4YM3A

Crystal structure of the human galectin-4 c-terminal carbohydrate recognition domain in complex with lactose
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
139
structure length
139
Chain Sequence
b'PPTFNPPVPYFGRLQGGLTARRTIIIKGYVPPTGKSFAINFKVGSSGDIALHINPRMGNGTVVRNSLLNGSWGSEEKKITHNPFGPGQFFDLSIRCGLDRFKVYANGQHLFDFAHRLSAFQRVDTLEIQGDVTLSYVQI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Galectin-4
publication title Structural characterization of human galectin-4 C-terminal domain: elucidating the molecular basis for recognition of glycosphingolipids, sulfated saccharides and blood group antigens.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
total genus 36
structure length 139
sequence length 139
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4ym3A00
1QOTA 1UMZA 4XXPA 1A8DA 1LJ7A 1N1SA 3RQ0A 1AJOA 3POYA 2ZGUA 5DUXA 1ZA4A 5T50A 4XBNA 3POSA 1N3PA 2FHRA 3VKFC 1YYNA 1JYIA 3HR9A 1ULGA 2WSUA 4YW3A 2PHXA 1KDMA 2AH2A 4PBPA 2DYCA 4BLIA 1N1YA 3WNXA 3B00A 4Y1YA 1LHNA 4YW2A 3AP6A 5IUQA 2NYYA 4GXLA 3N7MA 3WUCA 1AX1A 1LHVA 2CTVA 4YGCA 3SNMA 2C9AA 2DU1A 2OW4A 4LBOA 1NXD1 1Q8PA 1QNYA 2JDZA 3AZWA 4NO4A 3SITA 2ZGQA 4YG0A 4ZXKA 4Z8BA 1KITA 3O0WA 1W6MA 1ENQA 3O0XA 2GN7A 2PHRA 3M3QA 2DURA 4GALA 5GLWA 2NM1A 3ZSMA 5AVAA 1DBNA 1UPSA 3B01A 4XIOA 5JVVA 2NN8A 3I4IA 3O5SA 3AYAA 4K1ZA 1PZ7A 2JECA 2R0FA 1WW4A 2A3YA 4U36A 1Q8SA 5DUWA 4AGGA 2OUJA 1LENA 1HQLA 4KBBA 3M3EA 4YGDA 5H9QA 3APBA 3WDXA 2W68A 4XJ8A 3D4KA 2ZHKA 3OBTA 3OBRA 4UW4A 4Y26A 5HCFA 4GKXA 2FMDA 1W6QB 4XTMA 2ZGOA 1JW6A 4LBQB 1V6NA 1SCSA 2A3WA 4YM1A 3OYWA 2DTWA 2GDFA 1KQRA 5GZEA 4CTEA 2YROA 5CB7A 1SBDA 5DUUA 1Q8VA 3PVEA 5GLVA 1SCRA 2UWAA 1LTEA 4Q2FA 1IS4A 1VALA 1W6NB 3ATGA 4D69A 1GSLA 3RSJA 3AZYA 3AXDA 2DVBA 5EXOA 5GLUA 2E6VA 2PHWA 1CR7A 2ZA9A 1KJLA 3N36A 1DQ2A 1MZ6A 1W6NA 5JLVA 1S0GA 2B7YA 5H9RA 2NZ9A 5IK5A 5JOYA 3PVNA 5L73A 3WV6A 3ZVXA 4ISQA 1S0EA 2SBAA 2ERFA 1X50A 4FPYA 5E88A 2PHFA 4ASMB 4DRRA 1CIWA 1A3KA 4XIKA 4XJAA 3JU9A 1KDKA 1GKBA 3MW2A 4K21A 1FAYA 2AGSA 1SLAA 2ZHLA 1DQ5A 3DGTA 2D3PA 4M00A 3ENRA 3V65A 2DTYA 3WHUA 2ZGKA 1Z78A 2VUAA 4ISRA 3N7LA 3UL2A 1NLSA 5DZFA 1LOAA 2E7TA 4R9DA 1YXWA 4BLJA 4DS0A 1GV9A 3M2MA 1SLCA 3RG0A 2DU0A 5FREA 4DFSA 3AX4A 5H9PA 3FBYA 2ZMLA 4YM0A 1DQ6A 4TYSA 1C4RA 1LGBA 1DQ4A 4XYXA 4XDQA 4R9CA 5KXCA 1LOEA 1W0PA 2UURA 1G9AA 1QNWA 2JE9A 2W08A 2ZHNA 5T5PA 2ZZJA 3SH4A 3A0KA 3ZSKA 1OFSA 1AJKA 4L8QA 2HYKA 1HDKA 3U4XA 1W6PA 3USUB 4GWMA 1F9KA 5EYYA 3WG4A 1YI7A 3SLIA 5F5QA 4LBQD 2ZABA 3ILNA 3DUIA 4YM3A 1QMJA 3ZYPA 3GALA 5JDBA 5JOZA 1MR5A 5JOWA 3WDTA 2E53A 2GNMA 1I1EA 5GZGA 2PHTA 3QCWA 1V00A 1Y7BA 3O12A 2R0HA 4FPLA 1WLWA 1LECA 3ZSLA 1FV2A 2WQZC 1DQ1A 3OPZA 4ZKTB 2WSVA 1CVNA 3V0BA 4ATFA 3AFKA 1S0JA 1FNZA 4M3CE 2D6OX 3OGGA 3AYDA 4YW5A 2ZGLA 4YW4A 3WUDA 2WJSA 3W59A 3POWA 3Q9OA 3RMYA 1GICA 2RHPA 2A75A 5IK4A 2AUYA 4YGBA 1MS8A 2A7AA 3TAYA 3PJQA 1G8WA 4FQ4A 3IPVA 1S0DA 4XOGA 3WG2A 1LOFC 3ZXLA 2NMNA 2C5DA 1GZCA 4BMEA 4ITCA 3UJQA 5GM0A 3RRDA 1J1TA 5DUVA 1GZ9A 4P9YA 1SBFA 1MVEA 1XQNA 5GJ6A 1G86A 1UZYA 1H9PA 2VW2A 1W6MB 1JYCA 2ARXA 4LBKA 4YG3A 4AGVA 5DZGA 1DYKA 2VW0A 1V6MA 1QOSA 5T5LA 1ZM1A 2DVAA 1FV3A 3ZXKA 3SH5A 3IM0A 1IS3A 2VXRA 5E89A 3OY8B 2XB6C 1CN1A 2EIGA 3LCPA 5CBLA 2A6ZA 2XG3A 1Z0HA 4ATEA 1MS9A 1VAMA 2LTNA 3M3OA 1H9WA 2G4IA 4U2AA 3M3CA 4XXAA 1G9BA 1FATA 3C2UA 3M1HA 4LBJA 1DFQA 3OY8A 1CPMA 4M3CF 2GMEA 2AR6A 3MW3A 1DHKB 3OYWB 2CWMA 1WW7A 3NV4A 5FRAA 1GANA 3HN1A 4YZ4A 4F83A 4UW3A 3WZ1A 3ZXJA 5GLTA 2A70A 1ULDA 2ARBA 2ZHMA 3WDWA 4FOVA 4GA9A 4PQ9A 2D7FA 1ULEA 2V73A 2EXKA 2P2KA 4JC1A 2ZACA 1S0BA 1IKPA 3FLTA 2WKKA 1U0AA 3FLRA 1MZ5A 1S1AA 1YRZA 2W39A 4XJWA 5EWSA 5T5OA 2ZGNA 4XZPA 1QOOA 2EF6A 4UW6A 2YXSA 5SV8A 1APNA 1Q8OA 3AJZA 5HCBA 4AVVA 1JUIA 2I2SA 3VKMA 4CRQA 3AJYA 1D2SA 2D3SA 3N35A 1RINA 4HANA 1QKQA 2BQPA 2DVGA 2R1BA 3AP9A 1AXKA 1YO8A 3AXEA 4XJUA 3V64A 4WZFA 1G9DA 2DUOA 1PZ9A 4P9WA 4Y24A 2P34A 2ZGTA 4BOWA 3AP5A 1IOAA 1HQWA 4R9BA 1F31A 5IK7A 3FFZA 2DUQA 2WT1A 3FUQA 1EPWA 4I30A 5DG2A 3WG1A 1AXYA 2P3KA 1LHOA 5DXDA 4FPKA 1SLBA 3NWKA 3WCSA 1R1ZA 4BPZA 2DVFA 1JBCA 3TB0A 1LU1A 2D6KA 2EXIA 2OUHA 5H9SA 2ZMKA 4LBNA 2YY1A 4CZSA 1N47A 4YGEA 2WLQA 4Y1XA 3N7JA 1W6PB 1ENRA 4P9XA 2DUPA 1V6KA 1ONAA 3B3QE 4H55A 4YFZA 1FYUA 2DV9A 4XMIA 5JOXA 4HL0A 3BIWE 4LBLA 5IT6A 3A4UA 5CAZA 1KRIA 1LOCA 2A6XA 4FOQA 5CNAA 2D44A 1SLIA 1VIWB 2Z42A 1UX6A 3R4SA 4AYUA 1AXZA 2A6YA 2WNEA 1HLCA 1MACA 2ZGRA 1V6IA 5KXDA 1LCLA 3NV1A 2UU8A 4AVTA 2GNTA 4YZ5A 2JKBA 1Q8QA 3AK0A 1WD3A 2ES3A 1CPNA 3I8TA 3ZSJA 5DG1A 3V0BB 2NMOA 5EYXA 1JHNA 3R05A 4UW5A 2ZAAA 1G7YA 2E51A 1O4YA 1BQPA 1I3HA 4PF5A 5HCAA 1QF3A 3IMNA 4M01A 5T54A 1DZQA 3D5OA 2D3RA 2AYHA 1BYHA 2KM2A 3LSDA 3LSEA 4FOYA 5GALA 4GKYA 1W0OA 1ENSA 4TZDA 4P14A 3W58A 4DQAA 3H0OA 3IPVB 3VKNA 2R16A 3BOPA 1N1VA 4FQZA 2PHUA 1LEMA 1FX5A 1LHUA 1RIRA 2OVUA 1WBFA 4SLIA 3ZXEA 1WLDA 2R49A 1IKQA 1MVQA 3AZXA 4Q26A 1LU2A 1FNYA 1QDCA 2A6VA 3INAA 2PELA 2EXHA 2CWSA 4PCRA 4OZXA 4BQ1A 4YFWA 3VUOA 2GALA 2A71A 1LOFA 5GZCA 2P3IA 1LULA 1C1LA 1DQ0A 1W6OB 4Y20A 3N7KA 2ZMNA 5BYNA 3L2YA 2D6PA 3AYEA 4XHXA 1F5FA 2D6LX 2AREA 2H0BA 1DIWA 4YZ2A 1W6OA 2AENA 2JD4A 1QU0A 1IS5A 3KM5A 3O0VA 4XJZA 4YG6A 4YLZA 1JOJA 1OQ1A 3V0AB 3AYCA 3QLQA 3T1LA 1G9CA 1GZWB 4M3CB 1QDOA 4JCKA 1SFYA 2CNAA 3FUOA 1TEIA 5F9TA 3SH3A 4FVVA 1A78A 1LODA 2ZGMA 3WHTA 1SACA 3AZZA 4FPOB 4DPNA 1N3QA 5KXEA 3V0AA 1GZWA 2GNDA 4M3CA 2EAKA 2R1DA 1Q56A 4WVVA 1QGLA 5GLZA 1URXA 1MS4A 2GN3A 2UWBA 3VKOA 1OKQA 3A0NA 4Q8LA 3UK9A 1HKDA 2ZBJA 1DYPA 4FPJA 2ZGPA 5DZEA 1KJRA 5E8AA 4IQPA 4BM8A 1SBEA 3FLPA 2CL2A 3ILRA 1C57A 2P3JA 3WLUA 1LOGA 2LALA 4WVWA 5KXBA 4FPCA 1JXNA 1WBLA 1PZ8A 4Y1ZA 1AZDA 5GZFA 1UZZA 3KQRA 3WVJA 2VY0A 1S0CA 3BTAA 1BZWA 2DWRA 1VAVA 4Y1VA 2A5ZA 4FPHA 3VV1A 4AGRA 3JUUA 4Q27A 1CONA 1MS5A 2JJ6A 3T1MA 3RS6A 4RL7A 1BXHA 3WDUA 3ZXFA 3WG3A 4K1YA 1LHWA 4BMBA 1MS0A 3N3HA 3MPPG 1H30A 2E7QA 2P37A 4AVSA 1WCSA 4XHBA 4XMAA 1LOBA 3PVOA 1W6QA 1RITA 4LBQA 3IKWA 1V6LA 4XBLA 1D0HA 1UKGA 4FP3A 1ULFA 2V5YA 3ZPYA 1WW5A 4W65A 4FOWA 2VW1A 1GNHA 2GMPA 4FP2A 1LGCA 2DVDA 3B9CA 2ENRA 4XE9A 3IN9A 3ZYRA 3PMEA 1G9FA 3MW4A 2TEPA 2CY6A 4YZ1A 1BJQA 2WT0A 3WDVA 4DRVA 1S0FA 1AX0A 2YZ4A 1DLLA 1JN2P 4Q1RA 5JMCA 4AWDA 4Q8KA 3AP4A 5T55A 4YZ3A 1GNZA 3T2TA 2SLIA 3VKLA 1IS6A 3GNEA 3MEPA 4YM2A 3WOGA 2A6WA 2W52A 2NP0A 3ILFA 4FPGA 1O4ZA 1VLNA 4MYEA 1UAIA 2UWCA 3AP7A 4XBQA 2D6NA 2D6MA 1SLLA 2GMMA 1GYKA 2Q5TA 4FPEA 3CNAA 2ZKNA 1SLTA 3NV3A 1WUVA 2VH9A 3AZVA 1AVBA 1C1FA 2ZGSA 1UN1A 4RA0A 4XILA 1CQ9A 4R9AA 4C1WA 5CA6A 4Y22B 2WT2A 3B69A 1N3OA 2EALA 3R4UA 4JRAA 1WW6A 5GZDA 2YMZA 3ASIA 4Y1UA 1LEDA 4XJ9A 1N1TA 4C1XA 4K20A 1DGLA 1GLHA 1UL9A 2CYFA 3RMXA 4Y22A 3WCRA 3D6EA 1WD4A 5T52A 5LK5A 1B09A 3OJBA 1YIFA 1LGNA 4WV8A 1WLCA 2A3XA 1CESA 3SISA 1AX2A 1V6JA 1V6OA 3USUA 2EXJA 4LBMA 1LESA 4GWNA 4PBOA 5T5JA 2D43A 3HMYA 1S0IA 3WDYA 4YW1A 4FPFA 4Q1PA 2VU9A 1ULCA 4Y20B 3BODA 2JE7A 1MS3A 1MS1A 2YV8A 2GNBA 1GBGA 1AF9A 1CJPA 4XTPA 1BKZA 3NV2A 3UJOA 4NOTA 5IK8A
chains in the Genus database with same CATH superfamily
1UMZA 2BBAA 3RQ0A 1HXS1 4BA6A 2Z2SB 4LUMA 2KR2A 1YYNA 2IC1A 1VRH3 4Q0SA 4QX2A 1JYIA 4YW3A 3DEMA 3H1YA 2AH2A 4PBPA 5DPNA 3NNGA 2B9UA 2ET1A 1LHNA 1UD1A 3B00A 4LLOA 2RDNA 5IUQA 2ORZA 2HLEA 3H42B 2PQQA 4AR2A 5A3NA 5FR3A 2WNVC 2IUWA 2WC2A 2EIBA 4WM7C 5JIAA 1P8JA 2OW4A 4V1PA 2QQIA 1QNYA 4XURA 4C8DA 4NO4A 1BMV1 3SITA 3PNAA 4B4PA 1KEXA 1WMFA 4YG0A 4ZXKA 5IYYA 4TTGA 2IXKA 3O0WA 3WNOA 3NAPC 3SCHA 1GQHA 3MPBA 3QBQA 3LEMA 4QDRA 2H0VA 1RUJ1 1FMD1 3U4SA 1DCSA 1VBE3 4UAPA 4W6YA 2C1FA 3CZJA 4XIOA 3VBSB 2NN8A 2XQXA 3I4IA 2QUOA 3AYAA 2VCBA 2YGMA 5KHKA 2A3YA 5FQ0B 1Q8SA 2RMU2 3F2ZA 1HQLA 4YGDA 5L7OC 3JCIA 2B42B 2W68A 4XJ8A 3OBTA 3OBRA 4OHWA 4GZ9A 2FMDA 2ZGOA 1JW6A 3ACFA 5FQ0A 4M4PA 2DTWA 2BWCA 4MGKE 2QFEA 1DYOA 1UKRA 3PIJA 2C0ZA 3KHCA 1HX6A 5FY4A 4Q5OA 4CUBA 4RQPB 2WFF3 3BGAA 1IS4A 1TE1B 1GQPA 4GWIA 4D69A 1GSLA 4JKKA 4EWEA 2XJVA 4BQXA 2PHWA 4Y5SA 1CR7A 3WW2A 1W8OA 5FMOS 1DQ2A 2QDRA 4QQPA 2XQRA 1V9U2 1RHI3 1TVGA 2B7YA 1JOBA 4O7XA 5H9RA 3WEZA 2BNNA 4DY3A 1HV0A 4J25A 2K46A 4W8JA 5LWBA 5JR7B 3NJXA 4O9EA 2ERFA 3VBRB 4ZZ5A 2BJSA 4CDUB 1RVF1 2B4KA 1HV1A 4ZS2A 4FI9A 1DQ5A 2YG0A 3SMHA 3VBRA 2DTYA 4EWAA 1E5RA 3OBAA 4CCMA 1LOAA 4LLFA 1YXWA 1UW8A 5EPAA 4QPIC 3OBZA 3M2MA 5FXWA 4DS0A 5FWEA 1Z7S3 5JSPA 1JS9A 3FBMA 4NHMA 2LM3A 5FREA 1GU3A 4DFSA 5BNNC 2DBIA 3RGBA 3AX4A 3EYPA 3ZYFA 4EYUA 3FBYA 2V4AA 4AEJA 4B29A 5JZGC 1LGBA 4QQHA 1UZ0A 1W0PA 3MIFA 5TSWA 1EY2A 1QNWA 2QQMA 3HT2A 3VD5A 4AHZA 3ZSKA 1OVPA 1X82A 3MIBA 5C4WC 1AJKA 1FPN1 1OXCA 2HWC3 2ZJCA 3DYMA 4N53A 1W6PA 1KFXL 1JHJA 1W03A 4GWMA 1JZ5A 4AZZA 1U5IA 4AAXA 3SLIA 2X5IB 2Y0OA 3POBA 2ZABA 2VE1A 1UYPA 3ILNA 4LBQD 5F5QA 1NX9A 1QMJA 3MIDA 2VCAA 5JOZA 5EHDA 4CCLA 5JOWA 4ES8A 1I1EA 5D8AB 3O1TA 3GHMA 4BQYA 1XB9A 2HWE1 1V00A 5F6LB 3T0AA 3KD4A 5DAQA 5CKMA 1UCXA 2EIDA 4I0WB 3JD72 5CEHA 1M4WA 1OA3A 3GZUC 3I49A 1LECA 3P5BA 4GIQA 2QKDA 4AVAA 4IV3B 3GZTB 3TEYA 1I5PA 4ZKTB 2VZRA 4NR1A 4B1LA 1NLRA 1F5JA 2R061 1AR83 1S0JA 4M3CE 4NWVA 2D6OX 2OA2A 1O5UA 3T3YA 2QDNA 4AFBA 2VZPA 4P02B 2RS11 2ZGLA 2JX9A 2WJSA 4IV3A 1AYM2 3RI8A 3POWA 3Q9OA 1PMIA 4XUOA 5KHGA 5KHIA 2CHHA 1GICA 1YLLA 4GWJA 5IK4A 3WF2A 4UXAA 2HWB1 3TEWA 1MS8A 2A7AA 3KLSA 1G8WA 3IPVA 1PVC2 1S0DA 4BYYA 4DMIA 3IDCB 3ZXLA 2NMNA 3I2IA 4F8AA 4H7MA 4P00B 2RDSA 1JZ3A 4P9YA 1SBFA 4JVAA 4XVHA 1W6MB 5CKQA 1O5LA 3ZN4A 1DYKA 1W8TA 1W2OA 3KMHA 1ZM1A 5I0SA 1H1MA 2VO5A 4WM7A 2VVFA 4YSFA 1XE0A 5BXXA 1GMMA 2RMU3 2WS91 5E89A 2XB6C 3VDBA 4HVOA 4IGPA 2A6ZA 5BNPB 3KQ4B 5C8WA 1VAMA 2XBO1 1NE6A 2G4IA 3M3OA 3MYXA 3NAPA 3PUQA 1PK6C 1G9BA 3C2UA 5DMYA 4OVEA 1DFQA 1RUI1 5ABJC 5LK7B 1X9PA 5A32A 3CKHA 3H3ZA 4X6QB 3KV4A 3MW3A 1QJU1 3OYWB 3ZLIA 1KD7A 3NV4A 3UGFA 3GM8A 4ET7A 3E6CC 2XJUA 3ST7A 4LA3A 3T30A 3DPRA 2QNKA 4XF1A 1POQA 1L7RA 3JZVA 3A22A 3VDDC 4HG6B 2ARBA 1RXFA 3POEA 3PURA 5L7OA 3AVRA 4PQ9A 3SEEA 2O1QA 5CADA 1ULEA 2P2KA 1W2NA 3N4MA 2ZS6B 3I2JA 2R7EB 3U14A 4BQ3A 1IG3A 1EAH2 1ZBA3 2WUHA 5DN2A 5LY1A 1H0BA 3ES1A 3IMMA 4CP1A 3VBOC 4PDWA 2WZPP 3TOJA 4MADA 2QTWB 4A6SA 1JMUB 3ECQA 5F8PA 3BU0A 3MLJA 4KGQA 2ZGNA 4XZPA 5K9YA 2EF6A 4B3NA 2XMLA 4XF9A 2QQOA 4MSVA 5F5AA 1W2UA 1Q8OA 5LBCA 4N9HA 5IW0A 3ZX7A 1YEWA 4CU9A 2OXBA 2VTXJ 4QM9A 1PNFA 1RINA 5EJ3A 2D93A 3FZ3A 4XACA 2AACA 5CG9A 4OZOA 3ORJA 3GXUA 4I0BA 2QE3A 1W8WA 3TN91 5A33B 2DUOA 1UYXA 4ZU4A 5B4NA 4JDOA 3BUCA 1XE7A 2D5FA 4BCUA 4CXWA 5IK7A 3FUQA 4I09A 4JRLA 1AXYA 2Y64A 4S2DA 1UU4A 3GCWA 4FPKA 5C5UA 1R1ZA 2ILMA 4BPZA 2DVFA 2DDUA 4GB31 4O61A 5H9SA 2HBTA 4Q29A 3IZOA 4YGEA 2WLQA 3EHKA 5DAWA 3N7JA 1ENRA 4LHLA 4QXKA 5BNNA 2DUPA 3ALQA 3ZFGB 3I2DA 1OOPC 4IUGA 1RUOA 3I3BA 1UOJA 3OOXA 5JZGA 2ET7A 1AR73 5AC91 2A6XA 2DCKA 4JKMA 3RYKA 4HBNA 2WYFA 4P9GA 3OUJA 2Z42A 2RS51 2R073 1A8MA 1UXZA 2ZGRA 1HLCA 2X8KA 1A34A 2WZR2 4RHV1 1LCLA 4JHZA 4AVTA 1AR91 1WD3A 2ES3A 3I8TA 2HJIA 1BK1A 2DFBA 3E97A 3ZSJA 2ZX0A 4HKWA 2NMOA 2OT7A 1JHNA 1NZIA 2HWD1 3Q8AA 1AYM3 4HXCA 3J7HA 1BBT3 2IFWA 4MVTA 4UW5A 5C9AB 2E51A 1ZZCA 3P3NA 3IMNA 2JG9C 3NQHA 1DZQA 2XH6A 1CX1A 2HKXA 4LEJA 2KM2A 1PVC3 4FOYA 5GALA 2TBVA 1ZRCA 2VECA 5FYBA 3W58A 4DQAA 3QH7A 3H0OA 4JTNA 2BBVA 1OD5A 3LOBA 3VHPA 4XDOA 1FX5A 2OVUA 5FZ4A 1WBFA 2F4LA 1VB2A 4MGZE 4SLIA 3RZZA 3KV5A 1D7PM 1J3QA 1RUC2 4H2AA 4N8MA 4YVSC 1IKQA 4BQ2A 3IWZA 4Q26A 5ANQA 2EAAA 3A21A 5FYMA 1GWMA 1NUKA 1ZA7A 1ZRIA 2A6VA 4MX3A 1K12A 1UY2A 4PCRA 4OHZA 1XU2A 3AFGA 5FDBA 4P08A 3E6BA 1H1AA 3JB4C 2A71A 4UI9L 5GZCA 4QT6A 4QX5A 4URTA 4OI0A 1LULA 1VBD2 1C1LA 2VOTA 4H3WA 3JBG1 4Y20A 3QOPA 1OI6A 3N7KA 4FFFA 3L2YA 2IVIB 1NY72 3M8LA 2OZ6A 4XHXA 1VBC2 1XYNA 1RUH2 2AREA 1TG7A 2BGPA 3K48A 4TSVA 3KM5A 1DF0A 4YG6A 4LULA 3LDKA 3U0ZA 1QQP2 5IAXA 4E2SA 2R6QA 3V0AB 2XOMA 3T1LA 3UKTA 2FDHA 4M3CB 4AI1A 1QDOA 2IXCA 5A3UA 2CNAA 4FXKB 2G9ZA 4D7YA 2EVXA 1EAH3 4RS5C 5I0DA 1A78A 1LODA 1UYYA 3T0DA 4FPOB 3CDZB 3J8F2 2RS33 3ZFEC 5DDJ1 4DPNA 5KXEA 3V0AA 4M3CA 3D3AA 5ABJA 3BN6A 2EAKA 2R1DA 1ZBE2 1S4CA 1QGLA 1MZEA 5FOJB 1F4AA 1MS4A 2UWBA 4YVWC 1GUIA 3A0NA 3VKOA 2IWGB 3BOWA 3OGJA 1MQTC 4Q8LA 4BQWA 1STMA 5HPOA 5A7WA 2F17A 5E8AA 5J7MA 3NL1A 1YQ6A 3FLPA 3VDDA 1C57A 5JSOA 2KA3A 1LOGA 2LALA 3CMGA 5KXBA 4FPCA 3WF1A 1JXNA 4JDNA 4YPJA 1JZ8A 2VUCA 2RJLA 3CJIB 3CQOA 1UZZA 3KQRA 2RE9A 1NCRC 2JDMA 1HB4A 2PLV1 3K77A 3PMSA 4Y1VA 3SCGA 3VV1A 4NIGA 4MHUA 2JJ6A 4IE5A 3AMQA 4YWAA 4KL1A 4RL7A 3RS6A 1WA6X 5LRSA 3ZXFA 3SHRA 1MS0A 1CZVA 1ULOA 1ASJ1 1TMF1 3GHNA 1H30A 1RUG3 2E7QA 2P37A 3HBZA 5FV3A 5FO9B 3HNBM 4NHYA 1KS4A 4A7YA 5ERLA 4LBQA 3IKWA 3KV9A 4XBLA 1KS5A 4LOSA 3M70A 4WVMA 5J09A 4FP3A 1RMU2 1HN1A 3HT1A 4S2GA 3K2OA 3VBFB 1OA4A 3E5UA 2VMIA 1YC61 4Z07A 2VW1A 1GNHA 3ZYRA 5A3LA 2W91A 2MNGA 4HOOA 3IN9A 5IATA 1W28A 1CAXB 2CY6A 2W1QA 4YZ1A 5FYTA 3WDVA 4Q1RA 4YRDA 4LA2A 1S2BA 4CP9B 2ZX3A 4EN8B 3AP4A 2ZCWA 3IDAA 5F39A 2SLIA 3BKZA 3GNEA 1O91A 2WWJA 5LA1A 2VZ1A 3ZXDA 2XJSA 1YWKA 2WZR3 2W52A 5A3OA 4IETA 1HJFA 3UYJA 3WNPA 3ZKUA 2B45X 3JB8A 4DXRA 2WO1A 5A6QA 1VRH1 1WCDJ 1X8EA 3ILFA 4Q4X2 1UAIA 2JDUA 4FAGA 3AP7A 4B8EA 5C3RA 1PNGA 2XWJB 4XBQA 3ZYIB 3O1PA 3CEWA 2VJXA 1VPHA 2GH2A 2Q5TA 2EIEA 1TNRA 1OT5A 2HYXA 4COYA 1K3IA 2I45A 1R093 5A7QA 5FZ7A 1SHWB 1SLTA 3WW3A 2P6HA 1YJKA 2DCJA 3NV3A 1WUVA 4QKNA 3MFAA 3MHZA 1R1A2 4XC9A 3VN4A 3ZDSA 4RA0A 2X05A 5CA6A 5J36A 1AL22 1HQNA 4LR4A 3T08A 4BXFA 5JCTA 3WP5A 5FZHA 1EV12 2OZJA 2VMHA 3TEXA 5AFBA 3ASIA 1TME2 1OF3A 2AEYA 1RUC3 2VVEA 1HRI2 1RUD2 2CYFA 1DGLA 1GLHA 2ZAHA 4K20A 1T6BX 1WCKA 4MGSA 1PM7A 3RMXA 1WD4A 5EJZB 3WCRA 5F32A 4A45A 4IW3A 1BK0A 2JG9A 4EROA 5FJKA 3UT0A 4FT8A 1AR62 2EXJA 5FIXA 4L2NA 2B39A 2WA3A 1CAUA 3N9PA 1LESA 3MUY1 4Q4Y1 5T5JA 4AEKA 3POIA 1D4M2 3HMYA 4YW1A 3CLPA 1WA4A 1WZXA 5FY0A 5FYSA 1VBC3 1I9RA 2Y6KA 4P9JA 2IXHA 4L97A 4COVA 2AZ5A 3PUSA 2PAKA 1SFPA 4I3PA 4N43B 5A7PA 4XTPA 3LE0A 3UJOA 5IVFA 1OFNA 4NOTA 1OA2A 3GBGA 3KT1A 4B1MA 4TWTA 4XXPA 4UFHA 1LJ7A 4KMQA 1N1SA 3FHIB 2G9GA 2TNFA 2WO2A 2ZGUA 4IEXA 4N43A 1XU1A 4XBNA 2VL4A 1XXNA 3VKFC 4YW6A 2C6SA 3RI9A 2YBKA 2R30A 3HR9A 4LJHA 3DL3A 2PHXA 1YQ5A 5I8SA 2DYCA 1OH3A 1DZTA 2IZWA 3PU3A 4BB3A 1IHMA 5K0UA 4GH4B 4LKDA 2FDFA 1LHVA 3WY6A 2VGDA 3LDRA 4K6BA 2BU9A 2XJRA 2DU1A 3AMNA 4LBOA 1NXD1 2JDZA 3AZWA 1ULPA 2G19A 5C3QA 5LCWL 2IXIA 2XVKA 1PO23 4RS5A 1KITA 3MIHA 1Z7S1 3O0XA 1UQXA 1WLTA 1Y9MA 3OD0A 3VZKA 3ZFEA 4L99A 3S57A 2GN7A 1QEXA 3ZSMA 1XE8A 4D0QA 4Z82A 4D3WA 1UPSA 2OKXA 4QU2A 5HCHA 1UY0A 2E33A 4GMP3 2J1EA 1MQTA 2IVJA 5FZOA 3WQBA 1PZ7A 2JECA 3VBUB 2OIIA 2WNOA 3IIAA 1ACCA 2OUJA 1HIXA 1LENA 5FLJA 2HH9A 3M3EA 4INDA 4CP0A 4Y26A 4DIQA 5HCFA 4GKXA 1VBE2 1W6QB 1GOFA 1H2NA 4SBVA 1NCRA 1SCSA 1RUF1 1NCQB 3C8XA 3I2KA 4DEVA 4HVRA 4E4DX 4XABA 4URAA 1SFNA 4PLMA 2YROA 3MF6A 5J98B 1C8M1 2Q1FA 5GLVA 3OG2A 3QH6A 1DZRA 1NCQA 2D40A 3ACLA 1T2XA 5HXVA 3ATGA 1T6GC 4IE4A 3RSJA 3AZYA 3DKWA 3TNPB 5GLUA 2FMYA 5EXOA 2E6VA 4IEVA 1PVXA 5SV5A 4A3ZA 3BI3A 4Q4X3 4ZY9A 1KJLA 3N36A 1OURA 1S0GA 2HEYF 5A1LA 1W9TA 1RTVA 2JDAA 3ZXAC 5IK5A 1AYN2 1UOFA 1CIYA 2WFF2 3PVNA 4Z92B 5L73A 4NIHA 1NE4A 4F3JA 1S0EA 1MEC3 1DGWX 4RR3A 4CXXA 4IXLA 3SC7X 4DRRA 1JZ2A 3GJAA 2EA7A 3AL6A 4XIKA 3ZIXA 4IESA 3HIFA 5FXVA 4IDZA 3ZSEA 3DGTA 3V65A 2OYZA 1RHI2 2ZGKA 2VUAA 5LBEA 2HEVF 1L3JA 5FXXA 3UL2A 1AL23 2YPJA 4LKEA 4R9DA 1IG0A 4BLJA 1GV9A 1SLCA 3RG0A 4MO3M 4JGYC 4HSLA 3H8XA 1PX3A 4QXCA 1HRI3 3EJKA 5KHJA 4HN0A 3M3IA 2NQYA 2ZMLA 1K45A 2RMU1 5FP4A 1F8VA 1R083 4A6OA 4XUTA 2ZHNA 1AR63 1YFWA 3FFQA 3N9MA 2RR13 4HT1T 1C5IA 4L8QA 5LA0A 1HDKA 4S2HA 5BY5A 3S5AA 4KG0A 4DUXA 3LFIA 4GD4A 2Y6GA 2FCVA 3WG4A 2ID4A 4IE0A 2V72A 3DUIA 5JDBA 1DLCA 2WIIB 1MR5A 1UMIA 1UPIA 2GNMA 4IE7A 2BOJA 5C5TA 3CBNA 4JDMA 5DAPA 2HWC2 1TZOA 3QCWA 2GC3A 1K5MC 2Q8OA 1OMIA 5A6ZA 4FPLA 4BISA 4B4QA 2YPDA 3I2OA 1FV2A 1W9SA 3OPZA 1V9U1 3VL8A 4ZZ8A 2WSVA 3V0BA 3U11A 3J7NA 4FAHA 4A42A 1O3QA 4CEYC 3OGGA 1XOYA 3LIGA 4YW5A 5F5IA 4NJ4A 4MHRA 2A75A 2WO7A 4AVCA 1JUHA 1W8HA 1MZFA 4YGBA 1QJY3 5D8AC 2GP3A 2C5DA 1GZCA 1AR82 1W2AX 4ITCA 2ETEA 3M7AA 2W9XA 1UNBA 5FZ3A 1J1TA 1O7FA 1GZ9A 1W3XA 1YQ2A 2DCZA 3K4AA 3RRDA 1MVEA 5I8TA 3VD3A 4FTEA 3P3PA 1G86A 5GJ6A 1H9PA 4LBKA 4AI0A 5F2SA 5F3CA 1OD3A 5DZGA 5LBFA 2VW0A 4XQDA 3VB9A 1NKGA 1FV3A 2DVAA 3PTYA 4QPGC 3BCWA 3ZXKA 3VBHC 3SH5A 3IM0A 1IS3A 5EQUA 2YBPA 2FCTA 4MV2A 1ZX5A 5F2WA 3CIHA 3OY8B 4FCAA 2B8MA 4XFFA 3V56A 1CN1A 5CFCA 3LCPA 3GF6A 1Z0HA 4XF3A 4MG2A 1YQCA 1W99A 3FHAA 2LTNA 2DCTA 4KWLA 3T0BA 3M3CA 5FUNA 1FATA 5CVRA 5FZAA 3OY8A 2VZVA 4X8PA 1CPMA 4HFSA 3GDBA 4AQ6A 4O9GA 3ZN6B 1VR3A 2CWMA 2H6BA 3M4FA 1CZSA 2ADEA 4F83A 3W9AA 3ZXJA 5JMOA 5CU1A 2XDVA 2A70A 2XXZA 3MBWA 3C7HA 3JD71 4D94A 3WDWA 3UV9A 2Y6FA 1NA1C 2D7FA 2V73A 2EXKA 3Q8CA 3ZN6A 3MUZ1 3VDCA 2C4XA 2CSGA 5BNOC 1S0BA 4ASKA 2XWBB 1QXRA 4KQ7A 3WP3A 5BNPC 3VHRA 2Q8EA 2VQAA 2WFPA 1AYN3 1AYM1 5DAVA 3WF4A 3VZOA 3POGA 2XHKA 1H4GA 4LUKA 1QY4A 1PVC1 3AJZA 1ZBA2 2I2SA 2VMCA 3W21A 2BW8A 1O3SA 4UFJA 4W50A 1WMEA 2D3SA 4NIAA 3MIGA 4HANA 2BP6A 1VP6A 2BQPA 3RJRA 5ISLA 1ND2A 1AXKA 1UOBA 1YO8A 2CV6A 2V5DA 1G9DA 1PZ9A 2Q30A 1WKYA 4CCCA 2P34A 4EWDA 3AP5A 5APAA 4R9BA 1GP4A 2DUQA 4QDSA 2WWUA 3TEZA 2P6CA 1EPWA 2VUDA 4I30A 1VAKA 5DG2A 2Q1ZB 3WG1A 5FPUA 2P3KA 4KI5M 2GZWA 4TLGA 2ARAA 1Q43A 2JIJA 1BEV2 1SLBA 2BEOA 4CSWA 1U5XA 3NWKA 4BXSV 4K40A 1JBCA 3VZLA 2FQPA 3TB0A 2D6KA 4AG4A 1DG6A 1O59A 1WCUA 4LBNA 2VNRA 2PN5A 5T3NA 2HWF2 1GP5A 4DXTA 5FLHA 4N53B 1W6PB 4P9XA 2W1UA 1V6KA 4H55A 3FE5A 2DV9A 4XMIA 4LBLA 4MLOA 3E5XA 4FOQA 3I3MA 1SG3A 2D44A 2W5FA 1EUTA 1SLIA 1VIWB 3R6SA 3SEPA 3R4SA 3ZM8A 1PX4A 2YDEA 5FZ9A 1AXZA 2A6YA 1XYOA 2WNEA 3O1RA 5J96B 4WBBA 5IFPA 5KXDA 4CPBA 1MPXA 4IEQA 2VOWA 2JKBA 3WX5A 1UOGA 3I2FA 1JU3A 5DQ0A 5LATA 1CPNA 3I2HA 3ZYGA 2ZEXA 2FDKA 1AR72 2Y60A 4Y4RA 5IVEA 5DG1A 1ND3A 2JEMA 5FUIA 4XPVA 2R072 5FZFA 1I3HA 4QWNA 4BHPA 4AE2A 5HCAA 4M01A 1K5MA 2Q1MA 3D5OA 1XSQA 3RZJA 4P9LA 3W20A 3LSEA 3PUIA 4GKYA 4KU8A 4UFIA 5DAXA 4NAMA 4P5YA 3IPVB 4JZRA 3CJXA 2Y26A 1BBT2 4FQZA 2Q8DA 3PUHA 3VHOA 4NE9A 4CEYA 4K7JA 3ZXEA 1H2MA 3OB8A 5FP9A 5EFUA 5EP9A 5F7UA 4CCKA 1H8TC 2PAEA 5L19A 2PELA 2EXHA 2CWSA 2XGXA 3EXUA 1OHFA 4OZXA 4YFWA 5LA9A 3VUOA 2WNUC 4E8CA 4JGZC 1W8FA 5L9VA 4WM7B 2JICA 4MXWB 1COV3 5FY8A 4D6RA 1DQ0A 1W6OB 4P5HA 4QHZA 4HVQA 1RJ8A 4MUVA 2WNVA 4OI2A 3AYEA 4XDPA 4Y33A 4Q4W3 1CWPA 3C3VA 2D6LX 3NAPB 4MXWA 3KT7A 4NRMA 3SCFA 4CUGA 4ZS3A 5A70A 1W6OA 2AENA 2JD4A 3O0VA 1IS5A 3EO6A 1UO9A 3PU8A 1J3PA 3PVBB 5A32B 3VBHA 5ACA3 1H8VA 3I54A 1Q5OA 1JOJA 1QXJA 2WZR1 3AYCA 4H7LA 4IV1C 3UGHA 3DPRB 2WA4A 3NNFA 1TEIA 2C24A 4OUEA 3HBKA 2VUJA 1OF4A 2V09A 3RWKX 3WR0A 5L7OB 4K9SA 1N3QA 1XC6A 1HJGA 1OH4A 3NNMA 2VZQA 1Q56A 4WVVA 3UKVA 5GLZA 4PDWB 1QIQA 1URXA 4LKSA 1VBA3 2GN3A 4DNYA 1OKQA 2WN3A 1HKDA 5BUVA 2ZBJA 2VMGA 2R043 3WP4A 3KF3A 2FZ2A 1KJRA 4BM8A 4Q4V3 2CL2A 1YFUA 2ZZQA 3RZHA 2RS32 4RYDA 5LB6A 3KV6A 3WQ1A 2VCCA 4LTAA 1RUNA 5I8YA 5BNOA 4NPMA 4ARXA 1PZ8A 2WINB 5A1AA 1VBB2 3THCA 4EQVA 3DCQA 4XETA 2BGOA 1S0CA 3BTAA 1BZWA 1RUC1 3LIHA 3LEKA 4AGRA 4FPHA 3ME2A 4IL7A 4Q27A 4C91A 3T1MA 2ZOEB 2WAAA 1BXHA 2R32A 3T4HB 3J7MA 1OUXA 2LROA 4CDQC 5I0UA 4XHBA 3SXWA 3N9OA 1PGL2 1VBD1 1ZVFA 4WZCA 1RITA 1NAEA 4DOUA 1BEV3 4EN9B 3OGVA 1UKGA 2RJ2A 2W87A 3H3UA 4BWOA 1NY71 1RUE3 4UFKA 3O1MA 1WW5A 1VBC1 2VNOA 3OGRA 1RUH1 2HWF3 4W65A 1POV0 3IB3A 4OCTA 3HN3A 3WW4A 5KC6A 1RUG2 4UF0B 4NAOA 4QPIB 1QQP1 2VMFA 2W2IA 3BYWA 2WT0A 1QJX2 1S0FA 1AX0A 2PXJA 2YZ4A 1JN2P 5BNNB 2WWSA 4AWDA 3PIGA 5IWFA 5T55A 4YZ3A 4UF0A 5JZGB 4QPIA 3T2TA 3U75A 4YM2A 1FOD2 5FWJA 3J8F1 3J4UH 2NP0A 1VLNA 2YYOA 5C4WB 1ZBE1 4COWA 4QGLA 4QKFA 2D6MA 4OUMA 1CGPA 2OQ7A 2FBEA 2JG8C 2ZX1A 1BHGA 4CUAA 4Q0UA 3S6PA 2VOVA 5C4WA 4CCOA 2VQ0A 4IEUA 3MO4A 2YGLA 4NN0A 2VH9A 5CFDC 4A4AA 2HEWF 3WF0A 4E9KA 1UN1A 3KVBA 1W8UA 2W94A 4HONA 4RD7A 5CKNA 2VTFA 2J1AA 4L11A 4AHWA 4COUA 2WT2A 3B69A 3OSDA 4DEQA 2EALA 1D4VB 1R092 2CGNA 3LFMA 3ZFFC 1WW6A 1QJZA 2OS2A 3BU7A 2X10A 3LAGA 1ODMA 2PQSA 3ON7A 4NMIA 4QU1A 3RYRA 4GMP1 1POV1 4NPRA 3RZLA 1PO12 1UL9A 4A2UA 1SZBA 4YNIA 1VMHA 5LK5A 1B09A 5FPLA 1YIFA 4WM8C 4WV8A 2ZEYA 1WLCA 3DYOA 4LO5B 3USUA 1RMU1 4H14A 1JZ6A 2H6CA 2JD9A 1OQEA 1OPOA 3KF5A 4LBMA 4GWNA 5FAXA 4PBOA 1CAVA 4PLNA 3WDYA 2VQUA 1B35C 3N9QA 2BPA2 5LEKA 1ULCA 4Y20B 2ZPXA 3I3QA 3HWJA 4I2OA 1W9YA 4UBHA 1MS1A 2YV8A 1BCXA 1XNCA 2O0OA 1GQGA 1K5JA 5M0TA 1H8TA 3NV2A 3KGZA 2G9FA 2ORXA 2XL9A 3I3EA 1UXXX 3S7IA 5IK8A 2WNUA 4A3XA 3P1IA 1PIV2 1A8DA 3OCPA 4W6WA 3NKTA 4Q4X1 5DUXA 1ZA4A 1O3RA 4IEYA 1H1IA 2FHRA 4FFHA 1ULGA 3AMHA 3GJBA 1KDMA 2VZSA 3DKQA 4XAEA 5A3PA 1N1YA 1PK6B 4XFAA 1YQ8A 4HETA 4Y1YA 3WNXA 4YW2A 4GXLA 3VZJA 3TYJA 5ABJB 3WUCA 5A7NA 1W06A 1R1A1 2CTVA 1O8SA 3GGLA 2FZ1A 4NPLA 3EMRA 1PK6A 4IV1A 1M06G 4QHBA 3KCYA 5A7WB 2GC1A 3AKQA 3E6DA 1AL21 2ZGQA 1AHSA 4UFLA 3VDDB 5C3OA 1ZREA 3T2OA 2YC4A 1VBB3 1EV11 1HB2A 4CUCA 1TME1 5L9RA 3WNLA 1HRI1 1RUD1 2CAVA 2PHRA 4JV4A 1OLME 2NM1A 1X36A 1GWKA 2JXAA 1H6XA 4PHZA 5AVAA 5C3PA 2JKXA 3KZ4C 2YUEA 4CDXC 1FPN3 1S2EA 1X8MA 3S30A 3GZEA 5FOBB 3H7JA 3LWCA 4J1WA 4BDVB 2K9ZA 1PO22 5BV6A 2VG9A 5J3UA 1AR61 4K1ZA 4AGGA 5LASA 5F37A 4BK5A 2WO3A 3VBOA 1W9FA 4KBBA 4GJYA 3NJZA 5H9QA 1D4M1 5KBFA 4OHYA 1R64A 2Z5WA 3D4KA 1EUUA 3NRUA 4XTMA 5JXIA 4LBQB 1SPPB 1V6NA 5FPZA 4C0BA 5FZ6A 4WVMB 3ZR5A 4G4FA 2PYTA 4XFIA 1VJ2A 5GZEA 4OI4A 4CTEA 2Z4FA 4OMDA 1SQ4A 5CB7A 1SBDA 1QJX3 1SPPA 3PVEA 4MH0E 4CDQA 1GNYA 1CD3G 1SCRA 4ZONA 2UWAA 1LTEA 4Q2FA 4B7EA 1VALA 4AFDA 1UU6A 3B94A 3THPA 1FOD3 2QBXA 2RS13 2C9KA 1ZNPA 2WBKA 1UIJA 4QX3A 2VZTA 3AL5A 1C3HA 4ZHNA 1MZ6A 4LXLA 2XL7A 2RM22 1W05A 2YHJA 1VB4A 5JLVA 4NRPA 2HWB3 3DN7A 2NZ9A 3ZXGA 3W5NA 2QQUA 3H50A 4CDWC 4UYBA 4CU6A 1PGSA 3EQEA 4HPKB 2SBAA 1X50A 4FPYA 2PHFA 4UWDA 4ASMB 1C5HA 1A3KA 1OOPB 4ONUA 1S55A 1KDKA 5LY2A 1XJAA 3MW2A 4ZU5A 1FAYA 3JXSA 4ARYA 2D3PA 3ENRA 4HPKA 3WHUA 1Z78A 2BYVE 5C8CC 4ISRA 1O8PA 2ZX2A 1NLSA 1OOPA 2YFZA 2VNGA 1MEC2 2E7TA 3CL1A 3N7LA 4QGMA 5ANNA 2FDGA 1NYWA 3WSOA 3E1F1 2WS93 3LPGA 2VM9A 1CX4A 3K75B 1PO13 4PJYA 4UOJA 5H9PA 2N7GA 2V4VA 1S2KA 3F95A 5JI7A 1DQ6A 2RJKA 1C4RA 2PAMA 1DQ4A 4XYXA 1U12A 5B2GB 4R9CA 2UURA 4AFMA 2P1BA 2W08A 1LR5A 1RUI3 5CFDA 2ZZJA 5T5PA 3SH4A 1OLRA 3A0KA 1VBE1 1OFSA 2JG9B 1QJU3 5FK7A 1HN0A 1DP0A 1NQJA 3VZMA 1F9KA 1CAUB 4IEZA 3LOIA 4C0HA 5CZKA 1R082 1ZZBA 1DGRN 5A3TA 3ZYPA 4QPYA 3NNJA 1REDA 1AUYA 4EV0A 3G7DA 2E53A 2RR12 5FY7A 3K4DA 3U37A 1OSGA 4CA9A 2VMDA 4NVPA 3UKNA 5A3MA 1PIV3 1UX7A 4OMCA 3K46A 4CEWC 2WN2A 3H1WA 3IDBB 4LPLA 3O1VA 2WQZC 1DQ1A 4YVSA 4D6QA 1CVNA 3J7LA 1AYN1 1B35A 2WFF1 4ATFA 3UESA 4PI2A 1ZZ7A 2XLAA 4IGOA 4PLOA 5CYYA 5A3WA 3AYDA 4FTBA 1REFA 3JQWA 3WUDA 3KSCA 1XNAA 3W59A 4AW7A 4AEDC 4N9IA 2RHPA 1X7NA 4A7ZA 3MV11 4LO4B 5IAVA 2AUYA 2PLV2 1RHI1 5K0UB 4PI0A 4RSUA 3TN93 4LK6A 4OHXA 2WR9A 1LOFC 2WZ8A 4Q0QA 2VD7A 3ZMOA 4PQQA 1Y43B 3ZYJB 5GM0A 3FL7A 3DYPA 4Q0PA 2P4EA 5KHHA 4P9IA 4RS5B 2VW2A 2JENA 3GYDA 4AGVA 4DXSA 1JYCA 3LZZA 5AFEA 3ZFEB 5F3IA 1QJY2 3AKTA 3CO2A 3KGLA 5A1FA 5FP7A 1NT0A 4GB33 4J1XA 3EB7A 3AKRA 2VXRA 1CJDA 5DABA 2GH8A 2PA7A 4YVWB 4R52A 2GAUA 4LK7A 2K2SA 3D82A 1MQTB 3O7OA 3NKGA 4KBZA 5JR2A 5FZOB 5CBLA 2XG3A 4ATEA 5IVCA 1PGW2 3KCCA 1H9WA 4YVWA 5AC93 3GBWA 4LBJA 3M1HA 1XRUA 3BTZA 2GSYA 4NRQA 2RS53 1NCRB 2XKPA 1PM4A 4LO7A 4GJZA 1DHKB 2D5HA 4RHV3 1WW7A 2HWC1 3ACIA 1GANA 3L9JT 3WT3A 4YZ4A 4UW3A 4JKLA 5GLTA 1GOHA 2EICA 5FP3A 1C28A 4HN1A 1ULDA 1X33A 2ZHMA 1J83A 5LBBA 4FOVA 3U10A 4BQ5A 2ARCA 2Z69A 3CHXA 5HBAA 4CCNA 2JDPA 1IKPA 3FLTA 3AKSA 2WKKA 2RM23 3FLRA 4OLLA 4D8MA 3VLBB 1MZ5A 1S1AA 3ZPOA 3VBSC 2W39A 2PHLA 2BOIA 5EWSA 1HRV2 1SEFA 4IEWA 5A6YA 3IDEA 4QXBA 4UW6A 5A7SA 2YXSA 1Q3EA 5SV8A 4RR3B 5HCBA 4C90A 1OUSA 4AVVA 1JUIA 3WINE 1AR81 1U5ZA 3VKMA 4CU8A 5F6KA 3AJYA 4HKOA 5C7GA 3KB5A 1NZCA 5JIUA 4LE4A 3N35A 3WW1A 2VPVA 2BVVA 5KC5A 3O14A 2R1BA 3AP9A 2X53S 3AXEA 1OLMA 4CDWA 3L2HA 4P9WA 4RQPC 4AL9A 4BOWA 5F1RA 2J1SA 1IOAA 1F31A 3KS7A 4Q4Y2 3FFZA 5FYZA 1FXZA 3JBG3 3T4VA 3TNQA 2J22A 2WT1A 5IVYA 4TXWA 5FZIA 1WMXA 1GWLA 4KWJA 1HW5A 1UIKA 5K7PA 4DO0A 3FC0A 3VL9A 3MFCA 3ITQA 1RC6A 5DXDA 5C8CA 4XFBA 2BUKA 3B02A 4FSJA 4CE8A 5HI0A 4CZSA 2OUHA 2QZ2A 3UNPA 3TRSB 4FO9A 1N47A 3B93A 3VBRC 4Y1XA 3H8OA 4UFMA 3LQCA 1UWWA 4D7SA 4FBFA 3B3QE 3MI8A 1FYUA 1O3TA 5FZBA 4CDUC 5JOXA 1KRIA 3BIWE 3A4UA 5CAZA 3OEAA 3DF0A 2ZKLA 1SDDB 2MEV2 4E4ZA 4AEMA 4LQRA 2VXJA 1UX6A 4AYUA 3LPFA 3OTFA 4AAPA 1MACA 2O8QA 2WDBA 3NV1A 3LB9A 4YZ5A 2GNTA 3JQXA 3ZIWA 2DFCA 3OD4A 3H1MA 5FYYA 4BH9A 5IVJA 1YUDA 3V0BB 2GU9A 4EZ4A 5JUVA 1OC1A 2YU1A 2QJVA 4NHKA 4RFRB 4PIYA 2ZAAA 1G7YA 1ZBA1 4HK9A 4QXHA 4PF5A 1PMJX 2OPWA 4IEOA 1QF3A 4KNCA 2P5BA 4OUSA 2FDJA 2PLV3 4EN7B 5I93A 4R4ZA 3NJVA 3O1OA 3LSDA 4RGAA 5BNQA 1W0OA 2UY9A 4Y5TA 3LEIA 4E8DA 3OPWA 1DDLA 2MPFA 1L7LA 2X5IC 3VKNA 2R16A 3BOPA 4OHVA 1N1VA 5FZ1A 4LT5A 2J1UA 2PHUA 1BLZA 1LHUA 2J7MA 5J37A 1H2KA 1LNSA 3ZYBA 4K3UA 1ZZ6A 2R49A 2BRTA 2RV9A 1ZRDA 1J59A 5FUPA 4AVBA 2Q0AA 3AZXA 4OULA 4LMFA 5FZCA 4AK3A 1FNYA 1QDCA 3INAA 2ZTNA 1RUF2 1PHMA 1UMHA 1BEV1 2VBBA 2GALA 4IV3C 1LOFA 3BPSA 3MLLA 4JTOA 5FZDA 1WMDA 2I74A 4W4ZA 3I59A 4EJRA 2WL1A 4PIXA 4R4XA 5CFCB 3C7FA 2ZMNA 4AHYA 3HVDA 2D6PA 2JB8A 2DBNA 1TQ5A 1NG0A 2QVSB 5LZ6A 1UYZA 3B5LB 3GBFA 3PL0A 4GQ7A 4XJZA 4XZUG 2E31A 5D2AA 3I7DA 5I0TA 3RYPA 3USSA 5A80A 1COV2 4AQTA 3C7OA 1F2NA 4D6SA 1Y4WA 1OQ1A 2ATFA 1YCIA 3ZN5A 3QLQA 3S5QA 1G9CA 2YB7A 4LIVA 2C26A 3IAQA 3FUOA 2CGPA 1D0GA 4ORFA 4Q4W2 4J6GA 5F9TA 3SH3A 4FVVA 2ZGMA 3ZR6A 1AR71 1SACA 3HNYM 4QX7A 3S7EA 5ACA2 4LHKA 2BFUS 4Q0VA 4ASLA 2BNMA 5G05L 4E2QA 2VMEA 4LOTA 2R071 4BK4A 1W8NA 4XQWA 1HRV3 4HSJA 3DXUA 3POJA 3UK9A 2BGCA 1O4TA 2Y38A 3HQUA 1DYPA 4FPJA 2ZGPA 3PLQA 4K8RB 2P3JA 3WLUA 2Y8KA 4WVWA 1UZWA 2VR4A 1BBT1 3PJYA 5CISA 1WBLA 3DPRC 5FZLA 3Q8EA 5GZFA 3NW4A 3FX3A 3WVJA 1VBA2 2G1MA 1VAVA 1Y9GA 3WXPA 1ODNA 2R042 3JUUA 3VBSA 1CONA 1MS5A 3QD6A 1ND2B 4Q4V2 5JXGA 4KG8A 3RZKA 4Q4Y3 4K1YA 1REEA 3N3HA 4PDWC 3MPPG 4OQ9A 3OGSA 4AFAA 4AVSA 2VZ3A 1WCSA 3RZMA 4XMAA 1LOBA 1W2TA 2P17A 2XONA 1V6LA 1GFF2 1D0HA 3WD5A 3VGIA 3WNMA 4BE3A 4S2FA 5I0RA 1ULFA 3ZPYA 4NIIA 4OI1A 3LA7A 4RGKA 1JYVA 4FOWA 4FP2A 4XE9A 2GMPA 1JH5A 2DVDA 3B9CA 2ENRA 1NQDA 2ZX4A 2XUEA 3P6BA 5FJHA 3TBDA 2TEPA 2BERA 4RQPA 4FXGB 4JGYB 1BJQA 1JZ4A 1W0NA 4DRVA 1DLLA 3ZDVA 1AL0G 1V0AA 2MEV3 3OUHA 2MHFA 5FBZA 1RJ7A 2Q8CA 5CG8A 5A7OA 1RUE2 1GNZA 3UETA 2FCUA 2Q4SA 3VKLA 3MEPA 1X9TA 4JGYA 1I6XA 4QQOA 5JPMB 2QCSB 4QMAA 1QH6A 4Z2AA 2YU2A 1QWRA 2E63A 3LA3A 1EP0A 1O4ZA 2UYBA 4MYEA 4QD2A 2QQWA 2QQPA 5K8SA 1HXS2 2YC0A 3EBRA 3OF1A 1SLLA 1JYXA 3ETQA 4CDUA 3CNAA 1EAH1 4QX8A 1ND3B 4NUBA 3A7QA 3H8RA 4AQSA 4DUWA 1LB2A 2RS31 5GKAC 2PTMA 5IFTA 3AZVA 4LHSA 1AVBA 3ACGA 5FPBA 2ZGSA 1VBB1 4XILA 1K5MB 3PTRB 3ZMNA 1BMV2 4JX0A 4LO8A 1N3OA 2LW8A 3ZFGC 3R4UA 4JRAA 2BFUL 1Y3TA 2YMZA 3U07A 1W9WA 1LEDA 4C1XA 4LO6B 2ZEWA 3K51A 4CEYB 1RUJ2 1FMD2 4IE6A 5D1IA 1PGL1 2UYAA 3BPZA 3FHQA 1RUF3 1LGNA 2A3XA 4A41A 1F4HA 5LEJA 1AX2A 2Y6LA 1V6JA 3GZAA 3B7MA 1US3A 3WP6A 3KVAA 4ZU7A 2GC2A 3ES4A 1C8M3 2CU5A 2X5IA 1JYWA 1RUG1 4MXVA 5LA2A 2VU9A 5C9AC 1JOPA 2YBSA 4ES9A 1GR3A 3BODA 1MS3A 1QJX1 3IBMA 2WNVB 5D8AA 5FZ0A 1RL3A 1SMVA 5FCCA 5J1XA 2FDIA 1AF9A 3KHBA 3PHMA 1Y9QA 4XCBA 4XCAA 4LE3A 3THTA 4QPGB 1FOD1 2JDHA 3VBHB 3U78A 1QOTA 1ZZ8A 1VMJA 2VOXA 2W3JA 1YIPA 1AJOA 3POYA 4RFT0 4BQ4A 5JI9A 3RWNA 5T50A 3U1XA 3POSA 5FYUA 1N3PA 4QPGA 5HV4A 4BZ4A 3VD4A 2UY8A 1J58A 4AI9A 4ZXEA 2WSUA 4B7KA 5FLIA 4BLIA 4CCEA 3URFA 2QQKA 3AP6A 2NYYA 4M0HA 4XQ4A 3N7MA 5FMOL 3VD7A 1AX1A 3FN9A 5FZ8A 3MGUA 5D21A 2E9QA 2KD7A 4YGCA 4BJ0A 4LIUA 2C9AA 5FYHA 3SNMA 2XJPA 3HPNA 1CAWB 1ENXA 1Q8PA 3OEBA 1RVF2 4BU2A 2QQNA 5FY1A 1R091 1W6MA 2Y33A 1NA1B 3POFA 4Z2WA 1ENQA 4LHNA 2P3YA 4Z1VA 3WNKA 1CAWA 5BNOB 3M3QA 1PO11 2DURA 4GALA 1YFXA 5GLWA 2WABA 4PIZA 1TNFA 1DBNA 4Y5Z0 2ZEZA 4DINB 2VTXA 3B01A 1NA1A 4N7IA 5JVVA 5FZKA 3O5SA 5IHRA 2B5HA 2LUWA 2IXJA 5DUWA 5EJ1B 2R0FA 1WW4A 4U36A 5BNPA 2Y34A 3WDXA 1VRBA 2RDQA 3APBA 1HB3A 2ZHKA 2VCMA 4UW4A 3Q8BA 4E2GA 5B4XA 5L36A 4XF0A 3HQXA 1FPN2 2A3WA 4YM1A 5A6XA 3G6JB 3OYWA 2XUMA 2GDFA 1KQRA 2Z79A 4UBGA 1F15A 2NPIA 1WWYA 5DUUA 1W04A 4BIOA 1V9U3 1Q8VA 3ZO0B 4AI8A 1PIV1 1PMHX 1W6NB 4XW3A 5JPNB 5KR7A 4GMP0 2HWE2 3MZHA 3CJIC 4TLFA 1XBFA 3HEIA 1XSRA 3AXDA 2DVBA 3K3OA 1QJFA 3AM2A 4IERA 2ZA9A 3O1SA 5HV0A 1HXS3 1W6NA 1QHDA 1E57A 1VE0A 5JOYA 2BDRA 3MICA 3WV6A 1XNDA 2R062 2TUNA 4G9SB 4ISQA 4MOAA 4IGQA 1W39A 3ZVXA 3FJSA 5E88A 4A44A 3CF6E 3I3DA 1CIWA 2RS12 4X8NA 3RVHA 4XJAA 3JU9A 1GKBA 4K21A 4YARA 4XUPA 5FTTC 3VDAA 2AGSA 1SLAA 2WQ4A 2ZHLA 3HD8B 3QACA 4M00A 3RJ2X 3VBFC 4Z8BA 2HWB2 1BVP1 3VZNA 4V2WA 1JTZX 5DZFA 5A33A 3FWEA 4QAWA 5L9BA 4FTSA 3MF9A 3MV01 4OFGA 1WGPA 2CDPA 2VBDA 2DU0A 2XR4A 4XUQA 3RNSA 4NHXA 4R8HA 4B4RA 1RUJ3 1PO21 1FMD3 1UU5A 5FO8B 4YM0A 2W1SA 1UY1A 4TYSA 2D98A 4XDQA 5KXCA 1LOEA 1G9AA 1OKOA 2JE9A 3BB6A 1H2LA 5FZMA 4AFCA 1BVVA 2WS92 4I0AA 5E1RA 2HYKA 4XFCA 3U4XA 3VD9A 3USUB 1YHFA 4AQ2A 2O8OA 1L7QA 2PMWB 3LDBA 5EYYA 3ZFGA 2XBO2 3LEGA 1YI7A 3JD73 1CAVB 5FPXA 4YM3A 2W46A 3GALA 2RG4A 1OBNA 1RUI2 3E5QA 5HXMA 3WDTA 5GZGA 1QJU2 2F4PA 2PHTA 3HOBA 2PHDA 3RFRA 4CCDA 1EYBA 5C71A 1Y7BA 1H8TB 2R0HA 3O12A 4CYDA 1WLWA 5K4LA 2WNUB 3ZSLA 2RM21 1GOGA 4JGZB 4LORA 2RDRA 2W0XA 2CGOA 1LRHA 3AB0A 4JQRA 3C7GA 3CU7A 4EN6B 5C9AA 3AFKA 3DECA 1QJEA 1FNZA 3J9SA 3ZYHA 2QZ3A 4YW4A 4JGZA 3RZGA 1WCQA 4LITA 1F35A 2GC0A 2WLPA 2WZEA 3RMYA 4FFIA 4CU7A 4CVUA 4LNVA 1UY4A 3TAYA 4I3GA 3MIEA 3PJQA 4FQ4A 1RVF3 4N90A 4XOGA 3WG2A 4NIDA 4BMEA 2I07B 1MEC1 2PFWA 2VVDA 4XUNA 3BTXA 3UJQA 3AC0A 4IV1B 5DUVA 1KXGA 3THDA 1XQNA 1DU3D 4DZGA 5FMCA 1YI9A 1ZRRA 1UZYA 2AEZA 2ARXA 4MGIE 4YG3A 5EZWA 4N43C 3IT8A 1V6MA 1QOSA 5T5LA 3TN92 1J84A 4HMZA 5E6HA 1UZVA 1OLQA 4META 1JYTA 3LD8A 2JDYA 1O6UA 1UY3A 2D97A 2W47A 4QPWA 2VNVA 1C8NA 1YNAA 4QQLA 2FD8A 2EIGA 5K0UC 4YW7A 3I97A 4CXYA 4MGQA 5FPAA 4EZHA 3VBOB 1MS9A 1V70A 3DXTA 2Y6HA 4U2AA 4XXAA 1R081 4GB32 1QH7A 5J48A 4XF4A 4GH4C 3I2GA 2RR11 4M3CF 2GMEA 2AR6A 1JZ7A 3K4ZA 2IXLA 5FRAA 2VZUA 3HN1A 1RB8G 2W1WA 3WZ1A 2BV4A 2J1RA 1NOVA 4AOCA 5AC92 3H9AA 2HWE3 4GA9A 5G04L 4CDQB 1G6NA 3PDQA 3WQ7A 1JU4A 2RS52 2ZACA 3MLKA 4JC1A 2XJTA 5IVBA 1U0AA 4JHTA 4RGGA 3BVCA 4RHV2 3TWIA 5FK8A 1AR92 4L0PA 3W5MA 5FPVA 1YRZA 5CIRA 1DGWA 2XLFA 4E4HA 3NVCA 2R063 3SKJE 4XJWA 2DCYA 2VZOA 5T5OA 4PF1A 3SKVA 3ETPA 3VBUC 1QOOA 3ZKYA 2HWD2 1OPMA 5C6CA 1APNA 4MZUA 1JI6A 2W92A 4QGNA 4MGYE 4CRQA 3CJIA 3NO8A 1D2SA 2VULA 1NCQC 3VHNA 4DUVA 5JSRA 3HAGA 1QKQA 2DVGA 2WAOA 3LA2A 1W3VA 1A6CA 4XJUA 3ROUA 3V64A 1QJY1 2BWAA 4WZFA 2VOKA 1IPKA 3RPQA 1J1LA 2Y6JA 4QKBA 4Y24A 5LRRA 2ZGTA 4EN0A 1HQWA 2VAUA 5LW9A 1I5ZA 1NLQA 2B46X 2JG8B 5FFOC 1IPSA 4DB5A 1LHOA 4RR3C 1FI2A 3VBFA 1FT9A 1PGW1 3J26N 2CDOA 3WCSA 5CFDB 1ALYA 2JG8A 2YC2A 4IEPA 1LU1A 2EXIA 1LKNA 4K8FA 4M4RA 2ZMKA 3T2PA 1ST8A 2YY1A 2J1TA 1CAXA 2XBO3 3JBG2 2AC1A 2GP5A 5IJRA 4YYOA 4NWWA 4D7TA 4CP2A 1ONAA 4CP9A 4YFZA 4COZA 2XLGA 3ZFFB 4HL0A 4O65A 5IT6A 2VBPA 3H7YA 1LOCA 3HJRA 4KWUA 5CNAA 5F5CA 4QDQA 2J1VA 4RN5A 3ZFFA 4WM8B 2W95A 1V6IA 4NROA 5FY5A 2UU8A 5JWPA 1VMFA 3OPTA 1Q8QA 3AK0A 4OQ8A 4Y4YA 2F6BA 2Y0IA 3R0RA 3ZOIA 4AI3A 2NLRA 1RGSA 1HRV1 4WM8A 4YVSB 3FMGA 5DDJ2 1B35B 5EYXA 3R05A 1OQDA 1O4YA 1BQPA 5FZGA 4AF9A 2WYSA 5T54A 4QKDA 1GZTA 2D3RA 3O1UA 2AYHA 1BYHA 3PUAA 3X29B 1HB1A 3N9NA 4F7ZA 3NSTA 4QQ2A 1ENSA 5EV7A 4TZDA 4P14A 1XYPA 1LEMA 1RIRA 5FO7B 1SDWA 1VBD3 1IQAA 1WLDA 2E32A 4E4SA 4QB6A 5I91A 3S0MA 2OPKA 4QM8A 4MGTA 5KWRA 2YFUA 1MVQA 1LU2A 2J42A 2JDNA 3NJYA 5FXZA 1RUH3 1U5YA 1JODA 3CZUA 4BQ1A 3B9IA 1ASJ2 1TMF2 4ZPIA 4XAAA 4HK8A 3GCXA 4DY5A 2P3IA 1QQP3 4LKFA 5EIYB 1ZRFA 4W6XA 5IVVA 4WVZA 2L9LA 4JAAA 4NHLA 5BYNA 4HZFA 2A1XA 1F5FA 2H0BA 1DIWA 4YZ2A 1NXMA 5F3GA 1QU0A 3J8F3 2LS6A 2MEV1 5FKBA 2X09A 3D0SA 1IQDC 4YLZA 5FYCA 5FBJA 4CDXB 4XFHA 1ZBE3 2B9VA 4CPBD 4CCJA 1CZTA 1GZWB 4I01A 4JCKA 3AKPA 1SFYA 4FFGA 1W90A 5FYVA 4L92A 4CDXA 3H8UA 3WHTA 5FYIA 3AZZA 3RDIA 1JYNA 5CFCC 1AR93 1VRH2 3AMMA 1GZWA 2GNDA 2JE8A 4GULA 4QX0A 4DXZA 1KGYA 4GH4A 4JQTA 4OYUA 3HQRA 4QB1A 3DV8A 4KWKA 3NNLA 5FMDA 5FZEA 5BPXA 3UGGA 4N7UA 2HWD3 3D8CA 5C70A 1YFYA 3MDPA 1UF2C 5DZEA 4XFGA 4IQPA 1SBEA 3ILRA 2QQLA 3LF7A 4L9BA 3HNMA 1POV3 1E5IA 2QQVA 3NMBA 3ABZA 1AZDA 4Y1ZA 5FKCA 5JXHA 4KU7A 2VY0A 2IFRA 2DWRA 2E26A 2A5ZA 3OUIA 1K42A 1H4HA 2RVAA 3Q8FA 2O14A 1RMU3 4QHOA 3WDUA 1YJLA 3KWVA 3VBUA 3WG3A 4CDWB 1LHWA 4G3YC 1XNTA 2OX0A 4PT6A 4HKLA 4BMBA 2XHNA 4XEZA 4Y3OA 3PVOA 1W6QA 2BVBA 4GAZA 2QQJA 1US2A 4V2VA 4AHXA 1LAJA 1EPZA 3SQOA 2V5YA 3WNNA 5C8CB 2VC9A 2XJQA 3BTYA 2WRAA 1LGCA 3N9LA 4AI2A 2OQ6A 2BNOA 3PMEA 1G9FA 3MW4A 4A7KA 2ADDA 1COV1 1IGOA 2BTVC 4AXOA 1IPJA 1ND2C 2E7AA 5JMCA 4QB2A 4Q8KA 4E27A 1XPWA 2XVGA 2XPJA 4Q4W1 3AVSA 1IS6A 3K3NA 3WOGA 1OVSA 1XNBA 2A6WA 1XNKA 5FMBA 4BIFA 2X29A 5ACA1 3KCXA 5C3SA 4FPGA 2JDKA 2UWCA 1R1A3 1W8ZA 2D6NA 2XKOA 3T2QA 2GMMA 5DDJ3 1GYKA 1IZ3A 3IIIA 2HBUA 3BALA 4FPEA 3AMPA 4UT5A 3BIEA 1KFUL 2JIGA 3LKJA 1EV13 2ZKNA 4KH9A 1TME3 3T09A 4I02A 1RUD3 5E16A 2XVLA 1J3RA 1C1FA 5JAXA 1ZZ9A 4KGGA 1CQ9A 4R9AA 1VBA1 4C1WA 1H6YA 4Y22B 3IAPA 4N53C 2ZXQA 2WQ8A 2R041 4CEWB 5FY9A 2CAUA 4X6RB 1Z7S2 4Q4V1 1QXPA 3ELNA 5GZDA 4QX1A 3R4DB 1E5SA 4Y1UA 5AVPA 4XJ9A 1N1TA 1D4M3 1RYYA 4Y22A 3D6EA 1RXGA 1GP6A 5T52A 2BZDA 4CEWA 1E5HA 2JWPA 2JB4A 4M0NA 3OJBA 3D0JA 1ND3C 3KT4A 5FP8A 1ASJ3 1CESA 1TMF3 4AEDB 3SISA 1V6OA 4HLTA 5F3EA 4EE2A 5JXJA 1D2QA 2D43A 2VQTA 1S0IA 5C33A 3ACHA 4AEDA 4FPFA 3C7EA 3I59B 2LRPA 3LGRA 4Q1PA 1DGRA 2JE7A 3H3LA 2GNBA 1GBGA 2K0GA 2A73B 3A23A 4TN7A 3WQ0A 1CJPA 3WF3A 1RUE1 1BKZA 1ZYBA 2KXLA 2HWF1 1C8M2 2DF7A
chains in the Genus database with same CATH topology
1UMZA 3RQ0A 1HXS1 4BA6A 2Z2SB 4LUMA 1YYNA 2IC1A 1VRH3 4Q0SA 1JYIA 4YW3A 3H1YA 2AH2A 4PBPA 2B9UA 2ET1A 1LHNA 1UD1A 3B00A 4LLOA 5IUQA 5SV5A 2PQQA 2WNVC 2WC2A 4WM7C 5JIAA 2OW4A 4V1PA 1QNYA 1BMV1 4NO4A 3SITA 3PNAA 4B4PA 1WMFA 4YG0A 4ZXKA 2IXKA 3O0WA 3NAPC 3SCHA 1GQHA 3MPBA 3QBQA 2H0VA 1RUJ1 1FMD1 1VBE3 4W6YA 2C1FA 4XIOA 3VBSB 2NN8A 3I4IA 2QUOA 3AYAA 2YGMA 5KHKA 2A3YA 5FQ0B 1Q8SA 2RMU2 1HQLA 4YGDA 5L7OC 3JCIA 2B42B 2W68A 4XJ8A 3OBTA 3OBRA 4OHWA 2FMDA 2ZGOA 1JW6A 5FQ0A 2DTWA 2BWCA 4MGKE 2QFEA 1UKRA 2C0ZA 1HX6A 4RQPB 2WFF3 1IS4A 1TE1B 4D69A 1GSLA 4EWEA 2XJVA 2PHWA 1CR7A 3WW2A 5FMOS 1DQ2A 2QDRA 4QQPA 1V9U2 1RHI3 2B7YA 5H9RA 4DY3A 2BNNA 1HV0A 5JR7B 4O9EA 3VBRB 2ERFA 4CDUB 1RVF1 1HV1A 1DQ5A 3SMHA 3VBRA 2DTYA 4EWAA 1LOAA 4LLFA 1YXWA 1UW8A 4QPIC 4DS0A 3M2MA 5JSPA 1Z7S3 3FBMA 4NHMA 2LM3A 5FREA 4DFSA 5BNNC 3AX4A 3FBYA 4AEJA 4B29A 5JZGC 1LGBA 4QQHA 1W0PA 3MIFA 5TSWA 1EY2A 1QNWA 3HT2A 4AHZA 3ZSKA 1X82A 3MIBA 5C4WC 1AJKA 1FPN1 2HWC3 2ZJCA 4N53A 1W6PA 1KFXL 4GWMA 1U5IA 3SLIA 2X5IB 2Y0OA 4LBQD 2ZABA 5F5QA 3ILNA 1QMJA 3MIDA 5JOZA 5JOWA 4ES8A 1I1EA 5D8AB 3GHMA 2HWE1 1V00A 5F6LB 3KD4A 1UCXA 4I0WB 3JD72 1M4WA 1OA3A 3GZUC 1LECA 4AVAA 4GIQA 2QKDA 4IV3B 3GZTB 4ZKTB 4NR1A 1NLRA 1F5JA 2R061 1AR83 1S0JA 4M3CE 4NWVA 2D6OX 2OA2A 1O5UA 4AFBA 2QDNA 2RS11 2ZGLA 2JX9A 2WJSA 4IV3A 1AYM2 3RI8A 3POWA 3Q9OA 1PMIA 5KHGA 5KHIA 1GICA 1YLLA 5IK4A 4UXAA 2HWB1 1MS8A 2A7AA 3KLSA 1G8WA 3IPVA 1PVC2 1S0DA 4BYYA 4DMIA 3IDCB 3ZXLA 2NMNA 4F8AA 4H7MA 4P9YA 1SBFA 4JVAA 1W6MB 1O5LA 3ZN4A 1DYKA 3KMHA 1ZM1A 5I0SA 1H1MA 4WM7A 2VVFA 4YSFA 5BXXA 2RMU3 2WS91 5E89A 2XB6C 4HVOA 2A6ZA 5BNPB 5C8WA 1VAMA 2XBO1 1NE6A 2G4IA 3M3OA 3MYXA 3NAPA 1G9BA 1PK6C 3C2UA 4OVEA 1DFQA 1RUI1 5ABJC 5LK7B 5A32A 3H3ZA 4X6QB 3MW3A 1QJU1 3OYWB 1KD7A 3NV4A 3E6CC 2XJUA 3ST7A 4LA3A 3DPRA 2QNKA 4XF1A 3JZVA 3VDDC 2ARBA 5L7OA 4PQ9A 2O1QA 5CADA 1ULEA 2P2KA 3N4MA 2ZS6B 1EAH2 1ZBA3 1H0BA 3ES1A 4CP1A 3VBOC 4PDWA 2WZPP 3TOJA 3ECQA 3MLJA 4KGQA 2ZGNA 4XZPA 5K9YA 2EF6A 4B3NA 4XF9A 4MSVA 3ZX7A 1W2UA 1Q8OA 4N9HA 4QM9A 1PNFA 1RINA 5EJ3A 2D93A 3FZ3A 5CG9A 4I0BA 2QE3A 3TN91 5A33B 2DUOA 4ZU4A 4JDOA 1XE7A 2D5FA 4BCUA 5IK7A 3FUQA 4I09A 4JRLA 1AXYA 4S2DA 1UU4A 4FPKA 1R1ZA 2ILMA 4BPZA 2DVFA 4GB31 5H9SA 4Q29A 4YGEA 2WLQA 3EHKA 3N7JA 1ENRA 4LHLA 4QXKA 5BNNA 2DUPA 3ALQA 3ZFGB 3I2DA 1OOPC 1RUOA 5JZGA 2ET7A 1AR73 5AC91 2A6XA 2DCKA 3RYKA 4HBNA 4P9GA 2Z42A 2RS51 2R073 1A8MA 2ZGRA 1HLCA 2X8KA 2WZR2 4RHV1 1LCLA 4AVTA 1AR91 1WD3A 2ES3A 3I8TA 2HJIA 1BK1A 2DFBA 3E97A 3ZSJA 2ZX0A 4HKWA 2NMOA 1JHNA 2HWD1 1AYM3 4UW5A 4MVTA 1BBT3 2IFWA 5C9AB 2E51A 1ZZCA 3P3NA 3IMNA 2JG9C 1DZQA 2XH6A 2HKXA 4LEJA 2KM2A 1PVC3 4FOYA 5GALA 2TBVA 1ZRCA 2VECA 3W58A 4DQAA 3QH7A 3H0OA 4JTNA 2BBVA 1OD5A 3LOBA 3VHPA 1FX5A 2OVUA 1WBFA 1VB2A 4MGZE 4SLIA 3RZZA 1J3QA 1RUC2 4YVSC 1IKQA 3IWZA 4Q26A 2EAAA 4MX3A 2A6VA 4PCRA 4OHZA 1XU2A 3AFGA 5FDBA 3E6BA 1H1AA 3JB4C 2A71A 5GZCA 4QT6A 4QX5A 4URTA 4OI0A 1LULA 1VBD2 1C1LA 4H3WA 3JBG1 4Y20A 3QOPA 1OI6A 3N7KA 3L2YA 1NY72 3M8LA 2OZ6A 4XHXA 1VBC2 1XYNA 1RUH2 2AREA 4TSVA 3K48A 3KM5A 1DF0A 4YG6A 4LULA 3U0ZA 1QQP2 4E2SA 2R6QA 3V0AB 3T1LA 3UKTA 4M3CB 4AI1A 1QDOA 2IXCA 2CNAA 4FXKB 4D7YA 2EVXA 1EAH3 4RS5C 1A78A 1LODA 4FPOB 3J8F2 2RS33 3ZFEC 5DDJ1 4DPNA 5KXEA 3V0AA 4M3CA 5ABJA 2EAKA 2R1DA 1ZBE2 1QGLA 1MZEA 5FOJB 1MS4A 4YVWC 2UWBA 3VKOA 3A0NA 2IWGB 3BOWA 3OGJA 1MQTC 4Q8LA 5E8AA 5J7MA 3NL1A 3VDDA 3FLPA 1C57A 5JSOA 2KA3A 1LOGA 2LALA 5KXBA 4FPCA 1JXNA 4JDNA 2RJLA 3CJIB 1UZZA 3KQRA 2RE9A 1NCRC 2PLV1 3PMSA 4Y1VA 3SCGA 3VV1A 2JJ6A 3AMQA 3RS6A 4KL1A 4RL7A 5LRSA 3ZXFA 3SHRA 1MS0A 3HBZA 1ASJ1 1TMF1 3GHNA 1H30A 1RUG3 2E7QA 2P37A 5FO9B 1KS4A 4A7YA 4LBQA 3IKWA 4XBLA 5J09A 1KS5A 3M70A 4WVMA 4FP3A 1RMU2 4S2GA 3HT1A 3VBFB 1OA4A 3E5UA 2VMIA 4Z07A 5A3LA 2VW1A 1GNHA 3ZYRA 2MNGA 3IN9A 1CAXB 2CY6A 4YZ1A 3WDVA 4Q1RA 4YRDA 4LA2A 1S2BA 4EN8B 2ZX3A 3AP4A 2ZCWA 2SLIA 3GNEA 1O91A 3ZXDA 2XJSA 1YWKA 2WZR3 2W52A 4IETA 2B45X 3JB8A 1VRH1 1WCDJ 1X8EA 3ILFA 4Q4X2 1UAIA 4FAGA 3AP7A 4B8EA 1PNGA 2XWJB 4XBQA 3ZYIB 3CEWA 2GH2A 2Q5TA 1TNRA 4COYA 2I45A 1R093 1SLTA 3WW3A 1YJKA 2DCJA 3NV3A 1WUVA 3MFAA 1R1A2 3VN4A 3ZDSA 4RA0A 5CA6A 5J36A 1AL22 1HQNA 4LR4A 5JCTA 3WP5A 1EV12 2OZJA 2VMHA 5AFBA 3ASIA 1TME2 1RUC3 2VVEA 1HRI2 1RUD2 2CYFA 1DGLA 1GLHA 2ZAHA 4K20A 1WCKA 3RMXA 3WCRA 1PM7A 1WD4A 2JG9A 4EROA 4FT8A 1AR62 2EXJA 4L2NA 2B39A 2WA3A 1CAUA 4AEKA 1LESA 4Q4Y1 5T5JA 1D4M2 3HMYA 4YW1A 3CLPA 1WA4A 1VBC3 1I9RA 4P9JA 2IXHA 4L97A 4COVA 2AZ5A 2PAKA 4I3PA 4N43B 4XTPA 3UJOA 1OFNA 4NOTA 1OA2A 3GBGA 3KT1A 4TWTA 4XXPA 1LJ7A 1N1SA 3FHIB 2G9GA 2TNFA 4IEXA 2ZGUA 4N43A 1XU1A 4XBNA 1XXNA 3VKFC 3RI9A 2R30A 3HR9A 3DL3A 2PHXA 5I8SA 2DYCA 1DZTA 2IZWA 1IHMA 5K0UA 4GH4B 1LHVA 3WY6A 2VGDA 4K6BA 2XJRA 2DU1A 3AMNA 4LBOA 1NXD1 2JDZA 3AZWA 2IXIA 2XVKA 1PO23 4RS5A 1KITA 3MIHA 1Z7S1 3O0XA 3VZKA 1WLTA 3ZFEA 3OD0A 4L99A 2GN7A 3ZSMA 1XE8A 4Z82A 4D3WA 1UPSA 4QU2A 4GMP3 1MQTA 1PZ7A 2JECA 3VBUB 2OIIA 3IIAA 2OUJA 1HIXA 1LENA 5FLJA 3M3EA 4INDA 4CP0A 4Y26A 5HCFA 4GKXA 1VBE2 1W6QB 1H2NA 4SBVA 1NCRA 1SCSA 1RUF1 1NCQB 4HVRA 4E4DX 1SFNA 4PLMA 2YROA 3MF6A 5J98B 1C8M1 5GLVA 3QH6A 1DZRA 1NCQA 2D40A 3ACLA 5HXVA 3ATGA 1T6GC 3RSJA 3AZYA 3DKWA 3TNPB 5GLUA 2FMYA 5EXOA 2E6VA 4IEVA 1PVXA 4Q4X3 1KJLA 3N36A 1S0GA 2HEYF 1RTVA 3ZXAC 5IK5A 1AYN2 2WFF2 3PVNA 4Z92B 5L73A 1NE4A 4F3JA 1S0EA 1MEC3 1DGWX 4RR3A 4IXLA 4DRRA 2EA7A 3ZIXA 4XIKA 4IESA 3HIFA 3ZSEA 3DGTA 3V65A 2OYZA 1RHI2 2ZGKA 2VUAA 2HEVF 1L3JA 3UL2A 1AL23 2YPJA 4R9DA 4BLJA 1GV9A 1SLCA 3RG0A 4JGYC 4HSLA 1HRI3 3EJKA 5KHJA 4HN0A 3M3IA 2NQYA 2ZMLA 2RMU1 1F8VA 1R083 2ZHNA 1AR63 1YFWA 3FFQA 2RR13 4HT1T 1C5IA 4L8QA 1HDKA 4S2HA 5BY5A 4KG0A 3WG4A 3DUIA 5JDBA 2WIIB 1MR5A 1UPIA 2GNMA 4JDMA 2HWC2 3QCWA 2Q8OA 2GC3A 1K5MC 1OMIA 4FPLA 4B4QA 1FV2A 3OPZA 1V9U1 3VL8A 2WSVA 3V0BA 3U11A 4FAHA 1O3QA 4CEYC 3OGGA 4YW5A 2A75A 4AVCA 1JUHA 1MZFA 4YGBA 1QJY3 5D8AC 2C5DA 1GZCA 1AR82 4ITCA 2ETEA 3M7AA 3RRDA 1J1TA 1O7FA 1GZ9A 2DCZA 1MVEA 5I8TA 4FTEA 3P3PA 1G86A 5GJ6A 1H9PA 4LBKA 4AI0A 5DZGA 2VW0A 4XQDA 2DVAA 1FV3A 3PTYA 4QPGC 3BCWA 3ZXKA 3VBHC 3SH5A 3IM0A 1IS3A 4MV2A 1ZX5A 4FCAA 3OY8B 4XFFA 2B8MA 3V56A 5CFCA 1CN1A 3LCPA 3GF6A 1Z0HA 4XF3A 2LTNA 2DCTA 4KWLA 3M3CA 1FATA 5CVRA 3OY8A 4X8PA 1CPMA 4HFSA 4AQ6A 4O9GA 3ZN6B 1VR3A 2CWMA 2H6BA 3M4FA 4F83A 3W9AA 3ZXJA 5CU1A 2A70A 3JD71 4D94A 3WDWA 3UV9A 1NA1C 2D7FA 2V73A 2EXKA 3ZN6A 5BNOC 1S0BA 2XWBB 1QXRA 4KQ7A 3WP3A 5BNPC 3VHRA 2VQAA 2WFPA 1AYN3 1AYM1 3VZOA 2XHKA 1H4GA 4LUKA 1QY4A 1PVC1 3AJZA 1ZBA2 2I2SA 2BW8A 1O3SA 1WMEA 2D3SA 3MIGA 4HANA 1VP6A 2BQPA 3RJRA 1ND2A 1AXKA 1YO8A 2CV6A 1G9DA 1PZ9A 2Q30A 2P34A 4EWDA 3AP5A 4R9BA 2DUQA 1EPWA 4I30A 5DG2A 1VAKA 3WG1A 2Q1ZB 2P3KA 2GZWA 1Q43A 1BEV2 1SLBA 2BEOA 1U5XA 3NWKA 4K40A 1JBCA 3VZLA 2FQPA 3TB0A 2D6KA 4AG4A 1DG6A 5T3NA 4LBNA 2VNRA 2PN5A 2HWF2 5FLHA 4N53B 1W6PB 4P9XA 1V6KA 4H55A 3FE5A 2DV9A 4XMIA 4LBLA 4MLOA 3E5XA 4FOQA 2D44A 1SLIA 1VIWB 3R6SA 3R4SA 2YDEA 1AXZA 2A6YA 1XYOA 2WNEA 5J96B 4WBBA 5KXDA 4IEQA 2VOWA 2JKBA 3WX5A 1CPNA 3ZYGA 1AR72 5DG1A 1ND3A 2JEMA 4XPVA 2R072 1I3HA 4BHPA 4AE2A 5HCAA 4M01A 1K5MA 2Q1MA 3D5OA 4P9LA 3LSEA 4GKYA 4KU8A 3IPVB 3CJXA 2Y26A 1BBT2 4FQZA 3VHOA 4CEYA 4K7JA 3ZXEA 1H2MA 5EFUA 1H8TC 2PAEA 5L19A 2PELA 2EXHA 2CWSA 2XGXA 3EXUA 1OHFA 4OZXA 4YFWA 3VUOA 2WNUC 4JGZC 4WM7B 2JICA 4MXWB 1COV3 1DQ0A 1W6OB 4P5HA 4HVQA 1RJ8A 4MUVA 2WNVA 4OI2A 3AYEA 4Q4W3 3C3VA 2D6LX 3NAPB 4MXWA 3KT7A 3SCFA 1W6OA 2AENA 2JD4A 3O0VA 1IS5A 3EO6A 5ACA3 1J3PA 3PVBB 5A32B 3VBHA 1H8VA 3I54A 1Q5OA 1JOJA 1QXJA 2WZR1 3AYCA 4H7LA 4IV1C 3DPRB 2WA4A 1TEIA 3WR0A 2VUJA 2V09A 5L7OB 4K9SA 1N3QA 1Q56A 4WVVA 3UKVA 5GLZA 4PDWB 1URXA 1VBA3 2GN3A 4DNYA 1OKQA 1HKDA 5BUVA 2ZBJA 2VMGA 2R043 3WP4A 2FZ2A 1KJRA 4BM8A 4Q4V3 2CL2A 1YFUA 2ZZQA 2RS32 3WQ1A 1RUNA 4LTAA 5I8YA 5BNOA 1PZ8A 2WINB 1VBB2