3O0XA

Structural basis of carbohydrate recognition by calreticulin
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
259
structure length
250
Chain Sequence
DPAIYFKEQFLDGDAWTNRWVESKHKSDFGKFVLSSGKFYGDLEKDKGLQTSQDARFYALSAKFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPSGLDQKDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRSKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFPDANIYAYDSFAVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords Calreticulin
publication title Structural basis of carbohydrate recognition by calreticulin.
pubmed doi rcsb
source organism Mus musculus
total genus 65
structure length 250
sequence length 259
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-07-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3o0xA01
2A3WA 3PVEA 1C1LA 2NM1A 1IKPA 2ARXA 3UK9A 2D6PA 3WG1A 1S1AA 3RMYA 2E51A 2E7TA 1GZWB 4FOQA 2ARBA 1YI7A 1LOCA 3PVNA 3ASIA 3U4XA 1OFSA 1ULGA 4K1ZA 2GMMA 1SLCA 2AGSA 1CPNA 1X50A 2ES3A 3O0XA 4AWDA 1DQ5A 4ATFA 3MPPG 4NOTA 3ZPYA 1BXHA 4XJ9A 4XHBA 5GZEA 5T54A 3AZWA 1W6OB 4YLZA 3JUUA 4DRRA 4GALA 5GZCA 2A7AA 3AX4A 3OY8B 1QNYA 5JLVA 3AP7A 5IUQA 2OUJA 1MS8A 3W58A 2PHRA 4XJ8A 1LOEA 4JCKA 1W6OA 4XMIA 3WCSA 4TZDA 3ILFA 1AX0A 2JE7A 1YYNA 3OY8A 1Q8QA 2DU1A 2EF6A 1LHWA 5H9RA 1WD3A 5CNAA 2JDZA 4K20A 4YGEA 4XYXA 3TAYA 1LU2A 4WV8A 1S0CA 1OQ1A 2EALA 1V6JA 1LEDA 2NMOA 4WZFA 1QOSA 1JW6A 2DVAA 4LBQA 1CONA 1SLIA 1BKZA 1S0DA 3N7MA 4FPEA 4R9AA 1HDKA 3WOGA 1YXWA 1WLDA 2NMNA 3AYDA 1S0IA 3FUOA 4U2AA 3VKOA 1R1ZA 1KDMA 4FP2A 2XG3A 1J1TA 2H0BA 4XZPA 1ULFA 1RITA 1MVEA 4LBKA 3WV6A 3FLRA 1MS1A 1PZ9A 4W65A 4M01A 4Y1XA 3ZXKA 2ZHMA 1DQ6A 1LECA 1TEIA 2D3RA 2GDFA 2ZBJA 1DBNA 1LENA 2VW2A 4YZ1A 1G9BA 4Y1ZA 2Z42A 2TEPA 4K21A 1JXNA 3AK0A 3OGGA 3O0VA 1YRZA 4UW5A 1LGCA 3WUCA 1IOAA 1IS3A 1SFYA 4LBLA 2DVBA 3UJQA 5E88A 4AYUA 4XJWA 4M00A 5H9SA 3ILRA 1GICA 4Y20B 4YW2A 1WW6A 5DG2A 2YROA 1UZYA 3M3CA 1ENRA 2A6XA 5DUUA 2P3KA 3AP6A 3ZSLA 1N1VA 5HCFA 3USUA 2ZGLA 2D6KA 2PELA 1LOGA 3MEPA 4Q2FA 4YM1A 1N1YA 4FPOB 1AXKA 4H55A 3WG2A 5EWSA 1Q8VA 5JOZA 1MZ6A 4FPYA 5EYXA 2C9AA 4XILA 1G7YA 5IK8A 1FX5A 2Q5TA 3AYAA 1Q8SA 3AP5A 2A6VA 5FREA 1UX6A 1C1FA 4GWNA 1CESA 1LU1A 3AJZA 1F5FA 1GANA 2D6LX 2A70A 3OPZA 1LODA 3ZSKA 2A71A 3N36A 1ULEA 1UN1A 3NWKA 3FUQA 3NV1A 4LBJA 1G9AA 3WDWA 1CN1A 3O5SA 1DQ2A 2D3PA 2DTWA 2JKBA 1GLHA 2ZHKA 4LBOA 4M3CB 4BOWA 4R9CA 4XJUA 2CWMA 4XBQA 4DS0A 2W68A 4ZXKA 2PHFA 1QOTA 3D4KA 2AH2A 2R0HA 3FBYA 1WW7A 3AYCA 3B69A 4FQ4A 4M3CA 5BYNA 2ZABA 1OKQA 3LSEA 4AVSA 1LEMA 2FHRA 1N3QA 3Q9OA 2R49A 1LJ7A 5JMCA 3OYWA 2ZGTA 1G8WA 4Y1YA 3M3EA 1AX2A 1GV9A 3WDXA 1JBCA 3ZXFA 4AGRA 4FPCA 5T50A 3DGTA 5DZFA 5H9PA 1Q8PA 1QKQA 2RHPA 1W6NA 2DUQA 2CY6A 4PQ9A 1LHUA 2A6WA 2WQZC 3AJYA 1KDKA 1V00A 3ZXJA 4YFZA 1PZ8A 4UW6A 1FNYA 2P37A 3IM0A 3APBA 3VKLA 5T5LA 3SH4A 3SITA 1UMZA 4CRQA 1AZDA 3N3HA 3T1MA 1AJKA 1DHKB 1YO8A 2E7QA 4YZ5A 4WVVA 2DWRA 2PHTA 5DUWA 2EXJA 1URXA 4HL0A 5JDBA 3SH3A 3ZXLA 5CBLA 4ISQA 2WNEA 3RMXA 4YW3A 3MW3A 2A5ZA 1DYPA 5DZEA 3VKFC 2SLIA 3B00A 4XJZA 2DV9A 3VUOA 3A0KA 3T2TA 1RINA 1MS5A 3AP9A 4DQAA 2GALA 2WLQA 2A6YA 1Z0HA 3HMYA 5EYYA 4Q1PA 4Y26A 3WHTA 2ZGSA 4LBQB 4IQPA 3SNMA 2YXSA 4YG3A 2NP0A 5F9TA 3I8TA 1LHNA 3OBRA 1SCSA 1B09A 1DZQA 2GN7A 2KM2A 5JOXA 3WVJA 1AVBA 1A78A 2YZ4A 4DRVA 3RSJA 2R0FA 5HCAA 3SISA 2GNTA 2DVFA 2WKKA 4ITCA 3TB0A 5GALA 2AREA 1SLTA 2UURA 1Z78A 5HCBA 1S0FA 1VAVA 2DURA 3N7JA 1A3KA 3M1HA 1BJQA 1LHOA 4Y1UA 2AR6A 5DUVA 4YZ2A 1AJOA 4Y1VA 2D7FA 3POSA 2P3IA 4GXLA 4YGBA 2E53A 3A0NA 1I3HA 3WHUA 2GMPA 1S0EA 1C4RA 2CNAA 5LK5A 3V0AB 1LOBA 1SBEA 3D5OA 1N3OA 4WVWA 2DVGA 4DFSA 4GWMA 4KBBA 1RIRA 4Q8LA 2GNBA 3V0AA 2R16A 1KJRA 2ZGUA 1EPWA 4XHXA 3W59A 2YY1A 2ZGMA 5AVAA 3USUB 3PMEA 2CTVA 3ZYRA 1GNZA 5GJ6A 3ZSMA 4AVVA 5JOWA 3AXDA 3BTAA 3DUIA 1DLLA 1PZ7A 2ZKNA 3HN1A 1ZA4A 1FATA 2GN3A 1GZCA 3I4IA 1F9KA 3UJOA 3WG3A 3WDYA 2C5DA 1KJLA 4XOGA 4Q26A 1LHVA 3WNXA 2AYHA 1SLBA 4Y24A 1ZM1A 3UL2A 4L8QA 1HLCA 4PBPA 3INAA 2DUOA 1G9FA 1MS0A 1NLSA 4JC1A 4K1YA 3M3QA 5DUXA 2UWBA 3N7KA 2ZGRA 4BLIA 4YM2A 2D3SA 5KXBA 5GZGA 3SLIA 1QNWA 4YGDA 4AVTA 2P34A 2ENRA 1D2SA 3V0BB 1V6MA 2A3YA 5KXEA 5IK5A 2OUHA 2OW4A 4P9YA 4BPZA 1WUVA 1QDCA 1QMJA 2A75A 1WLWA 3D6EA 1LCLA 2ERFA 2ZMNA 2DVDA 1V6LA 3N7LA 2D44A 3R4SA 3V0BA 3H0OA 2WT2A 1Q56A 2DUPA 2UWCA 2CWSA 3SH5A 2ZGPA 5CB7A 1NXD1 1CQ9A 2VW1A 3HR9A 3IPVA 3VV1A 2ZMLA 2W52A 4Q1RA 2ZHLA 2PHXA 3T1LA 4FPGA 1MVQA 1SACA 1GNHA 3PVOA 3OYWB 2GNDA 2JECA 1O4YA 2PHUA 1IS4A 4FPJA 1QU0A 1ENSA 3RS6A 2JD4A 3B9CA 4LBQD 5DXDA 4ZKTB 2XB6C 3WDTA 1W6NB 2VY0A 2WSUA 2NN8A 1V6KA 1UPSA 2VUAA 4XXAA 4PCRA 3LSDA 1QF3A 1AF9A 3V65A 4XTMA 4OZXA 2UU8A 5T52A 1ULDA 2D6MA 4F83A 4D69A 4YW4A 3N35A 1W0PA 1BZWA 1SBDA 1S0BA 3ZYPA 2ZGKA 3O12A 1SLAA 1N1SA 1UKGA 4YZ4A 5IT6A 2P2KA 4Y22B 1CJPA 3AZXA 4C1WA 1DQ4A 3AZZA 3KQRA 3MW2A 4ATEA 4PBOA 1UZZA 4BMEA 4FPHA 5GZDA 1BQPA 1N1TA 2NZ9A 4YM0A 1G9CA 4Y22A 3O0WA 5DG1A 5JOYA 4FQZA 2SBAA 2R1BA 2JE9A 2DU0A 2ZA9A 1CVNA 2D6NA 5GLWA 2GMEA 1G9DA 1W6QA 5L73A 1LESA 2ZAAA 1Y7BA 4ISRA 4YZ3A 1H9WA 3R4UA 3AYEA 4C1XA 1FYUA 5GZFA 5KXCA 3L2YA 3WCRA 1FAYA 3JU9A 3FLPA 1G86A 3ATGA 3WG4A 2EXHA 1IS6A 1GZWA 1QDOA 4JRAA 3AFKA 1WCSA 2EXKA 2EAKA 4HANA 1LOAA 2OVUA 2P3JA 3GNEA 3POWA 4M3CE 3ZVXA 2YMZA 1WW4A 2PHWA 3OBTA 4XJAA 1QOOA 4I30A 1SLLA 1MR5A 3AZVA 4GKYA 4XTPA 2WT1A 4RA0A 1KITA 1H30A 4FOYA 5E89A 4Q8KA 1HQLA 1WBLA 3WLUA 4R9BA 1CIWA 1FV2A 1V6NA 2W08A 1KRIA 2EIGA 4YW1A 3IKWA 2R1DA 3A4UA 3IMNA 3QLQA 3ENRA 5E8AA 1MZ5A 1DYKA 1FNZA 3FFZA 2YV8A 3PJQA 2VW0A 2A6ZA 2ZHNA 3C2UA 2V5YA 1MS9A 1S0GA 1LOFC 1LGNA 1LGBA 2G4IA 4RL7A 4P14A 1A8DA 2LALA 3KM5A 2GNMA 1JYIA 5IK7A 1U0AA 4FOVA 5GLVA 4XIOA 2CYFA 4GA9A 2FMDA 1H9PA 2JJ6A 2WSVA 3BOPA 3R05A 5T5OA 5GM0A 1GKBA 1JYCA 5T55A 5T5PA 3M2MA 2DYCA 1IS5A 5EXOA 2AENA 3FLTA 2I2SA 4FPKA 2VH9A 2ZGQA 1ULCA 1FV3A 4FOWA 2NYYA 4YG0A 4FPLA 4P9XA 4SLIA 1W0OA 4FPFA 3WDVA 2ZGNA 4YW5A 4BQ1A 4Z8BA 4P9WA 1VIWB 4BM8A 1MS3A 1O4ZA 3IN9A 1DIWA 3WUDA 1F31A 3WDUA 4XXPA 3V64A 3AZYA 1VLNA 1WD4A 1ONAA 2VU9A 3ILNA 1I1EA 4PF5A 2D6OX 1MS4A 1CPMA 1WW5A 1YIFA 4YG6A 2ZGOA 3LCPA 5H9QA 4Q27A 3OJBA 1C57A 1LOFA 2D43A 1BYHA 1APNA 3POYA 4GKXA 4NO4A 2LTNA 1MACA 1SBFA 5SV8A 1N47A 3ZSJA 4AGVA 5T5JA 5KXDA 2E6VA 3AXEA 3IPVB 4LBMA 4XMAA 1XQNA 4MYEA 2AUYA 4Y20A 5CAZA 1AXYA 2EXIA 4FVVA 4U36A 4AGGA 3QCWA 1ENQA 4M3CF 2BQPA 1DFQA 1LULA 1Q8OA 2ZMKA 2B7YA 2V73A 5CA6A 4XBLA 1WLCA 5F5QA 1V6IA 4CTEA 4XE9A 4CZSA 3VKNA 4UW4A 1DQ0A 1GYKA 5FRAA 3GALA 4ASMB 4UW3A 1JOJA 2UWAA 3BIWE 1N3PA 1W6PB 1CR7A 3MW4A 1UL9A 4DPNA 2CL2A 3NV2A 3NV4A 1JN2P 2W39A 3NV3A 5GLUA 4LBNA 3RRDA 1VALA 4BMBA 1JHNA 1DQ1A 1UAIA 4XBNA 4XDQA 5GLTA 4XIKA 1W6PA 1AX1A 1KQRA 2HYKA 4YGCA 3RQ0A 4YFWA 3VKMA 3AP4A 1W6MB 2ZACA 3ZXEA 1SCRA 4YM3A 2A3XA 2WJSA 2WT0A 4R9DA 1IKQA 4FP3A 1VAMA 3BODA 1W6MA 1AXZA 1GBGA 1GZ9A 1HKDA 3M3OA 5GLZA 1S0JA 2DTYA 2VXRA 2ZZJA 1QGLA 3B01A 5IK4A 1JUIA 3WZ1A 1LTEA 1V6OA 5DZGA 3RG0A 3CNAA 5JVVA 1HQWA 1DGLA 1W6QB 4BLJA 3B3QE 1GSLA 1D0HA 4TYSA 1WBFA
chains in the Genus database with same CATH superfamily
3CJIB 3WP4A 3RDIA 2Y38A 2ARXA 2VECA 3UK9A 1Y3TA 1YUDA 3RMYA 3LPFA 2ZOEB 3GDBA 1KS5A 1JZ2A 3ASIA 5C7GA 4R4XA 3DYPA 3U37A 2WRAA 3EBRA 3W20A 2GMMA 2Y34A 5K4LA 1SLCA 2ES3A 4EJRA 1DQ5A 5FO8B 5CU1A 3ZPYA 3WW2A 1BXHA 3T0DA 5T54A 2WQ8A 2WS91 5JI9A 3L9JT 1AYN3 1RUD2 4DRRA 1AR61 3K77A 4GALA 4E2SA 2A7AA 3AX4A 4MGIE 3DKQA 3CDZB 1MEC3 4NIGA 2JWPA 4NIIA 4XZUG 1ASJ3 4TZDA 2GSYA 2YC0A 3THTA 4QAWA 1ZBE1 5FOBB 2JG9B 5KHJA 4E2QA 1WCQA 2WBKA 3X29B 5CNAA 4YGEA 4K20A 4QDQA 3MFAA 1OQ1A 3ZLIA 3HBZA 2Z79A 4XF9A 4AEDA 1QOSA 4LBQA 4QHBA 1CONA 3DKWA 2O8QA 5C5TA 1SLIA 2Y26A 2X53S 1BLZA 1HDKA 3KMHA 3W5MA 3DECA 1O8PA 4JDNA 5APAA 5KHGA 4IEWA 1OKOA 4DOUA 1YQ6A 5I93A 4UBGA 2ORXA 2ZPXA 4FAHA 1CAVB 4IL7A 3WINE 2JB4A 4Y1XA 3WSOA 3ZXKA 4AHWA 1MPXA 2HWD3 5C9AC 1TEIA 2GDFA 2OS2A 1DBNA 3M7AA 1RL3A 2B39A 1CAVA 3EMRA 1JXNA 5A3OA 3AK0A 4NRMA 4QQPA 1QQP3 3GJBA 4LXLA 4Q4W3 2P6CA 3BU0A 3LE0A 1LGCA 4H3WA 1TMF1 2Y6HA 3WUCA 3CU7A 1IS3A 2CU5A 2VNRA 3PTRB 4N7UA 4LBLA 4XUPA 3U78A 1BMV2 1ULPA 4C91A 5FZDA 5I91A 1O8SA 5AC91 2CGPA 2OA2A 4R52A 3ILRA 5FZBA 2WZPP 1WW6A 2I07B 5CG9A 3PLQA 5IFTA 3QD6A 3B9IA 4QQOA 4AR2A 5JXIA 4CDUC 3ACHA 5DUUA 4QU2A 1RMU1 3AP6A 5FP9A 3USUA 5HCFA 1M06G 1RUI2 2RS11 2PELA 2CV6A 4Q2FA 4YM1A 1UOBA 3KSCA 3AMHA 4ZS3A 5EYXA 3KV5A 3OD0A 1Z7S1 5M0TA 3JB4C 2D5FA 3BYWA 3AYAA 4WM7B 4HK9A 1W8TA 3RJ2X 1Q8SA 2A6VA 1OOPB 2VPVA 2RS52 4JVAA 3WXPA 1CESA 3AJZA 1F5FA 2D6LX 4PDWC 3V56A 1DG6A 4CUAA 1YLLA 4I2OA 4QX3A 1LODA 3ZSKA 1W3XA 1GR3A 1ULEA 3K75B 1UN1A 2R071 4RSUA 1UF2C 2FDJA 4IV3B 1UWWA 1Q3EA 2HWB3 1VR3A 1W2OA 2WFPA 1G9AA 5KWRA 3O5SA 1RJ8A 1XNCA 3AB0A 1GLHA 5FZ1A 2G19A 2RM21 4HSJA 4AHZA 5LB6A 1EP0A 4CSWA 4DS0A 1XJAA 4ZXKA 2PHFA 2QFEA 3NJYA 5ABJB 1JYNA 4IE6A 3WF0A 4I3GA 1C8M1 2XL7A 3AM2A 3ES1A 4CU8A 3FBYA 4F7ZA 2P1BA 3ZKYA 4QB1A 1RUJ3 2VNOA 1YFYA 2WNVC 5I8TA 5ABJA 2FHRA 4N8MA 1LJ7A 3POGA 2VUCA 1O91A 1ZZ6A 5D8AC 4PQQA 3OYWA 4W6YA 4Y1YA 4WBBA 2ZCWA 1RVF1 2HEYF 5IJRA 1JBCA 3RI8A 5FPBA 1J83A 1W8UA 5ISLA 2RS32 2FCTA 4B4RA 1H8TA 2VNVA 2C1FA 1W6NA 2CY6A 5C4WB 4PQ9A 2A6WA 4TTGA 3H8XA 4RQPB 2PA7A 2XBO2 4UW6A 1COV2 1UYXA 3IM0A 2HBTA 2XJPA 1ODMA 1H1MA 1GP5A 5T5LA 5C4WA 1RHI3 4HKOA 1ZBA2 5FJHA 1AJKA 2WZEA 3AMNA 5KC5A 3GZAA 4QHZA 3A21A 5DUWA 3ZXLA 5CBLA 1B35C 2C26A 1C5IA 2DFCA 4BK4A 2NPIA 5A3PA 4IUGA 1HX6A 2A5ZA 3URFA 1HB4A 2ZX1A 3VKFC 5A3UA 5LWBA 3LA7A 4P5YA 4FXKB 4NPLA 1VRH1 4C8DA 3A0KA 3D3AA 4WM8C 3K4AA 3T2TA 1RINA 1MS5A 1E5HA 1R092 1VBA3 3AP9A 3NRUA 5EQUA 3BI3A 4LKEA 1H1AA 4Y26A 2ZGSA 2WNUA 2W94A 3SNMA 3OUJA 4DO0A 3I8TA 1LHNA 2XUMA 1X9PA 3JXSA 4L0PA 1B09A 1ODNA 2XQXA 2GH2A 3CLPA 4N53B 2K2SA 1QXPA 5JPNB 4Q4Y3 4CCEA 1A78A 4HZFA 1HRV2 4QKNA 5FYIA 2EICA 3GGLA 5HCAA 2Q4SA 3A23A 2PLV1 4N53A 5FXVA 4ITCA 1ZZ7A 3VBSB 2RVAA 3L2HA 2X10A 3UGFA 2D40A 2AREA 2VMGA 5HCBA 1S0FA 2DURA 5F2WA 1VMHA 3N7JA 1H2NA 5F6LB 2I45A 3TOJA 5LK7B 1VBD3 4Y1UA 5DUVA 1VBE3 5K9YA 1AJOA 2XOMA 2D7FA 4YGBA 2P3IA 3VBSA 3BIEA 1IPKA 1S0EA 2BGOA 3A22A 3V0AB 5CFDB 1AHSA 4RD7A 1OVPA 4OFGA 5LA2A 2W9XA 2RMU1 1IGOA 5C5UA 2DVGA 3IAPA 1AL23 3NO8A 3IAQA 4PIYA 3V0AA 1ND3B 3FWEA 3I49A 3O7OA 3W59A 4A3ZA 1OMIA 3VBHC 3PMEA 3I2IA 4META 5JOWA 3AXDA 3RNSA 1FMD1 3DUIA 1ND3A 3S30A 4CP2A 2IFRA 3HIFA 4OZOA 2C5DA 1UD1A 3D8CA 3IDCB 1LHVA 1SLBA 2PYTA 5FO7B 1POV3 1UOJA 3UL2A 3NL1A 3WQ1A 4L8QA 3HQUA 5HPOA 3WNPA 2DUOA 1G9FA 1NLSA 4IERA 4JC1A 5FYUA 2EIEA 3M3QA 4KL1A 1ZRDA 1EAH1 1OA4A 5KXBA 3SLIA 4YGDA 2WZ8A 2RJ2A 3V0BB 2XMLA 2WA3A 4QGNA 1AR62 2VMFA 2OUHA 5IK5A 4P9YA 5F3CA 4MGYE 1QMJA 4KI5M 1I5ZA 2OPWA 2IVIB 3P3PA 3PURA 1WLWA 2BBAA 3N7LA 4AL9A 2ZMNA 4NRPA 3V0BA 4IGPA 4MX3A 1W8FA 3BOWA 4AZZA 2CWSA 4KGGA 4YW6A 4QXBA 4F3JA 4MG2A 3N9PA 1JTZX 4XCBA 5FYYA 2HWE3 3BALA 4IEXA 4JGZB 4UI9L 3T1LA 1PNFA 5F5CA 3KT1A 4RGGA 2QBXA 2YC2A 3KHBA 3HAGA 4KBZA 3H50A 4TXWA 1QU0A 1ENSA 2R061 4E8CA 4JGZA 3CJIC 5LA1A 4KU8A 5EJ3A 4LBQD 4XUTA 3W9AA 2XB6C 1W9YA 3I3QA 3JB8A 2WSUA 2CAUA 2NN8A 3KT4A 3WNLA 5DDJ2 3ZN5A 2Y6LA 3J7NA 4IE0A 4LUKA 3IT8A 4DUWA 2WDBA 1UZ0A 5IVBA 5JXJA 4K7JA 4L97A 1DU3D 5HV4A 1E57A 2Y64A 3LA3A 5A3WA 5T52A 3AKTA 4M0NA 3RYRA 1BZWA 3C8XA 3CIHA 4YZ4A 2HWF3 2YBKA 5FPLA 2VMIA 2P2KA 1H2KA 1CJPA 2H0VA 3AZXA 4B7KA 4C1WA 1DQ4A 1RUC2 2ZEZA 3AZZA 1TQ5A 5FYTA 5JUVA 4PBOA 1GMMA 5FZ6A 4E2GA 1TMF2 1N1TA 3LAGA 5BNOB 1YEWA 3O0WA 4INDA 2TNFA 5JOYA 4XABA 1H8VA 3UGHA 3VDBA 2XDVA 3ZO0B 4MUVA 3PJYA 2ATFA 2DU0A 2ADEA 1CVNA 5J96B 2XWBB 2BW8A 4LNVA 5BNOA 2JG9C 5BNPA 2YGMA 1LESA 5C71A 1IG0A 4ISRA 3IDAA 1DP0A 4GH4B 4C1XA 1JOBA 5LBCA 2YPJA 4FAGA 3JU9A 2WS93 4AFAA 1GUIA 3VN4A 2UY8A 4OYUA 3M3IA 1NXMA 4RN5A 4HANA 3MIDA 4WZCA 1E5RA 4GH4A 4AW7A 4N9IA 1D0GA 1R1A1 2VM9A 5DQ0A 4QPYA 2TUNA 2VBDA 1QY4A 3ZYFA 4IEPA 1ND2B 1ZBE3 4NIAA 3AZVA 4QGMA 4RA0A 2VCCA 1XNKA 3VD3A 1H30A 3VZJA 4QPIC 5E89A 2W1SA 5LRRA 4HKWA 1NG0A 3S7IA 4YVSB 1CIWA 3J9SA 4JRLA 2W08A 1CAWA 1ND2A 3PIJA 5FUPA 5ACA1 3N9LA 3IKWA 2R1DA 2X09A 3JBG1 3T2OA 2J22A 2XUEA 4QPGA 4ZS2A 5BY5A 1UPIA 5E1RA 5E8AA 1DYKA 4XF0A 3D0SA 4H14A 4OMCA 4D7YA 5A6QA 3OGJA 3RPQA 3ES4A 1A8MA 1GP6A 3LGRA 2GC3A 3N9MA 1LGNA 3J8F1 1A8DA 4E4DX 2WO3A 3POIA 3T3YA 2ARAA 1JYIA 4JDOA 5IK7A 2XHNA 4D6QA 1BBT1 5LY1A 5C8CB 3E1F1 4QQHA 1NY72 2JJ6A 2WO1A 1BCXA 1QQP1 2BJSA 4XACA 4ZY9A 4Q4W1 3HEIA 5GM0A 1JYCA 1AR92 4GJYA 4TWTA 3T0BA 1PX3A 2O14A 2AENA 2DCZA 2RDRA 5C8CA 1NQJA 2OIIA 1HQNA 4BQWA 4KWJA 4D7SA 2VH9A 1ULCA 4W50A 3G7DA 2Z4FA 1J59A 2NYYA 4YG0A 4FPLA 3H8RA 4SLIA 4Q0UA 1DF0A 2JEMA 2ZGNA 4HN1A 4P9WA 2PHDA 1OOPC 1OD5A 1MS3A 3GZEA 3TEXA 4AEMA 5AC93 4RYDA 4QXCA 4FBFA 1QJU1 3SQOA 3NQHA 4M0HA 5L7OB 3WDUA 4XXPA 4ZZ8A 1RMU3 1ONAA 3ILNA 4PF5A 2F6BA 1CPMA 2WO7A 2Y6JA 2RS13 2ZGOA 4IV3C 4XDPA 3OTFA 4YG6A 4BCUA 5L7OA 4Q27A 5LY2A 1PO12 4H7LA 1PGW2 2LTNA 1MACA 4PIXA 4CU6A 2IC1A 3AMMA 4GB32 4MV2A 4NAOA 5KXDA 4MGQA 3HJRA 1W04A 4Y20A 3HT1A 3KV6A 1AXYA 5FP4A 3UETA 5CAZA 3VHRA 3VD4A 4OQ8A 1CX1A 2BQPA 2W92A 3TEWA 2J1AA 3RZGA 3EO6A 2ZMKA 2AC1A 2JXAA 4N7IA 1YJKA 4MGZE 4MHRA 2AACA 5C9AA 1HV1A 1K12A 2HWB1 1ZX5A 1PO22 4LO8A 4XVHA 5FRAA 5FYBA 1XNDA 5C3QA 3VD9A 2R073 4ASMB 2OZ6A 1AR82 3ZDVA 3BIWE 4D6RA 2LRPA 1W6PB 3KV9A 5FZ7A 1CR7A 4UWDA 1RXFA 1UL9A 1ZZCA 4DPNA 3ZIWA 4L92A 2HWC1 4R8HA 5GLUA 2QQKA 5LA9A 3I3EA 1OFNA 5FUIA 3RZKA 2WAOA 2VZOA 2FQPA 2RM23 3ZN6A 1W8NA 2IWGB 4RQPC 2IXHA 1W6PA 2HYKA 1UYZA 3RQ0A 4XQ4A 4COVA 2FZ1A 1CZSA 1S2EA 3AP4A 5FTTC 2ZACA 1C8M3 5K7PA 1SCRA 1RC6A 2JIJA 5A32B 2MNGA 3ZMNA 3LOIA 4R9DA 1US2A 1TME1 4BIFA 4FP3A 1WMFA 3BVCA 4J6GA 1AXZA 5C6CA 1HKDA 1OQEA 3E6DA 1DGWX 5GLZA 2DTYA 5A3TA 2GH8A 1RVF3 1KD7A 2VXRA 1QGLA 2FDHA 1JUIA 3IDEA 4YVWB 5EFUA 2VZQA 4NWWA 3RG0A 3O1SA 3CNAA 4QXHA 1HQWA 3VBFB 3IB3A 3VHOA 1PIV1 3ST7A 1RHI1 1DZTA 4NVPA 3U75A 4TYSA 2JX9A 2A3WA 5DAXA 5LZ6A 3LOBA 1FMD2 3ACGA 3VBFA 2E51A 1NCQB 2E7TA 3GCWA 1JZ8A 3IWZA 2IXLA 1YI7A 1W2UA 1IHMA 1UMHA 3ZX7A 4X6RB 5LW9A 1LR5A 2ZX3A 2JDNA 1NCQA 1OC1A 2RR12 3GBGA 3LKJA 5FAXA 4Q0QA 1W2AX 3TWIA 1FOD2 2WAAA 2E9QA 4ATFA 3I2GA 4AK3A 1RUH1 2PHLA 1DCSA 1QXJA 5GZEA 1G6NA 2X29A 1VRH3 4L2NA 1EAH2 4MGSA 4YNIA 1U5IA 1VBC2 1F8VA 3OY8B 3ME2A 5SV5A 1HB2A 4MZUA 1R082 2X5IB 1OSGA 4XUQA 3AL6A 4B8EA 4Q4X1 1J3RA 3ILFA 3GYDA 3OY8A 2F4PA 1YYNA 1XPWA 3MHZA 2X5IA 5CFDC 2A1XA 1L7LA 1OUXA 1WD3A 2B46X 4QT6A 4BDVB 2IFWA 1H4GA 2NMOA 4S2DA 2ZZQA 4WZFA 2PLV3 3LF7A 4HPKA 4FPEA 1POQA 4QKDA 1VBE1 3FUOA 3PUAA 4AI3A 1LAJA 1WCUA 5DMYA 1OLME 2QQMA 3I59A 4IDZA 4CCNA 4FP2A 5KHIA 3AL5A 5BPXA 3WV6A 2W95A 1RITA 2YDEA 4LJHA 4LR4A 5JZGB 4QU1A 4I09A 5FZIA 3N9OA 1LECA 4IE7A 1UKRA 1LENA 4YZ1A 3I97A 2RMU3 4Y1ZA 2FMYA 3D82A 3OBZA 1U5XA 4RR3A 3VDAA 3SMHA 2DF7A 1UQXA 1PK6A 1KXGA 2QZ3A 4KNCA 1UY2A 4CDXB 1XE8A 3LQCA 3VZNA 1YQCA 2XKPA 4E9KA 5LEJA 1QJX1 1BVP1 2UY9A 3E5QA 4RGAA 2DVBA 5DN2A 3WNKA 1QIQA 3F95A 1X33A 3FJSA 5F3IA 1KGYA 2FCVA 5B4XA 3UJQA 4AYUA 1D7PM 4EN6B 1UNBA 2AEZA 3PUIA 4KWKA 1UY1A 4IW3A 4FFHA 5H9SA 1YHFA 2BOIA 5FR3A 1UZYA 3M3CA 1ENRA 2P3KA 4QXKA 5BUVA 1AYN2 5JR7B 1HRI1 2BYVE 4N43C 1W39A 1N1YA 4FPOB 1TZOA 5EWSA 5JOZA 5HV0A 4FPYA 1MEC2 1STMA 1ACCA 3K2OA 3POFA 4XILA 1G7YA 5IK8A 3WP3A 1ASJ2 1U5ZA 3FFQA 1NLQA 4LULA 4HVRA 4XDOA 5F39A 5FREA 4GWNA 3BN6A 2A70A 2P6HA 3R0RA 5FZOB 2HWE1 4LHSA 4PLNA 4PI2A 3Q8CA 4Y3OA 4EV0A 2IUWA 3ZMOA 2BDRA 2C24A 3J7MA 2JDKA 2NLRA 4HN0A 5FZMA 5FLIA 1AR71 3NV1A 4QQ2A 3RYPA 3MPBA 1DLCA 4AVCA 1CN1A 4BOWA 2ZHKA 1RUG1 2VTXJ 2VTFA 4R9CA 4XJUA 2CWMA 4XBQA 1PVC3 3ZIXA 4BJ0A 4NHMA 5A70A 1PX4A 4J1WA 1ZVFA 3D4KA 3OUHA 4XFAA 1BK1A 3HOBA 4LO4B 1WW7A 2HWD2 4FQ4A 3P1IA 4Q29A 3LA2A 5BYNA 2W3JA 3NSTA 3LSEA 4Z07A 4AVSA 1JZ6A 1GWMA 3SEPA 1Y9MA 4QD2A 1XB9A 2ZGTA 2WYSA 3WDXA 3ZOIA 1AX2A 1QQP2 2RG4A 5FBJA 4Q4W2 5T50A 3DGTA 5DZFA 4OHWA 5H9PA 4Q0PA 2RHPA 4LO6B 1CIYA 2DCTA 3J4UH 1V00A 3FBMA 2WINB 4FFFA 1PZ8A 2VCAA 2P37A 2VG9A 4UT5A 1W9FA 2F17A 4P9LA 3APBA 3VKLA 1AUYA 3MGUA 5IVYA 4CRQA 4IGOA 3N3HA 1WA6X 3ECQA 4CEWA 1CAUB 4XUOA 4CPBA 2E7QA 2UYBA 1OLMA 1RUE1 1DGRA 4NHLA 4HL0A 1SHWB 5JDBA 3SH3A 5LA0A 3OEBA 2QNKA 3DPRA 4YW3A 1CAUA 4YVSC 1JYWA 4D6SA 4Y4YA 4JAAA 5FZAA 3ZYIB 5DZEA 3USSA 5IHRA 1W8OA 2V4VA 3ZFGB 5J1XA 2JB8A 3WNOA 2ZAHA 1HJGA 5FOJB 2VXJA 1F15A 5FMOS 3WHTA 4DQAA 4AEDB 2WFF1 4Q1PA 2GP3A 1R1A3 3NVCA 4LBQB 3I2FA 3ZFGA 5EIYB 2NP0A 4YG3A 3MI8A 2BVBA 5FWEA 3WQ0A 5C3RA 3UKVA 2VL4A 2KR2A 2GN7A 2KM2A 2HWB2 3EQEA 5JOXA 1RGSA 3THCA 3HD8B 4C0BA 2YZ4A 2QZ2A 3EB7A 4QX5A 1K5MC 1CJDA 5ACA3 1NLRA 3JBG3 2R0FA 5FKCA 2ARCA 5L9RA 3T2PA 1X36A 2WKKA 4MADA 2YYOA 1MQTC 1NA1B 3NJVA 5A7NA 4CCCA 3I3DA 1XYNA 2UURA 1OBNA 5FYHA 2OKXA 3ZXAC 5A6YA 1RUJ2 1ZYBA 2VZRA 5FMBA 3M1HA 4I02A 3J8F3 4UAPA 2AR6A 4QX2A 5FXWA 1NA1A 4OUMA 2Q30A 2VO5A 4BXFA 1BBT3 4B7EA 2IXKA 2GMPA 3T09A 4LKDA 5LK5A 3WQ7A 1O3QA 1C8NA 2ID4A 1AYM3 1BVVA 2LUWA 4JQRA 1PNGA 4WVWA 5DPNA 5FZGA 5J7MA 3MYXA 4KBBA 3N4MA 2GNBA 2YPDA 4JGYB 2PQSA 4XCAA 5FZ9A 5JR2A 1QHDA 4P9GA 3HT2A 2YY1A 4HFSA 3USUB 1RHI2 3RFRA 2BNMA 2JG8C 2QQNA 3H7YA 5CADA 4J25A 4JGYA 1FPN1 3C7GA 1DLLA 3KVBA 1BEV3 1NT0A 2GN3A 3I4IA 1TE1B 4XF3A 2KD7A 1OLRA 1WMXA 1D4VB 3UJOA 1QJU3 1KJLA 4CA9A 4GAZA 4QPIA 1OQDA 3VL8A 3GBWA 2PN5A 1HLCA 2YFZA 4LK7A 1W2TA 1WKYA 2B4KA 2VJXA 1W90A 2H6BA 3K4ZA 2YUEA 5FP3A 1RUOA 2VQUA 5DUXA 4NHKA 1VBA2 5A3NA 3N7KA 4CUGA 4BLIA 2Q1FA 4QX0A 4YM2A 2D3SA 4OHYA 5I8YA 4LQRA 1F5JA 4DB5A 5KXEA 4BWOA 2G9ZA 5L9VA 4BPZA 1WUVA 2VNGA 5T3NA 5CG8A 1HXS1 5LBFA 1LCLA 2ERFA 2O1QA 3MBWA 4Q4Y2 3H0OA 5AFEA 1J3QA 2BNNA 5CB7A 3TNQA 1GQGA 5CFCC 1W28A 1CQ9A 2OT7A 4H2AA 4AFBA 4ES8A 2VOTA 1ST8A 3IPVA 1JYVA 5A7QA 2ZMLA 4YVWC 4BB3A 4LPLA 2HWC3 2VQ0A 4QM9A 3VDDA 4FPGA 5LBEA 3G6JB 1Y9GA 1XU1A 3OYWB 1VBD2 4QPWA 2GNDA 2PHUA 1VBE2 3KCYA 3RS6A 1OVSA 5DXDA 1H8TB 1SFPA 1W6NB 2VY0A 4J1XA 1V6KA 2JDAA 5FV3A 2HH9A 4BQ5A 1TME3 4PCRA 5LRSA 2BTVC 4JKMA 1NOVA 5AFBA 4P08A 3VHPA 5F1RA 1AL22 2UU8A 4LT5A 4F83A 4D69A 4YW4A 3N35A 1W0PA 1T2XA 1S0BA 4E27A 4EYUA 4F8AA 3ACFA 2ZGKA 3RZHA 3LWCA 3NW4A 4RS5B 4K3UA 1PVXA 3KS7A 1REDA 3ZFEC 1K42A 4MSVA 1PIV3 1RYYA 1VB4A 2QE3A 3KQRA 3BB6A 4MXVA 4ATEA 4KWLA 1JYTA 3KZ4C 4W6WA 4FPHA 2NZ9A 4RS5A 3ZFFC 2WLPA 1G9CA 2E32A 1QEXA 4O9GA 3EYPA 2R6QA 3FHQA 4FTEA 3O1RA 4JTNA 2R1BA 4ORFA 3KF3A 2XHKA 4XFHA 3ZPOA 5GLWA 3M8LA 3N9NA 2GMEA 2J42A 3I3MA 1W6QA 2W0XA 2DBIA 2JDMA 2WNUB 5FY7A 5L73A 2ZAAA 1HJFA 1YCIA 4YZ3A 1H9WA 1RUH3 5GZFA 2Y6FA 3WCRA 2VVEA 1UO9A 2P5BA 3CKHA 3CZUA 2EXHA 2P17A 1GZWA 1MZEA 1QDOA 3FLPA 3K3OA 4PIZA 4XF1A 5KHHA 5FQ0A 4FO9A 2OVUA 3GNEA 3MIHA 3VBUA 3AVSA 3PUHA 5F8PA 1F4AA 1GOHA 3MFCA 2E26A 4M3CE 3VB9A 3ABZA 3UV9A 3ZVXA 4DXSA 3VBOB 1DGWA 4Q4X3 3S5QA 4URAA 1US3A 5D2AA 2WO2A 5JZGC 3U0ZA 2C9KA 4GKYA 2YB7A 1KITA 2HWE2 2WN3A 2J1RA 4FOYA 4WVMA 4N90A 1WBLA 1KEXA 4GZ9A 3PNAA 4Q5OA 4R9BA 3VBOA 3MZHA 2ZX0A 5FY4A 4B4QA 1EV11 4NIDA 1OHFA 2EIGA 3TN92 2E7AA 4YW1A 5K0UB 5FZHA 4CDQC 3ZN4A 3IMNA 3RGBA 1ZNPA 1QXRA 1MZ5A 1FNZA 1TG7A 3NAPC 4NRQA 4CDXC 2RDSA 2Y8KA 3PJQA 3H1MA 2XJVA 5K0UA 1O59A 1XE7A 3VBRC 3C2UA 2V5YA 4I3PA 4YWAA 1S0GA 1SDDB 4WVZA 5BNNC 4CDWC 2W1UA 1U0AA 4FOVA 5GLVA 4XIOA 5EJ1B 2CYFA 4NROA 4GA9A 2HWF2 5FP7A 3LB9A 3I7DA 2WSVA 5DAWA 1GU3A 5T5PA 3LD8A 1GWLA 2L9LA 1PM7A 1O4TA 1XSRA 2FCUA 2I2SA 4JX0A 4FPKA 4XFIA 1QJX3 4N9HA 3U07A 4AAXA 1J3PA 3OGSA 4TLFA 5CKNA 3ZDSA 4LK6A 3E6CC 4AVAA 1VIWB 2YC4A 2HBUA 2BFUS 4LLFA 1O4ZA 3IZOA 4AQ6A 1OPOA 3QBQA 3AZYA 1VLNA 4EZHA 4LO5B 2HEWF 4CPBD 2D6OX 1MS4A 2FZ2A 2WS92 1OD3A 1HRI3 2J1EA 1C57A 1LOFA 3POYA 4GKXA 4HOOA 4NO4A 5A80A 5SV8A 5FYVA 4FCAA 2VBBA 1H0BA 3ZXGA 3TEZA 1CZVA 3LZZA 3O1TA 2V4AA 4BHPA 2VOWA 4U36A 4URTA 5FYMA 4LHNA 1ENQA 3MV11 1ZBE2 2VE1A 2W87A 2V73A 3F2ZA 1SMVA 3MF6A 3DF0A 2QDNA 4XBLA 1UY3A 3ZYJB 2WQ4A 1R64A 4E4HA 1GQPA 4IV1B 1DQ0A 1GYKA 5EJZB 5FPVA 1D2QA 3QACA 4MLOA 1XYPA 1JOJA 2UWAA 3P3NA 1AR73 5IAXA 2EIBA 1BK0A 1DGRN 1ZRIA 1PVC1 2I74A 2G9FA 3MW4A 4IV1A 2W39A 2BWAA 4LBNA 4BQ4A 4BMBA 1VALA 4O61A 1JHNA 1RUG3 1UAIA 5FMDA 4XIKA 3SCHA 1AX1A 4UFKA 5FLJA 1HV0A 1V9U1 2PMWB 3OPWA 4MGKE 4CCKA 2WJSA 2WWJA 1YJLA 4Y5Z0 4CU9A 1W9SA 3H8OA 4ONUA 4K8RB 1YFUA 4HBNA 5KBFA 3JCIA 3BCWA 4XF4A 3IMMA 1T6GC 3BUCA 1JZ4A 2ZZJA 3T0AA 3HVDA 3DXTA 5FFOC 2XONA 4CP9A 4UXAA 5EV7A 4FFGA 1V6OA 2OZJA 3KGLA 4YARA 3QOPA 2BVVA 4YRDA 5BNPB 3QH6A 1JZ5A 1CGPA 2IXIA 1GSLA 4ZZ5A 1CWPA 1NCRB 4QWNA 4CEYB 2FDGA 4AEKA 5AC92 2XR4A 3JD71 3RZMA 4AEDC 3AFGA 1C1LA 1JU3A 4IETA 4NHYA 3MDPA 3H8UA 1UIKA 4D7TA 3I2KA 1NCRA 3H42B 1RMU2 5EZWA 4Q4V3 4CEYA 3PVNA 1LOCA 2R041 4BISA 4S2FA 1RUE3 2RS12 1CZTA 1F4HA 1T6BX 4NHXA 1OFSA 4K1ZA 4LO7A 4AI9A 4B1MA 4DXTA 2HJIA 3O0XA 1CPNA 1X50A 4AEJA 4OHVA 4AWDA 4CU7A 1YC61 5IVEA 3MPPG 1UOGA 1VMFA 1PMJX 1GQHA 1Z7S2 3JZVA 4XHBA 3AZWA 2QUOA 3LEMA 4GWJA 2PQQA 3JUUA 2JDHA 4DXZA 4G3YC 5GZCA 1CAWB 1QNYA 5JLVA 4IXLA 2WFF3 2FDKA 1KFUL 4PHZA 4QPGB 1MS8A 4GULA 2RDNA 2PHRA 1X8EA 1LOEA 4OI0A 2R072 3ZM8A 1AX0A 3LEKA 4RHV1 1Q8QA 1Y9QA 2EF6A 2MHFA 5FLHA 2OYZA 2W2IA 2JDZA 1H2LA 4XYXA 4XFGA 3S57A 3M70A 1DDLA 2EALA 1V6JA 1WCDJ 2RM22 4B1LA 4PLOA 3I2DA 4A4AA 5JSPA 1JW6A 3P6BA 4NWVA 5FPZA 1MZFA 3RI9A 3N7MA 4ZU5A 1C8M2 1SPPA 3TBDA 3DCQA 4R9AA 3WOGA 2NMNA 4IEOA 3AYDA 1S0IA 1EYBA 1KDMA 1OT5A 1R1ZA 2CAVA 1DZRA 3I2HA 3ORJA 5A7WA 4Q0VA 4K6BA 4XZPA 1AYM1 1XNAA 1MVEA 2B42B 3KWVA 1YQ2A 4LBKA 1RVF2 1MS1A 1PZ9A 2N7GA 1PMIA 2QJVA 2VMHA 2ZHMA 3C3VA 1DQ6A 4W65A 5F32A 3VL9A 5C3SA 2Z2SB 4G4FA 4XURA 3WW1A 3DEMA 4KG0A 1G9BA 5FYCA 2Z42A 2W5FA 1FT9A 2MEV1 5IWFA 2TEPA 2ET7A 4OVEA 5A1AA 3GBFA 4K21A 4XQDA 4Y4RA 1EPZA 1REEA 3OGGA 1QJY1 4WM7C 4ZPIA 3O0VA 2Q8DA 3POJA 1BEV1 1OI6A 1YRZA 4UW5A 5HXVA 4XQWA 1IOAA 4MO3M 3U1XA 2LS6A 1FPN3 2RJKA 1H4HA 5FUNA 5L19A 4DXRA 1GICA 4Y20B 4YW2A 5DG2A 4DZGA 1X7NA 4UF0A 1WMDA 2A6XA 4CUBA 3AVRA 3GHNA 3ZSLA 1N1VA 1XC6A 4KWUA 2ZGLA 5C3PA 2B5HA 1VRH2 1XBFA 2D6KA 3ALQA 3KB5A 1WA4A 4JV4A 3WQBA 5C3OA 5ABJC 5C9AB 2DDUA 4KMQA 4AQTA 4EWEA 1AXKA 3WG2A 4Z2WA 1Q8VA 2VZUA 4LHLA 4JKLA 2C9AA 2VZ3A 4MH0E 4XPVA 4UOJA 3U11A 3MF9A 3EXUA 3WW3A 3KCCA 5FPXA 1H8TC 4LIVA 3H1YA 4A42A 3WF1A 1QJEA 1RUD1 2O8OA 3S6PA 1HXS3 2VQTA 3ZN6B 4RGKA 4LOTA 1LU1A 2TBVA 3NNJA 3OPZA 4LUMA 1JOPA 4YSFA 3O1MA 3AMQA 3P5BA 1OA3A 2CGOA 2PLV2 5C4WC 4BU2A 4L99A 2ADDA 1QJZA 5CYYA 4LBJA 5DAPA 3WDWA 4CDUB 2D3PA 3CMGA 4LBOA 4GMP0 3FZ3A 2XJUA 3NJZA 4LA3A 4AF9A 1UU4A 3OF1A 2WA4A 4DUXA 4CDUA 4PF1A 1P8JA 2WZR3 2AH2A 4KU7A 3AYCA 2Q0AA 1VB2A 2ZABA 5IVVA 2QQVA 1H1IA 1NQDA 2RMU2 3KT7A 4DY5A 1N3QA 1OF4A 2ZJCA 3PIGA 2R49A 4X8PA 5FDBA 1XXNA 3KD4A 5JMCA 5L36A 2WNUC 5JPMB 1CAXA 1GV9A 1K5JA 3EHKA 2FDIA 4AGRA 1Q8PA 4O7XA 3CJXA 1W9WA 2D5HA 1ZZBA 4OHXA 1LHUA 2WQZC 3AJYA 1V70A 3AC0A 4PDWA 5HI0A 4BYYA 3WW4A 4W8JA 5CISA 4N53C 1OPMA 3SH4A 3T1MA 4ZU7A 1DHKB 3FX3A 3VZLA 1YO8A 4YZ5A 1BMV1 2D98A 3HPNA 5FWJA 5F2SA 5ANQA 1NAEA 3DL3A 3MUZ1 2Q8EA 1W8WA 3OSDA 2WNVB 3VBSC 3W5NA 2HKXA 3PUSA 5D8AB 4OHZA 5CVRA 1VE0A 1RUI1 4RFT0 1UYYA 2WNVA 5LBBA 4M4PA 2GALA 2A6YA 1Y4WA 5D8AA 5A1LA 2QQWA 3VGIA 4HPKB 5FXXA 1JS9A 2XQRA 4JZRA 5D1IA 2QQPA 1ZRFA 1PO13 4HXCA 1SCSA 3W21A 4UYBA 4GB33 5FPUA 3I59B 2RS51 1ND3C 5FZLA 1D4M3 2Y60A 3GF6A 4DRVA 2IXCA 1EV13 3T2QA 4LKSA 3T4HB 3LEGA 3RSJA 3ZFEA 3ZXDA 1PVC2 2R062 2ZS6B 3LFMA 4QQLA 4XAEA 3SISA 3BTYA 2YBPA 4I0WB 2BV4A 3R6SA 1GZTA 4OI4A 4RR3B 1SLTA 3UKTA 1VAVA 1RUF3 1PK6B 1BJQA 1LHOA 1B35A 2ZKLA 4YZ2A 4WM8B 4Y1VA 3POSA 1HB1A 2QQUA 2VULA 1IZ3A 3ETQA 4OI2A 2PFWA 2CDOA 4A7ZA 2J7MA 1C4RA 2CNAA 3UYJA 4CCLA 2ET1A 4QHOA 5B2GB 3J7HA 4B4PA 1JZ3A 4WM8A 2VZ1A 1SBEA 2E33A 1HB3A 3KGZA 4DFSA 2DFBA 2W1WA 4PI0A 3BTZA 3M4FA 3DV8A 2ZGUA 1EPWA 1WGPA 5AVAA 5FCCA 1LKNA 1GNZA 4LEJA 4H7MA 5GJ6A 4AVVA 2VZPA 2V09A 4KH9A 4JTOA 2ZKNA 1PZ7A 3HN1A 3NJXA 1F9KA 5E6HA 4XOGA 3HN3A 4Q26A 5A7OA 3WNXA 4DY3A 2GC2A 4JGZC 1NUKA 1XE0A 4Y24A 1ZM1A 3T08A 3H3ZA 4NN0A 3MIFA 1YQ8A 3INAA 1VBB3 4IEQA 4PBPA 4COWA 1MS0A 4D0QA 4EROA 4CDQA 4LMFA 2ZGRA 4AI1A 1R1A2 1BHGA 1QNWA 4AVTA 5GZGA 2P34A 1D2SA 2W91A 1NKGA 3PTYA 2A3YA 4CUCA 1FXZA 4K8FA 1NE6A 1POV0 1VRBA 3B02A 4LORA 2PTMA 4OQ9A 4FTBA 2BP6A 3VBHB 1R091 2A75A 2BERA 2WN2A 3D6EA 1SFNA 4C90A 4E4ZA 2DVDA 1V6LA 5I0SA 3AKPA 4QKFA 2WT2A 1Q56A 1UZWA 2DUPA 3Q8AA 3SH5A 2ZGPA 5FIXA 4HVQA 5ACA2 3ETPA 3JBG2 3HNBM 1S4CA 4UFLA 2XWJB 2BBVA 3VBHA 2VW1A 4ES9A 2QQJA 1W9TA 5BNOC 3NNMA 1MVQA 1SACA 1GNHA 3CBNA 1HRV1 4LA2A 4GJZA 3J8F2 2J1TA 1IS4A 4FPJA 5IYYA 1V9U3 3VZOA 2P3YA 4ZKTB 4XEZA 1BBT2 4NMIA 3WDTA 4AQ2A 1UCXA 1ULOA 1UPSA 4XXAA 1IQDC 1XU2A 1Q43A 2C4XA 2EIDA 1AYM2 3V65A 5FZ0A 2V5DA 4GH4C 3WX5A 2VC9A 2ZX2A 2X05A 2D6MA 3T4VA 4LOSA 1SBDA 3ZYPA 4LLOA 4CEWB 5FZ4A 1IPJA 1N1SA 1SLAA 2G1MA 3B7MA 1KS4A 1YFXA 2R7EB 3BGAA 1SZBA 5FMOL 3DPRB 3KV4A 5KC6A 4AOCA 1EUUA 1BEV2 1HN0A 1UZZA 4Q4V1 3JD73 4FFIA 4K40A 1ND2C 4YM0A 1QJU2 4V2VA 5A3MA 3HQRA 4QPGC 4BQYA 4FQZA 2XJQA 2JE9A 4YW7A 2R043 2ZA9A 3ELNA 2D6NA 4LTAA 2VOXA 2CGNA 4HONA 1Y7BA 5AVPA 4Y33A 1U5YA 1ZRRA 3CJIA 1FYUA 3MV01 2GC0A 1QH7A 5FY9A 2YG0A 2QQIA 3Q8EA 3WF4A 4YPJA 3ATGA 5F9TA 4JRAA 5I0DA 3AFKA 3AKSA 1SEFA 2BGPA 2YBSA 2VZSA 5L9BA 3ZR6A 4DEQA 3POWA 4KQ7A 2YGLA 5C8CC 2VCBA 2YMZA 4LIUA 1WW4A 3OGRA 4DNYA 3OBTA 1QOOA 1XRUA 4RHV3 4XTPA 1U12A 2WT1A 4L9BA 3K3NA 4YYOA 3KHCA 2HWC2 3T30A 4EWDA 3QH7A 2B8MA 1V6NA 3MIEA 4HG6B 1KRIA 1UY4A 2ZEXA 3C7HA 5FZKA 3O1PA 3QLQA 3ENRA 2BZDA 3LPGA 5EP9A 3FFZA 2WABA 5K8SA 3BPZA 5FYSA 2YV8A 3CZJA 2JG9A 2VW0A 2A6ZA 1TME2 2VR4A 2ZHNA 1MS9A 3ZR5A 4DIQA 2QKDA 5L7OC 1RUNA 1LGBA 2VUJA 4RL7A 4P14A 2LALA 4FXGB 3WR0A 1OUSA 3OB8A 1H6XA 4MVTA 2FMDA 4OUSA 5DDJ1 1VAKA 3BOPA 4CCDA 5T5OA 4CXXA 5JXGA 4IEVA 3UKNA 2MEV3 1PIV2 1VJ2A 3M2MA 4XETA 5IATA 1W99A 1IS5A 4M4RA 4BQ3A 4COUA 3BTXA 2VZTA 1QJY3 4QPIB 4B3NA 3FLTA 1JZ7A 3AKQA 3NKTA 3CQOA 2ZGQA 3GXUA 5JI7A 3I2OA 4P9XA 4TSVA 3WP6A 1W0OA 3BKZA 4AI2A 1RUC1 2LM3A 2PAKA 4HT1T 4HVOA 1ZREA 4BM8A 3J26N 3OPTA 3TNPB 1UU6A 3IN9A 1DIWA 3PMSA 1F31A 3K46A 1OXCA 1J1LA 4NUBA 1IG3A 3V64A 1RUH2 2BEOA 4RFRB 1LNSA 2VU9A 4DINB 4EN9B 1I6XA 5JIAA 2XJRA 1WW5A 1YIFA 4EWAA 3LCPA 3OOXA 1OURA 4MXWB 4X8NA 4EE2A 3ZXJA 4IEYA 1APNA 1BYHA 4IEUA 2QQOA 3ZSJA 1SBFA 4SBVA 1N47A 5F5IA 1E5IA 5I0UA 3AXEA 3IPVB 4LBMA 4XMAA 1XQNA 4MYEA 2AUYA 4I01A 4JDMA 4MXWA 4Q4X2 3VDDB 5FKBA 3UESA 4ASKA 1JH5A 1LULA 1Q8OA 1RUD3 3H7JA 1WZXA 1S55A 1UY0A 2RV9A 4KGQA 4LKFA 4AXOA 5CA6A 1WLCA 4OUEA 4FTSA 3SCGA 4UW4A 4L11A 4QB2A 3VBFC 3IBMA 4UW3A 2HLEA 4GMP3 3SCFA 4BQXA 3RWNA 3K48A 4WM7A 3NV2A 4K9SA 1JN2P 1GP4A 3SEEA 1H2MA 1GNYA 1OOPA 2WZR1 4QX8A 1DQ1A 4XBNA 1NCQC 1YIPA 5FYZA 5GLTA 1I5PA 1KQRA 4YGCA 3ZSEA 4E4SA 1ZA7A 1GWKA 1QJFA 1ZZ9A 4YM3A 2A3XA 2WT0A 2XLGA 4IV3A 4DMIA 2RJLA 3IIIA 2QQLA 1VAMA 3BODA 3MLKA 1GBGA 2WWSA 1HW5A 1S0JA 2WIIB 2XKOA 3CL1A 5IK4A 3WZ1A 3BU7A 3IDBB 1LTEA 1QJX2 1NY71 5I0TA 5JAXA 2QTWB 5DZGA 3WD5A 5JVVA 1JODA 2K9ZA 1DGLA 1W6QB 4BLJA 2X5IC 4HMZA 1AR91 2ETEA 3MLLA 4OULA 1GOGA 1WBFA 1W2NA 3PVEA 4AFCA 2W1QA 2NM1A 3O1VA 5IVCA 1IKPA 2D6PA 3WG1A 1S1AA 5FQ0B 1GZWB 2GAUA 4FOQA 5JCTA 2ARBA 2RDQA 2VBPA 1GFF2 4EN8B 5BNQA 4I0AA 3DXUA 3VBUB 5FY5A 3U4XA 1HRI2 2VMEA 4XC9A 4P9JA 1ULGA 4LE3A 4RQPA 4EN0A 5JIUA 2AGSA 1LRHA 1RXGA 2OQ7A 1YNAA 1RB8G 5KHKA 3JQWA 4AAPA 4NOTA 1W8HA 4LE4A 4XJ9A 3PL0A 4WVMB 3ON7A 1RUI3 1W6OB 4YLZA 3H3UA 4RR3C 1NZIA 1PO11 4O65A 1PGW1 1TNRA 5JMOA 3AP7A 3KQ4B 3MIGA 5FMCA 1PK6C 5IUQA 1WCKA 2OUJA 4GB31 3W58A 2J1UA 4XJ8A 4XMIA 2E31A 4JCKA 1W6OA 4UFIA 3WCSA 1D4M1 2XXZA 4BH9A 4BZ4A 3KF5A 3RVHA 2JE7A 5E16A 2DU1A 1AR72 1O3TA 1LHWA 1PM4A 5CKMA 5H9RA 2RS53 2W47A 3TAYA 1LU2A 4WV8A 3S7EA 3U14A 1X9TA 1S0CA 1GOFA 5A6ZA 1JYXA 1RUG2 1LEDA 1PO21 3FMGA 2DVAA 4BIOA 1RUF1 1O7FA 5IW0A 1AR81 3N9QA 1BKZA 1S0DA 1O3SA 2BUKA 4GWIA 3ZYRA 1XSQA 1WLDA 1YXWA 4MHUA 3VKOA 2BFUL 4U2AA 3LDRA 2WNOA 3UT0A 3OEAA 4Z92B 1C3HA 4ET7A 3GHMA 3B5LB 2XG3A 1J1TA 2H0BA 4W4ZA 3E5XA 2BOJA 1ULFA 1A6CA 5TSWA 3FLRA 4M01A 4Y5TA 5F6KA 2D3RA 1PGSA 4Y5SA 2ZBJA 2VW2A 2YFUA 4KG8A 2F4LA 3OBAA 2XLAA 3GJAA 2XJSA 2JENA 2AZ5A 4A6SA 2DBNA 4O9EA 5BXXA 5LEKA 2RS33 1REFA 2LW8A 5FK7A 1SDWA 4E8DA 3RYKA 2BRTA 4BXSV 1O3RA 1RJ7A 1SFYA 1Y43B 3GCXA 3ACLA 4NJ4A 4Q4V2 5CFDA 3RJRA 3ZYGA 4A2UA 1NE4A 1RUE2 3LDKA 5E88A 4XJWA 2XBO3 1COV3 5G05L 4M00A 1VBB1 1L7RA 1O5LA 2YROA 4UFHA 2O0OA 3OGVA 1ZBA3 4IE4A 5FY8A 2Q8OA 3UNPA 5J37A 3E97A 3KCXA 2EA7A 1LOGA 3MEPA 2X8KA 3WNNA 2RR11 2WFF2 4H55A 1FOD1 1MZ6A 3WP5A 1HIXA 1FX5A 2Q5TA 4AHYA 1W06A 3AP5A 4UFJA 3RZZA 4A7YA 1R093 1UX6A 1VBC1 1C1FA 2ILMA 2XGXA 3K4DA 4QMAA 3WY6A 4AFDA 1GANA 2VTXA 1R081 1WLTA 2YU1A 4AQSA 2A71A 3N36A 2G9GA 4ZHNA 4D8MA 3JQXA 1J84A 4CXWA 4CCMA 2Z5WA 3NWKA 1QH6A 4CEWC 3FUQA 4HSLA 1KFXL 5G04L 2WR9A 3O14A 2ZTNA 1DQ2A 2PAEA 3PDQA 2DTWA 1HRV3 1O5UA 2JKBA 2PAMA 3DPRC 4M3CB 5JSRA 3S5AA 2QCSB 2Y0OA 1JUHA 1VPHA 2W68A 3K51A 4N43B 3CF6E 5FZ3A 4AFMA 4CP9B 2ZX4A 1QOTA 2R0HA 5ERLA 3H1WA 3B69A 3FHAA 4M3CA 2YU2A 5FO9B 3TN93 2VZVA 2Y6GA 1UXXX 1JMUB 1OKQA 3PUQA 5FJKA 4N43A 3RZJA 1LEMA 3Q9OA 4DEVA 3ROUA 1PGL1 3C7FA 3ZFGC 1G8WA 3M3EA 1OF3A 3ZXFA 4FPCA 2C6SA 1QKQA 4MGTA 2DUQA 4B29A 5F3GA 1FPN2 4CP0A 1KDKA 4YFZA 2JICA 3LIHA 2ZEYA 1FNYA 5I0RA 3VZMA 1PHMA 3TYJA 3NNGA 2QDRA 4OI1A 1UMZA 3SITA 5HXMA 1AZDA 2XVGA 3DYMA 1IQAA 1SG3A 1UXZA 4WVVA 2DWRA 2PHTA 3FHIB 3I3BA 2EXJA 5FXZA 1URXA 4JKKA 3TRSB 4ISQA 2WNEA 3RMXA 1K45A 1ZRCA 4HLTA 1NA1C 3MW3A 1H6YA 1ENXA 1DYPA 4NAMA 2ORZA 3R4DB 2SLIA 3B00A 4XJZA 2DV9A 3VUOA 2B9UA 1AYN1 4XW3A 1EUTA 3CHXA 2B45X 1HXS2 2WLQA 5EYYA 1Z0HA 3HMYA 4FT8A 3MICA 1MEC1 4IQPA 2YXSA 3S0MA 3POEA 1SPPB 1AR63 1UU5A 1ASJ1 2IZWA 3OBRA 2XH6A 5C8WA 2OXBA 1FI2A 1DZQA 4QB6A 3OD4A 1V0AA 4JGYC 3WVJA 3J7LA 1AVBA 3OCPA 5A7WB 3EJKA 4A3XA 1NZCA 5DAVA 3CEWA 3VD7A 3VHNA 2Z69A 2GNTA 3FN9A 2DVFA 4IGQA 5LASA 4OLLA 3TB0A 2WZR2 3LEIA 5GALA 4Z1VA 2FDFA 2FBEA 5FK8A 4A44A 1UIJA 1Z78A 1A3KA 3LIGA 4QDRA 4XFFA 5GKAC 5D21A 3O1UA 5A7SA 4YVSA 2VCMA 4GXLA 2E53A 3A0NA 1I3HA 2GC1A 2Y33A 3WHUA 1A34A 1X8MA 4CVUA 2HWD1 5DDJ3 3WEZA 1LOBA 2BGCA 5FZEA 2Y6KA 3H3LA 3D5OA 1N3OA 4A6OA 4GWMA 1RIRA 2Q8CA 4G9SB 3DYOA 4Q8LA 5FP8A 4X6QB 4Q0SA 2FD8A 4UF0B 2R16A 1KJRA 4ZXEA 1UW8A 2GU9A 2MPFA 3DN7A 4XHXA 5EHDA 2BU9A 2ZGMA 5EPAA 2R32A 3GZUC 1K5MB 5FZCA 2CTVA 1F2NA 1TNFA 3ZSMA 3I54A 3AKRA 4UBHA 1RUC3 3BTAA 5CZKA 4GQ7A 3VDDC 1ZA4A 1FATA 1GZCA 4QX7A 1MQTB 1TMF3 3WG3A 3WDYA 1K5MA 5HCHA 2VUDA 3HNMA 4S2HA 2AYHA 4V1PA 2IVJA 2V72A 4PLMA 1XNTA 4BK5A 2XVKA 4QKBA 1MQTA 3NNFA 3WF2A 3FC0A 2UYAA 4K1YA 4QGLA 4D94A 3WNMA 1XNBA 2UWBA 1YFWA 4BQ2A 4EZ4A 4LHKA 1W03A 4NIHA 4CXYA 2VD7A 2ENRA 1I9RA 1V6MA 4XFCA 2OW4A 4QX1A 1QDCA 3MO4A 4AE2A 3R4SA 1Z7S3 5KXCA 2VVDA 4GMP1 1D4M2 2D44A 2JG8B 2Q1MA 5CKQA 2UWCA 4RS5C 1F35A 2GZWA 1EV12 1OLQA 1NXD1 3UGGA 2NQYA 3HR9A 2WYFA 1AL0G 1VP6A 3VV1A 2W52A 4Q1RA 3VDCA 2JG8A 1VMJA 4FI9A 5CEHA 2ZHLA 2PHXA 5J3UA 2CDPA 1Q5OA 5FY1A 1RUF2 4TLGA 4Z2AA 3PVOA 2JECA 1CAXB 1O4YA 5C33A 1W8ZA 2JD4A 3B9CA 3U4SA 5FBZA 1TVGA 5FZ8A 2VUAA 3OG2A 5FPAA 4W6XA 2OPKA 4NR1A 3TEYA 4OMDA 3IIAA 1RUJ1 1QF3A 3LSDA 1AF9A 4PDWB 4FSJA 1J58A 4XTMA 1YI9A 2K0GA 3ITQA 4OZXA 3VBUC 1ULDA 4P9IA 4BE3A 4AI8A 3HQXA 4QDSA 2DCKA 3SC7X 2EAAA 2XLFA 2WL1A 3O12A 4PJYA 1UKGA 4PT6A 1CX4A 4JQTA 2GP5A 4NPMA 2VOKA 4XFBA 5IT6A 5F3EA 4Y22B 5CFCB 5A32A 2JD9A 1AR93 3MW2A 2W46A 3VBOC 4BMEA 5GZDA 1BQPA 2IXJA 1JI6A 3MUY1 3FE5A 3ZYBA 2H6CA 4AI0A 4EQVA 4Y22A 5A6XA 1OA2A 2VGDA 5DG1A 1OH4A 1ALYA 3PU3A 5CFCA 5JXHA 4ZONA 5J36A 2SBAA 1IPSA 1QWRA 1XYOA 2ZXQA 4YVWA 5C70A 3HWJA 1VBB2 5FZFA 5K0UC 5LCWL 1G9DA 5DAQA 2LROA 3C7EA 1W05A 2J1VA 3R4UA 3A7QA 3AYEA 5ANNA 2VMCA 4NPRA 2XJTA 3L2YA 3AMPA 1FAYA 1YQ5A 1K3IA 1W0NA 3RWKX 3WG4A 1G86A 3SKVA 1IS6A 1S2BA 2VMDA 1YWKA 1WCSA 1JHJA 1SQ4A 1XOYA 2EAKA 2EXKA 3FL7A 3ACIA 1VBA1 2D97A 1LOAA 2P3JA 4CP1A 3ZFEB 5LATA 2WUHA 3HNYM 4HETA 3O1OA 4C0HA 3ZYHA 5KR7A 2AEYA 1M4WA 2PHWA 2HEVF 1ZZ8A 4XJAA 2VQAA 4I30A 2HYXA 1SLLA 1MR5A 3ZFFB 5BV6A 4IESA 4NE9A 5F37A 1C5HA 4Q8KA 5B4NA 1C28A 5JSOA 1B35B 1HQLA 3WLUA 4AHXA 1L3JA 2OQ6A 4Q4Y1 1FV2A 5A7PA 1PO23 3ZFFA 3A4UA 4AVBA 1UMIA 1AR83 1V9U2 2D93A 4R4ZA 3HBKA 4XUNA 4CE8A 5IVJA 2BWCA 2OX0A 4LITA 4COZA 2ZEWA 3POBA 3GZTB 3Q8FA 1LOFC 1VBD1 1OH3A 2G4IA 2VAUA 3PU8A 4IE5A 4GIQA 3KM5A 4A7KA 2XPJA 1EY2A 1JU4A 2GNMA 3KLSA 3D0JA 4A41A 3MIBA 3I2JA 3THPA 2YHJA 4EN7B 3WT3A 1H9PA 2A73B 3E6BA 3VZKA 1PGL2 3PVBB 3NNLA 1NX9A 1S2KA 1CD3G 3R05A 1GKBA 4JHTA 4ZU4A 5T55A 4ASLA 4CCJA 2RS31 2DYCA 3VD5A 2JDUA 5J98B 1AL21 3LFIA 5EXOA 3Q8BA 5A33B 2VOVA 2QVSB 3JD72 2CSGA 1UYPA 4ARXA 1FV3A 2VVFA 1COV1 2JE8A 2WC2A 2XBO1 3LDBA 2K46A 4FOWA 5JZGA 4FPFA 3WDVA 4BQ1A 4YW5A 4CDQB 5A33A 2R042 4Z8BA 1ZBA1 4IV1C 3E5UA 5F7UA 2XVLA 3CO2A 3NAPB 3ZKUA 4P00B 3WUDA 3GM8A 3PHMA 3VBRB 2P4EA 1FMD3 2JIGA 4A45A 1DYOA 1L7QA 1POV1 4CDXA 2RE9A 1WD4A 3NAPA 5BNNB 5J48A 1I1EA 4CDWB 5A3LA 1X82A 1UOFA 5F5AA 5H9QA 3VBRA 5JWPA 2XL9A 3OUIA 2PXJA 2D43A 3OJBA 2DCYA 4AGVA 2RR13 4XAAA 2Y0IA 3U10A 5BNNA 1FOD3 1UX7A 4I0BA 5I8SA 5T5JA 4CDWA 2E6VA 2CHHA 3NMBA 4COYA 4Z82A 4AGGA 2EXIA 1W3VA 4FVVA 1HN1A 3QCWA 4M3CF 1EAH3 4RHV2 4CCOA 1DFQA 2C0ZA 1VBC3 3KVAA 1UZVA 2B7YA 1WMEA 5F5QA 3SKJE 1V6IA 4OCTA 4CTEA 4DUVA 1R083 4XE9A 4CZSA 3VKNA 5A1FA 2B9VA 4AG4A 3GALA 5DABA 4GD4A 5BNPC 4CYDA 3MLJA 4MOAA 1N3PA 4ARYA 1NCRC 2JDYA 4CEYC 5FY0A 4IEZA 2CL2A 3NV4A 3RZLA 2DCJA 3NV3A 3VLBB 5IFPA 3RRDA 5HBAA 3SHRA 4XDQA 1RTVA 4HKLA 2BPA2 3THDA 3B94A 3TN91 1E5SA 2R30A 5FZOA 5J09A 4YFWA 3VKMA 2JDPA 2JKXA 3ZXEA 1W6MB 1NYWA 3NKGA 2KXLA 4D3WA 4TN7A 1LB2A 3BPSA 4JHZA 2EVXA 3WF3A 2R063 1IKQA 1WWYA 2BNOA 2E63A 4P02B 2MEV2 2J1SA 1W6MA 5CIRA 3B93A 1GZ9A 4UFMA 3M3OA 1QJY2 4HK8A 3B01A 3H9AA 3SXWA 1O6UA 2HWF1 4V2WA 2WWUA 1PMHX 4P5HA 5IVFA 3C7OA 4BA6A 3B3QE 2KA3A 5IAVA 4QM8A 4S2GA 1D0HA 2Q1ZB
chains in the Genus database with same CATH topology
3CJIB 3WP4A 3RDIA 2Y38A 2ARXA 2VECA 3UK9A 1Y3TA 1YUDA 3RMYA 2ZOEB 1KS5A 3ASIA 4R4XA 3EBRA 2GMMA 1SLCA 2ES3A 4EJRA 1DQ5A 5FO8B 5CU1A 3ZPYA 3WW2A 1BXHA 5T54A 2WS91 5JI9A 3L9JT 1AYN3 1RUD2 4DRRA 1AR61 4E2SA 4GALA 2A7AA 3AX4A 4MGIE 1MEC3 4TZDA 1ASJ3 2GSYA 2YC0A 3THTA 1ZBE1 5FOBB 2JG9B 5KHJA 4E2QA 3X29B 5CNAA 4YGEA 4K20A 3MFAA 1OQ1A 3HBZA 2Z79A 4XF9A 4AEDA 1QOSA 4LBQA 4QHBA 1CONA 3DKWA 2O8QA 1SLIA 2Y26A 2X53S 3KMHA 1HDKA 4JDNA 5KHGA 4IEWA 4DOUA 5I93A 4UBGA 2ZPXA 4FAHA 1CAVB 4IL7A 3WINE 4Y1XA 3ZXKA 4AHWA 2HWD3 5C9AC 1TEIA 2GDFA 1DBNA 3M7AA 1RL3A 2B39A 1CAVA 1JXNA 3AK0A 4QQPA 1QQP3 4Q4W3 1LGCA 4H3WA 1TMF1 3WUCA 3CU7A 1IS3A 2VNRA 4N7UA 4LBLA 1BMV2 4C91A 5I91A 5AC91 2CGPA 2OA2A 4R52A 3ILRA 2WZPP 1WW6A 2I07B 5CG9A 3PLQA 3QD6A 3B9IA 4QQOA 4CDUC 5DUUA 4QU2A 1RMU1 3AP6A 1M06G 3USUA 5HCFA 1RUI2 2RS11 2PELA 2CV6A 4Q2FA 4YM1A 3KSCA 3AMHA 5EYXA 3OD0A 1Z7S1 3JB4C 2D5FA 3AYAA 4WM7B 4HK9A 3RJ2X 1Q8SA 2A6VA 1OOPB 2VPVA 2RS52 4JVAA 3WXPA 1CESA 3AJZA 1F5FA 2D6LX 4PDWC 3V56A 1DG6A 1YLLA 4I2OA 1LODA 3ZSKA 1GR3A 1ULEA 1UN1A 2R071 4RSUA 1UF2C 4IV3B 1Q3EA 2HWB3 1VR3A 2WFPA 1G9AA 5KWRA 3O5SA 1RJ8A 1XNCA 3AB0A 1GLHA 2RM21 4HSJA 4AHZA 1EP0A 4DS0A 4ZXKA 2PHFA 2QFEA 5ABJB 4I3GA 1C8M1 2XL7A 3AM2A 3ES1A 3FBYA 4F7ZA 1RUJ3 2VNOA 1YFYA 2WNVC 5I8TA 5ABJA 2FHRA 1LJ7A 5D8AC 1O91A 1ZZ6A 3OYWA 4W6YA 4Y1YA 4WBBA 2ZCWA 1RVF1 2HEYF 3RI8A 1JBCA 2RS32 4B4RA 1H8TA 2C1FA 1W6NA 2CY6A 5C4WB 4PQ9A 2A6WA 4RQPB 2PA7A 2XBO2 4UW6A 1COV2 3IM0A 2XJPA 1H1MA 5T5LA 5C4WA 1RHI3 4HKOA 1ZBA2 1AJKA 3AMNA 5KC5A 3GZAA 5DUWA 3ZXLA 5CBLA 1B35C 1C5IA 2DFCA 2NPIA 1HX6A 2A5ZA 3URFA 2ZX1A 3VKFC 3LA7A 4FXKB 1VRH1 3A0KA 4WM8C 3T2TA 1RINA 1MS5A 1R092 1VBA3 3AP9A 1H1AA 4Y26A 2ZGSA 2WNUA 3SNMA 3I8TA 1LHNA 2XUMA 1B09A 2GH2A 3CLPA 4N53B 2K2SA 1QXPA 5JPNB 4Q4Y3 1A78A 4HZFA 1HRV2 5HCAA 2Q4SA 4N53A 2PLV1 4ITCA 1ZZ7A 3VBSB 3L2HA 2D40A 2AREA 2VMGA 5HCBA 1S0FA 2DURA 3TOJA 3N7JA 1H2NA 5F6LB 2I45A 5LK7B 1VBD3 4Y1UA 5DUVA 1VBE3 5K9YA 1AJOA 4YGBA 2D7FA 3VBSA 2P3IA 1IPKA 1S0EA 3V0AB 5CFDB 1AHSA 4RD7A 4OFGA 2RMU1 1IGOA 2DVGA 1AL23 3NO8A 4PIYA 3V0AA 1ND3B 3FWEA 3O7OA 3W59A 1OMIA 3VBHC 3PMEA 4META 5JOWA 3AXDA 3RNSA 1FMD1 3DUIA 1ND3A 3S30A 4CP2A 2IFRA 3HIFA 2C5DA 1UD1A 3D8CA 3IDCB 1LHVA 1SLBA 2PYTA 5FO7B 1POV3 3UL2A 3NL1A 3WQ1A 4L8QA 2DUOA 1G9FA 1NLSA 4IERA 4JC1A 3M3QA 4KL1A 1ZRDA 1EAH1 1OA4A 5KXBA 3SLIA 4YGDA 3V0BB 2WA3A 4QGNA 1AR62 5IK5A 2OUHA 4P9YA 4MGYE 1QMJA 1I5ZA 3P3PA 1WLWA 3N7LA 2ZMNA 3V0BA 4MX3A 3BOWA 2CWSA 4KGGA 4F3JA 1JTZX 2HWE3 3BALA 4IEXA 4JGZB 3T1LA 1PNFA 3KT1A 4RGGA 3HAGA 3H50A 1QU0A 1ENSA 2R061 4JGZA 3CJIC 4KU8A 5EJ3A 4LBQD 3W9AA 2XB6C 3JB8A 3KT4A 2WSUA 2CAUA 2NN8A 5DDJ2 3ZN5A 4LUKA 3IT8A 4K7JA 4L97A 1DU3D 1E57A 3LA3A 5T52A 3AKTA 4M0NA 3RYRA 1BZWA 4YZ4A 2HWF3 2VMIA 2P2KA 1H2KA 1CJPA 2H0VA 3AZXA 4B7KA 4C1WA 1DQ4A 1RUC2 3AZZA 1TQ5A 4PBOA 4E2GA 1TMF2 1N1TA 3LAGA 5BNOB 3O0WA 4INDA 2TNFA 5JOYA 1H8VA 3ZO0B 4MUVA 3PJYA 2ATFA 2DU0A 1CVNA 5J96B 2XWBB 2BW8A 4LNVA 5BNOA 2JG9C 5BNPA 2YGMA 1LESA 4ISRA 4GH4B 4C1XA 2YPJA 4FAGA 3JU9A 2WS93 4AFAA 3VN4A 2UY8A 3M3IA 1NXMA 4HANA 3MIDA 4WZCA 4GH4A 4AW7A 4N9IA 1D0GA 1R1A1 4QPYA 2TUNA 1QY4A 4IEPA 1ND2B 1ZBE3 3AZVA 4QGMA 4RA0A 1XNKA 3VZJA 1H30A 4QPIC 5E89A 5LRRA 4HKWA 1NG0A 3S7IA 4YVSB 1CIWA 3J9SA 4JRLA 2W08A 1CAWA 1ND2A 5ACA1 3IKWA 2R1DA 3JBG1 5HI0A 5BY5A 4QPGA 1UPIA 5E1RA 5E8AA 1DYKA 4XF0A 3D0SA 4H14A 4D7YA 3OGJA 3RPQA 3ES4A 1A8MA 3LGRA 2GC3A 1LGNA 3J8F1 1A8DA 4E4DX 1JYIA 4JDOA 5IK7A 1BBT1 5C8CB 4QQHA 1NY72 2JJ6A 1BCXA 1QQP1 4Q4W1 5GM0A 1JYCA 1AR92 4TWTA 2AENA 2DCZA 5C8CA 1NQJA 2OIIA 1HQNA 4D7SA 4KWJA 2VH9A 1ULCA 3G7DA 1J59A 2NYYA 4YG0A 4FPLA 4SLIA 4Q0UA 1DF0A 2JEMA 2ZGNA 4HN1A 4P9WA 2PHDA 1OOPC 1OD5A 1MS3A 4AEMA 5AC93 4FBFA 1QJU1 4M0HA 5L7OB 3WDUA 4XXPA 1RMU3 1ONAA 3ILNA 4PF5A 2F6BA 1CPMA 4BCUA 2RS13 2ZGOA 4IV3C 4YG6A 3OTFA 5L7OA 4Q27A 1PO12 4H7LA 1PGW2 2LTNA 1MACA 4PIXA 2IC1A 3AMMA 4GB32 4MV2A 5KXDA 4Y20A 5CAZA 3HT1A 1AXYA 3VHRA 2BQPA 3EO6A 2ZMKA 2JXAA 4N7IA 1YJKA 4MGZE 5C9AA 1HV1A 2HWB1 1ZX5A 1PO22 4LO8A 5FRAA 1XNDA 2R073 4ASMB 2OZ6A 1AR82 3BIWE 1W6PB 1CR7A 1UL9A 1ZZCA 4DPNA 3ZIWA 4L92A 2HWC1 4R8HA 5GLUA 1OFNA 2FQPA 2RM23 3ZN6A 2IWGB 4RQPC 2IXHA 1W6PA 2HYKA 3RQ0A 4XQ4A 4COVA 2FZ1A 5FTTC 3AP4A 5K7PA 2ZACA 1C8M3 1SCRA 1RC6A 5A32B 2MNGA 3ZMNA 3LOIA 4R9DA 1TME1 4BIFA 4FP3A 1WMFA 4J6GA 1AXZA 5C6CA 1HKDA 1OQEA 3E6DA 1DGWX 5GLZA 2DTYA 2GH8A 1RVF3 1KD7A 2VXRA 1QGLA 1JUIA 3IDEA 4YVWB 5EFUA 4NWWA 3RG0A 3CNAA 1HQWA 3VBFB 3VHOA 1PIV1 3ST7A 1RHI1 1DZTA 4NVPA 4TYSA 2JX9A 2A3WA 3LOBA 1FMD2 3VBFA 2E51A 1NCQB 2E7TA 3IWZA 2IXLA 1YI7A 1W2UA 1IHMA 3ZX7A 4X6RB 1LR5A 2ZX3A 1NCQA 5FAXA 2RR12 3GBGA 3LKJA 4Q0QA 3TWIA 1FOD2 2E9QA 4ATFA 4AK3A 1RUH1 2PHLA 1QXJA 5GZEA 1G6NA 2X29A 1VRH3 4L2NA 1EAH2 4YNIA 1U5IA 1VBC2 1F8VA 3OY8B 3ME2A 5SV5A 4MZUA 1R082 2X5IB 1OSGA 4B8EA 4Q4X1 1J3RA 3ILFA 3GYDA 3OY8A 2F4PA 1YYNA 2X5IA 5CFDC 1WD3A 2B46X 4QT6A 2IFWA 1H4GA 2NMOA 4S2DA 2ZZQA 4WZFA 2PLV3 4HPKA 4FPEA 1VBE1 3FUOA 4AI3A 3I59A 5KHIA 4FP2A 5BPXA 3WV6A 1RITA 2YDEA 4LR4A 5JZGB 4I09A 1LECA 1UKRA 1LENA 4YZ1A 2RMU3 4Y1ZA 2FMYA 3D82A 4RR3A 1U5XA 3SMHA 2DF7A 1PK6A 1KXGA 2QZ3A 4KNCA 4CDXB 5LEJA 1XE8A 3VZNA 2XKPA 4E9KA 1QJX1 1BVP1 2UY9A 3E5QA 4RGAA 2DVBA 3FJSA 1X33A 3UJQA 4AYUA 4EN6B 4KWKA 5H9SA 1YHFA 1UZYA 3M3CA 1ENRA 2P3KA 4QXKA 5BUVA 1AYN2 5JR7B 1HRI1 2BYVE 4N43C 1W39A 1N1YA 4FPOB 5EWSA 5JOZA 4FPYA 1MEC2 4XILA 1G7YA 5IK8A 3WP3A 1ASJ2 1U5ZA 3FFQA 4LULA 4HVRA 5FREA 4GWNA 2A70A 3R0RA 2HWE1 4PLNA 4EV0A 3ZMOA 2NLRA 4HN0A 5FLIA 1AR71 3NV1A 4QQ2A 3RYPA 3MPBA 4AVCA 1CN1A 4BOWA 2ZHKA 1RUG1 4R9CA 4XJUA 2CWMA 4XBQA 1PVC3 3ZIXA 4NHMA 4J1WA 1ZVFA 3D4KA 4XFAA 1BK1A 4LO4B 4Q29A 1WW7A 2HWD2 4FQ4A 3LA2A 5BYNA 3NSTA 3LSEA 4Z07A 4AVSA 4QD2A 2ZGTA 3WDXA 1AX2A 1QQP2 4Q4W2 5T50A 3DGTA 5DZFA 4OHWA 5H9PA 4Q0PA 2RHPA 4LO6B 2DCTA 3J4UH 1V00A 3FBMA 2WINB 1PZ8A 2P37A 2VG9A 4P9LA 3APBA 3VKLA 1AUYA 3MGUA 4CRQA 3N3HA 3ECQA 4CEWA 1CAUB 2E7QA 2UYBA 1RUE1 1DGRA 4NHLA 4HL0A 5JDBA 3SH3A 2QNKA 3DPRA 4YW3A 1CAUA 4YVSC 4Y4YA 4JAAA 3ZYIB 5DZEA 3USSA 3ZFGB 2ZAHA 5FOJB 4DQAA 5FMOS 3WHTA 4AEDB 2WFF1 4Q1PA 1R1A3 3NVCA 4LBQB 3ZFGA 2NP0A 4YG3A 3MI8A 2BVBA 3WQ0A 3UKVA 2GN7A 2KM2A 2HWB2 3EQEA 5JOXA 1RGSA 3HD8B 4C0BA 2YZ4A 2QZ2A 4QX5A 1K5MC 1CJDA 5ACA3 1NLRA 3JBG3 2R0FA 1X36A 2WKKA 2YYOA 1MQTC 1NA1B 1XYNA 2UURA 3ZXAC 1RUJ2 1ZYBA 3M1HA 4I02A 3J8F3 2AR6A 1NA1A 4OUMA 2Q30A 1BBT3 4B7EA 2IXKA 2GMPA 5LK5A 3WQ7A 1O3QA 1C8NA 2LUWA 1AYM3 1BVVA 4JQRA 1PNGA 4WVWA 5J7MA 3MYXA 4KBBA 3N4MA 2GNBA 4JGYB 1QHDA 4P9GA 3HT2A 2YY1A 4HFSA 3USUB 1RHI2 2BNMA 2JG8C 3H7YA 5CADA 4JGYA 1FPN1 1DLLA 1BEV3 2GN3A 3I4IA 1TE1B 4XF3A 3UJOA 1OLRA 1D4VB 1QJU3 1KJLA 4QPIA 1OQDA 3VL8A 3GBWA 2PN5A 1HLCA 2H6BA 2YUEA 1RUOA 5DUXA 4NHKA 1VBA2 3N7KA 4BLIA 4YM2A 2D3SA 4OHYA 5I8YA 1F5JA 4DB5A 5KXEA 4BWOA 4BPZA 1WUVA 2VNGA 5T3NA 5CG8A 1HXS1 1LCLA 2ERFA 2O1QA 4Q4Y2 3H0OA 5AFEA 1J3QA 2BNNA 5CB7A 3TNQA 1GQGA 5CFCC 1CQ9A 4AFBA 4ES8A 3IPVA 2ZMLA 4YVWC 2HWC3 2VQ0A 4QM9A 3VDDA 4FPGA 3G6JB 1XU1A 3OYWB 1VBD2 2GNDA 2PHUA 1VBE2 3KCYA 3RS6A 5DXDA 1H8TB 1W6NB 2VY0A 4J1XA 1V6KA 1TME3 4PCRA 5LRSA 2BTVC 1NOVA 5AFBA 3VHPA 5F1RA 1AL22 2UU8A 4LT5A 4F83A 4D69A 4YW4A 3N35A 1W0PA 1S0BA 4E27A 4F8AA 2ZGKA 3LWCA 3NW4A 4RS5B 4K3UA 1PVXA 3KS7A 1REDA 3ZFEC 4MSVA 1PIV3 3KQRA 1VB4A 2QE3A 4ATEA 3BB6A 4MXVA 4KWLA 3KZ4C 4W6WA 4FPHA 2NZ9A 4RS5A 3ZFFC 2WLPA 1G9CA 4O9GA 2R6QA 4FTEA 4JTNA 2R1BA 4ORFA 4XFHA 2XHKA 5GLWA 3M8LA 2GMEA 1W6QA 2W0XA 2WNUB 5L73A 2ZAAA 1YCIA 4YZ3A 1H9WA 1RUH3 5GZFA 3WCRA 2VVEA 3FLPA 2EXHA 2P17A 1GZWA 1MZEA 1QDOA 4PIZA 4XF1A 5KHHA 5FQ0A 4FO9A 2OVUA 3GNEA 3MIHA 3VBUA 3MFCA 4M3CE 3ZVXA 3UV9A 3VBOB 1DGWA 4Q4X3 3U0ZA 5JZGC 4GKYA 1KITA 2HWE2 4FOYA 4WVMA 4N90A 1WBLA 3MZHA 3VBOA 3PNAA 4R9BA 2ZX0A 4B4QA