5BV6A

Pkg ii's carboxyl terminal cyclic nucleotide binding domain (cnb-b) in a complex with cgmp
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
150
structure length
150
Chain Sequence
TAQARDEQYRNFLRSVSLLKNLPEDKLTKIIDCLEVEYYDKGDYIIREGEEGSTFFILAKGKVKVTQSTEGHDQPQLIKTLQKGEYFGEKALISDDVRSANIIAEENDVACLVIDRETFNQTVGTFEELQKYLEGYVANLNRDDEKRHAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords cGMP-dependent protein kinase 2
publication title Structural Basis of Cyclic Nucleotide Selectivity in cGMP-dependent Protein Kinase II.
pubmed doi rcsb
source organism Homo sapiens
total genus 43
structure length 150
sequence length 150
ec nomenclature ec 2.7.11.12: cGMP-dependent protein kinase.
pdb deposition date 2015-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5bv6A00
2D40A 3FWEA 3LAGA 4XFHA 2PAMA 4IEWA 3I54A 4LTAA 4MH0E 1QXRA 5I0UA 3E5QA 2WC2A 1ZZ7A 2UYBA 5E16A 4META 3U11A 5KHGA 4I0AA 3QACA 2MNGA 2PYTA 5J7MA 3ZDSA 4HLTA 3IBMA 3LWCA 3SMHA 2PFWA 3ETQA 4MGZE 4X6QB 5C8WA 2PA7A 1V70A 1CAXB 2DCTA 5I0RA 5EFUA 4L2NA 2XLAA 3KMHA 4I3PA 4DINB 4N9HA 2N7GA 4NVPA 4XFAA 1RC6A 1XE7A 5JSOA 4GULA 4LLOA 5FQ0B 4E2GA 1UCXA 1X7NA 2K0GA 2ET1A 2GC1A 2Y0OA 4FAGA 1DZRA 1ZRFA 3H8UA 4R8HA 4I2OA 4IETA 1CX4A 5KBFA 3UKNA 3B02A 2Z69A 3IDCB 2B8MA 1PM7A 3FJSA 1J58A 3IIAA 1RGSA 4I02A 1ZRDA 4ORFA 3MZHA 2Q1ZB 1XE8A 1QY4A 4HBNA 1PMIA 3H3UA 4QGNA 5KHKA 1J1LA 1O7FA 2FMYA 1QXJA 4XF4A 3NKTA 5FDBA 1LB2A 2D5HA 1ZREA 1J3QA 4ZU5A 1J59A 2IXCA 3BCWA 3FFQA 4KU7A 4Q0PA 5JSRA 2EAAA 5E1RA 2VQAA 4XFIA 4BHPA 1UPIA 5K8SA 4KWLA 1TQ5A 4E2SA 4B29A 3NW4A 4PJYA 3S7IA 4BH9A 3G7DA 4LEJA 2KXLA 5KHHA 1LR5A 4N9IA 3JZVA 3OF1A 3M70A 3WW1A 1ZZ9A 3PVBB 5LRSA 2H6CA 1OFNA 4MGIE 3OD0A 3ES4A 4H7LA 4XFGA 1CAWB 3ELNA 1CAVB 3USSA 4AXOA 3PNAA 2H6BA 3IDBB 5LEJA 3CO2A 4ZU7A 4Z82A 2BEOA 4HVQA 4IEUA 3KGZA 4EWEA 2IC1A 4QX5A 2IXLA 3EHKA 4LUMA 4F8AA 3FZ3A 3GBFA 5CU1A 1IPKA 3ROUA 5BV6A 3GYDA 1EPZA 4XF3A 3M3IA 3LA2A 1DGRA 1X8EA 4IEPA 1ZNPA 4LUKA 4MUVA 2QDRA 4Z07A 5I93A 3RZZA 4BYYA 1FT9A 4QM8A 2GC0A 2CV6A 5KHIA 3BU7A 5KHJA 3HQXA 1XRUA 1O5UA 4Q0UA 3TNQA 2K9ZA 2MHFA 3OCPA 4X6RB 1I6XA 2OA2A 4XF9A 4HVOA 1LKNA 3RNSA 4Q0QA 2ET7A 1VP6A 4QM9A 3O14A 4PIYA 3DKWA 5FLJA 2O1QA 4IEQA 5FPZA 1YFWA 5BY5A 3HT2A 4MX3A 2Q0AA 2V09A 2XGXA 1O3QA 4AVAA 5AVPA 2IXIA 3EO6A 2IXJA 1EY2A 4WBBA 4I0BA 4XETA 3VHRA 4EWDA 2GU9A 4KU8A 1WGPA 2GH2A 4IEZA 3I59B 3PLQA 3RYRA 2IXKA 1X82A 3LZZA 4WZCA 3HT1A 4KL1A 3H9AA 4HSLA 1J3PA 3TNPB 1Y9QA 4YSFA 1CAVA 1NXMA 5F1RA 3U10A 4YRDA 4JVAA 5FCCA 5EZWA 2C0ZA 2VECA 1ZVFA 3D82A 5CVRA 1Q3EA 1FXZA 2OYZA 3NJZA 3ACLA 4I01A 4HN1A 2XKPA 3CJXA 1GQHA 3LA3A 4AQ6A 2PAKA 4YARA 1CGPA 4OLLA 3QOPA 4RD7A 1ZZ6A 2OPKA 4QMAA 5I91A 1CAUA 4IESA 4XFFA 1LRHA 2Q4SA 3WW2A 5JCTA 3EBRA 1NE4A 4ONUA 2MPFA 4IEXA 3LA7A 1ZRRA 4A2UA 2GC3A 5I0SA 1FI2A 3H3ZA 2Q30A 3H50A 3D0JA 1ZZ8A 4LULA 5BUVA 4JTOA 4IEOA 1ZZCA 5LEKA 1RTVA 1CAXA 4QXKA 2UYAA 3I7DA 1ZZBA 1Q43A 4HN0A 1O3SA 5BPXA 2I45A 5I8YA 4EWAA 3UKVA 4FT8A 4KWKA 2XHKA 4R52A 1VJ2A 1ZX5A 3E5UA 4OFGA 4LA3A 5FQ0A 1O5LA 2PHLA 4I09A 1UD1A 2H0VA 1JUHA 3ES1A 3E5XA 1UW8A 3OGJA 3MYXA 1Q5OA 4D7SA 3MPBA 1YHFA 1SFNA 4K8FA 2E9QA 4HZFA 1SQ4A 3FE5A 4FBFA 1GQGA 2CAUA 4L11A 1G6NA 4HVRA 2BNOA 1IPJA 3SCGA 2BYVE 3WW3A 3I59A 4XFCA 3KSCA 1UIKA 4WVZA 3U0ZA 5CADA 3CF6E 1I5ZA 3BB6A 3CEWA 3KGLA 2IXHA 2D93A 4UXAA 2O8QA 5JAXA 1NZCA 4XFBA 2Z2SB 3D0SA 5LRRA 1HW5A 3SXWA 4BIFA 2BGCA 3RYKA 4QGLA 3SCHA 1DZTA 2ZKLA 4XEZA 4CYDA 2QCSB 4O9GA 1O3RA 3NVCA 3FX3A 1QWRA 2QVSB 1DGWA 2XLFA 3H1MA 4QGMA 3RYPA 3UKTA 1Y3TA 5HI0A 1X8MA 3H1YA 3RDIA 4Q0SA 2XKOA 4XF0A 3ST7A 5J48A 5JR7B 5FPXA 3H7JA 1UIJA 4EV0A 4AVBA 5FLHA 1CAWA 3LOIA 4PIXA 3H1WA 2OZJA 4J1XA 3KCCA 3E6DA 3BPZA 1OD5A 1YLLA 2B5HA 1J3RA 2ETEA 4TLFA 1RUOA 2F4PA 4F7ZA 2ZCWA 5I8TA 4FAHA 4YYOA 3IWZA 1YFUA 3DN7A 3E6BA 2QJVA 4O9EA 3OTFA 2OZ6A 1NE6A 2CAVA 5T3NA 1RUNA 1H1IA 4Q0VA 4EROA 4P9GA 4HSJA 4E2QA 4LA2A 3NSTA 2XL7A 2UY9A 3C3VA 4YNIA 1O3TA 5C6CA 4PIZA 2XL9A 4IEYA 2HJIA 3WW4A 3RPQA 3EJKA 3MDPA 1EYBA 2XLGA 1YUDA 2UY8A 3E97A 2GAUA 4ZU4A 2ATFA 3L2HA 3S7EA 1WLTA 3DL3A 1OMIA 3CL1A 5I8SA 2D5FA 2BNMA 2P17A 2PAEA 1YFYA 2B9UA 3H7YA 3EQEA 2GC2A 5I0TA 2VPVA 3E6CC 2HKXA 2PHDA 4MZUA 1SEFA 2CGPA 4JTNA 4MGYE 3R6SA 4J1WA 3HIFA 4AVCA 1H1MA 1YFXA 3N4MA 1EP0A 2EA7A 3SCFA 3CLPA 1L3JA 1U12A 1NYWA 2PTMA 5J3UA 4MGKE 2QNKA 4JV4A 3SHRA 3FHIB 4Q29A 3DV8A 4HMZA 4IEVA 4IERA 1WA4A 3S0MA 4AQ2A 5D1IA 2FQPA 2PQQA 4KWJA 4MV2A 4XF1A 1RL3A 1ZRCA 2BNNA 5FLIA 5BXXA 4UBGA 1O4TA 1VR3A 5JSPA 2GZWA 1OI6A 2EVXA 1YWKA 1CAUB 4D7TA 4UBHA 2WFPA 3BALA 3NL1A
chains in the Genus database with same CATH superfamily
2RS11 2IVIB 3AL6A 2ZGUA 3I3DA 1BQPA 2HWC3 1Q8OA 1SLIA 4MH0E 1QXRA 5I0UA 1CPNA 3ZSJA 3E5QA 4URTA 1SACA 3AMPA 1PZ9A 1ZZ7A 4W8JA 5E16A 4META 5KHGA 4I0AA 4YVWB 3AZXA 3CHXA 3NAPC 5FY1A 4OQ8A 3D8CA 3IBMA 4CP9A 2A3XA 1RVF3 2PFWA 4CEWB 4BK4A 4YW7A 4D8MA 2HWB3 5IVYA 2PHUA 5L9RA 1OHFA 4E9KA 1QJX3 1V70A 2R072 1CAXB 2DCTA 1P8JA 2WQ8A 5EFUA 3H8RA 2JDHA 5AC92 4L2NA 1MPXA 2ZX3A 3ZN5A 3KMHA 1S0GA 5IVEA 2ARCA 4QXCA 5T52A 1UZYA 1RC6A 5F39A 1NLSA 2VL4A 5HCHA 4JQRA 5FQ0B 1ND3C 4Q8LA 4E2GA 1UCXA 1QNWA 4ISRA 1WZXA 1DQ5A 2YC4A 3ENRA 3P1IA 4XYXA 3AMMA 4BQXA 5FMOS 4FPLA 1U5YA 4N7UA 1KITA 1EV12 5A7NA 3PU3A 1UMZA 2HWE1 4NROA 1SG3A 2C6SA 3MW4A 1OPOA 4R8HA 5J1XA 3FL7A 3KV6A 4BLJA 2DU1A 3OPTA 4C91A 2Q8OA 1JZ3A 4IV1B 1GNHA 1SFYA 3B02A 4QB2A 1FATA 4IW3A 5DMYA 3IDCB 3J7HA 2XVLA 2VZ3A 4IV3C 3SKJE 2IFWA 2W94A 2P2KA 5DG1A 5KXEA 1RGSA 2HWF2 2YV8A 1ZRDA 4FSJA 3ZYRA 4YVSA 3FLPA 4XPVA 4HBNA 1PMIA 4QGNA 2YBKA 5HV0A 2QQPA 1UU4A 1O7FA 2FMYA 5CZKA 3JUUA 1UO9A 2JDZA 1LB2A 2FZ2A 1RUC1 4NHKA 4BB3A 2B9VA 2ZMLA 3TEXA 3S6PA 1J3QA 3DUIA 2AYHA 3D4KA 5LW9A 4P08A 1W28A 4JDMA 2OPWA 2FZ1A 5IK7A 1W6NB 1R081 2ZX2A 5FXXA 3O1TA 5CYYA 4XFIA 1R091 3AXDA 4BHPA 1UPIA 4BQWA 1MS8A 4NRPA 1G86A 2W3JA 4Q27A 3DKQA 4AHWA 4E2SA 1C57A 2VNRA 1FOD1 3P3NA 4P00B 2RMU2 3S7IA 4AQSA 1I1EA 4QKNA 2XBO3 4FPYA 1G9DA 2JX9A 3VKNA 5F37A 4JKMA 4LEJA 5EJ1B 3ZN6B 4N9IA 4YM0A 1AYN3 1RJ7A 3LPFA 3OF1A 4JCKA 2W39A 1CJDA 1E5RA 5IYYA 3VKOA 5LRSA 1OF3A 1N1VA 1OFNA 4MGIE 1GWMA 4CUCA 2VR4A 1MS3A 3CJIB 3ELNA 5BNPC 3W5MA 3MPPG 3P3PA 4CDWA 1HLCA 3VBRC 1TVGA 1OH4A 4YZ4A 3AKSA 5K0UA 4ZU7A 1GZWA 3RZHA 3AK0A 2J7MA 4HVQA 5M0TA 4CEWA 4IEUA 2AH2A 5EHDA 4KG8A 4Q1RA 2IC1A 3WEZA 4AFBA 4NRMA 1ZRIA 2JDAA 1MS1A 4X8PA 1CZTA 3OPWA 2P3KA 4FPHA 1RMU3 2ZX4A 1LGNA 4XBQA 2OQ6A 1QJU3 1S1AA 3MFCA 1W3VA 5CU1A 4DXSA 1S0FA 1YJLA 4PHZA 5LA1A 1EPZA 4QB1A 1E5HA 2ZBJA 3LA2A 2HWC1 3GF6A 2NN8A 5F3EA 1UYZA 5JDBA 4U2AA 5DAWA 2W68A 5T50A 2VNGA 1GU3A 4K9SA 2NQYA 1JU3A 3ZMNA 3RZZA 2X5IC 3SNMA 3BI3A 2BVBA 4NRQA 2R7EB 2Y6KA 1RVF1 3KT4A 2P34A 4FQZA 2HWB1 1FT9A 3PJQA 2WA3A 2YG0A 3UETA 1ULGA 1QJX1 5LY2A 4EN8B 1UY2A 5FZMA 4BZ4A 3D6EA 5A33A 3WP5A 1D2QA 1SLLA 1XRUA 1OQ1A 4P9WA 3WZ1A 3OCPA 3O1UA 4XF9A 2RV9A 4HVOA 1JYXA 3VBFB 4N53A 5C4WB 5FZAA 2PELA 1CN1A 3AMNA 4NMIA 5DUWA 5EPAA 4YM3A 2VQTA 3O1VA 1VRH2 2ID4A 3LQCA 4IEQA 1X50A 1ST8A 4CUAA 4IL7A 4Y5Z0 3EMRA 2ZGRA 2Q0AA 1GP5A 2V09A 3H8XA 4QDSA 3I2HA 1QXPA 3SQOA 3DXTA 1S55A 1UX7A 5AVPA 3JQWA 3USUB 5LCWL 1JH5A 2GNTA 4ARYA 2D98A 1HXS2 1CIYA 1GWKA 4DO0A 3VBSA 4XETA 3VHRA 5GJ6A 1PO22 2WO1A 4R9CA 1O4ZA 4Q4V3 3WG4A 3ZYGA 2YBPA 5BNQA 4CCOA 1ODNA 4IEZA 1UN1A 1Z7S3 4FP2A 1OOPC 2HH9A 4AVTA 2PLV2 4BXSV 5FKBA 4Y1XA 3NNGA 3NNMA 4KL1A 1U5IA 2ZGLA 4FPFA 2L9LA 4SLIA 1H4HA 2VMCA 4S2FA 4L0PA 3WG3A 5SV8A 4FPOB 1OQEA 2B4KA 1LGBA 4B7KA 2WAAA 4KNCA 3I97A 3MEPA 4IGQA 4ASLA 5KC5A 4XCBA 5EP9A 1ZVFA 2ARXA 3OY8B 1FMD2 1HV0A 1YQ2A 3TOJA 5FWEA 5JWPA 3NJZA 2VU9A 1RHI1 2X8KA 3VZOA 1ZBE1 1PVC3 2XBO1 2WO3A 1DQ6A 3K3NA 3LA3A 4AQ6A 1OLME 2PAKA 3SH3A 4YARA 2QZ2A 4K40A 1AYN1 1RUI2 3UK9A 5T5LA 5GALA 1QJFA 1LOBA 3UJQA 1B09A 4RS5B 3T3YA 3OBZA 2GN3A 4QMAA 2QQNA 3RI9A 3RVHA 5B2GB 5I91A 2ZEXA 2C9AA 5CFCA 3HEIA 4IESA 1NA1C 2F6BA 4YG6A 2ZGQA 3PMEA 4NWVA 1PIV3 3EBRA 3U4SA 3B5LB 5L9VA 2R6QA 3MW2A 4CPBA 2JG8A 3U4XA 4LHSA 4ONUA 3ACGA 1VBC3 1AXZA 4GZ9A 2MPFA 4BOWA 4QQOA 4WZFA 4EE2A 3DYPA 4LBJA 5J98B 3VBUB 1TME2 1OLMA 3NV4A 4FFGA 4R4XA 1WCUA 4OMDA 5I0SA 1KFXL 1DGLA 1FI2A 2EXKA 1QH7A 3H50A 3WF4A 4XUTA 3HJRA 4LULA 4JTOA 2G9FA 1BBT3 1VLNA 3HN3A 1QJU1 5GLWA 1XJAA 4TTGA 1AR82 2QQWA 5EXOA 2W87A 3A7QA 4BWOA 4NE9A 5C4WA 1LHUA 2ERFA 3IZOA 4BDVB 5JOZA 1RUG3 2I45A 4DB5A 5H9SA 4ZXEA 4FT8A 4DNYA 4S2HA 4HK8A 3ZFGC 2WN2A 5HCAA 1NY72 4COVA 1GQPA 3E5UA 3MGUA 2CNAA 1O5LA 1BEV3 5JPMB 2DFCA 2W2IA 5H9PA 1UD1A 4RQPC 3VBOC 2BFUS 2ZPXA 1UW8A 1ZA4A 1Q5OA 3MYXA 2OVUA 2LS6A 2Z5WA 3PHMA 3WLUA 2FDFA 2BRTA 2WZEA 4ATEA 4HZFA 3AB0A 3VHPA 2RS33 1SDDB 2A7AA 1RUE1 3LGRA 4L11A 2RDRA 5TSWA 2X09A 1G6NA 1LTEA 1WW4A 3AZWA 3Q8EA 5FZGA 1Q8SA 1W0NA 3T4VA 1C1LA 4MLOA 4NN0A 1UMIA 3WW3A 3BPSA 1NXD1 5A3WA 4DZGA 4QD2A 4WM7B 1N1YA 4XDOA 2WAOA 1I5ZA 3M3OA 1H2LA 1IS6A 2VVDA 3H8OA 1HKDA 3NJXA 5LASA 5L9BA 1NQDA 2D93A 4GQ7A 3O1MA 4Y22B 1GFF2 4OUSA 3PUAA 4UXAA 5ANNA 5IK8A 3RGBA 3ZPOA 2Z2SB 2GALA 3PDQA 4AK3A 1VBB2 1W8HA 3SXWA 2BGCA 5IWFA 3WG2A 4JRAA 4NHMA 3T30A 4LBOA 5FZIA 3TEYA 3SCHA 1SDWA 2ZKLA 1GLHA 3M3QA 4XIOA 3WVJA 2AC1A 2B7YA 4NIGA 3AKTA 3RZJA 1V00A 4K8RB 4O9GA 4XQWA 4Q4V1 3NVCA 5D2AA 2WFF3 3H1MA 1V9U3 5K9YA 1JYNA 1GSLA 1VB2A 2R1DA 3UKTA 3U0ZA 1Z7S1 4O65A 4YPJA 4RS5A 5FREA 3IKWA 2P5BA 5LWBA 3GNEA 2CL2A 2QKDA 3H1YA 4A4AA 3RDIA 2A71A 2XKOA 3V0AB 2ZEZA 4EZHA 4IV3A 4EV0A 3NRUA 1LHVA 2XOMA 4FOWA 5GLTA 5L19A 2BZDA 3VBUA 1OA3A 3H1WA 1KJLA 2OZJA 2RS12 1VRBA 3OB8A 3Q8AA 3KCCA 3BTZA 2GN7A 4JHZA 4HT1T 1OD5A 3J7LA 4Q1PA 1G9CA 3WDWA 4P14A 2B5HA 1DYPA 1JYIA 1VE0A 1SLBA 3B00A 4LJHA 4BJ0A 4JAAA 2VXJA 4HFSA 1SPPB 4CEYB 2PN5A 4PBOA 4XILA 4LO4B 4RYDA 5FO9B 3VUOA 3NMBA 3BKZA 4BQYA 1DIWA 1YXWA 2BBAA 2WNOA 1GMMA 3C7EA 4CCEA 3OJBA 2P3IA 4GH4B 2D6NA 3E6BA 4MXVA 5FUNA 1R1A3 3POGA 2AENA 1F5JA 3WNXA 1JODA 4Z2AA 3ILNA 4M0NA 1PZ8A 1PIV1 1NE6A 5T3NA 2XJTA 2DUOA 1RUNA 4WVMB 3ZKYA 3K51A 3MIDA 4HKOA 1W2AX 2B42B 4Q0VA 5FPVA 1H8VA 2D6LX 3ZYJB 4LA2A 5LBCA 4E2QA 5C3RA 4QQPA 1WKYA 3C3VA 3WHUA 1AX1A 1VBD3 5C33A 4PIZA 1VB4A 1K5MB 1HDKA 2XL9A 4DEQA 2R32A 4FOVA 2HJIA 3AVRA 4XZUG 3MUY1 2K2SA 2E51A 1RIRA 1GP6A 1YUDA 2FDJA 2JJ6A 1VBE3 2ATFA 2P4EA 4L9BA 4RSUA 2ES3A 3OGGA 2HWE2 1OFSA 1OMIA 1REDA 4TLGA 4AEDA 4XQDA 1F35A 4KH9A 3KF3A 4S2DA 3UT0A 1N1TA 1RUG1 4D94A 4WM7A 4LKDA 5C7GA 2GC2A 5I0TA 3MF9A 2JKBA 2Y8KA 3ACHA 4MZUA 2W91A 1JUIA 3OGSA 5AFBA 2DVGA 3ZVXA 3W21A 4YVWC 4OQ9A 1AL0G 1UZWA 1BEV1 2RM23 2WRAA 3R6SA 3KWVA 1G7YA 1W8OA 2QQOA 2NYYA 3LE0A 1GYKA 2V5DA 3M3CA 4NO4A 4W6XA 1H1MA 3VZJA 4AL9A 4CCMA 4E8CA 4CEWC 2R0HA 2CTVA 2E7TA 1AF9A 4PLMA 4AW7A 5F7UA 1BVP1 3AMHA 2VNOA 4XDQA 4OHYA 2C5DA 1RUC2 3MLKA 1QH6A 1UKRA 5J3UA 2RS31 4QX3A 2G19A 1AXYA 1U0AA 1WLDA 1OA2A 2QNKA 3SHRA 2YU1A 3DV8A 3LFIA 4HMZA 4QX7A 4COYA 4IERA 4QPGB 3GBWA 3WXPA 5CBLA 5D1IA 4A7YA 5F6LB 4KWJA 1R082 2UWBA 1R092 1V6IA 2X5IA 1O4TA 4YW3A 3ZOIA 5JSPA 1AXKA 4PCRA 3I4IA 1YNAA 1D0GA 1UU5A 1CAUB 1FOD2 4QQLA 2RDQA 4UBHA 3NL1A 4D7TA 1V6LA 3A21A 3HD8B 5J96B 2BOJA 2JECA 4QQHA 5F32A 2GMPA 1WMFA 1MVEA 2PAMA 3NJYA 1JYCA 1POQA 3AJZA 4IV1C 3ZXAC 3AKQA 1WCSA 1HJFA 2VZTA 4YFZA 3FHAA 4XDPA 1YRZA 4INDA 2UYBA 5C8CB 1ALYA 3JBG3 5HCBA 2VCAA 3U11A 5ABJB 3QACA 5H9RA 2MNGA 3VHNA 4FXGB 4X8NA 4Y33A 3PUQA 4B8EA 2WFF1 4HLTA 3ZXDA 1V9U1 3POIA 3GDBA 4IUGA 1OUXA 4H55A 4MGZE 1SPPA 2WS91 4GWMA 2YHJA 5JIUA 1RUF3 1RUD3 4AFMA 2PA7A 1MS0A 3B7MA 4LK7A 2AUYA 1YI9A 3NO8A 1HQWA 5I0RA 5CAZA 1W6OB 5CKMA 2XHNA 4BMEA 3R0RA 4V1PA 5JI7A 1ASJ3 4I3PA 1PGW1 2X05A 4WVMA 2HWD1 4YZ2A 4NVPA 1LEMA 3KT1A 2BGOA 5IJRA 1C5IA 2OX0A 2VQUA 4Q5OA 5DQ0A 3VD9A 4GULA 1MS4A 1GANA 1GBGA 4UF0B 4CA9A 2E31A 2K0GA 2WWUA 2ZABA 2FDIA 2HWC2 3U78A 2VMFA 1CD3G 1OOPA 2GP5A 2QQMA 2Y0OA 3VBSC 1SCSA 3MIBA 4CCKA 3ORJA 4NOTA 1LOFC 3H8UA 3S57A 5F8PA 4IETA 1OBNA 1F15A 3BYWA 1CX4A 1WCKA 2Y6HA 1JU4A 1OF4A 5FZOB 5KBFA 4G9SB 1IQDC 5HCFA 1RVF2 2Z69A 2W92A 1PM7A 5J36A 2HWB2 3KCYA 5A1AA 3INAA 1GUIA 1QJX2 1HQLA 4AG4A 4HONA 1DLLA 4ORFA 5C70A 2RJKA 3FHQA 4A42A 5GZGA 2WKKA 3CJIC 1QY4A 4UFLA 4COZA 3H3UA 1IOAA 5FO7B 4NIDA 4F83A 4A7KA 1KGYA 4LBQB 1QXJA 4V2VA 3ATGA 1W90A 5T5JA 4AI0A 1BXHA 1PGSA 3NKTA 3PTRB 3PUSA 2Y0IA 2ZKNA 1LEDA 2XWBB 3AC0A 2D5HA 2XWJB 5A7OA 4CVUA 1VBD1 4ZU5A 1QNYA 1J59A 2IXCA 3IPVB 4Q0PA 3WDYA 5JSRA 3N4MA 2DVDA 2EAAA 3SEEA 4ES8A 2VQAA 5FYIA 2AEYA 4QPIB 5KR7A 3ZSLA 2VCBA 1NA1A 3FBYA 4QPGA 5K8SA 4LOTA 4YZ5A 1PZ7A 4TN7A 4CCNA 1W9FA 1N3QA 1TQ5A 1XBFA 4GWIA 5CFCC 4B29A 2WABA 1GZTA 4PJYA 5FZHA 2VQ0A 3UGFA 5FJKA 4CDUB 1URXA 4QKDA 1D4M3 1CWPA 2EALA 5KHHA 2RM21 1GOHA 1LR5A 5FBZA 1D7PM 3J7NA 4KGGA 5BNOB 1A78A 2VZQA 4AEJA 1W03A 4E8DA 3PVBB 1Y43B 2H6CA 4Q4W3 2YPJA 3WNMA 5LA0A 5FXWA 2RHPA 4H7LA 3OBTA 2AACA 5C8CA 1CAWB 1XOYA 5LA2A 4KBBA 2ZA9A 1CAVB 4AXOA 3PNAA 2A3WA 5LEJA 2QQIA 2VZ1A 1YQ5A 3KVBA 2VUCA 4QKBA 4V2WA 4Z82A 4CDXB 1OC1A 3ZFGA 2LM3A 3VBFC 5C4WC 3O0WA 3KGZA 2O0OA 2VM9A 4EWEA 2F17A 4L92A 1W0OA 2A5ZA 2IXLA 2VJXA 5T54A 4ZZ5A 2VMGA 2QQKA 4GD4A 4LUMA 4AAPA 4CP2A 4RQPA 2BP6A 4CXXA 1W6OA 4AI2A 2ORZA 3PUIA 2AREA 4C8DA 3GJBA 1HRV1 5FZ3A 4F8AA 2SLIA 5IVJA 5CISA 1IPKA 4PLOA 1RHI2 2FDKA 3M2MA 3OGVA 1OLRA 1CONA 1SZBA 1ZBE2 4JKKA 2XBO2 3ILFA 3ROUA 1AHSA 3KM5A 2VC9A 5FXVA 3J8F1 3Q9OA 3M3IA 1RXGA 1LAJA 1AYN2 1O3SA 1L7QA 1HQNA 1H9WA 2W47A 4LUKA 3HMYA 1HN0A 2BW8A 5C9AB 1ZYBA 2JDYA 4AHXA 5FR3A 4MUVA 5DZGA 4Z07A 1CIWA 1XNTA 4XHXA 5ISLA 2WR9A 5I93A 1BHGA 3LFMA 2RDNA 3VV1A 2EIEA 2O8OA 4YZ3A 3ZFFB 4QM8A 1RUF1 1RUD1 3IAQA 4GJZA 5FZOA 4D7YA 1N3PA 3ASIA 5EJZB 5FYVA 3FUOA 1O5UA 4Y24A 3WY6A 2QQJA 2K9ZA 4X6RB 2C9KA 2VG9A 1I6XA 1ASJ1 1VMJA 2OA2A 4A3XA 4JX0A 3MV01 5LBBA 1VIWB 1QJU2 4HL0A 5FBJA 4Q4X3 2J1EA 2D6MA 1G9FA 5IT6A 3KHBA 1HB4A 1UOBA 3V56A 1KQRA 3DKWA 5FLJA 2O1QA 3LIHA 4DXZA 5A1FA 4IQPA 4HK9A 1YIPA 1PM4A 3POEA 4YW5A 3T1MA 5DUVA 5A32B 4HPKB 4MX3A 5F5QA 4DUVA 2Y38A 4CP1A 1MEC3 1K3IA 2VD7A 2XGXA 4JGZA 1JZ4A 1ENRA 3JD73 3EO6A 1BK1A 2ZAAA 4MHUA 4RS5C 1EY2A 2VZSA 3CBNA 1G8WA 3VZMA 3ZPYA 1UAIA 1C1FA 5DG2A 5FJHA 2D6PA 4CDUA 2YXSA 1CZSA 1Z78A 4A6OA 2GU9A 4YGCA 1UKGA 1W6MA 1WGPA 1DLCA 1RUE2 1NLQA 2VUDA 1GR3A 5CFDA 5BNOA 3PLQA 2VZVA 2VNVA 2XUEA 3LZZA 1IPSA 3WCRA 1PX4A 2R16A 3VBUC 1WMDA 3HT1A 4WZCA 2EICA 5KXDA 3OUIA 5GLVA 3K3OA 2ZGOA 4HSLA 4XAEA 5FV3A 1CVNA 2A6YA 4I3GA 4YSFA 1CAVA 5F1RA 2VO5A 1W06A 1F4AA 4QKFA 5ANQA 4BCUA 1XU2A 3DGTA 4Y4RA 4CDXA 3HOBA 2C0ZA 1NOVA 1PK6B 2VECA 4E4ZA 2IWGB 1JZ6A 3D82A 4FPJA 3NV1A 4RA0A 4QHZA 1FXZA 4RHV3 4MGTA 1W39A 1GNZA 3WNLA 3AP9A 3ZYHA 4CTEA 1O6UA 4HN1A 3CJXA 4W6YA 2JE7A 3U75A 4ZZ8A 2VVEA 1D4M1 2Y34A 4LHNA 1A8MA 4YG3A 1MVQA 4YW4A 4BISA 5JI9A 3QOPA 4Q4V2 1QJEA 4IDZA 3IB3A 1ZZ6A 4YG0A 3V0BA 2OPKA 5JZGB 2YYOA 4COUA 1W8TA 2AEZA 4HG6B 1Z7S2 4Q4W1 4H2AA 4P9XA 3ACFA 3FBMA 5C9AA 4J25A 5JCTA 4XUQA 1YIFA 2VBBA 1NE4A 2FHRA 2VULA 1AL22 2B46X 4LO7A 2UWCA 4LMFA 5ACA3 3GHNA 3QD6A 1UOJA 3Q8FA 2W1UA 2FD8A 4FTBA 3C7GA 4IEXA 4M4PA 5F6KA 3ZFFA 3O12A 4AEDC 4Z2WA 5CNAA 4YVWA 4M3CF 4A2UA 4QHBA 1KFUL 1RUJ3 3OUJA 4RGKA 1PMHX 4WM7C 1PO13 1NLRA 1KS5A 3D0JA 3ZFEB 2A1XA 1BVVA 2PHWA 4OI2A 2TNFA 4YGDA 4IEOA 5IHRA 3PL0A 1CAXA 2P6HA 4QXKA 2UYAA 3VD5A 2DFBA 3CNAA 4LO8A 4FFHA 4LO5B 3I2DA 3MHZA 4LIVA 2D6KA 4M3CB 1KD7A 1JTZX 4YW2A 2XHKA 3K77A 4PDWB 2YC0A 4CPBD 4CU9A 1Q56A 3AFKA 4OFGA 5A32A 5FQ0A 4XQ4A 1AR93 1PIV2 1S2KA 4I09A 1K12A 3ALQA 1C8M3 2E7AA 2LRPA 1PNGA 3ES1A 1NAEA 3SITA 4DFSA 3TEWA 3WNPA 1W8WA 2YU2A 3I2KA 1SFNA 2YDEA 3RQ0A 2R073 4GA9A 2VMEA 3KV5A 1Y4WA 3HVDA 4FBFA 2CAUA 1A3KA 1NG0A 2NM1A 4IV1A 1F9KA 1NCRB 3WQ1A 5FZ9A 5LATA 4QQ2A 1V6JA 5LK5A 3WINE 1X9TA 2BYVE 2VY0A 4GJYA 1DDLA 1REFA 2ADDA 4Q4X1 4XFCA 3WOGA 1WCDJ 1COV3 3KSCA 2JXAA 3OBAA 1SHWB 4KMQA 4XTPA 5FYCA 5LBEA 3WHTA 4FCAA 4AGGA 3DPRB 4JDNA 4Z1VA 5DUXA 2WNVB 2XQXA 3SC7X 2IXHA 3HR9A 4XW3A 1Q8PA 1RUG2 2YMZA 4FFFA 4L8QA 5FYMA 4AAXA 4AI9A 4FQ4A 3C2UA 5JPNB 1RITA 4ASKA 2Q8DA 5FZDA 5JAXA 1NZCA 3FN9A 5JR2A 1MEC1 2EXJA 1TEIA 2OUHA 1HW5A 1V6KA 3NQHA 1BEV2 3JD71 5LRRA 4AWDA 4CEYC 3LDKA 3RYKA 4NHLA 5F5AA 5C3OA 1W6NA 4QGLA 1WW7A 4BMBA 5FPBA 2A70A 5A3LA 1D0HA 4XEZA 4CYDA 5FP8A 2VMDA 2WDBA 1AR73 1QWRA 1YC61 4LITA 3W20A 5IVBA 1GZ9A 2RS32 3ACIA 1Q8VA 3RYPA 3SH4A 3I3MA 2WINB 5FYBA 2P6CA 2WT0A 2VOWA 1WUVA 5JZGA 1LOFA 5FTTC 2ZHKA 3IMNA 4L97A 3BVCA 3ZN6A 2A75A 2BOIA 5LY1A 3ST7A 3WX5A 1K5MC 3EB7A 5J48A 1H9PA 5JR7B 3WUCA 1PVXA 2VTXJ 4GKYA 5BYNA 2Z79A 3H7JA 4YWAA 2JDUA 4D6SA 4LXLA 3MIHA 3IDEA 4UFHA 3AJYA 2HLEA 2ZEWA 2E32A 5SV5A 1OKOA 3NWKA 3ZYIB 4R9AA 4D6RA 1PGL1 3LOIA 4PIXA 3CJIA 4Y1VA 4QX8A 5FAXA 1CQ9A 1QOTA 1W2NA 4RHV1 3KZ4C 2OIIA 2WLQA 4QT6A 3BPZA 1QDOA 4ET7A 2E6VA 1US3A 1DZQA 2XONA 2VBPA 2WNUB 3OSDA 3OGRA 5E89A 3ZFEA 5A6XA 1LENA 2XMLA 4CZSA 4FOQA 5FP4A 2IUWA 4E27A 1X33A 4BM8A 2X53S 5IK4A 4FAHA 1I9RA 2WFF2 3IWZA 3NAPB 1V9U2 3WF2A 2XDVA 4BPZA 1YFUA 3DN7A 5BNNB 2WS92 3N9MA 1HN1A 3DXUA 3NKGA 4R9DA 5GZDA 4Z92B 3N9QA 1S2BA 2OZ6A 2TEPA 1VAVA 2CAVA 3JB4C 4FPEA 2QQUA 3MBWA 5ACA1 4LKFA 1LHNA 4RR3B 2JE8A 2XJRA 4QPGC 2WNEA 3N9PA 4EROA 1PGW2 4OHXA 2W46A 2HWD2 4PQQA 3JU9A 4ES9A 2R043 4ISQA 3LSEA 4QXHA 4A6SA 4AZZA 1FPN3 2UY9A 2ZGKA 1C3HA 2G9ZA 2D6OX 1RUJ1 3LEGA 3MICA 4DOUA 1PO11 2D43A 4IEYA 1LHWA 2VH9A 1AZDA 1IZ3A 2XB6C 1UX6A 4WVVA 3MDPA 1EYBA 3E97A 1O4YA 2GAUA 4ZU4A 2RE9A 2FCTA 2RJ2A 4IGPA 5F3CA 1WLTA 1RMU1 3CL1A 1YQ6A 3RMYA 4CXYA 3N7MA 4L99A 5FYZA 4NPMA 1YEWA 2PAEA 4PF5A 2B9UA 2EIGA 3DPRA 1FV2A 3H7YA 4WM8B 1LOGA 5DZFA 5FZEA 3C8XA 3VBFA 2DYCA 3X29B 4ZKTB 3E6CC 5C8CC 5DAVA 1SEFA 2CGPA 3QLQA 1OVSA 1NZIA 2ZACA 4UW3A 5JIAA 1ZBA3 1AR91 5ABJC 1JZ2A 4MGYE 1ZM1A 2YY1A 3AP6A 1M4WA 2W95A 4JQTA 4CCCA 4QHOA 1C8M1 2Q1MA 1EP0A 3KQ4B 1H2KA 5CIRA 1UYYA 3THCA 5AFEA 2WL1A 1BLZA 4CE8A 3CLPA 3MW3A 4A45A 1BKZA 2G4IA 4WV8A 4C1XA 1W0PA 2XQRA 4DS0A 1WW5A 3VDDB 1U5ZA 2WZR3 4JV4A 1NCQB 4Q29A 3VKLA 2WWSA 2CU5A 3USUA 3K4DA 4XUOA 4LLFA 2VUAA 1YQCA 4XAAA 5JXIA 4AQ2A 3KT7A 1F31A 2DCKA 4G4FA 5FY4A 1DGRN 4MV2A 2JKXA 1COV1 1POV3 2XR4A 1RL3A 3L9JT 4XF1A 2ADEA 2FDHA 3QH7A 4UOJA 3J9SA 2JB4A 2P3JA 5FZ7A 3ZR6A 1YJKA 2VW2A 2JDPA 5EQUA 2YZ4A 5FMOL 2RS53 2WFPA 1C28A 3BALA 1UY0A 3VZNA 4GALA 3LAGA 4XFHA 1TZOA 4D0QA 4TZDA 2RM22 3WDXA 2BWCA 3WV6A 4LTAA 5JMOA 1ULOA 3VD7A 5JOYA 4AE2A 1SBFA 2WC2A 4NPRA 2BBVA 3GJAA 4XABA 5FZFA 4MSVA 1YYNA 1HXS3 3N9LA 5IVVA 2UWAA 1V0AA 5J7MA 3OY8A 1QQP3 1AR71 1PO23 3LWCA 4QU2A 4Y5SA 2FCUA 1S0BA 3ETQA 4RGGA 3RZGA 3LOBA 5T5OA 2OQ7A 3I2FA 4DPNA 2VMIA 4Q8KA 1JMUB 2DBNA 1JW6A 5IAXA 1N3OA 3IMMA 4UFMA 5L7OB 4NAMA 3O7OA 4P5HA 4P9LA 4YW6A 1UQXA 1V6OA 3UV9A 3OD4A 4LR4A 1IGOA 1UL9A 4CDQB 4N9HA 1K5JA 5EJ3A 4RR3A 3T4HB 3TBDA 1HRV2 4QU1A 1AYM3 4XFAA 5IW0A 1XE7A 4JGYB 5JSOA 3OEBA 4PQ9A 4JGZC 5IFTA 2ZJCA 3GHMA 1WD4A 4AVSA 4EN0A 2Y33A 1BJQA 1X7NA 4B1MA 2JE9A 1DYOA 1OKQA 1K45A 3J8F2 4JDOA 2ZZQA 2ET1A 3SLIA 4D6QA 1UXXX 4UW4A 4FAGA 1BMV1 3Q8BA 1DQ2A 3BIWE 4AI8A 1TNRA 3BOWA 4XTMA 1DZRA 5FFOC 4CDUC 4EN7B 3BTXA 4LKEA 4MADA 3ABZA 5B4XA 3VBHB 3THDA 2VOTA 1ENSA 4U36A 1Y9MA 5BNOC 5CFDC 1PVC1 2TUNA 2ARBA 3HPNA 5CB7A 4BQ1A 4DQAA 3WNNA 3H0OA 2VCMA 3A4UA 1RUF2 3IN9A 3IIAA 4I02A 4AR2A 3BTAA 5DN2A 1QJY3 5A7SA 1O8SA 1XE8A 2VW0A 5KHKA 1XYOA 3KB5A 4ITCA 3B93A 1ASJ2 3VZKA 4MXWB 4CDXC 1IS5A 3IAPA 2R041 3AMQA 1FPN1 1VPHA 3AP4A 3LPGA 4A44A 1VBC1 1BCXA 1NT0A 3BCWA 3POBA 2E26A 3FFQA 4KU7A 1JI6A 1J84A 1F8VA 1LECA 4W6WA 1NCQA 1YQ8A 4XUNA 5E1RA 4C0HA 4K3UA 1IS4A 2C4XA 3N7JA 1AR83 1QHDA 3WD5A 4AFDA 1LJ7A 5HBAA 1W6PB 1ULFA 4C90A 4KWLA 3T0DA 1BBT1 1UOFA 3WP4A 2XVKA 1ENXA 2V72A 2VZPA 4FFIA 4KG0A 4KQ7A 4LORA 5C9AC 3BN6A 5FY9A 4BH9A 3P6BA 3G7DA 1ZBA1 2KXLA 4MGSA 4XVHA 4DIQA 3TN93 4GMP3 3WR0A 1UYXA 3WW1A 3CDZB 4Y20B 4TWTA 2E33A 3K75B 3ZFFC 1S0JA 4D69A 3FMGA 2VCCA 3LEKA 3B01A 4M0HA 4Y22A 4GB33 3WP3A 1E57A 2WA4A 3ES4A 3OBRA 1O8PA 4R9BA 4TYSA 3R4SA 1QGLA 2ZXQA 2BDRA 2WZR1 3USSA 1WBLA 4BQ4A 5HXMA 4Y5TA 4AFAA 2WN3A 4B1LA 2BEOA 4Y4YA 3RZMA 3AXEA 1A8DA 1AX2A 1POV1 1IKQA 1UMHA 2RR13 3PVEA 2Y64A 3WF1A 2GSYA 4Y26A 5T5PA 4B4RA 2FCVA 2ZTNA 5FMBA 2JIJA 4W65A 5DAPA 2X29A 2XJQA 3GBFA 3VDCA 4LKSA 3B69A 4E4DX 2RS51 1R1ZA 2MEV3 1I3HA 2VAUA 2VZOA 4LNVA 3ZN4A 1WLCA 5FMDA 3KD4A 2GH8A 3GYDA 5FUPA 1D4M2 5IVCA 1KRIA 4E4SA 3WUDA 2OXBA 3VD4A 1DGRA 1X8EA 1VBB3 3NV2A 2R49A 4QX1A 3V0AA 3PURA 4IEPA 4LOSA 1ZNPA 4QB6A 4JRLA 5FMCA 4LHLA 5FO8B 4Q4W2 4XJWA 3LF7A 3FC0A 2QDRA 4LBMA 3GCXA 1QQP1 1ONAA 3J7MA 1W8UA 2C24A 3AL5A 5FXZA 1VMFA 2A73B 2ZGSA 4P5YA 3RMXA 2CV6A 3CZJA 4K1ZA 3J4UH 4XUPA 5KHIA 1POV0 2YROA 1DQ1A 1X36A 3HQXA 1ACCA 1US2A 2WWJA 4Q0UA 3TNQA 4CEYA 4OZXA 2WIIB 3HQUA 2JG9B 5GLUA 2BJSA 2ZGTA 1JYTA 1LKNA 1HRI3 1AYM1 4Q0QA 2ET7A 1VP6A 4GH4A 5FZ6A 2QDNA 4QM9A 1PK6C 2JD9A 3TRSB 3GGLA 2JENA 4ARXA 2RS13 2CSGA 1AR63 1YFWA 2WSVA 2J1AA 3T0BA 5FP9A 4NIAA 3WNOA 4AF9A 4XHBA 5FYSA 4K7JA 5BY5A 4XACA 2ZOEB 4AVCA 4AVVA 3I49A 1Z0HA 1DQ4A 2Z4FA 3AYDA 3R05A 1K5MA 5FY0A 2IXIA 2IXJA 2D44A 2Y6LA 3GZUC 4CCDA 5JZGC 2WSUA 3M8LA 2EXIA 1MS9A 3B3QE 2YUEA 1WWYA 4JKLA 4I0BA 2R30A 3H42B 1QJY1 3HQRA 4XMIA 4IE5A 2HYXA 1VAKA 2CDOA 1ND2B 4NJ4A 5K7PA 3I59B 1R1A1 2EXHA 3ZSKA 3RYRA 4AEMA 3D3AA 4YFWA 3KV4A 4Y20A 3T1LA 2DBIA 3BTYA 1UZZA 2VMHA 4Q4X2 1PHMA 2BERA 3H9AA 4IE7A 2JDNA 1OUSA 4OHWA 3EYPA 3ZFEC 1NXMA 3ZXGA 4M00A 4IGOA 2GMEA 1O59A 4MO3M 3DF0A 1MZ6A 4NHXA 4YRDA 3U10A 5JOXA 1VBA3 4JVAA 2RVAA 3K48A 1AUYA 3O0VA 5EZWA 5GZFA 1OLQA 1UPSA 1Q3EA 2HYKA 4PF1A 3WF3A 2Y6GA 3ZYBA 1MEC2 2OYZA 3ACLA 1I5PA 1VBE1 1ULDA 1SMVA 3JD72 1NUKA 3ZXFA 1GQHA 4PDWC 5A3TA 5LB6A 1MACA 1CGPA 1SFPA 2J22A 2VXRA 3TN91 5I0DA 2W1SA 5FWJA 5FZKA 4OUMA 4EN9B 2V4VA 3HNBM 2BFUL 4DY5A 4BQ3A 2GMMA 1CAUA 4GB31 1S0EA 3V64A 2WQZC 1LRHA 3I3QA 2A6XA 4GWJA 1BYHA 1W99A 3LSDA 5D8AB 3AYCA 3F95A 5A6ZA 1HB3A 2J1SA 1NCRC 2CWMA 5F9TA 5CKQA 3VKMA 3MIGA 5ABJA 3C7HA 3MIFA 1ZRRA 2RR11 1DBNA 4IE4A 5GKAC 2GC3A 1PGL2 1SLAA 1R093 2XH6A 1XC6A 3DPRC 2WNVC 1GWLA 1S0IA 1OSGA 1ZZ8A 4RHV2 3M1HA 2JG9A 3VB9A 2YPDA 2MEV1 1LOEA 3WQ7A 1ZZCA 3AYEA 3WNKA 5A3OA 2EIBA 2EF6A 3PVNA 1FAYA 1MS5A 1V6MA 4GMP0 2WYFA 4HN0A 4K20A 4YM1A 4OVEA 4YVSB 1MZ5A 3U14A 4CU8A 5JXJA 3I2JA 3BODA 2I2SA 2J1RA 2XG3A 4EWAA 5CKNA 5I8YA 2CHHA 1MZFA 5FZ0A 2BWAA 2VE1A 4NHYA 1QJZA 3IM0A 4J6GA 2PHLA 4UF0A 3TB0A 5FK8A 4H3WA 4QX2A 1TNFA 2WT2A 3HAGA 3ZYFA 2B39A 5FRAA 2H0VA 5ACA2 1JUHA 3JBG1 4O7XA 4YW1A 4OULA 2QE3A 3OGJA 3MPBA 1DHKB 1B35B 4OHZA 3UL2A 3ZLIA 3AYAA 2DF7A 3FE5A 4ATFA 1PX3A 1W6QB 3T2OA 1RUJ2 3N3HA 3ZYPA 5A3MA 5C5TA 1H8TB 1H4GA 3MIEA 2BNOA 1IPJA 1HRI1 3SCGA 1ND2A 4CU6A 5AVAA 2ARAA 4Y1UA 3I59A 1C8NA 1UIKA 4N43B 1XYPA 5A3PA 4C1WA 1DF0A 1RMU2 2KR2A 4K21A 4M4RA 4WVZA 5ERLA 1YCIA 3BB6A 4NR1A 5CADA 5B4NA 1AR61 4LBQA 3KGLA 1W9SA 2CDPA 5K4LA 2WNUC 1AJOA 5EV7A 4Q4Y3 4CXWA 3W5NA 2WBKA 2VW1A 2VOXA 1WD3A 4XFBA 2BTVC 2DCJA 2K46A 1AX0A 1AR92 1W2TA 2D3PA 2QTWB 3JB8A 3IPVA 3UGHA 4CDWB 3S5QA 1W05A 5K0UB 1GZWB 5CG9A 5BNNC 1C8M2 4QPIA 5FUIA 3KS7A 1O3RA 5H9QA 5DDJ3 3FX3A 1DGWA 1VAMA 4RR3C 3ETPA 4GXLA 3AZZA 3AZYA 4ZS3A 5FZBA 1Y3TA 5D21A 3BUCA 2G1MA 1QOOA 1N1SA 4TXWA 3LD8A 5HI0A 4BK5A 1DQ0A 1ULPA 1WLWA 2DWRA 1COV2 3T08A 4LO6B 1H30A 1S2EA 4XF0A 4AHYA 1W8ZA 1XNCA 5D8AA 1NKGA 2KD7A 3AVSA 5FPXA 4LE3A 1IKPA 5KXCA 4HKLA 3OYWB 3I2GA 1KJRA 1VBA1 4K1YA 3SH5A 1KDKA 4AVBA 5A3NA 2DCZA 1HIXA 3I2IA 3LCPA 5FIXA 5FLHA 1CAWA 2X10A 1W2OA 2JEMA 2D3RA 4PBPA 1XNKA 5HXVA 2XUMA 4QDQA 4J1XA 3B9IA 5JXHA 3PU8A 2Y60A 1YLLA 3MF6A 4WM8C 4CCJA 2ETEA 3AX4A 3T2TA 3PUHA 3KCXA 3VLBB 2VZRA 4UT5A 3AM2A 4XIKA 3Q8CA 3RRDA 4F7ZA 5A33B 3H3LA 3U07A 4M01A 1TMF3 5I8TA 1AR72 5J37A 2LTNA 1FX5A 3HBKA 1XXNA 4QX0A 5EIYB 3L2YA 5GZEA 4N53B 2F4LA 4F3JA 4PT6A 2Z42A 2OUJA 2QJVA 4EJRA 4DUWA 2W5FA 1W04A 1LU1A 1QEXA 4YZ1A 1OPMA 1E5IA 3VDDC 2Q8EA 1NCQC 1DYKA 1DCSA 2A6VA 3ILRA 3OUHA 2FDGA 2JWPA 1XYNA 1J83A 5DXDA 2V73A 2YBSA 1RUH3 4P9GA 4HSJA 3DYMA 3PVOA 4LBLA 4ZPIA 2XL7A 5EWSA 2ZHNA 3RSJA 1B35A 1ULEA 1EAH3 1UXZA 1SBDA 2DUQA 5DPNA 5C6CA 2DDUA 3E1F1 2NZ9A 2ZMNA 3GM8A 1W6QA 5JXGA 3RPQA 1H8TA 2XLGA 2UY8A 1BZWA 5FYYA 3ZKUA 3VBSB 4C0BA 1RHI3 2UURA 4N8MA 1BMV2 3L2HA 1ZBE3 2ORXA 1L7RA 3DL3A 4OUEA 2WZ8A 5F3IA 5A1LA 2D5FA 1A6CA 4EN6B 1C5HA 2R063 4N43A 2YGLA 5FZLA 1DP0A 2V4AA 1PVC2 3EQEA 3ZX7A 3ZR5A 4KGQA 2RJLA 2ZGPA 2PHDA 3TYJA 5FP7A 5F5CA 4DMIA 4XMAA 1T6BX 4YGBA 4BQ2A 4RN5A 2P37A 5A7QA 1GNYA 1YFXA 4XJUA 4UI9L 3N9NA 3ZXJA 4AEKA 3K4ZA 4OYUA 3SCFA 4QAWA 4HPKA 3VN4A 1CX1A 2VGDA 4AQTA 1L3JA 2R042 5IFPA 2DVAA 5L7OC 2ZEYA 1FPN2 2PTMA 3QBQA 2D3SA 1VBC2 3JCIA 3FHIB 4IEVA 4P9YA 1NX9A 1CR7A 4CDQC 3HWJA 2WYSA 4BE3A 5JUVA 2FQPA 2PQQA 4JGYC 1N47A 5L36A 5G05L 1XSQA 2BV4A 1F2NA 5AC93 2E53A 1H2NA 2PXJA 3RJRA 1OT5A 3GZEA 3LDBA 4UBGA 1MQTB 2CGOA 3POYA 2ZMKA 1BBT2 1VR3A 2GZWA 3HNYM 3G6JB 1OI6A 5F5IA 3VHOA 4D3WA 3RS6A 2EAKA 2XJVA 5LA9A 5CFCB 4Q4Y1 3FFZA 3UYJA 2GDFA 1SBEA 5JMCA 3OYWA 3O0XA 3VBHC 2D40A 5F2WA 3FWEA 1ZBA2 2OW4A 4DXTA 1JYWA 3NNLA 2JG8B 2DVFA 4IEWA 3I54A 5A80A 3AFGA 5HV4A 2NP0A 1EV13 4QXBA 1GZCA 5KXBA 5C5UA 5EYXA 4HKWA 2NMNA 4BXFA 4CUBA 1PK6A 1KDMA 2YFZA 2PYTA 4LBNA 5GLZA 1CJPA 2E7QA 3ZDSA 4B4PA 2HEWF 5DDJ1 2W9XA 3SMHA 1YO8A 4XBNA 2WZR2 1O91A 3N7KA 2B45X 4GH4C 1RUE3 3MO4A 4X6QB 5C8WA 4RGAA 1L7LA 2HWF3 4NPLA 2A6WA 2XJUA 3MI8A 5FK7A 4BLIA 2PQSA 4UFJA 1STMA 3PJYA 1GP4A 1VALA 2XLAA 4W50A 5A6YA 4NWWA 2C1FA 2A6ZA 2E63A 4DINB 4G3YC 3MUZ1 2N7GA 2QZ3A 3UGGA 4LIUA 1DFQA 3C7OA 5C3SA 1ODMA 1HX6A 4XZPA 2RS52 1WMXA 4LLOA 4MYEA 5FPLA 4M3CE 1J1TA 3DECA 5A3UA 2GC1A 2WT1A 5A70A 2BQPA 1T2XA 3KVAA 3A0NA 4HOOA 3VL9A 1FNZA 4Y1ZA 1ZRFA 3V65A 2HBTA 1W9TA 5GM0A 4I2OA 5LBFA 2R0FA 3O1PA 1LESA 1TMF1 4UFKA 1JN2P 3PMSA 3T09A 4UYBA 1FV3A 2WUHA 1XB9A 1QQP2 1OA4A 1RJ8A 3UKNA 2RMU3 2VTFA 2ZX1A 2FBEA 4GAZA 2B8MA 3FJSA 1Q8QA 4MHRA 1J58A 1G9AA 4FI9A 4A3ZA 4AGRA 4RL7A 3MZHA 2Q1ZB 3I3BA 4XJAA 5E8AA 4M3CA 1J1LA 4OZOA 1AL23 2OS2A 3EXUA 2JIGA 2TBVA 3IIIA 1IS3A 3LB9A 1RUH1 4XF4A 1GOFA 3RFRA 5APAA 5FDBA 3GZAA 4PDWA 5DUUA 5IVFA 1AYM2 3URFA 2R1BA 5JVVA 2ZGNA 1UF2C 1ZREA 1XSRA 1DGWX 3ME2A 1EAH1 2XVGA 4BQ5A 3WSOA 4MVTA 5T55A 4XJ8A 4AYUA 5GZCA 5EYYA 1IG3A 4B3NA 2Y6JA 5A6QA 4HETA 2VUJA 1ND3B 1QMJA 1H6YA 4XXPA 2J42A 2R061 1H2MA 2I07B 1NCRA 2W1WA 3NW4A 2JDMA 1MQTA 1JHNA 5LK7B 2PHRA 1UY4A 3K4AA 1U5XA 1PMJX 2GP3A 2DUPA 2LROA 2QBXA 2IVJA 4QDRA 1LHOA 2RG4A 1QJY2 1LULA 3JZVA 1X9PA 2WNVA 2VBDA 2DTWA 3M70A 4GKXA 3WQ0A 2XJPA 4R4ZA 3BOPA 1ZZ9A 4XJZA 4IV3B 4DEVA 1R1A2 2AGSA 3OD0A 5HPOA 3CZUA 4XC9A 3ZSMA 4XFGA 5IATA 4P02B 3ZMOA 1XQNA 1XNBA 3WQBA 3RWNA 2H6BA 3IDBB 2JG9C 3N7LA 3CO2A 3VD3A 3SEPA 1JOBA 3B9CA 3FLTA 2R071 3WF0A 1JOJA 3UJOA 1H0BA 1LOCA 1QDCA 5AC91 4QX5A 1R64A 1VBD2 2Q5TA 4LE4A 1LNSA 4XBLA 3T0AA 3EHKA 3RI8A 4EQVA 4CUGA 3FZ3A 4ASMB 4BA6A 3W59A 1VBE2 2BGPA 4LK6A 3PIGA 5BV6A 1VRH3 1XE0A 3WDTA 2BUKA 4XF3A 5L73A 3TAYA 4IE0A 4QPWA 2EIDA 4UFIA 3TN92 2YFUA 3MV11 5FPUA 3HN1A 1GV9A 2VOKA 2NPIA 5KWRA 3VZLA 1EV11 3JQXA 3CMGA 4Y3OA 1OQDA 4AI1A 3LEIA 4OHVA 3POJA 4XXAA 3A0KA 4GB32 2LALA 4UW6A 1UY1A 1LU2A 2D7FA 2YC2A 4BYYA 2J1VA 4PI2A 1ND2C 2P1BA 2GC0A 4LPLA 1HB1A 3F2ZA 4N90A 4WVWA 2HWF1 2WNUA 1F5FA 3NNJA 1W2UA 1MZEA 3BU7A 4I30A 5KHJA 1GICA 2AZ5A 4KBZA 5BNPB 4NUBA 4AEDB 2RR12 2G9GA 2MHFA 5FP3A 3AP7A 1LOAA 5C3PA 3VBRB 1OURA 1RB8G 3NAPA 1K42A 3DCQA 1SLTA 4LBKA 2PLV3 2QUOA 5BNNA 4XOGA 3RNSA 4A7ZA 4N7IA 4P9JA 1MR5A 3FUQA 4YLZA 2PMWB 2MEV2 1WBFA 2LW8A 5FY8A 3O14A 4PIYA 2VZUA 2FMDA 2HBUA 2UU8A 3ZSEA 5FPZA 2PHXA 3PTYA 4QPIC 5E6HA 1G9BA 1QOSA 1QF3A 3CU7A 3HT2A 3ON7A 4YGEA 2CY6A 2D97A 1DG6A 2XJSA 3SISA 4COWA 3ZXKA 1TG7A 2KM2A 2XXZA 1FMD3 1REEA 3DEMA 4XJ9A 3UNPA 1O3QA 3CIHA 1XPWA 5FYHA 2BVVA 1ND3A 3RG0A 3W58A 3M3EA 4AVAA 2RMU1 5G04L 4PLNA 3ZXLA 4WBBA 3JBG2 1OH3A 2WS93 5FYTA 5C71A 1RUI3 1W9YA 4OCTA 4EWDA 5D8AC 2RDSA 2X5IB 4AFCA 1LODA 2W52A 4KU8A 1AL21 4OMCA 2GH2A 1RUD2 4WM8A 1RYYA 1V6NA 2IXKA 1X82A 3GBGA 5FZ4A 4XE9A 3CKHA 1HRI2 2CGNA 1ULCA 2HWD3 1UOGA 4S2GA 3ZIXA 2BPA2 1NQJA 4K6BA 5IAVA 4UAPA 4HXCA 1J3PA 1WA6X 3TNPB 1QU0A 1Y9QA 2VVFA 2WO2A 4DUXA 1AVBA 1AR62 5F3GA 1H1AA 4IXLA 1M06G 1TME3 5FCCA 3VDBA 1OD3A 3NNFA 4YVSC 3LDRA 4EYUA 2Y6FA 5CVRA 3VDDA 3WDVA 4GIQA 3ECQA 1IQAA 4I01A 2NLRA 4FVVA 4FO9A 4YM2A 5CG8A 2XKPA 1QIQA 3IT8A 3D5OA 4OLLA 5FPAA 3ZO0B 4IE6A 4H7MA 4MOAA 4RD7A 3RZLA 1Y9GA 3KHCA 2I74A 2YB7A 3A22A 5FY5A 2ZS6B 3N36A 1SLCA 1A34A 3A23A 3OOXA 1FNYA 1B35C 4XFFA 1UYPA 4GWNA 2Q4SA 3WW2A 5J09A 4FPKA 4FP3A 3POFA 5CEHA 4FTSA 4UWDA 3KQRA 2BU9A 4CP0A 4LQRA 1H8TC 3S30A 4KI5M 5IK5A 1OOPB 1W8FA 1SCRA 3J26N 4ZXKA 4O61A 3LA7A 1D4VB 1JOPA 1VBA2 3WDUA 4N43C 5E88A 2WO7A 3QH6A 1UU6A 3GCWA 1JXNA 2Q30A 3H3ZA 5BNPA 4CRQA 1WCQA 1HV1A 2ZX0A 4AGVA 5BUVA 3VBRA 3O1RA 1LGCA 5LEKA 1RTVA 1CPMA 1VRH1 2DURA 4MGQA 4LHKA 5L7OA 3I7DA 4Y1YA 1ZZBA 1Q43A 2IZWA 1YI7A 5BPXA 3VL8A 4CDWC 2DV9A 2O14A 4CDQA 2DVBA 3UKVA 5K0UC 5FY7A 3BIEA 4KWKA 1IHMA 1JYVA 4R52A 3IDAA 4KWUA 3HBZA 1VJ2A 1XNDA 1ZX5A 3LEMA 4JGYA 5JLVA 1JZ8A 4AOCA 3POSA 4LA3A 4QPYA 4DY3A 4FPCA 4XCAA 1LCLA 2JD4A 5FZ1A 4FOYA 1HXS1 3E5XA 4DRRA 1JZ7A 4MG2A 1APNA 2ILMA 4D7SA 4ZONA 1YHFA 5C3QA 1NA1B 1PO21 2GNMA 2HEYF 3AP5A 4K8FA 3VBHA 2E9QA 1SQ4A 2JICA 3VDAA 2ZGMA 1AJKA 3O1SA 3U1XA 1GQGA 3GXUA 4JZRA 4OI0A 4HVRA 1QKQA 2PLV1 4RFT0 1W3XA 3M7AA 4OI1A 1KEXA 3ZXEA 1HRV3 2ZAHA 3KF5A 4CSWA 1HB2A 3BGAA 3O5SA 1S4CA 1JBCA 3POWA 4ZY9A 3CF6E 3CEWA 3J8F3 3C7FA 4MXWA 5FOJB 2O8QA 1Y7BA 3WP6A 1FMD1 4QWNA 5DABA 2DU0A 3NJVA 3D0SA 4BIFA 2DCYA 3B94A 3I8TA 3ZFGB 1BK0A 2GNDA 1DZTA 2YGMA 4N53C 3RJ2X 5A7WB 4NIIA 1JHJA 4P9IA 4OI4A 1RUI1 1W8NA 2QCSB 5A7PA 1W6PA 2HEVF 3BU0A 3S5AA 3OPZA 4NAOA 2QVSB 2XLFA 2PHFA 2DTYA 3MLJA 4RQPB 4QGMA 3VBOB 4HANA 4BIOA 4Z8BA 1RINA 1F4HA 2NMOA 4ZS2A 5FZ8A 2VTXA 2QQVA 1JZ5A 3WG1A 3O1OA 5F2SA 3WT3A 3I3EA 1JS9A 1X8MA 2ENRA 2J1UA 3SKVA 4LBQD 1D2SA 3P5BA 3U37A 4Q0SA 3PIJA 3I2OA 1EUUA 3GALA 1UIJA 5KC6A 1VMHA 5FZCA 1OVPA 5LZ6A 1TME1 3DYOA 4PI0A 4Q4Y2 1CESA 3CQOA 3HNMA 4AI3A 2H0BA 3E6DA 3KV9A 3TWIA 1AR81 3N35A 3KLSA 3FLRA 2IFRA 1J3RA 4FTEA 4TLFA 2CYFA 1RUOA 2F4PA 5DAQA 2HWE3 1GOGA 3MFAA 3NV3A 4W4ZA 5IUQA 2ZCWA 4CP9B 3LIGA 3VKFC 3ZM8A 1RXFA 2ZHMA 1UWWA 3T2QA 4YYOA 5DDJ2 3AZVA 3UESA 3GZTB 1NY71 1UZ0A 4UW5A 5DZEA 2WZPP 4GMP1 4O9EA 3OTFA 1KS4A 1WW6A 3K2OA 1E5SA 2J1TA 3JXSA 1T6GC 2QFEA 1H1IA 1C4RA 5FKCA 4A41A 1HJGA 1S0CA 2V5YA 2QQLA 1RUC3 2W08A 3RWKX 3THTA 4TSVA 3NSTA 3OG2A 4YNIA 4B7EA 1O3TA 4JGZB 2CWSA 2LUWA 1MQTC 1FYUA 3T2PA 1UNBA 3R4UA 1OXCA 3WW4A 4BU2A 4CU7A 5FOBB 3EJKA 3M4FA 2SBAA 2Q8CA 1R083 3K46A 2WLPA 2KA3A 3APBA 2JB8A 2C26A 3R4DB 3ZIWA 3S7EA 1PNFA 4E4HA 2WJSA 5I8SA 2BNMA 4DRVA 1TMF2 2JG8C 1W6MB 2P17A 4Q2FA 1EUTA 2W1QA 1YFYA 1TE1B 5CFDB 3LKJA 3THPA 1FOD3 2VPVA 3W9AA 4FXKB 2HKXA 2GNBA 2ZZJA 2W0XA 4I0WB 4JTNA 3AKPA 1VBB1 3QCWA 4URAA 4LT5A 4J1WA 2P3YA 1W9WA 3HIFA 2ZHLA 1UY3A 1XU1A 4RFRB 3RZKA 2EA7A 4CCLA 2A3YA 2Y26A 4JC1A 1S0DA 1WMEA 1IG0A 3AKRA 1RUH2 4Q26A 4AHZA 2WQ4A 3N9OA 1U12A 3VGIA 4DXRA 1NYWA 4NIHA 5A7WA 3MLLA 4MGKE 1EAH2 3OEAA 5CA6A 3TEZA 3ZDVA 1GKBA 1DU3D 4JHTA 1WA4A 4XURA 2VOVA 3S0MA 3VBOA 5DAXA 2Q1FA 4B4QA 2AR6A 2JDKA 3ITQA 1CZVA 2OKXA 4ZHNA 1ZRCA 2BNNA 2PHTA 1H6XA 2XPJA 5FLIA 4SBVA 5BXXA 1PO12 3WCSA 1UZVA 4H14A 5JOWA 2OT7A 3V0BB 5FYUA 2R062 1ZA7A 1KXGA 2EVXA 1YWKA 1ENQA 4FPGA 4EZ4A 1EPWA 1XNAA
chains in the Genus database with same CATH topology
2RS11 2ZGUA 1BQPA 2HWC3 1Q8OA 1SLIA 4MH0E 1QXRA 5I0UA 1CPNA 3ZSJA 3E5QA 4URTA 1SACA 3AMPA 1PZ9A 1ZZ7A 5E16A 4META 5KHGA 4I0AA 4YVWB 3AZXA 3NAPC 3D8CA 3IBMA 2A3XA 1RVF3 2PFWA 4CEWB 2HWB3 2PHUA 1OHFA 4E9KA 1QJX3 1V70A 2R072 1CAXB 2DCTA 5EFUA 5AC92 4L2NA 2ZX3A 3ZN5A 3KMHA 1S0GA 5T52A 1UZYA 1RC6A 1NLSA 4JQRA 5FQ0B 1ND3C 4Q8LA 4E2GA 1UCXA 1QNWA 4ISRA 1DQ5A 3ENRA 4XYXA 3AMMA 5FMOS 4FPLA 1U5YA 4N7UA 1KITA 1EV12 1UMZA 2HWE1 3MW4A 4R8HA 1OPOA 4BLJA 4C91A 2DU1A 2Q8OA 4IV1B 1GNHA 1SFYA 3B02A 1FATA 3IDCB 4IV3C 2XVLA 2IFWA 2P2KA 5DG1A 5KXEA 1RGSA 2HWF2 2YV8A 1ZRDA 4FSJA 4YVSA 3FLPA 4XPVA 4HBNA 1PMIA 4QGNA 2QQPA 1UU4A 1O7FA 2FMYA 3JUUA 2JDZA 1LB2A 2FZ2A 1RUC1 4NHKA 2ZMLA 3S6PA 1J3QA 3DUIA 2AYHA 3D4KA 4JDMA 2FZ1A 5IK7A 1W6NB 1R081 2ZX2A 4XFIA 1R091 3AXDA 4BHPA 1UPIA 1MS8A 1G86A 4Q27A 4AHWA 4E2SA 1C57A 2VNRA 1FOD1 3P3NA 1I1EA 2RMU2 3S7IA 4AQSA 2XBO3 4FPYA 1G9DA 2JX9A 3VKNA 4LEJA 3ZN6B 4N9IA 4YM0A 1AYN3 1RJ7A 3OF1A 4JCKA 2W39A 1CJDA 5LRSA 3VKOA 1N1VA 1OFNA 4MGIE 1MS3A 3CJIB 3ELNA 5BNPC 3MPPG 3P3PA 4CDWA 1HLCA 3VBRC 4YZ4A 5K0UA 3AKSA 4ZU7A 1GZWA 3AK0A 4HVQA 4CEWA 4IEUA 2AH2A 4KG8A 4Q1RA 2IC1A 4AFBA 1MS1A 4X8PA 4FPHA 2P3KA 1RMU3 2ZX4A 1LGNA 4XBQA 1QJU3 1S1AA 3MFCA 5CU1A 1S0FA 1YJLA 1EPZA 2ZBJA 3LA2A 2HWC1 3GF6A 2NN8A 5JDBA 4U2AA 2W68A 5T50A 2VNGA 4K9SA 2NQYA 3ZMNA 3RZZA 2X5IC 3SNMA 2BVBA 1RVF1 3KT4A 2P34A 4FQZA 2HWB1 1FT9A 3PJQA 2WA3A 1ULGA 1QJX1 4EN8B 4BZ4A 3D6EA 5A33A 3WP5A 1D2QA 1SLLA 1XRUA 1OQ1A 4P9WA 3WZ1A 3OCPA 4XF9A 4HVOA 3VBFB 4N53A 5C4WB 2PELA 1CN1A 3AMNA 5DUWA 4YM3A 1VRH2 4IEQA 1X50A 4IL7A 4Y5Z0 2ZGRA 2Q0AA 2V09A 1QXPA 1S55A 5AVPA 3JQWA 3USUB 1JH5A 2GNTA 2D98A 1HXS2 3VBSA 4XETA 3VHRA 5GJ6A 1PO22 4R9CA 1O4ZA 4Q4V3 3WG4A 3ZYGA 5BNQA 4IEZA 1UN1A 1Z7S3 4FP2A 1OOPC 4AVTA 2PLV2 4Y1XA 4KL1A 1U5IA 2ZGLA 4FPFA 4SLIA 1H4HA 4S2FA 3WG3A 5SV8A 4FPOB 1OQEA 4B7KA 1LGBA 4KNCA 3MEPA 4ASLA 5KC5A 1ZVFA 2ARXA 3OY8B 1FMD2 1HV0A 3TOJA 5JWPA 3NJZA 2VU9A 1RHI1 2X8KA 3VZOA 1ZBE1 1PVC3 2XBO1 1DQ6A 3LA3A 4AQ6A 2PAKA 3SH3A 4YARA 2QZ2A 4K40A 1AYN1 1RUI2 3UK9A 5T5LA 5GALA 1LOBA 3UJQA 1B09A 4RS5B 2GN3A 4QMAA 3RI9A 5B2GB 5I91A 5CFCA 2C9AA 4IESA 1NA1C 2F6BA 4YG6A 2ZGQA 3PMEA 4NWVA 1PIV3 3EBRA 3B5LB 3U4XA 2R6QA 3MW2A 2JG8A 4ONUA 1VBC3 1AXZA 2MPFA 4BOWA 4QQOA 4WZFA 4LBJA 5J98B 3VBUB 1TME2 3NV4A 4R4XA 5I0SA 1KFXL 1DGLA 1FI2A 2EXKA 1QH7A 3H50A 4LULA 4JTOA 2G9FA 1BBT3 1VLNA 5GLWA 1QJU1 1AR82 5EXOA 4BWOA 5C4WA 1LHUA 2ERFA 5JOZA 1RUG3 2I45A 4DB5A 5H9SA 4FT8A 4DNYA 4S2HA 4HK8A 3ZFGC 5HCAA 1NY72 4COVA 3E5UA 3MGUA 2CNAA 1O5LA 1BEV3 5JPMB 2DFCA 5H9PA 1UD1A 4RQPC 3VBOC 2BFUS 2ZPXA 1UW8A 1ZA4A 1Q5OA 3MYXA 2OVUA 2Z5WA 3WLUA 3PHMA 4ATEA 4HZFA 3AB0A 3VHPA 2RS33 2A7AA 1RUE1 3LGRA 4L11A 5TSWA 3AZWA 1G6NA 1LTEA 1WW4A 1Q8SA 1C1LA 4MLOA 4NN0A 3WW3A 1NXD1 4DZGA 4QD2A 4WM7B 1N1YA 1I5ZA 3M3OA 1H2LA 1IS6A 2VVDA 1HKDA 1NQDA 2D93A 4GQ7A 4Y22B 1GFF2 4OUSA 4UXAA 5IK8A 2Z2SB 2GALA 4AK3A 1VBB2 3SXWA 2BGCA 3WG2A 4JRAA 4NHMA 4LBOA 3SCHA 1SDWA 2ZKLA 1GLHA 3M3QA 4XIOA 3WVJA 2B7YA 3AKTA 1V00A 4O9GA 4XQWA 4Q4V1 3NVCA 2WFF3 3H1MA 1V9U3 5K9YA 1GSLA 1VB2A 2R1DA 3UKTA 1Z7S1 4RS5A 5FREA 3IKWA 3GNEA 2CL2A 2QKDA 3H1YA 3RDIA 2A71A 2XKOA 3V0AB 4IV3A 4EV0A 1LHVA 4FOWA 5GLTA 5L19A 3VBUA 1OA3A 3H1WA 1KJLA 2OZJA 2RS12 3KCCA 2GN7A 1G9CA 4HT1T 1OD5A 4Q1PA 3WDWA 4P14A 2B5HA 1DYPA 1JYIA 1SLBA 3B00A 4JAAA 4HFSA 4CEYB 2PN5A 4PBOA 4XILA 4LO4B 5FO9B 3VUOA 1DIWA 1YXWA 3OJBA 2P3IA 4GH4B 2D6NA 3E6BA 4MXVA 1R1A3 3WNXA 2AENA 1F5JA 3ILNA 4M0NA 1PZ8A 1PIV1 1NE6A 5T3NA 2XJTA 2DUOA 1RUNA 4WVMB 3K51A 3MIDA 4HKOA 2B42B 4Q0VA 1H8VA 2D6LX 3ZYJB 4LA2A 4E2QA 4QQPA 3C3VA 3WHUA 1AX1A 1VBD3 5C33A 4PIZA 2XL9A 1VB4A 1K5MB 1HDKA 2R32A 4FOVA 2HJIA 2K2SA 2E51A 1RIRA 2JJ6A 1YUDA 1VBE3 2ATFA 4L9BA 4RSUA 2ES3A 3OGGA 2HWE2 1OFSA 1OMIA 1REDA 4AEDA 4XQDA 4KH9A 4S2DA 1N1TA 1RUG1 4D94A 4WM7A 2GC2A 5I0TA 3MF9A 2JKBA 4MZUA 1JUIA 5AFBA 2DVGA 3ZVXA 4YVWC 1AL0G 2RM23 1BEV1 3R6SA 1G7YA 2NYYA 3SISA 4W6XA 3M3CA 1GYKA 4AVCA 3VZJA 4NO4A 1H1MA 4CEWC 3N4MA 2R0HA 2CTVA 2E7TA 1AF9A 4PLMA 4AW7A 1BVP1 3AMHA 2VNOA 4XDQA 4OHYA 2C5DA 1RUC2 3MLKA 1QH6A 1UKRA 5J3UA 2RS31 1AXYA 1U0AA 1WLDA 1OA2A 2QNKA 3SHRA 3DV8A 4HMZA 4COYA 4IERA 4QPGB 3GBWA 3WXPA 5CBLA 5D1IA 4A7YA 5F6LB 4KWJA 1R082 2UWBA 1R092 1V6IA 2X5IA 1O4TA 4YW3A 5JSPA 1AXKA 4PCRA 3I4IA 1YNAA 1D0GA 1UU5A 1CAUB 1FOD2 4QQLA 4UBHA 4D7TA 3NL1A 5J96B 1V6LA 3HD8B 2JECA 4QQHA 2GMPA 1WMFA 1MVEA 2PAMA 1JYCA 3AJZA 4IV1C 3ZXAC 3AKQA 1WCSA 4YFZA 1YRZA 4INDA 2UYBA 5C8CB 1ALYA 3JBG3 5HCBA 3U11A 5ABJB 3QACA 5H9RA 2MNGA 3VHNA 4FXGB 4X8NA 4B8EA 2WFF1 4HLTA 3ZXDA 1V9U1 4H55A 4MGZE 5JIUA 2WS91 4GWMA 2YHJA 1RUF3 1RUD3 4AFMA 2PA7A 1MS0A 3B7MA 2AUYA 1YI9A 3NO8A 1HQWA 5I0RA 5CAZA 1W6OB 4BMEA 3R0RA 4V1PA 5JI7A 1ASJ3 4I3PA 1PGW1 4YZ2A 4WVMA 2HWD1 4NVPA 1LEMA 3KT1A 1C5IA 4GULA 1MS4A 1GANA 1GBGA 2K0GA 2ZABA 2HWC2 1CD3G 1OOPA 2Y0OA 3VBSC 1SCSA 3MIBA 4NOTA 1LOFC 3H8UA 4IETA 1CX4A 1WCKA 5KBFA 4G9SB 5HCFA 1RVF2 2Z69A 1PM7A 5J36A 2HWB2 3KCYA 3INAA 1QJX2 1HQLA 4AG4A 1DLLA 4ORFA 2RJKA 5GZGA 2WKKA 3CJIC 1QY4A 4COZA 3H3UA 1IOAA 5FO7B 4F83A 4A7KA 4LBQB 1QXJA 5T5JA 3ATGA 4AI0A 1BXHA 1PGSA 3NKTA 2Y0IA 2ZKNA 1LEDA 2XWBB 2D5HA 2XWJB 1VBD1 4ZU5A 1QNYA 1J59A 2IXCA 3IPVB 4Q0PA 3WDYA 5JSRA 2DVDA 2EAAA 4ES8A 2VQAA 4QPIB 3ZSLA 3FBYA 1NA1A 4QPGA 5K8SA 4YZ5A 1PZ7A 1N3QA 1TQ5A 5CFCC 4B29A 4PJYA 2VQ0A 4CDUB 1URXA 1D4M3 2EALA 5KHHA 2RM21 1LR5A 5FBZA 5BNOB 4KGGA 1A78A 4AEJA 3PVBB 1Y43B 2H6CA 4Q4W3 2YPJA 2RHPA 4H7LA 3OBTA 5C8CA 1CAWB 4KBBA 2ZA9A 1CAVB 4AXOA 3PNAA 2A3WA 5LEJA 4CDXB 4Z82A 3ZFGA 2LM3A 3VBFC 5C4WC 3O0WA 3KGZA 2O0OA 4EWEA 4L92A 1W0OA 2A5ZA 2IXLA 5T54A 2VMGA 4LUMA 4CP2A 4RQPA 1W6OA 4AI2A 2AREA 4F8AA 1HRV1 2SLIA 1IPKA 4PLOA 1RHI2 3M2MA 1OLRA 1CONA 1ZBE2 3ROUA 2XBO2 3ILFA 1AHSA 3KM5A 3J8F1 3Q9OA 3M3IA 1AYN2 1HQNA 1H9WA 4LUKA 3HMYA 5C9AB 2BW8A 1ZYBA 4AHXA 4MUVA 5DZGA 4Z07A 1CIWA 4XHXA 5I93A 3VV1A 2O8OA 4YZ3A 3ZFFB 4QM8A 1RUF1 1RUD1 4D7YA 1N3PA 3ASIA 3FUOA 1O5UA 4Y24A 3WY6A 2K9ZA 4X6RB 2VG9A 4A3XA 1I6XA 1ASJ1 2OA2A 1VIWB 1QJU2 4HL0A 4Q4X3 2D6MA 1G9FA 5IT6A 3V56A 1KQRA 3DKWA 5FLJA 2O1QA 4DXZA 4IQPA 4HK9A 1YIPA 4YW5A 3T1MA 5DUVA 5A32B 4HPKB 4MX3A 5F5QA 2Y38A 4CP1A 1MEC3 2XGXA 4JGZA 1ENRA 3JD73 3EO6A 1BK1A 2ZAAA 4RS5C 1EY2A 1G8WA 3VZMA 3ZPYA 1UAIA 1C1FA 5DG2A 2D6PA 4CDUA 2YXSA 1Z78A 2GU9A 4YGCA 1UKGA 1W6MA 1WGPA 1RUE2 1GR3A 5CFDA 5BNOA 3PLQA 3LZZA 3WCRA 2R16A 3VBUC 1WMDA 3HT1A 4WZCA 5KXDA 5GLVA 2ZGOA 4HSLA 1CVNA 2A6YA 4I3GA 4YSFA 1CAVA 5F1RA 4BCUA 1XU2A 3DGTA 4CDXA 2C0ZA 1NOVA 1PK6B 2VECA 4E4ZA 2IWGB 3D82A 4FPJA 4RA0A 4RHV3 1FXZA 1W39A 1GNZA 3AP9A 4CTEA 4HN1A 3CJXA 4W6YA 2JE7A 2VVEA 1D4M1 4LHNA 1A8MA 4YG3A 1MVQA 4YW4A 5JI9A 3QOPA 4Q4V2 4YG0A 3V0BA 1ZZ6A 2OPKA 5JZGB 2YYOA 4COUA 4Q4W1 1Z7S2 4P9XA 3FBMA 5C9AA 5JCTA 1YIFA 1NE4A 2FHRA 2VULA 1AL22 2B46X 4LO7A 2UWCA 5ACA3 3GHNA 3QD6A 4FTBA 4IEXA 3ZFFA 5F6KA 3O12A 4AEDC 4Z2WA 5CNAA 4YVWA 4M3CF 4A2UA 4QHBA 1KFUL 1RUJ3 4WM7C 1PO13 1NLRA 1KS5A 3D0JA 3ZFEB 1BVVA 2PHWA 4OI2A 2TNFA 4YGDA 4IEOA 1CAXA 4QXKA 2UYAA 2DFBA 3CNAA 4LO8A 4LO5B 3I2DA 4M3CB 2D6KA 1KD7A 1JTZX 4YW2A 2XHKA 4PDWB 2YC0A 1Q56A 3AFKA 4OFGA 5A32A 5FQ0A 4XQ4A 1AR93 1PIV2 1S2KA 4I09A 3ALQA 1C8M3 2E7AA 3ES1A 1PNGA 3SITA 4DFSA 1SFNA 2YDEA 3RQ0A 2R073 4GA9A 4FBFA 2CAUA 1A3KA 1NG0A 2NM1A 4IV1A 1F9KA 1NCRB 3WQ1A 4QQ2A 1V6JA 5LK5A 3WINE 2BYVE 2VY0A 1DDLA 1REFA 4Q4X1 4XFCA 3WOGA 1WCDJ 1COV3 3KSCA 2JXAA 4XTPA 3WHTA 4FCAA 4AGGA 3DPRB 4JDNA 4Z1VA 5DUXA 2WNVB 2IXHA 3HR9A 4XW3A 1Q8PA 1RUG2 2YMZA 4L8QA 5JPNB 4FQ4A 3C2UA 1RITA 5JAXA 1NZCA 1MEC1 2EXJA 1TEIA 2OUHA 1HW5A 1V6KA 5LRRA 1BEV2 3JD71 4AWDA 4CEYC 3RYKA 4NHLA 1W6NA 4QGLA 1WW7A 4BMBA 2A70A 5A3LA 1D0HA 4XEZA 4CYDA 1AR73 1QWRA 2RS32 1GZ9A 3RYPA 1Q8VA 3SH4A 2WINB 2WT0A 2VOWA 1WUVA 5JZGA 1LOFA 5FTTC 2ZHKA 3IMNA 4L97A 3ZN6A 2A75A 3ST7A 3WX5A 1K5MC 5J48A 1H9PA 5JR7B 3WUCA 1PVXA 5BYNA 4GKYA 2Z79A 3H7JA 3MIHA 3IDEA 3AJYA 5SV5A 3ZYIB 3NWKA 1PGL1 4R9AA 3LOIA 4PIXA 3CJIA 4Y1VA 5FAXA 1CQ9A 1QOTA 4RHV1 3KZ4C 2OIIA 2WLQA 4QT6A 3BPZA 1QDOA 2E6VA 1DZQA 2WNUB 5E89A 3ZFEA 1LENA 4CZSA 4FOQA 4E27A 1X33A 4BM8A 2X53S 5IK4A 4FAHA 1I9RA 2WFF2 3IWZA 3NAPB 1V9U2 4BPZA 1YFUA 3DN7A 5BNNB 2WS92 3NKGA 4R9DA 5GZDA 4Z92B 1S2BA 2OZ6A 2TEPA 1VAVA 2CAVA 3JB4C 4FPEA 5ACA1 1LHNA 4RR3B 2XJRA 4QPGC 2WNEA 4EROA 1PGW2 4OHXA 2HWD2 4ES9A 3JU9A 2R043 4ISQA 3LSEA 1FPN3 2UY9A 2ZGKA 1C3HA 2D6OX 1RUJ1 3MICA 4DOUA 1PO11 2D43A 4IEYA 1LHWA 2VH9A 1AZDA 1IZ3A 2XB6C 1UX6A 4WVVA 3MDPA 1EYBA 3E97A 1O4YA 2GAUA 4ZU4A 2RE9A 1WLTA 1RMU1 3CL1A 3RMYA 3N7MA 4L99A 2PAEA 4PF5A 2B9UA 2EIGA 3DPRA 1FV2A 3H7YA 4WM8B 1LOGA 5DZFA 3E6CC 3VBFA 3X29B 2DYCA 4ZKTB 5C8CC 1SEFA 2CGPA 3QLQA 2ZACA 5ABJC 4UW3A 5JIAA 1ZBA3 1AR91 4MGYE 1ZM1A 2YY1A 3AP6A 1M4WA 1C8M1 2Q1MA 1EP0A 1H2KA 5CIRA 5AFEA 2WL1A 3CLPA 3MW3A 1BKZA 2G4IA 4WV8A 4C1XA 1W0PA 4DS0A 1WW5A 3VDDB 1U5ZA 2WZR3 4JV4A 1NCQB 4Q29A 3VKLA 2WWSA 3USUA 4LLFA 2VUAA 4AQ2A 3KT7A 1F31A 2DCKA 4G4FA 1DGRN 4MV2A 1COV1 1POV3 3L9JT 1RL3A 4XF1A 3QH7A 3J9SA 2P3JA 1YJKA 2VW2A 2YZ4A 5FMOL 2RS53 2WFPA 1C28A 3BALA 3VZNA 4GALA 3LAGA 4XFHA 4TZDA 2RM22 3WDXA 2BWCA 3WV6A 4LTAA 5JOYA 4AE2A 1SBFA 2WC2A 4NPRA 2BBVA 4MSVA 1YYNA 1HXS3 2UWAA 5J7MA 3OY8A 1QQP3 1AR71 1PO23 3LWCA 4QU2A 1S0BA 3ETQA 4RGGA 3LOBA 5T5OA 4DPNA 2VMIA 4Q8KA 1JW6A 1N3OA 5L7OB 3O7OA 4P5HA 4P9LA 1V6OA 3UV9A 3OD4A 4LR4A 1IGOA 1UL9A 4CDQB 4N9HA 5EJ3A 4RR3A 3TBDA 1HRV2 1AYM3 4XFAA 1XE7A 4JGYB 5JSOA 4PQ9A 4JGZC 2ZJCA 3GHMA 1WD4A 4AVSA 4EN0A 1BJQA 1X7NA 2JE9A 1OKQA 3J8F2 4JDOA 2ZZQA 2ET1A 3SLIA 4FAGA 4UW4A 1BMV1 1KRIA 1DQ2A 3BIWE 4AI8A 1TNRA 3BOWA 4XTMA 1DZRA 5FFOC 4CDUC 4EN7B 3VBHB 1ENSA 4U36A 5BNOC 5CFDC 1PVC1 2TUNA 2ARBA 5CB7A 4BQ1A 4DQAA 3H0OA 3A4UA 1RUF2 3IN9A 3IIAA 4I02A 3BTAA 1QJY3 1XE8A 2VW0A 5KHKA 1XYOA 3KB5A 4ITCA 3B93A 1ASJ2 3VZKA 4MXWB 4CDXC 1IS5A 2R041 3AMQA 1FPN1 3AP4A 1VBC1 1BCXA 3BCWA 3FFQA 4KU7A 1F8VA 1LECA 4W6WA 1NCQA 5E1RA 4C0HA 4K3UA 1IS4A 3N7JA 1AR83 1QHDA 3WD5A 4AFDA 1LJ7A 5HBAA 1W6PB 1ULFA 4C90A 4KWLA 1BBT1 3WP4A 2XVKA 1ENXA 4KG0A 4KQ7A 5C9AC 4BH9A 3G7DA 1ZBA1 2KXLA 3TN93 4GMP3 3WR0A 3WW1A 4Y20B 4TWTA 3ZFFC 4D69A 1S0JA 3FMGA 3B01A 4M0HA 4Y22A 4GB33 3WP3A 1E57A 2WA4A 3ES4A 3OBRA 4R9BA 4TYSA 3R4SA 1QGLA 2WZR1 3USSA 1WBLA 4AFAA 2BEOA 4Y4YA 3AXEA 1A8DA