA 3MEPA 2HWF3 5C3OA 2H6CA 3KB5A 2IXIA 2EIDA 2XB6C 4KH9A 3USUA 5FZOB 3B5LB 4EQVA 4NPRA 1BBT3 5FZ3A 1XYOA 3N3HA 1WLTA 3VBHB 4QHBA 3I8TA 1RITA 5I8YA 2ZHKA 4V1PA 3FLPA 4GMP1 4I3GA 1W0NA 2XL9A 4NR1A 1X7NA 2JD4A 4A41A 4EN8B 3OBAA 1MZ5A 1YIPA 2JIGA 3FHIB 2DVAA 3SQOA 4TLGA 4AI1A 4CUGA 1QJU2 1COV1 2V73A 4NHXA 5CFCB 4BLIA 3OUHA 1GNZA 3W20A 4XYXA 1A78A 4YVSC 3M3CA 1ZRDA 3OGSA 1PO12 5DXDA 5GLVA 3TNPB 2C4XA 2BYVE 1GNYA 1GYKA 5CFDB 1ZVFA 2G19A 2ZMLA 1U5IA 3NO8A 3J8F3 1WWYA 3ES4A 3P3PA 1H2MA 5FZ0A 1NLQA 3TAYA 1HRI1 4QHOA 1IKQA 1PNFA 5L73A 2W95A 3ZFGC 5GLTA 2HJIA 1WMFA 2XG3A 4FFHA 4MGYE 3ES1A 4RA0A 5DUXA 4PCRA 1ZRCA 2DU0A 3D3AA 2XJVA 4XJWA 4BK5A 1H1IA 1OUSA 1O3SA 1K5MB 4GXLA 3K77A 2Z69A 1ND3A 1UZWA 2EXHA 3WX5A 1NY72 1F35A 1XE8A 5FYVA 2R062 4H14A 2ZTNA 5F6LB 4CDXB 4NRPA 3WDVA 4DOUA 3RZHA 1SLAA 4NWWA 4CCMA 4FXKB 2HH9A 2R041 5D21A 1MVEA 1R091 1BYHA 3I2GA 4CP2A 1LEDA 2VQAA 3TN92 2W91A 4PQ9A 3VBUC 3VD7A 1GUIA 3OPWA 4CU8A 1MS3A 4R4ZA 1OQ1A 1Z7S1 1OFSA 5IK7A 1W8UA 3C7FA 2NMOA 5CB7A 3KWVA 2HEWF 4FOWA 5KC6A 4XFCA 1AYN2 4EWDA 4YWAA 4HONA 5FMOS 1OA3A 1N1VA 3LOIA 5TSWA 3H8RA 1XNDA 1BEV2 1FOD1 2DCYA 1PO22 2XOMA 4UT5A 5IT6A 5LA0A 1NXMA 1POQA 1V70A 5FLJA 5FQ0A 1HDKA 3VBHC 2WQ4A 3UL2A 4JKMA 3WNXA 4P9GA 3ZN6B 4C1WA 5FZ1A 1F2NA 3ELNA 2GNTA 3ACGA 3AYEA 5CFCC 2X5IA 4UW4A 2WYSA 2E32A 2WO1A 2W2IA 2WSUA 4QPYA 3KVBA 4MGZE 4URTA 4XF3A 1HV1A 3O1OA 1OOPB 2D6KA 2JENA 3APBA 4OZOA 1D4VB 5FMDA 5CFDC 2JDHA 2MEV3 2IVIB 2VJXA 1PK6A 2HWB2 3HVDA 5FJKA 1OPOA 2ADDA 5C9AB 2XWBB 2NM1A 2BJSA 2RMU3 4HZFA 5JWPA 3C7HA 5A7OA 1XNTA 1RVF1 3KV4A 2YGLA 4LITA 4IGPA 3A23A 1G8WA 3AZVA 1YWKA 5EHDA 3WG4A 2Y64A 4RHV3 3ZSJA 3M8LA 4KMQA 1VBE2 1FATA 4FPHA 3H3LA 3ME2A 2K9ZA 2AACA 3CLPA 5ACA2 1H8TB 4X8PA 1FNZA 4CDXC 2A71A 4FPCA 5FKCA 3ZYFA 3VDCA 5JVVA 3I3QA 5FXXA 4CP9A 4LE3A 1EV11 1QOTA 3AYDA 1XYNA 2FDFA 2G4IA 4QD2A 1YC61 5IVFA 2WZR2 1RUJ2 3W5MA 3AMHA 2P1BA 3FUOA 1JUIA 2OZ6A 3K2OA 3SEEA 4TLFA 5HCFA 3UGHA 5I93A 2OKXA 3E6CC 2E7TA 3UKNA 4ASLA 1REDA 3LDRA 3VDDB 1PO13 3HR9A 3WG1A 3IDEA 4PQQA 2Y0IA 3MI8A 1GOFA 1MACA 4Q2FA 2W08A 2ZKNA 4IEWA 5FO8B 2AGSA 5FYMA 1IQDC 5IK4A 2XUMA 3Q9OA 4JRLA 1AX2A 5IJRA 3NJVA 4YW3A 1PX3A 4U2AA 4AVBA 2R072 4CCKA 3ITQA 1YI7A 4CCJA 1QJEA 2VOWA 5FO9B 2ORZA 1UX7A 3MDPA 3QLQA 3AB0A 2ZGTA 4Q0PA 4IV1A 4OHXA 5LA2A 1GBGA 4LO4B 1REFA 1OC1A 2SBAA 1OOPC 4QPIB 3GXUA 4MHUA 4KWKA 4EWAA 5DMYA 4JKKA 2R063 5C9AC 4P14A 1TQ5A 1GZWA 1OFNA 3GNEA 3MF6A 2AR6A 4CXXA 4K21A 1WKYA 4BQ5A 2NN8A 3EJKA 5HCBA 4LHSA 2C24A 3TN93 2JX9A 3ZYPA 2W47A 4XILA 1VBD1 4MVTA 2NPIA 2Q8EA 4CXWA 2I45A 1ULGA 4JGZB 1XNAA 1XQNA 3GALA 1NCRB 1HB3A 4QX3A 4COWA 3H8UA 1SQ4A 4UW3A 4LKEA 3ZFEA 1AYN3 3E6BA 1ODMA 3Q8AA 3AJYA 5A32A 3J9SA 1H8TC 2D7FA 2R1BA 4Q8KA 3VD4A 5LEKA 3SKVA 1BMV1 1B35B 3E5XA 5LK5A 1LOBA 2BUKA 4Q27A 4Y1ZA 1CVNA 1D4M1 3MHZA 1UY2A 5LB6A 3KV9A 1OUXA 4K1YA 3C7EA 3JBG2 4FAGA 1OD3A 1PO23 1RUI1 2J22A 5FREA 1O7FA 1YNAA 4META 2EVXA 3UK9A 3B94A 2WWJA 1CZSA 1GR3A 1PGSA 3U4XA 1ENXA 2E63A 3VDAA 2B9VA 1Q8VA 2OZJA 3WHUA 3PURA 3IKWA 4CCOA 3NAPA 1C3HA 1OQDA 2XJPA 3VDDC 3LDKA 1IGOA 1WCSA 2WBKA 5JZGA 5FP7A 2V72A 5EZWA 3IBMA 3SEPA 1J3PA 3T30A 2OX0A 2IVJA 3H3UA 1JZ4A 4CPBD 3ZYJB 2P3IA 4LE4A 3I54A 1C4RA 4GWNA 3ZN5A 1ZZ9A 3LFIA 2VQUA 2QCSB 1QJZA 1HXS2 1IS4A 2MNGA 1H8VA 2QQNA 1OVSA 1U5YA 2VE1A 3LPGA 2JDKA 2PTMA 2X53S 1S4CA 1U0AA 2YC4A 2A3YA 1VBE3 3BTAA 1F9KA 3MPBA 4QPIC 2J1RA 3GHMA 4MYEA 1O91A 5ACA3 4QT6A 5DDJ1 5J1XA 3NJYA 2TBVA 4OVEA 3QD6A 1T6GC 3ACIA 4B7KA 1KDMA 4KGGA 1Q8SA 4NRQA 1DYOA 2FDIA 3J4UH 1JHJA 3TOJA 1MQTA 3IMNA 2ERFA 2JDAA 3O0XA 3Q8BA 2BV4A 4XW3A 2FDGA 1LOGA 4B3NA 2WZR3 1V6JA 3FHAA 1RUJ3 5JPMB 2EA7A 1ND3B 1QQP1 2YHJA 1OURA 1ZBA1 3CDZB 1NQDA 1H2NA 4EN7B 4JGZC 1KJRA 2VECA 2Q1MA 3WR0A 1NCRC 2JDZA 2RDSA 3GCXA 3IN9A 4QKNA 4QM8A 4KU8A 3RZJA 1ZBE1 1MS9A 1CAVA 3LKJA 3RFRA 4MXVA 1B35C 5JAXA 4UFMA 1DLCA 5E89A 3WNMA 4AEKA 3K4AA 5DAXA 3OBZA 3WHTA 3A21A 5FXWA 2OVUA 5IW0A 2QQPA 4PBOA 4NIHA 4H7MA 1QDCA 5I8SA 1L7QA 1OPMA 4LORA 2YPJA 4LO6B 1DGWA 2R073 1DQ2A 1AR82 3PHMA 1OF3A 3ZN4A 3KV6A 4XJUA 1W28A 5A7WA 2QQJA 1OLRA 4LTAA 3OBRA 1FPN3 4EWEA 5FPBA 5C7GA 5FQ0B 2FZ1A 2VQ0A 1OH4A 1WBFA 3NV4A 4AFCA 5JXJA 1TME1 4JGYA 5ISLA 3VD5A 5D1IA 2WC2A 2J1TA 2H6BA 1LHVA 2P6HA 1HN1A 2XKOA 3RPQA 3UYJA 4AGGA 5KHKA 1HIXA 4JRAA 3WF0A 3X29B 1G86A 1QJX2 3NMBA 4IV3A 4Q26A 2X5IB 1RUD1 4IEQA 1QXPA 2PHLA 4ONUA 5IVJA 3KM5A 3H8XA 1LESA 1J1TA 3KSCA 1HB4A 2D6OX 1PK6B 2BBVA 3V65A 1QJFA 1LGBA 2PHUA 3LZZA 2P3KA 4FVVA 3RQ0A 1CIWA 1LEMA 1RIRA 2QUOA 4OCTA 4LJHA 2ZKLA 5C8WA 1ZZCA 1UU6A 1ASJ1 2NMNA 1NCQA 4KWLA 1VBA1 4EV0A 5KHGA 3JBG3 2GNDA 4A7KA 4GB32 4Q0VA 1D2SA 2HBTA 3AK0A 3K48A 1ND3C 2RJKA 2WS91 5K0UA 5FJHA 4A6OA 2GU9A 1UQXA 3WDUA 3W21A 1UWWA 1YYNA 4CP9B 1ZNPA 4MO3M 3W58A 4PIYA 1VB4A 3AVRA 4QX1A 4CCNA 5LRRA 4HANA 3U1XA 5J09A 2GZWA 4NHYA 2OW4A 3ZDVA 2FCUA 4KG0A 2HWF1 3POYA 2JB4A 3DKWA 4XUTA 4B1MA 5GALA 5J3UA 3EQEA 3ORJA 3OGRA 4X6QB 2X29A 2R6QA 2ZGUA 1MEC2 3W59A 4EYUA 3WCRA 1FMD2 2IXHA 1X50A 4GWMA 5A6YA 3M2MA 3QH7A 4KQ7A 4PHZA 1HW5A 4TXWA 1HXS3 2ZGOA 3PJYA 2VMIA 4UI9L 4TZDA 2ET1A 4YRDA 3GGLA 2HWE2 4QKDA 2O1QA 2IXKA 4NHKA 4LNVA 1JZ8A 3P5BA 3DGTA 2WO2A 4D6RA 3WDTA 4OQ8A 2RHPA 4IQPA 3ZXGA 2D97A 1PZ9A 3BIWE 4P9XA 3BTYA 2MPFA 1W2NA 2ZHNA 3NNMA 3WG2A 3ST7A 4XETA 3IDCB 4WVVA 2PHRA 1AZDA 5HCAA 2R30A 3BU7A 3J8F1 3I2DA 3W9AA 2X5IC 1RUC1 2ZGNA 3CO2A 2ZGLA 1W8ZA 3IDBB 1IKPA 3N9QA 2BGCA 3AYCA 4QAWA 2GDFA 4XFGA 3MUZ1 1N1SA 2A73B 4PF5A 4XUQA 5FMOL 1RUG2 5C3PA 5GZCA 3BGAA 1V6KA 1W6MA 3UJOA 2LTNA 2BNMA 1W8HA 1PK6C 1S0DA 1TMF3 2W92A 2ZABA 4ZXKA 5L36A 3O12A 1GP5A 1GZWB 1DU3D 2CU5A 2W46A 2Q8CA 3AP7A 4QQPA 1VAVA 2H0VA 4XQDA 1PMIA 2ZZJA 4NROA 3LE0A 2XWJB 1YFXA 4NUBA 2A6VA 4XDPA 2Y26A 2BW8A 4HKOA 2B5HA 4NE9A 1SCRA 2B42B 2J1EA 3NNLA 4B7EA 5BUVA 2ORXA 4AL9A 3ECQA 1BCXA 5JOYA 2CV6A 1VMFA 2JICA 3V0AA 1GOGA 1WBLA 1N1TA 3PVOA 3ZFEB 4KGQA 1EP0A 5A32B 3I3MA 2WNVA 1AR83 1HQWA 4F8AA 2ZJCA 1RHI2 1DLLA 1QXRA 1VBC2 3WDWA 2E51A 4G4FA 4XJ8A 5KWRA 4LQRA 3MUY1 5JSPA 4NAMA 4WM8A 5CU1A 2RV9A 2E7QA 4W65A 2VW2A 3OSDA 3R05A 1JOBA 4FQZA 2VOKA 1ZA7A 2IXLA 4B8EA 4AFAA 3CZUA 4FQ4A 3AP4A 5T54A 3K75B 2C5DA 4Q4X2 3KLSA 1QJX3 1S2KA 3NAPB 1M06G 4QDQA 3C2UA 5JZGB 4KI5M 1GKBA 1ZA4A 2GC3A 2QQWA 1VBB3 3P6BA 4Y5Z0 4E2SA 5JR2A 3ABZA 1HRV1 1WD4A 2JECA 4QGLA 2GP3A 5FPLA 4XACA 1F5FA 4LBLA 2EAKA 2BP6A 3N9NA 4A7YA 2ZOEB 4GKXA 1T2XA 4FPYA 2ILMA 2VNVA 1WLCA 1Y4WA 1L7RA 1QNWA 2KXLA 2CY6A 4ZU7A 4EN6B 3WV6A 2QDNA 5F8PA 4Y26A 1C8M3 4CEWA 3WQ1A 1TEIA 1UYXA 5FUNA 2Z5WA 4IV1C 3JZVA 2O8OA 3IT8A 5FYUA 5DZFA 2RMU1 4GB33 4AGVA 2YU2A 3KF5A 4YNIA 4YW1A 1Q3EA 3RNSA 3VL9A 4OHYA 1HB2A 3C7GA 1V6MA 3M3OA 1OHFA 4HSJA 5A3MA 4A44A 1ULOA 4XMIA 1QOOA 1US3A 2EALA 4AFMA 1XXNA 4OZXA 4Q4Y2 4BE3A 5T52A 3UKVA 4BMBA 4BQ3A 2QQIA 4I2OA 3D8CA 3VKNA 1POV0 1MQTB 1U5XA 2X05A 1DIWA 4YGCA 3ROUA 2VM9A 3D6EA 2JIJA 1DQ0A 4TSVA 1YQ2A 3DXUA 4DEQA 2J1SA 2P4EA 2PN5A 4YW2A 3KVAA 1EUTA 2QQVA 3ZFEC 1FMD3 2VNRA 2ZAAA 3WG3A 5FP3A 4E27A 5CKNA 3CMGA 4Y1XA 5FZDA 5FOJB 1CAVB 4Y33A 3AXEA 5LBBA 5FWJA 3UETA 3N7KA 1QKQA 1SFPA 3JCIA 4XCAA 1CX1A 2XBO1 1JU3A 2Q1FA 4DPNA 2HWE3 4NIDA 2Q0AA 4S2GA 5JR7B 1UOBA 4L97A 3MLLA 2C1FA 3FLTA 2DFCA 1GLHA 2ZAHA 1NQJA 1PO11 1J58A 3JU9A 4XXAA 2VVDA 5A7WB 2YUEA 1JU4A 3CBNA 2Y6LA 4Y1UA 3LSEA 2D6NA 1O6UA 4AFDA 4S2FA 3NAPC 5A6QA 2I2SA 3KT4A 3DXTA 4JZRA 3MFCA 5F3CA 3EB7A 5JZGC 2VU9A 1WGPA 1V00A 1Y9MA 4AYUA 1RUG3 3MYXA 1SLIA 4JGYB 4YG3A 3ZYBA 4R8HA 4XF4A 4QXCA 3K51A 3L2YA 4MGQA 2ENRA 2ZMNA 3GM8A 5E8AA 4Z1VA 4IE7A 3POWA 4IV3B 4RQPA 3O1TA 1RTVA 4QB2A 5FLHA 4COZA 2ZXQA 3J7LA 3KCCA 1K3IA 4LA2A 3T08A 1PIV2 1YFUA 1YO8A 1FV3A 1N3OA 4UFIA 1QH7A 1S0FA 1NY71 2CDPA 5E1RA 2R061 3BOPA 1YI9A 4FAHA 1JW6A 4IGQA 1FAYA 3TYJA 4P9IA 4CTEA 1TNRA 2HKXA 2GC0A 2YDEA 4DB5A 1WMDA 3AZXA 1YQ6A 1NKGA 4Q1RA 5DAWA 3TN91 1RYYA 5BNPA 2ID4A 5FP4A 2YC2A 2F17A 3ILNA 3T3YA 1ENQA 4ISQA 1LOEA 1O3TA 2FDHA 1NCQB 1RHI3 3PTYA 3O1MA 1VBC3 5J48A 3MZHA 1Q8QA 1JODA 1MQTC 3FL7A 2BGPA 5FWEA 1GU3A 1B09A 1D0HA 1H6YA 4DXTA 4Y3OA 1AYN1 5CZKA 1PGL2 5K0UB 3DF0A 4KWUA 4AG4A 3ILFA 2UYBA 1DBNA 3RDIA 4BJ0A 4YW5A 4HG6B 3PJQA 4DINB 2GALA 2AYHA 3ACLA 3P1IA 4DMIA 2XJSA 3GBWA 4Q4X3 4CU6A 3H1MA 5JI7A 4R9DA 1Y9QA 4XUPA 3ZXJA 5IAXA 3S0MA 4YZ1A 1JYVA 5GZFA 5C33A 5HI0A 2B46X 2XQRA 3H3ZA 4QHZA 2GN7A 2VCCA 2WFF2 4MV2A 1FT9A 5FY8A 4QB6A 3M3IA 2UWBA 1C57A 2IFWA 3I2KA 2D44A 4AHXA 1PZ8A 4AHWA 1LRHA 1W9SA 3ILRA 1SEFA 2ZEWA 2ZMKA 1SLTA 5FR3A 5L9RA 3I3DA 3A0NA 4LK6A 2WAAA 4YW7A 1J83A 5K4LA 5FZFA 3FFQA 2X8KA 1R1A2 1YCIA 4JGYC 2WNUA 3WP6A 4BHPA 4L99A 1REEA 3AVSA 4LR4A 1IG0A 2DCZA 1DZTA 4COVA 5L7OA 2RS31 4Q4Y3 1UIJA 4XHXA 3LAGA 4B1LA 1GICA 5JSOA 4IV3C 5EP9A 4OI0A 5E88A 3EYPA 4W50A 2DVBA 3KGLA 1NUKA 1PVXA 2XKPA 3S7EA 3TWIA 1O8PA 1XNKA 4AQ6A 1W6MB 1ZZBA 2HWC2 5CYYA 1HN0A 2YXSA 5FOBB 2D98A 4CU7A 2LS6A 4Q4V1 2VBPA 1LHNA 3RWNA 3OYWA 2WZR1 1RUJ1 1NCQC 5HV0A 1CN1A 3VHRA 5LY2A 2OUJA 2QNKA 5FV3A 5F37A 3FJSA 1UZYA 1XOYA 2DURA 3FX3A 5FZAA 5FZ4A 3V0AB 1CX4A 5FZIA 3VKOA 4YFZA 2VOVA 4I30A 5K0UC 5FTTC 4D94A 5F39A 1GP4A 2WNVB 4A3XA 1WW6A 2WNEA 3SH4A 3WUCA 4AAPA 3HQUA 2WT2A 1VJ2A 1M4WA 2OQ7A 1GZ9A 1BVP1 4N90A 4WM8B 4N7UA 2LUWA 2PMWB 5IATA 1UIKA 2G9ZA 3AKPA 3IPVA 5IVYA 4L8QA 5IK8A 2LROA 3BB6A 2PLV1 2N7GA 3GJAA 4NIIA 2QQOA 4FSJA 4DO0A 3KQRA 3I2OA 1XE7A 4XF0A 5KXDA 4CCLA 2R16A 1FPN1 3AKQA 1PMHX 1YHFA 2GAUA 2XR4A 1PIV3 4OHWA 1WMXA 1Y3TA 5FIXA 4O9EA 3VKFC 5JMCA 2WUHA 2QJVA 1XYPA 2VZSA 1UZ0A 3AKSA 1SLLA 3MO4A 4IE4A 2NLRA 5DUUA 2WDBA 4XBLA 4HT1T 4YLZA 2CDOA 1QDOA 5EYXA 4DZGA 4PI2A 4GIQA 4AXOA 1J59A 3DYPA 4OI4A 1XJAA 1CR7A 1RGSA 4CUAA 3JB8A 2W9XA 2CAUA 3WNNA 2B8MA 2GC1A 4XQWA 4CCDA 4JVAA 1CZTA 4CCEA 3PUSA 3O1SA 1BLZA 4E2GA 3BIEA 1XNCA 4KBZA 1V6NA 2VZTA 4K9SA 1QF3A 2JDNA 2LW8A 2JDPA 3HQXA 5CEHA 3JBG1 1GQGA 3U78A 2QVSB 4XUOA 2ARBA
chains in the Genus database with same CATH topology
2QZ2A 3LCPA 4JCKA 3ZSMA 4OFGA 1O3QA 1VLNA 2WFF3 5ABJA 2AENA 2WA4A 3LWCA 2AUYA 4CP1A 3VUOA 5DZGA 4Q0QA 4AVAA 4RD7A 1XNBA 4K20A 4Q4W2 1UX6A 2WNVC 1VAKA 2JJ6A 2ZACA 5B2GB 4YVWA 3SNMA 1DG6A 5JOXA 4I09A 4WM8C 1POV3 3H0OA 3LB9A 1R1A3 1W6NA 1HQNA 2WA3A 2KA3A 4HN0A 3VN4A 1HXS1 1EPZA 1NXD1 4DQAA 4DY3A 1C8NA 4COYA 4YG6A 1HKDA 4MGKE 3GHNA 1SCSA 2VW0A 2HWC3 4Z8BA 3ZXEA 1LR5A 1AL22 3LOBA 3DPRA 4AF9A 1OMIA 3MW2A 4RQPB 4BA6A 1G6NA 1C5HA 2BTVC 3AXDA 2R0FA 3MLJA 3G6JB 4CEWC 1TMF1 3WD5A 4E2QA 1AJKA 4HPKA 3FC0A 4C1XA 3CF6E 1QJU3 3AFKA 1NZCA 5T3NA 2E9QA 4YARA 1OSGA 5AVPA 2IZWA 5BNPB 1NLSA 2EXKA 2XLGA 1MS1A 5T5OA 4NVPA 1PHMA 1RUH2 4X8NA 2RS11 3WCSA 5I0TA 5E16A 2CAVA 4OI1A 4OUSA 4IEUA 3U11A 2Q5TA 2A6ZA 3AM2A 3SCGA 4N43A 2DYCA 2R49A 3H7JA 3AYAA 3HAGA 1O4TA 2CNAA 4Z2WA 2E53A 2PAKA 2XL7A 3NVCA 4WVZA 2DF7A 3VL8A 3OJBA 1I9RA 4FCAA 4LLFA 1X8MA 4I0AA 2FZ2A 3AMQA 1S0BA 1QJX1 2ZGKA 4SBVA 2D3SA 2XVLA 5JDBA 4P9WA 4FPFA 2PQQA 3WUDA 1VBB1 2Y0OA 3VHOA 1X8EA 4ZU5A 2DFBA 2R32A 2RS52 3B9CA 3B69A 3KS7A 4QQ2A 1EYBA 4KWJA 1UKGA 4YZ5A 2WNUB 1W0OA 2ZX3A 5L7OB 2CYFA 5EXOA 4SLIA 1C8M1 3KCXA 1BEV3 4BLJA 3N7MA 4Y20A 1R092 4RQPC 3VZKA 2FHRA 3RJRA 4GALA 4DRVA 1C1FA 3IIAA 5KXEA 4XDQA 4IEYA 3USUB 2GH2A 4ISRA 1VAMA 5BNPC 5LK7B 4Q4W3 3AZYA 3DV8A 3OYWB 3M1HA 3VHNA 4BWOA 1EAH1 2HWB3 1WUVA 4YM3A 1LJ7A 3VBOA 1FMD1 4XJ9A 5GLUA 1H0BA 3B01A 4AK3A 1RUNA 3HD8B 3RS6A 5BNNA 1NG0A 1ULDA 2HWE1 4PIZA 2DCTA 5FFOC 3SMHA 4Z07A 4AQSA 5K8SA 3ZIWA 2MHFA 4QQHA 3IPVB 4OHVA 4B4RA 2C9AA 3VBRA 2P37A 4FPJA 1AL23 4ATFA 3O14A 5I0SA 2PHDA 1CPMA 3S6PA 1DHKB 4CDWA 1RVF2 1RUG1 4K1ZA 4D7YA 4RR3A 1C28A 1F5JA 4MZUA 2IWGB 1ZRFA 4N53A 1OLQA 4WVWA 5I0RA 1GNHA 4YSFA 1O3RA 3N35A 3URFA 2WNUC 3M3QA 1QY4A 4BH9A 2EF6A 1MZFA 4L11A 4KL1A 5L7OC 3GBFA 3VZJA 1EV12 1RUH3 4C90A 4IEPA 1S0GA 4AVSA 1DGWX 3NKGA 1Q56A 2DUQA 5KHIA 3TB0A 2P17A 3CEWA 4ES9A 3OD4A 1DYKA 1I3HA 4XBQA 3CL1A 3B00A 1URXA 4J1XA 4NOTA 3A4UA 2R0HA 4QMAA 1SBDA 2ZGSA 2NQYA 2OUHA 5ABJB 5AC91 2VUJA 4FPOB 4I01A 2D6PA 1YFYA 1MS0A 2B39A 3U0ZA 1DFQA 4FPLA 1LOCA 4YVWB 4AEDA 1S55A 3AMMA 1FX5A 3HN1A 2RS53 1CQ9A 1BXHA 1FV2A 2K2SA 5JCTA 2UU8A 1WA4A 1LCLA 2VGDA 4M00A 3DL3A 4ZKTB 2D6MA 1F8VA 3PVNA 1R093 2CGPA 4XXPA 1QOSA 4X6RB 1JYCA 2D3PA 3WT3A 1CJDA 2UWCA 4IEVA 4DXZA 3N4MA 3VZMA 4B4QA 2ZGRA 4Q4Y1 4XFBA 3SISA 3DPRB 1AYM2 3WDYA 2ZX0A 4NWVA 1BMV2 4MH0E 1BK1A 3TBDA 1R082 3N7LA 1QWRA 4HPKB 2O0OA 1MZ6A 4Z92B 1HV0A 5I8TA 3NV3A 1BBT1 3QOPA 4L92A 1N1YA 4UW5A 3B7MA 3E5UA 3JQWA 4R4XA 2BFUL 1ONAA 1QXJA 1AL0G 4QM9A 1YIFA 2PELA 4H3WA 2GMMA 4S2DA 5ABJC 4C0BA 3KT1A 4N43B 2OYZA 4FTBA 2UWAA 2HYKA 3MIFA 3VBSA 1RB8G 2WFPA 3O7OA 1RUF2 2XJRA 1RVF3 4S2HA 4NHMA 3ETQA 4YVWC 3U07A 4Q1PA 3FBMA 2RR12 4E4ZA 4CEYA 5DDJ2 4HKLA 1PIV1 1RC6A 2WJSA 1A8DA 3E5QA 3POSA 1MS4A 4TYSA 1AUYA 1AX0A 1EV13 1XRUA 2ZX4A 4LBJA 1CPNA 4K7JA 4AGGA 1WCDJ 1VR3A 2JE7A 1ZZ6A 3D82A 4IETA 4WV8A 5LEJA 4XEZA 1D0GA 3O0VA 4L9BA 1QQP2 1ZBA2 4KG8A 2WWSA 2A70A 4R9AA 2AZ5A 2CTVA 1CAWA 4BIOA 1Q43A 1CONA 1S1AA 1JBCA 2D3RA 3DPRC 2BVBA 4FOQA 3WW4A 4Y20B 4LO5B 1ZBE2 1MR5A 3AJZA 1SDWA 2CGNA 4FP3A 2DTYA 1PGL1 1O4YA 5HXVA 4OI2A 4IL7A 2WKKA 3C3VA 1WD3A 3FUQA 3O0WA 2R1DA 1UCXA 1AX1A 5A3LA 4AVTA 1SMVA 4LULA 4B4PA 4JQRA 4D69A 3LSDA 1QGLA 3SCHA 5CAZA 4NHLA 3WDXA 1N3QA 3VBOB 4D3WA 5KBFA 3FLRA 5EYYA 2C0ZA 1H9PA 4XPVA 3R4SA 5BYNA 2Q4SA 5BNNB 4AEMA 1Y43B 2WZPP 4N43C 2MEV1 4HN1A 5CIRA 1NA1A 1POV1 4FXGB 3ZSLA 1K5MA 2D6LX 4Q0SA 3THTA 2Y38A 4E9KA 3KMHA 3PMSA 4WVMA 5FDBA 3VBRB 2B45X 5KXCA 3NSTA 1X36A 1AYM3 4HK9A 1G9BA 4RHV1 3N36A 4CDWB 3ENRA 4H7LA 2HWD2 4LBNA 1GV9A 1JH5A 3O5SA 1R083 1S0IA 1KS4A 1ASJ2 5H9PA 3OY8A 4MSVA 4RR3B 1J1LA 4UBGA 4IEZA 4N53B 5JI9A 1MEC3 1X82A 2WS92 1VB2A 1NLRA 3I59A 3NJZA 4P9JA 4LUMA 3FE5A 5T55A 4J1WA 3AMPA 4LBQA 5GM0A 1GANA 1QJU1 4AQTA 3B3QE 3KCYA 1SBEA 2ZA9A 4FPKA 3TRSB 1UN1A 3PLQA 2EXJA 3RI9A 4WM7A 3ZYRA 5LRSA 2Q30A 3S30A 2PA7A 1UKRA 1LECA 1RUF3 5EFUA 3HT2A 2XPJA 4AI3A 1HQLA 2P2KA 1JN2P 4BYYA 4BM8A 2A75A 3KT7A 4Z82A 2CWSA 3IWZA 3VBOC 4FP2A 2A7AA 2RR13 3JUUA 1MS5A 5H9QA 4XTPA 4JDNA 5DDJ3 5BNNC 3RMYA 4N7IA 2DUOA 4AEDB 1A6CA 4QQOA 3QBQA 4L2NA 1RUC2 1ZX5A 2EIGA 4IEXA 4AW7A 1AR62 3SH5A 4XHBA 4XE9A 1KFUL 2GSYA 5DZEA 2D5FA 1ZBA3 1PGW2 3VBRC 4C91A 1W0PA 4AI0A 1H9WA 4Y4YA 1ZBE3 4CDWC 2G9GA 4M3CE 3RYRA 2DCKA 1YFWA 1A3KA 2ET7A 4RR3C 4HSLA 1AF9A 4N53C 1XU1A 1BEV1 4FBFA 3R4DB 4XIKA 1PO21 1KD7A 3L2HA 1RINA 1FXZA 4QX5A 4CDUA 2PHFA 1X33A 4XMAA 4P5HA 5T5JA 2IXCA 4W6YA 4FPEA 3H50A 4Q4W1 3MFAA 3G7DA 3OF1A 2GH8A 3H9AA 3JD72 1DZQA 3VZLA 2HWB1 4EN0A 2AREA 3HWJA 5BPXA 5J36A 2WLQA 5JSRA 1UD1A 1SFNA 4CYDA 3OCPA 2NYYA 3E6DA 3RI8A 1HRV2 5T5PA 1ZYBA 1IS6A 1V9U2 3VBSB 4I0WB 5AVAA 5GJ6A 3ZYIB 1VBE1 4GQ7A 1W6PA 2HWD3 3CU7A 4R9CA 3OTFA 1ASJ3 5FLIA 1YRZA 5ACA1 4AEDC 1UPSA 1AL21 1LU2A 1ZREA 3WP5A 2RMU2 2A6YA 1DGRA 4YGEA 4CEYB 2Z42A 1W6OA 2WS93 1IHMA 4HFSA 5KHHA 2UY8A 1JOJA 5HBAA 3LA2A 4XFFA 5DG1A 1RMU2 4O9GA 2EAAA 2YY1A 3MW3A 1AR92 3FFZA 3WY6A 1H4GA 3M4FA 1CAWB 2IC1A 4EN9B 2B9UA 1LGNA 5CG9A 1RUH1 4WBBA 1LHOA 3RJ2X 1Z78A 4AVCA 3AMNA 1KFXL 4AE2A 2YROA 2R071 1UL9A 2XBO2 2JG9A 5EV7A 1Z0HA 1LGCA 1H1AA 1LKNA 3S7IA 4INDA 3VBFA 2PFWA 2DWRA 2QDRA 4YGBA 4HVOA 2ARXA 3OBTA 1VRH2 3KD4A 2G9FA 2VG9A 1R1ZA 3VV1A 2V09A 5I91A 2OA2A 4GMP0 1BKZA 2Z79A 2F6BA 3ZFFA 4GA9A 3ZYGA 1AR72 1QJY2 3WOGA 3J26N 1RUC3 3ZXFA 4AHZA 3LA3A 1AR63 2ES3A 4LO8A 3VZNA 1MS8A 2ZGQA 2FBEA 3H1YA 4CEWB 1C5IA 3VBSC 2PHTA 1NA1B 2VNOA 2RS51 3CJIA 3EO6A 2GNBA 4PBPA 4PDWA 4WVMB 5BNOA 4HMZA 4HVQA 5CNAA 3MF9A 1N47A 4H55A 3ZMOA 4AEJA 1BQPA 2A3XA 5A33A 4CEYC 3V56A 5J96B 2D93A 2XVGA 2ZGMA 3WW1A 2VVFA 3OY8B 4MGIE 3N7JA 2OIIA 4AWDA 5C6CA 1JYIA 5H9RA 4AHYA 4EJRA 5K7PA 4M0HA 3AKRA 1CAUA 2VXRA 3I59B 5F5QA 3BALA 2A3WA 5IK5A 3JD73 3I7DA 4LBQB 1AJOA 3MIHA 2D5HA 4AI2A 3VZOA 1YJKA 2VMGA 3R4UA 4Q29A 3V0BA 1HRV3 4WM7B 2AH2A 1OKQA 2VH9A 2HEVF 1AXYA 1RUE2 1SBFA 1V9U3 4Q0UA 4XF9A 4NO4A 2GNMA 4N9IA 1H2LA 1VALA 4FOVA 1DDLA 1KDKA 2YGMA 2XGXA 4IERA 5KXBA 1LOAA 1ULFA 1PVC2 1WLDA 5DUWA 1OQEA 3USSA 4XFIA 2RS32 5FAXA 3AZZA 2GMEA 4QXKA 1IS5A 3MW4A 1NA1C 2W39A 4FOYA 4YM0A 2RM22 4NN0A 4ASMB 1RMU3 1V6LA 1K5MC 2W0XA 2K0GA 3HIFA 4K8FA 3WP3A 1AR93 2W52A 3H1WA 5JOWA 2GC2A 3RMXA 2UYAA 2A6WA 3WQ0A 2ZGPA 1TE1B 5KC5A 1UPIA 4WZCA 4Q4V2 1LU1A 2LM3A 1LENA 1FNYA 4YW4A 2DVFA 1I5ZA 1AR81 2XBO3 4K3UA 1U5ZA 1QNYA 2WLPA 2ZBJA 3FMGA 1COV2 3EXUA 2VNGA 1VRH3 3MIGA 2SLIA 5C4WA 4CDQA 4RS5A 3PMEA 4A2UA 2GMPA 4XTMA 1CD3G 4U36A 4G9SB 1AR73 4CDUB 3D0JA 4PLNA 1W6QA 1QJY3 4DS0A 4N9HA 2ZZQA 4E4DX 1HRI2 4QQLA 1NE4A 1SLBA 2DU1A 1LTEA 3MICA 2UY9A 4WM7C 2PLV2 3OD0A 2F4PA 3BPZA 4E4SA 1DGRN 4W6WA 4Y1VA 1C1LA 4A7ZA 1FPN2 4KNCA 1EY2A 2CGOA 1ND2A 1O5LA 5C8CA 1DZRA 1J3RA 4ATEA 1D2QA 1GQHA 4CP0A 1WW7A 1GSLA 2PHWA 2WT0A 4PJYA 4LLOA 2R042 4FT8A 1IPJA 2WT1A 2WINB 2DUPA 4GB31 1KXGA 4IXLA 1W6PB 2WL1A 2Q1ZB 1G7YA 3RSJA 3QH6A 5T5LA 4CRQA 1Z7S2 1WMEA 4LBKA 1AYM1 4F7ZA 3B93A 4GH4A 1W6OB 2UURA 2GN3A 3T1MA 1R081 4QPGA 2XJQA 4JAAA 1LOFA 4QGMA 1OA2A 3CNAA 1FOD2 3JQXA 3ZVXA 2EXIA 4XZPA 1MEC1 3FWEA 3MIBA 4Y22A 3D4KA 3M3EA 4MXWA 3FBYA 2VULA 1DQ1A 1AXZA 3MIEA 3ASIA 4AGRA 4LA3A 4AQ2A 2JG8A 1DQ5A 3AP9A 2CWMA 4RFT0 1TNFA 1JUHA 2VUAA 1RJ7A 1RUE3 2Z2SB 3ZPYA 4JTOA 1YXWA 4PLOA 1XU2A 4CDUC 4LO7A 1ZRRA 2I07B 2JG9B 1H30A 3SLIA 4OUMA 2WSVA 2I74A 2RJLA 1V6IA 4HLTA 2VOXA 3LA7A 3VBFB 2BNOA 3WW3A 1LULA 2OPKA 4HETA 4C0HA 4LBOA 4I0BA 4QU2A 1RUF1 2DCJA 4DFSA 4BOWA 1PVC3 4ITCA 3AP5A 3ZFFB 2RS33 2DTWA 4OLLA 4FTSA 4LBMA 4M01A 4FTEA 2RM23 3ALQA 1W39A 2Q8OA 4LUKA 2RR11 1IQAA 1YUDA 1OI6A 4KBBA 2CL2A 2XJTA 3GF6A 1FI2A 2BWCA 4XF1A 1AHSA 4RGAA 2XH6A 4D7TA 1ENRA 4Q4V3 3CJIB 3H7YA 1RUOA 2V5YA 4FO9A 2O8QA 4PDWB 1BJQA 1H2KA 1OA4A 5BNOB 1UZZA 4GMP3 1TMF2 5JPNB 2WIIB 1KQRA 1RHI1 5AFEA 2TEPA 1VBC1 3HMYA 1G9DA 1COV3 5A33B 1PM7A 3GZTB 4JDMA 3HT1A 3ATGA 5BNQA 4JC1A 2XLAA 1DF0A 4YFWA 3B9IA 1ENSA 2RS12 3BCWA 4Q4X1 1HRI3 5I0UA 4COUA 4XFAA 2VY0A 1CAUB 4TWTA 3RYPA 5FCCA 4XFHA 1PNGA 2PLV3 3VGIA 1G9AA 4QGNA 3WVJA 5CBLA 4DNYA 1IPKA 4HKWA 3UV9A 2VW1A 3HBZA 1S2BA 3VLBB 3WINE 4AI8A 1W6NB 4Y1YA 3M70A 1CJPA 2JG9C 3V0BB 1ALYA 1KITA 3GZUC 1DGLA 3VBFC 5D8AA 1DQ6A 5SV8A 2XLFA 5GZDA 2R043 2RE9A 3SXWA 3RYKA 4JV4A 1VBD2 3ZFFC 1VBB2 3D0SA 4AFBA 1Z7S3 2E6VA 3WXPA 4XQ4A 2NP0A 2HWD1 3AX4A 1O4ZA 1WLWA 2BPA2 3WP4A 4EROA 1RL3A 1D4M2 1C8M2 1PZ7A 3VHPA 1FOD3 4R52A 3CJIC 1O5UA 2DVGA 1RUI2 3V64A 2JKBA 2A6XA 5GLWA 3BODA 4PDWC 2FQPA 2NZ9A 1IOAA 4YVSA 5BNOC 3CJXA 1KRIA 2WQZC 4MUVA 5GLZA 4UW6A 3T1LA 4G3YC 4LBQD 3WLUA 4ES8A 1BVVA 1LHUA 5FBZA 5BV6A 3A0KA 1I6XA 3WW2A 2BFUS 2P34A 4M0NA 3ZXAC 3ZFGA 1L3JA 3ZXLA 2W68A 3SH3A 5FO7B 1EAH2 4RSUA 2XJUA 4M3CF 3AP6A 3R6SA 5AFBA 5C4WB 1H1MA 3ZIXA 4CDQB 1W2UA 1SACA 4GULA 5GZGA 2VPVA 4RS5B 3MLKA 5JIAA 2XHKA 1WCKA 4YG0A 1W6QB 4M3CA 4B29A 3MGUA 4J6GA 1RJ8A 4P9YA 1LHWA 4YZ4A 5CG8A 1QMJA 1J3QA 4XIOA 1QH6A 1KS5A 3R0RA 5J98B 3VBUA 4MLOA 5H9SA 2A5ZA 2ZHMA 3L9JT 1CAXA 5F1RA 1AR61 1ND2B 2BVVA 4YZ3A 4BMEA 5C8CB 2FMYA 4P9LA 4DY5A 3KZ4C 1PGW1 1MVQA 1Y7BA 2ZHLA 3ZDSA 4D7SA 1UMZA 3UKTA 3VBHA 3VKLA 3RRDA 3D5OA 1Q8OA 3LGRA 3ZO0B 4IESA 4JTNA 2RS13 4I3PA 1QHDA 5CFCA 3ZXDA 1UF2C 4GH4B 1KJLA 2JXAA 1G9FA 1UU5A 4QPGB 1G9CA 1LB2A 5CFDA 1HX6A 2WFF1 2PAMA 4Y22B 4MXWB 1S0EA 3FZ3A 1TME2 5EWSA 4ZU4A 4MX3A 4F3JA 1SFYA 2KM2A 3RG0A 2JG8B 4YZ2A 1ULCA 3JD71 2D40A 5AC92 4RGGA 4BPZA 5GKAC 2ZX2A 4LHLA 5C4WC 4CDQC 1RUD2 4CZSA 3SITA 5F9TA 4RS5C 1VBD3 1R1A1 4BZ4A 1GZCA 3GZAA 2VVEA 1JTZX 2QFEA 4XBNA 4DRRA 1IS3A 4CDXA 1OD5A 5J7MA 4LHKA 1VIWB 1V9U1 5EJ3A 3WQ7A 3PVBB 3PVEA 5JOZA 4Q8LA 2TUNA 2TNFA 1D4M3 1VBA2 2HWC1 3QACA 3NL1A 1CESA 4UBHA 4WZFA 4XOGA 3ZMNA 4BIFA 1RUI3 1A8MA 1ND2C 1DYPA 5C8CC 2ZX1A 1VP6A 2YC0A 2P3JA 4XJZA 1V6OA 4F83A 4YM1A 5GZEA 1RMU1 2QZ3A 3ZSEA 1CGPA 3GBGA 4HK8A 4HBNA 2HWF2 2PAEA 1AR91 3AZWA 3ZN6A 5CVRA 1QU0A 4ORFA 1EAH3 3OGGA 5BXXA 2VMHA 2YYOA 4GH4C 4Y24A 1Q5OA 2XVKA 1APNA 1GFF2 1BBT2 4W6XA 4QPGC 5CA6A 1OOPA 1JXNA 1LOFC 1YLLA 1JHNA 5C9AA 1BZWA 3M7AA 3BOWA 2BWAA 2IXJA 1VRH1 5K9YA 3MPPG 2E7AA 4LHNA 3DUIA 4IEOA 4KU7A 2DV9A 2JG8C 5FPZA 1AR71 2ATFA 1QJY1 3J8F2 3NKTA 5F6KA 4K6BA 1Q8PA 2BQPA 2BNNA 2YV8A 3MIDA 5JIUA 1UAIA 4K40A 4XJAA 1ZZ7A 1QQP3 2ZS6B 4YGDA 1UW8A 1H8TA 1U12A 4HVRA 5SV5A 2BEOA 1DQ4A 2JE9A 5D8AB 4YYOA 4BCUA 3KGZA 1I1EA 3UJQA 3ZXKA 3IM0A 4RL7A 1ZM1A 1S0JA 2HEYF 1LODA 4BQ1A 2QKDA 2QE3A 3AKTA 4I02A 3NV1A 5CADA 1NE6A 1NOVA 1ULEA 2PHXA 5L19A 4R9BA 4OHZA 4FPGA 3THPA 3OPZA 4PLMA 5DUVA 5FRAA 5BY5A 1WW4A 1MZEA 5J37A 3OGJA 3VDDA 3T2TA 3INAA 3ZSKA 4YM2A 3EBRA 2DVDA 1H4HA 1YJLA 3PNAA 1NYWA 3AFGA 5DG2A 3NWKA 5IUQA 3VKMA 4AVVA 2D43A 1TME3 2H0BA 4YVSB 1EPWA 3P3NA 3U10A 3SCFA 2LALA 3JB4C 1SLCA 5AC93 1UU4A 2IFRA 3EHKA 2B7YA 3RZZA 2FMDA 2JEMA 1RUD3 3WZ1A 1E57A 4QPIA 3B02A 2ZPXA 3ZFGB 4UXAA 3TNQA 1IZ3A 3E97A 1RUE1 3NW4A 4PIXA 1HLCA 3DN7A 2ETEA 1F31A 2ZCWA 5T50A 4JDOA 5KHJA 1VBA3 2MEV2 1AXKA 4JGZA 4M3CB 1NCRA 3NV2A 4OULA 1FYUA 3QCWA 2YMZA 3SHRA 1PVC1 3I4IA 1B35A 3VBUB 5FPXA 5D8AC 3ZX7A 1N3PA 1CAXB 2RM21 4RHV2 5JLVA 2YZ4A 1ZZ8A 3GYDA 4HL0A 1S0CA 4GKYA 1AVBA 1WW5A 2PYTA 3MEPA 2HWF3 2H6CA 3KB5A 2IXIA 2XB6C 4KH9A 3USUA 3B5LB 4NPRA 1BBT3 1XYOA 3N3HA 1WLTA 3VBHB 4QHBA 3I8TA 1RITA 5I8YA 2ZHKA 4V1PA 3FLPA 4GMP1 4I3GA 4NR1A 2XL9A 4EN8B 1X7NA 2JD4A 1MZ5A 1YIPA 3FHIB 4AI1A 2DVAA 1QJU2 1COV1 2V73A 5CFCB 4BLIA 1GNZA 4XYXA 1A78A 4YVSC 3M3CA 1ZRDA 1PO12 5DXDA 5GLVA 3TNPB 2BYVE 1GYKA 5CFDB 1ZVFA 2ZMLA 1U5IA 3NO8A 3J8F3 3ES4A 3P3PA 1H2MA 3TAYA 1HRI1 5L73A 1IKQA 1PNFA 3ZFGC 5GLTA 2HJIA 1WMFA 2XG3A 4MGYE 3ES1A 4RA0A 5DUXA 4PCRA 1ZRCA 2DU0A 2XJVA 4XJWA 1H1IA 1O3SA 1K5MB 4GXLA 2Z69A 1ND3A 2EXHA 3WX5A 1NY72 1XE8A 2R062 4H14A 2ZTNA 5F6LB 4CDXB 3WDVA 4DOUA 1SLAA 4NWWA 4FXKB 2R041 1MVEA 1R091 1BYHA 4CP2A 1LEDA 2VQAA 3TN92 4PQ9A 3VBUC 1MS3A 4R4ZA 1OQ1A 1Z7S1 1OFSA 5IK7A 2NMOA 5CB7A 2HEWF 4FOWA 5KC6A 4XFCA 1AYN2 4EWDA 1OA3A 1N1VA 3LOIA 5TSWA 1XNDA 1BEV2 1FOD1 2DCYA 1PO22 5IT6A 1NXMA 5FLJA 1V70A 5FQ0A 1HDKA 3VBHC 2WQ4A 3UL2A 3WNXA 4P9GA 3ZN6B 4C1WA 1F2NA 3ELNA 2GNTA 3AYEA 5CFCC 2X5IA 4UW4A 2WSUA 4QPYA 4MGZE 4URTA 4XF3A 1HV1A 1OOPB 2D6KA 2JENA 3APBA 1D4VB 5CFDC 2MEV3 4LT5A 1PK6A 2HWB2 1OPOA 5C9AB 2XWBB 2NM1A 2RMU3 4HZFA 5JWPA 1RVF1 2YGLA 1G8WA 3AZVA 1YWKA 3WG4A 4RHV3 3ZSJA 3M8LA 1VBE2 1FATA 4FPHA 3ME2A 2K9ZA 3CLPA 5ACA2 1H8TB 4X8PA 1FNZA 4CDXC 2A71A 4FPCA 5JVVA 4LE3A 1EV11 1QOTA 3AYDA 1XYNA 2G4IA 4QD2A 2WZR2 1RUJ2 3AMHA 3FUOA 1JUIA 2OZ6A 4TLFA 5HCFA 5I93A 3E6CC 2E7TA 3UKNA 4ASLA 1REDA 3VDDB 1PO13 3HR9A 3WG1A 3IDEA 2Y0IA 3MI8A 1MACA 4Q2FA 2W08A 2ZKNA 4IEWA 5FO8B 2AGSA 5IK4A 2XUMA 3Q9OA 4JRLA 1AX2A 4AVBA 4YW3A 4U2AA 2R072 1YI7A 2VOWA 5FO9B 3MDPA 3QLQA 3AB0A 2ZGTA 4Q0PA 4IV1A 4OHXA 1GBGA 4LO4B 1REFA 2SBAA 1OOPC 4QPIB 4KWKA 4EWAA 2R063 5C9AC 4P14A 1TQ5A 1GZWA 1OFNA 3GNEA 3MF6A 2AR6A 4K21A 2NN8A 3EJKA 5HCBA 3TN93 2JX9A 3ZYPA 4XILA 1VBD1 4MVTA 2NPIA 2I45A 1ULGA 4JGZB 1XQNA 3GALA 1NCRB 4COWA 3H8UA 1SQ4A 4UW3A 3ZFEA 1AYN3 3E6BA 3AJYA 5A32A 3J9SA 1H8TC 2D7FA 2R1BA 4Q8KA 5LEKA 1BMV1 1B35B 3E5XA 5LK5A 1LOBA 2BUKA 4Q27A 4Y1ZA 1CVNA 1D4M1 4K1YA 3JBG2 4FAGA 1PO23 1RUI1 5FREA 1O7FA 1YNAA 4META 2EVXA 3UK9A 3B94A 1GR3A 1PGSA