4YM3A

Crystal structure of the human galectin-4 c-terminal carbohydrate recognition domain in complex with lactose
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
139
structure length
139
Chain Sequence
PPTFNPPVPYFGRLQGGLTARRTIIIKGYVPPTGKSFAINFKVGSSGDIALHINPRMGNGTVVRNSLLNGSWGSEEKKITHNPFGPGQFFDLSIRCGLDRFKVYANGQHLFDFAHRLSAFQRVDTLEIQGDVTLSYVQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Sugar binding protein
molecule keywords Galectin-4
publication title Structural characterization of human galectin-4 C-terminal domain: elucidating the molecular basis for recognition of glycosphingolipids, sulfated saccharides and blood group antigens.
pubmed doi rcsb
source organism Homo sapiens
total genus 36
structure length 139
sequence length 139
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4ym3A00
2ZKNA 3WUCA 5F9TA 4PCRA 3WDTA 1AXZA 3OY8B 3N36A 1LENA 1W6NB 3I4IA 5T52A 3WDVA 1DIWA 3N7JA 3BODA 4PQ9A 2ZAAA 2NP0A 3NV3A 1S0GA 1UPSA 2I2SA 4XJ8A 5F5QA 2DVBA 4ATFA 1VIWB 5HCFA 5DUUA 2P3JA 3AP7A 3R4UA 4LBKA 5DUVA 3WZ1A 2CTVA 1N1YA 3NWKA 3OGGA 1G9AA 3IPVA 2PHUA 4P9YA 1SCRA 1CESA 4YW3A 1URXA 4FPYA 1C57A 4FQ4A 4YM1A 2ZHNA 3H0OA 2TEPA 1SLTA 2DYCA 1D2SA 2W68A 4AVVA 1UN1A 1Z0HA 1ENRA 1IS5A 3SH3A 1QOTA 3AYAA 1BKZA 4CTEA 1G7YA 3M2MA 1LHNA 2CNAA 1SBDA 3BTAA 1W6MA 2DU1A 4WZFA 1W6OA 1CVNA 2V73A 3A0KA 1SLAA 3MPPG 4UW6A 4YG0A 4PF5A 3SISA 1DQ6A 2JJ6A 3NV4A 1W6QB 1LTEA 4YGBA 1WLCA 1GV9A 1MR5A 2AUYA 4FP2A 5LK5A 5IT6A 1WBLA 2JECA 4Q8LA 3RSJA 1LOCA 1QNWA 1OQ1A 4YZ1A 1JN2P 1S0IA 2PHFA 2G4IA 1W0PA 1ULGA 3AP4A 1AX1A 4UW5A 3WV6A 5L73A 1MS8A 4XBLA 1I3HA 2W52A 2A3YA 3VKLA 1KJRA 3WDXA 5CA6A 4K20A 5EWSA 3AZYA 3FUQA 3WG1A 2EXJA 2ZGPA 4YW2A 4XJZA 4XXPA 4YG6A 5CNAA 1O4YA 2D6OX 4D69A 4M3CA 4DPNA 1ZM1A 3O0VA 1G9DA 1FYUA 5T5LA 1PZ8A 1AVBA 2KM2A 1YI7A 1CQ9A 4WVWA 3ZPYA 3W58A 2ARBA 1IKPA 5GZFA 1C1LA 2NYYA 1WUVA 4XOGA 1NLSA 5EYYA 4U2AA 3M3OA 1G86A 5DZFA 2JKBA 1FATA 4Y1ZA 4PBOA 4LBJA 1LOEA 3IPVB 3FFZA 1GYKA 1UL9A 4OZXA 5DUXA 1MZ5A 1SBFA 4ISRA 1GZCA 3POSA 4CRQA 3B00A 2EALA 4LBOA 3M3CA 2DVDA 4BM8A 3N3HA 3V65A 3WLUA 3RS6A 1AJKA 5HCBA 3WDYA 3WHTA 5IK5A 1QDCA 2ZGMA 3WCRA 3OBRA 1QOSA 2JE7A 4M00A 1FX5A 1SACA 4TYSA 4JC1A 1W6OB 4M3CF 3V0BA 1MS1A 1TEIA 2GNDA 2PHWA 2PHXA 1APNA 4BLJA 5GZGA 3V0AA 4CZSA 4R9CA 3AXEA 1WD3A 2E7TA 3R05A 1QOOA 1DFQA 2R49A 3UL2A 4M3CE 1H30A 3RMYA 3B9CA 4UW4A 2GDFA 4YM0A 3GNEA 4RL7A 1CIWA 5H9RA 1LCLA 3O5SA 1HKDA 3NV2A 3IM0A 2A3XA 4Y1UA 4DRVA 4XIOA 1W6PB 2PHTA 4XIKA 4NO4A 4YM3A 1ZA4A 3SNMA 2PHRA 2VUAA 3ZSLA 1MS3A 1AXKA 4JCKA 3VKFC 3FUOA 2C9AA 5IUQA 5IK8A 5JOYA 2GALA 1UMZA 2ZMNA 3ZXFA 1VLNA 4FP3A 5T50A 5JLVA 2DUOA 4FQZA 3UK9A 3ZYRA 2CYFA 3A0NA 1F31A 3N35A 1F5FA 5IK4A 2EF6A 4BMEA 2FMDA 5JOXA 1V6JA 1WLWA 3AZWA 3WCSA 4Q8KA 1BQPA 1UZZA 3I8TA 5CAZA 4Y26A 3QCWA 1KDKA 4GWMA 5T5PA 1MACA 4ITCA 1EPWA 1A3KA 3M3EA 4YFZA 4XBNA 4XJ9A 2YXSA 1DYPA 2VW2A 1LGCA 3N7KA 4XMAA 2A3WA 4Y20B 1LHWA 1VALA 1BJQA 1N3QA 3O0WA 3W59A 3V0BB 1V00A 3PVNA 1DQ5A 1DQ0A 4YZ5A 4XHXA 4Q1PA 2YV8A 3V0AB 4YGDA 1VAVA 5FRAA 2D3SA 4K1ZA 3ILFA 2DURA 4XHBA 4XMIA 3APBA 1FNZA 1H9WA 1DGLA 4LBQA 1SLBA 1DHKB 1LECA 1XQNA 1S0JA 1AX0A 2GN7A 2EXIA 2A6ZA 4ZXKA 4AVSA 2OW4A 1N3PA 3ZXJA 4ZKTB 1GBGA 3OYWA 1CN1A 1N1VA 4GWNA 3USUA 4XJWA 4YLZA 4UW3A 1CPMA 2WSVA 2CL2A 3AFKA 2VU9A 1S0BA 1FV2A 1MS5A 3ZYPA 1DZQA 1JW6A 4XE9A 2W08A 1IKQA 2OUJA 1Q8VA 1QKQA 2DU0A 1GZWA 1JYIA 1FNYA 1GANA 4YZ4A 2ZMLA 3MW4A 1J1TA 4JRAA 4M01A 4C1WA 2ZGTA 4C1XA 1S0FA 1DYKA 4HANA 1S1AA 1HQLA 5GJ6A 2V5YA 4XZPA 1G9FA 2WT0A 1DQ2A 5H9QA 3SITA 3WDUA 3JU9A 1RINA 1WW4A 5H9SA 5GM0A 1S0DA 3IKWA 2DUQA 2ZACA 3OPZA 4XDQA 1OFSA 2UWCA 2CWMA 2D6LX 1Q8OA 2P37A 3FLRA 1SCSA 1O4ZA 4FPJA 1RIRA 4WVVA 1ENSA 2VW0A 1WW7A 5KXCA 2ENRA 4K1YA 3VUOA 2DTWA 2A6XA 1UAIA 2D3PA 1NXD1 2AYHA 2YZ4A 2WLQA 4K21A 1QF3A 4YW1A 3Q9OA 2NMNA 4LBNA 2ZGLA 2AGSA 4ISQA 3PVEA 4Q27A 1KRIA 3INAA 3LSEA 5FREA 1BXHA 3TAYA 2ZBJA 4GKYA 1A78A 1MS9A 3AYEA 3M3QA 4FPGA 3RG0A 4TZDA 3HR9A 1WD4A 3MW2A 2XB6C 5DG1A 2WT2A 3KM5A 2H0BA 1WCSA 5AVAA 1LHVA 1W6MB 2R16A 3MEPA 5T54A 4AWDA 2ZGNA 1G9BA 3OBTA 3OYWB 4FOVA 4SLIA 3UJQA 4FPOB 4MYEA 3B01A 3USUB 3WG2A 3DGTA 1YYNA 1GKBA 1Q8SA 5GLUA 1UKGA 3OY8A 5DUWA 2NN8A 4R9DA 1ONAA 1GLHA 3AXDA 4FVVA 3T2TA 1V6OA 5DG2A 1KITA 1LHUA 1IS6A 3R4SA 1N1SA 2RHPA 2WJSA 1KQRA 4YM2A 2NZ9A 3AJZA 1GICA 1LHOA 1GZ9A 4YG3A 1LU2A 3BOPA 4R9AA 3PMEA 5SV8A 5T5OA 3M1HA 5JOWA 3WUDA 2WQZC 3AZZA 4KBBA 5GLZA 2FHRA 4M3CB 3POYA 2DVFA 2HYKA 2PELA 2R1BA 2ZGRA 4XYXA 3RRDA 2R0HA 1CJPA 4DS0A 1WW6A 1R1ZA 2DVAA 1QDOA 2ZHLA 4LBQD 4BOWA 3O12A 2SBAA 2E7QA 3B3QE 2ZHKA 1W0OA 2E51A 2WT1A 3WVJA 5KXBA 4DRRA 3WOGA 3AZXA 2NMOA 1S0EA 2ZGSA 2YROA 1QU0A 1CONA 5DXDA 2UURA 4YGCA 4P14A 3FLPA 1AXYA 1JOJA 2ARXA 2EXKA 3A4UA 2A70A 3FBYA 4XILA 5E89A 3CNAA 4Q1RA 1B09A 1DLLA 4GA9A 3O0XA 1JHNA 2VH9A 2GNBA 2GNMA 4AYUA 3D4KA 2DVGA 3AP5A 5GLWA 1LGNA 3OJBA 2GMMA 1DBNA 5KXEA 4AGVA 4FPHA 3UJOA 1LOBA 3D5OA 1ENQA 1U0AA 3IMNA 4XTPA 2A6YA 3T1MA 3WG4A 3GALA 3DUIA 2VW1A 1LEDA 2DV9A 5DZEA 2A6WA 5T5JA 1H9PA 4FOWA 2VY0A 2ZABA 1AX2A 1X50A 2AR6A 1WW5A 2GMPA 2ZMKA 2ZGKA 3BIWE 2B7YA 2CWSA 5JMCA 5IK7A 4FPCA 2E6VA 2XG3A 1F9KA 1V6NA 5GZEA 2A75A 2A71A 3AP6A 3RMXA 3SLIA 5JOZA 4U36A 2CY6A 4HL0A 4P9XA 2ES3A 2JE9A 4L8QA 1LOGA 4LBMA 3WDWA 3V64A 3ATGA 2LALA 4Y1YA 1HDKA 5GZCA 1PZ9A 3VKMA 1LULA 2JD4A 1PZ7A 4I30A 4YZ2A 2LTNA 3T1LA 3AX4A 1LGBA 3RQ0A 3ASIA 5EYXA 5JDBA 2P2KA 5EXOA 1IOAA 3NV1A 2JDZA 2OVUA 2VXRA 1Z78A 1CR7A 2D6MA 1G8WA 5DZGA 4Y1XA 1RITA 4FOYA 4H55A 2AENA 4YFWA 2DWRA 2WKKA 3HN1A 4XJUA 4BMBA 3ZSMA 4FPLA 1GNZA 1YXWA 3AYCA 3ZVXA 2AH2A 4XXAA 3AP9A 3HMYA 5T55A 4XJAA 2GNTA 4Y22A 1Q8QA 4FPKA 3C2UA 1SFYA 3U4XA 1SBEA 2E53A 1HLCA 2A6VA 3ILRA 5GLVA 1FV3A 1YIFA 5CBLA 1ULFA 3QLQA 1AJOA 1MZ6A 2D7FA 1YRZA 2ZGQA 1KDMA 3POWA 3AJYA 1IS3A 1G9CA 3ILNA 4DQAA 4DFSA 4WV8A 2ZA9A 4RA0A 3WHUA 1N1TA 1A8DA 3AK0A 1S0CA 1BZWA 1W6PA 2EXHA 1IS4A 3JUUA 1AF9A 2C5DA 2WSUA 2ERFA 1GNHA 3ENRA 4AGRA 1V6IA 4NOTA 2D43A 2R1DA 1UX6A 1YO8A 1LJ7A 1LU1A 2D3RA 2D6KA 5GALA 1MVEA 2BQPA 4LBQB 4BQ1A 1GSLA 1QMJA 3SH4A 3ZSJA 2D6NA 3VV1A 4P9WA 5E8AA 1MS4A 1UZYA 2Q5TA 3L2YA 3WG3A 4GKXA 1JXNA 1Q8PA 2D6PA 4FOQA 2P34A 5GZDA 1V6KA 4YZ3A 4W65A 1LOFC 2D44A 1W6NA 5JVVA 1C4RA 2UU8A 5E88A 2DTYA 2W39A 1ULEA 1ULCA 2GMEA 2R0FA 2YY1A 3AZVA 3AYDA 3IN9A 3ZXEA 1GZWB 4R9BA 2A5ZA 1LEMA 4Y24A 4PBPA 3ZXKA 5GLTA 2SLIA 2ZGUA 5HCAA 5H9PA 4Y20A 4ASMB 3TB0A 2GN3A 4Q26A 3SH5A 1V6LA 1ULDA 4ATEA 3N7MA 4Y22B 4YGEA 1BYHA 1CPNA 2OUHA 1JUIA 1LODA 1D0HA 2YMZA 1KJLA 4FPEA 4YW5A 3ZXLA 1QNYA 1Y7BA 2NM1A 3LCPA 4GXLA 5KXDA 1DQ1A 4BPZA 5CB7A 1AZDA 3PJQA 1Q56A 4Q2FA 2EIGA 1MVQA 1I1EA 3FLTA 1C1FA 2P3KA 1V6MA 4GALA 3VKNA 4FPFA 4BLIA 4AGGA 1LESA 4LBLA 2A7AA 3D6EA 1N3OA 1OKQA 1W6QA 1SLLA 2ZGOA 3N7LA 1LOAA 2UWAA 3MW3A 2P3IA 2Z42A 2ZZJA 2DUPA 1QGLA 4AVTA 3ZSKA 3PVOA 1JYCA 4IQPA 4XBQA 1LOFA 1JBCA 3LSDA 2EAKA 4Z8BA 1SLIA 4F83A 4Y1VA 2UWBA 1MS0A 3KQRA 2WNEA 5BYNA 1VAMA 1WBFA 1WLDA 1DQ4A 1N47A 4YW4A 3WNXA 3VKOA 1SLCA 4XTMA 3B69A 2AREA 1HQWA 2ZHMA 1FAYA
chains in the Genus database with same CATH superfamily
3DXUA 1ZZ6A 2ZKNA 3GBWA 5FYZA 4BDVB 5F9TA 5LA1A 1W3XA 4PCRA 4FFFA 1OT5A 1QEXA 3N7JA 3NQHA 5LY2A 3S7IA 2ZAAA 3SMHA 2XUEA 1LRHA 3GZUC 5A7WA 1DGWX 2OIIA 4DY3A 5I91A 2HWD2 3KF3A 1P8JA 3AMNA 1O3RA 1ZRFA 4IGOA 2JDUA 2WZR2 4NIIA 2Z69A 2ZTNA 1IG0A 1KFXL 3NWKA 3IPVA 1UY4A 1SCRA 1CESA 5A32A 1AYM3 1URXA 5J36A 2XPJA 1UIJA 5FUNA 1SLTA 3HJRA 4W50A 5FZ1A 4OUMA 1Z0HA 1ENRA 2ZXQA 3AYAA 3HVDA 3M7AA 2D93A 4BJ0A 4LO8A 2ZEXA 4ES9A 2O1QA 2JIGA 2PXJA 2CDPA 1XNAA 2DU1A 3HAGA 1ND2B 1F15A 1TMF1 2V73A 4JDOA 4QB1A 3A0KA 5CKMA 4YG0A 4E4HA 4UW6A 2NLRA 3OD0A 1LTEA 1OA2A 1TQ5A 2F6BA 2Z5WA 4Q4V3 1GV9A 4IDZA 1WBLA 3JQXA 4PHZA 4AQ2A 2BZDA 4OLLA 1S0IA 2G4IA 1E5SA 1ULGA 1AX1A 1GWKA 3WV6A 1HRI1 5A70A 5BUVA 3PVBB 1XE8A 5FUIA 1RUC3 3VKLA 2YDEA 1AR73 2HLEA 4DEVA 2EXJA 2IZWA 3E5QA 3FFQA 4YW2A 1UO9A 1VJ2A 2CGOA 1O4YA 5CNAA 3ROUA 3QBQA 1NQJA 4MHRA 1ZZ8A 2C26A 3WF1A 1R64A 1OD3A 2OXBA 4RS5A 5ANQA 2P5BA 4C0HA 1TVGA 5A7WB 4LT5A 4OQ8A 5GZFA 1OPMA 2WC2A 4XOGA 2W47A 1QY4A 1BEV2 1ZBE1 3BU0A 3EQEA 4AEJA 4JV4A 3VGIA 1DYOA 5FFOC 4A45A 5KHJA 4XACA 4UI9L 4X8NA 3VBHC 3BTZA 4CDXC 5CFCC 1YCIA 2VNGA 3IPVB 4OZXA 1RMU3 2PTMA 4EWAA 5I8TA 1HW5A 4ISRA 1AR91 4XFBA 3I97A 2YU2A 1PK6B 1WMFA 2EALA 2Y6GA 2E63A 3WLUA 3V65A 5L9VA 1AJKA 2MEV3 4MXVA 2VTXA 5FY8A 2IC1A 2DCZA 1AHSA 2IXIA 1QDCA 2PHDA 2Q1MA 2QBXA 2ZGMA 1OLRA 2JDMA 3OBRA 2BJSA 4IEOA 4QPGC 1ASJ3 3VB9A 5BNQA 1SACA 5I8SA 3KLSA 1VB2A 4K6BA 2JG9C 4FXKB 1HB3A 2GZWA 2GNDA 5LBEA 5D21A 1S2BA 4XCBA 4BLJA 5KC5A 3JD72 2Q8OA 3UT0A 4CZSA 1XE7A 3KV5A 1KXGA 2BV4A 1STMA 4GWIA 3VL8A 1HRV3 4LK7A 4PIXA 1XU2A 2WAOA 3F95A 1QJX2 4C0BA 4AEMA 3ZLIA 1EUUA 3E5XA 4LO4B 4AEDB 3CKHA 2QQLA 1W9SA 4YM0A 2GDFA 3GNEA 3K4DA 1LCLA 5DPNA 1ST8A 2OQ7A 3IM0A 4D7YA 1AL0G 3I2DA 2VZTA 4N90A 4KMQA 1W6PB 1OUXA 3NMBA 2VD7A 1AL22 1COV2 4LK6A 4ORFA 3VBHA 4CDXA 4YM3A 2BNNA 5CFCA 3J7LA 4MGQA 3Q8AA 1UXZA 4GB31 3ALQA 4RS5B 5FYMA 2C9AA 2BVVA 5AVPA 3ACIA 1DGWA 3I2IA 4H7MA 2VZQA 1PGW2 5ABJC 2ZMNA 1WA6X 5A33B 3EHKA 4FP3A 4QXHA 1VR3A 2DUOA 2JB8A 4XW3A 4S2HA 2CYFA 3A0NA 1F31A 3N35A 4AI1A 1O3QA 1JYTA 5IK4A 4QPGA 3WNMA 1BQPA 1GUIA 2RVAA 2WWJA 2XQXA 2JG9A 4JKKA 5BNOB 4ONUA 1KDKA 1AR62 1MACA 1A3KA 1K3IA 1GQGA 1R091 1L3JA 4BXSV 4YFZA 4LIUA 3HQRA 3VD7A 3N7KA 2XJQA 2A3WA 2NPIA 5A3MA 2VZOA 1DQ5A 1EPZA 3RZJA 4CE8A 4XHXA 2VQAA 4H2AA 3SEEA 4YGDA 1VAVA 2C9KA 5FZHA 3NNFA 4A6SA 4QDSA 4YRDA 1NLQA 4XMIA 4YW7A 2CAVA 1OVSA 3APBA 1REDA 1PIV1 1XSRA 1JU3A 3WY6A 2X53S 4QX2A 1DHKB 2H6CA 4Q4Y2 3QD6A 2DCJA 2A6ZA 2EXIA 4URAA 2OW4A 1N3PA 2HH9A 5IYYA 3S5AA 1GBGA 3K51A 3LA7A 3OYWA 4QM8A 5FZ8A 3URFA 1I5PA 5ABJA 2VCCA 5J09A 1X9TA 2J1TA 2ZS6B 1H1MA 2W5FA 1GWMA 3HT2A 3OCPA 4UW3A 4B8EA 5CADA 2VU9A 3C7OA 1MS5A 1IKQA 1C3HA 1DLCA 4QPIC 4RSUA 1JYNA 1ZYBA 4CSWA 3RNSA 1GANA 3THPA 2YBPA 4HPKB 3ME2A 5FYVA 2BPA2 4HANA 4AK3A 1Y4WA 4GJZA 3J8F3 3LAGA 4AR2A 1F2NA 5H9QA 5C4WA 3WDUA 3JU9A 3TRSB 3CEWA 3IDEA 2PMWB 1S0DA 1ZBE3 2ZEYA 3DPRC 4LUKA 4XDQA 3A22A 5FZ3A 3CZUA 3KT4A 2WLPA 3D82A 2D6LX 3IMMA 3NSTA 5ABJB 1CAWA 2A1XA 1YEWA 1O4ZA 5FWEA 2DCYA 5A7OA 1RIRA 3POFA 1W8OA 3O1PA 5DMYA 1W2AX 3VUOA 5HXMA 2A6XA 1ODMA 3T2OA 1NXD1 2AYHA 1QF3A 3AMMA 5FP8A 3FL7A 3Q9OA 4LBNA 3H7JA 4ISQA 1PO22 5D1IA 2Q30A 3INAA 1A6CA 5FREA 4Q4X1 3TAYA 2CV6A 3QOPA 1UOJA 1EP0A 1A78A 3H8UA 4TZDA 5C5UA 1UY2A 5C71A 5FY7A 1DDLA 2RS11 1FPN3 4B7KA 4QPIA 1QJFA 1RVF1 3KM5A 3AFGA 1TME1 1W6MB 3ZR6A 3HBZA 5J96B 3TN93 3OBTA 3OYWB 4B7EA 1G9BA 4Y5TA 1UKRA 3UJQA 5FTTC 3B01A 2WO1A 1YYNA 4RHV1 2JG8C 1PVC2 1UKGA 3GBFA 2R073 3OY8A 4AW7A 1ONAA 1GLHA 4YNIA 2W95A 1KITA 1HJGA 2RHPA 5EFUA 4QXBA 2WJSA 5F5AA 3DPRA 3TEXA 1BLZA 3BTXA 3DYMA 1Y3TA 1GICA 3ITQA 4RGAA 1LHOA 3PTRB 1ZBA2 1LU2A 2H0VA 1UMIA 5T5OA 1GOGA 2XWBB 4GB33 1NUKA 4D6SA 2GC2A 3AZZA 5C4WB 4LOSA 5FZEA 1QJZA 3CBNA 4MH0E 1W8TA 3NKGA 2FHRA 1QIQA 4ARYA 4QHZA 4C8DA 1RL3A 2DVFA 4XYXA 4HKOA 3LDBA 4IV3B 1YJKA 2R0HA 1CJPA 1WW6A 5FP4A 3POIA 1J3RA 2DVAA 3K77A 4LBQD 1ZZBA 5CYYA 5HXVA 3UGGA 4QT6A 2WWUA 1W05A 3HD8B 2E7QA 2VMFA 3B3QE 3KV6A 4D8MA 2ZHKA 3ACHA 1W0OA 3WVJA 2DFBA 4DRRA 3WF0A 1HB2A 3AZXA 1CGPA 1S0EA 3KD4A 4W6XA 3ZYFA 1J3PA 3FLPA 1AXYA 2ARXA 1HIXA 3NNMA 1LR5A 5FBZA 2QNKA 3JXSA 3CNAA 1SZBA 2BNOA 3MLJA 2VH9A 1OH4A 4LJHA 4AYUA 1GQHA 2DVGA 2I45A 4R4ZA 5FLJA 5F1RA 2JG8A 2VMGA 4OHXA 5FZAA 5KXEA 3EYPA 3AL6A 3KB5A 3UJOA 4KI5M 1U0AA 2A6YA 5JCTA 2IXCA 2EIDA 3NL1A 4K3UA 1RYYA 3SKVA 2A6WA 5T5JA 4NIHA 5FY1A 1X50A 2AR6A 2BGOA 4MGIE 1PM4A 2B7YA 3AMQA 4A42A 2E6VA 2BP6A 2TUNA 5GZEA 3RI9A 2I74A 1ZA7A 4HN1A 3RMXA 1J3QA 3SLIA 2Q0AA 4U36A 1WKYA 2CY6A 5FJHA 4CEWC 1V0AA 2IVJA 4L8QA 3AM2A 4JDNA 3ATGA 1PZ9A 2QDNA 1BVP1 4W6WA 1J59A 2LTNA 3T1LA 5JUVA 4EJRA 1W8UA 5DDJ2 5EYXA 2J1EA 2P2KA 3IZOA 2JDZA 4FI9A 3D0JA 1RUE2 3RDIA 3I49A 5FP3A 1H6XA 3NJXA 1YLLA 2BOJA 2QFEA 1H6YA 4H55A 3O1TA 2FZ2A 4YFWA 3ZKUA 4BMBA 5ACA2 5FYHA 4NHXA 4NAMA 2BNMA 1YXWA 3GBGA 3ZVXA 2BBVA 1EAH3 3H3UA 1WLTA 2PAMA 3LEKA 4RGKA 1TZOA 3R0RA 3AP9A 2BERA 3DV8A 3IIAA 2GNTA 5FXWA 3MV11 3VBUB 1O3SA 2QQKA 1W2TA 2IUWA 3DKQA 2E53A 2FBEA 3DKWA 4YSFA 3ILRA 1RUI1 3MPBA 3NAPB 4QXCA 4R8HA 5FK7A 1PO13 1ULFA 3PTYA 5J98B 3VHPA 5CBLA 2CGPA 1MZ6A 3HNBM 2ZGQA 1VBE1 4AAXA 1IS3A 1G9CA 4PI0A 4CCLA 1CAUB 2P17A 1JUHA 1QJU1 2HEWF 2RDQA 3NNGA 1OHFA 4UFJA 1QQP1 2VPVA 2XLAA 2BFUL 3BYWA 2R062 2DBIA 2VBPA 1E5IA 3PUQA 1H8TC 3AK0A 3CQOA 3HNYM 5IFPA 1US3A 4CEWA 3AKRA 2Y6LA 1SG3A 3D8CA 3H1WA 1AF9A 1KFUL 2C5DA 3I2GA 1GNHA 3ENRA 2QQJA 1KD7A 2W1WA 4NOTA 3IAQA 1OA3A 1REFA 1UX6A 4BQ3A 3OOXA 1MVEA 5EHDA 1Q43A 4Q4W1 5KHGA 3UGFA 2WFPA 5K0UB 4DIQA 2VMEA 4P9WA 4E8CA 3L2YA 5BNNB 5A3NA 1BCXA 1JXNA 3RWNA 5IFTA 1OLME 5CKNA 4O9GA 4E4SA 1UY0A 3VBSC 4YYOA 4CCJA 5FR3A 5A6ZA 1RUF2 5JVVA 1C4RA 2UU8A 5E88A 1W2OA 5E16A 1UIKA 2CAUA 1ULCA 3WQ7A 4NE9A 3E97A 4JHZA 2W9XA 3K46A 4UF0A 4CXXA 4BWOA 1GZWB 4R9BA 1VMHA 3GF6A 1RUOA 3ZXKA 5HPOA 2X09A 3C7FA 2XH6A 2ZGUA 3VHRA 1GOFA 4CDQB 5HCAA 4Y5SA 2BUKA 1OOPC 4N53C 4QGLA 2GC0A 2GN3A 1OFNA 3AKTA 3SH5A 3TB0A 2VOWA 2ZEZA 3G6JB 3EBRA 2OYZA 1IQAA 3VBFC 4ATEA 4AQ6A 1CPNA 5BV6A 1JYXA 1CAXB 1H8TA 2Z79A 2B46X 3VDAA 2DBNA 4LE3A 3FHAA 2QZ3A 3KVAA 1QXJA 2RM23 2VVEA 2Y33A 4DB5A 4Q2FA 1FMD2 3GHMA 3ES4A 1MVQA 1I1EA 1R1A2 4GALA 4P00B 2XJSA 2ORXA 4L97A 1LESA 4JX0A 4LUMA 4C91A 4MGTA 3HQUA 4OHWA 3U07A 1N3OA 1NE6A 1OKQA 2YPJA 2ZGOA 4LQRA 3ZX7A 5F3EA 4IE5A 4NHYA 4QXKA 4JHTA 4XQDA 4AVTA 4LULA 3H42B 4XBQA 1H1AA 5C33A 3HNMA 3LSDA 3KF5A 3B93A 4KGQA 4Y1VA 4E27A 5I0DA 1XNCA 1HXS3 4O7XA 3VBRC 5BYNA 4ZONA 1K12A 4HSLA 4A7YA 4LTAA 4YW4A 4E2QA 2QTWB 4EQVA 1NG0A 2RM22 4LO6B 4OVEA 3VHNA 2EVXA 4KNCA 3VD9A 2IVIB 3SKJE 2EA7A 1OD5A 2G19A 1OOPA 1ULOA 3N36A 3OEBA 1NA1A 3VBFA 3ZMOA 1DIWA 2QVSB 3CIHA 2NP0A 4E9KA 5JR2A 1EV11 4L9BA 4MHUA 4XDPA 1DGRA 2I2SA 2XBO3 2DVBA 1IG3A 3NW4A 5HCFA 2QQVA 1X33A 4XQWA 4YVWB 5DUUA 1Z7S1 3MLLA 3AP7A 1X8MA 4LBKA 2HWD1 3RZMA 2CTVA 2OX0A 2WZR1 3KHCA 2PAEA 3AKQA 4P9YA 1HV1A 4LHSA 4OMCA 4GH4C 5IVBA 3D3AA 2RS53 5DAVA 3O14A 3ZFGC 4YW3A 2ARCA 4FPYA 2R042 1WCUA 3C8XA 3H0OA 1XRUA 2DYCA 1D2SA 1NY71 2FCUA 4N43B 4CU8A 1IS5A 2WBKA 3RJ2X 4YW6A 1G7YA 1ZRCA 1Y9MA 5E1RA 4BZ4A 5FPZA 2CNAA 3GZEA 2WN2A 5JPNB 1GOHA 3J26N 5K4LA 3BTAA 5FY5A 1DZTA 1TG7A 2E9QA 2HWB2 5B4XA 5LA9A 5JPMB 3LPGA 3VBRA 3SISA 1RUG2 3ACFA 1WLCA 2WS92 4GMP3 2PN5A 2AUYA 5LK5A 2E33A 1QQP3 4Q8LA 4QKFA 1DGRN 1CWPA 1JN2P 3TNQA 3AP4A 4AFDA 3O1OA 1JZ3A 1V70A 1RUH1 1MS8A 4XBLA 4LKEA 1ZVFA 5CG9A 5CA6A 1VBB2 3N9OA 1OA4A 4N9IA 3FUQA 5FYCA 3PUHA 2X8KA 2ZGPA 3HEIA 3A7QA 3Q8EA 4I3PA 4XXPA 5EIYB 4JGYB 4D69A 3RFRA 4CU6A 1WGPA 4M3CA 4DPNA 1ZM1A 1Y9QA 1NA1B 2GU9A 4GH4A 4AVAA 1PZ8A 3UYJA 2Y0OA 4A4AA 1YI7A 4WVWA 1DZRA 5J1XA 5FMOL 1CZSA 1DP0A 2O14A 2GP3A 3R6SA 1HQNA 1NLSA 1RUJ3 2HWF1 4YPJA 3ST7A 2RG4A 5DZFA 2JKBA 1FATA 4DXRA 4HKWA 5A3WA 4IEYA 4PBOA 1REEA 1GYKA 1UCXA 1BHGA 1MZ5A 1O6UA 2ADDA 2XKPA 1GZCA 5I0UA 4A7KA 1W99A 2XONA 3POSA 4XUOA 2QQOA 2XWJB 2WZEA 2QQNA 5EJ1B 4TLFA 5HCBA 1SPPB 4F8AA 2IXJA 1PHMA 2BGCA 5IK5A 2PHLA 3K48A 4M00A 3L9JT 2WL1A 2ZX1A 4Y33A 1FX5A 4TYSA 4M3CF 2IFRA 1MS1A 4A2UA 4CDWC 2F4LA 2PHWA 4DMIA 1YNAA 2J42A 2WFF3 5BNPC 2BWAA 1MQTB 2HBTA 4DZGA 4NAOA 2J1SA 3SCHA 3JD71 2NQYA 1L7RA 3DXTA 3DYOA 3N9QA 4MX3A 5JXGA 3R05A 2HWC2 1RJ8A 1DFQA 2Y6HA 2E26A 4IXLA 3RMYA 3B9CA 2FDJA 4XF0A 1S2EA 2YB7A 2VZUA 3GDBA 3O5SA 3DECA 1W90A 1IHMA 1QJY2 2D97A 4QX5A 2A3XA 3DF0A 1OUSA 1NT0A 1H4GA 2VL4A 2WNVC 4XIOA 5FYSA 3UKNA 2PHTA 1VMJA 5C8WA 4WM8C 4RQPB 1ZA4A 3SNMA 4AL9A 2PHRA 1FOD1 2B5HA 3GXUA 4NPMA 1MS3A 4D6QA 5JI7A 3VKFC 3FUOA 4EZHA 5IK8A 1W8HA 4CU9A 5JOYA 5FO8B 1QHDA 2HWE1 2VTXJ 1V9U2 4D7SA 3WNPA 1PGW1 3ZXFA 4HZFA 5JLVA 2IXLA 2J1AA 4FQZA 3WT3A 1JOBA 3MF6A 2RMU2 3ZYGA 1VBC3 1VBD1 1X8EA 2EF6A 5JOXA 1V6JA 1WLWA 1DU3D 1Z7S3 2Y60A 5CKQA 3WCSA 4DNYA 5TSWA 2WO3A 3OBAA 4QD2A 2Y64A 5CAZA 4Y26A 4CDWA 3QCWA 4GWMA 3BKZA 3I2FA 2XVLA 1YQ5A 4ITCA 5BNPA 2HEYF 3FJSA 4V1PA 2WWSA 4COYA 4XBNA 2OPWA 2G9FA 3UV9A 2YXSA 3HQXA 4FTBA 2N7GA 3VD5A 1Q5OA 4Y20B 4CU7A 3KCYA 1BJQA 2FQPA 3B94A 4GULA 4P08A 5FQ0A 1DQ0A 1OSGA 4URTA 3VBOC 2YV8A 3T4VA 4PQQA 2XR4A 4NPRA 4OI1A 4DOUA 4MXWA 5FRAA 4EZ4A 1JZ4A 4HLTA 3S0MA 5FZMA 4XFHA 5B2GB 4K1ZA 2WNVA 3THCA 3EMRA 3ETPA 3ILFA 5HV0A 4WM8A 2Z2SB 1DGLA 4I3GA 1SLBA 1S0JA 2GN7A 4AVSA 3PJYA 1GP4A 2WDBA 4Q4Y1 2G9GA 2VNOA 1XNDA 1D4M3 4ZU7A 2VOTA 1VRBA 3USUA 2ZX3A 1K5JA 1CPMA 2WSVA 3ZXDA 2CL2A 2EICA 3AFKA 4M0NA 1RUH3 3Q8FA 2VCBA 1FV2A 2O8QA 4O9EA 4S2FA 4EN6B 1JW6A 2BYVE 3RWKX 4KU7A 1QKQA 1AYM2 2DU0A 4J25A 3LOBA 1AR83 1FNYA 4YZ4A 2VVFA 3NKTA 1OKOA 2ZZQA 1J1TA 1X36A 3BCWA 2VZPA 1O8PA 4X8PA 5IVEA 1S0FA 1S1AA 3MIGA 4KGGA 1HQLA 5GJ6A 4A3XA 2I07B 1CIYA 2XVGA 3SITA 4PLMA 2DFCA 2IFWA 1RINA 1QXRA 1WW4A 3Q8BA 5GM0A 3T0AA 4XFCA 2HWF3 2ZACA 3OPZA 2XJRA 4N7UA 2PLV1 1U5YA 4AFAA 2UWCA 3AVRA 3VBOA 2E31A 1Q8OA 2P37A 3C7EA 4Q4V2 3P5BA 4GJYA 1ENSA 1PGL2 3VZKA 4BE3A 1R083 2X29A 4Y3OA 5KXCA 4K1YA 3ZFFC 1F4AA 2DTWA 3HT1A 5FZ9A 5LBCA 3I2OA 2HBUA 1LB2A 5DAXA 2NMNA 5A32B 2X5IC 1RUC2 4Q27A 2WIIB 1BXHA 1PO21 4LLOA 1A8MA 3BB6A 1AR72 1MS9A 4QDRA 3M3QA 3QH6A 4R52A 2UYAA 1NZIA 2FDHA 2XB6C 2WT2A 5HBAA 1LHVA 2YGMA 4AWDA 4MLOA 4QQ2A 4FOVA 4IL7A 4S2DA 1RHI1 1SFPA 4FPOB 4MYEA 4Q0UA 4W4ZA 3USUB 4LKFA 3OUIA 1GKBA 1R082 2GC1A 1YFYA 4D7TA 2NN8A 3ZKYA 5FXZA 2JDYA 4E4ZA 2VZ3A 5JR7B 1PVC1 3R4SA 1LHUA 4XUQA 1BBT1 1MZEA 5I0SA 1VMFA 3VZMA 1RMU2 1KQRA 1C8M3 5C9AC 3W5NA 5AC93 3FWEA 5AFEA 2ILMA 4R9AA 2VBDA 5F6LB 3PMEA 1FOD3 5JOWA 3WUDA 2MEV2 4CCMA 4QWNA 4BK4A 3ZFFA 1BMV2 3QACA 1ASJ2 4X6QB 2R1BA 2ZGRA 3I2HA 4XF9A 4K8RB 1CX4A 3ZDSA 4QX8A 2B39A 4DS0A 5FZBA 3OEAA 1Y9GA 1NLRA 2X5IA 2ZHLA 4I0AA 1QDOA 5FZ0A 3OUJA 1VBD3 3O12A 4CP0A 4B1MA 4ET7A 2JIJA 3PU3A 2OT7A 1UZ0A 3LOIA 1W8FA 3THDA 4B29A 1HRV2 4PIYA 5C8CC 5I0RA 2JD9A 1WCKA 1CONA 1C5IA 2UURA 4EYUA 4HG6B 4P14A 1OBNA 5AC92 1X82A 4LMFA 1PMHX 2A70A 5DABA 4LPLA 4RR3C 5E89A 3ZYJB 1ZZCA 5LBBA 3O0XA 1GQPA 1GMMA 1JHNA 1EUTA 2GNBA 4Q0VA 3D4KA 3AP5A 1H2NA 3LKJA 1RC6A 3ZN6A 4Y4RA 3OJBA 1DBNA 1JYVA 3GZTB 1VBA1 2YG0A 3GZAA 5D2AA 4CPBD 4HN0A 3CZJA 3ZN5A 5CG8A 2CSGA 3KS7A 3WG4A 4AXOA 1WMEA 2VW1A 4JRLA 3LE0A 3ZDVA 5DZEA 4M4RA 1L7QA 4TLGA 3AMHA 4FXGB 1AX2A 3W20A 2GMPA 4L92A 2CWSA 1IZ3A 5IK7A 1TMF3 3U0ZA 4UWDA 1V6NA 1UW8A 3BTYA 3KZ4C 1J84A 1M4WA 4QQPA 4XEZA 4BYYA 5JOZA 4QKNA 5FY4A 3WD5A 1K42A 4P5YA 2JE9A 4LBMA 5IVFA 3V64A 4GMP0 2LALA 3U11A 5GZCA 3IIIA 4YZ2A 4I30A 4CEYC 1LGBA 2ZX0A 3RQ0A 2BFUS 1HRI3 3E6CC 5C8CA 4KWJA 5EXOA 3VBHB 1O59A 2E32A 2OVUA 1Z78A 4CDXB 5CFCB 3ZXGA 1G8WA 4CUCA 1RITA 1RUE1 4FOYA 2FDKA 1W2UA 4RR3A 2WKKA 4JGZC 4IGPA 4L11A 4XJUA 3CJIC 4QX1A 1GNZA 1ZX5A 3I3BA 1AYN1 2Y0IA 3LDKA 4QM9A 2RJLA 5ACA1 2YC4A 4XXAA 1TMF2 4AOCA 2PLV3 4OQ9A 3HMYA 1XB9A 3PDQA 4I09A 4HETA 1ND3C 2IXHA 4FPKA 4ZY9A 5A3UA 4QPGB 3MUY1 3U4XA 4CA9A 1LKNA 2RR11 1GR3A 2A6VA 5GLVA 1FV3A 4E2SA 2JG9B 3QLQA 5FXVA 4IW3A 3MI8A 1UPIA 2D7FA 2HYXA 3VL9A 4A3ZA 4AQSA 3POWA 1HB1A 4B3NA 2JDHA 2W87A 3LF7A 1NCRC 3ILNA 4OI4A 1AR93 1F4HA 2P4EA 1F35A 2ZA9A 2WQ4A 4G9SB 4OFGA 1A8DA 2R061 3CJXA 2BW8A 3KCXA 2DCTA 4E4DX 3ZFEC 2ERFA 2ETEA 3RZZA 1J58A 1V6IA 3C3VA 3CF6E 3J8F2 2D43A 2QQUA 2R1DA 3JBG1 4CEYA 4HVQA 1LU1A 5CISA 2D6KA 5GALA 4HVOA 1ZBE2 5KHIA 5E6HA 3ECQA 4PDWC 3T2QA 4LLFA 4ZU5A 1QMJA 3SH4A 2VAUA 3ZIXA 2D6NA 2VE1A 3T30A 3N9MA 4Q0SA 3THTA 1MS4A 1UZYA 2Q5TA 2QKDA 5CIRA 2JDNA 4GKXA 4FOQA 2H6BA 4EN8B 3CJIA 3LGRA 1BBT3 2P34A 4NWVA 1RUD1 1XC6A 2V4AA 2XHKA 4JAAA 5CVRA 5GZDA 5FAXA 5F37A 3S5QA 5FOJB 5FMCA 1LOFC 1DF0A 1YC61 2C6SA 3VD3A 4L99A 1ND3A 1RUF1 1ULEA 2GMEA 1W8ZA 2R0FA 3AZVA 3AYDA 2J7MA 3PUSA 1LEMA 2QQMA 1MEC1 3IAPA 3EJKA 3U75A 2OZJA 5GLTA 1OMIA 4CCOA 1O8SA 5LA2A 4UT5A 1NCRA 1ULDA 3AKSA 4QB2A 1FPN2 1W8WA 1LNSA 5FZKA 2YMZA 1KJLA 3DCQA 3N9LA 4YW5A 3ZXLA 1W04A 4FSJA 1OLQA 1CX1A 3TN92 4BIFA 1XYNA 3WW2A 5KXDA 3ZM8A 2QDRA 5CB7A 1CAWB 3ACGA 5FPVA 1AZDA 1JH5A 2ADEA 2W94A 3F2ZA 2YPDA 3IDAA 4OMDA 1YHFA 2R072 2VULA 1FMD1 3I3MA 4HOOA 4AGGA 3J7HA 1G6NA 4PDWA 1R093 1XYPA 3TEZA 4QB6A 1W6QA 2YFZA 3N7LA 1VBA3 1POQA 3TNPB 3UKTA 4GB32 1QGLA 4K9SA 1RXFA 3LIGA 4QQLA 3CMGA 4XF4A 1LOFA 4Z8BA 5C3OA 4F83A 5IVCA 4LA2A 3KQRA 4IUGA 1VAMA 4QPIB 5DQ0A 1WLDA 4I0WB 3WNXA 1GNYA 5A3OA 5D8AC 1SLCA 1W28A 3JQWA 3CJIB 1HQWA 1FAYA 2ZEWA 2VXJA 1PIV3 3WUCA 4DINB 4LHKA 5EQUA 1AXZA 3OY8B 1LENA 3I4IA 5T52A 3WDVA 4IEWA 1OF3A 3S57A 3BODA 1ND3B 3T0BA 3NV3A 2WA4A 4XUNA 1UPSA 4OUEA 3ZYIB 5F5QA 3DPRB 5F8PA 3BIEA 4AHYA 3BOWA 4XFFA 2P3JA 1O5LA 4WM7C 3LFMA 1GWLA 4FCAA 3ES1A 1XE0A 3GCWA 3VDDC 1N1YA 1NCRB 4JQTA 2W1QA 4ZS3A 4P5HA 3V56A 2LUWA 5KHKA 1JHJA 1HN1A 1OVPA 4FQ4A 4JVAA 2EIBA 2ZHNA 4M4PA 4YM1A 3H8RA 3LFIA 4AVVA 5J37A 3MIHA 2MPFA 5T3NA 3SH3A 3POBA 2GAUA 4A6OA 1PIV2 4QGNA 4UFMA 3ORJA 4B4PA 1O7FA 1LHNA 1K5MC 2Q1ZB 2RR13 5EV7A 4FFGA 2ET1A 3MO4A 4PLOA 5FMOS 2WNOA 1PNFA 5FYBA 3RYPA 4CUBA 4EE2A 2TNFA 2RS31 3N9PA 1VRH1 2Y26A 1NE4A 4AHXA 3MPPG 4CP1A 3P6BA 2HWB1 2WN3A 2VUDA 4PF5A 2JJ6A 1NCQC 1W6QB 2K9ZA 2W1UA 5J7MA 2VO5A 1RUG1 1XNTA 4OYUA 4YGBA 3RYRA 5D8AA 2C1FA 3KT7A 1MR5A 4IEUA 2JECA 4V2VA 2WS91 4DXTA 2Z4FA 3LQCA 1C8NA 1LOCA 4BH9A 2JG8B 1UYPA 1K45A 1W0PA 5C7GA 2QJVA 4UW5A 5F2SA 4CDUC 1M06G 3CL1A 3H50A 4Q4X3 1I3HA 2VNVA 2A3YA 2R30A 2W52A 5A1FA 4OHYA 3JBG3 4K20A 5EWSA 4WM7A 3I2JA 3T09A 2RS13 2D6OX 1EAH2 3MIEA 1B35C 1XNBA 3OGRA 3PLQA 3VDDA 1RVF3 3WP4A 1TME3 2QQIA 1FYUA 2ET7A 3BN6A 1AVBA 3WNOA 4H14A 1CQ9A 2P6HA 3OGSA 1OURA 1IKPA 1RUD3 1IPKA 2ARBA 3KGLA 3W9AA 2NYYA 4KQ7A 4CCCA 2HKXA 3G7DA 4RHV3 4WBBA 2UY9A 2V4VA 1PX3A 3SCGA 1QWRA 1PO12 2VQ0A 1TNFA 5A3TA 1UYZA 4NROA 4AEKA 1G86A 5FPXA 5A80A 3B7MA 2VTFA 1K5MA 2C0ZA 5CFDC 1LOEA 3DYPA 3FFZA 1OQDA 3MHZA 1UL9A 3S7EA 1MEC3 4NMIA 5KR7A 4CRQA 3LEGA 1H4HA 3KT1A 4L0PA 4LBOA 1NCQA 5F5IA 1OI6A 2PAKA 3RS6A 3WDYA 2VOXA 2XDVA 3WHTA 1E57A 3BGAA 3WCRA 1QOSA 3K75B 3RPQA 3VN4A 1U12A 1PMJX 4FTSA 2PQQA 3CU7A 4Q0QA 3MFCA 4INDA 2OPKA 2PHXA 4BK5A 5JWPA 3VDBA 1UMHA 5K7PA 5GZGA 3GJAA 5D8AB 4R9CA 4ZS2A 1YQCA 3AXEA 3B02A 1WD3A 4KU8A 2JDKA 4CCEA 3MIBA 2OKXA 1B35A 1QOOA 3JCIA 3UL2A 3OSDA 2VCAA 3K4ZA 1O91A 4RL7A 5H9RA 4KWKA 4DXSA 1W39A 1YQ6A 4CEWB 1QJY1 1VAKA 1JODA 2B9VA 1O3TA 1NYWA 1H2MA 4XIKA 2A73B 2BEOA 4BXFA 5ANNA 3I59A 3WSOA 1D2QA 1OC1A 3ZSLA 3UETA 5K9YA 3POJA 4JCKA 3VBSA 2LM3A 2QE3A 2LROA 2XHNA 3CLPA 1S4CA 5FPBA 2GALA 4RFRB 1JZ2A 5LB6A 1UMZA 2JB4A 2K46A 1V9U1 5T50A 5IWFA 2ZOEB 4AVBA 2RDSA 2YUEA 4D6RA 3UK9A 3A21A 3I3QA 5FMBA 1UNBA 1F5FA 1K5MB 4HONA 3RZHA 2QUOA 3H3LA 4BMEA 3QH7A 3AZWA 4N53A 1UD1A 1HV0A 4QX7A 5FYYA 4Q8KA 1UZZA 3T2PA 3MGUA 3I8TA 3WX5A 1J1LA 4NVPA 4UF0B 2X05A 3U10A 5A3LA 1I9RA 4BCUA 3M3EA 3O1MA 1E5RA 4BQ4A 3BPZA 1LGCA 3KCCA 4XMAA 1LHWA 3PHMA 3ZOIA 1ENXA 1N3QA 3O0WA 1HXS2 1V00A 1HX6A 2P3YA 2ZJCA 3PVNA 4YZ5A 4Z92B 1BVVA 1C5HA 4LHLA 1H8TB 3OBZA 3T3YA 5FWJA 1VRH3 4WZCA 5FZ6A 1FNZA 1H9WA 1GU3A 2XGXA 4LBQA 4DUVA 1LECA 1RUI3 1XOYA 1AX0A 2BBAA 2DCKA 3KQ4B 4ZXKA 3ZXJA 2XBO2 4CCKA 4KWUA 1N1VA 1VBE3 4E2GA 4GWNA 4PIZA 4YLZA 5GKAC 4KL1A 1WZXA 1QJU3 4LHNA 4W8JA 4FAGA 4K7JA 1S0BA 3W21A 3ZYPA 1VPHA 3GCXA 2GH8A 3VBSB 1Q8VA 2WNUC 2RS52 4NIAA 3I7DA 2XQRA 2F17A 3UNPA 4HVRA 2ZMLA 1AYM1 4M01A 3FBMA 4C1WA 3BU7A 3OG2A 2BGPA 1WWYA 5I0TA 1DYKA 4H7LA 4QGMA 2V5YA 4FFHA 1D7PM 1G9FA 1DQ2A 2J1VA 3IWZA 4JTOA 4Q4W3 5H9SA 1OOPB 4N53B 1JZ8A 5F3IA 5IJRA 3VBFB 1AUYA 4XCAA 1ZZ9A 2XJTA 5LK7B 3KV4A 2YC0A 2KXLA 2CWMA 4GQ7A 3ZFGA 1D0GA 4DEQA 1VBE2 2ORZA 3H8XA 4XABA 4P9IA 1H2KA 4IE0A 1SCSA 4LR4A 1SFNA 4ARXA 5F32A 4FPJA 4BQYA 4DXZA 4WVVA 1UYYA 4COZA 2Q8DA 1QQP2 1BEV1 1FT9A 2VW0A 4Q4V1 4XFAA 1WW7A 2LW8A 1PGL1 4AVCA 2VMCA 3MYXA 2C24A 1VB4A 2WLQA 2YZ4A 4K21A 4ZXEA 4YW1A 1W0NA 2WQ8A 3LIHA 5FIXA 4AHWA 4MUVA 1JTZX 1RUC1 2ZBJA 4GKYA 2JE8A 4HK9A 2QZ2A 3AYEA 2J22A 4FPGA 4XDOA 3HR9A 2V5DA 1A34A 3JB8A 1WD4A 3MW2A 2LRPA 5FLHA 4MSVA 1ND2C 5FMDA 5DG1A 4C90A 5LW9A 2W91A 2H0BA 1WCSA 2WNUA 4HK8A 1JZ6A 4XAEA 2ZGNA 4LXLA 4B4RA 1UOGA 3VBRB 2YU1A 1RUJ2 1BK1A 3RZLA 3WG2A 4LKDA 2JDPA 4F3JA 1POV1 5GLUA 4EN7B 2QQWA 1DCSA 5DUWA 5FP7A 3WQ1A 4FVVA 4L2NA 4Q5OA 1V6OA 2J1RA 3LD8A 1LAJA 1IS6A 2JKXA 1W06A 1N1SA 1YIPA 1WMXA 2RV9A 1I6XA 1HN0A 2VECA 2O8OA 1QJX1 3J7MA 2F4PA 2NZ9A 3AJZA 1RMU1 4YM2A 2FDIA 3LEMA 1GZ9A 1OF4A 3I54A 4YG3A 3BOPA 4LNVA 5F5CA 1UY1A 2VZVA 3VZJA 3ZIWA 1YI9A 5IAXA 3M1HA 3EO6A 3ON7A 4PLNA 2WQZC 4P9LA 3PIGA 1JU4A 1US2A 3RI8A 2FMYA 2OA2A 1Q3EA 4M3CB 4MV2A 2PELA 1AL21 1COV1 3RRDA 1BMV1 3SQOA 2BTVC 1ASJ1 2CHHA 4GH4B 3ZFGB 3HIFA 1IQDC 2WFF2 5FZOA 1NKGA 2SBAA 5LRRA 5JXJA 2JDAA 5KXBA 3KGZA 4XVHA 2MNGA 2RJKA 2VMIA 4LO7A 2NMOA 2ZGSA 4P9JA 1EV13 2YROA 4NRMA 1XXNA 1HRV1 1ND2A 1CAVA 1PK6C 2YBSA 4QMAA 3E6DA 2PQSA 5FCCA 5FPUA 2VOVA 4K40A 2HWD3 4TN7A 5DN2A 4XILA 4Q1RA 1DLLA 4GA9A 3RJRA 1CJDA 2WZR3 1AR61 2GNMA 4BHPA 5FV3A 5GLWA 3JZVA 3O1VA 1OXCA 2GMMA 2VCMA 4AGVA 4FPHA 3D5OA 5EZWA 1ENQA 2B9UA 3IMNA 3BPSA 4XTPA 3T1MA 1ZRIA 3GALA 3WW4A 4BISA 1UQXA 3DUIA 2DV9A 1UXXX 1EYBA 3K3OA 1W9WA 2YC2A 4FOWA 4XFGA 5FZ7A 2D5HA 4AEDC 5JI9A 1EV12 2ZGKA 3KV9A 4XF3A 3B9IA 3K2OA 5JMCA 5FBJA 1VBC2 1F9KA 3AB0A 2VJXA 4AI0A 1Z7S2 1OPOA 3WQBA 5BXXA 1GZTA 3LZZA 5F6KA 4P9XA 2ES3A 1QH6A 1GP5A 1S55A 4XZUG 2FDGA 2OZ6A 2VOKA 5FKCA 4QAWA 3CHXA 1NOVA 3AX4A 2HEVF 4RS5C 3ASIA 5FY9A 1IOAA 2GH2A 4KWLA 3USSA 1NY72 1CR7A 1PK6A 4Y4YA 4CYDA 4Y1XA 2VC9A 3WQ0A 3WW3A 1W3VA 3WF2A 2AENA 4XQ4A 4CXYA 1OLMA 5FZOB 5A7NA 4FPLA 3DL3A 4MG2A 3AYCA 4UOJA 2AH2A 1SHWB 4KH9A 4QKBA 4UFHA 4TXWA 2WR9A 5T55A 4Y22A 1CAVB 2DDUA 3W5MA 3C2UA 1TE1B 1SFYA 5BNOC 2XKOA 4LKSA 5FLIA 1BEV3 1YIFA 3MICA 1D4M2 4CDWB 3B5LB 2Y34A 1AJOA 3H3ZA 5KC6A 5BNPB 1KDMA 2EAAA 4YWAA 3AJYA 5C5TA 4MVTA 5A6QA 4AEDA 1YQ2A 2VM9A 4JDMA 1RUH2 4W6YA 3GGLA 1W2NA 4DFSA 1QH7A 3OGJA 4LOTA 3T4HB 5FZLA 4TWTA 1TNRA 1N1TA 1H0BA 5A1AA 4BQ5A 3ELNA 2BOIA 1AR82 1WMDA 2BRTA 3ABZA 2B8MA 3LB9A 5F3GA 5FQ0B 3MDPA 5BY5A 3KMHA 5ERLA 4D3WA 1W6PA 2AEYA 3JUUA 4ASLA 4AGRA 4MXWB 4BQXA 4JKLA 3AMPA 1UYXA 4LORA 4OHZA 1YO8A 1LJ7A 2WNVB 3J8F1 4O61A 4YVSC 4WM8B 4M0HA 2BQPA 2HWF2 2ZPXA 4LEJA 3T08A 5IHRA 3ZSJA 1IPSA 1GP6A 1O4TA 1POV3 3ETQA 4NRQA 4UBHA 5A33A 3JD73 3WG3A 4N9HA 1Q8PA 3J7NA 3ZSEA 4AE2A 3I3EA 2XXZA 1V6KA 4YZ3A 3UGHA 1QJX3 1RTVA 1G9AA 4W65A 2D44A 1W6NA 2OS2A 2VGDA 2DTYA 2FCTA 4F7ZA 5BNOA 4NN0A 2YY1A 3WNNA 1PMIA 2G9ZA 4Y24A 5A1LA 2VR4A 1KGYA 3E5UA 4AI8A 2SLIA 2YFUA 1AL23 1COV3 1ZBA1 5H9PA 3ZPOA 3S30A 1O5UA 4ASMB 4Q26A 3SEPA 4QU2A 3EXUA 4Y22B 4Y5Z0 4YGEA 1BYHA 2HWE3 1CZTA 1JI6A 2ZAHA 1D0HA 1FPN1 3DEMA 1Y7BA 2NM1A 2Q1FA 3LCPA 1RGSA 1DQ1A 3H9AA 3TN91 3VBOB 4EN0A 5A7SA 1L7LA 4LA3A 1Q56A 2ZX2A 3FLTA 4EROA 1V6MA 4UAPA 4FPFA 2R071 4BLIA 4YVSA 2W0XA 1AR63 1C8M2 3GM8A 2W92A 4BA6A 3A23A 3MW3A 2P3IA 1FOD2 4D0QA 2ZZJA 4CUAA 3FE5A 4NHLA 4WVMA 3ZSKA 4AI2A 4IE7A 4A41A 4CVUA 2HWE2 1JBCA 5LCWL 2EAKA 4IV1C 3O1RA 4XURA 1IGOA 1CD3G 5FZCA 3ZN4A 1MS0A 2WNEA 4HPKA 1N47A 3OPTA 4PJYA 5C3SA 5C9AA 4XTMA 1UX7A 3B69A 1VBD2 4OUSA 5FUPA 5F7UA 3AP6A 4LITA 4NUBA 3WEZA 1UU6A 2XJPA 3EB7A 2W2IA 4DO0A 3WDTA 4YARA 4A7ZA 1W6NB 2B45X 2V72A 3C7HA 4Q4Y3 4PQ9A 1X7NA 1S0GA 4XJ8A 5LATA 2B42B 3L2HA 2XMLA 4ATFA 1VIWB 5CU1A 5EJ3A 4JKMA 3R4UA 5C4WC 1JMUB 3WXPA 2ARAA 3N4MA 4H3WA 5DUVA 2IXKA 3WZ1A 3PUAA 4GWJA 1T2XA 4BIOA 3OGGA 3GHNA 4IV3C 2PHUA 3NJYA 4ES8A 3ZFFB 3UESA 1C57A 4RD7A 5L9RA 5DDJ1 1YWKA 4IEVA 2TEPA 4EN9B 3IDBB 5JIUA 2W68A 2FZ1A 4HT1T 1UN1A 4NHKA 2X5IB 1QOTA 1BKZA 4CTEA 3M2MA 4NIDA 1KS5A 1RUNA 5A7PA 4SBVA 4META 1SBDA 2WYSA 2XVKA 3O1SA 5HCHA 1W6MA 4YVSB 3UKVA 3HOBA 4IV1A 4WZFA 1W6OA 1CVNA 1SLAA 3VLBB 1DQ6A 3NV4A 1SEFA 3TYJA 4Z2WA 5A6XA 3AL5A 2VQTA 4FP2A 4Z2AA 5IT6A 1YFUA 3M8LA 5B4NA 1RB8G 5LWBA 3RSJA 1QNWA 1OQ1A 4WVMB 3ZN6B 3NJVA 5EPAA 2PHFA 4YZ1A 1HRI2 1JS9A 3FC0A 4JZRA 4CXWA 5J48A 3MZHA 4I2OA 5L73A 3PURA 1SQ4A 1PO23 3S6PA 3PIJA 3TBDA 2VG9A 1KJRA 1RXGA 3WDXA 5C9AB 1HJFA 4PF1A 3AZYA 3MBWA 3WG1A 2UYBA 1SMVA 4XJZA 5FYUA 4GAZA 4YG6A 4DUXA 2Y38A 2FDFA 2GP5A 1JZ5A 4R4XA 1G9DA 2PLV2 1EAH1 3O0VA 4IV3A 2CDOA 2MHFA 5FJKA 2KM2A 2BWCA 5T5LA 2P6CA 2XUMA 2YHJA 3ZPYA 3W58A 4MGSA 1RHI3 2GC3A 1C1LA 3POEA 1XJAA 1WUVA 4IE4A 3SXWA 5EYYA 2TBVA 3VZLA 4U2AA 3M3OA 1PO11 1PVC3 1ZNPA 4JGZA 5JSPA 4HXCA 5L9BA 3IT8A 2WABA 3LDRA 4Q29A 4Y1ZA 4CCNA 2V09A 2ATFA 4LBJA 1AR92 3P3PA 1HB4A 2XOMA 4P9GA 5DUXA 3U1XA 5C8CB 1SBFA 3O7OA 3VHOA 4X6RB 3SC7X 3OUHA 3ZR5A 5AFBA 3OGVA 2Q8CA 1UOBA 1ZBA3 3B00A 3X29B 5CZKA 3VZOA 3M3CA 2DVDA 2RE9A 3N3HA 4BM8A 5J3UA 4RR3B 4QQOA 2XJVA 4RN5A 3VBUC 1XYOA 4AF9A 4CUGA 2JE7A 4AFCA 4MGZE 4RFT0 4IV1B 4JC1A 2AZ5A 1W6OB 2R7EB 3NAPC 1RHI2 4N8MA 5CEHA 4EWEA 3V0BA 1PX4A 1TEIA 1APNA 1I5ZA 4NR1A 3V0AA 5JZGC 4IE6A 2Q8EA 1ZRDA 1BBT2 1ZREA 3H7YA 3VD4A 4MGKE 2E7TA 4UFLA 3ZFEA 1XNKA 2YGLA 4HFSA 5IATA 4NRPA 2QQPA 2QCSB 2R49A 2FD8A 1W9TA 1H30A 4M3CE 4AZZA 3K3NA 4IERA 1JYWA 4UW4A 3C7GA 4UBGA 1R1A1 1CIWA 2LS6A 4TSVA 5K8SA 1F8VA 4IEZA 3HBKA 4IEPA 3FN9A 3U37A 1HKDA 4MOAA 3NV2A 4HKLA 3E6BA 3NJZA 1CZVA 4Y1UA 4Z1VA 4XETA 2O0OA 3CDZB 3LA2A 4D94A 2JICA 5FPAA 5FOBB 4NO4A 4QPWA 4S2GA 5DAQA 5JAXA 2VUAA 3DN7A 3FMGA 1BK0A 4CEYB 5K0UC 1AXKA 5IUQA 3TEWA 2ZCWA 5BNNC 3LA3A 5L36A 4QDQA 2BVBA 1ZZ7A 2W3JA 1VLNA 1YUDA 4BB3A 2BU9A 4JGZB 5JSOA 3BI3A 3ZYRA 4Z07A 2WA3A 4BU2A 3ZO0B 2RM21 3VBUA 2FMDA 3MLKA 4GZ9A 5LBFA 1NX9A 2XLFA 1NZCA 3NAPA 1R092 5T5PA 5I8YA 3PMSA 4XFIA 4CDQC 1EPWA 3PUIA 5JZGA 5L7OC 1VBA2 1CAUA 4XJ9A 3WP3A 2XL9A 1DYPA 2VW2A 3HN3A 5DDJ3 4EWDA 5JXHA 2EIEA 3RGBA 1RUE3 4QKDA 1VALA 5JIAA 4G4FA 2JEMA 3PL0A 3W59A 3V0BB 5LY1A 4Q1PA 1HXS1 1AYN3 5DAWA 5ACA3 2R041 3V0AB 2RJ2A 1YFWA 4LIVA 1SDWA 2YYOA 3SCFA 5KBFA 2D3SA 2XJUA 1ULPA 2VMHA 5F2WA 3ZFEB 2DURA 4XHBA 4AHZA 5A7QA 5FKBA 1YFXA 1XQNA 2JENA 5K0UA 4QHBA 4ASKA 5BNNA 4ZKTB 4PDWB 3WNLA 1CN1A 2R6QA 2XBO1 4KG0A 4XJWA 3WW1A 5LA0A 4I0BA 1X9PA 3FX3A 5FYTA 5KWRA 3Q8CA 2VUJA 1XBFA 1ZRRA 3OB8A 5JSRA 4O65A 4FTEA 1DZQA 3BALA 4XE9A 2W08A 2OUJA 2R063 2R32A 4AI9A 4PI2A 4XF1A 1GZWA 1JYIA 2RS51 4JRAA 1AYN2 3MW4A 5L19A 4N7IA 2ZGTA 2AACA 4C1XA 4CDQA 4CPBA 5L7OA 4XZPA 2WT0A 1VBB1 2KA3A 1C28A 2WO7A 4WVZA 5G05L 5HI0A 2RR12 3IKWA 4RGGA 1CAXA 2DUQA 4AAPA 1VE0A 4YVWC 1OFSA 4AFMA 1POV0 2VQUA 2Y6KA 4NPLA 5LASA 3FLRA 5JZGB 1SDDB 3KHBA 3M3IA 5EP9A 4ZU4A 2ZX4A 1U5XA 4GMP1 4MADA 2ENRA 1RUF3 2CGNA 4CP9A 5FO7B 5IVJA 1UAIA 2D3PA 4N43C 3U14A 3ZYBA 1PVXA 2ZGLA 2WRAA 4QHOA 2AGSA 1YQ8A 3PVEA 4Q4X2 1KRIA 1UU5A 4JQRA 3LSEA 4UFKA 3JBG2 3NVCA 3BVCA 2CU5A 3RG0A 2VMDA 4NJ4A 3WP5A 2RS12 2WYFA 1JZ7A 1UF2C 1RVF2 4IETA 4QU1A 1TME2 4HMZA 4HBNA 4OULA 4QX0A 5T54A 5AVAA 3MEPA 4DRVA 2R16A 3O1UA 4EV0A 1H2LA 4CDUA 1RUD2 5DAPA 3IDCB 4MZUA 4RHV2 4SLIA 3KSCA 4XUPA 5FZDA 3DGTA 3VZNA 4AG4A 1RUJ1 1Q8SA 1FMD3 1UWWA 1F5JA 3R4DB 4XAAA 5SV5A 1R1A3 4R9DA 3AXDA 3T2TA 3D0SA 5DG2A 3RVHA 3MUZ1 5F3CA 4COUA 2KR2A 4IGQA 1PM7A 1ACCA 1MEC2 2HWC1 3POGA 4V2WA 4YVWA 5ISLA 1IPJA 5FZFA 2ID4A 5SV8A 1KEXA 3KWVA 4JGYC 5L7OB 4QX3A 4AQTA 1W8NA 1NA1C 2W46A 4WM7B 4BQWA 4KBBA 5GLZA 4HSJA 4P02B 3FHIB 2E7AA 1UU4A 4FAHA 3T0DA 3VDDB 4UXAA 3POYA 2HYKA 5CFDA 4N43A 5A6YA 1RJ7A 4G3YC 1W9FA 1YJLA 4IEXA 4OI2A 4J1XA 4OI0A 1R1ZA 4BOWA 4PT6A 4J1WA 3KVBA 5C70A 5F39A 2WFF1 4ZHNA 1QXPA 2E51A 2WT1A 3WOGA 2IWGB 4CP9B 1DG6A 4DY5A 1QU0A 4XPVA 2WZ8A 3WF3A 3OD4A 5DXDA 1MPXA 4YGCA 2JXAA 2RMU1 3AVSA 3E1F1 1JOJA 2EXKA 1UOFA 3A4UA 3LPFA 3FBYA 5M0TA 2K0GA 1PGSA 2Y6FA 1B09A 2VNRA 3SHRA 1NCQB 3MIFA 5FZ4A 5FZGA 1LGNA 5JXIA 1W03A 4XC9A 5C6CA 3AKPA 1LOBA 4B1LA 5FDBA 2R043 2ZKLA 3LEIA 4JTNA 3NO8A 2AEZA 1MQTC 4CDUB 3IB3A 1LEDA 4DUWA 4TTGA 1MZFA 1GFF2 3U4SA 4UYBA 1H9PA 4JGYA 2VY0A 2ZABA 5IAVA 1WW5A 2Y6JA 2ZMKA 3BIWE 2RS33 4FPCA 2VBBA 2XG3A 3OF1A 2K2SA 5A3PA 1B35B 4QPYA 2HWB3 3PU8A 1VBC1 4FT8A 2A75A 1VP6A 2A71A 4ZPIA 1RUG3 3NNLA 4NHMA 2YBKA 4HL0A 1NAEA 3H1YA 1LOGA 2WS93 3JB4C 5APAA 3WDWA 2G1MA 2D5FA 4LO5B 4Y1YA 1HDKA 3RZKA 4RQPC 1FI2A 1T6BX 3VKMA 1LULA 2JD4A 1PZ7A 3ZXAC 2BDRA 4Q0PA 1WCQA 3P1IA 5JDBA 2OQ6A 1D4VB 3NV1A 2UY8A 2VXRA 2XLGA 4OCTA 2D6MA 3I59B 4FO9A 5CFDB 3M70A 4MO3M 5DZGA 4ZZ5A 2VVDA 2FCVA 2D98A 1VBB3 2DWRA 1JOPA 3HN1A 1SPPA 3ZSMA 3BUCA 1NXMA 2WINB 4ZZ8A 5HV4A 2RS32 1VRH2 3WR0A 4OHVA 4COWA 4KG8A 4XJAA 1Q8QA 1U5IA 4RYDA 4XUTA 5KHHA 1SBEA 1RUI2 5FYIA 1HLCA 3GJBA 2JWPA 2Y8KA 1MQTA 2AC1A 4NIGA 3ZYHA 2L9LA 1D4M1 1YRZA 2X10A 2PYTA 4BQ2A 1QJU2 3FZ3A 5JMOA 3MF9A 5FY0A 4A44A 2W1SA 3K4AA 4DQAA 1E5HA 4WV8A 4RA0A 3WHUA 3OPWA 2HJIA 1S0CA 5FZIA 3WP6A 5LZ6A 1AR81 1BZWA 4FFIA 4CP2A 1H1IA 2EXHA 1IS4A 1U5ZA 2KD7A 2WSUA 5LRSA 4RQPA 4K8FA 3NRUA 3ACLA 1KS4A 5FXXA 1AR71 2D3RA 3HWJA 4Q4W2 4OZOA 4I01A 4UFIA 4LBQB 4BQ1A 1GSLA 3GYDA 3VV1A 1J83A 1W9YA 5E8AA 2GSYA 1QJEA 4COVA 2WAAA 3TEYA 4I02A 2WZPP 5C3QA 2D6PA 4CCDA 5C3PA 2WUHA 2WO2A 5IW0A 5G04L 4AI3A 2HWC3 3WF4A 4E8DA 5LEKA 1R081 5EJZB 1UZVA 2VZSA 1XU1A 2W39A 2JX9A 3IN9A 3CO2A 4GD4A 3MV01 4J6GA 2PFWA 4NWWA 1EY2A 3TWIA 2RDNA 3ZXEA 1QJY3 1Y43B 5I93A 2A5ZA 3H1MA 3TOJA 4PBPA 2XL7A 1OH3A 1WA4A 3P3NA 4GIQA 4MGYE 3I3DA 2VZRA 1PNGA 2VUCA 3M4FA 2B4KA 4Y20A 1NQDA 1V6LA 3N9NA 1XPWA 3N7MA 2MEV1 5LEJA 4AFBA 2OUHA 5IVVA 1JUIA 1LODA 4KBZA 2J1UA 1FXZA 3PNAA 1WCDJ 4FPEA 5FPLA 1QNYA 5FK8A 1V9U3 3RYKA 2P1BA 1UZWA 3J9SA 4GXLA 5C3RA 3RZGA 2D40A 3ZMNA 4IEQA 4BPZA 3PJQA 1XSQA 3FHQA 2RMU3 2VZ1A 2EIGA 1S2KA 1C1FA 2P3KA 3VKNA 3I2KA 3WNKA 1ALYA 1UY3A 3IBMA 3LWCA 3WINE 2PA7A 4LBLA 2A7AA 2Q4SA 3D6EA 5BPXA 3J4UH 1H8VA 1C8M1 1SLLA 4LE4A 5AC91 1OQEA 4FBFA 4QQHA 1LOAA 2UWAA 3OTFA 1ODNA 2Z42A 3AC0A 2DUPA 1T6GC 2DF7A 3PVOA 1JYCA 5FP9A 4IQPA 4B4QA 3MIDA 1SLIA 4IESA 2UWBA 3U78A 5FO9B 2C4XA 2WNUB 3H8OA 1WBFA 4Z82A 5IVYA 1DQ4A 3VDCA 3VKOA 3NNJA 2RDRA 2AREA 3MFAA 2ZHMA 3HPNA
chains in the Genus database with same CATH topology
1ZZ6A 2ZKNA 3GBWA 5F9TA 4PCRA 3N7JA 3S7IA 3SMHA 2ZAAA 1LRHA 3GZUC 1DGWX 2OIIA 4DY3A 5I91A 2HWD2 3AMNA 1O3RA 1ZRFA 2WZR2 2Z69A 2ZTNA 1KFXL 3NWKA 3IPVA 1SCRA 1CESA 5A32A 1AYM3 1URXA 5J36A 2XPJA 1UIJA 1SLTA 4OUMA 1Z0HA 1ENRA 3AYAA 3M7AA 2D93A 4LO8A 4ES9A 2O1QA 2DU1A 3HAGA 1ND2B 1TMF1 2V73A 4JDOA 3A0KA 4YG0A 4UW6A 2NLRA 3OD0A 1LTEA 1OA2A 1TQ5A 2F6BA 2Z5WA 4Q4V3 1GV9A 1WBLA 3JQXA 4AQ2A 4OLLA 1S0IA 2G4IA 1ULGA 1AX1A 3WV6A 1HRI1 5BUVA 3PVBB 1XE8A 1RUC3 3VKLA 2YDEA 1AR73 2EXJA 2IZWA 3E5QA 3FFQA 4YW2A 1VJ2A 2CGOA 1O4YA 5CNAA 3ROUA 3QBQA 1NQJA 1ZZ8A 4RS5A 4C0HA 4LT5A 5GZFA 1OPMA 2WC2A 4XOGA 1QY4A 1BEV2 1ZBE1 3EQEA 4AEJA 4JV4A 3VGIA 5FFOC 5KHJA 4X8NA 3VBHC 4CDXC 5CFCC 1YCIA 2VNGA 3IPVB 4OZXA 1RMU3 2PTMA 4EWAA 5I8TA 1HW5A 4ISRA 1AR91 4XFBA 1PK6B 1WMFA 2EALA 2E63A 3WLUA 3V65A 1AJKA 2MEV3 4MXVA 2IC1A 2DCZA 1AHSA 2IXIA 1QDCA 2PHDA 2Q1MA 2ZGMA 1OLRA 3OBRA 4IEOA 4QPGC 1ASJ3 5BNQA 1SACA 5I8SA 3KLSA 1VB2A 4K6BA 2JG9C 4FXKB 2GZWA 2GNDA 1S2BA 4BLJA 5KC5A 3JD72 2Q8OA 4CZSA 1XE7A 1KXGA 3VL8A 1HRV3 4PIXA 1XU2A 1QJX2 4C0BA 4AEMA 3E5XA 4LO4B 4AEDB 4YM0A 2GDFA 3GNEA 1LCLA 3IM0A 4D7YA 1AL0G 3I2DA 4N90A 1W6PB 1AL22 1COV2 4ORFA 3VBHA 4CDXA 4YM3A 2BNNA 5CFCA 4GB31 3ALQA 4RS5B 2C9AA 2BVVA 5AVPA 1DGWA 4H7MA 1PGW2 5ABJC 2ZMNA 5A33B 3EHKA 4FP3A 1VR3A 2DUOA 4XW3A 4S2HA 2CYFA 3A0NA 1F31A 3N35A 4AI1A 1O3QA 5IK4A 4QPGA 1BQPA 2JG9A 5BNOB 1AR62 4ONUA 1KDKA 1MACA 1A3KA 1R091 1GQGA 1L3JA 4YFZA 3N7KA 2XJQA 2A3WA 2NPIA 5A3MA 1DQ5A 1EPZA 4XHXA 2VQAA 4YGDA 1VAVA 4YRDA 4XMIA 2CAVA 3APBA 1REDA 1PIV1 3WY6A 2X53S 1DHKB 2H6CA 4Q4Y2 3QD6A 2DCJA 2A6ZA 2EXIA 2OW4A 1N3PA 1GBGA 3K51A 3LA7A 3OYWA 4QM8A 5ABJA 3URFA 5J09A 2ZS6B 1H1MA 3OCPA 3HT2A 4UW3A 4B8EA 5CADA 2VU9A 1MS5A 1IKQA 1C3HA 4QPIC 4RSUA 1ZYBA 3RNSA 1GANA 3THPA 4HPKB 3ME2A 2BPA2 4HANA 4AK3A 3J8F3 3LAGA 1F2NA 5H9QA 5C4WA 3WDUA 3JU9A 3TRSB 3CEWA 3IDEA 1S0DA 1ZBE3 3DPRC 4LUKA 4XDQA 3KT4A 2WLPA 3D82A 2D6LX 3NSTA 5ABJB 1CAWA 1O4ZA 2DCYA 1RIRA 3VUOA 2A6XA 1NXD1 2AYHA 1QF3A 3AMMA 3Q9OA 4LBNA 3H7JA 4ISQA 1PO22 5D1IA 2Q30A 3INAA 1A6CA 5FREA 4Q4X1 3TAYA 2CV6A 3QOPA 1EP0A 1A78A 3H8UA 4TZDA 1DDLA 2RS11 1FPN3 4B7KA 4QPIA 1RVF1 3KM5A 3AFGA 1TME1 1W6MB 3HBZA 5J96B 3TN93 3OBTA 3OYWB 4B7EA 1G9BA 1UKRA 3UJQA 5FTTC 3B01A 1YYNA 4RHV1 2JG8C 1PVC2 1UKGA 3GBFA 2R073 3OY8A 4AW7A 1ONAA 1GLHA 4YNIA 1KITA 2RHPA 5EFUA 2WJSA 3DPRA 1Y3TA 1GICA 4RGAA 1LHOA 1ZBA2 1LU2A 2H0VA 5T5OA 2XWBB 4GB33 2GC2A 3AZZA 5C4WB 1QJZA 4MH0E 3NKGA 2FHRA 1RL3A 2DVFA 4XYXA 4HKOA 4IV3B 1YJKA 2R0HA 1CJPA 1WW6A 1J3RA 2DVAA 4LBQD 1ZZBA 5HXVA 4QT6A 3HD8B 2E7QA 3B3QE 2ZHKA 1W0OA 3WVJA 2DFBA 4DRRA 1CGPA 3AZXA 1S0EA 3KD4A 4W6XA 1J3PA 3FLPA 1AXYA 2ARXA 1HIXA 1LR5A 5FBZA 2QNKA 3CNAA 2BNOA 3MLJA 2VH9A 4AYUA 1GQHA 2DVGA 2I45A 4R4ZA 5FLJA 5F1RA 2JG8A 2VMGA 4OHXA 5KXEA 3KB5A 3UJOA 1U0AA 2A6YA 5JCTA 2IXCA 3NL1A 4K3UA 2A6WA 5T5JA 1X50A 2AR6A 4MGIE 2B7YA 3AMQA 2E6VA 2TUNA 5GZEA 3RI9A 2I74A 4HN1A 3RMXA 1J3QA 3SLIA 2Q0AA 4U36A 2CY6A 4CEWC 4L8QA 3AM2A 4JDNA 3ATGA 1PZ9A 2QDNA 1BVP1 4W6WA 1J59A 2LTNA 3T1LA 4EJRA 5DDJ2 5EYXA 2P2KA 2JDZA 3D0JA 1RUE2 3RDIA 1YLLA 2QFEA 4H55A 2FZ2A 4YFWA 4BMBA 5ACA2 2BNMA 1YXWA 3GBGA 3ZVXA 2BBVA 1EAH3 3H3UA 1WLTA 2PAMA 3R0RA 3AP9A 3DV8A 3IIAA 2GNTA 3VBUB 1O3SA 2E53A 2FBEA 3DKWA 4YSFA 3ILRA 1RUI1 3MPBA 3NAPB 4R8HA 3VHPA 5CBLA 1PO13 1ULFA 3PTYA 5J98B 2CGPA 1MZ6A 2ZGQA 1VBE1 1IS3A 1G9CA 1CAUB 2P17A 1JUHA 1QJU1 2HEWF 1OHFA 1QQP1 2VPVA 2XLAA 2BFUL 2R062 1H8TC 3AK0A 4CEWA 3AKRA 3D8CA 3H1WA 1AF9A 1KFUL 2C5DA 1GNHA 3ENRA 1KD7A 4NOTA 1OA3A 1REFA 1UX6A 1MVEA 1Q43A 4Q4W1 5KHGA 2WFPA 5K0UB 4P9WA 3L2YA 5BNNB 1BCXA 1JXNA 3RWNA 4O9GA 4E4SA 3VBSC 4YYOA 1RUF2 5JVVA 1C4RA 2UU8A 5E88A 5E16A 1UIKA 2CAUA 1ULCA 3WQ7A 3E97A 4BWOA 1GZWB 4R9BA 3GF6A 1RUOA 3ZXKA 2XH6A 2ZGUA 3VHRA 4CDQB 5HCAA 2BUKA 1OOPC 4N53C 4QGLA 2GC0A 2GN3A 1OFNA 3AKTA 3SH5A 3TB0A 2VOWA 3G6JB 2OYZA 3EBRA 3VBFC 1IQAA 4ATEA 4AQ6A 4F3JA 1CPNA 5BV6A 1CAXB 1H8TA 2Z79A 2B46X 4LE3A 2QZ3A 1QXJA 2RM23 2VVEA 4DB5A 4Q2FA 1FMD2 3GHMA 3ES4A 1MVQA 1I1EA 1R1A2 4GALA 2XJSA 4L97A 1LESA 4LUMA 4C91A 4OHWA 3U07A 1N3OA 1NE6A 1OKQA 2YPJA 2ZGOA 3ZX7A 4QXKA 4XQDA 4AVTA 4LULA 4XBQA 1H1AA 5C33A 3LSDA 3B93A 4KGQA 4Y1VA 4E27A 1XNCA 1HXS3 3VBRC 5BYNA 4A7YA 4HSLA 4LTAA 4YW4A 4E2QA 1NG0A 2RM22 4LO6B 4OVEA 3VHNA 2EVXA 4KNCA 2EA7A 1OD5A 1OOPA 3N36A 3VBFA 1NA1A 3ZMOA 1DIWA 2QVSB 2NP0A 4E9KA 1EV11 4L9BA 1DGRA 2I2SA 2XBO3 2DVBA 3NW4A 5HCFA 1X33A 4XQWA 4YVWB 5DUUA 1Z7S1 3MLLA 3AP7A 1X8MA 4LBKA 2HWD1 2CTVA 2WZR1 2PAEA 3AKQA 4P9YA 1HV1A 1G9AA 4GH4C 2RS53 3O14A 3ZFGC 4YW3A 4FPYA 2R042 3H0OA 1XRUA 2DYCA 1D2SA 1NY71 4N43B 1IS5A 3RJ2X 1G7YA 1ZRCA 5E1RA 4BZ4A 5FPZA 2CNAA 5JPNB 3J26N 3BTAA 1DZTA 2E9QA 2HWB2 5JPMB 3VBRA 3SISA 1RUG2 1WLCA 2WS92 4GMP3 2PN5A 2AUYA 5LK5A 1QQP3 4Q8LA 1DGRN 1JN2P 3TNQA 3AP4A 4AFDA 1V70A 1RUH1 1MS8A 4XBLA 1ZVFA 5CG9A 5CA6A 1VBB2 1OA4A 4N9IA 3FUQA 2X8KA 2ZGPA 4I3PA 4XXPA 4JGYB 4D69A 1WGPA 4M3CA 4DPNA 1ZM1A 1Y9QA 1NA1B 2GU9A 4GH4A 4AVAA 1PZ8A 2Y0OA 1YI7A 4WVWA 1DZRA 5FMOL 3R6SA 1HQNA 1NLSA 1RUJ3 2HWF1 3ST7A 5DZFA 2JKBA 1FATA 4HKWA 4IEYA 4PBOA 1REEA 1GYKA 1UCXA 1MZ5A 2XKPA 5I0UA 1GZCA 4A7KA 3POSA 2XWJB 4TLFA 5HCBA 4F8AA 2IXJA 1PHMA 2BGCA 5IK5A 2PHLA 3K48A 4M00A 3L9JT 2WL1A 2ZX1A 1FX5A 4TYSA 4M3CF 2IFRA 1MS1A 4A2UA 4CDWC 2PHWA 4DMIA 1YNAA 2WFF3 5BNPC 2BWAA 1MQTB 4DZGA 3SCHA 3JD71 2NQYA 4MX3A 3R05A 2HWC2 1RJ8A 1DFQA 4IXLA 3RMYA 3B9CA 4XF0A 3O5SA 1IHMA 1QJY2 2D97A 4QX5A 2A3XA 3DF0A 3UKNA 4DRVA 1H4GA 2WNVC 4XIOA 5C8WA 2PHTA 4WM8C 4RQPB 1ZA4A 3SNMA 2PHRA 1FOD1 2B5HA 1MS3A 5JI7A 3VKFC 3FUOA 5IK8A 5JOYA 5FO8B 1QHDA 2HWE1 1V9U2 4D7SA 1PGW1 3ZXFA 4HZFA 5JLVA 2IXLA 4FQZA 3WT3A 3MF6A 2RMU2 3ZYGA 1VBC3 1VBD1 1X8EA 2EF6A 5JOXA 1V6JA 1WLWA 1DU3D 1Z7S3 3WCSA 4DNYA 5TSWA 4QD2A 5CAZA 4Y26A 4CDWA 3QCWA 4GWMA 2XVLA 4ITCA 5BNPA 2HEYF 3FJSA 4V1PA 2WWSA 4COYA 4XBNA 2G9FA 3UV9A 2YXSA 3HQXA 4FTBA 2N7GA 1Q5OA 4Y20B 3KCYA 1BJQA 2FQPA 3B94A 4GULA 5FQ0A 1DQ0A 1OSGA 4URTA 3VBOC 2YV8A 4NPRA 4OI1A 4DOUA 4MXWA 5FRAA 4HLTA 4XFHA 5B2GB 4K1ZA 2WNVA 3ILFA 4WM8A 2Z2SB 1DGLA 4I3GA 1SLBA 1S0JA 2GN7A 4AVSA 3PJYA 4Q4Y1 2G9GA 2VNOA 1XNDA 1D4M3 4ZU7A 3USUA 2ZX3A 1CPMA 2WSVA 3ZXDA 2CL2A 3AFKA 4M0NA 1RUH3 1FV2A 2O8QA 4O9EA 4S2FA 4EN6B 1JW6A 2BYVE 4KU7A 1QKQA 1AYM2 2DU0A 3LOBA 1AR83 1FNYA 4YZ4A 2VVFA 3NKTA 2ZZQA 3BCWA 1J1TA 1X36A 4X8PA 1S0FA 1S1AA 3MIGA 4KGGA 1HQLA 5GJ6A 4A3XA 2I07B 3SITA 2XVGA 4PLMA 2DFCA 2IFWA 1RINA 1QXRA 1WW4A 5GM0A 4XFCA 2HWF3 2ZACA 3OPZA 2XJRA 4N7UA 2PLV1 1U5YA 4AFAA 2UWCA 3VBOA 1Q8OA 2P37A 4Q4V2 1ENSA 1PGL2 3VZKA 4BE3A 1R083 2X29A 5KXCA 4K1YA 3ZFFC 3HT1A 2DTWA 1LB2A 2NMNA 5A32B 2X5IC 1RUC2 4Q27A 2WIIB 1BXHA 1PO21 4LLOA 1A8MA 3BB6A 1AR72 1MS9A 3M3QA 3QH6A 4R52A 2UYAA 2XB6C 2WT2A 5HBAA 1LHVA 2YGMA 4AWDA 4MLOA 4QQ2A 4FOVA 4IL7A 4S2DA 1RHI1 4FPOB 4MYEA 4Q0UA 3USUB 1GKBA 1R082 2GC1A 1YFYA 4D7TA 2NN8A 4E4ZA 5JR7B 1PVC1 3R4SA 1LHUA 1BBT1 1MZEA 5I0SA 3VZMA 1RMU2 1KQRA 1C8M3 5C9AC 5AC93 3FWEA 5AFEA 2ILMA 4R9AA 5F6LB 3PMEA 1FOD3 5JOWA 3WUDA 2MEV2 3ZFFA 1BMV2 3QACA 1ASJ2 4X6QB 2R1BA 2ZGRA 4XF9A 1CX4A 3ZDSA 2B39A 4DS0A 2X5IA 1NLRA 2ZHLA 4I0AA 1QDOA 1VBD3 3O12A 4CP0A 3LOIA 4B29A 1HRV2 4PIYA 5C8CC 5I0RA 1WCKA 1CONA 1C5IA 2UURA 4P14A 5AC92 1X82A 2A70A 4RR3C 5E89A 3ZYJB 1ZZCA 3O0XA 1JHNA 2GNBA 4Q0VA 3D4KA 3AP5A 1H2NA 3LKJA 1RC6A 3ZN6A 3OJBA 1DBNA 3GZTB 1VBA1 3GZAA 4HN0A 3ZN5A 5CG8A 3KS7A 3WG4A 4AXOA 1WMEA 2VW1A 4JRLA 5DZEA 3AMHA 4FXGB 1AX2A 2GMPA 4L92A 2CWSA 1IZ3A 5IK7A 1TMF3 3U0ZA 1V6NA 1UW8A 3KZ4C 1M4WA 4QQPA 4XEZA 4BYYA 5JOZA 3WD5A 2JE9A 4LBMA 3V64A 4GMP0 2LALA 3U11A 5GZCA 4YZ2A 4I30A 4CEYC 1LGBA 2ZX0A 3RQ0A 2BFUS 1HRI3 3E6CC 5C8CA 4KWJA 5EXOA 3VBHB 2OVUA 4CDXB 1Z78A 5CFCB 3ZXGA 1G8WA 1RITA 1RUE1 4FOYA 1W2UA 4RR3A 2WKKA 4JGZC 4XJUA 4L11A 3CJIC 1GNZA 1ZX5A 1AYN1 2Y0IA 4QM9A 5ACA1 2RJLA 4XXAA 1TMF2