5J96B

Crystal structure of slow bee paralysis virus at 3.4a resolution
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
261
structure length
252
Chain Sequence
b'MDRPEGSEERTVQTSNVVLGETNIESQDIASKEYSPTWDRLASSEVSDEYPMLTDRWLFWKSVKWEVNDSAFGKMLVQEKFPQSWVQMDVNIPNFIPFNIHQYMRADFEVKIYVNPNDFVSGWLIMAFLYQGSEMFDYKLRRNPAALMQMPHVLVNVGAANEATLKIPYRYVRPFMRCKDILRGDNLITGVTEPLNMGVLFVEVLIPFRTSAASSAPKSLDVSLFVKMTNAKFTGMVDGSIALLSKPIALPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VP1
publication title Virion Structure of Iflavirus Slow Bee Paralysis Virus at 2.6-Angstrom Resolution.
pubmed doi rcsb
source organism Slow bee paralysis virus
molecule tags Virus
total genus 34
structure length 252
sequence length 261
ec nomenclature
pdb deposition date 2016-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5j96B00
5DDJ1 1FPN1 3VBRB 4CEYB 4Q4X3 4RR3C 1VRH1 2BBVA 1RMU1 1ZBE2 1EV13 3ZFGB 1ZBE3 5C9AC 4N43A 1NOVA 1NA1C 1RUE3 1TME3 1PVC2 1VBD3 4YVSA 1VBC2 4BCUA 1NCQB 4JGYB 5BNOA 4GB32 1AR82 3VBSB 4GMP0 3VDDC 2RS13 4GB33 1AR83 2X5IA 1RB8G 4WM8B 1RVF1 1AYN3 1HXS1 4RQPA 4NWVA 4RS5B 4CDQA 4CEWA 2IZWA 4YVWB 1VBE3 4PDWC 5D8AB 3VBUB 5L7OA 1RUG3 3NAPB 1BBT2 1NCRB 2FZ2A 5ABJC 1K5MB 1QJU2 1R1A2 3JBG1 1B35A 2ZTNA 1QJU3 1R1A3 5GKAC 1AYM1 4RHV2 1CJDA 1BEV3 4WM7A 2WWSA 3IDEA 1QQP3 1ZBA3 3FBMA 1RUJ2 4RHV3 2MEV2 4Z92B 4Q4W1 4YVSB 1ND2B 1AR91 2Y26A 5LK7B 1V9U1 4EJRA 4N53A 3VBHC 5BNNC 4CDXC 2X5IB 2RS53 2R041 3VBRA 1POV1 2HWB2 1HRI2 4RQPB 1PIV1 2HWB3 4CEWB 2BFUS 1QJZA 1RUI2 1ASJ1 1GFF2 1HX6A 4N43C 5L7OB 1HRV2 5C4WC 3LOBA 1RUI3 3ZFFA 1COV1 2RMU2 1AR71 1NCQA 1R092 5ACA1 2HWD3 5BNOC 1AL0G 4Q4Y1 1C8M3 2RMU3 1FMD3 3VBSA 5CFCC 1R093 1W39A 4CDUA 3J8F3 2RS31 2HWF2 1R082 4JGZC 4WM8A 4WM7B 5BNPC 1QJY2 2HWE1 4RS5A 5JZGC 4YVWA 1H8TC 1RUF1 2RR13 1QJY3 4Q4V3 5D8AA 2WS91 1AR63 1AL21 1EAH1 2RM22 1NCRA 1RUH1 1VBA3 2RM23 2WLPA 4N53B 2WZR1 4Q4X2 4QPIA 1B35C 1EV12 3TN93 1RUD1 2R061 5DDJ3 1FPN3 1NA1B 1RUE2 1TME2 1VRH3 1RMU3 5CFDC 1VBD2 1MQTC 1ND2A 1PO21 3ZFFB 1RUC1 4LLFA 2QQPA 1FOD1 1MEC2 2RS12 5AC91 3CJIB 4IV3A 3VBFB 1MEC3 1AYN2 2BFUL 4CDUB 2XBO1 3VBRC 2R071 1VBE2 4CEYC 5J98B 5C8CA 4IV1A 1RUG2 1RVF3 1HXS3 3ZFGC 1PVC1 5A33A 4FSJA 3ZFEA 1VBC1 5ABJB 1NCQC 4JGYC 4SBVA 1BEV2 1SMVA 1VB4A 1QJX1 1X36A 4QPIB 1QQP2 1PGL2 1ND3C 1ZBA2 1D4M1 3JBG3 5K0UA 4CDWA 1BMV2 4WM8C 4QPGA 1AYM3 1PO11 4Q4W2 3DPRC 1BBT1 4YVWC 3JD71 5D8AC 3VBUC 1VBB1 4Q4W3 4Y5Z0 3NAPC 1X33A 2HWC1 1AR93 2PLV2 1K5MC 4IV3B 1V9U2 2RS52 1WCDJ 2PLV3 1V9U3 1RUJ1 4GH4B 3ZXAC 2MEV1 1NY72 5C8CB 2R043 4IV1B 1NA1A 1POV3 4AEDB 5C4WB 5A33B 3ZFEB 1ASJ2 1PIV3 1Z7S1 2HWD2 1AUYA 1ASJ3 4YVSC 1VB2A 1C8M2 1COV2 1AR72 1FMD2 2ZZQA 4RFT0 5CFCB 5ACA2 3VBOB 3CJIA 3J8F2 1COV3 4JGZB 1AR73 3VBFA 5ACA3 1HRI1 5FMOS 4Q4Y3 2FZ1A 2X5IC 5K0UB 4CDWB 4NWWA 4QPGB 1RHI1 4PDWA 2RR12 4Q4V2 1RUI1 4RQPC 2RS33 1AR62 2XPJA 4CDQC 1PGW2 4CEWC 1HRV1 1OOPB 2HWE3 2WS92 4FTEA 1TMF1 1VBA2 5L7OC 5ABJA 1RUF3 2WS93 4GMP1 4FTBA 1AL23 1EAH3 1RUH3 3TN92 4RR3B 2HWF1 1R081 4FTSA 5DDJ2 2WZR3 1FPN2 1VRH2 5CFDB 1POV0 1RMU2 2R062 4WM7C 5C9AB 1RUD3 1VAKA 2R063 2WFF1 2TBVA 3VBHA 3VDDB 4Q4X1 5AC92 4CDXA 1PO23 1OHFA 1RUC3 1EV11 1FOD3 4N53C 2BUKA 5AC93 2XBO2 1ZBE1 4GH4A 2GSYA 1RVF2 1RUE1 2R072 1HXS2 1TME1 4PDWB 1VBD1 2XBO3 4AEDA 5C4WA 2R073 2DF7A 1PVC3 1MEC1 2RS11 5FMOL 4GB31 1AR81 1VBC3 2GH8A 3ZFFC 5CFCA 3VBOA 1AYN1 1ND3B 3CJIC 4JGZA 3JBG2 1A6CA 3VBSC 1QJX2 3VBFC 5BNPA 1VBE1 1AYM2 4CDUC 1D4M2 5JZGA 1RUG1 1H8TA 3DPRB 1QJX3 1HQNA 1D4M3 1PO12 4RS5C 2BPA2 1OOPA 2VQ0A 1PO13 3JD72 1VBB2 1F8VA 5J96B 1BBT3 1AR92 4Y4YA 1QJU1 1R1A1 3VBHB 5BNNB 1NCRC 3JD73 2HWC2 1VBB3 1BEV1 4CDXB 1PGL1 1QQP1 1ZBA1 2HWC3 4RR3A 4RHV1 1BMV1 1OPOA 4QPIC 2R042 5CFDA 1MQTA 5C9AA 4N43B 1PIV2 1RUJ3 3S6PA 2MEV3 5A32A 5BNOB 1Z7S2 1DDLA 2PLV1 1ND2C 3VDDA 2RS51 1Z7S3 4Q4Y2 4IV3C 4CEYA 2HWB1 5BNPB 1NY71 2RS32 5JZGB 4CDQB 3ZFGA 1H8TB 1HRI3 4GH4C 1F2NA 1E57A 1RHI2 2HWE2 5C8CC 4IV1C 4AEDC 2HWD1 1RHI3 1RUF2 5FOJB 3ZFEC 1C8M1 1TMF2 2RMU1 1FMD1 1AL22 4JGYA 1R091 1HRV3 1EAH2 1RUH2 3J8F1 1TMF3 1B35B 1ND3A 3VBOC 2WZR2 1IHMA 4GMP3 1M06G 1CD3G 3JB4C 2RR11 1QJY1 4Q4V1 2HWF3 2ZAHA 1R083 1AR61 5K0UC 1RUD2 3DPRA 1C8NA 1MQTB 1PGW1 3JB8A 4CDWC 3M8LA 4QPGC 3VBUA 1VBA1 5A32B 2WFF2 3NAPA 2RM21 1OOPC 2WFF3 1K5MA 1PO22 1RUC2 5BNNA 3TN91 1NG0A 1FOD2 3HAGA
chains in the Genus database with same CATH superfamily
4MGIE 1D7PM 5DDJ1 2BGCA 2I74A 4Q4X3 4RR3C 2A71A 1GZWB 5HCAA 1VP6A 3ECQA 3W5NA 3MV11 2PHTA 3WG4A 3MYXA 4LO8A 3VHOA 2XDVA 4Y4RA 4QQHA 3JXSA 4LEJA 4C0BA 4N43A 2YPJA 1OFSA 1NA1C 1RUE3 1TME3 2AH2A 2UURA 3HT2A 4B3NA 2NP0A 5CU1A 4XOGA 4MGZE 1W6QA 4MX3A 1OQDA 5CBLA 4K21A 1GWLA 1NCQB 5JOWA 2L9LA 2Y8KA 1LGBA 1GNYA 2E7TA 4QQ2A 1FYUA 4KG8A 4GMP0 2JDHA 3PU8A 1LODA 3WDYA 3LDRA 1REFA 1JS9A 5JVVA 1UIKA 4UF0A 4IEUA 5GZDA 4XF3A 1BK0A 2VPVA 4WM8B 4ZXEA 2JDYA 2E32A 2YV8A 4RQPA 1QXPA 3ZPOA 2NLRA 4OUSA 4Y22B 1FX5A 1UZ0A 4FPEA 2I2SA 4DY3A 4CP2A 2BW8A 4PDWC 4OI1A 4LBQD 1N3OA 4JDOA 4DUXA 2VNGA 3KCYA 3LA3A 3B5LB 1SFYA 3HBZA 1LULA 2FCUA 5DUWA 3W20A 1K5MB 3J7HA 4RGKA 2AENA 1HIXA 4QX5A 3JBG1 4EROA 4Q8KA 1NX9A 3DYPA 2W9XA 1QJU3 5A1FA 5IAXA 3GNEA 3I3BA 2WWSA 4W8JA 4L97A 3PUIA 5M0TA 1RUJ2 1VE0A 2MEV2 4FFGA 4LUMA 3WG1A 3KT4A 3Q8AA 5FRAA 3WW2A 3ZKYA 1PVXA 3AZZA 1LU1A 4J25A 5APAA 5DUXA 1ND2B 2VMCA 5LBCA 1ZX5A 2ET7A 5LRRA 4WVVA 5LK7B 4FI9A 4EJRA 2C24A 4IEQA 3RZKA 1MS3A 1Q5OA 4E8CA 2VUAA 1CAVB 3CNAA 4NPMA 2VOXA 5FZ8A 2VMIA 1MVEA 4Y33A 5E1RA 4XBLA 5JMOA 1H2LA 1KFUL 3LE0A 2XL9A 4LQRA 2UY9A 2ZMNA 5SV5A 2Y6HA 1DF0A 1WD4A 1XE0A 1ZZBA 2D5HA 5EYXA 2HWB3 3QH7A 2W1SA 2ZJCA 1QJZA 4AOCA 4Y1VA 4BDVB 1LNSA 4O65A 3DEMA 5KC5A 1QHDA 4XCBA 5FZ7A 2GP3A 3OUIA 5I0SA 5FZ9A 1S55A 4LK6A 1RUI3 2WZ8A 1OVSA 5FMBA 1COV1 2EIEA 1W9FA 2RMU2 2ZGNA 4TLFA 5CG9A 4MZUA 1DU3D 2YROA 3FHAA 4Q5OA 1OXCA 5DG1A 1R093 4FO9A 3OPWA 5E88A 3WCSA 2W1UA 1HDKA 1QXJA 4HKWA 2HWF2 5CKQA 4A2UA 1UCXA 2HEVF 2HJIA 4UOJA 5JSOA 1WLCA 2A6YA 4FFIA 5CEHA 1QXRA 1U0AA 3HNBM 2F4LA 2VOVA 5FK7A 2OKXA 4CUCA 4EE2A 3I8TA 4EV0A 1OI6A 2OIIA 3IDBB 1GQHA 4Q4V3 5B4NA 2RG4A 1YJLA 2DVGA 2QVSB 2AZ5A 4R4XA 1WWYA 5FQ0A 5HCFA 1WLDA 3P1IA 2VQTA 3I2JA 5GJ6A 2CTVA 1C5HA 4FFHA 1LOFA 2FDGA 4N53B 3THPA 2PHXA 4Q4X2 4ZZ5A 3OPTA 2CSGA 5FYVA 3PURA 1B35C 3Q8BA 1UXXX 3VL8A 3FZ3A 2EXIA 1IPKA 3CO2A 3IB3A 1J1TA 2WT2A 1X8MA 2C9KA 2IFRA 3KB5A 3M2MA 2G4IA 4OULA 5GLVA 3RMXA 1DGRA 1ZA7A 3WNNA 3AK0A 1RUE2 1TME2 1VRH3 3B01A 5CFDC 3I49A 4P9JA 4AHZA 5IK4A 4G4FA 1TVGA 4M4RA 5JI9A 3HBKA 1CAUA 5FO9B 3VD3A 1PO21 2UWCA 3UGHA 5DAQA 1RUC1 5I8TA 3IIIA 2GC2A 1D0GA 1UY4A 1YIPA 2RJKA 2BGPA 1UY0A 4AFAA 5AC91 5J3UA 4CZSA 3CJIB 3AM2A 4MOAA 2DU0A 1OH4A 1DGRN 5FZBA 3TEXA 1MEC3 1QU0A 5DUUA 3VLBB 2IXIA 2BQPA 3ZXEA 3MW2A 5I93A 4MXWB 4Y1YA 2IUWA 4UW3A 4FPJA 4CDUB 4E9KA 5I0DA 1IKQA 3SEEA 1KD7A 4DXTA 5HPOA 3V64A 4NIHA 3POWA 5T5PA 2J1VA 2P3YA 2WA3A 1W6MA 3PTYA 3ZFEA 4BQ2A 3I3EA 2VW2A 1H1AA 2OUJA 4H2AA 4COVA 2VZRA 3OGSA 3DECA 1F15A 1UZVA 1US2A 2JD4A 1QJFA 3N35A 4OMDA 4MUVA 2VXRA 5K9YA 5D21A 1NCQC 2JDZA 4K1YA 3VL9A 1O4TA 1LU2A 3E97A 2A3WA 3FWEA 1SMVA 3LDBA 3QD6A 2JG9A 3NV2A 3AKRA 3ES1A 1XOYA 1OA2A 5FMCA 4BIFA 1BMV2 4WM8C 4QPGA 5FOBB 2VMEA 2HLEA 4QU1A 4LXLA 4BK4A 4SLIA 3U11A 3MV01 4NVPA 1L3JA 1V0AA 1US3A 1XPWA 2XVKA 2ZHMA 3ORJA 1OQ1A 3E5UA 3JD71 1DFQA 5L73A 2N7GA 3ZXKA 1JOPA 1VBB1 4YZ1A 4MG2A 4L99A 4FT8A 4NN0A 5FWJA 3FL7A 3OUHA 3N9QA 3O1MA 1QJEA 1G86A 3HQRA 1K5MC 4QD2A 5FZGA 1UU6A 1YYNA 3GZTB 5HCHA 1XYOA 4FPCA 1WCSA 3RYKA 5FZDA 3LCPA 4CXXA 3T4HB 3U10A 4N9HA 2W08A 1ZRRA 2W95A 3Q9OA 3CKHA 5FZLA 4GH4B 3O0WA 3RVHA 4AQSA 4D8MA 1CZSA 3TRSB 1S0DA 2Q4SA 1NY72 3WHTA 2E53A 4IE4A 1JYWA 5C8CB 2Z42A 4IV1B 1C28A 1NA1A 1POV3 1E5HA 2A73B 2QBXA 3I2OA 1V6IA 2FDIA 1UYZA 2DU1A 1PIV3 1WKYA 4E2SA 5IK7A 1LOCA 1KFXL 1AUYA 2WL1A 2W87A 2J1AA 3HNMA 1ASJ3 3OGRA 2IXHA 1COV2 3HVDA 3WF2A 5CFCB 5JXIA 4O61A 2A70A 3BALA 4Z07A 2ZACA 1L7QA 3ZSEA 3I59B 3VBFA 4OUMA 3VZJA 1V6JA 1DZRA 3N7KA 4Y5TA 2Y34A 5FFOC 2YYOA 1DGWX 1VIWB 3M3OA 4QX7A 3OUJA 3IN9A 2Y60A 4NWWA 4XAEA 1RHI1 4PDWA 4AEKA 2ID4A 4Q4V2 1MS0A 5FJKA 5F2WA 5T52A 1V6KA 4CDQC 5E89A 4LBQA 1LOGA 1OOPB 4E27A 3JCIA 2R32A 3ZN5A 4ZKTB 1TMF1 4E4SA 4YW7A 1O7FA 3GCXA 3IPVB 2BEOA 2XONA 2LUWA 3GZEA 4O9GA 3LSEA 3GBFA 2JDNA 1VAVA 1PNFA 2Q8EA 5AVAA 4Q26A 1BYHA 4WVMA 4FAGA 3LIGA 3SEPA 3EJKA 5TSWA 1I3HA 4B7KA 3BCWA 4BQXA 3MW3A 3I7DA 3KM5A 1DQ6A 4WVZA 4B1MA 4CP0A 1VRH2 2A7AA 1POV0 1J3PA 5C9AB 1STMA 3NNLA 4FAHA 1CAXB 2JKBA 3E6DA 4AI8A 4IE6A 4AL9A 2W2IA 3B69A 3HMYA 1DHKB 1RITA 3SITA 4DPNA 1LKNA 4C91A 2IXCA 2HYKA 2LRPA 5FTTC 5FY7A 2DDUA 4PIYA 4E2GA 3TEWA 5LCWL 3RYRA 2A6VA 4P02B 5AC92 2VBDA 1JYXA 4LHLA 4CXYA 1OHFA 1BCXA 4XC9A 2FDKA 1PGL1 2VW0A 5FO7B 4N53C 2BUKA 4I0WB 5FXWA 1PK6C 3USSA 5FYYA 4XJ9A 1XYNA 1YJKA 2WNEA 4MADA 4QHBA 3T4VA 4N90A 2GSYA 5FBZA 4UW5A 4W6XA 1VBD1 4CP9B 1URXA 2Q8DA 2ZHKA 3OBRA 1JYTA 3S7EA 3KHBA 3RNSA 2XMLA 4LHSA 4AVTA 1EPWA 3NO8A 1W6OB 4KU7A 4V2VA 4QQOA 2ZKLA 4PI2A 3N9NA 1SLLA 2RS11 2YGLA 3PIGA 5CVRA 2VOTA 5C8WA 1ZZ8A 1PMJX 2XUMA 4QXKA 2H0VA 3VBOA 1WW7A 3WY6A 4IGQA 4CCJA 5HV0A 4EWEA 1XNCA 3CJIC 1LHWA 4YM3A 1BK1A 1NQJA 2ZEWA 2YFUA 3B94A 4IERA 3V56A 2V4VA 2PQSA 1W8TA 4XDPA 4CDUC 5KR7A 2CGPA 2XJPA 4ATEA 4OHZA 4NHMA 1QJX3 1C3HA 3WUDA 2VM9A 1GP6A 2VMHA 2Y38A 3C7HA 5A7QA 3IT8A 3S5QA 4XFGA 3E5XA 4BA6A 4PI0A 4CRQA 5A3NA 5T55A 4XUQA 1PO13 3JD72 1VBB2 1UZYA 2X10A 2ZCWA 1BBT3 5A3PA 1CX1A 1R1A1 1W0NA 1NCRC 4YW6A 4CUGA 4S2DA 4IW3A 2ZX2A 4JRLA 2JDKA 2OZ6A 4B8EA 4BWOA 3A7QA 1W9SA 1OH3A 1HB2A 1ST8A 1XXNA 2ORZA 3K4ZA 4FQZA 2W1QA 1XNAA 3LFIA 1W0PA 5DPNA 3ZN6B 3ZXLA 3AZVA 1MR5A 1S2BA 1L7LA 3ZKUA 2DUPA 1W6PA 2UYAA 3GM8A 3CBNA 5CFDA 4OMCA 1DQ1A 1Q8SA 5ERLA 5I91A 1W8ZA 1PIV2 3T09A 5F5IA 2G19A 1FI2A 4A42A 4K3UA 1OA4A 5A32A 2WO1A 4AR2A 1JYNA 4OCTA 1UYXA 1LB2A 2KM2A 4YSFA 2Q1MA 4CVUA 2EVXA 3K4DA 4UFMA 4GALA 4FP2A 4PIZA 3VDDA 4DXSA 3UETA 3MHZA 3IDCB 4YNIA 2YHJA 1V6LA 3OTFA 2GC3A 2EIDA 3PUSA 4FVVA 3I2HA 2E9QA 3MZHA 3ZR6A 4YM0A 4AGVA 4BISA 1GZWA 2G9FA 5BNPB 4FBFA 1IKPA 1YI7A 4LE3A 1QMJA 5A6YA 2VE1A 1H8TB 1N3PA 1OUXA 3EO6A 3M1HA 1F2NA 4GH4C 1RHI2 4M0NA 4AWDA 4EN9B 3LKJA 1X9PA 1UD1A 2IXKA 3M70A 3T0DA 4FFFA 5C8CC 4IV1C 4IGOA 2WN2A 5F6LB 1TQ5A 1JYCA 4DFSA 1APNA 5D1IA 1W2OA 1C8M1 1TMF2 2DFBA 2W91A 2B9VA 1LHNA 5HXVA 1YWKA 1H2MA 1JN2P 3AMNA 3J8F1 2K0GA 4NIIA 2ZAAA 2ZX0A 4N7UA 1Y3TA 2QQWA 1I5ZA 4B7EA 4H7LA 2ARBA 3RZJA 3O0VA 4NRQA 3CL1A 1U12A 3ETQA 1DYKA 5ANQA 5FLHA 4L11A 1N1TA 2VOKA 2WSVA 1G9CA 4K40A 1QJY1 1O4ZA 2ZAHA 1R083 4Y22A 1XC6A 2RJ2A 2Q5TA 3JB8A 2HH9A 5DABA 4AQ6A 2VZSA 3GGLA 1EUUA 2QDNA 1VBA1 3OEAA 1UO9A 1W2AX 2VTXA 1TZOA 1H4GA 2XOMA 3CMGA 3Q8CA 4H7MA 4AVAA 4GWIA 1OOPC 1CZVA 3NV3A 4HPKB 4DMIA 5AFBA 1QH6A 3DL3A 4NHYA 4XFFA 2QJVA 4F3JA 5IW0A 5FXVA 1AF9A 2WNVC 1K5MA 2BBAA 3ACIA 4UW4A 5BNNA 4MV2A 4NO4A 2A3XA 3AVRA 1F5JA 1TEIA 3OGJA 1ACCA 4AF9A 1GYKA 4M3CB 2ADEA 2WC2A 3WOGA 3T1LA 4CEYB 5J09A 3Q8FA 1WBFA 1XE8A 2PMWB 2VZUA 5LATA 1P8JA 2DWRA 3A4UA 3N9MA 2BBVA 1GQGA 1EV13 3AJZA 1LOEA 3UKVA 2HBTA 3LGRA 4Y1UA 3ZFGB 5I8YA 4HVOA 4QQPA 1AVBA 4DEVA 2FCVA 5C9AC 5H9PA 3O1TA 3G7DA 4AI3A 3NJZA 4LJHA 3NJYA 2EIBA 4OHVA 4CUBA 1UY2A 5GLZA 4LA2A 1JHJA 2EICA 2R1BA 5FP4A 2PHFA 4JGYB 5BNOA 1ZM1A 1LENA 2AGSA 2CGNA 1W99A 2H6BA 5LW9A 3PIJA 3VBSB 2CU5A 3LEKA 1CAVA 4LITA 3H42B 4JTNA 4J6GA 1IQDC 3O1SA 1RVF1 1AYN3 1HXS1 2BNOA 2P6CA 4C8DA 1A34A 4EN6B 4OQ8A 1UQXA 2OT7A 3INAA 1CAWB 2WT1A 3A22A 4FXGB 2QCSB 4RS5B 4CDQA 4YM1A 3SKVA 4YVWB 4P00B 5J1XA 3VD5A 2TUNA 1W8NA 1RUG3 4BYYA 5A3LA 4FOWA 2E31A 2GMEA 2V72A 4MGQA 1G9BA 1BBT2 2QKDA 4GXLA 3MFAA 4NHKA 1BKZA 2G9GA 2GC1A 3H7JA 4N7IA 4MYEA 5FXZA 4B4PA 5DMYA 2EXJA 5ABJC 1YIFA 4XHXA 1R1A2 3IMNA 4RN5A 4YLZA 3I3QA 1WW5A 2OPWA 4YW1A 2VAUA 2WO7A 4Y20A 4UWDA 4C90A 1WUVA 1MZEA 5FDBA 4P5YA 4XE9A 1UY3A 5DAPA 5FZHA 1QQP3 3HJRA 3WNKA 4BZ4A 2W46A 4RYDA 5C3OA 5LEJA 3AKTA 3K77A 1IOAA 5LA1A 3GF6A 4PCRA 1ZREA 5IK5A 3S7IA 1U5ZA 4YZ4A 4YVSB 2ZZJA 3RZLA 3J7NA 1MZ5A 1MPXA 1F4AA 3E5QA 2Y26A 1JZ7A 3ZDVA 1YRZA 2QNKA 2VMDA 1V9U1 2BOIA 3EMRA 3C2UA 3ME2A 4N53A 4XQWA 4D7YA 4CU7A 2VOWA 4JRAA 3ELNA 2BNMA 2EA7A 3L9JT 1PK6A 4W4ZA 4DINB 4EQVA 2MPFA 2QQOA 4CDXC 2LM3A 5GALA 2MHFA 2R041 2WNUB 3VBRA 4LA3A 1SZBA 2K9ZA 1K5JA 4AI1A 4JTOA 2RHPA 3WCRA 3WT3A 5JR7B 1DYOA 3T2QA 1NE6A 4FOQA 4GA9A 1JYIA 2BFUS 1RJ7A 3ES4A 4NE9A 1GFF2 1HX6A 4BK5A 5EYYA 4XETA 1BJQA 1CQ9A 3VHNA 4QHZA 1YLLA 3ZXDA 3USUA 2CGOA 3ZM8A 5ACA1 1C5IA 2QQLA 4FOYA 4KL1A 4Q4Y1 1FNZA 2RMU3 4IL7A 4UBGA 2HYXA 4JKMA 1H9PA 5FPZA 3OY8B 4CP1A 2DBIA 4HONA 4I30A 4CDUA 2IWGB 2VNVA 2ZBJA 1R082 1G8WA 4JKKA 4DNYA 3V65A 4Q8LA 5KXBA 1WW6A 4IUGA 5BNPC 1QJY2 2HWE1 1A3KA 4PT6A 3ACFA 3AP6A 4HETA 1H8TC 1U5XA 4XTPA 3EXUA 2DCJA 2RR13 5D8AA 2WS91 4EZ4A 2XL7A 5JIAA 3U75A 5BY5A 1AL21 3S30A 1UF2C 1VLNA 1EAH1 1DP0A 2NMOA 1NCRA 5EWSA 2D6NA 5FO8B 3GYDA 1Q8OA 5GZEA 5BUVA 1ULCA 4XILA 5CZKA 1HV1A 4HT1T 2VVDA 3LEMA 4LPLA 1JZ4A 3U14A 1W3XA 2WZR1 4Y24A 4A6OA 1O3RA 4GULA 2DCYA 3H8UA 1EV12 5CG8A 3TN93 3U0ZA 1H1IA 4Q29A 1RUD1 2GNMA 1OC1A 3GHNA 1DGWA 2R061 3WF1A 4AQ2A 1O3SA 1UMZA 3LSDA 5DDJ3 1XJAA 5EHDA 1X82A 3O1PA 3T1MA 3P3NA 2DCTA 3DKWA 4HG6B 4CCOA 2DVBA 4D7TA 1G6NA 3KQRA 5FBJA 1W9TA 3BYWA 3EHKA 4OI0A 4AQTA 1XU1A 3ZYBA 5A3MA 4ONUA 1FOD1 3HQUA 3UKNA 1OMIA 3PUHA 5HV4A 1NXMA 3S57A 3ILFA 2PQQA 4COYA 2VW1A 5A3TA 2ZEZA 4YWAA 3JQXA 1AYN2 4K1ZA 4HSJA 2XBO1 2G1MA 3WW1A 5FP7A 4B29A 4E8DA 3POSA 2R071 4QT6A 4CEYC 4KI5M 5A70A 2EXKA 1ODMA 3BIEA 2RDSA 5C8CA 4IV1A 1I1EA 3WEZA 1RUG2 2LTNA 5A7PA 1A8MA 1JUHA 3ZFGC 1O4YA 1PVC1 4IEXA 1H9WA 1PZ8A 4ASMB 4FSJA 1YQ5A 5BPXA 1VBC1 1S1AA 2DVDA 2BV4A 2GH2A 3NRUA 2VY0A 1QGLA 4XCAA 1S2KA 3KLSA 5F32A 3BIWE 4FPKA 3ZYIB 5C3PA 4JGYC 3AJYA 2CDOA 2DCKA 2XVGA 3ENRA 2ARAA 4M0HA 1ULOA 3MEPA 5FPVA 4CCCA 4QX0A 4SBVA 3I59A 1AXKA 5LBFA 4CDXB 1VB4A 4QPIB 5EJZB 1QQP2 2YZ4A 4CPBA 5JPMB 4DXZA 3JBG3 1LEMA 3APBA 4IEOA 2DUQA 2VR4A 3H8OA 1WCKA 2QQJA 4LT5A 2BTVC 2FQPA 4CCDA 2Y6JA 4L0PA 4NIGA 3ACHA 5FIXA 4AFCA 4A44A 1O3TA 1ENXA 4YVWC 3WF4A 4UFJA 3KV9A 2WBKA 3POFA 1SDWA 4GWMA 2WNVA 3IPVA 4Y5Z0 2ILMA 3DYMA 4K9SA 4P9GA 3SH4A 2ZABA 3E6BA 3N3HA 3OD0A 2JG8B 2XHNA 1KRIA 3H8XA 1H6XA 1JZ3A 2WABA 4BXSV 2YC2A 4INDA 3B3QE 1UX6A 2PLV2 3J26N 3WX5A 4IV3B 1V9U2 3RJ2X 3PMEA 2BRTA 1WCDJ 2JKXA 3U4XA 3J7LA 2GMPA 1GNZA 2JDUA 3CEWA 2YBKA 4B1LA 3EYPA 3PVEA 1PM4A 3CQOA 5A7WB 4NIAA 5C3QA 2XUEA 3MW4A 5EZWA 1OQEA 4QGLA 2EAKA 5IJRA 3ZXAC 3T0BA 2XJSA 4LBJA 2E7QA 3H3ZA 4AW7A 1AZDA 4AEDB 1MS8A 5A3WA 5C4WB 2A3YA 2YFZA 5A33B 3MICA 4META 2AR6A 4AYUA 1UNBA 1VMHA 4R8HA 2RDNA 2ZMKA 4MVTA 3TYJA 3I2DA 3LZZA 4IXLA 4YVSC 2BERA 2WJSA 5A80A 2X05A 3AB0A 4Y5SA 5JIUA 5ACA2 2QQMA 2FBEA 1XE7A 2B46X 1J3RA 5K8SA 4XIOA 5F5AA 1COV3 4JGZB 4QGNA 3I3DA 3N7LA 2YU2A 3P3PA 1OF4A 1HRI1 2XLFA 1HQWA 1M4WA 4AG4A 3UK9A 1TNFA 3I2IA 1O5LA 2BDRA 2DURA 3GJAA 4YW3A 2WNUC 4YW5A 2GNTA 3WXPA 1NT0A 5GZGA 1DCSA 1WBLA 2RR12 1RUI1 3FLPA 3OJBA 5FREA 1I6XA 4OHWA 3MUY1 3H1WA 2XPJA 1NZCA 4UYBA 3NV1A 2Q1FA 2J1TA 1HRV1 4CU6A 1SLAA 2WS92 5AVPA 2ZGQA 4FTEA 3PMSA 5FYSA 5ABJA 5GZCA 4WZFA 2VL4A 2B42B 2GAUA 3PVNA 1X50A 5CKNA 4RA0A 2GP5A 4HSLA 3D5OA 1KQRA 3WDVA 3TN92 1GNHA 5F2SA 4DQAA 2V09A 4AVSA 1NZIA 4FTSA 1PHMA 5ANNA 4BH9A 5FAXA 4XF1A 5JOZA 1N1SA 5FZKA 5DDJ2 4TN7A 3KF3A 1GWMA 5C3SA 1J1LA 3IKWA 4FP3A 2R062 5EJ1B 3MI8A 4QMAA 2GMMA 3O12A 3N36A 2OPKA 3GDBA 3D82A 1QF3A 1N3QA 3QACA 3WR0A 1TE1B 2D3RA 2VNOA 4QHOA 4ISRA 3H50A 1RJ8A 2UWAA 3I4IA 5DZGA 3VB9A 1IG0A 4RD7A 4HK8A 5JSPA 3AFKA 3M7AA 5FZ4A 4CDXA 4NIDA 1PO23 2J22A 2WR9A 4IGPA 1RUC3 2VZPA 5FYUA 4Y26A 3UESA 3VKOA 4H55A 5IVFA 5AC93 2XBO2 1ZBE1 4DXRA 3WQ0A 5EJ3A 4P9XA 2YDEA 1GZCA 3U07A 2R072 2QDRA 2OXBA 2WA4A 5GLWA 3WNMA 1K45A 3F2ZA 1UOBA 3UYJA 1V6MA 4RSUA 3UJOA 1BHGA 1BXHA 1KS4A 1CJPA 2E7AA 1VMFA 4FPGA 3TNQA 1O5UA 3BPZA 2QZ2A 3AKPA 3KT1A 4OQ9A 5JWPA 4QGMA 1MEC1 2ZGPA 3H3UA 4QWNA 4GB31 2OX0A 1AR81 4NAMA 4KG0A 2ES3A 3ZYJB 2EAAA 3W5MA 1RUNA 4EZHA 1ND3B 3PDQA 5JR2A 4YG6A 1SBEA 3U37A 3JBG2 2VMFA 1A6CA 1QNWA 1Y43B 2D93A 5A3UA 4CYDA 4N8MA 1VBE1 1W6NB 1YCIA 5BNPA 1GR3A 1Y9MA 2W68A 5CNAA 4M01A 4UBHA 1CPMA 1H8TA 2D5FA 3DPRB 1JZ5A 3MLJA 4OFGA 5T54A 1NUKA 1UXZA 4FCAA 1GBGA 1ZZ9A 2R49A 3LQCA 3MO4A 3EQEA 4HVQA 2CHHA 1GICA 4R9AA 5J96B 5E6HA 1OF3A 3WLUA 3X29B 1D2QA 3KMHA 3JD73 3HNYM 1VBB3 2CY6A 1XQNA 3NNJA 4AK3A 1BEV1 2PHLA 3SXWA 3WINE 3I2KA 4YGDA 2LW8A 1ZBA1 3DUIA 3NNFA 1SBDA 1QNYA 2XJVA 3N9PA 3AL5A 4MXVA 4RHV1 4RR3A 4ZS2A 3WDXA 3HPNA 1S0FA 2FMYA 2JDPA 4QPIC 1HQLA 1S0CA 3LAGA 1JH5A 5IFTA 2KD7A 4NR1A 3TOJA 3UGFA 1H2NA 4P14A 1OFNA 1SG3A 4PLNA 5DAWA 2D7FA 4D6SA 1LESA 1SDDB 4N43B 2Z5WA 4AVCA 4DY5A 1JBCA 2ADDA 3BTAA 2MNGA 3S6PA 4AAXA 2W52A 1RUOA 5EPAA 5FK8A 3SC7X 4QX2A 1XNKA 4XXAA 4QXBA 1SFPA 5JOXA 5LBEA 1ONAA 1LGCA 4Z8BA 4TZDA 1KDMA 3POJA 3WQ1A 1ND2C 4TYSA 3CLPA 4EWDA 2FDJA 2RS51 4AVBA 2JG8C 1E5IA 1CIWA 3RZZA 3R4DB 4UF0B 1W04A 4ZY9A 5EXOA 4IV3C 2YBPA 2VCAA 4HK9A 1GV9A 4P9LA 4CEYA 3UNPA 3BUCA 5IVEA 5I8SA 1E5RA 1OLMA 5FZEA 5K4LA 3ZFGA 3FBYA 2GN7A 3NVCA 1SBFA 3AKQA 3DCQA 3TB0A 4BE3A 3B00A 4IEYA 4R4ZA 4LE4A 4AEDC 2HWD1 1RHI3 3DF0A 4F7ZA 1HB4A 1LHVA 2BNNA 2VD7A 2CWMA 4RFRB 1FMD1 3D3AA 4JGYA 4ZZ8A 2C9AA 2K46A 2WWUA 3ZSJA 3BN6A 1D2SA 3C7GA 3WF3A 1TMF3 4D0QA 4XJWA 2WZPP 4TTGA 1JZ8A 5L9BA 1HB1A 2F6BA 1PX4A 3HOBA 3UKTA 4HL0A 1XSQA 3FJSA 3E6CC 1CD3G 1D0HA 3A0KA 1CAWA 1DQ0A 3H7YA 4UXAA 1AR61 2NN8A 3OBZA 4KWLA 4YGEA 1KEXA 1PGW1 1FATA 3LB9A 1JTZX 4Y1ZA 3A21A 3OGVA 2D3PA 2PHDA 5DUVA 3W58A 3VD4A 2RM21 4W50A 5JAXA 3LF7A 4P9WA 3IM0A 2WNOA 3GZAA 1RC6A 1G9AA 1PO22 1W8FA 4IEVA 4NMIA 1RUC2 3VKNA 4EYUA 1NG0A 5FZOA 1MS5A 1YFUA 2B8MA 2JDMA 2IVIB 2CAVA 3HEIA 3HD8B 3OOXA 3OEBA 5DXDA 3SH5A 4A3XA 4C1XA 5LBBA 1GU3A 1W2NA 3IMMA 2W92A 1FPN1 4LKEA 4QDQA 4WVWA 2WIIB 5J37A 1KDKA 1XNTA 1RMU1 2ZGOA 3GXUA 2CAUA 1ZBE2 3KGLA 2ZEYA 1UL9A 2D6PA 2AC1A 3PUAA 4G3YC 4GWNA 4M4PA 4XBQA 4ARXA 4O7XA 3FX3A 1S0EA 5C71A 1ZYBA 2AEZA 4Y1XA 4FPFA 3KD4A 4D3WA 1SLIA 3EBRA 3AYCA 1VBD3 5DAXA 4YVSA 2FHRA 2ZGKA 2JE7A 2OQ6A 3ALQA 4AEJA 4XPVA 4GB32 1AR82 3V0BB 1JI6A 3N7JA 4Z82A 1JOBA 1Y7BA 3LIHA 2GC0A 2NQYA 3WW3A 1UKGA 2F17A 2RS13 5LWBA 5FJHA 4BPZA 1W90A 4LOSA 4AGGA 1LOBA 2OUHA 1RB8G 2WNUA 3VZOA 1YUDA 1E5SA 1YEWA 2ORXA 2NYYA 3RYPA 2V4AA 3AMMA 5FCCA 3AFGA 4MHRA 4NWVA 4Q1RA 2B7YA 3NSTA 1YQ8A 3ZMNA 1HKDA 2IZWA 2WSUA 5A7NA 2W47A 4NRMA 1OT5A 3AMPA 3JQWA 1LJ7A 4LO7A 3VBUB 1OPMA 2DYCA 3ACLA 3BI3A 2HBUA 2IVJA 1DYPA 4QPWA 4QX8A 3AXEA 3T30A 3GBWA 3N4MA 4ZU4A 4LUKA 3LEIA 2BYVE 4UFHA 2GNBA 4YW4A 3WQBA 2XJUA 3E1F1 1LEDA 1B35A 3RJRA 4EN7B 2ARXA 2VZ1A 3V0AA 1R1A3 5GKAC 1AYM1 4BQWA 4RHV2 1OD5A 3RI8A 2O8OA 2XHKA 2Q8CA 5C70A 1OLRA 1K42A 4GQ7A 5C5TA 3SISA 4Z92B 4Q4W1 4L9BA 3KT7A 3MLLA 4JVAA 2Y6LA 2WINB 1LAJA 3KWVA 3NQHA 3ZXGA 2DCZA 4HN0A 1MS4A 1CAUB 2I07B 5IVBA 1AR91 3KCCA 2W0XA 4LBMA 5ISLA 1ULFA 5IHRA 1AXZA 4ZU5A 3NMBA 4NHLA 2D97A 1H30A 2VH9A 4B4RA 3SHRA 2J1RA 2PTMA 1QEXA 2WYSA 4P08A 1S0JA 1ZRCA 5IVYA 5KHGA 2X5IB 5A1LA 2LS6A 3K2OA 2BJSA 5JMCA 1UIJA 5H9QA 3WDWA 1AX1A 2P1BA 4CEWB 3HQXA 5FZ3A 2JB4A 2UU8A 2KA3A 3AVSA 5L7OB 4N43C 4Q0UA 2VQAA 3LD8A 3MF9A 1O91A 3QH6A 4QB2A 5FY1A 2XLAA 4TXWA 5IFPA 1JXNA 3CJXA 3HR9A 5DZEA 1AR71 1NCQA 1LHOA 5KBFA 3VN4A 2CNAA 1AL0G 1VJ2A 1C8M3 1QY4A 2OQ7A 4I09A 4BQ5A 3KGZA 3ZYRA 5CFCC 2J1SA 4MO3M 3OYWB 3J8F3 4JQRA 1N1VA 3VHPA 2RS31 3WV6A 3JUUA 4WM8A 5C5UA 4WM7B 2VG9A 1ENSA 4QXCA 4QB6A 3NKGA 1F4HA 1IGOA 2YUEA 3MGUA 4AI2A 1ULPA 3TEYA 1DLCA 1LGNA 3DXUA 4GIQA 3NJVA 1RUF1 1QJY3 2Q0AA 1GOFA 3ABZA 4UI9L 5LRSA 5C6CA 3OB8A 2ET1A 4C1WA 1R1ZA 2RM22 3FMGA 5A6XA 1UZWA 1Q56A 1RUH1 3FC0A 1VBA3 2A75A 4GJYA 4LBLA 1V70A 1HB3A 1IS5A 3HWJA 5FWEA 5FY8A 2WLPA 3H0OA 5DG2A 3ZVXA 3B7MA 3EB7A 4YW2A 1ALYA 4QPIA 5F9TA 1RGSA 2JEMA 3NWKA 1X9TA 4LHNA 5KWRA 1LECA 5F39A 1GZ9A 1VAMA 4LBKA 3DN7A 1OVPA 5I0TA 3THDA 1NA1B 2PAKA 3THCA 1VBD2 1Y9GA 3PTRB 3SCHA 2FDHA 3I54A 3SKJE 1NXD1 5CIRA 4BLJA 3CIHA 1ND2A 1LTEA 2A6ZA 4LTAA 2X09A 1TNRA 3CU7A 4LLFA 3WG2A 3ZFFB 2JG8A 3VUOA 1WZXA 2Z79A 1HJGA 1NLSA 2BU9A 2RS12 2VCMA 4HMZA 2E33A 4YFWA 2VBBA 3BGAA 2VBPA 1GZTA 4IV3A 4PLOA 3FHQA 4JZRA 4A3ZA 3VBFB 4XW3A 2ZGTA 4BQ3A 2BFUL 2C4XA 5GLUA 2RE9A 1J84A 2JX9A 1XU2A 4XXPA 1T6GC 1BZWA 5J98B 2JIGA 4XACA 4BLIA 4LBNA 3GCWA 1RVF3 2Z2SB 1HXS3 5A33A 5EP9A 3WDTA 2VC9A 4UAPA 3Q8EA 3BB6A 1YFXA 3QBQA 1WLWA 5B4XA 4PQQA 4LIUA 3WF0A 3QOPA 4LLOA 1RXGA 4XABA 3T2PA 3SH3A 4HFSA 2RV9A 4QAWA 3M3EA 2PAEA 3O14A 4ATFA 1S0GA 4UT5A 2WQ4A 3TNPB 3O1RA 1UZZA 1PGL2 3WDUA 1D4M1 1FXZA 1VMJA 4I02A 4Q0PA 4I2OA 4QKFA 4XVHA 3WP6A 2KR2A 3KV5A 2GNDA 4XMAA 4XUTA 1H4HA 4Q4W2 4XZUG 4Z2AA 3R05A 2P3KA 1DQ2A 5IWFA 3PL0A 1ULGA 5I0UA 2XWBB 2YGMA 5L9RA 2E6VA 3NV4A 3VBUC 4AGRA 4COZA 3N9LA 2VQUA 3KVAA 3IZOA 4XFIA 3K75B 4RGGA 4Q2FA 5FUIA 2HWC1 3ZDSA 5JUVA 2RVAA 3KS7A 4PHZA 3MUZ1 1OSGA 4NPLA 1OKQA 4ORFA 4OHYA 3AP9A 1RIRA 4BMBA 2PHUA 4H3WA 2B4KA 1OUSA 2XR4A 2XVLA 4KBZA 2PLV3 2VU9A 1V9U3 1ZRIA 1H8VA 3ZSLA 3QCWA 3BKZA 1RUJ1 2DVAA 2CYFA 3PJQA 4CXWA 2MEV1 5A7SA 5HXMA 1Q8PA 2VUJA 3B9IA 5KHJA 2HKXA 2R043 2TEPA 2ZMLA 2VTFA 2YMZA 3AZXA 3U4SA 3ZYGA 4MHUA 2EF6A 4URAA 5CAZA 1PM7A 4QDRA 5LA9A 1F5FA 2HEYF 1F35A 2KXLA 2P17A 2OYZA 4CA9A 4YYOA 5HI0A 1Z7S1 1GANA 5JI7A 1U5IA 1CVNA 2WKKA 2PYTA 1C8M2 5KHHA 2RJLA 1AR72 5E16A 5T5OA 3VBOB 4BQ4A 3CJIA 2VVFA 3J8F2 3O1UA 4FQ4A 4QX1A 1JW6A 1SFNA 2W3JA 4XDQA 2WZEA 4CCKA 5ACA3 1PZ7A 5FMOS 4XFHA 4Q4Y3 1GQPA 4MXWA 5GM0A 2FZ1A 3POIA 4UFLA 2VZ3A 2X5IC 5K0UB 4CDWB 1UYYA 2D6OX 2BP6A 2VZOA 1ZRFA 5H9RA 5JPNB 3R4UA 2WRAA 4X8PA 1HW5A 2VJXA 2SBAA 4XJ8A 3C7FA 4S2FA 4CEWC 1W06A 2HWE3 2XXZA 1ZRDA 1VBA2 4A7ZA 5KXEA 5L7OC 1ENRA 2VZVA 2QQKA 3POYA 1OBNA 2QQIA 2WS93 4QB1A 4GMP1 4IQPA 3ZSMA 4AHXA 5JLVA 4LK7A 1AL23 1AXYA 2J42A 1EAH3 2A6WA 2QUOA 2XKOA 4JHTA 1N1YA 2JICA 3BODA 1QOTA 4XF9A 4JQTA 3WQ7A 2HWF1 4XEZA 5A1AA 2WQZC 4NPRA 2DFCA 1W6NA 5F3IA 5LK5A 4KU8A 1REDA 2WZR3 2Y6FA 3POGA 4PBOA 4E4HA 4BMEA 1W2UA 5CFDB 2C0ZA 4WM7C 4E2QA 1W0OA 3LA7A 1S0IA 1JMUB 2VECA 4KMQA 1RUD3 3P5BA 1KGYA 3C7OA 1VAKA 2R063 5BYNA 2WFF1 5I0RA 3VZKA 5KXDA 5LA0A 4E4ZA 4URTA 1GP4A 4AAPA 4Q0VA 2DV9A 2AACA 5F6KA 4KQ7A 1UX7A 2TBVA 4FPLA 3K3NA 4PF1A 3ST7A 3VDDB 1SCSA 4Q4X1 2Q1ZB 1HN1A 2JXAA 3THTA 1FOD3 4ZXKA 3BTYA 4QM9A 3AYAA 3C7EA 3M4FA 5FYHA 5KXCA 3DGTA 3WP5A 1SACA 4GH4A 1RVF2 1RUE1 1HXS2 1TME1 3OCPA 4CP9A 4WV8A 5J48A 2XBO3 1S2EA 2I45A 3S0MA 3RSJA 2Z69A 1DLLA 1W8OA 4I3PA 4YRDA 2R073 4DIQA 2YPDA 4ZU7A 3ILRA 3ZLIA 3VGIA 5BNQA 1UU4A 1FAYA 4LORA 3ZYFA 1PVC3 5DZFA 1J83A 3NNGA 1ZVFA 4MGKE 2ARCA 1VBC3 2GH8A 2YXSA 3ZFFC 1OKOA 5CFCA 2O0OA 3WP4A 1FNYA 4YPJA 2E26A 3T08A 1QDCA 1DZQA 2P3IA 3ILNA 3R0RA 4PQ9A 3VBSC 1BVVA 3VBFC 3U1XA 3SMHA 3FE5A 4QM8A 2Q8OA 4MSVA 3U78A 1D4M2 4YZ3A 2WLQA 4ASLA 4DEQA 4LKDA 4P5HA 1GOGA 4BQYA 3WNOA 3TAYA 3ZOIA 5KHKA 2JB8A 4XYXA 4RS5C 4HLTA 4UFKA 2BPA2 1OOPA 2VQ0A 4XUNA 2Q30A 3T0AA 3VDCA 3AXDA 3A0NA 3VKLA 3MIFA 4IE7A 3MIGA 1F8VA 2EXHA 2OS2A 4J1XA 4Y4YA 1QJU1 1EPZA 3VBHB 4HBNA 5BNNB 2HWC2 2D6KA 2FCTA 3AYEA 4GD4A 3VD7A 3PNAA 3ZIXA 1UOFA 1XNDA 2C26A 4R9DA 4MGTA 2JE8A 2V73A 3FLRA 1OPOA 1PMHX 1BMV1 2FMDA 5IVVA 3J9SA 4MLOA 5LZ6A 2R042 5C7GA 3OG2A 4OVEA 4YZ2A 4L92A 5C9AA 3FUOA 4A41A 2P4EA 2EALA 1J58A 1CAXA 3JZVA 1LR5A 2Y64A 4P9YA 1HLCA 1YC61 2P2KA 1GWKA 1C1FA 2W94A 2WWJA 4Q27A 4Q0SA 1WMFA 5HBAA 2NMNA 2W5FA 4OLLA 4BJ0A 4R9CA 1Z7S2 3KVBA 3BPSA 5BNOB 5FPXA 2D43A 2G9ZA 2XG3A 1SEFA 1WW4A 4JAAA 3UT0A 2WDBA 4K8RB 3B9CA 1JYVA 2IXLA 4BQ1A 1ENQA 1YFWA 2QE3A 3RQ0A 3IAQA 1FV2A 4NJ4A 3A23A 4Q4Y2 4XJAA 1XSRA 2QQVA 4XHBA 1B09A 2QQUA 2HWB1 3RWNA 4CTEA 4M00A 4IETA 4QKBA 1FT9A 2AREA 1NKGA 1IS6A 1NY71 2D6LX 3LEGA 5FPLA 5JZGB 1Y4WA 3FHIB 4CE8A 1HRI3 4CDQB 1UKRA 3G6JB 3I3MA 2HWE2 3ZXFA 2ZXQA 3O1OA 4HOOA 1O8SA 1PGSA 4YZ5A 4CU9A 5IAVA 3H8RA 2P3JA 1OD3A 2A1XA 1W6OA 4HKOA 4JKLA 4ISQA 2VO5A 1AL22 2JWPA 4FPHA 1R091 2JIJA 4NOTA 1ULDA 1EAH2 1HRV3 3J7MA 2VCBA 4RL7A 3GZUC 5FYBA 5FXXA 3CZUA 4NAOA 3RRDA 2VZTA 3V0BA 4PBPA 3M3IA 2P6HA 3VKFC 2VZQA 3OD4A 4ARYA 3S5AA 4QPYA 4Y20B 2D40A 3VBOC 5EV7A 3WZ1A 1UAIA 2WZR2 1IHMA 2XB6C 5FZFA 4XTMA 3BOWA 1M06G 2QQNA 3GALA 4LO5B 4OI2A 3JB4C 4Q4V1 3ZX7A 2WAOA 1U5YA 3DYOA 3FLTA 5K0UC 1RUD2 1ODNA 1ZZ7A 3AMQA 1MQTB 4JX0A 4XJUA 4CDWC 1H2KA 5IVJA 1YI9A 3VBUA 3AZYA 1S0BA 4KBBA 1CIYA 1UMIA 2WFF2 1C1LA 4MGSA 1AX0A 5G05L 4AE2A 3D0JA 2R6QA 2B39A 4XBNA 2YB7A 2ETEA 2FD8A 4V1PA 4H14A 4ET7A 1HJFA 1FOD2 3VKMA 4TWTA 2ERFA 4BB3A 2VUDA 5A6ZA 1PK6B 1OURA 5FYMA 3VV1A 1DGLA 1W05A 3SQOA 5T3NA 3VBRB 3ZN6A 3O7OA 2FDFA 3HIFA 1C57A 1VRH1 3CDZB 4AFDA 3RZHA 2UYBA 2E51A 1VPHA 4XFBA 4XQDA 3RFRA 3DV8A 4LULA 3FUQA 4KGQA 4D94A 1ZBE3 2V5DA 4XFAA 1G9FA 1NOVA 4UW6A 2O1QA 3TWIA 1PX3A 3VHRA 1PVC2 3MIDA 4GZ9A 3ZYHA 4DS0A 1VBC2 1SPPB 1H1MA 2V5YA 2A5ZA 4BCUA 4I01A 4YFZA 4PF5A 3USUB 2C6SA 5LEKA 4HVRA 2NZ9A 4Q1PA 1Q43A 1DQ4A 3O0XA 3VDDC 3MDPA 4GB33 1AR83 1LHUA 2X5IA 4GWJA 3VD9A 4A4AA 1GUIA 5D2AA 4K7JA 4XUOA 3OBAA 1W8HA 2H0BA 3QLQA 5FKBA 1JOJA 2PN5A 5C33A 1KJRA 4KWUA 4CEWA 1VBE3 1XBFA 2PXJA 4QKDA 5D8AB 5FPAA 1YQ2A 4QKNA 3W21A 5L7OA 2DTYA 4OZXA 1WMDA 3KQ4B 1MVQA 1CGPA 3NAPB 4V2WA 2LROA 1NCRB 1MACA 1Q3EA 4XIKA 2ZX4A 3FFZA 4IEZA 5LASA 1PNGA 3H1YA 5EFUA 2FZ2A 4XFCA 2OVUA 1REEA 4CCEA 4CSWA 1QJU2 1UWWA 4AI9A 5L9VA 2X29A 4JV4A 5GZFA 2BOJA 2ZTNA 2PAMA 1UOGA 3OPZA 3OYWA 4OI4A 2B5HA 4G9SB 2CV6A 1CJDA 4ZONA 4AZZA 1BEV3 1WCUA 3CF6E 1HN0A 3IDEA 4WM7A 4KNCA 2J7MA 4XDOA 3TBDA 1X7NA 1ZBA3 2LALA 3FBMA 4IEPA 3T2OA 1GKBA 3BOPA 3GJBA 2W1WA 4RHV3 5IATA 2YU1A 4A6SA 1YO8A 2J1EA 1XRUA 4YG3A 3AYDA 4LKFA 2Z4FA 4A7YA 5F3CA 1H6YA 5IYYA 1W6QB 1IZ3A 4HPKA 1XNBA 5FYZA 2DTWA 1G9DA 1UOJA 4YARA 5CADA 1EP0A 3VBHC 5BNNC 4HZFA 4I3GA 1WLTA 5B2GB 5FYTA 2PA7A 5C3RA 1CPNA 3L2YA 3UV9A 4M3CA 2ZS6B 1JU4A 2RS53 5FP8A 1JZ6A 1POV1 1IPJA 1HRI2 1Q8VA 2HWB2 3RDIA 5FYCA 4RQPB 1QDOA 4DUVA 4I0BA 4BU2A 4K20A 3VZMA 3KCXA 2YC0A 1PIV1 3MFCA 1Z78A 1T6BX 1A8DA 2PFWA 1RUI2 2RDQA 5F3GA 3BTXA 1ASJ1 4KWKA 5FZ6A 3SCGA 1KXGA 1PZ9A 1HRV2 1Q8QA 5C4WC 3LOBA 3URFA 3WSOA 1QIQA 3LPFA 3ZFFA 2YBSA 3C8XA 1QKQA 3WNXA 4AEMA 4BIOA 1R092 2ZGRA 2HWD3 3BVCA 5BNOC 1PMIA 1ULEA 4QX3A 3B93A 2SLIA 1FMD3 3VBSA 1SLTA 3KV4A 1W39A 5IK8A 2ZPXA 4HKLA 5JXGA 3M3CA 2YC4A 4JGZC 4X6RB 4NRPA 5DAVA 1EYBA 4WBBA 1W03A 3P6BA 2R0HA 5J36A 2IC1A 1YNAA 2BZDA 3OF1A 3J4UH 4RS5A 5JZGC 4YVWA 5FY5A 2VCCA 1S4CA 4C0HA 1AR63 4OHXA 4AFMA 4KWJA 5HCBA 2WNVB 4M3CE 5FP3A 1IS3A 1W9WA 1IPSA 3UGGA 3D0SA 3RG0A 1T2XA 1I5PA 1O59A 3I2FA 3AC0A 2VNRA 4RGAA 2RM23 2XGXA 4KGGA 1OLME 1Y9QA 1WA6X 3CZJA 3IAPA 1WMEA 3VDAA 4DOUA 5F7UA 4IEWA 3NKTA 5FYIA 1LOAA 3DKQA 4LNVA 3LFMA 1GLHA 4QDSA 1RYYA 2UY8A 3KV6A 4IE5A 3K48A 5FV3A 5FZIA 1WD3A 2ZEXA 5JDBA 3WUCA 1FPN3 1XYPA 2JECA 4A7KA 1RMU3 1MQTC 1AX2A 1DG6A 1F31A 3POBA 2AYHA 2XQXA 1RTVA 5CA6A 4IE0A 4GKYA 1BVP1 1DIWA 1V6OA 2Y6GA 3IIAA 1UPSA 4TLGA 3WP3A 5IT6A 2D44A 1W28A 2QQPA 4XUPA 1UU5A 2J1UA 4J1WA 1MEC2 4B4QA 4DRVA 1LRHA 3HT1A 2R16A 4JDMA 3PLQA 1O8PA 3MF6A 4AVVA 4CCMA 1LCLA 1O6UA 5CKMA 3R6SA 1QH7A 3D6EA 3RGBA 2B45X 5J7MA 1MZ6A 3KF5A 2ATFA 4K8FA 2W39A 4PLMA 2TNFA 3VBRC 1VBE2 2R7EB 1MZFA 1UMHA 1ZNPA 1BQPA 1NYWA 1YXWA 2XWJB 3RMYA 2XJTA 4A45A 2GDFA 3MBWA 5JXJA 2VXJA 2XLGA 5FZCA 3K46A 4F8AA 3LOIA 1JZ2A 5FPBA 4ES9A 5ABJB 4XJZA 5FQ0B 5LB6A 3VZLA 5BV6A 4WZCA 4AHYA 1ZZCA 4DUWA 3FFQA 3WW4A 3ATGA 1D4VB 2GALA 1UW8A 1DBNA 5G04L 1BEV2 1X36A 3OY8A 1QJX1 2OW4A 4BHPA 1ND3C 1ZBA2 2ZGSA 3WNLA 4M3CF 5K0UA 2VVEA 4N9IA 4CDWA 5LY2A 3ZMOA 2IXJA 1AYM3 2WO3A 3RS6A 1CR7A 1PO11 3PVBB 1JUIA 1UYPA 4AXOA 3DPRC 1AJOA 2D98A 1BBT1 4JDNA 2VMGA 5DN2A 1J59A 1JODA 2X53S 5D8AC 3ZSKA 4AFBA 3MPBA 4Q4W3 3SLIA 3NL1A 5K7PA 3NAPC 1FV3A 1K12A 5A3OA 1YQ6A 1X33A 2PHRA 1UY1A 4JC1A 3O5SA 4ZS3A 4CCNA 1JHNA 1AR93 3F95A 2RS52 3WNPA 5FY4A 1CN1A 3O1VA 3IBMA 2WO2A 4U2AA 2K2SA 2GN3A 5FKCA 1SCRA 2JD9A 1R64A 1V00A 2R30A 4QU2A 1CONA 5E8AA 4BXFA 5A7OA 1GOHA 5LA2A 1ZA4A 1W6MB 2F4PA 3UJQA 3W9AA 3ZFEB 1ASJ2 3PVOA 3PJYA 5IVCA 4IDZA 2HWD2 2Y0IA 3VDBA 3AZWA 3ZO0B 1VB2A 2CWSA 3RI9A 4P9IA 1FMD2 4AI0A 2ZZQA 4RFT0 4R9BA 3D4KA 4DO0A 1UPIA 4DRRA 3OSDA 2ZHLA 1W8WA 3AMHA 5JXHA 1AR73 2JE9A 4HANA 4LO4B 1VALA 1SLCA 4OUEA 2BVBA 2JG9B 3ZXJA 2D3SA 4XURA 2WUHA 3ZR5A 3NW4A 2O14A 4QPGB 1DZTA 1NE4A 2YG0A 3BU7A 2UWBA 1POQA 3MLKA 3M3QA 4RQPC 4XF4A 2RS33 5F8PA 5GLTA 5F1RA 3ZIWA 1AR62 4S2GA 4MGYE 1PGW2 4R52A 3IDAA 3H3LA 3HN3A 1HV0A 5FZ0A 4ZHNA 3BTZA 3T2TA 2ZHNA 5CYYA 3VZNA 3KHCA 4HXCA 1RINA 1RUF3 2B9UA 1MS9A 2ZA9A 4ASKA 5DQ0A 5FZAA 1SLBA 2A6XA 2E63A 4D6RA 4DB5A 4FTBA 3ETPA 2JENA 2ZGUA 1W8UA 3N9OA 4LO6B 4K6BA 1RUH3 4OZOA 3SCFA 4XAAA 2RDRA 2XJQA 1DQ5A 2JJ6A 2GU9A 2IFWA 1R081 2XQRA 4RR3B 5CISA 3D8CA 4CPBD 3AL6A 1C4RA 3ITQA 2ZOEB 4EN0A 1X8EA 2XKPA 1ZZ6A 2WAAA 1FPN2 3UL2A 1VRBA 5SV8A 4EWAA 1RMU2 2ENRA 2YY1A 1QWRA 1L7RA 3MIBA 4W6YA 4LKSA 1WCQA 3K51A 2ZKNA 4CUAA 4D7SA 3IWZA 3LPGA 4IESA 3RWKX 3R4SA 3MIHA 3VBHA 1OLQA 4BOWA 4JHZA 2JDAA 5H9SA 1CZTA 2NM1A 5T5LA 1O3QA 3RZGA 3T3YA 3JU9A 4O9EA 2Y33A 1EV11 1NLQA 5AFEA 3K3OA 1KJLA 4LBOA 2Y6KA 2C1FA 2P37A 3FN9A 5FPUA 1WA4A 5A7WA 3WD5A 2VTXJ 1IG3A 5FR3A 4PDWB 5KC6A 2AUYA 4JCKA 4ITCA 2WFPA 4AEDA 1N47A 4BM8A 1IS4A 5C4WA 4LBQB 1WMXA 5FY9A 2R1DA 2GZWA 1J3QA 2DF7A 2C5DA 1MS1A 3NNMA 4X6QB 2AEYA 2ZGLA 5FMOL 1KITA 3DXTA 3PHMA 4XZPA 5F5CA 1SQ4A 4Z2WA 5FZ1A 1SHWB 2CL2A 3NJXA 1AYN1 2BWCA 4Y3OA 1Z0HA 4JGZA 4WVMB 2VUCA 3BU0A 3AKSA 3LWCA 1QJX2 1YHFA 2HEWF 1NQDA 2DVFA 4W6WA 1AYM2 3WG3A 5JOYA 1CESA 1OA3A 5FUPA 5JZGA 1RUG1 2QTWB 3I97A 4YGCA 1GSLA 3ACGA 1HQNA 4OYUA 1D4M3 5EIYB 1PO12 5JSRA 3L2HA 4W65A 4XQ4A 4PIXA 3KSCA 4GKXA 4COWA 2BGOA 4F83A 2ZGMA 4FOVA 4E4DX 4QXHA 1VR3A 5FMDA 5FY0A 3ASIA 4PJYA 1AR92 1EY2A 2D6MA 1GMMA 3GBGA 4GJZA 2DUOA 2PHWA 5FZOB 2QFEA 2WT0A 5LY1A 1QQP1 2QZ3A 2XJRA 2OA2A 4D69A 2HWC3 1LOFC 3MPPG 1RL3A 1A78A 3PU3A 4U36A 4XF0A 4CU8A 2X8KA 4DZGA 2O8QA 1NAEA 1YFYA 4L2NA 1F9KA 1IQAA 4NHXA 4KH9A 2NPIA 1H0BA 1MQTA 4HN1A 5FLJA 3LDKA 4ES8A 3RZMA 1RUJ3 5A6QA 1JU3A 3H1MA 4EN8B 2MEV3 3CHXA 2OZJA 4FPOB 3HN1A 5F5QA 5IUQA 3K4AA 1EUTA 5T50A 5BXXA 1DDLA 1I9RA 3ON7A 4D6QA 2PLV1 3WHUA 1Z7S3 2ZX1A 3C3VA 4LHKA 1UN1A 3AX4A 5FUNA 5CB7A 2WN3A 3ROUA 2PELA 1AJKA 3GHMA 4YG0A 4QQLA 1CX4A 3OBTA 5JCTA 1RXFA 3AP5A 4COUA 2Y0OA 2RS32 2XH6A 5F3EA 2R0FA 3TEZA 1NLRA 1E57A 4ZPIA 5FP9A 5L36A 1W9YA 1BLZA 3LA2A 4X8NA 1W2TA 1RUF2 5FOJB 3N7MA 3ZYPA 1SPPA 3ZFEC 5FLIA 2RMU1 4AHWA 4LOTA 3AP7A 4LIVA 4Z1VA 1RUH2 5F37A 3H9AA 1K3IA 5L19A 3POEA 4UFIA 2ZX3A 4LR4A 1B35B 2P34A 1ND3A 1TG7A 3V0AB 3I2GA 3MIEA 3SNMA 3ZPYA 4FPYA 4GMP3 2P5BA 5FZMA 4CCLA 1G7YA 3PUQA 1W3VA 1AHSA 3AP4A 2VULA 4S2HA 2RR11 2JG9C 1W6PB 3RPQA 2HWF3 2BWAA 5KHIA 3DPRA 1C8NA 2WYFA 3M8LA 4QPGC 4TSVA 2WQ8A 4Q0QA 1QOSA 4L8QA 1KS5A 1WGPA 4GAZA 3W59A 2BVVA 2CDPA 3WVJA 5A32B 4YM2A 3NAPA 1YQCA 4LMFA 4MH0E 1V6NA 1QOOA 3OGGA 5EQUA 4NUBA 2H6CA 4I0AA 3ZN4A 2WFF3 4YGBA 1GP5A 2VGDA 3KZ4C 4FXKB 1CWPA 4NROA 2EIGA 3B02A 2DBNA 3HAGA 4XMIA 5T5JA 3TN91 1XB9A
chains in the Genus database with same CATH topology
4MGIE 5DDJ1 2BGCA 2I74A 4Q4X3 4RR3C 2A71A 1GZWB 5HCAA 1VP6A 3ECQA 3WG4A 2PHTA 3MYXA 4LO8A 3VHOA 4QQHA 4LEJA 4C0BA 4N43A 2YPJA 1OFSA 1NA1C 1RUE3 1TME3 2AH2A 2UURA 3HT2A 4B3NA 5CU1A 4XOGA 4MGZE 1W6QA 4MX3A 1OQDA 5CBLA 4K21A 5JOWA 1NCQB 1LGBA 2E7TA 4QQ2A 1FYUA 4KG8A 4GMP0 3WDYA 4AI3A 1LODA 5JVVA 1REFA 1UIKA 5GZDA 4IEUA 4XF3A 2VPVA 4WM8B 2YV8A 4RQPA 1QXPA 2NLRA 4OUSA 4Y22B 1FX5A 4FPEA 2I2SA 4DY3A 4CP2A 2BW8A 4PDWC 4OI1A 4LBQD 1N3OA 4JDOA 2VNGA 3KCYA 3LA3A 3B5LB 1SFYA 3HBZA 1LULA 1K5MB 2AENA 1HIXA 4QX5A 3JBG1 4EROA 4Q8KA 1QJU3 3GNEA 2WWSA 4L97A 1RUJ2 2MEV2 4LUMA 3WG1A 3KT4A 5FRAA 3WW2A 1PVXA 3AZZA 1LU1A 5DUXA 1ND2B 1ZX5A 2ET7A 5LRRA 4WVVA 5LK7B 4EJRA 4IEQA 1MS3A 1Q5OA 2VUAA 1CAVB 3CNAA 2VOXA 2VMIA 1MVEA 5E1RA 4XBLA 1H2LA 1KFUL 2XL9A 2UY9A 2ZMNA 5SV5A 1DF0A 1WD4A 1ZZBA 2D5HA 5EYXA 2HWB3 3QH7A 2ZJCA 1QJZA 4Y1VA 5KC5A 1QHDA 5I0SA 1S55A 1RUI3 1COV1 5CG9A 2RMU2 2ZGNA 4TLFA 4MZUA 1DU3D 2YROA 5DG1A 1R093 4FO9A 5E88A 3WCSA 1HDKA 1QXJA 4HKWA 2HWF2 4A2UA 1UCXA 2HEVF 2HJIA 5JSOA 1WLCA 2A6YA 1QXRA 1U0AA 2VOVA 3I8TA 4EV0A 1OI6A 2OIIA 3IDBB 1GQHA 4Q4V3 1YJLA 2DVGA 2QVSB 2AZ5A 4R4XA 5FQ0A 5HCFA 1WLDA 5GJ6A 2CTVA 1C5HA 1LOFA 4N53B 3THPA 2PHXA 4Q4X2 1B35C 3VL8A 3FZ3A 2EXIA 1IPKA 3CO2A 3KB5A 1J1TA 2WT2A 1X8MA 2IFRA 5GLVA 4OULA 3M2MA 2G4IA 3RMXA 1DGRA 3AK0A 1RUE2 1TME2 1VRH3 3B01A 5CFDC 4P9JA 4AHZA 5IK4A 4G4FA 1CAUA 5FO9B 1PO21 2UWCA 5I8TA 1RUC1 2GC2A 1D0GA 1YIPA 2RJKA 4AFAA 5AC91 5J3UA 4CZSA 3CJIB 3AM2A 2DU0A 1DGRN 1MEC3 1QU0A 5DUUA 3VLBB 2IXIA 2BQPA 3ZXEA 3MW2A 5I93A 4MXWB 4Y1YA 4CDUB 4UW3A 4FPJA 4E9KA 1IKQA 1KD7A 3V64A 3POWA 5T5PA 2WA3A 1W6MA 3PTYA 3ZFEA 2VW2A 1H1AA 2OUJA 4COVA 3N35A 2JD4A 5K9YA 4MUVA 2VXRA 1NCQC 2JDZA 4K1YA 3VL9A 1O4TA 1LU2A 3E97A 2A3WA 3FWEA 1SMVA 3QD6A 2JG9A 3NV2A 3AKRA 3ES1A 1OA2A 4BIFA 1BMV2 4WM8C 4QPGA 5FOBB 4SLIA 3U11A 4NVPA 1L3JA 2XVKA 2ZHMA 5L73A 1OQ1A 3E5UA 3JD71 1DFQA 2N7GA 3ZXKA 1VBB1 4YZ1A 4L99A 4FT8A 4NN0A 1G86A 1K5MC 4QD2A 1UU6A 1YYNA 3GZTB 1XYOA 4FPCA 1WCSA 3RYKA 3LCPA 3U10A 4N9HA 2W08A 1ZRRA 3Q9OA 4GH4B 3O0WA 4AQSA 3TRSB 1S0DA 2Q4SA 1NY72 3WHTA 2E53A 5C8CB 2Z42A 4IV1B 1C28A 1NA1A 1POV3 2A73B 1V6IA 2DU1A 1PIV3 4E2SA 5IK7A 1LOCA 1KFXL 1AUYA 2WL1A 1ASJ3 2IXHA 1COV2 5CFCB 4Z07A 2A70A 3BALA 2ZACA 3ZSEA 3I59B 3VBFA 4OUMA 3VZJA 1V6JA 1DZRA 3N7KA 5FFOC 2YYOA 1DGWX 1VIWB 3M3OA 3IN9A 4NWWA 1RHI1 4PDWA 4AEKA 4Q4V2 1MS0A 5T52A 1V6KA 4CDQC 5E89A 4LBQA 1LOGA 1OOPB 4E27A 3JCIA 2R32A 3ZN5A 4ZKTB 1TMF1 4E4SA 1O7FA 3IPVB 2BEOA 2LUWA 4O9GA 3LSEA 3GBFA 1VAVA 1PNFA 5AVAA 4Q26A 1BYHA 4WVMA 4FAGA 3EJKA 5TSWA 1I3HA 4B7KA 3BCWA 3MW3A 3I7DA 3KM5A 1DQ6A 4WVZA 4CP0A 1VRH2 2A7AA 1POV0 1J3PA 5C9AB 4FAHA 1CAXB 2JKBA 3E6DA 4AI8A 3B69A 3HMYA 1DHKB 1RITA 3SITA 4DPNA 1LKNA 4C91A 2IXCA 2HYKA 5FTTC 4PIYA 4E2GA 3RYRA 2A6VA 5AC92 4LHLA 1OHFA 1BCXA 2VW0A 5FO7B 4N53C 2BUKA 4I0WB 1PK6C 3USSA 4XJ9A 1XYNA 1YJKA 2WNEA 4QHBA 4N90A 2GSYA 5FBZA 4UW5A 4W6XA 1VBD1 1URXA 2ZHKA 3OBRA 3S7EA 3RNSA 4AVTA 1EPWA 3NO8A 1W6OB 4KU7A 4QQOA 2ZKLA 1SLLA 2RS11 2YGLA 5CVRA 5C8WA 1ZZ8A 2XUMA 4QXKA 2H0VA 3VBOA 1WW7A 3WY6A 4EWEA 1XNCA 3CJIC 1LHWA 4YM3A 1BK1A 1NQJA 3B94A 4IERA 3V56A 4CDUC 2CGPA 2XJPA 4ATEA 4OHZA 4NHMA 1QJX3 1C3HA 3WUDA 2VMHA 2Y38A 3IT8A 4XFGA 3E5XA 4BA6A 4CRQA 5T55A 1PO13 3JD72 1VBB2 1UZYA 2ZCWA 1BBT3 1R1A1 1NCRC 4S2DA 2ZX2A 4JRLA 2OZ6A 4B8EA 4BWOA 4CDXB 4FQZA 4DZGA 1PGL1 1XXNA 1W0PA 3ZN6B 3ZXLA 3AZVA 1MR5A 1S2BA 2DUPA 1W6PA 2UYAA 5CFDA 1DQ1A 1Q8SA 5I91A 1PIV2 1FI2A 5A32A 4K3UA 1OA4A 1LB2A 2KM2A 4YSFA 2Q1MA 2EVXA 4GALA 4FP2A 4PIZA 3VDDA 3IDCB 4YNIA 2YHJA 1V6LA 3OTFA 2GC3A 4FVVA 3MZHA 2E9QA 4YM0A 4AGVA 1GZWA 2G9FA 5BNPB 4FBFA 1IKPA 1YI7A 4LE3A 1QMJA 1H8TB 1N3PA 3M1HA 3EO6A 4GH4C 1F2NA 4M0NA 1RHI2 4AWDA 4EN9B 3LKJA 3M70A 1UD1A 2IXKA 5C8CC 4IV1C 5F6LB 1TQ5A 1JYCA 4DFSA 1APNA 5D1IA 2DFBA 1C8M1 1TMF2 1LHNA 5HXVA 1YWKA 1H2MA 1JN2P 3AMNA 3J8F1 2K0GA 2ZAAA 2ZX0A 4N7UA 1Y3TA 1I5ZA 4B7EA 4H7LA 2ARBA 3O0VA 3CL1A 1U12A 3ETQA 1DYKA 5FLHA 4L11A 1N1TA 2VOKA 2WSVA 1G9CA 4K40A 1QJY1 1O4ZA 2ZAHA 1R083 4Y22A 2Q5TA 3JB8A 4AQ6A 2QDNA 1VBA1 4AVAA 1H4GA 4H7MA 1OOPC 3NV3A 4HPKB 4DMIA 5AFBA 1QH6A 3DL3A 4XFFA 2QJVA 4F3JA 1AF9A 2WNVC 1K5MA 4UW4A 5BNNA 4MV2A 4NO4A 2A3XA 1F5JA 1TEIA 3OGJA 4AF9A 1GYKA 4M3CB 2WC2A 3WOGA 3T1LA 4CEYB 5J09A 1WBFA 1XE8A 2BBVA 2DWRA 3A4UA 1GQGA 1EV13 3AJZA 1LOEA 3UKVA 3LGRA 4Y1UA 3ZFGB 5I8YA 4HVOA 4QQPA 1AVBA 5C9AC 5H9PA 3G7DA 3NJZA 4OHVA 5GLZA 4LA2A 2R1BA 2PHFA 4JGYB 5BNOA 1ZM1A 1LENA 2AGSA 2CGNA 2H6BA 3VBSB 1CAVA 4JTNA 4J6GA 1RVF1 1AYN3 1HXS1 2BNOA 4EN6B 3INAA 1CAWB 2WT1A 4FXGB 2QCSB 4RS5B 4CDQA 4YM1A 4YVWB 2TUNA 1RUG3 4BYYA 5A3LA 4FOWA 2GMEA 1G9BA 1BBT2 2QKDA 4GXLA 3MFAA 4NHKA 1BKZA 2G9GA 2GC1A 3H7JA 4N7IA 4MYEA 4B4PA 2EXJA 5ABJC 1YIFA 4XHXA 1R1A2 3IMNA 4YLZA 1WW5A 4YW1A 4Y20A 4C90A 1WUVA 1MZEA 5FDBA 4XE9A 1QQP3 4BZ4A 5LEJA 3AKTA 1IOAA 3GF6A 4PCRA 1ZREA 5IK5A 3S7IA 1U5ZA 4YZ4A 4YVSB 2ZZJA 1MZ5A 3E5QA 2Y26A 1YRZA 2QNKA 4XQWA 1V9U1 3ME2A 4N53A 3C2UA 4D7YA 2VOWA 4JRAA 3ELNA 2BNMA 2EA7A 3L9JT 1PK6A 4DINB 2MPFA 4CDXC 2LM3A 5GALA 2MHFA 2R041 2WNUB 3VBRA 4LA3A 2K9ZA 4AI1A 4JTOA 2RHPA 3WCRA 3WT3A 5JR7B 1NE6A 4FOQA 4GA9A 1JYIA 2BFUS 1RJ7A 3ES4A 1GFF2 1HX6A 5EYYA 4XETA 1BJQA 1CQ9A 3VHNA 1YLLA 3ZXDA 3USUA 2CGOA 5ACA1 1C5IA 4FOYA 4KL1A 4Q4Y1 1FNZA 2RMU3 4IL7A 4UBGA 1H9PA 5FPZA 3OY8B 4CP1A 4I30A 4CDUA 2IWGB 2ZBJA 1R082 1G8WA 4DNYA 3V65A 4Q8LA 5KXBA 1WW6A 5BNPC 1QJY2 2HWE1 1A3KA 3AP6A 4HETA 1H8TC 1U5XA 4XTPA 3EXUA 2DCJA 2RR13 5D8AA 2WS91 2XL7A 5JIAA 5BY5A 1AL21 3S30A 1UF2C 1VLNA 1EAH1 2NMOA 5FO8B 1NCRA 5EWSA 2D6NA 3GYDA 1Q8OA 5GZEA 5BUVA 1ULCA 4XILA 1HV1A 4HT1T 2VVDA 2WZR1 4Y24A 1O3RA 4GULA 2DCYA 3H8UA 1EV12 5CG8A 3TN93 3U0ZA 1H1IA 4Q29A 1RUD1 2GNMA 3GHNA 4AQ2A 1DGWA 2R061 1O3SA 1UMZA 3LSDA 5DDJ3 1X82A 3T1MA 3P3NA 2DCTA 3DKWA 2DVBA 4D7TA 1G6NA 3KQRA 3EHKA 4OI0A 4AQTA 1XU1A 5A3MA 4ONUA 1FOD1 3UKNA 1OMIA 1NXMA 3ILFA 2PQQA 4COYA 2VW1A 3JQXA 1AYN2 4K1ZA 4HSJA 2XBO1 3WW1A 4B29A 3POSA 2R071 4QT6A 4CEYC 2EXKA 5C8CA 4IV1A 1I1EA 1RUG2 2LTNA 1A8MA 1JUHA 3ZFGC 1O4YA 1PVC1 4IEXA 1H9WA 1PZ8A 4ASMB 4FSJA 5BPXA 1VBC1 1S1AA 2DVDA 2GH2A 2VY0A 1QGLA 1S2KA 3KLSA 3BIWE 4FPKA 3ZYIB 4JGYC 3AJYA 2XVGA 2DCKA 3ENRA 4M0HA 3MEPA 4SBVA 3I59A 1AXKA 1VB4A 4QPIB 1QQP2 2YZ4A 5JPMB 4DXZA 3JBG3 1LEMA 3APBA 4IEOA 2DUQA 1WCKA 4LT5A 2BTVC 2FQPA 4AFCA 1O3TA 1ENXA 4YVWC 4GWMA 1SDWA 2WNVA 3IPVA 4Y5Z0 2ILMA 4K9SA 4P9GA 3SH4A 2ZABA 3E6BA 3N3HA 3OD0A 2JG8B 1KRIA 4INDA 3B3QE 1UX6A 2PLV2 3J26N 3WX5A 4IV3B 1V9U2 3RJ2X 3PMEA 1WCDJ 3U4XA 2GMPA 1GNZA 3CEWA 3PVEA 3MW4A 5EZWA 1OQEA 4QGLA 2EAKA 3ZXAC 2XJSA 4LBJA 2E7QA 3H3ZA 4AW7A 1AZDA 4AEDB 1MS8A 5C4WB 2A3YA 5A33B 3MICA 4META 2AR6A 4AYUA 4R8HA 2ZMKA 4MVTA 3TYJA 3I2DA 3LZZA 4IXLA 4YVSC 2WJSA 3AB0A 5JIUA 5ACA2 2FBEA 1XE7A 2B46X 1J3RA 5K8SA 4XIOA 1COV3 4JGZB 4QGNA 3N7LA 3P3PA 1HRI1 2XLFA 1HQWA 1M4WA 4AG4A 3UK9A 1TNFA 1O5LA 2DURA 4YW3A 2WNUC 4YW5A 2GNTA 3WXPA 5GZGA 1WBLA 2RR12 3FLPA 1RUI1 3OJBA 5FREA 1I6XA 4OHWA 3H1WA 2XPJA 1NZCA 3NV1A 1HRV1 1SLAA 2WS92 5AVPA 2ZGQA 4FTEA 3PMSA 5ABJA 5GZCA 4WZFA 2B42B 2GAUA 3PVNA 1X50A 4RA0A 4HSLA 3D5OA 1KQRA 3WDVA 3TN92 1GNHA 4DQAA 2V09A 4AVSA 4FTSA 1PHMA 4BH9A 5FAXA 4XF1A 5JOZA 1N1SA 5DDJ2 1J1LA 3IKWA 4FP3A 2R062 3MI8A 4QMAA 2GMMA 3O12A 3N36A 2OPKA 3D82A 1QF3A 1N3QA 3QACA 3WR0A 1TE1B 2D3RA 2VNOA 4ISRA 3H50A 1RJ8A 2UWAA 3I4IA 5DZGA 4RD7A 4HK8A 5JSPA 3AFKA 3M7AA 4CDXA 1PO23 1RUC3 4Y26A 3VKOA 4H55A 5AC93 2XBO2 1ZBE1 3WQ0A 5EJ3A 4P9XA 2YDEA 1GZCA 3U07A 2R072 2QDRA 2WA4A 5GLWA 1V6MA 4RSUA 3UJOA 1BXHA 1KS4A 1CJPA 2E7AA 5JWPA 4FPGA 3TNQA 1O5UA 3BPZA 2QZ2A 3AKPA 3KT1A 4QGMA 1MEC1 2ZGPA 3H3UA 4GB31 1AR81 4KG0A 2ES3A 3ZYJB 2EAAA 1RUNA 1ND3B 4YG6A 1SBEA 3JBG2 1A6CA 1QNWA 1Y43B 2D93A 4CYDA 5BNPA 1VBE1 1W6NB 1YCIA 1GR3A 2W68A 5CNAA 4M01A 4UBHA 1CPMA 1H8TA 2D5FA 3DPRB 3MLJA 4OFGA 5T54A 4FCAA 1GBGA 1ZZ9A 2R49A 3EQEA 4HVQA 1GICA 4R9AA 5J96B 3WLUA 3X29B 1D2QA 3KMHA 3JD73 1VBB3 2CY6A 1XQNA 1BEV1 2PHLA 3SXWA 3WINE 4YGDA 1ZBA1 3DUIA 4MXVA 1SBDA 1QNYA 2XJVA 4RR3A 4RHV1 3WDXA 1S0FA 2FMYA 4QPIC 1HQLA 1S0CA 3LAGA 1JH5A 4NR1A 3TOJA 1H2NA 4P14A 1OFNA 4PLNA 5JI9A 2D7FA 4DY5A 1LESA 4N43B 2Z5WA 4AVCA 1JBCA 3BTAA 2MNGA 3S6PA 2W52A 1RUOA 1XNKA 4XXAA 5JOXA 1ONAA 1LGCA 4Z8BA 4TZDA 1KDMA 3WQ1A 1ND2C 4TYSA 3CLPA 2RS51 4AVBA 2JG8C 1CIWA 3RZZA 3R4DB 5EXOA 4IV3C 4P9LA 4HK9A 1GV9A 4CEYA 5I8SA 3ZFGA 3FBYA 2GN7A 3NVCA 1SBFA 3AKQA 3TB0A 4BE3A 3B00A 4IEYA 4R4ZA 4LE4A 4AEDC 2HWD1 1RHI3 3DF0A 4F7ZA 1LHVA 2BNNA 2CWMA 1FMD1 4JGYA 2C9AA 3ZSJA 1D2SA 1TMF3 4XJWA 2WZPP 2F6BA 3UKTA 4HL0A 3FJSA 3E6CC 1CD3G 1D0HA 3A0KA 1CAWA 1DQ0A 3H7YA 4UXAA 1AR61 2NN8A 4KWLA 4YGEA 1PGW1 1FATA 3LB9A 1JTZX 4Y1ZA 2D3PA 2PHDA 5DUVA 3W58A 2RM21 5JAXA 4P9WA 3IM0A 3GZAA 1RC6A 1G9AA 1PO22 3VKNA 4IEVA 1RUC2 1NG0A 1MS5A 1YFUA 2B8MA 2CAVA 4A3XA 3HD8B 5DXDA 4C1XA 3SH5A 1FPN1 4WVWA 2WIIB 5J37A 1KDKA 2ZGOA 1RMU1 3KGLA 4I0AA 2CAUA 1ZBE2 5DUWA 4EWDA 1UL9A 2D6PA 4G3YC 4GWNA 4XBQA 3FX3A 1S0EA 1ZYBA 4Y1XA 4FPFA 3KD4A 4D3WA 1SLIA 3EBRA 3AYCA 1VBD3 4YVSA 2FHRA 2ZGKA 2JE7A 3ALQA 4AEJA 4XPVA 4GB32 1AR82 3V0BB 3N7JA 4Z82A 1Y7BA 2GC0A 2NQYA 3WW3A 1UKGA 2RS13 4BPZA 4AGGA 1LOBA 2OUHA 1RB8G 2WNUA 3VZOA 1YUDA 2NYYA 3RYPA 5FCCA 3AMMA 3AFGA 4NWVA 4Q1RA 2B7YA 3NSTA 3ZMNA 1HKDA 2IZWA 2WSUA 3JQWA 3AMPA 1LJ7A 4LO7A 3VBUB 1OPMA 2DYCA 3ACLA 1DYPA 3AXEA 3GBWA 3N4MA 4ZU4A 4LUKA 2BYVE 2GNBA 4YW4A 2XJUA 1LEDA 1B35A 3RJRA 4EN7B 2ARXA 3V0AA 1R1A3 5GKAC 1AYM1 4RHV2 1OD5A 3RI8A 2O8OA 2XHKA 1OLRA 4GQ7A 3SISA 4Z92B 4Q4W1 4L9BA 3KT7A 3MLLA 4JVAA 2WINB 3ZXGA 2DCZA 4HN0A 1MS4A 1CAUB 2I07B 1AR91 3KCCA 2W0XA 4LBMA 1ULFA 1AXZA 4ZU5A 4NHLA 2D97A 1H30A 2VH9A 4B4RA 3SHRA 2PTMA 1S0JA 1ZRCA 5KHGA 2X5IB 5JMCA 1UIJA 5H9QA 3WDWA 1AX1A 4CEWB 3HQXA 2UU8A 2KA3A 5L7OB 4N43C 4Q0UA 2VQAA 3MF9A 1O91A 3QH6A 2XLAA 1JXNA 3CJXA 3HR9A 5DZEA 1AR71 1NCQA 1LHOA 5KBFA 3VN4A 2CNAA 1AL0G 1VJ2A 1C8M3 1QY4A 4I09A 3KGZA 3ZYRA 5CFCC 3OYWB 3J8F3 4JQRA 1N1VA 3VHPA 2RS31 3WV6A 3JUUA 4WM8A 4WM7B 2VG9A 1ENSA 3NKGA 1IGOA 2YUEA 4AI2A 3MGUA 1LGNA 4GIQA 1RUF1 1QJY3 2Q0AA 5LRSA 5C6CA 4C1WA 2ET1A 1R1ZA 2RM22 3FMGA 1Q56A 1RUH1 3FC0A 1VBA3 2A75A 4LBLA 1V70A 1IS5A 3HWJA 2WLPA 3H0OA 5DG2A 3ZVXA 3B7MA 4YW2A 1ALYA 4QPIA 5F9TA 1RGSA 2JEMA 3NWKA 4LHNA 5KWRA 1LECA 1GZ9A 1VAMA 4LBKA 3DN7A 5I0TA 1NA1B 2PAKA 1VBD2 3SCHA 3I54A 1NXD1 5CIRA 4BLJA 1ND2A 1LTEA 2A6ZA 4LTAA 1TNRA 3CU7A 4LLFA 3WG2A 3ZFFB 2JG8A 3VUOA 2Z79A 1NLSA 4HMZA 2RS12 4YFWA 4IV3A 4PLOA 3VBFB 4XW3A