1AYN1

Human rhinovirus 16 coat protein
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
285
structure length
285
Chain Sequence
NPVERYVDEVLNEVLVVPNINQSHPTTSNAAPVLDAAETGHTNKIQPEDTIETRYVQSSQTLDEMSVESFLGRSGCIHESVLDIVDNYNDQSFTKWNINLQEMAQIRRKFEMFTYARFDSEITMVPSVAAKDGHIGHIVMQYMYVPPGAPIPTTRDDYAWQSGTNASVFWQHGQPFPRFSLPFLSIASAYYMFYDGYDGDTYKSRYGTVVTNDMGTLCSRIVTSEQLHKVKVVTRIYHKAKHTKAWCPRPPRAVQYSHTHTTNYKLSSEVHNDVAIRPRTNLTTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords HUMAN RHINOVIRUS 16 COAT PROTEIN
publication title The structure of human rhinovirus 16.
pubmed doi rcsb
source organism Human rhinovirus sp.
total genus 58
structure length 285
sequence length 285
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1997-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1ayn100
5J98B 2RR12 5C9AA 1HX6A 1VBD1 1AR71 2BFUS 2RMU1 3ZFEB 4CDQB 1VBD3 1AR73 5C4WC 4Q4V1 4Q4V3 2XPJA 4IV3C 1QJU2 5A32B 1ZBA2 1MQTA 4N53B 1QJY1 1TMF2 4RQPC 2HWF1 4Q4Y2 1QJY3 3VBRB 2HWF3 3VBUA 5L7OB 1PVC2 3CJIB 1NA1B 2XBO1 3NAPB 3ZFFA 2XBO3 4WM8B 2HWB2 3VBHC 1PO11 2GSYA 4JGYC 1PO13 1PGL1 1COV1 2BFUL 1COV3 1EAH1 4GH4A 2MEV2 5C4WB 2RS51 2R062 1AYM1 2RS53 4IV3B 1AYM3 1BBT1 4WM7A 4RQPB 1OOPA 1ASJ2 5FOJB 4Q4X1 4GB31 4Q4X3 1A6CA 4GB33 5BNPA 4AEDA 4JGYA 1C8NA 1RUI1 1AR82 1VB2A 1RUI3 1MEC1 3VBHB 1NY71 1NCRC 1MEC3 1NCQA 1H8TC 1VBC2 2WS91 1ND2A 2WS93 5A33A 1BMV2 1B35C 4NWVA 1SMVA 1FPN2 4Q4W1 1VBE1 1HRI2 1QJX1 4Q4W3 1VBE3 1HRV2 1QJX3 1RUC1 3JBG3 5CFCC 1RUC3 1K5MA 1OHFA 1ND3B 1FMD1 5BNOC 1FMD3 1IHMA 1RHI2 2WZR1 2ZZQA 3JB4C 4YVSC 3VDDC 5CFDC 2WZR3 4FTEA 5GKAC 1NCRB 2RR11 2WWSA 1H8TB 2RR13 5C9AC 5CFCA 1B35B 2GH8A 1QQP2 4GMP1 1D4M2 4N43A 1QJU1 4GMP3 3IDEA 1ZBA1 1QJU3 1AL21 5BNOA 1ZBA3 1AL23 1TMF1 5AC92 1MQTC 1TMF3 5JZGA 5K0UA 1PVC1 1RMU2 3VBUC 1PVC3 4YVSB 3VDDB 5CFDB 2RS12 2R072 3TN92 3ZFFC 2HWB1 3VBOA 2HWD2 2HWB3 1X36A 3J8F2 5D8AA 1VBB2 4QPGA 5C9AB 2MEV1 1RUJ2 1VBA2 1VRH1 4GH4C 2MEV3 1VRH3 3LOBA 4RR3A 1MQTB 4WM7C 1ZBE2 1OOPC 2R041 3VBUB 4RFT0 1F2NA 2R043 5BNPC 5DDJ2 4AEDC 2PLV2 3ZFFB 1AR81 2X5IC 4NWWA 1AR83 1PO22 2RM22 3JD72 3ZFGA 1W39A 1VBC1 4QPIA 2HWC2 1NCQC 1VBC3 1R091 1BMV1 1F8VA 1ND2C 1R093 1R1A2 4GH4B 2BPA2 1NG0A 1RVF2 4PDWA 1HRI1 2ZAHA 1HRI3 1HRV1 1HRV3 1VBD2 2RMU2 4WM7B 1HXS2 2WFF2 1M06G 1OOPB 1K5MC 2HWE2 2X5IA 1V9U2 1RHI1 5BNPB 1RHI3 4AEDB 4JGYB 1RUD2 1VB4A 5ABJA 1RUE2 1POV1 2DF7A 1NOVA 1POV3 1NCQB 1ND2B 3JBG1 1QQP1 5A33B 4CDUA 1D4M1 1QQP3 1FOD1 3JB8A 4YVWA 1PGL2 1D4M3 1FOD3 4N43C 1CD3G 5BNNA 5AC91 1BEV2 1EAH2 1WCDJ 5AC93 1AR62 1K5MB 4JGZA 5JZGC 1AYM2 5K0UC 1BBT2 3VBSA 2RS11 2R071 3TN91 1VAKA 2RS13 2R073 3TN93 2HWD1 2HWD3 3VBOC 3J8F1 3FBMA 3J8F3 4IV1A 5C8CA 5D8AC 4RHV2 1RUJ1 1VBA1 5LK7B 4QPGC 1Z7S2 1RUJ3 1VBA3 5CFCB 1RUF2 3VBFA 1PIV2 4Q4Y1 1EV12 4N43B 4Q4Y3 4CEYC 4RR3C 5BNOB 4CDWA 4GMP0 1ZBE3 5JZGB 4CDXA 5K0UB 2PLV1 5DDJ3 2PLV3 1RB8G 1C8M2 2RM21 3VBOB 1PO23 2RM23 3JD71 1OPOA 1RUH2 2HWC1 3JD73 5D8AB 3ZFGC 2R061 2HWC3 1AR92 4QPIC 2R063 2RS32 4CEYA 1R1A1 4QPGB 4CDQA 3ZFEA 1R1A3 1RVF1 1GFF2 1RVF3 1ASJ1 4PDWC 1TME2 1AYN2 1ASJ3 4CEYB 4RR3B 1RUG2 2BUKA 5A32A 1HXS1 2WFF1 4LLFA 2RMU3 4N53A 1HXS3 2WFF3 2HWE1 4Z92B 5FMOS 5J96B 2HWE3 1V9U1 3VBRA 1V9U3 5L7OA 1AL22 3CJIA 1NA1A 3NAPA 1RUD1 1RUD3 4WM8A 4FTBA 1PGW2 1RUE1 1R082 1RUE3 5ABJC 5ACA2 1FPN1 3ZFGB 4QPIB 1FPN3 1HQNA 2ZTNA 1AR72 5C4WA 4CDUC 4PDWB 4YVWC 4Q4V2 4IV3A 1BEV1 5BNNC 1BEV3 1EAH3 1AR61 1VRH2 5FMOL 4RQPA 4Y5Z0 1AR63 2VQ0A 1QJY2 4FTSA 2HWF2 2X5IB 4JGZC 1BBT3 3VBSC 1ND3C 2XBO2 2R042 3VBHA 5ABJB 4IV1C 5C8CC 3M8LA 1PO12 4RHV1 4RHV3 1Z7S1 2QQPA 1COV2 1POV0 1RUF1 1Z7S3 2Y26A 1PIV1 1EV11 1RUF3 1DDLA 4CDUB 3VBFC 1QJZA 1PIV3 1EV13 2FZ1A 4YVWB 2RS52 1RMU1 4CEWC 5BNNB 1R092 3DPRC 1RMU3 4RS5C 4CDWC 1ND3A 1AUYA 4SBVA 4JGZB 4Y4YA 4Q4X2 4CDXC 2FZ2A 3S6PA 3HAGA 4GB32 3VBSB 1AL0G 2IZWA 1C8M1 1VBB1 4EJRA 1E57A 1C8M3 1VBB3 2BBVA 1RUI2 1NCRA 1RUH1 4IV1B 1MEC2 5C8CB 1NY72 1RUH3 1AR91 2RS31 1AR93 1H8TA 2RS33 4CEWA 3DPRA 2WS92 4RS5A 4CDQC 2TBVA 1B35A 3ZFEC 2WLPA 1TME1 3VBFB 1ZBE1 1AYN1 3ZXAC 1TME3 1AYN3 1RUG1 4CEWB 4Q4W2 3DPRB 1CJDA 1RUG3 1VBE2 1QJX2 4RS5B 4CDWB 3JBG2 1RUC2 4N53C 5DDJ1 4BCUA 4FSJA 1X33A 1FOD2 3VBRC 1PO21 4CDXB 1FMD2 5L7OC 3CJIC 4YVSA 5CFDA 3VDDA 1NA1C 3NAPC 2WZR2 1PGW1 4WM8C 1R081 5ACA1 1R083 5ACA3
chains in the Genus database with same CATH superfamily
4IEQA 4XFCA 5DZGA 4FOQA 5J98B 3AP9A 5FZIA 3S30A 5I8TA 1HX6A 3RNSA 1UYZA 5E1RA 2RMU1 3POFA 5K7PA 2EXIA 3ON7A 1WCUA 4Q4V1 1GP6A 1UQXA 1WW4A 2GC1A 3WW1A 2Y60A 2YBSA 3ZXLA 4Q4V3 5HV0A 5AVAA 4IV3C 1ZRCA 1QJU2 2VZ1A 3KD4A 3PDQA 3IN9A 2Z79A 1DLCA 2WJSA 3HBKA 3MW4A 2P3KA 1V6NA 1BZWA 4N53B 4RQPC 3ZXJA 2WZEA 3RWNA 1LB2A 1JOPA 2VTFA 2HWF1 3IM0A 5FY4A 1F31A 3VHPA 3WW4A 2HWF3 3KCYA 4Q8KA 4LTAA 1E5SA 4XUQA 4ZU4A 3CJIB 5JUVA 3GZAA 4PLMA 2W47A 3N3HA 2VULA 3NAPB 1HB3A 3ZFFA 4CU9A 2AR6A 5GZCA 1QJFA 2HWB2 3J26N 1JYVA 4YGEA 4COVA 3CBNA 4JZRA 4LBMA 4XFIA 2W39A 1D2QA 1PGL1 4HANA 2JDUA 3W59A 2R7EB 4P14A 2HEVF 2W2IA 2DURA 4NOTA 4QHOA 4QDQA 2BOJA 2D6NA 4MYEA 4GH4A 3WDVA 3RS6A 3RYKA 1GQPA 2B45X 4Y1UA 3WG3A 5JSRA 1AXZA 2P3YA 4MGKE 4DPNA 3EBRA 1C5HA 1MZEA 5C3QA 3J7HA 1V6JA 4IETA 4M0NA 4AVVA 2Z42A 3H7JA 3J7MA 1G9DA 3SMHA 2XMLA 4WM7A 5FY9A 4LE4A 4QKNA 1PMHX 1SLIA 4I3PA 1JYTA 4DQAA 1NYWA 2E7TA 2WT1A 3SH4A 5C3SA 3VKMA 4MGZE 1A6CA 4UW6A 2QDRA 1TE1B 3MO4A 1SQ4A 4GXLA 4XEZA 1BJQA 1C8NA 1F5JA 4LKFA 4Y33A 2AH2A 2RJKA 1GLHA 1VB2A 4XMAA 2YYOA 4LORA 4QHZA 3ORJA 1HKDA 4I01A 1MEC1 3T09A 3POYA 1W6PA 3OGGA 1NCRC 1MEC3 4XDQA 5A6ZA 4JC1A 1OA4A 2QQLA 2VMEA 3WNNA 5JXHA 1NCQA 1EUUA 2WQ8A 2C5DA 2WS91 1OVPA 2ZHMA 2W87A 5IFTA 2WS93 2YC4A 3B9IA 4EWEA 3HQRA 2SBAA 1VMHA 5HXMA 5I0TA 4UFHA 1J3RA 4BMBA 3SITA 5GZDA 1KJRA 4HKWA 4XF9A 2EXJA 3NL1A 4OI2A 3CL1A 1RUC1 4MGSA 4AAXA 4IGPA 1WLTA 1WLWA 4UAPA 1RUC3 4WVWA 1K5MA 5DN2A 3OB8A 3ME2A 5IVCA 1Q8PA 4XACA 2IWGB 2JDKA 2EICA 4YZ4A 3WF1A 1FMD1 5HCAA 2ZKNA 1I9RA 3K4AA 1FMD3 1TZOA 2RDNA 1DBNA 4NPLA 5FZOB 2W1QA 4YVSC 2ZZQA 4ISRA 2ZGMA 2GALA 1IZ3A 1NQDA 1HDKA 1KS4A 3HMYA 3NO8A 5AVPA 4FPYA 3UESA 4NJ4A 4QKDA 1UY2A 1V6LA 2YBKA 3ZMNA 1VMFA 2I45A 2UYAA 2WWSA 3CU7A 3USUA 3DF0A 4CUGA 1AF9A 3ZSMA 5C9AC 2PXJA 1B35B 2W5FA 2ZX2A 2CTVA 1R1ZA 4C8DA 3VD5A 1QJU1 3I2OA 2XKPA 2Y6HA 3TRSB 1QJU3 2MHFA 1XBFA 4MADA 2BVBA 4LO8A 5AC92 1UY4A 3MW2A 1MQTC 5FXXA 1H0BA 4BXSV 2WRAA 2GNBA 3SXWA 3WW3A 1CZTA 4WVMB 1HV0A 3DXTA 1OUSA 1W8HA 5KHGA 5BUVA 3D4KA 3W9AA 2K46A 5FXVA 4GZ9A 1UZYA 4FQ4A 3H0OA 2DUQA 5F2SA 2HWB1 2VW2A 3PMEA 4S2HA 1RIRA 2HWB3 2PAEA 3VBOA 4DB5A 1GUIA 2Q8DA 3J8F2 3MIGA 1QXPA 5D8AA 1ZYBA 3M1HA 1JUIA 1VBB2 2HYXA 2WYSA 4URAA 4OULA 5CG8A 4L8QA 4UFIA 3E6CC 3AP5A 2W08A 1CAWA 4MXWA 4XOGA 4OQ9A 1RINA 4IE5A 1CONA 1LJ7A 5LB6A 4NR1A 4CVUA 2WNVA 2ZEWA 2GP3A 2WAAA 3SC7X 2W91A 1ZBE2 1S0EA 2UY8A 1PK6A 5A7WA 3M3OA 1GU3A 3FC0A 4D7TA 5J1XA 2ZHNA 4M0HA 4URTA 4C0HA 2K0GA 3ZN4A 3K2OA 3KSCA 3ZX7A 1HW5A 5FZHA 2I2SA 4BPZA 2YMZA 2YV8A 5DUUA 3WNPA 2PLV2 4K8RB 2WN3A 3ZFFB 2GC2A 4AEDC 2WBKA 3KHBA 4Z8BA 4M3CA 1PO22 1WLCA 5FZBA 1DF0A 2Q1ZB 2RM22 2QFEA 3SCFA 3VUOA 3NSTA 2V5YA 1XE0A 4QQPA 1XJAA 3ZFGA 1UXXX 1W39A 3KVAA 4QPIA 1OBNA 2ZHKA 1V6OA 1ENXA 1WKYA 4BE3A 5FPXA 5C70A 2JE9A 4XJWA 5LA9A 1US2A 4GH4B 1LEMA 2BPA2 4PDWA 4O9GA 2VL4A 3UKNA 5I0UA 2ZAHA 1W03A 4QKBA 2R1DA 5JOXA 3LQCA 2VXJA 5APAA 5IHRA 1POQA 3AP6A 3OD4A 3PMSA 1XNBA 2EF6A 1CIYA 4WM7B 5L9BA 2WFF2 1M06G 1IS6A 2YGLA 5I0SA 2HWE2 3N7KA 4HVOA 1QXRA 4YW7A 4COYA 1ZNPA 2LALA 4GJZA 5L73A 1ZRRA 2XOMA 5DQ0A 2ZAAA 1GR3A 1VB4A 5A1LA 3VD4A 3DYPA 4XHBA 2CY6A 4XAAA 1RUE2 4PCRA 1W6PB 2C6SA 1SEFA 4M3CF 1OQ1A 2KR2A 5FJHA 1NCQB 5KC5A 4ZY9A 4FO9A 1TEIA 3PVNA 4CCNA 5IK5A 2VMGA 1ZVFA 4JKMA 2NMOA 4CDUA 3C7EA 2IXJA 4YGCA 2XHKA 4W50A 4N43C 1XC6A 4Y3OA 3MPBA 4UBHA 1A8DA 4UOJA 5BNNA 3H8XA 3FBYA 3V64A 4DXSA 4QKFA 5AC91 3E5XA 5AC93 4HN1A 2ID4A 1K5MB 2DV9A 3CNAA 4AR2A 4CU7A 5A6QA 5C3RA 2PHXA 5CISA 1QDCA 4D0QA 1OSGA 1AYM2 5FKBA 4Q0UA 2B9UA 2ZGLA 2P37A 1BCXA 1YUDA 3A4UA 3LAGA 3M3IA 4XURA 3J4UH 1ULOA 4L92A 3GJBA 3J8F1 3HN1A 1CQ9A 5FTTC 2A70A 3J8F3 3AKTA 3VGIA 4AYUA 2OPWA 1LRHA 4Y1YA 1WGPA 5DG2A 5A3UA 3USUB 1LKNA 5GLTA 2JECA 3WV6A 4OHZA 4XJUA 4E4HA 1Z7S2 2DU1A 4QQ2A 4EWAA 1DGRA 4KH9A 2QQNA 4K1YA 3POEA 5DAQA 1K12A 1ENSA 5T5PA 3D82A 4CEYC 4BU2A 5FZ0A 4RL7A 2C1FA 1OLMA 1ZBE3 1DYKA 4CDXA 1W0PA 1CAVA 2R1BA 4XJ9A 1HB1A 4MSVA 1B09A 2PLV1 3ST7A 4ZKTB 2R30A 4H7LA 4JTNA 2PLV3 2DWRA 1C8M2 4RA0A 2RM21 3FLPA 3VBOB 1PO23 3GGLA 2RM23 3WVJA 3MBWA 3VV1A 1OD5A 5JR7B 3K3OA 4H2AA 4AFBA 3E5UA 5IVBA 1OPOA 2NN8A 5D8AB 3KF5A 4WVVA 4Z2WA 4XDPA 1ZM1A 3DGTA 5CYYA 2DVFA 3M3EA 2VNGA 2K2SA 2ARAA 1CAWB 2WA4A 2LW8A 4MXWB 4ZU5A 3W58A 5I8YA 1GFF2 1SLLA 4GAZA 1ASJ1 1YFYA 2HEYF 5DPNA 5CKMA 1ASJ3 4IE4A 3T3YA 3K3NA 4W6XA 2ZGKA 2WNVB 5A32A 2DCZA 2WFF1 3A22A 2VTXA 2HWE1 2WFF3 5H9SA 4CSWA 5A7WB 5FMOS 5F7UA 1PK6B 5J96B 2HWE3 1OUXA 4ITCA 1ZA4A 4I2OA 1F5FA 1MZFA 1FV2A 4XXAA 1AL22 2JDNA 4FP2A 3GZTB 1NLRA 3O7OA 1NA1A 1BKZA 2BOIA 3E1F1 4DZGA 1YYNA 4AI0A 4CRQA 3PURA 4F3JA 4WM8A 5IK4A 3DYOA 1CX1A 4M3CB 2UURA 1RUE1 1RUE3 5IVJA 5C3PA 4CCJA 5ACA2 3WX5A 4AI1A 3ZXKA 1I5PA 1RC6A 1RJ8A 4XJZA 1CZSA 3FMGA 4XPVA 3ZFGB 3WQ0A 4QPIB 4A41A 1U5IA 4DXRA 2RG4A 1GWMA 2WUHA 5CA6A 3KM5A 1MS3A 5JOYA 5EIYB 4CCEA 5FREA 5EJ3A 2ZGOA 1UMIA 4IE0A 4META 1AR72 5C4WA 5LEJA 4PDWB 2XJPA 3UV9A 1UWWA 2FCVA 4HBNA 5A3TA 3RI9A 1VRH2 3KV6A 3H7YA 4Y5Z0 1V6IA 3GCWA 1S0JA 3ES4A 4HN0A 4QM8A 4I0WB 1JZ4A 1QJY2 1NQJA 4AZZA 1IPJA 5JVVA 5T50A 2ZX4A 2WO7A 4O7XA 1D4VB 2V4VA 2ZOEB 4A6OA 5FQ0B 2WWUA 1G9BA 1RITA 4MO3M 3WQBA 2VZ3A 4Y5SA 2VZOA 3VBSC 4EN0A 4K3UA 2E51A 1ZZ7A 1SBFA 1U5XA 3C7GA 2J1SA 3VZLA 5K8SA 2GNDA 2XBO2 2K9ZA 1XYNA 2ZMKA 3I2FA 4J6GA 4U2AA 5FZLA 4E4DX 3MW3A 4PBOA 4Y24A 1W9WA 5KHIA 4IV1C 4AFAA 3M8LA 1PO12 5C8CC 3ITQA 2R32A 2WIIB 1SDDB 1WLDA 4XF3A 3IKWA 1Y9QA 1Z7S1 3VHNA 4D6RA 5D1IA 1KITA 2WL1A 1H2LA 3I59A 2QQPA 1Z7S3 1DP0A 3ZN6A 2Y26A 3VKNA 1AZDA 1VPHA 4FPFA 1DDLA 4CDUB 1QJZA 1DQ0A 1CPNA 1QXJA 2JDPA 1IPSA 5FAXA 2NZ9A 5BNNB 3DPRC 2Y6KA 3IIAA 2WSUA 4CDWC 4H55A 3K51A 4COUA 2BTVC 2WT0A 4AK3A 1OH4A 1ND3A 1C1LA 1PM7A 3PUHA 1QEXA 5FY8A 4Q4X2 1CESA 1MR5A 1UXZA 4GQ7A 2BBAA 3NRUA 1S4CA 2LS6A 4QD2A 1AL0G 5IVEA 2IZWA 1C8M1 2WKKA 3SH3A 3DUIA 3UGHA 1AXKA 2NQYA 4XUTA 3T08A 1C8M3 3S5AA 3WW2A 3BTZA 4TLGA 1GOFA 4YW2A 4QX8A 2Q8OA 3EYPA 4YZ2A 3FN9A 2D7FA 3AJZA 1URXA 2YB7A 4YW3A 5FK8A 1NY72 4E27A 3BGAA 4NIGA 5FZ7A 3Q9OA 3LZZA 5I91A 3U75A 1YJLA 2CNAA 1F4HA 4RS5A 1DIWA 1RJ7A 1F9KA 2WLPA 1MS0A 1SLAA 3G7DA 2RDRA 3K48A 3EO6A 1F15A 1QU0A 5IYYA 4CEWB 2KXLA 1VBE2 1JODA 4Y5TA 3TAYA 3JBG2 4BQYA 1HIXA 2RHPA 3HVDA 3LA7A 1BVP1 2Q1FA 5DDJ1 4FSJA 3ZMOA 1X33A 3AFKA 5LBFA 2ZKLA 5LA1A 3VZNA 3Q8FA 4AI2A 4CDXB 5A7PA 1W90A 1US3A 1CAVB 4BIOA 5L7OC 5AFBA 2VQTA 2A6XA 1Y4WA 5CFDA 1LHOA 1ZA7A 4JKKA 2WZR2 2Z5WA 4AXOA 2OXBA 3VZMA 4Y4RA 5FR3A 4H14A 3A23A 3I3DA 3D5OA 5FZ4A 5ACA1 4IEXA 4IGQA 5F32A 1CJPA 3LKJA 4MOAA 5FMBA 5ACA3 2BWCA 4QX2A 3W5MA 4FQZA 1OT5A 4MH0E 2HH9A 2ZZJA 2RR12 1JUHA 4GA9A 3Q8AA 4JHZA 2A3XA 4DUWA 1S0CA 1L7RA 2A6ZA 1VBD1 1AR71 2BFUS 4NIDA 2VVDA 1PMJX 1VBD3 1AR73 4QAWA 3WG4A 4JDOA 3AKSA 3BI3A 3ZO0B 3NNFA 1OFSA 3LEGA 3SEEA 3ZSKA 5EFUA 4AGRA 4PF1A 3O1RA 3BIEA 2VTXJ 5A32B 1ZBA2 3T1LA 1X50A 3M7AA 1FI2A 4Y1ZA 2BERA 3T2PA 3UJOA 1QJY1 2DFBA 1RUOA 1H9PA 1QJY3 2C0ZA 3WINE 3BN6A 4GWJA 3VBUA 3WCSA 5JSPA 2JG8B 2X29A 1PVC2 4KWJA 3LEKA 5FZEA 4B7EA 2AYHA 1UYXA 1S55A 1YHFA 1QF3A 4UFKA 4XTMA 1NA1B 1ZZ8A 5D2AA 2XBO1 2ET7A 5FBJA 4YW4A 3WNMA 5IT6A 5JXGA 1PMIA 4LO6B 1Q8SA 2XBO3 4WM8B 5DMYA 1VR3A 3KT7A 2AUYA 3VBHC 3MPPG 1PO11 4TLFA 1OQEA 2W1SA 2GSYA 1F4AA 1O7FA 3QCWA 1RUNA 1PO13 2LRPA 3PLQA 5CEHA 4YFZA 4LHLA 3O0VA 4GD4A 2AACA 5FCCA 3RVHA 1WMXA 4QM9A 3T1MA 5KXCA 2MEV2 3UJQA 1X82A 1TQ5A 4PI0A 5C4WB 1W28A 2UWBA 2R062 3APBA 4WV8A 4NHLA 1L3JA 1GNZA 2ZX1A 4KNCA 3M3QA 1UZWA 2ORZA 1W9FA 3LGRA 3OSDA 3HNBM 2XJTA 4Y1VA 4I30A 5FP9A 1OOPA 3TWIA 4YZ1A 5KHKA 1X8MA 4HXCA 3M3CA 2TUNA 4MVTA 1XE8A 1G9FA 2ZGNA 3E6BA 3HQXA 4LUMA 4Q4X1 2GZWA 4Q4X3 1JYWA 3I3QA 4CUAA 4AQ2A 2DU0A 1W2NA 3HPNA 3CJXA 4KBZA 4JGYA 2EIEA 3T0AA 4RGAA 1S2EA 2B42B 4OHWA 1V70A 1MACA 3WEZA 4WZCA 1VALA 3ACFA 4IUGA 4NRMA 1NY71 4BHPA 1DQ6A 5DAWA 3LCPA 3AK0A 2W46A 4LKDA 4NRPA 1H8TC 1VBC2 1N3OA 5M0TA 1ND2A 1GNYA 2P34A 3I59B 4XF0A 3MF6A 4XETA 5A33A 5AFEA 1KDKA 1NT0A 1Y9GA 3K46A 3ZN6B 4CXWA 1CZVA 3GM8A 1DQ5A 1FPN2 1DGWA 2OUHA 4W65A 5A7NA 3WOGA 4CCDA 3KB5A 1VBE1 1HRI2 1OF3A 1VBE3 1HRV2 5I93A 3JBG3 4OMCA 2VE1A 3T2QA 4CUCA 1TVGA 1S0FA 1W6QB 1ND3B 2W0XA 3KV9A 4DFSA 4CPBD 4HT1T 1XE7A 2P6HA 1ACCA 2LUWA 3AP7A 4NPMA 1Q8QA 3ABZA 2WZR1 3VDDC 2BGCA 3I54A 1T6GC 5SV8A 2YY1A 2WZR3 3RYPA 2D97A 5E89A 3WDUA 3OBRA 4OLLA 5KC6A 1HQWA 1XNTA 5EXOA 2QNKA 3PVBB 1LESA 2RR11 3THDA 2YBPA 3UKTA 2IC1A 4ASKA 2RR13 4L0PA 3HOBA 4OI0A 5DUXA 1RYYA 1JTZX 2PHTA 5ANNA 4Q29A 3HNMA 1QQP2 1UOGA 5J7MA 3NNGA 1CAUA 2R0HA 5E88A 1HN0A 3OEBA 2QUOA 3JZVA 3VLBB 1ZBA1 1SDWA 4LQRA 2DCTA 3DKQA 3IIIA 1LGBA 3V56A 1ZBA3 2MPFA 1OMIA 4LR4A 4N7IA 4L2NA 4XBNA 1UYYA 3S7EA 4I02A 2BZDA 5JZGA 2OX0A 1PVC1 1RMU2 4LBNA 2G9ZA 1PVC3 4MZUA 4FAHA 5F3GA 5CFDB 2AZ5A 3AXDA 1PK6C 3RZKA 2JEMA 1PHMA 4ZXKA 2JG9A 3E97A 4HK9A 2HWD2 1X36A 2FDKA 2WZPP 1WW7A 4LK6A 2DYCA 4X8PA 5JPNB 2X8KA 2Z2SB 4XUOA 3ZDSA 2XGXA 4Q8LA 4K7JA 4FPOB 2EAKA 3OPTA 4KGQA 1ULFA 2XH6A 2QQVA 4QPGA 4B1MA 2VH9A 2MEV1 3VD9A 1HJGA 4BQ1A 1CIWA 2MEV3 4ZPIA 4Q5OA 4UFJA 4XF4A 4AFCA 5F5AA 1ULCA 3POWA 4G9SB 1AJKA 4XHXA 3LOBA 1LULA 3PU8A 4RR3A 1SFNA 3ZKYA 4E4ZA 1GOGA 4DO0A 4MXVA 2OKXA 4XCBA 3SH5A 4M3CE 2O0OA 3S57A 3H1MA 2OIIA 1AX2A 3P3PA 2R041 2RJ2A 3GF6A 5FZMA 3VBUB 3ILFA 2QBXA 2R043 1O8PA 2JE8A 5FP7A 3R6SA 1O5UA 5LA2A 2GU9A 1GP4A 3OPZA 1YQCA 5BNPC 2CGPA 3RFRA 5EYYA 5FPAA 3AZVA 3MI8A 5B4NA 4DUVA 4AQ6A 2WAOA 1FT9A 1UZZA 3VD3A 3AZZA 2WN2A 5K4LA 4YZ5A 5LW9A 1PZ8A 3POJA 5L36A 1WMDA 5FZ9A 1G9AA 3FWEA 4JDMA 1VBC1 3LEMA 2HWC2 4IEUA 4QGNA 2YROA 4PIXA 1VBC3 2NMNA 1R091 2XVLA 3ZYJB 5LY1A 4P5YA 3BTYA 1F8VA 1XU2A 4HSLA 1R093 3BB6A 2TEPA 3RZZA 4OQ8A 3I3BA 4X6RB 4EN6B 1OKQA 1HRI1 2BV4A 2C4XA 5FPBA 5GZGA 3BPZA 1HRI3 1HRV1 3NW4A 2Y38A 4QPYA 1HRV3 2GN3A 2VVFA 1IS4A 2H6BA 1OOPB 5FDBA 2JD9A 4XJ8A 4M4RA 4YGDA 2P4EA 5JI7A 2P2KA 2X5IA 2VGDA 2Q30A 4GWNA 4LBJA 4Y22A 3P3NA 4GWMA 3WP3A 2D5FA 3AYEA 2FBEA 2PMWB 4LBLA 1TG7A 3VKFC 3VD7A 4TSVA 2ZGQA 3GZUC 4BQ3A 4JGYB 4P9IA 1OD3A 1RUD2 2DVBA 3DV8A 3KT1A 3LFIA 1W06A 2VG9A 1GP5A 1QKQA 4LHSA 1H4GA 1UO9A 2B39A 3IAQA 4D8MA 3FJSA 1W2AX 2DF7A 2W52A 3HR9A 1XOYA 4KQ7A 1ND2B 5C6CA 2LM3A 1QQP1 2B8MA 2G19A 4LBQA 1OFNA 2XL7A 4FXGB 3CLPA 5A33B 1QQP3 4UFMA 3UYJA 2NP0A 4D7SA 4YVWA 3H8OA 2YFUA 3AC0A 4UWDA 1YI9A 2JKBA 5FPUA 2IXKA 1ONAA 4P02B 3AMPA 1EAH2 1IKQA 1H9WA 1WZXA 3C7OA 2RJLA 3N35A 2E31A 3MV01 1O4YA 4BOWA 1SBDA 4JGZA 4FPCA 2WDBA 5JOWA 4DRVA 5K0UC 1W0NA 1NE6A 2DCYA 4FFIA 5I8SA 1JYXA 1BBT2 4XBLA 1UPSA 1VAKA 1J59A 2LROA 4A44A 2HWD1 1W9YA 2XJVA 4V2VA 3MIHA 4YSFA 2BDRA 2HWD3 2Y33A 4HOOA 5FZ6A 4XQDA 5F3CA 3SHRA 1JXNA 1WUVA 5C7GA 4E2GA 4UFLA 5A3NA 4AQSA 1UN1A 1QNWA 3ENRA 3O1UA 1YI7A 3OGJA 4PJYA 4EZ4A 3HIFA 4RHV2 5F9TA 1A8MA 3B01A 1OLME 4ZS3A 3O5SA 3RDIA 3OEAA 1QDOA 4FCAA 1RUF2 4JQRA 2HYKA 3VBFA 1PNGA 3WHTA 2F4LA 1J3QA 3PNAA 4GKXA 4XAEA 5J36A 1CAXA 5KWRA 1CAUB 2V5DA 5JMOA 2X09A 5GM0A 4LNVA 2B7YA 1IKPA 3SKVA 4NN0A 2ZGUA 3BOWA 3FHIB 1G7YA 3O1PA 1MZ6A 1KJLA 2IFRA 4L11A 5F8PA 5JZGB 1GMMA 1OQDA 3TEYA 1DGWX 3WNOA 3U1XA 4D7YA 3THCA 2XXZA 4ZU7A 2JDHA 3KV4A 1OH3A 4NAOA 1RB8G 2PQSA 2JG9B 1J83A 4AI9A 2VOVA 1OLRA 1ENQA 2QTWB 4J1WA 5T54A 3AFGA 2WNUC 3POSA 3VL9A 2VMCA 2HWC1 3NV2A 3GZEA 4AG4A 2JIGA 4BQXA 2HWC3 5A70A 5IVFA 2Q4SA 3HNYM 2RS32 4R9AA 3LPGA 4BM8A 4C1XA 4QPGB 4OUSA 2E32A 4CDQA 3VN4A 3ZFEA 2VOWA 2CDPA 5T5JA 1YC61 4L9BA 4E9KA 5A3WA 4MGTA 2BVVA 1LOFC 4HONA 1SFYA 1T2XA 2YU2A 4NIAA 3WCRA 4RR3B 4P9JA 4KGGA 4EE2A 3N9PA 2QJVA 3WLUA 4AVAA 1UY3A 3R05A 3IT8A 1JOBA 3VBRA 1VLNA 4N90A 4CCKA 1ZZBA 2PHWA 3TEWA 3DCQA 2PQQA 5FWJA 2ZXQA 3FLTA 1KQRA 1RUD1 3CHXA 3WXPA 1RUD3 5FY5A 2WSVA 2W1UA 1VJ2A 3U4XA 3P1IA 1HV1A 4DUXA 5ABJC 4XFAA 5FYBA 2JXAA 3N4MA 3AL6A 5FZ8A 4TWTA 5T52A 3F95A 1W2TA 4NVPA 3D0JA 1MPXA 4R4ZA 1BVVA 3JUUA 4LO7A 2Y6FA 3SCGA 3W21A 4IXLA 4IV3A 5DAXA 5FY1A 1UY1A 4ZHNA 3ZM8A 1WWYA 3VKLA 5FQ0A 2Y6GA 1EAH3 2V4AA 2P17A 5A7QA 1S0IA 5FMOL 4RQPA 4C1WA 4FOWA 4AL9A 5J3UA 2VQ0A 3QLQA 3T4VA 3CEWA 4FTSA 2X5IB 1WW5A 3JQXA 4Y22B 4CCLA 5JMCA 1J84A 4FPHA 4O9EA 1BBT3 2G9FA 3EJKA 2D5HA 4Q0PA 3ZYGA 5A1AA 1AHSA 1SLBA 1ND3C 1Q3EA 1XNKA 3C8XA 3QD6A 3MLKA 3O1MA 2Y6LA 1BK1A 2JIJA 3H50A 5FJKA 5HCHA 4AEJA 1ULPA 2PHLA 5F6KA 2Y8KA 4RHV1 3S7IA 3ELNA 4QDSA 1NLSA 4O65A 4RHV3 1UU4A 2GN7A 2D6MA 4NPRA 5LWBA 1RUF1 2DTYA 4LBQB 1N1SA 3BOPA 1RUF3 2ZMLA 2DFCA 1JU3A 4XW3A 2ARXA 4YVWB 1LAJA 3B93A 1W0OA 2XJQA 4OHXA 4C90A 2VZQA 4RS5C 2OW4A 4NUBA 3FFQA 5LASA 2WNEA 2GDFA 2XLAA 3U14A 4AFDA 4JQTA 4UXAA 1AUYA 2JENA 1NKGA 2ORXA 1AX0A 4JGZB 3UK9A 4Y4YA 3S6PA 1UKRA 5CBLA 2VR4A 3AKQA 3RYRA 5JSOA 2CV6A 2CYFA 2EIGA 4EJRA 1VBB1 1V00A 2BNMA 2WABA 1VBB3 3AZXA 3VB9A 5KXBA 4QXKA 2BBVA 4R52A 4AW7A 4KWKA 3VKOA 2BU9A 2IXIA 2P1BA 4XZUG 1YO8A 1JN2P 1NCRA 3MUY1 3WF4A 3ZDVA 4H7MA 4BXFA 2ZJCA 4XF1A 3T4HB 2SLIA 3ZYBA 2RS31 3PU3A 1ULDA 3WG2A 2RS33 2VMFA 4CEWA 5DZEA 3WHUA 3KV5A 4PLOA 4RD7A 2R49A 3VBFB 1ZBE1 2GNTA 4KG8A 3AVRA 4LE3A 3S5QA 4AHYA 1CAXB 4AHWA 1O3SA 2Q5TA 1I1EA 1REDA 4HLTA 3RJ2X 1QJX2 2VCBA 1H2KA 1LTEA 5JAXA 4N53C 5FV3A 1YJKA 5JXIA 2HKXA 1FOD2 1FNZA 5FFOC 4BB3A 1ZRFA 4DINB 1O3RA 2B9VA 1PO21 3LOIA 2CL2A 4KU8A 1V0AA 4NRQA 2OYZA 3SLIA 2ZPXA 4EZHA 3O1TA 1H1IA 3CJIC 1MS5A 4YVSA 3I2KA 4C91A 3QH7A 1IPKA 3SEPA 4B4PA 3NAPC 2G9GA 1Q8VA 1GZWA 3CZUA 4I3GA 2XR4A 4E8DA 2XLGA 3BODA 4AVCA 3J7NA 5F39A 4CYDA 4A4AA 4PIYA 1ZRDA 1SCRA 5FPVA 1HJFA 1NZIA 1OI6A 1IQAA 2W94A 2XUEA 4EROA 4QHBA 1WBLA 3W20A 2YXSA 2FD8A 2VZVA 3C3VA 1J3PA 1JU4A 3BIWE 4YG3A 1P8JA 5C9AA 4YM2A 4CDQB 3U4SA 4AVBA 3ZFEB 4DRRA 1S2KA 1SPPA 2W1WA 4S2GA 2BGOA 3I2DA 2XPJA 4UW5A 1XQNA 2IXCA 1O6UA 5J37A 2PELA 1L7QA 2HLEA 2JG8A 2ZS6B 5FYYA 1QIQA 3NV3A 5KXDA 5LRSA 1MQTA 3LSDA 5A3OA 5A80A 1TMF2 2Y0IA 1Y7BA 1CVNA 5LBBA 4Q4Y2 2FDGA 3N9MA 2VNRA 1OVSA 3VBRB 4MG2A 1GZTA 1LHUA 1RGSA 2WNOA 1MS9A 4NIIA 2ZEZA 4P9WA 4G3YC 4YFWA 4BZ4A 2VCMA 1D0GA 1NLQA 2V09A 3IDAA 3WY6A 1L7LA 2O14A 1DQ1A 3AX4A 3OBTA 4JGYC 4I0BA 4UT5A 4CP0A 1BHGA 1GV9A 1KS5A 1I6XA 1ZREA 2BFUL 3D0SA 3H9AA 3JU9A 3AL5A 4ET7A 1ZX5A 3RMXA 1AYM1 1LENA 4IV3B 4HFSA 3UT0A 1AYM3 4P00B 3OF1A 1C1FA 2DCKA 3O1SA 2VUDA 5GJ6A 1STMA 2A73B 3NJVA 4RQPB 1HN1A 4YWAA 5HXVA 2H0VA 1GANA 1NAEA 1QWRA 2MNGA 2VY0A 3RQ0A 2XVGA 1W9TA 3NV4A 4LIUA 5FMCA 3GALA 4JRAA 5JR2A 4AEDA 1FX5A 2J1AA 1U5ZA 1RXFA 3AJYA 3V65A 2ES3A 1H2MA 3UNPA 1AR82 1H8VA 2AENA 3JXSA 3K4DA 2DBIA 5CKQA 2XG3A 3CKHA 4AHZA 3OUJA 4CZSA 1XNAA 1YQ5A 3LB9A 3BALA 4ASLA 4JAAA 4K20A 2B5HA 3OYWA 3LIHA 1W3XA 2G4IA 1LOGA 4XQWA 2XWBB 1Y9MA 5HV4A 1B35C 5K9YA 1D7PM 1LGNA 1LCLA 2JDZA 2W3JA 3QBQA 4K9SA 4RYDA 1W6QA 5HCFA 1QJX1 1W8WA 3MUZ1 4GJYA 2CDOA 4LHKA 1DGLA 1QJX3 1T6BX 3IWZA 1XXNA 4TZDA 4HKLA 3EB7A 3MHZA 2E53A 1PZ9A 1Q56A 3ACHA 2FQPA 3KGLA 3TBDA 1AX1A 1H4HA 1O91A 5FO9B 1H6XA 1IHMA 2OA2A 5FYCA 4OUMA 1FNYA 2XWJB 2R6QA 1RHI2 2WLQA 1O3TA 2VJXA 4L97A 2FMDA 4LIVA 4SLIA 1ENRA 1GNHA 1MZ5A 5FP3A 4FFFA 4FTEA 2VZSA 4E8CA 1UPIA 2XDVA 2BNNA 1NCRB 4QX5A 2ERFA 2A3YA 1LR5A 4XBQA 5FY0A 3WUCA 1LECA 1EP0A 4CU8A 1V6KA 1LHVA 1J1LA 4XTPA 3KS7A 2ILMA 1GWLA 4UBGA 5CFCA 1K42A 5IFPA 2GAUA 2GH8A 3ZPYA 4GMP1 5JWPA 1D4M2 1YIFA 4N43A 4GMP3 3OGRA 4PBPA 5BNOA 4B7KA 1AL21 1LOBA 5FK7A 2VBBA 5F5CA 1OC1A 1AL23 1TMF1 3WNXA 4DXZA 3Q8BA 4R9CA 1TMF3 3I7DA 4MGQA 4I09A 5FUPA 5FZ1A 1BLZA 3F2ZA 5F1RA 5FKCA 1CWPA 5A6YA 3WR0A 1LNSA 1CN1A 1LU2A 4BK4A 4BQ4A 2ZX3A 4YVSB 2VZTA 3DXUA 3LDKA 4QGLA 4E2SA 4D94A 2F17A 3TN92 1GZWB 3ZFFC 4BK5A 5C5TA 2G1MA 2XJSA 1XYOA 3I3EA 5ISLA 3HT2A 4W6YA 4QPWA 1ODMA 4ES9A 4LHNA 1OKOA 4MX3A 3ZIXA 1WCQA 1JBCA 5HBAA 5KHJA 4OI1A 2WFPA 3PJYA 4Z07A 5C9AB 1VRH1 3KQ4B 4GH4C 3M4FA 1UAIA 1VRH3 4PHZA 4NMIA 1SPPB 2A3WA 2VO5A 3SISA 1OLQA 2CGNA 3RMYA 3E5QA 2D98A 3THTA 3VZOA 1WMEA 1IG3A 4OYUA 1DQ4A 1MQTB 3V0BA 4EQVA 1H1AA 4WM7C 2O8QA 5BPXA 4OVEA 4QX1A 2CAUA 4RGGA 3T30A 5CAZA 1LGCA 2BP6A 4DOUA 5FYIA 4IEPA 1AR81 1IG0A 1X9PA 4LEJA 2X5IC 5LK5A 3LFMA 3TNPB 1AR83 4A45A 3WDYA 5EYXA 3EQEA 3H1YA 2WYFA 2L9LA 5IATA 3ATGA 3KVBA 1PX4A 2YFZA 1NCQC 1GBGA 2YG0A 1SHWB 4R9BA 3INAA 4AVSA 3ZYIB 2QZ3A 1NUKA 2VOKA 5IAXA 1NG0A 4HPKB 5B2GB 1PGSA 1ODNA 2XJRA 1W2OA 5LZ6A 2BEOA 2RMU2 5FY7A 3U0ZA 2W92A 1XNCA 2YHJA 1K5MC 4IERA 4LKEA 1OA3A 5LBCA 1JI6A 1OXCA 3GXUA 4S2DA 5FZFA 4IE6A 1Q5OA 1RHI1 2ZEYA 2KA3A 3ZN5A 3TEZA 4BWOA 4IGOA 1RHI3 4AEDB 1YFUA 5FZGA 3NV1A 2J42A 4YG0A 2FDHA 1EYBA 3MFAA 3WG1A 4YG6A 4CUBA 3ZXFA 2R0FA 4XILA 3OBAA 3A7QA 5EV7A 1JYIA 1POV1 3O1VA 2B4KA 1EPZA 3MYXA 1POV3 2PHFA 3OYWB 2VM9A 4P9LA 5I0DA 1JYNA 1X9TA 3D8CA 1QNYA 4QX7A 3JBG1 3ASIA 1VP6A 3H3UA 4GIQA 1D4M1 3JB8A 4JHTA 1BXHA 1MS4A 2OVUA 1D4M3 3GHNA 4NE9A 1PGL2 4LITA 4QU1A 4ZS2A 3ZSJA 5T3NA 4JTOA 1WMFA 3UGFA 3LDBA 4YRDA 3VZJA 5JOZA 3A0NA 2HBTA 3RZGA 1Z78A 2ET1A 3I4IA 2D43A 3N7JA 1PZ7A 3ILNA 5L9VA 2Y0OA 1W6MA 2Y6JA 1JZ6A 5LRRA 3P5BA 4AFMA 1UZVA 4LK7A 3B94A 3VBSA 2DVGA 3H3LA 3TN91 4LXLA 4G4FA 3K4ZA 3TN93 1W99A 2JE7A 3PUSA 3QOPA 3BTXA 3ZYRA 1UU5A 1HQLA 2E7QA 1MVQA 2J1EA 3GBWA 3B02A 3Q8CA 4Q26A 3FBMA 3VBOC 2C24A 3N9OA 4IV1A 2J7MA 5C8CA 5T5LA 3KCCA 4EWDA 4MHUA 5D8AC 2QQKA 5BV6A 2AEZA 4ZXEA 3MFCA 5ERLA 3ZIWA 2PAMA 1W8OA 2VBPA 3KLSA 2ARBA 5GLVA 5CFCB 3PTRB 4NHXA 4P9XA 3PUIA 4CTEA 4N43B 2Y64A 2FDJA 2BQPA 2VCCA 4MV2A 5BNOB 1O59A 1IGOA 3R0RA 3LPFA 1LOEA 2WNVC 4CDWA 2OQ6A 2VUCA 3OJBA 4Q1RA 2W9XA 1W05A 1W6OA 4M00A 2YZ4A 3PUAA 4MGIE 1ULGA 4QWNA 3SCHA 1SFPA 4DS0A 5FWEA 2JDMA 2VOTA 4AEMA 5F6LB 2CWMA 4OHYA 1LODA 1WCKA 2PN5A 1CGPA 1UNBA 3WDWA 1QHDA 3IAPA 1KGYA 5G04L 4IDZA 3G6JB 1C3HA 5BXXA 3EXUA 1RUH2 3RWKX 3ZFGC 2R061 4QPIC 1AR92 4NIHA 3FLRA 2R063 5FYSA 1W6NA 2IVIB 3WSOA 1R64A 2YU1A 1D2SA 3ZYFA 1DYPA 5C71A 5FZKA 4R8HA 2OUJA 3O14A 4XQ4A 4PDWC 2WQ4A 4I0AA 5DG1A 1OA2A 4HSJA 2LTNA 4OI4A 5IW0A 4CEYB 3RZJA 1RUG2 4QMAA 1YNAA 1W9SA 2ZMNA 3JQWA 1UOBA 4QXCA 4LLFA 2RMU3 4J25A 4N8MA 3V0BB 1KD7A 2OS2A 3AZWA 3MLJA 3GNEA 4ZONA 1BQPA 3AYDA 3LA2A 4OHVA 2JD4A 2B46X 2J1UA 5L7OA 4Y1XA 3DKWA 4Q27A 4YM3A 5LEKA 1RL3A 2A5ZA 3B69A 2ZGRA 3HN3A 4C0BA 2EALA 4GALA 1VMJA 4AVTA 5IUQA 4ONUA 3KGZA 3VHOA 3ZYPA 2EA7A 1PGW2 2VW1A 3NNJA 4EN9B 1E5RA 3HQUA 4GULA 1H30A 4NROA 4XFGA 2WQZC 3AKPA 4LT5A 1EUTA 5KHHA 1FPN1 1WD4A 3MGUA 2A7AA 2XB6C 1FPN3 2GMEA 3OY8A 5GLUA 2QQUA 5FZCA 2VXRA 4DY3A 4BLJA 1HQNA 1VIWB 4D3WA 2P6CA 3RRDA 4XZPA 1ALYA 1E5HA 4P9GA 1FAYA 4QQOA 3ZXDA 1KXGA 4CDUC 1UD1A 3WP6A 2VUAA 3V0AA 1DYOA 2J1RA 3LIGA 3LD8A 3BTAA 2NM1A 2IXLA 5BNNC 5GLZA 1FATA 4XVHA 4ZZ8A 1S0GA 2BJSA 2YGMA 3MF9A 2QE3A 3MLLA 2IFWA 3I3MA 4K1ZA 1JOJA 1GQGA 3B7MA 1O3QA 2CGOA 1WW6A 2D6PA 3UKVA 1WBFA 4FFHA 5FUNA 3OUHA 1UZ0A 4ORFA 5GZFA 3LSEA 3WNLA 1KRIA 2JB4A 4UF0A 3OUIA 3U10A 4CP9A 1DZTA 3GJAA 2QQOA 3ROUA 2ZACA 3AYAA 4NHMA 1GQHA 1NZCA 3N9NA 1DHKB 3VBHA 2ZGPA 3PTYA 3AXEA 4AGVA 4JRLA 2A1XA 3D6EA 4X6QB 2VOXA 4YPJA 3NVCA 2VC9A 3O12A 1COV2 3GBFA 4HMZA 4OFGA 2VNVA 4JV4A 1UL9A 2XQXA 3RI8A 1SG3A 4FT8A 1UMZA 5DUVA 3WNKA 2VQUA 3FZ3A 2O8OA 2RS52 1HB4A 3OPWA 1RMU1 4CPBA 4CEWC 4QU2A 3PVEA 1S0DA 1RMU3 4XFHA 1UU6A 4RFRB 1GOHA 3ZXEA 2WO2A 5JIUA 1YQ8A 1GWKA 2ATFA 4INDA 3WDTA 1W6MB 4H3WA 4CDXC 2FZ2A 5FYUA 4GB32 3VBSB 3FHAA 4WVZA 4FPKA 4AWDA 5HPOA 3E6DA 1E57A 1VAMA 5JXJA 3BUCA 4RGKA 3O1OA 1RUI2 1FXZA 2C26A 5E16A 3ZKUA 1CPMA 5A6XA 4AQTA 1RUH1 4IV1B 2UYBA 4FVVA 2ZHLA 3POGA 4IEYA 5C8CB 1RUH3 1A78A 1AR91 1QOSA 2XHNA 3AYCA 3M2MA 5FYHA 3RSJA 1QJEA 3U78A 1AR93 1H8TA 1N3PA 2D6KA 2E7AA 2P3IA 3DN7A 4L99A 4RN5A 4CE8A 4FPGA 1O4TA 2TNFA 2TBVA 2VUJA 4HK8A 4YLZA 2XONA 4K8FA 2GP5A 5FIXA 3ZXAC 3CMGA 4CCCA 3M70A 4FOVA 2ZABA 1RUG1 3ZPOA 2C9AA 2WO1A 3GHMA 4Q4W2 3DPRB 1ST8A 1RUG3 1WCSA 3ZXGA 4CP2A 5A7SA 2JDYA 4CDWB 4ES8A 3ZSEA 4ATFA 4QB2A 4IL7A 4BCUA 5FLIA 1Y3TA 1IQDC 1W6OB 2J22A 3N9QA 4CXYA 2ZGTA 5GALA 4ISQA 1SBEA 2JG8C 3ZOIA 3AP4A 1BK0A 3OCPA 4IEOA 3VDDA 1NA1C 5C5UA 3IPVA 2NYYA 5L19A 1H2NA 1K5JA 1PGW1 2PFWA 3JCIA 4WM8C 3KF3A 1F35A 4XDOA 3WF3A 2D6OX 3Q8EA 3MIDA 2E63A 1PM4A 5FLJA 2DVAA 3HBZA 2V72A 4KBBA 4DMIA 1DG6A 3DL3A 3HD8B 4LO5B 1LEDA 4JKLA 1GKBA 3R4SA 3VDCA 3CZJA 1W6NB 2F6BA 1XSRA 4A2UA 1ZZ6A 2H6CA 5C4WC 5HCBA 3N7MA 1YRZA 4A6SA 2XLFA 3A21A 5FPLA 1BYHA 2ZX0A 3BU7A 1DFQA 3T2TA 2FCUA 2I07B 3RZLA 4QXHA 4QX3A 2HEWF 4K6BA 3KZ4C 3WQ7A 5BYNA 1JHJA 3RPQA 2RVAA 4YW1A 1XRUA 3OOXA 5L7OB 2ZEXA 4COWA 4FAGA 1LOAA 4XYXA 3TOJA 1LHNA 2EIDA 3VL8A 4LBOA 1LOCA 2X10A 1AJOA 2UY9A 1DQ2A 1I5ZA 3EHKA 3K77A 5IJRA 2VMDA 2FDIA 1VE0A 3OGSA 5CIRA 1VRBA 4XABA 4YGBA 2Z4FA 1COV1 3OY8B 1G86A 1Z0HA 2HJIA 1COV3 1UY0A 1EAH1 5T5OA 4Z1VA 2PTMA 1DLLA 1XNDA 2RS51 3H1WA 3V0AB 3CO2A 5KXEA 1AXYA 4YM1A 2BYVE 2RS53 2YUEA 5FP8A 4J1XA 1NE4A 3LWCA 2BRTA 1V6MA 1BBT1 1KEXA 1XSQA 4LO4B 2A6YA 5FBZA 2QKDA 3B9CA 4HL0A 4ASMB 4Z2AA 3IB3A 2Q8EA 1ASJ2 2EXKA 5FOJB 2CU5A 1W04A 2H0BA 4QQHA 3L9JT 1QMJA 4GB31 4LBQD 4Q1PA 5FPZA 2A6VA 2WO3A 2VZPA 4GB33 4D69A 2YPDA 4TXWA 5GLWA 3T0BA 5BNPA 4UF0B 4N9IA 1OPMA 4CP9B 2X53S 4AAPA 1KFXL 2XL9A 2AEYA 5EZWA 1RUI1 2NLRA 1NXD1 3AMQA 3C7FA 4LA2A 1RUI3 2WINB 4Y20A 5JCTA 4A7YA 1SCSA 3VBHB 1YLLA 3B00A 3CF6E 4BQWA 4K21A 4M4PA 2WT2A 5IWFA 2GNMA 1N47A 3H42B 2YPJA 4EV0A 1XB9A 1G8WA 3IMMA 5DABA 1BMV2 2VW0A 4HKOA 2E26A 4NWVA 4KG0A 2UWAA 4COZA 3DEMA 2GMMA 5A7OA 1SMVA 2A75A 4FI9A 4Q4W1 3ETPA 4BMEA 2Z69A 3KMHA 4Q4W3 2KD7A 2IXHA 4OZXA 5CFCC 5FXWA 2E6VA 4BH9A 1OHFA 1W2UA 4DY5A 3FE5A 2Q0AA 5BNOC 5IAVA 4OUEA 3GCXA 1JYCA 5E8AA 5IK8A 4NHYA 2IUWA 5D21A 3UGGA 4PIZA 4B3NA 3CQOA 5CB7A 3VDBA 3QACA 4D6SA 5CFDC 1W8TA 3JB4C 2GH2A 1W8FA 1I3HA 2VZRA 1IS3A 2XQRA 5GKAC 4CXXA 3HEIA 5FXZA 4OZOA 2VMIA 3AMNA 1DZQA 5JIAA 4R9DA 1H8TB 4W4ZA 3IBMA 4XJAA 3IMNA 4NHKA 5EJ1B 4JDNA 5EQUA 4A3ZA 2YC0A 3K75B 4P5HA 5ANQA 4DIQA 1YFXA 5CADA 1YQ6A 2D40A 3FX3A 3WQ1A 3IDEA 1JZ3A 1QH7A 4KU7A 1REEA 5CVRA 3OGVA 4HG6B 3AKRA 3FUOA 1JMUB 2W95A 3J9SA 4CCOA 3RZMA 2GC0A 4IQPA 5E6HA 5K0UA 1UOJA 1UOFA 1WD3A 2OT7A 3VBUC 1C28A 1UIKA 2XJUA 4B4RA 1YIPA 4UW4A 3VDDB 1UYPA 1Y43B 3AM2A 4LOSA 2RS12 2R072 2AREA 3IPVB 4D6QA 5I0RA 4V1PA 1G6NA 5IVYA 2YDEA 3WP4A 3ZVXA 3PIJA 1IS5A 2QQIA 2N7GA 4AF9A 1SLCA 1YQ2A 5JPMB 2DDUA 1UCXA 3BCWA 3PHMA 3O0XA 3ZYHA 3SNMA 4XUPA 1U12A 5CU1A 4YNIA 4N9HA 2VPVA 1FV3A 4EN8B 1RUJ2 1VBA2 2VD7A 3RZHA 1LU1A 2ENRA 4IEVA 1RTVA 2D6LX 5IVVA 3SKJE 4V2WA 4B8EA 4QT6A 1GYKA 1TNFA 2JDAA 1OOPC 3HJRA 5H9PA 3NWKA 2EVXA 2W68A 4BYYA 1UX6A 4JVAA 2D3RA 5T55A 2WWJA 4RFT0 1F2NA 1QY4A 3IZOA 3KWVA 1JZ8A 3BVCA 4XFBA 2QVSB 3RG0A 5DDJ2 2BNOA 2JWPA 2J1VA 3LDRA 1GZ9A 2P5BA 2I74A 4NWWA 4XCAA 2CAVA 1K45A 1NX9A 3J7LA 3ALQA 4YYOA 1W8ZA 3U11A 2WNUA 3WD5A 5H9QA 3AZYA 3IDCB 2VECA 3JD72 3I2HA 3TB0A 5FZ3A 4HPKA 1ZRIA 1C57A 4K40A 4N7UA 4M01A 1J1TA 2DVDA 5LATA 3RGBA 1BMV1 5LCWL 1ND2C 1R1A2 4BISA 2VCAA 3R4DB 2VZUA 4JCKA 4WBBA 5F2WA 4B1LA 2WR9A 1RVF2 3DYMA 5F3IA 1LOFA 3H3ZA 3W5NA 2VAUA 5LBEA 4XIOA 4XMIA 4ATEA 3MZHA 2FMYA 1GZCA 5A3MA 1VBD2 3L2HA 1HXS2 2UU8A 2D44A 2QZ2A 1DU3D 4ARYA 3BKZA 5TSWA 4IE7A 3ACLA 3CIHA 2PHRA 5EPAA 1V9U2 3I49A 3I2IA 4JX0A 3AMHA 2JKXA 4BJ0A 2DUOA 3MIEA 3FHQA 4FFGA 3NJZA 3WUDA 5BNPB 1ULEA 4HZFA 1SACA 3ETQA 1O4ZA 5FMDA 2OZJA 4Y20B 5ABJA 4YZ3A 5FZAA 4AE2A 4FBFA 3VDAA 3TYJA 1A34A 1AVBA 2FDFA 1XPWA 4QX0A 4F8AA 1NOVA 2YC2A 3C7HA 3KCXA 4BDVB 3L2YA 1Q8OA 3N7LA 4A7KA 3FUQA 4AOCA 1U5YA 1UMHA 1X8EA 3I97A 1FOD1 1VAVA 2D93A 2DBNA 2BW8A 3NQHA 1FOD3 3BPSA 3QH6A 1W8UA 3I8TA 4GKYA 1CD3G 4LKSA 4NAMA 1JS9A 4Z82A 4HVQA 1PNFA 1BEV2 3OG2A 4WZFA 5DZFA 1WCDJ 5IK7A 2ZBJA 1UKGA 1W8NA 4FOYA 4CU6A 1AR62 3C2UA 1REFA 1UIJA 1H1MA 4PLNA 5JZGC 1HLCA 4YM0A 4BQ5A 2J1TA 1GICA 5FRAA 2NPIA 1YWKA 3I2GA 3RJRA 1M4WA 2WZ8A 2VBDA 4QB6A 2OPKA 2A71A 2R071 2RS11 1PX3A 5A3LA 3T0DA 2RS13 2R073 5FYZA 1YEWA 5DXDA 1ZZCA 2HBUA 4KWLA 2JG9C 3POBA 4W8JA 2AC1A 4Q2FA 4KWUA 4QB1A 2CSGA 5C33A 1UW8A 5FLHA 3NMBA 4XXPA 1W3VA 2IVJA 4DXTA 5JLVA 4A3XA 2Q1MA 2CWSA 3NNLA 4OMDA 1RUJ1 1VBA1 3FFZA 3NKGA 4QPGC 3NKTA 5LK7B 5FYVA 4EN7B 1RUJ3 1VBA3 1YFWA 1H6YA 1SZBA 4P9YA 3TNQA 4BQ2A 1QGLA 1XYPA 3PL0A 3PVOA 4TN7A 4A7ZA 2PHUA 1GSLA 1PIV2 4Q0QA 1EV12 4Q4Y1 3CDZB 5JDBA 2PYTA 5H9RA 2Q8CA 4Q4Y3 3MIFA 5F5QA 4HETA 4RR3C 3ECQA 2VNOA 3ACGA 4X8NA 4GMP0 1KDMA 4LULA 2OZ6A 3WT3A 1APNA 3ILRA 5FOBB 4FPJA 2PA7A 4QGMA 2RDQA 3N36A 3B3QE 5K0UB 1JZ2A 3ACIA 4LUKA 3MV11 3I2JA 4PQQA 5A3PA 1G9CA 4B4QA 5J48A 5DDJ3 4UW3A 2WA3A 5F5IA 1QOOA 3THPA 4DEVA 1ZZ9A 4XE9A 1S1AA 3JD71 4P08A 5B4XA 4IW3A 3SQOA 3P6BA 1K3IA 2FCTA 3JD73 4EYUA 5A1FA 5FYTA 3U07A 4CA9A 1OURA 3MICA 4E2QA 1O5LA 4CEYA 1R1A1 1R1A3 1UX7A 3H8UA 1RVF1 1LHWA 4FPLA 4BIFA 5F3EA 3B5LB 1RVF3 1TME2 1AYN2 3WF0A 1JW6A 2EIBA 4KL1A 2BUKA 1Q43A 1HXS1 4XFFA 5L9RA 4PT6A 4N53A 2DCJA 1HXS3 4KI5M 4Z92B 2QQMA 3GDBA 3VHRA 1YXWA 1V9U1 3GBGA 3HWJA 4Q0VA 1V9U3 2FHRA 2WC2A 5LA0A 3CJIA 3ZR6A 1MVEA 5F37A 3WP5A 4GWIA 3NAPA 1WA4A 2XKOA 5DUWA 1JH5A 2RDSA 4FTBA 1C5IA 2BWAA 3EMRA 2EAAA 3FL7A 4U36A 4CP1A 1R082 5EJZB 3BYWA 2WNUB 3KQRA 4UI9L 1DCSA 1S0BA 5EHDA 4AEKA 4LJHA 1QH6A 3LA3A 4FXKB 4PF5A 1XU1A 2UWCA 4QDRA 4RSUA 2O1QA 3U37A 2QQWA 5C3OA 5KBFA 4TYSA 3A0KA 1PVXA 2A6WA 2ZTNA 3TEXA 5EP9A 4UYBA 4XIKA 1N1VA 4MLOA 2GMPA 4YVWC 3ZR5A 4Q4V2 4BA6A 1E5IA 3MIBA 3S0MA 1BEV1 1S2BA 4E4SA 1BEV3 3T2OA 1AR61 4IESA 5CNAA 1EPWA 1AR63 1WA6X 2JX9A 1N1YA 2VMHA 3R4UA 2P3JA 4Q0SA 1MS8A 2HWF2 4JGZC 2QQJA 5DAPA 1D0HA 4S2FA 2X05A 4ZZ5A 3N9LA 4ARXA 4KMQA 1J58A 3KT4A 3X29B 2R042 2CHHA 3UL2A 5BY5A 1YCIA 4MUVA 1OF4A 1N1TA 2QDNA 3PUQA 3ZLIA 5ABJB 4F83A 3USSA 4AI3A 3O0WA 1CX4A 5J09A 3OBZA 1N3QA 1DZRA 2BGPA 1EY2A 5CZKA 5EWSA 1POV0 1SLTA 3IDBB 5HI0A 1X7NA 1JHNA 4OCTA 1HB2A 1PIV1 1EV11 4F7ZA 3H8RA 2D3SA 3VBFC 1PIV3 4CCMA 1EV13 2FZ1A 2KM2A 1FYUA 3NJXA 4HVRA 5FZDA 2DTWA 3POIA 4LA3A 1JZ7A 1O8SA 2ETEA 1QOTA 1R092 4YW6A 2ZGSA 4LBKA 4LLOA 4QXBA 5LY2A 4XUNA 4DEQA 3BU0A 3AVSA 1RXGA 4LOTA 2GC3A 4SBVA 2ZA9A 5DAVA 4LMFA 3WF2A 3HAGA 5SV5A 5FZOA 3UETA 4R4XA 2JJ6A 4Y26A 2ZCWA 2R16A 2JICA 2Y34A 3HT1A 4AI8A 2XVKA 4QQLA 4B29A 4FPEA 3WDXA 1C4RA 3OD0A 3AMMA 3VZKA 1MEC2 4PI2A 4A42A 4YARA 4XC9A 5BNQA 4MHRA 2PHDA 4MGYE 3URFA 5CKNA 3DPRA 2WS92 3PJQA 4CDQC 4FP3A 1B35A 3ZFEC 2ARCA 1TME1 1DGRN 2AGSA 3D3AA 2RE9A 1AYN1 3ES1A 3LE0A 4LPLA 3AB0A 1TME3 3NNMA 1A3KA 5FO8B 4IEZA 1AYN3 1JZ5A 2E9QA 3LEIA 2PAKA 1CJDA 1NXMA 2JB8A 4RS5B 3KHCA 2C9KA 3ZSLA 2E33A 4W6WA 1CR7A 1RUC2 1IOAA 1TNRA 4DNYA 2DUPA 1U0AA 2EXHA 5CG9A 4WVMA 3VBRC 5KR7A 2XUMA 2VQAA 1MS1A 3MEPA 2VU9A 1FMD2 1UF2C 3OTFA 4YW5A 5FP4A 3GYDA 5FO7B 5GZEA 3MDPA 4AGGA 3NJYA 3LF7A 3PIGA 2VVEA 4BLIA 5FUIA 4O61A 4NO4A 5G05L 2QCSB 3DECA 5JI9A 4IEWA 5FYMA 1R081 2RV9A 2V73A 5C8WA 2F4PA 4TTGA 1R083 4AHXA 1KFUL 2OQ7A 2D3PA 2ADEA 3WZ1A 2ADDA 4PQ9A
chains in the Genus database with same CATH topology
4IEQA 4XFCA 5DZGA 4FOQA 5J98B 3AP9A 3S30A 5I8TA 1HX6A 3RNSA 5E1RA 2RMU1 5K7PA 2EXIA 4Q4V1 3WW1A 1WW4A 2GC1A 3ZXLA 1ZRCA 4Q4V3 5AVAA 4IV3C 1QJU2 3KD4A 3IN9A 2Z79A 2WJSA 3MW4A 2P3KA 1V6NA 1BZWA 4N53B 4RQPC 3ZXJA 3RWNA 1LB2A 3IM0A 2HWF1 1F31A 3VHPA 3WW4A 2HWF3 3KCYA 4Q8KA 4LTAA 4ZU4A 3CJIB 3GZAA 4PLMA 3N3HA 2VULA 3NAPB 3ZFFA 2AR6A 5GZCA 2HWB2 3J26N 4YGEA 4COVA 4LBMA 4XFIA 2W39A 1D2QA 1PGL1 4HANA 3W59A 4P14A 2HEVF 4NOTA 2DURA 2D6NA 4MYEA 4GH4A 3WDVA 3RS6A 3RYKA 3WG3A 2B45X 4Y1UA 5JSRA 1AXZA 4MGKE 4DPNA 3EBRA 1C5HA 1MZEA 1V6JA 4IETA 4M0NA 4AVVA 2Z42A 3H7JA 1G9DA 3SMHA 4WM7A 4LE4A 1SLIA 4I3PA 4DQAA 1NYWA 2E7TA 2WT1A 3SH4A 3VKMA 4MGZE 1A6CA 4UW6A 2QDRA 1TE1B 1SQ4A 4GXLA 4XEZA 1BJQA 1C8NA 1F5JA 2AH2A 2RJKA 1GLHA 1VB2A 4XMAA 2YYOA 1HKDA 4I01A 1MEC1 3POYA 1W6PA 3OGGA 1NCRC 1MEC3 4XDQA 4JC1A 1OA4A 1NCQA 2C5DA 2WS91 2ZHMA 2WS93 3B9IA 4EWEA 2SBAA 5I0TA 1J3RA 4BMBA 3SITA 5GZDA 1KJRA 4HKWA 4XF9A 2EXJA 3NL1A 4OI2A 3CL1A 1RUC1 1WLTA 1WLWA 1RUC3 4WVWA 1K5MA 3ME2A 1Q8PA 2IWGB 4YZ4A 1FMD1 5HCAA 2ZKNA 1I9RA 1FMD3 1DBNA 4YVSC 2ZZQA 4ISRA 2ZGMA 2GALA 1IZ3A 1NQDA 1HDKA 1KS4A 3HMYA 3NO8A 5AVPA 4FPYA 1V6LA 3ZMNA 2I45A 2UYAA 2WWSA 3CU7A 3USUA 3DF0A 1AF9A 3ZSMA 5C9AC 1B35B 2ZX2A 2CTVA 1R1ZA 1QJU1 2XKPA 3TRSB 1QJU3 2MHFA 2BVBA 4LO8A 5AC92 3MW2A 1MQTC 1H0BA 3SXWA 2GNBA 3WW3A 4WVMB 1HV0A 5KHGA 5BUVA 3D4KA 3W9AA 1UZYA 4FQ4A 3H0OA 2DUQA 2HWB1 2VW2A 3PMEA 4S2HA 1RIRA 2HWB3 2PAEA 3VBOA 4DB5A 3J8F2 3MIGA 1QXPA 5D8AA 1ZYBA 3M1HA 1JUIA 1VBB2 4OULA 5CG8A 4L8QA 3E6CC 3AP5A 2W08A 1CAWA 4MXWA 4XOGA 1RINA 1CONA 1LJ7A 4NR1A 2WNVA 1ZBE2 1S0EA 2UY8A 1PK6A 3M3OA 3FC0A 4D7TA 2ZHNA 4M0HA 4URTA 4C0HA 2K0GA 3ZN4A 3KSCA 3ZX7A 1HW5A 2I2SA 4BPZA 2YMZA 2YV8A 5DUUA 4AEDC 2PLV2 3ZFFB 2GC2A 4Z8BA 4M3CA 1PO22 1WLCA 1DF0A 2Q1ZB 2RM22 2QFEA 3SCFA 3VUOA 3NSTA 2V5YA 4QQPA 3ZFGA 1W39A 4QPIA 2ZHKA 1V6OA 1ENXA 4BE3A 5FPXA 2JE9A 4XJWA 4GH4B 1LEMA 2BPA2 4PDWA 4O9GA 3UKNA 5I0UA 2ZAHA 5JOXA 2R1DA 3AP6A 3OD4A 3PMSA 1XNBA 2EF6A 4WM7B 1M06G 2WFF2 1IS6A 2YGLA 5I0SA 2HWE2 3N7KA 4HVOA 1QXRA 4COYA 1ZNPA 2LALA 5L73A 1ZRRA 2ZAAA 1GR3A 1VB4A 4XHBA 2CY6A 1RUE2 4PCRA 1W6PB 1SEFA 4M3CF 1OQ1A 5KC5A 1NCQB 4FO9A 1TEIA 3PVNA 5IK5A 2VMGA 1ZVFA 4CDUA 2NMOA 2IXJA 4YGCA 2XHKA 4N43C 3MPBA 4UBHA 1A8DA 5BNNA 3FBYA 3V64A 5AC91 3E5XA 5AC93 4HN1A 3CNAA 1K5MB 2DV9A 2PHXA 1QDCA 1OSGA 1AYM2 4Q0UA 2B9UA 2ZGLA 2P37A 1BCXA 1YUDA 3A4UA 3LAGA 3M3IA 3J4UH 4L92A 3J8F1 3HN1A 1CQ9A 5FTTC 2A70A 3J8F3 3AKTA 3VGIA 4AYUA 1LRHA 4Y1YA 1WGPA 5DG2A 3USUB 1LKNA 5GLTA 2JECA 3WV6A 4OHZA 4XJUA 1Z7S2 2DU1A 4QQ2A 4EWAA 1DGRA 4KH9A 4K1YA 1ENSA 5T5PA 3D82A 4CEYC 4RL7A 2C1FA 1ZBE3 1DYKA 4CDXA 1W0PA 1CAVA 2R1BA 4XJ9A 4MSVA 1B09A 2PLV1 3ST7A 4ZKTB 2R30A 4H7LA 4JTNA 2PLV3 2DWRA 1C8M2 4RA0A 2RM21 3FLPA 3VBOB 1PO23 2RM23 3WVJA 3VV1A 1OD5A 5JR7B 4AFBA 3E5UA 1OPOA 2NN8A 5D8AB 4WVVA 4Z2WA 1ZM1A 3DGTA 2DVFA 3M3EA 2VNGA 2K2SA 1CAWB 2WA4A 4MXWB 4ZU5A 3W58A 5I8YA 1GFF2 1SLLA 1ASJ1 1YFYA 2HEYF 1ASJ3 4W6XA 2ZGKA 2WNVB 5A32A 2DCZA 2WFF1 2WFF3 2HWE1 5H9SA 5FMOS 1PK6B 5J96B 2HWE3 4I2OA 4ITCA 1ZA4A 1F5FA 1MZFA 1FV2A 4XXAA 1AL22 4FP2A 3GZTB 1NLRA 3O7OA 1NA1A 1BKZA 4DZGA 1YYNA 4AI0A 4CRQA 4F3JA 4WM8A 5IK4A 4M3CB 2UURA 1RUE1 1RUE3 5ACA2 3WX5A 4AI1A 3ZXKA 1RC6A 1RJ8A 4XJZA 3FMGA 4XPVA 3ZFGB 3WQ0A 4QPIB 1U5IA 5CA6A 3KM5A 1MS3A 5JOYA 5FREA 5EJ3A 2ZGOA 4META 1AR72 5C4WA 5LEJA 4PDWB 2XJPA 3UV9A 4HBNA 3RI9A 1VRH2 3H7YA 4Y5Z0 1V6IA 4QM8A 1S0JA 3ES4A 4HN0A 4I0WB 1QJY2 1NQJA 1IPJA 5JVVA 5T50A 2ZX4A 1D4VB 2ZOEB 5FQ0B 1G9BA 1RITA 4EN0A 3VBSC 4K3UA 2E51A 1ZZ7A 1SBFA 1U5XA 3VZLA 5K8SA 2GNDA 2XBO2 2K9ZA 1XYNA 2ZMKA 4J6GA 4U2AA 4E4DX 3MW3A 4PBOA 4Y24A 5KHIA 4IV1C 4AFAA 3M8LA 1PO12 5C8CC 2R32A 2WIIB 1WLDA 4XF3A 3IKWA 1Y9QA 1Z7S1 3VHNA 2QQPA 5D1IA 1KITA 2WL1A 1H2LA 3I59A 1Z7S3 3ZN6A 2Y26A 3VKNA 1AZDA 4FPFA 1DDLA 4CDUB 1QJZA 1DQ0A 1CPNA 1QXJA 5FAXA 2NZ9A 5BNNB 3DPRC 3IIAA 2WSUA 4CDWC 4H55A 3K51A 4COUA 2BTVC 2WT0A 4AK3A 1PM7A 1ND3A 1C1LA 4Q4X2 1CESA 1MR5A 4GQ7A 4QD2A 1AL0G 2IZWA 1C8M1 2WKKA 3SH3A 3DUIA 1AXKA 2NQYA 1C8M3 3WW2A 4YW2A 2Q8OA 4YZ2A 2D7FA 3AJZA 1URXA 4YW3A 4E27A 1NY72 3Q9OA 3LZZA 5I91A 1YJLA 2CNAA 4RS5A 1DIWA 1RJ7A 1F9KA 2WLPA 1MS0A 1SLAA 3G7DA 3K48A 3EO6A 1QU0A 4CEWB 2KXLA 1VBE2 3TAYA 3JBG2 1HIXA 2RHPA 3LA7A 1BVP1 5DDJ1 4FSJA 3ZMOA 1X33A 3AFKA 2ZKLA 3VZNA 4AI2A 4CDXB 4BIOA 1CAVB 5L7OC 5AFBA 2A6XA 5CFDA 1LHOA 2WZR2 2Z5WA 4AXOA 3VZMA 4H14A 3D5OA 5ACA1 4IEXA 1CJPA 3LKJA 5ACA3 2BWCA 4FQZA 4MH0E 2ZZJA 2RR12 1JUHA 4GA9A 2A3XA 1S0CA 2A6ZA 1VBD1 1AR71 2BFUS 2VVDA 1VBD3 1AR73 3WG4A 4JDOA 3AKSA 3ZO0B 1OFSA 3ZSKA 5EFUA 4AGRA 5A32B 1ZBA2 3T1LA 1X50A 3M7AA 1FI2A 4Y1ZA 3UJOA 1QJY1 2DFBA 1RUOA 1H9PA 1QJY3 2C0ZA 3WINE 3VBUA 3WCSA 5JSPA 2JG8B 2X29A 1PVC2 4KWJA 4B7EA 2AYHA 1S55A 1YHFA 1QF3A 4XTMA 4YW4A 1NA1B 1ZZ8A 2XBO1 2ET7A 5IT6A 1PMIA 4LO6B 1Q8SA 2XBO3 4WM8B 1VR3A 3KT7A 2AUYA 3VBHC 3MPPG 1PO11 4TLFA 1OQEA 2GSYA 3QCWA 1O7FA 1RUNA 1PO13 3PLQA 4YFZA 4LHLA 3O0VA 5FCCA 4QM9A 3T1MA 5KXCA 2MEV2 3UJQA 1X82A 1TQ5A 5C4WB 2UWBA 2R062 3APBA 4WV8A 4NHLA 1L3JA 1GNZA 2ZX1A 4KNCA 3M3QA 4Y1VA 3LGRA 3TWIA 2XJTA 4YZ1A 4I30A 1OOPA 5KHKA 1X8MA 4MVTA 3M3CA 2TUNA 4Q4X1 1XE8A 1G9FA 2ZGNA 3E6BA 3HQXA 4LUMA 2GZWA 4Q4X3 4AQ2A 2DU0A 3CJXA 4JGYA 4RGAA 2B42B 4OHWA 1V70A 1MACA 4WZCA 1VALA 1NY71 4BHPA 1DQ6A 3LCPA 3AK0A 1H8TC 1VBC2 1N3OA 1ND2A 2P34A 3I59B 4XF0A 4XETA 3MF6A 5A33A 5AFEA 1KDKA 3ZN6B 1DQ5A 1FPN2 1DGWA 2OUHA 4W65A 3WOGA 3KB5A 1VBE1 1HRI2 1VBE3 1HRV2 5I93A 3JBG3 1S0FA 1W6QB 2W0XA 1ND3B 4DFSA 4HT1T 1XE7A 2LUWA 3AP7A 1Q8QA 2WZR1 3VDDC 2BGCA 3I54A 1T6GC 5SV8A 2YY1A 2WZR3 3RYPA 2D97A 5E89A 3WDUA 3OBRA 4OLLA 5KC6A 1HQWA 5EXOA 2QNKA 3PVBB 1LESA 2RR11 3UKTA 2IC1A 2RR13 4OI0A 5DUXA 1JTZX 2PHTA 4Q29A 1QQP2 5J7MA 1CAUA 2R0HA 5E88A 2QUOA 3JZVA 3VLBB 1ZBA1 1SDWA 2DCTA 1LGBA 3V56A 1ZBA3 2MPFA 1OMIA 4LR4A 4N7IA 4L2NA 4XBNA 3S7EA 4I02A 5JZGA 1PVC1 1RMU2 4LBNA 1PVC3 4MZUA 4FAHA 5CFDB 2AZ5A 3AXDA 1PK6C 2JEMA 1PHMA 4ZXKA 2JG9A 3E97A 4HK9A 2HWD2 1X36A 2WZPP 1WW7A 2DYCA 4X8PA 5JPNB 2X8KA 2Z2SB 3ZDSA 2XGXA 4Q8LA 4K7JA 4FPOB 2EAKA 4KGQA 1ULFA 2XH6A 4QPGA 2VH9A 2MEV1 4BQ1A 1CIWA 2MEV3 4XF4A 4AFCA 1ULCA 3POWA 4G9SB 1AJKA 4XHXA 3LOBA 1LULA 4RR3A 1SFNA 4E4ZA 4MXVA 3SH5A 4M3CE 2O0OA 3H1MA 2OIIA 1AX2A 3P3PA 2R041 3GF6A 3VBUB 3ILFA 2R043 3R6SA 1O5UA 2GU9A 3OPZA 5BNPC 2CGPA 5EYYA 3AZVA 3MI8A 4AQ6A 1FT9A 1UZZA 3AZZA 4YZ5A 1PZ8A 5L36A 1WMDA 1G9AA 3FWEA 4JDMA 1VBC1 4IEUA 2HWC2 4QGNA 2YROA 4PIXA 1VBC3 2NMNA 1R091 2XVLA 3ZYJB 1F8VA 1XU2A 4HSLA 1R093 3BB6A 2TEPA 3RZZA 4X6RB 4EN6B 1OKQA 1HRI1 5GZGA 3BPZA 1HRI3 1HRV1 3NW4A 2Y38A 4QPYA 1HRV3 2GN3A 2VVFA 1IS4A 2H6BA 1OOPB 5FDBA 4XJ8A 4YGDA 5JI7A 2P2KA 2X5IA 2VGDA 2Q30A 4GWNA 4LBJA 4Y22A 3P3NA 4GWMA 3WP3A 2D5FA 3AYEA 2FBEA 4LBLA 3VKFC 4TSVA 2ZGQA 3GZUC 4JGYB 4P9IA 1RUD2 2DVBA 3DV8A 3KT1A 2VG9A 1QKQA 1H4GA 2B39A 3FJSA 2DF7A 2W52A 3HR9A 4KQ7A 1ND2B 5C6CA 2LM3A 1QQP1 2B8MA 4LBQA 5A33B 1OFNA 2XL7A 4FXGB 3CLPA 1QQP3 2NP0A 4D7SA 4YVWA 1YI9A 2JKBA 2IXKA 1ONAA 3AMPA 1EAH2 1IKQA 1H9WA 2RJLA 3N35A 1O4YA 4BOWA 1SBDA 4JGZA 4FPCA 5JOWA 4DRVA 5K0UC 2DCYA 1NE6A 5I8SA 1BBT2 4XBLA 1UPSA 1VAKA 1J59A 2HWD1 2XJVA 3MIHA 4YSFA 2HWD3 4XQDA 3SHRA 1JXNA 1WUVA 4E2GA 4AQSA 1UN1A 1QNWA 3ENRA 1YI7A 3OGJA 4PJYA 3HIFA 4RHV2 5F9TA 1A8MA 3B01A 3O5SA 3RDIA 1QDOA 4FCAA 1RUF2 4JQRA 2HYKA 3VBFA 1PNGA 3WHTA 3PNAA 1J3QA 4GKXA 5J36A 5KWRA 1CAXA 1CAUB 5GM0A 4LNVA 2B7YA 1IKPA 4NN0A 2ZGUA 3BOWA 3FHIB 1G7YA 1MZ6A 1KJLA 2IFRA 4L11A 5JZGB 1OQDA 1DGWX 4D7YA 4ZU7A 1RB8G 2JG9B 2VOVA 1OLRA 1ENQA 4J1WA 5T54A 3AFGA 2WNUC 3POSA 3VL9A 2HWC1 3NV2A 4AG4A 2HWC3 2Q4SA 2RS32 4R9AA 4BM8A 4C1XA 4QPGB 4OUSA 4CDQA 3VN4A 3ZFEA 2VOWA 5T5JA 4L9BA 4E9KA 2BVVA 1LOFC 1SFYA 3WCRA 4RR3B 4P9JA 4KGGA 3WLUA 2QJVA 4AVAA 3R05A 3IT8A 3VBRA 1VLNA 4N90A 1ZZBA 2PHWA 2PQQA 3FLTA 1KQRA 1RUD1 3WXPA 1RUD3 2WSVA 1VJ2A 3U4XA 1HV1A 5ABJC 4XFAA 3N4MA 2JXAA 4TWTA 5T52A 4NVPA 3D0JA 4R4ZA 1BVVA 3JUUA 4LO7A 3SCGA 4IXLA 4IV3A 3VKLA 5FQ0A 1EAH3 2P17A 1S0IA 5FMOL 4RQPA 4C1WA 4FOWA 5J3UA 2VQ0A 3QLQA 3CEWA 4FTSA 2X5IB 1WW5A 3JQXA 4Y22B 5JMCA 4FPHA 4O9EA 1BBT3 2G9FA 3EJKA 2D5HA 4Q0PA 3ZYGA 1AHSA 1SLBA 1ND3C 1Q3EA 1XNKA 3QD6A 3MLKA 1BK1A 3H50A 4AEJA 2PHLA 5F6KA 4RHV1 3S7IA 3ELNA 1NLSA 4RHV3 1UU4A 2GN7A 2D6MA 4NPRA 1RUF1 2DTYA 4LBQB 1N1SA 3BOPA 1RUF3 2ZMLA 2DFCA 4XW3A 2ARXA 4YVWB 3B93A 1W0OA 2XJQA 4OHXA 4C90A 4RS5C 2OW4A 3FFQA 2WNEA 2GDFA 2XLAA 4AFDA 4UXAA 1AUYA 2JENA 4JGZB 1AX0A 3UK9A 4Y4YA 3S6PA 1UKRA 5CBLA 3AKQA 3RYRA 5JSOA 2CV6A 2CYFA 2EIGA 4EJRA 1VBB1 1V00A 2BNMA 1VBB3 3AZXA 5KXBA 2BBVA 4QXKA 4R52A 4AW7A 4KWKA 3VKOA 2IXIA 1YO8A 1JN2P 1NCRA 4H7MA 2ZJCA 4XF1A 2SLIA 2RS31 1ULDA 3WG2A 2RS33 4CEWA 5DZEA 3WHUA 4PLOA 4RD7A 2R49A 3VBFB 1ZBE1 2GNTA 4KG8A 4LE3A 4AHYA 1CAXB 4AHWA 1O3SA 2Q5TA 1I1EA 1REDA 4HLTA 3RJ2X 1QJX2 1H2KA 1LTEA 5JAXA 4N53C 1YJKA 2HKXA 1FOD2 1FNZA 5FFOC 1ZRFA 4DINB 1O3RA 1PO21 3LOIA 2CL2A 4KU8A 2OYZA 3SLIA 2ZPXA 1H1IA 3CJIC 1MS5A 4YVSA 4C91A 3QH7A 1IPKA 4B4PA 3NAPC 2G9GA 1Q8VA 1GZWA 4I3GA 2XLGA 3BODA 4AVCA 4CYDA 4PIYA 1ZRDA 1SCRA 1OI6A 4EROA 1IQAA 4QHBA 1WBLA 2YXSA 3C3VA 1J3PA 3BIWE 4YG3A 5C9AA 4YM2A 4CDQB 4AVBA 3ZFEB 4DRRA 1S2KA 4S2GA 3I2DA 2XPJA 4UW5A 1XQNA 2IXCA 5J37A 2PELA 2ZS6B 2JG8A 5LRSA 3NV3A 5KXDA 1MQTA 3LSDA 1TMF2 2Y0IA 1Y7BA 1CVNA 4Q4Y2 2VNRA 3VBRB 1LHUA 1RGSA 1MS9A 4P9WA 4G3YC 4YFWA 4BZ4A 1D0GA 2V09A 3WY6A 3AX4A 1DQ1A 3OBTA 4JGYC 4I0BA 4CP0A 1GV9A 1KS5A 1I6XA 1ZREA 2BFUL 3D0SA 3H9AA 3JU9A 1ZX5A 3RMXA 1AYM1 1LENA 4IV3B 4HFSA 1AYM3 3OF1A 1C1FA 2DCKA 5GJ6A 2A73B 4RQPB 5HXVA 2H0VA 1GANA 1QWRA 2MNGA 2VY0A 3RQ0A 2XVGA 3NV4A 3GALA 4JRAA 4AEDA 1FX5A 3V65A 1U5ZA 3AJYA 2ES3A 1H2MA 1AR82 1H8VA 2AENA 2XG3A 4AHZA 4CZSA 3LB9A 3BALA 4ASLA 4JAAA 4K20A 2B5HA 3OYWA 2G4IA 1LOGA 4XQWA 2XWBB 1B35C 5K9YA 1LGNA 1LCLA 2JDZA 3QBQA 4K9SA 1W6QA 5HCFA 1QJX1 4LHKA 1DGLA 1QJX3 3IWZA 1XXNA 4TZDA 4HKLA 2E53A 1PZ9A 1Q56A 2FQPA 3KGLA 3TBDA 1AX1A 1H4HA 1O91A 5FO9B 1IHMA 2OA2A 4OUMA 1FNYA 2XWJB 2R6QA 1RHI2 2WLQA 1O3TA 4L97A 2FMDA 4SLIA 1ENRA 1GNHA 1MZ5A 4FTEA 1UPIA 2BNNA 1NCRB 4QX5A 2ERFA 2A3YA 1LR5A 4XBQA 3WUCA 1LECA 1EP0A 1V6KA 1LHVA 1J1LA 4XTPA 3KS7A 2ILMA 4UBGA 5CFCA 2GAUA 2GH8A 3ZPYA 4GMP1 5JWPA 1D4M2 1YIFA 4N43A 4GMP3 4PBPA 5BNOA 4B7KA 1AL21 1LOBA 4DXZA 1AL23 1TMF1 3WNXA 4R9CA 1TMF3 3I7DA 4I09A 5F1RA 3WR0A 1CN1A 1LU2A 2ZX3A 4YVSB 4D94A 4QGLA 4E2SA 3TN92 3ZFFC 1GZWB 2XJSA 1XYOA 3HT2A 4W6YA 4ES9A 4LHNA 4MX3A 3ZIXA 1JBCA 5HBAA 5KHJA 4OI1A