4Z92B

Crystal structure of parechovirus-1 virion
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
239
structure length
239
Chain Sequence
MSTKYKWTRTKIDIAEGPGSMNMANVLCTTGAQSVALVGERAFYDPRTAGSKSRFDDLVKIAQLFSVMADSTTPSENHGVDAKGYFKWSATTAPQSIVHRNIVYLRLFPNLNVFVNSYSYFRGSLVLRLSVYASTFNRGRLRMGFFPNATTDSTSTLDNAIYTICDIGSDNSFEITIPYSFSTWMRKTNGHPIGLFQIEVLNRLTYNSSSPSEVYCIVQGKMGQDARFFCPTGSVVTFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of Human Parechovirus 1 Reveals an Association of the RNA Genome with the Capsid.
pubmed doi rcsb
source organism Human parechovirus 1 (strain harris)
molecule tags Virus
molecule keywords capsid subunit VP1
total genus 42
structure length 239
sequence length 239
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2015-04-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4z92B00
3ZFGC 4PDWA 4Q4V2 1TME2 4GMP1 1V9U1 3JBG1 1RVF1 1RUC1 4QPIB 4YVSA 1RUE2 1FPN3 5CFDC 2R041 1RUD3 1QJX3 1QJU2 1VBE3 5A33A 1HRV2 1HQNA 2XBO2 4CDXC 1AR83 1PO13 1RUH2 5C9AC 1BMV2 1HRI2 3TN92 1RUH1 1QJU3 5CFDA 4FTEA 1PGL1 3VBUC 1V9U3 4WM8B 3VBOB 1AR82 1CD3G 1PO12 4WM7B 4Q4Y3 2BPA2 1RUE1 1W39A 2ZTNA 1RUG1 1OOPA 1VBD2 3M8LA 1AL22 1QJZA 1NA1C 4IV3C 4SBVA 4CEYB 1RMU3 1VBC1 2WS92 4Q4W3 5FOJB 2RR13 1F2NA 1VBD3 2FZ1A 4WM8C 5DDJ2 1R1A1 3VBUB 5JZGC 4CDQC 1NY71 1PO23 4N43A 3FBMA 3JBG3 4RHV1 4YVWA 4GB33 5C8CC 4RHV2 2HWD3 1AR73 1B35A 4WM8A 1HXS3 1R081 5CFDB 3TN91 4Q4X2 2R072 2WFF1 2RM22 1ZBA1 3JD73 1COV1 1ND3C 3ZFGA 5L7OB 4RQPC 4YVWC 4CDWB 5C9AB 1POV3 1VBC2 2WS91 5C4WC 1E57A 5BNNC 1PO22 5BNOC 1R092 3J8F2 2WLPA 4WM7C 1EAH3 1MEC3 1R083 3VBOC 3ZFEB 5BNNB 1RUI3 4GMP0 3ZFEA 5BNOB 3JD71 1AYM3 2IZWA 1A6CA 2MEV1 3DPRC 1NCRC 4Y4YA 2RMU1 1AYN3 2XPJA 5BNOA 1ZBA3 2WZR3 1OHFA 1NOVA 1ZBE3 4QPGC 2TBVA 2HWF3 1POV1 1FOD1 1C8M1 1FMD1 4Z92B 4JGZB 1RHI3 5L7OA 2GH8A 1PO21 5CFCC 5C8CB 2HWC2 5K0UC 4RHV3 1VRH1 3J8F3 5GKAC 3VBRA 3NAPB 4GH4C 1PIV2 1PVC2 1GFF2 1AR71 2R073 1RUF2 2RS53 2WZR1 1ND3B 2MEV3 5L7OC 1AR61 5CFCB 1QQP1 1VBA2 1AR92 4RS5C 5ABJC 3ZXAC 1ZBE1 1D4M3 3VBSA 1ND2A 3VBUA 2WS93 4Q4W2 1H8TB 1C8NA 2HWE3 1RUC3 1VRH3 3J8F1 5C8CA 2RS33 2R071 3NAPC 3VBSC 3CJIC 1ND2C 1PGW1 2RM21 4IV3A 1OOPB 2WFF2 2R061 1VBB2 1Z7S1 2QQPA 2ZAHA 1ASJ3 2BUKA 1VB2A 5BNNA 5ACA1 4N53B 5BNPA 2R043 1RHI2 4CDQA 1RUD2 1QJX1 3VBFB 1HXS1 1RUJ3 1NCQB 1ASJ2 2HWD1 3VBOA 5DDJ1 1NY72 1HRI3 3TN93 3ZFGB 1NCRA 4FTBA 2RR11 1AL21 1ASJ1 2HWD2 4YVSB 1MEC2 4QPIA 4Q4Y1 5C4WB 5A33B 4N53A 4Q4X3 1D4M1 4AEDC 5ACA2 1AYM2 1AR62 1RUJ1 5C9AA 1AR91 1QJY3 4Q4V1 1RUI1 2R062 4N43B 5AC93 1TME3 4IV3B 1BMV1 1AR81 1PO11 2FZ2A 1PVC1 1K5MA 1BBT3 5FMOS 1BEV1 2WFF3 2XBO1 4CEWB 1C8M2 1NA1A 1FOD3 2WWSA 5JZGB 3VBHA 3HAGA 1ND2B 3JBG2 1EV12 3VBSB 1RUF3 2RS13 1K5MC 1BBT2 5ACA3 4GB31 2PLV2 4Q4V3 5CFCA 5J98B 4CEWC 1H8TA 3VDDC 4GH4B 1D4M2 5AC91 1TME1 1RMU1 4Q4Y2 2RS12 1BBT1 4RFT0 4GH4A 1AYM1 1R091 2BFUS 5D8AA 2XBO3 1AL23 4RR3A 1R1A3 2RS32 2VQ0A 2Y26A 5ABJA 1B35C 1X33A 1COV2 2RR12 1VBE1 1MQTA 1QJX2 1RUI2 4RR3C 1RUH3 2RM23 3JD72 5K0UB 1AYN2 4LLFA 4JGYB 4CDXA 3ZFFB 5J96B 2HWF2 1OPOA 4NWWA 5A32A 4QPIC 1PGW2 4WM7A 1R1A2 4N53C 1TMF3 1RUE3 1VB4A 2HWC3 4CDWA 5DDJ3 1VBE2 4IV1A 1VBC3 4Q4W1 1TMF2 3LOBA 2RS31 2RS51 1OOPC 1RUG2 1VBD1 1NCQA 2HWB1 2RMU3 1AYN1 1QJY2 3JB8A 5LK7B 1RVF3 1HXS2 1EAH2 2BFUL 1SMVA 2R063 2HWF1 1Z7S3 4CDQB 3VBRC 1RUD1 1B35B 2BBVA 4BCUA 4FTSA 1PGL2 4AEDA 2PLV1 2DF7A 4GB32 1NCQC 3JB4C 1Z7S2 4CEYC 2X5IA 1AR72 3IDEA 2X5IB 1FOD2 4AEDB 1EV13 1HRI1 1HX6A 2RMU2 4YVSC 1BEV3 1RVF2 5AC92 1HRV1 2X5IC 2ZZQA 1DDLA 1RUC2 5FMOL 4RQPA 1RUF1 2WZR2 2RS11 3CJIA 1FPN1 4QPGB 2MEV2 1EAH1 1AL0G 1MEC1 1ZBE2 5C4WA 1V9U2 1PIV1 4NWVA 4CDUA 1AR93 1QJY1 3VBFC 1M06G 1NCRB 1H8TC 4EJRA 1EV11 5BNPC 4PDWC 1HRV3 1ZBA2 3ZFFC 2HWB3 1X36A 4Q4X1 3VBFA 2R042 1RHI1 4FSJA 4JGYA 4QPGA 5BNPB 1WCDJ 1RUJ2 4CDWC 4RQPB 2HWB2 1VBB1 1IHMA 1R082 3ZFFA 4CDXB 1MQTC 1PVC3 5K0UA 1RB8G 1COV3 4PDWB 4JGYC 2RS52 5ABJB 3S6PA 1TMF1 1MQTB 4RR3B 3VDDB 3DPRB 1FMD3 2HWE1 1NG0A 4RS5A 2HWE2 1VBB3 1QQP2 5D8AB 1PIV3 4CDUB 1ND3A 4JGZC 4IV1C 3CJIB 4Y5Z0 1F8VA 3VBHC 1VAKA 1R093 1VBA3 1QQP3 2GSYA 4YVWB 1C8M3 3NAPA 1NA1B 5JZGA 4GMP3 3VBRB 4N43C 4CEWA 4IV1B 3VDDA 1RUG3 1FMD2 2PLV3 4JGZA 1VRH2 3VBHB 3ZFEC 1K5MB 4RS5B 2HWC1 1BEV2 4CDUC 3DPRA 1POV0 1RMU2 1AUYA 5D8AC 1CJDA 5A32B 4CEYA 1AR63 1QJU1 1VBA1 1FPN2
chains in the Genus database with same CATH superfamily
3DYOA 3B9IA 2VZPA 4XOGA 5LA2A 2PAKA 4AI0A 3POWA 2QQLA 3WZ1A 1W90A 4GMP1 1U0AA 2P1BA 3JBG1 1RVF1 5SV5A 1JHJA 1O3RA 1JYIA 1RUE2 1JYVA 2VU9A 2YBKA 1HQWA 5FOBB 3RG0A 1RUD3 3AP5A 3RRDA 1UNBA 5FZ8A 4LITA 2ZGSA 4M3CF 1QJU2 2BRTA 2IVJA 4IE4A 4WVVA 1UKGA 5J7MA 5A7SA 2B9VA 1HQNA 5FZFA 2CAUA 2XBO2 5FXVA 3IM0A 1OFNA 5LB6A 1RUH2 4YW3A 5T5JA 3CEWA 4XMAA 3LIHA 4HLTA 1YCIA 1A3KA 1VMHA 2DCTA 3KSCA 1QJU3 4JDNA 1O4YA 3WG1A 4M01A 1MPXA 2DWRA 3VBUC 5BV6A 4LE4A 4M00A 2BZDA 4WM8B 4PQQA 3VBOB 4QQLA 3KCXA 4ZU5A 3U4SA 3OPZA 2AEZA 4Y5TA 4GA9A 2C9AA 1HW5A 4IGOA 1T2XA 1SACA 4Q4Y3 3AP9A 1KFXL 1GOFA 4YW4A 3AMQA 1U5YA 2CWMA 2R16A 5JVVA 3HT2A 3GYDA 3UESA 1MZ6A 1VBD2 1QDCA 4OUEA 5C5UA 5IVVA 1H2KA 1NA1C 4IV3C 5DXDA 4RYDA 4AI3A 1OD5A 2VMDA 1IS6A 2ARBA 4CEYB 5IVFA 2WS92 4AI2A 1ZRCA 2VW2A 4XUQA 2A1XA 1F2NA 3CQOA 4LBKA 2BWCA 3IIIA 5F39A 4KG8A 4NAMA 4JV4A 3VBUB 1TE1B 3A0NA 3TOJA 1BK1A 1VR3A 3K3OA 4AVAA 3WDTA 2WO2A 1Y9GA 5FZ9A 3RJRA 3POIA 3AM2A 3WXPA 4B1MA 1DYOA 1RTVA 4FAGA 1E5SA 2VE1A 4AFBA 1AR73 2WINB 1QXPA 1B35A 4JRLA 3VHPA 5I8YA 4OULA 1HXS3 2VTFA 3POYA 1QOOA 2EAAA 1L3JA 4OQ9A 4Q4X2 1UZZA 1WW4A 5FMOS 2WFF1 3RZHA 2VBBA 3JD73 2YG0A 1RXFA 2YBPA 3CDZB 4ZU7A 2QQMA 4KNCA 2GMEA 1ND3C 3ZFGA 4YVWC 4LPLA 4CDWB 1POV3 2WS91 4M0HA 2OKXA 3H3UA 4CTEA 3C7HA 1N1SA 2VO5A 1PO22 3WDWA 1HB3A 1UYXA 1AX2A 1UY4A 4IERA 4X6RB 5DABA 5BNOC 4MG2A 1W3VA 1POQA 2D5HA 1XNCA 4KBZA 5IJRA 1YFUA 2GAUA 1QNWA 2OZJA 2WLPA 1EAH3 4D7SA 1MVEA 2WWJA 1J59A 1R083 1GSLA 4GXLA 4IEXA 1YQ5A 5ISLA 1Q8OA 2PXJA 1HN0A 4Y26A 5ANNA 2IWGB 1WLCA 2YPJA 1LAJA 5FZ1A 1VP6A 1TQ5A 4FI9A 2XWJB 1AYM3 3DXUA 4AGVA 2MEV1 5I8SA 2OYZA 2CWSA 1JZ8A 1AYN3 1LODA 2E32A 2VNVA 2WDBA 3OEAA 1UW8A 1ZBA3 1MR5A 3M1HA 1G7YA 4NPLA 5JR2A 2FMYA 3POEA 3WW4A 4QPGC 5KBFA 3AZWA 2IUWA 3B00A 3AYDA 3DF0A 1W2UA 3IMMA 4V1PA 1CQ9A 5KHIA 5AFBA 1UPIA 3P3PA 4YGEA 4XCAA 2I74A 1YQCA 1H1IA 1ZVFA 2IXCA 2RDNA 3E6BA 2X29A 3ES1A 2QCSB 3J8F3 4LBNA 4LLOA 2NQYA 3TNQA 3ZSMA 3LQCA 2HYXA 4XAAA 2A6WA 3BOPA 1KITA 3NW4A 5FP8A 4ES8A 3BYWA 3H3LA 1RUF2 2RS53 2WZR1 4X8PA 3MF9A 2MEV3 1OVSA 1OA4A 1HIXA 3V0BB 1AXZA 1VBA2 1N47A 4FFGA 5ABJC 5HBAA 3BKZA 1OH4A 1ZBE1 5A3MA 1RL3A 3ORJA 1V6MA 1DYPA 1E5HA 4MADA 4XUOA 3WQ1A 1C8NA 2JKXA 3K4ZA 4YM0A 4GJYA 5CG9A 1XU2A 3POFA 3J8F1 4Q26A 3MICA 4S2GA 2ZGMA 3PU3A 4XE9A 4HZFA 5EJZB 5E1RA 2R0HA 5IVJA 1LHOA 2E31A 4QWNA 1WWYA 4A6OA 3TEWA 5F9TA 1NE6A 2FHRA 4AGRA 2RS33 3MW2A 2LALA 3VKLA 4XTMA 4UW4A 1WUVA 3VBSC 3ZKUA 1PGW1 2JG8C 3OJBA 1OOPB 2G9ZA 2YC2A 3GCWA 4OI2A 4Q0UA 4Q0PA 4TSVA 5H9PA 3LWCA 3T1MA 2QQOA 1VBB2 5FMBA 4KBBA 1LOCA 3H7JA 4NJ4A 4UFJA 3T2QA 2JG9A 1NZCA 1OKOA 2HH9A 2VH9A 3TYJA 4ZKTB 5JXGA 3CF6E 2WNOA 2XJUA 2R043 1RHI2 4R8HA 4YRDA 4XTPA 1OURA 1QJX1 1V0AA 1H1AA 5LCWL 2BOJA 4XBNA 4BISA 5C6CA 3RJ2X 2VZOA 3OUHA 5EIYB 5APAA 1NCQB 2BVVA 1GU3A 2NMOA 1BZWA 4IE5A 2RE9A 4YFWA 2BGOA 3LEGA 5FJKA 4YW7A 4NIAA 1IG3A 3WG2A 3TN93 4BIOA 3MZHA 2VUJA 3ZFGB 1LCLA 4FO9A 4C0HA 1SQ4A 1ASJ1 3ATGA 4LBJA 2DURA 2YXSA 2WRAA 4GALA 3KHCA 2DYCA 4LBQD 3B9CA 4Q4X3 3RMYA 1DGRN 2PHLA 2G1MA 3IPVB 1CAUA 1AYM2 1J84A 1U12A 1VE0A 2A70A 3K51A 3S5QA 1QJY3 2ARCA 1F9KA 1W0PA 2UY9A 3WW2A 1OVPA 2VTXA 2R062 4IL7A 4B7EA 3F95A 3ZR6A 2OW4A 2YZ4A 2FZ2A 3ON7A 1SPPB 2O8QA 4FP2A 4CYDA 2UURA 2P6CA 4HT1T 5SV8A 1GANA 2XBO1 3PLQA 5FR3A 4S2FA 1HV0A 3H1YA 4GIQA 3WQ7A 2J1RA 4TWTA 4C90A 5JZGB 4D6SA 2MHFA 3VBHA 2DBNA 1KJLA 3JBG2 5A1LA 1EV12 1UOBA 2R32A 5JOYA 2RS13 4F3JA 2Y0IA 3HNBM 2RVAA 4PI0A 4TN7A 4UWDA 1LGBA 4IQPA 4QU2A 1WBLA 3AFKA 4CEWC 3QH6A 4UW5A 4N9IA 1I1EA 5FZ6A 1ZA4A 1TME1 4R9DA 4CCEA 4XEZA 4Q4Y2 2RS12 2J1TA 1PMHX 2YGLA 3OPTA 2ZOEB 4LR4A 5JSPA 1GNYA 3HIFA 3KF3A 4LO4B 1MS3A 3H1WA 2OA2A 2R49A 2XLAA 3H8OA 1R091 4BM8A 5DMYA 1O4TA 1AL23 1QKQA 2W0XA 3CNAA 3KD4A 3OGSA 3FE5A 1Q8QA 4RR3A 4XUPA 2VQ0A 1W6PA 4CP9B 3USUA 2Y26A 5F32A 1HB2A 5ABJA 5FUNA 5FO9B 3FX3A 5GLZA 5JAXA 4OCTA 3QCWA 4MXWB 5HCFA 5D1IA 1GQPA 5KC6A 3SNMA 4G3YC 3POJA 1XB9A 1PZ9A 1QOTA 4IETA 3TWIA 3RZLA 5A3NA 3SH5A 4MGZE 5DUWA 2P2KA 3LF7A 2HKXA 3ITQA 3T0BA 1AYN2 2HEVF 1ENXA 2I2SA 3NVCA 1UAIA 5FWEA 4C0BA 4JGYB 1N3PA 2EAKA 2YY1A 3KB5A 3MPBA 4B3NA 4AF9A 2QKDA 5IUQA 4C8DA 3APBA 1K12A 3MHZA 4QDRA 4XF3A 4XXAA 1HV1A 1H1MA 2FBEA 2ZCWA 2BU9A 3RYPA 3I2KA 3OF1A 3S5AA 2P4EA 3K3NA 1LKNA 3PUIA 3NL1A 1BVVA 3BCWA 4A7ZA 3PUQA 3HEIA 3ZSLA 4CDWA 5JOZA 2XUEA 3PNAA 1W8NA 5DDJ3 1VBE2 1C3HA 3KVBA 3OGVA 1KEXA 2Q30A 2ZHKA 2R1DA 3N7MA 4O9GA 5A70A 3CU7A 5CISA 5L9RA 3LOBA 2PAEA 3C8XA 4P5HA 5LBBA 3RVHA 1Y9MA 2RS51 5GZEA 2WABA 3KV4A 2WNVC 1UOGA 1YFYA 3JB8A 5FYYA 3AKSA 2Q8CA 4BMEA 1RVF3 3ILRA 3NO8A 2BFUL 1SMVA 1ALYA 2HWF1 2RHPA 2WBKA 4PI2A 1C1LA 1CAVB 2W91A 2HJIA 4LUKA 4ZPIA 4BCUA 2KD7A 5FTTC 4FTSA 1Q8SA 2ZBJA 3VKFC 4EQVA 1GZTA 2R0FA 3B69A 4UFMA 3SHRA 1YJKA 2BJSA 5A6XA 2JDMA 3JB4C 4CEYC 4S2HA 3WR0A 5E89A 4BQWA 4LTAA 4AK3A 5K9YA 2Q4SA 4AEDB 4IEQA 2PTMA 4YW1A 2QQJA 4P5YA 1DGWA 1REDA 4MUVA 4YLZA 1GP5A 3A21A 3I3QA 5C3RA 5GJ6A 2ZHMA 4K40A 2RV9A 1ZZ6A 3EO6A 4WZFA 4XUTA 1CPNA 1RVF2 1PX3A 4GKXA 3BU7A 4QT6A 5A7QA 1CWPA 5FUPA 5T52A 1OQDA 2ZZQA 2GMMA 1RIRA 3GHMA 1PK6B 4HANA 5C3QA 3IPVA 2PQSA 4LK7A 1FPN1 4YM3A 3B7MA 1ZBE2 3RFRA 1PIV1 4NWVA 2P37A 3H1MA 1QJY1 3SH4A 3AX4A 5KHHA 2ZAAA 4O7XA 3GGLA 2FMDA 3PUAA 3GZTB 5CVRA 1NCRB 5EQUA 4QHZA 5ERLA 3WF2A 1UIJA 1OF4A 3IBMA 4XXPA 5D2AA 1JMUB 3WQBA 5TSWA 4QGNA 2LW8A 3P3NA 4CUGA 3OGGA 2ZACA 3OG2A 5JWPA 3U14A 4CCDA 2DV9A 1X36A 2O1QA 5FBZA 5CZKA 3S57A 3UK9A 3R05A 5JR7B 3GALA 2AH2A 1JYNA 3WG3A 2JENA 4DOUA 3C2UA 1OSGA 2FDFA 1RINA 1DQ0A 1WCDJ 3WDXA 5FO8B 3GBFA 5A3UA 3K2OA 1R082 5F6LB 3DXTA 3UV9A 3ZFFA 4ZHNA 4XURA 3HJRA 4ISQA 4FXGB 1PVC3 5A6YA 5FK7A 2GP5A 1IPKA 4MXWA 4MYEA 3IWZA 2CV6A 4PDWB 4JGYC 1UX7A 2ADEA 3ZXLA 4MXVA 2QE3A 3KF5A 4XJZA 1YLLA 4YM2A 5KHGA 4FFHA 1SLIA 1YO8A 5FYTA 1W9SA 1A8MA 3WUCA 3ZPYA 1CJPA 3KT4A 2WSVA 5ABJB 1RGSA 1HB4A 3QOPA 2GZWA 5EPAA 4RR3B 2VOVA 3NNFA 3DPRB 3DKWA 1W8HA 4HSLA 4RGKA 2ZX3A 2HWE1 1MS1A 2QZ3A 4XIOA 1XE0A 4YG6A 2LTNA 3WF1A 1YQ2A 4D6RA 3MFCA 4NHXA 1SG3A 3QH7A 4CXYA 5JSRA 1URXA 4DIQA 4DEVA 2XVGA 3MYXA 3NV3A 2ZGNA 5D8AB 5DPNA 4PT6A 2A75A 2CU5A 2X53S 4AQ2A 3MIBA 4A3ZA 2JG8B 2Y6KA 1EUTA 3A23A 2W95A 3GBGA 4P9XA 2VVDA 4IDZA 4RD7A 1IPSA 4E8CA 1R093 2QDRA 3DYPA 4NO4A 2VOXA 2WR9A 4XW3A 1L7RA 2VZVA 4YM1A 4COZA 4IW3A 4YZ5A 5JZGA 5A6ZA 2AENA 1UYPA 1GICA 3FZ3A 3P5BA 2D3SA 5JUVA 5JOXA 5A80A 3D0SA 1LOBA 3AVRA 4AI9A 5FJHA 4E2QA 5JLVA 1OUSA 4OYUA 3E5XA 3ZFEC 2HWC1 1AF9A 3PU8A 1BEV2 2CY6A 3OUIA 4CDUC 1REEA 2DFCA 5D8AC 1MVQA 5A32B 1YRZA 3RSJA 2K2SA 2BNOA 2XWBB 4UFHA 4CEYA 1S2BA 2QDNA 1FPN2 3FHQA 3U1XA 1PZ7A 1MS4A 4CUBA 1KFUL 1ONAA 3MGUA 2WNUA 2IXHA 2H0VA 1CAWB 4Q4V2 1HJGA 4HKLA 1TME2 5AVPA 2DVBA 2VOWA 3TRSB 1LOAA 3ETPA 4N90A 4QPIB 3E5QA 4QX5A 2VD7A 1H4HA 1VMJA 1RXGA 4KI5M 4YZ1A 2R041 4X6QB 5CFDC 4LE3A 2DVDA 4BMBA 4C1WA 3H7YA 1VBE3 5A33A 3ZOIA 3WDUA 2ZMNA 3E1F1 2H0BA 4AAXA 1QXJA 1NX9A 5C9AC 1BMV2 5HPOA 1HRI2 1GWMA 3WHUA 1DGWX 4WVMA 3TN92 1LEMA 4IEPA 4TYSA 3MIHA 5FZCA 1DQ4A 2E6VA 4D3WA 3VD9A 4CSWA 4NPRA 4FTEA 1PGL1 1V9U3 3UKNA 2VW0A 1OBNA 2Y34A 3H42B 1CIWA 4BJ0A 1AR82 2QFEA 5IVBA 4O65A 1UY0A 3KT1A 4KGQA 1BK0A 2JDZA 4MH0E 4TTGA 2P5BA 1RUE1 4MX3A 3JXSA 4Z07A 5IVYA 3E5UA 4QPYA 1FAYA 2D6LX 2ZTNA 4YG3A 5I0SA 3KVAA 4A6SA 1W0NA 3WNPA 1LEDA 4RGGA 3T3YA 1VALA 4PIYA 1Y3TA 3I2JA 4H2AA 4CCJA 1BJQA 2B42B 5FOJB 1HB1A 3N9NA 2A73B 3HNMA 1FATA 1XQNA 3VZLA 3LDBA 1F31A 1VBD3 3IZOA 3VLBB 1IGOA 2Q1ZB 3WG4A 2YROA 4ATFA 3OTFA 3VHNA 2Q1FA 4AZZA 4BLJA 2ERFA 2FZ1A 3AJZA 1XU1A 1C28A 1R1A1 2YU2A 2JDHA 5JZGC 1NY71 1V6JA 4LHSA 4UW6A 1PO23 3ZN6A 5FY7A 4UAPA 1JU4A 2QJVA 3Q8CA 4PIXA 1LHVA 3V0BA 4OVEA 4QKNA 1CIYA 2QQNA 4YVWA 3CL1A 1H4GA 1UF2C 4GB33 4RHV2 5C8CC 1ZM1A 3BTZA 2HWD3 3MPPG 2JB4A 4PJYA 3ZYFA 5T54A 4ORFA 2C9KA 1YEWA 4WM8A 3J4UH 3SCGA 1W6NA 2BYVE 1CX1A 4QPWA 3AXEA 2VZ1A 1QOSA 1VLNA 2GMPA 1GZWB 3LPGA 5A7WB 3L2HA 2O14A 4J1WA 4NN0A 5FQ0B 3LD8A 2GDFA 1COV1 3NKGA 1ENRA 3KV6A 3ROUA 2WL1A 1QY4A 4RQPC 3RI9A 2GC3A 3OY8A 3WNLA 1IQDC 1NKGA 2V5YA 3I97A 5A7OA 4CXWA 4PF1A 2W2IA 5C4WC 4GD4A 1G6NA 2BOIA 3POBA 5J37A 2CDOA 2EALA 1MS9A 3E6DA 3GF6A 1IQAA 2OT7A 4JKMA 2JWPA 4IUGA 4CE8A 2QTWB 2UU8A 4HG6B 2D7FA 1LR5A 4JKKA 1WA6X 2Z2SB 2NYYA 4M4PA 1YFXA 3VBOC 1BHGA 2R1BA 1OXCA 4K20A 1ULGA 4GMP0 2JDKA 3JD71 3AL6A 3KM5A 1IPJA 2PHUA 3GJBA 4JDMA 4LJHA 1O5UA 1EPWA 1NCRC 2P3YA 1NLQA 2HEYF 1H6XA 4Y4YA 2EXHA 5BNOA 1GLHA 4H7MA 5KXCA 4HETA 5FY4A 3PVOA 1UZ0A 5BPXA 2BV4A 1OHFA 2OQ6A 1NOVA 5FY0A 1ZBE3 2WN2A 3OBAA 3AYAA 4Z2AA 1LU1A 2AC1A 1POV1 3HQUA 5BNQA 4QD2A 2XVKA 3OY8B 3ZLIA 4Z92B 1QGLA 1JOJA 3S30A 5AFEA 1PO21 1XNDA 2EVXA 4UF0A 5AVAA 1PVXA 2XJRA 4B4RA 5CFCC 5F2SA 1DYKA 2DU1A 4J6GA 2EICA 4HKOA 4XQ4A 4RHV3 2D5FA 5GKAC 3VBRA 5FPXA 1ZA7A 3NAPB 4SLIA 1GWKA 1PIV2 2OX0A 1GFF2 1AR71 3AB0A 4P9JA 2F17A 5F8PA 5FUIA 5L36A 2D3RA 4CP0A 3LEMA 4K9SA 3G6JB 5L7OC 1C5IA 2VUAA 3LFMA 3W9AA 3PHMA 1W28A 4UXAA 1AR92 4RS5C 4XF0A 3AYCA 3VBSA 3BVCA 5GLWA 1LENA 1ND2A 1N3QA 2DUPA 4IEOA 3VZJA 5FMCA 3K46A 4BYYA 2I45A 1NYWA 1CZVA 5C8CA 1LESA 2XH6A 1LTEA 2WO3A 5C70A 4DS0A 5J36A 2GC1A 1G9FA 3BB6A 2PHXA 2PHRA 3NAPC 4AEJA 1CZTA 4AI8A 4QXHA 1KRIA 1KQRA 4MGYE 4YNIA 3QBQA 2ZX4A 4MSVA 4F8AA 5JXJA 2VJXA 3LA7A 4YFZA 2WFF2 1H9WA 1Z7S1 1XOYA 2JE7A 5IAVA 3NNJA 1NT0A 4P02B 1H30A 2E51A 3DV8A 4XCBA 3D5OA 3VD5A 4FPKA 4EWDA 5I8TA 3GZEA 2LROA 1VB2A 5BNNA 5ACA1 4XHBA 5BNPA 1SBEA 3WV6A 3H8UA 2G19A 1ZRIA 5A6QA 1RUD2 5F3EA 4AL9A 3I2IA 2ORZA 3VB9A 1HXS1 2B5HA 4QKBA 3I3BA 4JVAA 4YGCA 2HWD1 1NE4A 5FK8A 5EP9A 3SH3A 2PHTA 1N1YA 3HQRA 1W2TA 4L0PA 4L97A 1QJFA 4OLLA 4PQ9A 2W5FA 5T5PA 1K3IA 3NKTA 2VQAA 2D97A 3UGHA 1QWRA 2GU9A 3T2OA 3ENRA 1AL21 3UKTA 1XNTA 2JICA 3TEYA 5EYYA 3DCQA 4CCLA 1MEC2 4QPIA 2VR4A 1T6BX 1TVGA 5DUVA 5EYXA 2ZKNA 1CAWA 1A34A 3LSEA 1HKDA 3UGFA 1D4M1 4AEDC 4QXCA 2DUOA 1RUJ1 2JG9B 1FV3A 1GP6A 3D6EA 3OYWB 2VVEA 1AR91 1SCSA 2VL4A 4Q4V1 2H6CA 2YBSA 5IYYA 4FCAA 2PMWB 1GQHA 2VY0A 3EB7A 4BA6A 4DUXA 4Y22B 3BI3A 1FX5A 2MPFA 3MLLA 4WBBA 3ABZA 4YW5A 1DZRA 2ZABA 2W1SA 4LQRA 3PURA 3O0WA 3JUUA 1S0FA 3EQEA 2VNGA 1BEV1 2BERA 4HPKB 1QF3A 1C1FA 3EBRA 2VVFA 3CMGA 2XQRA 4XF4A 4I0WB 5FLHA 4LOSA 3WCSA 1C8M2 5HXVA 2W39A 1FOD3 1WKYA 5H9SA 2XKPA 3GBWA 2GN7A 4UBHA 1RUF3 5ACA3 2XR4A 4GB31 1YYNA 2PLV2 4R9CA 3WP3A 5I0DA 4Q4V3 2XJVA 4FPGA 2K9ZA 2V73A 1H8TA 1SFPA 2W1WA 1L7QA 1D4M2 1G9CA 4YZ4A 5DN2A 4K1YA 4AQSA 4CPBD 4HFSA 3UJOA 1HJFA 1RMU1 3HPNA 4FFFA 4M3CA 5ANQA 3UGGA 5JMCA 1BBT1 4RFT0 4GH4A 2FDHA 4NIGA 2B8MA 4I3GA 5F1RA 4EV0A 5FV3A 3NMBA 1W9WA 3JCIA 1UYZA 4FOYA 1BKZA 4D7TA 4AGGA 5LEKA 4OUMA 2RS32 1XNBA 3OUJA 2ADDA 1ULFA 4FPCA 1QNYA 4BHPA 2EIGA 4RA0A 2VC9A 4HONA 2XL7A 1COV2 3U75A 4EYUA 2WZEA 4K8FA 5JXHA 1MQTA 2DVAA 2GC2A 2XJQA 2XVLA 1QJX2 2X10A 3I8TA 5DAVA 5FYSA 2ARXA 3F2ZA 3VKOA 3NQHA 4RR3C 3VDBA 2CAVA 5FZGA 4BOWA 1RUH3 3JD72 3OSDA 1J3RA 3VD4A 2A6VA 1AZDA 5HCHA 2XHKA 4AI1A 3BODA 5F3GA 1O6UA 4QPIC 5F3CA 2Y6HA 1R1A2 4HK8A 5J1XA 1O3TA 5FZOA 4GWNA 1OH3A 1RUE3 1TMF3 1VB4A 3PVEA 4XFGA 1DQ2A 4P9LA 3PJQA 5JMOA 2VQUA 1AVBA 4AEMA 1N1VA 5FIXA 5HI0A 2VZUA 1OA3A 4BXFA 4KMQA 4M4RA 2IXIA 5JI7A 4I01A 2J42A 2H6BA 3CO2A 2PHDA 3BIWE 1R64A 1F35A 1VBC3 3KZ4C 4Q4W1 4Y33A 3ILFA 4RL7A 4Z8BA 2YYOA 1X9TA 1DLLA 1W8UA 3TAYA 1RUG2 1S0IA 4MV2A 3KLSA 3LA2A 3ZX7A 2BWAA 1AYN1 5C5TA 1WLDA 5FXXA 4XUNA 4YGBA 4Q0VA 2R063 4FFIA 3RWKX 1Z7S3 4EWEA 1VIWB 3JU9A 1NAEA 3ZSJA 5F3IA 1IOAA 2BGCA 4MGIE 4GQ7A 4A41A 2WNEA 4NHMA 1W6OA 3ZYPA 5FXZA 2E7QA 5LBCA 1UWWA 4AEDA 2LM3A 2DF7A 1ZZ8A 2NN8A 4ATEA 1I5PA 4DUWA 5F6KA 5FPLA 5JIAA 2X5IB 1REFA 3FMGA 1W06A 5IVCA 3H0OA 4XC9A 1LRHA 5H9QA 1HX6A 2FDJA 2JXAA 2ZEZA 2B46X 3B5LB 3A0KA 4YVSC 2JKBA 2P3IA 4AHZA 1CESA 3HNYM 2PYTA 3ZN5A 1DCSA 2WZPP 1DDLA 2F6BA 5EZWA 3IDBB 1PHMA 1D0GA 4XQWA 4RQPA 4A4AA 4AR2A 4Q1PA 1WLTA 3CJIA 4COUA 4QPGB 1AL0G 5C4WA 2VMHA 4IEVA 4GKYA 1ZZBA 2OZ6A 4XJ9A 2DCZA 3AZVA 1V70A 3L2YA 4AXOA 1VMFA 3WLUA 5T5LA 3WW3A 2Z42A 4Q2FA 2CTVA 1JH5A 2BVBA 3N7KA 1EV11 4LO6B 3LPFA 5H9RA 1E5IA 1PK6C 4IE6A 1HRV3 1ZBA2 3N4MA 1MS5A 4H3WA 1W2NA 2QVSB 5FYIA 2W87A 3V65A 4OZXA 1W8OA 3NSTA 4Q4X1 3VBFA 4HN0A 5GM0A 3RI8A 3H3ZA 3V56A 1RHI1 2EF6A 5L73A 2JDPA 4DZGA 2Q1MA 2F4PA 3B93A 4JGYA 5FBJA 2XJTA 1QJEA 3G7DA 5F37A 3J9SA 4FQZA 1RUJ2 2ZJCA 5G05L 3T4VA 3QD6A 4RQPB 3DGTA 1BYHA 2Q5TA 3MF6A 5CNAA 2DFBA 3LE0A 2D93A 4CDXB 2WUHA 3ZYRA 1MQTC 3NJXA 4LO5B 1GKBA 4XDOA 5A1AA 2WYFA 3MW4A 5K0UA 4BQ3A 3O1PA 1RB8G 2ET7A 1X8EA 2C6SA 2RS52 4LKDA 1ULDA 2I07B 4LHKA 1OA2A 1W6PB 1XE7A 4WVZA 4A7YA 2ID4A 2JECA 4CP2A 5L9VA 3I49A 3DUIA 1O8SA 4FOVA 2WT2A 5KXEA 4R4XA 2SLIA 4BQXA 4RS5A 3O1RA 1QH6A 2PHWA 2B39A 3KV9A 5D21A 1LOFC 3SKVA 5JDBA 5FMDA 3V0AA 4FXKB 5FYMA 4AE2A 2PAMA 4XFCA 1QQP2 4NHKA 2CSGA 2P3JA 1DGLA 1XNAA 2HBTA 2V72A 5A3PA 1P8JA 4IXLA 1ND3A 5C33A 3M3QA 3OD0A 4Y5Z0 4PF5A 3VBHC 4UFKA 4BLIA 5BYNA 3EXUA 1FT9A 5FZAA 3OD4A 5FZMA 3O7OA 1NA1B 2VBDA 4Y1YA 2VNOA 1AJOA 2PA7A 1OLMA 5J48A 2XHNA 3M3CA 3SCFA 4CEWA 4IV1B 1FV2A 1MZFA 3VDDA 3B02A 1RUG3 1FMD2 5LBEA 1AX1A 4EZHA 2WC2A 2ZGKA 2WNUC 4JGZA 4XETA 1HLCA 4Y5SA 3UT0A 3WF4A 4J25A 3WEZA 4B8EA 4RS5B 5EXOA 4DRRA 4XJAA 1GQGA 5LZ6A 1KGYA 3DPRA 1OQ1A 3I59A 3CHXA 3SEPA 4URAA 4V2VA 1ULEA 4AFAA 1AR63 1W9YA 4LEJA 1SLCA 4C91A 1VBA1 5IVEA 1JZ4A 3ZFGC 1WCUA 2WLQA 4L9BA 1MZ5A 4D7YA 3SITA 2Q8EA 4CUAA 3INAA 5HV4A 3IB3A 3T4HB 4OHYA 1V9U1 2ES3A 2B4KA 1QEXA 2GALA 3PUHA 1RUC1 4KL1A 5E8AA 4CCCA 5FY5A 4MGQA 1WCKA 2D98A 4L2NA 4YVSA 4A44A 2XG3A 4IE0A 5LY1A 5JOWA 4ISRA 5FP4A 4BE3A 5CKMA 3KV5A 4QX7A 1W99A 3MUZ1 2VQTA 1HRV2 3WP4A 4HN1A 1W8ZA 2FDGA 3WOGA 2J1SA 2AUYA 2ZGPA 2O0OA 4QDSA 2EA7A 5F5CA 1NZIA 1PNFA 1X9PA 1PO13 1ZX5A 3IMNA 3TEXA 4CDXC 3RZMA 3E6CC 3PUSA 1DG6A 5CEHA 2D6OX 2OPWA 2DCKA 3PL0A 5CFDA 2ILMA 1NLRA 3DECA 3O1MA 5LW9A 4M3CB 1PO12 1UZVA 4WM7B 5A3TA 1WZXA 5IK8A 4ZS2A 4JDOA 4PBPA 1TNFA 2BPA2 4DXTA 3WQ0A 4LT5A 1DHKB 3ELNA 3I2HA 4Q29A 4K8RB 5LA0A 1W39A 2ZGLA 2VZ3A 1XBFA 1OOPA 3FUOA 1US2A 2XLGA 3MBWA 2WNVA 5FPBA 1W6MB 2W46A 3PVBB 1GV9A 1LULA 2VMFA 3HBZA 3WX5A 3GZAA 1Q5OA 3IAQA 5DQ0A 5EHDA 1WCSA 2IXLA 4CCNA 2RR13 2JG9C 2QZ2A 4Z82A 3FLTA 5IAXA 4YG0A 4JHTA 3VDCA 5FCCA 2GC0A 4WM8C 5DDJ2 2ZS6B 3WD5A 2NMNA 4CDQC 5L9BA 1W03A 1XC6A 3CKHA 4N43A 5DZEA 1U5XA 4EE2A 2F4LA 3SEEA 3ZYBA 3N7JA 4S2DA 4RHV1 4KGGA 2VMGA 3O14A 3AP7A 1KJRA 4MZUA 4F7ZA 2KR2A 4B1LA 4XF1A 5T5OA 3OBZA 3H8XA 3GDBA 3T2TA 1BCXA 4MGKE 5CFDB 4NRQA 1V6KA 4QM9A 3TN91 2AYHA 1QMJA 3NV2A 5IWFA 3T0DA 3B94A 5FYVA 3J7MA 3N9MA 2A3YA 1UD1A 2AGSA 4QAWA 4D6QA 4XJ8A 1ULCA 3ZXDA 5KWRA 5G04L 2FDIA 1Y4WA 2A3WA 2XLFA 4YGDA 1SLAA 3IN9A 4QX0A 4AYUA 2ZA9A 4R52A 2OS2A 3OB8A 1XSRA 4ZZ5A 4AFCA 2VUDA 3AZZA 2VMCA 2DBIA 4JQRA 4BPZA 4BQ5A 1E57A 3OEBA 4DMIA 1Q56A 4I02A 5FYUA 2J7MA 3VDAA 3ZKYA 4E4SA 3MO4A 3ACIA 3AMHA 4PLOA 1D7PM 4UFIA 1F5FA 3OPWA 1O7FA 1ULPA 2OXBA 1R092 4FT8A 4Y20A 5JI9A 2QUOA 4URTA 1MEC3 3ILNA 5BNNB 2ETEA 3I2FA 4QHBA 1ZZ7A 2J1VA 1EUUA 2WYSA 1RUI3 2FQPA 4Q27A 2NPIA 4YZ3A 4CZSA 1IS3A 1DP0A 1JYCA 2J1UA 1LJ7A 1MZEA 2VTXJ 1AHSA 3DPRC 1S55A 3NJYA 4DY3A 5FZ4A 2RMU1 1S0DA 1ZYBA 2W08A 3S7EA 1V6IA 3URFA 4CU7A 1APNA 3ZIWA 3I2GA 3Q9OA 2HYKA 4LORA 4OHVA 1C8M1 1BLZA 2BBAA 3AP4A 3Q8AA 5DAQA 5DG1A 5L7OA 2C26A 5CKQA 5F7UA 1YQ6A 2HWC2 1XSQA 4ZZ8A 1SLBA 1VRH1 2PELA 3ALQA 3VV1A 1EP0A 5HCBA 3V64A 1PVC2 5FZ3A 3WNMA 3ZYIB 4YW6A 4QX2A 4AVTA 5FZDA 1W8FA 2R073 4N7UA 5FZHA 5E16A 1ND3B 2X09A 4BXSV 4QXBA 2RDSA 3ZXFA 5CFCB 4LKSA 1CVNA 1QQP1 1W9FA 5FZBA 1OMIA 1ODNA 1DZTA 2J22A 4Q1RA 1D0HA 4AOCA 1YUDA 5LA9A 1KDKA 2WT0A 2SBAA 4JTOA 3VBUA 2VAUA 2WS93 1H8TB 1ULOA 2YUEA 4LBOA 1RUC3 3WDVA 3CJXA 2FCUA 1VRH3 4M0NA 3VZNA 2ZX0A 2CGPA 3T2PA 3WY6A 1WD3A 4LULA 4J1XA 3ZM8A 3HD8B 1F5JA 2Y6LA 2R071 2R30A 3D82A 5DUUA 1XYNA 2Q8OA 2JIJA 3CJIC 1ND2C 2RM21 4IV3A 5DAXA 4JAAA 1ENSA 5FKCA 4CCKA 1XNKA 3LIGA 2XJSA 2GNDA 2R061 3I7DA 2WQZC 1YC61 2YFUA 3HOBA 3KGZA 1GWLA 1N3OA 2AZ5A 1UPSA 3C7FA 4MOAA 2QQPA 2ZAHA 5IHRA 2BUKA 4OMCA 1RJ7A 2BP6A 3VZOA 4P9YA 2IFRA 1A78A 3DYMA 2Z69A 4N53B 4GWJA 2AACA 4FBFA 1TG7A 3EMRA 3S7IA 2W1QA 4CDQA 3W5NA 4LHLA 2JX9A 4I0AA 1SCRA 2A6YA 2W92A 5GZCA 1F4HA 1RUJ3 1ASJ2 2XXZA 3R6SA 4XBLA 1I9RA 4UFLA 4D94A 4C1XA 4XPVA 1NY72 2Y38A 3RYKA 1HRI3 3BTAA 1B09A 2RJLA 4CP1A 5BUVA 2D3PA 3QACA 3PJYA 3GNEA 3T09A 3BIEA 4BIFA 4FTBA 1LOGA 2RR11 2V09A 1GNZA 1JODA 2RJ2A 1R1ZA 1UOFA 3EHKA 3LFIA 4N8MA 3KCYA 4Q4Y1 5C4WB 3ZYGA 2FD8A 4UOJA 3M7AA 2E33A 1QU0A 2WT1A 1UX6A 4AWDA 4GWIA 1PX4A 1UL9A 3AMPA 3VHOA 4DQAA 1RJ8A 1UY1A 5ACA2 5IT6A 3O1UA 1HDKA 3FFZA 5C9AA 2YC0A 4BK4A 1RUI1 3LDKA 5FY1A 1JYTA 1XYOA 1CAXB 4N43B 5AC93 1JOBA 3ZXJA 1BMV1 5CG8A 1AR81 2JDAA 4XFHA 2C24A 4LBLA 5GALA 1DQ5A 2GN3A 4LIVA 3FLPA 4B29A 4AEKA 4F83A 3I59B 2WFF3 1XXNA 4BWOA 3W58A 1QDOA 1UXXX 1LHNA 2Y60A 4QX8A 4COWA 3O0VA 1E5RA 4CU9A 2WWSA 3LCPA 3LEIA 1YXWA 2WIIB 3NRUA 1UN1A 3GJAA 1K5MC 1GZ9A 1ST8A 3K4AA 5A3WA 3THDA 5I91A 4QU1A 4B4PA 1W04A 3RMXA 4MO3M 1G86A 2W9XA 2D44A 5J98B 3VDDC 5IFTA 4ZXEA 4OUSA 4NIDA 5AC91 2HLEA 2DCJA 4AG4A 3LZZA 3HN1A 4BQ1A 4CPBA 1YNAA 5CA6A 3CLPA 1AYM1 3LDRA 5C3SA 2Z4FA 2BFUS 2ZX2A 4B4QA 5DAWA 3FLRA 4EN9B 2V4AA 1IKPA 2AEYA 3CZUA 2E63A 1XJAA 2OQ7A 5LRRA 2DU0A 4AFMA 1X33A 4QKFA 2XKOA 1UU5A 2RDRA 2RR12 1GOHA 2OUJA 4QM8A 2P3KA 4RSUA 2WA4A 4XILA 4QB1A 3ZYJB 1W8TA 2D6KA 3B01A 1OUXA 2BNNA 1RUI2 4ONUA 1W6MA 4XBQA 2ZMKA 4EN8B 1XPWA 3THPA 2RM23 3QLQA 5K0UB 2WNUB 2Y6JA 3HR9A 1PM7A 2XB6C 3N36A 4CDXA 5J96B 4EZ4A 5LWBA 1OPOA 1SBFA 4NWWA 4QX1A 3A22A 4TZDA 1DF0A 2WSUA 1PGW2 1SLTA 4GZ9A 4WM7A 5T50A 4YPJA 1H6YA 1X8MA 3MI8A 4JX0A 1Q8VA 3RS6A 1YI9A 3PVNA 4XFBA 3WF3A 4K21A 3MW3A 3HT1A 4FPYA 4Y1VA 4KWUA 1HN1A 1UOJA 4IV1A 4P08A 1WCQA 5BY5A 3O1OA 1PNGA 2QQIA 3J7LA 4TLGA 1OOPC 1VBD1 3ASIA 3NV4A 5DZGA 3SKJE 4L99A 1QJY2 3VKMA 3RYRA 5A7PA 2VPVA 2ZEYA 1HXS2 1EAH2 4P14A 1QH7A 4CDQB 1RUOA 2WFPA 2RJKA 1JUIA 2VOKA 3HQXA 3VBRC 1GR3A 1RUD1 3OGJA 4COVA 1O3QA 4G4FA 2XONA 4KG0A 4QGMA 2BBVA 3RZJA 3ACLA 3BALA 1PGL2 4N7IA 1BQPA 2ZPXA 3IKWA 4H7LA 3N7LA 4AW7A 3Q8FA 5HV0A 1Q3EA 4LUMA 4EROA 3UNPA 1NCQC 4GB32 2YGMA 3KS7A 4PBOA 5JSOA 1UU4A 5FREA 3RPQA 3U0ZA 1AR72 1S0BA 2XDVA 1DBNA 2Z5WA 1GNHA 4L92A 1FOD2 3I2DA 4DEQA 4W6XA 3HN3A 2P17A 1WMFA 2W47A 1EV13 2ZKLA 5C7GA 4OFGA 2WNVB 3M2MA 2C5DA 2W68A 4XFIA 3FFQA 2RMU2 2YHJA 5IK5A 2VCBA 1O91A 3BPSA 5LY2A 5AC92 2ZHLA 1VJ2A 2X5IC 3AL5A 3D4KA 2Y0OA 2YU1A 3PIJA 1RUC2 2FCVA 2ZGUA 3KT7A 4QMAA 3BGAA 4QXKA 1NXMA 4MLOA 3ACHA 3N9QA 3VKNA 5HCAA 1D2SA 1EAH1 3MLKA 2WZ8A 4I2OA 4HKWA 1V9U2 4CDUA 3FUQA 1VAVA 2E26A 5GZFA 3VBFC 3MV11 3NV1A 1VRBA 3WINE 4BDVB 2TEPA 3SC7X 3DL3A 4OHWA 2D43A 1ZZCA 4NE9A 3ZMOA 4JZRA 3U07A 3V0AB 3NWKA 1ZRDA 2ZGQA 5BNPC 2WKKA 4FVVA 4META 4PDWC 3UKVA 3SISA 3FL7A 3NJVA 1UZYA 2X8KA 4KU7A 3OBRA 1GUIA 3RZKA 5FY9A 4XYXA 1J3QA 5T3NA 2WN3A 2IC1A 4IE7A 2J1EA 4I3PA 1S2EA 4CUCA 2ENRA 1JYXA 1J83A 3FJSA 1L7LA 4JCKA 2C0ZA 3OGRA 5FLJA 1KD7A 4QPGA 1GP4A 2A3XA 4FOQA 4CDWC 2WAOA 4QHOA 2CHHA 5GZGA 1G9BA 4TLFA 1PK6A 2ZXQA 3I54A 4COYA 1IHMA 1H8VA 1UU6A 1EYBA 4W65A 2YMZA 4NUBA 3C7EA 4E2GA 3FHAA 1IS4A 3N9LA 4K7JA 4BZ4A 1J3PA 2UYBA 3AJYA 1LOFA 3C7GA 1NQDA 3Q8EA 1UIKA 1LGCA 3C3VA 4LA2A 2BDRA 4Y1ZA 5CIRA 4BQYA 5JXIA 2CDPA 1OC1A 4UBGA 5FZ7A 1LHWA 2MNGA 4HVQA 2DUQA 2JDNA 2KM2A 1DLCA 4NRPA 5KR7A 1MQTB 2OIIA 1MS8A 1TZOA 2ZGRA 4YWAA 4AHWA 2GNTA 1UMZA 1NQJA 1JOPA 2DCYA 4H55A 1F4AA 2EIBA 4A7KA 1JI6A 1SFNA 3GCXA 4HOOA 4HXCA 2JD9A 1IKQA 2D40A 4NHLA 1CAVA 4FAHA 3RZZA 3ZPOA 4CDUB 4LO7A 1Q43A 4NPMA 4JGZC 1W6NB 4IV1C 3LB9A 5A1FA 4Q5OA 1F8VA 4Q0QA 1VAKA 4E4HA 3IDCB 3D8CA 3W5MA 3LA3A 2JE8A 5KHJA 2GSYA 2XJPA 3DKQA 4YVWB 2LS6A 1U5IA 2HEWF 4K6BA 3VBRB 1IZ3A 4AQ6A 4DINB 1C5HA 2WJSA 1UMIA 3POGA 4XF9A 3ZN6B 3IIAA 1YWKA 4MHUA 4HVOA 1O4ZA 1NLSA 2PLV3 3ZVXA 3M4FA 1D4VB 3VBHB 1YIPA 3K4DA 4DB5A 5I0TA 1K5MB 3RZGA 1SEFA 1S2KA 3IAPA 3N9OA 1RMU2 1AUYA 1WMXA 2OPKA 1S0CA 3NNGA 3AP6A 1QJU1 5C9AB 2IFWA 1JHNA 1STMA 3NJZA 1F15A 4YSFA 2G9FA 4PDWA 3FBYA 1XYPA 4CVUA 5FPVA 4EN6B 5FPAA 5FP3A 2VMEA 3ACGA 3U11A 4CA9A 4A2UA 2VOTA 3HVDA 1WD4A 2V5DA 1SFYA 1OQEA 2CGNA 1PMIA 3OYWA 1FPN3 3OBTA 3C7OA 1CAUB 1OF3A 3WNOA 2YB7A 2YFZA 4LHNA 4XIKA 1OLQA 3K48A 1QJX3 2W3JA 1PGSA 4JQTA 4LNVA 1Y7BA 1W3XA 5JIUA 4CP9A 1AR83 5F2WA 2B7YA 3TEZA 2HBUA 3ZO0B 4ARXA 5B2GB 3R4UA 4FOWA 1S1AA 4A42A 1X50A 1V00A 1WA4A 2JEMA 2A71A 1RUH1 2EXJA 2YV8A 3MUY1 4Q0SA 3WF0A 1VPHA 4OQ8A 4KWKA 2BGPA 5T55A 4IEYA 5FZOB 4OI0A 2VECA 4NHYA 1JXNA 1CD3G 2DTYA 3ZDVA 1YHFA 4KU8A 1BXHA 4JTNA 3AKPA 3I2OA 3ZXGA 5GLVA 5FPZA 4ZONA 4KH9A 1K42A 3W59A 3AXDA 5FPUA 3ZR5A 2Y6FA 1O8PA 1RUG1 3AZYA 3M8LA 1AL22 4Y24A 1H2NA 1QJZA 3K75B 2NM1A 4CCMA 4NR1A 3SCHA 4SBVA 4OHZA 2O8OA 4YYOA 1RMU3 1VBC1 4Q4W3 2QBXA 1UQXA 4HPKA 5E6HA 4QGLA 5C8WA 2XPJA 1LNSA 1SPPA 2E9QA 2WAAA 1H0BA 1ODMA 4YARA 3HWJA 1CGPA 1S4CA 3GM8A 3MV01 1V6OA 5FO7B 2IXKA 4IESA 1JZ7A 5F5AA 4XJUA 3FBMA 3THCA 3WSOA 3JBG3 1FYUA 2W52A 4NVPA 5FZLA 1Z0HA 3AKRA 1A8DA 3POSA 4MGSA 3ZXEA 2Q0AA 5EJ1B 5JCTA 3UL2A 3HMYA 4CU8A 3BPZA 4XDPA 4HVRA 3MIDA 3RWNA 2XGXA 5FZEA 1R081 1W05A 1PMJX 4E2SA 1LOEA 2R072 3ZYHA 4H14A 2D6PA 5FP9A 2QQUA 2RM22 1ZBA1 2ZEWA 4UT5A 3T30A 2ZZJA 3HBKA 3W20A 5L7OB 2ARAA 5FYHA 4LKFA 1VBC2 1O5LA 2Y33A 5DZFA 1M4WA 5BNNC 1OLME 3UYJA 1WW7A 3SLIA 2LUWA 1ENQA 3H9AA 1EPZA 1W9TA 5B4XA 4UYBA 5IW0A 4QDQA 2ZGOA 3J8F2 4NAOA 3N9PA 4Q8LA 4LBQB 1SHWB 4WM7C 3PDQA 1UY3A 3M3IA 3ZFEB 4CU6A 1ZRRA 1CAXA 3VN4A 3ZFEA 3FWEA 1UYYA 3BN6A 4NMIA 5BNOB 1YI7A 2N7GA 3AC0A 1S0GA 2IZWA 1A6CA 2W94A 3FC0A 3MDPA 2UY8A 4FPJA 3SQOA 1OT5A 3A4UA 3AZXA 5DAPA 3WVJA 4CRQA 3VUOA 1DIWA 2WZR3 3LSDA 3RNSA 2AREA 1CZSA 4IEWA 4CCOA 4TXWA 1JN2P 2TBVA 2HWF3 4WZCA 3IDAA 4AAPA 3S0MA 1PZ8A 1FOD1 4D8MA 1FMD1 3O1SA 2R6QA 1UCXA 3AKTA 4IGPA 4UI9L 4JGZB 1RHI3 2GH8A 1I3HA 1CN1A 3U78A 4P00B 5C8CB 1W6QA 2QQWA 1J58A 2L9LA 2IVIB 4GULA 2QNKA 4L8QA 5K0UC 4HBNA 5FZ0A 1JTZX 2ATFA 2JDUA 3RQ0A 4ASLA 2NP0A 1UKRA 4GH4C 1C4RA 2VCMA 2UYAA 1XE8A 4DXRA 4LA3A 1YFWA 1GZWA 4XDQA 3KCCA 5K4LA 2NZ9A 1RC6A 4WV8A 4LXLA 4AFDA 2R7EB 1AR61 1WW6A 5F5QA 5IK4A 1DU3D 2VG9A 3P1IA 3ZXAC 2WQ4A 1D4M3 5FP7A 1GZCA 4ZS3A 1UY2A 2X05A 3FHIB 4Q4W2 2ZEXA 2PQQA 5K7PA 2HWE3 2A6ZA 4IEUA 3J26N 5J3UA 3UETA 4P9GA 3MFAA 4UF0B 1JZ5A 3CZJA 3WP5A 3MIFA 2JJ6A 2E7TA 4XZUG 4U2AA 4DUVA 1ZNPA 2BTVC 4Y4RA 4BQ2A 5CBLA 3PIGA 4XABA 2BEOA 4DXZA 3AMNA 3VHRA 2JIGA 2PHFA 4GJZA 4DXSA 1OLRA 4LK6A 1RUNA 5FYBA 1N1TA 3ECQA 1W0OA 2ZGTA 4FPFA 4ZU4A 3ZMNA 4Z2WA 1ASJ3 4MGTA 1K45A 1CR7A 1JZ6A 3J7NA 3ZXKA 4JKLA 3I3MA 1EY2A 3VZMA 2VGDA 1G8WA 2VCAA 2Y8KA 3M70A 4MVTA 3VBFB 4PLNA 4FPHA 2ET1A 4LOTA 3VBOA 2IXJA 3D3AA 5DDJ1 4BK5A 4O61A 5FDBA 2GP3A 4ZXKA 1OI6A 2B45X 1SZBA 5FRAA 2JE9A 3N3HA 4LMFA 4WVMB 5FKBA 3B3QE 5F5IA 4OZOA 1NCRA 3ZSKA 4DPNA 5A7WA 2HWD2 4YW2A 1OKQA 1D2QA 4YVSB 2J1AA 3JZVA 2VUCA 1WMDA 5EWSA 1NXD1 1K5JA 4ES9A 4JC1A 5A33B 4N53A 4B7KA 3USSA 2WQ8A 5EFUA 4ITCA 1AR62 3GZUC 1O59A 2UWBA 1H2LA 1T6GC 3KWVA 1YIFA 5IK7A 4R9AA 1JZ3A 5KXDA 1TME3 4IV3B 3ME2A 5EV7A 1PO11 2GNBA 4OI1A 1PVC1 1K5MA 1GYKA 1OD3A 1SBDA 3AVSA 5CB7A 4Y20B 2G9GA 3KQ4B 4QQHA 1J1LA 3I3DA 1GBGA 3PTYA 4W6YA 5LK5A 1WLWA 5CYYA 1BBT3 5DG2A 3H8RA 2Q8DA 2ZMLA 3VD3A 3ETQA 4CEWB 2E7AA 1RITA 4IEZA 4BB3A 3KHBA 1G9AA 5FYZA 2Y64A 4O9EA 1ZZ9A 1NA1A 2UWCA 3PMEA 3USUB 3HAGA 1W6OB 1ND2B 3W21A 4XQDA 5M0TA 3BUCA 3VBSB 4XZPA 1BBT2 1ZRFA 3M3OA 2ZHNA 1LU2A 1OFSA 2LRPA 4EWAA 2A5ZA 4LO8A 1S0JA 3KGLA 1KDMA 3IT8A 5FLIA 1WW5A 2PFWA 4MHRA 3OCPA 5CFCA 4NOTA 4GH4B 2EIDA 3VD7A 2XQXA 4G9SB 3DEMA 5LEJA 4R9BA 2CNAA 4P9IA 3ZIXA 4LIUA 4I0BA 3MIEA 1TNRA 4QB2A 4A45A 2DDUA 5D8AA 1NUKA 2XBO3 1I5ZA 2TUNA 4OHXA 1R1A3 1SDWA 3WHTA 4AQTA 4XACA 5GZDA 4INDA 1B35C 4HSJA 1GMMA 5IATA 3ZDSA 3R4DB 1OPMA 4X8NA 3WNNA 1VBE1 3WNKA 1US3A 2CGOA 1W6QB 1AX0A 4FPEA 2VZRA 4GAZA 4E4DX 1V6LA 2W1UA 5DUXA 5CU1A 3ZN4A 1FNYA 2ORXA 4IGQA 4PHZA 4QX3A 4M3CE 3P6BA 4R4ZA 1I6XA 3JQXA 4I30A 4AVVA 5L19A 3E97A 1JYWA 1GOGA 4Y22A 5LBFA 2Z79A 3AK0A 3MIGA 3M3EA 1XRUA 1DFQA 2P6HA 4LLFA 3BU0A 3R0RA 4ZY9A 2WO7A 4NIIA 3ZFFB 5I0RA 4AVCA 2HWF2 4PCRA 3T08A 5A32A 5A3OA 4OI4A 1H2MA 4RN5A 4EN0A 5FWJA 3WUDA 4N53C 2WO1A 1WGPA 3N35A 2FDKA 2VM9A 4XFFA 2WA3A 4LBQA 5FZIA 2HWC3 1U5ZA 1WMEA 3LGRA 5KC5A 4K3UA 1YJLA 5EJ3A 5CAZA 4XVHA 3NNLA 5LA1A 3D0JA 2XOMA 2G4IA 5FFOC 1TMF2 3TBDA 4HMZA 2GNMA 4WVWA 4HK9A 3VL8A 2RS31 4ARYA 1RYYA 2CYFA 2VXJA 1Q8PA 3JQWA 3O12A 1HQLA 4UW3A 2DVGA 4KQ7A 1NCQA 1W8WA 2HWB1 2RMU3 4XMIA 3U10A 3UJQA 3WCRA 5LK7B 2D6MA 5A7NA 1Y43B 2ZX1A 2VCCA 1S0EA 3OOXA 1W2AX 5JPNB 1Y9QA 3ZSEA 1KS5A 1YQ8A 2YC4A 1B35B 2UWAA 3WDYA 1VAMA 4AHYA 4E8DA 3FN9A 4E9KA 3U37A 5FXWA 2DTWA 2E53A 3Q8BA 4FPLA 2PLV1 2XL9A 2KXLA 4DRVA 2JDYA 2RG4A 1SDDB 5BXXA 5HXMA 1Z7S2 3RGBA 2X5IA 1O3SA 2XUMA 2OVUA 3IDEA 5GLTA 3AYEA 4GWMA 4AVBA 3VGIA 1WBFA 1DGRA 1Z78A 1JUHA 2VZTA 4Q8KA 1UO9A 1MS0A 3O5SA 3LOIA 4P9WA 1HRI1 5FY8A 5J09A 3ES4A 1AXKA 2K46A 3ACFA 2CL2A 2GH2A 4N9HA 1BEV3 1X82A 5C71A 3WW1A 1BVP1 4NROA 1JW6A 1DQ1A 2VNRA 4Y1XA 1HRV1 1H9PA 5I93A 5CKNA 4XJWA 4ET7A 4Z1VA 1FNZA 2VW1A 1AJKA 1QHDA 1LECA 5FMOL 3VZKA 3T0AA 4LBMA 4FPOB 2Y6GA 1RUF1 2WZR2 2RS11 2P34A 3I3EA 5E88A 3PMSA 2MEV2 2JG8A 3SXWA 4BU2A 1MEC1 1CX4A 3BOWA 1AR93 3THTA 2TNFA 4E27A 1M06G 2VZSA 3AFGA 1FXZA 2QQKA 2VMIA 2EIEA 1H8TC 4JHZA 4V2WA 4BQ4A 3R4SA 4E4ZA 4EJRA 1AXYA 1FI2A 3TNPB 3BTXA 4EN7B 3J7HA 2PN5A 1W2OA 4Y1UA 3WT3A 4D69A 2C1FA 5LRSA 3PTRB 3ZFFC 2HWB3 3T1LA 5LATA 2VBPA 4QB6A 2VZQA 2R042 5KXBA 4AHXA 2XMLA 3GXUA 3LEKA 5I0UA 4FSJA 3CIHA 4KWLA 2BQPA 3H50A 5BNPB 3BTYA 1JBCA 2FCTA 2HWB2 4RFRB 1VBB1 1IS5A 2JD4A 4ASMB 5LASA 1LHUA 3EJKA 3WP6A 4XFAA 4DNYA 3KMHA 2VXRA 1DQ6A 4DY5A 1COV3 4CXXA 1UZWA 3AKQA 3LAGA 1CONA 3I4IA 3MLJA 4K1ZA 2A7AA 3RDIA 4QQOA 2BW8A 3CBNA 4NRMA 4OMDA 4LKEA 3S6PA 3X29B 2KA3A 1TMF1 5JPMB 4HL0A 3VDDB 1JS9A 1FMD3 1NG0A 2BNMA 1UMHA 4L11A 4NIHA 1LGNA 4W6WA 1LB2A 1JU3A 1X7NA 2HWE2 1VBB3 3KQRA 3O1VA 4FQ4A 4PIZA 4D0QA 4XHXA 4W8JA 1KS4A 4DFSA 5FQ0A 3WNXA 3NNMA 2K0GA 2B9UA 4AVSA 1MACA 4W4ZA 5IFPA 1PIV3 4QQ2A 5CADA 3EYPA 3U4XA 5A3LA 4JRAA 2JB8A 5GLUA 1TEIA 3DN7A 1ZREA 3A7QA 3CJIB 1QIQA 1J1TA 1JZ2A 1CPMA 4QKDA 2WWUA 4ASKA 2AR6A 1VBA3 1ACCA 1QQP3 2EXIA 3L9JT 4W50A 1C8M3 3NAPA 3ST7A 4U36A 4BH9A 5K8SA 4GMP3 3O1TA 5FZKA 3LKJA 1DZQA 2QQVA 4N43C 2V4VA 1QXRA 2YDEA 3O0XA 3GHNA 2D6NA 4I09A 1PM4A 2RDQA 2C4XA 4A3XA 2EXKA 1KXGA 1VRH2 2NLRA 4QQPA 4RGAA 2VULA 1G9DA 2DVFA 5FYCA 4YZ2A 4FP3A 2OUHA 1SLLA 4XAEA 1IG0A 3MEPA 2A6XA 5C3PA 5C3OA 5KHKA 3K77A 1V6NA 1UXZA 1POV0 4DO0A 1CJDA 3TB0A 5FAXA 3SMHA 2YPDA 4KWJA 3AMMA 4Y3OA 3VL9A 1C57A 4PLMA 5B4NA
chains in the Genus database with same CATH topology
3B9IA 4AI0A 4XOGA 2PAKA 3POWA 3WZ1A 4GMP1 1U0AA 3JBG1 1RVF1 5SV5A 1O3RA 1JYIA 1RUE2 2VU9A 1HQWA 5FOBB 3RG0A 1RUD3 3AP5A 3RRDA 2ZGSA 4M3CF 1QJU2 5J7MA 4WVVA 1UKGA 1HQNA 2CAUA 2XBO2 3IM0A 1OFNA 1RUH2 4YW3A 5T5JA 3CEWA 4XMAA 4HLTA 1YCIA 1A3KA 4JDNA 2DCTA 3KSCA 1QJU3 3WG1A 1O4YA 4M01A 2DWRA 3VBUC 5BV6A 4LE4A 4M00A 4WM8B 3VBOB 4QQLA 3KCXA 4ZU5A 3OPZA 4GA9A 2C9AA 1HW5A 4Q4Y3 1SACA 3AP9A 1KFXL 4YW4A 3AMQA 1U5YA 2CWMA 2R16A 5JVVA 3HT2A 3GYDA 1MZ6A 1VBD2 1QDCA 1H2KA 1NA1C 4IV3C 5DXDA 4AI3A 1OD5A 1IS6A 2ARBA 4CEYB 2WS92 4AI2A 1ZRCA 2VW2A 1F2NA 4LBKA 2BWCA 4KG8A 4JV4A 3VBUB 1TE1B 3A0NA 3TOJA 1BK1A 1VR3A 4AVAA 3WDTA 3RJRA 3WXPA 3AM2A 1RTVA 4FAGA 4AFBA 1AR73 2WINB 1QXPA 1B35A 4JRLA 3VHPA 5I8YA 4OULA 1HXS3 3POYA 1QOOA 2EAAA 1L3JA 4Q4X2 1UZZA 1WW4A 5FMOS 2WFF1 3JD73 4ZU7A 4KNCA 2GMEA 1ND3C 3ZFGA 4YVWC 4CDWB 1POV3 2WS91 4M0HA 3H3UA 4CTEA 1N1SA 1PO22 3WDWA 1AX2A 4X6RB 4IERA 5BNOC 2D5HA 1XNCA 1YFUA 2GAUA 1QNWA 2WLPA 2OZJA 1EAH3 4D7SA 1MVEA 1J59A 1R083 1GSLA 4GXLA 4IEXA 1Q8OA 4Y26A 2IWGB 1WLCA 2YPJA 1VP6A 1TQ5A 2XWJB 1AYM3 4AGVA 2MEV1 5I8SA 2OYZA 2CWSA 1LODA 1AYN3 2XPJA 1UW8A 1ZBA3 1MR5A 3M1HA 1G7YA 2FMYA 3WW4A 4QPGC 5KBFA 3AZWA 3B00A 3AYDA 3DF0A 1W2UA 4V1PA 1CQ9A 5KHIA 5AFBA 1UPIA 3P3PA 4YGEA 2I74A 2IXCA 1H1IA 1ZVFA 3E6BA 3ES1A 3J8F3 2X29A 4LBNA 2QCSB 4LLOA 3TNQA 3ZSMA 2NQYA 2A6WA 3BOPA 1KITA 3NW4A 4ES8A 1RUF2 2RS53 2WZR1 4X8PA 3MF9A 2MEV3 1OA4A 1HIXA 3V0BB 1AXZA 1VBA2 1N47A 5ABJC 5HBAA 5A3MA 1ZBE1 1RL3A 1V6MA 1DYPA 3WQ1A 1C8NA 4YM0A 5CG9A 1XU2A 3J8F1 4Q26A 3MICA 4S2GA 2ZGMA 4XE9A 4HZFA 5E1RA 2R0HA 1LHOA 5F9TA 1NE6A 2FHRA 4AGRA 2RS33 3MW2A 2LALA 3VKLA 4XTMA 4UW4A 1WUVA 3VBSC 1PGW1 2JG8C 3OJBA 1OOPB 4Q0UA 4TSVA 5H9PA 4OI2A 4Q0PA 3LWCA 3T1MA 1VBB2 4KBBA 1LOCA 3H7JA 2JG9A 1NZCA 2VH9A 3TYJA 4ZKTB 3CF6E 2XJUA 2R043 1RHI2 4R8HA 4YRDA 4XTPA 1QJX1 1H1AA 4XBNA 5C6CA 3RJ2X 1NCQB 2BVVA 2NMOA 1BZWA 2RE9A 4YFWA 3WG2A 3TN93 4BIOA 3MZHA 2VUJA 3ZFGB 1LCLA 4FO9A 4C0HA 1SQ4A 1ASJ1 3ATGA 4LBJA 2DURA 2YXSA 4GALA 2DYCA 4LBQD 3B9CA 4Q4X3 3RMYA 1DGRN 2PHLA 3IPVB 1CAUA 1AYM2 1U12A 2A70A 3K51A 1QJY3 1F9KA 1W0PA 2UY9A 3WW2A 2R062 4IL7A 4B7EA 2OW4A 2YZ4A 2FZ2A 2O8QA 4FP2A 4CYDA 2UURA 4HT1T 5SV8A 1GANA 2XBO1 3PLQA 4S2FA 1HV0A 3H1YA 4GIQA 3WQ7A 4TWTA 4C90A 5JZGB 2MHFA 3VBHA 1KJLA 3JBG2 1EV12 2R32A 5JOYA 2RS13 4F3JA 2Y0IA 1LGBA 4IQPA 4QU2A 1WBLA 3AFKA 4CEWC 3QH6A 4UW5A 4N9IA 1I1EA 1ZA4A 1TME1 4R9DA 4XEZA 4Q4Y2 2RS12 2YGLA 2ZOEB 4LR4A 5JSPA 3HIFA 4LO4B 1MS3A 3H1WA 2OA2A 2R49A 2XLAA 1R091 4BM8A 1O4TA 1AL23 1QKQA 2W0XA 3CNAA 3KD4A 4RR3A 3FE5A 1Q8QA 2VQ0A 1W6PA 3USUA 2Y26A 5ABJA 5FO9B 3FX3A 5GLZA 5JAXA 3QCWA 4MXWB 5HCFA 5D1IA 5KC6A 3SNMA 4G3YC 1PZ9A 1QOTA 4IETA 3TWIA 3SH5A 4MGZE 5DUWA 2P2KA 2HKXA 1AYN2 2HEVF 1ENXA 2I2SA 3NVCA 1UAIA 4C0BA 4JGYB 1N3PA 2EAKA 2YY1A 3KB5A 3MPBA 4B3NA 4AF9A 2QKDA 5IUQA 3APBA 4XF3A 4XXAA 1HV1A 1H1MA 2FBEA 2ZCWA 3RYPA 3OF1A 1LKNA 3NL1A 1BVVA 3BCWA 4A7ZA 3ZSLA 4CDWA 5JOZA 3PNAA 5DDJ3 1VBE2 1C3HA 2Q30A 2ZHKA 2R1DA 3N7MA 4O9GA 3CU7A 3LOBA 2PAEA 4P5HA 2RS51 5GZEA 2WNVC 1YFYA 3JB8A 4BMEA 3AKSA 1RVF3 3ILRA 3NO8A 2BFUL 1SMVA 1ALYA 2HWF1 2RHPA 1C1LA 1CAVB 4LUKA 2HJIA 4BCUA 5FTTC 4FTSA 1Q8SA 2ZBJA 3VKFC 2R0FA 3B69A 3SHRA 1YJKA 3JB4C 4CEYC 4S2HA 3WR0A 5E89A 4LTAA 4AK3A 5K9YA 2Q4SA 4AEDB 4IEQA 2PTMA 4YW1A 1DGWA 1REDA 4MUVA 4YLZA 5GJ6A 2ZHMA 4K40A 1ZZ6A 3EO6A 4WZFA 1CPNA 1RVF2 4GKXA 3BU7A 4QT6A 5T52A 1OQDA 2ZZQA 2GMMA 1RIRA 3GHMA 1PK6B 4HANA 3IPVA 1FPN1 4YM3A 3B7MA 1ZBE2 1PIV1 4NWVA 2P37A 3H1MA 1QJY1 3SH4A 3AX4A 5KHHA 2ZAAA 2FMDA 3GZTB 5CVRA 1NCRB 1UIJA 3IBMA 4XXPA 5TSWA 4QGNA 3P3NA 5JWPA 3OGGA 2ZACA 2DV9A 1X36A 2O1QA 5FBZA 3UK9A 3R05A 5JR7B 3GALA 2AH2A 3WG3A 2JENA 4DOUA 3C2UA 1OSGA 1RINA 1DQ0A 1WCDJ 3WDXA 5FO8B 3GBFA 1R082 5F6LB 3UV9A 3ZFFA 4ISQA 4FXGB 1PVC3 4MYEA 1IPKA 4MXWA 3IWZA 2CV6A 4PDWB 4JGYC 3ZXLA 4MXVA 2QE3A 4XJZA 1YLLA 4YM2A 5KHGA 1SLIA 1YO8A 3WUCA 3ZPYA 1A8MA 5ABJB 1CJPA 3KT4A 2WSVA 1RGSA 3QOPA 2GZWA 4RR3B 2VOVA 4HSLA 3DPRB 3DKWA 2ZX3A 2HWE1 1MS1A 2QZ3A 4XIOA 4YG6A 2LTNA 3MFCA 3QH7A 5JSRA 1URXA 2XVGA 3MYXA 3NV3A 2ZGNA 5D8AB 2A75A 2X53S 4AQ2A 3MIBA 2JG8B 3GBGA 4P9XA 2VVDA 4RD7A 1R093 2QDRA 4NO4A 2VOXA 4XW3A 4YM1A 4YZ5A 4COZA 5JZGA 2AENA 1GICA 3FZ3A 2D3SA 5JOXA 3D0SA 1LOBA 4E2QA 3ZFEC 3E5XA 2HWC1 1AF9A 1BEV2 2CY6A 4CDUC 1REEA 2DFCA 5D8AC 1MVQA 5A32B 1YRZA 3RSJA 2K2SA 2BNOA 2XWBB 4CEYA 1S2BA 2QDNA 1FPN2 1PZ7A 1MS4A 1KFUL 1ONAA 3MGUA 2WNUA 2IXHA 2H0VA 1CAWB 4Q4V2 4HKLA 1TME2 5AVPA 2DVBA 2VOWA 3TRSB 1LOAA 4N90A 4QPIB 3E5QA 4QX5A 1H4HA 4YZ1A 5CFDC 2R041 4X6QB 4LE3A 2DVDA 4BMBA 4C1WA 3H7YA 1VBE3 5A33A 3WDUA 2ZMNA 2H0BA 1QXJA 5C9AC 1BMV2 1HRI2 3WHUA 1DGWX 4WVMA 3TN92 1LEMA 4IEPA 4TYSA 3MIHA 1DQ4A 2E6VA 4D3WA 4FTEA 1PGL1 4NPRA 1V9U3 3UKNA 2VW0A 1CIWA 1AR82 2QFEA 3KT1A 4KGQA 4MH0E 2JDZA 4Z07A 1RUE1 4MX3A 3E5UA 4QPYA 1FAYA 2D6LX 2ZTNA 4YG3A 5I0SA 1LEDA 4RGGA 1VALA 4PIYA 1Y3TA 1BJQA 2B42B 5FOJB 2A73B 1FATA 1XQNA 3VZLA 3VLBB 1F31A 1VBD3 1IGOA 2Q1ZB 3WG4A 2YROA 4ATFA 3OTFA 3VHNA 4BLJA 2ERFA 2FZ1A 3AJZA 1XU1A 1C28A 1R1A1 5JZGC 1NY71 1V6JA 4UW6A 1PO23 3ZN6A 2QJVA 4PIXA 1LHVA 3V0BA 4OVEA 4YVWA 3CL1A 1H4GA 1UF2C 4GB33 4RHV2 5C8CC 1ZM1A 2HWD3 3MPPG 4PJYA 5T54A 4ORFA 4WM8A 3SCGA 3J4UH 1W6NA 2BYVE 3AXEA 1QOSA 1VLNA 2GMPA 1GZWB 3L2HA 4J1WA 4NN0A 5FQ0B 2GDFA 1COV1 3NKGA 1ENRA 3ROUA 2WL1A 1QY4A 4RQPC 3RI9A 2GC3A 3OY8A 2V5YA 5C4WC 1G6NA 5J37A 2EALA 1MS9A 3E6DA 3GF6A 1IQAA 2UU8A 2D7FA 1LR5A 2Z2SB 2NYYA 3VBOC 1YFXA 2R1BA 4K20A 1ULGA 4GMP0 3JD71 3KM5A 4JDMA 1IPJA 2PHUA 1O5UA 1EPWA 1NCRC 2HEYF 4Y4YA 2EXHA 5BNOA 1GLHA 4H7MA 5KXCA 4HETA 3PVOA 5BPXA 1OHFA 1NOVA 1ZBE3 3AYAA 1LU1A 1POV1 5BNQA 4QD2A 2XVKA 3OY8B 4Z92B 1QGLA 1JOJA 3S30A 5AFEA 1PO21 1XNDA 2EVXA 5AVAA 5CFCC 1PVXA 2XJRA 4B4RA 1DYKA 2DU1A 4J6GA 4XQ4A 4HKOA 4RHV3 2D5FA 5GKAC 3VBRA 5FPXA 3NAPB 4SLIA 1PIV2 3AB0A 1GFF2 1AR71 4P9JA 5L36A 2D3RA 4CP0A 4K9SA 3G6JB 5L7OC 1C5IA 2VUAA 3W9AA 3PHMA 4UXAA 1AR92 4RS5C 4XF0A 3AYCA 3VBSA 5GLWA 1LENA 1ND2A 1N3QA 2DUPA 4IEOA 3VZJA 4BYYA 2I45A 1NYWA 5C8CA 1LESA 2XH6A 1LTEA 4DS0A 5J36A 2GC1A 1G9FA 3BB6A 2PHXA 2PHRA 3NAPC 4AEJA 4AI8A 1KRIA 1KQRA 4MGYE 4YNIA 3QBQA 2ZX4A 4MSVA 4F8AA 3LA7A 4YFZA 2WFF2 1H9WA 1Z7S1 2JE7A 1H30A 2E51A 3DV8A 4EWDA 3D5OA 5I8TA 4FPKA 1VB2A 5BNNA 5ACA1 4XHBA 5BNPA 1SBEA 3WV6A 3H8UA 1RUD2 1HXS1 2B5HA 4JVAA 4YGCA 2HWD1 1NE4A 3SH3A 2PHTA 1N1YA 4L97A 4OLLA 4PQ9A 5T5PA 3NKTA 2VQAA 2D97A 1QWRA 2GU9A 3ENRA 1AL21 3UKTA 2JICA 5EYYA 1MEC2 4QPIA 5EYXA 5DUVA 2ZKNA 1CAWA 3LSEA 1HKDA 1D4M1 4AEDC 2DUOA 1RUJ1 2JG9B 1FV3A 3D6EA 3OYWB 2VVEA 1AR91 1SCSA 4Q4V1 2H6CA 4FCAA 1GQHA 2VY0A 4BA6A 4Y22B 1FX5A 2MPFA 3MLLA 4WBBA 4YW5A 1DZRA 2ZABA 3O0WA 3JUUA 1S0FA 3EQEA 2VNGA 1BEV1 4HPKB 4I0BA 1QF3A 1C1FA 3EBRA 2VVFA 4XF4A 5FLHA 4I0WB 3WCSA 1C8M2 5HXVA 2W39A 1FOD3 5H9SA 2XKPA 3GBWA 2GN7A 4UBHA 1RUF3 5ACA3 4GB31 4R9CA 1YYNA 2PLV2 3WP3A 4Q4V3 2XJVA 4FPGA 2K9ZA 2V73A 1H8TA 1D4M2 1G9CA 4YZ4A 4K1YA 4AQSA 4HFSA 3UJOA 5JMCA 1RMU1 4M3CA 1BBT1 4RFT0 4GH4A 2B8MA 4I3GA 5F1RA 4EV0A 3JCIA 4FOYA 1BKZA 4D7TA 4AGGA 5LEKA 4OUMA 2RS32 1XNBA 1ULFA 4FPCA 1QNYA 4BHPA 2EIGA 4RA0A 2XL7A 1COV2 4K8FA 1MQTA 2DVAA 2GC2A 2XJQA 2XVLA 1QJX2 3I8TA 2ARXA 3VKOA 4RR3C 2CAVA 4BOWA 1RUH3 3JD72 1J3RA 2A6VA 1AZDA 2XHKA 4AI1A 3BODA 4QPIC 1R1A2 4HK8A 1O3TA 4GWNA 1TMF3 1RUE3 1VB4A 3PVEA 4XFGA 1DQ2A 4P9LA 3PJQA 1AVBA 4AEMA 1N1VA 5HI0A 1OA3A 5JI7A 2IXIA 4I01A 2H6BA 3CO2A 2PHDA 3BIWE 1VBC3 4Q4W1 3KZ4C 3ILFA 4RL7A 4Z8BA 2YYOA 1DLLA 3TAYA 1RUG2 1S0IA 4MV2A 3KLSA 3LA2A 3ZX7A 2BWAA 1AYN1 1WLDA 4YGBA 4Q0VA 2R063 4EWEA 1Z7S3 1VIWB 3JU9A 3ZSJA 1IOAA 2BGCA 4MGIE 4GQ7A 2WNEA 4NHMA 1W6OA 3ZYPA 2E7QA 4AEDA 2LM3A 2DF7A 1ZZ8A 2NN8A 4ATEA 5F6KA 5JIAA 2X5IB 1REFA 3FMGA 3H0OA 1LRHA 5H9QA 1HX6A 2JXAA 3B5LB 2B46X 3A0KA 4YVSC 2JKBA 2P3IA 4AHZA 1CESA 2PYTA 3ZN5A 2WZPP 1DDLA 2F6BA 5EZWA 3IDBB 1PHMA 1D0GA 4XQWA 4RQPA 4Q1PA 1WLTA 3CJIA 4COUA 4QPGB 1AL0G 5C4WA 2VMHA 4IEVA 4GKYA 1ZZBA 2OZ6A 4XJ9A 2DCZA 3AZVA 1V70A 3L2YA 4AXOA 3WLUA 5T5LA 3WW3A 2Z42A 4Q2FA 2CTVA 1JH5A 2BVBA 3N7KA 1EV11 4LO6B 5H9RA 1PK6C 1HRV3 1ZBA2 3N4MA 1MS5A 4H3WA 2QVSB 3V65A 4OZXA 3NSTA 4Q4X1 3VBFA 4HN0A 5GM0A 3RI8A 3H3ZA 3V56A 1RHI1 2EF6A 5L73A 4AQTA 4DZGA 2Q1MA 2F4PA 3B93A 4JGYA 5JLVA 2XJTA 3G7DA 3J9SA 4FQZA 1RUJ2 2ZJCA 3QD6A 4RQPB 3DGTA 1BYHA 2Q5TA 3MF6A 5CNAA 2DFBA 2D93A 4CDXB 3ZYRA 1MQTC 4LO5B 1GKBA 3MW4A 5K0UA 1RB8G 2ET7A 1X8EA 2RS52 1ULDA 2I07B 4LHKA 1OA2A 1W6PB 1XE7A 4WVZA 4A7YA 2JECA 4CP2A 3DUIA 4FOVA 2WT2A 5KXEA 4R4XA 2SLIA 4RS5A 1QH6A 2PHWA 2B39A 1LOFC 5JDBA 3V0AA 4FXKB 4AE2A 2PAMA 4XFCA 1QQP2 4NHKA 2P3JA 1DGLA 4IXLA 1ND3A 5C33A 3M3QA 3OD0A 4Y5Z0 4PF5A 3VBHC 4BLIA 5BYNA 3EXUA 1FT9A 3OD4A 3O7OA 1NA1B 4Y1YA 2VNOA 1AJOA 2PA7A 5J48A 3M3CA 3SCFA 4CEWA 4IV1B 1FV2A 1MZFA 3VDDA 3B02A 1RUG3 1FMD2 1AX1A 2ZGKA 2WC2A 2WNUC 4JGZA 4XETA 1HLCA 4B8EA 4RS5B 5EXOA 4DRRA 4XJAA 1GQGA 3DPRA 1OQ1A 3I59A 1ULEA 4AFAA 1AR63 4LEJA 4C91A 1SLCA 1VBA1 3ZFGC 2WLQA 4L9BA 1MZ5A 4D7YA 3SITA 3INAA 4OHYA 1V9U1 2ES3A 2GALA 4KL1A 5E8AA 1RUC1 4YVSA 1WCKA 2D98A 4L2NA 2XG3A 5JOWA 4ISRA 4BE3A 3WP4A 1HRV2 4HN1A 3WOGA 2AUYA 2ZGPA 2O0OA 2EA7A 1PNFA 1ZX5A 1PO13 3IMNA 4CDXC 3E6CC 1DG6A 2D6OX 2DCKA 5CFDA 2ILMA 1NLRA 4M3CB 1PO12 4WM7B 5IK8A 4JDOA 4PBPA 1TNFA 2BPA2 3WQ0A 4LT5A 1DHKB 3ELNA 4Q29A 1W39A 2ZGLA 1OOPA 3FUOA 2XLGA 2WNVA 1W6MB 3PVBB 1GV9A 1LULA 3WX5A 3HBZA 3GZAA 1Q5OA 1WCSA 2IXLA 2RR13 2JG9C 2QZ2A 4Z82A 3FLTA 4YG0A 5FCCA 2GC0A 4WM8C 5DDJ2 2ZS6B 3WD5A 2NMNA 4CDQC 5DZEA 4N43A 1U5XA 3N7JA 4S2DA 4RHV1 4KGGA 2VMGA 3O14A 3AP7A 1KJRA 4MZUA 4F7ZA 4XF1A 5T5OA 3T2TA 1BCXA 4MGKE 5CFDB 3TN91 1V6KA 4QM9A 2AYHA 1QMJA 3NV2A 3B94A 2A3YA 1UD1A 2AGSA 5KWRA 4XJ8A 1ULCA 3ZXDA 2A3WA 2XLFA 4YGDA 1SLAA 3IN9A 4AYUA 2ZA9A 4R52A 4AFCA 3AZZA 4BPZA 4JQRA 1E57A 4DMIA 1Q56A 4I02A 4E4SA 3AMHA 4PLOA 1F5FA 4FT8A 1O7FA 1R092 4Y20A 5JI9A 2QUOA 4URTA 1MEC3 3ILNA 5BNNB 2ETEA 4QHBA 1ZZ7A 1RUI3 2FQPA 4Q27A 2NPIA 4YZ3A 4CZSA 1IS3A 1JYCA 4DY3A 1LJ7A 1MZEA 1AHSA 3DPRC 1S55A 2RMU1 1S0DA 1ZYBA 2W08A 3S7EA 1V6IA 3URFA 1APNA 3ZIWA 3Q9OA 2HYKA 4OHVA 1C8M1 3AP4A 5L7OA 5DG1A 2HWC2 1SLBA 1VRH1 2PELA 3ALQA 3VV1A 1EP0A 5HCBA 3V64A 1PVC2 3ZYIB 4AVTA 2R073 4N7UA 5E16A 1ND3B 3ZXFA 5CFCB 1CVNA 1QQP1 1OMIA 1DZTA 4Q1RA 1D0HA 1YUDA 1KDKA 2WT0A 2SBAA 4JTOA 3VBUA 2WS93 1H8TB 2YUEA 4LBOA 1RUC3 3WDVA 3CJXA 1VRH3 4M0NA 3VZNA 2ZX0A 2CGPA 3WY6A 1WD3A 4LULA 4J1XA 3HD8B 1F5JA 2R071 2R30A 3D82A 5DUUA 1XYNA 2Q8OA 3CJIC 1ND2C 2RM21 4IV3A 4JAAA 1ENSA 1XNKA 2XJSA