1AYN1

Human rhinovirus 16 coat protein
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
285
structure length
285
Chain Sequence
NPVERYVDEVLNEVLVVPNINQSHPTTSNAAPVLDAAETGHTNKIQPEDTIETRYVQSSQTLDEMSVESFLGRSGCIHESVLDIVDNYNDQSFTKWNINLQEMAQIRRKFEMFTYARFDSEITMVPSVAAKDGHIGHIVMQYMYVPPGAPIPTTRDDYAWQSGTNASVFWQHGQPFPRFSLPFLSIASAYYMFYDGYDGDTYKSRYGTVVTNDMGTLCSRIVTSEQLHKVKVVTRIYHKAKHTKAWCPRPPRAVQYSHTHTTNYKLSSEVHNDVAIRPRTNLTTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 16 COAT PROTEIN
publication title The structure of human rhinovirus 16.
pubmed doi rcsb
source organism Human rhinovirus sp.
molecule tags Virus
total genus 58
structure length 285
sequence length 285
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1997-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1ayn100
1PGL1 1HXS2 1H8TA 1RUI1 1V9U2 1RUJ2 1CJDA 3J8F2 1RMU3 1HRI1 1ZBA1 1RUF2 1SMVA 4YVSA 1NOVA 1ND2A 4RQPB 4WM8C 4FTEA 5BNPB 2R042 5GKAC 4Q4V1 3JBG2 2WS92 2RS33 5C4WB 4RHV3 1AL21 5ACA2 4N53A 1AR81 2MEV2 5C8CB 1WCDJ 1NCRB 2R073 1QQP3 1AR61 2HWB2 3HAGA 4Q4X3 1RUD3 5L7OB 2WLPA 2PLV3 1AR72 1VBD1 1FPN1 2FZ2A 1EV13 2FZ1A 1HRV3 1D4M2 1R1A1 1VBA3 4RR3C 4RS5B 2R061 4PDWB 1BEV2 1VB2A 4AEDB 4Q4W2 2RMU3 2HWD3 5C4WC 4CEWA 4CEYB 3VDDC 1PO22 1PGW1 1NCRC 1E57A 1AYM2 3CJIB 1AR92 1Z7S1 1PO12 1VBC3 1TME2 1RUE2 5AC93 4Q4Y2 1AYN2 4GB32 1HXS3 2ZAHA 4NWWA 1NCQB 1V9U3 1RUJ3 4AEDC 4RR3A 1VBE2 3VBHB 5ABJA 1RUH2 3J8F3 4N43B 4BCUA 1RUF3 3VBFB 1NA1C 1R091 1BMV2 1BBT2 4JGYA 1F8VA 3CJIC 2WZR1 1MQTA 2BFUL 1HX6A 1RUG1 2R043 1VBB1 3JBG3 2WS93 2RM21 2RS52 1QJU2 3DPRA 4CDWA 4CDQA 4CDXC 2RS12 1FOD1 5DDJ2 2ZZQA 5ACA3 1NCQC 1RHI2 1GFF2 1R082 2MEV3 5A32A 2HWB3 1QJX2 4N43C 1AR73 3VBOB 3VBFC 1D4M3 2HWF2 1DDLA 1QJY2 1ZBE3 2RR12 1BEV3 3TN92 1NA1A 5A33A 2BPA2 4WM7B 4Y4YA 3VBUC 2VQ0A 1PO23 1ND3B 1HRI2 5J98B 4GMP3 1AYM3 4N53B 1PIV2 1AR93 4CDUA 1PO13 2RS31 4JGZB 4GH4A 1F2NA 1TME3 4RHV1 1RUE3 5C9AB 4Q4Y3 1AYN3 1K5MC 4GB33 4Q4V2 1W39A 3JB4C 3VBRA 4QPIB 2R071 5CFCC 5CFDC 1AL22 1OOPC 1VBE3 1RUD1 2PLV1 1RUH3 2HWE1 1HRV1 3ZFGB 1ND3C 1RB8G 2WWSA 4IV1B 4CEWB 1BBT3 1VRH1 1FPN2 4QPGC 5BNOB 1COV2 1TMF2 1M06G 1R1A2 3JB8A 4JGZC 2QQPA 4YVWA 5FMOL 2R062 3ZFEB 5K0UA 2RS53 1QJU3 1FMD2 2RS13 5DDJ3 5JZGB 2BBVA 1RHI3 1R083 1RUC1 1QJX3 1PGW2 1VBC1 5ABJB 1X33A 3ZFGC 5AC91 1HQNA 1Z7S2 4RQPC 1HXS1 2HWF3 5BNOC 1QJY3 5BNPC 1V9U1 4JGYB 2RR13 3NAPB 3TN93 3J8F1 4WM8A 3VBSB 5JZGC 3DPRB 1HRI3 5C8CC 4RFT0 1OPOA 4NWVA 5L7OC 1PIV3 2IZWA 1B35B 3JBG1 1IHMA 5A32B 3JD72 5BNNB 4RS5C 5ACA1 2XBO2 1RUG2 4PDWC 1VBB2 1VAKA 1ASJ1 1C8M2 3ZFFB 1PVC1 1FOD2 1AL23 3VBSC 1OHFA 4CEYC 1AR71 5BNPA 2BFUS 1MEC2 2X5IB 1D4M1 4EJRA 5D8AB 5C4WA 1FPN3 1ZBE1 4IV3B 3VDDA 1BEV1 1COV3 1TMF3 1R1A3 2HWC2 1NCRA 2GH8A 2R063 1NY72 1PO21 1FMD3 3VBHC 1H8TB 1AR91 4SBVA 4RS5A 3LOBA 1RVF2 1EAH2 3VBRB 1PO11 1TME1 4AEDA 2X5IC 1RUE1 1C8NA 4Q4Y1 1AYN1 5D8AC 1Z7S3 4GB31 5LK7B 4CEYA 4YVSB 1ND2B 1POV3 2WFF2 1PGL2 1VBE1 1RMU1 4Q4W3 3CJIA 1RUI2 2TBVA 1AL0G 4LLFA 5K0UB 1BBT1 1ZBA2 1H8TC 2HWE2 4CDXA 1NCQA 3VBOC 1VRH2 5J96B 2RS51 3JD73 3FBMA 1A6CA 2RS11 1QJZA 4N43A 4YVSC 2XBO3 1RHI1 1R081 1VBB3 3VBFA 1C8M3 1QQP1 4Q4X1 4WM7C 1FOD3 1QJX1 1VB4A 1EV11 1AR82 4WM8B 1MEC3 1RUC2 1VBA1 5FMOS 1AR62 2DF7A 2HWF1 1QJY1 1VBD2 3VBUA 4N53C 2RR11 2Y26A 3TN91 5FOJB 2RMU1 2HWD1 2HWC3 5C9AC 3VBOA 4QPIC 1K5MA 1PIV1 1RVF3 1EAH3 4RR3B 5CFCA 5CFDA 1OOPA 4IV1C 4CEWC 4WM7A 1RUJ1 1ND3A 1X36A 2WFF3 4QPGA 3VDDB 3ZFEC 1MQTB 1RUI3 1ASJ2 4Y5Z0 2XPJA 1RUF1 4JGZA 1PVC2 4CDWB 4CDQB 1ZBA3 5C9AA 2HWE3 1COV1 1TMF1 1R092 2R041 2WS91 5ABJC 1NG0A 1CD3G 4QPIA 1VRH3 1ZBE2 2WZR2 1FMD1 4Q4V3 2RM22 4JGYC 3ZFGA 3NAPC 2MEV1 4IV1A 4RQPA 2HWB1 5BNOA 1MQTC 1NA1B 5A33B 1AR83 3ZXAC 1RUC3 3DPRC 4CDQC 1AR63 4CDWC 3ZFEA 1VBD3 5JZGA 1POV1 1B35C 4Q4W1 4CDXB 5C8CA 5BNNC 4CDUB 5L7OA 4GH4B 1RMU2 4GMP1 3ZFFC 1AYM1 4PDWA 3NAPA 3JD71 3VBSA 2RS32 2XBO1 4IV3C 4FTSA 1C8M1 3IDEA 3M8LA 4RHV2 3VBUB 1RUH1 1POV0 4CDUC 4FTBA 1ASJ3 4GH4C 4YVWB 2R072 1B35A 1MEC1 1QQP2 4Q4X2 1RUD2 1BMV1 1PVC3 2PLV2 2ZTNA 5BNNA 1EV12 1HRV2 3VBRC 1VBA2 1R093 4GMP0 3S6PA 1K5MB 2HWC1 3VBHA 3ZFFA 1QJU1 2GSYA 4FSJA 2WZR3 5DDJ1 4Z92B 1NY71 5CFCB 1RUG3 2RMU2 5CFDB 2HWD2 1OOPB 1ND2C 2X5IA 2RM23 5D8AA 2BUKA 1RVF1 1EAH1 4IV3A 4YVWC 4QPGB 5K0UC 1VBC2 5AC92 2WFF1 1AUYA
chains in the Genus database with same CATH superfamily
4ZU4A 3AJZA 1W28A 5LASA 1S1AA 2IXJA 5LZ6A 2JXAA 4BXSV 3U14A 2EA7A 1QKQA 4XAAA 5I0SA 3IN9A 1NX9A 1V6JA 3GBGA 1US2A 3KV6A 1YHFA 2JE8A 2VUCA 3UGHA 4OI1A 3TOJA 5FWJA 1UU5A 4YVSA 4AI2A 2VW1A 3IZOA 4ITCA 3HVDA 1ND2A 2XLGA 4JQRA 1QH7A 1WD4A 5F3IA 2W87A 3KT4A 4DMIA 3MICA 2A6XA 5GKAC 1LOAA 4R8HA 1YNAA 2WS92 2A7AA 3JBG2 2BRTA 4MSVA 4XUOA 2C1FA 4L0PA 3UKTA 3PVOA 1F31A 2DCKA 3HPNA 3GJAA 4O7XA 4XYXA 5A3TA 1JHJA 3V56A 5J09A 4Y1ZA 1JHNA 4HSJA 4N53A 3PU8A 1AR81 2VMIA 2MEV2 4BA6A 1PX3A 3VV1A 1LEDA 2DTWA 5C3QA 4CXYA 5E1RA 2C9KA 4Q4X3 5L7OB 2WLPA 4XUNA 1FPN1 3CU7A 2FZ2A 3AMPA 4EWEA 1OLME 3ZKUA 2A3XA 2A6ZA 4WZFA 3ZMOA 3MIGA 1FI2A 4UBGA 1SFYA 3N9NA 1HIXA 2R061 4PDWB 4ZU5A 5ANNA 2VNGA 4KWLA 2WNVC 3WNXA 2QCSB 1H30A 1CGPA 2R0FA 4OI4A 4LA3A 4TTGA 2ZEZA 1JBCA 4COZA 1PM4A 3I3EA 4P9GA 3THDA 3VDDC 3I2DA 4HKOA 3EB7A 5CNAA 5A3WA 1PGW1 2JDMA 3U78A 4Q0UA 2ZMNA 1GP4A 1SACA 3WDYA 3CJIB 5LW9A 4LA2A 1AR92 1Z7S1 2KM2A 1ZRIA 2XJSA 3AVSA 1VBC3 1TME2 2WLQA 3FLRA 2RHPA 1ZZ6A 4XBNA 3ILFA 5FJHA 4YZ5A 4LO5B 4Q4Y2 3HJRA 4F83A 4LORA 3CEWA 5JR7B 4Q8KA 1HXS3 2ZAHA 4MVTA 4XAEA 2ZEWA 4LO8A 4NHLA 5FPAA 3WV6A 4DIQA 2Y0IA 1RUJ3 1QIQA 4HN0A 4U2AA 4LBQD 1HB1A 3VBHB 1XJAA 2W92A 1U5YA 2PTMA 1UX7A 5LBBA 1MS1A 1AJKA 1NKGA 2WYFA 1CR7A 3IMNA 4N43B 5KBFA 3AJYA 1W8NA 3DXTA 1DGRA 1RUF3 1TNFA 3LOIA 3M3QA 3T2OA 1C57A 1R091 2BGPA 4MADA 4JGYA 3RSJA 3GZAA 2DWRA 3CJIC 2FDGA 5KC6A 1XNTA 2VY0A 2WZR1 5J7MA 1SFNA 5A3NA 5FZIA 5LA0A 1L7LA 1ZRFA 1CPNA 2BU9A 4DXZA 5DMYA 4XJWA 4CDQA 1MS0A 1J59A 2RS12 2VTXJ 3AZXA 4B4QA 1V00A 1O7FA 4V1PA 1RHI2 1GFF2 3POWA 2VBBA 4MV2A 1OUSA 3OBTA 1O4YA 4IEQA 5FZ6A 2VZTA 2HWB3 1QJX2 2Z4FA 1UAIA 4JZRA 1ZNPA 4N43C 4ONUA 4A6SA 3VBOB 3H8XA 1H6XA 4P9IA 3LIGA 4QWNA 1D4M3 2WYSA 3OPTA 5E8AA 2R1BA 2UYBA 1C28A 5GM0A 4DEVA 5LATA 2FCTA 1UF2C 3NJVA 2DVDA 1W06A 4OMDA 1OLQA 4DO0A 4WM7B 3AYEA 3ZLIA 2WINB 1SLBA 1UY4A 4HFSA 4Y4YA 4IGOA 1RITA 4OHVA 3RJ2X 4GWNA 4Q27A 4CYDA 4LMFA 3ZXJA 1VAVA 4GMP3 2IWGB 2E7TA 1AYM3 4IEXA 4LOTA 5FPZA 4IL7A 1W9YA 4JGZB 4TWTA 1NAEA 4GH4A 5F32A 4XZPA 5FZAA 2LROA 1DQ2A 5FCCA 4LBKA 4YM1A 1K5MC 2VO5A 1LOEA 4QPIB 2ZGLA 4QQHA 4UFJA 4XF0A 1JS9A 4LNVA 1W8UA 3PJQA 4Y22A 2ZGNA 1JZ2A 5I8TA 1ZA7A 5DAVA 1H9WA 2DFBA 4BMBA 3WP3A 5AFBA 1WA4A 2YBSA 4DUWA 4E2SA 4Y20B 1COV2 3TNQA 4JGZC 4D94A 3O5SA 4YVWA 3MDPA 5FMOL 3OEAA 1WWYA 1X9PA 5IYYA 1QDCA 3A4UA 5JZGB 2BBVA 3MW2A 1Q8VA 1R083 2B9UA 2R32A 4RGAA 4XJ9A 2V72A 2PAMA 3N3HA 4H7MA 3VKFC 4META 5ABJB 5IAXA 3RI8A 5C33A 3A0KA 4RQPC 3MW4A 3H9AA 1DFQA 1JOPA 4LR4A 5KXEA 4OFGA 1WLTA 5BNPC 1UY0A 1UY1A 1REDA 2WWUA 3K3NA 4ISRA 4HPKB 4IE4A 2VNVA 3POSA 2XL7A 2VUJA 4PIXA 3VBSB 5E16A 4MGSA 3AZZA 3LE0A 3NO8A 1JUIA 2EIEA 5JZGC 3MUY1 2CTVA 2QDNA 1XU2A 4CA9A 1IS4A 4P02B 1QH6A 3DPRB 2Y6HA 4Y5TA 3EQEA 4UWDA 3NVCA 4BISA 3PURA 3MHZA 3AP9A 3POJA 2C4XA 1FX5A 2CAUA 1X8MA 3DYOA 5FP3A 3UYJA 3H8RA 4DQAA 5IK4A 3T08A 1IHMA 1W6OA 2VOXA 3ZDSA 3JD72 3KM5A 5BY5A 5JIAA 2HBTA 3GALA 1XNBA 2V4AA 2YGLA 1IS5A 3MV01 4CU9A 2C5DA 4UW6A 5FFOC 1F4HA 4A7KA 1F5JA 2IXIA 5JUVA 1PVC1 1FOD2 4QDRA 4MHRA 3VBSC 4AGRA 4CEYC 1AR71 4XPVA 4G3YC 3I59B 1N3OA 3FFQA 2PHUA 2WNVA 1W3XA 1WMXA 4QU2A 2CV6A 2NQYA 3KS7A 5D8AB 5FDBA 5J37A 1FPN3 2CY6A 2WA3A 1ZBE1 1I6XA 5FRAA 3VDDA 1O3QA 3LWCA 3U37A 1TMF3 4W4ZA 1O59A 3CQOA 2HWC2 2JG9C 2RDSA 1YI9A 4MGYE 3VZMA 2R063 3LEKA 3J7LA 1NY72 1PO21 1FMD3 2OUJA 3THTA 1GZCA 2VOKA 4ASMB 3N9PA 1U5XA 2BQPA 1H8TB 1UMIA 5DG1A 3D82A 2EIGA 2JDYA 4RA0A 3I3MA 1RVF2 4IQPA 5DAQA 5FZEA 3W21A 2H0VA 1OD3A 2AACA 3ATGA 3AYAA 4BQ2A 2Q1MA 3ZKYA 1AYN1 5D8AC 1Z7S3 4AVTA 3O1PA 1XOYA 5CU1A 1QEXA 2F17A 2UWBA 4BQ5A 2D6OX 2XXZA 1HN1A 2RE9A 2BGOA 3DF0A 3V0BB 1POV3 1ENQA 1DZQA 1RMU1 3I4IA 3J26N 4J1XA 5FYVA 5IT6A 3CJIA 5IJRA 1JU4A 1RUI2 2QQJA 1AL0G 3VGIA 2WQ8A 5A3MA 5KHJA 2W91A 1D2QA 1BBT1 1HB4A 2Z79A 1ZBA2 3JXSA 2GP3A 4S2GA 1H8TC 1HLCA 1SDWA 3U11A 2HWE2 2K0GA 4TXWA 3OGJA 5F5IA 3HT2A 5C5UA 1VRH2 2YY1A 3G6JB 3KD4A 4GALA 4M01A 3WVJA 4CRQA 3ZM8A 4AVVA 1LKNA 5J96B 2RS51 2XJTA 3KF5A 3FBMA 2QFEA 4LIVA 4N43A 4XDOA 2XBO3 2XGXA 2QQNA 3WNLA 4AL9A 2ZHLA 2QQVA 1OKQA 4P5YA 2YBPA 2NYYA 1G86A 1C8M3 3B00A 3PUSA 4FFFA 4XF1A 5JSOA 1G9CA 3GDBA 5JSRA 3RRDA 3AMMA 1VB4A 3ZN5A 3JU9A 2CDPA 2VG9A 3LIHA 3NNJA 5FZ4A 1XYOA 3BVCA 1VBA1 1S0IA 3PTRB 3ZR6A 1X7NA 1X9TA 1L7QA 2DCTA 5H9QA 5JR2A 1AR62 1QJY1 3PUIA 4QXBA 4CXXA 3KMHA 4FPLA 2YC0A 2GU9A 2MHFA 1MZ5A 5FOJB 3S7IA 3SXWA 3LAGA 4W6YA 2ORXA 3ZDVA 2B9VA 3RFRA 5C9AC 2J1RA 3MLLA 4O9GA 3NKTA 1V70A 4QPWA 3K4AA 3ACLA 1QJFA 4RYDA 3VBOA 2WRAA 3WW2A 1J1LA 2ZAAA 4GULA 4JDOA 2YC4A 3A0NA 3HWJA 3SC7X 1K5MA 1OLMA 4ES9A 2N7GA 2Y64A 2YFUA 3AKPA 4MYEA 5CZKA 3B69A 4BIFA 4WM7A 3EBRA 3WP6A 1SPPB 1PMIA 3WSOA 2PMWB 3OJBA 3VZLA 2BW8A 1JTZX 3SLIA 2B39A 3B9IA 1UYXA 3DN7A 3M3OA 4IETA 2JIGA 4AHZA 2IFWA 4I0WB 4CPBD 4JKLA 3UKNA 4QM9A 3SQOA 4JGZA 4YZ2A 1KEXA 1WW4A 4A3XA 2SLIA 3ZXEA 4MGZE 3E1F1 1CPMA 4XQDA 5AVPA 3WUDA 3BN6A 4AQ6A 2R041 4FPCA 4AI8A 2XL9A 1V6IA 2BJSA 2ZX1A 4QPIA 3R05A 2D3SA 4QX5A 4BK4A 5JDBA 2JICA 3CO2A 4Q0VA 3W9AA 2YZ4A 1YQ8A 4AR2A 3WDWA 3C3VA 1O91A 1QOOA 2DFCA 2RM22 3T4VA 5DUVA 5J48A 3S30A 1CX4A 4RQPA 5FUNA 1TE1B 3I3DA 1QXPA 4O61A 2WZEA 3VB9A 1NA1B 2J1VA 2ZJCA 3KB5A 2ZGQA 2PHDA 3AM2A 5EYXA 3MYXA 3IWZA 2WBKA 4YGCA 3PUQA 2QJVA 1VBD3 4WVZA 2JDKA 4GWMA 2VQUA 4FBFA 5JZGA 3V65A 3EXUA 4KWJA 5IATA 2ET1A 2ZX4A 3O0WA 3IAPA 3ZN4A 1S0BA 2VCBA 1D7PM 2X8KA 2WSUA 3RYPA 3WEZA 5BNNC 2HEWF 2NMOA 2YMZA 4ORFA 4BZ4A 4CDUB 2W52A 4A3ZA 2YBKA 3F2ZA 4L92A 4NHYA 4OUSA 4QX8A 1ZX5A 1HKDA 3ILRA 1HN0A 5A3PA 1D4VB 3O14A 1W8OA 3SCFA 5IVEA 3ZFFC 2ENRA 3H42B 3NNMA 2Y6GA 4KG8A 1O6UA 1IG3A 2J1UA 4OYUA 5A3OA 4HPKA 3THPA 4B4RA 1YRZA 2E6VA 1G9AA 4UFKA 2EIBA 2WABA 3KQRA 2VMGA 4NIIA 3VBSA 1FAYA 3WY6A 4FTSA 1W3VA 2HJIA 2VMDA 5L9VA 1Q8PA 4WBBA 1C4RA 3IDEA 3M8LA 5D21A 2BNNA 2Y6JA 4UFLA 4Q0QA 3N9MA 2XVGA 5FPLA 4CDUC 1OA2A 4EROA 5CA6A 4C8DA 4Q4X2 1ODMA 2OYZA 3ZXKA 1PVC3 4I3GA 4FAHA 4URTA 2VU9A 3VBRC 2CGPA 2R1DA 4AQTA 1IQAA 1ZYBA 3M3IA 4GMP0 3PMSA 3LA2A 2AZ5A 3S0MA 5JVVA 1M4WA 2VMEA 1ZZBA 1IQDC 2GSYA 2P1BA 3H8OA 2X09A 4FQZA 5C5TA 1DYOA 5DDJ1 4TSVA 1PX4A 4Q1RA 1ND2C 1UOFA 3MIDA 3HOBA 1AX2A 1UIJA 2E33A 4BLIA 4EN7B 5D8AA 2DBNA 2VVFA 1QNYA 3OY8B 1EAH1 2BZDA 5A1LA 3T0AA 5A7NA 4LUMA 1G9BA 4CU8A 2I45A 5K0UC 4FPYA 1S0JA 3NWKA 4XFFA 4Y1XA 1GSLA 1BVVA 1VBC2 1OF3A 2WL1A 5FYCA 4LQRA 5LK5A 4D3WA 2FDIA 2P6CA 4F3JA 4E4ZA 2D6KA 1YLLA 2W3JA 2WFF1 3UGGA 3ZMNA 1HXS2 1GWMA 1H1IA 1HB3A 1VR3A 1KS5A 1PGL1 1H8TA 1UYPA 3RDIA 3E5QA 3MLKA 3P1IA 1OBNA 2BBAA 1RUJ2 3A22A 5CIRA 1PZ8A 1CJDA 3MEPA 1RMU3 1HRI1 4DS0A 5F6LB 1G8WA 2VOWA 2QQIA 4FXGB 3RZZA 3SEEA 1H2LA 5DXDA 1RUF2 1SMVA 4N7IA 4CCLA 2W1UA 2HKXA 4BXFA 2VOVA 1IPSA 5FZFA 3V0BA 3VZOA 4WM8C 5FZKA 1EYBA 3AL6A 1KD7A 1QY4A 2NP0A 1RUNA 1PNGA 3WP5A 3FFZA 5IWFA 2Y60A 2P4EA 4K21A 1JYXA 3OGSA 5K8SA 2Y34A 5DQ0A 1D0GA 2DVAA 4M4RA 1AL21 2Q8CA 4M00A 1A3KA 2YG0A 4H55A 5I0RA 3UJQA 4M0NA 1V6KA 5CKMA 1ZZ7A 2CSGA 4JCKA 1WCDJ 2R073 3BOPA 3HNYM 5GLUA 2HWB2 3N9OA 1GP6A 4QQOA 1AXKA 3RQ0A 1QOTA 1LHNA 3J4UH 4JDNA 1ULDA 2FZ1A 2Q0AA 1D4M2 3ELNA 3LPFA 1R1A1 2XDVA 1VBA3 4URAA 2Q1FA 1HB2A 1S0CA 2OT7A 2VGDA 1Y3TA 1HJFA 4RS5B 2RJ2A 1RTVA 1GQGA 1W03A 1YUDA 2OPKA 2Q4SA 4S2HA 3VD9A 1SLLA 1W90A 4AEDB 4XJ8A 2YC2A 4Q4W2 4KBBA 3BI3A 2JDUA 2VPVA 2JKXA 3G7DA 4ZHNA 1XE8A 5IVBA 2OZJA 1UU4A 1FV2A 1OD5A 4Z82A 3FLTA 1RYYA 2B8MA 3B93A 4OZOA 4JAAA 5FMBA 4KU8A 5FZOB 5A7WB 1RXGA 3R6SA 1E57A 1UPIA 1AYM2 3OD4A 3GHMA 3O12A 1YIPA 5JXGA 5IVCA 3PL0A 1DQ5A 2L9LA 2ZGSA 2F4LA 1OC1A 4M4PA 3GHNA 5AC93 2X29A 2AR6A 2YHJA 3P3NA 5IVFA 2VBPA 2Q8OA 3ACIA 4HLTA 1V9U3 4AEDC 2I74A 4MGQA 3H3ZA 3WD5A 3J8F3 5I8SA 1JZ5A 4BCUA 5KWRA 4M0HA 1UX6A 1SPPA 3LFIA 4JTOA 3AZYA 3H3LA 2XLFA 4UYBA 3VBFB 1BMV2 3PTYA 3C2UA 4NO4A 3I2GA 1CAVA 4PLMA 2ZBJA 1PHMA 2D3PA 5D1IA 5F39A 3ZN6B 4IDZA 2R043 1HX6A 1RUG1 4OVEA 4JRLA 4UF0B 1DZRA 2WAOA 5F2WA 5I8YA 3APBA 2CAVA 2ZS6B 1PM7A 4YNIA 1NXMA 4NRQA 3OYWB 3BYWA 5ACA3 2ZEYA 3URFA 1R082 4B29A 1FV3A 4AI1A 2VZ1A 1ZRRA 4PIZA 2D6MA 3IKWA 4XMAA 4ES8A 4XE9A 3MF9A 3VKNA 2IXKA 2GNMA 5A70A 3VBFC 2WNUC 1GNYA 2XOMA 1H0BA 3OUIA 2JDAA 3LA7A 1DF0A 3RVHA 1YJLA 2JB4A 4MXWA 3EJKA 1W2NA 2J7MA 1BEV3 2ZKLA 2OXBA 1NA1A 1N3PA 1AX1A 2VNRA 3GZTB 2BPA2 4ZZ8A 1Y4WA 3OSDA 1BJQA 2GP5A 1CAXB 4OLLA 1SBDA 3AXEA 5K4LA 1KS4A 1ND3B 4IEUA 4HMZA 4R9CA 1ULFA 1FXZA 1RJ8A 2BGCA 5CKQA 2D98A 5J98B 3VL9A 4CCMA 3AMQA 1SLTA 4FI9A 2FBEA 4CDUA 1PO13 1SBEA 2RS31 5HXVA 4RHV1 1PZ9A 1RUE3 4MZUA 3I54A 5H9PA 4NIHA 2OA2A 4GB33 4N7UA 3O1OA 4BH9A 1H1AA 1H2MA 1IZ3A 4FPGA 4DXSA 4QU1A 3VBRA 3K77A 5CFCC 1NE6A 5CFDC 1VBE3 1OOPC 1RUD1 4BE3A 2OPWA 2R16A 1SLAA 2PLV1 5FLJA 5BXXA 3T2PA 5A80A 4P9LA 3N7LA 1HRV1 3ZFGB 3T4HB 4FP3A 1ND3C 5A6XA 1AHSA 2ZCWA 4IV1B 1REFA 4NPLA 3GCWA 4XW3A 4CEWB 1FPN2 1S55A 2BERA 3NJXA 4XOGA 3I3BA 4YW3A 3O1TA 3QOPA 3ZYGA 3I49A 5JPNB 5E6HA 1TMF2 2QQPA 4JKMA 3I2IA 2B45X 5FXWA 2EAAA 2R062 5K0UA 3ZFEB 2B7YA 4Q1PA 4BYYA 5CKNA 3ACGA 1ENSA 1FMD2 5DDJ3 1FT9A 3TBDA 1CONA 1GZTA 5T5OA 5BUVA 1K3IA 5FPXA 4YARA 1SHWB 2RV9A 3WT3A 5K7PA 4RN5A 1H4GA 3ILNA 3FZ3A 1PGW2 1WUVA 3CMGA 4HETA 1GZWB 1YFUA 1X33A 4GKXA 3ZFGC 4XQ4A 4D6SA 1EPZA 5IFTA 1Z7S2 5HV4A 4YRDA 3HEIA 2HWF3 3CL1A 3MUZ1 1MVEA 1YC61 1W8FA 4QT6A 5AFEA 3DV8A 5JSPA 4EZ4A 4FCAA 1ACCA 3OY8A 3WF0A 3RZHA 2RR13 3TN93 1V6LA 5CG8A 2VMFA 2A3WA 4HZFA 2WZPP 5IK5A 2VM9A 3MPPG 4WM8A 4XURA 1NZCA 1SLCA 5FYUA 3AFKA 3AB0A 4JVAA 5IAVA 2EVXA 1MS4A 3B9CA 2UY9A 5FQ0B 5CISA 1HRI3 3KVBA 1HQLA 1W99A 3ON7A 4OZXA 1ULPA 1C1LA 3SCGA 2A75A 3PDQA 5L7OC 2E31A 3PNAA 4JDMA 1PIV3 1WW7A 4JC1A 2IZWA 1B35B 1RL3A 3JBG1 3OGRA 5J3UA 1W05A 5A32B 1S0DA 3ABZA 4L99A 3RYRA 4TLGA 4NRMA 4FFIA 4B1LA 3RZLA 3LCPA 2XBO2 4PDWC 3CLPA 1ASJ1 1C8M2 5FYBA 4CSWA 1JI6A 1WA6X 1QOSA 3SKVA 2EALA 3IPVA 1AL23 3KSCA 5D2AA 1CWPA 1OHFA 4Y1VA 1VMJA 1IPKA 3ENRA 3SMHA 1UKGA 4XF3A 2BFUS 1UO9A 4KG0A 2X5IB 4LBQB 5CVRA 3WCRA 3SISA 4AGGA 5FXVA 2EXHA 2QQUA 4JTNA 3ES1A 5GLTA 4KWKA 2CWSA 4IV3B 4S2DA 3T0BA 4E2GA 3LF7A 4FPOB 4Z2AA 5KC5A 4UFIA 1R1A3 4KGQA 2VQAA 1KJRA 1QJEA 1VAMA 3K75B 4DOUA 1JYTA 3DYMA 4E4HA 3OGVA 5KXBA 1I3HA 4A4AA 1NLQA 1Z0HA 2G1MA 4FFGA 5JI9A 4XMIA 2V5DA 1VP6A 5KHGA 5SV8A 4W65A 1TVGA 3VBHC 3OPWA 1J3PA 4GD4A 1AR91 4RS5A 4QM8A 2YB7A 3LOBA 3K51A 2Z2SB 1AXYA 1TME1 2J42A 2X5IC 4XF4A 1L7RA 4AEDA 5F37A 3BTZA 4Q4Y1 3VZKA 4YW1A 4OI2A 2HYKA 2G4IA 2ARBA 2R6QA 2K46A 4Q4W3 3RG0A 3T0DA 2O14A 2WO1A 2D97A 4OHXA 3ZSMA 3NMBA 2WT2A 5FZHA 2D44A 1VE0A 3BUCA 4BQYA 3RJRA 2VZPA 1S2EA 3UK9A 2GMMA 1UWWA 4IEYA 1Y9GA 5I91A 1UU6A 3VBOC 5LEKA 4I01A 5FPBA 3ZSEA 2X05A 4QQLA 1O8SA 2E32A 4L2NA 4XTMA 1Q3EA 4UBHA 3TNPB 3POIA 2RS11 4IE7A 3MIEA 3WG3A 1QXRA 3WINE 4B7EA 4N9HA 1PK6B 2QNKA 1RHI1 3SH3A 2PELA 4XCAA 3VBFA 2WNUA 4MGIE 1QQP1 4IEVA 4HG6B 3D8CA 2D6PA 2XHKA 4WM7C 3T09A 1QJX1 2EF6A 1N1SA 3ZN6A 1W04A 2V4VA 3RZGA 3JQXA 4LO4B 4UF0A 1MEC3 3A23A 4CZSA 2VJXA 2DF7A 4Y4RA 5FO9B 1VBD2 2CL2A 1ST8A 2ZHNA 3IB3A 2YUEA 4IXLA 5AVAA 2E7QA 2Q8DA 4R9DA 1VMHA 1YYNA 4NHMA 3SEPA 3U07A 1TZOA 1YQCA 2RMU1 4FPHA 2HWD1 4LBLA 4LBNA 2W2IA 4QGMA 5FBZA 4C0BA 4CTEA 5HCAA 1SCRA 1PMHX 4NIAA 3LKJA 2YPDA 1PK6C 2Y6KA 3LEIA 4IEOA 1NYWA 3AKQA 5FZCA 4QPIC 2XJUA 4AFAA 3T1MA 2NMNA 3O1MA 2VCAA 4LEJA 4NOTA 5HCFA 1J84A 1GZ9A 4RR3B 1OA4A 3I2JA 4LOSA 3CZJA 5CFCA 4KGGA 4COVA 5GZFA 5CFDA 1OOPA 2Y38A 3WCSA 4P9XA 4AG4A 3D5OA 2QZ3A 3E97A 2CDOA 3W20A 3I7DA 1KXGA 2WN2A 1W9SA 3JCIA 1ND3A 2W39A 4FOVA 5FY0A 1VMFA 4BLJA 2A5ZA 4PLNA 1XU1A 3ME2A 3QCWA 2LUWA 5FZ3A 1MQTB 4Y5Z0 1UMZA 2UWCA 5FY8A 4LHLA 5FZGA 1CESA 3WG1A 3U75A 1PVC2 2PHXA 2VXJA 3MZHA 2DU0A 4R9BA 3OGGA 4AHYA 4AVCA 4BK5A 2PQSA 3HQRA 1COV1 4XEZA 1ZRDA 2CGNA 4YW6A 2JENA 4R52A 5ABJC 1CD3G 2X53S 4K1ZA 3WNPA 3A21A 4NIGA 2XQXA 4CU6A 1ZBE2 2GMEA 2YU2A 5EJ1B 3KZ4C 1VALA 3ZR5A 4RFRB 1ODNA 1Q8OA 1OI6A 3LQCA 3SHRA 3ZFGA 2XJQA 4O9EA 2W08A 4IV1A 1GOFA 1DQ6A 1MQTC 1EPWA 5FY4A 1AR83 4CU7A 2P5BA 1RJ7A 1LR5A 3AMHA 1LESA 3DPRC 3M1HA 3IDBB 3ZFEA 3BU0A 1OKOA 4Y5SA 2LS6A 4NIDA 3W5MA 1KDMA 2PAKA 3C7EA 1GQPA 1GU3A 5JMCA 1N1TA 4CDXB 2QDRA 3LD8A 4N8MA 3RWNA 5L73A 4QHZA 3TRSB 5KR7A 1CZTA 1AJOA 2O8QA 1YCIA 5L7OA 3PIJA 5FREA 3WQ7A 1DZTA 3K4ZA 4QXKA 2VNOA 1RMU2 1YFWA 2WJSA 2WT1A 3KF3A 4AEMA 1JOJA 1UN1A 1T2XA 3BALA 4EWDA 4CVUA 1XNCA 1W6NB 1SEFA 4PDWA 5IVJA 4HONA 1DLCA 2JG8B 3HN1A 2YPJA 4XTPA 1ONAA 3JD71 5CBLA 5F6KA 4FOQA 1UOGA 4I3PA 3ZVXA 4XJUA 1UKRA 1P8JA 3VL8A 4ZKTB 2PHRA 3DUIA 1LODA 2JD4A 3BCWA 1IS3A 3WHTA 3VBUB 1U0AA 1RUH1 2YGMA 5KHIA 1XYPA 2IUWA 4ZPIA 2UYAA 1DIWA 3J7MA 1ZREA 4MOAA 4I0BA 4QGNA 1ASJ3 3POYA 2R072 1B35A 3EYPA 3RI9A 4QGLA 1ENXA 3WF2A 4YM3A 1IOAA 3SNMA 2WC2A 1LNSA 3FLPA 4JV4A 4LK7A 1XNDA 1VBA2 2YYOA 3O0VA 3WUCA 1K5JA 1R093 1U12A 4QKDA 3VD3A 2ZGOA 1SDDB 5JOWA 2B42B 5DAWA 3SH4A 1W6PB 2HWC1 3AKSA 5F2SA 1WW6A 3VBHA 1JZ6A 1QJU1 3N7MA 1BQPA 1NLRA 1UOJA 2WZR3 3OBZA 1NY71 2VTFA 4XBQA 2VL4A 3TEZA 4L9BA 3ES4A 2X5IA 3WF4A 5FUIA 4AI0A 5JOZA 2AUYA 4XDPA 4LHNA 3LDBA 4MO3M 5C3PA 2VECA 4D6RA 4XETA 2BUKA 3IBMA 1RVF1 2E51A 4IV3A 4K8RB 2GNTA 2VD7A 2BOJA 4QPGB 1GNZA 1OH4A 3PU3A 4BQ1A 1H1MA 2WN3A 2K9ZA 2DDUA 3KT1A 4J6GA 3AZVA 1CZSA 1GUIA 5AC92 1YO8A 3NKGA 1AUYA 2OVUA 5FPUA 4ZZ5A 2NPIA 3FX3A 2WFPA 5T52A 1RUI1 3HQUA 1V9U2 1YFYA 2XQRA 4W6WA 4ZONA 1DU3D 1KQRA 3AFGA 1MS9A 2WO7A 3J7NA 2Y33A 3J8F2 3K4DA 1JZ4A 4A41A 1LGNA 2RJKA 2ZHKA 3Q8FA 1ZBA1 4ASLA 1E5SA 1STMA 3FJSA 1HV0A 2Z69A 3H7YA 2XH6A 5DZEA 4E4SA 2ZX0A 1NOVA 4UXAA 4OHYA 5HPOA 1LTEA 2JDNA 3LGRA 2B46X 4PQ9A 4AHXA 4FTEA 1GMMA 2R042 3FUQA 3JQWA 4PHZA 4Q4V1 3WNMA 1T6BX 2LM3A 2Q1ZB 4LO6B 4ZXKA 4YZ4A 1MS5A 3K3OA 3M3EA 2C26A 1DBNA 1MS8A 1PGSA 3RPQA 3OOXA 4BQ4A 5IFPA 4AEKA 5ACA2 3AK0A 5ANQA 2A6YA 2FDKA 2BV4A 2ORZA 2VE1A 3M2MA 4V2VA 5I0UA 5FZ7A 5C8CB 1QQP3 1BLZA 2DBIA 1AR61 3BPZA 3HAGA 1WLCA 4GQ7A 2D3RA 3BPSA 1WD3A 4FVVA 5GLVA 2CU5A 2DYCA 1JN2P 2VZVA 3H8UA 1PK6A 2PYTA 5FOBB 1RUOA 3VKLA 4XILA 1LOBA 4AAXA 2KXLA 1POQA 1B09A 4IE5A 4COYA 1C3HA 3WW4A 1GYKA 2BDRA 2Z5WA 4FXKB 1BEV2 4X6RB 1UY3A 1VB2A 2XUEA 4C0HA 4K8FA 2J1AA 3GZEA 2RMU3 2XONA 1W0PA 2HWD3 2P2KA 4JQTA 1OQEA 4LBJA 4HKLA 4ZS2A 2GAUA 3VHOA 3RZJA 1LRHA 1UZZA 5F3EA 4Y20A 4X6QB 3WX5A 4EV0A 3VDAA 1OFSA 4CP0A 4EN8B 1MACA 1N1YA 4LK6A 3P6BA 1PO12 2ZHMA 4QHBA 1O4ZA 4ZY9A 4XIOA 1BYHA 2VH9A 4I30A 3KT7A 1JH5A 4YYOA 5FTTC 4C1XA 4YG0A 5F7UA 1RUE2 4AE2A 4JHTA 5C70A 5F3GA 2VUAA 3DL3A 3MF6A 2LRPA 4GB32 4QX3A 3VHRA 1H6YA 4AK3A 4C90A 4E8DA 5BYNA 3HNBM 5C3OA 3ZOIA 1NCQB 3OTFA 4Z07A 5FP7A 5EWSA 1YI7A 3PLQA 2A71A 4YW4A 4RR3A 1VBE2 4LLOA 5ABJA 5DN2A 1OA3A 4YW7A 4F7ZA 4HVRA 1AX0A 1NUKA 3BKZA 2EIDA 3DXUA 4KMQA 4XXPA 1W6MB 1NA1C 3LSDA 4C91A 4FO9A 2ZMKA 1Q8QA 3WQ1A 1OF4A 3E6CC 1UMHA 2XHNA 4PBPA 2HLEA 1MQTA 5LRRA 2FHRA 1JUHA 1VBB1 4FAGA 2RM21 4IE6A 1Q43A 1W8ZA 5FK8A 3AYDA 4YGDA 1GR3A 3DPRA 1UZWA 5DDJ2 4M3CF 3ZXDA 1WGPA 2D40A 2GZWA 4CCJA 1NCQC 4EQVA 2GN7A 3AL5A 2GALA 2XMLA 3V64A 2PA7A 4Q5OA 3I2FA 3VLBB 2OQ6A 3HBKA 1K12A 1NQJA 1SQ4A 1AR73 4WVVA 5DUUA 1JOBA 4EWAA 5LA2A 4U36A 2HWF2 2JE7A 4AOCA 1F35A 2HEVF 3NNGA 3M3CA 2ATFA 1ZBE3 3O1UA 2JJ6A 2RR12 1ALYA 3KV9A 3TN92 2Y6FA 3N4MA 3I59A 4AQ2A 2XB6C 3NJZA 1FNZA 4NHXA 4HVQA 3N9LA 4P00B 4D7YA 1GKBA 1PO23 3MLJA 3B3QE 3ZYHA 1HRI2 3WF1A 1LHUA 4NMIA 3RNSA 4N53B 1CIYA 1PIV2 1BHGA 4KH9A 4XF9A 2QE3A 1ZZCA 3POFA 2BVBA 3Q9OA 1F2NA 1UL9A 1OUXA 2RDQA 4AHWA 4CP9B 4B1MA 1AYN3 4CXWA 1O5LA 3H0OA 5JLVA 3ZYBA 3Q8EA 3NSTA 1W39A 2AC1A 3JB4C 3AP4A 5FZ0A 1W6NA 4DNYA 2DCJA 1AL22 1OXCA 5IK8A 3O7OA 3PUHA 1RUH3 4D69A 2A73B 1VRBA 1XRUA 1UIKA 5A6YA 1X8EA 4K6BA 3AC0A 1YWKA 4I0AA 3IIIA 2WWSA 1RB8G 1BBT3 2ZA9A 1YEWA 3NV1A 1N47A 4LBOA 5BNOB 1A8MA 4IEWA 5FZ9A 3NRUA 1M06G 1R1A2 1UXZA 3KCCA 1DP0A 2JDHA 3JB8A 4IW3A 1TEIA 2W95A 5EJ3A 1X82A 3WNOA 4CCKA 4W50A 1CIWA 3WNNA 2RS53 1JYWA 1LGCA 1QJU3 4XFHA 5CB7A 2H6BA 4EZHA 5FZDA 2D6LX 3OD0A 5ISLA 2J1TA 1WLDA 2VVDA 5FMCA 4WVMB 3VHNA 4A7YA 3NNLA 5DUXA 3PUAA 5FBJA 1RUC1 4XFCA 3NW4A 1W6PA 4OMCA 1VBC1 1H2NA 2GC1A 3BODA 2H6CA 3GM8A 2LALA 3LA3A 5DABA 2UU8A 4AVAA 5A1FA 5IHRA 2DUOA 2TUNA 5FWEA 1HXS1 5A3UA 5BPXA 1QJY3 1S2KA 4X8NA 4AVBA 5BNOC 2WNEA 3Q8CA 4JGYB 2EXKA 1CJPA 5LWBA 4YWAA 3DGTA 3NAPB 5B4NA 3BGAA 3FHIB 4FFHA 1GANA 3IMMA 4EN0A 5JOYA 2P3IA 4NR1A 4XIKA 1J1TA 1C5IA 5I0DA 3U0ZA 2JEMA 1XQNA 2QVSB 1LHWA 4RFT0 3VHPA 5FZMA 1LAJA 1C1FA 3ZSKA 3N9QA 4N9IA 3UNPA 1BCXA 3HMYA 1WMFA 2Y6LA 1MVQA 1WW5A 1JYVA 1O3TA 4GZ9A 4RS5C 1RUG2 2WSVA 4DXRA 5JXIA 1VAKA 4E4DX 2W1WA 3D6EA 2XUMA 1VPHA 2JD9A 5EXOA 4BHPA 3UL2A 4CCOA 3WW3A 5F9TA 3MBWA 2YROA 2YXSA 2ZOEB 1F9KA 2D93A 3C7HA 4XDQA 4K40A 2ET7A 4MGTA 1MEC2 1SZBA 1D4M1 1LULA 3NL1A 4FOYA 3H50A 4KQ7A 1JYCA 4ZU7A 2VBDA 4BM8A 4CE8A 4P08A 3MV11 3ETPA 4D8MA 4OHZA 2BNOA 1LU1A 4QXHA 3FC0A 5FIXA 5FXZA 4AZZA 3WG2A 2GH8A 5F5AA 1GQHA 3PVEA 5CEHA 2GC3A 4L8QA 2QQOA 4AFBA 4CPBA 3O1RA 4LO7A 5EQUA 3S5QA 3QACA 4E9KA 1TQ5A 4MUVA 1HQWA 1XXNA 3N7JA 1MPXA 3MIBA 3MO4A 3B94A 3T1LA 4SBVA 1O3RA 1A34A 3H1WA 2JB8A 3A7QA 1VJ2A 4Q0SA 4SLIA 3WP4A 1C8NA 2VZ3A 4LIUA 5KXCA 1DGLA 3QLQA 4LKSA 4Y22B 3RMXA 4YZ1A 3L9JT 3IM0A 1DQ1A 4FQ4A 3LSEA 2DTYA 2G9ZA 1TG7A 2QKDA 2WZ8A 3N35A 4NRPA 3INAA 5A7OA 3PVBB 1YQ5A 1GOHA 3VDCA 1LOFC 2VZRA 5J1XA 4LHKA 2FMDA 2MPFA 2EICA 4LUKA 4QB2A 3FL7A 3TAYA 3I2OA 1W9TA 1JW6A 2WAAA 4K7JA 3FHAA 5F8PA 4DEQA 5EIYB 1QF3A 1RXFA 3NV4A 4DFSA 1KFXL 1NCQA 4Q8LA 1LENA 4B3NA 4QHOA 1S4CA 2GN3A 5IUQA 2W47A 4XACA 4IGQA 1JMUB 4GWIA 4D6QA 4AFDA 1J58A 2FCUA 4AF9A 1UZ0A 1R081 1VBB3 5H9SA 1J3QA 1W6MA 4IESA 2YDEA 4DY3A 3PVNA 4JHZA 1E5HA 3KWVA 2KA3A 1V6OA 1EV11 5FYZA 1AR82 2KR2A 1W8WA 3C7GA 2JDPA 5FMOS 5IW0A 2VCMA 2FDJA 3TEYA 2GC2A 1PVXA 2XLAA 1MR5A 1CAUB 4C1WA 2HEYF 5GLZA 5JXJA 3WLUA 2NN8A 3E6DA 4QAWA 4BQXA 4LTAA 3ALQA 1UCXA 4A6OA 2JECA 2Q5TA 1W6OB 2Q8EA 4ARXA 4BQ3A 4XUPA 3OUHA 3WDUA 4QKFA 1MZ6A 3RS6A 2G19A 3ROUA 4PQQA 5LBCA 1EAH3 2UWAA 1CZVA 2ILMA 2WIIB 2ZKNA 2P37A 1HW5A 1S0GA 4GAZA 4PJYA 4Y33A 4IV1C 4QQPA 4CEWC 3EMRA 2PHFA 1BXHA 5FR3A 3VD4A 2WNVB 1K45A 3KHCA 3OUJA 5FV3A 1YFXA 1JODA 4MX3A 3BTAA 1X36A 1W8HA 2CGOA 2WFF3 3ZXFA 1LGBA 1NLSA 4J25A 3VDDB 2Q30A 3ZFEC 1WCSA 5KXDA 1SFPA 3GF6A 1ASJ2 2XR4A 3J7HA 5FY5A 2XPJA 1PNFA 1QDOA 2D43A 5E88A 4UFMA 5FKBA 5L9BA 5GLWA 5JWPA 2SBAA 4CDWB 3ACFA 2FQPA 3H3UA 4CP9A 4NPRA 3IT8A 1C5HA 4S2FA 3CZUA 3HQXA 4R9AA 1TMF1 1R092 5F5QA 2XKOA 2WS91 1NG0A 4PF5A 4HANA 2IVJA 4LE3A 2CYFA 3AP5A 4XZUG 3R4SA 1KGYA 1PZ7A 4XHXA 2WZR2 2D5FA 4HBNA 1FMD1 2BTVC 3LEMA 2WQ4A 3FBYA 2DV9A 3LEGA 4XXAA 2WQZC 2MEV1 4FPJA 2ERFA 2QBXA 1GWKA 3WQBA 2W5FA 3CNAA 4IEPA 5BNOA 1S0EA 5FYMA 4FP2A 4TZDA 3C7FA 3AP6A 1ULGA 5I93A 4XJAA 1KITA 5A33B 3ZXAC 2CNAA 1RUC3 4CDWC 4CUCA 2E9QA 3U10A 1WBLA 2R30A 3DCQA 3WOGA 3O1SA 4NVPA 2AENA 2BYVE 2WUHA 5FPVA 1POV1 1YXWA 4TLFA 4A45A 1B35C 1DGWA 3B7MA 4UW4A 5FMDA 4DY5A 4WVMA 4YSFA 3ZYFA 3B01A 1UZVA 1UPSA 2W68A 2XWJB 3CKHA 1WMDA 2DUPA 1J3RA 1CQ9A 4I02A 3M4FA 5L36A 3UV9A 1F5FA 1YJKA 3HBZA 4Y26A 4AI9A 1XE7A 4PT6A 2GNBA 3KGZA 1NE4A 2Y8KA 3RYKA 3NAPA 4XFBA 4DB5A 1IKQA 3R0RA 3JZVA 5DAXA 1DGWX 3F95A 4LE4A 4OUEA 4OCTA 4YGEA 2XBO1 5GZDA 4IV3C 4HK8A 4H14A 5FAXA 1C8M1 1FATA 1YQ2A 3WQ0A 3T2QA 4BPZA 1Q8SA 5FZOA 3RZKA 4P9JA 3FMGA 5A7WA 2ZGRA 2ARXA 3VD7A 3MIHA 1Z78A 1IGOA 2PN5A 5EJZB 1L3JA 2W46A 4NAMA 1AVBA 4FTBA 3OBRA 1QQP2 5JAXA 3UJOA 3OEBA 4GJZA 4NAOA 2VZSA 1W6QB 2ZTNA 2IXLA 2PHTA 1SLIA 3QH7A 4WV8A 4A42A 4L11A 5JOXA 2VVEA 1LOCA 5K9YA 1I5ZA 4E2QA 3EHKA 5FK7A 3QBQA 4RSUA 3LZZA 5DZFA 1K5MB 1Y43B 4YZ3A 5CYYA 4FSJA 3ZYJB 4HOOA 1WCQA 5FZLA 2ZABA 5T5JA 4Z92B 1RUG3 2RMU2 1OSGA 2HWD2 1W8TA 1QU0A 2PFWA 3B02A 3MIFA 2F4PA 1A8DA 2VW2A 2LW8A 3GNEA 4K9SA 3HR9A 3SCHA 2ID4A 1W2OA 1OH3A 4D7SA 1U5IA 1U5ZA 4ATFA 2R7EB 4BWOA 1FYUA 1LOGA 3ST7A 2XJPA 2H0BA 1URXA 5G05L 1T6GC 4GWJA 3WG4A 1LOFA 4DRRA 1WMEA 5HV0A 5JPMB 5LA1A 3OYWA 4P9YA 4L97A 2IXHA 3U4SA 3TEXA 1CVNA 5FY1A 2I2SA 2VMHA 3W59A 3WDXA 5CADA 3GBFA 3E5XA 3KCYA 5FY9A 2ZMLA 1O5UA 4G9SB 5F3CA 4KBZA 1Q56A 1OFNA 5C3RA 3JUUA 2Y0OA 2XVKA 3I2HA 1OT5A 4CCNA 1J83A 1OLRA 2ZGKA 1KJLA 1W2TA 4QDQA 2GDFA 4RQPB 1JYNA 1S2BA 2P34A 2B4KA 3GBWA 4LJHA 1UXXX 2G9FA 5FLIA 3ZIWA 5BNPB 2W9XA 1HDKA 1GNHA 1VLNA 4GJYA 1CAXA 2DUQA 2EXJA 2RS33 4YG3A 3ZYIB 2BP6A 2C24A 4INDA 5C4WB 1GV9A 3ZSLA 4RHV3 1GLHA 1O3SA 1H9PA 3MI8A 5T3NA 3AVRA 3I8TA 1NCRB 3OCPA 1UW8A 1RUD3 3FE5A 4QDSA 1AR72 1RINA 1VBD1 2PLV3 3K46A 1EV13 2XJRA 5FP4A 1W2AX 4COWA 4QQ2A 1HRV3 1NT0A 1OVPA 3HT1A 4RR3C 4CUBA 1IG0A 1OURA 4RGKA 4DXTA 3I2KA 3M70A 1I1EA 4EYUA 5FO8B 2WDBA 1ULEA 5F5CA 1DGRN 4V2WA 2IFRA 5TSWA 4YPJA 3FWEA 4R4ZA 3POGA 4K3UA 3IAQA 5B4XA 5C4WC 5C6CA 4CEWA 5FYSA 2D7FA 3AMNA 1HJGA 4CEYB 1US3A 4DPNA 1PO22 1BK0A 1GBGA 5GJ6A 2A70A 5DG2A 1NQDA 4FPKA 2FCVA 4HKWA 1CAUA 1Q5OA 5APAA 2BWAA 1NCRC 3I3QA 1GICA 1DCSA 2NZ9A 2VZOA 1TNRA 5GALA 2Z42A 2W0XA 4FOWA 1CAWB 4TN7A 4H2AA 2JG9B 4XJZA 1Y9MA 1CN1A 5FZ8A 1AYN2 4AAPA 3S57A 4NWWA 4PBOA 4DUVA 5JXHA 3D3AA 3GXUA 5I0TA 1E5IA 3Q8AA 2WO3A 3HN3A 3J9SA 2E26A 3R4DB 5LEJA 1CX1A 4HSLA 4H3WA 1GZWA 1LEMA 1ZZ9A 1RUH2 4Z8BA 2P17A 3RGBA 4FPFA 3MW3A 2OZ6A 4OI0A 2WR9A 4MHUA 4YFZA 3KVAA 3VKOA 4BOWA 4QX2A 2VZUA 3USUB 1LCLA 1BBT2 2RDRA 1F8VA 1MZEA 4QKBA 3LPGA 5CG9A 3S7EA 3AKTA 2DURA 3WXPA 2BFUL 3JBG3 2WS93 4MH0E 2RS52 1QJU2 5FQ0A 4CDWA 1OMIA 2TNFA 4JX0A 4CDXC 5JMOA 1FOD1 3POEA 1ZZ8A 5ERLA 2ZZQA 2EXIA 2O8OA 4AFMA 1QGLA 2MEV3 1W9WA 5A32A 2IVIB 3BB6A 3ZSJA 4GKYA 1IPJA 1V0AA 1ZA4A 3EO6A 4LPLA 4B4PA 3KV4A 2JG8C 5JIUA 1QJY2 3DEMA 2VUDA 4LHSA 5EYYA 3WF3A 3OPZA 4CCDA 4ET7A 3V0AB 5KHKA 5FP9A 1EY2A 5A33A 4ASKA 3UKVA 4LBQA 2OW4A 3VBUC 3L2YA 2VQ0A 2W94A 4ATEA 1UY2A 4QPYA 2E53A 5KHHA 3TEWA 1V6MA 4Y3OA 1EUUA 3KCXA 4XCBA 2KD7A 2A1XA 1AR93 5EZWA 5H9RA 2BEOA 1W0NA 4CUAA 3DKWA 4HL0A 1XYNA 2PHLA 2VULA 1TME3 2C6SA 2AGSA 1RC6A 1BK1A 1XE0A 1WCKA 2AYHA 2OQ7A 4CP1A 5C9AB 2WO2A 4Q4Y3 5HXMA 4Q4V2 2RVAA 2XJVA 3VD5A 3USSA 4D0QA 4A2UA 1I9RA 3P5BA 4K20A 2R071 4O65A 2OKXA 1BZWA 4QD2A 4KL1A 1DQ0A 3TWIA 5A7SA 3POBA 3BOWA 1REEA 1XSRA 2HWE1 1JZ7A 1DYPA 3ACHA 4NE9A 4WVWA 1OPMA 3KQ4B 4XBLA 3AYCA 1VRH1 4M3CE 4QPGC 2DVGA 3LFMA 1QXJA 4QB1A 2XWBB 5C7GA 3L2HA 3THCA 3WDTA 4CUGA 4RL7A 1XSQA 2VW0A 3RZMA 1R64A 3BTYA 3VZNA 2JDZA 2HH9A 5JI7A 2VOTA 3WDVA 3SITA 3H1YA 3QD6A 1W6QA 1WLWA 2RS13 5FJKA 1ZM1A 3CHXA 4XFIA 5IVVA 1RHI3 3WW1A 1V6NA 3ASIA 5EV7A 4NHKA 2WA4A 1QJX3 3SH5A 2LTNA 4XFGA 5AC91 1SBFA 4QX1A 1HQNA 4KNCA 4PLOA 5LY2A 2QQMA 4XUTA 4BU2A 1V9U1 2ZXQA 1EP0A 2ZGTA 1CAVB 4UAPA 3J8F1 4LITA 3P3PA 1PMJX 4KU7A 2ZEXA 3IDCB 5FO7B 1MS3A 4Y1UA 2JE9A 3PJYA 4X8PA 4YM0A 3CIHA 1N1VA 1XC6A 4GIQA 1D0HA 2XG3A 4R4XA 4Z1VA 3ITQA 4P14A 5C8CC 1OVSA 5LA9A 2QQKA 1N3QA 1OPOA 4UFHA 4NWVA 3GGLA 4TYSA 5LB6A 4HT1T 4AGVA 1RGSA 4BB3A 1S0FA 1NXD1 2C9AA 4WZCA 5BNNB 2YFZA 4E27A 5G04L 5CAZA 2YU1A 3W5NA 2ETEA 5ACA1 1VBB2 5BNQA 5BV6A 3ETQA 2D6NA 1YQ6A 2ZX2A 4YW2A 1JXNA 1I5PA 4MXWB 3ZFFB 1G7YA 5LCWL 4NUBA 4QX7A 5GZEA 5LRSA 2VTXA 5BNPA 3AXDA 2NM1A 5FZBA 2OUHA 2ARCA 4KI5M 2BWCA 4GA9A 1DDLA 4EJRA 3HD8B 4ZXEA 4RD7A 1W2UA 5C4WA 3RMYA 3E5UA 1JYIA 3H7JA 2V73A 3NNFA 1BEV1 3TB0A 2ZGUA 3UESA 4DINB 1COV3 5L19A 3X29B 2ARAA 4M3CB 2W1SA 4AWDA 4I2OA 3VN4A 3BU7A 2MNGA 1NCRA 4IUGA 1GOGA 2PHWA 4QXCA 4AI3A 4B7KA 1DG6A 3BTXA 2DU1A 2GNDA 4XC9A 4AVSA 1DQ4A 5EHDA 2PQQA 4PCRA 3BIWE 5T55A 2ZGMA 4MGKE 3ORJA 2ADDA 3OG2A 1E5RA 3D0SA 4XUQA 2P3JA 1JZ3A 1IS6A 1Y9QA 3NJYA 4Y1YA 1AXZA 1EAH2 1LECA 3NV2A 1PO11 4ISQA 3VBRB 1UYZA 5FZ1A 5J36A 1LHOA 1DHKB 1EUTA 1RUE1 4P5HA 4FPEA 4W6XA 2WT0A 4Y24A 1UYYA 3PHMA 1LHVA 2RJLA 4GB31 4CEYA 5LK7B 2DCYA 2HBUA 3QH6A 1VIWB 4YFWA 4YVSB 5FLHA 4AYUA 2FDHA 4N90A 1ND2B 3C8XA 2XVLA 4P9WA 2WFF2 4LKEA 4UI9L 1PGL2 1VBE1 4QX0A 5HCBA 2R49A 5FYYA 2TBVA 4QKNA 3RWKX 4LLFA 5HCHA 1CAWA 5K0UB 4ZS3A 2JG9A 5IVYA 4PF1A 5FYIA 3ZX7A 2XKPA 4YW5A 1XBFA 3UETA 4CDXA 5A1AA 2J1EA 4QMAA 3PIGA 2VXRA 3DKQA 4EN6B 1DLLA 5HBAA 1JU3A 2O0OA 2DVBA 1KRIA 2JWPA 3I97A 5DPNA 4DZGA 1XPWA 5A7QA 3JD73 4J1WA 4XHBA 5A6QA 1ZRCA 1A6CA 4W8JA 1W9FA 5B2GB 1QJZA 3UT0A 1KFUL 4YVSC 3ZXGA 5A7PA 3CF6E 1WBFA 5T5LA 3USUA 4D7TA 4YM2A 2C0ZA 4CCCA 2JG8A 3VDBA 2QZ2A 1RIRA 1XB9A 4Q4X1 3K2OA 4UOJA 5M0TA 1FOD3 4NROA 4WM8B 1QMJA 1RUC2 3VKMA 1BVP1 3IIAA 2HWF1 4PIYA 4UW5A 1YIFA 3HIFA 5EFUA 5LBEA 3VBUA 4HXCA 4N53C 3D0JA 5C8WA 3Q8BA 2RR11 2Y26A 3TN91 3ZO0B 2ADEA 1SG3A 4HN1A 4OUMA 1D2SA 1X50A 1AZDA 2CWMA 2HWC3 3NQHA 1K42A 1O4TA 2AEYA 5EP9A 4AW7A 3T3YA 1H4HA 4JKKA 4DUXA 2VAUA 4CCEA 2CHHA 2F6BA 4AFCA 4MG2A 1G9FA 2ZZJA 4Q29A 1F4AA 4JRAA 4A44A 2WWJA 5EPAA 2B5HA 3V0AA 2P3KA 4LKDA 1BKZA 1PIV1 2K2SA 3OF1A 1GP5A 1RVF3 4YGBA 5T50A 2VQTA 3IPVB 3R4UA 1APNA 3OB8A 2RG4A 5SV5A 1XNAA 1UQXA 3CBNA 3ZYRA 4LXLA 2GH2A 3NV3A 4NN0A 2X10A 1H8VA 3AKRA 3AP7A 2J22A 1RUJ1 3VUOA 4MLOA 3WNKA 3WZ1A 1DYKA 4QPGA 3B5LB 4BIOA 2A6VA 2QUOA 2ZACA 1RUI3 1NZIA 1RUF1 3GJBA 4BMEA 2OX0A 4HK9A 2ES3A 2FDFA 2P3YA 4CDQB 4H7LA 3DYPA 1JZ8A 1ZBA3 1SCSA 5C9AA 2BOIA 5GZGA 2VR4A 3FHQA 2HWE3 3KV5A 3ZPYA 3KHBA 3ZPOA 4DRVA 1XNKA 3N36A 3U4XA 2GC0A 1VRH3 3LDKA 1QNWA 4K1YA 1FNYA 3T30A 5E89A 3ZYPA 2QTWB 1OQDA 2BVVA 2FD8A 1QWRA 4PI2A 2BNMA 2FMYA 2ZX3A 1OQ1A 4HVOA 2YV8A 2UURA 5FY7A 4Q4V3 5C71A 1A78A 4Q2FA 4JGYC 3ZIXA 4BQWA 3NAPC 3PMEA 2DVFA 3GZUC 4NPMA 5T5PA 2HWB1 3TYJA 4UT5A 3M7AA 5LBFA 4KWUA 1O8PA 4XVHA 5A6ZA 2DCZA 2AEZA 3GYDA 4I09A 5FKCA 2QQWA 2E63A 2R0HA 1AR63 3OBAA 4LBMA 4CDQC 2IXCA 2I07B 3MGUA 2IC1A 3GCXA 3ZXLA 3WHUA 3MFAA 2AREA 2P6HA 4Q4W1 4AEJA 2J1SA 5C8CA 3IDAA 3N7KA 4OQ8A 2PXJA 3BIEA 3KLSA 4GH4B 5L9RA 1MZFA 4QB6A 4BDVB 2ZPXA 2GMPA 4LKFA 2QQLA 2UY8A 1HV1A 3C7OA 4CP2A 4GMP1 2VC9A 4FT8A 1AYM1 4LULA 4E8CA 2WNOA 1AF9A 3T2TA 5DUWA 3W58A 1UZYA 2WNUB 3O1VA 1W0OA 2V5YA 1Y7BA 4OQ9A 1LB2A 3UGFA 1LU2A 4IE0A 1KDKA 2AH2A 3ECQA 1GWLA 4F8AA 3LDRA 5LY1A 3AX4A 4MXVA 5FUPA 2A6WA 4YG6A 2RS32 1UOBA 4EE2A 4Q26A 3U1XA 4AXOA 3H1MA 5FYTA 2G9GA 4RHV2 3S5AA 5FYHA 4XQWA 5FXXA 4ARYA 4OULA 4COUA 4B8EA 4XFAA 5JCTA 2EAKA 1POV0 2E7AA 1WZXA 3DECA 4GH4C 4YVWB 5HI0A 3K48A 1MEC1 2RDNA 2D5HA 3AZWA 2TEPA 1RUD2 1BMV1 2PLV2 5BNNA 2PAEA 2W1QA 2OS2A 1EV12 3D4KA 3E6BA 3LB9A 3WR0A 1ENRA 1HRV2 2WKKA 5DZGA 4IGPA 4Q0PA 4YLZA 5IK7A 4NJ4A 3S6PA 5C3SA 1F15A 3ZFFA 4IERA 4UW3A 4LT5A 1R1ZA 3HNMA 1QHDA 1WCUA 2HYXA 1H2KA 4XABA 5CFCB 1WKYA 2OIIA 2VMCA 4EN9B 1OOPB 1ULCA 2RM23 5CFDB 4GXLA 1ZVFA 3SKJE 2VZQA 2V09A 4G4FA 4AQSA 3MFCA 3FUOA 4RGGA 2NLRA 2VCCA 3CJXA 4YVWC 1UD1A 2A3YA 5FP8A 1IKPA 2ZGPA 5A3LA 1UNBA 4M3CA 5GZCA 1G9DA 4PI0A 1G6NA 4IEZA 5F1RA 2JKBA 3MPBA 3O0XA 4A7ZA 3VZJA 3CDZB 2JX9A 2O1QA 4Z2WA 3KGLA 4OHWA 5T54A 4BJ0A 3FN9A 1LJ7A 2JIJA 1ULOA 5DAPA
chains in the Genus database with same CATH topology
3AJZA 1S1AA 2IXJA 2JXAA 2EA7A 1QKQA 5I0SA 3IN9A 1V6JA 3GBGA 1YHFA 4OI1A 3TOJA 1UU5A 4YVSA 4AI2A 2VW1A 4ITCA 1ND2A 2XLGA 4JQRA 1QH7A 1WD4A 3KT4A 4DMIA 3MICA 2A6XA 5GKAC 1LOAA 4R8HA 1YNAA 2WS92 2A7AA 3JBG2 4MSVA 4ZU4A 2C1FA 3UKTA 3PVOA 1F31A 2DCKA 4XYXA 3V56A 5J09A 4Y1ZA 1JHNA 4HSJA 4N53A 1AR81 2VMIA 2MEV2 4BA6A 3VV1A 1LEDA 2DTWA 5E1RA 4Q4X3 5L7OB 2WLPA 1FPN1 3CU7A 2FZ2A 3AMPA 4EWEA 2A3XA 2A6ZA 4WZFA 3ZMOA 3MIGA 1FI2A 4UBGA 1SFYA 1HIXA 2R061 4PDWB 4ZU5A 2VNGA 4KWLA 2WNVC 3WNXA 2QCSB 1H30A 1CGPA 2R0FA 4OI4A 4LA3A 1JBCA 4COZA 4P9GA 3VDDC 3I2DA 4HKOA 5CNAA 1PGW1 4Q0UA 2ZMNA 1SACA 3WDYA 3CJIB 4LA2A 1AR92 1Z7S1 2KM2A 2XJSA 1VBC3 1TME2 2WLQA 3FLRA 2RHPA 1ZZ6A 4XBNA 3ILFA 4YZ5A 4LO5B 4Q4Y2 4F83A 3CEWA 5JR7B 4Q8KA 1HXS3 2ZAHA 4MVTA 4LO8A 4NHLA 3WV6A 2Y0IA 1RUJ3 4HN0A 4U2AA 4LBQD 3VBHB 1U5YA 2PTMA 1MS1A 1AJKA 3IMNA 4N43B 1CR7A 5KBFA 3AJYA 3LOIA 3M3QA 1DGRA 1RUF3 1TNFA 1C57A 1R091 4JGYA 3RSJA 3GZAA 2DWRA 3CJIC 5KC6A 2VY0A 2WZR1 5J7MA 1SFNA 1ZRFA 1CPNA 4DXZA 4XJWA 4CDQA 1MS0A 1J59A 2RS12 3AZXA 4B4QA 1V00A 1O7FA 4V1PA 1RHI2 1GFF2 3POWA 4MV2A 3OBTA 1O4YA 4IEQA 2HWB3 1QJX2 4ONUA 1UAIA 1ZNPA 4N43C 3VBOB 4P9IA 1D4M3 5E8AA 2R1BA 2UYBA 1C28A 5GM0A 1UF2C 2DVDA 1OLQA 4WM7B 3AYEA 2WINB 1SLBA 4HFSA 4Y4YA 4OHVA 1RITA 3RJ2X 4GWNA 4Q27A 4CYDA 3ZXJA 1VAVA 4GMP3 2IWGB 2E7TA 1AYM3 4IEXA 5FPZA 4IL7A 4JGZB 4TWTA 4GH4A 4XZPA 1DQ2A 5FCCA 4LBKA 4YM1A 1K5MC 1LOEA 4QPIB 2ZGLA 4QQHA 4XF0A 4LNVA 3PJQA 4Y22A 2ZGNA 5I8TA 1H9WA 2DFBA 4BMBA 3WP3A 5AFBA 1WA4A 4E2SA 4Y20B 1COV2 3TNQA 4JGZC 4D94A 3O5SA 4YVWA 3MDPA 5FMOL 1QDCA 3A4UA 5JZGB 2BBVA 3MW2A 1Q8VA 1R083 2B9UA 2R32A 4RGAA 4XJ9A 4H7MA 2PAMA 3N3HA 3VKFC 4META 5ABJB 3RI8A 5C33A 3A0KA 4RQPC 3MW4A 3H9AA 1DFQA 5KXEA 4LR4A 4OFGA 1WLTA 5BNPC 1REDA 4ISRA 4HPKB 3POSA 2XL7A 2VUJA 4PIXA 3VBSB 5E16A 3AZZA 3NO8A 1JUIA 5JZGC 2CTVA 2QDNA 1XU2A 1IS4A 1QH6A 3DPRB 3EQEA 3NVCA 3AP9A 1FX5A 2CAUA 1X8MA 4DQAA 5IK4A 1IHMA 1W6OA 2VOXA 3ZDSA 3JD72 3KM5A 5BY5A 5JIAA 3GALA 1XNBA 2YGLA 1IS5A 2C5DA 4UW6A 5FFOC 4A7KA 1F5JA 2IXIA 1PVC1 1FOD2 3VBSC 4AGRA 4CEYC 1AR71 4XPVA 4G3YC 3I59B 1N3OA 3FFQA 2PHUA 2WNVA 4QU2A 2CV6A 2NQYA 3KS7A 5D8AB 5FDBA 5J37A 1FPN3 2CY6A 2WA3A 1ZBE1 1I6XA 5FRAA 3VDDA 1O3QA 3LWCA 1TMF3 2HWC2 2JG9C 1YI9A 4MGYE 3VZMA 2R063 1NY72 1PO21 1FMD3 2OUJA 3THTA 1GZCA 2VOKA 4ASMB 1U5XA 2BQPA 1H8TB 5DG1A 3D82A 2EIGA 4RA0A 1RVF2 4IQPA 2H0VA 3ATGA 3AYAA 2Q1MA 1AYN1 5D8AC 1Z7S3 4AVTA 5CU1A 2UWBA 2D6OX 3DF0A 2RE9A 3V0BB 1POV3 1ENQA 1DZQA 1RMU1 3I4IA 3J26N 4J1XA 5IT6A 3CJIA 1RUI2 1AL0G 3VGIA 5A3MA 5KHJA 1D2QA 1BBT1 2Z79A 1ZBA2 4S2GA 1H8TC 1HLCA 1SDWA 3U11A 2HWE2 2K0GA 3OGJA 3HT2A 1VRH2 2YY1A 3G6JB 3KD4A 4GALA 4M01A 3WVJA 4CRQA 4AVVA 5J96B 1LKNA 2RS51 2XJTA 3FBMA 2QFEA 4N43A 2XGXA 2XBO3 2ZHLA 5EXOA 1OKQA 2NYYA 1G86A 1C8M3 3B00A 4XF1A 5JSOA 1G9CA 5JSRA 3RRDA 3AMMA 1VB4A 3ZN5A 3JU9A 2VG9A 1XYOA 1VBA1 1S0IA 1AR62 1X7NA 2DCTA 5H9QA 1QJY1 3KMHA 4FPLA 2YC0A 2GU9A 2MHFA 1MZ5A 5FOJB 3S7IA 3SXWA 3LAGA 4W6YA 5C9AC 3MLLA 4O9GA 3NKTA 1V70A 3VBOA 3ACLA 3WW2A 1J1LA 2ZAAA 4GULA 4JDOA 3A0NA 3HWJA 1K5MA 4ES9A 2N7GA 3AKPA 4MYEA 4BIFA 3B69A 4WM7A 3EBRA 3WP6A 1PMIA 3OJBA 3VZLA 2BW8A 1JTZX 3SLIA 2B39A 3B9IA 3DN7A 3M3OA 4IETA 4AHZA 2IFWA 4I0WB 3UKNA 4QM9A 4JGZA 4YZ2A 1WW4A 4A3XA 2SLIA 3ZXEA 4MGZE 1CPMA 4XQDA 5AVPA 3WUDA 4AQ6A 2R041 4FPCA 4AI8A 2XL9A 1V6IA 2ZX1A 4QPIA 3R05A 2D3SA 4QX5A 5JDBA 2JICA 3CO2A 4Q0VA 3W9AA 2YZ4A 3WDWA 3C3VA 1O91A 1QOOA 2DFCA 2RM22 5DUVA 5J48A 3S30A 1CX4A 4RQPA 1TE1B 1QXPA 1NA1B 2ZJCA 3KB5A 2ZGQA 2PHDA 3AM2A 5EYXA 3MYXA 3IWZA 4YGCA 2QJVA 1VBD3 4WVZA 4GWMA 4FBFA 5JZGA 3V65A 3EXUA 4KWJA 2ET1A 2ZX4A 3O0WA 3ZN4A 1S0BA 2X8KA 3RYPA 5BNNC 2WSUA 2HEWF 2NMOA 2YMZA 4ORFA 4BZ4A 4CDUB 2W52A 4L92A 4OUSA 1ZX5A 1HKDA 3ILRA 1D4VB 3O14A 3SCFA 3ZFFC 2ENRA 4KG8A 4B4RA 4HPKA 3THPA 1YRZA 2E6VA 1G9AA 3KQRA 2VMGA 3VBSA 1FAYA 3WY6A 4FTSA 2HJIA 1Q8PA 4WBBA 1C4RA 3IDEA 3M8LA 2BNNA 4Q0QA 2XVGA 4CDUC 1OA2A 4EROA 5CA6A 4Q4X2 2OYZA 3ZXKA 1PVC3 4I3GA 4FAHA 4URTA 2VU9A 3VBRC 2CGPA 2R1DA 4AQTA 1IQAA 1ZYBA 3M3IA 4GMP0 3PMSA 3LA2A 2AZ5A 3S0MA 5JVVA 1M4WA 1ZZBA 2GSYA 4FQZA 5DDJ1 4TSVA 4Q1RA 1ND2C 3MIDA 1AX2A 1UIJA 4BLIA 4EN7B 5D8AA 2VVFA 1QNYA 3OY8B 1EAH1 4LUMA 1G9BA 2I45A 5K0UC 4FPYA 1S0JA 3NWKA 4XFFA 4Y1XA 1GSLA 1BVVA 1VBC2 2WL1A 5LK5A 4D3WA 4F3JA 4E4ZA 2D6KA 1YLLA 2WFF1 5JWPA 3ZMNA 1HXS2 1H1IA 1VR3A 1PGL1 1KS5A 1H8TA 3RDIA 3E5QA 3MLKA 1RUJ2 5CIRA 1PZ8A 1CJDA 3MEPA 1RMU3 1HRI1 4DS0A 5F6LB 1G8WA 2VOWA 4FXGB 3RZZA 1H2LA 5DXDA 1RUF2 1SMVA 4N7IA 2HKXA 2VOVA 3V0BA 3VZOA 4WM8C 1EYBA 1KD7A 1QY4A 2NP0A 1RUNA 1PNGA 3WP5A 3FFZA 4K21A 5K8SA 1D0GA 2DVAA 1AL21 4M00A 1A3KA 4H55A 5I0RA 3UJQA 4M0NA 1V6KA 1ZZ7A 4JCKA 1WCDJ 2R073 3BOPA 5GLUA 2HWB2 4QQOA 3RQ0A 1AXKA 1QOTA 1LHNA 3J4UH 4JDNA 1ULDA 2FZ1A 2Q0AA 1D4M2 3ELNA 1R1A1 1VBA3 2VGDA 1S0CA 1Y3TA 4RS5B 1RTVA 1GQGA 2Q4SA 1YUDA 2OPKA 4S2HA 1SLLA 4AEDB 4XJ8A 4Q4W2 4KBBA 2VPVA 3G7DA 1XE8A 2OZJA 1UU4A 1FV2A 1OD5A 4Z82A 3FLTA 3B93A 2B8MA 4JAAA 3R6SA 4KU8A 1E57A 1UPIA 1AYM2 3OD4A 3GHMA 3O12A 1YIPA 1DQ5A 2ZGSA 3GHNA 5AC93 2X29A 2AR6A 2YHJA 3P3NA 2Q8OA 4HLTA 1V9U3 4AEDC 2I74A 3H3ZA 3WD5A 3J8F3 5I8SA 4BCUA 5KWRA 4M0HA 1UX6A 4JTOA 3AZYA 2XLFA 3VBFB 1BMV2 3PTYA 3C2UA 4NO4A 1CAVA 4PLMA 2ZBJA 1PHMA 2D3PA 5D1IA 3ZN6B 2R043 1HX6A 1RUG1 4OVEA 4JRLA 5I8YA 1DZRA 3APBA 2CAVA 2ZS6B 1PM7A 4YNIA 1NXMA 3OYWB 5ACA3 3URFA 1R082 4B29A 1FV3A 4AI1A 1ZRRA 4PIZA 2D6MA 3IKWA 4XMAA 4ES8A 4XE9A 3MF9A 3VKNA 2IXKA 2GNMA 3VBFC 2WNUC 1H0BA 3LA7A 1DF0A 1YJLA 4MXWA 3EJKA 2ZKLA 1BEV3 1NA1A 1N3PA 1AX1A 2VNRA 3GZTB 2BPA2 1BJQA 1CAXB 4OLLA 1SBDA 3AXEA 1KS4A 1ND3B 4IEUA 4HMZA 4R9CA 1ULFA 1FXZA 1RJ8A 2BGCA 5J98B 2D98A 3VL9A 3AMQA 1SLTA 2FBEA 4CDUA 1PO13 1SBEA 2RS31 5HXVA 4RHV1 1PZ9A 1RUE3 4MZUA 3I54A 5H9PA 2OA2A 4GB33 4N7UA 4BH9A 1H1AA 1H2MA 1IZ3A 4FPGA 3VBRA 5CFCC 1NE6A 5CFDC 1VBE3 1OOPC 1RUD1 4BE3A 2R16A 5BXXA 1SLAA 2PLV1 5FLJA 4P9LA 3N7LA 1HRV1 3ZFGB 4FP3A 1ND3C 1AHSA 2ZCWA 4IV1B 1REFA 4XW3A 4CEWB 1FPN2 1S55A 4YW3A 4XOGA 3QOPA 3ZYGA 5JPNB 1TMF2 2QQPA 2B45X 2EAAA 2R062 5K0UA 3ZFEB 2B7YA 4Q1PA 4BYYA 1ENSA 1FMD2 5DDJ3 1FT9A 3TBDA 1CONA 5T5OA 5BUVA 5FPXA 4YARA 3WT3A 5K7PA 1H4GA 3ILNA 3FZ3A 1PGW2 1WUVA 4HETA 1GZWB 1YFUA 1X33A 4GKXA 3ZFGC 4XQ4A 1EPZA 1Z7S2 4YRDA 2HWF3 3CL1A 5AFEA 1MVEA 4QT6A 3DV8A 5JSPA 4FCAA 3OY8A 5CG8A 2RR13 3TN93 1V6LA 4HZFA 2A3WA 2WZPP 5IK5A 3MPPG 4WM8A 1NZCA 1SLCA 3AFKA 3AB0A 4JVAA 2EVXA 1MS4A 3B9CA 2UY9A 5FQ0B 1HRI3 1HQLA 4OZXA 1C1LA 3SCGA 2A75A 5L7OC 3PNAA 4JDMA 1PIV3 1WW7A 4JC1A 2IZWA 1B35B 1RL3A 3JBG1 5J3UA 5A32B 1S0DA 4L99A 3RYRA 3LCPA 2XBO2 4PDWC 3CLPA 1ASJ1 1C8M2 1QOSA 2EALA 3IPVA 1AL23 3KSCA 1OHFA 4Y1VA 3ENRA 1IPKA 3SMHA 1UKGA 4XF3A 2BFUS 4KG0A 5CVRA 2X5IB 4LBQB 3WCRA 3SISA 2EXHA 4JTNA 3ES1A 5GLTA 4KWKA 2CWSA 4IV3B 4S2DA 4E2GA 5KC5A 4FPOB 1R1A3 4KGQA 2VQAA 1KJRA 1VAMA 4DOUA 5KXBA 1I3HA 1Z0HA 5JI9A 4XMIA 1VP6A 5KHGA 5SV8A 4W65A 3VBHC 1J3PA 1AR91 4RS5A 4QM8A 3LOBA 3K51A 2Z2SB 1AXYA 1TME1 2X5IC 4XF4A 4AEDA 4Q4Y1 3VZKA 4YW1A 4OI2A 2HYKA 2G4IA 2ARBA 2R6QA 4Q4W3 3RG0A 2D97A 4OHXA 3ZSMA 2WT2A 2D44A 3RJRA 2GMMA 4IEYA 5I91A 1UU6A 3VBOC 5LEKA 4I01A 3ZSEA 4QQLA 4L2NA 4XTMA 1Q3EA 4UBHA 3TNPB 3WG3A 2RS11 3WINE 3MIEA 4B7EA 1QXRA 4N9HA 1PK6B 2QNKA 1RHI1 3SH3A 2PELA 3VBFA 2WNUA 4MGIE 1QQP1 4IEVA 3D8CA 2D6PA 2XHKA 4WM7C 1QJX1 2EF6A 1N1SA 3ZN6A 3JQXA 4LO4B 1MEC3 4CZSA 2DF7A 5FO9B 1VBD2 2CL2A 2ZHNA 2YUEA 4IXLA 5AVAA 2E7QA 4R9DA 4NHMA 1YYNA 3U07A 2RMU1 5FBZA 4FPHA 2HWD1 4LBLA 4LBNA 4QGMA 4CTEA 5HCAA 4C0BA 1SCRA 3LKJA 1PK6C 4IEOA 1NYWA 3AKQA 4QPIC 2XJUA 4AFAA 3T1MA 2NMNA 4LEJA 5HCFA 4NOTA 1GZ9A 4RR3B 1OA4A 5CFCA 4KGGA 4COVA 5GZFA 5CFDA 1OOPA 2Y38A 3WCSA 4P9XA 4AG4A 3D5OA 2QZ3A 3E97A 3I7DA 1KXGA 3JCIA 1ND3A 2W39A 4FOVA 4BLJA 2A5ZA 4PLNA 1XU1A 3ME2A 3QCWA 2LUWA 1MQTB 4Y5Z0 1UMZA 2UWCA 4LHLA 1CESA 3WG1A 1PVC2 2PHXA 3MZHA 2DU0A 4R9BA 3OGGA 4AHYA 4AVCA 4XEZA 1COV1 1ZRDA 2CGNA 5ABJC 2JENA 4R52A 1CD3G 2X53S 4K1ZA 1ZBE2 2GMEA 3KZ4C 1VALA 1Q8OA 1OI6A 3SHRA 3ZFGA 2XJQA 4O9EA 2W08A 4IV1A 1DQ6A 1MQTC 1EPWA 1AR83 1RJ7A 1LR5A 3AMHA 1LESA 3DPRC 3M1HA 3IDBB 3ZFEA 1KDMA 2PAKA 5JMCA 1N1TA 4CDXB 2QDRA 3RWNA 5L73A 3TRSB 2O8QA 1AJOA 1YCIA 5L7OA 5FREA 3WQ7A 1DZTA 4QXKA 2VNOA 1RMU2 1YFWA 2WJSA 2WT1A 4AEMA 1JOJA 1UN1A 3BALA 4EWDA 1XNCA 1W6NB 1SEFA 4PDWA 2JG8B 3HN1A 2YPJA 4XTPA 1ONAA 3JD71 5CBLA 5F6KA 4FOQA 4I3PA 3ZVXA 4XJUA 1UKRA 3VL8A 4ZKTB 2PHRA 3DUIA 1LODA 2JD4A 3BCWA 1IS3A 3WHTA 3VBUB 1U0AA 1RUH1 2YGMA 5KHIA 1XYPA 2UYAA 1DIWA 1ZREA 4QGNA 4I0BA 1ASJ3 3POYA 2R072 1B35A 3RI9A 4QGLA 1ENXA 4YM3A 1IOAA 3SNMA 2WC2A 3FLPA 4JV4A 1XNDA 1VBA2 2YYOA 3O0VA 3WUCA 1R093 1U12A 2ZGOA 5JOWA 2B42B 3SH4A 1W6PB 2HWC1 3AKSA 3VBHA 1WW6A 1QJU1 3N7MA 1BQPA 1NLRA 2WZR3 1NY71 4XBQA 4L9BA 3ES4A 2X5IA 4AI0A 5JOZA 2AUYA 4LHNA 2VECA 4XETA 2BUKA 3IBMA 1RVF1 2E51A 4IV3A 2GNTA 4QPGB 1GNZA 4BQ1A 1H1MA 2K9ZA 3KT1A 4J6GA 3AZVA 5AC92 1YO8A 3NKGA 1AUYA 2OVUA 2NPIA 3FX3A 2WFPA 5T52A 1RUI1 1V9U2 1YFYA 3UK9A 4W6WA 1DU3D 1KQRA 3AFGA 1MS9A 3J8F2 1LGNA 2RJKA 2ZHKA 1ZBA1 4ASLA 3FJSA 1HV0A 2Z69A 3H7YA 2XH6A 5DZEA 4E4SA 2ZX0A 1NOVA 4UXAA 4OHYA 1LTEA 3LGRA 2B46X 4PQ9A 4AHXA 4FTEA 2R042 3FUQA 3JQWA 4Q4V1 2LM3A 2Q1ZB 4LO6B 4ZXKA 4YZ4A 1MS5A 3M3EA 1DBNA 1MS8A 1PGSA 3RPQA 4AEKA 5ACA2 3AK0A 2A6YA 3M2MA 5I0UA 5C8CB 1QQP3 3BPZA 1AR61 3HAGA 1WLCA 4GQ7A 2D3RA 1WD3A 4FVVA 5GLVA 2DYCA 1JN2P 3H8UA 5FOBB 1PK6A 2PYTA 1RUOA 3VKLA 4XILA 1LOBA 2KXLA 4COYA 1B09A 1C3HA 3WW4A 1GYKA 2Z5WA 4FXKB 1BEV2 4X6RB 1VB2A 4C0HA 4K8FA 2RMU3 1W0PA 2HWD3 2P2KA 1OQEA 4LBJA 4HKLA 2GAUA 3VHOA 1LRHA 1UZZA 3WX5A 4Y20A 4X6QB 4EV0A 1OFSA 4CP0A 4EN8B 1MACA 1N1YA 1PO12 2ZHMA 4QHBA 1O4ZA 4YYOA 4XIOA 1BYHA 2VH9A 4I30A 3KT7A 1JH5A 4C1XA 5FTTC 4YG0A 1RUE2 4AE2A 2VUAA 3DL3A 3MF6A 3VHRA 4GB32 4AK3A 5BYNA 4C90A 1NCQB 3OTFA 4Z07A 5EWSA 1YI7A 3PLQA 2A71A 4YW4A 4RR3A 1VBE2 4LLOA 5ABJA 1OA3A 4F7ZA 4HVRA 1AX0A 4XXPA 1W6MB 1NA1C 3LSDA 4C91A 4FO9A 2ZMKA 1Q8QA 3WQ1A 3E6CC 4PBPA 1MQTA 5LRRA 2FHRA 1JUHA 1VBB1 4FAGA 2RM21 1Q43A 3AYDA 4YGDA 1GR3A 3DPRA 5DDJ2 4M3CF 3ZXDA 1WGPA 2D40A 2GZWA 1NCQC 2GN7A 2GALA 3V64A 2PA7A 3VLBB 1NQJA 1SQ4A 1AR73 4WVVA 5DUUA 4EWAA 4U36A 2HWF2 2JE7A 2HEVF 3M3CA 2ATFA 1ZBE3 2JJ6A 2RR12 1ALYA 3TN92 3N4MA 3I59A 4AQ2A 2XB6C 3NJZA 1FNZA 4HVQA 4D7YA 1GKBA 1PO23 3MLJA 3B3QE 1HRI2 1LHUA 3RNSA 4N53B 1PIV2 4KH9A 4XF9A 2QE3A 1ZZCA 2BVBA 3Q9OA 1F2NA 1UL9A 4AHWA 1AYN3 1O5LA 3H0OA 5JLVA 3NSTA 1W39A 3JB4C 3AP4A 1W6NA 4DNYA 2DCJA