1AYN1

Human rhinovirus 16 coat protein
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
285
structure length
285
Chain Sequence
NPVERYVDEVLNEVLVVPNINQSHPTTSNAAPVLDAAETGHTNKIQPEDTIETRYVQSSQTLDEMSVESFLGRSGCIHESVLDIVDNYNDQSFTKWNINLQEMAQIRRKFEMFTYARFDSEITMVPSVAAKDGHIGHIVMQYMYVPPGAPIPTTRDDYAWQSGTNASVFWQHGQPFPRFSLPFLSIASAYYMFYDGYDGDTYKSRYGTVVTNDMGTLCSRIVTSEQLHKVKVVTRIYHKAKHTKAWCPRPPRAVQYSHTHTTNYKLSSEVHNDVAIRPRTNLTTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 16 COAT PROTEIN
publication title The structure of human rhinovirus 16.
pubmed doi rcsb
source organism Human rhinovirus sp.
molecule tags Virus
total genus 58
structure length 285
sequence length 285
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1997-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1ayn100
3TN91 2HWB1 1R092 2WFF1 1RUH1 4YVWC 3VBUA 2R061 1Z7S2 1ND3C 4WM7C 2XBO3 1TME1 4BCUA 4CDXA 3J8F3 3JBG1 1RUG3 4GMP1 4Y5Z0 1R081 1MQTB 1B35A 1RMU1 1D4M2 5K0UB 1VBA3 4GB32 2RR11 3VBRC 4RR3C 5ACA1 1RUE3 5J98B 5JZGB 4IV3C 1COV3 2WZR3 1C8M3 1VBC3 1FPN1 1ZBA3 1HRI3 5C9AA 4WM8C 1MEC3 1ND2C 4RQPC 1RUD3 1CJDA 5CFCA 3S6PA 4CDQC 2R072 3VBSC 5AC93 1PO11 1EAH1 1EV12 4Q4V2 5L7OC 3NAPA 3VBFA 1R093 1OHFA 1RVF1 1AR72 3ZFGA 2BUKA 2MEV2 2PLV1 1PGL2 5DDJ2 4RHV2 1SMVA 2RMU2 1FMD1 1R1A1 1K5MC 1NCQC 2HWB2 5BNNA 1ZBE1 1VBB3 1D4M3 3VDDA 5ABJB 1TMF2 2R041 4GB33 4N53B 5BNPB 1FOD2 1PO22 1R082 1IHMA 5A32A 2HWD3 1H8TC 4Q4Y2 4YVSB 5CFDB 1FPN2 1EV13 4Q4V3 3ZFEA 4IV1C 1AR62 1HXS2 1NCRA 1GFF2 1AR73 3JD72 2MEV3 3LOBA 4JGZB 5DDJ3 4RHV3 2RMU3 1EAH2 2HWF2 4CDUA 1HRV1 2HWB3 2WFF3 1RUH3 2GSYA 3ZFFC 2X5IC 1RVF2 4YVWA 2HWC1 2R063 2PLV2 1AYN1 1RHI1 1RUJ1 3VBUB 4NWVA 1AL21 1ND3A 1TME3 4WM7A 5FMOS 1HX6A 2WS91 1R1A2 5BNOC 3JBG3 3J8F2 1FOD3 1PO23 1R083 1VB2A 3VBRA 4RR3A 1VBD1 4Z92B 4IV3A 1FPN3 1X33A 1PVC1 4QPIB 4CDWC 1MQTC 2WZR2 1AR63 1ND2A 4RQPA 1PIV2 4CDQA 1AR81 1RUD2 3ZXAC 1PO13 1QQP1 1EAH3 1V9U1 2TBVA 4GH4B 3VBHB 5C4WB 1QJZA 2HWF3 5L7OA 1WCDJ 3NAPB 1RVF3 2PLV3 5A33A 1FMD3 1R1A3 1NCQA 1RUI2 2Y26A 1NG0A 4AEDB 1RHI2 1VBB2 1AL22 2R043 3VDDB 5GKAC 1AR92 1BEV1 1A6CA 1AYM1 1NY72 3HAGA 1BBT1 2WLPA 4PDWC 2BPA2 2DF7A 1H8TA 2HWD2 2RS32 1AL0G 5ABJC 1VBE1 1QJY2 1POV3 1PIV3 1VBD2 5BNPC 2BFUS 4FTEA 1AUYA 4IV1A 4FTSA 4YVSC 2ZTNA 5C8CB 1OOPB 1RUC2 5CFDC 1HRV3 2RS12 1RUI3 3ZFFA 2HWC3 4JGYC 3TN92 2WFF2 1RUH2 1NA1B 1RHI3 4Q4W1 2R062 1AL23 2FZ1A 1AR93 4JGZC 4WM7B 5BNOA 1TME2 3JBG2 1RMU2 2RS33 5D8AB 2ZZQA 1QJY3 4Q4X1 1AYM2 2RR12 5ACA2 1VBD3 4N43B 2XBO1 4CDWA 1PGW1 1RUG1 1M06G 1VBE2 4CEWB 3VBOB 1NOVA 2BBVA 4RS5B 1F8VA 1QQP3 1V9U3 1RUC3 1QJX1 1PO12 2RS13 1ASJ1 3CJIC 1RUE1 4QPIC 4CEYB 1COV1 3TN93 1VBC1 1ZBA1 4QPGB 1HRI1 3DPRC 2IZWA 5A33B 1RUF1 1RB8G 5C4WC 3VBHC 1FMD2 4GH4C 4CDXB 3FBMA 4GMP3 3NAPC 1ZBE2 1BMV1 1RMU3 1B35B 1AYM3 2R042 1Z7S1 2RR13 1BBT3 5ACA3 2RS51 3M8LA 4PDWA 1F2NA 4Y4YA 5FMOL 4AEDC 1VBE3 4Q4X2 4WM8A 5K0UC 3VDDC 5C9AB 5FOJB 1VAKA 4SBVA 4GB31 1W39A 5CFCB 5BNPA 3VBSA 1CD3G 2RM21 5JZGC 1POV0 1VB4A 4YVSA 3VBFB 3ZFGB 5CFDA 1ASJ2 2R071 1HRV2 1K5MA 4JGYA 2ZAHA 1QJU1 1EV11 3IDEA 1ZBE3 2HWC2 1AYN2 5BNNB 1RUJ2 5C8CC 1AR71 4JGZA 1OOPC 2WS92 1PGL1 1OPOA 1BMV2 1NA1C 5A32B 4Q4X3 2WWSA 2HWE1 1E57A 2RS52 1TMF1 4N53C 1PVC2 1FOD1 4CDWB 1PO21 2XPJA 5D8AC 3ZFEB 4Q4Y1 1NCRB 1AR82 1VRH1 4N43C 1QJX3 2RM22 1QQP2 1ASJ3 1V9U2 2FZ2A 3CJIA 4EJRA 4QPIA 4CDUB 4CEWC 3VBOC 2X5IA 2VQ0A 3DPRA 1AR61 1AYN3 1HXS1 2BFUL 1RUJ3 4YVWB 4RS5C 1RUF3 3JD71 2WS93 5C4WA 3VBHA 4GH4A 5LK7B 1ND3B 2QQPA 4CEYC 1QJU2 2HWF1 4QPGC 1HQNA 1Z7S3 4LLFA 3VBUC 1BEV2 2RS53 3JB4C 1BBT2 3VBRB 4GMP0 4PDWB 4RR3B 4CDXC 1PVC3 3J8F1 4IV3B 4AEDA 1MQTA 5K0UA 2HWE2 4WM8B 1B35C 1ND2B 1AR83 4RQPB 1VBA1 3JB8A 2RM23 4CDQB 3VBSB 5JZGA 5L7OB 2WZR1 1C8M1 5C9AC 1VRH2 1MEC1 4FSJA 1POV1 1PIV1 2R073 5CFCC 1RUD1 1QJU3 5AC91 1K5MB 1NCQB 4JGYB 4Q4W2 3VBFC 5C8CA 1R091 3ZFGC 1OOPA 1BEV3 1C8NA 1RUI1 1NA1A 2HWE3 5BNNC 5ABJA 1H8TB 1VBB1 1TMF3 1D4M1 1AR91 1NY71 2XBO2 4N53A 1PGW2 1RUG2 4FTBA 4NWWA 5D8AA 4Q4Y3 4IV1B 2HWD1 2RS31 1VRH3 1VBA2 1QJY1 4N43A 1QJX2 3CJIB 1RUE2 1X36A 1COV2 4CEWA 3VBOA 1C8M2 1VBC2 1HXS3 1ZBA2 1HRI2 3ZFEC 3ZFFB 4Q4V1 1MEC2 2X5IB 4Q4W3 3DPRB 3JD73 1DDLA 4RS5A 1NCRC 5J96B 1RUF2 4RFT0 2MEV1 2GH8A 4CEYA 5AC92 5BNOB 1RUC1 4RHV1 5DDJ1 2RMU1 2RS11 4CDUC 4QPGA
chains in the Genus database with same CATH superfamily
2VO5A 1UWWA 1ZZ7A 3TN91 1YXWA 1R092 1RUH1 1XYNA 5CYYA 1FV2A 3VZNA 3OY8B 5IVYA 5FQ0B 4ARXA 2R061 4E4DX 3RPQA 3H8RA 2W1WA 3HN1A 4JKMA 4XYXA 2PHLA 3Q8FA 4QXHA 4B7KA 3WQ1A 4AK3A 4PBOA 5FZBA 4JV4A 4N7UA 3IN9A 1AJOA 3JBG1 1S0FA 1SLCA 4QX7A 4GMP1 4Y5Z0 2B8MA 3LD8A 3RGBA 5DAXA 2Q8DA 5LK5A 4CP9B 4AEJA 1CAVB 1VBA3 2E63A 3VDAA 1XB9A 4FO9A 1CZSA 1QH7A 5LY1A 4OHWA 4GWNA 2MNGA 3E5QA 1X7NA 1CAWB 4RR3C 2IFRA 1YIPA 4YGDA 1IKPA 3O1TA 4AGVA 5JZGB 2WYFA 2J1EA 1COV3 4IE6A 2WZR3 3USSA 1FPN1 4IW3A 1MEC3 2CU5A 2UYBA 1LOBA 2ZXQA 4IEPA 5FK7A 5FZLA 1YIFA 1BVVA 2YUEA 5J36A 3P5BA 3KHBA 1ENSA 2D5FA 4KMQA 3S6PA 2QFEA 3SCGA 5T5PA 2WSUA 5KXBA 1O3QA 3AVSA 3U10A 4AVCA 1F5JA 1EAH1 3MO4A 1HV1A 5FTTC 1ULDA 3Q8AA 4CXXA 3I2KA 4EE2A 1ULPA 2XLFA 1R093 2GC0A 2RV9A 5GZDA 4R8HA 3KVBA 1OMIA 1SACA 1OHFA 2YBKA 1OBNA 2DU0A 4QGLA 4ZY9A 2MEV2 3WP3A 4AHXA 2O14A 1ZYBA 5DDJ2 4QQOA 1SMVA 4LE4A 5FBZA 1T2XA 2YG0A 4XBQA 4NHXA 4BHPA 4TSVA 2UWAA 2WL1A 2JG9A 2WNEA 3LIHA 2Z69A 3R05A 4MHRA 5ABJB 4DOUA 1A78A 4XUQA 4FAHA 1F4AA 1RITA 4G4FA 4LNVA 2K9ZA 4CCMA 5BNQA 2XDVA 1W3VA 5FZOB 3N7KA 3WG4A 4AVBA 3VKOA 1OF4A 1W05A 5DAWA 4FPLA 1H8TC 4Q4Y2 3FLTA 4YVSB 2E7AA 1LOEA 2XHNA 3S30A 4CCLA 5KHKA 4GWIA 1ZX5A 5T54A 3AMHA 3LSEA 4UYBA 3UKTA 5CFDB 1VP6A 2VMEA 3CLPA 3E5XA 5JI7A 2JJ6A 1FPN2 1JZ4A 4ZU7A 1JBCA 3ZFEA 3AP4A 4OLLA 2VZ3A 4FAGA 4BQ2A 5JAXA 1XSRA 1UZWA 2EXKA 4FXKB 5DUXA 1OH4A 3AJZA 3VKFC 3FJSA 1CAUB 2MEV3 3A0NA 3D0SA 3K77A 3KQ4B 4Q8LA 2EIEA 4WVVA 5JR2A 3LOBA 5DDJ3 2BNMA 4TLFA 1HW5A 4UOJA 5AFBA 1EAH2 2IXLA 2AEYA 3RZGA 1GR3A 2JIJA 2WUHA 4K3UA 1RUH3 2PTMA 4W6XA 1SQ4A 3DL3A 3ZN6A 2R063 2WA3A 2V4AA 4YW5A 3WOGA 3B5LB 1JZ5A 4UXAA 5FMOS 4F8AA 2WS91 3L2YA 4UI9L 1QEXA 5FV3A 3JBG3 4IEXA 3B69A 3E5UA 4K8FA 3H1MA 5JMOA 1IPKA 2FDFA 2EIDA 3LEMA 4QQPA 2XUEA 1CAXB 2C5DA 3EBRA 5KC5A 2EIGA 3K75B 3OBTA 4FP3A 2B9UA 2W94A 3DKWA 3RMYA 4FBFA 4L99A 2BVVA 1ZRCA 4RR3A 4OHYA 2BNNA 3BI3A 4O65A 1HB2A 5DG1A 5DN2A 3WDWA 4PF1A 1FPN3 3OPTA 1JZ8A 5FP8A 2PQSA 4QPIB 3I2FA 1N1YA 3WX5A 2L9LA 1SEFA 2K0GA 3WDUA 1XE0A 1W8TA 2VZ1A 5LRRA 1F15A 3GCWA 3N7MA 1PIV2 5FZKA 1AR81 5F2SA 1F35A 3I2DA 1RGSA 1V9U1 1EAH3 2GC3A 2GZWA 2UU8A 3NQHA 3VV1A 4BMBA 3O12A 1NQJA 3AP5A 3NV4A 1DZRA 1SCSA 1OQDA 5FFOC 1H9WA 3BALA 4CSWA 1W2TA 1L7LA 1NZIA 4OQ8A 2BQPA 5TSWA 3I2IA 5CU1A 4EN6B 1AZDA 1RUI2 2GNMA 4LK7A 2OT7A 2Y26A 3E97A 1NG0A 4IEWA 4LBQD 4AEDB 3I59A 5LW9A 4V2WA 4AVAA 1IKQA 3SLIA 4OI0A 5KHIA 1ACCA 1VMFA 1RJ8A 1BEV1 1A6CA 1AYM1 1HDKA 5I0TA 1LR5A 5FPZA 2K46A 4DUXA 4HBNA 3ELNA 3ZXKA 4B1MA 1S0EA 1GQHA 4LO5B 4YZ3A 1WLDA 4XMIA 1H8TA 5CBLA 3NMBA 1DP0A 1HB4A 4HOOA 5ABJC 3N9OA 4V2VA 1X8MA 3TBDA 1EUTA 4JZRA 4RSUA 1PIV3 5FPVA 1A8DA 2V4VA 4LO6B 3ZO0B 2AACA 5FBJA 1GWKA 3ZN5A 1UXXX 1XRUA 3LE0A 5SV8A 4BK4A 1Y9GA 2GDFA 4YW4A 2YC2A 3AMMA 3IDAA 1G7YA 3VD5A 1ST8A 3GDBA 4G3YC 4ZU4A 5FZGA 4HPKA 4YVSC 3IWZA 4DUVA 2LROA 4MSVA 4NUBA 5FO7B 3LAGA 2J1RA 1ODNA 4LO8A 3KB5A 2VNOA 1G9FA 5CFDC 3I2GA 2HJIA 3V0BB 2RS12 2DCJA 1H8VA 3R4SA 1RUI3 5FREA 3T0BA 3T2OA 2E26A 1SFNA 4JGYC 4XTPA 4CCOA 1C4RA 4Q0SA 3TNQA 4Q4W1 4QPWA 3E6CC 3TRSB 3P1IA 1AXZA 2Q30A 1QOOA 1T6BX 4LULA 3WHUA 4WM7B 1W9YA 2D98A 3IAQA 1PMIA 4LA2A 3ZX7A 4NIGA 4R4XA 1DYKA 5A6YA 2Q8OA 4LKSA 4P9GA 1ALYA 1MR5A 5FLHA 2YU1A 2RG4A 1RMU2 3OY8A 1K45A 3C7GA 5FQ0A 4QKBA 1V6IA 4I02A 1JI6A 1AYM2 1YFYA 3T4VA 4ONUA 5EIYB 2XXZA 5ACA2 1GQPA 4N43B 1OVPA 2A3XA 1RXGA 2ORXA 2XBO1 3GBWA 1GMMA 3B9IA 4M01A 5BUVA 5CG8A 2W3JA 4IEOA 1ZRFA 2JDUA 4IXLA 4YM3A 2QQIA 3HQRA 4I30A 3VBOB 4A42A 4HT1T 2RE9A 4QPYA 4XE9A 2ZOEB 1O7FA 1YQ6A 3AZXA 3ZXDA 3H7YA 4AF9A 1V9U3 4XC9A 1HN0A 1NQDA 1UPSA 3ON7A 4LE3A 1W06A 5F5QA 4E2SA 2H0VA 1QJX1 1PO12 2RS13 3CJIC 1UY1A 3MDPA 3LB9A 4QPIC 4UFHA 3ZXFA 4COUA 4XCAA 1ZBA1 4EWAA 1JMUB 3O7OA 3RZZA 1XNAA 3PUSA 2CAVA 2W0XA 1MS5A 1QH6A 4A3XA 1W8UA 4JX0A 5FYMA 5A33B 2QQVA 4FOVA 3VHRA 3ZMOA 1FMD2 3T30A 4W6WA 3AMNA 4MXVA 1SDDB 2J1VA 3FBMA 2XJSA 4NIIA 1S0JA 4CPBA 4AFBA 1ZBE2 4Y26A 5L9RA 1RMU3 5JOYA 3PMEA 1S1AA 2W5FA 2X10A 1YO8A 1AYM3 2R042 3K2OA 1Z7S1 2WLQA 5IVFA 4QX5A 3AKRA 4OZXA 5ACA3 2P34A 2WRAA 4GQ7A 1O3SA 4XFHA 3M8LA 2P3KA 5LZ6A 1JH5A 3MV11 4XF3A 5LEJA 3KM5A 5JLVA 1GICA 1O4TA 2CWMA 5JPNB 1UY0A 4K7JA 4AEDC 2EXIA 4WM8A 1Y9MA 1WCQA 5C9AB 1G9AA 1M4WA 3C7EA 2VW2A 3WW2A 4SBVA 4OUMA 3DYPA 1W39A 5CFCB 3ZSJA 3O5SA 4L97A 1CD3G 2VUJA 3WNPA 3WNKA 5CADA 1KS4A 4XCBA 2FBEA 1W6QA 1POV0 1HV0A 4KQ7A 4QDSA 3ALQA 4YVSA 3UK9A 1LESA 4NN0A 1OFSA 5F3IA 4K9SA 2RDRA 2QQOA 3ZFGB 2I2SA 4HN1A 5CFDA 3IAPA 4GA9A 1UIKA 5FYYA 3MW2A 1QU0A 4GJZA 3APBA 4AVSA 1HRV2 4NOTA 1I9RA 1K5MA 1XU1A 4JGYA 2ZAHA 2XWBB 5GZGA 1ZBE3 4A7ZA 1JHJA 3WUCA 2BDRA 4Q0VA 4Y5TA 4ZU5A 2ILMA 4BU2A 4BJ0A 5KWRA 1AR71 2WT0A 2FQPA 4TN7A 1PGL1 1BXHA 2D6NA 1E5RA 3J4UH 4IESA 5C3RA 3WF3A 2C0ZA 3NV2A 3Q8EA 4FOYA 5FO8B 3BTYA 5KXCA 2RHPA 2HEVF 4QKDA 1K12A 4MH0E 4CU6A 4S2GA 1I5PA 2P2KA 2WWSA 4FOWA 1DZQA 2A7AA 3TAYA 3POFA 5FR3A 1TMF1 5IJRA 2VQTA 4KGQA 2RJKA 4COVA 4R9BA 3ACGA 1OUSA 1PVC2 4LQRA 3ZYFA 4CDWB 1CAXA 5FYVA 4E4ZA 2XPJA 1FYUA 2Z79A 2D3RA 4ES9A 4HANA 5C3OA 2VOWA 4NRMA 4AHWA 5L36A 1CVNA 1S2BA 4DQAA 4N43C 3I49A 4AAXA 4UBGA 1QJX3 3Q8BA 1WWYA 2VCCA 3CJIA 1WMEA 2NPIA 2WN3A 5IUQA 1IS4A 4QPIA 4P9IA 2QQLA 4NHMA 5FP3A 3AYEA 3NNLA 3VBOC 1YI7A 4QU2A 1WD4A 2Y6KA 2VQ0A 1AR61 3OD0A 5C5TA 4ES8A 3JD71 4XMAA 3MW4A 3H8XA 3M7AA 1JYCA 3POYA 4CUAA 1ND3B 4UW5A 2ZHKA 5FYCA 3FX3A 3NWKA 2UURA 2RDSA 3KV5A 4HONA 4ASKA 1N1VA 2GH2A 3HD8B 2D6LX 3ABZA 4I0AA 3ZKYA 5A3WA 3HMYA 3WQ0A 4J1WA 3PURA 4XQWA 5T50A 1Z7S3 3SKVA 3E6BA 1W03A 1LECA 2OQ6A 4BYYA 4AGGA 4GD4A 4NVPA 1BBT2 1N3QA 3BPSA 4GMP0 5IT6A 4YZ5A 3B7MA 5IATA 1PVC3 3J8F1 2JWPA 4IV3B 4AEDA 2WN2A 1JU3A 4PHZA 4LKEA 4AVVA 4XFGA 4QWNA 1BQPA 1ENXA 4KU7A 1ZZ9A 2P1BA 1GWMA 3U14A 2BYVE 4GZ9A 4CDQB 4RYDA 3VBSB 1H4HA 3CBNA 4QX1A 3J7NA 3POWA 2CHHA 4ITCA 5L7OB 4LBMA 4MG2A 2J7MA 3VD9A 5C9AC 2ZKNA 3V64A 2FMYA 3M2MA 4IL7A 1FAYA 5CFCC 2VMHA 4M4PA 2YB7A 1IZ3A 1MZ6A 2ADDA 1KS5A 4LBQB 2WZPP 3IMNA 1FX5A 3UJOA 5L9BA 1ENQA 2W52A 5LWBA 5CA6A 2NMNA 3MICA 2JDMA 5IFPA 5IVJA 5FYIA 2JIGA 3T0AA 5F6LB 4Z2AA 5C33A 3ZFGC 3BKZA 4MLOA 4CXYA 2C9AA 3HPNA 1SLAA 5F3GA 4F83A 3V0BA 4OI2A 3H42B 1C8NA 1XYPA 3M3EA 3PJYA 4XURA 2LW8A 5C3SA 1W6MB 3SH4A 3ES4A 3ACHA 1VBB1 3RZKA 1TMF3 1D4M1 2JKXA 4XF4A 1WGPA 4QXCA 1AR91 5LA9A 1H1MA 1NY71 4NRPA 3WP6A 2ZGQA 1LHVA 4QHBA 4XDQA 3DYOA 4Z82A 1RUG2 1OA4A 2PYTA 4XFBA 3PTRB 3VD3A 2XQXA 4AEMA 2QQMA 3H0OA 2ZABA 4IV1B 3PUHA 4OFGA 4AEKA 2HWD1 2RS31 3I4IA 2ZGNA 3I3DA 1S0BA 4A2UA 1QJY1 2W1SA 4N43A 4CP2A 1PZ7A 4C0HA 2R6QA 5LA1A 1UOBA 1WUVA 2B4KA 2RVAA 4FPCA 4NO4A 1RUE2 2I45A 3ZPOA 1X36A 5FZIA 5DZEA 3VBOA 4XXAA 2DTYA 1HRI2 1OF3A 1QF3A 1JZ7A 2X5IB 4NR1A 3JD73 4XIKA 5H9PA 1I1EA 5L9VA 4NE9A 2BWAA 3ZDVA 4META 1O8SA 2VD7A 4QM8A 4RFT0 4K6BA 4Y4RA 1PK6B 3MLLA 2WKKA 4LMFA 1IGOA 4PI2A 1G9BA 3TWIA 2DFBA 4JQRA 4HFSA 1PHMA 2ZHNA 2GP5A 3POGA 1GP4A 2AUYA 2X53S 3MW3A 3CEWA 1DGRA 4JDOA 2MHFA 1V0AA 2LALA 2ET1A 1ND3C 3D5OA 3MPBA 4BQWA 1TME1 4QX8A 4BCUA 5I0DA 4Y20B 3J8F3 4Y5SA 5FZMA 2YXSA 1RUG3 4D6SA 4XBNA 4ZKTB 2ZGRA 1D4M2 3U1XA 5HXMA 4KI5M 1CWPA 2VVDA 1QGLA 3BTAA 1GANA 3QH6A 1D7PM 2RR11 3FLRA 3PVEA 4GB32 2NLRA 4LBLA 3FLPA 3ZSKA 1RUE3 3KWVA 5J98B 4IV3C 1WW5A 3P6BA 3U78A 3H9AA 5FWEA 1HRI3 2R0FA 2VUDA 5C9AA 1HB1A 2XL9A 1ZA7A 4Q27A 4QQLA 2OYZA 1W3XA 4CYDA 3USUA 2I74A 2DVGA 2G19A 3OUHA 4LKFA 4AI1A 5FZDA 2ZMLA 4COZA 4IE5A 5CFCA 4CDQC 2W1QA 3VBSC 4Q0PA 5CKQA 3I3BA 5DAVA 1J58A 4MO3M 5DAPA 4NHYA 2VAUA 5L7OC 5I93A 4CTEA 3NAPA 3BIWE 1U5IA 4YGCA 5FZ8A 5FZ7A 5LBCA 3CO2A 4GULA 3ZFGA 4C0BA 2JDNA 3OBZA 4P14A 2XG3A 2PLV1 1YWKA 4PLOA 3O1RA 5CB7A 2D40A 4M0HA 1I6XA 2OPWA 4XQDA 5IW0A 4B29A 3OB8A 1VBB3 2WO1A 1JZ6A 1D4M3 4LO4B 4XUTA 3VDDA 3MLJA 2XJUA 1US2A 2ID4A 3GHMA 4GB33 5APAA 3K51A 1W04A 4N53B 3E1F1 5A3PA 1FOD2 3H3UA 1PO22 3WNLA 4M3CB 1IHMA 3D4KA 4AWDA 4YARA 2HWD3 5LBBA 1OKQA 2C6SA 2WT2A 4XJUA 2B42B 4XIOA 1SLLA 4C1WA 1UMHA 2BVBA 2N7GA 3K48A 2NN8A 2A6VA 4NPMA 2JICA 3J7MA 3MUZ1 3LWCA 2EIBA 1OQEA 4X6RB 2DUQA 4IV1C 4WBBA 4EN0A 1H0BA 3C7HA 1HXS2 3MUY1 3VN4A 2F4LA 1GFF2 1W9SA 2PHFA 2YPDA 4KL1A 3AM2A 2BOIA 2HEYF 2OZJA 4R9AA 2CSGA 1V6MA 2YZ4A 1W2OA 1NX9A 2WNVB 1YHFA 4I0BA 2BZDA 3LKJA 4P9JA 3S7IA 1AXKA 4UAPA 2X5IC 4CU7A 2PLV2 1AYN1 3AMQA 1RHI1 3VBUB 1ND3A 1TME3 3C2UA 2PAEA 1HX6A 1H2LA 1PK6C 4YWAA 2WSVA 3NKTA 5HI0A 2J22A 3MIBA 3THCA 4YZ1A 3RI8A 1FOD3 1PO23 2VVFA 2XJPA 3WNNA 2WT1A 4FPFA 4K21A 2IXKA 3RYPA 1J1TA 4XPVA 2YC4A 1G8WA 5FMDA 5EJ1B 3PLQA 4MGSA 4XXPA 1VBD1 1ZZ8A 2TEPA 4IV3A 1W2UA 1ZA4A 5B4NA 3RDIA 1TNFA 4BQ4A 3SISA 4BB3A 4GALA 2WZR2 2VW1A 2P4EA 3MV01 3NJZA 3OPZA 3MFCA 4H7MA 2BWCA 1W99A 1JYVA 2YY1A 4QX2A 4YW7A 3B00A 4DIQA 2FDHA 2Y60A 5LY2A 1GKBA 2DBNA 3ZYJB 2WQ8A 4LLOA 4YGBA 4CDQA 4LBKA 1DLCA 1KFXL 1QQP1 4CCNA 4E8DA 5C4WB 3FUOA 4UFKA 5L7OA 1W2AX 1UQXA 5FY7A 3BCWA 2Y6FA 3HQUA 4NROA 1B09A 1SHWB 5EHDA 2JDHA 5B2GB 2PLV3 3BPZA 5EWSA 5A3TA 4PQQA 4Y33A 5IK5A 3MIGA 3VD7A 4LBQA 1BK1A 4UFJA 3WR0A 4H7LA 1CESA 2ZX1A 4D6QA 4LPLA 4EN9B 5IYYA 1J3PA 3WD5A 3IB3A 5E1RA 3AK0A 1RHI2 2DVBA 3CU7A 1UZZA 2J1UA 4S2DA 3KCCA 1ZZCA 1S0CA 1ULFA 4A4AA 5E6HA 5A7QA 1PM4A 2DTWA 3ZLIA 1LENA 3A23A 3DV8A 3ZR6A 1LKNA 5K7PA 2BGCA 2BPA2 2DF7A 3BOPA 1EPZA 1W6MA 1QNWA 2JKBA 2ZHLA 3KZ4C 4Q0UA 2G9ZA 3FHAA 1AL0G 4MOAA 1VBE1 1DFQA 3CHXA 2E32A 4A6OA 3GCXA 1POV3 2OXBA 4FFGA 1VBD2 5F39A 2XJVA 2BFUS 3ZSLA 5CKNA 2H6BA 2TUNA 4AI8A 1XBFA 2HKXA 4IV1A 5CKMA 4EZ4A 1YEWA 1OD5A 2BV4A 2E7QA 4FPJA 4O7XA 3JU9A 5C8CB 2GMEA 4P9WA 3FE5A 4XABA 5K8SA 1RUC2 1OKOA 2QE3A 4MXWB 3ILNA 4XJWA 4XDOA 3TB0A 1GQGA 2W87A 1OSGA 2VQUA 4RD7A 3TN92 2WNUB 5EXOA 5GALA 1RUH2 1NA1B 1RHI3 5A6QA 4WV8A 5T5LA 2R062 5JSOA 2BEOA 4GJYA 4WVMA 4IGQA 3OSDA 4NPRA 1PK6A 4BQYA 4P5YA 2WNVC 3NW4A 3SEEA 2YBSA 3JBG2 1IPSA 1UU4A 1YUDA 2LTNA 4XUOA 3HN3A 2NM1A 2R49A 2Y34A 2CYFA 5DUWA 4Q4X1 3AXDA 5KR7A 3UV9A 4CCKA 2YYOA 1VBD3 2VBBA 2LS6A 5FY9A 5FXWA 5JIUA 4KWLA 3C3VA 2PMWB 2B39A 1O3TA 2V73A 2XJQA 2AC1A 1FNYA 1VBE2 4CEWB 2DCTA 3UKVA 5K4LA 1W0PA 2E9QA 1KFUL 1WMDA 2HEWF 2A6XA 1QQP3 3K4ZA 5JOXA 1RUC3 3VZLA 4TTGA 2VXJA 3FC0A 1ZZ6A 4NMIA 3PL0A 5E8AA 3WUDA 3RWNA 5FYTA 4LBJA 1LGCA 3TN93 1CIWA 3ZOIA 1VBC1 1JW6A 1PZ9A 1K5JA 4X8NA 5F5CA 3AFKA 2YBPA 3DPRC 3S7EA 3CNAA 3GBFA 5FZAA 3MZHA 2IZWA 4COWA 5C71A 1JYIA 4NPLA 5EV7A 5FPAA 4Q8KA 2OVUA 5C4WC 1DHKB 1EYBA 4OULA 2VCBA 4CDXB 2YFZA 3KHCA 3LSDA 4GMP3 5FP4A 1DQ4A 3DECA 5GLZA 1YJKA 1H1AA 1B35B 4L0PA 1R1ZA 5KXDA 4AL9A 4YGEA 3KT7A 1PM7A 2WAOA 2JB4A 2QDNA 5DZFA 2QZ3A 1I5ZA 4J6GA 4WVZA 3ETPA 4HSJA 1PVXA 3AP7A 3THDA 4BH9A 1V6KA 1C5IA 1UOGA 2G1MA 5FMOL 1VBE3 2PAMA 3BYWA 3H1YA 4J1XA 4Q4X2 4IEUA 4W65A 5EPAA 2JD4A 3ROUA 3M70A 1OLME 3OD4A 4A41A 2WYSA 3EXUA 4FPGA 3NNMA 3T3YA 1Q56A 2BRTA 3IDCB 4HKLA 4M3CA 3IPVB 1J3RA 3ZYPA 5JZGC 2OIIA 3VZMA 4XVHA 1H2MA 4MGQA 4AI9A 1NLQA 1AVBA 1VB4A 5FZFA 1PNFA 1P8JA 4UFMA 3EJKA 5HV0A 4HL0A 3F95A 1U5ZA 4CUBA 1XSQA 5IFTA 3VB9A 2DVAA 1UOFA 4RL7A 4URTA 5EYXA 5GZCA 2R071 4XBLA 5ERLA 1GOGA 1JS9A 5C6CA 4Y3OA 1HIXA 3S5QA 4H14A 1EV11 2ZJCA 4AI2A 1REDA 4Z1VA 5BNNB 4MUVA 5C8CC 2O0OA 1IS3A 5F5IA 4BLIA 3EHKA 4LA3A 2VOTA 2WS92 2VMDA 2WNVA 5A3UA 4LHLA 3UKNA 3K4AA 3NV3A 1LULA 4ARYA 2ZBJA 5ISLA 3SH3A 2Q1MA 4P08A 1SBEA 1NA1C 3W5MA 5A32B 4Q4X3 3HT2A 2XWJB 1JHNA 3RZLA 1E57A 3C8XA 2PN5A 3LA2A 2VW0A 2AYHA 3NRUA 4ATEA 1CIYA 2H0BA 1A8MA 1YYNA 4OMDA 1AX2A 4H3WA 3BN6A 3NNGA 4C8DA 1URXA 2FDJA 1UX7A 2JE8A 3RJ2X 1XJAA 1HN1A 1AR82 3GM8A 3GJAA 4JHTA 3VL8A 4XFFA 5A70A 1V9U2 5HCAA 3VDBA 4QKNA 3T4HB 2WWJA 4YG0A 2R30A 4CEWC 4BPZA 4IEYA 1W90A 2OZ6A 4NAMA 4XQ4A 4BZ4A 3DPRA 5EFUA 4YW6A 4DXTA 2CNAA 5FY4A 3FHIB 3KLSA 1NZCA 5F8PA 5EJ3A 2WS93 2IXCA 5C4WA 3WDXA 2AH2A 4M3CE 1UZYA 2DDUA 3UGFA 3GZAA 3VHPA 2HWF1 2W46A 3WP5A 1K3IA 1MS3A 4DNYA 3A7QA 1HQNA 1UO9A 4YZ4A 1AJKA 1TVGA 4YZ2A 5FPLA 3J26N 1BEV2 4R9CA 3H8UA 3VL9A 1DGRN 4LBNA 4I09A 1JZ2A 2VZSA 1CJPA 4PDWB 3VBRB 3MIFA 4CDXC 2ET7A 3KT4A 1WA6X 2JDAA 4OUEA 2QKDA 1MZ5A 3HEIA 1NKGA 1WBLA 1O59A 2GAUA 1XC6A 2XGXA 3THTA 1LAJA 1B35C 4CP9A 1H2NA 1CAVA 2GMMA 5GZFA 4DZGA 3BGAA 2ZZJA 4HN0A 1AR83 4RQPB 1W9WA 2P3YA 3OGRA 1CAWA 5GLWA 2YU2A 5BXXA 3RJRA 3U4SA 4IE0A 1J59A 5DPNA 5JZGA 3RZJA 3ZIWA 3O0VA 1YI9A 1NAEA 4IUGA 4CCCA 2E7TA 4QGNA 1JOPA 4MVTA 4NHKA 1IG3A 1VE0A 5E88A 4LIUA 2YFUA 1ZVFA 3WDYA 2XHKA 2R073 4LT5A 1RUD1 3FWEA 3OBAA 1GP6A 5EQUA 2E33A 1L7RA 4DUWA 4XHBA 2X29A 4PI0A 1NCQB 3HQXA 1XXNA 2ZGPA 5FPBA 2GC1A 4Q4W2 5C8CA 2JD9A 5FKCA 3OTFA 1T6GC 5HCFA 1BEV3 2Q1FA 4DMIA 1ZRIA 4MXWA 1H30A 2IXHA 4HZFA 2A3WA 3PU8A 4CUGA 4TWTA 1LRHA 2HBTA 1SPPB 1NA1A 2XJTA 3PJQA 2E6VA 2ZCWA 3RS6A 3SEPA 1KITA 3W59A 5BNNC 5ABJA 4RGGA 3LF7A 2VZTA 4IEQA 4ATFA 4QXBA 1X82A 5BV6A 2XBO2 3FZ3A 4FXGB 5GLVA 3WEZA 1HB3A 1QY4A 5FZOA 5BY5A 2OW4A 4BDVB 4NHLA 1C57A 3RYKA 4FTBA 4E4HA 1E5IA 4Y1YA 4COYA 5JSRA 5FMCA 2WWUA 1Q8SA 2Z2SB 3HNMA 1OPMA 4RN5A 1TQ5A 5FRAA 1H4GA 3C7OA 5F2WA 2X09A 1QXPA 3WQ7A 1QJX2 4JRLA 3M4FA 4GKXA 5J37A 5FYHA 4CEWA 1ZBA2 1I3HA 1W8WA 2SBAA 3LZZA 3OGSA 3WF0A 1ULCA 3ZFFB 4Q4W3 3ZDSA 1CAUA 5LA2A 3EB7A 5J96B 1D0HA 3W5NA 4OHXA 4DO0A 2GH8A 1UOJA 3DYMA 5LCWL 2XVKA 5CISA 4JVAA 1MS4A 1UNBA 4RHV1 5BNOB 2RMU1 4JC1A 3HBZA 3WW3A 4XAAA 4BIFA 5EYYA 4P5HA 1Q8PA 1WCUA 2HWB1 1LGNA 1OVSA 2VNGA 2WFF1 2VZVA 4DEQA 3OEBA 4BK5A 5A1AA 1Z7S2 3IBMA 1W28A 2YMZA 5JIAA 1MS9A 2A6YA 1MS0A 2JXAA 1UY4A 2O1QA 2ZX4A 2PXJA 2XBO3 3O0XA 4QB2A 4WM7C 5ANQA 4CDXA 5JWPA 3FL7A 2Y38A 3NL1A 3X29B 3PVOA 4B3NA 1GU3A 1HLCA 4U36A 2BOJA 1MQTB 1B35A 2WQ4A 5K0UB 1GZTA 3ENRA 1CQ9A 2NMOA 1FATA 1DG6A 4QM9A 4YSFA 2J1SA 2P3IA 3WG1A 2VZRA 1U12A 2PHUA 3VBRC 1XE7A 3CL1A 5C3PA 3H8OA 1Q8OA 2D43A 4I0WB 5A3LA 1TZOA 4XW3A 2A73B 1S2KA 2D97A 1NXD1 5G04L 1ZBA3 2E51A 4K1YA 3RFRA 2X8KA 4Z2WA 2XVLA 3R0RA 1SCRA 5AVPA 1TNRA 3PDQA 4L8QA 4ORFA 5K9YA 4RQPC 1RUD3 4DRVA 4QKFA 2WO7A 3G7DA 4YFWA 1DBNA 3ZKUA 2B9VA 2UY9A 1UU5A 4AFAA 5IAXA 2NZ9A 1Q8VA 3JQWA 1VRBA 2XKPA 5CVRA 4DB5A 1BLZA 1DQ2A 5FY0A 1AR72 4GAZA 4OZOA 1FI2A 3K3NA 3MF9A 1PGL2 4LIVA 1NXMA 2YPJA 4RHV2 1OFNA 2RMU2 1N3PA 3ZSMA 4L2NA 1R1A1 4GWMA 4YLZA 3V0AB 1NCQC 1WKYA 2HWB2 3SC7X 1GZWB 3ZXEA 2HH9A 2VVEA 3GGLA 5BNNA 3NVCA 1W6PB 1VAMA 2OA2A 2Q5TA 2WC2A 3DCQA 2XKOA 3QH7A 1TMF2 3WT3A 1WLCA 4XUNA 4KNCA 1UYYA 1W8ZA 2IVJA 2EAAA 5BNPB 3IMMA 1VJ2A 3EYPA 5A32A 2QUOA 4D69A 1N3OA 3ZMNA 2G9GA 2NYYA 4HVRA 3M3IA 3KT1A 1BK0A 3L2HA 3OBRA 2VOKA 4LOSA 3KF5A 2GP3A 2UYAA 3OF1A 4D7SA 2DUPA 3I3MA 3U0ZA 4YG3A 1AR62 4BOWA 2Q8CA 4CXWA 1D0GA 1AR73 3JD72 2XLAA 4JGZB 1VR3A 4RHV3 1L7QA 1KD7A 2RMU3 2PAKA 2YDEA 3AZZA 3RRDA 1OA3A 2HWB3 2WFF3 4PLNA 2GSYA 3R6SA 3ZFFC 4ZHNA 2VH9A 3B94A 2HWC1 4EZHA 2VZPA 4QQHA 3B93A 1RUJ1 5FZ4A 1AL21 1JODA 4WM7A 3BOWA 3HBKA 1R1A2 2VY0A 1JUIA 1S4CA 4UW4A 1C3HA 1KDMA 1TEIA 5BNOC 3U4XA 2RJLA 3LEIA 3J8F2 4XFAA 1BYHA 2WZ8A 1G9DA 1UY2A 2Y0IA 4AI0A 1XYOA 4BM8A 4DEVA 1W9TA 4CPBD 4NIHA 3NO8A 3VBRA 3ILRA 3N9NA 1NT0A 4IDZA 5JVVA 1OC1A 4Z92B 5GZEA 3ME2A 2P6HA 4MV2A 2DCZA 5DABA 3V56A 1X33A 4B4QA 4CDWC 1FT9A 4XOGA 1MQTC 3WNOA 1AR63 1EY2A 2CV6A 2D6PA 4RQPA 4CCEA 1YFUA 2C4XA 4AG4A 4CVUA 1XNDA 3JZVA 2TBVA 3VLBB 1WCDJ 2VZQA 1JU4A 2W1UA 2GN7A 4QDRA 3CJXA 5F3EA 4XEZA 3AB0A 3KGLA 5F5AA 3MHZA 4PIXA 4QU1A 3GYDA 4EV0A 2CDPA 4IEZA 5A33A 3VHNA 1LOFC 1BCXA 1K42A 1R1A3 3MFAA 5DAQA 2WQZC 4ISQA 1GOHA 4PCRA 2IUWA 5I8TA 1NCQA 4QD2A 1EPWA 3W20A 1NLSA 2C26A 2AGSA 1NYWA 3LA7A 3NV1A 4LXLA 1LU2A 2RDQA 3LPGA 2FCTA 2JG9B 4NAOA 2VC9A 1VBB2 3WF4A 4QB6A 1AL22 5J09A 4E4SA 1A34A 2E53A 1AR92 1NY72 1LJ7A 2ARXA 4UBHA 3HAGA 3D3AA 4YW3A 2YHJA 4UFLA 3TEZA 4TXWA 2Y6LA 2WR9A 2YV8A 5F9TA 1JYWA 5T5JA 1Q3EA 1WCSA 1JOBA 1Y9QA 4FPOB 2HWD2 2RS32 2TNFA 2VR4A 4LOTA 2DYCA 4ZS3A 3HVDA 3WDVA 1PZ8A 4IQPA 1QJY2 2ZGSA 5L19A 3O1MA 1LEMA 2UWBA 2ZACA 1WZXA 1V00A 4AFDA 2VULA 3ZYRA 4FFHA 3T2PA 3EQEA 3AKQA 3WNXA 3TEYA 2DURA 2O8QA 5D2AA 5BNPC 5A3OA 5A6ZA 4OI1A 4ASLA 4HSLA 3SMHA 2VUCA 1DGWA 4GIQA 4HLTA 3O1PA 3HJRA 3BUCA 4FTSA 2ZGTA 1RC6A 3J7LA 2ZTNA 5A6XA 2CDOA 2JE7A 1BJQA 2XLGA 5B4XA 3ZYBA 1X9TA 1W6OB 4ZONA 4CA9A 4DY5A 5JXJA 5IVVA 4H2AA 1VIWB 3N9LA 2K2SA 5LA0A 4BXFA 1YJLA 2FHRA 4OVEA 3ZFFA 4LITA 2FDIA 1QOSA 2HWC3 1N1SA 5FYZA 2WO2A 1H6YA 2D6OX 3OOXA 4YG6A 1DYOA 3ZN6B 4CUCA 5F3CA 5FWJA 2VJXA 4OCTA 3GBGA 1AL23 2WZEA 4ET7A 4OMCA 4RA0A 4UT5A 4UW6A 2FZ1A 2OQ7A 1AR93 4JGZC 4NIAA 4UF0B 2ZX3A 4A44A 5BNOA 1Z0HA 1TME2 3RI9A 2BNOA 1DLLA 2KD7A 2A6ZA 2Z4FA 3OG2A 1SLIA 2BJSA 3DUIA 3J7HA 3I8TA 4S2HA 2ZEXA 2VTXA 3S0MA 3LCPA 2RS33 3C7FA 3KV9A 2ZZQA 4BMEA 4F7ZA 1QJY3 5FUNA 4XTMA 3A22A 2RR12 2Y6JA 3BTXA 2VG9A 5CNAA 1BKZA 2E31A 2VNVA 2BGOA 4B7EA 1SG3A 3FN9A 4QAWA 5BPXA 5FP7A 4CDWA 4XDPA 1PGW1 3B02A 2ZX2A 4IGOA 4BA6A 4D94A 1M06G 1H9PA 3T09A 4FVVA 4H55A 4IETA 4DXZA 2ZKLA 3VZKA 4AQ2A 4XZPA 1F8VA 1QXJA 3AYAA 4IE7A 4JDNA 2GALA 1CR7A 1UY3A 4CEYB 1YCIA 4Q29A 1AHSA 1COV1 1US3A 3KQRA 4XILA 4QPGB 1XNKA 1LCLA 4LBOA 2G9FA 3SNMA 1LOFA 1PX4A 1RUF1 1Y7BA 4AOCA 1RB8G 3E6DA 4JCKA 1MVQA 2DCYA 4JKKA 1KGYA 5FIXA 2F6BA 2OS2A 2PELA 3I59B 1CPNA 1WW4A 3WNMA 1UL9A 5HXVA 2KM2A 4AE2A 3HOBA 5ANNA 2RR13 2C1FA 5IWFA 3PIJA 2VUAA 3WINE 4C1XA 4FPHA 2RS51 4YM0A 3MPPG 1QDOA 2BU9A 2JENA 1F2NA 1GZWA 2JDKA 1F4HA 2AZ5A 1GNZA 2R16A 2JG9C 4Y4YA 4O61A 2V72A 3VGIA 5KXEA 5FOJB 1YQ8A 2C24A 3LDKA 4OYUA 1ULEA 2WDBA 2WJSA 3LOIA 3GNEA 1GZCA 1W0OA 2JX9A 1QOTA 2P3JA 3CIHA 4Q26A 4TYSA 3VBSA 3OPWA 5BNPA 3TEWA 4Q1RA 5CIRA 2X05A 1N47A 5E89A 1YQ5A 5FLIA 5CG9A 2YGMA 4Y1UA 4DS0A 4YPJA 1OUXA 4CCDA 5FJKA 1VPHA 2BBAA 1G6NA 1LHUA 1OURA 1XPWA 1W8HA 2XQRA 2GNDA 4QHZA 4AR2A 4K40A 3T08A 4MX3A 1W2NA 1D4VB 1QJEA 3IDEA 4EWDA 2CGPA 2GMPA 1AYN2 5FZEA 4NJ4A 3IZOA 4JGZA 2VOVA 2VOXA 1H6XA 3KD4A 1WW6A 1WLTA 2QDRA 2R0HA 1VMJA 3KV6A 4UW3A 1W8FA 5GLUA 2JDYA 3LDBA 1UF2C 4HVQA 5FLJA 4B4RA 1RYYA 3O1VA 3POSA 3DKQA 1AX0A 2LRPA 3KSCA 4JHZA 5JUVA 2JECA 3NNJA 3T1LA 5FCCA 3M3CA 2HWE1 2Y0OA 3AYCA 2VQAA 3AXEA 4AQ6A 4XHXA 2RS52 5HBAA 1DQ5A 2ARCA 3RVHA 1VLNA 2JEMA 5LB6A 1S0IA 4N53C 3MLKA 4UFIA 1DQ1A 5A7OA 4HKOA 1J3QA 4HETA 4FP2A 4LHKA 3AZWA 4AFCA 2QQNA 3KMHA 4Q4Y1 3CF6E 3LA3A 5FZ3A 1NLRA 5T52A 4GXLA 3U11A 1NCRB 3VKMA 1VRH1 3WXPA 3K46A 4HKWA 1YC61 4XETA 1QQP2 3D6EA 1OLRA 4CDUB 5JXIA 3OUIA 1FV3A 2X5IA 2ZGMA 3PVBB 3U37A 5IVEA 5JXHA 1AYN3 3KVAA 3N7JA 2BFUL 4YVWB 1JTZX 4IERA 1RUF3 1DU3D 2CWSA 5FJHA 5FZCA 3WV6A 1SBFA 3A0KA 1OLMA 1V70A 2ZMKA 4ZPIA 3SHRA 2QQPA 1JZ3A 1UKRA 2FCVA 4CEYC 4RFRB 3RZMA 1UZ0A 2ADEA 3ZM8A 4QPGC 1V6NA 2OX0A 4IEVA 5FZ9A 3FHQA 4QQ2A 4LLFA 2EXJA 4J25A 1JYTA 5F32A 3VBUC 1WBFA 4YNIA 2RS53 2ZS6B 3JB4C 2ZMNA 4U2AA 4Y1ZA 1ULOA 2O8OA 4Y20A 1JXNA 4JTOA 1SDWA 1J84A 1IG0A 3AZYA 3JXSA 4DFSA 2A70A 2VL4A 2D93A 2DU1A 3LGRA 1UAIA 2HWE2 3N9QA 4D7TA 4WM8B 1ND2B 1UD1A 4OHZA 1MACA 4QXKA 3ZYGA 2A3YA 1QJFA 1OI6A 3N9PA 3JB8A 5FZ6A 1DGWX 1V6OA 4E9KA 4YW2A 1MVEA 1ODMA 2VMGA 1UPIA 4KU8A 1LU1A 1W6NB 2QQJA 4V1PA 3BU7A 2XUMA 1W6QB 1C8M1 3AMPA 1VRH2 1TE1B 2BTVC 4FSJA 1GUIA 2Q0AA 1QHDA 1ENRA 1PIV1 3IIAA 3NSTA 1JUHA 4YW1A 3I97A 2JE9A 3ZN4A 3WVJA 5AC91 1K5MB 3RMXA 4JGYB 1MPXA 5FY5A 4AFMA 1IQAA 4LHNA 3RG0A 3Q8CA 3HNYM 3MI8A 3KS7A 5I91A 1W6OA 3OJBA 2VMCA 2VU9A 1RUOA 2J1TA 4JDMA 4X8PA 3OGJA 5FP9A 4K8RB 1HJFA 4MGIE 2Q8EA 5I8SA 4A45A 3M1HA 2NP0A 1ULGA 2B7YA 3WG2A 3BODA 3KF3A 1RUI1 3PHMA 1Y3TA 2ZGUA 3M3QA 3AX4A 2HWE3 5JI9A 4Y22B 5LATA 4UF0A 1YNAA 4URAA 5IK4A 1E5HA 1GV9A 1J83A 3LFMA 5GJ6A 2EVXA 4N53A 3A21A 3DN7A 1U5XA 1YFWA 2W2IA 4BQ5A 1CPMA 2P37A 4NWWA 2XB6C 5IAVA 1RIRA 3MGUA 3I54A 4Q4Y3 4C90A 5C8WA 4MGYE 3T0DA 4EN8B 1EUUA 1VRH3 3D82A 3D0JA 4WVWA 2PA7A 2VECA 2AEZA 2B5HA 2OUJA 2QVSB 3H7JA 4N9IA 3SKJE 3I7DA 4BXSV 1IS6A 4HG6B 5HV4A 3CJIB 1LEDA 3ZYIB 1O5UA 4I01A 5JOZA 1ONAA 5I0UA 3POIA 1C8M2 1VBC2 3AKPA 4Q4V1 3OYWB 5F37A 4LO7A 2KR2A 4XUPA 4AYUA 1DDLA 2XONA 1NCRC 1O5LA 5E16A 4LUMA 1IQDC 4XJZA 4LTAA 4B1LA 3RWKX 4CEYA 5AC92 2JDPA 2UY8A 5GLTA 5T55A 1ZREA 1UKGA 3VKLA 2RS11 4N8MA 5H9SA 3GXUA 3G6JB 4LJHA 4QPGA 5FMBA 4CDUC 4CE8A 2WNUC 2YGLA 5FZHA 3RZHA 4YVWC 3VBUA 1RXFA 4O9EA 3DEMA 3UJQA 3UT0A 2VE1A 4P9XA 3UYJA 3WF1A 5C70A 1UW8A 3LQCA 4OHVA 4IGPA 3RNSA 4BQ3A 4MGTA 1KEXA 2FD8A 3GZUC 4Q5OA 3FFZA 3KGZA 4MYEA 4I3PA 5DMYA 2CGNA 1UZVA 4WZCA 3FFQA 1R081 3IKWA 1RMU1 3VKNA 4CP1A 4L9BA 3BVCA 3OGGA 2G4IA 4BE3A 4M0NA 5ACA1 1LNSA 2D44A 2DCKA 2QNKA 4INDA 5LBEA 4W50A 4KGGA 5C7GA 2EXHA 3CDZB 1C8M3 1VBC3 4E27A 1DGLA 1NE6A 4WM8C 2VZUA 4DY3A 1ND2C 3DXUA 3ES1A 1S2EA 1RL3A 1OT5A 1V6LA 1CJDA 2A75A 4LR4A 1UYZA 3T2QA 2R072 2BERA 1REEA 5AC93 3NNFA 3QBQA 5DG2A 4QB1A 2QTWB 3ZXJA 1PO11 4CP0A 1SBDA 1EV12 4Q4V2 3O14A 5A3NA 3KCYA 4NRQA 4P9LA 5FXVA 2VCAA 2W9XA 1WCKA 2Y6GA 1MZEA 3AKSA 1GBGA 1SLBA 1RVF1 3CZUA 3O0WA 1W8NA 4L11A 3SITA 2BUKA 5T3NA 4Z8BA 4D8MA 5IK7A 1GNYA 1O3RA 1VMHA 1DZTA 2A1XA 3DF0A 5C5UA 1FMD1 1RTVA 1K5MC 1X8EA 3K4DA 3B3QE 1POQA 3PTYA 3IT8A 1CZVA 5A3MA 1IOAA 5F6KA 2XVGA 1ZBE1 1ZRRA 1UIJA 5FO9B 2D6MA 3R4DB 4D7YA 3ILFA 5L73A 2AR6A 2R041 1UYPA 3N4MA 2Q1ZB 1BZWA 1R082 2VM9A 4KG8A 3PNAA 3V65A 3ZR5A 1C1FA 2VTFA 2IC1A 3VZJA 5I0SA 4W6YA 1C1LA 3POEA 4BLJA 5DZGA 2ENRA 4XZUG 3I3QA 1QNYA 2YC0A 2W39A 4KBBA 1UMZA 2PQQA 3MBWA 4FQ4A 2JDZA 2HBUA 1EV13 2JG8B 4JAAA 3OEAA 1H2KA 4Q4V3 2VNRA 3P3NA 4ZZ8A 1LGBA 4FI9A 1NCRA 1FNZA 2QBXA 2KA3A 3OUJA 4Q2FA 5A7PA 1YRZA 4EWEA 2QCSB 2ZAAA 4JTNA 1KJRA 1SZBA 3J9SA 1BHGA 3VD4A 2HWF2 4CDUA 1HRV1 3MIEA 2WNUA 3LDRA 5F1RA 1HJGA 1Y43B 1RVF2 4YVWA 5HCBA 1X50A 1UX6A 3ACFA 1Q8QA 1LODA 2VGDA 4OQ9A 2W08A 4NWVA 4XJ9A 4FQZA 1O91A 4AGRA 4O9GA 1WLWA 2F17A 3LPFA 1EP0A 2VMFA 4W4ZA 4QT6A 1YQCA 4Q0QA 5FPUA 2GU9A 1R083 1VB2A 2EICA 1DCSA 4PF5A 1CN1A 4WZFA 1WD3A 3INAA 3ACLA 4PJYA 5FYBA 5CAZA 5JXGA 5SV5A 4FT8A 4PLMA 4XFIA 4E2QA 3VUOA 2R1BA 3WG3A 3PU3A 4JQTA 5FAXA 3QD6A 1XU2A 5C3QA 1CGPA 4X6QB 2BGPA 1QDCA 1PVC1 4E8CA 1KXGA 1ND2A 3LEKA 5EJZB 3ZXGA 3I3EA 1YQ2A 4EYUA 2B46X 2EAKA 3USUB 4KWUA 1PMJX 1RUD2 1WA4A 2VXRA 1E5SA 1UMIA 4KG0A 1XE8A 3ZXAC 1PO13 2V5YA 3VBHB 1W6NA 1O4YA 4GH4B 5FPXA 1QJZA 3A4UA 1AF9A 2HWF3 3CQOA 5FY8A 4TZDA 1HQWA 1YFXA 4E2GA 4EROA 3M3OA 3NAPB 1RVF3 2Y6HA 4AI3A 2XOMA 2ZGLA 1N1TA 3MIHA 4QX3A 4M00A 2WNOA 3ACIA 1FMD3 3BTZA 3OGVA 4W8JA 5FKBA 3U75A 3WLUA 5LASA 1G9CA 3I2OA 4HK8A 2WFPA 5GM0A 4A6SA 1W8OA 4PBPA 2R043 5DUVA 3AC0A 3VDDB 3ZPYA 3HIFA 1OA2A 5GKAC 5F7UA 1GLHA 2C9KA 4AZZA 4LKDA 3S57A 1BBT1 2WLPA 3MF6A 4PDWC 4R9DA 2A6WA 1DQ6A 2ZGKA 2D3SA 3CKHA 2FDGA 4FPEA 3WP4A 3KV4A 3AJYA 3ECQA 5A7NA 5IK8A 4Y22A 2FDKA 1XOYA 5FOBB 1RUNA 3RSJA 5A7SA 4N7IA 2CY6A 4AQTA 1S0DA 1XNCA 2EALA 4MZUA 2W91A 2ATFA 3K3OA 3ASIA 4P02B 5BYNA 1W0NA 2DV9A 5A7WB 2HYXA 3THPA 2V5DA 2Q4SA 2VBPA 1O4ZA 3FBYA 3IPVA 5J7MA 1UN1A 3TNPB 4FTEA 1CZTA 1AUYA 4Q1PA 1CONA 3AVRA 3HR9A 2XL7A 1QIQA 4I2OA 2AENA 1KQRA 3Q9OA 2W68A 4F3JA 5JSPA 3R4UA 1OOPB 3QLQA 4KH9A 2Y64A 1JOJA 4DXSA 1HRV3 3ZIXA 5I0RA 2JG8C 1ZNPA 3OYWA 4K20A 2WFF2 1WMFA 4P9YA 3H3ZA 1PNGA 2ZPXA 4EQVA 3LFIA 3WHTA 4FCAA 1OLQA 1OXCA 3ZVXA 2ERFA 5HPOA 5JR7B 2VCMA 4XF9A 3WCSA 2B45X 1U5YA 2JB8A 2Y8KA 3IIIA 2CTVA 1SFPA 3MYXA 2F4PA 3AKTA 2XR4A 4D6RA 1MS8A 3PUAA 4EN7B 1ZZBA 5D8AB 3GJBA 2IXIA 3SCFA 2IFWA 2OUHA 1V6JA 1Y4WA 2WABA 2H6CA 2VMIA 2RDNA 4BWOA 1RUG1 1LOGA 5JPMB 1GNHA 1S55A 4PIYA 2DVFA 3BIEA 1NOVA 2BBVA 1YLLA 4AAPA 3ZYHA 1RJ7A 4GKYA 4CU8A 4IE4A 4RS5B 2ZEYA 3WW4A 4XF0A 2WIIB 2AREA 5FZ0A 2A5ZA 1QKQA 2V09A 1DF0A 1LHOA 1ASJ1 2A71A 1RUE1 2GNTA 2R7EB 5AFEA 3QCWA 5LEKA 2ETEA 5JCTA 2GNBA 4PT6A 1HRI1 5CEHA 4JKLA 4XJ8A 2XJRA 1OD3A 3QOPA 1BVP1 2DBIA 4KBZA 4AW7A 2EF6A 1QMJA 3FUQA 4Y24A 5IHRA 5KBFA 5HCHA 4A7KA 3VBHC 4GH4C 4ZXKA 2PHRA 4MHUA 5IVBA 4AXOA 2P5BA 4YFZA 4OI4A 3O1SA 3NAPC 2UWCA 4XFCA 4YM1A 2PHDA 4KWKA 5D21A 1BMV1 2W92A 2VZOA 1Q43A 3P3PA 2ZA9A 1F5FA 2BP6A 1R64A 3GF6A 5KHJA 2ES3A 4ZXEA 3NJYA 1BBT3 4AHYA 3IM0A 2PHTA 4FOQA 4PDWA 2ZX0A 3PMSA 3SQOA 4FFIA 2R32A 2Y33A 4LHSA 4CRQA 3BU0A 4AQSA 1Q5OA 4P00B 1KJLA 1LTEA 4A3ZA 3VDDC 1UYXA 5K0UC 2QQWA 3FMGA 2D5HA 1VAKA 4UWDA 3BB6A 3WW1A 2QQUA 3EO6A 4MGZE 3N3HA 5J48A 4GB31 1ZM1A 2LM3A 4GWJA 3PUQA 5LBFA 3WY6A 5FDBA 4S2FA 3LIGA 3N35A 5FXZA 3WF2A 2RM21 3AL5A 3TYJA 5H9QA 4G9SB 5FUIA 2DVDA 1LOAA 2IXJA 1Z78A 3VBFB 2XMLA 4AHZA 3AP9A 3F2ZA 2Z5WA 3TEXA 1LHNA 3S5AA 4LORA 3AL6A 5T5OA 1ASJ2 2ARAA 3GZEA 3RYRA 2CL2A 2JG8A 3JQXA 1OQ1A 5JDBA 2MPFA 4R52A 3CZJA 3UL2A 1QJU1 3POJA 1GP5A 2QZ2A 4YYOA 2ZEZA 1QWRA 2HLEA 2HWC2 2BW8A 2QQKA 4TLGA 3JUUA 4BQXA 4QX0A 1RUJ2 1PX3A 2HYKA 4QHOA 4WVMB 5FK8A 3RQ0A 1OOPC 3U07A 4DXRA 5FYUA 1OPOA 1GYKA 3ZSEA 3N7LA 1BMV2 1SPPA 3UGHA 2RJ2A 1AXYA 3B9CA 4PIZA 4LEJA 1LHWA 4KWJA 4LUKA 2P6CA 5FZ1A 1C5HA 1C28A 1U0AA 2XH6A 4JRAA 4QMAA 2VBDA 1VAVA 3WQBA 2WBKA 1JYXA 2ZEWA 1O6UA 3ATGA 4FPYA 1F31A 5M0TA 1FOD1 1O8PA 1PO21 4XACA 5D1IA 1KDKA 5D8AC 3ZFEB 1HQLA 2SLIA 3PUIA 5LRSA 3KCXA 3VZOA 1FXZA 2R1DA 3HNBM 2DWRA 3B01A 3TOJA 1DQ0A 5JMCA 1JYNA 1DIWA 2RM22 2FZ2A 1ASJ3 3I2HA 4EJRA 2CAUA 5KC6A 2QJVA 2VPVA 4ZS2A 4YRDA 5IVCA 1DYPA 3H3LA 3JCIA 1L3JA 1HXS1 1OH3A 1RUJ3 3L9JT 4RS5C 1XQNA 4XJAA 4NIDA 3ORJA 4K1ZA 1VALA 1UCXA 5FUPA 3VBHA 4GH4A 3W21A 1UU6A 5LK7B 3HT1A 5CZKA 3VDCA 1QJU2 3NJVA 4OUSA 2D7FA 2WA4A 4QDQA 3AZVA 4XF1A 4C91A 4D3WA 1CX1A 1W9FA 2ARBA 5JOWA 1KRIA 3WDTA 4BISA 1GZ9A 2ZHMA 4HVOA 1JN2P 4B8EA 2EA7A 1LB2A 1F9KA 2GC2A 4RR3B 1MZFA 2LUWA 1IPJA 1PGSA 3W58A 3QACA 3H50A 4Z07A 4CCJA 3T2TA 1MQTA 1MS1A 2W47A 5K0UA 2CGOA 2P17A 1GWLA 4BIOA 2WAAA 4XAEA 3O1UA 2I07B 4MADA 3GHNA 1SFYA 2ORZA 1VBA1 3URFA 2RM23 3MEPA 1D2QA 5DQ0A 2PHWA 4Y1XA 3PIGA 2KXLA 2DUOA 1H1IA 2YROA 1X9PA 2WZR1 4Y1VA 1NE4A 3ST7A 4M3CF 4YM2A 3GZTB 4I3GA 3CMGA 1MEC1 1WMXA 4L92A 4MGKE 1POV1 1STMA 1TG7A 1XNBA 5FYSA 5A7WA 4CU9A 5KHGA 3I2JA 3PVNA 3SXWA 3MIDA 1NUKA 5A1LA 1QJU3 3VBFA 1QXRA 2WO3A 4ISRA 1REFA 4M4RA 3N36A 4HXCA 2OKXA 3UGGA 4PQ9A 2ZGOA 5J3UA 3ZXLA 4HMZA 3VBFC 2WINB 4N90A 1R091 1IS5A 1OOPA 1J1LA 3AFGA 3AP6A 2J42A 1CX4A 2J1AA 3N9MA 3NKGA 4SLIA 3UESA 1WW7A 5FY1A 3WSOA 3NJXA 3T1MA 1RINA 4DINB 3V0AA 3WCRA 2DFCA 1LOCA 3SH5A 4HK9A 3SCHA 1SLTA 3DXTA 3IDBB 2PFWA 2FCUA 2NQYA 1W6PA 4FFFA 1H8TB 3GALA 1G86A 5DUUA 3UETA 1PMHX 4D0QA 1AX1A 5EZWA 5I8YA 3VHOA 3W9AA 1ZRDA 2FMDA 4ASMB 5KHHA 1PGW2 1D2SA 5J1XA 4DPNA 2PHXA 2IVIB 5D8AA 4RGAA 3ETQA 2GN3A 3HWJA 3H1WA 3EMRA 1A3KA 1VBA2 4HPKB 4R4ZA 5EP9A 1GOFA 4LK6A 4B4PA 2VTXJ 2D3PA 4BQ1A 4ZZ5A 4CZSA 5AVAA 3POBA 2OPKA 4QGMA 1GSLA 4N9HA 1COV2 3WZ1A 4DRRA 1XNTA 3OCPA 2Z42A 1HXS3 3ITQA 3ZFEC 3D8CA 1MEC2 5G05L 5A80A 3DPRB 4RGKA 4RS5A 4AVTA 3O1OA 5FXXA 2W95A 3UNPA 5DXDA 5H9RA 3DGTA 1RUF2 2D6KA 1APNA 2MEV1 4FPKA 4A7YA 3AYDA 1HKDA 1RUC1 2IWGB 5DDJ1 3LEGA 5A1FA 1S0GA 1UXZA
chains in the Genus database with same CATH topology
1ZZ7A 3TN91 1YXWA 1R092 1RUH1 1XYNA 3VZNA 1FV2A 3OY8B 5FQ0B 2R061 4E4DX 3RPQA 3HN1A 4XYXA 2PHLA 4B7KA 3WQ1A 4AK3A 4PBOA 4JV4A 4N7UA 3IN9A 1AJOA 3JBG1 1S0FA 1SLCA 4GMP1 4Y5Z0 2B8MA 5LK5A 4AEJA 1CAVB 1VBA3 2E63A 4FO9A 1QH7A 4OHWA 4GWNA 2MNGA 3E5QA 1X7NA 1CAWB 4RR3C 2IFRA 1YIPA 4YGDA 1IKPA 4AGVA 5JZGB 1COV3 2WZR3 3USSA 1FPN1 1MEC3 2UYBA 1LOBA 4IEPA 1YIFA 1BVVA 2YUEA 5J36A 1ENSA 2D5FA 3S6PA 2QFEA 3SCGA 5T5PA 2WSUA 5KXBA 1O3QA 3U10A 4AVCA 1F5JA 1EAH1 1HV1A 5FTTC 1ULDA 2XLFA 3VBFA 1R093 2GC0A 5GZDA 4R8HA 1OMIA 1SACA 1OHFA 2DU0A 4QGLA 2MEV2 3WP3A 4AHXA 1ZYBA 5DDJ2 4QQOA 1SMVA 4LE4A 5FBZA 4XBQA 4BHPA 4TSVA 2UWAA 2WL1A 2JG9A 2WNEA 2Z69A 3R05A 5ABJB 4DOUA 1A78A 4FAHA 1RITA 4G4FA 4LNVA 2K9ZA 5BNQA 3N7KA 3WG4A 4AVBA 3VKOA 4FPLA 1H8TC 4Q4Y2 3FLTA 4YVSB 2E7AA 1LOEA 5KHKA 3S30A 5T54A 1ZX5A 3AMHA 3LSEA 3UKTA 5CFDB 1VP6A 3E5XA 3CLPA 5JI7A 2JJ6A 1FPN2 4ZU7A 1JBCA 3ZFEA 3AP4A 4OLLA 4FAGA 5JAXA 2EXKA 4FXKB 5DUXA 3AJZA 3VKFC 3FJSA 1CAUB 2MEV3 3A0NA 3D0SA 4Q8LA 4WVVA 3LOBA 5DDJ3 2BNMA 4TLFA 1HW5A 5AFBA 1EAH2 2IXLA 1GR3A 4K3UA 1RUH3 2PTMA 4W6XA 1SQ4A 3DL3A 3ZN6A 2R063 2WA3A 4YW5A 3WOGA 3B5LB 4UXAA 5FMOS 4F8AA 2WS91 3L2YA 3JBG3 4IEXA 3B69A 3E5UA 4K8FA 3H1MA 1IPKA 4QQPA 1CAXB 2C5DA 3EBRA 5KC5A 2EIGA 3OBTA 4FP3A 2B9UA 4FBFA 3DKWA 3RMYA 4L99A 2BVVA 1ZRCA 4RR3A 4OHYA 2BNNA 5DG1A 3WDWA 1FPN3 4QPIB 1N1YA 3WX5A 1SEFA 2K0GA 3WDUA 5LRRA 3N7MA 1PIV2 1AR81 3I2DA 1RGSA 1V9U1 1EAH3 2GC3A 2GZWA 2UU8A 3VV1A 4BMBA 3O12A 1NQJA 3AP5A 3NV4A 1DZRA 1SCSA 1OQDA 5FFOC 1H9WA 3BALA 2BQPA 5TSWA 5CU1A 4EN6B 1AZDA 1RUI2 2GNMA 2Y26A 3E97A 1NG0A 4IEWA 4LBQD 4AEDB 3I59A 1IKQA 3SLIA 5KHIA 1RJ8A 1BEV1 1A6CA 1AYM1 1HDKA 5I0TA 1LR5A 5FPZA 4HBNA 3ELNA 3ZXKA 1S0EA 1GQHA 4LO5B 4YZ3A 1WLDA 4XMIA 1H8TA 5CBLA 5ABJC 1X8MA 3TBDA 4RSUA 1PIV3 1A8DA 4LO6B 3ZO0B 3ZN5A 1XRUA 5SV8A 2GDFA 4YW4A 3AMMA 1G7YA 4G3YC 4ZU4A 4HPKA 4YVSC 3IWZA 4MSVA 5FO7B 3LAGA 4LO8A 3KB5A 2VNOA 1G9FA 5CFDC 2HJIA 3V0BB 2RS12 2DCJA 1H8VA 3R4SA 1RUI3 5FREA 4JGYC 1SFNA 4XTPA 1C4RA 4Q0SA 3TNQA 4Q4W1 3E6CC 3TRSB 1AXZA 2Q30A 1QOOA 4LULA 3WHUA 3ZX7A 4WM7B 2D98A 1PMIA 4LA2A 4R4XA 1DYKA 2Q8OA 4P9GA 1ALYA 1MR5A 5FLHA 1RMU2 3OY8A 5FQ0A 1V6IA 4I02A 1AYM2 1YFYA 4ONUA 5ACA2 4N43B 2A3XA 3GBWA 2XBO1 4M01A 5BUVA 3B9IA 5CG8A 4IEOA 1ZRFA 4IXLA 4YM3A 3VBOB 4I30A 4HT1T 2RE9A 4QPYA 4XE9A 2ZOEB 1O7FA 3AZXA 3ZXDA 3H7YA 4AF9A 1V9U3 1NQDA 1UPSA 4LE3A 5F5QA 4E2SA 1QJX1 1PO12 2H0VA 2RS13 3CJIC 3MDPA 4QPIC 3LB9A 4COUA 3ZXFA 1ZBA1 4EWAA 3O7OA 3RZZA 2CAVA 2W0XA 1MS5A 1QH6A 4A3XA 5A33B 3ZMOA 4FOVA 3VHRA 1FMD2 4W6WA 3AMNA 4MXVA 3FBMA 2XJSA 1S0JA 4AFBA 1ZBE2 4Y26A 5JOYA 1RMU3 3PMEA 1S1AA 1YO8A 1AYM3 2R042 1Z7S1 2WLQA 4QX5A 3AKRA 4OZXA 5ACA3 2P34A 4GQ7A 1O3SA 4XFHA 3M8LA 2P3KA 1JH5A 5LEJA 4XF3A 3KM5A 5JLVA 1GICA 1O4TA 2CWMA 5JPNB 4K7JA 4AEDC 2EXIA 4WM8A 5C9AB 1G9AA 1M4WA 2VW2A 3WW2A 4SBVA 4OUMA 1W39A 5CFCB 3ZSJA 3O5SA 4L97A 1CD3G 2VUJA 5CADA 1KS4A 2FBEA 1W6QA 1POV0 1HV0A 4KQ7A 3UK9A 3ALQA 4YVSA 1LESA 4NN0A 1OFSA 4K9SA 3ZFGB 2I2SA 4HN1A 5CFDA 4GA9A 1UIKA 3MW2A 1QU0A 3APBA 4AVSA 1HRV2 4NOTA 1I9RA 1K5MA 1XU1A 4JGYA 2ZAHA 2XWBB 5GZGA 1ZBE3 4A7ZA 3WUCA 4Q0VA 4ZU5A 2ILMA 5KWRA 1AR71 2WT0A 2FQPA 1PGL1 1BXHA 2D6NA 3J4UH 4IESA 2C0ZA 3NV2A 5FO8B 4FOYA 5KXCA 2RHPA 2HEVF 4MH0E 4S2GA 2P2KA 2WWSA 4FOWA 1DZQA 2A7AA 3TAYA 1TMF1 4KGQA 2RJKA 4COVA 4R9BA 1PVC2 4E4ZA 4CDWB 1CAXA 2XPJA 1FYUA 2Z79A 2D3RA 4ES9A 4HANA 2VOWA 4AHWA 5L36A 1CVNA 1S2BA 4DQAA 4N43C 4UBGA 1QJX3 3CJIA 5IUQA 1WMEA 2NPIA 1IS4A 4QPIA 4P9IA 4NHMA 3AYEA 3VBOC 1YI7A 4QU2A 1WD4A 2VQ0A 1AR61 3OD0A 4ES8A 3JD71 4XMAA 3MW4A 3M7AA 1JYCA 3POYA 1ND3B 4UW5A 2ZHKA 3FX3A 3NWKA 2UURA 1N1VA 2GH2A 3HD8B 2D6LX 4I0AA 3HMYA 3WQ0A 4J1WA 4XQWA 5T50A 1Z7S3 3E6BA 4BYYA 1LECA 4AGGA 4NVPA 1BBT2 1N3QA 4GMP0 5IT6A 4YZ5A 3B7MA 1PVC3 3J8F1 4IV3B 4AEDA 4AVVA 4XFGA 1BQPA 1ENXA 4KU7A 1ZZ9A 2BYVE 4CDQB 3VBSB 1H4HA 3POWA 5L7OB 4ITCA 4LBMA 5C9AC 2ZKNA 3V64A 2FMYA 3M2MA 4IL7A 1FAYA 5CFCC 2VMHA 1IZ3A 1MZ6A 4LBQB 1KS5A 2WZPP 3IMNA 1FX5A 3UJOA 1ENQA 2W52A 5CA6A 2NMNA 3MICA 5C33A 5F6LB 3ZFGC 4MLOA 2C9AA 1SLAA 4F83A 3V0BA 4OI2A 1C8NA 1XYPA 3M3EA 3PJYA 1W6MB 3SH4A 3ES4A 1VBB1 1TMF3 1D4M1 4XF4A 1WGPA 1AR91 1H1MA 1NY71 3WP6A 2ZGQA 1LHVA 4QHBA 4XDQA 4Z82A 1RUG2 1OA4A 2PYTA 4XFBA 4AEMA 4DRRA 3H0OA 2ZABA 4IV1B 4OFGA 4AEKA 2HWD1 2RS31 3I4IA 2ZGNA 4A2UA 1S0BA 1QJY1 4CP2A 4N43A 1PZ7A 4C0HA 2R6QA 1WUVA 4FPCA 4NO4A 1RUE2 2I45A 1X36A 5DZEA 3VBOA 4XXAA 2DTYA 1HRI2 1QF3A 2X5IB 4NR1A 3JD73 4XIKA 5H9PA 1I1EA 2BWAA 4META 4QM8A 4RFT0 4K6BA 1PK6B 3MLLA 2WKKA 1IGOA 1G9BA 3TWIA 2DFBA 4JQRA 4HFSA 1PHMA 2ZHNA 2X53S 2AUYA 3MW3A 3CEWA 1DGRA 4JDOA 2MHFA 2LALA 2ET1A 1ND3C 3D5OA 3MPBA 1TME1 4BCUA 4Y20B 3J8F3 2YXSA 1RUG3 4XBNA 4ZKTB 2ZGRA 1D4M2 2VVDA 1QGLA 3BTAA 1GANA 3QH6A 2RR11 3PVEA 3FLRA 4GB32 4LBLA 2NLRA 5JDBA 3FLPA 3ZSKA 1RUE3 5J98B 4IV3C 1WW5A 3H9AA 1HRI3 2R0FA 5C9AA 2XL9A 4Q27A 2OYZA 4QQLA 4CYDA 3USUA 2I74A 2DVGA 4AI1A 5CFCA 2ZMLA 4COZA 4CDQC 3VBSC 4Q0PA 1J58A 5L7OC 5I93A 4CTEA 3NAPA 3BIWE 1U5IA 4YGCA 3CO2A 4GULA 3ZFGA 4C0BA 4P14A 2XG3A 2PLV1 1YWKA 4PLOA 5CB7A 2D40A 4M0HA 1I6XA 4XQDA 4B29A 1VBB3 1D4M3 4LO4B 3VDDA 3MLJA 2XJUA 3GHMA 4GB33 3K51A 4N53B 1FOD2 3H3UA 1PO22 4M3CB 1IHMA 3D4KA 4AWDA 4YARA 2HWD3 1OKQA 2WT2A 4XJUA 2B42B 4XIOA 1SLLA 4C1WA 2N7GA 2BVBA 3K48A 2NN8A 2A6VA 2JICA 3LWCA 1OQEA 4X6RB 2DUQA 4IV1C 4WBBA 4EN0A 1H0BA 1HXS2 3VN4A 1GFF2 4KL1A 2PHFA 3AM2A 2HEYF 2OZJA 4R9AA 1V6MA 2YZ4A 2WNVB 1YHFA 4I0BA 3LKJA 4P9JA 3S7IA 1AXKA 2X5IC 2PLV2 1AYN1 3AMQA 1RHI1 3VBUB 1ND3A 1TME3 3C2UA 2PAEA 1HX6A 1H2LA 1PK6C 5HI0A 2WSVA 3NKTA 3MIBA 4YZ1A 3RI8A 1FOD3 1PO23 2VVFA 2XJPA 2WT1A 4FPFA 4K21A 2IXKA 3RYPA 1J1TA 4XPVA 1G8WA 3PLQA 4XXPA 1VBD1 1ZZ8A 2TEPA 4IV3A 1W2UA 1ZA4A 3RDIA 1TNFA 3SISA 4GALA 2WZR2 2VW1A 3OPZA 4H7MA 3NJZA 3MFCA 2BWCA 2YY1A 3B00A 3ZYJB 4CDQA 1GKBA 4LLOA 4LBKA 1KFXL 1QQP1 5C4WB 3FUOA 5L7OA 3BCWA 1B09A 5B2GB 2PLV3 3BPZA 5EWSA 5IK5A 3MIGA 4LBQA 1BK1A 3WR0A 4H7LA 1CESA 2ZX1A 4EN9B 1J3PA 3WD5A 5E1RA 3AK0A 1RHI2 2DVBA 3CU7A 1UZZA 4S2DA 3KCCA 1ZZCA 1S0CA 1ULFA 2DTWA 1LENA 3DV8A 1LKNA 5K7PA 2BGCA 2BPA2 2DF7A 3BOPA 1EPZA 1W6MA 1QNWA 2JKBA 2ZHLA 3KZ4C 4Q0UA 1AL0G 1VBE1 1DFQA 1POV3 1VBD2 2XJVA 2BFUS 3ZSLA 2H6BA 2TUNA 4AI8A 2HKXA 4IV1A 1OD5A 2E7QA 4FPJA 3JU9A 5C8CB 2GMEA 4P9WA 3FE5A 5K8SA 1RUC2 2QE3A 4MXWB 3ILNA 4XJWA 3TB0A 1GQGA 1OSGA 4RD7A 3TN92 2WNUB 5EXOA 5GALA 1RUH2 1NA1B 1RHI3 4WV8A 5T5LA 2R062 5JSOA 2BEOA 4WVMA 4NPRA 1PK6A 2WNVC 3NW4A 3JBG2 1UU4A 1YUDA 2LTNA 2NM1A 2R49A 2CYFA 5DUWA 4Q4X1 3AXDA 3UV9A 2YYOA 1VBD3 5JIUA 4KWLA 3C3VA 2B39A 1O3TA 2V73A 2XJQA 1FNYA 1VBE2 4CEWB 2DCTA 3UKVA 1W0PA 2E9QA 1KFUL 1WMDA 2HEWF 2A6XA 1QQP3 5JOXA 1RUC3 3VZLA 3FC0A 1ZZ6A 3WUDA 5E8AA 3RWNA 4LBJA 1LGCA 3TN93 1CIWA 1VBC1 1JW6A 1PZ9A 4X8NA 3S7EA 3AFKA 3DPRC 3CNAA 3GBFA 3MZHA 2IZWA 4COWA 1JYIA 5EV7A 4Q8KA 2OVUA 5C4WC 1DHKB 1EYBA 4OULA 4CDXB 3LSDA 4GMP3 1DQ4A 5GLZA 1YJKA 1H1AA 1B35B 1R1ZA 5KXDA 4YGEA 3KT7A 1PM7A 2QDNA 5DZFA 2QZ3A 1I5ZA 4J6GA 4WVZA 4HSJA 1PVXA 3AP7A 4BH9A 1V6KA 1C5IA 5FMOL 1VBE3 2PAMA 3H1YA 4J1XA 4Q4X2 4IEUA 4W65A 2JD4A 3ROUA 3M70A 3OD4A 3EXUA 4FPGA 1Q56A 3IDCB 4HKLA 4M3CA 3IPVB 1J3RA 3ZYPA 5JZGC 2OIIA 3VZMA 1H2MA 1AVBA 1VB4A 1PNFA 3EJKA 4HL0A 1U5ZA 2DVAA 4RL7A 4URTA 5EYXA 5GZCA 2R071 4XBLA 5C6CA 1HIXA 4AI2A 4H14A 1EV11 2ZJCA 1REDA 4Z1VA 5BNNB 4MUVA 5C8CC 2O0OA 1IS3A 4BLIA 3EHKA 4LA3A 2WS92 2WNVA 4LHLA 3UKNA 3NV3A 1LULA 2ZBJA 3SH3A 2Q1MA 1SBEA 1NA1C 5A32B 4Q4X3 3HT2A 2XWJB 1JHNA 1E57A 2PN5A 3LA2A 2VW0A 2AYHA 4ATEA 2H0BA 1A8MA 1YYNA 1AX2A 4H3WA 1URXA 3RJ2X 1AR82 3VL8A 4XFFA 1V9U2 5HCAA 4YG0A 2R30A 4CEWC 4BPZA 4IEYA 4XQ4A 2OZ6A 4BZ4A 3DPRA 5EFUA 2CNAA 3FHIB 3KLSA 1NZCA 5EJ3A 2WS93 2IXCA 5C4WA 3WDXA 2AH2A 4M3CE 1UZYA 3GZAA 3VHPA 2HWF1 3WP5A 1MS3A 4DNYA 1HQNA 4YZ4A 1AJKA 4YZ2A 3J26N 1BEV2 4R9CA 3H8UA 3VL9A 1DGRN 4LBNA 4I09A 3VBRB 1CJPA 4PDWB 3MIFA 4CDXC 2ET7A 3KT4A 2QKDA 1MZ5A 1WBLA 2XGXA 2GAUA 3THTA 1B35C 1H2NA 1CAVA 2GMMA 5GZFA 4DZGA 2ZZJA 4HN0A 1AR83 4RQPB 1CAWA 5GLWA 3RJRA 5BXXA 1J59A 5JZGA 3ZIWA 3O0VA 1YI9A 2E7TA 4QGNA 4MVTA 4NHKA 5E88A 4LT5A 1ZVFA 3WDYA 2XHKA 2R073 1RUD1 3FWEA 4XHBA 2X29A 1NCQB 3HQXA 1XXNA 2ZGPA 2GC1A 4Q4W2 5C8CA 3OTFA 1T6GC 5HCFA 1BEV3 4DMIA 4MXWA 1H30A 2IXHA 4HZFA 2A3WA 4TWTA 1LRHA 2XJTA 1NA1A 3PJQA 3RS6A 2E6VA 2ZCWA 1KITA 3W59A 5BNNC 5ABJA 4RGGA 4IEQA 4ATFA 1X82A 5BV6A 2XBO2 3FZ3A 4FXGB 5GLVA 1QY4A 5BY5A 2OW4A 4NHLA 1C57A 3RYKA 4FTBA 4Y1YA 4COYA 5JSRA 2Z2SB 1Q8SA 1OPMA 1TQ5A 5FRAA 1H4GA 1QXPA 3WQ7A 1QJX2 4JRLA 3M4FA 4GKXA 5J37A 4CEWA 1ZBA2 1I3HA 2SBAA 3LZZA 3ZFFB 3ZDSA 1ULCA 4Q4W3 1CAUA 5J96B 1D0HA 4OHXA 2GH8A 1S0GA 2XVKA 4JVAA 1MS4A 5BNOB 4RHV1 2RMU1 4JC1A 3HBZA 3WW3A 4BIFA 5EYYA 4P5HA 1Q8PA 2VNGA 2HWB1 1LGNA 2WFF1 1Z7S2 3IBMA 2YMZA 5JIAA 1MS9A 2A6YA 1MS0A 2JXAA 2O1QA 3O0XA 2ZX4A 4WM7C 2XBO3 5JWPA 4CDXA 2Y38A 3NL1A 3X29B 3PVOA 4B3NA 1HLCA 4U36A 1MQTB 1B35A 2WQ4A 5K0UB 3ENRA 1CQ9A 2NMOA 1FATA 1DG6A 4QM9A 4YSFA 2P3IA 3WG1A 1U12A 2PHUA 3VBRC 1XE7A 3CL1A 1Q8OA 2D43A 4I0WB 5A3LA 4XW3A 2A73B 1S2KA 2D97A 1NXD1 1ZBA3 2E51A 4K1YA 4Z2WA 2X8KA 2XVLA 3R0RA 1SCRA 5AVPA 1TNRA 4L8QA 4ORFA 5K9YA 4RQPC 1RUD3 4DRVA 3G7DA 4YFWA 1DBNA 2UY9A 1UU5A 4AFAA 2NZ9A 1Q8VA 3JQWA 2XKPA 5CVRA 4DB5A 1DQ2A 1AR72 1PGL2 1FI2A 3MF9A 4RHV2 1NXMA 2YPJA 1OFNA 2RMU2 1N3PA 3ZSMA 4L2NA 1R1A1 4GWMA 4YLZA 3V0AB 1NCQC 2HWB2 1GZWB 3ZXEA 5BNNA 2VVEA 3NVCA 1W6PB 1VAMA 2OA2A 2Q5TA 2WC2A 2XKOA 3QH7A 1TMF2 3WT3A 1WLCA 4KNCA 2EAAA 5BNPB 1VJ2A 5A32A 2QUOA 4D69A 1N3OA 3ZMNA 2G9GA 2NYYA 4HVRA 3M3IA 3KT1A 3L2HA 3OBRA 2VOKA 2UYAA 3OF1A 4D7SA 2DUPA 3U0ZA 4YG3A 1AR62 4BOWA 1D0GA 1AR73 3JD72 2XLAA 4JGZB 1VR3A 4RHV3 1KD7A 2RMU3 2PAKA 2YDEA 3AZZA 3RRDA 1OA3A 2HWB3 2WFF3 4PLNA 2GSYA 3R6SA 3ZFFC 2VH9A 3B94A 2HWC1 4QQHA 3B93A 1RUJ1 1AL21 4WM7A 3BOWA 1R1A2 2VY0A 1JUIA 5BNOC 4UW4A 1C3HA 1KDMA 1TEIA 3U4XA 2RJLA 3J8F2 4XFAA 1BYHA 1G9DA 2Y0IA 4AI0A 1XYOA 4BM8A 3NO8A 3VBRA 3ILRA 5JVVA 4Z92B 5GZEA 3ME2A 4MV2A 2DCZA 3V56A 1X33A 4B4QA 4CDWC 1FT9A 4XOGA 1MQTC 1AR63 1EY2A 2CV6A 2D6PA 4RQPA 1YFUA 4AG4A 1XNDA 3JZVA 2TBVA 3VLBB 1WCDJ 5J3UA 2GN7A 3CJXA 4XEZA 3AB0A 3KGLA 4PIXA 3GYDA 4EV0A 4IEZA 5A33A 3VHNA 1LOFC 1BCXA 1R1A3 3MFAA 2WQZC 4ISQA 4PCRA 5I8TA 1NCQA 4QD2A 1EPWA 1NLSA 2AGSA 1NYWA 3LA7A 3NV1A 4YGBA 1LU2A 2JG9B 1VBB2 5J09A 1AL22 4E4SA 2E53A 1AR92 1NY72 1LJ7A 2ARXA 4UBHA 3HAGA 4YW3A 2YHJA 5F9TA 2YV8A 5T5JA 1Q3EA 1WCSA 1Y9QA 4FPOB 2HWD2 2RS32 2TNFA 2DYCA 3WDVA