4Z92B

Crystal structure of parechovirus-1 virion
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
239
structure length
239
Chain Sequence
MSTKYKWTRTKIDIAEGPGSMNMANVLCTTGAQSVALVGERAFYDPRTAGSKSRFDDLVKIAQLFSVMADSTTPSENHGVDAKGYFKWSATTAPQSIVHRNIVYLRLFPNLNVFVNSYSYFRGSLVLRLSVYASTFNRGRLRMGFFPNATTDSTSTLDNAIYTICDIGSDNSFEITIPYSFSTWMRKTNGHPIGLFQIEVLNRLTYNSSSPSEVYCIVQGKMGQDARFFCPTGSVVTFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords capsid subunit VP1
publication title The Structure of Human Parechovirus 1 Reveals an Association of the RNA Genome with the Capsid.
pubmed doi rcsb
source organism Human parechovirus 1 (strain harris)
total genus 42
structure length 239
sequence length 239
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2015-04-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4z92B00
5D8AB 4RR3A 3TN92 1RVF3 1D4M2 3JBG2 2X5IB 3VBSC 2WFF1 2R062 2WLPA 2ZZQA 1RHI1 5JZGC 1RUD3 5DDJ1 4GB31 1VB2A 3LOBA 2RM21 4RS5C 1RB8G 5J96B 2R043 2ZAHA 4WM8A 1NA1C 1RMU2 1V9U1 4JGZC 5C9AC 4BCUA 2HWC3 4GH4B 1K5MA 4GMP0 3VDDB 1BMV1 1AR73 1HRI2 5BNNB 2PLV2 1FMD3 1PVC3 5ACA2 1AR93 3J8F2 1VBA3 4IV1A 2HWB2 4JGYA 5CFCA 1FOD2 2XPJA 3VBRA 1HXS3 2MEV3 1RUH2 1R1A1 1TME1 5L7OB 1A6CA 1VAKA 4RR3C 2HWD3 1TMF2 1ZBA3 4RHV3 1NY71 2XBO1 1E57A 1COV3 2WS93 3JD71 2RR12 3CJIB 1AR82 1C8M1 1Z7S1 2HWF2 2RS52 1RUE2 1R091 5BNOA 1AR63 1QJZA 2DF7A 4QPIB 5DDJ3 4WM8B 1EV11 3ZFEA 2RM23 2QQPA 1POV0 2BUKA 1VRH2 1PGL2 1QJU2 1RUG3 1K5MC 1ASJ1 1V9U3 4NWWA 3TN91 4CDUB 4IV1B 1MQTB 2RS13 5BNPA 1RVF1 4JGYB 4CDXB 4JGYC 5CFCC 1AUYA 3VBRC 2GSYA 1NCRA 1RUD1 1AYN2 1AL23 5AC93 3VBHA 1FPN2 1MEC2 2RS32 3VBOC 3FBMA 1W39A 1R1A3 4FTSA 2XBO3 2HWC1 1NA1A 1ZBE2 1AR71 3IDEA 4AEDC 5BNOC 1FMD1 1PVC1 1RUC2 1AR91 1BBT2 3J8F1 1VBA1 1C8M3 1Z7S3 1QQP2 1RUF3 5C8CB 2IZWA 4QPGA 4Z92B 2GH8A 3ZFEC 1FOD1 1HQNA 2R072 1H8TB 5ABJB 1ND2B 1HXS1 2MEV1 4YVSB 4RQPB 1RUH1 1HRV2 1ND3B 4WM7A 2HWD1 1NCQB 1TMF1 1VBD3 1ZBA1 4RHV1 5BNPC 5C4WA 1COV1 2WS91 4CDQA 3TN93 4Q4X2 1NCRC 1X33A 1RUE1 1IHMA 3JBG3 3VBSB 3VBHC 1AR61 2R063 5JZGB 4N43A 1OOPA 4RS5B 5CFDA 2WWSA 1AYM2 1QJU1 3NAPA 1RUG1 1NA1B 1RMU3 3JB8A 3M8LA 1BEV2 5LK7B 4JGZB 5C9AB 5FMOS 2RS11 3DPRA 1HRI3 4QPGC 2PLV3 1RUJ2 4IV3A 5ACA3 4N53A 3J8F3 2HWB3 2RMU2 1PO22 1AYN1 1AL0G 1F8VA 1FOD3 1AL21 4Q4W2 5AC91 2RS31 4WM7C 2R042 1RUH3 1QJY2 4YVWA 5A33A 3VBOA 5C4WC 4CDQC 4LLFA 4RR3B 4CEWA 1TMF3 2RR13 2Y26A 1RUC1 1EAH2 1RUF1 2RS53 4N43C 1RUE3 4Q4Y2 1OOPC 2WZR2 4AEDA 5CFDC 1CD3G 2HWE2 3NAPC 1B35A 1X36A 4FTBA 1VRH3 4PDWA 3ZFFA 1QJU3 1VBD1 1K5MB 3DPRC 4Q4V2 4IV3C 1PO12 4N53C 1PIV2 5A32A 5K0UC 1D4M1 1R082 1OPOA 5CFCB 3VBFC 3JBG1 3VBRB 2WFF2 4CDWA 1RHI2 2R061 4GB32 1AYN3 5A33B 2BBVA 4YVWC 1FPN3 1MEC3 2RS33 5FMOL 3VBOB 3ZFGA 1VBC2 1OHFA 4Y5Z0 1QJX2 4CEWC 3VBUC 1RMU1 1DDLA 1BMV2 3S6PA 1ZBE3 4CEYA 1HRI1 2PLV1 1CJDA 5D8AA 2BPA2 4AEDB 5BNOB 5ACA1 1RUC3 1QQP3 2HWB1 2X5IA 3ZFEB 2FZ2A 4Q4W1 2R073 1B35C 1VB4A 1HRV3 1QJY1 4PDWC 3ZXAC 3ZFFC 1TME2 1SMVA 5BNPB 3JD72 1F2NA 2RR11 1RUI2 4Q4X3 1Z7S2 1AR81 4CDWC 1NCRB 3VDDA 1R092 2HWF1 5BNNA 1D4M3 2RS51 4GMP1 1GFF2 3VBHB 2ZTNA 3ZFGC 1EV12 2HWE1 1VBB2 5FOJB 1VBE2 1VRH1 1AYM3 1PGL1 1ASJ2 5L7OA 4CEYC 4SBVA 1BEV3 5D8AC 1PO11 3JB4C 1PIV1 1RVF2 4QPGB 1R081 1RUJ3 2X5IC 3CJIA 1RUD2 2RMU3 1PO23 5K0UA 1WCDJ 3VBFA 4Q4W3 1FPN1 1MEC1 4WM7B 4QPIA 1VBC1 1QJY3 2BFUS 1QJX1 4NWVA 5C4WB 1POV1 4CDQB 1PGW2 3VBUA 2HWC2 4GH4C 3VDDC 1AR72 4EJRA 1ZBE1 5BNNC 1FMD2 1PVC2 1AR92 4CDUA 1MQTA 1NG0A 1AR83 1BBT1 1HX6A 1VBA2 4CDXA 1EAH3 1QQP1 2FZ1A 2HWF3 4N43B 4Q4Y3 4GMP3 1OOPB 2WZR3 2R071 1HXS2 2MEV2 5CFDB 1HRV1 2HWE3 3NAPB 5L7OC 1M06G 4FSJA 2HWD2 1ZBA2 4RHV2 3DPRB 1COV2 4Q4V3 2WS92 4IV3B 1RUI1 1PO13 3CJIC 3HAGA 4N53B 1PIV3 4Q4X1 5K0UB 1R083 3VBFB 2WFF3 1AR62 1RHI3 5J98B 4QPIC 5C8CA 4GB33 5DDJ2 4WM8C 2RM22 1VBB1 4YVWB 5GKAC 4FTEA 1H8TA 5ABJA 1ND2A 4YVSA 1VBE1 4RQPA 1VBC3 1AYM1 1NOVA 1QJX3 1RUG2 3VBUB 4CEWB 1ND3A 1V9U2 1POV3 1BEV1 1NCQA 4CDUC 4IV1C 1MQTC 2RS12 4CDXC 2BFUL 1RUJ1 1BBT3 2RMU1 1PO21 1AL22 5AC92 3VBSA 1B35B 5JZGA 2R041 4PDWB 2TBVA 4RS5A 1TME3 3ZFFB 1R1A2 1PGW1 1NY72 5A32B 2XBO2 2VQ0A 3JD73 4JGZA 5C9AA 1RUI3 4CDWB 1C8M2 4RFT0 4GH4A 1RUF2 5C8CC 1R093 1EAH1 4Q4Y1 2WZR1 1H8TC 5ABJC 1ND2C 4YVSC 4RQPC 3ZFGB 1EV13 1VBB3 1ND3C 1C8NA 1VBE3 1NCQC 4Y4YA 1VBD2 1ASJ3 4Q4V1 4CEYB
chains in the Genus database with same CATH superfamily
5FP7A 3OOXA 3HNBM 2A73B 4QD2A 4MGTA 2ZGOA 1UOFA 4GALA 2YY1A 4KH9A 5FYZA 4LT5A 4O9GA 3I3BA 1ZREA 1H1IA 1YJLA 1RHI1 2WNUA 3E97A 4HBNA 5JZGC 3SLIA 1N3OA 2VL4A 4KMQA 3VKNA 2WAAA 1RB8G 3LOBA 4DQAA 3EBRA 2B46X 1SLIA 2W08A 4XCAA 3Q9OA 3O14A 5J1XA 1QF3A 3WR0A 5IAXA 3WUCA 4A3XA 2Y64A 5IHRA 2P1BA 2R16A 1V9U1 3VKFC 2VC9A 1AHSA 2QQVA 2XJSA 5E16A 1L7RA 5DPNA 4BCUA 1QY4A 1CGPA 1UU5A 1HDKA 1I9RA 3VDDB 3WP5A 3OY8B 4L11A 5H9RA 3SCFA 2VZOA 4UFLA 3CLPA 5HBAA 3MUY1 2P4EA 3S5QA 5ACA2 3J8F2 3N9OA 1GLHA 4IV1A 2VBBA 4LTAA 1G9FA 3WG3A 3D5OA 3SXWA 2WO3A 4H7LA 1FOD2 5IFTA 3IDCB 3VBRA 2XPJA 3B9IA 3ILFA 2VZUA 1C4RA 1GKBA 1YXWA 4B8EA 4FXGB 1GSLA 4KNCA 4I2OA 5FP8A 2BOIA 1R1A1 2VVFA 4XFFA 2D6KA 2TEPA 2DVDA 1ENXA 2K2SA 2QQMA 1NZCA 3T3YA 3MPBA 2ZZJA 3V0BA 1UKGA 2D3SA 3S5AA 2FDHA 3OGJA 2IC1A 1ENSA 2XBO1 4D69A 1E57A 3T1LA 3EJKA 1LEMA 1JTZX 3VUOA 3KGLA 2RR12 4DEQA 3RZMA 1W8TA 3CJIB 5FQ0B 2B8MA 1Z7S1 3ZMNA 3AKTA 3KV4A 1KS5A 1QOTA 3PUHA 3R4DB 4LO8A 3VHPA 1RUE2 3W21A 4MGIE 2FDGA 2WQZC 5BNOA 1WWYA 5K8SA 1NYWA 4UI9L 2XH6A 1UW8A 2F4LA 2IXCA 3O5SA 2VQUA 4CP9A 2PHUA 4K1ZA 2D6OX 4WM8B 4Y1UA 5CNAA 5F37A 3VD9A 2GZWA 3BOWA 3VN4A 4UFJA 5FUNA 2F4PA 5JXIA 4KU8A 2BUKA 3VZLA 1PGL2 4Q5OA 5KXCA 1RUG3 5LRSA 2XG3A 2J1TA 5T5PA 1RL3A 1V9U3 2Q8CA 4PF1A 5IVBA 4A6OA 3AP9A 5FK8A 4H14A 4Y33A 1X8EA 3MICA 1MQTB 2BEOA 2RS13 4Q8LA 5LATA 2A3XA 2GN3A 4JGYC 4YM1A 1AX0A 4AR2A 4CDXB 4NIAA 5CFCC 4CXWA 1PNFA 1QDOA 3U11A 3W5MA 2W68A 2GSYA 1NCRA 2CL2A 2DVFA 1DYPA 2R1BA 5A1AA 4LHSA 5CVRA 3HIFA 3HT2A 5AC93 1OD3A 1CIWA 5T54A 5FZOA 1MEC2 2ZGSA 3D0JA 2A1XA 1R1A3 5FYCA 4CXYA 4CCMA 1GZCA 1XU1A 2DTWA 3D82A 1H2MA 1JZ7A 3H8XA 2D6NA 3SEEA 2WA3A 2O8QA 5I93A 3L9JT 3WF2A 2XBO3 2HWC1 2MNGA 4P5HA 4XDOA 5FBJA 1NA1A 1ZBE2 2AACA 2VVEA 5IUQA 2ZEZA 3IDEA 4CU7A 3OD4A 1FMD1 4H3WA 4NR1A 3UKVA 1AR91 3ZIXA 1VBA1 1Z7S3 3KVBA 2VZSA 3GYDA 4IEXA 2ZGPA 4Z92B 2IZWA 1DGRN 3BU7A 2GH8A 3SNMA 3ZFEC 1V6LA 3ORJA 4LIUA 5F5AA 1S0BA 2Z2SB 4YVSB 3NNMA 5DAVA 4XFHA 4JKLA 4XETA 3RRDA 4S2FA 2QJVA 1LEDA 3O1TA 1NE4A 1W99A 1LHNA 2AEYA 3M3OA 1JU3A 2RDRA 1W9YA 4UWDA 3X29B 3OUJA 5IVFA 5JI7A 3VKLA 1NCQB 2FQPA 5JSRA 1X82A 4RHV1 3S7IA 3AP5A 1Q5OA 3ES4A 5C7GA 2HEVF 2C5DA 1SLCA 2YU2A 5A6YA 4A7YA 2BW8A 2R32A 3ZIWA 1QIQA 1UO9A 1X33A 3T2OA 1UNBA 1BVP1 1BQPA 2I45A 5AVAA 1CAXA 5E8AA 1CAWA 4TN7A 4BQ1A 2H0VA 4FI9A 3VBHC 2GP5A 2CU5A 5JZGB 4N7UA 3M4FA 1OOPA 1US2A 1OSGA 2JDKA 1EUTA 4U2AA 2A70A 1DG6A 4E4ZA 5FIXA 4QKDA 2A6VA 2WWSA 4BWOA 2ADEA 1BVVA 1N3PA 5FZEA 2JDAA 4FPHA 2X09A 3MLLA 2N7GA 4MGQA 5LK7B 2P17A 4QGMA 1F4HA 2RV9A 2DFCA 4P9XA 1NQDA 5FMOS 4F3JA 5L36A 5ANQA 3FLTA 3MHZA 3R0RA 1HRI3 4ZS3A 2PLV3 5LRRA 3ZX7A 2C0ZA 5FZDA 5JPMB 1G9CA 4DINB 2ZABA 2DBNA 5SV5A 1YHFA 2VNOA 2HWB3 4XQ4A 2RMU2 3RZKA 2GNMA 2HH9A 2RS31 5BPXA 3CNAA 4WM7C 2ZCWA 1TZOA 4PT6A 4XUOA 5F6KA 1L3JA 4MGZE 5LBFA 2ZEYA 4JKMA 4Y5SA 2GC0A 3WNMA 1OA2A 4KG0A 4YVWA 3IM0A 3PMEA 4BXSV 3VBOA 4EWAA 2NM1A 5FJHA 1IZ3A 4CDQC 3H8RA 2VE1A 3WV6A 5A3LA 2DTYA 5FZAA 2EVXA 1ZRCA 4DOUA 3ST7A 2B7YA 1XNCA 3K46A 4MX3A 4C8DA 1RJ8A 4OQ8A 2VUJA 5C3SA 4XTPA 3BKZA 2NQYA 1CWPA 1RUC1 4N9HA 5FK7A 4CU8A 1EY2A 2GNBA 4IW3A 4R9AA 1EAH2 1H30A 1RUF1 2RS53 4N43C 2WINB 4ISRA 4NO4A 4Q4Y2 2WZR2 5FZFA 3RGBA 4AF9A 2JG9C 1UYXA 3R05A 1S0GA 3KGZA 1UOGA 3W59A 1H2KA 3QOPA 5CFDC 1CD3G 5EJZB 5IK4A 3NAPC 5A7WB 3IMMA 1W8ZA 3U37A 2YZ4A 3NO8A 4F7ZA 1D2QA 4QX8A 2CGOA 1B35A 3ACFA 5LA0A 4PDWA 2XL9A 1LOFA 5FPBA 3HOBA 3N7KA 3AJYA 2WSUA 2XXZA 2YYOA 3HN3A 3THPA 1YJKA 1KQRA 5T5OA 3UGFA 3VD5A 3WF0A 1FNZA 1PO12 1PK6A 5JOXA 1PIV2 2UU8A 4YM3A 1FNYA 4OULA 1GQHA 3NWKA 4OZXA 3ZSKA 1R082 5FZGA 5EXOA 4XURA 5LY2A 5CFCB 1QH6A 4CDWA 1OLMA 1UAIA 4BIOA 3WP3A 1W8NA 4GB32 3ZM8A 2UWBA 4E4SA 3ZSMA 2BBVA 2RS33 1G9AA 4LE4A 1GICA 3T0DA 2XLFA 1VBC2 1OHFA 3LF7A 5FUPA 1CVNA 4Y5Z0 3D4KA 3D6EA 1NX9A 3I54A 3FUOA 1LOBA 1W9TA 4FCAA 1MZ6A 1V6NA 3F2ZA 3LSEA 4FQ4A 3S0MA 1SACA 5FYYA 1MR5A 2DU0A 3A0NA 2DUQA 1H9PA 4HN0A 4J1XA 3S6PA 1BMV2 3PUSA 4XFCA 3GBFA 3K2OA 4ZHNA 1CJDA 4M3CB 4OI1A 3KHBA 3R4UA 5ACA1 1RUC3 2JIGA 3N9QA 5A70A 2LTNA 3ZYPA 4V1PA 1DIWA 2UWAA 3ZFEB 2FZ2A 1U5XA 5EQUA 4PQ9A 4Q4W1 4D7YA 5JSPA 1QJEA 5FMCA 3SMHA 4YW6A 1LCLA 3ZXAC 1QJY1 1WCQA 2QNKA 3M2MA 1REEA 4LUKA 3ZFFC 3GHMA 1PMIA 4YZ4A 4YFWA 3U78A 4Q4V1 4CPBA 3QH7A 1YUDA 2NMNA 4TTGA 1ZRDA 4CPBD 1SLBA 2ZX3A 1UOBA 1GOHA 1RIRA 3BPSA 2ETEA 5LK5A 5JDBA 1ULEA 3PU3A 1F2NA 2RR11 2ZJCA 3LIGA 4M4RA 4CE8A 4Q4X3 1ZRRA 3PHMA 1LB2A 3I2IA 5FZBA 4LULA 3O0WA 1H1AA 1PNGA 4EZHA 1R092 4YM0A 3POFA 4LBQB 2ZKNA 4H55A 1OKQA 3VBHB 2VO5A 2CDOA 5EJ1B 4DXZA 1OXCA 4AVCA 4NN0A 4E8CA 1W8OA 2HWE1 1QNYA 3P5BA 1VBB2 4TZDA 2IXKA 2G9ZA 1QXJA 3PVNA 3I8TA 5CBLA 1PGL1 2DVAA 2F17A 3MFAA 4U36A 5A3NA 1N3QA 4E2GA 5L7OA 3OJBA 3O0VA 1JHNA 1I5ZA 4MGYE 4CEYC 3ASIA 3JB4C 4FFGA 1W6MA 2W1WA 3U1XA 3KF5A 2YFUA 4B7KA 4JAAA 3V0AA 3WT3A 4JC1A 1LOAA 5D21A 5L73A 3WW1A 1KDKA 1KFUL 2ARAA 1GQPA 4K40A 1ZZ6A 5F3IA 1N1YA 3FL7A 1FI2A 3VBFA 4Q4W3 2IXIA 2YGLA 1MEC1 4WM7B 4QPIA 3AP7A 5IFPA 1QJY3 4B4QA 2IWGB 4QHZA 2CYFA 1HV1A 3MV01 1LHOA 4TYSA 4CDQB 5G04L 3KQ4B 3VBUA 4D8MA 1T2XA 4I0BA 2W46A 1ZBE1 4DO0A 3C8XA 2OZ6A 1W3XA 2VPVA 2ZHMA 4JTOA 1BZWA 1NG0A 3N9MA 3CZJA 2A3WA 4GAZA 4N43B 1BKZA 4PLMA 3KB5A 1WUVA 2ORXA 2Z42A 2JG9B 2H6BA 3PNAA 1CX4A 4OMCA 4UYBA 4AEMA 5CFDB 2HWE3 4FP3A 3NAPB 1F31A 1U5YA 4UW3A 1NQJA 2WN2A 1M06G 4FSJA 2J1AA 2VM9A 2NN8A 2FD8A 3K75B 1D2SA 4MXWB 3OEAA 2VMHA 1APNA 3MIDA 4CCLA 3WG2A 2FDJA 3IMNA 5EFUA 1AVBA 4BQ3A 1SDWA 1W2TA 2WNUC 4ZZ8A 4D0QA 5K7PA 2O1QA 3IDAA 4HT1T 2WNEA 3IPVB 4HKWA 2WLQA 4RD7A 4DXSA 2GP3A 4COVA 4OLLA 4QQHA 5IWFA 2BNMA 3SC7X 2AENA 2LM3A 1QEXA 4EYUA 1H8TA 2R6QA 3L2HA 3D8CA 5JOWA 4MOAA 4AHYA 4RQPA 5KHGA 4LORA 2V72A 4NAOA 2K9ZA 3HQUA 1LESA 1RUG2 3ZXKA 4CEWB 3R4SA 1ND3A 2JJ6A 3T2TA 4QM8A 3L2YA 1V9U2 4DZGA 1N1SA 4D6RA 2XHKA 1H8VA 1LENA 3E5QA 4MG2A 1EPWA 4CDUC 4IV1C 1PMHX 2RS12 2HEWF 3OF1A 2EF6A 2J22A 1G8WA 4COZA 4CU6A 1W6PB 2ORZA 3LFMA 3M3CA 1GMMA 4YRDA 4FVVA 2CV6A 5JWPA 2A75A 2WKKA 1KEXA 3CMGA 1WW4A 2RMU1 2DVGA 2X29A 2LW8A 5AC92 5A7SA 1SPPB 1WD3A 4QX3A 5J09A 1DFQA 4XZPA 2TBVA 2EICA 3OYWB 4XAAA 3WUDA 3ZFFB 1R1A2 2Z69A 2G9FA 3PIJA 4L2NA 1IKPA 2IFRA 2QQOA 3LA3A 3UL2A 5C3OA 2GALA 4QXBA 3T1MA 3FE5A 4E4DX 1DYKA 1W0PA 1W8WA 2XUMA 3LPFA 1O7FA 1RYYA 2VZTA 2XBO2 3MW2A 3VDAA 2VQ0A 1UN1A 3JD73 3RFRA 1XC6A 5C9AA 1WGPA 3FHIB 5HCBA 3DUIA 1DLLA 4GH4A 5C8CC 1EAH1 4Y24A 4Q4Y1 2E7AA 3OGRA 5A6QA 5BUVA 3KZ4C 1ONAA 2WZR1 2ZMNA 5T55A 2VY0A 2LUWA 2R0HA 3GALA 4P9WA 3LEMA 1IQDC 1CAVB 1OUXA 3ZOIA 5C6CA 3MI8A 1DZRA 4QT6A 1GWKA 4E9KA 2Y6KA 3E5UA 1J1LA 3ITQA 5A7PA 4CEYB 5AFBA 4J1WA 4HANA 4Q0PA 5D1IA 3THDA 2BYVE 5FYHA 2QQKA 4FFHA 4P9IA 3WNOA 4BQXA 3FZ3A 3ZSLA 3U4SA 1KFXL 4EWDA 4Q0VA 2ZZQA 3MW3A 2EALA 3UNPA 1RUD3 3EYPA 2X05A 4GB31 4XUPA 2VTXA 3CO2A 2RM21 4RS5C 2C4XA 4IEZA 2XL7A 3B3QE 5HXVA 4CCKA 3M3IA 1RTVA 1KDMA 2YHJA 4MADA 2QCSB 3H7JA 3THTA 2P5BA 4DPNA 4AI9A 4L97A 1NA1C 1REDA 3PVEA 4GKYA 3WDTA 2OX0A 2ZGRA 4JGZC 5GLWA 1J1TA 1XRUA 1CX1A 2GC1A 3E6DA 3HWJA 1ZZ7A 4IEUA 5JI9A 1WA6X 1BMV1 2VNVA 1HRI2 2PLV2 2E26A 2J7MA 4BK4A 1LTEA 1NXMA 4E8DA 1ZRFA 4AEJA 4KL1A 4I02A 4J6GA 2HWB2 1WMFA 4B7EA 1J59A 4DUVA 3OBRA 1VMJA 1G6NA 4AVBA 1HXS3 2MEV3 3C3VA 2AGSA 1KJLA 1S1AA 1MVEA 5DAPA 1ACCA 3W5NA 3EO6A 3SISA 3QCWA 4XDPA 3KVAA 4P9LA 3T2PA 2OQ6A 4IL7A 4K8RB 3E5XA 2J1RA 2VOKA 4RR3C 1ENQA 3LOIA 5FY0A 2D3RA 1YQ5A 1ZBA3 3O7OA 1LRHA 4NPMA 1O59A 1OUSA 1VAVA 4QB1A 3MIBA 4RL7A 4AQ6A 2YC4A 1HN1A 1YFYA 5IW0A 2WNUB 2B5HA 4J25A 3SKJE 1FV3A 2HWF2 2RS52 4FP2A 1J58A 1R091 1UY1A 2SBAA 1IQAA 5DUWA 3VLBB 3TRSB 5I0RA 1ULOA 1HIXA 1QJZA 1UYZA 4BOWA 1VLNA 1VMFA 1OFNA 2RDNA 3PVBB 4ISQA 4WVVA 2RM23 1LHVA 3BODA 3K51A 4GKXA 5FMDA 4E27A 5LBCA 1POV0 1GUIA 2VJXA 3DYPA 3GJAA 1V0AA 2PA7A 3OB8A 4PLOA 4YW5A 3VKMA 4CYDA 2QVSB 4BPZA 2FHRA 4YPJA 2HYXA 5FWEA 4UBGA 3WNPA 1DCSA 1K5MC 1HLCA 4DNYA 2BV4A 4QDQA 2EA7A 5J36A 2OZJA 3TN91 5J7MA 4AI1A 4IV1B 4CDUB 3V64A 2BBAA 5CKNA 2NLRA 4JZRA 5FXZA 4LOTA 4A41A 4R4XA 1W9SA 2FDKA 2EIGA 3RMXA 3DGTA 3PLQA 4BU2A 1C57A 3J7HA 4CRQA 1MACA 4AFMA 1IPSA 2Y8KA 5C3PA 3HBZA 5JIUA 1AL23 4XF1A 2JB4A 1OA4A 2RS32 3VBOC 3USUB 2G4IA 2C26A 2YGMA 1WMXA 2CAVA 3HEIA 3ZO0B 4AHXA 5FXXA 3I59A 4I01A 1ODMA 1W2UA 3AMMA 2ZBJA 1RUOA 5HPOA 3I2OA 3AKSA 3JZVA 1IGOA 4XCBA 3KT4A 3IT8A 1F4AA 1MS3A 3LIHA 5J37A 2Y6FA 4K20A 1UXZA 5CU1A 3UETA 5HV0A 1RUC2 1BBT2 5FY8A 4NIHA 5I8YA 2A6YA 3ZSJA 4A4AA 1Y4WA 4QPGA 2XOMA 5C8CB 3H3ZA 2VMGA 5CEHA 2B39A 3VZNA 4WBBA 4QB6A 1IS4A 5FYSA 3OPTA 1RUH1 1LOFC 3VZJA 5CKMA 4KI5M 4H7MA 1MS8A 2C6SA 2Q1FA 1OPMA 4BJ0A 2YG0A 4CU9A 2W1QA 4M3CF 1SLTA 4OUEA 4ZONA 1TMF1 5FY4A 5FYMA 1UQXA 1VBD3 2YB7A 5T5LA 4I0AA 3NMBA 5BNPC 3MIGA 1ZA7A 3J4UH 1K42A 4GWNA 3TNPB 1UWWA 1LR5A 2ZOEB 4AAXA 1VRBA 3CHXA 4XILA 4Q4X2 3TN93 5FRAA 1W9WA 2LS6A 1Q8PA 2UY8A 3B9CA 4EROA 1SFYA 4AVSA 3KD4A 3VZMA 3MF6A 1ULFA 5A7OA 3AFKA 2VGDA 3TEWA 3OCPA 5FP3A 3EXUA 3JBG3 4FBFA 3DCQA 2YC2A 3DXUA 2R063 2Q1ZB 4ZZ5A 3VD7A 2D6PA 4LBMA 3U07A 3WNLA 4RS5B 1UCXA 1W6QB 4EWEA 5JXJA 2ZX2A 2YFZA 4XBNA 3MPPG 3OUIA 3ACLA 1JOJA 2ERFA 5J48A 5LZ6A 1E5IA 4JQRA 2BRTA 4W4ZA 1QJU1 4NMIA 4M0NA 1RUG1 4LMFA 3ZXLA 1NA1B 4LR4A 2QBXA 3JB8A 4UW4A 3I2DA 3GDBA 4YFZA 1KRIA 4JGZB 5FPLA 4JCKA 1S0IA 1W03A 1SCSA 1WW5A 2RS11 4AQTA 3R6SA 2O14A 3HNYM 4IV3A 4RGAA 5LWBA 3LFIA 4BH9A 4BLIA 2P37A 3LA7A 4N53A 5KXEA 1SHWB 2ZGMA 4URTA 2WWUA 1ZZ8A 2QQLA 3CQOA 2ZEWA 1AL0G 3MW4A 1C5HA 2RHPA 4Q4W2 5AC91 5FDBA 2F6BA 2VUAA 3B00A 2JG8C 3I2FA 4HK8A 1RUH3 1HB4A 5FY5A 1QJY2 4S2HA 3NNGA 1S0CA 2ARCA 2HLEA 1ZNPA 3QD6A 3WHTA 5C4WC 3PTYA 2XB6C 4CCDA 4CP1A 4RR3B 1JHJA 1TMF3 2H6CA 2MHFA 3DF0A 2QZ2A 2GMEA 3Q8FA 1CN1A 2JE8A 5GJ6A 2ZX1A 2VCCA 5FKCA 3MLKA 5LASA 4UW6A 5T50A 3KSCA 2GAUA 5KR7A 4YW4A 3J7NA 3WW4A 2A71A 2ZPXA 4CUAA 1Y9QA 4AEDA 3LEKA 2WIIB 3LDRA 4JDNA 1VPHA 4JDMA 1T6GC 4NROA 3SCGA 1DQ6A 5D2AA 2GC3A 2HWE2 2VR4A 3AZWA 1MPXA 4Y20A 4EQVA 4W8JA 3BCWA 1LOGA 3T2QA 1X7NA 1E5RA 1X36A 1HJFA 5H9QA 4FTBA 1DHKB 1VRH3 5C5UA 1QJU3 1GP4A 3N9PA 1LU1A 2QDRA 5DUVA 1K5MB 1IPKA 2CAUA 3DPRC 5LCWL 4GD4A 2D40A 5DUUA 2FCTA 2XLAA 2VOWA 5CG9A 3J9SA 2R49A 2OT7A 5A32A 4R52A 3VL8A 5JAXA 1AF9A 5IVVA 2ZHNA 3DEMA 4XMAA 2ZGUA 2GMMA 3VBFC 2JDNA 2EXHA 5FZMA 4NE9A 3AFGA 3AVSA 1R1ZA 4UT5A 3FMGA 4BQWA 1CPMA 4UFHA 2ZMKA 3GM8A 3ES1A 1NUKA 1Q3EA 4QHBA 1IKQA 2XJPA 3VBOB 1W2OA 3ZFGA 5T3NA 1DGWX 3H50A 3RYKA 1GOFA 2VZRA 1ZA4A 4CUBA 3TOJA 3C7EA 2YUEA 3VBUC 4OHYA 4OZOA 1ST8A 1U12A 5CKQA 5EV7A 3GZAA 1T6BX 3O1RA 3PU8A 5LY1A 2Y34A 3LSDA 3UKNA 4LBJA 5KXDA 1PZ9A 2I2SA 1WCUA 3N4MA 4QX0A 1Q8SA 1HRI1 1MZFA 2PLV1 3AXDA 3P3PA 2BPA2 3BALA 2DCYA 1V6KA 4LO7A 4Y3OA 2QUOA 1QQP3 2HWB1 1YFUA 4KGQA 5BV6A 4LUMA 1WA4A 2OXBA 2D93A 2R073 3T09A 3PIGA 5FZ7A 1GU3A 1HRV3 4XOGA 5FXVA 4HOOA 2WQ4A 4LBNA 1HB3A 3FJSA 1S55A 4DXRA 4XIKA 1NLSA 5FYTA 3S30A 5BNPB 3QH6A 2WN3A 3KV6A 3JD72 1CJPA 2DCJA 4XFBA 1LGCA 1HQLA 1REFA 1VMHA 2C1FA 4JX0A 1BCXA 4G3YC 5CA6A 4N9IA 3VDDA 3A4UA 3OY8A 3OGVA 3WF1A 2G1MA 2HWF1 2WT1A 2RS51 3MLJA 5C3RA 4IE7A 2EAAA 5E89A 5A6ZA 1DQ5A 1GFF2 1V00A 3S57A 2WA4A 1UF2C 4HG6B 4DS0A 4A44A 2VH9A 5EIYB 3BVCA 3FHAA 1GOGA 5E1RA 1L7QA 3MIHA 5E6HA 4BYYA 5F9TA 1DYOA 5IATA 3KT7A 3O1SA 2W39A 3RSJA 3BTXA 2E33A 1SQ4A 3LZZA 3N3HA 5BNQA 4HL0A 4IGOA 5DG2A 1OF4A 5A80A 4GQ7A 2DCTA 2OUHA 2QE3A 3ZMOA 4SBVA 4LHNA 3ETQA 5D8AC 2D43A 4C0BA 5LA1A 5F5QA 4QMAA 1NT0A 5C33A 2VMDA 3TAYA 1EP0A 4W6YA 1GZTA 2PAEA 1RUJ3 1N1TA 2WR9A 2X5IC 4XHXA 3CJIA 4Q0UA 3WG1A 5FQ0A 1BXHA 1JUIA 1YYNA 2KM2A 2Q1MA 1YNAA 1RUD2 2OPKA 3D0SA 3HVDA 2DYCA 4JDOA 1PO23 5TSWA 4AWDA 4UF0A 4HVRA 2Y0OA 1WCDJ 5A3MA 2W5FA 4W6XA 5FZHA 3ZYBA 1QGLA 2JG8B 4LHKA 1UX7A 3ECQA 4MV2A 4XFIA 4BIFA 5H9SA 3A21A 5F39A 3V56A 3ELNA 4Y1ZA 3NV1A 3AP6A 3K3NA 3ZXJA 1YIFA 2FCVA 5C4WB 1HKDA 3I2GA 1POV1 1ZRIA 2JICA 2WABA 4Y1YA 3TEYA 5IVYA 4GH4C 3O1PA 5BNNC 2VNGA 3WZ1A 5AFEA 4P02B 2W87A 4GJZA 3POGA 5IVJA 4LO6B 1MQTA 1BBT1 1HX6A 1ULDA 4CDXA 3NKGA 3W9AA 5C8WA 1OFSA 2HWF3 5IK8A 1WLWA 3I7DA 2B9VA 3NJZA 4QHOA 3MIFA 3NJYA 1NLRA 4NRQA 1HXS2 2AUYA 2MEV2 2QQNA 4EN6B 1UIKA 2BGCA 3FBYA 4LIVA 4YGDA 2ZXQA 2CGPA 1GZWB 3AKRA 1X8MA 4A3ZA 4WZFA 4Q1PA 1V70A 3WW3A 4XIOA 1ZBA2 4GULA 4WZCA 4Y4RA 3ZR6A 2QQJA 3DPRB 1F15A 2B45X 2UWCA 3KCXA 1JZ4A 3C7FA 4BMBA 2ZGTA 5FKBA 3HAGA 2VOXA 2ZHKA 4Q4X1 4N90A 5M0TA 4Y22B 1OQ1A 1OQEA 1SCRA 4TWTA 1YO8A 2IXJA 4QGNA 3VBFB 4Z8BA 3KHCA 4ZU5A 2WFF3 4BQ5A 4AVVA 5J98B 2PAKA 1OH3A 3W20A 1JI6A 2QFEA 2RM22 3Q8AA 5FO8B 5GKAC 4YVSA 2Y60A 1VBE1 4X8PA 5FAXA 5LEKA 1K3IA 3UYJA 4M0HA 1O3QA 3VBUB 3ZXFA 1PM4A 2JXAA 3RJRA 2RJ2A 5HCHA 2P3JA 4Y1XA 1EYBA 1HB1A 1POV3 2WUHA 1H1MA 3WNNA 1NCQA 5EYXA 2QQWA 1QOOA 4P9GA 4FPEA 2AZ5A 3K48A 4GWMA 3AX4A 3LEIA 5I0UA 2DDUA 3POBA 3UK9A 4IE4A 4EV0A 1BBT3 3H1YA 3OBTA 3TYJA 3NNJA 1JYWA 2PAMA 1AL22 5FXWA 4DY3A 3HQRA 1GNHA 2Z4FA 1W3VA 4XXPA 5JZGA 3DL3A 1OLME 4GWIA 4RFRB 1F5JA 1ODNA 2BQPA 3AKQA 3JQWA 1O3RA 1TME3 3DYMA 4K21A 4C1XA 5FCCA 4HKOA 3OD0A 3T0AA 2VBPA 4YGCA 1PGW1 5FFOC 4FOWA 3WCRA 3I3MA 2DUOA 5FMBA 2NP0A 4XUNA 1UL9A 2WNOA 4I09A 4ZXKA 1OI6A 2Q8OA 1U5ZA 1J3RA 5T52A 1HQWA 1W8HA 3H3LA 4RFT0 4YZ2A 1W6OB 1FYUA 3EB7A 4OVEA 3POWA 4YM2A 4NIDA 2WFPA 2P3YA 3U4XA 3BUCA 5ABJC 1OT5A 1ND2C 2WL1A 4AOCA 4LK7A 1EV13 1H2NA 5EHDA 4UFMA 2R7EB 2BDRA 4I0WB 2YXSA 3Q8BA 1VBE3 4S2GA 4AG4A 2XQXA 4HZFA 1O8PA 4FPKA 3LKJA 3I97A 1VBD2 3H3UA 3ON7A 1ASJ3 4WVZA 3M7AA 2XVKA 2VBDA 5D8AB 1A78A 1GANA 4XPVA 3TN92 2XDVA 4RYDA 4ES8A 1YQ8A 4HXCA 4K7JA 1RVF3 1M4WA 3ZDSA 3ALQA 3JBG2 2WRAA 2X5IB 4BB3A 3VBSC 4B3NA 1TVGA 2R062 2WLPA 5CZKA 5IJRA 2ADDA 4UW5A 2P2KA 2KD7A 5DDJ1 4XBQA 3GZUC 4NHLA 5FYBA 1YIPA 1YRZA 4IE5A 1I3HA 2RDSA 3QACA 4DUWA 4YSFA 4XTMA 4PHZA 2ZAHA 3P6BA 4JVAA 3BPZA 5A7WA 1WW6A 2VECA 5A3UA 3AL5A 4KG8A 3WDVA 3MUZ1 5FZ3A 1UMIA 1JN2P 1GP5A 4HK9A 5I0SA 1WBFA 3N9NA 4OUMA 4GH4B 2ES3A 1AR73 5BNNB 1DQ0A 3UT0A 4IETA 1PVC3 1BK1A 2QZ3A 2K46A 2PYTA 5JSOA 4Y5TA 5FZCA 4JGYA 2VAUA 3KF3A 4CCOA 2RG4A 3WXPA 5CFCA 2YC0A 1MZ5A 4MHUA 3ZN6B 4YYOA 3UV9A 1UPIA 2CSGA 1BK0A 2YU1A 1RUH2 1V6OA 2JE9A 3OPZA 2WDBA 1FXZA 5GLTA 4GWJA 5JR7B 4Q0SA 4Q0QA 1A6CA 1GQGA 3IZOA 2HWD3 1W28A 1TMF2 3DXTA 3RJ2X 2V4AA 1COV3 4P5YA 2WS93 3JD71 3VHOA 3O1OA 3J26N 2JDZA 2TUNA 1QH7A 3B69A 1AXKA 1AR82 1UY0A 2PN5A 2Z5WA 3T4HB 1C8M1 4CEWC 4CUGA 3MFCA 2VXJA 1FT9A 4MUVA 4O9EA 1UY4A 4M3CA 4N7IA 2VQAA 1SBDA 3RI9A 1AR63 1LHWA 2FMYA 2DF7A 3IB3A 3NKTA 4LITA 1F5FA 1KD7A 3ACGA 4Q8KA 5DDJ3 1TG7A 3ZFEA 2QQPA 1LJ7A 1CESA 1ALYA 5C71A 3K4AA 5DQ0A 3DV8A 2O0OA 3AP4A 3N7JA 3WNKA 1VRH2 2ZGLA 1WBLA 2XVGA 4QU1A 1QJU2 2QTWB 1OKOA 4QX2A 4AVAA 3O1VA 2PHFA 4BLJA 2FMDA 3WHUA 2XONA 2R30A 3VB9A 3GNEA 1PHMA 4D6QA 1J3QA 2Q0AA 2RDQA 3C7GA 3NRUA 3HT1A 4LKSA 3K77A 4MSVA 3VBRC 4LK6A 5JMCA 1DGLA 4EE2A 2D5HA 1RUD1 3H7YA 3IDBB 3ETPA 3VHNA 4LBQA 3ZYHA 4CCNA 5C3QA 3AMPA 1Y7BA 2B42B 4M3CE 3SH4A 3VBHA 2XJTA 4LBQD 2B9UA 3POJA 2VOTA 4LNVA 4IERA 3RWNA 4HN1A 1TEIA 2VXRA 4IGPA 4FTSA 3HN1A 2WNVA 5FREA 2A7AA 2GU9A 3SQOA 5JOZA 3VKOA 3CJXA 1JOBA 4QX5A 3VGIA 3PUIA 4AEDC 1CAUA 4BM8A 5EZWA 5BNOC 1ZX5A 2KR2A 1C8M3 5EJ3A 3M1HA 1QQP2 1TQ5A 4CTEA 1N47A 3RYRA 3T0BA 3UGHA 2Y6LA 4F8AA 1H2LA 2BGOA 3HBKA 1HQNA 3M70A 2EIDA 4FQZA 2R072 1JYVA 3KCYA 4RN5A 5ABJB 2XVLA 1ND2B 1HXS1 2MEV1 3IBMA 4IGQA 5F8PA 1HRV2 4CZSA 4JQTA 3LAGA 5LA9A 2ZX4A 2Q5TA 1R64A 3KMHA 2OVUA 4P14A 3SHRA 3WQ0A 1MS4A 3ILRA 1G9BA 4WM7A 1W6NB 3DKQA 1C1FA 5CB7A 3TNQA 3UKTA 3N7LA 3FN9A 3H9AA 3VZOA 1W9FA 2Y6HA 3ZYGA 1ZBA1 4XF9A 5FO7B 3KM5A 4OI2A 4W6WA 2E7QA 3IIIA 3MDPA 4M4PA 4CDQA 3RZLA 4JRAA 1BHGA 2BOJA 2WT2A 3LDKA 5F32A 2W1UA 1NCRC 3CU7A 5FZ9A 2VNRA 3WW2A 1NKGA 1QOSA 2BVVA 2KXLA 4L92A 4XXAA 5A3WA 2VMCA 3VBSB 5IVCA 5BY5A 2RVAA 5A6XA 4XUTA 4LHLA 4N43A 4D3WA 1UU6A 4BQYA 3BIEA 4NOTA 3BTZA 2BTVC 1OVPA 2JG9A 2JX9A 3I59B 2OUJA 4IEYA 4JRLA 3SEPA 4A42A 3AVRA 2PTMA 5CFDA 3RS6A 2HYKA 4LKEA 3NQHA 3NAPA 1OC1A 5A7NA 5HCAA 2ZA9A 1S2EA 1PMJX 1RMU3 4P9JA 2DV9A 4FPCA 2FDIA 2XUEA 4HSJA 1BJQA 1D4VB 2PMWB 3AZXA 4XABA 3PDQA 4Q1RA 1RUJ2 3NW4A 2KA3A 2JEMA 1DBNA 3K3OA 4XJ9A 2MPFA 3HR9A 5K4LA 4R8HA 5FUIA 2ZHLA 3AMHA 1PO22 3SITA 1AYN1 1OMIA 1F8VA 2AR6A 1AL21 4LE3A 4A45A 3IPVA 1XSQA 1Y3TA 2E53A 1RUNA 4DRRA 4QKNA 2R042 3I3QA 1NE6A 2J1EA 2VG9A 1XNBA 5FZ6A 3ZYRA 3NV3A 5A33A 5EP9A 5F3EA 1IS6A 2W91A 3URFA 2X53S 4LLFA 5BXXA 4JV4A 1S2KA 4CEWA 3RZJA 1C3HA 3LEGA 1RXFA 4ZKTB 3UJOA 5FYIA 4BXFA 4CCCA 5LEJA 3TBDA 1H6XA 5FZIA 4EZ4A 2BU9A 2IVJA 2ID4A 4LBOA 4XZUG 4EN7B 1I5PA 2ZACA 5FTTC 5JOYA 1OOPC 2E7TA 2GDFA 4UFKA 2DFBA 2OS2A 3Q8EA 4G9SB 2ILMA 4L8QA 1NZIA 5A1FA 1WMDA 5F1RA 2JDHA 4NJ4A 4BHPA 1XXNA 2EXIA 2D5FA 1G9DA 1UOJA 1A8DA 5FBZA 5A3TA 3ZFFA 5IVEA 4O65A 5C5TA 1VBD1 1AXYA 4R9DA 1PVXA 2ZGQA 4AFCA 4DFSA 1O6UA 2AREA 1IS3A 3PTRB 4XFGA 1JZ3A 2XJVA 5GZGA 2EXKA 1ZZ9A 4PJYA 3ILNA 1YQCA 2XWJB 2E32A 1OPOA 4XQWA 5FPAA 2YBSA 3JBG1 3VBRB 1Q8VA 4ZS2A 2WFF2 5F5CA 3FFQA 2CGNA 1US3A 2R061 4NHXA 4XC9A 4LXLA 1OVSA 1AYN3 4YVWC 1Q8QA 2VULA 1FPN3 4Q27A 3E1F1 4YZ3A 4DEVA 3ZLIA 4ASKA 1JXNA 3H1MA 1W2AX 3V0BB 5AVPA 1CAVA 4GXLA 2LALA 1XE0A 5GLVA 3A7QA 3DYOA 4IXLA 1J84A 2HEYF 4QU2A 2JENA 2B4KA 2J1UA 2BNNA 3BYWA 4K3UA 2WJSA 4MGSA 3BTYA 1FV2A 3EHKA 4IEQA 3AMQA 4CEYA 1S4CA 4R4ZA 5B2GB 4AEDB 5BNOB 5DAWA 4K1YA 1YC61 3VDBA 3JUUA 3WF3A 1UMZA 3IWZA 3FWEA 4CP9B 4XJWA 4IEOA 5GZFA 1GNZA 2BP6A 3DECA 3JU9A 3RG0A 3WDUA 4AI0A 1B35C 2CNAA 5ERLA 3OEBA 4PDWC 2J42A 2QQIA 4QX1A 1TME2 4AI8A 4AVTA 4LLOA 4KWUA 4COUA 3AZYA 4DY5A 4OI4A 3KV9A 5APAA 4BISA 3ACIA 3FX3A 3WSOA 1YI9A 4CUCA 1PK6C 2IFWA 4TSVA 3RMYA 1LHUA 3QBQA 4LJHA 4IESA 4QDRA 1DGWA 1WW7A 2ATFA 2ZKLA 3AKPA 4HVOA 5I8TA 1JYXA 2CWSA 4A7ZA 5DXDA 4CDWC 1AR81 3MF9A 5FY1A 1NCRB 3N9LA 4O61A 3LCPA 2G9GA 3EQEA 4DUXA 4HFSA 1QNWA 5FJKA 3KCCA 4PIZA 4UFIA 5FZOB 5FPVA 3AB0A 4FPJA 4L0PA 1EV12 1DF0A 4PIXA 1W0OA 4QB2A 3TEZA 4Z82A 4KWLA 5IK7A 1HV0A 3Q8CA 4HMZA 4JTNA 5FOJB 2Q8DA 1VBE2 1E5SA 1CZSA 2WQ8A 1VRH1 4XF4A 1AYM3 4C0HA 1I1EA 3B7MA 1U0AA 3D3AA 4CA9A 1ASJ2 3CZUA 4SLIA 2QDNA 3PURA 5KHHA 1ZM1A 1BEV3 4LKDA 4FPGA 4AXOA 4LPLA 4XACA 1OQDA 1S0DA 1RVF2 3AMNA 1B09A 1J3PA 3POEA 1DQ1A 2FCUA 3B5LB 4NRPA 1XYNA 2VTFA 5DZEA 4AFBA 2RJLA 4LQRA 4MHRA 5JCTA 3WCSA 2C9KA 2NPIA 3DN7A 2C24A 5K0UA 4FXKB 3TEXA 2ZAAA 3O12A 5DAXA 3RDIA 3E6CC 1YQ2A 1JODA 1W8FA 1MZEA 4B1MA 1QJX1 4NWVA 3WEZA 4XW3A 4WVMA 1XNKA 1WCSA 4CP0A 4K8FA 2D6LX 1PGW2 5KC5A 4CVUA 3OUHA 1ZZCA 3GGLA 4QPYA 1AR72 3BGAA 5A7QA 1CAXB 1CAWB 1PVC2 1XYOA 2VMIA 2W3JA 4CDUA 1AR83 5FOBB 1XE8A 3V65A 1QQP1 3OG2A 4DMIA 1OOPB 2OPWA 3AM2A 1UYYA 2R071 4QM9A 2YPJA 2VW2A 3GBGA 4V2WA 1CZVA 1HRV1 2CWMA 3IKWA 1IS5A 4ZPIA 4YW1A 3I2KA 1MVQA 2NZ9A 1A8MA 3RI8A 1ULCA 4P9YA 1SFPA 4KQ7A 3USUA 5FR3A 1DLCA 5L7OC 2DU1A 2Q30A 3VD4A 3ZXEA 4YW2A 2HWD2 4ASLA 1ULPA 4AK3A 1QXPA 3U10A 4AGVA 2WZPP 2ET7A 3U14A 2R1DA 4F83A 4Q4V3 1COV2 5GZEA 2WS92 1QXRA 1LULA 2JD4A 4JHZA 1RUI1 4B4PA 1JYIA 3I2HA 1PZ7A 2XJRA 4PCRA 3CIHA 5FY9A 4ES9A 5L19A 4BK5A 4UF0B 2G19A 4COWA 4YZ1A 1TE1B 3MV11 4HKLA 4MYEA 1VIWB 1AXZA 1AR62 3HPNA 1RHI3 1CIYA 5FWJA 3ABZA 4QPIC 5FZ0A 5C8CA 5DDJ2 4XUQA 2A6ZA 4O7XA 4ATFA 5JLVA 4YVWB 1BYHA 4NVPA 4FTEA 4L99A 4B4RA 4IEVA 3WDYA 1EPZA 5FYVA 4DB5A 1MS1A 4XEZA 1NOVA 3MBWA 3LB9A 4KBBA 1QJX3 2H0BA 4OHVA 5A3PA 2XMLA 4QQ2A 4R9CA 4XJUA 2Q8EA 4WVWA 3OTFA 1XNDA 3AYDA 2VMEA 4EN9B 4AHZA 1O8SA 4OCTA 4XE9A 4S2DA 4FT8A 4HPKA 4X8NA 4XJZA 2BFUL 1RUJ1 1JS9A 2BWAA 2EAKA 2ENRA 2W52A 1KGYA 4QDSA 1HB2A 5I0TA 2ZGKA 5FPXA 4G4FA 2GH2A 1C1LA 2WAOA 1PO21 3SCHA 2JKBA 1D7PM 4PIYA 3VHRA 3PJQA 2VZPA 1B35B 2Y0IA 4GJYA 3TB0A 2R041 2W2IA 3E6BA 4PDWB 1I6XA 1J83A 1LU2A 4RS5A 4PQQA 1W6QA 2JWPA 3C7HA 4FFIA 4YNIA 2E9QA 2GMPA 3LWCA 3POSA 4AW7A 4TLGA 3M3QA 4HVQA 2I07B 2YBKA 1PK6B 2VZQA 1OH4A 5CAZA 1UXXX 4YWAA 1S2BA 4HLTA 5JIAA 2XHNA 3A22A 3WINE 3C2UA 4JGZA 1RUI3 2WO1A 2A6XA 3GZEA 1LGBA 2W0XA 1WLDA 1LODA 4CDWB 1C8M2 1ZVFA 5ISLA 2PHXA 1Y9MA 3WP4A 4PI2A 1HJGA 5JMOA 3JXSA 1H8TC 4Q2FA 4OFGA 2VVDA 4RQPC 1WD4A 4NPRA 2ZEXA 1YEWA 1ULGA 1ND3C 5HI0A 1LNSA 1XB9A 4QXCA 3KQRA 2GN7A 2NMOA 1W90A 2AH2A 4QPWA 5L9BA 1N1VA 4IEWA 4W65A 4B29A 4YZ5A 4FO9A 5G05L 4K6BA 3NJXA 5CYYA 4AYUA 1A34A 4RR3A 2XGXA 4BZ4A 1C28A 1WMEA 3ACHA 5KHJA 4IEPA 5LBEA 1D4M2 3B02A 3ZYIB 3RZHA 4K9SA 5H9PA 1A3KA 2WFF1 3WG4A 2E6VA 1FAYA 3LGRA 1VB2A 2DWRA 3RPQA 4UOJA 5DZGA 5EWSA 5J96B 1S0JA 1YFXA 3PVOA 4COYA 4ZU7A 3FFZA 3NV2A 4FFFA 2R043 2WNVC 3IIAA 4WM8A 5DMYA 4C1WA 1UY3A 1XBFA 2AYHA 4QX7A 3ZN5A 1RMU2 2VCMA 3B94A 3NL1A 1JYNA 1JMUB 5C9AC 5GLZA 3IAPA 4AFAA 2HWC3 2IXHA 1K5MA 2YV8A 4GMP0 5F5IA 5T5JA 3VD3A 2O8OA 1FMD3 5EYYA 4D94A 1O4YA 1AR93 1X9TA 1NAEA 3I4IA 1VBA3 2YMZA 4C91A 1YI7A 1U5IA 2VZ1A 4Z2WA 3WLUA 1Q56A 5FY7A 1KITA 4Y1VA 4LKFA 4ITCA 1W2NA 4AI2A 1TME1 3A23A 5F3CA 5L7OB 1VAKA 1SG3A 1YLLA 2OIIA 4LEJA 4RHV3 1NY71 1AX1A 1W6MB 4UBHA 3I3EA 3V0AB 3LPGA 5DN2A 4FPFA 1S0FA 2BERA 4MLOA 1SBEA 4KGGA 4D7SA 2JB8A 3GCXA 1XNTA 3FLRA 3OBAA 2D7FA 3ZPYA 4AQ2A 4OQ9A 2PQSA 3B01A 5F2WA 4PBPA 5FLHA 1QHDA 2Z79A 4QPIB 2XQRA 2E51A 1AX2A 1EV11 3P3NA 1XE7A 4OUSA 3AK0A 4XAEA 5F3GA 3ZYJB 5B4NA 2OQ7A 2PXJA 3LE0A 5KHIA 4ARXA 3APBA 5GALA 1URXA 4X6RB 4YW7A 3HMYA 1O3TA 1K5JA 4XYXA 2WYFA 3ME2A 5GZDA 5IT6A 2DUPA 3B93A 4XJ8A 4FAGA 1ASJ1 1TNRA 2YBPA 1Q43A 2WZEA 4NWWA 3UJQA 2AC1A 5BNPA 2PFWA 1RVF1 4IUGA 3I2JA 4JGYB 5IYYA 1OF3A 1E5HA 3ZPOA 1AUYA 3NNLA 5CADA 3OGGA 4I3GA 4QQLA 1OLQA 4B1LA 5FPUA 2DBIA 2ZX0A 2OYZA 1AYN2 1SBFA 4ARYA 4MH0E 1FPN2 4XF3A 4C90A 5FV3A 3HD8B 1KS4A 2A3YA 3FBMA 2I74A 3H1WA 1W39A 1MS0A 2Y6GA 2P3IA 1RINA 1Y43B 3OPWA 3SH3A 3UESA 4BMEA 5JPNB 1UZYA 3AJZA 4I30A 3FHQA 2D98A 3KT1A 5SV8A 3THCA 2FDFA 1ENRA 4TLFA 2P3KA 3LD8A 3ZKUA 4AZZA 1O91A 1AR71 4FPLA 3RWKX 1PVC1 1JYCA 3J8F1 5F2SA 4HETA 2BVBA 4BQ2A 1RUF3 2JDUA 4AL9A 3CEWA 1XSRA 1STMA 2V4VA 1FOD1 3EMRA 3RVHA 4XBLA 4EN0A 1H4GA 1H8TB 4H2AA 5FZ1A 1GNYA 4RQPB 3CKHA 2XR4A 2WSVA 1O4TA 1XNAA 2VZVA 3CF6E 2IUWA 1H6YA 4OHXA 5DZFA 5EPAA 1ND3B 4FOYA 5L9VA 5I91A 5K9YA 2JG8A 5DG1A 2X8KA 5A3OA 1OBNA 1NLQA 1RXGA 2HWD1 1OLRA 1W8UA 3N36A 5C4WA 1W05A 1COV1 1ZYBA 5GLUA 2WS91 2GNTA 1KXGA 3H8OA 3PMSA 1CZTA 1PGSA 2VCBA 3KS7A 4D7TA 2ARXA 2Y6JA 1RUE1 2W95A 1IHMA 4WV8A 1JZ5A 3LA2A 4W50A 4HONA 3RQ0A 3PJYA 4JHTA 3T08A 1AR61 3ZYFA 1Y9GA 4M00A 4CXXA 2BZDA 1GR3A 1XJAA 2UYBA 2BNOA 1GZ9A 2P34A 5C70A 1AZDA 1F35A 1VR3A 3AZVA 5CIRA 3GHNA 4QKFA 4RSUA 1MS5A 4DXTA 2WNVB 1AYM2 1SFNA 2D97A 3RZGA 4XMIA 1XU2A 1GZWA 2D6MA 3POIA 4HSLA 1FATA 2Y38A 5IK5A 3M8LA 2ZS6B 1BEV2 1CAUB 1JU4A 5C9AB 4RGGA 2XWBB 3DPRA 4QQOA 4QPGC 5DUXA 1YCIA 3FUQA 4A6SA 1PX3A 1Z0HA 2NYYA 1CQ9A 4E4HA 5ACA3 3O1UA 2EIBA 2WT0A 1UMHA 3J8F3 2VZ3A 4ATEA 4QKBA 1X50A 4Y22A 4P00B 3SKVA 1P8JA 4YG6A 1JZ2A 2HJIA 2VOVA 1FOD3 2XJUA 1O4ZA 4KBZA 1AJKA 4QGLA 1JBCA 4GIQA 3JQXA 4FOQA 4IE6A 3A0KA 1IG3A 3MGUA 2IXLA 2VTXJ 3H42B 5JUVA 1V6MA 2JIJA 2P6HA 2VD7A 3AZZA 4ORFA 3WQ7A 1UZVA 3OBZA 2W1SA 2PHDA 1OD5A 3BI3A 1PX4A 3NV4A 1WZXA 4LBKA 3RYPA 1G86A 3FLPA 3H8UA 4XJAA 5LBBA 3O1MA 4QQPA 2RR13 2TNFA 2Y26A 4XDQA 4XQDA 4OHZA 1TNFA 5JXHA 1GWMA 5DAQA 1XYPA 2A5ZA 1RUE3 3BU0A 2GC2A 1W06A 2PHTA 3CDZB 4OHWA 4YLZA 5CG8A 3HNMA 4V2VA 3ZKYA 4NUBA 4NHMA 1GBGA 3MO4A 5FZKA 3WQ1A 1F9KA 1O3SA 3QLQA 1CPNA 3USSA 2HKXA 1CR7A 4MZUA 5CISA 4OI0A 2OKXA 5FZLA 4AEKA 3RZZA 1JUHA 4UXAA 4LOSA 4Q4V2 1WKYA 2W47A 4IV3C 4L9BA 4N53C 1CONA 1UZZA 1DZTA 4NRMA 3IAQA 5K0UC 1D4M1 1JZ6A 2RJKA 2PQQA 1Z78A 5J3UA 3O0XA 3GXUA 2JDYA 3G6JB 4R9BA 4BQ4A 1RHI2 2DCZA 2PHLA 1GV9A 1AJOA 1W6OA 1SZBA 2R0FA 2LRPA 5A33B 4QWNA 3WVJA 3RNSA 1XOYA 4NPLA 1DZQA 3ENRA 4GA9A 1MEC3 1K12A 5FMOL 4YGEA 2C9AA 3BIWE 1HW5A 4AQSA 3K4ZA 1QJX2 4FPYA 1YQ6A 3AYEA 1RMU1 1IG0A 3AYCA 4ONUA 1SEFA 3DKWA 4Z07A 5FZ8A 2FBEA 3MEPA 4YARA 3VDCA 1DDLA 3MYXA 1QMJA 3VL9A 1QKQA 4RGKA 5ANNA 4E2QA 2J1VA 2YPDA 2CY6A 1ZBE3 3T30A 3P1IA 3KWVA 1H0BA 2ET1A 2DVBA 5D8AA 5E88A 1D0GA 1RITA 2IVIB 1GYKA 4P08A 2JE7A 1VALA 4Z1VA 4IE0A 5FP9A 4FOVA 4LBLA 2X5IA 3S7EA 4D6SA 5GZCA 4MO3M 3J7LA 1VP6A 4ZU4A 4XHBA 4YG0A 4YGBA 5FLJA 1VB4A 3UGGA 3VZKA 3ZVXA 3MZHA 4Y26A 4PBOA 4X6QB 1JW6A 1SMVA 3POYA 4JKKA 3C7OA 5LB6A 5KBFA 2PHRA 5LA2A 4NHKA 4LA3A 1UYPA 2WYSA 4A7KA 2A6WA 2P6CA 4AHWA 4EN8B 3PL0A 1RUI2 3H0OA 3NNFA 3WF4A 2J1SA 2XLGA 1Z7S2 3HJRA 1V6IA 4LO5B 3PUQA 1HN0A 4PI0A 4AAPA 5BNNA 2VUCA 1D4M3 1K45A 4GMP1 5DABA 1QU0A 1UD1A 4AE2A 1UY2A 4NIGA 3BB6A 1UZWA 2ZTNA 3TWIA 3ZFGC 4FAHA 1X9PA 2WWJA 3HQXA 4IDZA 4AFDA 4MGKE 3CL1A 3ZN6A 4Z2AA 2WO7A 3VV1A 1BLZA 5A1LA 1DU3D 1MS9A 3WP6A 4NIIA 5I8SA 1SDDB 2JD9A 2OA2A 4YG3A 4ZXEA 3ZR5A 4INDA 4GZ9A 4E2SA 1EUUA 1DP0A 1G7YA 1PO11 5FYUA 1YFWA 3N35A 4XVHA 1PIV1 3NVCA 2CDPA 4KWJA 2LROA 3I49A 2L9LA 4MXWA 4NHYA 3W58A 2RE9A 4QPGB 1R081 4CCJA 2BGPA 4OMDA 2UURA 5FP4A 4FPOB 1H4HA 3I3DA 2RMU3 2VUDA 2HBUA 1PM7A 2D44A 1D0HA 2EXJA 4PF5A 3AYAA 1FPN1 1LOCA 4CP2A 5HXMA 4A2UA 1VBC1 2BFUS 3WNXA 2BJSA 3WOGA 1H9WA 1KJRA 1UZ0A 3WDWA 4LA2A 3LDBA 3F95A 1XPWA 1OA3A 3ZSEA 5KXBA 3MIEA 1W0NA 4QAWA 1RGSA 2HWC2 2Q4SA 3VDDC 3GBWA 3T4VA 1UX6A 2JDPA 5FPZA 5B4XA 4EJRA 2WBKA 1QWRA 5F6LB 1JZ8A 5FLIA 1FMD2 1AR92 1VBA2 1C5IA 3ZXDA 1EAH3 2D3PA 2FZ1A 2W94A 3AC0A 4Q4Y3 4GMP3 4KWKA 4BA6A 2WZR3 1LAJA 1QJFA 1W6PA 1XQNA 5GM0A 3WX5A 3CBNA 5FZ4A 1ZZBA 2GNDA 1WCKA 4AGGA 5JVVA 1SPPA 5I0DA 5IAVA 2ZMLA 1JYTA 2CHHA 3OYWA 4IQPA 3ROUA 1SLAA 2V5DA 5HCFA 1IOAA 4RHV2 4KU7A 1GWLA 2ARBA 4XFAA 1VE0A 3ZDVA 4IV3B 4UAPA 1PO13 3CJIC 2XKPA 3KLSA 1W04A 4N53B 1PIV3 3PUAA 4QXHA 4LO4B 4AI3A 1FX5A 4META 4DIQA 2XJQA 5K0UB 1R083 1JH5A 3BTAA 4MXVA 1LOEA 4QXKA 2DCKA 2VU9A 4YW3A 1O5UA 4OYUA 2V5YA 2YROA 4GB33 4WM8C 3LQCA 2QKDA 5KWRA 1VBB1 3ATGA 5KHKA 1SLLA 3ZN4A 4WVMB 2VMFA 5ABJA 1ND2A 5BYNA 2JECA 5JXGA 2X10A 1DQ4A 3GJBA 1VBC3 2DURA 1AYM1 2JKXA 2WC2A 2VQTA 2ZGNA 3NSTA 2VW1A 2HBTA 1IPJA 1W6NA 3FC0A 4TXWA 4Q26A 3ZXGA 3AL6A 3GZTB 3OSDA 3J7MA 3WD5A 1BEV1 5L9RA 1VJ2A 4NAMA 5LW9A 2V09A 3WQBA 1YWKA 2PHWA 1MQTC 1UPSA 1O5LA 3INAA 4CDXC 4ET7A 4AGRA 3IN9A 4I3PA 4DRVA 2XKOA 1V6JA 2SLIA 2VW0A 5KC6A 1JOPA 1UU4A 1DGRA 4MVTA 3GF6A 1QDCA 1L7LA 2QQUA 4Y20B 3VBSA 3GCWA 4BDVB 1UIJA 1WLCA 3OGSA 1OURA 3WDXA 2BWCA 2PELA 5F7UA 1WLTA 4Q29A 1RJ7A 3WY6A 4URAA 3M3EA 2E63A 1RC6A 1LKNA 1POQA 3N7MA 4XF0A 3BN6A 2E31A 1NY72 1S0EA 5A32B 1PZ8A 2UY9A 1NXD1 3BOPA 2W9XA 1GP6A 2CTVA 1DQ2A 4N8MA 4M01A 4CCEA 5FO9B 2Y33A 1Q8OA 5HV4A 1LECA 1RUF2 2UYAA 2JDMA 1R093 3KV5A 4PLNA 3U75A 2K0GA 3AXEA 2OW4A 3K4DA 5JR2A 1UKRA 2WO2A 4YVSC 4ASMB 3ZFGB 3NJVA 3SH5A 3G7DA 1VBB3 2VCAA 1C8NA 2V73A 1VAMA 2YDEA 2EIEA 2W92A 3JCIA 3U0ZA 2WZ8A 4RA0A 1NCQC 2AEZA 4ZY9A 4Y4YA 1LGNA 4BE3A 4CSWA 4HPKB
chains in the Genus database with same CATH topology
2A73B 4QD2A 2ZGOA 4GALA 2YY1A 4KH9A 4LT5A 4O9GA 1ZREA 1H1IA 1YJLA 1RHI1 2WNUA 3E97A 4HBNA 5JZGC 3SLIA 1N3OA 3VKNA 3LOBA 1RB8G 4DQAA 3EBRA 2B46X 1SLIA 2W08A 3Q9OA 3O14A 1QF3A 3WR0A 3WUCA 4A3XA 2R16A 1V9U1 3VKFC 5E16A 1AHSA 2XJSA 1CGPA 4BCUA 1QY4A 1UU5A 1HDKA 1I9RA 3VDDB 3WP5A 3OY8B 4L11A 5H9RA 3SCFA 3CLPA 5HBAA 5ACA2 3J8F2 4LTAA 1GLHA 4IV1A 1G9FA 3WG3A 3D5OA 3SXWA 4H7LA 1FOD2 2XPJA 3IDCB 3VBRA 3B9IA 3ILFA 1C4RA 1GKBA 1YXWA 4B8EA 4FXGB 1GSLA 4KNCA 4I2OA 1R1A1 2VVFA 4XFFA 2D6KA 2TEPA 2DVDA 1ENXA 2K2SA 1NZCA 3MPBA 2ZZJA 3V0BA 1UKGA 2D3SA 3OGJA 2IC1A 1ENSA 2XBO1 4D69A 1E57A 3T1LA 3EJKA 1LEMA 1JTZX 3VUOA 3KGLA 2RR12 3CJIB 5FQ0B 2B8MA 1Z7S1 3ZMNA 3AKTA 3VHPA 1KS5A 1QOTA 3R4DB 4LO8A 1RUE2 4MGIE 2WQZC 5BNOA 5K8SA 1NYWA 2XH6A 1UW8A 2IXCA 3O5SA 2PHUA 4K1ZA 2D6OX 4WM8B 4Y1UA 5CNAA 2GZWA 3BOWA 3VN4A 2F4PA 4KU8A 2BUKA 3VZLA 1PGL2 5KXCA 1RUG3 5LRSA 2XG3A 5T5PA 1RL3A 1V9U3 3AP9A 4H14A 1X8EA 3MICA 1MQTB 2BEOA 2RS13 4Q8LA 2A3XA 2GN3A 4JGYC 4YM1A 1AX0A 4CDXB 5CFCC 1PNFA 1QDOA 3U11A 2W68A 2GSYA 1NCRA 2CL2A 2DVFA 1DYPA 2R1BA 5CVRA 3HIFA 3HT2A 5AC93 1CIWA 5T54A 1MEC2 2ZGSA 3D0JA 1R1A3 1GZCA 1XU1A 2DTWA 3D82A 1H2MA 2D6NA 5I93A 2WA3A 2O8QA 3L9JT 2XBO3 2HWC1 2MNGA 4P5HA 5IUQA 1NA1A 1ZBE2 2VVEA 3IDEA 3OD4A 1FMD1 4H3WA 4NR1A 3UKVA 1AR91 3ZIXA 1VBA1 1Z7S3 3GYDA 4IEXA 2ZGPA 4Z92B 2IZWA 1DGRN 3BU7A 2GH8A 3SNMA 3ZFEC 1V6LA 1S0BA 2Z2SB 4YVSB 4XFHA 4XETA 3RRDA 4S2FA 2QJVA 1LEDA 1NE4A 1LHNA 3M3OA 3X29B 5JI7A 3VKLA 1NCQB 2FQPA 5JSRA 1X82A 4RHV1 3S7IA 3AP5A 1Q5OA 3ES4A 2HEVF 2C5DA 1SLCA 4A7YA 2BW8A 2R32A 3ZIWA 1X33A 1BVP1 1BQPA 2I45A 5AVAA 1CAXA 5E8AA 1CAWA 4BQ1A 2H0VA 3VBHC 5JZGB 4N7UA 3M4FA 1OOPA 1OSGA 4U2AA 2A70A 1DG6A 4E4ZA 2A6VA 2WWSA 4BWOA 1BVVA 1N3PA 4FPHA 3MLLA 2N7GA 5LK7B 2P17A 4QGMA 2DFCA 4P9XA 1NQDA 5FMOS 4F3JA 5L36A 3FLTA 3R0RA 1HRI3 5LRRA 2PLV3 3ZX7A 2C0ZA 5JPMB 1G9CA 4DINB 2ZABA 5SV5A 1YHFA 2VNOA 2HWB3 4XQ4A 2RMU2 2GNMA 2RS31 5BPXA 3CNAA 4WM7C 2ZCWA 5F6KA 1L3JA 4MGZE 2GC0A 1OA2A 4KG0A 4YVWA 3IM0A 3PMEA 3VBOA 4EWAA 2NM1A 1IZ3A 4CDQC 3WV6A 5A3LA 2DTYA 2EVXA 1ZRCA 4DOUA 3ST7A 2B7YA 1XNCA 1RJ8A 2VUJA 4XTPA 2NQYA 1RUC1 4N9HA 1EY2A 2GNBA 4R9AA 1EAH2 1H30A 1RUF1 2RS53 4N43C 2WINB 4ISRA 4NO4A 4Q4Y2 2WZR2 4AF9A 2JG9C 3R05A 1S0GA 3KGZA 3W59A 1H2KA 3QOPA 5CFDC 1CD3G 5IK4A 3NAPC 2YZ4A 3NO8A 4F7ZA 1D2QA 2CGOA 1B35A 4PDWA 2XL9A 1LOFA 3N7KA 3AJYA 2WSUA 2YYOA 3THPA 1YJKA 1KQRA 5T5OA 5JOXA 1FNZA 1PO12 1PK6A 1PIV2 2UU8A 4YM3A 1FNYA 4OULA 1GQHA 3NWKA 4OZXA 3ZSKA 1R082 5EXOA 5CFCB 1QH6A 4CDWA 4BIOA 1UAIA 3WP3A 4GB32 2UWBA 4E4SA 3ZSMA 2BBVA 2RS33 1G9AA 4LE4A 1GICA 2XLFA 1VBC2 1OHFA 1CVNA 4Y5Z0 3D4KA 3D6EA 3I54A 4FQ4A 3FUOA 1LOBA 4FCAA 4CEWC 1MZ6A 1V6NA 3LSEA 3S0MA 1SACA 1MR5A 2DU0A 3A0NA 2DUQA 1H9PA 4HN0A 4J1XA 3S6PA 1BMV2 4XFCA 3GBFA 1CJDA 4M3CB 4OI1A 3R4UA 5ACA1 1RUC3 2LTNA 3ZYPA 4V1PA 1DIWA 2UWAA 3ZFEB 2FZ2A 1U5XA 4PQ9A 4Q4W1 4D7YA 5JSPA 3SMHA 1LCLA 3ZXAC 1QJY1 2QNKA 3M2MA 1REEA 4LUKA 3ZFFC 3GHMA 1PMIA 4YZ4A 4YFWA 4Q4V1 3QH7A 1YUDA 2NMNA 1ZRDA 1SLBA 2ZX3A 1RIRA 2ETEA 5LK5A 5JDBA 1ULEA 1F2NA 2RR11 2ZJCA 4Q4X3 1ZRRA 3PHMA 1LB2A 4LULA 3O0WA 1H1AA 1PNGA 1R092 4YM0A 4LBQB 2ZKNA 4H55A 1OKQA 3VBHB 4DXZA 4AVCA 4NN0A 2HWE1 1QNYA 1VBB2 4TZDA 2IXKA 1QXJA 3PVNA 3I8TA 5CBLA 1PGL1 2DVAA 3MFAA 4U36A 1N3QA 4E2GA 5L7OA 3OJBA 3O0VA 1JHNA 1I5ZA 4MGYE 4CEYC 3ASIA 3JB4C 1W6MA 4B7KA 4JAAA 3V0AA 3WT3A 4JC1A 1LOAA 5L73A 3WW1A 1KDKA 1KFUL 4K40A 1ZZ6A 1N1YA 1FI2A 3VBFA 4Q4W3 2IXIA 2YGLA 1MEC1 4WM7B 4QPIA 3AP7A 1QJY3 4B4QA 2IWGB 2CYFA 1HV1A 1LHOA 4TYSA 4CDQB 3VBUA 4I0BA 1ZBE1 2OZ6A 2VPVA 2ZHMA 4JTOA 1BZWA 1NG0A 2A3WA 4N43B 1BKZA 4PLMA 3KB5A 1WUVA 2Z42A 2JG9B 2H6BA 3PNAA 1CX4A 4AEMA 5CFDB 2HWE3 4FP3A 3NAPB 1F31A 1U5YA 4UW3A 1NQJA 1M06G 4FSJA 2NN8A 1D2SA 4MXWB 2VMHA 1APNA 3MIDA 3WG2A 3IMNA 5EFUA 1AVBA 1SDWA 2WNUC 5K7PA 2O1QA 4HT1T 2WNEA 3IPVB 4HKWA 2WLQA 4RD7A 4COVA 4OLLA 4QQHA 2BNMA 2AENA 2LM3A 5JOWA 1H8TA 2R6QA 3L2HA 3D8CA 4AHYA 4RQPA 5KHGA 2K9ZA 1LESA 1RUG2 3ZXKA 4CEWB 3R4SA 1ND3A 2JJ6A 3T2TA 4QM8A 3L2YA 1V9U2 4DZGA 1N1SA 2XHKA 1H8VA 1LENA 3E5QA 1EPWA 4CDUC 4IV1C 2RS12 2HEWF 3OF1A 2EF6A 1G8WA 4COZA 1W6PB 3M3CA 4YRDA 4FVVA 2CV6A 5JWPA 2A75A 2WKKA 1WW4A 2RMU1 2DVGA 2X29A 5AC92 1WD3A 5J09A 1DFQA 4XZPA 2TBVA 3OYWB 3WUDA 3ZFFB 1R1A2 2Z69A 2G9FA 4L2NA 1IKPA 2IFRA 3UL2A 3LA3A 2GALA 3T1MA 3FE5A 4E4DX 1DYKA 1W0PA 2XUMA 1O7FA 2XBO2 3MW2A 2VQ0A 1UN1A 3JD73 5C9AA 1WGPA 3FHIB 5HCBA 3DUIA 1DLLA 4GH4A 5C8CC 1EAH1 4Y24A 4Q4Y1 2E7AA 5BUVA 3KZ4C 1ONAA 2WZR1 2ZMNA 5T55A 2VY0A 2LUWA 2R0HA 3GALA 4P9WA 1CAVB 5C6CA 3MI8A 1DZRA 4QT6A 4E9KA 3E5UA 1J1LA 4CEYB 5AFBA 4J1WA 4HANA 4Q0PA 5D1IA 2BYVE 4P9IA 3FZ3A 3ZSLA 1KFXL 4EWDA 4Q0VA 2ZZQA 3MW3A 2EALA 1RUD3 4GB31 3CO2A 2RM21 4RS5C 4IEZA 2XL7A 3B3QE 5HXVA 3M3IA 1RTVA 1KDMA 2YHJA 2QCSB 3H7JA 3THTA 4DPNA 4L97A 1NA1C 1REDA 3PVEA 4GKYA 3WDTA 2ZGRA 4JGZC 5GLWA 1J1TA 1XRUA 2GC1A 3E6DA 3HWJA 1ZZ7A 4IEUA 5JI9A 1BMV1 1HRI2 2PLV2 1LTEA 1NXMA 1ZRFA 4AEJA 4KL1A 4I02A 4J6GA 2HWB2 1WMFA 4B7EA 1J59A 3OBRA 4AVBA 1G6NA 1HXS3 2MEV3 3C3VA 2AGSA 1KJLA 1S1AA 1MVEA 3EO6A 3SISA 3QCWA 4P9LA 4IL7A 3E5XA 2VOKA 4RR3C 1ENQA 3LOIA 2D3RA 1ZBA3 3O7OA 1LRHA 1VAVA 3MIBA 4RL7A 4AQ6A 1YFYA 2WNUB 2B5HA 1FV3A 2HWF2 2RS52 4FP2A 1J58A 1R091 2SBAA 5DUWA 1IQAA 3VLBB 3TRSB 5I0RA 1HIXA 1QJZA 4BOWA 1VLNA 1OFNA 3PVBB 4ISQA 4WVVA 2RM23 1LHVA 3BODA 3K51A 4GKXA 4E27A 1POV0 4YW5A 3VKMA 4CYDA 2PA7A 4PLOA 2QVSB 4BPZA 2FHRA 4UBGA 1K5MC 1HLCA 4DNYA 2EA7A 5J36A 2OZJA 3TN91 5J7MA 4AI1A 4IV1B 4CDUB 3V64A 2NLRA 4R4XA 2EIGA 3RMXA 3DGTA 3PLQA 1C57A 4CRQA 1MACA 4AFMA 3HBZA 5JIUA 1AL23 4XF1A 1OA4A 2RS32 3VBOC 3USUB 2G4IA 2YGMA 2CAVA 3ZO0B 4AHXA 3I59A 4I01A 1W2UA 3AMMA 2ZBJA 1RUOA 3AKSA 3JZVA 1IGOA 3KT4A 3IT8A 1MS3A 5J37A 4K20A 5CU1A 1RUC2 1BBT2 5I8YA 2A6YA 3ZSJA 5C8CB 4QPGA 3H3ZA 2VMGA 2B39A 3VZNA 4WBBA 1IS4A 1RUH1 1LOFC 3VZJA 4H7MA 1MS8A 1OPMA 4M3CF 1SLTA 1TMF1 5T5LA 1VBD3 5BNPC 4I0AA 3MIGA 3J4UH 4GWNA 3TNPB 1LR5A 2ZOEB 4XILA 3TN93 4Q4X2 5FRAA 2UY8A 1Q8PA 3B9CA 4EROA 1SFYA 4AVSA 3KD4A 3VZMA 3MF6A 1ULFA 3AFKA 2VGDA 3OCPA 3EXUA 3JBG3 4FBFA 2R063 2Q1ZB 2D6PA 4LBMA 3U07A 4RS5B 1UCXA 1W6QB 4EWEA 2ZX2A 4XBNA 3MPPG 3ACLA 1JOJA 2ERFA 5J48A 4JQRA 1QJU1 4M0NA 1RUG1 3ZXLA 1NA1B 4LR4A 3JB8A 4UW4A 3I2DA 4YFZA 1KRIA 4JGZB 4JCKA 1S0IA 1SCSA 1WW5A 2RS11 4AQTA 3R6SA 4IV3A 4RGAA 4BH9A 4BLIA 2P37A 3LA7A 4N53A 5KXEA 2ZGMA 4URTA 1ZZ8A 1AL0G 3MW4A 1C5HA 2RHPA 4Q4W2 5AC91 5FDBA 2F6BA 2VUAA 3B00A 2JG8C 4HK8A 1RUH3 1QJY2 4S2HA 1S0CA 3QD6A 1ZNPA 3WHTA 5C4WC 3PTYA 2XB6C 4CP1A 4RR3B 1TMF3 2H6CA 2MHFA 3DF0A 2QZ2A 2GMEA 1CN1A 5GJ6A 2ZX1A 3MLKA 4UW6A 5T50A 3KSCA 2GAUA 4YW4A 3WW4A 2A71A 2ZPXA 1Y9QA 4AEDA 2WIIB 4JDNA 4JDMA 3SCGA 1T6GC 1DQ6A 2GC3A 2HWE2 3AZWA 4Y20A 3BCWA 1LOGA 1X7NA 1X36A 5H9QA 4FTBA 1DHKB 1VRH3 1QJU3 1LU1A 2QDRA 5DUVA 1K5MB 1IPKA 2CAUA 3DPRC 2D40A 5DUUA 2XLAA 2VOWA 5CG9A 3J9SA 2R49A 5A32A 4R52A 3VL8A 5JAXA 1AF9A 2ZHNA 4XMAA 2ZGUA 2GMMA 3VBFC 2EXHA 3AFGA 1R1ZA 3FMGA 1CPMA 2ZMKA 3ES1A 1Q3EA 4QHBA 1IKQA 2XJPA 3VBOB 3ZFGA 5T3NA 1DGWX 3H50A 3RYKA 1ZA4A 3TOJA 3VBUC 2YUEA 4OHYA 1U12A 5EV7A 3GZAA 3LSDA 3UKNA 4LBJA 5KXDA 1PZ9A 2I2SA 3N4MA 1Q8SA 1HRI1 1MZFA 2PLV1 3AXDA 3P3PA 2BPA2 3BALA 2DCYA 1V6KA 4LO7A 2QUOA 1QQP3 2HWB1 1YFUA 4KGQA 5BV6A 4LUMA 1WA4A 2D93A 2R073 1HRV3 4XOGA 2WQ4A 4LBNA 3FJSA 1S55A 4XIKA 1NLSA 3S30A 5BNPB 3QH6A 3JD72 1CJPA 2DCJA 4XFBA 1LGCA 1HQLA 1REFA 2C1FA 1BCXA 4G3YC 5CA6A 4N9IA 3VDDA 3A4UA 3OY8A 2WT1A 2HWF1 3MLJA 2RS51 2EAAA 5E89A 1DQ5A 1GFF2 1V00A 2WA4A 1UF2C 4DS0A 2VH9A 5E1RA 4BYYA 3MIHA 5F9TA 3KT7A 2W39A 3RSJA 1SQ4A 3LZZA 3N3HA 5BNQA 4HL0A 5DG2A 4GQ7A 2DCTA 2OUHA 2QE3A 3ZMOA 4SBVA 4LHNA 3ETQA 5D8AC 2D43A 4C0BA 5F5QA 4QMAA 5C33A 3TAYA 1EP0A 4W6YA 2PAEA 1RUJ3 1N1TA 2X5IC 4XHXA 3CJIA 4Q0UA 3WG1A 5FQ0A 1BXHA 1JUIA 1YYNA 2KM2A 2Q1MA 1YNAA 1RUD2 2OPKA 3D0SA 5TSWA 2DYCA 4JDOA 1PO23 4AWDA 4HVRA 2Y0OA 1WCDJ 5A3MA 4W6XA 1QGLA 2JG8B 4LHKA 4MV2A 3ECQA 4XFIA 4BIFA 5H9SA 3V56A 3ELNA 4Y1ZA 3NV1A 3AP6A 3ZXJA 1YIFA 5C4WB 1HKDA 1POV1 2JICA 4Y1YA 4GH4C 5BNNC 2VNGA 3WZ1A 5AFEA 4LO6B 1MQTA 1BBT1 1HX6A 1ULDA 4CDXA 3NKGA 3W9AA 5C8WA 1OFSA 2HWF3 5IK8A 1WLWA 3I7DA 3NJZA 3MIFA 1NLRA 1HXS2 2AUYA 2MEV2 1UIKA 2BGCA 3FBYA 4YGDA 2CGPA 1GZWB 3AKRA 1X8MA 4WZFA 4Q1PA 1V70A 3WW3A 4XIOA 1ZBA2 4GULA 4WZCA 3DPRB 2B45X 2UWCA 3KCXA 4BMBA 2ZGTA 3HAGA 2VOXA 2ZHKA 4Q4X1 4N90A 4Y22B 1OQ1A 1OQEA 1SCRA 4TWTA 1YO8A 2IXJA 4QGNA 3VBFB 4Z8BA 4ZU5A 2WFF3 4AVVA 5J98B 2PAKA 2QFEA 2RM22 5FO8B 5GKAC 4YVSA 1VBE1 4X8PA 5FAXA 5LEKA 4M0HA 1O3QA 3VBUB 3ZXFA 2JXAA 3RJRA 2P3JA 4Y1XA 1EYBA 1POV3 1H1MA 1NCQA 5EYXA 1QOOA 4P9GA 4FPEA 2AZ5A 3K48A 4GWMA 3AX4A 5I0UA 3UK9A 4EV0A 1BBT3 3H1YA 3OBTA 3TYJA 2PAMA 1AL22 4DY3A 1GNHA 4XXPA 5JZGA 3DL3A 1F5JA 2BQPA 3AKQA 3JQWA 1O3RA 1TME3 4K21A 4C1XA 5FCCA 4HKOA 3OD0A 4YGCA 1PGW1 5FFOC 4FOWA 3WCRA 2DUOA 2NP0A 1UL9A 4I09A 4ZXKA 1OI6A 2Q8OA 1U5ZA 1J3RA 5T52A 1HQWA 4RFT0 4YZ2A 1W6OB 1FYUA 4OVEA 3POWA 4YM2A 2WFPA 3U4XA 5ABJC 1ND2C 2WL1A 1EV13 1H2NA 4I0WB 2YXSA 1VBE3 4S2GA 4AG4A 4HZFA 4FPKA 3LKJA 1VBD2 3H3UA 4WVZA 1ASJ3 3M7AA 2XVKA 5D8AB 1A78A 1GANA 4XPVA 3TN92 4ES8A 4K7JA 1RVF3 1M4WA 3ZDSA 3ALQA 3JBG2 2X5IB 3VBSC 4B3NA 2R062 2WLPA 4UW5A 2P2KA 5DDJ1 4XBQA 3GZUC 4NHLA 1YIPA 1YRZA 1I3HA 3QACA 4YSFA 4XTMA 2ZAHA 4JVAA 3BPZA 1WW6A 2VECA 4KG8A 3WDVA 4HK9A 1JN2P 5I0SA 1WBFA 4OUMA 4GH4B 2ES3A 1AR73 5BNNB 1DQ0A 4IETA 1PVC3 1BK1A 2QZ3A 2PYTA 5JSOA 4JGYA 3WXPA 5CFCA 2YC0A 1MZ5A 3ZN6B 4YYOA 3UV9A 1UPIA 1RUH2 1V6OA 2JE9A 3OPZA 1FXZA 5GLTA 5JR7B 4Q0SA 4Q0QA 1A6CA 1GQGA 2HWD3 1TMF2 3RJ2X 1COV3 2WS93 3JD71 3VHOA 3J26N 2JDZA 2TUNA 1QH7A 3B69A 1AXKA 1AR82 2PN5A 2Z5WA 1C8M1 3MFCA 1FT9A 4MUVA 4O9EA 4M3CA 4N7IA 2VQAA 1SBDA 3RI9A 1AR63 1LHWA 2FMYA 2DF7A 3NKTA 4MX3A 1F5FA 1KD7A 4Q8KA 5DDJ3 3ZFEA 2QQPA 1LJ7A 1CESA 1ALYA 3DV8A 2O0OA 3AP4A 3N7JA 1VRH2 2ZGLA 1WBLA 2XVGA 1QJU2 4AVAA 2PHFA 4BLJA 2FMDA 3WHUA 2R30A 3GNEA 1PHMA 1J3QA 2Q0AA 4MSVA 5JMCA 3HT1A 3VBRC 1DGLA 2D5HA 1RUD1 3H7YA 3IDBB 3VHNA 4LBQA 3AMPA 1Y7BA 2B42B 4M3CE 3SH4A 3VBHA 2XJTA 4LBQD 2B9UA 4LNVA 4IERA 3RWNA 4HN1A 1TEIA 2VXRA 4FTSA 3HN1A 2WNVA 5FREA 2A7AA 2GU9A 5JOZA 3VKOA 3CJXA 4QX5A 3VGIA 4AEDC 1CAUA 4BM8A 5EZWA 5BNOC 1ZX5A 1C8M3 5EJ3A 3M1HA 1QQP2 1TQ5A 4CTEA 1N47A 3RYRA 4F8AA 1H2LA 3M70A 1HQNA 4FQZA 2R072 3KCYA 5ABJB 2XVLA 1ND2B 1HXS1 2MEV1 3IBMA 1HRV2 4CZSA 3LAGA 2ZX4A 2Q5TA 3KMHA 2OVUA 4P14A 3SHRA 3WQ0A 1MS4A 3ILRA 1G9BA 4WM7A 1W6NB 3TNQA 1C1FA 5CB7A 3UKTA 3N7LA 3H9AA 3VZOA 1ZBA1 4XF9A