1AYN1

Human rhinovirus 16 coat protein
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
285
structure length
285
Chain Sequence
b'NPVERYVDEVLNEVLVVPNINQSHPTTSNAAPVLDAAETGHTNKIQPEDTIETRYVQSSQTLDEMSVESFLGRSGCIHESVLDIVDNYNDQSFTKWNINLQEMAQIRRKFEMFTYARFDSEITMVPSVAAKDGHIGHIVMQYMYVPPGAPIPTTRDDYAWQSGTNASVFWQHGQPFPRFSLPFLSIASAYYMFYDGYDGDTYKSRYGTVVTNDMGTLCSRIVTSEQLHKVKVVTRIYHKAKHTKAWCPRPPRAVQYSHTHTTNYKLSSEVHNDVAIRPRTNLTTV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 16 COAT PROTEIN
publication title The structure of human rhinovirus 16.
pubmed doi rcsb
source organism Human rhinovirus sp.
molecule tags Virus
total genus 58
structure length 285
sequence length 285
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1997-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1ayn100
4QPIA 1PGW2 2R072 3VBUA 1MQTC 4CEWB 2RMU1 3ZFFA 3CJIA 1AL23 1QJY1 2PLV3 2RR11 1VBA1 1QJU2 1COV1 1PO11 1POV0 1COV3 2HWC3 1PO13 4WM7B 4PDWC 5DDJ1 1X33A 1NCRA 4CDWA 4RS5C 2RS12 1PO22 1HRI2 1FOD1 4GB31 5BNOC 1FOD3 4GB33 1PVC2 1R1A1 3J8F1 4JGYC 4CEYA 1R1A3 4CDQC 2RS51 5C4WC 3J8F3 2HWB2 1C8M1 1QJX1 4GMP0 2MEV2 1C8M3 3VBOA 3NAPC 1AYM2 4N53B 1GFF2 4BCUA 3HAGA 4RHV2 3JD71 5BNNB 3JD73 4FTSA 4NWVA 1DDLA 1POV1 5CFCB 1RHI1 4GH4C 5FOJB 1R081 1RHI3 2RS32 1R083 2RM21 5AC93 4CEWA 5ACA3 2RM23 1PGW1 4RFT0 1AR62 1PIV3 4QPGC 4FSJA 2R043 3ZFGC 1VB2A 5J96B 5D8AC 1QJU1 4WM7A 1AYN2 1K5MC 5C8CC 3VBSC 4Q4W2 4GMP1 4GMP3 2RS11 1PO21 1X36A 3VBRB 4AEDB 1AR73 1OPOA 2WFF2 3JBG3 4IV1B 4YVWB 2HWB1 1V9U3 4N53A 4YVSC 1RUJ1 5BNNA 1B35A 1RUJ3 1NA1C 2IZWA 2TBVA 4Q4Y2 1Z7S2 1NCRB 1C8NA 1VBE2 4CDXB 2RS31 4JGZC 2RS33 3VBFB 1RUG1 1AR61 1OOPA 1RUG3 1ZBA3 1VRH2 3DPRC 5ABJA 5C9AA 1AR63 1H8TB 1RUD2 5CFDA 1RMU2 1RUC2 5BNPB 1BBT3 5FMOS 2GSYA 1PGL1 2WS91 2GH8A 2WS93 2FZ1A 1ND3B 1AYN1 1HXS2 5K0UB 4WM8C 1AYN3 1E57A 4Q4W1 3ZFEC 1R092 4FTEA 4Q4W3 3VDDB 4AEDA 1RUF2 1TME2 1VBD2 4RR3C 2RMU3 1ND2C 4IV1A 4QPIC 4YVWA 2WFF1 3VBUC 2WFF3 1QJY3 1FPN2 2RR13 3ZFFC 1VBA3 3CJIC 4N43B 2VQ0A 1RB8G 1RUH2 5DDJ3 1Z7S1 4CDXA 1Z7S3 1ZBE2 1VBE1 3VBFA 1HRV2 1VBE3 1AR81 1NCRC 4CDWC 1AR83 1VB4A 1H8TA 5L7OA 1VRH1 1A6CA 1RUD1 5BNPA 2RS53 1RUD3 1CJDA 1RUC1 2X5IB 5A32B 1QJX3 1ASJ2 1ND3A 4CEYC 1TMF2 5K0UA 4FTBA 1FMD2 1HXS1 1B35B 3VBOC 4CDQA 1POV3 3JB8A 4Q4X2 4RQPB 1R091 1EV12 3VDDA 1VBB2 2R071 1TME1 1VBD1 1RVF2 2R073 1VBD3 4IV3B 1OOPB 5ABJB 1BEV2 1W39A 5C9AB 4CEWC 5CFDB 1AR92 1NCQB 1FPN1 1NG0A 1QJU3 4N43A 3ZXAC 1CD3G 1VBC2 1RUH1 2R062 3ZFGA 4WM7C 2HWE2 3TN92 2RS13 5A33B 1HRI1 1PO23 5JZGB 1HRI3 1HRV1 3VBHB 2HWF2 3FBMA 1PVC1 1PVC3 1QQP2 2ZTNA 2X5IA 5A32A 1RUE2 4CDUB 2HWB3 2MEV1 4Q4V2 2BFUS 1ASJ1 1AYM1 2MEV3 1ASJ3 1AYM3 1MQTB 4EJRA 1FMD1 4RHV1 1FMD3 4N53C 4RHV3 4RQPA 2ZZQA 5BNNC 1B35C 4Q4X1 1VBB1 1AL22 2PLV2 5CFCC 4IV3A 1RVF1 4PDWB 2HWC2 1PO12 1RVF3 5L7OB 1QJZA 4RS5B 2XPJA 1NCQA 1OOPC 5ABJC 5C9AC 2HWD2 1OHFA 5BNOB 1VBC1 4NWWA 4JGYB 2R061 4CDQB 5C4WB 2BPA2 2HWE1 5A33A 4Z92B 2HWE3 5JZGA 3J8F2 3NAPB 3VBHA 1C8M2 1BMV2 2HWF1 1D4M2 3VBRC 4AEDC 2WZR2 4CDUA 1F2NA 4GH4B 1RUE1 1IHMA 1VAKA 2BFUL 1M06G 1MQTA 4Q4V1 4IV1C 1MEC2 1AUYA 4Q4V3 4YVWC 1R082 5AC92 4QPGB 1ND2A 5ACA2 2RM22 4Q4Y1 1PIV2 4Q4Y3 3ZFGB 2R042 5D8AB 1AL21 2PLV1 4PDWA 1K5MB 4CDXC 2HWC1 5C8CB 1VRH3 3VBSB 4RS5A 3VBFC 3JB4C 5LK7B 2XBO2 1RMU1 5FMOL 1H8TC 1RMU3 1RUC3 1F8VA 5L7OC 5BNOA 2HWD1 5BNPC 2WLPA 2HWD3 1HXS3 4JGYA 5C4WA 1ND3C 5K0UC 1AR72 2FZ2A 1HX6A 1R093 1NY72 3NAPA 3JBG2 1RUF1 1RUI2 4YVSB 1V9U2 1RUF3 1TME3 1BMV1 3VDDC 1D4M1 1NA1B 1D4M3 4GH4A 1RUJ2 3IDEA 2WZR1 2ZAHA 4Y5Z0 2WZR3 1FPN3 4JGZB 4QPGA 1MEC1 5J98B 1MEC3 3DPRB 5AC91 1EAH2 5ACA1 1RUH3 1ZBA2 1PIV1 1RUG2 4N43C 2QQPA 1SMVA 2R041 5D8AA 1ZBE1 2DF7A 1ZBE3 4Y4YA 1K5MA 1BBT2 1HRV3 3S6PA 5C8CA 4WM8B 1PGL2 2WS92 3VBSA 2BBVA 3ZFEB 2XBO1 2XBO3 1TMF1 4SBVA 2WWSA 1TMF3 2X5IC 4RR3B 1ND2B 4QPIB 2RMU2 5GKAC 3VBUB 1AR71 1EV11 4Q4X3 3ZFFB 1NY71 1EV13 3JBG1 3CJIB 4YVSA 1VBB3 1QJY2 4RQPC 2RR12 1VBA2 1RUI1 1COV2 1V9U1 1NA1A 1RUI3 1BEV1 1BEV3 4IV3C 1AR91 2Y26A 5DDJ2 4JGZA 1AR93 1AL0G 5CFCA 5CFDC 4CDWB 3DPRA 1NCQC 1VBC3 1EAH1 1FOD2 1AR82 4GB32 1EAH3 1ZBA1 2R063 3TN91 1R1A2 3TN93 2RS52 1WCDJ 4CEYB 4WM8A 1BBT1 1QJX2 3LOBA 2HWF3 4LLFA 5JZGC 3VBOB 1QQP1 3ZFEA 3VBHC 1QQP3 3JD72 1RUE3 1RHI2 3M8LA 2BUKA 4RR3A 4CDUC 1NOVA 1HQNA 3VBRA
chains in the Genus database with same CATH superfamily
2BNMA 1LKNA 2GC1A 3GZEA 2Y33A 5CBLA 1MQTC 2DU0A 2QQNA 4JRLA 1ZZ7A 1POQA 4BLJA 2Y6GA 2HYXA 4LBJA 4RGGA 4JAAA 2ZMNA 3A0KA 2VZQA 3M3QA 1AL23 2PLV3 5FZOA 3RG0A 5EJ1B 5A70A 1COV1 3GCWA 1ZZ6A 2Q30A 1UY1A 3W5NA 1COV3 1W0OA 2HWC3 4Y20A 4CU8A 1SLBA 4QPYA 5E1RA 3I8TA 2DBNA 2PAMA 3E6DA 3PIGA 4IEUA 4YM1A 3ZN6B 1PZ7A 3H8XA 1JODA 1ONAA 3RWKX 3KWVA 3WHTA 1NCRA 4XF1A 4ZXEA 4MHUA 1OA3A 4RS5C 5JXHA 4PT6A 2RS12 5I0SA 4EN6B 2BTVC 3SH5A 1A34A 4LR4A 4ARYA 4QXHA 4E8CA 4C0BA 4YZ3A 2D6LX 3DCQA 4HPKB 3SNMA 3FN9A 3WCSA 1GOGA 4F7ZA 3ZDVA 4E27A 1LHVA 2NMNA 1UD1A 1R1A1 1VR3A 1S2KA 4P00B 3J8F1 5A6XA 5L19A 1R1A3 3UETA 4S2DA 3J8F3 2Q0AA 2HWB2 1GQPA 1C8M1 3H42B 1RTVA 4GMP0 1C8M3 1F5JA 1AYM2 1WW6A 3HD8B 4N53B 4LOSA 3D4KA 2WSUA 1LB2A 4NUBA 4WVMA 5FPXA 2VCBA 1OD3A 2IFWA 3LCPA 4IETA 3DXTA 3CL1A 5FMDA 4BHPA 2ZEZA 2JIGA 1POV1 5CFCB 3WSOA 5C6CA 2PN5A 3ZYBA 1Z78A 3BCWA 2XB6C 1V6NA 2UWAA 5FRAA 5AC93 2BOJA 3ABZA 5ACA3 4DOUA 2WBKA 1DZQA 3JZVA 5KXEA 2QQLA 1XNTA 4PI0A 4ARXA 1DCSA 1MR5A 4D3WA 2R043 4JHTA 3HNYM 1ENQA 1CESA 4WZFA 5FP7A 2LM3A 3ZFGC 2IXLA 4AL9A 2HJIA 3IZOA 3WDXA 4HOOA 5GZGA 1CIWA 1H9WA 2P3IA 1GOHA 5EFUA 1H2KA 1UYYA 2LRPA 1AYN2 4OULA 5FPVA 3ZN6A 3E5XA 1GANA 2KD7A 3IWZA 3NO8A 5IHRA 4SLIA 2LUWA 3SC7X 4EYUA 2J1VA 3LA2A 3NJXA 3VBSC 4Q4W2 1UOGA 1Y3TA 5FFOC 2RS11 4X6QB 4HPKA 1X36A 3NV3A 4N7UA 5JPMB 3I3MA 5JOZA 4AEDB 1NT0A 5CADA 2GU9A 2FD8A 5I0TA 4XUTA 2MNGA 2WLQA 4NOTA 4Q0PA 2JDYA 2WABA 2VGDA 4R9CA 1AZDA 4L8QA 4YVWB 2HWB1 2P6CA 3H7YA 3W5MA 4LUMA 1F15A 1AX2A 4N53A 4E4SA 4QQLA 1OT5A 1O6UA 4Q1PA 1UXXX 2JENA 1NLRA 1H1MA 4AOCA 4HZFA 2YPDA 4YW3A 4BQ3A 2PYTA 3ZYGA 1W0NA 2W9XA 3FC0A 3C7OA 5JXJA 4YW6A 4W6XA 1ZYBA 4LHNA 2VVEA 3JQXA 4JGZC 2XLAA 3VBFB 1OLRA 3NNMA 4XJ9A 5FMCA 4UFHA 4N7IA 1ZBA3 3SKVA 4YZ5A 5ABJA 1DQ5A 1VRH2 1XQNA 3OPZA 1H8TB 5EYYA 5FO9B 2QQIA 4LPLA 1RUD2 3DKQA 1WZXA 4MGKE 4RN5A 2AREA 4XTMA 1MS3A 1RUC2 4EZ4A 1BBT3 2B8MA 2GSYA 2WS91 1P8JA 1O4ZA 2GH8A 3LB9A 2WS93 3RQ0A 1CZTA 3WNOA 1AYN1 2A3XA 3V64A 4UW5A 1T6BX 1AYN3 1BJQA 4H14A 3IM0A 1JOPA 1CX1A 4PBPA 4XF4A 3SEEA 2D97A 4Q4W1 4I3GA 1R092 2GMEA 4Q4W3 4GALA 1CWPA 1YHFA 5FP3A 4MGIE 4M3CA 4Y26A 4AEDA 4QKNA 1YYNA 3POFA 3SCGA 3LF7A 3AC0A 2A3WA 1Q56A 5IAVA 4HFSA 2IVIB 3PUSA 1REEA 4CP9B 5T5LA 4YVWA 1BCXA 3VBUC 2AEYA 2W46A 2Q8CA 1HW5A 2NPIA 4KMQA 1QJY3 4NIGA 2RR13 3AL6A 3SMHA 2CYFA 2VXJA 2OKXA 4D7TA 4HK8A 3VL8A 1YNAA 1GV9A 4N43B 3KZ4C 4R9BA 3MF9A 3C7GA 4RGKA 1AX0A 4LXLA 2V4AA 2BVVA 5IT6A 3K75B 1ZREA 3POBA 3QH7A 4YW5A 5CZKA 5DDJ3 4ZS2A 5KR7A 5KC6A 1WBLA 3ZVXA 4AK3A 4IXLA 5EPAA 4DRVA 1RXGA 1PHMA 3VBFA 1HRV2 1W28A 2DYCA 1AR81 3ZSMA 4CDWC 1IS3A 2UWBA 1AR83 1VB4A 1H8TA 4LJHA 1GP5A 1VRH1 3CO2A 1A6CA 1RUD1 3T0AA 2AUYA 3PVEA 3OF1A 1RUD3 2A1XA 4XF3A 1CJDA 1RUC1 1QGLA 4M01A 1LODA 3SISA 1J84A 4UAPA 1QHDA 4CEYC 4DXZA 2B39A 4Y1ZA 1B35B 5FZ4A 4M0HA 1VMJA 3VBOC 4ZPIA 3ZXGA 4JRAA 2D44A 2LALA 2W39A 1R091 3AJZA 3E1F1 1Y9MA 4Q4X2 4RQPB 3GALA 1YUDA 4U36A 1UU6A 5GZCA 2ZGRA 1UY0A 5F6LB 3E6BA 2R071 1GSLA 1OFSA 1JYWA 4AVVA 4CCCA 2R073 5BNQA 1TQ5A 2FCTA 1OOPB 4XQ4A 4CP9A 4IGQA 1JZ5A 4ZKTB 4CYDA 4CCNA 5J7MA 5JSPA 1C1FA 3GXUA 1ZA4A 1A3KA 2XHKA 4N43A 4X6RB 5LY2A 1SLLA 2YBSA 2VZUA 5LBEA 4D0QA 2C5DA 1FATA 2J1EA 4DQAA 3BTXA 1RUOA 5FLJA 2ZHNA 3FBYA 4OI1A 3BN6A 4WM7C 2ZACA 2HWE2 4FPCA 1GZ9A 4JQRA 4NHMA 4AEKA 2IWGB 1W0PA 5A33B 1HRI1 3M2MA 1HRI3 1HRV1 4KWJA 2BW8A 5K9YA 3PLQA 4Z1VA 3FBMA 4LITA 5T3NA 2QQMA 2DUPA 4AAXA 1QQP2 2ZXQA 1Y4WA 3PU8A 1G9AA 2ZTNA 2L9LA 1ENRA 4OVEA 4P9LA 3WW2A 1MS8A 3EYPA 5F5IA 4FPEA 1MS1A 3FHQA 4AZZA 3M1HA 4EJRA 5I8YA 1E5RA 1KJLA 1MZ6A 4RQPA 2MHFA 4A41A 2QVSB 4QU1A 3T4HB 4FBFA 1B35C 4Q4X1 1JZ4A 3PJYA 2Q8OA 1UOJA 2YYOA 1ENXA 2ZGNA 3KV6A 4FOYA 4C8DA 2VQUA 1PO12 5FKBA 4CU6A 3POIA 3WW4A 1QMJA 5EJ3A 1OOPC 3WF2A 1NLQA 3AYCA 1V6LA 2HWD2 2ZAAA 4GQ7A 4A42A 5T54A 4COVA 4ZXKA 4W50A 2DWRA 1MVQA 2GDFA 2XJVA 3A23A 4META 3SH3A 5BNOB 3QBQA 4UFJA 4V2VA 3VD9A 2YGLA 4TXWA 4LNVA 2VAUA 1LOGA 2JE8A 1F4AA 3EQEA 4NWWA 3ZO0B 3UV9A 4JGYB 4LKDA 1HDKA 2VBPA 2BPA2 3DXUA 2HWE1 1TEIA 3AZYA 1K5JA 5A33A 3ORJA 4JCKA 5LA2A 2Q8DA 2HWE3 3NAPB 4Z8BA 4YFZA 4LHSA 3DYOA 1BMV2 5HCHA 4YSFA 3IAQA 4EZHA 5C3RA 2WZR2 1F2NA 2W94A 2O14A 3QD6A 4IEVA 2EICA 4GH4B 5FREA 1ZRCA 3F95A 2AZ5A 3D8CA 1KQRA 2XG3A 3P5BA 1C57A 1MEC2 1AUYA 2ILMA 3SHRA 1R082 2YMZA 3BTZA 2NMOA 2KA3A 3CEWA 4RFRB 5H9SA 2PAKA 3GHMA 4TYSA 5CG8A 1W8FA 5KHHA 1UY2A 5FZ3A 1US3A 3GZUC 3AZXA 4OI2A 2IXKA 3ZIWA 4XDPA 2V09A 1NLSA 4MGYE 4ASMB 1SLIA 4XMAA 4FPYA 3LSEA 4YM2A 4CDXC 2R1DA 2DV9A 1AXKA 3H3LA 3KHCA 4P08A 2FDFA 1S0BA 4ZU5A 3WP6A 3U0ZA 3TEYA 3JB4C 4RYDA 2QQJA 4W6YA 5FMOL 5T50A 1KS4A 3PMEA 4IEXA 2Q8EA 1YFYA 2QCSB 2CWMA 3MV01 1H9PA 4CCOA 3JUUA 2VW0A 5BNOA 1ZRFA 2HWD1 1NQDA 1HN1A 3EBRA 4I0WB 4XFIA 2RDQA 4OLLA 2HWD3 5A3TA 4Y3OA 1YFUA 3VKLA 5FXVA 3U78A 4JGYA 1HN0A 2JKBA 1ND3C 5JVVA 3KV5A 1AR72 4HN1A 2DTWA 1QOTA 3O0XA 1QNWA 3OGGA 4NHKA 5C70A 3T09A 1GNZA 3NAPA 4YG6A 4NMIA 5FXWA 1BXHA 1RUF1 2ZZJA 1CGPA 1V9U2 1O4YA 1RUF3 5FK8A 1BMV1 3AMMA 2O1QA 1GMMA 4CPBD 4JKMA 4MLOA 3UJOA 3ZPYA 4GH4A 4AEMA 4BU2A 4CP1A 4DMIA 5LCWL 2WZR1 4LULA 5CU1A 1RL3A 1X50A 2BV4A 4UFKA 4Y5Z0 2WZR3 4INDA 3VGIA 3AX4A 5GZFA 5CB7A 2BWCA 1EP0A 3WT3A 4CXXA 2D5FA 4ZONA 2BDRA 1MEC1 4Y1XA 4MHRA 1MEC3 2X09A 4YM0A 5F32A 3TAYA 2XLGA 2JDHA 4L9BA 5F3IA 4IUGA 1RUG2 4PLNA 1UU5A 1WCQA 2P37A 4QX7A 1SMVA 1NAEA 1OKOA 2ZJCA 4U2AA 1S0GA 2X10A 2JDAA 4WVZA 2WNVC 2CDOA 3NV1A 1LCLA 4WVWA 4B3NA 3KVAA 4QMAA 4Y4YA 1XE7A 3WZ1A 3CDZB 3S6PA 2D6NA 2WRAA 1KDKA 2WNUA 3WNPA 5F3CA 2CGPA 2IXCA 1PK6B 2PHTA 1CQ9A 4H7MA 4NROA 2VCAA 1Q43A 3N7LA 4HSLA 3ZFEB 2QDNA 1V6MA 3KQ4B 1QY4A 1ULDA 1VMHA 5FYZA 5FZIA 3WP3A 3PVBB 4XACA 1YRZA 5GLUA 1PMJX 3THPA 3N9MA 4AGVA 2WA4A 2X5IC 4XJUA 4HETA 3WP5A 4G3YC 5CKMA 1ENSA 5A7PA 3WNMA 4PIZA 4F8AA 2NZ9A 1AR71 4K21A 2P3JA 2BNNA 3CKHA 4Q29A 1I9RA 3ZFFB 5JDBA 3CJIB 2ZX0A 2UYAA 1VBB3 2Y6JA 4LKEA 1W9YA 3D3AA 3RI8A 4XAEA 2QQVA 4YW7A 1VBA2 1V9U1 4AYUA 3ETQA 3J7MA 3UGFA 2HLEA 3VD4A 4XFGA 5FKCA 3I2KA 2ZEYA 3FZ3A 5CEHA 4Q26A 1AR91 2Y26A 1AR93 2DURA 3WF3A 4DO0A 3AP4A 4XBLA 2HBUA 3KF3A 4NR1A 4ZU7A 5KHIA 3Q8CA 2N7GA 1NCQC 2DFBA 3U10A 1VBC3 1OUXA 1REDA 3UGHA 4GB32 3BUCA 4K1ZA 4QM8A 2R063 2ZGQA 3LWCA 2P17A 3JCIA 1MS4A 1W2OA 1R64A 2JJ6A 5L9RA 2PHXA 4NVPA 4COYA 4F83A 5FYMA 1JUHA 4M4PA 4P9GA 5AFBA 1BHGA 1QJX2 2SBAA 1LOBA 1PK6A 1V6KA 4FFFA 2HWF3 1XJAA 2FDKA 5JZGC 3ZFEA 2RG4A 3OB8A 1CR7A 3CQOA 5IK4A 3BPSA 4UXAA 1YWKA 2JB8A 3UGGA 3ZN5A 1A8MA 2A75A 2C1FA 5FYSA 4ATEA 3MYXA 4COUA 1CAUA 5IVBA 4AGRA 2HEVF 5BV6A 1J1TA 1HQNA 4CXYA 4NPRA 1KFXL 1REFA 4XBNA 4FAGA 2ENRA 2WSVA 3ZXFA 1IOAA 3ZFFA 2GC3A 1W6OA 3CJIA 4K3UA 3H1WA 1N3QA 2JWPA 1JMUB 3BPZA 4XIKA 1VBA1 3V56A 3NKTA 2ARCA 5L9VA 5AFEA 3IDCB 4XCBA 2IFRA 2PELA 1OF4A 3QH6A 3AJYA 2WT1A 4PDWC 4OI4A 5C33A 1Q3EA 1W6MB 5HPOA 2VNOA 5I93A 1GP6A 1X33A 1ULOA 4YZ4A 2QZ2A 4QX5A 1JHNA 2IVJA 2XQRA 3A0NA 3TWIA 4BA6A 4BWOA 1PO22 2XJSA 5A6QA 5BYNA 4XJ8A 3ZKUA 3OGRA 2VH9A 1DQ0A 3ZOIA 4UYBA 2Q4SA 4HT1T 1XYOA 1JYXA 4GB31 1LHUA 2WR9A 5A7OA 5FZKA 4FAHA 4GB33 3U4XA 1PVC2 2VL4A 1QXJA 1SZBA 5HXVA 1O3RA 1F31A 4CDQC 3HMYA 1BLZA 2ZMKA 3I59A 1OUSA 3VZLA 2C9KA 3UYJA 1UZYA 3KHBA 1QJX1 4OCTA 1RGSA 2VXRA 4BCUA 5HI0A 5GLWA 4RHV2 2VMCA 2ET1A 4P9IA 3B02A 4FTSA 4NWVA 3RJ2X 3I2JA 5ANQA 4AI1A 1C4RA 1KJRA 2RS32 2V73A 2Z42A 2YFUA 1H6YA 5BUVA 5IK7A 2RM21 3ZYFA 4GWJA 2YC4A 2RM23 1CONA 2CY6A 1PIV3 2JDMA 3J26N 1SFYA 3K2OA 3M3IA 4PIXA 1UL9A 3OBRA 3USSA 1UPIA 2ZGOA 3SCFA 2WZ8A 3WQ7A 5JLVA 1UZZA 2CHHA 1IPJA 2FCVA 5GZEA 3KCXA 1S0JA 4H2AA 3OPWA 5D8AC 5A3WA 5GM0A 4QX0A 1O3TA 2PHDA 4CRQA 4B7EA 3M7AA 1SFPA 1SCSA 1K5MC 5CISA 2G9FA 1DP0A 1W6MA 3B9IA 2R16A 3DYMA 1O7FA 5C8CC 3M3CA 1Q5OA 4XF9A 4GWMA 4GMP1 3POGA 2JG8B 4FP3A 4GMP3 4DUVA 1TVGA 3BTAA 4FXKB 3WLUA 1PO21 4FFGA 1UKGA 2D6OX 4PF1A 1G9FA 1I6XA 1UYXA 1CAVB 3HR9A 4Y22B 3VBRB 3HOBA 3W59A 5H9PA 5HCAA 1I5ZA 4NIDA 5LRSA 4EWDA 3HWJA 2YY1A 3BVCA 3FUQA 4Q0VA 4FOQA 2WFF2 3JBG3 2IXIA 4BPZA 1RYYA 2CNAA 2VOWA 4IV1B 3N9LA 3KD4A 4Y5TA 4R9AA 2VECA 5FV3A 3HQUA 2TNFA 4YVSC 5FY1A 3FLPA 1NA1C 2TBVA 2LW8A 2IXHA 3GJBA 3HN3A 4M3CF 4Q4Y2 5CNAA 1NCRB 5IFPA 4YW4A 4O65A 5F2WA 4BOWA 2RS31 4DNYA 4TWTA 2RS33 5DUWA 1VMFA 1PX4A 2JDPA 1SEFA 2BGPA 3K48A 5FXXA 1WWYA 4Q0QA 1GWMA 3LIHA 3AZVA 2QFEA 5CFDA 1RMU2 3PURA 4FOVA 2XQXA 1PGL1 2Q1MA 1W6QB 1WMFA 2ADDA 1AJOA 4HSJA 4DFSA 4ISQA 3HBZA 4AHXA 2EIGA 1HXS2 4L11A 1JI6A 4AHZA 1SLAA 3CZUA 1CVNA 2J1RA 2OUJA 4AW7A 2I74A 3L2HA 1XC6A 2W2IA 5T5OA 2GN7A 4O7XA 2JG8A 2CTVA 4JQTA 4GXLA 4PQQA 1FNYA 2P5BA 4CCDA 1UX6A 2RHPA 2YU2A 2NYYA 2WAAA 1OLQA 3D0JA 1CAVA 4Y22A 3S7IA 5C5TA 3VDDB 3WF1A 1YJLA 2GN3A 1OLMA 4RR3C 1WMDA 2E32A 3K3OA 1GNHA 4WBBA 1AF9A 1ND2C 2A73B 3ES1A 3LKJA 1VAVA 3VD5A 5KHKA 1ULFA 1V6JA 3LSDA 4IV1A 4QQPA 4CCEA 1HB4A 2WFF1 1JYCA 2WFF3 5FY5A 3K4DA 5LBBA 3ZKYA 4IEPA 4RD7A 3WW3A 1GZWB 2W47A 4QQOA 2VD7A 1C5HA 3LDKA 4AHYA 4XILA 2VW1A 2W0XA 2GH2A 3RGBA 1WCUA 1QF3A 5F6KA 1W90A 3T2PA 2HYKA 3WQBA 1DU3D 2UU8A 2XGXA 1N1TA 2VMGA 4LIVA 3BKZA 1ZBE2 4FPOB 4QGLA 3WY6A 4E4DX 3O0WA 3OOXA 2VZVA 1NKGA 1NZIA 1NCRC 4EN7B 5CKQA 5A7NA 3NV4A 1DLLA 4PLOA 3GM8A 3VZNA 5L7OA 2BVBA 1J1LA 1B09A 1JOJA 2B7YA 4FPJA 4KQ7A 3AMHA 1KFUL 1W04A 2WYSA 5FPAA 4LO5B 1W6QA 3FL7A 4JC1A 2NN8A 2NM1A 1A8DA 1W8HA 5FZGA 3WDUA 5JI9A 4YW2A 2E63A 4FTBA 1YEWA 3EB7A 2HKXA 1HXS1 1J59A 4XJAA 4NAOA 4NRQA 2VOVA 4A3ZA 1FV2A 3H9AA 1JW6A 1POV3 2A7AA 5IVCA 1EV12 1YIFA 1N1VA 3VDDA 2VUAA 3ZYPA 3WHUA 4MGTA 2DCKA 4R4XA 3S7EA 3T3YA 1RVF2 4J25A 2LS6A 5EYXA 1DYKA 4IV3B 3A22A 5ABJB 1BEV2 4P5HA 2BNOA 3GDBA 4FCAA 1GWKA 1GQHA 3ACIA 3H1MA 3ECQA 5FCCA 3O1MA 3W20A 2VTFA 5M0TA 2EVXA 1GZWA 1NG0A 2BU9A 2ZGUA 4YFWA 3ZXAC 4AFDA 2JD9A 4NPLA 3SEPA 4DS0A 2GP3A 2VU9A 3ZFGA 4Z2WA 3OGSA 3RYKA 4BXSV 1I1EA 2B45X 3U1XA 4BZ4A 5LWBA 2J1SA 2RS13 5JXGA 3RZHA 2QKDA 3NMBA 2JB4A 2A6WA 3FLRA 1J83A 1DF0A 4M3CB 4F3JA 4N9IA 3VBHB 4UBGA 3NV2A 1PGSA 3MUY1 5IVJA 3HQXA 4ITCA 1JXNA 2ZKNA 2AH2A 3Q8AA 2FQPA 2PAEA 4W6WA 3OSDA 1K45A 3NWKA 3K46A 4J1XA 3MFAA 1XYPA 1RUE2 3BI3A 2HWB3 4A6SA 4B4QA 3AKQA 3B7MA 3DN7A 4IGOA 2BFUS 3T0DA 1AYM1 1BK0A 1AYM3 4QB6A 1PX3A 2I45A 1IG0A 3SKJE 3U37A 4NRPA 3TYJA 4N53C 1S0IA 1G8WA 5F5AA 5GALA 2ZZQA 1JH5A 4GKYA 3PUAA 3VDAA 1X82A 4QKDA 4FPKA 4W4ZA 4XW3A 1BQPA 5CFCC 4IV3A 1RUNA 2WJSA 4EN9B 1RVF1 5F39A 4LOTA 1DYPA 3OCPA 4JZRA 5FP9A 2PXJA 1RVF3 3TBDA 1C3HA 1XSQA 1QJZA 5BPXA 4CZSA 1J3PA 4D6QA 5ABJC 2WT2A 4P9WA 1DQ1A 4I0AA 4B4PA 1OQ1A 4TTGA 2GNDA 3OPTA 3IAPA 4O9EA 4FP2A 2Y0OA 1QDCA 3T30A 3DGTA 5KC5A 3ZSJA 1ZRIA 2P3KA 4HANA 2IXJA 3WQ0A 1S0DA 3J9SA 2P4EA 3AL5A 2BP6A 4OUSA 3RJRA 3OY8A 3SLIA 1AVBA 4XC9A 5A6ZA 5C4WB 2XJTA 5K8SA 1EY2A 3ENRA 4XBQA 4CE8A 4CCLA 2DCJA 3FHAA 3VBHA 1WW7A 3KB5A 1R1ZA 4AHWA 3ILRA 3VD3A 5FO7B 1STMA 5DUVA 5F5QA 2XL7A 2E9QA 4AEDC 4FO9A 3IT8A 3R6SA 1GBGA 1RUE1 1SG3A 1W2UA 1VAKA 2BFUL 2QTWB 3RS6A 2TUNA 1ZZCA 1W6PA 5FP8A 1T2XA 2ZHLA 4YVWC 1QDOA 4R8HA 2D5HA 3BALA 5IUQA 4QPGB 1WLDA 3WNNA 1Q8VA 3KT7A 3NJYA 1U5XA 2YZ4A 2WT0A 1YQ6A 4ZY9A 5F3GA 4CUGA 3N35A 2P34A 5DPNA 3P6BA 3RZZA 2HBTA 5FPZA 2C24A 1IQAA 1MZ5A 4QD2A 1JU4A 1E5SA 1HJFA 5J48A 1VRH3 1PM4A 4GIQA 3VBFC 1JYIA 5FZ8A 2XBO2 5FMBA 4XPVA 3L9JT 1H8TC 1RUC3 1F8VA 1YCIA 2GC2A 2E7AA 2WNOA 2JXAA 2WN2A 4QX2A 3VDBA 1ODNA 1F4HA 1XNAA 2XKPA 2W68A 1O5UA 4HKLA 2F17A 4XDQA 4BMBA 1OQDA 3WP4A 3R4UA 2BERA 5C4WA 3D6EA 4HXCA 3J7NA 3P3NA 1HX6A 2XVGA 2Y6HA 1R093 4LLOA 3IKWA 4CU9A 1LNSA 5AVAA 2JDNA 2B46X 2F4LA 2JG9B 2QDRA 4FQ4A 4KU7A 1RUI2 1ZM1A 4P9JA 1H1AA 4R4ZA 4AFAA 4CPBA 4QX8A 1W8ZA 1V70A 4LBLA 1APNA 5DABA 3ELNA 5DXDA 1NE6A 1UZVA 3ILFA 1RUJ2 2ERFA 2Z69A 3I54A 4AR2A 4M00A 2HH9A 5GLTA 2C9AA 2QUOA 4V1PA 3VZJA 2WL1A 4N90A 5A7SA 3URFA 5F37A 3TEWA 1NUKA 4NIHA 3OUJA 4QPGA 4XHBA 5LK5A 1BK1A 2YPJA 3B5LB 3DPRB 1SLCA 1WD3A 1WLWA 2VE1A 4LA3A 4HKWA 4LUKA 5B4XA 5B2GB 2OX0A 5DG1A 4N43C 1W2NA 5FLIA 1UY4A 1F9KA 2F6BA 1VALA 2PA7A 2G4IA 1BZWA 4S2GA 2Q1FA 3NJVA 3WDVA 3I97A 3PJQA 2Y64A 1Q8PA 4OHXA 5JIAA 1HRV3 3I3DA 5JAXA 4WM8B 4LK7A 1YLLA 1YFXA 4UFLA 3UKVA 1UZ0A 1LRHA 2ADEA 5FZHA 2H6CA 3VLBB 3R4SA 4LKFA 4DXTA 3QACA 2XBO1 5CAZA 2XBO3 4DB5A 3AKRA 2WWSA 5FZCA 4KL1A 3WD5A 2YFZA 4D6SA 2H0BA 4OFGA 3ACLA 1OQEA 3K77A 4QPIB 1S2BA 2RMU2 1HJGA 5FBJA 1W8WA 4Q4X3 1OKQA 3MI8A 1LTEA 2JG9A 2VMHA 3KGLA 1RXFA 4RQPC 2Y60A 1RUI1 1MZEA 4GAZA 4AE2A 5A3UA 3MIEA 4CTEA 5ERLA 1RUI3 3WR0A 5JR2A 2JEMA 3NJZA 1YO8A 2VZRA 1CIYA 3VDCA 1WD4A 5KXCA 1VP6A 1OA4A 4GKXA 1KXGA 4BQ5A 3CHXA 3IIAA 3NW4A 4ZS3A 5FBZA 5FZ6A 3B69A 4CCMA 3DPRA 3K51A 3ZSLA 3NRUA 5F5CA 3FMGA 3KGZA 4CUAA 2V5YA 3MLJA 3O5SA 1QXPA 4Y24A 5CVRA 5FY7A 4YARA 2WO1A 2Q5TA 4MGSA 5HV4A 1MACA 3OBZA 4MADA 3ILNA 3VHOA 4I09A 4MZUA 4IERA 2RS52 3T2TA 3MV11 2Z4FA 4WM8A 4UFIA 3MIHA 5GJ6A 4ES9A 5FLHA 1XE0A 2VY0A 2Z5WA 4COWA 1QQP1 1FYUA 4QXCA 3AP6A 2ZPXA 1QQP3 1ZVFA 4I02A 1KEXA 1A78A 3JD72 4BQXA 5FR3A 3E6CC 2YROA 1WCKA 4FFHA 4K8FA 3UKTA 4C1XA 1CAXB 1BVP1 1NQJA 1UZWA 1RHI2 2BGOA 2PMWB 5HCBA 4AXOA 1W2TA 2OIIA 1LOFA 5EQUA 1NOVA 1QXRA 3WDWA 4DRRA 2CGNA 3V65A 1C28A 2W1QA 4QPIA 2BOIA 4XUNA 5EXOA 3ZDSA 4C0HA 1LECA 4K40A 2RE9A 2CV6A 4IEYA 4BJ0A 4CEWB 2RMU1 2QE3A 4XFAA 2CGOA 3GHNA 5D1IA 2EXJA 2WQ4A 5FUPA 4TLFA 3NNLA 4V2WA 5HBAA 2GNMA 3RRDA 1SFNA 2JE7A 5LRRA 1QJU2 2WNUB 2ARBA 1GUIA 1EPZA 1PO11 4R52A 5LASA 4E9KA 1PO13 2DU1A 2VQAA 1LESA 4Q8LA 1MZFA 2OYZA 2DVBA 3AP5A 3MUZ1 1Y7BA 1L7QA 1UMZA 2EA7A 4BM8A 1FX5A 5FYHA 1JHJA 3I3QA 3ASIA 1MVEA 1D2QA 1PVXA 3GGLA 4Y1VA 5FZ0A 4B29A 2WA3A 4OHYA 4IGPA 2KM2A 5F8PA 4Q0SA 1XB9A 4JDOA 3WX5A 2RJKA 5JMCA 3N36A 3PVNA 4LK6A 5DAXA 2VZTA 5BNOC 4ZHNA 2PHRA 2DCZA 3T1LA 5BY5A 4XXAA 3RZKA 4LBQB 2H6BA 4JGYC 2RS51 3LIGA 1SBEA 3S57A 1GICA 4K8RB 4NE9A 4UT5A 4XAAA 4W65A 5KXBA 4L97A 3I2FA 2MEV2 4AF9A 1N47A 5C7GA 3F2ZA 3NAPC 2VOTA 3P3PA 5JSOA 1SHWB 1DGLA 3C7FA 4XE9A 5IVYA 1GFF2 4OQ8A 4BK5A 5A3PA 1JOBA 1AHSA 1CAXA 3A7QA 4HL0A 3JD71 5FYYA 5BNNB 2AENA 4JDMA 2ZGTA 2CWSA 1LGNA 2W95A 3ACGA 1UMHA 3JD73 3O1RA 2JDKA 3RI9A 1RHI1 4GH4C 4LKSA 5FXZA 3RYRA 5FOJB 3W21A 1R081 1RHI3 1PNFA 1XNCA 1R083 3LDRA 4BQYA 3BTYA 4NIAA 4CEWA 4K1YA 2CDPA 2QZ3A 5CIRA 2DCTA 4RFT0 4BISA 2FDJA 4D7SA 1AR62 3MPPG 3ZM8A 4AVTA 3OTFA 2VNVA 4FSJA 2XJRA 3EMRA 3H1YA 5LA9A 2Y6FA 2A3YA 3C8XA 1NX9A 5J96B 3X29B 4E4HA 2A6VA 1QJU1 4UWDA 5C3SA 1Z0HA 2JECA 1F5FA 1URXA 5L9BA 3I3BA 2K46A 1OD5A 1FXZA 1LEDA 1NXD1 2ZMLA 5FZLA 5AVPA 1WW5A 2WYFA 2B9UA 2QBXA 1IPSA 1UCXA 3H0OA 2VTXJ 2K9ZA 4S2FA 2D40A 3AFKA 2DVFA 1SPPB 3LEKA 3WEZA 5A6YA 1CAUB 1JN2P 1YI7A 4AFCA 1ZZ8A 2BZDA 3POSA 3HPNA 4AFMA 4LBQA 3PTYA 4QXKA 1AR73 4OMCA 3VHPA 1W6OB 3H50A 5EV7A 3I49A 3G7DA 2EF6A 5TSWA 1V9U3 3CBNA 1WA6X 1U5YA 3AVSA 3BOWA 1BKZA 3NKGA 5BNNA 5IATA 4XETA 3AVRA 4OZXA 3HT2A 3WQ1A 4LHLA 5FJKA 1UF2C 3GBWA 1Z7S2 3O7OA 1ZRRA 1W8UA 1YXWA 3FHIB 3WG2A 4ES8A 3WUDA 4OYUA 1XNKA 1GP4A 1LR5A 3T2QA 2RVAA 2O8QA 4AVAA 3HVDA 3C7HA 3TEZA 2J1TA 3D5OA 1RUG1 1UWWA 4NPMA 1LAJA 4DEVA 1AR61 4QHBA 1RUG3 4H55A 4IEZA 5F7UA 2YDEA 2R0HA 5C9AA 1AR63 1Y9QA 4GD4A 3VKNA 3ME2A 4PBOA 4XYXA 4KH9A 1PZ8A 3R4DB 5T5JA 4XMIA 5FWJA 1KRIA 2ZGPA 1S2EA 3I59B 2OT7A 4LO7A 4A6OA 5BNPB 1N3OA 2VBBA 2VPVA 2AGSA 3MIBA 2ZX2A 3GJAA 2FZ1A 1QEXA 1GU3A 3N9PA 1JZ3A 1LENA 5LB6A 5K0UB 1V6OA 1PK6C 1OI6A 2X05A 5LZ6A 1E57A 3ZFEC 1V0AA 2ZBJA 3B9CA 1SPPA 4B1MA 5JXIA 2WNEA 2CAUA 1CN1A 3VZMA 1VPHA 1J58A 3RMXA 5JWPA 1DGWA 1TME2 2IC1A 3B00A 3KSCA 3KS7A 5FZ1A 2P2KA 4HONA 2QQWA 2R32A 3H8RA 4S2HA 1UQXA 1D7PM 2CL2A 1XU1A 1ACCA 3N4MA 3MF6A 1UU4A 2ID4A 1M4WA 2O8OA 2PHUA 1G7YA 2A71A 2ORXA 5F9TA 1FPN2 3ZFFC 1VBA3 3CJIC 2ZGKA 2XJPA 5IWFA 4M4RA 1H2MA 5KHJA 1L3JA 2UY9A 1SDDB 2ZGSA 2BJSA 3IMMA 4EROA 2VTXA 4EWEA 3VV1A 1LU1A 1RUH2 1BYHA 4GJZA 2GNBA 1Z7S1 4Y4RA 3LEGA 3LEMA 1Z7S3 3K4AA 1SLTA 2Z79A 4HVQA 4XUPA 3KMHA 1LHWA 5E88A 2ZX3A 1OURA 4BXFA 3H8OA 1UYZA 4LMFA 4DXSA 2OPWA 1QIQA 3TB0A 4X8PA 5G04L 1SDWA 5FY0A 5BNPA 3T0BA 5FQ0B 1AX1A 3BODA 4XZUG 3RZMA 4LA2A 1QJX3 3ACFA 2AR6A 4UBHA 1TMF2 5K0UA 1FMD2 2VG9A 3VZKA 3BGAA 4DUXA 2BEOA 1OPMA 4KNCA 3FE5A 4CDQA 3INAA 2BBAA 1OF3A 3JB8A 1WA4A 3DUIA 4HVOA 3K3NA 1J3RA 3AZZA 4QT6A 1TME1 1U5IA 5L73A 2DVDA 4JX0A 3IDBB 4NHXA 3RDIA 3MW2A 1W39A 4IEOA 4Z82A 1UKRA 1PMIA 3Q8FA 3GYDA 2ZEXA 1FT9A 1DIWA 1W05A 5CFDB 2JICA 1NXMA 2YV8A 4UW3A 4B7KA 5FYCA 4URAA 1FPN1 2B4KA 2X53S 2YG0A 1HB3A 5D21A 5KHGA 3MZHA 1YC61 2VJXA 2KR2A 4D69A 1CD3G 5FY9A 3NL1A 5JCTA 1WBFA 4IEQA 4NIIA 1RUH1 3HEIA 2FDIA 4BB3A 1Y9GA 1WUVA 5C71A 5HV0A 1DGRA 5IVVA 3TN92 2V4VA 5F1RA 5JOWA 3N9NA 5DN2A 1RJ7A 2DTYA 5DAVA 1PO23 2GALA 2X8KA 1GZTA 1H30A 1CAWB 1RITA 1WCSA 2P1BA 5FZDA 5A7QA 4BLIA 4CA9A 3WG1A 5FO8B 3TNPB 4FOWA 4PCRA 5IFTA 3EO6A 1QJFA 1PVC1 2C0ZA 1OC1A 4L2NA 1PVC3 1T6GC 5FQ0A 4YGDA 3RZGA 2G19A 2VMIA 4YYOA 3P1IA 3NNJA 1S1AA 4K7JA 4CDUB 2H0VA 1YQ8A 4HN0A 4UF0B 5SV5A 2WZPP 4A7ZA 1GR3A 4WZCA 5I8SA 2WQZC 4FXGB 1WMXA 4Y5SA 2W91A 2LTNA 1MQTB 2FDHA 3KT4A 1FMD1 1G6NA 3N3HA 4NAMA 4RHV1 1FMD3 1UO9A 3D82A 4UFMA 4RHV3 1OH4A 3RPQA 5IVEA 4W8JA 1JZ2A 1FI2A 3AKPA 4HVRA 1W9WA 3UK9A 3WG3A 1ZA7A 1AL22 2PLV2 4KG0A 4HKOA 3I2DA 4LBOA 4URTA 5LEKA 1IGOA 1SBFA 4H7LA 5J09A 1OVSA 3GCXA 1IQDC 2HWC2 5LATA 4KWUA 4BDVB 3DF0A 1LJ7A 3GF6A 2QQUA 3MHZA 4MGZE 3MIFA 5L7OB 3V0BA 5ISLA 3DEMA 3OGJA 3GNEA 2OPKA 4RS5B 3N7MA 2P3YA 3AXDA 1D2SA 4Q5OA 3VZOA 4I2OA 2J42A 5C3OA 4G4FA 4YGEA 5F2SA 5A3OA 3H8UA 1FAYA 3AXEA 3LDBA 3ZYRA 1O8SA 3PVOA 2XH6A 2R6QA 2ZX4A 4BE3A 5KBFA 2XJQA 1ZRDA 2W52A 2WKKA 2K2SA 4UI9L 4QPWA 5J36A 5DQ0A 4Z2AA 1AXYA 1IKPA 1H2NA 3K4ZA 1HIXA 1CAWA 2E33A 3MBWA 1LGBA 1U5ZA 2JIJA 3J8F2 2OXBA 2JG8C 2Y6KA 1PNGA 3GBFA 4QDQA 1C8M2 2D7FA 1GWLA 3QOPA 5IYYA 2VCCA 2VUCA 4ASKA 3MLKA 1O8PA 2XVKA 3WDTA 3VBRC 4KBZA 2W08A 2WDBA 2C26A 1W03A 3C3VA 5APAA 1S4CA 4UF0A 2HEYF 3S30A 3POEA 4CDUA 1IHMA 1X9PA 4OHZA 2DDUA 2E7QA 1MQTA 1CZVA 4IV1C 3N7KA 1UN1A 2JX9A 4HLTA 1W2AX 4AQSA 1CZSA 5AC92 1E5HA 1ND2A 4Y1UA 5ACA2 3MDPA 4Q4Y1 4QKBA 4J6GA 3W9AA 4Q4Y3 5E8AA 3ZFGB 3NQHA 3APBA 4ISRA 1YQCA 2R042 3KLSA 1TZOA 3PDQA 5J1XA 3PUHA 2XDVA 3Q8EA 2D6KA 1AL21 2PLV1 1HB1A 3WINE 3WV6A 5EP9A 2WFPA 1UW8A 4JKKA 5KXDA 1JUIA 4FPLA 1OSGA 1CPMA 2HWC1 2Y38A 4LBMA 2VQTA 3VBSB 3WXPA 4RS5A 3ZSEA 1KITA 5I0DA 1OMIA 1QOOA 2YU1A 3H7JA 5FAXA 1RMU1 3SXWA 3THDA 5LK7B 4O9GA 5T52A 3CF6E 4YRDA 1RMU3 3WOGA 3ATGA 4PLMA 5L7OC 4IW3A 4YPJA 3PMSA 2A6YA 1H4HA 2PHWA 4IE4A 2F4PA 5I91A 3HQRA 2VUJA 2WLPA 4KGQA 1HXS3 1H1IA 4KG8A 3S0MA 1CPNA 1HV1A 4IEWA 3VB9A 3EXUA 2C6SA 3ZXDA 1DQ4A 1NY72 4XQWA 1ALYA 4E2QA 4N8MA 4IE0A 3IBMA 2FMDA 3AM2A 2VUDA 4XFBA 1UXZA 3I2GA 2XVLA 2A5ZA 3U11A 2R7EB 1GOFA 1HB2A 4P14A 3VDDC 2XUEA 3MICA 4CUBA 1S0FA 2E7TA 3IDEA 3C7EA 3MIGA 1JTZX 3POJA 3U75A 4JHZA 3WNLA 4QQ2A 4PHZA 1D4VB 5FDBA 4JGZB 1QWRA 1TG7A 4YWAA 4YNIA 1UIJA 1IS6A 1YI9A 2BYVE 5J98B 1D0GA 1LULA 4LEJA 4OUEA 5AC91 3LEIA 5ACA1 2IUWA 2ZGMA 3RSJA 1ZBA2 1EYBA 1KD7A 3USUB 2QQPA 4ONUA 3OY8B 5SV8A 2E26A 3CU7A 4JKLA 2R041 1ZBE1 1GKBA 1WW4A 2YHJA 5H9RA 1ZBE3 4AVBA 1BBT2 2FMYA 4MOAA 5E6HA 5FYTA 2DUQA 3RVHA 2VZOA 2WS92 4H3WA 5FY8A 2WQ8A 3VBSA 1MS0A 4GWNA 2BBVA 3LAGA 2DVGA 2A6XA 4P9XA 3VKOA 1UNBA 3FFZA 5A80A 2AEZA 4XUQA 3VUOA 2OW4A 4CU7A 1G9DA 1QH7A 1OXCA 2WZEA 4P9YA 2WINB 3AP9A 4E2SA 4AVCA 3BIEA 1XPWA 4R9DA 4SBVA 1W6PB 5JOYA 4OHWA 1ZX5A 2TEPA 3AB0A 2ZHMA 2WWJA 3KM5A 1XSRA 3VKMA 4J1WA 1YIPA 2MPFA 4XHXA 4A4AA 2A70A 4AI9A 2ES3A 3J7HA 1V00A 4XFFA 4XCAA 3VBUB 4I30A 1EV11 4LO6B 4QHZA 1O59A 2FDGA 1NY71 1IZ3A 1EV13 1O4TA 1LHOA 4KI5M 1MS5A 4MO3M 1QJY2 2RR12 2YXSA 2B9VA 3MLLA 3WCRA 5EHDA 1ZZBA 1BEV1 4I3PA 3I2IA 4OI0A 5IW0A 1BEV3 1RINA 2D98A 3ZSKA 1GNYA 3OUIA 1UYPA 4D7YA 4IV3C 3ZLIA 4OUMA 4ET7A 1HV0A 5DDJ2 1QH6A 4JGZA 1ZNPA 4OMDA 1X9TA 4XJWA 1VLNA 3PUIA 4CUCA 4Q8KA 2W1SA 5CFCA 3THCA 1XNDA 3BU0A 4CDWB 3DL3A 2WO2A 4KBBA 2VMDA 3AFGA 5JSRA 3SQOA 4XJZA 4AI0A 3T4VA 4AAPA 3USUA 3ON7A 1FOD2 1AR82 3KV4A 3DECA 1ZBA1 5JMOA 2XXZA 2XR4A 4DUWA 2R1BA 5DAWA 2K0GA 3LFIA 5FP4A 3FLTA 3ES4A 4CEYB 5T55A 3ZMOA 5A1FA 1BBT1 3MEPA 4M3CE 4BK4A 3FX3A 3LOIA 4DY3A 4LLFA 1W9SA 4Q2FA 5GLVA 3PIJA 3VBOB 3VBHC 3KCYA 3KVBA 4CCKA 3LQCA 2A6ZA 3N7JA 1U12A 5T5PA 5BXXA 1RJ8A 4QAWA 2VULA 5FUNA 4HK9A 1RUE3 2AYHA 4DPNA 3O1TA 3O1UA 3E97A 5JOXA 2E51A 1W9TA 1G9BA 5A3LA 5FUIA 2O0OA 4IQPA 4JTOA 3RFRA 1L7RA 4YGBA 5JPNB 1DQ2A 1PGW2 2R072 2Q1ZB 3POWA 3VBUA 1JYTA 1DZRA 2VZPA 3ZMNA 5I8TA 2FCUA 4MSVA 5KWRA 3POYA 1W3XA 1XOYA 1QJY1 2RR11 5A3NA 3HT1A 1Q8SA 3OYWB 3HIFA 4FVVA 3CJXA 4DEQA 1POV0 4PF5A 1OVPA 4CXWA 2NP0A 4ASLA 2OQ6A 3N9QA 4WM7B 3SITA 3KCCA 5JUVA 3G6JB 3UESA 1VJ2A 5DDJ1 4CDWA 1KS5A 5FK7A 3ZIXA 2Y6LA 4MG2A 4A45A 1LHNA 2D6MA 4Q1RA 1W9FA 3ZR5A 1HRI2 1X7NA 3OUHA 3ZXJA 1EUUA 2XWJB 1FOD1 3CMGA 2G9GA 4LO8A 2YBKA 3BU7A 1O91A 1FOD3 2VO5A 5FYVA 3SH4A 4MUVA 1UMIA 4CEYA 1W6NB 3O14A 3PTRB 3LPFA 5C4WC 2D93A 3MW3A 4G9SB 4CP0A 3CIHA 4FFIA 5IK5A 3OGVA 2JD4A 3OBTA 5FYBA 1ZZ9A 2AC1A 3AMNA 3VBOA 5FZAA 4A2UA 4LBNA 1H2LA 1LGCA 3ALQA 3O12A 1RC6A 2AACA 3HAGA 2ZCWA 2JDUA 1NZCA 2ARAA 3UKNA 4GZ9A 3S5AA 1DDLA 1YJKA 3VD7A 2ORZA 1LOEA 2P6HA 2XUMA 4I0BA 2VMEA 3R0RA 3FJSA 1SQ4A 2XONA 2V5DA 1PGW1 1VRBA 2B5HA 4FQZA 4QPGC 2R49A 4DZGA 4RA0A 4D94A 1X8EA 3AYDA 5E16A 3B01A 2J7MA 1IS4A 4LQRA 3ACHA 4IDZA 1VB2A 3I2HA 4XVHA 3OYWA 3AKTA 4UW4A 2X29A 2WO7A 3T08A 5A7WB 3AYAA 4WM7A 5FPBA 2RJLA 4IE6A 5H9QA 1K12A 5FPUA 1QNYA 1VIWB 5DMYA 5LY1A 4AWDA 1KGYA 2BWAA 3DKWA 5C3QA 1I5PA 3RYPA 2XWBB 3LE0A 1PM7A 2OZ6A 4KU8A 4QHOA 1ULEA 1C1LA 5K4LA 1W06A 2WC2A 4MGQA 4UOJA 1DFQA 2GMMA 5IVFA 2CSGA 1TE1B 1CJPA 4RSUA 1W8NA 2WAOA 3ZN4A 1W6NA 4AG4A 2BGCA 1OPOA 2RDSA 4HG6B 4OZOA 3QLQA 4ZU4A 1X8MA 1E5IA 4TZDA 2XL9A 2NLRA 4QDRA 5CKNA 1HQLA 4LTAA 4D8MA 2JG9C 4XQDA 1RUJ1 1B35A 3AYEA 1RUJ3 1WLCA 3B94A 1AXZA 3M3EA 2IZWA 2YB7A 2GP5A 3AMQA 2PHFA 3WG4A 2E53A 1C8NA 4QB2A 1DG6A 1YQ5A 1VBE2 2VNRA 5DG2A 1LOCA 4CDXB 1ULPA 2ZEWA 5CA6A 2EXIA 5EWSA 3TRSB 1OOPA 3DPRC 2C4XA 2J22A 3N9OA 3T2OA 4L0PA 3WVJA 3AK0A 4EV0A 4BQWA 5J3UA 4MVTA 2EIBA 3JU9A 4TSVA 4QWNA 2GNTA 3IDAA 3CZJA 5A7WA 1HLCA 5FMOS 1XRUA 3IMNA 4LE4A 2DVAA 2XKOA 1ND3B 3IPVB 1S0CA 2B42B 4WM8C 3WW1A 4QDSA 5JI7A 2D3SA 3AP7A 4GULA 4NHYA 1LU2A 1DZTA 1MPXA 2EAAA 2UWCA 2XHNA 4IL7A 4C1WA 4C90A 2RDNA 2NQYA 4CP2A 4FTEA 4EE2A 3PHMA 3I4IA 5EZWA 2PHLA 4MV2A 2GZWA 2V72A 1RUF2 1VBD2 2W87A 2XOMA 5E89A 3PUQA 4P02B 2ZS6B 3LFMA 1UX7A 1QOSA 2DCYA 1LOFC 2RMU3 1GLHA 2VVFA 2CAVA 4I01A 4QPIC 4XFCA 4DIQA 5DZGA 4N9HA 1UOFA 4XIOA 2VM9A 4BQ1A 4O61A 4Y1YA 4MH0E 1GZCA 1DGWX 1US2A 4FPGA 5DAPA 5DZEA 2VQ0A 5I0UA 3VHRA 1RB8G 2WNVB 4YGCA 2VBDA 4LBKA 1BVVA 3NVCA 3OEAA 1N1SA 3IB3A 4QB1A 5F3EA 5FPLA 4CDXA 3O1OA 1VBE1 1UIKA 3AKSA 3VKFC 3GZTB 1VBE3 3LA7A 2OQ7A 4K20A 4QQHA 3MFCA 2BQPA 3BIWE 2W5FA 4AFBA 5LBFA 4TN7A 1AJKA 5DUUA 5FTTC 3A21A 1W99A 3I2OA 3HBKA 2PQSA 2RS53 1V6IA 3UNPA 4Q0UA 3OJBA 1U0AA 4BYYA 5FIXA 2X5IB 4FT8A 5A32B 1ASJ2 3IPVA 1C5IA 1ND3A 3LA3A 2QQKA 2R0FA 4YZ1A 5B4NA 1JZ7A 5D2AA 3WDYA 2LROA 4ORFA 4CSWA 3UL2A 1XBFA 3WNKA 3SCHA 1DBNA 3HNMA 1DHKB 3R05A 3GZAA 1TNFA 1DGRN 3MIDA 4IE7A 5FZ7A 1VBB2 4NO4A 2Z2SB 4CCJA 4GWIA 4YZ2A 3S5QA 2QQOA 1VBD1 5DZFA 1OBNA 3WF4A 4BH9A 1VBD3 5C5UA 4BIFA 1VAMA 5C9AB 5ANNA 5IAXA 4K6BA 4CEWC 5G05L 1MS9A 2WO3A 4EN0A 1AR92 1NCQB 2E31A 2UY8A 1ULCA 2WIIB 1QJU3 3TNQA 4AI2A 1GYKA 2D6PA 2RJ2A 3BOPA 1VBC2 2WNVA 2WNUC 3M4FA 4YW1A 1ULGA 5LW9A 4JDNA 5LA0A 2R062 1DLCA 2G1MA 5J37A 2WWUA 4JTNA 4A44A 1G9CA 4LT5A 4LIUA 4EQVA 5JZGB 2XMLA 3M70A 3ZXEA 4ZZ8A 1SCRA 2EXKA 2HWF2 4QU2A 3C2UA 2E6VA 2EIEA 3U07A 4XZPA 2QJVA 2VW2A 1OA2A 2UURA 4PIYA 5L36A 5FZBA 1G86A 1JZ8A 3RZJA 2X5IA 5A32A 3ZR6A 2MEV1 3RWNA 2OA2A 4Q4V2 1ASJ1 2MEV3 2ZA9A 1ASJ3 4AQ2A 5LEJA 1JS9A 3EHKA 5IK8A 3JQWA 2FBEA 4GJYA 4JVAA 4YG0A 4C91A 1PMHX 3E5QA 2D3RA 2QNKA 5BNNC 2GC0A 3WF0A 2DFCA 2PTMA 3CLPA 1VBB1 3KQRA 4D6RA 3E5UA 1IS5A 2WN3A 4PDWB 2I2SA 2VZ1A 1UOBA 1SBDA 1XU2A 3QCWA 4FPHA 4COZA 5C8WA 5EIYB 1WKYA 2R30A 4AGGA 5CYYA 2XPJA 3THTA 1H6XA 1NCQA 2W3JA 5FY4A 4AEJA 5C9AC 1I3HA 1N1YA 1ST8A 1XXNA 3AZWA 3ITQA 3J4UH 1OHFA 3NSTA 5GLZA 1WLTA 4PQ9A 3O1SA 1VBC1 4JV4A 1F35A 1RIRA 1IPKA 2R061 2ZX1A 4BMEA 4CDQB 4OHVA 4Z92B 2YC2A 3VL9A 3ZXLA 5JZGA 2ZKLA 3OEBA 3H3ZA 4XUOA 1S0EA 4IESA 2VNGA 2GAUA 4YM3A 3NNGA 3IIIA 3MPBA 1KDMA 4BIOA 2HWF1 2ETEA 3PU3A 1D4M2 2OZJA 5EJZB 4E4ZA 4NN0A 3LZZA 2ATFA 4EWAA 4AVSA 4XOGA 3A4UA 5JR7B 3DYPA 1YFWA 1M06G 2VCMA 4Q4V1 4XFHA 4QGNA 4Q4V3 4RGAA 3B3QE 3LPGA 2G9ZA 2RM22 1H0BA 1WGPA 3BYWA 1PIV2 3FUOA 3GBGA 1JYVA 5A3MA 3VHNA 2JDZA 3ZX7A 5K7PA 2WUHA 4Y33A 2VMFA 5D8AB 1YQ2A 1L7LA 4X8NA 4E8DA 4PDWA 1HQWA 3EJKA 1K5MB 1Q8QA 5C8CB 3ETPA 4MX3A 4GA9A 2EIDA 3NNFA 1OFNA 1QKQA 3HJRA 4KWLA 2VZSA 4QXBA 4KGGA 3O0VA 2ZHKA 5FZFA 4K9SA 4TLGA 2FHRA 1DYOA 2YC0A 4DXRA 3DV8A 1W3VA 4QKFA 4AQ6A 5BNPC 3CNAA 4BQ2A 5LBCA 2CU5A 2GMPA 4Z07A 1FNZA 2PQQA 1JYNA 1O3QA 5K0UC 2FZ2A 2ZGLA 4HBNA 4FPFA 4QGMA 2DBIA 3JBG2 5HXMA 1EUTA 3ZYJB 3OD4A 5DUXA 2ARXA 1JBCA 3OD0A 4XDOA 3WNXA 3ZPOA 2EXHA 2JKXA 4XF0A 1XE8A 1TME3 2PFWA 3B93A 4PI2A 2YBPA 4YVSB 3I3EA 3MO4A 3FFQA 3T1MA 1D4M1 1NA1B 3ZYHA 4MXWB 1D4M3 1CX4A 3V0BB 1JU3A 3V0AB 2D3PA 3D0SA 4YLZA 2ZAHA 1SACA 3KF5A 4B4RA 1K42A 3Q9OA 1JZ6A 1FPN3 2VOKA 3HNBM 3JXSA 4PJYA 3O1VA 3FWEA 2OVUA 3BB6A 2KXLA 4LO4B 4EN8B 3Q8BA 4L92A 3ST7A 1EAH2 1HKDA 4WVVA 4A3XA 5HCFA 1RUH3 1PIV1 1N3PA 4XABA 3O1PA 5D8AA 2YGMA 3HN1A 3M3OA 1O3SA 5I0RA 2DF7A 4XTPA 3MW4A 3WUCA 4CVUA 1K5MA 3VN4A 1XYNA 1W8OA 4BQ4A 1LEMA 3KT1A 5C8CA 1PGL2 3L2YA 2EAKA 4M0NA 4NHLA 5JIUA 4QX3A 2I07B 4ATFA 3TEXA 3UT0A 5LA1A 4FI9A 4NRMA 2OS2A 1LOAA 5GZDA 1TMF1 1WMEA 5A1AA 5FJHA 1UY3A 4WV8A 5FOBB 1TMF3 3MGUA 4LE3A 2D43A 3PNAA 4RR3B 1NE4A 3TOJA 2DUOA 1D0HA 2VZ3A 3ZYIB 1ND2B 1NYWA 1EPWA 1QJEA 3ROUA 3UJQA 4DY5A 4IE5A 2SLIA 5GKAC 3KV9A 2J1UA 2RV9A 2W1UA 2W92A 2VOXA 1PZ9A 2ZABA 3AMPA 4L99A 4B1LA 2Y8KA 2JE9A 2ET7A 3JBG1 4XEZA 4LBQD 4XXPA 1ODMA 1Q8OA 2EALA 4YVSA 3W58A 4XURA 1Y43B 1IG3A 4QM9A 4YG3A 4MXVA 1COV2 1GQGA 1NA1A 4AQTA 3PL0A 4UW6A 2W1WA 3J7LA 4MXWA 5DAQA 5FZOB 3V0AA 4HMZA 4Y20B 3I7DA 4Q27A 4AI8A 1IKQA 5FYIA 2Y34A 1QU0A 4P5YA 1AL0G 2VC9A 2Y0IA 1VE0A 2RDRA 3U14A 4MYEA 4DINB 5CFDC 5A1LA 1UAIA 3IN9A 2ZOEB 4AI3A 3U4SA 3H3UA 5FYUA 1EAH1 4E2GA 4ZZ5A 3RNSA 4NJ4A 1EAH3 2OUHA 2J1AA 1J3QA 2BRTA 2UYBA 1K3IA 3TN91 4LORA 4A7KA 1R1A2 3LD8A 4LHKA 3TN93 4QX1A 2VR4A 5FZ9A 5FZMA 1WCDJ 1DQ6A 5IJRA 1OH3A 1W8TA 3LOBA 1XNBA 5FZEA 5C3PA 5CG9A 3OG2A 2YUEA 1H8VA 1O5LA 1OLME 3LGRA 2XLFA 4RL7A 1UPSA 4KWKA 4OQ9A 2HEWF 2VVDA 1TNRA 4WVMB 1FV3A 4A7YA 3OBAA 3RZLA 2XJUA 3M8LA 3ZXKA 1S55A 2BUKA 4RR3A 3RMYA 4B8EA 4CDUC 1H4GA 3VBRA 5FWEA
chains in the Genus database with same CATH topology
2BNMA 1LKNA 2GC1A 5CBLA 1MQTC 2DU0A 4JRLA 1ZZ7A 4BLJA 4LBJA 4RGGA 4JAAA 2ZMNA 3A0KA 3M3QA 1AL23 2PLV3 3RG0A 1COV1 1ZZ6A 2Q30A 1COV3 1W0OA 2HWC3 4Y20A 1SLBA 4QPYA 5E1RA 3I8TA 2PAMA 3E6DA 4IEUA 4YM1A 3ZN6B 1PZ7A 1ONAA 3WHTA 1NCRA 4XF1A 1OA3A 4RS5C 2RS12 5I0SA 4EN6B 2BTVC 3SH5A 4LR4A 4C0BA 4YZ3A 2D6LX 4HPKB 3SNMA 3WCSA 4F7ZA 4E27A 1LHVA 2NMNA 1UD1A 1R1A1 1VR3A 1S2KA 3J8F1 5L19A 1R1A3 4S2DA 3J8F3 2Q0AA 2HWB2 1C8M1 1RTVA 4GMP0 1C8M3 1F5JA 1AYM2 1WW6A 3HD8B 4N53B 3D4KA 2WSUA 1LB2A 4WVMA 5FPXA 2IFWA 3LCPA 4IETA 3CL1A 4BHPA 1POV1 5CFCB 5C6CA 2PN5A 1Z78A 3BCWA 2XB6C 1V6NA 2UWAA 5FRAA 5AC93 5ACA3 4DOUA 1DZQA 3JZVA 5KXEA 1MR5A 4D3WA 2R043 1ENQA 1CESA 4WZFA 2LM3A 3ZFGC 2IXLA 2HJIA 3WDXA 5GZGA 1CIWA 1H9WA 2P3IA 5EFUA 1H2KA 1AYN2 4OULA 3ZN6A 3E5XA 1GANA 3IWZA 3NO8A 4SLIA 2LUWA 3LA2A 3VBSC 4Q4W2 1Y3TA 5FFOC 2RS11 4X6QB 4HPKA 1X36A 3NV3A 4N7UA 5JPMB 5JOZA 4AEDB 5CADA 2GU9A 5I0TA 2MNGA 2WLQA 4NOTA 4Q0PA 2VGDA 4R9CA 1AZDA 4L8QA 4YVWB 2HWB1 3H7YA 4LUMA 1AX2A 4N53A 4E4SA 4QQLA 4Q1PA 2JENA 1NLRA 1H1MA 4HZFA 4YW3A 2PYTA 3ZYGA 3FC0A 4W6XA 1ZYBA 4LHNA 2VVEA 3JQXA 4JGZC 2XLAA 3VBFB 1OLRA 4XJ9A 4N7IA 1ZBA3 4YZ5A 5ABJA 1DQ5A 1VRH2 1XQNA 3OPZA 1H8TB 5EYYA 5FO9B 1RUD2 4MGKE 2AREA 4XTMA 1MS3A 1RUC2 1BBT3 2B8MA 2GSYA 2WS91 1O4ZA 2GH8A 3LB9A 2WS93 3RQ0A 1AYN1 2A3XA 3V64A 4UW5A 1AYN3 1BJQA 4H14A 3IM0A 4PBPA 4XF4A 2D97A 4Q4W1 4I3GA 1R092 2GMEA 4Q4W3 4GALA 1YHFA 4MGIE 4M3CA 4Y26A 4AEDA 1YYNA 3SCGA 2A3WA 1Q56A 4HFSA 1REEA 5T5LA 4YVWA 1BCXA 3VBUC 1HW5A 2NPIA 1QJY3 2RR13 3SMHA 2CYFA 4D7TA 4HK8A 3VL8A 1YNAA 1GV9A 4N43B 3KZ4C 4R9BA 3MF9A 1AX0A 2BVVA 5IT6A 1ZREA 3QH7A 4YW5A 5DDJ3 5KC6A 1WBLA 3ZVXA 4AK3A 4IXLA 4DRVA 1PHMA 3VBFA 1HRV2 2DYCA 1AR81 3ZSMA 4CDWC 1IS3A 2UWBA 1AR83 1VB4A 1H8TA 1VRH1 3CO2A 1A6CA 1RUD1 2AUYA 3PVEA 3OF1A 1RUD3 4XF3A 1CJDA 1RUC1 1QGLA 4M01A 1LODA 3SISA 1QHDA 4CEYC 4DXZA 2B39A 4Y1ZA 1B35B 4M0HA 3VBOC 3ZXGA 4JRAA 2D44A 2LALA 2W39A 1R091 3AJZA 4Q4X2 4RQPB 3GALA 1YUDA 4U36A 1UU6A 5GZCA 2ZGRA 5F6LB 3E6BA 2R071 1GSLA 1OFSA 4AVVA 5BNQA 2R073 1TQ5A 4XQ4A 1OOPB 4ZKTB 4CYDA 5J7MA 5JSPA 1C1FA 1ZA4A 1A3KA 2XHKA 4N43A 4X6RB 1SLLA 2C5DA 1FATA 4DQAA 1RUOA 5FLJA 2ZHNA 3FBYA 4OI1A 4WM7C 2ZACA 2HWE2 4FPCA 1GZ9A 4JQRA 4NHMA 4AEKA 2IWGB 1W0PA 5A33B 1HRI1 3M2MA 1HRI3 1HRV1 4KWJA 2BW8A 5K9YA 3PLQA 4Z1VA 3FBMA 5T3NA 2DUPA 1QQP2 1G9AA 2ZTNA 1ENRA 4OVEA 4P9LA 3WW2A 1MS8A 4FPEA 1MS1A 3M1HA 4EJRA 5I8YA 1KJLA 1MZ6A 4RQPA 2MHFA 2QVSB 4FBFA 1B35C 4Q4X1 3PJYA 2Q8OA 2YYOA 2ZGNA 1ENXA 4FOYA 1PO12 3WW4A 1QMJA 5EJ3A 1OOPC 3AYCA 1V6LA 2HWD2 2ZAAA 4GQ7A 4COVA 5T54A 4ZXKA 2DWRA 1MVQA 2GDFA 2XJVA 4META 3SH3A 5BNOB 3QBQA 2YGLA 4LNVA 1LOGA 3EQEA 4NWWA 3ZO0B 3UV9A 4JGYB 2BPA2 1HDKA 2HWE1 1TEIA 3AZYA 5A33A 4JCKA 2HWE3 3NAPB 4Z8BA 4YFZA 1BMV2 4YSFA 2WZR2 1F2NA 3QD6A 4IEVA 5FREA 4GH4B 1ZRCA 2AZ5A 3D8CA 1KQRA 2XG3A 1C57A 1MEC2 1AUYA 2ILMA 3SHRA 1R082 2YMZA 2NMOA 2KA3A 3CEWA 5H9SA 2PAKA 3GHMA 4TYSA 5CG8A 5KHHA 3GZUC 3AZXA 4OI2A 2IXKA 3ZIWA 2V09A 1NLSA 4MGYE 4ASMB 1SLIA 4XMAA 4FPYA 3LSEA 4YM2A 4CDXC 2R1DA 1AXKA 2DV9A 1S0BA 4ZU5A 3WP6A 3U0ZA 3JB4C 5T50A 4W6YA 5FMOL 1KS4A 3PMEA 4IEXA 1YFYA 2QCSB 2CWMA 1H9PA 3JUUA 2VW0A 5BNOA 1ZRFA 2HWD1 1NQDA 3EBRA 4I0WB 4XFIA 4OLLA 2HWD3 1YFUA 3VKLA 4JGYA 2JKBA 1ND3C 5JVVA 4HN1A 1AR72 2DTWA 1QOTA 3O0XA 1QNWA 3OGGA 4NHKA 1GNZA 3NAPA 4YG6A 1BXHA 1RUF1 2ZZJA 1CGPA 1V9U2 1O4YA 1RUF3 1BMV1 3AMMA 2O1QA 4MLOA 3UJOA 3ZPYA 4AEMA 4GH4A 4CP1A 4DMIA 2WZR1 4LULA 5CU1A 1RL3A 1X50A 4Y5Z0 3VGIA 2WZR3 4INDA 3AX4A 5GZFA 5CB7A 2BWCA 1EP0A 3WT3A 2D5FA 1MEC1 4Y1XA 1MEC3 4YM0A 3TAYA 2XLGA 4L9BA 1RUG2 4PLNA 1UU5A 2P37A 1SMVA 4U2AA 2ZJCA 1S0GA 4WVZA 2WNVC 3NV1A 1LCLA 4WVWA 4B3NA 4Y4YA 4QMAA 3WZ1A 1XE7A 3S6PA 2D6NA 1KDKA 2WNUA 2CGPA 2IXCA 1PK6B 2PHTA 1CQ9A 4H7MA 1Q43A 3N7LA 4HSLA 3ZFEB 2QDNA 1V6MA 1QY4A 1ULDA 3WP3A 3PVBB 1YRZA 5GLUA 3THPA 4AGVA 2WA4A 2X5IC 4XJUA 4HETA 3WP5A 4G3YC 1ENSA 4PIZA 4F8AA 2NZ9A 1AR71 4K21A 2P3JA 2BNNA 5JDBA 4Q29A 1I9RA 3ZFFB 3CJIB 2ZX0A 2UYAA 1VBB3 3RI8A 1VBA2 1V9U1 4AYUA 3ETQA 4XFGA 3FZ3A 4Q26A 1AR91 2Y26A 1AR93 2DURA 3AP4A 4XBLA 4ZU7A 4NR1A 5KHIA 2N7GA 1NCQC 2DFBA 3U10A 1VBC3 1REDA 4GB32 4K1ZA 4QM8A 2R063 2ZGQA 3LWCA 2P17A 3JCIA 1MS4A 2JJ6A 2PHXA 4NVPA 4COYA 4F83A 1JUHA 4P9GA 5AFBA 1QJX2 2SBAA 1LOBA 1PK6A 1V6KA 2HWF3 5JZGC 3ZFEA 1CR7A 5IK4A 4UXAA 1YWKA 3ZN5A 1A8MA 2A75A 2C1FA 4ATEA 3MYXA 4COUA 1CAUA 4AGRA 2HEVF 5BV6A 1J1TA 1HQNA 4NPRA 1KFXL 1REFA 4XBNA 4FAGA 2ENRA 2WSVA 3ZXFA 1IOAA 3ZFFA 2GC3A 1W6OA 3CJIA 4K3UA 3H1WA 1N3QA 3BPZA 4XIKA 1VBA1 3V56A 3NKTA 5AFEA 3IDCB 2IFRA 2PELA 3QH6A 3AJYA 2WT1A 4PDWC 4OI4A 5C33A 1Q3EA 1W6MB 2VNOA 5I93A 1X33A 4YZ4A 2QZ2A 4QX5A 1JHNA 3A0NA 3TWIA 4BA6A 4BWOA 1PO22 2XJSA 5BYNA 4XJ8A 2VH9A 1DQ0A 2Q4SA 4HT1T 1XYOA 4GB31 1LHUA 4FAHA 4GB33 3U4XA 1PVC2 1QXJA 5HXVA 1O3RA 1F31A 4CDQC 3HMYA 2ZMKA 3I59A 3VZLA 1UZYA 1QJX1 1RGSA 2VXRA 4BCUA 5HI0A 5GLWA 4RHV2 2ET1A 4P9IA 3B02A 4FTSA 4NWVA 3RJ2X 4AI1A 1C4RA 1KJRA 2RS32 2V73A 2Z42A 5IK7A 5BUVA 2RM21 2RM23 1CONA 2CY6A 1PIV3 3J26N 4PIXA 1SFYA 3M3IA 1UL9A 3OBRA 3USSA 1UPIA 2ZGOA 3SCFA 3WQ7A 5JLVA 1UZZA 1IPJA 5GZEA 3KCXA 1S0JA 5D8AC 5GM0A 1O3TA 2PHDA 4CRQA 4B7EA 3M7AA 1SCSA 1K5MC 2G9FA 1W6MA 3B9IA 2R16A 1O7FA 5C8CC 3M3CA 1Q5OA 4XF9A 4GWMA 4GMP1 2JG8B 4FP3A 4GMP3 3BTAA 4FXKB 3WLUA 1PO21 1UKGA 2D6OX 1G9FA 1I6XA 3HR9A 1CAVB 4Y22B 3VBRB 3W59A 5H9PA 5HCAA 1I5ZA 5LRSA 4EWDA 3HWJA 2YY1A 4Q0VA 3FUQA 4FOQA 2WFF2 3JBG3 2IXIA 4BPZA 2CNAA 2VOWA 4IV1B 3KD4A 4R9AA 2VECA 2TNFA 4YVSC 3FLPA 1NA1C 2TBVA 2IXHA 4Q4Y2 4M3CF 5CNAA 1NCRB 4YW4A 4BOWA 2RS31 4DNYA 4TWTA 2RS33 5DUWA 1SEFA 3K48A 4Q0QA 3AZVA 2QFEA 5CFDA 1RMU2 4FOVA 1PGL1 2Q1MA 1W6QB 1WMFA 1AJOA 4HSJA 4DFSA 4ISQA 3HBZA 4AHXA 2EIGA 1HXS2 4L11A 4AHZA 1SLAA 1CVNA 2OUJA 4AW7A 2I74A 3L2HA 5T5OA 2GN7A 2JG8A 2CTVA 4GXLA 1FNYA 1UX6A 2RHPA 3S7IA 2NYYA 1OLQA 3D0JA 1CAVA 4Y22A 3VDDB 1YJLA 2GN3A 4RR3C 1WMDA 4WBBA 1GNHA 1AF9A 1ND2C 2A73B 3ES1A 3LKJA 1VAVA 5KHKA 1ULFA 1V6JA 3LSDA 4IV1A 4QQPA 2WFF1 1JYCA 2WFF3 4IEPA 4RD7A 3WW3A 1GZWB 4QQOA 1C5HA 4AHYA 4XILA 2VW1A 2W0XA 2GH2A 1QF3A 5F6KA 2HYKA 1DU3D 2UU8A 2XGXA 1N1TA 2VMGA 1ZBE2 4FPOB 4QGLA 3WY6A 4E4DX 3O0WA 4EN7B 1NCRC 3NV4A 1DLLA 4PLOA 3VZNA 5L7OA 2BVBA 1J1LA 1B09A 1JOJA 2B7YA 4FPJA 4KQ7A 3AMHA 1KFUL 4LO5B 1W6QA 4JC1A 2NN8A 2NM1A 1A8DA 3WDUA 5JI9A 4YW2A 2E63A 4FTBA 2HKXA 1HXS1 1J59A 4XJAA 2VOVA 1FV2A 3H9AA 1JW6A 1POV3 2A7AA 1EV12 1YIFA 1N1VA 3VDDA 2VUAA 3ZYPA 3WHUA 2DCKA 4R4XA 3S7EA 1RVF2 5EYXA 1DYKA 4IV3B 5ABJB 1BEV2 4P5HA 2BNOA 4FCAA 1GQHA 3H1MA 3ECQA 5FCCA 2EVXA 1GZWA 1NG0A 4YFWA 2ZGUA 3ZXAC 4AFDA 4DS0A 2VU9A 3ZFGA 4Z2WA 3RYKA 1I1EA 2B45X 4BZ4A 2RS13 2QKDA 2A6WA 3FLRA 4M3CB 1DF0A 4F3JA 4N9IA 3VBHB 4UBGA 3NV2A 1PGSA 3HQXA 4ITCA 1JXNA 2ZKNA 2AH2A 4W6WA 2FQPA 2PAEA 3NWKA 4J1XA 3MFAA 1XYPA 1RUE2 2HWB3 4B4QA 3AKQA 3B7MA 3DN7A 2BFUS 1AYM1 1AYM3 2I45A 3TYJA 4N53C 1S0IA 1G8WA 5GALA 2ZZQA 1JH5A 4GKYA 1X82A 4FPKA 4XW3A 1BQPA 5CFCC 4IV3A 1RUNA 2WJSA 4EN9B 1RVF1 1DYPA 3OCPA 3TBDA 1RVF3 1C3HA 1QJZA 5BPXA 4CZSA 1J3PA 5ABJC 2WT2A 4P9WA 1DQ1A 4I0AA 4B4PA 1OQ1A 2GNDA 4O9EA 4FP2A 2Y0OA 1QDCA 5KC5A 3DGTA 3ZSJA 2P3KA 4HANA 2IXJA 3WQ0A 1S0DA 3J9SA 3RJRA 3SLIA 4OUSA 3OY8A 1AVBA 5C4WB 2XJTA 5K8SA 1EY2A 3ENRA 4XBQA 2DCJA 3VBHA 1WW7A 3KB5A 1R1ZA 4AHWA 3ILRA 5FO7B 5DUVA 5F5QA 2XL7A 2E9QA 4AEDC 4FO9A 3IT8A 3R6SA 1GBGA 1RUE1 1W2UA 1VAKA 2BFUL 3RS6A 2TUNA 1ZZCA 1W6PA 2ZHLA 4YVWC 1QDOA 4R8HA 2D5HA 3BALA 5IUQA 4QPGB 1WLDA 1Q8VA 3KT7A 1U5XA 2YZ4A 2WT0A 3N35A 2P34A 3RZZA 5FPZA 1IQAA 1MZ5A 4QD2A 5J48A 1VRH3 4GIQA 3VBFC 1JYIA 2XBO2 4XPVA 3L9JT 1H8TC 1RUC3 1F8VA 1YCIA 2GC2A 2E7AA 2JXAA 2XKPA 2W68A 1O5UA 4HKLA 4XDQA 4BMBA 1OQDA 3WP4A 3R4UA 5C4WA 3D6EA 3P3NA 1HX6A 2XVGA 1R093 4LLOA 3IKWA 5AVAA 2B46X 2JG9B 4FQ4A 2QDRA 4KU7A 4P9JA 1RUI2 1ZM1A 4AFAA 1H1AA 4R4ZA 1V70A 4LBLA 1APNA 3ELNA 5DXDA 1NE6A 3ILFA 1RUJ2 2ERFA 2Z69A 3I54A 4M00A 5GLTA 2C9AA 2QUOA 4V1PA 3VZJA 2WL1A 4N90A 3URFA 4QPGA 4XHBA 5LK5A 1BK1A 2YPJA 3B5LB 3DPRB 1SLCA 1WD3A 1WLWA 4LA3A 4LUKA 4HKWA 5B2GB 5DG1A 4N43C 5FLIA 1F9KA 2F6BA 1VALA 2PA7A 2G4IA 1BZWA 4S2GA 3WDVA 5JIAA 3PJQA 1Q8PA 4OHXA 1HRV3 5JAXA 4WM8B 1YLLA 1YFXA 3UKVA 1LRHA 2H6CA 3VLBB 3R4SA 3QACA 2XBO1 5CAZA 2XBO3 4DB5A 3AKRA 2WWSA 4KL1A 3WD5A 2H0BA 4OFGA 3ACLA 1OQEA 4QPIB 1S2BA 2RMU2 4Q4X3 1OKQA 3MI8A 1LTEA 2JG9A 2VMHA 3KGLA 4RQPC 1RUI1 1MZEA 4AE2A 3MIEA 4CTEA 1RUI3 3WR0A 2JEMA 3NJZA 1YO8A 1WD4A 5KXCA 1VP6A 1OA4A 4GKXA 1KXGA 3IIAA 3NW4A 5FBZA 3B69A 3DPRA 3K51A 3ZSLA 3FMGA 3KGZA 2V5YA 3MLJA 3O5SA 1QXPA 4Y24A 5CVRA 4YARA 2Q5TA 1MACA 3ILNA 3VHOA 4I09A 4MZUA 4IERA 2RS52 3T2TA 4WM8A 5GJ6A 3MIHA 4ES9A 5FLHA 2VY0A 2Z5WA 4COWA 1QQP1 1FYUA 3AP6A 2ZPXA 1QQP3 1ZVFA 4I02A 3E6CC 1A78A 3JD72 2YROA 1WCKA 4K8FA 3UKTA 4C1XA 1CAXB 1BVP1 1NQJA 5HCBA 1RHI2 4AXOA 2OIIA 1LOFA 1NOVA 1QXRA 3WDWA 4DRRA 2CGNA 3V65A 1C28A 4QPIA 5EXOA 3ZDSA 4C0HA 1LECA 4K40A 2RE9A 2CV6A 4IEYA 4CEWB 2RMU1 2QE3A 4XFAA 2CGOA 3GHNA 5D1IA 2EXJA 2WQ4A 4TLFA 5HBAA 2GNMA 3RRDA 1SFNA 2JE7A 5LRRA 1QJU2 2WNUB 2ARBA 1PO11 1EPZA 4R52A 4E9KA 1PO13 2DU1A 2VQAA 1LESA 4Q8LA 1MZFA 2OYZA 2DVBA 3AP5A 1Y7BA 1UMZA 2EA7A 4BM8A 1FX5A 3ASIA 1MVEA 1D2QA 1PVXA 4Y1VA 4B29A 2WA3A 4OHYA 2KM2A 5JMCA 4Q0SA 4JDOA 3WX5A 2RJKA 3N36A 3PVNA 5BNOC 2PHRA 2DCZA 3T1LA 5BY5A 4XXAA 4LBQB 2H6BA 4JGYC 2RS51 1SBEA 1GICA 4W65A 5KXBA 4L97A 2MEV2 4AF9A 1N47A 3NAPC 5JSOA 3P3PA 1DGLA 4XE9A 1GFF2 1AHSA 1CAXA 4HL0A 3JD71 5BNNB 2AENA 4JDMA 2ZGTA 2CWSA 1LGNA 3JD73 3RI9A 1RHI1 4GH4C 3RYRA 5FOJB 1R081 1RHI3 1PNFA 1XNCA 1R083 4CEWA 4K1YA 2QZ3A 5CIRA 2DCTA 4RFT0 4D7SA 1AR62 3MPPG 4AVTA 3OTFA 4FSJA 2XJRA 3H1YA 2A3YA 5J96B 3X29B 2A6VA 1QJU1 1Z0HA 2JECA 1F5FA 1URXA 1OD5A 1FXZA 1LEDA 1NXD1 2ZMLA 5AVPA 1WW5A 2B9UA 1UCXA 3H0OA 2K9ZA 4S2FA 2D40A 3AFKA 2DVFA 1CAUB 1JN2P 1YI7A 4AFCA 1ZZ8A 3POSA 4AFMA 4LBQA 3PTYA 4QXKA 1AR73 3VHPA 1W6OB 3H50A 5EV7A 3G7DA 2EF6A 5TSWA 1V9U3 1U5YA 3BOWA 1BKZA 3NKGA 5BNNA 4XETA 4OZXA 3HT2A 3WQ1A 4LHLA 1UF2C 3GBWA 1Z7S2 3O7OA 1ZRRA 1YXWA 3WG2A 3FHIB 4ES8A 3WUDA 1XNKA 1LR5A 2O8QA 4AVAA 3D5OA 1RUG1 1AR61 4QHBA 1RUG3 4H55A 4IEZA 2YDEA 2R0HA 5C9AA 1AR63 1Y9QA 3VKNA 3ME2A 4PBOA 4XYXA 4KH9A 1PZ8A 3R4DB 5T5JA 4XMIA 1KRIA 2ZGPA 3I59B 5BNPB 4LO7A 1N3OA 2VPVA 2AGSA 3MIBA 2ZX2A 2FZ1A 1LENA 5K0UB 1V6OA 1PK6C 1OI6A 1E57A 3ZFEC 3B9CA 2ZBJA 2WNEA 2CAUA 1CN1A 3VZMA 1J58A 3RMXA 5JWPA 1DGWA 1TME2 2IC1A 3B00A 3KSCA 3KS7A 2P2KA 2R32A 4S2HA 2CL2A 1XU1A 3N4MA 3MF6A 1UU4A 1M4WA