5BV6A

Pkg ii's carboxyl terminal cyclic nucleotide binding domain (cnb-b) in a complex with cgmp
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
150
structure length
150
Chain Sequence
TAQARDEQYRNFLRSVSLLKNLPEDKLTKIIDCLEVEYYDKGDYIIREGEEGSTFFILAKGKVKVTQSTEGHDQPQLIKTLQKGEYFGEKALISDDVRSANIIAEENDVACLVIDRETFNQTVGTFEELQKYLEGYVANLNRDDEKRHAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis of Cyclic Nucleotide Selectivity in cGMP-dependent Protein Kinase II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords cGMP-dependent protein kinase 2
total genus 43
structure length 150
sequence length 150
ec nomenclature ec 2.7.11.12: cGMP-dependent protein kinase.
pdb deposition date 2015-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5bv6A00
4OLLA 4MV2A 5KHKA 3KMHA 3HQXA 2XLGA 1H1MA 2Z2SB 1NYWA 4B29A 5BPXA 1ZREA 4J1XA 2H0VA 3WW4A 3KGZA 4IEQA 4QGNA 5LEJA 4YARA 2H6BA 4EWDA 4MGIE 3H1YA 4HVOA 3RPQA 1UW8A 1PM7A 1J3QA 2XL7A 1YFWA 4HMZA 2QNKA 3DN7A 2OYZA 4FAGA 4XF4A 3ST7A 4MH0E 2GU9A 3S7IA 3GYDA 3NKTA 4KWLA 4F7ZA 3KSCA 4XETA 5I0TA 1CAVB 4Q0VA 3FFQA 4LA2A 4XFIA 4MGKE 2WC2A 1QXJA 3B02A 3EQEA 4I09A 3RZZA 1VP6A 4E2QA 3WW3A 2B8MA 2OZ6A 4EROA 1O5LA 1RTVA 3LA7A 4CYDA 4R52A 4IERA 3UKTA 2XL9A 1UIKA 3ACLA 3RYKA 2Q30A 3LA3A 4HN1A 4JV4A 5F1RA 4GULA 2ETEA 2Y0OA 5CVRA 4I01A 3IIAA 2FMYA 4K8FA 2UY8A 5JSPA 3SMHA 3N4MA 3S7EA 4XFAA 3BALA 3NVCA 1CGPA 1UD1A 3I7DA 4MGYE 2B9UA 4X6QB 4IEVA 1CAUB 4E2GA 3E6CC 2HJIA 1UCXA 4H7LA 3HIFA 2PA7A 2OA2A 3TNPB 1X82A 3JZVA 4LLOA 5I91A 5LEKA 2GZWA 1J59A 3D0JA 1U12A 4MGZE 4AQ2A 3L2HA 4IEOA 5CU1A 4QM9A 1Y9QA 1FXZA 3I59B 3CO2A 3H7YA 4YSFA 4I0BA 4TLFA 3G7DA 4ZU4A 5HI0A 4E2SA 3OF1A 4I2OA 1ZZ7A 3OTFA 1LR5A 1RUOA 3PVBB 4HZFA 4JVAA 5E16A 3GBFA 4DINB 5AVPA 4KWJA 5JSRA 1LB2A 5JR7B 2DCTA 4ONUA 4UBHA 5C6CA 1CAXA 3FHIB 1CAVA 1X8MA 1UPIA 5I0RA 3S0MA 1V70A 1X7NA 1QWRA 4N9HA 1SQ4A 1EYBA 4HVRA 2EVXA 2PTMA 1RGSA 3QACA 5T3NA 1XE7A 5J7MA 2PQQA 4XF0A 3ROUA 5C8WA 1RC6A 1LKNA 1ZVFA 1YHFA 2K9ZA 3CLPA 4Q0PA 4LTAA 4XFFA 1FI2A 1QXRA 2MPFA 4Q0QA 2KXLA 3UKNA 4ZU7A 2QDRA 3EHKA 3FWEA 3OGJA 4IEUA 2GC0A 3NW4A 3D0SA 1O3TA 3IBMA 1XE8A 1Y3TA 2Q1ZB 3R6SA 4EWAA 5FQ0B 5FLIA 4BIFA 2Q0AA 1L3JA 4AVCA 5JCTA 1ZRDA 2XLAA 2ZKLA 4P9GA 3RYPA 3LWCA 1IPJA 4WBBA 5FCCA 1O3RA 1SEFA 5FDBA 2IXIA 3TNQA 4MUVA 4EV0A 3MZHA 1VR3A 3NL1A 1CX4A 4MZUA 1EP0A 4WVZA 4Q29A 4AVAA 1YFUA 3SXWA 4FAHA 3MPBA 1WGPA 3H50A 1NZCA 2VECA 5FLHA 2VQAA 4IESA 1OFNA 2CAUA 4QX5A 4HSJA 3FE5A 4RD7A 3ZDSA 4YNIA 5LRSA 2BNMA 1XRUA 1J3PA 4IEWA 4Q0SA 3OCPA 1ZRRA 2EAAA 2PAEA 2K0GA 1H1IA 2GH2A 3SHRA 4EWEA 2GC2A 3C3VA 2GC1A 2O1QA 2Q4SA 4XFHA 1GQGA 1DZTA 2P17A 4F8AA 5I8YA 4I02A 3DL3A 4X6RB 3E6BA 2E9QA 3H3UA 1O5UA 1NE4A 1RL3A 1SFNA 3D82A 4A2UA 5BUVA 4FT8A 1ZNPA 1Q3EA 2PYTA 5CADA 5BXXA 3HT1A 1WLTA 3LOIA 2XHKA 4L11A 5BY5A 1CAXB 4HBNA 4IEPA 1O7FA 1YUDA 4O9GA 3LAGA 4L2NA 2XLFA 2MHFA 1OMIA 2IXJA 5EZWA 3BU7A 4QM8A 3SCGA 3U0ZA 1ZZ9A 2H6CA 1O4TA 3LA2A 1OD5A 3FZ3A 1Q5OA 2GAUA 4AVBA 4XF9A 1TQ5A 2N7GA 2CV6A 2OPKA 2CGPA 4LUKA 4YRDA 3U11A 4N9IA 1EY2A 1HW5A 4IETA 5E1RA 2VPVA 2QJVA 5I93A 1OI6A 3ETQA 2F4PA 4KL1A 1G6NA 3CEWA 3E5UA 1DGWA 3SCHA 5FLJA 2IXHA 4JTOA 3SCFA 2ET1A 3H7JA 3WW2A 3FX3A 4D7SA 3HT2A 3EO6A 3IDCB 2XKOA 2Z69A 4UBGA 2HKXA 3H9AA 4Z82A 4LULA 4PIYA 1YFXA 4I0AA 3DV8A 1Q43A 2BNOA 3RDIA 1ZX5A 3O14A 4META 1CAWA 2D5FA 2ZCWA 2MNGA 4BH9A 5KHJA 4IEZA 5J48A 4Z07A 1X8EA 3RYRA 3BCWA 3QOPA 3USSA 1FT9A 1ZRCA 4Q0UA 4QMAA 4IEXA 3IWZA 2D93A 2IC1A 3PLQA 4O9EA 3E97A 3CL1A 3BB6A 1QY4A 4PIZA 1EPZA 3E6DA 3H3ZA 3EBRA 5K8SA 1ZZ8A 3NJZA 2C0ZA 1O3SA 1VJ2A 4XFBA 3OD0A 5I8SA 5FQ0A 1JUHA 3ES4A 4R8HA 5LRRA 1RUNA 2V09A 4ORFA 4XEZA 4I3PA 2ET7A 2BNNA 2UYBA 2QCSB 3LZZA 3NSTA 4QGMA 4IEYA 2PAKA 4QGLA 2PAMA 1J58A 1DGRA 3E5XA 4FBFA 4WZCA 4ZU5A 2IXLA 1ZZCA 1CAWB 3I54A 2GC3A 2D40A 3MDPA 3E5QA 1YFYA 3FJSA 1J1LA 3MYXA 4LA3A 4YYOA 3H1WA 3H1MA 4BYYA 2EA7A 4LUMA 4KU8A 5KBFA 1LRHA 3ELNA 2BYVE 1J3RA 4QXKA 5FPZA 5I0UA 1UIJA 4HVQA 4D7TA 5FPXA 1DZRA 2IXKA 1WA4A 5D1IA 5I0SA 2PFWA 4HLTA 4XF1A 5JAXA 5I8TA 2PHLA 3M70A 3KCCA 1ZZBA 5BV6A 4AXOA 2XKPA 4AQ6A 2CAVA 1YWKA 3WW1A 2D5HA 1IPKA 4PIXA 2IXCA 4BHPA 5J3UA 2WFPA 3ES1A 2XGXA 3I59A 4JTNA 4PJYA 4KU7A 1PMIA 2B5HA 3IDBB 4NVPA 3VHRA 2UYAA 2I45A 1NXMA 2FQPA 1I6XA 2QVSB 4MX3A 4HN0A 4OFGA 1YLLA 2ATFA 1ZZ6A 1O3QA 3U10A 3CF6E 1NE6A 2UY9A 3M3IA 4XFCA 3DKWA 3KGLA 4LEJA 2PHDA 4KWKA 5EFUA 1CAUA 3RNSA 3UKVA 2O8QA 4UXAA 5KHGA 4J1WA 3EJKA 5KHIA 3BPZA 3CJXA 4XFGA 3H8UA 3PNAA 1GQHA 4HSLA 5JSOA 5KHHA 2BEOA 2BGCA 2OZJA 4XF3A 1I5ZA 1ZRFA
chains in the Genus database with same CATH superfamily
4OLLA 5SV5A 1RYYA 4QX0A 3IB3A 5DUUA 1H1MA 2CDOA 5HXMA 2Z2SB 2YYOA 2HH9A 4XYXA 4UFJA 4COUA 3LFMA 1NXD1 4CCDA 1BZWA 4J1XA 5C9AB 1RB8G 2WT2A 3O0WA 4Q26A 3O1MA 4YVWB 1AR83 1URXA 4NHYA 1YQ5A 4XJAA 2F4LA 4IEQA 4UW3A 3VKNA 3PVOA 4EWDA 2B9VA 2G9FA 4V2WA 5FY5A 2V5DA 3IKWA 3HNYM 2LS6A 1C8M3 4JDNA 4DUXA 2VU9A 2OQ6A 1TNRA 3H8RA 3V0BA 5CKMA 3BPSA 3A23A 3A0KA 3MIHA 3RZHA 1RUF3 3DN7A 3KV6A 4LT5A 5FYTA 5T5LA 4LBQA 1WBLA 4MH0E 1LU2A 2GU9A 4R9AA 3S7IA 5C9AC 3NKTA 2XDVA 3WINE 1GR3A 4L9BA 2P3KA 1DLLA 2CWMA 4F7ZA 2WNVA 5FAXA 5K7PA 1XYOA 2FCUA 1CAVB 3ZYHA 3FFQA 1GZWA 3ACIA 4XFIA 2VMHA 4D94A 2ZTNA 5L73A 5LY2A 1PO11 1SDWA 1LEMA 2VC9A 2WQZC 1C1FA 3MFAA 4CPBA 5K0UB 1DQ5A 1OOPC 1PGSA 1W28A 4KMQA 2JDPA 4QWNA 1GOHA 2JE8A 4EROA 3IDAA 4OZXA 3KZ4C 1DCSA 1K5MB 1OSGA 4FOQA 4WZFA 4BZ4A 2DU1A 4DPNA 3UKTA 2XL9A 4ISRA 3VDAA 3UL2A 1IS6A 2D7FA 2HEYF 4LMFA 3SISA 4Y1ZA 2F6BA 2YY1A 2YDEA 2YBPA 3HN1A 3VBOB 1G9DA 4QPIB 1BHGA 2VBBA 5F1RA 1DYPA 1TMF3 2R042 1W9FA 2Y0OA 3EXUA 1Z7S3 3WG4A 3ZIXA 4IQPA 3RWKX 1SMVA 2I07B 1OLME 2P3JA 5CVRA 3WEZA 2WT1A 2WZR2 4GB31 5FPVA 4CCJA 4IV3C 2FMYA 2XMLA 1CZSA 2K46A 2YC2A 4GWMA 1COV2 4K8FA 4MXWA 5A80A 3ZXJA 4XXPA 3AXEA 3S7EA 4HKWA 2W0XA 4RGKA 4NIIA 3BALA 2BPA2 2W2IA 1X9PA 1CN1A 1XXNA 1JXNA 4GZ9A 4MGYE 4RL7A 2D3RA 4R9DA 4OMDA 3B9IA 1NCRB 4QKFA 4HKLA 1W0NA 3IT8A 1CAUB 1AJKA 4SLIA 3AFKA 5IVYA 2JD4A 3AKSA 1NA1B 1QJU1 2DURA 5DAPA 3KV9A 5C5TA 3WP3A 4IV1B 1UAIA 2A3XA 1P8JA 2XJRA 3TNPB 2AEYA 1X82A 3AM2A 3LEGA 3RG0A 4AEJA 4FPOB 5FWJA 4BM8A 2PLV3 2RR13 2Y6LA 2ZZQA 4PBOA 2R061 2EXKA 2ZHKA 1QNYA 2C24A 5IYYA 3M3EA 1HXS2 4Y4RA 2ZGSA 4TXWA 3N3HA 4I30A 4CXXA 1Y9QA 3C2UA 5C4WB 4LHLA 1CVNA 1SBDA 1XNKA 3I59B 4CDQA 3CO2A 3H7YA 1H6YA 4XW3A 4TLFA 4K1YA 3G7DA 1D7PM 5HI0A 2XJQA 1AF9A 1S0IA 3SNMA 3ZPOA 4CCLA 3AP6A 2SLIA 3OTFA 3JD72 1RUOA 4YLZA 1S4CA 3K4AA 3POBA 4R9BA 4LOTA 1GV9A 5EQUA 3GBFA 4FPHA 1OBNA 3ZSEA 3ZR6A 1OLMA 2EXIA 2FDJA 4NJ4A 5IAXA 4CRQA 3LPFA 3PU3A 1A34A 2V4AA 4LO7A 2DCTA 5DUWA 4RHV1 1H2LA 3M3CA 2W08A 1JZ7A 1QOSA 4LBNA 5I0RA 2D6OX 2LALA 4LK7A 5CKNA 4N9HA 3SH5A 3I2IA 4HVRA 2BW8A 1OF3A 2PTMA 3QACA 1GZTA 2ZKNA 5T3NA 3ZFFC 1K42A 3ZXGA 4KWUA 4FI9A 3P3PA 5EP9A 3ATGA 4XF0A 2VAUA 3FUQA 4BQ5A 2Q8DA 3VLBB 1O4ZA 1V9U3 5FUPA 4AHYA 1KFUL 2W94A 1GYKA 2VG9A 2XR4A 4U2AA 2K9ZA 2WYFA 2RMU2 3PU8A 3CLPA 5HV4A 5IT6A 1ENRA 1MS1A 4URAA 5FXXA 2HEWF 1KS4A 4MVTA 2MPFA 4W6XA 1GOGA 1W3XA 4Q0QA 5FZCA 5FP8A 1HQWA 5LK7B 4E4DX 1L7QA 4ZU7A 2QDRA 4XIOA 2CU5A 2QQKA 1ULEA 5F5CA 4NO4A 4IE0A 4IV1C 3AZVA 1XE8A 4AI3A 5IFPA 2WAOA 2Q1ZB 3KB5A 4PDWC 1JYXA 4EWAA 1VRH2 4XACA 3J7NA 3FFZA 5FQ0B 4XJ9A 4WM7A 4LKFA 4BIFA 1RUC1 4LO6B 2QQWA 2XLAA 3FL7A 3P6BA 3LWCA 1YXWA 5FCCA 1D2SA 1ND2B 1JYTA 3TNQA 4CZSA 2HWC3 1COV3 1UO9A 1DG6A 1W6MA 2XG3A 5IK7A 1DQ6A 3DF0A 1H8VA 1MVEA 4CDXA 2MEV3 3I2JA 1UN1A 2GP5A 2VMCA 3WQ1A 1BMV2 1QJZA 3B00A 3TEYA 2GN7A 1RHI2 3MPBA 1X9TA 3H50A 1NZCA 3LSDA 2VBPA 2VQAA 3NKGA 4FPYA 1OFNA 5FMOS 5FV3A 1AXYA 3W59A 3R4SA 4QX5A 1RVF3 4LHSA 2VTXJ 3WOGA 1SPPB 4Y5Z0 3NJYA 1LHOA 2NP0A 4YG0A 4Y33A 2A6ZA 1BXHA 3ILFA 3ZDSA 5HBAA 1XRUA 1DP0A 4DO0A 4IEWA 1H8TB 4Q0SA 4XTPA 5JLVA 3OCPA 5F5AA 1OC1A 4QQ2A 1H1IA 2E26A 1FMD3 4P9WA 2Q4SA 5J98B 2VTXA 1DZTA 3C7HA 4F8AA 1W6PB 5I8YA 2WO1A 1WCQA 4I02A 1S0GA 5JR2A 2BQPA 2LUWA 3ORJA 3BUCA 4CDUB 3LIHA 3BTXA 3F2ZA 4UW5A 1QJX3 2DDUA 4H7MA 4XQWA 2IZWA 4YG3A 3B93A 4Y1UA 5D8AC 1W6QA 3TOJA 3VKLA 4A2UA 4K6BA 1ZNPA 1VIWB 1Q3EA 1WCKA 1R64A 2PYTA 3L2YA 3OD4A 1V9U1 3KWVA 4JRLA 2JENA 4XABA 2AGSA 5DPNA 3B9CA 1JU3A 4RA0A 1XOYA 2VZPA 1FNYA 4FPFA 1Q8QA 5IK5A 2VCAA 1CAXB 1MQTA 1QQP1 4LNVA 1UZ0A 1X33A 3VKOA 1YUDA 2ERFA 2FZ1A 2DVAA 2XLFA 3WF0A 1JYIA 4QM8A 5FZHA 3U0ZA 1O4TA 2W46A 5LATA 1QJY2 2VZ3A 5E88A 3OY8B 5F2SA 1LEDA 2R32A 3CZJA 5A33A 1A6CA 4CUBA 5C3QA 4LUKA 4YRDA 4K40A 3RWNA 1VB2A 1JUIA 3LGRA 4W6WA 5AC91 1US2A 4AVBA 2RDRA 5EWSA 4CDWB 1RUE3 4RS5C 1D4M1 2A73B 3VBRB 5A3UA 2QJVA 3PUSA 1EV11 1R091 2ZA9A 1GZ9A 3N9QA 4AAPA 5I93A 1RUH1 5JXIA 1REEA 3ETQA 3J26N 2F4PA 2WKKA 2VCBA 3USUA 1HKDA 1DDLA 1LODA 3E5UA 3GNEA 3BGAA 1AR63 2WAAA 4FFIA 4QQLA 4XUNA 5FLJA 3U14A 3SCFA 5J96B 2IVIB 4D7SA 2FHRA 1RUG2 4CP1A 3ZLIA 1RJ8A 2NPIA 2XQXA 4I3GA 1RIRA 2W47A 2Z69A 1QGLA 3B94A 3VV1A 2JG8A 1SHWB 2WO3A 1HLCA 3IM0A 4UBGA 1FYUA 3H9AA 4JKMA 4YZ4A 1Y9MA 2EXJA 4P14A 2HWF1 3ZO0B 1XSRA 1CX1A 3DPRA 3ZFEC 1XNCA 3T3YA 3WG2A 4AI1A 2BOJA 5C3RA 1POV1 1VRH1 1SCSA 2ZCWA 1PZ8A 1TME2 2VNOA 3H8OA 4BMEA 1XSQA 3LSEA 1D0HA 1EUUA 1IPSA 4QPIC 4QKNA 4DXRA 5FBZA 5JXJA 5J48A 4Z07A 3T4VA 5K9YA 1Z0HA 4KBZA 5A7WA 3WHTA 5F3EA 1FT9A 4Q0UA 4QMAA 3NJXA 3AMQA 1VMHA 3GBGA 1ULFA 3B69A 4QX8A 4QD2A 1YQ8A 3JBG3 5KXBA 1DYOA 3AJYA 3CL1A 3IDEA 4CXWA 2O8OA 3AB0A 4XOGA 1UX6A 1EPZA 3E6DA 3VDDC 4D6SA 1B35A 1W6QB 3KQRA 5IK8A 1RHI1 1C28A 1OOPA 1W8OA 5K8SA 4CDUA 5BNNB 4AW7A 1OKQA 3OJBA 5FZ1A 5T50A 4GD4A 4PLOA 4QB1A 2X5IA 2X10A 3ES4A 2B7YA 5CBLA 2V09A 5DG1A 4ORFA 1W8TA 1JMUB 5FYUA 5SV8A 2HWD1 2VUJA 2JX9A 3URFA 4DS0A 3I2GA 1A8DA 4ZS2A 5DQ0A 4ZY9A 5A7WB 5A7NA 4QHZA 4QGLA 1UZWA 2DUQA 1MZ5A 1RUE1 2JDUA 2PAKA 3AP7A 2PHRA 4IEYA 4IW3A 1AR72 3MF6A 3T0BA 4FBFA 3ZN6B 5LCWL 2VUAA 3K48A 1QIQA 5KWRA 1HRV3 4LBJA 2GSYA 1W9YA 3I54A 1WCSA 1RMU2 2GMPA 1V9U2 4COYA 4FP2A 4XXAA 4LA3A 2OW4A 2JDHA 3J7HA 5CNAA 2R071 2HLEA 4YYOA 4M01A 2ZPXA 2HWE1 2RS32 2EA7A 4G3YC 4BYYA 4GWJA 4COVA 2BFUL 2RJKA 4QKDA 5IVCA 1FMD2 2JICA 2W3JA 2WNUC 3B5LB 4FOVA 1LRHA 3VZKA 2BYVE 4PQ9A 1S1AA 4O7XA 1OLQA 2VVDA 1ENXA 5C71A 3VB9A 4HVQA 3VBUB 3M1HA 4CP9A 2BERA 4A44A 1DZRA 2IXKA 4AEDC 3BIWE 5FIXA 1LU1A 2HYKA 2PFWA 4YW5A 1UYXA 5DDJ1 3RMYA 1OA2A 2VNVA 3GZTB 3MUZ1 2J1VA 3OPTA 5HCBA 2IFWA 3UETA 2JIJA 1VBC3 4S2GA 4AXOA 3ALQA 3TEWA 1B35C 4OZOA 4N53A 4YZ3A 2NN8A 5H9PA 3ZM8A 1YWKA 2ZX4A 3N9LA 1UKRA 1U5ZA 4OHVA 3TYJA 3WW1A 4TSVA 3NNMA 1QNWA 2IXCA 1NCQB 1E5RA 2A6YA 2WNUB 1POQA 2ZXQA 3M8LA 2V4VA 4A4AA 3RZJA 2E33A 1IGOA 1NCQC 1V6MA 4JTNA 3JBG1 3PIJA 1LULA 4PJYA 4B4PA 2VOWA 1LHWA 1PMIA 2TBVA 1QDOA 2B5HA 3IDBB 2LW8A 2AACA 3OPWA 4NVPA 4Q5OA 4GMP1 1NKGA 3ZSMA 2I45A 4KNCA 5FZBA 5C70A 3VUOA 1ZBE2 3C7OA 3FLTA 1AL21 2BOIA 3T0AA 1D2QA 2RJ2A 2W91A 4MX3A 4OFGA 4B3NA 2R16A 3ZXDA 4XDPA 2VJXA 3ZKYA 2G19A 4DY3A 5GZGA 3WNLA 4CU7A 4HT1T 2ARAA 1XC6A 1BEV2 5D8AB 3CF6E 5H9RA 3MV01 4INDA 4QU1A 3ZXKA 5KXDA 4XFCA 3A0NA 3DKWA 1GWMA 5FREA 1S2BA 1GQPA 4KWKA 3RNSA 2G1MA 3ACFA 3NNLA 2O8QA 1UL9A 3LF7A 4OMCA 3W9AA 3VKFC 2EICA 3EMRA 1HRV1 3JXSA 5I0DA 5FUIA 4W65A 1RUC2 4HANA 5JSOA 5HCFA 5KHHA 4QX7A 2WNOA 2R6QA 4XF3A 4XJUA 1S0CA 3TB0A 5A3NA 2FCVA 1ZYBA 1PO22 2RMU3 3D5OA 5F3CA 3W5MA 5KHKA 3KMHA 3ZFGB 4TZDA 3HQXA 2C9AA 2XLGA 4GJZA 4QU2A 1ZA7A 2VZTA 5C5UA 2DUPA 4QX3A 2H0VA 1H0BA 4QGNA 1Q8OA 3K4DA 1U0AA 4YARA 5A3PA 1OH3A 2CWSA 1GFF2 2B39A 3BYWA 1G9CA 1BMV1 2OUHA 3RSJA 4NE9A 3QBQA 3OGVA 4Y5TA 2W1QA 3VBHC 4C1XA 1MS9A 1ND2C 4J25A 3MIGA 2SBAA 1ND2A 1ASJ1 5IVVA 1J3QA 5BNNC 4IGPA 2XQRA 4CEWB 4HMZA 2VMFA 3HWJA 2QNKA 1LHUA 4FAGA 1ENQA 5A3MA 2PELA 2BGPA 4Q4W1 2VBDA 2AYHA 1JHNA 2QTWB 1HV0A 2V5YA 3A21A 4KWLA 4CVUA 3KSCA 3CDZB 5I0TA 2FD8A 2EXHA 1AR93 4Q0VA 3TEXA 4FO9A 4LA2A 5FZLA 4Q4V3 4YZ2A 3EQEA 1N1SA 3B02A 3WP4A 1SLIA 3WP6A 4DEQA 2RG4A 2XJPA 3ABZA 2CY6A 3VBUA 4GMP3 4CP9B 4D69A 5JOWA 4AGVA 5KR7A 3GJAA 2GH8A 5FXWA 1LECA 1RTVA 4DRVA 5EYXA 4CP0A 4BU2A 1CESA 4C91A 5FY4A 4CYDA 4R52A 5HXVA 4IERA 1IS4A 2JDYA 5FPUA 3T2QA 3RRDA 4RR3B 2X8KA 1GP6A 2YBKA 5LK5A 1KJLA 4RYDA 4B4QA 4P5HA 3IAPA 5A1LA 3R4UA 2Q30A 1HQLA 5LWBA 3J8F3 1UOJA 4HN1A 4JV4A 4GULA 2ETEA 3D8CA 3N9MA 1H6XA 3WZ1A 4AFAA 1E5IA 1QJX2 1NG0A 5EJZB 4BQWA 4QPGA 1JHJA 3K4ZA 4DUWA 1V6IA 1QHDA 3CU7A 4CUAA 1AX0A 1OQ1A 2XUMA 2P6HA 4LKDA 1W03A 3I3EA 2WFF3 5CB7A 2WNVB 2UY8A 3HQRA 5JOYA 2HWB3 3RZMA 1YJLA 5FYCA 1ZM1A 4RR3C 4YGEA 3NVCA 1EV12 1R092 2A3YA 2NLRA 3KLSA 1SLBA 4A6SA 2QDNA 1UNBA 1W2NA 4NPLA 4EE2A 4AHXA 3THTA 1O8SA 4BK4A 3LPGA 5GZFA 5LBFA 1HXS1 3Q8BA 3DXTA 1I1EA 4E2GA 3E6CC 3DUIA 5BNNA 2WN2A 2QQMA 4Y1YA 1LOEA 1C57A 1BEV3 5AVAA 2PA7A 3HIFA 4NIAA 2OA2A 3ZKUA 4RFRB 4MG2A 3O1OA 3JZVA 1AYM3 5A7QA 5I91A 3FLRA 2WWUA 3VZOA 1REFA 2VXJA 3VBHB 1PX3A 2YC0A 3I2DA 1RJ7A 4YVWA 4RS5A 3OPZA 4M0HA 1G8WA 2WWJA 3T1MA 3IMNA 2W92A 4AQ2A 5FOBB 1V6NA 1OLRA 2P3IA 3AL5A 3KT4A 1DYKA 4JHZA 4QM9A 3ASIA 1OA3A 4R4ZA 1IQAA 1FXZA 5FFOC 3PTRB 4E9KA 5A6QA 1AR91 2A70A 4YVSC 2EIGA 4PF5A 3WDUA 1Q8PA 1ZBA1 4I2OA 3PVBB 1HB4A 1SDDB 1TZOA 5FK7A 4ASKA 3O1VA 5CEHA 1YIFA 1XU2A 3AP4A 4FPLA 1XNTA 1C8NA 1SLTA 4BA6A 3R05A 4ONUA 5IATA 1QOOA 3ITQA 4UBHA 3FHIB 5GLTA 1X8MA 4H3WA 4JGZC 5FR3A 1KDKA 2NYYA 2YPJA 4Q4Y2 1E5SA 2HWF2 2WYSA 4AFCA 4D7TA 4BQ2A 5T5PA 1WMXA 2O14A 1QWRA 2YV8A 3VDDB 1QJEA 3POJA 4C90A 2DVFA 4OI1A 1HJGA 2PLV1 2RR11 4AFBA 5FYSA 4Z92B 5JOZA 4LBMA 3MZHA 5IJRA 4XQDA 1N1TA 4Z1VA 1AJOA 1ODMA 4KQ7A 5FZKA 1W90A 2YHJA 3LKJA 4HK8A 3UYJA 4BQ4A 2X53S 1LKNA 3AYCA 3KV5A 1ZVFA 4ES9A 5A3OA 3MW3A 4LTAA 2ZEWA 4ATEA 1FI2A 2XOMA 4WM8B 3VBSC 5FYIA 4ISQA 2KXLA 1OF4A 3K77A 4JZRA 5ISLA 5LBBA 1B09A 5A7OA 2WDBA 1QXPA 3D4KA 3PVEA 3FWEA 3MBWA 3OGJA 4IEUA 1J1TA 4XILA 3ZFFA 1TMF2 2GC0A 2Y0IA 3D0SA 5FZ3A 1GZWB 3MIDA 2AENA 4D6RA 5F5IA 1Y3TA 4V1PA 2E7TA 1ZRIA 3R6SA 3I3MA 2XH6A 1FOD1 5FLIA 2BTVC 2Q0AA 4LBQB 4TLGA 5FMBA 1VMJA 1XYPA 4P9GA 4AEDB 5JCTA 4UI9L 1ZRDA 5GZCA 4NRPA 3AZZA 5GZEA 2ZGKA 3SKVA 5ACA2 4YGBA 2JG9A 1QOTA 2RS12 1AXKA 5A3TA 1A3KA 5J36A 4EV0A 3P5BA 1B35B 1QMJA 2BBAA 4H2AA 4LORA 1ZA4A 1FX5A 2UWAA 5D8AA 5FZ0A 1PX4A 5FZDA 1CX4A 1QKQA 2ZHNA 4HL0A 4HOOA 2VVFA 4MZUA 3GM8A 2Q1FA 4AVAA 1YFUA 3SXWA 1XNDA 4AOCA 3AK0A 4CUGA 3HD8B 4YW2A 1VAVA 2QQVA 5KC6A 1WGPA 3ZIWA 3ZFFB 1QH6A 1G9FA 2WT0A 2VECA 5FO8B 2Y34A 1HDKA 1ONAA 4HSJA 3FE5A 1SPPA 4WVMB 3OYWB 4AI2A 3K51A 3CZUA 4MLOA 1DGRN 3APBA 3JBG2 4CU8A 4JAAA 1VBB3 5GLVA 5LRSA 1UKGA 4M4PA 2NM1A 1BK0A 2EAAA 2QQOA 4WM8C 3U75A 3WNOA 4COZA 4LE3A 2K0GA 2ENRA 3SHRA 2BWCA 2G4IA 3DYMA 5FZFA 2GC2A 2OKXA 3I2FA 4A3ZA 4BXSV 2D3SA 2GC1A 2L9LA 3S57A 2O1QA 4N53B 4ZZ5A 1AL22 4XZPA 4DQAA 2ZGRA 5F6LB 3BIEA 1WA6X 4D6QA 4YW4A 5FYMA 1C5IA 4X6RB 4CP2A 1MEC2 1PGW2 2A6XA 5DZGA 5BUVA 1NE4A 4KG0A 1COV1 1S0EA 4YVSB 5L19A 1JZ8A 5CISA 2C6SA 2JEMA 5CADA 2WZEA 4AEKA 2XVLA 3LOIA 4UFMA 3USUB 2JDNA 2BFUS 2OVUA 1CJPA 4LIUA 4L11A 1ULDA 4PCRA 3C7EA 4AGGA 1SG3A 3Q8CA 1RUD3 1D4M2 4GWNA 2IUWA 1MZEA 1O7FA 1GNHA 4QAWA 3VBRA 5BNOB 3CMGA 4O9GA 4L2NA 2LRPA 2D6KA 3NV2A 3SCGA 3SEPA 4DMIA 2E63A 2H6CA 2VD7A 1IZ3A 4UYBA 2JKBA 2WR9A 4FTEA 4N43C 1U5YA 2TEPA 1VE0A 1UU4A 2N7GA 5TSWA 3R0RA 1S2EA 1I5PA 2YC4A 3VBOC 1FATA 2Z42A 1FOD3 1DGWX 4LPLA 4N9IA 2OX0A 4W50A 1HW5A 4FXGB 1W2AX 5E1RA 5JIAA 3GF6A 1UF2C 3PMEA 1GSLA 1W9SA 2VZSA 4A3XA 4OI4A 2Y6GA 4JX0A 2Q8OA 2WA3A 2WQ4A 1WCDJ 4QHOA 4GH4C 3CEWA 3RJ2X 1DGWA 3QH7A 3GJBA 5HPOA 1QJU2 1PGL2 3MHZA 1ASJ2 3K3OA 1AYN3 4JTOA 2VH9A 2ET1A 2TUNA 2W1UA 4XVHA 4QXBA 1LHVA 3EO6A 3IDCB 4QB6A 3ZYGA 3LDRA 2YUEA 2XKOA 3H3LA 4YFWA 1ND3A 4XQ4A 3UESA 1F35A 1YC61 1V6LA 3WCSA 2HKXA 4Z82A 1U5XA 2HEVF 2ILMA 4LULA 1DIWA 3UK9A 1SLAA 3THCA 3T08A 1F4AA 1VBB1 2VOKA 4YFZA 5LZ6A 2BNOA 3WD5A 3RDIA 1H8TA 1ZX5A 5FMDA 2RDNA 2FDHA 3FC0A 5CFDC 2VULA 3CJIB 2VCCA 4M00A 4K1ZA 3I97A 2MNGA 1DFQA 5DXDA 4BH9A 5KHJA 3U4XA 3MLJA 4IEZA 1X8EA 3B01A 4PQQA 5J09A 1AR81 1ULOA 1RUH3 4AF9A 3VBRC 2ZAHA 2QQPA 2YXSA 1F8VA 4RHV3 1ZRCA 4XJWA 1MPXA 1OURA 1GWLA 3IWZA 4FPEA 4IEXA 1BYHA 4IUGA 4RQPA 1NLSA 4CE8A 3VHOA 4IV3A 1PVC3 3BB6A 1UYYA 4PBPA 5EYYA 4PIZA 5FZ4A 1C8M1 1SFYA 1UX7A 1MZ6A 1KXGA 3EBRA 4M3CA 2GNBA 1IG3A 2DCYA 2WA4A 3I3QA 5CG8A 3FN9A 2XPJA 1W39A 3NJZA 1YI7A 2UWBA 4EN0A 5JOXA 1WCUA 1DU3D 4K8RB 4Y20A 5ACA3 1OUSA 3OD0A 5FQ0A 2O0OA 2WUHA 4XUTA 4R8HA 4AEDA 1LHNA 1MS0A 1JOPA 2Y60A 2VZRA 2EALA 2JB8A 3KCXA 4JGYB 4FFHA 1H2NA 4P00B 1VRBA 3VD5A 3LZZA 2ZABA 4OI0A 4QPGB 2Y26A 4LIVA 4CA9A 2A75A 1G7YA 4WZCA 4ZU5A 5GJ6A 1NQJA 4XHBA 2E7AA 4F3JA 4Z8BA 3PJYA 2IXLA 4WVWA 1ZZCA 4TN7A 5ABJA 1CAWB 5ABJC 2D40A 2WBKA 4YPJA 3GALA 3E5QA 3FJSA 3MDPA 3MYXA 3MUY1 1BQPA 2JECA 4N7IA 5JDBA 4JDMA 1AXZA 1AYN1 2Y64A 4RR3A 2Y33A 3B3QE 1JOBA 2DYCA 3H1MA 1Z7S2 5GKAC 3WDWA 1H8TC 3ZDVA 1VPHA 1AUYA 1ULGA 5AFEA 4LKSA 4XE9A 4UOJA 1CJDA 4KU8A 4MOAA 4H14A 1J3RA 1QF3A 3FLPA 3POYA 4QXKA 3O7OA 1KS5A 1O4YA 4GB33 5FTTC 4XJZA 2ZGMA 5I0UA 4D0QA 2D97A 3UGHA 1KQRA 4JC1A 3ZYJB 2KR2A 5DN2A 2HWD3 3HNMA 3ZFGC 2EF6A 3KS7A 4AL9A 1Y7BA 3AVRA 4P08A 3OGGA 1DQ0A 3BODA 3RFRA 3ZXFA 2AC1A 2A71A 3NAPA 1PVXA 4YW7A 3NAPC 4PDWB 2RS31 3M70A 2P37A 1REDA 3WUDA 4B4RA 4DFSA 1SFPA 4Q4X3 4GH4B 4NPMA 5BV6A 2XKPA 3ZYFA 1D0GA 2JDAA 3AP9A 1POV0 4AQ6A 2D44A 5EJ1B 1UOFA 4Q4Y1 5FRAA 1QJU3 5J3UA 4BHPA 2CDPA 1W06A 2VOVA 2RDQA 1OA4A 1WMDA 2WLPA 2YU2A 3I59A 1UU6A 4CDQB 3J8F2 3OY8A 5IAVA 4GALA 1PVC1 2V72A 2R073 5GLZA 1S55A 1GU3A 1MVQA 5DDJ2 4V2VA 4WVMA 1AR92 3DCQA 3I3BA 5BNPB 4NHLA 5E6HA 3ZSKA 2FQPA 2XBO1 5FPAA 4DY5A 1MQTB 3LEIA 1K5MC 4BCUA 2YBSA 2QZ3A 3RI8A 4RS5B 4QQPA 1YLLA 2ATFA 2DVBA 1NX9A 3OEBA 4GWIA 1VALA 2VL4A 3VBHA 1O3QA 1UY1A 2YGLA 4IV1A 3UJQA 1PO21 1HQNA 1KGYA 1H9PA 2ZGOA 1UPSA 4CDQC 4HPKB 1T6GC 4QQOA 1AX1A 1VBA2 2ZX3A 1CZVA 4UW6A 3WVJA 4CEWC 1PK6B 1DZQA 1O59A 3JB4C 1LENA 3H0OA 2ZX2A 3EJKA 3M3QA 3S6PA 3CJXA 5CFCC 1R1ZA 3SLIA 5E8AA 4D3WA 1H2MA 3AYAA 1GQHA 4HSLA 3NAPB 3K46A 1UMHA 1H1AA 2BGCA 4Q1PA 2OZJA 2XWJB 5H9SA 3SC7X 1YO8A 5ERLA 3AX4A 2RS11 3VBUC 1D4M3 1NYWA 5L36A 5AC92 3WP5A 3JD73 1BK1A 2ZHMA 4OUSA 5D21A 1X50A 1EV13 1R093 1UZZA 2PHTA 3MPPG 4KGGA 3WR0A 4S2HA 3WW4A 2JE9A 2RJLA 3AC0A 4LO8A 4YVWC 5JPMB 4FPKA 4M0NA 4A7YA 4MGIE 2RE9A 3H1YA 1NLRA 2ZBJA 4BJ0A 3GZUC 2P4EA 4HVOA 4ZONA 3RPQA 1N3PA 5CFCB 5GM0A 5L9VA 1LCLA 1UW8A 4CCMA 4M4RA 3E1F1 5ABJB 2BZDA 1JYVA 3WV6A 2XL7A 1YFWA 4QB2A 3MICA 5K0UA 2OYZA 2CL2A 1J84A 3DPRC 4XF4A 4PI0A 3C8XA 1EPWA 2R0FA 3ST7A 5HCAA 4Y3OA 1QH7A 5LA0A 1O6UA 4Q4Y3 4QPGC 5JMOA 2VXRA 2HWF3 4E4HA 4YW3A 5A6ZA 1JYWA 3D6EA 4ITCA 3VBFA 4MGKE 5JZGA 2RMU1 2RDSA 3PUIA 4I09A 3RZZA 1VP6A 4IE4A 1UY3A 2DTYA 2VZUA 3WW3A 2BJSA 2OZ6A 1TVGA 2RM22 3NQHA 3FBMA 2VZOA 2ZMNA 4K9SA 4LBOA 1O91A 4AG4A 5FZ7A 3LA7A 3TEZA 2B45X 2HWD2 5CYYA 2C4XA 5B4NA 3O0VA 2VOXA 2XWBB 3WQ0A 3TAYA 2YMZA 5FZ8A 3LB9A 4RFT0 5C4WA 3MIFA 5CFCA 3RYKA 1ACCA 3U07A 3VN4A 3MW2A 2BUKA 3LA3A 5A3WA 1PIV1 1WZXA 2VW1A 3WNNA 3HPNA 1OXCA 2KM2A 2VY0A 4JQRA 5L9RA 5FYYA 3N9PA 3Q8EA 3H8XA 1XJAA 3ILNA 4Y1XA 3FHAA 2OPWA 4KG8A 3RQ0A 4Q4W3 3W5NA 1VBD2 2ZX0A 2D43A 4B7EA 1QJFA 3ZN4A 2GN3A 4HK9A 4YWAA 5JVVA 4P9YA 3V64A 4QPYA 5JSPA 1O8PA 3N4MA 4E4ZA 3AKRA 2JG9C 3TN93 3DPRB 3HAGA 2DBNA 1UD1A 1NCRA 2JXAA 2VZQA 3ME2A 4B8EA 1CGPA 4KBBA 1RUD2 2PMWB 4C0BA 2B9UA 5LASA 4KGQA 2JG8B 4X6QB 2D6PA 1H30A 1ODNA 2WQ8A 2HJIA 4MO3M 3WNKA 1AR71 5FPBA 2XUEA 4H7LA 1AZDA 4PDWA 1JI6A 3M2MA 4P9JA 1OFSA 3G6JB 3RS6A 1VMFA 2RS51 5LEKA 3BOWA 5DUVA 1GNZA 1TME3 5FJHA 1HRI2 2VZ1A 5LA2A 4A7ZA 4COWA 3PDQA 4DXSA 1J59A 3NNJA 4AQSA 1G9AA 1TNFA 4CUCA 4LJHA 4QDRA 4GJYA 1LGBA 1WMEA 3L2HA 1FPN1 5CU1A 4UFHA 4ZPIA 3BTZA 4JGYC 4CU9A 4CXYA 4AI8A 4ZS3A 5T55A 4YSFA 1RITA 4I0BA 3POEA 1EAH2 3AJZA 1NA1C 5GLUA 5FZOB 4ZU4A 1HB2A 1C3HA 1N3QA 5C3PA 4XJ8A 4E2SA 1ZBE1 3AMPA 1LR5A 3WNMA 2IVJA 2GP3A 2DV9A 1WW7A 1PK6C 2A1XA 2C1FA 3EB7A 4YG6A 1LOAA 4DINB 1WD3A 1YQ2A 5JSRA 1LB2A 4NAMA 4AZZA 1G86A 2BVVA 1RUJ2 2JB4A 3UV9A 5JXGA 1ND3C 3HR9A 5FYBA 1CAXA 3KT1A 1KRIA 1CAVA 1OPMA 1X36A 1Y4WA 4XCAA 4L92A 4IE6A 1UPIA 1RUG3 5FKBA 5GLWA 1D4VB 3J4UH 1V70A 2YROA 5KXCA 3OSDA 2JD9A 2GMMA 5C33A 1EYBA 5JI9A 4DIQA 4UW4A 1CPNA 1KDMA 1RGSA 3ZFEA 4WV8A 1XE7A 3O1SA 3WDYA 3WQ7A 1UY2A 2PN5A 3KM5A 2PQQA 3ROUA 5C8WA 2WS91 5LY1A 3I8TA 4CDWA 1NLQA 3CKHA 4BQ3A 3JB8A 4G4FA 4CTEA 2Y8KA 2R0HA 4XBNA 1GP5A 4J6GA 4FPGA 1POV3 1VRH3 1W2UA 2ARCA 4Q0PA 4BQXA 3UNPA 1YJKA 3LE0A 2OIIA 1JYCA 1QXRA 2E7QA 4AYUA 4CSWA 5CG9A 1C8M2 2ADEA 4GH4A 1RUF1 3OYWA 4Q1RA 3UKNA 3EHKA 4DB5A 1UOGA 3T4HB 1GZCA 4BDVB 3MI8A 2JIGA 1ST8A 3AMNA 1SBFA 3MV11 5M0TA 1O3TA 1HB1A 3V0AA 4C8DA 3GGLA 2E51A 2Y38A 4TTGA 1JN2P 2WN3A 4AVCA 1L3JA 2VM9A 1PMJX 3HMYA 2HWB2 2ZKLA 3MGUA 3RYPA 1RHI3 3K2OA 4S2FA 2FZ2A 4Q4W2 1IPJA 2ID4A 4Y20B 1R1A1 2JG9B 1SEFA 2WZR3 5FDBA 2IXIA 1SZBA 4MUVA 1KITA 3POWA 3TRSB 1VR3A 4P02B 1PNGA 3NL1A 4MHUA 1GUIA 1W04A 4WVVA 2P1BA 4WM7B 1W8WA 3BTAA 3UGGA 5IFTA 1EP0A 2FDFA 1FOD2 3SH3A 2DCZA 5EHDA 4DEVA 3NV4A 3GHNA 1IG0A 2KA3A 3FMGA 2VOTA 1UZYA 4NHXA 3POIA 4IESA 3WSOA 2J1AA 2CAUA 1DQ4A 1Z7S1 2XVKA 4Q2FA 1HX6A 2VW0A 1MEC1 1PGW1 2YZ4A 3RMXA 1LAJA 3I4IA 1BVP1 4CEYC 3ACHA 1PVC2 1J3PA 1LNSA 1AHSA 1XPWA 2W87A 4FFFA 4QPWA 3WY6A 1ZRRA 3AZWA 4ATFA 5FOJB 1JBCA 4FSJA 2PAEA 2GH2A 1UOBA 3N9OA 2WWSA 1GWKA 4EWEA 2R1DA 2C9KA 2A6VA 4XTMA 2XBO2 4XFHA 2I2SA 3DEMA 3K75B 4RQPC 2DTWA 3POSA 1GP4A 3PTYA 3IN9A 4Q4X2 2KD7A 3DL3A 1XB9A 4LK6A 3I2HA 4GKXA 3ENRA 3E6BA 3S30A 3D82A 1RL3A 5CAZA 5BNOA 1JW6A 5ANNA 2WS93 1YIPA 3V65A 3OGRA 4SBVA 5DG2A 5JXHA 3VDDA 1JZ6A 5T52A 3HT1A 4KI5M 1WLTA 3VBSB 2XVGA 4W8JA 1K3IA 3BOPA 2WABA 3CQOA 3J8F1 3O0XA 3PUQA 4BLJA 4DUVA 5BY5A 5GZDA 4CCEA 1GICA 4YGDA 4BPZA 1UYZA 2VMEA 1MS5A 1OMIA 1RUJ1 1V0AA 5EZWA 3BU7A 1HIXA 3Q8AA 4IGQA 1OD5A 1WLDA 3FZ3A 1OHFA 3GHMA 4B7KA 4UWDA 2JKXA 4XF9A 1FNZA 1TQ5A 3MIBA 2CV6A 2DWRA 2P3YA 2OPKA 1ALYA 5CFDA 4CU6A 3VL9A 2GALA 5FJKA 1UY0A 2VNGA 1CIWA 3PL0A 3U11A 5DUXA 5IW0A 2W1WA 3ZN6A 1LOBA 2ZMKA 3BTYA 2QE3A 1YCIA 1MS4A 2QFEA 2VGDA 5FZIA 5G04L 3WDTA 3TWIA 4AGRA 1VBC2 4YGCA 1OI6A 3QH6A 4LQRA 1JZ4A 2LROA 4GIQA 1VBB2 1YQ6A 1LESA 4LBLA 3SQOA 5CA6A 1G6NA 1W8UA 2FDKA 2WO7A 3O1UA 3AYEA 1ZBA2 3SCHA 3ZSLA 3M3OA 2IXHA 5G05L 4OUEA 1JH5A 3WW2A 1JZ5A 3FX3A 3VD4A 2J1TA 3HT2A 4NN0A 5JWPA 5DMYA 1OUXA 1JTZX 2QKDA 1IS5A 2ZEXA 3M4FA 1M06G 1F5FA 5FZMA 5DAWA 5J37A 3AZYA 4JQTA 4CCCA 1MEC3 2E32A 4D7YA 2DCKA 4PIYA 4BISA 4OCTA 4W6YA 5ANQA 2LM3A 3DV8A 3VZNA 1Q43A 5C7GA 4FOYA 1FV3A 5DAQA 4H55A 1V00A 3O14A 2D5FA 2WNVC 4O61A 2RM21 5CKQA 3L9JT 4DXTA 4HG6B 1JOJA 3PUAA 3C7GA 4YM2A 3O1PA 4LO4B 5FMCA 2ZJCA 2HWC2 4EN9B 5K0UC 5F3IA 4OQ8A 1IS3A 2CGOA 4Y4YA 4LXLA 1W9WA 5JIUA 2MEV2 3VBSA 2D93A 2CGNA 2YG0A 4JGZB 2VQ0A 1XBFA 5FZ9A 3E97A 3DXUA 3ON7A 1UU5A 1NUKA 5DABA 1V6OA 1RXGA 2A7AA 2VUCA 1RUC3 2ZHLA 2BRTA 4NR1A 1GMMA 1UXZA 3H3ZA 2R49A 2ADDA 4HETA 4X8NA 1ZZ8A 1XNBA 3WT3A 1QDCA 5F37A 2VE1A 3VD9A 2QQIA 1TMF1 4B1LA 3T0DA 4K3UA 3N9NA 4OHYA 1VJ2A 4JRAA 4UFIA 4X8PA 4BIOA 3C7FA 1R083 1OQEA 3I2KA 5LRRA 1CIYA 4XEZA 3THPA 3AFGA 4A42A 1GKBA 1GLHA 4Q4V1 2ZGTA 2ET7A 3IAQA 1AYN2 2D6NA 2BNNA 2R7EB 3GXUA 3POFA 2Y6HA 1F4HA 1AL0G 3HQUA 3NSTA 4QGMA 2Q8EA 4Q8KA 5FZAA 1G9BA 2PAMA 2WSUA 5CIRA 2WJSA 3E5XA 2ARBA 5DAXA 4GAZA 1V6JA 2R041 5IK4A 1R082 2DBIA 3LDKA 4XCBA 2GC3A 5A33B 2Z79A 2BVBA 2D3PA 3OBTA 4XDQA 1JZ2A 3CNAA 5FY9A 1J1LA 1HRI1 1OVSA 5DAVA 5EJ3A 3ZSJA 3IMMA 3INAA 1U5IA 4AK3A 4AE2A 2W95A 2VCMA 4XMAA 4LO5B 5FYZA 1KFXL 1K5MA 4XUQA 2R063 4ZXEA 4OVEA 2OT7A 3DECA 4CPBD 2DU0A 1AVBA 5ACA1 1DLCA 1W2TA 2FBEA 1YYNA 5FPXA 3IIIA 2J1EA 1F2NA 2P6CA 2J22A 2WFF1 4MSVA 4Q8LA 5F6KA 4GA9A 4BMBA 2BU9A 4HONA 1JS9A 1OVPA 1W8NA 1A78A 1LGCA 1S0BA 2PHLA 3GCXA 4IE7A 5FP7A 3JU9A 4DZGA 2NMOA 2NZ9A 3KCCA 1DQ2A 4XDOA 5LB6A 4YW6A 4AWDA 4AVSA 4EQVA 1NT0A 2ZACA 5EXOA 3T09A 4IXLA 4WM8A 4DXZA 3KV4A 5LBEA 5FP4A 4OHZA 1GBGA 1AR62 2D5HA 1IPKA 2WIIB 4PIXA 4FTSA 3HNBM 4BE3A 2XHNA 1L7LA 2XGXA 1FPN2 1Z78A 3I3DA 1RINA 3AVSA 2VMGA 2YGMA 1FV2A 5IUQA 3UT0A 2X29A 2WZPP 3D3AA 1WLWA 3AP5A 3PJQA 1EAH1 2E53A 3ZXLA 1K45A 4NHKA 4YW1A 1VBA1 3W20A 5IWFA 3O1RA 1NXMA 3WXPA 4PLNA 2AEZA 3VDBA 3U78A 4E4SA 2C5DA 3ILRA 3M7AA 4CCNA 2QVSB 2DUOA 4CDXB 4F83A 4TWTA 4RGGA 5C8CB 3U37A 4O65A 3LDBA 4HKOA 4RHV2 3TN92 4BQ1A 3U10A 4K7JA 1RUI1 1WW6A 2AUYA 2XB6C 4NRMA 5FYHA 5J1XA 1OD3A 4FQ4A 4ARXA 1AYM2 2ES3A 2Q5TA 1ZBA3 1NQDA 4MXVA 1IHMA 2HYXA 2P2KA 2FCTA 4OYUA 5KC5A 4NIGA 1VBE2 1CAUA 4OHWA 3BI3A 4XUOA 4AFDA 4J1WA 5KHGA 4YM1A 5KHIA 3BPZA 3PURA 4FFGA 4MGQA 4XFGA 5F2WA 3S5AA 1PGL1 4E8CA 5FZOA 2YB7A 3PNAA 1KEXA 2Y6JA 3PVNA 1XQNA 3NJVA 2CSGA 1HRI3 1C1LA 2DF7A 3CHXA 4IEVA 5FP9A 3WCRA 3ZXAC 4FAHA 4MV2A 4LHNA 4YZ1A 3V56A 1TG7A 1R1A2 3OGSA 1S0DA 3PUHA 4LHKA 2VMDA 1UMZA 2AREA 4PHZA 4B29A 5BPXA 3KF5A 3FUOA 3T2PA 1TEIA 2IWGB 4CEWA 2DFCA 3IZOA 3KGZA 2ZGPA 3LOBA 5LEJA 1SLCA 2YFUA 2H6BA 4QPIA 5JI7A 1IOAA 1BVVA 2QQLA 1IQDC 1PHMA 1HJFA 1PO23 3GDBA 1PO12 3MO4A 3R4DB 3OUHA 5FY1A 3U1XA 2W1SA 2B4KA 1PM7A 1LGNA 1RUE2 2C26A 3UGFA 3VZMA 2ZGLA 3MLLA 1VB4A 3OOXA 4C0HA 3OBAA 3GYDA 2PQSA 3ZXEA 1DBNA 5FY8A 1RMU1 1SACA 4XETA 3WF3A 1CONA 4NMIA 1CD3G 2NMNA 2VNRA 1E5HA 2W39A 2JWPA 3B7MA 3OUIA 3ZMOA 2WC2A 2VR4A 1QXJA 3HEIA 3NNGA 4RSUA 4MGSA 1QEXA 5FYVA 1BKZA 4GQ7A 4E2QA 2RS13 4P9XA 1EAH3 5APAA 2B8MA 4NWVA 1VBA3 5FY7A 3PHMA 3QD6A 3WF1A 2P5BA 3LEKA 1RVF2 2JG8C 1O5LA 1W8ZA 5JUVA 2WLQA 4EZ4A 5A7PA 3V0BB 4HPKA 2GDFA 3THDA 1UIKA 3ACLA 3JQXA 3VHPA 1HB3A 4UFLA 1KD7A 5A32B 5BNPC 1PZ9A 5FWEA 4W4ZA 1N3OA 4E8DA 3JCIA 1BLZA 1RUI3 4B1MA 1MS3A 4PI2A 5F9TA 4QKBA 1QQP3 3BN6A 2XJTA 4GMP0 4Y1VA 3ZYBA 5JZGC 1WLCA 3NRUA 4XURA 4JDOA 4AI0A 2OQ7A 1QJY1 2Y6FA 5DZEA 1L7RA 5C9AA 3I2OA 4AHWA 3LD8A 2Y6KA 2V73A 4I01A 4DNYA 1WW5A 5JZGB 3IIAA 4FP3A 1MS8A 3AKQA 3NMBA 1US3A 4Y5SA 4UF0B 3SMHA 1NA1A 5AFBA 2BWAA 3OBRA 3OUJA 3WQBA 3ECQA 5L9BA 4EYUA 4P5YA 4XFAA 5AC93 2BV4A 1JYNA 2Z4FA 3I7DA 1VBC1 3GZAA 3GBWA 2XJUA 2FMDA 4Y24A 1NOVA 1UCXA 3O5SA 1SLLA 4A41A 3ZR5A 1F15A 4K20A 1N1VA 1XYNA 2QQNA 4N53C 5FUNA 4LLOA 3AYDA 2PHFA 5FZGA 3RGBA 2A5ZA 1V6KA 4FQZA 1YRZA 2E6VA 2GZWA 5F8PA 5L7OC 3NO8A 5L7OA 3VGIA 2FDGA 3MLKA 3D0JA 1MACA 1RUD1 3HBKA 1DF0A 4AVVA 1U12A 3CBNA 1AL23 2W9XA 4DRRA 4MGZE 5BNPA 4R9CA 3VBOA 5L7OB 1EUTA 4IEOA 5EIYB 1NY71 4NOTA 4XBLA 3ZFGA 5F39A 3N7MA 5A32A 1W6OA 4XBQA 4NAOA 1F31A 3O12A 3KQ4B 3KCYA 2GNDA 2VVEA 1RMU3 5K4LA 3WNXA 2B46X 2XJVA 4CDWC 4YM0A 1BJQA 1ULPA 1MR5A 3DYPA 2RS52 3GCWA 2H0BA 3RVHA 3UJOA 5HV0A 3OF1A 3O1TA 1IKPA 1ZZ7A 4TYSA 4CCKA 2RS33 2WNUA 4HZFA 2CNAA 2UU8A 4JVAA 5E16A 1Y9GA 5FPLA 5IVJA 5HCHA 2ZGNA 4G9SB 4KWJA 4L99A 5AVPA 3VHNA 1DQ1A 1UQXA 3HN3A 2WRAA 5JR7B 4OHXA 3ACGA 2VUDA 5C6CA 4Y22B 4UF0A 4I0WB 4MYEA 3KT7A 5IVEA 1LOFA 1Q8SA 2ZMLA 2WZ8A 3JUUA 3S0MA 4FOWA 3J9SA 4JGYA 4QT6A 1X7NA 3SH4A 1OQDA 2ZOEB 4Y26A 1SQ4A 1GANA 2EVXA 3WX5A 2PHUA 1VLNA 4PT6A 2X5IB 4L97A 5B4XA 2I74A 5LA9A 4YM3A 2VW2A 2XBO3 1SBEA 1QJY3 3BVCA 4QHBA 3DGTA 4YZ5A 3T2OA 2UURA 5J7MA 1W6NB 2JJ6A 2HWC1 3W21A 1RC6A 4CEYA 4WM7C 2ZX1A 1WBFA 3K3NA 1W3VA 1YHFA 1W2OA 1NCQA 2MEV1 3JQWA 5H9QA 4XFFA 5CFDB 1UY4A 4C1WA 1ASJ3 2ZGQA 4A45A 4OUMA 2W68A 1YI9A 3F95A 5LA1A 1RVF1 2QZ2A 5F7UA 2ARXA 2J1SA 3NW4A 1NZIA 3WG3A 3QLQA 3IBMA 2ZEYA 3N7LA 1VBD3 5F32A 5FK8A 4EN7B 5F3GA 4AHZA 2EIDA 3N35A 1PM4A 4JHTA 1WD4A 3LEMA 1FMD1 5BNQA 5A7SA 1UWWA 2ZS6B 1JODA 3T30A 4AR2A 1Q56A 1W8HA 1LOFC 3NNFA 4WBBA 4Z2AA 1IKQA 1O3RA 2QQJA 1WW4A 2ORXA 1H2KA 1ND3B 1BBT2 5A1FA 1QJX1 3KHCA 3Q9OA 4EJRA 2WFF2 2J1UA 3A22A 3PMSA 1OOPB 4MHRA 5A1AA 4IV3B 2X05A 1DGLA 4NHMA 4N90A 1ULCA 1F5JA 1A8MA 4Q29A 4LOSA 4WVZA 3WF2A 2YFZA 3SKJE 5DDJ3 2B42B 3NWKA 5FZ6A 2JE7A 1STMA 2ZGUA 4S2DA 3OB8A 3VDCA 4M3CF 3MW4A 5FLHA 3VZJA 1BCXA 4EN6B 4KH9A 2WL1A 2HWE2 2EIEA 2VQUA 4HFSA 1CZTA 4FTBA 3CJIA 4RD7A 2ZEZA 4YNIA 3OEAA 2BNMA 2D6MA 3T1LA 1WMFA 3N7KA 2W52A 3HVDA 2GNTA 2CHHA 2GMEA 3C3VA 4CEYB 3WLUA 1GQGA 2VQTA 2P17A 4BK5A 1OPOA 3IPVB 1WKYA 2G9ZA 4N43B 4E27A 1S0FA 2WZR1 1YEWA 2YPDA 2E9QA 3H3UA 1NY72 1O5UA 1SFNA 2DCJA 2RV9A 3MFCA 4OULA 4BXFA 4FT8A 2LTNA 1BEV1 2CTVA 3QCWA 4Q27A 2R30A 3ZOIA 5C8CC 5BXXA 1AYM1 5T5JA 1AR61 1WUVA 1S2KA 4RQPB 4CDXC 4OI2A 5C8CA 3RZGA 3HBZA 2XHKA 5BYNA 3ZMNA 4BWOA 4Y22A 1H9WA 3AZXA 4HBNA 4IEPA 1GNYA 2TNFA 2HBTA 5E89A 5CZKA 4BLIA 4Q4X1 1PIV2 3LAGA 1HRV2 2MHFA 2IXJA 2AZ5A 1CR7A 2EAKA 1NAEA 1ZZ9A 4OQ9A 3LA2A 3CIHA 4IL7A 2XJSA 1Q5OA 4MADA 4AFMA 1ENSA 2GAUA 3AMMA 1VBD1 3LFIA 4HXCA 2F17A 2CGPA 1XE0A 1T6BX 2JDZA 3KVBA 1EY2A 3TN91 2QUOA 3RJRA 2R062 4IETA 2E31A 1W6OB 1QQP2 2W5FA 3RI9A 2VPVA 1JZ3A 4EN8B 3S5QA 4JCKA 1PMHX 4NROA 3DYOA 5T54A 3AL6A 3FHQA 4QDSA 3U4SA 4QDQA 1FAYA 1OKOA 1VBE1 1AR73 1H4HA 4EZHA 4KL1A 3ZN5A 3CJIC 1E57A 4BQYA 3PIGA 5DZFA 4FXKB 3H7JA 3HOBA 3VBFC 3WG1A 1F9KA 1TME1 3SEEA 4NPRA 5FO9B 5JMCA 3I49A 2PHWA 3NV1A 3P3NA 1M4WA 5A6XA 3OBZA 3A4UA 1RUJ3 3DKQA 2J42A 1LJ7A 4QX1A 2FDIA 4ZXKA 1FPN3 1RUH2 4L0PA 2D98A 3IPVA 3WHUA 1YFXA 4FPJA 1GOFA 3AKPA 4I0AA 3TBDA 2A6WA 4DOUA 1S0JA 3ZX7A 4META 1CAWA 2GNMA 4LBKA 2D6LX 1YNAA 3ZPYA 4U36A 5IVBA 2RHPA 3X29B 1ZBE3 4XHXA 3A7QA 2J1RA 4BB3A 1N47A 2X5IC 3VKMA 4URTA 3JD71 1K5JA 2WS92 1XNAA 5IHRA 3RYRA 1BBT1 2DFBA 4GXLA 4NWWA 4UFKA 1LOGA 3BCWA 3QOPA 4QXHA 3USSA 4A6OA 4XPVA 4ASLA 5T5OA 4BOWA 1WWYA 1Y43B 2IC1A 2R1BA 3PLQA 4O9EA 2ORZA 4FVVA 4XMIA 1MZFA 2J7MA 2JDMA 4PF1A 2IFRA 1PNFA 1QY4A 4JKLA 4Q4V2 4XIKA 1J83A 5JPNB 3T2TA 4FCAA 4LITA 4YVSA 2BDRA 3J7LA 1RUF2 3LQCA 5A3LA 1OT5A 5B2GB 2HWE3 1W0OA 1W9TA 1KJRA 1VAKA 2Q8CA 1RXFA 4RGAA 1W6PA 4M3CB 2C0ZA 5C3OA 3BU0A 1O3SA 5LBCA 1W0PA 4XFBA 5I8SA 4ASMB 4LR4A 1JUHA 1LOCA 4N8MA 4R4XA 2WINB 4AEMA 1I3HA 1OH4A 1Q8VA 4XAEA 4XC9A 1YQCA 5FBJA 5FXZA 4D8MA 4ES8A 1RUNA 4JGZA 3SITA 2HWB1 4ZKTB 5GALA 4I3PA 3H42B 2QQUA 2PHXA 2RM23 3KF3A 4GKYA 1ZRFA 2UYBA 1HN0A 2WO2A 4CCOA 2QCSB 3WF4A 2DVDA 5FXVA 2P34A 3KVAA 4MGTA 1J58A 1DGRA 1HXS3 2Q1MA 1N1YA 3POGA 4L8QA 2ZAAA 1C5HA 3MEPA 1VBE3 1HV1A 2VMIA 3LCPA 5LW9A 5FY0A 4P9LA 4NUBA 4LBQD 3AKTA 2AH2A 1YFYA 5FZEA 4RN5A 4IE5A 2UWCA 2PXJA 4Z2WA 1W6MB 1W05A 2QBXA 4XZUG 2BBVA 2X09A 3H1WA 1PIV3 4XUPA 3NV3A 4LUMA 4NRQA 1QU0A 4LKEA 3VD3A 5C4WC 3ZFEB 3ZYIB 1W6NA 4N7UA 1H4GA 5A70A 5KBFA 3ZVXA 2OS2A 3ELNA 1R1A3 3ZYPA 1UMIA 4ZZ8A 4AAXA 4ZHNA 1R081 5FPZA 2ZZJA 1UIJA 4AQTA 1JU4A 2DVGA 3ETPA 3Q8FA 4QXCA 3N7JA 4UAPA 1CWPA 1WA4A 5FP3A 5D1IA 5I0SA 5JAXA 4HLTA 4XF1A 5D2AA 2R072 3VBFB 5I8TA 5FKCA 3VZLA 1LTEA 1W8FA 2OUJA 2WSVA 4UT5A 4JKKA 4QQHA 1ZZBA 3WUCA 4N43A 2XONA 1XU1A 3N36A 2CAVA 2OXBA 2A3WA 3LIGA 4P9IA 4ARYA 5EV7A 3MIEA 1NCRC 1BBT3 2JDKA 3WDVA 5C3SA 5KXEA 4PLMA 2R043 2VO5A 2XXZA 4AI9A 4GB32 2VZVA 4NIHA 2WFPA 3ES1A 1UXXX 5F5QA 3KHBA 1I9RA 4QX2A 1DHKB 3KD4A 1VAMA 2CYFA 3AXDA 1MQTC 1PO13 2RS53 4KU7A 4MXWB 5FMOL 4ET7A 2BGOA 3RZLA 5EPAA 1UYPA 4IGOA 3GZEA 3W58A 5A6YA 2RVAA 3FBYA 1UZVA 3RZKA 2AR6A 3VHRA 2UYAA 2VTFA 5BNOC 3BKZA 3P1IA 1HN1A 4IDZA 2Z5WA 2NQYA 3WDXA 2K2SA 2WNEA 1I6XA 2G9GA 3EYPA 4FPCA 4HN0A 1CQ9A 2EIBA 3J7MA 3VD7A 4NIDA 2HBUA 5IVFA 3VL8A 1TE1B 1ZZ6A 4AVTA 3OG2A 2BP6A 1T2XA 1ZREA 1NE6A 2UY9A 4K21A 1AX2A 4LE4A 3M3IA 4LLFA 3AMHA 1PZ7A 3KGLA 3WNPA 1K12A 4LEJA 2PHDA 5EFUA 1W99A 1APNA 2PLV2 2RR12 3UKVA 1CPMA 4XAAA 1AR82 4UXAA 3HJRA 1PK6A 3H8UA 4CDUC 3ZYRA 5FO7B 4A7KA 3V0AB 3MF9A 2BEOA 2YU1A 1RUG1 1SCRA 1I5ZA 4M3CE 1RUI2 1C4RA
chains in the Genus database with same CATH topology
4OLLA 5SV5A 5DUUA 1H1MA 2Z2SB 2YYOA 4XYXA 4COUA 1NXD1 1ZREA 1BZWA 4J1XA 5C9AB 1RB8G 2WT2A 3O0WA 4Q26A 4YVWB 1AR83 1URXA 4XJAA 4IEQA 4UW3A 3VKNA 3PVOA 4EWDA 2G9FA 3IKWA 1C8M3 4JDNA 2VU9A 1TNRA 3V0BA 3A0KA 3MIHA 1RUF3 3DN7A 4LT5A 5T5LA 4LBQA 1WBLA 4MH0E 1LU2A 2GU9A 4R9AA 3S7IA 5C9AC 3NKTA 3WINE 1GR3A 4L9BA 2P3KA 1DLLA 2CWMA 4F7ZA 2WNVA 5FAXA 5K7PA 1XYOA 1CAVB 3FFQA 1GZWA 4XFIA 2VMHA 4D94A 2ZTNA 5L73A 1PO11 1SDWA 1LEMA 2WQZC 1C1FA 3MFAA 5K0UB 1DQ5A 1OOPC 1PGSA 4EROA 4OZXA 3KZ4C 1K5MB 1OSGA 4FOQA 4WZFA 4BZ4A 2DU1A 4DPNA 3UKTA 2XL9A 4ISRA 3UL2A 1IS6A 2D7FA 2HEYF 3SISA 4Y1ZA 2F6BA 2YY1A 2YDEA 1G9DA 3HN1A 3VBOB 4QPIB 5F1RA 1DYPA 1TMF3 2R042 2Y0OA 3EXUA 3WG4A 1Z7S3 3ZIXA 4IQPA 1SMVA 2I07B 2P3JA 5CVRA 2WT1A 2WZR2 4GB31 4IV3C 2FMYA 4MXWA 4K8FA 4GWMA 1COV2 3ZXJA 4XXPA 3AXEA 3S7EA 4HKWA 2W0XA 3BALA 2BPA2 1CN1A 1XXNA 1JXNA 4MGYE 4RL7A 2D3RA 4R9DA 3B9IA 1NCRB 4HKLA 3IT8A 4SLIA 1CAUB 1AJKA 3UJOA 3AFKA 2JD4A 3AKSA 1NA1B 1QJU1 2DURA 3WP3A 4IV1B 1UAIA 2A3XA 2XJRA 3TNPB 1X82A 3AM2A 3RG0A 4AEJA 4FPOB 4BM8A 2PLV3 2RR13 2ZZQA 4PBOA 2R061 2EXKA 2ZHKA 1QNYA 3M3EA 1HXS2 2ZGSA 3N3HA 4I30A 1Y9QA 3C2UA 5C4WB 4LHLA 1CVNA 1SBDA 1XNKA 3I59B 4CDQA 3CO2A 3H7YA 4XW3A 4TLFA 4K1YA 3G7DA 5HI0A 2XJQA 1AF9A 1S0IA 3SNMA 3AP6A 2SLIA 3OTFA 3JD72 1RUOA 4YLZA 4R9BA 1GV9A 3GBFA 4FPHA 3ZSEA 2EXIA 4CRQA 4LO7A 2DCTA 5DUWA 4RHV1 1H2LA 3M3CA 2W08A 1QOSA 4LBNA 5I0RA 2D6OX 2LALA 4N9HA 3SH5A 4HVRA 2BW8A 2PTMA 3QACA 2ZKNA 5T3NA 3ZFFC 3ZXGA 3P3PA 3ATGA 4XF0A 3FUQA 3VLBB 1O4ZA 1V9U3 4AHYA 1KFUL 1GYKA 2VG9A 4U2AA 2K9ZA 2RMU2 5IT6A 3CLPA 1ENRA 1MS1A 2HEWF 1KS4A 4MVTA 2MPFA 4W6XA 4Q0QA 1HQWA 5LK7B 4E4DX 4ZU7A 2QDRA 4XIOA 1ULEA 4NO4A 4IV1C 3AZVA 1XE8A 4AI3A 2Q1ZB 3KB5A 4PDWC 4EWAA 1VRH2 5FQ0B 4BIFA 3FFZA 4XJ9A 4WM7A 1RUC1 4LO6B 2XLAA 3LWCA 1YXWA 5FCCA 1D2SA 1ND2B 3TNQA 4CZSA 2HWC3 1COV3 1DG6A 1W6MA 2XG3A 5IK7A 1DQ6A 3DF0A 1H8VA 1MVEA 4CDXA 2MEV3 1UN1A 3WQ1A 1BMV2 1QJZA 3B00A 2GN7A 1RHI2 3MPBA 5FMOS 3H50A 1NZCA 3LSDA 3NKGA 2VQAA 4FPYA 3W59A 1OFNA 1AXYA 3R4SA 4QX5A 1RVF3 3WOGA 2NP0A 4Y5Z0 1LHOA 4YG0A 2A6ZA 1BXHA 3ILFA 3ZDSA 5HBAA 1XRUA 4IEWA 1H8TB 4Q0SA 4XTPA 5JLVA 3OCPA 4QQ2A 1H1IA 1FMD3 4P9WA 2Q4SA 5J98B 4F8AA 1DZTA 1W6PB 5I8YA 4I02A 1S0GA 2BQPA 2LUWA 4CDUB 4UW5A 1QJX3 3TOJA 4H7MA 4XQWA 2IZWA 4YG3A 3B93A 4Y1UA 5D8AC 1W6QA 3VKLA 4A2UA 4K6BA 1ZNPA 1VIWB 1Q3EA 1WCKA 2PYTA 3L2YA 3OD4A 4JRLA 1V9U1 2JENA 2AGSA 3B9CA 4RA0A 1FNYA 4FPFA 1Q8QA 5IK5A 1CAXB 1MQTA 1QQP1 4LNVA 1X33A 3VKOA 1YUDA 2ERFA 2FZ1A 2DVAA 2XLFA 1JYIA 4QM8A 3U0ZA 1O4TA 1QJY2 5E88A 3OY8B 1LEDA 2R32A 5A33A 1A6CA 4LUKA 4YRDA 4K40A 3RWNA 1VB2A 1JUIA 3LGRA 4W6WA 5AC91 5EWSA 4CDWB 1RUE3 4RS5C 1D4M1 2A73B 3VBRB 2QJVA 1EV11 1R091 2ZA9A 1GZ9A 5I93A 1RUH1 1REEA 3ETQA 3J26N 2F4PA 2WKKA 3USUA 1HKDA 1LODA 3E5UA 3GNEA 1AR63 4QQLA 5FLJA 3SCFA 5J96B 4D7SA 2FHRA 1RUG2 4CP1A 1RJ8A 2NPIA 4I3GA 1RIRA 3B94A 2Z69A 1QGLA 3VV1A 2JG8A 3IM0A 1HLCA 4UBGA 1FYUA 3H9AA 4YZ4A 2EXJA 4P14A 2HWF1 3ZO0B 3DPRA 3ZFEC 1XNCA 3WG2A 4AI1A 1POV1 1VRH1 1SCSA 2ZCWA 1PZ8A 1TME2 2VNOA 4BMEA 3LSEA 1D0HA 4QPIC 5FBZA 5J48A 4Z07A 5K9YA 1Z0HA 3WHTA 1FT9A 4Q0UA 4QMAA 3AMQA 3GBGA 1ULFA 3B69A 4QD2A 3JBG3 5KXBA 3AJYA 3IDEA 3CL1A 2O8OA 3AB0A 4XOGA 1UX6A 1EPZA 3E6DA 3VDDC 1B35A 1W6QB 3KQRA 5IK8A 1RHI1 1C28A 1OOPA 5K8SA 4CDUA 5BNNB 4AW7A 1OKQA 3OJBA 5T50A 4PLOA 2X5IA 3ES4A 2B7YA 5CBLA 2V09A 5DG1A 4ORFA 5SV8A 2HWD1 2VUJA 2JX9A 3URFA 4DS0A 1A8DA 4QGLA 5GLWA 2DUQA 1MZ5A 1RUE1 2PAKA 4IEYA 3AP7A 2PHRA 1AR72 3MF6A 4FBFA 3ZN6B 2VUAA 3K48A 5KWRA 1HRV3 4LBJA 2GSYA 3I54A 1WCSA 1RMU2 2GMPA 1V9U2 4COYA 4FP2A 4XXAA 4LA3A 2OW4A 5CNAA 2R071 4YYOA 4M01A 2ZPXA 2HWE1 2RS32 2EA7A 4G3YC 4BYYA 4COVA 2BFUL 2RJKA 1FMD2 2JICA 2WNUC 3B5LB 4FOVA 1LRHA 3VZKA 2BYVE 4PQ9A 1S1AA 1OLQA 2VVDA 1ENXA 4HVQA 3VBUB 3M1HA 1DZRA 2IXKA 4AEDC 3BIWE 1LU1A 2HYKA 2PFWA 4YW5A 5DDJ1 3RMYA 1OA2A 3GZTB 5HCBA 2IFWA 4S2GA 1VBC3 4AXOA 3ALQA 1B35C 4N53A 4YZ3A 2NN8A 5H9PA 1YWKA 2ZX4A 1UKRA 1U5ZA 4OHVA 3TYJA 3WW1A 4TSVA 1QNWA 2IXCA 1NCQB 2A6YA 2WNUB 3M8LA 1IGOA 1NCQC 1V6MA 4JTNA 3JBG1 4PJYA 1LULA 4B4PA 2VOWA 1LHWA 1PMIA 2TBVA 1QDOA 2B5HA 3IDBB 3ZSMA 5KC5A 4NVPA 4GMP1 2I45A 4KNCA 3VUOA 1ZBE2 3FLTA 1AL21 1D2QA 4MX3A 4OFGA 4B3NA 2R16A 3ZXDA 5GZGA 4DY3A 4HT1T 1BEV2 5D8AB 3CF6E 5H9RA 4INDA 3ZXKA 5KXDA 4XFCA 3A0NA 3DKWA 5FREA 1S2BA 4KWKA 3RNSA 2O8QA 1UL9A 3W9AA 3VKFC 1HRV1 4W65A 1RUC2 4HANA 5JSOA 5HCFA 5KHHA 2R6QA 4XF3A 4XJUA 1S0CA 3TB0A 2RMU3 1ZYBA 1PO22 3D5OA 1ZRFA 5KHKA 3KMHA 3ZFGB 4TZDA 3HQXA 2C9AA 2XLGA 4QU2A 2DUPA 2H0VA 1H0BA 4QGNA 1Q8OA 1U0AA 4YARA 2CWSA 1GFF2 2B39A 1G9CA 1BMV1 2OUHA 3RSJA 4C1XA 3QBQA 3VBHC 1MS9A 1ND2C 3MIGA 2SBAA 1ND2A 1ASJ1 1J3QA 5BNNC 4CEWB 4HMZA 3HWJA 2QNKA 1LHUA 4FAGA 1ENQA 5A3MA 2PELA 4Q4W1 2AYHA 1JHNA 4KWLA 1HV0A 2V5YA 3KSCA 5I0TA 2EXHA 1AR93 4Q0VA 4YZ2A 4FO9A 4LA2A 4Q4V3 3EQEA 1N1SA 3B02A 3WP4A 1SLIA 3WP6A 2XJPA 2CY6A 3VBUA 4GMP3 4D69A 5JOWA 4AGVA 2GH8A 1LECA 1RTVA 4DRVA 5EYXA 4CP0A 1CESA 4C91A 4CYDA 4R52A 5HXVA 4IERA 1IS4A 3RRDA 4RR3B 2X8KA 5LK5A 1KJLA 4B4QA 4P5HA 3R4UA 2Q30A 1HQLA 3J8F3 4HN1A 4JV4A 4GULA 2ETEA 3D8CA 3WZ1A 4AFAA 1QJX2 1NG0A 4QPGA 1V6IA 1QHDA 3CU7A 1AX0A 1OQ1A 2XUMA 2WFF3 5CB7A 2WNVB 2UY8A 5JOYA 2HWB3 1YJLA 1ZM1A 4RR3C 4YGEA 3NVCA 1EV12 1R092 2A3YA 2NLRA 3KLSA 1SLBA 2QDNA 4AHXA 3THTA 5GZFA 1HXS1 1I1EA 4E2GA 3E6CC 3DUIA 5BNNA 4Y1YA 1LOEA 1C57A 1BEV3 5AVAA 2PA7A 3HIFA 2OA2A 3JZVA 1AYM3 5I91A 3FLRA 3VZOA 1REFA 3VBHB 2YC0A 3I2DA 1RJ7A 4YVWA 4RS5A 3OPZA 4M0HA 1G8WA 3T1MA 3IMNA 4AQ2A 5FOBB 1V6NA 1OLRA 2P3IA 4QM9A 3KT4A 1DYKA 4R4ZA 3ASIA 1OA3A 1IQAA 1FXZA 5FFOC 4E9KA 1AR91 2A70A 4YVSC 2EIGA 4PF5A 3WDUA 1Q8PA 1ZBA1 4I2OA 3PVBB 1YIFA 1XU2A 3AP4A 4FPLA 1C8NA 1SLTA 4BA6A 3R05A 4ONUA 1QOOA 4UBHA 3FHIB 5GLTA 1X8MA 4H3WA 4JGZC 1KDKA 2NYYA 2YPJA 4Q4Y2 2HWF2 4AFCA 5T5PA 2YV8A 1QWRA 3VDDB 4C90A 2DVFA 4OI1A 2PLV1 2RR11 4AFBA 4Z92B 5JOZA 4LBMA 4XQDA 1N1TA 4Z1VA 1AJOA 4KQ7A 2YHJA 3LKJA 4HK8A 2X53S 1LKNA 3AYCA 1ZVFA 3MW3A 4LTAA 4ATEA 1FI2A 4WM8B 3VBSC 4ISQA 2KXLA 1B09A 1QXPA 3D4KA 3PVEA 3FWEA 3OGJA 4IEUA 1J1TA 4XILA 3ZFFA 1TMF2 2GC0A 2Y0IA 3D0SA 1GZWB 3MIDA 2AENA 1Y3TA 4V1PA 2E7TA 3R6SA 2XH6A 1FOD1 5FLIA 2BTVC 2Q0AA 4LBQB 5JCTA 1ZRDA 1XYPA 4P9GA 1DDLA 4AEDB 5GZCA 5GZEA 3AZZA 5ACA2 2ZGKA 4YGBA 2JG9A 1QOTA 2RS12 1AXKA 5J36A 1A3KA 4EV0A 3MZHA 1B35B 1QMJA 1ZA4A 1FX5A 2UWAA 5D8AA 1CX4A 1QKQA 2ZHNA 4HL0A 2VVFA 4MZUA 4AVAA 1YFUA 3SXWA 1XNDA 3AK0A 3HD8B 4YW2A 1VAVA 5KC6A 1WGPA 3ZIWA 3ZFFB 1QH6A 1G9FA 2WT0A 2VECA 5FO8B 1HDKA 1ONAA 4HSJA 3FE5A 4WVMB 3OYWB 4AI2A 3K51A 4MLOA 1DGRN 3APBA 3JBG2 5LRSA 4JAAA 1VBB3 5GLVA 1UKGA 2NM1A 2EAAA 4WM8C 4COZA 4LE3A 2K0GA 2ENRA 3SHRA 2BWCA 2G4IA 2GC2A 2D3SA 2GC1A 2O1QA 4N53B 1AL22 4XZPA 4DQAA 2ZGRA 5F6LB 4YW4A 1C5IA 4X6RB 4CP2A 1MEC2 1PGW2 2A6XA 5DZGA 5BUVA 1NE4A 4KG0A 1COV1 1S0EA 4YVSB 5L19A 2JEMA 5CADA 4AEKA 2XVLA 3LOIA 3USUB 2OVUA 2BFUS 1CJPA 4L11A 1ULDA 4PCRA 4AGGA 1RUD3 1D4M2 4GWNA 3VBRA 1MZEA 1O7FA 1GNHA 5BNOB 4O9GA 4L2NA 2D6KA 3NV2A 3SCGA 4DMIA 2E63A 2H6CA 1IZ3A 2JKBA 4FTEA 4N43C 1U5YA 2TEPA 1UU4A 2N7GA 5TSWA 3R0RA 3VBOC 1FATA 2Z42A 1FOD3 1DGWX 4N9IA 1HW5A 4FXGB 5E1RA 5JIAA 3GF6A 1UF2C 3PMEA 1GSLA 4A3XA 4OI4A 2Q8OA 2WA3A 2WQ4A 1WCDJ 4GH4C 3CEWA 3RJ2X 1DGWA 3QH7A 1PGL2 1QJU2 1ASJ2 4JTOA 1AYN3 2VH9A 2ET1A 2TUNA 1LHVA 3EO6A 3IDCB 3ZYGA 2YUEA 2XKOA 4YFWA 1ND3A 4XQ4A 3WCSA 1V6LA 2HKXA 4Z82A 1U5XA 2HEVF 2ILMA 4LULA 1DIWA 3UK9A 1SLAA 1VBB1 2VOKA 4YFZA 2BNOA 3WD5A 3RDIA 1H8TA 1ZX5A 3FC0A 5CFDC 2VULA 3CJIB 4M00A 4K1ZA 2MNGA 1DFQA 5DXDA 4BH9A 5KHJA 3U4XA 3MLJA 4IEZA 1X8EA 3B01A 5J09A 1AR81 1RUH3 4AF9A 3VBRC 2ZAHA 2QQPA 2YXSA 1F8VA 4RHV3 1ZRCA 4XJWA 4IEXA 3IWZA 4FPEA 4RQPA 1BYHA 1NLSA 3VHOA 4IV3A 1PVC3 3BB6A 4PBPA 5EYYA 4PIZA 1C8M1 1SFYA 1MZ6A 1KXGA 3EBRA 4M3CA 2GNBA 2DCYA 2WA4A 5CG8A 2XPJA 1W39A 3NJZA 1YI7A 2UWBA 4EN0A 5JOXA 4Y20A 1DU3D 5ACA3 3OD0A 5FQ0A 2O0OA 4AEDA 4R8HA 1LHNA 1MS0A 2EALA 3KCXA 4JGYB 1H2NA 3LZZA 2ZABA 4OI0A 4QPGB 2Y26A 2A75A 1G7YA 4WZCA 4ZU5A 5GJ6A 1NQJA 4XHBA 2E7AA 4F3JA 4Z8BA 3PJYA 2IXLA 4WVWA 1ZZCA 5ABJA 1CAWB 5ABJC 2D40A 3GALA 3E5QA 3FJSA 3MDPA 3MYXA 4N7IA 1BQPA 2JECA 5JDBA 4JDMA 1AXZA 1AYN1 4RR3A 3B3QE 2DYCA 3H1MA 1Z7S2 5GKAC 3WDWA 1H8TC 5AFEA 1AUYA 1ULGA 4XE9A 1CJDA 4KU8A 4H14A 1J3RA 1QF3A 3FLPA 3POYA 4QXKA 3O7OA 1KS5A 1O4YA 4GB33 5FTTC 4XJZA 2ZGMA 5I0UA 4D7TA 2D97A 1KQRA 4JC1A 3ZYJB 2HWD3 3ZFGC 2EF6A 3KS7A 1Y7BA 4ES9A 3OGGA 1DQ0A 3BODA 3ZXFA 2A71A 3NAPA 1PVXA 3NAPC 4PDWB 2RS31 3M70A 2P37A 1REDA 3WUDA 4B4RA 4DFSA 4Q4X3 4GH4B 5BV6A 2XKPA 1D0GA 3AP9A 4AQ6A 1POV0 2D44A 4Q4Y1 5FRAA 1QJU3 5J3UA 4BHPA 2WLPA 2VOVA 1OA4A 1WMDA 3I59A 4CDQB 1UU6A 3J8F2 3OY8A 4GALA 1PVC1 2R073 5GLZA 1S55A 1MVQA 5DDJ2 4WVMA 1AR92 5BNPB 4NHLA 3ZSKA 2FQPA 2XBO1 4DY5A 1MQTB 1K5MC 4BCUA 2QZ3A 3RI8A 4RS5B 4QQPA 1YLLA 2ATFA 2DVBA 3VBHA 1VALA 1O3QA 2YGLA 4IV1A 3UJQA 1PO21 1HQNA 1H9PA 2ZGOA 1UPSA 4CDQC 4HPKB 1T6GC 4QQOA 1AX1A 1VBA2 2ZX3A 4UW6A 3WVJA 4CEWC 1PK6B 1DZQA 3JB4C 1LENA 3H0OA 2ZX2A 3EJKA 3M3QA 3S6PA 3CJXA 5CFCC 1R1ZA 3SLIA 5E8AA 4D3WA 1H2MA 3AYAA 1GQHA 4HSLA 3NAPB 1H1AA 2BGCA 4Q1PA 2OZJA 2XWJB 5H9SA 1YO8A 3AX4A 2RS11 3VBUC 1D4M3 1NYWA 5L36A 5AC92 3WP5A 3JD73 1BK1A 2ZHMA 4OUSA 3WR0A 1X50A 1EV13 1R093 1UZZA 2PHTA 3MPPG 4KGGA 4S2HA 3WW4A 2JE9A 2RJLA 4LO8A 4YVWC 5JPMB 4FPKA 4M0NA 4A7YA 4MGIE 2RE9A 3H1YA 1NLRA 2ZBJA 3GZUC 4HVOA 3RPQA 1N3PA 5CFCB 5GM0A 1LCLA 1UW8A 5ABJB 3WV6A 2XL7A 1YFWA 3MICA 5K0UA 2OYZA 2CL2A 3DPRC 4XF4A 3ST7A 1EPWA 2R0FA 5HCAA 1QH7A 4QPGC 4Q4Y3 2VXRA 2HWF3 4YW3A 3D6EA 4ITCA 3VBFA 4MGKE 5JZGA 2RMU1 4I09A 3RZZA 1VP6A 2DTYA 3WW3A 2OZ6A 2RM22 3FBMA 2ZMNA 4K9SA 4LBOA 1O91A 4AG4A 3LA7A 2B45X 2HWD2 3O0VA 2VOXA 2XWBB 3WQ0A 3TAYA 2YMZA 3LB9A 4RFT0 5C4WA 3MIFA 5CFCA 3RYKA 3U07A 3VN4A 3MW2A 2BUKA 3LA3A 1PIV1 2VW1A 2KM2A 2VY0A 4JQRA 3ILNA 4Y1XA 3RQ0A 4KG8A 4Q4W3 1VBD2 2ZX0A 2D43A 4B7EA 3ZN4A 2GN3A 4HK9A 5JVVA 4P9YA 3V64A 4QPYA 5JSPA 3N4MA 4E4ZA 3AKRA 2JG9C 3TN93 3DPRB 3HAGA 3ME2A 1UD1A 1NCRA 2JXAA 4B8EA 1CGPA 4KBBA 1RUD2 4C0BA 2B9UA 4KGQA 2JG8B 4X6QB 2D6PA 1H30A 2HJIA 1AR71 4H7LA 1AZDA 4PDWA 3M2MA 4P9JA 1OFSA 3G6JB 3RS6A 2RS51 5LEKA 3BOWA 5DUVA 1GNZA 1TME3 4A7ZA 1HRI2 4COWA 1J59A 4AQSA 1G9AA 1TNFA 1LGBA 1WMEA 3L2HA 1FPN1 5CU1A 4JGYC 4AI8A 5T55A 4YSFA 1RITA