5J96B

Crystal structure of slow bee paralysis virus at 3.4a resolution
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
261
structure length
252
Chain Sequence
MDRPEGSEERTVQTSNVVLGETNIESQDIASKEYSPTWDRLASSEVSDEYPMLTDRWLFWKSVKWEVNDSAFGKMLVQEKFPQSWVQMDVNIPNFIPFNIHQYMRADFEVKIYVNPNDFVSGWLIMAFLYQGSEMFDYKLRRNPAALMQMPHVLVNVGAANEATLKIPYRYVRPFMRCKDILRGDNLITGVTEPLNMGVLFVEVLIPFRTSAASSAPKSLDVSLFVKMTNAKFTGMVDGSIALLSKPIALPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords VP1
publication title Virion Structure of Iflavirus Slow Bee Paralysis Virus at 2.6-Angstrom Resolution.
pubmed doi rcsb
source organism Slow bee paralysis virus
total genus 34
structure length 252
sequence length 261
ec nomenclature
pdb deposition date 2016-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5j96B00
1RVF1 1RB8G 3DPRB 3LOBA 2XPJA 2RM23 5ABJB 1BEV1 1K5MA 1AUYA 4PDWA 5J96B 2R071 3ZFGA 1NCQC 5D8AC 3ZFEA 5CFDA 1AYM2 1NCRC 3VBHB 3TN92 1RUD2 1AR72 3VBRA 1TMF1 1VBD3 1FMD3 4WM8C 3VBSB 1B35B 1VAKA 1Z7S2 2MEV2 3CJIA 4QPGC 1NY71 2WFF1 3J8F3 1H8TC 1QJY3 1ASJ2 1RMU3 2WWSA 1HXS2 1PIV1 4Q4V1 2RS11 1RUF1 2R061 1M06G 1AL0G 5C9AA 1VRH2 1OOPB 1RUG1 3JB8A 1R091 4RR3B 1QJX3 4IV3C 4GH4B 4Y4YA 4GB31 2HWE3 1RUI2 1MQTA 5AC92 3NAPB 1RHI1 1HRI2 2RS32 4Q4W2 1GFF2 2RR12 1FOD3 5C4WB 1R1A2 4QPIA 2RMU3 1RUJ2 5J98B 1MEC3 4YVWC 1AR91 1FPN2 5DDJ3 5A33A 1ND2B 1PVC3 1ZBE1 4RQPB 4CDWA 4CEYA 3VBUB 4Q4X2 1VBE3 1WCDJ 4JGZC 4JGYB 3ZFFA 1R082 5JZGA 1RUH3 1X33A 5K0UB 1AL21 4IV1A 1QJU2 2TBVA 3DPRC 5ABJC 1VBA1 4CEWA 1PGW2 5JZGB 1W39A 4FTBA 4CDUA 5BNPA 4N53A 3VBHC 1RUC1 2HWF1 1BMV2 4CEWB 1EV11 3JD73 2RM22 1VBB3 1V9U1 1AR61 1NA1B 5CFCA 1RUE1 5BNPB 1POV0 2XBO1 1HXS1 1HRV3 1POV1 4N53B 1C8M3 3VBSC 1B35C 4YVSC 1EAH1 1AYN3 3VDDC 5BNOB 1ND3A 1VBD2 1FMD2 2HWB1 2R041 3JBG1 4IV3A 4RS5A 3VBOB 5ACA1 2WS91 4AEDA 2BPA2 3J8F2 1QJY2 4Q4Y1 1BBT1 1OOPC 1RMU2 1QQP3 1RVF3 1A6CA 2BUKA 4GH4C 2HWD1 1PGL2 1BEV3 2PLV1 4N43A 4YVWA 2R073 5BNNB 3NAPC 4CDQB 4FTSA 2WZR1 4WM7A 1QJX2 1VBC1 5C4WC 5FMOL 2HWE2 2X5IA 4RHV1 1PO13 1K5MB 2ZAHA 4WM7B 4PDWB 3ZFGB 1ND2C 3ZFEB 4RQPC 2WFF3 3VBUC 1FOD2 5CFDB 3VBFA 4JGYC 3ZXAC 2RMU2 3VBRB 1MEC2 5K0UC 1PIV3 4Q4V3 5C8CA 2RS13 1RUF3 5DDJ2 1ZBA1 1CD3G 2R063 1PVC2 1VBE2 3CJIB 5L7OA 1COV1 4YVSA 1RUG3 1RUH2 4CDXC 3VDDA 1R093 2GSYA 5FOJB 5L7OB 1OPOA 1NA1C 4GB33 2RS51 1PO21 2HWC1 1TME1 5C9AB 1RHI3 2FZ1A 3JD72 1VB2A 1VBB2 5BNOC 5FMOS 1C8NA 4NWWA 1HRV2 1C8M2 3VBOC 1AR93 1MQTB 1D4M2 2Y26A 1AYN2 1AL23 1NCQA 4QPIB 5D8AA 1NCRA 1VBA3 4GMP0 5A33B 4GMP1 1AYM1 4CDWB 1NG0A 1QQP2 4CEYB 5BNNC 1RVF2 3TN91 1RUD1 4CDQC 1AR71 3ZFFB 4WM8A 1RUC3 2HWF3 1NCRB 1NOVA 1EV13 1BEV2 4QPGA 1V9U3 4IV1B 1Z7S1 2BFUL 1AR63 2MEV1 2R072 1H8TA 1POV3 4PDWC 3ZFGC 3ZFEC 4CDUB 1ASJ1 1EAH3 5CFDC 1TMF2 2HWB3 1PO12 3VBRC 2R043 1D4M3 1AR83 3JBG3 2GH8A 5CFCB 4Z92B 5ACA3 2WS93 1VRH1 2WFF2 3CJIC 4Q4Y3 1BBT3 3S6PA 1PIV2 1IHMA 1ND3B 4Q4V2 2RS12 1RUF2 2R062 1RUI1 2HWD3 5AC91 1E57A 4IV3B 4RS5B 2PLV3 2QQPA 4RR3C 1HRI1 2RS31 4Q4W1 4AEDB 2RR11 1RUG2 1C8M1 1HX6A 1R092 1R1A1 2WZR3 1RUJ1 1VBC3 4GB32 1FPN1 2BFUS 4RHV3 1CJDA 4JGZA 1HQNA 4N43B 4YVWB 1VB4A 4Q4X1 1MQTC 1RHI2 1TMF3 1R081 3DPRA 5ABJA 1QJU1 1F2NA 4QPIC 2X5IB 1AR92 1PGW1 1ZBA3 3VBHA 1ZBE2 1DDLA 4CDWC 4CEYC 1COV3 1BMV1 3VBFB 2RM21 3ZFFC 1AL22 3VBSA 5JZGC 1B35A 5C8CB 1VBA2 4IV1C 3HAGA 1F8VA 1PO11 2RS53 4CEWC 1PO23 2HWC3 1TME3 1VBD1 2HWF2 1RUC2 1FMD1 4YVSB 4CDUC 5BNPC 4N53C 1EV12 3VDDB 1V9U2 1QJZA 1AR62 1RUE2 4LLFA 2ZTNA 2XBO2 1OOPA 3J8F1 5CFCC 1QJY1 3FBMA 1EAH2 4Y5Z0 1RMU1 4RR3A 4GH4A 4SBVA 2FZ2A 2HWB2 4BCUA 2R042 1ND3C 1PGL1 1AR82 1ZBE3 3JBG2 5LK7B 5ACA2 2WS92 3NAPA 4RS5C 4NWVA 2VQ0A 4AEDC 4GMP3 1AYM3 4Q4Y2 1QJX1 1BBT2 5C4WA 2WLPA 3TN93 1RUD3 1AR73 2HWE1 3IDEA 2HWD2 1ND2A 1NCQB 5D8AB 2PLV2 4RQPA 3VBUA 1Z7S3 2MEV3 4JGYA 4N43C 1FOD1 5A32A 5K0UA 2IZWA 2WZR2 3JB4C 1ASJ3 1RUE3 2RMU1 1K5MC 1HXS3 1MEC1 1VBC2 2XBO3 4WM8B 4WM7C 4FSJA 5DDJ1 4RHV2 1PVC1 4QPGB 5A32B 2X5IC 1VBE1 4RFT0 1H8TB 1VRH3 4CDXA 1RUH1 3VBFC 1X36A 1NA1A 2BBVA 1NY72 1ZBA2 4CDXB 5C8CC 1RUI3 2DF7A 5AC93 1OHFA 5BNOA 1HRI3 2RS33 1COV2 4Q4W3 2RR13 4EJRA 3JD71 2ZZQA 1VBB1 5L7OC 1R1A3 5GKAC 3M8LA 3VBOA 1HRV1 1RUJ3 5C9AC 1FPN3 2RS52 1PO22 1D4M1 2HWC2 1AYN1 1AR81 1TME2 4Q4X3 1R083 1SMVA 1QJU3 5BNNA 4CDQA 4FTEA 4JGZB 1QQP1
chains in the Genus database with same CATH superfamily
2VCBA 2VCMA 2YBSA 4Q2FA 3ZIWA 4E4ZA 5C5TA 4LOTA 2J1SA 2G19A 3UV9A 4LE3A 1GWKA 3ZOIA 4Y1XA 1RB8G 3LOBA 3LF7A 4F83A 5GLZA 5J3UA 3BPSA 3HOBA 4CXYA 4AQSA 2OT7A 2KR2A 3ZFGA 4ES9A 5D8AC 2NZ9A 4XZPA 4EYUA 5BY5A 5CFDA 1QXRA 2VXJA 3J26N 3MIBA 4KBBA 3NSTA 1UX7A 3EB7A 3TN92 5LRSA 1AR72 2XJUA 4LBLA 1TMF1 1UO9A 4XAEA 5FZLA 1OF4A 4LK7A 1ZYBA 1WBFA 4E8DA 1RGSA 3VBSB 4ARYA 4OZXA 2BGOA 2G9GA 5FWEA 5HV4A 1NY71 2WFF1 5DQ0A 3O1VA 2NM1A 2BJSA 3AP5A 4XUOA 3ATGA 2VOKA 1RMU3 2WWSA 4YW3A 1TG7A 1JYNA 2WUHA 2WQZC 1REDA 2Q8CA 3BALA 2R061 4ATEA 4XFIA 2PAMA 2ZEWA 4DFSA 4Q5OA 1M06G 4YARA 1FYUA 2OQ7A 3A0NA 2QQJA 2A3WA 3WF4A 4D3WA 1I5PA 1LOCA 1OQDA 3H9AA 4DRVA 1PK6C 5J36A 5CAZA 3DGTA 4LPLA 4RR3B 1SG3A 3OD4A 2BVBA 1J1TA 1PGSA 4FAHA 3SHRA 3TWIA 3B7MA 1OPMA 1WD3A 3WNKA 1ZZBA 3JCIA 4DEQA 4S2GA 2BERA 2CDOA 2ADEA 4HKLA 3NAPB 1RHI1 2RS32 1KFXL 4GAZA 1POQA 3GZEA 3SEPA 3R4SA 5A3NA 4XF4A 4IUGA 3T0AA 2HYXA 4IW3A 5C4WB 5JDBA 4GALA 1H2LA 5KXCA 4ATFA 2FMYA 3PJYA 3MBWA 1BZWA 4IXLA 1MEC3 3WF2A 3PU3A 4LMFA 3WDVA 1XNCA 2A3YA 4RSUA 2BU9A 3VN4A 3KWVA 5JXIA 3ZSMA 1VALA 3PIJA 4L9BA 4BQ4A 2FMDA 4FFIA 3OEAA 4IEYA 3NW4A 4XMAA 5FV3A 1GZWA 2D98A 3OSDA 1RUNA 5F37A 5HXVA 3POBA 5FP7A 5F3CA 1RUH3 4Q26A 3H1YA 2A6ZA 5T5PA 1AL21 1BLZA 4XXPA 1W9TA 2PXJA 4QU1A 3U07A 1UMHA 2F6BA 5T5OA 1G7YA 2J1AA 4B7EA 3D8CA 4AI1A 1VBA1 3V56A 3O1MA 3I3BA 2JE7A 1WD4A 4XFCA 2K2SA 5EPAA 3JQWA 5FFOC 4FTBA 2AR6A 1YI7A 2ZOEB 1AJKA 3POFA 4X6QB 3T2TA 5BNPA 3VBHC 1AXZA 1BMV2 4CEWB 3SH5A 5FQ0A 3AKPA 1O91A 3OPTA 2RM22 2VUAA 3INAA 4TLFA 2AC1A 1UYPA 1NA1B 1UY0A 2XONA 1RUE1 4DS0A 5FPXA 3USUA 1HXS1 1XNBA 1ULFA 1B35C 2Q1ZB 4PJYA 1HB1A 2ZMLA 1W6QB 1FNYA 1MS9A 3DCQA 3NKTA 4CCLA 2QQMA 5EIYB 1WCQA 4MXWB 2QE3A 3WG2A 4COUA 1ND3A 1ULCA 5I91A 1GZTA 4AVCA 1XYNA 1DLLA 2R041 3OTFA 3BN6A 3MF6A 3ORJA 5EJ3A 1KRIA 2EIDA 2WNVC 4RS5A 4FPHA 3MFAA 3EO6A 4XF1A 4XCBA 4E2QA 4AGRA 1QQP3 3K4AA 4J6GA 5EJZB 1RVF3 3I2KA 1JOPA 2C1FA 4J1XA 1E5SA 5FYSA 1PZ8A 5KXBA 2BUKA 2B42B 2PHTA 3SH4A 1RTVA 5A6XA 4U36A 2C5DA 2HWD1 4ZHNA 1VR3A 2PAKA 4K8RB 1BEV3 1J3QA 4UT5A 2JE8A 4N43A 4FT8A 4YVWA 5SV8A 4BQ5A 3CMGA 5ERLA 5FP8A 3VD3A 4O9GA 2WNOA 5FZIA 5FPUA 3MDPA 4WM7A 5FXXA 1N1SA 1HQLA 2WO2A 1ZA7A 3WDTA 1S0FA 3HMYA 4W4ZA 2QNKA 5FBZA 1K5MB 2VJXA 4CCMA 1SFYA 3AMQA 5LRRA 1C57A 2ZACA 2C9AA 3RVHA 1REEA 1ND2C 5GLVA 3V0AB 3MLKA 4UXAA 3N4MA 3AKTA 5KC6A 3LD8A 1XOYA 3T3YA 4B8EA 4HSLA 2D5HA 4Y22B 2RMU2 4MGTA 4JDOA 1PIV3 3SITA 2RS13 4WVMB 5DDJ2 1ZBA1 4FFFA 1HV0A 2JG9B 1DP0A 2A75A 1ZRCA 1S2BA 3L2HA 1NXD1 5DUXA 3VZOA 3CJIB 2CDPA 1RITA 2DVFA 5JOZA 2V09A 1RUG3 3FN9A 2C24A 2RV9A 2ZAAA 2JDPA 1JYVA 3VDDA 4LBQA 1R093 1V0AA 4HN0A 4OMDA 4QWNA 4XJ8A 3R6SA 3G6JB 5T50A 4COWA 5CNAA 1BQPA 4R9BA 5FOJB 2VM9A 3BIWE 3ZXGA 5L7OB 4GB33 5FPLA 4TTGA 2O8OA 3T4HB 1H4HA 4JQRA 4K8FA 1V6MA 5FUIA 3OJBA 1QOTA 1RL3A 3AMNA 2AZ5A 2VQTA 4QPYA 4XJWA 3IDBB 5BNOC 5HCHA 5FMOS 1C8NA 4NWWA 2ZGUA 2WBKA 1JOJA 1XSRA 1W6NB 2NN8A 4NRQA 3AMMA 2FDJA 1QMJA 5FZHA 4NIIA 3TYJA 2GZWA 5LATA 1LGCA 1MQTB 3J4UH 1SBEA 4XAAA 3PUHA 2C0ZA 1K3IA 2Y60A 4SLIA 5L9BA 5KXEA 2IFWA 2W52A 4O9EA 4EN9B 1CIWA 4Q0SA 3TEXA 1OKOA 1JN2P 1CN1A 2YV8A 3OG2A 1JU3A 4PI0A 3C7FA 1Q3EA 2PHUA 1O8SA 2J22A 3ZYRA 1NCQA 3FE5A 3N3HA 1W9YA 3DKQA 4QD2A 2EALA 1GICA 5C3OA 3UK9A 1UPSA 1N3PA 3W58A 3ZYFA 5A33B 1UU4A 3THCA 3K3OA 3WNPA 1JZ8A 4XW3A 2ARCA 4CEYB 5BNNC 1RUD1 2UWBA 4CDQC 1WLTA 1ULPA 3ZFFB 4WM8A 4MGYE 4COVA 1RUC3 4EZHA 2RJKA 3RYRA 1YYNA 3R4UA 4JVAA 1YJLA 1FV3A 1BXHA 1W8TA 4IV1B 4LJHA 1SLBA 4CTEA 1Z7S1 1KJLA 4BB3A 4Z2AA 3AKQA 1AR63 5I0DA 3BI3A 1V6JA 5BUVA 3E5XA 2XHKA 1ZM1A 1EAH3 1XE8A 2D5FA 2E63A 3U75A 1OI6A 3Q8FA 1GMMA 2OZJA 4E27A 1TMF2 4QAWA 1IGOA 2R6QA 3IAQA 4UW4A 3SMHA 1PO12 1XB9A 5E88A 3OBAA 5FRAA 1D4M3 4FFGA 1KJRA 1S0EA 1AR83 2JDYA 3JBG3 3Q8AA 4UFLA 1BK1A 5FMBA 4YZ2A 2BGPA 3RZLA 3ZVXA 4BXSV 1ENSA 3OY8B 4LHKA 3RZGA 2WFF2 3ZXLA 2P4EA 1E5HA 5DZFA 4A7YA 1DQ5A 4FCAA 3HVDA 4IE4A 1BBT3 4AI0A 1CPNA 3QD6A 3AMHA 3SCFA 3BTXA 4QX7A 3C8XA 3IMMA 4X8NA 2R062 1OH4A 3MI8A 1IQDC 2O8QA 2LUWA 3O1RA 1I5ZA 2WO1A 1CAUB 3ZR5A 5IVJA 3PTRB 1PX3A 1S0CA 5JXHA 2QQPA 3CEWA 1HRI1 4AEDB 1ZZ8A 4B1LA 2YPJA 4NRMA 4LBMA 3CBNA 5GZCA 5DUUA 1TNFA 1XC6A 1XPWA 4UYBA 3ENRA 4AWDA 4ZPIA 1UZZA 4GJYA 3AL6A 2XJSA 4EWDA 5FWJA 1K45A 3PTYA 3AZZA 3OBRA 3N36A 4RHV3 3ZN5A 1VE0A 3X29B 3V0BB 4JGZA 1HQNA 4W8JA 4XQDA 2VMIA 2W1WA 2PELA 4L99A 4AR2A 1RHI2 3I3QA 4F7ZA 1H8VA 4AI9A 5A1AA 1HIXA 4YNIA 4XJUA 5ANQA 3TB0A 1J84A 3FL7A 4ZXKA 2HBUA 1SLTA 4LBNA 4QPIC 5FPAA 5FYBA 4A3ZA 3D82A 1NE6A 1QGLA 1H9WA 2VMCA 2CGNA 2QQNA 4ASKA 2QUOA 3NJVA 2P37A 3DECA 1YFYA 5H9PA 4YM1A 3E6DA 3UJOA 4CDWC 2WKKA 3ON7A 4BJ0A 2JG8B 2WSVA 2E31A 3HNYM 1J58A 1AL22 5L36A 1GV9A 2R32A 3VBSA 1DQ1A 3LEMA 2BP6A 3GYDA 2XWJB 4W50A 1VBA2 3ZXFA 1W03A 1O5UA 3VD7A 1GWLA 1N47A 5T5LA 2YZ4A 5FYIA 3TAYA 3I3DA 1O7FA 2HWC3 5EJ1B 1TME3 2VUDA 5LA1A 1VBD1 4CDUC 3F2ZA 3K51A 1JXNA 3CO2A 4EROA 4UBGA 2AEZA 1SLIA 3LIGA 3THTA 1RUE2 1JTZX 2AENA 1SPPB 5CVRA 3KMHA 3J8F1 5CFCC 1PVXA 2Q1MA 1S55A 5DAQA 1OLME 2A6YA 3WXPA 4RR3A 5CYYA 4JKKA 2XJRA 1MPXA 5FZ3A 1CGPA 4SBVA 2FZ2A 2QJVA 3LA3A 3T4VA 4UW3A 2LROA 1UOJA 2BWCA 3PNAA 2R042 4NN0A 3W20A 4HFSA 4UBHA 4IE6A 5DG2A 1J3PA 2VW1A 5F32A 2Z2SB 1CAWB 1I9RA 4OHVA 3NAPA 1SBDA 1WZXA 4LKDA 5DAWA 3ZLIA 4YG3A 3WVJA 2ETEA 4CA9A 5IATA 2DUOA 5C4WA 5HXMA 3VZMA 2ZS6B 5T55A 3TN93 1AR73 2YC4A 5ISLA 2HWE1 2ADDA 5FO7B 2E7AA 2HWD2 1ZRRA 3FMGA 1H4GA 4YFWA 4CZSA 4YRDA 3P5BA 4YFZA 4UW5A 3LPFA 1JYIA 3PVBB 2VL4A 3HEIA 5FBJA 2EXIA 5C8CC 3FHIB 4URTA 1GP6A 1L7RA 5IJRA 1OH3A 5F2WA 1GYKA 3GXUA 2BZDA 3KLSA 4KL1A 1J59A 1CIYA 2LRPA 3ILRA 3SXWA 4FSJA 3OGGA 4NR1A 4GIQA 4CSWA 2HEVF 2OUJA 3HN1A 3MYXA 5K9YA 3O5SA 3T08A 2X5IC 1UZ0A 4LULA 5LB6A 1VBE1 4RFT0 3VB9A 3N9PA 1UOBA 1YQ6A 1JH5A 5JI7A 5T54A 2RG4A 5FZKA 3KM5A 1FV2A 1R1ZA 4TWTA 4OI2A 1H1MA 3I2GA 4PLNA 3VBFC 1NA1A 2YY1A 4QX0A 5IAXA 4XVHA 1M4WA 1XQNA 2E7TA 1ZBA2 2QDRA 3PL0A 4UF0B 3WF0A 3ZYJB 4Y1VA 1PMHX 1W6QA 4K1YA 5FZ4A 2EXHA 1WUVA 2QQUA 3EYPA 3RQ0A 3WNNA 5A1LA 3VHNA 3ETQA 4MXWA 2EVXA 5FK8A 1JW6A 4BH9A 3T0BA 2VPVA 1G6NA 2YDEA 2RS33 4W6WA 1WW5A 5CADA 1XYPA 3AM2A 5KWRA 2LW8A 1YI9A 4M01A 1VBB1 4Y20B 3UYJA 4C0HA 4LO8A 3PHMA 4DUXA 5GKAC 2MHFA 4AFCA 3WDWA 3LCPA 4CU6A 1O3SA 5C9AC 1NQJA 3B9IA 5FY7A 1WMXA 2D6PA 1AYN1 4QQ2A 4L2NA 1LCLA 2PHFA 2X29A 4LA2A 3OCPA 4QKFA 4QX3A 3FJSA 5I0TA 2XB6C 3BTYA 2YFZA 2ZABA 3AXEA 4AG4A 5LEKA 2ZHMA 4IGPA 4JV4A 5GM0A 3GCXA 4QPWA 1UMZA 5JMOA 1CWPA 2Y8KA 2Z42A 1HKDA 4X8PA 5FPBA 5IFPA 3V64A 2XKPA 5E89A 4FTEA 3H1MA 3OGSA 2BOIA 3M3EA 3PIGA 4Y5SA 5I8SA 5IK4A 5JOWA 1KDKA 3U0ZA 4IE5A 1MS0A 1KS4A 2Z79A 1V6OA 1FI2A 3GF6A 3BGAA 3IBMA 1XRUA 3DPRB 4K7JA 4R52A 5L19A 2RM23 1X9TA 3RRDA 1K5MA 4ZONA 2NYYA 4HL0A 1I6XA 3VZLA 3PUSA 3V0AA 1DZRA 4NHLA 3GBFA 1NCRC 1E5IA 4DIQA 3WSOA 3FUOA 1RUD2 4FPEA 2E51A 5ANNA 5HCAA 1AHSA 4HPKB 1UU5A 1CJPA 5FYUA 3HJRA 5JOXA 3C7HA 4WVMA 3SCGA 4DXZA 3MW2A 4CCCA 1EPZA 1IPKA 4C90A 2D3SA 2JG9A 4BA6A 4CU9A 2W46A 2D6MA 1Z7S2 2G9FA 1I3HA 4JX0A 5HV0A 3CJIA 5IK5A 4QPGC 4YZ3A 2C6SA 3N7LA 5F2SA 4YZ1A 1YO8A 2ZJCA 1H8TC 5LCWL 2Z69A 4MGIE 4HLTA 1DYKA 3VDBA 4Q4V1 4DINB 2ORXA 3WNXA 1ZZCA 1RUF1 4D94A 3M1HA 4HVQA 4MO3M 5K8SA 1F15A 1XU2A 2BEOA 1C4RA 2A6WA 2L9LA 4Y1UA 2FCTA 3AYCA 5C33A 1YFXA 5F1RA 3WG3A 2A6VA 2J1RA 1OOPB 2CNAA 4FXKB 3JB8A 2P3YA 3U4SA 2XHNA 4O7XA 3M3OA 1T6BX 2W68A 3OBZA 4IV3C 5IT6A 1W6NA 2W39A 1YQ2A 4M00A 4IESA 3TOJA 1VIWB 1MQTA 3RJRA 3B69A 4NHYA 4QGMA 4QXBA 2KXLA 1DU3D 2WNUB 4K3UA 5F5IA 1HRI2 3ES1A 3I3MA 1W04A 3UNPA 3VKNA 1ENXA 4LE4A 1V70A 2XMLA 3FWEA 4OLLA 3ABZA 2PHWA 2HH9A 3ZDVA 1IQAA 3T2QA 3A21A 2VUCA 4DXTA 2AREA 2RMU3 4EWAA 3KD4A 1C5HA 2Z4FA 5FZAA 5IFTA 5FZDA 5C8WA 5DDJ3 4BQ3A 1C3HA 5A33A 2WR9A 2YG0A 1ZBE1 2D6NA 4RQPB 3WR0A 5FPVA 4CEYA 4KQ7A 4K40A 3VBUB 2K46A 4XFBA 5AVAA 3M3CA 1JHJA 4JGYB 3ZFFA 3VD4A 2XOMA 4OCTA 1KQRA 1EUTA 2JE9A 5FZ7A 1LHWA 5K0UB 5JPNB 2WL1A 1EY2A 4IV1A 3K77A 1UYXA 1UWWA 3ECQA 4HSJA 2PAEA 5ABJC 5B4NA 1CR7A 1JYWA 1UF2C 1HJFA 4RYDA 1A8DA 5A6QA 3DV8A 1W8ZA 3OUHA 5DZGA 1GOFA 4N53A 2TUNA 4P02B 1WA6X 5L9RA 3ACHA 2A6XA 2K9ZA 3QACA 1UL9A 1V9U1 3R05A 2GMPA 4KH9A 4GULA 2A5ZA 4J25A 1N1VA 5F5AA 1F5JA 3OY8A 1GZCA 2XBO1 4AAPA 4AQ2A 1XE7A 4YVSC 3H8OA 5AFEA 2OPWA 3C7EA 2W08A 1GOGA 4AHXA 1LODA 2R1DA 3DF0A 4MV2A 4NHMA 2HWB1 1VBD2 1PNFA 4Y1ZA 3ZM8A 2OPKA 2UY8A 2XVKA 2D43A 4CUGA 2CAVA 4FO9A 4PT6A 1BVP1 4KWUA 2WAAA 1CAUA 4H7LA 3MF9A 4NJ4A 2P6CA 2WS91 5GALA 4AEDA 4META 4XC9A 3IT8A 3J8F2 2BPA2 4B7KA 3H42B 4NVPA 1Q8SA 1IKPA 3FHAA 5HI0A 4E4HA 4FPJA 4YPJA 4JDMA 3H3UA 4S2HA 5JPMB 4KWKA 2V4VA 1YXWA 4XF0A 3ZN4A 1DGWX 1LJ7A 1PMIA 4GH4C 5A3WA 1UMIA 1DF0A 4XABA 1WBLA 3S30A 3IPVB 5A70A 3V0BA 2PLV1 2ARBA 3RNSA 2WABA 2RDSA 4AHYA 4RGAA 4FTSA 1W9SA 3NRUA 4P9LA 2K0GA 2B9UA 1UKRA 3NL1A 5FP3A 4LT5A 4DY5A 3T1MA 4XUQA 3WW4A 4BQ1A 3WT3A 2ZGMA 2HWE2 1PO13 3AFKA 3MV11 3TBDA 4LA3A 2HLEA 3NMBA 4YM3A 2ZAHA 4AFAA 3BUCA 4E4SA 3J7NA 4PDWB 4M3CF 1UX6A 2D97A 2V5YA 2VECA 3ZFEB 5GZDA 3LIHA 2JG8A 2WFF3 2ZA9A 3JZVA 2D3PA 4IEQA 3MIGA 2CYFA 2PTMA 3KHBA 3KZ4C 2VE1A 5LY2A 2G9ZA 2VZPA 2J7MA 4MGZE 3MO4A 1CQ9A 4W6XA 4XUPA 3URFA 3VBRB 3RGBA 2R063 4FPCA 3W9AA 3OOXA 3T09A 5FZEA 5C71A 5FPZA 1YCIA 5T52A 4ZZ5A 1VBE2 1UXZA 3F95A 3DL3A 3H1WA 4AI2A 4P5YA 4DUWA 4COZA 1GBGA 4QX1A 1ZRDA 1GWMA 2JB4A 5KHIA 2GSYA 2Q0AA 5I8TA 2JDUA 3AC0A 2AUYA 4Y3OA 1OURA 1U5XA 1SPPA 3HQRA 4PIYA 1OD3A 1RJ7A 2VD7A 4HOOA 1PO21 4LR4A 4XFFA 1P8JA 4LNVA 1JYCA 1OFSA 5C3QA 4BPZA 4M4RA 5C9AB 1RHI3 1KFUL 2FZ1A 3OPZA 3PDQA 5F6KA 4WVZA 5FZ1A 2FDIA 1VB2A 1VBB2 4YW6A 4D6QA 5FYCA 2ZX3A 3UGFA 2P3KA 4U2AA 1CAXB 1PM7A 2CGOA 1T2XA 4AL9A 1CAWA 1LTEA 1OUSA 3MIEA 1C8M2 3CF6E 1PMJX 3VBOC 1WMEA 1H6XA 3I97A 3KQ4B 5JIAA 4XACA 2Y26A 1AYN2 2W1QA 4K1ZA 1SHWB 3LDRA 3MUY1 2UWAA 3HT1A 1Q8VA 3HWJA 3VLBB 1W2UA 2WWJA 1GNYA 1YLLA 2FDKA 1AL23 1XYOA 4OI0A 2ZEZA 3AZWA 2MPFA 4QU2A 1GP4A 1XSQA 1W6PB 1VBA3 2YC0A 1JI6A 4CYDA 1SDDB 2A73B 1AYM1 3KF5A 4GMP1 4RGGA 5DPNA 2UURA 5A3UA 2IVJA 3AX4A 1LU1A 4K21A 3HNMA 3UKTA 2ERFA 2QZ3A 1XBFA 3ILNA 5LEJA 1NCRB 2Q4SA 2QTWB 2YXSA 1Y43B 4TXWA 4B1MA 4B3NA 2ES3A 1YC61 1ZZ7A 3IIAA 2E53A 2PFWA 1DBNA 4AQ6A 3SCHA 4XURA 1XXNA 2BFUL 4PHZA 2ZGNA 1AZDA 1D2QA 2P5BA 2GC1A 2MEV1 4LHNA 1LGBA 4QX8A 4BLIA 3S5AA 4OZOA 5C3PA 3DN7A 3ZDSA 1LOFA 4Q8LA 3ZFGC 1RINA 1ASJ1 2IXKA 3WD5A 1REFA 4AGVA 5CFDC 1VPHA 2UU8A 1S2KA 4LHLA 5LA0A 3ZYIB 5FZGA 2PA7A 3L9JT 4IQPA 4UF0A 2R043 5EXOA 1UIJA 2Q5TA 4FAGA 4M3CE 5FZCA 5JLVA 4Z92B 4ONUA 4A6OA 2WT0A 1LU2A 3D6EA 4E2SA 3E1F1 3HPNA 5EZWA 2N7GA 5A6ZA 1KGYA 4HBNA 2P3JA 3MIDA 5FOBB 2ZX2A 3S6PA 1LEMA 4Q4V2 4XXAA 4XIKA 4XF3A 1RUF2 2WRAA 1Q8QA 1QIQA 3BU0A 2AYHA 3MHZA 2UYAA 4PQ9A 1RUI1 2HWD3 5AC91 1E57A 4IV3B 4NE9A 3SNMA 4Q27A 1DQ2A 1O4TA 2B8MA 3BCWA 3ZSKA 1DYOA 1QOSA 3FX3A 4JKLA 4QMAA 5LA9A 1JBCA 2W9XA 1H30A 3ACIA 2RR11 1A3KA 1D0HA 4B29A 4NIHA 1IS4A 2IXCA 4ZKTB 2P17A 1L7LA 2DCZA 1QNWA 2X10A 1VMHA 3KV6A 1RUJ1 3K75B 5HCBA 3SC7X 5KR7A 5JI9A 2BNMA 3AYAA 2JKXA 1LHNA 1N3QA 5FY1A 3S7IA 4A7ZA 4AFBA 4XFAA 3M7AA 5KHGA 1JZ5A 1IZ3A 3IAPA 2J1VA 5FMDA 5JUVA 5A6YA 1R081 3LQCA 2B5HA 3DPRA 3CZJA 5IUQA 1UZVA 4RD7A 3RG0A 1ONAA 5FYTA 5FZOB 1QJU1 3OGVA 4OI4A 5KHHA 1AX2A 1F2NA 2Y6GA 3N7JA 4XJ9A 3J7LA 4KU7A 1ULDA 1ZBA3 4LIVA 1LKNA 1ZBE2 1DDLA 5E16A 4I2OA 1O6UA 4AEMA 2VBDA 2XR4A 4HPKA 1NE4A 4YM0A 1DGWA 1GLHA 2EAAA 2ENRA 1GKBA 3OUIA 2D6KA 2A71A 2VNGA 1VJ2A 4XUNA 3WDYA 1IG3A 3U11A 2Y6HA 3KS7A 3WHTA 1AF9A 4C8DA 2GC2A 5JZGC 1XJAA 3AKRA 3M70A 3I7DA 4PF1A 4QHOA 2V73A 1HLCA 4P08A 2WLQA 2VMHA 1D4VB 1C28A 5BV6A 1F8VA 3EJKA 4H55A 3IDAA 3KVAA 3D3AA 4I30A 2FDHA 4AEJA 3O1UA 1FMD1 4YVSB 4OQ9A 2OQ6A 3MPBA 5BNPC 4MGQA 4AVTA 1APNA 1HB4A 5APAA 1V9U2 4TN7A 2YFUA 3AZYA 4CU7A 2CY6A 3KGZA 4LLFA 2XBO2 2ZEYA 2PN5A 1YNAA 1OOPA 4AVAA 1DLCA 2KM2A 1QJY1 3FBMA 4QGNA 2VMEA 2QBXA 4L0PA 4RGKA 3AJYA 4R4ZA 4L8QA 4IE0A 2AH2A 1NQDA 3WG1A 2HWB2 2CGPA 3LE0A 2ZKNA 4QQHA 1ND3C 3ELNA 1AXKA 2EAKA 2LS6A 2WS92 2WNUA 1X7NA 2HYKA 4XBQA 4RS5C 3MUZ1 2YPDA 5FY4A 4NAMA 4GQ7A 3CZUA 1WMDA 2VQ0A 4NWVA 3AZVA 5AVPA 1LESA 4AI8A 1QJX1 2BBAA 2BOJA 2GH2A 4IEZA 4NIDA 2VZUA 4MHUA 2YC2A 1RUD3 5CB7A 3GDBA 5FXZA 4PLMA 4ISRA 3IDEA 3SH3A 2QQWA 4CPBA 5DG1A 1MZEA 5D8AB 5EWSA 5IK8A 2PLV2 4RQPA 5LBFA 4FOQA 2BDRA 1Z7S3 1DIWA 3VBUA 2H0BA 2WIIB 4IE7A 3O0XA 4JGYA 1YIPA 4N43C 3A23A 2P6HA 2VXRA 1FOD1 5A32A 5K0UA 1G9AA 2OYZA 5FDBA 4NROA 2EXKA 2VZOA 4R9DA 4BQXA 1O3RA 4WM7C 1NX9A 2X53S 3LWCA 4XTPA 3RZZA 3NJXA 5IVVA 3KHCA 3CLPA 3EBRA 4P9XA 2BV4A 1PVC1 4AVBA 3DUIA 3WNLA 2DV9A 4A2UA 1NZIA 4RL7A 3B94A 4FPFA 4NO4A 3O1PA 1UY4A 4CDXA 3WOGA 2EF6A 2PQSA 5FUNA 3CNAA 4OULA 4QQLA 2DWRA 4QDQA 4XDOA 1Y9GA 4QQPA 1X36A 4CP2A 2BBVA 1NY72 2YGLA 3U78A 3UKNA 2D40A 4BK4A 2OX0A 1N1TA 2Z5WA 2WQ8A 2ZX1A 1JU4A 4C1XA 2Q30A 2JDNA 2YMZA 2DFCA 4PIZA 1YHFA 2DF7A 1GSLA 3GBWA 1NZCA 2DVGA 1PK6B 1ZX5A 2O14A 4TSVA 3FZ3A 3LOIA 1HRI3 3LFMA 1J3RA 2XUEA 1ENRA 3JD71 4JHZA 4QKNA 1KEXA 4QHBA 2VZ1A 2CV6A 1UY1A 3VHPA 2E9QA 2A3XA 3M8LA 1MS3A 1HRV1 3KT7A 3ZKYA 2W0XA 2ET1A 2ZGSA 4UW6A 1HB2A 1PO22 1D4M1 1Y7BA 1HDKA 1AR81 4NUBA 2VTXA 4XE9A 3FFQA 1NT0A 5LA2A 5C5UA 3CDZB 2BYVE 2D6LX 1QY4A 1W8OA 3W5NA 3IPVA 5FREA 3I2OA 2BNNA 1EPWA 4CXWA 4X6RB 2DUQA 5F8PA 4HK8A 1IPJA 1CX1A 2Y0OA 2Y6FA 2VG9A 2Y38A 1W8WA 3WP6A 1RIRA 1PHMA 1OQ1A 4A42A 4P00B 3OUJA 1LHVA 2XJVA 4YGEA 4J1WA 3PUIA 3VZJA 5L73A 1G9CA 2ZHKA 1OUXA 5FP4A 3RPQA 2XPJA 1F9KA 3NV2A 3FHQA 4LO6B 1J1LA 1D7PM 4PDWA 2R071 2ZPXA 4TYSA 4YGCA 1NCQC 1XNKA 3ZFEA 5J96B 2E6VA 1AYM2 2DBIA 2VZTA 2XG3A 3VBHB 1JUHA 3KB5A 4NAOA 3WUCA 3RYKA 2DFBA 2XLAA 5A80A 3RWNA 2NPIA 3LEKA 3VBRA 4BDVB 1VBD3 1WCSA 4LTAA 4FVVA 2UY9A 4WM8C 2VVEA 5FY0A 3C2UA 3GCWA 1U0AA 3LEIA 4QX2A 4XOGA 1B35B 1VAKA 3EMRA 2WT2A 2MEV2 3ZKUA 1MZ6A 4QT6A 4AF9A 4WVWA 2ATFA 5KHKA 4XIOA 4OHWA 1QDCA 1W6MB 1L3JA 2CU5A 3J8F3 3MW4A 4QKBA 4EZ4A 5FUPA 1FAYA 1QU0A 2VVDA 3H3ZA 1ASJ2 5IVYA 3ZPOA 4YW2A 2VR4A 4AGGA 3I2DA 3N7KA 1HXS2 4ZU5A 2BTVC 2DDUA 4EN6B 1QWRA 1WGPA 2WNVB 4YZ5A 3I8TA 1U5ZA 4IETA 4MZUA 5DZEA 2VGDA 1AL0G 5JZGA 1UY3A 2B7YA 2ZBJA 2OA2A 3I2FA 3V65A 1QKQA 4EWEA 4N90A 5C9AA 3I59B 1GUIA 4I01A 4MX3A 2DVBA 3H0OA 3NO8A 4KWJA 4LBQD 5FYYA 4C91A 1CAXA 5HCFA 4Y4YA 4OUMA 1QH7A 3E5QA 3M3QA 4PBPA 4XILA 2HWE3 1RUI2 3A22A 2ZMKA 3Q8CA 3JUUA 5AC92 3GJBA 2DTWA 4NPLA 4Y5TA 3O0WA 2VW0A 4QM9A 1G8WA 1QXJA 1XNDA 1JYTA 3I2HA 5DAVA 2RR12 4DO0A 3C7OA 1Q8OA 3POSA 1NLSA 4CCNA 1UOGA 3LFIA 3OEBA 1UZYA 4A7KA 1RUJ2 5FZFA 5J98B 4V2WA 1QJEA 1W6PA 1AR91 3K3NA 2ZEXA 3KSCA 3BB6A 3HN3A 2WN2A 2XLFA 1ND2B 2R0HA 5LASA 4OUSA 2QKDA 4IEUA 1OD5A 1VBE3 1WCDJ 2O1QA 2OXBA 3OD0A 2E32A 4JGZC 3ASIA 4LHSA 5DN2A 4MXVA 3ROUA 2SLIA 4D6RA 2V72A 1R082 4DXRA 2FCUA 5CG9A 1OQEA 3UL2A 1OA4A 5G05L 2X05A 4CCKA 1QJU2 2VNOA 2JXAA 2F4LA 2IUWA 4Q0VA 3QBQA 1F4AA 2B46X 4RN5A 4CEWA 5CG8A 1K12A 4D0QA 2XJTA 1YWKA 3KT1A 1DFQA 1QXPA 5JZGB 4GKXA 3ZYHA 2JDKA 1XE0A 3E5UA 1DG6A 5JMCA 4N8MA 2HWF1 3RI8A 3H3LA 4OYUA 4K6BA 1NXMA 1ACCA 2R0FA 3VHOA 3E97A 2ZX0A 1EV11 3WEZA 4A45A 5C70A 2WNEA 4YG6A 1VBB3 5JXGA 4ES8A 1YFWA 5JIUA 4WZFA 1WLDA 5B2GB 1JZ3A 5BNPB 3RSJA 1W3VA 1POV1 5HBAA 4FP2A 1C8M3 3VBSC 4MSVA 4WV8A 4ASMB 1SACA 1AXYA 5FQ0B 1F31A 1BVVA 1V00A 4MVTA 1LOAA 1AYN3 2WSUA 3MICA 1OMIA 1WWYA 5BNOB 4XHXA 1FMD2 2WZPP 3LA2A 2GNDA 3WP3A 3MIFA 4YWAA 4LO4B 4GXLA 2D93A 1DYPA 4FP3A 1UN1A 2VNVA 4IV3A 4PQQA 4S2FA 1L7QA 2PHRA 1LOBA 5ACA1 1LOGA 3VZKA 3VKOA 1QJY2 4Q4Y1 4AW7A 4IEOA 4GA9A 1PZ9A 2PHXA 3SQOA 5IVEA 4BQ2A 1A6CA 1V6IA 3T2OA 2JJ6A 4BM8A 4Q8KA 3N9NA 1NUKA 3PJQA 2YBPA 3DXUA 5A7SA 3AKSA 2VH9A 3KV4A 3LSDA 4IGQA 2H0VA 1MS8A 5FIXA 1S0IA 1SBFA 5FYVA 5C3RA 5LWBA 5BNNB 5A3LA 3NAPC 3AP6A 4CDQB 4AAXA 1IS6A 4OVEA 2WZR1 1UCXA 1QJX2 2WO3A 3GBGA 4ZS2A 4ET7A 4JDNA 3WQ7A 1UOFA 4LQRA 2F4PA 3A0KA 1VBC1 5FZOA 5DXDA 4EN0A 5C4WC 4KMQA 5FMOL 1OA2A 2WO7A 2DTYA 3OF1A 2VOVA 3QCWA 5K4LA 2R1BA 4Q29A 1OVPA 4Y22A 4WM7B 2CTVA 1FT9A 1ULGA 4FFHA 4LUMA 2VZVA 4ZU4A 1FOD2 1T6GC 2ZGLA 4V1PA 2Y6KA 2WZ8A 4H2AA 3FUQA 4XETA 5CZKA 4Q4V3 2I74A 4G9SB 5BYNA 1RUF3 2EXJA 4KGGA 1UAIA 5IVFA 1CPMA 1PVC2 2JB8A 5C3SA 3NV3A 1KDMA 1OBNA 4NOTA 2GU9A 5FCCA 4CCOA 4DB5A 2PHLA 1US2A 3WF3A 4FPOB 5IW0A 3GZTB 3WNOA 1COV1 4YVSA 4NHXA 5L7OA 3WNMA 5JSRA 3B93A 4BU2A 2WJSA 1ZRFA 3HIFA 1IKQA 3PUAA 2ORZA 1OF3A 4P14A 4I0BA 1ALYA 2YU2A 4UAPA 1OPOA 1NA1C 4KU8A 5FZ9A 2RS51 2WA3A 4R4XA 2JX9A 3H7YA 5IWFA 3BTAA 3LB9A 3DYMA 1W8HA 3IM0A 2D6OX 2ID4A 2C26A 3RFRA 3JD72 5GZFA 3OB8A 3D0JA 5EP9A 1W9WA 4AEKA 4XTMA 2YBKA 2AEYA 1HRV2 5B4XA 1TQ5A 4A6SA 2VTFA 3U1XA 3BOPA 5GLWA 1OC1A 3AZXA 2XL7A 3APBA 1D4M2 3WCRA 5GZGA 4XQWA 2KA3A 1W90A 1MVEA 3PUQA 1UYYA 4Y26A 5C6CA 1DGRN 1LRHA 3N7MA 5FJKA 3K48A 5J48A 5LY1A 3S5QA 4CP9B 5D8AA 3KCXA 4QPIB 3VKFC 3B00A 4LKSA 4GWJA 5JWPA 4AK3A 3PURA 5DAXA 1QF3A 2OW4A 4GMP0 3HQXA 1VMFA 3AVSA 2JICA 4CDWB 4XUTA 4OFGA 5FP9A 2BWAA 3NV1A 4Z8BA 3N9OA 4BLJA 4CE8A 3SKJE 2VW2A 3GZAA 2I07B 2J42A 4Z07A 2W94A 1NOVA 3B9CA 3ITQA 4D7YA 1OFNA 3TRSB 3WQ0A 1V9U3 2VO5A 4AVVA 5D21A 3POEA 2R072 3HNBM 4KGQA 4QXCA 2CWSA 3NNJA 1URXA 1MZ5A 4CDUB 1SCRA 1RXFA 5IK7A 1DQ0A 3IN9A 4L92A 1HB3A 2E26A 2NLRA 5IVCA 2HEYF 2HWB3 4JKMA 3JXSA 5FJHA 2BQPA 4Y33A 1LENA 2R16A 3AB0A 1OA3A 5FYHA 2XXZA 3GGLA 3OPWA 1OLMA 5CFCB 3RZKA 1PK6A 3U37A 2PYTA 2WS93 1VRH1 2JG9C 3LEGA 3WINE 3AP7A 1FNZA 4HKWA 1YJKA 1R64A 4QXKA 2GC3A 3CJIC 1W0OA 2WQ4A 3B3QE 1QEXA 2VZSA 2IXHA 3MGUA 1LECA 1H2NA 4UOJA 1Y4WA 1WW7A 2XJQA 3WDXA 2QQLA 1SFNA 3LPGA 5GZEA 5JOYA 1EP0A 4PCRA 1PZ7A 4FXGB 5LW9A 2GN3A 1YRZA 3WX5A 2A70A 5FTTC 5FKBA 4I0AA 2PLV3 4P9IA 4QB6A 4PF5A 3SLIA 4Q4W1 1NAEA 5F6LB 1Y3TA 5IYYA 4ZS3A 2Y34A 1JOBA 1R1A1 4Z1VA 1RC6A 2DBNA 5A3TA 3ZXKA 1CONA 3G7DA 4XFHA 2NQYA 4Y4RA 3ZYPA 1FPN1 1KS5A 1GNZA 3H8RA 5F7UA 1QJFA 1CJDA 3T2PA 4URAA 1VB4A 4Q4X1 1MQTC 4L11A 1TMF3 3MW3A 2DVAA 3PVNA 3VD9A 4KI5M 1OT5A 2DCJA 3PU8A 2QQOA 5DAPA 1WCUA 2EIBA 2JD4A 3K2OA 3AMPA 4EE2A 3MV01 4YLZA 2BRTA 2ZCWA 4AHWA 1DZTA 3ZO0B 5JSPA 3BVCA 2JD9A 2X5IB 1AR92 2X09A 2ZKLA 1PGW1 5FZMA 2I45A 2VC9A 2GNBA 3VBHA 3I2JA 2W47A 5FY8A 2QDNA 1AJOA 5F5QA 4UFKA 3HQUA 4CEYC 3OGRA 4FPLA 4TLGA 3VBFB 1GP5A 1JMUB 3ZFFC 3P1IA 1UU6A 3FFZA 4M3CB 4JRAA 1B35A 1W2TA 5C8CB 3KV5A 4IV1C 2A7AA 3FLRA 1W6MA 2Y64A 1PO11 4JGZB 2JKBA 3ZX7A 1ZA4A 1PO23 4LUKA 1X8EA 4A3XA 4GKYA 3ACGA 2HWF2 5J09A 4ASLA 2WNVA 1VMJA 2WDBA 4N53C 1EV12 3SEEA 2WINB 2DCKA 1W0NA 1SLAA 4Y1YA 5FYMA 4CVUA 1W05A 2VAUA 1O8PA 2Q1FA 4NMIA 2EICA 2GP5A 2QVSB 4BMEA 2VOWA 3I59A 4CCDA 3J7MA 3ZIXA 5FY9A 1XNTA 4PIXA 4UWDA 4EQVA 5FLJA 3GHNA 4INDA 1RMU1 1F5FA 3E6BA 3HD8B 1O59A 1TVGA 4LBJA 1I1EA 4MH0E 4BCUA 3UETA 1ZVFA 1BK0A 4JRLA 1PGL1 1IOAA 3N9MA 1FATA 3POYA 5A3OA 4HT1T 5ACA2 3QOPA 2VULA 2O0OA 1W8FA 5A7WB 1BKZA 4FPGA 2QQIA 4B4QA 4AEDC 3KT4A 4GMP3 1AYM3 1X9PA 4Q4Y2 4MG2A 1NLRA 2WLPA 3P3NA 2D7FA 4XYXA 4M0NA 3B01A 4UI9L 3WW3A 1RXGA 4LKFA 1ST8A 1H0BA 4LORA 4DPNA 1G9FA 1OVSA 4M0HA 1ND2A 3MEPA 5A3MA 3IB3A 3RWKX 4Z82A 2WYSA 2DU0A 2MEV3 2ZGPA 4JC1A 1JZ7A 2OUHA 4YW7A 3QH6A 1BYHA 3AYDA 1W2OA 3CHXA 4HVOA 3H8XA 1UPIA 3MFCA 2IZWA 2WZR2 3JB4C 3LA7A 1ASJ3 1RUE3 1W9FA 2QZ2A 1MEC1 1HXS3 1VBC2 4E2GA 4TZDA 2GMEA 1B09A 2VUJA 5DUWA 3BU7A 3TNPB 1LULA 2HBTA 2V4AA 3B5LB 4QPGB 1MVQA 1PM4A 3UGHA 3WF1A 4ARXA 4C0BA 3VGIA 1H8TB 2Y6LA 3VDCA 1N1YA 1RUH1 3VHRA 1X82A 5BPXA 3NWKA 4IDZA 1X8MA 4YG0A 1CESA 2JG8C 2LALA 4HETA 4PI2A 3VKLA 4A41A 1MS4A 2I2SA 3CJXA 2XL9A 1A78A 3NNFA 2RJ2A 4YGDA 5A7NA 5T5JA 1WA4A 4NIAA 3JU9A 5C7GA 4QXHA 5JAXA 1SEFA 1TZOA 1ULOA 4Y20A 4BIFA 4CUAA 1RUI3 2WN3A 1YUDA 3U10A 1ODMA 5AC93 2BW8A 1S0BA 1YQ5A 3CU7A 3O7OA 4G3YC 4ZY9A 3VZNA 1RUOA 5BNOA 4XJAA 1COV2 4EJRA 2RR13 2HJIA 1Y9QA 3MPPG 1H6YA 1UW8A 4QQOA 4DEVA 2VTXJ 4I09A 5CEHA 4YGBA 4HXCA 4IL7A 3M4FA 5IHRA 3KGLA 5FY5A 1RUJ3 3W59A 5FO9B 3W21A 3M3IA 3O12A 3ZPYA 2P34A 4Y24A 2RS52 4YYOA 4AZZA 1ENQA 2FHRA 3DEMA 1OKQA 4DNYA 5FAXA 3AP9A 4JAAA 1CAVB 3O14A 2Y6JA 4XF9A 1W8NA 3ZN6B 4CP1A 5FZBA 3RMYA 3ACLA 1W6OB 2B9VA 1R083 5FKCA 1SMVA 2V5DA 3NNMA 2VCAA 3GM8A 3S57A 3I54A 1XNAA 1QJU3 4OHXA 1S0DA 1JHNA 2P3IA 3ME2A 5J7MA 2DCYA 4S2DA 5BNNA 2ARXA 3S0MA 4CDQA 4MLOA 3RYPA 4FQ4A 1QQP1 4R9AA 1RVF1 2DVDA 4LKEA 5F3GA 3GZUC 4DQAA 1ZNPA 4AE2A 5K7PA 4NPMA 4LEJA 5LBBA 5KHJA 5ABJB 1BEV1 1AUYA 4W65A 3BODA 1J83A 2G1MA 1RYYA 2CSGA 1UKGA 2DURA 3OBTA 4MOAA 4DRRA 4Z2WA 1O3QA 1LB2A 4XDQA 3TNQA 2ZGOA 4Q0UA 4IEPA 4AQTA 1W2AX 3R0RA 4BQWA 5JSOA 1QOOA 2JWPA 2IC1A 5FZ0A 1FMD3 4L97A 5FK7A 5F3IA 1LNSA 2JECA 3POGA 2XUMA 1HV1A 3ZSLA 2WZEA 4NHKA 2A1XA 4XBNA 3ES4A 3FBYA 3P3PA 4CXXA 3O1OA 4OUEA 1QJY3 4OHYA 1WCKA 2GAUA 2XKOA 4KG8A 4UFJA 1LOFC 1PIV1 5I0UA 3MZHA 4XPVA 1KD7A 2RS11 4O61A 4Q1RA 3DYPA 3SKVA 3IZOA 3J9SA 3RZHA 4WBBA 4ZXEA 4D8MA 4HANA 4AI3A 4BZ4A 4HONA 4P5HA 3NVCA 4JTNA 1VRH2 4QHZA 2RJLA 1RUG1 2W1SA 2G4IA 2QQKA 2JIGA 2LTNA 1JZ6A 4CUCA 1R091 2XQRA 3IDCB 4YW4A 4ZZ8A 3E6CC 1QJX3 2W3JA 5I8YA 4GH4B 4HG6B 3T30A 1ZREA 5FYZA 1D0GA 4I02A 5GLTA 3TEWA 2QQVA 4GB31 3N35A 1IPSA 3Q9OA 5LZ6A 5DMYA 5I93A 3POIA 1UZWA 2WYFA 3QLQA 1YQ8A 2OS2A 1GFF2 1OXCA 4Q4W2 4E8CA 4XCAA 2IXLA 4ITCA 1N3OA 4XMIA 1FOD3 1YQCA 4GJZA 1R1A2 1SDWA 2RDQA 4CP9A 4QPIA 2GDFA 1IS5A 3FC0A 2VBBA 4LITA 4N7IA 4YVWC 2GMMA 4OQ8A 4GWNA 3K4DA 5T3NA 4MHRA 1FPN2 2WWUA 3T1LA 3P6BA 4O65A 1DQ4A 1GZ9A 2B4KA 3LZZA 4GWMA 3FLPA 1PVC3 1CZVA 4CDWA 3ZMNA 2VQUA 3HR9A 4Q4X2 2OKXA 2D44A 3USSA 1NYWA 1ZZ9A 2H6BA 2IVIB 5M0TA 1GOHA 1X33A 2VMDA 5KXDA 3K46A 2JEMA 1ULEA 4MYEA 2TBVA 3DPRC 3L2YA 5IVBA 1AX0A 4OHZA 4NIGA 1SFPA 1PGW2 1LAJA 2FCVA 1O5LA 2VOXA 1W39A 4DXSA 4CDUA 2QFEA 1K5JA 1GQHA 1Q56A 1RUC1 3AFGA 1SLCA 4QM8A 4PLOA 5EHDA 3CL1A 3JD73 3ZXDA 1A8MA 1SCSA 3ZSEA 1SZBA 2ZZJA 1S1AA 5J1XA 2LM3A 1AR61 1UNBA 2VOTA 5JR7B 4ZU7A 5CFCA 1HRV3 1POV0 1LHOA 4N53B 2ZHNA 4H7MA 4IGOA 3D0SA 1KITA 3C7GA 4AHZA 4D7TA 3QH7A 2YGMA 4COYA 4DZGA 4JHTA 1EAH1 1C5IA 3UT0A 1JYXA 3ILFA 5CKQA 5EYXA 4IEXA 3VDDC 2UWCA 3KV9A 2CWMA 1UY2A 4NRPA 3JBG1 1E5RA 1Q5OA 1Q8PA 1S4CA 2VZ3A 1O4YA 1PNGA 2Q8EA 2XVLA 3PVOA 4QX5A 2XQXA 3VBOB 4BQYA 1GQGA 5EYYA 2SBAA 5BXXA 2BGCA 2YUEA 3LGRA 4AVSA 2YROA 3BKZA 3Q8EA 1U5IA 4I3PA 5E8AA 3ZXJA 1BBT1 1OOPC 1RMU2 3H8UA 3OYWB 5I0SA 3K4ZA 4GWIA 4R8HA 2ZGRA 3NJYA 1XU1A 1PGL2 2ARAA 3H7JA 2W92A 5LK5A 3THPA 2OVUA 2CAUA 4BE3A 3BPZA 3LDKA 2JIJA 5FXVA 2R073 2WAOA 3NNGA 5JXJA 1FX5A 2WNUC 5JVVA 2W2IA 4DY3A 4NPRA 2GALA 4YM2A 1MS1A 4HKOA 3WLUA 3WCSA 1VP6A 5CKMA 3T0DA 1WMFA 4OI1A 1W3XA 3O1TA 4IEVA 2X5IA 4KNCA 1EUUA 4RHV1 4N7UA 1US3A 2ZGKA 2ET7A 1MACA 3PMEA 3ZFGB 2WC2A 2EA7A 2KD7A 2Y33A 4RQPC 1SLLA 2GNMA 4HK9A 3VBUC 3RZMA 5FLIA 4PBOA 3VBFA 5CFDB 5F9TA 4JGYC 1S0GA 4C1WA 5F5CA 1STMA 1BJQA 3ZXAC 4B4PA 1H2KA 4M3CA 1MEC2 5K0UC 2ZX4A 2RDNA 4HZFA 5CU1A 5C8CA 1YEWA 2RDRA 3Q8BA 4HMZA 4I3GA 1LEDA 1CD3G 1LR5A 2W5FA 2JDHA 3ZR6A 3AJZA 1A34A 2BVVA 4I0WB 4XBLA 1GANA 1V6KA 4P9WA 3WUDA 1G9BA 3AP4A 4EN7B 1ODNA 3A4UA 2VCCA 1W8UA 1RUH2 2UYBA 5DUVA 4CUBA 4CDXC 3WHUA 2FD8A 2EIEA 2XDVA 3GALA 3TEZA 3LAGA 3AL5A 1JUIA 2GC0A 4FOYA 3JQXA 3MIHA 3LDBA 1LHUA 2RHPA 3GNEA 2PQQA 1G9DA 3CKHA 3VKMA 2EIGA 3HBKA 4LO5B 2HWC1 2IFRA 1TME1 2FBEA 1W99A 4FPYA 3ZSJA 3VDAA 2NMOA 5A7PA 4CU8A 4EV0A 5A3PA 1HQWA 1KXGA 3WDUA 2VMGA 2TEPA 5LBCA 3PLQA 3RMXA 4HVRA 2VQAA 4XFGA 3O1SA 3I49A 5A7WA 1AR93 2R30A 3IKWA 3I3EA 4Q0QA 1D2SA 3WZ1A 5H9QA 3EQEA 1S0JA 3ZYGA 1F4HA 1EYBA 1LGNA 2YYOA 1K42A 3DYOA 1OSGA 3VD5A 4KG0A 3R4DB 5EV7A 5A1FA 1NCRA 4JZRA 3H50A 3IIIA 3ZYBA 1O4ZA 3J7HA 1JODA 1HN1A 1JZ2A 1HJGA 2VNRA 2HEWF 2AGSA 5CIRA 5EFUA 1NG0A 1QQP2 2XH6A 3TEYA 1RVF2 3TN91 1AR71 1GZWB 4AFDA 4IEWA 2HWF3 2F17A 1DCSA 4H3WA 4CPBD 2WA4A 1EV13 1BHGA 2YB7A 1BEV2 4QPGA 3WY6A 2W95A 5CA6A 2QCSB 1H8TA 1QH6A 1POV3 4XEZA 4PDWC 1ZZ6A 2XGXA 2XVGA 4Q0PA 3ZFEC 3B02A 3WW2A 5I0RA 3NQHA 3KCCA 4QKDA 5FMCA 1QHDA 5SV5A 5J37A 2J1TA 2YU1A 3UGGA 5GLUA 1UIKA 1VAMA 1W06A 3VBRC 5KBFA 3POWA 4KBZA 3VV1A 2WFPA 4XQ4A 2GH8A 3PMSA 5ACA3 1UD1A 3USUB 3MLLA 1WLCA 4N9IA 2GP3A 3IMNA 4DMIA 3POJA 3EHKA 5HPOA 2P2KA 4Q4Y3 5A7OA 1V6NA 5FR3A 4AFMA 1PIV2 1IHMA 1ND3B 3BTZA 3FLTA 2RS12 1RJ8A 2B45X 5E1RA 1YFUA 3ALQA 4LBOA 4MGSA 2XJPA 5E6HA 3SISA 4RS5B 4A4AA 1MZFA 3UESA 4BHPA 3AXDA 1CAVA 4RR3C 2RS31 2HKXA 3ACFA 3ZN6A 4BIOA 1RUG2 1C8M1 4QDRA 1W6OA 5JCTA 3RDIA 1HX6A 1R092 2WZR3 5DABA 1DGLA 1GU3A 5IAVA 4UFMA 3VL8A 1VBC3 4FBFA 4GB32 3CQOA 4JQTA 2BFUS 1UQXA 2DCTA 1WW4A 1WKYA 2W87A 3GHMA 5FLHA 4N43B 4KWLA 4XHBA 4YVWB 1UYZA 5AFBA 4AYUA 1DHKB 4E4DX 4CRQA 1TEIA 2FDGA 1V6LA 3ZMOA 4WZCA 4BOWA 1H1AA 4MUVA 3NJZA 5ABJA 4FOWA 2PHDA 4IERA 1WW6A 2W91A 4LXLA 5A7QA 2IXJA 4Q1PA 1OLRA 1GR3A 1VRBA 3OGJA 4LLOA 4G4FA 1MS5A 2R7EB 1COV3 2TNFA 1BMV1 4K20A 4CCJA 1YIFA 2VVFA 2RM21 5H9SA 4P9GA 4BK5A 3A7QA 2B39A 3PVEA 3VUOA 1QNYA 2IWGB 3NNLA 2Y0IA 2C4XA 2JENA 2OIIA 5GJ6A 3ETPA 3HAGA 1LOEA 3THDA 2RS53 1QDOA 4CEWC 1UXXX 1Y9MA 2D3RA 4V2VA 3WQ1A 1MR5A 1W2NA 5FZ6A 1RUC2 4YSFA 2XWBB 4QB1A 4BISA 1CZTA 1H1IA 3RI9A 1O3TA 2CL2A 4LBQB 3RJ2X 4LK6A 3VDDB 2H6CA 4D7SA 1H9PA 1QJZA 1AR62 4CP0A 1GNHA 1H2MA 1Q43A 2DUPA 2VMFA 2ZGTA 2ZTNA 4K9SA 4BYYA 2ZMNA 2NP0A 4XJZA 2BNOA 3I4IA 4N9HA 4D6SA 3D4KA 3NV4A 4GD4A 5CISA 4GZ9A 1EAH2 4Y5Z0 4GH4A 3CIHA 1JZ4A 4UFIA 2J1UA 5F3EA 1AR82 1C1FA 1ZBE3 3JBG2 3BOWA 3LKJA 5H9RA 2JDZA 1DGRA 5L9VA 5LK7B 1CX4A 3WQBA 4HN1A 1SQ4A 2YHJA 4FOVA 4RFRB 1HW5A 4MGKE 3DKWA 4H14A 4XZUG 2RE9A 1HN0A 3N9QA 1VLNA 1BBT2 4AXOA 3D5OA 2MNGA 5TSWA 3UJQA 2GN7A 4B4RA 2XLGA 3N9LA 1DQ6A 3ST7A 3AVRA 2VY0A 1CZSA 2R49A 3KQRA 3RS6A 1NCQB 3WG4A 2RVAA 2ZXQA 3U14A 3ZXEA 1JS9A 4R9CA 4P9YA 1S2EA 3DXTA 1IG0A 2IXIA 3O0VA 4BXFA 4MADA 4F8AA 2VU9A 4LIUA 4OMCA 3KVBA 2Q8DA 4QB2A 1VAVA 2RMU1 2Q8OA 1K5MC 2XBO3 2JDMA 4WM8B 3MLJA 4JTOA 4DUVA 5DDJ1 2E33A 4RHV2 4YW5A 2W1UA 1Z78A 3LSEA 2J1EA 1BCXA 5A32B 2ZHLA 2VZQA 3M2MA 1FXZA 1C1LA 4XDPA 4EN8B 5JR2A 2C9KA 4FQZA 2GNTA 4QDSA 2FQPA 2OZ6A 1VRH3 4WVVA 5CBLA 2JDAA 4FPKA 5CKNA 4YW1A 1AVBA 1CVNA 3AK0A 5FO8B 3EXUA 2VBPA 4DOUA 3VL9A 4W6YA 1NLQA 3HT2A 3GJAA 1ZRIA 3IWZA 5D2AA 4CCEA 4M4PA 1GQPA 3WP4A 4A44A 4CDXB 3NKGA 2E7QA 3U4XA 5F39A 4LO7A 1TNRA 3BIEA 3WP5A 2FDFA 2DU1A 2NMNA 4JCKA 3RZJA 1OHFA 3BYWA 4Q4W3 4QGLA 3S7EA 4UFHA 1PX4A 1NKGA 2ZZQA 3WV6A 4BMBA 5L7OC 5FZ8A 1IS3A 5FXWA 2ILMA 1R1A3 1Z0HA 1AX1A 1X50A 3KF3A 4YZ4A 3HBZA 4ORFA 4AOCA 3AYEA 3VBOA 1G86A 4D69A 4P9JA 1F35A 3WW1A 5BNQA 1FPN3 1OLQA 5EQUA 4F3JA 2CHHA 2HWC2 1TME2 3OYWA 4LOSA 3KCYA 4Q4X3 2WT1A 3W5MA 4BWOA 3I2IA 4RA0A 2ZGQA 4LBKA 2X8KA 2AACA 5D1IA 2DYCA 3UKVA 1WLWA 4ISQA 5KC5A 3C3VA 1TE1B 1DZQA 4E9KA 1U5YA 4FI9A 5LBEA 2PMWB 5G04L 1W28A 2VZRA 2P1BA 1U12A 1W0PA
chains in the Genus database with same CATH topology
4Q2FA 4E4ZA 3ZIWA 3UV9A 4LE3A 4Y1XA 1RB8G 3LOBA 5J3UA 4F83A 5GLZA 4AQSA 3ZFGA 4ES9A 5D8AC 2NZ9A 4XZPA 5BY5A 5CFDA 1QXRA 3J26N 3MIBA 4KBBA 3NSTA 3TN92 5LRSA 1AR72 2XJUA 4LBLA 1TMF1 1ZYBA 1WBFA 1RGSA 3VBSB 4OZXA 2G9GA 1NY71 2WFF1 2NM1A 3AP5A 3ATGA 2VOKA 1RMU3 2WWSA 4YW3A 2WQZC 1REDA 3BALA 2R061 4ATEA 4XFIA 2PAMA 4DFSA 1M06G 4YARA 1FYUA 3A0NA 2A3WA 4D3WA 1LOCA 1OQDA 3H9AA 4DRVA 1PK6C 5J36A 5CAZA 3DGTA 4RR3B 3OD4A 2BVBA 1J1TA 1PGSA 4FAHA 3SHRA 3TWIA 3B7MA 1OPMA 1WD3A 1ZZBA 3JCIA 4S2GA 4HKLA 3NAPB 1RHI1 2RS32 1KFXL 3R4SA 4XF4A 5JDBA 5C4WB 4GALA 1H2LA 5KXCA 4ATFA 2FMYA 3PJYA 4IXLA 1BZWA 1MEC3 3WDVA 1XNCA 2A3YA 4RSUA 3VN4A 3ZSMA 1VALA 4L9BA 2FMDA 4IEYA 3NW4A 4XMAA 1GZWA 2D98A 1RUNA 5HXVA 5JZGA 1RUH3 4Q26A 3H1YA 2A6ZA 5T5PA 1AL21 4XXPA 3U07A 2F6BA 5T5OA 1G7YA 4B7EA 3D8CA 4AI1A 1VBA1 3V56A 2JE7A 1WD4A 4XFCA 2K2SA 5FFOC 3JQWA 4FTBA 2AR6A 1YI7A 2ZOEB 1AJKA 4X6QB 3T2TA 5BNPA 3VBHC 1AXZA 1BMV2 4CEWB 3SH5A 5FQ0A 3AKPA 1O91A 2RM22 2VUAA 3INAA 4TLFA 1NA1B 1RUE1 4DS0A 5FPXA 3USUA 1HXS1 1XNBA 1ULFA 1B35C 2Q1ZB 4PJYA 2ZMLA 1W6QB 1FNYA 1MS9A 3NKTA 4MXWB 2QE3A 3WG2A 4COUA 1ND3A 1ULCA 5I91A 4AVCA 1XYNA 1DLLA 2R041 3OTFA 5EJ3A 3MF6A 1KRIA 2WNVC 4RS5A 4FPHA 3MFAA 3EO6A 4XF1A 4E2QA 4AGRA 1QQP3 4J6GA 1RVF3 2C1FA 4J1XA 5KXBA 1PZ8A 2BUKA 2B42B 2PHTA 3SH4A 1RTVA 4U36A 2C5DA 2HWD1 1VR3A 2PAKA 1BEV3 1J3QA 4N43A 4FT8A 4YVWA 5SV8A 4O9GA 3MDPA 4WM7A 1N1SA 1HQLA 3WDTA 1S0FA 3HMYA 2QNKA 5FBZA 1K5MB 1SFYA 3AMQA 5LRRA 1C57A 2ZACA 2C9AA 1REEA 1ND2C 5GLVA 3V0AB 3MLKA 4UXAA 3N4MA 3AKTA 5KC6A 4B8EA 4HSLA 2D5HA 4Y22B 2RMU2 4JDOA 1PIV3 3SITA 2RS13 4WVMB 5DDJ2 1ZBA1 1HV0A 2JG9B 2A75A 1ZRCA 1S2BA 3L2HA 1NXD1 5DUXA 3VZOA 3CJIB 1RITA 2DVFA 5JOZA 2V09A 1RUG3 2ZAAA 3VDDA 4LBQA 1R093 4HN0A 4XJ8A 3R6SA 3G6JB 5T50A 4COWA 5CNAA 1BQPA 4R9BA 5FOJB 3BIWE 3ZXGA 5L7OB 4GB33 2O8OA 1H4HA 4JQRA 4K8FA 1V6MA 3OJBA 1QOTA 1RL3A 3AMNA 2AZ5A 4QPYA 4XJWA 3IDBB 5BNOC 5FMOS 1C8NA 4NWWA 2ZGUA 1JOJA 1W6NB 2NN8A 3AMMA 3TYJA 1QMJA 2GZWA 1LGCA 1MQTB 3J4UH 1SBEA 2C0ZA 5KXEA 4SLIA 2IFWA 2W52A 4O9EA 4EN9B 1CIWA 4Q0SA 1JN2P 1CN1A 2YV8A 1Q3EA 2PHUA 3ZYRA 1NCQA 3FE5A 3N3HA 4QD2A 2EALA 1GICA 3UK9A 1UPSA 1N3PA 3W58A 5A33B 1UU4A 4XW3A 4CEYB 5BNNC 1RUD1 2UWBA 4CDQC 1WLTA 3ZFFB 4WM8A 4MGYE 4COVA 1RUC3 2RJKA 3RYRA 1YYNA 3R4UA 4JVAA 1YJLA 1FV3A 1BXHA 4IV1B 5K8SA 1SLBA 4CTEA 1Z7S1 1KJLA 3AKQA 1AR63 1V6JA 5BUVA 3E5XA 2XHKA 1ZM1A 1EAH3 1XE8A 2D5FA 2E63A 1OI6A 2OZJA 4E27A 1TMF2 3SMHA 1IGOA 2R6QA 4UW4A 1PO12 5E88A 5FRAA 1D4M3 1KJRA 1S0EA 1AR83 3JBG3 4YZ2A 1BK1A 3ZVXA 1ENSA 3OY8B 4LHKA 2WFF2 3ZXLA 5DZFA 4A7YA 1DQ5A 4FCAA 1BBT3 4AI0A 1CPNA 3QD6A 3AMHA 3SCFA 4X8NA 2R062 3MI8A 2O8QA 2LUWA 1I5ZA 1CAUB 1S0CA 2QQPA 3CEWA 1HRI1 4AEDB 1ZZ8A 2YPJA 4LBMA 5GZCA 5DUUA 1TNFA 3ENRA 4AWDA 1UZZA 4EWDA 2XJSA 3PTYA 3AZZA 3OBRA 3N36A 4RHV3 3ZN5A 3X29B 3V0BB 4JGZA 1HQNA 4XQDA 2VMIA 2PELA 4L99A 1RHI2 4F7ZA 1H8VA 1HIXA 4YNIA 4XJUA 3TB0A 4ZXKA 1SLTA 4LBNA 4QPIC 3D82A 1NE6A 1QGLA 1H9WA 2CGNA 2QUOA 2P37A 1YFYA 5H9PA 4YM1A 3E6DA 3UJOA 4CDWC 2WKKA 2JG8B 2WSVA 1J58A 1AL22 5L36A 1GV9A 2R32A 3VBSA 1DQ1A 3GYDA 2XWJB 1VBA2 3ZXFA 1O5UA 1N47A 5T5LA 2YZ4A 3TAYA 1O7FA 2HWC3 1TME3 1VBD1 4CDUC 3K51A 1JXNA 3CO2A 4EROA 4UBGA 1SLIA 3THTA 1RUE2 1JTZX 2AENA 5CVRA 3KMHA 3J8F1 5CFCC 1PVXA 2Q1MA 1S55A 3WXPA 2A6YA 4RR3A 2XJRA 1CGPA 4SBVA 2FZ2A 2QJVA 3LA3A 4UW3A 2BWCA 3PNAA 2R042 4NN0A 4HFSA 4UBHA 5DG2A 1J3PA 2VW1A 2Z2SB 1CAWB 1I9RA 4OHVA 3NAPA 1SBDA 4YG3A 3WVJA 2ETEA 2DUOA 5C4WA 3VZMA 2ZS6B 5T55A 3TN93 1AR73 2HWE1 5FO7B 2E7AA 2HWD2 1ZRRA 3FMGA 1H4GA 4YFWA 4CZSA 4YRDA 4YFZA 4UW5A 1JYIA 3PVBB 2EXIA 3FHIB 4URTA 1GYKA 3KLSA 4KL1A 1J59A 3ILRA 3SXWA 4FSJA 3OGGA 4NR1A 4GIQA 2HEVF 2OUJA 3HN1A 3MYXA 5K9YA 3O5SA 2X5IC 4LULA 1VBE1 4RFT0 1JH5A 5JI7A 5T54A 3KM5A 1FV2A 1R1ZA 4TWTA 4OI2A 1H1MA 4PLNA 3VBFC 1NA1A 2YY1A 1M4WA 1XQNA 2E7TA 1ZBA2 2QDRA 3ZYJB 4Y1VA 4K1YA 1W6QA 5C8CC 2EXHA 1WUVA 3RQ0A 3VHNA 3ETQA 4MXWA 2EVXA 4BH9A 1JW6A 2VPVA 2YDEA 1G6NA 2RS33 4W6WA 1WW5A 5CADA 1XYPA 3AM2A 5KWRA 1YI9A 4M01A 1VBB1 4Y20B 4C0HA 4LO8A 3PHMA 5GKAC 2MHFA 4AFCA 3WDWA 3LCPA 1O3SA 5C9AC 1NQJA 3B9IA 2D6PA 1AYN1 4QQ2A 4L2NA 1LCLA 2PHFA 2X29A 4LA2A 3OCPA 5I0TA 3FJSA 2XB6C 2ZABA 3AXEA 4AG4A 5LEKA 2ZHMA 4JV4A 5GM0A 1UMZA 2Z42A 4X8PA 1HKDA 3V64A 2XKPA 5E89A 4FTEA 3H1MA 5I8SA 5JOWA 3M3EA 3U0ZA 5IK4A 1KDKA 1MS0A 1KS4A 2Z79A 1V6OA 1FI2A 3GF6A 3IBMA 1XRUA 3DPRB 4K7JA 4R52A 5L19A 2RM23 3RRDA 1K5MA 2NYYA 4HL0A 1I6XA 3VZLA 3V0AA 1DZRA 4NHLA 3GBFA 1NCRC 3FUOA 1RUD2 4FPEA 2E51A 5HCAA 1AHSA 4HPKB 1UU5A 1CJPA 5JOXA 3SCGA 4WVMA 4DXZA 3MW2A 1EPZA 1IPKA 4C90A 2D3SA 2JG9A 4BA6A 2D6MA 1Z7S2 2G9FA 1I3HA 3CJIA 5IK5A 4QPGC 4YZ3A 3N7LA 4YZ1A 1YO8A 2ZJCA 1H8TC 2Z69A 4MGIE 4HLTA 1DYKA 4Q4V1 4DINB 3WNXA 1ZZCA 1RUF1 4D94A 3M1HA 4HVQA 1XU2A 2BEOA 1C4RA 2A6WA 4Y1UA 3AYCA 5C33A 1YFXA 5F1RA 3WG3A 2A6VA 1OOPB 2CNAA 4FXKB 3JB8A 3M3OA 2W68A 4IV3C 5IT6A 1W6NA 2W39A 4M00A 4IESA 3TOJA 1VIWB 1MQTA 3RJRA 3B69A 4QGMA 2KXLA 1DU3D 2WNUB 4K3UA 1HRI2 3ES1A 3VKNA 1ENXA 4LE4A 1V70A 4OLLA 3FWEA 2PHWA 1IQAA 4EWAA 2AREA 2RMU3 3KD4A 1C5HA 5C8WA 5DDJ3 1C3HA 5A33A 3WR0A 1ZBE1 2D6NA 4RQPB 4CEYA 4KQ7A 4K40A 3VBUB 4XFBA 5AVAA 3M3CA 4JGYB 3ZFFA 1KQRA 2JE9A 1LHWA 5K0UB 5JPNB 2WL1A 1EY2A 4IV1A 3ECQA 4HSJA 2PAEA 5ABJC 1CR7A 1UF2C 1A8DA 3DV8A 5DZGA 4N53A 2TUNA 2A6XA 2K9ZA 3QACA 1UL9A 1V9U1 3R05A 2GMPA 4KH9A 4GULA 2A5ZA 1N1VA 1F5JA 3OY8A 1GZCA 2XBO1 4AQ2A 1XE7A 4YVSC 5AFEA 2W08A 4AHXA 1LODA 2R1DA 3DF0A 4MV2A 4NHMA 2HWB1 1VBD2 1PNFA 4Y1ZA 2OPKA 2UY8A 2XVKA 2D43A 2CAVA 4FO9A 1BVP1 1CAUA 4H7LA 3MF9A 2WS91 5GALA 4AEDA 4META 3IT8A 3J8F2 2BPA2 4B7KA 4NVPA 1Q8SA 1IKPA 5HI0A 4FPJA 4JDMA 3H3UA 4S2HA 5JPMB 4KWKA 1YXWA 4XF0A 3ZN4A 1DGWX 1LJ7A 1PMIA 4GH4C 1DF0A 1WBLA 3S30A 3IPVB 3V0BA 2PLV1 2ARBA 3RNSA 4AHYA 4RGAA 4FTSA 4P9LA 2K0GA 2B9UA 1UKRA 3NL1A 4LT5A 4DY5A 3T1MA 3WW4A 4BQ1A 3WT3A 2ZGMA 2HWE2 1PO13 3AFKA 3TBDA 4LA3A 4YM3A 2ZAHA 4AFAA 4E4SA 4PDWB 4M3CF 1UX6A 2D97A 2V5YA 2VECA 3ZFEB 5GZDA 2JG8A 2WFF3 2ZA9A 3JZVA 2D3PA 4IEQA 3MIGA 2CYFA 2PTMA 3KZ4C 4MGZE 3VBRB 3URFA 1CQ9A 4W6XA 2R063 4FPCA 3W9AA 5FPZA 1YCIA 5T52A 1VBE2 3DL3A 3H1WA 4AI2A 4COZA 1GBGA 1ZRDA 5KHIA 2GSYA 2Q0AA 5I8TA 2AUYA 1U5XA 4PIYA 1RJ7A 4LR4A 1PO21 4XFFA 4LNVA 1JYCA 1OFSA 5C9AB 4BPZA 1RHI3 1KFUL 2FZ1A 3OPZA 5F6KA 4WVZA 1VB2A 1VBB2 2ZX3A 2P3KA 4U2AA 1CAXB 1PM7A 2CGOA 1CAWA 1LTEA 3MIEA 1C8M2 3CF6E 3VBOC 1WMEA 5JIAA 2Y26A 1AYN2 4K1ZA 2UWAA 3HT1A 1Q8VA 3HWJA 3VLBB 1W2UA 1YLLA 1AL23 1XYOA 4OI0A 3AZWA 2MPFA 4QU2A 1W6PB 1VBA3 2YC0A 4CYDA 2A73B 1AYM1 4GMP1 4RGGA 2UURA 3AX4A 1LU1A 4K21A 3UKTA 2ERFA 2QZ3A 3ILNA 5LEJA 1NCRB 2Q4SA 2YXSA 1Y43B 4B3NA 1ZZ7A 2ES3A 3IIAA 2E53A 2PFWA 1DBNA 4AQ6A 3SCHA 1XXNA 2BFUL 2ZGNA 1AZDA 1D2QA 4LHNA 2GC1A 2MEV1 1LGBA 4BLIA 3DN7A 3ZDSA 1LOFA 4Q8LA 3ZFGC 1RINA 1ASJ1 2IXKA 3WD5A 1REFA 4AGVA 5CFDC 2UU8A 1S2KA 4LHLA 3ZYIB 2PA7A 3L9JT 4IQPA 5EXOA 2R043 1UIJA 2Q5TA 4FAGA 4M3CE 5JLVA 4Z92B 4ONUA 2WT0A 1LU2A 3D6EA 4E2SA 5EZWA 2N7GA 4HBNA 2P3JA 3MIDA 5FOBB 2ZX2A 3S6PA 1LEMA 4Q4V2 4XXAA 4XIKA 4XF3A 1RUF2 1Q8QA 2AYHA 2UYAA 4PQ9A 1RUI1 2HWD3 5AC91 1E57A 4IV3B 3SNMA 3ZSKA 4Q27A 1DQ2A 1O4TA 2B8MA 3BCWA 1QOSA 4QMAA 3FX3A 1JBCA 1H30A 2RR11 1A3KA 1D0HA 4B29A 1IS4A 2IXCA 4ZKTB 2P17A 2DCZA 1QNWA 1RUJ1 5HCBA 5JI9A 2BNMA 3AYAA 1LHNA 1N3QA 3S7IA 4A7ZA 4AFBA 4XFAA 3M7AA 5KHGA 1IZ3A 1R081 2B5HA 3DPRA 5IUQA 4RD7A 3RG0A 1ONAA 1QJU1 4OI4A 5KHHA 1AX2A 1F2NA 3N7JA 4XJ9A 4KU7A 1ULDA 1ZBA3 1LKNA 1ZBE2 1DDLA 5E16A 4I2OA 4AEMA 4HPKA 1NE4A 4YM0A 1DGWA 1GLHA 2EAAA 2ENRA 1GKBA 2D6KA 2A71A 2VNGA 1VJ2A 3WDYA 3U11A 3KS7A 3WHTA 1AF9A 5JZGC 2GC2A 3AKRA 3M70A 3I7DA 2V73A 1HLCA 2WLQA 2VMHA 1D4VB 1C28A 5BV6A 1F8VA 3EJKA 4H55A 4I30A 4AEJA 1FMD1 4YVSB 3MPBA 5BNPC 4AVTA 1APNA 1V9U2 3AZYA 2CY6A 3KGZA 4LLFA 2XBO2 2PN5A 1YNAA 1OOPA 4AVAA 2KM2A 1QJY1 3FBMA 4QGNA 3WG1A 3AJYA 4R4ZA 4L8QA 2CGPA 2AH2A 1NQDA 2HWB2 2ZKNA 4QQHA 1ND3C 3ELNA 1AXKA 2EAKA 2WS92 2WNUA 1X7NA 2HYKA 4XBQA 4RS5C 4GQ7A 1WMDA 2VQ0A 4NWVA 3AZVA 5AVPA 1LESA 4AI8A 1QJX1 2GH2A 4IEZA 1RUD3 5CB7A 4PLMA 4ISRA 3IDEA 3SH3A 5DG1A 1MZEA 5D8AB 5EWSA 5IK8A 2PLV2 4RQPA 4FOQA 3VBUA 1Z7S3 1DIWA 2H0BA 2WIIB 3O0XA 4JGYA 1YIPA 4N43C 2VXRA 1FOD1 5A32A 5K0UA 1G9AA 1U12A 2OYZA 5FDBA 2EXKA 4R9DA 1O3RA 4WM7C 2X53S 3LWCA 4XTPA 3RZZA 3CLPA 3EBRA 4P9XA 4AVBA 1PVC1 3DUIA 2DV9A 4A2UA 4RL7A 3B94A 4FPFA 4NO4A 4CDXA 3WOGA 2EF6A 3CNAA 4OULA 4QQLA 2DWRA 4QQPA 1X36A 4CP2A 2BBVA 1NY72 2YGLA 3UKNA 2D40A 1N1TA 2Z5WA 2ZX1A 4C1XA 2Q30A 2YMZA 2DFCA 4PIZA 1YHFA 2DF7A 1GSLA 3GBWA 1NZCA 2DVGA 1PK6B 1ZX5A 4TSVA 3FZ3A 3LOIA 1HRI3 1J3RA 1ENRA 3JD71 4QHBA 2CV6A 3VHPA 2E9QA 2A3XA 3M8LA 1MS3A 1HRV1 3KT7A 2W0XA 2ET1A 2ZGSA 4UW6A 1PO22 1D4M1 1Y7BA 1HDKA 1AR81 4XE9A 3FFQA 2BYVE 2D6LX 1QY4A 3IPVA 5FREA 2BNNA 1EPWA 4X6RB 2DUQA 4HK8A 1IPJA 2Y0OA 2VG9A 2Y38A 3WP6A 1RIRA 1PHMA 1OQ1A 1LHVA 2XJVA 4YGEA 4J1WA 3VZJA 5L73A 1G9CA 2ZHKA 3RPQA 2XPJA 1F9KA 3NV2A 4LO6B 1J1LA 4PDWA 4TYSA 2R071 2ZPXA 4YGCA 5J96B 1NCQC 1XNKA 3ZFEA 2E6VA 1AYM2 3VBHB 3WUCA 2XG3A 1JUHA 3KB5A 3RYKA 2DFBA 2XLAA 3RWNA 2NPIA 3VBRA 1VBD3 1WCSA 4LTAA 4FVVA 2UY9A 4WM8C 2VVEA 3C2UA 1U0AA 4XOGA 1B35B 1VAKA 2WT2A 2MEV2 1MZ6A 4QT6A 4AF9A 4WVWA 2ATFA 5KHKA 4XIOA 4OHWA 1QDCA 1W6MB 1L3JA 3J8F3 3MW4A 1FAYA 1QU0A 2VVDA 3H3ZA 1ASJ2 4YW2A 4AGGA 3I2DA 3N7KA 1HXS2 4ZU5A 2BTVC 4EN6B 1QWRA 1WGPA 2WNVB 4YZ5A 3I8TA 1U5ZA 4IETA 4MZUA 5DZEA 2VGDA 1AL0G 2ZBJA 2B7YA 3V65A 2OA2A 1QKQA 4EWEA 4N90A 5C9AA 3I59B 4I01A 4MX3A 2DVBA 3H0OA 3NO8A 4KWJA 4LBQD 4C91A 1CAXA 5HCFA 4Y4YA 4OUMA 1QH7A 3E5QA 3M3QA 4PBPA 4XILA 2HWE3 1RUI2 2ZMKA 5AC92 3JUUA 2DTWA 3O0WA 2VW0A 4QM9A 1G8WA 1QXJA 1XNDA 2RR12 1Q8OA 3POSA 1NLSA 1UZYA 4A7KA 1RUJ2 5J98B 1W6PA 1AR91 3KSCA 3BB6A 2XLFA 1ND2B 2R0HA 4OUSA 2QKDA 4IEUA 1OD5A 1VBE3 1WCDJ 2O1QA 3OD0A 4JGZC 3ROUA 3ASIA 4MXVA 2SLIA 1R082 5CG9A 1OQEA 3UL2A 1OA4A 1QJU2 2VNOA 2JXAA 4Q0VA 5CG8A 3QBQA 4CEWA 2B46X 2XJTA 1YWKA 3KT1A 1DFQA 1QXPA 5JZGB 4GKXA 3E5UA 1DG6A 5JMCA 2HWF1 3RI8A 4K6BA 1NXMA 2R0FA 3VHOA 3E97A 2ZX0A 1EV11 2WNEA 4YG6A 1VBB3 4ES8A 1YFWA 5JIUA 4WZFA 1WLDA 5B2GB 5BNPB 3RSJA 1POV1 5HBAA 4FP2A 1C8M3 3VBSC 4MSVA 4WV8A 4ASMB 1SACA 1AXYA 5FQ0B 1F31A 1BVVA 1V00A 4MVTA 1LOAA 1AYN3 2WSUA 3MICA 1OMIA 5BNOB 4XHXA 1FMD2 2WZPP 3LA2A 2GNDA 3WP3A 3MIFA 4LO4B 4GXLA 2D93A 1DYPA 4FP3A 1UN1A 4IV3A 4S2FA 5ACA1 2PHRA 1LOBA 1LOGA 3VZKA 3VKOA 1QJY2 4Q4Y1 4AW7A 4IEOA 4GA9A 1PZ9A 2PHXA 1A6CA 1V6IA 4Q8KA 2JJ6A 4BM8A 3PJQA 3AKSA 2VH9A