5BV6A

Pkg ii's carboxyl terminal cyclic nucleotide binding domain (cnb-b) in a complex with cgmp
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
150
structure length
150
Chain Sequence
TAQARDEQYRNFLRSVSLLKNLPEDKLTKIIDCLEVEYYDKGDYIIREGEEGSTFFILAKGKVKVTQSTEGHDQPQLIKTLQKGEYFGEKALISDDVRSANIIAEENDVACLVIDRETFNQTVGTFEELQKYLEGYVANLNRDDEKRHAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis of Cyclic Nucleotide Selectivity in cGMP-dependent Protein Kinase II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords cGMP-dependent protein kinase 2
total genus 43
structure length 150
sequence length 150
ec nomenclature ec 2.7.11.12: cGMP-dependent protein kinase.
pdb deposition date 2015-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5bv6A00
5LRSA 1RUOA 4XF3A 4AVBA 4XF9A 3MZHA 1J3RA 2IXLA 4MUVA 3KSCA 1ZVFA 4XF1A 4AQ6A 4XFIA 5KBFA 3NKTA 4IERA 1CGPA 1YFUA 4WBBA 3E97A 1QXRA 4QMAA 2N7GA 4FT8A 1LRHA 3H1WA 1I5ZA 5K8SA 4E2SA 4N9IA 1RUNA 5JSOA 1X7NA 2H0VA 2HJIA 2B9UA 3RZZA 4QGLA 1YFYA 3H1YA 1XE7A 3MDPA 1V70A 3LZZA 1Y9QA 4AXOA 3DN7A 3CEWA 4MGYE 1UPIA 5LEKA 1ZRRA 5BUVA 4N9HA 1O5UA 3R6SA 2DCTA 4KWJA 3FX3A 4MZUA 2MPFA 3HQXA 3QACA 4HVRA 1DGWA 5FPZA 4PIZA 4PIXA 3CL1A 3NSTA 4HN1A 5C8WA 3ROUA 3S0MA 3LA7A 2GC2A 4B29A 4ZU5A 1YFWA 2UYAA 4DINB 3NW4A 3E6BA 3D0JA 4HLTA 4YRDA 2GU9A 3QOPA 4IEOA 1ZRDA 3PLQA 4D7TA 2BNNA 4I09A 5JCTA 5HI0A 5FLHA 1O3SA 4HSLA 4ORFA 2QDRA 1FT9A 1Q3EA 5FCCA 2XL7A 5JAXA 3FWEA 3SXWA 1UD1A 2IC1A 4MH0E 4WVZA 5I91A 2GZWA 1CAWA 3H7YA 4Q29A 3U11A 4BIFA 1CAUA 4K8FA 2C0ZA 1NE4A 1ZNPA 4HBNA 1TQ5A 2D5FA 3ETQA 2OA2A 4HMZA 4FAHA 4HZFA 2XLGA 4H7LA 4UBGA 4XFBA 3PVBB 2MHFA 4IEXA 3CLPA 4EWAA 3JZVA 3U0ZA 1O5LA 2BEOA 3EQEA 1J59A 3FE5A 3E5QA 2OPKA 4KL1A 3H7JA 3RNSA 3RYPA 4XFCA 4WZCA 2CV6A 4IEWA 3ST7A 4D7SA 2O8QA 4QX5A 3CF6E 1ZZ8A 1XRUA 3LWCA 3E5UA 3I54A 3OCPA 4JTNA 2Z69A 3DV8A 3MPBA 1Q43A 4MGZE 5I0TA 1QWRA 1PM7A 3PNAA 2EAAA 4Q0QA 1EPZA 3LA2A 2FQPA 3KMHA 3GYDA 1LB2A 1CAVA 5KHHA 4TLFA 2V09A 3B02A 4AVAA 1H1MA 3RYKA 3DL3A 4IEYA 4YSFA 4LTAA 4ONUA 3UKVA 4R52A 3E6CC 1IPJA 3TNPB 2D93A 3N4MA 3BALA 3UKTA 4RD7A 2IXKA 3FZ3A 1FI2A 4ZU7A 4I0AA 4JTOA 3M3IA 2QNKA 4PIYA 1SEFA 1X8EA 2EA7A 2Q0AA 2XKPA 2BNOA 3NVCA 1U12A 2FMYA 3S7IA 4ZU4A 3IIAA 4XEZA 4HVQA 5I0SA 5CVRA 4E2QA 2ETEA 3E6DA 1NZCA 4OLLA 2ATFA 2PHLA 1RGSA 2ET7A 4IEZA 3BU7A 3S7EA 1NXMA 1ZRFA 3ZDSA 2WC2A 2IXHA 1O3RA 3L2HA 1QY4A 4XETA 1CAWB 2Q30A 1CX4A 4I02A 4Q0PA 3WW2A 3LAGA 1DZRA 4QGNA 1NYWA 1FXZA 4KWLA 1RTVA 5BV6A 2XHKA 3D0SA 3E5XA 4I01A 1ZX5A 5J7MA 4UXAA 1J3PA 3BPZA 3BCWA 3HT2A 4E2GA 3SCHA 1YFXA 4LUMA 2QVSB 4HVOA 1UCXA 1DGRA 2BGCA 3H1MA 5CU1A 1UIJA 1VR3A 1X82A 4MV2A 1QXJA 2EVXA 4PJYA 2MNGA 3CJXA 3IBMA 4IETA 3BB6A 2PA7A 2GC3A 3H3ZA 4O9EA 2IXJA 1JUHA 3ACLA 3WW4A 3HIFA 4LEJA 3M70A 2IXCA 3I59A 3OGJA 1ZZ7A 3EHKA 4J1WA 2GH2A 1O4TA 4QGMA 3CO2A 4LLOA 2GAUA 5KHKA 4I0BA 3D82A 1EP0A 3HT1A 4LUKA 5I8SA 5KHIA 4XFHA 4OFGA 4MX3A 1LKNA 3SCGA 4Q0SA 4JVAA 3G7DA 2Q1ZB 3SCFA 5FPXA 1HW5A 2H6CA 5FQ0B 5EFUA 4J1XA 3U10A 4EWDA 4BH9A 4CYDA 4Q0VA 2IXIA 1CAVB 4Z82A 5LRRA 4XFGA 4LA3A 3WW3A 5E16A 3OF1A 3LA3A 2F4PA 3O14A 1ZREA 1VP6A 5KHGA 5I0RA 3FFQA 1EY2A 1SFNA 1O7FA 2I45A 2Z2SB 4MGIE 2QJVA 3IDBB 4QM8A 1OFNA 1CAXA 3VHRA 2HKXA 1X8MA 2XL9A 5BY5A 5F1RA 5EZWA 4IEPA 2PHDA 2B8MA 4JV4A 5BXXA 4F8AA 3H50A 1O3QA 2QCSB 1ZZ6A 2XLAA 3RDIA 3USSA 2UY8A 2K9ZA 2GC1A 3WW1A 3IDCB 5I0UA 5AVPA 4LULA 5J48A 1YUDA 4XFFA 5E1RA 2PYTA 4IEVA 1ZZCA 3IWZA 2PFWA 2XGXA 4XF4A 1H1IA 4QM9A 4YARA 3TNQA 4O9GA 4BHPA 4L2NA 4AQ2A 4KU7A 2XKOA 3EJKA 4QXKA 1Y3TA 5FQ0A 2VECA 1RC6A 1YHFA 4LA2A 4KU8A 3EO6A 3EBRA 4UBHA 1LR5A 2KXLA 2OZ6A 1OD5A 4IEQA 3C3VA 4F7ZA 2WFPA 1OI6A 1WA4A 4FAGA 3KGZA 4R8HA 5FDBA 3I7DA 4X6RB 1J58A 2OZJA 1NE6A 2PTMA 1WLTA 2CAVA 3FJSA 5I93A 3DKWA 2OYZA 2VQAA 2PAEA 2BNMA 2O1QA 4HN0A 1Q5OA 2ZCWA 1DZTA 1L3JA 1YLLA 1UIKA 3I59B 1VJ2A 3RPQA 1SQ4A 2CAUA 3FHIB 1OMIA 3ES4A 5JR7B 3SHRA 2PQQA 4P9GA 4Q0UA 3OD0A 1YWKA 1G6NA 1GQGA 1RL3A 4META 2K0GA 1ZRCA 4AVCA 3NJZA 4EROA 4EWEA 2ET1A 2E9QA 4IEUA 3UKNA 1CAUB 5J3UA 5JSRA 5I8TA 2ZKLA 2Y0OA 3KCCA 1PMIA 5C6CA 5D1IA 1IPKA 3H8UA 4YYOA 2UY9A 3H3UA 5FLJA 1J3QA 3SMHA 4XF0A 2XLFA 1WGPA 1O3TA 5FLIA 4MGKE 2VPVA 4I3PA 1GQHA 4FBFA 3KGLA 3LOIA 4NVPA 1UW8A 4X6QB 5CADA 2BYVE 1ZZ9A 2B5HA 4GULA 2PAMA 2GC0A 3NL1A 3MYXA 4XFAA 2D5HA 3H9AA 3ES1A 1ZZBA 1CAXB 5I8YA 4BYYA 4L11A 4I2OA 4Z07A 3RYRA 4A2UA 2H6BA 5JSPA 5BPXA 2UYBA 4IESA 4EV0A 4YNIA 2P17A 5KHJA 5LEJA 1I6XA 2D40A 2CGPA 5T3NA 2Q4SA 3GBFA 1J1LA 1EYBA 2PAKA 1XE8A 3OTFA 4KWKA 3ELNA 4HSJA
chains in the Genus database with same CATH superfamily
1X50A 4JGZA 1Q8QA 2NMOA 3ZFEB 2O14A 4FPGA 4AOCA 1PGL2 4EN6B 3DKQA 1URXA 1GOGA 2P3IA 4XF3A 4CDQB 2BW8A 3LDBA 4AVBA 1OF3A 2DCKA 2R6QA 2ADEA 3MZHA 4CDQC 2JKBA 1ND3A 2VCCA 2R062 1ENQA 4MUVA 2YHJA 4AAXA 4LKFA 1ZVFA 1XPWA 3RWNA 4ASMB 4FOYA 4XFIA 3VBSB 1NXD1 4OI4A 4ASLA 4CA9A 3W5NA 3DYPA 2HYKA 1CGPA 3MI8A 5AC91 1YCIA 1UNBA 3JD72 2A6WA 3VDDA 3KHCA 3J26N 3BI3A 1VE0A 2W95A 4FT8A 3I2GA 1CESA 1OH3A 5DG1A 4KI5M 4FFGA 2R041 3ZXGA 4QKDA 3A0NA 1UOJA 4N9IA 1V0AA 1AYM3 3GZAA 5FY8A 2ZX3A 3ZSLA 2DCZA 3RZZA 3TWIA 2EXJA 1O6UA 1K45A 2XR4A 5C71A 1V70A 4BQ3A 3DN7A 1BZWA 5A7WA 2ZHKA 2ZX2A 3WF2A 3OGRA 1K3IA 3PL0A 4OQ9A 2P4EA 2QDNA 1UKGA 4N9HA 4ZHNA 1VRH1 4CUCA 3JQXA 1HQNA 2DCTA 2YPDA 1REFA 3RJ2X 1R1A3 1UX7A 2FCVA 5FR3A 2K2SA 2VMEA 1VIWB 2KR2A 2OS2A 5EYXA 1DQ5A 3CDZB 1GKBA 2QQVA 2VNGA 1JXNA 2WQZC 5A33B 4PIXA 5IK7A 1DG6A 1R081 2VVFA 4HN1A 5L73A 4LBMA 1VRH2 5C8WA 5AFEA 2VUDA 4XCBA 4B29A 2D3RA 5KWRA 3INAA 1ND3C 2UYAA 1RUH3 3JXSA 5F5AA 3ZIXA 1GNHA 1MQTA 3E6BA 4MHRA 3D0JA 4BLJA 4CP9A 2DWRA 3T4HB 4Q4V1 1EAH2 5A3LA 1XXNA 5GLTA 2PN5A 4I09A 2WLQA 2DFBA 2ES3A 3KCXA 4RFRB 5JCTA 3LEKA 4NE9A 1QIQA 2JDYA 4MSVA 4OCTA 1TME3 1VB4A 4NIAA 4Q5OA 2HWC3 4C0HA 4I30A 3CMGA 5BNNA 1TMF3 1IS6A 2WYSA 2RE9A 5FY1A 5FZ1A 4URTA 5FY9A 3TEYA 5FZCA 1QQP3 2A3WA 3SXWA 4BWOA 4GA9A 2XVGA 4QDSA 4N7UA 3H7YA 3VV1A 1CAUA 4HETA 1QKQA 2C0ZA 4K8FA 5FZEA 2GH8A 3QH7A 3KF5A 2ILMA 4HBNA 2VMGA 2OA2A 2R0FA 2W87A 2XLGA 4XFBA 3MLJA 3PVBB 3AFKA 4IEXA 3RMXA 5C9AA 1F5JA 3CLPA 4LBNA 1GV9A 1NLSA 1VALA 1XU2A 1W8ZA 2BEOA 4LO5B 1J59A 1W6OB 3AMHA 4G9SB 2WT2A 1VRH3 4KL1A 1AVBA 2AREA 1JODA 1ASJ1 2O8QA 4PI0A 2B42B 5FK8A 3T2OA 4CUGA 1CZVA 2XVLA 3G6JB 3T2TA 1IPSA 3HJRA 3WP5A 2WWJA 4UFKA 4A45A 2ZMKA 2VNVA 3BOWA 4GMP0 2GALA 2W94A 1NUKA 3ZFGB 4AAPA 4CEWB 1SDDB 5T55A 3ZPYA 2ID4A 3DV8A 1AYM1 3MPBA 1ASJ2 2B7YA 2DVDA 1PVC2 4CDUB 1UYXA 1ND2A 2FDJA 4P5YA 3PIGA 2IVJA 1GQPA 4Q0QA 1C8M1 4YVWA 4BQ2A 3AC0A 4CEYA 3LA2A 1NG0A 3KMHA 1W6QA 3GYDA 3U14A 3WP6A 3KVBA 3KCYA 2W3JA 4P9IA 2R1BA 3B02A 3RYKA 3WSOA 3AZYA 4IEYA 2YC4A 4HPKA 5AC92 1PK6A 1XNBA 2E33A 2ZAAA 1BBT3 3I3QA 4LTAA 1ULCA 5FP9A 5IVYA 4ZXKA 3TOJA 5FTTC 4CP2A 3U4XA 3NNMA 2AR6A 3ATGA 2WBKA 3BALA 3UKTA 2C26A 1GICA 4XHBA 3UNPA 2IXKA 4FQ4A 2VCAA 4ZU7A 5FJHA 1JYTA 4FPJA 4JTOA 4DOUA 1H9PA 2VVEA 1GOFA 4MGTA 4GD4A 4O65A 5FXWA 4QPIB 4RS5B 3NJXA 1EAH1 4XUTA 2EA7A 4D94A 1S2KA 2QFEA 4Y20B 2JDNA 4FPCA 1BEV2 2BNOA 2XKPA 2W52A 2EAKA 1RHI1 3GJAA 3P3NA 5JDBA 4UW3A 4Y1XA 2EALA 2P37A 2PHFA 2GP3A 4XEZA 3WNNA 4DUXA 3THCA 1U5ZA 1VBB2 1SLCA 1WA6X 3AMMA 5TSWA 3T08A 3U78A 3WP4A 5DUVA 3HNBM 4E2QA 5FZ7A 3BKZA 3E6DA 5IFTA 4IE5A 3URFA 4OLLA 1C5HA 1OSGA 1JOPA 2PHLA 4OYUA 3THTA 3ZYFA 3ZR5A 1UY4A 2GN7A 1KFUL 4XJZA 5JOXA 4MOAA 4B7KA 3FL7A 5A7PA 2IXHA 2BGPA 1QY4A 3A21A 3LB9A 4XBLA 4D69A 1DYPA 1GANA 2Q8DA 1S0GA 2CU5A 3ETPA 5CBLA 3ZSMA 4Q8LA 4RN5A 4TXWA 3ACHA 4Q0PA 5C7GA 3M2MA 2EXHA 4XZUG 4B4PA 3WW2A 3UGGA 1XC6A 1IZ3A 1NYWA 3DPRA 5D8AA 4KWLA 1W2AX 5DZGA 4E4ZA 3AYDA 4PQ9A 1LOFA 2RMU1 4FTSA 4TZDA 3D0SA 4QKFA 4CP9B 1BKZA 3E5XA 2GP5A 3GHNA 4I01A 1ZX5A 2EIGA 3TYJA 1VMHA 4DUWA 2LS6A 2FCUA 5C33A 4LQRA 4TLGA 2RJKA 1PZ7A 4LORA 3VD4A 5EJ3A 3K3NA 4JHTA 4AE2A 3RZMA 4UFJA 1HB4A 1QDOA 4LUMA 3IB3A 2J1VA 3VBHC 5L19A 1YNAA 1LULA 4CEWC 1H4HA 1BVP1 2QQOA 3AZXA 4GJYA 4IL7A 1TME1 3VD7A 1VR3A 1BLZA 3WP3A 1FOD2 4MGQA 3I2JA 5D21A 1H2LA 4WM8C 2I2SA 3VHOA 3K51A 4IETA 2VMFA 2VNRA 3BB6A 3UESA 3OUJA 3ZFEC 5C9AB 1HRV1 1YI7A 4AFCA 2OW4A 3M8LA 3ACLA 2BFUS 1PIV2 4YW2A 3V0AB 1ALYA 4LEJA 1H30A 3AP5A 2JG8B 5I0DA 5D2AA 4Q4Y1 4LKSA 5ABJA 5HCAA 1T6GC 2A6VA 2BP6A 3CO2A 2XJUA 5GJ6A 2GAUA 3O1TA 5FIXA 1NA1A 4LUKA 4XFHA 4OFGA 1K5JA 1YQ6A 2JEMA 1QEXA 2W92A 2P3KA 2XHNA 4M0NA 4MX3A 5FV3A 1YEWA 1UU5A 1W8UA 5FUPA 2WWSA 5E88A 1LGNA 4YZ2A 4QDRA 1ODMA 4A7YA 3ZSJA 1DQ1A 2X10A 2HLEA 1BEV3 2R043 5EFUA 4OUSA 2CGNA 2R49A 4EWDA 1JU3A 1W9YA 1RUD3 1SBFA 1W8WA 2IXIA 1SLAA 4P08A 3USUA 4OUEA 1RYYA 1UN1A 4LR4A 1G86A 3AJZA 5F39A 5LRRA 2E6VA 2RS12 2LRPA 4SLIA 3LA3A 2HWB1 4L8QA 4JQRA 1D2SA 2W9XA 1REDA 2CDPA 3P1IA 2KA3A 1LHUA 3ENRA 2PQSA 1JTZX 4CE8A 4PLOA 3B94A 3MIHA 2QJVA 5FZ8A 1FYUA 1OFNA 4AK3A 4YLZA 1T6BX 3ZYPA 4RGKA 5FMDA 2XL9A 2D43A 4GKXA 3SKVA 3LIGA 2J1TA 3JU9A 1JZ8A 3AYEA 3GZUC 3KT1A 2PHDA 4M4PA 4JV4A 4XMIA 4Y20A 4F8AA 2D3PA 1PO22 3WVJA 2VH9A 4N53A 5JI9A 1TVGA 2DCJA 3H50A 4CPBD 1N1SA 2QCSB 1E5RA 3DCQA 5C8CB 2WR9A 1O3QA 2XLAA 2HWB3 1UU4A 3ZM8A 2J1EA 1W9FA 4EE2A 1LOGA 4AI1A 4DUVA 5I0UA 4N43B 2X53S 4QPGA 3VBUA 5J48A 3WDYA 1V6MA 2NYYA 3ZFEA 3KV9A 1AR82 2PYTA 3ZYGA 2JXAA 3T1MA 2WO1A 4Q8KA 2ZXQA 1H6XA 1VBA1 5FZLA 2V72A 1LESA 2D97A 5CG9A 2K46A 3F2ZA 2XGXA 1ZYBA 4GB31 4NR1A 2CWSA 2R30A 3BVCA 1S1AA 2JDMA 1RXGA 1RUD1 4O9GA 5EYYA 1FNZA 1LTEA 2HEVF 1OPMA 1KS5A 2HWD2 3OGSA 4GH4C 3ZN5A 1LU2A 3W21A 5F3CA 1Y3TA 2C9AA 1O91A 5F8PA 2BVVA 1YQ5A 3HQUA 3R4DB 2VOKA 4GALA 3HEIA 5LY2A 3SNMA 4CDXA 4DMIA 4EZHA 5FFOC 1W99A 1W2NA 2UU8A 3J8F2 4OHXA 1G9FA 5C4WB 2AYHA 1V6IA 5KXEA 1OUXA 2AEZA 5BNPA 1JZ5A 2DTWA 5IUQA 4AFDA 2PLV2 4R9DA 4LBJA 2ARBA 2VOTA 2D6PA 1COV3 1Y9GA 2OZ6A 2CWMA 4UBHA 4LO6B 2O8OA 1SG3A 4M4RA 2SBAA 4DXTA 1R1ZA 1BCXA 5IAXA 2WFPA 1MACA 1UZVA 3MUZ1 1AJOA 4BXSV 5FDBA 1HB1A 2WT0A 3O1PA 3NMBA 1OLQA 2R0HA 3B7MA 3B93A 2Z79A 1UL9A 2XWJB 4X6RB 1WLTA 1EUUA 3FJSA 2OYZA 3BUCA 3WEZA 3V0BA 4W6XA 3PUHA 1F8VA 2EIEA 3BIWE 3J7LA 3KLSA 4UW6A 2G9GA 4XTPA 4XTMA 5F5IA 3NAPC 1W2UA 5FYIA 1FPN1 1QJZA 2CHHA 1YQ2A 2Y6LA 3RSJA 1VJ2A 4GMP3 3DXUA 2ZMLA 2A70A 2P2KA 3R4UA 3OPTA 4LBLA 3GJBA 3M3QA 3OJBA 2PMWB 2W08A 4KQ7A 1H6YA 4UOJA 5LW9A 4K20A 2NP0A 1UOFA 4Y5SA 5SV8A 4MXVA 5IYYA 3SHRA 4GQ7A 3W59A 2PQQA 2Q1MA 4P9GA 1B35A 1WW5A 4PCRA 3N7KA 2B39A 1G6NA 1GQGA 3ZSKA 1CZSA 5J1XA 1KITA 4EROA 4P14A 2ET1A 2E9QA 4AQSA 1CR7A 2QE3A 4HKLA 1F4AA 3H8RA 1S0DA 2D6LX 1ZA4A 4H14A 1CAUB 5J3UA 1ZBA2 1WMDA 1AL23 3USUB 2VMHA 2ZHMA 2W1WA 3GGLA 1PMIA 5C6CA 2VJXA 5D1IA 2JDZA 1IPKA 3H8UA 2E51A 4YYOA 5FLJA 4AL9A 4K21A 2C6SA 2VTXA 5DQ0A 3JBG3 1F15A 3SMHA 1ZBA1 1D4M3 3AMPA 1PO12 3RJRA 4RHV3 4QKBA 5CFDB 1DZQA 1YO8A 3M1HA 1RUF3 2CNAA 2VPVA 2ZBJA 1JS9A 2TEPA 2MEV2 3PUSA 4N53C 1XQNA 3KGLA 4GWIA 3FHQA 1FNYA 4CCEA 1AXKA 2P3JA 4HL0A 3NNLA 4N53B 4X6QB 5BNOA 2RR13 2WSVA 5FYBA 2VQTA 3H8OA 2VZQA 5FO8B 2D6OX 5DUWA 5KXCA 1GLHA 2Y64A 3IMMA 3LDRA 3TAYA 4CCLA 3ZXFA 4CEYB 1CJPA 3VBUB 3RZJA 4IGPA 2WO7A 3OUHA 1WCDJ 4BYYA 1A8MA 4L11A 4I2OA 1US3A 2Q1FA 2FCTA 5FMOL 2JE7A 4K7JA 2Q5TA 5EPAA 3W20A 5JSPA 3AJYA 5J98B 1LECA 1WD3A 2PHWA 3O0WA 1HIXA 4XDQA 1HV0A 3O1UA 3OGGA 2AC1A 2VMCA 4YNIA 5FZKA 5FXVA 5HCBA 2YFUA 4YZ5A 1B09A 1OC1A 1PK6C 2JB8A 3KD4A 3OUIA 4L0PA 2RDNA 1UXZA 2DBNA 2DVFA 4COWA 3TN91 3WF4A 2OPWA 2XJQA 1J1LA 2DBIA 3O1VA 4E4SA 2J1RA 4JRLA 1XYPA 3IKWA 3OTFA 2PLV1 4AYUA 4CXYA 1VBB3 3ELNA 3C7OA 2QQUA 4R9BA 5LRSA 3ZFGC 1VB2A 1WLCA 1OA4A 1JZ6A 4UFMA 5BNPC 1MEC2 1VBE2 3KM5A 3KT4A 4K3UA 4IV1C 5A32A 1Q8OA 2HH9A 2IXLA 4FXKB 5ERLA 3KSCA 1DYKA 3RI8A 4PI2A 4XF1A 1P8JA 3ZFFA 3CZJA 5KBFA 1POV3 5A6XA 4CCDA 1VBE1 1MVEA 3E97A 5DAWA 5JXJA 1QXRA 2DFCA 4E8DA 1RITA 1UOGA 1Z78A 2C24A 3HOBA 5EXOA 3AB0A 3ZKUA 1W9TA 4N7IA 2FD8A 1C1FA 1NCRB 2YBSA 4DIQA 5HBAA 1LEDA 3B01A 3I8TA 4N43C 5GM0A 2P34A 4D6SA 1IQAA 1MS5A 2IFWA 3VKNA 5IK8A 5JSOA 4BZ4A 3C7FA 2NQYA 2A6YA 1YFYA 3OBTA 3H1YA 4QGLA 1Y9QA 2R063 4DB5A 3ZN4A 1RUC1 1WUVA 4MGYE 1UPIA 4XHXA 5A6QA 2PXJA 4XABA 4HONA 2ZGPA 2ZX1A 4LK7A 4ZONA 1O5UA 1PIV3 1TEIA 4BE3A 2JD4A 2JDUA 1HX6A 1XNAA 4KWJA 5K0UA 4AEDA 3FX3A 1TME2 5JIUA 1KRIA 5CZKA 5C4WC 2ZHNA 1XJAA 4JGYB 3QACA 2R1DA 1QJFA 1V6LA 1N1YA 2WIIB 3MV01 2HBTA 2PHRA 4LO4B 3LSDA 3WG2A 4CUBA 3MLKA 5GZGA 2VZ1A 2OUHA 2G1MA 4A3ZA 1FV2A 1DHKB 2ARCA 4HOOA 5APAA 2VCBA 2Y26A 4AEDC 4DINB 2C5DA 1LGCA 3C8XA 3DGTA 3HVDA 4OHWA 4P00B 4YRDA 4M0HA 1RUC3 1ZRDA 4IEOA 4JKLA 5KR7A 3GM8A 2WABA 2XJVA 1O3SA 1VAVA 1X33A 1LOFC 4ORFA 2ZGUA 4LJHA 2ARXA 2QDRA 4QX1A 3QBQA 2MEV1 1UAIA 2W68A 4ASKA 4Q2FA 5CA6A 2RM22 3RI9A 3T1LA 3WNMA 2GNTA 4S2HA 4A3XA 5JAXA 4K6BA 3FWEA 3UGFA 2AACA 1K5MA 1QJX3 4FQZA 3IN9A 4WVZA 2GMMA 2W2IA 3RS6A 5E89A 2GZWA 4Q29A 4ZS3A 3B69A 4PHZA 1RUE2 2ZHLA 3ZXKA 2D5FA 2WWUA 3ETQA 3ZYIB 3VHPA 4HZFA 4INDA 3ZFFC 3OY8A 1A8DA 3LFMA 4V2WA 4YGDA 4Y1ZA 3JZVA 4WVMA 1EAH3 3MF6A 3VD3A 1W05A 2Y34A 3FE5A 2TUNA 1DLCA 2WNVA 3SQOA 5LK7B 1PHMA 3RNSA 5T5JA 1ULDA 2CV6A 5FRAA 4D7SA 3JD71 4XQWA 1HV1A 4QX5A 2V4AA 3I97A 3NJVA 1ZZ8A 2D6KA 2Y0IA 1V9U1 1XRUA 4MO3M 1VBB1 2FDHA 3ZYJB 3I54A 3POFA 1EV13 3OCPA 4JTNA 5H9RA 1DP0A 1V00A 1XOYA 2ZMNA 5FPBA 2QBXA 2ORZA 1JZ4A 2XPJA 4A41A 4MGZE 3WOGA 5FWJA 2WAAA 2WS92 4PF5A 2XMLA 4BIOA 5FZGA 4Z2AA 3FLRA 2EAAA 3THPA 5FBJA 4XURA 1C8M3 1EPZA 1HRV2 2LUWA 1LB2A 1OLME 1OF4A 2D6NA 4OUMA 5E6HA 3MIEA 1YXWA 4BOWA 3AYAA 2NLRA 2W39A 3UYJA 1IG0A 2VZSA 5FYMA 2QQKA 1AL21 5LA2A 4R52A 5C8CA 4XYXA 5JMOA 2P5BA 3FC0A 1OKQA 4RD7A 3PMSA 1IKPA 3ACIA 4LHSA 2XUEA 5T50A 1W39A 3KT7A 4Y26A 4JX0A 4JKMA 5A6ZA 4PIYA 5IATA 1ULFA 4URAA 1X8EA 2A7AA 1MZEA 3FBMA 4OMCA 3ILFA 3POIA 3LEGA 2XJPA 2W0XA 3A7QA 4IE7A 4FSJA 2VD7A 3NVCA 1U12A 4B3NA 4IV1A 4AFMA 2FMYA 3N35A 2UURA 3AZVA 2WFF1 3POJA 3S7IA 4AQTA 4EQVA 3AZWA 3IIAA 5C5UA 4HVQA 2BZDA 4LE4A 5FZ9A 1RJ8A 3WF1A 4LPLA 5CFDC 4BJ0A 1HRV3 2DU0A 1HRI3 1H8TB 2ATFA 4YGCA 1RGSA 4IEZA 1NX9A 2WKKA 4Y1UA 4M00A 4CCNA 1A3KA 1Y4WA 2CYFA 5BNNC 2DF7A 4NIGA 5IVFA 3CJIB 2DVGA 4TTGA 2G19A 2XWBB 1SPPA 1FMD1 4U2AA 3OYWA 4AEDB 2XH6A 3L2HA 3O5SA 1O3RA 1MZFA 2OQ7A 1CAWB 2JE8A 1CX4A 4JGYA 1TE1B 3WQBA 4DXZA 3WZ1A 3FMGA 4QDQA 3LGRA 4EJRA 2Y6GA 4XUPA 4TWTA 4HKWA 1WMEA 2W1UA 4CRQA 2XBO2 4HFSA 1RTVA 2PHUA 5SV5A 1KDMA 4FFIA 2XHKA 1Q8PA 3AYCA 3W58A 5F6LB 3WDTA 4BCUA 5IK5A 4QB6A 5J7MA 2E26A 4UXAA 3BPZA 3TBDA 4AI3A 2VOVA 1XYOA 3MGUA 1JN2P 4B7EA 2Z4FA 4FPEA 3BODA 3V64A 1QJU1 3WUCA 4QPIC 4RS5C 5JLVA 5A80A 4HVOA 4YZ4A 3D8CA 5C3OA 1BXHA 1AYM2 3A22A 1UIJA 3U4SA 2XJRA 2QUOA 1SMVA 3ZR6A 4XW3A 1QXJA 2EVXA 4BM8A 1C8NA 3CJXA 1J84A 3ILRA 1H1AA 1AL22 1BYHA 3OD4A 4O9EA 4NPRA 5FYYA 5C3RA 4QWNA 4ITCA 2FMDA 3POEA 3I3BA 1DGLA 5GKAC 3HIFA 4P9LA 5G05L 3LD8A 4OI0A 1RUG3 3I59A 3OGJA 1OQ1A 4CU6A 2ZKNA 1QJY3 4FFHA 2DURA 1O4TA 1L7RA 2VC9A 4GIQA 4CCCA 4BQ1A 5FP7A 4QD2A 2A5ZA 4I0BA 4CDXC 4UF0B 3D82A 1LAJA 1VMFA 2WSUA 4Q4W2 4Y5TA 1S0FA 3F95A 4HANA 4K40A 1IS4A 3CQOA 5F6KA 1OPOA 2VZOA 1WCKA 2V5DA 1QOTA 4RA0A 3SCGA 5B4XA 5C70A 3J4UH 2Q1ZB 1NZIA 3LEMA 1HW5A 1S0JA 2H6CA 2RR11 5EV7A 5IAVA 4BK4A 5A70A 2Y60A 4YW3A 5FZIA 4PBOA 1PO21 3MW3A 2RG4A 4NWWA 4Q0VA 5FZAA 5LCWL 2HWD3 2ZX0A 3OBRA 3U75A 2JENA 4K1YA 5FXZA 3VBOB 1QF3A 1R64A 1E57A 1SZBA 4LA3A 3TEZA 5CKQA 5E16A 1W6NB 2F4PA 2FDFA 3VZLA 3VBRB 3WNXA 1Z7S3 1W90A 1JU4A 1OKOA 1RHI3 1UMHA 1SFNA 2VE1A 5CYYA 1M4WA 3AP9A 5T5OA 4LOSA 1JOJA 1W03A 3MLLA 4Q1PA 2HWC2 2R073 1V9U3 2VOWA 1X8MA 2YC0A 4NWVA 1HJGA 1W6MA 4IEPA 2YGMA 5F5CA 1G8WA 2YDEA 1FATA 1W8OA 2WL1A 1WCSA 2A3XA 2LM3A 4RQPA 2ZA9A 1CN1A 3Q8CA 4LBQB 1CIYA 2XJTA 3RDIA 2XONA 1D0GA 2JX9A 4KH9A 3USSA 2DCYA 2EF6A 2ZEYA 2K9ZA 4CDWA 2GMEA 4LULA 5EQUA 5FUNA 1YUDA 1E5SA 2IVIB 1QXPA 3K2OA 3NV4A 3MUY1 4ZS2A 1POV0 4BMEA 5C3SA 1MS3A 3C7GA 5LY1A 4OI2A 2BOIA 4YVSA 2ZABA 3NV3A 1ZZCA 5HV4A 1SPPB 4COUA 2PFWA 2R042 1F9KA 3AMNA 1RHI2 4NMIA 1N1VA 5CNAA 3VBOC 3CZUA 4L2NA 3K46A 4KU7A 3IMNA 1QGLA 2VNOA 2XXZA 4QB2A 5C3QA 4Y5Z0 2XKOA 1HN1A 4AVVA 3T2PA 4FPLA 3EJKA 4CDWC 1DGRN 2FZ2A 4KBZA 4Q4V3 5FZ0A 2A6XA 5FQ0A 5EJZB 3B5LB 2VAUA 5FZBA 3MHZA 5HPOA 4DXSA 3NRUA 3MIDA 2A71A 4QXHA 1E5HA 4R9CA 3EO6A 4XJ9A 5JZGC 4GKYA 3K75B 1LR5A 4QX8A 4WM7C 1UO9A 2WLPA 1SBDA 4IGQA 2XJSA 4IEQA 1RMU2 1OD3A 2FDKA 4NRQA 4IV3A 1IKQA 4YFWA 3NAPA 2RS11 2ZAHA 4FAGA 3W5MA 3VN4A 4Q4X2 3HMYA 1X9TA 1SHWB 5K4LA 1GU3A 1J58A 2P3YA 2Y6KA 3R4SA 2CAVA 2ENRA 5I93A 2D44A 5A3UA 3ZIWA 2PAEA 3J8F3 1FAYA 3MEPA 4HN0A 2A1XA 4GWNA 4Q1RA 1JZ7A 3CU7A 1DZTA 1L3JA 4KG0A 3W9AA 3O1SA 3FN9A 1UIKA 4YVSC 5FMCA 3UK9A 1OA3A 2RS52 4RR3B 3I59B 3ALQA 1QJY2 5GLZA 3RPQA 3VBSC 4NIHA 1QJU2 4FOQA 3VUOA 4MG2A 3ES4A 4DFSA 3O12A 2ZZJA 4G4FA 1W6PB 4Z8BA 4Q0UA 1YI9A 1C5IA 4C90A 4I0WB 2K0GA 5L9RA 1ZRCA 3NJZA 3ZVXA 3N7JA 1APNA 4IEUA 4CDQA 4EN9B 1O8PA 2VXJA 4NRMA 3O1MA 3OG2A 1VBA2 4XJ8A 3T2QA 5I8TA 2WNOA 2ZEZA 3VBOA 3H8XA 3GDBA 1LEMA 3T09A 3VBSA 4AVTA 3N36A 3ACGA 4Y1YA 5DUUA 4GB33 4OI1A 5A1AA 3ILNA 4SBVA 5LBCA 1C1LA 4WVMB 1BQPA 1NCQC 3CJIC 3H3UA 3VKMA 4RGGA 5DDJ1 1V6JA 4COYA 1O4YA 5FPVA 4XF0A 4AEMA 1QH6A 2XLFA 2ZPXA 1WGPA 1PGW2 1I1EA 1UKRA 3UGHA 5J96B 1JZ3A 1W6MB 4FPOB 4P9JA 2OVUA 3AKTA 3PUAA 1C57A 4I3PA 1QNWA 1WW6A 3MO4A 3WHTA 3WQ1A 1UMZA 3ORJA 5BNQA 1K42A 5LA0A 2I74A 4AI2A 4CVUA 2DVAA 2Z5WA 3T30A 3KB5A 2B5HA 3IDEA 3LF7A 4GULA 4LXLA 3AL5A 2HWE2 4XFAA 1VBC1 4LITA 3IAQA 4CCOA 3CHXA 4AHZA 2RS13 5ABJC 5I8YA 3J7HA 2E7TA 5KXDA 3RMYA 3JB4C 4A44A 4A2UA 5FZ4A 3EMRA 2VUJA 1RUI1 3AP6A 4NIIA 4MVTA 1UY2A 2PELA 4NUBA 4OHZA 4EV0A 1N3PA 2P17A 5KHJA 1I6XA 2D3SA 3K48A 2CGPA 1XNCA 1UY1A 5T3NA 4BQ4A 4E9KA 4W65A 3S6PA 2G9ZA 1KFXL 3LKJA 1HJFA 4LT5A 4NHMA 1ENXA 2VW0A 1F2NA 3N7LA 5DG2A 1I3HA 2GNDA 1POQA 4HSJA 3T4VA 5BNNB 5DDJ2 4AR2A 4IV1B 2L9LA 4XBQA 2RDRA 4UW4A 4D6QA 1EUTA 2R061 2E32A 3PVEA 1RUC2 5JI7A 1ENSA 4DXRA 4DS0A 2EICA 1QJU3 4ZKTB 2GNMA 2P6CA 4AQ6A 4GH4A 3LDKA 4XQ4A 5JXGA 5FMOS 1DQ6A 4FOWA 2VBDA 4LO8A 4IERA 3ZXLA 1YFUA 1YQ8A 2VMIA 3C7HA 1CVNA 4W8JA 4S2FA 2RV9A 3CJIA 1ND2B 4YZ3A 1DGWX 3H1WA 5T5PA 2DUPA 4LMFA 3FLPA 5K8SA 4DNYA 4XZPA 5DZEA 3L9JT 4Z2WA 4DQAA 3EB7A 4ET7A 5F2SA 1JW6A 3MIFA 1X7NA 2H0VA 5CEHA 1MEC3 1YJKA 1UOBA 3GALA 5L7OC 1XE7A 4NHKA 3VBUC 3LZZA 2VULA 1GP4A 2HEYF 2VZRA 4XAEA 1ODNA 3ZMNA 1ZRRA 5IJRA 4CDUA 3KV4A 1GZTA 5FZHA 1MS8A 5ACA3 4QHZA 5FPAA 2OQ6A 2ZEXA 4MZUA 1AR61 1IGOA 1AL0G 5IHRA 2YU2A 3AP7A 1CJDA 1DGWA 2HWE1 1OHFA 4PIZA 2QQJA 2WINB 4KG8A 1QH7A 2RMU3 4HK8A 3X29B 2NPIA 4JZRA 2HWF1 3S0MA 3IZOA 2GC2A 3LA7A 4JDOA 4HPKB 4PLMA 2VTXJ 4ZU5A 1YFWA 1H2KA 4JDNA 1REEA 3LOBA 4FI9A 2BERA 4LNVA 4DY3A 4KGGA 4CP0A 3NW4A 1AHSA 1X36A 4W6WA 1AX1A 1LOCA 1PZ9A 2W46A 3P3PA 2BJSA 3QOPA 1ENRA 4JDMA 1WW4A 4L9BA 4NPMA 3WR0A 5ANNA 2BNNA 1H8TC 2EXKA 3UETA 4HSLA 4Q4W3 4RFT0 4AGRA 1PVC3 1ULEA 1W3XA 5FWEA 1FT9A 4YM1A 4YW6A 3D5OA 3I3EA 4Y22A 2PLV3 3MW4A 3K4ZA 1Q3EA 1BBT1 2XL7A 4GJZA 2JDHA 2IC1A 4XC9A 5LB6A 4W50A 3L2YA 3U11A 2JDKA 5IT6A 1NE4A 1NAEA 1RUG1 5L7OA 4CXWA 1TQ5A 1CONA 1ND2C 4EN7B 2X5IB 4FAHA 2P6HA 4AHWA 3C2UA 3TEXA 1TG7A 1BBT2 4O61A 5CFCC 4EWAA 1LHOA 4L92A 1IS3A 3U0ZA 3I2OA 1O5LA 1AR93 2VO5A 2RMU2 2QZ3A 5F3EA 3AMQA 1LHWA 4ARXA 2YB7A 2OPKA 4CPBA 4Y33A 4XJUA 2BUKA 4QQHA 3RYPA 1Z7S2 1PVC1 4V2VA 3ST7A 3BYWA 1WCUA 3TB0A 3MPPG 3ZPOA 4D8MA 1JHJA 1GWLA 3N9LA 5T52A 1OA2A 3E5UA 1W6NA 1XSRA 2GN3A 3WNLA 2W1QA 1LOBA 2GDFA 2HYXA 3R05A 2VTFA 4UAPA 5FZ6A 1Q43A 1WMXA 4BB3A 1AR71 2ZGNA 5FREA 1CPMA 3DEMA 3PNAA 2ZGTA 2HEWF 2XB6C 3AVSA 3ME2A 3P5BA 5KC5A 4JGYC 4RHV1 3Q8AA 4BMBA 5GLWA 2V4VA 2JG9C 4S2GA 2FQPA 2VQUA 1ZBE3 4J6GA 3DYOA 5KHHA 3WHUA 1J1TA 4TLFA 2VZTA 1DBNA 1PIV1 2X5IC 5A7OA 1W28A 3PHMA 4L97A 3K3OA 3V0AA 3DL3A 1IOAA 3WQ0A 3PU8A 1AUYA 1FPN3 4FOVA 3APBA 4RQPB 4YW4A 3UKVA 1V6NA 2JG8A 3S5QA 3TNPB 2D93A 3O0VA 4GWMA 1MQTB 5GALA 1HRI2 1XE0A 3WUDA 3VBHA 1GUIA 1FI2A 4AVSA 1PNGA 3SC7X 5A33A 1S0CA 1SEFA 2CDOA 2RR12 3WINE 4AGGA 5IVVA 1W2OA 4XXPA 3KV5A 2WQ4A 2ZGSA 1QNYA 2Q0AA 3PTYA 5JZGB 1I9RA 2WZ8A 4RGAA 3LQCA 2Z42A 4KNCA 4B4RA 3VD5A 2Y6HA 1Y9MA 3I49A 4IE4A 1SLIA 4ES9A 4FTBA 4ZU4A 1G9BA 4IUGA 2VZ3A 1GBGA 4NHXA 2DUOA 5CVRA 2XBO3 1H8VA 2ETEA 3VDBA 1NZCA 4E4DX 1K5MC 5CIRA 4YW7A 5A1FA 3FBYA 2ET7A 3BU7A 3WX5A 3AZZA 3S7EA 5FY7A 5LATA 4XE9A 1NXMA 4BK5A 1DLLA 3RG0A 1FMD3 2WC2A 3ZDSA 2J42A 1JYXA 1MS9A 1UY0A 1AR91 1OVSA 1VRBA 2Q30A 3BN6A 1UZYA 4XETA 3NV2A 3SH5A 3AXDA 3LIHA 1R093 3MW2A 4QXBA 1Z7S1 3JCIA 2WO3A 4AHXA 5A3NA 3T3YA 3LAGA 1S0BA 1H0BA 2Q8EA 1OURA 4QGNA 1VBE3 4RQPC 2FDGA 3KHBA 1YQCA 3ZXJA 3GZTB 3O0XA 4JHZA 2RM21 4LE3A 4BQYA 2RS53 5EWSA 3KWVA 3GXUA 5BV6A 4CSWA 2PHXA 1HLCA 4YVWB 2LTNA 1KQRA 1UYYA 4YPJA 3VDAA 1VBD3 2JIGA 2UWCA 5FKCA 2VBPA 4AI8A 2RJ2A 4FPHA 2G9FA 1J3PA 1S0IA 3FFZA 1DQ0A 1RUG2 3N9MA 1AR73 2ERFA 4NHYA 1W04A 5JIAA 2BWAA 1LODA 3HT2A 2YU1A 4XDPA 5A7NA 4AF9A 4XIOA 2VW2A 5EIYB 3AVRA 2W47A 4M3CB 4RR3A 2QVSB 1W0NA 2BBAA 4GB32 4YM2A 1KXGA 4DY5A 2JE9A 1UCXA 1HDKA 2BGCA 3KZ4C 5A7SA 4TYSA 2R072 3V56A 3TN93 1X82A 3IDAA 4MV2A 4NAOA 2D7FA 1GP5A 1Y7BA 2MNGA 5G04L 4D3WA 1BVVA 2LALA 1G9CA 4N43A 1RUJ3 1VBA3 1W6QB 4E27A 1CQ9A 3BOPA 4PLNA 3ZX7A 1JMUB 2HWE3 1YC61 3MFAA 3OEBA 3OGVA 3H3ZA 4L99A 4QPIA 4RS5A 1JUHA 1JZ2A 4YGBA 2ZGMA 1RB8G 1YIFA 3M70A 3RRDA 2BPA2 2OIIA 2ARAA 3EHKA 4J1WA 4F3JA 2VGDA 5BNPB 1WBFA 2XQXA 1ULPA 1HXS3 1QHDA 3LFIA 4LK6A 2GMPA 5KHKA 1L7QA 3SH4A 2C1FA 3VDCA 5KHIA 1OVPA 3HBKA 2WFF2 3O1RA 2P1BA 2VW1A 4QPWA 2ZGQA 1UX6A 3OSDA 5ACA1 1LKNA 1MVQA 5JPMB 1ASJ3 3M3EA 2A75A 1W8FA 2EXIA 2HWB2 3G7DA 3Q8EA 4JQTA 1NCQA 4R4ZA 1C4RA 4CDXB 4FTEA 3A4UA 4ZZ8A 3NQHA 1DCSA 3OOXA 3U10A 2VR4A 3NNFA 4KBBA 5LASA 4CYDA 1YRZA 2YY1A 3K77A 4X8NA 1MEC1 3SEPA 1ZBA3 3V0BB 1FOD3 5GZCA 3T0DA 4Q4Y3 2B9VA 2ZGKA 3WW3A 4LKDA 3WNKA 3OF1A 1QJY1 4H7MA 1QMJA 1VP6A 1KJRA 1RMU1 3ZXAC 5KHGA 5I0RA 5ISLA 4PQQA 2H0BA 2D98A 1EY2A 5IW0A 2I45A 4MGIE 1N1TA 3IDBB 3NV1A 3P6BA 2XOMA 2XUMA 1JYNA 4QM8A 4WM8A 4FXGB 3BTZA 5F1RA 1SFPA 2YC2A 5JMCA 1HQWA 3D3AA 2E63A 4FFFA 2F17A 2VZPA 1QJX2 2QQNA 2B8MA 4HXCA 4OHYA 3Q8FA 1BHGA 4OHVA 3DPRB 5D8AB 2JICA 3PIJA 1ZA7A 4YGEA 5B2GB 5A3PA 3ZKYA 5EJ1B 3PTRB 4D7YA 1WLDA 4FP3A 2PHTA 4AFAA 1RVF2 2UY8A 5CISA 4EN8B 2GC1A 4DPNA 2OXBA 3WW1A 2QQPA 1RUI3 5AVPA 1EV12 1G7YA 3PURA 5EP9A 2KM2A 2XG3A 4XFFA 3PVNA 2XVKA 5J36A 4XACA 2WZEA 5FPUA 1B35B 5ANQA 5E1RA 5IVCA 2J1SA 4IEVA 4Y4YA 3OEAA 1Q8VA 4LBOA 1W2TA 4JGZC 5FYTA 1UYPA 3MICA 2ZGLA 3S57A 4QX0A 1XB9A 1PZ8A 1H1IA 1IS5A 4QM9A 2QQLA 1MR5A 1QDCA 1BK0A 3RVHA 3VZOA 2RDSA 4YARA 5CFDA 3MV11 1R092 5CKNA 1GNYA 2F6BA 4AQ2A 4NN0A 4NHLA 1OLMA 4QKNA 1LENA 2JD9A 3POWA 1PX3A 1HKDA 4JRAA 1C8M2 3VZMA 3VKOA 3HNMA 4RSUA 1RC6A 1S55A 2YMZA 3POBA 3WCRA 2A6ZA 4UWDA 1H2MA 1S2EA 1TMF2 3KQ4B 4LA2A 1SCRA 5DUXA 4ZY9A 3HAGA 1ZM1A 4KU8A 2C4XA 5ACA2 3BIEA 2WUHA 4FPKA 3MIBA 4BQXA 2QKDA 1NLQA 3H3LA 4XUQA 2ZEWA 2C9KA 4WM7B 4YW1A 4QB1A 4IQPA 1N47A 3VKFC 4A6SA 1PMHX 4DEQA 5BNOB 5F9TA 1WA4A 1IG3A 2IUWA 4KWUA 4R8HA 2UWAA 3TN92 4A42A 5K7PA 2W1SA 3I7DA 4W4ZA 1RUH2 5T54A 1NE6A 1O59A 3ZYHA 3DECA 5JVVA 1MPXA 1XYNA 3CIHA 1UZZA 3DKWA 4MHUA 4XDOA 2YGLA 2BNMA 2O1QA 3BGAA 4LIUA 4IE6A 4XMAA 5A3MA 4Z92B 2J22A 4IDZA 1YLLA 2CSGA 4UFIA 2B4KA 2JG9B 4QQ2A 4PBPA 4MLOA 5A32B 3N9PA 4LHKA 1OOPA 3IPVA 4M3CF 5FYVA 2F4LA 2CAUA 3M7AA 3FHIB 3VB9A 5JXIA 3U1XA 2AGSA 5JR7B 2GSYA 4BPZA 2JDAA 5E8AA 3ZFFB 3OD0A 1LNSA 1E5IA 5DZFA 1YWKA 2Y6FA 3EXUA 1RL3A 4META 4M01A 4UFLA 2XQRA 4AVCA 1UQXA 4Y22B 1NCQB 4EWEA 3RZHA 4Y24A 3N9NA 1JYCA 2IWGB 1F31A 1KJLA 4NOTA 4OZOA 3POSA 5H9SA 2EIDA 4A7ZA 1LU1A 2WRAA 2ZKLA 3ACFA 4IXLA 2AH2A 3KCCA 2ZX4A 4AHYA 2X5IA 1OXCA 2BDRA 1DQ2A 4K9SA 3D4KA 3HNYM 4BQWA 5M0TA 3PJQA 1KS4A 1W9SA 1W3VA 3GHMA 4AZZA 1J3QA 1F5FA 1VBD1 5F3GA 1GOHA 1SLLA 3WF3A 1C28A 3VD9A 1D4M1 4Y4RA 1KEXA 4XUOA 5A3WA 4MXWA 3NNGA 3GBWA 1OBNA 3I4IA 5FLIA 1O3TA 3BTYA 3M3OA 2WNUB 2NM1A 4CTEA 4QXCA 4FBFA 1US2A 3RWKX 2NMNA 3THDA 1Z0HA 2JJ6A 2WDBA 1T2XA 3KF3A 2QQIA 4NVPA 4YWAA 1OH4A 2B45X 3U07A 3LCPA 1BEV1 1XU1A 3LE0A 4XIKA 3NL1A 3J7NA 1DYOA 5C4WA 3H9AA 3IT8A 1PGSA 1A34A 3ES1A 1ZZBA 4C1WA 1CAXB 3GF6A 4KMQA 4FPYA 4CU7A 1AR83 1N3QA 3UV9A 3RYRA 2RS32 1RUH1 5FY5A 1QOOA 1JYVA 2H6BA 2YBPA 5F37A 3ZO0B 2YFZA 4AEKA 1CX1A 5BPXA 1UWWA 3AKQA 3ZLIA 2UYBA 3J9SA 2BBVA 1GSLA 1MS4A 3VZNA 2E31A 5LEJA 2JG8C 5IVBA 2XDVA 5HXMA 4XXAA 3NJYA 2KD7A 5J37A 4MYEA 3HPNA 2PAKA 1QQP1 3N7MA 1XE8A 3WQ7A 2VG9A 2WZR1 1JBCA 1Q8SA 4KWKA 5FPLA 4WVWA 2TNFA 5FYHA 5JZGA 1VBD2 1XNKA 3QCWA 4E8CA 2ZACA 4C91A 1RUOA 1PMJX 4DEVA 4XF9A 1J3RA 1Q56A 1LCLA 4AGVA 4IV3C 3AKPA 5FY4A 5FO9B 1HXS1 2LW8A 4TN7A 5LA9A 4LLFA 5C5TA 3NKTA 2R32A 4LO7A 1OUSA 4WBBA 1IHMA 1R1A2 5JOYA 1SLTA 4QMAA 2N7GA 1UF2C 5FK7A 1LRHA 2WT1A 1NLRA 2TBVA 1I5ZA 4A7KA 4E2SA 4PDWB 1HN0A 3B9IA 1RUNA 5K0UC 4QX2A 2HJIA 3AX4A 2HWD1 5LBEA 3RQ0A 2B9UA 3DXTA 3ZN6A 3NWKA 1UMIA 3MDPA 4AXOA 2DYCA 2ZZQA 3CEWA 5FZDA 5LEKA 3N9OA 4FP2A 4YW5A 3VLBB 5FYZA 4AWDA 1UZWA 5BUVA 1RIRA 2VU9A 2JB4A 2CGOA 3R6SA 3J7MA 5A7QA 2IZWA 4HT1T 5HCFA 4C0BA 2R071 4P9XA 3VZKA 2MPFA 4OMDA 5JPNB 5FJKA 1SFYA 3HQXA 3EYPA 4DO0A 3GCWA 1D4VB 3OBAA 4HVRA 4LBKA 3BU0A 3WDVA 5FPZA 4QHOA 1O8SA 2FZ1A 4AEJA 1O4ZA 5JOZA 5DN2A 2BWCA 2HWF3 3CL1A 3NSTA 4M3CA 3ROUA 1WLWA 4ZZ5A 4J25A 5LBBA 5L9VA 4LHNA 1CD3G 4XVHA 3RZLA 3VZJA 1D0HA 3DUIA 3PJYA 1S4CA 1ZBE2 1TNFA 4HLTA 2GU9A 5FYCA 1IQDC 2EIBA 3PLQA 4EYUA 1RINA 3GCXA 4N90A 4D7TA 2RJLA 1D7PM 2WN3A 5FLHA 4Q4W1 3OPZA 4RL7A 5HI0A 3WF0A 3MBWA 1ST8A 4COZA 4BDVB 2NN8A 1JYIA 3RGBA 3T0BA 1HQLA 5FCCA 4AI0A 1JH5A 3OYWB 1XNDA 2O0OA 1UD1A 4XCAA 4YG6A 4QQOA 4COVA 4MXWB 4MH0E 2ZJCA 5I91A 1CAWA 1WD4A 4K8RB 4BIFA 2AZ5A 5IVJA 2ORXA 5BYNA 1ZNPA 4QT6A 2X05A 4HMZA 3IAPA 4CP1A 4H7LA 1PM4A 1TZOA 4UBGA 5A6YA 2MHFA 5GZEA 1YIPA 5IVEA 2JECA 3EQEA 2JWPA 2E7AA 3A23A 4NPLA 2R7EB 3E5QA 1NCRA 3H7JA 4EN0A 1U0AA 5KXBA 4XFCA 4WZCA 2A3YA 4D0QA 4IEWA 2OUJA 4CCMA 1OQEA 4XOGA 4B1MA 3O7OA 3AL6A 3CF6E 1YJLA 3D6EA 3PUIA 4GZ9A 1NKGA 3ZXEA 5FUIA 1FPN2 1W9WA 3GNEA 3LWCA 1HRI1 2ZGOA 4QU2A 1WMFA 4Q26A 3SISA 1EPWA 5F7UA 2A73B 1GYKA 2Z69A 4C1XA 4B1LA 4BU2A 3IIIA 1WZXA 3Q9OA 4FCAA 5I0TA 1QWRA 3K4DA 1FOD1 5J09A 1PM7A 3B9CA 2WS91 4WM8B 3HR9A 2E53A 4B8EA 5FZMA 1DF0A 1FV3A 4K1ZA 4RR3C 1CZTA 1XSQA 3OBZA 1CAVA 5B4NA 4BA6A 3ECQA 3JQWA 2V09A 3MFCA 3UJQA 5H9QA 4A6OA 1WW7A 3AKRA 1JI6A 1H1MA 3AK0A 4AVAA 2DTYA 5CG8A 4NROA 3QD6A 4YSFA 4GMP1 4ES8A 4ONUA 5C3PA 3E6CC 1IPJA 4B4QA 1SCSA 4CUAA 3ABZA 3N4MA 4O7XA 1I5PA 4Q27A 4CEYC 5FZOA 2VQ0A 1WKYA 2Y8KA 1VBC3 5FXXA 4D6RA 4Z1VA 5K0UB 5FP8A 1R082 2Y6JA 3VHNA 2ZTNA 2BU9A 3FZ3A 1KD7A 1LHNA 1PX4A 3IM0A 4PDWC 2QZ2A 4ATEA 4I0AA 3N9QA 1F4HA 1AJKA 2GNBA 4IGOA 5IWFA 1MS1A 2QNKA 3M3IA 3I2DA 1COV2 1UYZA 1MS0A 1SBEA 1PO11 5DABA 4XJWA 1GZCA 1ZBE1 2AEYA 3ASIA 4AFBA 1UPSA 1UY3A 1W8HA 3LSEA 5FP4A 1K5MB 2BVBA 3TEWA 3H0OA 5FO7B 4QQLA 1DDLA 1NQDA 1ND3B 3AP4A 4PDWA 2QQWA 1H4GA 1AYN3 1W0OA 2YBKA 4S2DA 1COV1 2VMDA 3ZN6B 5K9YA 1WWYA 2BTVC 4FPFA 5I0SA 3OY8B 3ZXDA 1S0EA 2V5YA 2IFRA 3WDUA 1VAMA 4PF1A 1VPHA 2WNVB 4QPYA 4YM3A 1QJEA 5JOWA 1DU3D 1ZRFA 1LOAA 2WQ8A 2BQPA 4QPGC 1GMMA 1KGYA 1ACCA 5FYSA 2WZR2 1V9U2 2WNUC 3UL2A 4IW3A 4YVWC 4ATFA 1AZDA 1NY72 4FO9A 4I02A 1VAKA 3ITQA 4R4XA 5F3IA 3SITA 1MQTC 5IK4A 4YG3A 4WM7A 3JD73 2D6MA 1DZRA 1GZWB 1W8TA 1FXZA 3WV6A 2VZUA 1L7LA 2RVAA 4LBQA 1QJX1 4ZXEA 1WCQA 3CBNA 5IFPA 2VOXA 5JR2A 3BTXA 1XBFA 4H2AA 5DDJ3 3WG1A 3H42B 1D4M2 2Q8CA 1C3HA 3BCWA 4RHV2 3ON7A 2J7MA 4WZFA 4E2GA 4BLIA 2YV8A 1YFXA 3I3DA 3SCHA 5EHDA 2JG9A 1U5XA 4PT6A 3J8F1 5T5LA 1MZ5A 1DGRA 1OOPB 2RDQA 2VZVA 3C7EA 2OX0A 3H1MA 3IPVB 4TSVA 4UT5A 5CU1A 5DAPA 4P02B 4XAAA 1G9DA 2CY6A 3JBG2 4Q4X3 3VL8A 2VUCA 1VLNA 4PJYA 2VL4A 3IBMA 2WZR3 2NZ9A 4XILA 3V65A 1NOVA 2GC3A 2PA7A 3WCSA 3AXEA 2IXJA 2WYFA 3RFRA 2VVDA 4OULA 5BNOC 4WVVA 4W6YA 1RUD2 3WW4A 3JBG1 4YVSB 1JUIA 2J1AA 2IXCA 1OFSA 4A4AA 1RVF3 5LBFA 1PNFA 1ZZ7A 2R16A 5FMBA 2GH2A 2BRTA 4QGMA 2WA3A 3HN3A 4LLOA 1F35A 3VBFA 5FOBB 2DVBA 2W5FA 1EP0A 3HT1A 3POGA 5I8SA 5C9AC 1BMV2 4JC1A 1R091 2LROA 2HWC1 3PDQA 3Q8BA 1AX2A 3WG4A 1A6CA 1AX0A 3GZEA 3WD5A 1QQP2 1DFQA 2MEV3 3OPWA 4JAAA 4JVAA 4Q0SA 3SCFA 5FPXA 3O1OA 1RUJ2 1UU6A 4AW7A 1CIWA 1NCRC 3I2KA 2FDIA 3ZYBA 5FQ0B 3HN1A 4YM0A 4CCJA 5AFBA 3MIGA 4J1XA 4AG4A 4CU8A 4BH9A 1X9PA 3CNAA 2WNUA 3CKHA 1CAVB 4QU1A 2BOJA 4Z82A 2FBEA 1J83A 3AFGA 4LBQD 4GXLA 4XFGA 3PMEA 2AENA 1RVF1 3NNJA 3VKLA 3ZFGA 1H8TA 1NY71 3O14A 1BJQA 2CL2A 4NAMA 1ZREA 5CFCB 3ZSEA 3RZGA 5CB7A 2X09A 1OOPC 1OT5A 1RUI2 3B00A 3FFQA 1H2NA 2YROA 3HD8B 4HG6B 3NO8A 2W91A 4M3CE 3DYMA 1PGL1 1CPNA 1LOEA 1O7FA 1XNTA 1RUE1 1STMA 1R1A1 2Z2SB 3FHAA 5FZOB 3E1F1 3A0KA 1CAXA 3JB8A 1TMF1 2HKXA 3VHRA 1W6PA 4LKEA 4XPVA 5BY5A 5EZWA 5AVAA 3GBGA 4R9AA 5FZ3A 2YXSA 1DQ4A 5JUVA 5H9PA 3KQRA 5JWPA 4UFHA 3NKGA 4AI9A 3VDDC 1AXYA 5BXXA 3MF9A 3DPRC 5D8AC 1PK6B 4XJAA 3ZDVA 1DIWA 1KDKA 2WNVC 1B35C 1ZZ6A 2Y33A 1GFF2 3VGIA 3BTAA 4QX7A 4CCKA 1CWPA 4UI9L 4KGQA 3IDCB 1AR92 1M06G 1HXS2 2DUQA 1BK1A 5F5QA 4NO4A 2X8KA 5GLVA 1A78A 4Y3OA 5AC93 4QQPA 5LA1A 4N8MA 4QHBA 5HXVA 4I3GA 5CKMA 3I2IA 3HWJA 1OLRA 2BFUL 2WA4A 3M4FA 3TRSB 3QLQA 3IWZA 4RYDA 3S5AA 1SLBA 3KV6A 4XF4A 4OQ8A 1UXXX 1JOBA 5LK5A 1EV11 3TNQA 4BHPA 1PO23 2WAOA 3FUOA 3M3CA 4UF0A 5FP3A 2ZOEB 4EZ4A 1V6OA 1WBLA 3I3MA 2I07B 4QAWA 5DPNA 3SH3A 4XBNA 4OZXA 3RZKA 1GZWA 4HK9A 4JGZB 4Q4Y2 4QXKA 5F2WA 5HCHA 4UW5A 5DAXA 1BMV1 3VBRC 2VECA 2E7QA 1G9AA 1FX5A 3PVOA 1GWKA 2JKXA 1VMJA 1YHFA 5FZFA 1AXZA 1YYNA 2YZ4A 2WJSA 4YZ1A 1W06A 1AR63 3POYA 1NQJA 4NRPA 1AYN1 4ARYA 3EBRA 4BQ5A 2YYOA 2AUYA 1W8NA 3LPGA 2KXLA 4NJ4A 4GWJA 1RUJ1 2Q8OA 5JXHA 1NA1C 1OD5A 5FAXA 5FKBA 2ZS6B 2X29A 1GR3A 3ZMOA 3VBRA 3C3VA 2HBUA 3S30A 3SLIA 3U37A 4F7ZA 1ZRIA 4FVVA 4OVEA 3VDDB 2FHRA 1MZ6A 1FMD2 2G4IA 2HWF2 2SLIA 3DF0A 5A3OA 1OI6A 2B46X 1RJ7A 2YPJA 4XQDA 3KGZA 3HQRA 4CDUC 4G3YC 1ULOA 4U36A 5L36A 1GZ9A 2OZJA 2PTMA 5GZFA 1HB2A 3ZYRA 4UYBA 4CXXA 3FUQA 3VL9A 1RUF1 4WV8A 4CZSA 2VQAA 2VCMA 1RUE3 1H9WA 4DRRA 5FOJB 2ZGRA 1JYWA 1Q5OA 2ZCWA 3LEIA 3AKSA 3KS7A 5A7WB 2YG0A 4QX3A 1N3OA 4H55A 2RS51 3WDXA 1QOSA 2ADDA 4P9YA 2RM23 4Y1VA 2WNEA 3SKJE 2WZPP 5A3TA 1PVXA 1SQ4A 3VBFB 4E4HA 3HBZA 5FYUA 1OMIA 4LHLA 1AR72 1RXFA 1W0PA 2RS33 2CTVA 4YG0A 1AR81 2V73A 2JDPA 2WN2A 4LIVA 1PGW1 4CU9A 1PO13 3WLUA 3SEEA 2OT7A 1ULGA 4JKKA 3QH6A 3WG3A 3KVAA 1U5IA 2JIJA 2VY0A 1U5YA 4DRVA 5A1LA 3UKNA 3WNPA 4P9WA 4LOTA 1D2QA 4F83A 5FBZA 5ABJB 5DAQA 5CAZA 1V6KA 2BGOA 3OB8A 1OQDA 4CDWB 5DXDA 5JSRA 2Y0OA 1NA1B 4GH4B 3UT0A 2BV4A 2XBO1 4HKOA 2VXRA 3B3QE 1S2BA 1LJ7A 2VBBA 1R083 4P5HA 3ZOIA 5CFCA 2UY9A 4MADA 2RS31 4BISA 3AM2A 3I2FA 2DDUA 1JHNA 1TNRA 3PU3A 1UZ0A 3JUUA 3R0RA 2WS93 5F32A 1GP6A 4MGKE 1QU0A 1HB3A 4GAZA 4BXFA 5GZDA 2VUAA 5LZ6A 4H3WA 1SDWA 2QTWB 1GQHA 4ISQA 2J1UA 1SACA 3LOIA 4C8DA 4IV3B 1UW8A 5CADA 5LWBA 2Y38A 3NAPB 2BYVE 1ZZ9A 5HV0A 1W6OA 1GNZA 4Q4V2 3WY6A 2OKXA 4YFZA 2PAMA 3UJOA 2GC0A 4IE0A 2QQMA 3K4AA 1LHVA 2D5HA 3MYXA 1AF9A 1ONAA 3VBFC 2DV9A 3PUQA 5FY0A 1VBC2 1AR62 4NIDA 4X8PA 3BPSA 4Z07A 3WT3A 2VM9A 4CEWA 1K12A 4MGSA 1GWMA 3WNOA 4JCKA 1RMU3 1NT0A 1RUF2 3FLTA 3LPFA 4IESA 4V1PA 5DMYA 1POV1 2UWBA 5DAVA 2D40A 2DU1A 2WFF3 5C8CC 5KC6A 2Q4SA 4ZPIA 1Y43B 2YUEA 1LGBA 3VBHB 4Q4X1 3GBFA 3WXPA 3WDWA 4ISRA 1EYBA 4XUNA 4DZGA 5L7OB 2WO2A 3I2HA 1AYN2 2RHPA 4QPGB 3T0AA 5GLUA 3N3HA 5L9BA
chains in the Genus database with same CATH topology
1X50A 4JGZA 1Q8QA 2NMOA 3ZFEB 4FPGA 1PGL2 4EN6B 1URXA 2P3IA 4XF3A 4CDQB 2BW8A 4AVBA 2DCKA 2R6QA 3MZHA 4CDQC 2JKBA 1ND3A 2R062 1ENQA 4MUVA 2YHJA 1ZVFA 3RWNA 4ASMB 4FOYA 4XFIA 3VBSB 1NXD1 4OI4A 4ASLA 2HYKA 1CGPA 3MI8A 5AC91 1YCIA 3VDDA 3JD72 2A6WA 3J26N 4FT8A 1CESA 5DG1A 2R041 3ZXGA 3A0NA 4N9IA 1AYM3 3GZAA 2ZX3A 3ZSLA 2DCZA 3RZZA 3TWIA 2EXJA 1V70A 3DN7A 1BZWA 2ZHKA 2ZX2A 2QDNA 1UKGA 4N9HA 1VRH1 3JQXA 1HQNA 2DCTA 1REFA 3RJ2X 1R1A3 2K2SA 1VIWB 5EYXA 1DQ5A 1GKBA 2VNGA 2WQZC 1JXNA 5A33B 4PIXA 5IK7A 1DG6A 1R081 2VVFA 4HN1A 5L73A 4LBMA 1VRH2 5C8WA 5AFEA 4B29A 2D3RA 5KWRA 3INAA 1ND3C 2UYAA 1RUH3 3ZIXA 1GNHA 1MQTA 3E6BA 3D0JA 4BLJA 2DWRA 4Q4V1 1EAH2 5A3LA 1XXNA 5GLTA 2PN5A 4I09A 2WLQA 2DFBA 2ES3A 3KCXA 5JCTA 4MSVA 1TME3 1VB4A 4C0HA 5BNNA 2HWC3 4I30A 1TMF3 1IS6A 2RE9A 4URTA 1QQP3 2A3WA 3SXWA 4BWOA 4GA9A 2XVGA 4N7UA 3H7YA 3VV1A 1CAUA 4HETA 1QKQA 2C0ZA 4K8FA 2GH8A 3QH7A 4HBNA 2ILMA 2VMGA 2OA2A 2R0FA 2XLGA 4XFBA 3MLJA 3PVBB 3AFKA 4IEXA 3RMXA 5C9AA 1F5JA 3CLPA 4LBNA 1GV9A 1NLSA 1VALA 1XU2A 2BEOA 4LO5B 1J59A 1W6OB 3AMHA 4G9SB 2WT2A 1VRH3 4KL1A 1AVBA 2AREA 1ASJ1 2O8QA 2B42B 2XVLA 3G6JB 3T2TA 3WP5A 2ZMKA 3BOWA 4GMP0 2GALA 4CEWB 3ZFGB 5T55A 3ZPYA 3DV8A 1AYM1 3MPBA 1ASJ2 2B7YA 2DVDA 1PVC2 4CDUB 1ND2A 4Q0QA 1C8M1 4YVWA 4CEYA 3LA2A 1NG0A 3KMHA 1W6QA 3GYDA 3WP6A 3KCYA 4P9IA 2R1BA 3B02A 3RYKA 3AZYA 4IEYA 4HPKA 5AC92 1PK6A 1XNBA 4LTAA 2ZAAA 1BBT3 4AGVA 1ULCA 3TOJA 4ZXKA 5FTTC 4CP2A 3U4XA 2AR6A 3ATGA 3BALA 3UKTA 4XHBA 1GICA 2IXKA 4FQ4A 4ZU7A 4FPJA 4JTOA 4DOUA 1H9PA 2VVEA 4QPIB 4RS5B 1EAH1 2EA7A 4D94A 1S2KA 2QFEA 4Y20B 4FPCA 1BEV2 2BNOA 2XKPA 2W52A 2EAKA 1RHI1 3P3NA 5JDBA 4UW3A 4Y1XA 2EALA 2P37A 2PHFA 4XEZA 1U5ZA 1VBB2 1SLCA 3AMMA 5TSWA 3WP4A 5DUVA 4E2QA 3E6DA 3URFA 4OLLA 1C5HA 1OSGA 2PHLA 3THTA 2GN7A 1KFUL 4XJZA 5JOXA 4B7KA 2IXHA 1QY4A 3LB9A 4XBLA 4D69A 1DYPA 1GANA 1S0GA 5CBLA 3ZSMA 4Q8LA 4Q0PA 3M2MA 2EXHA 4B4PA 3WW2A 1IZ3A 1NYWA 3DPRA 5D8AA 4KWLA 5DZGA 4E4ZA 3AYDA 4PQ9A 1LOFA 2RMU1 4FTSA 4TZDA 3D0SA 1BKZA 3E5XA 3GHNA 4I01A 1ZX5A 2EIGA 3TYJA 5C33A 2RJKA 1PZ7A 5EJ3A 4AE2A 1QDOA 4LUMA 5L19A 1YNAA 1LULA 4CEWC 1H4HA 3AZXA 1BVP1 4IL7A 1TME1 1VR3A 3WP3A 1FOD2 1H2LA 4WM8C 2I2SA 3VHOA 3K51A 4IETA 2VNRA 3BB6A 3ZFEC 5C9AB 1HRV1 1YI7A 4AFCA 2OW4A 3M8LA 3ACLA 2BFUS 1PIV2 4YW2A 3V0AB 1ALYA 4LEJA 1H30A 3AP5A 2JG8B 4Q4Y1 5ABJA 5HCAA 1T6GC 2A6VA 3CO2A 2XJUA 5GJ6A 2GAUA 1NA1A 4LUKA 4XFHA 4OFGA 2JEMA 2P3KA 4M0NA 4MX3A 1UU5A 2WWSA 5E88A 1LGNA 4YZ2A 4A7YA 3ZSJA 1DQ1A 1BEV3 2R043 5EFUA 4OUSA 2CGNA 2R49A 4EWDA 1RUD3 1SBFA 2IXIA 1SLAA 3USUA 1UN1A 4LR4A 1G86A 3AJZA 5LRRA 2E6VA 2RS12 4SLIA 3LA3A 2HWB1 4L8QA 4JQRA 1D2SA 1REDA 2KA3A 1LHUA 3ENRA 1JTZX 4PLOA 3B94A 3MIHA 2QJVA 1FYUA 1OFNA 4AK3A 4YLZA 3ZYPA 2XL9A 2D43A 4GKXA 3JU9A 3AYEA 3GZUC 3KT1A 2PHDA 4JV4A 4XMIA 4Y20A 4F8AA 2D3PA 1PO22 3WVJA 2VH9A 4N53A 5JI9A 2DCJA 3H50A 5C8CB 1O3QA 1N1SA 2QCSB 2XLAA 2HWB3 1UU4A 1LOGA 4AI1A 5I0UA 4N43B 2X53S 4QPGA 3VBUA 5J48A 3WDYA 1V6MA 2NYYA 3ZFEA 3ZYGA 1AR82 2PYTA 2JXAA 3T1MA 4Q8KA 1VBA1 1LESA 2D97A 5CG9A 2XGXA 1ZYBA 4GB31 4NR1A 2CWSA 2R30A 1S1AA 1RUD1 4O9GA 5EYYA 1FNZA 1LTEA 2HEVF 1OPMA 1KS5A 2HWD2 4GH4C 3ZN5A 1LU2A 1Y3TA 2C9AA 1O91A 2BVVA 4CDXA 4GALA 3R4DB 2VOKA 3SNMA 4DMIA 5FFOC 2UU8A 3J8F2 4OHXA 1G9FA 5C4WB 2AYHA 1V6IA 5KXEA 5BNPA 2DTWA 5IUQA 4AFDA 2PLV2 4R9DA 4LBJA 2ARBA 4UBHA 2D6PA 1COV3 3VBHC 2OZ6A 2CWMA 4LO6B 2O8OA 2SBAA 1R1ZA 1BCXA 2WFPA 1MACA 1AJOA 5FDBA 2WT0A 1OLQA 2R0HA 3B7MA 3B93A 2Z79A 1UL9A 2XWJB 4X6RB 1WLTA 3FJSA 2OYZA 3V0BA 4W6XA 1F8VA 3KLSA 3BIWE 4XTPA 4UW6A 2G9GA 4XTMA 3NAPC 1W2UA 1FPN1 1QJZA 3RSJA 1VJ2A 4GMP3 2ZMLA 2A70A 2P2KA 3R4UA 4LBLA 3OJBA 3M3QA 4KQ7A 2W08A 2NP0A 4K20A 5SV8A 4MXVA 3SHRA 4GQ7A 3W59A 2PQQA 2Q1MA 4P9GA 1B35A 1WW5A 4PCRA 3N7KA 2B39A 1G6NA 1GQGA 3ZSKA 1KITA 4EROA 4P14A 2ET1A 2E9QA 4AQSA 1CR7A 2QE3A 4HKLA 1S0DA 2D6LX 1ZA4A 4H14A 1CAUB 5J3UA 1ZBA2 1WMDA 1AL23 3USUB 2VMHA 2ZHMA 1PMIA 5C6CA 5D1IA 2JDZA 1IPKA 3H8UA 2E51A 4YYOA 5FLJA 4K21A 3JBG3 3SMHA 1ZBA1 1D4M3 3AMPA 1PO12 3RJRA 4RHV3 5CFDB 1DZQA 1YO8A 3M1HA 1RUF3 2CNAA 2VPVA 2ZBJA 2TEPA 2MEV2 4N53C 1XQNA 3KGLA 1FNYA 1AXKA 2P3JA 4HL0A 4N53B 4X6QB 5BNOA 2RR13 2WSVA 5FO8B 2D6OX 5DUWA 5KXCA 1GLHA 3TAYA 3ZXFA 4CEYB 1CJPA 3VBUB 1WCDJ 4BYYA 1A8MA 4L11A 4I2OA 5FMOL 2JE7A 4K7JA 2Q5TA 5JSPA 3AJYA 5J98B 1LECA 1WD3A 2PHWA 3O0WA 1HIXA 4XDQA 1HV0A 3OGGA 5HCBA 4YNIA 4YZ5A 1B09A 1PK6C 3KD4A 2DVFA 4COWA 3TN91 2XJQA 1J1LA 4E4SA 4JRLA 1XYPA 3IKWA 3OTFA 2PLV1 4AYUA 1VBB3 3ELNA 4R9BA 5LRSA 3ZFGC 1VB2A 1WLCA 1OA4A 5BNPC 1MEC2 1VBE2 3KM5A 3KT4A 4K3UA 4IV1C 5A32A 1Q8OA 2IXLA 4FXKB 3KSCA 1DYKA 3RI8A 4XF1A 3ZFFA 5KBFA 1POV3 1VBE1 1MVEA 3E97A 1QXRA 2DFCA 1RITA 1Z78A 5EXOA 3AB0A 4N7IA 1C1FA 1NCRB 5HBAA 1LEDA 3B01A 3I8TA 4N43C 5GM0A 2P34A 1IQAA 1MS5A 2IFWA 3VKNA 5IK8A 5JSOA 4BZ4A 3OBTA 2NQYA 2A6YA 1YFYA 4QGLA 3H1YA 1Y9QA 2R063 4DB5A 1RUC1 1WUVA 4MGYE 1UPIA 4XHXA 2ZGPA 2ZX1A 1O5UA 1PIV3 1TEIA 4BE3A 2JD4A 5JIUA 1HX6A 4KWJA 5K0UA 4AEDA 3FX3A 1TME2 1KRIA 5C4WC 2ZHNA 4JGYB 3QACA 2R1DA 1V6LA 2WIIB 1N1YA 2PHRA 4LO4B 3LSDA 3MLKA 5GZGA 2OUHA 1FV2A 1DHKB 4AEDC 2Y26A 4DINB 2C5DA 1LGCA 3DGTA 4OHWA 4YRDA 1ZRDA 4M0HA 1RUC3 4IEOA 2XJVA 1O3SA 1VAVA 1X33A 1LOFC 4ORFA 2ZGUA 2ARXA 2QDRA 3QBQA 2MEV1 1UAIA 2W68A 5CA6A 4Q2FA 2RM22 3RI9A 3T1LA 2GNTA 4S2HA 4A3XA 5JAXA 4K6BA 3FWEA 1K5MA 1QJX3 4FQZA 3IN9A 4WVZA 2GMMA 3RS6A 5E89A 2GZWA 4Q29A 3B69A 1RUE2 2ZHLA 3ZXKA 2D5FA 3ETQA 3ZYIB 3VHPA 4HZFA 4INDA 3ZFFC 3OY8A 1A8DA 4YGDA 4Y1ZA 3JZVA 4WVMA 1EAH3 3MF6A 3FE5A 2TUNA 2WNVA 5LK7B 1PHMA 3RNSA 5T5JA 1ULDA 2CV6A 5FRAA 4D7SA 3JD71 4XQWA 1HV1A 4QX5A 1ZZ8A 2D6KA 2Y0IA 1V9U1 1XRUA 1VBB1 3ZYJB 3I54A 1EV13 3OCPA 4JTNA 5H9RA 1V00A 2ZMNA 2XPJA 4MGZE 3WOGA 2WS92 4PF5A 4BIOA 3FLRA 2EAAA 3THPA 1C8M3 1EPZA 1HRV2 2LUWA 1LB2A 2D6NA 4OUMA 3MIEA 1YXWA 4BOWA 3AYAA 2NLRA 2W39A 5C8CA 1AL21 4R52A 4XYXA 3FC0A 1OKQA 4RD7A 3PMSA 1IKPA 5T50A 1W39A 3KT7A 4Y26A 4PIYA 1ULFA 1X8EA 2A7AA 1MZEA 3FBMA 3ILFA 2XJPA 2W0XA 4FSJA 3NVCA 1U12A 4B3NA 4IV1A 4AFMA 2FMYA 3N35A 2UURA 3AZVA 2WFF1 3S7IA 4AQTA 3AZWA 3IIAA 4HVQA 4LE4A 1RJ8A 5CFDC 1HRV3 2DU0A 1HRI3 1H8TB 2ATFA 4YGCA 1RGSA 4IEZA 2WKKA 4Y1UA 4M00A 1A3KA 2CYFA 5BNNC 2DF7A 3CJIB 2DVGA 2XWBB 1FMD1 4U2AA 3OYWA 4AEDB 2XH6A 3L2HA 3O5SA 1O3RA 1MZFA 1CAWB 4JGYA 1CX4A 1TE1B 4DXZA 3WZ1A 3FMGA 3LGRA 4EJRA 4TWTA 4HKWA 1WMEA 4CRQA 2XBO2 4HFSA 1RTVA 2PHUA 5SV5A 1KDMA 2XHKA 1Q8PA 3AYCA 3W58A 5F6LB 3WDTA 4BCUA 5IK5A 5J7MA 4UXAA 3BPZA 3TBDA 4AI3A 2VOVA 1XYOA 3MGUA 1JN2P 4B7EA 4FPEA 3BODA 3V64A 1QJU1 3WUCA 4QPIC 4RS5C 5JLVA 4HVOA 4YZ4A 3D8CA 1BXHA 1AYM2 1UIJA 2XJRA 2QUOA 1SMVA 4XW3A 1QXJA 2EVXA 4BM8A 1C8NA 3CJXA 3ILRA 1H1AA 1AL22 1BYHA 3OD4A 4O9EA 4NPRA 4ITCA 2FMDA 1DGLA 5GKAC 3HIFA 4P9LA 4OI0A 1RUG3 3I59A 3OGJA 1OQ1A 2ZKNA 1QJY3 4GIQA 2DURA 1O4TA 4BQ1A 4QD2A 2A5ZA 4I0BA 4CDXC 3D82A 2WSUA 4Q4W2 1S0FA 4K40A 4HANA 1IS4A 5F6KA 1OPOA 1WCKA 1QOTA 4RA0A 3SCGA 3J4UH 2Q1ZB 1HW5A 1S0JA 2H6CA 2RR11 5EV7A 4YW3A 4PBOA 1PO21 3MW3A 4NWWA 4Q0VA 2HWD3 2ZX0A 3OBRA 2JENA 4K1YA 3VBOB 1QF3A 1E57A 4LA3A 5E16A 1W6NB 2F4PA 3VZLA 3VBRB 3WNXA 1Z7S3 1RHI3 1SFNA 1M4WA 3AP9A 5T5OA 1JOJA 3MLLA 4Q1PA 2HWC2 2R073 1V9U3 2VOWA 1X8MA 2YC0A 4NWVA 1W6MA 4IEPA 2YGMA 1G8WA 2YDEA 1FATA 2WL1A 1WCSA 2A3XA 2LM3A 4RQPA 2ZA9A 1CN1A 4LBQB 2XJTA 3RDIA 4KH9A 1D0GA 2JX9A 3USSA 2DCYA 2EF6A 2K9ZA 4CDWA 2GMEA 4LULA 1YUDA 1QXPA 3NV4A 1POV0 4BMEA 1MS3A 4OI2A 4YVSA 2ZABA 3NV3A 1ZZCA 4COUA 2PFWA 2R042 1F9KA 3AMNA 1RHI2 1N1VA 5CNAA 3VBOC 4L2NA 4KU7A 3IMNA 1QGLA 2VNOA 4Y5Z0 2XKOA 4AVVA 4FPLA 3EJKA 4CDWC 1DGRN 2FZ2A 4Q4V3 2A6XA 5FQ0A 3B5LB 3MIDA 2A71A 4R9CA 3EO6A 4XJ9A 5JZGC 4GKYA 1LR5A 4WM7C 2WLPA 1SBDA 2XJSA 4IEQA 1RMU2 4IV3A 1IKQA 4YFWA 3NAPA 2RS11 2ZAHA 4FAGA 3VN4A 4Q4X2 3HMYA 1J58A 3R4SA 2CAVA 2ENRA 5I93A 2D44A 3ZIWA 2PAEA 3J8F3 1FAYA 3MEPA 4HN0A 4GWNA 4Q1RA 3CU7A 1DZTA 1L3JA 4KG0A 3W9AA 4YVSC 1UIKA 3UK9A 1OA3A 2RS52 4RR3B 3I59B 3ALQA 1QJY2 5GLZA 3RPQA 3VBSC 1QJU2 4FOQA 3VUOA 3ES4A 4DFSA 3O12A 2ZZJA 4G4FA 1W6PB 4Z8BA 4Q0UA 1YI9A 1C5IA 4C90A 4I0WB 2K0GA 1ZRCA 3NJZA 3ZVXA 3N7JA 1APNA 4IEUA 4CDQA 4EN9B 1VBA2 4XJ8A 5I8TA 3VBOA 1LEMA 3VBSA 4AVTA 3N36A 4Y1YA 5DUUA 4GB33 4OI1A 3ILNA 4SBVA 1C1LA 4WVMB 1BQPA 1NCQC 3CJIC 3H3UA 3VKMA 4RGGA 5DDJ1 1V6JA 4COYA 1O4YA 4AEMA 4XF0A 1QH6A 2XLFA 2ZPXA 1WGPA 1PGW2 1I1EA 1UKRA 5J96B 1W6MB 4FPOB 4P9JA 2OVUA 3AKTA 4I3PA 1C57A 5BNQA 1QNWA 1WW6A 3WHTA 3WQ1A 1UMZA 2I74A 4AI2A 2DVAA 2Z5WA 3KB5A 2B5HA 3IDEA 4GULA 2HWE2 4XFAA 1VBC1 5ABJC 4AHZA 2RS13 5I8YA 2E7TA 5KXDA 3RMYA 3JB4C 4A2UA 2VUJA 1RUI1 3AP6A 4MVTA 2PELA 4OHZA 4EV0A 1N3PA 2P17A 5KHJA 1I6XA 2D3SA 3K48A 2CGPA 1XNCA 5T3NA 4E9KA 4W65A 3S6PA 1KFXL 3LKJA 4NHMA 1ENXA 2VW0A 1F2NA 3N7LA 5DG2A 1I3HA 2GNDA 4HSJA 5BNNB 5DDJ2 4IV1B 4XBQA 4UW4A 2R061 3PVEA 1RUC2 5JI7A 1ENSA 4DS0A 1QJU3 4ZKTB 2GNMA 4AQ6A 4GH4A 4XQ4A 5FMOS 1DQ6A 4FOWA 4LO8A 4IERA 3ZXLA 1YFUA 2VMIA 1CVNA 4YZ3A 4S2FA 3CJIA 1ND2B 1DGWX 3H1WA 5T5PA 2DUPA 3FLPA 5K8SA 4DNYA 4XZPA 5DZEA 3L9JT 4Z2WA 4DQAA 1JW6A 3MIFA 1X7NA 2H0VA 1MEC3 1YJKA 3GALA 5L7OC 1XE7A 4NHKA 3VBUC 3LZZA 2VULA 2HEYF 3ZMNA 1ZRRA 4CDUA 1MS8A 5ACA3 4MZUA 1AR61 1IGOA 1AL0G 3AP7A 1CJDA 1DGWA 2HWE1 1OHFA 4PIZA 2WINB 4KG8A 1QH7A 2RMU3 4HK8A 3X29B 2NPIA 2HWF1 3S0MA 3LA7A 2GC2A 4JDOA 4HPKB 4PLMA 4ZU5A 1YFWA 1H2KA 4JDNA 1REEA 3LOBA 4LNVA 4DY3A 4KGGA 4CP0A 3NW4A 1AHSA 1X36A 4W6WA 1AX1A 1LOCA 1PZ9A 3P3PA 3QOPA 3WR0A 1ENRA 4JDMA 1WW4A 4L9BA 2BNNA 1H8TC 2EXKA 4HSLA 4Q4W3 4RFT0 4AGRA 1PVC3 1ULEA 1FT9A 4YM1A 3D5OA 4Y22A 2PLV3 3MW4A 1Q3EA 1BBT1 2XL7A 2IC1A 3L2YA 3U11A 5IT6A 1NE4A 1RUG1 5L7OA 1TQ5A 1CONA 1ND2C 4EN7B 2X5IB 4FAHA 4AHWA 3C2UA 1BBT2 5CFCC 4EWAA 1LHOA 4L92A 1IS3A 3U0ZA 1O5LA 1AR93 2RMU2 2QZ3A 3AMQA 1LHWA 2OPKA 4XJUA 2BUKA 4QQHA 3RYPA 1Z7S2 1PVC1 3ST7A 3TB0A 3MPPG 5T52A 1OA2A 3E5UA 1W6NA 2GN3A 1LOBA 2GDFA 3R05A 1Q43A 1AR71 2ZGNA 5FREA 1CPMA 3PNAA 2ZGTA 2HEWF 2XB6C 3ME2A 5KC5A 4JGYC 4RHV1 4BMBA 5GLWA 4S2GA 2JG9C 2FQPA 4J6GA 1ZBE3 3WHUA 5KHHA 1J1TA 4TLFA 1DBNA 1PIV1 2X5IC 3PHMA 4L97A 3V0AA 3DL3A 1IOAA 3WQ0A 1AUYA 1FPN3 4FOVA 3APBA 4RQPB 4YW4A 3UKVA 1V6NA 2JG8A 3TNPB 2D93A 3O0VA 4GWMA 1MQTB 5GALA 1HRI2 3WUDA 1FI2A 4AVSA 1PNGA 5A33A 1S0CA 1SEFA 2RR12 3WINE 4AGGA 4XXPA 2WQ4A 2ZGSA 1QNYA 2Q0AA 3PTYA