5BV6A

Pkg ii's carboxyl terminal cyclic nucleotide binding domain (cnb-b) in a complex with cgmp
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
150
structure length
150
Chain Sequence
b'TAQARDEQYRNFLRSVSLLKNLPEDKLTKIIDCLEVEYYDKGDYIIREGEEGSTFFILAKGKVKVTQSTEGHDQPQLIKTLQKGEYFGEKALISDDVRSANIIAEENDVACLVIDRETFNQTVGTFEELQKYLEGYVANLNRDDEKRHAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords cGMP-dependent protein kinase 2
molecule tags Transferase
source organism Homo sapiens
publication title Structural Basis of Cyclic Nucleotide Selectivity in cGMP-dependent Protein Kinase II.
pubmed doi rcsb
total genus 43
structure length 150
sequence length 150
ec nomenclature ec 2.7.11.12: cGMP-dependent protein kinase.
pdb deposition date 2015-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5bv6A00
3VHRA 3EO6A 3CO2A 4I2OA 5J7MA 5E1RA 1DZTA 3IDBB 1FXZA 1QWRA 4OLLA 3S7IA 1XE8A 2IXKA 1GQHA 5C6CA 4IEVA 5E16A 2GU9A 4MZUA 4UXAA 4WVZA 5EZWA 3MZHA 4K8FA 4ZU7A 4E2QA 2O1QA 5I0RA 2GH2A 1O5UA 4N9HA 1YHFA 2XKPA 2XLFA 3HQXA 2HKXA 4QXKA 4O9EA 2BEOA 4RD7A 2ZKLA 2XL9A 1LRHA 1PMIA 1YLLA 3WW3A 2CGPA 1WGPA 4EROA 3BCWA 5C8WA 1ZZBA 4KU7A 4HVRA 4YRDA 5JSRA 3H50A 2VQAA 2B5HA 3FFQA 4ZU5A 3ST7A 1NYWA 4JTNA 5FLJA 5FDBA 1EPZA 2B8MA 2Z2SB 3FWEA 3LOIA 1EY2A 1JUHA 1NXMA 2EAAA 1VP6A 4FAHA 1J58A 3PVBB 2Q4SA 1J3QA 4D7SA 3N4MA 2BNOA 2IXLA 3PNAA 1Y3TA 2D40A 1LR5A 1J59A 3I59B 3E5UA 4HVQA 3BALA 2IXCA 2VECA 4DINB 4Q0VA 5LRRA 3H8UA 4IESA 4IEUA 2CAVA 3IDCB 3D82A 3L2HA 1FT9A 2PHDA 5FLHA 4AVAA 2MHFA 4QGLA 2VPVA 3RYRA 3BU7A 3S7EA 1DGWA 1J3PA 1V70A 1NE4A 4LA3A 3D0JA 1H1IA 2GC2A 1O5LA 4L11A 2EVXA 2KXLA 4MV2A 2BGCA 2XKOA 4R52A 4YSFA 3I59A 3MYXA 4WZCA 4XFBA 4BYYA 3MPBA 3HT2A 1UW8A 4XFFA 4KWLA 5I0SA 1ZRDA 1ZZ6A 2WFPA 5JCTA 1DZRA 3S0MA 4AVCA 1VJ2A 1YFYA 4FAGA 5I0TA 2QNKA 3HT1A 4XF1A 1RGSA 4XF9A 2CV6A 5FQ0B 4OFGA 2D5HA 2V09A 3MDPA 3LA7A 1CAVB 3RPQA 3WW4A 4QM8A 5I0UA 4MH0E 1OD5A 1RUOA 2ETEA 3UKNA 1QXRA 1SQ4A 1ZX5A 2D5FA 3E6DA 4BHPA 3OD0A 4XFIA 2OYZA 4MGZE 2B9UA 3ES4A 3H3UA 4Q0UA 5KHKA 3KGZA 3NW4A 4NVPA 1CAWB 1Q3EA 1RC6A 3LZZA 1YWKA 2F4PA 4IEQA 1U12A 4XF4A 3U10A 5FPXA 4MUVA 2PTMA 4EWDA 1CAVA 3TNPB 3TNQA 4QX5A 1IPKA 4QMAA 4Q0QA 1ZZ9A 1OFNA 1O4TA 4META 2ET1A 3M70A 4PIYA 4UBHA 2H0VA 4HSLA 1Y9QA 3SCGA 1CX4A 1CAUB 5K8SA 4XFCA 3FE5A 2GC0A 1G6NA 3E5QA 3RZZA 5BXXA 4LA2A 4QGMA 4LUKA 2HJIA 3R6SA 1YFUA 4HLTA 3E6BA 2O8QA 3WW2A 2XLGA 3NVCA 4EV0A 2H6BA 5BPXA 1ZRRA 2XGXA 4I0BA 4XFGA 4F8AA 3H1YA 3ES1A 2UY9A 2CAUA 1YUDA 1ZNPA 3CEWA 2XHKA 3SHRA 3B02A 4IEYA 2MPFA 1NE6A 1CAXB 1TQ5A 4IEOA 4QM9A 3H7YA 4Z82A 1WA4A 5T3NA 4E2GA 1X8EA 3FHIB 4JVAA 4J1XA 2WC2A 2ET7A 5BV6A 1J1LA 5AVPA 3USSA 4HN1A 3DKWA 4ZU4A 1UPIA 3E97A 5KHIA 4IERA 1OMIA 5J3UA 4HVOA 2FQPA 5FLIA 2UYBA 3ELNA 4FBFA 3G7DA 2BNMA 1ZREA 4LLOA 3ZDSA 4PJYA 4YNIA 3NKTA 3UKTA 1X8MA 4HSJA 2Q0AA 4L2NA 1YFWA 3O14A 3QOPA 3DL3A 3NSTA 3SMHA 1PM7A 2IXIA 3H7JA 1O7FA 5JAXA 1I6XA 4BH9A 2P17A 3OGJA 4IEPA 4LEJA 2PQQA 3NJZA 3I7DA 5BUVA 2PAEA 1Q43A 3BB6A 1GQGA 3HIFA 3FJSA 4YARA 2UY8A 4AXOA 3SCHA 5D1IA 4H7LA 1XE7A 4QGNA 5HI0A 3WW1A 4XEZA 5KBFA 4I0AA 3CJXA 4ONUA 3LA3A 4CYDA 2EA7A 5FPZA 3RDIA 2IXJA 5I8TA 2I45A 1O3TA 4R8HA 2QVSB 4D7TA 4ORFA 3KSCA 3JZVA 4HN0A 4LULA 4XFAA 5FCCA 4GULA 4MGIE 4IEXA 1QXJA 1QY4A 4E2SA 5JSOA 3EHKA 2PHLA 3GYDA 4HMZA 5I8YA 3BPZA 3OCPA 2MNGA 2PA7A 3U0ZA 1LKNA 3GBFA 3OTFA 3FZ3A 1SFNA 2N7GA 5EFUA 2K9ZA 4A2UA 1EP0A 3FX3A 5LRSA 3KMHA 4I3PA 1L3JA 3CL1A 4I01A 4BIFA 2GC1A 2Z69A 1O3RA 3H1MA 3ACLA 5LEJA 3H9AA 2ZCWA 1RL3A 2XLAA 3IIAA 3LWCA 1H1MA 5LEKA 2K0GA 1ZZ7A 1ZVFA 1O3QA 3E6CC 3U11A 4Q0SA 4KWKA 5JR7B 4WBBA 4PIXA 4O9GA 4JTOA 5JSPA 3EQEA 3E5XA 1I5ZA 4EWEA 3KGLA 2PAMA 2UYAA 4XFHA 2QDRA 1CAXA 5I93A 4AVBA 1LB2A 4J1WA 1ZRFA 1CGPA 1UIKA 2GC3A 3LAGA 1UCXA 1UIJA 2PFWA 4PIZA 5BY5A 5I91A 1FI2A 2D93A 4UBGA 4JV4A 4HBNA 5F1RA 1EYBA 4TLFA 1CAUA 3H1WA 3DV8A 4YYOA 2XL7A 3UKVA 4Q29A 2PAKA 4KL1A 5I8SA 2E9QA 3RYPA 2QCSB 3CLPA 3SXWA 2GZWA 4Z07A 3M3IA 3ETQA 1CAWA 4Q0PA 3ROUA 1J3RA 2Q30A 5CU1A 5FQ0A 1ZRCA 3QACA 3IBMA 4LUMA 4MGKE 3I54A 2IXHA 2C0ZA 2BNNA 2DCTA 5J48A 4P9GA 5KHJA 3D0SA 5CVRA 1YFXA 1OI6A 4AQ2A 2QJVA 4F7ZA 4EWAA 3RNSA 3H3ZA 2Y0OA 3NL1A 4IETA 5KHHA 2OPKA 4N9IA 5CADA 4KU8A 1NZCA 3EJKA 1Q5OA 4I09A 4I02A 3LA2A 2GAUA 4FT8A 3EBRA 1VR3A 4X6RB 2OZJA 4X6QB 1X82A 1WLTA 1RTVA 3OF1A 4MGYE 5KHGA 1SEFA 1XRUA 2OA2A 4MX3A 2BYVE 3C3VA 1O3SA 1DGRA 2IC1A 3CF6E 4KWJA 2ATFA 1ZZCA 3IWZA 2Q1ZB 3KCCA 4HZFA 4XF3A 1HW5A 1IPJA 4B29A 1ZZ8A 4IEZA 3SCFA 1X7NA 3DN7A 2PYTA 4IEWA 4XETA 3RYKA 2H6CA 1UD1A 3PLQA 4AQ6A 2OZ6A 1RUNA 4LTAA 2FMYA 4XF0A
chains in the Genus database with same CATH superfamily
3C2UA 5GZEA 3ZIXA 5IT6A 1SDDB 2DU0A 4FPLA 2ENRA 2RM23 5A3PA 1VRH1 2X09A 2YC4A 3AP9A 1JI6A 1L7QA 4Y4YA 1ULEA 4R4XA 1H9PA 1XE8A 1APNA 1GQHA 2IXKA 1H8TC 1YIPA 4JGYA 4Y20B 5FXWA 5GLUA 1LHNA 3JBG2 1W05A 3OY8A 2DCZA 2DVFA 4IEVA 1W6MB 2Y0IA 1FOD3 3MZHA 5CB7A 2DV9A 4YVWB 4AGVA 4CDWC 2LW8A 3MIEA 4GXLA 5DG1A 3VKFC 4E2QA 1JOBA 1E5HA 3ITQA 4D6RA 2XLFA 3HQXA 5IFPA 1LGNA 1W2TA 4RSUA 1UYPA 1VB2A 2DVAA 4GWNA 4DO0A 3AC0A 3NWKA 3UV9A 4RD7A 2ZKLA 5L9RA 5D2AA 1LGCA 3AM2A 1LRHA 3ETPA 3NV2A 4IV3C 4SBVA 2E51A 3WW3A 4ATEA 1QJX1 3PIGA 4CEWA 2BV4A 1WGPA 4EROA 3LPGA 2B7YA 2C4XA 1R082 1MEC3 2WWJA 5FR3A 3OSDA 5C8WA 1BEV1 4BQ2A 5FZ0A 4ZHNA 1H2NA 2VQAA 2B5HA 4XPVA 4JGZC 3ST7A 4NIDA 2XXZA 1QHDA 4ZY9A 2CNAA 3HOBA 4HKLA 3WCRA 2UU8A 1JZ5A 2R0HA 1O91A 1C57A 3FWEA 2YC2A 5CFDC 5BNPA 4CCLA 1NXMA 1VP6A 4PF1A 3PVBB 3TWIA 2G1MA 2BNOA 2IXLA 5A7NA 5LA1A 5FZ8A 5IYYA 5DN2A 1EAH1 5L9VA 5JWPA 3MFAA 3URFA 4CDXC 4PBOA 1AYM2 1UY3A 3BALA 3GZUC 1S0EA 4Q0VA 4KH9A 2RVAA 1C1LA 3T0DA 3BOWA 3IDCB 4Q4V2 3G6JB 1LEDA 4QWNA 1ENRA 2ZA9A 5DZFA 4BDVB 3C7OA 5FLHA 2GMEA 4RQPC 1V9U3 3ACFA 2P37A 3VBRA 1S1AA 2MHFA 2JB8A 2QQIA 4IGOA 2VUJA 5CKMA 3U1XA 1BMV2 5J36A 4QGLA 4B1MA 1XJAA 2VPVA 1JZ3A 2R071 4MHUA 2VVEA 4D6SA 3P1IA 1LU1A 3QH7A 4Q4W2 4NIIA 5AC92 4RHV1 4YGCA 1U5XA 5JXIA 4FPGA 5JZGB 3N36A 5FO7B 3MIBA 3H0OA 1H1IA 2GC2A 1XU2A 4JAAA 3J4UH 4JQRA 1XC6A 4KBBA 4NWVA 4WZCA 4LITA 3HT2A 1FPN2 2NPIA 2WT0A 3U14A 4KWLA 5FBJA 3VDDC 1H30A 1W9WA 3ZXLA 4JCKA 5KWRA 5JCTA 3S0MA 2VTFA 4XIKA 2EXIA 4AVCA 2JG8B 5IW0A 3B94A 1YFYA 4Q1PA 2BP6A 4AK3A 5I0TA 1WLDA 2WFF1 3QLQA 1JYWA 5ABJC 2CWSA 5ERLA 2O0OA 1YQ5A 5EYYA 4PBPA 1RGSA 2HWF3 3MW2A 3UL2A 4HKOA 2R32A 1RUD2 3MDPA 2VL4A 3WQ7A 4NIHA 4I30A 5I0UA 5A3TA 1LOGA 2XJVA 3A22A 4CDWA 4XQ4A 4JGZB 1VBE2 4CCNA 1W2AX 2VUCA 2A75A 2VBBA 4ATFA 4BHPA 3I2JA 2R073 2VULA 3GJBA 3OD0A 1N1SA 3PURA 2YBSA 5JIUA 2RS51 1I1EA 3JD72 4FPJA 1JU4A 1DHKB 4NVPA 1W8NA 1AX0A 5KXDA 2E7QA 1Q3EA 5EYXA 3LZZA 4LHKA 4UI9L 4I0WB 2P4EA 3RQ0A 5JPNB 5KR7A 3AP5A 2WSVA 4XBLA 4AVTA 4WM8A 2X05A 1W6MA 5A1FA 4EWDA 2VNRA 3THTA 3IDAA 3HNBM 5FKCA 4LO6B 1DQ1A 4YVWC 3FN9A 4NO4A 1KGYA 4QX5A 1C4RA 3MV01 1VBA2 5F5CA 3VBRC 5HCBA 5JMCA 2MEV3 3PJYA 1ZZ9A 3M3QA 2A71A 1GZWB 4E4HA 1PNGA 2ET1A 3NJXA 4XACA 2H0VA 1AYN1 4DPNA 1VAKA 2Y60A 3BI3A 2VMCA 2GC0A 1SFPA 3RZZA 1D0GA 3WP4A 4IGQA 4UF0B 3KV9A 4LUKA 3W59A 2CGNA 4P9YA 2ZGKA 2QQVA 1YFUA 3SNMA 4AEMA 4JQTA 1VBC2 3O1UA 2V5YA 2O8QA 3WW2A 1HB4A 3J8F1 1UOBA 2V4VA 3THCA 2VVFA 4WVMA 2JD9A 4Q4W1 4EV0A 4CTEA 2BZDA 1MS4A 1ZRRA 1JW6A 1YQ6A 2XGXA 4KG0A 4Y3OA 4YM2A 2W0XA 4CUAA 2VCBA 1WWYA 5ANNA 5FY5A 1WMEA 4O7XA 4WV8A 1RMU2 2ZAAA 4NAOA 1BK0A 2UY9A 1IHMA 3HMYA 2GH8A 4HFSA 4QQPA 4ZXEA 3DKQA 1IKQA 1YRZA 2XHKA 3ILFA 1CJPA 5FTTC 1BK1A 1I5PA 5D21A 4IEYA 3LKJA 5IVJA 3F2ZA 1VALA 2AEZA 1BHGA 2ZX3A 3FC0A 5A3OA 5LK7B 1TQ5A 1JYNA 2Y33A 4CUGA 2BVBA 4Z82A 1WA4A 4NR1A 5FMDA 1W9YA 3MGUA 1SLLA 4U2AA 1XYOA 5DXDA 3U4SA 2WLQA 3ZDVA 4E8DA 3AXEA 5TSWA 2OUHA 4OULA 1QIQA 3ZYGA 1AR81 3C7FA 2ZMLA 3ENRA 4YPJA 3FHIB 2KR2A 3SQOA 3ZXGA 5K0UB 3PU3A 3O5SA 3Q8CA 5FY8A 4ES9A 5AVPA 1ND2A 3BTAA 4Q5OA 4CEWC 4QB1A 1RVF2 5A6YA 4F83A 1MQTA 2UURA 5HCFA 3HD8B 4KGGA 5T5JA 1AYN2 4N43B 2FQPA 1TNRA 1QJX2 4FBFA 1PGW2 4M3CB 2G4IA 3J8F3 3POWA 5FOBB 2EXKA 3NNJA 4D69A 4LLOA 4EYUA 3NKTA 4OUEA 5K8SA 4PHZA 1MVQA 4WM7A 3KF3A 4HSJA 4CCMA 2VUDA 1Z7S1 2DUOA 2GMPA 3NMBA 4CCEA 2VW2A 3HVDA 2VZUA 1UY0A 1KRIA 2C24A 5JAXA 3JCIA 4IUGA 1F8VA 1I6XA 1H6YA 4M3CA 4BH9A 1GV9A 2WO3A 3A0KA 5FZCA 4XDQA 4AF9A 2P3IA 2NZ9A 4FPEA 2R062 4N7UA 5FZMA 5C4WC 1IG0A 4NRQA 1W9FA 2PAEA 4QT6A 5DAWA 1OQDA 3T2OA 2ZACA 5A6QA 5A7PA 1SPPA 3WDWA 4YWAA 2XJTA 3DPRB 1REDA 4ZKTB 4JGZA 1DBNA 3FLPA 4R4ZA 1XE7A 2DFBA 2ZTNA 2W87A 1WKYA 5JI7A 2ZHKA 1S0CA 1PVC2 2RS32 1PGSA 2WABA 2ZJCA 4I0AA 3ON7A 5CAZA 3VZLA 1RXGA 1GZWA 2FBEA 2WRAA 3RDIA 1DGLA 1REEA 3KSCA 1VMJA 4QKBA 4FP2A 1NOVA 1NUKA 4HN0A 2JDHA 1SBDA 4OHVA 2PXJA 4PI0A 5C71A 3TN91 5GM0A 3ILRA 5FFOC 5FK7A 1GWKA 4Q4Y2 1YNAA 2DYCA 4WM8B 1FMD1 1W6OA 5C8CB 4A3ZA 1UZYA 2OPWA 3GYDA 3I8TA 4ARXA 2FD8A 2HYKA 1F15A 1O8SA 1W03A 4KI5M 1JZ4A 3K75B 2VZOA 3M4FA 3MPPG 1ND2C 1UU5A 2GN7A 2OUJA 2P2KA 2R061 3FZ3A 3IAPA 3OTFA 3VUOA 2QQUA 4W50A 2GNTA 4QX8A 3U37A 2WNEA 4EZHA 1OPMA 4AE2A 2DCJA 2WZR3 1S0JA 3IT8A 2XWBB 5EFUA 1RHI2 5LASA 4Z8BA 1F4HA 1L3JA 1OF3A 4I01A 2ORXA 5IVYA 1PM4A 4AG4A 2HWB3 1GZCA 1O3RA 1J84A 2D3PA 1W2OA 2RHPA 2E33A 4KQ7A 4CU6A 1RL3A 5FZ7A 2VW1A 4XBNA 1EAH3 2PELA 2WN3A 5FK8A 3M7AA 2Q8EA 3RJ2X 4NRPA 1IS3A 3NNFA 1CZSA 4GALA 3X29B 3MLJA 3NQHA 3MIDA 1EAH2 3JU9A 1EUTA 4Q0SA 1MS5A 2CU5A 3N7MA 4S2DA 1OVPA 2BWAA 3WINE 1LTEA 2C1FA 3KVAA 4BQYA 4O9GA 1NA1C 1FV3A 2WZR1 2VXJA 5JSPA 4XJUA 2P6HA 3E5XA 1AYM3 4UAPA 2ID4A 3KGLA 4LBQB 3NNMA 4GH4C 3S57A 2ZGUA 3O0XA 3D6EA 4PQQA 1JXNA 4RGAA 1QJY1 2YROA 5A3NA 3S5AA 3PHMA 3OBZA 4A6SA 2AYHA 5CFDA 1CGPA 1ULOA 1UIKA 2XWJB 3FFZA 4L8QA 2GC3A 5EJ3A 1TMF2 1UIJA 4LLFA 1SLAA 4RR3A 3WNOA 3ZXFA 1UZ0A 1RMU1 5BNPB 5GZCA 1VBC3 4PIZA 5FREA 4RS5C 4JKKA 2PMWB 2DVBA 2K2SA 5FYBA 3UGHA 4YZ1A 4YVSA 2E53A 3WOGA 1GLHA 2WNOA 4TLFA 1ODNA 2WYFA 2D97A 1OURA 1QEXA 3OOXA 4CVUA 1YXWA 1BJQA 1RUC3 1OXCA 3FUOA 3CBNA 1BMV1 1LAJA 5CFCA 4Q29A 1E5SA 1S2KA 2G9GA 5FZ6A 1LEMA 2QBXA 2PAKA 3WQBA 4KL1A 4NUBA 2WNUB 5HXVA 5AC91 5JOYA 3UESA 2C5DA 3RYPA 3SXWA 3GM8A 4YW5A 3WDTA 3VDBA 5CFDB 2WWSA 5F3IA 5GZFA 4K9SA 3ACIA 1CAWA 3KZ4C 4Q0PA 3W21A 1K5MC 4XXAA 4A7ZA 3VBFB 4XOGA 4GZ9A 2SLIA 1BEV3 4IE4A 1AR83 1ZRCA 4JKLA 4ARYA 3WUDA 2A3XA 3IBMA 4LUMA 3U07A 2QDNA 2C0ZA 2BNNA 1LODA 1Y7BA 3AMPA 3VBFA 1QJEA 1RUF3 2HWF2 2G9FA 2HWE1 4P9GA 4S2FA 3DGTA 1DG6A 4LBJA 3K46A 3WT3A 4AEDC 5DMYA 1W28A 4MG2A 4PLOA 1CQ9A 1OI6A 1PIV1 2WLPA 4AQ2A 1HRV3 4RFRB 4XABA 3W5MA 1M06G 3KB5A 1GQPA 1M4WA 1RUF2 4IETA 5KHHA 4K40A 1FYUA 3VD7A 1R091 4K3UA 5IK5A 1OC1A 1PZ9A 3TN93 4BQ1A 3I49A 2JDZA 1QOOA 1US3A 3IPVA 1QH6A 3KM5A 1HRV2 3ZVXA 1OKQA 1W2NA 2RDNA 1CESA 1R083 5BNOA 3WV6A 4C0BA 1A3KA 3LA2A 3SLIA 2ZOEB 3EBRA 1SFYA 1HDKA 2ZHLA 4YFWA 3B00A 3IAQA 5F3CA 1NXD1 3VHNA 4GJZA 4MGYE 2YU2A 1C1FA 1UXXX 3WR0A 2RM21 3CJIB 1LOFC 1W8UA 5JUVA 1V6LA 4FPFA 2E6VA 5GZDA 4YM0A 1ZBE1 3GCXA 1TME1 3POEA 2BYVE 2D3SA 2WO7A 3B01A 4JGYB 1UZZA 3BN6A 5SV5A 4OQ9A 1NT0A 2CYFA 2IC1A 2JDMA 5FZDA 3VZKA 5DPNA 4MLOA 2ATFA 1I3HA 1ZZCA 3KCCA 3POFA 5KC5A 1NLQA 1JOJA 3B7MA 3I97A 5IVVA 3O0VA 3JBG1 3M1HA 5HXMA 1Z7S2 1PIV2 4I3GA 3SCFA 2RV9A 4IEWA 5C8CA 1ULGA 2J1SA 1NY71 2TNFA 2VW0A 3R05A 4XETA 2WQZC 3WLUA 3RYKA 3HNMA 1H2KA 4B8EA 3WF1A 2FCVA 3AP7A 1UD1A 4CEWB 5IK4A 1ND3B 1AR63 1OUXA 4FFIA 4XF0A 5ACA2 4FPOB 5DDJ2 1AUYA 2ARBA 3EO6A 2HWD2 2WO1A 4FFFA 3V0AB 5J7MA 2NP0A 5IJRA 1V9U2 3IDBB 3RS6A 1SACA 3BIEA 3NAPA 4FVVA 4JHTA 5FP7A 1QWRA 5FXVA 4OLLA 2W1SA 3DF0A 2QQWA 5C6CA 2A6ZA 3IKWA 2VH9A 2VCMA 3T1LA 1OLQA 4D0QA 4CP2A 2L9LA 1GBGA 4K8FA 5CKQA 5FP4A 2ARXA 4MOAA 2E63A 5IAVA 3JXSA 1KDKA 3KV4A 3WUCA 5L19A 2VZTA 4AVVA 5H9SA 4QXKA 4QPIA 2DCYA 3OUIA 2BEOA 4V1PA 3VZMA 5HCAA 4JRLA 2GNBA 2XL9A 1YLLA 4LBNA 1ASJ2 1HB1A 2EALA 1BVVA 3S6PA 3WEZA 1GWMA 1GICA 5T5LA 1NQJA 4RN5A 4AI1A 2CGPA 3O12A 5LWBA 2VJXA 1V0AA 1NQDA 4XXPA 1UY2A 4NPLA 3WF2A 5C7GA 1ZZBA 1ASJ3 3VDAA 4YRDA 3AKTA 1UMZA 4EN9B 4K21A 1RVF3 3JB4C 3LGRA 5F6KA 1NCQC 3O7OA 3SKJE 4JTNA 3M2MA 5L36A 2RS13 3KV6A 1EPZA 3FHQA 3HR9A 2B8MA 1PO13 4QX7A 2Z2SB 4DXSA 5H9QA 2VZRA 2JX9A 1YEWA 3TEWA 5CFCC 2HEYF 1F2NA 1DQ4A 1GSLA 1OH3A 3MUY1 4L92A 4BLJA 5LBEA 4IV1A 3RMYA 1VIWB 2A6YA 2Y6JA 3JD73 1CONA 3LQCA 4N8MA 1Y3TA 2P34A 3ZSEA 1VRBA 2D40A 2WNUA 3VD5A 1LR5A 1OOPA 1W8OA 1J59A 4MVTA 5FZ3A 1TMF1 4QKDA 2WKKA 2DU1A 2IXCA 1REFA 4DINB 1W6PB 2B4KA 1PX3A 5LRRA 4CPBA 3VL8A 4IESA 2JECA 5LBFA 3LD8A 4ZONA 4FXKB 1GZ9A 1JMUB 3D82A 4HXCA 5FMOS 3L2HA 2OKXA 1FT9A 3O1PA 2J22A 5LY2A 3ZXKA 1O8PA 4AVAA 3T08A 5FYUA 1IQAA 3RRDA 2WZPP 3LIHA 1H8VA 1HB2A 3K3OA 4AFMA 5KXBA 4Y20A 5EXOA 2YG0A 3WXPA 3BU7A 5BNNB 1DGWA 1V70A 5FYZA 3AZXA 1NE4A 4AHXA 4QHBA 4ITCA 1PX4A 4XTMA 1HRI2 1A34A 2RS52 3C7HA 4OMDA 2JEMA 2XQXA 1RUD1 4FPYA 3ZIWA 4OI1A 2KXLA 2BGCA 3APBA 2XKOA 1CPNA 4YSFA 5C8CC 1H2MA 3I59A 3W58A 2BFUS 3AL5A 2AH2A 2R6QA 2RS53 3TYJA 1LU2A 2VMHA 4XFFA 1W6OB 2W3JA 1ZRDA 4PLMA 3ZKYA 1K5JA 3AJYA 4XVHA 1DZRA 2NM1A 3R4UA 1FOD2 4AEJA 4CDQB 4Z2WA 3VBUC 1NAEA 3C7EA 2QNKA 4LHNA 2DBNA 5F3GA 3WY6A 2WUHA 1V6IA 3KF5A 4XW3A 5FRAA 3AVSA 4CCKA 5IVFA 2XVKA 2TUNA 2VMIA 1N3PA 1AXKA 1C8M2 1KQRA 2CV6A 4R9DA 4XF9A 5FQ0B 3WP5A 5JZGC 1CAVB 3WW4A 2VUAA 1RHI3 2NYYA 4QM8A 3AL6A 3N9NA 4GA9A 2WT1A 5ACA1 1STMA 5FZ4A 3HBZA 5K9YA 3MIGA 1VBA1 1JYIA 1RUOA 3ZSKA 4QPYA 3WNMA 4JZRA 1SQ4A 1ZX5A 2D5FA 2VZ3A 3ECQA 4W8JA 2HWB2 3AKSA 2AACA 3MHZA 2O8OA 2ZGPA 3CHXA 4MGZE 3ES4A 4NN0A 2OYZA 4C0HA 1UOGA 5FIXA 1JYVA 4B1LA 3O1TA 3D4KA 1K3IA 2GDFA 3UJQA 1VRH3 5HPOA 3BTYA 4WM8C 1YWKA 1VBB1 2XVGA 4QX1A 1B35C 2F4PA 5L7OC 4IEQA 1U12A 4XF4A 3U10A 4MUVA 2RJKA 3MIHA 2MEV2 2PTMA 4HK9A 4XQWA 4XUPA 5FV3A 1CAVA 1MEC1 3UETA 3TNPB 3J8F2 3U78A 3H42B 4UFIA 1QDCA 1IPKA 4QMAA 2BFUL 3AMNA 4FPKA 2B39A 1MACA 1OFNA 2IUWA 3IZOA 4Y5Z0 4YW4A 3K4DA 4COUA 4Z2AA 1DDLA 3V0AA 5E89A 1LHWA 4PIYA 2JXAA 4UBHA 3OYWA 3VBHC 1ONAA 3ORJA 1Y9QA 4URAA 3HQUA 1CAUB 4GD4A 4XFCA 4Q4V3 4AGGA 1PZ8A 1U5ZA 2NN8A 4ZPIA 5C33A 1G6NA 4W4ZA 3HN1A 1QJZA 1W6NB 2RG4A 3MI8A 2BGPA 2WFF2 3B69A 4YM3A 2HJIA 3QBQA 5C5TA 1UZVA 4XJ9A 3R6SA 3VDCA 4MO3M 2XR4A 2ZMKA 3FUQA 4CEYA 2VMFA 3POSA 3ZXJA 3NVCA 4BWOA 3AZYA 3UGGA 1GZTA 1X9PA 3TAYA 3VDDA 2JDAA 5LY1A 4I0BA 4NHMA 4F8AA 4D8MA 4DUXA 3T0BA 2ZXQA 3ES1A 5FZLA 3RGBA 1JBCA 2WS92 4QPGA 4Y1UA 4PDWA 1BLZA 1DZQA 1N1VA 3B02A 3N9PA 1KITA 1QNYA 2Y6HA 1R1A2 3RFRA 4XMAA 2YDEA 3H7YA 4ZZ8A 1WW4A 5T3NA 4LKDA 3MV11 4B4PA 3RWNA 2HWC2 1W6PA 4PQ9A 4Q4Y3 2Q8CA 5JMOA 1WLWA 2YV8A 2ET7A 4Q8KA 4N7IA 1RUD3 1A78A 4OI4A 5FPUA 1AYN3 4ASMB 5DAQA 1W9TA 5HV0A 1QJX3 2R041 4ZU4A 4Y22A 4OHZA 4AR2A 3N9LA 1OMIA 3WNKA 5J3UA 1NG0A 1BYHA 2RS12 1RB8G 4A42A 2UYBA 2W92A 5FYHA 1T2XA 1DGWX 2P3YA 3P5BA 1S55A 5FYMA 5A70A 5EIYB 1LOCA 1N1YA 4R9AA 1QOSA 4CXWA 1FPN1 2B42B 2BNMA 4ZS3A 1ZREA 1Q8OA 4OYUA 4PCRA 4YNIA 5EHDA 1RUG1 5K4LA 3RZKA 2BU9A 2KA3A 3CZJA 3VBFC 1VBC1 4L2NA 1K45A 4TXWA 1UU6A 5FZGA 3DL3A 3LDRA 5CG9A 2RR11 2IXIA 1EV12 3LEMA 4YZ5A 3VZNA 2P17A 1UZWA 3UJOA 2V73A 5CG8A 2J1EA 1EV13 5FYYA 1PO21 4ISQA 2DTWA 2C9AA 2XJQA 3CDZB 4FTSA 5BUVA 3BB6A 1Q43A 2ZMNA 1JS9A 4YFZA 1ENXA 2Y26A 2E7AA 3OB8A 4LKSA 4LORA 2DUPA 5APAA 4LNVA 1PIV3 1R1A1 1JZ6A 1PVC3 2D43A 2EIDA 2RS33 5JIAA 3WG4A 1K5MA 4Z1VA 1OLME 3BTZA 2R0FA 2VQTA 5D1IA 1GP6A 4H7LA 5FUIA 1W39A 4B7EA 3MIFA 5KBFA 3KQRA 2QKDA 1YJKA 3B5LB 5A7OA 3WG2A 3I3MA 4AEDB 1POV0 1VAVA 1W3XA 4ONUA 2JD4A 2XVLA 4XAAA 1FATA 4CSWA 1XXNA 1W8TA 5FPZA 2PLV2 4P9LA 4R8HA 1VE0A 4V2WA 1KFXL 5IVBA 3ZYBA 3RZJA 3JZVA 4INDA 3VDDB 1PMHX 1KXGA 3L9JT 4KBZA 4FOVA 4LULA 4Y1YA 2XHNA 2UWCA 3USUA 1OOPC 3ATGA 2JB4A 4IV3A 4RGKA 4E2SA 4YG3A 2FDJA 3AZWA 4DZGA 1E5IA 4DMIA 4BXFA 3DXTA 4A7KA 5I8YA 2ZGTA 4K8RB 2LTNA 2MNGA 3KS7A 5LBCA 5BNOC 1QJU1 1UMHA 3AZVA 4QXBA 3T2QA 5FMCA 2XBO3 2W9XA 3RZMA 1H9WA 4NHXA 1H4HA 2WA3A 4H3WA 4P5HA 4FI9A 1EP0A 3AX4A 4UF0A 1S4CA 1S0FA 1H8TB 3PU8A 1LHOA 5LRSA 3FLRA 1HXS2 4M3CF 3KMHA 1MQTB 3BKZA 4QU2A 3CL1A 4L9BA 4Y1ZA 4OZOA 4ASLA 4COZA 2WAAA 1QJY3 2OT7A 2JWPA 2Z69A 2YXSA 1D2SA 3H1MA 3QH6A 3ACLA 3P3PA 5LEJA 1XOYA 2SBAA 3OUJA 1G9CA 3H9AA 4LBQA 2PLV1 2ZCWA 1AYM1 3GGLA 4L0PA 3IIAA 3LEGA 5DAXA 2VM9A 2ZGNA 3LWCA 5LEKA 1PO12 1W9SA 5IK8A 4AQTA 2J1VA 1OLMA 3OBAA 1ZZ7A 1VBD1 2D6PA 4URTA 5F32A 4GWMA 2QQPA 2XPJA 1W8FA 1ND2B 1DLLA 3ILNA 3LSEA 5FZOA 1ACCA 4KWUA 3U11A 4CP0A 1WUVA 4Q27A 5EJZB 1B35A 5L7OA 4KWKA 4YW3A 3WNPA 4NIGA 2E7TA 4JTOA 2EIEA 2HWC1 3NAPC 3EQEA 1UY4A 1I5ZA 1HQNA 4CEYB 4CP9A 5T52A 4DXTA 2IZWA 1R092 2WWUA 2X10A 2E31A 3OGSA 4XFHA 3ZSJA 4WVWA 2X5IC 3ZXAC 2WIIB 5I93A 1LB2A 1ZRFA 3JQXA 4AI2A 4PLNA 2VY0A 3SC7X 3LAGA 3PIJA 1UCXA 1XNAA 2PFWA 1RINA 2XG3A 1MS9A 1W8WA 1W06A 1QMJA 2HWD1 4WVVA 1LESA 5F5IA 3POBA 3Q8AA 1X50A 1FI2A 5DUUA 4UBGA 5EP9A 1KJRA 4MGSA 3WD5A 2CL2A 1DQ6A 3V64A 3DV8A 2WBKA 2ZGLA 2BBAA 2HWF1 2VMDA 3B9IA 3C8XA 1AX2A 3INAA 2WQ4A 2VMEA 3WF3A 1Y43B 4EQVA 1YJLA 2CWMA 1RUE3 4BB3A 1T6BX 4IXLA 4W6WA 1K12A 2ZX4A 1URXA 1C5HA 4HT1T 3RI9A 3POYA 4OCTA 4K6BA 4XDPA 1AR73 4DOUA 3VKMA 1AR82 4P9XA 1W99A 4E4ZA 1XYNA 3SEPA 5T50A 4KNCA 4QXCA 2ZHMA 1ZBE2 1UN1A 3LEIA 2ZGSA 4Y1VA 3NNLA 1J3RA 1U5YA 2A6WA 1ASJ1 2Q30A 4QB2A 1HX6A 2VOXA 4EN6B 4GJYA 3UT0A 4DUVA 3QACA 4JDOA 3WF4A 1L7RA 1NA1B 3POGA 1FNZA 1RUJ1 3O1MA 5LA0A 4BMEA 4NMIA 2VNGA 4QQLA 1SZBA 4GH4B 4XBQA 4XQDA 2VZVA 1IS6A 2YGMA 3T09A 1PGW1 3D0SA 4H2AA 4XJZA 5ANQA 1VB4A 3AYDA 1F4AA 1V6OA 4IL7A 3WQ1A 3I3DA 4QB6A 2KD7A 3MW4A 1F5FA 2OPKA 1AL0G 2B9VA 2ZGRA 5C9AC 1CD3G 5CADA 4KU8A 1G9FA 4IE5A 1BBT1 1NZCA 3EJKA 4RHV3 4RS5B 4MADA 1N1TA 2VC9A 4LQRA 4CCJA 3A21A 3FLTA 4JGYC 1NLSA 2VZ1A 3IIIA 3EYPA 2GAUA 3O1RA 1VRH2 5FZAA 5F2SA 3SH5A 2OW4A 1VR3A 4MGTA 5GLVA 4X6QB 4CUCA 1HLCA 2BPA2 2VBDA 2QTWB 4J25A 5FY9A 3AB0A 3NV3A 1GP5A 5KHGA 1XRUA 3I3EA 1W90A 2OA2A 4MX3A 5H9RA 2FMDA 2D6KA 4CU9A 2VMGA 2W91A 3R0RA 4MYEA 3CF6E 4CCOA 5A3MA 2X5IB 1XNKA 5BNQA 5IHRA 3CZUA 4DY5A 4HZFA 1LCLA 3VV1A 4XF3A 4OUMA 1HW5A 1LULA 2EXJA 1PVC1 2RS31 4B29A 2F17A 1ZZ8A 1N3OA 5EQUA 5H9PA 3DYPA 5F3EA 4BM8A 3DN7A 5JDBA 2PYTA 1RITA 4M0NA 4YW7A 5DABA 4AEKA 2HBUA 1KS4A 2H6CA 4UW4A 2P6CA 2I74A 1MS0A 2OZ6A 4RR3C 2NMOA 4W6YA 3SEEA 5AFEA 5IVEA 2FMYA 4QHOA 1W8ZA 1X9TA 1VMHA 4Z92B 3WVJA 3U4XA 3CO2A 1F31A 5K0UC 4I2OA 5A3LA 4YVSC 1NLRA 1CIYA 1DZTA 5E1RA 3ZO0B 3GZEA 2FDGA 1UOJA 1FXZA 2QQLA 3DCQA 2PHTA 1MQTC 3J7HA 1GU3A 2YB7A 4UW5A 3S7IA 4BQWA 1AXYA 3LE0A 2A7AA 2BTVC 3RWKX 1AXZA 1CPMA 1W3VA 2GU9A 2XQRA 3VBRB 4E9KA 2BOIA 4UXAA 4WVZA 3AFKA 5D8AC 1HRI3 4ZXKA 4XYXA 3ZFGC 1CWPA 4FQ4A 1FMD2 2O1QA 3HJRA 2EAKA 1O5UA 4LK6A 4NHYA 4BE3A 5J09A 4J6GA 2XKPA 3P3NA 1FX5A 2HKXA 2JKXA 3RMXA 5JPMB 2QFEA 5IK7A 1C8M1 1WA6X 1LENA 2ZX2A 1SHWB 4LO4B 5DDJ1 3ZXDA 2RS11 4ES8A 3ZYIB 2WINB 1PMIA 3ABZA 2JG8A 1HJGA 2BBVA 1ENSA 3VD9A 2JKBA 2XONA 2EXHA 1CR7A 3BCWA 2F6BA 3TRSB 1YQCA 5C3RA 4KU7A 2FCTA 3SISA 2DFCA 2RMU1 3H50A 1MVEA 3FFQA 2G19A 3CQOA 3KCXA 4Q1RA 1D2QA 4HG6B 1DU3D 2VQUA 1TG7A 5FLJA 2DTYA 4N43C 1MZEA 2DBIA 3PL0A 4CXYA 4LKEA 2FZ2A 3LOIA 1RXFA 1YQ8A 1AX1A 1JUHA 2LROA 3DPRC 4NPRA 5J37A 2BWCA 1OLRA 2EAAA 4YW2A 2DURA 4CDUB 1J58A 2WNUC 3CJIA 4KG8A 4TYSA 2HBTA 2Y6KA 4FAHA 2YU1A 4LE4A 1IZ3A 4LBOA 1WCDJ 2VE1A 4A3XA 5J1XA 4P9JA 5JXGA 1KS5A 1AR91 1GR3A 3I59B 1GOHA 2G9ZA 3E5UA 2J1UA 3QCWA 2RE9A 2DDUA 3K51A 4HVQA 1WMDA 1ZBA1 2VECA 2ZX0A 5FZBA 1C8NA 1OD3A 2P1BA 5SV8A 2HWE2 4IEUA 4D7YA 2CAVA 1XNCA 5A33A 3VHPA 4AAPA 2W1QA 4RL7A 1UOFA 4RGGA 1H0BA 4UYBA 1DYKA 5CBLA 3RZGA 4YZ4A 1SCSA 2BERA 3ZFEA 4DEQA 5KXEA 1QXPA 5JLVA 3UYJA 3JUUA 3MF6A 3NJVA 2Z42A 5FXXA 3T3YA 1NA1A 1YCIA 2VTXA 1XNDA 3D0JA 3PUAA 4FTBA 5KXCA 1ENQA 2WZ8A 1JU3A 3FL7A 2IFWA 2EVXA 2HLEA 1UYXA 3GZAA 2D6LX 1RUE2 4MV2A 1RMU3 2XDVA 4R52A 5CIRA 1ZA4A 5IATA 2QZ2A 1AR72 1QJFA 3LB9A 4AFBA 2XH6A 5FY4A 3LF7A 4M3CE 5FPLA 3VD3A 1UW8A 1XE0A 2A6VA 3FMGA 1ZZ6A 2WFPA 1R1ZA 3M3CA 3VBHB 3KCYA 4BU2A 5BYNA 1MEC2 4P00B 5FKBA 2ERFA 1XPWA 4FAGA 2WR9A 4LIVA 4CRQA 1GANA 3HT1A 3WDXA 2WYSA 1DQ5A 5T54A 1S2EA 4CDUC 4XF1A 3I3BA 1HB3A 4C8DA 4N53C 3BIWE 3NJYA 1UQXA 2RDQA 4COWA 4H14A 4X8PA 3RPQA 1RUE1 3HNYM 4MH0E 3P6BA 4NJ4A 1QJU2 1OD5A 2WDBA 1B35B 5L7OB 2ETEA 1MS1A 3UKNA 1QXRA 1HKDA 4NAMA 1RUF1 4XTPA 5C4WB 4ISRA 2CHHA 4BISA 4XFIA 3AFGA 1OQEA 2B9UA 2VR4A 3H3UA 3IMNA 3KGZA 2ORZA 3NW4A 4BQ4A 1A6CA 1HRV1 4FP3A 3RZHA 4WVMB 2JG9C 1RC6A 4UFHA 2JDPA 2Z4FA 4A6OA 4BLIA 3ZN5A 2ES3A 2QQJA 4TN7A 4DS0A 2CGOA 2RDSA 4QD2A 4CCDA 3ZMNA 1DQ2A 5DZEA 3NNGA 3K4ZA 2HH9A 4OZXA 1W04A 4P02B 4Q0QA 4HOOA 2WQ8A 3T1MA 1PHMA 1SLCA 5LA9A 2ZAHA 3HWJA 1O4TA 4K1YA 3VBUB 1GKBA 1Q8VA 2BDRA 4HSLA 4BCUA 3DUIA 3FE5A 5AVAA 2ADDA 3OD4A 2FHRA 5F9TA 2Y38A 3E5QA 1OA4A 2VCCA 4NRMA 5I0DA 3MLKA 3IMMA 2R30A 2VG9A 4LA2A 5BXXA 2J7MA 4QGMA 3ZR5A 4D6QA 4NHLA 1J83A 1LOFA 3KLSA 5FUNA 3WP6A 3RZLA 2J1RA 5IWFA 4DFSA 1WZXA 3PTYA 4XMIA 3PUQA 4HLTA 3E6BA 5A1LA 4TSVA 2WAOA 1SLTA 4N43A 3K2OA 4LE3A 4NROA 5E8AA 1JZ7A 4PT6A 4OI0A 2H6BA 5GLWA 1AR93 5LW9A 1AZDA 1POV3 2QZ3A 3KQ4B 5BNNC 3POIA 3VZJA 1QQP1 5A32A 3H1YA 3PUSA 3V56A 4A7YA 4COYA 4MXWB 4W6XA 5LK5A 3ZX7A 1YUDA 4HK8A 1AR92 4A41A 2RJ2A 2H0BA 1FMD3 1JTZX 2NQYA 5JI9A 5B2GB 3CKHA 2MPFA 4XC9A 3AMQA 4IDZA 3HEIA 4IEOA 2PQSA 2FCUA 2ZHNA 1G9AA 3BTXA 1VBE3 2ADEA 1ZM1A 4C91A 1D7PM 4E2GA 1UKRA 4EE2A 1D4M1 1OA3A 2WZR2 3PUHA 1RJ8A 1ULPA 3IPVB 5A3WA 2DWRA 2RR13 1PMJX 4BK5A 1X8EA 1ND3A 4JVAA 2WC2A 3HAGA 5BV6A 4D3WA 4YZ3A 5F37A 1RUG3 1SPPB 4QU1A 2PHWA 2F4LA 1SBEA 4RHV2 1R64A 1DLCA 1UPIA 5FWJA 1WW7A 1JHJA 2ZABA 1NCRA 3WF0A 3E97A 1W6QB 4OQ8A 4AYUA 2LALA 2QQKA 4CDXA 3AYAA 2X5IA 1JODA 4FPCA 3ELNA 4KMQA 5HBAA 2E26A 1BKZA 2J1AA 1LOBA 4XIOA 2R7EB 4DB5A 3H3LA 2ZEXA 1VMFA 4S2HA 3FBMA 1XSRA 3ZDSA 1EUUA 2XOMA 1GFF2 1QQP3 1IKPA 1YIFA 1YQ2A 2PHXA 4IGPA 5F39A 1X8MA 2JE9A 4DXRA 3O1VA 1VBB2 1ZRIA 1HJFA 3HPNA 3O14A 2EIGA 3NV4A 3ZFEB 4M01A 5FY0A 1PM7A 3H7JA 4Y5TA 1MZ5A 2ILMA 1YC61 1HXS1 3ZPOA 3KT7A 1WD3A 5HCHA 4HKWA 4IE7A 1VBB3 2Z79A 4NWWA 4QQOA 3OGJA 3LFIA 3PJQA 4QDQA 4UOJA 4OHWA 4LEJA 2QQMA 2PQQA 5FY7A 3I7DA 5FZ1A 1MS8A 5CZKA 3I2HA 1D4M3 3E1F1 3ZFGB 2JDKA 3HIFA 4B3NA 4JDMA 1IGOA 5C9AB 1WCKA 2A73B 2UY8A 4FFGA 3LSDA 5FZFA 4UFMA 4YG0A 2JJ6A 1JZ2A 2RJLA 1W6NA 4XHXA 1MZFA 4Y26A 5HI0A 3VKOA 1S0DA 3AJZA 4XEZA 1F35A 2A6XA 4AVSA 1TNFA 5ABJB 3CJXA 1NKGA 3LA3A 1FOD1 4G4FA 2OQ6A 2EA7A 1O3TA 2IXJA 4YLZA 2I45A 5JXJA 2J42A 5G04L 1S0GA 1S0IA 4GKYA 4QPGB 4YVSB 5FCCA 4GULA 4MGIE 4IEXA 4H55A 4OI2A 1QXJA 4EN7B 2VOKA 4Q4X1 5JSOA 3VBOA 3VLBB 2CDPA 2PHLA 5EJ1B 1WCUA 3I2FA 4RR3B 4HMZA 4Q2FA 5C3OA 3BPZA 3BPSA 3OCPA 1Q56A 2ZGMA 3GCWA 5FYCA 4B4RA 1RJ7A 1V6JA 1R1A3 1WD4A 2VZQA 5GJ6A 3T2TA 2VBPA 3LPFA 2X29A 5DUVA 4AFAA 3H8XA 3CNAA 5FO8B 2PN5A 1AL22 5FYVA 5LATA 4P9IA 4K7JA 4LBLA 4CP9B 5JZGA 1QOTA 2ZEWA 4YZ2A 1E57A 3FX3A 3ROUA 2VOVA 3OGVA 3OEAA 5B4XA 1O4YA 3MLLA 4OVEA 1S0BA 3WHTA 1AL23 4JX0A 1OVSA 3AP4A 2ARCA 4FFHA 2GC1A 3TN92 3C7GA 4BIFA 5FWEA 4IV1C 4FTEA 2JDUA 2QE3A 1XU1A 1DFQA 1UY1A 4LBMA 3I4IA 2Q8OA 3VBUA 3PTRB 3VBSB 1MR5A 4NPMA 2XLAA 2XJUA 3B93A 5B4NA 1R081 5GLTA 1H1MA 4E27A 5EWSA 2K0GA 4YGBA 2WJSA 3K77A 4M4PA 2P3JA 4K1ZA 1W0PA 1NX9A 3VBSA 1XQNA 4HANA 5C70A 3ALQA 4EN8B 5FMOL 5KC6A 3BOPA 1O6UA 3AKPA 4OHXA 1GOFA 3LOBA 4WBBA 3OPZA 2D3RA 5C3QA 4K20A 1UAIA 2D6NA 3ZSMA 3ASIA 4CDUA 3F95A 2W95A 4RYDA 4N53A 2PAMA 3K3NA 2P3KA 1COV1 2UYAA 1GOGA 3KVBA 3AMHA 4YGEA 4AEDA 2JENA 2QDRA 4NE9A 1CAXA 3UGFA 4Q4Y1 4XJAA 4AVBA 2W52A 4QPWA 5D8AA 3AMMA 5K7PA 5A7QA 1SG3A 4JDNA 3DPRA 1Y9GA 4LO5B 2VTXJ 4MXWA 2WL1A 4BA6A 4CPBD 2PHUA 4EN0A 5FYSA 4AZZA 5I91A 4IV3B 1OSGA 4ZZ5A 2JE7A 1RIRA 4JV4A 5FY1A 3NKGA 3ZYJB 4CA9A 3KV5A 1BZWA 4CDXB 3H1WA 1DF0A 1Y4WA 1OQ1A 3B3QE 4TWTA 4YYOA 1RUI2 3VBHA 3W9AA 5FP8A 1MZ6A 2PLV3 2W2IA 3KHBA 1HN1A 1V6NA 3FBYA 1F9KA 2VD7A 5I8SA 2E9QA 2HWD3 4B4QA 1VBD3 2DCKA 2B46X 2QCSB 3CLPA 2GZWA 1D0HA 2YC0A 2Y6GA 3J7NA 4Z07A 4CP1A 1IPSA 3M3IA 1TEIA 3ZFEC 4AFDA 2P5BA 1NY72 1UX7A 1CZVA 1XYPA 1DP0A 4GWIA 5L9BA 5FQ0A 5CU1A 1VBD2 4QPIB 4LOTA 4MGKE 1POQA 3I54A 1TME3 3AP6A 4GKXA 4Y33A 2WSUA 5J48A 1ODMA 2D44A 3N7LA 5F5AA 4E4DX 5KHJA 2A1XA 2D6OX 5FZHA 4UW6A 1ZA7A 2WS91 3Q8FA 1G8WA 2YFZA 1K5MB 1RYYA 1US2A 3MFCA 4PF5A 2YY1A 3JB8A 1YFXA 1VLNA 1TME2 2AGSA 2AUYA 4EWAA 4BJ0A 1HIXA 1RHI1 3T2PA 3KHCA 2Y0OA 3NL1A 2X8KA 1HV0A 4QHZA 2R042 2XBO1 3N9QA 4L97A 4N9IA 5GALA 3LDKA 4XUOA 1QJY2 4YW1A 3VD4A 2BGOA 1U0AA 4GMP3 3MBWA 4QXHA 5DAVA 5BNPC 3DECA 5DQ0A 4BXSV 1ST8A 1IG3A 3GHNA 1CZTA 4I09A 4FT8A 4YM1A 3ZFFC 2BQPA 4X6RB 2OZJA 3MUZ1 4JKMA 4XDOA 1X82A 1PO22 1WLTA 4FXGB 3MEPA 3OF1A 4A45A 2A3WA 5LB6A 1PGL1 3WG3A 4LO8A 3VKLA 2VVDA 5T5PA 3C3VA 1TMF3 1G9BA 2WNVB 2LUWA 2XJRA 1O3SA 3SH4A 4O61A 1UL9A 1WBLA 1YI9A 2Q1ZB 1ND3C 3M3EA 2BOJA 2Y64A 1IPJA 4IEZA 4DRRA 1DQ0A 4AI8A 3WDYA 4FOYA 4DXZA 3ZYPA 2OX0A 1X33A 3H8OA 2ZEZA 1PNFA 1GYKA 4Q4W3 5A80A 3PLQA 3VZOA 2JDNA 1RUNA 1UMIA 1HRI1 4GAZA 4QQHA 4CUBA 3ZSLA 3M8LA 4LHSA 3VHRA 4Q4X2 1NZIA 2CTVA 4Y4RA 1H2LA 2YPJA 1IS4A 2JIGA 5C3SA 2VAUA 3OBRA 1UNBA 3BYWA 1WBFA 5FAXA 3W5NA 3V65A 1Y9MA 1A8MA 5C5UA 3THDA 5JOXA 2HYXA 3CMGA 3EXUA 2RM22 1TVGA 4IV1B 1OBNA 5E16A 2OXBA 1KFUL 2AR6A 4MZUA 5EZWA 4BQ5A 3GZTB 5EV7A 4ZU7A 5I0RA 2GH2A 1JUIA 2K46A 2RMU3 4N9HA 1YHFA 1OH4A 2ZS6B 3S5QA 4AI9A 4EJRA 1XSQA 4Q8LA 4O9EA 1P8JA 1WCQA 2VOWA 2W5FA 1SBFA 2NMNA 3AKRA 3UNPA 1MPXA 3KT4A 4XILA 4QPGC 1JYXA 2W39A 3A0NA 3TEXA 5FYIA 2HWB1 3N9MA 1W8HA 2DF7A 4HVRA 2W94A 1N47A 1ZBA2 4HONA 5FZKA 5JSRA 3D8CA 4Y24A 4ZU5A 5IAXA 3THPA 5HV4A 1NYWA 1HV1A 1GMMA 1VPHA 2VO5A 3I2GA 1UXZA 5F5QA 5FDBA 3NAPB 2TEPA 1EY2A 4N53B 3IM0A 4AFCA 5J96B 1C28A 1CX1A 5E6HA 1BBT2 3ME2A 1PK6B 1CJDA 2WT2A 1QU0A 3MICA 2Q4SA 3VBOC 1J3QA 3MF9A 4D7SA 1UKGA 3N4MA 1N3QA 3EMRA 3VGIA 3PNAA 2WN2A 3J26N 3KT1A 2HWE3 2UWAA 4Y5SA 3V0BB 2C9KA 2Y6LA 5DG2A 3ZKUA 5JOWA 3U75A 3BU0A 2FDKA 4YG6A 3BUCA 4RS5A 2DVGA 1JYCA 4UW3A 3KD4A 2GN3A 1D4VB 2Y6FA 1W2UA 3H8UA 1JZ8A 4DEVA 5F7UA 1SLBA 2JG9B 4HL0A 1RUJ3 3SKVA 1V6MA 2PHDA 3LCPA 4A4AA 2A5ZA 5CA6A 1D4M2 3T4HB 1WCSA 3O0WA 1SLIA 5IFTA 3R4DB 2KM2A 3K4AA 4PI2A 4DUWA 5IUQA 4COVA 4CU7A 3RYRA 1VBE1 3M3OA 3TOJA 3S7EA 2JIJA 1J3PA 5CKNA 1AR62 3N7KA 2R1DA 4LA3A 5ACA3 1RVF1 2A3YA 2ZBJA 2YPDA 4RQPB 3A7QA 4XJWA 1NCQA 1O5LA 5J98B 4AW7A 4L11A 4H7MA 2PHFA 4XAEA 3NRUA 5FO9B 1V9U1 3MYXA 4Y1XA 5GLZA 4XFBA 1RUI1 4BYYA 4TZDA 2YFUA 2IFRA 3MPBA 3GF6A 2HEVF 3WG1A 3PVEA 3PVOA 5I0SA 3A23A 2LM3A 5T5OA 3AYEA 4E4SA 1DCSA 1SDWA 3ACHA 3AVRA 1VJ2A 1XBFA 3NO8A 1JHNA 2WO2A 2XMLA 2R1BA 3TBDA 3WHUA 4AHZA 1OFSA 2W08A 1L7LA 2ZGOA 5JVVA 1Q8SA 1WW5A 1UYZA 4NIAA 1LHVA 1DGRN 1TZOA 2W47A 1PK6C 2AENA 2WNVA 3MW3A 4HPKB 1QJU3 2WS93 4LXLA 4OFGA 2D5HA 2V09A 3B9CA 3LA7A 3I2KA 2YUEA 2D7FA 1CN1A 4XJ8A 1WMFA 3BODA 4C90A 4DY3A 4AAXA 2R043 4QKFA 2AZ5A 1O59A 1RUH3 2YGLA 3E6DA 5FZOB 5AFBA 1LOAA 2VZPA 3AK0A 3W20A 4UFKA 3DXUA 4Q0UA 5KHKA 1PO11 1CAWB 1ULFA 3OEBA 1RUH2 1RUG2 4A44A 2W68A 4AI3A 2BVVA 4M00A 1OOPB 2W1UA 2QQNA 1G7YA 5CYYA 2UWBA 4PDWC 5FPXA 1XB9A 2FDIA 3DYMA 1TE1B 1LOEA 2C26A 2J1TA 5FZ9A 2BRTA 2XJPA 4XURA 1FNYA 1PGL2 5FPBA 3TNQA 1UWWA 2VOTA 4SLIA 4QX2A 4ASKA 3KWVA 5L73A 2VU9A 1QQP2 2GP5A 4LO7A 2JE8A 4META 3M70A 4CDQC 1VAMA 4BOWA 4NHKA 1POV1 4RA0A 3SCGA 1CX4A 4C1WA 1C5IA 3R4SA 4FOWA 3Q8EA 3VHOA 5A6ZA 1AHSA 5E88A 4BQXA 2W46A 3GDBA 1QNWA 3HN3A 5LBBA 3ZN6A 2VCAA 1LHUA 1U5IA 3AXDA 3J9SA 4Q4X3 2ZKNA 3WX5A 3OY8B 5A7SA 4L99A 4TTGA 1JN2P 1LGBA 2XLGA 4BQ3A 3ZFFA 2RDRA 5BPXA 1GNHA 4CZSA 2DUQA 4XFGA 2GNMA 3WNNA 1RUI3 3VKNA 3JBG3 4QKNA 1V00A 2MEV1 2CAUA 4XCBA 4M4RA 1ZNPA 3DEMA 1YI7A 2ZPXA 3CEWA 3USUB 3WCSA 3N9OA 5A7WB 4GH4A 3SHRA 3ZXEA 4LHLA 5DUXA 3S30A 1NE6A 1CAXB 3ZR6A 3CJIC 1HQLA 4QM9A 3OGGA 2FDHA 2X53S 5A33B 1BXHA 1AL21 3EB7A 5FYTA 5CISA 2GSYA 1EPWA 2BW8A 4BMBA 2VNVA 5F8PA 2VNOA 1JYTA 2IVJA 5FJKA 1JH5A 5A7WA 2BUKA 2NLRA 1C8M3 4J1XA 4LT5A 1J1LA 2YZ4A 3USSA 4HN1A 2ZEYA 2W1WA 2EICA 3DKWA 4GMP1 4XHBA 3ZFGA 2XBO2 1A8DA 3T0AA 2IWGB 3D5OA 4V2VA 1K42A 5DUWA 4RFT0 4IERA 5KHIA 3GALA 4P08A 1COV3 4HVOA 4X8NA 2VZSA 4XZUG 3LIGA 3QD6A 1C3HA 2QUOA 4GB32 5FLIA 1GNZA 2AC1A 1GNYA 2YYOA 3IB3A 3OYWB 2FZ1A 5FBZA 4OUSA 3WNLA 5C3PA 3G7DA 4N90A 4RQPA 1BBT3 1KEXA 2R49A 5F2WA 5ABJA 3PVNA 1LNSA 4PJYA 5EPAA 3AZZA 1O4ZA 3GBGA 3JQWA 3UKTA 3N7JA 1Q8PA 4PDWB 2Q0AA 3ACGA 1WMXA 1H8TA 1YFWA 2HEWF 3QOPA 1E5RA 3NSTA 3SMHA 1O7FA 3HBKA 4G3YC 3ZPYA 3ZYFA 4UFLA 1SMVA 4W65A 3OJBA 5ISLA 1LJ7A 2WFF3 4BIOA 4IEPA 1J1TA 4FPHA 4GIQA 4P5YA 2D98A 3NJZA 2EIBA 4GMP0 1AR61 4UWDA 2GP3A 4D94A 1GQGA 3VN4A 4XUNA 4FSJA 2AREA 3WDUA 1RUC1 3FJSA 4YARA 4G9SB 1AJOA 1UX6A 2R063 5FOJB 1ULDA 1KD7A 4AXOA 3SCHA 4FCAA 4BZ4A 4P9WA 5AC93 1R093 4QGNA 5T55A 3WW1A 3PMSA 5LZ6A 1OA2A 1F5JA 5JXHA 3CU7A 4FO9A 3ZYHA 1Z0HA 3TB0A 3PDQA 4CYDA 5CFCB 3IN9A 4E8CA 4CU8A 1GUIA 1CVNA 4JHZA 4D7TA 2QVSB 5I8TA 4LMFA 4ORFA 2OIIA 3GNEA 4MSVA 3LEKA 2D6MA 2YBKA 1FPN3 4QAWA 4XZPA 4XFAA 3WSOA 3TEZA 1AR71 4Y22B 1H1AA 1QY4A 5FXZA 3ZM8A 2AEYA 2R16A 3N35A 2OVUA 5FP3A 3EHKA 3ZN6B 3N3HA 4C1XA 5G05L 3WP3A 1FAYA 2PA7A 2V5DA 3DYOA 5FPAA 3U0ZA 1LKNA 1FV2A 2RMU2 3GBFA 4KGQA 3SITA 1SFNA 3RG0A 5CEHA 5M0TA 1G9DA 3OG2A 4JC1A 4CDQA 1AF9A 1UF2C 1HQWA 1WLCA 2N7GA 5FP9A 2HWC3 4LPLA 2Q8DA 1GP4A 4HETA 4CXXA 2K9ZA 2RR12 4A2UA 1BQPA 1HN0A 1OT5A 1ZBE3 3OBTA 2WA4A 4I3PA 3OPTA 4YVWA 1W6QA 1ZYBA 3OGRA 4S2GA 4CDWB 4DNYA 3GHMA 2CSGA 5D8AB 2FDFA 3CIHA 4DQAA 3T4VA 2BJSA 2VXRA 1XNBA 1ZBA3 4YGDA 1IS5A 1WW6A 4QDSA 2CDOA 3Q8BA 2Q5TA 4R9BA 3UK9A 5LCWL 4OHYA 2JG8C 2JG9A 3LFMA 4OMCA 3OUHA 3ZOIA 3ZFFB 2I2SA 3Q9OA 1I9RA 3RSJA 1ZVFA 1YYNA 1O3QA 4MGQA 5CNAA 1H4GA 4AWDA 3ZN4A 2GNDA 1X36A 5JOZA 4AL9A 3O1SA 3RVHA 3E6CC 1V6KA 4B7KA 3V0BA 4CCCA 5JR7B 1DYPA 1BCXA 2DVDA 3POJA 1QH7A 1CIWA 1VBA3 4GWJA 4PIXA 2B45X 2XJSA 3J7LA 1ULCA 1PK6A 1ALYA 1BVP1 1OF4A 1QDOA 2A70A 2E32A 2WNVC 4NOTA 4EWEA 1B09A 1IOAA 1NCQB 1JOPA 3AKQA 1PO23 4IQPA 4JRAA 1Z7S3 2V72A 3ZLIA 2ZZQA 3I2OA 1PVXA 4J1WA 1RUJ2 5FMBA 1OPOA 3BGAA 4AGRA 2CY6A 4M0HA 2I07B 4QQ2A 4F3JA 2YBPA 2VQ0A 1NCRB 2Y34A 5A3UA 5C9AA 3LDBA 1IQDC 2WZEA 2YHJA 3AYCA 2JDYA 4GB31 1SCRA 4WM7C 5DDJ3 5BY5A 1GWLA 2D93A 2O14A 1H6XA 1UU4A 1OUSA 2ZX1A 4HBNA 4YW6A 5F1RA 1EYBA 1Z78A 4LKFA 4U36A 1CAUA 3WNXA 4LR4A 3J7MA 3WQ0A 2XL7A 1DYOA 3D3AA 3ZYRA 3UKVA 1QF3A 4IW3A 4QX0A 5A1AA 2ARAA 2PHRA 5C4WA 3VBOB 3I2IA 4UFJA 1AVBA 4QX3A 1EV11 3RI8A 5A6XA 4LK7A 4CE8A 2ZGQA 4LBQD 4R9CA 3ZMOA 5DZGA 3ETQA 3WZ1A 3O1OA 4LIUA 2LRPA 4O65A 1HXS3 1QKQA 4QPIC 3HQRA 4XUQA 5DAPA 3T30A 4WZFA 3I3QA 1UO9A 2XUMA 4HPKA 1OHFA 5FZEA 2GALA 2IXHA 1UPSA 5FUPA 2DCTA 3PMEA 4LJHA 5GZGA 1RUH1 4FQZA 2LS6A 1BEV2 4CEYC 1LECA 4P14A 3TEYA 4MHRA 5CVRA 4BPZA 2VGDA 2QJVA 4F7ZA 1Q8QA 4ZS2A 3RNSA 3H3ZA 4AHYA 4TLGA 3VB9A 4XCAA 1YO8A 1COV2 4XUTA 5GKAC 5K0UA 2EF6A 3A4UA 3JD71 4GB33 3SH3A 3RJRA 2R072 1QGLA 1Q5OA 2YMZA 5LA2A 4AI0A 3WDVA 4I02A 1T6GC 4IE6A 4MXVA 1AJKA 2OS2A 4EZ4A 5FJHA 2Q1FA 3I2DA 5JR2A 3VBSC 4DIQA 2V4AA 3GBWA 5FPVA 1RTVA 1OKOA 1S2BA 4AOCA 4WM7B 4BK4A 1SEFA 2OQ7A 1W0OA 3IDEA 1W0NA 5IVCA 1UYYA 4LOSA 1NCRC 4IE0A 5F6LB 1KJLA 3GJAA 3K48A 4ET7A 1DIWA 1PZ7A 4AHWA 5A32B 3BVCA 4Q4V1 1G86A 1DGRA 4Q26A 3VL9A 1XNTA 2Y8KA 4KWJA 4LBKA 1MS3A 1KDMA 2JICA 3IWZA 3H8RA 5BNOB 2XB6C 3MO4A 3OPWA 4XE9A 2TBVA 3L2YA 3NV1A 2GMMA 4FOQA 4DRVA 4QDRA 2C6SA 1X7NA 2Z5WA 2IVIB 4UT5A 1RUC2 2ZZJA 2XUEA 4AQSA 5BNNA 3FHAA 4AQ6A 2QQOA 4GQ7A 3GXUA 5FZIA 4LTAA 3PUIA 2Q1MA
chains in the Genus database with same CATH topology
3C2UA 5GZEA 3ZIXA 5IT6A 2DU0A 4FPLA 2ENRA 2RM23 1VRH1 3AP9A 4Y4YA 1ULEA 4R4XA 1H9PA 1XE8A 1APNA 1GQHA 2IXKA 1H8TC 1YIPA 4JGYA 4Y20B 5GLUA 1LHNA 3JBG2 3OY8A 2DCZA 2DVFA 4IEVA 1W6MB 2Y0IA 1FOD3 3MZHA 5CB7A 2DV9A 4YVWB 4AGVA 4CDWC 3MIEA 4GXLA 5DG1A 3VKFC 4E2QA 2XLFA 3HQXA 1LGNA 4RSUA 1VB2A 2DVAA 4GWNA 3NWKA 3UV9A 4RD7A 2ZKLA 1LGCA 3AM2A 1LRHA 3NV2A 4IV3C 4SBVA 3WW3A 2E51A 4ATEA 1QJX1 4CEWA 1WGPA 4EROA 2B7YA 1R082 1MEC3 5C8WA 1BEV1 1H2NA 2VQAA 2B5HA 4XPVA 4JGZC 3ST7A 3WCRA 1QHDA 2CNAA 4HKLA 2UU8A 2R0HA 1O91A 1C57A 3FWEA 5CFDC 5BNPA 1NXMA 1VP6A 3PVBB 3TWIA 2BNOA 2IXLA 1EAH1 5JWPA 3MFAA 3URFA 4CDXC 4PBOA 1AYM2 3BALA 3GZUC 1S0EA 4Q0VA 4KH9A 1C1LA 3BOWA 3IDCB 4Q4V2 3G6JB 1LEDA 1ENRA 2ZA9A 5DZFA 5FLHA 2GMEA 4RQPC 1V9U3 2P37A 3VBRA 1S1AA 2MHFA 2VUJA 1BMV2 5J36A 4QGLA 2VPVA 2R071 2VVEA 1LU1A 3QH7A 4Q4W2 5AC92 4RHV1 4YGCA 1U5XA 4FPGA 5JZGB 3N36A 5FO7B 3MIBA 3H0OA 1H1IA 2GC2A 1XU2A 4JAAA 3J4UH 4JQRA 4KBBA 4NWVA 4WZCA 3HT2A 1FPN2 2NPIA 2WT0A 4KWLA 3VDDC 1H30A 3ZXLA 4JCKA 5KWRA 5JCTA 3S0MA 4XIKA 2EXIA 4AVCA 2JG8B 3B94A 1YFYA 4Q1PA 4AK3A 5I0TA 1WLDA 2WFF1 3QLQA 5ABJC 2CWSA 2O0OA 5EYYA 4PBPA 1RGSA 2HWF3 3MW2A 3UL2A 4HKOA 2R32A 1RUD2 3MDPA 3WQ7A 4I30A 5I0UA 1LOGA 2XJVA 4CDWA 4XQ4A 4JGZB 1VBE2 2A75A 4ATFA 4BHPA 2R073 2VULA 3OD0A 1N1SA 5JIUA 1I1EA 2RS51 3JD72 4FPJA 1DHKB 4NVPA 1AX0A 5KXDA 2E7QA 1Q3EA 5EYXA 3LZZA 4LHKA 4I0WB 3RQ0A 5JPNB 3AP5A 2WSVA 4XBLA 4AVTA 4WM8A 1W6MA 4EWDA 2VNRA 3THTA 4LO6B 1DQ1A 4YVWC 4NO4A 4QX5A 3VBRC 1C4RA 1VBA2 5JMCA 5HCBA 2MEV3 3PJYA 1ZZ9A 3M3QA 2A71A 1GZWB 1PNGA 2ET1A 2H0VA 1AYN1 4DPNA 1VAKA 2GC0A 3RZZA 1D0GA 3WP4A 4LUKA 3W59A 2CGNA 4P9YA 2ZGKA 1YFUA 3SNMA 4AEMA 1VBC2 2V5YA 2O8QA 3WW2A 3J8F1 2VVFA 4WVMA 4EV0A 4Q4W1 4CTEA 1MS4A 1ZRRA 1JW6A 2XGXA 4KG0A 4YM2A 2W0XA 1WMEA 4WV8A 1RMU2 2ZAAA 2UY9A 3HMYA 1IHMA 4HFSA 2GH8A 4QQPA 1IKQA 1YRZA 2XHKA 3ILFA 1CJPA 5FTTC 1BK1A 4IEYA 3LKJA 1VALA 2ZX3A 3FC0A 5LK7B 1TQ5A 2BVBA 4Z82A 1WA4A 4NR1A 3MGUA 1SLLA 4U2AA 1XYOA 5DXDA 2WLQA 3AXEA 5TSWA 2OUHA 4OULA 3ZYGA 1AR81 3ENRA 2ZMLA 3ZXGA 5K0UB 3FHIB 3O5SA 4ES9A 5AVPA 1ND2A 3BTAA 4CEWC 1RVF2 4F83A 1MQTA 2UURA 5HCFA 3HD8B 4KGGA 5T5JA 1AYN2 4N43B 2FQPA 1TNRA 1QJX2 4FBFA 1PGW2 4M3CB 2G4IA 3J8F3 3POWA 5FOBB 2EXKA 4D69A 4LLOA 3NKTA 4WM7A 1MVQA 4HSJA 1Z7S1 2DUOA 2GMPA 2VW2A 1KRIA 5JAXA 3JCIA 1F8VA 1I6XA 4M3CA 4BH9A 1GV9A 3A0KA 4XDQA 4AF9A 2P3IA 2NZ9A 4FPEA 2R062 4N7UA 5C4WC 2PAEA 4QT6A 1OQDA 2ZACA 3WDWA 2XJTA 3DPRB 1REDA 4ZKTB 4JGZA 1DBNA 3FLPA 4R4ZA 1XE7A 2DFBA 2ZTNA 5JI7A 2ZHKA 1S0CA 1PVC2 2RS32 1PGSA 2ZJCA 4I0AA 5CAZA 3VZLA 1GZWA 2FBEA 3RDIA 1DGLA 1REEA 3KSCA 4FP2A 1NOVA 4HN0A 1SBDA 4OHVA 3TN91 5GM0A 3ILRA 5FFOC 4Q4Y2 1YNAA 2DYCA 4WM8B 1FMD1 1W6OA 5C8CB 1UZYA 3GYDA 3I8TA 2HYKA 3MPPG 3M4FA 4RHV3 3VDDA 1ND2C 1UU5A 2GN7A 2OUJA 2P2KA 2R061 3FZ3A 3OTFA 3VUOA 2GNTA 2WNEA 1OPMA 4AE2A 2DCJA 2WZR3 1S0JA 3IT8A 2XWBB 5EFUA 1RHI2 4Z8BA 1L3JA 4I01A 4AG4A 2HWB3 1GZCA 1O3RA 2D3PA 2RHPA 4KQ7A 1RL3A 2VW1A 4XBNA 1EAH3 2PELA 3M7AA 3RJ2X 1IS3A 3X29B 4GALA 3MLJA 3MIDA 1EAH2 3JU9A 4Q0SA 1MS5A 3N7MA 4S2DA 2BWAA 3WINE 1LTEA 2C1FA 4O9GA 1NA1C 1FV3A 2WZR1 5JSPA 4XJUA 3E5XA 1AYM3 4LBQB 3KGLA 4GH4C 2ZGUA 3O0XA 3D6EA 4RGAA 1JXNA 1QJY1 2YROA 3PHMA 2AYHA 5CFDA 1CGPA 1UIKA 2XWJB 3FFZA 4L8QA 2GC3A 5EJ3A 1TMF2 1UIJA 4LLFA 1SLAA 4RR3A 3ZXFA 1RMU1 5BNPB 5GZCA 1VBC3 4PIZA 5FREA 4RS5C 2DVBA 2K2SA 4YZ1A 4YVSA 2E53A 3WOGA 1GLHA 4TLFA 2D97A 1YXWA 1BJQA 1RUC3 3FUOA 1BMV1 5CFCA 4Q29A 1S2KA 2G9GA 1LEMA 2PAKA 5JOYA 4KL1A 5HXVA 2WNUB 5AC91 2C5DA 3RYPA 3SXWA 4YW5A 3WDTA 5CFDB 2WWSA 5GZFA 4K9SA 1CAWA 3KZ4C 4Q0PA 1K5MC 4XXAA 4A7ZA 3VBFB 4XOGA 2SLIA 1BEV3 1ZRCA 1AR83 3WUDA 2A3XA 3IBMA 4LUMA 3U07A 2QDNA 2C0ZA 2BNNA 1LODA 1Y7BA 3AMPA 3VBFA 1RUF3 2HWF2 2G9FA 2HWE1 4P9GA 4S2FA 3DGTA 1DG6A 4LBJA 3WT3A 4AEDC 4PLOA 1CQ9A 1OI6A 2WLPA 1PIV1 4AQ2A 1HRV3 1M06G 3KB5A 1M4WA 1RUF2 4IETA 5KHHA 4K40A 1FYUA 1R091 4K3UA 5IK5A 1PZ9A 3TN93 4BQ1A 2JDZA 1QOOA 3IPVA 1QH6A 3KM5A 1HRV2 3ZVXA 1OKQA 1CESA 1R083 5BNOA 3WV6A 4C0BA 1A3KA 3LA2A 3SLIA 2ZOEB 3EBRA 1SFYA 1HDKA 2ZHLA 4YFWA 3B00A 1NXD1 3VHNA 3WXPA 4MGYE 4COVA 1C1FA 3WR0A 2RM21 3CJIB 1LOFC 1V6LA 4FPFA 2E6VA 5GZDA 4YM0A 1ZBE1 1TME1 2BYVE 2D3SA 3B01A 4JGYB 1UZZA 5SV5A 2CYFA 2IC1A 3VZKA 4MLOA 2ATFA 1I3HA 1ZZCA 3KCCA 5KC5A 3B7MA 1JOJA 3O0VA 3JBG1 3M1HA 1Z7S2 1PIV2 4I3GA 3SCFA 5C8CA 4IEWA 1ULGA 2TNFA 1NY71 2VW0A 4XETA 3R05A 3WLUA 2WQZC 3RYKA 1H2KA 4B8EA 4CEWB 3AP7A 1UD1A 5IK4A 1ND3B 1AR63 4XF0A 5ACA2 4FPOB 5DDJ2 1AUYA 2ARBA 3EO6A 2HWD2 3V0AB 5J7MA 2NP0A 1V9U2 3IDBB 3RS6A 1SACA 3NAPA 4FVVA 1QWRA 4OLLA 3DF0A 5C6CA 2A6ZA 3IKWA 2VH9A 3T1LA 1OLQA 4CP2A 1GBGA 4K8FA 2ARXA 2E63A 1KDKA 3WUCA 5L19A 4AVVA 5H9SA 4QXKA 4QPIA 2DCYA 2BEOA 4V1PA 3VZMA 5HCAA 4JRLA 2GNBA 2XL9A 1YLLA 4LBNA 1ASJ2 2EALA 1BVVA 3S6PA 1GICA 5T5LA 1NQJA 4AI1A 2CGPA 3O12A 1NQDA 4XXPA 1ZZBA 1ASJ3 4YRDA 3AKTA 1UMZA 4EN9B 4K21A 1RVF3 3JB4C 3LGRA 5F6KA 1NCQC 3O7OA 4JTNA 3M2MA 5L36A 2RS13 1EPZA 3HR9A 2B8MA 1PO13 2Z2SB 5H9QA 2JX9A 5CFCC 2HEYF 1F2NA 1DQ4A 1GSLA 4BLJA 4L92A 4IV1A 3RMYA 1VIWB 2A6YA 3JD73 1CONA 1Y3TA 2P34A 3ZSEA 2WNUA 2D40A 1LR5A 1OOPA 1J59A 4MVTA 1TMF1 2WKKA 2DU1A 2IXCA 1REFA 4DINB 1W6PB 5LRRA 3VL8A 4IESA 2JECA 4FXKB 1GZ9A 3D82A 5FMOS 3L2HA 1FT9A 3ZXKA 4AVAA 1IQAA 3RRDA 2WZPP 1H8VA 4AFMA 5KXBA 4Y20A 5EXOA 3BU7A 5BNNB 1DGWA 1V70A 3AZXA 1NE4A 4AHXA 4QHBA 4ITCA 4XTMA 1HRI2 2RS52 2JEMA 1RUD1 4FPYA 3ZIWA 4OI1A 2KXLA 2BGCA 3APBA 2XKOA 1CPNA 4YSFA 5C8CC 1H2MA 3I59A 3W58A 2BFUS 2AH2A 2R6QA 2RS53 3TYJA 1LU2A 2VMHA 4XFFA 1W6OB 1ZRDA 4PLMA 3AJYA 1DZRA 2NM1A 3R4UA 1FOD2 4AEJA 4CDQB 4Z2WA 3VBUC 2QNKA 4LHNA 3WY6A 1V6IA 5FRAA 4XW3A 2XVKA 2TUNA 2VMIA 1N3PA 1AXKA 1C8M2 1KQRA 2CV6A 4R9DA 4XF9A 5FQ0B 3WP5A 5JZGC 1CAVB 3WW4A 2VUAA 1RHI3 2NYYA 4QM8A 5ACA1 4GA9A 2WT1A 3HBZA 5K9YA 3MIGA 1VBA1 1JYIA 1RUOA 3ZSKA 4QPYA 1SQ4A 1ZX5A 2D5FA 3ECQA 2HWB2 3AKSA 4C0HA 2O8OA 2ZGPA 4MGZE 2OYZA 3ES4A 4NN0A 3D4KA 2GDFA 3UJQA 1VRH3 4WM8C 1YWKA 1VBB1 2XVGA 1B35C 2F4PA 5L7OC 4IEQA 1U12A 4XF4A 3U10A 4MUVA 2RJKA 3MIHA 2MEV2 2PTMA 4HK9A 4XQWA 1CAVA 1MEC1 3TNPB 3J8F2 1QDCA 1IPKA 4QMAA 2BFUL 3AMNA 4FPKA 2B39A 1MACA 1OFNA 4Y5Z0 4YW4A 4COUA 1DDLA 3V0AA 5E89A 1LHWA 4PIYA 2JXAA 4UBHA 3OYWA 3VBHC 1ONAA 1Y9QA 1CAUB 5K8SA 4XFCA 4Q4V3 4AGGA 1PZ8A 1U5ZA 2NN8A 5C33A 1G6NA 3HN1A 1QJZA 1W6NB 3MI8A 2WFF2 3B69A 4YM3A 2HJIA 3QBQA 4XJ9A 3R6SA 2ZMKA 3FUQA 4CEYA 3POSA 3ZXJA 3NVCA 4BWOA 3AZYA 3TAYA 4I0BA 4NHMA 4F8AA 3ES1A 1JBCA 2WS92 4QPGA 4Y1UA 4PDWA 1DZQA 1N1VA 3B02A 1KITA 1QNYA 1R1A2 4XMAA 2YDEA 3H7YA 1WW4A 5T3NA 4B4PA 3RWNA 2HWC2 1W6PA 4PQ9A 4Q4Y3 1WLWA 2YV8A 2ET7A 4Q8KA 4N7IA 1RUD3 1A78A 4OI4A 1AYN3 4ASMB 1QJX3 2R041 4ZU4A 4Y22A 4OHZA 1OMIA 5J3UA 1NG0A 1BYHA 2RS12 1RB8G 2UYBA 1DGWX 1S55A 1LOCA 1N1YA 4R9AA 1QOSA 1FPN1 2B42B 2BNMA 1ZREA 1Q8OA 4PCRA 4YNIA 1RUG1 2KA3A 3VBFC 1VBC1 4L2NA 1UU6A 3DL3A 5CG9A 2RR11 2IXIA 1EV12 4YZ5A 3VZNA 2P17A 3UJOA 2V73A 5CG8A 1EV13 1PO21 4ISQA 2DTWA 2C9AA 2XJQA 4FTSA 5BUVA 3BB6A 1Q43A 2ZMNA 4YFZA 1ENXA 2Y26A 2E7AA 2DUPA 4LNVA 1PIV3 1R1A1 1PVC3 2D43A 2RS33 5JIAA 3WG4A 4Z1VA 1K5MA 2R0FA 5D1IA 4H7LA 1W39A 4B7EA 3MIFA 5KBFA 3KQRA 2QKDA 1YJKA 3B5LB 3WG2A 4AEDB 1POV0 1VAVA 4ONUA 2JD4A 2XVLA 1FATA 1XXNA 5FPZA 2PLV2 4P9LA 4R8HA 1KFXL 3JZVA 4INDA 3VDDB 3L9JT 1KXGA 4Y1YA 4LULA 4FOVA 2UWCA 3USUA 1OOPC 3ATGA 4IV3A 4E2SA 4DZGA 4YG3A 3AZWA 4DMIA 4A7KA 5I8YA 2ZGTA 2LTNA 2MNGA 3KS7A 5BNOC 1QJU1 3AZVA 2XBO3 1H9WA 1H4HA 2WA3A 4H3WA 4P5HA 1EP0A 3AX4A 1S0FA 1H8TB 5LRSA 1LHOA 3FLRA 1HXS2 4M3CF 3KMHA 1MQTB 4QU2A 3CL1A 4L9BA 4Y1ZA 4ASLA 4COZA 1QJY3 2Z69A 2YXSA 1D2SA 3H1MA 3QH6A 3ACLA 3P3PA 5LEJA 2SBAA 1G9CA 3H9AA 4LBQA 2PLV1 2ZCWA 1AYM1 3IIAA 2ZGNA 3LWCA 5LEKA 1PO12 5IK8A 4AQTA 1ZZ7A 1VBD1 2D6PA 4URTA 4GWMA 2QQPA 2XPJA 1ND2B 1DLLA 3ILNA 3LSEA 3U11A 4CP0A 1WUVA 4Q27A 1B35A 5L7OA 4KWKA 4YW3A 2E7TA 4JTOA 2HWC1 3NAPC 3EQEA 1I5ZA 1HQNA 4CEYB 5T52A 2IZWA 1R092 3ZSJA 4XFHA 4WVWA 2X5IC 3ZXAC 2WIIB 5I93A 1LB2A 1ZRFA 3JQXA 4AI2A 4PLNA 2VY0A 3LAGA 1UCXA 2PFWA 1RINA 2XG3A 1MS9A 2HWD1 1QMJA 4WVVA 1LESA 1X50A 1FI2A 5DUUA 4UBGA 1KJRA 3WD5A 2CL2A 1DQ6A 3V64A 3DV8A 2ZGLA 2HWF1 3B9IA 1AX2A 3INAA 2WQ4A 1Y43B 1YJLA 2CWMA 1RUE3 4IXLA 4W6WA 2ZX4A 1URXA 1C5HA 4HT1T 3RI9A 3POYA 4K6BA 1AR73 4DOUA 3VKMA 1AR82 4P9XA 4E4ZA 1XYNA 5T50A 4KNCA 2ZHMA 1ZBE2 1UN1A 3ROUA 2ZGSA 4Y1VA 1J3RA 1U5YA 2A6WA 1ASJ1 2Q30A 1HX6A 2VOXA 4EN6B 3QACA 4JDOA 1NA1B 1FNZA 1RUJ1 4BMEA 4QQLA 2VNGA 4XBQA 4GH4B 4XQDA 1IS6A 2YGMA 1PGW1 3D0SA 4XJZA 1VB4A 3AYDA 1V6OA 4IL7A 3WQ1A 3MW4A 1F5FA 2OPKA 1AL0G 2ZGRA 5C9AC 1CD3G 5CADA 4KU8A 1G9FA 1BBT1 1NZCA 3EJKA 4RS5B 4TZDA 1N1TA 3FLTA 4JGYC 1NLSA 2GAUA 1VRH2 3SH5A 2OW4A 1VR3A 5GLVA 4X6QB 2BPA2 1HLCA 3AB0A 3NV3A 5KHGA 1XRUA 2OA2A 5H9RA 4MX3A 2FMDA 2D6KA 2VMGA 3R0RA 4MYEA 3CF6E 5A3MA 2X5IB 1XNKA 5BNQA 4DY5A 4HZFA 1LCLA 3VV1A 4XF3A 4OUMA 1HW5A 1LULA 2EXJA 1PVC1 2RS31 4B29A 1ZZ8A 1N3OA 5H9PA 4BM8A 5JDBA 3DN7A 2PYTA 1RITA 4M0NA 4AEKA 1KS4A 2H6CA 4UW4A 2I74A 1MS0A 2OZ6A 4RR3C 4W6YA 2NMOA 5AFEA 2FMYA 4Z92B 3WVJA 3U4XA 3CO2A 1F31A 5K0UC 4I2OA 5A3LA 4YVSC 1NLRA 5E1RA 1DZTA 3ZO0B 1FXZA 2PHTA 1MQTC 4UW5A 3S7IA 1AXYA 2A7AA 2BTVC 1AXZA 1CPMA 2GU9A 3VBRB 4E9KA 4UXAA 4WVZA 5D8AC 3AFKA 4ZXKA 1HRI3 3ZFGC 4XYXA 4FQ4A 1FMD2 2O1QA 2EAKA 1O5UA 4BE3A 5J09A 4J6GA 2XKPA 3P3NA 1FX5A 2HKXA 5JPMB 3RMXA 5IK7A 2QFEA 1C8M1 1LENA 2ZX2A 4LO4B 5DDJ1 3ZXDA 2RS11 4ES8A 3ZYIB 2WINB 1PMIA 2JG8A 2BBVA 1ENSA 2JKBA 3TRSB 2EXHA 1CR7A 3BCWA 2F6BA 4KU7A 3SISA 2DFCA 2RMU1 3H50A 1MVEA 3FFQA 3KCXA 4Q1RA 1D2QA 1DU3D 5FLJA 2DTYA 4N43C 1MZEA 2FZ2A 3LOIA 1AX1A 1JUHA 4NPRA 3DPRC 5J37A 2BWCA 1OLRA 2EAAA 4YW2A 2DURA 4CDUB 1J58A 2WNUC 3CJIA 4KG8A 4TYSA 4FAHA 4LE4A 1IZ3A 4LBOA 1WCDJ 4A3XA 4P9JA 1KS5A 1AR91 1GR3A 3I59B 3E5UA 3QCWA 2RE9A 3K51A 4HVQA 1WMDA 1ZBA1 2VECA 2ZX0A 1C8NA 5SV8A 2HWE2 4IEUA 4D7YA 2CAVA 1XNCA 5A33A 3VHPA 4RL7A 4RGGA 1H0BA 1DYKA 5CBLA 4YZ4A 1SCSA 3ZFEA 5KXEA 1QXPA 5JLVA 3JUUA 3MF6A 2Z42A 1NA1A 1YCIA 3D0JA 1XNDA 4FTBA 5KXCA 1ENQA 2IFWA 2EVXA 3GZAA 2D6LX 1RUE2 4MV2A 1RMU3 5CIRA 4R52A 1ZA4A 2QZ2A 1AR72 3LB9A 4AFBA 2XH6A 4M3CE 1UW8A 2A6VA 3FMGA 1ZZ6A 2WFPA 1R1ZA 3M3CA 3VBHB 3KCYA 5BYNA 1MEC2 2ERFA 4FAGA 4CRQA 1GANA 3HT1A 3WDXA 1DQ5A 5T54A 4CDUC 4XF1A 4N53C 3BIWE 4COWA