5BV6A

Pkg ii's carboxyl terminal cyclic nucleotide binding domain (cnb-b) in a complex with cgmp
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
150
structure length
150
Chain Sequence
TAQARDEQYRNFLRSVSLLKNLPEDKLTKIIDCLEVEYYDKGDYIIREGEEGSTFFILAKGKVKVTQSTEGHDQPQLIKTLQKGEYFGEKALISDDVRSANIIAEENDVACLVIDRETFNQTVGTFEELQKYLEGYVANLNRDDEKRHAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords cGMP-dependent protein kinase 2
publication title Structural Basis of Cyclic Nucleotide Selectivity in cGMP-dependent Protein Kinase II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 43
structure length 150
sequence length 150
ec nomenclature ec 2.7.11.12: cGMP-dependent protein kinase.
pdb deposition date 2015-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5bv6A00
4HVQA 5KBFA 2I45A 4JV4A 4XFBA 3CJXA 5BXXA 3L2HA 2CAVA 4KL1A 1ZRFA 4BIFA 4KU7A 2ETEA 4XF9A 3U0ZA 3H7YA 1SEFA 1VJ2A 2VQAA 4QM8A 4QX5A 1H1MA 4OFGA 1YFWA 4Q0VA 1O5UA 4IEWA 4Q0UA 1HW5A 1XE8A 4MZUA 1NYWA 3U10A 5KHGA 3KCCA 5E1RA 3LWCA 3SXWA 4I01A 4I0BA 4IEQA 2B9UA 2OZ6A 3TNQA 3WW3A 1UD1A 4MGIE 2K0GA 4MUVA 3IBMA 4E2SA 1PM7A 5I8SA 1UCXA 4BHPA 4YARA 1NE4A 4TLFA 3MPBA 1VP6A 3RNSA 5T3NA 3E5UA 3NL1A 2Z2SB 4MGZE 3CF6E 4X6QB 2Q0AA 5J3UA 1XE7A 4META 4PIZA 4WBBA 5I93A 2WFPA 5HI0A 4O9GA 3RYPA 1RUNA 4E2QA 4XFIA 3VHRA 4XFCA 2CV6A 3H1MA 1LKNA 1Q5OA 3MDPA 5I0TA 5CVRA 3NW4A 1ZRDA 3CL1A 3G7DA 2EVXA 2EA7A 2XLFA 5LRRA 1CAUB 1ZREA 4Z82A 2BGCA 3DV8A 4XF3A 4I09A 4XFGA 1IPKA 1X8EA 3CEWA 2UYBA 2D93A 4Z07A 4XFHA 4FAHA 4HSLA 1GQHA 4E2GA 5LEKA 4MGYE 3DN7A 1VR3A 4R8HA 3D0SA 3E6DA 3EHKA 3EO6A 4KWJA 2BEOA 5JSRA 2V09A 2MPFA 1Y3TA 1OI6A 4QM9A 2GC3A 2Y0OA 4IETA 1X7NA 3FFQA 4QGLA 1XRUA 1I5ZA 4XETA 2ZKLA 1WLTA 3NSTA 1CAWB 3S7EA 4XFAA 2K9ZA 3LA7A 4MGKE 4UBHA 4LUMA 3OGJA 2N7GA 1RUOA 4PIYA 2XKOA 3H1WA 3OF1A 2XL9A 3IWZA 1UPIA 5K8SA 4Q0SA 1FXZA 3UKTA 1OFNA 4Q29A 1UIKA 5EZWA 3SMHA 4FT8A 4D7SA 3N4MA 4Q0PA 1DGRA 3OTFA 3D0JA 2MHFA 3KSCA 5I0RA 2QVSB 2OA2A 2PHLA 2XL7A 3FJSA 4MH0E 4I3PA 3FHIB 2GC0A 3E6BA 4LUKA 2GAUA 4N9HA 2QJVA 5FLHA 3WW1A 2Q30A 2GH2A 4LA3A 1TQ5A 4YYOA 3UKVA 5FPZA 3HT2A 4FBFA 1WGPA 1YUDA 2OYZA 5D1IA 2CAUA 4BYYA 1UIJA 2BNMA 3SCGA 3KMHA 3EBRA 4X6RB 4AVCA 5C6CA 1YHFA 4F8AA 1J3QA 4NVPA 3E5XA 3RPQA 2EAAA 2PHDA 2H6BA 2D5HA 4ORFA 4UBGA 5CU1A 1DZTA 3HT1A 5JAXA 1O3RA 2H0VA 3E97A 1PMIA 2FQPA 1CAUA 4LEJA 3H8UA 4CYDA 1QXRA 2IXCA 3HIFA 1DGWA 3M3IA 2IXIA 4GULA 3HQXA 3FE5A 4I02A 2ATFA 3RDIA 1CAXB 3LOIA 5JSPA 2XGXA 3ETQA 1YFYA 2ZCWA 4LULA 3IIAA 1RC6A 2WC2A 5EFUA 4IEUA 3LAGA 4EWEA 5JSOA 2UY8A 5FQ0B 2BYVE 1CAVA 2F4PA 1O3QA 3MYXA 4BH9A 2B8MA 4ZU5A 1OMIA 2E9QA 1ZNPA 2OPKA 4IEPA 2CGPA 5JCTA 1LB2A 3GYDA 2IC1A 1CAWA 1O3SA 5C8WA 3KGZA 3SCHA 4O9EA 3H3UA 1SQ4A 5BY5A 3MZHA 4YNIA 4RD7A 3JZVA 3PVBB 3ES4A 4EROA 1J1LA 4AVAA 3I54A 3FZ3A 1FT9A 4IEXA 1ZZ7A 4HZFA 4IEOA 4D7TA 3PLQA 4XF1A 2QCSB 3EJKA 3TNPB 2GC1A 3QOPA 4AVBA 4FAGA 2ET1A 1CGPA 2IXLA 4A2UA 3D82A 4JTNA 4KWLA 3I59B 1O7FA 2C0ZA 5BPXA 3S7IA 4ZU4A 1EY2A 2IXJA 1NE6A 1Y9QA 1YLLA 1V70A 1ZRRA 2QNKA 4IEYA 4XF4A 1YWKA 2IXKA 4L2NA 4WZCA 4Q0QA 3BCWA 1QY4A 2XLAA 3BB6A 3GBFA 3H50A 5KHHA 3USSA 3FWEA 3BALA 2PYTA 4R52A 3U11A 4IEZA 5JR7B 2VECA 4DINB 3E5QA 5I8TA 4XF0A 2O1QA 3RZZA 1J59A 1Q3EA 1G6NA 5FPXA 4KU8A 3NKTA 1X82A 2Z69A 4ONUA 2KXLA 3PNAA 1EPZA 2PQQA 3C3VA 1O5LA 4UXAA 4WVZA 1IPJA 3WW2A 4YSFA 1L3JA 2PA7A 2XKPA 1ZZ8A 3CO2A 1YFUA 4I2OA 1QWRA 1CX4A 1ZZCA 3ROUA 3OD0A 3KGLA 1J3RA 3R6SA 5KHIA 2Q1ZB 5FDBA 5J48A 4AQ6A 2D40A 1QXJA 5FLJA 1CAXA 2PAEA 1NZCA 3BU7A 3RYKA 5I8YA 4P9GA 4QXKA 2FMYA 3LA3A 3DL3A 2UYAA 1O4TA 2D5FA 4XFFA 4J1WA 5BV6A 5FQ0A 4HSJA 1EP0A 3H1YA 1J58A 1LRHA 5F1RA 2GC2A 4H7LA 4OLLA 1ZRCA 4YRDA 4I0AA 3E6CC 2XHKA 4HN1A 4JTOA 5I0UA 5FCCA 1JUHA 3ELNA 2UY9A 2OZJA 4HVOA 4EWDA 2BNNA 5LEJA 3RYRA 1SFNA 1ZZ6A 4EV0A 3NVCA 4L11A 2ET7A 1OD5A 3H9AA 3WW4A 4PJYA 1DZRA 3BPZA 3LZZA 3SCFA 1U12A 1RL3A 4KWKA 5BUVA 5KHJA 3NJZA 4JVAA 1WA4A 4N9IA 4LTAA 3ES1A 4QMAA 4HVRA 4PIXA 1ZZ9A 5I91A 4HBNA 2HKXA 4QGNA 4XEZA 2GZWA 3H3ZA 4HLTA 3IDCB 3ACLA 4K8FA 4LA2A 2IXHA 1H1IA 2MNGA 2P17A 4MV2A 3I59A 1EYBA 3S0MA 4F7ZA 3IDBB 3CLPA 3B02A 3EQEA 2BNOA 2PAKA 2QDRA 4QGMA 4IESA 2HJIA 5LRSA 2PAMA 3UKNA 1I6XA 4HMZA 3H7JA 3LA2A 1RGSA 4AQ2A 5E16A 3ST7A 1YFXA 1CAVB 4ZU7A 4MX3A 1FI2A 4AXOA 1LR5A 4IERA 2PTMA 2Q4SA 3O14A 3SHRA 2B5HA 3ZDSA 1Q43A 1RTVA 2VPVA 4LLOA 1ZVFA 5AVPA 5FLIA 1ZX5A 4IEVA 1UW8A 2DCTA 5KHKA 1J3PA 1NXMA 4EWAA 4J1XA 1ZZBA 2H6CA 2O8QA 2XLGA 3DKWA 5J7MA 5I0SA 4B29A 3QACA 5CADA 3FX3A 3I7DA 2PFWA 3M70A 2GU9A 1X8MA 4HN0A 1O3TA 3OCPA 1GQGA
chains in the Genus database with same CATH superfamily
1GKBA 4HVQA 3U07A 3KZ4C 4CDQC 1AF9A 2OT7A 4JV4A 5DDJ2 3VKLA 4B4RA 1UMZA 4CEYC 1QJEA 1CJPA 1OQDA 1K3IA 1XBFA 4WVWA 1W90A 1SHWB 3AM2A 4NIAA 5LBFA 4CU8A 2VOVA 5F37A 1XSQA 1DQ4A 1D0GA 5T5JA 4XF9A 3UYJA 3VBSB 2D6MA 3U0ZA 1FYUA 3MIHA 1OPOA 1R1A2 3LIHA 1RUC3 2WO7A 5SV5A 4IUGA 4XQWA 3USUB 3B01A 5FP3A 4AFCA 4FXKB 3WP6A 3UK9A 1DLLA 3ZSLA 2Z79A 1YFWA 3VL9A 1F5JA 1DQ5A 2RR11 3Q8FA 3VBHC 1TE1B 1YJKA 2NMNA 1H2NA 1HW5A 4IV3C 4LKSA 3TN91 2DBNA 1HDKA 2VTFA 3VBUA 1ULOA 2QFEA 3B00A 1XOYA 3O0WA 1QDOA 4RN5A 5E1RA 4C91A 5KHGA 2EAKA 3TWIA 4I01A 5EXOA 3RJRA 1RIRA 2OZ6A 1UD1A 1JOPA 5C3OA 2K0GA 3IBMA 1JYTA 3V56A 4M4RA 4A42A 1MEC1 1UCXA 1YO8A 2DCYA 4HKWA 5KXBA 3ZMNA 4H2AA 4CDXC 3APBA 5T50A 1NE4A 2H0BA 3MPBA 3RNSA 3SEPA 1EUUA 1G9FA 3WUCA 1QOTA 4WM8A 1AJKA 3VBFC 1NA1C 4BQ3A 1YCIA 2QQLA 3WP5A 5I93A 2WFPA 2C26A 1V00A 4Y24A 4YZ2A 1LU1A 3I4IA 2WT2A 1IS4A 2XBO2 3OUJA 4XFCA 4ZPIA 3S57A 3N9QA 1ASJ3 4CE8A 1RUF1 1YQ6A 3ACHA 3JBG1 4XJUA 3AMPA 2AEYA 3AKTA 5D2AA 3TYJA 2MEV3 1LENA 3CL1A 1EAH3 1OKOA 1BQPA 1TEIA 2EVXA 2XLFA 1CAUB 4QX8A 4AOCA 4DO0A 3K51A 1G9BA 1F9KA 2VZVA 4RR3B 1D4M2 2BGCA 1LJ7A 5FZ1A 1ZBA1 2E53A 3MW3A 4XFGA 1LTEA 3ECQA 1OA3A 1X8EA 1IQAA 3WCSA 2Z42A 4XFHA 3KQRA 3AFKA 1G8WA 3AP5A 1XJAA 4DQAA 1OLMA 3KF5A 4LBLA 4NIGA 1UL9A 1UOJA 5LBBA 2VCAA 2OX0A 3RQ0A 2O8OA 3HAGA 1A8DA 5FUNA 2P2KA 3VN4A 3WQ1A 4A3ZA 3E6DA 4H7MA 3EHKA 1OT5A 1UY4A 4BQ2A 1WLCA 3WNOA 3MPPG 1MPXA 2V09A 3NAPB 4LBMA 1Y3TA 1QJU3 3C2UA 1C57A 2RS52 2ZGRA 3PURA 2GC3A 4CUGA 2AYHA 5J1XA 1AXZA 1O8PA 2BBAA 4LNVA 2WO1A 1DQ2A 1GOFA 1PNFA 1XRUA 4QT6A 1LOEA 1PGSA 4XETA 1ODMA 1XQNA 4AWDA 1CAWB 4Q26A 1C8M2 2RM23 2K9ZA 3GF6A 4LE4A 3S7EA 1HQWA 4IE6A 2CGOA 1SLCA 5IWFA 3LDBA 1AYM3 3WG2A 3I2OA 2QQUA 4P5YA 4PIYA 1FX5A 5A6YA 2AH2A 1CVNA 1PGL2 1WMFA 2WAOA 3PMSA 1NQDA 4LBOA 1UPIA 1FXZA 1GNYA 1NY72 1SFYA 3UKTA 1Y9GA 4RL7A 4COUA 5EZWA 1MS8A 1UIKA 2TNFA 1CQ9A 3SMHA 1KRIA 3N4MA 3I2GA 1VBD1 2CWMA 2WAAA 3VBSA 2R042 1NCRB 3LSEA 3C7FA 1FPN1 1D2QA 3A21A 2V4AA 1ULCA 4ZS3A 4Q4Y2 5H9QA 3USUA 5H9RA 3FJSA 3ZXAC 3UJOA 4MH0E 5F3IA 5CFCB 1CPNA 1GBGA 2UWCA 5IVVA 4Z1VA 4GZ9A 2W87A 4JKMA 1VBE1 4NHYA 2Y64A 2XVGA 2QQPA 1Y43B 1Z7S2 2BRTA 4NAOA 3AMMA 5F5AA 2VMFA 4R9DA 2CGNA 3ILFA 5LZ6A 2XOMA 4LO5B 4XBLA 1JYNA 1PX4A 2R16A 3GHNA 2ZGOA 5FY8A 3R4UA 4N7IA 2A1XA 2AENA 3WHTA 4R4XA 1WGPA 3OEBA 5FYSA 5KWRA 5EQUA 4D6RA 2J1RA 4HPKB 3J8F3 2W46A 3P3NA 3SCGA 3ZFEB 2R063 1W6OB 2W9XA 2GNDA 4X6RB 4E8DA 4EN9B 2QQKA 2DCKA 1E5IA 4NVPA 4XHBA 4XCBA 4BQXA 1N1VA 1COV1 1AR91 2EAAA 5FZ6A 3IDEA 2H6BA 4UOJA 1RJ8A 4L0PA 3GBGA 3OB8A 4TZDA 3D4KA 3HOBA 4QPWA 1DZTA 1VAKA 4UBGA 5CU1A 1ULEA 2WZEA 4NHXA 1GLHA 4M0HA 3E97A 1UNBA 1PMIA 4H14A 4GJZA 1CAUA 1REEA 4LEJA 2XH6A 4PF1A 1JXNA 5D21A 4F3JA 1LODA 4JCKA 5FY1A 4RR3A 3FFZA 1P8JA 1QXRA 3HIFA 1AYN3 3ZIWA 4DXRA 2D6LX 3H8XA 3DPRC 1KITA 3SNMA 3VBOC 4QB6A 1IKQA 4W6WA 3SEEA 5L9RA 3P1IA 3FN9A 4CTEA 1HXS1 2YBPA 3RDIA 3NNFA 3LOIA 5FTTC 2C9KA 1G9DA 2W1SA 1DFQA 1RINA 1AR72 4UW3A 5FUIA 3AYEA 1DP0A 2VZOA 2FDKA 4QX0A 5A3PA 3LAGA 2KM2A 1XNAA 2BOJA 1BMV2 3MF6A 3NAPA 3ZXLA 4QXHA 2EIEA 5FQ0B 1E5HA 2GN3A 3QLQA 4AW7A 1Y7BA 4XJ9A 4BK4A 3KT7A 3MYXA 5A70A 2YPDA 1UWWA 4P08A 4AI9A 3WNPA 5DZEA 4KGQA 4RHV2 1WKYA 4RGAA 4EZHA 2RMU2 2ARCA 3HJRA 3K48A 3VLBB 2EXHA 4B7EA 1GR3A 2V4VA 4QQLA 4OCTA 3ZDVA 1CAWA 1IGOA 4JHZA 2BPA2 3OBAA 3VD3A 3H3UA 3ZVXA 2JG8C 5F5IA 3VDCA 1RJ7A 4FPEA 5BY5A 3UL2A 4CDQB 2ORZA 4D7YA 3MI8A 4RD7A 5FO8B 2YXSA 1W8OA 4AI3A 3PVBB 4CEYB 1VBB1 4EROA 3LEKA 3WINE 3BTYA 5FZGA 1IHMA 4Y1VA 4AVAA 5FZKA 1QNWA 1ZZ7A 4ASMB 2P3IA 2JE9A 2PHRA 4Q4Y3 3BVCA 3AMHA 4D7TA 1S0JA 2EXIA 1NCRA 1TME1 1WW4A 1POV1 1RUG3 1XYOA 1XYPA 3TNPB 4TWTA 4P9YA 3EMRA 1V9U2 2HEYF 4P5HA 1PK6C 3VBHB 4IV3B 5FYIA 4AVBA 5FJHA 1UKGA 5CFCA 5A1AA 1UZWA 2ET1A 1AJOA 2ZX4A 1GWMA 2WS93 3D82A 4JTNA 5C71A 4ARYA 3KVAA 3WV6A 1VMJA 4QHZA 1O7FA 4ZU4A 1DF0A 5FZCA 1Y9QA 3OBRA 4IQPA 2G1MA 2QQNA 5L7OC 5F5QA 3AYDA 4NIIA 2WWUA 1TMF3 3WDXA 1O4ZA 4IEYA 4XF4A 1QQP3 4G3YC 4IE7A 2GMEA 4H3WA 4CDXB 2IXKA 1VB2A 1H2LA 5T55A 3H8OA 1PGW1 2AGSA 2R30A 3VBFB 1NA1B 2VH9A 2CNAA 3BB6A 1GNZA 2VW0A 4HPKA 3WXPA 3ZFEA 4F83A 1W6OA 1RUD3 1W05A 5CA6A 2W95A 1TZOA 4P9IA 1HN0A 1QNYA 2HWD1 3X29B 4FP3A 2I07B 4LJHA 3RZKA 3PIJA 2YG0A 2W1UA 5FYMA 3ZXFA 5I8TA 2GP5A 2O1QA 2RR12 1D7PM 2X10A 3TN92 4OUSA 3GZAA 4TSVA 1RUE3 1J84A 3ETPA 4JGYC 4FPFA 3VDDC 3IM0A 4DEQA 5FPXA 5KC5A 1SG3A 1DYPA 3B93A 2FCTA 3ZXDA 3T2OA 4ONUA 1MS1A 4Q4X1 5APAA 3VD7A 3HWJA 5DQ0A 2VUCA 2DTWA 5ERLA 1LHUA 4AHWA 4CCMA 3CIHA 3ZOIA 2W91A 1FATA 1SDWA 4Y20B 3JXSA 2VQUA 3T2PA 3ZM8A 1YFUA 2HWE1 1C1LA 1QWRA 4H55A 3NV2A 1CX4A 2Q1FA 4X8NA 3ROUA 4C8DA 1F31A 3DCQA 1POV0 3AKSA 3OGVA 5GLTA 1JS9A 5A33B 1W3VA 1VBC3 5J48A 2JDYA 3FUOA 1RHI3 3ALQA 1MS3A 1UXXX 1QXJA 5FLJA 4Z8BA 2PAEA 1NZCA 2HLEA 1FV2A 2CDPA 3AJYA 3HQUA 1BEV1 1D4VB 2A3YA 2DWRA 5BYNA 2JJ6A 5BNPC 1RUF2 3ZYHA 4ARXA 1F35A 3ZFFC 1RUI1 3JBG2 3LA3A 2ZACA 4LOSA 4ZHNA 1JYCA 1S55A 1A3KA 1MVEA 3K46A 3OGRA 4XFFA 5BV6A 1GANA 2RJLA 2WSUA 5LY2A 4KGGA 4AHXA 5FQ0A 1RMU3 1OVSA 1J58A 1KS5A 3ZYJB 2V5YA 5HV0A 2XR4A 2GC2A 4AFMA 3J9SA 4OLLA 2D3RA 1WCDJ 4TLGA 1ZBA2 5JXGA 4YRDA 3E6CC 3HPNA 2ZGLA 3OSDA 3JUUA 4W65A 1JUHA 2WINB 2UY9A 3ELNA 4HVOA 4XDOA 1Y4WA 3BPSA 1HRI1 1PVXA 2PHWA 5F32A 1ND3C 1QJZA 1REFA 2ZHKA 3OOXA 5EYYA 4CDQA 3TEZA 2A3WA 1GZ9A 4OQ8A 3RZGA 4N8MA 2XJSA 4RFRB 3M1HA 4R4ZA 1OD5A 1US3A 3AP6A 4CEYA 1JYIA 4ATFA 1LHWA 4MSVA 4ATEA 3BPZA 5GZDA 1NZIA 4XOGA 4Q8KA 5ACA3 3KQ4B 1NLQA 1N47A 1W03A 2NLRA 3ON7A 3SKVA 2G9FA 1VRH3 4NMIA 4PQ9A 4LTAA 4AFDA 4AFAA 2BGPA 1XNCA 5I91A 2WFF3 4CU7A 2VBPA 4HK8A 3VBHA 4BPZA 4IV3A 3N36A 5C4WC 2OPWA 1FMD1 1S1AA 1W2OA 3R05A 1NQJA 5FYVA 2OVUA 4YGBA 3LFMA 2WLPA 4HLTA 4OHYA 3ACLA 1HRV1 4LA2A 2DVAA 2MNGA 1OC1A 3B69A 1K45A 3B9CA 3LDRA 5GALA 1V6NA 2RJKA 3I2HA 3MGUA 2X09A 2VMIA 3M2MA 1IOAA 3B02A 5IUQA 4NPMA 4HG6B 3GCWA 4CDXA 2HJIA 2HWC1 1UYXA 2WO3A 3MFCA 3VBFA 2PHTA 1NA1A 2XQRA 1VBD2 1RGSA 2OIIA 3LA2A 4QB2A 4AQ2A 4XTPA 4XUOA 4FFGA 1CAVB 1TNFA 2G4IA 1FPN2 4MLOA 2RR13 3UETA 3TN93 1LR5A 2WO2A 1LULA 3ZX7A 3BI3A 4BZ4A 4IERA 2EALA 4BQ4A 2Q4SA 4B8EA 2P3KA 1UX6A 1CWPA 2AEZA 1R093 1H6YA 4B1MA 1VBE2 3T2QA 3ZN5A 1ZA7A 4QKDA 1KJRA 3R4SA 3VL8A 2VPVA 1AR83 2AZ5A 5AVPA 4YGDA 2DU1A 3KWVA 4IEVA 1MEC3 2RHPA 4K1ZA 4LKDA 4FPCA 5FZAA 1CR7A 1WW5A 2OW4A 4M3CF 1ULDA 1ENSA 2Y26A 4Y20A 4JQRA 4Y1UA 5JUVA 1J3PA 4EWAA 1SBDA 5GLVA 5A6ZA 2D6OX 3DPRB 1UY2A 4QPYA 3VBOB 3CZUA 3L9JT 3N7KA 2WLQA 1NLRA 1RUJ3 2ARAA 2BFUL 2Y8KA 5DUVA 1DG6A 2XLGA 2W2IA 5A33A 3DKWA 4TXWA 5J7MA 3FMGA 4EE2A 5I0SA 3BTZA 3QACA 4D69A 3I7DA 1Q8PA 2C6SA 2BW8A 4XMAA 3ZR5A 2VM9A 1URXA 4PDWC 2GU9A 4NN0A 4UFKA 4RYDA 4UT5A 1COV2 2LS6A 1AR92 3H0OA 4AI8A 1UU6A 3TB0A 4YM3A 4I3GA 2A73B 5F2SA 3OCPA 1CZVA 1LGNA 4RFT0 3FHAA 2W1QA 1W04A 3GNEA 3LKJA 2GNBA 5DG2A 5JI9A 2I45A 4GMP1 3AL5A 4CUCA 5IVYA 2VJXA 5FPUA 1JOJA 3CJXA 1ZRFA 4QPGC 4OHVA 4KU7A 1APNA 2V73A 4YZ3A 2V72A 2P5BA 3ZYGA 3VHPA 4AVSA 4ZXKA 5AFBA 2PLV3 4MGTA 3RJ2X 2VQAA 5F3EA 4QM8A 1Z7S1 1CX1A 1QJX3 2J42A 2VUJA 3I2FA 2C1FA 4OFGA 2XB6C 2JG8B 3K75B 2CSGA 3HQRA 5DAPA 1GICA 1HXS2 2OQ6A 3VB9A 1NOVA 2R1DA 2B9VA 3U10A 1OA4A 3U4XA 1CZTA 5CZKA 5JOXA 4KWUA 2ZGNA 3W21A 5C3RA 2FDFA 2YC2A 4MGIE 4D3WA 4A7ZA 5KR7A 1V6JA 2BGOA 1GZCA 2JIGA 2YC4A 5FBZA 3WNKA 1PM7A 5I8SA 1GSLA 3DYPA 4YW4A 5A80A 2P1BA 4CU9A 4E2SA 1PK6B 4YW6A 1W6PB 4TLFA 1N3OA 1N1TA 1VP6A 2HWB1 3J7MA 1W9SA 2QTWB 5T3NA 1AR61 2W68A 2YPJA 3I2IA 5ANNA 3CF6E 4XACA 3NV4A 4META 4PIZA 3IIIA 4NUBA 1GWKA 4LBKA 4XFIA 5L7OB 2ENRA 3VHRA 4FPGA 4W8JA 3RZMA 2WRAA 4FPJA 5A7QA 1WW6A 1H4HA 1Q5OA 3EXUA 3M3QA 4KG0A 2BZDA 4W50A 1ZRDA 3N9OA 4FFHA 1VBB2 5LRRA 4U36A 5JXIA 4TYSA 1JZ7A 3Q8CA 2O14A 4Y5TA 3IDAA 5HXMA 5LA2A 1J83A 3I3BA 2E31A 2JECA 2VQ0A 4QDSA 1JZ5A 5ISLA 3KCYA 2DUPA 1SPPB 4QQOA 4XF3A 1W39A 5CAZA 2UU8A 2E7QA 1TME2 2WA4A 1PMHX 1SLBA 3BIWE 3CEWA 5AVAA 4AYUA 2D93A 5A1LA 3VGIA 4Z07A 1I3HA 3IAPA 1DDLA 1E5RA 1UY0A 2IZWA 4NWWA 4JGYB 3VDDB 3VZNA 2VCBA 4HSLA 4MO3M 1KFXL 5LEKA 4MGYE 3DN7A 2WYFA 4LPLA 4M3CB 2G9GA 4JHTA 4AEJA 3CNAA 3KHBA 1MS0A 3KV6A 2FDGA 1VBA1 1X33A 3EO6A 1PZ8A 4PBPA 1UMHA 1WD4A 1F4AA 3WSOA 3IB3A 2A6ZA 4LKFA 3DPRA 1OI6A 1S0DA 2WIIB 2LROA 2VCMA 4YG0A 3VBOA 1PGW2 1VB4A 3WD5A 3NNJA 1S2BA 3FFQA 5FYTA 4QGLA 3B7MA 1DGLA 2FMDA 2VMCA 2JG9C 1D0HA 5FZIA 5F6LB 3THTA 2HWD2 2ZKLA 4PT6A 1E5SA 1WLTA 2WQZC 1BBT3 5K9YA 3BTXA 5BNPB 5FP9A 3LA7A 3LPGA 4L92A 4DOUA 2JKXA 2VNRA 2WT1A 3ZFFB 4Q1PA 4P02B 4CZSA 3AKPA 4L99A 3WG4A 3WR0A 3ZYFA 4BA6A 2VTXJ 3PUSA 4ES8A 5FPBA 2ADDA 4UI9L 5FZ4A 4CP0A 2DUQA 2JDMA 4FI9A 4S2GA 1I1EA 2XL9A 4Q4X2 4RGGA 1QMJA 3VZMA 3ZPYA 2RV9A 2W47A 3WLUA 2JWPA 1H9PA 2JENA 3NNGA 4Q5OA 1IG0A 2D44A 4JKLA 4M00A 5IJRA 4G9SB 2ZMLA 1EV11 1O8SA 4CP1A 2HWE2 3D0JA 3KSCA 1W06A 1PO13 1Z0HA 4P14A 4B3NA 2QVSB 5CKNA 4KQ7A 5I0RA 5KXDA 3PVEA 4YZ1A 2WA3A 2JG8A 5A6XA 1ND3B 1XXNA 3ENRA 2NQYA 3E6BA 1S0GA 3T2TA 2RG4A 1JN2P 1REDA 1UKRA 4N9HA 3OD4A 1H9WA 3BOWA 5JZGC 1LHOA 1BEV2 2P37A 5FLHA 4DXTA 1W9TA 2FD8A 1CIYA 4XQDA 3WW1A 3VKNA 1RUI2 4CXWA 1S0EA 2Q30A 4INDA 1GNHA 1TQ5A 4YYOA 3EYPA 1HQNA 4Q2FA 4PBOA 4FBFA 3WNMA 3MV11 1RVF1 3VBRC 1PK6A 4YWAA 5C4WB 1F8VA 4BMEA 1W6PA 2CAUA 3S5QA 3MUZ1 4FO9A 4QX7A 1UIJA 2BNMA 4BJ0A 2DV9A 3WQ7A 1HV1A 4GB31 4Y4YA 3VUOA 1BKZA 4AR2A 1OLRA 3E5XA 1VMHA 3D8CA 2J1VA 4MXWB 5L7OA 1HRI2 3A7QA 1C28A 1UZZA 2QQVA 3B94A 1H2KA 1QDCA 1PVC3 1HN1A 1LOCA 1ZBE1 5JAXA 2H0VA 4KBBA 1IPSA 3KLSA 1OFSA 5BNOC 5C70A 4IW3A 1XPWA 3QD6A 3H8UA 3HNBM 5G04L 5DN2A 4O61A 4QKNA 4FOYA 1SPPA 1MR5A 2D6PA 1XU2A 4N53C 4QXCA 3WY6A 1O4YA 1OLQA 2GNTA 2VNOA 3JD73 2HBTA 1FMD2 4JGYA 4Q1RA 4HONA 4Y22B 3U75A 5L9VA 1HRV2 1S0IA 5LBEA 2RS13 1MVQA 2EXJA 3PUAA 5CKMA 4M3CA 3ZXGA 1YFYA 1YI9A 2ZCWA 3HMYA 4R9BA 2Q8DA 4AQTA 5EFUA 4YPJA 4DEVA 3EB7A 2DYCA 3N9MA 5IATA 5FP8A 2BBVA 4K8RB 2W52A 5JSOA 4QHBA 2CY6A 4LT5A 2Y38A 1JYWA 2VZ1A 3PUIA 1NAEA 2CHHA 4ASLA 1FNYA 2F4PA 2WZR1 2HWC2 1O3QA 2ZX3A 3VZOA 4LHLA 4DY3A 4ET7A 1NUKA 2PHUA 4LK6A 1ZNPA 2HWF1 3O1SA 2OPKA 2HWD3 5FZ7A 2PMWB 4FTEA 4PDWB 2J1UA 2R6QA 1KXGA 1W8NA 5IK4A 1LB2A 4FSJA 5IFPA 3GYDA 1Q8OA 4QKFA 1I5PA 4BMBA 4OYUA 4XVHA 3KV4A 2VZTA 5H9PA 5BNPA 2ZHNA 4SBVA 1XNKA 3NNMA 4FQZA 4OZOA 3ZFFA 3KHCA 3FHQA 2D7FA 3MZHA 1YNAA 1WWYA 2FDHA 5E8AA 3N7JA 3PUQA 5CNAA 4XBNA 4CP9B 5EJ1B 2PHFA 3ES4A 4QPGB 3URFA 1RYYA 4FOVA 5A3TA 5DPNA 2G19A 3NNLA 5CB7A 5EP9A 4ES9A 4LIVA 4PHZA 4QXBA 2LW8A 4XF1A 2QCSB 4UW5A 3IMNA 1DCSA 2GC1A 5HPOA 1ODNA 1G9CA 5J98B 1V6IA 1JZ8A 1GV9A 3QOPA 4IDZA 2P6HA 1OUXA 3NV3A 4WZFA 1ND3A 5DDJ3 1W0OA 4CCCA 4A2UA 2R1BA 4E4HA 4KWLA 1W2AX 5C3PA 1M4WA 3LEIA 3I59B 1HV0A 5BPXA 1EY2A 2HYXA 2W92A 4KBZA 5HCAA 1NE6A 5DUXA 2XONA 2RS31 5T5OA 5JPMB 4OHWA 1R1A3 5DUUA 3POSA 4LITA 1N3PA 1KS4A 4JKKA 3NJXA 3IMMA 1YWKA 5GLWA 4HK9A 3MIEA 4OMDA 1YIPA 3LF7A 3T3YA 1YQ8A 5C4WA 3OPZA 3LQCA 3BCWA 4Q0QA 1Y9MA 3Q8EA 3H50A 3GBFA 1X9PA 3USSA 5ABJC 3FWEA 4COZA 3BALA 1WMDA 4IV1C 2VZ3A 3R4DB 3U11A 4BIOA 1JI6A 4FFFA 4IEZA 4K40A 3AMQA 2D97A 4X8PA 3E5QA 5CG9A 4XE9A 5J96B 1QJY2 4MXWA 4A6OA 3K4AA 3RZZA 1HIXA 2YUEA 1Q3EA 2FCUA 2ZX0A 3W9AA 1NT0A 3WHUA 4CCEA 4KU8A 4U2AA 3BGAA 1X82A 4FPKA 3BKZA 3V64A 1AX0A 2KXLA 2FHRA 3M3CA 2VMDA 4PI2A 4RS5C 5EJZB 1ZRIA 4UXAA 3POWA 5FAXA 3C7HA 3WF3A 1LOBA 5A3MA 2I2SA 2XKPA 4XZUG 5K7PA 2DDUA 1W8FA 1SFPA 2XBO3 3ZR6A 1AXYA 2VOWA 2GNMA 3M4FA 3OD0A 1J3RA 1FMD3 2Q1ZB 5C3SA 2HWB2 3WDVA 4CUAA 1AR62 2P4EA 1FOD1 1R081 1AL21 1QXPA 1NCQC 1V0AA 3ACIA 4FPOB 3BU7A 4QAWA 4Y22A 2Q8CA 5I8YA 1PIV1 1Q8SA 4NAMA 3WG1A 1D4M3 2E33A 2ILMA 4P9GA 4QXKA 5IK7A 2GSYA 2DBIA 3OYWB 1JZ2A 2E26A 1N3QA 2VL4A 4NIDA 1O4TA 2GP3A 2J1AA 1B09A 1OKQA 3WCRA 5FYUA 3SH5A 3C8XA 2VUAA 4XUPA 4YFWA 2LRPA 3POYA 1YQ2A 4ISRA 3VKOA 5LCWL 1ZRCA 2JG9B 2ZZQA 4I0AA 3J7LA 2WSVA 1KDKA 2ZGPA 1R64A 2YBSA 5C9AB 1HQLA 4HN1A 4PDWA 5KC6A 4QB1A 2AUYA 4QKBA 3ZYBA 2RS53 5A3WA 3IKWA 4NRQA 4EV0A 2J1TA 4ZXEA 2ZS6B 5FR3A 1JU4A 4CP9A 4OVEA 1D2SA 3H9AA 3WW4A 3NQHA 4PJYA 4QPGA 1UO9A 2WNVC 3ZLIA 3W5NA 1V6KA 1VBA2 1GZWB 4AHYA 3K77A 3O7OA 3CQOA 3D5OA 1C8M3 3TAYA 3V65A 4A6SA 5CISA 2P3JA 4FTBA 2GH8A 4N90A 4D8MA 3ES1A 1RUH1 4QMAA 1W99A 4PIXA 2P34A 4AEDC 4DXZA 3NO8A 2YFZA 2LM3A 1OPMA 4Y5SA 2YROA 2ZBJA 2XG3A 5CEHA 2XJQA 3CDZB 3H3ZA 1UU4A 2B45X 3GALA 4DY5A 4K8FA 5JZGB 4Q4W2 2VAUA 4K3UA 2RVAA 3I59A 2R49A 1EYBA 3NRUA 4GWNA 4V2VA 4F7ZA 2IFWA 4W6YA 2VG9A 3POFA 1RUC1 2R043 3GBWA 3IDBB 2CDOA 5LA1A 4PLOA 4QD2A 3KV9A 3EQEA 3TBDA 2WDBA 3VBRB 1QKQA 4IESA 1GFF2 3AXDA 5B4XA 4Y4RA 3RMXA 4BM8A 5CFDC 1XNDA 1I6XA 3CMGA 1XNBA 2GALA 2UURA 4XJAA 1EV12 2DURA 1OLME 1Z7S3 3H7JA 3HEIA 1DYKA 1PO21 3ABZA 3J7NA 3JB8A 3KM5A 5A7WB 3ZXEA 1YFXA 4V1PA 2OXBA 4ZU7A 4MX3A 1FI2A 3MV01 2JEMA 2ZOEB 5C33A 1W6MB 4NWVA 4CDWB 5BXXA 3B3QE 4MGQA 3WF4A 1F15A 2ZMKA 4D94A 3I97A 2V5DA 3ZDSA 5BNOB 4Q4V1 4L8QA 3ZN6B 4LLOA 2YU2A 4DPNA 1PZ7A 1ZVFA 5F3CA 1TG7A 3S6PA 2A6WA 3UT0A 5LA0A 4ZZ8A 1BK1A 4MHRA 2DCTA 5T5PA 1AUYA 5KHKA 2ZAHA 4N53B 5LY1A 3V0BB 2JDNA 2H6CA 4NRPA 2O8QA 3KS7A 4QX3A 1RVF2 3OJBA 4L97A 1Q8QA 2MEV1 5FP7A 2WBKA 2PHXA 4XIKA 4GWMA 2VR4A 4GB32 5CADA 4MADA 1T2XA 1UZVA 1WCQA 2PFWA 3JU9A 5DAXA 3M70A 3ZMOA 1BLZA 1W0PA 5FZ9A 3A23A 4HN0A 3ITQA 4GWIA 1O3TA 3RZJA 4FPHA 3VZLA 4CDWC 3OYWA 1GQGA 4Q0VA 3CHXA 3O1VA 1PX3A 4XZPA 1JMUB 1ZBE2 3A0KA 1XC6A 1GOGA 4XFBA 4MYEA 3T4VA 4QU1A 3A4UA 1UZ0A 4HKLA 4CCKA 4AAXA 4D0QA 2WN3A 2A75A 1GP4A 2WABA 4XIOA 4CCNA 2ETEA 2JG9A 3AP4A 5FPLA 3H7YA 1AR73 4NO4A 4YW1A 1MACA 1VJ2A 4IL7A 5C9AA 4SLIA 5LK5A 1ENXA 1SDDB 4UF0B 5HCBA 4BLJA 1H1MA 1QJU1 4COWA 4CPBA 2CTVA 2VOTA 1HLCA 1U5YA 3MIBA 1OBNA 1XE8A 2R072 4N43C 3SKJE 2Y33A 1F4HA 3U4SA 3LWCA 3CU7A 5FBJA 3AYCA 4RHV3 4I0BA 4IEQA 3IPVB 2RMU3 2XVLA 3Q8BA 4AAPA 1S0FA 1WCKA 1W9FA 2X5IC 4MUVA 2RM21 4WV8A 2VVDA 4RSUA 5F39A 4XBQA 2GMPA 2Z5WA 5I0DA 1G9AA 4BHPA 1AYM1 2EIGA 2WZR2 3RWNA 2LALA 1YC61 3E5UA 3T0AA 5B4NA 2PELA 2HWF2 2Z2SB 4KH9A 5FY0A 4X6QB 1BVVA 2VY0A 4MVTA 1XE7A 4ISQA 1YYNA 1J1TA 4QX1A 3ZSEA 4CEWC 1XU1A 2EIBA 4AZZA 4YZ5A 5JI7A 1RB8G 4O9GA 5JZGA 4QQPA 5LBCA 3RYPA 2ZKNA 4E2QA 3N9PA 3VDBA 2XJUA 4C1WA 2Y6KA 3H1MA 3UGGA 1LKNA 3AL6A 1KEXA 4OI1A 2NYYA 4MGSA 2QDNA 4P9XA 2ZEXA 1UU5A 5CVRA 3THPA 4NROA 1FV3A 5J09A 1V9U3 4FPYA 3ATGA 3POGA 2EA7A 2ZA9A 4K9SA 2ARBA 5A7SA 3VBRA 4AL9A 1EUTA 2XJRA 5AC91 3MLJA 1XE0A 4Z82A 5FREA 3LSDA 4YZ4A 4AHZA 5ABJB 1F5FA 2IUWA 2VOXA 4IV1B 2Y6FA 5FOBB 3SQOA 4I09A 4JQTA 1UYPA 1SLTA 4NRMA 1IS6A 4DXSA 3GZEA 4GH4C 1W6MA 5LB6A 2ZXQA 1GQHA 2WKKA 5EJ3A 3WQBA 1W9YA 4E2GA 3RZLA 2WQ8A 3RI8A 4CA9A 3J8F1 5BNOA 4RS5B 5L36A 3ZN6A 2R061 4CU6A 1IKPA 3THDA 3S30A 4S2FA 4E4DX 2RS32 3D0SA 4GIQA 1H1AA 5FZMA 2W08A 4KWJA 3N35A 4OHXA 4N53A 3LE0A 3JQXA 2ZGKA 3V0BA 4QM9A 1WBFA 2Y0OA 2ORXA 2VBBA 2Y34A 3GCXA 2BOIA 1X7NA 3OY8B 4IETA 5JOZA 4LK7A 4HXCA 4AI1A 2YV8A 1NCQB 2QQIA 4WVMB 5DAQA 1SCRA 4J6GA 3K3OA 3MICA 1PZ9A 3IT8A 4FOWA 1LHVA 2A70A 2O0OA 4BLIA 4CP2A 4CXXA 3HBZA 4DUXA 3NSTA 1GP6A 4XFAA 5A7PA 4UFMA 2XJVA 4MGKE 5CG8A 1AYN1 2YYOA 3OGJA 2N7GA 1RUOA 3CZJA 2XKOA 3GJBA 2HYKA 3ASIA 5GLUA 1BK0A 2EF6A 3AKRA 4EJRA 2XPJA 5K8SA 1YIFA 3M8LA 2RE9A 3WNNA 1SLAA 3DKQA 4Q29A 5DAWA 4XC9A 4CPBD 1N1YA 2VZSA 5GZFA 4JGZC 1DGRA 2BQPA 3OTFA 5BNNC 3ILNA 2MHFA 5FP4A 3VHNA 1RUF3 4CSWA 3IAQA 3JB4C 5LA9A 2OA2A 3HVDA 2PHLA 2XL7A 3JBG3 3K4DA 4QWNA 4UF0A 1FOD2 1R082 5FMBA 2WZPP 4AI0A 3AJZA 1AL22 5DZFA 5FK7A 5A32B 3WVJA 3FHIB 1T6GC 2K2SA 3FUQA 4JDMA 1U0AA 1IZ3A 4LUKA 1PIV2 2GAUA 2ZEWA 4OI0A 4XABA 2WNVB 2QJVA 1ZM1A 1ZBA3 2QE3A 3POBA 1OQEA 3IPVA 2TBVA 3A22A 3V0AB 2Y6HA 4J25A 2GH2A 4LA3A 4TN7A 4CDUC 1GP5A 4XURA 1ENRA 4JZRA 4CXYA 5FPZA 3LDKA 4AEDB 2HWF3 2VC9A 3D3AA 2VULA 1POQA 2ZTNA 5D1IA 5L19A 4XJ8A 3K2OA 1SBEA 5FZDA 1QJY1 4UW4A 4BYYA 4P9WA 4BISA 1GU3A 1UYZA 2X53S 5A7OA 3RSJA 2WNEA 4DB5A 1UX7A 1UPSA 4AVCA 3PMEA 3VZKA 4XDQA 5C6CA 4A41A 3T0BA 4F8AA 2NZ9A 2VQTA 3DXTA 1LCLA 3RG0A 1MS5A 3RPQA 1UOGA 5IK8A 4A7YA 1ENQA 5FZEA 3AKQA 2D5HA 3ZSKA 1RUG1 2BU9A 1W8UA 1HKDA 1OXCA 1JW6A 3GGLA 1BJQA 4HT1T 5DABA 5A7NA 3HT1A 4KNCA 4XQ4A 1UY1A 1XNTA 5CFDB 2DVDA 5J36A 4OUMA 1WUVA 2WS91 4A45A 5ABJA 4IV1A 2IXCA 1DGWA 1L7LA 3CBNA 4V2WA 4W6XA 3M3IA 4AF9A 1RUH2 3HQXA 3FE5A 5CBLA 1VAMA 4KG8A 5JLVA 1QQP1 1AL0G 1MZFA 4JAAA 1JBCA 4LO6B 2FZ1A 3CJIC 1A78A 3PUHA 5FXWA 1CAXB 2XGXA 2CL2A 4YGCA 3T1LA 4CVUA 2VNGA 3MUY1 4G4FA 4GMP0 4OMCA 3BUCA 4RS5A 3K4ZA 5FZ0A 5M0TA 4LULA 3UJQA 1H6XA 1RC6A 1RUD1 2WC2A 4PLNA 1VBD3 4Q27A 3WEZA 1UMIA 4EN7B 1RUC2 3NV1A 1MZ6A 3AZWA 4IEUA 1FPN3 3ZXKA 1HB4A 1DLCA 2W0XA 5FWJA 1CAVA 1MZEA 2C9AA 3VD4A 1RUE1 3J7HA 1IS3A 1S0BA 2B8MA 4UFIA 5F2WA 2VOKA 1OMIA 1VBE3 3OY8A 4GA9A 4YVWC 4IEPA 3DECA 1NCQA 2YDEA 4WVMA 4C1XA 1PO22 5L73A 5FMDA 1ND2C 5JCTA 1DQ0A 1DQ6A 1H0BA 3P5BA 5FXZA 3T09A 2IC1A 2PXJA 1O3SA 5C8WA 1UOFA 4XXPA 5IAVA 2YFUA 2D3SA 1WLDA 1SACA 2IVJA 2VZRA 4O9EA 1QH7A 5DXDA 1SQ4A 2XUEA 1E57A 1WMXA 2VZQA 1R1ZA 1VBC1 3WF0A 1LAJA 3PVOA 4Q4V2 1RHI1 4HANA 3INAA 5JWPA 5FOJB 1J1LA 2WN2A 3O1PA 4WM7C 2E51A 3FZ3A 1FT9A 3I54A 5EV7A 3BU0A 4IEXA 4K7JA 3ZSMA 1YRZA 4BQWA 1GMMA 2BVBA 4Y5Z0 4M0NA 4IEOA 2VZPA 1COV3 1AR93 1YEWA 4AEKA 4A3XA 3PLQA 4Q4W1 3EJKA 4LBQD 4AG4A 1UYYA 2MEV2 4N43B 1UF2C 2KD7A 3E1F1 1RMU1 5A32A 4XUQA 1CGPA 2IXLA 2GDFA 3O1UA 4NJ4A 5JPNB 4BB3A 3JCIA 4UFLA 2WZ8A 3W58A 2WNVA 2E7TA 4XHXA 2YGLA 2IXJA 2X5IB 1JOBA 2B42B 3MIFA 4PLMA 3AZZA 3V0AA 4B4QA 1W2UA 2JKBA 1ZRRA 1LEDA 2QNKA 3PU8A 3G6JB 4LQRA 1OH4A 3TRSB 2YU1A 4AEDA 5LW9A 1HXS3 4L2NA 2WJSA 1MZ5A 2QQOA 4WZCA 3MIDA 3OBZA 4Y26A 4M01A 2Q1MA 4NR1A 5KHHA 2X05A 3UGHA 4CEWB 2YZ4A 1RITA 5ACA1 1HX6A 3VHOA 4GAZA 3SH3A 2VECA 3VV1A 1QJU2 1VRH1 2RDRA 5IAXA 4XF0A 2BP6A 4RGKA 1SLLA 1JODA 4COYA 1NXD1 2WFF1 3A0NA 1OOPC 3VZJA 3ZFGC 1A34A 3HR9A 1S2KA 1PMJX 3LIGA 5CFDA 2PQQA 3C3VA 1O5LA 1IPJA 2JXAA 2QQJA 4YSFA 2RM22 2PA7A 5FYYA 1AX2A 1ZZ8A 2FCVA 2NP0A 5FUPA 1AYM2 1W6QB 2JX9A 1WLWA 4JRLA 4YLZA 3KGLA 1GQPA 1N1SA 5FMOS 4GH4B 5GLZA 4Z2AA 3ZO0B 1JTZX 1LEMA 2D40A 2VD7A 1SLIA 3LFIA 2ZGSA 4AQ6A 4D6SA 1VBB3 1CAXA 3ZN4A 2ZGTA 4K21A 4K6BA 3RYKA 2C4XA 2ZABA 3FBYA 3I8TA 3WZ1A 4AFBA 3I3EA 1DZQA 1KGYA 1KJLA 1VE0A 2BVVA 4K1YA 4LKEA 4XCAA 2FMYA 3LGRA 1JYXA 1TME3 3MFAA 1POV3 4E9KA 3DL3A 3RS6A 2DFCA 1Q8VA 2W1WA 1V6LA 2D5FA 1RXFA 3OUIA 4J1WA 4HSJA 1R091 3H1YA 5DAVA 5LATA 5AC92 4CCDA 1LRHA 2B4KA 1PO23 2KA3A 5LK7B 3W59A 2BV4A 1AR81 1U5ZA 4H7LA 3VDDA 2A3XA 2R071 2XHKA 2ZGQA 4JTOA 4P9JA 5I0UA 5FCCA 3O12A 4E8CA 4NIHA 1UXZA 2OZJA 3I3QA 3WG3A 5B2GB 5IVFA 3ZKYA 4Y3OA 4EWDA 4CDWA 2XMLA 4Q4V3 1K5JA 2WR9A 1SFNA 1ONAA 1RUJ1 1ZZ6A 4R9CA 2X29A 3J8F2 5FIXA 5FYHA 4XJWA 2R062 3LEMA 4B1LA 5C8CC 1H30A 5F5CA 4DRRA 1DZRA 3ZSJA 3LZZA 3NKGA 1C8NA 1U5IA 3HD8B 4JGZB 1U12A 2XXZA 2L9LA 1RL3A 2EICA 3IN9A 4KWKA 4JVAA 3WNXA 5BNNB 1W8ZA 2Q5TA 5KHJA 2LTNA 4FOQA 1WA4A 2ZPXA 4XXAA 2Y6GA 1OVPA 4PQQA 3QH7A 4E4SA 1AXKA 1EPWA 4GD4A 2E7AA 5FYCA 3OBTA 1SMVA 1OH3A 1JHJA 3F2ZA 1UAIA 2XJPA 4N43A 4URAA 2HKXA 4XEZA 1LHNA 2GZWA 4Q4X3 1W0NA 3WQ0A 2P17A 2J1EA 1S4CA 4MV2A 3BIEA 1DQ1A 4RQPC 1AYN2 2X5IA 2HWE3 2PLV1 3UV9A 2J1SA 3BTAA 2AACA 4ZONA 4B7KA 2ZZJA 2IFRA 4CDUB 1DHKB 1B35C 1QJX1 2FBEA 4MHUA 1JU3A 2AREA 1RXGA 2BNOA 1OUSA 2F17A 2PAKA 2QDRA 3M3OA 4NHKA 3C7EA 4WVVA 4COVA 4EYUA 4CCJA 2BDRA 4XUNA 1DYOA 2P3YA 3AZXA 2JIJA 3LB9A 1QF3A 4RA0A 3AB0A 1LECA 4CEWA 2Y6LA 1BEV3 1CPMA 3HN3A 5E16A 5C5TA 4ZZ5A 1KQRA 3BODA 5DMYA 1ACCA 1RUI3 3VD5A 2CU5A 3OGSA 1JZ6A 1L7RA 2B5HA 4LE3A 5A1FA 5JVVA 3GXUA 3HBKA 3ZPOA 3I2KA 4DMIA 1RTVA 2YY1A 4LBJA 4QQHA 4YW3A 4UFJA 1HJGA 1BHGA 4JX0A 2E63A 2W39A 3J26N 4JDNA 1JZ3A 3GJAA 4YG6A 2R7EB 2VCCA 3RWKX 1WA6X 5T54A 1HRI3 1QHDA 1W6QA 2E6VA 2YB7A 1WCSA 1ULFA 4GH4A 2OKXA 2XUMA 3CJIB 5GM0A 3FLTA 4BXSV 4OI2A 2VZUA 2D3PA 1GOHA 3FX3A 2YBKA 3UNPA 2R32A 3D6EA 5EHDA 2DTYA 4FPLA 4YVSC 3WNLA 3ZXJA 4IE5A 4CCOA 2WWJA 1X8MA 2ADEA 4ZY9A 4EN8B 4JDOA 5HBAA 4E27A 1RUG2 2JDZA 4YM2A 1FNZA 3SH4A 5FPAA 3SLIA 5FYZA 1WD3A 1YI7A 3I3MA 5AC93 2OS2A 2WNUC 4N7UA 5L9BA 2Z4FA 5FZOB 1H2MA 3MO4A 5KBFA 3FL7A 2VU9A 3AFGA 2WS92 1MQTC 1WMEA 2WUHA 1W2TA 2CAVA 3L2HA 4KI5M 4KL1A 4XYXA 4YVWB 3T30A 3VDAA 4BIFA 1HRV3 1WW7A 2F6BA 1PNGA 2HBUA 3KB5A 1G7YA 1SBFA 1ND2B 1SEFA 1LOGA 2DCZA 4NHMA 1BVP1 5D8AC 1TMF2 4HOOA 4QX5A 3QBQA 1QQP2 4PCRA 4NOTA 4LXLA 1W8TA 4FTSA 1O5UA 3MBWA 4IEWA 4Q0UA 1H8TC 4MZUA 5IT6A 2ZGUA 2HWC3 1NYWA 5A6QA 3LCPA 3KCCA 3VD9A 3SXWA 2TEPA 1LOFC 4GXLA 4WM7B 1RUD2 3KV5A 4OI4A 3RGBA 5GZGA 2B9UA 4NPRA 1OA2A 2EXKA 3MHZA 2ID4A 2IVIB 2VE1A 3MW4A 5FK8A 3TNQA 3WW3A 1T6BX 1BBT1 3ZIXA 3POEA 2QBXA 4JGZA 4LHNA 3WF2A 5BNNA 1XSRA 2BWAA 3MLLA 4YW7A 2QKDA 3I2JA 2JDKA 1IS5A 4O7XA 2R0HA 1RUE2 1M06G 4YARA 4DNYA 4QPIC 1W2NA 5FZ3A 3PDQA 1K12A 4GQ7A 3NL1A 3PHMA 3C7GA 4YM0A 4MGZE 2Q0AA 5J3UA 1VALA 3NMBA 4ITCA 5FMCA 2XHNA 4WBBA 3SITA 5K0UC 2VMGA 5HI0A 3I3DA 1RUNA 1GWLA 3WDUA 1O6UA 3O1OA 2JB8A 1AVBA 1V6OA 2CV6A 3ACFA 4YFZA 5C5UA 1PO11 2OQ7A 3WDWA 3MDPA 3PTYA 5I0TA 4GKYA 4CDUA 4KMQA 1VBC2 3KVBA 5HV4A 3NW4A 3LOBA 5IW0A 1RHI2 3KF3A 3G7DA 3DEMA 2YC0A 2WQ4A 4MXVA 5FO7B 5C3QA 1ZREA 2ARXA 3P6BA 1QOOA 2J7MA 2ZEZA 1JZ4A 4UYBA 4GJYA 5JIUA 1KFUL 3N9LA 1W3XA 3DV8A 1YXWA 5EPAA 1IPKA 4AVVA 4AGGA 1SZBA 2DCJA 2UYBA 4M3CE 5FYBA 5IVJA 1OSGA 5KXCA 2WWSA 4GMP3 2VXRA 1RMU2 4FAHA 4LHSA 4UW6A 1OOPB 3ZFGB 5IFTA 1VR3A 1W8HA 3WP3A 3KCXA 4R8HA 1K5MC 4S2DA 5E6HA 4OHZA 1W6NB 4Y1YA 3DYMA 3LEGA 2BEOA 4UAPA 4BWOA 5JSRA 2MPFA 4Z92B 1GUIA 1QJY3 1C3HA 3Q9OA 4O65A 2BERA 4EN6B 2ZHMA 3POIA 1LGCA 1UN1A 4IGPA 4I0WB 1PVC1 1CN1A 4MOAA 1WCUA 5E88A 3CJIA 2VUDA 5T5LA 3PVNA 1H8VA 3U1XA 2I74A 1I5ZA 1DU3D 1JHNA 1X36A 5GKAC 5JMCA 5ACA2 1WBLA 3PJQA 4OQ9A 5IVEA 1IQDC 4PI0A 2W94A 3NWKA 1VRH2 4UBHA 5JOWA 3FC0A 2ZMNA 4LUMA 3N9NA 4DUVA 4M4PA 4NE9A 2WFF2 3JD71 1ASJ1 2HWB3 3H1WA 3OF1A 3LD8A 3RVHA 1AR63 5FZOA 3VBUC 3ZKUA 5FZFA 1S2EA 3IWZA 4Q0SA 4GWJA 5F7UA 4LO8A 1X9TA 1DIWA 4YVWA 2RS11 2XQXA 1EAH1 1DBNA 1OFNA 3AMNA 5JR2A 3O1MA 4FT8A 4IGQA 2B7YA 4D7SA 3N3HA 4Q0PA 4LLFA 5CIRA 1ND2A 4XAEA 5EYXA 2VXJA 5CKQA 3H42B 2JICA 2R0FA 1YQ5A 5GZCA 3WOGA 1A8MA 2ZAAA 3OPWA 5ANQA 4I3PA 3UGFA 1LNSA 2HEWF 2W3JA 2GC0A 4WM8C 3IZOA 5GZEA 2A6VA 2VW1A 4CCLA 5C8CB 4AVTA 2B46X 1YJLA 2VNVA 1LESA 2ZJCA 4WM7A 4Z2WA 1ALYA 4LBNA 4UWDA 2RJ2A 4YW5A 1QEXA 3FLPA 3M7AA 3UKVA 2JDUA 3HT2A 4Y1ZA 4DRVA 1YUDA 1R092 4XTMA 2OYZA 1C5HA 5FY7A 4LMFA 2VO5A 3KD4A 4BE3A 5C7GA 1AR82 2ZEYA 1W8WA 3N7LA 3W5MA 3KMHA 4LOTA 3EBRA 4BQ1A 3RMYA 3GHMA 1WZXA 1MEC2 2JDAA 2SBAA 4LBQB 1K42A 1YHFA 1VBA3 1J3QA 3N7MA 4RQPB 2Q8OA 5E89A 5IHRA 4C90A 2PHDA 1VAVA 1JH5A 2P6CA 4ORFA 1B35B 2DU0A 1U5XA 2B39A 2E32A 1GZWA 1RUJ2 3ZYIB 5JIAA 2XJTA 4P00B 2NPIA 4XAAA 1O3RA 3GZTB 1HB2A 5DDJ1 2FQPA 1JYVA 1NX9A 2CYFA 2DVGA 2UWBA 4CYDA 4XW3A 4Q4W3 4YW2A 2AC1A 4AK3A 1OHFA 2VGDA 4YGEA 4AI2A 5FPVA 2IXIA 1R1A1 3KT4A 4GULA 5K4LA 1YQCA 2K46A 1FAYA 3DXUA 2W5FA 2SLIA 3AP9A 3AX4A 4I02A 3ZYRA 2ATFA 4D6QA 1X50A 2BTVC 4BQYA 5IK5A 3RFRA 5JOYA 5JSPA 3ZFGA 3P3PA 1OOPA 3O5SA 3PL0A 5FFOC 3O1TA 4B4PA 4HL0A 1ULGA 2XVKA 3ETQA 2ERFA 4GALA 5A3OA 2DVFA 2PQSA 3HNYM 3PU3A 2BUKA 3IIAA 5HCFA 4Y1XA 1EV13 2YGMA 3SISA 2PLV2 4FXGB 2ZX1A 4NPLA 2NN8A 1QJX2 1W6NA 3AXEA 5J37A 1TNRA 4EWEA 5A7WA 2VW2A 2UY8A 5JXJA 1F2NA 2BYVE 1DGWX 4FQ4A 4BH9A 4IGOA 3O0XA 4ZU5A 3Q8AA 1OF4A 3BOPA 2E9QA 4A4AA 2IWGB 4C0BA 1NG0A 3ACGA 4YVSB 2CGPA 1LOAA 4DZGA 3VBSC 4FP2A 3WDYA 4UFHA 2XWJB 2XBO1 3GDBA 5HXVA 2XWBB 3KGZA 3SCHA 2JE7A 2C24A 4A7KA 3ORJA 5FO9B 2WNUB 2QZ3A 5FKCA 1KD7A 1GZTA 1RVF3 2PN5A 4S2HA 4YNIA 5LWBA 2G9ZA 4AE2A 1MS9A 3JZVA 1MQTB 2AR6A 3AZVA 2Y0IA 4XUTA 2YHJA 4GB33 4QU2A 1W28A 1S0CA 3O1RA 1D4M1 5FY9A 4R9AA 3OUHA 2XDVA 1Z78A 4HZFA 1IG3A 5AFEA 3TEWA 5D8AB 3OGGA 5FWEA 5FY5A 3I49A 3VKMA 5FJKA 3B5LB 1CD3G 3BN6A 3HN1A 1C1FA 2TUNA 4ZS2A 4ZKTB 1OURA 2WT0A 5FY4A 1ZBE3 1H8TB 2VBDA 4FAGA 5A3UA 3GM8A 1PM4A 2ES3A 1BYHA 4LO4B 3U78A 3JQWA 4XMIA 5C8CA 2C0ZA 3S7IA 2FDJA 3MEPA 5FV3A 2VMEA 1L7QA 3MW2A 3WX5A 5A3NA 1AHSA 3LPFA 2DUOA 1YLLA 4BXFA 2J22A 1CESA 1V70A 4FFIA 1ST8A 1ZA4A 1DGRN 4QPIB 2HH9A 2RS51 2D98A 2R073 1VPHA 1QY4A 2QQMA 2XLAA 3H8RA 2WL1A 4OZXA 3WUDA 1XB9A 5IVBA 3DGTA 4RR3C 4JC1A 1QOSA 1VMFA 2QQWA 4LO7A 5K0UB 2A7AA 2PYTA 4LBQA 1HB1A 3ILRA 4L9BA 4R52A 3CKHA 4RQPA 5JR7B 3MIGA 2D6NA 1C8M1 4IE4A 4XDPA 5FXVA 5H9SA 4AEMA 4DINB 5JMOA 1BXHA 2GMMA 4K20A 1J59A 3TEXA 4C0HA 1B35A 1CONA 1G6NA 3PTRB 2FZ2A 2WZR3 3NKTA 3MLKA 2DFBA 4FCAA 5FZLA 4URTA 1BZWA 2Z69A 3RI9A 4YG3A 4JRAA 1PGL1 3T0DA 1XYNA 4OULA 3PNAA 1EPZA 5JDBA 3S5AA 1NY71 3KT1A 4WVZA 3QH6A 2LUWA 3WW2A 1BBT2 1L3JA 4EQVA 1A6CA 1VLNA 3CO2A 4I2OA 2ZX2A 2R041 1C4RA 1ZZCA 3NAPC 1OF3A 5LASA 3NJYA 3FBMA 4Q8LA 3R6SA 3T1MA 4BDVB 2A5ZA 1HB3A 2ZGMA 4Q4Y1 5KHIA 1AZDA 5FDBA 4MG2A 3POJA 2JD9A 2QZ2A 5FMOL 1UY3A 2F4LA 3T4HB 1K5MB 2DVBA 4EZ4A 2JB4A 2UWAA 1PO12 5FKBA 5DUWA 4DUWA 1C5IA 4P9LA 2UYAA 2CWSA 1UOBA 1OD3A 3I2DA 1ULPA 5EIYB 3J4UH 3BYWA 4OUEA 5FRAA 1EP0A 3K3NA 4IXLA 1TMF1 1US2A 3B9IA 5FXXA 4AGVA 5A3LA 4DIQA 2JD4A 2Y60A 3WP4A 5F1RA 2ZHLA 5T52A 2Q8EA 4BOWA 4IE0A 1O59A 3OPTA 4YVSA 3R0RA 2BJSA 2RDNA 2RS33 2VVFA 1NCRC 5FZHA 1QGLA 2D6KA 1NLSA 2KR2A 5FZ8A 3ZYPA 5IYYA 2D43A 2VTXA 2RDQA 2BNNA 4TTGA 5KXEA 3RYRA 5LEJA 1MS4A 3WDTA 5CFCC 1H4GA 3VBUB 2WNUA 3H3LA 3AC0A 3MF9A 1SCSA 3NVCA 4L11A 4BK5A 3AVSA 2A6YA 5BNQA 2FDIA 2ET7A 1MQTA 4EN0A 4QDQA 1VIWB 4XJZA 3THCA 4AQSA 4CUBA 3OG2A 2A6XA 4QX2A 3SCFA 3VKFC 5BUVA 3NJZA 4HKOA 2HEVF 1NKGA 2EIDA 4N9IA 1AX1A 1VRBA 5D8AA 1LGBA 3AYAA 3PIGA 4DS0A 1CJDA 3AP7A 1TVGA 4HVRA 1PHMA 1PVC2 1ZZ9A 4BU2A 1QH6A 3DF0A 3M3EA 1H8TA 1UZYA 4LORA 4WM8B 5CYYA 1UQXA 4HBNA 4QGNA 3WT3A 3DYOA 5HCHA 1QU0A 3ZFEC 3IDCB 2OUJA 1LOFA 2IXHA 1H1IA 1V6MA 3F95A 4W4ZA 4XILA 5JXHA 2C5DA 3S0MA 3QCWA 1AR71 1JUIA 1QJFA 3TOJA 3OEAA 5GJ6A 3HNMA 3NJVA 3U14A 4LIUA 3CLPA 2VMHA 3JD72 5F6KA 1ASJ2 1O91A 2JDPA 3L2YA 1BMV1 2NM1A 1FOD3 1R083 2BWCA 4QGMA 1AL23 2DF7A 4QQ2A 1GYKA 4QPIA 5LRSA 5TSWA 2PAMA 3ME2A 2RS12 4HETA 1EAH2 3UKNA 2WNOA 1PIV3 4GKXA 4HMZA 4RHV1 4AGRA 4CRQA 1ZYBA 2RMU1 1BCXA 5K0UA 1I9RA 1CIWA 1LU2A 5DG1A 3ST7A 4AXOA 2NMOA 4XPVA 1CZSA 5SV8A 3RRDA 3PJYA 4BQ5A 3FLRA 2PTMA 3WF1A 3T08A 3SHRA 3O14A 5IVCA 5F3GA 3U37A 1Q43A 4QDRA 5C9AC 5DZGA 5F9TA 1KDMA 4ASKA 3SC7X 4NHLA 5EWSA 5FLIA 4BCUA 3AVRA 1ZX5A 1W9WA 2JDHA 2BFUS 4PF5A 5F8PA 4I30A 4DFSA 1UW8A 1NXMA 1Q56A 2WYSA 2Y6JA 4J1XA 2OUHA 1ZZBA 2A71A 4LHKA 5FZBA 1HJFA 3W20A 2RDSA 1STMA 1V9U1 3O0VA 2VVEA 1OQ1A 4QHOA 3TEYA 4A44A 4B29A 2JE8A 2YMZA 4FVVA 4HFSA 4YM1A 3C7OA 3AK0A 3DUIA 2QUOA 4E4ZA 3GZUC 2X8KA 1K5MA 4Y33A 3RZHA 1G86A 3AZYA 2GN7A 1QIQA 3UESA 4LR4A 5G05L 1RUH3
chains in the Genus database with same CATH topology
1GKBA 4HVQA 3U07A 3KZ4C 4CDQC 1AF9A 4JV4A 5DDJ2 3VKLA 4B4RA 1UMZA 4CEYC 1CJPA 1OQDA 4WVWA 3AM2A 2VOVA 1DQ4A 1D0GA 5T5JA 4XF9A 3VBSB 3U0ZA 2D6MA 1FYUA 3MIHA 1OPOA 1R1A2 1RUC3 5SV5A 3USUB 4XQWA 4AFCA 3B01A 4FXKB 3WP6A 3UK9A 1DLLA 3ZSLA 2Z79A 1YFWA 3VL9A 1F5JA 1DQ5A 2RR11 3VBHC 1TE1B 1YJKA 2NMNA 1H2NA 1HW5A 4IV3C 3TN91 1HDKA 3VBUA 2QFEA 3B00A 3O0WA 4C91A 1QDOA 5E1RA 5KHGA 2EAKA 3TWIA 4I01A 5EXOA 3RJRA 1RIRA 2OZ6A 1UD1A 2K0GA 3IBMA 3V56A 5KXBA 1MEC1 1UCXA 1YO8A 2DCYA 4HKWA 3ZMNA 4CDXC 3APBA 5T50A 1NE4A 2H0BA 3MPBA 3RNSA 1G9FA 3WUCA 1QOTA 4WM8A 1AJKA 3VBFC 1NA1C 1YCIA 3WP5A 5I93A 2WFPA 1V00A 4Y24A 4YZ2A 1LU1A 3I4IA 2WT2A 1IS4A 2XBO2 4XFCA 1ASJ3 1RUF1 3JBG1 4XJUA 3AMPA 3AKTA 3TYJA 2MEV3 1LENA 3CL1A 1EAH3 1BQPA 1TEIA 2EVXA 2XLFA 1CAUB 3K51A 1G9BA 1F9KA 4RR3B 1D4M2 2BGCA 1LJ7A 1ZBA1 2E53A 3MW3A 4XFGA 1LTEA 3ECQA 1OA3A 1X8EA 1IQAA 3WCSA 2Z42A 4XFHA 3KQRA 3AFKA 1G8WA 3AP5A 4DQAA 4LBLA 1UL9A 3RQ0A 2O8OA 3HAGA 1A8DA 3VN4A 2P2KA 3WQ1A 3E6DA 4H7MA 3EHKA 1WLCA 3MPPG 2V09A 3NAPB 4LBMA 1Y3TA 1QJU3 3C2UA 1C57A 2RS52 2ZGRA 2GC3A 2AYHA 1AXZA 4LNVA 1DQ2A 1PNFA 4QT6A 1XRUA 1LOEA 1PGSA 4XETA 1XQNA 4AWDA 1CAWB 4Q26A 1C8M2 2RM23 2K9ZA 3GF6A 4LE4A 3S7EA 1HQWA 2CGOA 1SLCA 1AYM3 3WG2A 4PIYA 1FX5A 2AH2A 1CVNA 1PGL2 1WMFA 3PMSA 4LBOA 1NQDA 1UPIA 1FXZA 1NY72 1SFYA 3UKTA 4RL7A 4COUA 5EZWA 1MS8A 1UIKA 2TNFA 1CQ9A 3SMHA 1KRIA 3N4MA 1VBD1 2CWMA 3VBSA 2R042 1NCRB 3LSEA 1FPN1 1D2QA 5H9QA 1ULCA 4Q4Y2 3USUA 5H9RA 3FJSA 3ZXAC 3UJOA 4MH0E 5CFCB 1CPNA 1GBGA 2UWCA 4Z1VA 1VBE1 2XVGA 2QQPA 1Y43B 1Z7S2 3AMMA 4R9DA 2CGNA 3ILFA 4LO5B 4XBLA 3GHNA 2R16A 2ZGOA 3R4UA 4N7IA 2AENA 3WHTA 4R4XA 1WGPA 5KWRA 4HPKB 3J8F3 3P3NA 3SCGA 3ZFEB 2R063 1W6OB 4EN9B 2GNDA 4X6RB 2DCKA 4NVPA 4XHBA 1N1VA 1COV1 1AR91 2EAAA 3IDEA 2H6BA 1RJ8A 3GBGA 4TZDA 3D4KA 4UBGA 5CU1A 1DZTA 1VAKA 1ULEA 1GLHA 4M0HA 3E97A 1PMIA 4H14A 1CAUA 1REEA 4LEJA 2XH6A 1JXNA 4F3JA 1LODA 4JCKA 4RR3A 3FFZA 1QXRA 3HIFA 1AYN3 3ZIWA 2D6LX 3DPRC 1KITA 3SNMA 3VBOC 1IKQA 4W6WA 4CTEA 1HXS1 3RDIA 1G9DA 3LOIA 5FTTC 1DFQA 1RINA 1AR72 4UW3A 3AYEA 3LAGA 2KM2A 1BMV2 3MF6A 3NAPA 3ZXLA 5FQ0B 4AW7A 2GN3A 3QLQA 1Y7BA 4XJ9A 3KT7A 3MYXA 5DZEA 4KGQA 4RHV2 4RGAA 2RMU2 3K48A 3VLBB 2EXHA 4B7EA 1GR3A 4QQLA 1CAWA 1IGOA 2BPA2 3H3UA 3ZVXA 2JG8C 1RJ7A 4FPEA 5BY5A 3UL2A 4CDQB 4D7YA 3MI8A 4RD7A 5FO8B 2YXSA 4AI3A 3PVBB 4CEYB 1VBB1 4EROA 3WINE 1IHMA 4Y1VA 4AVAA 1QNWA 1ZZ7A 4ASMB 2P3IA 2JE9A 2PHRA 4Q4Y3 3AMHA 4D7TA 1S0JA 2EXIA 1NCRA 1TME1 1WW4A 1POV1 1RUG3 1XYOA 1XYPA 3TNPB 4TWTA 4P9YA 1V9U2 2HEYF 4P5HA 1PK6C 3VBHB 4IV3B 4AVBA 5CFCA 1UKGA 2ET1A 1AJOA 2ZX4A 2WS93 3D82A 4JTNA 3WV6A 1O7FA 4ZU4A 1DF0A 1Y9QA 3OBRA 4IQPA 5L7OC 5F5QA 3AYDA 1TMF3 3WDXA 1O4ZA 4IEYA 4XF4A 1QQP3 4G3YC 4CDXB 2GMEA 4H3WA 2IXKA 1VB2A 1H2LA 5T55A 1PGW1 2AGSA 2R30A 3VBFB 1NA1B 2VH9A 2CNAA 3BB6A 1GNZA 2VW0A 4HPKA 3WXPA 3ZFEA 4F83A 1W6OA 1RUD3 5CA6A 4P9IA 1QNYA 2HWD1 3X29B 4FP3A 2I07B 3ZXFA 5I8TA 2O1QA 2RR12 3TN92 4OUSA 3GZAA 4TSVA 1RUE3 4JGYC 3VDDC 5FPXA 4FPFA 3IM0A 5KC5A 1DYPA 3B93A 3ZXDA 4ONUA 1MS1A 4Q4X1 3HWJA 2DTWA 4AHWA 1LHUA 1FATA 1SDWA 4Y20B 1YFUA 1C1LA 1QWRA 2HWE1 4H55A 3NV2A 1CX4A 4X8NA 3ROUA 1F31A 1POV0 3AKSA 5GLTA 5A33B 1VBC3 5J48A 3FUOA 1RHI3 3ALQA 1MS3A 1QXJA 5FLJA 4Z8BA 2PAEA 1NZCA 1FV2A 3AJYA 1BEV1 1D4VB 2A3YA 2DWRA 5BYNA 2JJ6A 5BNPC 1RUF2 3ZFFC 1RUI1 3JBG2 3LA3A 2ZACA 1JYCA 1S55A 1A3KA 1MVEA 4XFFA 5BV6A 1GANA 2RJLA 2WSUA 5FQ0A 4KGGA 4AHXA 1RMU3 1J58A 1KS5A 3ZYJB 2V5YA 2GC2A 4AFMA 3J9SA 4OLLA 2D3RA 1WCDJ 1ZBA2 4YRDA 3E6CC 2ZGLA 3JUUA 4W65A 1JUHA 2WINB 2UY9A 3ELNA 4HVOA 1HRI1 1PVXA 2PHWA 1ND3C 1QJZA 1REFA 2ZHKA 5EYYA 4CDQA 2A3WA 1GZ9A 2XJSA 3M1HA 4R4ZA 1OD5A 4CEYA 3AP6A 1JYIA 4ATFA 1LHWA 4MSVA 4ATEA 3BPZA 5GZDA 4XOGA 4Q8KA 5ACA3 1N47A 2NLRA 4AFDA 2G9FA 1VRH3 4PQ9A 4LTAA 4AFAA 1XNCA 5I91A 2WFF3 4HK8A 3VBHA 4BPZA 4IV3A 3N36A 5C4WC 1FMD1 1S1AA 3R05A 1NQJA 2OVUA 4YGBA 2WLPA 4HLTA 4OHYA 3ACLA 1HRV1 4LA2A 2DVAA 2MNGA 3B69A 3B9CA 5GALA 1V6NA 2RJKA 3MGUA 2VMIA 3M2MA 1IOAA 3B02A 5IUQA 4CDXA 2HJIA 2HWC1 3MFCA 3VBFA 2PHTA 1NA1A 1VBD2 1RGSA 2OIIA 3LA2A 4AQ2A 4XTPA 1CAVB 1TNFA 2G4IA 1FPN2 4MLOA 2RR13 3TN93 1LR5A 3ZX7A 1LULA 4BZ4A 4IERA 2EALA 2Q4SA 4B8EA 2P3KA 1UX6A 1R093 1VBE2 3ZN5A 1KJRA 3R4SA 3VL8A 2VPVA 1AR83 2AZ5A 5AVPA 4YGDA 2DU1A 4IEVA 1MEC3 2RHPA 4K1ZA 4FPCA 1CR7A 1WW5A 2OW4A 4M3CF 1ULDA 1ENSA 2Y26A 4Y20A 4JQRA 4Y1UA 1J3PA 4EWAA 1SBDA 5GLVA 2D6OX 3DPRB 4QPYA 3VBOB 3L9JT 3N7KA 2WLQA 1NLRA 1RUJ3 2BFUL 5DUVA 4Z2WA 1DG6A 2XLGA 5A33A 3DKWA 5J7MA 3FMGA 5I0SA 3QACA 4D69A 3I7DA 1Q8PA 2BW8A 4XMAA 4PDWC 1URXA 2GU9A 4NN0A 1COV2 3H0OA 1AR92 4AI8A 1UU6A 3TB0A 4YM3A 4I3GA 2A73B 3OCPA 4RFT0 1LGNA 3GNEA 3LKJA 2GNBA 5DG2A 5JI9A 2I45A 4GMP1 1JOJA 3CJXA 1ZRFA 4QPGC 4OHVA 4KU7A 1APNA 2V73A 4YZ3A 3ZYGA 3VHPA 4AVSA 4ZXKA 5AFBA 2PLV3 3RJ2X 2VQAA 4QM8A 1Z7S1 1QJX3 2VUJA 2C1FA 4OFGA 2XB6C 2JG8B 1GICA 1HXS2 1NOVA 2R1DA 3U10A 1OA4A 3U4XA 5JOXA 2ZGNA 4MGIE 4D3WA 4A7ZA 1V6JA 1GZCA 5FBZA 4E2SA 1PM7A 5I8SA 1GSLA 4YW4A 1PK6B 1W6PB 4TLFA 1N3OA 1N1TA 1VP6A 2HWB1 5T3NA 3W59A 1AR61 2W68A 2YPJA 3CF6E 3NV4A 4META 4PIZA 4LBKA 4XFIA 5L7OB 2ENRA 3VHRA 4FPGA 4FPJA 1WW6A 1H4HA 1Q5OA 3EXUA 3M3QA 4KG0A 1ZRDA 1VBB2 5LRRA 4U36A 4TYSA 2VQ0A 2JECA 3KCYA 2DUPA 4QQOA 4XF3A 1W39A 5CAZA 2UU8A 2E7QA 1TME2 2WA4A 1SLBA 3BIWE 3CEWA 5AVAA 4AYUA 2D93A 3VGIA 4Z07A 1I3HA 1DDLA 2IZWA 4NWWA 4JGYB 3VDDB 3VZNA 4HSLA 1KFXL 5LEKA 4MGYE 3DN7A 4M3CB 2G9GA 4AEJA 3CNAA 1MS0A 1VBA1 1X33A 3EO6A 1PZ8A 4PBPA 1WD4A 2A6ZA 3DPRA 1OI6A 1S0DA 2WIIB 4YG0A 3VBOA 1PGW2 1VB4A 3WD5A 1S2BA 3FFQA 4QGLA 3B7MA 1DGLA 2FMDA 2JG9C 1D0HA 5F6LB 3THTA 2HWD2 2ZKLA 5K9YA 1WLTA 2WQZC 1BBT3 5BNPB 4DOUA 3LA7A 4L92A 2VNRA 2WT1A 3ZFFB 4Q1PA 4CZSA 3AKPA 4L99A 3WG4A 3WR0A 4BA6A 4ES8A 4CP0A 2DUQA 4S2GA 1I1EA 2XL9A 4Q4X2 4RGGA 1QMJA 3VZMA 3ZPYA 3WLUA 1H9PA 2JENA 2D44A 4M00A 4G9SB 2ZMLA 1EV11 4CP1A 2HWE2 3D0JA 3KSCA 1PO13 1Z0HA 4P14A 4B3NA 2QVSB 5I0RA 4KQ7A 5KXDA 3PVEA 4YZ1A 2WA3A 2JG8A 1ND3B 1XXNA 3ENRA 2NQYA 3E6BA 1S0GA 3T2TA 1JN2P 1REDA 1UKRA 4N9HA 3OD4A 1H9WA 3BOWA 5JZGC 1LHOA 1BEV2 2P37A 5FLHA 4XQDA 3WW1A 3VKNA 1RUI2 1S0EA 2Q30A 4INDA 1GNHA 1TQ5A 4YYOA 1HQNA 4Q2FA 4PBOA 4FBFA 1RVF1 3VBRC 1PK6A 5C4WB 1F8VA 4BMEA 1W6PA 2CAUA 4FO9A 1UIJA 2BNMA 2DV9A 3WQ7A 1HV1A 4GB31 4Y4YA 3VUOA 1BKZA 1OLRA 3E5XA 3D8CA 4MXWB 5L7OA 1HRI2 1C28A 1UZZA 3B94A 1H2KA 1QDCA 1PVC3 1ZBE1 1LOCA 5JAXA 2H0VA 4KBBA 3KLSA 1OFSA 5BNOC 3QD6A 3H8UA 4FOYA 1MR5A 2D6PA 1XU2A 4N53C 3WY6A 1O4YA 1OLQA 2GNTA 2VNOA 3JD73 1FMD2 4JGYA 4Q1RA 4Y22B 1HRV2 1S0IA 2RS13 1MVQA 2EXJA 3ZXGA 5JPNB 4M3CA 1YFYA 1YI9A 2ZCWA 3HMYA 4R9BA 4AQTA 5EFUA 2DYCA 2BBVA 2W52A 5JSOA 4QHBA 2CY6A 4LT5A 2Y38A 4ASLA 1FNYA 2F4PA 2WZR1 2HWC2 1O3QA 2ZX3A 3VZOA 4LHLA 4DY3A 2PHUA 1ZNPA 2HWF1 2OPKA 2HWD3 4FTEA 4PDWB 2R6QA 1KXGA 5IK4A 1LB2A 4FSJA 3GYDA 1Q8OA 4BMBA 5H9PA 5BNPA 2ZHNA 4SBVA 1XNKA 4FQZA 3ZFFA 2D7FA 3MZHA 1YNAA 5E8AA 3N7JA 5CNAA 4XBNA 2PHFA 3ES4A 4QPGB 3URFA 4FOVA 5CB7A 4ES9A 4XF1A 2QCSB 4UW5A 3IMNA 2GC1A 1G9CA 5J98B 1V6IA 1GV9A 3QOPA 3NV3A 4WZFA 1ND3A 5DDJ3 1W0OA 4A2UA 2R1BA 4KWLA 1M4WA 3I59B 1HV0A 5BPXA 1EY2A 5HCAA 1NE6A 5DUXA 5T5OA 2RS31 5JPMB 4OHWA 1R1A3 5DUUA 3POSA 1N3PA 1KS4A 1YWKA 5GLWA 4HK9A 3MIEA 1YIPA 5C4WA 3OPZA 4Q0QA 3BCWA 3H50A 3GBFA 3USSA 5ABJC 3FWEA 4COZA 3BALA 1WMDA 4IV1C 3R4DB 3U11A 4BIOA 4IEZA 4K40A 4X8PA 3AMQA 2D97A 5CG9A 3E5QA 4XE9A 5J96B 1QJY2 4MXWA 3RZZA 1HIXA 2YUEA 1Q3EA 2ZX0A 3W9AA 3WHUA 4KU8A 4U2AA 1X82A 4FPKA 3V64A 1AX0A 2KXLA 2FHRA 3M3CA 4RS5C 4UXAA 3POWA 5FAXA 1LOBA 5A3MA 2I2SA 2XKPA 5K7PA 2XBO3 1AXYA 2VOWA 2GNMA 3M4FA 3OD0A 1J3RA 1FMD3 2Q1ZB 2HWB2 3WDVA 1AR62 1FOD1 1R081 1AL21 1QXPA 1NCQC 4FPOB 3BU7A 4Y22A 5I8YA 1PIV1 1Q8SA 3WG1A 1D4M3 2ILMA 4P9GA 4QXKA 5IK7A 2GSYA 3OYWB 1N3QA 1O4TA 3WCRA 1B09A 1OKQA 3SH5A 2VUAA 4YFWA 3POYA 4ISRA 3VKOA 1ZRCA 2JG9B 2ZZQA 4I0AA 2WSVA 1KDKA 2ZGPA 5C9AB 1HQLA 4HN1A 4PDWA 5KC6A 2AUYA 2RS53 3IKWA 4EV0A 2ZS6B 4OVEA 1D2SA 3H9AA 3WW4A 4PJYA 4QPGA 2WNVC 1V6KA 1VBA2 1GZWB 4AHYA 3O7OA 3V65A 3D5OA 1C8M3 3TAYA 2P3JA 4FTBA 2GH8A 4N90A 3ES1A 1RUH1 4QMAA 4AEDC 4PIXA 2P34A 4DXZA 3NO8A 2LM3A 1OPMA 2YROA 2ZBJA 2XG3A 2XJQA 3H3ZA 1UU4A 2B45X 3GALA 4DY5A 4K8FA 5JZGB 4Q4W2 4K3UA 3I59A 2R49A 1EYBA 4GWNA 4F7ZA 2IFWA 4W6YA 2VG9A 1RUC1 2R043 3GBWA 3IDBB 4PLOA 4QD2A 3EQEA 3TBDA 3VBRB 1QKQA 4IESA 1GFF2 3AXDA 4BM8A 3RMXA 5CFDC 1XNDA 1I6XA 1XNBA 2GALA 2UURA 4XJAA 1EV12 2DURA 1Z7S3 3H7JA 1DYKA 1PO21 3JB8A 3ZXEA 3KM5A 1YFXA 4V1PA 4ZU7A 4MX3A 1FI2A 2JEMA 2ZOEB 5C33A 1W6MB 4NWVA 3B3QE 2ZMKA 4D94A 3ZDSA 5BNOB 4Q4V1 4L8QA 3ZN6B 4LLOA 4DPNA 1PZ7A 1ZVFA 3S6PA 2A6WA 1BK1A 2DCTA 5T5PA 1AUYA 5KHKA 2ZAHA 4N53B 3V0BB 2H6CA 2O8QA 3KS7A 1RVF2 3OJBA 4L97A 1Q8QA 2MEV1 2PHXA 4XIKA 4GWMA 4GB32 5CADA 2PFWA 3JU9A 3ZMOA 3M70A 1W0PA 4HN0A 1O3TA 4FPHA 3VZLA 4CDWC 3OYWA 1GQGA 4Q0VA 4XZPA 1ZBE2 3A0KA 4XFBA 4MYEA 3A4UA 4HKLA 2A75A 4XIOA 2ETEA 2JG9A 3AP4A 3H7YA 1AR73 4NO4A 4YW1A 1MACA 1VJ2A 4IL7A 5C9AA 4SLIA 5LK5A 1ENXA 5HCBA 4BLJA 1H1MA 1QJU1 4COWA 2CTVA 1HLCA 1U5YA 3MIBA 1XE8A 2R072 4N43C 3LWCA 3CU7A 3AYCA 4RHV3 4I0BA 4IEQA 3IPVB 2RMU3 2XVLA 1S0FA 1WCKA 2X5IC 4MUVA 2RM21 4WV8A 2VVDA 4RSUA 4XBQA 2GMPA 2Z5WA 1G9AA 4BHPA 1AYM1 2EIGA 2WZR2 3RWNA 2LALA 3E5UA 2PELA 2HWF2 2Z2SB 4KH9A 4X6QB 1BVVA 2VY0A 4MVTA 1XE7A 4ISQA 1YYNA 1J1TA 3ZSEA 4CEWC 1XU1A 4YZ5A 1RB8G 5JI7A 4O9GA 5JZGA 4QQPA 3RYPA 2ZKNA 4E2QA 2XJUA 4C1WA 3H1MA 1LKNA 4OI1A 2NYYA 2QDNA 4P9XA 5CVRA 1UU5A 3THPA 5J09A 1FV3A 1V9U3 4FPYA 3ATGA 2EA7A 2ZA9A 4K9SA 2ARBA 3VBRA 2XJRA 5AC91 3MLJA 4Z82A 5FREA 3LSDA 4YZ4A 4AHZA 5ABJB 1F5FA 2VOXA 4IV1B 5FOBB 4I09A 1SLTA 1IS6A 4GH4C 1W6MA 1GQHA 2WKKA 5EJ3A 4E2GA 3RI8A 3J8F1 5BNOA 4RS5B 5L36A 3ZN6A 2R061 1IKPA 3S30A 4S2FA 4E4DX 2RS32 3D0SA 4GIQA 1H1AA 2W08A 4KWJA 3N35A 4OHXA 4N53A 3JQXA 2ZGKA 3V0BA 4QM9A 1WBFA 2Y0OA 4IETA 1X7NA 3OY8B 5JOZA 4AI1A 2YV8A 1NCQB 4WVMB 1SCRA 4J6GA 3MICA 1PZ9A 3IT8A 4FOWA 1LHVA 2A70A 2O0OA 4BLIA 4CP2A 3HBZA 3NSTA 4XFAA 2XJVA 4MGKE 5CG8A 1AYN1 2YYOA 3OGJA 2N7GA 1RUOA 2XKOA 2HYKA 3ASIA 5GLUA 2EF6A 3AKRA 4EJRA 2XPJA 5K8SA 1YIFA 3M8LA 2RE9A 1SLAA 4Q29A 1N1YA 5GZFA 4JGZC 1DGRA 2BQPA 3OTFA 5BNNC 3ILNA 2MHFA 3VHNA 1RUF3 3JB4C 2OA2A 3JBG3 2PHLA 2XL7A 4AFBA 4AI0A 1FOD2 1R082 2WZPP 3AJZA 1AL22 5DZFA 5A32B